3GOEA

Molecular mimicry of sumo promotes dna repair
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
HHHHHHKLITLLLRSSKSEDLRLSIPVDFTVKDLIKRYCTEVKISFHERIRLEFEGEWLDPNDQVQSTELEDEDQVSVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination, replication
molecule keywords DNA repair protein rad60
publication title Molecular mimicry of SUMO promotes DNA repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3goeA00
4HLEA 1E8WA 2PJHA 3B0AA 4II3B 2LRWA 2MWSB 3DOWA 4W9FA 2OJRA 4LJPB 3SD5A 4JIOU 3JVZX 4XZ4A 4EOYA 3LDZE 4MJSA 3BY4B 3IVFA 5AZGA 3ML9A 5CX3A 3RT3B 1GJZA 2L0FA 2KC1A 3N32A 4ASWC 4W9DA 1V80A 5GMVA 3JSVA 4MSQB 2KJHB 2GBJA 3A4SC 3DVGX 4MGKE 3GOEA 2JF5A 1IYFA 2KQSA 2G45B 2HJ8A 1ZW7A 1YQBA 4XC2A 3L54A 3DBHI 2M1MA 3ZRFA 5AZHA 4CHKA 2A5UA 3PPAA 4W9LA 2EMSA 5AEKB 1KJTA 2BPSA 4FN2A 1LXDA 4IC7B 3R7RA 1GUAB 1V2YA 4DHJB 1S1QB 2G3QB 3PREA 5FR6A 4G50A 1VD2A 1ZGUB 2JRHA 2NBUA 2IY1B 2FCNA 2B3AA 5E6OA 1IP9A 3L08A 4M8MA 1WX9A 3ZTCA 2KDFB 1WJ6A 3W1YA 3HIZA 1L7YA 4W9IA 2DZIA 1ISNA 2AYOB 2M17A 5C23A 1HE8A 1F9JA 5L95C 2LZ6A 2K8BA 2NBWB 3A4RA 4GOCA 4B95A 4KZ0A 2JY6A 3DBLI 4W9KA 2LUEA 1MG8A 2JPHA 3WIMA 2KXJA 2KDEB 2C7MB 2KX3A 2R2QA 3RZWC 3VTUA 1C1YB 4W9GA 4E3CA 3KUCB 2IO1B 3SHQA 2L7RA 4OVUA 3OJ3A 2IZVB 4ZRIA 2I1KA 3BINA 2RD0A 4MEMA 3A9KB 2C5LC 3APCA 3M62B 4IM0A 3SU8X 1RFAA 4W9JA 3L10B 4YL8A 1V49A 4HXDA 1TBEA 4TQ1A 4AJWA 1K8RB 5TR5A 1TZ1A 2D2QA 3UQAA 1TTNA 2CHZA 2KDBA 4G3XB 2KDIA 4N9F4 4IWPA 4K7SA 3V60A 4WAAA 1WF9A 2GBKA 4ANUA 4WJOA 3PV1A 3A9JA 2LGXA 4I6LB 1A5RA 2IO2B 2FUHB 4I6NB 2MQJA 3PZDA 2QHOA 4G0NB 4PS3A 4HJKA 3APDA 3DBSA 3ZNID 3UF8A 4GDKA 3A9KA 1V6EA 2OOBB 1M94A 4KVGB 4TV3A 3APFA 3PLVA 3QA8A 3DPDA 2G4SA 4HPLB 2MA9B 1TGZB 3ZDTA 5J2RA 2MBOA 3WAMA 2KHWB 2N7EA 2D11A 2NS5A 3HM3A 3R3MA 2WWZA 3ZNHB 1P0RA 1E7UA 1VCBA 2K6QA 3IFWB 3QAQA 2LD9A 3H1UA 4WWNA 2AL6A 4TKNA 4A20A 4BFRA 1GC6A 1WGYA 2MBQA 4NNJB 1LQBA 3H9DA 2DYMA 4LCDE 4NQKE 3A1QA 3NHEB 1EUVB 5L83A 2LGDA 4GMVA 2LVPA 4WWOA 3TJPA 2AWTA 4F7ZA 4IW0A 4W9HA 3VXWA 2RSUA 4ICUA 2GBMA 3WALA 2NVUI 4PS7A 4GU2A 1WGDA 4ANVA 4KSLC 4MELA 5G55A 2BYVE 4EFOA 4RMAA 2V1YA 1WI0A 2KKCA 1WXAA 3ZUNA 1P98A 4G11A 2DHZA 3QCAA 2J0JA 3O65B 2WX1A 3EECA 4KSKC 1J19A 3LJ3A 2DZJA 4IWOA 3R7QA 2MBEA 3TIXA 2PE9A 3DDCB 4IG7B 5JZEB 1E7VA 2NR2A 3ZTDA 1FXTB 1UZXB 1WJUA 3ECIA 2FCQA 1GNUA 4AJYB 3RULA 4DHZE 3ZRCA 3QJZA 2BWFA 2BKFA 2DZKA 2Z0EB 2MBHA 3KW5B 2KQ7A 3T9LA 4FJZA 4EUTA 2K8HA 1EF5A 2NCNA 3VUWA 1NDDA 1UD7A 3PT2B 2YVCA 1WXMA 3EHVA 3ZNZB 3WAOA 4KZCA 4LJOB 4B6WA 5IA7A 4LDTB 2MX2A 2WYQA 1SE9A 3R66C 4FLHA 4NY0A 3PGEA 4WJQA 3B1LX 1KOTA 4BOSC 5E6PA 1Q5WB 1WGHA 3Q3JA 1WYWB 1BT0A 3TMPB 2FCSA 1Y8RC 2ZVNA 4X57B 4FJVB 2BWES 3QARA 2LVOA 2C60A 3U30A 2ZEQA 3ZVVA 4ZYNA 2XK5B 1UGMA 1WJNA 2L3ZA 2KWCA 2DYOA 2N1VA 3VAWA 1OEYJ 2BYEA 1RLFA 1RRBA 1Z2MA 2KNBA 5E6NA 4DDID 3IG3A 1P1AA 4AUQC 2CHXA 2K6DB 2UYZB 2LASA 1C3TA 1CMXB 3KUZA 2KTRA 1LFDA 3VQIA 1V81A 3PRMB 4DHJD 3UINB 4W9CA 3I3TB 1IPGA 2CS4A 2KC2A 1ZKHA 2J0MA 3A9JB 5J17A 2NPTB 3ENEA 2FAZA 3WA0A 2O2VB 1U4AA 2XK5A 5KHOA 5LXHA 2KZRA 1NBFC 3HK0A 4KIKB 4MSMB 5J18A 1KLVA 2WX0A 2LRUA 2NBVB 3PSEB 4GDKB 3T8MA 3X0WA 2IY0B 2C9WB 4HCNB 1UBIA 4GDLA 3MJWA 4HK2A 3V62A 2XBBC 1WM3A 2G4DB 5D6JB 3KYCD 2KK8A 3PLUA 3PHWB 5EDSA 4BBNF 1E8ZA 3QX1A 3M63B 2NPTA 2IBIB 2FNJB 2V4LA 2O2VA 2IO0B 4B9KA 2YLMA 3OAWA 2IO3B 4KIKA 1OGWA 2KJRA 3TL5A 1V9JA 2HE7A 3K9OB 2KANA 4JL9A 3H7SA 5D7GA 3KUDB 3A1QB 2CKHB 4PS8A 2Z59B 4CYEA 3OLMD 4ZRJA 4E74A 1V86A 4EKUA 2FCMA 1Q1OA 1YIWA 1GG3A 5KHQA 2N4FA 1KM7A 3PVLA 2ZNVC 4AWJA 4GIVA 4BKSD 4M0WB 4IUMB 4M8NA 3B08A 2JT4B 1P9DU 3K9PB 4DDGD 4NJ7A 1I35A 3AU5A 2M0XA 2FIDA 3RYTA 1WXSA 2ZVOA 3DVGY 2W9NA 1AARA 1EO6A 2KN5A 3AI5A 4PYZA 5DPWA 2GOWA 4JLCA 1WM2A 4NJ6A 2KLGA 2HD5B 3CSTA 3JW0X 3KVFB 2PE6B 3AULA 2O6VD 1T0YA 3QWZB 4K1RB 4HVBA 2A4ZA 4WQOB 3NOBA 3VUYA 2GMIC 1WRDB 2JZ3B 3QHTA 4DWFA 1GC7A 2M4NA 4HCPB 1E5WA 2PPHA 4P7IA 4GGQA 4FA6A 4PYUA 2N9XA 4EEWA 4F1SA 2KOXA 3S2AA 2K8CA 3PRPB 4GB9A 2GBNA 3ONSA 3VFKA 2DX5B 3DVNU 3H6NA 4FHJA 4I6PA 5G2NA 3JYUA 5JHAA 1Z5SB 3PTFC 4FBJB 3N3KB 4KDLB 4BVUC 2PEAA 1PQSA 1QZEA 2K25A 2KWVB 3NZSA 1WX8A 3VH4B 3ZW3A 4BOZB 2ZCCA 3N30A 1E8YA 2CU1A 2Z0DB 3NY5A 1LM8B 3L13A 2JXXA 5DPTA 4AOFA 2KMCA 3V61A 2DAJA 2K39A 3DBRI 2KVRA 3NS8A 2LXAA 5CHFA 1G6JA 2EKEC 5D2MB 3ZO5B 2L05A 3D32A 2DENB 2KTRB 1WR1A 3W1SC 1SGHA 2LVQA 5IAAC 2KFKA 1YJ1A 2MCNB 3UIOB 3X23A 2JWZA 2HTHA 1WX7A 4TQ0A 4ZDVA 5CTRC 2BF8B 3RUIB 1H4RA 1WZ3A 2REXA 4WWPA 3ZLZA 1H8CA 3RZFA 2KJ6A 2LXCA 2N9EB 4MH0E 3ALBA 3AU4A 5LXIB 3L17A 5CHVC 4ANWA 4MGZE 1SIFA 1J0GA 2XEWA 2KMAA 2K1FA 2MSED 3QQ8B 4JQWC 2ZNVB 4KV2A 3KYDD 2KTFA 4TUUA 4LDTD 1XD3B 3QK0A 1JRUA 2KFJA 3UIPB 2LWPA 2ZZPB 4GDLB 4MDKE 2C7HA 2AEHA 4EZJA 1WJ4A 2ZPNA 2ASQA 4IM3A 4RM8A 2RR9A 3VDZA 1UH6A 2N9PC 2KLCA 2LI5A 2BKRB 1X1MA 5DCNA 4MGIE 1I42A 1OTRB 3KH0A 4ICVA 3H7PB 4WJNA 4NPNA 4GN1A 3HM6X 4HDOA 3VTWA 4BKTA 3U8ZA 2BGFA 3PHXB 2ZPYA 5CHWA 1WMHB 3OJ4B 4K7WA 4HDQA 3SDLC 3ZNGC 4W9EA 4DBGA 2JZZA 2D3GA 4J6IA 5LLIA 4EZLA 2R2OA 5C1ZA 1WGRA 1WH3A 1P3QU 2C7NB 3DQVA 4FULA 2JUOA 4HWIB 2L00B 2RGFA 2JVCA 1OEYA 3IHPC 3PS6A 4FHKA 2MP2B 2ZCBA 1WFYA 2MW5A 1V5OA 4IWQA 3H7PA 2EMTA 4WJPA 4K81A 2LGYA 4A3PA 2JRIB 3MHSD 4NAWB 1R4NI 5DPRA 1WMHA 1YD8U 5JH5C 4E71A 2V3SA 1WIAA 2GBRA 4NQLB 3L16A 2BYFA 4BKGA 3EC8A 3V6EB 4DK5A 2KD0A 1WR6E 3ZIMA 1J8CA 2Y5BB 1S3SG 3U7DA 3M95A 3QIJA 2J0KA 3NZUA 1XT9B 5DPSA 4JGHB 3ZKJC 2MLBA 2CHWA 3CF6E 4CO7A 1E90A 1YX5B 2MP2A 3CSFA 3HHMA 1WY8A 1WGGA 1E8XA 1WE6A 1WXVA 3RCZA 4XX5A 5AZFA 3A33B 4NAWA 5BO4B 2N1WA 3M3JA 3IBEA 3L0WB 2DAFA 1WE7A 1NI2A 1EF1A 2D10A 1UELA 4IM2A 3ZDMC 3TBLD 4A3OA 3VVWB 3EFUA 2LJ5A 1Q0WB 2DYBA 2L8JA 3RD2A 4FJYA 2KX0A 4GSWA 2O6VB 2I1JA 4GXBA 4II2B 3VHTC 3DVNV 1L2NA 2M8SA 4DXAB 4BKSA 2MBBB 1XQQA 2N7DA 4MGYE 3VUXA 3W1SA 3PRZA 2UWQA 4K7UA 1OQYA 3WAPA 4F8CB 2DZMA 3DCGA 4FADA 4BBNC 4EZKA 4HPMB 1YX6B 1WZ0A 1R4MI 2D07B 2CR5A 3AXCA 3C0RB 3VH3B 2IYDB 4ANXA 4DHZB 4URKA 3UQBA 2AL3A 2KO3A 2L76A 4ZRKA 1UBQA 2MRPA 4KDIC 2KFKB 2L0TA 5JHBA 3P2BA 2O6VA 2KWUB 3MTNB 4MJSB 3TCAA 5D94A 2FIFA 2VRRB 1V5TA 4AP4C 3VTVA 2RPQA 1D3ZA 3V6CB 4OVVA 3ML8A 2WDTB 4MM3A 5HKHA 2J7QB 2ZJDA 3CMMB 3JSVB 3Q3FA 3UGBB 3GZNI 4RM9A 3WANA 3QC8B 1RAXA
chains in the Genus database with same CATH superfamily
