4A20A

Crystal structure of the ubl domain of mdy2 (get5) at 1.78a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
AAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN-LIKE PROTEIN MDY2
publication title Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 18
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a20A00
2LJ5A 3C0RB 2MBEA 3OAWA 4DHJB 1UZXB 3ML8A 3ZIMA 4EKUA 3W1SC 1L7YA 2C7NB 1WR1A 3HK0A 1WXVA 2OOBB 3VVWB 2LUEA 2REXA 4WJPA 3X0WA 2R2OA 3VFKA 3GOEA 4P7IA 1E8ZA 4A3PA 1I35A 2G45B 2LRUA 3X23A 2KK8A 3WAOA 3DVNU 3H7SA 5C1ZA 4URKA 3TCAA 4A20A 5J18A 5G2NA 2ZCBA 3KH0A 3PHXB 2AYOB 1WM3A 2BGFA 2FCSA 2N9XA 2ZCCA 2KC2A 3DQVA 4AOFA 5FR6A 3QK0A 2WX0A 3NY5A 3RYTA 2JT4B 3GZNI 2MBBB 4A3OA 1KJTA 3SD5A 2N1WA 2MX2A 4TQ0A 1WIAA 4LDTB 3ZRFA 3SHQA 1LQBA 5E6PA 1EO6A 1XT9B 4TKNA 4G0NB 5DPTA 2BKFA 1WZ3A 5GMVA 2IZVB 4ICVA 3ZDTA 2IO3B 2HJ8A 2PE6B 4AUQC 2BKRB 2RR9A 3NOBA 3L17A 2M8SA 1WFYA 2MBOA 2ZPYA 4MSQB 1T0YA 3ZTCA 1WGGA 2N7DA 4IW0A 4MEMA 1YX6B 2IY1B 2CR5A 2C60A 1WX7A 3PVLA 3VHTC 3A4RA 4N9F4 3U30A 2D2QA 1WGRA 4EZKA 3ZNZB 2KJRA 3WAPA 2C7MB 2KWUB 4X57B 5D94A 3VUYA 2JWZA 4WJOA 5EDSA 3MJWA 2OJRA 1P3QU 2K8HA 3HIZA 4WJNA 2L76A 3EC8A 1ISNA 3ONSA 3PRMB 2FCNA 4PS7A 4DHJD 4KSLC 2NPTA 4JLCA 2O2VA 2L0TA 1WJ4A 3IG3A 4BBNF 3L10B 2MRPA 4ZYNA 1EF1A 3PZDA 2V3SA 2ZNVC 4IWQA 2N4FA 4KZ0A 3HHMA 4B9KA 3QJZA 2YLMA 4FBJB 2A5UA 1Z2MA 4MGIE 1KLVA 2D10A 2NPTB 3WANA 4FADA 1M94A 5JH5C 2O2VB 1R4MI 4KDLB 4TUUA 3H1UA 3L16A 3N3KB 4ZDVA 2K8BA 4KDIC 2J0JA 2V4LA 1RAXA 1TGZB 5JHAA 1V5OA 3L13A 3OJ3A 4NY0A 2JUOA 2XEWA 3ZLZA 3PT2B 4WJQA 2AL6A 3ZRCA 1V81A 2JRHA 3BY4B 2HD5B 2ZVNA 3OJ4B 2I1KA 3M63B 4LDTD 1D3ZA 2RSUA 4GDLA 4EEWA 1K8RB 3JSVA 5G55A 3WA0A 1J8CA 3TMPB 4DXAB 2FUHB 4F1SA 1WZ0A 2D11A 3M3JA 1WXMA 4ANVA 1WGDA 3PREA 2WDTB 2AL3A 4GDLB 2KWCA 3WIMA 2UYZB 2N9PC 2EMTA 3JSVB 3ALBA 1A5RA 4ANUA 4LJPB 2JVCA 3ECIA 1WYWB 1OEYA 4W9GA 1RRBA 3RCZA 2BYVE 2LRWA 4GU2A 3WALA 2D3GA 2CS4A 4HJKA 2DZMA 2IO0B 2LXAA 2NVUI 4ZRJA 2AEHA 3N32A 3UGBB 4BKTA 1GC6A 2K8CA 3L08A 2ZEQA 4J6IA 1UELA 1S1QB 5CTRC 1BT0A 4I6LB 3S2AA 5D6JB 1WGYA 1V80A 1V86A 3NS8A 5L83A 2GBMA 2DYMA 2IO1B 2LWPA 3JVZX 2RPQA 2UWQA 4RM8A 4MGZE 4I6NB 4K7WA 3ZTDA 4KV2A 1E90A 2G4DB 2ZVOA 3V62A 2MBQA 1XD3B 4FN2A 1WXAA 4DHZE 2FCMA 4BKSD 1RFAA 4HPMB 3APCA 4KVGB 5IAAC 4NJ6A 4TQ1A 1Z5SB 2M1MA 3PGEA 3CSFA 4HDQA 3Q3JA 2CHZA 4IM2A 3VUWA 3PHWB 5CX3A 1ZGUB 1EUVB 4FJYA 2XK5A 4E74A 4F8CB 3VXWA 3AULA 1MG8A 2O6VD 4PS8A 4IM0A 3ZKJC 2L7RA 3M95A 4JQWC 4CO7A 3ZW3A 1NBFC 3A9JA 1PQSA 3PLVA 1GJZA 3IBEA 5J2RA 3CF6E 2XK5B 4G3XB 3EECA 2DENB 4NQKE 1WJNA 2AWTA 3KUDB 4IC7B 1IPGA 4IG7B 1Y8RC 3A1QA 2BWFA 3V61A 1C3TA 3RULA 3A9JB 3ZUNA 2K1FA 3DVNV 4BKGA 5AZFA 2NCNA 4ZRIA 4W9LA 2J0KA 4E3CA 2Z0DB 1LFDA 2CU1A 2CHXA 3V6EB 4RMAA 3VTVA 3TL5A 3QA8A 2DAFA 4M8MA 4KZCA 4WAAA 3A1QB 2D07B 2NS5A 1WX8A 1V49A 1WRDB 2A4ZA 4W9JA 4DDGD 2IO2B 2NR2A 4AJYB 3UQBA 3KUCB 2CKHB 2KX3A 1P0RA 2GBJA 2YVCA 4PYZA 3PRZA 5LLIA 2K39A 2KMCA 2LGXA 4GSWA 2GBNA 3BINA 4WWPA 4DK5A 1WMHA 3QHTA 4GB9A 1KM7A 3DOWA 1GUAB 3JW0X 2KFKA 2MA9B 4G11A 4BKSA 2N7EA 4HDOA 5D2MB 2Z59B 1E8YA 1WJUA 2Z0EB 4LJOB 4MELA 2MP2A 1WI0A 1YIWA 5J17A 3H7PA 3H9DA 1AARA 4BVUC 4GIVA 5D7GA 1WMHB 3W1SA 4CYEA 2QHOA 4EZLA 4EZJA 2JPHA 4HPLB 2KFKB 1G6JA 4W9DA 2ZJDA 4MGYE 2BYEA 3DBSA 4NPNA 2V1YA 4NQLB 2MP2B 2O6VA 4ANXA 3R66C 3U8ZA 2KKCA 5DPSA 4JL9A 3U7DA 3H7PB 2KJHB 4KSKC 1P1AA 4FA6A 1E7VA 3I3TB 4CHKA 4FULA 3ZVVA 4IWPA 3RD2A 4M0WB 3VH3B 2O6VB 5JZEB 2LVPA 2M0XA 2MCNB 3LDZE 2FIFA 1OQYA 2HE7A 2L05A 3B1LX 3Q3FA 3UF8A 3P2BA 3KW5B 2KDIA 3JYUA 1EF5A 3VDZA 3ZNID 5KHQA 3B0AA 4HVBA 2K25A 2KDFB 3DVGX 2FCQA 3SU8X 3W1YA 3ZNGC 5DPWA 1GC7A 1YQBA 2MSED 4K1RB 3IHPC 2J7QB 3R7RA 2JXXA 2KWVB 1V6EA 4AJWA 2PEAA 1WXSA 3QARA 2B3AA 4MH0E 3QIJA 4ICUA 4KIKA 3KYCD 2W9NA 2HTHA 3B08A 1YJ1A 2L00B 1H4RA 1GG3A 2LASA 4HK2A 2LI5A 3IVFA 3CSTA 2KQSA 4EOYA 2BF8B 5L95C 2DZKA 1R4NI 3D32A 4NNJB 4ANWA 4KIKB 4W9EA 4FHKA 4MM3A 1E8WA 3MTNB 3NHEB 2C5LC 2KQ7A 1WF9A 4BOZB 1TTNA 5CHVC 3APDA 3O65B 2BYFA 5JHBA 2C7HA 1UBQA 1RLFA 4YL8A 1L2NA 3DDCB 3HM6X 1TZ1A 2G4SA 4IM3A 1NDDA 2J0MA 2KHWB 3VQIA 4BOSC 1WX9A 4ZRKA 3RZFA 1WE7A 4EUTA 4GDKA 2LVOA 2KC1A 4FLHA 3UQAA 1VCBA 2KANA 3VUXA 2FAZA 5LXIB 2PE9A 1E8XA 2GBKA 4W9HA 1P9DU 2NBUA 4G50A 2IBIB 2L0FA 2MBHA 2N9EB 2ZNVB 2WYQA 3KVFB 1HE8A 3PPAA 2KN5A 2WX1A 4GDKB 3ZNHB 2LXCA 4K7SA 3DBRI 4FJZA 2KO3A 4AWJA 4DWFA 1J0GA 3DCGA 1LM8B 3PS6A 3DBLI 4W9IA 4DBGA 3QAQA 2C9WB 4W9FA 3EFUA 3AI5A 2LGDA 2ASQA 4LCDE 3L0WB 1P98A 1OGWA 2BWES 2KDEB 2LGYA 2M17A 2XBBC 3VTWA 3DPDA 3R7QA 1WJ6A 3QX1A 4GN1A 1TBEA 5BO4B 2KX0A 2MW5A 2GOWA 1SE9A 3K9OB 4B95A 4BFRA 1OEYJ 1F9JA 3V60A 3T9LA 3KUZA 3AXCA 4NJ7A 3TBLD 4HCPB 4JIOU 4W9CA 1OTRB 3VTUA 4AP4C 3TJPA 2G3QB 2DZIA 3VH4B 4TV3A 2KXJA 2PJHA 1IP9A 3M62B 2KNBA 3QQ8B 4GXBA 4DDID 4HWIB 1UGMA 3KYDD 1VD2A 1IYFA 3RT3B 3TIXA 2LZ6A 2EMSA 2NBVB 1Q0WB 3PRPB 4EFOA 2K6DB 4OVVA 1I42A 4II2B 3ZO5B 1E7UA 5E6OA 1Q5WB 4IUMB 3VAWA 2DAJA 2DHZA 3T8MA 2KDBA 4PS3A 2JZ3B 4GOCA 2VRRB 3A9KA 5HKHA 1UBIA 2KLCA 3AU4A 2L8JA 3PLUA 4XX5A 5TR5A 4WQOB 1XQQA 3ZDMC 1FXTB 2KLGA 2DYBA 2PPHA 2KOXA 5DCNA 1U4AA 1ZW7A 1WM2A 3UIOB 3WAMA 1KOTA 2LVQA 1WGHA 3A9KB 3ML9A 2CHWA 1GNUA 3UIPB 5AZGA 3RZWC 3SDLC 2KTRA 2GBRA 1ZKHA 4OVUA 2KVRA 3K9PB 3PSEB 1Q1OA 3A33B 3DVGY 3A4SC 1V2YA 4II3B 4HXDA 4MSMB 4DHZB 2Y5BB 1WH3A 2KTFA 2JF5A 3IFWB 4BBNC 5LXHA 4RM9A 2KTRB 2WWZA 3OLMD 4FJVB 2ZZPB 4XZ4A 5KHOA 4IWOA 2KZRA 1WR6E 2GMIC 2MLBA 4GMVA 1J19A 1X1MA 1H8CA 1QZEA 2KJ6A 2MQJA 2IYDB 2DYOA 2KMAA 3LJ3A 4MGKE 4M8NA 3APFA 1C1YB 3ENEA 1WE6A 2LD9A 5AZHA 3DBHI 3UINB 1LXDA 2R2QA 5CHFA 4K7UA 4ASWC 1CMXB 4E71A 3NZSA 1V9JA 1NI2A 3QCAA 2DX5B 4PYUA 3EHVA 4MJSA 3QC8B 4NAWA 3H6NA 5C23A 4WWNA 2FNJB 2IY0B 2L3ZA 4HCNB 4I6PA 5E6NA 3PV1A 3NZUA 2KFJA 2RGFA 5CHWA 2JY6A 3L54A 3HM3A 1WY8A 2N1VA 3RUIB 3AU5A 3V6CB 4XC2A 2M4NA 2JZZA 3QWZB 1UH6A 4MJSB 4K81A 4NAWB 4B6WA 4W9KA 5IA7A 3MHSD 4WWOA 4F7ZA 1YD8U 2JRIB 2EKEC 1SGHA 2K6QA 1SIFA 2DZJA 2FIDA 1JRUA 2RD0A 4JGHB 1E5WA 3CMMB 4GGQA 1S3SG 2I1JA 2KD0A 1UD7A 2NBWB 3N30A 1V5TA 3PTFC 4HLEA 2BPSA 1YX5B 2ZPNA 3R3MA 5AEKB 5DPRA 2MWSB 4MDKE 4FHJA
chains in the Genus database with same CATH superfamily
