4A20A

Crystal structure of the ubl domain of mdy2 (get5) at 1.78a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
b'AAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN-LIKE PROTEIN MDY2
publication title Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 18
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a20A00
5EDSA 1WX7A 2L05A 2MBBB 1ZW7A 2CHXA 3UQAA 4JQWC 1IP9A 2D3GA 3IBEA 1Q5WB 3VXWA 3WIMA 5LXIB 5GMVA 2OJRA 2RGFA 4I6PA 1Q1OA 3KUZA 1SE9A 3QC8B 3OJ3A 3RULA 2ZJDA 2K6QA 5TR5A 2Z0DB 4IW0A 2N1VA 3TBLD 1WGGA 2M17A 4N9F4 4XZ4A 3RZFA 2C7HA 1WJNA 5DCNA 3ZVVA 3UIPB 5IA7A 1GC6A 2G45B 3QK0A 4HDOA 3TL5A 5J17A 2FCMA 4DK5A 1X1MA 2MX2A 3BINA 4KDIC 4G3XB 1EO6A 1WJ6A 2WDTB 3AULA 2KN5A 2FCNA 4LJOB 4NQLB 4M8MA 3O65B 3RCZA 3ALBA 4E71A 2HD5B 2K1FA 1WR1A 3B08A 2GBNA 2LWPA 3PPAA 2CHWA 4W9LA 1WF9A 3PVLA 3PLVA 3X0WA 2D2QA 4GDKB 2JVCA 2KHWB 4X57B 3WANA 3ZUNA 2DZJA 2EMSA 1WX8A 3OAWA 1GJZA 3SU8X 1KOTA 1KJTA 3A4SC 3DPDA 3R3MA 1P9DU 2Z0EB 4K7WA 3SDLC 1ZGUB 4WWPA 3ZNHB 2NVUI 3PSEB 2DZKA 2LGDA 2NBUA 4MSMB 3HK0A 3QARA 1V49A 4F8CB 2DAJA 1WZ3A 4W9HA 3QIJA 3RYTA 2KC2A 3H7SA 3OLMD 3JYUA 4IWPA 3ZKJC 2LGYA 4BBNC 1QZEA 2DYOA 2GMIC 3QQ8B 2MA9B 1T0YA 3ECIA 3KH0A 4G11A 3ZTDA 1TGZB 2FAZA 2CHZA 4HK2A 4JGHB 2BGFA 4PYUA 4NJ7A 2IY1B 4LDTD 4EZJA 2J7QB 2RR9A 3K9PB 3DBLI 3H6NA 4EUTA 5LXHA 2N9EB 2RPQA 4KZ0A 4NPNA 4PS8A 1VCBA 2PE6B 5D94A 3AXCA 3A9JB 3VH3B 1YQBA 2O6VD 4HLEA 4FLHA 5LLIA 1NI2A 2WX1A 3MJWA 5AZHA 1GC7A 4OVUA 5L83A 2GBRA 1YD8U 3GOEA 4WJPA 4WJOA 2W9NA 2KXJA 1V5TA 4G0NB 5C1ZA 2RSUA 3DDCB 2KO3A 3HHMA 2KDFB 1RAXA 2B3AA 2LJ5A 5C23A 5DPWA 4NQKE 2L0TA 1BT0A 3QJZA 1WXSA 2Z59B 3JW0X 4RM8A 1Q0WB 1WGHA 2KTRA 4KDLB 4EKUA 2V4LA 3Q3JA 2FUHB 4HXDA 4MM3A 4A20A 2J0MA 3M63B 2NCNA 3A33B 1I42A 3VQIA 2NR2A 4IWOA 3OJ4B 4E3CA 1GUAB 3SD5A 1UD7A 2KLCA 2LUEA 3A4RA 1G6JA 2LD9A 2D10A 1UBQA 2MBQA 3Q3FA 3M62B 2Y5BB 4HCPB 3HM6X 3U7DA 3T9LA 4HWIB 3V62A 1IYFA 2G3QB 1P1AA 2JRHA 3V6EB 2HE7A 4HPLB 4TQ0A 2DAFA 1OGWA 3QX1A 3NOBA 5D6JB 1XT9B 2ZCBA 3ZO5B 3ML9A 4I6NB 3NY5A 2KDBA 1NBFC 1E7UA 3AU5A 3DBSA 2R2OA 1P3QU 3APDA 2PE9A 3W1SA 2HTHA 4K7UA 5CTRC 4ZRIA 3H7PB 2KWUB 4GB9A 2MRPA 4WAAA 2AWTA 2BKFA 3DBHI 3N32A 2CR5A 3PRMB 5JHAA 2GBJA 3P2BA 2AL6A 1WJ4A 4W9EA 4URKA 1Z2MA 4NY0A 3KYCD 4MGIE 1V9JA 4II3B 4EZLA 1S1QB 1WGDA 2LXCA 4K7SA 1A5RA 1E90A 2BF8B 1UH6A 2MQJA 2I1JA 2L8JA 1J0GA 2IZVB 3H7PA 1V86A 3EECA 2GBKA 4AOFA 4AP4C 4FA6A 2BWES 3JSVB 3QAQA 2I1KA 3PTFC 2LZ6A 4IUMB 4FBJB 2LRUA 1XQQA 2AEHA 2LASA 4K81A 4BKSD 3ZNZB 4ASWC 2MP2A 5CHFA 2CS4A 4IG7B 2A4ZA 1WZ0A 2J0JA 4KSKC 2XBBC 3ZTCA 2XEWA 3HIZA 2MBEA 3A1QB 4HPMB 1L2NA 1UGMA 1UZXB 3I3TB 3NZUA 2N7EA 5JHBA 3U30A 1WI0A 3L0WB 5DPRA 2BWFA 2KC1A 1P98A 3JSVA 4TQ1A 2KFKA 2M0XA 1WXMA 2XK5B 5FR6A 2CU1A 2N1WA 2LVPA 3GZNI 1GNUA 4AJYB 1XD3B 3DVNU 1YX5B 5D2MB 4BOSC 3B0AA 2KJRA 5CHWA 3ZNGC 5G2NA 3ONSA 4MGYE 4TKNA 4BKTA 2BYFA 5DPTA 3A1QA 4WWNA 2GOWA 4GGQA 1WE7A 4M0WB 4TUUA 3EFUA 1KM7A 3RZWC 1RLFA 4KSLC 5AZFA 1WRDB 3WAPA 3M3JA 3DVGY 2AYOB 2XK5A 5KHQA 4GOCA 1SIFA 3W1YA 2K6DB 1ZKHA 4JLCA 4NAWA 3KW5B 1ISNA 2KX0A 3MHSD 2KTRB 1AARA 3ZDMC 1V81A 1OEYA 3EHVA 1LFDA 3N3KB 2K8HA 2DX5B 1S3SG 4WQOB 3VUWA 3PS6A 4ANWA 4CYEA 1D3ZA 4AWJA 1WXVA 2JRIB 4GIVA 2AL3A 2L3ZA 3PREA 3A9KA 1H8CA 1WXAA 1WYWB 2C7MB 1OEYJ 3VHTC 4JIOU 3VAWA 3PHXB 2JZZA 2KDEB 2KNBA 3V6CB 2K39A 2L7RA 2K25A 4WJQA 5L95C 2KOXA 4MDKE 4CO7A 2J0KA 3WALA 4CHKA 3ENEA 1EF5A 1WH3A 4DWFA 4WJNA 1WMHA 1YIWA 2IBIB 3VVWB 2N4FA 4IM3A 2KQSA 3ZLZA 4ANVA 1OQYA 2O6VA 2M1MA 3R66C 3X23A 4DXAB 1GG3A 1YX6B 3UGBB 4AJWA 1WGRA 4IC7B 2DZMA 2KZRA 1WM3A 4HJKA 4IM2A 1H4RA 2K8BA 2WX0A 3PLUA 4HDQA 4E74A 3V60A 4PYZA 3TJPA 4FHJA 2L00B 3V61A 3ZIMA 3JVZX 1V80A 1K8RB 3IG3A 4MJSB 2OOBB 3QWZB 4DHZE 3MTNB 2MCNB 3K9OB 1Z5SB 4B9KA 2GBMA 2JUOA 2N9XA 2DYMA 3DOWA 4GU2A 4W9JA 3RUIB 4HCNB 4ANXA 1FXTB 1J8CA 3AU4A 1VD2A 3NS8A 1V6EA 3DBRI 2C7NB 2KKCA 3PGEA 1E8YA 2PEAA 3CF6E 3RD2A 1SGHA 5CHVC 1U4AA 4DHJD 3VDZA 4DBGA 4IWQA 4BOZB 5E6PA 3TCAA 2KX3A 1PQSA 2JZ3B 2R2QA 2YLMA 3L13A 4YL8A 2L0FA 2BYEA 4KV2A 1RRBA 4ZRJA 3NHEB 2MP2B 4MJSA 3M95A 4II2B 2KMAA 3L17A 3BY4B 1J19A 1WE6A 2NPTA 1TZ1A 3L10B 2D11A 2KANA 4W9FA 4P7IA 2JWZA 2BPSA 2M8SA 3DCGA 4M8NA 2MBHA 5E6OA 4ZRKA 3DQVA 2KFKB 4MGZE 4EOYA 2C5LC 1V5OA 1Y8RC 2KDIA 4KIKA 3PRZA 4ICVA 4J6IA 2KJHB 2ZEQA 4IM0A 3T8MA 5J2RA 2O2VB 5D7GA 4K1RB 1EF1A 2DZIA 5DPSA 3VUYA 4F7ZA 4B95A 2ZNVB 4EFOA 3L16A 4GDLA 3VUXA 4DDID 3VTVA 3ZRCA 2KWCA 2WWZA 3L08A 4MGKE 4NJ6A 2KK8A 4NNJB 5CX3A 5AZGA 3ZDTA 2MBOA 3WAOA 4XC2A 2FNJB 2BKRB 1WX9A 2FIFA 3R7RA 2LI5A 3PRPB 3UQBA 4NAWB 2C60A 2MLBA 2NS5A 3N30A 2O2VA 3R7QA 1E8ZA 2JT4B 2ZCCA 3VTUA 3RT3B 3APCA 2LVQA 3IFWB 2KD0A 3PT2B 2NBVB 5G55A 2ZZPB 2FCQA 3B1LX 3WA0A 4B6WA 4DHZB 2HJ8A 3L54A 3C0RB 3A9KB 3IVFA 4BKSA 4ANUA 2MSED 1F9JA 3ZRFA 2FCSA 3CSFA 3D32A 1HE8A 2ZPNA 4FULA 2M4NA 2JPHA 3W1SC 1C1YB 3PV1A 3UINB 4GXBA 2IO2B 4DDGD 2KFJA 4W9GA 3UIOB 4A3PA 4BKGA 1TBEA 1WGYA 4W9DA 3UF8A 1I35A 3NZSA 3PHWB 4GMVA 4OVVA 4A3OA 1LXDA 2UWQA 5BO4B 4HVBA 4ZYNA 4LDTB 5KHOA 3ZNID 3CMMB 4GDKA 4KVGB 3QHTA 3EC8A 1M94A 2FIDA 1P0RA 1WMHB 2JY6A 2KJ6A 1WFYA 4LJPB 2JXXA 1EUVB 2G4DB 4MH0E 2O6VB 4RMAA 1CMXB 4EZKA 5JZEB 3SHQA 4FADA 1WIAA 4BVUC 4GN1A 4FJYA 1E8XA 3VTWA 1E7VA 2JF5A 4G50A 5J18A 2KMCA 3ML8A 1R4MI 2N7DA 3IHPC 3H9DA 4FJVB 3S2AA 3ZW3A 4PS7A 5AEKB 1UELA 3HM3A 3U8ZA 3APFA 3H1UA 2BYVE 3PZDA 3TMPB 4TV3A 4W9CA 4PS3A 2LRWA 2NBWB 4GSWA 2IO3B 1JRUA 2ZVNA 5HKHA 2IY0B 4ICUA 4MELA 2EMTA 2LVOA 1R4NI 2WYQA 4KZCA 3KVFB 3WAMA 4FJZA 1IPGA 2C9WB 4RM9A 1LQBA 3QCAA 2VRRB 1L7YA 2UYZB 2MWSB 4EEWA 3TIXA 2K8CA 1WM2A 3A9JA 2LGXA 2RD0A 2QHOA 1LM8B 1UBIA 2DHZA 1WJUA 2KWVB 3VH4B 1NDDA 2ZVOA 2PPHA 2REXA 2DYBA 4JL9A 1C3TA 2IO1B 1V2YA 3QA8A 2ZPYA 2KTFA 2V3SA 1E8WA 3KUDB 2ZNVC 1TTNA 4W9KA 2NPTB 4F1SA 5JH5C 1WY8A 4MEMA 2EKEC 2IYDB 2L76A 2KQ7A 4I6LB 4W9IA 4ZDVA 2CKHB 2N9PC 4XX5A 1YJ1A 5IAAC 2YVCA 1KLVA 3LJ3A 4KIKB 2PJHA 2KVRA 4FHKA 2DENB 3VFKA 4FN2A 4AUQC 3AI5A 2IO0B 3CSTA 4BBNF 1WR6E 4WWOA 2KLGA 2G4SA 1OTRB 1MG8A 4MSQB 3KUCB 3LDZE 4DHJB 3DVGX 3KYDD 4LCDE 5E6NA 2LXAA 2ASQA 1RFAA 2A5UA 2MW5A 2V1YA 4GDLB 4BFRA 1E5WA 3DVNV 2D07B
chains in the Genus database with same CATH superfamily
