2GBRA

Crystal structure of the 35-36 moad insertion mutant of ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
b'MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGRWALAIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
molecule tags Protein binding
source organism Homo sapiens
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
total genus 21
structure length 77
sequence length 77
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbrA00
2IZVB 2MP2A 2OOBB 3V62A 4W9LA 1CMXB 2K6DB 2WX0A 3KUZA 4CYEA 3LJ3A 2IY1B 1NDDA 3CSFA 4II3B 5D94A 3RZFA 4I6LB 4IM0A 4IWPA 4RM9A 2ZCBA 3DCGA 5CHVC 3RYTA 1XD3B 4MDKE 1WXSA 4JGHB 3UINB 2KX3A 2WDTB 2AYOB 5C1ZA 1LXDA 2D3GA 3DQVA 2KZRA 4A3PA 3L08A 5DPTA 1KLVA 3H9DA 4KZ0A 3PPAA 1M94A 3ZUNA 2MBQA 5E6PA 2REXA 5J2RA 2GBNA 3EHVA 3A9KB 2K8CA 2J7QB 2B3AA 4MELA 4M8MA 3M3JA 3BINA 4K7SA 2J0MA 1V86A 4MSQB 2GBRA 1P1AA 1Z2MA 2JF5A 4DHZE 1MG8A 3H7PB 3P2BA 2V1YA 2HJ8A 2KMCA 4BKTA 2RSUA 4DK5A 3L13A 5D7GA 1C1YB 1WXMA 3DVNV 3VUYA 1U4AA 2PE6B 3IHPC 4GDLA 4NAWB 4XX5A 3DVGY 5LXIB 2KXJA 2JXXA 5E6NA 3NZSA 2KANA 4DXAB 1OEYA 1UH6A 3V6CB 3K9OB 3VTUA 1SGHA 3ZDTA 5JZEB 2RPQA 2M8SA 1JRUA 1WH3A 2BKRB 3QK0A 4GGQA 4RM8A 3VH3B 2K8BA 3RULA 4NNJB 2KK8A 1OTRB 3DVGX 2Y5BB 4GXBA 1GJZA 2LWPA 3NOBA 4HDQA 4NPNA 2CHXA 3L54A 2RGFA 3ONSA 2CHWA 4BBNC 3ZO5B 4BOSC 4CO7A 2DYBA 2MRPA 3GOEA 4GU2A 4KV2A 1WGYA 3A4SC 4W9FA 2NCNA 3PGEA 1K8RB 3KYCD 1V5OA 4DWFA 5KHOA 5J18A 5JHAA 1E8ZA 1EUVB 1WXVA 4LDTB 1WZ3A 4KIKB 2ZVOA 1LFDA 4WWOA 3TJPA 4B9KA 4WWNA 2DZKA 2JZ3B 1H4RA 3B08A 3B0AA 2DZJA 2L7RA 4TUUA 2LGDA 4JQWC 3ENEA 3RUIB 1WR6E 2ZZPB 3KUDB 4URKA 2N9XA 3IBEA 4HPMB 4WJQA 2MBBB 3HHMA 1GUAB 1UD7A 4MM3A 2L0FA 4BKSA 2JZZA 1IPGA 3VVWB 3KW5B 1WX9A 4FHJA 1YIWA 4IC7B 3ZNZB 2JRIB 3SHQA 1V2YA 2JT4B 3UQBA 2MA9B 4ZDVA 1TZ1A 2JY6A 3X0WA 3QQ8B 1Y8RC 2PJHA 2V3SA 3MHSD 5DCNA 3A4RA 1UGMA 3KYDD 1OGWA 3ZLZA 2IO3B 2L3ZA 4GDKB 1Q5WB 2LVPA 2XBBC 3VAWA 1VCBA 2LZ6A 2KN5A 4J6IA 1F9JA 5JH5C 2MW5A 4IM3A 1WJ6A 4WJPA 2MBOA 4I6PA 3R66C 1E7VA 2R2OA 2UYZB 1GC7A 1IP9A 3DOWA 4BVUC 2N1VA 4GN1A 3R7QA 4WWPA 2JRHA 4AUQC 1Q0WB 2DYOA 2K8HA 3A9JA 3PSEB 4NQKE 4KVGB 3KUCB 3ZNID 1NBFC 2JWZA 2KDEB 1GC6A 2Z0EB 2ZEQA 2UWQA 4NY0A 1WE7A 2MQJA 4FJYA 1TTNA 3U30A 2DAJA 4I6NB 5L95C 2GBMA 4K1RB 3PTFC 5LXHA 2FIFA 2WYQA 1VD2A 3DPDA 4G0NB 1YX5B 2L76A 2A4ZA 1WMHA 3H7PA 1WM3A 4GB9A 4W9KA 2M0XA 3JSVA 2G4DB 3UGBB 4FLHA 4FA6A 3DBLI 1EO6A 2I1KA 4BOZB 1KJTA 3DDCB 3QARA 5CX3A 2ASQA 1WZ0A 2O2VA 2KMAA 2XK5B 2R2QA 3HM6X 4PYUA 1P0RA 1WX7A 2LXAA 2K39A 3R7RA 3V60A 2LRWA 1WX8A 2QHOA 2K6QA 3VFKA 4IM2A 3VHTC 1WGDA 2KD0A 2L0TA 2NS5A 3T9LA 1NI2A 4EEWA 3V6EB 2NR2A 3AU4A 4TQ0A 3EECA 4HLEA 4ICUA 4ANVA 2DAFA 4ANUA 1KOTA 2KQSA 4G3XB 3PV1A 2AEHA 2DHZA 2JUOA 4ZYNA 1XQQA 3VH4B 3W1SA 2CHZA 2ZPYA 4E74A 2J0KA 3WAMA 2G45B 5JHBA 3UF8A 3VUWA 3ZVVA 1RAXA 2AL3A 2G3QB 2GMIC 4GMVA 4DHZB 1WJ4A 2MP2B 1S1QB 2J0JA 4GSWA 5GMVA 3WA0A 2BWES 2NVUI 4BFRA 4PS8A 5E6OA 3C0RB 3L17A 4HXDA 3AI5A 5D2MB 5AZGA 3Q3FA 3RCZA 4WQOB 1ZGUB 1ZW7A 3DBRI 3ZNGC 3IG3A 1HE8A 2XEWA 2CU1A 4MJSB 3CSTA 4P7IA 3ZRFA 3EC8A 1A5RA 4LJOB 5TR5A 3PLUA 3PREA 3HM3A 2D2QA 1I35A 2KNBA 4BKSD 1GG3A 3GZNI 4HK2A 3H1UA 4MH0E 3RD2A 3VDZA 2CS4A 1WGRA 3A33B 1WR1A 2WX1A 2BYFA 4TQ1A 4ANXA 1WIAA 3DVNU 1YJ1A 4KSKC 2LGXA 1P98A 2V4LA 3L0WB 1E8XA 2BWFA 3OJ3A 4HWIB 4NJ6A 3RZWC 3WANA 3OAWA 5CHWA 2FAZA 3APFA 4KIKA 1PQSA 1L7YA 3IVFA 3JYUA 3MTNB 2WWZA 1E8YA 3TMPB 2BYVE 2FCNA 4MSMB 1J0GA 2EKEC 2FNJB 2N4FA 4EZKA 3JW0X 4K7UA 3WIMA 1GNUA 5DPWA 5IAAC 3NS8A 3V61A 4GIVA 1P9DU 4FADA 2N7DA 2YVCA 4PYZA 3SD5A 1X1MA 2KDBA 3TCAA 1YX6B 3OLMD 2KLCA 4KDLB 4OVUA 4F8CB 4GOCA 1UBQA 1WY8A 4JLCA 4MJSA 3A1QA 3DBHI 1LQBA 2JVCA 3L10B 4FULA 3ALBA 4ZRIA 4AJWA 3TIXA 4DDGD 4W9DA 2KKCA 1S3SG 2LJ5A 2IO2B 3UQAA 4FN2A 2W9NA 3NY5A 4ZRKA 4B6WA 5EDSA 2XK5A 4GDLB 1E5WA 2N9PC 4FJZA 4NAWA 3APDA 4HCNB 4JL9A 2ZNVB 4LJPB 1I42A 4G50A 2C5LC 3AXCA 2EMSA 3EFUA 3ECIA 3ZNHB 3QHTA 2NBWB 3ZIMA 2M4NA 3RT3B 3VTVA 4F1SA 4II2B 1IYFA 4W9HA 2GBKA 1V9JA 4EZLA 1R4NI 3HIZA 3A9KA 3TL5A 1C3TA 3WALA 1WM2A 2L05A 2OJRA 2GBJA 1V49A 2MWSB 1D3ZA 2KWUB 3W1SC 3QX1A 4LDTD 2MSED 4MGIE 4W9GA 3R3MA 4WJNA 2GOWA 1BT0A 3CF6E 2PE9A 3VTWA 2I1JA 2NPTB 4IWOA 3WAPA 1WGHA 3KH0A 4GDKA 4IG7B 2KFKB 2O2VB 2KJ6A 2KWVB 2KC2A 3TBLD 3HK0A 4A3OA 2G4SA 2ZJDA 2HD5B 3I3TB 1TGZB 5L83A 2IO0B 3H6NA 4ASWC 1SIFA 4IWQA 4NQLB 4TV3A 2C7MB 5FR6A 1EF1A 4K7WA 5LLIA 2D10A 3S2AA 4M0WB 2DYMA 2KX0A 4HPLB 4BKGA 1UBIA 4W9IA 2CKHB 4EOYA 3PHXB 2LI5A 5AZFA 4EFOA 3QC8B 2KTRA 2AL6A 1ZKHA 3SU8X 3QWZB 2DENB 2KLGA 3U8ZA 2BPSA 5DPSA 3ZRCA 3WAOA 2ZVNA 3ZTDA 2O6VA 2LRUA 3PZDA 2KTRB 3L16A 4DHJD 3PT2B 2ZNVC 3NZUA 4LCDE 4W9EA 1J19A 2D11A 4ICVA 4HCPB 4WAAA 2MCNB 3JVZX 4EKUA 1TBEA 2YLMA 3IFWB 4E3CA 2LUEA 2RD0A 4AP4C 1OQYA 4ANWA 2BYEA 3PS6A 4FBJB 3B1LX 5G2NA 3OJ4B 5AEKB 2ZPNA 2LD9A 5CTRC 3QJZA 5HKHA 2MLBA 2KDIA 4HDOA 2LVQA 2KC1A 4WJOA 2DX5B 1H8CA 1OEYJ 2AWTA 1V5TA 1SE9A 3PRZA 5AZHA 1WXAA 2KQ7A 2O6VB 3ZTCA 4PS7A 4F7ZA 3U7DA 4AJYB 2KFKA 1R4MI 4DBGA 5CHFA 1RLFA 1WGGA 4A20A 4DDID 2MX2A 5G55A 3N30A 4PS3A 2IY0B 2JPHA 2BF8B 2KJHB 4W9CA 2KJRA 1V6EA 2NPTA 3N32A 4K81A 2K1FA 2K25A 3ML9A 2PPHA 3UIOB 2IO1B 1WYWB 2HE7A 3APCA 2L8JA 3PVLA 3T8MA 3ZKJC 2HTHA 4OVVA 1WI0A 2N9EB 1RFAA 3AU5A 2BGFA 4IW0A 2FCMA 2L00B 2FIDA 2DZIA 1RRBA 2DZMA 4M8NA 4MGKE 2VRRB 5J17A 1L2NA 1T0YA 3KVFB 2LVOA 1P3QU 3JSVB 3QA8A 1Q1OA 4E71A 4IUMB 2N7EA 2LASA 1WMHB 3X23A 2Z59B 3PLVA 4B95A 3H7SA 3PHWB 4YL8A 2Z0DB 2D07B 3QIJA 3AULA 4JIOU 3DBSA 4NJ7A 4W9JA 2ZCCA 3PRMB 4XZ4A 2FUHB 4FHKA 1WE6A 1YQBA 2LXCA 4CHKA 2LGYA 1E90A 1UZXB 4ZRJA 1EF5A 3VQIA 4HJKA 2IYDB 2M17A 2KWCA 1E8WA 2KVRA 4KSLC 2FCQA 3QAQA 4DHJB 5IA7A 2PEAA 3A9JB 2N1WA 3PRPB 4N9F4 1LM8B 2RR9A 3CMMB 1E7UA 1V80A 2KHWB 1WFYA 3M62B 1G6JA 2IBIB 4KZCA 3M63B 2NBUA 2NBVB 2C60A 3MJWA 3K9PB 4G11A 2A5UA 2KTFA 4XC2A 3SDLC 3VXWA 5D6JB 1AARA 1YD8U 1Z5SB 4KDIC 3UIPB 1WRDB 1UELA 3W1YA 2MBHA 3Q3JA 1WJUA 4MEMA 4AOFA 3A1QB 2EMTA 2KO3A 2KDFB 4MGYE 3N3KB 5BO4B 2FCSA 1V81A 4AWJA 5C23A 1WJNA 1QZEA 2C7NB 3ML8A 3NHEB 3ZDMC 2MBEA 4FJVB 3BY4B 4X57B 3QCAA 2O6VD 3O65B 4HVBA 3ZW3A 1WF9A 2C7HA 1ISNA 3VUXA 4EUTA 2BKFA 2C9WB 4MGZE 5KHQA 3LDZE 4RMAA 1FXTB 4BBNF 3D32A 2CR5A 1J8CA 5DPRA 1XT9B 2KFJA 4TKNA 2M1MA 2KOXA 3M95A 1KM7A 4EZJA
chains in the Genus database with same CATH superfamily