1E8WA 3DOWA 3SD5A 4JIOU 4B0EA 4MJSA 5CX3A 3RT3B 1GJZA 2L0FA 3N32A 2QC8A 2KJHB 3DVGX 3GOEA 1HTQA 3BIID 1K50A 1VR9A 1IYFA 1AWDA 2G45B 2QMTA 3DBHI 5AZHA 5AEKB 1QOBA 4JX1C 1RWSA 4DHJB 1FEHA 2NBUA 4KKJA 4US9A 1GPXA 5E6OA 1EM7A 3L08A 1WX9A 1JW9D 1WJ6A 2DZIA 1ISNA 1I4RA 3I63C 2NBWB 1GAQB 3BK2A 4GOCA 2BW2A 3AN1A 2KXJA 2KDEB 5JXVA 3RZWC 1HA5A 2L7RA 1JALA 2IZVB 3AEBB 2I1KA 1VZ7A 2RD0A 4MEMA 2D5GA 3M62B 3R2TA 1C4CA 4YL8A 4HXDA 4TQ1A 4AJWA 1DGJA 3N9YC 2CHZA 2HDEA 4G3XB 3P42A 1BUIC 4N9F4 3V60A 3GS2A 4JWSC 1ET6A 2GBKA 4ANUA 4YSZB 4WJOA 4I6LB 3LYYA 2QHOA 3DBSA 1KRHA 4ITKA 3A9KA 1V6EA 1M94A 1BMLC 2JX5A 1HZ6A 2MA9B 3TEYA 5J2RA 1HEZE 4P1BC 2WWZA 1UNSA 2K9XA 1E7UA 3QAQA 4MM3B 4M01A 2LD9A 4WWNA 2AL6A 2J52A 1GC6A 4C4VB 1F2RI 1EUVB 1D4BA 4GMVA 2LVPA 3VXWA 3WALA 1FMAD 2W3SA 3I5JC 3Q2AC 1CK1A 2RDHA 1K52A 5G55A 1WXAA 3ZUNA 4G11A 3QCAA 2DLBA 3O65B 2WX1A 4KSKC 4YTMB 2V4IB 4IWOA 2MBEA 1VRAB 4WQMA 2FCQA 4WWMA 4DHZE 2BKFA 2DZKA 2MBHA 2CJNA 4M02A 4FJZA 4EUTA 5GXGB 3EHVA 1WXMA 3ZNZB 3R2IA 1WRIA 3GP7A 2WXGA 5FK9C 2MX2A 2WYQA 4R3DA 4BOSC 1WGHA 2LEKA 1BT0A 3TMPB 2ZVNA 2ZEQA 3ZVVA 1OEYJ 3P4RB 1I4QA 3CWIA 4ZHPA 4RF0A 1V1OA 1C3TA 2KTRA 1LFDA 3VQIA 3I3TB 1IPGA 2FAZA 1QKZA 2ACZB 1NBFC 2PIAA 2LRUA 4GDKB 2ON8A 2IY0B 2C9WB 3V62A 1KTKA 2PVOD 2M19A 5D6JB 4A8XC 4C7YA 1EU4A 1EU3A 4BBNF 1E8ZA 2BQQA 2NPTA 3KWLA 3NS1A 4B9KA 1Y56A 2YLMA 1OGWA 1FD6A 3K9OB 4JL9A 3A1QB 2Z59B 5AUKA 4EKUA 1Q1OA 5KHQA 1QILA 3PVLA 4GIVA 4M8NA 1P9DU 1JWUD 2M0XA 1F77A 3RYTA 2QJLA 1EO6A 1V97A 4RH6A 2GOWA 2BS2B 2HD5B 3AULA 2WLBA 3QWZB 3Q14C 4K1RB 2A4ZA 2FBWB 1SBBB 3V05A 2GMIC 4DWFA 4ARIA 3TEXA 1JRPA 4GGQA 1TY0A 4PYUA 2N9XA 1MI0A 1K53A 3ONSA 1FO4A 1SB3C 5IO9A 4M00A 5JHAA 1VZ8A 3N3KB 4BVUC 4PT5A 1PQSA 1QZEA 3NZSA 2D3BA 4BOZB 1E8YA 2WXJA 2CU1A 1LM8B 3L13A 1J7BA 5BYRA 3WCQA 5CHFA 2K39A 4DXFA 4C7ZA 2L05A 1P7FA 3W1SC 4CQNA 2KACA 3UIOB 2JWZA 4TQ0A 4ZDVA 1TKYA 3Q8FA 2LFIA 2REXA 2LXCA 3ALBA 2J53A 5LXIB 3L17A 1SIFA 1E7PB 1STEA 4WAFA 1UWMA 2Q5WD 1TT5B 2LWPA 2ZZPB 1L0YB 2ZPNA 4RM8A 1RFKA 2J4XA 2WU5B 3ZGZA 1D5MC 2LI5A 1X1MA 4ICVA 4N58A 3HM6X 3MC9A 2QEJC 1J7CA 2BGFA 3OJ4B 4K7WA 2EKIA 3N1YC 2AQ1B 3DBLB 1YN4A 4K3CA 1B9RA 2L00B 3RI7C 2JVCA 1OEYA 4USAA 3PZ7A 1FCLA 2MW5A 2KQ4X 3H7PA 4WJPA 1MFWA 1WXQA 2L52A 3MHSD 5DPRA 5JH5C 4NQLB 4S0RA 2BYFA 2KVZA 1J8CA 1ACCA 2Y5BB 3U7DA 2PKOA 2D3CA 1VDVA 3VRAB 2J0KA 3RMKC 1JQ4A 2EELA 3AEAB 2WDQB 3CSFA 1WY8A 3RCZA 3AE9B 4RGNA 5BO4B 2WXQA 1PUTA 2D10A 4PK1A 4A3OA 3EFUA 1Q0WB 1ET9A 2DYBA 1I4HA 2L8JA 4FJYA 2BS3B 3SFDB 3VHTC 2INCC 3LB8C 2N7DA 4MGYE 1JWBD 2WHIA 1IBXA 3PRZA 2UWQA 4FADA 4HPMB 4IOIE 3C0RB 3UQBA 1VLBA 4HKQA 2AL3A 3W5VB 2BT6A 2L76A 2L0TA 3P2BA 4MJSB 2MJ3A 2FIFA 2VRRB 1V5TA 3VTVA 2RPQA 2GB1A 4MT5A 2J7QB 4US8A 5HKHA 3P4SB 2INDC 4RM9A 2PW9A 2WXPA 3MC8A 1XLNA 3MFGA 4HLEA 2PJHA 5LNK1 4II3B 2LRWA 2QILA 5EE3A 4D2KA 3AH7A 2OJRA 1T3QA 3JVZX 4XZ4A 3NJTA 3P4PB 1JMLA 4EOYA 3ML9A 4JE3B 2KC1A 4W9DA 1B1ZA 1V80A 2V3NA 5GMVA 4MSQB 3A4SC 5EE1A 2IJ0A 2KQSA 2HJ8A 1ZW7A 4XC2A 2A5UA 1KJTA 2BPSA 4FN2A 4LNOA 1QQRA 3PREA 5FR6A 4A9AA 2IY1B 1FRRA 1MPEA 2Y5CA 2FCNA 2B3AA 2H89B 4M8MA 3W1YA 3HIZA 1TYGB 2RPVA 4B0MA 2VH1A 2YEPB 5C23A 1MHXA 3A4RA 4B95A 4KZ0A 2TSSA 2JY6A 1IUEA 3DBLI 4W9KA 1L6VA 1F1HA 2IO1B 4ZRPA 1QF6A 5EE0A 3A9KB 4IM0A 1NENB 4W9JA 1V49A 5TR5A 3LXFA 1YN3A 1TTNA 4WAAA 5HFYA 1LO5D 2JU6X 3PV1A 3A9JA 4XWTA 2IO2B 1SEBD 2K22A 2BB6A 3PZDA 4HJKA 3APDA 1ENFA 4Q2JA 4DXGA 3RNGC 3QA8A 3DPDA 4HPLB 1TGZB 3VR8B 3N1ZC 2W55A 3AE5B 3R3MA 3ZNHB 3AE2B 1VCBA 5HI1A 3H1UA 4NNJB 2MBQA 1LQBA 3H9DA 1SE2A 4LCDE 2LHEA 3RNFC 2N0SB 2OJWA 1ZP0B 3Q8EA 4WWOA 1CZPA 1YNTE 2WNMA 3R8BA 3U4EG 4M0WA 3W5UB 1T0QC 4ANVA 4MELA 2BYVE 4EFOA 1HZ5A 4YXDB 2XN9C 2DHZA 1XLQA 1J19A 2DZJA 4JPSA 4HJGE 5MPOA 1N63A 2PE9A 4IG7B 1FXTB 3ECIA 3ZJVA 1GNUA 1V1PA 3RULA 3QJZA 2KMMA 2Z0EB 2K8HA 3Q8CA 2BYTA 2L83A 2PVGC 3PT2B 4HROA 4AQ7A 2JZPA 4LJOB 1TY2A 2JQRB 2AQ2B 4WJQA 2X38A 4FLHA 4NY0A 1KOTA 5E6PA 1MVKA 2FCSA 1N62A 1D5XC 1Y8RC 4X57B 1XCQL 2LVOA 3U30A 1E10A 4ZYNA 2L3ZA 1ZXHA 2N1VA 3VAWA 1RRBA 1YJIA 4DDID 3IAM1 1P1AA 1SE4A 4AUQC 2CHXA 2K6DB 2LASA 1V81A 3AEEB 1DOXA 4KKIA 1UWXA 2J0MA 2NPTB 4J3OD 5KHOA 4RGMA 4BZAA 4MSMB 1NI3A 3O13A 1JROA 2IPKD 3PSEB 1ZUD2 1D6EC 3X0WA 4GDLA 2XBBC 1WM3A 1V8CA 1RYJA 2MH7A 2V4LA 2O2VA 2WDRB 2KJRA 3TL5A 3BYTB 2BVCA 5D7GA 4RF1A 3KUDB 1KH0A 2CKHB 2SEBD 3OLMD 2JSVX 3AEDB 2FCMA 2N4FA 2ZNVC 4AWJA 4BKSD 1F52A 3B08A 3NUHB 1WGKA 4MH8A 3DVGY 4RGOS 3OG5A 2JXTA 3AE4B 5FKAC 2KN5A 3V3XA 1NEKB 3CSTA 3JW0X 2PE6B 4WQOB 3B9JA 3NOBA 3VUYA 1WRDB 3QHTA 2M4NA 2PPHA 3TEWA 3TEZA 4WURA 4F1SA 2GBNA 3DVNU 2BTEA 3EUB2 5G2NA 3JYUA 3UI3A 4KDLB 5AUIA 3VH4B 1OQQA 3HVDA 3GZNB 1UF0A 4ACFA 2Z0DB 3NY5A 2MJDA 2W54A 2JXXA 5DPTA 4P16A 2K0PA 2BBCA 1L6UA 2KMCA 3RNCC 3NS8A 3ZO5B 4ZYSA 1WR1A 1SGHA 2MCNB 3X23A 1WWTA 5CTRC 2WXLA 1UUPA 1DOYA 2WQYB 2KJ6A 1EWYC 3AU4A 4MGZE 1J0GA 4C56C 4A55A 2ZNVB 1HTOA 4KV2A 3QK0A 2D3AA 3Q3NC 1MHHE 5IKCM 1ZPSA 1TKGA 2AEHA 2ASQA 3VDZA 1UH6A 3DWMA 4YT0B 4RFBA 2BKRB 4MGIE 3W9CB 3H7PB 4GN1A 5FR3A 4HDOA 3U8ZA 2ZPYA 2INNE 1E9MA 2D3GA 4YTPB 3AE3B 1AN8A 4K3BA 5C1ZA 1WH3A 3RNAC 5BMIA 1YMHE 4FHKA 2VH2A 1WFYA 4IWQA 4ZRQA 4FXCA 1CJEA 3KLSX 3V6EB 2KD0A 3PZ8A 1L5PA 3ETRA 4L23A 3NZUA 1XT9B 5DPSA 3ZXVA 4JGHB 3ZKJC 2CHWA 1PGBA 3CF6E 2M0AA 3SR6A 2MP2A 1SXTA 3HHMA 2ONQA 1E8XA 1WE6A 1WXVA 5D3IB 3A33B 1IBXB 1FM0D 3SEBA 1ZDXA 1WE7A 2IGGA 3RD2A 2WXMA 4YWGG 2KX0A 2I1JA 4GXBA 3DVNV 2QIEB 2MBBB 1XQQA 1I4GA 1C78A 4F8CB 4BBNC 1WZ0A 2D07B 3AXCA 3VH3B 2IYDB 1FCCC 4DHZB 2KO3A 4ZRKA 1J7AA 1UBQA 3GE3C 2KFKB 5JHBA 2O6VA 3TCAA 5D94A 3V6CB 4OVVA 2WXIA 4MM3A 3CMMB 3UGBB 2KDMA 3GZNI 2WXNA 3QC8B 1RAXA 2LUMA 4ZHOA 1E6EB 3IVFA 2W3RA 1PDXA 1KF6B 3JSVA 2GBJA 1JCKB 2JF5A 3ZRFA 1YQBA 3KQ4A 3L54A 3Q8BA 4HKZE 1T0SC 3U7ZA 3Q3OC 4CHKA 1XCTL 3PPAA 4W9LA 2V0GA 2R61A 3OWEB 1LXDA 3R7RA 1GUAB 1V2YA 1S1QB 2J42A 3AEGB 1ZGUB 2AX5A 2UU7A 2KDFB 1KLGD 1L7YA 4W9IA 2M17A 5L95C 4KGTA 2LZ6A 2CU3A 4XDCA 3HVZA 2LUEA 2JPHA 5BYSA 3ABVB 2KX3A 3VTUA 4W9GA 2E6XA 3KUCB 1FIQA 3SHQA 2I2YA 2N9KA 1UGJA 2C5LC 3APCA 3SU8X 3L10B 2RMMA 3FILB 3P63A 2X8XX 1IGCA 3UQAA 1FNUA 2XNAC 4LLGM 1T0RC 3AM9A 2NTSA 3BK1A 4IWPA 4K7SA 4YSXB 1WYGA 2LGXA 2FUHB 4I6NB 4A6QA 4G0NB 1NVID 3ZNID 2L32A 4GDKA 2GRIA 3PLVA 1FFUA 2MEKA 1ZDVA 3AE7B 2KHWB 2NS5A 3HM3A 3AB5A 4LTUA 2MHJA 4JWUC 2RDBC 4A20A 4BFRA 4TKNA 1WGYA 3Q8AA 3NRZA 4YSYB 4QAYA 3A1QA 3AEFB 5L83A 2LGDA 3TJPA 2AWTA 2NTTA 4IW0A 4W9HA 4OHJA 2QCZA 1V1PB 1CQVA 4ICUA 5HHDG 2WP9B 1WSPA 4PS7A 4KGSA 4KSLC 1R4MB 1PYWD 1BXTA 2J0JA 4XDDA 2OEDA 1M4VA 3LJ3A 1QOGA 3R7QA 3TIXA 2GI9A 5JZEB 1UZXB 2BWFA 3NVVA 3KW5B 2KQ7A 3DBRB 3NZ3A 3VUWA 4KZCA 1ZE3D 5IA7A 4P6VF 1SE9A 1JWSD 3B1LX 3NVWA 1Q10A 4AS1A 3QARA 1AW7A 1UGMA 2KWCA 1TS4A 1RLFA 4IDIA 3DBHB 3DWGC 1FPYA 2Z8LA 2UYZB 1A70A 4LNIA 3KUZA 4XYCA 1F2RC 1L4DB 3PRMB 4HEA1 3UINB 1C4AA 3ZYYX 2CS4A 2Y3AA 5J17A 1D5ZC 3VR9B 3P1MA 3WA0A 1DYQA 2O2VB 1U4AA 2XK5A 5LXHA 2G9HD 2KZRA 3HK0A 5J18A 1KLVA 2NBVB 3ZJTA 1FXAA 1UBIA 4HCNB 3MJWA 4HK2A 2G4DB 3PLUA 5EDSA 2PLPA 1T6BX 3L4PA 3QX1A 2IBIB 2M56B 2IO0B 4KIKA 2IO3B 1V9JA 2HE7A 2KYWA 3AV8A 4PS8A 2HJ1A 3C19A 4ZRJA 1YIWA 1GG3A 3AE8B 2LGIA 2JT4B 3K9PB 4WH4A 1I35A 3AU5A 5I4DA 3Q3MC 2BB5A 5E6JA 4S17A 1WXSA 2ZVOA 2W9NA 1AARA 3AI5A 4PYZA 4JLCA 2KLGA 3KVFB 2HTME 4HVBA 4ZOHC 3HRDD 1N6ZA 1GC7A 4P7IA 1N60A 4EEWA 2LMCA 3IT6B 2WXOA 3S2AA 4RCOA 2VZKB 4P1CC 2KN4A 2DX5B 3H6NA 4EE2A 1HQRD 4I6PA 1Z5SB 3PTFC 4FBJB 4XGAB 4A90A 2KWVB 1WX8A 1SIJA 3EFCA 3N30A 2DWQA 3BVMA 3V61A 2DAJA 3DBRI 2KVRA 2KWDA 1PGAA 3D32A 2DENB 2KTRB 5IAAC 2LVQA 1XF5L 2HTHA 1SF0A 1WX7A 3AMZA 3RUIB 1H4RA 1H8CA 1YOVB 5IN7A 1MJDA 2LHDA 4ANWA 2XEWA 2MSED 3QQ8B 3B2GA 2K5PA 3KYDD 2KTFA 4TUUA 4DQOC 4LDTD 1JRUA 3GB1A 3GE8C 4EZJA 4IM3A 3NVZA 2RR9A 1TS3A 2KLCA 1SE3A 1I42A 1OTRB 4NAMA 4WJNA 4NPNA 3BZDB 3VTWA 1QOFA 5CHWA 3SDLC 1EWCA 4HDQA 2JZZA 4J6IA 1ROEA 1I4XA 1P3QU 3DQVA 4FULA 2JUOA 3PS6A 3IHPC 2MP2B 5IP4D 2JYEA 1V5OA 1PFDA 1IGDA 4A3PA 2JRIB 1F0ZA 1WMHA 1YD8U 4E71A 2V3SA 4DK5A 4BKGA 1YQ4B 3B2FA 3QIJA 2N9LA 1C76A 3RN9C 2B76B 1WGGA 5AZFA 3IXSA 4NAWA 2N1WA 3IBEA 1AYFA 1NYQA 