3GOEA

Molecular mimicry of sumo promotes dna repair
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
HHHHHHKLITLLLRSSKSEDLRLSIPVDFTVKDLIKRYCTEVKISFHERIRLEFEGEWLDPNDQVQSTELEDEDQVSVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein rad60
publication title Molecular mimicry of SUMO promotes DNA repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Recombination, replication
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3goeA00
2KJ6A 4HJKA 1E7VA 1IP9A 4K81A 2IO1B 3B08A 1WJNA 3QAQA 4IC7B 4ANWA 4DXAB 4P7IA 2ZEQA 2LRUA 2MBBB 3QARA 5E6NA 4BVUC 3ZO5B 2KVRA 5BO4B 2JXXA 2Z0EB 3H7PA 2MLBA 3A1QA 1WJ6A 4DWFA 2KWCA 3L54A 4DHZB 1VCBA 1WGDA 3TJPA 2MA9B 4KIKB 2L0FA 1WF9A 1SIFA 4M0WB 4EZKA 1KM7A 4HDQA 5JH5C 2G4SA 4ICUA 4NAWB 3DVGX 3ZUNA 1GJZA 2G4DB 2KANA 1WI0A 3V61A 4BBNC 4F1SA 3T8MA 4AWJA 3PHWB 1I42A 2Z59B 1GNUA 1WMHA 4MM3A 2LVOA 1JRUA 2XK5B 1I35A 5JZEB 2KX0A 3QWZB 1P98A 4IWPA 4FADA 5LXHA 2KWUB 2O2VB 3RYTA 4AJYB 2DHZA 1E8WA 1WGRA 2LGDA 3VVWB 2D2QA 2YVCA 3SDLC 3QQ8B 2C7MB 2K6DB 3OJ3A 2JWZA 1WYWB 2KK8A 4K7UA 4FA6A 4KSLC 4ANXA 3OAWA 2REXA 4PYUA 4KZCA 3ZW3A 2JT4B 4W9CA 3VTVA 4MDKE 2OJRA 3QHTA 2HE7A 3EECA 1WE6A 4DDGD 4TQ0A 1V5OA 1YX6B 3OLMD 3ALBA 3A4RA 3ECIA 3NZSA 3DQVA 4BBNF 4EZLA 3DOWA 4HCNB 2CU1A 4K7WA 4NNJB 1V49A 3UIPB 4B95A 4E74A 5KHOA 3IFWB 2KQ7A 2L76A 5AZHA 1MG8A 3R3MA 1EF5A 4F7ZA 3NZUA 1KLVA 3M63B 3MTNB 4GN1A 2DYOA 2KLGA 3A9KA 2ZCCA 2V1YA 3DBLI 4LCDE 4W9KA 2PEAA 5AZFA 3U7DA 3UF8A 5D7GA 4WWPA 2NPTB 2JVCA 4DK5A 2PPHA 3ENEA 4URKA 3PRMB 4I6PA 3ZDMC 2J0KA 2L05A 1E8YA 2MCNB 4IG7B 3N3KB 2C5LC 2EMSA 4II3B 2K1FA 2LGYA 3O65B 4JL9A 3C0RB 4GOCA 2ZVOA 3UIOB 2K8CA 3ZDTA 4FN2A 1XT9B 3H9DA 2R2QA 1WR6E 3L10B 4CHKA 3PREA 4XZ4A 3V6CB 4A3OA 1Q0WB 4JQWC 1H4RA 4J6IA 1SE9A 3SHQA 2KDIA 4BKSA 4IWOA 3T9LA 4JGHB 3PVLA 2DAJA 1OEYA 4WQOB 5IAAC 2KLCA 2L3ZA 2FNJB 3N32A 1F9JA 5KHQA 2XEWA 5JHAA 2KKCA 2MBOA 3L13A 4GDKA 1LFDA 3M95A 3WANA 4MSQB 5D2MB 5IA7A 5D94A 2LI5A 2LASA 4FULA 4WWNA 5CX3A 4HCPB 2Y5BB 3M3JA 1WZ0A 2ASQA 2NBVB 4A3PA 4FBJB 2KMCA 1TBEA 1WGHA 4GU2A 2PJHA 4HWIB 1WGGA 4GXBA 4AOFA 3PPAA 4K1RB 4PS7A 3ZNGC 3PGEA 2I1KA 3VTWA 4FJZA 4MGZE 1PQSA 1Q1OA 1S3SG 1H8CA 4ZYNA 2C9WB 2NBWB 2RGFA 2NVUI 2N1WA 1WM3A 2FIFA 3QK0A 2JF5A 1L7YA 3H6NA 4TQ1A 2ZCBA 2LXAA 2A5UA 2RPQA 1E7UA 2FUHB 1K8RB 3AU5A 2EKEC 2FCMA 1GC7A 3A33B 3V60A 1WJUA 1AARA 4LDTD 4NPNA 3PRPB 2N9XA 4HPLB 1V2YA 5DPWA 4W9EA 1G6JA 1YD8U 4IM2A 3EC8A 3H7SA 3NS8A 3ZRCA 1UGMA 1E8XA 3VUYA 1IYFA 2GBMA 4RM9A 1UBIA 3DCGA 3KH0A 2OOBB 1ZKHA 2M17A 2D10A 3P2BA 3RCZA 4DHJD 2ZVNA 1UD7A 3VDZA 4TV3A 2DZKA 4M8NA 3KUZA 5HKHA 2O6VD 4W9HA 1RAXA 4KDLB 5G55A 4W9FA 2GMIC 4MEMA 4IM0A 4YL8A 1BT0A 4JLCA 3ML9A 2LWPA 2K25A 4OVUA 3HHMA 3QC8B 3A9JB 3PLUA 3WALA 4WWOA 3RD2A 4PS8A 4BKTA 3WAOA 4IW0A 1EUVB 3PV1A 3ZLZA 5DCNA 2IYDB 2D11A 2MX2A 1TTNA 2WDTB 4MGKE 1P0RA 2CS4A 5G2NA 3S2AA 4DBGA 1D3ZA 2KC2A 4DDID 2AL6A 2AL3A 4GMVA 4KIKA 1L2NA 3JSVB 3R7RA 3R7QA 5E6OA 3Q3JA 4NAWA 2MQJA 1E8ZA 2DENB 4FHKA 4KDIC 2FCQA 2KDEB 1S1QB 4MGIE 2W9NA 3ZNHB 2KMAA 2DZIA 2K6QA 4II2B 2ZJDA 2VRRB 2KFKB 2RR9A 1SGHA 2N9PC 2WWZA 2XK5A 5DPSA 1YQBA 3M62B 3OJ4B 2JPHA 2NCNA 2NS5A 1V5TA 2O2VA 2LRWA 2M0XA 3JW0X 4MGYE 4W9JA 5CHWA 5EDSA 5J2RA 1V6EA 2AEHA 1QZEA 2KZRA 4PS3A 3GZNI 4EOYA 3IVFA 3VXWA 3I3TB 3NOBA 1KOTA 2KJRA 5C1ZA 5AZGA 1V9JA 2DZMA 4KV2A 3LJ3A 3LDZE 1J0GA 2MP2B 3NHEB 3A9JA 2IO2B 2K39A 3RT3B 2BKFA 1YIWA 4M8MA 2M1MA 4HVBA 3KYDD 2FAZA 2MBHA 3KVFB 4CO7A 4DHJB 2ZZPB 1WIAA 1ZGUB 2JUOA 2L7RA 1LM8B 2BGFA 1WRDB 2NR2A 3VUXA 2O6VB 3H1UA 1J8CA 3B1LX 3KUDB 4LJOB 3APDA 1T0YA 5J17A 2WX0A 3PSEB 3WAPA 1V80A 2IO0B 2JRIB 2FIDA 2IO3B 4GGQA 1V81A 3UGBB 4GDLB 5AEKB 2KNBA 3TIXA 2QHOA 2BYVE 2LJ5A 4G11A 1M94A 2KTRB 1R4NI 4HK2A 1NBFC 1UBQA 1XD3B 1P1AA 2KN5A 3VUWA 5C23A 2JZZA 2MW5A 1OTRB 3BINA 4FJVB 1WE7A 5CTRC 2ZNVB 4BOZB 2DZJA 1WM2A 2I1JA 4WJPA 4EKUA 1EF1A 4I6LB 3EFUA 1WH3A 4EFOA 3PRZA 1A5RA 3H7PB 2LUEA 2BPSA 2NPTA 3NY5A 3PHXB 4KZ0A 4WJQA 5E6PA 1RRBA 1XQQA 2HTHA 3ZNZB 5LXIB 2N9EB 2CR5A 2ZPYA 3L16A 3Q3FA 4ZRKA 5DPTA 4EUTA 3L0WB 1Z5SB 2KD0A 2GOWA 3HM3A 4GSWA 3V62A 4HLEA 1NDDA 1WX7A 2M4NA 3GOEA 3JYUA 2AYOB 1EO6A 4B6WA 3VQIA 3APCA 2ZPNA 3WAMA 2BF8B 4CYEA 1WMHB 4OVVA 2MBEA 1UZXB 4AJWA 3ZRFA 5J18A 2V3SA 3DBSA 3IBEA 1WR1A 2DAFA 2L00B 1UELA 2LXCA 5LLIA 4HXDA 2J7QB 4ASWC 3WIMA 3MJWA 1R4MI 1WGYA 2LVPA 2MWSB 4NQKE 3RULA 2MBQA 4BFRA 4MSMB 4BKSD 3HM6X 1TZ1A 2NBUA 2CHXA 1P9DU 2RD0A 4MJSB 3PZDA 4G50A 1ZW7A 4IUMB 2ZNVC 3ZTCA 2GBJA 4GIVA 1E5WA 2IY0B 2L8JA 2YLMA 4ICVA 3U30A 3APFA 2K8BA 3DBHI 1RFAA 3W1YA 4ANVA 2GBKA 3HIZA 3L17A 3RZFA 4I6NB 2LZ6A 3IG3A 3QCAA 2DX5B 4DHZE 1Q5WB 4IM3A 3QJZA 3VFKA 2WX1A 3VH4B 1IPGA 2KDBA 4WJNA 4GB9A 3IHPC 3X0WA 3A4SC 1J19A 4RMAA 3CSFA 4BKGA 4MH0E 4FJYA 1V86A 3CF6E 2MSED 4FHJA 1E90A 3EHVA 4XX5A 4E3CA 1TGZB 2CHWA 2HD5B 2LD9A 3ML8A 3UQBA 3ZVVA 2C60A 3PT2B 4ANUA 4EZJA 2KX3A 3KUCB 2J0JA 3A9KB 3PTFC 3AI5A 4KSKC 5D6JB 3K9PB 2FCSA 4A20A 5JHBA 2KDFB 1WXMA 4G0NB 4HPMB 5CHFA 2PE9A 4E71A 2IBIB 2CKHB 5TR5A 2HJ8A 1FXTB 2FCNA 3MHSD 1U4AA 3UINB 3V6EB 4B9KA 4ZRJA 2LGXA 3D32A 4MJSA 3WA0A 1C3TA 3RZWC 1WXVA 2UWQA 1CMXB 4G3XB 2J0MA 1WZ3A 3ONSA 1WFYA 4F8CB 3CMMB 4KVGB 2Z0DB 3W1SA 4WJOA 4TUUA 2KTFA 3W1SC 4LDTB 2CHZA 3AU4A 3AXCA 3L08A 4BOSC 4AUQC 2C7HA 1UH6A 2C7NB 1YJ1A 3DVGY 2AWTA 3KW5B 2UYZB 2XBBC 3QA8A 2D3GA 4NJ6A 2G45B 2A4ZA 5DPRA 3ZNID 1Y8RC 1WJ4A 4XC2A 2BYFA 1LQBA 4GDKB 1OGWA 1C1YB 2RSUA 4EEWA 3PS6A 3DVNV 2N1VA 4FLHA 4N9F4 3BY4B 3R66C 3VHTC 3UQAA 2KXJA 4ZDVA 3TCAA 2D07B 1ISNA 2JZ3B 2N4FA 3JSVA 1WY8A 4WAAA 3K9OB 3TMPB 1LXDA 5CHVC 4TKNA 4HDOA 4RM8A 3TBLD 3RUIB 1GUAB 4NY0A 3VH3B 2KFKA 2IY1B 2JY6A 2BWFA 2L0TA 1GG3A 2PE6B 3DVNU 3KYCD 1WX8A 3ZKJC 3TL5A 4JIOU 2GBRA 5L95C 1NI2A 1WXAA 4K7SA 2KWVB 3DBRI 2IZVB 3N30A 1GC6A 4W9LA 2KC1A 1KJTA 2KO3A 1OEYJ 2DYMA 2M8SA 2B3AA 4PYZA 1VD2A 2KOXA 3JVZX 3A1QB 5FR6A 2JRHA 3U8ZA 3X23A 3DPDA 2MP2A 2WYQA 2KHWB 2DYBA 3ZTDA 2BKRB 2EMTA 2R2OA 3AULA 4MELA 3CSTA 1HE8A 3B0AA 3SU8X 2MRPA 1P3QU 4LJPB 3SD5A 3DDCB 2LVQA 4W9GA 1RLFA 2G3QB 3VAWA 1X1MA 3QIJA 2K8HA 4NQLB 2O6VA 4IWQA 2BWES 4W9IA 2V4LA 3HK0A 1WXSA 2N7DA 4W9DA 1WX9A 4ZRIA 3QX1A 3PLVA 4AP4C 2KJHB 1YX5B 5L83A 4X57B 4GDLA 3VTUA 5GMVA 2KFJA 2N7EA 2KTRA 4NJ7A 1OQYA 2KQSA 2BYEA 1Z2MA 3ZIMA 2GBNA
chains in the Genus database with same CATH superfamily
