2GBRA

Crystal structure of the 35-36 moad insertion mutant of ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGRWALAIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 77
sequence length 77
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbrA00
3KYCD 4W9GA 3ZNGC 2LGXA 4JL9A 4KDLB 2MW5A 4FLHA 1P3QU 2FCMA 2ZPYA 2J0KA 3QHTA 1RLFA 3H7PA 3H1UA 4ANVA 2BPSA 2KDEB 2FUHB 4ICVA 3NOBA 2OOBB 4IG7B 3AU4A 3N32A 4MGKE 3ZRCA 2MBQA 2BKFA 2GBNA 3PZDA 3ZDTA 4E71A 4W9CA 2L05A 2DHZA 4TUUA 2WX1A 1LFDA 2DZJA 3HM3A 4PS8A 2PE9A 2LRUA 2PE6B 3DVGX 1ZKHA 1LM8B 2BF8B 5DCNA 1M94A 3PGEA 2KWUB 5AZGA 3QC8B 4ICUA 4CO7A 3HHMA 3PTFC 3JSVB 5AEKB 4HDQA 2AL3A 3M95A 5D7GA 4HXDA 4HVBA 3B0AA 1K8RB 2RPQA 4WWNA 2O2VA 3R66C 2FIFA 4NAWB 2KNBA 1E7UA 3VUWA 2KN5A 2CU1A 2KTRA 2NCNA 4MGZE 2WWZA 1WF9A 2LVPA 2XBBC 1WE7A 1UGMA 3MJWA 2I1JA 5G55A 2ZPNA 5D2MB 3M63B 2LI5A 3PLVA 1YIWA 3V6CB 4XX5A 4ASWC 1E8ZA 2AYOB 2M4NA 1XT9B 3B08A 3VQIA 1V86A 1E5WA 2ZCBA 4XC2A 3V6EB 2L76A 4DHZB 1WZ0A 1MG8A 2JF5A 2D07B 3PV1A 4HLEA 3ENEA 2C7NB 2R2QA 1H4RA 1HE8A 4PYUA 3DVNU 3ZNZB 3UINB 3EFUA 3NS8A 2KDFB 2CHXA 1UZXB 2M0XA 3KH0A 3QA8A 4PS3A 1SGHA 2BWFA 2FCNA 5CHWA 4HWIB 3WAMA 3NZSA 3WAOA 2N9PC 5CHFA 3RZWC 1YQBA 3RYTA 2J0MA 1WZ3A 4MH0E 2FNJB 2JPHA 2BGFA 2G45B 4K7WA 4EFOA 2BKRB 3RUIB 1ZW7A 2MRPA 2D10A 5AZHA 5LLIA 3VFKA 1EO6A 4A20A 5IAAC 4ZYNA 4F7ZA 3BY4B 3R3MA 1RAXA 1WYWB 4N9F4 4MM3A 2L00B 1WR6E 3TCAA 3U30A 2LJ5A 3JSVA 4WAAA 5G2NA 1WX8A 2KO3A 3ZUNA 3CSTA 2K6QA 4LJOB 4TV3A 4E74A 4W9EA 3T8MA 1P98A 3NHEB 5CX3A 3O65B 4AJYB 3CF6E 4HPLB 1V5TA 1E7VA 2LXCA 4NAWA 4W9JA 1WJNA 4K1RB 1J19A 3HM6X 2FCSA 3KW5B 5DPRA 3WANA 3ZO5B 2NVUI 2KMCA 3L0WB 2LWPA 3IFWB 3T9LA 3AU5A 4DHJD 2IYDB 2ZNVB 1TTNA 2JUOA 4NJ6A 4GDKA 2HTHA 3PHWB 3GZNI 3DBSA 2JT4B 3DPDA 2JZ3B 1FXTB 4OVUA 3SDLC 4DWFA 4B9KA 1KM7A 2NBVB 5FR6A 4M0WB 3SD5A 2K8HA 3V61A 4CHKA 4FBJB 1X1MA 4NPNA 3LDZE 3EC8A 2ZVNA 2GBRA 3VAWA 1QZEA 1WRDB 4GSWA 4KDIC 3UQAA 2D2QA 4GIVA 1RFAA 4FJZA 4BVUC 1C3TA 1NBFC 4IWPA 5KHQA 2IZVB 1C1YB 1WE6A 2NBUA 4IM2A 3SU8X 2HD5B 2KJ6A 3C0RB 2CR5A 4GDLB 4BFRA 2ZJDA 3PPAA 2BYVE 3ZLZA 1UBQA 1E8YA 2NR2A 2JXXA 2Y5BB 4J6IA 1TGZB 4W9HA 2IY1B 1YX6B 3S2AA 2DAJA 4ANWA 2EKEC 2K8BA 5D94A 4W9LA 3ML8A 5AZFA 2BYFA 3KUDB 3KUZA 4GXBA 4I6NB 5C23A 2MA9B 1WJ4A 1J8CA 1WH3A 1WGGA 3OLMD 3R7RA 5JHBA 1D3ZA 1WM3A 2KANA 2KVRA 3APDA 5J18A 2HJ8A 3ZNID 3RD2A 3I3TB 3QX1A 4I6PA 1JRUA 1WXVA 4LDTD 4MJSB 3VVWB 2AL6A 4K81A 4FHJA 1YD8U 3NZUA 3CMMB 2KWCA 1UH6A 3OJ4B 2KXJA 2WYQA 3ECIA 5TR5A 4G0NB 3TMPB 1SE9A 4NY0A 2BYEA 5CTRC 4AJWA 2EMSA 2KKCA 4EOYA 3R7QA 3W1YA 1WGRA 3PLUA 2KK8A 2O6VD 4HK2A 1KJTA 1R4MI 2FIDA 2L8JA 1AARA 5JHAA 2BWES 4GN1A 4MSQB 4GU2A 4MSMB 3RZFA 5KHOA 3VUXA 3DQVA 4GGQA 1EF1A 2N4FA 2NPTA 2AWTA 4JIOU 4WWPA 5D6JB 2RD0A 4TQ1A 1IPGA 1V80A 4GDLA 4WJNA 2KX3A 2C7HA 2N1VA 2G4DB 2KOXA 2LD9A 1UD7A 2MBHA 2KDIA 4E3CA 3DVNV 2MP2A 3AXCA 3IHPC 3A33B 2JRIB 3B1LX 2K8CA 2N9XA 4W9DA 1EUVB 3TIXA 1XD3B 4FADA 5DPTA 3W1SA 3JYUA 3Q3JA 4CYEA 4HJKA 2ASQA 1OGWA 2ZVOA 4JLCA 4B95A 1E8XA 1Q1OA 2M8SA 2IO2B 4HCNB 1LQBA 4MGIE 4BKTA 3APCA 4EKUA 4EZKA 4KIKB 2LXAA 1Q0WB 5DPSA 2D3GA 1F9JA 5BO4B 4TQ0A 2GBJA 2RSUA 4AOFA 2K1FA 2MLBA 4BBNC 4PYZA 3A4RA 5CHVC 3L17A 4ANXA 4DHJB 5J2RA 2DZKA 3ZDMC 3ZKJC 4DK5A 3ONSA 3IG3A 4BKSD 3UF8A 3ZNHB 2LZ6A 3H9DA 1VCBA 2NBWB 3QQ8B 4G11A 4HCPB 2KZRA 1XQQA 4F1SA 2GOWA 2KC2A 2LUEA 2XEWA 4URKA 2MWSB 4RM8A 1LXDA 1V9JA 3CSFA 2M1MA 1PQSA 1Q5WB 4G50A 5E6NA 1IP9A 2LGDA 1H8CA 2LRWA 2KFJA 4FJYA 1YJ1A 3IVFA 3DDCB 4LJPB 4AWJA 1BT0A 4M8MA 1A5RA 3P2BA 3PS6A 3WA0A 2CS4A 3EHVA 2G4SA 5JZEB 2IO0B 2KDBA 4W9IA 1WX7A 3MHSD 3V62A 4DDID 4A3OA 5J17A 3N30A 3KUCB 4W9KA 1OTRB 2IBIB 2DYOA 3U7DA 1OEYJ 2DZIA 3A4SC 3VHTC 3X23A 3QCAA 4K7SA 3M3JA 2VRRB 2KD0A 3KYDD 3KVFB 5E6PA 1WR1A 2CKHB 1GG3A 2N1WA 3GOEA 1I42A 2N7EA 3EECA 3LJ3A 4KSKC 4WWOA 4ANUA 1NDDA 3ZTCA 1GC7A 4LDTB 2Z59B 1WXSA 3VH4B 2R2OA 3IBEA 3PSEB 3DOWA 3AULA 2KFKB 4NJ7A 5E6OA 2OJRA 1V2YA 4MDKE 4HPMB 1WGDA 2EMTA 1U4AA 2UWQA 5DPWA 4G3XB 1WGHA 1Y8RC 2QHOA 4HDOA 3TJPA 5JH5C 2M17A 2O6VB 4IM3A 1GNUA 1WJ6A 4IW0A 4WQOB 1GJZA 5GMVA 1KLVA 4KV2A 4BBNF 4IWOA 2B3AA 4KZ0A 2ZEQA 2JWZA 1WXMA 1WMHB 2JRHA 1WGYA 4P7IA 4XZ4A 2DZMA 1CMXB 3WAPA 3VXWA 3OAWA 1J0GA 1ISNA 4FJVB 4BKGA 3HIZA 1V49A 4TKNA 1VD2A 3DBRI 4IC7B 2A4ZA 4BOSC 1V81A 2MBEA 4OVVA 4ZRIA 4YL8A 1KOTA 5L95C 3D32A 2C7MB 1RRBA 3A9KB 2KQ7A 2KHWB 3DCGA 2G3QB 1TZ1A 4GOCA 3A1QB 3UIOB 1WXAA 2DX5B 2MSED 4FN2A 1WM2A 3ZTDA 4AUQC 4EZJA 1WJUA 3VTUA 2C60A 4KSLC 3L54A 4WJOA 2LVQA 3L08A 2V4LA 2AEHA 3PRMB 1GC6A 5LXHA 2IO1B 2V3SA 1NI2A 1TBEA 3QWZB 3UGBB 2WDTB 2KTFA 4ZDVA 5IA7A 3BINA 2L3ZA 3L10B 4II3B 2MBOA 1IYFA 4NNJB 3AI5A 4I6LB 3U8ZA 2Z0EB 2LGYA 1E90A 1T0YA 2UYZB 1S3SG 2JZZA 3QIJA 3QJZA 3ALBA 5EDSA 5HKHA 4KVGB 1P1AA 3L13A 2KFKA 3WIMA 2KC1A 2FAZA 2IO3B 3M62B 2GBMA 3K9OB 1WX9A 2N7DA 4MELA 3DVGY 4DHZE 1UELA 3TL5A 2O6VA 2KMAA 2DYBA 2LVOA 2XK5B 2Z0DB 3PRPB 3V60A 1WI0A 4MGYE 2KQSA 4NQLB 2DYMA 1WMHA 2MX2A 4PS7A 1OEYA 4GDKB 4MJSA 4RM9A 2PPHA 2ZNVC 4A3PA 3N3KB 3RULA 1L2NA 3H7SA 2IY0B 2RGFA 3A9JB 5C1ZA 4K7UA 2K25A 2RR9A 3A9KA 3SHQA 4JQWC 2CHWA 2KWVB 3A1QA 1S1QB 2ZCCA 2W9NA 3DBHI 3QARA 3X0WA 1EF5A 1SIFA 4MEMA 2K6DB 4NQKE 2J7QB 1P9DU 4EEWA 4EZLA 2MCNB 3Q3FA 4X57B 4BOZB 2C5LC 2I1KA 3UQBA 2KX0A 2J0JA 4F8CB 3PRZA 2CHZA 1OQYA 3PHXB 4DXAB 4KZCA 1WIAA 2JY6A 3HK0A 4II2B 1G6JA 2YLMA 2GMIC 2N9EB 3PVLA 3PREA 4W9FA 2DENB 5LXIB 2ZZPB 3ZVVA 3ZIMA 5L83A 3TBLD 2C9WB 2MQJA 2WX0A 2FCQA 3APFA 3H7PB 3W1SC 3ZRFA 2HE7A 4BKSA 2D11A 2A5UA 2KJHB 3ZW3A 2REXA 4EUTA 1ZGUB 3H6NA 4ZRKA 3NY5A 4GB9A 4M8NA 2GBKA 3VTVA 2KLGA 2XK5A 4GMVA 4LCDE 1L7YA 2MBBB 4FHKA 1WY8A 1V5OA 4KIKA 3QK0A 4IWQA 2L0TA 3WALA 4AP4C 2NS5A 3K9PB 4DDGD 4IUMB 3UIPB 2PEAA 3RCZA 3RT3B 2V1YA 1YX5B 2K39A 3A9JA 3QAQA 4ZRJA 1E8WA 4FULA 1GUAB 2YVCA 2O2VB 3MTNB 1Z2MA 3PT2B 2L7RA 3DBLI 4WJPA 4WJQA 4FA6A 1R4NI 2NPTB 2L0FA 1I35A 2JVCA 3JW0X 1WFYA 2KTRB 1Z5SB 3VUYA 4JGHB 4DBGA 2KLCA 3VDZA 1UBIA 2KJRA 2LASA 3OJ3A 2DAFA 4B6WA 4IM0A 2PJHA 3VTWA 3L16A 4RMAA 1P0RA 3ML9A 2MP2B 3JVZX 1V6EA 3VH3B
chains in the Genus database with same CATH superfamily
