4A20A

Crystal structure of the ubl domain of mdy2 (get5) at 1.78a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
b'AAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN-LIKE PROTEIN MDY2
publication title Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 18
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a20A00
2CHZA 3TBLD 3V6CB 5C1ZA 5IA7A 3AU5A 3ZLZA 4A20A 1GG3A 4G11A 5IAAC 1WMHB 3ALBA 3ECIA 1LQBA 3DCGA 1L7YA 1LM8B 1V9JA 5EDSA 2CU1A 2R2QA 2KTRA 2JWZA 3PZDA 1P0RA 1V5TA 2JF5A 1V80A 3V6EB 3VDZA 3VTUA 1WX8A 2M1MA 3MTNB 4KSKC 4DWFA 3ZNHB 1QZEA 1WI0A 4DDID 3ZDMC 4DDGD 2IY0B 1GJZA 4F7ZA 4HCNB 2KVRA 2LWPA 2D11A 3H7PA 4W9FA 1P1AA 1WJUA 4MSMB 3ZNID 2G4SA 5L95C 1UD7A 1IPGA 4AOFA 1AARA 1WY8A 2XK5A 4BOZB 4B9KA 2MBBB 4DHZE 5L83A 4IM0A 2LXCA 2GBKA 3UF8A 3TJPA 2CHWA 1E90A 3L13A 1E8YA 1CMXB 3JYUA 4MGIE 4RM9A 3ZIMA 4KZCA 3N30A 1UH6A 2BPSA 3VHTC 4OVUA 3VUYA 4HWIB 1C1YB 2Z59B 3CMMB 3EECA 3NOBA 4LDTD 4GSWA 3ZNGC 5DPWA 3ML8A 4BKTA 2FNJB 3JSVA 5G2NA 3U30A 3MJWA 3QWZB 2D3GA 2MP2A 5CHFA 4HDOA 4XX5A 3VXWA 4FA6A 2NR2A 2OOBB 2YVCA 3SD5A 3HIZA 1JRUA 3WAPA 2L00B 1UBIA 4CO7A 2MCNB 3RZFA 2JRHA 3VQIA 4E3CA 3QIJA 5C23A 1KM7A 2KJHB 3APFA 4LDTB 5D7GA 1TGZB 2N1VA 4FN2A 4A3PA 3DVNU 1L2NA 2LRWA 4BBNC 2L8JA 1WGYA 4WWOA 2N7DA 4ZYNA 3I3TB 2KN5A 4W9EA 4NY0A 3W1YA 2BWES 2DYMA 1P9DU 1RFAA 2DYOA 3SDLC 4JIOU 2KANA 4ZRKA 2IBIB 4DHZB 1X1MA 4TQ1A 2CHXA 3L54A 3QC8B 1WE7A 2GOWA 1LFDA 2KQSA 4KIKB 4M8MA 2REXA 5D94A 4BKGA 3M3JA 4MJSA 2IO2B 5E6NA 2LUEA 2LVOA 3C0RB 3KYCD 4MGYE 4PYUA 4EEWA 4PYZA 5JZEB 3K9OB 2KLCA 3JVZX 3VVWB 1C3TA 2KNBA 2A5UA 3KVFB 2C7NB 2MRPA 4AP4C 1XQQA 2NVUI 2UYZB 3A1QB 3L10B 4WJQA 3RCZA 2L76A 2ZZPB 2B3AA 3RYTA 4TKNA 3PHWB 1WGDA 2O2VA 3H1UA 2ASQA 4WWPA 3SU8X 4BOSC 4HXDA 1I35A 2HD5B 3PV1A 3V62A 3VH3B 4II2B 4LJOB 5J18A 2KTRB 4AWJA 2N4FA 3CF6E 4G50A 5LXIB 3R7RA 2C9WB 4FBJB 2AL6A 1IYFA 3QQ8B 1K8RB 1RAXA 1V86A 1WXAA 2FCQA 4IM3A 4W9IA 3PT2B 2YLMA 2XEWA 3DVGX 2LI5A 1G6JA 4IWOA 3PPAA 4K7SA 4IUMB 1Q5WB 3NY5A 4K1RB 4DBGA 4PS7A 2KHWB 2XK5B 4NNJB 2K39A 1GC7A 2C7MB 5CHWA 3DQVA 4KIKA 5CX3A 3NHEB 3PLUA 4GOCA 1SE9A 3PREA 3APDA 2EMTA 3SHQA 3V60A 3WAOA 2ZNVC 2C5LC 3TMPB 2KD0A 1WXVA 2CS4A 1TBEA 3APCA 3QARA 1UGMA 4HK2A 4IWQA 4ZRJA 5J2RA 3JSVB 2GBRA 1J8CA 5AEKB 3RUIB 4EKUA 4KZ0A 4W9GA 4MELA 2LGXA 4HCPB 4WAAA 1MG8A 3Q3FA 1BT0A 4K7WA 2KWVB 1WX9A 4MDKE 2CKHB 1ISNA 3BINA 3LDZE 5AZGA 4EZJA 3PHXB 3PRPB 2KFKA 1GNUA 3VH4B 2NCNA 3DBLI 4IWPA 4NAWA 1OGWA 4MGZE 1XD3B 2DZKA 3IFWB 1NBFC 2AYOB 4I6NB 2WWZA 4CYEA 1P3QU 3ZTCA 1S3SG 4WQOB 4NQLB 2G4DB 1EF5A 2PPHA 3U8ZA 3W1SC 2ZVNA 4EFOA 1UELA 5HKHA 2FIFA 2LJ5A 3DPDA 2ZCBA 3ZO5B 5JH5C 2M0XA 2JPHA 3NZSA 4G0NB 4TV3A 1J19A 4FADA 2PE6B 3WANA 5AZFA 2W9NA 3D32A 4NPNA 3WAMA 3H7SA 3L17A 2KC2A 2FCNA 1ZGUB 3AI5A 2KWUB 5E6PA 4GMVA 1WE6A 4MJSB 2V3SA 3W1SA 1WXSA 3M63B 4HDQA 1VD2A 3ZRFA 1S1QB 3OJ3A 1KJTA 4ANVA 3DDCB 2ZPNA 3X23A 4DXAB 2JT4B 4GIVA 2MA9B 3VUWA 1H8CA 2RSUA 3QJZA 4M8NA 2MLBA 4BFRA 1Z2MA 3UIPB 4JQWC 4ICVA 2O2VB 1OEYA 3IG3A 2J7QB 2K6QA 4MH0E 4DHJD 1P98A 2I1KA 2IZVB 3ENEA 3VUXA 4E74A 1YJ1A 2JUOA 5KHOA 5D6JB 1NDDA 2A4ZA 2JZ3B 5J17A 1V49A 4FJYA 5CTRC 4LCDE 1WGHA 2DX5B 2LVPA 2MQJA 4KVGB 2KJRA 4B95A 1E7UA 1OTRB 2L0FA 2JZZA 2NBUA 4GGQA 3H6NA 4TQ0A 4FHJA 4TUUA 4W9CA 3UQBA 2GMIC 2HTHA 2BWFA 3PSEB 2AL3A 2N1WA 2DZIA 3Q3JA 1XT9B 3CSFA 3ZDTA 4WJOA 3A9JA 3HK0A 3QCAA 2NPTA 2V4LA 1YX5B 2O6VD 4I6LB 4URKA 3IBEA 4IW0A 4BBNF 5FR6A 3ZTDA 4EZLA 3VTWA 1KLVA 1HE8A 4FHKA 2KFJA 4FULA 4RMAA 1V2YA 2KTFA 2L05A 1WIAA 3DVNV 4W9KA 5CHVC 2CR5A 2GBJA 2ZNVB 3V61A 2KMCA 4K81A 3UINB 1Z5SB 2BYEA 4AUQC 3QX1A 1V6EA 3T9LA 2KFKB 3A9KA 4W9HA 2FCSA 2LASA 1Q1OA 3MHSD 3WIMA 2RD0A 4A3OA 4B6WA 4NAWB 4BKSD 3ZW3A 2DAFA 3AU4A 3UQAA 2M17A 2BKFA 1YD8U 4J6IA 1I42A 2IO0B 4M0WB 2KLGA 2WYQA 2JY6A 4BVUC 2LGYA 5DCNA 3R3MA 3HM6X 3RULA 4NJ7A 2GBNA 2NBWB 2L7RA 2MSED 3N32A 1WFYA 2HJ8A 3L16A 1E8WA 2FIDA 1F9JA 4MEMA 3B08A 3ZVVA 1H4RA 1ZKHA 3DVGY 3M62B 3QAQA 2M8SA 3A4RA 2LRUA 1E7VA 1WZ3A 4PS3A 2KXJA 3B1LX 4YL8A 3RD2A 4XZ4A 4F8CB 4EZKA 2G45B 2BYFA 1GC6A 2WX1A 1YIWA 4W9JA 1WH3A 3WALA 4GDLA 2GBMA 2N9EB 3PGEA 4KDIC 2KX0A 3TCAA 2C7HA 2KDIA 3PVLA 1T0YA 1V81A 2UWQA 3RT3B 4FLHA 2FUHB 2FAZA 3R7QA 1E8ZA 2O6VA 4OVVA 3T8MA 1D3ZA 2M4NA 4CHKA 4NJ6A 2N9XA 1E5WA 4JGHB 4LJPB 3UGBB 2K8CA 3DBSA 1M94A 3JW0X 1KOTA 4I6PA 1GUAB 1R4MI 5D2MB 5KHQA 4NQKE 3PRZA 4FJZA 4ANWA 4ICUA 2D10A 4ZRIA 2LVQA 4IG7B 1YQBA 2DYBA 2ZCCA 3S2AA 1WZ0A 1EUVB 2IY1B 1WF9A 3R66C 2LZ6A 2R2OA 1WGRA 2RGFA 2XBBC 4K7UA 3KUDB 4ZDVA 3N3KB 4BKSA 2KWCA 3CSTA 3GOEA 2KDFB 3A9JB 2FCMA 1WJNA 2NPTB 3QHTA 3DBRI 3EFUA 1U4AA 1SIFA 4HVBA 2KQ7A 2D2QA 4GN1A 5JHBA 2KZRA 3DOWA 3PS6A 2MW5A 3H9DA 2OJRA 2C60A 3EC8A 4PS8A 1IP9A 1WRDB 3NS8A 1NI2A 2DHZA 3IHPC 3LJ3A 2KK8A 4XC2A 4GDKA 3A9KB 3KUCB 4F1SA 1UBQA 1WX7A 3RZWC 3AULA 5JHAA 2VRRB 2EKEC 5GMVA 2KX3A 2K25A 2Z0DB 3NZUA 4HPMB 1Q0WB 3OAWA 5DPSA 2ZPYA 2Z0EB 2BGFA 4X57B 2MX2A 1WMHA 4EOYA 3EHVA 2J0MA 2LXAA 1EO6A 1PQSA 2RPQA 1WM3A 2JVCA 1TZ1A 2QHOA 4DHJB 2IO1B 5LXHA 1WYWB 3ZNZB 4FJVB 2BKRB 2NS5A 3K9PB 3ZKJC 2MBQA 1WR1A 2V1YA 1RRBA 1TTNA 5E6OA 1RLFA 2PE9A 2N9PC 2KKCA 2IO3B 4HJKA 2K8BA 3KW5B 2AEHA 3WA0A 1WGGA 2KOXA 2JXXA 3IVFA 4GDLB 3PRMB 2DZMA 2N7EA 1WM2A 3P2BA 1WJ4A 5TR5A 2J0JA 2MWSB 1J0GA 2PJHA 3HM3A 3OLMD 4WJNA 4KSLC 2O6VB 2DENB 2KJ6A 4MM3A 2MBOA 4AJWA 4II3B 4HLEA 3VAWA 2NBVB 3O65B 2MBEA 3DBHI 3L0WB 2Y5BB 2KO3A 5DPTA 2K1FA 4ANXA 3HHMA 1R4NI 4AJYB 1A5RA 4MSQB 4WJPA 3TIXA 2IYDB 2RR9A 4KV2A 2KDEB 3VTVA 1ZW7A 5LLIA 1OQYA 2BYVE 4GXBA 2WDTB 2G3QB 2KC1A 3TL5A 3ZUNA 2MBHA 2WX0A 3QA8A 2K8HA 2D07B 3KYDD 4KDLB 2ZVOA 1OEYJ 3X0WA 4EUTA 1WXMA 2L3ZA 3A33B 3BY4B 3KH0A 3QK0A 2BF8B 3ONSA 3H7PB 4N9F4 4P7IA 5G55A 1YX6B 3KUZA 4ANUA 2DZJA 1Y8RC 4HPLB 2KDBA 5AZHA 2DAJA 4GU2A 3UIOB 2KMAA 4ASWC 4DK5A 1LXDA 2J0KA 1E8XA 4GB9A 4W9DA 5DPRA 1WR6E 2LD9A 3AXCA 3L08A 4RM8A 4W9LA 4G3XB 2L0TA 1VCBA 1UZXB 2ZJDA 3A4SC 2K6DB 3GZNI 3ZRCA 4IC7B 4E71A 2AWTA 3PLVA 1EF1A 3OJ4B 4GDKB 1SGHA 4IM2A 2LGDA 3U7DA 1WJ6A 2EMSA 3PTFC 2HE7A 2ZEQA 5BO4B 2PEAA 4MGKE 3VFKA 3A1QA 2I1JA 1V5OA 1FXTB 2JRIB 4JL9A 3B0AA 4JLCA 4WWNA 2MP2B 3M95A 3ML9A
chains in the Genus database with same CATH superfamily