2DAFA 1EF1A 1UELA 5EE9A 3TBLD 2LJ5A 1DOIA 2V9HA 3EGRA 4GSWA 2O6VB 4LK0M 1JWAD 4II2B 4OZBA 2M8SA 4DXAB 3MP9A 3VUXA 2CJOA 3DCGA 2WXFA 4EZKA 3SFEB 2CR5A 1OFFA 4URKA 3E56A 2MRPA 4KDIC 3MTNB 3MC0B 3ML8A 3JSVB 1YJJA 3WANA 3T3NA 4OVZA 3B0AA 3ZXRA 2MWSB 4XWWA 3PO0A 4W9FA 4LJPB 4TSSA 3LDZE 3BY4B 5AZGA 4ASWC 1PGXA 5D3DA 4MGKE 1N61A 5BYQA 4IKGA 2BS4B 2M1MA 2JYTA 2EMSA 4IC7B 2G3QB 4G50A 3W2DA 2E3TA 1VD2A 2JRHA 5T8IA 1IP9A 3ZTCA 3RNBC 3RNEC 2INPE 2WXRA 2AYOB 1HE8A 1F9JA 2K8BA 1MG8A 3WIMA 2C7MB 2R2QA 1ESFA 1C1YB 4E3CA 3FC4A 4OVUA 3OJ3A 3FAHA 4ZRIA 3BINA 1GB4A 4HRSA 1RFAA 1TS5A 4REZA 1TBEA 2KAJA 1TS2A 1K8RB 1TZ1A 2D2QA 4ARCA 2KDBA 2DBYA 2KDIA 2QDFA 1WF9A 1L4ZB 1A5RA 2MQJA 1RM6C 4PS3A 3UF8A 2OOBB 1YN5A 4KVGB 4TV3A 3APFA 1TIFA 4OZAA 2G4SA 2I38A 3ZDTA 1I4PA 2MBOA 3WAMA 2N7EA 2D11A 2FUG1 1P0RA 2K6QA 3IFWB 1TKEA 3EA6A 1QOAA 1ZOYB 4TMAB 2DYMA 4NQKE 3NHEB 3ZQ4A 4F7ZA 2LJIA 2W82A 3IAS1 1KFYB 2RSUA 4GLSC 2GBMA 3T3OA 2NVUI 1L0VB 4GU2A 1WGDA 2IGHA 4RMAA 1XLOA 2VZKD 2V1YA 1WI0A 2KKCA 4UDUC 1P98A 4C4VA 5TSSA 3FKYA 3EECA 1MG4A 3DDCB 1E7VA 2NR2A 3ZTDA 1WJUA 4WIPA 4AJYB 3DHHC 3ZRCA 1I7HA 4BAXA 5G5GA 3KWVA 3U52E 3T9LA 5C2TB 1FNVA 1EF5A 2NCNA 1NDDA 1UD7A 2YVCA 3WAOA 2QSDA 2Y5PA 4B6WA 2WXKA 3AE6B 4LDTB 2G1EA 3R66C 1KLUD 3PGEA 4C00A 1Q5WB 3Q3JA 1WYWB 2LGSA 1OQRA 4FJVB 4LNKA 2BWES 4XE0A 2C60A 1FFVA 2DNFA 2XK5B 1WJNA 2DYOA 3NVYA 2BYEA 5E6NA 1Z2MA 2KNBA 1GOZA 3IG3A 4L2YA 2ICIA 1CMXB 4DHJD 2L1AA 5IOIA 3J9CA 4W9CA 4HPPA 2KC2A 1ZKHA 5H8YE 3A9JB 4OZCA 3ENEA 1NYRA 4KIKB 2WX0A 3N1XC 3T8MA 4YTNB 2PMVA 2YEPF 2WGSA 1N5WA 3E9SA 3H8HA 2IDYA 3KYCD 2KK8A 3PHWB 3M63B 1R4NB 2ZW1A 3CIRB 2FNJB 2NMQA 3OAWA 3Q6BA 2KANA 3H7SA 1GB1A 1FRDA 4CYEA 2MJEA 4E74A 1V86A 1VJKA 1C77A 1KM7A 2K3UA 3Q69A 4MACA 4M0WB 5BMGA 4IUMB 5C3JB 1JWMD 4DDGD 4NJ7A 1C79A 4LNNA 1XXGA 2FIDA 3NG0A 3BVGA 5DPWA 5G5HA 1E0ZA 1C9FA 1WM2A 4NJ6A 2O6VD 1T0YA 2WU2B 2JZ3B 3HUIA 4HCPB 1E5WA 1ZXIA 4FA6A 4C80A 2KOXA 1SJHD 3MHZA 2K8CA 1FXIA 3PRPB 4GB9A 4NJCA 3VFKA 4FHJA 4NZLB 4N59A 3DHGC 1TJEA 4O1NA 2PEAA 2K25A 4H2AA 3ZW3A 2V3PA 1HXYD 2ZCCA 3MJ5A 5HG2A 2GLSA 4AOFA 1TZOA 2OHFA 2LXAA 1G6JA 2RDGA 2EKEC 5D2MB 5BMHA 2KFKA 1YJ1A 2N7JA 2BF8B 1WZ3A 4WWPA 3ZLZA 3RZFA 1XLPA 4MH0E 2N9EB 3P4QB 5CHVC 2SAKA 1R7SA 4KX6B 2KMAA 2K1FA 4JQWC 3I57A 1QLBB 1XD3B 1VZ6A 1N5XA 2KFJA 3C8YA 3UIPB 4GDLB 4MDKE 2C7HA 3U2SC 1WJ4A 2WXHA 1XO3A 2N9PC 3DHIC 5DCNA 2AQ3B 3KH0A 3RPFC 4BKTA 3PHXB 3IT4B 1WMHB 3N20C 3ZJUA 3ZNGC 4W9EA 4DBGA 2FE8A 5LLIA 4N6EB 1YQ3B 4RNAA 4EZLA 2R2OA 1WGRA 2C7NB 4HWIB 2RGFA 2ZCBA 5H92C 1SJED 2EMTA 4K81A 2LGYA 4NAWB 1R4NI 1LGRA 1P7EA 1SSNA 3AECB 1WIAA 2GBRA 4RGTA 3L16A 3EC8A 1WR6E 3ZIMA 2KT7A 1S3SG 3M95A 4KGRA 3BYYB 2MLBA 3BVZA 3RFZB 4CO7A 1E90A 1YX5B 2WS3B 3URYA 4XX5A 3I9V1 3M3JA 3L0WB 1NI2A 3VRBB 4IM2A 3ZDMC 3FILA 3TUOA 3VVWB 3TSSA 1FNWA 2ZW0A 1L2NA 4BKSA 3W1SA 1K51A 2WDVB 3AE1B 4K7UA 1OQYA 3WAPA 2DZMA 1L0XB 1XEEA 1YX6B 2PTLA 1R4MI 4ANXA 4OW0A 3BWUD 2IGDA 4LNFA 2JWUA 1T5XD 2KWUB 4L1BA 4AP4C 1D3ZA 1QT9A 1C4PA 2WDTB 2ZJDA 3Q3FA 2H88B
chains in the Genus database with same CATH topology
4HLEA 1E8WA 2PJHA 3B0AA 4II3B 2LRWA 2MWSB 3DOWA 4W9FA 2OJRA 4LJPB 3SD5A 4JIOU 3JVZX 4XZ4A 4EOYA 3LDZE 4MJSA 3BY4B 3IVFA 5AZGA 3ML9A 5CX3A 3RT3B 1GJZA 2L0FA 2KC1A 3N32A 4ASWC 4W9DA 1V80A 5GMVA 3JSVA 4MSQB 2KJHB 2GBJA 3A4SC 3DVGX 4MGKE 3GOEA 2JF5A 1IYFA 2KQSA 2G45B 2HJ8A 1ZW7A 1YQBA 4XC2A 3L54A 3DBHI 2M1MA 3ZRFA 5AZHA 4CHKA 2A5UA 3PPAA 4W9LA 2EMSA 5AEKB 1KJTA 2BPSA 4FN2A 1LXDA 4IC7B 3R7RA 1GUAB 1V2YA 4DHJB 1S1QB 2G3QB 3PREA 5FR6A 4G50A 1VD2A 1ZGUB 2JRHA 2NBUA 2IY1B 2FCNA 2B3AA 5E6OA 1IP9A 3L08A 4M8MA 1WX9A 3ZTCA 2KDFB 1WJ6A 3W1YA 3HIZA 1L7YA 4W9IA 2DZIA 1ISNA 2AYOB 2M17A 5C23A 1HE8A 1F9JA 5L95C 2LZ6A 2K8BA 2NBWB 3A4RA 4GOCA 4B95A 4KZ0A 2JY6A 3DBLI 4W9KA 2LUEA 1MG8A 2JPHA 3WIMA 2KXJA 2KDEB 2C7MB 2KX3A 2R2QA 3RZWC 3VTUA 1C1YB 4W9GA 4E3CA 3KUCB 2IO1B 3SHQA 2L7RA 4OVUA 3OJ3A 2IZVB 4ZRIA 2I1KA 3BINA 2RD0A 4MEMA 3A9KB 2C5LC 3APCA 3M62B 4IM0A 3SU8X 1RFAA 4W9JA 3L10B 4YL8A 1V49A 4HXDA 1TBEA 4TQ1A 4AJWA 1K8RB 5TR5A 1TZ1A 2D2QA 3UQAA 1TTNA 2CHZA 2KDBA 4G3XB 2KDIA 4N9F4 4IWPA 4K7SA 3V60A 4WAAA 1WF9A 2GBKA 4ANUA 4WJOA 3PV1A 3A9JA 2LGXA 4I6LB 1A5RA 2IO2B 2FUHB 4I6NB 2MQJA 3PZDA 2QHOA 4G0NB 4PS3A 4HJKA 3APDA 3DBSA 3ZNID 3UF8A 4GDKA 3A9KA 1V6EA 2OOBB 1M94A 4KVGB 4TV3A 3APFA 3PLVA 3QA8A 3DPDA 2G4SA 4HPLB 2MA9B 1TGZB 3ZDTA 5J2RA 2MBOA 3WAMA 2KHWB 2N7EA 2D11A 2NS5A 3HM3A 3R3MA 2WWZA 3ZNHB 1P0RA 1E7UA 1VCBA 2K6QA 3IFWB 3QAQA 2LD9A 3H1UA 4WWNA 2AL6A 4TKNA 4A20A 4BFRA 1GC6A 1WGYA 2MBQA 4NNJB 1LQBA 3H9DA 2DYMA 4LCDE 4NQKE 3A1QA 3NHEB 1EUVB 5L83A 2LGDA 4GMVA 2LVPA 4WWOA 3TJPA 2AWTA 4F7ZA 4IW0A 4W9HA 3VXWA 2RSUA 4ICUA 2GBMA 3WALA 2NVUI 4PS7A 4GU2A 1WGDA 4ANVA 4KSLC 4MELA 5G55A 2BYVE 4EFOA 4RMAA 2V1YA 1WI0A 2KKCA 1WXAA 3ZUNA 1P98A 4G11A 2DHZA 3QCAA 2J0JA 3O65B 2WX1A 3EECA 4KSKC 1J19A 3LJ3A 2DZJA 4IWOA 3R7QA 2MBEA 3TIXA 2PE9A 3DDCB 4IG7B 5JZEB 1E7VA 2NR2A 3ZTDA 1FXTB 1UZXB 1WJUA 3ECIA 2FCQA 1GNUA 4AJYB 3RULA 4DHZE 3ZRCA 3QJZA 2BWFA 2BKFA 2DZKA 2Z0EB 2MBHA 3KW5B 2KQ7A 3T9LA 4FJZA 4EUTA 2K8HA 1EF5A 2NCNA 3VUWA 1NDDA 1UD7A 3PT2B 2YVCA 1WXMA 3EHVA 3ZNZB 3WAOA 4KZCA 4LJOB 4B6WA 5IA7A 4LDTB 2MX2A 2WYQA 1SE9A 3R66C 4FLHA 4NY0A 3PGEA 4WJQA 3B1LX 1KOTA 4BOSC 5E6PA 1Q5WB 1WGHA 3Q3JA 1WYWB 1BT0A 3TMPB 2FCSA 1Y8RC 2ZVNA 4X57B 4FJVB 2BWES 3QARA 2LVOA 2C60A 3U30A 2ZEQA 3ZVVA 4ZYNA 2XK5B 1UGMA 1WJNA 2L3ZA 2KWCA 2DYOA 2N1VA 3VAWA 1OEYJ 2BYEA 1RLFA 1RRBA 1Z2MA 2KNBA 5E6NA 4DDID 3IG3A 1P1AA 4AUQC 2CHXA 2K6DB 2UYZB 2LASA 1C3TA 1CMXB 3KUZA 2KTRA 1LFDA 3VQIA 1V81A 3PRMB 4DHJD 3UINB 4W9CA 3I3TB 1IPGA 2CS4A 2KC2A 1ZKHA 2J0MA 3A9JB 5J17A 2NPTB 3ENEA 2FAZA 3WA0A 2O2VB 1U4AA 2XK5A 5KHOA 5LXHA 2KZRA 1NBFC 3HK0A 4KIKB 4MSMB 5J18A 1KLVA 2WX0A 2LRUA 2NBVB 3PSEB 4GDKB 3T8MA 3X0WA 2IY0B 2C9WB 4HCNB 1UBIA 4GDLA 3MJWA 4HK2A 3V62A 2XBBC 1WM3A 2G4DB 5D6JB 3KYCD 2KK8A 3PLUA 3PHWB 5EDSA 4BBNF 1E8ZA 3QX1A 3M63B 2NPTA 2IBIB 2FNJB 2V4LA 2O2VA 2IO0B 4B9KA 2YLMA 3OAWA 2IO3B 4KIKA 1OGWA 2KJRA 3TL5A 1V9JA 2HE7A 3K9OB 2KANA 4JL9A 3H7SA 5D7GA 3KUDB 3A1QB 2CKHB 4PS8A 2Z59B 4CYEA 3OLMD 4ZRJA 4E74A 1V86A 4EKUA 2FCMA 1Q1OA 1YIWA 1GG3A 5KHQA 2N4FA 1KM7A 3PVLA 2ZNVC 4AWJA 4GIVA 4BKSD 4M0WB 4IUMB 4M8NA 3B08A 2JT4B 1P9DU 3K9PB 4DDGD 4NJ7A 1I35A 3AU5A 2M0XA 2FIDA 3RYTA 1WXSA 2ZVOA 3DVGY 2W9NA 1AARA 1EO6A 2KN5A 3AI5A 4PYZA 5DPWA 2GOWA 4JLCA 1WM2A 4NJ6A 2KLGA 2HD5B 3CSTA 3JW0X 3KVFB 2PE6B 3AULA 2O6VD 1T0YA 3QWZB 4K1RB 4HVBA 2A4ZA 4WQOB 3NOBA 3VUYA 2GMIC 1WRDB 2JZ3B 3QHTA 4DWFA 1GC7A 2M4NA 4HCPB 1E5WA 2PPHA 4P7IA 4GGQA 4FA6A 4PYUA 2N9XA 4EEWA 4F1SA 2KOXA 3S2AA 2K8CA 3PRPB 4GB9A 2GBNA 3ONSA 3VFKA 2DX5B 3DVNU 3H6NA 4FHJA 4I6PA 5G2NA 3JYUA 5JHAA 1Z5SB 3PTFC 4FBJB 3N3KB 4KDLB 4BVUC 2PEAA 1PQSA 1QZEA 2K25A 2KWVB 3NZSA 1WX8A 3VH4B 3ZW3A 4BOZB 2ZCCA 3N30A 1E8YA 2CU1A 2Z0DB 3NY5A 1LM8B 3L13A 2JXXA 5DPTA 4AOFA 2KMCA 3V61A 2DAJA 2K39A 3DBRI 2KVRA 3NS8A 2LXAA 5CHFA 1G6JA 2EKEC 5D2MB 3ZO5B 2L05A 3D32A 2DENB 2KTRB 1WR1A 3W1SC 1SGHA 2LVQA 5IAAC 2KFKA 1YJ1A 2MCNB 3UIOB 3X23A 2JWZA 2HTHA 1WX7A 4TQ0A 4ZDVA 5CTRC 2BF8B 3RUIB 1H4RA 1WZ3A 2REXA 4WWPA 3ZLZA 1H8CA 3RZFA 2KJ6A 2LXCA 2N9EB 4MH0E 3ALBA 