3QC8B

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
EPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qc8B00
3RYTA 4BKSD 4TQ1A 3H9DA 4EUTA 2HE7A 3VTUA 4ZRKA 2V1YA 3CSFA 3T8MA 2JRHA 1X1MA 2K8BA 4M0WB 1WE6A 2PJHA 1V81A 3ENEA 1WGYA 1V9JA 1ZGUB 3NOBA 1WYWB 4MSMB 4WJQA 2KWVB 2N7EA 2XEWA 2N4FA 4PYUA 2LJ5A 1J19A 3DBHI 3TCAA 2NR2A 2CS4A 3EFUA 4AUQC 4WWOA 2K6QA 2FCSA 4KV2A 1WR1A 2MP2B 1E8XA 2GMIC 3V62A 3LDZE 3VXWA 3PVLA 2KD0A 1HE8A 4IG7B 4MGKE 3VUXA 1P9DU 1UGMA 4HPMB 3R7QA 4HLEA 4HK2A 4ZYNA 2N9EB 3AI5A 3SHQA 2PPHA 1R4NI 1WH3A 1UD7A 1YQBA 2DZJA 4HDOA 4NAWA 3UIPB 2ZNVC 4IC7B 2Z0EB 4W9CA 4FULA 4PS8A 2CHZA 1OTRB 2HJ8A 2LXCA 3ZNGC 2VRRB 5EDSA 5JZEB 3NHEB 2LZ6A 3D32A 4NQLB 4ANWA 3DVNU 2JY6A 5GMVA 2K8CA 4CYEA 4GU2A 4BOZB 2G4DB 5AZHA 3CSTA 2KJRA 5D94A 2BWES 3QARA 1WGGA 4B9KA 2CHWA 1WI0A 3VQIA 2ZCCA 3Q3JA 4RM9A 2G3QB 3ZVVA 3A4RA 4B95A 4G3XB 3DVGX 1Q1OA 2LGXA 3MJWA 3PSEB 4IM2A 4RMAA 4FJYA 5CHWA 3OLMD 3T9LA 2MP2A 2FCNA 2CHXA 3U7DA 4F8CB 1V5OA 2K6DB 3IVFA 4E71A 2L0TA 2GBJA 3HM3A 2LGDA 3RT3B 2C7HA 2OJRA 4DDID 1WIAA 3L10B 1M94A 1TBEA 5LLIA 3EC8A 3NS8A 1WX8A 2YVCA 4GDKA 4II2B 2MCNB 1V49A 2C60A 3JSVB 4PS7A 1EF5A 2KTRB 3SU8X 4HDQA 5DPSA 3UGBB 4URKA 1WGRA 3SDLC 1OEYA 4LDTB 3PV1A 3OJ3A 2DYMA 3QAQA 4GDLB 4GIVA 1EF1A 1YX6B 4KSKC 4MJSA 5AZGA 1UBIA 1E8WA 4J6IA 2QHOA 3QQ8B 4WWPA 3S2AA 4GOCA 4WJOA 4IM3A 1CMXB 3TL5A 4NY0A 4NQKE 1YD8U 2DAJA 3OAWA 1TZ1A 3H6NA 1GG3A 4TQ0A 2YLMA 3DVNV 3L08A 3DPDA 4K7SA 3W1SA 2J0KA 3IFWB 4F7ZA 5KHOA 2I1JA 3VHTC 3ZRCA 3HIZA 4GDKB 2BPSA 2N1VA 4HCNB 2ZPNA 4JL9A 4NPNA 2RD0A 3DBRI 4PYZA 5FR6A 1LXDA 3VH4B 3IHPC 1WF9A 2WWZA 3UINB 1P3QU 1WM3A 2ZNVB 4BBNF 3VDZA 2Z0DB 1SGHA 2EKEC 2KQ7A 3DBSA 3R3MA 4IUMB 4JIOU 3LJ3A 3K9OB 3ZO5B 2JRIB 5J18A 4BVUC 4XX5A 1XD3B 4MM3A 2MA9B 2NVUI 1NBFC 5BO4B 2JPHA 2IY1B 3CF6E 3ZLZA 2O6VA 3DDCB 3WALA 1S3SG 3NY5A 1LFDA 3KH0A 5JHBA 4DHJB 3UF8A 1KOTA 3B1LX 4MEMA 3EHVA 3PT2B 2KWCA 2ZZPB 2KK8A 2MSED 2KN5A 2IYDB 1WE7A 1RAXA 3RCZA 4W9DA 4NAWB 5IAAC 3PTFC 3VVWB 4G50A 2V3SA 3PZDA 2LGYA 4MELA 1ZW7A 3PGEA 3NZSA 1P0RA 3U30A 1WGDA 4G0NB 1KJTA 2OOBB 3RD2A 3APDA 1S1QB 4HJKA 2DZIA 5DPWA 4TV3A 2N9PC 1Z5SB 1XT9B 5L83A 4EZJA 4EFOA 2K39A 2KC1A 2KMAA 2KZRA 5J17A 3KYDD 4W9FA 2LI5A 4NNJB 2FNJB 3Q3FA 1IYFA 3KUDB 4MSQB 3RZWC 2ZVNA 5C23A 1J0GA 1E8ZA 1GC7A 2NBWB 2AWTA 2HD5B 2DX5B 1RRBA 2FAZA 2L76A 1LM8B 2KC2A 4LJPB 4KSLC 2EMSA 5DCNA 4P7IA 2C5LC 3JYUA 4ICUA 3PPAA 3X23A 4I6PA 4EEWA 3VUWA 2MQJA 2KFKA 3L17A 1YJ1A 4WJPA 1PQSA 2JZZA 4WQOB 4KVGB 1GC6A 3KUZA 2KFJA 2L05A 4W9GA 3VH3B 2BKRB 4X57B 4FBJB 3JW0X 1MG8A 2MRPA 4FJZA 2MBHA 3WA0A 1WJNA 5DPRA 2CU1A 4F1SA 1WXMA 3A9KB 3DQVA 1UBQA 1V5TA 3ZDMC 3W1YA 2FIDA 1WXVA 4IW0A 4ICVA 2FCQA 4HPLB 2KO3A 3BY4B 4K7UA 3CMMB 4LCDE 1F9JA 3WIMA 2M8SA 2L7RA 4DXAB 2L3ZA 5L95C 3AXCA 3QIJA 5D2MB 3PS6A 3B0AA 3MHSD 1WXAA 4ANXA 1BT0A 1H4RA 4KIKA 2M4NA 2D10A 2KX3A 2RR9A 2KQSA 3I3TB 3APCA 3QWZB 2O2VB 2MLBA 2PE6B 4WAAA 3A9JB 3NZUA 2JWZA 2NPTB 1RLFA 2O6VD 2LVOA 1UELA 2FUHB 2KTFA 2XK5B 4DHZE 4A3PA 4HVBA 1I35A 1U4AA 3PREA 1TTNA 4EOYA 3ZNZB 1JRUA 5E6PA 4ASWC 1E5WA 5KHQA 4JGHB 4GDLA 1WJ6A 4JLCA 3M3JA 1GNUA 1WX9A 2IBIB 2KWUB 4W9IA 1WXSA 2AL6A 2KHWB 4OVUA 4TKNA 3A1QA 4IWPA 2A5UA 1E90A 4G11A 2MBOA 1YX5B 5G2NA 3ONSA 2L8JA 3L16A 2BKFA 3QK0A 1TGZB 1E7UA 4KZCA 1Y8RC 3M95A 2KVRA 1WMHB 4M8MA 4WJNA 2PEAA 1YIWA 2FIFA 2B3AA 2KXJA 1WRDB 4MDKE 5AZFA 4W9EA 4E74A 3ZIMA 3ZNHB 1ISNA 2C7NB 3APFA 2M1MA 2MBBB 4I6LB 2J0MA 2EMTA 1C3TA 3W1SC 3AULA 5J2RA 2RSUA 2KJ6A 1EUVB 3RUIB 3IG3A 4ZRIA 4TUUA 1LQBA 1T0YA 3QA8A 4ANUA 2N9XA 3PHXB 2D07B 2GBKA 2MBQA 2KMCA 2Z59B 4FHKA 1V86A 2IO1B 2M0XA 4E3CA 3JVZX 3H1UA 5E6NA 2BYVE 4LJOB 3ALBA 1L2NA 3TIXA 4WWNA 3UIOB 2GBRA 1UH6A 4K81A 3V61A 1OQYA 2IO0B 3QCAA 4HXDA 4K7WA 2WX1A 4BKGA 2JUOA 2LRUA 2ZJDA 3DBLI 5CTRC 2CKHB 1V6EA 3ML8A 2WDTB 2ZEQA 3P2BA 4FLHA 2NS5A 2N1WA 3H7SA 3TMPB 2IZVB 2R2OA 2W9NA 2KDFB 3N30A 3ZTDA 2AL3A 5TR5A 2PE9A 5JH5C 3A9JA 4GGQA 3C0RB 2DZKA 4DHJD 4AJYB 1WJUA 2ZCBA 4PS3A 3HM6X 4A20A 4CO7A 2ASQA 4XZ4A 1G6JA 2IO3B 1FXTB 4AWJA 3KUCB 1KLVA 3EECA 3WAOA 2KDBA 2D11A 1WJ4A 2D2QA 2HTHA 4I6NB 1GUAB 2G4SA 2A4ZA 4A3OA 2LUEA 3X0WA 1UZXB 1WGHA 3HHMA 3M62B 2IO2B 3L54A 2J7QB 3IBEA 3ZW3A 3KYCD 4AOFA 2XK5A 1IP9A 4LDTD 4B6WA 1ZKHA 4RM8A 3GZNI 3AU4A 4BKTA 4BFRA 1NDDA 4W9HA 2JT4B 3N32A 2MX2A 1L7YA 4EZKA 2KTRA 4OVVA 3GOEA 4AJWA 2UYZB 4DHZB 3A33B 2L00B 3ZNID 4FA6A 2N7DA 4DK5A 1IPGA 1Q0WB 1V80A 1P98A 2BYEA 4KDLB 5HKHA 4BBNC 4GXBA 3N3KB 1WZ3A 5DPTA 2WX0A 1OGWA 3L13A 3O65B 1P1AA 5CHVC 4EZLA 2KDIA 4W9LA 2AYOB 3TBLD 4DDGD 4FN2A 4II3B 2LVQA 3ZKJC 2Y5BB 2ZPYA 2IY0B 3JSVA 3UQBA 3PHWB 2GBNA 4BOSC 3HK0A 2M17A 2KKCA 3QX1A 2G45B 2NBVB 1SE9A 4IWOA 4ZRJA 3TJPA 3ZUNA 1AARA 4YL8A 4IWQA 4MGZE 4M8NA 4NJ7A 1NI2A 2KLCA 4MH0E 2KX0A 1VD2A 4FJVB 3R66C 4N9F4 2KFKB 4XC2A 2KDEB 2AEHA 2BYFA 2C7MB 2K1FA 1E8YA 4FADA 3VTVA 3UQAA 4NJ6A 4HWIB 2DZMA 1A5RA 3A4SC 2RPQA 3AU5A 4HCPB 5LXIB 3BINA 3M63B 2LVPA 4FHJA 3PRZA 4GMVA 4KZ0A 5E6OA 3ZRFA 1WMHA 1Z2MA 4W9KA 1Q5WB 2WYQA 3PLVA 5G55A 1V2YA 4GSWA 3PRMB 5AEKB 2J0JA 3OJ4B 5JHAA 3QJZA 4GN1A 5CHFA 1WM2A 2BGFA 4ZDVA 4DBGA 3A1QB 3ZDTA 5D6JB 2K25A 2O6VB 2KJHB 2I1KA 4DWFA 4CHKA 2MBEA 2JXXA 2L0FA 2UWQA 3ECIA 4GB9A 2K8HA 4W9JA 2CR5A 2KANA 3ML9A 2LXAA 5C1ZA 4JQWC 3K9PB 1E7VA 1WFYA 1EO6A 3ZTCA 3V6EB 2KNBA 4MGIE 1I42A 5CX3A 3WAMA 4EKUA 4AP4C 2LRWA 5LXHA 3H7PA 2DHZA 2R2QA 3DVGY 3L0WB 3VUYA 3DOWA 3B08A 2V4LA 5IA7A 1H8CA 1KM7A 1WX7A 3KW5B 3V6CB 5D7GA 2RGFA 2XBBC 1WY8A 3V60A 1WZ0A 1K8RB 4ANVA 2DAFA 1VCBA 3MTNB 1R4MI 2NCNA 2LWPA 2BF8B 2REXA 2LASA 2GBMA 4K1RB 1C1YB 1J8CA 1QZEA 3VAWA 3WANA 4BKSA 2KOXA 2NBUA 4MGYE 2DYBA 4MJSB 1D3ZA 1XQQA 2BWFA 2MW5A 2ZVOA 2MWSB 2NPTA 3A9KA 4KDIC 3VTWA 3SD5A 2GOWA 2C9WB 2O2VA 3QC8B 2JF5A 3RULA 3RZFA 3QHTA 3PLUA 3VFKA 2D3GA 1OEYJ 2DYOA 4KIKB 2JVCA 4IM0A 1GJZA 1SIFA 3DCGA 2LD9A 3H7PB 3R7RA 3U8ZA 3WAPA 1RFAA 2JZ3B 3KVFB 1WR6E 2KLGA 3PRPB 2FCMA 2DENB
chains in the Genus database with same CATH superfamily
3H9DA 3UI3A 3AEEB 3CSFA 1V1PA 1CQVA 3Q8CA 1AWDA 1IGDA 2PJHA 1YNTE 3ENEA 2WXIA 3NOBA 1WYWB 2KWVB 2XEWA 4M01A 2QEJC 2RDBC 2N4FA 4ZHPA 4PYUA 1FEHA 3TCAA 3R8BA 2K6QA 1WR1A 2MP2B 2WU5B 3RPFC 4IG7B 4MGKE 1LGRA 1P9DU 1C4AA 2N9EB 3MJ5A 3UIPB 3AMZA 2ZNVC 2BS4B 2Z0EB 1OTRB 5JZEB 2WXFA 1CK1A 4ANWA 4AS1A 4S17A 3U2SC 4CYEA 3I63C 2G4DB 2BWES 1WGGA 2HDEA 3VQIA 3Q3JA 4RM9A 2G3QB 3DVGX 4RMAA 2Y3AA 3NRZA 2WXKA 3U7DA 4F8CB 2K6DB 4E71A 2L0TA 1RM6C 2C7HA 2OJRA 3VRAB 1WIAA 1YQ3B 4II2B 2C60A 3MC9A 1EF5A 3UGBB 1WGRA 3SDLC 4MM3B 3PV1A 3OJ3A 1C4CA 1FM0D 1R7SA 1YX6B 4HEA1 4KSKC 1UBIA 1N60A 4OVZA 1L6VA 2QHOA 4GOCA 4IM3A 5EE9A 1YD8U 1TZ1A 3H6NA 3DVNV 1I4QA 4F7ZA 1FRDA 5KHOA 3KWLA 2J4XA 4NAMA 2IGHA 1TIFA 3O13A 4KGRA 1LXDA 2MJDA 2WWZA 3UINB 1SF0A 3VDZA 4LNFA 2EKEC 4JIOU 5J18A 4BVUC 4JPSA 1F1HA 1ENFA 4MM3A 2MA9B 1NBFC 2O6VA 3DDCB 3B9JA 3NY5A 1LFDA 5JHBA 2JX5A 3Q69A 4EE2A 1KOTA 3EUB2 1FXIA 3L4PA 4RCOA 3BWUD 1RAXA 2LHEA 2LGIA 2QC8A 2PW9A 4W9DA 4NAWB 4UDUC 1LO5D 4G50A 2V3SA 2LGYA 1VJKA 3NZSA 3SR6A 3NVYA 5MPOA 2N9PC 1XXGA 1Z5SB 1XT9B 5L83A 2WS3B 1MPEA 2KC1A 3AE3B 2WDRB 3AEBB 1IYFA 4MSQB 5C23A 2B76B 2KMMA 1D5ZC 4YT0B 1GB4A 1FXAA 5AUKA 