3DHIC 1CQVA 3AU5A 3ZLZA 1GG3A 3Q69A 4P6VF 1WMHB 4YT0B 1JCKB 2M1MA 4KSKC 4DWFA 3AE5B 1AWDA 4DDID 4RFBA 4DDGD 2IY0B 4F7ZA 1TS4A 4HCNB 4RF0A 1YN4A 4W9FA 5L95C 1FNUA 1QLBB 4AOFA 1YNTE 3N20C 3L13A 1E8YA 4WWMA 4RM9A 4HWIB 1C1YB 4LDTD 3EECA 5DPWA 1C9FA 4GSWA 3LXFA 3ML8A 2FNJB 4HDOA 3SFDB 1YJJA 2NR2A 2OOBB 3SD5A 3I57A 2L00B 1UBIA 1UUPA 4XE0A 1TGZB 4LTUA 3DWGC 2BW2A 1L2NA 2IPKD 4NY0A 1SE4A 1RFAA 2DYOA 2R61A 4YXDB 4JIOU 3AE8B 1WE7A 3W5VB 4IOIE 4ZHPA 1LFDA 2KQSA 2K9XA 1MG4A 5E6NA 2LUEA 4PYUA 4EEWA 1HZ5A 2KLCA 3VVWB 5H92C 1MHXA 4AP4C 1XQQA 1ZE3D 2H89B 2NTTA 4OW0A 1B9RA 2KVZA 2KDMA 2O2VA 4WWPA 3SU8X 1I35A 2HD5B 2BVCA 3PV1A 3V62A 4II2B 4P1BC 5J18A 2W3RA 3NVZA 3R7RA 4FBJB 3AEFB 3I9V1 3QQ8B 1K8RB 4IM3A 1IGDA 2K3UA 1V8CA 1EWYC 2VZKB 3DVGX 2LI5A 4O1NA 1ZXIA 2FE8A 4P16A 1TYGB 1Q5WB 3NVVA 4PS7A 2KHWB 2XK5B 2K39A 1GC7A 2KAJA 3DQVA 1V1OA 2RDHA 3PLUA 4GOCA 4QAYA 3APDA 2EMTA 3SHQA 3V60A 3WAOA 3N9YC 2KD0A 3QARA 3ZXRA 5J2RA 4IWQA 3JSVB 1J8CA 1UWXA 3RUIB 4EKUA 4W9GA 2LGXA 1FCLA 1BT0A 2KWVB 1YOVB 3BINA 2BS4B 2KFKA 3DBLI 4IWPA 4NAWA 2EELA 2DZKA 2AYOB 2WWZA 4CYEA 1P3QU 2Y3AA 2WXRA 1YJIA 1S3SG 3WCQA 4Q2JA 5E6JA 3NZSA 1J19A 5IKCM 2W9NA 3UI3A 2WXNA 4NPNA 3TSSA 3AI5A 5TSSA 4GMVA 1I4HA 4MJSB 2V3SA 1D5XC 3M63B 3DBLB 3DDCB 1STEA 1H8CA 4S17A 2BB6A 2G9HD 4ICVA 2K6QA 4DHJD 1P98A 2I1KA 3VUXA 1EM7A 5D6JB 3R2TA 4XDDA 1ZDVA 1V49A 4LCDE 2ICIA 4KVGB 1E7UA 3DBRB 1QQRA 4TUUA 2GMIC 2HTHA 4US8A 3PSEB 3Q3JA 1C76A 1XT9B 4WJOA 3U4EG 4JE3B 1YX5B 1JW9D 3RI7C 4IW0A 4EZLA 4FHKA 3KQ4A 4ZRPA 1V2YA 2L05A 3ZJUA 2WXLA 2GBJA 2ZNVB 4ZYSA 2NTSA 4YTMB 4OHJA 3QX1A 3V05A 2FCSA 3MHSD 4LNNA 1NYQA 2RD0A 4YSXB 1TS2A 2M17A 3UQAA 1YD8U 1I42A 2KLGA 4BVUC 1JWSD 2NBWB 4YTNB 3L16A 2QCZA 2FIDA 1JMLA 1XO3A 3KWVA 1UWMA 3HUIA 3QAQA 3NRZA 2KXJA 2XN9C 4EZKA 3FAHA 2WX1A 1YIWA 4GDLA 4OVZA 1ZP0B 2N9EB 1KTKA 3TCAA 1T0YA 3R7QA 3ZJTA 1T0RC 1F0ZA 4FXCA 4OVVA 2ZW0A 1HTQA 2PW9A 3GB1A 4JGHB 1L0VB 2WXJA 1KOTA 2L52A 4I6PA 1R4MI 1D6EC 3PRZA 2D10A 4ZRIA 4IG7B 2JXTA 1WZ0A 1EUVB 2IY1B 1WF9A 2XBBC 4JX1C 2WXQA 4A6QA 2FCMA 5HG2A 3QHTA 1V97A 4HVBA 4WURA 1AN8A 4BZAA 4GN1A 5MPOA 5JHBA 3H9DA 1R4MB 1WRDB 2RPVA 2QIEB 4GDKA 3A9KB 1IUEA 1WX7A 3MJ5A 5JHAA 5GMVA 3VRAB 5EE0A 4X57B 2LXAA 1XLQA 3GP7A 2JVCA 2PTLA 2WLBA 2IO1B 3BVZA 2ONQA 2MBQA 1WR1A 4J3OD 3OWEB 3EA6A 1L6UA 4HJKA 2HDEA 3KW5B 3WA0A 2KOXA 2JXXA 3PRMB 1I4PA 2N7EA 2RDGA 4A55A 3P2BA 1I4GA 1HQRD 3RNEC 2PJHA 3P63A 2O6VB 2JSVX 2MBOA 3FC4A 4HPPA 4OZBA 1QILA 1RWSA 3VAWA 2K1FA 3HHMA 1BXTA 4MSQB 2IYDB 3VTVA 3HVDA 1KLGD 3ZUNA 3TL5A 4WIPA 2MBHA 3QA8A 4EUTA 1OEYJ 3BY4B 1A70A 1YX6B 3KUZA 4C00A 2DZJA 2EKIA 2KDBA 3AM9A 4GU2A 5AZHA 2KMAA 1E8XA 2LD9A 4W9LA 2L0TA 2K0PA 3ZRCA 2AWTA 3PLVA 4IM2A 3FKYA 2JWUA 2JRIB 1V5OA 3B0AA 4AJWA 4KX6B 2MP2B 2LGIA 5I4DA 3TBLD 5C1ZA 5IA7A 4A20A 1TY0A 3ALBA 5IAAC 3DCGA 1LM8B 2KTRA 2JWZA 1IBXA 1P0RA 3V6EB 1F77A 1RFKA 3MTNB 4OZAA 1QZEA 5EE1A 4JWUC 1WI0A 2W55A 1GJZA 3B9JA 2KVRA 1WJUA 4MSMB 3ZNID 1UD7A 5D3IB 4DHZE 1AW7A 1CMXB 1SEBD 4KZCA 3Q3OC 3IXSA 1WWTA 4AQ7A 4OVUA 2WXKA 3NOBA 3CMMB 3ZNGC 1Q10A 5G2NA 3MJWA 4KKIA 2MP2A 4FA6A 2L83A 2YVCA 3E9SA 3HIZA 1JQ4A 1JRUA 3KLSX 3RZFA 1TKGA 2E6XA 3VQIA 5C23A 3APFA 4LDTB 1L0XB 4FN2A 3EFCA 3Q8AA 4WWOA 1SE3A 3I3TB 2M19A 3W1YA 4K3CA 1NYRA 2RDBC 4ZRKA 1XLPA 2GOWA 1NVID 3AE2B 1K52A 4M8MA 2REXA 5D94A 4BKGA 3M3JA 2KACA 2IO2B 1HEZE 2LVOA 3KYCD 5JZEB 1I4QA 1C3TA 3GE8C 2MRPA 2UYZB 3L10B 3BYYB 4WJQA 3RCZA 3PHWB 1WGDA 3H1UA 4BOSC 4HXDA 2D3AA 3AECB 4LJOB 2G1EA 2N4FA 3CF6E 4G50A 2C9WB 3P4QB 2DBYA 1IYFA 2FCQA 1WXAA 3C8YA 3Q8EA 1G6JA 3PPAA 4IUMB 3NY5A 2J53A 2WQYB 2QSDA 2YEPB 4A90A 3PREA 2WXFA 2M0AA 1NENB 2C5LC 3TMPB 4YSZB 2JX5A 2CS4A 1TBEA 2GBRA 4C4VA 3TEYA 1ISNA 3LDZE 2BBCA 1JALA 1GNUA 3ZGZA 2KQ4X 1XEEA 1PDXA 1OGWA 4XWWA 1NBFC 4I6NB 5HKHA 1UELA 1OQRA 2LJ5A 3DPDA 2ZCBA 4B0MA 3ZO5B 4G0NB 4FADA 4NJCA 4XWTA 3D32A 3AE1B 1QOGA 1FXIA 2KC2A 4B0EA 1WXSA 2WXGA 1TS5A 4ANVA 2ZPNA 1DOXA 4DXAB 2JT4B 1HZ6A 4BFRA 2O2VB 1OEYA 2GB1A 3IG3A 4MH0E 2LHDA 3OG5A 4E74A 1YJ1A 5KHOA 4M02A 2JZ3B 1L5PA 4FJYA 2BB5A 4P1CC 2BQQA 2KJRA 1OTRB 1FMAD 2L0FA 3H6NA 4FHJA 3B2GA 2BWFA 1YN3A 5IO9A 3MHZA 1XCTL 3NZ3A 3ZDTA 1I4RA 3A9JA 1TS3A 2NPTA 2V4LA 4BBNF 3ZTDA 1HE8A 4FULA 3DVNV 3V61A 2M56B 2KMCA 4AUQC 3AE3B 3T9LA 2KFKB 2LASA 3WIMA 1MI0A 3N1YC 4DXFA 4B6WA 4NAWB 2MJ3A 1YMHE 4XGAB 2DAFA 2BKFA 2CJNA 5HI1A 2JY6A 4OZCA 2OJWA 2LGYA 2D3CA 4NJ7A 2Q5WD 1MVKA 3TEWA 1HA5A 1N60A 1F9JA 1XXGA 4L23A 1T3QA 1DYQA 3M62B 3A4RA 5BMHA 4XZ4A 3O13A 1XLOA 5FK9C 3PGEA 4KDIC 1GPXA 2KDIA 1L6VA 1T0SC 3C19A 3RT3B 3DBHB 1ET9A 2ZW1A 3BZDB 1TIFA 2KWDA 2WDVB 3ABVB 3JW0X 3CIRB 2IGDA 5HHDG 4WH4A 4ICUA 2B76B 3I5JC 3J9CA 3R66C 2W82A 4N6EB 1WGRA 2BS3B 3N3KB 1TJEA 3GZNB 2VH2A 1OQQA 1WJNA 3DBRI 2N0SB 1U4AA 5AUKA 4RF1A 5G5HA 2MW5A 2OJRA 5BYSA 3EC8A 1LO5D 2MEKA 1QKZA 1GB1A 4F1SA 3RZWC 3NVWA 4RNAA 1FIQA 4RGNA 1Q0WB 3OAWA 2CU3A 2INDC 2BGFA 1PQSA 2RPQA 3PO0A 1WM3A 1ZDXA 2LMCA 2TSSA 2AQ2B 2QHOA 5LXHA 1PUTA 3ZNZB 4FJVB 2NS5A 3K9PB 3NS1A 5E6OA 1RLFA 3AV8A 4AS1A 3AE9B 3AE7B 1E10A 4GDLB 2MJEA 2DZMA 5EE9A 5T8IA 4HEA1 2MWSB 3HM3A 2AQ3B 2DENB 1P7FA 1FD6A 4AJYB 1A5RA 3BVGA 3TIXA 3CWIA 5HFYA 4GXBA 1FPYA 2G3QB 1PYWD 4UDUC 3W9CB 3X0WA 2ZVOA 4M01A 3KH0A 2BF8B 3ONSA 5G55A 4N9F4 2N7JA 1LGRA 1Y8RC 4HPLB 4ASWC 2D5GA 5BYQA 2J0KA 4K3BA 4W9DA 1JWUD 1WR6E 4G3XB 2OEDA 1UZXB 3AMZA 2K6DB 2J4XA 2LGSA 1EF1A 4GDKB 3U7DA 1WJ6A 2J52A 2ZEQA 2PEAA 2IJ0A 3A1QA 2I1JA 1UF0A 4JLCA 4WWNA 3Q6BA 4RGTA 1ESFA 3ECIA 3IT4B 1V9JA 1ZXHA 5EDSA 2CU1A 2MJDA 2R2QA 3VDZA 1V80A 1WX8A 2QDFA 5BMGA 3ZNHB 3URYA 3ZDMC 1N63A 4LNFA 2D11A 3AEEB 1P1AA 1IPGA 1AARA 1WY8A 4B9KA 2MBBB 5L83A 3RNAC 3SR6A 2LXCA 2CHWA 1E90A 3JYUA 4WAFA 2LHEA 4MH8A 2Y5PA 1RYJA 4BKTA 3U30A 3QWZB 3AE4B 5CHFA 3VXWA 3VRBB 2E3TA 2MCNB 2X38A 2JRHA 3QIJA 1KM7A 5D7GA 2N1VA 2LRWA 4BBNC 4KKJA 2NMQA 2KN5A 1ROEA 2BWES 2QMTA 1P9DU 3SDLC 4C7ZA 1X1MA 2ON8A 3L54A 3QC8B 4KIKB 1C4PA 3RPFC 1DGJA 4LK0M 4MGYE 4C7YA 4MT5A 2A5UA 3KVFB 3IT6B 2C7NB 2NVUI 1BUIC 2L76A 3T3NA 1J7CA 3RYTA 3P1MA 3Q14C 1TKYA 3IAM1 1FRDA 2KTRB 1IBXB 4AWJA 5LXIB 4TSSA 5JXVA 1KF6B 2AL6A 2LFIA 1RAXA 4W9IA 4DXGA 5C3JB 4K7SA 4K1RB 4DBGA 3AB5A 4KIKA 3ZXVA 3NHEB 3AEAB 4HKZE 1VRAB 1WXVA 3APCA 1V1PA 4ZRJA 1E6EB 5AEKB 4KZ0A 4MELA 3NUHB 3Q8BA 4HCPB 3Q3FA 4WAAA 2KMMA 4MDKE 2CKHB 5AZGA 2WXOA 4EZJA 3PHXB 3VH4B 3B2FA 2WP9B 4MGZE 3IFWB 1CZPA 3TEXA 1K50A 4WQOB 2G4DB 3W1SC 1VZ8A 4EFOA 3W5UB 5GXGB 2BYTA 2M0XA 2JPHA 2PE6B 3WANA 5AZFA 3AH7A 3GE3C 2INNE 3H7SA 1ZGUB 2KWUB 5E6PA 4ZHOA 2V3NA 3W1SA 1E9MA 3ZRFA 4HDQA 1S1QB 1PFDA 1C77A 2WDRB 1KJTA 4GIVA 3VUWA 2RSUA 3QJZA 4M8NA 1C79A 3UIPB 4JQWC 3RNFC 2J7QB 2IZVB 1ACCA 1NDDA 1F2RC 2N9LA 3BVMA 5J17A 1N5XA 2DX5B 2LVPA 2MQJA 4B95A 5AUIA 1N61A 2NBUA 4W9CA 2AL3A 1VZ7A 1B1ZA 3CSFA 4HJGE 3HK0A 2L1AA 2O6VD 4URKA 3IBEA 1KLVA 3T3OA 2KFJA 4RMAA 1SIJA 1SBBB 4W9KA 2CR5A 4C4VB 4K81A 3Q8FA 2BYEA 4LLGM 1V6EA 4W9HA 3W2DA 2V3PA 2WXHA 1T5XD 4BKSD 1WYGA 3AU4A 2IO0B 1M4VA 1TT5B 3PZ7A 1TY2A 3HM6X 3RULA 1NEKB 1EU4A 2L7RA 2MSED 3N32A 3SFEB 2IGHA 1FEHA 2SEBD 1K51A 1WFYA 1XCQL 1N6ZA 1E8WA 3RNCC 4MEMA 2MH7A 4L1BA 1H4RA 4M00A 1ZKHA 4RH6A 3DVGY 2LRUA 1E7VA 3B1LX 3RD2A 4W9JA 1WH3A 2GBMA 2WU5B 2UWQA 2FUHB 1Y56A 1D4BA 2V0GA 2QEJC 1ENFA 2KN4A 4LJPB 3DBSA 5D2MB 1GB4A 1SE2A 4FJZA 4L2YA 5FKAC 4ANWA 2DLBA 2LVQA 2DYBA 2ZCCA 2LZ6A 2R2OA 2RGFA 3CSTA 2KDFB 3A9JB 1MHHE 2NPTB 3EFUA 1SIFA 2KQ7A 3KWLA 5C2TB 2QILA 2KZRA 3DOWA 4PS8A 3IAS1 4EE2A 1NI2A 2L32A 1C4CA 3IHPC 2KK8A 4JPSA 3N1ZC 2PMVA 4LNKA 2JQRB 1CJEA 4MM3B 1SJHD 1D5MC 2Z0DB 4HPMB 4EOYA 2MX2A 1WMHA 2J0MA 1EO6A 3L4PA 4DHJB 3GS2A 1ET6A 2KYWA 1RRBA 5D3DA 4C56C 2X8XX 2PE9A 1YN5A 2IO3B 2K8BA 2AEHA 1WGGA 3SEBA 1DOIA 1J0GA 3DHGC 2XNAC 3OLMD 2D3BA 4KSLC 5IOIA 2KJ6A 4MM3A 4II3B 2PIAA 2GLSA 4IDIA 3O65B 3DBHI 2KO3A 1JWAD 4N58A 4ANXA 2GRIA 3R2IA 4WJPA 2RR9A 4KV2A 1L4ZB 2BYVE 2WDTB 3ZQ4A 2KC1A 1T6BX 3Q3MC 3HRDD 2WX0A 2K8HA 2D07B 2WGSA 1WXMA 3A33B 3E56A 3QK0A 4P7IA 3H7PB 4ANUA 1N62A 2JYEA 4US9A 2DAJA 1AYFA 4DK5A 4GB9A 1L0YB 1PGXA 4YWGG 4ZOHC 4YTPB 1VCBA 3RNGC 3GZNI 4IC7B 3OJ4B 3NJTA 3R8BA 2HJ1A 2LGDA 2EMSA 3AEBB 3PTFC 2HE7A 5BO4B 3VFKA 1E7PB 1CK1A 4JL9A 1FXTB 2LUMA 3ML9A 2CHZA 1QOBA 3V6CB 