1HXYD

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
b'DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 66
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hxyD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hxyD02
1L0XB 2QEJC 3DWPA 2O2LD 5ELBA 1PTOD 4TSSA 1XTCD 1B44D 1FD7D 1LTBD 2J4XA 1PZJD 1STEA 1I4HA 5FK9C 1D5MC 1EWCA 1D6EC 1QILA 1TS2A 1LLRD 2RDHA 3BYTB 1RF2D 1JWSD 1SE4A 5TSSA 1YN3A 1PRTB 1PRTC 4RFBA 1ET6A 1LTTD 1I4PA 1JWMD 1ENFA 1D5ZC 3BYYB 1HA5A 1T5XD 1JWUD 1AW7A 2WV6D 3W2DA 1PRTF 1ET9A 4L63B 4RGTA 1SE3A 1V1PB 1SXTA 1PTOH 3MFGA 2NTSA 1EU4A 3DWAA 1RCVD 1I4XA 3EA6A 1YN5A 1PTOB 3BVMA 1PTOC 2CHBD 3BVGA 4O1NA 2XRQD 4RGNA 3V05A 4RGMA 5I4DA 1CHPD 2XN9C 5ELEA 1PTOF 3MC0B 1KLUD 2Z8LA 1S5ED 5ELFA 1CHQD 4RH6A 1EFID 1BCPD 3R8BA 3R2IA 1FNVA 1PYWD 4RHRA 1KLGD 1TS3A 1RDPD 4Z9CB 1G8ZD 4L6TB 1TY0A 5ELCA 1I4QA 2IJ0A 1ESFA 3O13A 1JQYD 3TSSA 3GP7A 1XXGA 4ZYSA 1MD2D 1LTSD 1V1PA 4RGOS 2AQ3B 1UUPA 1FGBD 1SEBD 1TS5A 2RDGA 3OWEB 1F77A 1LT6D 1D5XC 5ELDA 1S5BD 1LT5D 2QILA 1HXYD 1UNSA 5FKAC 1BXTA 1PRTD 2R61A 1EEFD 1GOZA 4OHJA 4RCOA 4NZLB 2ICIA 1S5DD 1FNUA 3DWQA 1SJED 1I4RA 5D3IB 1AN8A 1BCPB 1BCPC 1SBBB 2IPKD 2G9HD 3EFXD 1YN4A 1CQVA 1LO5D 1S5FD 3R2TA 2AQ2B 3KLSX 3CHBD 1BCPF 1HTLD 1I4GA 2NTTA 1M4VA 3SEBA 4K6LA 1RD9D 1TY2A 1L0YB 1TS4A 1CT1D 4RHSA 1PZID 4UDUC 1LTID 1DJRD 1LT3D 1CK1A 4DXFA 1S5CD 1EEID 3BVZA 1FNWA 2TSSA 3URYA 1SJHD 2XNAC 1KTKA 1V1OA 1HQRD 1JR0D 1SE2A 4BWGB 4C56C 5D3DA 3BZDB 1B1ZA 2SEBD 1JCKB 2XRSD 1LT4D 1LTGD 1DYQA 1PZKD 4DXGA 1LTRD 1LTAD 2AQ1B 1EU3A
chains in the Genus database with same CATH superfamily
3HHMA 4DGZA 3NWTA 2EMSA 1C7YA 1WTPA 5K36G 2B29A 3ZYYX 5LMUL 1MSGA 1MHWC 4DR5L 5IGBA 2JWZA 4XQNA 2K5NA 4J1MA 5IWAL 5LMNQ 1TWHH 2FE8A 2ZVNA 3ECIA 2V3SA 4N58A 1GB4A 4Q0FA 3GTQH 2F52A 1BMLC 1V5TA 1I6HH 2E2JB 1LQBA 2UU9Q 5G55A 2A8VA 5IYBH 1PRTC 3OSOA 1EY9A 3K80C 1II3A 1NEKB 1B9NA 4LJPB 3L7ZC 3TMEA 2NPTA 2KA7A 2DZJA 1FPYA 2A68C 3OHXC 4HCEA 5CV8A 4X66L 4IW0A 3AEFB 1GVPA 4PT5A 1VQLA 4YY3Q 2INPE 4ZOHC 1WGDA 4OVZA 4RF1A 2JZZA 1PDQA 4LCDE 1PTOB 2CHBD 3VR4A 4LF6L 2N9EB 2XRQD 3HOVH 1WXQA 3VR3A 3FAHA 4M0WB 1WXAA 1U4RA 2MPMA 1YITA 4YT0B 2F0JA 3AULA 3ZKJC 1SYBA 1VQJA 3PQIA 2F0GA 2N55A 2NUCA 1C78A 3QARA 1HCZA 1AE2A 3KYDD 2R7FA 5E6JA 5C4JH 1KABA 4G3XB 1EFID 2QEXA 4A3MH 4IUVA 1K53A 1DOXA 2PNHA 4M1UB 4A3DH 1EQQA 3DLLA 1Q81C 4GN3B 5DNFA 2N88A 1ASYA 4F8MA 4S0RA 3RNAC 3A9JA 3G6JB 1RDPD 1UE5A 2WAQE 5D6JB 4XDDA 3P63A 4KDIC 1VQGA 2IJ0A 1ESRA 5LMNL 3I57A 3ND8A 3FC4A 3NXWA 3F2UA 3Q8BA 2X6LA 4LUVA 3RMHA 3HVDA 2K4KA 3R7QA 1H9KA 2WDTB 1VQ6A 1VZ8A 4IUMB 1LT5D 3QWNA 4IM3A 4JBKA 4MELA 3N30A 3ZGZA 3VFKA 3DBRI 3M62B 1F9JA 4RCOA 2F0EA 1VQFA 5M3FH 4M01A 4AYBB 1V9PA 3HOXH 1BCPC 1OTRB 2DZKA 2PMVA 4BZAA 1Z2MA 4A3IG 1WYDA 5HY6A 4AIMA 4YY3L 1N6ZA 1OEYA 4DR2Q 2INDC 3IRBA 4N8X1 5BMGA 2ZJQA 4DR7Q 2BCOA 1F52A 1VF7A 2SNMA 3DHQA 2JUOA 1SE8A 2MA9B 2F0KA 1SGHA 1N9WA 2BB6A 3OG5A 2ATWA 4HVBA 1F2RI 3A56A 1T3QA 2NMQA 3RNUA 3WALA 4KX6B 3V62A 1KNAA 4E71A 4JBJA 1TYGB 1FO4A 3ZDTA 2IHFA 3ERQA 4KKJA 1VQMA 1EEID 5HURA 3DCGA 2DNCA 1AFPA 2TSSA 3QJZA 2OCEA 2C9WB 4DV6Q 1V1OA 3WDNA 2D3AA 4B6WA 2J7ZA 3MJ5A 2Q5WD 4FXGC 4YCVA 1AWDA 2J0MA 1EOTA 1I50B 3JW0X 5C5MA 2K5DA 1JC7A 1YI2A 2DX5B 1FGUA 1XF5L 2OTJA 1CMXB 1MI0A 2C7HA 4K2KA 2KECA 1WVLA 1YNTE 1DYQA 4LF9L 5I6WA 1OEYJ 2G45B 1YQ4B 4I6LB 1XCTL 3STBD 2PPBC 1RJTA 3EFUA 2EYLA 2L5TA 1WX8A 3A9KB 1ILQA 3IL8A 1FRDA 1QZEA 2ZZPB 5CHVC 3S1NH 1VS0A 4MZ9A 4OONA 2KAJA 2LGSA 3HRDD 1K3BC 2AL6A 4P16A 1BO0A 1JWSD 3CMMB 5TSSA 3KUDB 1K50A 5IYBG 2CJNA 1ENFA 1GUSA 1SYEA 5H8YE 1R4MI 