3SEBA 4ICUA 1KLGD 1HQRD 2MQJA 3L17A 5IO9A 1PQSA 2JZZA 3KUZA 2QCZA 3VH3B 2NTTA 3FAHA 5C3JB 4FBJB 2MRPA 5IKCM 4Q2JA 1ZPSA 4C7ZA 1TJEA 3Q14C 1GB1A 3URYA 1AYFA 2WP9B 2KO3A 1F2RC 1PGAA 4FXCA 4LCDE 2L7RA 2AQ1B 1SE3A 5L95C 3B0AA 1WXAA 1L0VB 2D10A 1QILA 2KX3A 5BMIA 4KGSA 2MLBA 1QOAA 3A9JB 1P7EA 2NPTB 2O6VD 3GB1A 1UELA 2KTFA 3N1ZC 2DBYA 1U4AA 1TYGB 2KT7A 1B9RA 5E6PA 3NZ3A 3AH7A 4GDLA 4TMAB 1WX9A 4OVUA 1NVID 3A1QA 1YX5B 3ONSA 1JWSD 2BKFA 1OFFA 1FFUA 2WXHA 3GP7A 3M95A 4OW0A 4WJNA 2PEAA 2B3AA 1WRDB 1QQRA 3Q8BA 4W9EA 3H8HA 3U7ZA 2MBBB 2W54A 3EA6A 4KGTA 2SEBD 3W1SC 3AULA 4ZRIA 1LQBA 3QA8A 2V0GA 1N5WA 1JRPA 2Z59B 3KWVA 1N6ZA 1V86A 2IO1B 3P4QB 4DXFA 3JVZX 2PVGC 5E6NA 5G5HA 3ALBA 2FE8A 3TIXA 1UH6A 2VH2A 5EE0A 3I5JC 2V3PA 2JUOA 2LRUA 5AUIA 3TMPB 2IZVB 1B1ZA 4KKIA 2W9NA 2KDFB 3N30A 2AL3A 4GGQA 4AJYB 1G6JA 4CO7A 4M02A 1FXTB 4AWJA 3KUCB 2KDBA 1GUAB 1XLOA 2IO2B 3L54A 2J7QB 4LDTD 3GZNI 3AU4A 4W9HA 1L7YA 2HTME 4EZKA 4IOIE 1C77A 2BB5A 4AJWA 5BMGA 4DHZB 3A33B 4FA6A 1VRAB 4DK5A 1IPGA 3N3KB 1FRRA 1TKYA 2NTSA 1OGWA 3AE7B 3L13A 3O65B 4EZLA 4W9LA 5H8YE 2LVQA 2Y5BB 2ZPYA 3LYYA 1F52A 3ZGZA 3UQBA 3PHWB 1L4DB 2PMVA 1J7CA 1E7PB 4M8NA 4MH0E 2JXTA 3ETRA 1UNSA 1VZ8A 1IBXA 1CZPA 3NVVA 3Q3OC 2RPQA 4HCPB 3BINA 3M63B 2LVPA 3PRZA 1WMHA 1Z2MA 3Q8EA 2WXMA 3PRMB 1TT5B 1WM2A 4ZDVA 4A90A 4DBGA 3A1QB 2K25A 2I1KA 4CHKA 2MBEA 2KANA 1FFVA 3ZTCA 4KKJA 1SE2A 4RGOS 3WAMA 2LRWA 3Q8FA 1TS3A 5FKAC 1L0XB 3B08A 1K50A 5IA7A 1H8CA 1KM7A 4L1BA 1WX7A 2XBBC 1WZ0A 2WXGA 2DAFA 1JWAD 1C76A 1C1YB 1J8CA 3WANA 2KOXA 2NBUA 2WXLA 1MVKA 1WXQA 1D3ZA 1ZDVA 2BWFA 2XNAC 2MW5A 2C9WB 3QC8B 3QHTA 3PLUA 5BYRA 4KIKB 2WNMA 4ITKA 4IM0A 1SBBB 1PYWD 1SIFA 3DCGA 3WAPA 3ABVB 2JZ3B 1WR6E 2KLGA 4FJYA 3IAS1 4EUTA 4ZRKA 2V1YA 1X1MA 2K8BA 2WHIA 2W3RA 4M0WB 3AN1A 2WXQA 1N62A 1V9JA 4WJQA 3N9YC 2LJ5A 3MC0B 2JZPA 4AUQC 4WWOA 2D3AA 2FCSA 1MG4A 4KV2A 3Q6BA 2KD0A 2AQ2B 3HVDA 4HK2A 1E6EB 3FILB 3SHQA 2LUMA 2DZJA 4NAWA 5C2TB 4IC7B 4PS8A 3ZNGC 2LXCA 3Q2AC 4YXDB 2KN4A 2LZ6A 4NZLB 3D32A 4R3DA 3DVNU 1E9MA 5GMVA 1I4GA 1KH0A 4BOZB 3IT4B 3CSTA 3VR9B 3HUIA 2ICIA 4B9KA 2Q5WD 4G3XB 2KVZA 3MJWA 1Q1OA 2LGXA 3OLMD 4YTMB 2MP2A 2VZKB 3DHIC 3L10B 3EC8A 1WX8A 4GDKA 4PS7A 3JSVB 4US9A 3C8YA 4HDQA 5DPSA 4URKA 1K53A 4A9AA 2IGGA 4A8XC 1EF1A 4J6IA 1EU4A 4PT5A 2WXNA 4WJOA 1QT9A 3DWMA 1CMXB 3TEZA 4NY0A 4NQKE 4ARCA 1GG3A 3KQ4A 3DPDA 2I1JA 1QKZA 3BYTB 2CJOA 1C4PA 3HIZA 3AB5A 4HCNB 2ZPNA 2CU3A 1SJHD 2RD0A 4PYZA 1FCCC 3ZYYX 3IHPC 1P3QU 1WM3A 4BBNF 1SGHA 4LNIA 3B2GA 3DBSA 4XE0A 3ZO5B 3K9OB 1T5XD 1TZOA 2EKIA 1V97A 4OZCA 1F77A 3ZLZA 3WALA 3GS2A 4WWMA 4DHJB 4MEMA 3PT2B 4YSXB 1QOBA 2IYDB 4LLGM 3VVWB 1XF5L 4A55A 1VR9A 3PZDA 1QLBB 1FO4A 3PGEA 1WGDA 4G0NB 1KJTA 2OOBB 3RD2A 1VZ6A 4HJKA 4YSYB 2INDC 2OHFA 5HI1A 4W9FA 4NNJB 3Q3FA 1C79A 1GC7A 3P4SB 2HD5B 1ZE3D 1RRBA 4H2AA 2FAZA 1JALA 2KC2A 4KSLC 4P7IA 2C5LC 2INPE 3JYUA 1XLPA 1L5PA 4I6PA 3VUWA 1NYQA 1ET9A 2KAJA 2IJ0A 2G9HD 2HJ1A 2INNE 2Y5CA 4W9GA 2M0AA 1MHHE 1KRHA 1MG8A 1SIJA 4FJZA 2MBHA 3WA0A 1WJNA 5DPRA 3HVZA 1Q10A 3A9KB 3B2FA 2LJIA 1UBQA 2VH1A 4YSZB 1FMAD 4IW0A 1UWXA 2FCQA 3BY4B 2R61A 1ET6A 2EELA 1F9JA 1WGKA 1RFKA 4ANXA 3FC4A 2I38A 2JQRB 2RR9A 1JQ4A 3APCA 3QWZB 2PE6B 3NZUA 2MHJA 1RLFA 5FK9C 2LVOA 4P16A 4YTNB 4WIPA 3BVMA 5D3DA 2XK5B 4HVBA 3AE1B 3AE4B 3NVZA 1GOZA 4EOYA 4D2KA 3C19A 2YEPB 3TSSA 3NG0A 1SEBD 1WJ6A 3M3JA 1GNUA 2IBIB 4W9IA 2KWUB 2M19A 3W9CB 4IWPA 1XEEA 2A5UA 2SAKA 2GRIA 2MBOA 4MH8A 3N1YC 1PGBA 4KZCA 4IKGA 1D5XC 2BBCA 4M8MA 1FD6A 3P4PB 3BVZA 2WXRA 5AZFA 4HROA 3BYYB 2N9LA 3ZIMA 2WQYB 1ISNA 2C7NB 4E74A 2J53A 1GAQB 2KJ6A 3IG3A 4TUUA 1T0YA 2K22A 3EFCA 1J7AA 4ANUA 2D07B 2GBKA 2MBQA 4E3CA 2WLBA 4ZHOA 2BYVE 1L2NA 3V61A 5T8IA 3AE8B 4HXDA 4WAFA 2W3SA 1I4XA 2WDTB 3P2BA 3TUOA 2NS5A 3ZTDA 3Q8AA 5TR5A 5JH5C 1QF6A 5BYQA 2DZKA 2ZW0A 2ZCBA 3HM6X 4A20A 4XZ4A 2IO3B 4XGAB 4LK0M 2D2QA 2HTHA 4I6NB 4XDCA 2A4ZA 4A3OA 2LUEA 3W2DA 2WXPA 4RNAA 5G5GA 1D5MC 2QSDA 3KYCD 4AOFA 2XK5A 1IP9A 2QJLA 4RM8A 2QMTA 3N32A 3N1XC 3BIID 2N7DA 2L83A 2BYEA 3Q3MC 3P42A 4LNOA 5CHVC 2KDIA 1HA5A 4DDGD 3ZKJC 2IY0B 2W55A 2GBNA 2FUG1 4LTUA 2M17A 3BZDB 4ZRJA 1YN4A 4YL8A 4IWQA 4MGZE 4NJ7A 1NI2A 3AECB 2KX0A 4P6VF 2KFKB 2BYFA 2K1FA 2WXJA 3SFDB 3MP9A 2DZMA 3A4SC 4GMVA 4W9KA 2WYQA 4GSWA 1DOXA 2J0JA 3OJ4B 2KWDA 1EWYC 3TEXA 1M4VA 3AEDB 2O6VB 5D6JB 1HTQA 1JWMD 1VZ7A 3KLSX 2CR5A 5IP4D 1T0QC 3I9V1 1N63A 2R2QA 3L0WB 3VUYA 1IUEA 1IGCA 4P1BC 3I57A 4US8A 2V4IB 2G1EA 4LNKA 3V6CB 5D7GA 3ZJTA 1K8RB 4RGTA 1YJJA 3MTNB 2BW2A 2BF8B 4USAA 2LASA 4K1RB 4C4VA 2DYBA 4MJSB 1DYQA 2NPTA 2V9HA 2NMQA 3Q3NC 3RULA 4HPPA 2D3GA 1OEYJ 2L1AA 2JVCA 1STEA 1XLQA 2MEKA 3U8ZA 3R7RA 3J9CA 2ZW1A 4DXGA 1QOGA 3RNBC 2FCMA 4BKSD 4TQ1A 1T3QA 4J3OD 1V81A 1WGYA 2BQQA 2N7EA 3DBHI 2OJWA 2NR2A 2CS4A 3EFUA 2JYTA 2GLSA 4RFBA 1FNUA 2GMIC 5HFYA 4AQ7A 1F0ZA 3VUXA 4ZYSA 1UGMA 4HPMB 3R7QA 3EGRA 1MHXA 1R4NI 1WH3A 2BT6A 4W9CA 2CHZA 2HJ8A 5EDSA 4NQLB 4ZOHC 1N61A 2E3TA 2K8CA 1DGJA 4GU2A 1VDVA 5AZHA 2KJRA 3QARA 2H88B 2CHWA 4B95A 3A4RA 3V05A 2K5PA 3PSEB 3RN9C 1R4NB 3T9LA 2FCNA 2CHXA 1V5OA 2Z8LA 3GZNB 2GBJA 3NVWA 4DDID 1M94A 2LGSA 3NS8A 2YVCA 2PTLA 1TKEA 1C78A 2V3NA 4M00A 1OEYA 2D3BA 4LDTB 3QAQA 4GIVA 4M0WA 4WH4A 4MJSA 1SXTA 5AZGA 4HKQA 3RNGC 2BS2B 3MFGA 3TL5A 2DAJA 3OAWA 2LFIA 4TQ0A 2YLMA 3L08A 4K7SA 3W1SA 3VHTC 3CWIA 4XYCA 3ZRCA 5BMHA 1ZP0B 3AEGB 4GDKB 2RDHA 4JL9A 4NPNA 3DBRI 3VH4B 3DBRB 2Z0DB 2KQ7A 3DBHB 1ESFA 2JRIB 1WRIA 1HXYD 4XX5A 1XD3B 5E6JA 3AE2B 2IDYA 2NVUI 5BO4B 2JPHA 4ZRPA 2IY1B 3CF6E 2WDQB 1S3SG 2Y5PA 3KH0A 2K9XA 3UF8A 3EHVA 2ZZPB 2KK8A 3RMKC 2JSVX 1GPXA 4MELA 1ZW7A 1P0RA 4A6QA 3APDA 4DQOC 5DPWA 4TV3A 1XLNA 1FIQA 2K39A 5BYSA 2KZRA 5J17A 3KYDD 2LI5A 3WCQA 3KUDB 2NBWB 2AWTA 2N9KA 1Y56A 2QILA 2L76A 1LM8B 5DCNA 4EEWA 1YJ1A 2PVOD 4KVGB 1EU3A 1GC6A 1NI3A 2L05A 5HG2A 2BKRB 4X57B 3JW0X 3RNFC 1P7FA 2CU1A 3DQVA 3IT6B 1V5TA 3ZDMC 5JXVA 3W1YA 1WXVA 4HPLB 1J7BA 4GLSC 3CMMB 3WIMA 2M8SA 3AXCA 1K51A 3N20C 3MHSD 1BT0A 1H4RA 1KTKA 2KQSA 1TY0A 2JWZA 4XWWA 5GXGB 2X38A 4C80A 3E9SA 4A3PA 1I35A 1WYGA 4ZRQA 1TTNA 3DHGC 2QDFA 3ZNZB 5H92C 1OQRA 1PGXA 1JRUA 1E5WA 1V1OA 5HHDG 4JLCA 1WXSA 2AL6A 2WU2B 4TKNA 2FBWB 3L16A 1JWBD 1E7UA 1Y8RC 2KVRA 1WMHB 1YIWA 2FIFA 2KXJA 3E56A 3APFA 4RF0A 1TKGA 1UUPA 4S0RA 2RSUA 4ARIA 1EUVB 3RUIB 1I4PA 3PHXB 4KX6B 4FHKA 2M0XA 1WWTA 4XWTA 2K3UA 4WWNA 2I2YA 2GBRA 4K81A 1SJED 1FNWA 3DBLI 2ZJDA 1PFDA 3ZXVA 1V6EA 2YEPF 3ML8A 2ZEQA 4FLHA 3H7SA 1BXTA 3C0RB 1WJUA 3AM9A 1UGJA 4HKZE 1R4MB 3EECA 3WAOA 1SE4A 4O1NA 2BS3B 3P63A 2G4SA 3W5VB 2W82A 2ACZB 3M62B 3GE3C 3IBEA 2PIAA 4B6WA 1ZKHA 4BKTA 3PO0A 2JT4B 2BB6A 3AE5B 2MX2A 1EM7A 3LXFA 2UYZB 1K52A 2L00B 3ZNID 2RDGA 1Q0WB 2M56B 2X8XX 4GXBA 1WZ3A 1TS5A 1P1AA 1A70A 5I4DA 1L4ZB 4II3B 3JSVA 1T0RC 3HK0A 2G45B 2NBVB 3TJPA 3ZUNA 1BMLC 2GB1A 2KLCA 1VD2A 1ZOYB 1BUIC 2KDEB 2AEHA 2L52A 2C7MB 4FADA 4C7YA 1JWUD 4RGMA 1EWCA 1A5RA 3R2TA 4FHJA 4KZ0A 1TS2A 3ZRFA 1Q5WB 2WDVB 3RI7C 1V2YA 1PUTA 3BVGA 5JHAA 3QJZA 5CHFA 2BGFA 3OWEB 3ZDTA 4RF1A 2KJHB 2JXXA 2L0FA 2UWQA 4GB9A 4W9JA 3ML9A 1E7VA 1WFYA 1EO6A 3V6EB 4WURA 4MGIE 4RGNA 1I42A 5CX3A 4EKUA 4AP4C 2WGSA 5LXHA 1NEKB 3ZXRA 3H7PA 4C00A 2DHZA 3BK2A 2DLBA 3DVGY 