4USAA 2K5PA 4G11A 4R3DA 1LQBA 2I2YA 1FRRA 1UNSA 1L7YA 2N9KA 3DWMA 1F52A 3PZDA 1V5TA 1D5ZC 2JF5A 4JWSC 3VTUA 4ARIA 2BTEA 4NZLB 3BIID 4WQMA 2LWPA 3H7PA 3AE6B 2BT6A 2RMMA 2G4SA 1WGKA 2XK5A 1KH0A 4BOZB 1VDVA 4IM0A 2GBKA 1XF5L 3AN1A 3TJPA 3UF8A 3V3XA 4MGIE 3ZIMA 2GI9A 3VHTC 3N30A 1UH6A 2BPSA 3VUYA 2Z59B 2DWQA 3JSVA 4TMAB 2FUG1 4YSYB 2D3GA 2FBWB 4XX5A 3MC9A 3EUB2 3WAPA 4CO7A 2V9HA 4E3CA 1UGJA 2KJHB 4A3PA 3AEDB 3DVNU 1R7SA 2L8JA 1WGYA 2N7DA 2LEKA 4ZYNA 4W9EA 2DYMA 2KANA 2H88B 2IBIB 4MACA 4DHZB 4TQ1A 2CHXA 3HVZA 2KT7A 1WRIA 3U7ZA 3ETRA 4A8XC 3BK1A 4MJSA 3C0RB 2BS2B 4PYZA 3K9OB 3JVZX 2J42A 2MHJA 3P4PB 5H8YE 2KNBA 1FCCC 1YQ4B 3Q8CA 3RN9C 3A1QB 2W3SA 2VZKD 5EE3A 2ZZPB 2B3AA 3BK2A 1QF6A 4TKNA 2ASQA 1VJKA 1MPEA 3VH3B 1QT9A 3NG0A 3LB8C 3FILB 1KFYB 1V86A 3PT2B 2YLMA 3U52E 2XEWA 3RFZB 1JWBD 4IWOA 1IGCA 1KRHA 4NNJB 2C7MB 3TEZA 5CHWA 5CX3A 1SE9A 2HTME 4DQOC 4PK1A 2ZNVC 2IGGA 3P4SB 4BAXA 4HK2A 1UGMA 1TKEA 1MG8A 2PVGC 4K7WA 1WX9A 1SF0A 5BMIA 3PRPB 3FILA 2NCNA 1XD3B 3DHHC 3N1XC 3H8HA 4D2KA 3ZTCA 3P4RB 2QJLA 4NQLB 3U8ZA 1EF5A 2PPHA 2ZVNA 1HTOA 2FIFA 1WSPA 5JH5C 4TV3A 1PGAA 2ACZB 4RGMA 3WAMA 3L17A 2FCNA 1WE6A 2YEPF 4RCOA 3TUOA 1VD2A 1FM0D 3OJ3A 1FFUA 3BYTB 3MFGA 3X23A 2WXPA 2MA9B 1SB3C 2MLBA 1FFVA 1JWMD 1Z2MA 2PKOA 3ENEA 4PT5A 2JUOA 2A4ZA 5CTRC 1WGHA 1BMLC 1C78A 4GGQA 2JZZA 4TQ0A 1VLBA 4XYCA 3UQBA 1PGBA 2N1WA 2DZIA 1EU3A 3VR9B 1JRPA 3QCAA 4I6LB 4ARCA 1E0ZA 4ZRQA 1V1PB 5FR6A 2I38A 4REZA 3VTWA 2INPE 2CJOA 1KLUD 2KTFA 5CHVC 1WIAA 2SAKA 3UINB 1Z5SB 2QC8A 3A9KA 3Q2AC 4KGTA 1Q1OA 2AQ1B 4KGRA 2K22A 4A3OA 3NVYA 3ZW3A 2UU7A 1P7EA 1ZPSA 4J6IA 2VH1A 4M0WB 2WYQA 5BYRA 1I4XA 1TZOA 2INCC 5DCNA 3Q3NC 3R3MA 3MC0B 2GBNA 4HRSA 1J7AA 3AEGB 1NI3A 2HJ8A 1XLNA 1I7HA 3RNBC 3B08A 2WU2B 3ZVVA 1VR9A 2M8SA 5FR3A 1WZ3A 2WS3B 2AX5A 4PS3A 4YL8A 4F8CB 2G45B 2DNFA 2BYFA 1GC6A 3WALA 1HXYD 1F2RI 2KX0A 2C7HA 3PVLA 1GOZA 1V81A 4FLHA 2FAZA 1E8ZA 2O6VA 3T8MA 1D3ZA 4C80A 2M4NA 4CHKA 4NJ6A 2N9XA 5IN7A 1E5WA 3I63C 4M0WA 3UGBB 1FNVA 2K8CA 1M94A 1ZUD2 2LJIA 1GUAB 5KHQA 4ITKA 4NAMA 4NQKE 4A9AA 1YQBA 5LNK1 4S0RA 1RM6C 3S2AA 4K7UA 3KUDB 4ZDVA 4BKSA 2WXIA 2KWCA 3GOEA 3MP9A 4H2AA 2IDYA 4HROA 3P42A 2D2QA 1SXTA 3PS6A 1C4AA 1JROA 2OHFA 2C60A 1IP9A 3NS8A 2DHZA 4CQNA 3LJ3A 4XC2A 3KUCB 1UBQA 3AULA 2PLPA 2V4IB 2VRRB 2EKEC 2KX3A 5IP4D 1VZ6A 2K25A 4ACFA 3NZUA 5DPSA 1FO4A 2ZPYA 2Z0EB 1T0QC 3MC8A 1GAQB 1SSNA 3EHVA 1K53A 1TZ1A 1WYWB 2BKRB 1FXAA 4N59A 2Y5CA 3ZKJC 1ZOYB 2V1YA 1QOAA 3U2SC 3EGRA 1TTNA 2WDQB 2N9PC 2KKCA 4LNOA 4RGOS 2JYTA 3IVFA 1MFWA 3RMKC 3LYYA 1WM2A 1WJ4A 5TR5A 2J0JA 2PVOD 1J7BA 2WNMA 1L4DB 4WJNA 4IKGA 2WHIA 3ZYYX 4HLEA 1FNWA 2NBVB 4GLSC 2MBEA 5DPTA 3L0WB 2Y5BB 3PZ8A 1R4NI 4KGSA 2KDEB 1ZW7A 5LLIA 1OQYA 1SJED 4XDCA 4KDLB 3KYDD 3ZJVA 2L3ZA 1QOFA 1YQ3B 2Z8LA 3VR8B 4LNIA 3UIOB 1EWCA 2JZPA 1LXDA 5DPRA 4HKQA 1DOYA 3AXCA 4RM8A 3L08A 2ZJDA 1N5WA 3A4SC 4E71A 2WXMA 1MJDA 1R4NB 2JU6X 1SGHA 1WXQA 3BWUD 5G5GA 2W54A 4MGKE 1F1HA 3M95A 1OFFA
chains in the Genus database with same CATH topology
2CHZA 3TBLD 3V6CB 5C1ZA 5IA7A 3AU5A 3ZLZA 4A20A 1GG3A 4G11A 5IAAC 1WMHB 3ALBA 3ECIA 1LQBA 3DCGA 1L7YA 1LM8B 1V9JA 5EDSA 2CU1A 2R2QA 2KTRA 2JWZA 3PZDA 1P0RA 1V5TA 2JF5A 1V80A 3V6EB 3VDZA 3VTUA 1WX8A 2M1MA 3MTNB 4KSKC 4DWFA 3ZNHB 1QZEA 1WI0A 4DDID 3ZDMC 4DDGD 2IY0B 1GJZA 4F7ZA 4HCNB 2KVRA 2LWPA 2D11A 3H7PA 4W9FA 1P1AA 1WJUA 4MSMB 3ZNID 2G4SA 5L95C 1UD7A 1IPGA 4AOFA 1AARA 1WY8A 2XK5A 4BOZB 4B9KA 2MBBB 4DHZE 5L83A 4IM0A 2LXCA 2GBKA 3UF8A 3TJPA 2CHWA 1E90A 3L13A 1E8YA 1CMXB 3JYUA 4MGIE 4RM9A 3ZIMA 4KZCA 3N30A 1UH6A 2BPSA 3VHTC 4OVUA 3VUYA 4HWIB 1C1YB 2Z59B 3CMMB 3EECA 3NOBA 4LDTD 4GSWA 3ZNGC 5DPWA 3ML8A 4BKTA 2FNJB 3JSVA 5G2NA 3U30A 3MJWA 3QWZB 2D3GA 2MP2A 5CHFA 4HDOA 4XX5A 3VXWA 4FA6A 2NR2A 2OOBB 2YVCA 3SD5A 3HIZA 1JRUA 3WAPA 2L00B 1UBIA 4CO7A 2MCNB 3RZFA 2JRHA 3VQIA 4E3CA 3QIJA 5C23A 1KM7A 2KJHB 3APFA 4LDTB 5D7GA 1TGZB 2N1VA 4FN2A 4A3PA 3DVNU 1L2NA 2LRWA 4BBNC 2L8JA 1WGYA 4WWOA 2N7DA 4ZYNA 3I3TB 2KN5A 4W9EA 4NY0A 3W1YA 2BWES 2DYMA 1P9DU 1RFAA 2DYOA 3SDLC 4JIOU 2KANA 4ZRKA 2IBIB 4DHZB 1X1MA 4TQ1A 2CHXA 3L54A 3QC8B 1WE7A 2GOWA 1LFDA 2KQSA 4KIKB 4M8MA 2REXA 5D94A 4BKGA 3M3JA 4MJSA 2IO2B 5E6NA 2LUEA 2LVOA 3C0RB 3KYCD 4MGYE 4PYUA 4EEWA 4PYZA 5JZEB 3K9OB 2KLCA 3JVZX 3VVWB 1C3TA 2KNBA 2A5UA 3KVFB 2C7NB 2MRPA 4AP4C 1XQQA 2NVUI 2UYZB 3A1QB 3L10B 4WJQA 3RCZA 2L76A 2ZZPB 2B3AA 3RYTA 4TKNA 3PHWB 1WGDA 2O2VA 3H1UA 2ASQA 4WWPA 3SU8X 4BOSC 4HXDA 1I35A 2HD5B 3PV1A 3V62A 3VH3B 4II2B 4LJOB 5J18A 2KTRB 4AWJA 2N4FA 3CF6E 4G50A 5LXIB 3R7RA 2C9WB 4FBJB 2AL6A 1IYFA 3QQ8B 1K8RB 1RAXA 1V86A 1WXAA 2FCQA 4IM3A 4W9IA 3PT2B 2YLMA 2XEWA 3DVGX 2LI5A 1G6JA 4IWOA 3PPAA 4K7SA 4IUMB 1Q5WB 3NY5A 4K1RB 4DBGA 4PS7A 2KHWB 2XK5B 4NNJB 2K39A 1GC7A 2C7MB 5CHWA 3DQVA 4KIKA 5CX3A 3NHEB 3PLUA 4GOCA 1SE9A 3PREA 3APDA 2EMTA 3SHQA 3V60A 3WAOA 2ZNVC 2C5LC 3TMPB 2KD0A 1WXVA 2CS4A 1TBEA 3APCA 3QARA 1UGMA 4HK2A 4IWQA 4ZRJA 5J2RA 3JSVB 2GBRA 1J8CA 5AEKB 3RUIB 4EKUA 4KZ0A 4W9GA 4MELA 2LGXA 4HCPB 4WAAA 1MG8A 3Q3FA 1BT0A 4K7WA 2KWVB 1WX9A 4MDKE 2CKHB 1ISNA 3BINA 3LDZE 5AZGA 4EZJA 3PHXB 3PRPB 2KFKA 1GNUA 3VH4B 2NCNA 3DBLI 4IWPA 4NAWA 1OGWA 4MGZE 1XD3B 2DZKA 3IFWB 1NBFC 2AYOB 4I6NB 2WWZA 4CYEA 1P3QU 3ZTCA 1S3SG 4WQOB 4NQLB 2G4DB 1EF5A 2PPHA 3U8ZA 3W1SC 2ZVNA 4EFOA 1UELA 5HKHA 2FIFA 2LJ5A 3DPDA 2ZCBA 3ZO5B 5JH5C 2M0XA 2JPHA 3NZSA 4G0NB 4TV3A 1J19A 4FADA 2PE6B 3WANA 5AZFA 2W9NA 3D32A 4NPNA 3WAMA 3H7SA 3L17A 2KC2A 2FCNA 1ZGUB 3AI5A 2KWUB 5E6PA 4GMVA 1WE6A 4MJSB 2V3SA 3W1SA 1WXSA 3M63B 4HDQA 1VD2A 3ZRFA 1S1QB 3OJ3A 1KJTA 4ANVA 3DDCB 2ZPNA 3X23A 4DXAB 2JT4B 4GIVA 2MA9B 3VUWA 1H8CA 2RSUA 3QJZA 4M8NA 2MLBA 4BFRA 1Z2MA 3UIPB 4JQWC 4ICVA 2O2VB 1OEYA 3IG3A 2J7QB 2K6QA 4MH0E 4DHJD 1P98A 2I1KA 2IZVB 3ENEA 3VUXA 4E74A 1YJ1A 2JUOA 5KHOA 5D6JB 1NDDA 2A4ZA 2JZ3B 5J17A 1V49A 4FJYA 5CTRC 4LCDE 1WGHA 2DX5B 2LVPA 2MQJA 4KVGB 2KJRA 4B95A 1E7UA 1OTRB 2L0FA 2JZZA 2NBUA 4GGQA 3H6NA 4TQ0A 4FHJA 4TUUA 4W9CA 3UQBA 2GMIC 2HTHA 2BWFA 3PSEB 2AL3A 2N1WA 2DZIA 3Q3JA 1XT9B 3CSFA 3ZDTA 4WJOA 3A9JA 3HK0A 3QCAA 2NPTA 2V4LA 1YX5B 2O6VD 4I6LB 4URKA 3IBEA 4IW0A 4BBNF 5FR6A 3ZTDA 4EZLA 3VTWA 1KLVA 1HE8A 4FHKA 2KFJA 4FULA 4RMAA 1V2YA 2KTFA 2L05A 1WIAA 3DVNV 4W9KA 5CHVC 2CR5A 2GBJA 2ZNVB 3V61A 2KMCA 4K81A 3UINB 1Z5SB 2BYEA 4AUQC 3QX1A 1V6EA 3T9LA 2KFKB 3A9KA 4W9HA 2FCSA 2LASA 1Q1OA 3MHSD 3WIMA 2RD0A 4A3OA 4B6WA 4NAWB 4BKSD 3ZW3A 2DAFA 3AU4A 3UQAA 2M17A 2BKFA 1YD8U 4J6IA 1I42A 2IO0B 4M0WB 2KLGA 2WYQA 2JY6A 4BVUC 2LGYA 5DCNA 3R3MA 3HM6X 3RULA 4NJ7A 2GBNA 2NBWB 2L7RA 2MSED 3N32A 1WFYA 2HJ8A 3L16A 1E8WA 2FIDA 1F9JA 4MEMA 3B08A 3ZVVA 1H4RA 1ZKHA 3DVGY 3M62B 3QAQA 2M8SA 3A4RA 2LRUA 1E7VA 1WZ3A 4PS3A 2KXJA 3B1LX 4YL8A 3RD2A 4XZ4A 4F8CB 4EZKA 2G45B 2BYFA 1GC6A 2WX1A 1YIWA 4W9JA 1WH3A 3WALA 4GDLA 2GBMA 2N9EB 3PGEA 4KDIC 2KX0A 3TCAA 2C7HA 2KDIA 3PVLA 1T0YA 1V81A 2UWQA 3RT3B 4FLHA 2FUHB 2FAZA 3R7QA 1E8ZA 2O6VA 4OVVA 3T8MA 1D3ZA 2M4NA 4CHKA 4NJ6A 2N9XA 1E5WA 4JGHB 4LJPB 3UGBB 2K8CA 3DBSA 1M94A 3JW0X 1KOTA 4I6PA 1GUAB 1R4MI 5D2MB 5KHQA 4NQKE 3PRZA 4FJZA 4ANWA 4ICUA 2D10A 4ZRIA 2LVQA 4IG7B 1YQBA 2DYBA 2ZCCA 3S2AA 1WZ0A 1EUVB 2IY1B 1WF9A 3R66C 2LZ6A 2R2OA 1WGRA 2RGFA 