3GOEA

Molecular mimicry of sumo promotes dna repair
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
HHHHHHKLITLLLRSSKSEDLRLSIPVDFTVKDLIKRYCTEVKISFHERIRLEFEGEWLDPNDQVQSTELEDEDQVSVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein rad60
publication title Molecular mimicry of SUMO promotes DNA repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Recombination, replication
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2009-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3goeA00
1ISNA 4MGKE 4E3CA 1C1YB 3QA8A 4IW0A 4M8NA 4W9IA 1TZ1A 3HHMA 4MDKE 1BT0A 2L3ZA 3L17A 3QC8B 5E6NA 1IYFA 1GNUA 4DWFA 2J7QB 3KVFB 3B0AA 5CX3A 4EEWA 1U4AA 1YD8U 4CHKA 1Q1OA 2DZKA 4PS7A 2BWES 1QZEA 2M0XA 3VUXA 3ZKJC 2LJ5A 3VDZA 1MG8A 2GBNA 3Q3JA 5D6JB 4FBJB 3A1QB 3TCAA 5J17A 3KYDD 2EKEC 3RCZA 2MWSB 1XD3B 3HK0A 3ZNID 4DHZE 4CYEA 4I6LB 1V6EA 2KX3A 2LGXA 3CSFA 4BBNF 2BYVE 4GIVA 2KC1A 4NJ6A 4DK5A 2K8CA 2M17A 2ZNVB 4I6PA 5LXHA 2EMSA 2NR2A 3ZRFA 1WXVA 1V5TA 2WDTB 3K9PB 2YVCA 1UGMA 2L05A 4AJYB 3PRZA 5AZGA 4HPLB 4MELA 2BF8B 4NJ7A 3VUYA 3EHVA 1RLFA 1OEYA 2JWZA 2J0MA 1SIFA 2JVCA 4A3OA 2KVRA 3S2AA 2KOXA 3ENEA 1RRBA 1WIAA 2RD0A 3QQ8B 3OJ4B 2ZZPB 3H6NA 4F7ZA 2A4ZA 1WH3A 3ZW3A 1I35A 4EUTA 2UWQA 4MSQB 2LWPA 1Q5WB 4ZRJA 2KFKB 3UGBB 2HJ8A 3DOWA 5JZEB 4JLCA 3DQVA 2LRWA 2EMTA 5DPRA 3QHTA 1L7YA 3KW5B 3PHXB 3K9OB 4B9KA 4ANUA 2DYOA 2FUHB 1TGZB 3A4SC 2AL3A 2FIFA 4II3B 2N9PC 3UIOB 3ZNZB 3SHQA 3HM6X 3PRPB 1M94A 2MLBA 4F1SA 5C1ZA 1WR1A 3JSVB 4NAWB 2KDFB 5D94A 1HE8A 3QAQA 1ZKHA 1V81A 5KHOA 2KJ6A 3TL5A 1T0YA 4BKGA 1GJZA 2KZRA 4FJYA 2KN5A 2LZ6A 3IFWB 3SDLC 4DDID 2KTFA 4AP4C 3P2BA 2MCNB 2NBVB 3TJPA 1C3TA 3NZUA 3ZO5B 4KIKA 4GB9A 4BOSC 3U8ZA 2MBHA 1UZXB 3DBRI 4PYUA 2N4FA 1ZW7A 3VH4B 4AJWA 3B1LX 2G45B 3DDCB 3DCGA 4W9KA 1V2YA 3RYTA 2KDIA 1EUVB 2XK5B 1WM2A 2L0FA 3RT3B 3VXWA 4KVGB 4DHJB 1P3QU 1RAXA 2MBBB 4WWNA 4RMAA 3UIPB 2MQJA 2R2QA 1X1MA 3H1UA 2LVPA 3KUDB 1KM7A 3PVLA 3NS8A 4URKA 2OJRA 4NQKE 2FAZA 2MRPA 2LD9A 2KWUB 4TV3A 2K39A 2MBOA 1YQBA 3APDA 2KWVB 2MP2A 1GC7A 2JF5A 3NY5A 4IUMB 2M8SA 3AULA 3TIXA 2NS5A 5L95C 2ZCCA 2MW5A 1LM8B 4MEMA 4KZ0A 4KSKC 2RSUA 5J18A 2DAJA 1RFAA 5LXIB 4GSWA 1WJNA 2VRRB 2KLCA 2KQ7A 2KXJA 3AI5A 4HXDA 1WJ4A 1WXAA 4JIOU 4FHJA 4NPNA 2BWFA 3UF8A 2GBJA 3VFKA 4FN2A 1UBQA 4GN1A 2W9NA 2L76A 1G6JA 2M4NA 2G4SA 2J0JA 3CSTA 2WX0A 1Q0WB 3DPDA 3APFA 2DHZA 1V9JA 2NPTB 1XT9B 4J6IA 4DDGD 2AL6A 3ZDMC 2KX0A 4BFRA 3AXCA 3VUWA 3PSEB 3TBLD 3ZVVA 5BO4B 4BVUC 4NQLB 3DBHI 2IO3B 3N30A 4W9GA 3X23A 3A1QA 2D07B 3A9JA 4IG7B 4ZDVA 3UQBA 2KTRB 2ZPYA 3NZSA 3QIJA 3VTWA 4ANVA 3JYUA 4BBNC 4WJPA 2KMCA 2B3AA 4W9EA 4MJSB 4DHJD 4HDQA 2IZVB 4GDKB 4BKTA 2AWTA 1WF9A 2JXXA 1LFDA 2ZCBA 3CF6E 3L16A 3RZFA 2JZ3B 2PJHA 2LRUA 2D3GA 4W9JA 1V5OA 2KC2A 2O6VA 5LLIA 4X57B 3M95A 2FCSA 4GDLB 2LASA 2I1JA 1E5WA 1E90A 1GC6A 4IWPA 2V1YA 4WAAA 3ZLZA 3ONSA 3WALA 4DXAB 4G3XB 4LDTB 5DCNA 4GXBA 2ZEQA 2LVOA 4HJKA 3VTVA 3Q3FA 1E8XA 2GOWA 2DYMA 2J0KA 1UD7A 3SD5A 5AZFA 4A3PA 2KFKA 1YIWA 3MHSD 3IHPC 4TQ0A 4NNJB 2C5LC 1UELA 4ASWC 2QHOA 2N7DA 3ZTDA 3EECA 2KQSA 4IM0A 3DVGX 2IO0B 5C23A 2PE6B 3CMMB 3KYCD 4G50A 1WX7A 3JSVA 4LCDE 1WGRA 4NAWA 4FADA 3DVNU 1PQSA 4XC2A 2GBKA 3V62A 3OAWA 1P98A 2LUEA 4HDOA 4MSMB 2FNJB 3BY4B 4LJOB 3DVGY 3DBSA 3WAPA 3QK0A 5G55A 2ZNVC 3JW0X 4ANWA 4WJNA 1OQYA 1WRDB 2NBWB 2DZMA 5JH5C 1S3SG 1V86A 1WZ3A 1A5RA 3WAOA 3C0RB 1FXTB 2L7RA 3VHTC 4LDTD 3W1YA 1NBFC 1J19A 2CHZA 3O65B 2MA9B 4F8CB 1ZGUB 1VCBA 3PRMB 3ZNHB 1YX6B 4XZ4A 3L08A 1V49A 5HKHA 4G0NB 3VAWA 2I1KA 2XK5A 4KDIC 1GG3A 4AWJA 4EZJA 1LXDA 4E74A 1F9JA 3EC8A 4EFOA 5DPTA 2BGFA 4W9FA 2IBIB 5JHAA 1YX5B 2K6QA 2ZPNA 2GMIC 2WWZA 3M62B 4DBGA 2KDEB 2OOBB 2BPSA 2LGYA 5CHFA 1IPGA 2CHXA 3VTUA 1WMHB 2G3QB 2M1MA 1SGHA 4K7SA 3KUZA 1D3ZA 3R7QA 2PPHA 3W1SC 2K6DB 3D32A 3AU5A 3QWZB 2KWCA 4BOZB 2D11A 4WJQA 2REXA 3VVWB 4IWOA 3ZTCA 2GBMA 3EFUA 5DPWA 1TBEA 3KH0A 4RM9A 2MX2A 2PE9A 5CTRC 3T9LA 3PREA 3QARA 2NPTA 2BKFA 1XQQA 2C9WB 3A9KB 4TUUA 3RZWC 2AEHA 2HD5B 2N1WA 4A20A 2DYBA 3B08A 3NOBA 1R4MI 3VQIA 3WIMA 3ZUNA 5JHBA 4IM3A 2IY1B 2O2VB 4NY0A 3R3MA 2NBUA 5FR6A 1P9DU 2KTRA 3PTFC 4ICUA 1IP9A 3N3KB 1WYWB 4LJPB 4MJSA 3ALBA 3UQAA 4FJVB 4GDKA 2C7NB 2R2OA 3NHEB 4ICVA 3QCAA 4WWOA 3WANA 1OTRB 1P0RA 4HCNB 2GBRA 1E7UA 1J0GA 1WM3A 4GDLA 1L2NA 1CMXB 2CR5A 3QJZA 1E8ZA 1WFYA 2V3SA 3IG3A 3H7PB 3ZDTA 2N1VA 4ZYNA 4TQ1A 1WGHA 4K1RB 2KK8A 4CO7A 5IA7A 3V60A 2MBQA 1WE7A 3DBLI 4KSLC 2K8BA 2KLGA 4WWPA 2NCNA 5D7GA 3ZIMA 1KLVA 3PHWB 3BINA 2KJHB 2XBBC 3T8MA 5IAAC 1KOTA 2KFJA 4JQWC 1WJ6A 1V80A 1K8RB 4RM8A 1WGGA 4PS3A 4AOFA 4W9DA 4ANXA 1WR6E 2JZZA 3HM3A 2JUOA 1H8CA 3PPAA 3I3TB 2C7HA 2KO3A 1WJUA 4ZRKA 4MGIE 2UYZB 2CHWA 1S1QB 3A33B 4BKSD 4IWQA 2ZJDA 3ECIA 2BKRB 2MBEA 2Z59B 4KV2A 2FCNA 2KDBA 4OVUA 3MTNB 3GZNI 3UINB 3A9JB 1H4RA 2N9XA 2JY6A 3SU8X 4B95A 3H9DA 4K81A 4IM2A 4MM3A 3V6CB 2V4LA 2KD0A 4MGZE 1E7VA 2WX1A 5EDSA 5KHQA 3IVFA 2BYEA 5DPSA 2KKCA 4GGQA 2RPQA 5AZHA 3W1SA 2G4DB 1EF1A 4FULA 2O6VB 5AEKB 4KDLB 3APCA 4W9HA 2IO2B 4HK2A 1WXMA 4P7IA 2Y5BB 4WJOA 4GMVA 1WY8A 2L00B 4M8MA 4MGYE 2KANA 4WQOB 1Y8RC 2CKHB 3AU4A 4MH0E 2D10A 3DVNV 2FCMA 4EZLA 3PGEA 2RGFA 4I6NB 2IO1B 3VH3B 5CHWA 2JRHA 2C60A 3ZRCA 4HWIB 5GMVA 1TTNA 5TR5A 2L0TA 1AARA 4E71A 2NVUI 2PEAA 3LDZE 3TMPB 3R66C 3GOEA 3IBEA 1KJTA 3PT2B 2LXCA 2DZIA 2HE7A 3R7RA 4GOCA 2CU1A 1WMHA 1OGWA 4FLHA 5E6PA 4FHKA 4W9LA 2JRIB 2DZJA 3OJ3A 3RUIB 3OLMD 1WZ0A 4KZCA 3MJWA 3RULA 1P1AA 3PLVA 3V6EB 1EO6A 3KUCB 2BYFA 2RR9A 3N32A 4EZKA 1Z2MA 4HVBA 3L10B 1OEYJ 4HCPB 2MSED 4GU2A 4FJZA 3A9KA 4K7UA 2DENB 3PV1A 2JPHA 1JRUA 4EKUA 1WXSA 2C7MB 2XEWA 3M63B 3L0WB 2O6VD 3LJ3A 2LI5A 4JGHB 2A5UA 2O2VA 2DAFA 1NDDA 2K1FA 4BKSA 4IC7B 2FCQA 3RD2A 4N9F4 3H7SA 2WYQA 1J8CA 2ZVNA 4HPMB 1WX9A 1I42A 4HLEA 4OVVA 2JT4B 3PZDA 4FA6A 4W9CA 4PYZA 1UBIA 3HIZA 1EF5A 2LVQA 3M3JA 4AUQC 5J2RA 2KNBA 2AYOB 1WGYA 5D2MB 2DX5B 4YL8A 4B6WA 2LXAA 4K7WA 2KJRA 4PS8A 2YLMA 4G11A 3U30A 4KIKB 3PS6A 3ZNGC 5G2NA 3L54A 2HTHA 5E6OA 3WAMA 2D2QA 3WA0A 1E8YA 3QX1A 3H7PA 1WGDA 4DHZB 2IY0B 2KHWB 2KMAA 1NI2A 3ML8A 3X0WA 2L8JA 2LGDA 1VD2A 4II2B 5L83A 1E8WA 3U7DA 5CHVC 4EOYA 1YJ1A 3L13A 2N7EA 2Z0DB 2K8HA 3PLUA 3V61A 4TKNA 1GUAB 1LQBA 3JVZX 2K25A 2FIDA 1R4NI 3A4RA 2ASQA 1WI0A 3ML9A 4XX5A 1Z5SB 2MP2B 2Z0EB 2IYDB 2N9EB 2ZVOA 2CS4A 4JL9A 4M0WB 1WE6A 1SE9A 1WX8A 4ZRIA 1UH6A
chains in the Genus database with same CATH superfamily