1SIJA 1T3QA 5TSSA 1UZXB 3ZIMA 4EKUA 1L7YA 1WR1A 1VZ7A 3X0WA 1GOZA 4P7IA 1J7AA 4JX1C 1SSNA 3NG0A 1N60A 5C1ZA 5J18A 1N62A 2ZCBA 2AYOB 1WM3A 2DLBA 2I38A 2SAKA 3RYTA 1DGJA 4C4VA 3SD5A 4TQ0A 2MX2A 1QILA 1WIAA 3ZRFA 1TZOA 3ETRA 1IBXA 3Q69A 1WZ3A 4ICVA 3RFZB 4KKJA 3L17A 2M8SA 2ZPYA 3BVZA 2N7DA 4IW0A 4MEMA 2BW2A 2C60A 2OEDA 3PVLA 3VHTC 3A4RA 3GE3C 1T5XD 3WAPA 2C7MB 2QIEB 3Q14C 5D94A 3IT4B 4WJOA 3MJWA 3HIZA 1R4MB 4WJNA 2VZKD 3EC8A 2WXLA 4OVZA 4DHJD 2O2VA 5FR3A 3PZDA 4IWQA 2WXMA 2INCC 4LK0M 1XF5L 1QF6A 3HHMA 3WANA 3P4SB 4FADA 4KDLB 2JU6X 4HEA1 4ZDVA 1TS3A 3TEXA 5JHAA 2M19A 3RPFC 1V97A 3V3XA 1V81A 4N59A 1ACCA 3OJ4B 3M63B 1F2RC 1K8RB 1B1ZA 1TKEA 3WA0A 2H88B 1PGXA 1WSPA 2D11A 1D5ZC 2WDTB 3GP7A 2AL3A 4GDLB 3WIMA 2UYZB 3AM9A 5C3JB 1A5RA 1WYWB 4ZHPA 3P4PB 3WALA 4XYCA 2IO0B 3N20C 4LLGM 4ZRJA 2AEHA 3UGBB 1GC6A 2N0SB 4J6IA 1UELA 1S1QB 5CTRC 1WGYA 1V86A 3JVZX 2RPQA 4MGZE 2HTME 4K7WA 1E90A 2G4DB 3V62A 1L4DB 2VH1A 4DHZE 1VZ8A 1JQ4A 3Q2AC 4A8XC 1FCLA 2PLPA 2WXKA 4HDQA 2CHZA 3WCQA 4IM2A 3VUWA 4C7YA 5BMIA 2OHFA 2INNE 4PS8A 3V05A 3M95A 2WXQA 3ZW3A 2ZW1A 3PLVA 3IBEA 1FNUA 3EECA 4NQKE 4RF0A 4S17A 1OQQA 2XNAC 3V61A 3A9JB 2K1FA 1XCTL 1N6ZA 2IGHA 4ZRIA 3AMZA 3EFCA 4E3CA 1LFDA 3TL5A 4WAAA 3A1QB 1WX8A 2IO2B 4AJYB 1A70A 3KUCB 3PRZA 2D5GA 2K39A 2WXOA 4GSWA 2ACZB 3N1ZC 3DOWA 4L2YA 2KFKA 4BKSA 2N7EA 1XLOA 1YJJA 3Q3NC 4LJOB 4M01A 3H7PA 4BVUC 2W55A 2BYTA 2JSVX 1WMHB 4L23A 2JPHA 4W9DA 1ROEA 2BYEA 1JROA 2JXTA 4ANXA 5DPSA 1P1AA 4FA6A 4HJGE 1MVKA 3RD2A 4M0WB 3NZ3A 2FUG1 3LDZE 2FIFA 1OQYA 3Q3FA 3UF8A 3KW5B 3C8YA 3VDZA 5KHQA 2YEPB 2KDFB 3AE7B 1FFVA 3AE4B 5FK9C 2WP9B 3FC4A 1GC7A 2MSED 1RWSA 3RMKC 1V6EA 2LGIA 1WXSA 3QARA 1NVID 3BZDB 4MH0E 3VR9B 3B08A 1VR9A 2LI5A 3CSTA 2BF8B 4JWUC 4B0MA 4KIKB 4MM3A 2BTEA 1E8WA 2C5LC 2KAJA 4LNOA 3BWUD 1YNTE 1NDDA 2J0MA 2KHWB 4BOSC 4YXDB 1WX9A 2QEJC 4EUTA 1D6EC 4GLSC 5H8YE 4K3CA 5I4DA 3RNFC 2WDVB 3VUXA 5AUIA 1OQRA 4W9HA 1P9DU 4G50A 2QDFA 2IBIB 2L0FA 2N9EB 4GDKB 1YMHE 3ZNHB 2KN5A 4FJZA 4DWFA 1J0GA 3DCGA 2ICIA 3DBLI 2C9WB 1N5XA 3Q8AA 2ASQA 3L0WB 2BWES 2KDEB 3MC0B 3DPDA 3QX1A 1TBEA 4ZOHC 3FKYA 5IKCM 1EWYC 1DOYA 1F52A 4NJ7A 2LHEA 4N58A 1ZPSA 4MT5A 4TV3A 2V3NA 2QMTA 3QQ8B 4GXBA 1UGMA 4WH4A 1SE4A 3BK1A 1VZ6A 1E7UA 1Q5WB 3VAWA 2WXFA 3HRDD 3NJTA 4PK1A 2BB6A 3U2SC 4GOCA 3A9KA 3RNGC 4DXGA 3HVZA 2LJIA 1XQQA 2DNFA 3ZDMC 4NJCA 3URYA 1ZW7A 4XWWA 1WM2A 3WAMA 1KOTA 3E9SA 5T8IA 3MFGA 3UIPB 3RZWC 3Q8CA 5HFYA 3R8BA 1Q1OA 3A33B 3DBHB 4II3B 4HXDA 4WIPA 3NVYA 5LXHA 4IKGA 2W82A 1XLPA 2KZRA 2GMIC 2K22A 2MLBA 3OWEB 3LB8C 2MQJA 2IPKD 1D4BA 1CQVA 2DYOA 2IYDB 2KMAA 3AE2B 4M8NA 1LGRA 5AZHA 1LXDA 1YN5A 4K7UA 3QC8B 2KVZA 3H6NA 2V4IB 1SF0A 2IY0B 4HCNB 3PV1A 3Q8BA 1JW9D 5CHWA 3L54A 1WY8A 3RUIB 3V6CB 4XC2A 2JZZA 1N63A 1UH6A 1DYQA 4K81A 5IA7A 1TIFA 1YD8U 2V3PA 2JRIB 3FILB 1SGHA 1SIFA 4JGHB 2NBWB 1YX5B 5AEKB 1HTQA 4MACA 2WLBA 2MBEA 3OAWA 3ML8A 3I5JC 3W1SC 1CK1A 2OOBB 4C7ZA 1KTKA 4WJPA 2WHIA 4A3PA 1I35A 4A90A 1E0ZA 1UNSA 2G45B 3X23A 2IGDA 1XLNA 3DQVA 2FCSA 2N9XA 2KC2A 3Q6BA 5FR6A 2K0PA 2WX0A 3MP9A 3NY5A 2JT4B 3RNEC 3GZNI 2MBBB 1SXTA 3SHQA 3LXFA 1XT9B 4TKNA 2BKFA 1TKYA 2RPVA 1OFFA 2IO3B 2HJ8A 2PE6B 4AUQC 5BMHA 2RR9A 3NVWA 3ZQ4A 2MBOA 4A3OA 2IY1B 2CR5A 4N9F4 2LGSA 1WGRA 4EZKA 2KJRA 2KWUB 5EDSA 2JWZA 2OJRA 2K8HA 2Q5WD 3N1YC 2K3UA 1UGJA 2PTLA 3ONSA 4PS7A 4LNNA 3IG3A 4BBNF 1EF1A 1FNVA 3NVZA 3IAS1 2N4FA 4B9KA 3DWMA 3QJZA 4US9A 1T0RC 4FBJB 2A5UA 1Z2MA 3MJ5A 4MGIE 2CU3A 1M94A 1HTOA 3DHHC 3U52E 1NYQA 3VRBB 5EE0A 1I7HA 3L16A 2K8BA 1TGZB 3RNAC 1FPYA 1I4RA 2JUOA 3N9YC 3ZLZA 3PT2B 3AE1B 2HD5B 1TS5A 3TEWA 4GDLA 4EEWA 4OZCA 1SJHD 2FUHB 5BMGA 4TSSA 1WXMA 1MFWA 1OEYA 1F0ZA 4W9GA 1RRBA 3RCZA 4GU2A 4HJKA 2LXAA 2NVUI 1QOAA 4BKTA 1T0QC 2KYWA 4I6LB 3S2AA 1XXGA 4RH6A 3NS8A 5L83A 2IO1B 2DYMA 2LWPA 2DWQA 1MPEA 2UWQA 1LO5D 4O1NA 4KV2A 2G1EA 1N5WA 1XD3B 4FN2A 1FNWA 4KVGB 4NJ6A 1Z5SB 4P1BC 5CX3A 2Y5PA 4E74A 4F8CB 1MG8A 2O6VD 2GI9A 3ZKJC 4M02A 2L7RA 1QLBB 4CO7A 3A9JA 3NUHB 2WDQB 1PQSA 1GJZA 3CF6E 4K3BA 2XK5B 2DENB 2AWTA 4NAMA 1IPGA 3A1QA 2BWFA 4BKGA 5AZFA 4W9LA 1KRHA 2Z0DB 2CHXA 4RMAA 4M8MA 2EELA 4KZCA 1E6EB 2X8XX 2NS5A 1V49A 1WRDB 2A4ZA 3W2DA 2CKHB 1WRIA 1WMHA 3QHTA 2MA9B 1TY2A 4G11A 1E8YA 4USAA 1YIWA 3Q8EA 4EE2A 4ZYSA 3IXSA 5C2TB 2ON8A 4TMAB 4GIVA 5D7GA 4CYEA 4MH8A 4EZLA 4EZJA 1G6JA 4M0WA 4HPPA 3DBSA 4NPNA 2V0GA 1ZP0B 2V1YA 4RGMA 2KKCA 1ZDXA 3U7DA 2MJ3A 3KWVA 2AX5A 4CHKA 4Q2JA 1PGBA 3DWGC 2O6VB 2LVPA 2L05A 2JYEA 3P2BA 4YWGG 2KDIA 3JYUA 3B0AA 2K25A 3DVGX 3TUOA 3SU8X 3W1YA 1C76A 1CZPA 5DPWA 2J7QB 1AWDA 1P7FA 2PEAA 3VR8B 1BMLC 3B9JA 2AQ3B 4KIKA 1GG3A 2LASA 3H8HA 1R4NI 3AH7A 4FHKA 3VRAB 3MTNB 2KQ7A 3ZJTA 1WF9A 4BOZB 4A6QA 4ZRQA 2QCZA 5JHBA 1UBQA 1QOBA 3DHIC 2G4SA 1PDXA 2ONQA 4ZRKA 1WE7A 1IGDA 4GDKA 1C9FA 2WXNA 5JXVA 2LVOA 4YTNB 4RF1A 1VCBA 3HVDA 5LXIB 3KWLA 1E8XA 1YQ3B 5BYSA 3UI3A 1HE8A 1SEBD 4K7SA 2MEKA 2BS2B 4YT0B 3KLSX 1C4CA 2WU5B 3PS6A 4DBGA 4W9FA 3AI5A 1L0XB 1OGWA 4US8A 2M17A 3VTWA 1GB1A 3P42A 1ZUD2 2KX0A 2W54A 2GOWA 2RDGA 1SE9A 1OEYJ 1F9JA 2D3CA 3T9LA 1FRDA 4JIOU 4W9CA 1OTRB 2WXGA 2DZIA 1HQRD 2PJHA 4YTMB 3PZ7A 4DDID 4QAYA 1IYFA 3RT3B 1YN3A 2EMSA 2NBVB 4XE0A 1I42A 4II2B 3NVVA 1KF6B 1D5MC 1ZDVA 4DQOC 1XCQL 4NZLB 3W9CB 3AU4A 1EU3A 2KLGA 2PPHA 2KOXA 1V1PB 2CJNA 3UIOB 4JE3B 5GXGB 3ML9A 1GNUA 2QC8A 2GBRA 1ZKHA 1V8CA 1TKGA 4MSMB 2SEBD 2PIAA 2KTFA 2PKOA 3IFWB 4RM9A 4XZ4A 4IWOA 1JWMD 5D3DA 2IJ0A 4GMVA 1X1MA 2WDRB 1J7BA 3KQ4A 4JPSA 3APFA 2R2QA 1CMXB 5LNK1 1V9JA 1PGAA 2DX5B 4WWNA 1UF0A 4HKQA 4C00A 2HJ1A 2L3ZA 2X38A 2MH7A 3NZUA 2KFJA 2RGFA 3FILA 2JY6A 3QWZB 3AB5A 4W9KA 1ESFA 3MHSD 3DBRB 2CJOA 2K6QA 1JRUA 1E5WA 2I1JA 4ZHOA 3PTFC 5DPRA 4MDKE 1I4XA 2FE8A 3C0RB 3W5VB 4OW0A 3NRZA 3VVWB 2LUEA 1N61A 3PZ8A 1PUTA 3ZJUA 3VFKA 2D3BA 1VDVA 3B2FA 1E8ZA 1P7EA 3H7SA 1FCCC 4URKA 3TCAA 1M4VA 5G2NA 3KH0A 3PHXB 3GB1A 3BK2A 4AOFA 1DOXA 3QK0A 1YOVB 1K51A 2LHDA 1SE2A 4LDTB 1QT9A 2PVGC 1LQBA 5E6PA 3RI7C 2IZVB 3ZDTA 2BT6A 1AW7A 1I4HA 3NOBA 3ZTCA 4MSQB 1T0YA 1YX6B 2G9HD 2BQQA 3AEEB 2J52A 1NI3A 3I9V1 2AQ1B 1FXIA 3VUYA 1P3QU 2L76A 3U7ZA 1HA5A 1QOFA 1TJEA 2MJDA 2RMMA 3AN1A 4AQ7A 4JLCA 2MRPA 4ZYNA 2LFIA 1KLUD 2YLMA 2NPTB 5JH5C 2WXRA 3N3KB 4KDIC 1RAXA 1V5OA 3L13A 1C77A 4WJQA 2AQ2B 2AL6A 3ZRCA 1HEZE 2JRHA 1MG4A 3BY4B 2ZVNA 2I1KA 1GB4A 5G55A 1L4ZB 4DXAB 4F1SA 1WZ0A 4DXFA 1FRRA 4ARCA 2EMTA 3JSVB 3ALBA 4ANUA 4HROA 4LJPB 2JQRB 1L0YB 3MC9A 2LRWA 2D3GA 2DZMA 3N32A 2LMCA 4YTPB 2ZEQA 1SB3C 2D3AA 1K50A 2K9XA 1V80A 2INDC 1SJED 2GBMA 2MJEA 4RM8A 4I6NB 4RGNA 2YEPF 3AECB 4D2KA 2MBQA 2FCMA 4HPMB 3TSSA 5MPOA 2WGSA 2M1MA 3PGEA 1EUVB 4FJYA 2XK5A 3VXWA 1EWCA 3AULA 4IM0A 4JQWC 4RFBA 1NBFC 1FD6A 2J4XA 4G3XB 3BYYB 1T0SC 2FBWB 3KUDB 5G5GA 1Y8RC 1C3TA 3RULA 3ZUNA 1IGCA 1KLGD 2J0KA 2CU1A 3ZXVA 3VTVA 4C80A 3QA8A 2DAFA 2D07B 4W9JA 4DDGD 2WNMA 4JWSC 2BB5A 2KX3A 2YVCA 1P0RA 1VLBA 4PYZA 3P4RB 2KMCA 2LGXA 2GBNA 3AE9B 4GB9A 1GUAB 3JW0X 5D2MB 2Z59B 4MELA 5AUKA 5J17A 1AARA 1F2RI 2IGGA 2GB1A 3BIID 3W1SA 2QHOA 2JZPA 2ZJDA 4LNIA 4NQLB 2MP2B 2O6VA 3R66C 3RNBC 1E7VA 3I3TB 4FULA 1NEKB 1XEEA 3GS2A 3E56A 4OZBA 4N6EB 3EUB2 4WAFA 2Y3AA 3ZNID 3C19A 4HVBA 2FCQA 2WU2B 3IT6B 3J9CA 5EE3A 3R7RA 3IHPC 2KWVB 4L1BA 3P63A 2B3AA 3QIJA 4ICUA 2LEKA 2HTHA 4CQNA 1YJ1A 4M00A 4HK2A 3IVFA 5FKAC 2KQSA 2DZKA 4NNJB 4ANWA 4W9EA 3AE5B 1VJKA 3P4QB 4HKZE 3APDA 3O65B 2BYFA 1C4AA 2JWUA 4YL8A 1L2NA 3DDCB 1F77A 1TZ1A 4IM3A 4OZAA 5IOIA 2KC1A 3UQAA 2KANA 2FAZA 2PE9A 1K52A 4IDIA 5IO9A 2NBUA 5C23A 2MBHA 3PPAA 3KVFB 2WX1A 2LXCA 1AYFA 3ZJVA 2KO3A 4AWJA 1LM8B 4W9IA 2WXJA 1I4PA 1E7PB 2LGDA 2L83A 1WJ6A 5BO4B 2MW5A 4R3DA 4B95A 4BFRA 2N9LA 3ABVB 3TBLD 4AP4C 3TJPA 2UU7A 2KXJA 2Z8LA 3M62B 2KNBA 4HWIB 4H2AA 3KYDD 1VD2A 2LZ6A 4KGRA 4KGTA 3PRPB 4EFOA 2WS3B 4IUMB 2WXIA 2DHZA 1JCKB 1V1PA 1HZ5A 3BVMA 3B2GA 4XX5A 5TR5A 2QILA 3AEBB 5D3IB 1VRAB 5DCNA 4S0RA 2KMMA 1C78A 2CHWA 1MHXA 1IUEA 2PVOD 2DBYA 4B0EA 3PSEB 3K9PB 3DVGY 3A4SC 1L6UA 1FFUA 1KH0A 2Y5BB 1WH3A 3Q8FA 1MHHE 4BBNC 1YN4A 2GLSA 2KTRB 3OLMD 1I4QA 2RDBC 1J19A 1H8CA 1Q10A 1QZEA 3LJ3A 4XWTA 1HZ6A 1C1YB 2LD9A 5CHFA 4ASWC 1GPXA 1NI2A 3QCAA 1ET6A 4PYUA 2VH2A 3EHVA 2L52A 2PW9A 1RYJA 1L6VA 4I6PA 4IOIE 3HM3A 2N1VA 3AU5A 3W5UB 4MJSB 