2XBBC 4K7UA 3KUDB 4ZDVA 3N3KB 4BKSA 2KWCA 3CSTA 3GOEA 2KDFB 3A9JB 2FCMA 1WJNA 2NPTB 3QHTA 3DBRI 3EFUA 1U4AA 1SIFA 4HVBA 2KQ7A 2D2QA 4GN1A 5JHBA 2KZRA 3DOWA 3PS6A 2MW5A 3H9DA 2OJRA 2C60A 3EC8A 4PS8A 1IP9A 1WRDB 3NS8A 1NI2A 2DHZA 3IHPC 3LJ3A 2KK8A 4XC2A 4GDKA 3A9KB 3KUCB 4F1SA 1UBQA 1WX7A 3RZWC 3AULA 5JHAA 2VRRB 2EKEC 5GMVA 2KX3A 2K25A 2Z0DB 3NZUA 4HPMB 1Q0WB 3OAWA 5DPSA 2ZPYA 2Z0EB 2BGFA 4X57B 2MX2A 1WMHA 4EOYA 3EHVA 2J0MA 2LXAA 1EO6A 1PQSA 2RPQA 1WM3A 2JVCA 1TZ1A 2QHOA 4DHJB 2IO1B 5LXHA 1WYWB 3ZNZB 4FJVB 2BKRB 2NS5A 3K9PB 3ZKJC 2MBQA 1WR1A 2V1YA 1RRBA 1TTNA 5E6OA 1RLFA 2PE9A 2N9PC 2KKCA 2IO3B 4HJKA 2K8BA 3KW5B 2AEHA 3WA0A 1WGGA 2KOXA 2JXXA 3IVFA 4GDLB 3PRMB 2DZMA 2N7EA 1WM2A 3P2BA 1WJ4A 5TR5A 2J0JA 2MWSB 1J0GA 2PJHA 3HM3A 3OLMD 4WJNA 4KSLC 2O6VB 2DENB 2KJ6A 4MM3A 2MBOA 4AJWA 4II3B 4HLEA 3VAWA 2NBVB 3O65B 2MBEA 3DBHI 3L0WB 2Y5BB 2KO3A 5DPTA 2K1FA 4ANXA 3HHMA 1R4NI 4AJYB 1A5RA 4MSQB 4WJPA 3TIXA 2IYDB 2RR9A 4KV2A 2KDEB 3VTVA 1ZW7A 5LLIA 1OQYA 2BYVE 4GXBA 2WDTB 2G3QB 2KC1A 3TL5A 3ZUNA 2MBHA 2WX0A 3QA8A 2K8HA 2D07B 3KYDD 4KDLB 2ZVOA 1OEYJ 3X0WA 4EUTA 1WXMA 2L3ZA 3A33B 3BY4B 3KH0A 3QK0A 2BF8B 3ONSA 3H7PB 4N9F4 4P7IA 5G55A 1YX6B 3KUZA 4ANUA 2DZJA 1Y8RC 4HPLB 2KDBA 5AZHA 2DAJA 4GU2A 3UIOB 2KMAA 4ASWC 4DK5A 1LXDA 2J0KA 1E8XA 4GB9A 4W9DA 5DPRA 1WR6E 2LD9A 3AXCA 3L08A 4RM8A 4W9LA 4G3XB 2L0TA 1VCBA 1UZXB 2ZJDA 3A4SC 2K6DB 3GZNI 3ZRCA 4IC7B 4E71A 2AWTA 3PLVA 1EF1A 3OJ4B 4GDKB 1SGHA 4IM2A 2LGDA 3U7DA 1WJ6A 2EMSA 3PTFC 2HE7A 2ZEQA 5BO4B 2PEAA 4MGKE 3VFKA 3A1QA 2I1JA 1V5OA 1FXTB 2JRIB 4JL9A 3B0AA 4JLCA 4WWNA 2MP2B 3M95A 3ML9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHZ A;  3TBL D;  3V6C B;  5C1Z A;  5IA7 A;  3AU5 A;  3ZLZ A;  4A20 A;  1GG3 A;  4G11 A;  5IAA C;  1WMH B;  3ALB A;  3ECI A;  1LQB A;  3DCG A;  1L7Y A;  1LM8 B;  1V9J A;  5EDS A;  2CU1 A;  2R2Q A;  2KTR A;  2JWZ A;  3PZD A;  1P0R A;  1V5T A;  2JF5 A;  1V80 A;  3V6E B;  3VDZ A;  3VTU A;  1WX8 A;  2M1M A;  3MTN B;  4KSK C;  4DWF A;  3ZNH B;  1QZE A;  1WI0 A;  4DDI D;  3ZDM C;  4DDG D;  2IY0 B;  1GJZ A;  4F7Z A;  4HCN B;  2KVR A;  2LWP A;  2D11 A;  3H7P A;  4W9F A;  1P1A A;  1WJU A;  4MSM B;  3ZNI D;  2G4S A;  5L95 C;  1UD7 A;  1IPG A;  4AOF A;  1AAR A;  1WY8 A;  2XK5 A;  4BOZ B;  4B9K A;  2MBB B;  4DHZ E;  5L83 A;  4IM0 A;  2LXC A;  2GBK A;  3UF8 A;  3TJP A;  2CHW A;  1E90 A;  3L13 A;  1E8Y A;  1CMX B;  3JYU A;  4MGI E;  4RM9 A;  3ZIM A;  4KZC A;  3N30 A;  1UH6 A;  2BPS A;  3VHT C;  4OVU A;  3VUY A;  4HWI B;  1C1Y B;  2Z59 B;  3CMM B;  3EEC A;  3NOB A;  4LDT D;  4GSW A;  3ZNG C;  5DPW A;  3ML8 A;  4BKT A;  2FNJ B;  3JSV A;  5G2N A;  3U30 A;  3MJW A;  3QWZ B;  2D3G A;  2MP2 A;  5CHF A;  4HDO A;  4XX5 A;  3VXW A;  4FA6 A;  2NR2 A;  2OOB B;  2YVC A;  3SD5 A;  3HIZ A;  1JRU A;  3WAP A;  2L00 B;  1UBI A;  4CO7 A;  2MCN B;  3RZF A;  2JRH A;  3VQI A;  4E3C A;  3QIJ A;  5C23 A;  1KM7 A;  2KJH B;  3APF A;  4LDT B;  5D7G A;  1TGZ B;  2N1V A;  4FN2 A;  4A3P A;  3DVN U;  1L2N A;  2LRW A;  4BBN C;  2L8J A;  1WGY A;  4WWO A;  2N7D A;  4ZYN A;  3I3T B;  2KN5 A;  4W9E A;  4NY0 A;  3W1Y A;  2BWE S;  2DYM A;  1P9D U;  1RFA A;  2DYO A;  3SDL C;  4JIO U;  2KAN A;  4ZRK A;  2IBI B;  4DHZ B;  1X1M A;  4TQ1 A;  2CHX A;  3L54 A;  3QC8 B;  1WE7 A;  2GOW A;  1LFD A;  2KQS A;  4KIK B;  4M8M A;  2REX A;  5D94 A;  4BKG A;  3M3J A;  4MJS A;  2IO2 B;  5E6N A;  2LUE A;  2LVO A;  3C0R B;  3KYC D;  4MGY E;  4PYU A;  4EEW A;  4PYZ A;  5JZE B;  3K9O B;  2KLC A;  3JVZ X;  3VVW B;  1C3T A;  2KNB A;  2A5U A;  3KVF B;  2C7N B;  2MRP A;  4AP4 C;  1XQQ A;  2NVU I;  2UYZ B;  3A1Q B;  3L10 B;  4WJQ A;  3RCZ A;  2L76 A;  2ZZP B;  2B3A A;  3RYT A;  4TKN A;  3PHW B;  1WGD A;  2O2V A;  3H1U A;  2ASQ A;  4WWP A;  3SU8 X;  4BOS C;  4HXD A;  1I35 A;  2HD5 B;  3PV1 A;  3V62 A;  3VH3 B;  4II2 B;  4LJO B;  5J18 A;  2KTR B;  4AWJ A;  2N4F A;  3CF6 E;  4G50 A;  5LXI B;  3R7R A;  2C9W B;  4FBJ B;  2AL6 A;  1IYF A;  3QQ8 B;  1K8R B;  1RAX A;  1V86 A;  1WXA A;  2FCQ A;  4IM3 A;  4W9I A;  3PT2 B;  2YLM A;  2XEW A;  3DVG X;  2LI5 A;  1G6J A;  4IWO A;  3PPA A;  4K7S A;  4IUM B;  1Q5W B;  3NY5 A;  4K1R B;  4DBG A;  4PS7 A;  2KHW B;  2XK5 B;  4NNJ B;  2K39 A;  1GC7 A;  2C7M B;  5CHW A;  3DQV A;  4KIK A;  5CX3 A;  3NHE B;  3PLU A;  4GOC A;  1SE9 A;  3PRE A;  3APD A;  2EMT A;  3SHQ A;  3V60 A;  3WAO A;  2ZNV C;  2C5L C;  3TMP B;  2KD0 A;  1WXV A;  2CS4 A;  1TBE A;  3APC A;  3QAR A;  1UGM A;  4HK2 A;  4IWQ A;  4ZRJ A;  5J2R A;  3JSV B;  2GBR A;  1J8C A;  5AEK B;  3RUI B;  4EKU A;  4KZ0 A;  4W9G A;  4MEL A;  2LGX A;  4HCP B;  4WAA A;  1MG8 A;  3Q3F A;  1BT0 A;  4K7W A;  2KWV B;  1WX9 A;  4MDK E;  2CKH B;  1ISN A;  3BIN A;  3LDZ E;  5AZG A;  4EZJ A;  3PHX B;  3PRP B;  2KFK A;  1GNU A;  3VH4 B;  2NCN A;  3DBL I;  4IWP A;  4NAW A;  1OGW A;  4MGZ E;  1XD3 B;  2DZK A;  3IFW B;  1NBF C;  2AYO B;  4I6N B;  2WWZ A;  4CYE A;  1P3Q U;  3ZTC A;  1S3S G;  4WQO B;  4NQL B;  2G4D B;  1EF5 A;  2PPH A;  3U8Z A;  3W1S C;  2ZVN A;  4EFO A;  1UEL A;  5HKH A;  2FIF A;  2LJ5 A;  3DPD A;  2ZCB A;  3ZO5 B;  5JH5 C;  2M0X A;  2JPH A;  3NZS A;  4G0N B;  4TV3 A;  1J19 A;  4FAD A;  2PE6 B;  3WAN A;  5AZF A;  2W9N A;  3D32 A;  4NPN A;  3WAM A;  3H7S A;  3L17 A;  2KC2 A;  2FCN A;  1ZGU B;  3AI5 A;  2KWU B;  5E6P A;  4GMV A;  1WE6 A;  4MJS B;  2V3S A;  3W1S A;  1WXS A;  3M63 B;  4HDQ A;  1VD2 A;  3ZRF A;  1S1Q B;  3OJ3 A;  1KJT A;  4ANV A;  3DDC B;  2ZPN A;  3X23 A;  4DXA B;  2JT4 B;  4GIV A;  2MA9 B;  3VUW A;  1H8C A;  2RSU A;  3QJZ A;  4M8N A;  2MLB A;  4BFR A;  1Z2M A;  3UIP B;  4JQW C;  4ICV A;  2O2V B;  1OEY A;  3IG3 A;  2J7Q B;  2K6Q A;  4MH0 E;  4DHJ D;  1P98 A;  2I1K A;  2IZV B;  3ENE A;  3VUX A;  4E74 A;  1YJ1 A;  2JUO A;  5KHO A;  5D6J B;  1NDD A;  2A4Z A;  2JZ3 B;  5J17 A;  1V49 A;  4FJY A;  5CTR C;  4LCD E;  1WGH A;  2DX5 B;  2LVP A;  2MQJ A;  4KVG B;  2KJR A;  4B95 A;  1E7U A;  1OTR B;  2L0F A;  2JZZ A;  2NBU A;  4GGQ A;  3H6N A;  4TQ0 A;  4FHJ A;  4TUU A;  4W9C A;  3UQB A;  2GMI C;  2HTH A;  2BWF A;  3PSE B;  2AL3 A;  2N1W A;  2DZI A;  3Q3J A;  1XT9 B;  3CSF A;  3ZDT A;  4WJO A;  3A9J A;  3HK0 A;  3QCA A;  2NPT A;  2V4L A;  1YX5 B;  2O6V D;  4I6L B;  4URK A;  3IBE A;  4IW0 A;  4BBN F;  5FR6 A;  3ZTD A;  4EZL A;  3VTW A;  1KLV A;  1HE8 A;  4FHK A;  2KFJ A;  4FUL A;  4RMA A;  1V2Y A;  2KTF A;  2L05 A;  1WIA A;  3DVN V;  4W9K A;  5CHV C;  2CR5 A;  2GBJ A;  2ZNV B;  3V61 A;  2KMC A;  4K81 A;  3UIN B;  1Z5S B;  2BYE A;  4AUQ C;  3QX1 A;  1V6E A;  3T9L A;  2KFK B;  3A9K A;  4W9H A;  2FCS A;  2LAS A;  1Q1O A;  3MHS D;  3WIM A;  2RD0 A;  4A3O A;  4B6W A;  4NAW B;  4BKS D;  3ZW3 A;  2DAF A;  3AU4 A;  3UQA A;  2M17 A;  2BKF A;  1YD8 U;  4J6I A;  1I42 A;  2IO0 B;  4M0W B;  2KLG A;  2WYQ A;  2JY6 A;  4BVU C;  2LGY A;  5DCN A;  3R3M A;  3HM6 X;  3RUL A;  4NJ7 A;  2GBN A;  2NBW B;  2L7R A;  2MSE D;  3N32 A;  1WFY A;  2HJ8 A;  3L16 A;  1E8W A;  2FID A;  1F9J A;  4MEM A;  3B08 A;  3ZVV A;  1H4R A;  1ZKH A;  3DVG Y;  3M62 B;  3QAQ A;  2M8S A;  3A4R A;  2LRU A;  1E7V A;  1WZ3 A;  4PS3 A;  2KXJ A;  3B1L