3QC8B

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
EPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Transitional endoplasmic reticulum ATPase
publication title Crystal structure of FAF1 UBX domain in complex with p97/VCP N domain reveals a conformational change in the conserved FcisP touch-turn motif of UBX domain
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qc8B00
3APFA 4IUMB 4DDID 2O2VB 3DPDA 4GDLB 4DXAB 3DVGX 3B08A 3L10B 4WJNA 5GMVA 2KJRA 3DCGA 2JRHA 3UIPB 4LJOB 3LDZE 4FJZA 5D7GA 2KLCA 2IO0B 2L8JA 4G50A 4WAAA 4LJPB 2O6VB 2M17A 2WDTB 4W9LA 5DCNA 5FR6A 1KOTA 4WWOA 2M8SA 3WAOA 3M95A 2MQJA 4E71A 2IY0B 3QK0A 2WX0A 5DPRA 3QJZA 3TMPB 3L08A 3QHTA 3H9DA 1V49A 4MSQB 3ZKJC 3M62B 3IFWB 4KV2A 5JHBA 1BT0A 2G45B 4FHKA 1S3SG 2I1KA 2LWPA 2PPHA 2N4FA 3TJPA 3H7PB 4CHKA 3I3TB 5JHAA 1QZEA 2FCNA 4KSLC 1WGYA 1NBFC 4ZDVA 2KMCA 2DX5B 1HE8A 1P1AA 2GBJA 2KFJA 2LUEA 3ZNHB 4KZ0A 1PQSA 3L13A 2ZPNA 1R4NI 2HJ8A 4GGQA 2BYVE 4TUUA 1T0YA 3R66C 4MSMB 4ASWC 2CKHB 2BF8B 1ZGUB 3SD5A 4JQWC 4A3PA 2L3ZA 4NNJB 1KLVA 4WWNA 1WGDA 3M3JA 4HWIB 4ICUA 2KTFA 2AWTA 2K39A 4II2B 1V2YA 3VH4B 3VTWA 1H8CA 4F7ZA 2M0XA 2KFKB 4ANUA 4IM0A 2HD5B 4TQ1A 2JPHA 1UBQA 3ZRCA 2OOBB 3A9KA 1EF1A 3U8ZA 2FIFA 3H6NA 3KUCB 2MP2A 5AZHA 2AEHA 4A20A 2KX3A 4BOSC 1IPGA 3HK0A 2KNBA 1IYFA 3ENEA 2FAZA 2ZZPB 2WX1A 5AZGA 3QARA 3ECIA 2N7EA 4HXDA 4IWQA 5DPSA 3A4RA 4G3XB 3PRPB 2MBEA 2ZCCA 4IC7B 1E8WA 1MG8A 4MEMA 2J7QB 3DQVA 4NQLB 2BKFA 2O6VD 1WJUA 1XT9B 3DVNU 1I35A 4DK5A 3VTVA 4WJQA 4M0WB 3H1UA 3AU4A 3CSTA 3VUWA 2L0FA 3ZRFA 3APCA 2CHZA 2MBBB 5LXIB 1ZKHA 2GBMA 4ANXA 4HPLB 1OEYA 3DBLI 4GXBA 3BINA 2MBOA 3IG3A 2R2OA 1E7UA 3KYDD 4FHJA 4CYEA 1WGHA 2JT4B 2V3SA 2NS5A 2OJRA 5J18A 1RFAA 4ZYNA 2QHOA 1K8RB 1NI2A 2FIDA 4TV3A 4K7UA 3VXWA 3TIXA 5HKHA 3AU5A 3L17A 2JWZA 3OLMD 5KHOA 2ZCBA 4IW0A 3X0WA 5CHWA 4ANVA 2XK5B 3HIZA 4I6PA 2N9PC 2KJ6A 4HDQA 3RULA 4HVBA 2CS4A 4IWOA 1LQBA 3EHVA 4AOFA 3OAWA 1Q5WB 3PLVA 1E8ZA 3QWZB 3ZDTA 2FNJB 2KC2A 3PHXB 2KDIA 3RD2A 2BPSA 4MJSA 5AZFA 2AL3A 2K8CA 2KDBA 4LDTB 1YQBA 2J0JA 5DPWA 4B95A 1X1MA 2JF5A 2N9EB 3ZUNA 4DHJB 4NAWB 4IG7B 3IBEA 3WANA 4GDKA 3AI5A 3RUIB 2NPTA 3WALA 2K6QA 2BWES 3Q3FA 2NR2A 1YJ1A 4JLCA 4OVUA 4TQ0A 4HCPB 4EZKA 2AYOB 3A9JB 4FLHA 1UELA 1XQQA 3WA0A 3KVFB 2RPQA 2Y5BB 4PYZA 3ZIMA 3ML8A 5KHQA 5L95C 2KMAA 1SGHA 2IZVB 3ZNID 1A5RA 2EKEC 1IP9A 2N1VA 2FCSA 2JXXA 1WI0A 1WMHB 1KJTA 3NHEB 4XX5A 4AJYB 2K8BA 4HK2A 3V60A 3KUZA 4BKTA 1V5OA 2WYQA 1WXAA 4ZRJA 1WR1A 5J2RA 4BFRA 1EF5A 1RRBA 2CU1A 4A3OA 2A4ZA 2MW5A 1WE7A 4W9GA 2GBNA 4MELA 2MX2A 5L83A 1VCBA 5D94A 2MRPA 1GJZA 4EZJA 2KKCA 1OEYJ 4LCDE 4AWJA 3UGBB 2KWVB 2LI5A 3CMMB 3A1QA 5D2MB 5G2NA 4BKSA 4FN2A 3R7QA 4FJYA 1GUAB 4MH0E 3PVLA 3C0RB 4FULA 3AULA 5BO4B 3VQIA 4GMVA 4GN1A 2KTRB 3LJ3A 4W9JA 3RCZA 1YD8U 4LDTD 4CO7A 2J0KA 2L00B 2LXAA 2ZPYA 2RR9A 1F9JA 1TZ1A 3UQBA 2KVRA 4HJKA 3PLUA 1TTNA 4RM8A 4K1RB 4MDKE 3V6EB 5G55A 1WXVA 4EOYA 3W1YA 2L0TA 1GNUA 1OQYA 2IO2B 2KANA 2PJHA 3HM3A 5JZEB 4WJPA 4DHJD 2J0MA 2HE7A 2NBUA 3GOEA 2KWUB 1L2NA 1TBEA 4PS8A 1ZW7A 3B0AA 3QA8A 1V9JA 1WM3A 3TCAA 2IO1B 4W9HA 3DBSA 4EKUA 1V81A 3MTNB 4HCNB 3PGEA 3QQ8B 2ASQA 4E74A 2K8HA 2DZMA 3A33B 1OTRB 4KIKA 2V1YA 2KQSA 2KN5A 1WZ0A 2CHWA 2DZKA 2KJHB 2RSUA 4K7WA 3S2AA 2MBQA 3JW0X 2ZNVB 2M1MA 5E6NA 1FXTB 1L7YA 2KZRA 3APDA 3RZWC 3A4SC 3VVWB 4URKA 4NY0A 5JH5C 2DYOA 2XEWA 2KC1A 4NJ6A 3VAWA 3Q3JA 3VUYA 2BYFA 3EECA 2L05A 4AJWA 4MGYE 2YLMA 2RGFA 2KWCA 3OJ3A 3W1SC 4GB9A 1UGMA 3ZNGC 1Q0WB 4IM3A 1WF9A 3VUXA 1WZ3A 2IYDB 2IY1B 3ML9A 5DPTA 4HPMB 1E8XA 3PHWB 1Z2MA 2DZJA 2NVUI 3DBRI 4RM9A 3L0WB 4MGIE 1GG3A 5E6PA 2IO3B 3CSFA 4IWPA 4DDGD 4M8MA 1V6EA 2BWFA 4X57B 2LVPA 2I1JA 4DBGA 2N7DA 2Z0EB 4PS7A 1WYWB 3P2BA 3PZDA 4W9FA 2DYMA 3SHQA 3JYUA 2DZIA 2MA9B 2K6DB 2V4LA 2D2QA 4K7SA 2O2VA 4GDLA 3OJ4B 4TKNA 2ZVNA 2MP2B 4XC2A 3ZDMC 5C1ZA 3KW5B 3PPAA 1AARA 1SIFA 2WWZA 3DVGY 4PS3A 3H7SA 3JVZX 1E5WA 3NOBA 2NCNA 4M8NA 3T9LA 3ALBA 2O6VA 1Z5SB 5CHVC 5CX3A 2YVCA 2KX0A 3WIMA 4G11A 3GZNI 4OVVA 2NBVB 3EC8A 2KDEB 2Z59B 1TGZB 2KK8A 3R7RA 4J6IA 3VDZA 4B9KA 1UH6A 1CMXB 1J19A 3H7PA 3JSVB 2DAJA 2PE6B 2JUOA 4HDOA 4II3B 3UF8A 2LJ5A 1P98A 1LFDA 1RAXA 1WJ6A 4W9EA 3VTUA 1OGWA 2REXA 3W1SA 3KUDB 2CHXA 3MHSD 1S1QB 2DHZA 2JZZA 3CF6E 3IHPC 3R3MA 4ANWA 1U4AA 5CTRC 1WH3A 1P3QU 4GSWA 2NBWB 4RMAA 1WXMA 3X23A 4ICVA 1I42A 4DHZB 3VHTC 3EFUA 1J0GA 4KZCA 2LGYA 1R4MI 4ZRKA 2VRRB 1VD2A 1NDDA 2LVOA 4I6LB 1UD7A 3HHMA 3N30A 2LASA 3QCAA 2KLGA 3DBHI 4GOCA 2KFKA 3PRZA 3N32A 4JGHB 3ZNZB 1WJNA 2L7RA 1H4RA 5TR5A 2EMTA 2C7HA 5LXHA 3PV1A 2G4SA 1C3TA 3PRMB 4MJSB 3T8MA 3QIJA 1UBIA 4FBJB 4WWPA 1WX8A 4BOZB 3ONSA 3BY4B 2MWSB 3TBLD 5LLIA 3WAMA 4BKGA 1Y8RC 4KDIC 2CR5A 4KVGB 2A5UA 2GMIC 1RLFA 2KDFB 2D10A 2GBRA 1M94A 2ZJDA 2FCMA 4GDKB 4MGZE 3SU8X 2K1FA 3AXCA 2NPTB 1JRUA 4KDLB 2BGFA 5J17A 2MCNB 3RZFA 4XZ4A 4IM2A 3N3KB 2JVCA 2LRUA 2LVQA 4B6WA 4BBNC 2MBHA 1P9DU 2W9NA 3DDCB 2BYEA 3U30A 1UZXB 2KQ7A 2N9XA 1WJ4A 3K9OB 4W9CA 1E7VA 1G6JA 3QAQA 4EFOA 2GOWA 3PREA 4BVUC 4W9DA 4MGKE 2FCQA 2UYZB 2G4DB 3ZTDA 4DWFA 1D3ZA 3V62A 2B3AA 2DAFA 2XK5A 5EDSA 4F1SA 4I6NB 2DYBA 2LXCA 2JZ3B 2LD9A 3NS8A 1Q1OA 4NQKE 1WRDB 2G3QB 3UQAA 5CHFA 2Z0DB 2MSED 2R2QA 3A1QB 3D32A 3L54A 4PYUA 3VFKA 4NJ7A 1WGRA 3QC8B 2BKRB 4ZRIA 1EO6A 1V5TA 2ZEQA 3PSEB 2LRWA 1P0RA 3ZO5B 3DOWA 4W9KA 4JL9A 4GIVA 2LGDA 5AEKB 2L76A 2K25A 1LM8B 2KXJA 3KH0A 4MM3A 4WJOA 1WR6E 5E6OA 4EZLA 1YX5B 4NAWA 4KSKC 3NY5A 2MLBA 1GC6A 4K81A 3UIOB 1KM7A 4AP4C 3JSVA 3PTFC 3A9KB 3IVFA 3QX1A 4GU2A 1EUVB 2C7MB 3V61A 3O65B 3PS6A 3V6CB 3A9JA 3ZW3A 2D07B 4EUTA 2C5LC 2PEAA 3RT3B 2D11A 3HM6X 4G0NB 4N9F4 2KD0A 1E90A 4F8CB 4KIKB 2AL6A 4FJVB 3ZVVA 4AUQC 2PE9A 3L16A 1E8YA 3K9PB 1WMHA 4DHZE 2UWQA 2KO3A 1XD3B 2KOXA 3M63B 4WQOB 3TL5A 2ZVOA 1WY8A 2C60A 2HTHA 2ZNVC 1WM2A 3KYCD 3UINB 3SDLC 2FUHB 3MJWA 1WE6A 4BBNF 1WXSA 2M4NA 2N1WA 1WIAA 3VH3B 1C1YB 1V80A 2GBKA 1LXDA 1YX6B 3ZTCA 2C9WB 2EMSA 3NZUA 4EEWA 4HLEA 3NZSA 5C23A 4E3CA 5IA7A 2KHWB 1GC7A 2JY6A 2LZ6A 2JRIB 3B1LX 4JIOU 5IAAC 1WFYA 2RD0A 2D3GA 1SE9A 5D6JB 1J8CA 4BKSD 1V86A 2LGXA 2IBIB 2KTRA 4NPNA 4FADA 4FA6A 3WAPA 1WX7A 1WX9A 4YL8A 3DVNV 3RYTA 4P7IA 2C7NB 4W9IA 2XBBC 1WGGA 1ISNA 3PT2B 3U7DA 1YIWA 3ZLZA 2DENB
chains in the Genus database with same CATH superfamily