1E7VA 2V3PA 1WJNA 3QAQA 4IC7B 4XYCA 2ACZB 3H7PA 3DWMA 4DWFA 1WGDA 3TJPA 3GS2A 2L0FA 4NAWB 1GJZA 4IKGA 3BK1A 2G4DB 4F1SA 3T8MA 1IGDA 3PHWB 2Z59B 1I42A 2LVOA 1MVKA 1I35A 1DYQA 4IWPA 1WGRA 2LGDA 3VVWB 2YVCA 3SDLC 2PMVA 3VR8B 3OJ3A 4M02A 4KSLC 2W3SA 3RNEC 4ANXA 4AQ7A 2WDQB 1I4QA 2OJRA 2WNMA 1D5ZC 4B0EA 3QHTA 3EECA 4RF0A 3BYTB 3N20C 1FCLA 3OLMD 2IGHA 3ECIA 3NZSA 3DQVA 1STEA 2CU1A 4B95A 5KHOA 3IFWB 2KQ7A 3RNBC 5AZHA 1SF0A 1KLVA 3M63B 5D7GA 2VH2A 4URKA 1SXTA 1SJHD 4I6PA 2J0KA 1E8YA 2MCNB 3N3KB 3O65B 4C7ZA 4JL9A 2ZVOA 2K8CA 3H9DA 2R2QA 1WR6E 3PREA 4A3OA 3P4SB 2KDIA 2BTEA 4JGHB 2WU5B 2KLCA 2L3ZA 5KHQA 1FNUA 1EM7A 2KKCA 1LFDA 4WWNA 2Y5BB 4A3PA 2NBVB 4K1RB 2WS3B 3PGEA 3IXSA 2GI9A 1N63A 2NBWB 2RGFA 2NVUI 3W5VB 2FIFA 2JF5A 4TQ1A 1YJJA 2WU2B 1BMLC 3AU5A 3ZXRA 3SFEB 1ROEA 3EGRA 1WJUA 2I2YA 4NPNA 1V2YA 1RM6C 3Q8EA 3E9SA 3EC8A 3H7SA 3NS8A 3ZRCA 3N1XC 5IKCM 5IO9A 1SE3A 3P4QB 3KH0A 3B2FA 3P2BA 3RCZA 2ZVNA 1B1ZA 2WXHA 2GMIC 4YL8A 4JLCA 1TS5A 3ML9A 3C8YA 5HHDG 3AE6B 1EU3A 3N9YC 4WWOA 3VRAB 3RD2A 3Q8BA 1ZP0B 2QMTA 1L5PA 3PV1A 4L1BA 4MGKE 3N1YC 1P0RA 5D3IB 2CS4A 2PIAA 1D3ZA 2KC2A 4DDID 3SEBA 3R7QA 5E6OA 3Q3JA 4NAWA 1E8ZA 2DENB 1K53A 2FCQA 2KDEB 1S1QB 4MGIE 3ZNHB 1SGHA 2N9PC 5DPSA 1YQBA 1QLBB 1IBXB 3OJ4B 1M4VA 2N9KA 1FPYA 5EDSA 4MGYE 4XDCA 1YMHE 4K3BA 3IVFA 5AZGA 4KV2A 1WWTA 3ZJTA 3NHEB 2QDFA 4M8MA 2MBHA 4CO7A 2L7RA 3V05A 1CZPA 2BGFA 2NR2A 3VUXA 3H1UA 3KUDB 5J17A 2WX0A 1V80A 5AEKB 4GGQA 1V81A 2KNBA 3TIXA 1M94A 4HK2A 1XD3B 3VUWA 2IDYA 5C23A 5G5HA 1WE7A 1ENFA 2M19A 1FNWA 2ZNVB 4BOZB 2E3TA 1WM2A 1BXTA 4I6LB 4EFOA 1A5RA 2KVZA 4KZ0A 4WJQA 1RRBA 1XQQA 2N7JA 2JZPA 4ZRKA 4GSWA 5IOIA 4B6WA 3WAMA 3Q6BA 4MM3B 3KQ4A 3SR6A 4US8A 2WXNA 4A90A 1QKZA 3ZRFA 1JWBD 2DAFA 1UELA 1MHXA 2LXCA 1J7BA 3MJWA 1GB4A 1J7CA 3U4EG 4MSMB 4BKSD 1TZ1A 4MJSB 1T5XD 3PZDA 5BYRA 3T3OA 4ICVA 1DOYA 2K8BA 2CJOA 1XCTL 4ANVA 2BS2B 2WGSA 3HIZA 5H92C 2WDRB 1ZXIA 1N5XA 3X0WA 1J19A 4RMAA 2IGGA 4MH0E 4FJYA 1UWMA 1V86A 1SB3C 2HD5B 2WXJA 2KX3A 2J0JA 3A9KB 3FC4A 3AI5A 2LEKA 4JPSA 2FCSA 5JHBA 4XWTA 2KDFB 4YSXB 2KT7A 1C9FA 5BYQA 1U4AA 4B9KA 1WXVA 2J0MA 1NENB 4A55A 4KVGB 2V0GA 2Z0DB 3W1SA 2QSDA 3AXCA 3L08A 2UU7A 4BOSC 3HRDD 2MJDA 4AUQC 5FKAC 3DVGY 3KW5B 4OW0A 2XBBC 4NJ6A 3ZNID 1HEZE 1AWDA 1Y8RC 3ZXVA 1UWXA 1I4PA 1JALA 1C1YB 1PDXA 3PS6A 1SE2A 3ZJVA 3R66C 3BVGA 1A70A 2D07B 2WHIA 5HG2A 3K9OB 4RM8A 3TBLD 1AN8A 1SE4A 4P6VF 4LK0M 2IY1B 2L0TA 1GG3A 1WX8A 1IBXA 4JIOU 1NI2A 4K7SA 2KC1A 2M8SA 4MT5A 2KOXA 1C77A 1N61A 2KHWB 3AULA 3VRBB 2QJLA 4J3OD 2V4LA 3HK0A 1WX9A 3O13A 4LNFA 1IGCA 3SFDB 2N7EA 3NVWA 2H89B 2WXFA 2KQSA 3TUOA 4ANWA 1TYGB 2ZEQA 1XXGA 1F77A 2VH1A 2MLBA 3N1ZC 3A1QA 1QQRA 1WJ6A 2D3BA 3L54A 4DHZB 3RNGC 2QILA 1GB1A 3V61A 1WI0A 4BBNC 3BVMA 4WAFA 4AWJA 4MM3A 2PVGC 1JRUA 1P7EA 2G9HD 4FADA 2KWUB 2O2VB 3PO0A 1E8WA 1UF0A 2G1EA 4C56C 1VR9A 3DHIC 1WGKA 3QQ8B 2C7MB 3ABVB 2REXA 1F1HA 4KZCA 4W9CA 2KQ4X 3RNFC 3A4RA 1ZDVA 2RDBC 3DOWA 4LNOA 4RFBA 1E0ZA 1V49A 2NMQA 5FK9C 3Q8FA 1K52A 1EF5A 2K3UA 2RPVA 4REZA 2EKIA 3R2IA 2DYOA 1TJEA 1FXAA 2KLGA 2V1YA 3A9KA 4FXCA 4LCDE 5AZFA 4A6QA 4WWPA 2NPTB 4DK5A 2QC8A 2PPHA 3PRMB 4AS1A 1VZ6A 1ET6A 3TEXA 2LGYA 2E6XA 2WXGA 2OJWA 2M0AA 2NTTA 3UIOB 2LGIA 3ZDTA 2LUMA 4CHKA 3AEBB 2INPE 4RNAA 1HZ6A 1Q0WB 1VZ7A 1H4RA 4J6IA 5AUIA 1SE9A 3T3NA 3KLSX 5GXGB 3RNCC 3L13A 3FKYA 1VLBA 3WANA 4L23A 5D94A 2LI5A 5IP4D 4HCPB 4EE2A 2ASQA 2K5PA 1WGHA 2GB1A 1CJEA 4HWIB 1TIFA 4GXBA 4WQMA 3ZNGC 4FJZA 1S3SG 1H8CA 2KACA 4ZYNA 2YEPF 2N1WA 2Q5WD 1WM3A 1L7YA 4ZHPA 2RPQA 1E6EB 2FUHB 4ZRPA 1K8RB 1XLOA 4LDTD 5HI1A 4HPLB 5DPWA 2J42A 2TSSA 1YD8U 1ET9A 3VUYA 1FRRA 2GBMA 2JYEA 1QOFA 1FXIA 3VR9B 1DGJA 4TV3A 4M8NA 5HKHA 3Q14C 4W9HA 3EA6A 4W9FA 2V4IB 4IM0A 2K25A 4OVUA 1WXQA 3QC8B 5EE3A 2DNFA 3PLUA 4KKJA 4BKTA 3WAOA 3AH7A 3LB8C 3ZLZA 2IPKD 2IYDB 2MX2A 1L0VB 1T0RC 5G2NA 4DBGA 2AL6A 3URYA 4BZAA 4GMVA 3R7RA 2WP9B 2MQJA 1CQVA 3DHHC 4ITKA 4TSSA 3NUHB 2KMAA 2RR9A 3MC9A 2LHDA 2NCNA 2O2VA 3JW0X 2M0XA 2KZRA 3W9CB 3GZNI 5H8YE 1J0GA 3LDZE 2MP2B 2VZKD 4R3DA 2WXLA 1YIWA 2M1MA 4HVBA 3KVFB 3GZNB 1PFDA 1F0ZA 4HROA 1J8CA 4LJOB 1V97A 2IO3B 3UGBB 1R7SA 4GDLB 2QHOA 2LJ5A 4G11A 1R4NI 1NBFC 1UBQA 2KN5A 4FJVB 3P42A 4DXFA 2FBWB 3J9CA 4KGRA 1EF1A 1WH3A 3NY5A 1R4NB 2NPTA 5E6PA 1YQ3B 3R2TA 3Q3FA 5DPTA 3L0WB 1Z5SB 2GOWA 4HLEA 2B76B 2M4NA 3AB5A 2MEKA 2WXKA 3AECB 2J4XA 4OVVA 1YQ4B 1UZXB 4AJWA 5J18A 3DBSA 3MP9A 3GB1A 1WR1A 2L00B 3Q3NC 3WIMA 4ASWC 1NI3A 2MWSB 4NQKE 3ETRA 3RULA 4BFRA 1YNTE 1N6ZA 1RFKA 2NBUA 4G50A 4QAYA 2ZNVC 5C2TB 1E5WA 1MJDA 2YLMA 4HPPA 3APFA 3CIRB 1VRAB 3DHGC 2AX5A 3ZJUA 2LZ6A 2ZW0A 3MJ5A 4IM3A 3QJZA 5C3JB 2KDBA 3HVDA 1ZXHA 2JX5A 4WJNA 3A4SC 3Q69A 2D3CA 2MSED 3EHVA 4XX5A 1TGZB 2CHWA 2C60A 4EZJA 1T0QC 3BK2A 5EE1A 3K9PB 4G0NB 1QT9A 4JWSC 1RWSA 5TR5A 4S17A 3V6EB 2LGXA 3AE7B 3D32A 1HTQA 1C3TA 3RZWC 3OWEB 3ONSA 1WFYA 4F8CB 2HJ1A 2YEPB 3NVZA 2CHZA 3AU4A 1JWAD 1ESFA 2MJ3A 2C7NB 1KFYB 2AWTA 2UYZB 2Y5CA 5DPRA 1E9MA 1ZDXA 4GDKB 4L2YA 3DVNV 3RI7C 4FLHA 4ZDVA 3L4PA 4WAAA 5JXVA 3TMPB 4ZYSA 5CHVC 4TKNA 1GUAB 3VH3B 3RMKC 3DVNU 3TL5A 1AYFA 5L95C 1WXAA 2W55A 2KWVB 3DBRI 2IZVB 2BS3B 3GP7A 4YWGG 1KJTA 4HEA1 2DYMA 4WH4A 3AEAB 3A1QB 5FR6A 1I4XA 1N60A 3X23A 3DPDA 2MP2A 4JWUC 3ZTDA 4MELA 1HE8A 3DBRB 3SU8X 3SD5A 4LJPB 2LVQA 1X1MA 2FE8A 4K3CA 2AQ3B 4IWQA 2CU3A 2N7DA 1F2RI 2KYWA 3PLVA 2KJHB 1YX5B 4GDLA 3EUB2 2R61A 4RGNA 4BAXA 1LGRA 1OQYA 3Q3OC 3ZIMA 2IO1B 3B08A 3ZGZA 4DXAB 2MBBB 3QARA 5E6NA 1FFUA 3ZO5B 2JXXA 2KWCA 5IN7A 1VCBA 5BMIA 2MA9B 4KIKB 1LO5D 1ZUD2 1E10A 1KM7A 2BW2A 4HDQA 2G4SA 4MACA 4XWWA 2KANA 1TY0A 3KWVA 4WURA 1GNUA 2DHZA 3I5JC 2D2QA 1YJIA 2JWZA 4K7UA 4FA6A 1XCQL 3ZW3A 2JT4B 3AE8B 4DDGD 1YX6B 2ZW1A 1HA5A 4BBNF 2BQQA 4HCNB 1VJKA 2BYTA 4K7WA 1UGJA 3HVZA 3UIPB 4P1BC 1IUEA 1MG8A 4RF1A 4KKIA 3NZUA 4OVZA 4ZOHC 3MTNB 4W9KA 2PEAA 1C4PA 4N59A 1ZOYB 2JVCA 3B9JA 3ENEA 1C4CA 2L05A 3GE8C 1J7AA 3AE2B 4IG7B 1JWSD 2GRIA 2EMSA 4YSZB 1EU4A 1JW9D 1E7PB 4P16A 4XE0A 2DLBA 4FN2A 3B2GA 4YTNB 4XZ4A 2XN9C 4RGTA 3V6CB 4JQWC 4BKSA 1PUTA 4IWOA 5G5GA 3T9LA 1NYQA 1OEYA 4O1NA 1PGAA 1SSNA 4WQOB 3MFGA 3TEYA 1VDVA 3N32A 1F9JA 5JHAA 4GDKA 3M95A 1I4GA 5D2MB 5IA7A 2LASA 4FULA 4FBJB 1DOXA 2KMCA 2HTME 2M56B 4GU2A 2ICIA 2K0PA 4USAA 3KWLA 1WGGA 1TS4A 3PPAA 4PS7A 4MGZE 1PQSA 1TKEA 1Q1OA 1MFWA 4LNNA 3QK0A 1JMLA 2ZCBA 2LXAA 4Q2JA 1V8CA 4MH8A 2EKEC 3IAS1 1AARA 2WXIA 3PRPB 2LFIA 3I57A 4W9EA 2PTLA 4LNKA 1G6JA 4IM2A 2V9HA 1E8XA 1IYFA 4RM9A 1UBIA 3WCQA 2OOBB 4ARCA 1V1OA 1GAQB 4DHJD 2D3AA 1FO4A 1UD7A 3ZQ4A 3NRZA 2DZKA 2O6VD 1RAXA 4MEMA 1TKGA 1L0YB 3HHMA 1C76A 3WALA 2BB6A 4PS8A 3DBHB 1QILA 3UI3A 2KAJA 1EUVB 2WDVB 1TTNA 2WDTB 3LXFA 4PT5A 1KH0A 3P4PB 2AL3A 4KIKA 3JSVB 4KDIC 5I4DA 2W9NA 2K6QA 1Q10A 4WIPA 1EWCA 2VRRB 1L4DB 1ZE3D 2W54A 3RN9C 2JPHA 2NS5A 2LRWA 1MPEA 5CHWA 1QZEA 3VXWA 3I3TB 2KJRA 4JX1C 1V9JA 2DZMA 3LJ3A 1K50A 3A9JA 3RT3B 3AEGB 1WIAA 5E6JA 3B1LX 1F52A 2BVCA 3CWIA 1N5WA 3APDA 5BMGA 3WAPA 2IO0B 5AUKA 2MW5A 1OTRB 3NZ3A 5CTRC 4EKUA 1FD6A 3PRZA 1FNVA 2W82A 3PHXB 3ZNZB 2HTHA 2BB5A 4JE3B 2N9EB 2CR5A 3L16A 4EUTA 1T6BX 2KD0A 2L83A 3HM3A 3V62A 1NDDA 1P7FA 5TSSA 3GOEA 3JYUA 2AYOB 4S0RA 1JROA 2BT6A 2QCZA 1WMHB 2W3RA 1MG4A 2MHJA 3IBEA 5LLIA 4ZHOA 4HXDA 2JU6X 1L0XB 1R4MI 2WLBA 2MBQA 3P63A 2PKOA 3MC0B 4DQOC 4ZRQA 3ZTCA 3BWUD 4GIVA 2L8JA 3U30A 1R4MB 3W1YA 3DWGC 2GBKA 3FILB 3RZFA 4I6NB 3IG3A 1JWMD 1XO3A 2DX5B 1KTKA 1Q5WB 4RGOS 3Q8CA 3VFKA 4GB9A 5EE9A 5D3DA 3CF6E 1E90A 4KX6B 4HKZE 3IAM1 2LD9A 3UQBA 2QEJC 3ZVVA 3PT2B 1K51A 4KSKC 3AEDB 4A20A 1VZ8A 1WXMA 4HPMB 2CKHB 4RH6A 2HJ8A 1OQQA 3PZ7A 2RDGA 4ZRJA 1JRPA 3WA0A 1CMXB 1WZ3A 3ZYYX 3CMMB 4CQNA 4TUUA 2KTFA 3W1SC 2DWQA 1HQRD 4IDIA 2C7HA 4XDDA 3RFZB 2D3GA 2A4ZA 1AW7A 1UNSA 1WJ4A 2PW9A 4XC2A 3BYYB 1LQBA 1JQ4A 4EEWA 2KMMA 2N1VA 3I63C 4N9F4 2KXJA 3Q3MC 4N6EB 3NG0A 3JSVA 2N4FA 2MJEA 1WY8A 4NY0A 1KRHA 1T3QA 2JY6A 2BWFA 1ACCA 3N30A 2KO3A 1OEYJ 4M00A 2B3AA 4PYZA 1VD2A 1WSPA 3JVZX 2JRHA 4C80A 2QIEB 2WYQA 5MPOA 1TS2A 2BKRB 3B0AA 1TY2A 1P3QU 3DDCB 4NAMA 4W9GA 3QIJA 4NQLB 1TKYA 4W9IA 2BWES 3Q8AA 1FRDA 1WXSA 1SEBD 1KLGD 4AP4C 2IGDA 5L83A 1UUPA 