1ISNA 1C1YB 3V3XA 1IBXA 3AEAB 3L17A 5TSSA 5CX3A 2WNMA 1Q1OA 4JX1C 2BWES 3GE8C 1SB3C 2LJ5A 5D6JB 4FBJB 3U4EG 5J17A 4XYCA 1ZE3D 2KQ4X 3EFCA 2PTLA 1VRAB 2R61A 4BBNF 2BYVE 4I6PA 2WDTB 4K3CA 4P16A 3TSSA 2Y5CA 1VZ7A 4NJ7A 2BQQA 3FILB 2WHIA 2JWZA 4A3OA 2KVRA 4JE3B 1RRBA 2RD0A 3H6NA 1I35A 5JZEB 3Q14C 2EMTA 5DPRA 3PHXB 4B9KA 1ROEA 5IKCM 2FIFA 4KKIA 1SIJA 5HI1A 3JSVB 2KDFB 5D94A 3AEEB 1ZKHA 4CQNA 2BS2B 3Q69A 1GJZA 4IOIE 4ZOHC 3AE2B 2WXMA 4DDID 4K3BA 4YTPB 2N7JA 3TJPA 1JWMD 5BMGA 1QOBA 1V97A 3NZUA 4KIKA 3U8ZA 2BW2A 2LGIA 1KFYB 3DDCB 2KDIA 2QIEB 1PUTA 3PO0A 2XK5B 3O13A 2L0FA 3VXWA 1EU4A 2MQJA 1X1MA 4J3OD 1KM7A 2J4XA 2WDRB 2MRPA 2JX5A 1KLVA 4IUMB 3NY5A 1GC7A 5L95C 3AULA 3HUIA 2MW5A 4MEMA 2DAJA 4US9A 1AYFA 1FO4A 2J52A 3UF8A 3VFKA 4FN2A 2W9NA 2L76A 3BWUD 2M4NA 1I7HA 3V05A 1JROA 3AEDB 4HRSA 2DHZA 4J6IA 1F2RI 1XLQA 5BO4B 3DBHI 3X23A 3A9JA 2V0GA 4B0MA 2KTRB 3NZSA 3VTWA 3JYUA 4BBNC 4WJPA 4HDQA 2ZCBA 3CF6E 2D3CA 2PJHA 2D3GA 2CJOA 1TT5B 1YN3A 4X57B 3M95A 3P42A 4GDLB 2I1JA 3Q3OC 3SR6A 3KLSX 4L1BA 1TS3A 2WXPA 3ETRA 2WXFA 2PKOA 2J0KA 1V8CA 2L52A 3SD5A 2W3RA 4A3PA 2D3BA 1QKZA 4NNJB 2WU5B 3PZ7A 3EECA 3HRDD 4IM0A 3DVGX 2PE6B 1J7BA 1WX7A 1KLGD 3JSVA 4LCDE 1PQSA 4XC2A 2WQYB 2GBKA 3NS1A 4LJOB 2ZNVC 4RGTA 4WJNA 2DZMA 5JH5C 5MPOA 1QOGA 4RGOS 4LDTD 3W1YA 1NBFC 1J19A 2MA9B 2QCZA 2INDC 1V49A 3MJ5A 4G0NB 2XK5A 4E74A 4EFOA 5JHAA 4XDCA 3M62B 2OOBB 1SJHD 3VTUA 3AE9B 2G3QB 2M1MA 1D3ZA 2ON8A 4RFBA 1FD6A 1YOVB 2K6DB 1HTOA 4H2AA 1I4RA 2REXA 2WS3B 4WWMA 2GBMA 3KH0A 1ACCA 3A9KB 1FCLA 2N1WA 4YTNB 1ET6A 4NAMA 3VQIA 3ZUNA 5JHBA 2IY1B 4NY0A 5IOIA 4S17A 2KTRA 2HTME 2C7NB 4ICVA 4WWOA 1AW7A 1E7UA 3LXFA 4GDLA 1CMXB 2EKIA 1VZ8A 1D5MC 2KACA 3BVGA 1A70A 4TQ1A 3URYA 4CO7A 2Q5WD 1WE7A 3DBLI 4KSLC 2WXHA 2KLGA 2D5GA 2BTEA 3PHWB 1WJ6A 4L2YA 1NENB 3CIRB 3E9SA 3IAS1 1WJUA 2UYZB 2CHWA 1HXYD 2ZJDA 4KV2A 1EM7A 4OVUA 3MTNB 4DXFA 2Y5PA 2WXJA 4B95A 4MM3A 2WU2B 2V4LA 3Q2AC 2CJNA 2BT6A 2WX1A 1TS2A 2BYEA 1KLUD 3AV8A 2G4DB 1C4CA 2IGGA 2VZKB 2O6VB 5BYRA 4KDLB 2Y5BB 1WY8A 4RF0A 1F2RC 4WQOB 1DOIA 3AU4A 2C60A 3ZRCA 2L32A 4E71A 1TTNA 1AARA 2NVUI 2PEAA 1KJTA 2HE7A 2QDFA 3RNCC 2X38A 2BS4B 4A6QA 2KDMA 2KT7A 1C77A 1HQRD 3SFDB 3UI3A 2KWDA 2W54A 3KWLA 1FPYA 3RUIB 1AWDA 1IGDA 2K5PA 1FIQA 1P1AA 3V6EB 1EO6A 1YN5A 2BYFA 2RR9A 1HA5A 4EZKA 4HVBA 1F0ZA 1OEYJ 4GU2A 3A9KA 3NVWA 2I38A 3I5JC 1JRUA 2DLBA 4OZBA 4EKUA 4YSZB 3ZJUA 4JGHB 2A5UA 2OHFA 3H7SA 4OW0A 1TIFA 4OVVA 3PZDA 1MVKA 2LVQA 3AN1A 4BZAA 2KNBA 2AYOB 2PW9A 2KVZA 2LXAA 3MC8A 4PS8A 1GPXA 1V1OA 3L54A 2HTHA 5E6OA 1E8YA 4N6EB 1VDVA 3GE3C 4HPPA 3ML8A 3X0WA 5AUIA 1NI3A 5L83A 1NYQA 1YJ1A 1EU3A 3RMKC 1WYGA 1GUAB 3ML9A 2K3UA 1XO3A 2N9EB 2ZVOA 1WE6A 2JWUA 4E3CA 2RDBC 4LLGM 3R2IA 1SBBB 3HHMA 4MDKE 2L3ZA 1IYFA 4C80A 1GNUA 1FNUA 3B0AA 4EEWA 4MH8A 1TYGB 1E9MA 4CHKA 2AQ3B 2IPKD 2DZKA 3VUXA 2EELA 3U2SC 1MG8A 3Q3MC 2LHDA 3BVMA 3KYDD 1SF0A 3ZYYX 3RCZA 3WCQA 3HK0A 4DHZE 4I6LB 1V6EA 2LGXA 2PMVA 2K8CA 4DK5A 2M17A 1F1HA 2NR2A 3ZRFA 1V5TA 2K0PA 4AJYB 3PRZA 5AZGA 1GOZA 2H88B 4HPLB 2TSSA 3VUYA 1RLFA 5T8IA 2GB1A 3Q8BA 3ENEA 3AH7A 2AQ1B 4F7ZA 2A4ZA 1WH3A 3ZW3A 4EUTA 4MSQB 1Q5WB 4ZRJA 2KFKB 3UGBB 4JLCA 1L7YA 3KW5B 2L83A 2FUHB 2AL3A 2N9PC 4ACFA 3ZNZB 3NJTA 3PRPB 1GB1A 5C1ZA 3QAQA 5KHOA 2KJ6A 1T0YA 4BKGA 2LZ6A 3SDLC 3P2BA 2MCNB 1JWBD 2LEKA 3ZO5B 2WLBA 1XCTL 2MBHA 4PYUA 4AJWA 2G45B 2VH1A 4W9KA 3RYTA 5BYQA 5HFYA 4ZRPA 3W5VB 1RAXA 4WWNA 2R2QA 3H1UA 3PVLA 1FFUA 2BS3B 4URKA 1WXQA 5EE9A 1E0ZA 4IKGA 2K39A 2MBOA 2JF5A 2NS5A 2ZCCA 1LM8B 2IGHA 5J18A 3DWMA 4GSWA 4HXDA 2B76B 4NPNA 1BUIC 1HTQA 3ZGZA 1UBQA 2ACZB 2G4SA 2IGDA 3BIID 2WX0A 1XT9B 2NMQA 2KX0A 3AXCA 3ZVVA 3AE8B 1NEKB 3FKYA 4NQLB 2X8XX 3N30A 2D07B 3UQBA 2ZPYA 1UWXA 1T0RC 2KMCA 4W9EA 1ESFA 4DHJD 4GDKB 1NVID 4LNOA 3KQ4A 2JXXA 1P7FA 4W9JA 5FKAC 2FCSA 3EA6A 1E5WA 2JU6X 3AE3B 2V1YA 4LDTB 4GXBA 2LVOA 4DXGA 4HJKA 3Q3FA 3LB8C 2GOWA 2DYMA 4ZHOA 4JWUC 3TEXA 1MPEA 2KFKA 3IHPC 3EGRA 3Q8AA 1UELA 1WSPA 2LUMA 2N7DA 3VR9B 3ZTDA 4M01A 1L5PA 3AB5A 3CMMB 3KYCD 4WIPA 1WGRA 1P98A 2LUEA 4HDOA 4ZRQA 2QILA 3DBSA 3WAPA 2KN4A 3JW0X 2JXTA 1WRDB 3RI7C 4N59A 1A5RA 3C0RB 1FXTB 3O65B 5HKHA 1VCBA 4NZLB 2GI9A 4TMAB 3L08A 2I1KA 4KDIC 5D3DA 4AWJA 1PGAA 3FC4A 5DPTA 2BGFA 1YX5B 2ZPNA 2MJDA 2WWZA 3ZJTA 3ZJVA 3IT4B 2M19A 5CHFA 1MG4A 2CHXA 2JSVX 3PZ8A 2MEKA 1FEHA 2H89B 1L4DB 3D32A 2KWCA 4BOZB 2D11A 4A90A 1OQRA 1SE2A 3ZTCA 4WH4A 1ZOYB 4RNAA 4M0WA 1DOYA 5CTRC 3RZWC 2BKFA 1L2NA 2HD5B 2DYBA 3B08A 4IM3A 2NBUA 1OFFA 3HVZA 4PK1A 1P9DU 3PTFC 4ICUA 3N3KB 3ALBA 4FJVB 4GDKA 2V3PA 3HVDA 5EE3A 1P0RA 4HCNB 2QC8A 2CR5A 1E8ZA 2N1VA 1C4PA 2BYTA 1L0VB 3ZIMA 4MACA 1R4MB 2XBBC 1ET9A 5IAAC 1K50A 4RM8A 1WGGA 4W9DA 4LNKA 1L0YB 5EE0A 3PPAA 1BMLC 2KO3A 3FILA 1JMLA 4LNFA 4MGIE 3N1XC 4BKSD 3ECIA 1CJEA 2FCNA 2W82A 3AM9A 5C3JB 4C4VB 3N1YC 1WWTA 3SU8X 3CWIA 1E10A 4IM2A 3V6CB 1GB4A 2MJ3A 1CZPA 2KKCA 5BYSA 5C2TB 3APCA 4L23A 1WXMA 1TZOA 3P4QB 3DVNV 3PGEA 5CHWA 4HWIB 3TMPB 3GOEA 2LXCA 3MFGA 2WGSA 1T0QC 4FLHA 5E6PA 4FHKA 1YJJA 4W9LA 2DZJA 3OJ3A 3OLMD 2WXRA 3RULA 3AEBB 3N32A 3KUCB 4A9AA 3U7ZA 3L10B 4HCPB 2MSED 4M00A 1QLBB 4K7UA 2DENB 1K52A 1WXSA 4YSYB 1B1ZA 1VJKA 2LI5A 3RD2A 2E6XA 2SEBD 4N9F4 1J8CA 2ZVNA 1RYJA 2WXIA 4HPMB 4ITKA 1I42A 4HLEA 1UBIA 1UNSA 5J2RA 3GP7A 3OG5A 4YL8A 4YWGG 4K7WA 2KJRA 2YLMA 4USAA 5G2NA 3WAMA 2D2QA 4DHZB 1IUEA 3P1MA 1FNVA 2L8JA 2LGDA 1VD2A 3E56A 4II2B 1E8WA 5FK9C 2N7EA 2Z0DB 1T6BX 4TKNA 2QMTA 2YEPB 2K25A 1WI0A 1Z5SB 1N6ZA 2KMMA 3T3NA 4JL9A 4S0RA 1WX8A 2UU7A 4ZRIA 5IA7A 1UH6A 4LTUA 3N20C 4MGKE 3QA8A 2BVCA 2OEDA 4M8NA 4W9IA 2XNAC 1TZ1A 3C8YA 4C4VA 5E6NA 3QC8B 3H8HA 4DWFA 3BK1A 2DBYA 2J7QB 2JYTA 2AX5A 1M4VA 1YD8U 2V4IB 2M0XA 3VDZA 2GBNA 1YQ3B 1ZXHA 3ABVB 3A1QB 2LFIA 2PVOD 5G5GA 1R4NB 3KWVA 2MWSB 1XD3B 4NJ6A 5LXHA 2EMSA 2N9KA 1WXVA 2YVCA 1UGMA 2QJLA 4MELA 2BF8B 1K51A 5H8YE 3EHVA 4DQOC 1OEYA 1SIFA 2JVCA 3S2AA 1I4HA 3ZXVA 1TS4A 2LWPA 2HJ8A 3DOWA 2LRWA 1MI0A 2BB5A 3QHTA 2DYOA 1TGZB 2Y3AA 1JALA 4II3B 1LGRA 4XWWA 2MLBA 1DYQA 2G1EA 1WR1A 4NAWB 1HE8A 1V81A 1J7AA 5HHDG 3RNBC 3SEBA 4QAYA 5BMHA 4FJYA 2KTFA 4YSXB 1B9RA 2NBVB 1C3TA 4GB9A 4BOSC 3RNEC 4FXCA 3VH4B 3B1LX 3DCGA 1N63A 1VZ6A 1T0SC 2PVGC 3RT3B 1WM2A 4DHJB 1P3QU 2MBBB 4RMAA 3UIPB 2LVPA 3NS8A 2FAZA 3P4PB 2LD9A 1C79A 2KWUB 1YQBA 2KWVB 2M8SA 3TIXA 3LYYA 2WXOA 4TSSA 2QSDA 1DGJA 1VR9A 4WURA 4KZ0A 4LNIA 5LXIB 1HZ5A 1WJNA 2VRRB 4JIOU 1FCCC 2N0SB 4FHJA 2BWFA 1E6EB 2JQRB 2ONQA 2MJEA 3DBRB 3AECB 1V1PB 2J42A 2J0JA 3CSTA 1CQVA 3APFA 2IDYA 3FAHA 3RNGC 4REZA 4DDGD 1F52A 3ZDMC 4BFRA 1D5ZC 3PSEB 3TBLD 1YJIA 4BVUC 4ZDVA 4W9GA 4HJGE 3A1QA 3QIJA 2NTSA 2B3AA 5HG2A 2IJ0A 3AE7B 3L16A 3RZFA 1UWMA 2KC2A 2O6VA 5H92C 5LLIA 1T5XD 5E6JA 2LASA 3TEWA 5FR3A 1N60A 1E90A 4IWPA 4WAAA 3ZLZA 4DXAB 4G3XB 5DCNA 4WAFA 2ZEQA 2PLPA 4ZYSA 2DWQA 3VTVA 4EE2A 1UD7A 3MC9A 1QOAA 1E7PB 4TQ0A 2C5LC 3AEFB 1RFKA 1BXTA 2IO0B 4YT0B 5BMIA 3Q8FA 1UF0A 3DHIC 2VH2A 4NAWA 1ZP0B 3V62A 1UGJA 3OAWA 4MSMB 2RPVA 2FNJB 1ZDXA 3DVGY 4ANWA 4A8XC 1OQYA 1IGCA 3DHHC 3RN9C 1V86A 3GB1A 1WZ3A 3WAOA 2KYWA 4F8CB 1D5XC 3C19A 3PRMB 1JCKB 1YX6B 3RNAC 1LXDA 3NVZA 1SE4A 3I9V1 4W9FA 3W9CB 2K6QA 1L0XB 1I4PA 4DBGA 3NVYA 2ZW0A 1MFWA 2LGYA 1IPGA 1TS5A 3R8BA 3ZQ4A 4K7SA 1JWAD 3KUZA 1KRHA 3R7QA 4C56C 1K53A 2WXKA 3QWZB 4OHJA 1QQRA 2L1AA 1V1PA 1TBEA 1LO5D 4RM9A 2MX2A 2PE9A 1GAQB 1XQQA 1ZXIA 2AEHA 1WRIA 1R4MI 1TY2A 1TY0A 3WIMA 5GXGB 2O2VB 2D3AA 3R3MA 3VRAB 5FR6A 4M02A 2FBWB 3W2DA 2R2OA 3NHEB 3P4SB 2WDVB 3GS2A 1NYRA 1J0GA 2RDHA 1WM3A 3MP9A 3QJZA 3IG3A 3ZDTA 1WGHA 2PIAA 4K1RB 2KK8A 2Z8LA 4UDUC 4P6VF 4WWPA 2NCNA 3Q6BA 2HJ1A 5AUKA 3BINA 1KOTA 2KFJA 3RPFC 4JQWC 1V80A 3AMZA 4PS3A 4AOFA 4ANXA 1WR6E 2JZZA 1H8CA 2INPE 2C7HA 4P1CC 4KGTA 5IO9A 1S1QB 3A33B 2BKRB 2K9XA 4RF1A 2KDBA 1PDXA 2OJWA 3GZNI 3UINB 3A9JB 4XDDA 2N9XA 2JY6A 2KD0A 4MGZE 1E7VA 4NJCA 5EDSA 5KHQA 2LHEA 3IVFA 5DPSA 4GGQA 5AZHA 4FULA 3RNFC 1PGXA 3NVVA 4W9HA 1N5WA 1VLBA 4C7ZA 4JWSC 4WJOA 4GMVA 1QILA 3AE6B 2L00B 5EE1A 1XCQL 2KANA 2CKHB 4RCOA 4MH0E 4EZLA 2RGFA 4I6NB 2IO1B 2JRHA 3R2TA 2J53A 3R7RA 1SXTA 4GOCA 