1XCTL 3KYCD 4FLHA 2EELA 2WQYB 2BPSA 2KDEB 4UDUC 3NOBA 2OOBB 2RDBC 4MGKE 5BMHA 2MBQA 1E0ZA 3ZDTA 4E71A 4DQOC 2L05A 2DHZA 2DZJA 1K53A 1ZKHA 2HJ1A 5AZGA 3HHMA 4MACA 1UF0A 3JSVB 3I57A 2AL3A 5D7GA 1KH0A 2RPQA 2O2VA 4NAWB 2BS3B 4YTMB 3DBRB 2CU1A 4MGZE 3FILB 1JWUD 1DGJA 2XBBC 1UGMA 4HKZE 5D2MB 3M63B 3V6CB 2AYOB 3EUB2 1E5WA 2JF5A 1MG8A 3PV1A 2DWQA 3ZNZB 3QA8A 4P1BC 3GS2A 3RNFC 3N9YC 2KYWA 2N9PC 4MH0E 2FNJB 2G45B 4EFOA 1ZW7A 4A20A 1RAXA 5G2NA 1GAQB 2AQ1B 3MP9A 4LJOB 1KF6B 3RN9C 1GPXA 2IPKD 1C76A 1RFKA 4HROA 4DXFA 3ZJUA 3DWMA 1J19A 5DPRA 2FCSA 1OQQA 3AEBB 3L0WB 3IFWB 3AU5A 2HDEA 2BTEA 2IYDB 1TTNA 4US8A 3DBSA 3DPDA 3SDLC 4N59A 1TS3A 4CHKA 3LDZE 3EC8A 1JWAD 1QZEA 1WRDB 3ZYYX 4GSWA 4KDIC 3LYYA 5EE3A 4BVUC 1C3TA 1XLPA 4IWPA 4IM2A 1SF0A 2HD5B 3SU8X 2WDRB 4OW0A 1HZ5A 1TGZB 4W9HA 1YX6B 2DAJA 2EKEC 1JCKB 5D94A 4S0RA 2DLBA 3KUDB 5IO9A 2MA9B 1L4DB 1WH3A 3APDA 2HJ8A 3AEAB 4XWWA 1V1PA 5IN7A 2NMQA 4GLSC 3I3TB 3QX1A 4LDTD 1WXVA 4PK1A 3CMMB 2G9HD 1UH6A 1BXTA 2BYEA 2EMSA 2KKCA 4EOYA 3R7QA 1KJTA 1R4MI 2L8JA 3RMKC 5JHAA 2Y5PA 4MSQB 3VUXA 3DQVA 3R8BA 2FBWB 2LJIA 5D6JB 4TQ1A 3HRDD 5G5HA 2C7HA 2WU5B 1UD7A 2MP2A 3Q3OC 2WXPA 3B1LX 2WHIA 3AE8B 3JYUA 4A90A 2ASQA 1OGWA 4B95A 1K51A 2M8SA 2IO2B 4HCNB 1LQBA 2M56B 1C77A 2Y3AA 5DPSA 2D3GA 1F9JA 4YTNB 4MH8A 1WSPA 4OZAA 2MLBA 3HUIA 3A4RA 4ANXA 1C78A 3OG5A 2LMCA 2KAJA 2MJDA 4G11A 2KZRA 1XQQA 2LUEA 1FRRA 2MWSB 3CSFA 1J7BA 4G50A 2LGDA 1F1HA 1KLGD 1LO5D 4ZYSA 1PDXA 1UNSA 4AWJA 2ACZB 2CS4A 2X38A 1IUEA 1DOYA 4H2AA 4WH4A 4M02A 2IBIB 1TY0A 2CU3A 2BW2A 3A4SC 3QCAA 3M3JA 1V8CA 2KD0A 4XWTA 2I38A 3KYDD 5LNK1 2N1WA 3LJ3A 1ENFA 4WWOA 4ANUA 1NDDA 1WXSA 3VH4B 4A9AA 1TJEA 2QEJC 3AULA 2KFKB 1TS4A 4NJ7A 5E6OA 1JQ4A 2EMTA 3EGRA 1WGHA 2QHOA 3U52E 4D2KA 4HDOA 3TJPA 2O6VB 5G5GA 4KV2A 4KZ0A 1BUIC 1WMHB 1J0GA 1T3QA 4BKGA 3RNCC 3HIZA 1V49A 4TKNA 4IC7B 2A4ZA 2GLSA 4BOSC 2BVCA 5L95C 3EA6A 2QMTA 4IOIE 3A9KB 1TZ1A 4C4VB 2ZW1A 4XDCA 4FN2A 1WM2A 3ZTDA 2WXKA 1I4HA 1ZOYB 1E9MA 4WJOA 3AEDB 3PRMB 1JRPA 5IOIA 2WDTB 3L10B 1IYFA 1T0YA 3QJZA 4KVGB 1P1AA 4C00A 3WIMA 2KC1A 2V3PA 1WX9A 3DVGY 2ONQA 1YQ4B 2Z0DB 2KQSA 2MX2A 4GDKB 3AMZA 4NZLB 4RM9A 4O1NA 2ICIA 2ZNVC 2WNMA 1R4MB 2J4XA 3RULA 3H7SA 2RGFA 4L23A 5C1ZA 2K25A 3PO0A 4US9A 1QILA 2CHWA 2IGHA 5C2TB 2NTTA 3A1QA 2ZCCA 5C3JB 3DBHI 2M0AA 3N1ZC 1P9DU 4EZLA 2MCNB 2I1KA 3UQBA 1OQYA 2DENB 4YSZB 3ZQ4A 2WGSA 2WX0A 2PW9A 2HE7A 4NAMA 2A5UA 2KJHB 3ZW3A 4EUTA 2DBYA 1ZGUB 3H6NA 4GB9A 4M8NA 4K3CA 4RNAA 2XK5A 3E9SA 2WS3B 2L0TA 1JW9D 4DDGD 2MEKA 1CK1A 2V1YA 1E8WA 3AEGB 1HA5A 2FUG1 1R4NI 2L0FA 1N63A 1WFYA 4DBGA 4JGHB 2V0GA 3B2GA 3VDZA 2KJRA 2W3SA 4B6WA 1ESFA 3VTWA 4KKJA 1V6EA 2INDC 1C4CA 4OHJA 4B0MA 4W9GA 4JL9A 4YTPB 1FFUA 1L0YB 4LNOA 3I5JC 2J0KA 3MC9A 1RLFA 3H7PA 3H1UA 4ANVA 3N32A 3TEYA 4P16A 2BKFA 4W9CA 3Q3MC 1LFDA 1QOAA 2E6XA 3RI7C 2LRUA 2PE6B 1WYGA 2WXHA 1V1OA 2J42A 3PTFC 3ZJVA 3M95A 1FCLA 1L0XB 3VUWA 2KN5A 2WWZA 1WF9A 3ZJTA 3MJWA 4C56C 2LI5A 1YIWA 2KN4A 3LB8C 1D4BA 4ZRQA 4XX5A 2WU2B 4ASWC 2XN9C 1WZ0A 2D07B 4HLEA 2R2QA 3ZXVA 1H4RA 1LGRA 3DVNU 1UZXB 2M0XA 3KH0A 4LTUA 1SGHA 2BWFA 2FCNA 4HWIB 3NZSA 5CHFA 3RYTA 1WZ3A 1UWXA 2N9LA 3HVDA 2MRPA 2D10A 1EO6A 5IAAC 1ET9A 2V3NA 1C4AA 4N6EB 2LJ5A 3JSVA 4WAAA 1WX8A 4TV3A 1P98A 5CX3A 3DWGC 4QAYA 2KMMA 3CF6E 3IXSA 3FAHA 4NAWA 1E7VA 2LXCA 4W9JA 1ZXHA 2VH2A 3HM6X 3KW5B 3WANA 2KMCA 2LWPA 4BZAA 3MJ5A 4ZHOA 1FEHA 2JZ3B 4OVUA 3DBHB 4M0WB 3SD5A 2K8HA 1X1MA 1QOBA 2ZVNA 2GBRA 3BK1A 1RFAA 2IZVB 2NBUA 4WURA 3C0RB 2CR5A 4GDLB 2ZJDA 2BYVE 1UBQA 5BMGA 3ETRA 2NR2A 1KTKA 2Y5BB 1HTQA 3S2AA 1PUTA 1PYWD 4ANWA 4KGTA 3ML8A 5AZFA 2AX5A 3Q8FA 2LFIA 3KUZA 5C23A 2D5GA 2BT6A 1WGGA 3R7RA 1D3ZA 1KFYB 5J18A 1YMHE 3VVWB 2AL6A 1J7AA 1YD8U 3RNAC 2INNE 3GB1A 3V05A 4NY0A 1R4NB 5CTRC 3Q6BA 3W1YA 4HK2A 3PLUA 2KK8A 2O6VD 3C19A 1FNVA 5KHOA 1EF1A 1P7FA 4WWMA 2NPTA 1E6EB 4WWPA 3WCQA 2RD0A 4NJCA 1EU3A 3TSSA 2KX3A 2QSDA 1HZ6A 2MBHA 3AXCA 3P42A 2E3TA 1J7CA 2JRIB 4OVZA 2K8CA 2N9XA 1EM7A 1EUVB 3TIXA 1YQ3B 2ZVOA 2DNFA 3AE1B 4C7ZA 1Q1OA 3P4RB 2J52A 3CIRB 4EZKA 2RDGA 5BO4B 4TQ0A 2GBJA 4AOFA 4DHJB 5CHVC 1FPYA 1N6ZA 3AE4B 2BB5A 3IG3A 4BKSD 1NEKB 2BS2B 3TEZA 1KRHA 2JQRB 1VCBA 3GE3C 4F1SA 1TT5B 2XEWA 3NVZA 1LXDA 1V9JA 1FM0D 3AE7B 3C8YA 2MH7A 5E6NA 2CJOA 4HRSA 1H8CA 4HJGE 2KFJA 3BIID 5HHDG 4M8MA 2IGGA 4W9IA 1TY2A 4A3OA 5J17A 3N30A 1OTRB 1ZXIA 2D3AA 3VHTC 4K7SA 3AE6B 3AN1A 3KVFB 4IKGA 1XCQL 1GB4A 3GOEA 1I42A 2N7EA 3EECA 3URYA 1IBXB 4KSKC 3P4QB 2VZKD 3ZTCA 1XO3A 2Y5CA 1SJED 2X8XX 1E7PB 4TMAB 2OJRA 1V2YA 1VZ8A 4LNIA 1WGDA 1M4VA 1U4AA 5DPWA 1Y8RC 3EFCA 4IM3A 1GNUA 4IW0A 5GMVA 4BBNF 4IWOA 1NYQA 2B3AA 2ZEQA 3GE8C 2DZMA 4YT0B 3WAPA 3VXWA 4FJVB 4FXCA 5TSSA 3DHGC 1VD2A 1L6UA 4REZA 1HQRD 1YJIA 3HVZA 2KHWB 2G3QB 1UWMA 1SIJA 3UIOB 1WXAA 2DX5B 1MFWA 2MSED 4AUQC 1DOIA 1FXAA 4KSLC 4P1CC 3L54A 2AEHA 4KX6B 1GC6A 4HKQA 1NI3A 1ZDXA 2IO1B 2V3SA 1NI2A 3UGBB 3OWEB 2KTFA 4ZDVA 3BINA 2L3ZA 4II3B 1N5XA 2IDYA 2Z0EB 2JYEA 3BK2A 1N60A 3RNGC 3QIJA 5EDSA 1AWDA 2KFKA 1ROEA 4C7YA 3GP7A 2GBMA 2N7DA 4DHZE 1XLOA 1BMLC 3B2FA 2O6VA 2DYBA 3NVYA 5BYQA 1YJJA 1SB3C 1D5ZC 3AE3B 3KWVA 1A70A 1XLQA 4PS7A 1WMHA 4MJSA 3NZ3A 3TUOA 2IY0B 3A9JB 4K7UA 3A9KA 1I7HA 2KWVB 2PTLA 1FMAD 4C4VA 1WWTA 2RMMA 1B9RA 3BYTB 1EF5A 1EU4A 2K6DB 2WXRA 4NQKE 2J7QB 4EEWA 2N7JA 4X57B 2JYTA 2J0JA 4F8CB 1B1ZA 3PRZA 3AEFB 3PHXB 3PZ8A 4DXAB 4KZCA 1TYGB 1G6JA 1FXIA 3PREA 2ZZPB 3ZIMA 3APFA 4BKSA 3BVMA 1V1PB 2BB6A 1FNWA 4KIKA 4IWQA 5EE1A 2KT7A 4AP4C 1CJEA 1F2RC 1YX5B 2V9HA 3QAQA 4ZRJA 3TEWA 2EKIA 3MTNB 1HEZE 2QDFA 2L7RA 1HTOA 4WJPA 3DHHC 1QOFA 4WJQA 4AS1A 2JVCA 1XF5L 2KTRB 3VUYA 2OJWA 3IAM1 3W2DA 1UBIA 1EWCA 2LASA 2DAFA 1CQVA 1SSNA 2MP2B 3JVZX 4LCDE 5T8IA 3VH3B 3ZNGC 4KDLB 2MW5A 3LXFA 1P3QU 2FCMA 2L83A 2L32A 2FUHB 1VZ7A 4IG7B 1C9FA 3PZDA 1WGKA 4TUUA 3SR6A 1K50A 3HM3A 2PMVA 3U4EG 2BF8B 1LM8B 2JZPA 1M94A 3PGEA 3QC8B 4ICUA 5D3IB 3E56A 4HDQA 4Q2JA 1K8RB 3P4SB 3R66C 4ACFA 2FIFA 1FRDA 2NCNA 3NUHB 1EWYC 2LVPA 5HI1A 5G55A 4JWUC 1E8ZA 3B08A 3VQIA 2ZCBA 4XC2A 2L76A 1ZP0B 1JROA 3IT6B 2K22A 3ENEA 1HE8A 4LLGM 1SJHD 3UINB 3EFUA 3NS8A 2CHXA 2SAKA 3WAMA 1TS2A 3WAOA 2VH1A 4HPPA 4JE3B 2J0MA 2BGFA 3MFGA 4K7WA 1GB1A 5AZHA 3VFKA 4ZYNA 3R3MA 4N9F4 1WYWB 4MM3A 2L00B 2KO3A 4LNFA 2K6QA 5JXVA 4W9EA 1R7SA 2W3RA 4BAXA 4K1RB 4ITKA 1PGBA 3ZO5B 2NVUI 3T9LA 4DHJD 2WDVB 4WQMA 1DYQA 2JUOA 1JWMD 1SE3A 4DWFA 4JWSC 1KM7A 2NBVB 2R61A 4A6QA 3V61A 4FBJB 4NPNA 3FKYA 3KWLA 3UQAA 2D2QA 4RCOA 1QOGA 1NBFC 5KHQA 1CZPA 3P4PB 3PPAA 4USAA 1E8YA 4LK0M 2PVGC 4RFBA 1SE2A 4JX1C 3VR8B 4EE2A 4GXBA 4I6NB 4OZCA 1J8CA 3OLMD 5JHBA 2KANA 2KVRA 2WXMA 3GZNB 4A8XC 4I6PA 1JRUA 1L4ZB 4FHJA 3MC8A 2JU6X 2LUMA 2KXJA 3ECIA 1TKYA 4YWGG 3Q2AC 4M0WA 2N0SB 2LHDA 2BWES 4MSMB 4R3DA 4GGQA 2N4FA 2MJ3A 2LGSA 2OHFA 4JIOU 2PIAA 4WAFA 1FFVA 1IPGA 2WXGA 1V80A 5HFYA 4GDLA 3P1MA 2N1VA 2G4DB 2KDIA 3DVNV 2WDQB 2LHEA 3IHPC 3A33B 1SE4A 1T5XD 4IDIA 3W1SA 3Q3JA 2WLBA 3BYYB 1E8XA 1VR9A 4MGIE 3APCA 4EKUA 2OEDA 1I4RA 1Q0WB 1AW7A 3VRAB 4BBNC 3NRZA 5FR3A 4PYZA 1I4QA 2KVZA 3ZKJC 3Q14C 3ONSA 3UF8A 2LZ6A 3H9DA 1ET6A 2H88B 2KC2A 4URKA 1C79A 4CQNA 1VDVA 2M1MA 1PQSA 3IT4B 3AE5B 1Q5WB 2MJEA 4FJYA 1YJ1A 3FILA 3DDCB 1BT0A 4MT5A 3AE2B 4S17A 1K52A 1A5RA 3P2BA 3PS6A 3WA0A 3EHVA 2G4SA 1D5MC 1Q10A 1WX7A 2WXJA 3MHSD 3SEBA 1NENB 1NVID 1QT9A 2DYOA 3U7DA 1OEYJ 1OQRA 5E6PA 1GG3A 4C80A 2GRIA 4J3OD 1WXQA 1GC7A 2Z59B 3I9V1 2WXIA 3PSEB 3DOWA 1PGAA 1TIFA 1SXTA 4MDKE 2D3BA 4HPMB 2UWQA 4G3XB 1OFFA 2M17A 1XLNA 4TSSA 2JWZA 2JRHA 2BYTA 4P7IA 4KGRA 4XZ4A 1E10A 1CMXB 1QLBB 3OAWA 4ZHPA 3KQ4A 1PFDA 2RPVA 2MBEA 2KWDA 4OVVA 1KOTA 2BBCA 1RRBA 1MG4A 2KQ7A 3DCGA 2TSSA 1L5PA 3R2IA 4EZJA 5I4DA 2JWUA 2QC8A 3VTUA 2LVQA 5FK9C 1F77A 3L08A 2V4LA 5LXHA 1YN3A 1WRIA 2CJNA 1IBXA 1TBEA 5IA7A 2MBOA 4NNJB 3AI5A 4I6LB 3U8ZA 2LGYA 2UYZB 1T0SC 4YSXB 2JZZA 3T3NA 3L13A 2IO3B 3AEEB 4MELA 3Q8AA 2K9XA 3V60A 3N1YC 1I4GA 1TS5A 1WI0A 4MGYE 4NQLB 5BMIA 4ARCA 4JPSA 3N3KB 1L2NA 2WXOA 1ZUD2 2K5PA 4JQWC 5MPOA 5IP4D 2W9NA 3QARA 1SIFA 4MEMA 3SFEB 2LGIA 3AV8A 3Q3FA 4BOZB 4YSYB 2SEBD 4L1BA 2CHZA 2QCZA 1WIAA 3TEXA 2YLMA 2N9EB 3PVLA 1TKEA 4W9FA 3O13A 5L83A 2C9WB 2FCQA 2YEPB 3W1SC 3ZRFA 2AQ2B 4KGSA 3BVGA 5GXGB 2REXA 3N20C 3NY5A 5H92C 4WIPA 3VTVA 2KLGA 3B9JA 3IAS1 1L7YA 2MBBB 1WY8A 