4NAWB 1WWTA 4F7ZA 2FIDA 2RD0A 3FAHA 4GGQA 4HLEA 3DBLB 2BPSA 1EM7A 2ZPNA 3R3MA 4XDCA 3BYTB 1SBBB 4FHJA 2VZKB 2LJ5A 4DHJB 1YJIA 3EGRA 2C7NB 3HK0A 1WXVA 1I4GA 2W3SA 2REXA 3BVGA 2ZW0A 3P1MA 3SEBA 2R2OA 3GOEA 1K53A 1TS2A 2LRUA 2KK8A 3WAOA 3DVNU 4A20A 2BGFA 2ZCCA 3NS1A 3AEDB 4UDUC 1RM6C 4FXCA 3RN9C 1KJTA 2N1WA 2BVCA 1C79A 5EE1A 1EO6A 5DPTA 4G0NB 5GMVA 1JALA 4BAXA 3AEGB 2K5PA 4C4VB 2BKRB 3TEYA 1WFYA 1WGGA 1NYRA 3O13A 1IBXB 1WX7A 1BXTA 3U30A 2D2QA 3ZNZB 5G5HA 4X57B 2QSDA 1B9RA 2HDEA 2L1AA 1QKZA 3ZYYX 1ISNA 3PRMB 2FCNA 1J7CA 4KSLC 4RGTA 2NPTA 4XDDA 2L0TA 1WJ4A 3L10B 2V3SA 2ZNVC 4KZ0A 4REZA 2TSSA 1KLVA 2D10A 1FM0D 2O2VB 1R4MI 2EKIA 4TUUA 3H1UA 2J0JA 2V4LA 3OJ3A 4NY0A 4YSXB 2XEWA 4C56C 4P6VF 4LTUA 4LDTD 1D3ZA 2RSUA 1DOIA 3JSVA 4J3OD 1J8CA 3L4PA 3TMPB 3IAM1 1ZOYB 1MJDA 1UWXA 3M3JA 4ANVA 2I2YA 1WGDA 2N7JA 3PREA 2KWCA 2N9PC 4KX6B 1L5PA 2JVCA 3ECIA 3I57A 3AE3B 5H92C 2BYVE 4LNFA 4RNAA 2CS4A 2K8CA 3L08A 3AEAB 3T3OA 1BT0A 5D6JB 2KN4A 2LUMA 3SFEB 4PT5A 3ZTDA 2ZVOA 3GZNB 3ZGZA 4ITKA 1WXAA 4BKSD 2KT7A 1RFAA 3APCA 4KKIA 1V1OA 5IAAC 4TQ1A 4ARIA 2E3TA 3T3NA 3CSFA 3Q3JA 3PHWB 1ZGUB 1HXYD 1PFDA 5E6JA 1JWUD 1FXAA 2KWDA 3PO0A 1FMAD 5J2RA 1WGKA 2OJWA 1E10A 1WJNA 4IC7B 4IG7B 1XO3A 2NMQA 3DVNV 2KQ4X 2NCNA 3ZXRA 2JYTA 3V6EB 5BYRA 1RFKA 1JWSD 2MHJA 3DHGC 4HRSA 2NR2A 4A55A 3UQBA 4P1CC 2GBJA 5LLIA 1STEA 4DK5A 3BINA 4WWPA 4AS1A 1KM7A 3SR6A 4HDOA 1WJUA 2Z0EB 2MP2A 1WI0A 1CJEA 3H9DA 4BZAA 1QOGA 4HPLB 2KFKB 4MGYE 1MI0A 3U8ZA 4JL9A 2R61A 3H7PB 2KJHB 4KSKC 1FEHA 1NENB 1R7SA 3CWIA 3ZVVA 4IWPA 2E6XA 3VH3B 5JZEB 4OHJA 2MCNB 1YQ4B 2INPE 2M0XA 3MHZA 2HE7A 3B1LX 1EF5A 1UUPA 3Q3OC 1WYGA 2J42A 1D5XC 3GE8C 3ZNGC 1YQBA 4K1RB 1L0VB 2JXXA 4AJWA 2BS4B 4ACFA 2V9HA 2GRIA 2M56B 4RGOS 3N1XC 3KYCD 2W9NA 2Y5CA 2WQYB 2L00B 1H4RA 3MC8A 1E9MA 4EOYA 5L95C 4WURA 3D32A 4YSZB 1SE3A 1TY0A 1ET9A 1WXQA 1EU4A 1Y56A 3NHEB 3AE6B 5HG2A 1TTNA 5CHVC 2C7HA 3U4EG 1RLFA 3AEFB 1FO4A 4MM3B 3HM6X 2PMVA 3VQIA 1UWMA 3RZFA 1TS4A 5IN7A 4FLHA 3SFDB 3EA6A 1ENFA 2GBKA 4P16A 2ZNVB 2WYQA 2KACA 1C4PA 2RDHA 3DBRI 4WWMA 1T6BX 2NTTA 2L32A 3CIRB 3R2IA 3I63C 4A9AA 3QAQA 3EFUA 5IP4D 4LCDE 1P98A 2LGYA 2XBBC 3R7QA 4GN1A 3K9OB 5BYQA 3V60A 2N9KA 3KUZA 2B76B 3AXCA 3VTUA 4HCPB 2G3QB 3VH4B 3Q3MC 3R2TA 1IP9A 1JWAD 1QQRA 1TYGB 2JX5A 3RNCC 3TIXA 1JWBD 1Q0WB 1BUIC 2K6DB 4OVVA 4XGAB 3ZO5B 5E6OA 2W3RA 1KFYB 2DAJA 3T8MA 4WQMA 2KDBA 2H89B 4PS3A 2JZ3B 4ZRPA 2VRRB 5HKHA 1UBIA 2KLCA 2L8JA 3PLUA 4WQOB 1FIQA 1FXTB 2DYBA 2BBCA 1U4AA 2J53A 1F1HA 1WGHA 2LVQA 3A9KB 5AZGA 3SDLC 2KTRA 5HHDG 4OVUA 2KVRA 1JMLA 1V2YA 1ZXHA 4KGSA 2NTSA 1JRPA 4DHZB 1R4NB 2JF5A 2XN9C 2WWZA 4FJVB 2ZZPB 3OG5A 5KHOA 1WR6E 1ZXIA 2KDMA 1AN8A 2KJ6A 2QJLA 4MGKE 1GAQB 4RCOA 1ZE3D 3ENEA 1WE6A 2M0AA 3DBHI 3UINB 4E71A 3NZSA 3LYYA 4MJSA 4NAWA 3AV8A 2FNJB 5E6NA 5EE9A 4LNKA 2M4NA 2WXPA 4B6WA 5HI1A 4WWOA 1PYWD 2EKEC 2DZJA 2WXHA 4YSYB 3CMMB 1S3SG 2KD0A 1UD7A 3N30A 1V5TA 3HUIA 1XLQA 3AE8B 2MWSB 2BS3B 2IDYA 1TT5B 3TEZA
chains in the Genus database with same CATH topology
2LJ5A 3C0RB 2MBEA 3OAWA 4DHJB 1UZXB 3ML8A 3ZIMA 4EKUA 3W1SC 1L7YA 2C7NB 1WR1A 3HK0A 1WXVA 2OOBB 3VVWB 2LUEA 2REXA 4WJPA 3X0WA 2R2OA 3VFKA 3GOEA 4P7IA 1E8ZA 4A3PA 1I35A 2G45B 2LRUA 3X23A 2KK8A 3WAOA 3DVNU 3H7SA 5C1ZA 4URKA 3TCAA 4A20A 5J18A 5G2NA 2ZCBA 3KH0A 3PHXB 2AYOB 1WM3A 2BGFA 2FCSA 2N9XA 2ZCCA 2KC2A 3DQVA 4AOFA 5FR6A 3QK0A 2WX0A 3NY5A 3RYTA 2JT4B 3GZNI 2MBBB 4A3OA 1KJTA 3SD5A 2N1WA 2MX2A 4TQ0A 1WIAA 4LDTB 3ZRFA 3SHQA 1LQBA 5E6PA 1EO6A 1XT9B 4TKNA 4G0NB 5DPTA 2BKFA 1WZ3A 5GMVA 2IZVB 4ICVA 3ZDTA 2IO3B 2HJ8A 2PE6B 4AUQC 2BKRB 2RR9A 3NOBA 3L17A 2M8SA 1WFYA 2MBOA 2ZPYA 4MSQB 1T0YA 3ZTCA 1WGGA 2N7DA 4IW0A 4MEMA 1YX6B 2IY1B 2CR5A 2C60A 1WX7A 3PVLA 3VHTC 3A4RA 4N9F4 3U30A 2D2QA 1WGRA 4EZKA 3ZNZB 2KJRA 3WAPA 2C7MB 2KWUB 4X57B 5D94A 3VUYA 2JWZA 4WJOA 5EDSA 3MJWA 2OJRA 1P3QU 2K8HA 3HIZA 4WJNA 2L76A 3EC8A 1ISNA 3ONSA 3PRMB 2FCNA 4PS7A 4DHJD 4KSLC 2NPTA 4JLCA 2O2VA 2L0TA 1WJ4A 3IG3A 4BBNF 3L10B 2MRPA 4ZYNA 1EF1A 3PZDA 2V3SA 2ZNVC 4IWQA 2N4FA 4KZ0A 3HHMA 4B9KA 3QJZA 2YLMA 4FBJB 2A5UA 1Z2MA 4MGIE 1KLVA 2D10A 2NPTB 3WANA 4FADA 1M94A 5JH5C 2O2VB 1R4MI 4KDLB 4TUUA 3H1UA 3L16A 3N3KB 4ZDVA 2K8BA 4KDIC 2J0JA 2V4LA 1RAXA 1TGZB 5JHAA 1V5OA 3L13A 3OJ3A 4NY0A 2JUOA 2XEWA 3ZLZA 3PT2B 4WJQA 2AL6A 3ZRCA 1V81A 2JRHA 3BY4B 2HD5B 2ZVNA 3OJ4B 2I1KA 3M63B 4LDTD 1D3ZA 2RSUA 4GDLA 4EEWA 1K8RB 3JSVA 5G55A 3WA0A 1J8CA 3TMPB 4DXAB 2FUHB 4F1SA 1WZ0A 2D11A 3M3JA 1WXMA 4ANVA 1WGDA 3PREA 2WDTB 2AL3A 4GDLB 2KWCA 3WIMA 2UYZB 2N9PC 2EMTA 3JSVB 3ALBA 1A5RA 4ANUA 4LJPB 2JVCA 3ECIA 1WYWB 1OEYA 4W9GA 1RRBA 3RCZA 2BYVE 2LRWA 4GU2A 3WALA 2D3GA 2CS4A 4HJKA 2DZMA 2IO0B 2LXAA 2NVUI 4ZRJA 2AEHA 3N32A 3UGBB 4BKTA 1GC6A 2K8CA 3L08A 2ZEQA 4J6IA 1UELA 1S1QB 5CTRC 1BT0A 4I6LB 3S2AA 5D6JB 1WGYA 1V80A 1V86A 3NS8A 5L83A 2GBMA 2DYMA 2IO1B 2LWPA 3JVZX 2RPQA 2UWQA 4RM8A 4MGZE 4I6NB 4K7WA 3ZTDA 4KV2A 1E90A 2G4DB 2ZVOA 3V62A 2MBQA 1XD3B 4FN2A 1WXAA 4DHZE 2FCMA 4BKSD 1RFAA 4HPMB 3APCA 4KVGB 5IAAC 4NJ6A 4TQ1A 1Z5SB 2M1MA 3PGEA 3CSFA 4HDQA 3Q3JA 2CHZA 4IM2A 3VUWA 3PHWB 5CX3A 1ZGUB 1EUVB 4FJYA 2XK5A 4E74A 4F8CB 3VXWA 3AULA 1MG8A 2O6VD 4PS8A 4IM0A 3ZKJC 2L7RA 3M95A 4JQWC 4CO7A 3ZW3A 1NBFC 3A9JA 1PQSA 3PLVA 1GJZA 3IBEA 5J2RA 3CF6E 2XK5B 4G3XB 3EECA 2DENB 4NQKE 1WJNA 2AWTA 3KUDB 4IC7B 1IPGA 4IG7B 1Y8RC 3A1QA 2BWFA 3V61A 1C3TA 3RULA 3A9JB 3ZUNA 2K1FA 3DVNV 4BKGA 5AZFA 2NCNA 4ZRIA 4W9LA 2J0KA 4E3CA 2Z0DB 1LFDA 2CU1A 2CHXA 3V6EB 4RMAA 3VTVA 3TL5A 3QA8A 2DAFA 4M8MA 4KZCA 4WAAA 3A1QB 2D07B 2NS5A 1WX8A 1V49A 1WRDB 2A4ZA 4W9JA 4DDGD 2IO2B 2NR2A 4AJYB 3UQBA 3KUCB 2CKHB 2KX3A 1P0RA 2GBJA 2YVCA 4PYZA 3PRZA 5LLIA 2K39A 2KMCA 2LGXA 4GSWA 2GBNA 3BINA 4WWPA 4DK5A 1WMHA 3QHTA 4GB9A 1KM7A 3DOWA 1GUAB 3JW0X 2KFKA 2MA9B 4G11A 4BKSA 2N7EA 4HDOA 5D2MB 2Z59B 1E8YA 1WJUA 2Z0EB 4LJOB 4MELA 2MP2A 1WI0A 1YIWA 5J17A 3H7PA 3H9DA 1AARA 4BVUC 4GIVA 5D7GA 1WMHB 3W1SA 4CYEA 2QHOA 4EZLA 4EZJA 2JPHA 4HPLB 2KFKB 1G6JA 4W9DA 2ZJDA 4MGYE 2BYEA 3DBSA 4NPNA 2V1YA 4NQLB 2MP2B 2O6VA 4ANXA 3R66C 3U8ZA 2KKCA 5DPSA 4JL9A 3U7DA 3H7PB 2KJHB 4KSKC 1P1AA 4FA6A 1E7VA 3I3TB 4CHKA 4FULA 3ZVVA 4IWPA 3RD2A 4M0WB 3VH3B 2O6VB 5JZEB 2LVPA 2M0XA 2MCNB 3LDZE 2FIFA 1OQYA 2HE7A 2L05A 3B1LX 3Q3FA 3UF8A 3P2BA 3KW5B 2KDIA 3JYUA 1EF5A 3VDZA 3ZNID 5KHQA 3B0AA 4HVBA 2K25A 2KDFB 3DVGX 2FCQA 3SU8X 3W1YA 3ZNGC 5DPWA 1GC7A 1YQBA 2MSED 4K1RB 3IHPC 2J7QB 3R7RA 2JXXA 2KWVB 1V6EA 4AJWA 2PEAA 1WXSA 3QARA 2B3AA 4MH0E 3QIJA 4ICUA 4KIKA 3KYCD 2W9NA 2HTHA 3B08A 1YJ1A 2L00B 1H4RA 1GG3A 2LASA 4HK2A 2LI5A 3IVFA 3CSTA 2KQSA 4EOYA 2BF8B 5L95C 2DZKA 1R4NI 3D32A 4NNJB 4ANWA 4KIKB 4W9EA 4FHKA 4MM3A 1E8WA 3MTNB 3NHEB 2C5LC 2KQ7A 1WF9A 4BOZB 1TTNA 5CHVC 3APDA 3O65B 2BYFA 5JHBA 2C7HA 1UBQA 1RLFA 4YL8A 1L2NA 3DDCB 3HM6X 1TZ1A 2G4SA 4IM3A 1NDDA 2J0MA 2KHWB 3VQIA 4BOSC 1WX9A 4ZRKA 3RZFA 1WE7A 4EUTA 4GDKA 2LVOA 2KC1A 4FLHA 3UQAA 1VCBA 2KANA 3VUXA 2FAZA 5LXIB 2PE9A 1E8XA 2GBKA 4W9HA 1P9DU 2NBUA 4G50A 2IBIB 2L0FA 2MBHA 2N9EB 2ZNVB 2WYQA 3KVFB 1HE8A 3PPAA 2KN5A 2WX1A 4GDKB 3ZNHB 2LXCA 4K7SA 3DBRI 4FJZA 2KO3A 4AWJA 4DWFA 1J0GA 3DCGA 1LM8B 3PS6A 3DBLI 4W9IA 4DBGA 3QAQA 2C9WB 4W9FA 3EFUA 3AI5A 2LGDA 2ASQA 4LCDE 3L0WB 