5IE8A 3S16H 3BYYB 4AOFA 3H3VC 1I6HB 1HZBA 4DR7L 3N1ZC 3PSIA 2B63H 4ZAIA 2LY7A 3W1BA 1P3QU 2BYVE 3GE3C 3IHPC 3S17B 2NTSA 4NJ6A 5J2RA 4W9CA 2EJGC 2HUGA 3TS2A 1VQNA 4DQOC 4XYOA 1CTMA 3ONAB 1C4QA 2BW2A 3DPDA 3NUHB 3CCMA 2RCFA 3JVZX 4RGMA 3HOVG 4XIGS 2FJ2A 1XMOQ 3FMCA 2KN5A 2M19A 3UF8A 4CDCC 2JA5H 3QIAA 4KGSA 2O2VA 2LMCA 4LDTD 4K3CA 1NENB 2J7QB 1AYFA 4LNNA 3GTGH 2M4NA 3VR5A 5C4ZA 4A3MG 2LSSA 1GD7A 4HIOA 1A70A 1TIFA 5C0XI 4A3DG 1YD8U 2WXMA 4ZYNA 1F0ZA 2IGHA 3IG3A 1QF6A 4A3MB 3J7AV 4HJKA 1DD2A 4GB9A 4PZ8A 4KIKA 3W3AA 4PQXA 1JROA 5CHFA 2MEKA 3O13A 2R93H 5ELNA 4TQ1A 2GRIA 4JL9A 1R9TH 3HS0C 1ZPSA 1NJIC 3RZFA 1WM3A 2I5MX 2NVTB 3E9SA 4USAA 1UNSA 1TWAB 2NCNA 5C0XJ 3ZW3A 4GU2A 1LM8B 4K81A 4AH6A 1T9HA 4P74A 1I4RA 4HIDA 5DPWA 3SD5A 5M3FG 1HZ6A 1OGWA 1TKEA 3HOXG 5GXGB 3EFXD 5EQ0A 4L5SA 3BJUA 3TZDA 2E74C 3RN9C 3HOXB 4G0NB 2K14A 3ZIMA 3DBHI 3F1ZA 4K7SA 1CI3M 3VUXA 1UWXA 2CHXA 1C79A 2ZT9C 1RD9D 3JYUA 3QA8A 2B2YA 3KBXA 1KHIA 4KN7C 2IYDB 4AUQC 1A8VA 2XBBC 4LF4L 1UE1A 3ZJUA 3MXGA 1GHJA 1ZXTA 3HOUG 3VAWA 1FJGQ 3NRZA 3Q8AA 4O0AA 3M3JA 3IFTA 2L1AA 4EVOA 1HTPA 4UP8A 5C4HA 5HFYA 4B9WA 3A5UA 2NBUA 5EAYA 1V97A 1HTOA 3CMAA 4CDFC 2L7RA 4NJ7A 3AE4B 4A3BH 1EUJA 1TWCH 5CTRC 2VQEL 3HKSA 4OIJA 4H0LC 4W9LA 2AYOB 1I4HA 2JA9A 4TKOB 5FK9C 5IP9H 3GTOH 1CKMA 5JJKA 2F0PA 1C8CA 3Q6SA 4XXEA 3H3VH 4DV1Q 3P4SB 4LFBQ 1FEHA 1PRTB 1L1OC 1JJ2A 2NS5A 1EY5A 2IT1A 4POFA 4JG2A 4QJFA 4GKKQ 3R3OA 3KLRA 1BF4A 1SE3A 2B63G 1WF9A 3SHLA 1STAA 3MFGA 1IGCA 2D0OA 1UD7A 2JWUA 2PVGC 2F3IA 3CC2A 3GZNI 4DV0L 1Z6HA 3HOYB 2PYKA 1PYBA 2DENB 2L52A 2B63B 3HM6X 3K5MA 1Q8IA 3Q3MC 4NAMA 2RCNA 2WXGA 1JOOA 5E6PA 1EL0A 1YHBA 2A19A 4K5VA 3DHGC 4FXCA 4DPGA 5M9OA 1WI0A 1WD0A 4ZHOA 2HIVA 1PH6A 1XPUA 4L23A 1TU2B 5GAEC 2JA5G 4ANVA 3EJIA 3J80L 4NB3A 2BYEA 4J8QA 1LTLA 4C3JH 2W3SA 3U7ZA 1WTHA 2CKZB 3CCLA 1KLGD 2JA5B 3VUYA 3W1SC 4JOIC 1C9FA 1YEZA 2WXJA 1JICA 3NENA 2K33A 3S2HH 3AN1A 4Z9CB 5KRUA 4R4OA 1J5EQ 2NVQH 3GTGB 1PFDA 2NVUI 3AECB 3C19A 1KDBA 5DM73 3K5LA 1VQOA 2R93G 1V1PA 2HDEA 2KQSA 3K0XA 3UI3A 3AXCA 3PO2H 2ALYB 5JH5C 3GB1A 3GTJH 4LFBL 3LNNA 1DOYA 1IBXA 1RFKA 3ZNHB 4ANXA 3QR8A 1TIID 4QUCA 3HGBA 2PPHA 1D7QA 2NBFA 1SLJA 2HDLA 1FNUA 3PIP3 3VUWA 2D0PA 1AN8A 1BCPB 2ICEC 5D14A 2CW0D 2JY6A 2KJRA 4JI8L 3H15A 4K8JA 1N34L 1CQVA 5DEHA 1QOAA 4US8A 2HCCA 1VQ9A 3M95A 2A73B 1SNQA 3CU7A 1M4VA 1NE3A 3J80c 2YU9H 2LUMA 2KWUB 3B2GA 1SNPA 2MQHA 1BDOA 1YJ1A 4EEWA 2PW7A 3ZJTA 1XLQA 4RNAA 4HDOA 5L83A 1HZ5A 4BOSC 3V6EB 2RDFA 2VB2X 2K05A 2JEAI 2M00A 1C4AA 2LXCA 1ZEQX 3S1QH 1ROEA 3NELA 3UE0A 4P1CC 1STNA 3OIQA 3BVZA 1FNWA 4V0BA 1BNZA 4BBSH 1VDVA 1Y1VB 3GTMH 2HT1A 1ISNA 3S14H 5AUKA 3NG0A 4PK1A 5KIXA 1YNNC 4IFDI 3DWGC 5BR8Q 1IBML 1DCZA 2A6HC 3U50C 3M3YB 3UQAA 2F0OA 4GIVA 1CKNB 1MJEA 4JBMA 4EKUA 3AB5A 2V3NA 4POGA 3B0AA 2KTRB 4PYZA 5G2NA 3MHBA 2LFIA 4E6IA 4A3BG 4B0MA 4OL7A 1FFUA 2F4IA 1FD7D 1LTBD 4N59A 4KKUA 2Z6KA 1TWCB 3X3NA 4EE2A 2F3VA 4CJ2C 1CSQA 3CCRA 2OTLA 1SSNA 4N6EB 4UP9A 4C3IB 2K03A 5IP9G 1QILA 2ZPNA 4IFDJ 3KVFB 1BKBA 1C76A 3V61A 4AJWA 3V60A 1D3ZA 3ZO5B 1SE4A 3QAQA 3GTOB 2OT2A 1RKNA 4N9PA 3Q8CA 3K8AA 4KD3A 2ZJRA 1VQDA 3K7AH 2LASA 2AKWB 2NN6H 2EKIA 1AW7A 1X9NA 2OJRA 4MACA 2BH8A 3GO5A 2YTYA 4YIJA 2UUBQ 2HCIA 1NBFC 4A93B 2B2UA 1Y8OB 4YSYB 3NP8A 5C6AA 2RPVA 3H1UA 2RDBC 2E2DC 1TQOA 1YJWA 2LGIA 4YWGG 2KDFB 4MHEA 3RLNA 3A1QA 4R1JA 5I9OA 1WR1A 1KFYB 3QIJA 1PXUA 3M4QA 3AYHB 2KWCA 1OXSC 2UXCQ 2GI9A 2K0PA 4XYCA 3I73A 2R92B 5IAAC 1M8AA 1R4NI 2A6ED 3VYUA 1YBYA 2K28A 4FDBA 2GOWA 5BYQA 2YTVA 5BR8L 1WGKA 3H8HA 1V49A 4NXMQ 4E74A 2HTME 4X64L 4IJHA 3WCQA 3I3TB 3AEGB 2KTFA 2GA4B 