2MJ3A 3V62A 4JWUC 1VRAB 2WHIA 1T0RC 2ACZB 2FE8A 4IM0A 4RM9A 1J7BA 3UINB 2AYOB 5DPTA 1KLVA 3PPAA 1E0ZA 3P1MA 1UNSA 1I4QA 3A9KB 4M8MA 2HJ1A 1PGBA 4K7SA 2J0MA 2GBRA 1P1AA 3P2BA 3HVZA 2V1YA 5D7GA 1WXMA 2PE6B 3AE2B 4GDLA 4NAWB 3DVGY 2KXJA 1DYQA 2JXXA 3NZSA 2KANA 1HXYD 5JZEB 2RPQA 1YJIA 2M8SA 4GGQA 2INDC 3VH3B 2IGDA 1QOAA 4NNJB 1OTRB 4J3OD 3EA6A 2Y5BB 1XLPA 4NPNA 1BUIC 2RGFA 3ONSA 4BBNC 1ZOYB 4BOSC 3GOEA 3NG0A 4GU2A 4KV2A 4IDIA 1K8RB 3KYCD 1V5OA 3B2FA 2KDMA 5J18A 5JHAA 2RDBC 1EUVB 1WXVA 2K0PA 1WZ3A 1FCLA 2DZKA 2JZ3B 2PLPA 3B08A 2PVGC 3Q8FA 2L7RA 1SXTA 1ZUD2 4NZLB 3NVWA 4JQWC 2BQQA 2AX5A 2D3CA 2RDHA 4URKA 2N9XA 3IBEA 3HHMA 1VR9A 1IPGA 3VVWB 2WXKA 1YIWA 3ZNZB 4TSSA 2JT4B 2MA9B 2PVOD 2PJHA 2R61A 3A4RA 2WXMA 1UGMA 1C4PA 1OGWA 3KYDD 3DBLB 1Q5WB 4AQ7A 2LVPA 2XBBC 3ZGZA 2LZ6A 2KN5A 4JX1C 5G5GA 3R66C 1E7VA 4WQMA 3Q3NC 3VRBB 4NQKE 3KUCB 2KDEB 1GC6A 2Z0EB 1JWUD 1B9RA 3U30A 5L95C 4AS1A 1SB3C 2NTTA 4K1RB 3PTFC 5LXHA 2WYQA 4RGNA 3BK2A 3H7PA 3RNAC 2E6XA 1XF5L 2M0XA 3JSVA 2G4DB 4P1CC 3UGBB 4FLHA 3QARA 2ASQA 1WZ0A 2O2VA 2JQRB 2KMAA 3NVZA 3HM6X 4JPSA 4JWSC 4PYUA 1P0RA 1LO5D 2K39A 1JRPA 2XNAC 3R7RA 3V60A 2LRWA 2DBYA 1C9FA 2L0TA 2V3NA 5EE1A 4TQ0A 4HLEA 1D4BA 3AEAB 2DAFA 4ANUA 1KOTA 4G3XB 1IP9A 1JW9D 2AEHA 4E74A 1XQQA 2JSVX 5JHBA 3UF8A 2AL3A 2GMIC 2UU7A 3EUB2 1F0ZA 1S1QB 1ACCA 2D3BA 3P42A 3WA0A 5MPOA 2BWES 2NVUI 2N9KA 5E6OA 3C0RB 4WH4A 1IBXB 1V97A 1L5PA 1HTOA 3B9JA 2WDRB 3ZRFA 4HJGE 4LNNA 5TR5A 3WCQA 2KNBA 1GG3A 2KQ4X 1WIAA 2LGXA 1P98A 3BK1A 1E8XA 3RZWC 3U2SC 4ZHOA 3OAWA 2B76B 1PQSA 1M4VA 2WWZA 4ZRPA 1E8YA 5IN7A 3MJ5A 2BYVE 2FCNA 2N4FA 4EZKA 3GS2A 2MJDA 3NS8A 2WXQA 2LHDA 1N62A 1X1MA 3ZJVA 3TCAA 1FMAD 4JLCA 3IAS1 5G5HA 3RNBC 4ZRIA 3TIXA 2MJEA 4W9DA 4NAMA 4ZRKA 1E5WA 4HCNB 2QC8A 1I42A 4K3BA 1EU3A 4L1BA 3ECIA 3RT3B 4W9HA 3MC0B 1V9JA 4EZLA 4LNIA 3HIZA 3A9KA 4P1BC 2OJRA 2GBJA 3IXSA 3QX1A 4XDCA 3U4EG 1F77A 1IGDA 2MSED 2BW2A 4P16A 1BT0A 2ZW1A 1EU4A 2PE9A 3VTWA 4IWOA 1EM7A 3WAPA 3KH0A 4LTUA 4A3OA 3HK0A 1JWBD 4C7YA 1L6UA 2G4SA 2HDEA 1N60A 3S2AA 4EOYA 1TS4A 2KTRA 3QWZB 2DENB 4IKGA 5DPSA 3L16A 3NZUA 1P7FA 4LCDE 1QT9A 1QOBA 4ICVA 4LNFA 1E10A 2WXFA 4HKZE 4RCOA 4E3CA 4YSXB 3AE3B 3TEZA 2BYEA 4RNAA 3KQ4A 2ZPNA 5EE0A 5CTRC 4YTMB 3DWGC 3AB5A 2FBWB 3IT4B 1FPYA 1V5TA 2W3SA 5AZHA 3RI7C 2Y3AA 3ZTCA 2L1AA 4PS7A 4RGTA 2L32A 4DDID 1R4NB 2JPHA 1UF0A 4YT0B 3N32A 1AWDA 2NMQA 5FK9C 1WGKA 1N5WA 2HE7A 3APCA 3NZ3A 2N9EB 2BGFA 4IW0A 2L00B 2DZIA 2VRRB 3DBHB 1FNUA 1Q1OA 1C76A 2LASA 2PTLA 3PLVA 3MP9A 2D3AA 4YL8A 2Z0DB 3QIJA 4JIOU 3PRMB 2BS4B 2LGYA 2GI9A 4M01A 2M17A 2KWCA 1C78A 5BMGA 2KMMA 1XXGA 5HHDG 2PEAA 3PRPB 1HZ5A 1LM8B 4DQOC 2IBIB 4WIPA 2NBVB 3MHZA 4XC2A 3SDLC 1QILA 3N9YC 3C19A 2K3UA 3W1YA 2MBHA 4AOFA 3A1QB 1I4HA 2KO3A 4MGYE 4TMAB 5BO4B 1WJNA 2EELA 3R8BA 1QZEA 1R7SA 3AE1B 4X57B 1N6ZA 1TY2A 3P4RB 4EUTA 2C9WB 5KHQA 3Q3MC 2CR5A 2KFJA 4M0WA 2WU5B 2M1MA 3M95A 4EZJA 1WXQA 2LUMA 2OOBB 1CMXB 2K6DB 1I4XA 2N0SB 1XCQL 3GB1A 3CSFA 5D94A 2AQ3B 4IWPA 5CHVC 3RYTA 3SFDB 1LXDA 3DQVA 2KZRA 4A3PA 2MBQA 2REXA 5J2RA 4OZBA 2K8CA 3BWUD 1V86A 2JF5A 1QOFA 4DHZE 2QILA 2Z8LA 2KMCA 4BKTA 3L13A 1C1YB 3DVNV 3VUYA 4ZHPA 3IHPC 5E6NA 2JWUA 1VDVA 4OZCA 3ZDTA 2OHFA 1FD6A 3AH7A 4DXGA 1WH3A 3QK0A 2BKRB 2WXGA 4RM8A 2W54A 1FFVA 3RULA 2KK8A 4RFBA 4S0RA 3VR9B 4FXCA 2CHWA 4CO7A 1WWTA 1WYGA 3BZDB 1EWYC 3PGEA 1F1HA 3E9SA 2V9HA 2WGSA 4LDTB 2WXLA 1FNWA 4KIKB 1LFDA 4B9KA 2DZJA 4TUUA 4HEA1 1A70A 3RUIB 1WR6E 4HPMB 1C4CA 2CU3A 2BVCA 3AEGB 2JZZA 1HQRD 4QAYA 2SEBD 4FHJA 1D6EC 4MM3B 3SHQA 1P7EA 3UQBA 2XN9C 5T8IA 3NJTA 1VZ6A 2JY6A 4B0MA 4WURA 1K53A 3RNCC 3VAWA 1VCBA 4J6IA 1L0VB 1YQ3B 2UYZB 1FEHA 2JRHA 1D5ZC 3PSEB 1IUEA 3N1YC 4KVGB 1SIJA 3ZNID 3ZJTA 2JWZA 2ZEQA 3MFGA 2JXTA 3FILA 2DAJA 1I4PA 2FIFA 4RGMA 4G0NB 4US9A 3AE7B 4W9KA 1NYQA 4FA6A 3DBLI 1EO6A 3R2IA 3BIID 5CX3A 1KFYB 4YXDB 5FKAC 2XK5B 2R2QA 1FXAA 2DLBA 1C79A 2QHOA 1I4RA 2KD0A 1YNTE 3DWMA 1NI2A 3V6EB 3EECA 4ICUA 1TY0A 4ANVA 4DXFA 3RN9C 1JWMD 3VH4B 3O13A 3PV1A 2DHZA 3W1SA 4OW0A 2CHZA 1N61A 3WAMA 2G45B 3HUIA 3ZVVA 2KN4A 5TSSA 2J0JA 4GSWA 3I57A 1GB4A 1T3QA 4PS8A 4HXDA 3TEWA 3RCZA 1HE8A 2CU1A 4MJSB 3ZJUA 4LJOB 4A8XC 2LMCA 1I35A 4BKSD 3VDZA 2CS4A 1WR1A 3RPFC 2WX1A 4KSKC 1YJ1A 3OJ3A 4HWIB 1JMLA 3KLSX 5CHWA 3IVFA 1ZE3D 4ACFA 3TMPB 3ETRA 2N9LA 1J0GA 4MSMB 3C8YA 3WIMA 3GP7A 1GNUA 2WXOA 1FXIA 1FIQA 5HG2A 3V61A 2BYTA 4FADA 1STEA 2KDBA 2KLCA 4PK1A 5BMIA 4OVUA 4GOCA 1UBQA 3BVMA 2E3TA 2WS3B 3P4QB 4AJWA 3UI3A 4A90A 1WRIA 4DDGD 2W9NA 4FJZA 2D5GA 4G50A 3AXCA 2EMSA 3EFUA 3CIRB 5LNK1 2NBWB 3EFCA 3VTVA 4II2B 1VZ8A 4IOIE 1C3TA 2L05A 1QOGA 4XYCA 4LNKA 2KWUB 3KWVA 3Q8BA 4W9GA 3R3MA 1PGXA 2I1JA 3IAM1 4YSYB 1EWCA 4OHJA 2LHEA 2KFKB 2O2VB 3I9V1 2KC2A 3TBLD 3H6NA 3NRZA 4IWQA 4NQLB 5FR6A 4K7WA 1K52A 5LLIA 2DYMA 4W9IA 1L4ZB 3PHXB 2LI5A 4EFOA 3QC8B 3SU8X 2KLGA 3U8ZA 2ZVNA 3ZTDA 1B1ZA 2O6VA 3N1XC 2KTRB 1JROA 2D11A 2JZPA 4HCPB 3GE3C 3JVZX 5AUIA 1IBXA 2LGSA 3V05A 4FBJB 1GOZA 5BYSA 2J52A 2HTME 2DX5B 1H8CA 1OEYJ 1SE9A 1WXAA 2KQ7A 4F7ZA 2KFKA 4DBGA 5CHFA 1WGGA 1F52A 2WDQB 3N30A 2IY0B 2AQ2B 4W9CA 1V6EA 2INCC 1YOVB 2K1FA 2K25A 3ML9A 1K51A 2PPHA 4C00A 3T8MA 3ZKJC 1WI0A 3FILB 1GB1A 1T0YA 1XLOA 3JSVB 4E71A 1KLGD 3RFZB 1ET6A 3H7SA 3AULA 2V0GA 4NJ7A 2ZCCA 2PW9A 1YQBA 4C80A 1HEZE 2IYDB 1JCKB 4KKIA 4KSLC 2WXIA 2FCQA 3QAQA 2WQYB 1ENFA 2N1WA 3A9JB 4ITKA 2K9XA 1E7UA 4R3DA 5HFYA 3M62B 1YJJA 5AUKA 4G11A 4KGTA 1F2RC 3UIPB 1WRDB 4MEMA 1WJUA 2H89B 2KDFB 3N3KB 1JWSD 4AWJA 5IKCM 1L0YB 2C7NB 3ZDMC 4XWWA 2L52A 2I2YA 1WF9A 1C77A 1TJEA 1SJHD 3TEYA 3LDZE 4BBNF 3D32A 4TKNA 5IP4D 1KM7A 2IZVB 2MP2A 1I7HA 2WX0A 2PIAA 2IY1B 4I6LB 2G1EA 4MDKE 2WDTB 5C1ZA 2D3GA 2K5PA 3L08A 3H9DA 4KZ0A 3ZUNA 1GPXA 2GBNA 1LGRA 4B0EA 2B3AA 3M3JA 3BINA 2KWDA 1PYWD 4MSQB 1Z2MA 1ET9A 1DOXA 1MG8A 3H7PB 4P6VF 2LFIA 1MHXA 1U4AA 4XX5A 1SJED 2QMTA 3H8HA 3V6CB 3K9OB 3VTUA 1TKEA 1OFFA 1NYRA 4C56C 1T5XD 1XCTL 2K8BA 2RPVA 3DVGX 4GXBA 2BBCA 1GJZA 3NOBA 1FO4A 4HDQA 4ZOHC 1AYFA 2VZKD 1I4GA 1D5MC 5KHOA 3I5JC 3DHHC 2ZVOA 4HROA 4C7ZA 3TJPA 4WWNA 1H4RA 4ARCA 4LK0M 1DOYA 3EGRA 2LGDA 2QIEB 3ENEA 4JE3B 1XEEA 3KUDB 2ZW0A 5E6JA 4WJQA 2MBBB 1UD7A 4MM3A 4BKSA 3HVDA 3KW5B 4IC7B 1V1PA 2JRIB 4OZAA 3X0WA 3QQ8B 1Y8RC 3MHSD 5DCNA 4GDKB 2CJNA 2MW5A 4IM3A 1OQQA 2H88B 4WJPA 1YQ4B 2R2OA 4ZRQA 2N1VA 3R7QA 4WWPA 2LGIA 4AUQC 1Q0WB 2DYOA 2JU6X 2K8HA 3A9JA 1NBFC 1WE7A 4FJYA 1TTNA 1FCCC 1VD2A 1YX5B 1E7PB 2A4ZA 1WMHA 1WM3A 3VRAB 4GB9A 3DDCB 4UDUC 2YEPB 2WLBA 3P63A 3ABVB 2K6QA 1SE3A 3T9LA 2EKIA 3AU4A 2OJWA 3Q14C 2JUOA 3AEEB 2ZPYA 3VUWA 1TS3A 1RAXA 2G3QB 3Q2AC 3SEBA 1SE4A 3B2GA 4A6QA 5GMVA 2ICIA 1C4AA 3PZ7A 3L17A 2K22A 3AI5A 5D2MB 3Q3FA 4WQOB 1ZPSA 4MACA 3EC8A 3GE8C 3KWLA 3PLUA 3PREA 3RD2A 2YEPF 3A33B 4TQ1A 4ANXA 2KYWA 4C4VB 2V4LA 1WSPA 3L0WB 5BYQA 2BWFA 4NJ6A 2INPE 2IDYA 4D2KA 2IGHA 4KIKA 3JYUA 3MTNB 2WP9B 1SEBD 2W82A 2V4IB 3JW0X 4K7UA 3AEBB 1ZXHA 1P9DU 2YVCA 4PYZA 4N58A 4O1NA 2ON8A 3OLMD 4F8CB 1WY8A 4REZA 3DHGC 3DBHI 2JVCA 3ALBA 4YWGG 3TSSA 1S3SG 2LJ5A 2IO2B 3UQAA 5EDSA 5BMHA 3NY5A 5EE9A 3APDA 4JL9A 1NENB 2ZNVB 4LJPB 1TZOA 1TT5B 2C5LC 3W9CB 3ZNHB 2IGGA 3QHTA 1CJEA 3ZIMA 2M4NA 4L23A 1IYFA 1J7AA 2BB5A 1R4NI 1FFUA 2QCZA 3BYYB 1D5XC 3WALA 2KVZA 2MWSB 3TUOA 1QQRA 4CQNA 2INNE 3R2TA 4LDTD 4BZAA 3BVGA 1XLNA 2NPTB 4GLSC 3Q8AA 1WGHA 3NS1A 3V3XA 2KJ6A 1YMHE 2ZJDA 2HD5B 1TGZB 5L83A 2IO0B 2JX5A 1CZPA 4ASWC 2D10A 2BS2B 4HPLB 1UBIA 2CKHB 3AE9B 2BPSA 3WAOA 1ROEA 3PZDA 5C3JB 2ZNVC 2KT7A 3P4PB 1J19A 2JYTA 3RNGC 4EKUA 2YLMA 1KF6B 2LUEA 2RD0A 1OQYA 1V8CA 3PS6A 5G2NA 3OJ4B 5AEKB 2LD9A 1T0SC 3QJZA 5HKHA 2MLBA 2KDIA 4HDOA 4WJOA 2RMMA 4K3CA 2AWTA 3PRZA 1OQRA 4HRSA 4N59A 3U7DA 4PT5A 1SBBB 3Q8CA 3FKYA 2JYEA 2MX2A 5G55A 2BF8B 2KJRA 2NPTA 2BB6A 1SE2A 4K81A 3UIOB 1ZXIA 1WYWB 1RM6C 2L8JA 3FAHA 1GAQB 1NI3A 2ONQA 1RFAA 3AU5A 2FCMA 4M00A 4XGAB 1RRBA 4M8NA 4MGKE 5J17A 2LVOA 1P3QU 3AM9A 4IUMB 1WMHB 2Z59B 4B95A 4LLGM 2D07B 2KAJA 3DBSA 1UWXA 1E9MA 1WE6A 2LXCA 4CHKA 1UZXB 4ZRJA 3VQIA 4MH8A 4HJKA 1TS5A 1E8WA 2KVRA 2WXRA 3OWEB 2WNMA 3MC9A 5IA7A 4WWMA 2RR9A 3CMMB 1V80A 4XE0A 2KHWB 5I4DA 4KZCA 3M63B 