3QC8B

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
EPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qc8B00
1KM7A 1T0YA 2KMCA 1EUVB 3BY4B 4KIKA 4NQKE 1M94A 4JIOU 4AUQC 2PPHA 3QCAA 4W9DA 5KHOA 2KZRA 1WR1A 2GMIC 3DVNV 4ANUA 2O2VA 4ZDVA 3KH0A 2K8CA 2N7EA 2BYEA 2ZPNA 2PJHA 3DCGA 1OQYA 2PE9A 3KUCB 4MSMB 4OVVA 4XZ4A 4W9GA 2CHWA 3H7PB 4KSLC 2MBBB 2KC2A 4OVUA 2MBEA 2K8HA 2NPTB 5LXIB 1Q0WB 2WWZA 4GU2A 3DQVA 2J0MA 3Q3FA 2KK8A 4FLHA 3B0AA 5G55A 1LFDA 3PS6A 2N9PC 2GBKA 3TIXA 3H9DA 2C7MB 2I1KA 3EFUA 4HK2A 5AZGA 2LASA 3JSVB 3M95A 4FN2A 5DPTA 4MELA 1H4RA 3KUZA 3U7DA 5CHVC 3M3JA 3APCA 2BWFA 2IO3B 1WJNA 2MCNB 3BINA 4XX5A 1E7UA 2LXAA 1V9JA 3VDZA 1LM8B 2FNJB 1R4NI 2N7DA 2ZNVB 4II2B 2MP2A 4DDID 1G6JA 2B3AA 3MJWA 3N30A 2G3QB 1XQQA 4B6WA 2BPSA 3O65B 2N9EB 2DZIA 4ANVA 2NPTA 3OJ3A 2KDFB 1TZ1A 4BFRA 2KLCA 4M0WB 1Z2MA 2ZVOA 2LRUA 3HIZA 3PHWB 3R66C 4GDKA 4WQOB 1J8CA 4ANWA 1CMXB 2HD5B 4GOCA 1V2YA 4HPLB 1S1QB 2GBRA 2KKCA 2KANA 2L0FA 1AARA 3PLUA 3SD5A 1Y8RC 2JRHA 4TQ0A 2RSUA 4BOZB 3VUYA 4EZJA 3A4RA 3M63B 2KDEB 3PVLA 1C3TA 1ZKHA 4RM9A 3WA0A 4B9KA 2MBOA 3JVZX 4ZYNA 3V60A 3L17A 4X57B 4MSQB 2K6DB 3JW0X 2KN5A 3ENEA 2JT4B 2RD0A 2KTRA 4HLEA 4JLCA 3R7QA 3TCAA 4BKGA 2XK5A 4HDQA 3RCZA 3PRZA 3PZDA 2LRWA 1P1AA 2D11A 3DVNU 1SIFA 4TKNA 2D10A 3PPAA 2KQ7A 5LXHA 1GUAB 2FAZA 3TMPB 3QJZA 2GBNA 1WY8A 3CF6E 3AU5A 3AU4A 3NY5A 3Q3JA 2O2VB 2DHZA 3R7RA 1WF9A 4IWQA 4W9JA 3TJPA 5E6OA 3GOEA 3V62A 2LI5A 1E8WA 3UIOB 4MGYE 4B95A 1JRUA 1WX8A 2IZVB 3ZNGC 2ZNVC 2DAJA 2HE7A 4P7IA 1TTNA 3ZTCA 4ICVA 4GB9A 3NZUA 3QQ8B 1WH3A 1V80A 4PS8A 4W9LA 5JHAA 4WAAA 5D7GA 3RUIB 1WZ0A 3DPDA 3RULA 1A5RA 4WWNA 4ZRJA 3R3MA 2L0TA 4G11A 4DWFA 3HHMA 2V1YA 4GDKB 4GSWA 2NVUI 1I35A 2FCMA 4BOSC 5L95C 2L8JA 4WJQA 4PS7A 2C5LC 1S3SG 4ICUA 4DHJD 2KDIA 3PTFC 2Z59B 2K8BA 4PS3A 1YX5B 2KWUB 3C0RB 4ZRIA 3PRMB 1H8CA 4GDLA 3NOBA 4G0NB 4MH0E 4JGHB 1ISNA 2NCNA 4LJOB 3NZSA 2DYOA 2GBMA 3RZWC 2DYBA 2MBHA 2CU1A 3S2AA 4DK5A 3SU8X 1U4AA 2LD9A 2ZEQA 3RT3B 3LJ3A 2LWPA 3KW5B 3ZW3A 4DBGA 1UBQA 1KOTA 2LVQA 1XD3B 1MG8A 2IY0B 4FJVB 2DENB 1J19A 3P2BA 1SE9A 3V6EB 3HM6X 4KDIC 1Z5SB 2I1JA 3QC8B 4EZKA 2RGFA 3NHEB 4HXDA 3VUWA 5E6PA 2R2QA 4MDKE 2M4NA 2KMAA 4W9FA 2OOBB 4NAWA 3WAPA 5JHBA 2XBBC 4MEMA 1UD7A 4BKSA 2LGYA 4J6IA 2A4ZA 4EUTA 3H1UA 2L3ZA 3ZKJC 2DAFA 2XEWA 1WIAA 1RFAA 2L00B 3N3KB 3PHXB 2MQJA 2MWSB 4CYEA 1WJUA 4IUMB 5J18A 4HCPB 1WYWB 2BYFA 1I42A 2IBIB 3H7SA 3TL5A 1E8YA 2ASQA 2Y5BB 1WI0A 3APFA 3WAOA 1V86A 1NDDA 4KIKB 2NR2A 4LCDE 3JSVA 3A9JA 1WZ3A 1OEYJ 3VUXA 2KHWB 2WX0A 1GC6A 1IP9A 1UH6A 1WX9A 3AXCA 4AWJA 4DHZE 1PQSA 4GMVA 4NQLB 1WJ6A 3IG3A 2JZZA 2K6QA 3QX1A 1YD8U 4MM3A 4NNJB 4E71A 1WGHA 2DZMA 1ZGUB 2RR9A 1WGYA 3B1LX 3PLVA 2KFJA 2K39A 5CHWA 2KTRB 4KV2A 2Z0EB 4BBNF 5D6JB 3MHSD 2KLGA 2O6VD 4FJYA 3EHVA 1P0RA 2M17A 4FA6A 2J7QB 2M1MA 3L16A 2R2OA 2DYMA 4EZLA 1QZEA 2C7HA 2O6VB 3K9PB 1OEYA 4I6PA 3VQIA 1X1MA 2KQSA 2UYZB 3PGEA 2C60A 2DZKA 1UZXB 1IPGA 3ZO5B 4BKTA 3A1QA 5EDSA 1KLVA 1UELA 3I3TB 2JRIB 4KDLB 1WFYA 2UWQA 3QIJA 5TR5A 2WYQA 2KOXA 2ZCCA 2XK5B 1C1YB 4HDOA 1XT9B 5AZFA 1UBIA 2NBWB 3JYUA 4NPNA 5D2MB 3SDLC 1ZW7A 1WGGA 4IM0A 4WWPA 5JZEB 4LDTB 2KJ6A 1L7YA 2BYVE 2MSED 1YJ1A 4IWOA 1TGZB 4TUUA 1RLFA 2EMTA 3UQAA 3CSTA 2KWVB 5DPWA 3H6NA 2G4SA 2PE6B 2AL3A 3ZNZB 4ANXA 4I6LB 4WJOA 2JF5A 4KVGB 3VFKA 2L7RA 2YVCA 2G4DB 2N9XA 4HJKA 3AI5A 3KYDD 4JL9A 4NJ7A 4I6NB 2D2QA 2K1FA 3L0WB 1L2NA 1V5OA 2CHXA 2BKRB 1VCBA 3WAMA 2ZVNA 2EMSA 5D94A 4AP4C 4M8NA 4BKSD 2GOWA 3DDCB 3DVGY 3PRPB 4IC7B 4IW0A 4BBNC 4DHZB 2J0JA 5AEKB 4A3PA 2AL6A 1J0GA 1V6EA 2KFKA 3ONSA 2BWES 2QHOA 3L13A 2K25A 4F8CB 2BF8B 2ZCBA 3DOWA 3PSEB 2IYDB 4HPMB 3NS8A 3VXWA 4E74A 3SHQA 3X0WA 2A5UA 4FHJA 1YX6B 1WGDA 1WXVA 3HM3A 5JH5C 3QWZB 4FHKA 3GZNI 3VAWA 4GDLB 4KZCA 4N9F4 1OTRB 2LVPA 1E5WA 3IHPC 4JQWC 1V5TA 4K81A 5J17A 1E90A 3V61A 2D3GA 4ASWC 4RMAA 1V49A 1WM2A 2KJRA 3U8ZA 2MX2A 4CHKA 2PEAA 5C23A 5BO4B 3W1SA 3UGBB 2MLBA 4IM3A 4IG7B 2FIDA 3D32A 4EOYA 4ZRKA 3UF8A 4W9EA 4YL8A 2REXA 4AOFA 2L76A 4K7UA 5J2RA 1NI2A 5G2NA 5CHFA 1SGHA 3VHTC 2KC1A 1EO6A 2LXCA 3RYTA 4E3CA 3N32A 3DBSA 4IM2A 5FR6A 4FBJB 3DVGX 1TBEA 2LJ5A 3ZTDA 5HKHA 2LGXA 4TQ1A 1YIWA 4W9HA 1NBFC 2JWZA 2MW5A 3DBLI 4MGZE 3AULA 4MJSA 2IO0B 3A9JB 2NBVB 1Q5WB 3ZRFA 2FCQA 3PREA 2FIFA 2M8SA 3PV1A 2NBUA 4MJSB 1GC7A 2KFKB 2KNBA 3ML9A 2LUEA 3V6CB 3T9LA 3OAWA 2JZ3B 4WWOA 1R4MI 3QHTA 4W9IA 3VH4B 3VVWB 3WANA 4F1SA 2V4LA 4FULA 5C1ZA 3T8MA 3DBRI 5CX3A 1E8XA 5LLIA 3H7PA 1WE7A 4DHJB 2KVRA 3RD2A 4TV3A 3QAQA 2KWCA 1GG3A 4FADA 1WM3A 2AWTA 1EF1A 2LVOA 3OLMD 2ZZPB 4IWPA 3L10B 4RM8A 5GMVA 2C9WB 1LQBA 2DX5B 4GN1A 2AEHA 4LJPB 2KX0A 1E8ZA 4K7WA 3IVFA 3ZIMA 4CO7A 3ZUNA 4AJYB 2IY1B 4NJ6A 2N1VA 2KDBA 2C7NB 2KX3A 1D3ZA 3B08A 3PT2B 1HE8A 2KTFA 3ZNHB 5DCNA 3QK0A 2FUHB 3UIPB 2JVCA 5CTRC 4XC2A 4BVUC 5L83A 3ZVVA 1WXMA 2DZJA 3A9KB 4PYZA 2JXXA 1WXAA 2LGDA 3L08A 2GBJA 4NAWB 4HCNB 1EF5A 2FCSA 3UINB 3WALA 2G45B 4WJNA 3A9KA 3U30A 4MGIE 1KJTA 3A1QB 1E7VA 2W9NA 4GGQA 3ZDMC 3IFWB 2HJ8A 1WE6A 2HTHA 4AJWA 5KHQA 1V81A 3APDA 3UQBA 1F9JA 2WDTB 2J0KA 2MP2B 2N4FA 4II3B 2NS5A 4KZ0A 4HVBA 3KUDB 2YLMA 3M62B 1WMHA 4DXAB 4GIVA 3DBHI 4G3XB 4HWIB 3EC8A 4FJZA 1GJZA 1LXDA 3CSFA 3IBEA 1GNUA 4F7ZA 1WMHB 3W1YA 3ZNID 4NY0A 2L05A 3A4SC 3ALBA 3KVFB 3ECIA 3OJ4B 4LDTD 4EFOA 1RAXA 2CR5A 3ZDTA 1OGWA 4W9KA 5E6NA 3HK0A 2AYOB 3L54A 1WR6E 3ZLZA 2RPQA 3ZRCA 2KXJA 2JUOA 2KO3A 4EKUA 1K8RB 5DPSA 1VD2A 3VTVA 2D07B 2BGFA 2KJHB 2ZJDA 2KD0A 1WRDB 2IO1B 1YQBA 3W1SC 3QARA 4W9CA 3VH3B 2IO2B 2MBQA 2EKEC 3LDZE 2CKHB 3MTNB 4DDGD 4WJPA 4A20A 2O6VA 3QA8A 4URKA 1IYFA 2JPHA 3K9OB 1WGRA 1BT0A 1P9DU 4G50A 1Q1OA 2Z0DB 2FCNA 2BKFA 1FXTB 5AZHA 4M8MA 2WX1A 1WXSA 2V3SA 2MA9B 4KSKC 4PYUA 2JY6A 2N1WA 5DPRA 1WX7A 2LZ6A 3VTUA 1P98A 3X23A 4EEWA 3WIMA 1RRBA 2M0XA 4MGKE 3VTWA 3CMMB 4A3OA 4K7SA 5IA7A 1P3QU 3A33B 2MRPA 5IAAC 3ML8A 2ZPYA 3RZFA 2CS4A 4GXBA 2OJRA 1UGMA 3TBLD 3KYCD 3EECA 2VRRB 4K1RB 2CHZA 1WJ4A
chains in the Genus database with same CATH superfamily
2KMCA 3U2SC 3V05A 3BY4B 1C79A 1N5XA 4LLGM 2PPHA 1KLUD 4W9DA 2GMIC 4OW0A 1PDXA 2PE9A 2K9XA 2K8HA 2MJDA 3TSSA 3DQVA 2J0MA 4FLHA 3TIXA 3U7ZA 4HK2A 5AZGA 2J4XA 4MELA 3BYTB 3M3JA 2OEDA 4M02A 2INDC 2JSVX 2LXAA 1V9JA 2K22A 3B2FA 4HKQA 1LM8B 2N7DA 2SAKA 2JZPA 2H88B 2G3QB 2KN4A 4B6WA 2BPSA 3O65B 4PT5A 3VRBB 2KDFB 1JROA 5FK9C 5HHDG 4BFRA 1Z2MA 1J8CA 4RCOA 4ANWA 1N62A 4C7YA 2RDHA 1S1QB 5IKCM 2GBRA 2LJIA 2L0FA 4IDIA 3PLUA 2JRHA 3PVLA 1C3TA 1ZKHA 4RM9A 4ZRPA 3WA0A 2MBOA 3DWGC 4MSQB 2K6DB 4HLEA 3BVZA 3R7QA 2XK5A 1RYJA 2MEKA 1NI3A 2BB6A 3DVNU 1EWCA 2D10A 3MC9A 4P16A 3HVZA 1CJEA 2L52A 3AU4A 4LNKA 3CWIA 1D5XC 2LI5A 2WXJA 3UIOB 3N20C 1TZOA 4B95A 1JRUA 2IZVB 3TUOA 2BS3B 2HE7A 3SEBA 1FCLA 3ZTCA 3ZGZA 1TT5B 4ICVA 4GB9A 3QQ8B 3MC8A 3SFEB 5JHAA 4WAAA 3RUIB 3DPDA 2V1YA 4C4VA 1I4RA 4BOSC 1I4QA 2L8JA 4WJQA 2C5LC 1S3SG 4DHJD 2K8BA 4EE2A 3PRMB 3NOBA 4JGHB 1ISNA 5IP4D 2DYBA 2CU1A 1TKGA 1U4AA 2LWPA 2PVGC 1KOTA 2PMVA 1MG8A 2IY0B 3ETRA 3P2BA 1J19A 4JWSC 4EZKA 5E6PA 4MDKE 2IJ0A 2KMAA 4W9FA 5JHBA 2PLPA 2XBBC 4MEMA 3H1UA 3ZKJC 3GS2A 1E7PB 1RFAA 1XLQA 3T3NA 2KVZA 4IUMB 5J18A 1WYWB 1I42A 4YXDB 5JXVA 2Y5BB 1V86A 4LTUA 4B0MA 3NVZA 3AEBB 