5EDSA 1WX7A 4WQMA 3BYTB 3UQAA 2D3GA 1Q5WB 2OJRA 2JWUA 2RGFA 1YNTE 3RNAC 2G1EA 2K6QA 1WGGA 2M17A 1DOXA 2MJDA 4RGNA 3UIPB 3HVDA 3TL5A 4P16A 1I4HA 3N20C 3MC0B 1WWTA 2WDTB 1JWAD 3AULA 1ROEA 3ALBA 3LYYA 3BIID 2HD5B 3B08A 4ZYSA 1AW7A 2CHWA 1WF9A 3PLVA 2D2QA 2KHWB 3WANA 2EMSA 4USAA 4K7WA 3SDLC 4C7YA 1ZGUB 4HPPA 3PSEB 2NBUA 3RNFC 2WXLA 1KRHA 2IGGA 1TKGA 1HQRD 3QIJA 3LB8C 3OLMD 2DYOA 1GAQB 1ZE3D 3ZTDA 2CHZA 4TSSA 4LDTD 2K22A 2GLSA 2N9EB 5D94A 2CJOA 1ZXIA 3IT4B 3P4PB 3VH3B 4HLEA 4MM3B 4YXDB 5LLIA 4C4VB 1NYRA 5BMGA 3T3NA 2QDFA 3EFCA 1YD8U 2HJ1A 3DHIC 2W9NA 5H92C 2JYEA 3NVYA 1GB1A 2B3AA 5C23A 4NQKE 3QJZA 1XXGA 1WXSA 4RM8A 4KDLB 4B0EA 4EKUA 3Q3JA 4A20A 1I42A 5AUIA 3A33B 3FILA 1D6EC 2IGHA 1V1PB 3SD5A 1R7SA 2XNAC 1MFWA 2KN4A 2WDQB 2Y5BB 4HCPB 1RWSA 3HM6X 4HWIB 3U4EG 2HE7A 4HPLB 1F2RC 1FNWA 3NOBA 5D6JB 1V1OA 3ML9A 1B1ZA 1ET6A 1E7UA 1R4NB 1C4CA 1P3QU 2VH1A 4ZHPA 3H7PB 2KWUB 4WAAA 1QOGA 1L0XB 3RMKC 4W9EA 1Z2MA 2INCC 2W54A 1RYJA 1ZXHA 3MC8A 4II3B 1WGDA 4K7SA 5IKCM 1A5RA 5HI1A 3W5UB 1E90A 1Q10A 2BF8B 3DBRB 1P7FA 1UH6A 1J0GA 2L8JA 2IZVB 4AP4C 2WXOA 2MHJA 3AECB 5EE1A 2LZ6A 1XLNA 1TS2A 1ZOYB 2LASA 2N0SB 4K81A 5HFYA 2SAKA 4IG7B 2WQYB 2H89B 3ZTCA 1UZXB 2N7EA 4OVZA 1WRIA 1P98A 3JSVA 2N1WA 3GZNI 5D2MB 1T5XD 1GPXA 5CHWA 3ZXVA 4BKTA 3Q6BA 3A1QA 4WWNA 1RLFA 1WRDB 3M3JA 3MC9A 3W1YA 4N6EB 1TT5B 3GB1A 3ZDMC 3N3KB 1LFDA 2K8HA 3ZJTA 3PS6A 4AWJA 4M0WA 2AL3A 2WXPA 1QKZA 1WYWB 1B9RA 4JIOU 2FE8A 1FEHA 1HA5A 1N60A 2K39A 2L7RA 2BTEA 1IUEA 4IKGA 4WJQA 4CO7A 4OZBA 1EF5A 1IGDA 4MACA 4IM3A 4P1CC 1HZ6A 4ANVA 2O6VA 1YX6B 2WS3B 1I4PA 2DZMA 4HJKA 4LNIA 4PT5A 2WX0A 3PLUA 3V61A 4FHJA 2L00B 3N9YC 4MJSB 1XO3A 3N1XC 1K52A 1PGAA 3AE8B 3DOWA 2GB1A 4HCNB 2AX5A 1FXTB 1J8CA 3NS8A 1RFKA 3PGEA 4MT5A 5IP4D 1E10A 4LTUA 1TY2A 2KX3A 2JZ3B 3W5VB 4R3DA 2BYEA 2L52A 1F2RI 2KANA 1D5ZC 1TJEA 4W9FA 3Q3OC 3OG5A 3DCGA 5J2RA 4IM0A 3T8MA 5DPSA 4B95A 2ZNVB 1FNVA 4EFOA 2V9HA 4A8XC 4P6VF 2IPKD 2KWCA 4NJ6A 5G5GA 2KK8A 4NNJB 4AS1A 2MBOA 2FNJB 4A90A 3KLSX 3NVWA 3R7QA 2O2VA 2ZCCA 1VZ7A 2LVQA 3EGRA 3PT2B 2ZZPB 3O13A 3C0RB 3A9KB 3IVFA 4BKSA 4ANUA 3GS2A 2FCSA 3MJ5A 1ET9A 2AQ1B 3FC4A 1SF0A 3UINB 4GXBA 3IAM1 2IO2B 5C3JB 1WGYA 4W9DA 2WXRA 3UF8A 4GMVA 3NZSA 2JX5A 1E7PB 4H2AA 1YQ3B 4A3OA 2LEKA 4ZYNA 5KHOA 3ZNID 3CMMB 1FNUA 1M94A 1P0RA 1TYGB 1VDVA 3N1ZC 3AB5A 4YSYB 2G4DB 3GE8C 2WXMA 3SHQA 1QILA 3BK2A 1WIAA 3Q8CA 3VTWA 1E8XA 1UNSA 5J18A 3BK1A 3H9DA 4FJVB 4YT0B 1VRAB 3APFA 2BBCA 3PZDA 2IO3B 4HRSA 1JRUA 5HKHA 2IY0B 4ICUA 3C19A 2LVOA 2ACZB 2WYQA 3WAMA 4FJZA 3B2FA 4ZRQA 3E56A 2KACA 3QCAA 2VRRB 1L7YA 3DBLB 2ICIA 2MWSB 4EEWA 4C00A 4LNOA 3TIXA 2LGXA 2RD0A 1HXYD 1QOAA 3BZDB 4C4VA 2PPHA 1C3TA 2V3SA 1TTNA 4W9KA 2NPTB 4MEMA 2IYDB 2KQ7A 4GLSC 4XX5A 2YVCA 2PJHA 4FHKA 4FN2A 4RNAA 3AI5A 5BMHA 4N58A 2KLGA 1T6BX 4ZOHC 1WGKA 4BFRA 1E5WA 2OHFA 3AH7A 2L05A 3PZ8A 2QIEB 4JQWC 3IBEA 3VXWA 3WIMA 1C77A 5GMVA 4I6PA 1Q1OA 2ZJDA 5EE0A 1Y56A 4N9F4 4XZ4A 2C7HA 1WJNA 3QK0A 4HDOA 3Q8EA 3BINA 3AE1B 4KDIC 1WJ6A 3BWUD 4NQLB 3O65B 2GBNA 3PPAA 3PVLA 3X0WA 3KQ4A 2DZJA 1WX8A 1XLPA 1KJTA 3R3MA 2LMCA 2E3TA 2DZKA 1NI3A 4MH8A 1V49A 4XDCA 3H7SA 1L4DB 3ZKJC 2LGYA 4BBNC 1QZEA 2MA9B 1T0YA 4G11A 1FFUA 4HK2A 1TY0A 4PYUA 4D2KA 4ITKA 1GOZA 3K9PB 5BYSA 1VCBA 2PE6B 1YQBA 2O6VD 2V0GA 4FLHA 1GC7A 4OVUA 4WJPA 3HRDD 5C1ZA 3DDCB 3HHMA 1RAXA 3WCQA 2L0TA 2Z59B 4QAYA 1TZOA 1SXTA 1AYFA 2FUHB 2Y5PA 2ZW1A 2J0MA 2NCNA 2J52A 1CK1A 2NR2A 1GUAB 1UD7A 2KLCA 4RGTA 3RI7C 1G6JA 2LD9A 3RFZB 1VJKA 1P1AA 2EKIA 2KDMA 2JRHA 1PDXA 2DAFA 1XT9B 1VZ8A 5FK9C 1ZDXA 1PFDA 1UUPA 4L2YA 1NBFC 4YTMB 2PE9A 3W1SA 1DOIA 2HTHA 4ZRIA 1F77A 2AWTA 3N32A 2CR5A 5JHAA 4URKA 1TIFA 2MH7A 4MGIE 4RCOA 3ETRA 2QMTA 1V9JA 4EZLA 1S1QB 4LLGM 3L4PA 3EECA 4FA6A 4DXGA 2I1KA 3PTFC 3AEAB 1YQ4B 4IUMB 4FBJB 1XQQA 1N5WA 2AEHA 4BKSD 1SB3C 2J0JA 2LHEA 2XEWA 2MBEA 3P4QB 1UGMA 3SR6A 1GB4A 1WI0A 4XDDA 2L1AA 4DQOC 1FPYA 1MI0A 2OEDA 2M0XA 1WXMA 4JE3B 3MP9A 1GNUA 2WP9B 1YX5B 3B0AA 1XLQA 3ONSA 4MGYE 1SEBD 2BYFA 2RPVA 2GOWA 3GP7A 3RZWC 4KSLC 2NTSA 2XK5A 1ZKHA 4JLCA 3KW5B 1IBXB 2KTRB 1AARA 3NZ3A 1V81A 3EHVA 3VUWA 4WURA 2JRIB 2L3ZA 3A9KA 5C2TB 3RNBC 3UI3A 1SIJA 1JALA 2C7MB 2CU3A 1N63A 2KNBA 3IXSA 2WXNA 5L95C 5IN7A 2J0KA 3BVZA 1WH3A 3TEXA 2IBIB 1STEA 3AEBB 4LNFA 3VVWB 2KQSA 3AEFB 3R66C 1GG3A 1AWDA 3UGBB 1N5XA 1DOYA 4IC7B 1WM3A 1H4RA 1R4MB 3R2TA 3AN1A 4IDIA 4E74A 3V60A 2QC8A 2JZPA 1V97A 3NG0A 1K8RB 2OOBB 4BZAA 3MTNB 2GBMA 2JUOA 2KT7A 2DYMA 3U2SC 1MPEA 2K0PA 2FBWB 1VD2A 2BYTA 1V6EA 2QCZA 1SGHA 4DHJD 4IWQA 3TCAA 1PQSA 2L0FA 3Q14C 4ZRJA 3NHEB 2MP2B 3M95A 4II2B 3L17A 1J19A 2NPTA 1NVID 1XCQL 5LNK1 1KF6B 5E6OA 2KFKB 2C5LC 2HDEA 4ICVA 2ZEQA 4K1RB 2DZIA 3BVMA 3VUYA 5HHDG 3AEGB 1KLGD 3L16A 1EWYC 3VTVA 4DDID 3L08A 4MGKE 5CX3A 4M00A 3ZDTA 1OQRA 4XC2A 3R7RA 2LI5A 3PRPB 1ZPSA 4NAWB 1JWSD 1QOBA 1SE4A 1K50A 1TKYA 2AQ2B 3APCA 1VLBA 3WA0A 4B6WA 2WXFA 2HJ8A 3L54A 4S17A 3D32A 1HE8A 3EA6A 4FULA 2M4NA 1KH0A 1PUTA 4W9GA 3UIOB 3DWGC 4JWSC 4OW0A 5E6JA 4HVBA 4RGOS 4C7ZA 2FIDA 1WMHB 4MH0E 4RMAA 1CMXB 4YSXB 4FADA 1E7VA 2JF5A 4O1NA 4G50A 2Q5WD 1SE3A 3KWLA 3S2AA 4PS7A 1UELA 2BB6A 3P1MA 4TV3A 4W9CA 2LRWA 2AQ3B 2EMTA 1A70A 1IPGA 1TS4A 1LQBA 2JYTA 2UYZB 1WJUA 1NYQA 1KFYB 1UGJA 2VH2A 1F1HA 1WY8A 2BQQA 4RF0A 4ZDVA 2HTME 1EU4A 5IAAC 1KLVA 3LJ3A 1V8CA 4KIKB 3DHHC 1FXAA 1SJHD 2KVRA 3VFKA 2IO0B 2W3RA 1WR6E 4WWOA 3RPFC 2G4SA 4MSQB 2BW2A 4XE0A 2MW5A 3C8YA 3NUHB 3V3XA 3DVNV 2D07B 2MEKA 4XYCA 2CHXA 4XGAB 2BS2B 1IP9A 4NZLB 2FUG1 4KGTA 3KUZA 1JWMD 1SE9A 1T0SC 4YTPB 1J7AA 5TR5A 1FMAD 2Z0DB 4IW0A 2N1VA 3AE7B 3RNGC 3TBLD 1BUIC 1KLUD 3ZVVA 5DCNA 1GC6A 3IT6B 1YN3A 2FCMA 4DK5A 4REZA 2K9XA 3NJTA 3ZQ4A 4ARIA 4G3XB 1EO6A 1ENFA 2KN5A 2FCNA 4E71A 2LWPA 1JW9D 1QF6A 3NVZA 1XLOA 5IO9A 4X57B 1NEKB 1KOTA 3SU8X 4RF1A 3P63A 1P9DU 2Z0EB 4WWPA 1FXIA 2LGDA 1MHXA 1P7EA 2QJLA 2EELA 1JWBD 1WZ3A 4W9HA 2KC2A 4ACFA 2WXHA 4IWPA 4WWMA 1HTQA 3ZJVA 2GMIC 3KH0A 4P1BC 2BGFA 3E9SA 3FKYA 3GZNB 2J42A 2E6XA 5LXHA 2RPQA 4PS8A 2PVGC 3A9JB 4K3CA 3DWMA 1LGRA 4RGMA 5HG2A 1NI2A 2WX1A 3FILB 2L32A 1L0VB 2WDRB 1M4VA 3GOEA 1HTOA 4WJOA 1CZPA 2JQRB 1V5TA 2NTTA 2KDFB 2LJ5A 2LGIA 4NJCA 1BT0A 3JW0X 1WGHA 2KTRA 1K51A 4MM3A 3M63B 1XF5L 3VQIA 3P4SB 3TEZA 1ZUD2 1XEEA 2RDBC 4IWOA 3OJ4B 2LUEA 3A4RA 2LGSA 2N9KA 2MBQA 3M62B 1JQ4A 2OJWA 3T9LA 3V62A 1IYFA 2G3QB 4A9AA 3V6EB 4HKQA 4KKIA 4XWWA 1OGWA 3QX1A 1YN5A 2ZCBA 3ZO5B 4I6NB 1V1PA 3NY5A 4EE2A 3NS1A 2QSDA 3AU5A 3DBSA 2R2OA 1OQQA 3APDA 1EM7A 5CTRC 4DXFA 2BKFA 1CQVA 2KVZA 1HZ5A 3PRMB 3P2BA 3W2DA 4LK0M 2AL6A 2W82A 1AN8A 2LXCA 1E0ZA 2MQJA 2I1JA 3H7PA 1V86A 4AQ7A 2GBKA 3Q8AA 4AOFA 1FD6A 3JSVB 1WYGA 1D4BA 1N62A 1UWXA 2BS4B 2BB5A 3ABVB 4ASWC 1N61A 2MP2A 5CHFA 1E9MA 2A4ZA 4KSKC 3A1QB 4HPMB 1L2NA 5EE3A 5EE9A 3U30A 3L0WB 2BWFA 3ZJUA 2KWDA 4TQ1A 3J9CA 2KFKA 4IOIE 3AEEB 3DVNU 2PW9A 1L6VA 2DWQA 1J7CA 2KJRA 4TKNA 2H88B 5FR3A 4K3BA 1WE7A 4M0WB 3EFUA 3WAPA 3DVGY 2AYOB 1SIFA 4NAWA 1SSNA 3BYYB 4C80A 3DHGC 2VZKD 1OEYA 4US9A 2DX5B 1SJED 2PVOD 4CYEA 4GIVA 2WXJA 1H8CA 4RH6A 2K5PA 3VAWA 3T3OA 2JZZA 4L23A 2KDEB 1SE2A 2KOXA 4MDKE 1MVKA 1OFFA 4OZAA 2D5GA 4CHKA 3ENEA 5G5HA 4DWFA 1WMHA 1YIWA 2WXIA 3X23A 4AJWA 1WGRA 2KZRA 2ONQA 3KWVA 2K8BA 2Y5CA 5BYRA 4YWGG 4PYZA 3ZIMA 3JVZX 1V80A 4A6QA 3IG3A 1FFVA 4DHZE 1Z5SB 2JU6X 4B9KA 3EUB2 3AE6B 3AU4A 3DBRI 2C7NB 2M0AA 3CF6E 5CHVC 2RMMA 2WGSA 3N1YC 4DBGA 3LXFA 4BOZB 5E6PA 3L13A 2R2QA 2WHIA 1RRBA 3AE5B 4MJSA 4Q2JA 2KMAA 3BY4B 1WE6A 1PYWD 1TZ1A 3NVVA 2D11A 1FO4A 2M8SA 1HEZE 1L0YB 3Q69A 4M8NA 2MBHA 3DQVA 4EOYA 1Y8RC 2KDIA 1ACCA 4KIKA 4J6IA 4FXCA 2O2VB 4HROA 1EF1A 2PTLA 4F7ZA 4LNNA 3ZRCA 2WWZA 3P42A 4HJGE 5AZGA 2INPE 3ZYYX 2W3SA 1WX9A 4YSZB 3UQBA 2C60A 2MLBA 2NS5A 1I4RA 3N30A 1E8ZA 1TKEA 2JT4B 3VTUA 3RT3B 3Q3MC 1L4ZB 3IFWB 2GI9A 1I4GA 3V05A 2BS3B 1PGXA 2INNE 1F9JA 1DGJA 1I4QA 3PV1A 4DDGD 4BAXA 1FM0D 2KFJA 4A3PA 3AMZA 2WU2B 3SFDB 1I35A 3PHWB 2N7JA 1ZDVA 4OVVA 4HKZE 5BO4B 4LDTB 3QHTA 3EC8A 2JY6A 2KJ6A 2JXXA 1QOFA 2IDYA 2KAJA 4FJYA 2LUMA 1MJDA 2KMCA 4ARCA 2N7DA 3IHPC 2DBYA 1DYQA 2MJEA 3HM3A 3U8ZA 3H1UA 2L83A 4PS3A 2NBWB 4GSWA 4M01A 2ZVNA 2XN9C 1ESFA 1JWUD 3AE3B 4JX1C 4MELA 2I2YA 1FRDA 3ZGZA 2C9WB 4RM9A 1TS5A 2K8CA 1I7HA 1WM2A 3A9JA 4OHJA 