2PLPA 2WXLA 5H8YE 3MHZA 5EE9A 3AB5A 3RCZA 2B76B 2W54A 3RT3B 3A9JA 4ARIA 1GUAB 2YVCA 2O2VB 1Z2MA 3NS1A 4FA6A 3AH7A 2NPTB 1I35A 2W82A 2IJ0A 1Z5SB 2KLCA 2GI9A 3W5VB 4IM0A 2PJHA 3L16A 1P0RA 2LEKA 3CWIA 3MC0B 3SFDB 2LGXA 2D3CA 3V3XA 2ZPYA 3QHTA 3T3OA 3N1XC 4PT5A 5E6JA 4ICVA 4LNNA 3ZRCA 3AU4A 2GBNA 4DXGA 4XE0A 3RPFC 2WX1A 2PKOA 2WXQA 4PS8A 2PE9A 3DVGX 2WXNA 1TKGA 5DCNA 2KWUB 3FC4A 3Q8BA 3DBLB 4CO7A 2N9KA 5AEKB 5FKAC 4HXDA 4HVBA 3B0AA 4RF0A 2G1EA 4WWNA 1IGCA 2M19A 2KNBA 4LNKA 1AYFA 1E7UA 2Q5WD 2KTRA 1WE7A 4L2YA 2I1JA 2ZPNA 3PLVA 1QF6A 2M4NA 1XT9B 1V86A 3V6EB 4DHZB 1QQRA 1RM6C 5EE0A 2C7NB 4PYUA 1IGDA 1MHXA 2KDFB 4PS3A 5CHWA 3RZWC 1I4XA 1YQBA 1XXGA 1ZE3D 2JPHA 2BKRB 1YNTE 3RUIB 2KACA 5LLIA 4F7ZA 3BY4B 5BYRA 4XDDA 1WR6E 3TCAA 3U30A 3ZUNA 2JXTA 3CSTA 2KQ4X 2WXFA 3BZDB 4E74A 5D3DA 3T8MA 1FNUA 3NHEB 3RNBC 3O65B 4AJYB 4HPLB 1V5TA 1WJNA 1TZOA 2ZNVB 4NJ6A 4GDKA 1N61A 2HTHA 2NTSA 3PHWB 2ON8A 3GZNI 2JT4B 1FXTB 4B9KA 5FR6A 1FD6A 3VAWA 1L6VA 4M00A 4GIVA 4FJZA 5AUKA 1QKZA 1MI0A 1C1YB 1WE6A 2KJ6A 1DOXA 3Q8CA 4BFRA 3ZLZA 1ZPSA 2JXXA 4J6IA 4P6VF 3PZ7A 2IY1B 1HXYD 2K8BA 4W9LA 3ZGZA 2BYFA 5AUIA 3NVWA 1UGJA 1WJ4A 1YN5A 2H89B 4M01A 1UUPA 1WM3A 3ZNID 3RD2A 2INCC 4MJSB 1YOVB 4K81A 3DHIC 3NZUA 2KWCA 1N62A 3OJ4B 2WYQA 4KKIA 5TR5A 4G0NB 3TMPB 1SE9A 1V97A 4AJWA 1WGRA 2FIDA 1AARA 3AECB 4GN1A 3Q8EA 4GU2A 3RZFA 1N5WA 3J9CA 4RF1A 2AWTA 1FIQA 2FE8A 3NG0A 4WJNA 2KOXA 2LD9A 4E3CA 4AQ7A 1C4PA 4W9DA 2V4IB 1XEEA 3BWUD 1XD3B 3KLSX 4FADA 5DPTA 2W55A 4CYEA 4HJKA 4A55A 4JLCA 4B0EA 1FO4A 3VR9B 4BKTA 2JSVX 1JALA 5BYSA 1F52A 4KIKB 2LXAA 2KDMA 2RSUA 2K1FA 3VRBB 4ZRPA 3L17A 5J2RA 2DZKA 1P7EA 2GB1A 3ZDMC 4DK5A 4OZBA 3ZNHB 2K0PA 1NYRA 2NBWB 2Z8LA 3QQ8B 4HCPB 2GOWA 3U2SC 4RM8A 4ZOHC 4YXDB 1IP9A 1KLUD 4K3BA 2LRWA 1JMLA 4RGTA 3IVFA 4LJPB 1SEBD 3Q3NC 2VZKB 1RYJA 5JZEB 2IO0B 2KDBA 3V62A 4DDID 3KUCB 4W9KA 2PVOD 3UI3A 1GOZA 2DZIA 3L4PA 3X23A 2L52A 2VRRB 1VLBA 1WR1A 2CKHB 4XGAB 4LDTB 1Y56A 3BVZA 3P63A 2YEPF 2R2OA 3IBEA 1D6EC 1JWSD 4N58A 2QILA 1L0VB 5JH5C 1WJ6A 4WQOB 1GJZA 1KLVA 1T0QC 1T0RC 1WXMA 5HG2A 3RFZB 1WGYA 1ISNA 3DBRI 2QJLA 1V81A 4ZRIA 4YL8A 3D32A 2MHJA 2C7MB 2HTME 2ZW0A 4GOCA 2K3UA 3A1QB 1MPEA 3Q69A 3AE9B 4RGNA 2INPE 1WJUA 4RH6A 2C60A 4XYCA 3NVVA 1I4PA 3AM9A 3QWZB 4MM3B 1E90A 1D5XC 1S3SG 3ALBA 5HKHA 1MHHE 2FAZA 3M62B 3K9OB 1UELA 3TL5A 2BS4B 2KMAA 2LVOA 1VJKA 2XK5B 3PRPB 1STEA 2DYMA 3RNEC 1OEYA 3H8HA 3W9CB 1VZ6A 2PPHA 4A3PA 2J53A 2QIEB 3W5UB 1AN8A 2RR9A 2I2YA 3SHQA 4RGOS 1S1QB 2RDHA 1VRAB 1MJDA 1SBBB 3X0WA 3I63C 2AQ3B 2WP9B 2C5LC 2KX0A 4HEA1 2JY6A 3HK0A 4II2B 2GMIC 5IKCM 5LXIB 3ZVVA 3TBLD 2MQJA 3H7PB 1ZDVA 1F0ZA 4RGMA 2D11A 2IGDA 3ABVB 4ZRKA 2GBKA 4GMVA 4FHKA 2L1AA 1V5OA 3R2TA 3U7ZA 3QK0A 2XNAC 3WALA 2NS5A 3K9PB 4IUMB 3UIPB 2PEAA 3NJTA 1JWBD 2K39A 1RWSA 1T6BX 2BQQA 2UU7A 1PGXA 1F2RI 4FULA 3PT2B 3ZXRA 3DBLI 3JW0X 1MVKA 2JX5A 1YN4A 3OJ3A 1ACCA 4RMAA 1FCCC 3ML9A
chains in the Genus database with same CATH topology
3KYCD 4W9GA 3ZNGC 2LGXA 4JL9A 4KDLB 2MW5A 4FLHA 1P3QU 2FCMA 2ZPYA 2J0KA 3QHTA 1RLFA 3H7PA 3H1UA 4ANVA 2BPSA 2KDEB 2FUHB 4ICVA 3NOBA 2OOBB 4IG7B 3AU4A 3N32A 4MGKE 3ZRCA 2MBQA 2BKFA 2GBNA 3PZDA 3ZDTA 4E71A 4W9CA 2L05A 2DHZA 4TUUA 2WX1A 1LFDA 2DZJA 3HM3A 4PS8A 2PE9A 2LRUA 2PE6B 3DVGX 1ZKHA 1LM8B 2BF8B 5DCNA 1M94A 3PGEA 2KWUB 5AZGA 3QC8B 4ICUA 4CO7A 3HHMA 3PTFC 3JSVB 5AEKB 4HDQA 2AL3A 3M95A 5D7GA 4HXDA 4HVBA 3B0AA 1K8RB 2RPQA 4WWNA 2O2VA 3R66C 2FIFA 4NAWB 2KNBA 1E7UA 3VUWA 2KN5A 2CU1A 2KTRA 2NCNA 4MGZE 2WWZA 1WF9A 2LVPA 2XBBC 1WE7A 1UGMA 3MJWA 2I1JA 5G55A 2ZPNA 5D2MB 3M63B 2LI5A 3PLVA 1YIWA 3V6CB 4XX5A 4ASWC 1E8ZA 2AYOB 2M4NA 1XT9B 3B08A 3VQIA 1V86A 1E5WA 2ZCBA 4XC2A 3V6EB 2L76A 4DHZB 1WZ0A 1MG8A 2JF5A 2D07B 3PV1A 4HLEA 3ENEA 2C7NB 2R2QA 1H4RA 1HE8A 4PYUA 3DVNU 3ZNZB 3UINB 3EFUA 3NS8A 2KDFB 2CHXA 1UZXB 2M0XA 3KH0A 3QA8A 4PS3A 1SGHA 2BWFA 2FCNA 5CHWA 4HWIB 3WAMA 3NZSA 3WAOA 2N9PC 5CHFA 3RZWC 1YQBA 3RYTA 2J0MA 1WZ3A 4MH0E 2FNJB 2JPHA 2BGFA 2G45B 4K7WA 4EFOA 2BKRB 3RUIB 1ZW7A 2MRPA 2D10A 5AZHA 5LLIA 3VFKA 1EO6A 4A20A 5IAAC 4ZYNA 4F7ZA 3BY4B 3R3MA 1RAXA 1WYWB 4N9F4 4MM3A 2L00B 1WR6E 3TCAA 3U30A 2LJ5A 3JSVA 4WAAA 5G2NA 1WX8A 2KO3A 3ZUNA 3CSTA 2K6QA 4LJOB 4TV3A 4E74A 4W9EA 3T8MA 1P98A 3NHEB 5CX3A 3O65B 4AJYB 3CF6E 4HPLB 1V5TA 1E7VA 2LXCA 4NAWA 4W9JA 1WJNA 4K1RB 1J19A 3HM6X 2FCSA 3KW5B 5DPRA 3WANA 3ZO5B 2NVUI 2KMCA 3L0WB 2LWPA 3IFWB 3T9LA 3AU5A 4DHJD 2IYDB 2ZNVB 1TTNA 2JUOA 4NJ6A 4GDKA 2HTHA 3PHWB 3GZNI 3DBSA 2JT4B 3DPDA 2JZ3B 1FXTB 4OVUA 3SDLC 4DWFA 4B9KA 1KM7A 2NBVB 5FR6A 4M0WB 3SD5A 2K8HA 3V61A 4CHKA 4FBJB 1X1MA 4NPNA 3LDZE 3EC8A 2ZVNA 2GBRA 3VAWA 1QZEA 1WRDB 4GSWA 4KDIC 3UQAA 2D2QA 4GIVA 1RFAA 4FJZA 4BVUC 1C3TA 1NBFC 4IWPA 5KHQA 2IZVB 1C1YB 1WE6A 2NBUA 4IM2A 3SU8X 2HD5B 2KJ6A 3C0RB 2CR5A 4GDLB 4BFRA 2ZJDA 3PPAA 2BYVE 3ZLZA 1UBQA 1E8YA 2NR2A 2JXXA 2Y5BB 4J6IA 1TGZB 4W9HA 2IY1B 1YX6B 3S2AA 2DAJA 4ANWA 2EKEC 2K8BA 5D94A 4W9LA 3ML8A 5AZFA 2BYFA 3KUDB 3KUZA 4GXBA 4I6NB 5C23A 2MA9B 1WJ4A 1J8CA 1WH3A 1WGGA 3OLMD 3R7RA 5JHBA 1D3ZA 1WM3A 2KANA 2KVRA 3APDA 5J18A 2HJ8A 3ZNID 3RD2A 3I3TB 3QX1A 4I6PA 1JRUA 1WXVA 4LDTD 4MJSB 3VVWB 2AL6A 4K81A 4FHJA 1YD8U 3NZUA 3CMMB 2KWCA 1UH6A 3OJ4B 2KXJA 2WYQA 3ECIA 5TR5A 4G0NB 3TMPB 1SE9A 4NY0A 2BYEA 5CTRC 4AJWA 2EMSA 2KKCA 4EOYA 3R7QA 3W1YA 1WGRA 3PLUA 2KK8A 2O6VD 4HK2A 1KJTA 1R4MI 2FIDA 2L8JA 1AARA 5JHAA 2BWES 4GN1A 4MSQB 4GU2A 4MSMB 3RZFA 5KHOA 3VUXA 3DQVA 4GGQA 1EF1A 2N4FA 2NPTA 2AWTA 4JIOU 4WWPA 5D6JB 2RD0A 4TQ1A 1IPGA 1V80A 4GDLA 4WJNA 2KX3A 2C7HA 2N1VA 2G4DB 2KOXA 2LD9A 1UD7A 2MBHA 2KDIA 4E3CA 3DVNV 2MP2A 3AXCA 3IHPC 3A33B 2JRIB 3B1LX 2K8CA 2N9XA 4W9DA 1EUVB 3TIXA 1XD3B 4FADA 5DPTA 3W1SA 3JYUA 3Q3JA 4CYEA 4HJKA 2ASQA 1OGWA 2ZVOA 4JLCA 4B95A 1E8XA 1Q1OA 2M8SA 2IO2B 4HCNB 1LQBA 4MGIE 4BKTA 3APCA 4EKUA 4EZKA 4KIKB 2LXAA 1Q0WB 5DPSA 2D3GA 1F9JA 5BO4B 4TQ0A 2GBJA 2RSUA 4AOFA 2K1FA 2MLBA 4BBNC 4PYZA 3A4RA 5CHVC 3L17A 4ANXA 4DHJB 5J2RA 2DZKA 3ZDMC 3ZKJC 4DK5A 3ONSA 3IG3A 4BKSD 3UF8A 3ZNHB 2LZ6A 3H9DA 1VCBA 2NBWB 3QQ8B 4G11A 4HCPB 2KZRA 1XQQA 4F1SA 2GOWA 2KC2A 2LUEA 2XEWA 4URKA 2MWSB 4RM8A 1LXDA 1V9JA 3CSFA 2M1MA 1PQSA 1Q5WB 4G50A 5E6NA 1IP9A 2LGDA 1H8CA 2LRWA 2KFJA 4FJYA 1YJ1A 3IVFA 3DDCB 4LJPB 4AWJA 1BT0A 4M8MA 1A5RA 3P2BA 3PS6A 3WA0A 2CS4A 3EHVA 2G4SA 5JZEB 2IO0B 2KDBA 4W9IA 1WX7A 3MHSD 3V62A 4DDID 4A3OA 5J17A 3N30A 3KUCB 4W9KA 1OTRB 2IBIB 2DYOA 3U7DA 1OEYJ 2DZIA 3A4SC 3VHTC 3X23A 3QCAA 4K7SA 3M3JA 2VRRB 2KD0A 3KYDD 3KVFB 5E6PA 1WR1A 2CKHB 1GG3A 2N1WA 3GOEA 1I42A 2N7EA 3EECA 3LJ3A 4KSKC 4WWOA 4ANUA 1NDDA 3ZTCA 1GC7A 4LDTB 2Z59B 1WXSA 3VH4B 2R2OA 3IBEA 3PSEB 3DOWA 3AULA 2KFKB 4NJ7A 5E6OA 2OJRA 1V2YA 4MDKE 4HPMB 1WGDA 2EMTA 1U4AA 2UWQA 5DPWA 4G3XB 1WGHA 1Y8RC 2QHOA 4HDOA 3TJPA 5JH5C 2M17A 2O6VB 4IM3A 1GNUA 1WJ6A 4IW0A 4WQOB 1GJZA 5GMVA 1KLVA 4KV2A 4BBNF 4IWOA 2B3AA 4KZ0A 2ZEQA 2JWZA 1WXMA 1WMHB 2JRHA 1WGYA 4P7IA 4XZ4A 2DZMA 1CMXB 3WAPA 3VXWA 3OAWA 1J0GA 1ISNA 4FJVB 4BKGA 3HIZA 1V49A 4TKNA 1VD2A 3DBRI 4IC7B 2A4ZA 4BOSC 1V81A 2MBEA 4OVVA 4ZRIA 4YL8A 1KOTA 5L95C 3D32A 2C7MB 1RRBA 3A9KB 2KQ7A 2KHWB 3DCGA 2G3QB 1TZ1A 4GOCA 3A1QB 3UIOB 1WXAA 2DX5B 2MSED 4FN2A 1WM2A 3ZTDA 4AUQC 4EZJA 1WJUA 