4A20A

Crystal structure of the ubl domain of mdy2 (get5) at 1.78a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
AAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords UBIQUITIN-LIKE PROTEIN MDY2
publication title Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a20A00
2V1YA 4XZ4A 2O2VB 3Q3JA 3DPDA 2YLMA 4NY0A 3NOBA 2RSUA 1XD3B 2J0JA 4MSMB 2IZVB 4NNJB 3VDZA 1P3QU 2GMIC 1E5WA 3A9KB 2NPTB 2CU1A 2KWUB 4KIKA 2ZCBA 3V6EB 3SD5A 2KXJA 3R7RA 2NBVB 3MJWA 2LD9A 4RM8A 2MP2B 4BKSD 1E90A 3ZKJC 3TMPB 3R3MA 2KFKB 1RRBA 3H6NA 2M8SA 2BYFA 2IY0B 4I6NB 1YX5B 4EFOA 2WX1A 2FUHB 3R66C 3T8MA 4JLCA 5LLIA 3PVLA 3ZVVA 5DPTA 1WMHB 2ZVNA 4YL8A 2GBKA 3VTUA 4EKUA 1H8CA 2KNBA 4NJ6A 2L05A 3AULA 1CMXB 2D11A 2ASQA 2RD0A 3KUDB 2K8BA 4MDKE 3ONSA 4II2B 2MBOA 3KYDD 5CHVC 3P2BA 1UBIA 2ZCCA 4G3XB 1F9JA 1HE8A 3A4RA 4ANWA 2PE6B 1E8YA 3K9OB 4BBNF 1KM7A 4DK5A 2V4LA 3ZNGC 2JZ3B 4I6PA 1RAXA 2ZNVB 4A3OA 3VH4B 2WDTB 3PT2B 4GB9A 3PREA 4A20A 1E8ZA 2FCMA 1UELA 2KHWB 2LVOA 3WAMA 4MEMA 4MGKE 1S3SG 2L00B 1SIFA 3TL5A 3DQVA 1J0GA 4A3PA 2J7QB 4DBGA 2N9XA 3H7PA 2MBBB 1T0YA 3UF8A 3W1YA 2G4DB 4AP4C 2N9EB 3DVNU 2B3AA 1WY8A 4IM2A 3NZSA 2KJ6A 2J0KA 4KIKB 3QHTA 2EMTA 4B95A 2JT4B 3W1SA 4W9GA 1E8XA 1WJUA 3U8ZA 2GBRA 4MJSA 3X23A 3M3JA 2LRWA 3H9DA 3TJPA 5LXIB 2PEAA 4IM3A 2M17A 3PTFC 3VTVA 1YQBA 3L17A 4W9FA 5J18A 3HM3A 2JRIB 2BPSA 2NS5A 3APFA 4BFRA 4TQ1A 4DDGD 5C1ZA 1U4AA 1UBQA 1WJ4A 3B1LX 1WX7A 3KW5B 3PRMB 3RULA 4BKSA 5IAAC 3Q3FA 3VUXA 1TTNA 3TIXA 2DYBA 2IBIB 1QZEA 4ZDVA 1RLFA 2KTFA 4IC7B 3OJ3A 2L0FA 1NDDA 4II3B 3WAPA 3WAOA 3PPAA 3HHMA 1WE7A 2BWFA 3DBLI 5AZHA 4PYZA 4KVGB 2O6VB 5G55A 3DVNV 2FAZA 2K6QA 4JIOU 2LRUA 1WRDB 1VCBA 4GDLA 3ZTDA 3MHSD 4GN1A 2FCNA 4OVUA 4CYEA 1L2NA 2DYMA 2KVRA 2DX5B 2AL3A 3CF6E 1ZGUB 2AL6A 2KWVB 4IWPA 1I35A 2Z0EB 5GMVA 3ML9A 5EDSA 3H7PB 3ZNID 1WM3A 4GGQA 2O6VD 2ZZPB 4HDOA 3L16A 2I1JA 2R2OA 2A4ZA 3IFWB 4W9IA 5DCNA 3QAQA 3WIMA 1A5RA 4GOCA 2MX2A 2HTHA 2MWSB 4HWIB 3PSEB 1GG3A 4KSLC 3VH3B 3L0WB 2KQ7A 2MBHA 2ZPNA 2L76A 3L08A 3N32A 2MA9B 2W9NA 4FJYA 4MJSB 3O65B 5CHFA 2Y5BB 3RCZA 1WE6A 3ZNZB 4F8CB 2K6DB 2L8JA 2OOBB 1K8RB 2UYZB 3OAWA 4E74A 3WALA 4DWFA 1SGHA 3HIZA 1V9JA 3CMMB 1Y8RC 3UGBB 3ECIA 2IO3B 1WR6E 3BY4B 1WXSA 4M8MA 2DHZA 1ISNA 2NR2A 4HCPB 4JL9A 3U30A 4BBNC 1WGGA 4ANXA 3GZNI 3JVZX 2CHZA 5KHQA 2D07B 2KC2A 1GJZA 4EZKA 3ENEA 1BT0A 4NQLB 2M0XA 3S2AA 4GMVA 3KYCD 3HK0A 1NBFC 2OJRA 5D94A 1P1AA 4PYUA 2BYVE 2KLCA 4GDLB 1XT9B 3U7DA 4HPMB 1JRUA 2KOXA 1M94A 1OQYA 3L13A 3VQIA 4LCDE 1Q1OA 3JSVB 3AU4A 3EECA 4TV3A 2FNJB 1WIAA 4FJVB 2D10A 3RYTA 4DDID 2NBWB 2BGFA 3SDLC 3RUIB 2MBQA 5E6PA 4EZLA 2YVCA 3APDA 2K1FA 5AZFA 3C0RB 2MCNB 4EUTA 4X57B 4WAAA 1OEYJ 3B0AA 2DYOA 4M8NA 2LGYA 3L10B 4WWNA 3ZRFA 4AUQC 4FBJB 4K1RB 2N1WA 2M4NA 3K9PB 2O6VA 5CTRC 2G3QB 3PS6A 4G50A 5JH5C 4B9KA 4TUUA 5BO4B 3AXCA 2A5UA 5L95C 1EUVB 4HK2A 1WF9A 5E6NA 1OEYA 3HM6X 3UQAA 3A9JA 3DVGX 3BINA 2R2QA 1WX8A 5D2MB 1P0RA 2N1VA 2K25A 2IY1B 1OTRB 2KC1A 3KUZA 4GDKA 2N7DA 3UQBA 2MSED 3N3KB 1TZ1A 1J19A 1TBEA 4NAWA 2AWTA 4LJOB 2KWCA 3ZIMA 3OLMD 1AARA 2CS4A 2JUOA 2DZKA 4WJQA 1V80A 2JZZA 2KFJA 4CO7A 5LXHA 1WXVA 3NHEB 3ZO5B 3PRPB 4IG7B 1WJ6A 1KJTA 2DAJA 2LUEA 3DOWA 4F7ZA 4HVBA 1E7VA 3NS8A 2NBUA 2Z59B 4FJZA 5DPSA 4FA6A 3M62B 4B6WA 2KK8A 2NVUI 2N7EA 4HPLB 1KOTA 2KJHB 4W9KA 4ZRJA 2BWES 1YIWA 3SHQA 3M63B 2RR9A 1GNUA 3A33B 4FHJA 2LI5A 3H1UA 1ZW7A 3ZTCA 4KZCA 3ZW3A 2WX0A 4G0NB 3RZWC 4PS3A 4JGHB 3DBRI 2K8HA 1WJNA 5TR5A 4DXAB 2KMCA 3SU8X 4KDIC 4HXDA 2HD5B 2RGFA 1D3ZA 2M1MA 1V86A 4DHZE 3V61A 1WGYA 2I1KA 4NPNA 4ZRIA 1MG8A 2L7RA 5G2NA 5FR6A 3CSFA 2HE7A 1UH6A 2KANA 3RD2A 2QHOA 4K7WA 1E7UA 3ZNHB 3VXWA 3KVFB 3A9JB 3KUCB 3D32A 4FHKA 3JSVA 2CR5A 1Q5WB 5J17A 2KDBA 1WH3A 2GOWA 4K7SA 4WJPA 4LJPB 5D7GA 4EOYA 4GDKB 1C1YB 5C23A 2BF8B 4RM9A 2BYEA 4NAWB 2FCQA 2DENB 4E3CA 3RZFA 2N4FA 3QK0A 1LXDA 1WYWB 1L7YA 2EMSA 4URKA 2HJ8A 4CHKA 3PGEA 5E6OA 2JRHA 2ZJDA 1IPGA 2XBBC 3R7QA 1FXTB 1WXAA 2LJ5A 3TCAA 2K8CA 4PS8A 3EFUA 2PPHA 2KD0A 2K39A 2JWZA 2FIFA 4WWOA 4W9LA 3VTWA 3ZDMC 4ZYNA 1WXMA 2EKEC 2KO3A 2C7HA 4ANVA 1WGRA 2MQJA 3AI5A 3APCA 5JZEB 2L3ZA 3M95A 2JF5A 2AEHA 2LASA 5CHWA 1WGDA 3ALBA 3UIOB 1V2YA 3JYUA 3QARA 3ML8A 2G4SA 4MGYE 4DHZB 3UIPB 2D3GA 2KKCA 1V49A 2LZ6A 1S1QB 1WGHA 2KTRA 3L54A 3DCGA 4PS7A 4M0WB 2C5LC 2GBJA 2BKFA 3IBEA 3VHTC 4MGIE 3PRZA 2Z0DB 3WANA 3OJ4B 2KX0A 4IWQA 2MLBA 1V5TA 2C7MB 3I3TB 3PLUA 4GXBA 3VAWA 3QQ8B 3DDCB 3T9LA 2J0MA 2KDFB 2ZPYA 3PHWB 2MW5A 2DAFA 1E8WA 4AJWA 2REXA 4MELA 4K7UA 4TQ0A 1Z5SB 3LJ3A 4ICVA 3VUWA 2FIDA 4KZ0A 5AEKB 3WA0A 4EZJA 1YD8U 2C60A 3EC8A 4W9HA 2DZMA 4MM3A 1EF5A 1EO6A 1I42A 4TKNA 3ZDTA 3JW0X 5JHAA 1YX6B 3EHVA 3IG3A 3RT3B 1VD2A 2XEWA 3X0WA 2LVPA 4F1SA 3B08A 2MBEA 4HDQA 5D6JB 4ANUA 4GSWA 4MGZE 1IYFA 3A1QA 4GU2A 4J6IA 4KSKC 1H4RA 2IYDB 1YJ1A 4XC2A 4BVUC 5AZGA 2KDEB 1WFYA 4AOFA 1V5OA 2KLGA 4OVVA 3H7SA 4AWJA 2XK5A 1WX9A 3TBLD 2LGDA 2V3SA 2IO0B 3QCAA 2IO2B 1P9DU 2C7NB 2CKHB 4ICUA 3DVGY 3V60A 4ASWC 2KTRB 1V81A 3VUYA 2JXXA 4P7IA 1NI2A 1R4NI 2GBMA 3VFKA 5IA7A 1P98A 2WWZA 5HKHA 3IVFA 1WZ0A 3DBSA 2ZEQA 3PLVA 1WZ3A 4E71A 4HLEA 1Z2MA 5DPWA 3QA8A 5L83A 1IP9A 2CHXA 3NY5A 4I6LB 1J8CA 4W9EA 2PE9A 4G11A 2ZNVC 4KV2A 3PV1A 2BKRB 4EEWA 4W9DA 1X1MA 3CSTA 2NCNA 4NJ7A 5JHBA 1V6EA 4FADA 3PZDA 4AJYB 4HJKA 2KMAA 4BKGA 3VVWB 3QC8B 2JVCA 4N9F4 1GC6A 2LGXA 3ZUNA 1SE9A 3QWZB 4FLHA 1C3TA 3ZRCA 4IWOA 4IW0A 2G45B 2KJRA 2O2VA 2ZVOA 3A1QB 4LDTB 4IUMB 4W9CA 4WJNA 1TGZB 2LVQA 3GOEA 5DPRA 4BOZB 2RPQA 4BKTA 3ZLZA 2L0TA 3A4SC 4WJOA 3V6CB 2XK5B 3A9KA 2LWPA 2NPTA 4IM0A 4ZRKA 4XX5A 4JQWC 3QJZA 4DHJB 2KQSA 2LXCA 4NQKE 2UWQA 5KHOA 2JPHA 1WI0A 3LDZE 3N30A 3QIJA 4KDLB 1GUAB 4LDTD 2MP2A 4HCNB 2GBNA 3PHXB 1LFDA 2FCSA 4W9JA 2KFKA 1WR1A 2MRPA 2KDIA 2KZRA 1R4MI 3AU5A 1UGMA 5CX3A 2PJHA 1PQSA 4RMAA 1G6JA 2KX3A 3DBHI 2N9PC 1GC7A 1OGWA 1UD7A 2C9WB 2DZIA 3NZUA 4K81A 4MSQB 4DHJD 4FULA 4WWPA 1WMHA 1WM2A 2D2QA 4WQOB 3UINB 1LM8B 1ZKHA 4BOSC 2IO1B 1RFAA 2CHWA 2WYQA 3V62A 1KLVA 2DZJA 1XQQA 2AYOB 3MTNB 1Q0WB 3KH0A 3QX1A 4FN2A 4MH0E 2KN5A 3IHPC 2LXAA 1UZXB 2JY6A 4GIVA 5J2RA 3W1SC 2VRRB 1LQBA 1EF1A
chains in the Genus database with same CATH superfamily
