2GBRA

Crystal structure of the 35-36 moad insertion mutant of ubiquitin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
b'MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGRWALAIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structures of Ubiquitin Insertion Mutants Support Site-specific Reflex Response to Insertions Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 77
sequence length 77
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2gbrA00
4EFOA 2O6VD 1WR6E 3VTUA 4E74A 4BKSA 1V81A 3VTVA 2BF8B 1CMXB 2KTRA 4W9HA 2C7NB 1WXSA 5J18A 2KANA 4ZRKA 4LJOB 2DYMA 2ZCCA 3DVGY 5G2NA 2GBRA 4MGYE 2FCSA 3KYCD 1WH3A 1L2NA 4F8CB 2JRHA 1LM8B 4DXAB 1WJNA 2HTHA 3KYDD 1E7VA 1GUAB 3AI5A 4ZYNA 2LGXA 2IBIB 4EZLA 5AZGA 3VXWA 2LASA 3CSTA 3RD2A 1U4AA 1TGZB 3WA0A 5D2MB 2IYDB 2MWSB 2M4NA 3NOBA 1H8CA 4ZRJA 1V2YA 2LRWA 4GIVA 1WY8A 2N9PC 3M95A 4HDOA 3U30A 5BO4B 4FADA 2FIDA 1OQYA 1EF1A 1QZEA 4HCPB 4MM3A 5JHAA 1E8ZA 2LWPA 2PJHA 2KDEB 3QQ8B 4IW0A 2NR2A 2FCNA 2KVRA 4IG7B 1WGGA 4K7UA 2ZCBA 3DCGA 4DWFA 3Q3FA 4WJOA 2LI5A 4RM8A 1KM7A 3ONSA 4FHJA 1L7YA 1IPGA 1XD3B 2LD9A 4IUMB 3TL5A 3WANA 3ZDTA 4ASWC 2KWVB 1J8CA 1WR1A 4AJYB 2DAJA 1GC7A 2C60A 4NPNA 2Z0DB 3ZVVA 1E90A 2DYBA 2JWZA 1WI0A 3OJ4B 3OAWA 3TJPA 4IWOA 1ZGUB 4DDID 1T0YA 3K9OB 4GOCA 1TBEA 2MBEA 3JSVB 3KUCB 4X57B 2DX5B 2MBQA 3NZUA 4GB9A 3DDCB 1BT0A 4FJVB 4K1RB 2JXXA 2L0FA 1WXAA 1TZ1A 4FJYA 1E8YA 2XEWA 3H9DA 4EEWA 2J7QB 2V4LA 4AJWA 2O6VB 1UZXB 3VAWA 1WM2A 4NQKE 5JZEB 1YX5B 2LRUA 4HPMB 1WJUA 2WWZA 2YVCA 2DZJA 3IFWB 4KDIC 2CU1A 4BKSD 1Q1OA 3A9KA 1GNUA 2O2VB 1WX7A 4KIKB 3ZTDA 4RM9A 2BKFA 5D7GA 2FCMA 3MTNB 4W9EA 4EKUA 1AARA 1V5TA 1EUVB 2ZNVB 1VD2A 3UIPB 2J0KA 2LJ5A 4NNJB 4GDLB 1VCBA 3W1SC 3T8MA 3ZUNA 3B0AA 2Y5BB 4JQWC 1RAXA 2G4DB 4FA6A 3V62A 3ZTCA 3N30A 2PPHA 5AEKB 4RMAA 2MBOA 4KSLC 1ISNA 4K7WA 3QK0A 4JLCA 3A9JB 2KMAA 1EF5A 1Z5SB 4B6WA 3B1LX 4DBGA 2NBUA 4ICUA 1WJ6A 2NCNA 3DBLI 4N9F4 4G50A 5CTRC 2NPTB 3L10B 3V6CB 3ML8A 4I6NB 3QA8A 1WMHB 1P3QU 2MA9B 2OOBB 1WGRA 4PS7A 3M3JA 3GOEA 1WYWB 1S1QB 2BGFA 1HE8A 1WRDB 4I6PA 1V5OA 2FAZA 2KO3A 2L8JA 2CHWA 3R66C 2MCNB 3X23A 3PTFC 1YIWA 4OVVA 5E6PA 1YD8U 2KC2A 4HLEA 4GN1A 2XK5B 2PEAA 2EMTA 4BBNC 1LXDA 2DZIA 2JPHA 1X1MA 4MJSB 3A1QB 3EC8A 1PQSA 1YX6B 2XBBC 1P98A 2ZEQA 1RFAA 5LXIB 3V60A 1P9DU 3RULA 1V9JA 3PSEB 2IO1B 2KJ6A 2JRIB 3PREA 3SDLC 2EMSA 1JRUA 1C3TA 2EKEC 2MP2A 2KJRA 3H6NA 1WXVA 2C5LC 3HIZA 4IWQA 4W9GA 4PYZA 3WIMA 1UD7A 1ZW7A 2LXAA 2ZPYA 2LXCA 4MGIE 4AOFA 2ZJDA 3CSFA 2KX3A 3S2AA 4ZRIA 2DYOA 4MSMB 4PS3A 2K8BA 4BOSC 3HM3A 4WJPA 4CHKA 2GBJA 4JIOU 2DENB 2AEHA 3I3TB 5J17A 4W9CA 1UBQA 4BFRA 2LVPA 2KDFB 5KHOA 2N7EA 4LDTB 2RR9A 3NZSA 4GGQA 4JGHB 1D3ZA 4G0NB 2L0TA 4TV3A 3DVNV 3UF8A 2LGDA 4E71A 1J0GA 1I42A 1M94A 5CHFA 2KQ7A 4HK2A 3B08A 4LCDE 3ZNID 1R4NI 1E7UA 3QWZB 4G3XB 2K39A 4J6IA 4EUTA 5LLIA 3PRMB 3W1SA 3UQAA 4GMVA 2PE9A 2L3ZA 2W9NA 3VDZA 1YQBA 3ECIA 1OTRB 3H1UA 4BBNF 5IA7A 3NHEB 2C7MB 3P2BA 2RGFA 5CHWA 3QARA 1RLFA 2J0MA 1UELA 1Y8RC 2NBWB 2WYQA 1P1AA 4MH0E 3SU8X 3VH4B 2HE7A 2MW5A 3QC8B 2FCQA 3LDZE 2D10A 2KK8A 5G55A 2MX2A 4PYUA 4DHZB 1WX9A 2KNBA 3W1YA 1GJZA 2KC1A 1C1YB 1OGWA 2QHOA 1R4MI 3DBRI 2MLBA 5AZHA 2K25A 2K8HA 3RCZA 3AULA 3UIOB 2K1FA 4EOYA 2CHZA 2GBKA 2LVQA 1WZ3A 1YJ1A 4II2B 2NVUI 5E6NA 4WQOB 2M1MA 3EFUA 3PHXB 2IY1B 2L7RA 3H7SA 3ZLZA 3A9KB 2JZZA 2IO3B 2NBVB 2KQSA 3KH0A 3PLUA 4K7SA 3VUYA 1GC6A 4HPLB 4FLHA 3ZNGC 3L54A 2NS5A 2V3SA 4KSKC 4OVUA 2UYZB 3OLMD 4AWJA 2D11A 1WZ0A 2BYFA 2FNJB 3ZNHB 2KX0A 4GDKA 5LXHA 4ANXA 3HK0A 4KV2A 4LDTD 3H7PA 3VTWA 3ML9A 2J0JA 2GBMA 3KVFB 1TTNA 2M8SA 3L13A 3L0WB 4MEMA 1OEYJ 4P7IA 3PVLA 4XX5A 3R7RA 1WE7A 4GDLA 3UINB 3KUDB 4XZ4A 1EO6A 4MGKE 3TIXA 1KOTA 5D94A 2DAFA 4KVGB 3OJ3A 3VHTC 2KZRA 1WE6A 1RRBA 1FXTB 1WGHA 2IO2B 4W9JA 1GG3A 2KHWB 4YL8A 4HWIB 3M62B 1IYFA 2I1JA 2KFKA 3RT3B 1J19A 2DHZA 2LVOA 3PZDA 4WWNA 4NAWA 4WWPA 3QAQA 4DDGD 2V1YA 3PGEA 2KWCA 3DBSA 4CO7A 2AYOB 1P0RA 4IWPA 4AP4C 2KJHB 3RYTA 3NS8A 4E3CA 3APFA 2PE6B 2B3AA 2BYVE 4NJ6A 3KW5B 5TR5A 4F1SA 3HM6X 2JY6A 2LZ6A 4HJKA 2GMIC 2JF5A 2JUOA 1SE9A 2KKCA 3IHPC 4CYEA 2ZNVC 4JL9A 3RZWC 3NY5A 4HCNB 2KLCA 2BKRB 2K8CA 4KZCA 3T9LA 3V61A 2CS4A 3QCAA 2G4SA 2LGYA 4II3B 4MJSA 4IM0A 5C1ZA 2A4ZA 3PPAA 2KTRB 2MP2B 2KD0A 3A33B 3ZO5B 4URKA 2C9WB 3AU5A 3GZNI 2C7HA 4EZKA 1WGDA 1S3SG 4BOZB 3DBHI 3L08A 3ALBA 4WJNA 1K8RB 2KLGA 1WXMA 1E8WA 3U7DA 4A3OA 3UGBB 5HKHA 2IO0B 2K6DB 2AL3A 1H4RA 1WX8A 3QJZA 3VQIA 2N1WA 2FIFA 5J2RA 3EECA 2RPQA 1NDDA 2N4FA 2KN5A 3JYUA 1I35A 3VFKA 4KDLB 2M17A 3IBEA 3CMMB 5JHBA 4ANUA 1NBFC 3WAMA 5DPWA 2L76A 3K9PB 2KXJA 4MGZE 3V6EB 1WIAA 2N9XA 3C0RB 3D32A 4M0WB 4TQ0A 4A3PA 3BINA 3JVZX 2KDBA 2GBNA 1V49A 5EDSA 1XT9B 2IZVB 3UQBA 3R3MA 2BWFA 1G6JA 4HXDA 3PS6A 1WM3A 3WALA 4IM2A 2A5UA 3M63B 3ZNZB 3SD5A 3ZW3A 4ICVA 4A20A 3IG3A 4KZ0A 3ZDMC 5E6OA 3R7QA 2R2QA 1E8XA 1SIFA 2WX1A 4PS8A 2RD0A 5CHVC 4IM3A 4FBJB 2REXA 3TBLD 1UBIA 4EZJA 3ENEA 2MSED 2AL6A 4XC2A 2KDIA 1V6EA 3L16A 2KWUB 4M8NA 4MELA 4FHKA 4IC7B 3N3KB 3X0WA 4DHJD 2N9EB 2FUHB 1MG8A 5L83A 2G3QB 2D3GA 2MRPA 3JSVA 3AXCA 2N7DA 3DQVA 4MDKE 3VUXA 3O65B 2LUEA 3HHMA 3LJ3A 3N32A 4WJQA 2DZKA 4W9KA 4AUQC 2GOWA 2HD5B 4W9LA 3ZIMA 4W9FA 2KTFA 3PRZA 2O6VA 1XQQA 5JH5C 4W9IA 2G45B 2ZZPB 1UGMA 3QX1A 4HDQA 1Z2MA 1F9JA 3WAPA 1KLVA 2N1VA 5L95C 4W9DA 4FJZA 4FN2A 2O2VA 4KIKA 3QHTA 3ZKJC 3TCAA 5D6JB 2AWTA 3APCA 3PRPB 3QIJA 3SHQA 3L17A 3CF6E 3VH3B 3PLVA 4MSQB 2ZPNA 3A4SC 2VRRB 3DVNU 5FR6A 2JZ3B 4GDKB 2Z0EB 1OEYA 5IAAC 1IP9A 2DZMA 3PHWB 1Q5WB 2YLMA 4G11A 1SGHA 2K6QA 5CX3A 2D2QA 4DK5A 3H7PB 2HJ8A 3IVFA 4F7ZA 2JVCA 5DPSA 4WAAA 4TQ1A 1WF9A 5DPRA 1Q0WB 2ZVNA 2WX0A 2KFJA 4BKGA 3ZRFA 4ANWA 3PV1A 2MBBB 3ZRCA 2ASQA 1WGYA 4I6LB 3WAOA 1WJ4A 2UWQA 3BY4B 4LJPB 3AU4A 1NI2A 2Z59B 3DVGX 3Q3JA 4K81A 4WWOA 3A9JA 3PT2B 3VUWA 2L00B 2R2OA 2L05A 5C23A 2CR5A 2MQJA 3JW0X 2BWES 2NPTA 2KFKB 2OJRA 1LQBA 1E5WA 2WDTB 4B9KA 4ZDVA 4NAWB 4NJ7A 1WMHA 3RUIB 2JT4B 3APDA 3VVWB 1A5RA 2BYEA 4HVBA 3MHSD 3A4RA 4NQLB 4TUUA 5DPTA 4GXBA 3TMPB 2ZVOA 1V80A 3DPDA 5GMVA 2CKHB 2CHXA 2I1KA 2IY0B 1KJTA 2D07B 2M0XA 2XK5A 4TKNA 2KOXA 4B95A 4DHJB 4BKTA 1V86A 3A1QA 4FULA 3U8ZA 3EHVA 4GSWA 2BPSA 3DOWA 4DHZE 3MJWA 2MBHA 4NY0A 5DCNA 4GU2A 1LFDA 1ZKHA 2RSUA 3KUZA 4M8MA 3RZFA 5KHQA 4ANVA 4BVUC 1WFYA 5AZFA 1UH6A 2KMCA
chains in the Genus database with same CATH superfamily