5GMVA 2GLSA 2OEDA 3NS1A 2KWDA 1Z2MA 2PLPA 4UDUC 1QF6A 2KJ6A 4HJKA 1IP9A 4K81A 2SAKA 4P7IA 2LRUA 4BVUC 2KVRA 3AN1A 5BO4B 2Z0EB 1GOZA 1KF6B 3BVZA 3H8HA 1HZ5A 1N62A 2NTSA 1WF9A 1SIFA 1XLQA 4M0WB 4EZKA 5JH5C 2FUG1 5BYSA 4ICUA 3DVGX 3ZUNA 2LGSA 2WQYB 3AE5B 1WMHA 1DOIA 1WRIA 2XK5B 5JZEB 2KX0A 1FCCC 1P98A 3QWZB 1PGBA 5LXHA 3RYTA 4C00A 4AJYB 2K6DB 1WYWB 2KK8A 2MH7A 2WXMA 1NYRA 1RYJA 3OAWA 4IOIE 1F2RC 2IJ0A 4PYUA 3AV8A 3VTVA 4WWMA 4MDKE 2HE7A 4TQ0A 1WE6A 1V5OA 3ALBA 3FILA 1JWUD 4EZLA 4NNJB 3MC8A 4E74A 2L76A 3R3MA 4F7ZA 2AQ2B 4GN1A 4A9AA 2ZCCA 3DBLI 3U7DA 3UF8A 4OZAA 2JWUA 4YXDB 3ZDMC 1NVID 2KDMA 3W2DA 2C5LC 3DBLB 4II3B 2K1FA 4B0MA 1QOAA 3C0RB 2WXOA 4GOCA 1XT9B 2WXRA 3PZ8A 4C4VB 3L10B 5LNK1 1QOBA 3SHQA 3IT6B 3FAHA 4RGMA 2K9XA 3PVLA 2DAJA 5IAAC 2FNJB 2XEWA 2MBOA 1HTOA 4MSQB 5CX3A 3M3JA 1WZ0A 1XF5L 1TBEA 1ZPSA 3E56A 2PJHA 4AOFA 1XLNA 2I1KA 3VTWA 3AE4B 1B9RA 4NJCA 1L6VA 2C9WB 2Y3AA 3H6NA 2ONQA 2A5UA 2JQRB 1E7UA 5FR3A 2FCMA 4KGSA 1GC7A 3A33B 3V60A 4D2KA 2AQ1B 2N9XA 1PGXA 3NJTA 3OG5A 1UGMA 4TMAB 2L32A 4OZBA 1EWYC 4C7YA 1I4RA 2I38A 3DCGA 4OZCA 1ZKHA 2M17A 2D10A 2INDC 1QOGA 3VDZA 1TT5B 3TEZA 3KUZA 3IT4B 4KDLB 5G55A 1OFFA 1BT0A 2LWPA 3A9JB 2WXQA 1I7HA 4IW0A 4ACFA 5DCNA 2D11A 1SJED 1V1PB 3S2AA 2INCC 1L2NA 4M0WA 3U52E 4FHKA 3NVYA 4A8XC 3RNAC 2DZIA 4II2B 2EELA 2ZJDA 1D5XC 2BBCA 2KFKB 2WWZA 2XK5A 3M62B 2J52A 1V5TA 4W9JA 5J2RA 1V6EA 2AEHA 5BMHA 4PS3A 4EOYA 3NOBA 1KOTA 3MHZA 5HFYA 5C1ZA 4H2AA 2IO2B 1XEEA 2K39A 2BKFA 1FFVA 2HDEA 3KYDD 2FAZA 3W5UB 4DHJB 2ZZPB 3AE3B 1ZGUB 2JUOA 1LM8B 1WRDB 1OQRA 2O6VB 2JYTA 2Z8LA 4LNIA 3AM9A 1T0YA 3PSEB 2JRIB 1YN3A 2FIDA 1I4HA 4DXGA 2BYVE 4LTUA 2KTRB 3AE9B 1P1AA 2JZZA 3BINA 2JXTA 3V3XA 2DZJA 1KLUD 2I1JA 4M01A 4WJPA 4NZLB 1YOVB 1C79A 3EFUA 3HUIA 4GLSC 3H7PB 2LUEA 2BPSA 2WXPA 4ARIA 4YTMB 5LXIB 1FM0D 2ZPYA 1JCKB 4P1CC 2L52A 1GPXA 1D6EC 1WX7A 1EO6A 3VQIA 4KGTA 3APCA 2ZPNA 2BF8B 4CYEA 2V3NA 2X8XX 2MBEA 2JSVX 3BZDB 1MI0A 2X38A 4C4VA 2V3SA 2CJNA 1C78A 2N9LA 2SEBD 3TEWA 1L6UA 4XGAB 2J7QB 1YN5A 1CK1A 1WGYA 2LVPA 4YTPB 3HM6X 2CHXA 1P9DU 2RD0A 3NVVA 4IUMB 1ZW7A 1BUIC 1MHHE 1TZOA 2GBJA 2IY0B 3U2SC 3AEEB 4RCOA 4HKQA 2OHFA 3DBHI 1RFAA 3L17A 3QCAA 4DHZE 2INNE 1C4AA 2WX1A 3VH4B 1IPGA 1FIQA 3IHPC 3CSFA 2H88B 1SBBB 4BKGA 4FHJA 4E3CA 3ML8A 2Y5PA 1YN4A 4ANUA 3KUCB 4YSYB 3LYYA 3PTFC 5D6JB 4OHJA 1FEHA 5CHFA 2PE9A 5T8IA 4E71A 2IBIB 1FXTB 2FCNA 3MHSD 3R8BA 2BS4B 3P4RB 3UINB 4MJSA 2RDHA 2UWQA 4G3XB 2L1AA 4WJOA 4LDTB 1D4BA 3P1MA 2K22A 1UH6A 1NEKB 1YJ1A 2D5GA 1SIJA 3QA8A 2G45B 4N58A 2XNAC 2BYFA 3AEFB 1L4ZB 1OGWA 2ON8A 2RSUA 2DBYA 3BIID 3BY4B 1V1PA 2LJIA 3VHTC 1T0SC 3UQAA 3TCAA 3RPFC 2JZ3B 1ISNA 3AE1B 4US9A 4YT0B 2KN4A 3I9V1 3GE3C 2N0SB 3Q2AC 1LXDA 4HDOA 4LLGM 3U7ZA 3RUIB 2KFKA 2LMCA 4HRSA 5EE0A 1HXYD 1D5MC 2PVOD 2PE6B 3KYCD 3ZKJC 1FMAD 2GBRA 1TS3A 4W9LA 1GC6A 2RMMA 2J53A 3U8ZA 1WYGA 2LHEA 4HJGE 2DYBA 2R2OA 2EMTA 3EFCA 3CSTA 2MRPA 3VAWA 1RLFA 2G3QB 2K8HA 1XLPA 2O6VA 3AMZA 4W9DA 4ZRIA 3QX1A 4PK1A 3C19A 1PYWD 4X57B 3TSSA 3VTUA 1Y56A 2KFJA 2VZKB 2KTRA 4NJ7A 2BYEA 2GBNA
chains in the Genus database with same CATH topology
2KJ6A 4HJKA 1E7VA 1IP9A 4K81A 2IO1B 3B08A 1WJNA 3QAQA 4IC7B 4ANWA 4DXAB 4P7IA 2ZEQA 2LRUA 2MBBB 3QARA 5E6NA 4BVUC 3ZO5B 2KVRA 5BO4B 2JXXA 2Z0EB 3H7PA 2MLBA 3A1QA 1WJ6A 4DWFA 2KWCA 3L54A 4DHZB 1VCBA 1WGDA 3TJPA 2MA9B 4KIKB 2L0FA 1WF9A 1SIFA 4M0WB 4EZKA 1KM7A 4HDQA 5JH5C 2G4SA 4ICUA 4NAWB 3DVGX 3ZUNA 1GJZA 2G4DB 2KANA 1WI0A 3V61A 4BBNC 4F1SA 3T8MA 4AWJA 3PHWB 1I42A 2Z59B 1GNUA 1WMHA 4MM3A 2LVOA 1JRUA 2XK5B 1I35A 5JZEB 2KX0A 3QWZB 1P98A 4IWPA 4FADA 5LXHA 2KWUB 2O2VB 3RYTA 4AJYB 2DHZA 1E8WA 1WGRA 2LGDA 3VVWB 2D2QA 2YVCA 3SDLC 3QQ8B 2C7MB 2K6DB 3OJ3A 2JWZA 1WYWB 2KK8A 4K7UA 4FA6A 4KSLC 4ANXA 3OAWA 2REXA 4PYUA 4KZCA 3ZW3A 2JT4B 4W9CA 3VTVA 4MDKE 2OJRA 3QHTA 2HE7A 3EECA 1WE6A 4DDGD 4TQ0A 1V5OA 1YX6B 3OLMD 3ALBA 3A4RA 3ECIA 3NZSA 3DQVA 4BBNF 4EZLA 3DOWA 4HCNB 2CU1A 4K7WA 4NNJB 1V49A 3UIPB 4B95A 4E74A 5KHOA 3IFWB 2KQ7A 2L76A 5AZHA 1MG8A 3R3MA 1EF5A 4F7ZA 3NZUA 1KLVA 3M63B 3MTNB 4GN1A 2DYOA 2KLGA 3A9KA 2ZCCA 2V1YA 3DBLI 4LCDE 4W9KA 2PEAA 5AZFA 3U7DA 3UF8A 5D7GA 4WWPA 2NPTB 2JVCA 4DK5A 2PPHA 3ENEA 4URKA 3PRMB 4I6PA 3ZDMC 2J0KA 2L05A 1E8YA 2MCNB 4IG7B 3N3KB 2C5LC 2EMSA 4II3B 2K1FA 2LGYA 3O65B 4JL9A 3C0RB 4GOCA 2ZVOA 3UIOB 2K8CA 3ZDTA 4FN2A 1XT9B 3H9DA 2R2QA 1WR6E 3L10B 4CHKA 3PREA 4XZ4A 3V6CB 4A3OA 1Q0WB 4JQWC 1H4RA 4J6IA 1SE9A 3SHQA 2KDIA 4BKSA 4IWOA 3T9LA 4JGHB 3PVLA 2DAJA 1OEYA 4WQOB 5IAAC 2KLCA 2L3ZA 2FNJB 3N32A 1F9JA 5KHQA 2XEWA 5JHAA 2KKCA 2MBOA 3L13A 4GDKA 1LFDA 3M95A 3WANA 4MSQB 5D2MB 5IA7A 5D94A 2LI5A 2LASA 4FULA 4WWNA 5CX3A 4HCPB 2Y5BB 3M3JA 1WZ0A 2ASQA 2NBVB 4A3PA 4FBJB 2KMCA 1TBEA 1WGHA 4GU2A 2PJHA 4HWIB 1WGGA 4GXBA 4AOFA 3PPAA 4K1RB 4PS7A 3ZNGC 3PGEA 2I1KA 3VTWA 4FJZA 4MGZE 1PQSA 1Q1OA 1S3SG 1H8CA 4ZYNA 2C9WB 2NBWB 2RGFA 2NVUI 2N1WA 1WM3A 2FIFA 3QK0A 2JF5A 1L7YA 3H6NA 4TQ1A 2ZCBA 2LXAA 2A5UA 2RPQA 1E7UA 2FUHB 1K8RB 3AU5A 2EKEC 2FCMA 1GC7A 3A33B 3V60A 1WJUA 1AARA 4LDTD 4NPNA 3PRPB 2N9XA 4HPLB 1V2YA 5DPWA 4W9EA 1G6JA 1YD8U 4IM2A 3EC8A 3H7SA 3NS8A 3ZRCA 1UGMA 1E8XA 3VUYA 1IYFA 2GBMA 4RM9A 1UBIA 3DCGA 3KH0A 2OOBB 1ZKHA 2M17A 2D10A 3P2BA 3RCZA 4DHJD 2ZVNA 1UD7A 3VDZA 4TV3A 2DZKA 4M8NA 3KUZA 5HKHA 2O6VD 4W9HA 1RAXA 4KDLB 5G55A 4W9FA 2GMIC 4MEMA 4IM0A 4YL8A 1BT0A 4JLCA 3ML9A 2LWPA 2K25A 4OVUA 3HHMA 3QC8B 3A9JB 3PLUA 3WALA 4WWOA 3RD2A 4PS8A 4BKTA 3WAOA 4IW0A 1EUVB 3PV1A 3ZLZA 5DCNA 2IYDB 2D11A 2MX2A 1TTNA 2WDTB 4MGKE 1P0RA 2CS4A 5G2NA 3S2AA 4DBGA 1D3ZA 2KC2A 4DDID 2AL6A 2AL3A 4GMVA 4KIKA 1L2NA 3JSVB 3R7RA 3R7QA 5E6OA 3Q3JA 4NAWA 2MQJA 1E8ZA 2DENB 4FHKA 4KDIC 2FCQA 2KDEB 1S1QB 4MGIE 2W9NA 3ZNHB 2KMAA 2DZIA 2K6QA 4II2B 2ZJDA 2VRRB 2KFKB 2RR9A 1SGHA 2N9PC 2WWZA 2XK5A 5DPSA 1YQBA 3M62B 3OJ4B 2JPHA 2NCNA 2NS5A 1V5TA 2O2VA 2LRWA 2M0XA 3JW0X 4MGYE 4W9JA 5CHWA 5EDSA 5J2RA 1V6EA 2AEHA 1QZEA 2KZRA 4PS3A 3GZNI 4EOYA 3IVFA 3VXWA 3I3TB 3NOBA 1KOTA 2KJRA 5C1ZA 5AZGA 1V9JA 2DZMA 4KV2A 3LJ3A 3LDZE 1J0GA 2MP2B 3NHEB 3A9JA 2IO2B 2K39A 3RT3B 2BKFA 1YIWA 4M8MA 2M1MA 4HVBA 3KYDD 2FAZA 2MBHA 3KVFB 4CO7A 4DHJB 2ZZPB 1WIAA 1ZGUB 2JUOA 2L7RA 1LM8B 2BGFA 1WRDB 2NR2A 3VUXA 2O6VB 3H1UA 1J8CA 3B1LX 3KUDB 4LJOB 3APDA 1T0YA 5J17A 2WX0A 3PSEB 3WAPA 1V80A 2IO0B 2JRIB 2FIDA 2IO3B 4GGQA 1V81A 3UGBB 4GDLB 5AEKB 2KNBA 3TIXA 2QHOA 2BYVE 2LJ5A 4G11A 1M94A 2KTRB 1R4NI 4HK2A 1NBFC 1UBQA 1XD3B 1P1AA 2KN5A 3VUWA 5C23A 2JZZA 2MW5A 1OTRB 3BINA 4FJVB 1WE7A 5CTRC 2ZNVB 4BOZB 2DZJA 1WM2A 2I1JA 4WJPA 4EKUA 1EF1A 4I6LB 3EFUA 1WH3A 4EFOA 3PRZA 1A5RA 3H7PB 2LUEA 2BPSA 2NPTA 3NY5A 3PHXB 4KZ0A 4WJQA 5E6PA 1RRBA 1XQQA 2HTHA 3ZNZB 5LXIB 2N9EB 2CR5A 2ZPYA 3L16A 3Q3FA 4ZRKA 5DPTA 4EUTA 3L0WB 1Z5SB 2KD0A 2GOWA 3HM3A 4GSWA 3V62A 4HLEA 1NDDA 1WX7A 2M4NA 3GOEA 3JYUA 2AYOB 1EO6A 4B6WA 3VQIA 3APCA 2ZPNA 3WAMA 2BF8B 4CYEA 1WMHB 4OVVA 2MBEA 1UZXB 4AJWA 3ZRFA 5J18A 2V3SA 3DBSA 3IBEA 1WR1A 2DAFA 2L00B 1UELA 2LXCA 5LLIA 4HXDA 2J7QB 4ASWC 3WIMA 3MJWA 1R4MI 1WGYA 2LVPA 2MWSB 4NQKE 3RULA 2MBQA 4BFRA 4MSMB 4BKSD 3HM6X 1TZ1A 2NBUA 2CHXA 1P9DU 2RD0A 4MJSB 3PZDA 4G50A 1ZW7A 4IUMB 2ZNVC 3ZTCA 2GBJA 4GIVA 1E5WA 2IY0B 2L8JA 2YLMA 4ICVA 3U30A 3APFA 2K8BA 3DBHI 