4XZ4A 1UUPA 3DPDA 1FIQA 2RSUA 3BIID 2J0JA 1QOBA 2IZVB 3V3XA 1P3QU 1GB4A 3A9KB 3CWIA 3P1MA 3R7RA 2NBVB 3MJWA 4RM8A 5C3JB 3ZKJC 3Q2AC 4A6QA 1RRBA 3Q8AA 2BYFA 1YX5B 3GZNB 2FUHB 3T8MA 5LLIA 1L5PA 3PVLA 2VZKB 1WMHB 3VTUA 2D11A 1ZOYB 2QDFA 1D5ZC 2WXOA 1ENFA 4ARIA 3KYDD 2V4IB 1UBIA 1HE8A 2PE6B 2VZKD 2ZNVB 1E8ZA 3WAMA 2KHWB 2N9XA 1T0YA 3W1YA 1F1HA 4AP4C 2N9EB 2BYTA 5BMHA 3HVZA 2B3AA 3R2TA 4IM2A 1DOYA 4KIKB 4ZRQA 2EMTA 4B95A 2Y3AA 5H92C 2GBRA 2LRWA 3PTFC 1YQBA 2NTSA 3RNCC 3HM3A 2IGGA 3GP7A 1HZ6A 3PRMB 2IBIB 3KWLA 1RLFA 2X8XX 3W9CB 4LTUA 1C77A 4PYZA 2J52A 4KVGB 4JIOU 3C19A 4WIPA 4N58A 4CYEA 3CF6E 1ZGUB 2D3AA 3C8YA 4LNIA 4IWPA 3DBRB 2Z0EB 5GMVA 3AE4B 3H7PB 3ZNID 2ZZPB 3L16A 4W9IA 5BYSA 4HWIB 2HTHA 4S0RA 3I5JC 2KMMA 2L76A 3L08A 5CHFA 3RCZA 3ZNZB 2L52A 4B0EA 2UYZB 3IAS1 3OAWA 3WALA 3AV8A 1SGHA 1V9JA 3UGBB 3ECIA 1WR6E 2NR2A 2RDGA 4ANXA 3GZNI 1NYRA 3JVZX 2DLBA 1TY0A 4AS1A 4IKGA 2M0XA 3S2AA 3N1YC 2ZW0A 2KLCA 1JRUA 1SXTA 1M94A 3L13A 3VQIA 2KT7A 4LCDE 2PIAA 1WIAA 2D10A 1FNVA 4DDID 2BGFA 2N9LA 4EZLA 3TEWA 4EUTA 1OQRA 1I4HA 4WAAA 4K1RB 1ZP0B 1CJEA 3R8BA 5JH5C 4G50A 4HK2A 3RPFC 1XF5L 3RNGC 2W54A 1OTRB 2N7DA 1TZ1A 2EKIA 4LJOB 2KWCA 1FCLA 1SEBD 4WJQA 1GOZA 1GB1A 1XLNA 2LUEA 1V97A 4HVBA 3NS8A 2NBUA 2Z59B 5DPSA 4FA6A 2SAKA 3AEDB 2WDQB 2N7EA 2KJHB 4C7ZA 4W9KA 3M63B 1GNUA 3A33B 1VR9A 3H1UA 1IBXB 3EFCA 4PS3A 1FD6A 2L83A 3DBRI 3U7ZA 2HD5B 4RH6A 2CJOA 1WGYA 4M0WA 2L7RA 5G2NA 1AYFA 1UH6A 1JWAD 1E7UA 3ZNHB 3N1ZC 5H8YE 3VXWA 3KVFB 3A9JB 3KUCB 4A8XC 3AEAB 2OHFA 1WH3A 4K7SA 4LJPB 1T6BX 1C1YB 3P4SB 5C23A 4RM9A 4NAWB 3J9CA 1AN8A 2N9KA 3RZFA 4URKA 4CHKA 3PGEA 1IPGA 3DWMA 3NVYA 2QSDA 4PS8A 4WWOA 3N20C 4W9LA 4CQNA 4ANVA 1XLPA 5C2TB 2MQJA 3RFZB 3ALBA 3QARA 2G4SA 3UIPB 1ACCA 4KKIA 3IBEA 4MGIE 4R3DA 3PRZA 5BYRA 4IWQA 3DHHC 1V5TA 2C7MB 2ZPYA 3PHWB 1E8WA 1IBXA 4K7UA 4TQ0A 1YJIA 3LJ3A 2BQQA 4ICVA 1Q10A 2FIDA 3GE3C 1EWYC 1AWDA 4W9HA 1MG4A 2DZMA 4MM3A 1EF5A 1EO6A 1I4QA 1I42A 1VD2A 4HDQA 4ANUA 4REZA 4J6IA 4XC2A 3IXSA 2KDEB 4AOFA 1XLOA 1V5OA 4OVVA 1PFDA 3IAM1 1WX9A 2V3SA 1FRDA 1P9DU 2HTME 2Y5CA 3V60A 3DVGY 2KTRB 1JMLA 3RNBC 4P7IA 2GBMA 5IA7A 1LGRA 4UDUC 5HKHA 1WZ0A 3PLVA 3H8HA 4XGAB 5DPWA 3QA8A 4M00A 4YSZB 1T5XD 4HKZE 3BVMA 1V6EA 3PZDA 4AJYB 3IT4B 2V9HA 3ZUNA 1C3TA 4YT0B 4J3OD 2ZVOA 2FBWB 3A1QB 1NENB 1TGZB 4BKTA 2D3BA 3A4SC 4WJOA 1DYQA 2LWPA 4ZRKA 4OVZA 1JROA 3AE8B 2KQSA 2LXCA 5KHOA 3N30A 2MHJA 1R7SA 2MP2A 4IOIE 2V3NA 2W3SA 1LFDA 2JZPA 2WXPA 3AU5A 1UGMA 2PJHA 3GS2A 1TKEA 2N9PC 2LGSA 1MHXA 1UD7A 2DZIA 4DXFA 2WXQA 1WM2A 3DBLB 4JWUC 1ZKHA 1QOGA 4BOSC 1RFAA 3DHGC 3V62A 3W5UB 2DZJA 1UF0A 3E56A 4ZYSA 4GLSC 1WYGA 1XQQA 2AYOB 4MH0E 2KN5A 3B2GA 1UZXB 2JY6A 1J7BA 5J2RA 4LK0M 3UF8A 2V1YA 2O2VB 2IPKD 3Q3JA 1C4AA 1XXGA 3SFDB 1JWMD 2YLMA 3NOBA 2X38A 2GMIC 2NPTB 4WAFA 1L6VA 4BKSD 1E90A 2UU7A 3RNEC 3R3MA 3TMPB 3ETRA 5T8IA 1SIJA 1T0RC 1YQ4B 3H6NA 2M8SA 4OW0A 1HTOA 2WX1A 3R66C 4RCOA 3ZVVA 1KLGD 1DOIA 2ZVNA 3TEZA 3Q3MC 4EKUA 4NJ6A 3AULA 2ASQA 4Q2JA 2K8BA 4JX1C 3ONSA 2IJ0A 5BMIA 1B1ZA 5CHVC 3P2BA 2ZCCA 1KF6B 4G3XB 3A4RA 4ANWA 4BBNF 3K9OB 1KM7A 4DK5A 3ZNGC 2WXKA 4I6PA 1SE4A 1RAXA 1SJED 4PT5A 3VH4B 4GB9A 1ZDVA 4LNFA 3PREA 4A20A 2FCMA 2AQ3B 4MGKE 3TL5A 1JCKB 2PTLA 3DVNU 1WY8A 3NZSA 2KJ6A 3ZXRA 1NI3A 4W9GA 3X23A 1JRPA 2WU2B 5LXIB 2AQ1B 4IM3A 2Q5WD 3VTVA 3L17A 4W9FA 2CJNA 4RGOS 1T0QC 1JWSD 4BFRA 1U4AA 4EE2A 4BKSA 3Q3FA 2DYBA 2L0FA 3WAOA 1E9MA 1JWUD 3NVWA 3DBLI 5AZHA 2L1AA 2O6VB 3Q3OC 3URYA 3TUOA 1WRDB 1VCBA 4GDLA 2H88B 3MHSD 4GN1A 4OVUA 1MI0A 2DYMA 1K50A 2DX5B 2KVRA 5AUIA 4USAA 3FC4A 3MFGA 3RN9C 1I35A 2ON8A 1WM3A 2O6VD 3WIMA 5DCNA 2A4ZA 1L0VB 4GOCA 1MPEA 3U4EG 1GG3A 3VH3B 2E3TA 3L0WB 1SF0A 2ZPNA 3RMKC 3N32A 3NG0A 3B2FA 2MA9B 1OQQA 2W9NA 4FJYA 2QJLA 2L8JA 3ZJVA 4E74A 4DWFA 3CMMB 1Y8RC 2WQYB 2KWDA 2WXLA 1FNWA 3BY4B 1WXSA 4M8MA 2DHZA 1ISNA 4JL9A 2KAJA 1JQ4A 5KHQA 4EZKA 4NQLB 4GMVA 3KYCD 2MJDA 1YNTE 2BYVE 3U7DA 3VRBB 3AE3B 4BZAA 3JSVB 3AU4A 4S17A 4TV3A 4DQOC 3SDLC 2MBQA 3BVGA 5AZFA 2K1FA 2MCNB 3C0RB 1L4DB 3B0AA 3CIRB 3L10B 5FK9C 3ZRFA 4AUQC 4FBJB 3OG5A 2M4NA 1LO5D 3K9PB 2O6VA 2G3QB 3PS6A 1QKZA 5L95C 1D5MC 3N1XC 1OEYA 5E6NA 3HM6X 3DVGX 3BINA 1N5WA 1WX8A 2N1VA 1I7HA 5IO9A 2IY1B 1E6EB 3UQBA 2MSED 2PMVA 1PDXA 2AWTA 3OLMD 1AARA 2CS4A 2JUOA 2BVCA 2KFJA 3NHEB 5IOIA 4IG7B 3AE1B 1E7VA 3M62B 4B6WA 2NTTA 2KK8A 2NVUI 1KOTA 3SHQA 2AQ2B 2LI5A 2K5PA 1NYQA 3ZTCA 2LGIA 2WX0A 3RZWC 4JGHB 1C4PA 1R4NB 3AMZA 2WXNA 3UI3A 3Q3NC 5TR5A 2KMCA 3SU8X 1D3ZA 2M1MA 2QC8A 1N60A 4DHZE 4NPNA 4ZRIA 3Q6BA 3TEXA 4YSYB 5FR6A 2JWUA 2QHOA 4RFBA 4NAMA 3D32A 4FHKA 3JSVA 2CR5A 1Q5WB 4WH4A 2N0SB 3IT6B 2BYEA 2XN9C 3KWVA 2FCQA 2BT6A 1IUEA 3QK0A 1VZ7A 3AB5A 4P6VF 2JRHA 1WXAA 3KLSX 2KD0A 2K39A 1C78A 3P4PB 2XNAC 4HKQA 1FM0D 4C4VA 3ZDMC 4OZBA 1WXMA 2EKEC 2C7HA 3APCA 1F2RC 5D3DA 1WGDA 4XWTA 3UIOB 1MHHE 1A70A 1UWMA 4MGYE 4DHZB 2KKCA 1R4MB 2PVOD 2RDBC 3Q8BA 1FEHA 3L54A 3DCGA 4M0WB 2BKFA 3VHTC 3AH7A 2KX0A 2MLBA 3PLUA 3QQ8B 3AE5B 3DDCB 1P7EA 4ZRPA 4MELA 4PK1A 3RI7C 1ROEA 1UNSA 2KN4A 3BZDB 2LEKA 3LXFA 1EWCA 5JHAA 4NZLB 3IG3A 2XEWA 1QILA 3X0WA 4F1SA 3B08A 2MBEA 5D6JB 4GSWA 2GLSA 4MGZE 2OJWA 5FKAC 2I2YA 4BVUC 2MEKA 1WFYA 3H7SA 2XK5A 3Q14C 3TBLD 3ZQ4A 1HZ5A 2OEDA 2CKHB 4RF1A 1V81A 5BYQA 2J4XA 2SEBD 3VUYA 2E6XA 2JXXA 1NI2A 1R4NI 2GRIA 1P98A 1MVKA 1WZ3A 3T3OA 1C9FA 4I6LB 1J8CA 4W9EA 2PE9A 1E10A 3GB1A 2K9XA 2L32A 4AQ7A 2R61A 2HJ1A 4MM3B 4N9F4 1EU3A 2LGXA 4FLHA 3QWZB 3ZRCA 2NMQA 4IUMB 4WJNA 3GOEA 1L0XB 2RMMA 2RPQA 2KVZA 3ZLZA 3V6CB 3AEGB 2WXHA 4DHJB 3LDZE 3QIJA 1E7PB 4HCNB 3VR8B 2FCSA 2KFKA 1BMLC 2KZRA 1R4MI 4LNOA 5CX3A 1PQSA 1FXIA 1TIFA 2BS4B 2MJ3A 1OGWA 4C7YA 2LUMA 4K81A 4MSQB 4DHJD 2D2QA 2WXJA 2BS3B 4P16A 3UINB 1LM8B 3W5VB 4HROA 2CHWA 1KLVA 1T0SC 3GE8C 1QOFA 4C00A 1CZPA 1Q0WB 4FN2A 1WSPA 4GIVA 4ITKA 2VRRB 1LQBA 1ZE3D 2LJIA 1QT9A 1XCQL 1RYJA 3SFEB 2LHDA 4NNJB 3VDZA 5E6JA 2CU1A 2KWUB 1IGDA 4RNAA 2ZCBA 3V6EB 2KXJA 2MP2B 1D6EC 2INDC 2K0PA 1NEKB 1L6UA 2IY0B 1XO3A 2INPE 4JLCA 5MPOA 1XEEA 3HRDD 5DPTA 2KNBA 3N9YC 2RD0A 2HDEA 4MDKE 4II2B 2MBOA 1PGAA 1KH0A 1MFWA 1F0ZA 2JZ3B 2WXIA 2M0AA 2TSSA 2LVOA 1UELA 4MEMA 1C76A 3DQVA 4A3PA 3ZJUA 2J7QB 4DBGA 5I4DA 4MACA 4K3CA 1N63A 2PLPA 2J0KA 2YEPF 3W1SA 1WJUA 3U8ZA 4MJSA 3M3JA 3H9DA 3TJPA 1WRIA 2PEAA 3AE9B 2DNFA 2M17A 5J18A 2KDMA 5HHDG 2NS5A 2BPSA 4TQ1A 5C1ZA 1UBQA 4WWMA 2QCZA 1WX7A 3OWEB 3RULA 3HVDA 5IAAC 3VUXA 1TTNA 3TIXA 1QQRA 1F2RI 3P63A 4ZDVA 2LFIA 2KTFA 4IC7B 3OJ3A 4II3B 1WXQA 3HHMA 2VH1A 2BWFA 5G55A 1TS5A 3DVNV 2LRUA 2DWQA 3EA6A 5JXVA 3ZTDA 1KFYB 2K3UA 2AL3A 3ML9A 5EDSA 5CTRC 4GGQA 1F77A 1UGJA 3FILA 1ZXHA 3PSEB 3AE6B 2KQ7A 1QF6A 2WDRB 3O65B 1I4PA 2Y5BB 3LYYA 1K8RB 2J42A 4JPSA 1F52A 3HIZA 2Y5PA 3AEBB 3U30A 4BBNC 2CHZA 2WXRA 1YN5A 2MJEA 2YEPB 1NBFC 1VZ8A 2QMTA 3PZ7A 5D94A 4PYUA 4GDLB 1BUIC 2KOXA 1KLUD 3EECA 2FNJB 3Q8CA 5IP4D 4FJVB 3MHZA 3RYTA 1SB3C 2NBWB 4JE3B 2YVCA 3NVZA 4X57B 2B76B 2DYOA 4M8NA 2LGYA 1YMHE 2LMCA 2WDVB 3BYYB 3U2SC 2N1WA 1VJKA 3NJTA 4C56C 4B9KA 3AXCA 2JYEA 4OHJA 1EUVB 2R2QA 3NVVA 3I63C 4GDKA 3KUZA 4RGTA 3N3KB 1TBEA 3NUHB 3AECB 5G5HA 1V80A 2JZZA 3FAHA 3ZO5B 1WJ6A 1KJTA 2DAJA 3P4QB 4F7ZA 1L4ZB 3W2DA 1ZDXA 1ZXIA 3ZJTA 2VH2A 3MC9A 4ZRJA 1YIWA 2RR9A 2WU5B 1N6ZA 1ZW7A 4ACFA 1C79A 4KZCA 3ZW3A 5G5GA 1KTKA 4G0NB 4YTNB 1SBBB 2K8HA 1WJNA 2PVGC 4DXAB 1HA5A 3ZXVA 4OZAA 2IGHA 3V61A 1CQVA 1TY2A 1E0ZA 1STEA 3T3NA 3CSFA 2HE7A 3RD2A 5TSSA 5AUKA 1IGCA 4XDCA 3AM9A 1C4CA 1NVID 2KDBA 1MJDA 2GOWA 4EOYA 1YN4A 4YWGG 1EM7A 2BF8B 2MH7A 4HRSA 2DENB 2N4FA 1WYWB 1L7YA 2EMSA 2HJ8A 5E6OA 2H89B 2XBBC 3R7QA 1GPXA 1FXTB 1XLQA 2K8CA 2JWZA 2FIFA 4P1CC 3AI5A 4YTMB 5JZEB 2L3ZA 2BB5A 2JF5A 2AEHA 2LASA 5CHWA 1JWBD 1V2YA 3JYUA 3ML8A 2D3GA 1V49A 2LZ6A 1S1QB 4WURA 3DBHB 1FRRA 1VZ6A 4RGNA 3I3TB 1PUTA 3T9LA 1J7CA 4N59A 2J0MA 2WS3B 4JWSC 2DAFA 4AJWA 1K52A 1RFKA 1WGKA 1Z5SB 3VUWA 4HPPA 3WA0A 3EC8A 2N7JA 1HQRD 3KQ4A 4WQMA 3ZDTA 3JW0X 3RT3B 3EHVA 3ABVB 2LVPA 2G1EA 1TKYA 2KQ4X 3AN1A 4GU2A 4C4VB 2J53A 1H4RA 1EU4A 1N5XA 2KLGA 4L23A 3I57A 4AWJA 3O13A 4K3BA 2JQRB 2JXTA 3QCAA 2IO2B 4ICUA 4ASWC 5EE0A 2JYTA 3P4RB 4KX6B 4E71A 4HLEA 3R2IA 3FKYA 1HXYD 3NY5A 3DWGC 4G11A 4KV2A 3PV1A 2BKRB 3PO0A 3BK2A 3AEEB 1N61A 3CSTA 2NCNA 2CU3A 1TKGA 2WXGA 4YXDB 4NJ7A 