2M56B 1IP9A 3MJ5A 3AE8B 5EE0A 3BIID 2DZMA 3N1ZC 1J7BA 1ZGUB 2D3AA 1WGYA 2KFJA 1V1PB 4KV2A 5D6JB 4US8A 1T0SC 2INCC 1SIJA 4FA6A 2X8XX 2DYMA 5EE3A 1KFYB 2UYZB 1C4PA 1ZUD2 4KDLB 3QIJA 2KWDA 2LHEA 2WYQA 4L23A 4HDOA 1L4DB 2OHFA 4NPNA 5D2MB 2WXLA 2XNAC 2PTLA 4WWPA 5JZEB 1L7YA 1YJ1A 2Y5PA 3OWEB 1RLFA 2EMTA 3RNEC 2KQ4X 1PFDA 4BAXA 2G4SA 3ZNZB 1C4AA 3P4SB 1C4CA 4I6LB 2JF5A 3GE8C 4KVGB 2WDQB 5EE9A 2YVCA 2G4DB 4HJKA 1SJHD 3AI5A 3PO0A 4ZHOA 4MT5A 2D2QA 2K1FA 3BWUD 2ZVNA 4AP4C 4M8NA 1E0ZA 4BBNC 4TSSA 3IT4B 1J0GA 2KFKA 2QHOA 2ZCBA 3PSEB 5IOIA 3GZNB 2K0PA 1ACCA 3X0WA 1YX6B 5EE1A 3GZNI 1E90A 2W54A 2D3GA 1WM2A 2MX2A 2MLBA 4JX1C 2WDVB 4P1CC 1JW9D 2QC8A 2KC1A 1EO6A 1L4ZB 1MFWA 4IM2A 4YT0B 1TBEA 5HKHA 4TQ1A 2WQYB 2MW5A 3DBLI 4R3DA 1I4XA 2NBVB 1ZXHA 2FIFA 3DBLB 1JQ4A 1XO3A 2LUEA 1E10A 3OAWA 1D5MC 3VH4B 3QHTA 2MJEA 1T0QC 2V4IB 4ZHPA 5LLIA 3V3XA 3B2GA 4TV3A 1GG3A 2KWCA 1WM3A 4IWPA 3L10B 4WH4A 5E6JA 3Q69A 5FR3A 4HKZE 3ZIMA 1FXIA 3ZUNA 1SF0A 4C00A 4XDDA 2N1VA 4IOIE 2C7NB 2KX3A 3PT2B 1ENFA 1HE8A 2KTFA 1T6BX 5DCNA 1ZOYB 3UIPB 2DZJA 4WAFA 4NAWB 4HCNB 3UINB 4L1BA 3WALA 4WURA 2L1AA 4WJNA 3U30A 4MGIE 3DHHC 1KJTA 1E7VA 2W9NA 3IAM1 1NENB 1WE6A 5GXGB 4D2KA 1KH0A 3TEZA 3Q3NC 5FKAC 3EC8A 4FJZA 1HA5A 4LDTD 3NVYA 3FAHA 4UDUC 3ZLZA 2RPQA 3ZRCA 2JUOA 4XE0A 2WU2B 5DPSA 3VTVA 2KJHB 2B76B 2JU6X 3DBRB 3NVVA 1BMLC 3AN1A 1TS2A 4ZYSA 3LB8C 2DWQA 3IAS1 3H8HA 1ZPSA 4L2YA 4A20A 3QA8A 3URYA 1WGRA 1BT0A 4YTPB 1P9DU 1Q1OA 2ZW0A 1FXTB 2ZW1A 5AZHA 2WX1A 1WXSA 3HRDD 4KKJA 3AEGB 4MGKE 1TKYA 1GB4A 1VRAB 4US9A 5IA7A 4GXBA 3IT6B 1UGMA 3SFDB 3EECA 4ZRQA 4CO7A 1EUVB 4P1BC 4KIKA 3SR6A 4JIOU 2KZRA 2V3PA 4ANUA 1JWSD 1P7EA 2K8CA 2BYEA 3AE7B 1OQYA 4MSMB 3KUCB 4W9GA 3H7PB 4KSLC 4MM3B 2NPTB 3NUHB 3BYYB 1HXYD 2IGDA 3Q3FA 3B0AA 2IDYA 3H9DA 3EFUA 5IO9A 3M95A 4YTNB 5DPTA 1H4RA 5CHVC 3APCA 1WJNA 3BINA 1L0XB 3VDZA 4XWWA 1R4NI 2G1EA 4RGMA 1F0ZA 4DXGA 1RFKA 4ANVA 3OJ3A 2J42A 2EELA 3VR8B 1FRDA 4WQOB 2QILA 4GDKA 4RF0A 2HD5B 1V2YA 1LO5D 1GPXA 1QILA 1LGRA 1AARA 4LK0M 1EU3A 2RSUA 5AUKA 4TQ0A 3HUIA 3V60A 4ZYNA 3L17A 4WIPA 2BBCA 3AE6B 2KN5A 4N59A 2JT4B 3TCAA 5C3JB 2INPE 3PRZA 5LNK1 2RDGA 1DGJA 4M01A 3QJZA 3AU5A 3Q3JA 4IWQA 3V62A 1E8WA 1TTNA 2I2YA 4RNAA 2Y3AA 3RULA 1A5RA 1HEZE 4WWNA 4ZRJA 3HHMA 4A6QA 1I35A 2FCMA 1FXAA 1YN3A 1NEKB 4ICUA 3R2TA 1JWMD 1YX5B 1B1ZA 3EUB2 1AYFA 5H8YE 2DYOA 3Q8EA 3ZW3A 3KW5B 1UBQA 1DYQA 5AUIA 2DENB 3V6EB 3HM6X 3QC8B 1K53A 3EFCA 2M4NA 1GAQB 3WAPA 3B9JA 1VZ6A 3P63A 2UU7A 2A4ZA 1OQRA 2IGHA 4JWUC 1ZDVA 1HZ5A 2XEWA 2WXNA 1WSPA 4YWGG 3N3KB 3PHXB 3AEAB 2V0GA 4HCPB 2OJWA 2BYFA 2W3RA 1IGDA 1E8YA 3WAOA 4LCDE 1XEEA 1GC6A 1UH6A 4AWJA 1YMHE 1C76A 1QLBB 4NNJB 4E71A 1WGHA 1K50A 1XCTL 2RR9A 3B1LX 4XDCA 5CHWA 2Z0EB 4TMAB 2JQRB 3EHVA 2M1MA 3AECB 3CIRB 4I6PA 1X1MA 2W82A 1UZXB 4BKTA 5EDSA 4PK1A 5HFYA 1QOAA 1GOZA 5TR5A 1F77A 2XK5B 5AZFA 1UBIA 2BS4B 3JYUA 3SDLC 1WGGA 1L6UA 3N1YC 2KJ6A 2MSED 1FCCC 3NJTA 2KWVB 3Q3OC 1I4HA 4WJOA 1YJJA 2L7RA 1TIFA 2EKIA 3KYDD 4JL9A 3TEYA 1L2NA 1V5OA 1UUPA 2CHXA 4M0WA 3AE9B 2EMSA 2GOWA 3PRPB 5AEKB 2AL6A 1NVID 3ONSA 1JMLA 4HPMB 3VXWA 4E74A 3BZDB 3P4RB 1WGDA 1WXVA 3HM3A 4KZCA 1E5WA 2WDRB 5J17A 3V61A 4ASWC 4RMAA 1V49A 2E6XA 3RNCC 4CHKA 5C23A 4RGNA 2ON8A 1XLPA 2FIDA 2NTTA 3C8YA 2L76A 1WRIA 5J2RA 1NI2A 5G2NA 4YSZB 2D5GA 3RYTA 4E3CA 3N32A 3DBSA 4N6EB 4W9HA 3BVMA 3AULA 2IO0B 1Q5WB 4GLSC 3PV1A 2KFKB 1HZ6A 2J53A 3RMKC 3V6CB 4W9IA 1XXGA 3VVWB 4CQNA 3W9CB 2V4LA 2V9HA 4XGAB 1E8XA 2AQ2B 2X38A 3QAQA 1EF1A 5GMVA 1LQBA 1QF6A 2DX5B 4GN1A 4LJPB 2KX0A 1E8ZA 4NJ6A 1UGJA 2KDBA 4A90A 3I57A 2WXPA 1M4VA 2JVCA 4XC2A 3A9KB 4PYZA 3L08A 2GBJA 2FCSA 1KLGD 1FD6A 1MPEA 2Q5WD 3IFWB 1FIQA 5KHQA 3UQBA 1FNWA 3DBHB 4HVBA 4XYCA 5IN7A 3AM9A 1WXQA 3DBHI 4BZAA 4HWIB 2N9LA 3CSFA 2J52A 1TS4A 1K51A 1WMHB 5G5HA 4EFOA 2L05A 3A4SC 3OJ4B 2KACA 4MACA 3RNBC 3VRAB 2CR5A 2CU3A 2MHJA 4W9KA 4OHJA 5E6NA 5T8IA 4A8XC 1FNUA 3L54A 2KXJA 4EKUA 1K8RB 1Y56A 2BGFA 2D07B 1D4BA 2KD0A 1WRDB 1EWYC 1YQBA 3W1SC 1RM6C 2QSDA 2N9KA 2PVOD 4P6VF 3EGRA 2ONQA 2CKHB 3KWLA 3K9OB 4NZLB 1STEA 2FCNA 1SB3C 1DOXA 3MC0B 1ZE3D 2V3SA 3VTUA 1P98A 3X23A 4EEWA 3ABVB 1ZDXA 2KAJA 3VTWA 3RNAC 1OQQA 4A3OA 1MG4A 5IAAC 3A33B 2MRPA 2CS4A 3KLSX 1KTKA 4OZCA 4YTMB 3KYCD 4K1RB 2CHZA 1T0YA 1HTOA 3E9SA 3QCAA 5KHOA 2KDMA 3FILB 2N7EA 2ZPNA 2PJHA 3DCGA 4OVVA 5HG2A 2MBBB 4JE3B 2MBEA 3P1MA 5LXIB 5G55A 1LFDA 3PS6A 2N9PC 1JCKB 2C7MB 2I1KA 2LASA 3JSVB 2PIAA 4FN2A 3DWMA 2DBYA 1PYWD 3L4PA 2GLSA 1E7UA 1QQRA 4NAMA 4II2B 3NS1A 2ZNVB 3RFZB 2MP2A 4DDID 5BMHA 1XQQA 3GB1A 2N9EB 2DZIA 1TKEA 2NPTA 1TZ1A 2KLCA 3Q14C 1DOIA 3R66C 5BYSA 4GOCA 4A9AA 2KANA 3SD5A 3O13A 5I4DA 4C56C 3VUYA 3A4RA 3M63B 2KDEB 1JRPA 2D3CA 3U4EG 4JLCA 4BKGA 4HDQA 4XWTA 3RCZA 3PZDA 2D11A 4TKNA 1QKZA 4C80A 1FFVA 2KQ7A 1D6EC 1FEHA 3CF6E 3NY5A 2DHZA 3R7RA 4W9JA 3GOEA 1KRHA 1UWMA 4MGYE 3ZNGC 4MH8A 4P7IA 3NZUA 1XLNA 1WH3A 1V80A 4PS8A 4W9LA 5MPOA 1OFFA 1YQ3B 2L0TA 4G11A 1FPYA 2QMTA 3Q6BA 2Z59B 3W5VB 2PW9A 3C0RB 2BYTA 4ZRIA 3GE3C 4G0NB 2NCNA 2I38A 1JWAD 3NZSA 2GBMA 2LGSA 4DK5A 4DBGA 1F2RI 3LJ3A 1EM7A 4FJVB 2M19A 4JPSA 4NJCA 4KDIC 2WXHA 1Z5SB 2I1JA 1TY2A 4HXDA 3VUWA 3P4QB 1VZ7A 2LMCA 2WHIA 1UWXA 2OOBB 4NAWA 3W5UB 1UD7A 4HROA 4J6IA 4EUTA 2L3ZA 2TSSA 2DAFA 1WIAA 2W3SA 2L00B 2MWSB 4CYEA 1WJUA 2R61A 1T3QA 3H7SA 3TL5A 1WI0A 4AQ7A 1NDDA 2NR2A 3ZJTA 2KHWB 4ITKA 2FUG1 1WX9A 3AXCA 4DHZE 3C19A 2K6QA 3QX1A 2KYWA 4MM3A 2KTRB 3MHSD 2E3TA 1YOVB 2O6VD 4KGRA 2WXIA 1PUTA 3L16A 1F1HA 4EZLA 1FM0D 2C7HA 1J7CA 2O6VB 3Q2AC 3K9PB 1C77A 3VQIA 2AQ1B 2KQSA 3PGEA 1PGAA 2C60A 1VLBA 1T0RC 1ESFA 3ZO5B 2XN9C 3I3TB 3AE3B 3J9CA 2JRIB 3NRZA 1WFYA 2LGIA 3AV8A 1V97A 5G5GA 2KOXA 3I63C 1C1YB 1FO4A 1XT9B 2VZKD 2NBWB 1ZW7A 1L0VB 2VH1A 4IM0A 2BYVE 4IWOA 1TGZB 4TUUA 3UQAA 4ARCA 2PE6B 2AL3A 1BUIC 3VFKA 4HRSA 1QOBA 2N9XA 3AE4B 2QJLA 2GRIA 4NJ7A 4I6NB 3L0WB 1SE3A 1Q10A 4WQMA 1VCBA 3WAMA 5D94A 1TJEA 3DVGY 4IW0A 2JX5A 2WXGA 4DHZB 2J0JA 4A3PA 2BWES 4YSYB 2WNMA 2K25A 4F8CB 2BF8B 3NS8A 4FHJA 5JH5C 3QWZB 1J7AA 3AEDB 4N9F4 2LVPA 4LNNA 1V5TA 4K81A 4DQOC 3W1SA 3UGBB 1F2RC 4EOYA 4ZRKA 3UF8A 4YL8A 5BYQA 4AOFA 4C4VB 1SGHA 3VHTC 2LXCA 1WYGA 4FBJB 4LNIA 1L6VA 4MJSA 2DLBA 3A9JB 3PREA 2YEPB 2M8SA 3ML9A 3T9LA 3NG0A 1IBXA 4WWOA 1R4MI 1SXTA 2MH7A 3WANA 5HI1A 5C1ZA 3DBRI 1N5WA 5CX3A 4QAYA 3H7PA 1WE7A 2JWUA 3RD2A 2Z8LA 4FADA 2AWTA 3OLMD 4RM8A 4B0EA 4LNFA 3FILA 4S0RA 1WGKA 1MHXA 4K7WA 3IVFA 1V1OA 4AJYB 1YJIA 4RGTA 2GB1A 2KT7A 2VZKB 3QK0A 2FUHB 4BVUC 5L83A 1WXMA 3Q8BA 1WXAA 2LGDA 1EF5A 2CJOA 2WGSA 3N9YC 3A9KA 2SEBD 5TSSA 3KQ4A 3ZDMC 1IBXB 2RDBC 2HJ8A 4AJWA 2BW2A 1V81A 3MHZA 1F9JA 2WDTB 2J0KA 2MP2B 4KZ0A 2QCZA 4DXAB 4GIVA 4ZOHC 4G3XB 1GJZA 3Q3MC 1LXDA 3IBEA 1MI0A 1WJ4A 1OGWA 2WXOA 1FRRA 3HK0A 2KO3A 3ZQ4A 2BQQA 2ZJDA 5H92C 2IO1B 2BTEA 2WP9B 1JWBD 1MHHE 4O1NA 2K3UA 2LEKA 1N63A 2MBQA 2EKEC 2BB5A 3FKYA 3LDZE 4IKGA 4DDGD 1R4NB 4WJPA 4URKA 1IYFA 2FE8A 2JPHA 4WWMA 5D3IB 4G50A 2M0AA 2Z0DB 1B9RA 3AE2B 2ICIA 2KMMA 2MA9B 4KSKC 2N1WA 5DPRA 1WX7A 4RH6A 3HVDA 2M0XA 3CMMB 3U52E 1CZPA 4K7SA 1FMAD 1P3QU 1TY0A 3ML8A 3GP7A 2ZPYA 1YN4A 3TBLD 1VZ8A 4HJGE 2MJ3A 1RWSA 1KM7A 3DHIC 1WWTA 4NQKE 1M94A 4AUQC 1WR1A 3DVNV 2O2VA 4ZDVA 