1RFAA 3W1YA 4ANVA 2GBKA 3HIZA 3L17A 3RZFA 4I6NB 2LZ6A 3IG3A 3QCAA 2DX5B 4DHZE 1Q5WB 4IM3A 3QJZA 3VFKA 2WX1A 3VH4B 1IPGA 2KDBA 4WJNA 4GB9A 3IHPC 3X0WA 3A4SC 1J19A 4RMAA 3CSFA 4BKGA 4MH0E 4FJYA 1V86A 3CF6E 2MSED 4FHJA 1E90A 3EHVA 4XX5A 4E3CA 1TGZB 2CHWA 2HD5B 2LD9A 3ML8A 3UQBA 3ZVVA 2C60A 3PT2B 4ANUA 4EZJA 2KX3A 3KUCB 2J0JA 3A9KB 3PTFC 3AI5A 4KSKC 5D6JB 3K9PB 2FCSA 4A20A 5JHBA 2KDFB 1WXMA 4G0NB 4HPMB 5CHFA 2PE9A 4E71A 2IBIB 2CKHB 5TR5A 2HJ8A 1FXTB 2FCNA 3MHSD 1U4AA 3UINB 3V6EB 4B9KA 4ZRJA 2LGXA 3D32A 4MJSA 3WA0A 1C3TA 3RZWC 1WXVA 2UWQA 1CMXB 4G3XB 2J0MA 1WZ3A 3ONSA 1WFYA 4F8CB 3CMMB 4KVGB 2Z0DB 3W1SA 4WJOA 4TUUA 2KTFA 3W1SC 4LDTB 2CHZA 3AU4A 3AXCA 3L08A 4BOSC 4AUQC 2C7HA 1UH6A 2C7NB 1YJ1A 3DVGY 2AWTA 3KW5B 2UYZB 2XBBC 3QA8A 2D3GA 4NJ6A 2G45B 2A4ZA 5DPRA 3ZNID 1Y8RC 1WJ4A 4XC2A 2BYFA 1LQBA 4GDKB 1OGWA 1C1YB 2RSUA 4EEWA 3PS6A 3DVNV 2N1VA 4FLHA 4N9F4 3BY4B 3R66C 3VHTC 3UQAA 2KXJA 4ZDVA 3TCAA 2D07B 1ISNA 2JZ3B 2N4FA 3JSVA 1WY8A 4WAAA 3K9OB 3TMPB 1LXDA 5CHVC 4TKNA 4HDOA 4RM8A 3TBLD 3RUIB 1GUAB 4NY0A 3VH3B 2KFKA 2IY1B 2JY6A 2BWFA 2L0TA 1GG3A 2PE6B 3DVNU 3KYCD 1WX8A 3ZKJC 3TL5A 4JIOU 2GBRA 5L95C 1NI2A 1WXAA 4K7SA 2KWVB 3DBRI 2IZVB 3N30A 1GC6A 4W9LA 2KC1A 1KJTA 2KO3A 1OEYJ 2DYMA 2M8SA 2B3AA 4PYZA 1VD2A 2KOXA 3JVZX 3A1QB 5FR6A 2JRHA 3U8ZA 3X23A 3DPDA 2MP2A 2WYQA 2KHWB 2DYBA 3ZTDA 2BKRB 2EMTA 2R2OA 3AULA 4MELA 3CSTA 1HE8A 3B0AA 3SU8X 2MRPA 1P3QU 4LJPB 3SD5A 3DDCB 2LVQA 4W9GA 1RLFA 2G3QB 3VAWA 1X1MA 3QIJA 2K8HA 4NQLB 2O6VA 4IWQA 2BWES 4W9IA 2V4LA 3HK0A 1WXSA 2N7DA 4W9DA 1WX9A 4ZRIA 3QX1A 3PLVA 4AP4C 2KJHB 1YX5B 5L83A 4X57B 4GDLA 3VTUA 5GMVA 2KFJA 2N7EA 2KTRA 4NJ7A 1OQYA 2KQSA 2BYEA 1Z2MA 3ZIMA 2GBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJ6 A;  4HJK A;  1E7V A;  1IP9 A;  4K81 A;  2IO1 B;  3B08 A;  1WJN A;  3QAQ A;  4IC7 B;  4ANW A;  4DXA B;  4P7I A;  2ZEQ A;  2LRU A;  2MBB B;  3QAR A;  5E6N A;  4BVU C;  3ZO5 B;  2KVR A;  5BO4 B;  2JXX A;  2Z0E B;  3H7P A;  2MLB A;  3A1Q A;  1WJ6 A;  4DWF A;  2KWC A;  3L54 A;  4DHZ B;  1VCB A;  1WGD A;  3TJP A;  2MA9 B;  4KIK B;  2L0F A;  1WF9 A;  1SIF A;  4M0W B;  4EZK A;  1KM7 A;  4HDQ A;  5JH5 C;  2G4S A;  4ICU A;  4NAW B;  3DVG X;  3ZUN A;  1GJZ A;  2G4D B;  2KAN A;  1WI0 A;  3V61 A;  4BBN C;  4F1S A;  3T8M A;  4AWJ A;  3PHW B;  1I42 A;  2Z59 B;  1GNU A;  1WMH A;  4MM3 A;  2LVO A;  1JRU A;  2XK5 B;  1I35 A;  5JZE B;  2KX0 A;  3QWZ B;  1P98 A;  4IWP A;  4FAD A;  5LXH A;  2KWU B;  2O2V B;  3RYT A;  4AJY B;  2DHZ A;  1E8W A;  1WGR A;  2LGD A;  3VVW B;  2D2Q A;  2YVC A;  3SDL C;  3QQ8 B;  2C7M B;  2K6D B;  3OJ3 A;  2JWZ A;  1WYW B;  2KK8 A;  4K7U A;  4FA6 A;  4KSL C;  4ANX A;  3OAW A;  2REX A;  4PYU A;  4KZC A;  3ZW3 A;  2JT4 B;  4W9C A;  3VTV A;  4MDK E;  2OJR A;  3QHT A;  2HE7 A;  3EEC A;  1WE6 A;  4DDG D;  4TQ0 A;  1V5O A;  1YX6 B;  3OLM D;  3ALB A;  3A4R A;  3ECI A;  3NZS A;  3DQV A;  4BBN F;  4EZL A;  3DOW A;  4HCN B;  2CU1 A;  4K7W A;  4NNJ B;  1V49 A;  3UIP B;  4B95 A;  4E74 A;  5KHO A;  3IFW B;  2KQ7 A;  2L76 A;  5AZH A;  1MG8 A;  3R3M A;  1EF5 A;  4F7Z A;  3NZU A;  1KLV A;  3M63 B;  3MTN B;  4GN1 A;  2DYO A;  2KLG A;  3A9K A;  2ZCC A;  2V1Y A;  3DBL I;  4LCD E;  4W9K A;  2PEA A;  5AZF A;  3U7D A;  3UF8 A;  5D7G A;  4WWP A;  2NPT B;  2JVC A;  4DK5 A;  2PPH A;  3ENE A;  4URK A;  3PRM B;  4I6P A;  3ZDM C;  2J0K A;  2L05 A;  1E8Y A;  2MCN B;  4IG7 B;  3N3K B;  2C5L C;  2EMS A;  4II3 B;  2K1F A;  2LGY A;  3O65 B;  4JL9 A;  3C0R B;  4GOC A;  2ZVO A;  3UIO B;  2K8C A;  3ZDT A;  4FN2 A;  1XT9 B;  3H9D A;  2R2Q A;  1WR6 E;  3L10 B;  4CHK A;  3PRE A;  4XZ4 A;  3V6C B;  4A3O A;  1Q0W B;  4JQW C;  1H4R A;  4J6I A;  1SE9 A;  3SHQ A;  2KDI A;  4BKS A;  4IWO A;  3T9L A;  4JGH B;  3PVL A;  2DAJ A;  1OEY A;  4WQO B;  5IAA C;  2KLC A;  2L3Z A;  2FNJ B;  3N32 A;  1F9J A;  5KHQ A;  2XEW A;  5JHA A;  2KKC A;  2MBO A;  3L13 A;  4GDK A;  1LFD A;  3M95 A;  3WAN A;  4MSQ B;  5D2M B;  5IA7 A;  5D94 A;  2LI5 A;  2LAS A;  4FUL A;  4WWN A;  5CX3 A;  4HCP B;  2Y5B B;  3M3J A;  1WZ0 A;  2ASQ A;  2NBV B;  4A3P A;  4FBJ B;  2KMC A;  1TBE A;  1WGH A;  4GU2 A;  2PJH A;  4HWI B;  1WGG A;  4GXB A;  4AOF A;  3PPA A;  4K1R B;  4PS7 A;  3ZNG C;  3PGE A;  2I1K A;  3VTW A;  4FJZ A;  4MGZ E;  1PQS A;  1Q1O A;  1S3S G;  1H8C A;  4ZYN A;  2C9W B;  2NBW B;  2RGF A;  2NVU I;  2N1W A;  1WM3 A;  2FIF A;  3QK0 A;  2JF5 A;  1L7Y A;  3H6N A;  4TQ1 A;  2ZCB A;  2LXA A;  2A5U A;  2RPQ A;  1E7U A;  2FUH B;  1K8R B;  3AU5 A;  2EKE C;  2FCM A;  1GC7 A;  3A33 B;  3V60 A;  1WJU A;  1AAR A;  4LDT D;  4NPN A;  3PRP B;  2N9X A;  4HPL B;  1V2Y A;  5DPW A;  4W9E A;  1G6J A;  1YD8 U;  4IM2 A;  3EC8 A;  3H7S A;  3NS8 A;  3ZRC A;  1UGM A;  1E8X A;  3VUY A;  1IYF A;  2GBM A;  4RM9 A;  1UBI A;  3DCG A;  3KH0 A;  2OOB B;  1ZKH A;  2M17 A;  2D10 A;  3P2B A;  3RCZ A;  4DHJ D;  2ZVN A;  1UD7 A;  3VDZ A;  4TV3 A;  2DZK A;  4M8N A;  3KUZ A;  5HKH A;  2O6V D;  4W9H A;  1RAX A;  4KDL B;  5G55 A;  4W9F A;  2GMI C;  4MEM A;  4IM0 A;  4YL8 A;  1BT0 A;  4JLC A;  3ML9 A;  2LWP A;  2K25 A;  4OVU A;  3HHM A;  3QC8 B;  3A9J B;  3PLU A;  3WAL A;  4WWO A;  3RD2 A;  4PS8 A;  4BKT A;  3WAO A;  4IW0 A;  1EUV B;  3PV1 A;  3ZLZ A;  5DCN A;  2IYD B;  2D11 A;  2MX2 A;  1TTN A;  2WDT B;  4MGK E;  1P0R A;  2CS4 A;  5G2N A;  3S2A A;  4DBG A;  1D3Z A;  2KC2 A;  4DDI D;  2AL6 A;  2AL3 A;  4GMV A;  4KIK A;  1L2N A;  3JSV B;  3R7R A;  3R7Q A;  5E6O A;  3Q3J A;  4NAW A;  2MQJ A;  1E8Z A;  2DEN B;  4FHK A;  4KDI C;  2FCQ A;  2KDE B;  1S1Q B;  4MGI E;  2W9N A;  3ZNH B;  2KMA A;  2DZI A;  2K6Q A;  4II2 B;  2ZJD A;  2VRR B;  2KFK B;  2RR9 A;  1SGH A;  2N9P C;  2WWZ A;  2XK5 A;  5DPS A;  1YQB A;  3M62 B;  3OJ4 B;  2JPH A;  2NCN A;  2NS5 A;  1V5T A;  2O2V A;  2LRW A;  2M0X A;  3JW0 X;  4MGY E;  4W9J A;  5CHW A;  5EDS A;  5J2R A;  1V6E A;  2AEH A;  1QZE A;  2KZR A;  4PS3 A;  3GZN I;  4EOY A;  3IVF A;  3VXW A;  3I3T B;  3NOB A;  1KOT A;  2KJR A;  5C1Z A;  5AZG A;  1V9J A;  2DZM A;  4KV2 A;  3LJ3 A;  3LDZ E;  1J0G A;  2MP2 B;  3NHE B;  3A9J A;  2IO2 B;  2K39 A;  3RT3 B;  2BKF A;  1YIW A;  4M8M A;  2M1M A;  4HVB A;  3KYD D;  2FAZ A;  2MBH A;  3KVF B;  4CO7 A;  4DHJ B;  2ZZP B;  1WIA A;  1ZGU B;  2JUO A;  2L7R A;  1LM8 B;  2BGF A;  1WRD B;  2NR2 A;  3VUX A;  2O6V B;  3H1U A;  1J8C A;  3B1L X;  3KUD B;  4LJO B;  3APD A;  1T0Y A;  5J17 A;  2WX0 A;  3PSE B;  3WAP A;  1V80 A;  2IO0 B;  2JRI B;  2FID A;  2IO3 B;  4GGQ A;  1V81 A;  3UGB B;  4GDL B;  5AEK B;  2KNB A;  3TIX A;  2QHO A;  2BYV E;  2LJ5 A;  4G11 A;  1M94 A;  2KTR B;  1R4N I;  4HK2 A;  1NBF C;  1UBQ A;  1XD3 B;  1P1A A;  2KN5 A;  3VUW A;  5C23 A;  2JZZ A;  2MW5 A;  1OTR B;  3BIN A;  4FJV B;  1WE7 A;  5CTR C;  2ZNV B;  4BOZ B;  2DZJ A;  1WM2 A;  2I1J A;  4WJP A;  4EKU A;  1EF1 A;  4I6L B;  3EFU A;  1WH3 A;  4EFO A;  3PRZ A;  1A5R A;  3H7P B;  2LUE A;  2BPS A;  2NPT A;  3NY5 A;  3PHX B;  4KZ0 A;  4WJQ A;  5E6P A;  1RRB A;  1XQQ A;  2HTH A;  3ZNZ B;  5LXI B;  2N9E B;  2CR5 A;  2ZPY A;  3L16 A;  3Q3F A;  4ZRK A;  5DPT A;  4EUT A;  3L0W B;  1Z5S B;  2KD0 A;  2GOW A;  3HM3 A;  4GSW A;  3V62 A;  