2CU1A 1JW9D 2WP9B 4LNNA 1RWSA 3EUB2 2JRIB 1WZ0A 3B2FA 4KX6B 4FJZA 3PV1A 2INCC 4B0EA 2C7MB 2LJIA 4ARIA 3L0WB 2O2VA 2DAFA 2K1FA 1HZ6A 4BKSA 2FCQA 1PFDA 1EWCA 1MHXA 2JT4B 1XEEA 4N58A 4PYZA 3HIZA 1EF5A 4W9CA 4AUQC 1YN4A 5D2MB 4B6WA 4G11A 3IXSA 1PYWD 3PS6A 3ZNGC 3ZXRA 1WGDA 2GRIA 2IY0B 2KMAA 1NI2A 2LGSA 4KGSA 3U7DA 4EOYA 2WXGA 3PLUA 4IDIA 1LQBA 2JYEA 3JVZX 1Q10A 1R4NI 2FIDA 2ASQA 4XX5A 2MP2B 1DOXA 2Z0EB 3N9YC 1SE9A 4WQMA 4AP4C 2M0AA 4XGAB 2QEJC 4IW0A 2BB6A 4RGMA 4OVZA 1Y56A 1BT0A 2WXNA 3KVFB 2W55A 1U4AA 2I2YA 3P63A 4PS7A 1QZEA 5IP4D 3ZKJC 1PGBA 1ZUD2 1JQ4A 1FXIA 1XXGA 3I57A 3Q3JA 3TCAA 2EKEC 1I4QA 3ZNID 4CYEA 2KX3A 3CSFA 1KTKA 4GIVA 2KC1A 2ZNVB 2YEPF 2INNE 3K9PB 2L05A 3I63C 1SJED 4C7YA 2J0MA 2V9HA 3OWEB 5G5HA 2KOXA 3QQ8B 1WIAA 3OJ4B 2ZZPB 2WDQB 2UWQA 2KAJA 3GZNB 1WGKA 4KGRA 1YQ4B 3DQVA 3K9OB 1L6UA 4ANUA 4MM3B 1CK1A 1FRRA 1C78A 2AQ2B 3A4SC 3RFZB 4KKJA 3UIOB 3P4RB 3SHQA 3HM6X 1M94A 4F1SA 4GLSC 1C9FA 3TL5A 1TKYA 1XF5L 4P1BC 4RGNA 1D4BA 2KZRA 2KN5A 3IFWB 3B9JA 4OZAA 4A55A 1FNWA 1XLOA 1UZXB 3DBRI 2N4FA 1ZW7A 3BK2A 1XLNA 1V2YA 1EUVB 2G9HD 4KVGB 3DWGC 3TUOA 2WXQA 1TJEA 3KUDB 3AE1B 1JWUD 1RM6C 2OJRA 4NQKE 4TV3A 4FA6A 3APDA 2WXLA 2MP2A 4HKZE 1FM0D 2RSUA 4KSKC 1RFAA 2KLCA 2KQ7A 2KXJA 3AI5A 1WJ4A 1WXAA 2RMMA 2GBJA 4GN1A 1QT9A 1G6JA 1ZDVA 1I4GA 1Q0WB 4LK0M 3DPDA 1V9JA 2DNFA 2NPTB 1P7EA 2AL6A 1EWYC 3VUWA 1R7SA 2IO3B 4IG7B 4YTMB 4ANVA 1HEZE 3SFEB 4MJSB 1MHHE 2IZVB 4BKTA 2AWTA 3BYYB 1WF9A 2LMCA 1LFDA 2JZ3B 2ZW1A 2LRUA 4R3DA 1V5OA 1L6VA 1GC6A 3L4PA 1STEA 3ONSA 3WALA 2FE8A 3W5UB 3BYTB 1E8XA 1F77A 5AZFA 3DBHB 4C00A 1OQQA 1YIWA 3MHSD 2XN9C 2V3NA 4ASWC 2QHOA 2KQSA 5C23A 3IAM1 4G50A 4HROA 4FADA 2JZPA 3DVNU 4XWTA 3BY4B 3QK0A 5G55A 2NBWB 1ENFA 1S3SG 5IN7A 2ICIA 2L7RA 2BBCA 3VHTC 2CHZA 1ZGUB 3NRZA 1MJDA 3ZNHB 4XZ4A 3VAWA 1GG3A 4EZJA 1FXAA 1F9JA 3EC8A 1JWSD 5D3IB 3NZ3A 1N61A 2IBIB 2N9LA 2GMIC 3IT6B 3MC0B 1QOFA 1YMHE 2KDEB 2BPSA 1C4AA 1WMHB 3Q8EA 1SGHA 2PPHA 3W1SC 4AS1A 1QF6A 3AU5A 3AE5B 4WJQA 3VVWB 4IWOA 1D6EC 4Q2JA 3EFUA 5DPWA 4ZHPA 1KF6B 3BZDB 3T9LA 3PREA 3QARA 2NPTA 2C9WB 4TUUA 4A20A 1TKEA 2NTTA 4O1NA 1TKGA 3NOBA 3NG0A 2K22A 2RDGA 1IP9A 1ZPSA 1WYWB 4LJPB 4MJSA 3UQAA 1FFVA 1KH0A 3QCAA 3N1ZC 3VRBB 3TEYA 3WANA 1OTRB 2GBRA 4PT5A 5LNK1 1WFYA 2V3SA 3H7PB 2MH7A 4ZYNA 3V60A 2MBQA 2K8BA 5D7GA 3BVZA 3T8MA 2KJHB 1K8RB 5I4DA 1L4ZB 3HM3A 2JUOA 3I3TB 3U52E 3Q3NC 4ZRKA 4IWQA 2MBEA 2Z59B 4JPSA 1AN8A 1IBXB 1H4RA 3AE4B 3H9DA 4K81A 2M56B 4RH6A 3TEZA 1YNTE 3B2GA 3DBLB 2RPQA 4OZCA 3W1SA 4HKQA 1EF1A 5AEKB 3DHGC 2E3TA 2IO2B 4HK2A 4P7IA 4M8MA 4MGYE 1FMAD 1SEBD 1Y8RC 1UUPA 2D10A 2CU3A 2FCMA 3J9CA 3VH3B 4AQ7A 1XLPA 5GMVA 5TR5A 2L0TA 3LDZE 3R66C 3IBEA 3PT2B 1T3QA 4D2KA 2DZIA 3VR8B 1FRDA 1I4XA 1SSNA 1WMHA 1OGWA 3T3OA 2GLSA 1SE3A 5JXVA 3MHZA 4ARCA 2FUG1 3MJWA 1N5XA 3AEGB 3PLVA 1Z2MA 2W3SA 2MHJA 2SAKA 2JPHA 1C76A 2XEWA 3M63B 2VZKD 2O6VD 3LJ3A 1NDDA 4IC7B 2WYQA 1WX9A 3Q8CA 4MT5A 3M3JA 1WGYA 4BAXA 2DX5B 3U30A 4KIKB 1N62A 3WA0A 3QX1A 2HDEA 3H7PA 2KHWB 5CHVC 3L13A 2K8HA 3V61A 3A4RA 1J7CA 1JRPA 2IYDB 4XE0A 4YXDB 4M0WB 2CS4A 4HEA1 4US8A 3NUHB 4KZCA
chains in the Genus database with same CATH topology
1ISNA 4MGKE 4E3CA 1C1YB 3QA8A 4IW0A 4M8NA 4W9IA 1TZ1A 3HHMA 4MDKE 1BT0A 2L3ZA 3L17A 3QC8B 5E6NA 1IYFA 1GNUA 4DWFA 2J7QB 3KVFB 3B0AA 5CX3A 4EEWA 1U4AA 1YD8U 4CHKA 1Q1OA 2DZKA 4PS7A 2BWES 1QZEA 2M0XA 3VUXA 3ZKJC 2LJ5A 3VDZA 1MG8A 2GBNA 3Q3JA 5D6JB 4FBJB 3A1QB 3TCAA 5J17A 3KYDD 2EKEC 3RCZA 2MWSB 1XD3B 3HK0A 3ZNID 4DHZE 4CYEA 4I6LB 1V6EA 2KX3A 2LGXA 3CSFA 4BBNF 2BYVE 4GIVA 2KC1A 4NJ6A 4DK5A 2K8CA 2M17A 2ZNVB 4I6PA 5LXHA 2EMSA 2NR2A 3ZRFA 1WXVA 1V5TA 2WDTB 3K9PB 2YVCA 1UGMA 2L05A 4AJYB 3PRZA 5AZGA 4HPLB 4MELA 2BF8B 4NJ7A 3VUYA 3EHVA 1RLFA 1OEYA 2JWZA 2J0MA 1SIFA 2JVCA 4A3OA 2KVRA 3S2AA 2KOXA 3ENEA 1RRBA 1WIAA 2RD0A 3QQ8B 3OJ4B 2ZZPB 3H6NA 4F7ZA 2A4ZA 1WH3A 3ZW3A 1I35A 4EUTA 2UWQA 4MSQB 2LWPA 1Q5WB 4ZRJA 2KFKB 3UGBB 2HJ8A 3DOWA 5JZEB 4JLCA 3DQVA 2LRWA 2EMTA 5DPRA 3QHTA 1L7YA 3KW5B 3PHXB 3K9OB 4B9KA 4ANUA 2DYOA 2FUHB 1TGZB 3A4SC 2AL3A 2FIFA 4II3B 2N9PC 3UIOB 3ZNZB 3SHQA 3HM6X 3PRPB 1M94A 2MLBA 4F1SA 5C1ZA 1WR1A 3JSVB 4NAWB 2KDFB 5D94A 1HE8A 3QAQA 1ZKHA 1V81A 5KHOA 2KJ6A 3TL5A 1T0YA 4BKGA 1GJZA 2KZRA 4FJYA 2KN5A 2LZ6A 3IFWB 3SDLC 4DDID 2KTFA 4AP4C 3P2BA 2MCNB 2NBVB 3TJPA 1C3TA 3NZUA 3ZO5B 4KIKA 4GB9A 4BOSC 3U8ZA 2MBHA 1UZXB 3DBRI 4PYUA 2N4FA 1ZW7A 3VH4B 4AJWA 3B1LX 2G45B 3DDCB 3DCGA 4W9KA 1V2YA 3RYTA 2KDIA 1EUVB 2XK5B 1WM2A 2L0FA 3RT3B 3VXWA 4KVGB 4DHJB 1P3QU 1RAXA 2MBBB 4WWNA 4RMAA 3UIPB 2MQJA 2R2QA 1X1MA 3H1UA 2LVPA 3KUDB 1KM7A 3PVLA 3NS8A 4URKA 2OJRA 4NQKE 2FAZA 2MRPA 2LD9A 2KWUB 4TV3A 2K39A 2MBOA 1YQBA 3APDA 2KWVB 2MP2A 1GC7A 2JF5A 3NY5A 4IUMB 2M8SA 3AULA 3TIXA 2NS5A 5L95C 2ZCCA 2MW5A 1LM8B 4MEMA 4KZ0A 4KSKC 2RSUA 5J18A 2DAJA 1RFAA 5LXIB 4GSWA 1WJNA 2VRRB 2KLCA 2KQ7A 2KXJA 3AI5A 4HXDA 1WJ4A 1WXAA 4JIOU 4FHJA 4NPNA 2BWFA 3UF8A 2GBJA 3VFKA 4FN2A 1UBQA 4GN1A 2W9NA 2L76A 1G6JA 2M4NA 2G4SA 2J0JA 3CSTA 2WX0A 1Q0WB 3DPDA 3APFA 2DHZA 1V9JA 2NPTB 1XT9B 4J6IA 4DDGD 2AL6A 3ZDMC 2KX0A 4BFRA 3AXCA 3VUWA 3PSEB 3TBLD 3ZVVA 5BO4B 4BVUC 4NQLB 3DBHI 2IO3B 3N30A 4W9GA 3X23A 3A1QA 2D07B 3A9JA 4IG7B 4ZDVA 3UQBA 2KTRB 2ZPYA 3NZSA 3QIJA 3VTWA 4ANVA 3JYUA 4BBNC 4WJPA 2KMCA 2B3AA 4W9EA 4MJSB 4DHJD 4HDQA 2IZVB 4GDKB 4BKTA 2AWTA 1WF9A 2JXXA 1LFDA 2ZCBA 3CF6E 3L16A 3RZFA 2JZ3B 2PJHA 2LRUA 2D3GA 4W9JA 1V5OA 2KC2A 2O6VA 5LLIA 4X57B 3M95A 2FCSA 4GDLB 2LASA 2I1JA 1E5WA 1E90A 1GC6A 4IWPA 2V1YA 4WAAA 3ZLZA 3ONSA 3WALA 4DXAB 4G3XB 4LDTB 5DCNA 4GXBA 2ZEQA 2LVOA 4HJKA 3VTVA 3Q3FA 1E8XA 2GOWA 2DYMA 2J0KA 1UD7A 3SD5A 5AZFA 4A3PA 2KFKA 1YIWA 3MHSD 3IHPC 4TQ0A 4NNJB 2C5LC 1UELA 4ASWC 2QHOA 2N7DA 3ZTDA 3EECA 2KQSA 4IM0A 3DVGX 2IO0B 5C23A 2PE6B 3CMMB 3KYCD 4G50A 1WX7A 3JSVA 4LCDE 1WGRA 4NAWA 4FADA 3DVNU 1PQSA 4XC2A 2GBKA 3V62A 3OAWA 1P98A 2LUEA 4HDOA 4MSMB 2FNJB 3BY4B 4LJOB 3DVGY 3DBSA 3WAPA 3QK0A 5G55A 2ZNVC 3JW0X 4ANWA 4WJNA 1OQYA 1WRDB 2NBWB 2DZMA 5JH5C 1S3SG 1V86A 1WZ3A 1A5RA 3WAOA 3C0RB 1FXTB 2L7RA 3VHTC 4LDTD 3W1YA 1NBFC 1J19A 2CHZA 3O65B 2MA9B 4F8CB 1ZGUB 1VCBA 3PRMB 3ZNHB 1YX6B 4XZ4A 3L08A 1V49A 5HKHA 4G0NB 3VAWA 2I1KA 2XK5A 4KDIC 1GG3A 4AWJA 4EZJA 1LXDA 4E74A 1F9JA 3EC8A 4EFOA 5DPTA 2BGFA 4W9FA 2IBIB 5JHAA 1YX5B 2K6QA 2ZPNA 2GMIC 2WWZA 3M62B 4DBGA 2KDEB 2OOBB 2BPSA 2LGYA 5CHFA 1IPGA 2CHXA 3VTUA 1WMHB 2G3QB 2M1MA 1SGHA 4K7SA 3KUZA 1D3ZA 3R7QA 2PPHA 3W1SC 2K6DB 3D32A 3AU5A 3QWZB 2KWCA 4BOZB 2D11A 4WJQA 2REXA 3VVWB 4IWOA 3ZTCA 2GBMA 3EFUA 5DPWA 1TBEA 3KH0A 4RM9A 2MX2A 2PE9A 5CTRC 3T9LA 3PREA 3QARA 2NPTA 2BKFA 1XQQA 2C9WB 3A9KB 4TUUA 3RZWC 2AEHA 2HD5B 2N1WA 4A20A 2DYBA 3B08A 3NOBA 1R4MI 3VQIA 3WIMA 3ZUNA 5JHBA 4IM3A 2IY1B 2O2VB 4NY0A 3R3MA 2NBUA 5FR6A 1P9DU 2KTRA 3PTFC 4ICUA 1IP9A 3N3KB 1WYWB 4LJPB 4MJSA 3ALBA 3UQAA 4FJVB 4GDKA 2C7NB 2R2OA 3NHEB 4ICVA 3QCAA 4WWOA 3WANA 1OTRB 1P0RA 4HCNB 2GBRA 1E7UA 1J0GA 1WM3A 4GDLA 1L2NA 1CMXB 2CR5A 3QJZA 1E8ZA 1WFYA 2V3SA 3IG3A 3H7PB 3ZDTA 2N1VA 4ZYNA 4TQ1A 1WGHA 4K1RB 2KK8A 4CO7A 5IA7A 3V60A 2MBQA 1WE7A 3DBLI 4KSLC 2K8BA 2KLGA 4WWPA 2NCNA 5D7GA 3ZIMA 1KLVA 3PHWB 3BINA 2KJHB 2XBBC 3T8MA 5IAAC 1KOTA 2KFJA 4JQWC 1WJ6A 1V80A 1K8RB 4RM8A 1WGGA 4PS3A 4AOFA 