3KH0A 3TEWA 3Q8AA 1SSNA 2W55A 4XZ4A 2CHWA 2KC2A 4OVUA 2RPVA 1SE2A 1Q0WB 2WWZA 4GU2A 1E6EB 1FNVA 2KK8A 2QIEB 2GBKA 2PKOA 3OG5A 3WCQA 2WXKA 3KUZA 3U7DA 2CJNA 2WXFA 2BWFA 2IO3B 3DHGC 2JYEA 2MCNB 4XX5A 1GB1A 3ZJUA 2WU5B 2FNJB 3AEEB 2BVCA 1G6JA 2B3AA 3MJWA 3N30A 4KGSA 4KGTA 3AB5A 4M0WB 2ZVOA 2LRUA 3HIZA 3PHWB 4K3CA 1CMXB 1VR9A 4HPLB 2KKCA 1Y8RC 1L0YB 4BOZB 4EZJA 4B9KA 3JVZX 4N58A 3PZ7A 1JALA 4X57B 3AE5B 3JW0X 2IGGA 3ENEA 4S17A 2RD0A 1SJED 2KTRA 1C78A 1N6ZA 2DNFA 4K3BA 2WXMA 2LRWA 1P1AA 1SIFA 2INNE 4AS1A 3PPAA 5LXHA 1GUAB 2FAZA 1PGXA 3TMPB 2GBNA 1WY8A 2O2VB 1WF9A 3TJPA 2RMMA 5E6OA 3R2IA 3Q8CA 1AN8A 1WX8A 2ZNVC 2DAJA 3P4PB 2YEPF 3AMZA 4DXFA 5D7GA 1WZ0A 2L32A 1V8CA 3R3MA 4DWFA 4GDKB 4GSWA 2NVUI 3E56A 3VR9B 1T5XD 5L95C 3BVGA 4PS7A 2KDIA 3PTFC 1E9MA 4PS3A 2KWUB 1H8CA 4GDLA 4OVZA 1KF6B 4MH0E 4LJOB 1XLOA 3P42A 3RZWC 2MBHA 3S2AA 3SU8X 2LD9A 2ZEQA 3RT3B 2WS3B 2LVQA 1XD3B 4OZBA 1SE9A 3W2DA 2RGFA 3NHEB 3RN9C 1R4MB 2R2QA 4BKSA 2LGYA 1HQRD 4FXCA 2MQJA 1I4GA 2IBIB 2WXQA 2ASQA 3APFA 4KIKB 3JSVA 3A9JA 1WZ3A 1OEYJ 2IPKD 3VUXA 1SBBB 2WX0A 3I5JC 1PQSA 4GMVA 1F52A 4NQLB 1WJ6A 3IG3A 2JZZA 3MFGA 1YD8U 1BXTA 2WXRA 3PZ8A 2JXTA 3PLVA 3LYYA 2K39A 4BBNF 1XCQL 3AH7A 1DOYA 2KLGA 3ZXVA 1I4PA 4FJYA 2L83A 1ET6A 1P0RA 1QOGA 2M17A 2J7QB 1AW7A 2R2OA 1QZEA 1OEYA 2ACZB 4RFBA 5BMGA 2DZKA 3AEFB 1IPGA 1NYQA 3A1QA 1HTQA 1KLVA 1UELA 1FFUA 1ZP0B 2UWQA 4ACFA 1NYRA 3UI3A 2ZCCA 2D3BA 1MVKA 2G9HD 4LDTB 3Q8FA 4RGOS 3ZJVA 3CSTA 5DPWA 1IGCA 3H6NA 4ANXA 1K52A 1SEBD 3FC4A 3ZXRA 2BS2B 1QOFA 2BKRB 3BK1A 1JWUD 4BKSD 3DDCB 4IC7B 4REZA 5BYRA 1V6EA 2QEJC 3L13A 4ARIA 3DOWA 2IYDB 5C2TB 2VH2A 3SHQA 2A5UA 1YNTE 2N0SB 5BMIA 4FHKA 3VAWA 4GDLB 1PGBA 1OTRB 3IHPC 4JQWC 2Y5CA 2BT6A 2KJRA 3U8ZA 2PEAA 5BO4B 4IM3A 4IG7B 3BK2A 4KX6B 4Q2JA 3D32A 2NMQA 4W9EA 2REXA 4K7UA 5CHFA 3RPFC 2LHDA 3EA6A 2AX5A 5FR6A 3DVGX 4USAA 2LJ5A 3ZTDA 2LGXA 1YIWA 1NBFC 2JWZA 1UF0A 4MGZE 3LXFA 3I9V1 1EU4A 1N61A 1UNSA 3ZRFA 1C9FA 2FCQA 4KKIA 2NBUA 3T3OA 4MJSB 1GC7A 2KNBA 2JZ3B 1AWDA 2QDFA 4RF1A 4F1SA 4OZAA 4FULA 3T8MA 3N1XC 1VJKA 3ZYYX 1A70A 1N60A 4DHJB 2KVRA 3RNGC 2LVOA 2ZZPB 2AQ3B 2HDEA 3KWVA 1YN5A 2C9WB 2AEHA 2IY1B 3R8BA 2FBWB 3IXSA 2JYTA 4J3OD 3NZ3A 3B08A 1D3ZA 5D3DA 1L5PA 3ZNHB 1TS3A 5CTRC 3MP9A 2HTME 3ZVVA 4LNOA 2JXXA 2LUMA 4A55A 2G45B 4GGQA 3A1QB 1D5ZC 2HTHA 3RI7C 1SE4A 3APDA 2N7JA 4II3B 4M00A 2N4FA 2NTSA 2NS5A 3KUDB 2YLMA 3M62B 1WMHA 3NVWA 4C7ZA 1TYGB 4HEA1 1GNUA 4F7ZA 2WLBA 3W1YA 1ZXIA 1YQ4B 3ZNID 4NY0A 3ALBA 3KVFB 3ECIA 2V3NA 1V1PA 1P7FA 1RAXA 3ZDTA 1VDVA 3RNFC 1MJDA 2AYOB 1WR6E 1TS5A 3AE1B 1VD2A 2GI9A 4HPPA 2HJ1A 3QARA 1QT9A 1ROEA 4W9CA 3VH3B 2IO2B 3MTNB 2O6VA 2H89B 1CK1A 2BKFA 4M8MA 1ET9A 4PYUA 1IUEA 2JY6A 1I7HA 1XF5L 2LZ6A 1CQVA 3WIMA 3TEXA 4YSXB 1RRBA 3RZFA 4H2AA 2OJRA 2K5PA 1R7SA 2VRRB 2LFIA
chains in the Genus database with same CATH topology
1KM7A 1T0YA 2KMCA 1EUVB 3BY4B 4KIKA 4NQKE 1M94A 4JIOU 4AUQC 2PPHA 3QCAA 4W9DA 5KHOA 2KZRA 1WR1A 2GMIC 3DVNV 4ANUA 2O2VA 4ZDVA 3KH0A 2K8CA 2N7EA 2BYEA 2ZPNA 2PJHA 3DCGA 1OQYA 2PE9A 3KUCB 4MSMB 4OVVA 4XZ4A 4W9GA 2CHWA 3H7PB 4KSLC 2MBBB 2KC2A 4OVUA 2MBEA 2K8HA 2NPTB 5LXIB 1Q0WB 2WWZA 4GU2A 3DQVA 2J0MA 3Q3FA 2KK8A 4FLHA 3B0AA 5G55A 1LFDA 3PS6A 2N9PC 2GBKA 3TIXA 3H9DA 2C7MB 2I1KA 3EFUA 4HK2A 5AZGA 2LASA 3JSVB 3M95A 4FN2A 5DPTA 4MELA 1H4RA 3KUZA 3U7DA 5CHVC 3M3JA 3APCA 2BWFA 2IO3B 1WJNA 2MCNB 3BINA 4XX5A 1E7UA 2LXAA 1V9JA 3VDZA 1LM8B 2FNJB 1R4NI 2N7DA 2ZNVB 4II2B 2MP2A 4DDID 1G6JA 2B3AA 3MJWA 3N30A 2G3QB 1XQQA 4B6WA 2BPSA 3O65B 2N9EB 2DZIA 4ANVA 2NPTA 3OJ3A 2KDFB 1TZ1A 4BFRA 2KLCA 4M0WB 1Z2MA 2ZVOA 2LRUA 3HIZA 3PHWB 3R66C 4GDKA 4WQOB 1J8CA 4ANWA 1CMXB 2HD5B 4GOCA 1V2YA 4HPLB 1S1QB 2GBRA 2KKCA 2KANA 2L0FA 1AARA 3PLUA 3SD5A 1Y8RC 2JRHA 4TQ0A 2RSUA 4BOZB 3VUYA 4EZJA 3A4RA 3M63B 2KDEB 3PVLA 1C3TA 1ZKHA 4RM9A 3WA0A 4B9KA 2MBOA 3JVZX 4ZYNA 3V60A 3L17A 4X57B 4MSQB 2K6DB 3JW0X 2KN5A 3ENEA 2JT4B 2RD0A 2KTRA 4HLEA 4JLCA 3R7QA 3TCAA 4BKGA 2XK5A 4HDQA 3RCZA 3PRZA 3PZDA 2LRWA 1P1AA 2D11A 3DVNU 1SIFA 4TKNA 2D10A 3PPAA 2KQ7A 5LXHA 1GUAB 2FAZA 3TMPB 3QJZA 2GBNA 1WY8A 3CF6E 3AU5A 3AU4A 3NY5A 3Q3JA 2O2VB 2DHZA 3R7RA 1WF9A 4IWQA 4W9JA 3TJPA 5E6OA 3GOEA 3V62A 2LI5A 1E8WA 3UIOB 4MGYE 4B95A 1JRUA 1WX8A 2IZVB 3ZNGC 2ZNVC 2DAJA 2HE7A 4P7IA 1TTNA 3ZTCA 4ICVA 4GB9A 3NZUA 3QQ8B 1WH3A 1V80A 4PS8A 4W9LA 5JHAA 4WAAA 5D7GA 3RUIB 1WZ0A 3DPDA 3RULA 1A5RA 4WWNA 4ZRJA 3R3MA 2L0TA 4G11A 4DWFA 3HHMA 2V1YA 4GDKB 4GSWA 2NVUI 1I35A 2FCMA 4BOSC 5L95C 2L8JA 4WJQA 4PS7A 2C5LC 1S3SG 4ICUA 4DHJD 2KDIA 3PTFC 2Z59B 2K8BA 4PS3A 1YX5B 2KWUB 3C0RB 4ZRIA 3PRMB 1H8CA 4GDLA 3NOBA 4G0NB 4MH0E 4JGHB 1ISNA 2NCNA 4LJOB 3NZSA 2DYOA 2GBMA 3RZWC 2DYBA 2MBHA 2CU1A 3S2AA 4DK5A 3SU8X 1U4AA 2LD9A 2ZEQA 3RT3B 3LJ3A 2LWPA 3KW5B 3ZW3A 4DBGA 1UBQA 1KOTA 2LVQA 1XD3B 1MG8A 2IY0B 4FJVB 2DENB 1J19A 3P2BA 1SE9A 3V6EB 3HM6X 4KDIC 1Z5SB 2I1JA 3QC8B 4EZKA 2RGFA 3NHEB 4HXDA 3VUWA 5E6PA 2R2QA 4MDKE 2M4NA 2KMAA 4W9FA 2OOBB 4NAWA 3WAPA 5JHBA 2XBBC 4MEMA 1UD7A 4BKSA 2LGYA 4J6IA 2A4ZA 4EUTA 3H1UA 2L3ZA 3ZKJC 2DAFA 2XEWA 1WIAA 1RFAA 2L00B 3N3KB 3PHXB 2MQJA 2MWSB 4CYEA 1WJUA 4IUMB 5J18A 4HCPB 1WYWB 2BYFA 1I42A 2IBIB 3H7SA 3TL5A 1E8YA 2ASQA 2Y5BB 1WI0A 3APFA 3WAOA 1V86A 1NDDA 4KIKB 2NR2A 4LCDE 3JSVA 3A9JA 1WZ3A 1OEYJ 3VUXA 2KHWB 2WX0A 1GC6A 1IP9A 1UH6A 1WX9A 3AXCA 4AWJA 4DHZE 1PQSA 4GMVA 4NQLB 1WJ6A 3IG3A 2JZZA 2K6QA 3QX1A 1YD8U 4MM3A 4NNJB 4E71A 1WGHA 2DZMA 1ZGUB 2RR9A 1WGYA 3B1LX 3PLVA 2KFJA 2K39A 5CHWA 2KTRB 4KV2A 2Z0EB 4BBNF 5D6JB 3MHSD 2KLGA 2O6VD 4FJYA 3EHVA 1P0RA 2M17A 4FA6A 2J7QB 2M1MA 3L16A 2R2OA 2DYMA 4EZLA 1QZEA 2C7HA 2O6VB 3K9PB 1OEYA 4I6PA 3VQIA 1X1MA 2KQSA 2UYZB 3PGEA 2C60A 2DZKA 1UZXB 1IPGA 3ZO5B 4BKTA 3A1QA 5EDSA 1KLVA 1UELA 3I3TB 2JRIB 4KDLB 1WFYA 2UWQA 3QIJA 5TR5A 2WYQA 2KOXA 2ZCCA 2XK5B 1C1YB 4HDOA 1XT9B 5AZFA 1UBIA 2NBWB 3JYUA 4NPNA 5D2MB 3SDLC 1ZW7A 1WGGA 4IM0A 4WWPA 5JZEB 4LDTB 2KJ6A 1L7YA 2BYVE 2MSED 1YJ1A 4IWOA 1TGZB 4TUUA 1RLFA 2EMTA 3UQAA 3CSTA 2KWVB 5DPWA 3H6NA 2G4SA 2PE6B 2AL3A 3ZNZB 4ANXA 4I6LB 4WJOA 2JF5A 4KVGB 3VFKA 2L7RA 2YVCA 2G4DB 2N9XA 4HJKA 3AI5A 3KYDD 4JL9A 4NJ7A 4I6NB 2D2QA 2K1FA 3L0WB 1L2NA 1V5OA 2CHXA 2BKRB 1VCBA 3WAMA 2ZVNA 2EMSA 5D94A 4AP4C 4M8NA 4BKSD 2GOWA 3DDCB 3DVGY 3PRPB 4IC7B 4IW0A 4BBNC 4DHZB 2J0JA 5AEKB 4A3PA 2AL6A 1J0GA 1V6EA 2KFKA 3ONSA 2BWES 2QHOA 3L13A 2K25A 4F8CB 2BF8B 2ZCBA 3DOWA 3PSEB 2IYDB 4HPMB 3NS8A 3VXWA 4E74A 3SHQA 3X0WA 2A5UA 4FHJA 1YX6B 1WGDA 1WXVA 3HM3A 5JH5C 3QWZB 4FHKA 3GZNI 3VAWA 4GDLB 4KZCA 4N9F4 1OTRB 2LVPA 1E5WA 3IHPC 4JQWC 1V5TA 4K81A 5J17A 1E90A 3V61A 2D3GA 4ASWC 4RMAA 1V49A 1WM2A 2KJRA 3U8ZA 2MX2A 4CHKA 2PEAA 5C23A 5BO4B 3W1SA 3UGBB 2MLBA 4IM3A 4IG7B 2FIDA 3D32A 4EOYA 4ZRKA 3UF8A 4W9EA 4YL8A 2REXA 4AOFA 2L76A 4K7UA 5J2RA 1NI2A 5G2NA 5CHFA 1SGHA 3VHTC 2KC1A 1EO6A 2LXCA 3RYTA 4E3CA 3N32A 3DBSA 4IM2A 5FR6A 4FBJB 3DVGX 1TBEA 2LJ5A 3ZTDA 5HKHA 2LGXA 4TQ1A 1YIWA 4W9HA 1NBFC 2JWZA 2MW5A 3DBLI 4MGZE 3AULA 4MJSA 2IO0B 3A9JB 2NBVB 1Q5WB 3ZRFA 2FCQA 3PREA 2FIFA 2M8SA 3PV1A 2NBUA 4MJSB 1GC7A 2KFKB 2KNBA 3ML9A 2LUEA 3V6CB 3T9LA 3OAWA 2JZ3B 4WWOA 1R4MI 3QHTA 4W9IA 3VH4B 3VVWB 3WANA 4F1SA 2V4LA 4FULA 5C1ZA 3T8MA 