X;  4YL8 A;  3RD2 A;  4XZ4 A;  4F8C B;  4EZK A;  2G45 B;  2BYF A;  1GC6 A;  2WX1 A;  1YIW A;  4W9J A;  1WH3 A;  3WAL A;  4GDL A;  2GBM A;  2N9E B;  3PGE A;  4KDI C;  2KX0 A;  3TCA A;  2C7H A;  2KDI A;  3PVL A;  1T0Y A;  1V81 A;  2UWQ A;  3RT3 B;  4FLH A;  2FUH B;  2FAZ A;  3R7Q A;  1E8Z A;  2O6V A;  4OVV A;  3T8M A;  1D3Z A;  2M4N A;  4CHK A;  4NJ6 A;  2N9X A;  1E5W A;  4JGH B;  4LJP B;  3UGB B;  2K8C A;  3DBS A;  1M94 A;  3JW0 X;  1KOT A;  4I6P A;  1GUA B;  1R4M I;  5D2M B;  5KHQ A;  4NQK E;  3PRZ A;  4FJZ A;  4ANW A;  4ICU A;  2D10 A;  4ZRI A;  2LVQ A;  4IG7 B;  1YQB A;  2DYB A;  2ZCC A;  3S2A A;  1WZ0 A;  1EUV B;  2IY1 B;  1WF9 A;  3R66 C;  2LZ6 A;  2R2O A;  1WGR A;  2RGF A;  2XBB C;  4K7U A;  3KUD B;  4ZDV A;  3N3K B;  4BKS A;  2KWC A;  3CST A;  3GOE A;  2KDF B;  3A9J B;  2FCM A;  1WJN A;  2NPT B;  3QHT A;  3DBR I;  3EFU A;  1U4A A;  1SIF A;  4HVB A;  2KQ7 A;  2D2Q A;  4GN1 A;  5JHB A;  2KZR A;  3DOW A;  3PS6 A;  2MW5 A;  3H9D A;  2OJR A;  2C60 A;  3EC8 A;  4PS8 A;  1IP9 A;  1WRD B;  3NS8 A;  1NI2 A;  2DHZ A;  3IHP C;  3LJ3 A;  2KK8 A;  4XC2 A;  4GDK A;  3A9K B;  3KUC B;  4F1S A;  1UBQ A;  1WX7 A;  3RZW C;  3AUL A;  5JHA A;  2VRR B;  2EKE C;  5GMV A;  2KX3 A;  2K25 A;  2Z0D B;  3NZU A;  4HPM B;  1Q0W B;  3OAW A;  5DPS A;  2ZPY A;  2Z0E B;  2BGF A;  4X57 B;  2MX2 A;  1WMH A;  4EOY A;  3EHV A;  2J0M A;  2LXA A;  1EO6 A;  1PQS A;  2RPQ A;  1WM3 A;  2JVC A;  1TZ1 A;  2QHO A;  4DHJ B;  2IO1 B;  5LXH A;  1WYW B;  3ZNZ B;  4FJV B;  2BKR B;  2NS5 A;  3K9P B;  3ZKJ C;  2MBQ A;  1WR1 A;  2V1Y A;  1RRB A;  1TTN A;  5E6O A;  1RLF A;  2PE9 A;  2N9P C;  2KKC A;  2IO3 B;  4HJK A;  2K8B A;  3KW5 B;  2AEH A;  3WA0 A;  1WGG A;  2KOX A;  2JXX A;  3IVF A;  4GDL B;  3PRM B;  2DZM A;  2N7E A;  1WM2 A;  3P2B A;  1WJ4 A;  5TR5 A;  2J0J A;  2MWS B;  1J0G A;  2PJH A;  3HM3 A;  3OLM D;  4WJN A;  4KSL C;  2O6V B;  2DEN B;  2KJ6 A;  4MM3 A;  2MBO A;  4AJW A;  4II3 B;  4HLE A;  3VAW A;  2NBV B;  3O65 B;  2MBE A;  3DBH I;  3L0W B;  2Y5B B;  2KO3 A;  5DPT A;  2K1F A;  4ANX A;  3HHM A;  1R4N I;  4AJY B;  1A5R A;  4MSQ B;  4WJP A;  3TIX A;  2IYD B;  2RR9 A;  4KV2 A;  2KDE B;  3VTV A;  1ZW7 A;  5LLI A;  1OQY A;  2BYV E;  4GXB A;  2WDT B;  2G3Q B;  2KC1 A;  3TL5 A;  3ZUN A;  2MBH A;  2WX0 A;  3QA8 A;  2K8H A;  2D07 B;  3KYD D;  4KDL B;  2ZVO A;  1OEY J;  3X0W A;  4EUT A;  1WXM A;  2L3Z A;  3A33 B;  3BY4 B;  3KH0 A;  3QK0 A;  2BF8 B;  3ONS A;  3H7P B;  4N9F 4;  4P7I A;  5G55 A;  1YX6 B;  3KUZ A;  4ANU A;  2DZJ A;  1Y8R C;  4HPL B;  2KDB A;  5AZH A;  2DAJ A;  4GU2 A;  3UIO B;  2KMA A;  4ASW C;  4DK5 A;  1LXD A;  2J0K A;  1E8X A;  4GB9 A;  4W9D A;  5DPR A;  1WR6 E;  2LD9 A;  3AXC A;  3L08 A;  4RM8 A;  4W9L A;  4G3X B;  2L0T A;  1VCB A;  1UZX B;  2ZJD A;  3A4S C;  2K6D B;  3GZN I;  3ZRC A;  4IC7 B;  4E71 A;  2AWT A;  3PLV A;  1EF1 A;  3OJ4 B;  4GDK B;  1SGH A;  4IM2 A;  2LGD A;  3U7D A;  1WJ6 A;  2EMS A;  3PTF C;  2HE7 A;  2ZEQ A;  5BO4 B;  2PEA A;  4MGK E;  3VFK A;  3A1Q A;  2I1J A;  1V5O A;  1FXT B;  2JRI B;  4JL9 A;  3B0A A;  4JLC A;  4WWN A;  2MP2 B;  3M95 A;  3ML9 A; 
#chains in the Genus database with same CATH topology
 3DHI C;  1CQV A;  3AU5 A;  3ZLZ A;  1GG3 A;  3Q69 A;  4P6V F;  1WMH B;  4YT0 B;  1JCK B;  2M1M A;  4KSK C;  4DWF A;  3AE5 B;  1AWD A;  4DDI D;  4RFB A;  4DDG D;  2IY0 B;  4F7Z A;  1TS4 A;  4HCN B;  4RF0 A;  1YN4 A;  4W9F A;  5L95 C;  1FNU A;  1QLB B;  4AOF A;  1YNT E;  3N20 C;  3L13 A;  1E8Y A;  4WWM A;  4RM9 A;  4HWI B;  1C1Y B;  4LDT D;  3EEC A;  5DPW A;  1C9F A;  4GSW A;  3LXF A;  3ML8 A;  2FNJ B;  4HDO A;  3SFD B;  1YJJ A;  2NR2 A;  2OOB B;  3SD5 A;  3I57 A;  2L00 B;  1UBI A;  1UUP A;  4XE0 A;  1TGZ B;  4LTU A;  3DWG C;  2BW2 A;  1L2N A;  2IPK D;  4NY0 A;  1SE4 A;  1RFA A;  2DYO A;  2R61 A;  4YXD B;  4JIO U;  3AE8 B;  1WE7 A;  3W5V B;  4IOI E;  4ZHP A;  1LFD A;  2KQS A;  2K9X A;  1MG4 A;  5E6N A;  2LUE A;  4PYU A;  4EEW A;  1HZ5 A;  2KLC A;  3VVW B;  5H92 C;  1MHX A;  4AP4 C;  1XQQ A;  1ZE3 D;  2H89 B;  2NTT A;  4OW0 A;  1B9R A;  2KVZ A;  2KDM A;  2O2V A;  4WWP A;  3SU8 X;  1I35 A;  2HD5 B;  2BVC A;  3PV1 A;  3V62 A;  4II2 B;  4P1B C;  5J18 A;  2W3R A;  3NVZ A;  3R7R A;  4FBJ B;  3AEF B;  3I9V 1;  3QQ8 B;  1K8R B;  4IM3 A;  1IGD A;  2K3U A;  1V8C A;  1EWY C;  2VZK B;  3DVG X;  2LI5 A;  4O1N A;  1ZXI A;  2FE8 A;  4P16 A;  1TYG B;  1Q5W B;  3NVV A;  4PS7 A;  2KHW B;  2XK5 B;  2K39 A;  1GC7 A;  2KAJ A;  3DQV A;  1V1O A;  2RDH A;  3PLU A;  4GOC A;  4QAY A;  3APD A;  2EMT A;  3SHQ A;  3V60 A;  3WAO A;  3N9Y C;  2KD0 A;  3QAR A;  3ZXR A;  5J2R A;  4IWQ A;  3JSV B;  1J8C A;  1UWX A;  3RUI B;  4EKU A;  4W9G A;  2LGX A;  1FCL A;  1BT0 A;  2KWV B;  1YOV B;  3BIN A;  2BS4 B;  2KFK A;  3DBL I;  4IWP A;  4NAW A;  2EEL A;  2DZK A;  2AYO B;  2WWZ A;  4CYE A;  1P3Q U;  2Y3A A;  2WXR A;  1YJI A;  1S3S G;  3WCQ A;  4Q2J A;  5E6J A;  3NZS A;  1J19 A;  5IKC M;  2W9N A;  3UI3 A;  2WXN A;  4NPN A;  3TSS A;  3AI5 A;  5TSS A;  4GMV A;  1I4H A;  4MJS B;  2V3S A;  1D5X C;  3M63 B;  3DBL B;  3DDC B;  1STE A;  1H8C A;  4S17 A;  2BB6 A;  2G9H D;  4ICV A;  2K6Q A;  4DHJ D;  1P98 A;  2I1K A;  3VUX A;  1EM7 A;  5D6J B;  3R2T A;  4XDD A;  1ZDV A;  1V49 A;  4LCD E;  2ICI A;  4KVG B;  1E7U A;  3DBR B;  1QQR A;  4TUU A;  2GMI C;  2HTH A;  4US8 A;  3PSE B;  3Q3J A;  1C76 A;  1XT9 B;  4WJO A;  3U4E G;  4JE3 B;  1YX5 B;  1JW9 D;  3RI7 C;  4IW0 A;  4EZL A;  4FHK A;  3KQ4 A;  4ZRP A;  1V2Y A;  2L05 A;  3ZJU A;  2WXL A;  2GBJ A;  2ZNV B;  4ZYS A;  2NTS A;  4YTM B;  4OHJ A;  3QX1 A;  3V05 A;  2FCS A;  3MHS D;  4LNN A;  1NYQ A;  2RD0 A;  4YSX B;  1TS2 A;  2M17 A;  3UQA A;  1YD8 U;  1I42 A;  2KLG A;  4BVU C;  1JWS D;  2NBW B;  4YTN B;  3L16 A;  2QCZ A;  2FID A;  1JML A;  1XO3 A;  3KWV A;  1UWM A;  3HUI A;  3QAQ A;  3NRZ A;  2KXJ A;  2XN9 C;  4EZK A;  3FAH A;  2WX1 A;  1YIW A;  4GDL A;  4OVZ A;  1ZP0 B;  2N9E B;  1KTK A;  3TCA A;  1T0Y A;  3R7Q A;  3ZJT A;  1T0R C;  1F0Z A;  4FXC A;  4OVV A;  2ZW0 A;  1HTQ A;  2PW9 A;  3GB1 A;  4JGH B;  1L0V B;  2WXJ A;  1KOT A;  2L52 A;  4I6P A;  1R4M I;  1D6E C;  3PRZ A;  2D10 A;  4ZRI A;  4IG7 B;  2JXT A;  1WZ0 A;  1EUV B;  2IY1 B;  1WF9 A;  2XBB C;  4JX1 C;  2WXQ A;  4A6Q A;  2FCM A;  5HG2 A;  3QHT A;  1V97 A;  4HVB A;  4WUR A;  1AN8 A;  4BZA A;  4GN1 A;  5MPO A;  5JHB A;  3H9D A;  1R4M B;  1WRD B;  2RPV A;  2QIE B;  4GDK A;  3A9K B;  1IUE A;  1WX7 A;  3MJ5 A;  5JHA A;  5GMV A;  3VRA B;  5EE0 A;  4X57 B;  2LXA A;  1XLQ A;  3GP7 A;  2JVC A;  2PTL A;  2WLB A;  2IO1 B;  3BVZ A;  2ONQ A;  2MBQ A;  1WR1 A;  4J3O D;  3OWE B;  3EA6 A;  1L6U A;  4HJK A;  2HDE A;  3KW5 B;  3WA0 A;  2KOX A;  2JXX A;  3PRM B;  1I4P A;  2N7E A;  2RDG A;  4A55 A;  3P2B A;  1I4G A;  1HQR D;  3RNE C;  2PJH A;  3P63 A;  2O6V B;  2JSV X;  2MBO A;  3FC4 A;  4HPP A;  4OZB A;  1QIL A;  1RWS A;  3VAW A;  2K1F A;  3HHM A;  1BXT A;  4MSQ B;  2IYD B;  3VTV A;  3HVD A;  1KLG D;  3ZUN A;  3TL5 A;  4WIP A;  2MBH A;  3QA8 A;  4EUT A;  1OEY J;  3BY4 B;  1A70 A;  1YX6 B;  3KUZ A;  4C00 A;  2DZJ A;  2EKI A;  2KDB A;  