4HLE A;  1NDD A;  1WX7 A;  2M4N A;  3GOE A;  3JYU A;  2AYO B;  1EO6 A;  4B6W A;  3VQI A;  3APC A;  2ZPN A;  3WAM A;  2BF8 B;  4CYE A;  1WMH B;  4OVV A;  2MBE A;  1UZX B;  4AJW A;  3ZRF A;  5J18 A;  2V3S A;  3DBS A;  3IBE A;  1WR1 A;  2DAF A;  2L00 B;  1UEL A;  2LXC A;  5LLI A;  4HXD A;  2J7Q B;  4ASW C;  3WIM A;  3MJW A;  1R4M I;  1WGY A;  2LVP A;  2MWS B;  4NQK E;  3RUL A;  2MBQ A;  4BFR A;  4MSM B;  4BKS D;  3HM6 X;  1TZ1 A;  2NBU A;  2CHX A;  1P9D U;  2RD0 A;  4MJS B;  3PZD A;  4G50 A;  1ZW7 A;  4IUM B;  2ZNV C;  3ZTC A;  2GBJ A;  4GIV A;  1E5W A;  2IY0 B;  2L8J A;  2YLM A;  4ICV A;  3U30 A;  3APF A;  2K8B A;  3DBH I;  1RFA A;  3W1Y A;  4ANV A;  2GBK A;  3HIZ A;  3L17 A;  3RZF A;  4I6N B;  2LZ6 A;  3IG3 A;  3QCA A;  2DX5 B;  4DHZ E;  1Q5W B;  4IM3 A;  3QJZ A;  3VFK A;  2WX1 A;  3VH4 B;  1IPG A;  2KDB A;  4WJN A;  4GB9 A;  3IHP C;  3X0W A;  3A4S C;  1J19 A;  4RMA A;  3CSF A;  4BKG A;  4MH0 E;  4FJY A;  1V86 A;  3CF6 E;  2MSE D;  4FHJ A;  1E90 A;  3EHV A;  4XX5 A;  4E3C A;  1TGZ B;  2CHW A;  2HD5 B;  2LD9 A;  3ML8 A;  3UQB A;  3ZVV A;  2C60 A;  3PT2 B;  4ANU A;  4EZJ A;  2KX3 A;  3KUC B;  2J0J A;  3A9K B;  3PTF C;  3AI5 A;  4KSK C;  5D6J B;  3K9P B;  2FCS A;  4A20 A;  5JHB A;  2KDF B;  1WXM A;  4G0N B;  4HPM B;  5CHF A;  2PE9 A;  4E71 A;  2IBI B;  2CKH B;  5TR5 A;  2HJ8 A;  1FXT B;  2FCN A;  3MHS D;  1U4A A;  3UIN B;  3V6E B;  4B9K A;  4ZRJ A;  2LGX A;  3D32 A;  4MJS A;  3WA0 A;  1C3T A;  3RZW C;  1WXV A;  2UWQ A;  1CMX B;  4G3X B;  2J0M A;  1WZ3 A;  3ONS A;  1WFY A;  4F8C B;  3CMM B;  4KVG B;  2Z0D B;  3W1S A;  4WJO A;  4TUU A;  2KTF A;  3W1S C;  4LDT B;  2CHZ A;  3AU4 A;  3AXC A;  3L08 A;  4BOS C;  4AUQ C;  2C7H A;  1UH6 A;  2C7N B;  1YJ1 A;  3DVG Y;  2AWT A;  3KW5 B;  2UYZ B;  2XBB C;  3QA8 A;  2D3G A;  4NJ6 A;  2G45 B;  2A4Z A;  5DPR A;  3ZNI D;  1Y8R C;  1WJ4 A;  4XC2 A;  2BYF A;  1LQB A;  4GDK B;  1OGW A;  1C1Y B;  2RSU A;  4EEW A;  3PS6 A;  3DVN V;  2N1V A;  4FLH A;  4N9F 4;  3BY4 B;  3R66 C;  3VHT C;  3UQA A;  2KXJ A;  4ZDV A;  3TCA A;  2D07 B;  1ISN A;  2JZ3 B;  2N4F A;  3JSV A;  1WY8 A;  4WAA A;  3K9O B;  3TMP B;  1LXD A;  5CHV C;  4TKN A;  4HDO A;  4RM8 A;  3TBL D;  3RUI B;  1GUA B;  4NY0 A;  3VH3 B;  2KFK A;  2IY1 B;  2JY6 A;  2BWF A;  2L0T A;  1GG3 A;  2PE6 B;  3DVN U;  3KYC D;  1WX8 A;  3ZKJ C;  3TL5 A;  4JIO U;  2GBR A;  5L95 C;  1NI2 A;  1WXA A;  4K7S A;  2KWV B;  3DBR I;  2IZV B;  3N30 A;  1GC6 A;  4W9L A;  2KC1 A;  1KJT A;  2KO3 A;  1OEY J;  2DYM A;  2M8S A;  2B3A A;  4PYZ A;  1VD2 A;  2KOX A;  3JVZ X;  3A1Q B;  5FR6 A;  2JRH A;  3U8Z A;  3X23 A;  3DPD A;  2MP2 A;  2WYQ A;  2KHW B;  2DYB A;  3ZTD A;  2BKR B;  2EMT A;  2R2O A;  3AUL A;  4MEL A;  3CST A;  1HE8 A;  3B0A A;  3SU8 X;  2MRP A;  1P3Q U;  4LJP B;  3SD5 A;  3DDC B;  2LVQ A;  4W9G A;  1RLF A;  2G3Q B;  3VAW A;  1X1M A;  3QIJ A;  2K8H A;  4NQL B;  2O6V A;  4IWQ A;  2BWE S;  4W9I A;  2V4L A;  3HK0 A;  1WXS A;  2N7D A;  4W9D A;  1WX9 A;  4ZRI A;  3QX1 A;  3PLV A;  4AP4 C;  2KJH B;  1YX5 B;  5L83 A;  4X57 B;  4GDL A;  3VTU A;  5GMV A;  2KFJ A;  2N7E A;  2KTR A;  4NJ7 A;  1OQY A;  2KQS A;  2BYE A;  1Z2M A;  3ZIM A;  2GBN A; 
#chains in the Genus database with same CATH topology
 1E7V A;  2V3P A;  1WJN A;  3QAQ A;  4IC7 B;  4XYC A;  2ACZ B;  3H7P A;  3DWM A;  4DWF A;  1WGD A;  3TJP A;  3GS2 A;  2L0F A;  4NAW B;  1GJZ A;  4IKG A;  3BK1 A;  2G4D B;  4F1S A;  3T8M A;  1IGD A;  3PHW B;  2Z59 B;  1I42 A;  2LVO A;  1MVK A;  1I35 A;  1DYQ A;  4IWP A;  1WGR A;  2LGD A;  3VVW B;  2YVC A;  3SDL C;  2PMV A;  3VR8 B;  3OJ3 A;  4M02 A;  4KSL C;  2W3S A;  3RNE C;  4ANX A;  4AQ7 A;  2WDQ B;  1I4Q A;  2OJR A;  2WNM A;  1D5Z C;  4B0E A;  3QHT A;  3EEC A;  4RF0 A;  3BYT B;  3N20 C;  1FCL A;  3OLM D;  2IGH A;  3ECI A;  3NZS A;  3DQV A;  1STE A;  2CU1 A;  4B95 A;  5KHO A;  3IFW B;  2KQ7 A;  3RNB C;  5AZH A;  1SF0 A;  1KLV A;  3M63 B;  5D7G A;  2VH2 A;  4URK A;  1SXT A;  1SJH D;  4I6P A;  2J0K A;  1E8Y A;  2MCN B;  3N3K B;  3O65 B;  4C7Z A;  4JL9 A;  2ZVO A;  2K8C A;  3H9D A;  2R2Q A;  1WR6 E;  3PRE A;  4A3O A;  3P4S B;  2KDI A;  2BTE A;  4JGH B;  2WU5 B;  2KLC A;  2L3Z A;  5KHQ A;  1FNU A;  1EM7 A;  2KKC A;  1LFD A;  4WWN A;  2Y5B B;  4A3P A;  2NBV B;  4K1R B;  2WS3 B;  3PGE A;  3IXS A;  2GI9 A;  1N63 A;  2NBW B;  2RGF A;  2NVU I;  3W5V B;  2FIF A;  2JF5 A;  4TQ1 A;  1YJJ A;  2WU2 B;  1BML C;  3AU5 A;  3ZXR A;  3SFE B;  1ROE A;  3EGR A;  1WJU A;  2I2Y A;  4NPN A;  1V2Y A;  1RM6 C;  3Q8E A;  3E9S A;  3EC8 A;  3H7S A;  3NS8 A;  3ZRC A;  3N1X C;  5IKC M;  5IO9 A;  1SE3 A;  3P4Q B;  3KH0 A;  3B2F A;  3P2B A;  3RCZ A;  2ZVN A;  1B1Z A;  2WXH A;  2GMI C;  4YL8 A;  4JLC A;  1TS5 A;  3ML9 A;  3C8Y A;  5HHD G;  3AE6 B;  1EU3 A;  3N9Y C;  4WWO A;  3VRA B;  3RD2 A;  3Q8B A;  1ZP0 B;  2QMT A;  1L5P A;  3PV1 A;  4L1B A;  4MGK E;  3N1Y C;  1P0R A;  5D3I B;  2CS4 A;  2PIA A;  1D3Z A;  2KC2 A;  4DDI D;  3SEB A;  3R7Q A;  5E6O A;  3Q3J A;  4NAW A;  1E8Z A;  2DEN B;  1K53 A;  2FCQ A;  2KDE B;  1S1Q B;  4MGI E;  3ZNH B;  1SGH A;  2N9P C;  5DPS A;  1YQB A;  1QLB B;  1IBX B;  3OJ4 B;  1M4V A;  2N9K A;  1FPY A;  5EDS A;  4MGY E;  4XDC A;  1YMH E;  4K3B A;  3IVF A;  5AZG A;  4KV2 A;  1WWT A;  3ZJT A;  3NHE B;  2QDF A;  4M8M A;  2MBH A;  4CO7 A;  2L7R A;  3V05 A;  1CZP A;  2BGF A;  2NR2 A;  3VUX A;  3H1U A;  3KUD B;  5J17 A;  2WX0 A;  1V80 A;  5AEK B;  4GGQ A;  1V81 A;  2KNB A;  3TIX A;  1M94 A;  4HK2 A;  1XD3 B;  3VUW A;  2IDY A;  5C23 A;  5G5H A;  1WE7 A;  1ENF A;  2M19 A;  1FNW A;  2ZNV B;  4BOZ B;  2E3T A;  1WM2 A;  1BXT A;  4I6L B;  4EFO A;  1A5R A;  2KVZ A;  4KZ0 A;  4WJQ A;  1RRB A;  1XQQ A;  2N7J A;  2JZP A;  4ZRK A;  4GSW A;  5IOI A;  4B6W A;  3WAM A;  3Q6B A;  4MM3 B;  3KQ4 A;  3SR6 A;  4US8 A;  2WXN A;  4A90 A;  1QKZ A;  3ZRF A;  1JWB D;  2DAF A;  1UEL A;  1MHX A;  2LXC A;  1J7B A;  3MJW A;  1GB4 A;  1J7C A;  3U4E G;  4MSM B;  4BKS D;  1TZ1 A;  4MJS B;  1T5X D;  3PZD A;  5BYR A;  3T3O A;  4ICV A;  1DOY A;  2K8B A;  2CJO A;  1XCT L;  4ANV A;  2BS2 B;  2WGS A;  3HIZ A;  5H92 C;  2WDR B;  1ZXI A;  1N5X A;  3X0W A;  1J19 A;  4RMA A;  2IGG A;  4MH0 E;  4FJY A;  1UWM A;  1V86 A;  1SB3 C;  2HD5 B;  2WXJ A;  2KX3 A;  2J0J A;  3A9K B;  3FC4 A;  3AI5 A;  2LEK A;  4JPS A;  2FCS A;  5JHB A;  4XWT A;  2KDF B;  4YSX B;  2KT7 A;  1C9F A;  5BYQ A;  1U4A A;  4B9K A;  1WXV A;  2J0M A;  1NEN B;  4A55 A;  4KVG B;  2V0G A;  2Z0D B;  3W1S A;  2QSD A;  3AXC A;  3L08 A;  2UU7 A;  4BOS C;  3HRD D;  2MJD A;  4AUQ C;  5FKA C;  3DVG Y;  3KW5 B;  4OW0 A;  2XBB C;  4NJ6 A;  3ZNI D;  1HEZ E;  1AWD A;  1Y8R C;  3ZXV A;  1UWX A;  1I4P A;  1JAL A;  1C1Y B;  1PDX A;  3PS6 A;  1SE2 A;  3ZJV A;  3R66 C;  3BVG A;  1A70 A;  2D07 B;  2WHI A;  5HG2 A;  3K9O B;  4RM8 A;  3TBL D;  1AN8 A;  1SE4 A;  4P6V F;  4LK0 M;  2IY1 B;  2L0T A;  1GG3 A;  1WX8 A;  1IBX A;  4JIO U;  1NI2 A;  4K7S A;  2KC1 A;  2M8S A;  4MT5 A;  2KOX A;  1C77 A;  1N61 A;  2KHW B;  3AUL A;  3VRB B;  2QJL A;  4J3O D;  2V4L A;  3HK0 A;  1WX9 A;  3O13 A;  4LNF A;  1IGC A;  3SFD B;  2N7E A;  3NVW A;  2H89 B;  