3DBRI 5CX3A 1E8XA 5LLIA 3H7PA 1WE7A 4DHJB 2KVRA 3RD2A 4TV3A 3QAQA 2KWCA 1GG3A 4FADA 1WM3A 2AWTA 1EF1A 2LVOA 3OLMD 2ZZPB 4IWPA 3L10B 4RM8A 5GMVA 2C9WB 1LQBA 2DX5B 4GN1A 2AEHA 4LJPB 2KX0A 1E8ZA 4K7WA 3IVFA 3ZIMA 4CO7A 3ZUNA 4AJYB 2IY1B 4NJ6A 2N1VA 2KDBA 2C7NB 2KX3A 1D3ZA 3B08A 3PT2B 1HE8A 2KTFA 3ZNHB 5DCNA 3QK0A 2FUHB 3UIPB 2JVCA 5CTRC 4XC2A 4BVUC 5L83A 3ZVVA 1WXMA 2DZJA 3A9KB 4PYZA 2JXXA 1WXAA 2LGDA 3L08A 2GBJA 4NAWB 4HCNB 1EF5A 2FCSA 3UINB 3WALA 2G45B 4WJNA 3A9KA 3U30A 4MGIE 1KJTA 3A1QB 1E7VA 2W9NA 4GGQA 3ZDMC 3IFWB 2HJ8A 1WE6A 2HTHA 4AJWA 5KHQA 1V81A 3APDA 3UQBA 1F9JA 2WDTB 2J0KA 2MP2B 2N4FA 4II3B 2NS5A 4KZ0A 4HVBA 3KUDB 2YLMA 3M62B 1WMHA 4DXAB 4GIVA 3DBHI 4G3XB 4HWIB 3EC8A 4FJZA 1GJZA 1LXDA 3CSFA 3IBEA 1GNUA 4F7ZA 1WMHB 3W1YA 3ZNID 4NY0A 2L05A 3A4SC 3ALBA 3KVFB 3ECIA 3OJ4B 4LDTD 4EFOA 1RAXA 2CR5A 3ZDTA 1OGWA 4W9KA 5E6NA 3HK0A 2AYOB 3L54A 1WR6E 3ZLZA 2RPQA 3ZRCA 2KXJA 2JUOA 2KO3A 4EKUA 1K8RB 5DPSA 1VD2A 3VTVA 2D07B 2BGFA 2KJHB 2ZJDA 2KD0A 1WRDB 2IO1B 1YQBA 3W1SC 3QARA 4W9CA 3VH3B 2IO2B 2MBQA 2EKEC 3LDZE 2CKHB 3MTNB 4DDGD 4WJPA 4A20A 2O6VA 3QA8A 4URKA 1IYFA 2JPHA 3K9OB 1WGRA 1BT0A 1P9DU 4G50A 1Q1OA 2Z0DB 2FCNA 2BKFA 1FXTB 5AZHA 4M8MA 2WX1A 1WXSA 2V3SA 2MA9B 4KSKC 4PYUA 2JY6A 2N1WA 5DPRA 1WX7A 2LZ6A 3VTUA 1P98A 3X23A 4EEWA 3WIMA 1RRBA 2M0XA 4MGKE 3VTWA 3CMMB 4A3OA 4K7SA 5IA7A 1P3QU 3A33B 2MRPA 5IAAC 3ML8A 2ZPYA 3RZFA 2CS4A 4GXBA 2OJRA 1UGMA 3TBLD 3KYCD 3EECA 2VRRB 4K1RB 2CHZA 1WJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KM7 A;  1T0Y A;  2KMC A;  1EUV B;  3BY4 B;  4KIK A;  4NQK E;  1M94 A;  4JIO U;  4AUQ C;  2PPH A;  3QCA A;  4W9D A;  5KHO A;  2KZR A;  1WR1 A;  2GMI C;  3DVN V;  4ANU A;  2O2V A;  4ZDV A;  3KH0 A;  2K8C A;  2N7E A;  2BYE A;  2ZPN A;  2PJH A;  3DCG A;  1OQY A;  2PE9 A;  3KUC B;  4MSM B;  4OVV A;  4XZ4 A;  4W9G A;  2CHW A;  3H7P B;  4KSL C;  2MBB B;  2KC2 A;  4OVU A;  2MBE A;  2K8H A;  2NPT B;  5LXI B;  1Q0W B;  2WWZ A;  4GU2 A;  3DQV A;  2J0M A;  3Q3F A;  2KK8 A;  4FLH A;  3B0A A;  5G55 A;  1LFD A;  3PS6 A;  2N9P C;  2GBK A;  3TIX A;  3H9D A;  2C7M B;  2I1K A;  3EFU A;  4HK2 A;  5AZG A;  2LAS A;  3JSV B;  3M95 A;  4FN2 A;  5DPT A;  4MEL A;  1H4R A;  3KUZ A;  3U7D A;  5CHV C;  3M3J A;  3APC A;  2BWF A;  2IO3 B;  1WJN A;  2MCN B;  3BIN A;  4XX5 A;  1E7U A;  2LXA A;  1V9J A;  3VDZ A;  1LM8 B;  2FNJ B;  1R4N I;  2N7D A;  2ZNV B;  4II2 B;  2MP2 A;  4DDI D;  1G6J A;  2B3A A;  3MJW A;  3N30 A;  2G3Q B;  1XQQ A;  4B6W A;  2BPS A;  3O65 B;  2N9E B;  2DZI A;  4ANV A;  2NPT A;  3OJ3 A;  2KDF B;  1TZ1 A;  4BFR A;  2KLC A;  4M0W B;  1Z2M A;  2ZVO A;  2LRU A;  3HIZ A;  3PHW B;  3R66 C;  4GDK A;  4WQO B;  1J8C A;  4ANW A;  1CMX B;  2HD5 B;  4GOC A;  1V2Y A;  4HPL B;  1S1Q B;  2GBR A;  2KKC A;  2KAN A;  2L0F A;  1AAR A;  3PLU A;  3SD5 A;  1Y8R C;  2JRH A;  4TQ0 A;  2RSU A;  4BOZ B;  3VUY A;  4EZJ A;  3A4R A;  3M63 B;  2KDE B;  3PVL A;  1C3T A;  1ZKH A;  4RM9 A;  3WA0 A;  4B9K A;  2MBO A;  3JVZ X;  4ZYN A;  3V60 A;  3L17 A;  4X57 B;  4MSQ B;  2K6D B;  3JW0 X;  2KN5 A;  3ENE A;  2JT4 B;  2RD0 A;  2KTR A;  4HLE A;  4JLC A;  3R7Q A;  3TCA A;  4BKG A;  2XK5 A;  4HDQ A;  3RCZ A;  3PRZ A;  3PZD A;  2LRW A;  1P1A A;  2D11 A;  3DVN U;  1SIF A;  4TKN A;  2D10 A;  3PPA A;  2KQ7 A;  5LXH A;  1GUA B;  2FAZ A;  3TMP B;  3QJZ A;  2GBN A;  1WY8 A;  3CF6 E;  3AU5 A;  3AU4 A;  3NY5 A;  3Q3J A;  2O2V B;  2DHZ A;  3R7R A;  1WF9 A;  4IWQ A;  4W9J A;  3TJP A;  5E6O A;  3GOE A;  3V62 A;  2LI5 A;  1E8W A;  3UIO B;  4MGY E;  4B95 A;  1JRU A;  1WX8 A;  2IZV B;  3ZNG C;  2ZNV C;  2DAJ A;  2HE7 A;  4P7I A;  1TTN A;  3ZTC A;  4ICV A;  4GB9 A;  3NZU A;  3QQ8 B;  1WH3 A;  1V80 A;  4PS8 A;  4W9L A;  5JHA A;  4WAA A;  5D7G A;  3RUI B;  1WZ0 A;  3DPD A;  3RUL A;  1A5R A;  4WWN A;  4ZRJ A;  3R3M A;  2L0T A;  4G11 A;  4DWF A;  3HHM A;  2V1Y A;  4GDK B;  4GSW A;  2NVU I;  1I35 A;  2FCM A;  4BOS C;  5L95 C;  2L8J A;  4WJQ A;  4PS7 A;  2C5L C;  1S3S G;  4ICU A;  4DHJ D;  2KDI A;  3PTF C;  2Z59 B;  2K8B A;  4PS3 A;  1YX5 B;  2KWU B;  3C0R B;  4ZRI A;  3PRM B;  1H8C A;  4GDL A;  3NOB A;  4G0N B;  4MH0 E;  4JGH B;  1ISN A;  2NCN A;  4LJO B;  3NZS A;  2DYO A;  2GBM A;  3RZW C;  2DYB A;  2MBH A;  2CU1 A;  3S2A A;  4DK5 A;  3SU8 X;  1U4A A;  2LD9 A;  2ZEQ A;  3RT3 B;  3LJ3 A;  2LWP A;  3KW5 B;  3ZW3 A;  4DBG A;  1UBQ A;  1KOT A;  2LVQ A;  1XD3 B;  1MG8 A;  2IY0 B;  4FJV B;  2DEN B;  1J19 A;  3P2B A;  1SE9 A;  3V6E B;  3HM6 X;  4KDI C;  1Z5S B;  2I1J A;  3QC8 B;  4EZK A;  2RGF A;  3NHE B;  4HXD A;  3VUW A;  5E6P A;  2R2Q A;  4MDK E;  2M4N A;  2KMA A;  4W9F A;  2OOB B;  4NAW A;  3WAP A;  5JHB A;  2XBB C;  4MEM A;  1UD7 A;  4BKS A;  2LGY A;  4J6I A;  2A4Z A;  4EUT A;  3H1U A;  2L3Z A;  3ZKJ C;  2DAF A;  2XEW A;  1WIA A;  1RFA A;  2L00 B;  3N3K B;  3PHX B;  2MQJ A;  2MWS B;  4CYE A;  1WJU A;  4IUM B;  5J18 A;  4HCP B;  1WYW B;  2BYF A;  1I42 A;  2IBI B;  3H7S A;  3TL5 A;  1E8Y A;  2ASQ A;  2Y5B B;  1WI0 A;  3APF A;  3WAO A;  1V86 A;  1NDD A;  4KIK B;  2NR2 A;  4LCD E;  3JSV A;  3A9J A;  1WZ3 A;  1OEY J;  3VUX A;  2KHW B;  2WX0 A;  1GC6 A;  1IP9 A;  1UH6 A;  1WX9 A;  3AXC A;  4AWJ A;  4DHZ E;  1PQS A;  4GMV A;  4NQL B;  1WJ6 A;  3IG3 A;  2JZZ A;  2K6Q A;  3QX1 A;  1YD8 U;  4MM3 A;  4NNJ B;  4E71 A;  1WGH A;  2DZM A;  1ZGU B;  2RR9 A;  1WGY A;  3B1L X;  3PLV A;  2KFJ A;  2K39 A;  5CHW A;  2KTR B;  4KV2 A;  2Z0E B;  4BBN F;  5D6J B;  3MHS D;  2KLG A;  2O6V D;  4FJY A;  3EHV A;  1P0R A;  2M17 A;  4FA6 A;  2J7Q B;  2M1M A;  3L16 A;  2R2O A;  2DYM A;  4EZL A;  1QZE A;  2C7H A;  2O6V B;  3K9P B;  1OEY A;  4I6P A;  3VQI A;  1X1M A;  2KQS A;  2UYZ B;  3PGE A;  2C60 A;  2DZK A;  1UZX B;  1IPG A;  3ZO5 B;  4BKT A;  3A1Q A;  5EDS A;  1KLV A;  1UEL A;  3I3T B;  2JRI B;  4KDL B;  1WFY A;  2UWQ A;  3QIJ A;  5TR5 A;  2WYQ A;  2KOX A;  2ZCC A;  2XK5 B;  1C1Y B;  4HDO A;  1XT9 B;  5AZF A;  1UBI A;  2NBW B;  3JYU A;  4NPN A;  5D2M B;  3SDL C;  1ZW7 A;  1WGG A;  4IM0 A;  4WWP A;  5JZE B;  4LDT B;  2KJ6 A;  1L7Y A;  2BYV E;  2MSE D;  1YJ1 A;  4IWO A;  1TGZ B;  4TUU A;  1RLF A;  2EMT A;  3UQA A;  3CST A;  2KWV B;  5DPW A;  3H6N A;  2G4S A;  2PE6 B;  2AL3 A;  3ZNZ B;  4ANX A;  4I6L B;  4WJO A;  2JF5 A;  4KVG B;  3VFK A;  2L7R A;  2YVC A;  2G4D B;  2N9X A;  4HJK A;  3AI5 A;  3KYD D;  4JL9 A;  4NJ7 A;  4I6N B;  2D2Q A;  2K1F A;  3L0W B;  1L2N A;  1V5O A;  2CHX A;  2BKR B;  1VCB A;  3WAM A;  2ZVN A;  2EMS A;  5D94 A;  4AP4 C;  4M8N A;  4BKS D;  2GOW A;  3DDC B;  3DVG Y;  3PRP B;  4IC7 B;  4IW0 A;  4BBN C;  4DHZ B;  2J0J A;  5AEK B;  4A3P A;  2AL6 A;  1J0G A;  1V6E A;  2KFK A;  3ONS A;  2BWE S;  2QHO A;  3L13 A;  2K25 A;  4F8C B;  2BF8 B;  2ZCB A;  3DOW A;  3PSE B;  2IYD B;  4HPM B;  3NS8 A;  3VXW A;  4E74 A;  3SHQ A;  3X0W A;  2A5U A;  4FHJ A;  1YX6 B;  1WGD A;  1WXV A;  3HM3 A;  5JH5 C;  3QWZ B;  4FHK A;  3GZN I;  3VAW A;  4GDL B;  4KZC A;  4N9F 4;  1OTR B;  2LVP A;  1E5W A;  3IHP C;  4JQW C;  1V5T A;  4K81 A;  5J17 A;  1E90 A;  3V61 A;  2D3G A;  4ASW C;  4RMA A;  1V49 A;  1WM2 A;  2KJR A;  