3IFDA 4C3JG 4GOPA 4NPSA 2UUCL 5L95C 3NQTA 1RHPA 1SIJA 5IGCA 1GUOA 4NQKE 4KJOA 3PGZA 3OPOA 5ELCA 4IUUA 2ZPYA 3DWMA 3I9V1 4ZYSA 1WE6A 2CVRA 2W54A 3S2HB 1IUEA 1AH9A 4K7WA 4K1RB 5IT9L 1FGBD 5AZFA 2NZHA 1RIPA 3DVNV 2BH2A 2EIFA 3NTKA 1HXYD 2K8BA 3RNEC 3M85A 2JJQA 4JV5L 1JMLA 1Y56A 2BKFA 4MH8A 2EDGA 3ALBA 5JAVA 5C4XH 3PO2B 1IYJB 1EYCA 4L8JA 3OMGA 2GN5A 1F2MA 2KMMA 2KDBA 2UUBL 4A55A 2Y5PA 4ME3A 2MJEA 2B2TA 2QCPX 4XTCS 4MTNA 2BYFA 2EYOA 3Q23A 2KFKA 3KWVA 2AQ2B 1VQBA 4IM0A 1XNRQ 1WYGA 3CQZH 3S2DH 2NVXH 3GTKB 2VZAA 2KEDA 5L37A 4KHPL 4JX1C 1QVGA 1HFGA 4BY1H 2JRHA 1CT1D 1OXVA 2B2WC 2DN8A 4JK1C 2VRRB 5LXIB 2YU9B 3BK1A 3PGEA 2CQAA 1SYCA 4DR1Q 3AU7A 5AFWA 1GUGA 2JXMB 2VQFL 4A76A 1NY4A 3K9PB 3UIPB 4IJLA 3IKJA 2XVSA 2KC1A 3D32A 1CM9A 2ZJPA 1HZAA 2CR5A 4NXML 4JWUC 1O78A 2DJFC 5IT9c 4BBSG 3VH3B 2N9KA 5KEEA 1ONLA 3I4MB 1OTCA 1QCBD 4YSXB 4BBSB 3VHTC 1O7YA 5KYLA 2ASQA 1STHA 1WTWA 2JYEA 5D3DA 2F0SA 2XRSD 1UAPA 3PUYA 3KF6A 4RG1A 3AEVA 2EKEC 2NZOA 4MM3A 3M9BA 1AEXA 1C9OA 2QEJC 4RMFA 4II2B 4DBGA 2LHEA 3TEXA 4L5QA 1VD2A 3T1HQ 3MTSA 3J80i 4DN4M 2ON8A 4DK3C 3HUIA 1ZGUB 2BF8B 4CKBA 3TMPB 5A2QE 2K5PA 3KF8B 2Z4IA 1RF2D 2K50A 1YN3A 1IYFA 2CU1A 4DR4L 2WDQB 2UUAQ 5JVH3 1GNUA 3GV3A 1T5XD 5M5XH 3PT2B 2NN6G 2VH2A 1ET9A 1Q90A 2IHEA 4RGTA 2O4XA 4DV4Q 3AMUA 1OFFA 4WJQA 3WIMA 5BYSA 1EFWA 2RBMA 1L4DB 1HA6A 2C7NB 4G11A 3A8JE 3BZCA 1QKZA 2D11A 2WX0A 1K8GA 4DR1L 3PZ7A 4AQYQ 1LUZA 1E0ZA 4O1NA 5BN3A 1XQQA 4K3BA 3DBLB 4A3OA 4N8FA 1ICFB 3HP3A 1BBUA 4EOYA 3V96A 1HR0L 4X6AH 3L4PA 1GUWA 1YHQA 1VQEA 3NTHA 2KBNA 4MEMA 1NNXA 4LTUA 4Q2JA 5IODA 5FR6A 1WTRA 1U4PA 1DZ1A 1XMQL 5IA7A 5GADC 2MWSB 3K81C 4IWPA 2ZNVC 4HPMB 1SNOA 3DUZA 3TQYA 1E8ZA 3D4DA 4A3GB 4J15A 4HIKA 3MJWA 2OHFA 2KMCA 1ML0D 2JZ3B 1C0AA 1WFQA 2YEPF 2XSCA 3K5OA 4RGOS 2LWPA 1UUPA 1JORA 4TMAB 5C3WA 4A3LH 3N32A 5LHY1 4GSWA 1FYCA 2WDVB 4PYUA 1WOCA 5ELDA 2WXKA 3LJ3A 2DYMA 3KUZA 2WXNA 5E6OA 1PA6A 5M3MB 1WMHA 4NQLB 3MXPA 3DWQA 3TS0A 5C4XG 1S3OA 1A5RA 1UBQA 3U9OA 1SNMA 2EXDA 2JXTA 1S5FD 4DAPA 4JQWC 4MJSA 4DDID 2Z4HA 4EQ5A 2JA8G 1BUIC 2K22A 4MGYE 1NAPA 1J9OA 1QJOA 4S17A 3PTFC 4AQYL 4ARIA 3HIZA 1WY8A 3WAMA 2KQ4X 4PG3A 2JQRB 3CQZB 2QGQA 2NBVB 2EYHA 4BY1G 2UXBQ 1E6EB 3A33B 3BK2A 3APFA 4BY1B 3A0JA 1WI5A 4BBNF 4YXDB 1K83H 2MGSA 1B2TA 2ZM6L 1QOFA 2RMMA 2FCQA 1ZYRC 1ZKOA 1NR4A 3SXHA 4W9HA 4XX5A 2MBHA 3C1EA 4LW1A 3FPPA 2QC8A 2WXLA 2MHJA 5BMIA 1L7YA 4FULA 1E9MA 5J3BA 3VYTA 4GDLA 1EY7A 2BE5D 4PMBA 2F0DA 1I6VC 5E4XA 1DOIA 2A5UA 1KH0A 2WXQA 1K9MC 4JI7Q 1GAQB 1A15A 4IPGA 5I2XA 4OWWB 1FXAA 1TTNA 1IYUA 4YSZB 1SYGA 4A3FB 1IBLQ 1E7UA 5DPSA 4ZRJA 2M0AA 3WA0A 3PV1A 1QZGA 3AE3B 3JC66 1NMGA 3TL5A 1LXDA 4OZCA 1I50H 1YVCA 5LXHA 1ET6A 2JU6X 5CBAE 3CAMA 3CF5A 1PV4A 1J7BA 1E8YA 1L2NA 4A20A 2WXIA 1MVKA 4BVUC 3H94A 2K6AA 1KXLA 5EKIA 2D2CC 1W3SA 1TT5B 3BIID 4AJYB 3QC8B 3LB8C 1Q7YC 5EKKA 1C77A 1STBA 2MBQA 1QWYA 2UXBL 1WSPA 2QHOA 3DWAA 2KQ3A 4GNXC 2HJ1A 4M02A 1HTQA 4HTHA 1V6EA 3VRAB 1LACA 3TZUA 4NDXA 4NKLA 3P42A 1E22A 3E0EA 1KRSA 1SYFA 5CMDA 3NEMA 3OTOQ 1XLPA 3BG3A 1IW7D 2BA1A 4B3TQ 3MC0B 4MTKA 1Y8NB 5IOCA 2LUEA 3SDLC 3U4EG 4B3SQ 1BQQT 1K8MA 4ME5A 4MN3A 2WGSA 5DPTA 4FF4A 2PMZE 3RZWC 4IQZA 4FF1A 3CW2C 1OO9B 3S17H 1E8WA 3EC8A 4W9KA 4BKGA 1CSPA 2A69D 4IUTA 2LGYA 1X56A 4JI7L 1VQHA 3EVQA 4HMIA 4KJNA 3BINA 2CJOA 1I4QA 4W9EA 5C23A 3L54A 3TSSA 1LM0A 4L2YA 1IBLL 1ZDXA 4HK2A 3H7PB 3IVFA 2BYTA 4ZUIA 2Z1CA 2QDLA 1SRUA 1X6OA 3LGJA 4YTPB 4CJ1B 1LT6D 4F1SA 4A3LG 1D5XC 1RRBA 1S5BD 1D2BA 3RUZA 1WWTA 3JAML 2R61A 1PRTD 3EN2A 3I4NH 1P0RA 1PFSA 1P9DU 2R2QA 1B7YB 3N1XC 4ZRKA 3T8MA 2VZKB 2Z59B 1S1QB 4X3SA 3ML8A 4ZCKA 