4EFOA 1WR6E 3FC4A 3VTUA 3U52E 4W9HA 2V9HA 1WXSA 4ZRKA 2I38A 2ZCCA 3HVZA 4MGYE 2FCSA 1WH3A 3BVMA 1K53A 4P16A 3AI5A 1ZUD2 3VXWA 3RD2A 2MWSB 2FUG1 2INPE 3FILA 1F52A 3M95A 3GS2A 5BO4B 4FADA 1OQYA 1EF1A 1CZPA 3RNAC 4IW0A 3QQ8B 2KVRA 4IG7B 2BYTA 3Q3FA 4WJOA 2LI5A 4RM8A 1C4AA 5IP4D 5C2TB 2I2YA 4FHJA 1XD3B 3WANA 1J8CA 1QQRA 4ASWC 1PUTA 1QOAA 5G5GA 1VRAB 2MJEA 1UGJA 2XN9C 2BW2A 4R3DA 4RF1A 4GOCA 1TBEA 3AEBB 2DX5B 3AECB 4EEWA 1GPXA 4AJWA 5FKAC 1YX5B 1YOVB 2DZJA 2CU1A 1Q1OA 1PYWD 3I63C 1GNUA 1V5TA 1N62A 2WQYB 1L6VA 4C80A 4NNJB 2PMVA 2WDRB 1VCBA 3B0AA 5BYRA 3AE7B 1LO5D 2G4DB 4JX1C 2KQ4X 3V62A 3CIRB 4FXCA 1ZXHA 3NVWA 3O13A 3QK0A 5IO9A 2KMAA 2NBUA 4HRSA 3DBLI 4OHJA 3P4QB 5CTRC 3L10B 1WGRA 3M3JA 4LK0M 3GOEA 4I6PA 3R66C 4L23A 3N1XC 5E6PA 3EA6A 4HLEA 4O1NA 4YSYB 4MJSB 3AB5A 3EC8A 2XBBC 3DBRB 5LXIB 3IAM1 4RH6A 1V9JA 2JRIB 2RDGA 2M0AA 1SSNA 1JRUA 1NENB 1ZOYB 3H6NA 4PYZA 3LB8C 2ICIA 2LXAA 1JWSD 2LXCA 3NVVA 1TKGA 4MSMB 1B9RA 3PO0A 1GOZA 2GBJA 3I3TB 4W9CA 3ZQ4A 2QIEB 1UBQA 3E9SA 2PIAA 1VR9A 2KDFB 4XWWA 4MH8A 3FILB 2RR9A 2V3NA 4TV3A 3UF8A 2LGDA 1I42A 1ZXIA 4HK2A 3AE8B 3W1SA 4GMVA 2PE9A 3ECIA 5IA7A 2C7MB 3VR8B 4LTUA 3VH4B 1Y8RC 2WYQA 4HKZE 4MH0E 3SU8X 2D5GA 2TSSA 2D10A 4S0RA 2KK8A 2KNBA 2KC1A 1C1YB 2QHOA 1R4MI 3L4PA 3DBRI 2QCZA 2K1FA 4D2KA 5BMGA 2JQRB 3SEBA 1C4CA 1UWMA 4US9A 3H7SA 3ZLZA 1P7EA 1XCTL 2NBVB 3KH0A 3PLUA 1GC6A 3N1YC 3MFGA 2V3SA 4KSKC 4ARIA 2BYFA 4OVZA 2KX0A 3HK0A 2K22A 4LDTD 2GBMA 1C77A 3AE4B 3UINB 4XZ4A 1C9FA 4MGKE 2Q5WD 2HTME 3OJ3A 4K3CA 1WGHA 4W9JA 2M19A 3I9V1 1FCCC 2KVZA 2KHWB 4HWIB 3W9CB 3Q2AC 1J7CA 4OW0A 3NRZA 2OEDA 3PZDA 4WWNA 4WWPA 3VRAB 4IWPA 1SIJA 5AUKA 2KJHB 2JU6X 4NJ6A 3KW5B 4HJKA 2GMIC 2JUOA 2KKCA 4CYEA 2D3CA 3T9LA 4JL9A 3U7ZA 1KRHA 1ROEA 2DBYA 4II3B 4IM0A 1CK1A 2ON8A 1SE2A 5C1ZA 1V1OA 2KD0A 3A33B 1NEKB 4EZKA 4ZHPA 1CQVA 1T6BX 3HRDD 4A8XC 4RGTA 1FMAD 3KQ4A 4A3OA 5HKHA 2W82A 1GB1A 3QJZA 4AS1A 1NDDA 1I35A 3JYUA 2WS3B 3IT6B 1EU4A 1SXTA 1TKEA 1JROA 4GLSC 3BINA 1XT9B 3TEYA 2LHEA 2MEKA 1AN8A 4XDDA 2PKOA 3ZW3A 3SD5A 1WWTA 4KZ0A 3ZDMC 2WX1A 1IUEA 2AL6A 4WAFA 3L16A 2Y3AA 4DHJD 2FUHB 5L83A 2G3QB 2QSDA 4MDKE 3W2DA 2LUEA 4W9KA 1YJJA 1FFVA 2V0GA 4C7YA 1YN4A 1D6EC 3BVZA 1Z2MA 3Q8EA 2O2VA 4KIKA 2CU3A 3APCA 1YQ4B 3SHQA 2WU2B 2QDFA 2VRRB 1N6ZA 1OEYA 5CX3A 4DK5A 3I5JC 1DGJA 1NYRA 4BKGA 3ZRFA 1WGYA 2KN4A 2UWQA 1NI2A 2Z59B 1NI3A 1FNVA 3VUWA 4QAYA 1J7AA 1JMLA 4B9KA 3UI3A 2SEBD 3VRBB 1ACCA 2JWUA 2ZVOA 3DPDA 3RNGC 2CKHB 2XK5A 2D07B 4TKNA 4DHJB 3ZXRA 3U8ZA 2BPSA 2IGHA 2BB6A 1ZKHA 5KHQA 4ANVA 2BBCA 3NVZA 4BVUC 1I4GA 1V1PA 4RFBA 1KFYB 1VZ8A 1V81A 1CMXB 1JWUD 2KTRA 5J18A 2KANA 1I4QA 2DYMA 3DVGY 1VLBA 3KYCD 4BZAA 1L2NA 4DXAB 2HTHA 1QILA 1E7VA 2RDBC 4NJCA 4ZYNA 2KACA 2IBIB 5AZGA 3NJTA 3CSTA 1FFUA 1NVID 2IYDB 2MJDA 4YWGG 4ACFA 1H8CA 2RMMA 1V2YA 2GB1A 2LRWA 4GIVA 3VR9B 4B0EA 1D5ZC 2FIDA 1Q10A 4HCPB 3RMKC 4MM3A 5JHAA 1E8ZA 5BYQA 2L1AA 1KM7A 1PGAA 5I4DA 1WR1A 2DAJA 3I57A 2BTEA 1GC7A 2C60A 1EWYC 3ZVVA 3OJ4B 3TJPA 4IWOA 5EE0A 3PZ7A 2MBQA 1BT0A 4K1RB 1N61A 5E6JA 1WXAA 3NVYA 1E8YA 2XEWA 3H9DA 3P42A 2V4LA 5JZEB 5BMHA 3B9JA 4KDIC 3A9KA 2O2VB 1WX7A 4KIKB 3ZTDA 5D7GA 3U2SC 5D3DA 2ZNVB 3UIPB 3DBHB 4ZOHC 3T8MA 4JQWC 1YN3A 5IOIA 1TS4A 3EUB2 5AEKB 2JYEA 3MJ5A 4NAMA 1RM6C 3TUOA 4DBGA 1D4BA 1WJ6A 3R8BA 3V6CB 3ML8A 2OOBB 1WYWB 1YIWA 1YD8U 4IOIE 4GN1A 2XK5B 3P4PB 1X1MA 1YX6B 2WXLA 1P98A 4WIPA 1RFAA 3OWEB 3V60A 1P9DU 3RULA 1KF6B 2JXTA 2KJ6A 1T5XD 2EMSA 1E10A 4XYCA 1V1PB 2EKEC 4W9GA 1WXVA 3HIZA 2CJOA 3AE2B 2YEPB 4MGIE 4ARCA 4P1BC 3GP7A 4N59A 2DYOA 4PS3A 4BOSC 3HM3A 4WJPA 2Y5PA 5HI1A 1ESFA 2EKIA 2AEHA 2AQ1B 2LJIA 2MHJA 5H8YE 3Q8CA 2INDC 4L1BA 1FPYA 5IN7A 4M0WA 4MM3B 5CHFA 1VJKA 1UUPA 3ZNID 1E7UA 2LUMA 3QWZB 4EUTA 3PRMB 1Y56A 2K5PA 2L83A 4WQMA 2FBWB 2NMQA 4M02A 1OTRB 1WRIA 3NHEB 1GB4A 2IJ0A 3AE9B 3GB1A 2J0MA 4TMAB 2MW5A 1MHHE 4RGOS 5JXVA 1WX9A 4RGNA 2L32A 1GJZA 3BK1A 2MLBA 3RCZA 2JSVX 3ZJTA 2CHZA 2GBKA 1WZ3A 2NVUI 5E6NA 3PHXB 3A9KB 2JZZA 2IO3B 2K3UA 4FLHA 1SF0A 3ZNGC 2NS5A 4OVUA 2QJLA 4LNNA 4USAA 1BXTA 3RN9C 2D11A 1QKZA 2WXIA 2WXHA 1L0XB 2KWDA 1IBXA 3IAS1 3NG0A 3H7PA 1OFFA 1VDVA 3L13A 3L0WB 3R7RA 1OEYJ 3PVLA 4XX5A 1WE7A 4GDLA 1EO6A 1KOTA 2DAFA 1SE3A 3R2TA 3C8YA 1D5MC 4H2AA 4YL8A 4YTMB 3ZJUA 4ZRQA 4M01A 1IYFA 4PK1A 2DHZA 3QAQA 2V1YA 4CO7A 5HG2A 4AP4C 2H88B 3APFA 2PE6B 3LYYA 3HM6X 2JY6A 5EE1A 1SE9A 3IHPC 2BKRB 4KZCA 3QCAA 2AX5A 2G4SA 1B1ZA 3ZO5B 1SBBB 4URKA 2ACZB 1S3SG 4DQOC 4BOZB 3L08A 3ALBA 2MH7A 4WJNA 2KLGA 1WXMA 1ZDXA 2AL3A 2UU7A 2PLPA 5J2RA 2JX5A 2RPQA 3VFKA 5JHBA 4ANUA 2GRIA 2L76A 2KXJA 4MGZE 3V6EB 2N9XA 2OHFA 4M0WB 4A3PA 3JVZX 1V97A 4HEA1 1PGXA 2Y5CA 4KGTA 3SR6A 3UQBA 3R3MA 1G6JA 4IM2A 2A5UA 3M63B 1TY0A 1ET6A 2RD0A 1MPEA 4IM3A 3V05A 1FNWA 4EZJA 5LNK1 1SJED 2KDIA 1V6EA 3X0WA 4IC7B 2N9EB 4JWUC 3JSVA 3CWIA 3W5UB 3VUXA 1E7PB 3O65B 2VZKD 4WJQA 3KWLA 1HXYD 4AUQC 2HD5B 4W9FA 2KTFA 4P1CC 4HDQA 2LGSA 1F9JA 2N1VA 5L95C 3BYYB 4FJZA 1OQQA 4FN2A 1GAQB 3Q8AA 1TS2A 5D6JB 3PRPB 3VH3B 3CF6E 4KX6B 5FR6A 4A55A 2JZ3B 3KLSX 2N9KA 1IBXB 2DZMA 3PHWB 4G11A 3RPFC 2K6QA 4M00A 2D2QA 3H7PB 1C78A 2HJ8A 2JVCA 5DPRA 3HUIA 1Q0WB 4MACA 1FEHA 3BZDB 3AEGB 2MBBB 3ZRCA 2ASQA 1MG4A 3Q3JA 4WWOA 3A9JA 1ZP0B 1TZOA 1TS5A 2R2OA 2D3BA 2L05A 2CR5A 2BWES 2NPTA 2OJRA 3N9YC 2JT4B 3APDA 1A5RA 1ZE3D 3Q3MC 2KT7A 3A4RA 4TUUA 2CHXA 1L4DB 3ZGZA 4B95A 2M0XA 2KOXA 1BUIC 1I4XA 1V86A 3A1QA 3EHVA 4GSWA 1SEBD 2VZKB 2WDQB 4NY0A 4GU2A 4C7ZA 2RSUA 4M8MA 1JWAD 2L52A 3ZYYX 1RFKA 3P1MA 1NYQA 2BF8B 3T3OA 2C7NB 2VH1A 4DXFA 4YT0B 1QF6A 2GBRA 1K52A 4F8CB 4RGMA 3KYDD 2R61A 1GUAB 4EZLA 1T0RC 1FM0D 1TGZB 5D2MB 2WXKA 5TSSA 4ZRJA 3RFZB 2FE8A 4HDOA 3HVDA 3U30A 1XCQL 1QZEA 2WXGA 2LWPA 2IPKD 2PJHA 3RNCC 4K7UA 2ZCBA 2AQ3B 4KGSA 3E56A 1WYGA 3ZDTA 1IPGA 4IUMB 3TL5A 3ZJVA 2KWVB 4N6EB 1STEA 3EFCA 4NZLB 4XGAB 2Z0DB 1C79A 1E90A 2IGGA 1F1HA 2DYBA 4JWSC 3OAWA 4DDID 1T0YA 3BVGA 3JSVB 3KUCB 3NZUA 3AEDB 3DDCB 2JXXA 1DOYA 2WU5B 1TZ1A 5GXGB 3TEZA 2DWQA 1HTQA 1UZXB 1QOGA 3VAWA 4NQKE 2LRUA 1WJUA 2YVCA 2QILA 3GZNB 2BKFA 2FCMA 3MTNB 4W9EA 4EKUA 1EUVB 2LJ5A 3AE5B 1AYFA 4RCOA 3ZUNA 2W55A 1FRRA 3MHZA 2Y5BB 2RPVA 5G5HA 3DHIC 2WXRA 3N30A 2PPHA 2KAJA 4RMAA 2MBOA 3Q6BA 5HHDG 4KSLC 1OQRA 3A9JB 1R4NB 1EF5A 2QMTA 4B6WA 3B1LX 3P4RB 4G50A 2NPTB 4I6NB 3QA8A 2WXJA 1P3QU 1S1QB 2BGFA 1HE8A 2FAZA 2L8JA 2MCNB 2CHWA 3X23A 4JPSA 1E9MA 3PZ8A 2KC2A 3ABVB 3BYTB 4B0MA 1F2RI 2PEAA 3AEEB 1LXDA 2JPHA 3A1QB 1PQSA 2KMMA 4C4VA 2NTSA 3PSEB 1P7FA 1HZ5A 3SDLC 3ETRA 4IWQA 2V4IB 1AW7A 4HPPA 3WIMA 1UD7A 1ZW7A 2ZPYA 3AM9A 3CSFA 3MC0B 4ZRIA 4XE0A 2HDEA 3NZ3A 5J17A 4IKGA 4KKIA 1JWMD 5KHOA 2N7EA 2N0SB 4GGQA 1D3ZA 2L0TA 3NUHB 2PTLA 1AWDA 1TKYA 4E71A 4ZYSA 1M94A 1FXIA 2KQ7A 3AV8A 4LCDE 1R4NI 2K39A 4J6IA 2KDMA 4L2YA 3MC8A 2L3ZA 1MI0A 3VDZA 1YQBA 1F0ZA 3P2BA 5CHWA 3AE1B 1RLFA 1UELA 1P1AA 3LDZE 5G55A 2MX2A 4PYUA 4DHZB 2EELA 2WXOA 2OJWA 1OGWA 5AZHA 4EE2A 4J3OD 2GLSA 3UIOB 1TIFA 3Q3NC 2M56B 1IGDA 2M1MA 3EFUA 2IY1B 2L7RA 3VUYA 4HPLB 2WNMA 2UYZB 4AWJA 2X8XX 2VH2A 3KWVA 2FNJB 3DWMA 3ZNHB 2KYWA 4GDKA 4YTNB 4KV2A 3VTWA 3ML9A 2J0JA 3KVFB 1TTNA 2M8SA 4P7IA 4MEMA 2E3TA 1T3QA 3TIXA 4YTPB 3VHTC 1WE6A 2KZRA 3IT4B 1IGCA 1RRBA 2IO2B 3Q8FA 4C56C 1GG3A 2PVGC 2I1JA 1J19A 2ZW0A 4DDGD 2KWCA 2BQQA 3DBSA 2AYOB 2CJNA 1PFDA 1JQ4A 3RYTA 3NS8A 4HKQA 4E3CA 2B3AA 2YEPF 4F1SA 2LZ6A 2JF5A 4JE3B 4LNFA 1JALA 4C4VB 3TSSA 3NY5A 4HCNB 2KLCA 4OZBA 2K8CA 2LGYA 4MJSA 2A4ZA 2KTRB 4OZAA 3P63A 2AQ2B 3J9CA 1ENFA 1WGDA 1K50A 3DBHI 3T3NA 3U7DA 2K6DB 1WX8A 4RF0A 2FIFA 1N60A 3EECA 2J53A 4CQNA 3CMMB 2WXQA 5MPOA 1NBFC 5H92C 3C0RB 3D32A 2DLBA 4TQ0A 2KDBA 2GBNA 1C76A 1DOIA 1QOFA 2IZVB 1C4PA 1TS3A 2BWFA 3P4SB 3DBLB 4HXDA 3PS6A 1WM3A 1XLPA 4ICVA 4A20A 2WGSA 5E6OA 2V3PA 3R7QA 1EU3A 2R2QA 1E8XA 1SIFA 4PS8A 1E0ZA 2XNAC 3TBLD 3SFEB 2WXMA 2KWUB 4M8NA 4MELA 4FHKA 3N3KB 2ZW1A 1MG8A 1DYQA 1ZDVA 1I4HA 2BB5A 1EWCA 1QLBB 3DQVA 3HHMA 3N32A 4UDUC 3GE8C 1HA5A 2GOWA 3ZIMA 3DWGC 2O6VA 5JH5C 4W9IA 2G45B 2ZZPB 3WAPA 1M4VA 3MC9A 2RDHA 1K51A 1XF5L 2INCC 3TCAA 3AEAB 3QIJA 3L17A 3PLVA 4MSQB 2ZPNA 3A4SC 3DVNU 4GDKB 4OZCA 5IAAC 