2PKOA 2WLBA 2QHOA 1UBIA 2KWVB 4OZCA 3VH4B 2ZVOA 2REXA 2DYBA 2PMVA 3KUDB 3TUOA 2NMQA 3R2IA 3AV8A 2L76A 4I6LB 4W9IA 2CKHB 2N9PC 5TSSA 3TSSA 3B9JA 2WXQA 3U7ZA 1UF0A 2DENB 1BXTA 5D3DA 4AUQC 3CSTA 4BBNF 3VR8B 3PO0A 1OTRB 4DHJB 3LDZE 3DVGX 5E6NA 2LXAA 2ASQA 2A5UA 2V1YA 1TS3A 4GDLB 1C78A 2MBBB 1ZW7A 5LXIB 3QC8B 3OJ3A 3RULA 1CJEA 3RZFA 5GXGB 5IA7A 3Q8BA 2G45B 3BVGA 4L1BA 2WU5B 5J17A 1X1MA 2MX2A 1FIQA 1FCLA 1YN4A 1C4PA 4ZRPA 3TEWA 3I63C 5T8IA 1WXQA 4LJOB 4M8MA 3RCZA 2K1FA 1WR1A 1YJIA 2KMMA 4N59A 4W9LA 3I9V1 4GDKB 1T0QC 2JVCA 1L6UA 3ZUNA 3OAWA 1GJZA 1FRRA 3ZXRA 3A4SC 3DPDA 3ZNHB 2NVUI 3Q3NC 3PZ7A 4A55A 4MSMB 3HK0A 3QARA 4F8CB 2DAJA 3RYTA 3JYUA 2RDGA 3QQ8B 3ECIA 5IOIA 1TGZB 2FAZA 4JGHB 4NJ7A 2IY1B 4EZJA 2J7QB 2RR9A 3DBLI 3H6NA 4EUTA 4KZ0A 4NPNA 2Y3AA 3AXCA 2V4IB 3MJWA 5AZHA 5L83A 2GBRA 2QEJC 2MJ3A 3RNCC 1VR9A 2KXJA 3FAHA 4G0NB 2RSUA 2KO3A 5D3IB 2RDHA 5DPWA 1BMLC 1Q0WB 5I4DA 2D3AA 2V4LA 4HXDA 4E3CA 2IGDA 4YTNB 2D10A 1UBQA 3Q3FA 2I38A 3I5JC 2JXTA 3U7DA 4WIPA 2UU7A 2BT6A 5JXVA 2WDVB 4J3OD 3Q2AC 4TQ0A 3R8BA 2V3NA 3P4RB 2KQ4X 2KDBA 1QT9A 4K7UA 2WXGA 4GB9A 2MRPA 4TMAB 3DBHI 2GBJA 1IGCA 1WJ4A 2YEPF 4M02A 3URYA 4NY0A 3KYCD 3Q8FA 1XCTL 5BMIA 2IJ0A 2BWES 1EU3A 3QAQA 2PIAA 2LRUA 1F52A 1RM6C 3ZNZB 2CS4A 1WZ0A 3CIRB 2XBBC 2G9HD 3VRBB 3HIZA 3IAS1 2KYWA 1K53A 3I3TB 3NZUA 5JHBA 2J4XA 5DPRA 2KC1A 3AEDB 1KTKA 2XK5B 4LNKA 5FR6A 2CU1A 2LVPA 4AJYB 1C4AA 1XD3B 4BOSC 2SEBD 2D3BA 3ZNGC 5G2NA 5DPTA 5H8YE 4GGQA 4TUUA 1KM7A 4B0MA 3HUIA 5AZFA 1SBBB 5KHQA 1C9FA 1MG4A 4XWTA 4GOCA 4US8A 2K6DB 1VZ6A 3W9CB 1ISNA 2KX0A 3MHSD 3VR9B 4WAFA 1S3SG 4WQOB 2TSSA 4ANWA 1D3ZA 1WXVA 3PREA 1WXAA 2GRIA 3HVZA 1OEYJ 3VHTC 2JSVX 3PHXB 2WNMA 4KX6B 1N6ZA 3V6CB 2K25A 1IBXA 4JWUC 4UDUC 3WALA 3I57A 4RFBA 2X38A 4WJNA 3NRZA 3H8HA 4NAMA 2N4FA 3ZLZA 1OQYA 2M1MA 4DXAB 5AUKA 4IM2A 2R61A 4HDQA 4WH4A 3TJPA 2N9LA 1YOVB 3OWEB 3QWZB 2YEPB 2MCNB 3K9OB 3CWIA 3MHZA 4GU2A 2N9XA 4W9JA 3RUIB 4ANXA 1NENB 2KKCA 1E8YA 1L5PA 2M56B 2PEAA 3RD2A 1U4AA 3VDZA 4YL8A 2YLMA 3AE4B 4KV2A 3SEBA 2ON8A 1ZP0B 3L10B 3GE3C 4P7IA 1WSPA 1UWMA 2JWZA 2BPSA 3AM9A 5BYQA 5FKAC 2K3UA 4C56C 1T3QA 4ZRKA 4MGZE 1V5OA 1FCCC 1I4XA 3PRZA 2KJHB 1MHHE 5D7GA 4GDLA 3VUXA 3U52E 3SFEB 4KGRA 3DBHB 3MFGA 2LJIA 3WAOA 1JCKB 2BKRB 2FIFA 1D5XC 2KD0A 2LFIA 2NBVB 1C79A 5G55A 2FCQA 2INDC 3B1LX 3RNEC 4DHZB 1F0ZA 2MSED 2V3PA 3ZRFA 3CSFA 1E6EB 2ZPNA 3W1SC 2JPHA 1C1YB 3AE2B 4HEA1 4BKGA 1TBEA 1LO5D 1JROA 4JPSA 1LXDA 1C76A 2UWQA 3TEYA 4GDKA 4KKJA 4KVGB 2BVCA 1WFYA 1JMLA 1J7BA 3AE9B 2VZKB 4LJPB 5JZEB 1EUVB 2O6VB 4EZKA 2M19A 3VRAB 1QLBB 4PK1A 4BVUC 2D3CA 4GN1A 3ML8A 1R4MI 2LHDA 2J53A 5AEKB 3ZW3A 2BYVE 2W55A 3TMPB 4CQNA 3B2GA 1R4NI 4KZCA 3KVFB 2DNFA 2DLBA 1EWCA 1D5MC 1LM8B 1T0RC 2DHZA 2WXKA 1NDDA 4JL9A 2IO1B 1V2YA 2PLPA 3QA8A 2ZPYA 2KTFA 1E8WA 3RN9C 2ZNVC 4F1SA 5JH5C 2EKEC 2Z8LA 1JRPA 1YJ1A 5MPOA 2CJNA 1QQRA 2B76B 4S0RA 1PGBA 1YMHE 1MG8A 3KUCB 3KYDD 4LCDE 1RFAA 1YJJA 4KGSA 4ZHOA 2QILA 2X8XX 2ZW0A
chains in the Genus database with same CATH topology
5EDSA 1WX7A 2L05A 2MBBB 1ZW7A 2CHXA 3UQAA 4JQWC 1IP9A 2D3GA 3IBEA 1Q5WB 3VXWA 3WIMA 5LXIB 5GMVA 2OJRA 2RGFA 4I6PA 1Q1OA 3KUZA 1SE9A 3QC8B 3OJ3A 3RULA 2ZJDA 2K6QA 5TR5A 2Z0DB 4IW0A 2N1VA 3TBLD 1WGGA 2M17A 4N9F4 4XZ4A 3RZFA 2C7HA 1WJNA 5DCNA 3ZVVA 3UIPB 5IA7A 1GC6A 2G45B 3QK0A 4HDOA 3TL5A 5J17A 2FCMA 4DK5A 1X1MA 2MX2A 3BINA 4KDIC 4G3XB 1EO6A 1WJ6A 2WDTB 3AULA 2KN5A 2FCNA 4LJOB 4NQLB 4M8MA 3O65B 3RCZA 3ALBA 4E71A 2HD5B 2K1FA 1WR1A 3B08A 2GBNA 2LWPA 3PPAA 2CHWA 4W9LA 1WF9A 3PVLA 3PLVA 3X0WA 2D2QA 4GDKB 2JVCA 2KHWB 4X57B 3WANA 3ZUNA 2DZJA 2EMSA 1WX8A 3OAWA 1GJZA 3SU8X 1KOTA 1KJTA 3A4SC 3DPDA 3R3MA 1P9DU 2Z0EB 4K7WA 3SDLC 1ZGUB 4WWPA 3ZNHB 2NVUI 3PSEB 2DZKA 2LGDA 2NBUA 4MSMB 3HK0A 3QARA 1V49A 4F8CB 2DAJA 1WZ3A 4W9HA 3QIJA 3RYTA 2KC2A 3H7SA 3OLMD 3JYUA 4IWPA 3ZKJC 2LGYA 4BBNC 1QZEA 2DYOA 2GMIC 3QQ8B 2MA9B 1T0YA 3ECIA 3KH0A 4G11A 3ZTDA 1TGZB 2FAZA 2CHZA 4HK2A 4JGHB 2BGFA 4PYUA 4NJ7A 2IY1B 4LDTD 4EZJA 2J7QB 2RR9A 3K9PB 3DBLI 3H6NA 4EUTA 5LXHA 2N9EB 2RPQA 4KZ0A 4NPNA 4PS8A 1VCBA 2PE6B 5D94A 3AXCA 3A9JB 3VH3B 1YQBA 2O6VD 4HLEA 4FLHA 5LLIA 1NI2A 2WX1A 3MJWA 5AZHA 1GC7A 4OVUA 5L83A 2GBRA 1YD8U 3GOEA 4WJPA 4WJOA 2W9NA 2KXJA 1V5TA 4G0NB 5C1ZA 2RSUA 3DDCB 2KO3A 3HHMA 2KDFB 1RAXA 2B3AA 2LJ5A 5C23A 5DPWA 4NQKE 2L0TA 1BT0A 3QJZA 1WXSA 2Z59B 3JW0X 4RM8A 1Q0WB 1WGHA 2KTRA 4KDLB 4EKUA 2V4LA 3Q3JA 2FUHB 4HXDA 4MM3A 4A20A 2J0MA 3M63B 2NCNA 3A33B 1I42A 3VQIA 2NR2A 4IWOA 3OJ4B 4E3CA 1GUAB 3SD5A 1UD7A 2KLCA 2LUEA 3A4RA 1G6JA 2LD9A 2D10A 1UBQA 2MBQA 3Q3FA 3M62B 2Y5BB 4HCPB 3HM6X 3U7DA 3T9LA 4HWIB 3V62A 1IYFA 2G3QB 1P1AA 2JRHA 3V6EB 2HE7A 4HPLB 4TQ0A 2DAFA 1OGWA 3QX1A 3NOBA 5D6JB 1XT9B 2ZCBA 3ZO5B 3ML9A 4I6NB 3NY5A 2KDBA 1NBFC 1E7UA 3AU5A 3DBSA 2R2OA 1P3QU 3APDA 2PE9A 3W1SA 2HTHA 4K7UA 5CTRC 4ZRIA 3H7PB 2KWUB 4GB9A 2MRPA 4WAAA 2AWTA 2BKFA 3DBHI 3N32A 2CR5A 3PRMB 5JHAA 2GBJA 3P2BA 2AL6A 1WJ4A 4W9EA 4URKA 1Z2MA 4NY0A 3KYCD 4MGIE 1V9JA 4II3B 4EZLA 1S1QB 1WGDA 2LXCA 4K7SA 1A5RA 1E90A 2BF8B 1UH6A 2MQJA 2I1JA 2L8JA 1J0GA 2IZVB 3H7PA 1V86A 3EECA 2GBKA 4AOFA 4AP4C 4FA6A 2BWES 3JSVB 3QAQA 2I1KA 3PTFC 2LZ6A 4IUMB 4FBJB 2LRUA 1XQQA 2AEHA 2LASA 4K81A 4BKSD 3ZNZB 4ASWC 2MP2A 5CHFA 2CS4A 4IG7B 2A4ZA 1WZ0A 2J0JA 4KSKC 2XBBC 3ZTCA 2XEWA 3HIZA 2MBEA 3A1QB 4HPMB 1L2NA 1UGMA 1UZXB 3I3TB 3NZUA 2N7EA 5JHBA 3U30A 1WI0A 3L0WB 5DPRA 2BWFA 2KC1A 1P98A 3JSVA 4TQ1A 2KFKA 2M0XA 1WXMA 2XK5B 5FR6A 2CU1A 2N1WA 2LVPA 3GZNI 1GNUA 4AJYB 1XD3B 3DVNU 1YX5B 5D2MB 4BOSC 3B0AA 2KJRA 5CHWA 3ZNGC 5G2NA 3ONSA 4MGYE 4TKNA 4BKTA 2BYFA 5DPTA 3A1QA 4WWNA 2GOWA 4GGQA 1WE7A 4M0WB 4TUUA 3EFUA 1KM7A 3RZWC 1RLFA 4KSLC 5AZFA 1WRDB 3WAPA 3M3JA 3DVGY 2AYOB 2XK5A 5KHQA 4GOCA 1SIFA 3W1YA 2K6DB 1ZKHA 4JLCA 4NAWA 3KW5B 1ISNA 2KX0A 3MHSD 2KTRB 1AARA 3ZDMC 1V81A 1OEYA 3EHVA 1LFDA 3N3KB 2K8HA 2DX5B 1S3SG 4WQOB 3VUWA 3PS6A 4ANWA 4CYEA 1D3ZA 4AWJA 1WXVA 2JRIB 4GIVA 2AL3A 2L3ZA 3PREA 3A9KA 1H8CA 1WXAA 1WYWB 2C7MB 1OEYJ 3VHTC 4JIOU 3VAWA 3PHXB 2JZZA 2KDEB 2KNBA 3V6CB 2K39A 2L7RA 2K25A 4WJQA 5L95C 2KOXA 4MDKE 4CO7A 2J0KA 3WALA 4CHKA 3ENEA 1EF5A 1WH3A 4DWFA 4WJNA 1WMHA 1YIWA 2IBIB 3VVWB 2N4FA 4IM3A 2KQSA 3ZLZA 4ANVA 1OQYA 2O6VA 2M1MA 3R66C 3X23A 4DXAB 1GG3A 1YX6B 3UGBB 4AJWA 1WGRA 4IC7B 2DZMA 2KZRA 1WM3A 4HJKA 4IM2A 1H4RA 2K8BA 2WX0A 3PLUA 4HDQA 4E74A 3V60A 4PYZA 3TJPA 4FHJA 2L00B 3V61A 3ZIMA 3JVZX 1V80A 1K8RB 3IG3A 4MJSB 2OOBB 3QWZB 4DHZE 3MTNB 2MCNB 3K9OB 1Z5SB 4B9KA 2GBMA 2JUOA 2N9XA 2DYMA 3DOWA 4GU2A 4W9JA 3RUIB 4HCNB 4ANXA 1FXTB 1J8CA 3AU4A 1VD2A 3NS8A 1V6EA 3DBRI 2C7NB 2KKCA 3PGEA 1E8YA 2PEAA 3CF6E 3RD2A 1SGHA 5CHVC 1U4AA 4DHJD 3VDZA 4DBGA 4IWQA 4BOZB 5E6PA 3TCAA 2KX3A 1PQSA 2JZ3B 2R2QA 2YLMA 3L13A 4YL8A 2L0FA 2BYEA 4KV2A 1RRBA 4ZRJA 3NHEB 2MP2B 4MJSA 3M95A 4II2B 2KMAA 3L17A 3BY4B 1J19A 1WE6A 2NPTA 1TZ1A 3L10B 2D11A 2KANA 4W9FA 4P7IA 2JWZA 2BPSA 2M8SA 3DCGA 4M8NA 2MBHA 5E6OA 4ZRKA 3DQVA 2KFKB 4MGZE 4EOYA 2C5LC 1V5OA 1Y8RC 2KDIA 4KIKA 3PRZA 4ICVA 4J6IA 2KJHB 2ZEQA 4IM0A 3T8MA 5J2RA 2O2VB 5D7GA 4K1RB 1EF1A 2DZIA 5DPSA 3VUYA 4F7ZA 4B95A 2ZNVB 4EFOA 3L16A 4GDLA 3VUXA 4DDID 3VTVA 3ZRCA 2KWCA 2WWZA 3L08A 4MGKE 4NJ6A 2KK8A 4NNJB 5CX3A 5AZGA 3ZDTA 