4GGQA 2A68D 2LRUA 3HG9A 2XK5B 1WYWB 4LFAL 2WP8J 2F0LA 5BMHA 2JK8A 3I70A 1ASZA 3QOLA 4IZ8A 4DK0A 4DAYB 4W9JA 3I56A 1EQTA 3A7AB 1MG8A 2UWQA 3MHSD 4URKA 4P7IA 4LAAA 1QZHA 2OQ0A 4OO1H 1EY8A 1M94A 2NVTH 3OLMD 3OTOL 2ACZB 3TP8A 1TWAH 2J52A 3KDFB 2R6GA 4OELB 2UU9L 3ULLA 2NPTB 2B2VA 2L12A 1TJEA 3QWZB 4MSMB 4AYBG 5C5LA 2KHSA 1QOGA 4H02A 1K8RB 2EPBA 2F0WA 2WXHA 1WE7A 1NR2A 1JJCB 4ARCA 1K83B 3JAMc 5IYDH 1YX5B 2C35B 3L9AX 2JA7B 4OIKA 1PLFA 4JI2Q 5HGQA 2EJFC 3RLOA 2AQ1B 4WJOA 4RM8A 3L3OC 2I5HA 1QT9A 4GN1A 1K8AC 1KOTA 2IGGA 1JRUA 3IT4B 1C3TA 4C1NK 2D3GA 5K5PA 1N36Q 3DVGX 4FADA 3RFZB 4F8CB 3A9KA 2M0XA 2M2LA 4FNFA 2VH1A 4K5WA 1VMCA 1VQ4A 2EYFA 2ZTDA 3LX0A 3A9JB 2YV5A 1GG3A 1Q1BA 1D1IA 2L76A 4M8NA 4A6QA 2LHDA 4NAWA 1MGSA 2FXQA 1KIXA 2KZRA 1RTOA 1YHAA 1F9PA 1PH5A 3NQIA 4KMUC 3VYSA 1SXTA 2DLBA 1SYDA 4CQNA 2LKVA 4BA1I 3L13A 2AL3A 4WWPA 1EY4A 1EYAA 4B3RQ 3J9CA 4GLXA 5FR3A 3OOCA 3DMUA 3K59A 2Q8TA 5KNDA 2MNAA 4YL8A 1YJIA 5FLXc 2Z9HA 2PZTA 5AZGA 2L9HA 2LD9A 3AB9A 3RCZA 1EZ6A 2EELA 3NHEB 4ANWA 2JVCA 4K0KQ 3ZJVA 2K5VA 4DR3Q 1Q86C 2BB5A 4GKJQ 3PRZA 4ALPA 2LFNA 4IOIE 3A74A 4DR2L 4OW0A 4RHRA 2X69A 2KCMA 4QIWE 1L2FA 1E90A 2ZNVB 1TS3A 3HOYH 1G6PA 2KVRA 1I7HA 4HJ5A 1L6VA 1Y14B 1PH1A 1NSNS 1Y69U 4FLHA 3RN2A 5F2DA 5BN4A 1UWMA 4KD4A 2D3BA 2KD0A 2NZ1D 3M4PA 1VQ5A 3AEBB 5T1GA 1U5KA 4QF4A 2KDMA 2TMPA 2QDFA 2B76B 1UEBA 2KFJA 4JIOU 4DV6L 1PDXA 4A3PA 1UE7A 5IP4D 3F8TA 3I4NG 3AFQA 2ICIA 2V9HA 1EQRA 3RZOH 3HK0A 3VTWA 3B9JA 2R7ZB 1PFNA 1TR5A 5JEAJ 2GBRA 2V3PA 4KSLC 1SMYC 1K3RA 2FMCA 2G9HD 3I4NB 4NXNQ 2BS3B 2WS3B 5JXVA 3OMCA 1RYJA 2FBWB 1Q1OA 1R4MB 2LJIA 4OZBA 2CWPA 1SE9A 1FCLA 1VR9A 1EUVB 3A5ZB 2WACA 3NBHB 2ID0A 1PHJA 3TREA 2EY6A 4FXKC 1H9JA 4BXXH 4JYAQ 2BTEA 3SE0A 4OO1G 2WLBA 3PHWB 3ZNID 2FMMA 4K0KL 1YX6B 1S5CD 4KV2A 3ZXVA 1F2ZA 1X3QA 4A75A 4GKJL 3U4VA 2G5DA 2WP9B 3VH4B 2MO1A 4DV2Q 1WR6E 2D10A 4MGIE 1EZ8A 3BU2A 4R4IA 3L0OA 2V4LA 3V2TA 5HGTA 4C7YA 4UPAA 2MBEA 4EZJA 5I9PA 5LLIA 5IYDG 4KDLB 1PGBA 4HWIB 1UELA 3K0YA 3WOFA 2KWDA 3BDOA 3AE2B 1VQCA 2WKDA 4P71A 1WD1A 2MH7A 1SNCA 2CKHB 4G7OC 2HE7A 3DBSA 2MHVA 2O2VB 4MT5A 2JT4B 1STEA 1A0IA 1XMOL 4JI5Q 1Y1VH 2MX2A 4YHHQ 5C1ZA 1D5MC 1Z5SB 4DAVA 1B50A 2QA4A 3TCAA 3FPUB 4CDEC 1VQPA 2E5LQ 3M3YH 1JWAD 3M7GA 4TQUS 3CCQA 2ES2A 1GKHA 1QUQA 4KV6A 1YJ9A 3K57A 1FMAD 4IN3A 3QHTA 1KAAA 1PQSA 4CYEA 3MC8A 4GNXB 3X3MA 1JB7A 3EA6A 3NVZA 1N5XA 2DJGC 2K01A 1ILPA 2KO3A 4C3IH 3RNGC 4MIUA 2DNEA 2D5DA 4I65A 1N62A 1EYDA 3J81c 3VR6A 1HEZE 1AP0A 1V80A 1EY6A 5FLMH 3QX1A 1L4ZB 3BS1A 3SGIA 3E0JA 3ICEA 2Z8LA 1WJUA 3CCVA 1P7FA 2BA0A 5A35A 1YIWA 3AE1B 3K58A 4QUFA 2GBMA 4BKSD 1PYWD 4CBVA 4A93H 1PVOA 3JSVB 4DAMA 2PVOD 5AEKB 3CD6A 3AEDB 1R4QB 2Q2IA 3RLFA 3HOYG 3PCOB 3VRBB 3Q0AA 3S1MH 2LI5A 1GO3E 1XT9B 2Q8IB 2JPHA 1HZCA 3TP6A 1AZQA 1E8XA 4ZRIA 4LK0M 1OQYA 2LVQA 4GDKB 2R7DA 4J3OD 3I4OA 4QMGA 4MSQB 2R92H 3RUIB 4N9TA 5CGKA 3I8ZA 3MEHA 3ZLZA 1VMPA 3AI5A 2VNUD 2M9VA 1IKLA 1FJGL 3ULPA 3OW7A 1ACCA 4WH4A 2IGDA 2QSDA 1JB3A 3CPWA 2FUG1 4DHZB 3PIOA 2KDIA 1SBBB 4DR6Q 4ITKA 4JLCA 4ANUA 1KD1C 1TZ1A 4KSKC 1S40A 1Y1WB 3VR9B 1Z7TA 2LGXA 1B70B 3C1FA 3RZOB 3RI7C 2A5HA 2BWFA 2H5XA 2NTTA 4BA2I 1CQFA 1B53A 3ZNZB 3ZRCA 1UGMA 2K6QA 3QO2A 2ZJDA 5EE9A 1PH3A 2EY2A 4DUZQ 4B3MQ 4KGRA 1GJXA 4BXXG 2WHIA 3ONSA 3RNCC 1IXRA 2EOTA 3S1RH 2UU7A 3GZNB 2RR9A 3SK4A 1N33Q 1WGHA 3CIRB 1RTNA 4DV1L 3AFPA 4AYBE 3PRMB 3UE1A 3UINB 1A62A 4KKTA 3WAPA 4X3TA 3TEZA 4JI1Q 2FIDA 1Q3LA 3I5JC 2HTHA 4C4VB 4GKKL 1K0RA 2KYWA 1KF6B 1JR0D 1JOQA 2HIXA 2WU2B 1SE2A 3VDYA 3GTKH 4ODGA 3E6ZX 1UEAB 3FRPB 3PVLA 2F0MA 2N49A 1KRHA 1LT4D 1LTGD 1PZKD 4DXGA 4A4IA 