3AM9 A;  4GU2 A;  5AZH A;  2KMA A;  1E8X A;  2LD9 A;  4W9L A;  2L0T A;  2K0P A;  3ZRC A;  2AWT A;  3PLV A;  4IM2 A;  3FKY A;  2JWU A;  2JRI B;  1V5O A;  3B0A A;  4AJW A;  4KX6 B;  2MP2 B;  2LGI A;  5I4D A;  3TBL D;  5C1Z A;  5IA7 A;  4A20 A;  1TY0 A;  3ALB A;  5IAA C;  3DCG A;  1LM8 B;  2KTR A;  2JWZ A;  1IBX A;  1P0R A;  3V6E B;  1F77 A;  1RFK A;  3MTN B;  4OZA A;  1QZE A;  5EE1 A;  4JWU C;  1WI0 A;  2W55 A;  1GJZ A;  3B9J A;  2KVR A;  1WJU A;  4MSM B;  3ZNI D;  1UD7 A;  5D3I B;  4DHZ E;  1AW7 A;  1CMX B;  1SEB D;  4KZC A;  3Q3O C;  3IXS A;  1WWT A;  4AQ7 A;  4OVU A;  2WXK A;  3NOB A;  3CMM B;  3ZNG C;  1Q10 A;  5G2N A;  3MJW A;  4KKI A;  2MP2 A;  4FA6 A;  2L83 A;  2YVC A;  3E9S A;  3HIZ A;  1JQ4 A;  1JRU A;  3KLS X;  3RZF A;  1TKG A;  2E6X A;  3VQI A;  5C23 A;  3APF A;  4LDT B;  1L0X B;  4FN2 A;  3EFC A;  3Q8A A;  4WWO A;  1SE3 A;  3I3T B;  2M19 A;  3W1Y A;  4K3C A;  1NYR A;  2RDB C;  4ZRK A;  1XLP A;  2GOW A;  1NVI D;  3AE2 B;  1K52 A;  4M8M A;  2REX A;  5D94 A;  4BKG A;  3M3J A;  2KAC A;  2IO2 B;  1HEZ E;  2LVO A;  3KYC D;  5JZE B;  1I4Q A;  1C3T A;  3GE8 C;  2MRP A;  2UYZ B;  3L10 B;  3BYY B;  4WJQ A;  3RCZ A;  3PHW B;  1WGD A;  3H1U A;  4BOS C;  4HXD A;  2D3A A;  3AEC B;  4LJO B;  2G1E A;  2N4F A;  3CF6 E;  4G50 A;  2C9W B;  3P4Q B;  2DBY A;  1IYF A;  2FCQ A;  1WXA A;  3C8Y A;  3Q8E A;  1G6J A;  3PPA A;  4IUM B;  3NY5 A;  2J53 A;  2WQY B;  2QSD A;  2YEP B;  4A90 A;  3PRE A;  2WXF A;  2M0A A;  1NEN B;  2C5L C;  3TMP B;  4YSZ B;  2JX5 A;  2CS4 A;  1TBE A;  2GBR A;  4C4V A;  3TEY A;  1ISN A;  3LDZ E;  2BBC A;  1JAL A;  1GNU A;  3ZGZ A;  2KQ4 X;  1XEE A;  1PDX A;  1OGW A;  4XWW A;  1NBF C;  4I6N B;  5HKH A;  1UEL A;  1OQR A;  2LJ5 A;  3DPD A;  2ZCB A;  4B0M A;  3ZO5 B;  4G0N B;  4FAD A;  4NJC A;  4XWT A;  3D32 A;  3AE1 B;  1QOG A;  1FXI A;  2KC2 A;  4B0E A;  1WXS A;  2WXG A;  1TS5 A;  4ANV A;  2ZPN A;  1DOX A;  4DXA B;  2JT4 B;  1HZ6 A;  4BFR A;  2O2V B;  1OEY A;  2GB1 A;  3IG3 A;  4MH0 E;  2LHD A;  3OG5 A;  4E74 A;  1YJ1 A;  5KHO A;  4M02 A;  2JZ3 B;  1L5P A;  4FJY A;  2BB5 A;  4P1C C;  2BQQ A;  2KJR A;  1OTR B;  1FMA D;  2L0F A;  3H6N A;  4FHJ A;  3B2G A;  2BWF A;  1YN3 A;  5IO9 A;  3MHZ A;  1XCT L;  3NZ3 A;  3ZDT A;  1I4R A;  3A9J A;  1TS3 A;  2NPT A;  2V4L A;  4BBN F;  3ZTD A;  1HE8 A;  4FUL A;  3DVN V;  3V61 A;  2M56 B;  2KMC A;  4AUQ C;  3AE3 B;  3T9L A;  2KFK B;  2LAS A;  3WIM A;  1MI0 A;  3N1Y C;  4DXF A;  4B6W A;  4NAW B;  2MJ3 A;  1YMH E;  4XGA B;  2DAF A;  2BKF A;  2CJN A;  5HI1 A;  2JY6 A;  4OZC A;  2OJW A;  2LGY A;  2D3C A;  4NJ7 A;  2Q5W D;  1MVK A;  3TEW A;  1HA5 A;  1N60 A;  1F9J A;  1XXG A;  4L23 A;  1T3Q A;  1DYQ A;  3M62 B;  3A4R A;  5BMH A;  4XZ4 A;  3O13 A;  1XLO A;  5FK9 C;  3PGE A;  4KDI C;  1GPX A;  2KDI A;  1L6V A;  1T0S C;  3C19 A;  3RT3 B;  3DBH B;  1ET9 A;  2ZW1 A;  3BZD B;  1TIF A;  2KWD A;  2WDV B;  3ABV B;  3JW0 X;  3CIR B;  2IGD A;  5HHD G;  4WH4 A;  4ICU A;  2B76 B;  3I5J C;  3J9C A;  3R66 C;  2W82 A;  4N6E B;  1WGR A;  2BS3 B;  3N3K B;  1TJE A;  3GZN B;  2VH2 A;  1OQQ A;  1WJN A;  3DBR I;  2N0S B;  1U4A A;  5AUK A;  4RF1 A;  5G5H A;  2MW5 A;  2OJR A;  5BYS A;  3EC8 A;  1LO5 D;  2MEK A;  1QKZ A;  1GB1 A;  4F1S A;  3RZW C;  3NVW A;  4RNA A;  1FIQ A;  4RGN A;  1Q0W B;  3OAW A;  2CU3 A;  2IND C;  2BGF A;  1PQS A;  2RPQ A;  3PO0 A;  1WM3 A;  1ZDX A;  2LMC A;  2TSS A;  2AQ2 B;  2QHO A;  5LXH A;  1PUT A;  3ZNZ B;  4FJV B;  2NS5 A;  3K9P B;  3NS1 A;  5E6O A;  1RLF A;  3AV8 A;  4AS1 A;  3AE9 B;  3AE7 B;  1E10 A;  4GDL B;  2MJE A;  2DZM A;  5EE9 A;  5T8I A;  4HEA 1;  2MWS B;  3HM3 A;  2AQ3 B;  2DEN B;  1P7F A;  1FD6 A;  4AJY B;  1A5R A;  3BVG A;  3TIX A;  3CWI A;  5HFY A;  4GXB A;  1FPY A;  2G3Q B;  1PYW D;  4UDU C;  3W9C B;  3X0W A;  2ZVO A;  4M01 A;  3KH0 A;  2BF8 B;  3ONS A;  5G55 A;  4N9F 4;  2N7J A;  1LGR A;  1Y8R C;  4HPL B;  4ASW C;  2D5G A;  5BYQ A;  2J0K A;  4K3B A;  4W9D A;  1JWU D;  1WR6 E;  4G3X B;  2OED A;  1UZX B;  3AMZ A;  2K6D B;  2J4X A;  2LGS A;  1EF1 A;  4GDK B;  3U7D A;  1WJ6 A;  2J52 A;  2ZEQ A;  2PEA A;  2IJ0 A;  3A1Q A;  2I1J A;  1UF0 A;  4JLC A;  4WWN A;  3Q6B A;  4RGT A;  1ESF A;  3ECI A;  3IT4 B;  1V9J A;  1ZXH A;  5EDS A;  2CU1 A;  2MJD A;  2R2Q A;  3VDZ A;  1V80 A;  1WX8 A;  2QDF A;  5BMG A;  3ZNH B;  3URY A;  3ZDM C;  1N63 A;  4LNF A;  2D11 A;  3AEE B;  1P1A A;  1IPG A;  1AAR A;  1WY8 A;  4B9K A;  2MBB B;  5L83 A;  3RNA C;  3SR6 A;  2LXC A;  2CHW A;  1E90 A;  3JYU A;  4WAF A;  2LHE A;  4MH8 A;  2Y5P A;  1RYJ A;  4BKT A;  3U30 A;  3QWZ B;  3AE4 B;  5CHF A;  3VXW A;  3VRB B;  2E3T A;  2MCN B;  2X38 A;  2JRH A;  3QIJ A;  1KM7 A;  5D7G A;  2N1V A;  2LRW A;  4BBN C;  4KKJ A;  2NMQ A;  2KN5 A;  1ROE A;  2BWE S;  2QMT A;  1P9D U;  3SDL C;  4C7Z A;  1X1M A;  2ON8 A;  3L54 A;  3QC8 B;  4KIK B;  1C4P A;  3RPF C;  1DGJ A;  4LK0 M;  4MGY E;  4C7Y A;  4MT5 A;  2A5U A;  3KVF B;  3IT6 B;  2C7N B;  2NVU I;  1BUI C;  2L76 A;  3T3N A;  1J7C A;  3RYT A;  3P1M A;  3Q14 C;  1TKY A;  3IAM 1;  1FRD A;  2KTR B;  1IBX B;  4AWJ A;  5LXI B;  4TSS A;  5JXV A;  1KF6 B;  2AL6 A;  2LFI A;  1RAX A;  4W9I A;  4DXG A;  5C3J B;  4K7S A;  4K1R B;  4DBG A;  3AB5 A;  4KIK A;  3ZXV A;  3NHE B;  3AEA B;  4HKZ E;  1VRA B;  1WXV A;  3APC A;  1V1P A;  4ZRJ A;  1E6E B;  5AEK B;  4KZ0 A;  4MEL A;  3NUH B;  3Q8B A;  4HCP B;  3Q3F A;  4WAA A;  2KMM A;  4MDK E;  2CKH B;  5AZG A;  2WXO A;  4EZJ A;  3PHX B;  3VH4 B;  3B2F A;  2WP9 B;  4MGZ E;  3IFW B;  1CZP A;  3TEX A;  1K50 A;  4WQO B;  2G4D B;  3W1S C;  1VZ8 A;  4EFO A;  3W5U B;  5GXG B;  2BYT A;  2M0X A;  2JPH A;  2PE6 B;  3WAN A;  5AZF A;  3AH7 A;  3GE3 C;  2INN E;  3H7S A;  1ZGU B;  2KWU B;  5E6P A;  4ZHO A;  2V3N A;  3W1S A;  1E9M A;  3ZRF A;  4HDQ A;  1S1Q B;  1PFD A;  1C77 A;  2WDR B;  1KJT A;  4GIV A;  3VUW A;  2RSU A;  3QJZ A;  4M8N A;  1C79 A;  3UIP B;  4JQW C;  3RNF C;  2J7Q B;  2IZV B;  1ACC A;  1NDD A;  1F2R C;  2N9L A;  3BVM A;  5J17 A;  1N5X A;  2DX5 B;  2LVP A;  2MQJ A;  4B95 A;  5AUI A;  1N61 A;  2NBU A;  4W9C A;  2AL3 A;  1VZ7 A;  1B1Z A;  3CSF A;  4HJG E;  3HK0 A;  2L1A A;  2O6V D;  4URK A;  3IBE A;  1KLV A;  3T3O A;  2KFJ A;  4RMA A;  1SIJ A;  1SBB B;  4W9K A;  2CR5 A;  4C4V B;  4K81 A;  3Q8F A;  2BYE A;  4LLG M;  1V6E A;  4W9H A;  3W2D A;  2V3P A;  2WXH A;  1T5X D;  4BKS D;  1WYG A;  3AU4 A;  2IO0 B;  1M4V A;  1TT5 B;  3PZ7 A;  1TY2 A;  3HM6 X;  3RUL A;  1NEK B;  1EU4 A;  2L7R A;  2MSE D;  3N32 A;  3SFE B;  2IGH A;  1FEH A;  2SEB D;  1K51 A;  1WFY A;  1XCQ L;  1N6Z A;  1E8W A;  3RNC C;  4MEM A;  2MH7 A;  4L1B A;  1H4R A;  4M00 A;  1ZKH A;  4RH6 A;  3DVG Y;  2LRU A;  1E7V A;  3B1L X;  3RD2 A;  4W9J A;  1WH3 A;  2GBM A;  2WU5 B;  2UWQ A;  2FUH B;  1Y56 A;  1D4B A;  2V0G A;  2QEJ C;  1ENF A;  2KN4 A;  4LJP B;  3DBS A;  5D2M B;  1GB4 A;  1SE2 A;  4FJZ A;  4L2Y A;  5FKA C;  4ANW A;  2DLB A;  2LVQ A;  2DYB A;  2ZCC A;  2LZ6 A;  2R2O A;  2RGF A;  3CST A;  2KDF B;  3A9J B;  1MHH E;  2NPT B;  3EFU A;  1SIF A;  2KQ7 A;  3KWL A;  5C2T B;  2QIL A;  2KZR A;  3DOW A;  4PS8 A;  3IAS 1;  4EE2 