4FADA 4HJKA 5HI1A 1TS4A 3HUIA 4IW0A 5FR3A 4LDTB 1K51A 1N62A 2LVQA 4BOZB 2L0TA 2XK5B 4IDIA 3A9KA 4IM0A 2QILA 5BMGA 2JPHA 4KDLB 2D3CA 4LDTD 2GBNA 4W9JA 2MRPA 1I4XA 4RMAA 2WHIA 3BYTB 2KX3A 3DBHI 4US8A 1WMHA 1YJJA 1FPYA 2IO1B 1FCCC 1YOVB 3ZYYX 3ZGZA 3NZ3A 4MT5A 3MTNB 3IHPC 1ET9A 3RNAC 3W1SC 2I38A 5D2MB 4NY0A 1XD3B 4MSMB 1VLBA 2INNE 1E5WA 3RNFC 2V0GA 4KIKA 3SD5A 2LD9A 2AX5A 4KGRA 4MH8A 1ZUD2 2KFKB 2W3RA 4M01A 1TZOA 4I6NB 1JALA 4EFOA 1D4BA 1JW9D 5EE3A 2ICIA 3PZ8A 4YL8A 2GBKA 1H8CA 4YSXB 2L05A 1CMXB 2GB1A 3KUDB 4XYCA 3VR9B 4DXGA 2ONQA 1V1OA 2W82A 1F9JA 1E8YA 2LHEA 2V4LA 1L0YB 4A3OA 2WDTB 3PT2B 1TT5B 2WLBA 1S3SG 2L00B 1SIFA 1J0GA 1TJEA 3I9V1 3WCQA 4ZHOA 3H7PA 2MBBB 2G4DB 2PKOA 1SJHD 3QHTA 2JT4B 1E8XA 2FE8A 2WXFA 2JX5A 1PGBA 2QEJC 1I4RA 1TS3A 2JRIB 3APFA 4DDGD 1WJ4A 3B1LX 3P42A 3KW5B 1K53A 1QZEA 3L4PA 2M56B 3E9SA 1NDDA 3WAPA 3Q8EA 3PPAA 1WE7A 4A90A 3EUB2 2FAZA 2K6QA 1XCTL 4ARCA 1BXTA 2FCNA 2W55A 1WWTA 4HJGE 1L2NA 2AL6A 2KWVB 1CK1A 3LB8C 4HDOA 1ET6A 3V05A 2I1JA 2R2OA 4TSSA 3BWUD 3IFWB 3QAQA 1A5RA 2MX2A 2MWSB 4KSLC 2MBHA 1YQ3B 4MJSB 1WE6A 4F8CB 2K6DB 2OOBB 1HEZE 2INCC 2IO3B 2ACZB 4HCPB 3SR6A 1WGGA 4ZOHC 1FO4A 1M4VA 2D07B 2KC2A 1GJZA 3ENEA 1BT0A 3HK0A 2OJRA 1P1AA 1FMAD 1XT9B 4HPMB 5GXGB 3BVZA 1HTQA 1OQYA 1Q1OA 2RPVA 2G9HD 2K22A 1PYWD 3RUIB 4KGSA 5E6PA 3APDA 3FILB 1OEYJ 4WWNA 2WP9B 1DGJA 1T3QA 4TUUA 5BO4B 1J7AA 2A5UA 1WF9A 3UQAA 3A9JA 1P0RA 2D5GA 2K25A 4M02A 2KC1A 3MJ5A 1J19A 4NAWA 3ZIMA 2DZKA 1D5XC 4CO7A 5LXHA 1WXVA 3PRPB 3DOWA 1B9RA 2KACA 4FJZA 1QOAA 2Z8LA 4HPLB 2BWES 4FXCA 4FHJA 3EGRA 4HEA1 2DBYA 4BAXA 2BW2A 1VRAB 3AE7B 3AEFB 2WXMA 2JSVX 4KDIC 4HXDA 2RGFA 4YTPB 1V86A 1ESFA 2I1KA 1MG8A 3SEBA 1Y56A 2KANA 4K7WA 5HG2A 1SE3A 5J17A 4WJPA 1FXAA 5D7GA 5LNK1 4GDKB 4L2YA 4E3CA 1LXDA 4QAYA 1DOXA 2ZJDA 1V1PB 4US9A 1QLBB 2LJ5A 3TCAA 1RM6C 3EFUA 2PPHA 3VTWA 2GI9A 4ZYNA 4N6EB 1TYGB 1SSNA 2KO3A 4KKJA 1KRHA 1WGRA 4B0MA 3M95A 2QIEB 2WNMA 1I4GA 2KTRA 1WGHA 4PS7A 2C5LC 2GBJA 2Z0DB 3WANA 3OJ4B 3AE2B 2BBCA 4GXBA 3VAWA 4ZHPA 4LLGM 2KDFB 2MW5A 2REXA 4A9AA 4KZ0A 5AEKB 4EZJA 4C80A 1YD8U 2C60A 4H2AA 3MC8A 2KYWA 4D2KA 2JU6X 1TS2A 4XE0A 4TKNA 1YX6B 3DHIC 4OZCA 1IYFA 1FFVA 3A1QA 4KSKC 4RF0A 2IYDB 3NS1A 1YJ1A 2IGDA 5AZGA 1SE2A 2WGSA 1UWXA 1GAQB 2LGDA 2IO0B 2V3PA 2ZW1A 1AW7A 2C7NB 3VRAB 4RGMA 4P1BC 3Q69A 1V1PA 1FFUA 2BS2B 5D3IB 3VFKA 3NRZA 1RWSA 2EELA 2WWZA 3IVFA 3DBSA 2ZEQA 4LNNA 1Z2MA 2PW9A 4XWWA 5IKCM 1YN3A 5L83A 3BK1A 1IP9A 2CHXA 4A55A 2IDYA 2ZNVC 2RDHA 4EEWA 4W9DA 1X1MA 2M19A 5JHBA 4KGTA 4BKGA 2KMAA 5IN7A 3VVWB 3QC8B 2JVCA 1GC6A 3Q8FA 3B9JA 1SE9A 1VDVA 4IWOA 2BB6A 2G45B 2KJRA 2O2VA 4LNKA 5EE9A 1ZPSA 4W9CA 5EE1A 5DPRA 1V8CA 4O1NA 3MC0B 2NPTA 4XX5A 4JQWC 3QJZA 4NQKE 2UWQA 1WI0A 4NJCA 1GUAB 3TEYA 3PHXB 1WR1A 2KDIA 4L1BA 1G6JA 5HFYA 1GC7A 2C9WB 1OFFA 3NZUA 4FULA 4WWPA 4WQOB 3MP9A 2FUG1 2WYQA 2BTEA 1P7FA 1PGXA 3KH0A 3QX1A 4TMAB 1FNUA 2LXAA 3TSSA 3U52E 4XDDA 1EF1A
chains in the Genus database with same CATH topology
2V1YA 4XZ4A 2O2VB 3Q3JA 3DPDA 2YLMA 4NY0A 3NOBA 2RSUA 1XD3B 2J0JA 4MSMB 2IZVB 4NNJB 3VDZA 1P3QU 2GMIC 1E5WA 3A9KB 2NPTB 2CU1A 2KWUB 4KIKA 2ZCBA 3V6EB 3SD5A 2KXJA 3R7RA 2NBVB 3MJWA 2LD9A 4RM8A 2MP2B 4BKSD 1E90A 3ZKJC 3TMPB 3R3MA 2KFKB 1RRBA 3H6NA 2M8SA 2BYFA 2IY0B 4I6NB 1YX5B 4EFOA 2WX1A 2FUHB 3R66C 3T8MA 4JLCA 5LLIA 3PVLA 3ZVVA 5DPTA 1WMHB 2ZVNA 4YL8A 2GBKA 3VTUA 4EKUA 1H8CA 2KNBA 4NJ6A 2L05A 3AULA 1CMXB 2D11A 2ASQA 2RD0A 3KUDB 2K8BA 4MDKE 3ONSA 4II2B 2MBOA 3KYDD 5CHVC 3P2BA 1UBIA 2ZCCA 4G3XB 1F9JA 1HE8A 3A4RA 4ANWA 2PE6B 1E8YA 3K9OB 4BBNF 1KM7A 4DK5A 2V4LA 3ZNGC 2JZ3B 4I6PA 1RAXA 2ZNVB 4A3OA 3VH4B 2WDTB 3PT2B 4GB9A 3PREA 4A20A 1E8ZA 2FCMA 1UELA 2KHWB 2LVOA 3WAMA 4MEMA 4MGKE 1S3SG 2L00B 1SIFA 3TL5A 3DQVA 1J0GA 4A3PA 2J7QB 4DBGA 2N9XA 3H7PA 2MBBB 1T0YA 3UF8A 3W1YA 2G4DB 4AP4C 2N9EB 3DVNU 2B3AA 1WY8A 4IM2A 3NZSA 2KJ6A 2J0KA 4KIKB 3QHTA 2EMTA 4B95A 2JT4B 3W1SA 4W9GA 1E8XA 1WJUA 3U8ZA 2GBRA 4MJSA 3X23A 3M3JA 2LRWA 3H9DA 3TJPA 5LXIB 2PEAA 4IM3A 2M17A 3PTFC 3VTVA 1YQBA 3L17A 4W9FA 5J18A 3HM3A 2JRIB 2BPSA 2NS5A 3APFA 4BFRA 4TQ1A 4DDGD 5C1ZA 1U4AA 1UBQA 1WJ4A 3B1LX 1WX7A 3KW5B 3PRMB 3RULA 4BKSA 5IAAC 3Q3FA 3VUXA 1TTNA 3TIXA 2DYBA 2IBIB 1QZEA 4ZDVA 1RLFA 2KTFA 4IC7B 3OJ3A 2L0FA 1NDDA 4II3B 3WAPA 3WAOA 3PPAA 3HHMA 1WE7A 2BWFA 3DBLI 5AZHA 4PYZA 4KVGB 2O6VB 5G55A 3DVNV 2FAZA 2K6QA 4JIOU 2LRUA 1WRDB 1VCBA 4GDLA 3ZTDA 3MHSD 4GN1A 2FCNA 4OVUA 4CYEA 1L2NA 2DYMA 2KVRA 2DX5B 2AL3A 3CF6E 1ZGUB 2AL6A 2KWVB 4IWPA 1I35A 2Z0EB 5GMVA 3ML9A 5EDSA 3H7PB 3ZNID 1WM3A 4GGQA 2O6VD 2ZZPB 4HDOA 3L16A 2I1JA 2R2OA 2A4ZA 3IFWB 4W9IA 5DCNA 3QAQA 3WIMA 1A5RA 4GOCA 2MX2A 2HTHA 2MWSB 4HWIB 3PSEB 1GG3A 4KSLC 3VH3B 3L0WB 2KQ7A 2MBHA 2ZPNA 2L76A 3L08A 3N32A 2MA9B 2W9NA 4FJYA 4MJSB 3O65B 5CHFA 2Y5BB 3RCZA 1WE6A 3ZNZB 4F8CB 2K6DB 2L8JA 2OOBB 1K8RB 2UYZB 3OAWA 4E74A 3WALA 4DWFA 1SGHA 3HIZA 1V9JA 3CMMB 1Y8RC 3UGBB 3ECIA 2IO3B 1WR6E 3BY4B 1WXSA 4M8MA 2DHZA 1ISNA 2NR2A 4HCPB 4JL9A 3U30A 4BBNC 1WGGA 4ANXA 3GZNI 3JVZX 2CHZA 5KHQA 2D07B 2KC2A 1GJZA 4EZKA 3ENEA 1BT0A 4NQLB 2M0XA 3S2AA 4GMVA 3KYCD 3HK0A 1NBFC 2OJRA 5D94A 1P1AA 4PYUA 2BYVE 2KLCA 4GDLB 1XT9B 3U7DA 4HPMB 1JRUA 2KOXA 1M94A 1OQYA 3L13A 3VQIA 4LCDE 1Q1OA 3JSVB 3AU4A 3EECA 4TV3A 2FNJB 1WIAA 4FJVB 2D10A 3RYTA 4DDID 2NBWB 2BGFA 3SDLC 3RUIB 2MBQA 5E6PA 4EZLA 2YVCA 3APDA 2K1FA 5AZFA 3C0RB 2MCNB 4EUTA 4X57B 4WAAA 1OEYJ 3B0AA 2DYOA 4M8NA 2LGYA 3L10B 4WWNA 3ZRFA 4AUQC 4FBJB 4K1RB 2N1WA 2M4NA 3K9PB 2O6VA 5CTRC 2G3QB 3PS6A 4G50A 5JH5C 4B9KA 4TUUA 5BO4B 3AXCA 2A5UA 5L95C 1EUVB 4HK2A 1WF9A 5E6NA 1OEYA 3HM6X 3UQAA 3A9JA 3DVGX 3BINA 2R2QA 1WX8A 5D2MB 1P0RA 2N1VA 2K25A 2IY1B 1OTRB 2KC1A 3KUZA 4GDKA 2N7DA 3UQBA 2MSED 3N3KB 1TZ1A 1J19A 1TBEA 4NAWA 2AWTA 4LJOB 2KWCA 3ZIMA 3OLMD 1AARA 2CS4A 2JUOA 2DZKA 4WJQA 1V80A 2JZZA 2KFJA 4CO7A 5LXHA 1WXVA 3NHEB 3ZO5B 3PRPB 4IG7B 1WJ6A 1KJTA 2DAJA 2LUEA 3DOWA 4F7ZA 4HVBA 1E7VA 3NS8A 2NBUA 2Z59B 4FJZA 5DPSA 4FA6A 3M62B 4B6WA 2KK8A 2NVUI 2N7EA 4HPLB 1KOTA 2KJHB 4W9KA 4ZRJA 2BWES 1YIWA 3SHQA 3M63B 2RR9A 1GNUA 3A33B 4FHJA 2LI5A 3H1UA 1ZW7A 3ZTCA 4KZCA 3ZW3A 2WX0A 4G0NB 3RZWC 4PS3A 4JGHB 3DBRI 2K8HA 1WJNA 5TR5A 4DXAB 2KMCA 3SU8X 4KDIC 4HXDA 2HD5B 2RGFA 1D3ZA 2M1MA 1V86A 4DHZE 3V61A 1WGYA 2I1KA 4NPNA 4ZRIA 1MG8A 2L7RA 5G2NA 5FR6A 3CSFA 2HE7A 1UH6A 2KANA 3RD2A 2QHOA 4K7WA 1E7UA 3ZNHB 3VXWA 3KVFB 3A9JB 3KUCB 3D32A 4FHKA 3JSVA 2CR5A 1Q5WB 5J17A 2KDBA 1WH3A 2GOWA 4K7SA 4WJPA 4LJPB 5D7GA 4EOYA 4GDKB 1C1YB 5C23A 2BF8B 4RM9A 2BYEA 4NAWB 2FCQA 2DENB 4E3CA 3RZFA 2N4FA 3QK0A 1LXDA 1WYWB 1L7YA 2EMSA 4URKA 2HJ8A 4CHKA 3PGEA 5E6OA 2JRHA 2ZJDA 1IPGA 2XBBC 3R7QA 1FXTB 1WXAA 2LJ5A 3TCAA 2K8CA 4PS8A 3EFUA 2PPHA 2KD0A 2K39A 2JWZA 2FIFA 4WWOA 4W9LA 3VTWA 3ZDMC 4ZYNA 1WXMA 2EKEC 2KO3A 2C7HA 4ANVA 1WGRA 2MQJA 3AI5A 3APCA 5JZEB 2L3ZA 3M95A 2JF5A 2AEHA 2LASA 5CHWA 1WGDA 3ALBA 3UIOB 1V2YA 3JYUA 3QARA 3ML8A 2G4SA 4MGYE 4DHZB 3UIPB 2D3GA 2KKCA 1V49A 2LZ6A 1S1QB 1WGHA 2KTRA 3L54A 3DCGA 4PS7A 4M0WB 2C5LC 2GBJA 2BKFA 3IBEA 3VHTC 4MGIE 3PRZA 2Z0DB 3WANA 3OJ4B 2KX0A 4IWQA 2MLBA 1V5TA 2C7MB 3I3TB 3PLUA 4GXBA 3VAWA 3QQ8B 3DDCB 3T9LA 2J0MA 2KDFB 2ZPYA 3PHWB 2MW5A 2DAFA 1E8WA 4AJWA 2REXA 4MELA 