1YQ4B 2N9LA 4DDID 1FEHA 2R61A 4WJNA 5GMVA 2KJRA 2JRHA 3UIPB 3LDZE 1OFFA 4R3DA 1TS2A 2SEBD 1PGBA 2BS3B 2GI9A 2M8SA 2W3SA 2VH2A 3M95A 1QF6A 4MSQB 1S3SG 2LWPA 1XLQA 2L52A 3TJPA 1F2RC 1OQRA 1QZEA 4KSLC 1WGYA 1F1HA 1NBFC 3P4SB 2KMCA 2LHEA 1JALA 1MVKA 1SE2A 1FIQA 1R4NI 1SJHD 2WXLA 4GGQA 3R66C 3HVDA 1F52A 2BF8B 1NVID 1ZGUB 3GP7A 4LNKA 4WWNA 4HWIB 2KTFA 2K39A 3VTWA 3ABVB 2HD5B 3ZXVA 2JPHA 3ZRCA 3BVGA 4A6QA 1BXTA 3QARA 3A4RA 4MEMA 2QIEB 1JRPA 2NTTA 1XT9B 2D5GA 4A8XC 1L4ZB 1L0XB 2WXKA 2MBBB 1WRIA 5LXIB 4ANXA 2QDFA 3IG3A 4CYEA 4FHJA 2JT4B 2V3SA 2BVCA 2QHOA 1NI2A 1C4CA 3TIXA 1TIFA 5KHOA 1YN4A 1MG4A 1HA5A 2VZKD 4L1BA 4DXGA 1Q5WB 1N60A 1N61A 1E8ZA 3HRDD 1I4GA 1FNWA 2AL3A 5JXVA 1R4NB 1YQBA 2MJDA 5DPWA 1X1MA 3BYTB 2JF5A 2N9EB 1QLBB 3NVWA 3AE2B 3Q3NC 4MM3B 5IP4D 1BMLC 3RUIB 2BWES 4EZKA 2AYOB 5E6JA 3A9JB 3KVFB 1D5XC 5L95C 3ZJUA 2KMAA 1SGHA 4OHJA 1IP9A 2N1VA 3N9YC 1WMHB 3NHEB 4XX5A 3V60A 3KUZA 2WYQA 1WXAA 2CU1A 1RRBA 2MW5A 1WE7A 2GBNA 2L83A 5D94A 1TKEA 1ACCA 4DXFA 3A1QA 1UWMA 3V05A 3AEGB 1GUAB 3RNFC 1I4HA 2JYEA 2KTRB 3LJ3A 2NMQA 1GAQB 2L00B 4CO7A 1TTNA 4MDKE 2I38A 3W1YA 2N0SB 3HM3A 1GNUA 2IO2B 5JZEB 1DOYA 4WJPA 4FXCA 2J0MA 5EE9A 1L2NA 1TBEA 4KGSA 2V0GA 1FMAD 1JMLA 1V9JA 3TCAA 2HJ1A 2JSVX 4HCNB 3PGEA 2DZMA 2WXFA 1E7PB 3A33B 2V1YA 2KQSA 2CHWA 2WDVB 4RGMA 2RSUA 2GRIA 2BS4B 4NY0A 5JH5C 3KQ4A 1WWTA 4CQNA 3AE6B 4NJ6A 1T5XD 2L1AA 2WXMA 3EECA 2PW9A 2YLMA 2RGFA 3W1SC 4GB9A 1RFKA 1UGMA 1Q0WB 3VUXA 5DPTA 1E8XA 1Z2MA 2DZJA 2NVUI 3W2DA 3CSFA 4IWPA 4X57B 1KFYB 1V8CA 2LVPA 2N7DA 1R4MB 1UNSA 3SHQA 2DZIA 2K6DB 1DOXA 4WH4A 2WXRA 4XC2A 3OJ4B 4YWGG 1I4XA 1UWXA 5IKCM 3L4PA 1AARA 3SFEB 3AM9A 3DVGY 4PS3A 1QOFA 3ALBA 2O6VA 1YJIA 4YT0B 3EC8A 2Z59B 4B9KA 3VDZA 3ZGZA 3H7PA 2HTME 3AEDB 3JSVB 2DAJA 2PE6B 5D3DA 3UF8A 2J52A 1OGWA 4ZHPA 1V1PB 1N62A 3IHPC 1VZ6A 1ZXIA 3CF6E 4ANWA 1ET9A 5CTRC 1P3QU 3NVZA 2NBWB 4ZRQA 3VHTC 3EFUA 1J0GA 3R2TA 4KZCA 1NDDA 2LVOA 3QCAA 3HHMA 2LASA 2KFKA 4RGTA 2L7RA 2WXOA 1RWSA 1JROA 2C7HA 3QIJA 3SR6A 1SE3A 1PGXA 1XEEA 4LNIA 2CR5A 4KVGB 1ZDVA 1FXIA 1M94A 2FCMA 4GDKB 4MGZE 1YOVB 1F2RI 3URYA 1LGRA 3IT4B 2MCNB 4XZ4A 3N1YC 2LRUA 5BYRA 2W54A 2ON8A 4BBNC 2ZW0A 2N9XA 2UU7A 1DGJA 1WJ4A 1G6JA 1ZOYB 2K0PA 4EFOA 3ZTDA 5EE3A 2DAFA 2Y3AA 1V97A 3O13A 2DYBA 2JZ3B 3NS8A 1XLOA 1WRDB 2G3QB 5IOIA 3UQAA 3D32A 3VFKA 4NJ7A 4REZA 3PSEB 2LRWA 2LFIA 1L6VA 2YEPF 3ZO5B 2WDQB 3NVYA 1AYFA 2K22A 2SAKA 5E6OA 4NAWA 4KSKC 1GC6A 3PTFC 4GU2A 3AE5B 2LJIA 3O65B 3V6CB 1SE4A 2D07B 1QOAA 3RT3B 2D11A 4F8CB 4KIKB 2BS2B 3C19A 3ZVVA 4AUQC 1N5WA 4EE2A 3K9PB 1EWCA 3P63A 3NRZA 4WQOB 2KOXA 5BMGA 4USAA 3TL5A 2KMMA 3UINB 3KYCD 1WE6A 4BBNF 2M4NA 1VR9A 2N1WA 3VH3B 1V80A 2W3RA 1GC7A 2FE8A 4AS1A 3EUB2 1WFYA 2D3GA 1J8CA 2IBIB 4WQMA 1SJED 2XBBC 1ISNA 3PT2B 3U7DA 1F0ZA 1SXTA 3APFA 3Q2AC 3AE1B 2WGSA 4B0EA 2O2VB 3DPDA 4GDLB 4DXAB 3DVGX 3B08A 3DCGA 4LJOB 2KAJA 5LNK1 1FFVA 4LJPB 4DQOC 4W9LA 5FR6A 4WWOA 4US9A 3WAOA 2IY0B 3OG5A 3QK0A 5DPRA 3ZKJC 3M62B 1FCCC 5JHBA 2I1KA 3I3TB 3RNAC 3U52E 4ZDVA 4B0MA 1P1AA 3L13A 1UF0A 2J53A 4ITKA 1T0YA 2GLSA 2FBWB 4NZLB 3U7ZA 4JQWC 1WGDA 2VZKB 3AB5A 4II2B 3VH4B 3SEBA 4F7ZA 2IGDA 4ANUA 1UBQA 3Q69A 2OOBB 3A9KA 1V1OA 2MP2A 3KUCB 5AZHA 2AEHA 4A20A 4BOSC 1IPGA 3ENEA 1NYRA 2ZZPB 2WX1A 4WAFA 3ECIA 2N7EA 4HXDA 4G3XB 4IC7B 1E8WA 1MG8A 2KACA 2K9XA 4NQLB 2BKFA 2O6VD 3DVNU 2QEJC 4WJQA 4M0WB 3H1UA 4ZRPA 3APCA 2CHZA 3RFZB 3DBLI 4GXBA 4MACA 3KYDD 3W9CB 3RNEC 1K8RB 1ZDXA 3KWVA 5HKHA 3DWGC 4LTUA 2LEKA 2JWZA 3ZXRA 3HIZA 3MFGA 3ZJTA 4I6PA 2N9PC 2DBYA 2KJ6A 1IUEA 4HVBA 2CS4A 3FILA 3EHVA 3GE8C 3IXSA 2KC2A 3PHXB 2BPSA 2ONQA 5AZFA 2KDBA 1KLGD 2AQ2B 1JWBD 4YXDB 4IG7B 1FO4A 4XGAB 3FAHA 2RDBC 2V4IB 4Q2JA 3MHZA 2NR2A 2RDHA 3LXFA 1Q10A 2Y5BB 3ZIMA 5KHQA 3B2FA 4J3OD 3ZNID 1A5RA 1YJJA 2WXPA 4AJYB 4BKTA 1V5OA 1K50A 1KRHA 4BFRA 2A4ZA 1XLNA 2JYTA 3NS1A 3DHIC 3W5VB 2MX2A 5L83A 1VCBA 1GJZA 3DBLB 2EKIA 2KKCA 4LCDE 4AWJA 3CMMB 3Q8CA 3R7QA 1CQVA 3C0RB 4FULA 4GMVA 4GN1A 4W9JA 3DHGC 4LDTD 2LXAA 2RR9A 1ESFA 4O1NA 3AEBB 1T6BX 3PZ7A 3V6EB 5G55A 2OHFA 3R2IA 1XO3A 2JX5A 1FRDA 3BK1A 1WM3A 2IO1B 1V81A 2ASQA 2MH7A 1R7SA 1TS4A 2KN5A 2KJHB 5E6NA 1FXTB 2KZRA 3A4SC 2XEWA 4YTPB 3VAWA 5IO9A 2IGHA 1C76A 1WF9A 3AMZA 1WZ3A 3IAS1 1N63A 1GG3A 5E6PA 1V6EA 1DOIA 4PS7A 1WYWB 2YEPB 3Q3MC 4W9FA 2DYMA 2MA9B 4K7SA 3ZDMC 2ZVNA 1T0RC 1RM6C 1E5WA 4M8NA 4KKIA 5CHVC 3T3OA 2WXHA 5CX3A 3KWLA 1MHXA 2KX0A 2Q5WD 1PGAA 1MI0A 2INCC 4J6IA 4JE3B 3DWMA 1UH6A 1CMXB 1P7EA 1TJEA 1FNVA 3ZQ4A 1FFUA 1L4DB 2LJ5A 3R3MA 2JZZA 4OVZA 1VZ8A 2V3PA 2DWQA 3X23A 4H2AA 3BYYB 1NEKB 4ICVA 1I42A 3NJTA 4HROA 2N7JA 4M00A 1DYQA 4RCOA 1R4MI 4ZRKA 4I6LB 3N30A 4GOCA 2KLGA 3N32A 1KTKA 1H4RA 1WJNA 1QKZA 4P1BC 1TYGB 2G1EA 3OWEB 4FBJB 1WX8A 4A9AA 3BVMA 5LLIA 4BKGA 4HKQA 1ET6A 5C3JB 2GMIC 1I4QA 4C56C 1FXAA 2KDFB 3SU8X 1AW7A 2ACZB 3AEFB 4KDLB 2BGFA 2INNE 2KT7A 2LVQA 2MBHA 3DDCB 5H8YE 3U30A 1UZXB 5HG2A 2JQRB 4P1CC 2J42A 5GXGB 1E7VA 4C7YA 4BVUC 4XWTA 4W9DA 2FCQA 1I4RA 4N59A 2XK5A 4ARCA 2LXCA 1GPXA 2LD9A 4NQKE 5CHFA 1D4BA 1CZPA 3A1QB 2M19A 1WGRA 2BKRB 4ZRIA 1EO6A 1V5TA 1K53A 3Q8AA 2WXQA 2K25A 4ACFA 2KXJA 4IDIA 4WJOA 4EZLA 3ETRA 2MLBA 1Y56A 3UIOB 3JSVA 3QX1A 2BTEA 1KLUD 2C5LC 2PEAA 4N9F4 1E90A 4OZBA 4FJVB 2PE9A 1E8YA 4DHZE 2X38A 1XD3B 3M63B 3MP9A 1TT5B 2C60A 2HTHA 3W5UB 1WM2A 1SIJA 2MHJA 2MJ3A 1LXDA 1YX6B 2EMSA 2M0AA 4EEWA 4HLEA 1GB4A 3NZSA 5C23A 1P7FA 1FD6A 1HZ6A 2CJOA 4RF1A 3RN9C 1V86A 4TSSA 1KH0A 4K3CA 4NPNA 1QILA 4FADA 1E6EB 4KX6B 1WX7A 1WX9A 3DVNV 4QAYA 3RYTA 3V3XA 3T3NA 1WGGA 3ZLZA 4C00A 2DENB 2WXNA 1XCQL 4IUMB 3SFDB 3R8BA 2BB6A 3L10B 1T0SC 3AH7A 2L8JA 4G50A 4HJGE 3GE3C 2O6VB 2M17A 3AV8A 4E71A 2W55A 2WX0A 2INDC 3TMPB 3L08A 3H9DA 5I4DA 3IFWB 4KV2A 1BT0A 1LO5D 2N4FA 2D3BA 3H7PB 2WDRB 4AQ7A 1E9MA 3BIID 3Q3OC 1FCLA 4XDDA 2GBJA 2KFJA 2LUEA 3ZNHB 4KZ0A 1PQSA 4LNFA 2HJ8A 2JXTA 4C4VA 4ASWC 1HXYD 2AQ3B 3SD5A 4A3PA 3MC8A 4ICUA 2AWTA 1V2YA 1H8CA 4OZAA 2RPVA 2KFKB 4IM0A 1EF1A 3U8ZA 3H6NA 5AUKA 2KX3A 1IYFA 3AEEB 1N5XA 5DPSA 2ZCCA 2HDEA 2J7QB 3DQVA 1WSPA 1I35A 2PVGC 3VUWA 4RF0A 5BMHA 3MJ5A 4YTMB 1AWDA 2GBMA 3NG0A 1OEYA 3BINA 1E7UA 1FPYA 2BYTA 2NS5A 5J18A 1RFAA 4ZYNA 2IPKD 3B9JA 3IT6B 3VXWA 1STEA 4BAXA 4ZOHC 2BQQA 2ZCBA 3X0WA 5CHWA 4XWWA 2ICIA 4ANVA 1HTQA 2WU2B 2INPE 3AEAB 1TKGA 4IWOA 1LQBA 4NJCA 5HI1A 3NVVA 1E10A 3PLVA 4JX1C 3QWZB 3ZDTA 2FNJB 3RD2A 4MJSA 2BT6A 4LDTB 2J0JA 3Q14C 3BWUD 3ZUNA 3N20C 3AE9B 2PMVA 4NAWB 1ZUD2 3WANA 2WXGA 4MT5A 3AI5A 2NPTA 2K6QA 4OVUA 2H88B 4FLHA 1UELA 1XQQA 5G5GA 3WA0A 1A70A 2RPQA 1I7HA 4PYZA 3ML8A 3Q8FA 1D5MC 4C80A 2IZVB 2OJWA 2XNAC 2QJLA 5FKAC 2VH1A 1VLBA 1WI0A 2K8BA 4HK2A 4A3OA 4RFBA 4W9GA 4M01A 3GS2A 4MELA 3TEXA 2MRPA 1OEYJ 3I57A 3UGBB 2LI5A 5D2MB 4BKSA 4FN2A 1FRRA 1YQ3B 4FJYA 4MH0E 2B76B 3PVLA 1QT9A 5BO4B 3VQIA 3FKYA 3RCZA 1YD8U 1CK1A 2J0KA 2ZPYA 1TZ1A 3UQBA 4HJKA 3PLUA 4YSYB 1WXVA 1VJKA 2L0TA 2PJHA 2KANA 1C78A 4DHJD 2K5PA 2HE7A 2NBUA 2KWUB 4PS8A 1ZW7A 3VRBB 4TMAB 4P6VF 4W9HA 3DBSA 1NYQA 1YMHE 3P4QB 4C7ZA 2K8HA 3TSSA 1OTRB 3I63C 2E6XA 1EWYC 3H8HA 1WZ0A 4K7WA 3AE7B 3S2AA 4ARIA 3JW0X 2M1MA 2RMMA 3APDA 1D5ZC 1SF0A 3Q3JA 3VUYA 1IBXA 2L05A 4AJWA 4MGYE 3BZDB 3ZNGC 4GLSC 4IM3A 2IYDB 4HPMB 2Z8LA 3U4EG 4RM9A 3L0WB 2IO3B 1ZE3D 1VZ7A 1PUTA 2BWFA 3DHHC 2I1JA 4DBGA 1L0VB 2V4LA 2D2QA 4MH8A 5C1ZA 2MP2B 4YTNB 3PPAA 4L23A 1SIFA 2WWZA 1HEZE 3JVZX 4S17A 3T9LA 4BZAA 2PIAA 2TSSA 3AN1A 4G11A 4OVVA 1HTOA 4M02A 5AUIA 3TEWA 2I2YA 1WGKA 2JUOA 4II3B 1SEBD 4W9EA 1LFDA 1RAXA 1WJ6A 1N6ZA 3W1SA 3KUDB 4HRSA 3MHSD 2DHZA 1TKYA 1WH3A 4GSWA 4RMAA 1NI3A 1I4PA 3AECB 3WCQA 3TUOA 2LGYA 1T3QA 2VRRB 1VD2A 1UD7A 3DBHI 3ZNZB 3FILB 2M56B 3AE4B 5LXHA 2QSDA 2G4SA 3T8MA 1C79A 4BOZB 3ONSA 2WQYB 1ZP0B 3E56A 3WAMA 1Y8RC 1L5PA 2CJNA 4N58A 2D10A 2GBRA 2BBCA 2ZJDA 1FM0D 2K1FA 1JRUA 2V3NA 3RZFA 2KYWA 4B6WA 2KQ4X 4RH6A 1P9DU 2W9NA 3EA6A 1PYWD 2D3AA 5H92C 2KQ7A 4W9CA 2AX5A 3MC0B 2GOWA 4XYCA 4MGKE 2Y5CA 2UYZB 2G4DB 1D3ZA 2E3TA 1Q1OA 2NTSA 3J9CA 1E0ZA 2MSED 2R2QA 3Q8EA 2LGIA 1F77A 3QC8B 2ZEQA 3Q8BA 3N1XC 3DOWA 4ZHOA 4JL9A 2LGDA 5AEKB 2BB5A 2L76A 1LM8B 3KH0A 3EGRA 4MM3A 1WR6E 1YX5B 4K81A 3EFCA 3DBHB 3N1ZC 1QOBA 2C7MB 3A9JA 2MEKA 1PDXA 