4W9DA 4ANXA 1WR6E 2JZZA 3HM3A 2JUOA 1H8CA 3PPAA 3I3TB 2C7HA 2KO3A 1WJUA 4ZRKA 4MGIE 2UYZB 2CHWA 1S1QB 3A33B 4BKSD 4IWQA 2ZJDA 3ECIA 2BKRB 2MBEA 2Z59B 4KV2A 2FCNA 2KDBA 4OVUA 3MTNB 3GZNI 3UINB 3A9JB 1H4RA 2N9XA 2JY6A 3SU8X 4B95A 3H9DA 4K81A 4IM2A 4MM3A 3V6CB 2V4LA 2KD0A 4MGZE 1E7VA 2WX1A 5EDSA 5KHQA 3IVFA 2BYEA 5DPSA 2KKCA 4GGQA 2RPQA 5AZHA 3W1SA 2G4DB 1EF1A 4FULA 2O6VB 5AEKB 4KDLB 3APCA 4W9HA 2IO2B 4HK2A 1WXMA 4P7IA 2Y5BB 4WJOA 4GMVA 1WY8A 2L00B 4M8MA 4MGYE 2KANA 4WQOB 1Y8RC 2CKHB 3AU4A 4MH0E 2D10A 3DVNV 2FCMA 4EZLA 3PGEA 2RGFA 4I6NB 2IO1B 3VH3B 5CHWA 2JRHA 2C60A 3ZRCA 4HWIB 5GMVA 1TTNA 5TR5A 2L0TA 1AARA 4E71A 2NVUI 2PEAA 3LDZE 3TMPB 3R66C 3GOEA 3IBEA 1KJTA 3PT2B 2LXCA 2DZIA 2HE7A 3R7RA 4GOCA 2CU1A 1WMHA 1OGWA 4FLHA 5E6PA 4FHKA 4W9LA 2JRIB 2DZJA 3OJ3A 3RUIB 3OLMD 1WZ0A 4KZCA 3MJWA 3RULA 1P1AA 3PLVA 3V6EB 1EO6A 3KUCB 2BYFA 2RR9A 3N32A 4EZKA 1Z2MA 4HVBA 3L10B 1OEYJ 4HCPB 2MSED 4GU2A 4FJZA 3A9KA 4K7UA 2DENB 3PV1A 2JPHA 1JRUA 4EKUA 1WXSA 2C7MB 2XEWA 3M63B 3L0WB 2O6VD 3LJ3A 2LI5A 4JGHB 2A5UA 2O2VA 2DAFA 1NDDA 2K1FA 4BKSA 4IC7B 2FCQA 3RD2A 4N9F4 3H7SA 2WYQA 1J8CA 2ZVNA 4HPMB 1WX9A 1I42A 4HLEA 4OVVA 2JT4B 3PZDA 4FA6A 4W9CA 4PYZA 1UBIA 3HIZA 1EF5A 2LVQA 3M3JA 4AUQC 5J2RA 2KNBA 2AYOB 1WGYA 5D2MB 2DX5B 4YL8A 4B6WA 2LXAA 4K7WA 2KJRA 4PS8A 2YLMA 4G11A 3U30A 4KIKB 3PS6A 3ZNGC 5G2NA 3L54A 2HTHA 5E6OA 3WAMA 2D2QA 3WA0A 1E8YA 3QX1A 3H7PA 1WGDA 4DHZB 2IY0B 2KHWB 2KMAA 1NI2A 3ML8A 3X0WA 2L8JA 2LGDA 1VD2A 4II2B 5L83A 1E8WA 3U7DA 5CHVC 4EOYA 1YJ1A 3L13A 2N7EA 2Z0DB 2K8HA 3PLUA 3V61A 4TKNA 1GUAB 1LQBA 3JVZX 2K25A 2FIDA 1R4NI 3A4RA 2ASQA 1WI0A 3ML9A 4XX5A 1Z5SB 2MP2B 2Z0EB 2IYDB 2N9EB 2ZVOA 2CS4A 4JL9A 4M0WB 1WE6A 1SE9A 1WX8A 4ZRIA 1UH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISN A;  4MGK E;  4E3C A;  1C1Y B;  3QA8 A;  4IW0 A;  4M8N A;  4W9I A;  1TZ1 A;  3HHM A;  4MDK E;  1BT0 A;  2L3Z A;  3L17 A;  3QC8 B;  5E6N A;  1IYF A;  1GNU A;  4DWF A;  2J7Q B;  3KVF B;  3B0A A;  5CX3 A;  4EEW A;  1U4A A;  1YD8 U;  4CHK A;  1Q1O A;  2DZK A;  4PS7 A;  2BWE S;  1QZE A;  2M0X A;  3VUX A;  3ZKJ C;  2LJ5 A;  3VDZ A;  1MG8 A;  2GBN A;  3Q3J A;  5D6J B;  4FBJ B;  3A1Q B;  3TCA A;  5J17 A;  3KYD D;  2EKE C;  3RCZ A;  2MWS B;  1XD3 B;  3HK0 A;  3ZNI D;  4DHZ E;  4CYE A;  4I6L B;  1V6E A;  2KX3 A;  2LGX A;  3CSF A;  4BBN F;  2BYV E;  4GIV A;  2KC1 A;  4NJ6 A;  4DK5 A;  2K8C A;  2M17 A;  2ZNV B;  4I6P A;  5LXH A;  2EMS A;  2NR2 A;  3ZRF A;  1WXV A;  1V5T A;  2WDT B;  3K9P B;  2YVC A;  1UGM A;  2L05 A;  4AJY B;  3PRZ A;  5AZG A;  4HPL B;  4MEL A;  2BF8 B;  4NJ7 A;  3VUY A;  3EHV A;  1RLF A;  1OEY A;  2JWZ A;  2J0M A;  1SIF A;  2JVC A;  4A3O A;  2KVR A;  3S2A A;  2KOX A;  3ENE A;  1RRB A;  1WIA A;  2RD0 A;  3QQ8 B;  3OJ4 B;  2ZZP B;  3H6N A;  4F7Z A;  2A4Z A;  1WH3 A;  3ZW3 A;  1I35 A;  4EUT A;  2UWQ A;  4MSQ B;  2LWP A;  1Q5W B;  4ZRJ A;  2KFK B;  3UGB B;  2HJ8 A;  3DOW A;  5JZE B;  4JLC A;  3DQV A;  2LRW A;  2EMT A;  5DPR A;  3QHT A;  1L7Y A;  3KW5 B;  3PHX B;  3K9O B;  4B9K A;  4ANU A;  2DYO A;  2FUH B;  1TGZ B;  3A4S C;  2AL3 A;  2FIF A;  4II3 B;  2N9P C;  3UIO B;  3ZNZ B;  3SHQ A;  3HM6 X;  3PRP B;  1M94 A;  2MLB A;  4F1S A;  5C1Z A;  1WR1 A;  3JSV B;  4NAW B;  2KDF B;  5D94 A;  1HE8 A;  3QAQ A;  1ZKH A;  1V81 A;  5KHO A;  2KJ6 A;  3TL5 A;  1T0Y A;  4BKG A;  1GJZ A;  2KZR A;  4FJY A;  2KN5 A;  2LZ6 A;  3IFW B;  3SDL C;  4DDI D;  2KTF A;  4AP4 C;  3P2B A;  2MCN B;  2NBV B;  3TJP A;  1C3T A;  3NZU A;  3ZO5 B;  4KIK A;  4GB9 A;  4BOS C;  3U8Z A;  2MBH A;  1UZX B;  3DBR I;  4PYU A;  2N4F A;  1ZW7 A;  3VH4 B;  4AJW A;  3B1L X;  2G45 B;  3DDC B;  3DCG A;  4W9K A;  1V2Y A;  3RYT A;  2KDI A;  1EUV B;  2XK5 B;  1WM2 A;  2L0F A;  3RT3 B;  3VXW A;  4KVG B;  4DHJ B;  1P3Q U;  1RAX A;  2MBB B;  4WWN A;  4RMA A;  3UIP B;  2MQJ A;  2R2Q A;  1X1M A;  3H1U A;  2LVP A;  3KUD B;  1KM7 A;  3PVL A;  3NS8 A;  4URK A;  2OJR A;  4NQK E;  2FAZ A;  2MRP A;  2LD9 A;  2KWU B;  4TV3 A;  2K39 A;  2MBO A;  1YQB A;  3APD A;  2KWV B;  2MP2 A;  1GC7 A;  2JF5 A;  3NY5 A;  4IUM B;  2M8S A;  3AUL A;  3TIX A;  2NS5 A;  5L95 C;  2ZCC A;  2MW5 A;  1LM8 B;  4MEM A;  4KZ0 A;  4KSK C;  2RSU A;  5J18 A;  2DAJ A;  1RFA A;  5LXI B;  4GSW A;  1WJN A;  2VRR B;  2KLC A;  2KQ7 A;  2KXJ A;  3AI5 A;  4HXD A;  1WJ4 A;  1WXA A;  4JIO U;  4FHJ A;  4NPN A;  2BWF A;  3UF8 A;  2GBJ A;  3VFK A;  4FN2 A;  1UBQ A;  4GN1 A;  2W9N A;  2L76 A;  1G6J A;  2M4N A;  2G4S A;  2J0J A;  3CST A;  2WX0 A;  1Q0W B;  3DPD A;  3APF A;  2DHZ A;  1V9J A;  2NPT B;  1XT9 B;  4J6I A;  4DDG D;  2AL6 A;  3ZDM C;  2KX0 A;  4BFR A;  3AXC A;  3VUW A;  3PSE B;  3TBL D;  3ZVV A;  5BO4 B;  4BVU C;  4NQL B;  3DBH I;  2IO3 B;  3N30 A;  4W9G A;  3X23 A;  3A1Q A;  2D07 B;  3A9J A;  4IG7 B;  4ZDV A;  3UQB A;  2KTR B;  2ZPY A;  3NZS A;  3QIJ A;  3VTW A;  4ANV A;  3JYU A;  4BBN C;  4WJP A;  2KMC A;  2B3A A;  4W9E A;  4MJS B;  4DHJ D;  4HDQ A;  2IZV B;  4GDK B;  4BKT A;  2AWT A;  1WF9 A;  2JXX A;  1LFD A;  2ZCB A;  3CF6 E;  3L16 A;  3RZF A;  2JZ3 B;  2PJH A;  2LRU A;  2D3G A;  4W9J A;  1V5O A;  2KC2 A;  2O6V A;  5LLI A;  4X57 B;  3M95 A;  2FCS A;  4GDL B;  2LAS A;  2I1J A;  1E5W A;  1E90 A;  1GC6 A;  4IWP A;  2V1Y A;  4WAA A;  3ZLZ A;  3ONS A;  3WAL A;  4DXA B;  4G3X B;  4LDT B;  5DCN A;  4GXB A;  2ZEQ A;  2LVO A;  4HJK A;  3VTV A;  3Q3F A;  1E8X A;  2GOW A;  2DYM A;  2J0K A;  1UD7 A;  3SD5 A;  5AZF A;  4A3P A;  2KFK A;  1YIW A;  3MHS D;  3IHP C;  4TQ0 A;  4NNJ B;  2C5L C;  1UEL A;  4ASW C;  2QHO A;  2N7D A;  3ZTD A;  3EEC A;  2KQS A;  4IM0 A;  3DVG X;  2IO0 B;  5C23 A;  2PE6 B;  3CMM B;  3KYC D;  4G50 A;  1WX7 A;  3JSV A;  4LCD E;  1WGR A;  4NAW A;  4FAD A;  3DVN U;  1PQS A;  4XC2 A;  2GBK A;  3V62 A;  3OAW A;  1P98 A;  2LUE A;  4HDO A;  4MSM B;  2FNJ B;  3BY4 B;  4LJO B;  3DVG Y;  3DBS A;  3WAP A;  3QK0 A;  5G55 A;  2ZNV C;  3JW0 X;  4ANW A;  4WJN A;  1OQY A;  1WRD B;  2NBW B;  2DZM A;  5JH5 C;  1S3S G;  1V86 A;  1WZ3 A;  1A5R A;  3WAO A;  3C0R B;  1FXT B;  2L7R A;  3VHT C;  4LDT D;  3W1Y A;  1NBF C;  1J19 A;  2CHZ A;  3O65 B;  2MA9 B;  4F8C B;  1ZGU B;  1VCB A;  3PRM B;  3ZNH B;  1YX6 B;  4XZ4 A;  3L08 A;  1V49 A;  5HKH A;  4G0N B;  3VAW A;  2I1K A;  2XK5 A;  4KDI C;  1GG3 A;  4AWJ A;  4EZJ A;  1LXD A;  4E74 A;  1F9J A;  3EC8 A;  4EFO A;  5DPT A;  2BGF A;  4W9F A;  2IBI B;  5JHA A;  1YX5 B;  2K6Q A;  2ZPN A;  2GMI C;  2WWZ A;  3M62 B;  4DBG A;  2KDE B;  2OOB B;  2BPS A;  2LGY A;  5CHF A;  1IPG A;  2CHX A;  3VTU A;  1WMH B;  2G3Q B;  2M1M A;  1SGH A;  4K7S A;  3KUZ A;  1D3Z A;  3R7Q A;  2PPH A;  3W1S C;  2K6D B;  3D32 A;  3AU5 A;  3QWZ B;  2KWC A;  4BOZ B;  2D11 A;  4WJQ A;  2REX A;  3VVW B;  4IWO A;  3ZTC A;  2GBM A;  3EFU A;  5DPW A;  1TBE A;  3KH0 A;  4RM9 A;  2MX2 A;  2PE9 A;  5CTR C;  3T9L A;  3PRE A;  3QAR A;  2NPT A;  2BKF A;  1XQQ A;  2C9W B;  3A9K B;  4TUU A;  3RZW C;  2AEH A;  2HD5 B;  2N1W A;  4A20 A;  2DYB A;  3B08 A;  3NOB A;  1R4M I;  3VQI A;  3WIM A;  3ZUN A;  5JHB A;  4IM3 A;  2IY1 B;  2O2V B;  4NY0 A;  3R3M A;  2NBU A;  5FR6 A;  1P9D U;  2KTR A;  3PTF C;  4ICU A;  1IP9 A;  3N3K