1P98A 1OGWA 2BWES 2KDEB 2LGYA 2M17A 2XBBC 3VTWA 3DPDA 3R7QA 1WJ6A 3QX1A 4GN1A 1TBEA 5BO4B 2KX0A 2MW5A 2GOWA 1SE9A 3K9OB 4B95A 4BFRA 1OEYJ 1F9JA 3V60A 3T9LA 3KUZA 3AXCA 4NJ7A 3TBLD 4HCPB 4JIOU 4W9CA 1OTRB 3VTUA 4AP4C 3TJPA 2G3QB 2DZIA 3VH4B 4TV3A 2KXJA 2PJHA 1IP9A 3M62B 2KNBA 3QQ8B 4GXBA 4DDID 4HWIB 1UGMA 3KYDD 1VD2A 1IYFA 3RT3B 3TIXA 2LZ6A 2EMSA 2NBVB 1Q0WB 3PRPB 4EFOA 2K6DB 4OVVA 1I42A 4II2B 3ZO5B 1E7UA 5E6OA 1Q5WB 4IUMB 3VAWA 2DAJA 2DHZA 3T8MA 2KDBA 4PS3A 2JZ3B 4GOCA 2VRRB 3A9KA 5HKHA 1UBIA 2KLCA 3AU4A 2L8JA 3PLUA 4XX5A 5TR5A 4WQOB 1XQQA 3ZDMC 1FXTB 2KLGA 2DYBA 2PPHA 2KOXA 5DCNA 1U4AA 1ZW7A 1WM2A 3UIOB 3WAMA 1KOTA 2LVQA 1WGHA 3A9KB 3ML9A 2CHWA 1GNUA 3UIPB 5AZGA 3RZWC 3SDLC 2KTRA 2GBRA 1ZKHA 4OVUA 2KVRA 3K9PB 3PSEB 1Q1OA 3A33B 3DVGY 3A4SC 1V2YA 4II3B 4HXDA 4MSMB 4DHZB 2Y5BB 1WH3A 2KTFA 2JF5A 3IFWB 4BBNC 5LXHA 4RM9A 2KTRB 2WWZA 3OLMD 4FJVB 2ZZPB 4XZ4A 5KHOA 4IWOA 2KZRA 1WR6E 2GMIC 2MLBA 4GMVA 1J19A 1X1MA 1H8CA 1QZEA 2KJ6A 2MQJA 2IYDB 2DYOA 2KMAA 3LJ3A 4MGKE 4M8NA 3APFA 1C1YB 3ENEA 1WE6A 2LD9A 5AZHA 3DBHI 3UINB 1LXDA 2R2QA 5CHFA 4K7UA 4ASWC 1CMXB 4E71A 3NZSA 1V9JA 1NI2A 3QCAA 2DX5B 4PYUA 3EHVA 4MJSA 3QC8B 4NAWA 3H6NA 5C23A 4WWNA 2FNJB 2IY0B 2L3ZA 4HCNB 4I6PA 5E6NA 3PV1A 3NZUA 2KFJA 2RGFA 5CHWA 2JY6A 3L54A 3HM3A 1WY8A 2N1VA 3RUIB 3AU5A 3V6CB 4XC2A 2M4NA 2JZZA 3QWZB 1UH6A 4MJSB 4K81A 4NAWB 4B6WA 4W9KA 5IA7A 3MHSD 4WWOA 4F7ZA 1YD8U 2JRIB 2EKEC 1SGHA 2K6QA 1SIFA 2DZJA 2FIDA 1JRUA 2RD0A 4JGHB 1E5WA 3CMMB 4GGQA 1S3SG 2I1JA 2KD0A 1UD7A 2NBWB 3N30A 1V5TA 3PTFC 4HLEA 2BPSA 1YX5B 2ZPNA 3R3MA 5AEKB 5DPRA 2MWSB 4MDKE 4FHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ5 A;  3C0R B;  2MBE A;  3OAW A;  4DHJ B;  1UZX B;  3ML8 A;  3ZIM A;  4EKU A;  3W1S C;  1L7Y A;  2C7N B;  1WR1 A;  3HK0 A;  1WXV A;  2OOB B;  3VVW B;  2LUE A;  2REX A;  4WJP A;  3X0W A;  2R2O A;  3VFK A;  3GOE A;  4P7I A;  1E8Z A;  4A3P A;  1I35 A;  2G45 B;  2LRU A;  3X23 A;  2KK8 A;  3WAO A;  3DVN U;  3H7S A;  5C1Z A;  4URK A;  3TCA A;  4A20 A;  5J18 A;  5G2N A;  2ZCB A;  3KH0 A;  3PHX B;  2AYO B;  1WM3 A;  2BGF A;  2FCS A;  2N9X A;  2ZCC A;  2KC2 A;  3DQV A;  4AOF A;  5FR6 A;  3QK0 A;  2WX0 A;  3NY5 A;  3RYT A;  2JT4 B;  3GZN I;  2MBB B;  4A3O A;  1KJT A;  3SD5 A;  2N1W A;  2MX2 A;  4TQ0 A;  1WIA A;  4LDT B;  3ZRF A;  3SHQ A;  1LQB A;  5E6P A;  1EO6 A;  1XT9 B;  4TKN A;  4G0N B;  5DPT A;  2BKF A;  1WZ3 A;  5GMV A;  2IZV B;  4ICV A;  3ZDT A;  2IO3 B;  2HJ8 A;  2PE6 B;  4AUQ C;  2BKR B;  2RR9 A;  3NOB A;  3L17 A;  2M8S A;  1WFY A;  2MBO A;  2ZPY A;  4MSQ B;  1T0Y A;  3ZTC A;  1WGG A;  2N7D A;  4IW0 A;  4MEM A;  1YX6 B;  2IY1 B;  2CR5 A;  2C60 A;  1WX7 A;  3PVL A;  3VHT C;  3A4R A;  4N9F 4;  3U30 A;  2D2Q A;  1WGR A;  4EZK A;  3ZNZ B;  2KJR A;  3WAP A;  2C7M B;  2KWU B;  4X57 B;  5D94 A;  3VUY A;  2JWZ A;  4WJO A;  5EDS A;  3MJW A;  2OJR A;  1P3Q U;  2K8H A;  3HIZ A;  4WJN A;  2L76 A;  3EC8 A;  1ISN A;  3ONS A;  3PRM B;  2FCN A;  4PS7 A;  4DHJ D;  4KSL C;  2NPT A;  4JLC A;  2O2V A;  2L0T A;  1WJ4 A;  3IG3 A;  4BBN F;  3L10 B;  2MRP A;  4ZYN A;  1EF1 A;  3PZD A;  2V3S A;  2ZNV C;  4IWQ A;  2N4F A;  4KZ0 A;  3HHM A;  4B9K A;  3QJZ A;  2YLM A;  4FBJ B;  2A5U A;  1Z2M A;  4MGI E;  1KLV A;  2D10 A;  2NPT B;  3WAN A;  4FAD A;  1M94 A;  5JH5 C;  2O2V B;  1R4M I;  4KDL B;  4TUU A;  3H1U A;  3L16 A;  3N3K B;  4ZDV A;  2K8B A;  4KDI C;  2J0J A;  2V4L A;  1RAX A;  1TGZ B;  5JHA A;  1V5O A;  3L13 A;  3OJ3 A;  4NY0 A;  2JUO A;  2XEW A;  3ZLZ A;  3PT2 B;  4WJQ A;  2AL6 A;  3ZRC A;  1V81 A;  2JRH A;  3BY4 B;  2HD5 B;  2ZVN A;  3OJ4 B;  2I1K A;  3M63 B;  4LDT D;  1D3Z A;  2RSU A;  4GDL A;  4EEW A;  1K8R B;  3JSV A;  5G55 A;  3WA0 A;  1J8C A;  3TMP B;  4DXA B;  2FUH B;  4F1S A;  1WZ0 A;  2D11 A;  3M3J A;  1WXM A;  4ANV A;  1WGD A;  3PRE A;  2WDT B;  2AL3 A;  4GDL B;  2KWC A;  3WIM A;  2UYZ B;  2N9P C;  2EMT A;  3JSV B;  3ALB A;  1A5R A;  4ANU A;  4LJP B;  2JVC A;  3ECI A;  1WYW B;  1OEY A;  4W9G A;  1RRB A;  3RCZ A;  2BYV E;  2LRW A;  4GU2 A;  3WAL A;  2D3G A;  2CS4 A;  4HJK A;  2DZM A;  2IO0 B;  2LXA A;  2NVU I;  4ZRJ A;  2AEH A;  3N32 A;  3UGB B;  4BKT A;  1GC6 A;  2K8C A;  3L08 A;  2ZEQ A;  4J6I A;  1UEL A;  1S1Q B;  5CTR C;  1BT0 A;  4I6L B;  3S2A A;  5D6J B;  1WGY A;  1V80 A;  1V86 A;  3NS8 A;  5L83 A;  2GBM A;  2DYM A;  2IO1 B;  2LWP A;  3JVZ X;  2RPQ A;  2UWQ A;  4RM8 A;  4MGZ E;  4I6N B;  4K7W A;  3ZTD A;  4KV2 A;  1E90 A;  2G4D B;  2ZVO A;  3V62 A;  2MBQ A;  1XD3 B;  4FN2 A;  1WXA A;  4DHZ E;  2FCM A;  4BKS D;  1RFA A;  4HPM B;  3APC A;  4KVG B;  5IAA C;  4NJ6 A;  4TQ1 A;  1Z5S B;  2M1M A;  3PGE A;  3CSF A;  4HDQ A;  3Q3J A;  2CHZ A;  4IM2 A;  3VUW A;  3PHW B;  5CX3 A;  1ZGU B;  1EUV B;  4FJY A;  2XK5 A;  4E74 A;  4F8C B;  3VXW A;  3AUL A;  1MG8 A;  2O6V D;  4PS8 A;  4IM0 A;  3ZKJ C;  2L7R A;  3M95 A;  4JQW C;  4CO7 A;  3ZW3 A;  1NBF C;  3A9J A;  1PQS A;  3PLV A;  1GJZ A;  3IBE A;  5J2R A;  3CF6 E;  2XK5 B;  4G3X B;  3EEC A;  2DEN B;  4NQK E;  1WJN A;  2AWT A;  3KUD B;  4IC7 B;  1IPG A;  4IG7 B;  1Y8R C;  3A1Q A;  2BWF A;  3V61 A;  1C3T A;  3RUL A;  3A9J B;  3ZUN A;  2K1F A;  3DVN V;  4BKG A;  5AZF A;  2NCN A;  4ZRI A;  4W9L A;  2J0K A;  4E3C A;  2Z0D B;  1LFD A;  2CU1 A;  2CHX A;  3V6E B;  4RMA A;  3VTV A;  3TL5 A;  3QA8 A;  2DAF A;  4M8M A;  4KZC A;  4WAA A;  3A1Q B;  2D07 B;  2NS5 A;  1WX8 A;  1V49 A;  1WRD B;  2A4Z A;  4W9J A;  4DDG D;  2IO2 B;  2NR2 A;  4AJY B;  3UQB A;  3KUC B;  2CKH B;  2KX3 A;  1P0R A;  2GBJ A;  2YVC A;  4PYZ A;  3PRZ A;  5LLI A;  2K39 A;  2KMC A;  2LGX A;  4GSW A;  2GBN A;  3BIN A;  4WWP A;  4DK5 A;  1WMH A;  3QHT A;  4GB9 A;  1KM7 A;  3DOW A;  1GUA B;  3JW0 X;  2KFK A;  2MA9 B;  4G11 A;  4BKS A;  2N7E A;  4HDO A;  5D2M B;  2Z59 B;  1E8Y A;  1WJU A;  2Z0E B;  4LJO B;  4MEL A;  2MP2 A;  1WI0 A;  1YIW A;  5J17 A;  3H7P A;  3H9D A;  1AAR A;  4BVU C;  4GIV A;  5D7G A;  1WMH B;  3W1S A;  4CYE A;  2QHO A;  4EZL A;  4EZJ A;  2JPH A;  4HPL B;  2KFK B;  1G6J A;  4W9D A;  2ZJD A;  4MGY E;  2BYE A;  3DBS A;  4NPN A;  2V1Y A;  4NQL B;  2MP2 B;  2O6V A;  4ANX A;  3R66 C;  3U8Z A;  2KKC A;  5DPS A;  4JL9 A;  3U7D A;  3H7P B;  2KJH B;  4KSK C;  1P1A A;  4FA6 A;  1E7V A;  3I3T B;  4CHK A;  4FUL A;  3ZVV A;  4IWP A;  3RD2 A;  4M0W B;  3VH3 B;  2O6V B;  5JZE B;  2LVP A;  2M0X A;  2MCN B;  3LDZ E;  2FIF A;  1OQY A;  2HE7 A;  2L05 A;  3B1L X;  3Q3F A;  3UF8 A;  3P2B A;  3KW5 B;  2KDI A;  3JYU A;  1EF5 A;  3VDZ A;  3ZNI D;  5KHQ A;  3B0A A;  4HVB A;  2K25 A;  2KDF B;  3DVG X;  2FCQ A;  3SU8 X;  3W1Y A;  3ZNG C;  5DPW A;  1GC7 A;  1YQB A;  2MSE D;  4K1R B;  3IHP C;  2J7Q B;  3R7R A;  2JXX A;  2KWV B;  1V6E A;  4AJW A;  2PEA A;  1WXS A;  3QAR A;  2B3A A;  4MH0 E;  3QIJ A;  4ICU A;  4KIK A;  3KYC D;  2W9N A;  2HTH A;  3B08 A;  1YJ1 A;  2L00 B;  1H4R A;  1GG3 A;  2LAS A;  4HK2 A;  2LI5 A;  3IVF A;  3CST A;  2KQS A;  4EOY A;  2BF8 B;  5L95 C;  2DZK A;  1R4N I;  3D32 A;  4NNJ B;  4ANW A;  4KIK B;  4W9E A;  4FHK A;  4MM3 A;  1E8W A;  3MTN B;  3NHE B;  2C5L C;  2KQ7 A;  1WF9 A;  4BOZ B;  1TTN A;  5CHV C;  3APD