1SB3C 4EUTA 5C2TB 4YSXB 3HM6X 4G0NB 1HZ5A 4HEA1 4HPPA 2WHIA 2QMTA 3CIRB 1WMHA 3IAM1 2UWQA 4UDUC 2KO3A 2ZVOA 4KGTA 1EU3A 4PT5A 3SDLC 1JWAD 3MJWA 1WXSA 3I5JC 1WIAA 1C1YB 2GBKA 3ZTCA 3NZUA 5IA7A 3PZ8A 2KHWB 2JY6A 1XXGA 4JIOU 5IAAC 4LK0M 1SE9A 5D6JB 4BKSD 2LGXA 2KTRA 3WAPA 1C4AA 1JWUD 4YL8A 4W9IA 2PVOD 1YIWA 1L0YB 2QILA 2LMCA 4FJZA 5D7GA 2PTLA 2KLCA 2IO0B 4WAAA 5MPOA 1FNUA 5TSSA 1KOTA 2WDTB 5DCNA 1ZXHA 3BK2A 2MQJA 1ZPSA 2WP9B 3QJZA 3QHTA 1V49A 1VRAB 1TS3A 1EU4A 2G45B 4FHKA 5T8IA 4ZYSA 2PPHA 2WXIA 4CHKA 4A55A 5JHAA 1TY2A 2FCNA 3MC9A 3RPFC 2DX5B 1HE8A 1GB1A 2ZPNA 2KN4A 2BYVE 1EM7A 4TUUA 3I9V1 4MSMB 2IDYA 2CKHB 2WS3B 4WWMA 4A90A 2L3ZA 4NNJB 1KLVA 3M3JA 3AE3B 2M0XA 4NAMA 3P1MA 4TQ1A 4JPSA 2FIFA 3CWIA 3HK0A 2KNBA 4L2YA 1SBBB 2FAZA 5AZGA 4RGOS 4IWQA 3TEZA 2JZPA 3PRPB 1C4PA 2MBEA 3P4RB 1WJUA 3AE8B 5HFYA 4DK5A 3VTVA 3AU4A 3CSTA 2L0FA 3ZRFA 1RYJA 2IJ0A 1B9RA 1ZKHA 4HPLB 2MBOA 2R2OA 1WGHA 2OJRA 1V1PA 2FIDA 4TV3A 2Y5PA 4K7UA 3FC4A 1SSNA 1KF6B 3AU5A 3L17A 3OLMD 4KKJA 4IW0A 1UUPA 2JWUA 2XK5B 4XE0A 4HDQA 3RULA 1K52A 1J7BA 4AOFA 3OAWA 2KDIA 2KDMA 3P42A 4RNAA 1XLPA 2K8CA 4YSZB 2H89B 5FK9C 4B95A 1ENFA 2XN9C 4P16A 4DHJB 2LGSA 3IBEA 4GDKA 3Q3FA 4JLCA 1YJ1A 4TQ0A 4HCPB 2J4XA 4XDCA 3NUHB 3E9SA 2LHDA 2EKEC 4D2KA 2FCSA 1WYGA 2JXXA 1KJTA 4ZRJA 5J2RA 1WR1A 3VRAB 3TEYA 1EF5A 1MFWA 1VDVA 1YNTE 1J7AA 4EZJA 2PKOA 2KWVB 1IGCA 4IOIE 5G2NA 2QC8A 4S0RA 1C77A 3AULA 3KLSX 5FR3A 1BUIC 1F9JA 2KVRA 1JWSD 4RM8A 4K1RB 1IGDA 5EE1A 4EOYA 1OQYA 2WLBA 3GOEA 3B0AA 2WXJA 1TY0A 3QA8A 1ROEA 1JQ4A 4EKUA 3MTNB 1AN8A 3QQ8B 4E74A 4US8A 1NENB 4KIKA 5BYSA 2DZKA 2MBQA 2ZNVB 2RDGA 1L7YA 4HKZE 3RZWC 3VVWB 4URKA 2DYOA 2WU5B 2KC1A 2BYFA 3OJ3A 2KWCA 2MJEA 4OZCA 1YN5A 4C4VB 4IKGA 2IY1B 3ML9A 3PHWB 3DBRI 1MHHE 4MGIE 1J7CA 4DDGD 4M8MA 1MJDA 2X8XX 2Z0EB 2W82A 3P2BA 3PZDA 4OW0A 2DLBA 3JYUA 1M4VA 1YN3A 2O2VA 4GDLA 4TKNA 3ZYYX 3NZ3A 1K51A 3KW5B 2GB1A 3H7SA 3NOBA 2NCNA 1WXQA 1Z5SB 2IGGA 2N9KA 2WNMA 2YVCA 2V9HA 3HVZA 3WIMA 3GZNI 2ZW1A 2NBVB 1HQRD 3B2GA 2KDEB 1TGZB 2KK8A 1L6UA 2JU6X 3R7RA 3RI7C 3RMKC 1J19A 3RNBC 4WURA 4HDOA 3WALA 1P98A 3VTUA 2REXA 2CHXA 3RNCC 1S1QB 1U4AA 3PO0A 1WXMA 4DHZB 3U2SC 4K3BA 4JGHB 3PRZA 5TR5A 2EMTA 3PV1A 2OEDA 1C3TA 3PRMB 4MJSB 1UBIA 4WWPA 5G5HA 3BY4B 2MWSB 1TS5A 3TBLD 2L32A 3ZJVA 3DBRB 4WIPA 4KDIC 2FUG1 2A5UA 1RLFA 3GB1A 4M0WA 3AXCA 2NPTB 2DNFA 5J17A 4IM2A 3BVZA 2JVCA 3N3KB 5HHDG 2K3UA 1B1ZA 4LNNA 2BYEA 1MPEA 2AQ1B 3K9OB 2CU3A 3LYYA 4PK1A 1PFDA 2D3CA 3QAQA 3PREA 3GZNB 1CJEA 5BYQA 4RGNA 4DWFA 4JWSC 3V62A 2B3AA 1TZOA 5EDSA 4F1SA 4I6NB 3HUIA 3C8YA 2BW2A 2KWDA 2Z0DB 1C9FA 2PLPA 3L54A 4PYUA 4JWUC 3VR8B 1OQQA 1P0RA 2EELA 4W9KA 4LLGM 2QCZA 4GIVA 1JWMD 3NY5A 1KM7A 3RNGC 3UI3A 4AP4C 3VR9B 1JW9D 3A9KB 3IVFA 1EUVB 1GOZA 3V61A 3PS6A 1XF5L 3ZW3A 1UGJA 1QQRA 5EE0A 2KD0A 2AL6A 1XCTL 5BMIA 3L16A 4LNOA 2LUMA 1WY8A 2ZNVC 3P4PB 2FUHB 1QOGA 5IN7A 2G9HD 1JCKB 1IBXB 1T0QC 2C9WB 4E3CA 2LZ6A 2JRIB 3B1LX 3LB8C 2RD0A 4KGRA 1D6EC 4FA6A 2KVZA 4N6EB 3Q6BA 4P7IA 2C7NB 5D3IB
chains in the Genus database with same CATH topology
3APFA 4IUMB 4DDID 2O2VB 3DPDA 4GDLB 4DXAB 3DVGX 3B08A 3L10B 4WJNA 5GMVA 2KJRA 3DCGA 2JRHA 3UIPB 4LJOB 3LDZE 4FJZA 5D7GA 2KLCA 2IO0B 2L8JA 4G50A 4WAAA 4LJPB 2O6VB 2M17A 2WDTB 4W9LA 5DCNA 5FR6A 1KOTA 4WWOA 2M8SA 3WAOA 3M95A 2MQJA 4E71A 2IY0B 3QK0A 2WX0A 5DPRA 3QJZA 3TMPB 3L08A 3QHTA 3H9DA 1V49A 4MSQB 3ZKJC 3M62B 3IFWB 4KV2A 5JHBA 1BT0A 2G45B 4FHKA 1S3SG 2I1KA 2LWPA 2PPHA 2N4FA 3TJPA 3H7PB 4CHKA 3I3TB 5JHAA 1QZEA 2FCNA 4KSLC 1WGYA 1NBFC 4ZDVA 2KMCA 2DX5B 1HE8A 1P1AA 2GBJA 2KFJA 2LUEA 3ZNHB 4KZ0A 1PQSA 3L13A 2ZPNA 1R4NI 2HJ8A 4GGQA 2BYVE 4TUUA 1T0YA 3R66C 4MSMB 4ASWC 2CKHB 2BF8B 1ZGUB 3SD5A 4JQWC 4A3PA 2L3ZA 4NNJB 1KLVA 4WWNA 1WGDA 3M3JA 4HWIB 4ICUA 2KTFA 2AWTA 2K39A 4II2B 1V2YA 3VH4B 3VTWA 1H8CA 4F7ZA 2M0XA 2KFKB 4ANUA 4IM0A 2HD5B 4TQ1A 2JPHA 1UBQA 3ZRCA 2OOBB 3A9KA 1EF1A 3U8ZA 2FIFA 3H6NA 3KUCB 2MP2A 5AZHA 2AEHA 4A20A 2KX3A 4BOSC 1IPGA 3HK0A 2KNBA 1IYFA 3ENEA 2FAZA 2ZZPB 2WX1A 5AZGA 3QARA 3ECIA 2N7EA 4HXDA 4IWQA 5DPSA 3A4RA 4G3XB 3PRPB 2MBEA 2ZCCA 4IC7B 1E8WA 1MG8A 4MEMA 2J7QB 3DQVA 4NQLB 2BKFA 2O6VD 1WJUA 1XT9B 3DVNU 1I35A 4DK5A 3VTVA 4WJQA 4M0WB 3H1UA 3AU4A 3CSTA 3VUWA 2L0FA 3ZRFA 3APCA 2CHZA 2MBBB 5LXIB 1ZKHA 2GBMA 4ANXA 4HPLB 1OEYA 3DBLI 4GXBA 3BINA 2MBOA 3IG3A 2R2OA 1E7UA 3KYDD 4FHJA 4CYEA 1WGHA 2JT4B 2V3SA 2NS5A 2OJRA 5J18A 1RFAA 4ZYNA 2QHOA 1K8RB 1NI2A 2FIDA 4TV3A 4K7UA 3VXWA 3TIXA 5HKHA 3AU5A 3L17A 2JWZA 3OLMD 5KHOA 2ZCBA 4IW0A 3X0WA 5CHWA 4ANVA 2XK5B 3HIZA 4I6PA 2N9PC 2KJ6A 4HDQA 3RULA 4HVBA 2CS4A 4IWOA 1LQBA 3EHVA 4AOFA 3OAWA 1Q5WB 3PLVA 1E8ZA 3QWZB 3ZDTA 2FNJB 2KC2A 3PHXB 2KDIA 3RD2A 2BPSA 4MJSA 5AZFA 2AL3A 2K8CA 2KDBA 4LDTB 1YQBA 2J0JA 5DPWA 4B95A 1X1MA 2JF5A 2N9EB 3ZUNA 4DHJB 4NAWB 4IG7B 3IBEA 3WANA 4GDKA 3AI5A 3RUIB 2NPTA 3WALA 2K6QA 2BWES 3Q3FA 2NR2A 1YJ1A 4JLCA 4OVUA 4TQ0A 4HCPB 4EZKA 2AYOB 3A9JB 4FLHA 1UELA 1XQQA 3WA0A 3KVFB 2RPQA 2Y5BB 4PYZA 3ZIMA 3ML8A 5KHQA 5L95C 2KMAA 1SGHA 2IZVB 3ZNID 1A5RA 2EKEC 1IP9A 2N1VA 2FCSA 2JXXA 1WI0A 1WMHB 1KJTA 3NHEB 4XX5A 4AJYB 2K8BA 4HK2A 3V60A 3KUZA 4BKTA 1V5OA 2WYQA 1WXAA 4ZRJA 1WR1A 5J2RA 4BFRA 1EF5A 1RRBA 2CU1A 4A3OA 2A4ZA 2MW5A 1WE7A 4W9GA 2GBNA 4MELA 2MX2A 5L83A 1VCBA 5D94A 2MRPA 1GJZA 4EZJA 2KKCA 1OEYJ 4LCDE 4AWJA 3UGBB 2KWVB 2LI5A 3CMMB 3A1QA 5D2MB 5G2NA 4BKSA 4FN2A 3R7QA 4FJYA 1GUAB 4MH0E 3PVLA 3C0RB 4FULA 3AULA 5BO4B 3VQIA 4GMVA 4GN1A 2KTRB 3LJ3A 4W9JA 3RCZA 1YD8U 4LDTD 4CO7A 2J0KA 2L00B 2LXAA 2ZPYA 2RR9A 1F9JA 1TZ1A 3UQBA 2KVRA 4HJKA 3PLUA 1TTNA 4RM8A 4K1RB 4MDKE 3V6EB 5G55A 1WXVA 4EOYA 3W1YA 2L0TA 1GNUA 1OQYA 2IO2B 2KANA 2PJHA 3HM3A 5JZEB 4WJPA 4DHJD 2J0MA 2HE7A 2NBUA 3GOEA 2KWUB 1L2NA 1TBEA 4PS8A 1ZW7A 3B0AA 3QA8A 1V9JA 1WM3A 3TCAA 2IO1B 4W9HA 3DBSA 4EKUA 1V81A 3MTNB 4HCNB 3PGEA 3QQ8B 2ASQA 4E74A 2K8HA 2DZMA 3A33B 1OTRB 4KIKA 2V1YA 2KQSA 2KN5A 1WZ0A 2CHWA 2DZKA 2KJHB 2RSUA 4K7WA 3S2AA 2MBQA 3JW0X 2ZNVB 2M1MA 5E6NA 1FXTB 1L7YA 2KZRA 3APDA 3RZWC 3A4SC 3VVWB 4URKA 4NY0A 5JH5C 2DYOA 2XEWA 2KC1A 4NJ6A 3VAWA 3Q3JA 3VUYA 2BYFA 3EECA 2L05A 4AJWA 4MGYE 2YLMA 2RGFA 2KWCA 3OJ3A 3W1SC 4GB9A 1UGMA 3ZNGC 1Q0WB 4IM3A 1WF9A 3VUXA 1WZ3A 2IYDB 2IY1B 3ML9A 5DPTA 4HPMB 1E8XA 3PHWB 1Z2MA 2DZJA 2NVUI 3DBRI 4RM9A 3L0WB 4MGIE 1GG3A 5E6PA 2IO3B 3CSFA 4IWPA 4DDGD 4M8MA 1V6EA 2BWFA 4X57B 2LVPA 2I1JA 4DBGA 2N7DA 2Z0EB 4PS7A 1WYWB 3P2BA 3PZDA 4W9FA 2DYMA 3SHQA 3JYUA 2DZIA 2MA9B 2K6DB 2V4LA 2D2QA 4K7SA 2O2VA 4GDLA 3OJ4B 4TKNA 2ZVNA 2MP2B 4XC2A 3ZDMC 5C1ZA 3KW5B 3PPAA 1AARA 1SIFA 2WWZA 3DVGY 4PS3A 3H7SA 3JVZX 1E5WA 3NOBA 2NCNA 4M8NA 3T9LA 3ALBA 2O6VA 1Z5SB 5CHVC 5CX3A 2YVCA 2KX0A 3WIMA 4G11A 3GZNI 4OVVA 2NBVB 3EC8A 2KDEB 2Z59B 1TGZB 2KK8A 3R7RA 4J6IA 3VDZA 4B9KA 1UH6A 1CMXB 1J19A 3H7PA 3JSVB 2DAJA 2PE6B 2JUOA 4HDOA 4II3B 3UF8A 2LJ5A 1P98A 1LFDA 1RAXA 1WJ6A 4W9EA 3VTUA 1OGWA 2REXA 3W1SA 3KUDB 2CHXA 3MHSD 1S1QB 2DHZA 2JZZA 3CF6E 3IHPC 3R3MA 4ANWA 1U4AA 5CTRC 1WH3A 1P3QU 4GSWA 2NBWB 4RMAA 1WXMA 3X23A 4ICVA 1I42A 4DHZB 3VHTC 3EFUA 1J0GA 4KZCA 2LGYA 1R4MI 4ZRKA 2VRRB 1VD2A 1NDDA 2LVOA 4I6LB 1UD7A 3HHMA 3N30A 2LASA 3QCAA 2KLGA 3DBHI 4GOCA 2KFKA 3PRZA 3N32A 4JGHB 3ZNZB 1WJNA 2L7RA 1H4RA 5TR5A 