4K7UA 4TQ0A 1Z5SB 3LJ3A 4ICVA 3VUWA 2FIDA 4KZ0A 5AEKB 3WA0A 4EZJA 1YD8U 2C60A 3EC8A 4W9HA 2DZMA 4MM3A 1EF5A 1EO6A 1I42A 4TKNA 3ZDTA 3JW0X 5JHAA 1YX6B 3EHVA 3IG3A 3RT3B 1VD2A 2XEWA 3X0WA 2LVPA 4F1SA 3B08A 2MBEA 4HDQA 5D6JB 4ANUA 4GSWA 4MGZE 1IYFA 3A1QA 4GU2A 4J6IA 4KSKC 1H4RA 2IYDB 1YJ1A 4XC2A 4BVUC 5AZGA 2KDEB 1WFYA 4AOFA 1V5OA 2KLGA 4OVVA 3H7SA 4AWJA 2XK5A 1WX9A 3TBLD 2LGDA 2V3SA 2IO0B 3QCAA 2IO2B 1P9DU 2C7NB 2CKHB 4ICUA 3DVGY 3V60A 4ASWC 2KTRB 1V81A 3VUYA 2JXXA 4P7IA 1NI2A 1R4NI 2GBMA 3VFKA 5IA7A 1P98A 2WWZA 5HKHA 3IVFA 1WZ0A 3DBSA 2ZEQA 3PLVA 1WZ3A 4E71A 4HLEA 1Z2MA 5DPWA 3QA8A 5L83A 1IP9A 2CHXA 3NY5A 4I6LB 1J8CA 4W9EA 2PE9A 4G11A 2ZNVC 4KV2A 3PV1A 2BKRB 4EEWA 4W9DA 1X1MA 3CSTA 2NCNA 4NJ7A 5JHBA 1V6EA 4FADA 3PZDA 4AJYB 4HJKA 2KMAA 4BKGA 3VVWB 3QC8B 2JVCA 4N9F4 1GC6A 2LGXA 3ZUNA 1SE9A 3QWZB 4FLHA 1C3TA 3ZRCA 4IWOA 4IW0A 2G45B 2KJRA 2O2VA 2ZVOA 3A1QB 4LDTB 4IUMB 4W9CA 4WJNA 1TGZB 2LVQA 3GOEA 5DPRA 4BOZB 2RPQA 4BKTA 3ZLZA 2L0TA 3A4SC 4WJOA 3V6CB 2XK5B 3A9KA 2LWPA 2NPTA 4IM0A 4ZRKA 4XX5A 4JQWC 3QJZA 4DHJB 2KQSA 2LXCA 4NQKE 2UWQA 5KHOA 2JPHA 1WI0A 3LDZE 3N30A 3QIJA 4KDLB 1GUAB 4LDTD 2MP2A 4HCNB 2GBNA 3PHXB 1LFDA 2FCSA 4W9JA 2KFKA 1WR1A 2MRPA 2KDIA 2KZRA 1R4MI 3AU5A 1UGMA 5CX3A 2PJHA 1PQSA 4RMAA 1G6JA 2KX3A 3DBHI 2N9PC 1GC7A 1OGWA 1UD7A 2C9WB 2DZIA 3NZUA 4K81A 4MSQB 4DHJD 4FULA 4WWPA 1WMHA 1WM2A 2D2QA 4WQOB 3UINB 1LM8B 1ZKHA 4BOSC 2IO1B 1RFAA 2CHWA 2WYQA 3V62A 1KLVA 2DZJA 1XQQA 2AYOB 3MTNB 1Q0WB 3KH0A 3QX1A 4FN2A 4MH0E 2KN5A 3IHPC 2LXAA 1UZXB 2JY6A 4GIVA 5J2RA 3W1SC 2VRRB 1LQBA 1EF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1Y A;  4XZ4 A;  2O2V B;  3Q3J A;  3DPD A;  2YLM A;  4NY0 A;  3NOB A;  2RSU A;  1XD3 B;  2J0J A;  4MSM B;  2IZV B;  4NNJ B;  3VDZ A;  1P3Q U;  2GMI C;  1E5W A;  3A9K B;  2NPT B;  2CU1 A;  2KWU B;  4KIK A;  2ZCB A;  3V6E B;  3SD5 A;  2KXJ A;  3R7R A;  2NBV B;  3MJW A;  2LD9 A;  4RM8 A;  2MP2 B;  4BKS D;  1E90 A;  3ZKJ C;  3TMP B;  3R3M A;  2KFK B;  1RRB A;  3H6N A;  2M8S A;  2BYF A;  2IY0 B;  4I6N B;  1YX5 B;  4EFO A;  2WX1 A;  2FUH B;  3R66 C;  3T8M A;  4JLC A;  5LLI A;  3PVL A;  3ZVV A;  5DPT A;  1WMH B;  2ZVN A;  4YL8 A;  2GBK A;  3VTU A;  4EKU A;  1H8C A;  2KNB A;  4NJ6 A;  2L05 A;  3AUL A;  1CMX B;  2D11 A;  2ASQ A;  2RD0 A;  3KUD B;  2K8B A;  4MDK E;  3ONS A;  4II2 B;  2MBO A;  3KYD D;  5CHV C;  3P2B A;  1UBI A;  2ZCC A;  4G3X B;  1F9J A;  1HE8 A;  3A4R A;  4ANW A;  2PE6 B;  1E8Y A;  3K9O B;  4BBN F;  1KM7 A;  4DK5 A;  2V4L A;  3ZNG C;  2JZ3 B;  4I6P A;  1RAX A;  2ZNV B;  4A3O A;  3VH4 B;  2WDT B;  3PT2 B;  4GB9 A;  3PRE A;  4A20 A;  1E8Z A;  2FCM A;  1UEL A;  2KHW B;  2LVO A;  3WAM A;  4MEM A;  4MGK E;  1S3S G;  2L00 B;  1SIF A;  3TL5 A;  3DQV A;  1J0G A;  4A3P A;  2J7Q B;  4DBG A;  2N9X A;  3H7P A;  2MBB B;  1T0Y A;  3UF8 A;  3W1Y A;  2G4D B;  4AP4 C;  2N9E B;  3DVN U;  2B3A A;  1WY8 A;  4IM2 A;  3NZS A;  2KJ6 A;  2J0K A;  4KIK B;  3QHT A;  2EMT A;  4B95 A;  2JT4 B;  3W1S A;  4W9G A;  1E8X A;  1WJU A;  3U8Z A;  2GBR A;  4MJS A;  3X23 A;  3M3J A;  2LRW A;  3H9D A;  3TJP A;  5LXI B;  2PEA A;  4IM3 A;  2M17 A;  3PTF C;  3VTV A;  1YQB A;  3L17 A;  4W9F A;  5J18 A;  3HM3 A;  2JRI B;  2BPS A;  2NS5 A;  3APF A;  4BFR A;  4TQ1 A;  4DDG D;  5C1Z A;  1U4A A;  1UBQ A;  1WJ4 A;  3B1L X;  1WX7 A;  3KW5 B;  3PRM B;  3RUL A;  4BKS A;  5IAA C;  3Q3F A;  3VUX A;  1TTN A;  3TIX A;  2DYB A;  2IBI B;  1QZE A;  4ZDV A;  1RLF A;  2KTF A;  4IC7 B;  3OJ3 A;  2L0F A;  1NDD A;  4II3 B;  3WAP A;  3WAO A;  3PPA A;  3HHM A;  1WE7 A;  2BWF A;  3DBL I;  5AZH A;  4PYZ A;  4KVG B;  2O6V B;  5G55 A;  3DVN V;  2FAZ A;  2K6Q A;  4JIO U;  2LRU A;  1WRD B;  1VCB A;  4GDL A;  3ZTD A;  3MHS D;  4GN1 A;  2FCN A;  4OVU A;  4CYE A;  1L2N A;  2DYM A;  2KVR A;  2DX5 B;  2AL3 A;  3CF6 E;  1ZGU B;  2AL6 A;  2KWV B;  4IWP A;  1I35 A;  2Z0E B;  5GMV A;  3ML9 A;  5EDS A;  3H7P B;  3ZNI D;  1WM3 A;  4GGQ A;  2O6V D;  2ZZP B;  4HDO A;  3L16 A;  2I1J A;  2R2O A;  2A4Z A;  3IFW B;  4W9I A;  5DCN A;  3QAQ A;  3WIM A;  1A5R A;  4GOC A;  2MX2 A;  2HTH A;  2MWS B;  4HWI B;  3PSE B;  1GG3 A;  4KSL C;  3VH3 B;  3L0W B;  2KQ7 A;  2MBH A;  2ZPN A;  2L76 A;  3L08 A;  3N32 A;  2MA9 B;  2W9N A;  4FJY A;  4MJS B;  3O65 B;  5CHF A;  2Y5B B;  3RCZ A;  1WE6 A;  3ZNZ B;  4F8C B;  2K6D B;  2L8J A;  2OOB B;  1K8R B;  2UYZ B;  3OAW A;  4E74 A;  3WAL A;  4DWF A;  1SGH A;  3HIZ A;  1V9J A;  3CMM B;  1Y8R C;  3UGB B;  3ECI A;  2IO3 B;  1WR6 E;  3BY4 B;  1WXS A;  4M8M A;  2DHZ A;  1ISN A;  2NR2 A;  4HCP B;  4JL9 A;  3U30 A;  4BBN C;  1WGG A;  4ANX A;  3GZN I;  3JVZ X;  2CHZ A;  5KHQ A;  2D07 B;  2KC2 A;  1GJZ A;  4EZK A;  3ENE A;  1BT0 A;  4NQL B;  2M0X A;  3S2A A;  4GMV A;  3KYC D;  3HK0 A;  1NBF C;  2OJR A;  5D94 A;  1P1A A;  4PYU A;  2BYV E;  2KLC A;  4GDL B;  1XT9 B;  3U7D A;  4HPM B;  1JRU A;  2KOX A;  1M94 A;  1OQY A;  3L13 A;  3VQI A;  4LCD E;  1Q1O A;  3JSV B;  3AU4 A;  3EEC A;  4TV3 A;  2FNJ B;  1WIA A;  4FJV B;  2D10 A;  3RYT A;  4DDI D;  2NBW B;  2BGF A;  3SDL C;  3RUI B;  2MBQ A;  5E6P A;  4EZL A;  2YVC A;  3APD A;  2K1F A;  5AZF A;  3C0R B;  2MCN B;  4EUT A;  4X57 B;  4WAA A;  1OEY J;  3B0A A;  2DYO A;  4M8N A;  2LGY A;  3L10 B;  4WWN A;  3ZRF A;  4AUQ C;  4FBJ B;  4K1R B;  2N1W A;  2M4N A;  3K9P B;  2O6V A;  5CTR C;  2G3Q B;  3PS6 A;  4G50 A;  5JH5 C;  4B9K A;  4TUU A;  5BO4 B;  3AXC A;  2A5U A;  5L95 C;  1EUV B;  4HK2 A;  1WF9 A;  5E6N A;  1OEY A;  3HM6 X;  3UQA A;  3A9J A;  3DVG X;  3BIN A;  2R2Q A;  1WX8 A;  5D2M B;  1P0R A;  2N1V A;  2K25 A;  2IY1 B;  1OTR B;  2KC1 A;  3KUZ A;  4GDK A;  2N7D A;  3UQB A;  2MSE D;  3N3K B;  1TZ1 A;  1J19 A;  1TBE A;  4NAW A;  2AWT A;  4LJO B;  2KWC A;  3ZIM A;  3OLM D;  1AAR A;  2CS4 A;  2JUO A;  2DZK A;  4WJQ A;  1V80 A;  2JZZ A;  2KFJ A;  4CO7 A;  5LXH A;  1WXV A;  3NHE B;  3ZO5 B;  3PRP B;  4IG7 B;  1WJ6 A;  1KJT A;  2DAJ A;  2LUE A;  3DOW A;  4F7Z A;  4HVB A;  1E7V A;  3NS8 A;  2NBU A;  2Z59 B;  4FJZ A;  5DPS A;  4FA6 A;  3M62 B;  4B6W A;  2KK8 A;  2NVU I;  2N7E A;  4HPL B;  1KOT A;  2KJH B;  4W9K A;  4ZRJ A;  2BWE S;  1YIW A;  3SHQ A;  3M63 B;  2RR9 A;  1GNU A;  3A33 B;  4FHJ A;  2LI5 A;  3H1U A;  1ZW7 A;  3ZTC A;  4KZC A;  3ZW3 A;  2WX0 A;  4G0N B;  3RZW C;  4PS3 A;  4JGH B;  3DBR I;  2K8H A;  1WJN A;  5TR5 A;  4DXA B;  2KMC A;  3SU8 X;  4KDI C;  4HXD A;  2HD5 B;  2RGF A;  1D3Z A;  2M1M A;  1V86 A;  4DHZ E;  3V61 A;  1WGY A;  2I1K A;  4NPN A;  4ZRI A;  1MG8 A;  2L7R A;  5G2N A;  5FR6 A;  3CSF A;  2HE7 A;  1UH6 A;  2KAN A;  3RD2 A;  2QHO A;  4K7W A;  1E7U A;  3ZNH B;  3VXW A;  3KVF B;  3A9J B;  3KUC B;  3D32 A;  4FHK A;  3JSV A;  2CR5 A;  1Q5W B;  5J17 A;  2KDB A;  1WH3 A;  2GOW A;  4K7S A;  4WJP A;  4LJP B;  5D7G A;  4EOY A;  4GDK B;  1C1Y B;  5C23 A;  2BF8 B;  4RM9 A;  2BYE A;  4NAW B;  2FCQ A;  2DEN B;  4E3C A;  3RZF A;  2N4F A;  3QK0 A;  1LXD A;  1WYW B;  1L7Y A;  2EMS A;  4URK A;  2HJ8 A;  4CHK A;  3PGE A;  5E6O A;  2JRH A;  2ZJD A;  1IPG A;  2XBB C;  3R7Q A;  1FXT B;  1WXA A;  2LJ5 A;  3TCA A;  2K8C A;  4PS8 A;  3EFU A;  2PPH A;  