4BAXA 3LB8C 1D4BA 2KQ4X 3W5UB 3KW5B 2RGFA 1WY8A 3V60A 4ANVA 3ZQ4A 1UF0A 1VCBA 1AN8A 1R4MI 2NCNA 2LWPA 2GBMA 1QZEA 4BKSA 1XQQA 5FR3A 4B0MA 4KDIC 2GOWA 2O2VA 3DBLB 3T3OA 3PZ8A 1RFAA 3PRPB 4WQMA 4MGYE 3RYTA 1TY2A 2HE7A 3VTUA 1HTOA 3T8MA 2JRHA 1WE6A 2KYWA 2RPVA 1ZGUB 4MSMB 3AEFB 1J19A 1YN3A 1E8XA 3V62A 3LDZE 3VXWA 3PVLA 1HE8A 4HLEA 4ZYNA 3AI5A 2PPHA 1UD7A 1YQBA 2XN9C 4HDOA 2J52A 1UWMA 4FULA 2VRRB 3NHEB 2BVCA 3TEYA 1I4RA 2PKOA 2JY6A 2LEKA 3PZ7A 5D94A 1WI0A 2ZCCA 2TSSA 1YMHE 3ZVVA 4IM2A 5CHWA 1ACCA 3IVFA 3NS1A 1I7HA 2WXOA 3HM3A 2LGDA 3RT3B 5LLIA 1TBEA 2DWQA 2MCNB 1V49A 3RNAC 3SU8X 2KTRB 3MC8A 1YN5A 2DYMA 4GDLB 3RNEC 1E8WA 1ZXIA 3T3NA 3QQ8B 4WWPA 3S2AA 1N5XA 2PLPA 1KF6B 1SB3C 2J0KA 3IFWB 2BPSA 2N1VA 1YQ4B 2E6XA 2N7JA 5FR6A 2AX5A 1WF9A 1E0ZA 3CIRB 2ZNVB 3DHHC 3R3MA 4IUMB 1AW7A 3LJ3A 2J42A 1DOIA 2UU7A 4JX1C 3FKYA 4OHJA 4K3CA 3BK1A 4QAYA 3B1LX 2KWCA 2MSED 2KN5A 4N6EB 1WE7A 3RCZA 2ON8A 5IAAC 3AE6B 3PTFC 3VRBB 1T0SC 3U30A 1S1QB 2DZIA 2N0SB 1IBXB 1YJIA 1YOVB 4EZJA 3AEAB 4EFOA 2KMAA 4N58A 1ZDXA 1L0YB 2FNJB 1XO3A 2LHDA 3RZWC 2ZVNA 1J0GA 1E8ZA 1E10A 2DX5B 4XDDA 4LJPB 2EMSA 4OZBA 3R2IA 2MH7A 3HRDD 3PPAA 3X23A 2CJNA 2H89B 4HRSA 3OG5A 2KFKA 4WJPA 1MJDA 3MHZA 4WQOB 2BYTA 2KFJA 2K0PA 4JWSC 4F1SA 1WXMA 4RH6A 2GI9A 3P1MA 2FIDA 4ICVA 2IGDA 5TSSA 4K7UA 1ZUD2 4TSSA 4DXAB 4MACA 2L3ZA 3QIJA 5D2MB 3PS6A 1XCQL 4KIKA 1MFWA 2M4NA 3I3TB 4JE3B 2INCC 2O2VB 4WAAA 2QIEB 2FUHB 3P4RB 4DHZE 3PREA 2MJ3A 4ASWC 3ZJUA 5KHQA 4BZAA 4JGHB 3SFEB 4CQNA 1NENB 3RNCC 1D6EC 2KHWB 1V8CA 1SSNA 1VLBA 1E90A 4G11A 5G2NA 2L8JA 3QK0A 1TGZB 3GE8C 4YTPB 3IXSA 1FPYA 3DWGC 4MDKE 3ZJVA 3ZNHB 2M1MA 4I6LB 2J0MA 2EMTA 1C3TA 3U4EG 5J2RA 3V3XA 2ONQA 4LNNA 2N9XA 2KMCA 4OZAA 3H1UA 2D5GA 4LJOB 3UIOB 5EE1A 4P1CC 3U52E 2LMCA 1OQYA 2IO0B 3QCAA 4L2YA 4K7WA 2AQ3B 2WX1A 5EE3A 4BKGA 5CTRC 2RMMA 2CKHB 1HZ5A 2N1WA 4NJCA 2R2OA 1JMLA 2PE9A 3A9JA 4DHJD 4PS3A 2ASQA 1KLVA 4MT5A 3TEWA 1ROEA 2D11A 1WJ4A 2L32A 1V1PB 3NUHB 1JCKB 3X0WA 1UZXB 1WGHA 3HHMA 1DOYA 3ZW3A 1PDXA 4N59A 4BFRA 1JW9D 1NDDA 2KTRA 2MJEA 5LNK1 4OVVA 3GOEA 1FCLA 1HEZE 2KDMA 1XCTL 1V80A 1P98A 5IN7A 4KDLB 5HKHA 4BBNC 1F2RI 5DPTA 2WX0A 2AYOB 3TBLD 1KFYB 4FN2A 1FNVA 1CJEA 1JROA 4BOSC 4REZA 4C56C 2KKCA 2OEDA 3QX1A 4PK1A 1SE9A 4IWOA 1AARA 1NYRA 4FJVB 3R66C 4IDIA 4N9F4 4XC2A 1WSPA 1ZXHA 1QOFA 3UQAA 1E8YA 3FILA 3VTVA 4NJ6A 4HWIB 2JU6X 3AU5A 5LXIB 5E6OA 1L6UA 2DNFA 1C9FA 5AEKB 3PLVA 5G55A 4K3BA 3NJTA 4JWUC 5D3IB 4GN1A 4ACFA 4DWFA 3ECIA 2K8HA 1T6BX 2LXAA 5C1ZA 4JQWC 3K9PB 4HJGE 1RWSA 4L23A 2KNBA 2KACA 2VZKD 2D3CA 1RYJA 1HZ6A 2BTEA 3DOWA 2V4LA 2JYEA 1OQQA 1I4HA 2IPKD 4B0EA 3AE9B 2REXA 3IAM1 4YWGG 3VAWA 1TS4A 3RFZB 1MI0A 2ZVOA 5IOIA 2MWSB 3A9KA 3VTWA 3SD5A 2JF5A 3RZFA 3VFKA 3AV8A 2DYOA 2JWUA 3VR8B 1GJZA 3H7PB 2LD9A 3KVFB 1KLUD 4C4VB 2DENB
chains in the Genus database with same CATH topology
3RYTA 4BKSD 4TQ1A 3H9DA 4EUTA 2HE7A 3VTUA 4ZRKA 2V1YA 3CSFA 3T8MA 2JRHA 1X1MA 2K8BA 4M0WB 1WE6A 2PJHA 1V81A 3ENEA 1WGYA 1V9JA 1ZGUB 3NOBA 1WYWB 4MSMB 4WJQA 2KWVB 2N7EA 2XEWA 2N4FA 4PYUA 2LJ5A 1J19A 3DBHI 3TCAA 2NR2A 2CS4A 3EFUA 4AUQC 4WWOA 2K6QA 2FCSA 4KV2A 1WR1A 2MP2B 1E8XA 2GMIC 3V62A 3LDZE 3VXWA 3PVLA 2KD0A 1HE8A 4IG7B 4MGKE 3VUXA 1P9DU 1UGMA 4HPMB 3R7QA 4HLEA 4HK2A 4ZYNA 2N9EB 3AI5A 3SHQA 2PPHA 1R4NI 1WH3A 1UD7A 1YQBA 2DZJA 4HDOA 4NAWA 3UIPB 2ZNVC 4IC7B 2Z0EB 4W9CA 4FULA 4PS8A 2CHZA 1OTRB 2HJ8A 2LXCA 3ZNGC 2VRRB 5EDSA 5JZEB 3NHEB 2LZ6A 3D32A 4NQLB 4ANWA 3DVNU 2JY6A 5GMVA 2K8CA 4CYEA 4GU2A 4BOZB 2G4DB 5AZHA 3CSTA 2KJRA 5D94A 2BWES 3QARA 1WGGA 4B9KA 2CHWA 1WI0A 3VQIA 2ZCCA 3Q3JA 4RM9A 2G3QB 3ZVVA 3A4RA 4B95A 4G3XB 3DVGX 1Q1OA 2LGXA 3MJWA 3PSEB 4IM2A 4RMAA 4FJYA 5CHWA 3OLMD 3T9LA 2MP2A 2FCNA 2CHXA 3U7DA 4F8CB 1V5OA 2K6DB 3IVFA 4E71A 2L0TA 2GBJA 3HM3A 2LGDA 3RT3B 2C7HA 2OJRA 4DDID 1WIAA 3L10B 1M94A 1TBEA 5LLIA 3EC8A 3NS8A 1WX8A 2YVCA 4GDKA 4II2B 2MCNB 1V49A 2C60A 3JSVB 4PS7A 1EF5A 2KTRB 3SU8X 4HDQA 5DPSA 3UGBB 4URKA 1WGRA 3SDLC 1OEYA 4LDTB 3PV1A 3OJ3A 2DYMA 3QAQA 4GDLB 4GIVA 1EF1A 1YX6B 4KSKC 4MJSA 5AZGA 1UBIA 1E8WA 4J6IA 2QHOA 3QQ8B 4WWPA 3S2AA 4GOCA 4WJOA 4IM3A 1CMXB 3TL5A 4NY0A 4NQKE 1YD8U 2DAJA 3OAWA 1TZ1A 3H6NA 1GG3A 4TQ0A 2YLMA 3DVNV 3L08A 3DPDA 4K7SA 3W1SA 2J0KA 3IFWB 4F7ZA 5KHOA 2I1JA 3VHTC 3ZRCA 3HIZA 4GDKB 2BPSA 2N1VA 4HCNB 2ZPNA 4JL9A 4NPNA 2RD0A 3DBRI 4PYZA 5FR6A 1LXDA 3VH4B 3IHPC 1WF9A 2WWZA 3UINB 1P3QU 1WM3A 2ZNVB 4BBNF 3VDZA 2Z0DB 1SGHA 2EKEC 2KQ7A 3DBSA 3R3MA 4IUMB 4JIOU 3LJ3A 3K9OB 3ZO5B 2JRIB 5J18A 4BVUC 4XX5A 1XD3B 4MM3A 2MA9B 2NVUI 1NBFC 5BO4B 2JPHA 2IY1B 3CF6E 3ZLZA 2O6VA 3DDCB 3WALA 1S3SG 3NY5A 1LFDA 3KH0A 5JHBA 4DHJB 3UF8A 1KOTA 3B1LX 4MEMA 3EHVA 3PT2B 2KWCA 2ZZPB 2KK8A 2MSED 2KN5A 2IYDB 1WE7A 1RAXA 3RCZA 4W9DA 4NAWB 5IAAC 3PTFC 3VVWB 4G50A 2V3SA 3PZDA 2LGYA 4MELA 1ZW7A 3PGEA 3NZSA 1P0RA 3U30A 1WGDA 4G0NB 1KJTA 2OOBB 3RD2A 3APDA 1S1QB 4HJKA 2DZIA 5DPWA 4TV3A 2N9PC 1Z5SB 1XT9B 5L83A 4EZJA 4EFOA 2K39A 2KC1A 2KMAA 2KZRA 5J17A 3KYDD 4W9FA 2LI5A 4NNJB 2FNJB 3Q3FA 1IYFA 3KUDB 4MSQB 3RZWC 2ZVNA 5C23A 1J0GA 1E8ZA 1GC7A 2NBWB 2AWTA 2HD5B 2DX5B 1RRBA 2FAZA 2L76A 1LM8B 2KC2A 4LJPB 4KSLC 2EMSA 5DCNA 4P7IA 2C5LC 3JYUA 4ICUA 3PPAA 3X23A 4I6PA 4EEWA 3VUWA 2MQJA 2KFKA 3L17A 1YJ1A 4WJPA 1PQSA 2JZZA 4WQOB 4KVGB 1GC6A 3KUZA 2KFJA 2L05A 4W9GA 3VH3B 2BKRB 4X57B 4FBJB 3JW0X 1MG8A 2MRPA 4FJZA 2MBHA 3WA0A 1WJNA 5DPRA 2CU1A 4F1SA 1WXMA 3A9KB 3DQVA 1UBQA 1V5TA 3ZDMC 3W1YA 2FIDA 1WXVA 4IW0A 4ICVA 2FCQA 4HPLB 2KO3A 3BY4B 4K7UA 3CMMB 4LCDE 1F9JA 3WIMA 2M8SA 2L7RA 4DXAB 2L3ZA 5L95C 3AXCA 3QIJA 5D2MB 3PS6A 3B0AA 3MHSD 1WXAA 4ANXA 1BT0A 1H4RA 4KIKA 2M4NA 2D10A 2KX3A 2RR9A 2KQSA 3I3TB 3APCA 3QWZB 2O2VB 2MLBA 2PE6B 4WAAA 3A9JB 3NZUA 2JWZA 2NPTB 1RLFA 2O6VD 2LVOA 1UELA 2FUHB 2KTFA 2XK5B 4DHZE 4A3PA 4HVBA 1I35A 1U4AA 3PREA 1TTNA 4EOYA 3ZNZB 1JRUA 5E6PA 4ASWC 1E5WA 5KHQA 4JGHB 4GDLA 1WJ6A 4JLCA 3M3JA 1GNUA 1WX9A 2IBIB 2KWUB 4W9IA 1WXSA 2AL6A 2KHWB 4OVUA 4TKNA 3A1QA 4IWPA 2A5UA 1E90A 4G11A 2MBOA 1YX5B 5G2NA 3ONSA 2L8JA 3L16A 2BKFA 3QK0A 1TGZB 1E7UA 4KZCA 1Y8RC 3M95A 2KVRA 1WMHB 4M8MA 4WJNA 2PEAA 1YIWA 2FIFA 2B3AA 2KXJA 1WRDB 4MDKE 5AZFA 4W9EA 4E74A 3ZIMA 3ZNHB 1ISNA 2C7NB 3APFA 2M1MA 2MBBB 4I6LB 2J0MA 2EMTA 1C3TA 3W1SC 3AULA 5J2RA 2RSUA 2KJ6A 1EUVB 3RUIB 3IG3A 4ZRIA 4TUUA 1LQBA 1T0YA 3QA8A 4ANUA 2N9XA 3PHXB 2D07B 2GBKA 2MBQA 2KMCA 2Z59B 4FHKA 1V86A 2IO1B 2M0XA 4E3CA 3JVZX 3H1UA 5E6NA 2BYVE 4LJOB 3ALBA 1L2NA 3TIXA 4WWNA 3UIOB 2GBRA 1UH6A 4K81A 3V61A 1OQYA 2IO0B 3QCAA 4HXDA 4K7WA 2WX1A 4BKGA 2JUOA 2LRUA 2ZJDA 3DBLI 5CTRC 2CKHB 1V6EA 3ML8A 2WDTB 2ZEQA 3P2BA 4FLHA 2NS5A 2N1WA 3H7SA 3TMPB 2IZVB 2R2OA 2W9NA 2KDFB 3N30A 3ZTDA 2AL3A 5TR5A 2PE9A 5JH5C 3A9JA 4GGQA 3C0RB 2DZKA 4DHJD 4AJYB 1WJUA 2ZCBA 4PS3A 3HM6X 4A20A 4CO7A 2ASQA 4XZ4A 1G6JA 2IO3B 1FXTB 4AWJA 3KUCB 1KLVA 3EECA 3WAOA 2KDBA 2D11A 1WJ4A 2D2QA 2HTHA 4I6NB 1GUAB 2G4SA 2A4ZA 4A3OA 2LUEA 3X0WA 1UZXB 1WGHA 3HHMA 3M62B 2IO2B 3L54A 2J7QB 3IBEA 3ZW3A 3KYCD 4AOFA 2XK5A 1IP9A 4LDTD 4B6WA 1ZKHA 4RM8A 3GZNI 3AU4A 4BKTA 4BFRA 1NDDA 4W9HA 2JT4B 3N32A 2MX2A 1L7YA 4EZKA 2KTRA 4OVVA 3GOEA 4AJWA 2UYZB 4DHZB 3A33B 2L00B 3ZNID 4FA6A 2N7DA 4DK5A 1IPGA 1Q0WB 1V80A 