2MBOA 3WAOA 4XC2A 2FNJB 2BKRB 1WX9A 2FIFA 3R7RA 2LI5A 3PRPB 3UQBA 4NAWB 2C60A 2MLBA 2NS5A 3N30A 2O2VA 3R7QA 1E8ZA 2JT4B 2ZCCA 3VTUA 3RT3B 3APCA 2LVQA 3IFWB 2KD0A 3PT2B 2NBVB 5G55A 2ZZPB 2FCQA 3B1LX 3WA0A 4B6WA 4DHZB 2HJ8A 3L54A 3C0RB 3A9KB 3IVFA 4BKSA 4ANUA 2MSED 1F9JA 3ZRFA 2FCSA 3CSFA 3D32A 1HE8A 2ZPNA 4FULA 2M4NA 2JPHA 3W1SC 1C1YB 3PV1A 3UINB 4GXBA 2IO2B 4DDGD 2KFJA 4W9GA 3UIOB 4A3PA 4BKGA 1TBEA 1WGYA 4W9DA 3UF8A 1I35A 3NZSA 3PHWB 4GMVA 4OVVA 4A3OA 1LXDA 2UWQA 5BO4B 4HVBA 4ZYNA 4LDTB 5KHOA 3ZNID 3CMMB 4GDKA 4KVGB 3QHTA 3EC8A 1M94A 2FIDA 1P0RA 1WMHB 2JY6A 2KJ6A 1WFYA 4LJPB 2JXXA 1EUVB 2G4DB 4MH0E 2O6VB 4RMAA 1CMXB 4EZKA 5JZEB 3SHQA 4FADA 1WIAA 4BVUC 4GN1A 4FJYA 1E8XA 3VTWA 1E7VA 2JF5A 4G50A 5J18A 2KMCA 3ML8A 1R4MI 2N7DA 3IHPC 3H9DA 4FJVB 3S2AA 3ZW3A 4PS7A 5AEKB 1UELA 3HM3A 3U8ZA 3APFA 3H1UA 2BYVE 3PZDA 3TMPB 4TV3A 4W9CA 4PS3A 2LRWA 2NBWB 4GSWA 2IO3B 1JRUA 2ZVNA 5HKHA 2IY0B 4ICUA 4MELA 2EMTA 2LVOA 1R4NI 2WYQA 4KZCA 3KVFB 3WAMA 4FJZA 1IPGA 2C9WB 4RM9A 1LQBA 3QCAA 2VRRB 1L7YA 2UYZB 2MWSB 4EEWA 3TIXA 2K8CA 1WM2A 3A9JA 2LGXA 2RD0A 2QHOA 1LM8B 1UBIA 2DHZA 1WJUA 2KWVB 3VH4B 1NDDA 2ZVOA 2PPHA 2REXA 2DYBA 4JL9A 1C3TA 2IO1B 1V2YA 3QA8A 2ZPYA 2KTFA 2V3SA 1E8WA 3KUDB 2ZNVC 1TTNA 4W9KA 2NPTB 4F1SA 5JH5C 1WY8A 4MEMA 2EKEC 2IYDB 2L76A 2KQ7A 4I6LB 4W9IA 4ZDVA 2CKHB 2N9PC 4XX5A 1YJ1A 5IAAC 2YVCA 1KLVA 3LJ3A 4KIKB 2PJHA 2KVRA 4FHKA 2DENB 3VFKA 4FN2A 4AUQC 3AI5A 2IO0B 3CSTA 4BBNF 1WR6E 4WWOA 2KLGA 2G4SA 1OTRB 1MG8A 4MSQB 3KUCB 3LDZE 4DHJB 3DVGX 3KYDD 4LCDE 5E6NA 2LXAA 2ASQA 1RFAA 2A5UA 2MW5A 2V1YA 4GDLB 4BFRA 1E5WA 3DVNV 2D07B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EDS A;  1WX7 A;  2L05 A;  2MBB B;  1ZW7 A;  2CHX A;  3UQA A;  4JQW C;  1IP9 A;  2D3G A;  3IBE A;  1Q5W B;  3VXW A;  3WIM A;  5LXI B;  5GMV A;  2OJR A;  2RGF A;  4I6P A;  1Q1O A;  3KUZ A;  1SE9 A;  3QC8 B;  3OJ3 A;  3RUL A;  2ZJD A;  2K6Q A;  5TR5 A;  2Z0D B;  4IW0 A;  2N1V A;  3TBL D;  1WGG A;  2M17 A;  4N9F 4;  4XZ4 A;  3RZF A;  2C7H A;  1WJN A;  5DCN A;  3ZVV A;  3UIP B;  5IA7 A;  1GC6 A;  2G45 B;  3QK0 A;  4HDO A;  3TL5 A;  5J17 A;  2FCM A;  4DK5 A;  1X1M A;  2MX2 A;  3BIN A;  4KDI C;  4G3X B;  1EO6 A;  1WJ6 A;  2WDT B;  3AUL A;  2KN5 A;  2FCN A;  4LJO B;  4NQL B;  4M8M A;  3O65 B;  3RCZ A;  3ALB A;  4E71 A;  2HD5 B;  2K1F A;  1WR1 A;  3B08 A;  2GBN A;  2LWP A;  3PPA A;  2CHW A;  4W9L A;  1WF9 A;  3PVL A;  3PLV A;  3X0W A;  2D2Q A;  4GDK B;  2JVC A;  2KHW B;  4X57 B;  3WAN A;  3ZUN A;  2DZJ A;  2EMS A;  1WX8 A;  3OAW A;  1GJZ A;  3SU8 X;  1KOT A;  1KJT A;  3A4S C;  3DPD A;  3R3M A;  1P9D U;  2Z0E B;  4K7W A;  3SDL C;  1ZGU B;  4WWP A;  3ZNH B;  2NVU I;  3PSE B;  2DZK A;  2LGD A;  2NBU A;  4MSM B;  3HK0 A;  3QAR A;  1V49 A;  4F8C B;  2DAJ A;  1WZ3 A;  4W9H A;  3QIJ A;  3RYT A;  2KC2 A;  3H7S A;  3OLM D;  3JYU A;  4IWP A;  3ZKJ C;  2LGY A;  4BBN C;  1QZE A;  2DYO A;  2GMI C;  3QQ8 B;  2MA9 B;  1T0Y A;  3ECI A;  3KH0 A;  4G11 A;  3ZTD A;  1TGZ B;  2FAZ A;  2CHZ A;  4HK2 A;  4JGH B;  2BGF A;  4PYU A;  4NJ7 A;  2IY1 B;  4LDT D;  4EZJ A;  2J7Q B;  2RR9 A;  3K9P B;  3DBL I;  3H6N A;  4EUT A;  5LXH A;  2N9E B;  2RPQ A;  4KZ0 A;  4NPN A;  4PS8 A;  1VCB A;  2PE6 B;  5D94 A;  3AXC A;  3A9J B;  3VH3 B;  1YQB A;  2O6V D;  4HLE A;  4FLH A;  5LLI A;  1NI2 A;  2WX1 A;  3MJW A;  5AZH A;  1GC7 A;  4OVU A;  5L83 A;  2GBR A;  1YD8 U;  3GOE A;  4WJP A;  4WJO A;  2W9N A;  2KXJ A;  1V5T A;  4G0N B;  5C1Z A;  2RSU A;  3DDC B;  2KO3 A;  3HHM A;  2KDF B;  1RAX A;  2B3A A;  2LJ5 A;  5C23 A;  5DPW A;  4NQK E;  2L0T A;  1BT0 A;  3QJZ A;  1WXS A;  2Z59 B;  3JW0 X;  4RM8 A;  1Q0W B;  1WGH A;  2KTR A;  4KDL B;  4EKU A;  2V4L A;  3Q3J A;  2FUH B;  4HXD A;  4MM3 A;  4A20 A;  2J0M A;  3M63 B;  2NCN A;  3A33 B;  1I42 A;  3VQI A;  2NR2 A;  4IWO A;  3OJ4 B;  4E3C A;  1GUA B;  3SD5 A;  1UD7 A;  2KLC A;  2LUE A;  3A4R A;  1G6J A;  2LD9 A;  2D10 A;  1UBQ A;  2MBQ A;  3Q3F A;  3M62 B;  2Y5B B;  4HCP B;  3HM6 X;  3U7D A;  3T9L A;  4HWI B;  3V62 A;  1IYF A;  2G3Q B;  1P1A A;  2JRH A;  3V6E B;  2HE7 A;  4HPL B;  4TQ0 A;  2DAF A;  1OGW A;  3QX1 A;  3NOB A;  5D6J B;  1XT9 B;  2ZCB A;  3ZO5 B;  3ML9 A;  4I6N B;  3NY5 A;  2KDB A;  1NBF C;  1E7U A;  3AU5 A;  3DBS A;  2R2O A;  1P3Q U;  3APD A;  2PE9 A;  3W1S A;  2HTH A;  4K7U A;  5CTR C;  4ZRI A;  3H7P B;  2KWU B;  4GB9 A;  2MRP A;  4WAA A;  2AWT A;  2BKF A;  3DBH I;  3N32 A;  2CR5 A;  3PRM B;  5JHA A;  2GBJ A;  3P2B A;  2AL6 A;  1WJ4 A;  4W9E A;  4URK A;  1Z2M A;  4NY0 A;  3KYC D;  4MGI E;  1V9J A;  4II3 B;  4EZL A;  1S1Q B;  1WGD A;  2LXC A;  4K7S A;  1A5R A;  1E90 A;  2BF8 B;  1UH6 A;  2MQJ A;  2I1J A;  2L8J A;  1J0G A;  2IZV B;  3H7P A;  1V86 A;  3EEC A;  2GBK A;  4AOF A;  4AP4 C;  4FA6 A;  2BWE S;  3JSV B;  3QAQ A;  2I1K A;  3PTF C;  2LZ6 A;  4IUM B;  4FBJ B;  2LRU A;  1XQQ A;  2AEH A;  2LAS A;  4K81 A;  4BKS D;  3ZNZ B;  4ASW C;  2MP2 A;  5CHF A;  2CS4 A;  4IG7 B;  2A4Z A;  1WZ0 A;  2J0J A;  4KSK C;  2XBB C;  3ZTC A;  2XEW A;  3HIZ A;  2MBE A;  3A1Q B;  4HPM B;  1L2N A;  1UGM A;  1UZX B;  3I3T B;  3NZU A;  2N7E A;  5JHB A;  3U30 A;  1WI0 A;  3L0W B;  5DPR A;  2BWF A;  2KC1 A;  1P98 A;  3JSV A;  4TQ1 A;  2KFK A;  2M0X A;  1WXM A;  2XK5 B;  5FR6 A;  2CU1 A;  2N1W A;  2LVP A;  3GZN I;  1GNU A;  4AJY B;  1XD3 B;  3DVN U;  1YX5 B;  5D2M B;  4BOS C;  3B0A A;  2KJR A;  5CHW A;  3ZNG C;  5G2N A;  3ONS A;  4MGY E;  4TKN A;  4BKT A;  2BYF A;  5DPT A;  3A1Q A;  4WWN A;  2GOW A;  4GGQ A;  1WE7 A;  4M0W B;  4TUU A;  3EFU A;  1KM7 A;  3RZW C;  1RLF A;  4KSL C;  5AZF A;  1WRD B;  3WAP A;  3M3J A;  3DVG Y;  2AYO B;  2XK5 A;  5KHQ A;  4GOC A;  1SIF A;  3W1Y A;  2K6D B;  1ZKH A;  4JLC A;  4NAW A;  3KW5 B;  1ISN A;  2KX0 A;  3MHS D;  2KTR B;  1AAR A;  3ZDM C;  1V81 A;  1OEY A;  3EHV A;  1LFD A;  3N3K B;  2K8H A;  2DX5 B;  1S3S G;  4WQO B;  3VUW A;  3PS6 A;  4ANW A;  4CYE A;  1D3Z A;  4AWJ A;  1WXV A;  2JRI B;  4GIV A;  2AL3 A;  2L3Z A;  3PRE A;  3A9K A;  1H8C A;  1WXA A;  1WYW B;  2C7M B;  1OEY J;  3VHT C;  4JIO U;  3VAW A;  3PHX B;  2JZZ A;  2KDE B;  2KNB A;  3V6C B;  2K39 A;  2L7R A;  2K25 A;  4WJQ A;  5L95 C;  2KOX A;  4MDK E;  4CO7 A;  2J0K A;  3WAL A;  4CHK A;  3ENE A;  1EF5 A;  1WH3 A;  4DWF A;  4WJN A;  1WMH A;  1YIW A;  2IBI B;  3VVW B;  2N4F A;  4IM3 A;  2KQS A;  3ZLZ A;  4ANV A;  1OQY A;  2O6V A;  2M1M A;  3R66 C;  3X23 A;  4DXA B;  1GG3 A;  1YX6 B;  3UGB B;  4AJW A;  1WGR A;  4IC7 B;  2DZM A;  2KZR A;  1WM3 A;  4HJK A;  4IM2 A;  1H4R A;  2K8B A;  2WX0 A;  3PLU A;  4HDQ A;  4E74 A;  3V60 A;  4PYZ A;  3TJP A;  4FHJ A;  2L00 B;  3V61 A;  3ZIM A;  3JVZ X;  1V80 A;  1K8R B;  3IG3 A;  4MJS B;  2OOB B;  3QWZ B;  4DHZ E;  3MTN B;  2MCN B;  3K9O B;  1Z5S B;  4B9K A;  2GBM A;  2JUO A;  2N9X A;  2DYM A;  3DOW A;  4GU2 A;  4W9J A;  3RUI B;  4HCN B;  4ANX A;  1FXT B;  1J8C A;  3AU4 A;  1VD2 A;  3NS8 A;  1V6E A;  3DBR I;  2C7N B;  2KKC A;  3PGE A;  1E8Y A;  2PEA A;  3CF6 E;  3RD2 A;  1SGH A;  5CHV C;  1U4A A;  4DHJ D;  3VDZ A;  4DBG A;  4IWQ A;  4BOZ B;  5E6P A;  3TCA A;  2KX3 A;  1PQS A;  2JZ3 B;  2R2Q A;  2YLM