3AU4A 5LXIB 3L17A 5CHVC 4ANWA 4MGZE 1SIFA 1J0GA 2XEWA 2KMAA 2K1FA 2MSED 3QQ8B 4JQWC 2ZNVB 4KV2A 3KYDD 2KTFA 4TUUA 4LDTD 1XD3B 3QK0A 1JRUA 2KFJA 3UIPB 2LWPA 2ZZPB 4GDLB 4MDKE 2C7HA 2AEHA 4EZJA 1WJ4A 2ZPNA 2ASQA 4IM3A 4RM8A 2RR9A 3VDZA 1UH6A 2N9PC 2KLCA 2LI5A 2BKRB 1X1MA 5DCNA 4MGIE 1I42A 1OTRB 3KH0A 4ICVA 3H7PB 4WJNA 4NPNA 4GN1A 3HM6X 4HDOA 3VTWA 4BKTA 3U8ZA 2BGFA 3PHXB 2ZPYA 5CHWA 1WMHB 3OJ4B 4K7WA 4HDQA 3SDLC 3ZNGC 4W9EA 4DBGA 2JZZA 2D3GA 4J6IA 5LLIA 4EZLA 2R2OA 5C1ZA 1WGRA 1WH3A 1P3QU 2C7NB 3DQVA 4FULA 2JUOA 4HWIB 2L00B 2RGFA 2JVCA 1OEYA 3IHPC 3PS6A 4FHKA 2MP2B 2ZCBA 1WFYA 2MW5A 1V5OA 4IWQA 3H7PA 2EMTA 4WJPA 4K81A 2LGYA 4A3PA 2JRIB 3MHSD 4NAWB 1R4NI 5DPRA 1WMHA 1YD8U 5JH5C 4E71A 2V3SA 1WIAA 2GBRA 4NQLB 3L16A 2BYFA 4BKGA 3EC8A 3V6EB 4DK5A 2KD0A 1WR6E 3ZIMA 1J8CA 2Y5BB 1S3SG 3U7DA 3M95A 3QIJA 2J0KA 3NZUA 1XT9B 5DPSA 4JGHB 3ZKJC 2MLBA 2CHWA 3CF6E 4CO7A 1E90A 1YX5B 2MP2A 3CSFA 3HHMA 1WY8A 1WGGA 1E8XA 1WE6A 1WXVA 3RCZA 4XX5A 5AZFA 3A33B 4NAWA 5BO4B 2N1WA 3M3JA 3IBEA 3L0WB 2DAFA 1WE7A 1NI2A 1EF1A 2D10A 1UELA 4IM2A 3ZDMC 3TBLD 4A3OA 3VVWB 3EFUA 2LJ5A 1Q0WB 2DYBA 2L8JA 3RD2A 4FJYA 2KX0A 4GSWA 2O6VB 2I1JA 4GXBA 4II2B 3VHTC 3DVNV 1L2NA 2M8SA 4DXAB 4BKSA 2MBBB 1XQQA 2N7DA 4MGYE 3VUXA 3W1SA 3PRZA 2UWQA 4K7UA 1OQYA 3WAPA 4F8CB 2DZMA 3DCGA 4FADA 4BBNC 4EZKA 4HPMB 1YX6B 1WZ0A 1R4MI 2D07B 2CR5A 3AXCA 3C0RB 3VH3B 2IYDB 4ANXA 4DHZB 4URKA 3UQBA 2AL3A 2KO3A 2L76A 4ZRKA 1UBQA 2MRPA 4KDIC 2KFKB 2L0TA 5JHBA 3P2BA 2O6VA 2KWUB 3MTNB 4MJSB 3TCAA 5D94A 2FIFA 2VRRB 1V5TA 4AP4C 3VTVA 2RPQA 1D3ZA 3V6CB 4OVVA 3ML8A 2WDTB 4MM3A 5HKHA 2J7QB 2ZJDA 3CMMB 3JSVB 3Q3FA 3UGBB 3GZNI 4RM9A 3WANA 3QC8B 1RAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HLE A;  1E8W A;  2PJH A;  3B0A A;  4II3 B;  2LRW A;  2MWS B;  3DOW A;  4W9F A;  2OJR A;  4LJP B;  3SD5 A;  4JIO U;  3JVZ X;  4XZ4 A;  4EOY A;  3LDZ E;  4MJS A;  3BY4 B;  3IVF A;  5AZG A;  3ML9 A;  5CX3 A;  3RT3 B;  1GJZ A;  2L0F A;  2KC1 A;  3N32 A;  4ASW C;  4W9D A;  1V80 A;  5GMV A;  3JSV A;  4MSQ B;  2KJH B;  2GBJ A;  3A4S C;  3DVG X;  4MGK E;  3GOE A;  2JF5 A;  1IYF A;  2KQS A;  2G45 B;  2HJ8 A;  1ZW7 A;  1YQB A;  4XC2 A;  3L54 A;  3DBH I;  2M1M A;  3ZRF A;  5AZH A;  4CHK A;  2A5U A;  3PPA A;  4W9L A;  2EMS A;  5AEK B;  1KJT A;  2BPS A;  4FN2 A;  1LXD A;  4IC7 B;  3R7R A;  1GUA B;  1V2Y A;  4DHJ B;  1S1Q B;  2G3Q B;  3PRE A;  5FR6 A;  4G50 A;  1VD2 A;  1ZGU B;  2JRH A;  2NBU A;  2IY1 B;  2FCN A;  2B3A A;  5E6O A;  1IP9 A;  3L08 A;  4M8M A;  1WX9 A;  3ZTC A;  2KDF B;  1WJ6 A;  3W1Y A;  3HIZ A;  1L7Y A;  4W9I A;  2DZI A;  1ISN A;  2AYO B;  2M17 A;  5C23 A;  1HE8 A;  1F9J A;  5L95 C;  2LZ6 A;  2K8B A;  2NBW B;  3A4R A;  4GOC A;  4B95 A;  4KZ0 A;  2JY6 A;  3DBL I;  4W9K A;  2LUE A;  1MG8 A;  2JPH A;  3WIM A;  2KXJ A;  2KDE B;  2C7M B;  2KX3 A;  2R2Q A;  3RZW C;  3VTU A;  1C1Y B;  4W9G A;  4E3C A;  3KUC B;  2IO1 B;  3SHQ A;  2L7R A;  4OVU A;  3OJ3 A;  2IZV B;  4ZRI A;  2I1K A;  3BIN A;  2RD0 A;  4MEM A;  3A9K B;  2C5L C;  3APC A;  3M62 B;  4IM0 A;  3SU8 X;  1RFA A;  4W9J A;  3L10 B;  4YL8 A;  1V49 A;  4HXD A;  1TBE A;  4TQ1 A;  4AJW A;  1K8R B;  5TR5 A;  1TZ1 A;  2D2Q A;  3UQA A;  1TTN A;  2CHZ A;  2KDB A;  4G3X B;  2KDI A;  4N9F 4;  4IWP A;  4K7S A;  3V60 A;  4WAA A;  1WF9 A;  2GBK A;  4ANU A;  4WJO A;  3PV1 A;  3A9J A;  2LGX A;  4I6L B;  1A5R A;  2IO2 B;  2FUH B;  4I6N B;  2MQJ A;  3PZD A;  2QHO A;  4G0N B;  4PS3 A;  4HJK A;  3APD A;  3DBS A;  3ZNI D;  3UF8 A;  4GDK A;  3A9K A;  1V6E A;  2OOB B;  1M94 A;  4KVG B;  4TV3 A;  3APF A;  3PLV A;  3QA8 A;  3DPD A;  2G4S A;  4HPL B;  2MA9 B;  1TGZ B;  3ZDT A;  5J2R A;  2MBO A;  3WAM A;  2KHW B;  2N7E A;  2D11 A;  2NS5 A;  3HM3 A;  3R3M A;  2WWZ A;  3ZNH B;  1P0R A;  1E7U A;  1VCB A;  2K6Q A;  3IFW B;  3QAQ A;  2LD9 A;  3H1U A;  4WWN A;  2AL6 A;  4TKN A;  4A20 A;  4BFR A;  1GC6 A;  1WGY A;  2MBQ A;  4NNJ B;  1LQB A;  3H9D A;  2DYM A;  4LCD E;  4NQK E;  3A1Q A;  3NHE B;  1EUV B;  5L83 A;  2LGD A;  4GMV A;  2LVP A;  4WWO A;  3TJP A;  2AWT A;  4F7Z A;  4IW0 A;  4W9H A;  3VXW A;  2RSU A;  4ICU A;  2GBM A;  3WAL A;  2NVU I;  4PS7 A;  4GU2 A;  1WGD A;  4ANV A;  4KSL C;  4MEL A;  5G55 A;  2BYV E;  4EFO A;  4RMA A;  2V1Y A;  1WI0 A;  2KKC A;  1WXA A;  3ZUN A;  1P98 A;  4G11 A;  2DHZ A;  3QCA A;  2J0J A;  3O65 B;  2WX1 A;  3EEC A;  4KSK C;  1J19 A;  3LJ3 A;  2DZJ A;  4IWO A;  3R7Q A;  2MBE A;  3TIX A;  2PE9 A;  3DDC B;  4IG7 B;  5JZE B;  1E7V A;  2NR2 A;  3ZTD A;  1FXT B;  1UZX B;  1WJU A;  3ECI A;  2FCQ A;  1GNU A;  4AJY B;  3RUL A;  4DHZ E;  3ZRC A;  3QJZ A;  2BWF A;  2BKF A;  2DZK A;  2Z0E B;  2MBH A;  3KW5 B;  2KQ7 A;  3T9L A;  4FJZ A;  4EUT A;  2K8H A;  1EF5 A;  2NCN A;  3VUW A;  1NDD A;  1UD7 A;  3PT2 B;  2YVC A;  1WXM A;  3EHV A;  3ZNZ B;  3WAO A;  4KZC A;  4LJO B;  4B6W A;  5IA7 A;  4LDT B;  2MX2 A;  2WYQ A;  1SE9 A;  3R66 C;  4FLH A;  4NY0 A;  3PGE A;  4WJQ A;  3B1L X;  1KOT A;  4BOS C;  5E6P A;  1Q5W B;  1WGH A;  3Q3J A;  1WYW B;  1BT0 A;  3TMP B;  2FCS A;  1Y8R C;  2ZVN A;  4X57 B;  4FJV B;  2BWE S;  3QAR A;  2LVO A;  2C60 A;  3U30 A;  2ZEQ A;  3ZVV A;  4ZYN A;  2XK5 B;  1UGM A;  1WJN A;  2L3Z A;  2KWC A;  2DYO A;  2N1V A;  3VAW A;  1OEY J;  2BYE A;  1RLF A;  1RRB A;  1Z2M A;  2KNB A;  5E6N A;  4DDI D;  3IG3 A;  1P1A A;  4AUQ C;  2CHX A;  2K6D B;  2UYZ B;  2LAS A;  1C3T A;  1CMX B;  3KUZ A;  2KTR A;  1LFD A;  3VQI A;  1V81 A;  3PRM B;  4DHJ D;  3UIN B;  4W9C A;  3I3T B;  1IPG A;  2CS4 A;  2KC2 A;  1ZKH A;  2J0M A;  3A9J B;  5J17 A;  2NPT B;  3ENE A;  2FAZ A;  3WA0 A;  2O2V B;  1U4A A;  2XK5 A;  5KHO A;  5LXH A;  2KZR A;  1NBF C;  3HK0 A;  4KIK B;  4MSM B;  5J18 A;  1KLV A;  2WX0 A;  2LRU A;  2NBV B;  3PSE B;  4GDK B;  3T8M A;  3X0W A;  2IY0 B;  2C9W B;  4HCN B;  1UBI A;  4GDL A;  3MJW A;  4HK2 A;  3V62 A;  2XBB C;  1WM3 A;  2G4D B;  5D6J B;  3KYC D;  2KK8 A;  3PLU A;  3PHW B;  5EDS A;  4BBN F;  1E8Z A;  3QX1 A;  3M63 B;  2NPT A;  2IBI B;  2FNJ B;  2V4L A;  2O2V A;  2IO0 B;  4B9K A;  2YLM A;  3OAW A;  2IO3 B;  4KIK A;  1OGW A;  2KJR A;  3TL5 A;  1V9J A;  2HE7 A;  3K9O B;  2KAN A;  4JL9 A;  3H7S A;  5D7G A;  3KUD B;  3A1Q B;  2CKH B;  4PS8 A;  2Z59 B;  4CYE A;  3OLM D;  4ZRJ A;  4E74 A;  1V86 A;  4EKU A;  2FCM A;  1Q1O A;  1YIW A;  1GG3 A;  5KHQ A;  2N4F A;  1KM7 A;  3PVL A;  2ZNV C;  4AWJ A;  4GIV A;  4BKS D;  4M0W B;  4IUM B;  4M8N A;  3B08 A;  2JT4 B;  1P9D U;  3K9P B;  4DDG D;  4NJ7 A;  1I35 A;  3AU5 A;  2M0X A;  2FID A;  3RYT A;  1WXS A;  2ZVO A;  3DVG Y;  2W9N A;  1AAR A;  1EO6 A;  2KN5 A;  3AI5 A;  4PYZ A;  5DPW A;  2GOW A;  4JLC A;  1WM2 A;  4NJ6 A;  2KLG A;  2HD5 B;  3CST A;  3JW0 X;  3KVF B;  2PE6 B;  3AUL A;  2O6V D;  1T0Y A;  3QWZ B;  4K1R B;  4HVB A;  2A4Z A;  4WQO B;  3NOB A;  3VUY A;  2GMI C;  1WRD B;  2JZ3 B;  3QHT A;  4DWF A;  1GC7 A;  2M4N A;  4HCP B;  1E5W A;  2PPH A;  4P7I A;  4GGQ A;  4FA6 A;  4PYU A;  2N9X A;  4EEW A;  4F1S A;  2KOX A;  3S2A A;  2K8C A;  3PRP B;  4GB9 A;  2GBN A;  3ONS A;  3VFK A;  2DX5 B;  3DVN U;  3H6N A;  4FHJ A;  4I6P A;  5G2N A;  3JYU A;  5JHA A;  1Z5S B;  3PTF C;  