2NBUA 3VR8B 3K9PB 2A5UA 2KTFA 5H8YE 2PMVA 3Q6BA 4MT5A 1UELA 3Q3JA 2EMTA 3ML8A 3NHEB 5JXVA 3BY4B 4HVBA 4OVZA 1ISNA 3VUXA 3L4PA 2BKFA 1AW7A 4RMAA 1FXTB 1J8CA 1XT9B 4M02A 1KRHA 1K50A 1UUPA 2KOXA 2VH1A 3NVVA 4W9LA 3KUZA 3AEDB 4CYEA 3LJ3A 1MJDA 3ZYYX 1NDDA 4II3B 3RZFA 4USAA 1HZ6A 2ZCBA 3DCGA 1JQ4A 1XD3B 4L2YA 1WXSA 4JGHB 5D3IB 3Q69A 2KX3A 1DOIA 1ZP0B 1M94A 1CK1A 3RNEC 5E6PA 3EHVA 2J7QB 4MELA 1T6BX 1ZDXA 1TKYA 1TIFA 2CJOA 2HJ8A 2RSUA 1FNVA 4DK5A 3ZXVA 5LXIB 2X38A 1MFWA 4DXAB 2WXHA 1OEYA 1UH6A 1SGHA 1JRUA 3NUHB 4RGOS 2WXJA 4KX6B 1N63A 1DGJA 3IT6B 2LWPA 2CHXA 3L54A 3ZO5B 1MI0A 5IOIA 2DYBA 1N5XA 2MRPA 4W9FA 1WGYA 3A4SC 2NCNA 2M19A 2GRIA 4DWFA 1T0QC 1E8ZA 2W55A 1JALA 4WWOA 3B0AA 2Y5PA 2QEJC 3I63C 3AE4B 2NTSA 2ZZPB 2MHJA 1SF0A 3BYTB 3MC8A 1GUAB 2BTEA 1Y56A 2L0FA 1VZ7A 1WX9A 1FRRA 1V2YA 1TS2A 4ZDVA 1TZ1A 2V3SA 3P4SB 4RF0A 1QKZA 3ZLZA 1E6EB 3BVZA 2IO3B 2L3ZA 1UWMA 1F9JA 5JH5C 5FR3A 1WJ6A 2MBOA 4I6PA 2VH2A 1GC7A 3DOWA 4BVUC 4GN1A 1ZDVA 1L6VA 1QF6A 1RFKA 1HA5A 4NY0A 2UWQA 1MVKA 2QJLA 2MQJA 3ZXRA 1IGCA 1MG4A 4I6NB 4A9AA 2GBMA 2I38A 1J7CA 4KKJA 2RDGA 3DPDA 2L76A 1TKGA 3LB8C 3AN1A 2I1KA 4BOZB 1KJTA 1RWSA 3T3NA 1AN8A 4S17A 4ARIA 1WX7A 2LXAA 3U7ZA 3AECB 4A55A 3W5VB 2M56B 1WX8A 3VFKA 4IM2A 3VHTC 1WGDA 2NS5A 2DWQA 4EEWA 3N1ZC 2TSSA 2NR2A 2SAKA 1YN5A 1VLBA 2KQSA 4ZYNA 2PKOA 4C4VA 2J0KA 4GMVA 4DHZB 1WJ4A 2MP2B 3AMZA 1NVID 1F2RI 4BFRA 1PGAA 5AZGA 1VJKA 1ZGUB 1ZW7A 1YN4A 3DBRI 3ZNGC 2QSDA 3IG3A 2XEWA 5HI1A 1HTQA 3CSTA 4P7IA 1A5RA 3HM3A 1XLQA 2D2QA 4NJCA 3GZNI 4HK2A 2KACA 3H1UA 4MH0E 4LNOA 1WGRA 2IJ0A 1PDXA 2BYFA 3DVNU 3WANA 2WU2B 1MPEA 2Q5WD 2FAZA 3APFA 1L7YA 5GXGB 4BAXA 3RNFC 3FC4A 2EKEC 2FNJB 1CQVA 4YTNB 5DPWA 2AQ1B 5IAAC 1ESFA 4GIVA 4Q2JA 2N7DA 3SD5A 2W3RA 1KH0A 3U52E 2J53A 2V3PA 1YX6B 4KDLB 1L4DB 4MJSA 3A1QA 1LQBA 3L10B 4FULA 4XWTA 1RYJA 3W5UB 4YSZB 2KKCA 4ZYSA 4FN2A 4B6WA 2XK5A 4GDLB 4NAWA 2N9PC 3AE8B 4N6EB 4F1SA 2GBKA 2WXPA 4YTPB 3E56A 1MHHE 1R4MB 3PO0A 3TL5A 1WM2A 2L83A 1V49A 1BXTA 1UGJA 3DHIC 3J9CA 1D3ZA 2N7JA 3W1SC 2BS3B 4MGIE 4WJNA 3HRDD 2GOWA 2GLSA 3CF6E 3SFEB 1PUTA 2OEDA 4GDKA 4IG7B 2WXNA 3AV8A 2KWVB 1V1OA 4RF1A 3I3TB 4HPPA 1SIFA 4TV3A 2C7MB 2Y5CA 1EF1A 3AE5B 3OG5A 4M0WB 3URYA 2KX0A 4BKGA 1SSNA 2WDVB 5AZFA 2AL6A 1ZKHA 2DNFA 4H2AA 3ZRCA 3AEFB 2LRUA 2GB1A 4DHJD 1L0XB 3PT2B 4W9EA 4WAAA 2J42A 4XDDA 2MCNB 1TBEA 3IFWB 3T3OA 4AP4C 2J4XA 1XO3A 4ANWA 3B1LX 3N20C 1V1PB 1FM0D 2MEKA 2LVQA 2KC1A 3LXFA 1TYGB 3Q3OC 4WAFA 2O6VB 5EE3A 5IO9A 2FUG1 4AJYB 1R4MI 1RLFA 4A20A 2X8XX 4PS3A 2KJHB 1KLUD 3RMKC 3AE6B 2IO1B 1FRDA 3PVLA 4KGSA 2HTHA 2MH7A 4OVVA 4US8A 3W2DA 2FIDA 2IPKD 2DZMA 1L2NA 3KVFB 3QA8A 1BMLC 2N7EA 3X23A 3PHWB 3TEXA 3CWIA 2BT6A 1Q10A 4W9JA 2M0AA 4XZ4A 2FUHB 4FHKA 1JWAD 1E90A 1KTKA 1EF5A 2VZKB 5D3DA 3Q8EA 2G9HD 4DHJB 4N9F4 1YN3A 5BYRA 3ZQ4A 1WFYA 1G6JA 2C60A 3MJWA 3VXWA 5D6JB 1AARA 2LEKA 2LJIA 1YD8U 1Z5SB 4KDIC 1NEKB 3GZNB 3SR6A 3LYYA 2FCSA 4KGRA 4HKQA 1V81A 4RH6A 4EE2A 5C23A 3DBRB 2MBEA 4FJVB 1QLBB 3QCAA 2O6VD 3O65B 5H92C 3ZW3A 2C7HA 1PFDA 3PZ8A 2QDFA 4MGZE 5C2TB 3NVYA 5DPRA
chains in the Genus database with same CATH topology
2IZVB 2MP2A 2OOBB 3V62A 4W9LA 1CMXB 2K6DB 2WX0A 3KUZA 4CYEA 3LJ3A 2IY1B 1NDDA 3CSFA 4II3B 5D94A 3RZFA 4I6LB 4IM0A 4IWPA 4RM9A 2ZCBA 3DCGA 5CHVC 3RYTA 1XD3B 4MDKE 1WXSA 4JGHB 3UINB 2KX3A 2WDTB 2AYOB 5C1ZA 1LXDA 2D3GA 3DQVA 2KZRA 4A3PA 3L08A 5DPTA 1KLVA 3H9DA 4KZ0A 3PPAA 1M94A 3ZUNA 2MBQA 5E6PA 2REXA 5J2RA 2GBNA 3EHVA 3A9KB 2K8CA 2J7QB 2B3AA 4MELA 4M8MA 3M3JA 3BINA 4K7SA 2J0MA 1V86A 4MSQB 2GBRA 1P1AA 1Z2MA 2JF5A 4DHZE 1MG8A 3H7PB 3P2BA 2V1YA 2HJ8A 2KMCA 4BKTA 2RSUA 4DK5A 3L13A 5D7GA 1C1YB 1WXMA 3DVNV 3VUYA 1U4AA 2PE6B 3IHPC 4GDLA 4NAWB 4XX5A 3DVGY 5LXIB 2KXJA 2JXXA 5E6NA 3NZSA 2KANA 4DXAB 1OEYA 1UH6A 3V6CB 3K9OB 3VTUA 1SGHA 3ZDTA 5JZEB 2RPQA 2M8SA 1JRUA 1WH3A 2BKRB 3QK0A 4GGQA 4RM8A 3VH3B 2K8BA 3RULA 4NNJB 2KK8A 1OTRB 3DVGX 2Y5BB 4GXBA 1GJZA 2LWPA 3NOBA 4HDQA 4NPNA 2CHXA 3L54A 2RGFA 3ONSA 2CHWA 4BBNC 3ZO5B 4BOSC 4CO7A 2DYBA 2MRPA 3GOEA 4GU2A 4KV2A 1WGYA 3A4SC 4W9FA 2NCNA 3PGEA 1K8RB 3KYCD 1V5OA 4DWFA 5KHOA 5J18A 5JHAA 1E8ZA 1EUVB 1WXVA 4LDTB 1WZ3A 4KIKB 2ZVOA 1LFDA 4WWOA 3TJPA 4B9KA 4WWNA 2DZKA 2JZ3B 1H4RA 3B08A 3B0AA 2DZJA 2L7RA 4TUUA 2LGDA 4JQWC 3ENEA 3RUIB 1WR6E 2ZZPB 3KUDB 4URKA 2N9XA 3IBEA 4HPMB 4WJQA 2MBBB 3HHMA 1GUAB 1UD7A 4MM3A 2L0FA 4BKSA 2JZZA 1IPGA 3VVWB 3KW5B 1WX9A 4FHJA 1YIWA 4IC7B 3ZNZB 2JRIB 3SHQA 1V2YA 2JT4B 3UQBA 2MA9B 4ZDVA 1TZ1A 2JY6A 3X0WA 3QQ8B 1Y8RC 2PJHA 2V3SA 3MHSD 5DCNA 3A4RA 1UGMA 3KYDD 1OGWA 3ZLZA 2IO3B 2L3ZA 4GDKB 1Q5WB 2LVPA 2XBBC 3VAWA 1VCBA 2LZ6A 2KN5A 4J6IA 1F9JA 5JH5C 2MW5A 4IM3A 1WJ6A 4WJPA 2MBOA 4I6PA 3R66C 1E7VA 2R2OA 2UYZB 1GC7A 1IP9A 3DOWA 4BVUC 2N1VA 4GN1A 3R7QA 4WWPA 2JRHA 4AUQC 1Q0WB 2DYOA 2K8HA 3A9JA 3PSEB 4NQKE 4KVGB 3KUCB 3ZNID 1NBFC 2JWZA 2KDEB 1GC6A 2Z0EB 2ZEQA 2UWQA 4NY0A 1WE7A 2MQJA 4FJYA 1TTNA 3U30A 2DAJA 4I6NB 5L95C 2GBMA 4K1RB 3PTFC 5LXHA 2FIFA 2WYQA 1VD2A 3DPDA 4G0NB 1YX5B 2L76A 2A4ZA 1WMHA 3H7PA 1WM3A 4GB9A 4W9KA 2M0XA 3JSVA 2G4DB 3UGBB 4FLHA 4FA6A 3DBLI 1EO6A 2I1KA 4BOZB 1KJTA 3DDCB 3QARA 5CX3A 2ASQA 1WZ0A 2O2VA 2KMAA 2XK5B 2R2QA 3HM6X 4PYUA 1P0RA 1WX7A 2LXAA 2K39A 3R7RA 3V60A 2LRWA 1WX8A 2QHOA 2K6QA 3VFKA 4IM2A 3VHTC 1WGDA 2KD0A 2L0TA 2NS5A 3T9LA 1NI2A 4EEWA 3V6EB 2NR2A 3AU4A 4TQ0A 3EECA 4HLEA 4ICUA 4ANVA 2DAFA 4ANUA 1KOTA 2KQSA 4G3XB 3PV1A 2AEHA 2DHZA 2JUOA 4ZYNA 1XQQA 3VH4B 3W1SA 2CHZA 2ZPYA 4E74A 2J0KA 3WAMA 2G45B 5JHBA 3UF8A 3VUWA 3ZVVA 1RAXA 2AL3A 2G3QB 2GMIC 4GMVA 4DHZB 1WJ4A 2MP2B 1S1QB 2J0JA 4GSWA 5GMVA 3WA0A 2BWES 2NVUI 4BFRA 4PS8A 5E6OA 3C0RB 3L17A 4HXDA 3AI5A 5D2MB 5AZGA 3Q3FA 3RCZA 4WQOB 1ZGUB 1ZW7A 3DBRI 3ZNGC 3IG3A 1HE8A 2XEWA 2CU1A 4MJSB 3CSTA 4P7IA 3ZRFA 3EC8A 1A5RA 4LJOB 5TR5A 3PLUA 3PREA 3HM3A 2D2QA 1I35A 2KNBA 4BKSD 1GG3A 3GZNI 4HK2A 3H1UA 4MH0E 3RD2A 3VDZA 2CS4A 1WGRA 3A33B 1WR1A 2WX1A 2BYFA 4TQ1A 4ANXA 1WIAA 3DVNU 1YJ1A 4KSKC 2LGXA 1P98A 2V4LA 3L0WB 1E8XA 2BWFA 3OJ3A 4HWIB 4NJ6A 3RZWC 3WANA 3OAWA 5CHWA 2FAZA 3APFA 4KIKA 1PQSA 1L7YA 3IVFA 3JYUA 3MTNB 2WWZA 1E8YA 3TMPB 2BYVE 2FCNA 4MSMB 1J0GA 2EKEC 2FNJB 2N4FA 4EZKA 3JW0X 4K7UA 3WIMA 1GNUA 5DPWA 5IAAC 3NS8A 3V61A 4GIVA 1P9DU 4FADA 2N7DA 2YVCA 4PYZA 3SD5A 1X1MA 2KDBA 3TCAA 1YX6B 3OLMD 2KLCA 4KDLB 4OVUA 4F8CB 4GOCA 1UBQA 1WY8A 4JLCA 4MJSA 3A1QA 3DBHI 1LQBA 2JVCA 3L10B 4FULA 3ALBA 4ZRIA 4AJWA 3TIXA 4DDGD 4W9DA 2KKCA 1S3SG 2LJ5A 2IO2B 3UQAA 4FN2A 2W9NA 3NY5A 4ZRKA 4B6WA 5EDSA 2XK5A 4GDLB 1E5WA 2N9PC 4FJZA 4NAWA 3APDA 4HCNB 4JL9A 2ZNVB 4LJPB 1I42A 4G50A 2C5LC 3AXCA 2EMSA 3EFUA 3ECIA 3ZNHB 3QHTA 2NBWB 3ZIMA 2M4NA 3RT3B 3VTVA 4F1SA 4II2B 1IYFA 4W9HA 2GBKA 1V9JA 4EZLA 1R4NI 3HIZA 3A9KA 3TL5A 1C3TA 3WALA 1WM2A 2L05A 2OJRA 2GBJA 1V49A 2MWSB 1D3ZA 2KWUB 3W1SC 3QX1A 4LDTD 2MSED 4MGIE 4W9GA 3R3MA 4WJNA 2GOWA 1BT0A 3CF6E 2PE9A 3VTWA 2I1JA 2NPTB 4IWOA 3WAPA 1WGHA 3KH0A 4GDKA 4IG7B 2KFKB 2O2VB 2KJ6A 2KWVB 2KC2A 3TBLD 3HK0A 4A3OA 2G4SA 2ZJDA 2HD5B 3I3TB 1TGZB 5L83A 2IO0B 3H6NA 4ASWC 1SIFA 4IWQA 4NQLB 4TV3A 2C7MB 5FR6A 1EF1A 4K7WA 5LLIA 2D10A 3S2AA 4M0WB 2DYMA 2KX0A 4HPLB 4BKGA 1UBIA 4W9IA 2CKHB 4EOYA 3PHXB 2LI5A 5AZFA 4EFOA 3QC8B 2KTRA 2AL6A 1ZKHA 3SU8X 3QWZB 2DENB 