1Q5WB 2YLMA 1SGHA 3IVFA 4F7ZA 3R2IA 5DPSA 4WAAA 2X38A 1VZ6A 1FO4A 3AEFB 2ZVNA 2WX0A 2WDVB 2W3RA 3PV1A 3WAOA 4LJPB 3AU4A 2QEJC 4K81A 1HTOA 1YN5A 3JW0X 1A70A 1LQBA 4ZDVA 4NJ7A 3W5VB 1WMHA 1DOXA 1TJEA 1UF0A 3MHSD 4NQLB 4GXBA 1V80A 5GMVA 2IY0B 1YQ3B 1KJTA 1L5PA 5C3JB 4BKTA 4DHZE 2JYTA 3MJWA 4TSSA 5DCNA 2G1EA 1LFDA 1R4MB 3H8HA 1WFYA 1UH6A 2KDEB 2KMCA 1RWSA 2O6VD 1CJEA 2HJ1A 4E74A 4BKSA 2GI9A 2N9LA 3AMZA 4REZA 3BK2A 3VTVA 1FD6A 4A90A 3BWUD 1TT5B 4LJOB 5G2NA 2JRHA 1LM8B 1EM7A 1WJNA 2J52A 3IXSA 1F77A 2BT6A 2LGXA 1BMLC 3AE3B 2LASA 4WWMA 1U4AA 1TYGB 3WA0A 4XWTA 3NOBA 2M4NA 1HZ6A 1I4PA 1WY8A 2N9PC 1T0QC 5AUIA 3TEWA 4AQ7A 1XXGA 1ZPSA 1JW9D 4HROA 2NTTA 1YNTE 2NR2A 2PW9A 2FCNA 1I7HA 1WGGA 3DCGA 4DWFA 4US8A 1QT9A 3ONSA 1KLVA 1L7YA 2LD9A 4AJYB 4NPNA 3FKYA 3N1ZC 1YJIA 2JWZA 1WI0A 1ZGUB 3K9OB 2MBEA 4ZRPA 4X57B 4GB9A 3BIID 2BVCA 4FJVB 4S17A 2L0FA 4FJYA 2J7QB 2O6VB 1WM2A 4HPMB 2WWZA 3IFWB 4BKSD 1MFWA 4RM9A 4LNOA 1AARA 2LEKA 3MP9A 1VD2A 5T8IA 2J0KA 2W3SA 4GDLB 1N5XA 3W1SC 3RNBC 1RAXA 3RI7C 4FA6A 2WXNA 3ZTCA 3Q14C 2K9XA 2IDYA 1ISNA 4K7WA 5BMIA 4JLCA 1UWXA 1F2RC 1Z5SB 3Q69A 4ICUA 2NCNA 2B76B 4N9F4 3ZXVA 1WMHB 4PS7A 2MA9B 1WRDB 2WP9B 2INNE 1V5OA 2K0PA 2KO3A 3NS1A 4C00A 3PTFC 4OVVA 4BAXA 3B2FA 2EMTA 4BBNC 1WGKA 1FNUA 2DZIA 4A6QA 2ZEQA 3GE3C 1PGBA 1QOBA 2IO1B 3PREA 2SAKA 1XO3A 1L0VB 3AH7A 1C3TA 2MP2A 2KJRA 2C5LC 1KH0A 2D3AA 4AOFA 2ZJDA 2PVOD 2KX3A 3S2AA 2LHDA 3AN1A 1LGRA 1L0YB 3C19A 2K8BA 4IDIA 5D3IB 5EE9A 4CHKA 4JIOU 2DENB 4BFRA 2LVPA 1I4RA 4LDTB 3NZSA 4JGHB 4Q2JA 4G0NB 1D5XC 3DVNV 1RYJA 1J0GA 3B08A 4G3XB 3TEXA 5LLIA 3UQAA 5BYSA 1SE4A 2WXPA 2W9NA 3H1UA 4BBNF 1JWBD 2WXFA 5EE3A 2LMCA 2RGFA 3QARA 2NBWB 1HEZE 4WH4A 2HE7A 3QC8B 2FCQA 4ITKA 4YSZB 5HFYA 3SFDB 3W1YA 2K25A 2K8HA 3AULA 4EOYA 2LVQA 1YJ1A 4II2B 4WQOB 2KQSA 4K7SA 1MJDA 3L54A 2J4XA 4A9AA 3OLMD 3Q8BA 1WZ0A 5LXHA 4LNKA 4ANXA 5IKCM 1ET9A 3V3XA 4N58A 1N63A 1FCLA 2WLBA 3KUDB 5D94A 4KVGB 2QC8A 1E6EB 1FXTB 3Q3OC 2JZPA 3M62B 1KLGD 2KFKA 3RT3B 1MVKA 2H89B 2LVOA 4NAWA 4K3BA 3PGEA 1MHXA 1P0RA 3OG5A 2IGDA 4KKJA 1L6UA 2BYVE 5TR5A 2LGIA 1XLNA 1HQRD 3B2GA 2ZNVC 3RZWC 3V61A 2CS4A 2BS2B 3PPAA 2MP2B 2J42A 1V8CA 2C9WB 3AU5A 3GZNI 3N20C 2C7HA 3EGRA 5FK9C 3FAHA 1K8RB 1E8WA 3UGBB 2IO0B 5FR3A 1H4RA 3VQIA 2N1WA 1FXAA 2N4FA 2KN5A 2DNFA 4KDLB 2M17A 3IBEA 3WAMA 5DPWA 1WSPA 3K9PB 1WIAA 2E6XA 2BS3B 1V49A 5EDSA 1TY2A 3RNFC 2W54A 4ZHOA 3WALA 4HJGE 3ZNZB 1SB3C 3IG3A 4WURA 4YSXB 2WHIA 5CHVC 4FBJB 2REXA 1UBIA 3ENEA 2MSED 4XC2A 4LNIA 4DXGA 1XEEA 4LLGM 1JRPA 1FRDA 2D3GA 2MRPA 3URYA 3AXCA 2N7DA 3LJ3A 4PT5A 2DZKA 1PDXA 4W9LA 1L4ZB 1T0SC 3PRZA 1KTKA 1XQQA 1UGMA 3QX1A 4W9DA 1R7SA 3AE6B 1WXQA 1KLUD 1UNSA 3QHTA 3ZKJC 3DHGC 2AWTA 3DHHC 2Z0EB 1IP9A 2Z8LA 4TQ1A 1WF9A 2G9HD 2KFJA 4ANWA 3RNEC 4I6LB 2BS4B 1WJ4A 3BY4B 3WCQA 4MT5A 4YXDB 3DVGX 3PT2B 1YMHE 2N7JA 2L00B 5C23A 2MQJA 1FIQA 2KFKB 1E5WA 2WDTB 4P6VF 4NAWB 1N5WA 3RUIB 3VVWB 1JCKB 2BYEA 4HVBA 5DPTA 3TMPB 1J7BA 1VZ7A 2I1KA 2LFIA 3LXFA 4FULA 3U4EG 1XLQA 3DOWA 4XDCA 1XLOA 2MBHA 2ONQA 2MJ3A 3KUZA 3RZFA 4RNAA 1SJHD 4KGRA 5AZFA
chains in the Genus database with same CATH topology
4EFOA 2O6VD 1WR6E 3VTUA 4E74A 4BKSA 1V81A 3VTVA 2BF8B 1CMXB 2KTRA 4W9HA 2C7NB 1WXSA 5J18A 2KANA 4ZRKA 4LJOB 2DYMA 2ZCCA 3DVGY 5G2NA 2GBRA 4MGYE 2FCSA 3KYCD 1WH3A 1L2NA 4F8CB 2JRHA 1LM8B 4DXAB 1WJNA 2HTHA 3KYDD 1E7VA 1GUAB 3AI5A 4ZYNA 2LGXA 2IBIB 4EZLA 5AZGA 3VXWA 2LASA 3CSTA 3RD2A 1U4AA 1TGZB 3WA0A 5D2MB 2IYDB 2MWSB 2M4NA 3NOBA 1H8CA 4ZRJA 1V2YA 2LRWA 4GIVA 1WY8A 2N9PC 3M95A 4HDOA 3U30A 5BO4B 4FADA 2FIDA 1OQYA 1EF1A 1QZEA 4HCPB 4MM3A 5JHAA 1E8ZA 2LWPA 2PJHA 2KDEB 3QQ8B 4IW0A 2NR2A 2FCNA 2KVRA 4IG7B 1WGGA 4K7UA 2ZCBA 3DCGA 4DWFA 3Q3FA 4WJOA 2LI5A 4RM8A 1KM7A 3ONSA 4FHJA 1L7YA 1IPGA 1XD3B 2LD9A 4IUMB 3TL5A 3WANA 3ZDTA 4ASWC 2KWVB 1J8CA 1WR1A 4AJYB 2DAJA 1GC7A 2C60A 4NPNA 2Z0DB 3ZVVA 1E90A 2DYBA 2JWZA 1WI0A 3OJ4B 3OAWA 3TJPA 4IWOA 1ZGUB 4DDID 1T0YA 3K9OB 4GOCA 1TBEA 2MBEA 3JSVB 3KUCB 4X57B 2DX5B 2MBQA 3NZUA 4GB9A 3DDCB 1BT0A 4FJVB 4K1RB 2JXXA 2L0FA 1WXAA 1TZ1A 4FJYA 1E8YA 2XEWA 3H9DA 4EEWA 2J7QB 2V4LA 4AJWA 2O6VB 1UZXB 3VAWA 1WM2A 4NQKE 5JZEB 1YX5B 2LRUA 4HPMB 1WJUA 2WWZA 2YVCA 2DZJA 3IFWB 4KDIC 2CU1A 4BKSD 1Q1OA 3A9KA 1GNUA 2O2VB 1WX7A 4KIKB 3ZTDA 4RM9A 2BKFA 5D7GA 2FCMA 3MTNB 4W9EA 4EKUA 1AARA 1V5TA 1EUVB 2ZNVB 1VD2A 3UIPB 2J0KA 2LJ5A 4NNJB 4GDLB 1VCBA 3W1SC 3T8MA 3ZUNA 3B0AA 2Y5BB 4JQWC 1RAXA 2G4DB 4FA6A 3V62A 3ZTCA 3N30A 2PPHA 5AEKB 4RMAA 2MBOA 4KSLC 1ISNA 4K7WA 3QK0A 4JLCA 3A9JB 2KMAA 1EF5A 1Z5SB 4B6WA 3B1LX 4DBGA 2NBUA 4ICUA 1WJ6A 2NCNA 3DBLI 4N9F4 4G50A 5CTRC 2NPTB 3L10B 3V6CB 3ML8A 4I6NB 3QA8A 1WMHB 1P3QU 2MA9B 2OOBB 1WGRA 4PS7A 3M3JA 3GOEA 1WYWB 1S1QB 2BGFA 1HE8A 1WRDB 4I6PA 1V5OA 2FAZA 2KO3A 2L8JA 2CHWA 3R66C 2MCNB 3X23A 3PTFC 1YIWA 4OVVA 5E6PA 1YD8U 2KC2A 4HLEA 4GN1A 2XK5B 2PEAA 2EMTA 4BBNC 1LXDA 2DZIA 2JPHA 1X1MA 4MJSB 3A1QB 3EC8A 1PQSA 1YX6B 2XBBC 1P98A 2ZEQA 1RFAA 5LXIB 3V60A 1P9DU 3RULA 1V9JA 3PSEB 2IO1B 2KJ6A 2JRIB 3PREA 3SDLC 2EMSA 1JRUA 1C3TA 2EKEC 2MP2A 2KJRA 3H6NA 1WXVA 2C5LC 3HIZA 4IWQA 4W9GA 4PYZA 3WIMA 1UD7A 1ZW7A 2LXAA 2ZPYA 2LXCA 4MGIE 4AOFA 2ZJDA 3CSFA 2KX3A 3S2AA 4ZRIA 2DYOA 4MSMB 4PS3A 2K8BA 4BOSC 3HM3A 4WJPA 4CHKA 2GBJA 4JIOU 2DENB 2AEHA 3I3TB 5J17A 4W9CA 1UBQA 4BFRA 2LVPA 2KDFB 5KHOA 2N7EA 4LDTB 2RR9A 3NZSA 4GGQA 4JGHB 1D3ZA 4G0NB 2L0TA 4TV3A 3DVNV 3UF8A 2LGDA 4E71A 1J0GA 1I42A 1M94A 5CHFA 2KQ7A 4HK2A 3B08A 4LCDE 3ZNID 1R4NI 1E7UA 3QWZB 4G3XB 2K39A 4J6IA 4EUTA 5LLIA 3PRMB 3W1SA 3UQAA 4GMVA 2PE9A 2L3ZA 2W9NA 3VDZA 1YQBA 3ECIA 1OTRB 3H1UA 4BBNF 5IA7A 3NHEB 2C7MB 3P2BA 2RGFA 5CHWA 3QARA 1RLFA 2J0MA 1UELA 1Y8RC 2NBWB 2WYQA 1P1AA 4MH0E 3SU8X 3VH4B 2HE7A 2MW5A 3QC8B 2FCQA 3LDZE 2D10A 2KK8A 5G55A 2MX2A 4PYUA 4DHZB 1WX9A 2KNBA 3W1YA 1GJZA 2KC1A 1C1YB 1OGWA 2QHOA 1R4MI 3DBRI 2MLBA 5AZHA 2K25A 2K8HA 3RCZA 3AULA 3UIOB 2K1FA 4EOYA 2CHZA 2GBKA 2LVQA 1WZ3A 1YJ1A 4II2B 2NVUI 5E6NA 4WQOB 2M1MA 3EFUA 3PHXB 2IY1B 2L7RA 3H7SA 3ZLZA 3A9KB 2JZZA 2IO3B 2NBVB 2KQSA 3KH0A 3PLUA 4K7SA 3VUYA 1GC6A 4HPLB 4FLHA 3ZNGC 3L54A 2NS5A 2V3SA 4KSKC 4OVUA 2UYZB 3OLMD 4AWJA 2D11A 1WZ0A 2BYFA 2FNJB 3ZNHB 2KX0A 4GDKA 5LXHA 4ANXA 3HK0A 4KV2A 4LDTD 3H7PA 3VTWA 3ML9A 2J0JA 2GBMA 3KVFB 1TTNA 2M8SA 3L13A 3L0WB 4MEMA 1OEYJ 4P7IA 3PVLA 4XX5A 3R7RA 1WE7A 4GDLA 3UINB 3KUDB 4XZ4A 1EO6A 4MGKE 3TIXA 1KOTA 5D94A 2DAFA 4KVGB 3OJ3A 3VHTC 2KZRA 1WE6A 1RRBA 1FXTB 1WGHA 2IO2B 4W9JA 1GG3A 2KHWB 4YL8A 4HWIB 3M62B 1IYFA 2I1JA 2KFKA 3RT3B 1J19A 2DHZA 2LVOA 3PZDA 4WWNA 4NAWA 4WWPA 3QAQA 4DDGD 2V1YA 3PGEA 2KWCA 3DBSA 4CO7A 2AYOB 1P0RA 4IWPA 4AP4C 2KJHB 3RYTA 3NS8A 4E3CA 3APFA 2PE6B 2B3AA 2BYVE 4NJ6A 3KW5B 5TR5A 4F1SA 3HM6X 2JY6A 2LZ6A 4HJKA 2GMIC 2JF5A 2JUOA 1SE9A 2KKCA 3IHPC 4CYEA 2ZNVC 4JL9A 3RZWC 3NY5A 4HCNB 2KLCA 2BKRB 2K8CA 4KZCA 3T9LA 3V61A 2CS4A 3QCAA 2G4SA 2LGYA 4II3B 4MJSA 4IM0A 5C1ZA 2A4ZA 3PPAA 2KTRB 2MP2B 2KD0A 3A33B 3ZO5B 4URKA 2C9WB 3AU5A 3GZNI 2C7HA 4EZKA 1WGDA 1S3SG 4BOZB 3DBHI 3L08A 3ALBA 4WJNA 1K8RB 2KLGA 1WXMA 1E8WA 3U7DA 4A3OA 3UGBB 5HKHA 2IO0B 2K6DB 2AL3A 1H4RA 1WX8A 3QJZA 3VQIA 2N1WA 2FIFA 5J2RA 3EECA 2RPQA 1NDDA 2N4FA 2KN5A 3JYUA 1I35A 3VFKA 4KDLB 2M17A 3IBEA 3CMMB 5JHBA 4ANUA 