B;  1WYW B;  4LJP B;  4MJS A;  3ALB A;  3UQA A;  4FJV B;  4GDK A;  2C7N B;  2R2O A;  3NHE B;  4ICV A;  3QCA A;  4WWO A;  3WAN A;  1OTR B;  1P0R A;  4HCN B;  2GBR A;  1E7U A;  1J0G A;  1WM3 A;  4GDL A;  1L2N A;  1CMX B;  2CR5 A;  3QJZ A;  1E8Z A;  1WFY A;  2V3S A;  3IG3 A;  3H7P B;  3ZDT A;  2N1V A;  4ZYN A;  4TQ1 A;  1WGH A;  4K1R B;  2KK8 A;  4CO7 A;  5IA7 A;  3V60 A;  2MBQ A;  1WE7 A;  3DBL I;  4KSL C;  2K8B A;  2KLG A;  4WWP A;  2NCN A;  5D7G A;  3ZIM A;  1KLV A;  3PHW B;  3BIN A;  2KJH B;  2XBB C;  3T8M A;  5IAA C;  1KOT A;  2KFJ A;  4JQW C;  1WJ6 A;  1V80 A;  1K8R B;  4RM8 A;  1WGG A;  4PS3 A;  4AOF A;  4W9D A;  4ANX A;  1WR6 E;  2JZZ A;  3HM3 A;  2JUO A;  1H8C A;  3PPA A;  3I3T B;  2C7H A;  2KO3 A;  1WJU A;  4ZRK A;  4MGI E;  2UYZ B;  2CHW A;  1S1Q B;  3A33 B;  4BKS D;  4IWQ A;  2ZJD A;  3ECI A;  2BKR B;  2MBE A;  2Z59 B;  4KV2 A;  2FCN A;  2KDB A;  4OVU A;  3MTN B;  3GZN I;  3UIN B;  3A9J B;  1H4R A;  2N9X A;  2JY6 A;  3SU8 X;  4B95 A;  3H9D A;  4K81 A;  4IM2 A;  4MM3 A;  3V6C B;  2V4L A;  2KD0 A;  4MGZ E;  1E7V A;  2WX1 A;  5EDS A;  5KHQ A;  3IVF A;  2BYE A;  5DPS A;  2KKC A;  4GGQ A;  2RPQ A;  5AZH A;  3W1S A;  2G4D B;  1EF1 A;  4FUL A;  2O6V B;  5AEK B;  4KDL B;  3APC A;  4W9H A;  2IO2 B;  4HK2 A;  1WXM A;  4P7I A;  2Y5B B;  4WJO A;  4GMV A;  1WY8 A;  2L00 B;  4M8M A;  4MGY E;  2KAN A;  4WQO B;  1Y8R C;  2CKH B;  3AU4 A;  4MH0 E;  2D10 A;  3DVN V;  2FCM A;  4EZL A;  3PGE A;  2RGF A;  4I6N B;  2IO1 B;  3VH3 B;  5CHW A;  2JRH A;  2C60 A;  3ZRC A;  4HWI B;  5GMV A;  1TTN A;  5TR5 A;  2L0T A;  1AAR A;  4E71 A;  2NVU I;  2PEA A;  3LDZ E;  3TMP B;  3R66 C;  3GOE A;  3IBE A;  1KJT A;  3PT2 B;  2LXC A;  2DZI A;  2HE7 A;  3R7R A;  4GOC A;  2CU1 A;  1WMH A;  1OGW A;  4FLH A;  5E6P A;  4FHK A;  4W9L A;  2JRI B;  2DZJ A;  3OJ3 A;  3RUI B;  3OLM D;  1WZ0 A;  4KZC A;  3MJW A;  3RUL A;  1P1A A;  3PLV A;  3V6E B;  1EO6 A;  3KUC B;  2BYF A;  2RR9 A;  3N32 A;  4EZK A;  1Z2M A;  4HVB A;  3L10 B;  1OEY J;  4HCP B;  2MSE D;  4GU2 A;  4FJZ A;  3A9K A;  4K7U A;  2DEN B;  3PV1 A;  2JPH A;  1JRU A;  4EKU A;  1WXS A;  2C7M B;  2XEW A;  3M63 B;  3L0W B;  2O6V D;  3LJ3 A;  2LI5 A;  4JGH B;  2A5U A;  2O2V A;  2DAF A;  1NDD A;  2K1F A;  4BKS A;  4IC7 B;  2FCQ A;  3RD2 A;  4N9F 4;  3H7S A;  2WYQ A;  1J8C A;  2ZVN A;  4HPM B;  1WX9 A;  1I42 A;  4HLE A;  4OVV A;  2JT4 B;  3PZD A;  4FA6 A;  4W9C A;  4PYZ A;  1UBI A;  3HIZ A;  1EF5 A;  2LVQ A;  3M3J A;  4AUQ C;  5J2R A;  2KNB A;  2AYO B;  1WGY A;  5D2M B;  2DX5 B;  4YL8 A;  4B6W A;  2LXA A;  4K7W A;  2KJR A;  4PS8 A;  2YLM A;  4G11 A;  3U30 A;  4KIK B;  3PS6 A;  3ZNG C;  5G2N A;  3L54 A;  2HTH A;  5E6O A;  3WAM A;  2D2Q A;  3WA0 A;  1E8Y A;  3QX1 A;  3H7P A;  1WGD A;  4DHZ B;  2IY0 B;  2KHW B;  2KMA A;  1NI2 A;  3ML8 A;  3X0W A;  2L8J A;  2LGD A;  1VD2 A;  4II2 B;  5L83 A;  1E8W A;  3U7D A;  5CHV C;  4EOY A;  1YJ1 A;  3L13 A;  2N7E A;  2Z0D B;  2K8H A;  3PLU A;  3V61 A;  4TKN A;  1GUA B;  1LQB A;  3JVZ X;  2K25 A;  2FID A;  1R4N I;  3A4R A;  2ASQ A;  1WI0 A;  3ML9 A;  4XX5 A;  1Z5S B;  2MP2 B;  2Z0E B;  2IYD B;  2N9E B;  2ZVO A;  2CS4 A;  4JL9 A;  4M0W B;  1WE6 A;  1SE9 A;  1WX8 A;  4ZRI A;  1UH6 A; 
#chains in the Genus database with same CATH topology
 1ISN A;  1C1Y B;  3V3X A;  1IBX A;  3AEA B;  3L17 A;  5TSS A;  5CX3 A;  2WNM A;  1Q1O A;  4JX1 C;  2BWE S;  3GE8 C;  1SB3 C;  2LJ5 A;  5D6J B;  4FBJ B;  3U4E G;  5J17 A;  4XYC A;  1ZE3 D;  2KQ4 X;  3EFC A;  2PTL A;  1VRA B;  2R61 A;  4BBN F;  2BYV E;  4I6P A;  2WDT B;  4K3C A;  4P16 A;  3TSS A;  2Y5C A;  1VZ7 A;  4NJ7 A;  2BQQ A;  3FIL B;  2WHI A;  2JWZ A;  4A3O A;  2KVR A;  4JE3 B;  1RRB A;  2RD0 A;  3H6N A;  1I35 A;  5JZE B;  3Q14 C;  2EMT A;  5DPR A;  3PHX B;  4B9K A;  1ROE A;  5IKC M;  2FIF A;  4KKI A;  1SIJ A;  5HI1 A;  3JSV B;  2KDF B;  5D94 A;  3AEE B;  1ZKH A;  4CQN A;  2BS2 B;  3Q69 A;  1GJZ A;  4IOI E;  4ZOH C;  3AE2 B;  2WXM A;  4DDI D;  4K3B A;  4YTP B;  2N7J A;  3TJP A;  1JWM D;  5BMG A;  1QOB A;  1V97 A;  3NZU A;  4KIK A;  3U8Z A;  2BW2 A;  2LGI A;  1KFY B;  3DDC B;  2KDI A;  2QIE B;  1PUT A;  3PO0 A;  2XK5 B;  3O13 A;  2L0F A;  3VXW A;  1EU4 A;  2MQJ A;  1X1M A;  4J3O D;  1KM7 A;  2J4X A;  2WDR B;  2MRP A;  2JX5 A;  1KLV A;  4IUM B;  3NY5 A;  1GC7 A;  5L95 C;  3AUL A;  3HUI A;  2MW5 A;  4MEM A;  2DAJ A;  4US9 A;  1AYF A;  1FO4 A;  2J52 A;  3UF8 A;  3VFK A;  4FN2 A;  2W9N A;  2L76 A;  3BWU D;  2M4N A;  1I7H A;  3V05 A;  1JRO A;  3AED B;  4HRS A;  2DHZ A;  4J6I A;  1F2R I;  1XLQ A;  5BO4 B;  3DBH I;  3X23 A;  3A9J A;  2V0G A;  4B0M A;  2KTR B;  3NZS A;  3VTW A;  3JYU A;  4BBN C;  4WJP A;  4HDQ A;  2ZCB A;  3CF6 E;  2D3C A;  2PJH A;  2D3G A;  2CJO A;  1TT5 B;  1YN3 A;  4X57 B;  3M95 A;  3P42 A;  4GDL B;  2I1J A;  3Q3O C;  3SR6 A;  3KLS X;  4L1B A;  1TS3 A;  2WXP A;  3ETR A;  2WXF A;  2PKO A;  2J0K A;  1V8C A;  2L52 A;  3SD5 A;  2W3R A;  4A3P A;  2D3B A;  1QKZ A;  4NNJ B;  2WU5 B;  3PZ7 A;  3EEC A;  3HRD D;  4IM0 A;  3DVG X;  2PE6 B;  1J7B A;  1WX7 A;  1KLG D;  3JSV A;  4LCD E;  1PQS A;  4XC2 A;  2WQY B;  2GBK A;  3NS1 A;  4LJO B;  2ZNV C;  4RGT A;  4WJN A;  2DZM A;  5JH5 C;  5MPO A;  1QOG A;  4RGO S;  4LDT D;  3W1Y A;  1NBF C;  1J19 A;  2MA9 B;  2QCZ A;  2IND C;  1V49 A;  3MJ5 A;  4G0N B;  2XK5 A;  4E74 A;  4EFO A;  5JHA A;  4XDC A;  3M62 B;  2OOB B;  1SJH D;  3VTU A;  3AE9 B;  2G3Q B;  2M1M A;  1D3Z A;  2ON8 A;  4RFB A;  1FD6 A;  1YOV B;  2K6D B;  1HTO A;  4H2A A;  1I4R A;  2REX A;  2WS3 B;  4WWM A;  2GBM A;  3KH0 A;  1ACC A;  3A9K B;  1FCL A;  2N1W A;  4YTN B;  1ET6 A;  4NAM A;  3VQI A;  3ZUN A;  5JHB A;  2IY1 B;  4NY0 A;  5IOI A;  4S17 A;  2KTR A;  2HTM E;  2C7N B;  4ICV A;  4WWO A;  1AW7 A;  1E7U A;  3LXF A;  4GDL A;  1CMX B;  2EKI A;  1VZ8 A;  1D5M C;  2KAC A;  3BVG A;  1A70 A;  4TQ1 A;  3URY A;  4CO7 A;  2Q5W D;  1WE7 A;  3DBL I;  4KSL C;  2WXH A;  2KLG A;  2D5G A;  2BTE A;  3PHW B;  1WJ6 A;  4L2Y A;  1NEN B;  3CIR B;  3E9S A;  3IAS 1;  1WJU A;  2UYZ B;  2CHW A;  1HXY D;  2ZJD A;  4KV2 A;  1EM7 A;  4OVU A;  3MTN B;  4DXF A;  2Y5P A;  2WXJ A;  4B95 A;  4MM3 A;  2WU2 B;  2V4L A;  3Q2A C;  2CJN A;  2BT6 A;  2WX1 A;  1TS2 A;  2BYE A;  1KLU D;  3AV8 A;  2G4D B;  1C4C A;  2IGG A;  2VZK B;  2O6V B;  5BYR A;  4KDL B;  2Y5B B;  1WY8 A;  4RF0 A;  1F2R C;  4WQO B;  1DOI A;  3AU4 A;  2C60 A;  3ZRC A;  2L32 A;  4E71 A;  1TTN A;  1AAR A;  2NVU I;  2PEA A;  1KJT A;  2HE7 A;  2QDF A;  3RNC C;  2X38 A;  2BS4 B;  4A6Q A;  2KDM A;  2KT7 A;  1C77 A;  1HQR D;  3SFD B;  3UI3 A;  2KWD A;  2W54 A;  3KWL A;  1FPY A;  3RUI B;  1AWD A;  1IGD A;  2K5P A;  1FIQ A;  1P1A A;  3V6E B;  1EO6 A;  1YN5 A;  2BYF A;  2RR9 A;  1HA5 A;  4EZK A;  4HVB A;  1F0Z A;  1OEY J;  4GU2 A;  3A9K A;  3NVW A;  2I38 A;  3I5J C;  1JRU A;  2DLB A;  4OZB A;  4EKU A;  4YSZ B;  3ZJU A;  4JGH B;  2A5U A;  2OHF A;  3H7S A;  4OW0 A;  1TIF A;  4OVV A;  3PZD A;  1MVK A;  2LVQ A;  3AN1 A;  4BZA A;  2KNB A;  2AYO B;  2PW9 A;  2KVZ A;  2LXA A;  3MC8 A;  4PS8 A;  1GPX A;  1V1O A;  3L54 A;  2HTH A;  5E6O A;  1E8Y A;  4N6E B;  1VDV A;  3GE3 C;  4HPP