3VTUA 2C60A 4KSLC 3L54A 4WJOA 2LVQA 3L08A 2V4LA 2AEHA 3PRMB 1GC6A 5LXHA 2IO1B 2V3SA 1NI2A 1TBEA 3QWZB 3UGBB 2WDTB 2KTFA 4ZDVA 5IA7A 3BINA 2L3ZA 3L10B 4II3B 2MBOA 1IYFA 4NNJB 3AI5A 4I6LB 3U8ZA 2Z0EB 2LGYA 1E90A 1T0YA 2UYZB 1S3SG 2JZZA 3QIJA 3QJZA 3ALBA 5EDSA 5HKHA 4KVGB 1P1AA 3L13A 2KFKA 3WIMA 2KC1A 2FAZA 2IO3B 3M62B 2GBMA 3K9OB 1WX9A 2N7DA 4MELA 3DVGY 4DHZE 1UELA 3TL5A 2O6VA 2KMAA 2DYBA 2LVOA 2XK5B 2Z0DB 3PRPB 3V60A 1WI0A 4MGYE 2KQSA 4NQLB 2DYMA 1WMHA 2MX2A 4PS7A 1OEYA 4GDKB 4MJSA 4RM9A 2PPHA 2ZNVC 4A3PA 3N3KB 3RULA 1L2NA 3H7SA 2IY0B 2RGFA 3A9JB 5C1ZA 4K7UA 2K25A 2RR9A 3A9KA 3SHQA 4JQWC 2CHWA 2KWVB 3A1QA 1S1QB 2ZCCA 2W9NA 3DBHI 3QARA 3X0WA 1EF5A 1SIFA 4MEMA 2K6DB 4NQKE 2J7QB 1P9DU 4EEWA 4EZLA 2MCNB 3Q3FA 4X57B 4BOZB 2C5LC 2I1KA 3UQBA 2KX0A 2J0JA 4F8CB 3PRZA 2CHZA 1OQYA 3PHXB 4DXAB 4KZCA 1WIAA 2JY6A 3HK0A 4II2B 1G6JA 2YLMA 2GMIC 2N9EB 3PVLA 3PREA 4W9FA 2DENB 5LXIB 2ZZPB 3ZVVA 3ZIMA 5L83A 3TBLD 2C9WB 2MQJA 2WX0A 2FCQA 3APFA 3H7PB 3W1SC 3ZRFA 2HE7A 4BKSA 2D11A 2A5UA 2KJHB 3ZW3A 2REXA 4EUTA 1ZGUB 3H6NA 4ZRKA 3NY5A 4GB9A 4M8NA 2GBKA 3VTVA 2KLGA 2XK5A 4GMVA 4LCDE 1L7YA 2MBBB 4FHKA 1WY8A 1V5OA 4KIKA 3QK0A 4IWQA 2L0TA 3WALA 4AP4C 2NS5A 3K9PB 4DDGD 4IUMB 3UIPB 2PEAA 3RCZA 3RT3B 2V1YA 1YX5B 2K39A 3A9JA 3QAQA 4ZRJA 1E8WA 4FULA 1GUAB 2YVCA 2O2VB 3MTNB 1Z2MA 3PT2B 2L7RA 3DBLI 4WJPA 4WJQA 4FA6A 1R4NI 2NPTB 2L0FA 1I35A 2JVCA 3JW0X 1WFYA 2KTRB 1Z5SB 3VUYA 4JGHB 4DBGA 2KLCA 3VDZA 1UBIA 2KJRA 2LASA 3OJ3A 2DAFA 4B6WA 4IM0A 2PJHA 3VTWA 3L16A 4RMAA 1P0RA 3ML9A 2MP2B 3JVZX 1V6EA 3VH3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYC D;  4W9G A;  3ZNG C;  2LGX A;  4JL9 A;  4KDL B;  2MW5 A;  4FLH A;  1P3Q U;  2FCM A;  2ZPY A;  2J0K A;  3QHT A;  1RLF A;  3H7P A;  3H1U A;  4ANV A;  2BPS A;  2KDE B;  2FUH B;  4ICV A;  3NOB A;  2OOB B;  4IG7 B;  3AU4 A;  3N32 A;  4MGK E;  3ZRC A;  2MBQ A;  2BKF A;  2GBN A;  3PZD A;  3ZDT A;  4E71 A;  4W9C A;  2L05 A;  2DHZ A;  4TUU A;  2WX1 A;  1LFD A;  2DZJ A;  3HM3 A;  4PS8 A;  2PE9 A;  2LRU A;  2PE6 B;  3DVG X;  1ZKH A;  1LM8 B;  2BF8 B;  5DCN A;  1M94 A;  3PGE A;  2KWU B;  5AZG A;  3QC8 B;  4ICU A;  4CO7 A;  3HHM A;  3PTF C;  3JSV B;  5AEK B;  4HDQ A;  2AL3 A;  3M95 A;  5D7G A;  4HXD A;  4HVB A;  3B0A A;  1K8R B;  2RPQ A;  4WWN A;  2O2V A;  3R66 C;  2FIF A;  4NAW B;  2KNB A;  1E7U A;  3VUW A;  2KN5 A;  2CU1 A;  2KTR A;  2NCN A;  4MGZ E;  2WWZ A;  1WF9 A;  2LVP A;  2XBB C;  1WE7 A;  1UGM A;  3MJW A;  2I1J A;  5G55 A;  2ZPN A;  5D2M B;  3M63 B;  2LI5 A;  3PLV A;  1YIW A;  3V6C B;  4XX5 A;  4ASW C;  1E8Z A;  2AYO B;  2M4N A;  1XT9 B;  3B08 A;  3VQI A;  1V86 A;  1E5W A;  2ZCB A;  4XC2 A;  3V6E B;  2L76 A;  4DHZ B;  1WZ0 A;  1MG8 A;  2JF5 A;  2D07 B;  3PV1 A;  4HLE A;  3ENE A;  2C7N B;  2R2Q A;  1H4R A;  1HE8 A;  4PYU A;  3DVN U;  3ZNZ B;  3UIN B;  3EFU A;  3NS8 A;  2KDF B;  2CHX A;  1UZX B;  2M0X A;  3KH0 A;  3QA8 A;  4PS3 A;  1SGH A;  2BWF A;  2FCN A;  5CHW A;  4HWI B;  3WAM A;  3NZS A;  3WAO A;  2N9P C;  5CHF A;  3RZW C;  1YQB A;  3RYT A;  2J0M A;  1WZ3 A;  4MH0 E;  2FNJ B;  2JPH A;  2BGF A;  2G45 B;  4K7W A;  4EFO A;  2BKR B;  3RUI B;  1ZW7 A;  2MRP A;  2D10 A;  5AZH A;  5LLI A;  3VFK A;  1EO6 A;  4A20 A;  5IAA C;  4ZYN A;  4F7Z A;  3BY4 B;  3R3M A;  1RAX A;  1WYW B;  4N9F 4;  4MM3 A;  2L00 B;  1WR6 E;  3TCA A;  3U30 A;  2LJ5 A;  3JSV A;  4WAA A;  5G2N A;  1WX8 A;  2KO3 A;  3ZUN A;  3CST A;  2K6Q A;  4LJO B;  4TV3 A;  4E74 A;  4W9E A;  3T8M A;  1P98 A;  3NHE B;  5CX3 A;  3O65 B;  4AJY B;  3CF6 E;  4HPL B;  1V5T A;  1E7V A;  2LXC A;  4NAW A;  4W9J A;  1WJN A;  4K1R B;  1J19 A;  3HM6 X;  2FCS A;  3KW5 B;  5DPR A;  3WAN A;  3ZO5 B;  2NVU I;  2KMC A;  3L0W B;  2LWP A;  3IFW B;  3T9L A;  3AU5 A;  4DHJ D;  2IYD B;  2ZNV B;  1TTN A;  2JUO A;  4NJ6 A;  4GDK A;  2HTH A;  3PHW B;  3GZN I;  3DBS A;  2JT4 B;  3DPD A;  2JZ3 B;  1FXT B;  4OVU A;  3SDL C;  4DWF A;  4B9K A;  1KM7 A;  2NBV B;  5FR6 A;  4M0W B;  3SD5 A;  2K8H A;  3V61 A;  4CHK A;  4FBJ B;  1X1M A;  4NPN A;  3LDZ E;  3EC8 A;  2ZVN A;  2GBR A;  3VAW A;  1QZE A;  1WRD B;  4GSW A;  4KDI C;  3UQA A;  2D2Q A;  4GIV A;  1RFA A;  4FJZ A;  4BVU C;  1C3T A;  1NBF C;  4IWP A;  5KHQ A;  2IZV B;  1C1Y B;  1WE6 A;  2NBU A;  4IM2 A;  3SU8 X;  2HD5 B;  2KJ6 A;  3C0R B;  2CR5 A;  4GDL B;  4BFR A;  2ZJD A;  3PPA A;  2BYV E;  3ZLZ A;  1UBQ A;  1E8Y A;  2NR2 A;  2JXX A;  2Y5B B;  4J6I A;  1TGZ B;  4W9H A;  2IY1 B;  1YX6 B;  3S2A A;  2DAJ A;  4ANW A;  2EKE C;  2K8B A;  5D94 A;  4W9L A;  3ML8 A;  5AZF A;  2BYF A;  3KUD B;  3KUZ A;  4GXB A;  4I6N B;  5C23 A;  2MA9 B;  1WJ4 A;  1J8C A;  1WH3 A;  1WGG A;  3OLM D;  3R7R A;  5JHB A;  1D3Z A;  1WM3 A;  2KAN A;  2KVR A;  3APD A;  5J18 A;  2HJ8 A;  3ZNI D;  3RD2 A;  3I3T B;  3QX1 A;  4I6P A;  1JRU A;  1WXV A;  4LDT D;  4MJS B;  3VVW B;  2AL6 A;  4K81 A;  4FHJ A;  1YD8 U;  3NZU A;  3CMM B;  2KWC A;  1UH6 A;  3OJ4 B;  2KXJ A;  2WYQ A;  3ECI A;  5TR5 A;  4G0N B;  3TMP B;  1SE9 A;  4NY0 A;  2BYE A;  5CTR C;  4AJW A;  2EMS A;  2KKC A;  4EOY A;  3R7Q A;  3W1Y A;  1WGR A;  3PLU A;  2KK8 A;  2O6V D;  4HK2 A;  1KJT A;  1R4M I;  2FID A;  2L8J A;  1AAR A;  5JHA A;  2BWE S;  4GN1 A;  4MSQ B;  4GU2 A;  4MSM B;  3RZF A;  5KHO A;  3VUX A;  3DQV A;  4GGQ A;  1EF1 A;  2N4F A;  2NPT A;  2AWT A;  4JIO U;  4WWP A;  5D6J B;  2RD0 A;  4TQ1 A;  1IPG A;  1V80 A;  4GDL A;  4WJN A;  2KX3 A;  2C7H A;  2N1V A;  2G4D B;  2KOX A;  2LD9 A;  1UD7 A;  2MBH A;  2KDI A;  4E3C A;  3DVN V;  2MP2 A;  3AXC A;  3IHP C;  3A33 B;  2JRI B;  3B1L X;  2K8C A;  2N9X A;  4W9D A;  1EUV B;  3TIX A;  1XD3 B;  4FAD A;  5DPT A;  3W1S A;  3JYU A;  3Q3J A;  4CYE A;  4HJK A;  2ASQ A;  1OGW A;  2ZVO A;  4JLC A;  4B95 A;  1E8X A;  1Q1O A;  2M8S A;  2IO2 B;  4HCN B;  1LQB A;  4MGI E;  4BKT A;  3APC A;  4EKU A;  4EZK A;  4KIK B;  2LXA A;  1Q0W B;  5DPS A;  2D3G A;  1F9J A;  5BO4 B;  4TQ0 A;  2GBJ A;  2RSU A;  4AOF A;  2K1F A;  2MLB A;  4BBN C;  4PYZ A;  3A4R A;  5CHV C;  3L17 A;  4ANX A;  4DHJ B;  5J2R A;  2DZK A;  3ZDM C;  3ZKJ C;  4DK5 A;  3ONS A;  3IG3 A;  4BKS D;  3UF8 A;  3ZNH B;  2LZ6 A;  3H9D A;  1VCB A;  2NBW B;  3QQ8 B;  4G11 A;  4HCP B;  2KZR A;  1XQQ A;  4F1S A;  2GOW A;  2KC2 A;  2LUE A;  2XEW A;  4URK A;  2MWS B;  4RM8 A;  1LXD A;  1V9J A;  3CSF A;  2M1M A;  1PQS A;  1Q5W B;  4G50 A;  5E6N A;  1IP9 A;  2LGD A;  1H8C A;  2LRW A;  2KFJ A;  4FJY A;  1YJ1 A;  3IVF A;  3DDC B;  4LJP B;  4AWJ A;  1BT0 A;  4M8M A;  1A5R A;  3P2B A;  3PS6 A;  3WA0 A;  2CS4 A;  3EHV A;  2G4S A;  5JZE B;  2IO0 B;  2KDB A;  4W9I A;  1WX7 A;  3MHS D;  3V62 A;  4DDI D;  4A3O A;  5J17 A;  3N30 A;  3KUC B;  4W9K A;  1OTR B;  2IBI B;  2DYO A;  3U7D A;  1OEY J;  2DZI A;  3A4S C;  3VHT C;  3X23 A;  3QCA A;  4K7S A;  3M3J A;  2VRR B;  2KD0 A;  3KYD D;  3KVF B;  5E6P A;  1WR1 A;  2CKH B;  1GG3 A;  2N1W A;  3GOE A;  1I42 A;  2N7E A;  3EEC A;  3LJ3 A;  4KSK C;  4WWO A;  4ANU A;  1NDD A;  3ZTC A;  1GC7 A;  4LDT B;  2Z59 B;  1WXS A;  3VH4 B;  2R2O A;  3IBE A;  3PSE B;  3DOW A;  3AUL A;  2KFK B;  4NJ7 A;  5E6O A;  2OJR A;  1V2Y A;  4MDK E;  4HPM