2WXF A;  2KQS A;  3TUO A;  4ANW A;  1TYG B;  2ZEQ A;  1XXG A;  1F77 A;  2VH1 A;  2MLB A;  3N1Z C;  3A1Q A;  1QQR A;  1WJ6 A;  2D3B A;  3L54 A;  4DHZ B;  3RNG C;  2QIL A;  1GB1 A;  3V61 A;  1WI0 A;  4BBN C;  3BVM A;  4WAF A;  4AWJ A;  4MM3 A;  2PVG C;  1JRU A;  1P7E A;  2G9H D;  4FAD A;  2KWU B;  2O2V B;  3PO0 A;  1E8W A;  1UF0 A;  2G1E A;  4C56 C;  1VR9 A;  3DHI C;  1WGK A;  3QQ8 B;  2C7M B;  3ABV B;  2REX A;  1F1H A;  4KZC A;  4W9C A;  2KQ4 X;  3RNF C;  3A4R A;  1ZDV A;  2RDB C;  3DOW A;  4LNO A;  4RFB A;  1E0Z A;  1V49 A;  2NMQ A;  5FK9 C;  3Q8F A;  1K52 A;  1EF5 A;  2K3U A;  2RPV A;  4REZ A;  2EKI A;  3R2I A;  2DYO A;  1TJE A;  1FXA A;  2KLG A;  2V1Y A;  3A9K A;  4FXC A;  4LCD E;  5AZF A;  4A6Q A;  4WWP A;  2NPT B;  4DK5 A;  2QC8 A;  2PPH A;  3PRM B;  4AS1 A;  1VZ6 A;  1ET6 A;  3TEX A;  2LGY A;  2E6X A;  2WXG A;  2OJW A;  2M0A A;  2NTT A;  3UIO B;  2LGI A;  3ZDT A;  2LUM A;  4CHK A;  3AEB B;  2INP E;  4RNA A;  1HZ6 A;  1Q0W B;  1VZ7 A;  1H4R A;  4J6I A;  5AUI A;  1SE9 A;  3T3N A;  3KLS X;  5GXG B;  3RNC C;  3L13 A;  3FKY A;  1VLB A;  3WAN A;  4L23 A;  5D94 A;  2LI5 A;  5IP4 D;  4HCP B;  4EE2 A;  2ASQ A;  2K5P A;  1WGH A;  2GB1 A;  1CJE A;  4HWI B;  1TIF A;  4GXB A;  4WQM A;  3ZNG C;  4FJZ A;  1S3S G;  1H8C A;  2KAC A;  4ZYN A;  2YEP F;  2N1W A;  2Q5W D;  1WM3 A;  1L7Y A;  4ZHP A;  2RPQ A;  1E6E B;  2FUH B;  4ZRP A;  1K8R B;  1XLO A;  4LDT D;  5HI1 A;  4HPL B;  5DPW A;  2J42 A;  2TSS A;  1YD8 U;  1ET9 A;  3VUY A;  1FRR A;  2GBM A;  2JYE A;  1QOF A;  1FXI A;  3VR9 B;  1DGJ A;  4TV3 A;  4M8N A;  5HKH A;  3Q14 C;  4W9H A;  3EA6 A;  4W9F A;  2V4I B;  4IM0 A;  2K25 A;  4OVU A;  1WXQ A;  3QC8 B;  5EE3 A;  2DNF A;  3PLU A;  4KKJ A;  4BKT A;  3WAO A;  3AH7 A;  3LB8 C;  3ZLZ A;  2IPK D;  2IYD B;  2MX2 A;  1L0V B;  1T0R C;  5G2N A;  4DBG A;  2AL6 A;  3URY A;  4BZA A;  4GMV A;  3R7R A;  2WP9 B;  2MQJ A;  1CQV A;  3DHH C;  4ITK A;  4TSS A;  3NUH B;  2KMA A;  2RR9 A;  3MC9 A;  2LHD A;  2NCN A;  2O2V A;  3JW0 X;  2M0X A;  2KZR A;  3W9C B;  3GZN I;  5H8Y E;  1J0G A;  3LDZ E;  2MP2 B;  2VZK D;  4R3D A;  2WXL A;  1YIW A;  2M1M A;  4HVB A;  3KVF B;  3GZN B;  1PFD A;  1F0Z A;  4HRO A;  1J8C A;  4LJO B;  1V97 A;  2IO3 B;  3UGB B;  1R7S A;  4GDL B;  2QHO A;  2LJ5 A;  4G11 A;  1R4N I;  1NBF C;  1UBQ A;  2KN5 A;  4FJV B;  3P42 A;  4DXF A;  2FBW B;  3J9C A;  4KGR A;  1EF1 A;  1WH3 A;  3NY5 A;  1R4N B;  2NPT A;  5E6P A;  1YQ3 B;  3R2T A;  3Q3F A;  5DPT A;  3L0W B;  1Z5S B;  2GOW A;  4HLE A;  2B76 B;  2M4N A;  3AB5 A;  2MEK A;  2WXK A;  3AEC B;  2J4X A;  4OVV A;  1YQ4 B;  1UZX B;  4AJW A;  5J18 A;  3DBS A;  3MP9 A;  3GB1 A;  1WR1 A;  2L00 B;  3Q3N C;  3WIM A;  4ASW C;  1NI3 A;  2MWS B;  4NQK E;  3ETR A;  3RUL A;  4BFR A;  1YNT E;  1N6Z A;  1RFK A;  2NBU A;  4G50 A;  4QAY A;  2ZNV C;  5C2T B;  1E5W A;  1MJD A;  2YLM A;  4HPP A;  3APF A;  3CIR B;  1VRA B;  3DHG C;  2AX5 A;  3ZJU A;  2LZ6 A;  2ZW0 A;  3MJ5 A;  4IM3 A;  3QJZ A;  5C3J B;  2KDB A;  3HVD A;  1ZXH A;  2JX5 A;  4WJN A;  3A4S C;  3Q69 A;  2D3C A;  2MSE D;  3EHV A;  4XX5 A;  1TGZ B;  2CHW A;  2C60 A;  4EZJ A;  1T0Q C;  3BK2 A;  5EE1 A;  3K9P B;  4G0N B;  1QT9 A;  4JWS C;  1RWS A;  5TR5 A;  4S17 A;  3V6E B;  2LGX A;  3AE7 B;  3D32 A;  1HTQ A;  1C3T A;  3RZW C;  3OWE B;  3ONS A;  1WFY A;  4F8C B;  2HJ1 A;  2YEP B;  3NVZ A;  2CHZ A;  3AU4 A;  1JWA D;  1ESF A;  2MJ3 A;  2C7N B;  1KFY B;  2AWT A;  2UYZ B;  2Y5C A;  5DPR A;  1E9M A;  1ZDX A;  4GDK B;  4L2Y A;  3DVN V;  3RI7 C;  4FLH A;  4ZDV A;  3L4P A;  4WAA A;  5JXV A;  3TMP B;  4ZYS A;  5CHV C;  4TKN A;  1GUA B;  3VH3 B;  3RMK C;  3DVN U;  3TL5 A;  1AYF A;  5L95 C;  1WXA A;  2W55 A;  2KWV B;  3DBR I;  2IZV B;  2BS3 B;  3GP7 A;  4YWG G;  1KJT A;  4HEA 1;  2DYM A;  4WH4 A;  3AEA B;  3A1Q B;  5FR6 A;  1I4X A;  1N60 A;  3X23 A;  3DPD A;  2MP2 A;  4JWU C;  3ZTD A;  4MEL A;  1HE8 A;  3DBR B;  3SU8 X;  3SD5 A;  4LJP B;  2LVQ A;  1X1M A;  2FE8 A;  4K3C A;  2AQ3 B;  4IWQ A;  2CU3 A;  2N7D A;  1F2R I;  2KYW A;  3PLV A;  2KJH B;  1YX5 B;  4GDL A;  3EUB 2;  2R61 A;  4RGN A;  4BAX A;  1LGR A;  1OQY A;  3Q3O C;  3ZIM A;  2IO1 B;  3B08 A;  3ZGZ A;  4DXA B;  2MBB B;  3QAR A;  5E6N A;  1FFU A;  3ZO5 B;  2JXX A;  2KWC A;  5IN7 A;  1VCB A;  5BMI A;  2MA9 B;  4KIK B;  1LO5 D;  1ZUD 2;  1E10 A;  1KM7 A;  2BW2 A;  4HDQ A;  2G4S A;  4MAC A;  4XWW A;  2KAN A;  1TY0 A;  3KWV A;  4WUR A;  1GNU A;  2DHZ A;  3I5J C;  2D2Q A;  1YJI A;  2JWZ A;  4K7U A;  4FA6 A;  1XCQ L;  3ZW3 A;  2JT4 B;  3AE8 B;  4DDG D;  1YX6 B;  2ZW1 A;  1HA5 A;  4BBN F;  2BQQ A;  4HCN B;  1VJK A;  2BYT A;  4K7W A;  1UGJ A;  3HVZ A;  3UIP B;  4P1B C;  1IUE A;  1MG8 A;  4RF1 A;  4KKI A;  3NZU A;  4OVZ A;  4ZOH C;  3MTN B;  4W9K A;  2PEA A;  1C4P A;  4N59 A;  1ZOY B;  2JVC A;  3B9J A;  3ENE A;  1C4C A;  2L05 A;  3GE8 C;  1J7A A;  3AE2 B;  4IG7 B;  1JWS D;  2GRI A;  2EMS A;  4YSZ B;  1EU4 A;  1JW9 D;  1E7P B;  4P16 A;  4XE0 A;  2DLB A;  4FN2 A;  3B2G A;  4YTN B;  4XZ4 A;  2XN9 C;  4RGT A;  3V6C B;  4JQW C;  4BKS A;  1PUT A;  4IWO A;  5G5G A;  3T9L A;  1NYQ A;  1OEY A;  4O1N A;  1PGA A;  1SSN A;  4WQO B;  3MFG A;  3TEY A;  1VDV A;  3N32 A;  1F9J A;  5JHA A;  4GDK A;  3M95 A;  1I4G A;  5D2M B;  5IA7 A;  2LAS A;  4FUL A;  4FBJ B;  1DOX A;  2KMC A;  2HTM E;  2M56 B;  4GU2 A;  2ICI A;  2K0P A;  4USA A;  3KWL A;  1WGG A;  1TS4 A;  3PPA A;  4PS7 A;  4MGZ E;  1PQS A;  1TKE A;  1Q1O A;  1MFW A;  4LNN A;  3QK0 A;  1JML A;  2ZCB A;  2LXA A;  4Q2J A;  1V8C A;  4MH8 A;  2EKE C;  3IAS 1;  1AAR A;  2WXI A;  3PRP B;  2LFI A;  3I57 A;  4W9E A;  2PTL A;  4LNK A;  1G6J A;  4IM2 A;  2V9H A;  1E8X A;  1IYF A;  4RM9 A;  1UBI A;  3WCQ A;  2OOB B;  4ARC A;  1V1O A;  1GAQ B;  4DHJ D;  2D3A A;  1FO4 A;  1UD7 A;  3ZQ4 A;  3NRZ A;  2DZK A;  2O6V D;  1RAX A;  4MEM A;  1TKG A;  1L0Y B;  3HHM A;  1C76 A;  3WAL A;  2BB6 A;  4PS8 A;  3DBH B;  1QIL A;  3UI3 A;  2KAJ A;  1EUV B;  2WDV B;  1TTN A;  2WDT B;  3LXF A;  4PT5 A;  1KH0 A;  3P4P B;  2AL3 A;  4KIK A;  3JSV B;  4KDI C;  5I4D A;  2W9N A;  2K6Q A;  1Q10 A;  4WIP A;  1EWC A;  2VRR B;  1L4D B;  1ZE3 D;  2W54 A;  3RN9 C;  2JPH A;  2NS5 A;  2LRW A;  1MPE A;  5CHW A;  1QZE A;  3VXW A;  3I3T B;  2KJR A;  4JX1 C;  1V9J A;  2DZM A;  3LJ3 A;  1K50 A;  3A9J A;  3RT3 B;  3AEG B;  1WIA A;  5E6J A;  3B1L X;  1F52 A;  2BVC A;  3CWI A;  1N5W A;  3APD A;  5BMG A;  3WAP A;  2IO0 B;  5AUK A;  2MW5 A;  1OTR B;  3NZ3 A;  5CTR C;  4EKU A;  1FD6 A;  3PRZ A;  1FNV A;  2W82 A;  3PHX B;  3ZNZ B;  2HTH A;  2BB5 A;  4JE3 B;  2N9E B;  2CR5 A;  3L16 A;  4EUT A;  1T6B X;  2KD0 A;  2L83 A;  3HM3 A;  3V62 A;  1NDD A;  1P7F A;  5TSS A;  3GOE A;  3JYU A;  2AYO B;  4S0R A;  1JRO A;  2BT6 A;  2QCZ A;  1WMH B;  2W3R A;  1MG4 A;  2MHJ A;  3IBE A;  5LLI A;  4ZHO A;  4HXD A;  2JU6 X;  1L0X B;  1R4M I;  2WLB A;  2MBQ A;  3P63 A;  2PKO A;  3MC0 B;  4DQO C;  4ZRQ A;  3ZTC A;  3BWU D;  4GIV A;  2L8J A;  3U30 A;  1R4M B;  3W1Y A;  3DWG C;  2GBK A;  3FIL B;  3RZF A;  4I6N B;  3IG3 A;  1JWM D;  1XO3 A;  2DX5 B;  1KTK A;  1Q5W B;  4RGO S;  3Q8C A;  3VFK A;  4GB9 A;  5EE9 A;  