2KD0 A;  2K39 A;  2JWZ A;  2FIF A;  4WWO A;  4W9L A;  3VTW A;  3ZDM C;  4ZYN A;  1WXM A;  2EKE C;  2KO3 A;  2C7H A;  4ANV A;  1WGR A;  2MQJ A;  3AI5 A;  3APC A;  5JZE B;  2L3Z A;  3M95 A;  2JF5 A;  2AEH A;  2LAS A;  5CHW A;  1WGD A;  3ALB A;  3UIO B;  1V2Y A;  3JYU A;  3QAR A;  3ML8 A;  2G4S A;  4MGY E;  4DHZ B;  3UIP B;  2D3G A;  2KKC A;  1V49 A;  2LZ6 A;  1S1Q B;  1WGH A;  2KTR A;  3L54 A;  3DCG A;  4PS7 A;  4M0W B;  2C5L C;  2GBJ A;  2BKF A;  3IBE A;  3VHT C;  4MGI E;  3PRZ A;  2Z0D B;  3WAN A;  3OJ4 B;  2KX0 A;  4IWQ A;  2MLB A;  1V5T A;  2C7M B;  3I3T B;  3PLU A;  4GXB A;  3VAW A;  3QQ8 B;  3DDC B;  3T9L A;  2J0M A;  2KDF B;  2ZPY A;  3PHW B;  2MW5 A;  2DAF A;  1E8W A;  4AJW A;  2REX A;  4MEL A;  4K7U A;  4TQ0 A;  1Z5S B;  3LJ3 A;  4ICV A;  3VUW A;  2FID A;  4KZ0 A;  5AEK B;  3WA0 A;  4EZJ A;  1YD8 U;  2C60 A;  3EC8 A;  4W9H A;  2DZM A;  4MM3 A;  1EF5 A;  1EO6 A;  1I42 A;  4TKN A;  3ZDT A;  3JW0 X;  5JHA A;  1YX6 B;  3EHV A;  3IG3 A;  3RT3 B;  1VD2 A;  2XEW A;  3X0W A;  2LVP A;  4F1S A;  3B08 A;  2MBE A;  4HDQ A;  5D6J B;  4ANU A;  4GSW A;  4MGZ E;  1IYF A;  3A1Q A;  4GU2 A;  4J6I A;  4KSK C;  1H4R A;  2IYD B;  1YJ1 A;  4XC2 A;  4BVU C;  5AZG A;  2KDE B;  1WFY A;  4AOF A;  1V5O A;  2KLG A;  4OVV A;  3H7S A;  4AWJ A;  2XK5 A;  1WX9 A;  3TBL D;  2LGD A;  2V3S A;  2IO0 B;  3QCA A;  2IO2 B;  1P9D U;  2C7N B;  2CKH B;  4ICU A;  3DVG Y;  3V60 A;  4ASW C;  2KTR B;  1V81 A;  3VUY A;  2JXX A;  4P7I A;  1NI2 A;  1R4N I;  2GBM A;  3VFK A;  5IA7 A;  1P98 A;  2WWZ A;  5HKH A;  3IVF A;  1WZ0 A;  3DBS A;  2ZEQ A;  3PLV A;  1WZ3 A;  4E71 A;  4HLE A;  1Z2M A;  5DPW A;  3QA8 A;  5L83 A;  1IP9 A;  2CHX A;  3NY5 A;  4I6L B;  1J8C A;  4W9E A;  2PE9 A;  4G11 A;  2ZNV C;  4KV2 A;  3PV1 A;  2BKR B;  4EEW A;  4W9D A;  1X1M A;  3CST A;  2NCN A;  4NJ7 A;  5JHB A;  1V6E A;  4FAD A;  3PZD A;  4AJY B;  4HJK A;  2KMA A;  4BKG A;  3VVW B;  3QC8 B;  2JVC A;  4N9F 4;  1GC6 A;  2LGX A;  3ZUN A;  1SE9 A;  3QWZ B;  4FLH A;  1C3T A;  3ZRC A;  4IWO A;  4IW0 A;  2G45 B;  2KJR A;  2O2V A;  2ZVO A;  3A1Q B;  4LDT B;  4IUM B;  4W9C A;  4WJN A;  1TGZ B;  2LVQ A;  3GOE A;  5DPR A;  4BOZ B;  2RPQ A;  4BKT A;  3ZLZ A;  2L0T A;  3A4S C;  4WJO A;  3V6C B;  2XK5 B;  3A9K A;  2LWP A;  2NPT A;  4IM0 A;  4ZRK A;  4XX5 A;  4JQW C;  3QJZ A;  4DHJ B;  2KQS A;  2LXC A;  4NQK E;  2UWQ A;  5KHO A;  2JPH A;  1WI0 A;  3LDZ E;  3N30 A;  3QIJ A;  4KDL B;  1GUA B;  4LDT D;  2MP2 A;  4HCN B;  2GBN A;  3PHX B;  1LFD A;  2FCS A;  4W9J A;  2KFK A;  1WR1 A;  2MRP A;  2KDI A;  2KZR A;  1R4M I;  3AU5 A;  1UGM A;  5CX3 A;  2PJH A;  1PQS A;  4RMA A;  1G6J A;  2KX3 A;  3DBH I;  2N9P C;  1GC7 A;  1OGW A;  1UD7 A;  2C9W B;  2DZI A;  3NZU A;  4K81 A;  4MSQ B;  4DHJ D;  4FUL A;  4WWP A;  1WMH A;  1WM2 A;  2D2Q A;  4WQO B;  3UIN B;  1LM8 B;  1ZKH A;  4BOS C;  2IO1 B;  1RFA A;  2CHW A;  2WYQ A;  3V62 A;  1KLV A;  2DZJ A;  1XQQ A;  2AYO B;  3MTN B;  1Q0W B;  3KH0 A;  3QX1 A;  4FN2 A;  4MH0 E;  2KN5 A;  3IHP C;  2LXA A;  1UZX B;  2JY6 A;  4GIV A;  5J2R A;  3W1S C;  2VRR B;  1LQB A;  1EF1 A; 
#chains in the Genus database with same CATH topology
 4XZ4 A;  1UUP A;  3DPD A;  1FIQ A;  2RSU A;  3BII D;  2J0J A;  1QOB A;  2IZV B;  3V3X A;  1P3Q U;  1GB4 A;  3A9K B;  3CWI A;  3P1M A;  3R7R A;  2NBV B;  3MJW A;  4RM8 A;  5C3J B;  3ZKJ C;  3Q2A C;  4A6Q A;  1RRB A;  3Q8A A;  2BYF A;  1YX5 B;  3GZN B;  2FUH B;  3T8M A;  5LLI A;  1L5P A;  3PVL A;  2VZK B;  1WMH B;  3VTU A;  2D11 A;  1ZOY B;  2QDF A;  1D5Z C;  2WXO A;  1ENF A;  4ARI A;  3KYD D;  2V4I B;  1UBI A;  1HE8 A;  2PE6 B;  2VZK D;  2ZNV B;  1E8Z A;  3WAM A;  2KHW B;  2N9X A;  1T0Y A;  3W1Y A;  1F1H A;  4AP4 C;  2N9E B;  2BYT A;  5BMH A;  3HVZ A;  2B3A A;  3R2T A;  4IM2 A;  1DOY A;  4KIK B;  4ZRQ A;  2EMT A;  4B95 A;  2Y3A A;  5H92 C;  2GBR A;  2LRW A;  3PTF C;  1YQB A;  2NTS A;  3RNC C;  3HM3 A;  2IGG A;  3GP7 A;  1HZ6 A;  3PRM B;  2IBI B;  3KWL A;  1RLF A;  2X8X X;  3W9C B;  4LTU A;  1C77 A;  4PYZ A;  2J52 A;  4KVG B;  4JIO U;  3C19 A;  4WIP A;  4N58 A;  4CYE A;  3CF6 E;  1ZGU B;  2D3A A;  3C8Y A;  4LNI A;  4IWP A;  3DBR B;  2Z0E B;  5GMV A;  3AE4 B;  3H7P B;  3ZNI D;  2ZZP B;  3L16 A;  4W9I A;  5BYS A;  4HWI B;  2HTH A;  4S0R A;  3I5J C;  2KMM A;  2L76 A;  3L08 A;  5CHF A;  3RCZ A;  3ZNZ B;  2L52 A;  4B0E A;  2UYZ B;  3IAS 1;  3OAW A;  3WAL A;  3AV8 A;  1SGH A;  1V9J A;  3UGB B;  3ECI A;  1WR6 E;  2NR2 A;  2RDG A;  4ANX A;  3GZN I;  1NYR A;  3JVZ X;  2DLB A;  1TY0 A;  4AS1 A;  4IKG A;  2M0X A;  3S2A A;  3N1Y C;  2ZW0 A;  2KLC A;  1JRU A;  1SXT A;  1M94 A;  3L13 A;  3VQI A;  2KT7 A;  4LCD E;  2PIA A;  1WIA A;  2D10 A;  1FNV A;  4DDI D;  2BGF A;  2N9L A;  4EZL A;  3TEW A;  4EUT A;  1OQR A;  1I4H A;  4WAA A;  4K1R B;  1ZP0 B;  1CJE A;  3R8B A;  5JH5 C;  4G50 A;  4HK2 A;  3RPF C;  1XF5 L;  3RNG C;  2W54 A;  1OTR B;  2N7D A;  1TZ1 A;  2EKI A;  4LJO B;  2KWC A;  1FCL A;  1SEB D;  4WJQ A;  1GOZ A;  1GB1 A;  1XLN A;  2LUE A;  1V97 A;  4HVB A;  3NS8 A;  2NBU A;  2Z59 B;  5DPS A;  4FA6 A;  2SAK A;  3AED B;  2WDQ B;  2N7E A;  2KJH B;  4C7Z A;  4W9K A;  3M63 B;  1GNU A;  3A33 B;  1VR9 A;  3H1U A;  1IBX B;  3EFC A;  4PS3 A;  1FD6 A;  2L83 A;  3DBR I;  3U7Z A;  2HD5 B;  4RH6 A;  2CJO A;  1WGY A;  4M0W A;  2L7R A;  5G2N A;  1AYF A;  1UH6 A;  1JWA D;  1E7U A;  3ZNH B;  3N1Z C;  5H8Y E;  3VXW A;  3KVF B;  3A9J B;  3KUC B;  4A8X C;  3AEA B;  2OHF A;  1WH3 A;  4K7S A;  4LJP B;  1T6B X;  1C1Y B;  3P4S B;  5C23 A;  4RM9 A;  4NAW B;  3J9C A;  1AN8 A;  2N9K A;  3RZF A;  4URK A;  4CHK A;  3PGE A;  1IPG A;  3DWM A;  3NVY A;  2QSD A;  4PS8 A;  4WWO A;  3N20 C;  4W9L A;  4CQN A;  4ANV A;  1XLP A;  5C2T B;  2MQJ A;  3RFZ B;  3ALB A;  3QAR A;  2G4S A;  3UIP B;  1ACC A;  4KKI A;  3IBE A;  4MGI E;  4R3D A;  3PRZ A;  5BYR A;  4IWQ A;  3DHH C;  1V5T A;  2C7M B;  2ZPY A;  3PHW B;  1E8W A;  1IBX A;  4K7U A;  4TQ0 A;  1YJI A;  3LJ3 A;  2BQQ A;  4ICV A;  1Q10 A;  2FID A;  3GE3 C;  1EWY C;  1AWD A;  4W9H A;  1MG4 A;  2DZM A;  4MM3 A;  1EF5 A;  1EO6 A;  1I4Q A;  1I42 A;  1VD2 A;  4HDQ A;  4ANU A;  4REZ A;  4J6I A;  4XC2 A;  3IXS A;  2KDE B;  4AOF A;  1XLO A;  1V5O A;  4OVV A;  1PFD A;  3IAM 1;  1WX9 A;  2V3S A;  1FRD A;  1P9D U;  2HTM E;  2Y5C A;  3V60 A;  3DVG Y;  2KTR B;  1JML A;  3RNB C;  4P7I A;  2GBM A;  5IA7 A;  1LGR A;  4UDU C;  5HKH A;  1WZ0 A;  3PLV A;  3H8H A;  4XGA B;  5DPW A;  3QA8 A;  4M00 A;  4YSZ B;  1T5X D;  4HKZ E;  3BVM A;  1V6E A;  3PZD A;  4AJY B;  3IT4 B;  2V9H A;  3ZUN A;  1C3T A;  4YT0 B;  4J3O D;  2ZVO A;  2FBW B;  3A1Q B;  1NEN B;  1TGZ B;  4BKT A;  2D3B A;  3A4S C;  4WJO A;  1DYQ A;  2LWP A;  4ZRK A;  4OVZ A;  1JRO A;  3AE8 B;  2KQS A;  2LXC A;  5KHO A;  3N30 A;  2MHJ A;  1R7S A;  2MP2 A;  4IOI E;  2V3N A;  2W3S A;  1LFD A;  2JZP A;  2WXP A;  3AU5 A;  1UGM A;  2PJH A;  3GS2 A;  1TKE A;  2N9P C;  2LGS A;  1MHX A;  1UD7 A;  2DZI A;  4DXF A;  2WXQ A;  1WM2 A;  3DBL B;  4JWU C;  1ZKH A;  1QOG A;  4BOS C;  1RFA A;  3DHG C;  3V62 A;  3W5U B;  2DZJ A;  1UF0 A;  3E56 A;  4ZYS A;  4GLS C;  1WYG A;  