A;  1NI2 A;  2L32 A;  1C4C A;  3IHP C;  2KK8 A;  4JPS A;  3N1Z C;  2PMV A;  4LNK A;  2JQR B;  1CJE A;  4MM3 B;  1SJH D;  1D5M C;  2Z0D B;  4HPM B;  4EOY A;  2MX2 A;  1WMH A;  2J0M A;  1EO6 A;  3L4P A;  4DHJ B;  3GS2 A;  1ET6 A;  2KYW A;  1RRB A;  5D3D A;  4C56 C;  2X8X X;  2PE9 A;  1YN5 A;  2IO3 B;  2K8B A;  2AEH A;  1WGG A;  3SEB A;  1DOI A;  1J0G A;  3DHG C;  2XNA C;  3OLM D;  2D3B A;  4KSL C;  5IOI A;  2KJ6 A;  4MM3 A;  4II3 B;  2PIA A;  2GLS A;  4IDI A;  3O65 B;  3DBH I;  2KO3 A;  1JWA D;  4N58 A;  4ANX A;  2GRI A;  3R2I A;  4WJP A;  2RR9 A;  4KV2 A;  1L4Z B;  2BYV E;  2WDT B;  3ZQ4 A;  2KC1 A;  1T6B X;  3Q3M C;  3HRD D;  2WX0 A;  2K8H A;  2D07 B;  2WGS A;  1WXM A;  3A33 B;  3E56 A;  3QK0 A;  4P7I A;  3H7P B;  4ANU A;  1N62 A;  2JYE A;  4US9 A;  2DAJ A;  1AYF A;  4DK5 A;  4GB9 A;  1L0Y B;  1PGX A;  4YWG G;  4ZOH C;  4YTP B;  1VCB A;  3RNG C;  3GZN I;  4IC7 B;  3OJ4 B;  3NJT A;  3R8B A;  2HJ1 A;  2LGD A;  2EMS A;  3AEB B;  3PTF C;  2HE7 A;  5BO4 B;  3VFK A;  1E7P B;  1CK1 A;  4JL9 A;  1FXT B;  2LUM A;  3ML9 A;  2CHZ A;  1QOB A;  3V6C B;  4USA A;  2K5P A;  4G11 A;  4R3D A;  1LQB A;  2I2Y A;  1FRR A;  1UNS A;  1L7Y A;  2N9K A;  3DWM A;  1F52 A;  3PZD A;  1V5T A;  1D5Z C;  2JF5 A;  4JWS C;  3VTU A;  4ARI A;  2BTE A;  4NZL B;  3BII D;  4WQM A;  2LWP A;  3H7P A;  3AE6 B;  2BT6 A;  2RMM A;  2G4S A;  1WGK A;  2XK5 A;  1KH0 A;  4BOZ B;  1VDV A;  4IM0 A;  2GBK A;  1XF5 L;  3AN1 A;  3TJP A;  3UF8 A;  3V3X A;  4MGI E;  3ZIM A;  2GI9 A;  3VHT C;  3N30 A;  1UH6 A;  2BPS A;  3VUY A;  2Z59 B;  2DWQ A;  3JSV A;  4TMA B;  2FUG 1;  4YSY B;  2D3G A;  2FBW B;  4XX5 A;  3MC9 A;  3EUB 2;  3WAP A;  4CO7 A;  2V9H A;  4E3C A;  1UGJ A;  2KJH B;  4A3P A;  3AED B;  3DVN U;  1R7S A;  2L8J A;  1WGY A;  2N7D A;  2LEK A;  4ZYN A;  4W9E A;  2DYM A;  2KAN A;  2H88 B;  2IBI B;  4MAC A;  4DHZ B;  4TQ1 A;  2CHX A;  3HVZ A;  2KT7 A;  1WRI A;  3U7Z A;  3ETR A;  4A8X C;  3BK1 A;  4MJS A;  3C0R B;  2BS2 B;  4PYZ A;  3K9O B;  3JVZ X;  2J42 A;  2MHJ A;  3P4P B;  5H8Y E;  2KNB A;  1FCC C;  1YQ4 B;  3Q8C A;  3RN9 C;  3A1Q B;  2W3S A;  2VZK D;  5EE3 A;  2ZZP B;  2B3A A;  3BK2 A;  1QF6 A;  4TKN A;  2ASQ A;  1VJK A;  1MPE A;  3VH3 B;  1QT9 A;  3NG0 A;  3LB8 C;  3FIL B;  1KFY B;  1V86 A;  3PT2 B;  2YLM A;  3U52 E;  2XEW A;  3RFZ B;  1JWB D;  4IWO A;  1IGC A;  1KRH A;  4NNJ B;  2C7M B;  3TEZ A;  5CHW A;  5CX3 A;  1SE9 A;  2HTM E;  4DQO C;  4PK1 A;  2ZNV C;  2IGG A;  3P4S B;  4BAX A;  4HK2 A;  1UGM A;  1TKE A;  1MG8 A;  2PVG C;  4K7W A;  1WX9 A;  1SF0 A;  5BMI A;  3PRP B;  3FIL A;  2NCN A;  1XD3 B;  3DHH C;  3N1X C;  3H8H A;  4D2K A;  3ZTC A;  3P4R B;  2QJL A;  4NQL B;  3U8Z A;  1EF5 A;  2PPH A;  2ZVN A;  1HTO A;  2FIF A;  1WSP A;  5JH5 C;  4TV3 A;  1PGA A;  2ACZ B;  4RGM A;  3WAM A;  3L17 A;  2FCN A;  1WE6 A;  2YEP F;  4RCO A;  3TUO A;  1VD2 A;  1FM0 D;  3OJ3 A;  1FFU A;  3BYT B;  3MFG A;  3X23 A;  2WXP A;  2MA9 B;  1SB3 C;  2MLB A;  1FFV A;  1JWM D;  1Z2M A;  2PKO A;  3ENE A;  4PT5 A;  2JUO A;  2A4Z A;  5CTR C;  1WGH A;  1BML C;  1C78 A;  4GGQ A;  2JZZ A;  4TQ0 A;  1VLB A;  4XYC A;  3UQB A;  1PGB A;  2N1W A;  2DZI A;  1EU3 A;  3VR9 B;  1JRP A;  3QCA A;  4I6L B;  4ARC A;  1E0Z A;  4ZRQ A;  1V1P B;  5FR6 A;  2I38 A;  4REZ A;  3VTW A;  2INP E;  2CJO A;  1KLU D;  2KTF A;  5CHV C;  1WIA A;  2SAK A;  3UIN B;  1Z5S B;  2QC8 A;  3A9K A;  3Q2A C;  4KGT A;  1Q1O A;  2AQ1 B;  4KGR A;  2K22 A;  4A3O A;  3NVY A;  3ZW3 A;  2UU7 A;  1P7E A;  1ZPS A;  4J6I A;  2VH1 A;  4M0W B;  2WYQ A;  5BYR A;  1I4X A;  1TZO A;  2INC C;  5DCN A;  3Q3N C;  3R3M A;  3MC0 B;  2GBN A;  4HRS A;  1J7A A;  3AEG B;  1NI3 A;  2HJ8 A;  1XLN A;  1I7H A;  3RNB C;  3B08 A;  2WU2 B;  3ZVV A;  1VR9 A;  2M8S A;  5FR3 A;  1WZ3 A;  2WS3 B;  2AX5 A;  4PS3 A;  4YL8 A;  4F8C B;  2G45 B;  2DNF A;  2BYF A;  1GC6 A;  3WAL A;  1HXY D;  1F2R I;  2KX0 A;  2C7H A;  3PVL A;  1GOZ A;  1V81 A;  4FLH A;  2FAZ A;  1E8Z A;  2O6V A;  3T8M A;  1D3Z A;  4C80 A;  2M4N A;  4CHK A;  4NJ6 A;  2N9X A;  5IN7 A;  1E5W A;  3I63 C;  4M0W A;  3UGB B;  1FNV A;  2K8C A;  1M94 A;  1ZUD 2;  2LJI A;  1GUA B;  5KHQ A;  4ITK A;  4NAM A;  4NQK E;  4A9A A;  1YQB A;  5LNK 1;  4S0R A;  1RM6 C;  3S2A A;  4K7U A;  3KUD B;  4ZDV A;  4BKS A;  2WXI A;  2KWC A;  3GOE A;  3MP9 A;  4H2A A;  2IDY A;  4HRO A;  3P42 A;  2D2Q A;  1SXT A;  3PS6 A;  1C4A A;  1JRO A;  2OHF A;  2C60 A;  1IP9 A;  3NS8 A;  2DHZ A;  4CQN A;  3LJ3 A;  4XC2 A;  3KUC B;  1UBQ A;  3AUL A;  2PLP A;  2V4I B;  2VRR B;  2EKE C;  2KX3 A;  5IP4 D;  1VZ6 A;  2K25 A;  4ACF A;  3NZU A;  5DPS A;  1FO4 A;  2ZPY A;  2Z0E B;  1T0Q C;  3MC8 A;  1GAQ B;  1SSN A;  3EHV A;  1K53 A;  1TZ1 A;  1WYW B;  2BKR B;  1FXA A;  4N59 A;  2Y5C A;  3ZKJ C;  1ZOY B;  2V1Y A;  1QOA A;  3U2S C;  3EGR A;  1TTN A;  2WDQ B;  2N9P C;  2KKC A;  4LNO A;  4RGO S;  2JYT A;  3IVF A;  1MFW A;  3RMK C;  3LYY A;  1WM2 A;  1WJ4 A;  5TR5 A;  2J0J A;  2PVO D;  1J7B A;  2WNM A;  1L4D B;  4WJN A;  4IKG A;  2WHI A;  3ZYY X;  4HLE A;  1FNW A;  2NBV B;  4GLS C;  2MBE A;  5DPT A;  3L0W B;  2Y5B B;  3PZ8 A;  1R4N I;  4KGS A;  2KDE B;  1ZW7 A;  5LLI A;  1OQY A;  1SJE D;  4XDC A;  4KDL B;  3KYD D;  3ZJV A;  2L3Z A;  1QOF A;  1YQ3 B;  2Z8L A;  3VR8 B;  4LNI A;  3UIO B;  1EWC A;  2JZP A;  1LXD A;  5DPR A;  4HKQ A;  1DOY A;  3AXC A;  4RM8 A;  3L08 A;  2ZJD A;  1N5W A;  3A4S C;  4E71 A;  2WXM A;  1MJD A;  1R4N B;  2JU6 X;  1SGH A;  1WXQ A;  3BWU D;  5G5G A;  2W54 A;  4MGK E;  1F1H A;  3M95 A;  1OFF A; 
#chains in the Genus database with same CATH homology
 2CHZ A;  3TBL D;  3V6C B;  5C1Z A;  5IA7 A;  3AU5 A;  3ZLZ A;  4A20 A;  1GG3 A;  4G11 A;  5IAA C;  1WMH B;  3ALB A;  3ECI A;  1LQB A;  3DCG A;  1L7Y A;  1LM8 B;  1V9J A;  5EDS A;  2CU1 A;  2R2Q A;  2KTR A;  2JWZ A;  3PZD A;  1P0R A;  1V5T A;  2JF5 A;  1V80 A;  3V6E B;  3VDZ A;  3VTU A;  1WX8 A;  2M1M A;  3MTN B;  4KSK C;  4DWF A;  3ZNH B;  1QZE A;  1WI0 A;  4DDI D;  3ZDM C;  4DDG D;  2IY0 B;  1GJZ A;  4F7Z A;  4HCN B;  2KVR A;  2LWP A;  2D11 A;  3H7P A;  4W9F A;  1P1A A;  1WJU A;  4MSM B;  3ZNI D;  2G4S A;  5L95 C;  1UD7 A;  1IPG A;  4AOF A;  1AAR A;  1WY8 A;  2XK5 A;  4BOZ B;  4B9K A;  2MBB B;  4DHZ E;  5L83 A;  4IM0 A;  2LXC A;  2GBK A;  3UF8 A;  3TJP A;  2CHW A;  1E90 A;  3L13 A;  1E8Y A;  1CMX B;  3JYU A;  4MGI E;  4RM9 A;  3ZIM A;  4KZC A;  3N30 A;  1UH6 A;  2BPS A;  3VHT C;  4OVU A;  3VUY A;  4HWI B;  1C1Y B;  2Z59 B;  3CMM B;  3EEC A;  3NOB A;  4LDT D;  4GSW A;  3ZNG C;  5DPW A;  3ML8 A;  4BKT A;  2FNJ B;  3JSV A;  5G2N A;  3U30 A;  3MJW A;  3QWZ B;  2D3G A;  2MP2 A;  5CHF A;  4HDO A;  4XX5 A;  3VXW A;  4FA6 A;  2NR2 A;  2OOB B;  2YVC A;  3SD5 A;  3HIZ A;  1JRU A;  3WAP A;  2L00 B;  1UBI A;  4CO7 A;  2MCN B;  3RZF A;  2JRH A;  3VQI A;  4E3C A;  3QIJ A;  5C23 A;  1KM7 A;  2KJH B;  3APF A;  4LDT B;  5D7G A;  1TGZ B;  2N1V A;  4FN2 A;  4A3P A;  3DVN U;  1L2N A;  2LRW A;  4BBN C;  2L8J A;  1WGY A;  4WWO A;  2N7D A;  4ZYN A;  3I3T B;  2KN5 A;  4W9E A;  4NY0 A;  3W1Y A;  2BWE S;  2DYM A;  1P9D U;  1RFA A;  2DYO A;  3SDL C;  4JIO U;  