A;  3L13 A;  4YL8 A;  2L0F A;  2BYE A;  4KV2 A;  1RRB A;  4ZRJ A;  3NHE B;  2MP2 B;  4MJS A;  3M95 A;  4II2 B;  2KMA A;  3L17 A;  3BY4 B;  1J19 A;  1WE6 A;  2NPT A;  1TZ1 A;  3L10 B;  2D11 A;  2KAN A;  4W9F A;  4P7I A;  2JWZ A;  2BPS A;  2M8S A;  3DCG A;  4M8N A;  2MBH A;  5E6O A;  4ZRK A;  3DQV A;  2KFK B;  4MGZ E;  4EOY A;  2C5L C;  1V5O A;  1Y8R C;  2KDI A;  4KIK A;  3PRZ A;  4ICV A;  4J6I A;  2KJH B;  2ZEQ A;  4IM0 A;  3T8M A;  5J2R A;  2O2V B;  5D7G A;  4K1R B;  1EF1 A;  2DZI A;  5DPS A;  3VUY A;  4F7Z A;  4B95 A;  2ZNV B;  4EFO A;  3L16 A;  4GDL A;  3VUX A;  4DDI D;  3VTV A;  3ZRC A;  2KWC A;  2WWZ A;  3L08 A;  4MGK E;  4NJ6 A;  2KK8 A;  4NNJ B;  5CX3 A;  5AZG A;  3ZDT A;  2MBO A;  3WAO A;  4XC2 A;  2FNJ B;  2BKR B;  1WX9 A;  2FIF A;  3R7R A;  2LI5 A;  3PRP B;  3UQB A;  4NAW B;  2C60 A;  2MLB A;  2NS5 A;  3N30 A;  2O2V A;  3R7Q A;  1E8Z A;  2JT4 B;  2ZCC A;  3VTU A;  3RT3 B;  3APC A;  2LVQ A;  3IFW B;  2KD0 A;  3PT2 B;  2NBV B;  5G55 A;  2ZZP B;  2FCQ A;  3B1L X;  3WA0 A;  4B6W A;  4DHZ B;  2HJ8 A;  3L54 A;  3C0R B;  3A9K B;  3IVF A;  4BKS A;  4ANU A;  2MSE D;  1F9J A;  3ZRF A;  2FCS A;  3CSF A;  3D32 A;  1HE8 A;  2ZPN A;  4FUL A;  2M4N A;  2JPH A;  3W1S C;  1C1Y B;  3PV1 A;  3UIN B;  4GXB A;  2IO2 B;  4DDG D;  2KFJ A;  4W9G A;  3UIO B;  4A3P A;  4BKG A;  1TBE A;  1WGY A;  4W9D A;  3UF8 A;  1I35 A;  3NZS A;  3PHW B;  4GMV A;  4OVV A;  4A3O A;  1LXD A;  2UWQ A;  5BO4 B;  4HVB A;  4ZYN A;  4LDT B;  5KHO A;  3ZNI D;  3CMM B;  4GDK A;  4KVG B;  3QHT A;  3EC8 A;  1M94 A;  2FID A;  1P0R A;  1WMH B;  2JY6 A;  2KJ6 A;  1WFY A;  4LJP B;  2JXX A;  1EUV B;  2G4D B;  4MH0 E;  2O6V B;  4RMA A;  1CMX B;  4EZK A;  5JZE B;  3SHQ A;  4FAD A;  1WIA A;  4BVU C;  4GN1 A;  4FJY A;  1E8X A;  3VTW A;  1E7V A;  2JF5 A;  4G50 A;  5J18 A;  2KMC A;  3ML8 A;  1R4M I;  2N7D A;  3IHP C;  3H9D A;  4FJV B;  3S2A A;  3ZW3 A;  4PS7 A;  5AEK B;  1UEL A;  3HM3 A;  3U8Z A;  3APF A;  3H1U A;  2BYV E;  3PZD A;  3TMP B;  4TV3 A;  4W9C A;  4PS3 A;  2LRW A;  2NBW B;  4GSW A;  2IO3 B;  1JRU A;  2ZVN A;  5HKH A;  2IY0 B;  4ICU A;  4MEL A;  2EMT A;  2LVO A;  1R4N I;  2WYQ A;  4KZC A;  3KVF B;  3WAM A;  4FJZ A;  1IPG A;  2C9W B;  4RM9 A;  1LQB A;  3QCA A;  2VRR B;  1L7Y A;  2UYZ B;  2MWS B;  4EEW A;  3TIX A;  2K8C A;  1WM2 A;  3A9J A;  2LGX A;  2RD0 A;  2QHO A;  1LM8 B;  1UBI A;  2DHZ A;  1WJU A;  2KWV B;  3VH4 B;  1NDD A;  2ZVO A;  2PPH A;  2REX A;  2DYB A;  4JL9 A;  1C3T A;  2IO1 B;  1V2Y A;  3QA8 A;  2ZPY A;  2KTF A;  2V3S A;  1E8W A;  3KUD B;  2ZNV C;  1TTN A;  4W9K A;  2NPT B;  4F1S A;  5JH5 C;  1WY8 A;  4MEM A;  2EKE C;  2IYD B;  2L76 A;  2KQ7 A;  4I6L B;  4W9I A;  4ZDV A;  2CKH B;  2N9P C;  4XX5 A;  1YJ1 A;  5IAA C;  2YVC A;  1KLV A;  3LJ3 A;  4KIK B;  2PJH A;  2KVR A;  4FHK A;  2DEN B;  3VFK A;  4FN2 A;  4AUQ C;  3AI5 A;  2IO0 B;  3CST A;  4BBN F;  1WR6 E;  4WWO A;  2KLG A;  2G4S A;  1OTR B;  1MG8 A;  4MSQ B;  3KUC B;  3LDZ E;  4DHJ B;  3DVG X;  3KYD D;  4LCD E;  5E6N A;  2LXA A;  2ASQ A;  1RFA A;  2A5U A;  2MW5 A;  2V1Y A;  4GDL B;  4BFR A;  1E5W A;  3DVN V;  2D07 B; 
#chains in the Genus database with same CATH topology
 5EDS A;  1WX7 A;  4WQM A;  3BYT B;  3UQA A;  2D3G A;  1Q5W B;  2OJR A;  2JWU A;  2RGF A;  1YNT E;  3RNA C;  2G1E A;  2K6Q A;  1WGG A;  2M17 A;  1DOX A;  2MJD A;  4RGN A;  3UIP B;  3HVD A;  3TL5 A;  4P16 A;  1I4H A;  3N20 C;  3MC0 B;  1WWT A;  2WDT B;  1JWA D;  3AUL A;  1ROE A;  3ALB A;  3LYY A;  3BII D;  2HD5 B;  3B08 A;  4ZYS A;  1AW7 A;  2CHW A;  1WF9 A;  3PLV A;  2D2Q A;  2KHW B;  3WAN A;  2EMS A;  4USA A;  4K7W A;  3SDL C;  4C7Y A;  1ZGU B;  4HPP A;  3PSE B;  2NBU A;  3RNF C;  2WXL A;  1KRH A;  2IGG A;  1TKG A;  1HQR D;  3QIJ A;  3LB8 C;  3OLM D;  2DYO A;  1GAQ B;  1ZE3 D;  3ZTD A;  2CHZ A;  4TSS A;  4LDT D;  2K22 A;  2GLS A;  2N9E B;  5D94 A;  2CJO A;  1ZXI A;  3IT4 B;  3P4P B;  3VH3 B;  4HLE A;  4MM3 B;  4YXD B;  5LLI A;  4C4V B;  1NYR A;  5BMG A;  3T3N A;  2QDF A;  3EFC A;  1YD8 U;  2HJ1 A;  3DHI C;  2W9N A;  5H92 C;  2JYE A;  3NVY A;  1GB1 A;  2B3A A;  5C23 A;  4NQK E;  3QJZ A;  1XXG A;  1WXS A;  4RM8 A;  4KDL B;  4B0E A;  4EKU A;  3Q3J A;  4A20 A;  1I42 A;  5AUI A;  3A33 B;  3FIL A;  1D6E C;  2IGH A;  1V1P B;  3SD5 A;  1R7S A;  2XNA C;  1MFW A;  2KN4 A;  2WDQ B;  2Y5B B;  4HCP B;  1RWS A;  3HM6 X;  4HWI B;  3U4E G;  2HE7 A;  4HPL B;  1F2R C;  1FNW A;  3NOB A;  5D6J B;  1V1O A;  3ML9 A;  1B1Z A;  1ET6 A;  1E7U A;  1R4N B;  1C4C A;  1P3Q U;  2VH1 A;  4ZHP A;  3H7P B;  2KWU B;  4WAA A;  1QOG A;  1L0X B;  3RMK C;  4W9E A;  1Z2M A;  2INC C;  2W54 A;  1RYJ A;  1ZXH A;  3MC8 A;  4II3 B;  1WGD A;  4K7S A;  5IKC M;  1A5R A;  5HI1 A;  3W5U B;  1E90 A;  1Q10 A;  2BF8 B;  3DBR B;  1P7F A;  1UH6 A;  1J0G A;  2L8J A;  2IZV B;  4AP4 C;  2WXO A;  2MHJ A;  3AEC B;  5EE1 A;  2LZ6 A;  1XLN A;  1TS2 A;  1ZOY B;  2LAS A;  2N0S B;  4K81 A;  5HFY A;  2SAK A;  4IG7 B;  2WQY B;  2H89 B;  3ZTC A;  1UZX B;  2N7E A;  4OVZ A;  1WRI A;  1P98 A;  3JSV A;  2N1W A;  3GZN I;  5D2M B;  1T5X D;  1GPX A;  5CHW A;  3ZXV A;  4BKT A;  3Q6B A;  3A1Q A;  4WWN A;  1RLF A;  1WRD B;  3M3J A;  3MC9 A;  3W1Y A;  4N6E B;  1TT5 B;  3GB1 A;  3ZDM C;  3N3K B;  1LFD A;  2K8H A;  3ZJT A;  3PS6 A;  4AWJ A;  4M0W A;  2AL3 A;  2WXP A;  1QKZ A;  1WYW B;  1B9R A;  4JIO U;  2FE8 A;  1FEH A;  1HA5 A;  1N60 A;  2K39 A;  2L7R A;  2BTE A;  1IUE A;  4IKG A;  4WJQ A;  4CO7 A;  4OZB A;  1EF5 A;  1IGD A;  4MAC A;  4IM3 A;  4P1C C;  1HZ6 A;  4ANV A;  2O6V A;  1YX6 B;  2WS3 B;  1I4P A;  2DZM A;  4HJK A;  4LNI A;  4PT5 A;  2WX0 A;  3PLU A;  3V61 A;  4FHJ A;  2L00 B;  3N9Y C;  4MJS B;  1XO3 A;  3N1X C;  1K52 A;  1PGA A;  3AE8 B;  3DOW A;  2GB1 A;  4HCN B;  2AX5 A;  1FXT B;  1J8C A;  3NS8 A;  1RFK A;  3PGE A;  4MT5 A;  5IP4 D;  1E10 A;  4LTU A;  1TY2 A;  2KX3 A;  2JZ3 B;  3W5V B;  4R3D A;  2BYE A;  2L52 A;  1F2R I;  2KAN A;  1D5Z C;  1TJE A;  4W9F A;  3Q3O C;  3OG5 A;  3DCG A;  5J2R A;  4IM0 A;  3T8M A;  5DPS A;  4B95 A;  2ZNV B;  1FNV A;  4EFO A;  2V9H A;  4A8X C;  4P6V F;  2IPK D;  2KWC A;  4NJ6 A;  5G5G A;  2KK8 A;  4NNJ B;  4AS1 A;  2MBO A;  2FNJ B;  4A90 A;  3KLS X;  3NVW A;  3R7Q A;  2O2V A;  2ZCC A;  1VZ7 A;  2LVQ A;  3EGR A;  3PT2 B;  2ZZP B;  3O13 A;  3C0R B;  3A9K B;  3IVF A;  4BKS A;  4ANU A;  3GS2 A;  2FCS A;  3MJ5 A;  1ET9 A;  2AQ1 B;  3FC4 A;  1SF0 A;  3UIN B;  4GXB A;  3IAM 1;  2IO2 B;  5C3J B;  1WGY A;  4W9D A;  2WXR A;  3UF8 A;  4GMV A;  3NZS A;  2JX5 A;  1E7P B;  4H2A A;  1YQ3 B;  4A3O A;  2LEK A;  4ZYN A;  5KHO A;  3ZNI D;  3CMM B;  1FNU A;  1M94 A;  1P0R A;  1TYG B;  1VDV A;  3N1Z C;  3AB5 A;  4YSY B;  2G4D B;  3GE8 C;  2WXM A;  3SHQ A;  1QIL A;  3BK2 A;  1WIA A;  3Q8C A;  3VTW A;  1E8X A;  1UNS A;  5J18 A;  3BK1 A;  3H9D A;  4FJV B;  4YT0 B;  1VRA B;  3APF A;  2BBC A;  3PZD A;  2IO3 B;  4HRS A;  1JRU A;  5HKH A;  2IY0 B;  4ICU A;  3C19 A;  2LVO A;  2ACZ B;  2WYQ A;  3WAM A;  4FJZ A;  3B2F A;  4ZRQ A;  3E56 A;  2KAC A;  3QCA A;  2VRR B;  1L7Y A;  3DBL B;  2ICI A;  2MWS B;  4EEW A;  4C00 A;  4LNO A;  3TIX A;  