3H6MA 1P16A 1EU3A 2G4DB 5BO4B 1R7SA 1YNJC 1YIJA 3L16A 1XTCD 4R8IA 3U9SA 2KENA 5JJIA 1WH3A 4GXBA 1Y8RC 2Q8RE 2KTRA 1UH6A 4LNFA 1GUTA 1TWFH 2BBCA 1EWCA 1Y1VG 2KC2A 4HXDA 3I4MH 2L11A 3CPFA 1HNZQ 4RFBA 2WYQA 2C5LC 4KY6A 4C3HH 5KGUA 1MJDA 3VTUA 1HA5A 4B9KA 4OWTB 1ICWA 3BWUD 2EXZA 3FILB 2JYTA 1J5EL 3J7A5 5HHDG 4F87A 2VXWA 1V1PB 4CHKA 4BKTA 4XDXA 5FO9B 4G50A 1KLVA 2WNMA 1L0VB 4CO7A 1E1OA 4OX9Q 5JPNC 1L5PA 1IBXB 4C2MH 1BUVT 1I4XA 1WXVA 3BVGA 1WCMH 3PS6A 4US9A 4C3IG 1QNKA 2H89B 4P73A 5HG2A 1UE6A 4JI1L 2K5WA 2NVYB 5E1FA 1H9MA 2XN9C 2H1EA 2XTIA 1CA6A 1DONA 3H3VI 1WGYA 1NYQA 4JPSA 3CSFA 4OGQC 1IL8A 2GVBA 2JP1A 5FLMG 4OEMB 5ELFA 2CFMA 3VA5A 5CR3A 1YNND 5COYA 3RZDH 3APCA 2A6HD 4H7BA 3K5NA 1RL2A 1UWVA 3C2PA 1VZ6A 4ZK9B 5LL6X 4JVZA 3FKIB 4HPPA 2WFWA 4A93G 3G6EA 5IGGA 3CF6E 3UGBB 2L4NA 2O6VD 2VUMB 3VXWA 3TEHB 1XTDA 2ZXOA 3NVWA 4Q5VA 1SFOH 2MBBB 4XQJA 1LYLA 2HDMA 1Q10A 1OQRA 2E2HB 4ZKCB 2FNJB 5FOBB 3S1MB 3OWEB 4HAEA 5D65A 2R92G 4EQOA 2WX1A 4JI0Q 1JE4A 3D6WA 1HNWQ 4WORA 2N1WA 4PZ6A 5FKAC 3E9IA 3A54A 3CCEA 3NUCA 1BXTA 3I7FA 3ZDMC 4D2KA 2M56B 4OHJA 5E4WC 3SK5A 2E2IB 2KK8A 1TXYA 4IC7B 1GUNA 4LDTB 3TIXA 3Q8DA 2NBWB 4A3GH 2NWGA 4HDQA 3ZTDA 1NYRA 4GLSC 2JA6B 2EE1A 2OXPA 1PUTA 2GBNA 1S3SG 5CV4A 3PO3B 1FIQA 5LNK1 1Y8PB 2I38A 2DBYA 1PH2A 4WAFA 1L0YB 1TS4A 2PZWA 5AJ3Q 4L5RC 1AARA 4UDUC 1VRAB 2N3SA 3HZXA 3N6RA 1X3FA 1TWGH 5M3MH 2N4FA 2KOXA 1YJJA 4ZDVA 3NPPA 3J7ZC 1NMFA 4LFCQ 1STGA 3GTPB 1V43A 3PO2G 3CMEA 1IP9A 1H9SA 1YMHE 3SK8A 3RMKC 3S1RB 3AQQA 1SR3A 1IBKQ 3ZXRA 1XJVA 3W5UB 3KJPA 5JZEB 1T0SC 1FM0D 5J39A 1R4NB 4A90A 4PS8A 3MXNA 1ENCA 2Z6BA 3DHIC 2K25A 1B1ZA 1XO3A 1JCKB 3X0WA 4BFRA 4NJCA 2M8SA 4BKSA 1A2UA 1Z47A 2KHIA 4MNOA 1CUKA 2B8GA 5M5WB 1VQ7A 4HEA1 1FXTB 4L1BA 1PTOD 2BKRB 4JI0L 3ZNGC 1B44D 2IX3A 2KJHB 2UXCL 2PIAA 3X23A 4X57B 3NY5A 1X3GA 2SOBA 3S15B 2UXDQ 4K6DA 1RODA 3NS8A 1QVFA 4WURA 4C7ZA 2CHZA 5MPOA 2RDHA 3T4AC 2LGDA 4GOPB 4V190 3I4MG 1TWFB 1UGJA 4RA8A 3LDZE 4JC0A 1WM2A 4C3HG 2PI2E 3PZ8A 1RM6C 2PE6B 3N9YC 4FN2A 4EQNA 4WJNA 2WV6D 1PGXA 2D9UA 4NP5A 3FDTA 2N9LA 3MTNB 3AEAB 1L1OA 4DWFA 4C3HB 3VDZA 5J1ZA 3T3NA 3E3XA 1J6QA 4GLVB 5AJ3L 2FINB 1U4AA 3P75A 2HHHQ 3ULJA 4A3FH 1IGDA 1P8LA 2KDEB 3Q8FA 5C3JB 3PUXA 2WAQB 3SHQA 2JN4A 4EZKA 4RAUC 1WCMG 1GHKA 4C2MB 1XCQL 3HVZA 5ELEA 3TN2A 5EE0A 1PTOF 1ZKHA 1WCMB 2PQAB 3QK0A 2PLPA 1TGZB 1XWEA 1GC7A 3IBEA 4MH0E 3WAOA 3MAQA 2AHOB 1XEEA 2IDYA 2NN6I 1TKWB 2EVBA 4LUZA 2Y5CA 4P1BC 1A2TA 2KMAA 2F0QA 4K14A 1XNRL 2IBIB 2MP2A 2X38A 4LNOA 3ZQ4A 1Q46A 3RZDB 2BQQA 2RHSB 2MQJA 3A55A 4A3CH 4IPHA 1Z9FA 1KQSA 3L2PA 5CC4A 2MO0A 4WQOB 3W1SA 1ESFA 3D31A 4JOIA 1HZ9A 1I94Q 3W9CB 4REZA 1WGRA 4LF8Q 2UXDL 4IUNA 5EDSA 3QCAA 3KUCB 2DHZA 5IN7A 1FXIA 2V4DA 1SFOB 4TRDA 3J80E 5M5YB 3DVGY 3J7YW 1OXTA 1F2RC 4DKAC 1NTGA 5G3LD 2KLCA 1GOZA 1R4PB 3N1YC 5LL6S 1S5DD 3KF6B 1SJED 3GQBA 1NI3A 2WKCA 4ASWC 1DOLA 4HKZE 4JWSC 1V9JA 1E3PA 5KNCA 3CXCA 1YN4A 1G291 4XWWA 4A3GG 2V0GA 3R2TA 2BGFA 2XWJB 3KLSX 3CHBD 3L17A 3RD4A 2FCMA 2GBJA 1WTXA 4FF3A 3KQ4A 3GD7A 2IX0A 3DXJC 4K6LA 3N52A 3J7AF 2OQKA 3RPFC 1EF5A 1PZID 3T1HL 4BBNC 4UAIA 1V8CA 4LUOA 2PO4A 1E24A 1EOVA 2RA4A 3KWLA 2HD3A 1VCBA 3EROA 5M3MG 3F2CA 3H91A 2DAFA 4HEDA 1T0QC 2KJ6A 3A4SC 4HJGE 2UUAL 1LFDA 1VQAA 1H9RA 4C1NI 4CDDC 5JPMC 1TWGB 1VCIA 1XPOA 2FAZA 4DUYQ 3HOWH 4ZUJA 3P2BA 3EIVA 1I5FA 4IALA 4B08A 1ZW7A 1CKOA 4KTAA 3CRKC 1N63A 4DV4L 4KY5A 1WJ6A 2I1JA 3AH7A 1DGSA 4FHKA 5G3LF 4NY0A 2RSOA 2J0TD 1RLFA 2N9PC 3KJOA 4A3JB 4FF2A 1J8IA 2SAKA 5DPRA 4FBJB 4JW0A 3DWPA 1EIFA 2O2LD 2KACA 1B9RA 1EIHA 4CKEA 2DY8A 5EBCA 3Q69A 4LLGM 3P4RB 1PZJD 2O6VA 3KH0A 