A;  3O65 B;  2BYF A;  5JHB A;  2C7H A;  1UBQ A;  1RLF A;  4YL8 A;  1L2N A;  3DDC B;  3HM6 X;  1TZ1 A;  2G4S A;  4IM3 A;  1NDD A;  2J0M A;  2KHW B;  3VQI A;  4BOS C;  1WX9 A;  4ZRK A;  3RZF A;  1WE7 A;  4EUT A;  4GDK A;  2LVO A;  2KC1 A;  4FLH A;  3UQA A;  1VCB A;  2KAN A;  3VUX A;  2FAZ A;  5LXI B;  2PE9 A;  1E8X A;  2GBK A;  4W9H A;  1P9D U;  2NBU A;  4G50 A;  2IBI B;  2L0F A;  2MBH A;  2N9E B;  2ZNV B;  2WYQ A;  3KVF B;  1HE8 A;  3PPA A;  2KN5 A;  2WX1 A;  4GDK B;  3ZNH B;  2LXC A;  4K7S A;  3DBR I;  4FJZ A;  2KO3 A;  4AWJ A;  4DWF A;  1J0G A;  3DCG A;  1LM8 B;  3PS6 A;  3DBL I;  4W9I A;  4DBG A;  3QAQ A;  2C9W B;  4W9F A;  3EFU A;  3AI5 A;  2LGD A;  2ASQ A;  4LCD E;  3L0W B;  1P98 A;  1OGW A;  2BWE S;  2KDE B;  2LGY A;  2M17 A;  2XBB C;  3VTW A;  3DPD A;  3R7Q A;  1WJ6 A;  3QX1 A;  4GN1 A;  1TBE A;  5BO4 B;  2KX0 A;  2MW5 A;  2GOW A;  1SE9 A;  3K9O B;  4B95 A;  4BFR A;  1OEY J;  1F9J A;  3V60 A;  3T9L A;  3KUZ A;  3AXC A;  4NJ7 A;  3TBL D;  4HCP B;  4JIO U;  4W9C A;  1OTR B;  3VTU A;  4AP4 C;  3TJP A;  2G3Q B;  2DZI A;  3VH4 B;  4TV3 A;  2KXJ A;  2PJH A;  1IP9 A;  3M62 B;  2KNB A;  3QQ8 B;  4GXB A;  4DDI D;  4HWI B;  1UGM A;  3KYD D;  1VD2 A;  1IYF A;  3RT3 B;  3TIX A;  2LZ6 A;  2EMS A;  2NBV B;  1Q0W B;  3PRP B;  4EFO A;  2K6D B;  4OVV A;  1I42 A;  4II2 B;  3ZO5 B;  1E7U A;  5E6O A;  1Q5W B;  4IUM B;  3VAW A;  2DAJ A;  2DHZ A;  3T8M A;  2KDB A;  4PS3 A;  2JZ3 B;  4GOC A;  2VRR B;  3A9K A;  5HKH A;  1UBI A;  2KLC A;  3AU4 A;  2L8J A;  3PLU A;  4XX5 A;  5TR5 A;  4WQO B;  1XQQ A;  3ZDM C;  1FXT B;  2KLG A;  2DYB A;  2PPH A;  2KOX A;  5DCN A;  1U4A A;  1ZW7 A;  1WM2 A;  3UIO B;  3WAM A;  1KOT A;  2LVQ A;  1WGH A;  3A9K B;  3ML9 A;  2CHW A;  1GNU A;  3UIP B;  5AZG A;  3RZW C;  3SDL C;  2KTR A;  2GBR A;  1ZKH A;  4OVU A;  2KVR A;  3K9P B;  3PSE B;  1Q1O A;  3A33 B;  3DVG Y;  3A4S C;  1V2Y A;  4II3 B;  4HXD A;  4MSM B;  4DHZ B;  2Y5B B;  1WH3 A;  2KTF A;  2JF5 A;  3IFW B;  4BBN C;  5LXH A;  4RM9 A;  2KTR B;  2WWZ A;  3OLM D;  4FJV B;  2ZZP B;  4XZ4 A;  5KHO A;  4IWO A;  2KZR A;  1WR6 E;  2GMI C;  2MLB A;  4GMV A;  1J19 A;  1X1M A;  1H8C A;  1QZE A;  2KJ6 A;  2MQJ A;  2IYD B;  2DYO A;  2KMA A;  3LJ3 A;  4MGK E;  4M8N A;  3APF A;  1C1Y B;  3ENE A;  1WE6 A;  2LD9 A;  5AZH A;  3DBH I;  3UIN B;  1LXD A;  2R2Q A;  5CHF A;  4K7U A;  4ASW C;  1CMX B;  4E71 A;  3NZS A;  1V9J A;  1NI2 A;  3QCA A;  2DX5 B;  4PYU A;  3EHV A;  4MJS A;  3QC8 B;  4NAW A;  3H6N A;  5C23 A;  4WWN A;  2FNJ B;  2IY0 B;  2L3Z A;  4HCN B;  4I6P A;  5E6N A;  3PV1 A;  3NZU A;  2KFJ A;  2RGF A;  5CHW A;  2JY6 A;  3L54 A;  3HM3 A;  1WY8 A;  2N1V A;  3RUI B;  3AU5 A;  3V6C B;  4XC2 A;  2M4N A;  2JZZ A;  3QWZ B;  1UH6 A;  4MJS B;  4K81 A;  4NAW B;  4B6W A;  4W9K A;  5IA7 A;  3MHS D;  4WWO A;  4F7Z A;  1YD8 U;  2JRI B;  2EKE C;  1SGH A;  2K6Q A;  1SIF A;  2DZJ A;  2FID A;  1JRU A;  2RD0 A;  4JGH B;  1E5W A;  3CMM B;  4GGQ A;  1S3S G;  2I1J A;  2KD0 A;  1UD7 A;  2NBW B;  3N30 A;  1V5T A;  3PTF C;  4HLE A;  2BPS A;  1YX5 B;  2ZPN A;  3R3M A;  5AEK B;  5DPR A;  2MWS B;  4MDK E;  4FHJ A; 
#chains in the Genus database with same CATH topology
 1SIJ A;  1T3Q A;  5TSS A;  1UZX B;  3ZIM A;  4EKU A;  1L7Y A;  1WR1 A;  1VZ7 A;  3X0W A;  1GOZ A;  4P7I A;  1J7A A;  4JX1 C;  1SSN A;  3NG0 A;  1N60 A;  5C1Z A;  5J18 A;  1N62 A;  2ZCB A;  2AYO B;  1WM3 A;  2DLB A;  2I38 A;  2SAK A;  3RYT A;  1DGJ A;  4C4V A;  3SD5 A;  4TQ0 A;  2MX2 A;  1QIL A;  1WIA A;  3ZRF A;  1TZO A;  3ETR A;  1IBX A;  3Q69 A;  1WZ3 A;  4ICV A;  3RFZ B;  4KKJ A;  3L17 A;  2M8S A;  2ZPY A;  3BVZ A;  2N7D A;  4IW0 A;  4MEM A;  2BW2 A;  2C60 A;  2OED A;  3PVL A;  3VHT C;  3A4R A;  3GE3 C;  1T5X D;  3WAP A;  2C7M B;  2QIE B;  3Q14 C;  5D94 A;  3IT4 B;  4WJO A;  3MJW A;  3HIZ A;  1R4M B;  4WJN A;  2VZK D;  3EC8 A;  2WXL A;  4OVZ A;  4DHJ D;  2O2V A;  5FR3 A;  3PZD A;  4IWQ A;  2WXM A;  2INC C;  4LK0 M;  1XF5 L;  1QF6 A;  3HHM A;  3WAN A;  3P4S B;  4FAD A;  4KDL B;  2JU6 X;  4HEA 1;  4ZDV A;  1TS3 A;  3TEX A;  5JHA A;  2M19 A;  3RPF C;  1V97 A;  3V3X A;  1V81 A;  4N59 A;  1ACC A;  3OJ4 B;  3M63 B;  1F2R C;  1K8R B;  1B1Z A;  1TKE A;  3WA0 A;  2H88 B;  1PGX A;  1WSP A;  2D11 A;  1D5Z C;  2WDT B;  3GP7 A;  2AL3 A;  4GDL B;  3WIM A;  2UYZ B;  3AM9 A;  5C3J B;  1A5R A;  1WYW B;  4ZHP A;  3P4P B;  3WAL A;  4XYC A;  2IO0 B;  3N20 C;  4LLG M;  4ZRJ A;  2AEH A;  3UGB B;  1GC6 A;  2N0S B;  4J6I A;  1UEL A;  1S1Q B;  5CTR C;  1WGY A;  1V86 A;  3JVZ X;  2RPQ A;  4MGZ E;  2HTM E;  4K7W A;  1E90 A;  2G4D B;  3V62 A;  1L4D B;  2VH1 A;  4DHZ E;  1VZ8 A;  1JQ4 A;  3Q2A C;  4A8X C;  1FCL A;  2PLP A;  2WXK A;  4HDQ A;  2CHZ A;  3WCQ A;  4IM2 A;  3VUW A;  4C7Y A;  5BMI A;  2OHF A;  2INN E;  4PS8 A;  3V05 A;  3M95 A;  2WXQ A;  3ZW3 A;  2ZW1 A;  3PLV A;  3IBE A;  1FNU A;  3EEC A;  4NQK E;  4RF0 A;  4S17 A;  1OQQ A;  2XNA C;  3V61 A;  3A9J B;  2K1F A;  1XCT L;  1N6Z A;  2IGH A;  4ZRI A;  3AMZ A;  3EFC A;  4E3C A;  1LFD A;  3TL5 A;  4WAA A;  3A1Q B;  1WX8 A;  2IO2 B;  4AJY B;  1A70 A;  3KUC B;  3PRZ A;  2D5G A;  2K39 A;  2WXO A;  4GSW A;  2ACZ B;  3N1Z C;  3DOW A;  4L2Y A;  2KFK A;  4BKS A;  2N7E A;  1XLO A;  1YJJ A;  3Q3N C;  4LJO B;  4M01 A;  3H7P A;  4BVU C;  2W55 A;  2BYT A;  2JSV X;  1WMH B;  4L23 A;  2JPH A;  4W9D A;  1ROE A;  2BYE A;  1JRO A;  2JXT A;  4ANX A;  5DPS A;  1P1A A;  4FA6 A;  4HJG E;  1MVK A;  3RD2 A;  4M0W B;  3NZ3 A;  2FUG 1;  3LDZ E;  2FIF A;  1OQY A;  3Q3F A;  3UF8 A;  3KW5 B;  3C8Y A;  3VDZ A;  5KHQ A;  2YEP B;  2KDF B;  3AE7 B;  1FFV A;  3AE4 B;  5FK9 C;  2WP9 B;  3FC4 A;  1GC7 A;  2MSE D;  1RWS A;  3RMK C;  1V6E A;  2LGI A;  1WXS A;  3QAR A;  1NVI D;  3BZD B;  4MH0 E;  3VR9 B;  3B08 A;  1VR9 A;  2LI5 A;  3CST A;  2BF8 B;  4JWU C;  4B0M A;  4KIK B;  4MM3 A;  2BTE A;  1E8W A;  2C5L C;  2KAJ A;  4LNO A;  3BWU D;  1YNT E;  1NDD A;  2J0M A;  2KHW B;  4BOS C;  4YXD B;  1WX9 A;  2QEJ C;  4EUT A;  1D6E C;  4GLS C;  5H8Y E;  4K3C A;  5I4D A;  3RNF C;  2WDV B;  3VUX A;  5AUI A;  1OQR A;  4W9H A;  1P9D U;  4G50 A;  2QDF A;  2IBI B;  2L0F A;  2N9E B;  4GDK B;  1YMH E;  3ZNH B;  2KN5 A;  4FJZ A;  4DWF A;  1J0G A;  3DCG A;  2ICI A;  3DBL I;  2C9W B;  1N5X A;  3Q8A A;  2ASQ A;  3L0W B;  2BWE S;  2KDE B;  3MC0 B;  3DPD A;  3QX1 A;  1TBE A;  4ZOH C;  3FKY A;  5IKC M;  1EWY C;  1DOY A;  1F52 A;  4NJ7 A;  2LHE A;  4N58 A;  1ZPS A;  4MT5 A;  4TV3 A;  2V3N A;  2QMT A;  3QQ8 B;  4GXB A;  1UGM A;  4WH4 A;  1SE4 A;  3BK1 A;  1VZ6 A;  1E7U A;  1Q5W B;  3VAW A;  2WXF A;  3HRD D;  3NJT A;  4PK1 A;  2BB6 A;  3U2S C;  4GOC A;  3A9K A;  3RNG C;  4DXG A;  3HVZ A;  2LJI A;  1XQQ A;  2DNF A;  3ZDM C;  4NJC A;  3URY A;  1ZW7 A;  4XWW A;  1WM2 A;  3WAM A;  1KOT A;  3E9S A;  5T8I A;  3MFG A;  3UIP B;  3RZW C;  3Q8C A;  5HFY A;  3R8B A;  1Q1O A;  3A33 B;  3DBH B;  4II3 B;  4HXD A;  4WIP A;  3NVY A;  5LXH A;  4IKG A;  2W82 A;  1XLP A;  2KZR A;  2GMI C;  2K22 A;  2MLB A;  3OWE B;  3LB8 C;  2MQJ A;  2IPK D;  1D4B A;  1CQV A;  2DYO A;  2IYD B;  2KMA A;  3AE2 B;  4M8N A;  1LGR A;  5AZH A;  