1XQQ A;  2AYO B;  4MH0 E;  2KN5 A;  3B2G A;  1UZX B;  2JY6 A;  1J7B A;  5J2R A;  4LK0 M;  3UF8 A;  2V1Y A;  2O2V B;  2IPK D;  3Q3J A;  1C4A A;  1XXG A;  3SFD B;  1JWM D;  2YLM A;  3NOB A;  2X38 A;  2GMI C;  2NPT B;  4WAF A;  1L6V A;  4BKS D;  1E90 A;  2UU7 A;  3RNE C;  3R3M A;  3TMP B;  3ETR A;  5T8I A;  1SIJ A;  1T0R C;  1YQ4 B;  3H6N A;  2M8S A;  4OW0 A;  1HTO A;  2WX1 A;  3R66 C;  4RCO A;  3ZVV A;  1KLG D;  1DOI A;  2ZVN A;  3TEZ A;  3Q3M C;  4EKU A;  4NJ6 A;  3AUL A;  2ASQ A;  4Q2J A;  2K8B A;  4JX1 C;  3ONS A;  2IJ0 A;  5BMI A;  1B1Z A;  5CHV C;  3P2B A;  2ZCC A;  1KF6 B;  4G3X B;  3A4R A;  4ANW A;  4BBN F;  3K9O B;  1KM7 A;  4DK5 A;  3ZNG C;  2WXK A;  4I6P A;  1SE4 A;  1RAX A;  1SJE D;  4PT5 A;  3VH4 B;  4GB9 A;  1ZDV A;  4LNF A;  3PRE A;  4A20 A;  2FCM A;  2AQ3 B;  4MGK E;  3TL5 A;  1JCK B;  2PTL A;  3DVN U;  1WY8 A;  3NZS A;  2KJ6 A;  3ZXR A;  1NI3 A;  4W9G A;  3X23 A;  1JRP A;  2WU2 B;  5LXI B;  2AQ1 B;  4IM3 A;  2Q5W D;  3VTV A;  3L17 A;  4W9F A;  2CJN A;  4RGO S;  1T0Q C;  1JWS D;  4BFR A;  1U4A A;  4EE2 A;  4BKS A;  3Q3F A;  2DYB A;  2L0F A;  3WAO A;  1E9M A;  1JWU D;  3NVW A;  3DBL I;  5AZH A;  2L1A A;  2O6V B;  3Q3O C;  3URY A;  3TUO A;  1WRD B;  1VCB A;  4GDL A;  2H88 B;  3MHS D;  4GN1 A;  4OVU A;  1MI0 A;  2DYM A;  1K50 A;  2DX5 B;  2KVR A;  5AUI A;  4USA A;  3FC4 A;  3MFG A;  3RN9 C;  1I35 A;  2ON8 A;  1WM3 A;  2O6V D;  3WIM A;  5DCN A;  2A4Z A;  1L0V B;  4GOC A;  1MPE A;  3U4E G;  1GG3 A;  3VH3 B;  2E3T A;  3L0W B;  1SF0 A;  2ZPN A;  3RMK C;  3N32 A;  3NG0 A;  3B2F A;  2MA9 B;  1OQQ A;  2W9N A;  4FJY A;  2QJL A;  2L8J A;  3ZJV A;  4E74 A;  4DWF A;  3CMM B;  1Y8R C;  2WQY B;  2KWD A;  2WXL A;  1FNW A;  3BY4 B;  1WXS A;  4M8M A;  2DHZ A;  1ISN A;  4JL9 A;  2KAJ A;  1JQ4 A;  5KHQ A;  4EZK A;  4NQL B;  4GMV A;  3KYC D;  2MJD A;  1YNT E;  2BYV E;  3U7D A;  3VRB B;  3AE3 B;  4BZA A;  3JSV B;  3AU4 A;  4S17 A;  4TV3 A;  4DQO C;  3SDL C;  2MBQ A;  3BVG A;  5AZF A;  2K1F A;  2MCN B;  3C0R B;  1L4D B;  3B0A A;  3CIR B;  3L10 B;  5FK9 C;  3ZRF A;  4AUQ C;  4FBJ B;  3OG5 A;  2M4N A;  1LO5 D;  3K9P B;  2O6V A;  2G3Q B;  3PS6 A;  1QKZ A;  5L95 C;  1D5M C;  3N1X C;  1OEY A;  5E6N A;  3HM6 X;  3DVG X;  3BIN A;  1N5W A;  1WX8 A;  2N1V A;  1I7H A;  5IO9 A;  2IY1 B;  1E6E B;  3UQB A;  2MSE D;  2PMV A;  1PDX A;  2AWT A;  3OLM D;  1AAR A;  2CS4 A;  2JUO A;  2BVC A;  2KFJ A;  3NHE B;  5IOI A;  4IG7 B;  3AE1 B;  1E7V A;  3M62 B;  4B6W A;  2NTT A;  2KK8 A;  2NVU I;  1KOT A;  3SHQ A;  2AQ2 B;  2LI5 A;  2K5P A;  1NYQ A;  3ZTC A;  2LGI A;  2WX0 A;  3RZW C;  4JGH B;  1C4P A;  1R4N B;  3AMZ A;  2WXN A;  3UI3 A;  3Q3N C;  5TR5 A;  2KMC A;  3SU8 X;  1D3Z A;  2M1M A;  2QC8 A;  1N60 A;  4DHZ E;  4NPN A;  4ZRI A;  3Q6B A;  3TEX A;  4YSY B;  5FR6 A;  2JWU A;  2QHO A;  4RFB A;  4NAM A;  3D32 A;  4FHK A;  3JSV A;  2CR5 A;  1Q5W B;  4WH4 A;  2N0S B;  3IT6 B;  2BYE A;  2XN9 C;  3KWV A;  2FCQ A;  2BT6 A;  1IUE A;  3QK0 A;  1VZ7 A;  3AB5 A;  4P6V F;  2JRH A;  1WXA A;  3KLS X;  2KD0 A;  2K39 A;  1C78 A;  3P4P B;  2XNA C;  4HKQ A;  1FM0 D;  4C4V A;  3ZDM C;  4OZB A;  1WXM A;  2EKE C;  2C7H A;  3APC A;  1F2R C;  5D3D A;  1WGD A;  4XWT A;  3UIO B;  1MHH E;  1A70 A;  1UWM A;  4MGY E;  4DHZ B;  2KKC A;  1R4M B;  2PVO D;  2RDB C;  3Q8B A;  1FEH A;  3L54 A;  3DCG A;  4M0W B;  2BKF A;  3VHT C;  3AH7 A;  2KX0 A;  2MLB A;  3PLU A;  3QQ8 B;  3AE5 B;  3DDC B;  1P7E A;  4ZRP A;  4MEL A;  4PK1 A;  3RI7 C;  1ROE A;  1UNS A;  2KN4 A;  3BZD B;  2LEK A;  3LXF A;  1EWC A;  5JHA A;  4NZL B;  3IG3 A;  2XEW A;  1QIL A;  3X0W A;  4F1S A;  3B08 A;  2MBE A;  5D6J B;  4GSW A;  2GLS A;  4MGZ E;  2OJW A;  5FKA C;  2I2Y A;  4BVU C;  2MEK A;  1WFY A;  3H7S A;  2XK5 A;  3Q14 C;  3TBL D;  3ZQ4 A;  1HZ5 A;  2OED A;  2CKH B;  4RF1 A;  1V81 A;  5BYQ A;  2J4X A;  2SEB D;  3VUY A;  2E6X A;  2JXX A;  1NI2 A;  1R4N I;  2GRI A;  1P98 A;  1MVK A;  1WZ3 A;  3T3O A;  1C9F A;  4I6L B;  1J8C A;  4W9E A;  2PE9 A;  1E10 A;  3GB1 A;  2K9X A;  2L32 A;  4AQ7 A;  2R61 A;  2HJ1 A;  4MM3 B;  4N9F 4;  1EU3 A;  2LGX A;  4FLH A;  3QWZ B;  3ZRC A;  2NMQ A;  4IUM B;  4WJN A;  3GOE A;  1L0X B;  2RMM A;  2RPQ A;  2KVZ A;  3ZLZ A;  3V6C B;  3AEG B;  2WXH A;  4DHJ B;  3LDZ E;  3QIJ A;  1E7P B;  4HCN B;  3VR8 B;  2FCS A;  2KFK A;  1BML C;  2KZR A;  1R4M I;  4LNO A;  5CX3 A;  1PQS A;  1FXI A;  1TIF A;  2BS4 B;  2MJ3 A;  1OGW A;  4C7Y A;  2LUM A;  4K81 A;  4MSQ B;  4DHJ D;  2D2Q A;  2WXJ A;  2BS3 B;  4P16 A;  3UIN B;  1LM8 B;  3W5V B;  4HRO A;  2CHW A;  1KLV A;  1T0S C;  3GE8 C;  1QOF A;  4C00 A;  1CZP A;  1Q0W B;  4FN2 A;  1WSP A;  4GIV A;  4ITK A;  2VRR B;  1LQB A;  1ZE3 D;  2LJI A;  1QT9 A;  1XCQ L;  1RYJ A;  3SFE B;  2LHD A;  4NNJ B;  3VDZ A;  5E6J A;  2CU1 A;  2KWU B;  1IGD A;  4RNA A;  2ZCB A;  3V6E B;  2KXJ A;  2MP2 B;  1D6E C;  2IND C;  2K0P A;  1NEK B;  1L6U A;  2IY0 B;  1XO3 A;  2INP E;  4JLC A;  5MPO A;  1XEE A;  3HRD D;  5DPT A;  2KNB A;  3N9Y C;  2RD0 A;  2HDE A;  4MDK E;  4II2 B;  2MBO A;  1PGA A;  1KH0 A;  1MFW A;  1F0Z A;  2JZ3 B;  2WXI A;  2M0A A;  2TSS A;  2LVO A;  1UEL A;  4MEM A;  1C76 A;  3DQV A;  4A3P A;  3ZJU A;  2J7Q B;  4DBG A;  5I4D A;  4MAC A;  4K3C A;  1N63 A;  2PLP A;  2J0K A;  2YEP F;  3W1S A;  1WJU A;  3U8Z A;  4MJS A;  3M3J A;  3H9D A;  3TJP A;  1WRI A;  2PEA A;  3AE9 B;  2DNF A;  2M17 A;  5J18 A;  2KDM A;  5HHD G;  2NS5 A;  2BPS A;  4TQ1 A;  5C1Z A;  1UBQ A;  4WWM A;  2QCZ A;  1WX7 A;  3OWE B;  3RUL A;  3HVD A;  5IAA C;  3VUX A;  1TTN A;  3TIX A;  1QQR A;  1F2R I;  3P63 A;  4ZDV A;  2LFI A;  2KTF A;  4IC7 B;  3OJ3 A;  4II3 B;  1WXQ A;  3HHM A;  2VH1 A;  2BWF A;  5G55 A;  1TS5 A;  3DVN V;  2LRU A;  2DWQ A;  3EA6 A;  5JXV A;  3ZTD A;  1KFY B;  2K3U A;  2AL3 A;  3ML9 A;  5EDS A;  5CTR C;  4GGQ A;  1F77 A;  1UGJ A;  3FIL A;  1ZXH A;  3PSE B;  3AE6 B;  2KQ7 A;  1QF6 A;  2WDR B;  3O65 B;  1I4P A;  2Y5B B;  3LYY A;  1K8R B;  2J42 A;  4JPS A;  1F52 A;  3HIZ A;  2Y5P A;  3AEB B;  3U30 A;  4BBN C;  2CHZ A;  2WXR A;  1YN5 A;  2MJE A;  2YEP B;  1NBF C;  1VZ8 A;  2QMT A;  3PZ7 A;  5D94 A;  4PYU A;  4GDL B;  1BUI C;  2KOX A;  1KLU D;  3EEC A;  2FNJ B;  3Q8C A;  5IP4 D;  4FJV B;  3MHZ A;  3RYT A;  1SB3 C;  2NBW B;  4JE3 B;  2YVC A;  3NVZ A;  4X57 B;  2B76 B;  2DYO A;  4M8N A;  2LGY A;  1YMH E;  2LMC A;  2WDV B;  3BYY B;  3U2S C;  2N1W A;  1VJK A;  3NJT A;  4C56 C;  4B9K A;  3AXC A;  2JYE A;  4OHJ A;  1EUV B;  2R2Q A;  3NVV A;  3I63 C;  4GDK A;  3KUZ A;  4RGT A;  3N3K B;  1TBE A;  3NUH B;  3AEC B;  5G5H A;  1V80 A;  2JZZ A;  3FAH A;  3ZO5 B;  1WJ6 A;  1KJT A;  2DAJ A;  3P4Q B;  4F7Z A;  1L4Z B;  3W2D A;  1ZDX A;  1ZXI A;  3ZJT A;  2VH2 A;  3MC9 A;  4ZRJ A;  1YIW A;  2RR9 A;  2WU5 B;  1N6Z A;  1ZW7 A;  4ACF A;  1C79 A;  4KZC A;  3ZW3 A;  5G5G A;  1KTK A;  4G0N B;  4YTN B;  1SBB B;  2K8H A;  1WJN A;  2PVG C;  4DXA B;  1HA5 A;  3ZXV A;  4OZA A;  2IGH A;  3V61 A;  1CQV A;  1TY2 A;  1E0Z A;  1STE A;  3T3N A;  3CSF A;  2HE7 A;  3RD2 A;  5TSS A;  5AUK A;  1IGC A;  4XDC A;  3AM9 A;  1C4C A;  1NVI D;  2KDB A;  1MJD A;  2GOW