2KLGA 3U8ZA 2BPSA 5DPSA 3ZRCA 3WAOA 2ZVNA 3ZTDA 2O6VA 2LRUA 3PZDA 2KTRB 3L16A 4DHJD 3PT2B 2ZNVC 3NZUA 4LCDE 4W9EA 1J19A 2D11A 4ICVA 4HCPB 4WAAA 2MCNB 3JVZX 4EKUA 1TBEA 2YLMA 3IFWB 4E3CA 2LUEA 2RD0A 4AP4C 1OQYA 4ANWA 2BYEA 3PS6A 4FBJB 3B1LX 5G2NA 3OJ4B 5AEKB 2ZPNA 2LD9A 5CTRC 3QJZA 5HKHA 2MLBA 2KDIA 4HDOA 2LVQA 2KC1A 4WJOA 2DX5B 1H8CA 1OEYJ 2AWTA 1V5TA 1SE9A 3PRZA 5AZHA 1WXAA 2KQ7A 2O6VB 3ZTCA 4PS7A 4F7ZA 3U7DA 4AJYB 2KFKA 1R4MI 4DBGA 5CHFA 1RLFA 1WGGA 4A20A 4DDID 2MX2A 5G55A 3N30A 4PS3A 2IY0B 2JPHA 2BF8B 2KJHB 4W9CA 2KJRA 1V6EA 2NPTA 3N32A 4K81A 2K1FA 2K25A 3ML9A 2PPHA 3UIOB 2IO1B 1WYWB 2HE7A 3APCA 2L8JA 3PVLA 3T8MA 3ZKJC 2HTHA 4OVVA 1WI0A 2N9EB 1RFAA 3AU5A 2BGFA 4IW0A 2FCMA 2L00B 2FIDA 2DZIA 1RRBA 2DZMA 4M8NA 4MGKE 2VRRB 5J17A 1L2NA 1T0YA 3KVFB 2LVOA 1P3QU 3JSVB 3QA8A 1Q1OA 4E71A 4IUMB 2N7EA 2LASA 1WMHB 3X23A 2Z59B 3PLVA 4B95A 3H7SA 3PHWB 4YL8A 2Z0DB 2D07B 3QIJA 3AULA 4JIOU 3DBSA 4NJ7A 4W9JA 2ZCCA 3PRMB 4XZ4A 2FUHB 4FHKA 1WE6A 1YQBA 2LXCA 4CHKA 2LGYA 1E90A 1UZXB 4ZRJA 1EF5A 3VQIA 4HJKA 2IYDB 2M17A 2KWCA 1E8WA 2KVRA 4KSLC 2FCQA 3QAQA 4DHJB 5IA7A 2PEAA 3A9JB 2N1WA 3PRPB 4N9F4 1LM8B 2RR9A 3CMMB 1E7UA 1V80A 2KHWB 1WFYA 3M62B 1G6JA 2IBIB 4KZCA 3M63B 2NBUA 2NBVB 2C60A 3MJWA 3K9PB 4G11A 2A5UA 2KTFA 4XC2A 3SDLC 3VXWA 5D6JB 1AARA 1YD8U 1Z5SB 4KDIC 3UIPB 1WRDB 1UELA 3W1YA 2MBHA 3Q3JA 1WJUA 4MEMA 4AOFA 3A1QB 2EMTA 2KO3A 2KDFB 4MGYE 3N3KB 5BO4B 2FCSA 1V81A 4AWJA 5C23A 1WJNA 1QZEA 2C7NB 3ML8A 3NHEB 3ZDMC 2MBEA 4FJVB 3BY4B 4X57B 3QCAA 2O6VD 3O65B 4HVBA 3ZW3A 1WF9A 2C7HA 1ISNA 3VUXA 4EUTA 2BKFA 2C9WB 4MGZE 5KHQA 3LDZE 4RMAA 1FXTB 4BBNF 3D32A 2CR5A 1J8CA 5DPRA 1XT9B 2KFJA 4TKNA 2M1MA 2KOXA 3M95A 1KM7A 4EZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZV B;  2MP2 A;  2OOB B;  3V62 A;  4W9L A;  1CMX B;  2K6D B;  2WX0 A;  3KUZ A;  4CYE A;  3LJ3 A;  2IY1 B;  1NDD A;  3CSF A;  4II3 B;  5D94 A;  3RZF A;  4I6L B;  4IM0 A;  4IWP A;  4RM9 A;  2ZCB A;  3DCG A;  5CHV C;  3RYT A;  1XD3 B;  4MDK E;  1WXS A;  4JGH B;  3UIN B;  2KX3 A;  2WDT B;  2AYO B;  5C1Z A;  1LXD A;  2D3G A;  3DQV A;  2KZR A;  4A3P A;  3L08 A;  5DPT A;  1KLV A;  3H9D A;  4KZ0 A;  3PPA A;  1M94 A;  3ZUN A;  2MBQ A;  5E6P A;  2REX A;  5J2R A;  2GBN A;  3EHV A;  3A9K B;  2K8C A;  2J7Q B;  2B3A A;  4MEL A;  4M8M A;  3M3J A;  3BIN A;  4K7S A;  2J0M A;  1V86 A;  4MSQ B;  2GBR A;  1P1A A;  1Z2M A;  2JF5 A;  4DHZ E;  1MG8 A;  3H7P B;  3P2B A;  2V1Y A;  2HJ8 A;  2KMC A;  4BKT A;  2RSU A;  4DK5 A;  3L13 A;  5D7G A;  1C1Y B;  1WXM A;  3DVN V;  3VUY A;  1U4A A;  2PE6 B;  3IHP C;  4GDL A;  4NAW B;  4XX5 A;  3DVG Y;  5LXI B;  2KXJ A;  2JXX A;  5E6N A;  3NZS A;  2KAN A;  4DXA B;  1OEY A;  1UH6 A;  3V6C B;  3K9O B;  3VTU A;  1SGH A;  3ZDT A;  5JZE B;  2RPQ A;  2M8S A;  1JRU A;  1WH3 A;  2BKR B;  3QK0 A;  4GGQ A;  4RM8 A;  3VH3 B;  2K8B A;  3RUL A;  4NNJ B;  2KK8 A;  1OTR B;  3DVG X;  2Y5B B;  4GXB A;  1GJZ A;  2LWP A;  3NOB A;  4HDQ A;  4NPN A;  2CHX A;  3L54 A;  2RGF A;  3ONS A;  2CHW A;  4BBN C;  3ZO5 B;  4BOS C;  4CO7 A;  2DYB A;  2MRP A;  3GOE A;  4GU2 A;  4KV2 A;  1WGY A;  3A4S C;  4W9F A;  2NCN A;  3PGE A;  1K8R B;  3KYC D;  1V5O A;  4DWF A;  5KHO A;  5J18 A;  5JHA A;  1E8Z A;  1EUV B;  1WXV A;  4LDT B;  1WZ3 A;  4KIK B;  2ZVO A;  1LFD A;  4WWO A;  3TJP A;  4B9K A;  4WWN A;  2DZK A;  2JZ3 B;  1H4R A;  3B08 A;  3B0A A;  2DZJ A;  2L7R A;  4TUU A;  2LGD A;  4JQW C;  3ENE A;  3RUI B;  1WR6 E;  2ZZP B;  3KUD B;  4URK A;  2N9X A;  3IBE A;  4HPM B;  4WJQ A;  2MBB B;  3HHM A;  1GUA B;  1UD7 A;  4MM3 A;  2L0F A;  4BKS A;  2JZZ A;  1IPG A;  3VVW B;  3KW5 B;  1WX9 A;  4FHJ A;  1YIW A;  4IC7 B;  3ZNZ B;  2JRI B;  3SHQ A;  1V2Y A;  2JT4 B;  3UQB A;  2MA9 B;  4ZDV A;  1TZ1 A;  2JY6 A;  3X0W A;  3QQ8 B;  1Y8R C;  2PJH A;  2V3S A;  3MHS D;  5DCN A;  3A4R A;  1UGM A;  3KYD D;  1OGW A;  3ZLZ A;  2IO3 B;  2L3Z A;  4GDK B;  1Q5W B;  2LVP A;  2XBB C;  3VAW A;  1VCB A;  2LZ6 A;  2KN5 A;  4J6I A;  1F9J A;  5JH5 C;  2MW5 A;  4IM3 A;  1WJ6 A;  4WJP A;  2MBO A;  4I6P A;  3R66 C;  1E7V A;  2R2O A;  2UYZ B;  1GC7 A;  1IP9 A;  3DOW A;  4BVU C;  2N1V A;  4GN1 A;  3R7Q A;  4WWP A;  2JRH A;  4AUQ C;  1Q0W B;  2DYO A;  2K8H A;  3A9J A;  3PSE B;  4NQK E;  4KVG B;  3KUC B;  3ZNI D;  1NBF C;  2JWZ A;  2KDE B;  1GC6 A;  2Z0E B;  2ZEQ A;  2UWQ A;  4NY0 A;  1WE7 A;  2MQJ A;  4FJY A;  1TTN A;  3U30 A;  2DAJ A;  4I6N B;  5L95 C;  2GBM A;  4K1R B;  3PTF C;  5LXH A;  2FIF A;  2WYQ A;  1VD2 A;  3DPD A;  4G0N B;  1YX5 B;  2L76 A;  2A4Z A;  1WMH A;  3H7P A;  1WM3 A;  4GB9 A;  4W9K A;  2M0X A;  3JSV A;  2G4D B;  3UGB B;  4FLH A;  4FA6 A;  3DBL I;  1EO6 A;  2I1K A;  4BOZ B;  1KJT A;  3DDC B;  3QAR A;  5CX3 A;  2ASQ A;  1WZ0 A;  2O2V A;  2KMA A;  2XK5 B;  2R2Q A;  3HM6 X;  4PYU A;  1P0R A;  1WX7 A;  2LXA A;  2K39 A;  3R7R A;  3V60 A;  2LRW A;  1WX8 A;  2QHO A;  2K6Q A;  3VFK A;  4IM2 A;  3VHT C;  1WGD A;  2KD0 A;  2L0T A;  2NS5 A;  3T9L A;  1NI2 A;  4EEW A;  3V6E B;  2NR2 A;  3AU4 A;  4TQ0 A;  3EEC A;  4HLE A;  4ICU A;  4ANV A;  2DAF A;  4ANU A;  1KOT A;  2KQS A;  4G3X B;  3PV1 A;  2AEH A;  2DHZ A;  2JUO A;  4ZYN A;  1XQQ A;  3VH4 B;  3W1S A;  2CHZ A;  2ZPY A;  4E74 A;  2J0K A;  3WAM A;  2G45 B;  5JHB A;  3UF8 A;  3VUW A;  3ZVV A;  1RAX A;  2AL3 A;  2G3Q B;  2GMI C;  4GMV A;  4DHZ B;  1WJ4 A;  2MP2 B;  1S1Q B;  2J0J A;  4GSW A;  5GMV A;  3WA0 A;  2BWE S;  2NVU I;  4BFR A;  4PS8 A;  5E6O A;  3C0R B;  3L17 A;  4HXD A;  3AI5 A;  5D2M B;  5AZG A;  3Q3F A;  3RCZ A;  4WQO B;  1ZGU B;  1ZW7 A;  3DBR I;  3ZNG C;  3IG3 A;  1HE8 A;  2XEW A;  2CU1 A;  4MJS B;  3CST A;  4P7I A;  3ZRF A;  3EC8 A;  1A5R A;  4LJO B;  5TR5 A;  3PLU A;  3PRE A;  3HM3 A;  2D2Q A;  1I35 A;  2KNB A;  4BKS D;  1GG3 A;  3GZN I;  4HK2 A;  3H1U A;  4MH0 E;  3RD2 A;  3VDZ A;  2CS4 A;  1WGR A;  3A33 B;  1WR1 A;  2WX1 A;  2BYF A;  4TQ1 A;  4ANX A;  1WIA A;  3DVN U;  1YJ1 A;  4KSK C;  2LGX A;  1P98 A;  2V4L A;  3L0W B;  1E8X A;  2BWF A;  3OJ3 A;  4HWI B;  4NJ6 A;  3RZW C;  3WAN A;  3OAW A;  5CHW A;  2FAZ A;  3APF A;  4KIK A;  1PQS A;  1L7Y A;  3IVF A;  3JYU A;  3MTN B;  2WWZ A;  1E8Y A;  3TMP B;  2BYV E;  2FCN A;  4MSM B;  1J0G A;  2EKE C;  2FNJ B;  2N4F A;  4EZK A;  3JW0 X;  4K7U A;  3WIM A;  1GNU A;  5DPW A;  5IAA C;  3NS8 A;  3V61 A;  4GIV A;  1P9D U;  4FAD A;  2N7D A;  2YVC A;  4PYZ A;  3SD5 A;  1X1M A;  2KDB A;  3TCA A;  1YX6 B;  3OLM D;  2KLC A;  4KDL B;  4OVU A;  4F8C B;  4GOC A;  1UBQ A;  1WY8 A;  4JLC A;  4MJS A;  3A1Q A;  3DBH I;  1LQB A;  2JVC A;  3L10 B;  4FUL A;  3ALB A;  4ZRI A;  4AJW A;  3TIX A;  4DDG D;  4W9D A;  2KKC A;  1S3S G;  2LJ5 A;  2IO2 B;  3UQA A;  4FN2 A;  2W9N A;  3NY5 A;  4ZRK A;  4B6W A;  5EDS A;  2XK5 A;  4GDL B;  1E5W A;  2N9P C;  4FJZ A;  4NAW A;  3APD A;  4HCN B;  4JL9 A;  2ZNV B;  4LJP B;  1I42 A;  4G50 A;  2C5L C;  3AXC A;  2EMS A;  3EFU A;  3ECI A;  3ZNH B;  3QHT A;  2NBW B;  3ZIM A;  2M4N A;  3RT3 B;  3VTV A;  4F1S A;  4II2 B;  1IYF A;  4W9H A;  2GBK A;  1V9J A;  4EZL A;  1R4N I;  3HIZ A;  3A9K A;  3TL5 A;  1C3T A;  3WAL A;  1WM2 A;  2L05 A;  2OJR A;  2GBJ A;  1V49 A;  2MWS B;  1D3Z A;  