B;  1WGD A;  2EMT A;  1U4A A;  2UWQ A;  5DPW A;  4G3X B;  1WGH A;  1Y8R C;  2QHO A;  4HDO A;  3TJP A;  5JH5 C;  2M17 A;  2O6V B;  4IM3 A;  1GNU A;  1WJ6 A;  4IW0 A;  4WQO B;  1GJZ A;  5GMV A;  1KLV A;  4KV2 A;  4BBN F;  4IWO A;  2B3A A;  4KZ0 A;  2ZEQ A;  2JWZ A;  1WXM A;  1WMH B;  2JRH A;  1WGY A;  4P7I A;  4XZ4 A;  2DZM A;  1CMX B;  3WAP A;  3VXW A;  3OAW A;  1J0G A;  1ISN A;  4FJV B;  4BKG A;  3HIZ A;  1V49 A;  4TKN A;  1VD2 A;  3DBR I;  4IC7 B;  2A4Z A;  4BOS C;  1V81 A;  2MBE A;  4OVV A;  4ZRI A;  4YL8 A;  1KOT A;  5L95 C;  3D32 A;  2C7M B;  1RRB A;  3A9K B;  2KQ7 A;  2KHW B;  3DCG A;  2G3Q B;  1TZ1 A;  4GOC A;  3A1Q B;  3UIO B;  1WXA A;  2DX5 B;  2MSE D;  4FN2 A;  1WM2 A;  3ZTD A;  4AUQ C;  4EZJ A;  1WJU A;  3VTU A;  2C60 A;  4KSL C;  3L54 A;  4WJO A;  2LVQ A;  3L08 A;  2V4L A;  2AEH A;  3PRM B;  1GC6 A;  5LXH A;  2IO1 B;  2V3S A;  1NI2 A;  1TBE A;  3QWZ B;  3UGB B;  2WDT B;  2KTF A;  4ZDV A;  5IA7 A;  3BIN A;  2L3Z A;  3L10 B;  4II3 B;  2MBO A;  1IYF A;  4NNJ B;  3AI5 A;  4I6L B;  3U8Z A;  2Z0E B;  2LGY A;  1E90 A;  1T0Y A;  2UYZ B;  1S3S G;  2JZZ A;  3QIJ A;  3QJZ A;  3ALB A;  5EDS A;  5HKH A;  4KVG B;  1P1A A;  3L13 A;  2KFK A;  3WIM A;  2KC1 A;  2FAZ A;  2IO3 B;  3M62 B;  2GBM A;  3K9O B;  1WX9 A;  2N7D A;  4MEL A;  3DVG Y;  4DHZ E;  1UEL A;  3TL5 A;  2O6V A;  2KMA A;  2DYB A;  2LVO A;  2XK5 B;  2Z0D B;  3PRP B;  3V60 A;  1WI0 A;  4MGY E;  2KQS A;  4NQL B;  2DYM A;  1WMH A;  2MX2 A;  4PS7 A;  1OEY A;  4GDK B;  4MJS A;  4RM9 A;  2PPH A;  2ZNV C;  4A3P A;  3N3K B;  3RUL A;  1L2N A;  3H7S A;  2IY0 B;  2RGF A;  3A9J B;  5C1Z A;  4K7U A;  2K25 A;  2RR9 A;  3A9K A;  3SHQ A;  4JQW C;  2CHW A;  2KWV B;  3A1Q A;  1S1Q B;  2ZCC A;  2W9N A;  3DBH I;  3QAR A;  3X0W A;  1EF5 A;  1SIF A;  4MEM A;  2K6D B;  4NQK E;  2J7Q B;  1P9D U;  4EEW A;  4EZL A;  2MCN B;  3Q3F A;  4X57 B;  4BOZ B;  2C5L C;  2I1K A;  3UQB A;  2KX0 A;  2J0J A;  4F8C B;  3PRZ A;  2CHZ A;  1OQY A;  3PHX B;  4DXA B;  4KZC A;  1WIA A;  2JY6 A;  3HK0 A;  4II2 B;  1G6J A;  2YLM A;  2GMI C;  2N9E B;  3PVL A;  3PRE A;  4W9F A;  2DEN B;  5LXI B;  2ZZP B;  3ZVV A;  3ZIM A;  5L83 A;  3TBL D;  2C9W B;  2MQJ A;  2WX0 A;  2FCQ A;  3APF A;  3H7P B;  3W1S C;  3ZRF A;  2HE7 A;  4BKS A;  2D11 A;  2A5U A;  2KJH B;  3ZW3 A;  2REX A;  4EUT A;  1ZGU B;  3H6N A;  4ZRK A;  3NY5 A;  4GB9 A;  4M8N A;  2GBK A;  3VTV A;  2KLG A;  2XK5 A;  4GMV A;  4LCD E;  1L7Y A;  2MBB B;  4FHK A;  1WY8 A;  1V5O A;  4KIK A;  3QK0 A;  4IWQ A;  2L0T A;  3WAL A;  4AP4 C;  2NS5 A;  3K9P B;  4DDG D;  4IUM B;  3UIP B;  2PEA A;  3RCZ A;  3RT3 B;  2V1Y A;  1YX5 B;  2K39 A;  3A9J A;  3QAQ A;  4ZRJ A;  1E8W A;  4FUL A;  1GUA B;  2YVC A;  2O2V B;  3MTN B;  1Z2M A;  3PT2 B;  2L7R A;  3DBL I;  4WJP A;  4WJQ A;  4FA6 A;  1R4N I;  2NPT B;  2L0F A;  1I35 A;  2JVC A;  3JW0 X;  1WFY A;  2KTR B;  1Z5S B;  3VUY A;  4JGH B;  4DBG A;  2KLC A;  3VDZ A;  1UBI A;  2KJR A;  2LAS A;  3OJ3 A;  2DAF A;  4B6W A;  4IM0 A;  2PJH A;  3VTW A;  3L16 A;  4RMA A;  1P0R A;  3ML9 A;  2MP2 B;  3JVZ X;  1V6E A;  3VH3 B; 
#chains in the Genus database with same CATH topology
 1XCT L;  3KYC D;  4FLH A;  2EEL A;  2WQY B;  2BPS A;  2KDE B;  4UDU C;  3NOB A;  2OOB B;  2RDB C;  4MGK E;  5BMH A;  2MBQ A;  1E0Z A;  3ZDT A;  4E71 A;  4DQO C;  2L05 A;  2DHZ A;  2DZJ A;  1K53 A;  1ZKH A;  2HJ1 A;  5AZG A;  3HHM A;  4MAC A;  1UF0 A;  3JSV B;  3I57 A;  2AL3 A;  5D7G A;  1KH0 A;  2RPQ A;  2O2V A;  4NAW B;  2BS3 B;  4YTM B;  3DBR B;  2CU1 A;  4MGZ E;  3FIL B;  1JWU D;  1DGJ A;  2XBB C;  1UGM A;  4HKZ E;  5D2M B;  3M63 B;  3V6C B;  2AYO B;  3EUB 2;  1E5W A;  2JF5 A;  1MG8 A;  3PV1 A;  2DWQ A;  3ZNZ B;  3QA8 A;  4P1B C;  3GS2 A;  3RNF C;  3N9Y C;  2KYW A;  2N9P C;  4MH0 E;  2FNJ B;  2G45 B;  4EFO A;  1ZW7 A;  4A20 A;  1RAX A;  5G2N A;  1GAQ B;  2AQ1 B;  3MP9 A;  4LJO B;  1KF6 B;  3RN9 C;  1GPX A;  2IPK D;  1C76 A;  1RFK A;  4HRO A;  4DXF A;  3ZJU A;  3DWM A;  1J19 A;  5DPR A;  2FCS A;  1OQQ A;  3AEB B;  3L0W B;  3IFW B;  3AU5 A;  2HDE A;  2BTE A;  2IYD B;  1TTN A;  4US8 A;  3DBS A;  3DPD A;  3SDL C;  4N59 A;  1TS3 A;  4CHK A;  3LDZ E;  3EC8 A;  1JWA D;  1QZE A;  1WRD B;  3ZYY X;  4GSW A;  4KDI C;  3LYY A;  5EE3 A;  4BVU C;  1C3T A;  1XLP A;  4IWP A;  4IM2 A;  1SF0 A;  2HD5 B;  3SU8 X;  2WDR B;  4OW0 A;  1HZ5 A;  1TGZ B;  4W9H A;  1YX6 B;  2DAJ A;  2EKE C;  1JCK B;  5D94 A;  4S0R A;  2DLB A;  3KUD B;  5IO9 A;  2MA9 B;  1L4D B;  1WH3 A;  3APD A;  2HJ8 A;  3AEA B;  4XWW A;  1V1P A;  5IN7 A;  2NMQ A;  4GLS C;  3I3T B;  3QX1 A;  4LDT D;  1WXV A;  4PK1 A;  3CMM B;  2G9H D;  1UH6 A;  1BXT A;  2BYE A;  2EMS A;  2KKC A;  4EOY A;  3R7Q A;  1KJT A;  1R4M I;  2L8J A;  3RMK C;  5JHA A;  2Y5P A;  4MSQ B;  3VUX A;  3DQV A;  3R8B A;  2FBW B;  2LJI A;  5D6J B;  4TQ1 A;  3HRD D;  5G5H A;  2C7H A;  2WU5 B;  1UD7 A;  2MP2 A;  3Q3O C;  2WXP A;  3B1L X;  2WHI A;  3AE8 B;  3JYU A;  4A90 A;  2ASQ A;  1OGW A;  4B95 A;  1K51 A;  2M8S A;  2IO2 B;  4HCN B;  1LQB A;  2M56 B;  1C77 A;  2Y3A A;  5DPS A;  2D3G A;  1F9J A;  4YTN B;  4MH8 A;  1WSP A;  4OZA A;  2MLB A;  3HUI A;  3A4R A;  4ANX A;  1C78 A;  3OG5 A;  2LMC A;  2KAJ A;  2MJD A;  4G11 A;  2KZR A;  1XQQ A;  2LUE A;  1FRR A;  2MWS B;  3CSF A;  1J7B A;  4G50 A;  2LGD A;  1F1H A;  1KLG D;  1LO5 D;  4ZYS A;  1PDX A;  1UNS A;  4AWJ A;  2ACZ B;  2CS4 A;  2X38 A;  1IUE A;  1DOY A;  4H2A A;  4WH4 A;  4M02 A;  2IBI B;  1TY0 A;  2CU3 A;  2BW2 A;  3A4S C;  3QCA A;  3M3J A;  1V8C A;  2KD0 A;  4XWT A;  2I38 A;  3KYD D;  5LNK 1;  2N1W A;  3LJ3 A;  1ENF A;  4WWO A;  4ANU A;  1NDD A;  1WXS A;  3VH4 B;  4A9A A;  1TJE A;  2QEJ C;  3AUL A;  2KFK B;  1TS4 A;  4NJ7 A;  5E6O A;  1JQ4 A;  2EMT A;  3EGR A;  1WGH A;  2QHO A;  3U52 E;  4D2K A;  4HDO A;  3TJP A;  2O6V B;  5G5G A;  4KV2 A;  4KZ0 A;  1BUI C;  1WMH B;  1J0G A;  1T3Q A;  4BKG A;  3RNC C;  3HIZ A;  1V49 A;  4TKN A;  4IC7 B;  2A4Z A;  2GLS A;  4BOS C;  2BVC A;  5L95 C;  3EA6 A;  2QMT A;  4IOI E;  3A9K B;  1TZ1 A;  4C4V B;  2ZW1 A;  4XDC A;  4FN2 A;  1WM2 A;  3ZTD A;  2WXK A;  1I4H A;  1ZOY B;  1E9M A;  4WJO A;  3AED B;  3PRM B;  1JRP A;  5IOI A;  2WDT B;  3L10 B;  1IYF A;  1T0Y A;  3QJZ A;  4KVG B;  1P1A A;  4C00 A;  3WIM A;  2KC1 A;  2V3P A;  1WX9 A;  3DVG Y;  2ONQ A;  1YQ4 B;  2Z0D B;  2KQS A;  2MX2 A;  4GDK B;  3AMZ A;  4NZL B;  4RM9 A;  4O1N A;  2ICI A;  2ZNV C;  2WNM A;  1R4M B;  2J4X A;  3RUL A;  3H7S A;  2RGF A;  4L23 A;  5C1Z A;  2K25 A;  3PO0 A;  4US9 A;  1QIL A;  2CHW A;  2IGH A;  5C2T B;  2NTT A;  3A1Q A;  2ZCC A;  5C3J B;  3DBH I;  2M0A A;  3N1Z C;  1P9D U;  4EZL A;  2MCN B;  2I1K A;  3UQB A;  1OQY A;  2DEN B;  4YSZ B;  3ZQ4 A;  2WGS A;  2WX0 A;  2PW9 A;  2HE7 A;  4NAM A;  2A5U A;  2KJH B;  3ZW3 A;  4EUT A;  2DBY A;  1ZGU B;  3H6N A;  4GB9 A;  4M8N A;  4K3C A;  4RNA A;  2XK5 A;  3E9S A;  2WS3 B;  2L0T A;  1JW9 D;  4DDG D;  2MEK A;  1CK1 A;  2V1Y A;  1E8W A;  3AEG B;  1HA5 A;  2FUG 1;  1R4N I;  2L0F A;  1N63 A;  1WFY A;  4DBG A;  4JGH B;  2V0G A;  3B2G A;  3VDZ A;  2KJR A;  2W3S A;  4B6W A;  1ESF A;  3VTW A;  