1LXD A;  1YN5 A;  4K7U A;  3QC8 B;  2KVZ A;  3H6N A;  2V4I B;  1SF0 A;  2IY0 B;  4HCN B;  3PV1 A;  3Q8B A;  1JW9 D;  5CHW A;  3L54 A;  1WY8 A;  3RUI B;  3V6C B;  4XC2 A;  2JZZ A;  1N63 A;  1UH6 A;  1DYQ A;  4K81 A;  5IA7 A;  1TIF A;  1YD8 U;  2V3P A;  2JRI B;  3FIL B;  1SGH A;  1SIF A;  4JGH B;  2NBW B;  1YX5 B;  5AEK B;  1HTQ A;  4MAC A;  2WLB A;  2MBE A;  3OAW A;  3ML8 A;  3I5J C;  3W1S C;  1CK1 A;  2OOB B;  4C7Z A;  1KTK A;  4WJP A;  2WHI A;  4A3P A;  1I35 A;  4A90 A;  1E0Z A;  1UNS A;  2G45 B;  3X23 A;  2IGD A;  1XLN A;  3DQV A;  2FCS A;  2N9X A;  2KC2 A;  3Q6B A;  5FR6 A;  2K0P A;  2WX0 A;  3MP9 A;  3NY5 A;  2JT4 B;  3RNE C;  3GZN I;  2MBB B;  1SXT A;  3SHQ A;  3LXF A;  1XT9 B;  4TKN A;  2BKF A;  1TKY A;  2RPV A;  1OFF A;  2IO3 B;  2HJ8 A;  2PE6 B;  4AUQ C;  5BMH A;  2RR9 A;  3NVW A;  3ZQ4 A;  2MBO A;  4A3O A;  2IY1 B;  2CR5 A;  4N9F 4;  2LGS A;  1WGR A;  4EZK A;  2KJR A;  2KWU B;  5EDS A;  2JWZ A;  2OJR A;  2K8H A;  2Q5W D;  3N1Y C;  2K3U A;  1UGJ A;  2PTL A;  3ONS A;  4PS7 A;  4LNN A;  3IG3 A;  4BBN F;  1EF1 A;  1FNV A;  3NVZ A;  3IAS 1;  2N4F A;  4B9K A;  3DWM A;  3QJZ A;  4US9 A;  1T0R C;  4FBJ B;  2A5U A;  1Z2M A;  3MJ5 A;  4MGI E;  2CU3 A;  1M94 A;  1HTO A;  3DHH C;  3U52 E;  1NYQ A;  3VRB B;  5EE0 A;  1I7H A;  3L16 A;  2K8B A;  1TGZ B;  3RNA C;  1FPY A;  1I4R A;  2JUO A;  3N9Y C;  3ZLZ A;  3PT2 B;  3AE1 B;  2HD5 B;  1TS5 A;  3TEW A;  4GDL A;  4EEW A;  4OZC A;  1SJH D;  2FUH B;  5BMG A;  4TSS A;  1WXM A;  1MFW A;  1OEY A;  1F0Z A;  4W9G A;  1RRB A;  3RCZ A;  4GU2 A;  4HJK A;  2LXA A;  2NVU I;  1QOA A;  4BKT A;  1T0Q C;  2KYW A;  4I6L B;  3S2A A;  1XXG A;  4RH6 A;  3NS8 A;  5L83 A;  2IO1 B;  2DYM A;  2LWP A;  2DWQ A;  1MPE A;  2UWQ A;  1LO5 D;  4O1N A;  4KV2 A;  2G1E A;  1N5W A;  1XD3 B;  4FN2 A;  1FNW A;  4KVG B;  4NJ6 A;  1Z5S B;  4P1B C;  5CX3 A;  2Y5P A;  4E74 A;  4F8C B;  1MG8 A;  2O6V D;  2GI9 A;  3ZKJ C;  4M02 A;  2L7R A;  1QLB B;  4CO7 A;  3A9J A;  3NUH B;  2WDQ B;  1PQS A;  1GJZ A;  3CF6 E;  4K3B A;  2XK5 B;  2DEN B;  2AWT A;  4NAM A;  1IPG A;  3A1Q A;  2BWF A;  4BKG A;  5AZF A;  4W9L A;  1KRH A;  2Z0D B;  2CHX A;  4RMA A;  4M8M A;  2EEL A;  4KZC A;  1E6E B;  2X8X X;  2NS5 A;  1V49 A;  1WRD B;  2A4Z A;  3W2D A;  2CKH B;  1WRI A;  1WMH A;  3QHT A;  2MA9 B;  1TY2 A;  4G11 A;  1E8Y A;  4USA A;  1YIW A;  3Q8E A;  4EE2 A;  4ZYS A;  3IXS A;  5C2T B;  2ON8 A;  4TMA B;  4GIV A;  5D7G A;  4CYE A;  4MH8 A;  4EZL A;  4EZJ A;  1G6J A;  4M0W A;  4HPP A;  3DBS A;  4NPN A;  2V0G A;  1ZP0 B;  2V1Y A;  4RGM A;  2KKC A;  1ZDX A;  3U7D A;  2MJ3 A;  3KWV A;  2AX5 A;  4CHK A;  4Q2J A;  1PGB A;  3DWG C;  2O6V B;  2LVP A;  2L05 A;  2JYE A;  3P2B A;  4YWG G;  2KDI A;  3JYU A;  3B0A A;  2K25 A;  3DVG X;  3TUO A;  3SU8 X;  3W1Y A;  1C76 A;  1CZP A;  5DPW A;  2J7Q B;  1AWD A;  1P7F A;  2PEA A;  3VR8 B;  1BML C;  3B9J A;  2AQ3 B;  4KIK A;  1GG3 A;  2LAS A;  3H8H A;  1R4N I;  3AH7 A;  4FHK A;  3VRA B;  3MTN B;  2KQ7 A;  3ZJT A;  1WF9 A;  4BOZ B;  4A6Q A;  4ZRQ A;  2QCZ A;  5JHB A;  1UBQ A;  1QOB A;  3DHI C;  2G4S A;  1PDX A;  2ONQ A;  4ZRK A;  1WE7 A;  1IGD A;  4GDK A;  1C9F A;  2WXN A;  5JXV A;  2LVO A;  4YTN B;  4RF1 A;  1VCB A;  3HVD A;  5LXI B;  3KWL A;  1E8X A;  1YQ3 B;  5BYS A;  3UI3 A;  1HE8 A;  1SEB D;  4K7S A;  2MEK A;  2BS2 B;  4YT0 B;  3KLS X;  1C4C A;  2WU5 B;  3PS6 A;  4DBG A;  4W9F A;  3AI5 A;  1L0X B;  1OGW A;  4US8 A;  2M17 A;  3VTW A;  1GB1 A;  3P42 A;  1ZUD 2;  2KX0 A;  2W54 A;  2GOW A;  2RDG A;  1SE9 A;  1OEY J;  1F9J A;  2D3C A;  3T9L A;  1FRD A;  4JIO U;  4W9C A;  1OTR B;  2WXG A;  2DZI A;  1HQR D;  2PJH A;  4YTM B;  3PZ7 A;  4DDI D;  4QAY A;  1IYF A;  3RT3 B;  1YN3 A;  2EMS A;  2NBV B;  4XE0 A;  1I42 A;  4II2 B;  3NVV A;  1KF6 B;  1D5M C;  1ZDV A;  4DQO C;  1XCQ L;  4NZL B;  3W9C B;  3AU4 A;  1EU3 A;  2KLG A;  2PPH A;  2KOX A;  1V1P B;  2CJN A;  3UIO B;  4JE3 B;  5GXG B;  3ML9 A;  1GNU A;  2QC8 A;  2GBR A;  1ZKH A;  1V8C A;  1TKG A;  4MSM B;  2SEB D;  2PIA A;  2KTF A;  2PKO A;  3IFW B;  4RM9 A;  4XZ4 A;  4IWO A;  1JWM D;  5D3D A;  2IJ0 A;  4GMV A;  1X1M A;  2WDR B;  1J7B A;  3KQ4 A;  4JPS A;  3APF A;  2R2Q A;  1CMX B;  5LNK 1;  1V9J A;  1PGA A;  2DX5 B;  4WWN A;  1UF0 A;  4HKQ A;  4C00 A;  2HJ1 A;  2L3Z A;  2X38 A;  2MH7 A;  3NZU A;  2KFJ A;  2RGF A;  3FIL A;  2JY6 A;  3QWZ B;  3AB5 A;  4W9K A;  1ESF A;  3MHS D;  3DBR B;  2CJO A;  2K6Q A;  1JRU A;  1E5W A;  2I1J A;  4ZHO A;  3PTF C;  5DPR A;  4MDK E;  1I4X A;  2FE8 A;  3C0R B;  3W5V B;  4OW0 A;  3NRZ A;  3VVW B;  2LUE A;  1N61 A;  3PZ8 A;  1PUT A;  3ZJU A;  3VFK A;  2D3B A;  1VDV A;  3B2F A;  1E8Z A;  1P7E A;  3H7S A;  1FCC C;  4URK A;  3TCA A;  1M4V A;  5G2N A;  3KH0 A;  3PHX B;  3GB1 A;  3BK2 A;  4AOF A;  1DOX A;  3QK0 A;  1YOV B;  1K51 A;  2LHD A;  1SE2 A;  4LDT B;  1QT9 A;  2PVG C;  1LQB A;  5E6P A;  3RI7 C;  2IZV B;  3ZDT A;  2BT6 A;  1AW7 A;  1I4H A;  3NOB A;  3ZTC A;  4MSQ B;  1T0Y A;  1YX6 B;  2G9H D;  2BQQ A;  3AEE B;  2J52 A;  1NI3 A;  3I9V 1;  2AQ1 B;  1FXI A;  3VUY A;  1P3Q U;  2L76 A;  3U7Z A;  1HA5 A;  1QOF A;  1TJE A;  2MJD A;  2RMM A;  3AN1 A;  4AQ7 A;  4JLC A;  2MRP A;  4ZYN A;  2LFI A;  1KLU D;  2YLM A;  2NPT B;  5JH5 C;  2WXR A;  3N3K B;  4KDI C;  1RAX A;  1V5O A;  3L13 A;  1C77 A;  4WJQ A;  2AQ2 B;  2AL6 A;  3ZRC A;  1HEZ E;  2JRH A;  1MG4 A;  3BY4 B;  2ZVN A;  2I1K A;  1GB4 A;  5G55 A;  1L4Z B;  4DXA B;  4F1S A;  1WZ0 A;  4DXF A;  1FRR A;  4ARC A;  2EMT A;  3JSV B;  3ALB A;  4ANU A;  4HRO A;  4LJP B;  2JQR B;  1L0Y B;  3MC9 A;  2LRW A;  2D3G A;  2DZM A;  3N32 A;  2LMC A;  4YTP B;  2ZEQ A;  1SB3 C;  2D3A A;  1K50 A;  2K9X A;  1V80 A;  2IND C;  1SJE D;  2GBM A;  2MJE A;  4RM8 A;  4I6N B;  4RGN A;  2YEP F;  3AEC B;  4D2K A;  2MBQ A;  2FCM A;  4HPM B;  3TSS A;  5MPO A;  2WGS A;  2M1M A;  3PGE A;  1EUV B;  4FJY A;  2XK5 A;  3VXW A;  1EWC A;  3AUL A;  4IM0 A;  4JQW C;  4RFB A;  1NBF C;  1FD6 A;  2J4X A;  4G3X B;  3BYY B;  1T0S C;  2FBW B;  3KUD B;  5G5G A;  1Y8R C;  1C3T A;  3RUL A;  3ZUN A;  1IGC A;  1KLG D;  2J0K A;  2CU1 A;  3ZXV A;  3VTV A;  4C80 A;  3QA8 A;  2DAF A;  2D07 B;  4W9J A;  4DDG D;  2WNM A;  4JWS C;  2BB5 A;  2KX3 A;  2YVC A;  1P0R A;  1VLB A;  4PYZ A;  3P4R B;  2KMC A;  2LGX A;  2GBN A;  3AE9 B;  4GB9 A;  1GUA B;  3JW0 X;  5D2M B;  2Z59 B;  4MEL A;  5AUK A;  5J17 A;  1AAR A;  1F2R I;  2IGG A;  2GB1 A;  3BII D;  3W1S A;  2QHO A;  2JZP A;  2ZJD A;  4LNI A;  4NQL B;  2MP2 B;  2O6V A;  3R66 C;  3RNB C;  1E7V A;  3I3T B;  4FUL A;  1NEK B;  1XEE A;  3GS2 A;  3E56 A;  4OZB A;  4N6E B;  3EUB 2;  4WAF A;  2Y3A A;  3ZNI D;  3C19 A;  4HVB A;  2FCQ A;  2WU2 B;  3IT6 B;  3J9C A;  5EE3 A;  3R7R A;  3IHP C;  2KWV B;  4L1B A;  3P63 A;  2B3A A;  3QIJ A;  4ICU A;  2LEK A;  2HTH A;  4CQN A;  1YJ1 A;  4M00 A;  4HK2 A;  3IVF A;  5FKA C;  2KQS A;  2DZK A;  4NNJ B;  4ANW A;  4W9E A;  3AE5 B;  1VJK A;  3P4Q B;  4HKZ E;  3APD A;  3O65 B;  2BYF A;  1C4A A;  2JWU A;  4YL8 A;  1L2N A;  3DDC B;  1F77 A;  1TZ1 A;  4IM3 A;  4OZA A;  5IOI A;  2KC1 A;  3UQA A;  2KAN A;  2FAZ A;  2PE9 A;  1K52 