1NBFC 3WAMA 5DPWA 2L76A 3K9PB 2KXJA 4MGZE 3V6EB 1WIAA 2N9XA 3C0RB 3D32A 4M0WB 4TQ0A 4A3PA 3BINA 3JVZX 2KDBA 2GBNA 1V49A 5EDSA 1XT9B 2IZVB 3UQBA 3R3MA 2BWFA 1G6JA 4HXDA 3PS6A 1WM3A 3WALA 4IM2A 2A5UA 3M63B 3ZNZB 3SD5A 3ZW3A 4ICVA 4A20A 3IG3A 4KZ0A 3ZDMC 5E6OA 3R7QA 2R2QA 1E8XA 1SIFA 2WX1A 4PS8A 2RD0A 5CHVC 4IM3A 4FBJB 2REXA 3TBLD 1UBIA 4EZJA 3ENEA 2MSED 2AL6A 4XC2A 2KDIA 1V6EA 3L16A 2KWUB 4M8NA 4MELA 4FHKA 4IC7B 3N3KB 3X0WA 4DHJD 2N9EB 2FUHB 1MG8A 5L83A 2G3QB 2D3GA 2MRPA 3JSVA 3AXCA 2N7DA 3DQVA 4MDKE 3VUXA 3O65B 2LUEA 3HHMA 3LJ3A 3N32A 4WJQA 2DZKA 4W9KA 4AUQC 2GOWA 2HD5B 4W9LA 3ZIMA 4W9FA 2KTFA 3PRZA 2O6VA 1XQQA 5JH5C 4W9IA 2G45B 2ZZPB 1UGMA 3QX1A 4HDQA 1Z2MA 1F9JA 3WAPA 1KLVA 2N1VA 5L95C 4W9DA 4FJZA 4FN2A 2O2VA 4KIKA 3QHTA 3ZKJC 3TCAA 5D6JB 2AWTA 3APCA 3PRPB 3QIJA 3SHQA 3L17A 3CF6E 3VH3B 3PLVA 4MSQB 2ZPNA 3A4SC 2VRRB 3DVNU 5FR6A 2JZ3B 4GDKB 2Z0EB 1OEYA 5IAAC 1IP9A 2DZMA 3PHWB 1Q5WB 2YLMA 4G11A 1SGHA 2K6QA 5CX3A 2D2QA 4DK5A 3H7PB 2HJ8A 3IVFA 4F7ZA 2JVCA 5DPSA 4WAAA 4TQ1A 1WF9A 5DPRA 1Q0WB 2ZVNA 2WX0A 2KFJA 4BKGA 3ZRFA 4ANWA 3PV1A 2MBBB 3ZRCA 2ASQA 1WGYA 4I6LB 3WAOA 1WJ4A 2UWQA 3BY4B 4LJPB 3AU4A 1NI2A 2Z59B 3DVGX 3Q3JA 4K81A 4WWOA 3A9JA 3PT2B 3VUWA 2L00B 2R2OA 2L05A 5C23A 2CR5A 2MQJA 3JW0X 2BWES 2NPTA 2KFKB 2OJRA 1LQBA 1E5WA 2WDTB 4B9KA 4ZDVA 4NAWB 4NJ7A 1WMHA 3RUIB 2JT4B 3APDA 3VVWB 1A5RA 2BYEA 4HVBA 3MHSD 3A4RA 4NQLB 4TUUA 5DPTA 4GXBA 3TMPB 2ZVOA 1V80A 3DPDA 5GMVA 2CKHB 2CHXA 2I1KA 2IY0B 1KJTA 2D07B 2M0XA 2XK5A 4TKNA 2KOXA 4B95A 4DHJB 4BKTA 1V86A 3A1QA 4FULA 3U8ZA 3EHVA 4GSWA 2BPSA 3DOWA 4DHZE 3MJWA 2MBHA 4NY0A 5DCNA 4GU2A 1LFDA 1ZKHA 2RSUA 3KUZA 4M8MA 3RZFA 5KHQA 4ANVA 4BVUC 1WFYA 5AZFA 1UH6A 2KMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFO A;  2O6V D;  1WR6 E;  3VTU A;  4E74 A;  4BKS A;  1V81 A;  3VTV A;  2BF8 B;  1CMX B;  2KTR A;  4W9H A;  2C7N B;  1WXS A;  5J18 A;  2KAN A;  4ZRK A;  4LJO B;  2DYM A;  2ZCC A;  3DVG Y;  5G2N A;  2GBR A;  4MGY E;  2FCS A;  3KYC D;  1WH3 A;  1L2N A;  4F8C B;  2JRH A;  1LM8 B;  4DXA B;  1WJN A;  2HTH A;  3KYD D;  1E7V A;  1GUA B;  3AI5 A;  4ZYN A;  2LGX A;  2IBI B;  4EZL A;  5AZG A;  3VXW A;  2LAS A;  3CST A;  3RD2 A;  1U4A A;  1TGZ B;  3WA0 A;  5D2M B;  2IYD B;  2MWS B;  2M4N A;  3NOB A;  1H8C A;  4ZRJ A;  1V2Y A;  2LRW A;  4GIV A;  1WY8 A;  2N9P C;  3M95 A;  4HDO A;  3U30 A;  5BO4 B;  4FAD A;  2FID A;  1OQY A;  1EF1 A;  1QZE A;  4HCP B;  4MM3 A;  5JHA A;  1E8Z A;  2LWP A;  2PJH A;  2KDE B;  3QQ8 B;  4IW0 A;  2NR2 A;  2FCN A;  2KVR A;  4IG7 B;  1WGG A;  4K7U A;  2ZCB A;  3DCG A;  4DWF A;  3Q3F A;  4WJO A;  2LI5 A;  4RM8 A;  1KM7 A;  3ONS A;  4FHJ A;  1L7Y A;  1IPG A;  1XD3 B;  2LD9 A;  4IUM B;  3TL5 A;  3WAN A;  3ZDT A;  4ASW C;  2KWV B;  1J8C A;  1WR1 A;  4AJY B;  2DAJ A;  1GC7 A;  2C60 A;  4NPN A;  2Z0D B;  3ZVV A;  1E90 A;  2DYB A;  2JWZ A;  1WI0 A;  3OJ4 B;  3OAW A;  3TJP A;  4IWO A;  1ZGU B;  4DDI D;  1T0Y A;  3K9O B;  4GOC A;  1TBE A;  2MBE A;  3JSV B;  3KUC B;  4X57 B;  2DX5 B;  2MBQ A;  3NZU A;  4GB9 A;  3DDC B;  1BT0 A;  4FJV B;  4K1R B;  2JXX A;  2L0F A;  1WXA A;  1TZ1 A;  4FJY A;  1E8Y A;  2XEW A;  3H9D A;  4EEW A;  2J7Q B;  2V4L A;  4AJW A;  2O6V B;  1UZX B;  3VAW A;  1WM2 A;  4NQK E;  5JZE B;  1YX5 B;  2LRU A;  4HPM B;  1WJU A;  2WWZ A;  2YVC A;  2DZJ A;  3IFW B;  4KDI C;  2CU1 A;  4BKS D;  1Q1O A;  3A9K A;  1GNU A;  2O2V B;  1WX7 A;  4KIK B;  3ZTD A;  4RM9 A;  2BKF A;  5D7G A;  2FCM A;  3MTN B;  4W9E A;  4EKU A;  1AAR A;  1V5T A;  1EUV B;  2ZNV B;  1VD2 A;  3UIP B;  2J0K A;  2LJ5 A;  4NNJ B;  4GDL B;  1VCB A;  3W1S C;  3T8M A;  3ZUN A;  3B0A A;  2Y5B B;  4JQW C;  1RAX A;  2G4D B;  4FA6 A;  3V62 A;  3ZTC A;  3N30 A;  2PPH A;  5AEK B;  4RMA A;  2MBO A;  4KSL C;  1ISN A;  4K7W A;  3QK0 A;  4JLC A;  3A9J B;  2KMA A;  1EF5 A;  1Z5S B;  4B6W A;  3B1L X;  4DBG A;  2NBU A;  4ICU A;  1WJ6 A;  2NCN A;  3DBL I;  4N9F 4;  4G50 A;  5CTR C;  2NPT B;  3L10 B;  3V6C B;  3ML8 A;  4I6N B;  3QA8 A;  1WMH B;  1P3Q U;  2MA9 B;  2OOB B;  1WGR A;  4PS7 A;  3M3J A;  3GOE A;  1WYW B;  1S1Q B;  2BGF A;  1HE8 A;  1WRD B;  4I6P A;  1V5O A;  2FAZ A;  2KO3 A;  2L8J A;  2CHW A;  3R66 C;  2MCN B;  3X23 A;  3PTF C;  1YIW A;  4OVV A;  5E6P A;  1YD8 U;  2KC2 A;  4HLE A;  4GN1 A;  2XK5 B;  2PEA A;  2EMT A;  4BBN C;  1LXD A;  2DZI A;  2JPH A;  1X1M A;  4MJS B;  3A1Q B;  3EC8 A;  1PQS A;  1YX6 B;  2XBB C;  1P98 A;  2ZEQ A;  1RFA A;  5LXI B;  3V60 A;  1P9D U;  3RUL A;  1V9J A;  3PSE B;  2IO1 B;  2KJ6 A;  2JRI B;  3PRE A;  3SDL C;  2EMS A;  1JRU A;  1C3T A;  2EKE C;  2MP2 A;  2KJR A;  3H6N A;  1WXV A;  2C5L C;  3HIZ A;  4IWQ A;  4W9G A;  4PYZ A;  3WIM A;  1UD7 A;  1ZW7 A;  2LXA A;  2ZPY A;  2LXC A;  4MGI E;  4AOF A;  2ZJD A;  3CSF A;  2KX3 A;  3S2A A;  4ZRI A;  2DYO A;  4MSM B;  4PS3 A;  2K8B A;  4BOS C;  3HM3 A;  4WJP A;  4CHK A;  2GBJ A;  4JIO U;  2DEN B;  2AEH A;  3I3T B;  5J17 A;  4W9C A;  1UBQ A;  4BFR A;  2LVP A;  2KDF B;  5KHO A;  2N7E A;  4LDT B;  2RR9 A;  3NZS A;  4GGQ A;  4JGH B;  1D3Z A;  4G0N B;  2L0T A;  4TV3 A;  3DVN V;  3UF8 A;  2LGD A;  4E71 A;  1J0G A;  1I42 A;  1M94 A;  5CHF A;  2KQ7 A;  4HK2 A;  3B08 A;  4LCD E;  3ZNI D;  1R4N I;  1E7U A;  3QWZ B;  4G3X B;  2K39 A;  4J6I A;  4EUT A;  5LLI A;  3PRM B;  3W1S A;  3UQA A;  4GMV A;  2PE9 A;  2L3Z A;  2W9N A;  3VDZ A;  1YQB A;  3ECI A;  1OTR B;  3H1U A;  4BBN F;  5IA7 A;  3NHE B;  2C7M B;  3P2B A;  2RGF A;  5CHW A;  3QAR A;  1RLF A;  2J0M A;  1UEL A;  1Y8R C;  2NBW B;  2WYQ A;  1P1A A;  4MH0 E;  3SU8 X;  3VH4 B;  2HE7 A;  2MW5 A;  3QC8 B;  2FCQ A;  3LDZ E;  2D10 A;  2KK8 A;  5G55 A;  2MX2 A;  4PYU A;  4DHZ B;  1WX9 A;  2KNB A;  3W1Y A;  1GJZ A;  2KC1 A;  1C1Y B;  1OGW A;  2QHO A;  1R4M I;  3DBR I;  2MLB A;  5AZH A;  2K25 A;  2K8H A;  3RCZ A;  3AUL A;  3UIO B;  2K1F A;  4EOY A;  2CHZ A;  2GBK A;  2LVQ A;  1WZ3 A;  1YJ1 A;  4II2 B;  2NVU I;  5E6N A;  4WQO B;  2M1M A;  3EFU A;  3PHX B;  2IY1 B;  2L7R A;  3H7S A;  3ZLZ A;  3A9K B;  2JZZ A;  2IO3 B;  2NBV B;  2KQS A;  3KH0 A;  3PLU A;  4K7S A;  3VUY A;  1GC6 A;  4HPL B;  4FLH A;  3ZNG C;  3L54 A;  2NS5 A;  2V3S A;  4KSK C;  4OVU A;  2UYZ B;  3OLM D;  4AWJ A;  2D11 A;  1WZ0 A;  2BYF A;  2FNJ B;  3ZNH B;  2KX0 A;  4GDK A;  5LXH A;  4ANX A;  3HK0 A;  4KV2 A;  4LDT D;  3H7P A;  3VTW A;  3ML9 A;  2J0J A;  2GBM A;  3KVF B;  1TTN A;  2M8S A;  3L13 A;  3L0W B;  4MEM A;  1OEY J;  4P7I A;  3PVL A;  4XX5 A;  3R7R A;  1WE7 A;  4GDL A;  3UIN B;  3KUD B;  4XZ4 A;  1EO6 A;  4MGK E;  3TIX A;  1KOT A;  5D94 A;  2DAF A;  4KVG B;  3OJ3 A;  3VHT C;  2KZR A;  1WE6 A;  1RRB A;  1FXT B;  1WGH A;  2IO2 B;  4W9J A;  1GG3 A;  2KHW B;  4YL8 A;  4HWI B;  3M62 B;  1IYF A;  2I1J A;  2KFK A;  3RT3 B;  1J19 A;  2DHZ A;  2LVO A;  3PZD A;  4WWN A;  4NAW A;  4WWP A;  3QAQ A;  4DDG D;  2V1Y A;  3PGE A;  2KWC A;  3DBS A;  4CO7 A;  2AYO B;  1P0R A;  4IWP A;  4AP4 C;  2KJH B;  3RYT A;  3NS8 A;  4E3C A;  3APF A;  2PE6 B;  2B3A A;  2BYV E;  4NJ6 A;  3KW5 B;  5TR5 A;  4F1S A;  3HM6 X;  2JY6 A;  2LZ6 A;  4HJK A;  2GMI C;  2JF5 A;  2JUO A;  1SE9 A;  2KKC A;  3IHP C;  4CYE A;  2ZNV C;  4JL9 