2KWU B;  3W1S C;  3QX1 A;  4LDT D;  2MSE D;  4MGI E;  4W9G A;  3R3M A;  4WJN A;  2GOW A;  1BT0 A;  3CF6 E;  2PE9 A;  3VTW A;  2I1J A;  2NPT B;  4IWO A;  3WAP A;  1WGH A;  3KH0 A;  4GDK A;  4IG7 B;  2KFK B;  2O2V B;  2KJ6 A;  2KWV B;  2KC2 A;  3TBL D;  3HK0 A;  4A3O A;  2G4S A;  2ZJD A;  2HD5 B;  3I3T B;  1TGZ B;  5L83 A;  2IO0 B;  3H6N A;  4ASW C;  1SIF A;  4IWQ A;  4NQL B;  4TV3 A;  2C7M B;  5FR6 A;  1EF1 A;  4K7W A;  5LLI A;  2D10 A;  3S2A A;  4M0W B;  2DYM A;  2KX0 A;  4HPL B;  4BKG A;  1UBI A;  4W9I A;  2CKH B;  4EOY A;  3PHX B;  2LI5 A;  5AZF A;  4EFO A;  3QC8 B;  2KTR A;  2AL6 A;  1ZKH A;  3SU8 X;  3QWZ B;  2DEN B;  2KLG A;  3U8Z A;  2BPS A;  5DPS A;  3ZRC A;  3WAO A;  2ZVN A;  3ZTD A;  2O6V A;  2LRU A;  3PZD A;  2KTR B;  3L16 A;  4DHJ D;  3PT2 B;  2ZNV C;  3NZU A;  4LCD E;  4W9E A;  1J19 A;  2D11 A;  4ICV A;  4HCP B;  4WAA A;  2MCN B;  3JVZ X;  4EKU A;  1TBE A;  2YLM A;  3IFW B;  4E3C A;  2LUE A;  2RD0 A;  4AP4 C;  1OQY A;  4ANW A;  2BYE A;  3PS6 A;  4FBJ B;  3B1L X;  5G2N A;  3OJ4 B;  5AEK B;  2ZPN A;  2LD9 A;  5CTR C;  3QJZ A;  5HKH A;  2MLB A;  2KDI A;  4HDO A;  2LVQ A;  2KC1 A;  4WJO A;  2DX5 B;  1H8C A;  1OEY J;  2AWT A;  1V5T A;  1SE9 A;  3PRZ A;  5AZH A;  1WXA A;  2KQ7 A;  2O6V B;  3ZTC A;  4PS7 A;  4F7Z A;  3U7D A;  4AJY B;  2KFK A;  1R4M I;  4DBG A;  5CHF A;  1RLF A;  1WGG A;  4A20 A;  4DDI D;  2MX2 A;  5G55 A;  3N30 A;  4PS3 A;  2IY0 B;  2JPH A;  2BF8 B;  2KJH B;  4W9C A;  2KJR A;  1V6E A;  2NPT A;  3N32 A;  4K81 A;  2K1F A;  2K25 A;  3ML9 A;  2PPH A;  3UIO B;  2IO1 B;  1WYW B;  2HE7 A;  3APC A;  2L8J A;  3PVL A;  3T8M A;  3ZKJ C;  2HTH A;  4OVV A;  1WI0 A;  2N9E B;  1RFA A;  3AU5 A;  2BGF A;  4IW0 A;  2FCM A;  2L00 B;  2FID A;  2DZI A;  1RRB A;  2DZM A;  4M8N A;  4MGK E;  2VRR B;  5J17 A;  1L2N A;  1T0Y A;  3KVF B;  2LVO A;  1P3Q U;  3JSV B;  3QA8 A;  1Q1O A;  4E71 A;  4IUM B;  2N7E A;  2LAS A;  1WMH B;  3X23 A;  2Z59 B;  3PLV A;  4B95 A;  3H7S A;  3PHW B;  4YL8 A;  2Z0D B;  2D07 B;  3QIJ A;  3AUL A;  4JIO U;  3DBS A;  4NJ7 A;  4W9J A;  2ZCC A;  3PRM B;  4XZ4 A;  2FUH B;  4FHK A;  1WE6 A;  1YQB A;  2LXC A;  4CHK A;  2LGY A;  1E90 A;  1UZX B;  4ZRJ A;  1EF5 A;  3VQI A;  4HJK A;  2IYD B;  2M17 A;  2KWC A;  1E8W A;  2KVR A;  4KSL C;  2FCQ A;  3QAQ A;  4DHJ B;  5IA7 A;  2PEA A;  3A9J B;  2N1W A;  3PRP B;  4N9F 4;  1LM8 B;  2RR9 A;  3CMM B;  1E7U A;  1V80 A;  2KHW B;  1WFY A;  3M62 B;  1G6J A;  2IBI B;  4KZC A;  3M63 B;  2NBU A;  2NBV B;  2C60 A;  3MJW A;  3K9P B;  4G11 A;  2A5U A;  2KTF A;  4XC2 A;  3SDL C;  3VXW A;  5D6J B;  1AAR A;  1YD8 U;  1Z5S B;  4KDI C;  3UIP B;  1WRD B;  1UEL A;  3W1Y A;  2MBH A;  3Q3J A;  1WJU A;  4MEM A;  4AOF A;  3A1Q B;  2EMT A;  2KO3 A;  2KDF B;  4MGY E;  3N3K B;  5BO4 B;  2FCS A;  1V81 A;  4AWJ A;  5C23 A;  1WJN A;  1QZE A;  2C7N B;  3ML8 A;  3NHE B;  3ZDM C;  2MBE A;  4FJV B;  3BY4 B;  4X57 B;  3QCA A;  2O6V D;  3O65 B;  4HVB A;  3ZW3 A;  1WF9 A;  2C7H A;  1ISN A;  3VUX A;  4EUT A;  2BKF A;  2C9W B;  4MGZ E;  5KHQ A;  3LDZ E;  4RMA A;  1FXT B;  4BBN F;  3D32 A;  2CR5 A;  1J8C A;  5DPR A;  1XT9 B;  2KFJ A;  4TKN A;  2M1M A;  2KOX A;  3M95 A;  1KM7 A;  4EZJ A; 
#chains in the Genus database with same CATH topology
 2MJ3 A;  3V62 A;  4JWU C;  1VRA B;  2WHI A;  1T0R C;  2ACZ B;  2FE8 A;  4IM0 A;  4RM9 A;  1J7B A;  3UIN B;  2AYO B;  5DPT A;  1KLV A;  3PPA A;  1E0Z A;  3P1M A;  1UNS A;  1I4Q A;  3A9K B;  4M8M A;  2HJ1 A;  1PGB A;  4K7S A;  2J0M A;  2GBR A;  1P1A A;  3P2B A;  3HVZ A;  2V1Y A;  5D7G A;  1WXM A;  2PE6 B;  3AE2 B;  4GDL A;  4NAW B;  3DVG Y;  2KXJ A;  1DYQ A;  2JXX A;  3NZS A;  2KAN A;  1HXY D;  5JZE B;  2RPQ A;  1YJI A;  2M8S A;  4GGQ A;  2IND C;  3VH3 B;  2IGD A;  1QOA A;  4NNJ B;  1OTR B;  4J3O D;  3EA6 A;  2Y5B B;  1XLP A;  4NPN A;  1BUI C;  2RGF A;  3ONS A;  4BBN C;  1ZOY B;  4BOS C;  3GOE A;  3NG0 A;  4GU2 A;  4KV2 A;  4IDI A;  1K8R B;  3KYC D;  1V5O A;  3B2F A;  2KDM A;  5J18 A;  5JHA A;  2RDB C;  1EUV B;  1WXV A;  2K0P A;  1WZ3 A;  1FCL A;  2DZK A;  2JZ3 B;  2PLP A;  3B08 A;  2PVG C;  3Q8F A;  2L7R A;  1SXT A;  1ZUD 2;  4NZL B;  3NVW A;  4JQW C;  2BQQ A;  2AX5 A;  2D3C A;  2RDH A;  4URK A;  2N9X A;  3IBE A;  3HHM A;  1VR9 A;  1IPG A;  3VVW B;  2WXK A;  1YIW A;  3ZNZ B;  4TSS A;  2JT4 B;  2MA9 B;  2PVO D;  2PJH A;  2R61 A;  3A4R A;  2WXM A;  1UGM A;  1C4P A;  1OGW A;  3KYD D;  3DBL B;  1Q5W B;  4AQ7 A;  2LVP A;  2XBB C;  3ZGZ A;  2LZ6 A;  2KN5 A;  4JX1 C;  5G5G A;  3R66 C;  1E7V A;  4WQM A;  3Q3N C;  3VRB B;  4NQK E;  3KUC B;  2KDE B;  1GC6 A;  2Z0E B;  1JWU D;  1B9R A;  3U30 A;  5L95 C;  4AS1 A;  1SB3 C;  2NTT A;  4K1R B;  3PTF C;  5LXH A;  2WYQ A;  4RGN A;  3BK2 A;  3H7P A;  3RNA C;  2E6X A;  1XF5 L;  2M0X A;  3JSV A;  2G4D B;  4P1C C;  3UGB B;  4FLH A;  3QAR A;  2ASQ A;  1WZ0 A;  2O2V A;  2JQR B;  2KMA A;  3NVZ A;  3HM6 X;  4JPS A;  4JWS C;  4PYU A;  1P0R A;  1LO5 D;  2K39 A;  1JRP A;  2XNA C;  3R7R A;  3V60 A;  2LRW A;  2DBY A;  1C9F A;  2L0T A;  2V3N A;  5EE1 A;  4TQ0 A;  4HLE A;  1D4B A;  3AEA B;  2DAF A;  4ANU A;  1KOT A;  4G3X B;  1IP9 A;  1JW9 D;  2AEH A;  4E74 A;  1XQQ A;  2JSV X;  5JHB A;  3UF8 A;  2AL3 A;  2GMI C;  2UU7 A;  3EUB 2;  1F0Z A;  1S1Q B;  1ACC A;  2D3B A;  3P42 A;  3WA0 A;  5MPO A;  2BWE S;  2NVU I;  2N9K A;  5E6O A;  3C0R B;  4WH4 A;  1IBX B;  1V97 A;  1L5P A;  1HTO A;  3B9J A;  2WDR B;  3ZRF A;  4HJG E;  4LNN A;  5TR5 A;  3WCQ A;  2KNB A;  1GG3 A;  2KQ4 X;  1WIA A;  2LGX A;  1P98 A;  3BK1 A;  1E8X A;  3RZW C;  3U2S C;  4ZHO A;  3OAW A;  2B76 B;  1PQS A;  1M4V A;  2WWZ A;  4ZRP A;  1E8Y A;  5IN7 A;  3MJ5 A;  2BYV E;  2FCN A;  2N4F A;  4EZK A;  3GS2 A;  2MJD A;  3NS8 A;  2WXQ A;  2LHD A;  1N62 A;  1X1M A;  3ZJV A;  3TCA A;  1FMA D;  4JLC A;  3IAS 1;  5G5H A;  3RNB C;  4ZRI A;  3TIX A;  2MJE A;  4W9D A;  4NAM A;  4ZRK A;  1E5W A;  4HCN B;  2QC8 A;  1I42 A;  4K3B A;  1EU3 A;  4L1B A;  3ECI A;  3RT3 B;  4W9H A;  3MC0 B;  1V9J A;  4EZL A;  4LNI A;  3HIZ A;  3A9K A;  4P1B C;  2OJR A;  2GBJ A;  3IXS A;  3QX1 A;  4XDC A;  3U4E G;  1F77 A;  1IGD A;  2MSE D;  2BW2 A;  4P16 A;  1BT0 A;  2ZW1 A;  1EU4 A;  2PE9 A;  3VTW A;  4IWO A;  1EM7 A;  3WAP A;  3KH0 A;  4LTU A;  4A3O A;  3HK0 A;  1JWB D;  4C7Y A;  1L6U A;  2G4S A;  2HDE A;  1N60 A;  3S2A A;  4EOY A;  1TS4 A;  2KTR A;  3QWZ B;  2DEN B;  4IKG A;  5DPS A;  3L16 A;  3NZU A;  1P7F A;  4LCD E;  1QT9 A;  1QOB A;  4ICV A;  4LNF A;  1E10 A;  2WXF A;  4HKZ E;  4RCO A;  4E3C A;  4YSX B;  3AE3 B;  3TEZ A;  2BYE A;  4RNA A;  3KQ4 A;  2ZPN A;  5EE0 A;  5CTR C;  4YTM B;  3DWG C;  3AB5 A;  2FBW B;  3IT4 B;  1FPY A;  1V5T A;  2W3S A;  5AZH A;  3RI7 C;  2Y3A A;  3ZTC A;  2L1A A;  4PS7 A;  4RGT A;  2L32 A;  4DDI D;  1R4N B;  2JPH A;  1UF0 A;  4YT0 B;  3N32 A;  1AWD A;  2NMQ A;  5FK9 C;  1WGK A;  1N5W A;  2HE7 A;  3APC A;  3NZ3 A;  2N9E B;  2BGF A;  4IW0 A;  2L00 B;  2DZI A;  2VRR B;  3DBH B;  1FNU A;  1Q1O A;  1C76 A;  2LAS A;  2PTL A;  3PLV A;  3MP9 A;  2D3A A;  4YL8 A;  2Z0D B;  3QIJ A;  4JIO U;  3PRM B;  2BS4 B;  2LGY A;  2GI9 A;  4M01 A;  2M17 A;  2KWC A;  1C78 