2LGX A;  2RD0 A;  1HXY D;  1QOA A;  3BZD B;  4C4V A;  2PPH A;  1C3T A;  2V3S A;  1TTN A;  4W9K A;  2NPT B;  4MEM A;  2IYD B;  2KQ7 A;  4GLS C;  4XX5 A;  2YVC A;  2PJH A;  4FHK A;  4FN2 A;  4RNA A;  3AI5 A;  5BMH A;  4N58 A;  2KLG A;  1T6B X;  4ZOH C;  1WGK A;  4BFR A;  1E5W A;  2OHF A;  3AH7 A;  2L05 A;  3PZ8 A;  2QIE B;  4JQW C;  3IBE A;  3VXW A;  3WIM A;  1C77 A;  5GMV A;  4I6P A;  1Q1O A;  2ZJD A;  5EE0 A;  1Y56 A;  4N9F 4;  4XZ4 A;  2C7H A;  1WJN A;  3QK0 A;  4HDO A;  3Q8E A;  3BIN A;  3AE1 B;  4KDI C;  1WJ6 A;  3BWU D;  4NQL B;  3O65 B;  2GBN A;  3PPA A;  3PVL A;  3X0W A;  3KQ4 A;  2DZJ A;  1WX8 A;  1XLP A;  1KJT A;  3R3M A;  2LMC A;  2E3T A;  2DZK A;  1NI3 A;  4MH8 A;  1V49 A;  4XDC A;  3H7S A;  1L4D B;  3ZKJ C;  2LGY A;  4BBN C;  1QZE A;  2MA9 B;  1T0Y A;  4G11 A;  1FFU A;  4HK2 A;  1TY0 A;  4PYU A;  4D2K A;  4ITK A;  1GOZ A;  3K9P B;  5BYS A;  1VCB A;  2PE6 B;  1YQB A;  2O6V D;  2V0G A;  4FLH A;  1GC7 A;  4OVU A;  4WJP A;  3HRD D;  5C1Z A;  3DDC B;  3HHM A;  1RAX A;  3WCQ A;  2L0T A;  2Z59 B;  4QAY A;  1TZO A;  1SXT A;  1AYF A;  2FUH B;  2Y5P A;  2ZW1 A;  2J0M A;  2NCN A;  2J52 A;  1CK1 A;  2NR2 A;  1GUA B;  1UD7 A;  2KLC A;  4RGT A;  3RI7 C;  1G6J A;  2LD9 A;  3RFZ B;  1VJK A;  1P1A A;  2EKI A;  2KDM A;  2JRH A;  1PDX A;  2DAF A;  1XT9 B;  1VZ8 A;  5FK9 C;  1ZDX A;  1PFD A;  1UUP A;  4L2Y A;  1NBF C;  4YTM B;  2PE9 A;  3W1S A;  1DOI A;  2HTH A;  4ZRI A;  1F77 A;  2AWT A;  3N32 A;  2CR5 A;  5JHA A;  4URK A;  1TIF A;  2MH7 A;  4MGI E;  4RCO A;  3ETR A;  2QMT A;  1V9J A;  4EZL A;  1S1Q B;  4LLG M;  3L4P A;  3EEC A;  4FA6 A;  4DXG A;  2I1K A;  3PTF C;  3AEA B;  1YQ4 B;  4IUM B;  4FBJ B;  1XQQ A;  1N5W A;  2AEH A;  4BKS D;  1SB3 C;  2J0J A;  2LHE A;  2XEW A;  2MBE A;  3P4Q B;  1UGM A;  3SR6 A;  1GB4 A;  1WI0 A;  4XDD A;  2L1A A;  4DQO C;  1FPY A;  1MI0 A;  2OED A;  2M0X A;  1WXM A;  4JE3 B;  3MP9 A;  1GNU A;  2WP9 B;  1YX5 B;  3B0A A;  1XLQ A;  3ONS A;  4MGY E;  1SEB D;  2BYF A;  2RPV A;  2GOW A;  3GP7 A;  3RZW C;  4KSL C;  2NTS A;  2XK5 A;  1ZKH A;  4JLC A;  3KW5 B;  1IBX B;  2KTR B;  1AAR A;  3NZ3 A;  1V81 A;  3EHV A;  3VUW A;  4WUR A;  2JRI B;  2L3Z A;  3A9K A;  5C2T B;  3RNB C;  3UI3 A;  1SIJ A;  1JAL A;  2C7M B;  2CU3 A;  1N63 A;  2KNB A;  3IXS A;  2WXN A;  5L95 C;  5IN7 A;  2J0K A;  3BVZ A;  1WH3 A;  3TEX A;  2IBI B;  1STE A;  3AEB B;  4LNF A;  3VVW B;  2KQS A;  3AEF B;  3R66 C;  1GG3 A;  1AWD A;  3UGB B;  1N5X A;  1DOY A;  4IC7 B;  1WM3 A;  1H4R A;  1R4M B;  3R2T A;  3AN1 A;  4IDI A;  4E74 A;  3V60 A;  2QC8 A;  2JZP A;  1V97 A;  3NG0 A;  1K8R B;  2OOB B;  4BZA A;  3MTN B;  2GBM A;  2JUO A;  2KT7 A;  2DYM A;  3U2S C;  1MPE A;  2K0P A;  2FBW B;  1VD2 A;  2BYT A;  1V6E A;  2QCZ A;  1SGH A;  4DHJ D;  4IWQ A;  3TCA A;  1PQS A;  2L0F A;  3Q14 C;  4ZRJ A;  3NHE B;  2MP2 B;  3M95 A;  4II2 B;  3L17 A;  1J19 A;  2NPT A;  1NVI D;  1XCQ L;  5LNK 1;  1KF6 B;  5E6O A;  2KFK B;  2C5L C;  2HDE A;  4ICV A;  2ZEQ A;  4K1R B;  2DZI A;  3BVM A;  3VUY A;  5HHD G;  3AEG B;  1KLG D;  3L16 A;  1EWY C;  3VTV A;  4DDI D;  3L08 A;  4MGK E;  5CX3 A;  4M00 A;  3ZDT A;  1OQR A;  4XC2 A;  3R7R A;  2LI5 A;  3PRP B;  1ZPS A;  4NAW B;  1JWS D;  1QOB A;  1SE4 A;  1K50 A;  1TKY A;  2AQ2 B;  3APC A;  1VLB A;  3WA0 A;  4B6W A;  2WXF A;  2HJ8 A;  3L54 A;  4S17 A;  3D32 A;  1HE8 A;  3EA6 A;  4FUL A;  2M4N A;  1KH0 A;  1PUT A;  4W9G A;  3UIO B;  3DWG C;  4JWS C;  4OW0 A;  5E6J A;  4HVB A;  4RGO S;  4C7Z A;  2FID A;  1WMH B;  4MH0 E;  4RMA A;  1CMX B;  4YSX B;  4FAD A;  1E7V A;  2JF5 A;  4O1N A;  4G50 A;  2Q5W D;  1SE3 A;  3KWL A;  3S2A A;  4PS7 A;  1UEL A;  2BB6 A;  3P1M A;  4TV3 A;  4W9C A;  2LRW A;  2AQ3 B;  2EMT A;  1A70 A;  1IPG A;  1TS4 A;  1LQB A;  2JYT A;  2UYZ B;  1WJU A;  1NYQ A;  1KFY B;  1UGJ A;  2VH2 A;  1F1H A;  1WY8 A;  2BQQ A;  4RF0 A;  4ZDV A;  2HTM E;  1EU4 A;  5IAA C;  1KLV A;  3LJ3 A;  1V8C A;  4KIK B;  3DHH C;  1FXA A;  1SJH D;  2KVR A;  3VFK A;  2IO0 B;  2W3R A;  1WR6 E;  4WWO A;  3RPF C;  2G4S A;  4MSQ B;  2BW2 A;  4XE0 A;  2MW5 A;  3C8Y A;  3NUH B;  3V3X A;  3DVN V;  2D07 B;  2MEK A;  4XYC A;  2CHX A;  4XGA B;  2BS2 B;  1IP9 A;  4NZL B;  2FUG 1;  4KGT A;  3KUZ A;  1JWM D;  1SE9 A;  1T0S C;  4YTP B;  1J7A A;  5TR5 A;  1FMA D;  2Z0D B;  4IW0 A;  2N1V A;  3AE7 B;  3RNG C;  3TBL D;  1BUI C;  1KLU D;  3ZVV A;  5DCN A;  1GC6 A;  3IT6 B;  1YN3 A;  2FCM A;  4DK5 A;  4REZ A;  2K9X A;  3NJT A;  3ZQ4 A;  4ARI A;  4G3X B;  1EO6 A;  1ENF A;  2KN5 A;  2FCN A;  4E71 A;  2LWP A;  1JW9 D;  1QF6 A;  3NVZ A;  1XLO A;  5IO9 A;  4X57 B;  1NEK B;  1KOT A;  3SU8 X;  4RF1 A;  3P63 A;  1P9D U;  2Z0E B;  4WWP A;  1FXI A;  2LGD A;  1MHX A;  1P7E A;  2QJL A;  2EEL A;  1JWB D;  1WZ3 A;  4W9H A;  2KC2 A;  4ACF A;  2WXH A;  4IWP A;  4WWM A;  1HTQ A;  3ZJV A;  2GMI C;  3KH0 A;  4P1B C;  2BGF A;  3E9S A;  3FKY A;  3GZN B;  2J42 A;  2E6X A;  5LXH A;  2RPQ A;  4PS8 A;  2PVG C;  3A9J B;  4K3C A;  3DWM A;  1LGR A;  4RGM A;  5HG2 A;  1NI2 A;  2WX1 A;  3FIL B;  2L32 A;  1L0V B;  2WDR B;  1M4V A;  3GOE A;  1HTO A;  4WJO A;  1CZP A;  2JQR B;  1V5T A;  2NTT A;  2KDF B;  2LJ5 A;  2LGI A;  4NJC A;  1BT0 A;  3JW0 X;  1WGH A;  2KTR A;  1K51 A;  4MM3 A;  3M63 B;  1XF5 L;  3VQI A;  3P4S B;  3TEZ A;  1ZUD 2;  1XEE A;  2RDB C;  4IWO A;  3OJ4 B;  2LUE A;  3A4R A;  2LGS A;  2N9K A;  2MBQ A;  3M62 B;  1JQ4 A;  2OJW A;  3T9L A;  3V62 A;  1IYF A;  2G3Q B;  4A9A A;  3V6E B;  4HKQ A;  4KKI A;  4XWW A;  1OGW A;  3QX1 A;  1YN5 A;  2ZCB A;  3ZO5 B;  4I6N B;  1V1P A;  3NY5 A;  4EE2 A;  3NS1 A;  2QSD A;  3AU5 A;  3DBS A;  2R2O A;  1OQQ A;  3APD A;  1EM7 A;  5CTR C;  4DXF A;  2BKF A;  1CQV A;  2KVZ A;  1HZ5 A;  3PRM B;  3P2B A;  3W2D A;  4LK0 M;  2AL6 A;  2W82 A;  1AN8 A;  2LXC A;  1E0Z A;  2MQJ A;  2I1J A;  3H7P A;  1V86 A;  4AQ7 A;  2GBK A;  3Q8A A;  4AOF A;  1FD6 A;  3JSV B;  1WYG A;  1D4B A;  1N62 A;  1UWX A;  2BS4 B;  2BB5 A;  3ABV B;  4ASW C;  1N61 A;  2MP2 A;  5CHF A;  1E9M A;  2A4Z A;  4KSK C;  3A1Q B;  4HPM B;  1L2N A;  5EE3 A;  5EE9 A;  3U30 A;  3L0W B;  2BWF A;  3ZJU A;  2KWD A;  4TQ1 A;  3J9C A;  2KFK A;  4IOI E;  3AEE B;  3DVN U;  2PW9 A;  1L6V A;  2DWQ A;  1J7C A;  2KJR A;  4TKN A;  2H88 B;  5FR3 A;  4K3B A;  1WE7 A;  4M0W B;  3EFU A;  3WAP A;  3DVG Y;  2AYO B;  1SIF A;  4NAW A;  1SSN A;  3BYY B;  4C80 A;  3DHG C;  2VZK D;  1OEY A;  4US9 A;  2DX5 B;  1SJE D;  2PVO D;  4CYE A;  4GIV A;  2WXJ A;  1H8C A;  4RH6 A;  2K5P A;  3VAW A;  3T3O A;  2JZZ A;  4L23 A;  2KDE B;  1SE2 A;  2KOX A;  4MDK E;  1MVK A;  1OFF A;  4OZA A;  2D5G A;  4CHK A;  3ENE A;  5G5H A;  4DWF A;  1WMH A;  1YIW A;  2WXI A;  3X23 A;  4AJW A;  1WGR A;  2KZR A;  2ONQ A;  3KWV A;  2K8B A;  2Y5C A;  5BYR A;  4YWG G;  4PYZ A;  3ZIM A;  3JVZ X;  1V80 A;  4A6Q A;  3IG3 A;  1FFV A;  4DHZ E;  1Z5S B;  2JU6 X;  4B9K A;  3EUB 2;  3AE6 B;  3AU4 A;  3DBR I;  2C7N B;  2M0A A;  3CF6 E;  5CHV C;  2RMM A;  2WGS A;  3N1Y C;  4DBG A;  3LXF A;  4BOZ B;  5E6P A;  3L13 A;  2R2Q A;  2WHI A;  1RRB A;  3AE5 B;  4MJS A;  4Q2J A;  2KMA A;  3BY4 B;  1WE6 A;  1PYW D;  1TZ1 