2EMTA 2C7HA 5LXHA 3PV1A 2G4SA 1C3TA 3PRMB 4MJSB 3T8MA 3QIJA 1UBIA 4FBJB 4WWPA 1WX8A 4BOZB 3ONSA 3BY4B 2MWSB 3TBLD 5LLIA 3WAMA 4BKGA 1Y8RC 4KDIC 2CR5A 4KVGB 2A5UA 2GMIC 1RLFA 2KDFB 2D10A 2GBRA 1M94A 2ZJDA 2FCMA 4GDKB 4MGZE 3SU8X 2K1FA 3AXCA 2NPTB 1JRUA 4KDLB 2BGFA 5J17A 2MCNB 3RZFA 4XZ4A 4IM2A 3N3KB 2JVCA 2LRUA 2LVQA 4B6WA 4BBNC 2MBHA 1P9DU 2W9NA 3DDCB 2BYEA 3U30A 1UZXB 2KQ7A 2N9XA 1WJ4A 3K9OB 4W9CA 1E7VA 1G6JA 3QAQA 4EFOA 2GOWA 3PREA 4BVUC 4W9DA 4MGKE 2FCQA 2UYZB 2G4DB 3ZTDA 4DWFA 1D3ZA 3V62A 2B3AA 2DAFA 2XK5A 5EDSA 4F1SA 4I6NB 2DYBA 2LXCA 2JZ3B 2LD9A 3NS8A 1Q1OA 4NQKE 1WRDB 2G3QB 3UQAA 5CHFA 2Z0DB 2MSED 2R2QA 3A1QB 3D32A 3L54A 4PYUA 3VFKA 4NJ7A 1WGRA 3QC8B 2BKRB 4ZRIA 1EO6A 1V5TA 2ZEQA 3PSEB 2LRWA 1P0RA 3ZO5B 3DOWA 4W9KA 4JL9A 4GIVA 2LGDA 5AEKB 2L76A 2K25A 1LM8B 2KXJA 3KH0A 4MM3A 4WJOA 1WR6E 5E6OA 4EZLA 1YX5B 4NAWA 4KSKC 3NY5A 2MLBA 1GC6A 4K81A 3UIOB 1KM7A 4AP4C 3JSVA 3PTFC 3A9KB 3IVFA 3QX1A 4GU2A 1EUVB 2C7MB 3V61A 3O65B 3PS6A 3V6CB 3A9JA 3ZW3A 2D07B 4EUTA 2C5LC 2PEAA 3RT3B 2D11A 3HM6X 4G0NB 4N9F4 2KD0A 1E90A 4F8CB 4KIKB 2AL6A 4FJVB 3ZVVA 4AUQC 2PE9A 3L16A 1E8YA 3K9PB 1WMHA 4DHZE 2UWQA 2KO3A 1XD3B 2KOXA 3M63B 4WQOB 3TL5A 2ZVOA 1WY8A 2C60A 2HTHA 2ZNVC 1WM2A 3KYCD 3UINB 3SDLC 2FUHB 3MJWA 1WE6A 4BBNF 1WXSA 2M4NA 2N1WA 1WIAA 3VH3B 1C1YB 1V80A 2GBKA 1LXDA 1YX6B 3ZTCA 2C9WB 2EMSA 3NZUA 4EEWA 4HLEA 3NZSA 5C23A 4E3CA 5IA7A 2KHWB 1GC7A 2JY6A 2LZ6A 2JRIB 3B1LX 4JIOU 5IAAC 1WFYA 2RD0A 2D3GA 1SE9A 5D6JB 1J8CA 4BKSD 1V86A 2LGXA 2IBIB 2KTRA 4NPNA 4FADA 4FA6A 3WAPA 1WX7A 1WX9A 4YL8A 3DVNV 3RYTA 4P7IA 2C7NB 4W9IA 2XBBC 1WGGA 1ISNA 3PT2B 3U7DA 1YIWA 3ZLZA 2DENB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APF A;  4IUM B;  4DDI D;  2O2V B;  3DPD A;  4GDL B;  4DXA B;  3DVG X;  3B08 A;  3L10 B;  4WJN A;  5GMV A;  2KJR A;  3DCG A;  2JRH A;  3UIP B;  4LJO B;  3LDZ E;  4FJZ A;  5D7G A;  2KLC A;  2IO0 B;  2L8J A;  4G50 A;  4WAA A;  4LJP B;  2O6V B;  2M17 A;  2WDT B;  4W9L A;  5DCN A;  5FR6 A;  1KOT A;  4WWO A;  2M8S A;  3WAO A;  3M95 A;  2MQJ A;  4E71 A;  2IY0 B;  3QK0 A;  2WX0 A;  5DPR A;  3QJZ A;  3TMP B;  3L08 A;  3QHT A;  3H9D A;  1V49 A;  4MSQ B;  3ZKJ C;  3M62 B;  3IFW B;  4KV2 A;  5JHB A;  1BT0 A;  2G45 B;  4FHK A;  1S3S G;  2I1K A;  2LWP A;  2PPH A;  2N4F A;  3TJP A;  3H7P B;  4CHK A;  3I3T B;  5JHA A;  1QZE A;  2FCN A;  4KSL C;  1WGY A;  1NBF C;  4ZDV A;  2KMC A;  2DX5 B;  1HE8 A;  1P1A A;  2GBJ A;  2KFJ A;  2LUE A;  3ZNH B;  4KZ0 A;  1PQS A;  3L13 A;  2ZPN A;  1R4N I;  2HJ8 A;  4GGQ A;  2BYV E;  4TUU A;  1T0Y A;  3R66 C;  4MSM B;  4ASW C;  2CKH B;  2BF8 B;  1ZGU B;  3SD5 A;  4JQW C;  4A3P A;  2L3Z A;  4NNJ B;  1KLV A;  4WWN A;  1WGD A;  3M3J A;  4HWI B;  4ICU A;  2KTF A;  2AWT A;  2K39 A;  4II2 B;  1V2Y A;  3VH4 B;  3VTW A;  1H8C A;  4F7Z A;  2M0X A;  2KFK B;  4ANU A;  4IM0 A;  2HD5 B;  4TQ1 A;  2JPH A;  1UBQ A;  3ZRC A;  2OOB B;  3A9K A;  1EF1 A;  3U8Z A;  2FIF A;  3H6N A;  3KUC B;  2MP2 A;  5AZH A;  2AEH A;  4A20 A;  2KX3 A;  4BOS C;  1IPG A;  3HK0 A;  2KNB A;  1IYF A;  3ENE A;  2FAZ A;  2ZZP B;  2WX1 A;  5AZG A;  3QAR A;  3ECI A;  2N7E A;  4HXD A;  4IWQ A;  5DPS A;  3A4R A;  4G3X B;  3PRP B;  2MBE A;  2ZCC A;  4IC7 B;  1E8W A;  1MG8 A;  4MEM A;  2J7Q B;  3DQV A;  4NQL B;  2BKF A;  2O6V D;  1WJU A;  1XT9 B;  3DVN U;  1I35 A;  4DK5 A;  3VTV A;  4WJQ A;  4M0W B;  3H1U A;  3AU4 A;  3CST A;  3VUW A;  2L0F A;  3ZRF A;  3APC A;  2CHZ A;  2MBB B;  5LXI B;  1ZKH A;  2GBM A;  4ANX A;  4HPL B;  1OEY A;  3DBL I;  4GXB A;  3BIN A;  2MBO A;  3IG3 A;  2R2O A;  1E7U A;  3KYD D;  4FHJ A;  4CYE A;  1WGH A;  2JT4 B;  2V3S A;  2NS5 A;  2OJR A;  5J18 A;  1RFA A;  4ZYN A;  2QHO A;  1K8R B;  1NI2 A;  2FID A;  4TV3 A;  4K7U A;  3VXW A;  3TIX A;  5HKH A;  3AU5 A;  3L17 A;  2JWZ A;  3OLM D;  5KHO A;  2ZCB A;  4IW0 A;  3X0W A;  5CHW A;  4ANV A;  2XK5 B;  3HIZ A;  4I6P A;  2N9P C;  2KJ6 A;  4HDQ A;  3RUL A;  4HVB A;  2CS4 A;  4IWO A;  1LQB A;  3EHV A;  4AOF A;  3OAW A;  1Q5W B;  3PLV A;  1E8Z A;  3QWZ B;  3ZDT A;  2FNJ B;  2KC2 A;  3PHX B;  2KDI A;  3RD2 A;  2BPS A;  4MJS A;  5AZF A;  2AL3 A;  2K8C A;  2KDB A;  4LDT B;  1YQB A;  2J0J A;  5DPW A;  4B95 A;  1X1M A;  2JF5 A;  2N9E B;  3ZUN A;  4DHJ B;  4NAW B;  4IG7 B;  3IBE A;  3WAN A;  4GDK A;  3AI5 A;  3RUI B;  2NPT A;  3WAL A;  2K6Q A;  2BWE S;  3Q3F A;  2NR2 A;  1YJ1 A;  4JLC A;  4OVU A;  4TQ0 A;  4HCP B;  4EZK A;  2AYO B;  3A9J B;  4FLH A;  1UEL A;  1XQQ A;  3WA0 A;  3KVF B;  2RPQ A;  2Y5B B;  4PYZ A;  3ZIM A;  3ML8 A;  5KHQ A;  5L95 C;  2KMA A;  1SGH A;  2IZV B;  3ZNI D;  1A5R A;  2EKE C;  1IP9 A;  2N1V A;  2FCS A;  2JXX A;  1WI0 A;  1WMH B;  1KJT A;  3NHE B;  4XX5 A;  4AJY B;  2K8B A;  4HK2 A;  3V60 A;  3KUZ A;  4BKT A;  1V5O A;  2WYQ A;  1WXA A;  4ZRJ A;  1WR1 A;  5J2R A;  4BFR A;  1EF5 A;  1RRB A;  2CU1 A;  4A3O A;  2A4Z A;  2MW5 A;  1WE7 A;  4W9G A;  2GBN A;  4MEL A;  2MX2 A;  5L83 A;  1VCB A;  5D94 A;  2MRP A;  1GJZ A;  4EZJ A;  2KKC A;  1OEY J;  4LCD E;  4AWJ A;  3UGB B;  2KWV B;  2LI5 A;  3CMM B;  3A1Q A;  5D2M B;  5G2N A;  4BKS A;  4FN2 A;  3R7Q A;  4FJY A;  1GUA B;  4MH0 E;  3PVL A;  3C0R B;  4FUL A;  3AUL A;  5BO4 B;  3VQI A;  4GMV A;  4GN1 A;  2KTR B;  3LJ3 A;  4W9J A;  3RCZ A;  1YD8 U;  4LDT D;  4CO7 A;  2J0K A;  2L00 B;  2LXA A;  2ZPY A;  2RR9 A;  1F9J A;  1TZ1 A;  3UQB A;  2KVR A;  4HJK A;  3PLU A;  1TTN A;  4RM8 A;  4K1R B;  4MDK E;  3V6E B;  5G55 A;  1WXV A;  4EOY A;  3W1Y A;  2L0T A;  1GNU A;  1OQY A;  2IO2 B;  2KAN A;  2PJH A;  3HM3 A;  5JZE B;  4WJP A;  4DHJ D;  2J0M A;  2HE7 A;  2NBU A;  3GOE A;  2KWU B;  1L2N A;  1TBE A;  4PS8 A;  1ZW7 A;  3B0A A;  3QA8 A;  1V9J A;  1WM3 A;  3TCA A;  2IO1 B;  4W9H A;  3DBS A;  4EKU A;  1V81 A;  3MTN B;  4HCN B;  3PGE A;  3QQ8 B;  2ASQ A;  4E74 A;  2K8H A;  2DZM A;  3A33 B;  1OTR B;  4KIK A;  2V1Y A;  2KQS A;  2KN5 A;  1WZ0 A;  2CHW A;  2DZK A;  2KJH B;  2RSU A;  4K7W A;  3S2A A;  2MBQ A;  3JW0 X;  2ZNV B;  2M1M A;  5E6N A;  1FXT B;  1L7Y A;  2KZR A;  3APD A;  3RZW C;  3A4S C;  3VVW B;  4URK A;  4NY0 A;  5JH5 C;  2DYO A;  2XEW A;  2KC1 A;  4NJ6 A;  3VAW A;  3Q3J A;  3VUY A;  2BYF A;  3EEC A;  2L05 A;  4AJW A;  4MGY E;  2YLM A;  2RGF A;  2KWC A;  3OJ3 A;  3W1S C;  4GB9 A;  1UGM A;  3ZNG C;  1Q0W B;  4IM3 A;  1WF9 A;  3VUX A;  1WZ3 A;  2IYD B;  2IY1 B;  3ML9 A;  5DPT A;  4HPM B;  1E8X A;  3PHW B;  1Z2M A;  2DZJ A;  2NVU I;  3DBR I;  4RM9 A;  3L0W B;  4MGI E;  1GG3 A;  5E6P A;  2IO3 B;  3CSF A;  4IWP A;  4DDG D;  4M8M A;  1V6E A;  2BWF A;  4X57 B;  2LVP A;  2I1J A;  4DBG A;  2N7D A;  2Z0E B;  4PS7 A;  1WYW B;  3P2B A;  3PZD A;  4W9F A;  2DYM A;  3SHQ A;  3JYU A;  2DZI A;  2MA9 B;  2K6D B;  2V4L A;  2D2Q A;  4K7S A;  2O2V A;  4GDL A;  3OJ4 B;  4TKN A;  2ZVN A;  2MP2 B;  4XC2 A;  3ZDM C;  5C1Z A;  3KW5 B;  3PPA A;  1AAR A;  1SIF A;  2WWZ A;  3DVG Y;  4PS3 A;  3H7S A;  3JVZ X;  1E5W A;  3NOB A;  2NCN A;  4M8N A;  3T9L A;  3ALB A;  2O6V A;  1Z5S B;  5CHV C;  5CX3 A;  2YVC A;  2KX0 A;  3WIM A;  4G11 A;  3GZN I;  4OVV A;  2NBV B;  3EC8 A;  2KDE B;  2Z59 B;  1TGZ B;  2KK8 A;  3R7R A;  4J6I A;  