A;  5BMG A;  2KMM A;  1XXG A;  5HHD G;  2PEA A;  3PRP B;  1HZ5 A;  1LM8 B;  4DQO C;  2IBI B;  4WIP A;  2NBV B;  3MHZ A;  4XC2 A;  3SDL C;  1QIL A;  3N9Y C;  3C19 A;  2K3U A;  3W1Y A;  2MBH A;  4AOF A;  3A1Q B;  1I4H A;  2KO3 A;  4MGY E;  4TMA B;  5BO4 B;  1WJN A;  2EEL A;  3R8B A;  1QZE A;  1R7S A;  3AE1 B;  4X57 B;  1N6Z A;  1TY2 A;  3P4R B;  4EUT A;  2C9W B;  5KHQ A;  3Q3M C;  2CR5 A;  2KFJ A;  4M0W A;  2WU5 B;  2M1M A;  3M95 A;  4EZJ A;  1WXQ A;  2LUM A;  2OOB B;  1CMX B;  2K6D B;  1I4X A;  2N0S B;  1XCQ L;  3GB1 A;  3CSF A;  5D94 A;  2AQ3 B;  4IWP A;  5CHV C;  3RYT A;  3SFD B;  1LXD A;  3DQV A;  2KZR A;  4A3P A;  2MBQ A;  2REX A;  5J2R A;  4OZB A;  2K8C A;  3BWU D;  1V86 A;  2JF5 A;  1QOF A;  4DHZ E;  2QIL A;  2Z8L A;  2KMC A;  4BKT A;  3L13 A;  1C1Y B;  3DVN V;  3VUY A;  4ZHP A;  3IHP C;  5E6N A;  2JWU A;  1VDV A;  4OZC A;  3ZDT A;  2OHF A;  1FD6 A;  3AH7 A;  4DXG A;  1WH3 A;  3QK0 A;  2BKR B;  2WXG A;  4RM8 A;  2W54 A;  1FFV A;  3RUL A;  2KK8 A;  4RFB A;  4S0R A;  3VR9 B;  4FXC A;  2CHW A;  4CO7 A;  1WWT A;  1WYG A;  3BZD B;  1EWY C;  3PGE A;  1F1H A;  3E9S A;  2V9H A;  2WGS A;  4LDT B;  2WXL A;  1FNW A;  4KIK B;  1LFD A;  4B9K A;  2DZJ A;  4TUU A;  4HEA 1;  1A70 A;  3RUI B;  1WR6 E;  4HPM B;  1C4C A;  2CU3 A;  2BVC A;  3AEG B;  2JZZ A;  1HQR D;  4QAY A;  2SEB D;  4FHJ A;  1D6E C;  4MM3 B;  3SHQ A;  1P7E A;  3UQB A;  2XN9 C;  5T8I A;  3NJT A;  1VZ6 A;  2JY6 A;  4B0M A;  4WUR A;  1K53 A;  3RNC C;  3VAW A;  1VCB A;  4J6I A;  1L0V B;  1YQ3 B;  2UYZ B;  1FEH A;  2JRH A;  1D5Z C;  3PSE B;  1IUE A;  3N1Y C;  4KVG B;  1SIJ A;  3ZNI D;  3ZJT A;  2JWZ A;  2ZEQ A;  3MFG A;  2JXT A;  3FIL A;  2DAJ A;  1I4P A;  2FIF A;  4RGM A;  4G0N B;  4US9 A;  3AE7 B;  4W9K A;  1NYQ A;  4FA6 A;  3DBL I;  1EO6 A;  3R2I A;  3BII D;  5CX3 A;  1KFY B;  4YXD B;  5FKA C;  2XK5 B;  2R2Q A;  1FXA A;  2DLB A;  1C79 A;  2QHO A;  1I4R A;  2KD0 A;  1YNT E;  3DWM A;  1NI2 A;  3V6E B;  3EEC A;  4ICU A;  1TY0 A;  4ANV A;  4DXF A;  3RN9 C;  1JWM D;  3VH4 B;  3O13 A;  3PV1 A;  2DHZ A;  3W1S A;  4OW0 A;  2CHZ A;  1N61 A;  3WAM A;  2G45 B;  3HUI A;  3ZVV A;  2KN4 A;  5TSS A;  2J0J A;  4GSW A;  3I57 A;  1GB4 A;  1T3Q A;  4PS8 A;  4HXD A;  3TEW A;  3RCZ A;  1HE8 A;  2CU1 A;  4MJS B;  3ZJU A;  4LJO B;  4A8X C;  2LMC A;  1I35 A;  4BKS D;  3VDZ A;  2CS4 A;  1WR1 A;  3RPF C;  2WX1 A;  4KSK C;  1YJ1 A;  3OJ3 A;  4HWI B;  1JML A;  3KLS X;  5CHW A;  3IVF A;  1ZE3 D;  4ACF A;  3TMP B;  3ETR A;  2N9L A;  1J0G A;  4MSM B;  3C8Y A;  3WIM A;  3GP7 A;  1GNU A;  2WXO A;  1FXI A;  1FIQ A;  5HG2 A;  3V61 A;  2BYT A;  4FAD A;  1STE A;  2KDB A;  2KLC A;  4PK1 A;  5BMI A;  4OVU A;  4GOC A;  1UBQ A;  3BVM A;  2E3T A;  2WS3 B;  3P4Q B;  4AJW A;  3UI3 A;  4A90 A;  1WRI A;  4DDG D;  2W9N A;  4FJZ A;  2D5G A;  4G50 A;  3AXC A;  2EMS A;  3EFU A;  3CIR B;  5LNK 1;  2NBW B;  3EFC A;  3VTV A;  4II2 B;  1VZ8 A;  4IOI E;  1C3T A;  2L05 A;  1QOG A;  4XYC A;  4LNK A;  2KWU B;  3KWV A;  3Q8B A;  4W9G A;  3R3M A;  1PGX A;  2I1J A;  3IAM 1;  4YSY B;  1EWC A;  4OHJ A;  2LHE A;  2KFK B;  2O2V B;  3I9V 1;  2KC2 A;  3TBL D;  3H6N A;  3NRZ A;  4IWQ A;  4NQL B;  5FR6 A;  4K7W A;  1K52 A;  5LLI A;  2DYM A;  4W9I A;  1L4Z B;  3PHX B;  2LI5 A;  4EFO A;  3QC8 B;  3SU8 X;  2KLG A;  3U8Z A;  2ZVN A;  3ZTD A;  1B1Z A;  2O6V A;  3N1X C;  2KTR B;  1JRO A;  2D11 A;  2JZP A;  4HCP B;  3GE3 C;  3JVZ X;  5AUI A;  1IBX A;  2LGS A;  3V05 A;  4FBJ B;  1GOZ A;  5BYS A;  2J52 A;  2HTM E;  2DX5 B;  1H8C A;  1OEY J;  1SE9 A;  1WXA A;  2KQ7 A;  4F7Z A;  2KFK A;  4DBG A;  5CHF A;  1WGG A;  1F52 A;  2WDQ B;  3N30 A;  2IY0 B;  2AQ2 B;  4W9C A;  1V6E A;  2INC C;  1YOV B;  2K1F A;  2K25 A;  3ML9 A;  1K51 A;  2PPH A;  4C00 A;  3T8M A;  3ZKJ C;  1WI0 A;  3FIL B;  1GB1 A;  1T0Y A;  1XLO A;  3JSV B;  4E71 A;  1KLG D;  3RFZ B;  1ET6 A;  3H7S A;  3AUL A;  2V0G A;  4NJ7 A;  2ZCC A;  2PW9 A;  1YQB A;  4C80 A;  1HEZ E;  2IYD B;  1JCK B;  4KKI A;  4KSL C;  2WXI A;  2FCQ A;  3QAQ A;  2WQY B;  1ENF A;  2N1W A;  3A9J B;  4ITK A;  2K9X A;  1E7U A;  4R3D A;  5HFY A;  3M62 B;  1YJJ A;  5AUK A;  4G11 A;  4KGT A;  1F2R C;  3UIP B;  1WRD B;  4MEM A;  1WJU A;  2H89 B;  2KDF B;  3N3K B;  1JWS D;  4AWJ A;  5IKC M;  1L0Y B;  2C7N B;  3ZDM C;  4XWW A;  2L52 A;  2I2Y A;  1WF9 A;  1C77 A;  1TJE A;  1SJH D;  3TEY A;  3LDZ E;  4BBN F;  3D32 A;  4TKN A;  5IP4 D;  1KM7 A;  2IZV B;  2MP2 A;  1I7H A;  2WX0 A;  2PIA A;  2IY1 B;  4I6L B;  2G1E A;  4MDK E;  2WDT B;  5C1Z A;  2D3G A;  2K5P A;  3L08 A;  3H9D A;  4KZ0 A;  3ZUN A;  1GPX A;  2GBN A;  1LGR A;  4B0E A;  2B3A A;  3M3J A;  3BIN A;  2KWD A;  1PYW D;  4MSQ B;  1Z2M A;  1ET9 A;  1DOX A;  1MG8 A;  3H7P B;  4P6V F;  2LFI A;  1MHX A;  1U4A A;  4XX5 A;  1SJE D;  2QMT A;  3H8H A;  3V6C B;  3K9O B;  3VTU A;  1TKE A;  1OFF A;  1NYR A;  4C56 C;  1T5X D;  1XCT L;  2K8B A;  2RPV A;  3DVG X;  4GXB A;  2BBC A;  1GJZ A;  3NOB A;  1FO4 A;  4HDQ A;  4ZOH C;  1AYF A;  2VZK D;  1I4G A;  1D5M C;  5KHO A;  3I5J C;  3DHH C;  2ZVO A;  4HRO A;  4C7Z A;  3TJP A;  4WWN A;  1H4R A;  4ARC A;  4LK0 M;  1DOY A;  3EGR A;  2LGD A;  2QIE B;  3ENE A;  4JE3 B;  1XEE A;  3KUD B;  2ZW0 A;  5E6J A;  4WJQ A;  2MBB B;  1UD7 A;  4MM3 A;  4BKS A;  3HVD A;  3KW5 B;  4IC7 B;  1V1P A;  2JRI B;  4OZA A;  3X0W A;  3QQ8 B;  1Y8R C;  3MHS D;  5DCN A;  4GDK B;  2CJN A;  2MW5 A;  4IM3 A;  1OQQ A;  2H88 B;  4WJP A;  1YQ4 B;  2R2O A;  4ZRQ A;  2N1V A;  3R7Q A;  4WWP A;  2LGI A;  4AUQ C;  1Q0W B;  2DYO A;  2JU6 X;  2K8H A;  3A9J A;  1NBF C;  1WE7 A;  4FJY A;  1TTN A;  1FCC C;  1VD2 A;  1YX5 B;  1E7P B;  2A4Z A;  1WMH A;  1WM3 A;  3VRA B;  4GB9 A;  3DDC B;  4UDU C;  2YEP B;  2WLB A;  3P63 A;  3ABV B;  2K6Q A;  1SE3 A;  3T9L A;  2EKI A;  3AU4 A;  2OJW A;  3Q14 C;  2JUO A;  3AEE B;  2ZPY A;  3VUW A;  1TS3 A;  1RAX A;  2G3Q B;  3Q2A C;  3SEB A;  1SE4 A;  3B2G A;  4A6Q A;  5GMV A;  2ICI A;  1C4A A;  3PZ7 A;  3L17 A;  2K22 A;  3AI5 A;  5D2M B;  3Q3F A;  4WQO B;  1ZPS A;  4MAC A;  3EC8 A;  3GE8 C;  3KWL A;  3PLU A;  3PRE A;  3RD2 A;  2YEP F;  3A33 B;  4TQ1 A;  4ANX A;  2KYW A;  4C4V B;  2V4L A;  1WSP A;  3L0W B;  5BYQ A;  2BWF A;  4NJ6 A;  2INP E;  2IDY A;  4D2K A;  2IGH A;  4KIK A;  3JYU A;  3MTN B;  2WP9 B;  1SEB D;  2W82 A;  2V4I B;  3JW0 X;  4K7U A;  3AEB B;  1ZXH A;  1P9D U;  2YVC A;  4PYZ A;  4N58 A;  4O1N A;  2ON8 A;  3OLM D;  4F8C B;  1WY8 A;  4REZ A;  3DHG C;  3DBH I;  2JVC A;  3ALB A;  4YWG G;  3TSS A;  1S3S G;  2LJ5 A;  2IO2 B;  3UQA A;  5EDS A;  5BMH A;  3NY5 A;  5EE9 A;  3APD A;  4JL9 A;  1NEN B;  2ZNV B;  4LJP B;  1TZO A;  1TT5 B;  2C5L C;  3W9C B;  3ZNH B;  2IGG A;  3QHT A;  1CJE A;  3ZIM A;  2M4N A;  4L23 A;  1IYF A;  1J7A A;  2BB5 A;  1R4N I;  1FFU A;  2QCZ A;  3BYY B;  1D5X C;  3WAL A;  2KVZ A;  2MWS B;  3TUO A;  1QQR A;  4CQN A;  2INN E;  3R2T A;  4LDT D;  4BZA A;  3BVG A;  1XLN A;  2NPT B;  4GLS C;  3Q8A A;  1WGH A;  3NS1 A;  3V3X A;  2KJ6 A;  1YMH E;  2ZJD A;  2HD5 B;  1TGZ B;  5L83 A;  2IO0 B;  2JX5 A;  1CZP A;  4ASW C;  2D10 A;  2BS2 B;  4HPL B;  1UBI A;  2CKH B;  3AE9 B;  2BPS A;  3WAO A;  