4FBJ B;  3N3K B;  4KDL B;  4BVU C;  2PEA A;  1PQS A;  1QZE A;  2K25 A;  2KWV B;  3NZS A;  1WX8 A;  3VH4 B;  3ZW3 A;  4BOZ B;  2ZCC A;  3N30 A;  1E8Y A;  2CU1 A;  2Z0D B;  3NY5 A;  1LM8 B;  3L13 A;  2JXX A;  5DPT A;  4AOF A;  2KMC A;  3V61 A;  2DAJ A;  2K39 A;  3DBR I;  2KVR A;  3NS8 A;  2LXA A;  5CHF A;  1G6J A;  2EKE C;  5D2M B;  3ZO5 B;  2L05 A;  3D32 A;  2DEN B;  2KTR B;  1WR1 A;  3W1S C;  1SGH A;  2LVQ A;  5IAA C;  2KFK A;  1YJ1 A;  2MCN B;  3UIO B;  3X23 A;  2JWZ A;  2HTH A;  1WX7 A;  4TQ0 A;  4ZDV A;  5CTR C;  2BF8 B;  3RUI B;  1H4R A;  1WZ3 A;  2REX A;  4WWP A;  3ZLZ A;  1H8C A;  3RZF A;  2KJ6 A;  2LXC A;  2N9E B;  4MH0 E;  3ALB A;  3AU4 A;  5LXI B;  3L17 A;  5CHV C;  4ANW A;  4MGZ E;  1SIF A;  1J0G A;  2XEW A;  2KMA A;  2K1F A;  2MSE D;  3QQ8 B;  4JQW C;  2ZNV B;  4KV2 A;  3KYD D;  2KTF A;  4TUU A;  4LDT D;  1XD3 B;  3QK0 A;  1JRU A;  2KFJ A;  3UIP B;  2LWP A;  2ZZP B;  4GDL B;  4MDK E;  2C7H A;  2AEH A;  4EZJ A;  1WJ4 A;  2ZPN A;  2ASQ A;  4IM3 A;  4RM8 A;  2RR9 A;  3VDZ A;  1UH6 A;  2N9P C;  2KLC A;  2LI5 A;  2BKR B;  1X1M A;  5DCN A;  4MGI E;  1I42 A;  1OTR B;  3KH0 A;  4ICV A;  3H7P B;  4WJN A;  4NPN A;  4GN1 A;  3HM6 X;  4HDO A;  3VTW A;  4BKT A;  3U8Z A;  2BGF A;  3PHX B;  2ZPY A;  5CHW A;  1WMH B;  3OJ4 B;  4K7W A;  4HDQ A;  3SDL C;  3ZNG C;  4W9E A;  4DBG A;  2JZZ A;  2D3G A;  4J6I A;  5LLI A;  4EZL A;  2R2O A;  5C1Z A;  1WGR A;  1WH3 A;  1P3Q U;  2C7N B;  3DQV A;  4FUL A;  2JUO A;  4HWI B;  2L00 B;  2RGF A;  2JVC A;  1OEY A;  3IHP C;  3PS6 A;  4FHK A;  2MP2 B;  2ZCB A;  1WFY A;  2MW5 A;  1V5O A;  4IWQ A;  3H7P A;  2EMT A;  4WJP A;  4K81 A;  2LGY A;  4A3P A;  2JRI B;  3MHS D;  4NAW B;  1R4N I;  5DPR A;  1WMH A;  1YD8 U;  5JH5 C;  4E71 A;  2V3S A;  1WIA A;  2GBR A;  4NQL B;  3L16 A;  2BYF A;  4BKG A;  3EC8 A;  3V6E B;  4DK5 A;  2KD0 A;  1WR6 E;  3ZIM A;  1J8C A;  2Y5B B;  1S3S G;  3U7D A;  3M95 A;  3QIJ A;  2J0K A;  3NZU A;  1XT9 B;  5DPS A;  4JGH B;  3ZKJ C;  2MLB A;  2CHW A;  3CF6 E;  4CO7 A;  1E90 A;  1YX5 B;  2MP2 A;  3CSF A;  3HHM A;  1WY8 A;  1WGG A;  1E8X A;  1WE6 A;  1WXV A;  3RCZ A;  4XX5 A;  5AZF A;  3A33 B;  4NAW A;  5BO4 B;  2N1W A;  3M3J A;  3IBE A;  3L0W B;  2DAF A;  1WE7 A;  1NI2 A;  1EF1 A;  2D10 A;  1UEL A;  4IM2 A;  3ZDM C;  3TBL D;  4A3O A;  3VVW B;  3EFU A;  2LJ5 A;  1Q0W B;  2DYB A;  2L8J A;  3RD2 A;  4FJY A;  2KX0 A;  4GSW A;  2O6V B;  2I1J A;  4GXB A;  4II2 B;  3VHT C;  3DVN V;  1L2N A;  2M8S A;  4DXA B;  4BKS A;  2MBB B;  1XQQ A;  2N7D A;  4MGY E;  3VUX A;  3W1S A;  3PRZ A;  2UWQ A;  4K7U A;  1OQY A;  3WAP A;  4F8C B;  2DZM A;  3DCG A;  4FAD A;  4BBN C;  4EZK A;  4HPM B;  1YX6 B;  1WZ0 A;  1R4M I;  2D07 B;  2CR5 A;  3AXC A;  3C0R B;  3VH3 B;  2IYD B;  4ANX A;  4DHZ B;  4URK A;  3UQB A;  2AL3 A;  2KO3 A;  2L76 A;  4ZRK A;  1UBQ A;  2MRP A;  4KDI C;  2KFK B;  2L0T A;  5JHB A;  3P2B A;  2O6V A;  2KWU B;  3MTN B;  4MJS B;  3TCA A;  5D94 A;  2FIF A;  2VRR B;  1V5T A;  4AP4 C;  3VTV A;  2RPQ A;  1D3Z A;  3V6C B;  4OVV A;  3ML8 A;  2WDT B;  4MM3 A;  5HKH A;  2J7Q B;  2ZJD A;  3CMM B;  3JSV B;  3Q3F A;  3UGB B;  3GZN I;  4RM9 A;  3WAN A;  3QC8 B;  1RAX A; 
#chains in the Genus database with same CATH topology
 1E8W A;  3DOW A;  3SD5 A;  4JIO U;  4B0E A;  4MJS A;  5CX3 A;  3RT3 B;  1GJZ A;  2L0F A;  3N32 A;  2QC8 A;  2KJH B;  3DVG X;  3GOE A;  1HTQ A;  3BII D;  1K50 A;  1VR9 A;  1IYF A;  1AWD A;  2G45 B;  2QMT A;  3DBH I;  5AZH A;  5AEK B;  1QOB A;  4JX1 C;  1RWS A;  4DHJ B;  1FEH A;  2NBU A;  4KKJ A;  4US9 A;  1GPX A;  5E6O A;  1EM7 A;  3L08 A;  1WX9 A;  1JW9 D;  1WJ6 A;  2DZI A;  1ISN A;  1I4R A;  3I63 C;  2NBW B;  1GAQ B;  3BK2 A;  4GOC A;  2BW2 A;  3AN1 A;  2KXJ A;  2KDE B;  5JXV A;  3RZW C;  1HA5 A;  2L7R A;  1JAL A;  2IZV B;  3AEB B;  2I1K A;  1VZ7 A;  2RD0 A;  4MEM A;  2D5G A;  3M62 B;  3R2T A;  1C4C A;  4YL8 A;  4HXD A;  4TQ1 A;  4AJW A;  1DGJ A;  3N9Y C;  2CHZ A;  2HDE A;  4G3X B;  3P42 A;  1BUI C;  4N9F 4;  3V60 A;  3GS2 A;  4JWS C;  1ET6 A;  2GBK A;  4ANU A;  4YSZ B;  4WJO A;  4I6L B;  3LYY A;  2QHO A;  3DBS A;  1KRH A;  4ITK A;  3A9K A;  1V6E A;  1M94 A;  1BML C;  2JX5 A;  1HZ6 A;  2MA9 B;  3TEY A;  5J2R A;  1HEZ E;  4P1B C;  2WWZ A;  1UNS A;  2K9X A;  1E7U A;  3QAQ A;  4MM3 B;  4M01 A;  2LD9 A;  4WWN A;  2AL6 A;  2J52 A;  1GC6 A;  4C4V B;  1F2R I;  1EUV B;  1D4B A;  4GMV A;  2LVP A;  3VXW A;  3WAL A;  1FMA D;  2W3S A;  3I5J C;  3Q2A C;  1CK1 A;  2RDH A;  1K52 A;  5G55 A;  1WXA A;  3ZUN A;  4G11 A;  3QCA A;  2DLB A;  3O65 B;  2WX1 A;  4KSK C;  4YTM B;  2V4I B;  4IWO A;  2MBE A;  1VRA B;  4WQM A;  2FCQ A;  4WWM A;  4DHZ E;  2BKF A;  2DZK A;  2MBH A;  2CJN A;  4M02 A;  4FJZ A;  4EUT A;  5GXG B;  3EHV A;  1WXM A;  3ZNZ B;  3R2I A;  1WRI A;  3GP7 A;  2WXG A;  5FK9 C;  2MX2 A;  2WYQ A;  4R3D A;  4BOS C;  1WGH A;  2LEK A;  1BT0 A;  3TMP B;  2ZVN A;  2ZEQ A;  3ZVV A;  1OEY J;  3P4R B;  1I4Q A;  3CWI A;  4ZHP A;  4RF0 A;  1V1O A;  1C3T A;  2KTR A;  1LFD A;  3VQI A;  3I3T B;  1IPG A;  2FAZ A;  1QKZ A;  2ACZ B;  1NBF C;  2PIA A;  2LRU A;  4GDK B;  2ON8 A;  2IY0 B;  2C9W B;  3V62 A;  1KTK A;  2PVO D;  2M19 A;  5D6J B;  4A8X C;  4C7Y A;  1EU4 A;  1EU3 A;  4BBN F;  1E8Z A;  2BQQ A;  2NPT A;  3KWL A;  3NS1 A;  4B9K A;  1Y56 A;  2YLM A;  1OGW A;  1FD6 A;  3K9O B;  4JL9 A;  3A1Q B;  2Z59 B;  5AUK A;  4EKU A;  1Q1O A;  5KHQ A;  1QIL A;  3PVL A;  4GIV A;  4M8N A;  1P9D U;  1JWU D;  2M0X A;  1F77 A;  3RYT A;  2QJL A;  1EO6 A;  1V97 A;  4RH6 A;  2GOW A;  2BS2 B;  2HD5 B;  3AUL A;  2WLB A;  3QWZ B;  3Q14 C;  4K1R B;  2A4Z A;  2FBW B;  1SBB B;  3V05 A;  2GMI C;  4DWF A;  4ARI A;  3TEX A;  1JRP A;  4GGQ A;  1TY0 A;  4PYU A;  2N9X A;  1MI0 A;  1K53 A;  3ONS A;  1FO4 A;  1SB3 C;  5IO9 A;  4M00 A;  5JHA A;  1VZ8 A;  3N3K B;  4BVU C;  4PT5 A;  1PQS A;  1QZE A;  3NZS A;  2D3B A;  4BOZ B;  1E8Y A;  2WXJ A;  2CU1 A;  1LM8 B;  3L13 A;  1J7B A;  5BYR A;  3WCQ A;  5CHF A;  2K39 A;  4DXF A;  4C7Z A;  2L05 A;  1P7F A;  3W1S C;  4CQN A;  2KAC A;  3UIO B;  2JWZ A;  4TQ0 A;  4ZDV A;  1TKY A;  3Q8F A;  2LFI A;  2REX A;  2LXC A;  3ALB A;  2J53 A;  5LXI B;  3L17 A;  1SIF A;  1E7P B;  1STE A;  4WAF A;  1UWM A;  2Q5W D;  1TT5 B;  2LWP A;  2ZZP B;  1L0Y B;  2ZPN A;  4RM8 A;  1RFK A;  2J4X A;  2WU5 B;  3ZGZ A;  1D5M C;  2LI5 A;  1X1M A;  4ICV A;  4N58 A;  3HM6 X;  3MC9 A;  2QEJ C;  1J7C A;  2BGF A;  3OJ4 B;  4K7W A;  2EKI A;  3N1Y C;  2AQ1 B;  3DBL B;  1YN4 A;  4K3C A;  1B9R A;  2L00 B;  3RI7 C;  2JVC A;  1OEY A;  4USA A;  3PZ7 A;  1FCL A;  2MW5 A;  2KQ4 X;  3H7P A;  4WJP A;  1MFW A;  1WXQ A;  2L52 A;  3MHS D;  5DPR A;  5JH5 C;  4NQL B;  4S0R A;  2BYF A;  2KVZ A;  1J8C A;  1ACC A;  2Y5B B;  3U7D A;  2PKO A;  2D3C A;  1VDV A;  3VRA B;  2J0K A;  3RMK C;  1JQ4 A;  2EEL A;  3AEA B;  2WDQ B;  3CSF A;  1WY8 A;  3RCZ A;  3AE9 B;  4RGN A;  5BO4 B;  2WXQ A;  1PUT A;  2D10 A;  4PK1 A;  4A3O A;  3EFU A;  1Q0W B;  1ET9 A;  2DYB A;  1I4H A;  2L8J A;  4FJY A;  2BS3 B;  3SFD B;  3VHT C;  2INC C;  3LB8 C;  2N7D A;  4MGY E;  1JWB D;  2WHI A;  1IBX A;  3PRZ A;  2UWQ A;  4FAD A;  4HPM B;  