3VDZ A;  4B9K A;  1UH6 A;  1CMX B;  1J19 A;  3H7P A;  3JSV B;  2DAJ A;  2PE6 B;  2JUO A;  4HDO A;  4II3 B;  3UF8 A;  2LJ5 A;  1P98 A;  1LFD A;  1RAX A;  1WJ6 A;  4W9E A;  3VTU A;  1OGW A;  2REX A;  3W1S A;  3KUD B;  2CHX A;  3MHS D;  1S1Q B;  2DHZ A;  2JZZ A;  3CF6 E;  3IHP C;  3R3M A;  4ANW A;  1U4A A;  5CTR C;  1WH3 A;  1P3Q U;  4GSW A;  2NBW B;  4RMA A;  1WXM A;  3X23 A;  4ICV A;  1I42 A;  4DHZ B;  3VHT C;  3EFU A;  1J0G A;  4KZC A;  2LGY A;  1R4M I;  4ZRK A;  2VRR B;  1VD2 A;  1NDD A;  2LVO A;  4I6L B;  1UD7 A;  3HHM A;  3N30 A;  2LAS A;  3QCA A;  2KLG A;  3DBH I;  4GOC A;  2KFK A;  3PRZ A;  3N32 A;  4JGH B;  3ZNZ B;  1WJN A;  2L7R A;  1H4R A;  5TR5 A;  2EMT A;  2C7H A;  5LXH A;  3PV1 A;  2G4S A;  1C3T A;  3PRM B;  4MJS B;  3T8M A;  3QIJ A;  1UBI A;  4FBJ B;  4WWP A;  1WX8 A;  4BOZ B;  3ONS A;  3BY4 B;  2MWS B;  3TBL D;  5LLI A;  3WAM A;  4BKG A;  1Y8R C;  4KDI C;  2CR5 A;  4KVG B;  2A5U A;  2GMI C;  1RLF A;  2KDF B;  2D10 A;  2GBR A;  1M94 A;  2ZJD A;  2FCM A;  4GDK B;  4MGZ E;  3SU8 X;  2K1F A;  3AXC A;  2NPT B;  1JRU A;  4KDL B;  2BGF A;  5J17 A;  2MCN B;  3RZF A;  4XZ4 A;  4IM2 A;  3N3K B;  2JVC A;  2LRU A;  2LVQ A;  4B6W A;  4BBN C;  2MBH A;  1P9D U;  2W9N A;  3DDC B;  2BYE A;  3U30 A;  1UZX B;  2KQ7 A;  2N9X A;  1WJ4 A;  3K9O B;  4W9C A;  1E7V A;  1G6J A;  3QAQ A;  4EFO A;  2GOW A;  3PRE A;  4BVU C;  4W9D A;  4MGK E;  2FCQ A;  2UYZ B;  2G4D B;  3ZTD A;  4DWF A;  1D3Z A;  3V62 A;  2B3A A;  2DAF A;  2XK5 A;  5EDS A;  4F1S A;  4I6N B;  2DYB A;  2LXC A;  2JZ3 B;  2LD9 A;  3NS8 A;  1Q1O A;  4NQK E;  1WRD B;  2G3Q B;  3UQA A;  5CHF A;  2Z0D B;  2MSE D;  2R2Q A;  3A1Q B;  3D32 A;  3L54 A;  4PYU A;  3VFK A;  4NJ7 A;  1WGR A;  3QC8 B;  2BKR B;  4ZRI A;  1EO6 A;  1V5T A;  2ZEQ A;  3PSE B;  2LRW A;  1P0R A;  3ZO5 B;  3DOW A;  4W9K A;  4JL9 A;  4GIV A;  2LGD A;  5AEK B;  2L76 A;  2K25 A;  1LM8 B;  2KXJ A;  3KH0 A;  4MM3 A;  4WJO A;  1WR6 E;  5E6O A;  4EZL A;  1YX5 B;  4NAW A;  4KSK C;  3NY5 A;  2MLB A;  1GC6 A;  4K81 A;  3UIO B;  1KM7 A;  4AP4 C;  3JSV A;  3PTF C;  3A9K B;  3IVF A;  3QX1 A;  4GU2 A;  1EUV B;  2C7M B;  3V61 A;  3O65 B;  3PS6 A;  3V6C B;  3A9J A;  3ZW3 A;  2D07 B;  4EUT A;  2C5L C;  2PEA A;  3RT3 B;  2D11 A;  3HM6 X;  4G0N B;  4N9F 4;  2KD0 A;  1E90 A;  4F8C B;  4KIK B;  2AL6 A;  4FJV B;  3ZVV A;  4AUQ C;  2PE9 A;  3L16 A;  1E8Y A;  3K9P B;  1WMH A;  4DHZ E;  2UWQ A;  2KO3 A;  1XD3 B;  2KOX A;  3M63 B;  4WQO B;  3TL5 A;  2ZVO A;  1WY8 A;  2C60 A;  2HTH A;  2ZNV C;  1WM2 A;  3KYC D;  3UIN B;  3SDL C;  2FUH B;  3MJW A;  1WE6 A;  4BBN F;  1WXS A;  2M4N A;  2N1W A;  1WIA A;  3VH3 B;  1C1Y B;  1V80 A;  2GBK A;  1LXD A;  1YX6 B;  3ZTC A;  2C9W B;  2EMS A;  3NZU A;  4EEW A;  4HLE A;  3NZS A;  5C23 A;  4E3C A;  5IA7 A;  2KHW B;  1GC7 A;  2JY6 A;  2LZ6 A;  2JRI B;  3B1L X;  4JIO U;  5IAA C;  1WFY A;  2RD0 A;  2D3G A;  1SE9 A;  5D6J B;  1J8C A;  4BKS D;  1V86 A;  2LGX A;  2IBI B;  2KTR A;  4NPN A;  4FAD A;  4FA6 A;  3WAP A;  1WX7 A;  1WX9 A;  4YL8 A;  3DVN V;  3RYT A;  4P7I A;  2C7N B;  4W9I A;  2XBB C;  1WGG A;  1ISN A;  3PT2 B;  3U7D A;  1YIW A;  3ZLZ A;  2DEN B; 
#chains in the Genus database with same CATH topology
 1YQ4 B;  2N9L A;  4DDI D;  1FEH A;  2R61 A;  4WJN A;  5GMV A;  2KJR A;  2JRH A;  3UIP B;  3LDZ E;  1OFF A;  4R3D A;  1TS2 A;  2SEB D;  1PGB A;  2BS3 B;  2GI9 A;  2M8S A;  2W3S A;  2VH2 A;  3M95 A;  1QF6 A;  4MSQ B;  1S3S G;  2LWP A;  1XLQ A;  2L52 A;  3TJP A;  1F2R C;  1OQR A;  1QZE A;  4KSL C;  1WGY A;  1F1H A;  1NBF C;  3P4S B;  2KMC A;  2LHE A;  1JAL A;  1MVK A;  1SE2 A;  1FIQ A;  1R4N I;  1SJH D;  2WXL A;  4GGQ A;  3R66 C;  3HVD A;  1F52 A;  2BF8 B;  1NVI D;  1ZGU B;  3GP7 A;  4LNK A;  4WWN A;  4HWI B;  2KTF A;  2K39 A;  3VTW A;  3ABV B;  2HD5 B;  3ZXV A;  2JPH A;  3ZRC A;  3BVG A;  4A6Q A;  1BXT A;  3QAR A;  3A4R A;  4MEM A;  2QIE B;  1JRP A;  2NTT A;  1XT9 B;  2D5G A;  4A8X C;  1L4Z B;  1L0X B;  2WXK A;  2MBB B;  1WRI A;  5LXI B;  4ANX A;  2QDF A;  3IG3 A;  4CYE A;  4FHJ A;  2JT4 B;  2V3S A;  2BVC A;  2QHO A;  1NI2 A;  1C4C A;  3TIX A;  1TIF A;  5KHO A;  1YN4 A;  1MG4 A;  1HA5 A;  2VZK D;  4L1B A;  4DXG A;  1Q5W B;  1N60 A;  1N61 A;  1E8Z A;  3HRD D;  1I4G A;  1FNW A;  2AL3 A;  5JXV A;  1R4N B;  1YQB A;  2MJD A;  5DPW A;  1X1M A;  3BYT B;  2JF5 A;  2N9E B;  1QLB B;  3NVW A;  3AE2 B;  3Q3N C;  4MM3 B;  5IP4 D;  1BML C;  3RUI B;  2BWE S;  4EZK A;  2AYO B;  5E6J A;  3A9J B;  3KVF B;  1D5X C;  5L95 C;  3ZJU A;  2KMA A;  1SGH A;  4OHJ A;  1IP9 A;  2N1V A;  3N9Y C;  1WMH B;  3NHE B;  4XX5 A;  3V60 A;  3KUZ A;  2WYQ A;  1WXA A;  2CU1 A;  1RRB A;  2MW5 A;  1WE7 A;  2GBN A;  2L83 A;  5D94 A;  1TKE A;  1ACC A;  4DXF A;  3A1Q A;  1UWM A;  3V05 A;  3AEG B;  1GUA B;  3RNF C;  1I4H A;  2JYE A;  2KTR B;  3LJ3 A;  2NMQ A;  1GAQ B;  2L00 B;  4CO7 A;  1TTN A;  4MDK E;  2I38 A;  3W1Y A;  2N0S B;  3HM3 A;  1GNU A;  2IO2 B;  5JZE B;  1DOY A;  4WJP A;  4FXC A;  2J0M A;  5EE9 A;  1L2N A;  1TBE A;  4KGS A;  2V0G A;  1FMA D;  1JML A;  1V9J A;  3TCA A;  2HJ1 A;  2JSV X;  4HCN B;  3PGE A;  2DZM A;  2WXF A;  1E7P B;  3A33 B;  2V1Y A;  2KQS A;  2CHW A;  2WDV B;  4RGM A;  2RSU A;  2GRI A;  2BS4 B;  4NY0 A;  5JH5 C;  3KQ4 A;  1WWT A;  4CQN A;  3AE6 B;  4NJ6 A;  1T5X D;  2L1A A;  2WXM A;  3EEC A;  2PW9 A;  2YLM A;  2RGF A;  3W1S C;  4GB9 A;  1RFK A;  1UGM A;  1Q0W B;  3VUX A;  5DPT A;  1E8X A;  1Z2M A;  2DZJ A;  2NVU I;  3W2D A;  3CSF A;  4IWP A;  4X57 B;  1KFY B;  1V8C A;  2LVP A;  2N7D A;  1R4M B;  1UNS A;  3SHQ A;  2DZI A;  2K6D B;  1DOX A;  4WH4 A;  2WXR A;  4XC2 A;  3OJ4 B;  4YWG G;  1I4X A;  1UWX A;  5IKC M;  3L4P A;  1AAR A;  3SFE B;  3AM9 A;  3DVG Y;  4PS3 A;  1QOF A;  3ALB A;  2O6V A;  1YJI A;  4YT0 B;  3EC8 A;  2Z59 B;  4B9K A;  3VDZ A;  3ZGZ A;  3H7P A;  2HTM E;  3AED B;  3JSV B;  2DAJ A;  2PE6 B;  5D3D A;  3UF8 A;  2J52 A;  1OGW A;  4ZHP A;  1V1P B;  1N62 A;  3IHP C;  1VZ6 A;  1ZXI A;  3CF6 E;  4ANW A;  1ET9 A;  5CTR C;  1P3Q U;  3NVZ A;  2NBW B;  4ZRQ A;  3VHT C;  3EFU A;  1J0G A;  3R2T A;  4KZC A;  1NDD A;  2LVO A;  3QCA A;  3HHM A;  2LAS A;  2KFK A;  4RGT A;  2L7R A;  2WXO A;  1RWS A;  1JRO A;  2C7H A;  3QIJ A;  3SR6 A;  1SE3 A;  1PGX A;  1XEE A;  4LNI A;  2CR5 A;  4KVG B;  1ZDV A;  1FXI A;  1M94 A;  2FCM A;  4GDK B;  4MGZ E;  1YOV B;  1F2R I;  3URY A;  1LGR A;  3IT4 B;  2MCN B;  4XZ4 A;  3N1Y C;  2LRU A;  5BYR A;  2W54 A;  2ON8 A;  4BBN C;  2ZW0 A;  2N9X A;  2UU7 A;  1DGJ A;  1WJ4 A;  1G6J A;  1ZOY B;  2K0P A;  4EFO A;  3ZTD A;  5EE3 A;  2DAF A;  2Y3A A;  1V97 A;  3O13 A;  2DYB A;  2JZ3 B;  3NS8 A;  1XLO A;  1WRD B;  2G3Q B;  5IOI A;  3UQA A;  3D32 A;  3VFK A;  4NJ7 A;  4REZ A;  3PSE B;  2LRW A;  2LFI A;  1L6V A;  2YEP F;  3ZO5 B;  2WDQ B;  3NVY A;  1AYF A;  2K22 A;  2SAK A;  5E6O A;  4NAW A;  4KSK C;  1GC6 A;  3PTF C;  4GU2 A;  3AE5 B;  2LJI A;  3O65 B;  3V6C B;  1SE4 A;  2D07 B;  1QOA A;  3RT3 B;  2D11 A;  4F8C B;  4KIK B;  2BS2 B;  3C19 A;  3ZVV A;  4AUQ C;  1N5W A;  4EE2 A;  3K9P B;  1EWC A;  3P63 A;  3NRZ A;  4WQO B;  2KOX A;  5BMG A;  4USA A;  3TL5 