1ROE A;  3PZD A;  5C3J B;  2ZNV C;  2KT7 A;  3P4P B;  1J19 A;  2JYT A;  3RNG C;  4EKU A;  2YLM A;  1KF6 B;  2LUE A;  2RD0 A;  1OQY A;  1V8C A;  3PS6 A;  5G2N A;  3OJ4 B;  5AEK B;  2LD9 A;  1T0S C;  3QJZ A;  5HKH A;  2MLB A;  2KDI A;  4HDO A;  4WJO A;  2RMM A;  4K3C A;  2AWT A;  3PRZ A;  1OQR A;  4HRS A;  4N59 A;  3U7D A;  4PT5 A;  1SBB B;  3Q8C A;  3FKY A;  2JYE A;  2MX2 A;  5G55 A;  2BF8 B;  2KJR A;  2NPT A;  2BB6 A;  1SE2 A;  4K81 A;  3UIO B;  1ZXI A;  1WYW B;  1RM6 C;  2L8J A;  3FAH A;  1GAQ B;  1NI3 A;  2ONQ A;  1RFA A;  3AU5 A;  2FCM A;  4M00 A;  4XGA B;  1RRB A;  4M8N A;  4MGK E;  5J17 A;  2LVO A;  1P3Q U;  3AM9 A;  4IUM B;  1WMH B;  2Z59 B;  4B95 A;  4LLG M;  2D07 B;  2KAJ A;  3DBS A;  1UWX A;  1E9M A;  1WE6 A;  2LXC A;  4CHK A;  1UZX B;  4ZRJ A;  3VQI A;  4MH8 A;  4HJK A;  1TS5 A;  1E8W A;  2KVR A;  2WXR A;  3OWE B;  2WNM A;  3MC9 A;  5IA7 A;  4WWM A;  2RR9 A;  3CMM B;  1V80 A;  4XE0 A;  2KHW B;  5I4D A;  4KZC A;  3M63 B;  2NBU A;  3VR8 B;  3K9P B;  2A5U A;  2KTF A;  5H8Y E;  2PMV A;  3Q6B A;  4MT5 A;  1UEL A;  3Q3J A;  2EMT A;  3ML8 A;  3NHE B;  5JXV A;  3BY4 B;  4HVB A;  4OVZ A;  1ISN A;  3VUX A;  3L4P A;  2BKF A;  1AW7 A;  4RMA A;  1FXT B;  1J8C A;  1XT9 B;  4M02 A;  1KRH A;  1K50 A;  1UUP A;  2KOX A;  2VH1 A;  3NVV A;  4W9L A;  3KUZ A;  3AED B;  4CYE A;  3LJ3 A;  1MJD A;  3ZYY X;  1NDD A;  4II3 B;  3RZF A;  4USA A;  1HZ6 A;  2ZCB A;  3DCG A;  1JQ4 A;  1XD3 B;  4L2Y A;  1WXS A;  4JGH B;  5D3I B;  3Q69 A;  2KX3 A;  1DOI A;  1ZP0 B;  1M94 A;  1CK1 A;  3RNE C;  5E6P A;  3EHV A;  2J7Q B;  4MEL A;  1T6B X;  1ZDX A;  1TKY A;  1TIF A;  2CJO A;  2HJ8 A;  2RSU A;  1FNV A;  4DK5 A;  3ZXV A;  5LXI B;  2X38 A;  1MFW A;  4DXA B;  2WXH A;  1OEY A;  1UH6 A;  1SGH A;  1JRU A;  3NUH B;  4RGO S;  2WXJ A;  4KX6 B;  1N63 A;  1DGJ A;  3IT6 B;  2LWP A;  2CHX A;  3L54 A;  3ZO5 B;  1MI0 A;  5IOI A;  2DYB A;  1N5X A;  2MRP A;  4W9F A;  1WGY A;  3A4S C;  2NCN A;  2M19 A;  2GRI A;  4DWF A;  1T0Q C;  1E8Z A;  2W55 A;  1JAL A;  4WWO A;  3B0A A;  2Y5P A;  2QEJ C;  3I63 C;  3AE4 B;  2NTS A;  2ZZP B;  2MHJ A;  1SF0 A;  3BYT B;  3MC8 A;  1GUA B;  2BTE A;  1Y56 A;  2L0F A;  1VZ7 A;  1WX9 A;  1FRR A;  1V2Y A;  1TS2 A;  4ZDV A;  1TZ1 A;  2V3S A;  3P4S B;  4RF0 A;  1QKZ A;  3ZLZ A;  1E6E B;  3BVZ A;  2IO3 B;  2L3Z A;  1UWM A;  1F9J A;  5JH5 C;  5FR3 A;  1WJ6 A;  2MBO A;  4I6P A;  2VH2 A;  1GC7 A;  3DOW A;  4BVU C;  4GN1 A;  1ZDV A;  1L6V A;  1QF6 A;  1RFK A;  1HA5 A;  4NY0 A;  2UWQ A;  1MVK A;  2QJL A;  2MQJ A;  3ZXR A;  1IGC A;  1MG4 A;  4I6N B;  4A9A A;  2GBM A;  2I38 A;  1J7C A;  4KKJ A;  2RDG A;  3DPD A;  2L76 A;  1TKG A;  3LB8 C;  3AN1 A;  2I1K A;  4BOZ B;  1KJT A;  1RWS A;  3T3N A;  1AN8 A;  4S17 A;  4ARI A;  1WX7 A;  2LXA A;  3U7Z A;  3AEC B;  4A55 A;  3W5V B;  2M56 B;  1WX8 A;  3VFK A;  4IM2 A;  3VHT C;  1WGD A;  2NS5 A;  2DWQ A;  4EEW A;  3N1Z C;  2TSS A;  2NR2 A;  2SAK A;  1YN5 A;  1VLB A;  2KQS A;  4ZYN A;  2PKO A;  4C4V A;  2J0K A;  4GMV A;  4DHZ B;  1WJ4 A;  2MP2 B;  3AMZ A;  1NVI D;  1F2R I;  4BFR A;  1PGA A;  5AZG A;  1VJK A;  1ZGU B;  1ZW7 A;  1YN4 A;  3DBR I;  3ZNG C;  2QSD A;  3IG3 A;  2XEW A;  5HI1 A;  1HTQ A;  3CST A;  4P7I A;  1A5R A;  3HM3 A;  1XLQ A;  2D2Q A;  4NJC A;  3GZN I;  4HK2 A;  2KAC A;  3H1U A;  4MH0 E;  4LNO A;  1WGR A;  2IJ0 A;  1PDX A;  2BYF A;  3DVN U;  3WAN A;  2WU2 B;  1MPE A;  2Q5W D;  2FAZ A;  3APF A;  1L7Y A;  5GXG B;  4BAX A;  3RNF C;  3FC4 A;  2EKE C;  2FNJ B;  1CQV A;  4YTN B;  5DPW A;  2AQ1 B;  5IAA C;  1ESF A;  4GIV A;  4Q2J A;  2N7D A;  3SD5 A;  2W3R A;  1KH0 A;  3U52 E;  2J53 A;  2V3P A;  1YX6 B;  4KDL B;  1L4D B;  4MJS A;  3A1Q A;  1LQB A;  3L10 B;  4FUL A;  4XWT A;  1RYJ A;  3W5U B;  4YSZ B;  2KKC A;  4ZYS A;  4FN2 A;  4B6W A;  2XK5 A;  4GDL B;  4NAW A;  2N9P C;  3AE8 B;  4N6E B;  4F1S A;  2GBK A;  2WXP A;  4YTP B;  3E56 A;  1MHH E;  1R4M B;  3PO0 A;  3TL5 A;  1WM2 A;  2L83 A;  1V49 A;  1BXT A;  1UGJ A;  3DHI C;  3J9C A;  1D3Z A;  2N7J A;  3W1S C;  2BS3 B;  4MGI E;  4WJN A;  3HRD D;  2GOW A;  2GLS A;  3CF6 E;  3SFE B;  1PUT A;  2OED A;  4GDK A;  4IG7 B;  2WXN A;  3AV8 A;  2KWV B;  1V1O A;  4RF1 A;  3I3T B;  4HPP A;  1SIF A;  4TV3 A;  2C7M B;  2Y5C A;  1EF1 A;  3AE5 B;  3OG5 A;  4M0W B;  3URY A;  2KX0 A;  4BKG A;  1SSN A;  2WDV B;  5AZF A;  2AL6 A;  1ZKH A;  2DNF A;  4H2A A;  3ZRC A;  3AEF B;  2LRU A;  2GB1 A;  4DHJ D;  1L0X B;  3PT2 B;  4W9E A;  4WAA A;  2J42 A;  4XDD A;  2MCN B;  1TBE A;  3IFW B;  3T3O A;  4AP4 C;  2J4X A;  1XO3 A;  4ANW A;  3B1L X;  3N20 C;  1V1P B;  1FM0 D;  2MEK A;  2LVQ A;  2KC1 A;  3LXF A;  1TYG B;  3Q3O C;  4WAF A;  2O6V B;  5EE3 A;  5IO9 A;  2FUG 1;  4AJY B;  1R4M I;  1RLF A;  4A20 A;  2X8X X;  4PS3 A;  2KJH B;  1KLU D;  3RMK C;  3AE6 B;  2IO1 B;  1FRD A;  3PVL A;  4KGS A;  2HTH A;  2MH7 A;  4OVV A;  4US8 A;  3W2D A;  2FID A;  2IPK D;  2DZM A;  1L2N A;  3KVF B;  3QA8 A;  1BML C;  2N7E A;  3X23 A;  3PHW B;  3TEX A;  3CWI A;  2BT6 A;  1Q10 A;  4W9J A;  2M0A A;  4XZ4 A;  2FUH B;  4FHK A;  1JWA D;  1E90 A;  1KTK A;  1EF5 A;  2VZK B;  5D3D A;  3Q8E A;  2G9H D;  4DHJ B;  4N9F 4;  1YN3 A;  5BYR A;  3ZQ4 A;  1WFY A;  1G6J A;  2C60 A;  3MJW A;  3VXW A;  5D6J B;  1AAR A;  2LEK A;  2LJI A;  1YD8 U;  1Z5S B;  4KDI C;  1NEK B;  3GZN B;  3SR6 A;  3LYY A;  2FCS A;  4KGR A;  4HKQ A;  1V81 A;  4RH6 A;  4EE2 A;  5C23 A;  3DBR B;  2MBE A;  4FJV B;  1QLB B;  3QCA A;  2O6V D;  3O65 B;  5H92 C;  3ZW3 A;  2C7H A;  1PFD A;  3PZ8 A;  2QDF A;  4MGZ E;  5C2T B;  3NVY A;  5DPR A; 
#chains in the Genus database with same CATH homology
 2IZV B;  2MP2 A;  2OOB B;  3V62 A;  4W9L A;  1CMX B;  2K6D B;  2WX0 A;  3KUZ A;  4CYE A;  3LJ3 A;  2IY1 B;  1NDD A;  3CSF A;  4II3 B;  5D94 A;  3RZF A;  4I6L B;  4IM0 A;  4IWP A;  4RM9 A;  2ZCB A;  3DCG A;  5CHV C;  3RYT A;  1XD3 B;  4MDK E;  1WXS A;  4JGH B;  3UIN B;  2KX3 A;  2WDT B;  2AYO B;  5C1Z A;  1LXD A;  2D3G A;  3DQV A;  2KZR A;  4A3P A;  3L08 A;  5DPT A;  1KLV A;  3H9D A;  4KZ0 A;  3PPA A;  1M94 A;  3ZUN A;  2MBQ A;  5E6P A;  2REX A;  5J2R A;  2GBN A;  3EHV A;  3A9K B;  2K8C A;  2J7Q B;  2B3A A;  4MEL A;  4M8M A;  3M3J A;  3BIN A;  4K7S A;  2J0M A;  1V86 A;  4MSQ B;  2GBR A;  1P1A A;  1Z2M A;  2JF5 A;  4DHZ E;  1MG8 A;  3H7P B;  3P2B A;  2V1Y A;  2HJ8 A;  2KMC A;  4BKT A;  2RSU A;  4DK5 A;  3L13 A;  5D7G A;  1C1Y B;  1WXM A;  3DVN V;  3VUY A;  1U4A A;  2PE6 B;  3IHP C;  4GDL A;  4NAW B;  4XX5 A;  3DVG Y;  5LXI B;  2KXJ A;  2JXX A;  5E6N A;  3NZS A;  2KAN A;  4DXA B;  1OEY A;  1UH6 A;  3V6C B;  3K9O B;  3VTU A;  1SGH A;  3ZDT A;  5JZE B;  2RPQ A;  2M8S A;  1JRU A;  1WH3 A;  2BKR B;  3QK0 A;  4GGQ A;  4RM8 A;  3VH3 B;  2K8B A;  3RUL A;  4NNJ B;  2KK8 A;  1OTR B;  3DVG X;  2Y5B B;  4GXB A;  1GJZ A;  2LWP A;  3NOB A;  4HDQ A;  4NPN A;  2CHX A;  3L54 A;  2RGF A;  3ONS A;  2CHW A;  4BBN C;  3ZO5 B;  4BOS C;  4CO7 A;  2DYB A;  2MRP A;  3GOE A;  4GU2 A;  4KV2 A;  1WGY A;  3A4S C;  4W9F A;  2NCN A;  3PGE A;  1K8R B;  3KYC D;  1V5O A;  4DWF A;  5KHO A;  5J18 A;  5JHA A;  1E8Z A;  1EUV B;  1WXV A;  4LDT B;  1WZ3 A;  