4KKJ A;  1V6E A;  2IND C;  1C4C A;  4OHJ A;  4B0M A;  4W9G A;  4JL9 A;  4YTP B;  1FFU A;  1L0Y B;  4LNO A;  3I5J C;  2J0K A;  3MC9 A;  1RLF A;  3H7P A;  3H1U A;  4ANV A;  3N32 A;  3TEY A;  4P16 A;  2BKF A;  4W9C A;  3Q3M C;  1LFD A;  1QOA A;  2E6X A;  3RI7 C;  2LRU A;  2PE6 B;  1WYG A;  2WXH A;  1V1O A;  2J42 A;  3PTF C;  3ZJV A;  3M95 A;  1FCL A;  1L0X B;  3VUW A;  2KN5 A;  2WWZ A;  1WF9 A;  3ZJT A;  3MJW A;  4C56 C;  2LI5 A;  1YIW A;  2KN4 A;  3LB8 C;  1D4B A;  4ZRQ A;  4XX5 A;  2WU2 B;  4ASW C;  2XN9 C;  1WZ0 A;  2D07 B;  4HLE A;  2R2Q A;  3ZXV A;  1H4R A;  1LGR A;  3DVN U;  1UZX B;  2M0X A;  3KH0 A;  4LTU A;  1SGH A;  2BWF A;  2FCN A;  4HWI B;  3NZS A;  5CHF A;  3RYT A;  1WZ3 A;  1UWX A;  2N9L A;  3HVD A;  2MRP A;  2D10 A;  1EO6 A;  5IAA C;  1ET9 A;  2V3N A;  1C4A A;  4N6E B;  2LJ5 A;  3JSV A;  4WAA A;  1WX8 A;  4TV3 A;  1P98 A;  5CX3 A;  3DWG C;  4QAY A;  2KMM A;  3CF6 E;  3IXS A;  3FAH A;  4NAW A;  1E7V A;  2LXC A;  4W9J A;  1ZXH A;  2VH2 A;  3HM6 X;  3KW5 B;  3WAN A;  2KMC A;  2LWP A;  4BZA A;  3MJ5 A;  4ZHO A;  1FEH A;  2JZ3 B;  4OVU A;  3DBH B;  4M0W B;  3SD5 A;  2K8H A;  1X1M A;  1QOB A;  2ZVN A;  2GBR A;  3BK1 A;  1RFA A;  2IZV B;  2NBU A;  4WUR A;  3C0R B;  2CR5 A;  4GDL B;  2ZJD A;  2BYV E;  1UBQ A;  5BMG A;  3ETR A;  2NR2 A;  1KTK A;  2Y5B B;  1HTQ A;  3S2A A;  1PUT A;  1PYW D;  4ANW A;  4KGT A;  3ML8 A;  5AZF A;  2AX5 A;  3Q8F A;  2LFI A;  3KUZ A;  5C23 A;  2D5G A;  2BT6 A;  1WGG A;  3R7R A;  1D3Z A;  1KFY B;  5J18 A;  1YMH E;  3VVW B;  2AL6 A;  1J7A A;  1YD8 U;  3RNA C;  2INN E;  3GB1 A;  3V05 A;  4NY0 A;  1R4N B;  5CTR C;  3Q6B A;  3W1Y A;  4HK2 A;  3PLU A;  2KK8 A;  2O6V D;  3C19 A;  1FNV A;  5KHO A;  1EF1 A;  1P7F A;  4WWM A;  2NPT A;  1E6E B;  4WWP A;  3WCQ A;  2RD0 A;  4NJC A;  1EU3 A;  3TSS A;  2KX3 A;  2QSD A;  1HZ6 A;  2MBH A;  3AXC A;  3P42 A;  2E3T A;  1J7C A;  2JRI B;  4OVZ A;  2K8C A;  2N9X A;  1EM7 A;  1EUV B;  3TIX A;  1YQ3 B;  2ZVO A;  2DNF A;  3AE1 B;  4C7Z A;  1Q1O A;  3P4R B;  2J52 A;  3CIR B;  4EZK A;  2RDG A;  5BO4 B;  4TQ0 A;  2GBJ A;  4AOF A;  4DHJ B;  5CHV C;  1FPY A;  1N6Z A;  3AE4 B;  2BB5 A;  3IG3 A;  4BKS D;  1NEK B;  2BS2 B;  3TEZ A;  1KRH A;  2JQR B;  1VCB A;  3GE3 C;  4F1S A;  1TT5 B;  2XEW A;  3NVZ A;  1LXD A;  1V9J A;  1FM0 D;  3AE7 B;  3C8Y A;  2MH7 A;  5E6N A;  2CJO A;  4HRS A;  1H8C A;  4HJG E;  2KFJ A;  3BII D;  5HHD G;  4M8M A;  2IGG A;  4W9I A;  1TY2 A;  4A3O A;  5J17 A;  3N30 A;  1OTR B;  1ZXI A;  2D3A A;  3VHT C;  4K7S A;  3AE6 B;  3AN1 A;  3KVF B;  4IKG A;  1XCQ L;  1GB4 A;  3GOE A;  1I42 A;  2N7E A;  3EEC A;  3URY A;  1IBX B;  4KSK C;  3P4Q B;  2VZK D;  3ZTC A;  1XO3 A;  2Y5C A;  1SJE D;  2X8X X;  1E7P B;  4TMA B;  2OJR A;  1V2Y A;  1VZ8 A;  4LNI A;  1WGD A;  1M4V A;  1U4A A;  5DPW A;  1Y8R C;  3EFC A;  4IM3 A;  1GNU A;  4IW0 A;  5GMV A;  4BBN F;  4IWO A;  1NYQ A;  2B3A A;  2ZEQ A;  3GE8 C;  2DZM A;  4YT0 B;  3WAP A;  3VXW A;  4FJV B;  4FXC A;  5TSS A;  3DHG C;  1VD2 A;  1L6U A;  4REZ A;  1HQR D;  1YJI A;  3HVZ A;  2KHW B;  2G3Q B;  1UWM A;  1SIJ A;  3UIO B;  1WXA A;  2DX5 B;  1MFW A;  2MSE D;  4AUQ C;  1DOI A;  1FXA A;  4KSL C;  4P1C C;  3L54 A;  2AEH A;  4KX6 B;  1GC6 A;  4HKQ A;  1NI3 A;  1ZDX A;  2IO1 B;  2V3S A;  1NI2 A;  3UGB B;  3OWE B;  2KTF A;  4ZDV A;  3BIN A;  2L3Z A;  4II3 B;  1N5X A;  2IDY A;  2Z0E B;  2JYE A;  3BK2 A;  1N60 A;  3RNG C;  3QIJ A;  5EDS A;  1AWD A;  2KFK A;  1ROE A;  4C7Y A;  3GP7 A;  2GBM A;  2N7D A;  4DHZ E;  1XLO A;  1BML C;  3B2F A;  2O6V A;  2DYB A;  3NVY A;  5BYQ A;  1YJJ A;  1SB3 C;  1D5Z C;  3AE3 B;  3KWV A;  1A70 A;  1XLQ A;  4PS7 A;  1WMH A;  4MJS A;  3NZ3 A;  3TUO A;  2IY0 B;  3A9J B;  4K7U A;  3A9K A;  1I7H A;  2KWV B;  2PTL A;  1FMA D;  4C4V A;  1WWT A;  2RMM A;  1B9R A;  3BYT B;  1EF5 A;  1EU4 A;  2K6D B;  2WXR A;  4NQK E;  2J7Q B;  4EEW A;  2N7J A;  4X57 B;  2JYT A;  2J0J A;  4F8C B;  1B1Z A;  3PRZ A;  3AEF B;  3PHX B;  3PZ8 A;  4DXA B;  4KZC A;  1TYG B;  1G6J A;  1FXI A;  3PRE A;  2ZZP B;  3ZIM A;  3APF A;  4BKS A;  3BVM A;  1V1P B;  2BB6 A;  1FNW A;  4KIK A;  4IWQ A;  5EE1 A;  2KT7 A;  4AP4 C;  1CJE A;  1F2R C;  1YX5 B;  2V9H A;  3QAQ A;  4ZRJ A;  3TEW A;  2EKI A;  3MTN B;  1HEZ E;  2QDF A;  2L7R A;  1HTO A;  4WJP A;  3DHH C;  1QOF A;  4WJQ A;  4AS1 A;  2JVC A;  1XF5 L;  2KTR B;  3VUY A;  2OJW A;  3IAM 1;  3W2D A;  1UBI A;  1EWC A;  2LAS A;  2DAF A;  1CQV A;  1SSN A;  2MP2 B;  3JVZ X;  4LCD E;  5T8I A;  3VH3 B;  3ZNG C;  4KDL B;  2MW5 A;  3LXF A;  1P3Q U;  2FCM A;  2L83 A;  2L32 A;  2FUH B;  1VZ7 A;  4IG7 B;  1C9F A;  3PZD A;  1WGK A;  4TUU A;  3SR6 A;  1K50 A;  3HM3 A;  2PMV A;  3U4E G;  2BF8 B;  1LM8 B;  2JZP A;  1M94 A;  3PGE A;  3QC8 B;  4ICU A;  5D3I B;  3E56 A;  4HDQ A;  4Q2J A;  1K8R B;  3P4S B;  3R66 C;  4ACF A;  2FIF A;  1FRD A;  2NCN A;  3NUH B;  1EWY C;  2LVP A;  5HI1 A;  5G55 A;  4JWU C;  1E8Z A;  3B08 A;  3VQI A;  2ZCB A;  4XC2 A;  2L76 A;  1ZP0 B;  1JRO A;  3IT6 B;  2K22 A;  3ENE A;  1HE8 A;  4LLG M;  1SJH D;  3UIN B;  3EFU A;  3NS8 A;  2CHX A;  2SAK A;  3WAM A;  1TS2 A;  3WAO A;  2VH1 A;  4HPP A;  4JE3 B;  2J0M A;  2BGF A;  3MFG A;  4K7W A;  1GB1 A;  5AZH A;  3VFK A;  4ZYN A;  3R3M A;  4N9F 4;  1WYW B;  4MM3 A;  2L00 B;  2KO3 A;  4LNF A;  2K6Q A;  5JXV A;  4W9E A;  1R7S A;  2W3R A;  4BAX A;  4K1R B;  4ITK A;  1PGB A;  3ZO5 B;  2NVU I;  3T9L A;  4DHJ D;  2WDV B;  4WQM A;  1DYQ A;  2JUO A;  1JWM D;  1SE3 A;  4DWF A;  4JWS C;  1KM7 A;  2NBV B;  2R61 A;  4A6Q A;  3V61 A;  4FBJ B;  4NPN A;  3FKY A;  3KWL A;  3UQA A;  2D2Q A;  4RCO A;  1QOG A;  1NBF C;  5KHQ A;  1CZP A;  3P4P B;  3PPA A;  4USA A;  1E8Y A;  4LK0 M;  2PVG C;  4RFB A;  1SE2 A;  4JX1 C;  3VR8 B;  4EE2 A;  4GXB A;  4I6N B;  4OZC A;  1J8C A;  3OLM D;  5JHB A;  2KAN A;  2KVR A;  2WXM A;  3GZN B;  4A8X C;  4I6P A;  1JRU A;  1L4Z B;  4FHJ A;  3MC8 A;  2JU6 X;  2LUM A;  2KXJ A;  3ECI A;  1TKY A;  4YWG G;  3Q2A C;  4M0W A;  2N0S B;  2LHD A;  2BWE S;  4MSM B;  4R3D A;  4GGQ A;  2N4F A;  2MJ3 A;  2LGS A;  2OHF A;  4JIO U;  2PIA A;  4WAF A;  1FFV A;  1IPG A;  2WXG A;  1V80 A;  5HFY A;  4GDL A;  3P1M A;  2N1V A;  2G4D B;  2KDI A;  3DVN V;  2WDQ B;  2LHE A;  3IHP C;  3A33 B;  1SE4 A;  1T5X D;  4IDI A;  3W1S A;  3Q3J A;  2WLB A;  3BYY B;  1E8X A;  1VR9 A;  4MGI E;  3APC A;  4EKU A;  2OED A;  1I4R A;  1Q0W B;  1AW7 A;  3VRA B;  4BBN C;  3NRZ A;  5FR3 A;  4PYZ A;  1I4Q A;  2KVZ A;  3ZKJ C;  3Q14 C;  3ONS A;  3UF8 A;  2LZ6 A;  3H9D A;  1ET6 A;  2H88 B;  2KC2 A;  4URK A;  1C79 A;  4CQN A;  1VDV A;  2M1M A;  1PQS A;  3IT4 B;  3AE5 B;  1Q5W B;  2MJE A;  4FJY A;  1YJ1 A;  3FIL A;  3DDC B;  1BT0 A;  4MT5 A;  3AE2 B;  4S17 A;  1K52 A;  1A5R A;  3P2B A;  3PS6 A;  3WA0 A;  3EHV A;  2G4S A;  1D5M C;  1Q10 A;  1WX7 A;  2WXJ A;  3MHS D;  3SEB A;  1NEN B;  1NVI D;  1QT9 A;  2DYO A;  3U7D A;  1OEY J;  1OQR A;  5E6P A;  1GG3 A;  4C80 A;  2GRI A;  4J3O D;  1WXQ A;  1GC7 A;  2Z59 B;  3I9V 1;  2WXI A;  3PSE B;  3DOW A;  1PGA A;  1TIF A;  1SXT A;  4MDK E;  2D3B A;  4HPM B;  2UWQ A;  4G3X B;  1OFF A;  2M17 