A;  3RZW C;  3NY5 A;  4HCN B;  2KLC A;  2BKR B;  2K8C A;  4KZC A;  3T9L A;  3V61 A;  2CS4 A;  3QCA A;  2G4S A;  2LGY A;  4II3 B;  4MJS A;  4IM0 A;  5C1Z A;  2A4Z A;  3PPA A;  2KTR B;  2MP2 B;  2KD0 A;  3A33 B;  3ZO5 B;  4URK A;  2C9W B;  3AU5 A;  3GZN I;  2C7H A;  4EZK A;  1WGD A;  1S3S G;  4BOZ B;  3DBH I;  3L08 A;  3ALB A;  4WJN A;  1K8R B;  2KLG A;  1WXM A;  1E8W A;  3U7D A;  4A3O A;  3UGB B;  5HKH A;  2IO0 B;  2K6D B;  2AL3 A;  1H4R A;  1WX8 A;  3QJZ A;  3VQI A;  2N1W A;  2FIF A;  5J2R A;  3EEC A;  2RPQ A;  1NDD A;  2N4F A;  2KN5 A;  3JYU A;  1I35 A;  3VFK A;  4KDL B;  2M17 A;  3IBE A;  3CMM B;  5JHB A;  4ANU A;  1NBF C;  3WAM A;  5DPW A;  2L76 A;  3K9P B;  2KXJ A;  4MGZ E;  3V6E B;  1WIA A;  2N9X A;  3C0R B;  3D32 A;  4M0W B;  4TQ0 A;  4A3P A;  3BIN A;  3JVZ X;  2KDB A;  2GBN A;  1V49 A;  5EDS A;  1XT9 B;  2IZV B;  3UQB A;  3R3M A;  2BWF A;  1G6J A;  4HXD A;  3PS6 A;  1WM3 A;  3WAL A;  4IM2 A;  2A5U A;  3M63 B;  3ZNZ B;  3SD5 A;  3ZW3 A;  4ICV A;  4A20 A;  3IG3 A;  4KZ0 A;  3ZDM C;  5E6O A;  3R7Q A;  2R2Q A;  1E8X A;  1SIF A;  2WX1 A;  4PS8 A;  2RD0 A;  5CHV C;  4IM3 A;  4FBJ B;  2REX A;  3TBL D;  1UBI A;  4EZJ A;  3ENE A;  2MSE D;  2AL6 A;  4XC2 A;  2KDI A;  1V6E A;  3L16 A;  2KWU B;  4M8N A;  4MEL A;  4FHK A;  4IC7 B;  3N3K B;  3X0W A;  4DHJ D;  2N9E B;  2FUH B;  1MG8 A;  5L83 A;  2G3Q B;  2D3G A;  2MRP A;  3JSV A;  3AXC A;  2N7D A;  3DQV A;  4MDK E;  3VUX A;  3O65 B;  2LUE A;  3HHM A;  3LJ3 A;  3N32 A;  4WJQ A;  2DZK A;  4W9K A;  4AUQ C;  2GOW A;  2HD5 B;  4W9L A;  3ZIM A;  4W9F A;  2KTF A;  3PRZ A;  2O6V A;  1XQQ A;  5JH5 C;  4W9I A;  2G45 B;  2ZZP B;  1UGM A;  3QX1 A;  4HDQ A;  1Z2M A;  1F9J A;  3WAP A;  1KLV A;  2N1V A;  5L95 C;  4W9D A;  4FJZ A;  4FN2 A;  2O2V A;  4KIK A;  3QHT A;  3ZKJ C;  3TCA A;  5D6J B;  2AWT A;  3APC A;  3PRP B;  3QIJ A;  3SHQ A;  3L17 A;  3CF6 E;  3VH3 B;  3PLV A;  4MSQ B;  2ZPN A;  3A4S C;  2VRR B;  3DVN U;  5FR6 A;  2JZ3 B;  4GDK B;  2Z0E B;  1OEY A;  5IAA C;  1IP9 A;  2DZM A;  3PHW B;  1Q5W B;  2YLM A;  4G11 A;  1SGH A;  2K6Q A;  5CX3 A;  2D2Q A;  4DK5 A;  3H7P B;  2HJ8 A;  3IVF A;  4F7Z A;  2JVC A;  5DPS A;  4WAA A;  4TQ1 A;  1WF9 A;  5DPR A;  1Q0W B;  2ZVN A;  2WX0 A;  2KFJ A;  4BKG A;  3ZRF A;  4ANW A;  3PV1 A;  2MBB B;  3ZRC A;  2ASQ A;  1WGY A;  4I6L B;  3WAO A;  1WJ4 A;  2UWQ A;  3BY4 B;  4LJP B;  3AU4 A;  1NI2 A;  2Z59 B;  3DVG X;  3Q3J A;  4K81 A;  4WWO A;  3A9J A;  3PT2 B;  3VUW A;  2L00 B;  2R2O A;  2L05 A;  5C23 A;  2CR5 A;  2MQJ A;  3JW0 X;  2BWE S;  2NPT A;  2KFK B;  2OJR A;  1LQB A;  1E5W A;  2WDT B;  4B9K A;  4ZDV A;  4NAW B;  4NJ7 A;  1WMH A;  3RUI B;  2JT4 B;  3APD A;  3VVW B;  1A5R A;  2BYE A;  4HVB A;  3MHS D;  3A4R A;  4NQL B;  4TUU A;  5DPT A;  4GXB A;  3TMP B;  2ZVO A;  1V80 A;  3DPD A;  5GMV A;  2CKH B;  2CHX A;  2I1K A;  2IY0 B;  1KJT A;  2D07 B;  2M0X A;  2XK5 A;  4TKN A;  2KOX A;  4B95 A;  4DHJ B;  4BKT A;  1V86 A;  3A1Q A;  4FUL A;  3U8Z A;  3EHV A;  4GSW A;  2BPS A;  3DOW A;  4DHZ E;  3MJW A;  2MBH A;  4NY0 A;  5DCN A;  4GU2 A;  1LFD A;  1ZKH A;  2RSU A;  3KUZ A;  4M8M A;  3RZF A;  5KHQ A;  4ANV A;  4BVU C;  1WFY A;  5AZF A;  1UH6 A;  2KMC A; 
#chains in the Genus database with same CATH topology
 4EFO A;  1WR6 E;  3FC4 A;  3VTU A;  3U52 E;  4W9H A;  2V9H A;  1WXS A;  4ZRK A;  2I38 A;  2ZCC A;  3HVZ A;  4MGY E;  2FCS A;  1WH3 A;  3BVM A;  1K53 A;  4P16 A;  3AI5 A;  1ZUD 2;  3VXW A;  3RD2 A;  2MWS B;  2FUG 1;  2INP E;  3FIL A;  1F52 A;  3M95 A;  3GS2 A;  5BO4 B;  4FAD A;  1OQY A;  1EF1 A;  1CZP A;  3RNA C;  4IW0 A;  3QQ8 B;  2KVR A;  4IG7 B;  2BYT A;  3Q3F A;  4WJO A;  2LI5 A;  4RM8 A;  1C4A A;  5IP4 D;  5C2T B;  2I2Y A;  4FHJ A;  1XD3 B;  3WAN A;  1J8C A;  1QQR A;  4ASW C;  1PUT A;  1QOA A;  5G5G A;  1VRA B;  2MJE A;  1UGJ A;  2XN9 C;  2BW2 A;  4R3D A;  4RF1 A;  4GOC A;  1TBE A;  3AEB B;  2DX5 B;  3AEC B;  4EEW A;  1GPX A;  4AJW A;  5FKA C;  1YX5 B;  1YOV B;  2DZJ A;  2CU1 A;  1Q1O A;  1PYW D;  3I63 C;  1GNU A;  1V5T A;  1N62 A;  2WQY B;  1L6V A;  4C80 A;  4NNJ B;  2PMV A;  2WDR B;  1VCB A;  3B0A A;  5BYR A;  3AE7 B;  1LO5 D;  2G4D B;  4JX1 C;  2KQ4 X;  3V62 A;  3CIR B;  4FXC A;  1ZXH A;  3NVW A;  3O13 A;  3QK0 A;  5IO9 A;  2KMA A;  2NBU A;  4HRS A;  3DBL I;  4OHJ A;  3P4Q B;  5CTR C;  3L10 B;  1WGR A;  3M3J A;  4LK0 M;  3GOE A;  4I6P A;  3R66 C;  4L23 A;  3N1X C;  5E6P A;  3EA6 A;  4HLE A;  4O1N A;  4YSY B;  4MJS B;  3AB5 A;  3EC8 A;  2XBB C;  3DBR B;  5LXI B;  3IAM 1;  4RH6 A;  1V9J A;  2JRI B;  2RDG A;  2M0A A;  1SSN A;  1JRU A;  1NEN B;  1ZOY B;  3H6N A;  4PYZ A;  3LB8 C;  2ICI A;  2LXA A;  1JWS D;  2LXC A;  3NVV A;  1TKG A;  4MSM B;  1B9R A;  3PO0 A;  1GOZ A;  2GBJ A;  3I3T B;  4W9C A;  3ZQ4 A;  2QIE B;  1UBQ A;  3E9S A;  2PIA A;  1VR9 A;  2KDF B;  4XWW A;  4MH8 A;  3FIL B;  2RR9 A;  2V3N A;  4TV3 A;  3UF8 A;  2LGD A;  1I42 A;  1ZXI A;  4HK2 A;  3AE8 B;  3W1S A;  4GMV A;  2PE9 A;  3ECI A;  5IA7 A;  2C7M B;  3VR8 B;  4LTU A;  3VH4 B;  1Y8R C;  2WYQ A;  4HKZ E;  4MH0 E;  3SU8 X;  2D5G A;  2TSS A;  2D10 A;  4S0R A;  2KK8 A;  2KNB A;  2KC1 A;  1C1Y B;  2QHO A;  1R4M I;  3L4P A;  3DBR I;  2QCZ A;  2K1F A;  4D2K A;  5BMG A;  2JQR B;  3SEB A;  1C4C A;  1UWM A;  4US9 A;  3H7S A;  3ZLZ A;  1P7E A;  1XCT L;  2NBV B;  3KH0 A;  3PLU A;  1GC6 A;  3N1Y C;  3MFG A;  2V3S A;  4KSK C;  4ARI A;  2BYF A;  4OVZ A;  2KX0 A;  3HK0 A;  2K22 A;  4LDT D;  2GBM A;  1C77 A;  3AE4 B;  3UIN B;  4XZ4 A;  1C9F A;  4MGK E;  2Q5W D;  2HTM E;  3OJ3 A;  4K3C A;  1WGH A;  4W9J A;  2M19 A;  3I9V 1;  1FCC C;  2KVZ A;  2KHW B;  4HWI B;  3W9C B;  3Q2A C;  1J7C A;  4OW0 A;  3NRZ A;  2OED A;  3PZD A;  4WWN A;  4WWP A;  3VRA B;  4IWP A;  1SIJ A;  5AUK A;  2KJH B;  2JU6 X;  4NJ6 A;  3KW5 B;  4HJK A;  2GMI C;  2JUO A;  2KKC A;  4CYE A;  2D3C A;  3T9L A;  4JL9 A;  3U7Z A;  1KRH A;  1ROE A;  2DBY A;  4II3 B;  4IM0 A;  1CK1 A;  2ON8 A;  1SE2 A;  5C1Z A;  1V1O A;  2KD0 A;  3A33 B;  1NEK B;  4EZK A;  4ZHP A;  1CQV A;  1T6B X;  3HRD D;  4A8X C;  4RGT A;  1FMA D;  3KQ4 A;  4A3O A;  5HKH A;  2W82 A;  1GB1 A;  3QJZ A;  4AS1 A;  1NDD A;  1I35 A;  3JYU A;  2WS3 B;  3IT6 B;  1EU4 A;  1SXT A;  1TKE A;  1JRO A;  4GLS C;  3BIN A;  1XT9 B;  3TEY A;  2LHE A;  2MEK A;  1AN8 A;  4XDD A;  2PKO A;  3ZW3 A;  3SD5 A;  1WWT A;  4KZ0 A;  3ZDM C;  2WX1 A;  1IUE A;  2AL6 A;  4WAF A;  3L16 A;  2Y3A A;  4DHJ D;  2FUH B;  5L83 A;  2G3Q B;  2QSD A;  4MDK E;  3W2D A;  2LUE A;  4W9K A;  1YJJ A;  1FFV A;  2V0G A;  4C7Y A;  1YN4 A;  1D6E C;  3BVZ A;  1Z2M A;  3Q8E A;  2O2V A;  4KIK A;  2CU3 A;  3APC A;  1YQ4 B;  3SHQ A;  2WU2 B;  2QDF A;  2VRR B;  1N6Z A;  1OEY A;  5CX3 A;  4DK5 A;  3I5J C;  1DGJ A;  1NYR A;  4BKG A;  3ZRF A;  1WGY A;  2KN4 A;  2UWQ A;  1NI2 A;  2Z59 B;  1NI3 A;  1FNV A;  3VUW A;  4QAY A;  1J7A A;  1JML A;  4B9K A;  3UI3 A;  2SEB D;  3VRB B;  1ACC A;  2JWU A;  2ZVO A;  3DPD A;  3RNG C;  2CKH B;  2XK5 A;  2D07 B;  4TKN A;  4DHJ B;  3ZXR A;  3U8Z A;  2BPS A;  2IGH A;  2BB6 A;  1ZKH A;  5KHQ A;  4ANV A;  2BBC A;  3NVZ A;  4BVU C;  1I4G A;  1V1P A;  4RFB A;  1KFY B;  