3U8Z A;  2MX2 A;  4CHK A;  2PEA A;  5C23 A;  5BO4 B;  3W1S A;  3UGB B;  2MLB A;  4IM3 A;  4IG7 B;  2FID A;  3D32 A;  4EOY A;  4ZRK A;  3UF8 A;  4W9E A;  4YL8 A;  2REX A;  4AOF A;  2L76 A;  4K7U A;  5J2R A;  1NI2 A;  5G2N A;  5CHF A;  1SGH A;  3VHT C;  2KC1 A;  1EO6 A;  2LXC A;  3RYT A;  4E3C A;  3N32 A;  3DBS A;  4IM2 A;  5FR6 A;  4FBJ B;  3DVG X;  1TBE A;  2LJ5 A;  3ZTD A;  5HKH A;  2LGX A;  4TQ1 A;  1YIW A;  4W9H A;  1NBF C;  2JWZ A;  2MW5 A;  3DBL I;  4MGZ E;  3AUL A;  4MJS A;  2IO0 B;  3A9J B;  2NBV B;  1Q5W B;  3ZRF A;  2FCQ A;  3PRE A;  2FIF A;  2M8S A;  3PV1 A;  2NBU A;  4MJS B;  1GC7 A;  2KFK B;  2KNB A;  3ML9 A;  2LUE A;  3V6C B;  3T9L A;  3OAW A;  2JZ3 B;  4WWO A;  1R4M I;  3QHT A;  4W9I A;  3VH4 B;  3VVW B;  3WAN A;  4F1S A;  2V4L A;  4FUL A;  5C1Z A;  3T8M A;  3DBR I;  5CX3 A;  1E8X A;  5LLI A;  3H7P A;  1WE7 A;  4DHJ B;  2KVR A;  3RD2 A;  4TV3 A;  3QAQ A;  2KWC A;  1GG3 A;  4FAD A;  1WM3 A;  2AWT A;  1EF1 A;  2LVO A;  3OLM D;  2ZZP B;  4IWP A;  3L10 B;  4RM8 A;  5GMV A;  2C9W B;  1LQB A;  2DX5 B;  4GN1 A;  2AEH A;  4LJP B;  2KX0 A;  1E8Z A;  4K7W A;  3IVF A;  3ZIM A;  4CO7 A;  3ZUN A;  4AJY B;  2IY1 B;  4NJ6 A;  2N1V A;  2KDB A;  2C7N B;  2KX3 A;  1D3Z A;  3B08 A;  3PT2 B;  1HE8 A;  2KTF A;  3ZNH B;  5DCN A;  3QK0 A;  2FUH B;  3UIP B;  2JVC A;  5CTR C;  4XC2 A;  4BVU C;  5L83 A;  3ZVV A;  1WXM A;  2DZJ A;  3A9K B;  4PYZ A;  2JXX A;  1WXA A;  2LGD A;  3L08 A;  2GBJ A;  4NAW B;  4HCN B;  1EF5 A;  2FCS A;  3UIN B;  3WAL A;  2G45 B;  4WJN A;  3A9K A;  3U30 A;  4MGI E;  1KJT A;  3A1Q B;  1E7V A;  2W9N A;  4GGQ A;  3ZDM C;  3IFW B;  2HJ8 A;  1WE6 A;  2HTH A;  4AJW A;  5KHQ A;  1V81 A;  3APD A;  3UQB A;  1F9J A;  2WDT B;  2J0K A;  2MP2 B;  2N4F A;  4II3 B;  2NS5 A;  4KZ0 A;  4HVB A;  3KUD B;  2YLM A;  3M62 B;  1WMH A;  4DXA B;  4GIV A;  3DBH I;  4G3X B;  4HWI B;  3EC8 A;  4FJZ A;  1GJZ A;  1LXD A;  3CSF A;  3IBE A;  1GNU A;  4F7Z A;  1WMH B;  3W1Y A;  3ZNI D;  4NY0 A;  2L05 A;  3A4S C;  3ALB A;  3KVF B;  3ECI A;  3OJ4 B;  4LDT D;  4EFO A;  1RAX A;  2CR5 A;  3ZDT A;  1OGW A;  4W9K A;  5E6N A;  3HK0 A;  2AYO B;  3L54 A;  1WR6 E;  3ZLZ A;  2RPQ A;  3ZRC A;  2KXJ A;  2JUO A;  2KO3 A;  4EKU A;  1K8R B;  5DPS A;  1VD2 A;  3VTV A;  2D07 B;  2BGF A;  2KJH B;  2ZJD A;  2KD0 A;  1WRD B;  2IO1 B;  1YQB A;  3W1S C;  3QAR A;  4W9C A;  3VH3 B;  2IO2 B;  2MBQ A;  2EKE C;  3LDZ E;  2CKH B;  3MTN B;  4DDG D;  4WJP A;  4A20 A;  2O6V A;  3QA8 A;  4URK A;  1IYF A;  2JPH A;  3K9O B;  1WGR A;  1BT0 A;  1P9D U;  4G50 A;  1Q1O A;  2Z0D B;  2FCN A;  2BKF A;  1FXT B;  5AZH A;  4M8M A;  2WX1 A;  1WXS A;  2V3S A;  2MA9 B;  4KSK C;  4PYU A;  2JY6 A;  2N1W A;  5DPR A;  1WX7 A;  2LZ6 A;  3VTU A;  1P98 A;  3X23 A;  4EEW A;  3WIM A;  1RRB A;  2M0X A;  4MGK E;  3VTW A;  3CMM B;  4A3O A;  4K7S A;  5IA7 A;  1P3Q U;  3A33 B;  2MRP A;  5IAA C;  3ML8 A;  2ZPY A;  3RZF A;  2CS4 A;  4GXB A;  2OJR A;  1UGM A;  3TBL D;  3KYC D;  3EEC A;  2VRR B;  4K1R B;  2CHZ A;  1WJ4 A; 
#chains in the Genus database with same CATH topology
 2KMC A;  3U2S C;  3V05 A;  3BY4 B;  1C79 A;  1N5X A;  4LLG M;  2PPH A;  1KLU D;  4W9D A;  2GMI C;  4OW0 A;  1PDX A;  2PE9 A;  2K9X A;  2K8H A;  2MJD A;  3TSS A;  3DQV A;  2J0M A;  4FLH A;  3TIX A;  3U7Z A;  4HK2 A;  5AZG A;  2J4X A;  4MEL A;  3BYT B;  3M3J A;  2OED A;  4M02 A;  2IND C;  2JSV X;  2LXA A;  1V9J A;  2K22 A;  3B2F A;  4HKQ A;  1LM8 B;  2N7D A;  2SAK A;  2JZP A;  2H88 B;  2G3Q B;  2KN4 A;  4B6W A;  2BPS A;  3O65 B;  4PT5 A;  3VRB B;  2KDF B;  1JRO A;  5FK9 C;  5HHD G;  4BFR A;  1Z2M A;  1J8C A;  4RCO A;  4ANW A;  1N62 A;  4C7Y A;  2RDH A;  1S1Q B;  5IKC M;  2GBR A;  2LJI A;  2L0F A;  4IDI A;  3PLU A;  2JRH A;  3PVL A;  1C3T A;  1ZKH A;  4RM9 A;  4ZRP A;  3WA0 A;  2MBO A;  3DWG C;  4MSQ B;  2K6D B;  4HLE A;  3BVZ A;  3R7Q A;  2XK5 A;  1RYJ A;  2MEK A;  1NI3 A;  2BB6 A;  3DVN U;  1EWC A;  2D10 A;  3MC9 A;  4P16 A;  3HVZ A;  1CJE A;  2L52 A;  3AU4 A;  4LNK A;  3CWI A;  1D5X C;  2LI5 A;  2WXJ A;  3UIO B;  3N20 C;  1TZO A;  4B95 A;  1JRU A;  2IZV B;  3TUO A;  2BS3 B;  2HE7 A;  3SEB A;  1FCL A;  3ZTC A;  3ZGZ A;  1TT5 B;  4ICV A;  4GB9 A;  3QQ8 B;  3MC8 A;  3SFE B;  5JHA A;  4WAA A;  3RUI B;  3DPD A;  2V1Y A;  4C4V A;  1I4R A;  4BOS C;  1I4Q A;  2L8J A;  4WJQ A;  2C5L C;  1S3S G;  4DHJ D;  2K8B A;  4EE2 A;  3PRM B;  3NOB A;  4JGH B;  1ISN A;  5IP4 D;  2DYB A;  2CU1 A;  1TKG A;  1U4A A;  2LWP A;  2PVG C;  1KOT A;  2PMV A;  1MG8 A;  2IY0 B;  3ETR A;  3P2B A;  1J19 A;  4JWS C;  4EZK A;  5E6P A;  4MDK E;  2IJ0 A;  2KMA A;  4W9F A;  5JHB A;  2PLP A;  2XBB C;  4MEM A;  3H1U A;  3ZKJ C;  3GS2 A;  1E7P B;  1RFA A;  1XLQ A;  3T3N A;  2KVZ A;  4IUM B;  5J18 A;  1WYW B;  1I42 A;  4YXD B;  5JXV A;  2Y5B B;  1V86 A;  4LTU A;  4B0M A;  3NVZ A;  3AEB B;  2M56 B;  1IP9 A;  3MJ5 A;  3AE8 B;  5EE0 A;  3BII D;  2DZM A;  3N1Z C;  1J7B A;  1ZGU B;  2D3A A;  1WGY A;  2KFJ A;  1V1P B;  4KV2 A;  5D6J B;  4US8 A;  1T0S C;  2INC C;  1SIJ A;  4FA6 A;  2X8X X;  2DYM A;  5EE3 A;  1KFY B;  2UYZ B;  1C4P A;  1ZUD 2;  4KDL B;  3QIJ A;  2KWD A;  2LHE A;  2WYQ A;  4L23 A;  4HDO A;  1L4D B;  2OHF A;  4NPN A;  5D2M B;  2WXL A;  2XNA C;  2PTL A;  4WWP A;  5JZE B;  1L7Y A;  1YJ1 A;  2Y5P A;  3OWE B;  1RLF A;  2EMT A;  3RNE C;  2KQ4 X;  1PFD A;  4BAX A;  2G4S A;  3ZNZ B;  1C4A A;  3P4S B;  1C4C A;  4I6L B;  2JF5 A;  3GE8 C;  4KVG B;  2WDQ B;  5EE9 A;  2YVC A;  2G4D B;  4HJK A;  1SJH D;  3AI5 A;  3PO0 A;  4ZHO A;  4MT5 A;  2D2Q A;  2K1F A;  3BWU D;  2ZVN A;  4AP4 C;  4M8N A;  1E0Z A;  4BBN C;  4TSS A;  3IT4 B;  1J0G A;  2KFK A;  2QHO A;  2ZCB A;  3PSE B;  5IOI A;  3GZN B;  2K0P A;  1ACC A;  3X0W A;  1YX6 B;  5EE1 A;  3GZN I;  1E90 A;  2W54 A;  2D3G A;  1WM2 A;  2MX2 A;  2MLB A;  4JX1 C;  2WDV B;  4P1C C;  1JW9 D;  2QC8 A;  2KC1 A;  1EO6 A;  1L4Z B;  1MFW A;  4IM2 A;  4YT0 B;  1TBE A;  5HKH A;  4TQ1 A;  2WQY B;  2MW5 A;  3DBL I;  4R3D A;  1I4X A;  2NBV B;  1ZXH A;  2FIF A;  3DBL B;  1JQ4 A;  1XO3 A;  2LUE A;  1E10 A;  3OAW A;  1D5M C;  3VH4 B;  3QHT A;  2MJE A;  1T0Q C;  2V4I B;  4ZHP A;  5LLI A;  3V3X A;  3B2G A;  4TV3 A;  1GG3 A;  2KWC A;  1WM3 A;  4IWP A;  3L10 B;  4WH4 A;  5E6J A;  3Q69 A;  5FR3 A;  4HKZ E;  3ZIM A;  1FXI A;  3ZUN A;  1SF0 A;  4C00 A;  4XDD A;  2N1V A;  4IOI E;  2C7N B;  2KX3 A;  3PT2 B;  1ENF A;  1HE8 A;  2KTF A;  1T6B X;  5DCN A;  1ZOY B;  3UIP B;  2DZJ A;  4WAF A;  4NAW B;  4HCN B;  3UIN B;  4L1B A;  3WAL A;  4WUR A;  2L1A A;  4WJN A;  3U30 A;  4MGI E;  3DHH C;  1KJT A;  1E7V A;  2W9N A;  3IAM 1;  1NEN B;  1WE6 A;  5GXG B;  4D2K A;  1KH0 A;  3TEZ A;  3Q3N C;  5FKA C;  3EC8 A;  4FJZ A;  1HA5 A;  4LDT D;  3NVY A;  3FAH A;  4UDU C;  3ZLZ A;  2RPQ A;  3ZRC A;  2JUO A;  4XE0 A;  2WU2 B;  5DPS A;  3VTV A;  2KJH B;  2B76 B;  2JU6 X;  3DBR B;  3NVV A;  1BML C;  3AN1 A;  1TS2 A;  4ZYS A;  3LB8 C;  2DWQ A;  3IAS 1;  3H8H A;  1ZPS A;  4L2Y A;  4A20 A;  3QA8 A;  3URY A;  1WGR A;  1BT0 A;  4YTP B;  1P9D U;  1Q1O A;  2ZW0 A;  1FXT B;  2ZW1 A;  5AZH A;  2WX1 A;  1WXS