A;  1XLN A;  4TSS A;  2JWZ A;  2JRH A;  2BYT A;  4P7I A;  4KGR A;  4XZ4 A;  1E10 A;  1CMX B;  1QLB B;  3OAW A;  4ZHP A;  3KQ4 A;  1PFD A;  2RPV A;  2MBE A;  2KWD A;  4OVV A;  1KOT A;  2BBC A;  1RRB A;  1MG4 A;  2KQ7 A;  3DCG A;  2TSS A;  1L5P A;  3R2I A;  4EZJ A;  5I4D A;  2JWU A;  2QC8 A;  3VTU A;  2LVQ A;  5FK9 C;  1F77 A;  3L08 A;  2V4L A;  5LXH A;  1YN3 A;  1WRI A;  2CJN A;  1IBX A;  1TBE A;  5IA7 A;  2MBO A;  4NNJ B;  3AI5 A;  4I6L B;  3U8Z A;  2LGY A;  2UYZ B;  1T0S C;  4YSX B;  2JZZ A;  3T3N A;  3L13 A;  2IO3 B;  3AEE B;  4MEL A;  3Q8A A;  2K9X A;  3V60 A;  3N1Y C;  1I4G A;  1TS5 A;  1WI0 A;  4MGY E;  4NQL B;  5BMI A;  4ARC A;  4JPS A;  3N3K B;  1L2N A;  2WXO A;  1ZUD 2;  2K5P A;  4JQW C;  5MPO A;  5IP4 D;  2W9N A;  3QAR A;  1SIF A;  4MEM A;  3SFE B;  2LGI A;  3AV8 A;  3Q3F A;  4BOZ B;  4YSY B;  2SEB D;  4L1B A;  2CHZ A;  2QCZ A;  1WIA A;  3TEX A;  2YLM A;  2N9E B;  3PVL A;  1TKE A;  4W9F A;  3O13 A;  5L83 A;  2C9W B;  2FCQ A;  2YEP B;  3W1S C;  3ZRF A;  2AQ2 B;  4KGS A;  3BVG A;  5GXG B;  2REX A;  3N20 C;  3NY5 A;  5H92 C;  4WIP A;  3VTV A;  2KLG A;  3B9J A;  3IAS 1;  1L7Y A;  2MBB B;  1WY8 A;  2PLP A;  2WXL A;  5H8Y E;  3MHZ A;  5EE9 A;  3AB5 A;  3RCZ A;  2B76 B;  2W54 A;  3RT3 B;  3A9J A;  4ARI A;  1GUA B;  2YVC A;  2O2V B;  1Z2M A;  3NS1 A;  4FA6 A;  3AH7 A;  2NPT B;  1I35 A;  2W82 A;  2IJ0 A;  1Z5S B;  2KLC A;  2GI9 A;  3W5V B;  4IM0 A;  2PJH A;  3L16 A;  1P0R A;  2LEK A;  3CWI A;  3MC0 B;  3SFD B;  2LGX A;  2D3C A;  3V3X A;  2ZPY A;  3QHT A;  3T3O A;  3N1X C;  4PT5 A;  5E6J A;  4ICV A;  4LNN A;  3ZRC A;  3AU4 A;  2GBN A;  4DXG A;  4XE0 A;  3RPF C;  2WX1 A;  2PKO A;  2WXQ A;  4PS8 A;  2PE9 A;  3DVG X;  2WXN A;  1TKG A;  5DCN A;  2KWU B;  3FC4 A;  3Q8B A;  3DBL B;  4CO7 A;  2N9K A;  5AEK B;  5FKA C;  4HXD A;  4HVB A;  3B0A A;  4RF0 A;  2G1E A;  4WWN A;  1IGC A;  2M19 A;  2KNB A;  4LNK A;  1AYF A;  1E7U A;  2Q5W D;  2KTR A;  1WE7 A;  4L2Y A;  2I1J A;  2ZPN A;  3PLV A;  1QF6 A;  2M4N A;  1XT9 B;  1V86 A;  3V6E B;  4DHZ B;  1QQR A;  1RM6 C;  5EE0 A;  2C7N B;  4PYU A;  1IGD A;  1MHX A;  2KDF B;  4PS3 A;  5CHW A;  3RZW C;  1I4X A;  1YQB A;  1XXG A;  1ZE3 D;  2JPH A;  2BKR B;  1YNT E;  3RUI B;  2KAC A;  5LLI A;  4F7Z A;  3BY4 B;  5BYR A;  4XDD A;  1WR6 E;  3TCA A;  3U30 A;  3ZUN A;  2JXT A;  3CST A;  2KQ4 X;  2WXF A;  3BZD B;  4E74 A;  5D3D A;  3T8M A;  1FNU A;  3NHE B;  3RNB C;  3O65 B;  4AJY B;  4HPL B;  1V5T A;  1WJN A;  1TZO A;  2ZNV B;  4NJ6 A;  4GDK A;  1N61 A;  2HTH A;  2NTS A;  3PHW B;  2ON8 A;  3GZN I;  2JT4 B;  1FXT B;  4B9K A;  5FR6 A;  1FD6 A;  3VAW A;  1L6V A;  4M00 A;  4GIV A;  4FJZ A;  5AUK A;  1QKZ A;  1MI0 A;  1C1Y B;  1WE6 A;  2KJ6 A;  1DOX A;  3Q8C A;  4BFR A;  3ZLZ A;  1ZPS A;  2JXX A;  4J6I A;  4P6V F;  3PZ7 A;  2IY1 B;  1HXY D;  2K8B A;  4W9L A;  3ZGZ A;  2BYF A;  5AUI A;  3NVW A;  1UGJ A;  1WJ4 A;  1YN5 A;  2H89 B;  4M01 A;  1UUP A;  1WM3 A;  3ZNI D;  3RD2 A;  2INC C;  4MJS B;  1YOV B;  4K81 A;  3DHI C;  3NZU A;  2KWC A;  1N62 A;  3OJ4 B;  2WYQ A;  4KKI A;  5TR5 A;  4G0N B;  3TMP B;  1SE9 A;  1V97 A;  4AJW A;  1WGR A;  2FID A;  1AAR A;  3AEC B;  4GN1 A;  3Q8E A;  4GU2 A;  3RZF A;  1N5W A;  3J9C A;  4RF1 A;  2AWT A;  1FIQ A;  2FE8 A;  3NG0 A;  4WJN A;  2KOX A;  2LD9 A;  4E3C A;  4AQ7 A;  1C4P A;  4W9D A;  2V4I B;  1XEE A;  3BWU D;  1XD3 B;  3KLS X;  4FAD A;  5DPT A;  2W55 A;  4CYE A;  4HJK A;  4A55 A;  4JLC A;  4B0E A;  1FO4 A;  3VR9 B;  4BKT A;  2JSV X;  1JAL A;  5BYS A;  1F52 A;  4KIK B;  2LXA A;  2KDM A;  2RSU A;  2K1F A;  3VRB B;  4ZRP A;  3L17 A;  5J2R A;  2DZK A;  1P7E A;  2GB1 A;  3ZDM C;  4DK5 A;  4OZB A;  3ZNH B;  2K0P A;  1NYR A;  2NBW B;  2Z8L A;  3QQ8 B;  4HCP B;  2GOW A;  3U2S C;  4RM8 A;  4ZOH C;  4YXD B;  1IP9 A;  1KLU D;  4K3B A;  2LRW A;  1JML A;  4RGT A;  3IVF A;  4LJP B;  1SEB D;  3Q3N C;  2VZK B;  1RYJ A;  5JZE B;  2IO0 B;  2KDB A;  3V62 A;  4DDI D;  3KUC B;  4W9K A;  2PVO D;  3UI3 A;  1GOZ A;  2DZI A;  3L4P A;  3X23 A;  2L52 A;  2VRR B;  1VLB A;  1WR1 A;  2CKH B;  4XGA B;  4LDT B;  1Y56 A;  3BVZ A;  3P63 A;  2YEP F;  2R2O A;  3IBE A;  1D6E C;  1JWS D;  4N58 A;  2QIL A;  1L0V B;  5JH5 C;  1WJ6 A;  4WQO B;  1GJZ A;  1KLV A;  1T0Q C;  1T0R C;  1WXM A;  5HG2 A;  3RFZ B;  1WGY A;  1ISN A;  3DBR I;  2QJL A;  1V81 A;  4ZRI A;  4YL8 A;  3D32 A;  2MHJ A;  2C7M B;  2HTM E;  2ZW0 A;  4GOC A;  2K3U A;  3A1Q B;  1MPE A;  3Q69 A;  3AE9 B;  4RGN A;  2INP E;  1WJU A;  4RH6 A;  2C60 A;  4XYC A;  3NVV A;  1I4P A;  3AM9 A;  3QWZ B;  4MM3 B;  1E90 A;  1D5X C;  1S3S G;  3ALB A;  5HKH A;  1MHH E;  2FAZ A;  3M62 B;  3K9O B;  1UEL A;  3TL5 A;  2BS4 B;  2KMA A;  2LVO A;  1VJK A;  2XK5 B;  3PRP B;  1STE A;  2DYM A;  3RNE C;  1OEY A;  3H8H A;  3W9C B;  1VZ6 A;  2PPH A;  4A3P A;  2J53 A;  2QIE B;  3W5U B;  1AN8 A;  2RR9 A;  2I2Y A;  3SHQ A;  4RGO S;  1S1Q B;  2RDH A;  1VRA B;  1MJD A;  1SBB B;  3X0W A;  3I63 C;  2AQ3 B;  2WP9 B;  2C5L C;  2KX0 A;  4HEA 1;  2JY6 A;  3HK0 A;  4II2 B;  2GMI C;  5IKC M;  5LXI B;  3ZVV A;  3TBL D;  2MQJ A;  3H7P B;  1ZDV A;  1F0Z A;  4RGM A;  2D11 A;  2IGD A;  3ABV B;  4ZRK A;  2GBK A;  4GMV A;  4FHK A;  2L1A A;  1V5O A;  3R2T A;  3U7Z A;  3QK0 A;  2XNA C;  3WAL A;  2NS5 A;  3K9P B;  4IUM B;  3UIP B;  2PEA A;  3NJT A;  1JWB D;  2K39 A;  1RWS A;  1T6B X;  2BQQ A;  2UU7 A;  1PGX A;  1F2R I;  4FUL A;  3PT2 B;  3ZXR A;  3DBL I;  3JW0 X;  1MVK A;  2JX5 A;  1YN4 A;  3OJ3 A;  1ACC A;  4RMA A;  1FCC C;  3ML9 A; 
#chains in the Genus database with same CATH homology
 3KYC D;  4W9G A;  3ZNG C;  2LGX A;  4JL9 A;  4KDL B;  2MW5 A;  4FLH A;  1P3Q U;  2FCM A;  2ZPY A;  2J0K A;  3QHT A;  1RLF A;  3H7P A;  3H1U A;  4ANV A;  2BPS A;  2KDE B;  2FUH B;  4ICV A;  3NOB A;  2OOB B;  4IG7 B;  3AU4 A;  3N32 A;  4MGK E;  3ZRC A;  2MBQ A;  2BKF A;  2GBN A;  3PZD A;  3ZDT A;  4E71 A;  4W9C A;  2L05 A;  2DHZ A;  4TUU A;  2WX1 A;  1LFD A;  2DZJ A;  3HM3 A;  4PS8 A;  2PE9 A;  2LRU A;  2PE6 B;  3DVG X;  1ZKH A;  1LM8 B;  2BF8 B;  5DCN A;  1M94 A;  3PGE A;  2KWU B;  5AZG A;  3QC8 B;  4ICU A;  4CO7 A;  3HHM A;  3PTF C;  3JSV B;  5AEK B;  4HDQ A;  2AL3 A;  3M95 A;  5D7G A;  4HXD A;  4HVB A;  3B0A A;  1K8R B;  2RPQ A;  4WWN A;  2O2V A;  3R66 C;  2FIF A;  4NAW B;  2KNB A;  1E7U A;  3VUW A;  2KN5 A;  2CU1 A;  2KTR A;  2NCN A;  4MGZ E;  2WWZ A;  1WF9 A;  2LVP A;  2XBB C;  1WE7 A;  1UGM A;  3MJW A;  2I1J A;  5G55 A;  2ZPN A;  5D2M B;  3M63 B;  2LI5 A;  3PLV A;  1YIW A;  3V6C B;  4XX5 A;  4ASW C;  1E8Z A;  2AYO B;  2M4N A;  1XT9 B;  3B08 A;  3VQI A;  1V86 A;  1E5W A;  2ZCB A;  4XC2 A;  3V6E B;  2L76 A;  4DHZ B;  1WZ0 A;  1MG8 A;  2JF5 A;  2D07 B;  3PV1 A;  4HLE A;  3ENE A;  2C7N B;  2R2Q A;  1H4R A;  1HE8 A;  4PYU A;  3DVN U;  3ZNZ B;  3UIN B;  3EFU A;  3NS8 A;  2KDF B;  2CHX A;  1UZX B;  2M0X A;  3KH0 A;  3QA8 A;  4PS3 A;  1SGH A;  2BWF A;  2FCN A;  5CHW A;  4HWI B;  3WAM A;  3NZS A;  3WAO A;  2N9P C;  5CHF A;  3RZW C;  1YQB A;  3RYT A;  2J0M A;  1WZ3 A;  4MH0 E;  2FNJ B;  2JPH A;  2BGF A;  2G45 B;  4K7W A;  4EFO A;  2BKR B;  3RUI B;  