1P98A 2BYEA 4KDLB 5HKHA 4BBNC 4GXBA 3N3KB 1WZ3A 5DPTA 2WX0A 1OGWA 3L13A 3O65B 1P1AA 5CHVC 4EZLA 2KDIA 4W9LA 2AYOB 3TBLD 4DDGD 4FN2A 4II3B 2LVQA 3ZKJC 2Y5BB 2ZPYA 2IY0B 3JSVA 3UQBA 3PHWB 2GBNA 4BOSC 3HK0A 2M17A 2KKCA 3QX1A 2G45B 2NBVB 1SE9A 4IWOA 4ZRJA 3TJPA 3ZUNA 1AARA 4YL8A 4IWQA 4MGZE 4M8NA 4NJ7A 1NI2A 2KLCA 4MH0E 2KX0A 1VD2A 4FJVB 3R66C 4N9F4 2KFKB 4XC2A 2KDEB 2AEHA 2BYFA 2C7MB 2K1FA 1E8YA 4FADA 3VTVA 3UQAA 4NJ6A 4HWIB 2DZMA 1A5RA 3A4SC 2RPQA 3AU5A 4HCPB 5LXIB 3BINA 3M63B 2LVPA 4FHJA 3PRZA 4GMVA 4KZ0A 5E6OA 3ZRFA 1WMHA 1Z2MA 4W9KA 1Q5WB 2WYQA 3PLVA 5G55A 1V2YA 4GSWA 3PRMB 5AEKB 2J0JA 3OJ4B 5JHAA 3QJZA 4GN1A 5CHFA 1WM2A 2BGFA 4ZDVA 4DBGA 3A1QB 3ZDTA 5D6JB 2K25A 2O6VB 2KJHB 2I1KA 4DWFA 4CHKA 2MBEA 2JXXA 2L0FA 2UWQA 3ECIA 4GB9A 2K8HA 4W9JA 2CR5A 2KANA 3ML9A 2LXAA 5C1ZA 4JQWC 3K9PB 1E7VA 1WFYA 1EO6A 3ZTCA 3V6EB 2KNBA 4MGIE 1I42A 5CX3A 3WAMA 4EKUA 4AP4C 2LRWA 5LXHA 3H7PA 2DHZA 2R2QA 3DVGY 3L0WB 3VUYA 3DOWA 3B08A 2V4LA 5IA7A 1H8CA 1KM7A 1WX7A 3KW5B 3V6CB 5D7GA 2RGFA 2XBBC 1WY8A 3V60A 1WZ0A 1K8RB 4ANVA 2DAFA 1VCBA 3MTNB 1R4MI 2NCNA 2LWPA 2BF8B 2REXA 2LASA 2GBMA 4K1RB 1C1YB 1J8CA 1QZEA 3VAWA 3WANA 4BKSA 2KOXA 2NBUA 4MGYE 2DYBA 4MJSB 1D3ZA 1XQQA 2BWFA 2MW5A 2ZVOA 2MWSB 2NPTA 3A9KA 4KDIC 3VTWA 3SD5A 2GOWA 2C9WB 2O2VA 3QC8B 2JF5A 3RULA 3RZFA 3QHTA 3PLUA 3VFKA 2D3GA 1OEYJ 2DYOA 4KIKB 2JVCA 4IM0A 1GJZA 1SIFA 3DCGA 2LD9A 3H7PB 3R7RA 3U8ZA 3WAPA 1RFAA 2JZ3B 3KVFB 1WR6E 2KLGA 3PRPB 2FCMA 2DENB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RYT A;  4BKS D;  4TQ1 A;  3H9D A;  4EUT A;  2HE7 A;  3VTU A;  4ZRK A;  2V1Y A;  3CSF A;  3T8M A;  2JRH A;  1X1M A;  2K8B A;  4M0W B;  1WE6 A;  2PJH A;  1V81 A;  3ENE A;  1WGY A;  1V9J A;  1ZGU B;  3NOB A;  1WYW B;  4MSM B;  4WJQ A;  2KWV B;  2N7E A;  2XEW A;  2N4F A;  4PYU A;  2LJ5 A;  1J19 A;  3DBH I;  3TCA A;  2NR2 A;  2CS4 A;  3EFU A;  4AUQ C;  4WWO A;  2K6Q A;  2FCS A;  4KV2 A;  1WR1 A;  2MP2 B;  1E8X A;  2GMI C;  3V62 A;  3LDZ E;  3VXW A;  3PVL A;  2KD0 A;  1HE8 A;  4IG7 B;  4MGK E;  3VUX A;  1P9D U;  1UGM A;  4HPM B;  3R7Q A;  4HLE A;  4HK2 A;  4ZYN A;  2N9E B;  3AI5 A;  3SHQ A;  2PPH A;  1R4N I;  1WH3 A;  1UD7 A;  1YQB A;  2DZJ A;  4HDO A;  4NAW A;  3UIP B;  2ZNV C;  4IC7 B;  2Z0E B;  4W9C A;  4FUL A;  4PS8 A;  2CHZ A;  1OTR B;  2HJ8 A;  2LXC A;  3ZNG C;  2VRR B;  5EDS A;  5JZE B;  3NHE B;  2LZ6 A;  3D32 A;  4NQL B;  4ANW A;  3DVN U;  2JY6 A;  5GMV A;  2K8C A;  4CYE A;  4GU2 A;  4BOZ B;  2G4D B;  5AZH A;  3CST A;  2KJR A;  5D94 A;  2BWE S;  3QAR A;  1WGG A;  4B9K A;  2CHW A;  1WI0 A;  3VQI A;  2ZCC A;  3Q3J A;  4RM9 A;  2G3Q B;  3ZVV A;  3A4R A;  4B95 A;  4G3X B;  3DVG X;  1Q1O A;  2LGX A;  3MJW A;  3PSE B;  4IM2 A;  4RMA A;  4FJY A;  5CHW A;  3OLM D;  3T9L A;  2MP2 A;  2FCN A;  2CHX A;  3U7D A;  4F8C B;  1V5O A;  2K6D B;  3IVF A;  4E71 A;  2L0T A;  2GBJ A;  3HM3 A;  2LGD A;  3RT3 B;  2C7H A;  2OJR A;  4DDI D;  1WIA A;  3L10 B;  1M94 A;  1TBE A;  5LLI A;  3EC8 A;  3NS8 A;  1WX8 A;  2YVC A;  4GDK A;  4II2 B;  2MCN B;  1V49 A;  2C60 A;  3JSV B;  4PS7 A;  1EF5 A;  2KTR B;  3SU8 X;  4HDQ A;  5DPS A;  3UGB B;  4URK A;  1WGR A;  3SDL C;  1OEY A;  4LDT B;  3PV1 A;  3OJ3 A;  2DYM A;  3QAQ A;  4GDL B;  4GIV A;  1EF1 A;  1YX6 B;  4KSK C;  4MJS A;  5AZG A;  1UBI A;  1E8W A;  4J6I A;  2QHO A;  3QQ8 B;  4WWP A;  3S2A A;  4GOC A;  4WJO A;  4IM3 A;  1CMX B;  3TL5 A;  4NY0 A;  4NQK E;  1YD8 U;  2DAJ A;  3OAW A;  1TZ1 A;  3H6N A;  1GG3 A;  4TQ0 A;  2YLM A;  3DVN V;  3L08 A;  3DPD A;  4K7S A;  3W1S A;  2J0K A;  3IFW B;  4F7Z A;  5KHO A;  2I1J A;  3VHT C;  3ZRC A;  3HIZ A;  4GDK B;  2BPS A;  2N1V A;  4HCN B;  2ZPN A;  4JL9 A;  4NPN A;  2RD0 A;  3DBR I;  4PYZ A;  5FR6 A;  1LXD A;  3VH4 B;  3IHP C;  1WF9 A;  2WWZ A;  3UIN B;  1P3Q U;  1WM3 A;  2ZNV B;  4BBN F;  3VDZ A;  2Z0D B;  1SGH A;  2EKE C;  2KQ7 A;  3DBS A;  3R3M A;  4IUM B;  4JIO U;  3LJ3 A;  3K9O B;  3ZO5 B;  2JRI B;  5J18 A;  4BVU C;  4XX5 A;  1XD3 B;  4MM3 A;  2MA9 B;  2NVU I;  1NBF C;  5BO4 B;  2JPH A;  2IY1 B;  3CF6 E;  3ZLZ A;  2O6V A;  3DDC B;  3WAL A;  1S3S G;  3NY5 A;  1LFD A;  3KH0 A;  5JHB A;  4DHJ B;  3UF8 A;  1KOT A;  3B1L X;  4MEM A;  3EHV A;  3PT2 B;  2KWC A;  2ZZP B;  2KK8 A;  2MSE D;  2KN5 A;  2IYD B;  1WE7 A;  1RAX A;  3RCZ A;  4W9D A;  4NAW B;  5IAA C;  3PTF C;  3VVW B;  4G50 A;  2V3S A;  3PZD A;  2LGY A;  4MEL A;  1ZW7 A;  3PGE A;  3NZS A;  1P0R A;  3U30 A;  1WGD A;  4G0N B;  1KJT A;  2OOB B;  3RD2 A;  3APD A;  1S1Q B;  4HJK A;  2DZI A;  5DPW A;  4TV3 A;  2N9P C;  1Z5S B;  1XT9 B;  5L83 A;  4EZJ A;  4EFO A;  2K39 A;  2KC1 A;  2KMA A;  2KZR A;  5J17 A;  3KYD D;  4W9F A;  2LI5 A;  4NNJ B;  2FNJ B;  3Q3F A;  1IYF A;  3KUD B;  4MSQ B;  3RZW C;  2ZVN A;  5C23 A;  1J0G A;  1E8Z A;  1GC7 A;  2NBW B;  2AWT A;  2HD5 B;  2DX5 B;  1RRB A;  2FAZ A;  2L76 A;  1LM8 B;  2KC2 A;  4LJP B;  4KSL C;  2EMS A;  5DCN A;  4P7I A;  2C5L C;  3JYU A;  4ICU A;  3PPA A;  3X23 A;  4I6P A;  4EEW A;  3VUW A;  2MQJ A;  2KFK A;  3L17 A;  1YJ1 A;  4WJP A;  1PQS A;  2JZZ A;  4WQO B;  4KVG B;  1GC6 A;  3KUZ A;  2KFJ A;  2L05 A;  4W9G A;  3VH3 B;  2BKR B;  4X57 B;  4FBJ B;  3JW0 X;  1MG8 A;  2MRP A;  4FJZ A;  2MBH A;  3WA0 A;  1WJN A;  5DPR A;  2CU1 A;  4F1S A;  1WXM A;  3A9K B;  3DQV A;  1UBQ A;  1V5T A;  3ZDM C;  3W1Y A;  2FID A;  1WXV A;  4IW0 A;  4ICV A;  2FCQ A;  4HPL B;  2KO3 A;  3BY4 B;  4K7U A;  3CMM B;  4LCD E;  1F9J A;  3WIM A;  2M8S A;  2L7R A;  4DXA B;  2L3Z A;  5L95 C;  3AXC A;  3QIJ A;  5D2M B;  3PS6 A;  3B0A A;  3MHS D;  1WXA A;  4ANX A;  1BT0 A;  1H4R A;  4KIK A;  2M4N A;  2D10 A;  2KX3 A;  2RR9 A;  2KQS A;  3I3T B;  3APC A;  3QWZ B;  2O2V B;  2MLB A;  2PE6 B;  4WAA A;  3A9J B;  3NZU A;  2JWZ A;  2NPT B;  1RLF A;  2O6V D;  2LVO A;  1UEL A;  2FUH B;  2KTF A;  2XK5 B;  4DHZ E;  4A3P A;  4HVB A;  1I35 A;  1U4A A;  3PRE A;  1TTN A;  4EOY A;  3ZNZ B;  1JRU A;  5E6P A;  4ASW C;  1E5W A;  5KHQ A;  4JGH B;  4GDL A;  1WJ6 A;  4JLC A;  3M3J A;  1GNU A;  1WX9 A;  2IBI B;  2KWU B;  4W9I A;  1WXS A;  2AL6 A;  2KHW B;  4OVU A;  4TKN A;  3A1Q A;  4IWP A;  2A5U A;  1E90 A;  4G11 A;  2MBO A;  1YX5 B;  5G2N A;  3ONS A;  2L8J A;  3L16 A;  2BKF A;  3QK0 A;  1TGZ B;  1E7U A;  4KZC A;  1Y8R C;  3M95 A;  2KVR A;  1WMH B;  4M8M A;  4WJN A;  2PEA A;  1YIW A;  2FIF A;  2B3A A;  2KXJ A;  1WRD B;  4MDK E;  5AZF A;  4W9E A;  4E74 A;  3ZIM A;  3ZNH B;  1ISN A;  2C7N B;  3APF A;  2M1M A;  2MBB B;  4I6L B;  2J0M A;  2EMT A;  1C3T A;  3W1S C;  3AUL A;  5J2R A;  2RSU A;  2KJ6 A;  1EUV B;  3RUI B;  3IG3 A;  4ZRI A;  4TUU A;  1LQB A;  1T0Y A;  3QA8 A;  4ANU A;  2N9X A;  3PHX B;  2D07 B;  2GBK A;  2MBQ A;  2KMC A;  2Z59 B;  4FHK A;  1V86 A;  2IO1 B;  2M0X A;  4E3C A;  3JVZ X;  3H1U A;  5E6N A;  2BYV E;  4LJO B;  3ALB A;  1L2N A;  3TIX A;  4WWN A;  3UIO B;  2GBR A;  1UH6 A;  4K81 A;  3V61 A;  1OQY A;  2IO0 B;  3QCA A;  4HXD A;  4K7W A;  2WX1 A;  4BKG A;  2JUO A;  2LRU A;  2ZJD A;  3DBL I;  5CTR C;  2CKH B;  1V6E A;  3ML8 A;  2WDT B;  2ZEQ A;  3P2B A;  4FLH A;  2NS5 A;  2N1W A;  3H7S A;  3TMP B;  