1VZ8 A;  1V81 A;  1CMX B;  1JWU D;  2KTR A;  5J18 A;  2KAN A;  1I4Q A;  2DYM A;  3DVG Y;  1VLB A;  3KYC D;  4BZA A;  1L2N A;  4DXA B;  2HTH A;  1QIL A;  1E7V A;  2RDB C;  4NJC A;  4ZYN A;  2KAC A;  2IBI B;  5AZG A;  3NJT A;  3CST A;  1FFU A;  1NVI D;  2IYD B;  2MJD A;  4YWG G;  4ACF A;  1H8C A;  2RMM A;  1V2Y A;  2GB1 A;  2LRW A;  4GIV A;  3VR9 B;  4B0E A;  1D5Z C;  2FID A;  1Q10 A;  4HCP B;  3RMK C;  4MM3 A;  5JHA A;  1E8Z A;  5BYQ A;  2L1A A;  1KM7 A;  1PGA A;  5I4D A;  1WR1 A;  2DAJ A;  3I57 A;  2BTE A;  1GC7 A;  2C60 A;  1EWY C;  3ZVV A;  3OJ4 B;  3TJP A;  4IWO A;  5EE0 A;  3PZ7 A;  2MBQ A;  1BT0 A;  4K1R B;  1N61 A;  5E6J A;  1WXA A;  3NVY A;  1E8Y A;  2XEW A;  3H9D A;  3P42 A;  2V4L A;  5JZE B;  5BMH A;  3B9J A;  4KDI C;  3A9K A;  2O2V B;  1WX7 A;  4KIK B;  3ZTD A;  5D7G A;  3U2S C;  5D3D A;  2ZNV B;  3UIP B;  3DBH B;  4ZOH C;  3T8M A;  4JQW C;  1YN3 A;  5IOI A;  1TS4 A;  3EUB 2;  5AEK B;  2JYE A;  3MJ5 A;  4NAM A;  1RM6 C;  3TUO A;  4DBG A;  1D4B A;  1WJ6 A;  3R8B A;  3V6C B;  3ML8 A;  2OOB B;  1WYW B;  1YIW A;  1YD8 U;  4IOI E;  4GN1 A;  2XK5 B;  3P4P B;  1X1M A;  1YX6 B;  2WXL A;  1P98 A;  4WIP A;  1RFA A;  3OWE B;  3V60 A;  1P9D U;  3RUL A;  1KF6 B;  2JXT A;  2KJ6 A;  1T5X D;  2EMS A;  1E10 A;  4XYC A;  1V1P B;  2EKE C;  4W9G A;  1WXV A;  3HIZ A;  2CJO A;  3AE2 B;  2YEP B;  4MGI E;  4ARC A;  4P1B C;  3GP7 A;  4N59 A;  2DYO A;  4PS3 A;  4BOS C;  3HM3 A;  4WJP A;  2Y5P A;  5HI1 A;  1ESF A;  2EKI A;  2AEH A;  2AQ1 B;  2LJI A;  2MHJ A;  5H8Y E;  3Q8C A;  2IND C;  4L1B A;  1FPY A;  5IN7 A;  4M0W A;  4MM3 B;  5CHF A;  1VJK A;  1UUP A;  3ZNI D;  1E7U A;  2LUM A;  3QWZ B;  4EUT A;  3PRM B;  1Y56 A;  2K5P A;  2L83 A;  4WQM A;  2FBW B;  2NMQ A;  4M02 A;  1OTR B;  1WRI A;  3NHE B;  1GB4 A;  2IJ0 A;  3AE9 B;  3GB1 A;  2J0M A;  4TMA B;  2MW5 A;  1MHH E;  4RGO S;  5JXV A;  1WX9 A;  4RGN A;  2L32 A;  1GJZ A;  3BK1 A;  2MLB A;  3RCZ A;  2JSV X;  3ZJT A;  2CHZ A;  2GBK A;  1WZ3 A;  2NVU I;  5E6N A;  3PHX B;  3A9K B;  2JZZ A;  2IO3 B;  2K3U A;  4FLH A;  1SF0 A;  3ZNG C;  2NS5 A;  4OVU A;  2QJL A;  4LNN A;  4USA A;  1BXT A;  3RN9 C;  2D11 A;  1QKZ A;  2WXI A;  2WXH A;  1L0X B;  2KWD A;  1IBX A;  3IAS 1;  3NG0 A;  3H7P A;  1OFF A;  1VDV A;  3L13 A;  3L0W B;  3R7R A;  1OEY J;  3PVL A;  4XX5 A;  1WE7 A;  4GDL A;  1EO6 A;  1KOT A;  2DAF A;  1SE3 A;  3R2T A;  3C8Y A;  1D5M C;  4H2A A;  4YL8 A;  4YTM B;  3ZJU A;  4ZRQ A;  4M01 A;  1IYF A;  4PK1 A;  2DHZ A;  3QAQ A;  2V1Y A;  4CO7 A;  5HG2 A;  4AP4 C;  2H88 B;  3APF A;  2PE6 B;  3LYY A;  3HM6 X;  2JY6 A;  5EE1 A;  1SE9 A;  3IHP C;  2BKR B;  4KZC A;  3QCA A;  2AX5 A;  2G4S A;  1B1Z A;  3ZO5 B;  1SBB B;  4URK A;  2ACZ B;  1S3S G;  4DQO C;  4BOZ B;  3L08 A;  3ALB A;  2MH7 A;  4WJN A;  2KLG A;  1WXM A;  1ZDX A;  2AL3 A;  2UU7 A;  2PLP A;  5J2R A;  2JX5 A;  2RPQ A;  3VFK A;  5JHB A;  4ANU A;  2GRI A;  2L76 A;  2KXJ A;  4MGZ E;  3V6E B;  2N9X A;  2OHF A;  4M0W B;  4A3P A;  3JVZ X;  1V97 A;  4HEA 1;  1PGX A;  2Y5C A;  4KGT A;  3SR6 A;  3UQB A;  3R3M A;  1G6J A;  4IM2 A;  2A5U A;  3M63 B;  1TY0 A;  1ET6 A;  2RD0 A;  1MPE A;  4IM3 A;  3V05 A;  1FNW A;  4EZJ A;  5LNK 1;  1SJE D;  2KDI A;  1V6E A;  3X0W A;  4IC7 B;  2N9E B;  4JWU C;  3JSV A;  3CWI A;  3W5U B;  3VUX A;  1E7P B;  3O65 B;  2VZK D;  4WJQ A;  3KWL A;  1HXY D;  4AUQ C;  2HD5 B;  4W9F A;  2KTF A;  4P1C C;  4HDQ A;  2LGS A;  1F9J A;  2N1V A;  5L95 C;  3BYY B;  4FJZ A;  1OQQ A;  4FN2 A;  1GAQ B;  3Q8A A;  1TS2 A;  5D6J B;  3PRP B;  3VH3 B;  3CF6 E;  4KX6 B;  5FR6 A;  4A55 A;  2JZ3 B;  3KLS X;  2N9K A;  1IBX B;  2DZM A;  3PHW B;  4G11 A;  3RPF C;  2K6Q A;  4M00 A;  2D2Q A;  3H7P B;  1C78 A;  2HJ8 A;  2JVC A;  5DPR A;  3HUI A;  1Q0W B;  4MAC A;  1FEH A;  3BZD B;  3AEG B;  2MBB B;  3ZRC A;  2ASQ A;  1MG4 A;  3Q3J A;  4WWO A;  3A9J A;  1ZP0 B;  1TZO A;  1TS5 A;  2R2O A;  2D3B A;  2L05 A;  2CR5 A;  2BWE S;  2NPT A;  2OJR A;  3N9Y C;  2JT4 B;  3APD A;  1A5R A;  1ZE3 D;  3Q3M C;  2KT7 A;  3A4R A;  4TUU A;  2CHX A;  1L4D B;  3ZGZ A;  4B95 A;  2M0X A;  2KOX A;  1BUI C;  1I4X A;  1V86 A;  3A1Q A;  3EHV A;  4GSW A;  1SEB D;  2VZK B;  2WDQ B;  4NY0 A;  4GU2 A;  4C7Z A;  2RSU A;  4M8M A;  1JWA D;  2L52 A;  3ZYY X;  1RFK A;  3P1M A;  1NYQ A;  2BF8 B;  3T3O A;  2C7N B;  2VH1 A;  4DXF A;  4YT0 B;  1QF6 A;  2GBR A;  1K52 A;  4F8C B;  4RGM A;  3KYD D;  2R61 A;  1GUA B;  4EZL A;  1T0R C;  1FM0 D;  1TGZ B;  5D2M B;  2WXK A;  5TSS A;  4ZRJ A;  3RFZ B;  2FE8 A;  4HDO A;  3HVD A;  3U30 A;  1XCQ L;  1QZE A;  2WXG A;  2LWP A;  2IPK D;  2PJH A;  3RNC C;  4K7U A;  2ZCB A;  2AQ3 B;  4KGS A;  3E56 A;  1WYG A;  3ZDT A;  1IPG A;  4IUM B;  3TL5 A;  3ZJV A;  2KWV B;  4N6E B;  1STE A;  3EFC A;  4NZL B;  4XGA B;  2Z0D B;  1C79 A;  1E90 A;  2IGG A;  1F1H A;  2DYB A;  4JWS C;  3OAW A;  4DDI D;  1T0Y A;  3BVG A;  3JSV B;  3KUC B;  3NZU A;  3AED B;  3DDC B;  2JXX A;  1DOY A;  2WU5 B;  1TZ1 A;  5GXG B;  3TEZ A;  2DWQ A;  1HTQ A;  1UZX B;  1QOG A;  3VAW A;  4NQK E;  2LRU A;  1WJU A;  2YVC A;  2QIL A;  3GZN B;  2BKF A;  2FCM A;  3MTN B;  4W9E A;  4EKU A;  1EUV B;  2LJ5 A;  3AE5 B;  1AYF A;  4RCO A;  3ZUN A;  2W55 A;  1FRR A;  3MHZ A;  2Y5B B;  2RPV A;  5G5H A;  3DHI C;  2WXR A;  3N30 A;  2PPH A;  2KAJ A;  4RMA A;  2MBO A;  3Q6B A;  5HHD G;  4KSL C;  1OQR A;  3A9J B;  1R4N B;  1EF5 A;  2QMT A;  4B6W A;  3B1L X;  3P4R B;  4G50 A;  2NPT B;  4I6N B;  3QA8 A;  2WXJ A;  1P3Q U;  1S1Q B;  2BGF A;  1HE8 A;  2FAZ A;  2L8J A;  2MCN B;  2CHW A;  3X23 A;  4JPS A;  1E9M A;  3PZ8 A;  2KC2 A;  3ABV B;  3BYT B;  4B0M A;  1F2R I;  2PEA A;  3AEE B;  1LXD A;  2JPH A;  3A1Q B;  1PQS A;  2KMM A;  4C4V A;  2NTS A;  3PSE B;  1P7F A;  1HZ5 A;  3SDL C;  3ETR A;  4IWQ A;  2V4I B;  1AW7 A;  4HPP A;  3WIM A;  1UD7 A;  1ZW7 A;  2ZPY A;  3AM9 A;  3CSF A;  3MC0 B;  4ZRI A;  4XE0 A;  2HDE A;  3NZ3 A;  5J17 A;  4IKG A;  4KKI A;  1JWM D;  5KHO A;  2N7E A;  2N0S B;  4GGQ A;  1D3Z A;  2L0T A;  3NUH B;  2PTL A;  1AWD A;  1TKY A;  4E71 A;  4ZYS A;  1M94 A;  1FXI A;  2KQ7 A;  3AV8 A;  4LCD E;  1R4N I;  2K39 A;  4J6I A;  2KDM A;  4L2Y A;  3MC8 A;  2L3Z A;  1MI0 A;  3VDZ A;  1YQB A;  1F0Z A;  3P2B A;  5CHW A;  3AE1 B;  1RLF A;  1UEL A;  1P1A A;  3LDZ E;  5G55 A;  2MX2 A;  4PYU A;  4DHZ B;  2EEL A;  2WXO A;  2OJW A;  1OGW A;  5AZH A;  4EE2 A;  4J3O D;  2GLS A;  3UIO B;  1TIF A;  3Q3N C;  2M56 B;  1IGD A;  2M1M A;  3EFU A;  2IY1 B;  2L7R A;  3VUY A;  4HPL B;  2WNM A;  2UYZ B;  4AWJ A;  2X8X X;  2VH2 A;  3KWV A;  2FNJ B;  3DWM A;  3ZNH B;  2KYW A;  4GDK A;  4YTN B;  4KV2 A;  3VTW A;  3ML9 A;  2J0J A;  3KVF B;  1TTN A;  2M8S A;  4P7I A;  4MEM A;  2E3T A;  1T3Q A;  3TIX A;  4YTP B;  3VHT C;  1WE6 A;  2KZR A;  3IT4 B;  1IGC A;  1RRB A;  2IO2 B;  3Q8F A;  4C56 C;  1GG3 A;  2PVG C;  2I1J A;  1J19 A;  2ZW0 A;  4DDG D;  2KWC A;  2BQQ A;  3DBS A;  2AYO B;  2CJN A;  1PFD A;  1JQ4 A;  3RYT A;  3NS8 A;  4HKQ A;  4E3C A;  2B3A A;  2YEP F;  4F1S A;  2LZ6 A;  2JF5 A;  4JE3 B;  4LNF A;  1JAL A;  4C4V B;  3TSS A;  3NY5 A;  4HCN B;  2KLC A;  4OZB A;  2K8C A;  2LGY A;  4MJS A;  2A4Z A;  2KTR