1ZW7 A;  2MRP A;  2D10 A;  5AZH A;  5LLI A;  3VFK A;  1EO6 A;  4A20 A;  5IAA C;  4ZYN A;  4F7Z A;  3BY4 B;  3R3M A;  1RAX A;  1WYW B;  4N9F 4;  4MM3 A;  2L00 B;  1WR6 E;  3TCA A;  3U30 A;  2LJ5 A;  3JSV A;  4WAA A;  5G2N A;  1WX8 A;  2KO3 A;  3ZUN A;  3CST A;  2K6Q A;  4LJO B;  4TV3 A;  4E74 A;  4W9E A;  3T8M A;  1P98 A;  3NHE B;  5CX3 A;  3O65 B;  4AJY B;  3CF6 E;  4HPL B;  1V5T A;  1E7V A;  2LXC A;  4NAW A;  4W9J A;  1WJN A;  4K1R B;  1J19 A;  3HM6 X;  2FCS A;  3KW5 B;  5DPR A;  3WAN A;  3ZO5 B;  2NVU I;  2KMC A;  3L0W B;  2LWP A;  3IFW B;  3T9L A;  3AU5 A;  4DHJ D;  2IYD B;  2ZNV B;  1TTN A;  2JUO A;  4NJ6 A;  4GDK A;  2HTH A;  3PHW B;  3GZN I;  3DBS A;  2JT4 B;  3DPD A;  2JZ3 B;  1FXT B;  4OVU A;  3SDL C;  4DWF A;  4B9K A;  1KM7 A;  2NBV B;  5FR6 A;  4M0W B;  3SD5 A;  2K8H A;  3V61 A;  4CHK A;  4FBJ B;  1X1M A;  4NPN A;  3LDZ E;  3EC8 A;  2ZVN A;  2GBR A;  3VAW A;  1QZE A;  1WRD B;  4GSW A;  4KDI C;  3UQA A;  2D2Q A;  4GIV A;  1RFA A;  4FJZ A;  4BVU C;  1C3T A;  1NBF C;  4IWP A;  5KHQ A;  2IZV B;  1C1Y B;  1WE6 A;  2NBU A;  4IM2 A;  3SU8 X;  2HD5 B;  2KJ6 A;  3C0R B;  2CR5 A;  4GDL B;  4BFR A;  2ZJD A;  3PPA A;  2BYV E;  3ZLZ A;  1UBQ A;  1E8Y A;  2NR2 A;  2JXX A;  2Y5B B;  4J6I A;  1TGZ B;  4W9H A;  2IY1 B;  1YX6 B;  3S2A A;  2DAJ A;  4ANW A;  2EKE C;  2K8B A;  5D94 A;  4W9L A;  3ML8 A;  5AZF A;  2BYF A;  3KUD B;  3KUZ A;  4GXB A;  4I6N B;  5C23 A;  2MA9 B;  1WJ4 A;  1J8C A;  1WH3 A;  1WGG A;  3OLM D;  3R7R A;  5JHB A;  1D3Z A;  1WM3 A;  2KAN A;  2KVR A;  3APD A;  5J18 A;  2HJ8 A;  3ZNI D;  3RD2 A;  3I3T B;  3QX1 A;  4I6P A;  1JRU A;  1WXV A;  4LDT D;  4MJS B;  3VVW B;  2AL6 A;  4K81 A;  4FHJ A;  1YD8 U;  3NZU A;  3CMM B;  2KWC A;  1UH6 A;  3OJ4 B;  2KXJ A;  2WYQ A;  3ECI A;  5TR5 A;  4G0N B;  3TMP B;  1SE9 A;  4NY0 A;  2BYE A;  5CTR C;  4AJW A;  2EMS A;  2KKC A;  4EOY A;  3R7Q A;  3W1Y A;  1WGR A;  3PLU A;  2KK8 A;  2O6V D;  4HK2 A;  1KJT A;  1R4M I;  2FID A;  2L8J A;  1AAR A;  5JHA A;  2BWE S;  4GN1 A;  4MSQ B;  4GU2 A;  4MSM B;  3RZF A;  5KHO A;  3VUX A;  3DQV A;  4GGQ A;  1EF1 A;  2N4F A;  2NPT A;  2AWT A;  4JIO U;  4WWP A;  5D6J B;  2RD0 A;  4TQ1 A;  1IPG A;  1V80 A;  4GDL A;  4WJN A;  2KX3 A;  2C7H A;  2N1V A;  2G4D B;  2KOX A;  2LD9 A;  1UD7 A;  2MBH A;  2KDI A;  4E3C A;  3DVN V;  2MP2 A;  3AXC A;  3IHP C;  3A33 B;  2JRI B;  3B1L X;  2K8C A;  2N9X A;  4W9D A;  1EUV B;  3TIX A;  1XD3 B;  4FAD A;  5DPT A;  3W1S A;  3JYU A;  3Q3J A;  4CYE A;  4HJK A;  2ASQ A;  1OGW A;  2ZVO A;  4JLC A;  4B95 A;  1E8X A;  1Q1O A;  2M8S A;  2IO2 B;  4HCN B;  1LQB A;  4MGI E;  4BKT A;  3APC A;  4EKU A;  4EZK A;  4KIK B;  2LXA A;  1Q0W B;  5DPS A;  2D3G A;  1F9J A;  5BO4 B;  4TQ0 A;  2GBJ A;  2RSU A;  4AOF A;  2K1F A;  2MLB A;  4BBN C;  4PYZ A;  3A4R A;  5CHV C;  3L17 A;  4ANX A;  4DHJ B;  5J2R A;  2DZK A;  3ZDM C;  3ZKJ C;  4DK5 A;  3ONS A;  3IG3 A;  4BKS D;  3UF8 A;  3ZNH B;  2LZ6 A;  3H9D A;  1VCB A;  2NBW B;  3QQ8 B;  4G11 A;  4HCP B;  2KZR A;  1XQQ A;  4F1S A;  2GOW A;  2KC2 A;  2LUE A;  2XEW A;  4URK A;  2MWS B;  4RM8 A;  1LXD A;  1V9J A;  3CSF A;  2M1M A;  1PQS A;  1Q5W B;  4G50 A;  5E6N A;  1IP9 A;  2LGD A;  1H8C A;  2LRW A;  2KFJ A;  4FJY A;  1YJ1 A;  3IVF A;  3DDC B;  4LJP B;  4AWJ A;  1BT0 A;  4M8M A;  1A5R A;  3P2B A;  3PS6 A;  3WA0 A;  2CS4 A;  3EHV A;  2G4S A;  5JZE B;  2IO0 B;  2KDB A;  4W9I A;  1WX7 A;  3MHS D;  3V62 A;  4DDI D;  4A3O A;  5J17 A;  3N30 A;  3KUC B;  4W9K A;  1OTR B;  2IBI B;  2DYO A;  3U7D A;  1OEY J;  2DZI A;  3A4S C;  3VHT C;  3X23 A;  3QCA A;  4K7S A;  3M3J A;  2VRR B;  2KD0 A;  3KYD D;  3KVF B;  5E6P A;  1WR1 A;  2CKH B;  1GG3 A;  2N1W A;  3GOE A;  1I42 A;  2N7E A;  3EEC A;  3LJ3 A;  4KSK C;  4WWO A;  4ANU A;  1NDD A;  3ZTC A;  1GC7 A;  4LDT B;  2Z59 B;  1WXS A;  3VH4 B;  2R2O A;  3IBE A;  3PSE B;  3DOW A;  3AUL A;  2KFK B;  4NJ7 A;  5E6O A;  2OJR A;  1V2Y A;  4MDK E;  4HPM B;  1WGD A;  2EMT A;  1U4A A;  2UWQ A;  5DPW A;  4G3X B;  1WGH A;  1Y8R C;  2QHO A;  4HDO A;  3TJP A;  5JH5 C;  2M17 A;  2O6V B;  4IM3 A;  1GNU A;  1WJ6 A;  4IW0 A;  4WQO B;  1GJZ A;  5GMV A;  1KLV A;  4KV2 A;  4BBN F;  4IWO A;  2B3A A;  4KZ0 A;  2ZEQ A;  2JWZ A;  1WXM A;  1WMH B;  2JRH A;  1WGY A;  4P7I A;  4XZ4 A;  2DZM A;  1CMX B;  3WAP A;  3VXW A;  3OAW A;  1J0G A;  1ISN A;  4FJV B;  4BKG A;  3HIZ A;  1V49 A;  4TKN A;  1VD2 A;  3DBR I;  4IC7 B;  2A4Z A;  4BOS C;  1V81 A;  2MBE A;  4OVV A;  4ZRI A;  4YL8 A;  1KOT A;  5L95 C;  3D32 A;  2C7M B;  1RRB A;  3A9K B;  2KQ7 A;  2KHW B;  3DCG A;  2G3Q B;  1TZ1 A;  4GOC A;  3A1Q B;  3UIO B;  1WXA A;  2DX5 B;  2MSE D;  4FN2 A;  1WM2 A;  3ZTD A;  4AUQ C;  4EZJ A;  1WJU A;  3VTU A;  2C60 A;  4KSL C;  3L54 A;  4WJO A;  2LVQ A;  3L08 A;  2V4L A;  2AEH A;  3PRM B;  1GC6 A;  5LXH A;  2IO1 B;  2V3S A;  1NI2 A;  1TBE A;  3QWZ B;  3UGB B;  2WDT B;  2KTF A;  4ZDV A;  5IA7 A;  3BIN A;  2L3Z A;  3L10 B;  4II3 B;  2MBO A;  1IYF A;  4NNJ B;  3AI5 A;  4I6L B;  3U8Z A;  2Z0E B;  2LGY A;  1E90 A;  1T0Y A;  2UYZ B;  1S3S G;  2JZZ A;  3QIJ A;  3QJZ A;  3ALB A;  5EDS A;  5HKH A;  4KVG B;  1P1A A;  3L13 A;  2KFK A;  3WIM A;  2KC1 A;  2FAZ A;  2IO3 B;  3M62 B;  2GBM A;  3K9O B;  1WX9 A;  2N7D A;  4MEL A;  3DVG Y;  4DHZ E;  1UEL A;  3TL5 A;  2O6V A;  2KMA A;  2DYB A;  2LVO A;  2XK5 B;  2Z0D B;  3PRP B;  3V60 A;  1WI0 A;  4MGY E;  2KQS A;  4NQL B;  2DYM A;  1WMH A;  2MX2 A;  4PS7 A;  1OEY A;  4GDK B;  4MJS A;  4RM9 A;  2PPH A;  2ZNV C;  4A3P A;  3N3K B;  3RUL A;  1L2N A;  3H7S A;  2IY0 B;  2RGF A;  3A9J B;  5C1Z A;  4K7U A;  2K25 A;  2RR9 A;  3A9K A;  3SHQ A;  4JQW C;  2CHW A;  2KWV B;  3A1Q A;  1S1Q B;  2ZCC A;  2W9N A;  3DBH I;  3QAR A;  3X0W A;  1EF5 A;  1SIF A;  4MEM A;  2K6D B;  4NQK E;  2J7Q B;  1P9D U;  4EEW A;  4EZL A;  2MCN B;  3Q3F A;  4X57 B;  4BOZ B;  2C5L C;  2I1K A;  3UQB A;  2KX0 A;  2J0J A;  4F8C B;  3PRZ A;  2CHZ A;  1OQY A;  3PHX B;  4DXA B;  4KZC A;  1WIA A;  2JY6 A;  3HK0 A;  4II2 B;  1G6J A;  2YLM A;  2GMI C;  2N9E B;  3PVL A;  3PRE A;  4W9F A;  2DEN B;  5LXI B;  2ZZP B;  3ZVV A;  3ZIM A;  5L83 A;  3TBL D;  2C9W B;  2MQJ A;  2WX0 A;  2FCQ A;  3APF A;  3H7P B;  3W1S C;  3ZRF A;  2HE7 A;  4BKS A;  2D11 A;  2A5U A;  2KJH B;  3ZW3 A;  2REX A;  4EUT A;  1ZGU B;  3H6N A;  4ZRK A;  3NY5 A;  4GB9 A;  4M8N A;  2GBK A;  3VTV A;  2KLG A;  2XK5 A;  4GMV A;  4LCD E;  1L7Y A;  2MBB B;  4FHK A;  1WY8 A;  1V5O A;  4KIK A;  3QK0 A;  4IWQ A;  2L0T A;  3WAL A;  4AP4 C;  2NS5 A;  3K9P B;  4DDG D;  4IUM B;  3UIP B;  2PEA A;  3RCZ A;  3RT3 B;  2V1Y A;  1YX5 B;  2K39 A;  3A9J A;  3QAQ A;  4ZRJ A;  1E8W A;  4FUL A;  1GUA B;  2YVC A;  2O2V B;  3MTN B;  1Z2M A;  3PT2 B;  2L7R A;  3DBL I;  4WJP A;  4WJQ A;  4FA6 A;  1R4N I;  2NPT B;  2L0F A;  1I35 A;  2JVC A;  3JW0 X;  1WFY A;  2KTR B;  1Z5S B;  3VUY A;  4JGH B;  4DBG A;  2KLC A;  3VDZ A;  1UBI A;  2KJR A;  2LAS A;  3OJ3 A;  2DAF A;  4B6W A;  4IM0 A;  2PJH A;  3VTW A;  3L16 A;  4RMA A;  1P0R A;  3ML9 A;  2MP2 B;  3JVZ X;  1V6E A;  3VH3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...