2KOLA 1QE6A 4QY7A 4YTNB 4ZHPA 2E3TA 4FP5D 1LLRD 2K7VA 3T3OA 3KK7A 3L08A 5C44B 2JA7H 2EZVA 1O7ZA 2QIEB 3HM3A 4LF7Q 3NBIA 2GVAA 3MWYW 4K2LA 3G7LA 3KYHC 5CV5A 5IGEA 5FO7B 4WFN3 2KKCA 1OXUA 2O5IC 2GB1A 3AE7B 2E75C 2A4ZA 4J6HA 4PS7A 2I46A 1EU4A 1LV9A 4A3KB 4DNRB 3TBIB 3C46A 1SN8A 4HN7A 3I91A 4A3FG 3BVMA 4PZ7A 1B8AA 3BDCA 4UP7A 5GMVA 1H4RA 2I5LX 1QB5D 4DR5Q 5LMUQ 1I42A 3VA7A 4DUYL 3E5SA 1ZYRD 5LMNW 1CHQD 4RH6A 3C3LA 1FFVA 2KVZA 1MJCA 2OEDA 1A3VA 3IAS1 4RKLA 4XGAB 2WB1B 5IOIA 1HRJA 5C2TB 3DEPA 1NVID 4X66Q 1G8ZD 2KCCA 4A3CG 1EIGA 3PIPA 2FIFA 3V3XA 3WANA 3L10B 1E1TA 1GC6A 1G6ZA 1MD2D 1NUCA 4W9IA 2LXKA 1PMRA 3ML9A 2ENBA 4R3DA 4NW2A 1F77A 3UI2A 1GM5A 4EZLA 1EWIA 2XGTA 4BAXA 2BDOA 4HSPA 3OIPA 2MCNB 2PEAA 3PUVA 2RVLA 2KJXA 2F0IA 3I90A 2UYZB 3E56A 3O65B 4M0WA 4HCSA 4KK7A 2IY5B 1NDDA 4RM9A 3DDCB 1GJZA 2F0FA 2JX5A 1JE5A 5GQOA 3NHHA 1HH2P 2B2YC 2EQSA 2P5ZX 1BR9A 3U30A 2L0TA 5IT9E 1G51A 1HTLD 5CORA 2KHWB 5JOBA 4JE3B 2XK5A 3P20A 1E2ZA 5AZHA 2KN4A 2IY1B 4ICVA 2N1VA 1VZ7A 1FCCC 1UZXB 4DAYA 1DOMA 3EUB2 2WXRA 5D7GA 4XZ4A 2IL8A 4WJ3M 2BOSA 2B2WA 2N8NA 4HR7B 4CJ0B 2R7ZH 3IAYA 1XYIA 3ENEA 3URYA 2D3CA 2XNAC 1MI2A 3KDFA 4OVUA 3HOWG 3I3CA 4OZAA 4IG7B 3NE5B 3RNFC 3F2BA 2YTXA 3HOWB 2PE9A 5IO9A 1MFWA 3Q3JA 2C60A 5JEAH 1U4MA 3J81j 1O7IA 2V4IB 1A3TA 4F7XA 3LYYA 4WIPA 5CV6A 1MHHE 4R9WA 3AMZA 4ZRPA 4CGYB 2K52A 2KXJA 2IO0B 2K04A 1GUAB 1IYVA 3DM3A 3H7SA 3W1YA 5FO8B 2N0SB 2KT7A 2H88B 4B3TL 5DLQE 5IYCH 1TS2A 1Q0WB 4B3SL 2K1BA 4Y52H 2RD0A 4OWXB 3D8GA 2QKIC 4DA2A 2C5CA 2JA7G 1JWUD 2WDRB 3AV8A 1OXXK 1PRTF 2LS01 4IOAA 3W5VB 4DU9A 1LABA 5C0XH 1K51A 2OJWA 1S4ZA 2VS1A 1H8CA 1O7LA 1B3QA 1G2TA 5FLXL 4LF9Q 1C48A 4IM2A 1YN5A 1MHXA 2B3AA 1E7ZA 5FJ8H 3NZ3A 5I4DA 1HNXQ 4NNJB 1H95A 2R2OA 2ZCBA 4QAYA 4WJWA 4YWMA 4MGZE 2REXA 1VDZA 3N3KB 4LNQA 4JI3Q 1EWYC 4LK1C 3TEYA 1BCPD 4HJAA 4H13C 1S72A 3R2IA 4CHTB 5G5HA 3U8ZA 3B6YA 2IZVB 3DBRB 4A3IB 4CKCA 1M1KC 2YEPB 1T5EA 2WIIB 5T1IA 4DHJB 2EJMA 3WOEA 2N7JA 1WGGA 4PMCA 5KHOA 3F2DA 1WRIA 3LWUA 3PSEB 3STBC 1LTSD 3ITPA 4B9XA 1E5WA 4IUPA 3Q8EA 1SIFA 4O2DA 3HOUH 1N32Q 4K7UA 5CYUA 2Z0EB 1SAPA 4DXAB 5JHBA 3NVVA 1B3AA 2L8JA 5EPLA 1L0WA 1EEFD 3K9OB 2BS2B 4A3EH 2Z0SA 1W6KA 5HKHA 1EYGA 4JI4Q 4NMZA 2IPKD 5I2YA 2IX1A 1UF0A 3KLWA 2F4VQ 2K5HA 3PF4A 1CZGA 4JI2L 3P1MA 1VF5C 3LXFA 5C3EH 2K3UA 1O80A 2INNE 1BCPF 1I4GA 3SEBA 2LVOA 5JHAA 4GN4B 2F0HA 1ZP0B 1WJ4A 1HNXL 3D0FA 4GOCA 2WWZA 4HCNB 4PS3A 1N36L 2PNRC 1J7AA 4F7ZA 1LTID 3EGRA 1WTQA 4P6VF 2IO2B 3NBHA 5D2MB 3OYYA 5D94A 3UDIA 4NAWB 4PMWA 4JI3L 3SR1A 5DAUA 2R7ZG 1TWHB 3H0GH 4ULLA 3SK6A 1KTKA 1Y1WH 1TVXA 2WXOA 2I1KA 3GTQB 3D6CA 4ILWA 5KNBA 4FJVB 3GS2A 1BOSA 3GOEA 4BWGB 2J0JA 1SMXA 2M1MA 2RKSA 1Q1EA 1AZPA 3DVNU 2O5JC 5JEAG 3HOZH 3PUZA 2Z6KC 4B3RL 1MSHA 4WRDA 2ZEQA 1L0XB 3SU8X 1QOBA 4OO1I 1JWBD 2JXXA 4DNTB 2R3ZA 1N32L 2EY1A 3DHHC 4W9FA 2K75A 2LZ6A 3QB3A 2J4XA 4XDCA 1V81A 1LGRA 1FRRA 4BY7H 3NS1A 3I55A 4I7AA 1D6EC 3HOVB 4LF4Q 5JJLA 1WRDB 2F03A 4DR3L 4JI4L 2VY3A 5IYCG 4X65Q 1T6BX 4UY8C 3PV0A 4KGTA 4JI6Q 2H4OA 2F4VL 4IDIA 5CV9A 4KY7A 1U0LA 1SMYD 1JWMD 1CZPA 3OAWA 2B2UC 1KDAA 1V2YA 3ZUNA 3W2DA 5C4JB 2N9XA 3UQBA 1QG7A 1GPXA 4DF7A 4A3DB 3M63B 5C0XG 2RSNA 1J7CA 3IT6B 1I35A 3EFCA 3S9WA 1KC8C 4TUUA 4GN5A 1FVIA 2AEHA 2AUKA 3QG1A 3J81L 2W3RA 1SB3C 4KLKA 5BN5A 2VB3X 3NWSA 4P75A 3Q3OC 2ZW1A 1F9RA 4AQ7A 2VQEQ 4PNYA 1QNUA 2PI2A 2LMCB 2NYZD 4KZCA 5FJ8G 4GNXA 2E8GA 2KX0A 1YNXA 4OVVA 5IGDA 4B0EA 2XWBB 4L5TA 5CV7A 2CU3A 2L15A 3DQVA 3AM9A 2WB1E 1PFBA 5I6YA 3RNBC 2JE6I 1S5ED 4RMAA 4GOPC 4WQMA 4NXNL 4EGVA 1WXMA 3R8BA 2BS4B 2OF1A 4KIKB 1TKYA 3EECA 3ZVVA 1X54A 4KN4C 