A;  4EOY A;  1YN4 A;  4YWG G;  1EM7 A;  2BF8 B;  2MH7 A;  4HRS A;  2DEN B;  2N4F A;  1WYW B;  1L7Y A;  2EMS A;  2HJ8 A;  5E6O A;  2H89 B;  2XBB C;  3R7Q A;  1GPX A;  1FXT B;  1XLQ A;  2K8C A;  2JWZ A;  2FIF A;  4P1C C;  3AI5 A;  4YTM B;  5JZE B;  2L3Z A;  2BB5 A;  2JF5 A;  2AEH A;  2LAS A;  5CHW A;  1JWB D;  1V2Y A;  3JYU A;  3ML8 A;  2D3G A;  1V49 A;  2LZ6 A;  1S1Q B;  4WUR A;  3DBH B;  1FRR A;  1VZ6 A;  4RGN A;  3I3T B;  1PUT A;  3T9L A;  1J7C A;  4N59 A;  2J0M A;  2WS3 B;  4JWS C;  2DAF A;  4AJW A;  1K52 A;  1RFK A;  1WGK A;  1Z5S B;  3VUW A;  4HPP A;  3WA0 A;  3EC8 A;  2N7J A;  1HQR D;  3KQ4 A;  4WQM A;  3ZDT A;  3JW0 X;  3RT3 B;  3EHV A;  3ABV B;  2LVP A;  2G1E A;  1TKY A;  2KQ4 X;  3AN1 A;  4GU2 A;  4C4V B;  2J53 A;  1H4R A;  1EU4 A;  1N5X A;  2KLG A;  4L23 A;  3I57 A;  4AWJ A;  3O13 A;  4K3B A;  2JQR B;  2JXT A;  3QCA A;  2IO2 B;  4ICU A;  4ASW C;  5EE0 A;  2JYT A;  3P4R B;  4KX6 B;  4E71 A;  4HLE A;  3R2I A;  3FKY A;  1HXY D;  3NY5 A;  3DWG C;  4G11 A;  4KV2 A;  3PV1 A;  2BKR B;  3PO0 A;  3BK2 A;  3AEE B;  1N61 A;  3CST A;  2NCN A;  2CU3 A;  1TKG A;  2WXG A;  4YXD B;  4NJ7 A;  4FAD A;  4HJK A;  5HI1 A;  1TS4 A;  3HUI A;  4IW0 A;  5FR3 A;  4LDT B;  1K51 A;  1N62 A;  2LVQ A;  4BOZ B;  2L0T A;  2XK5 B;  4IDI A;  3A9K A;  4IM0 A;  2QIL A;  5BMG A;  2JPH A;  4KDL B;  2D3C A;  4LDT D;  2GBN A;  4W9J A;  2MRP A;  1I4X A;  4RMA A;  2WHI A;  3BYT B;  2KX3 A;  3DBH I;  4US8 A;  1WMH A;  1YJJ A;  1FPY A;  2IO1 B;  1FCC C;  1YOV B;  3ZYY X;  3ZGZ A;  3NZ3 A;  4MT5 A;  3MTN B;  3IHP C;  1ET9 A;  3RNA C;  3W1S C;  2I38 A;  5D2M B;  4NY0 A;  1XD3 B;  4MSM B;  1VLB A;  2INN E;  1E5W A;  3RNF C;  2V0G A;  4KIK A;  3SD5 A;  2LD9 A;  2AX5 A;  4KGR A;  4MH8 A;  1ZUD 2;  2KFK B;  2W3R A;  4M01 A;  1TZO A;  4I6N B;  1JAL A;  4EFO A;  1D4B A;  1JW9 D;  5EE3 A;  2ICI A;  3PZ8 A;  4YL8 A;  2GBK A;  1H8C A;  4YSX B;  2L05 A;  1CMX B;  2GB1 A;  3KUD B;  4XYC A;  3VR9 B;  4DXG A;  2ONQ A;  1V1O A;  2W82 A;  1F9J A;  1E8Y A;  2LHE A;  2V4L A;  1L0Y B;  4A3O A;  2WDT B;  3PT2 B;  1TT5 B;  2WLB A;  1S3S G;  2L00 B;  1SIF A;  1J0G A;  1TJE A;  3I9V 1;  3WCQ A;  4ZHO A;  3H7P A;  2MBB B;  2G4D B;  2PKO A;  1SJH D;  3QHT A;  2JT4 B;  1E8X A;  2FE8 A;  2WXF A;  2JX5 A;  1PGB A;  2QEJ C;  1I4R A;  1TS3 A;  2JRI B;  3APF A;  4DDG D;  1WJ4 A;  3B1L X;  3P42 A;  3KW5 B;  1K53 A;  1QZE A;  3L4P A;  2M56 B;  3E9S A;  1NDD A;  3WAP A;  3Q8E A;  3PPA A;  1WE7 A;  4A90 A;  3EUB 2;  2FAZ A;  2K6Q A;  1XCT L;  4ARC A;  1BXT A;  2FCN A;  2W55 A;  1WWT A;  4HJG E;  1L2N A;  2AL6 A;  2KWV B;  1CK1 A;  3LB8 C;  4HDO A;  1ET6 A;  3V05 A;  2I1J A;  2R2O A;  4TSS A;  3BWU D;  3IFW B;  3QAQ A;  1A5R A;  2MX2 A;  2MWS B;  4KSL C;  2MBH A;  1YQ3 B;  4MJS B;  1WE6 A;  4F8C B;  2K6D B;  2OOB B;  1HEZ E;  2INC C;  2IO3 B;  2ACZ B;  4HCP B;  3SR6 A;  1WGG A;  4ZOH C;  1FO4 A;  1M4V A;  2D07 B;  2KC2 A;  1GJZ A;  3ENE A;  1BT0 A;  3HK0 A;  2OJR A;  1P1A A;  1FMA D;  1XT9 B;  4HPM B;  5GXG B;  3BVZ A;  1HTQ A;  1OQY A;  1Q1O A;  2RPV A;  2G9H D;  2K22 A;  1PYW D;  3RUI B;  4KGS A;  5E6P A;  3APD A;  3FIL B;  1OEY J;  4WWN A;  2WP9 B;  1DGJ A;  1T3Q A;  4TUU A;  5BO4 B;  1J7A A;  2A5U A;  1WF9 A;  3UQA A;  3A9J A;  1P0R A;  2D5G A;  2K25 A;  4M02 A;  2KC1 A;  3MJ5 A;  1J19 A;  4NAW A;  3ZIM A;  2DZK A;  1D5X C;  4CO7 A;  5LXH A;  1WXV A;  3PRP B;  3DOW A;  1B9R A;  2KAC A;  4FJZ A;  1QOA A;  2Z8L A;  4HPL B;  2BWE S;  4FXC A;  4FHJ A;  3EGR A;  4HEA 1;  2DBY A;  4BAX A;  2BW2 A;  1VRA B;  3AE7 B;  3AEF B;  2WXM A;  2JSV X;  4KDI C;  4HXD A;  2RGF A;  4YTP B;  1V86 A;  1ESF A;  2I1K A;  1MG8 A;  3SEB A;  1Y56 A;  2KAN A;  4K7W A;  5HG2 A;  1SE3 A;  5J17 A;  4WJP A;  1FXA A;  5D7G A;  5LNK 1;  4GDK B;  4L2Y A;  4E3C A;  1LXD A;  4QAY A;  1DOX A;  2ZJD A;  1V1P B;  4US9 A;  1QLB B;  2LJ5 A;  3TCA A;  1RM6 C;  3EFU A;  2PPH A;  3VTW A;  2GI9 A;  4ZYN A;  4N6E B;  1TYG B;  1SSN A;  2KO3 A;  4KKJ A;  1KRH A;  1WGR A;  4B0M A;  3M95 A;  2QIE B;  2WNM A;  1I4G A;  2KTR A;  1WGH A;  4PS7 A;  2C5L C;  2GBJ A;  2Z0D B;  3WAN A;  3OJ4 B;  3AE2 B;  2BBC A;  4GXB A;  3VAW A;  4ZHP A;  4LLG M;  2KDF B;  2MW5 A;  2REX A;  4A9A A;  4KZ0 A;  5AEK B;  4EZJ A;  4C80 A;  1YD8 U;  2C60 A;  4H2A A;  3MC8 A;  2KYW A;  4D2K A;  2JU6 X;  1TS2 A;  4XE0 A;  4TKN A;  1YX6 B;  3DHI C;  4OZC A;  1IYF A;  1FFV A;  3A1Q A;  4KSK C;  4RF0 A;  2IYD B;  3NS1 A;  1YJ1 A;  2IGD A;  5AZG A;  1SE2 A;  2WGS A;  1UWX A;  1GAQ B;  2LGD A;  2IO0 B;  2V3P A;  2ZW1 A;  1AW7 A;  2C7N B;  3VRA B;  4RGM A;  4P1B C;  3Q69 A;  1V1P A;  1FFU A;  2BS2 B;  5D3I B;  3VFK A;  3NRZ A;  1RWS A;  2EEL A;  2WWZ A;  3IVF A;  3DBS A;  2ZEQ A;  4LNN A;  1Z2M A;  2PW9 A;  4XWW A;  5IKC M;  1YN3 A;  5L83 A;  3BK1 A;  1IP9 A;  2CHX A;  4A55 A;  2IDY A;  2ZNV C;  2RDH A;  4EEW A;  4W9D A;  1X1M A;  2M19 A;  5JHB A;  4KGT A;  4BKG A;  2KMA A;  5IN7 A;  3VVW B;  3QC8 B;  2JVC A;  1GC6 A;  3Q8F A;  3B9J A;  1SE9 A;  1VDV A;  4IWO A;  2BB6 A;  2G45 B;  2KJR A;  2O2V A;  4LNK A;  5EE9 A;  1ZPS A;  4W9C A;  5EE1 A;  5DPR A;  1V8C A;  4O1N A;  3MC0 B;  2NPT A;  4XX5 A;  4JQW C;  3QJZ A;  4NQK E;  2UWQ A;  1WI0 A;  4NJC A;  1GUA B;  3TEY A;  3PHX B;  1WR1 A;  2KDI A;  4L1B A;  1G6J A;  5HFY A;  1GC7 A;  2C9W B;  1OFF A;  3NZU A;  4FUL A;  4WWP A;  4WQO B;  3MP9 A;  2FUG 1;  2WYQ A;  2BTE A;  1P7F A;  1PGX A;  3KH0 A;  3QX1 A;  4TMA B;  1FNU A;  2LXA A;  3TSS A;  3U52 E;  4XDD A;  1EF1 A; 
#chains in the Genus database with same CATH homology
 2V1Y A;  4XZ4 A;  2O2V B;  3Q3J A;  3DPD A;  2YLM A;  4NY0 A;  3NOB A;  2RSU A;  1XD3 B;  2J0J A;  4MSM B;  2IZV B;  4NNJ B;  3VDZ A;  1P3Q U;  2GMI C;  1E5W A;  3A9K B;  2NPT B;  2CU1 A;  2KWU B;  4KIK A;  2ZCB A;  3V6E B;  3SD5 A;  2KXJ A;  3R7R A;  2NBV B;  3MJW A;  2LD9 A;  4RM8 A;  2MP2 B;  4BKS D;  1E90 A;  3ZKJ C;  3TMP B;  3R3M A;  2KFK B;  1RRB A;  3H6N A;  2M8S A;  2BYF A;  2IY0 B;  4I6N B;  1YX5 B;  4EFO A;  2WX1 A;  2FUH B;  3R66 C;  3T8M A;  4JLC A;  5LLI A;  3PVL A;  3ZVV A;  5DPT A;  1WMH B;  2ZVN A;  4YL8 A;  2GBK A;  3VTU A;  4EKU A;  1H8C A;  2KNB A;  4NJ6 A;  2L05 A;  3AUL A;  1CMX B;  2D11 A;  2ASQ A;  2RD0 A;  3KUD B;  2K8B A;  4MDK E;  3ONS A;  4II2 B;  2MBO A;  3KYD D;  5CHV C;  3P2B A;  1UBI A;  2ZCC A;  4G3X B;  1F9J A;  1HE8 A;  3A4R A;  4ANW A;  2PE6 B;  1E8Y A;  3K9O B;  4BBN F;  1KM7 A;  4DK5 A;  2V4L A;  3ZNG C;  2JZ3 B;  4I6P A;  1RAX A;  2ZNV B;  4A3O A;  3VH4 B;  2WDT B;  3PT2 B;  4GB9 A;  3PRE A;  4A20 A;  1E8Z A;  2FCM A;  1UEL A;  2KHW B;  2LVO A;  3WAM A;  4MEM A;  4MGK E;  1S3S G;  2L00 B;  1SIF A;  3TL5 A;  3DQV A;  1J0G A;  4A3P A;  2J7Q B;  4DBG A;  2N9X A;  3H7P A;  2MBB B;  1T0Y A;  3UF8 A;  3W1Y A;  2G4D B;  4AP4 C;  2N9E B;  3DVN U;  2B3A A;  1WY8 A;  4IM2 A;  3NZS A;  2KJ6 A;  2J0K A;  4KIK B;  3QHT A;  2EMT A;  4B95 A;  2JT4 B;  3W1S A;  4W9G A;  1E8X A;  1WJU A;  3U8Z A;  2GBR A;  4MJS A;  3X23 A;  3M3J A;  2LRW A;  3H9D A;  3TJP A;  5LXI B;  2PEA A;  4IM3 A;  2M17 A;  3PTF C;  3VTV A;  1YQB