4IOI E;  3C0R B;  3UQB A;  1VLB A;  4HKQ A;  2AL3 A;  3W5V B;  2BT6 A;  2L76 A;  2L0T A;  3P2B A;  4MJS B;  2MJ3 A;  2FIF A;  2VRR B;  1V5T A;  3VTV A;  2RPQ A;  2GB1 A;  4MT5 A;  2J7Q B;  4US8 A;  5HKH A;  3P4S B;  2IND C;  4RM9 A;  2PW9 A;  2WXP A;  3MC8 A;  1XLN A;  3MFG A;  4HLE A;  2PJH A;  5LNK 1;  4II3 B;  2LRW A;  2QIL A;  5EE3 A;  4D2K A;  3AH7 A;  2OJR A;  1T3Q A;  3JVZ X;  4XZ4 A;  3NJT A;  3P4P B;  1JML A;  4EOY A;  3ML9 A;  4JE3 B;  2KC1 A;  4W9D A;  1B1Z A;  1V80 A;  2V3N A;  5GMV A;  4MSQ B;  3A4S C;  5EE1 A;  2IJ0 A;  2KQS A;  2HJ8 A;  1ZW7 A;  4XC2 A;  2A5U A;  1KJT A;  2BPS A;  4FN2 A;  4LNO A;  1QQR A;  3PRE A;  5FR6 A;  4A9A A;  2IY1 B;  1FRR A;  1MPE A;  2Y5C A;  2FCN A;  2B3A A;  2H89 B;  4M8M A;  3W1Y A;  3HIZ A;  1TYG B;  2RPV A;  4B0M A;  2VH1 A;  2YEP B;  5C23 A;  1MHX A;  3A4R A;  4B95 A;  4KZ0 A;  2TSS A;  2JY6 A;  1IUE A;  3DBL I;  4W9K A;  1L6V A;  1F1H A;  2IO1 B;  4ZRP A;  1QF6 A;  5EE0 A;  3A9K B;  4IM0 A;  1NEN B;  4W9J A;  1V49 A;  5TR5 A;  3LXF A;  1YN3 A;  1TTN A;  4WAA A;  5HFY A;  1LO5 D;  2JU6 X;  3PV1 A;  3A9J A;  4XWT A;  2IO2 B;  1SEB D;  2K22 A;  2BB6 A;  3PZD A;  4HJK A;  3APD A;  1ENF A;  4Q2J A;  4DXG A;  3RNG C;  3QA8 A;  3DPD A;  4HPL B;  1TGZ B;  3VR8 B;  3N1Z C;  2W55 A;  3AE5 B;  3R3M A;  3ZNH B;  3AE2 B;  1VCB A;  5HI1 A;  3H1U A;  4NNJ B;  2MBQ A;  1LQB A;  3H9D A;  1SE2 A;  4LCD E;  2LHE A;  3RNF C;  2N0S B;  2OJW A;  1ZP0 B;  3Q8E A;  4WWO A;  1CZP A;  1YNT E;  2WNM A;  3R8B A;  3U4E G;  4M0W A;  3W5U B;  1T0Q C;  4ANV A;  4MEL A;  2BYV E;  4EFO A;  1HZ5 A;  4YXD B;  2XN9 C;  2DHZ A;  1XLQ A;  1J19 A;  2DZJ A;  4JPS A;  4HJG E;  5MPO A;  1N63 A;  2PE9 A;  4IG7 B;  1FXT B;  3ECI A;  3ZJV A;  1GNU A;  1V1P A;  3RUL A;  3QJZ A;  2KMM A;  2Z0E B;  2K8H A;  3Q8C A;  2BYT A;  2L83 A;  2PVG C;  3PT2 B;  4HRO A;  4AQ7 A;  2JZP A;  4LJO B;  1TY2 A;  2JQR B;  2AQ2 B;  4WJQ A;  2X38 A;  4FLH A;  4NY0 A;  1KOT A;  5E6P A;  1MVK A;  2FCS A;  1N62 A;  1D5X C;  1Y8R C;  4X57 B;  1XCQ L;  2LVO A;  3U30 A;  1E10 A;  4ZYN A;  2L3Z A;  1ZXH A;  2N1V A;  3VAW A;  1RRB A;  1YJI A;  4DDI D;  3IAM 1;  1P1A A;  1SE4 A;  4AUQ C;  2CHX A;  2K6D B;  2LAS A;  1V81 A;  3AEE B;  1DOX A;  4KKI A;  1UWX A;  2J0M A;  2NPT B;  4J3O D;  5KHO A;  4RGM A;  4BZA A;  4MSM B;  1NI3 A;  3O13 A;  1JRO A;  2IPK D;  3PSE B;  1ZUD 2;  1D6E C;  3X0W A;  4GDL A;  2XBB C;  1WM3 A;  1V8C A;  1RYJ A;  2MH7 A;  2V4L A;  2O2V A;  2WDR B;  2KJR A;  3TL5 A;  3BYT B;  2BVC A;  5D7G A;  4RF1 A;  3KUD B;  1KH0 A;  2CKH B;  2SEB D;  3OLM D;  2JSV X;  3AED B;  2FCM A;  2N4F A;  2ZNV C;  4AWJ A;  4BKS D;  1F52 A;  3B08 A;  3NUH B;  1WGK A;  4MH8 A;  3DVG Y;  4RGO S;  3OG5 A;  2JXT A;  3AE4 B;  5FKA C;  2KN5 A;  3V3X A;  1NEK B;  3CST A;  3JW0 X;  2PE6 B;  4WQO B;  3B9J A;  3NOB A;  3VUY A;  1WRD B;  3QHT A;  2M4N A;  2PPH A;  3TEW A;  3TEZ A;  4WUR A;  4F1S A;  2GBN A;  3DVN U;  2BTE A;  3EUB 2;  5G2N A;  3JYU A;  3UI3 A;  4KDL B;  5AUI A;  3VH4 B;  1OQQ A;  3HVD A;  3GZN B;  1UF0 A;  4ACF A;  2Z0D B;  3NY5 A;  2MJD A;  2W54 A;  2JXX A;  5DPT A;  4P16 A;  2K0P A;  2BBC A;  1L6U A;  2KMC A;  3RNC C;  3NS8 A;  3ZO5 B;  4ZYS A;  1WR1 A;  1SGH A;  2MCN B;  3X23 A;  1WWT A;  5CTR C;  2WXL A;  1UUP A;  1DOY A;  2WQY B;  2KJ6 A;  1EWY C;  3AU4 A;  4MGZ E;  1J0G A;  4C56 C;  4A55 A;  2ZNV B;  1HTO A;  4KV2 A;  3QK0 A;  2D3A A;  3Q3N C;  1MHH E;  5IKC M;  1ZPS A;  1TKG A;  2AEH A;  2ASQ A;  3VDZ A;  1UH6 A;  3DWM A;  4YT0 B;  4RFB A;  2BKR B;  4MGI E;  3W9C B;  3H7P B;  4GN1 A;  5FR3 A;  4HDO A;  3U8Z A;  2ZPY A;  2INN E;  1E9M A;  2D3G A;  4YTP B;  3AE3 B;  1AN8 A;  4K3B A;  5C1Z A;  1WH3 A;  3RNA C;  5BMI A;  1YMH E;  4FHK A;  2VH2 A;  1WFY A;  4IWQ A;  4ZRQ A;  4FXC A;  1CJE A;  3KLS X;  3V6E B;  2KD0 A;  3PZ8 A;  1L5P A;  3ETR A;  4L23 A;  3NZU A;  1XT9 B;  5DPS A;  3ZXV A;  4JGH B;  3ZKJ C;  2CHW A;  1PGB A;  3CF6 E;  2M0A A;  3SR6 A;  2MP2 A;  1SXT A;  3HHM A;  2ONQ A;  1E8X A;  1WE6 A;  1WXV A;  5D3I B;  3A33 B;  1IBX B;  1FM0 D;  3SEB A;  1ZDX A;  1WE7 A;  2IGG A;  3RD2 A;  2WXM A;  4YWG G;  2KX0 A;  2I1J A;  4GXB A;  3DVN V;  2QIE B;  2MBB B;  1XQQ A;  1I4G A;  1C78 A;  4F8C B;  4BBN C;  1WZ0 A;  2D07 B;  3AXC A;  3VH3 B;  2IYD B;  1FCC C;  4DHZ B;  2KO3 A;  4ZRK A;  1J7A A;  1UBQ A;  3GE3 C;  2KFK B;  5JHB A;  2O6V A;  3TCA A;  5D94 A;  3V6C B;  4OVV A;  2WXI A;  4MM3 A;  3CMM B;  3UGB B;  2KDM A;  3GZN I;  2WXN A;  3QC8 B;  1RAX A;  2LUM A;  4ZHO A;  1E6E B;  3IVF A;  2W3R A;  1PDX A;  1KF6 B;  3JSV A;  2GBJ A;  1JCK B;  2JF5 A;  3ZRF A;  1YQB A;  3KQ4 A;  3L54 A;  3Q8B A;  4HKZ E;  1T0S C;  3U7Z A;  3Q3O C;  4CHK A;  1XCT L;  3PPA A;  4W9L A;  2V0G A;  2R61 A;  3OWE B;  1LXD A;  3R7R A;  1GUA B;  1V2Y A;  1S1Q B;  2J42 A;  3AEG B;  1ZGU B;  2AX5 A;  2UU7 A;  2KDF B;  1KLG D;  1L7Y A;  4W9I A;  2M17 A;  5L95 C;  4KGT A;  2LZ6 A;  2CU3 A;  4XDC A;  3HVZ A;  2LUE A;  2JPH A;  5BYS A;  3ABV B;  2KX3 A;  3VTU A;  4W9G A;  2E6X A;  3KUC B;  1FIQ A;  3SHQ A;  2I2Y A;  2N9K A;  1UGJ A;  2C5L C;  3APC A;  3SU8 X;  3L10 B;  2RMM A;  3FIL B;  3P63 A;  2X8X X;  1IGC A;  3UQA A;  1FNU A;  2XNA C;  4LLG M;  1T0R C;  3AM9 A;  2NTS A;  3BK1 A;  4IWP A;  4K7S A;  4YSX B;  1WYG A;  2LGX A;  2FUH B;  4I6N B;  4A6Q A;  4G0N B;  1NVI D;  3ZNI D;  2L32 A;  4GDK A;  2GRI A;  3PLV A;  1FFU A;  2MEK A;  1ZDV A;  3AE7 B;  2KHW B;  2NS5 A;  3HM3 A;  3AB5 A;  4LTU A;  2MHJ A;  4JWU C;  2RDB C;  4A20 A;  4BFR A;  4TKN A;  1WGY A;  3Q8A A;  3NRZ A;  4YSY B;  4QAY A;  3A1Q A;  3AEF B;  5L83 A;  2LGD A;  3TJP A;  2AWT A;  2NTT A;  4IW0 A;  4W9H A;  4OHJ A;  2QCZ A;  1V1P B;  1CQV A;  4ICU A;  5HHD G;  2WP9 B;  1WSP A;  4PS7 A;  4KGS A;  4KSL C;  1R4M B;  1PYW D;  1BXT A;  2J0J A;  4XDD A;  2OED A;  1M4V A;  3LJ3 A;  1QOG A;  3R7Q A;  3TIX A;  2GI9 A;  5JZE B;  1UZX B;  2BWF A;  3NVV A;  3KW5 B;  2KQ7 A;  3DBR B;  3NZ3 A;  3VUW A;  4KZC A;  1ZE3 D;  5IA7 A;  4P6V F;  1SE9 A;  1JWS D;  3B1L X;  3NVW A;  1Q10 A;  4AS1 A;  3QAR A;  1AW7 A;  1UGM A;  2KWC A;  1TS4 A;  1RLF A;  4IDI A;  3DBH B;  3DWG C;  1FPY A;  2Z8L A;  2UYZ B;  1A70 A;  4LNI A;  3KUZ A;  4XYC A;  1F2R C;  1L4D B;  3PRM B;  4HEA 1;  3UIN B;  1C4A A;  3ZYY X;  2CS4 A;  2Y3A A;  5J17 A;  1D5Z C;  3VR9 B;  3P1M A;  3WA0 A;  1DYQ A;  2O2V B;  1U4A A;  2XK5 A;  5LXH A;  2G9H D;  2KZR A;  3HK0 A;  5J18 A;  1KLV A;  2NBV B;  3ZJT A;  1FXA A;  1UBI A;  4HCN B;  3MJW A;  4HK2 A;  2G4D B;  3PLU A;  5EDS A;  2PLP A;  1T6B X;  3L4P A;  3QX1 A;  2IBI B;  2M56 B;  2IO0 B;  4KIK A;  2IO3 B;  1V9J A;  2HE7 A;  2KYW A;  3AV8 A;  4PS8 A;  2HJ1 A;  3C19 A;  4ZRJ A;  1YIW A;  1GG3 A;  3AE8 B;  2LGI A;  2JT4 B;  3K9P B;  4WH4 A;  1I35 A;  3AU5 A;  5I4D A;  3Q3M C;  2BB5 A;  5E6J A;  4S17 A;  1WXS A;  2ZVO A;  2W9N A;  1AAR A;  3AI5 A;  4PYZ A;  4JLC A;  2KLG A;  3KVF B;  2HTM E;  4HVB A;  4ZOH C;  3HRD D;  1N6Z A;  1GC7 A;  4P7I A;  1N60 A;  4EEW A;  2LMC A;  3IT6 B;  2WXO A;  3S2A A;  4RCO A;  2VZK B;  4P1C C;  2KN4 A;  2DX5 B;  3H6N A;  4EE2 A;  1HQR D;  