A;  2KMM A;  3UIN B;  3KYC D;  1WE6 A;  4BBN F;  2M4N A;  1VR9 A;  2N1W A;  3VH3 B;  1V80 A;  2W3R A;  1GC7 A;  2FE8 A;  4AS1 A;  3EUB 2;  1WFY A;  2D3G A;  1J8C A;  2IBI B;  4WQM A;  1SJE D;  2XBB C;  1ISN A;  3PT2 B;  3U7D A;  1F0Z A;  1SXT A;  3APF A;  3Q2A C;  3AE1 B;  2WGS A;  4B0E A;  2O2V B;  3DPD A;  4GDL B;  4DXA B;  3DVG X;  3B08 A;  3DCG A;  4LJO B;  2KAJ A;  5LNK 1;  1FFV A;  4LJP B;  4DQO C;  4W9L A;  5FR6 A;  4WWO A;  4US9 A;  3WAO A;  2IY0 B;  3OG5 A;  3QK0 A;  5DPR A;  3ZKJ C;  3M62 B;  1FCC C;  5JHB A;  2I1K A;  3I3T B;  3RNA C;  3U52 E;  4ZDV A;  4B0M A;  1P1A A;  3L13 A;  1UF0 A;  2J53 A;  4ITK A;  1T0Y A;  2GLS A;  2FBW B;  4NZL B;  3U7Z A;  4JQW C;  1WGD A;  2VZK B;  3AB5 A;  4II2 B;  3VH4 B;  3SEB A;  4F7Z A;  2IGD A;  4ANU A;  1UBQ A;  3Q69 A;  2OOB B;  3A9K A;  1V1O A;  2MP2 A;  3KUC B;  5AZH A;  2AEH A;  4A20 A;  4BOS C;  1IPG A;  3ENE A;  1NYR A;  2ZZP B;  2WX1 A;  4WAF A;  3ECI A;  2N7E A;  4HXD A;  4G3X B;  4IC7 B;  1E8W A;  1MG8 A;  2KAC A;  2K9X A;  4NQL B;  2BKF A;  2O6V D;  3DVN U;  2QEJ C;  4WJQ A;  4M0W B;  3H1U A;  4ZRP A;  3APC A;  2CHZ A;  3RFZ B;  3DBL I;  4GXB A;  4MAC A;  3KYD D;  3W9C B;  3RNE C;  1K8R B;  1ZDX A;  3KWV A;  5HKH A;  3DWG C;  4LTU A;  2LEK A;  2JWZ A;  3ZXR A;  3HIZ A;  3MFG A;  3ZJT A;  4I6P A;  2N9P C;  2DBY A;  2KJ6 A;  1IUE A;  4HVB A;  2CS4 A;  3FIL A;  3EHV A;  3GE8 C;  3IXS A;  2KC2 A;  3PHX B;  2BPS A;  2ONQ A;  5AZF A;  2KDB A;  1KLG D;  2AQ2 B;  1JWB D;  4YXD B;  4IG7 B;  1FO4 A;  4XGA B;  3FAH A;  2RDB C;  2V4I B;  4Q2J A;  3MHZ A;  2NR2 A;  2RDH A;  3LXF A;  1Q10 A;  2Y5B B;  3ZIM A;  5KHQ A;  3B2F A;  4J3O D;  3ZNI D;  1A5R A;  1YJJ A;  2WXP A;  4AJY B;  4BKT A;  1V5O A;  1K50 A;  1KRH A;  4BFR A;  2A4Z A;  1XLN A;  2JYT A;  3NS1 A;  3DHI C;  3W5V B;  2MX2 A;  5L83 A;  1VCB A;  1GJZ A;  3DBL B;  2EKI A;  2KKC A;  4LCD E;  4AWJ A;  3CMM B;  3Q8C A;  3R7Q A;  1CQV A;  3C0R B;  4FUL A;  4GMV A;  4GN1 A;  4W9J A;  3DHG C;  4LDT D;  2LXA A;  2RR9 A;  1ESF A;  4O1N A;  3AEB B;  1T6B X;  3PZ7 A;  3V6E B;  5G55 A;  2OHF A;  3R2I A;  1XO3 A;  2JX5 A;  1FRD A;  3BK1 A;  1WM3 A;  2IO1 B;  1V81 A;  2ASQ A;  2MH7 A;  1R7S A;  1TS4 A;  2KN5 A;  2KJH B;  5E6N A;  1FXT B;  2KZR A;  3A4S C;  2XEW A;  4YTP B;  3VAW A;  5IO9 A;  2IGH A;  1C76 A;  1WF9 A;  3AMZ A;  1WZ3 A;  3IAS 1;  1N63 A;  1GG3 A;  5E6P A;  1V6E A;  1DOI A;  4PS7 A;  1WYW B;  2YEP B;  3Q3M C;  4W9F A;  2DYM A;  2MA9 B;  4K7S A;  3ZDM C;  2ZVN A;  1T0R C;  1RM6 C;  1E5W A;  4M8N A;  4KKI A;  5CHV C;  3T3O A;  2WXH A;  5CX3 A;  3KWL A;  1MHX A;  2KX0 A;  2Q5W D;  1PGA A;  1MI0 A;  2INC C;  4J6I A;  4JE3 B;  3DWM A;  1UH6 A;  1CMX B;  1P7E A;  1TJE A;  1FNV A;  3ZQ4 A;  1FFU A;  1L4D B;  2LJ5 A;  3R3M A;  2JZZ A;  4OVZ A;  1VZ8 A;  2V3P A;  2DWQ A;  3X23 A;  4H2A A;  3BYY B;  1NEK B;  4ICV A;  1I42 A;  3NJT A;  4HRO A;  2N7J A;  4M00 A;  1DYQ A;  4RCO A;  1R4M I;  4ZRK A;  4I6L B;  3N30 A;  4GOC A;  2KLG A;  3N32 A;  1KTK A;  1H4R A;  1WJN A;  1QKZ A;  4P1B C;  1TYG B;  2G1E A;  3OWE B;  4FBJ B;  1WX8 A;  4A9A A;  3BVM A;  5LLI A;  4BKG A;  4HKQ A;  1ET6 A;  5C3J B;  2GMI C;  1I4Q A;  4C56 C;  1FXA A;  2KDF B;  3SU8 X;  1AW7 A;  2ACZ B;  3AEF B;  4KDL B;  2BGF A;  2INN E;  2KT7 A;  2LVQ A;  2MBH A;  3DDC B;  5H8Y E;  3U30 A;  1UZX B;  5HG2 A;  2JQR B;  4P1C C;  2J42 A;  5GXG B;  1E7V A;  4C7Y A;  4BVU C;  4XWT A;  4W9D A;  2FCQ A;  1I4R A;  4N59 A;  2XK5 A;  4ARC A;  2LXC A;  1GPX A;  2LD9 A;  4NQK E;  5CHF A;  1D4B A;  1CZP A;  3A1Q B;  2M19 A;  1WGR A;  2BKR B;  4ZRI A;  1EO6 A;  1V5T A;  1K53 A;  3Q8A A;  2WXQ A;  2K25 A;  4ACF A;  2KXJ A;  4IDI A;  4WJO A;  4EZL A;  3ETR A;  2MLB A;  1Y56 A;  3UIO B;  3JSV A;  3QX1 A;  2BTE A;  1KLU D;  2C5L C;  2PEA A;  4N9F 4;  1E90 A;  4OZB A;  4FJV B;  2PE9 A;  1E8Y A;  4DHZ E;  2X38 A;  1XD3 B;  3M63 B;  3MP9 A;  1TT5 B;  2C60 A;  2HTH A;  3W5U B;  1WM2 A;  1SIJ A;  2MHJ A;  2MJ3 A;  1LXD A;  1YX6 B;  2EMS A;  2M0A A;  4EEW A;  4HLE A;  1GB4 A;  3NZS A;  5C23 A;  1P7F A;  1FD6 A;  1HZ6 A;  2CJO A;  4RF1 A;  3RN9 C;  1V86 A;  4TSS A;  1KH0 A;  4K3C A;  4NPN A;  1QIL A;  4FAD A;  1E6E B;  4KX6 B;  1WX7 A;  1WX9 A;  3DVN V;  4QAY A;  3RYT A;  3V3X A;  3T3N A;  1WGG A;  3ZLZ A;  4C00 A;  2DEN B;  2WXN A;  1XCQ L;  4IUM B;  3SFD B;  3R8B A;  2BB6 A;  3L10 B;  1T0S C;  3AH7 A;  2L8J A;  4G50 A;  4HJG E;  3GE3 C;  2O6V B;  2M17 A;  3AV8 A;  4E71 A;  2W55 A;  2WX0 A;  2IND C;  3TMP B;  3L08 A;  3H9D A;  5I4D A;  3IFW B;  4KV2 A;  1BT0 A;  1LO5 D;  2N4F A;  2D3B A;  3H7P B;  2WDR B;  4AQ7 A;  1E9M A;  3BII D;  3Q3O C;  1FCL A;  4XDD A;  2GBJ A;  2KFJ A;  2LUE A;  3ZNH B;  4KZ0 A;  1PQS A;  4LNF A;  2HJ8 A;  2JXT A;  4C4V A;  4ASW C;  1HXY D;  2AQ3 B;  3SD5 A;  4A3P A;  3MC8 A;  4ICU A;  2AWT A;  1V2Y A;  1H8C A;  4OZA A;  2RPV A;  2KFK B;  4IM0 A;  1EF1 A;  3U8Z A;  3H6N A;  5AUK A;  2KX3 A;  1IYF A;  3AEE B;  1N5X A;  5DPS A;  2ZCC A;  2HDE A;  2J7Q B;  3DQV A;  1WSP A;  1I35 A;  2PVG C;  3VUW A;  4RF0 A;  5BMH A;  3MJ5 A;  4YTM B;  1AWD A;  2GBM A;  3NG0 A;  1OEY A;  3BIN A;  1E7U A;  1FPY A;  2BYT A;  2NS5 A;  5J18 A;  1RFA A;  4ZYN A;  2IPK D;  3B9J A;  3IT6 B;  3VXW A;  1STE A;  4BAX A;  4ZOH C;  2BQQ A;  2ZCB A;  3X0W A;  5CHW A;  4XWW A;  2ICI A;  4ANV A;  1HTQ A;  2WU2 B;  2INP E;  3AEA B;  1TKG A;  4IWO A;  1LQB A;  4NJC A;  5HI1 A;  3NVV A;  1E10 A;  3PLV A;  4JX1 C;  3QWZ B;  3ZDT A;  2FNJ B;  3RD2 A;  4MJS A;  2BT6 A;  4LDT B;  2J0J A;  3Q14 C;  3BWU D;  3ZUN A;  3N20 C;  3AE9 B;  2PMV A;  4NAW B;  1ZUD 2;  3WAN A;  2WXG A;  4MT5 A;  3AI5 A;  2NPT A;  2K6Q A;  4OVU A;  2H88 B;  4FLH A;  1UEL A;  1XQQ A;  5G5G A;  3WA0 A;  1A70 A;  2RPQ A;  1I7H A;  4PYZ A;  3ML8 A;  3Q8F A;  1D5M C;  4C80 A;  2IZV B;  2OJW A;  2XNA C;  2QJL A;  5FKA C;  2VH1 A;  1VLB A;  1WI0 A;  2K8B A;  4HK2 A;  4A3O A;  4RFB A;  4W9G A;  4M01 A;  3GS2 A;  4MEL A;  3TEX A;  2MRP A;  1OEY J;  3I57 A;  3UGB B;  2LI5 A;  5D2M B;  4BKS A;  4FN2 A;  1FRR A;  1YQ3 B;  4FJY A;  4MH0 E;  2B76 B;  3PVL A;  1QT9 A;  5BO4 B;  3VQI A;  3FKY A;  3RCZ A;  1YD8 U;  1CK1 A;  2J0K A;  2ZPY A;  1TZ1 A;  3UQB A;  4HJK A;  3PLU A;  4YSY B;  1WXV A;  1VJK A;  2L0T A;  2PJH A;  2KAN A;  1C78 A;  4DHJ D;  2K5P A;  2HE7 A;  2NBU A;  2KWU B;  4PS8 A;  1ZW7 A;  3VRB B;  4TMA B;  4P6V F;  4W9H A;  3DBS A;  1NYQ A;  1YMH E;  3P4Q B;  4C7Z A;  2K8H A;  3TSS A;  1OTR B;  3I63 C;  2E6X A;  1EWY C;  3H8H A;  1WZ0 A;  4K7W A;  3AE7 B;  3S2A A;  4ARI A;  3JW0 X;  2M1M A;  2RMM A;  3APD A;  1D5Z C;  1SF0 A;  3Q3J A;  3VUY A;  1IBX A;  2L05 A;  4AJW A;  4MGY E;  3BZD B;  3ZNG C;  4GLS C;  4IM3 A;  2IYD B;  4HPM B;  2Z8L A;  3U4E G;  4RM9 A;  3L0W B;  2IO3 B;  1ZE3 D;  1VZ7 A;  1PUT A;  2BWF A;  3DHH C;  2I1J A;  4DBG A;  1L0V B;  2V4L A;  2D2Q A;  4MH8 A;  5C1Z A;  2MP2 B;  4YTN B;  3PPA A;  4L23 A;  1SIF A;  2WWZ A;  1HEZ E;  3JVZ X;  4S17 A;  3T9L A;  4BZA A;  2PIA A;  2TSS A;  3AN1 A;  4G11 A;  4OVV A;  1HTO A;  4M02 A;  5AUI A;  3TEW A;  2I2Y A;  1WGK A;  2JUO A;  