A;  3ML8 A;  3X0W A;  5AUI A;  1NI3 A;  5L83 A;  1NYQ A;  1YJ1 A;  1EU3 A;  3RMK C;  1WYG A;  1GUA B;  3ML9 A;  2K3U A;  1XO3 A;  2N9E B;  2ZVO A;  1WE6 A;  2JWU A;  4E3C A;  2RDB C;  4LLG M;  3R2I A;  1SBB B;  3HHM A;  4MDK E;  2L3Z A;  1IYF A;  4C80 A;  1GNU A;  1FNU A;  3B0A A;  4EEW A;  4MH8 A;  1TYG B;  1E9M A;  4CHK A;  2AQ3 B;  2IPK D;  2DZK A;  3VUX A;  2EEL A;  3U2S C;  1MG8 A;  3Q3M C;  2LHD A;  3BVM A;  3KYD D;  1SF0 A;  3ZYY X;  3RCZ A;  3WCQ A;  3HK0 A;  4DHZ E;  4I6L B;  1V6E A;  2LGX A;  2PMV A;  2K8C A;  4DK5 A;  2M17 A;  1F1H A;  2NR2 A;  3ZRF A;  1V5T A;  2K0P A;  4AJY B;  3PRZ A;  5AZG A;  1GOZ A;  2H88 B;  4HPL B;  2TSS A;  3VUY A;  1RLF A;  5T8I A;  2GB1 A;  3Q8B A;  3ENE A;  3AH7 A;  2AQ1 B;  4F7Z A;  2A4Z A;  1WH3 A;  3ZW3 A;  4EUT A;  4MSQ B;  1Q5W B;  4ZRJ A;  2KFK B;  3UGB B;  4JLC A;  1L7Y A;  3KW5 B;  2L83 A;  2FUH B;  2AL3 A;  2N9P C;  4ACF A;  3ZNZ B;  3NJT A;  3PRP B;  1GB1 A;  5C1Z A;  3QAQ A;  5KHO A;  2KJ6 A;  1T0Y A;  4BKG A;  2LZ6 A;  3SDL C;  3P2B A;  2MCN B;  1JWB D;  2LEK A;  3ZO5 B;  2WLB A;  1XCT L;  2MBH A;  4PYU A;  4AJW A;  2G45 B;  2VH1 A;  4W9K A;  3RYT A;  5BYQ A;  5HFY A;  4ZRP A;  3W5V B;  1RAX A;  4WWN A;  2R2Q A;  3H1U A;  3PVL A;  1FFU A;  2BS3 B;  4URK A;  1WXQ A;  5EE9 A;  1E0Z A;  4IKG A;  2K39 A;  2MBO A;  2JF5 A;  2NS5 A;  2ZCC A;  1LM8 B;  2IGH A;  5J18 A;  3DWM A;  4GSW A;  4HXD A;  2B76 B;  4NPN A;  1BUI C;  1HTQ A;  3ZGZ A;  1UBQ A;  2ACZ B;  2G4S A;  2IGD A;  3BII D;  2WX0 A;  1XT9 B;  2NMQ A;  2KX0 A;  3AXC A;  3ZVV A;  3AE8 B;  1NEK B;  3FKY A;  4NQL B;  2X8X X;  3N30 A;  2D07 B;  3UQB A;  2ZPY A;  1UWX A;  1T0R C;  2KMC A;  4W9E A;  1ESF A;  4DHJ D;  4GDK B;  1NVI D;  4LNO A;  3KQ4 A;  2JXX A;  1P7F A;  4W9J A;  5FKA C;  2FCS A;  3EA6 A;  1E5W A;  2JU6 X;  3AE3 B;  2V1Y A;  4LDT B;  4GXB A;  2LVO A;  4DXG A;  4HJK A;  3Q3F A;  3LB8 C;  2GOW A;  2DYM A;  4ZHO A;  4JWU C;  3TEX A;  1MPE A;  2KFK A;  3IHP C;  3EGR A;  3Q8A A;  1UEL A;  1WSP A;  2LUM A;  2N7D A;  3VR9 B;  3ZTD A;  4M01 A;  1L5P A;  3AB5 A;  3CMM B;  3KYC D;  4WIP A;  1WGR A;  1P98 A;  2LUE A;  4HDO A;  4ZRQ A;  2QIL A;  3DBS A;  3WAP A;  2KN4 A;  3JW0 X;  2JXT A;  1WRD B;  3RI7 C;  4N59 A;  1A5R A;  3C0R B;  1FXT B;  3O65 B;  5HKH A;  1VCB A;  4NZL B;  2GI9 A;  4TMA B;  3L08 A;  2I1K A;  4KDI C;  5D3D A;  4AWJ A;  1PGA A;  3FC4 A;  5DPT A;  2BGF A;  1YX5 B;  2ZPN A;  2MJD A;  2WWZ A;  3ZJT A;  3ZJV A;  3IT4 B;  2M19 A;  5CHF A;  1MG4 A;  2CHX A;  2JSV X;  3PZ8 A;  2MEK A;  1FEH A;  2H89 B;  1L4D B;  3D32 A;  2KWC A;  4BOZ B;  2D11 A;  4A90 A;  1OQR A;  1SE2 A;  3ZTC A;  4WH4 A;  1ZOY B;  4RNA A;  4M0W A;  1DOY A;  5CTR C;  3RZW C;  2BKF A;  1L2N A;  2HD5 B;  2DYB A;  3B08 A;  4IM3 A;  2NBU A;  1OFF A;  3HVZ A;  4PK1 A;  1P9D U;  3PTF C;  4ICU A;  3N3K B;  3ALB A;  4FJV B;  4GDK A;  2V3P A;  3HVD A;  5EE3 A;  1P0R A;  4HCN B;  2QC8 A;  2CR5 A;  1E8Z A;  2N1V A;  1C4P A;  2BYT A;  1L0V B;  3ZIM A;  4MAC A;  1R4M B;  2XBB C;  1ET9 A;  5IAA C;  1K50 A;  4RM8 A;  1WGG A;  4W9D A;  4LNK A;  1L0Y B;  5EE0 A;  3PPA A;  1BML C;  2KO3 A;  3FIL A;  1JML A;  4LNF A;  4MGI E;  3N1X C;  4BKS D;  3ECI A;  1CJE A;  2FCN A;  2W82 A;  3AM9 A;  5C3J B;  4C4V B;  3N1Y C;  1WWT A;  3SU8 X;  3CWI A;  1E10 A;  4IM2 A;  3V6C B;  1GB4 A;  2MJ3 A;  1CZP A;  2KKC A;  5BYS A;  5C2T B;  3APC A;  4L23 A;  1WXM A;  1TZO A;  3P4Q B;  3DVN V;  3PGE A;  5CHW A;  4HWI B;  3TMP B;  3GOE A;  2LXC A;  3MFG A;  2WGS A;  1T0Q C;  4FLH A;  5E6P A;  4FHK A;  1YJJ A;  4W9L A;  2DZJ A;  3OJ3 A;  3OLM D;  2WXR A;  3RUL A;  3AEB B;  3N32 A;  3KUC B;  4A9A A;  3U7Z A;  3L10 B;  4HCP B;  2MSE D;  4M00 A;  1QLB B;  4K7U A;  2DEN B;  1K52 A;  1WXS A;  4YSY B;  1B1Z A;  1VJK A;  2LI5 A;  3RD2 A;  2E6X A;  2SEB D;  4N9F 4;  1J8C A;  2ZVN A;  1RYJ A;  2WXI A;  4HPM B;  4ITK A;  1I42 A;  4HLE A;  1UBI A;  1UNS A;  5J2R A;  3GP7 A;  3OG5 A;  4YL8 A;  4YWG G;  4K7W A;  2KJR A;  2YLM A;  4USA A;  5G2N A;  3WAM A;  2D2Q A;  4DHZ B;  1IUE A;  3P1M A;  1FNV A;  2L8J A;  2LGD A;  1VD2 A;  3E56 A;  4II2 B;  1E8W A;  5FK9 C;  2N7E A;  2Z0D B;  1T6B X;  4TKN A;  2QMT A;  2YEP B;  2K25 A;  1WI0 A;  1Z5S B;  1N6Z A;  2KMM A;  3T3N A;  4JL9 A;  4S0R A;  1WX8 A;  2UU7 A;  4ZRI A;  5IA7 A;  1UH6 A;  4LTU A;  3N20 C;  4MGK E;  3QA8 A;  2BVC A;  2OED A;  4M8N A;  4W9I A;  2XNA C;  1TZ1 A;  3C8Y A;  4C4V A;  5E6N A;  3QC8 B;  3H8H A;  4DWF A;  3BK1 A;  2DBY A;  2J7Q B;  2JYT A;  2AX5 A;  1M4V A;  1YD8 U;  2V4I B;  2M0X A;  3VDZ A;  2GBN A;  1YQ3 B;  1ZXH A;  3ABV B;  3A1Q B;  2LFI A;  2PVO D;  5G5G A;  1R4N B;  3KWV A;  2MWS B;  1XD3 B;  4NJ6 A;  5LXH A;  2EMS A;  2N9K A;  1WXV A;  2YVC A;  1UGM A;  2QJL A;  4MEL A;  2BF8 B;  1K51 A;  5H8Y E;  3EHV A;  4DQO C;  1OEY A;  1SIF A;  2JVC A;  3S2A A;  1I4H A;  3ZXV A;  1TS4 A;  2LWP A;  2HJ8 A;  3DOW A;  2LRW A;  1MI0 A;  2BB5 A;  3QHT A;  2DYO A;  1TGZ B;  2Y3A A;  1JAL A;  4II3 B;  1LGR A;  4XWW A;  2MLB A;  1DYQ A;  2G1E A;  1WR1 A;  4NAW B;  1HE8 A;  1V81 A;  1J7A A;  5HHD G;  3RNB C;  3SEB A;  4QAY A;  5BMH A;  4FJY A;  2KTF A;  4YSX B;  1B9R A;  2NBV B;  1C3T A;  4GB9 A;  4BOS C;  3RNE C;  4FXC A;  3VH4 B;  3B1L X;  3DCG A;  1N63 A;  1VZ6 A;  1T0S C;  2PVG C;  3RT3 B;  1WM2 A;  4DHJ B;  1P3Q U;  2MBB B;  4RMA A;  3UIP B;  2LVP A;  3NS8 A;  2FAZ A;  3P4P B;  2LD9 A;  1C79 A;  2KWU B;  1YQB A;  2KWV B;  2M8S A;  3TIX A;  3LYY A;  2WXO A;  4TSS A;  2QSD A;  1DGJ A;  1VR9 A;  4WUR A;  4KZ0 A;  4LNI A;  5LXI B;  1HZ5 A;  1WJN A;  2VRR B;  4JIO U;  1FCC C;  2N0S B;  4FHJ A;  2BWF A;  1E6E B;  2JQR B;  2ONQ A;  2MJE A;  3DBR B;  3AEC B;  1V1P B;  2J42 A;  2J0J A;  3CST A;  1CQV A;  3APF A;  2IDY A;  3FAH A;  3RNG C;  4REZ A;  4DDG D;  1F52 A;  3ZDM C;  4BFR A;  1D5Z C;  3PSE B;  3TBL D;  1YJI A;  4BVU C;  4ZDV A;  4W9G A;  4HJG E;  3A1Q A;  3QIJ A;  2NTS A;  2B3A A;  5HG2 A;  2IJ0 A;  3AE7 B;  3L16 A;  3RZF A;  1UWM A;  2KC2 A;  2O6V A;  5H92 C;  5LLI A;  1T5X D;  5E6J A;  2LAS A;  3TEW A;  5FR3 A;  1N60 A;  1E90 A;  4IWP A;  4WAA A;  3ZLZ A;  4DXA B;  4G3X B;  5DCN A;  4WAF A;  2ZEQ A;  2PLP A;  4ZYS A;  2DWQ A;  3VTV A;  4EE2 A;  1UD7 A;  3MC9 A;  1QOA A;  1E7P B;  4TQ0 A;  2C5L C;  3AEF B;  1RFK A;  1BXT A;  2IO0 B;  4YT0 B;  5BMI A;  3Q8F A;  1UF0 A;  3DHI C;  2VH2 A;  4NAW A;  1ZP0 B;  3V62 A;  1UGJ A;  3OAW A;  4MSM B;  2RPV A;  2FNJ B;  1ZDX A;  3DVG Y;  4ANW A;  4A8X C;  1OQY A;  1IGC A;  3DHH C;  3RN9 C;  1V86 A;  3GB1 A;  1WZ3 A;  3WAO A;  2KYW A;  4F8C B;  1D5X C;  3C19 A;  3PRM B;  1JCK B;  1YX6 B;  3RNA C;  1LXD A;  3NVZ A;  1SE4 A;  3I9V 1;  4W9F A;  3W9C B;  2K6Q A;  1L0X B;  1I4P A;  4DBG A;  3NVY A;  2ZW0 A;  1MFW A;  2LGY A;  1IPG A;  1TS5 A;  3R8B A;  3ZQ4 A;  4K7S A;  1JWA D;  3KUZ A;  1KRH A;  3R7Q A;  4C56 C;  1K53 A;  2WXK A;  3QWZ B;  4OHJ A;  1QQR A;  2L1A A;  1V1P A;  1TBE A;  1LO5 D;  4RM9 A;  2MX2 A;  2PE9 A;  1GAQ B;  1XQQ A;  1ZXI A;  2AEH A;  1WRI A;  1R4M I;  1TY2 A;  1TY0 A;  3WIM A;  5GXG B;  2O2V B;  2D3A A;  3R3M A;  3VRA B;  5FR6 A;  4M02 