A;  4IDI A;  5IO9 A;  2NBU A;  5C23 A;  2MBH A;  3PPA A;  3KVF B;  2WX1 A;  2LXC A;  1AYF A;  3ZJV A;  2KO3 A;  4AWJ A;  1LM8 B;  4W9I A;  2WXJ A;  1I4P A;  1E7P B;  2LGD A;  2L83 A;  1WJ6 A;  5BO4 B;  2MW5 A;  4R3D A;  4B95 A;  4BFR A;  2N9L A;  3ABV B;  3TBL D;  4AP4 C;  3TJP A;  2UU7 A;  2KXJ A;  2Z8L A;  3M62 B;  2KNB A;  4HWI B;  4H2A A;  3KYD D;  1VD2 A;  2LZ6 A;  4KGR A;  4KGT A;  3PRP B;  4EFO A;  2WS3 B;  4IUM B;  2WXI A;  2DHZ A;  1JCK B;  1V1P A;  1HZ5 A;  3BVM A;  3B2G A;  4XX5 A;  5TR5 A;  2QIL A;  3AEB B;  5D3I B;  1VRA B;  5DCN A;  4S0R A;  2KMM A;  1C78 A;  2CHW A;  1MHX A;  1IUE A;  2PVO D;  2DBY A;  4B0E A;  3PSE B;  3K9P B;  3DVG Y;  3A4S C;  1L6U A;  1FFU A;  1KH0 A;  2Y5B B;  1WH3 A;  3Q8F A;  1MHH E;  4BBN C;  1YN4 A;  2GLS A;  2KTR B;  3OLM D;  1I4Q A;  2RDB C;  1J19 A;  1H8C A;  1Q10 A;  1QZE A;  3LJ3 A;  4XWT A;  1HZ6 A;  1C1Y B;  2LD9 A;  5CHF A;  4ASW C;  1GPX A;  1NI2 A;  3QCA A;  1ET6 A;  4PYU A;  2VH2 A;  3EHV A;  2L52 A;  2PW9 A;  1RYJ A;  1L6V A;  4I6P A;  4IOI E;  3HM3 A;  2N1V A;  3AU5 A;  3W5U B;  4MJS B;  4NAW B;  1WWT A;  4F7Z A;  2FID A;  2RD0 A;  3FAH A;  4GGQ A;  4HLE A;  3DBL B;  2BPS A;  1EM7 A;  2ZPN A;  3R3M A;  4XDC A;  3BYT B;  1SBB B;  4FHJ A;  2VZK B;  2LJ5 A;  4DHJ B;  1YJI A;  3EGR A;  2C7N B;  3HK0 A;  1WXV A;  1I4G A;  2W3S A;  2REX A;  3BVG A;  2ZW0 A;  3P1M A;  3SEB A;  2R2O A;  3GOE A;  1K53 A;  1TS2 A;  2LRU A;  2KK8 A;  3WAO A;  3DVN U;  4A20 A;  2BGF A;  2ZCC A;  3NS1 A;  3AED B;  4UDU C;  1RM6 C;  4FXC A;  3RN9 C;  1KJT A;  2N1W A;  2BVC A;  1C79 A;  5EE1 A;  1EO6 A;  5DPT A;  4G0N B;  5GMV A;  1JAL A;  4BAX A;  3AEG B;  2K5P A;  4C4V B;  2BKR B;  3TEY A;  1WFY A;  1WGG A;  1NYR A;  3O13 A;  1IBX B;  1WX7 A;  1BXT A;  3U30 A;  2D2Q A;  3ZNZ B;  5G5H A;  4X57 B;  2QSD A;  1B9R A;  2HDE A;  2L1A A;  1QKZ A;  3ZYY X;  1ISN A;  3PRM B;  2FCN A;  1J7C A;  4KSL C;  4RGT A;  2NPT A;  4XDD A;  2L0T A;  1WJ4 A;  3L10 B;  2V3S A;  2ZNV C;  4KZ0 A;  4REZ A;  2TSS A;  1KLV A;  2D10 A;  1FM0 D;  2O2V B;  1R4M I;  2EKI A;  4TUU A;  3H1U A;  2J0J A;  2V4L A;  3OJ3 A;  4NY0 A;  4YSX B;  2XEW A;  4C56 C;  4P6V F;  4LTU A;  4LDT D;  1D3Z A;  2RSU A;  1DOI A;  3JSV A;  4J3O D;  1J8C A;  3L4P A;  3TMP B;  3IAM 1;  1ZOY B;  1MJD A;  1UWX A;  3M3J A;  4ANV A;  2I2Y A;  1WGD A;  2N7J A;  3PRE A;  2KWC A;  2N9P C;  4KX6 B;  1L5P A;  2JVC A;  3ECI A;  3I57 A;  3AE3 B;  5H92 C;  2BYV E;  4LNF A;  4RNA A;  2CS4 A;  2K8C A;  3L08 A;  3AEA B;  3T3O A;  1BT0 A;  5D6J B;  2KN4 A;  2LUM A;  3SFE B;  4PT5 A;  3ZTD A;  2ZVO A;  3GZN B;  3ZGZ A;  4ITK A;  1WXA A;  4BKS D;  2KT7 A;  1RFA A;  3APC A;  4KKI A;  1V1O A;  5IAA C;  4TQ1 A;  4ARI A;  2E3T A;  3T3N A;  3CSF A;  3Q3J A;  3PHW B;  1ZGU B;  1HXY D;  1PFD A;  5E6J A;  1JWU D;  1FXA A;  2KWD A;  3PO0 A;  1FMA D;  5J2R A;  1WGK A;  2OJW A;  1E10 A;  1WJN A;  4IC7 B;  4IG7 B;  1XO3 A;  2NMQ A;  3DVN V;  2KQ4 X;  2NCN A;  3ZXR A;  2JYT A;  3V6E B;  5BYR A;  1RFK A;  1JWS D;  2MHJ A;  3DHG C;  4HRS A;  2NR2 A;  4A55 A;  3UQB A;  4P1C C;  2GBJ A;  5LLI A;  1STE A;  4DK5 A;  3BIN A;  4WWP A;  4AS1 A;  1KM7 A;  3SR6 A;  4HDO A;  1WJU A;  2Z0E B;  2MP2 A;  1WI0 A;  1CJE A;  3H9D A;  4BZA A;  1QOG A;  4HPL B;  2KFK B;  4MGY E;  1MI0 A;  3U8Z A;  4JL9 A;  2R61 A;  3H7P B;  2KJH B;  4KSK C;  1FEH A;  1NEN B;  1R7S A;  3CWI A;  3ZVV A;  4IWP A;  2E6X A;  3VH3 B;  5JZE B;  4OHJ A;  2MCN B;  1YQ4 B;  2INP E;  2M0X A;  3MHZ A;  2HE7 A;  3B1L X;  1EF5 A;  1UUP A;  3Q3O C;  1WYG A;  2J42 A;  1D5X C;  3GE8 C;  3ZNG C;  1YQB A;  4K1R B;  1L0V B;  2JXX A;  4AJW A;  2BS4 B;  4ACF A;  2V9H A;  2GRI A;  2M56 B;  4RGO S;  3N1X C;  3KYC D;  2W9N A;  2Y5C A;  2WQY B;  2L00 B;  1H4R A;  3MC8 A;  1E9M A;  4EOY A;  5L95 C;  4WUR A;  3D32 A;  4YSZ B;  1SE3 A;  1TY0 A;  1ET9 A;  1WXQ A;  1EU4 A;  1Y56 A;  3NHE B;  3AE6 B;  5HG2 A;  1TTN A;  5CHV C;  2C7H A;  3U4E G;  1RLF A;  3AEF B;  1FO4 A;  4MM3 B;  3HM6 X;  2PMV A;  3VQI A;  1UWM A;  3RZF A;  1TS4 A;  5IN7 A;  4FLH A;  3SFD B;  3EA6 A;  1ENF A;  2GBK A;  4P16 A;  2ZNV B;  2WYQ A;  2KAC A;  1C4P A;  2RDH A;  3DBR I;  4WWM A;  1T6B X;  2NTT A;  2L32 A;  3CIR B;  3R2I A;  3I63 C;  4A9A A;  3QAQ A;  3EFU A;  5IP4 D;  4LCD E;  1P98 A;  2LGY A;  2XBB C;  3R7Q A;  4GN1 A;  3K9O B;  5BYQ A;  3V60 A;  2N9K A;  3KUZ A;  2B76 B;  3AXC A;  3VTU A;  4HCP B;  2G3Q B;  3VH4 B;  3Q3M C;  3R2T A;  1IP9 A;  1JWA D;  1QQR A;  1TYG B;  2JX5 A;  3RNC C;  3TIX A;  1JWB D;  1Q0W B;  1BUI C;  2K6D B;  4OVV A;  4XGA B;  3ZO5 B;  5E6O A;  2W3R A;  1KFY B;  2DAJ A;  3T8M A;  4WQM A;  2KDB A;  2H89 B;  4PS3 A;  2JZ3 B;  4ZRP A;  2VRR B;  5HKH A;  1UBI A;  2KLC A;  2L8J A;  3PLU A;  4WQO B;  1FIQ A;  1FXT B;  2DYB A;  2BBC A;  1U4A A;  2J53 A;  1F1H A;  1WGH A;  2LVQ A;  3A9K B;  5AZG A;  3SDL C;  2KTR A;  5HHD G;  4OVU A;  2KVR A;  1JML A;  1V2Y A;  1ZXH A;  4KGS A;  2NTS A;  1JRP A;  4DHZ B;  1R4N B;  2JF5 A;  2XN9 C;  2WWZ A;  4FJV B;  2ZZP B;  3OG5 A;  5KHO A;  1WR6 E;  1ZXI A;  2KDM A;  1AN8 A;  2KJ6 A;  2QJL A;  4MGK E;  1GAQ B;  4RCO A;  1ZE3 D;  3ENE A;  1WE6 A;  2M0A A;  3DBH I;  3UIN B;  4E71 A;  3NZS A;  3LYY A;  4MJS A;  4NAW A;  3AV8 A;  2FNJ B;  5E6N A;  5EE9 A;  4LNK A;  2M4N A;  2WXP A;  4B6W A;  5HI1 A;  4WWO A;  1PYW D;  2EKE C;  2DZJ A;  2WXH A;  4YSY B;  3CMM B;  1S3S G;  2KD0 A;  1UD7 A;  3N30 A;  1V5T A;  3HUI A;  1XLQ A;  3AE8 B;  2MWS B;  2BS3 B;  2IDY A;  1TT5 B;  3TEZ A; 
#chains in the Genus database with same CATH homology
 2LJ5 A;  3C0R B;  2MBE A;  3OAW A;  4DHJ B;  1UZX B;  3ML8 A;  3ZIM A;  4EKU A;  3W1S C;  1L7Y A;  2C7N B;  1WR1 A;  3HK0 A;  1WXV A;  2OOB B;  3VVW B;  2LUE A;  2REX A;  4WJP A;  3X0W A;  2R2O A;  3VFK A;  3GOE A;  4P7I A;  1E8Z A;  4A3P A;  1I35 A;  2G45 B;  2LRU A;  3X23 A;  2KK8 A;  3WAO A;  3DVN U;  3H7S A;  5C1Z A;  4URK A;  3TCA A;  4A20 A;  5J18 A;  5G2N A;  2ZCB A;  3KH0 A;  3PHX B;  2AYO B;  1WM3 A;  2BGF A;  2FCS A;  2N9X A;  2ZCC A;  2KC2 A;  3DQV A;  4AOF A;  5FR6 A;  3QK0 A;  2WX0 A;  3NY5 A;  3RYT A;  2JT4 B;  3GZN I;  2MBB B;  4A3O A;  1KJT A;  3SD5 A;  2N1W A;  2MX2 A;  4TQ0 A;  1WIA A;  4LDT B;  3ZRF A;  3SHQ A;  1LQB A;  5E6P A;  1EO6 A;  1XT9 B;  4TKN A;  4G0N B;  5DPT A;  2BKF A;  1WZ3 A;  5GMV A;  2IZV B;  4ICV A;  3ZDT A;  2IO3 B;  2HJ8 A;  2PE6 B;  4AUQ C;  2BKR B;  2RR9 A;  3NOB A;  3L17 A;  2M8S A;  1WFY A;  2MBO A;  2ZPY A;  4MSQ B;  1T0Y A;  3ZTC A;  1WGG A;  2N7D A;  4IW0 A;  4MEM A;  1YX6 B;  2IY1 B;  2CR5 A;  2C60 A;  1WX7 A;  3PVL A;  3VHT C;  3A4R A;  4N9F 4;  3U30 A;  2D2Q A;  1WGR A;  4EZK A;  3ZNZ B;  2KJR A;  3WAP A;  2C7M B;  2KWU B;  4X57 B;  5D94 A;  3VUY A;  2JWZ A;  4WJO A;  5EDS A;  3MJW A;  2OJR A;  1P3Q U;  2K8H A;  3HIZ A;  4WJN A;  2L76 A;  3EC8 A;  1ISN A;  3ONS A;  3PRM B;  2FCN A;  4PS7 A;  4DHJ D;  4KSL C;  2NPT A;  4JLC A;  2O2V A;  2L0T A;  1WJ4 A;  3IG3 A;  4BBN F;  3L10 B;  2MRP A;  4ZYN A;  1EF1 A;  3PZD A;  2V3S A;  2ZNV C;  4IWQ A;  2N4F A;  4KZ0 A;  3HHM A;  4B9K A;  3QJZ A;  