A;  3NVV A;  2D11 A;  1FO4 A;  2M8S A;  1HEZ E;  1L0Y B;  3Q69 A;  4M8N A;  2MBH A;  3DQV A;  4EOY A;  1Y8R C;  2KDI A;  1ACC A;  4KIK A;  4J6I A;  4FXC A;  2O2V B;  4HRO A;  1EF1 A;  2PTL A;  4F7Z A;  4LNN A;  3ZRC A;  2WWZ A;  3P42 A;  4HJG E;  5AZG A;  2INP E;  3ZYY X;  2W3S A;  1WX9 A;  4YSZ B;  3UQB A;  2C60 A;  2MLB A;  2NS5 A;  1I4R A;  3N30 A;  1E8Z A;  1TKE A;  2JT4 B;  3VTU A;  3RT3 B;  3Q3M C;  1L4Z B;  3IFW B;  2GI9 A;  1I4G A;  3V05 A;  2BS3 B;  1PGX A;  2INN E;  1F9J A;  1DGJ A;  1I4Q A;  3PV1 A;  4DDG D;  4BAX A;  1FM0 D;  2KFJ A;  4A3P A;  3AMZ A;  2WU2 B;  3SFD B;  1I35 A;  3PHW B;  2N7J A;  1ZDV A;  4OVV A;  4HKZ E;  5BO4 B;  4LDT B;  3QHT A;  3EC8 A;  2JY6 A;  2KJ6 A;  2JXX A;  1QOF A;  2IDY A;  2KAJ A;  4FJY A;  2LUM A;  1MJD A;  2KMC A;  4ARC A;  2N7D A;  3IHP C;  2DBY A;  1DYQ A;  2MJE A;  3HM3 A;  3U8Z A;  3H1U A;  2L83 A;  4PS3 A;  2NBW B;  4GSW A;  4M01 A;  2ZVN A;  2XN9 C;  1ESF A;  1JWU D;  3AE3 B;  4JX1 C;  4MEL A;  2I2Y A;  1FRD A;  3ZGZ A;  2C9W B;  4RM9 A;  1TS5 A;  2K8C A;  1I7H A;  1WM2 A;  3A9J A;  4OHJ A;  2PKO A;  2WLB A;  2QHO A;  1UBI A;  2KWV B;  4OZC A;  3VH4 B;  2ZVO A;  2REX A;  2DYB A;  2PMV A;  3KUD B;  3TUO A;  2NMQ A;  3R2I A;  3AV8 A;  2L76 A;  4I6L B;  4W9I A;  2CKH B;  2N9P C;  5TSS A;  3TSS A;  3B9J A;  2WXQ A;  3U7Z A;  1UF0 A;  2DEN B;  1BXT A;  5D3D A;  4AUQ C;  3CST A;  4BBN F;  3VR8 B;  3PO0 A;  1OTR B;  4DHJ B;  3LDZ E;  3DVG X;  5E6N A;  2LXA A;  2ASQ A;  2A5U A;  2V1Y A;  1TS3 A;  4GDL B;  1C78 A;  2MBB B;  1ZW7 A;  5LXI B;  3QC8 B;  3OJ3 A;  3RUL A;  1CJE A;  3RZF A;  5GXG B;  5IA7 A;  3Q8B A;  2G45 B;  3BVG A;  4L1B A;  2WU5 B;  5J17 A;  1X1M A;  2MX2 A;  1FIQ A;  1FCL A;  1YN4 A;  1C4P A;  4ZRP A;  3TEW A;  3I63 C;  5T8I A;  1WXQ A;  4LJO B;  4M8M A;  3RCZ A;  2K1F A;  1WR1 A;  1YJI A;  2KMM A;  4N59 A;  4W9L A;  3I9V 1;  4GDK B;  1T0Q C;  2JVC A;  1L6U A;  3ZUN A;  3OAW A;  1GJZ A;  1FRR A;  3ZXR A;  3A4S C;  3DPD A;  3ZNH B;  2NVU I;  3Q3N C;  3PZ7 A;  4A55 A;  4MSM B;  3HK0 A;  3QAR A;  4F8C B;  2DAJ A;  3RYT A;  3JYU A;  2RDG A;  3QQ8 B;  3ECI A;  5IOI A;  1TGZ B;  2FAZ A;  4JGH B;  4NJ7 A;  2IY1 B;  4EZJ A;  2J7Q B;  2RR9 A;  3DBL I;  3H6N A;  4EUT A;  4KZ0 A;  4NPN A;  2Y3A A;  3AXC A;  2V4I B;  3MJW A;  5AZH A;  5L83 A;  2GBR A;  2QEJ C;  2MJ3 A;  3RNC C;  1VR9 A;  2KXJ A;  3FAH A;  4G0N B;  2RSU A;  2KO3 A;  5D3I B;  2RDH A;  5DPW A;  1BML C;  1Q0W B;  5I4D A;  2D3A A;  2V4L A;  4HXD A;  4E3C A;  2IGD A;  4YTN B;  2D10 A;  1UBQ A;  3Q3F A;  2I38 A;  3I5J C;  2JXT A;  3U7D A;  4WIP A;  2UU7 A;  2BT6 A;  5JXV A;  2WDV B;  4J3O D;  3Q2A C;  4TQ0 A;  3R8B A;  2V3N A;  3P4R B;  2KQ4 X;  2KDB A;  1QT9 A;  4K7U A;  2WXG A;  4GB9 A;  2MRP A;  4TMA B;  3DBH I;  2GBJ A;  1IGC A;  1WJ4 A;  2YEP F;  4M02 A;  3URY A;  4NY0 A;  3KYC D;  3Q8F A;  1XCT L;  5BMI A;  2IJ0 A;  2BWE S;  1EU3 A;  3QAQ A;  2PIA A;  2LRU A;  1F52 A;  1RM6 C;  3ZNZ B;  2CS4 A;  1WZ0 A;  3CIR B;  2XBB C;  2G9H D;  3VRB B;  3HIZ A;  3IAS 1;  2KYW A;  1K53 A;  3I3T B;  3NZU A;  5JHB A;  2J4X A;  5DPR A;  2KC1 A;  3AED B;  1KTK A;  2XK5 B;  4LNK A;  5FR6 A;  2CU1 A;  2LVP A;  4AJY B;  1C4A A;  1XD3 B;  4BOS C;  2SEB D;  2D3B A;  3ZNG C;  5G2N A;  5DPT A;  5H8Y E;  4GGQ A;  4TUU A;  1KM7 A;  4B0M A;  3HUI A;  5AZF A;  1SBB B;  5KHQ A;  1C9F A;  1MG4 A;  4XWT A;  4GOC A;  4US8 A;  2K6D B;  1VZ6 A;  3W9C B;  1ISN A;  2KX0 A;  3MHS D;  3VR9 B;  4WAF A;  1S3S G;  4WQO B;  2TSS A;  4ANW A;  1D3Z A;  1WXV A;  3PRE A;  1WXA A;  2GRI A;  3HVZ A;  1OEY J;  3VHT C;  2JSV X;  3PHX B;  2WNM A;  4KX6 B;  1N6Z A;  3V6C B;  2K25 A;  1IBX A;  4JWU C;  4UDU C;  3WAL A;  3I57 A;  4RFB A;  2X38 A;  4WJN A;  3NRZ A;  3H8H A;  4NAM A;  2N4F A;  3ZLZ A;  1OQY A;  2M1M A;  4DXA B;  5AUK A;  4IM2 A;  2R61 A;  4HDQ A;  4WH4 A;  3TJP A;  2N9L A;  1YOV B;  3OWE B;  3QWZ B;  2YEP B;  2MCN B;  3K9O B;  3CWI A;  3MHZ A;  4GU2 A;  2N9X A;  4W9J A;  3RUI B;  4ANX A;  1NEN B;  2KKC A;  1E8Y A;  1L5P A;  2M56 B;  2PEA A;  3RD2 A;  1U4A A;  3VDZ A;  4YL8 A;  2YLM A;  3AE4 B;  4KV2 A;  3SEB A;  2ON8 A;  1ZP0 B;  3L10 B;  3GE3 C;  4P7I A;  1WSP A;  1UWM A;  2JWZ A;  2BPS A;  3AM9 A;  5BYQ A;  5FKA C;  2K3U A;  4C56 C;  1T3Q A;  4ZRK A;  4MGZ E;  1V5O A;  1FCC C;  1I4X A;  3PRZ A;  2KJH B;  1MHH E;  5D7G A;  4GDL A;  3VUX A;  3U52 E;  3SFE B;  4KGR A;  3DBH B;  3MFG A;  2LJI A;  3WAO A;  1JCK B;  2BKR B;  2FIF A;  1D5X C;  2KD0 A;  2LFI A;  2NBV B;  1C79 A;  5G55 A;  2FCQ A;  2IND C;  3B1L X;  3RNE C;  4DHZ B;  1F0Z A;  2MSE D;  2V3P A;  3ZRF A;  3CSF A;  1E6E B;  2ZPN A;  3W1S C;  2JPH A;  1C1Y B;  3AE2 B;  4HEA 1;  4BKG A;  1TBE A;  1LO5 D;  1JRO A;  4JPS A;  1LXD A;  1C76 A;  2UWQ A;  3TEY A;  4GDK A;  4KKJ A;  4KVG B;  2BVC A;  1WFY A;  1JML A;  1J7B A;  3AE9 B;  2VZK B;  4LJP B;  5JZE B;  1EUV B;  2O6V B;  4EZK A;  2M19 A;  3VRA B;  1QLB B;  4PK1 A;  4BVU C;  2D3C A;  4GN1 A;  3ML8 A;  1R4M I;  2LHD A;  2J53 A;  5AEK B;  3ZW3 A;  2BYV E;  2W55 A;  3TMP B;  4CQN A;  3B2G A;  1R4N I;  4KZC A;  3KVF B;  2DNF A;  2DLB A;  1EWC A;  1D5M C;  1LM8 B;  1T0R C;  2DHZ A;  2WXK A;  1NDD A;  4JL9 A;  2IO1 B;  1V2Y A;  2PLP A;  3QA8 A;  2ZPY A;  2KTF A;  1E8W A;  3RN9 C;  2ZNV C;  4F1S A;  5JH5 C;  2EKE C;  2Z8L A;  1JRP A;  1YJ1 A;  5MPO A;  2CJN A;  1QQR A;  2B76 B;  4S0R A;  1PGB A;  1YMH E;  1MG8 A;  3KUC B;  3KYD D;  4LCD E;  1RFA A;  1YJJ A;  4KGS A;  4ZHO A;  2QIL A;  2X8X X;  2ZW0 A; 
#chains in the Genus database with same CATH homology
 5EDS A;  1WX7 A;  2L05 A;  2MBB B;  1ZW7 A;  2CHX A;  3UQA A;  4JQW C;  1IP9 A;  2D3G A;  3IBE A;  1Q5W B;  3VXW A;  3WIM A;  5LXI B;  5GMV A;  2OJR A;  2RGF A;  4I6P A;  1Q1O A;  3KUZ A;  1SE9 A;  3QC8 B;  3OJ3 A;  3RUL A;  2ZJD A;  2K6Q A;  5TR5 A;  2Z0D B;  4IW0 A;  2N1V A;  3TBL D;  1WGG A;  2M17 A;  4N9F 4;  4XZ4 A;  3RZF A;  2C7H A;  1WJN A;  5DCN A;  3ZVV A;  3UIP B;  5IA7 A;  1GC6 A;  2G45 B;  3QK0 A;  4HDO A;  3TL5 A;  5J17 A;  2FCM A;  4DK5 A;  1X1M A;  2MX2 A;  3BIN A;  4KDI C;  4G3X B;  1EO6 A;  1WJ6 A;  2WDT B;  3AUL A;  2KN5 A;  2FCN A;  4LJO B;  4NQL B;  4M8M A;  3O65 B;  3RCZ A;  3ALB A;  4E71 A;  2HD5 B;  2K1F A;  1WR1 A;  3B08 A;  2GBN A;  2LWP A;  3PPA A;  2CHW A;  4W9L A;  1WF9 A;  3PVL A;  3PLV A;  3X0W A;  2D2Q A;  4GDK B;  2JVC A;  2KHW B;  4X57 B;  3WAN A;  3ZUN A;  2DZJ A;  2EMS A;  1WX8 A;  3OAW A;  1GJZ A;  3SU8 X;  1KOT A;  1KJT A;  3A4S C;  3DPD A;  3R3M A;  1P9D U;  2Z0E B;  4K7W A;  3SDL C;  1ZGU B;  4WWP A;  3ZNH B;  2NVU I;  3PSE B;  2DZK A;  2LGD A;  2NBU A;  4MSM B;  3HK0 A;  3QAR A;  1V49 A;  4F8C B;  2DAJ A;  1WZ3 A;  4W9H A;  3QIJ A;  3RYT A;  2KC2 A;  3H7S A;  3OLM D;  3JYU A;  4IWP A;  3ZKJ C;  2LGY A;  4BBN C;  1QZE A;  2DYO A;  2GMI C;  3QQ8 B;  2MA9 B;  1T0Y A;  3ECI A;  3KH0 A;  4G11 A;  3ZTD A;  1TGZ B;  2FAZ A;  2CHZ A;  4HK2 A;  4JGH B;  2BGF A;  4PYU A;  4NJ7 A;  2IY1 B;  4LDT D;  4EZJ A;  2J7Q B;  2RR9 A;  3K9P B;  3DBL I;  3H6N A;  4EUT A;  5LXH A;  2N9E B;  2RPQ A;  4KZ0 A;  4NPN A;  