A;  2FBW B;  3W2D A;  2R2O A;  3NHE B;  3P4S B;  2WDV B;  3GS2 A;  1NYR A;  1J0G A;  2RDH A;  1WM3 A;  3MP9 A;  3QJZ A;  3IG3 A;  3ZDT A;  1WGH A;  2PIA A;  4K1R B;  2KK8 A;  2Z8L A;  4UDU C;  4P6V F;  4WWP A;  2NCN A;  3Q6B A;  2HJ1 A;  5AUK A;  3BIN A;  1KOT A;  2KFJ A;  3RPF C;  4JQW C;  1V80 A;  3AMZ A;  4PS3 A;  4AOF A;  4ANX A;  1WR6 E;  2JZZ A;  1H8C A;  2INP E;  2C7H A;  4P1C C;  4KGT A;  5IO9 A;  1S1Q B;  3A33 B;  2BKR B;  2K9X A;  4RF1 A;  2KDB A;  1PDX A;  2OJW A;  3GZN I;  3UIN B;  3A9J B;  4XDD A;  2N9X A;  2JY6 A;  2KD0 A;  4MGZ E;  1E7V A;  4NJC A;  5EDS A;  5KHQ A;  2LHE A;  3IVF A;  5DPS A;  4GGQ A;  5AZH A;  4FUL A;  3RNF C;  1PGX A;  3NVV A;  4W9H A;  1N5W A;  1VLB A;  4C7Z A;  4JWS C;  4WJO A;  4GMV A;  1QIL A;  3AE6 B;  2L00 B;  5EE1 A;  1XCQ L;  2KAN A;  2CKH B;  4RCO A;  4MH0 E;  4EZL A;  2RGF A;  4I6N B;  2IO1 B;  2JRH A;  3R2T A;  2J53 A;  3R7R A;  1SXT A;  4GOC A;  2CU1 A;  1JW9 D;  2WP9 B;  4LNN A;  1RWS A;  3EUB 2;  2JRI B;  1WZ0 A;  3B2F A;  4KX6 B;  4FJZ A;  3PV1 A;  2INC C;  4B0E A;  2C7M B;  2LJI A;  4ARI A;  3L0W B;  2O2V A;  2DAF A;  2K1F A;  1HZ6 A;  4BKS A;  2FCQ A;  1PFD A;  1EWC A;  1MHX A;  2JT4 B;  1XEE A;  4N58 A;  4PYZ A;  3HIZ A;  1EF5 A;  4W9C A;  4AUQ C;  1YN4 A;  5D2M B;  4B6W A;  4G11 A;  3IXS A;  1PYW D;  3PS6 A;  3ZNG C;  3ZXR A;  1WGD A;  2GRI A;  2IY0 B;  2KMA A;  1NI2 A;  2LGS A;  4KGS A;  3U7D A;  4EOY A;  2WXG A;  3PLU A;  4IDI A;  1LQB A;  2JYE A;  3JVZ X;  1Q10 A;  1R4N I;  2FID A;  2ASQ A;  4XX5 A;  2MP2 B;  1DOX A;  2Z0E B;  3N9Y C;  1SE9 A;  4WQM A;  4AP4 C;  2M0A A;  4XGA B;  2QEJ C;  4IW0 A;  2BB6 A;  4RGM A;  4OVZ A;  1Y56 A;  1BT0 A;  2WXN A;  3KVF B;  2W55 A;  1U4A A;  2I2Y A;  3P63 A;  4PS7 A;  1QZE A;  5IP4 D;  3ZKJ C;  1PGB A;  1ZUD 2;  1JQ4 A;  1FXI A;  1XXG A;  3I57 A;  3Q3J A;  3TCA A;  2EKE C;  1I4Q A;  3ZNI D;  4CYE A;  2KX3 A;  3CSF A;  1KTK A;  4GIV A;  2KC1 A;  2ZNV B;  2YEP F;  2INN E;  3K9P B;  2L05 A;  3I63 C;  1SJE D;  4C7Y A;  2J0M A;  2V9H A;  3OWE B;  5G5H A;  2KOX A;  3QQ8 B;  1WIA A;  3OJ4 B;  2ZZP B;  2WDQ B;  2UWQ A;  2KAJ A;  3GZN B;  1WGK A;  4KGR A;  1YQ4 B;  3DQV A;  3K9O B;  1L6U A;  4ANU A;  4MM3 B;  1CK1 A;  1FRR A;  1C78 A;  2AQ2 B;  3A4S C;  3RFZ B;  4KKJ A;  3UIO B;  3P4R B;  3SHQ A;  3HM6 X;  1M94 A;  4F1S A;  4GLS C;  1C9F A;  3TL5 A;  1TKY A;  1XF5 L;  4P1B C;  4RGN A;  1D4B A;  2KZR A;  2KN5 A;  3IFW B;  3B9J A;  4OZA A;  4A55 A;  1FNW A;  1XLO A;  1UZX B;  3DBR I;  2N4F A;  1ZW7 A;  3BK2 A;  1XLN A;  1V2Y A;  1EUV B;  2G9H D;  4KVG B;  3DWG C;  3TUO A;  2WXQ A;  1TJE A;  3KUD B;  3AE1 B;  1JWU D;  1RM6 C;  2OJR A;  4NQK E;  4TV3 A;  4FA6 A;  3APD A;  2WXL A;  2MP2 A;  4HKZ E;  1FM0 D;  2RSU A;  4KSK C;  1RFA A;  2KLC A;  2KQ7 A;  2KXJ A;  3AI5 A;  1WJ4 A;  1WXA A;  2RMM A;  2GBJ A;  4GN1 A;  1QT9 A;  1G6J A;  1ZDV A;  1I4G A;  1Q0W B;  4LK0 M;  3DPD A;  1V9J A;  2DNF A;  2NPT B;  1P7E A;  2AL6 A;  1EWY C;  3VUW A;  1R7S A;  2IO3 B;  4IG7 B;  4YTM B;  4ANV A;  1HEZ E;  3SFE B;  4MJS B;  1MHH E;  2IZV B;  4BKT A;  2AWT A;  3BYY B;  1WF9 A;  2LMC A;  1LFD A;  2JZ3 B;  2ZW1 A;  2LRU A;  4R3D A;  1V5O A;  1L6V A;  1GC6 A;  3L4P A;  1STE A;  3ONS A;  3WAL A;  2FE8 A;  3W5U B;  3BYT B;  1E8X A;  1F77 A;  5AZF A;  3DBH B;  4C00 A;  1OQQ A;  1YIW A;  3MHS D;  2XN9 C;  2V3N A;  4ASW C;  2QHO A;  2KQS A;  5C23 A;  3IAM 1;  4G50 A;  4HRO A;  4FAD A;  2JZP A;  3DVN U;  4XWT A;  3BY4 B;  3QK0 A;  5G55 A;  2NBW B;  1ENF A;  1S3S G;  5IN7 A;  2ICI A;  2L7R A;  2BBC A;  3VHT C;  2CHZ A;  1ZGU B;  3NRZ A;  1MJD A;  3ZNH B;  4XZ4 A;  3VAW A;  1GG3 A;  4EZJ A;  1FXA A;  1F9J A;  3EC8 A;  1JWS D;  5D3I B;  3NZ3 A;  1N61 A;  2IBI B;  2N9L A;  2GMI C;  3IT6 B;  3MC0 B;  1QOF A;  1YMH E;  2KDE B;  2BPS A;  1C4A A;  1WMH B;  3Q8E A;  1SGH A;  2PPH A;  3W1S C;  4AS1 A;  1QF6 A;  3AU5 A;  3AE5 B;  4WJQ A;  3VVW B;  4IWO A;  1D6E C;  4Q2J A;  3EFU A;  5DPW A;  4ZHP A;  1KF6 B;  3BZD B;  3T9L A;  3PRE A;  3QAR A;  2NPT A;  2C9W B;  4TUU A;  4A20 A;  1TKE A;  2NTT A;  4O1N A;  1TKG A;  3NOB A;  3NG0 A;  2K22 A;  2RDG A;  1IP9 A;  1ZPS A;  1WYW B;  4LJP B;  4MJS A;  3UQA A;  1FFV A;  1KH0 A;  3QCA A;  3N1Z C;  3VRB B;  3TEY A;  3WAN A;  1OTR B;  2GBR A;  4PT5 A;  5LNK 1;  1WFY A;  2V3S A;  3H7P B;  2MH7 A;  4ZYN A;  3V60 A;  2MBQ A;  2K8B A;  5D7G A;  3BVZ A;  3T8M A;  2KJH B;  1K8R B;  5I4D A;  1L4Z B;  3HM3 A;  2JUO A;  3I3T B;  3U52 E;  3Q3N C;  4ZRK A;  4IWQ A;  2MBE A;  2Z59 B;  4JPS A;  1AN8 A;  1IBX B;  1H4R A;  3AE4 B;  3H9D A;  4K81 A;  2M56 B;  4RH6 A;  3TEZ A;  1YNT E;  3B2G A;  3DBL B;  2RPQ A;  4OZC A;  3W1S A;  4HKQ A;  1EF1 A;  5AEK B;  3DHG C;  2E3T A;  2IO2 B;  4HK2 A;  4P7I A;  4M8M A;  4MGY E;  1FMA D;  1SEB D;  1Y8R C;  1UUP A;  2D10 A;  2CU3 A;  2FCM A;  3J9C A;  3VH3 B;  4AQ7 A;  1XLP A;  5GMV A;  5TR5 A;  2L0T A;  3LDZ E;  3R66 C;  3IBE A;  3PT2 B;  1T3Q A;  4D2K A;  2DZI A;  3VR8 B;  1FRD A;  1I4X A;  1SSN A;  1WMH A;  1OGW A;  3T3O A;  2GLS A;  1SE3 A;  5JXV A;  3MHZ A;  4ARC A;  2FUG 1;  3MJW A;  1N5X A;  3AEG B;  3PLV A;  1Z2M A;  2W3S A;  2MHJ A;  2SAK A;  2JPH A;  1C76 A;  2XEW A;  3M63 B;  2VZK D;  2O6V D;  3LJ3 A;  1NDD A;  4IC7 B;  2WYQ A;  1WX9 A;  3Q8C A;  4MT5 A;  3M3J A;  1WGY A;  4BAX A;  2DX5 B;  3U30 A;  4KIK B;  1N62 A;  3WA0 A;  3QX1 A;  2HDE A;  3H7P A;  2KHW B;  5CHV C;  3L13 A;  2K8H A;  3V61 A;  3A4R A;  1J7C A;  1JRP A;  2IYD B;  4XE0 A;  4YXD B;  4M0W B;  2CS4 A;  4HEA 1;  4US8 A;  3NUH B;  4KZC A; 
#chains in the Genus database with same CATH homology
 1ISN A;  4MGK E;  4E3C A;  1C1Y B;  3QA8 A;  4IW0 A;  4M8N A;  4W9I A;  1TZ1 A;  3HHM A;  4MDK E;  1BT0 A;  2L3Z A;  3L17 A;  3QC8 B;  5E6N A;  1IYF A;  1GNU A;  4DWF A;  2J7Q B;  3KVF B;  3B0A A;  5CX3 A;  4EEW A;  1U4A A;  1YD8 U;  4CHK A;  1Q1O A;  2DZK A;  4PS7 A;  2BWE S;  1QZE A;  2M0X A;  3VUX A;  3ZKJ C;  2LJ5 A;  3VDZ A;  1MG8 A;  2GBN A;  3Q3J A;  5D6J B;  4FBJ B;  3A1Q B;  3TCA A;  5J17 A;  3KYD D;  2EKE C;  3RCZ A;  2MWS B;  1XD3 B;  3HK0 A;  3ZNI D;  4DHZ E;  4CYE A;  4I6L B;  1V6E A;  2KX3 A;  2LGX A;  3CSF A;  4BBN F;  2BYV E;  4GIV A;  2KC1 A;  4NJ6 A;  4DK5 A;  2K8C A;  2M17 A;  2ZNV B;  4I6P A;  5LXH A;  2EMS A;  2NR2 A;  3ZRF A;  1WXV A;  1V5T A;  2WDT B;  3K9P B;  2YVC A;  1UGM A;  2L05 A;  4AJY B;  3PRZ A;  5AZG A;  4HPL B;  4MEL A;  2BF8 B;  4NJ7 A;  3VUY A;  3EHV A;  1RLF A;  1OEY A;  2JWZ A;  2J0M A;  1SIF A;  2JVC A;  4A3O A;  2KVR A;  3S2A A;  2KOX A;  3ENE A;  1RRB A;  1WIA A;  2RD0 A;  3QQ8 B;  3OJ4 B;  2ZZP B;  3H6N A;  4F7Z A;  2A4Z A;  1WH3 A;  3ZW3 A;  1I35 A;  4EUT A;  2UWQ A;  4MSQ B;  2LWP A;  1Q5W B;  4ZRJ A;  2KFK B;  3UGB B;  2HJ8 A;  3DOW A;  5JZE B;  4JLC A;  3DQV A;  2LRW A;  2EMT A;  5DPR A;  3QHT A;  1L7Y A;  3KW5 B;  3PHX B;  3K9O B;  4B9K A;  4ANU A;  2DYO A;  2FUH B;  1TGZ B;  3A4S C;  2AL3 A;  2FIF A;  4II3 B;  2N9P C;  3UIO B;  3ZNZ B;  3SHQ A;  3HM6 X;  3PRP B;  1M94 A;  2MLB A;  4F1S A;  5C1Z A;  1WR1 A;  3JSV B;  4NAW B;  2KDF B;  5D94 A;  1HE8 A;  3QAQ A;  1ZKH