2IZV B;  2R2O A;  2W9N A;  2KDF B;  3N30 A;  3ZTD A;  2AL3 A;  5TR5 A;  2PE9 A;  5JH5 C;  3A9J A;  4GGQ A;  3C0R B;  2DZK A;  4DHJ D;  4AJY B;  1WJU A;  2ZCB A;  4PS3 A;  3HM6 X;  4A20 A;  4CO7 A;  2ASQ A;  4XZ4 A;  1G6J A;  2IO3 B;  1FXT B;  4AWJ A;  3KUC B;  1KLV A;  3EEC A;  3WAO A;  2KDB A;  2D11 A;  1WJ4 A;  2D2Q A;  2HTH A;  4I6N B;  1GUA B;  2G4S A;  2A4Z A;  4A3O A;  2LUE A;  3X0W A;  1UZX B;  1WGH A;  3HHM A;  3M62 B;  2IO2 B;  3L54 A;  2J7Q B;  3IBE A;  3ZW3 A;  3KYC D;  4AOF A;  2XK5 A;  1IP9 A;  4LDT D;  4B6W A;  1ZKH A;  4RM8 A;  3GZN I;  3AU4 A;  4BKT A;  4BFR A;  1NDD A;  4W9H A;  2JT4 B;  3N32 A;  2MX2 A;  1L7Y A;  4EZK A;  2KTR A;  4OVV A;  3GOE A;  4AJW A;  2UYZ B;  4DHZ B;  3A33 B;  2L00 B;  3ZNI D;  4FA6 A;  2N7D A;  4DK5 A;  1IPG A;  1Q0W B;  1V80 A;  1P98 A;  2BYE A;  4KDL B;  5HKH A;  4BBN C;  4GXB A;  3N3K B;  1WZ3 A;  5DPT A;  2WX0 A;  1OGW A;  3L13 A;  3O65 B;  1P1A A;  5CHV C;  4EZL A;  2KDI A;  4W9L A;  2AYO B;  3TBL D;  4DDG D;  4FN2 A;  4II3 B;  2LVQ A;  3ZKJ C;  2Y5B B;  2ZPY A;  2IY0 B;  3JSV A;  3UQB A;  3PHW B;  2GBN A;  4BOS C;  3HK0 A;  2M17 A;  2KKC A;  3QX1 A;  2G45 B;  2NBV B;  1SE9 A;  4IWO A;  4ZRJ A;  3TJP A;  3ZUN A;  1AAR A;  4YL8 A;  4IWQ A;  4MGZ E;  4M8N A;  4NJ7 A;  1NI2 A;  2KLC A;  4MH0 E;  2KX0 A;  1VD2 A;  4FJV B;  3R66 C;  4N9F 4;  2KFK B;  4XC2 A;  2KDE B;  2AEH A;  2BYF A;  2C7M B;  2K1F A;  1E8Y A;  4FAD A;  3VTV A;  3UQA A;  4NJ6 A;  4HWI B;  2DZM A;  1A5R A;  3A4S C;  2RPQ A;  3AU5 A;  4HCP B;  5LXI B;  3BIN A;  3M63 B;  2LVP A;  4FHJ A;  3PRZ A;  4GMV A;  4KZ0 A;  5E6O A;  3ZRF A;  1WMH A;  1Z2M A;  4W9K A;  1Q5W B;  2WYQ A;  3PLV A;  5G55 A;  1V2Y A;  4GSW A;  3PRM B;  5AEK B;  2J0J A;  3OJ4 B;  5JHA A;  3QJZ A;  4GN1 A;  5CHF A;  1WM2 A;  2BGF A;  4ZDV A;  4DBG A;  3A1Q B;  3ZDT A;  5D6J B;  2K25 A;  2O6V B;  2KJH B;  2I1K A;  4DWF A;  4CHK A;  2MBE A;  2JXX A;  2L0F A;  2UWQ A;  3ECI A;  4GB9 A;  2K8H A;  4W9J A;  2CR5 A;  2KAN A;  3ML9 A;  2LXA A;  5C1Z A;  4JQW C;  3K9P B;  1E7V A;  1WFY A;  1EO6 A;  3ZTC A;  3V6E B;  2KNB A;  4MGI E;  1I42 A;  5CX3 A;  3WAM A;  4EKU A;  4AP4 C;  2LRW A;  5LXH A;  3H7P A;  2DHZ A;  2R2Q A;  3DVG Y;  3L0W B;  3VUY A;  3DOW A;  3B08 A;  2V4L A;  5IA7 A;  1H8C A;  1KM7 A;  1WX7 A;  3KW5 B;  3V6C B;  5D7G A;  2RGF A;  2XBB C;  1WY8 A;  3V60 A;  1WZ0 A;  1K8R B;  4ANV A;  2DAF A;  1VCB A;  3MTN B;  1R4M I;  2NCN A;  2LWP A;  2BF8 B;  2REX A;  2LAS A;  2GBM A;  4K1R B;  1C1Y B;  1J8C A;  1QZE A;  3VAW A;  3WAN A;  4BKS A;  2KOX A;  2NBU A;  4MGY E;  2DYB A;  4MJS B;  1D3Z A;  1XQQ A;  2BWF A;  2MW5 A;  2ZVO A;  2MWS B;  2NPT A;  3A9K A;  4KDI C;  3VTW A;  3SD5 A;  2GOW A;  2C9W B;  2O2V A;  3QC8 B;  2JF5 A;  3RUL A;  3RZF A;  3QHT A;  3PLU A;  3VFK A;  2D3G A;  1OEY J;  2DYO A;  4KIK B;  2JVC A;  4IM0 A;  1GJZ A;  1SIF A;  3DCG A;  2LD9 A;  3H7P B;  3R7R A;  3U8Z A;  3WAP A;  1RFA A;  2JZ3 B;  3KVF B;  1WR6 E;  2KLG A;  3PRP B;  2FCM A;  2DEN B; 
#chains in the Genus database with same CATH topology
 3H9D A;  3UI3 A;  3AEE B;  3CSF A;  1V1P A;  1CQV A;  3Q8C A;  1AWD A;  1IGD A;  2PJH A;  1YNT E;  3ENE A;  2WXI A;  3NOB A;  1WYW B;  2KWV B;  2XEW A;  4M01 A;  2QEJ C;  2RDB C;  2N4F A;  4ZHP A;  4PYU A;  1FEH A;  3TCA A;  3R8B A;  2K6Q A;  1WR1 A;  2MP2 B;  2WU5 B;  3RPF C;  4IG7 B;  4MGK E;  1LGR A;  1P9D U;  1C4A A;  2N9E B;  3MJ5 A;  3UIP B;  3AMZ A;  2ZNV C;  2BS4 B;  2Z0E B;  1OTR B;  5JZE B;  2WXF A;  1CK1 A;  4ANW A;  4AS1 A;  4S17 A;  3U2S C;  4CYE A;  3I63 C;  2G4D B;  2BWE S;  1WGG A;  2HDE A;  3VQI A;  3Q3J A;  4RM9 A;  2G3Q B;  3DVG X;  4RMA A;  2Y3A A;  3NRZ A;  2WXK A;  3U7D A;  4F8C B;  2K6D B;  4E71 A;  2L0T A;  1RM6 C;  2C7H A;  2OJR A;  3VRA B;  1WIA A;  1YQ3 B;  4II2 B;  2C60 A;  3MC9 A;  1EF5 A;  3UGB B;  1WGR A;  3SDL C;  4MM3 B;  3PV1 A;  3OJ3 A;  1C4C A;  1FM0 D;  1R7S A;  1YX6 B;  4HEA 1;  4KSK C;  1UBI A;  1N60 A;  4OVZ A;  1L6V A;  2QHO A;  4GOC A;  4IM3 A;  5EE9 A;  1YD8 U;  1TZ1 A;  3H6N A;  3DVN V;  1I4Q A;  4F7Z A;  1FRD A;  5KHO A;  3KWL A;  2J4X A;  4NAM A;  2IGH A;  1TIF A;  3O13 A;  4KGR A;  1LXD A;  2MJD A;  2WWZ A;  3UIN B;  1SF0 A;  3VDZ A;  4LNF A;  2EKE C;  4JIO U;  5J18 A;  4BVU C;  4JPS A;  1F1H A;  1ENF A;  4MM3 A;  2MA9 B;  1NBF C;  2O6V A;  3DDC B;  3B9J A;  3NY5 A;  1LFD A;  5JHB A;  2JX5 A;  3Q69 A;  4EE2 A;  1KOT A;  3EUB 2;  1FXI A;  3L4P A;  4RCO A;  3BWU D;  1RAX A;  2LHE A;  2LGI A;  2QC8 A;  2PW9 A;  4W9D A;  4NAW B;  4UDU C;  1LO5 D;  4G50 A;  2V3S A;  2LGY A;  1VJK A;  3NZS A;  3SR6 A;  3NVY A;  5MPO A;  2N9P C;  1XXG A;  1Z5S B;  1XT9 B;  5L83 A;  2WS3 B;  1MPE A;  2KC1 A;  3AE3 B;  2WDR B;  3AEB B;  1IYF A;  4MSQ B;  5C23 A;  2B76 B;  2KMM A;  1D5Z C;  4YT0 B;  1GB4 A;  1FXA A;  5AUK A;  3SEB A;  4ICU A;  1KLG D;  1HQR D;  2MQJ A;  3L17 A;  5IO9 A;  1PQS A;  2JZZ A;  3KUZ A;  2QCZ A;  3VH3 B;  2NTT A;  3FAH A;  5C3J B;  4FBJ B;  2MRP A;  5IKC M;  4Q2J A;  1ZPS A;  4C7Z A;  1TJE A;  3Q14 C;  1GB1 A;  3URY A;  1AYF A;  2WP9 B;  2KO3 A;  1F2R C;  1PGA A;  4FXC A;  4LCD E;  2L7R A;  2AQ1 B;  1SE3 A;  5L95 C;  3B0A A;  1WXA A;  1L0V B;  2D10 A;  1QIL A;  2KX3 A;  5BMI A;  4KGS A;  2MLB A;  1QOA A;  3A9J B;  1P7E A;  2NPT B;  2O6V D;  3GB1 A;  1UEL A;  2KTF A;  3N1Z C;  2DBY A;  1U4A A;  1TYG B;  2KT7 A;  1B9R A;  5E6P A;  3NZ3 A;  3AH7 A;  4GDL A;  4TMA B;  1WX9 A;  4OVU A;  1NVI D;  3A1Q A;  1YX5 B;  3ONS A;  1JWS D;  2BKF A;  1OFF A;  1FFU A;  2WXH A;  3GP7 A;  3M95 A;  4OW0 A;  4WJN A;  2PEA A;  2B3A A;  1WRD B;  1QQR A;  3Q8B A;  4W9E A;  3H8H A;  3U7Z A;  2MBB B;  2W54 A;  3EA6 A;  4KGT A;  2SEB D;  3W1S C;  3AUL A;  4ZRI A;  1LQB A;  3QA8 A;  2V0G A;  1N5W A;  1JRP A;  2Z59 B;  3KWV A;  1N6Z A;  1V86 A;  2IO1 B;  3P4Q B;  4DXF A;  3JVZ X;  2PVG C;  5E6N A;  5G5H A;  3ALB A;  2FE8 A;  3TIX A;  1UH6 A;  2VH2 A;  5EE0 A;  3I5J C;  2V3P A;  2JUO A;  2LRU A;  5AUI A;  3TMP B;  2IZV B;  1B1Z A;  4KKI A;  2W9N A;  2KDF B;  3N30 A;  2AL3 A;  4GGQ A;  4AJY B;  1G6J A;  4CO7 A;  4M02 A;  1FXT B;  4AWJ A;  3KUC B;  2KDB A;  1GUA B;  1XLO A;  2IO2 B;  3L54 A;  2J7Q B;  4LDT D;  3GZN I;  3AU4 A;  4W9H A;  1L7Y A;  2HTM E;  4EZK A;  4IOI E;  1C77 A;  2BB5 A;  4AJW A;  5BMG A;  4DHZ B;  3A33 B;  4FA6 A;  1VRA B;  4DK5 A;  1IPG A;  3N3K B;  1FRR A;  1TKY A;  2NTS A;  1OGW A;  3AE7 B;  3L13 A;  3O65 B;  4EZL A;  4W9L A;  5H8Y E;  2LVQ A;  2Y5B B;  2ZPY A;  3LYY A;  1F52 A;  3ZGZ A;  3UQB A;  3PHW B;  1L4D B;  2PMV A;  1J7C A;  1E7P B;  4M8N A;  4MH0 E;  2JXT A;  3ETR A;  1UNS A;  1VZ8 A;  1IBX A;  1CZP A;  3NVV A;  3Q3O C;  2RPQ A;  4HCP B;  3BIN A;  3M63 B;  2LVP A;  3PRZ A;  1WMH A;  1Z2M A;  3Q8E A;  2WXM A;  3PRM B;  1TT5 B;  1WM2 A;  4ZDV A;  4A90 A;  4DBG A;  3A1Q B;  2K25 A;  2I1K A;  4CHK A;  2MBE A;  2KAN A;  1FFV A;  3ZTC A;  4KKJ A;  1SE2 A;  4RGO S;  3WAM A;  2LRW A;  3Q8F A;  1TS3 A;  5FKA C;  1L0X B;  3B08 A;  1K50 A;  5IA7 A;  1H8C A;  1KM7 A;  4L1B A;  1WX7 A;  2XBB C;  1WZ0 A;  2WXG