B;  4OZA A;  3P63 A;  2AQ2 B;  3J9C A;  1ENF A;  1WGD A;  1K50 A;  3DBH I;  3T3N A;  3U7D A;  2K6D B;  1WX8 A;  4RF0 A;  2FIF A;  1N60 A;  3EEC A;  2J53 A;  4CQN A;  3CMM B;  2WXQ A;  5MPO A;  1NBF C;  5H92 C;  3C0R B;  3D32 A;  2DLB A;  4TQ0 A;  2KDB A;  2GBN A;  1C76 A;  1DOI A;  1QOF A;  2IZV B;  1C4P A;  1TS3 A;  2BWF A;  3P4S B;  3DBL B;  4HXD A;  3PS6 A;  1WM3 A;  1XLP A;  4ICV A;  4A20 A;  2WGS A;  5E6O A;  2V3P A;  3R7Q A;  1EU3 A;  2R2Q A;  1E8X A;  1SIF A;  4PS8 A;  1E0Z A;  2XNA C;  3TBL D;  3SFE B;  2WXM A;  2KWU B;  4M8N A;  4MEL A;  4FHK A;  3N3K B;  2ZW1 A;  1MG8 A;  1DYQ A;  1ZDV A;  1I4H A;  2BB5 A;  1EWC A;  1QLB B;  3DQV A;  3HHM A;  3N32 A;  4UDU C;  3GE8 C;  1HA5 A;  2GOW A;  3ZIM A;  3DWG C;  2O6V A;  5JH5 C;  4W9I A;  2G45 B;  2ZZP B;  3WAP A;  1M4V A;  3MC9 A;  2RDH A;  1K51 A;  1XF5 L;  2INC C;  3TCA A;  3AEA B;  3QIJ A;  3L17 A;  3PLV A;  4MSQ B;  2ZPN A;  3A4S C;  3DVN U;  4GDK B;  4OZC A;  5IAA C;  1Q5W B;  2YLM A;  1SGH A;  3IVF A;  4F7Z A;  3R2I A;  5DPS A;  4WAA A;  2X38 A;  1VZ6 A;  1FO4 A;  3AEF B;  2ZVN A;  2WX0 A;  2WDV B;  2W3R A;  3PV1 A;  3WAO A;  4LJP B;  3AU4 A;  2QEJ C;  4K81 A;  1HTO A;  1YN5 A;  3JW0 X;  1A70 A;  1LQB A;  4ZDV A;  4NJ7 A;  3W5V B;  1WMH A;  1DOX A;  1TJE A;  1UF0 A;  3MHS D;  4NQL B;  4GXB A;  1V80 A;  5GMV A;  2IY0 B;  1YQ3 B;  1KJT A;  1L5P A;  5C3J B;  4BKT A;  4DHZ E;  2JYT A;  3MJW A;  4TSS A;  5DCN A;  2G1E A;  1LFD A;  1R4M B;  3H8H A;  1WFY A;  1UH6 A;  2KDE B;  2KMC A;  1RWS A;  2O6V D;  1CJE A;  2HJ1 A;  4E74 A;  4BKS A;  2GI9 A;  2N9L A;  3AMZ A;  4REZ A;  3BK2 A;  3VTV A;  1FD6 A;  4A90 A;  3BWU D;  1TT5 B;  4LJO B;  5G2N A;  2JRH A;  1LM8 B;  1EM7 A;  1WJN A;  2J52 A;  3IXS A;  1F77 A;  2BT6 A;  2LGX A;  1BML C;  3AE3 B;  2LAS A;  4WWM A;  1U4A A;  1TYG B;  3WA0 A;  4XWT A;  3NOB A;  2M4N A;  1HZ6 A;  1I4P A;  1WY8 A;  2N9P C;  1T0Q C;  5AUI A;  3TEW A;  4AQ7 A;  1XXG A;  1ZPS A;  1JW9 D;  4HRO A;  2NTT A;  1YNT E;  2NR2 A;  2PW9 A;  2FCN A;  1I7H A;  1WGG A;  3DCG A;  4DWF A;  4US8 A;  1QT9 A;  3ONS A;  1KLV A;  1L7Y A;  2LD9 A;  4AJY B;  4NPN A;  3FKY A;  3N1Z C;  1YJI A;  2JWZ A;  1WI0 A;  1ZGU B;  3K9O B;  2MBE A;  4ZRP A;  4X57 B;  4GB9 A;  3BII D;  2BVC A;  4FJV B;  4S17 A;  2L0F A;  4FJY A;  2J7Q B;  2O6V B;  1WM2 A;  4HPM B;  2WWZ A;  3IFW B;  4BKS D;  1MFW A;  4RM9 A;  4LNO A;  1AAR A;  2LEK A;  3MP9 A;  1VD2 A;  5T8I A;  2J0K A;  2W3S A;  4GDL B;  1N5X A;  3W1S C;  3RNB C;  1RAX A;  3RI7 C;  4FA6 A;  2WXN A;  3ZTC A;  3Q14 C;  2K9X A;  2IDY A;  1ISN A;  4K7W A;  5BMI A;  4JLC A;  1UWX A;  1F2R C;  1Z5S B;  3Q69 A;  4ICU A;  2NCN A;  2B76 B;  4N9F 4;  3ZXV A;  1WMH B;  4PS7 A;  2MA9 B;  1WRD B;  2WP9 B;  2INN E;  1V5O A;  2K0P A;  2KO3 A;  3NS1 A;  4C00 A;  3PTF C;  4OVV A;  4BAX A;  3B2F A;  2EMT A;  4BBN C;  1WGK A;  1FNU A;  2DZI A;  4A6Q A;  2ZEQ A;  3GE3 C;  1PGB A;  1QOB A;  2IO1 B;  3PRE A;  2SAK A;  1XO3 A;  1L0V B;  3AH7 A;  1C3T A;  2MP2 A;  2KJR A;  2C5L C;  1KH0 A;  2D3A A;  4AOF A;  2ZJD A;  2PVO D;  2KX3 A;  3S2A A;  2LHD A;  3AN1 A;  1LGR A;  1L0Y B;  3C19 A;  2K8B A;  4IDI A;  5D3I B;  5EE9 A;  4CHK A;  4JIO U;  2DEN B;  4BFR A;  2LVP A;  1I4R A;  4LDT B;  3NZS A;  4JGH B;  4Q2J A;  4G0N B;  1D5X C;  3DVN V;  1RYJ A;  1J0G A;  3B08 A;  4G3X B;  3TEX A;  5LLI A;  3UQA A;  5BYS A;  1SE4 A;  2WXP A;  2W9N A;  3H1U A;  4BBN F;  1JWB D;  2WXF A;  5EE3 A;  2LMC A;  2RGF A;  3QAR A;  2NBW B;  1HEZ E;  4WH4 A;  2HE7 A;  3QC8 B;  2FCQ A;  4ITK A;  4YSZ B;  5HFY A;  3SFD B;  3W1Y A;  2K25 A;  2K8H A;  3AUL A;  4EOY A;  2LVQ A;  1YJ1 A;  4II2 B;  4WQO B;  2KQS A;  4K7S A;  1MJD A;  3L54 A;  2J4X A;  4A9A A;  3OLM D;  3Q8B A;  1WZ0 A;  5LXH A;  4LNK A;  4ANX A;  5IKC M;  1ET9 A;  3V3X A;  4N58 A;  1N63 A;  1FCL A;  2WLB A;  3KUD B;  5D94 A;  4KVG B;  2QC8 A;  1E6E B;  1FXT B;  3Q3O C;  2JZP A;  3M62 B;  1KLG D;  2KFK A;  3RT3 B;  1MVK A;  2H89 B;  2LVO A;  4NAW A;  4K3B A;  3PGE A;  1MHX A;  1P0R A;  3OG5 A;  2IGD A;  4KKJ A;  1L6U A;  2BYV E;  5TR5 A;  2LGI A;  1XLN A;  1HQR D;  3B2G A;  2ZNV C;  3RZW C;  3V61 A;  2CS4 A;  2BS2 B;  3PPA A;  2MP2 B;  2J42 A;  1V8C A;  2C9W B;  3AU5 A;  3GZN I;  3N20 C;  2C7H A;  3EGR A;  5FK9 C;  3FAH A;  1K8R B;  1E8W A;  3UGB B;  2IO0 B;  5FR3 A;  1H4R A;  3VQI A;  2N1W A;  1FXA A;  2N4F A;  2KN5 A;  2DNF A;  4KDL B;  2M17 A;  3IBE A;  3WAM A;  5DPW A;  1WSP A;  3K9P B;  1WIA A;  2E6X A;  2BS3 B;  1V49 A;  5EDS A;  1TY2 A;  3RNF C;  2W54 A;  4ZHO A;  3WAL A;  4HJG E;  3ZNZ B;  1SB3 C;  3IG3 A;  4WUR A;  4YSX B;  2WHI A;  5CHV C;  4FBJ B;  2REX A;  1UBI A;  3ENE A;  2MSE D;  4XC2 A;  4LNI A;  4DXG A;  1XEE A;  4LLG M;  1JRP A;  1FRD A;  2D3G A;  2MRP A;  3URY A;  3AXC A;  2N7D A;  3LJ3 A;  4PT5 A;  2DZK A;  1PDX A;  4W9L A;  1L4Z B;  1T0S C;  3PRZ A;  1KTK A;  1XQQ A;  1UGM A;  3QX1 A;  4W9D A;  1R7S A;  3AE6 B;  1WXQ A;  1KLU D;  1UNS A;  3QHT A;  3ZKJ C;  3DHG C;  2AWT A;  3DHH C;  2Z0E B;  1IP9 A;  2Z8L A;  4TQ1 A;  1WF9 A;  2G9H D;  2KFJ A;  4ANW A;  3RNE C;  4I6L B;  2BS4 B;  1WJ4 A;  3BY4 B;  3WCQ A;  4MT5 A;  4YXD B;  3DVG X;  3PT2 B;  1YMH E;  2N7J A;  2L00 B;  5C23 A;  2MQJ A;  1FIQ A;  2KFK B;  1E5W A;  2WDT B;  4P6V F;  4NAW B;  1N5W A;  3RUI B;  3VVW B;  1JCK B;  2BYE A;  4HVB A;  5DPT A;  3TMP B;  1J7B A;  1VZ7 A;  2I1K A;  2LFI A;  3LXF A;  4FUL A;  3U4E G;  1XLQ A;  3DOW A;  4XDC A;  1XLO A;  2MBH A;  2ONQ A;  2MJ3 A;  3KUZ A;  3RZF A;  4RNA A;  1SJH D;  4KGR A;  5AZF A; 
#chains in the Genus database with same CATH homology
 4EFO A;  2O6V D;  1WR6 E;  3VTU A;  4E74 A;  4BKS A;  1V81 A;  3VTV A;  2BF8 B;  1CMX B;  2KTR A;  4W9H A;  2C7N B;  1WXS A;  5J18 A;  2KAN A;  4ZRK A;  4LJO B;  2DYM A;  2ZCC A;  3DVG Y;  5G2N A;  2GBR A;  4MGY E;  2FCS A;  3KYC D;  1WH3 A;  1L2N A;  4F8C B;  2JRH A;  1LM8 B;  4DXA B;  1WJN A;  2HTH A;  3KYD D;  1E7V A;  1GUA B;  3AI5 A;  4ZYN A;  2LGX A;  2IBI B;  4EZL A;  5AZG A;  3VXW A;  2LAS A;  3CST A;  3RD2 A;  1U4A A;  1TGZ B;  3WA0 A;  5D2M B;  2IYD B;  2MWS B;  2M4N A;  3NOB A;  1H8C A;  4ZRJ A;  1V2Y A;  2LRW A;  4GIV A;  1WY8 A;  2N9P C;  3M95 A;  4HDO A;  3U30 A;  5BO4 B;  4FAD A;  2FID A;  1OQY A;  1EF1 A;  1QZE A;  4HCP B;  4MM3 A;  5JHA A;  1E8Z A;  2LWP A;  2PJH A;  2KDE B;  3QQ8 B;  4IW0 A;  2NR2 A;  2FCN A;  2KVR A;  4IG7 B;  1WGG A;  4K7U A;  2ZCB A;  3DCG A;  4DWF A;  3Q3F A;  4WJO A;  2LI5 A;  4RM8 A;  1KM7 A;  3ONS A;  4FHJ A;  1L7Y A;  1IPG A;  1XD3 B;  2LD9 A;  4IUM B;  3TL5 A;  3WAN A;  3ZDT A;  4ASW C;  2KWV B;  1J8C A;  1WR1 A;  4AJY B;  2DAJ A;  1GC7 A;  2C60 A;  4NPN A;  2Z0D B;  3ZVV A;  1E90 A;  2DYB A;  2JWZ A;  1WI0 A;  3OJ4 B;  3OAW A;  3TJP A;  4IWO A;  1ZGU B;  4DDI D;  1T0Y A;  3K9O B;  4GOC A;  1TBE A;  2MBE A;  3JSV B;  3KUC B;  4X57 B;  2DX5 B;  2MBQ A;  3NZU A;  4GB9 A;  3DDC B;  1BT0 A;  4FJV B;  4K1R B;  2JXX A;  2L0F A;  1WXA A;  1TZ1 A;  4FJY A;  1E8Y A;  2XEW A;  3H9D A;  4EEW A;  2J7Q B;  2V4L A;  4AJW A;  2O6V B;  1UZX B;  3VAW A;  1WM2 A;  4NQK E;  5JZE B;  1YX5 B;  