A;  1V81 A;  5KHO A;  2KJ6 A;  3TL5 A;  1T0Y A;  4BKG A;  1GJZ A;  2KZR A;  4FJY A;  2KN5 A;  2LZ6 A;  3IFW B;  3SDL C;  4DDI D;  2KTF A;  4AP4 C;  3P2B A;  2MCN B;  2NBV B;  3TJP A;  1C3T A;  3NZU A;  3ZO5 B;  4KIK A;  4GB9 A;  4BOS C;  3U8Z A;  2MBH A;  1UZX B;  3DBR I;  4PYU A;  2N4F A;  1ZW7 A;  3VH4 B;  4AJW A;  3B1L X;  2G45 B;  3DDC B;  3DCG A;  4W9K A;  1V2Y A;  3RYT A;  2KDI A;  1EUV B;  2XK5 B;  1WM2 A;  2L0F A;  3RT3 B;  3VXW A;  4KVG B;  4DHJ B;  1P3Q U;  1RAX A;  2MBB B;  4WWN A;  4RMA A;  3UIP B;  2MQJ A;  2R2Q A;  1X1M A;  3H1U A;  2LVP A;  3KUD B;  1KM7 A;  3PVL A;  3NS8 A;  4URK A;  2OJR A;  4NQK E;  2FAZ A;  2MRP A;  2LD9 A;  2KWU B;  4TV3 A;  2K39 A;  2MBO A;  1YQB A;  3APD A;  2KWV B;  2MP2 A;  1GC7 A;  2JF5 A;  3NY5 A;  4IUM B;  2M8S A;  3AUL A;  3TIX A;  2NS5 A;  5L95 C;  2ZCC A;  2MW5 A;  1LM8 B;  4MEM A;  4KZ0 A;  4KSK C;  2RSU A;  5J18 A;  2DAJ A;  1RFA A;  5LXI B;  4GSW A;  1WJN A;  2VRR B;  2KLC A;  2KQ7 A;  2KXJ A;  3AI5 A;  4HXD A;  1WJ4 A;  1WXA A;  4JIO U;  4FHJ A;  4NPN A;  2BWF A;  3UF8 A;  2GBJ A;  3VFK A;  4FN2 A;  1UBQ A;  4GN1 A;  2W9N A;  2L76 A;  1G6J A;  2M4N A;  2G4S A;  2J0J A;  3CST A;  2WX0 A;  1Q0W B;  3DPD A;  3APF A;  2DHZ A;  1V9J A;  2NPT B;  1XT9 B;  4J6I A;  4DDG D;  2AL6 A;  3ZDM C;  2KX0 A;  4BFR A;  3AXC A;  3VUW A;  3PSE B;  3TBL D;  3ZVV A;  5BO4 B;  4BVU C;  4NQL B;  3DBH I;  2IO3 B;  3N30 A;  4W9G A;  3X23 A;  3A1Q A;  2D07 B;  3A9J A;  4IG7 B;  4ZDV A;  3UQB A;  2KTR B;  2ZPY A;  3NZS A;  3QIJ A;  3VTW A;  4ANV A;  3JYU A;  4BBN C;  4WJP A;  2KMC A;  2B3A A;  4W9E A;  4MJS B;  4DHJ D;  4HDQ A;  2IZV B;  4GDK B;  4BKT A;  2AWT A;  1WF9 A;  2JXX A;  1LFD A;  2ZCB A;  3CF6 E;  3L16 A;  3RZF A;  2JZ3 B;  2PJH A;  2LRU A;  2D3G A;  4W9J A;  1V5O A;  2KC2 A;  2O6V A;  5LLI A;  4X57 B;  3M95 A;  2FCS A;  4GDL B;  2LAS A;  2I1J A;  1E5W A;  1E90 A;  1GC6 A;  4IWP A;  2V1Y A;  4WAA A;  3ZLZ A;  3ONS A;  3WAL A;  4DXA B;  4G3X B;  4LDT B;  5DCN A;  4GXB A;  2ZEQ A;  2LVO A;  4HJK A;  3VTV A;  3Q3F A;  1E8X A;  2GOW A;  2DYM A;  2J0K A;  1UD7 A;  3SD5 A;  5AZF A;  4A3P A;  2KFK A;  1YIW A;  3MHS D;  3IHP C;  4TQ0 A;  4NNJ B;  2C5L C;  1UEL A;  4ASW C;  2QHO A;  2N7D A;  3ZTD A;  3EEC A;  2KQS A;  4IM0 A;  3DVG X;  2IO0 B;  5C23 A;  2PE6 B;  3CMM B;  3KYC D;  4G50 A;  1WX7 A;  3JSV A;  4LCD E;  1WGR A;  4NAW A;  4FAD A;  3DVN U;  1PQS A;  4XC2 A;  2GBK A;  3V62 A;  3OAW A;  1P98 A;  2LUE A;  4HDO A;  4MSM B;  2FNJ B;  3BY4 B;  4LJO B;  3DVG Y;  3DBS A;  3WAP A;  3QK0 A;  5G55 A;  2ZNV C;  3JW0 X;  4ANW A;  4WJN A;  1OQY A;  1WRD B;  2NBW B;  2DZM A;  5JH5 C;  1S3S G;  1V86 A;  1WZ3 A;  1A5R A;  3WAO A;  3C0R B;  1FXT B;  2L7R A;  3VHT C;  4LDT D;  3W1Y A;  1NBF C;  1J19 A;  2CHZ A;  3O65 B;  2MA9 B;  4F8C B;  1ZGU B;  1VCB A;  3PRM B;  3ZNH B;  1YX6 B;  4XZ4 A;  3L08 A;  1V49 A;  5HKH A;  4G0N B;  3VAW A;  2I1K A;  2XK5 A;  4KDI C;  1GG3 A;  4AWJ A;  4EZJ A;  1LXD A;  4E74 A;  1F9J A;  3EC8 A;  4EFO A;  5DPT A;  2BGF A;  4W9F A;  2IBI B;  5JHA A;  1YX5 B;  2K6Q A;  2ZPN A;  2GMI C;  2WWZ A;  3M62 B;  4DBG A;  2KDE B;  2OOB B;  2BPS A;  2LGY A;  5CHF A;  1IPG A;  2CHX A;  3VTU A;  1WMH B;  2G3Q B;  2M1M A;  1SGH A;  4K7S A;  3KUZ A;  1D3Z A;  3R7Q A;  2PPH A;  3W1S C;  2K6D B;  3D32 A;  3AU5 A;  3QWZ B;  2KWC A;  4BOZ B;  2D11 A;  4WJQ A;  2REX A;  3VVW B;  4IWO A;  3ZTC A;  2GBM A;  3EFU A;  5DPW A;  1TBE A;  3KH0 A;  4RM9 A;  2MX2 A;  2PE9 A;  5CTR C;  3T9L A;  3PRE A;  3QAR A;  2NPT A;  2BKF A;  1XQQ A;  2C9W B;  3A9K B;  4TUU A;  3RZW C;  2AEH A;  2HD5 B;  2N1W A;  4A20 A;  2DYB A;  3B08 A;  3NOB A;  1R4M I;  3VQI A;  3WIM A;  3ZUN A;  5JHB A;  4IM3 A;  2IY1 B;  2O2V B;  4NY0 A;  3R3M A;  2NBU A;  5FR6 A;  1P9D U;  2KTR A;  3PTF C;  4ICU A;  1IP9 A;  3N3K B;  1WYW B;  4LJP B;  4MJS A;  3ALB A;  3UQA A;  4FJV B;  4GDK A;  2C7N B;  2R2O A;  3NHE B;  4ICV A;  3QCA A;  4WWO A;  3WAN A;  1OTR B;  1P0R A;  4HCN B;  2GBR A;  1E7U A;  1J0G A;  1WM3 A;  4GDL A;  1L2N A;  1CMX B;  2CR5 A;  3QJZ A;  1E8Z A;  1WFY A;  2V3S A;  3IG3 A;  3H7P B;  3ZDT A;  2N1V A;  4ZYN A;  4TQ1 A;  1WGH A;  4K1R B;  2KK8 A;  4CO7 A;  5IA7 A;  3V60 A;  2MBQ A;  1WE7 A;  3DBL I;  4KSL C;  2K8B A;  2KLG A;  4WWP A;  2NCN A;  5D7G A;  3ZIM A;  1KLV A;  3PHW B;  3BIN A;  2KJH B;  2XBB C;  3T8M A;  5IAA C;  1KOT A;  2KFJ A;  4JQW C;  1WJ6 A;  1V80 A;  1K8R B;  4RM8 A;  1WGG A;  4PS3 A;  4AOF A;  4W9D A;  4ANX A;  1WR6 E;  2JZZ A;  3HM3 A;  2JUO A;  1H8C A;  3PPA A;  3I3T B;  2C7H A;  2KO3 A;  1WJU A;  4ZRK A;  4MGI E;  2UYZ B;  2CHW A;  1S1Q B;  3A33 B;  4BKS D;  4IWQ A;  2ZJD A;  3ECI A;  2BKR B;  2MBE A;  2Z59 B;  4KV2 A;  2FCN A;  2KDB A;  4OVU A;  3MTN B;  3GZN I;  3UIN B;  3A9J B;  1H4R A;  2N9X A;  2JY6 A;  3SU8 X;  4B95 A;  3H9D A;  4K81 A;  4IM2 A;  4MM3 A;  3V6C B;  2V4L A;  2KD0 A;  4MGZ E;  1E7V A;  2WX1 A;  5EDS A;  5KHQ A;  3IVF A;  2BYE A;  5DPS A;  2KKC A;  4GGQ A;  2RPQ A;  5AZH A;  3W1S A;  2G4D B;  1EF1 A;  4FUL A;  2O6V B;  5AEK B;  4KDL B;  3APC A;  4W9H A;  2IO2 B;  4HK2 A;  1WXM A;  4P7I A;  2Y5B B;  4WJO A;  4GMV A;  1WY8 A;  2L00 B;  4M8M A;  4MGY E;  2KAN A;  4WQO B;  1Y8R C;  2CKH B;  3AU4 A;  4MH0 E;  2D10 A;  3DVN V;  2FCM A;  4EZL A;  3PGE A;  2RGF A;  4I6N B;  2IO1 B;  3VH3 B;  5CHW A;  2JRH A;  2C60 A;  3ZRC A;  4HWI B;  5GMV A;  1TTN A;  5TR5 A;  2L0T A;  1AAR A;  4E71 A;  2NVU I;  2PEA A;  3LDZ E;  3TMP B;  3R66 C;  3GOE A;  3IBE A;  1KJT A;  3PT2 B;  2LXC A;  2DZI A;  2HE7 A;  3R7R A;  4GOC A;  2CU1 A;  1WMH A;  1OGW A;  4FLH A;  5E6P A;  4FHK A;  4W9L A;  2JRI B;  2DZJ A;  3OJ3 A;  3RUI B;  3OLM D;  1WZ0 A;  4KZC A;  3MJW A;  3RUL A;  1P1A A;  3PLV A;  3V6E B;  1EO6 A;  3KUC B;  2BYF A;  2RR9 A;  3N32 A;  4EZK A;  1Z2M A;  4HVB A;  3L10 B;  1OEY J;  4HCP B;  2MSE D;  4GU2 A;  4FJZ A;  3A9K A;  4K7U A;  2DEN B;  3PV1 A;  2JPH A;  1JRU A;  4EKU A;  1WXS A;  2C7M B;  2XEW A;  3M63 B;  3L0W B;  2O6V D;  3LJ3 A;  2LI5 A;  4JGH B;  2A5U A;  2O2V A;  2DAF A;  1NDD A;  2K1F A;  4BKS A;  4IC7 B;  2FCQ A;  3RD2 A;  4N9F 4;  3H7S A;  2WYQ A;  1J8C A;  2ZVN A;  4HPM B;  1WX9 A;  1I42 A;  4HLE A;  4OVV A;  2JT4 B;  3PZD A;  4FA6 A;  4W9C A;  4PYZ A;  1UBI A;  3HIZ A;  1EF5 A;  2LVQ A;  3M3J A;  4AUQ C;  5J2R A;  2KNB A;  2AYO B;  1WGY A;  5D2M B;  2DX5 B;  4YL8 A;  4B6W A;  2LXA A;  4K7W A;  2KJR A;  4PS8 A;  2YLM A;  4G11 A;  3U30 A;  4KIK B;  3PS6 A;  3ZNG C;  5G2N A;  3L54 A;  2HTH A;  5E6O A;  3WAM A;  2D2Q A;  3WA0 A;  1E8Y A;  3QX1 A;  3H7P A;  1WGD A;  4DHZ B;  2IY0 B;  2KHW B;  2KMA A;  1NI2 A;  3ML8 A;  3X0W A;  2L8J A;  2LGD A;  1VD2 A;  4II2 B;  5L83 A;  1E8W A;  3U7D A;  5CHV C;  4EOY A;  1YJ1 A;  3L13 A;  2N7E A;  2Z0D B;  2K8H A;  3PLU A;  3V61 A;  4TKN A;  1GUA B;  1LQB A;  3JVZ X;  2K25 A;  2FID A;  1R4N I;  3A4R A;  2ASQ A;  1WI0 A;  3ML9 A;  4XX5 A;  1Z5S B;  2MP2 B;  2Z0E B;  2IYD B;  2N9E B;  2ZVO A;  2CS4 A;  4JL9 A;  4M0W B;  1WE6 A;  1SE9 A;  1WX8 A;  4ZRI A;  1UH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...