A;  2DAF A;  1JWA D;  1C76 A;  1C1Y B;  1J8C A;  3WAN A;  2KOX A;  2NBU A;  2WXL A;  1MVK A;  1WXQ A;  1D3Z A;  1ZDV A;  2BWF A;  2XNA C;  2MW5 A;  2C9W B;  3QC8 B;  3QHT A;  3PLU A;  5BYR A;  4KIK B;  2WNM A;  4ITK A;  4IM0 A;  1SBB B;  1PYW D;  1SIF A;  3DCG A;  3WAP A;  3ABV B;  2JZ3 B;  1WR6 E;  2KLG A;  4FJY A;  3IAS 1;  4EUT A;  4ZRK A;  2V1Y A;  1X1M A;  2K8B A;  2WHI A;  2W3R A;  4M0W B;  3AN1 A;  2WXQ A;  1N62 A;  1V9J A;  4WJQ A;  3N9Y C;  2LJ5 A;  3MC0 B;  2JZP A;  4AUQ C;  4WWO A;  2D3A A;  2FCS A;  1MG4 A;  4KV2 A;  3Q6B A;  2KD0 A;  2AQ2 B;  3HVD A;  4HK2 A;  1E6E B;  3FIL B;  3SHQ A;  2LUM A;  2DZJ A;  4NAW A;  5C2T B;  4IC7 B;  4PS8 A;  3ZNG C;  2LXC A;  3Q2A C;  4YXD B;  2KN4 A;  2LZ6 A;  4NZL B;  3D32 A;  4R3D A;  3DVN U;  1E9M A;  5GMV A;  1I4G A;  1KH0 A;  4BOZ B;  3IT4 B;  3CST A;  3VR9 B;  3HUI A;  2ICI A;  4B9K A;  2Q5W D;  4G3X B;  2KVZ A;  3MJW A;  1Q1O A;  2LGX A;  3OLM D;  4YTM B;  2MP2 A;  2VZK B;  3DHI C;  3L10 B;  3EC8 A;  1WX8 A;  4GDK A;  4PS7 A;  3JSV B;  4US9 A;  3C8Y A;  4HDQ A;  5DPS A;  4URK A;  1K53 A;  4A9A A;  2IGG A;  4A8X C;  1EF1 A;  4J6I A;  1EU4 A;  4PT5 A;  2WXN A;  4WJO A;  1QT9 A;  3DWM A;  1CMX B;  3TEZ A;  4NY0 A;  4NQK E;  4ARC A;  1GG3 A;  3KQ4 A;  3DPD A;  2I1J A;  1QKZ A;  3BYT B;  2CJO A;  1C4P A;  3HIZ A;  3AB5 A;  4HCN B;  2ZPN A;  2CU3 A;  1SJH D;  2RD0 A;  4PYZ A;  1FCC C;  3ZYY X;  3IHP C;  1P3Q U;  1WM3 A;  4BBN F;  1SGH A;  4LNI A;  3B2G A;  3DBS A;  4XE0 A;  3ZO5 B;  3K9O B;  1T5X D;  1TZO A;  2EKI A;  1V97 A;  4OZC A;  1F77 A;  3ZLZ A;  3WAL A;  3GS2 A;  4WWM A;  4DHJ B;  4MEM A;  3PT2 B;  4YSX B;  1QOB A;  2IYD B;  4LLG M;  3VVW B;  1XF5 L;  4A55 A;  1VR9 A;  3PZD A;  1QLB B;  1FO4 A;  3PGE A;  1WGD A;  4G0N B;  1KJT A;  2OOB B;  3RD2 A;  1VZ6 A;  4HJK A;  4YSY B;  2IND C;  2OHF A;  5HI1 A;  4W9F A;  4NNJ B;  3Q3F A;  1C79 A;  1GC7 A;  3P4S B;  2HD5 B;  1ZE3 D;  1RRB A;  4H2A A;  2FAZ A;  1JAL A;  2KC2 A;  4KSL C;  4P7I A;  2C5L C;  2INP E;  3JYU A;  1XLP A;  1L5P A;  4I6P A;  3VUW A;  1NYQ A;  1ET9 A;  2KAJ A;  2IJ0 A;  2G9H D;  2HJ1 A;  2INN E;  2Y5C A;  4W9G A;  2M0A A;  1MHH E;  1KRH A;  1MG8 A;  1SIJ A;  4FJZ A;  2MBH A;  3WA0 A;  1WJN A;  5DPR A;  3HVZ A;  1Q10 A;  3A9K B;  3B2F A;  2LJI A;  1UBQ A;  2VH1 A;  4YSZ B;  1FMA D;  4IW0 A;  1UWX A;  2FCQ A;  3BY4 B;  2R61 A;  1ET6 A;  2EEL A;  1F9J A;  1WGK A;  1RFK A;  4ANX A;  3FC4 A;  2I38 A;  2JQR B;  2RR9 A;  1JQ4 A;  3APC A;  3QWZ B;  2PE6 B;  3NZU A;  2MHJ A;  1RLF A;  5FK9 C;  2LVO A;  4P16 A;  4YTN B;  4WIP A;  3BVM A;  5D3D A;  2XK5 B;  4HVB A;  3AE1 B;  3AE4 B;  3NVZ A;  1GOZ A;  4EOY A;  4D2K A;  3C19 A;  2YEP B;  3TSS A;  3NG0 A;  1SEB D;  1WJ6 A;  3M3J A;  1GNU A;  2IBI B;  4W9I A;  2KWU B;  2M19 A;  3W9C B;  4IWP A;  1XEE A;  2A5U A;  2SAK A;  2GRI A;  2MBO A;  4MH8 A;  3N1Y C;  1PGB A;  4KZC A;  4IKG A;  1D5X C;  2BBC A;  4M8M A;  1FD6 A;  3P4P B;  3BVZ A;  2WXR A;  5AZF A;  4HRO A;  3BYY B;  2N9L A;  3ZIM A;  2WQY B;  1ISN A;  2C7N B;  4E74 A;  2J53 A;  1GAQ B;  2KJ6 A;  3IG3 A;  4TUU A;  1T0Y A;  2K22 A;  3EFC A;  1J7A A;  4ANU A;  2D07 B;  2GBK A;  2MBQ A;  4E3C A;  2WLB A;  4ZHO A;  2BYV E;  1L2N A;  3V61 A;  5T8I A;  3AE8 B;  4HXD A;  4WAF A;  2W3S A;  1I4X A;  2WDT B;  3P2B A;  3TUO A;  2NS5 A;  3ZTD A;  3Q8A A;  5TR5 A;  5JH5 C;  1QF6 A;  5BYQ A;  2DZK A;  2ZW0 A;  2ZCB A;  3HM6 X;  4A20 A;  4XZ4 A;  2IO3 B;  4XGA B;  4LK0 M;  2D2Q A;  2HTH A;  4I6N B;  4XDC A;  2A4Z A;  4A3O A;  2LUE A;  3W2D A;  2WXP A;  4RNA A;  5G5G A;  1D5M C;  2QSD A;  3KYC D;  4AOF A;  2XK5 A;  1IP9 A;  2QJL A;  4RM8 A;  2QMT A;  3N32 A;  3N1X C;  3BII D;  2N7D A;  2L83 A;  2BYE A;  3Q3M C;  3P42 A;  4LNO A;  5CHV C;  2KDI A;  1HA5 A;  4DDG D;  3ZKJ C;  2IY0 B;  2W55 A;  2GBN A;  2FUG 1;  4LTU A;  2M17 A;  3BZD B;  4ZRJ A;  1YN4 A;  4YL8 A;  4IWQ A;  4MGZ E;  4NJ7 A;  1NI2 A;  3AEC B;  2KX0 A;  4P6V F;  2KFK B;  2BYF A;  2K1F A;  2WXJ A;  3SFD B;  3MP9 A;  2DZM A;  3A4S C;  4GMV A;  4W9K A;  2WYQ A;  4GSW A;  1DOX A;  2J0J A;  3OJ4 B;  2KWD A;  1EWY C;  3TEX A;  1M4V A;  3AED B;  2O6V B;  5D6J B;  1HTQ A;  1JWM D;  1VZ7 A;  3KLS X;  2CR5 A;  5IP4 D;  1T0Q C;  3I9V 1;  1N63 A;  2R2Q A;  3L0W B;  3VUY A;  1IUE A;  1IGC A;  4P1B C;  3I57 A;  4US8 A;  2V4I B;  2G1E A;  4LNK A;  3V6C B;  5D7G A;  3ZJT A;  1K8R B;  4RGT A;  1YJJ A;  3MTN B;  2BW2 A;  2BF8 B;  4USA A;  2LAS A;  4K1R B;  4C4V A;  2DYB A;  4MJS B;  1DYQ A;  2NPT A;  2V9H A;  2NMQ A;  3Q3N C;  3RUL A;  4HPP A;  2D3G A;  1OEY J;  2L1A A;  2JVC A;  1STE A;  1XLQ A;  2MEK A;  3U8Z A;  3R7R A;  3J9C A;  2ZW1 A;  4DXG A;  1QOG A;  3RNB C;  2FCM A;  4BKS D;  4TQ1 A;  1T3Q A;  4J3O D;  1V81 A;  1WGY A;  2BQQ A;  2N7E A;  3DBH I;  2OJW A;  2NR2 A;  2CS4 A;  3EFU A;  2JYT A;  2GLS A;  4RFB A;  1FNU A;  2GMI C;  5HFY A;  4AQ7 A;  1F0Z A;  3VUX A;  4ZYS A;  1UGM A;  4HPM B;  3R7Q A;  3EGR A;  1MHX A;  1R4N I;  1WH3 A;  2BT6 A;  4W9C A;  2CHZ A;  2HJ8 A;  5EDS A;  4NQL B;  4ZOH C;  1N61 A;  2E3T A;  2K8C A;  1DGJ A;  4GU2 A;  1VDV A;  5AZH A;  2KJR A;  3QAR A;  2H88 B;  2CHW A;  4B95 A;  3A4R A;  3V05 A;  2K5P A;  3PSE B;  3RN9 C;  1R4N B;  3T9L A;  2FCN A;  2CHX A;  1V5O A;  2Z8L A;  3GZN B;  2GBJ A;  3NVW A;  4DDI D;  1M94 A;  2LGS A;  3NS8 A;  2YVC A;  2PTL A;  1TKE A;  1C78 A;  2V3N A;  4M00 A;  1OEY A;  2D3B A;  4LDT B;  3QAQ A;  4GIV A;  4M0W A;  4WH4 A;  4MJS A;  1SXT A;  5AZG A;  4HKQ A;  3RNG C;  2BS2 B;  3MFG A;  3TL5 A;  2DAJ A;  3OAW A;  2LFI A;  4TQ0 A;  2YLM A;  3L08 A;  4K7S A;  3W1S A;  3VHT C;  3CWI A;  4XYC A;  3ZRC A;  5BMH A;  1ZP0 B;  3AEG B;  4GDK B;  2RDH A;  4JL9 A;  4NPN A;  3DBR I;  3VH4 B;  3DBR B;  2Z0D B;  2KQ7 A;  3DBH B;  1ESF A;  2JRI B;  1WRI A;  1HXY D;  4XX5 A;  1XD3 B;  5E6J A;  3AE2 B;  2IDY A;  2NVU I;  5BO4 B;  2JPH A;  4ZRP A;  2IY1 B;  3CF6 E;  2WDQ B;  1S3S G;  2Y5P A;  3KH0 A;  2K9X A;  3UF8 A;  3EHV A;  2ZZP B;  2KK8 A;  3RMK C;  2JSV X;  1GPX A;  4MEL A;  1ZW7 A;  1P0R A;  4A6Q A;  3APD A;  4DQO C;  5DPW A;  4TV3 A;  1XLN A;  1FIQ A;  2K39 A;  5BYS A;  2KZR A;  5J17 A;  3KYD D;  2LI5 A;  3WCQ A;  3KUD B;  2NBW B;  2AWT A;  2N9K A;  1Y56 A;  2QIL A;  2L76 A;  1LM8 B;  5DCN A;  4EEW A;  1YJ1 A;  2PVO D;  4KVG B;  1EU3 A;  1GC6 A;  1NI3 A;  2L05 A;  5HG2 A;  2BKR B;  4X57 B;  3JW0 X;  3RNF C;  1P7F A;  2CU1 A;  3DQV A;  3IT6 B;  1V5T A;  3ZDM C;  5JXV A;  3W1Y A;  1WXV A;  4HPL B;  1J7B A;  4GLS C;  3CMM B;  3WIM A;  2M8S A;  3AXC A;  1K51 A;  3N20 C;  3MHS D;  1BT0 A;  1H4R A;  1KTK A;  2KQS A;  1TY0 A;  2JWZ A;  4XWW A;  5GXG B;  2X38 A;  4C80 A;  3E9S A;  4A3P A;  1I35 A;  1WYG A;  4ZRQ A;  1TTN A;  3DHG C;  2QDF A;  3ZNZ B;  5H92 C;  1OQR A;  1PGX A;  1JRU A;  1E5W A;  1V1O A;  5HHD G;  4JLC A;  1WXS A;  2AL6 A;  2WU2 B;  4TKN A;  2FBW B;  3L16 A;  1JWB D;  1E7U A;  1Y8R C;  2KVR A;  1WMH B;  1YIW A;  2FIF A;  2KXJ A;  3E56 A;  3APF A;  4RF0 A;  1TKG A;  1UUP A;  4S0R A;  2RSU A;  4ARI A;  1EUV B;  3RUI B;  1I4P A;  3PHX B;  