5M3FB 1F1HA 2J0KA 3AU5A 2A1AA 2W9NA 3OW2A 1K52A 1WZ3A 2N78A 2JRIB 3NTIA 1G6JA 3GDEA 2N7EA 3JSVA 4WAAA 1TY0A 2WU5B 2PZUA 2E76C 3VYRA 3AE5B 4JYAL 3GP7A 3JAMi 2NVYH 4R4CA 4DV0Q 4ACFA 1KNEA 1X55A 1T0YA 2L00B 3DBHB 1SEBD 5KHQA 1WJNA 4X65L 2Q2HA 2DZIA 2C9OA 4JI6L 1XD3B 5EE3A 4DV2L 4GDKA 2B2TC 2K6DB 1KL9A 4NZLB 3HOUB 4P2CB 2Y0SG 3FKIH 2CCZA 4XE0A 3GE8C 4A3EG 4HMJA 5J18A 3IAM1 3KBGA 4M00A 3CCUA 2Y0SB 4FVMA 4DK1A 4IFDH 2VUMH 3CC4A 4A3EB 1LO5D 4IUQA 2JZPA 4M8MA 4C80A 4E3CA 3B2FA 2CH4W 2B39A 5C3EG 2VW9A 1I3QH 3ABVB 2E2HH 2DYOA 2CWAA 3UDFA 4KKSA 1IPGA 2AWOA 4LMQD 3JAME 5C3EB 1K8OA 1WZ0A 5GAGC 3AE9B 3N20C 1ZOYB 1YQBA 4JI5L 1EF1A 2KLGA 4HCPB 4YHHL 1JW9D 4K5XA 3AE8B 4NPNA 1AE3A 1D8LA 2K32A 2YYZA 1LT3D 3U58A 2PW5A 1TT2A 1KRTA 1BBXC 2ASBA 4LJZC 3TP7A 2E2IH 4DXFA 1QUQB 4QGUA 4K8IA 3G71A 1WTOA 2WXPA 1EO6A 4HPLB 1MIUA 3HKZG 4KKIA 2WQYB 3Q24A 2E5LL 3S1NB 1J0GA 2I2YA 1D1KA 4KHZA 2X6GA 2MJ8A 3U7DA 3H0GG 3HKZB 1Y1WG 1E10A 2JA6H 4TQ0A 1HHVA 1PYSB 3M4OH 4DK6C 5A2QL 3H0GB 1IKMA 3C0RB 1CZWA 2D2QA 4JI8Q 3PO3H 2DUDA 4C4VA 4C00A 3DM1A 3S16B 3H9DA 1N34Q 2ZTEA 3IXSA 4WWMA 1CFMA 2AUJD 4DV5Q 2SDFA 4IPCA 2F0VA 1SJHD 3PLVA 3VQIA 4FO2A 3HOZG 5ELBA 3TEWA 1GXDC 2MUYA 3SVMA 3GTPH 3HOZB 1ZUD2 1X65A 3MHZA 5EJWA 3MZ5A 1ZE3D 2F0NA 4BY7G 2ZXRA 4DFAA 4IOCA 4AP4C 5ISRA 2IO1B 1PGAA 3PMFA 1C4CA 4HSVA 2L05A 1OQQA 1IHZA 4I7ZC 4BY7B 3PREA 4H2AA 5EE1A 1I4PA 5FLXE 1M90C 5KYIA 1D5ZC 2CH4A 3K7UC 2JSVX 1B4OA 1SSOA 2CW0C 3MXUA 1U4LA 4L63B 2L0FA 5M5WH 1IBMQ 1P7EA 2PKOA 1WX9A 1PH9A 3I72A 3APDA 3PHXB 5BYRA 1DM0B 1XNQQ 1VLBA 2F3WA 3FILA 1J19A 4KHVA 4H44C 2IW3A 2F0TA 4AS1A 4DV3Q 3S15H 4KVGB 5CX3A 1CKNA 4JPBW 4TVAB 3D4WA 2R93B 1RWSA 4IPDA 4QCLA 3UDGA 4A8XC 3DEOA 3S24A 3Q22A 1R9TB 2CS4A 3CWIA 1HUMA 2BT6A 2JQOA 1V86A 1NBWA 2HJ8A 1KLUD 4DR6L 3FP9A 1BVSA 3T53B 2K5QA 5CBEE 2LVPA 2J53A 4ZQ3A 2I07B 1FNVA 3RR5A 2LRWA 4DV5L 1RAXA 3VVWB 2KEEA 2SNSA 4QL5A 4EFOA 2G1EA 2PTLA 3P1HA 1SNDA 3S2AA 4DUZL 4ZLTF 1YNJD 4B3ML 2DAJA 1L6UA 1JQYD 2KWVB 3VTVA 2L3ZA 5IP7H 3HEJA 2ZVOA 1N33L 2AX5A 3SFEB 2B3GA 4YCWA 2QILA 2L55A 3RN5A 1BT0A 2DYBA 5E3FA 1HPCA 3I2ZA 1Q8KA 5D3IB 3G48A 3KUPA 2EYMA 3FKIG 4HJ7A 2WXFA 3U52E 1SROA 4IWQA 1P1AA 2JF5A 4IFDG 1XNQL 4X64Q 2VUMG 4IO9A 4RKBA 1UBIA 4JGHB 2UUCQ 4DV3L 2EYJA 4U68A 3T1YQ 3C8YA 3T13A 4ICUA 1TY2A 4J6IA 4HJ8A 4JBWA 4TV3A 5M5YH 1F2YA 4ID6A 4A3BB 1I3QB 4RCNA 2RSUA 4W9DA 3ND9A 2BWES 4XQQA 1V1QA 2VL6A 3M7NA 4RWSC 1Q12A 3W5OA 4ABNA 3SR6A 1HNZL 1K73C 5IY0A 3TBLD 1YOVB 4N9F4 1N5WA 2A6EC 3KOJA 4JV5Q 5EGTA 1EQVA 3CCJA 1HQRD 2KHJA 3E9HA 3HRZC 3J81i 5EKLA 1DOKA 4KI0A 2JA6G 2DNFA 1K28A 2DGYA 4EQPA 5DM63 3P4PB 2F0UA 1QLBB 5IKCM 2I0QA 2KQ7A 1U9RA 1E7VA 3T51B 4OX9L 3PO3G 3EHVA 4W9GA 3U2SC 1XLOA 1LTRD 2B8FA 2D5GA 2K9XA 3M4OB 4TKNA 2YVCA 3MA2B 3CP0A 2CQOA 3D4RA 4G4KA 4WJ4A 4HROA 3B1LX 4TSSA 2JYOA 2V1CC 3U4ZA 4KHPQ 1HFNA 1K0SA 3ETRA 2KNBA 1TBEA 4KZ0A 1E0BA 2QW7A 3R93A 4GZYC 1HJPA 4IWOA 2L1BA 3T16A 2OOBB 4LWCA 2VQFQ 1XPRA 3BYTB 1X1MA 3ZJYC 5TR5A 4BBRH 2DWQA 2PW9A 1RFAA 3A4RA 2EY5A 2X8XX 4R8NA 3BDLA 3J81E 2ZCCA 4A3JH 1E2WA 1VQKA 2DZMA 1PH8A 2LEKA 4FA6A 4EX5A 3P4QB 1HR0W 3A1QB 4EUTA 1ZXIA 3T1YL 2RPQA 1A6XA 3A8KE 4C3JB 5EPJA 1DXMA 2FFKB 2HD5B 3PPAA 2PMZB 2XIWA 1SDFA 5EPKA 2MSED 3NK9A 3P7JA 1VQIA 1RCVD 2NVQB 1KDCA 1PTOC 3PZDA 4A9AA 1HNWL 2XEWA 4MDKE 1C4PA 3EBEA 2GBKA 3T9LA 1CHPD 1JJGA 1WFYA 1TKGA 4GLAC 2JSOA 1EM7A 5C44H 2INCC 3GTJB 5E7NA 4FHJA 3MEFA 1MBYA 3FEWX 2VZKD 3UIOB 2OEOA 2FCSA 5EBDA 3UDXA 4XT3B 4DR4Q 3KFUA 1T0RC 4FJZA 4X3UA 2JA8H 2PQAA 3GV6A 4X62Q 2EYPA 3KF8A 1CA5A 1SF0A 3MP9A 3OJ4B 4JCVE 4A3KH 3LWEA 3H09A 5ELOA 5H1SE 2ZXPA 