4I6P A;  1Z5S B;  3PTF C;  4FBJ B;  4XGA B;  4A90 A;  2KWV B;  1WX8 A;  1SIJ A;  3EFC A;  3N30 A;  2DWQ A;  3BVM A;  3V61 A;  2DAJ A;  3DBR I;  2KVR A;  2KWD A;  1PGA A;  3D32 A;  2DEN B;  2KTR B;  5IAA C;  2LVQ A;  1XF5 L;  2HTH A;  1SF0 A;  1WX7 A;  3AMZ A;  3RUI B;  1H4R A;  1H8C A;  1YOV B;  5IN7 A;  1MJD A;  2LHD A;  4ANW A;  2XEW A;  2MSE D;  3QQ8 B;  3B2G A;  2K5P A;  3KYD D;  2KTF A;  4TUU A;  4DQO C;  4LDT D;  1JRU A;  3GB1 A;  3GE8 C;  4EZJ A;  4IM3 A;  3NVZ A;  2RR9 A;  1TS3 A;  2KLC A;  1SE3 A;  1I42 A;  1OTR B;  4NAM A;  4WJN A;  4NPN A;  3BZD B;  3VTW A;  1QOF A;  5CHW A;  3SDL C;  1EWC A;  4HDQ A;  2JZZ A;  4J6I A;  1ROE A;  1I4X A;  1P3Q U;  3DQV A;  4FUL A;  2JUO A;  3PS6 A;  3IHP C;  2MP2 B;  5IP4 D;  2JYE A;  1V5O A;  1PFD A;  1IGD A;  4A3P A;  2JRI B;  1F0Z A;  1WMH A;  1YD8 U;  4E71 A;  2V3S A;  4DK5 A;  4BKG A;  1YQ4 B;  3B2F A;  3QIJ A;  2N9L A;  1C76 A;  3RN9 C;  2B76 B;  1WGG A;  5AZF A;  3IXS A;  4NAW A;  2N1W A;  3IBE A;  1AYF A;  1NYQ A;  2DAF A;  1EF1 A;  1UEL A;  5EE9 A;  3TBL D;  2LJ5 A;  1DOI A;  2V9H A;  3EGR A;  4GSW A;  2O6V B;  4LK0 M;  1JWA D;  4II2 B;  4OZB A;  2M8S A;  4DXA B;  3MP9 A;  3VUX A;  2CJO A;  3DCG A;  2WXF A;  4EZK A;  3SFE B;  2CR5 A;  1OFF A;  4URK A;  3E56 A;  2MRP A;  4KDI C;  3MTN B;  3MC0 B;  3ML8 A;  3JSV B;  1YJJ A;  3WAN A;  3T3N A;  4OVZ A;  3B0A A;  3ZXR A;  2MWS B;  4XWW A;  3PO0 A;  4W9F A;  4LJP B;  4TSS A;  3LDZ E;  3BY4 B;  5AZG A;  4ASW C;  1PGX A;  5D3D A;  4MGK E;  1N61 A;  5BYQ A;  4IKG A;  2BS4 B;  2M1M A;  2JYT A;  2EMS A;  4IC7 B;  2G3Q B;  4G50 A;  3W2D A;  2E3T A;  1VD2 A;  2JRH A;  5T8I A;  1IP9 A;  3ZTC A;  3RNB C;  3RNE C;  2INP E;  2WXR A;  2AYO B;  1HE8 A;  1F9J A;  2K8B A;  1MG8 A;  3WIM A;  2C7M B;  2R2Q A;  1ESF A;  1C1Y B;  4E3C A;  3FC4 A;  4OVU A;  3OJ3 A;  3FAH A;  4ZRI A;  3BIN A;  1GB4 A;  4HRS A;  1RFA A;  1TS5 A;  4REZ A;  1TBE A;  2KAJ A;  1TS2 A;  1K8R B;  1TZ1 A;  2D2Q A;  4ARC A;  2KDB A;  2DBY A;  2KDI A;  2QDF A;  1WF9 A;  1L4Z B;  1A5R A;  2MQJ A;  1RM6 C;  4PS3 A;  3UF8 A;  2OOB B;  1YN5 A;  4KVG B;  4TV3 A;  3APF A;  1TIF A;  4OZA A;  2G4S A;  2I38 A;  3ZDT A;  1I4P A;  2MBO A;  3WAM A;  2N7E A;  2D11 A;  2FUG 1;  1P0R A;  2K6Q A;  3IFW B;  1TKE A;  3EA6 A;  1QOA A;  1ZOY B;  4TMA B;  2DYM A;  4NQK E;  3NHE B;  3ZQ4 A;  4F7Z A;  2LJI A;  2W82 A;  3IAS 1;  1KFY B;  2RSU A;  4GLS C;  2GBM A;  3T3O A;  2NVU I;  1L0V B;  4GU2 A;  1WGD A;  2IGH A;  4RMA A;  1XLO A;  2VZK D;  2V1Y A;  1WI0 A;  2KKC A;  4UDU C;  1P98 A;  4C4V A;  5TSS A;  3FKY A;  3EEC A;  1MG4 A;  3DDC B;  1E7V A;  2NR2 A;  3ZTD A;  1WJU A;  4WIP A;  4AJY B;  3DHH C;  3ZRC A;  1I7H A;  4BAX A;  5G5G A;  3KWV A;  3U52 E;  3T9L A;  5C2T B;  1FNV A;  1EF5 A;  2NCN A;  1NDD A;  1UD7 A;  2YVC A;  3WAO A;  2QSD A;  2Y5P A;  4B6W A;  2WXK A;  3AE6 B;  4LDT B;  2G1E A;  3R66 C;  1KLU D;  3PGE A;  4C00 A;  1Q5W B;  3Q3J A;  1WYW B;  2LGS A;  1OQR A;  4FJV B;  4LNK A;  2BWE S;  4XE0 A;  2C60 A;  1FFV A;  2DNF A;  2XK5 B;  1WJN A;  2DYO A;  3NVY A;  2BYE A;  5E6N A;  1Z2M A;  2KNB A;  1GOZ A;  3IG3 A;  4L2Y A;  2ICI A;  1CMX B;  4DHJ D;  2L1A A;  5IOI A;  3J9C A;  4W9C A;  4HPP A;  2KC2 A;  1ZKH A;  5H8Y E;  3A9J B;  4OZC A;  3ENE A;  1NYR A;  4KIK B;  2WX0 A;  3N1X C;  3T8M A;  4YTN B;  2PMV A;  2YEP F;  2WGS A;  1N5W A;  3E9S A;  3H8H A;  2IDY A;  3KYC D;  2KK8 A;  3PHW B;  3M63 B;  1R4N B;  2ZW1 A;  3CIR B;  2FNJ B;  2NMQ A;  3OAW A;  3Q6B A;  2KAN A;  3H7S A;  1GB1 A;  1FRD A;  4CYE A;  2MJE A;  4E74 A;  1V86 A;  1VJK A;  1C77 A;  1KM7 A;  2K3U A;  3Q69 A;  4MAC A;  4M0W B;  5BMG A;  4IUM B;  5C3J B;  1JWM D;  4DDG D;  4NJ7 A;  1C79 A;  4LNN A;  1XXG A;  2FID A;  3NG0 A;  3BVG A;  5DPW A;  5G5H A;  1E0Z A;  1C9F A;  1WM2 A;  4NJ6 A;  2O6V D;  1T0Y A;  2WU2 B;  2JZ3 B;  3HUI A;  4HCP B;  1E5W A;  1ZXI A;  4FA6 A;  4C80 A;  2KOX A;  1SJH D;  3MHZ A;  2K8C A;  1FXI A;  3PRP B;  4GB9 A;  4NJC A;  3VFK A;  4FHJ A;  4NZL B;  4N59 A;  3DHG C;  1TJE A;  4O1N A;  2PEA A;  2K25 A;  4H2A A;  3ZW3 A;  2V3P A;  1HXY D;  2ZCC A;  3MJ5 A;  5HG2 A;  2GLS A;  4AOF A;  1TZO A;  2OHF A;  2LXA A;  1G6J A;  2RDG A;  2EKE C;  5D2M B;  5BMH A;  2KFK A;  1YJ1 A;  2N7J A;  2BF8 B;  1WZ3 A;  4WWP A;  3ZLZ A;  3RZF A;  1XLP A;  4MH0 E;  2N9E B;  3P4Q B;  5CHV C;  2SAK A;  1R7S A;  4KX6 B;  2KMA A;  2K1F A;  4JQW C;  3I57 A;  1QLB B;  1XD3 B;  1VZ6 A;  1N5X A;  2KFJ A;  3C8Y A;  3UIP B;  4GDL B;  4MDK E;  2C7H A;  3U2S C;  1WJ4 A;  2WXH A;  1XO3 A;  2N9P C;  3DHI C;  5DCN A;  2AQ3 B;  3KH0 A;  3RPF C;  4BKT A;  3PHX B;  3IT4 B;  1WMH B;  3N20 C;  3ZJU A;  3ZNG C;  4W9E A;  4DBG A;  2FE8 A;  5LLI A;  4N6E B;  1YQ3 B;  4RNA A;  4EZL A;  2R2O A;  1WGR A;  2C7N B;  4HWI B;  2RGF A;  2ZCB A;  5H92 C;  1SJE D;  2EMT A;  4K81 A;  2LGY A;  4NAW B;  1R4N I;  1LGR A;  1P7E A;  1SSN A;  3AEC B;  1WIA A;  2GBR A;  4RGT A;  3L16 A;  3EC8 A;  1WR6 E;  3ZIM A;  2KT7 A;  1S3S G;  3M95 A;  4KGR A;  3BYY B;  2MLB A;  3BVZ A;  3RFZ B;  4CO7 A;  1E90 A;  1YX5 B;  2WS3 B;  3URY A;  4XX5 A;  3I9V 1;  3M3J A;  3L0W B;  1NI2 A;  3VRB B;  4IM2 A;  3ZDM C;  3FIL A;  3TUO A;  3VVW B;  3TSS A;  1FNW A;  2ZW0 A;  1L2N A;  4BKS A;  3W1S A;  1K51 A;  2WDV B;  3AE1 B;  4K7U A;  1OQY A;  3WAP A;  2DZM A;  1L0X B;  1XEE A;  1YX6 B;  2PTL A;  1R4M I;  4ANX A;  4OW0 A;  3BWU D;  2IGD A;  4LNF A;  2JWU A;  1T5X D;  2KWU B;  4L1B A;  4AP4 C;  1D3Z A;  1QT9 A;  1C4P A;  2WDT B;  2ZJD A;  3Q3F A;  2H88 B; 
#chains in the Genus database with same CATH homology
 4HLE A;  1E8W A;  2PJH A;  3B0A A;  4II3 B;  2LRW A;  2MWS B;  3DOW A;  4W9F A;  2OJR A;  4LJP B;  3SD5 A;  4JIO U;  3JVZ X;  4XZ4 A;  4EOY A;  3LDZ E;  4MJS A;  3BY4 B;  3IVF A;  5AZG A;  3ML9 A;  5CX3 A;  3RT3 B;  1GJZ A;  2L0F A;  2KC1 A;  3N32 A;  4ASW C;  4W9D A;  1V80 A;  5GMV A;  3JSV A;  4MSQ B;  2KJH B;  2GBJ A;  3A4S C;  3DVG X;  4MGK E;  3GOE A;  2JF5 A;  1IYF A;  2KQS A;  2G45 B;  2HJ8 A;  1ZW7 A;  1YQB A;  4XC2 A;  3L54 A;  3DBH I;  2M1M A;  3ZRF A;  5AZH A;  4CHK A;  2A5U A;  3PPA A;  4W9L A;  2EMS A;  5AEK B;  1KJT A;  2BPS A;  4FN2 A;  1LXD A;  4IC7 B;  3R7R A;  1GUA B;  1V2Y A;  4DHJ B;  1S1Q B;  2G3Q B;  3PRE A;  5FR6 A;  4G50 A;  1VD2 A;  1ZGU B;  2JRH A;  2NBU A;  2IY1 B;  2FCN A;  2B3A A;  5E6O A;  1IP9 A;  3L08 A;  4M8M A;  1WX9 A;  3ZTC A;  2KDF B;  1WJ6 A;  3W1Y A;  3HIZ A;  1L7Y A;  4W9I A;  2DZI A;  1ISN A;  2AYO B;  2M17 A;  5C23 A;  1HE8 A;  1F9J A;  5L95 C;  2LZ6 A;  2K8B A;  2NBW B;  3A4R A;  4GOC A;  4B95 A;  4KZ0 A;  2JY6 A;  3DBL I;  4W9K A;  2LUE A;  1MG8 A;  2JPH A;  3WIM A;  2KXJ A;  2KDE B;  2C7M B;  2KX3 A;  2R2Q A;  3RZW C;  3VTU A;  1C1Y B;  4W9G A;  4E3C A;  3KUC B;  2IO1 B;  3SHQ A;  2L7R A;  4OVU A;  3OJ3 A;  2IZV B;  4ZRI A;  2I1K A;  3BIN A;  2RD0 A;  4MEM A;  3A9K B;  2C5L C;  3APC A;  3M62 B;  4IM0 A;  3SU8 X;  1RFA A;  4W9J A;  3L10 B;  4YL8 A;  1V49 A;  4HXD A;  1TBE A;  4TQ1 A;  4AJW A;  1K8R B;  5TR5 A;  1TZ1 A;  2D2Q A;  3UQA A;  1TTN A;  2CHZ A;  2KDB A;  4G3X B;  2KDI