4KX6 B;  4FHK A;  2M0X A;  1WWT A;  4XWT A;  2K3U A;  4WWN A;  2I2Y A;  2GBR A;  4K81 A;  1SJE D;  1FNW A;  3DBL I;  2ZJD A;  1PFD A;  3ZXV A;  1V6E A;  2YEP F;  3ML8 A;  2ZEQ A;  4FLH A;  3H7S A;  1BXT A;  3C0R B;  1WJU A;  3AM9 A;  1UGJ A;  4HKZ E;  1R4M B;  3EEC A;  3WAO A;  1SE4 A;  4O1N A;  2BS3 B;  3P63 A;  2G4S A;  3W5V B;  2W82 A;  2ACZ B;  3M62 B;  3GE3 C;  3IBE A;  2PIA A;  4B6W A;  1ZKH A;  4BKT A;  3PO0 A;  2JT4 B;  2BB6 A;  3AE5 B;  2MX2 A;  1EM7 A;  3LXF A;  2UYZ B;  1K52 A;  2L00 B;  3ZNI D;  2RDG A;  1Q0W B;  2M56 B;  2X8X X;  4GXB A;  1WZ3 A;  1TS5 A;  1P1A A;  1A70 A;  5I4D A;  1L4Z B;  4II3 B;  3JSV A;  1T0R C;  3HK0 A;  2G45 B;  2NBV B;  3TJP A;  3ZUN A;  1BML C;  2GB1 A;  2KLC A;  1VD2 A;  1ZOY B;  1BUI C;  2KDE B;  2AEH A;  2L52 A;  2C7M B;  4FAD A;  4C7Y A;  1JWU D;  4RGM A;  1EWC A;  1A5R A;  3R2T A;  4FHJ A;  4KZ0 A;  1TS2 A;  3ZRF A;  1Q5W B;  2WDV B;  3RI7 C;  1V2Y A;  1PUT A;  3BVG A;  5JHA A;  3QJZ A;  5CHF A;  2BGF A;  3OWE B;  3ZDT A;  4RF1 A;  2KJH B;  2JXX A;  2L0F A;  2UWQ A;  4GB9 A;  4W9J A;  3ML9 A;  1E7V A;  1WFY A;  1EO6 A;  3V6E B;  4WUR A;  4MGI E;  4RGN A;  1I42 A;  5CX3 A;  4EKU A;  4AP4 C;  2WGS A;  5LXH A;  1NEK B;  3ZXR A;  3H7P A;  4C00 A;  2DHZ A;  3BK2 A;  2DLB A;  3DVG Y;  4BAX A;  3LB8 C;  1D4B A;  2KQ4 X;  3W5U B;  3KW5 B;  2RGF A;  1WY8 A;  3V60 A;  4ANV A;  3ZQ4 A;  1UF0 A;  1VCB A;  1AN8 A;  1R4M I;  2NCN A;  2LWP A;  2GBM A;  1QZE A;  4BKS A;  1XQQ A;  5FR3 A;  4B0M A;  4KDI C;  2GOW A;  2O2V A;  3DBL B;  3T3O A;  3PZ8 A;  1RFA A;  3PRP B;  4WQM A;  4MGY E;  3RYT A;  1TY2 A;  2HE7 A;  3VTU A;  1HTO A;  3T8M A;  2JRH A;  1WE6 A;  2KYW A;  2RPV A;  1ZGU B;  4MSM B;  3AEF B;  1J19 A;  1YN3 A;  1E8X A;  3V62 A;  3LDZ E;  3VXW A;  3PVL A;  1HE8 A;  4HLE A;  4ZYN A;  3AI5 A;  2PPH A;  1UD7 A;  1YQB A;  2XN9 C;  4HDO A;  2J52 A;  1UWM A;  4FUL A;  2VRR B;  3NHE B;  2BVC A;  3TEY A;  1I4R A;  2PKO A;  2JY6 A;  2LEK A;  3PZ7 A;  5D94 A;  1WI0 A;  2ZCC A;  2TSS A;  1YMH E;  3ZVV A;  4IM2 A;  5CHW A;  1ACC A;  3IVF A;  3NS1 A;  1I7H A;  2WXO A;  3HM3 A;  2LGD A;  3RT3 B;  5LLI A;  1TBE A;  2DWQ A;  2MCN B;  1V49 A;  3RNA C;  3SU8 X;  2KTR B;  3MC8 A;  1YN5 A;  2DYM A;  4GDL B;  3RNE C;  1E8W A;  1ZXI A;  3T3N A;  3QQ8 B;  4WWP A;  3S2A A;  1N5X A;  2PLP A;  1KF6 B;  1SB3 C;  2J0K A;  3IFW B;  2BPS A;  2N1V A;  1YQ4 B;  2E6X A;  2N7J A;  5FR6 A;  2AX5 A;  1WF9 A;  1E0Z A;  3CIR B;  2ZNV B;  3DHH C;  3R3M A;  4IUM B;  1AW7 A;  3LJ3 A;  2J42 A;  1DOI A;  2UU7 A;  4JX1 C;  3FKY A;  4OHJ A;  4K3C A;  3BK1 A;  4QAY A;  3B1L X;  2KWC A;  2MSE D;  2KN5 A;  4N6E B;  1WE7 A;  3RCZ A;  2ON8 A;  5IAA C;  3AE6 B;  3PTF C;  3VRB B;  1T0S C;  3U30 A;  1S1Q B;  2DZI A;  2N0S B;  1IBX B;  1YJI A;  1YOV B;  4EZJ A;  3AEA B;  4EFO A;  2KMA A;  4N58 A;  1ZDX A;  1L0Y B;  2FNJ B;  1XO3 A;  2LHD A;  3RZW C;  2ZVN A;  1J0G A;  1E8Z A;  1E10 A;  2DX5 B;  4XDD A;  4LJP B;  2EMS A;  4OZB A;  3R2I A;  2MH7 A;  3HRD D;  3PPA A;  3X23 A;  2CJN A;  2H89 B;  4HRS A;  3OG5 A;  2KFK A;  4WJP A;  1MJD A;  3MHZ A;  4WQO B;  2BYT A;  2KFJ A;  2K0P A;  4JWS C;  4F1S A;  1WXM A;  4RH6 A;  2GI9 A;  3P1M A;  2FID A;  4ICV A;  2IGD A;  5TSS A;  4K7U A;  1ZUD 2;  4TSS A;  4DXA B;  4MAC A;  2L3Z A;  3QIJ A;  5D2M B;  3PS6 A;  1XCQ L;  4KIK A;  1MFW A;  2M4N A;  3I3T B;  4JE3 B;  2INC C;  2O2V B;  4WAA A;  2QIE B;  2FUH B;  3P4R B;  4DHZ E;  3PRE A;  2MJ3 A;  4ASW C;  3ZJU A;  5KHQ A;  4BZA A;  4JGH B;  3SFE B;  4CQN A;  1NEN B;  3RNC C;  1D6E C;  2KHW B;  1V8C A;  1SSN A;  1VLB A;  1E90 A;  4G11 A;  5G2N A;  2L8J A;  3QK0 A;  1TGZ B;  3GE8 C;  4YTP B;  3IXS A;  1FPY A;  3DWG C;  4MDK E;  3ZJV A;  3ZNH B;  2M1M A;  4I6L B;  2J0M A;  2EMT A;  1C3T A;  3U4E G;  5J2R A;  3V3X A;  2ONQ A;  4LNN A;  2N9X A;  2KMC A;  4OZA A;  3H1U A;  2D5G A;  4LJO B;  3UIO B;  5EE1 A;  4P1C C;  3U52 E;  2LMC A;  1OQY A;  2IO0 B;  3QCA A;  4L2Y A;  4K7W A;  2AQ3 B;  2WX1 A;  5EE3 A;  4BKG A;  5CTR C;  2RMM A;  2CKH B;  1HZ5 A;  2N1W A;  4NJC A;  2R2O A;  1JML A;  2PE9 A;  3A9J A;  4DHJ D;  4PS3 A;  2ASQ A;  1KLV A;  4MT5 A;  3TEW A;  1ROE A;  2D11 A;  1WJ4 A;  2L32 A;  1V1P B;  3NUH B;  1JCK B;  3X0W A;  1UZX B;  1WGH A;  3HHM A;  1DOY A;  3ZW3 A;  1PDX A;  4N59 A;  4BFR A;  1JW9 D;  1NDD A;  2KTR A;  2MJE A;  5LNK 1;  4OVV A;  3GOE A;  1FCL A;  1HEZ E;  2KDM A;  1XCT L;  1V80 A;  1P98 A;  5IN7 A;  4KDL B;  5HKH A;  4BBN C;  1F2R I;  5DPT A;  2WX0 A;  2AYO B;  3TBL D;  1KFY B;  4FN2 A;  1FNV A;  1CJE A;  1JRO A;  4BOS C;  4REZ A;  4C56 C;  2KKC A;  2OED A;  3QX1 A;  4PK1 A;  1SE9 A;  4IWO A;  1AAR A;  1NYR A;  4FJV B;  3R66 C;  4IDI A;  4N9F 4;  4XC2 A;  1WSP A;  1ZXH A;  1QOF A;  3UQA A;  1E8Y A;  3FIL A;  3VTV A;  4NJ6 A;  4HWI B;  2JU6 X;  3AU5 A;  5LXI B;  5E6O A;  1L6U A;  2DNF A;  1C9F A;  5AEK B;  3PLV A;  5G55 A;  4K3B A;  3NJT A;  4JWU C;  5D3I B;  4GN1 A;  4ACF A;  4DWF A;  3ECI A;  2K8H A;  1T6B X;  2LXA A;  5C1Z A;  4JQW C;  3K9P B;  4HJG E;  1RWS A;  4L23 A;  2KNB A;  2KAC A;  2VZK D;  2D3C A;  1RYJ A;  1HZ6 A;  2BTE A;  3DOW A;  2V4L A;  2JYE A;  1OQQ A;  1I4H A;  2IPK D;  4B0E A;  3AE9 B;  2REX A;  3IAM 1;  4YWG G;  3VAW A;  1TS4 A;  3RFZ B;  1MI0 A;  2ZVO A;  5IOI A;  2MWS B;  3A9K A;  3VTW A;  3SD5 A;  2JF5 A;  3RZF A;  3VFK A;  3AV8 A;  2DYO A;  2JWU A;  3VR8 B;  1GJZ A;  3H7P B;  2LD9 A;  3KVF B;  1KLU D;  4C4V B;  2DEN B; 
#chains in the Genus database with same CATH homology
 3RYT A;  4BKS D;  4TQ1 A;  3H9D A;  4EUT A;  2HE7 A;  3VTU A;  4ZRK A;  2V1Y A;  3CSF A;  3T8M A;  2JRH A;  1X1M A;  2K8B A;  4M0W B;  1WE6 A;  2PJH A;  1V81 A;  3ENE A;  1WGY A;  1V9J A;  1ZGU B;  3NOB A;  1WYW B;  4MSM B;  4WJQ A;  2KWV B;  2N7E A;  2XEW A;  2N4F A;  4PYU A;  2LJ5 A;  1J19 A;  3DBH I;  3TCA A;  2NR2 A;  2CS4 A;  3EFU A;  4AUQ C;  4WWO A;  2K6Q A;  2FCS A;  4KV2 A;  1WR1 A;  2MP2 B;  1E8X A;  2GMI C;  3V62 A;  3LDZ E;  3VXW A;  3PVL A;  2KD0 A;  1HE8 A;  4IG7 B;  4MGK E;  3VUX A;  1P9D U;  1UGM A;  4HPM B;  3R7Q A;  4HLE A;  4HK2 A;  4ZYN A;  2N9E B;  3AI5 A;  3SHQ A;  2PPH A;  1R4N I;  1WH3 A;  1UD7 A;  1YQB A;  2DZJ A;  4HDO A;  4NAW A;  3UIP B;  2ZNV C;  4IC7 B;  2Z0E B;  4W9C A;  4FUL A;  4PS8 A;  2CHZ A;  1OTR B;  2HJ8 A;  2LXC A;  3ZNG C;  2VRR B;  5EDS A;  5JZE B;  3NHE B;  2LZ6 A;  3D32 A;  4NQL B;  4ANW A;  3DVN U;  2JY6 A;  5GMV A;  2K8C A;  4CYE A;  4GU2 A;  4BOZ B;  2G4D B;  5AZH A;  3CST A;  2KJR A;  5D94 A;  2BWE S;  3QAR A;  1WGG A;  4B9K A;  2CHW A;  1WI0 A;  3VQI A;  2ZCC A;  3Q3J A;  4RM9 A;  2G3Q B;  3ZVV A;  3A4R A;  4B95 A;  4G3X B;  3DVG X;  1Q1O A;  2LGX A;  3MJW A;  3PSE B;  4IM2 A;  4RMA A;  4FJY A;  5CHW A;  3OLM D;  3T9L A;  2MP2 A;  2FCN A;  2CHX A;  3U7D A;  4F8C B;  1V5O A;  2K6D B;  3IVF A;  4E71 A;  2L0T A;  2GBJ A;  3HM3 A;  2LGD A;  3RT3 B;  2C7H A;  2OJR A;  4DDI D;  1WIA A;  3L10 B;  1M94 A;  1TBE A;  5LLI A;  3EC8 A;  3NS8 A;  1WX8 A;  2YVC A;  4GDK A;  4II2 B;  2MCN B;  1V49 A;  2C60 A;  3JSV B;  4PS7 A;  