A;  3HRD D;  4KKJ A;  3AEG B;  4MGK E;  1TKY A;  1GB4 A;  1VRA B;  4US9 A;  5IA7 A;  4GXB A;  3IT6 B;  1UGM A;  3SFD B;  3EEC A;  4ZRQ A;  4CO7 A;  1EUV B;  4P1B C;  4KIK A;  3SR6 A;  4JIO U;  2KZR A;  2V3P A;  4ANU A;  1JWS D;  1P7E A;  2K8C A;  2BYE A;  3AE7 B;  1OQY A;  4MSM B;  3KUC B;  4W9G A;  3H7P B;  4KSL C;  4MM3 B;  2NPT B;  3NUH B;  3BYY B;  1HXY D;  2IGD A;  3Q3F A;  3B0A A;  2IDY A;  3H9D A;  3EFU A;  5IO9 A;  3M95 A;  4YTN B;  5DPT A;  1H4R A;  5CHV C;  3APC A;  1WJN A;  3BIN A;  1L0X B;  3VDZ A;  4XWW A;  1R4N I;  2G1E A;  4RGM A;  1F0Z A;  4DXG A;  1RFK A;  4ANV A;  3OJ3 A;  2J42 A;  2EEL A;  3VR8 B;  1FRD A;  4WQO B;  2QIL A;  4GDK A;  4RF0 A;  2HD5 B;  1V2Y A;  1LO5 D;  1GPX A;  1QIL A;  1LGR A;  1AAR A;  4LK0 M;  1EU3 A;  2RSU A;  5AUK A;  4TQ0 A;  3HUI A;  3V60 A;  4ZYN A;  3L17 A;  4WIP A;  2BBC A;  3AE6 B;  2KN5 A;  4N59 A;  2JT4 B;  3TCA A;  5C3J B;  2INP E;  3PRZ A;  5LNK 1;  2RDG A;  1DGJ A;  4M01 A;  3QJZ A;  3AU5 A;  3Q3J A;  4IWQ A;  3V62 A;  1E8W A;  1TTN A;  2I2Y A;  4RNA A;  2Y3A A;  3RUL A;  1A5R A;  1HEZ E;  4WWN A;  4ZRJ A;  3HHM A;  4A6Q A;  1I35 A;  2FCM A;  1FXA A;  1YN3 A;  1NEK B;  4ICU A;  3R2T A;  1JWM D;  1YX5 B;  1B1Z A;  3EUB 2;  1AYF A;  5H8Y E;  2DYO A;  3Q8E A;  3ZW3 A;  3KW5 B;  1UBQ A;  1DYQ A;  5AUI A;  2DEN B;  3V6E B;  3HM6 X;  3QC8 B;  1K53 A;  3EFC A;  2M4N A;  1GAQ B;  3WAP A;  3B9J A;  1VZ6 A;  3P63 A;  2UU7 A;  2A4Z A;  1OQR A;  2IGH A;  4JWU C;  1ZDV A;  1HZ5 A;  2XEW A;  2WXN A;  1WSP A;  4YWG G;  3N3K B;  3PHX B;  3AEA B;  2V0G A;  4HCP B;  2OJW A;  2BYF A;  2W3R A;  1IGD A;  1E8Y A;  3WAO A;  4LCD E;  1XEE A;  1GC6 A;  1UH6 A;  4AWJ A;  1YMH E;  1C76 A;  1QLB B;  4NNJ B;  4E71 A;  1WGH A;  1K50 A;  1XCT L;  2RR9 A;  3B1L X;  4XDC A;  5CHW A;  2Z0E B;  4TMA B;  2JQR B;  3EHV A;  2M1M A;  3AEC B;  3CIR B;  4I6P A;  1X1M A;  2W82 A;  1UZX B;  4BKT A;  5EDS A;  4PK1 A;  5HFY A;  1QOA A;  1GOZ A;  5TR5 A;  1F77 A;  2XK5 B;  5AZF A;  1UBI A;  2BS4 B;  3JYU A;  3SDL C;  1WGG A;  1L6U A;  3N1Y C;  2KJ6 A;  2MSE D;  1FCC C;  3NJT A;  2KWV B;  3Q3O C;  1I4H A;  4WJO A;  1YJJ A;  2L7R A;  1TIF A;  2EKI A;  3KYD D;  4JL9 A;  3TEY A;  1L2N A;  1V5O A;  1UUP A;  2CHX A;  4M0W A;  3AE9 B;  2EMS A;  2GOW A;  3PRP B;  5AEK B;  2AL6 A;  1NVI D;  3ONS A;  1JML A;  4HPM B;  3VXW A;  4E74 A;  3BZD B;  3P4R B;  1WGD A;  1WXV A;  3HM3 A;  4KZC A;  1E5W A;  2WDR B;  5J17 A;  3V61 A;  4ASW C;  4RMA A;  1V49 A;  2E6X A;  3RNC C;  4CHK A;  5C23 A;  4RGN A;  2ON8 A;  1XLP A;  2FID A;  2NTT A;  3C8Y A;  2L76 A;  1WRI A;  5J2R A;  1NI2 A;  5G2N A;  4YSZ B;  2D5G A;  3RYT A;  4E3C A;  3N32 A;  3DBS A;  4N6E B;  4W9H A;  3BVM A;  3AUL A;  2IO0 B;  1Q5W B;  4GLS C;  3PV1 A;  2KFK B;  1HZ6 A;  2J53 A;  3RMK C;  3V6C B;  4W9I A;  1XXG A;  3VVW B;  4CQN A;  3W9C B;  2V4L A;  2V9H A;  4XGA B;  1E8X A;  2AQ2 B;  2X38 A;  3QAQ A;  1EF1 A;  5GMV A;  1LQB A;  1QF6 A;  2DX5 B;  4GN1 A;  4LJP B;  2KX0 A;  1E8Z A;  4NJ6 A;  1UGJ A;  2KDB A;  4A90 A;  3I57 A;  2WXP A;  1M4V A;  2JVC A;  4XC2 A;  3A9K B;  4PYZ A;  3L08 A;  2GBJ A;  2FCS A;  1KLG D;  1FD6 A;  1MPE A;  2Q5W D;  3IFW B;  1FIQ A;  5KHQ A;  3UQB A;  1FNW A;  3DBH B;  4HVB A;  4XYC A;  5IN7 A;  3AM9 A;  1WXQ A;  3DBH I;  4BZA A;  4HWI B;  2N9L A;  3CSF A;  2J52 A;  1TS4 A;  1K51 A;  1WMH B;  5G5H A;  4EFO A;  2L05 A;  3A4S C;  3OJ4 B;  2KAC A;  4MAC A;  3RNB C;  3VRA B;  2CR5 A;  2CU3 A;  2MHJ A;  4W9K A;  4OHJ A;  5E6N A;  5T8I A;  4A8X C;  1FNU A;  3L54 A;  2KXJ A;  4EKU A;  1K8R B;  1Y56 A;  2BGF A;  2D07 B;  1D4B A;  2KD0 A;  1WRD B;  1EWY C;  1YQB A;  3W1S C;  1RM6 C;  2QSD A;  2N9K A;  2PVO D;  4P6V F;  3EGR A;  2ONQ A;  2CKH B;  3KWL A;  3K9O B;  4NZL B;  1STE A;  2FCN A;  1SB3 C;  1DOX A;  3MC0 B;  1ZE3 D;  2V3S A;  3VTU A;  1P98 A;  3X23 A;  4EEW A;  3ABV B;  1ZDX A;  2KAJ A;  3VTW A;  3RNA C;  1OQQ A;  4A3O A;  1MG4 A;  5IAA C;  3A33 B;  2MRP A;  2CS4 A;  3KLS X;  1KTK A;  4OZC A;  4YTM B;  3KYC D;  4K1R B;  2CHZ A;  1T0Y A;  1HTO A;  3E9S A;  3QCA A;  5KHO A;  2KDM A;  3FIL B;  2N7E A;  2ZPN A;  2PJH A;  3DCG A;  4OVV A;  5HG2 A;  2MBB B;  4JE3 B;  2MBE A;  3P1M A;  5LXI B;  5G55 A;  1LFD A;  3PS6 A;  2N9P C;  1JCK B;  2C7M B;  2I1K A;  2LAS A;  3JSV B;  2PIA A;  4FN2 A;  3DWM A;  2DBY A;  1PYW D;  3L4P A;  2GLS A;  1E7U A;  1QQR A;  4NAM A;  4II2 B;  3NS1 A;  2ZNV B;  3RFZ B;  2MP2 A;  4DDI D;  5BMH A;  1XQQ A;  3GB1 A;  2N9E B;  2DZI A;  1TKE A;  2NPT A;  1TZ1 A;  2KLC A;  3Q14 C;  1DOI A;  3R66 C;  5BYS A;  4GOC A;  4A9A A;  2KAN A;  3SD5 A;  3O13 A;  5I4D A;  4C56 C;  3VUY A;  3A4R A;  3M63 B;  2KDE B;  1JRP A;  2D3C A;  3U4E G;  4JLC A;  4BKG A;  4HDQ A;  4XWT A;  3RCZ A;  3PZD A;  2D11 A;  4TKN A;  1QKZ A;  4C80 A;  1FFV A;  2KQ7 A;  1D6E C;  1FEH A;  3CF6 E;  3NY5 A;  2DHZ A;  3R7R A;  4W9J A;  3GOE A;  1KRH A;  1UWM A;  4MGY E;  3ZNG C;  4MH8 A;  4P7I A;  3NZU A;  1XLN A;  1WH3 A;  1V80 A;  4PS8 A;  4W9L A;  5MPO A;  1OFF A;  1YQ3 B;  2L0T A;  4G11 A;  1FPY A;  2QMT A;  3Q6B A;  2Z59 B;  3W5V B;  2PW9 A;  3C0R B;  2BYT A;  4ZRI A;  3GE3 C;  4G0N B;  2NCN A;  2I38 A;  1JWA D;  3NZS A;  2GBM A;  2LGS A;  4DK5 A;  4DBG A;  1F2R I;  3LJ3 A;  1EM7 A;  4FJV B;  2M19 A;  4JPS A;  4NJC A;  4KDI C;  2WXH A;  1Z5S B;  2I1J A;  1TY2 A;  4HXD A;  3VUW A;  3P4Q B;  1VZ7 A;  2LMC A;  2WHI A;  1UWX A;  2OOB B;  4NAW A;  3W5U B;  1UD7 A;  4HRO A;  4J6I A;  4EUT A;  2L3Z A;  2TSS A;  2DAF A;  1WIA A;  2W3S A;  2L00 B;  2MWS B;  4CYE A;  1WJU A;  2R61 A;  1T3Q A;  3H7S A;  3TL5 A;  1WI0 A;  4AQ7 A;  1NDD A;  2NR2 A;  3ZJT A;  2KHW B;  4ITK A;  2FUG 1;  1WX9 A;  3AXC A;  4DHZ E;  3C19 A;  2K6Q A;  3QX1 A;  2KYW A;  4MM3 A;  2KTR B;  3MHS D;  2E3T A;  1YOV B;  2O6V D;  4KGR A;  2WXI A;  1PUT A;  3L16 A;  1F1H A;  4EZL A;  1FM0 D;  2C7H A;  1J7C A;  2O6V B;  3Q2A C;  3K9P B;  1C77 A;  3VQI A;  2AQ1 B;  2KQS A;  3PGE A;  1PGA A;  2C60 A;  1VLB A;  1T0R C;  1ESF A;  3ZO5 B;  2XN9 C;  3I3T B;  3AE3 B;  3J9C A;  2JRI B;  3NRZ A;  1WFY A;  2LGI A;  3AV8 A;  1V97 A;  5G5G A;  2KOX A;  3I63 C;  1C1Y B;  1FO4 A;  1XT9 B;  2VZK D;  2NBW B;  1ZW7 A;  1L0V B;  2VH1 A;  4IM0 A;  2BYV E;  4IWO A;  1TGZ B;  4TUU A;  3UQA A;  4ARC A;  2PE6 B;  2AL3 A;  1BUI C;  3VFK A;  4HRS A;  1QOB A;  2N9X A;  3AE4 B;  2QJL A;  2GRI A;  4NJ7 A;  4I6N B;  3L0W B;  1SE3 A;  1Q10 A;  4WQM A;  1VCB A;  3WAM A;  5D94 A;  1TJE A;  3DVG Y;  4IW0 A;  2JX5 A;  2WXG A;  4DHZ B;  2J0J A;  4A3P A;  2BWE S;  4YSY B;  2WNM A;  2K25 A;  4F8C B;  2BF8 B;  3NS8 A;  4FHJ A;  5JH5 C;  3QWZ B;  1J7A A;  3AED B;  4N9F 4;  2LVP A;  4LNN A;  1V5T A;  4K81 A;  4DQO C;  3W1S A;  3UGB B;  1F2R C;  4EOY A;  4ZRK A;  3UF8 A;  4YL8 A;  5BYQ A;  4AOF A;  4C4V B;  1SGH A;  3VHT C;  2LXC A;  1WYG A;  4FBJ B;  4LNI A;  1L6V A;  4MJS A;  2DLB A;  3A9J B;  3PRE A;  2YEP B;  2M8S A;  3ML9 A;  3T9L A;  3NG0 A;  1IBX A;  4WWO A;  1R4M I;  1SXT A;  2MH7 A;  3WAN A;  5HI1 A;  5C1Z A;  3DBR I;  1N5W A;  5CX3 A;  4QAY A;  