2KAN A;  4ZRK A;  2IBI B;  4DHZ B;  1X1M A;  4TQ1 A;  2CHX A;  3L54 A;  3QC8 B;  1WE7 A;  2GOW A;  1LFD A;  2KQS A;  4KIK B;  4M8M A;  2REX A;  5D94 A;  4BKG A;  3M3J A;  4MJS A;  2IO2 B;  5E6N A;  2LUE A;  2LVO A;  3C0R B;  3KYC D;  4MGY E;  4PYU A;  4EEW A;  4PYZ A;  5JZE B;  3K9O B;  2KLC A;  3JVZ X;  3VVW B;  1C3T A;  2KNB A;  2A5U A;  3KVF B;  2C7N B;  2MRP A;  4AP4 C;  1XQQ A;  2NVU I;  2UYZ B;  3A1Q B;  3L10 B;  4WJQ A;  3RCZ A;  2L76 A;  2ZZP B;  2B3A A;  3RYT A;  4TKN A;  3PHW B;  1WGD A;  2O2V A;  3H1U A;  2ASQ A;  4WWP A;  3SU8 X;  4BOS C;  4HXD A;  1I35 A;  2HD5 B;  3PV1 A;  3V62 A;  3VH3 B;  4II2 B;  4LJO B;  5J18 A;  2KTR B;  4AWJ A;  2N4F A;  3CF6 E;  4G50 A;  5LXI B;  3R7R A;  2C9W B;  4FBJ B;  2AL6 A;  1IYF A;  3QQ8 B;  1K8R B;  1RAX A;  1V86 A;  1WXA A;  2FCQ A;  4IM3 A;  4W9I A;  3PT2 B;  2YLM A;  2XEW A;  3DVG X;  2LI5 A;  1G6J A;  4IWO A;  3PPA A;  4K7S A;  4IUM B;  1Q5W B;  3NY5 A;  4K1R B;  4DBG A;  4PS7 A;  2KHW B;  2XK5 B;  4NNJ B;  2K39 A;  1GC7 A;  2C7M B;  5CHW A;  3DQV A;  4KIK A;  5CX3 A;  3NHE B;  3PLU A;  4GOC A;  1SE9 A;  3PRE A;  3APD A;  2EMT A;  3SHQ A;  3V60 A;  3WAO A;  2ZNV C;  2C5L C;  3TMP B;  2KD0 A;  1WXV A;  2CS4 A;  1TBE A;  3APC A;  3QAR A;  1UGM A;  4HK2 A;  4IWQ A;  4ZRJ A;  5J2R A;  3JSV B;  2GBR A;  1J8C A;  5AEK B;  3RUI B;  4EKU A;  4KZ0 A;  4W9G A;  4MEL A;  2LGX A;  4HCP B;  4WAA A;  1MG8 A;  3Q3F A;  1BT0 A;  4K7W A;  2KWV B;  1WX9 A;  4MDK E;  2CKH B;  1ISN A;  3BIN A;  3LDZ E;  5AZG A;  4EZJ A;  3PHX B;  3PRP B;  2KFK A;  1GNU A;  3VH4 B;  2NCN A;  3DBL I;  4IWP A;  4NAW A;  1OGW A;  4MGZ E;  1XD3 B;  2DZK A;  3IFW B;  1NBF C;  2AYO B;  4I6N B;  2WWZ A;  4CYE A;  1P3Q U;  3ZTC A;  1S3S G;  4WQO B;  4NQL B;  2G4D B;  1EF5 A;  2PPH A;  3U8Z A;  3W1S C;  2ZVN A;  4EFO A;  1UEL A;  5HKH A;  2FIF A;  2LJ5 A;  3DPD A;  2ZCB A;  3ZO5 B;  5JH5 C;  2M0X A;  2JPH A;  3NZS A;  4G0N B;  4TV3 A;  1J19 A;  4FAD A;  2PE6 B;  3WAN A;  5AZF A;  2W9N A;  3D32 A;  4NPN A;  3WAM A;  3H7S A;  3L17 A;  2KC2 A;  2FCN A;  1ZGU B;  3AI5 A;  2KWU B;  5E6P A;  4GMV A;  1WE6 A;  4MJS B;  2V3S A;  3W1S A;  1WXS A;  3M63 B;  4HDQ A;  1VD2 A;  3ZRF A;  1S1Q B;  3OJ3 A;  1KJT A;  4ANV A;  3DDC B;  2ZPN A;  3X23 A;  4DXA B;  2JT4 B;  4GIV A;  2MA9 B;  3VUW A;  1H8C A;  2RSU A;  3QJZ A;  4M8N A;  2MLB A;  4BFR A;  1Z2M A;  3UIP B;  4JQW C;  4ICV A;  2O2V B;  1OEY A;  3IG3 A;  2J7Q B;  2K6Q A;  4MH0 E;  4DHJ D;  1P98 A;  2I1K A;  2IZV B;  3ENE A;  3VUX A;  4E74 A;  1YJ1 A;  2JUO A;  5KHO A;  5D6J B;  1NDD A;  2A4Z A;  2JZ3 B;  5J17 A;  1V49 A;  4FJY A;  5CTR C;  4LCD E;  1WGH A;  2DX5 B;  2LVP A;  2MQJ A;  4KVG B;  2KJR A;  4B95 A;  1E7U A;  1OTR B;  2L0F A;  2JZZ A;  2NBU A;  4GGQ A;  3H6N A;  4TQ0 A;  4FHJ A;  4TUU A;  4W9C A;  3UQB A;  2GMI C;  2HTH A;  2BWF A;  3PSE B;  2AL3 A;  2N1W A;  2DZI A;  3Q3J A;  1XT9 B;  3CSF A;  3ZDT A;  4WJO A;  3A9J A;  3HK0 A;  3QCA A;  2NPT A;  2V4L A;  1YX5 B;  2O6V D;  4I6L B;  4URK A;  3IBE A;  4IW0 A;  4BBN F;  5FR6 A;  3ZTD A;  4EZL A;  3VTW A;  1KLV A;  1HE8 A;  4FHK A;  2KFJ A;  4FUL A;  4RMA A;  1V2Y A;  2KTF A;  2L05 A;  1WIA A;  3DVN V;  4W9K A;  5CHV C;  2CR5 A;  2GBJ A;  2ZNV B;  3V61 A;  2KMC A;  4K81 A;  3UIN B;  1Z5S B;  2BYE A;  4AUQ C;  3QX1 A;  1V6E A;  3T9L A;  2KFK B;  3A9K A;  4W9H A;  2FCS A;  2LAS A;  1Q1O A;  3MHS D;  3WIM A;  2RD0 A;  4A3O A;  4B6W A;  4NAW B;  4BKS D;  3ZW3 A;  2DAF A;  3AU4 A;  3UQA A;  2M17 A;  2BKF A;  1YD8 U;  4J6I A;  1I42 A;  2IO0 B;  4M0W B;  2KLG A;  2WYQ A;  2JY6 A;  4BVU C;  2LGY A;  5DCN A;  3R3M A;  3HM6 X;  3RUL A;  4NJ7 A;  2GBN A;  2NBW B;  2L7R A;  2MSE D;  3N32 A;  1WFY A;  2HJ8 A;  3L16 A;  1E8W A;  2FID A;  1F9J A;  4MEM A;  3B08 A;  3ZVV A;  1H4R A;  1ZKH A;  3DVG Y;  3M62 B;  3QAQ A;  2M8S A;  3A4R A;  2LRU A;  1E7V A;  1WZ3 A;  4PS3 A;  2KXJ A;  3B1L X;  4YL8 A;  3RD2 A;  4XZ4 A;  4F8C B;  4EZK A;  2G45 B;  2BYF A;  1GC6 A;  2WX1 A;  1YIW A;  4W9J A;  1WH3 A;  3WAL A;  4GDL A;  2GBM A;  2N9E B;  3PGE A;  4KDI C;  2KX0 A;  3TCA A;  2C7H A;  2KDI A;  3PVL A;  1T0Y A;  1V81 A;  2UWQ A;  3RT3 B;  4FLH A;  2FUH B;  2FAZ A;  3R7Q A;  1E8Z A;  2O6V A;  4OVV A;  3T8M A;  1D3Z A;  2M4N A;  4CHK A;  4NJ6 A;  2N9X A;  1E5W A;  4JGH B;  4LJP B;  3UGB B;  2K8C A;  3DBS A;  1M94 A;  3JW0 X;  1KOT A;  4I6P A;  1GUA B;  1R4M I;  5D2M B;  5KHQ A;  4NQK E;  3PRZ A;  4FJZ A;  4ANW A;  4ICU A;  2D10 A;  4ZRI A;  2LVQ A;  4IG7 B;  1YQB A;  2DYB A;  2ZCC A;  3S2A A;  1WZ0 A;  1EUV B;  2IY1 B;  1WF9 A;  3R66 C;  2LZ6 A;  2R2O A;  1WGR A;  2RGF A;  2XBB C;  4K7U A;  3KUD B;  4ZDV A;  3N3K B;  4BKS A;  2KWC A;  3CST A;  3GOE A;  2KDF B;  3A9J B;  2FCM A;  1WJN A;  2NPT B;  3QHT A;  3DBR I;  3EFU A;  1U4A A;  1SIF A;  4HVB A;  2KQ7 A;  2D2Q A;  4GN1 A;  5JHB A;  2KZR A;  3DOW A;  3PS6 A;  2MW5 A;  3H9D A;  2OJR A;  2C60 A;  3EC8 A;  4PS8 A;  1IP9 A;  1WRD B;  3NS8 A;  1NI2 A;  2DHZ A;  3IHP C;  3LJ3 A;  2KK8 A;  4XC2 A;  4GDK A;  3A9K B;  3KUC B;  4F1S A;  1UBQ A;  1WX7 A;  3RZW C;  3AUL A;  5JHA A;  2VRR B;  2EKE C;  5GMV A;  2KX3 A;  2K25 A;  2Z0D B;  3NZU A;  4HPM B;  1Q0W B;  3OAW A;  5DPS A;  2ZPY A;  2Z0E B;  2BGF A;  4X57 B;  2MX2 A;  1WMH A;  4EOY A;  3EHV A;  2J0M A;  2LXA A;  1EO6 A;  1PQS A;  2RPQ A;  1WM3 A;  2JVC A;  1TZ1 A;  2QHO A;  4DHJ B;  2IO1 B;  5LXH A;  1WYW B;  3ZNZ B;  4FJV B;  2BKR B;  2NS5 A;  3K9P B;  3ZKJ C;  2MBQ A;  1WR1 A;  2V1Y A;  1RRB A;  1TTN A;  5E6O A;  1RLF A;  2PE9 A;  2N9P C;  2KKC A;  2IO3 B;  4HJK A;  2K8B A;  3KW5 B;  2AEH A;  3WA0 A;  1WGG A;  2KOX A;  2JXX A;  3IVF A;  4GDL B;  3PRM B;  2DZM A;  2N7E A;  1WM2 A;  3P2B A;  1WJ4 A;  5TR5 A;  2J0J A;  2MWS B;  1J0G A;  2PJH A;  3HM3 A;  3OLM D;  4WJN A;  4KSL C;  2O6V B;  2DEN B;  2KJ6 A;  4MM3 A;  2MBO A;  4AJW A;  4II3 B;  4HLE A;  3VAW A;  2NBV B;  3O65 B;  2MBE A;  3DBH I;  3L0W B;  2Y5B B;  2KO3 A;  5DPT A;  2K1F A;  4ANX A;  3HHM A;  1R4N I;  4AJY B;  1A5R A;  4MSQ B;  4WJP A;  3TIX A;  2IYD B;  2RR9 A;  4KV2 A;  2KDE B;  3VTV A;  1ZW7 A;  5LLI A;  1OQY A;  2BYV E;  4GXB A;  2WDT B;  2G3Q B;  2KC1 A;  3TL5 A;  3ZUN A;  2MBH A;  2WX0 A;  3QA8 A;  2K8H A;  2D07 B;  3KYD D;  4KDL B;  2ZVO A;  1OEY J;  3X0W A;  4EUT A;  1WXM A;  2L3Z A;  3A33 B;  3BY4 B;  3KH0 A;  3QK0 A;  2BF8 B;  3ONS A;  3H7P B;  4N9F 4;  4P7I A;  5G55 A;  1YX6 B;  3KUZ A;  4ANU A;  2DZJ A;  1Y8R C;  4HPL B;  2KDB A;  5AZH A;  2DAJ A;  4GU2 A;  3UIO B;  2KMA A;  4ASW C;  4DK5 A;  1LXD A;  2J0K A;  1E8X A;  4GB9 A;  4W9D A;  5DPR A;  1WR6 E;  2LD9 A;  3AXC A;  3L08 A;  4RM8 A;  4W9L A;  4G3X B;  2L0T A;  1VCB A;  1UZX B;  2ZJD A;  3A4S C;  2K6D B;  3GZN I;  3ZRC A;  4IC7 B;  4E71 A;  2AWT A;  3PLV A;  1EF1 A;  3OJ4 B;  4GDK B;  1SGH A;  4IM2 A;  2LGD A;  3U7D A;  1WJ6 A;  2EMS A;  3PTF C;  2HE7 A;  2ZEQ A;  5BO4 B;  2PEA A;  4MGK E;  3VFK A;  3A1Q A;  2I1J A;  1V5O A;  1FXT B;  2JRI B;  4JL9 A;  3B0A A;  4JLC A;  4WWN A;  2MP2 B;  3M95 A;  3ML9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...