4II3 B;  1SEB D;  4W9E A;  1LFD A;  1RAX A;  1WJ6 A;  1N6Z A;  3W1S A;  3KUD B;  4HRS A;  3MHS D;  2DHZ A;  1TKY A;  1WH3 A;  4GSW A;  4RMA A;  1NI3 A;  1I4P A;  3AEC B;  3WCQ A;  3TUO A;  2LGY A;  1T3Q A;  2VRR B;  1VD2 A;  1UD7 A;  3DBH I;  3ZNZ B;  3FIL B;  2M56 B;  3AE4 B;  5LXH A;  2QSD A;  2G4S A;  3T8M A;  1C79 A;  4BOZ B;  3ONS A;  2WQY B;  1ZP0 B;  3E56 A;  3WAM A;  1Y8R C;  1L5P A;  2CJN A;  4N58 A;  2D10 A;  2GBR A;  2BBC A;  2ZJD A;  1FM0 D;  2K1F A;  1JRU A;  2V3N A;  3RZF A;  2KYW A;  4B6W A;  2KQ4 X;  4RH6 A;  1P9D U;  2W9N A;  3EA6 A;  1PYW D;  2D3A A;  5H92 C;  2KQ7 A;  4W9C A;  2AX5 A;  3MC0 B;  2GOW A;  4XYC A;  4MGK E;  2Y5C A;  2UYZ B;  2G4D B;  1D3Z A;  2E3T A;  1Q1O A;  2NTS A;  3J9C A;  1E0Z A;  2MSE D;  2R2Q A;  3Q8E A;  2LGI A;  1F77 A;  3QC8 B;  2ZEQ A;  3Q8B A;  3N1X C;  3DOW A;  4ZHO A;  4JL9 A;  2LGD A;  5AEK B;  2BB5 A;  2L76 A;  1LM8 B;  3KH0 A;  3EGR A;  4MM3 A;  1WR6 E;  1YX5 B;  4K81 A;  3EFC A;  3DBH B;  3N1Z C;  1QOB A;  2C7M B;  3A9J A;  2MEK A;  1PDX A;  1SB3 C;  4EUT A;  5C2T B;  4YSX B;  3HM6 X;  4G0N B;  1HZ5 A;  4HEA 1;  4HPP A;  2WHI A;  2QMT A;  3CIR B;  1WMH A;  3IAM 1;  2UWQ A;  4UDU C;  2KO3 A;  2ZVO A;  4KGT A;  1EU3 A;  4PT5 A;  3SDL C;  1JWA D;  3MJW A;  1WXS A;  3I5J C;  1WIA A;  1C1Y B;  2GBK A;  3ZTC A;  3NZU A;  5IA7 A;  3PZ8 A;  2KHW B;  2JY6 A;  1XXG A;  4JIO U;  5IAA C;  4LK0 M;  1SE9 A;  5D6J B;  4BKS D;  2LGX A;  2KTR A;  3WAP A;  1C4A A;  1JWU D;  4YL8 A;  4W9I A;  2PVO D;  1YIW A;  1L0Y B;  2QIL A;  2LMC A;  4FJZ A;  5D7G A;  2PTL A;  2KLC A;  2IO0 B;  4WAA A;  5MPO A;  1FNU A;  5TSS A;  1KOT A;  2WDT B;  5DCN A;  1ZXH A;  3BK2 A;  2MQJ A;  1ZPS A;  2WP9 B;  3QJZ A;  3QHT A;  1V49 A;  1VRA B;  1TS3 A;  1EU4 A;  2G45 B;  4FHK A;  5T8I A;  4ZYS A;  2PPH A;  2WXI A;  4CHK A;  4A55 A;  5JHA A;  1TY2 A;  2FCN A;  3MC9 A;  3RPF C;  2DX5 B;  1HE8 A;  1GB1 A;  2ZPN A;  2KN4 A;  2BYV E;  1EM7 A;  4TUU A;  3I9V 1;  4MSM B;  2IDY A;  2CKH B;  2WS3 B;  4WWM A;  4A90 A;  2L3Z A;  4NNJ B;  1KLV A;  3M3J A;  3AE3 B;  2M0X A;  4NAM A;  3P1M A;  4TQ1 A;  4JPS A;  2FIF A;  3CWI A;  3HK0 A;  2KNB A;  4L2Y A;  1SBB B;  2FAZ A;  5AZG A;  4RGO S;  4IWQ A;  3TEZ A;  2JZP A;  3PRP B;  1C4P A;  2MBE A;  3P4R B;  1WJU A;  3AE8 B;  5HFY A;  4DK5 A;  3VTV A;  3AU4 A;  3CST A;  2L0F A;  3ZRF A;  1RYJ A;  2IJ0 A;  1B9R A;  1ZKH A;  4HPL B;  2MBO A;  2R2O A;  1WGH A;  2OJR A;  1V1P A;  2FID A;  4TV3 A;  2Y5P A;  4K7U A;  3FC4 A;  1SSN A;  1KF6 B;  3AU5 A;  3L17 A;  3OLM D;  4KKJ A;  4IW0 A;  1UUP A;  2JWU A;  2XK5 B;  4XE0 A;  4HDQ A;  3RUL A;  1K52 A;  1J7B A;  4AOF A;  3OAW A;  2KDI A;  2KDM A;  3P42 A;  4RNA A;  1XLP A;  2K8C A;  4YSZ B;  2H89 B;  5FK9 C;  4B95 A;  1ENF A;  2XN9 C;  4P16 A;  4DHJ B;  2LGS A;  3IBE A;  4GDK A;  3Q3F A;  4JLC A;  1YJ1 A;  4TQ0 A;  4HCP B;  2J4X A;  4XDC A;  3NUH B;  3E9S A;  2LHD A;  2EKE C;  4D2K A;  2FCS A;  1WYG A;  2JXX A;  1KJT A;  4ZRJ A;  5J2R A;  1WR1 A;  3VRA B;  3TEY A;  1EF5 A;  1MFW A;  1VDV A;  1YNT E;  1J7A A;  4EZJ A;  2PKO A;  2KWV B;  1IGC A;  4IOI E;  5G2N A;  2QC8 A;  4S0R A;  1C77 A;  3AUL A;  3KLS X;  5FR3 A;  1BUI C;  1F9J A;  2KVR A;  1JWS D;  4RM8 A;  4K1R B;  1IGD A;  5EE1 A;  4EOY A;  1OQY A;  2WLB A;  3GOE A;  3B0A A;  2WXJ A;  1TY0 A;  3QA8 A;  1ROE A;  1JQ4 A;  4EKU A;  3MTN B;  1AN8 A;  3QQ8 B;  4E74 A;  4US8 A;  1NEN B;  4KIK A;  5BYS A;  2DZK A;  2MBQ A;  2ZNV B;  2RDG A;  1L7Y A;  4HKZ E;  3RZW C;  3VVW B;  4URK A;  2DYO A;  2WU5 B;  2KC1 A;  2BYF A;  3OJ3 A;  2KWC A;  2MJE A;  4OZC A;  1YN5 A;  4C4V B;  4IKG A;  2IY1 B;  3ML9 A;  3PHW B;  3DBR I;  1MHH E;  4MGI E;  1J7C A;  4DDG D;  4M8M A;  1MJD A;  2X8X X;  2Z0E B;  2W82 A;  3P2B A;  3PZD A;  4OW0 A;  2DLB A;  3JYU A;  1M4V A;  1YN3 A;  2O2V A;  4GDL A;  4TKN A;  3ZYY X;  3NZ3 A;  1K51 A;  3KW5 B;  2GB1 A;  3H7S A;  3NOB A;  2NCN A;  1WXQ A;  1Z5S B;  2IGG A;  2N9K A;  2WNM A;  2YVC A;  2V9H A;  3HVZ A;  3WIM A;  3GZN I;  2ZW1 A;  2NBV B;  1HQR D;  3B2G A;  2KDE B;  1TGZ B;  2KK8 A;  1L6U A;  2JU6 X;  3R7R A;  3RI7 C;  3RMK C;  1J19 A;  3RNB C;  4WUR A;  4HDO A;  3WAL A;  1P98 A;  3VTU A;  2REX A;  2CHX A;  3RNC C;  1S1Q B;  1U4A A;  3PO0 A;  1WXM A;  4DHZ B;  3U2S C;  4K3B A;  4JGH B;  3PRZ A;  5TR5 A;  2EMT A;  3PV1 A;  2OED A;  1C3T A;  3PRM B;  4MJS B;  1UBI A;  4WWP A;  5G5H A;  3BY4 B;  2MWS B;  1TS5 A;  3TBL D;  2L32 A;  3ZJV A;  3DBR B;  4WIP A;  4KDI C;  2FUG 1;  2A5U A;  1RLF A;  3GB1 A;  4M0W A;  3AXC A;  2NPT B;  2DNF A;  5J17 A;  4IM2 A;  3BVZ A;  2JVC A;  3N3K B;  5HHD G;  2K3U A;  1B1Z A;  4LNN A;  2BYE A;  1MPE A;  2AQ1 B;  3K9O B;  2CU3 A;  3LYY A;  4PK1 A;  1PFD A;  2D3C A;  3QAQ A;  3PRE A;  3GZN B;  1CJE A;  5BYQ A;  4RGN A;  4DWF A;  4JWS C;  3V62 A;  2B3A A;  1TZO A;  5EDS A;  4F1S A;  4I6N B;  3HUI A;  3C8Y A;  2BW2 A;  2KWD A;  2Z0D B;  1C9F A;  2PLP A;  3L54 A;  4PYU A;  4JWU C;  3VR8 B;  1OQQ A;  1P0R A;  2EEL A;  4W9K A;  4LLG M;  2QCZ A;  4GIV A;  1JWM D;  3NY5 A;  1KM7 A;  3RNG C;  3UI3 A;  4AP4 C;  3VR9 B;  1JW9 D;  3A9K B;  3IVF A;  1EUV B;  1GOZ A;  3V61 A;  3PS6 A;  1XF5 L;  3ZW3 A;  1UGJ A;  1QQR A;  5EE0 A;  2KD0 A;  2AL6 A;  1XCT L;  5BMI A;  3L16 A;  4LNO A;  2LUM A;  1WY8 A;  2ZNV C;  3P4P B;  2FUH B;  1QOG A;  5IN7 A;  2G9H D;  1JCK B;  1IBX B;  1T0Q C;  2C9W B;  4E3C A;  2LZ6 A;  2JRI B;  3B1L X;  3LB8 C;  2RD0 A;  4KGR A;  1D6E C;  4FA6 A;  2KVZ A;  4N6E B;  3Q6B A;  4P7I A;  2C7N B;  5D3I B; 
#chains in the Genus database with same CATH homology
 3APF A;  4IUM B;  4DDI D;  2O2V B;  3DPD A;  4GDL B;  4DXA B;  3DVG X;  3B08 A;  3L10 B;  4WJN A;  5GMV A;  2KJR A;  3DCG A;  2JRH A;  3UIP B;  4LJO B;  3LDZ E;  4FJZ A;  5D7G A;  2KLC A;  2IO0 B;  2L8J A;  4G50 A;  4WAA A;  4LJP B;  2O6V B;  2M17 A;  2WDT B;  4W9L A;  5DCN A;  5FR6 A;  1KOT A;  4WWO A;  2M8S A;  3WAO A;  3M95 A;  2MQJ A;  4E71 A;  2IY0 B;  3QK0 A;  2WX0 A;  5DPR A;  3QJZ A;  3TMP B;  3L08 A;  3QHT A;  3H9D A;  1V49 A;  4MSQ B;  3ZKJ C;  3M62 B;  3IFW B;  4KV2 A;  5JHB A;  1BT0 A;  2G45 B;  4FHK A;  1S3S G;  2I1K A;  2LWP A;  2PPH A;  2N4F A;  3TJP A;  3H7P B;  4CHK A;  3I3T B;  5JHA A;  1QZE A;  2FCN A;  4KSL C;  1WGY A;  1NBF C;  4ZDV A;  2KMC A;  2DX5 B;  1HE8 A;  1P1A A;  2GBJ A;  2KFJ A;  2LUE A;  3ZNH B;  4KZ0 A;  1PQS A;  3L13 A;  2ZPN A;  1R4N I;  2HJ8 A;  4GGQ A;  2BYV E;  4TUU A;  1T0Y A;  3R66 C;  4MSM B;  4ASW C;  2CKH B;  2BF8 B;  1ZGU B;  3SD5 A;  4JQW C;  4A3P A;  2L3Z A;  4NNJ B;  1KLV A;  4WWN A;  1WGD A;  3M3J A;  4HWI B;  4ICU A;  2KTF A;  2AWT A;  2K39 A;  4II2 B;  1V2Y A;  3VH4 B;  3VTW A;  1H8C A;  4F7Z A;  2M0X A;  2KFK B;  4ANU A;  4IM0 A;  2HD5 B;  4TQ1 A;  2JPH A;  1UBQ A;  3ZRC A;  2OOB B;  3A9K A;  1EF1 A;  3U8Z A;  2FIF A;  3H6N A;  3KUC B;  2MP2 A;  5AZH A;  2AEH A;  4A20 A;  2KX3 A;  4BOS C;  1IPG A;  3HK0 A;  2KNB A;  1IYF A;  3ENE A;  2FAZ A;  2ZZP B;  2WX1 A;  5AZG A;  3QAR A;  3ECI A;  2N7E A;  4HXD A;  4IWQ A;  5DPS A;  3A4R A;  4G3X B;  3PRP B;  2MBE A;  2ZCC A;  4IC7 B;  