A;  4N9F 4;  4IWP A;  4K7S A;  3V60 A;  4WAA A;  1WF9 A;  2GBK A;  4ANU A;  4WJO A;  3PV1 A;  3A9J A;  2LGX A;  4I6L B;  1A5R A;  2IO2 B;  2FUH B;  4I6N B;  2MQJ A;  3PZD A;  2QHO A;  4G0N B;  4PS3 A;  4HJK A;  3APD A;  3DBS A;  3ZNI D;  3UF8 A;  4GDK A;  3A9K A;  1V6E A;  2OOB B;  1M94 A;  4KVG B;  4TV3 A;  3APF A;  3PLV A;  3QA8 A;  3DPD A;  2G4S A;  4HPL B;  2MA9 B;  1TGZ B;  3ZDT A;  5J2R A;  2MBO A;  3WAM A;  2KHW B;  2N7E A;  2D11 A;  2NS5 A;  3HM3 A;  3R3M A;  2WWZ A;  3ZNH B;  1P0R A;  1E7U A;  1VCB A;  2K6Q A;  3IFW B;  3QAQ A;  2LD9 A;  3H1U A;  4WWN A;  2AL6 A;  4TKN A;  4A20 A;  4BFR A;  1GC6 A;  1WGY A;  2MBQ A;  4NNJ B;  1LQB A;  3H9D A;  2DYM A;  4LCD E;  4NQK E;  3A1Q A;  3NHE B;  1EUV B;  5L83 A;  2LGD A;  4GMV A;  2LVP A;  4WWO A;  3TJP A;  2AWT A;  4F7Z A;  4IW0 A;  4W9H A;  3VXW A;  2RSU A;  4ICU A;  2GBM A;  3WAL A;  2NVU I;  4PS7 A;  4GU2 A;  1WGD A;  4ANV A;  4KSL C;  4MEL A;  5G55 A;  2BYV E;  4EFO A;  4RMA A;  2V1Y A;  1WI0 A;  2KKC A;  1WXA A;  3ZUN A;  1P98 A;  4G11 A;  2DHZ A;  3QCA A;  2J0J A;  3O65 B;  2WX1 A;  3EEC A;  4KSK C;  1J19 A;  3LJ3 A;  2DZJ A;  4IWO A;  3R7Q A;  2MBE A;  3TIX A;  2PE9 A;  3DDC B;  4IG7 B;  5JZE B;  1E7V A;  2NR2 A;  3ZTD A;  1FXT B;  1UZX B;  1WJU A;  3ECI A;  2FCQ A;  1GNU A;  4AJY B;  3RUL A;  4DHZ E;  3ZRC A;  3QJZ A;  2BWF A;  2BKF A;  2DZK A;  2Z0E B;  2MBH A;  3KW5 B;  2KQ7 A;  3T9L A;  4FJZ A;  4EUT A;  2K8H A;  1EF5 A;  2NCN A;  3VUW A;  1NDD A;  1UD7 A;  3PT2 B;  2YVC A;  1WXM A;  3EHV A;  3ZNZ B;  3WAO A;  4KZC A;  4LJO B;  4B6W A;  5IA7 A;  4LDT B;  2MX2 A;  2WYQ A;  1SE9 A;  3R66 C;  4FLH A;  4NY0 A;  3PGE A;  4WJQ A;  3B1L X;  1KOT A;  4BOS C;  5E6P A;  1Q5W B;  1WGH A;  3Q3J A;  1WYW B;  1BT0 A;  3TMP B;  2FCS A;  1Y8R C;  2ZVN A;  4X57 B;  4FJV B;  2BWE S;  3QAR A;  2LVO A;  2C60 A;  3U30 A;  2ZEQ A;  3ZVV A;  4ZYN A;  2XK5 B;  1UGM A;  1WJN A;  2L3Z A;  2KWC A;  2DYO A;  2N1V A;  3VAW A;  1OEY J;  2BYE A;  1RLF A;  1RRB A;  1Z2M A;  2KNB A;  5E6N A;  4DDI D;  3IG3 A;  1P1A A;  4AUQ C;  2CHX A;  2K6D B;  2UYZ B;  2LAS A;  1C3T A;  1CMX B;  3KUZ A;  2KTR A;  1LFD A;  3VQI A;  1V81 A;  3PRM B;  4DHJ D;  3UIN B;  4W9C A;  3I3T B;  1IPG A;  2CS4 A;  2KC2 A;  1ZKH A;  2J0M A;  3A9J B;  5J17 A;  2NPT B;  3ENE A;  2FAZ A;  3WA0 A;  2O2V B;  1U4A A;  2XK5 A;  5KHO A;  5LXH A;  2KZR A;  1NBF C;  3HK0 A;  4KIK B;  4MSM B;  5J18 A;  1KLV A;  2WX0 A;  2LRU A;  2NBV B;  3PSE B;  4GDK B;  3T8M A;  3X0W A;  2IY0 B;  2C9W B;  4HCN B;  1UBI A;  4GDL A;  3MJW A;  4HK2 A;  3V62 A;  2XBB C;  1WM3 A;  2G4D B;  5D6J B;  3KYC D;  2KK8 A;  3PLU A;  3PHW B;  5EDS A;  4BBN F;  1E8Z A;  3QX1 A;  3M63 B;  2NPT A;  2IBI B;  2FNJ B;  2V4L A;  2O2V A;  2IO0 B;  4B9K A;  2YLM A;  3OAW A;  2IO3 B;  4KIK A;  1OGW A;  2KJR A;  3TL5 A;  1V9J A;  2HE7 A;  3K9O B;  2KAN A;  4JL9 A;  3H7S A;  5D7G A;  3KUD B;  3A1Q B;  2CKH B;  4PS8 A;  2Z59 B;  4CYE A;  3OLM D;  4ZRJ A;  4E74 A;  1V86 A;  4EKU A;  2FCM A;  1Q1O A;  1YIW A;  1GG3 A;  5KHQ A;  2N4F A;  1KM7 A;  3PVL A;  2ZNV C;  4AWJ A;  4GIV A;  4BKS D;  4M0W B;  4IUM B;  4M8N A;  3B08 A;  2JT4 B;  1P9D U;  3K9P B;  4DDG D;  4NJ7 A;  1I35 A;  3AU5 A;  2M0X A;  2FID A;  3RYT A;  1WXS A;  2ZVO A;  3DVG Y;  2W9N A;  1AAR A;  1EO6 A;  2KN5 A;  3AI5 A;  4PYZ A;  5DPW A;  2GOW A;  4JLC A;  1WM2 A;  4NJ6 A;  2KLG A;  2HD5 B;  3CST A;  3JW0 X;  3KVF B;  2PE6 B;  3AUL A;  2O6V D;  1T0Y A;  3QWZ B;  4K1R B;  4HVB A;  2A4Z A;  4WQO B;  3NOB A;  3VUY A;  2GMI C;  1WRD B;  2JZ3 B;  3QHT A;  4DWF A;  1GC7 A;  2M4N A;  4HCP B;  1E5W A;  2PPH A;  4P7I A;  4GGQ A;  4FA6 A;  4PYU A;  2N9X A;  4EEW A;  4F1S A;  2KOX A;  3S2A A;  2K8C A;  3PRP B;  4GB9 A;  2GBN A;  3ONS A;  3VFK A;  2DX5 B;  3DVN U;  3H6N A;  4FHJ A;  4I6P A;  5G2N A;  3JYU A;  5JHA A;  1Z5S B;  3PTF C;  4FBJ B;  3N3K B;  4KDL B;  4BVU C;  2PEA A;  1PQS A;  1QZE A;  2K25 A;  2KWV B;  3NZS A;  1WX8 A;  3VH4 B;  3ZW3 A;  4BOZ B;  2ZCC A;  3N30 A;  1E8Y A;  2CU1 A;  2Z0D B;  3NY5 A;  1LM8 B;  3L13 A;  2JXX A;  5DPT A;  4AOF A;  2KMC A;  3V61 A;  2DAJ A;  2K39 A;  3DBR I;  2KVR A;  3NS8 A;  2LXA A;  5CHF A;  1G6J A;  2EKE C;  5D2M B;  3ZO5 B;  2L05 A;  3D32 A;  2DEN B;  2KTR B;  1WR1 A;  3W1S C;  1SGH A;  2LVQ A;  5IAA C;  2KFK A;  1YJ1 A;  2MCN B;  3UIO B;  3X23 A;  2JWZ A;  2HTH A;  1WX7 A;  4TQ0 A;  4ZDV A;  5CTR C;  2BF8 B;  3RUI B;  1H4R A;  1WZ3 A;  2REX A;  4WWP A;  3ZLZ A;  1H8C A;  3RZF A;  2KJ6 A;  2LXC A;  2N9E B;  4MH0 E;  3ALB A;  3AU4 A;  5LXI B;  3L17 A;  5CHV C;  4ANW A;  4MGZ E;  1SIF A;  1J0G A;  2XEW A;  2KMA A;  2K1F A;  2MSE D;  3QQ8 B;  4JQW C;  2ZNV B;  4KV2 A;  3KYD D;  2KTF A;  4TUU A;  4LDT D;  1XD3 B;  3QK0 A;  1JRU A;  2KFJ A;  3UIP B;  2LWP A;  2ZZP B;  4GDL B;  4MDK E;  2C7H A;  2AEH A;  4EZJ A;  1WJ4 A;  2ZPN A;  2ASQ A;  4IM3 A;  4RM8 A;  2RR9 A;  3VDZ A;  1UH6 A;  2N9P C;  2KLC A;  2LI5 A;  2BKR B;  1X1M A;  5DCN A;  4MGI E;  1I42 A;  1OTR B;  3KH0 A;  4ICV A;  3H7P B;  4WJN A;  4NPN A;  4GN1 A;  3HM6 X;  4HDO A;  3VTW A;  4BKT A;  3U8Z A;  2BGF A;  3PHX B;  2ZPY A;  5CHW A;  1WMH B;  3OJ4 B;  4K7W A;  4HDQ A;  3SDL C;  3ZNG C;  4W9E A;  4DBG A;  2JZZ A;  2D3G A;  4J6I A;  5LLI A;  4EZL A;  2R2O A;  5C1Z A;  1WGR A;  1WH3 A;  1P3Q U;  2C7N B;  3DQV A;  4FUL A;  2JUO A;  4HWI B;  2L00 B;  2RGF A;  2JVC A;  1OEY A;  3IHP C;  3PS6 A;  4FHK A;  2MP2 B;  2ZCB A;  1WFY A;  2MW5 A;  1V5O A;  4IWQ A;  3H7P A;  2EMT A;  4WJP A;  4K81 A;  2LGY A;  4A3P A;  2JRI B;  3MHS D;  4NAW B;  1R4N I;  5DPR A;  1WMH A;  1YD8 U;  5JH5 C;  4E71 A;  2V3S A;  1WIA A;  2GBR A;  4NQL B;  3L16 A;  2BYF A;  4BKG A;  3EC8 A;  3V6E B;  4DK5 A;  2KD0 A;  1WR6 E;  3ZIM A;  1J8C A;  2Y5B B;  1S3S G;  3U7D A;  3M95 A;  3QIJ A;  2J0K A;  3NZU A;  1XT9 B;  5DPS A;  4JGH B;  3ZKJ C;  2MLB A;  2CHW A;  3CF6 E;  4CO7 A;  1E90 A;  1YX5 B;  2MP2 A;  3CSF A;  3HHM A;  1WY8 A;  1WGG A;  1E8X A;  1WE6 A;  1WXV A;  3RCZ A;  4XX5 A;  5AZF A;  3A33 B;  4NAW A;  5BO4 B;  2N1W A;  3M3J A;  3IBE A;  3L0W B;  2DAF A;  1WE7 A;  1NI2 A;  1EF1 A;  2D10 A;  1UEL A;  4IM2 A;  3ZDM C;  3TBL D;  4A3O A;  3VVW B;  3EFU A;  2LJ5 A;  1Q0W B;  2DYB A;  2L8J A;  3RD2 A;  4FJY A;  2KX0 A;  4GSW A;  2O6V B;  2I1J A;  4GXB A;  4II2 B;  3VHT C;  3DVN V;  1L2N A;  2M8S A;  4DXA B;  4BKS A;  2MBB B;  1XQQ A;  2N7D A;  4MGY E;  3VUX A;  3W1S A;  3PRZ A;  2UWQ A;  4K7U A;  1OQY A;  3WAP A;  4F8C B;  2DZM A;  3DCG A;  4FAD A;  4BBN C;  4EZK A;  4HPM B;  1YX6 B;  1WZ0 A;  1R4M I;  2D07 B;  2CR5 A;  3AXC A;  3C0R B;  3VH3 B;  2IYD B;  4ANX A;  4DHZ B;  4URK A;  3UQB A;  2AL3 A;  2KO3 A;  2L76 A;  4ZRK A;  1UBQ A;  2MRP A;  4KDI C;  2KFK B;  2L0T A;  5JHB A;  3P2B A;  2O6V A;  2KWU B;  3MTN B;  4MJS B;  3TCA A;  5D94 A;  2FIF A;  2VRR B;  1V5T A;  4AP4 C;  3VTV A;  2RPQ A;  1D3Z A;  3V6C B;  4OVV A;  3ML8 A;  2WDT B;  4MM3 A;  5HKH A;  2J7Q B;  2ZJD A;  3CMM B;  3JSV B;  3Q3F A;  3UGB B;  3GZN I;  4RM9 A;  3WAN A;  3QC8 B;  1RAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...