4KIK B;  2ZVO A;  1LFD A;  4WWO A;  3TJP A;  4B9K A;  4WWN A;  2DZK A;  2JZ3 B;  1H4R A;  3B08 A;  3B0A A;  2DZJ A;  2L7R A;  4TUU A;  2LGD A;  4JQW C;  3ENE A;  3RUI B;  1WR6 E;  2ZZP B;  3KUD B;  4URK A;  2N9X A;  3IBE A;  4HPM B;  4WJQ A;  2MBB B;  3HHM A;  1GUA B;  1UD7 A;  4MM3 A;  2L0F A;  4BKS A;  2JZZ A;  1IPG A;  3VVW B;  3KW5 B;  1WX9 A;  4FHJ A;  1YIW A;  4IC7 B;  3ZNZ B;  2JRI B;  3SHQ A;  1V2Y A;  2JT4 B;  3UQB A;  2MA9 B;  4ZDV A;  1TZ1 A;  2JY6 A;  3X0W A;  3QQ8 B;  1Y8R C;  2PJH A;  2V3S A;  3MHS D;  5DCN A;  3A4R A;  1UGM A;  3KYD D;  1OGW A;  3ZLZ A;  2IO3 B;  2L3Z A;  4GDK B;  1Q5W B;  2LVP A;  2XBB C;  3VAW A;  1VCB A;  2LZ6 A;  2KN5 A;  4J6I A;  1F9J A;  5JH5 C;  2MW5 A;  4IM3 A;  1WJ6 A;  4WJP A;  2MBO A;  4I6P A;  3R66 C;  1E7V A;  2R2O A;  2UYZ B;  1GC7 A;  1IP9 A;  3DOW A;  4BVU C;  2N1V A;  4GN1 A;  3R7Q A;  4WWP A;  2JRH A;  4AUQ C;  1Q0W B;  2DYO A;  2K8H A;  3A9J A;  3PSE B;  4NQK E;  4KVG B;  3KUC B;  3ZNI D;  1NBF C;  2JWZ A;  2KDE B;  1GC6 A;  2Z0E B;  2ZEQ A;  2UWQ A;  4NY0 A;  1WE7 A;  2MQJ A;  4FJY A;  1TTN A;  3U30 A;  2DAJ A;  4I6N B;  5L95 C;  2GBM A;  4K1R B;  3PTF C;  5LXH A;  2FIF A;  2WYQ A;  1VD2 A;  3DPD A;  4G0N B;  1YX5 B;  2L76 A;  2A4Z A;  1WMH A;  3H7P A;  1WM3 A;  4GB9 A;  4W9K A;  2M0X A;  3JSV A;  2G4D B;  3UGB B;  4FLH A;  4FA6 A;  3DBL I;  1EO6 A;  2I1K A;  4BOZ B;  1KJT A;  3DDC B;  3QAR A;  5CX3 A;  2ASQ A;  1WZ0 A;  2O2V A;  2KMA A;  2XK5 B;  2R2Q A;  3HM6 X;  4PYU A;  1P0R A;  1WX7 A;  2LXA A;  2K39 A;  3R7R A;  3V60 A;  2LRW A;  1WX8 A;  2QHO A;  2K6Q A;  3VFK A;  4IM2 A;  3VHT C;  1WGD A;  2KD0 A;  2L0T A;  2NS5 A;  3T9L A;  1NI2 A;  4EEW A;  3V6E B;  2NR2 A;  3AU4 A;  4TQ0 A;  3EEC A;  4HLE A;  4ICU A;  4ANV A;  2DAF A;  4ANU A;  1KOT A;  2KQS A;  4G3X B;  3PV1 A;  2AEH A;  2DHZ A;  2JUO A;  4ZYN A;  1XQQ A;  3VH4 B;  3W1S A;  2CHZ A;  2ZPY A;  4E74 A;  2J0K A;  3WAM A;  2G45 B;  5JHB A;  3UF8 A;  3VUW A;  3ZVV A;  1RAX A;  2AL3 A;  2G3Q B;  2GMI C;  4GMV A;  4DHZ B;  1WJ4 A;  2MP2 B;  1S1Q B;  2J0J A;  4GSW A;  5GMV A;  3WA0 A;  2BWE S;  2NVU I;  4BFR A;  4PS8 A;  5E6O A;  3C0R B;  3L17 A;  4HXD A;  3AI5 A;  5D2M B;  5AZG A;  3Q3F A;  3RCZ A;  4WQO B;  1ZGU B;  1ZW7 A;  3DBR I;  3ZNG C;  3IG3 A;  1HE8 A;  2XEW A;  2CU1 A;  4MJS B;  3CST A;  4P7I A;  3ZRF A;  3EC8 A;  1A5R A;  4LJO B;  5TR5 A;  3PLU A;  3PRE A;  3HM3 A;  2D2Q A;  1I35 A;  2KNB A;  4BKS D;  1GG3 A;  3GZN I;  4HK2 A;  3H1U A;  4MH0 E;  3RD2 A;  3VDZ A;  2CS4 A;  1WGR A;  3A33 B;  1WR1 A;  2WX1 A;  2BYF A;  4TQ1 A;  4ANX A;  1WIA A;  3DVN U;  1YJ1 A;  4KSK C;  2LGX A;  1P98 A;  2V4L A;  3L0W B;  1E8X A;  2BWF A;  3OJ3 A;  4HWI B;  4NJ6 A;  3RZW C;  3WAN A;  3OAW A;  5CHW A;  2FAZ A;  3APF A;  4KIK A;  1PQS A;  1L7Y A;  3IVF A;  3JYU A;  3MTN B;  2WWZ A;  1E8Y A;  3TMP B;  2BYV E;  2FCN A;  4MSM B;  1J0G A;  2EKE C;  2FNJ B;  2N4F A;  4EZK A;  3JW0 X;  4K7U A;  3WIM A;  1GNU A;  5DPW A;  5IAA C;  3NS8 A;  3V61 A;  4GIV A;  1P9D U;  4FAD A;  2N7D A;  2YVC A;  4PYZ A;  3SD5 A;  1X1M A;  2KDB A;  3TCA A;  1YX6 B;  3OLM D;  2KLC A;  4KDL B;  4OVU A;  4F8C B;  4GOC A;  1UBQ A;  1WY8 A;  4JLC A;  4MJS A;  3A1Q A;  3DBH I;  1LQB A;  2JVC A;  3L10 B;  4FUL A;  3ALB A;  4ZRI A;  4AJW A;  3TIX A;  4DDG D;  4W9D A;  2KKC A;  1S3S G;  2LJ5 A;  2IO2 B;  3UQA A;  4FN2 A;  2W9N A;  3NY5 A;  4ZRK A;  4B6W A;  5EDS A;  2XK5 A;  4GDL B;  1E5W A;  2N9P C;  4FJZ A;  4NAW A;  3APD A;  4HCN B;  4JL9 A;  2ZNV B;  4LJP B;  1I42 A;  4G50 A;  2C5L C;  3AXC A;  2EMS A;  3EFU A;  3ECI A;  3ZNH B;  3QHT A;  2NBW B;  3ZIM A;  2M4N A;  3RT3 B;  3VTV A;  4F1S A;  4II2 B;  1IYF A;  4W9H A;  2GBK A;  1V9J A;  4EZL A;  1R4N I;  3HIZ A;  3A9K A;  3TL5 A;  1C3T A;  3WAL A;  1WM2 A;  2L05 A;  2OJR A;  2GBJ A;  1V49 A;  2MWS B;  1D3Z A;  2KWU B;  3W1S C;  3QX1 A;  4LDT D;  2MSE D;  4MGI E;  4W9G A;  3R3M A;  4WJN A;  2GOW A;  1BT0 A;  3CF6 E;  2PE9 A;  3VTW A;  2I1J A;  2NPT B;  4IWO A;  3WAP A;  1WGH A;  3KH0 A;  4GDK A;  4IG7 B;  2KFK B;  2O2V B;  2KJ6 A;  2KWV B;  2KC2 A;  3TBL D;  3HK0 A;  4A3O A;  2G4S A;  2ZJD A;  2HD5 B;  3I3T B;  1TGZ B;  5L83 A;  2IO0 B;  3H6N A;  4ASW C;  1SIF A;  4IWQ A;  4NQL B;  4TV3 A;  2C7M B;  5FR6 A;  1EF1 A;  4K7W A;  5LLI A;  2D10 A;  3S2A A;  4M0W B;  2DYM A;  2KX0 A;  4HPL B;  4BKG A;  1UBI A;  4W9I A;  2CKH B;  4EOY A;  3PHX B;  2LI5 A;  5AZF A;  4EFO A;  3QC8 B;  2KTR A;  2AL6 A;  1ZKH A;  3SU8 X;  3QWZ B;  2DEN B;  2KLG A;  3U8Z A;  2BPS A;  5DPS A;  3ZRC A;  3WAO A;  2ZVN A;  3ZTD A;  2O6V A;  2LRU A;  3PZD A;  2KTR B;  3L16 A;  4DHJ D;  3PT2 B;  2ZNV C;  3NZU A;  4LCD E;  4W9E A;  1J19 A;  2D11 A;  4ICV A;  4HCP B;  4WAA A;  2MCN B;  3JVZ X;  4EKU A;  1TBE A;  2YLM A;  3IFW B;  4E3C A;  2LUE A;  2RD0 A;  4AP4 C;  1OQY A;  4ANW A;  2BYE A;  3PS6 A;  4FBJ B;  3B1L X;  5G2N A;  3OJ4 B;  5AEK B;  2ZPN A;  2LD9 A;  5CTR C;  3QJZ A;  5HKH A;  2MLB A;  2KDI A;  4HDO A;  2LVQ A;  2KC1 A;  4WJO A;  2DX5 B;  1H8C A;  1OEY J;  2AWT A;  1V5T A;  1SE9 A;  3PRZ A;  5AZH A;  1WXA A;  2KQ7 A;  2O6V B;  3ZTC A;  4PS7 A;  4F7Z A;  3U7D A;  4AJY B;  2KFK A;  1R4M I;  4DBG A;  5CHF A;  1RLF A;  1WGG A;  4A20 A;  4DDI D;  2MX2 A;  5G55 A;  3N30 A;  4PS3 A;  2IY0 B;  2JPH A;  2BF8 B;  2KJH B;  4W9C A;  2KJR A;  1V6E A;  2NPT A;  3N32 A;  4K81 A;  2K1F A;  2K25 A;  3ML9 A;  2PPH A;  3UIO B;  2IO1 B;  1WYW B;  2HE7 A;  3APC A;  2L8J A;  3PVL A;  3T8M A;  3ZKJ C;  2HTH A;  4OVV A;  1WI0 A;  2N9E B;  1RFA A;  3AU5 A;  2BGF A;  4IW0 A;  2FCM A;  2L00 B;  2FID A;  2DZI A;  1RRB A;  2DZM A;  4M8N A;  4MGK E;  2VRR B;  5J17 A;  1L2N A;  1T0Y A;  3KVF B;  2LVO A;  1P3Q U;  3JSV B;  3QA8 A;  1Q1O A;  4E71 A;  4IUM B;  2N7E A;  2LAS A;  1WMH B;  3X23 A;  2Z59 B;  3PLV A;  4B95 A;  3H7S A;  3PHW B;  4YL8 A;  2Z0D B;  2D07 B;  3QIJ A;  3AUL A;  4JIO U;  3DBS A;  4NJ7 A;  4W9J A;  2ZCC A;  3PRM B;  4XZ4 A;  2FUH B;  4FHK A;  1WE6 A;  1YQB A;  2LXC A;  4CHK A;  2LGY A;  1E90 A;  1UZX B;  4ZRJ A;  1EF5 A;  3VQI A;  4HJK A;  2IYD B;  2M17 A;  2KWC A;  1E8W A;  2KVR A;  4KSL C;  2FCQ A;  3QAQ A;  4DHJ B;  5IA7 A;  2PEA A;  3A9J B;  2N1W A;  3PRP B;  4N9F 4;  1LM8 B;  2RR9 A;  3CMM B;  1E7U A;  1V80 A;  2KHW B;  1WFY A;  3M62 B;  1G6J A;  2IBI B;  4KZC A;  3M63 B;  2NBU A;  2NBV B;  2C60 A;  3MJW A;  3K9P B;  4G11 A;  2A5U A;  2KTF A;  4XC2 A;  3SDL C;  3VXW A;  5D6J B;  1AAR A;  1YD8 U;  1Z5S B;  4KDI C;  3UIP B;  1WRD B;  1UEL A;  3W1Y A;  2MBH A;  3Q3J A;  1WJU A;  4MEM A;  4AOF A;  3A1Q B;  2EMT A;  2KO3 A;  2KDF B;  4MGY E;  3N3K B;  5BO4 B;  2FCS A;  1V81 A;  4AWJ A;  5C23 A;  1WJN A;  1QZE A;  2C7N B;  3ML8 A;  3NHE B;  3ZDM C;  2MBE A;  4FJV B;  3BY4 B;  4X57 B;  3QCA A;  2O6V D;  3O65 B;  4HVB A;  3ZW3 A;  1WF9 A;  2C7H A;  1ISN A;  3VUX A;  4EUT A;  2BKF A;  2C9W B;  4MGZ E;  5KHQ A;  3LDZ E;  4RMA A;  1FXT B;  4BBN F;  3D32 A;  2CR5 A;  1J8C A;  5DPR A;  1XT9 B;  2KFJ A;  4TKN A;  2M1M A;  2KOX A;  3M95 A;  1KM7 A;  4EZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...