1E8W A;  1MG8 A;  4MEM A;  2J7Q B;  3DQV A;  4NQL B;  2BKF A;  2O6V D;  1WJU A;  1XT9 B;  3DVN U;  1I35 A;  4DK5 A;  3VTV A;  4WJQ A;  4M0W B;  3H1U A;  3AU4 A;  3CST A;  3VUW A;  2L0F A;  3ZRF A;  3APC A;  2CHZ A;  2MBB B;  5LXI B;  1ZKH A;  2GBM A;  4ANX A;  4HPL B;  1OEY A;  3DBL I;  4GXB A;  3BIN A;  2MBO A;  3IG3 A;  2R2O A;  1E7U A;  3KYD D;  4FHJ A;  4CYE A;  1WGH A;  2JT4 B;  2V3S A;  2NS5 A;  2OJR A;  5J18 A;  1RFA A;  4ZYN A;  2QHO A;  1K8R B;  1NI2 A;  2FID A;  4TV3 A;  4K7U A;  3VXW A;  3TIX A;  5HKH A;  3AU5 A;  3L17 A;  2JWZ A;  3OLM D;  5KHO A;  2ZCB A;  4IW0 A;  3X0W A;  5CHW A;  4ANV A;  2XK5 B;  3HIZ A;  4I6P A;  2N9P C;  2KJ6 A;  4HDQ A;  3RUL A;  4HVB A;  2CS4 A;  4IWO A;  1LQB A;  3EHV A;  4AOF A;  3OAW A;  1Q5W B;  3PLV A;  1E8Z A;  3QWZ B;  3ZDT A;  2FNJ B;  2KC2 A;  3PHX B;  2KDI A;  3RD2 A;  2BPS A;  4MJS A;  5AZF A;  2AL3 A;  2K8C A;  2KDB A;  4LDT B;  1YQB A;  2J0J A;  5DPW A;  4B95 A;  1X1M A;  2JF5 A;  2N9E B;  3ZUN A;  4DHJ B;  4NAW B;  4IG7 B;  3IBE A;  3WAN A;  4GDK A;  3AI5 A;  3RUI B;  2NPT A;  3WAL A;  2K6Q A;  2BWE S;  3Q3F A;  2NR2 A;  1YJ1 A;  4JLC A;  4OVU A;  4TQ0 A;  4HCP B;  4EZK A;  2AYO B;  3A9J B;  4FLH A;  1UEL A;  1XQQ A;  3WA0 A;  3KVF B;  2RPQ A;  2Y5B B;  4PYZ A;  3ZIM A;  3ML8 A;  5KHQ A;  5L95 C;  2KMA A;  1SGH A;  2IZV B;  3ZNI D;  1A5R A;  2EKE C;  1IP9 A;  2N1V A;  2FCS A;  2JXX A;  1WI0 A;  1WMH B;  1KJT A;  3NHE B;  4XX5 A;  4AJY B;  2K8B A;  4HK2 A;  3V60 A;  3KUZ A;  4BKT A;  1V5O A;  2WYQ A;  1WXA A;  4ZRJ A;  1WR1 A;  5J2R A;  4BFR A;  1EF5 A;  1RRB A;  2CU1 A;  4A3O A;  2A4Z A;  2MW5 A;  1WE7 A;  4W9G A;  2GBN A;  4MEL A;  2MX2 A;  5L83 A;  1VCB A;  5D94 A;  2MRP A;  1GJZ A;  4EZJ A;  2KKC A;  1OEY J;  4LCD E;  4AWJ A;  3UGB B;  2KWV B;  2LI5 A;  3CMM B;  3A1Q A;  5D2M B;  5G2N A;  4BKS A;  4FN2 A;  3R7Q A;  4FJY A;  1GUA B;  4MH0 E;  3PVL A;  3C0R B;  4FUL A;  3AUL A;  5BO4 B;  3VQI A;  4GMV A;  4GN1 A;  2KTR B;  3LJ3 A;  4W9J A;  3RCZ A;  1YD8 U;  4LDT D;  4CO7 A;  2J0K A;  2L00 B;  2LXA A;  2ZPY A;  2RR9 A;  1F9J A;  1TZ1 A;  3UQB A;  2KVR A;  4HJK A;  3PLU A;  1TTN A;  4RM8 A;  4K1R B;  4MDK E;  3V6E B;  5G55 A;  1WXV A;  4EOY A;  3W1Y A;  2L0T A;  1GNU A;  1OQY A;  2IO2 B;  2KAN A;  2PJH A;  3HM3 A;  5JZE B;  4WJP A;  4DHJ D;  2J0M A;  2HE7 A;  2NBU A;  3GOE A;  2KWU B;  1L2N A;  1TBE A;  4PS8 A;  1ZW7 A;  3B0A A;  3QA8 A;  1V9J A;  1WM3 A;  3TCA A;  2IO1 B;  4W9H A;  3DBS A;  4EKU A;  1V81 A;  3MTN B;  4HCN B;  3PGE A;  3QQ8 B;  2ASQ A;  4E74 A;  2K8H A;  2DZM A;  3A33 B;  1OTR B;  4KIK A;  2V1Y A;  2KQS A;  2KN5 A;  1WZ0 A;  2CHW A;  2DZK A;  2KJH B;  2RSU A;  4K7W A;  3S2A A;  2MBQ A;  3JW0 X;  2ZNV B;  2M1M A;  5E6N A;  1FXT B;  1L7Y A;  2KZR A;  3APD A;  3RZW C;  3A4S C;  3VVW B;  4URK A;  4NY0 A;  5JH5 C;  2DYO A;  2XEW A;  2KC1 A;  4NJ6 A;  3VAW A;  3Q3J A;  3VUY A;  2BYF A;  3EEC A;  2L05 A;  4AJW A;  4MGY E;  2YLM A;  2RGF A;  2KWC A;  3OJ3 A;  3W1S C;  4GB9 A;  1UGM A;  3ZNG C;  1Q0W B;  4IM3 A;  1WF9 A;  3VUX A;  1WZ3 A;  2IYD B;  2IY1 B;  3ML9 A;  5DPT A;  4HPM B;  1E8X A;  3PHW B;  1Z2M A;  2DZJ A;  2NVU I;  3DBR I;  4RM9 A;  3L0W B;  4MGI E;  1GG3 A;  5E6P A;  2IO3 B;  3CSF A;  4IWP A;  4DDG D;  4M8M A;  1V6E A;  2BWF A;  4X57 B;  2LVP A;  2I1J A;  4DBG A;  2N7D A;  2Z0E B;  4PS7 A;  1WYW B;  3P2B A;  3PZD A;  4W9F A;  2DYM A;  3SHQ A;  3JYU A;  2DZI A;  2MA9 B;  2K6D B;  2V4L A;  2D2Q A;  4K7S A;  2O2V A;  4GDL A;  3OJ4 B;  4TKN A;  2ZVN A;  2MP2 B;  4XC2 A;  3ZDM C;  5C1Z A;  3KW5 B;  3PPA A;  1AAR A;  1SIF A;  2WWZ A;  3DVG Y;  4PS3 A;  3H7S A;  3JVZ X;  1E5W A;  3NOB A;  2NCN A;  4M8N A;  3T9L A;  3ALB A;  2O6V A;  1Z5S B;  5CHV C;  5CX3 A;  2YVC A;  2KX0 A;  3WIM A;  4G11 A;  3GZN I;  4OVV A;  2NBV B;  3EC8 A;  2KDE B;  2Z59 B;  1TGZ B;  2KK8 A;  3R7R A;  4J6I A;  3VDZ A;  4B9K A;  1UH6 A;  1CMX B;  1J19 A;  3H7P A;  3JSV B;  2DAJ A;  2PE6 B;  2JUO A;  4HDO A;  4II3 B;  3UF8 A;  2LJ5 A;  1P98 A;  1LFD A;  1RAX A;  1WJ6 A;  4W9E A;  3VTU A;  1OGW A;  2REX A;  3W1S A;  3KUD B;  2CHX A;  3MHS D;  1S1Q B;  2DHZ A;  2JZZ A;  3CF6 E;  3IHP C;  3R3M A;  4ANW A;  1U4A A;  5CTR C;  1WH3 A;  1P3Q U;  4GSW A;  2NBW B;  4RMA A;  1WXM A;  3X23 A;  4ICV A;  1I42 A;  4DHZ B;  3VHT C;  3EFU A;  1J0G A;  4KZC A;  2LGY A;  1R4M I;  4ZRK A;  2VRR B;  1VD2 A;  1NDD A;  2LVO A;  4I6L B;  1UD7 A;  3HHM A;  3N30 A;  2LAS A;  3QCA A;  2KLG A;  3DBH I;  4GOC A;  2KFK A;  3PRZ A;  3N32 A;  4JGH B;  3ZNZ B;  1WJN A;  2L7R A;  1H4R A;  5TR5 A;  2EMT A;  2C7H A;  5LXH A;  3PV1 A;  2G4S A;  1C3T A;  3PRM B;  4MJS B;  3T8M A;  3QIJ A;  1UBI A;  4FBJ B;  4WWP A;  1WX8 A;  4BOZ B;  3ONS A;  3BY4 B;  2MWS B;  3TBL D;  5LLI A;  3WAM A;  4BKG A;  1Y8R C;  4KDI C;  2CR5 A;  4KVG B;  2A5U A;  2GMI C;  1RLF A;  2KDF B;  2D10 A;  2GBR A;  1M94 A;  2ZJD A;  2FCM A;  4GDK B;  4MGZ E;  3SU8 X;  2K1F A;  3AXC A;  2NPT B;  1JRU A;  4KDL B;  2BGF A;  5J17 A;  2MCN B;  3RZF A;  4XZ4 A;  4IM2 A;  3N3K B;  2JVC A;  2LRU A;  2LVQ A;  4B6W A;  4BBN C;  2MBH A;  1P9D U;  2W9N A;  3DDC B;  2BYE A;  3U30 A;  1UZX B;  2KQ7 A;  2N9X A;  1WJ4 A;  3K9O B;  4W9C A;  1E7V A;  1G6J A;  3QAQ A;  4EFO A;  2GOW A;  3PRE A;  4BVU C;  4W9D A;  4MGK E;  2FCQ A;  2UYZ B;  2G4D B;  3ZTD A;  4DWF A;  1D3Z A;  3V62 A;  2B3A A;  2DAF A;  2XK5 A;  5EDS A;  4F1S A;  4I6N B;  2DYB A;  2LXC A;  2JZ3 B;  2LD9 A;  3NS8 A;  1Q1O A;  4NQK E;  1WRD B;  2G3Q B;  3UQA A;  5CHF A;  2Z0D B;  2MSE D;  2R2Q A;  3A1Q B;  3D32 A;  3L54 A;  4PYU A;  3VFK A;  4NJ7 A;  1WGR A;  3QC8 B;  2BKR B;  4ZRI A;  1EO6 A;  1V5T A;  2ZEQ A;  3PSE B;  2LRW A;  1P0R A;  3ZO5 B;  3DOW A;  4W9K A;  4JL9 A;  4GIV A;  2LGD A;  5AEK B;  2L76 A;  2K25 A;  1LM8 B;  2KXJ A;  3KH0 A;  4MM3 A;  4WJO A;  1WR6 E;  5E6O A;  4EZL A;  1YX5 B;  4NAW A;  4KSK C;  3NY5 A;  2MLB A;  1GC6 A;  4K81 A;  3UIO B;  1KM7 A;  4AP4 C;  3JSV A;  3PTF C;  3A9K B;  3IVF A;  3QX1 A;  4GU2 A;  1EUV B;  2C7M B;  3V61 A;  3O65 B;  3PS6 A;  3V6C B;  3A9J A;  3ZW3 A;  2D07 B;  4EUT A;  2C5L C;  2PEA A;  3RT3 B;  2D11 A;  3HM6 X;  4G0N B;  4N9F 4;  2KD0 A;  1E90 A;  4F8C B;  4KIK B;  2AL6 A;  4FJV B;  3ZVV A;  4AUQ C;  2PE9 A;  3L16 A;  1E8Y A;  3K9P B;  1WMH A;  4DHZ E;  2UWQ A;  2KO3 A;  1XD3 B;  2KOX A;  3M63 B;  4WQO B;  3TL5 A;  2ZVO A;  1WY8 A;  2C60 A;  2HTH A;  2ZNV C;  1WM2 A;  3KYC D;  3UIN B;  3SDL C;  2FUH B;  3MJW A;  1WE6 A;  4BBN F;  1WXS A;  2M4N A;  2N1W A;  1WIA A;  3VH3 B;  1C1Y B;  1V80 A;  2GBK A;  1LXD A;  1YX6 B;  3ZTC A;  2C9W B;  2EMS A;  3NZU A;  4EEW A;  4HLE A;  3NZS A;  5C23 A;  4E3C A;  5IA7 A;  2KHW B;  1GC7 A;  2JY6 A;  2LZ6 A;  2JRI B;  3B1L X;  4JIO U;  5IAA C;  1WFY A;  2RD0 A;  2D3G A;  1SE9 A;  5D6J B;  1J8C A;  4BKS D;  1V86 A;  2LGX A;  2IBI B;  2KTR A;  4NPN A;  4FAD A;  4FA6 A;  3WAP A;  1WX7 A;  1WX9 A;  4YL8 A;  3DVN V;  3RYT A;  4P7I A;  2C7N B;  4W9I A;  2XBB C;  1WGG A;  1ISN A;  3PT2 B;  3U7D A;  1YIW A;  3ZLZ A;  2DEN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...