4PS8 A;  1VCB A;  2PE6 B;  5D94 A;  3AXC A;  3A9J B;  3VH3 B;  1YQB A;  2O6V D;  4HLE A;  4FLH A;  5LLI A;  1NI2 A;  2WX1 A;  3MJW A;  5AZH A;  1GC7 A;  4OVU A;  5L83 A;  2GBR A;  1YD8 U;  3GOE A;  4WJP A;  4WJO A;  2W9N A;  2KXJ A;  1V5T A;  4G0N B;  5C1Z A;  2RSU A;  3DDC B;  2KO3 A;  3HHM A;  2KDF B;  1RAX A;  2B3A A;  2LJ5 A;  5C23 A;  5DPW A;  4NQK E;  2L0T A;  1BT0 A;  3QJZ A;  1WXS A;  2Z59 B;  3JW0 X;  4RM8 A;  1Q0W B;  1WGH A;  2KTR A;  4KDL B;  4EKU A;  2V4L A;  3Q3J A;  2FUH B;  4HXD A;  4MM3 A;  4A20 A;  2J0M A;  3M63 B;  2NCN A;  3A33 B;  1I42 A;  3VQI A;  2NR2 A;  4IWO A;  3OJ4 B;  4E3C A;  1GUA B;  3SD5 A;  1UD7 A;  2KLC A;  2LUE A;  3A4R A;  1G6J A;  2LD9 A;  2D10 A;  1UBQ A;  2MBQ A;  3Q3F A;  3M62 B;  2Y5B B;  4HCP B;  3HM6 X;  3U7D A;  3T9L A;  4HWI B;  3V62 A;  1IYF A;  2G3Q B;  1P1A A;  2JRH A;  3V6E B;  2HE7 A;  4HPL B;  4TQ0 A;  2DAF A;  1OGW A;  3QX1 A;  3NOB A;  5D6J B;  1XT9 B;  2ZCB A;  3ZO5 B;  3ML9 A;  4I6N B;  3NY5 A;  2KDB A;  1NBF C;  1E7U A;  3AU5 A;  3DBS A;  2R2O A;  1P3Q U;  3APD A;  2PE9 A;  3W1S A;  2HTH A;  4K7U A;  5CTR C;  4ZRI A;  3H7P B;  2KWU B;  4GB9 A;  2MRP A;  4WAA A;  2AWT A;  2BKF A;  3DBH I;  3N32 A;  2CR5 A;  3PRM B;  5JHA A;  2GBJ A;  3P2B A;  2AL6 A;  1WJ4 A;  4W9E A;  4URK A;  1Z2M A;  4NY0 A;  3KYC D;  4MGI E;  1V9J A;  4II3 B;  4EZL A;  1S1Q B;  1WGD A;  2LXC A;  4K7S A;  1A5R A;  1E90 A;  2BF8 B;  1UH6 A;  2MQJ A;  2I1J A;  2L8J A;  1J0G A;  2IZV B;  3H7P A;  1V86 A;  3EEC A;  2GBK A;  4AOF A;  4AP4 C;  4FA6 A;  2BWE S;  3JSV B;  3QAQ A;  2I1K A;  3PTF C;  2LZ6 A;  4IUM B;  4FBJ B;  2LRU A;  1XQQ A;  2AEH A;  2LAS A;  4K81 A;  4BKS D;  3ZNZ B;  4ASW C;  2MP2 A;  5CHF A;  2CS4 A;  4IG7 B;  2A4Z A;  1WZ0 A;  2J0J A;  4KSK C;  2XBB C;  3ZTC A;  2XEW A;  3HIZ A;  2MBE A;  3A1Q B;  4HPM B;  1L2N A;  1UGM A;  1UZX B;  3I3T B;  3NZU A;  2N7E A;  5JHB A;  3U30 A;  1WI0 A;  3L0W B;  5DPR A;  2BWF A;  2KC1 A;  1P98 A;  3JSV A;  4TQ1 A;  2KFK A;  2M0X A;  1WXM A;  2XK5 B;  5FR6 A;  2CU1 A;  2N1W A;  2LVP A;  3GZN I;  1GNU A;  4AJY B;  1XD3 B;  3DVN U;  1YX5 B;  5D2M B;  4BOS C;  3B0A A;  2KJR A;  5CHW A;  3ZNG C;  5G2N A;  3ONS A;  4MGY E;  4TKN A;  4BKT A;  2BYF A;  5DPT A;  3A1Q A;  4WWN A;  2GOW A;  4GGQ A;  1WE7 A;  4M0W B;  4TUU A;  3EFU A;  1KM7 A;  3RZW C;  1RLF A;  4KSL C;  5AZF A;  1WRD B;  3WAP A;  3M3J A;  3DVG Y;  2AYO B;  2XK5 A;  5KHQ A;  4GOC A;  1SIF A;  3W1Y A;  2K6D B;  1ZKH A;  4JLC A;  4NAW A;  3KW5 B;  1ISN A;  2KX0 A;  3MHS D;  2KTR B;  1AAR A;  3ZDM C;  1V81 A;  1OEY A;  3EHV A;  1LFD A;  3N3K B;  2K8H A;  2DX5 B;  1S3S G;  4WQO B;  3VUW A;  3PS6 A;  4ANW A;  4CYE A;  1D3Z A;  4AWJ A;  1WXV A;  2JRI B;  4GIV A;  2AL3 A;  2L3Z A;  3PRE A;  3A9K A;  1H8C A;  1WXA A;  1WYW B;  2C7M B;  1OEY J;  3VHT C;  4JIO U;  3VAW A;  3PHX B;  2JZZ A;  2KDE B;  2KNB A;  3V6C B;  2K39 A;  2L7R A;  2K25 A;  4WJQ A;  5L95 C;  2KOX A;  4MDK E;  4CO7 A;  2J0K A;  3WAL A;  4CHK A;  3ENE A;  1EF5 A;  1WH3 A;  4DWF A;  4WJN A;  1WMH A;  1YIW A;  2IBI B;  3VVW B;  2N4F A;  4IM3 A;  2KQS A;  3ZLZ A;  4ANV A;  1OQY A;  2O6V A;  2M1M A;  3R66 C;  3X23 A;  4DXA B;  1GG3 A;  1YX6 B;  3UGB B;  4AJW A;  1WGR A;  4IC7 B;  2DZM A;  2KZR A;  1WM3 A;  4HJK A;  4IM2 A;  1H4R A;  2K8B A;  2WX0 A;  3PLU A;  4HDQ A;  4E74 A;  3V60 A;  4PYZ A;  3TJP A;  4FHJ A;  2L00 B;  3V61 A;  3ZIM A;  3JVZ X;  1V80 A;  1K8R B;  3IG3 A;  4MJS B;  2OOB B;  3QWZ B;  4DHZ E;  3MTN B;  2MCN B;  3K9O B;  1Z5S B;  4B9K A;  2GBM A;  2JUO A;  2N9X A;  2DYM A;  3DOW A;  4GU2 A;  4W9J A;  3RUI B;  4HCN B;  4ANX A;  1FXT B;  1J8C A;  3AU4 A;  1VD2 A;  3NS8 A;  1V6E A;  3DBR I;  2C7N B;  2KKC A;  3PGE A;  1E8Y A;  2PEA A;  3CF6 E;  3RD2 A;  1SGH A;  5CHV C;  1U4A A;  4DHJ D;  3VDZ A;  4DBG A;  4IWQ A;  4BOZ B;  5E6P A;  3TCA A;  2KX3 A;  1PQS A;  2JZ3 B;  2R2Q A;  2YLM A;  3L13 A;  4YL8 A;  2L0F A;  2BYE A;  4KV2 A;  1RRB A;  4ZRJ A;  3NHE B;  2MP2 B;  4MJS A;  3M95 A;  4II2 B;  2KMA A;  3L17 A;  3BY4 B;  1J19 A;  1WE6 A;  2NPT A;  1TZ1 A;  3L10 B;  2D11 A;  2KAN A;  4W9F A;  4P7I A;  2JWZ A;  2BPS A;  2M8S A;  3DCG A;  4M8N A;  2MBH A;  5E6O A;  4ZRK A;  3DQV A;  2KFK B;  4MGZ E;  4EOY A;  2C5L C;  1V5O A;  1Y8R C;  2KDI A;  4KIK A;  3PRZ A;  4ICV A;  4J6I A;  2KJH B;  2ZEQ A;  4IM0 A;  3T8M A;  5J2R A;  2O2V B;  5D7G A;  4K1R B;  1EF1 A;  2DZI A;  5DPS A;  3VUY A;  4F7Z A;  4B95 A;  2ZNV B;  4EFO A;  3L16 A;  4GDL A;  3VUX A;  4DDI D;  3VTV A;  3ZRC A;  2KWC A;  2WWZ A;  3L08 A;  4MGK E;  4NJ6 A;  2KK8 A;  4NNJ B;  5CX3 A;  5AZG A;  3ZDT A;  2MBO A;  3WAO A;  4XC2 A;  2FNJ B;  2BKR B;  1WX9 A;  2FIF A;  3R7R A;  2LI5 A;  3PRP B;  3UQB A;  4NAW B;  2C60 A;  2MLB A;  2NS5 A;  3N30 A;  2O2V A;  3R7Q A;  1E8Z A;  2JT4 B;  2ZCC A;  3VTU A;  3RT3 B;  3APC A;  2LVQ A;  3IFW B;  2KD0 A;  3PT2 B;  2NBV B;  5G55 A;  2ZZP B;  2FCQ A;  3B1L X;  3WA0 A;  4B6W A;  4DHZ B;  2HJ8 A;  3L54 A;  3C0R B;  3A9K B;  3IVF A;  4BKS A;  4ANU A;  2MSE D;  1F9J A;  3ZRF A;  2FCS A;  3CSF A;  3D32 A;  1HE8 A;  2ZPN A;  4FUL A;  2M4N A;  2JPH A;  3W1S C;  1C1Y B;  3PV1 A;  3UIN B;  4GXB A;  2IO2 B;  4DDG D;  2KFJ A;  4W9G A;  3UIO B;  4A3P A;  4BKG A;  1TBE A;  1WGY A;  4W9D A;  3UF8 A;  1I35 A;  3NZS A;  3PHW B;  4GMV A;  4OVV A;  4A3O A;  1LXD A;  2UWQ A;  5BO4 B;  4HVB A;  4ZYN A;  4LDT B;  5KHO A;  3ZNI D;  3CMM B;  4GDK A;  4KVG B;  3QHT A;  3EC8 A;  1M94 A;  2FID A;  1P0R A;  1WMH B;  2JY6 A;  2KJ6 A;  1WFY A;  4LJP B;  2JXX A;  1EUV B;  2G4D B;  4MH0 E;  2O6V B;  4RMA A;  1CMX B;  4EZK A;  5JZE B;  3SHQ A;  4FAD A;  1WIA A;  4BVU C;  4GN1 A;  4FJY A;  1E8X A;  3VTW A;  1E7V A;  2JF5 A;  4G50 A;  5J18 A;  2KMC A;  3ML8 A;  1R4M I;  2N7D A;  3IHP C;  3H9D A;  4FJV B;  3S2A A;  3ZW3 A;  4PS7 A;  5AEK B;  1UEL A;  3HM3 A;  3U8Z A;  3APF A;  3H1U A;  2BYV E;  3PZD A;  3TMP B;  4TV3 A;  4W9C A;  4PS3 A;  2LRW A;  2NBW B;  4GSW A;  2IO3 B;  1JRU A;  2ZVN A;  5HKH A;  2IY0 B;  4ICU A;  4MEL A;  2EMT A;  2LVO A;  1R4N I;  2WYQ A;  4KZC A;  3KVF B;  3WAM A;  4FJZ A;  1IPG A;  2C9W B;  4RM9 A;  1LQB A;  3QCA A;  2VRR B;  1L7Y A;  2UYZ B;  2MWS B;  4EEW A;  3TIX A;  2K8C A;  1WM2 A;  3A9J A;  2LGX A;  2RD0 A;  2QHO A;  1LM8 B;  1UBI A;  2DHZ A;  1WJU A;  2KWV B;  3VH4 B;  1NDD A;  2ZVO A;  2PPH A;  2REX A;  2DYB A;  4JL9 A;  1C3T A;  2IO1 B;  1V2Y A;  3QA8 A;  2ZPY A;  2KTF A;  2V3S A;  1E8W A;  3KUD B;  2ZNV C;  1TTN A;  4W9K A;  2NPT B;  4F1S A;  5JH5 C;  1WY8 A;  4MEM A;  2EKE C;  2IYD B;  2L76 A;  2KQ7 A;  4I6L B;  4W9I A;  4ZDV A;  2CKH B;  2N9P C;  4XX5 A;  1YJ1 A;  5IAA C;  2YVC A;  1KLV A;  3LJ3 A;  4KIK B;  2PJH A;  2KVR A;  4FHK A;  2DEN B;  3VFK A;  4FN2 A;  4AUQ C;  3AI5 A;  2IO0 B;  3CST A;  4BBN F;  1WR6 E;  4WWO A;  2KLG A;  2G4S A;  1OTR B;  1MG8 A;  4MSQ B;  3KUC B;  3LDZ E;  4DHJ B;  3DVG X;  3KYD D;  4LCD E;  5E6N A;  2LXA A;  2ASQ A;  1RFA A;  2A5U A;  2MW5 A;  2V1Y A;  4GDL B;  4BFR A;  1E5W A;  3DVN V;  2D07 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...