2YLM A;  4FBJ B;  2A5U A;  1Z2M A;  4MGI E;  1KLV A;  2D10 A;  2NPT B;  3WAN A;  4FAD A;  1M94 A;  5JH5 C;  2O2V B;  1R4M I;  4KDL B;  4TUU A;  3H1U A;  3L16 A;  3N3K B;  4ZDV A;  2K8B A;  4KDI C;  2J0J A;  2V4L A;  1RAX A;  1TGZ B;  5JHA A;  1V5O A;  3L13 A;  3OJ3 A;  4NY0 A;  2JUO A;  2XEW A;  3ZLZ A;  3PT2 B;  4WJQ A;  2AL6 A;  3ZRC A;  1V81 A;  2JRH A;  3BY4 B;  2HD5 B;  2ZVN A;  3OJ4 B;  2I1K A;  3M63 B;  4LDT D;  1D3Z A;  2RSU A;  4GDL A;  4EEW A;  1K8R B;  3JSV A;  5G55 A;  3WA0 A;  1J8C A;  3TMP B;  4DXA B;  2FUH B;  4F1S A;  1WZ0 A;  2D11 A;  3M3J A;  1WXM A;  4ANV A;  1WGD A;  3PRE A;  2WDT B;  2AL3 A;  4GDL B;  2KWC A;  3WIM A;  2UYZ B;  2N9P C;  2EMT A;  3JSV B;  3ALB A;  1A5R A;  4ANU A;  4LJP B;  2JVC A;  3ECI A;  1WYW B;  1OEY A;  4W9G A;  1RRB A;  3RCZ A;  2BYV E;  2LRW A;  4GU2 A;  3WAL A;  2D3G A;  2CS4 A;  4HJK A;  2DZM A;  2IO0 B;  2LXA A;  2NVU I;  4ZRJ A;  2AEH A;  3N32 A;  3UGB B;  4BKT A;  1GC6 A;  2K8C A;  3L08 A;  2ZEQ A;  4J6I A;  1UEL A;  1S1Q B;  5CTR C;  1BT0 A;  4I6L B;  3S2A A;  5D6J B;  1WGY A;  1V80 A;  1V86 A;  3NS8 A;  5L83 A;  2GBM A;  2DYM A;  2IO1 B;  2LWP A;  3JVZ X;  2RPQ A;  2UWQ A;  4RM8 A;  4MGZ E;  4I6N B;  4K7W A;  3ZTD A;  4KV2 A;  1E90 A;  2G4D B;  2ZVO A;  3V62 A;  2MBQ A;  1XD3 B;  4FN2 A;  1WXA A;  4DHZ E;  2FCM A;  4BKS D;  1RFA A;  4HPM B;  3APC A;  4KVG B;  5IAA C;  4NJ6 A;  4TQ1 A;  1Z5S B;  2M1M A;  3PGE A;  3CSF A;  4HDQ A;  3Q3J A;  2CHZ A;  4IM2 A;  3VUW A;  3PHW B;  5CX3 A;  1ZGU B;  1EUV B;  4FJY A;  2XK5 A;  4E74 A;  4F8C B;  3VXW A;  3AUL A;  1MG8 A;  2O6V D;  4PS8 A;  4IM0 A;  3ZKJ C;  2L7R A;  3M95 A;  4JQW C;  4CO7 A;  3ZW3 A;  1NBF C;  3A9J A;  1PQS A;  3PLV A;  1GJZ A;  3IBE A;  5J2R A;  3CF6 E;  2XK5 B;  4G3X B;  3EEC A;  2DEN B;  4NQK E;  1WJN A;  2AWT A;  3KUD B;  4IC7 B;  1IPG A;  4IG7 B;  1Y8R C;  3A1Q A;  2BWF A;  3V61 A;  1C3T A;  3RUL A;  3A9J B;  3ZUN A;  2K1F A;  3DVN V;  4BKG A;  5AZF A;  2NCN A;  4ZRI A;  4W9L A;  2J0K A;  4E3C A;  2Z0D B;  1LFD A;  2CU1 A;  2CHX A;  3V6E B;  4RMA A;  3VTV A;  3TL5 A;  3QA8 A;  2DAF A;  4M8M A;  4KZC A;  4WAA A;  3A1Q B;  2D07 B;  2NS5 A;  1WX8 A;  1V49 A;  1WRD B;  2A4Z A;  4W9J A;  4DDG D;  2IO2 B;  2NR2 A;  4AJY B;  3UQB A;  3KUC B;  2CKH B;  2KX3 A;  1P0R A;  2GBJ A;  2YVC A;  4PYZ A;  3PRZ A;  5LLI A;  2K39 A;  2KMC A;  2LGX A;  4GSW A;  2GBN A;  3BIN A;  4WWP A;  4DK5 A;  1WMH A;  3QHT A;  4GB9 A;  1KM7 A;  3DOW A;  1GUA B;  3JW0 X;  2KFK A;  2MA9 B;  4G11 A;  4BKS A;  2N7E A;  4HDO A;  5D2M B;  2Z59 B;  1E8Y A;  1WJU A;  2Z0E B;  4LJO B;  4MEL A;  2MP2 A;  1WI0 A;  1YIW A;  5J17 A;  3H7P A;  3H9D A;  1AAR A;  4BVU C;  4GIV A;  5D7G A;  1WMH B;  3W1S A;  4CYE A;  2QHO A;  4EZL A;  4EZJ A;  2JPH A;  4HPL B;  2KFK B;  1G6J A;  4W9D A;  2ZJD A;  4MGY E;  2BYE A;  3DBS A;  4NPN A;  2V1Y A;  4NQL B;  2MP2 B;  2O6V A;  4ANX A;  3R66 C;  3U8Z A;  2KKC A;  5DPS A;  4JL9 A;  3U7D A;  3H7P B;  2KJH B;  4KSK C;  1P1A A;  4FA6 A;  1E7V A;  3I3T B;  4CHK A;  4FUL A;  3ZVV A;  4IWP A;  3RD2 A;  4M0W B;  3VH3 B;  2O6V B;  5JZE B;  2LVP A;  2M0X A;  2MCN B;  3LDZ E;  2FIF A;  1OQY A;  2HE7 A;  2L05 A;  3B1L X;  3Q3F A;  3UF8 A;  3P2B A;  3KW5 B;  2KDI A;  3JYU A;  1EF5 A;  3VDZ A;  3ZNI D;  5KHQ A;  3B0A A;  4HVB A;  2K25 A;  2KDF B;  3DVG X;  2FCQ A;  3SU8 X;  3W1Y A;  3ZNG C;  5DPW A;  1GC7 A;  1YQB A;  2MSE D;  4K1R B;  3IHP C;  2J7Q B;  3R7R A;  2JXX A;  2KWV B;  1V6E A;  4AJW A;  2PEA A;  1WXS A;  3QAR A;  2B3A A;  4MH0 E;  3QIJ A;  4ICU A;  4KIK A;  3KYC D;  2W9N A;  2HTH A;  3B08 A;  1YJ1 A;  2L00 B;  1H4R A;  1GG3 A;  2LAS A;  4HK2 A;  2LI5 A;  3IVF A;  3CST A;  2KQS A;  4EOY A;  2BF8 B;  5L95 C;  2DZK A;  1R4N I;  3D32 A;  4NNJ B;  4ANW A;  4KIK B;  4W9E A;  4FHK A;  4MM3 A;  1E8W A;  3MTN B;  3NHE B;  2C5L C;  2KQ7 A;  1WF9 A;  4BOZ B;  1TTN A;  5CHV C;  3APD A;  3O65 B;  2BYF A;  5JHB A;  2C7H A;  1UBQ A;  1RLF A;  4YL8 A;  1L2N A;  3DDC B;  3HM6 X;  1TZ1 A;  2G4S A;  4IM3 A;  1NDD A;  2J0M A;  2KHW B;  3VQI A;  4BOS C;  1WX9 A;  4ZRK A;  3RZF A;  1WE7 A;  4EUT A;  4GDK A;  2LVO A;  2KC1 A;  4FLH A;  3UQA A;  1VCB A;  2KAN A;  3VUX A;  2FAZ A;  5LXI B;  2PE9 A;  1E8X A;  2GBK A;  4W9H A;  1P9D U;  2NBU A;  4G50 A;  2IBI B;  2L0F A;  2MBH A;  2N9E B;  2ZNV B;  2WYQ A;  3KVF B;  1HE8 A;  3PPA A;  2KN5 A;  2WX1 A;  4GDK B;  3ZNH B;  2LXC A;  4K7S A;  3DBR I;  4FJZ A;  2KO3 A;  4AWJ A;  4DWF A;  1J0G A;  3DCG A;  1LM8 B;  3PS6 A;  3DBL I;  4W9I A;  4DBG A;  3QAQ A;  2C9W B;  4W9F A;  3EFU A;  3AI5 A;  2LGD A;  2ASQ A;  4LCD E;  3L0W B;  1P98 A;  1OGW A;  2BWE S;  2KDE B;  2LGY A;  2M17 A;  2XBB C;  3VTW A;  3DPD A;  3R7Q A;  1WJ6 A;  3QX1 A;  4GN1 A;  1TBE A;  5BO4 B;  2KX0 A;  2MW5 A;  2GOW A;  1SE9 A;  3K9O B;  4B95 A;  4BFR A;  1OEY J;  1F9J A;  3V60 A;  3T9L A;  3KUZ A;  3AXC A;  4NJ7 A;  3TBL D;  4HCP B;  4JIO U;  4W9C A;  1OTR B;  3VTU A;  4AP4 C;  3TJP A;  2G3Q B;  2DZI A;  3VH4 B;  4TV3 A;  2KXJ A;  2PJH A;  1IP9 A;  3M62 B;  2KNB A;  3QQ8 B;  4GXB A;  4DDI D;  4HWI B;  1UGM A;  3KYD D;  1VD2 A;  1IYF A;  3RT3 B;  3TIX A;  2LZ6 A;  2EMS A;  2NBV B;  1Q0W B;  3PRP B;  4EFO A;  2K6D B;  4OVV A;  1I42 A;  4II2 B;  3ZO5 B;  1E7U A;  5E6O A;  1Q5W B;  4IUM B;  3VAW A;  2DAJ A;  2DHZ A;  3T8M A;  2KDB A;  4PS3 A;  2JZ3 B;  4GOC A;  2VRR B;  3A9K A;  5HKH A;  1UBI A;  2KLC A;  3AU4 A;  2L8J A;  3PLU A;  4XX5 A;  5TR5 A;  4WQO B;  1XQQ A;  3ZDM C;  1FXT B;  2KLG A;  2DYB A;  2PPH A;  2KOX A;  5DCN A;  1U4A A;  1ZW7 A;  1WM2 A;  3UIO B;  3WAM A;  1KOT A;  2LVQ A;  1WGH A;  3A9K B;  3ML9 A;  2CHW A;  1GNU A;  3UIP B;  5AZG A;  3RZW C;  3SDL C;  2KTR A;  2GBR A;  1ZKH A;  4OVU A;  2KVR A;  3K9P B;  3PSE B;  1Q1O A;  3A33 B;  3DVG Y;  3A4S C;  1V2Y A;  4II3 B;  4HXD A;  4MSM B;  4DHZ B;  2Y5B B;  1WH3 A;  2KTF A;  2JF5 A;  3IFW B;  4BBN C;  5LXH A;  4RM9 A;  2KTR B;  2WWZ A;  3OLM D;  4FJV B;  2ZZP B;  4XZ4 A;  5KHO A;  4IWO A;  2KZR A;  1WR6 E;  2GMI C;  2MLB A;  4GMV A;  1J19 A;  1X1M A;  1H8C A;  1QZE A;  2KJ6 A;  2MQJ A;  2IYD B;  2DYO A;  2KMA A;  3LJ3 A;  4MGK E;  4M8N A;  3APF A;  1C1Y B;  3ENE A;  1WE6 A;  2LD9 A;  5AZH A;  3DBH I;  3UIN B;  1LXD A;  2R2Q A;  5CHF A;  4K7U A;  4ASW C;  1CMX B;  4E71 A;  3NZS A;  1V9J A;  1NI2 A;  3QCA A;  2DX5 B;  4PYU A;  3EHV A;  4MJS A;  3QC8 B;  4NAW A;  3H6N A;  5C23 A;  4WWN A;  2FNJ B;  2IY0 B;  2L3Z A;  4HCN B;  4I6P A;  5E6N A;  3PV1 A;  3NZU A;  2KFJ A;  2RGF A;  5CHW A;  2JY6 A;  3L54 A;  3HM3 A;  1WY8 A;  2N1V A;  3RUI B;  3AU5 A;  3V6C B;  4XC2 A;  2M4N A;  2JZZ A;  3QWZ B;  1UH6 A;  4MJS B;  4K81 A;  4NAW B;  4B6W A;  4W9K A;  5IA7 A;  3MHS D;  4WWO A;  4F7Z A;  1YD8 U;  2JRI B;  2EKE C;  1SGH A;  2K6Q A;  1SIF A;  2DZJ A;  2FID A;  1JRU A;  2RD0 A;  4JGH B;  1E5W A;  3CMM B;  4GGQ A;  1S3S G;  2I1J A;  2KD0 A;  1UD7 A;  2NBW B;  3N30 A;  1V5T A;  3PTF C;  4HLE A;  2BPS A;  1YX5 B;  2ZPN A;  3R3M A;  5AEK B;  5DPR A;  2MWS B;  4MDK E;  4FHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...