5D3D A;  3CF6 E;  1E90 A;  4KX6 B;  4HKZ E;  3IAM 1;  2LD9 A;  3UQB A;  2QEJ C;  3ZVV A;  3PT2 B;  1K51 A;  4KSK C;  3AED B;  4A20 A;  1VZ8 A;  1WXM A;  4HPM B;  2CKH B;  4RH6 A;  2HJ8 A;  1OQQ A;  3PZ7 A;  2RDG A;  4ZRJ A;  1JRP A;  3WA0 A;  1CMX B;  1WZ3 A;  3ZYY X;  3CMM B;  4CQN A;  4TUU A;  2KTF A;  3W1S C;  2DWQ A;  1HQR D;  4IDI A;  2C7H A;  4XDD A;  3RFZ B;  2D3G A;  2A4Z A;  1AW7 A;  1UNS A;  1WJ4 A;  2PW9 A;  4XC2 A;  3BYY B;  1LQB A;  1JQ4 A;  4EEW A;  2KMM A;  2N1V A;  3I63 C;  4N9F 4;  2KXJ A;  3Q3M C;  4N6E B;  3NG0 A;  3JSV A;  2N4F A;  2MJE A;  1WY8 A;  4NY0 A;  1KRH A;  1T3Q A;  2JY6 A;  2BWF A;  1ACC A;  3N30 A;  2KO3 A;  1OEY J;  4M00 A;  2B3A A;  4PYZ A;  1VD2 A;  1WSP A;  3JVZ X;  2JRH A;  4C80 A;  2QIE B;  2WYQ A;  5MPO A;  1TS2 A;  2BKR B;  3B0A A;  1TY2 A;  1P3Q U;  3DDC B;  4NAM A;  4W9G A;  3QIJ A;  4NQL B;  1TKY A;  4W9I A;  2BWE S;  3Q8A A;  1FRD A;  1WXS A;  1SEB D;  1KLG D;  4AP4 C;  2IGD A;  5L83 A;  1UUP A;  5GMV A;  2GLS A;  2OED A;  3NS1 A;  2KWD A;  1Z2M A;  2PLP A;  4UDU C;  1QF6 A;  2KJ6 A;  4HJK A;  1IP9 A;  4K81 A;  2SAK A;  4P7I A;  2LRU A;  4BVU C;  2KVR A;  3AN1 A;  5BO4 B;  2Z0E B;  1GOZ A;  1KF6 B;  3BVZ A;  3H8H A;  1HZ5 A;  1N62 A;  2NTS A;  1WF9 A;  1SIF A;  1XLQ A;  4M0W B;  4EZK A;  5JH5 C;  2FUG 1;  5BYS A;  4ICU A;  3DVG X;  3ZUN A;  2LGS A;  2WQY B;  3AE5 B;  1WMH A;  1DOI A;  1WRI A;  2XK5 B;  5JZE B;  2KX0 A;  1FCC C;  1P98 A;  3QWZ B;  1PGB A;  5LXH A;  3RYT A;  4C00 A;  4AJY B;  2K6D B;  1WYW B;  2KK8 A;  2MH7 A;  2WXM A;  1NYR A;  1RYJ A;  3OAW A;  4IOI E;  1F2R C;  2IJ0 A;  4PYU A;  3AV8 A;  3VTV A;  4WWM A;  4MDK E;  2HE7 A;  4TQ0 A;  1WE6 A;  1V5O A;  3ALB A;  3FIL A;  1JWU D;  4EZL A;  4NNJ B;  3MC8 A;  4E74 A;  2L76 A;  3R3M A;  4F7Z A;  2AQ2 B;  4GN1 A;  4A9A A;  2ZCC A;  3DBL I;  3U7D A;  3UF8 A;  4OZA A;  2JWU A;  4YXD B;  3ZDM C;  1NVI D;  2KDM A;  3W2D A;  2C5L C;  3DBL B;  4II3 B;  2K1F A;  4B0M A;  1QOA A;  3C0R B;  2WXO A;  4GOC A;  1XT9 B;  2WXR A;  3PZ8 A;  4C4V B;  3L10 B;  5LNK 1;  1QOB A;  3SHQ A;  3IT6 B;  3FAH A;  4RGM A;  2K9X A;  3PVL A;  2DAJ A;  5IAA C;  2FNJ B;  2XEW A;  2MBO A;  1HTO A;  4MSQ B;  5CX3 A;  3M3J A;  1WZ0 A;  1XF5 L;  1TBE A;  1ZPS A;  3E56 A;  2PJH A;  4AOF A;  1XLN A;  2I1K A;  3VTW A;  3AE4 B;  1B9R A;  4NJC A;  1L6V A;  2C9W B;  2Y3A A;  3H6N A;  2ONQ A;  2A5U A;  2JQR B;  1E7U A;  5FR3 A;  2FCM A;  4KGS A;  1GC7 A;  3A33 B;  3V60 A;  4D2K A;  2AQ1 B;  2N9X A;  1PGX A;  3NJT A;  3OG5 A;  1UGM A;  4TMA B;  2L32 A;  4OZB A;  1EWY C;  4C7Y A;  1I4R A;  2I38 A;  3DCG A;  4OZC A;  1ZKH A;  2M17 A;  2D10 A;  2IND C;  1QOG A;  3VDZ A;  1TT5 B;  3TEZ A;  3KUZ A;  3IT4 B;  4KDL B;  5G55 A;  1OFF A;  1BT0 A;  2LWP A;  3A9J B;  2WXQ A;  1I7H A;  4IW0 A;  4ACF A;  5DCN A;  2D11 A;  1SJE D;  1V1P B;  3S2A A;  2INC C;  1L2N A;  4M0W A;  3U52 E;  4FHK A;  3NVY A;  4A8X C;  3RNA C;  2DZI A;  4II2 B;  2EEL A;  2ZJD A;  1D5X C;  2BBC A;  2KFK B;  2WWZ A;  2XK5 A;  3M62 B;  2J52 A;  1V5T A;  4W9J A;  5J2R A;  1V6E A;  2AEH A;  5BMH A;  4PS3 A;  4EOY A;  3NOB A;  1KOT A;  3MHZ A;  5HFY A;  5C1Z A;  4H2A A;  2IO2 B;  1XEE A;  2K39 A;  2BKF A;  1FFV A;  2HDE A;  3KYD D;  2FAZ A;  3W5U B;  4DHJ B;  2ZZP B;  3AE3 B;  1ZGU B;  2JUO A;  1LM8 B;  1WRD B;  1OQR A;  2O6V B;  2JYT A;  2Z8L A;  4LNI A;  3AM9 A;  1T0Y A;  3PSE B;  2JRI B;  1YN3 A;  2FID A;  1I4H A;  4DXG A;  2BYV E;  4LTU A;  2KTR B;  3AE9 B;  1P1A A;  2JZZ A;  3BIN A;  2JXT A;  3V3X A;  2DZJ A;  1KLU D;  2I1J A;  4M01 A;  4WJP A;  4NZL B;  1YOV B;  1C79 A;  3EFU A;  3HUI A;  4GLS C;  3H7P B;  2LUE A;  2BPS A;  2WXP A;  4ARI A;  4YTM B;  5LXI B;  1FM0 D;  2ZPY A;  1JCK B;  4P1C C;  2L52 A;  1GPX A;  1D6E C;  1WX7 A;  1EO6 A;  3VQI A;  4KGT A;  3APC A;  2ZPN A;  2BF8 B;  4CYE A;  2V3N A;  2X8X X;  2MBE A;  2JSV X;  3BZD B;  1MI0 A;  2X38 A;  4C4V A;  2V3S A;  2CJN A;  1C78 A;  2N9L A;  2SEB D;  3TEW A;  1L6U A;  4XGA B;  2J7Q B;  1YN5 A;  1CK1 A;  1WGY A;  2LVP A;  4YTP B;  3HM6 X;  2CHX A;  1P9D U;  2RD0 A;  3NVV A;  4IUM B;  1ZW7 A;  1BUI C;  1MHH E;  1TZO A;  2GBJ A;  2IY0 B;  3U2S C;  3AEE B;  4RCO A;  4HKQ A;  2OHF A;  3DBH I;  1RFA A;  3L17 A;  3QCA A;  4DHZ E;  2INN E;  1C4A A;  2WX1 A;  3VH4 B;  1IPG A;  1FIQ A;  3IHP C;  3CSF A;  2H88 B;  1SBB B;  4BKG A;  4FHJ A;  4E3C A;  3ML8 A;  2Y5P A;  1YN4 A;  4ANU A;  3KUC B;  4YSY B;  3LYY A;  3PTF C;  5D6J B;  4OHJ A;  1FEH A;  5CHF A;  2PE9 A;  5T8I A;  4E71 A;  2IBI B;  1FXT B;  2FCN A;  3MHS D;  3R8B A;  2BS4 B;  3P4R B;  3UIN B;  4MJS A;  2RDH A;  2UWQ A;  4G3X B;  2L1A A;  4WJO A;  4LDT B;  1D4B A;  3P1M A;  2K22 A;  1UH6 A;  1NEK B;  1YJ1 A;  2D5G A;  1SIJ A;  3QA8 A;  2G45 B;  4N58 A;  2XNA C;  2BYF A;  3AEF B;  1L4Z B;  1OGW A;  2ON8 A;  2RSU A;  2DBY A;  3BII D;  3BY4 B;  1V1P A;  2LJI A;  3VHT C;  1T0S C;  3UQA A;  3TCA A;  3RPF C;  2JZ3 B;  1ISN A;  3AE1 B;  4US9 A;  4YT0 B;  2KN4 A;  3I9V 1;  3GE3 C;  2N0S B;  3Q2A C;  1LXD A;  4HDO A;  4LLG M;  3U7Z A;  3RUI B;  2KFK A;  2LMC A;  4HRS A;  5EE0 A;  1HXY D;  1D5M C;  2PVO D;  2PE6 B;  3KYC D;  3ZKJ C;  1FMA D;  2GBR A;  1TS3 A;  4W9L A;  1GC6 A;  2RMM A;  2J53 A;  3U8Z A;  1WYG A;  2LHE A;  4HJG E;  2DYB A;  2R2O A;  2EMT A;  3EFC A;  3CST A;  2MRP A;  3VAW A;  1RLF A;  2G3Q B;  2K8H A;  1XLP A;  2O6V A;  3AMZ A;  4W9D A;  4ZRI A;  3QX1 A;  4PK1 A;  3C19 A;  1PYW D;  4X57 B;  3TSS A;  3VTU A;  1Y56 A;  2KFJ A;  2VZK B;  2KTR A;  4NJ7 A;  2BYE A;  2GBN A; 
#chains in the Genus database with same CATH homology
 2KJ6 A;  4HJK A;  1E7V A;  1IP9 A;  4K81 A;  2IO1 B;  3B08 A;  1WJN A;  3QAQ A;  4IC7 B;  4ANW A;  4DXA B;  4P7I A;  2ZEQ A;  2LRU A;  2MBB B;  3QAR A;  5E6N A;  4BVU C;  3ZO5 B;  2KVR A;  5BO4 B;  2JXX A;  2Z0E B;  3H7P A;  2MLB A;  3A1Q A;  1WJ6 A;  4DWF A;  2KWC A;  3L54 A;  4DHZ B;  1VCB A;  1WGD A;  3TJP A;  2MA9 B;  4KIK B;  2L0F A;  1WF9 A;  1SIF A;  4M0W B;  4EZK A;  1KM7 A;  4HDQ A;  5JH5 C;  2G4S A;  4ICU A;  4NAW B;  3DVG X;  3ZUN A;  1GJZ A;  2G4D B;  2KAN A;  1WI0 A;  3V61 A;  4BBN C;  4F1S A;  3T8M A;  4AWJ A;  3PHW B;  1I42 A;  2Z59 B;  1GNU A;  1WMH A;  4MM3 A;  2LVO A;  1JRU A;  2XK5 B;  1I35 A;  5JZE B;  2KX0 A;  3QWZ B;  1P98 A;  4IWP A;  4FAD A;  5LXH A;  2KWU B;  2O2V B;  3RYT A;  4AJY B;  2DHZ A;  1E8W A;  1WGR A;  2LGD A;  3VVW B;  2D2Q A;  2YVC A;  3SDL C;  3QQ8 B;  2C7M B;  2K6D B;  3OJ3 A;  2JWZ A;  1WYW B;  2KK8 A;  4K7U A;  4FA6 A;  4KSL C;  4ANX A;  3OAW A;  2REX A;  4PYU A;  4KZC A;  3ZW3 A;  2JT4 B;  4W9C A;  3VTV A;  4MDK E;  2OJR A;  3QHT A;  2HE7 A;  3EEC A;  1WE6 A;  4DDG D;  4TQ0 A;  1V5O A;  1YX6 B;  3OLM D;  3ALB A;  3A4R A;  3ECI A;  3NZS A;  3DQV A;  4BBN F;  4EZL A;  3DOW A;  4HCN B;  2CU1 A;  4K7W A;  4NNJ B;  1V49 A;  3UIP B;  4B95 A;  4E74 A;  5KHO A;  3IFW B;  2KQ7 A;  2L76 A;  5AZH A;  1MG8 A;  3R3M A;  1EF5 A;  4F7Z A;  3NZU A;  1KLV A;  3M63 B;  3MTN B;  4GN1 A;  2DYO A;  2KLG A;  3A9K A;  2ZCC A;  2V1Y A;  3DBL I;  4LCD E;  4W9K A;  2PEA A;  5AZF A;  3U7D A;  3UF8 A;  5D7G