3H7P A;  1WE7 A;  2JWU A;  3RD2 A;  2Z8L A;  4FAD A;  2AWT A;  3OLM D;  4RM8 A;  4B0E A;  4LNF A;  3FIL A;  4S0R A;  1WGK A;  1MHX A;  4K7W A;  3IVF A;  1V1O A;  4AJY B;  1YJI A;  4RGT A;  2GB1 A;  2KT7 A;  2VZK B;  3QK0 A;  2FUH B;  4BVU C;  5L83 A;  1WXM A;  3Q8B A;  1WXA A;  2LGD A;  1EF5 A;  2CJO A;  2WGS A;  3N9Y C;  3A9K A;  2SEB D;  5TSS A;  3KQ4 A;  3ZDM C;  1IBX B;  2RDB C;  2HJ8 A;  4AJW A;  2BW2 A;  1V81 A;  3MHZ A;  1F9J A;  2WDT B;  2J0K A;  2MP2 B;  4KZ0 A;  2QCZ A;  4DXA B;  4GIV A;  4ZOH C;  4G3X B;  1GJZ A;  3Q3M C;  1LXD A;  3IBE A;  1MI0 A;  1WJ4 A;  1OGW A;  2WXO A;  1FRR A;  3HK0 A;  2KO3 A;  3ZQ4 A;  2BQQ A;  2ZJD A;  5H92 C;  2IO1 B;  2BTE A;  2WP9 B;  1JWB D;  1MHH E;  4O1N A;  2K3U A;  2LEK A;  1N63 A;  2MBQ A;  2EKE C;  2BB5 A;  3FKY A;  3LDZ E;  4IKG A;  4DDG D;  1R4N B;  4WJP A;  4URK A;  1IYF A;  2FE8 A;  2JPH A;  4WWM A;  5D3I B;  4G50 A;  2M0A A;  2Z0D B;  1B9R A;  3AE2 B;  2ICI A;  2KMM A;  2MA9 B;  4KSK C;  2N1W A;  5DPR A;  1WX7 A;  4RH6 A;  3HVD A;  2M0X A;  3CMM B;  3U52 E;  1CZP A;  4K7S A;  1FMA D;  1P3Q U;  1TY0 A;  3ML8 A;  3GP7 A;  2ZPY A;  1YN4 A;  3TBL D;  1VZ8 A;  4HJG E;  2MJ3 A;  1RWS A;  1KM7 A;  3DHI C;  1WWT A;  4NQK E;  1M94 A;  4AUQ C;  1WR1 A;  3DVN V;  2O2V A;  4ZDV A;  3KH0 A;  3TEW A;  3Q8A A;  1SSN A;  2W55 A;  4XZ4 A;  2CHW A;  2KC2 A;  4OVU A;  2RPV A;  1SE2 A;  1Q0W B;  2WWZ A;  4GU2 A;  1E6E B;  1FNV A;  2KK8 A;  2QIE B;  2GBK A;  2PKO A;  3OG5 A;  3WCQ A;  2WXK A;  3KUZ A;  3U7D A;  2CJN A;  2WXF A;  2BWF A;  2IO3 B;  3DHG C;  2JYE A;  2MCN B;  4XX5 A;  1GB1 A;  3ZJU A;  2WU5 B;  2FNJ B;  3AEE B;  2BVC A;  1G6J A;  2B3A A;  3MJW A;  3N30 A;  4KGS A;  4KGT A;  3AB5 A;  4M0W B;  2ZVO A;  2LRU A;  3HIZ A;  3PHW B;  4K3C A;  1CMX B;  1VR9 A;  4HPL B;  2KKC A;  1Y8R C;  1L0Y B;  4BOZ B;  4EZJ A;  4B9K A;  3JVZ X;  4N58 A;  3PZ7 A;  1JAL A;  4X57 B;  3AE5 B;  3JW0 X;  2IGG A;  3ENE A;  4S17 A;  2RD0 A;  1SJE D;  2KTR A;  1C78 A;  1N6Z A;  2DNF A;  4K3B A;  2WXM A;  2LRW A;  1P1A A;  1SIF A;  2INN E;  4AS1 A;  3PPA A;  5LXH A;  1GUA B;  2FAZ A;  1PGX A;  3TMP B;  2GBN A;  1WY8 A;  2O2V B;  1WF9 A;  3TJP A;  2RMM A;  5E6O A;  3R2I A;  3Q8C A;  1AN8 A;  1WX8 A;  2ZNV C;  2DAJ A;  3P4P B;  2YEP F;  3AMZ A;  4DXF A;  5D7G A;  1WZ0 A;  2L32 A;  1V8C A;  3R3M A;  4DWF A;  4GDK B;  4GSW A;  2NVU I;  3E56 A;  3VR9 B;  1T5X D;  5L95 C;  3BVG A;  4PS7 A;  2KDI A;  3PTF C;  1E9M A;  4PS3 A;  2KWU B;  1H8C A;  4GDL A;  4OVZ A;  1KF6 B;  4MH0 E;  4LJO B;  1XLO A;  3P42 A;  3RZW C;  2MBH A;  3S2A A;  3SU8 X;  2LD9 A;  2ZEQ A;  3RT3 B;  2WS3 B;  2LVQ A;  1XD3 B;  4OZB A;  1SE9 A;  3W2D A;  2RGF A;  3NHE B;  3RN9 C;  1R4M B;  2R2Q A;  4BKS A;  2LGY A;  1HQR D;  4FXC A;  2MQJ A;  1I4G A;  2IBI B;  2WXQ A;  2ASQ A;  3APF A;  4KIK B;  3JSV A;  3A9J A;  1WZ3 A;  1OEY J;  2IPK D;  3VUX A;  1SBB B;  2WX0 A;  3I5J C;  1PQS A;  4GMV A;  1F52 A;  4NQL B;  1WJ6 A;  3IG3 A;  2JZZ A;  3MFG A;  1YD8 U;  1BXT A;  2WXR A;  3PZ8 A;  2JXT A;  3PLV A;  3LYY A;  2K39 A;  4BBN F;  1XCQ L;  3AH7 A;  1DOY A;  2KLG A;  3ZXV A;  1I4P A;  4FJY A;  2L83 A;  1ET6 A;  1P0R A;  1QOG A;  2M17 A;  2J7Q B;  1AW7 A;  2R2O A;  1QZE A;  1OEY A;  2ACZ B;  4RFB A;  5BMG A;  2DZK A;  3AEF B;  1IPG A;  1NYQ A;  3A1Q A;  1HTQ A;  1KLV A;  1UEL A;  1FFU A;  1ZP0 B;  2UWQ A;  4ACF A;  1NYR A;  3UI3 A;  2ZCC A;  2D3B A;  1MVK A;  2G9H D;  4LDT B;  3Q8F A;  4RGO S;  3ZJV A;  3CST A;  5DPW A;  1IGC A;  3H6N A;  4ANX A;  1K52 A;  1SEB D;  3FC4 A;  3ZXR A;  2BS2 B;  1QOF A;  2BKR B;  3BK1 A;  1JWU D;  4BKS D;  3DDC B;  4IC7 B;  4REZ A;  5BYR A;  1V6E A;  2QEJ C;  3L13 A;  4ARI A;  3DOW A;  2IYD B;  5C2T B;  2VH2 A;  3SHQ A;  2A5U A;  1YNT E;  2N0S B;  5BMI A;  4FHK A;  3VAW A;  4GDL B;  1PGB A;  1OTR B;  3IHP C;  4JQW C;  2Y5C A;  2BT6 A;  2KJR A;  3U8Z A;  2PEA A;  5BO4 B;  4IM3 A;  4IG7 B;  3BK2 A;  4KX6 B;  4Q2J A;  3D32 A;  2NMQ A;  4W9E A;  2REX A;  4K7U A;  5CHF A;  3RPF C;  2LHD A;  3EA6 A;  2AX5 A;  5FR6 A;  3DVG X;  4USA A;  2LJ5 A;  3ZTD A;  2LGX A;  1YIW A;  1NBF C;  2JWZ A;  1UF0 A;  4MGZ E;  3LXF A;  3I9V 1;  1EU4 A;  1N61 A;  1UNS A;  3ZRF A;  1C9F A;  2FCQ A;  4KKI A;  2NBU A;  3T3O A;  4MJS B;  1GC7 A;  2KNB A;  2JZ3 B;  1AWD A;  2QDF A;  4RF1 A;  4F1S A;  4OZA A;  4FUL A;  3T8M A;  3N1X C;  1VJK A;  3ZYY X;  1A70 A;  1N60 A;  4DHJ B;  2KVR A;  3RNG C;  2LVO A;  2ZZP B;  2AQ3 B;  2HDE A;  3KWV A;  1YN5 A;  2C9W B;  2AEH A;  2IY1 B;  3R8B A;  2FBW B;  3IXS A;  2JYT A;  4J3O D;  3NZ3 A;  3B08 A;  1D3Z A;  5D3D A;  1L5P A;  3ZNH B;  1TS3 A;  5CTR C;  3MP9 A;  2HTM E;  3ZVV A;  4LNO A;  2JXX A;  2LUM A;  4A55 A;  2G45 B;  4GGQ A;  3A1Q B;  1D5Z C;  2HTH A;  3RI7 C;  1SE4 A;  3APD A;  2N7J A;  4II3 B;  4M00 A;  2N4F A;  2NTS A;  2NS5 A;  3KUD B;  2YLM A;  3M62 B;  1WMH A;  3NVW A;  4C7Z A;  1TYG B;  4HEA 1;  1GNU A;  4F7Z A;  2WLB A;  3W1Y A;  1ZXI A;  1YQ4 B;  3ZNI D;  4NY0 A;  3ALB A;  3KVF B;  3ECI A;  2V3N A;  1V1P A;  1P7F A;  1RAX A;  3ZDT A;  1VDV A;  3RNF C;  1MJD A;  2AYO B;  1WR6 E;  1TS5 A;  3AE1 B;  1VD2 A;  2GI9 A;  4HPP A;  2HJ1 A;  3QAR A;  1QT9 A;  1ROE A;  4W9C A;  3VH3 B;  2IO2 B;  3MTN B;  2O6V A;  2H89 B;  1CK1 A;  2BKF A;  4M8M A;  1ET9 A;  4PYU A;  1IUE A;  2JY6 A;  1I7H A;  1XF5 L;  2LZ6 A;  1CQV A;  3WIM A;  3TEX A;  4YSX B;  1RRB A;  3RZF A;  4H2A A;  2OJR A;  2K5P A;  1R7S A;  2VRR B;  2LFI A; 
#chains in the Genus database with same CATH homology
 1KM7 A;  1T0Y A;  2KMC A;  1EUV B;  3BY4 B;  4KIK A;  4NQK E;  1M94 A;  4JIO U;  4AUQ C;  2PPH A;  3QCA A;  4W9D A;  5KHO A;  2KZR A;  1WR1 A;  2GMI C;  3DVN V;  4ANU A;  2O2V A;  4ZDV A;  3KH0 A;  2K8C A;  2N7E A;  2BYE A;  2ZPN A;  2PJH A;  3DCG A;  1OQY A;  2PE9 A;  3KUC B;  4MSM B;  4OVV A;  4XZ4 A;  4W9G A;  2CHW A;  3H7P B;  4KSL C;  2MBB B;  2KC2 A;  4OVU A;  2MBE A;  2K8H A;  2NPT B;  5LXI B;  1Q0W B;  2WWZ A;  4GU2 A;  3DQV A;  2J0M A;  3Q3F A;  2KK8 A;  4FLH A;  3B0A A;  5G55 A;  1LFD A;  3PS6 A;  2N9P C;  2GBK A;  3TIX A;  3H9D A;  2C7M B;  2I1K A;  3EFU A;  4HK2 A;  5AZG A;  2LAS A;  3JSV B;  3M95 A;  4FN2 A;  5DPT A;  4MEL A;  1H4R A;  3KUZ A;  3U7D A;  5CHV C;  3M3J A;  3APC A;  2BWF A;  2IO3 B;  1WJN A;  2MCN B;  3BIN A;  4XX5 A;  1E7U A;  2LXA A;  1V9J A;  3VDZ A;  1LM8 B;  2FNJ B;  1R4N I;  2N7D A;  2ZNV B;  4II2 B;  2MP2 A;  4DDI D;  1G6J A;  2B3A A;  3MJW A;  3N30 A;  2G3Q B;  1XQQ A;  4B6W A;  2BPS A;  3O65 B;  2N9E B;  2DZI A;  4ANV A;  2NPT A;  3OJ3 A;  2KDF B;  1TZ1 A;  4BFR A;  2KLC A;  4M0W B;  1Z2M A;  2ZVO A;  2LRU A;  3HIZ A;  3PHW B;  3R66 C;  4GDK A;  4WQO B;  1J8C A;  4ANW A;  1CMX B;  2HD5 B;  4GOC A;  1V2Y A;  4HPL B;  1S1Q B;  2GBR A;  2KKC A;  2KAN A;  2L0F A;  1AAR A;  3PLU A;  3SD5 A;  1Y8R C;  2JRH A;  4TQ0 A;  2RSU A;  4BOZ B;  3VUY A;  4EZJ A;  3A4R A;  3M63 B;  2KDE B;  3PVL A;  1C3T A;  1ZKH A;  4RM9 A;  3WA0 A;  4B9K A;  2MBO A;  3JVZ X;  4ZYN A;  3V60 A;  3L17 A;  4X57 B;  4MSQ B;  2K6D B;  3JW0 X;  2KN5 A;  3ENE A;  