A;  3L17 A;  4W9F A;  5J18 A;  3HM3 A;  2JRI B;  2BPS A;  2NS5 A;  3APF A;  4BFR A;  4TQ1 A;  4DDG D;  5C1Z A;  1U4A A;  1UBQ A;  1WJ4 A;  3B1L X;  1WX7 A;  3KW5 B;  3PRM B;  3RUL A;  4BKS A;  5IAA C;  3Q3F A;  3VUX A;  1TTN A;  3TIX A;  2DYB A;  2IBI B;  1QZE A;  4ZDV A;  1RLF A;  2KTF A;  4IC7 B;  3OJ3 A;  2L0F A;  1NDD A;  4II3 B;  3WAP A;  3WAO A;  3PPA A;  3HHM A;  1WE7 A;  2BWF A;  3DBL I;  5AZH A;  4PYZ A;  4KVG B;  2O6V B;  5G55 A;  3DVN V;  2FAZ A;  2K6Q A;  4JIO U;  2LRU A;  1WRD B;  1VCB A;  4GDL A;  3ZTD A;  3MHS D;  4GN1 A;  2FCN A;  4OVU A;  4CYE A;  1L2N A;  2DYM A;  2KVR A;  2DX5 B;  2AL3 A;  3CF6 E;  1ZGU B;  2AL6 A;  2KWV B;  4IWP A;  1I35 A;  2Z0E B;  5GMV A;  3ML9 A;  5EDS A;  3H7P B;  3ZNI D;  1WM3 A;  4GGQ A;  2O6V D;  2ZZP B;  4HDO A;  3L16 A;  2I1J A;  2R2O A;  2A4Z A;  3IFW B;  4W9I A;  5DCN A;  3QAQ A;  3WIM A;  1A5R A;  4GOC A;  2MX2 A;  2HTH A;  2MWS B;  4HWI B;  3PSE B;  1GG3 A;  4KSL C;  3VH3 B;  3L0W B;  2KQ7 A;  2MBH A;  2ZPN A;  2L76 A;  3L08 A;  3N32 A;  2MA9 B;  2W9N A;  4FJY A;  4MJS B;  3O65 B;  5CHF A;  2Y5B B;  3RCZ A;  1WE6 A;  3ZNZ B;  4F8C B;  2K6D B;  2L8J A;  2OOB B;  1K8R B;  2UYZ B;  3OAW A;  4E74 A;  3WAL A;  4DWF A;  1SGH A;  3HIZ A;  1V9J A;  3CMM B;  1Y8R C;  3UGB B;  3ECI A;  2IO3 B;  1WR6 E;  3BY4 B;  1WXS A;  4M8M A;  2DHZ A;  1ISN A;  2NR2 A;  4HCP B;  4JL9 A;  3U30 A;  4BBN C;  1WGG A;  4ANX A;  3GZN I;  3JVZ X;  2CHZ A;  5KHQ A;  2D07 B;  2KC2 A;  1GJZ A;  4EZK A;  3ENE A;  1BT0 A;  4NQL B;  2M0X A;  3S2A A;  4GMV A;  3KYC D;  3HK0 A;  1NBF C;  2OJR A;  5D94 A;  1P1A A;  4PYU A;  2BYV E;  2KLC A;  4GDL B;  1XT9 B;  3U7D A;  4HPM B;  1JRU A;  2KOX A;  1M94 A;  1OQY A;  3L13 A;  3VQI A;  4LCD E;  1Q1O A;  3JSV B;  3AU4 A;  3EEC A;  4TV3 A;  2FNJ B;  1WIA A;  4FJV B;  2D10 A;  3RYT A;  4DDI D;  2NBW B;  2BGF A;  3SDL C;  3RUI B;  2MBQ A;  5E6P A;  4EZL A;  2YVC A;  3APD A;  2K1F A;  5AZF A;  3C0R B;  2MCN B;  4EUT A;  4X57 B;  4WAA A;  1OEY J;  3B0A A;  2DYO A;  4M8N A;  2LGY A;  3L10 B;  4WWN A;  3ZRF A;  4AUQ C;  4FBJ B;  4K1R B;  2N1W A;  2M4N A;  3K9P B;  2O6V A;  5CTR C;  2G3Q B;  3PS6 A;  4G50 A;  5JH5 C;  4B9K A;  4TUU A;  5BO4 B;  3AXC A;  2A5U A;  5L95 C;  1EUV B;  4HK2 A;  1WF9 A;  5E6N A;  1OEY A;  3HM6 X;  3UQA A;  3A9J A;  3DVG X;  3BIN A;  2R2Q A;  1WX8 A;  5D2M B;  1P0R A;  2N1V A;  2K25 A;  2IY1 B;  1OTR B;  2KC1 A;  3KUZ A;  4GDK A;  2N7D A;  3UQB A;  2MSE D;  3N3K B;  1TZ1 A;  1J19 A;  1TBE A;  4NAW A;  2AWT A;  4LJO B;  2KWC A;  3ZIM A;  3OLM D;  1AAR A;  2CS4 A;  2JUO A;  2DZK A;  4WJQ A;  1V80 A;  2JZZ A;  2KFJ A;  4CO7 A;  5LXH A;  1WXV A;  3NHE B;  3ZO5 B;  3PRP B;  4IG7 B;  1WJ6 A;  1KJT A;  2DAJ A;  2LUE A;  3DOW A;  4F7Z A;  4HVB A;  1E7V A;  3NS8 A;  2NBU A;  2Z59 B;  4FJZ A;  5DPS A;  4FA6 A;  3M62 B;  4B6W A;  2KK8 A;  2NVU I;  2N7E A;  4HPL B;  1KOT A;  2KJH B;  4W9K A;  4ZRJ A;  2BWE S;  1YIW A;  3SHQ A;  3M63 B;  2RR9 A;  1GNU A;  3A33 B;  4FHJ A;  2LI5 A;  3H1U A;  1ZW7 A;  3ZTC A;  4KZC A;  3ZW3 A;  2WX0 A;  4G0N B;  3RZW C;  4PS3 A;  4JGH B;  3DBR I;  2K8H A;  1WJN A;  5TR5 A;  4DXA B;  2KMC A;  3SU8 X;  4KDI C;  4HXD A;  2HD5 B;  2RGF A;  1D3Z A;  2M1M A;  1V86 A;  4DHZ E;  3V61 A;  1WGY A;  2I1K A;  4NPN A;  4ZRI A;  1MG8 A;  2L7R A;  5G2N A;  5FR6 A;  3CSF A;  2HE7 A;  1UH6 A;  2KAN A;  3RD2 A;  2QHO A;  4K7W A;  1E7U A;  3ZNH B;  3VXW A;  3KVF B;  3A9J B;  3KUC B;  3D32 A;  4FHK A;  3JSV A;  2CR5 A;  1Q5W B;  5J17 A;  2KDB A;  1WH3 A;  2GOW A;  4K7S A;  4WJP A;  4LJP B;  5D7G A;  4EOY A;  4GDK B;  1C1Y B;  5C23 A;  2BF8 B;  4RM9 A;  2BYE A;  4NAW B;  2FCQ A;  2DEN B;  4E3C A;  3RZF A;  2N4F A;  3QK0 A;  1LXD A;  1WYW B;  1L7Y A;  2EMS A;  4URK A;  2HJ8 A;  4CHK A;  3PGE A;  5E6O A;  2JRH A;  2ZJD A;  1IPG A;  2XBB C;  3R7Q A;  1FXT B;  1WXA A;  2LJ5 A;  3TCA A;  2K8C A;  4PS8 A;  3EFU A;  2PPH A;  2KD0 A;  2K39 A;  2JWZ A;  2FIF A;  4WWO A;  4W9L A;  3VTW A;  3ZDM C;  4ZYN A;  1WXM A;  2EKE C;  2KO3 A;  2C7H A;  4ANV A;  1WGR A;  2MQJ A;  3AI5 A;  3APC A;  5JZE B;  2L3Z A;  3M95 A;  2JF5 A;  2AEH A;  2LAS A;  5CHW A;  1WGD A;  3ALB A;  3UIO B;  1V2Y A;  3JYU A;  3QAR A;  3ML8 A;  2G4S A;  4MGY E;  4DHZ B;  3UIP B;  2D3G A;  2KKC A;  1V49 A;  2LZ6 A;  1S1Q B;  1WGH A;  2KTR A;  3L54 A;  3DCG A;  4PS7 A;  4M0W B;  2C5L C;  2GBJ A;  2BKF A;  3IBE A;  3VHT C;  4MGI E;  3PRZ A;  2Z0D B;  3WAN A;  3OJ4 B;  2KX0 A;  4IWQ A;  2MLB A;  1V5T A;  2C7M B;  3I3T B;  3PLU A;  4GXB A;  3VAW A;  3QQ8 B;  3DDC B;  3T9L A;  2J0M A;  2KDF B;  2ZPY A;  3PHW B;  2MW5 A;  2DAF A;  1E8W A;  4AJW A;  2REX A;  4MEL A;  4K7U A;  4TQ0 A;  1Z5S B;  3LJ3 A;  4ICV A;  3VUW A;  2FID A;  4KZ0 A;  5AEK B;  3WA0 A;  4EZJ A;  1YD8 U;  2C60 A;  3EC8 A;  4W9H A;  2DZM A;  4MM3 A;  1EF5 A;  1EO6 A;  1I42 A;  4TKN A;  3ZDT A;  3JW0 X;  5JHA A;  1YX6 B;  3EHV A;  3IG3 A;  3RT3 B;  1VD2 A;  2XEW A;  3X0W A;  2LVP A;  4F1S A;  3B08 A;  2MBE A;  4HDQ A;  5D6J B;  4ANU A;  4GSW A;  4MGZ E;  1IYF A;  3A1Q A;  4GU2 A;  4J6I A;  4KSK C;  1H4R A;  2IYD B;  1YJ1 A;  4XC2 A;  4BVU C;  5AZG A;  2KDE B;  1WFY A;  4AOF A;  1V5O A;  2KLG A;  4OVV A;  3H7S A;  4AWJ A;  2XK5 A;  1WX9 A;  3TBL D;  2LGD A;  2V3S A;  2IO0 B;  3QCA A;  2IO2 B;  1P9D U;  2C7N B;  2CKH B;  4ICU A;  3DVG Y;  3V60 A;  4ASW C;  2KTR B;  1V81 A;  3VUY A;  2JXX A;  4P7I A;  1NI2 A;  1R4N I;  2GBM A;  3VFK A;  5IA7 A;  1P98 A;  2WWZ A;  5HKH A;  3IVF A;  1WZ0 A;  3DBS A;  2ZEQ A;  3PLV A;  1WZ3 A;  4E71 A;  4HLE A;  1Z2M A;  5DPW A;  3QA8 A;  5L83 A;  1IP9 A;  2CHX A;  3NY5 A;  4I6L B;  1J8C A;  4W9E A;  2PE9 A;  4G11 A;  2ZNV C;  4KV2 A;  3PV1 A;  2BKR B;  4EEW A;  4W9D A;  1X1M A;  3CST A;  2NCN A;  4NJ7 A;  5JHB A;  1V6E A;  4FAD A;  3PZD A;  4AJY B;  4HJK A;  2KMA A;  4BKG A;  3VVW B;  3QC8 B;  2JVC A;  4N9F 4;  1GC6 A;  2LGX A;  3ZUN A;  1SE9 A;  3QWZ B;  4FLH A;  1C3T A;  3ZRC A;  4IWO A;  4IW0 A;  2G45 B;  2KJR A;  2O2V A;  2ZVO A;  3A1Q B;  4LDT B;  4IUM B;  4W9C A;  4WJN A;  1TGZ B;  2LVQ A;  3GOE A;  5DPR A;  4BOZ B;  2RPQ A;  4BKT A;  3ZLZ A;  2L0T A;  3A4S C;  4WJO A;  3V6C B;  2XK5 B;  3A9K A;  2LWP A;  2NPT A;  4IM0 A;  4ZRK A;  4XX5 A;  4JQW C;  3QJZ A;  4DHJ B;  2KQS A;  2LXC A;  4NQK E;  2UWQ A;  5KHO A;  2JPH A;  1WI0 A;  3LDZ E;  3N30 A;  3QIJ A;  4KDL B;  1GUA B;  4LDT D;  2MP2 A;  4HCN B;  2GBN A;  3PHX B;  1LFD A;  2FCS A;  4W9J A;  2KFK A;  1WR1 A;  2MRP A;  2KDI A;  2KZR A;  1R4M I;  3AU5 A;  1UGM A;  5CX3 A;  2PJH A;  1PQS A;  4RMA A;  1G6J A;  2KX3 A;  3DBH I;  2N9P C;  1GC7 A;  1OGW A;  1UD7 A;  2C9W B;  2DZI A;  3NZU A;  4K81 A;  4MSQ B;  4DHJ D;  4FUL A;  4WWP A;  1WMH A;  1WM2 A;  2D2Q A;  4WQO B;  3UIN B;  1LM8 B;  1ZKH A;  4BOS C;  2IO1 B;  1RFA A;  2CHW A;  2WYQ A;  3V62 A;  1KLV A;  2DZJ A;  1XQQ A;  2AYO B;  3MTN B;  1Q0W B;  3KH0 A;  3QX1 A;  4FN2 A;  4MH0 E;  2KN5 A;  3IHP C;  2LXA A;  1UZX B;  2JY6 A;  4GIV A;  5J2R A;  3W1S C;  2VRR B;  1LQB A;  1EF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...