1EF5 A;  2KTR B;  3SU8 X;  4HDQ A;  5DPS A;  3UGB B;  4URK A;  1WGR A;  3SDL C;  1OEY A;  4LDT B;  3PV1 A;  3OJ3 A;  2DYM A;  3QAQ A;  4GDL B;  4GIV A;  1EF1 A;  1YX6 B;  4KSK C;  4MJS A;  5AZG A;  1UBI A;  1E8W A;  4J6I A;  2QHO A;  3QQ8 B;  4WWP A;  3S2A A;  4GOC A;  4WJO A;  4IM3 A;  1CMX B;  3TL5 A;  4NY0 A;  4NQK E;  1YD8 U;  2DAJ A;  3OAW A;  1TZ1 A;  3H6N A;  1GG3 A;  4TQ0 A;  2YLM A;  3DVN V;  3L08 A;  3DPD A;  4K7S A;  3W1S A;  2J0K A;  3IFW B;  4F7Z A;  5KHO A;  2I1J A;  3VHT C;  3ZRC A;  3HIZ A;  4GDK B;  2BPS A;  2N1V A;  4HCN B;  2ZPN A;  4JL9 A;  4NPN A;  2RD0 A;  3DBR I;  4PYZ A;  5FR6 A;  1LXD A;  3VH4 B;  3IHP C;  1WF9 A;  2WWZ A;  3UIN B;  1P3Q U;  1WM3 A;  2ZNV B;  4BBN F;  3VDZ A;  2Z0D B;  1SGH A;  2EKE C;  2KQ7 A;  3DBS A;  3R3M A;  4IUM B;  4JIO U;  3LJ3 A;  3K9O B;  3ZO5 B;  2JRI B;  5J18 A;  4BVU C;  4XX5 A;  1XD3 B;  4MM3 A;  2MA9 B;  2NVU I;  1NBF C;  5BO4 B;  2JPH A;  2IY1 B;  3CF6 E;  3ZLZ A;  2O6V A;  3DDC B;  3WAL A;  1S3S G;  3NY5 A;  1LFD A;  3KH0 A;  5JHB A;  4DHJ B;  3UF8 A;  1KOT A;  3B1L X;  4MEM A;  3EHV A;  3PT2 B;  2KWC A;  2ZZP B;  2KK8 A;  2MSE D;  2KN5 A;  2IYD B;  1WE7 A;  1RAX A;  3RCZ A;  4W9D A;  4NAW B;  5IAA C;  3PTF C;  3VVW B;  4G50 A;  2V3S A;  3PZD A;  2LGY A;  4MEL A;  1ZW7 A;  3PGE A;  3NZS A;  1P0R A;  3U30 A;  1WGD A;  4G0N B;  1KJT A;  2OOB B;  3RD2 A;  3APD A;  1S1Q B;  4HJK A;  2DZI A;  5DPW A;  4TV3 A;  2N9P C;  1Z5S B;  1XT9 B;  5L83 A;  4EZJ A;  4EFO A;  2K39 A;  2KC1 A;  2KMA A;  2KZR A;  5J17 A;  3KYD D;  4W9F A;  2LI5 A;  4NNJ B;  2FNJ B;  3Q3F A;  1IYF A;  3KUD B;  4MSQ B;  3RZW C;  2ZVN A;  5C23 A;  1J0G A;  1E8Z A;  1GC7 A;  2NBW B;  2AWT A;  2HD5 B;  2DX5 B;  1RRB A;  2FAZ A;  2L76 A;  1LM8 B;  2KC2 A;  4LJP B;  4KSL C;  2EMS A;  5DCN A;  4P7I A;  2C5L C;  3JYU A;  4ICU A;  3PPA A;  3X23 A;  4I6P A;  4EEW A;  3VUW A;  2MQJ A;  2KFK A;  3L17 A;  1YJ1 A;  4WJP A;  1PQS A;  2JZZ A;  4WQO B;  4KVG B;  1GC6 A;  3KUZ A;  2KFJ A;  2L05 A;  4W9G A;  3VH3 B;  2BKR B;  4X57 B;  4FBJ B;  3JW0 X;  1MG8 A;  2MRP A;  4FJZ A;  2MBH A;  3WA0 A;  1WJN A;  5DPR A;  2CU1 A;  4F1S A;  1WXM A;  3A9K B;  3DQV A;  1UBQ A;  1V5T A;  3ZDM C;  3W1Y A;  2FID A;  1WXV A;  4IW0 A;  4ICV A;  2FCQ A;  4HPL B;  2KO3 A;  3BY4 B;  4K7U A;  3CMM B;  4LCD E;  1F9J A;  3WIM A;  2M8S A;  2L7R A;  4DXA B;  2L3Z A;  5L95 C;  3AXC A;  3QIJ A;  5D2M B;  3PS6 A;  3B0A A;  3MHS D;  1WXA A;  4ANX A;  1BT0 A;  1H4R A;  4KIK A;  2M4N A;  2D10 A;  2KX3 A;  2RR9 A;  2KQS A;  3I3T B;  3APC A;  3QWZ B;  2O2V B;  2MLB A;  2PE6 B;  4WAA A;  3A9J B;  3NZU A;  2JWZ A;  2NPT B;  1RLF A;  2O6V D;  2LVO A;  1UEL A;  2FUH B;  2KTF A;  2XK5 B;  4DHZ E;  4A3P A;  4HVB A;  1I35 A;  1U4A A;  3PRE A;  1TTN A;  4EOY A;  3ZNZ B;  1JRU A;  5E6P A;  4ASW C;  1E5W A;  5KHQ A;  4JGH B;  4GDL A;  1WJ6 A;  4JLC A;  3M3J A;  1GNU A;  1WX9 A;  2IBI B;  2KWU B;  4W9I A;  1WXS A;  2AL6 A;  2KHW B;  4OVU A;  4TKN A;  3A1Q A;  4IWP A;  2A5U A;  1E90 A;  4G11 A;  2MBO A;  1YX5 B;  5G2N A;  3ONS A;  2L8J A;  3L16 A;  2BKF A;  3QK0 A;  1TGZ B;  1E7U A;  4KZC A;  1Y8R C;  3M95 A;  2KVR A;  1WMH B;  4M8M A;  4WJN A;  2PEA A;  1YIW A;  2FIF A;  2B3A A;  2KXJ A;  1WRD B;  4MDK E;  5AZF A;  4W9E A;  4E74 A;  3ZIM A;  3ZNH B;  1ISN A;  2C7N B;  3APF A;  2M1M A;  2MBB B;  4I6L B;  2J0M A;  2EMT A;  1C3T A;  3W1S C;  3AUL A;  5J2R A;  2RSU A;  2KJ6 A;  1EUV B;  3RUI B;  3IG3 A;  4ZRI A;  4TUU A;  1LQB A;  1T0Y A;  3QA8 A;  4ANU A;  2N9X A;  3PHX B;  2D07 B;  2GBK A;  2MBQ A;  2KMC A;  2Z59 B;  4FHK A;  1V86 A;  2IO1 B;  2M0X A;  4E3C A;  3JVZ X;  3H1U A;  5E6N A;  2BYV E;  4LJO B;  3ALB A;  1L2N A;  3TIX A;  4WWN A;  3UIO B;  2GBR A;  1UH6 A;  4K81 A;  3V61 A;  1OQY A;  2IO0 B;  3QCA A;  4HXD A;  4K7W A;  2WX1 A;  4BKG A;  2JUO A;  2LRU A;  2ZJD A;  3DBL I;  5CTR C;  2CKH B;  1V6E A;  3ML8 A;  2WDT B;  2ZEQ A;  3P2B A;  4FLH A;  2NS5 A;  2N1W A;  3H7S A;  3TMP B;  2IZV B;  2R2O A;  2W9N A;  2KDF B;  3N30 A;  3ZTD A;  2AL3 A;  5TR5 A;  2PE9 A;  5JH5 C;  3A9J A;  4GGQ A;  3C0R B;  2DZK A;  4DHJ D;  4AJY B;  1WJU A;  2ZCB A;  4PS3 A;  3HM6 X;  4A20 A;  4CO7 A;  2ASQ A;  4XZ4 A;  1G6J A;  2IO3 B;  1FXT B;  4AWJ A;  3KUC B;  1KLV A;  3EEC A;  3WAO A;  2KDB A;  2D11 A;  1WJ4 A;  2D2Q A;  2HTH A;  4I6N B;  1GUA B;  2G4S A;  2A4Z A;  4A3O A;  2LUE A;  3X0W A;  1UZX B;  1WGH A;  3HHM A;  3M62 B;  2IO2 B;  3L54 A;  2J7Q B;  3IBE A;  3ZW3 A;  3KYC D;  4AOF A;  2XK5 A;  1IP9 A;  4LDT D;  4B6W A;  1ZKH A;  4RM8 A;  3GZN I;  3AU4 A;  4BKT A;  4BFR A;  1NDD A;  4W9H A;  2JT4 B;  3N32 A;  2MX2 A;  1L7Y A;  4EZK A;  2KTR A;  4OVV A;  3GOE A;  4AJW A;  2UYZ B;  4DHZ B;  3A33 B;  2L00 B;  3ZNI D;  4FA6 A;  2N7D A;  4DK5 A;  1IPG A;  1Q0W B;  1V80 A;  1P98 A;  2BYE A;  4KDL B;  5HKH A;  4BBN C;  4GXB A;  3N3K B;  1WZ3 A;  5DPT A;  2WX0 A;  1OGW A;  3L13 A;  3O65 B;  1P1A A;  5CHV C;  4EZL A;  2KDI A;  4W9L A;  2AYO B;  3TBL D;  4DDG D;  4FN2 A;  4II3 B;  2LVQ A;  3ZKJ C;  2Y5B B;  2ZPY A;  2IY0 B;  3JSV A;  3UQB A;  3PHW B;  2GBN A;  4BOS C;  3HK0 A;  2M17 A;  2KKC A;  3QX1 A;  2G45 B;  2NBV B;  1SE9 A;  4IWO A;  4ZRJ A;  3TJP A;  3ZUN A;  1AAR A;  4YL8 A;  4IWQ A;  4MGZ E;  4M8N A;  4NJ7 A;  1NI2 A;  2KLC A;  4MH0 E;  2KX0 A;  1VD2 A;  4FJV B;  3R66 C;  4N9F 4;  2KFK B;  4XC2 A;  2KDE B;  2AEH A;  2BYF A;  2C7M B;  2K1F A;  1E8Y A;  4FAD A;  3VTV A;  3UQA A;  4NJ6 A;  4HWI B;  2DZM A;  1A5R A;  3A4S C;  2RPQ A;  3AU5 A;  4HCP B;  5LXI B;  3BIN A;  3M63 B;  2LVP A;  4FHJ A;  3PRZ A;  4GMV A;  4KZ0 A;  5E6O A;  3ZRF A;  1WMH A;  1Z2M A;  4W9K A;  1Q5W B;  2WYQ A;  3PLV A;  5G55 A;  1V2Y A;  4GSW A;  3PRM B;  5AEK B;  2J0J A;  3OJ4 B;  5JHA A;  3QJZ A;  4GN1 A;  5CHF A;  1WM2 A;  2BGF A;  4ZDV A;  4DBG A;  3A1Q B;  3ZDT A;  5D6J B;  2K25 A;  2O6V B;  2KJH B;  2I1K A;  4DWF A;  4CHK A;  2MBE A;  2JXX A;  2L0F A;  2UWQ A;  3ECI A;  4GB9 A;  2K8H A;  4W9J A;  2CR5 A;  2KAN A;  3ML9 A;  2LXA A;  5C1Z A;  4JQW C;  3K9P B;  1E7V A;  1WFY A;  1EO6 A;  3ZTC A;  3V6E B;  2KNB A;  4MGI E;  1I42 A;  5CX3 A;  3WAM A;  4EKU A;  4AP4 C;  2LRW A;  5LXH A;  3H7P A;  2DHZ A;  2R2Q A;  3DVG Y;  3L0W B;  3VUY A;  3DOW A;  3B08 A;  2V4L A;  5IA7 A;  1H8C A;  1KM7 A;  1WX7 A;  3KW5 B;  3V6C B;  5D7G A;  2RGF A;  2XBB C;  1WY8 A;  3V60 A;  1WZ0 A;  1K8R B;  4ANV A;  2DAF A;  1VCB A;  3MTN B;  1R4M I;  2NCN A;  2LWP A;  2BF8 B;  2REX A;  2LAS A;  2GBM A;  4K1R B;  1C1Y B;  1J8C A;  1QZE A;  3VAW A;  3WAN A;  4BKS A;  2KOX A;  2NBU A;  4MGY E;  2DYB A;  4MJS B;  1D3Z A;  1XQQ A;  2BWF A;  2MW5 A;  2ZVO A;  2MWS B;  2NPT A;  3A9K A;  4KDI C;  3VTW A;  3SD5 A;  2GOW A;  2C9W B;  2O2V A;  3QC8 B;  2JF5 A;  3RUL A;  3RZF A;  3QHT A;  3PLU A;  3VFK A;  2D3G A;  1OEY J;  2DYO A;  4KIK B;  2JVC A;  4IM0 A;  1GJZ A;  1SIF A;  3DCG A;  2LD9 A;  3H7P B;  3R7R A;  3U8Z A;  3WAP A;  1RFA A;  2JZ3 B;  3KVF B;  1WR6 E;  2KLG A;  3PRP B;  2FCM A;  2DEN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...