2JT4 B;  2RD0 A;  2KTR A;  4HLE A;  4JLC A;  3R7Q A;  3TCA A;  4BKG A;  2XK5 A;  4HDQ A;  3RCZ A;  3PRZ A;  3PZD A;  2LRW A;  1P1A A;  2D11 A;  3DVN U;  1SIF A;  4TKN A;  2D10 A;  3PPA A;  2KQ7 A;  5LXH A;  1GUA B;  2FAZ A;  3TMP B;  3QJZ A;  2GBN A;  1WY8 A;  3CF6 E;  3AU5 A;  3AU4 A;  3NY5 A;  3Q3J A;  2O2V B;  2DHZ A;  3R7R A;  1WF9 A;  4IWQ A;  4W9J A;  3TJP A;  5E6O A;  3GOE A;  3V62 A;  2LI5 A;  1E8W A;  3UIO B;  4MGY E;  4B95 A;  1JRU A;  1WX8 A;  2IZV B;  3ZNG C;  2ZNV C;  2DAJ A;  2HE7 A;  4P7I A;  1TTN A;  3ZTC A;  4ICV A;  4GB9 A;  3NZU A;  3QQ8 B;  1WH3 A;  1V80 A;  4PS8 A;  4W9L A;  5JHA A;  4WAA A;  5D7G A;  3RUI B;  1WZ0 A;  3DPD A;  3RUL A;  1A5R A;  4WWN A;  4ZRJ A;  3R3M A;  2L0T A;  4G11 A;  4DWF A;  3HHM A;  2V1Y A;  4GDK B;  4GSW A;  2NVU I;  1I35 A;  2FCM A;  4BOS C;  5L95 C;  2L8J A;  4WJQ A;  4PS7 A;  2C5L C;  1S3S G;  4ICU A;  4DHJ D;  2KDI A;  3PTF C;  2Z59 B;  2K8B A;  4PS3 A;  1YX5 B;  2KWU B;  3C0R B;  4ZRI A;  3PRM B;  1H8C A;  4GDL A;  3NOB A;  4G0N B;  4MH0 E;  4JGH B;  1ISN A;  2NCN A;  4LJO B;  3NZS A;  2DYO A;  2GBM A;  3RZW C;  2DYB A;  2MBH A;  2CU1 A;  3S2A A;  4DK5 A;  3SU8 X;  1U4A A;  2LD9 A;  2ZEQ A;  3RT3 B;  3LJ3 A;  2LWP A;  3KW5 B;  3ZW3 A;  4DBG A;  1UBQ A;  1KOT A;  2LVQ A;  1XD3 B;  1MG8 A;  2IY0 B;  4FJV B;  2DEN B;  1J19 A;  3P2B A;  1SE9 A;  3V6E B;  3HM6 X;  4KDI C;  1Z5S B;  2I1J A;  3QC8 B;  4EZK A;  2RGF A;  3NHE B;  4HXD A;  3VUW A;  5E6P A;  2R2Q A;  4MDK E;  2M4N A;  2KMA A;  4W9F A;  2OOB B;  4NAW A;  3WAP A;  5JHB A;  2XBB C;  4MEM A;  1UD7 A;  4BKS A;  2LGY A;  4J6I A;  2A4Z A;  4EUT A;  3H1U A;  2L3Z A;  3ZKJ C;  2DAF A;  2XEW A;  1WIA A;  1RFA A;  2L00 B;  3N3K B;  3PHX B;  2MQJ A;  2MWS B;  4CYE A;  1WJU A;  4IUM B;  5J18 A;  4HCP B;  1WYW B;  2BYF A;  1I42 A;  2IBI B;  3H7S A;  3TL5 A;  1E8Y A;  2ASQ A;  2Y5B B;  1WI0 A;  3APF A;  3WAO A;  1V86 A;  1NDD A;  4KIK B;  2NR2 A;  4LCD E;  3JSV A;  3A9J A;  1WZ3 A;  1OEY J;  3VUX A;  2KHW B;  2WX0 A;  1GC6 A;  1IP9 A;  1UH6 A;  1WX9 A;  3AXC A;  4AWJ A;  4DHZ E;  1PQS A;  4GMV A;  4NQL B;  1WJ6 A;  3IG3 A;  2JZZ A;  2K6Q A;  3QX1 A;  1YD8 U;  4MM3 A;  4NNJ B;  4E71 A;  1WGH A;  2DZM A;  1ZGU B;  2RR9 A;  1WGY A;  3B1L X;  3PLV A;  2KFJ A;  2K39 A;  5CHW A;  2KTR B;  4KV2 A;  2Z0E B;  4BBN F;  5D6J B;  3MHS D;  2KLG A;  2O6V D;  4FJY A;  3EHV A;  1P0R A;  2M17 A;  4FA6 A;  2J7Q B;  2M1M A;  3L16 A;  2R2O A;  2DYM A;  4EZL A;  1QZE A;  2C7H A;  2O6V B;  3K9P B;  1OEY A;  4I6P A;  3VQI A;  1X1M A;  2KQS A;  2UYZ B;  3PGE A;  2C60 A;  2DZK A;  1UZX B;  1IPG A;  3ZO5 B;  4BKT A;  3A1Q A;  5EDS A;  1KLV A;  1UEL A;  3I3T B;  2JRI B;  4KDL B;  1WFY A;  2UWQ A;  3QIJ A;  5TR5 A;  2WYQ A;  2KOX A;  2ZCC A;  2XK5 B;  1C1Y B;  4HDO A;  1XT9 B;  5AZF A;  1UBI A;  2NBW B;  3JYU A;  4NPN A;  5D2M B;  3SDL C;  1ZW7 A;  1WGG A;  4IM0 A;  4WWP A;  5JZE B;  4LDT B;  2KJ6 A;  1L7Y A;  2BYV E;  2MSE D;  1YJ1 A;  4IWO A;  1TGZ B;  4TUU A;  1RLF A;  2EMT A;  3UQA A;  3CST A;  2KWV B;  5DPW A;  3H6N A;  2G4S A;  2PE6 B;  2AL3 A;  3ZNZ B;  4ANX A;  4I6L B;  4WJO A;  2JF5 A;  4KVG B;  3VFK A;  2L7R A;  2YVC A;  2G4D B;  2N9X A;  4HJK A;  3AI5 A;  3KYD D;  4JL9 A;  4NJ7 A;  4I6N B;  2D2Q A;  2K1F A;  3L0W B;  1L2N A;  1V5O A;  2CHX A;  2BKR B;  1VCB A;  3WAM A;  2ZVN A;  2EMS A;  5D94 A;  4AP4 C;  4M8N A;  4BKS D;  2GOW A;  3DDC B;  3DVG Y;  3PRP B;  4IC7 B;  4IW0 A;  4BBN C;  4DHZ B;  2J0J A;  5AEK B;  4A3P A;  2AL6 A;  1J0G A;  1V6E A;  2KFK A;  3ONS A;  2BWE S;  2QHO A;  3L13 A;  2K25 A;  4F8C B;  2BF8 B;  2ZCB A;  3DOW A;  3PSE B;  2IYD B;  4HPM B;  3NS8 A;  3VXW A;  4E74 A;  3SHQ A;  3X0W A;  2A5U A;  4FHJ A;  1YX6 B;  1WGD A;  1WXV A;  3HM3 A;  5JH5 C;  3QWZ B;  4FHK A;  3GZN I;  3VAW A;  4GDL B;  4KZC A;  4N9F 4;  1OTR B;  2LVP A;  1E5W A;  3IHP C;  4JQW C;  1V5T A;  4K81 A;  5J17 A;  1E90 A;  3V61 A;  2D3G A;  4ASW C;  4RMA A;  1V49 A;  1WM2 A;  2KJR A;  3U8Z A;  2MX2 A;  4CHK A;  2PEA A;  5C23 A;  5BO4 B;  3W1S A;  3UGB B;  2MLB A;  4IM3 A;  4IG7 B;  2FID A;  3D32 A;  4EOY A;  4ZRK A;  3UF8 A;  4W9E A;  4YL8 A;  2REX A;  4AOF A;  2L76 A;  4K7U A;  5J2R A;  1NI2 A;  5G2N A;  5CHF A;  1SGH A;  3VHT C;  2KC1 A;  1EO6 A;  2LXC A;  3RYT A;  4E3C A;  3N32 A;  3DBS A;  4IM2 A;  5FR6 A;  4FBJ B;  3DVG X;  1TBE A;  2LJ5 A;  3ZTD A;  5HKH A;  2LGX A;  4TQ1 A;  1YIW A;  4W9H A;  1NBF C;  2JWZ A;  2MW5 A;  3DBL I;  4MGZ E;  3AUL A;  4MJS A;  2IO0 B;  3A9J B;  2NBV B;  1Q5W B;  3ZRF A;  2FCQ A;  3PRE A;  2FIF A;  2M8S A;  3PV1 A;  2NBU A;  4MJS B;  1GC7 A;  2KFK B;  2KNB A;  3ML9 A;  2LUE A;  3V6C B;  3T9L A;  3OAW A;  2JZ3 B;  4WWO A;  1R4M I;  3QHT A;  4W9I A;  3VH4 B;  3VVW B;  3WAN A;  4F1S A;  2V4L A;  4FUL A;  5C1Z A;  3T8M A;  3DBR I;  5CX3 A;  1E8X A;  5LLI A;  3H7P A;  1WE7 A;  4DHJ B;  2KVR A;  3RD2 A;  4TV3 A;  3QAQ A;  2KWC A;  1GG3 A;  4FAD A;  1WM3 A;  2AWT A;  1EF1 A;  2LVO A;  3OLM D;  2ZZP B;  4IWP A;  3L10 B;  4RM8 A;  5GMV A;  2C9W B;  1LQB A;  2DX5 B;  4GN1 A;  2AEH A;  4LJP B;  2KX0 A;  1E8Z A;  4K7W A;  3IVF A;  3ZIM A;  4CO7 A;  3ZUN A;  4AJY B;  2IY1 B;  4NJ6 A;  2N1V A;  2KDB A;  2C7N B;  2KX3 A;  1D3Z A;  3B08 A;  3PT2 B;  1HE8 A;  2KTF A;  3ZNH B;  5DCN A;  3QK0 A;  2FUH B;  3UIP B;  2JVC A;  5CTR C;  4XC2 A;  4BVU C;  5L83 A;  3ZVV A;  1WXM A;  2DZJ A;  3A9K B;  4PYZ A;  2JXX A;  1WXA A;  2LGD A;  3L08 A;  2GBJ A;  4NAW B;  4HCN B;  1EF5 A;  2FCS A;  3UIN B;  3WAL A;  2G45 B;  4WJN A;  3A9K A;  3U30 A;  4MGI E;  1KJT A;  3A1Q B;  1E7V A;  2W9N A;  4GGQ A;  3ZDM C;  3IFW B;  2HJ8 A;  1WE6 A;  2HTH A;  4AJW A;  5KHQ A;  1V81 A;  3APD A;  3UQB A;  1F9J A;  2WDT B;  2J0K A;  2MP2 B;  2N4F A;  4II3 B;  2NS5 A;  4KZ0 A;  4HVB A;  3KUD B;  2YLM A;  3M62 B;  1WMH A;  4DXA B;  4GIV A;  3DBH I;  4G3X B;  4HWI B;  3EC8 A;  4FJZ A;  1GJZ A;  1LXD A;  3CSF A;  3IBE A;  1GNU A;  4F7Z A;  1WMH B;  3W1Y A;  3ZNI D;  4NY0 A;  2L05 A;  3A4S C;  3ALB A;  3KVF B;  3ECI A;  3OJ4 B;  4LDT D;  4EFO A;  1RAX A;  2CR5 A;  3ZDT A;  1OGW A;  4W9K A;  5E6N A;  3HK0 A;  2AYO B;  3L54 A;  1WR6 E;  3ZLZ A;  2RPQ A;  3ZRC A;  2KXJ A;  2JUO A;  2KO3 A;  4EKU A;  1K8R B;  5DPS A;  1VD2 A;  3VTV A;  2D07 B;  2BGF A;  2KJH B;  2ZJD A;  2KD0 A;  1WRD B;  2IO1 B;  1YQB A;  3W1S C;  3QAR A;  4W9C A;  3VH3 B;  2IO2 B;  2MBQ A;  2EKE C;  3LDZ E;  2CKH B;  3MTN B;  4DDG D;  4WJP A;  4A20 A;  2O6V A;  3QA8 A;  4URK A;  1IYF A;  2JPH A;  3K9O B;  1WGR A;  1BT0 A;  1P9D U;  4G50 A;  1Q1O A;  2Z0D B;  2FCN A;  2BKF A;  1FXT B;  5AZH A;  4M8M A;  2WX1 A;  1WXS A;  2V3S A;  2MA9 B;  4KSK C;  4PYU A;  2JY6 A;  2N1W A;  5DPR A;  1WX7 A;  2LZ6 A;  3VTU A;  1P98 A;  3X23 A;  4EEW A;  3WIM A;  1RRB A;  2M0X A;  4MGK E;  3VTW A;  3CMM B;  4A3O A;  4K7S A;  5IA7 A;  1P3Q U;  3A33 B;  2MRP A;  5IAA C;  3ML8 A;  2ZPY A;  3RZF A;  2CS4 A;  4GXB A;  2OJR A;  1UGM A;  3TBL D;  3KYC D;  3EEC A;  2VRR B;  4K1R B;  2CHZ A;  1WJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...