2LRU A;  4HPM B;  1WJU A;  2WWZ A;  2YVC A;  2DZJ A;  3IFW B;  4KDI C;  2CU1 A;  4BKS D;  1Q1O A;  3A9K A;  1GNU A;  2O2V B;  1WX7 A;  4KIK B;  3ZTD A;  4RM9 A;  2BKF A;  5D7G A;  2FCM A;  3MTN B;  4W9E A;  4EKU A;  1AAR A;  1V5T A;  1EUV B;  2ZNV B;  1VD2 A;  3UIP B;  2J0K A;  2LJ5 A;  4NNJ B;  4GDL B;  1VCB A;  3W1S C;  3T8M A;  3ZUN A;  3B0A A;  2Y5B B;  4JQW C;  1RAX A;  2G4D B;  4FA6 A;  3V62 A;  3ZTC A;  3N30 A;  2PPH A;  5AEK B;  4RMA A;  2MBO A;  4KSL C;  1ISN A;  4K7W A;  3QK0 A;  4JLC A;  3A9J B;  2KMA A;  1EF5 A;  1Z5S B;  4B6W A;  3B1L X;  4DBG A;  2NBU A;  4ICU A;  1WJ6 A;  2NCN A;  3DBL I;  4N9F 4;  4G50 A;  5CTR C;  2NPT B;  3L10 B;  3V6C B;  3ML8 A;  4I6N B;  3QA8 A;  1WMH B;  1P3Q U;  2MA9 B;  2OOB B;  1WGR A;  4PS7 A;  3M3J A;  3GOE A;  1WYW B;  1S1Q B;  2BGF A;  1HE8 A;  1WRD B;  4I6P A;  1V5O A;  2FAZ A;  2KO3 A;  2L8J A;  2CHW A;  3R66 C;  2MCN B;  3X23 A;  3PTF C;  1YIW A;  4OVV A;  5E6P A;  1YD8 U;  2KC2 A;  4HLE A;  4GN1 A;  2XK5 B;  2PEA A;  2EMT A;  4BBN C;  1LXD A;  2DZI A;  2JPH A;  1X1M A;  4MJS B;  3A1Q B;  3EC8 A;  1PQS A;  1YX6 B;  2XBB C;  1P98 A;  2ZEQ A;  1RFA A;  5LXI B;  3V60 A;  1P9D U;  3RUL A;  1V9J A;  3PSE B;  2IO1 B;  2KJ6 A;  2JRI B;  3PRE A;  3SDL C;  2EMS A;  1JRU A;  1C3T A;  2EKE C;  2MP2 A;  2KJR A;  3H6N A;  1WXV A;  2C5L C;  3HIZ A;  4IWQ A;  4W9G A;  4PYZ A;  3WIM A;  1UD7 A;  1ZW7 A;  2LXA A;  2ZPY A;  2LXC A;  4MGI E;  4AOF A;  2ZJD A;  3CSF A;  2KX3 A;  3S2A A;  4ZRI A;  2DYO A;  4MSM B;  4PS3 A;  2K8B A;  4BOS C;  3HM3 A;  4WJP A;  4CHK A;  2GBJ A;  4JIO U;  2DEN B;  2AEH A;  3I3T B;  5J17 A;  4W9C A;  1UBQ A;  4BFR A;  2LVP A;  2KDF B;  5KHO A;  2N7E A;  4LDT B;  2RR9 A;  3NZS A;  4GGQ A;  4JGH B;  1D3Z A;  4G0N B;  2L0T A;  4TV3 A;  3DVN V;  3UF8 A;  2LGD A;  4E71 A;  1J0G A;  1I42 A;  1M94 A;  5CHF A;  2KQ7 A;  4HK2 A;  3B08 A;  4LCD E;  3ZNI D;  1R4N I;  1E7U A;  3QWZ B;  4G3X B;  2K39 A;  4J6I A;  4EUT A;  5LLI A;  3PRM B;  3W1S A;  3UQA A;  4GMV A;  2PE9 A;  2L3Z A;  2W9N A;  3VDZ A;  1YQB A;  3ECI A;  1OTR B;  3H1U A;  4BBN F;  5IA7 A;  3NHE B;  2C7M B;  3P2B A;  2RGF A;  5CHW A;  3QAR A;  1RLF A;  2J0M A;  1UEL A;  1Y8R C;  2NBW B;  2WYQ A;  1P1A A;  4MH0 E;  3SU8 X;  3VH4 B;  2HE7 A;  2MW5 A;  3QC8 B;  2FCQ A;  3LDZ E;  2D10 A;  2KK8 A;  5G55 A;  2MX2 A;  4PYU A;  4DHZ B;  1WX9 A;  2KNB A;  3W1Y A;  1GJZ A;  2KC1 A;  1C1Y B;  1OGW A;  2QHO A;  1R4M I;  3DBR I;  2MLB A;  5AZH A;  2K25 A;  2K8H A;  3RCZ A;  3AUL A;  3UIO B;  2K1F A;  4EOY A;  2CHZ A;  2GBK A;  2LVQ A;  1WZ3 A;  1YJ1 A;  4II2 B;  2NVU I;  5E6N A;  4WQO B;  2M1M A;  3EFU A;  3PHX B;  2IY1 B;  2L7R A;  3H7S A;  3ZLZ A;  3A9K B;  2JZZ A;  2IO3 B;  2NBV B;  2KQS A;  3KH0 A;  3PLU A;  4K7S A;  3VUY A;  1GC6 A;  4HPL B;  4FLH A;  3ZNG C;  3L54 A;  2NS5 A;  2V3S A;  4KSK C;  4OVU A;  2UYZ B;  3OLM D;  4AWJ A;  2D11 A;  1WZ0 A;  2BYF A;  2FNJ B;  3ZNH B;  2KX0 A;  4GDK A;  5LXH A;  4ANX A;  3HK0 A;  4KV2 A;  4LDT D;  3H7P A;  3VTW A;  3ML9 A;  2J0J A;  2GBM A;  3KVF B;  1TTN A;  2M8S A;  3L13 A;  3L0W B;  4MEM A;  1OEY J;  4P7I A;  3PVL A;  4XX5 A;  3R7R A;  1WE7 A;  4GDL A;  3UIN B;  3KUD B;  4XZ4 A;  1EO6 A;  4MGK E;  3TIX A;  1KOT A;  5D94 A;  2DAF A;  4KVG B;  3OJ3 A;  3VHT C;  2KZR A;  1WE6 A;  1RRB A;  1FXT B;  1WGH A;  2IO2 B;  4W9J A;  1GG3 A;  2KHW B;  4YL8 A;  4HWI B;  3M62 B;  1IYF A;  2I1J A;  2KFK A;  3RT3 B;  1J19 A;  2DHZ A;  2LVO A;  3PZD A;  4WWN A;  4NAW A;  4WWP A;  3QAQ A;  4DDG D;  2V1Y A;  3PGE A;  2KWC A;  3DBS A;  4CO7 A;  2AYO B;  1P0R A;  4IWP A;  4AP4 C;  2KJH B;  3RYT A;  3NS8 A;  4E3C A;  3APF A;  2PE6 B;  2B3A A;  2BYV E;  4NJ6 A;  3KW5 B;  5TR5 A;  4F1S A;  3HM6 X;  2JY6 A;  2LZ6 A;  4HJK A;  2GMI C;  2JF5 A;  2JUO A;  1SE9 A;  2KKC A;  3IHP C;  4CYE A;  2ZNV C;  4JL9 A;  3RZW C;  3NY5 A;  4HCN B;  2KLC A;  2BKR B;  2K8C A;  4KZC A;  3T9L A;  3V61 A;  2CS4 A;  3QCA A;  2G4S A;  2LGY A;  4II3 B;  4MJS A;  4IM0 A;  5C1Z A;  2A4Z A;  3PPA A;  2KTR B;  2MP2 B;  2KD0 A;  3A33 B;  3ZO5 B;  4URK A;  2C9W B;  3AU5 A;  3GZN I;  2C7H A;  4EZK A;  1WGD A;  1S3S G;  4BOZ B;  3DBH I;  3L08 A;  3ALB A;  4WJN A;  1K8R B;  2KLG A;  1WXM A;  1E8W A;  3U7D A;  4A3O A;  3UGB B;  5HKH A;  2IO0 B;  2K6D B;  2AL3 A;  1H4R A;  1WX8 A;  3QJZ A;  3VQI A;  2N1W A;  2FIF A;  5J2R A;  3EEC A;  2RPQ A;  1NDD A;  2N4F A;  2KN5 A;  3JYU A;  1I35 A;  3VFK A;  4KDL B;  2M17 A;  3IBE A;  3CMM B;  5JHB A;  4ANU A;  1NBF C;  3WAM A;  5DPW A;  2L76 A;  3K9P B;  2KXJ A;  4MGZ E;  3V6E B;  1WIA A;  2N9X A;  3C0R B;  3D32 A;  4M0W B;  4TQ0 A;  4A3P A;  3BIN A;  3JVZ X;  2KDB A;  2GBN A;  1V49 A;  5EDS A;  1XT9 B;  2IZV B;  3UQB A;  3R3M A;  2BWF A;  1G6J A;  4HXD A;  3PS6 A;  1WM3 A;  3WAL A;  4IM2 A;  2A5U A;  3M63 B;  3ZNZ B;  3SD5 A;  3ZW3 A;  4ICV A;  4A20 A;  3IG3 A;  4KZ0 A;  3ZDM C;  5E6O A;  3R7Q A;  2R2Q A;  1E8X A;  1SIF A;  2WX1 A;  4PS8 A;  2RD0 A;  5CHV C;  4IM3 A;  4FBJ B;  2REX A;  3TBL D;  1UBI A;  4EZJ A;  3ENE A;  2MSE D;  2AL6 A;  4XC2 A;  2KDI A;  1V6E A;  3L16 A;  2KWU B;  4M8N A;  4MEL A;  4FHK A;  4IC7 B;  3N3K B;  3X0W A;  4DHJ D;  2N9E B;  2FUH B;  1MG8 A;  5L83 A;  2G3Q B;  2D3G A;  2MRP A;  3JSV A;  3AXC A;  2N7D A;  3DQV A;  4MDK E;  3VUX A;  3O65 B;  2LUE A;  3HHM A;  3LJ3 A;  3N32 A;  4WJQ A;  2DZK A;  4W9K A;  4AUQ C;  2GOW A;  2HD5 B;  4W9L A;  3ZIM A;  4W9F A;  2KTF A;  3PRZ A;  2O6V A;  1XQQ A;  5JH5 C;  4W9I A;  2G45 B;  2ZZP B;  1UGM A;  3QX1 A;  4HDQ A;  1Z2M A;  1F9J A;  3WAP A;  1KLV A;  2N1V A;  5L95 C;  4W9D A;  4FJZ A;  4FN2 A;  2O2V A;  4KIK A;  3QHT A;  3ZKJ C;  3TCA A;  5D6J B;  2AWT A;  3APC A;  3PRP B;  3QIJ A;  3SHQ A;  3L17 A;  3CF6 E;  3VH3 B;  3PLV A;  4MSQ B;  2ZPN A;  3A4S C;  2VRR B;  3DVN U;  5FR6 A;  2JZ3 B;  4GDK B;  2Z0E B;  1OEY A;  5IAA C;  1IP9 A;  2DZM A;  3PHW B;  1Q5W B;  2YLM A;  4G11 A;  1SGH A;  2K6Q A;  5CX3 A;  2D2Q A;  4DK5 A;  3H7P B;  2HJ8 A;  3IVF A;  4F7Z A;  2JVC A;  5DPS A;  4WAA A;  4TQ1 A;  1WF9 A;  5DPR A;  1Q0W B;  2ZVN A;  2WX0 A;  2KFJ A;  4BKG A;  3ZRF A;  4ANW A;  3PV1 A;  2MBB B;  3ZRC A;  2ASQ A;  1WGY A;  4I6L B;  3WAO A;  1WJ4 A;  2UWQ A;  3BY4 B;  4LJP B;  3AU4 A;  1NI2 A;  2Z59 B;  3DVG X;  3Q3J A;  4K81 A;  4WWO A;  3A9J A;  3PT2 B;  3VUW A;  2L00 B;  2R2O A;  2L05 A;  5C23 A;  2CR5 A;  2MQJ A;  3JW0 X;  2BWE S;  2NPT A;  2KFK B;  2OJR A;  1LQB A;  1E5W A;  2WDT B;  4B9K A;  4ZDV A;  4NAW B;  4NJ7 A;  1WMH A;  3RUI B;  2JT4 B;  3APD A;  3VVW B;  1A5R A;  2BYE A;  4HVB A;  3MHS D;  3A4R A;  4NQL B;  4TUU A;  5DPT A;  4GXB A;  3TMP B;  2ZVO A;  1V80 A;  3DPD A;  5GMV A;  2CKH B;  2CHX A;  2I1K A;  2IY0 B;  1KJT A;  2D07 B;  2M0X A;  2XK5 A;  4TKN A;  2KOX A;  4B95 A;  4DHJ B;  4BKT A;  1V86 A;  3A1Q A;  4FUL A;  3U8Z A;  3EHV A;  4GSW A;  2BPS A;  3DOW A;  4DHZ E;  3MJW A;  2MBH A;  4NY0 A;  5DCN A;  4GU2 A;  1LFD A;  1ZKH A;  2RSU A;  3KUZ A;  4M8M A;  3RZF A;  5KHQ A;  4ANV A;  4BVU C;  1WFY A;  5AZF A;  1UH6 A;  2KMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...