A;  4WWP A;  2NPT B;  2JVC A;  4DK5 A;  2PPH A;  3ENE A;  4URK A;  3PRM B;  4I6P A;  3ZDM C;  2J0K A;  2L05 A;  1E8Y A;  2MCN B;  4IG7 B;  3N3K B;  2C5L C;  2EMS A;  4II3 B;  2K1F A;  2LGY A;  3O65 B;  4JL9 A;  3C0R B;  4GOC A;  2ZVO A;  3UIO B;  2K8C A;  3ZDT A;  4FN2 A;  1XT9 B;  3H9D A;  2R2Q A;  1WR6 E;  3L10 B;  4CHK A;  3PRE A;  4XZ4 A;  3V6C B;  4A3O A;  1Q0W B;  4JQW C;  1H4R A;  4J6I A;  1SE9 A;  3SHQ A;  2KDI A;  4BKS A;  4IWO A;  3T9L A;  4JGH B;  3PVL A;  2DAJ A;  1OEY A;  4WQO B;  5IAA C;  2KLC A;  2L3Z A;  2FNJ B;  3N32 A;  1F9J A;  5KHQ A;  2XEW A;  5JHA A;  2KKC A;  2MBO A;  3L13 A;  4GDK A;  1LFD A;  3M95 A;  3WAN A;  4MSQ B;  5D2M B;  5IA7 A;  5D94 A;  2LI5 A;  2LAS A;  4FUL A;  4WWN A;  5CX3 A;  4HCP B;  2Y5B B;  3M3J A;  1WZ0 A;  2ASQ A;  2NBV B;  4A3P A;  4FBJ B;  2KMC A;  1TBE A;  1WGH A;  4GU2 A;  2PJH A;  4HWI B;  1WGG A;  4GXB A;  4AOF A;  3PPA A;  4K1R B;  4PS7 A;  3ZNG C;  3PGE A;  2I1K A;  3VTW A;  4FJZ A;  4MGZ E;  1PQS A;  1Q1O A;  1S3S G;  1H8C A;  4ZYN A;  2C9W B;  2NBW B;  2RGF A;  2NVU I;  2N1W A;  1WM3 A;  2FIF A;  3QK0 A;  2JF5 A;  1L7Y A;  3H6N A;  4TQ1 A;  2ZCB A;  2LXA A;  2A5U A;  2RPQ A;  1E7U A;  2FUH B;  1K8R B;  3AU5 A;  2EKE C;  2FCM A;  1GC7 A;  3A33 B;  3V60 A;  1WJU A;  1AAR A;  4LDT D;  4NPN A;  3PRP B;  2N9X A;  4HPL B;  1V2Y A;  5DPW A;  4W9E A;  1G6J A;  1YD8 U;  4IM2 A;  3EC8 A;  3H7S A;  3NS8 A;  3ZRC A;  1UGM A;  1E8X A;  3VUY A;  1IYF A;  2GBM A;  4RM9 A;  1UBI A;  3DCG A;  3KH0 A;  2OOB B;  1ZKH A;  2M17 A;  2D10 A;  3P2B A;  3RCZ A;  4DHJ D;  2ZVN A;  1UD7 A;  3VDZ A;  4TV3 A;  2DZK A;  4M8N A;  3KUZ A;  5HKH A;  2O6V D;  4W9H A;  1RAX A;  4KDL B;  5G55 A;  4W9F A;  2GMI C;  4MEM A;  4IM0 A;  4YL8 A;  1BT0 A;  4JLC A;  3ML9 A;  2LWP A;  2K25 A;  4OVU A;  3HHM A;  3QC8 B;  3A9J B;  3PLU A;  3WAL A;  4WWO A;  3RD2 A;  4PS8 A;  4BKT A;  3WAO A;  4IW0 A;  1EUV B;  3PV1 A;  3ZLZ A;  5DCN A;  2IYD B;  2D11 A;  2MX2 A;  1TTN A;  2WDT B;  4MGK E;  1P0R A;  2CS4 A;  5G2N A;  3S2A A;  4DBG A;  1D3Z A;  2KC2 A;  4DDI D;  2AL6 A;  2AL3 A;  4GMV A;  4KIK A;  1L2N A;  3JSV B;  3R7R A;  3R7Q A;  5E6O A;  3Q3J A;  4NAW A;  2MQJ A;  1E8Z A;  2DEN B;  4FHK A;  4KDI C;  2FCQ A;  2KDE B;  1S1Q B;  4MGI E;  2W9N A;  3ZNH B;  2KMA A;  2DZI A;  2K6Q A;  4II2 B;  2ZJD A;  2VRR B;  2KFK B;  2RR9 A;  1SGH A;  2N9P C;  2WWZ A;  2XK5 A;  5DPS A;  1YQB A;  3M62 B;  3OJ4 B;  2JPH A;  2NCN A;  2NS5 A;  1V5T A;  2O2V A;  2LRW A;  2M0X A;  3JW0 X;  4MGY E;  4W9J A;  5CHW A;  5EDS A;  5J2R A;  1V6E A;  2AEH A;  1QZE A;  2KZR A;  4PS3 A;  3GZN I;  4EOY A;  3IVF A;  3VXW A;  3I3T B;  3NOB A;  1KOT A;  2KJR A;  5C1Z A;  5AZG A;  1V9J A;  2DZM A;  4KV2 A;  3LJ3 A;  3LDZ E;  1J0G A;  2MP2 B;  3NHE B;  3A9J A;  2IO2 B;  2K39 A;  3RT3 B;  2BKF A;  1YIW A;  4M8M A;  2M1M A;  4HVB A;  3KYD D;  2FAZ A;  2MBH A;  3KVF B;  4CO7 A;  4DHJ B;  2ZZP B;  1WIA A;  1ZGU B;  2JUO A;  2L7R A;  1LM8 B;  2BGF A;  1WRD B;  2NR2 A;  3VUX A;  2O6V B;  3H1U A;  1J8C A;  3B1L X;  3KUD B;  4LJO B;  3APD A;  1T0Y A;  5J17 A;  2WX0 A;  3PSE B;  3WAP A;  1V80 A;  2IO0 B;  2JRI B;  2FID A;  2IO3 B;  4GGQ A;  1V81 A;  3UGB B;  4GDL B;  5AEK B;  2KNB A;  3TIX A;  2QHO A;  2BYV E;  2LJ5 A;  4G11 A;  1M94 A;  2KTR B;  1R4N I;  4HK2 A;  1NBF C;  1UBQ A;  1XD3 B;  1P1A A;  2KN5 A;  3VUW A;  5C23 A;  2JZZ A;  2MW5 A;  1OTR B;  3BIN A;  4FJV B;  1WE7 A;  5CTR C;  2ZNV B;  4BOZ B;  2DZJ A;  1WM2 A;  2I1J A;  4WJP A;  4EKU A;  1EF1 A;  4I6L B;  3EFU A;  1WH3 A;  4EFO A;  3PRZ A;  1A5R A;  3H7P B;  2LUE A;  2BPS A;  2NPT A;  3NY5 A;  3PHX B;  4KZ0 A;  4WJQ A;  5E6P A;  1RRB A;  1XQQ A;  2HTH A;  3ZNZ B;  5LXI B;  2N9E B;  2CR5 A;  2ZPY A;  3L16 A;  3Q3F A;  4ZRK A;  5DPT A;  4EUT A;  3L0W B;  1Z5S B;  2KD0 A;  2GOW A;  3HM3 A;  4GSW A;  3V62 A;  4HLE A;  1NDD A;  1WX7 A;  2M4N A;  3GOE A;  3JYU A;  2AYO B;  1EO6 A;  4B6W A;  3VQI A;  3APC A;  2ZPN A;  3WAM A;  2BF8 B;  4CYE A;  1WMH B;  4OVV A;  2MBE A;  1UZX B;  4AJW A;  3ZRF A;  5J18 A;  2V3S A;  3DBS A;  3IBE A;  1WR1 A;  2DAF A;  2L00 B;  1UEL A;  2LXC A;  5LLI A;  4HXD A;  2J7Q B;  4ASW C;  3WIM A;  3MJW A;  1R4M I;  1WGY A;  2LVP A;  2MWS B;  4NQK E;  3RUL A;  2MBQ A;  4BFR A;  4MSM B;  4BKS D;  3HM6 X;  1TZ1 A;  2NBU A;  2CHX A;  1P9D U;  2RD0 A;  4MJS B;  3PZD A;  4G50 A;  1ZW7 A;  4IUM B;  2ZNV C;  3ZTC A;  2GBJ A;  4GIV A;  1E5W A;  2IY0 B;  2L8J A;  2YLM A;  4ICV A;  3U30 A;  3APF A;  2K8B A;  3DBH I;  1RFA A;  3W1Y A;  4ANV A;  2GBK A;  3HIZ A;  3L17 A;  3RZF A;  4I6N B;  2LZ6 A;  3IG3 A;  3QCA A;  2DX5 B;  4DHZ E;  1Q5W B;  4IM3 A;  3QJZ A;  3VFK A;  2WX1 A;  3VH4 B;  1IPG A;  2KDB A;  4WJN A;  4GB9 A;  3IHP C;  3X0W A;  3A4S C;  1J19 A;  4RMA A;  3CSF A;  4BKG A;  4MH0 E;  4FJY A;  1V86 A;  3CF6 E;  2MSE D;  4FHJ A;  1E90 A;  3EHV A;  4XX5 A;  4E3C A;  1TGZ B;  2CHW A;  2HD5 B;  2LD9 A;  3ML8 A;  3UQB A;  3ZVV A;  2C60 A;  3PT2 B;  4ANU A;  4EZJ A;  2KX3 A;  3KUC B;  2J0J A;  3A9K B;  3PTF C;  3AI5 A;  4KSK C;  5D6J B;  3K9P B;  2FCS A;  4A20 A;  5JHB A;  2KDF B;  1WXM A;  4G0N B;  4HPM B;  5CHF A;  2PE9 A;  4E71 A;  2IBI B;  2CKH B;  5TR5 A;  2HJ8 A;  1FXT B;  2FCN A;  3MHS D;  1U4A A;  3UIN B;  3V6E B;  4B9K A;  4ZRJ A;  2LGX A;  3D32 A;  4MJS A;  3WA0 A;  1C3T A;  3RZW C;  1WXV A;  2UWQ A;  1CMX B;  4G3X B;  2J0M A;  1WZ3 A;  3ONS A;  1WFY A;  4F8C B;  3CMM B;  4KVG B;  2Z0D B;  3W1S A;  4WJO A;  4TUU A;  2KTF A;  3W1S C;  4LDT B;  2CHZ A;  3AU4 A;  3AXC A;  3L08 A;  4BOS C;  4AUQ C;  2C7H A;  1UH6 A;  2C7N B;  1YJ1 A;  3DVG Y;  2AWT A;  3KW5 B;  2UYZ B;  2XBB C;  3QA8 A;  2D3G A;  4NJ6 A;  2G45 B;  2A4Z A;  5DPR A;  3ZNI D;  1Y8R C;  1WJ4 A;  4XC2 A;  2BYF A;  1LQB A;  4GDK B;  1OGW A;  1C1Y B;  2RSU A;  4EEW A;  3PS6 A;  3DVN V;  2N1V A;  4FLH A;  4N9F 4;  3BY4 B;  3R66 C;  3VHT C;  3UQA A;  2KXJ A;  4ZDV A;  3TCA A;  2D07 B;  1ISN A;  2JZ3 B;  2N4F A;  3JSV A;  1WY8 A;  4WAA A;  3K9O B;  3TMP B;  1LXD A;  5CHV C;  4TKN A;  4HDO A;  4RM8 A;  3TBL D;  3RUI B;  1GUA B;  4NY0 A;  3VH3 B;  2KFK A;  2IY1 B;  2JY6 A;  2BWF A;  2L0T A;  1GG3 A;  2PE6 B;  3DVN U;  3KYC D;  1WX8 A;  3ZKJ C;  3TL5 A;  4JIO U;  2GBR A;  5L95 C;  1NI2 A;  1WXA A;  4K7S A;  2KWV B;  3DBR I;  2IZV B;  3N30 A;  1GC6 A;  4W9L A;  2KC1 A;  1KJT A;  2KO3 A;  1OEY J;  2DYM A;  2M8S A;  2B3A A;  4PYZ A;  1VD2 A;  2KOX A;  3JVZ X;  3A1Q B;  5FR6 A;  2JRH A;  3U8Z A;  3X23 A;  3DPD A;  2MP2 A;  2WYQ A;  2KHW B;  2DYB A;  3ZTD A;  2BKR B;  2EMT A;  2R2O A;  3AUL A;  4MEL A;  3CST A;  1HE8 A;  3B0A A;  3SU8 X;  2MRP A;  1P3Q U;  4LJP B;  3SD5 A;  3DDC B;  2LVQ A;  4W9G A;  1RLF A;  2G3Q B;  3VAW A;  1X1M A;  3QIJ A;  2K8H A;  4NQL B;  2O6V A;  4IWQ A;  2BWE S;  4W9I A;  2V4L A;  3HK0 A;  1WXS A;  2N7D A;  4W9D A;  1WX9 A;  4ZRI A;  3QX1 A;  3PLV A;  4AP4 C;  2KJH B;  1YX5 B;  5L83 A;  4X57 B;  4GDL A;  3VTU A;  5GMV A;  2KFJ A;  2N7E A;  2KTR A;  4NJ7 A;  1OQY A;  2KQS A;  2BYE A;  1Z2M A;  3ZIM A;  2GBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...