1V5OA 3L0WB 4L6TB 4S3SA 2WAQG 2NR2A 3TUOA 2BDNA 1YZ6A 1H9SB 2DY7A 4Y7NH 1WXSA 3NJTA 5IP7G 4PV1C 2AQ3B 1WIAA 3Q2AC 1DGJA 2WINB 2A74C 2RDGA 4LFCL 2V1YA 3B08A 2RGFA 4LJOB 2Y0SE 3MXNB 3VR2A 1IBKL 1HR0Q 1WX7A 4G7ZC 3K6OA 2HQLA 4F88A 3S1QB 2KFKB 4I6PA 2PJHA 3I4LA 5E6NA 1QQRA 2F1MA 4QQBX 3QJYA 4HIMA 3Q6BA 2CHWA 1PH4A 3GTMB 2BPSA 5IGFA 2FHTA 4LF5Q 1C1YB 3S14B 1WJJA 5GAHC 2M17A 1W2BA 4O42A 1FL0A 1XMQQ 2K39A 3AU4A 3RD2A 2KX3A 1W6JA 3FHWA 3DBLI 1EWHA 2N7DA 2RF4A 3ERSX 1N60A 1E7PB 3GTLH 2LXJA 2Y5BB 4XC2A 4ZKBB 1JALA 1HE8A 4RHSA 4FXDA 1QOHA 2B2VC 3H6NA 4R4TA 1STYA 3BZKA 3HKZE 2LJ5A 3FVQA 1A63A 2W82A 3IFWB 4DHZE 2ZTCA 2MP1A 3MC9A 4YTMB 1FD6A 2C7MB 3ER0A 3AE6B 1L1OB 1B9MA 3WWVA 4FJYA 4YWLA 3VR8B 4X62L 1JRPA 2Q2TA 2YLMA 2MJDA 2AWNA 2KCTA 3SFDB 1ENAA 4FYDA 4DV7Q 1ZDVA 1MG4A 5JJZA 4MM3B 1V8QA 3MFYA 2QMTA 4C56C 3BZDB 4DHJD 3CKIB 3K7AB 3KLSA 3PLUA 3TDQA 3M4YA 2HHHL 1LTAD 4GMVA 1NI2A 2KANA 5CHWA 5K36H 3R3MA 1QVCA 2FCNA 4ZRZA 1X3PA 4BOZB 2E2JH 3TP5A 5T8IA 2K8HA 4I6NB 4X3KA 2OWOA 3RT3B 1VJKA 4YWKA 2J42A 4WJPA 2MP2B 3CSTA 2MJ3A 2G4SA 3R66C 1N61A 4OXPA 2IWHA 4LF5L 1A3UA 1LTTD 1XLNA 2ZM6Q 4BBRG 4WWOA 3HFZB 3DOWA 5JVG3 4A3JG 1E2VA 3QOJA 4BBRB 3NOBA 2W55A 1D4BA 2IY0B 1PTOH 2RHQB 1I94L 1VQ8A 2KVMA 4QIWB 4APVA 4LF8L 5HI1A 1P98A 2GLSA 3PO0A 2MW5A 2PCFB 4RGNA 4AWJA 3ZRFA 3KYCD 4LNIA 3PUWA 3V05A 1X32A 3CCSA 2LXAA 4XT1B 1TZOA 2KCNA 2GMIC 3D3RA 1KM7A 5NUCA 3PF5A 1G91A 2QJLA 4YCUA 2K1FA 3TJPA 5IIFA 5H92C 5C44G 4B95A 2IO3B 2EMTA 1PH7A 1JT8A 4G57A 2MFIA 4DV7L 1WTVA 3W1GA 3CRLC 1Q5WB 1IZ6A 2JEBI 1HQMC 4M8AA 2QF7A 3SDZA 5C3XA 4HLEA 5C4XB 4LNKA 4HKQA 1NCVA 5J22A 3AEEB 4HRSA 4XWTA 3Q3NC 4ZRQA 1EIYB 4A3KG 1JMCA 3PRPB 4II3B 3QQ8B 4HJ9A 2JA8B 1G2SA 2BE5C 4WWNA 3CC7A 3S2DB 1XXGA 1MPEA 3A8IE 2NVXB 2L0CA 4IURA 4G7HC 1ZXHA 1YJNA 4XYQA 1KJTA 1FR3A 1KAWA 1TS5A 1WMHB 3EQLC 1PFMA 4Y7NB 1F2LA 2PQEA 2L32A 4U673 5DCNA 1JQ4A 5IWAQ 1F9QA 2MLBA 2AWTA 4QB4A 3FKYA 3NZUA 1MKHA 3Q3FA 4MJSB 3G4SA 3R7RA 4RF0A 4A3IH 2WB1G 4P72A 3BY4B 4DK5A 3RYTA 3V6CB 2ZW0A 5J17A 1J8CA 2KUMA 3OWFA 4BS9A 3A7LA 3Q14C 2ONQA 1IL2A 3NVYA 2O6VB 2NB0A 4DNIA 2RQXA 4GS3A 2Y3AA 4R4QA 5G5GA 2G3QB 4UHVA 1N8RC 2AMCB 1HUNA 2L83A 3PIO3 3OJ3A 3NZSA 4DDGD 1DJRD 3GTLB 1CJEA 4IKGA 1CK1A 4LF6Q 1F9SA 1GB1A 3ZTCA 2K8CA 3MVVA 2QDBA 2BVCA 2Z0DB 1BBWA 3H7PA 1IW7C 2E6XA 2QCZA 4LF7L 4GDLB 2Q2UA 4MGKE 1YQ3B 5AUIA 3T56B 2G9DA 2HQEA 1XX8A 3I63C 2FUHB 5GROA 3TRZA 1JOKA 2SEBD 3KW5B 3RULA 2D07B 2D62A 1X3EA 3NSWA 4LFAQ 5M5XB 1Q82C 1EY0A 2MBOA 2A69C 2MRPA
chains in the Genus database with same CATH topology
4DGZA 3NWTA 1WTPA 5K36G 3ZYYX 1MSGA 5IGBA 4XQNA 4J1MA 2FE8A 1GB4A 4N58A 4Q0FA 1BMLC 2E2JB 1PRTC 3OSOA 1EY9A 1II3A 1NEKB 1B9NA 3L7ZC 3TMEA 2KA7A 2A68C 3OHXC 4HCEA 5CV8A 3AEFB 4PT5A 2INPE 4ZOHC 4OVZA 4RF1A 1PDQA 1PTOB 2CHBD 3VR4A 2XRQD 1WXQA 3VR3A 3FAHA 4YT0B 1U4RA 2MPMA 2F0JA 1SYBA 2F0GA 2N55A 2NUCA 1C78A 5E6JA 1HCZA 1KABA 1EFID 1DOXA 4IUVA 1K53A 4M1UB 5DNFA 2N88A 4F8MA 3G6JB 1RDPD 4XDDA 3P63A 2IJ0A 1ESRA 3I57A 3ND8A 3FC4A 3NXWA 3F2UA 3Q8BA 2X6LA 3RMHA 3HVDA 1H9KA 1VZ8A 1LT5D 3QWNA 3ZGZA 4RCOA 2F0EA 4AYBB 2PMVA 1BCPC 5BMGA 2BCOA 3AV8A 1VF7A 2SNMA 3DHQA 3P1MA 2F0KA 2BB6A 1F2RI 3A56A 1T3QA 2NMQA 4KX6B 1KNAA 1TYGB 1FO4A 3ERQA 4KKJA 1EEID 5HURA 2DNCA 1AFPA 2TSSA 1V1OA 3WDNA 2J7ZA 3MJ5A 2Q5WD 4FXGC 1AWDA 1EOTA 1I50B 5C5MA 2K5DA 1JC7A 1XF5L 1MI0A 4K2KA 2KECA 1WVLA 1YNTE 1DYQA 5I6WA 1YQ4B 1XCTL 2PPBC 1RJTA 2EYLA 2L5TA 1ILQA 3IL8A 1FRDA 2KAJA 3HRDD 4P16A 1BO0A 1JWSD 5TSSA 1K50A 2CJNA 1ENFA 1GUSA 1SYEA 5H8YE 3BYYB 3H3VC 1I6HB 4ZAIA 2LY7A 3S17B 2NTSA 2EJGC 2HUGA 4DQOC 4XYOA 1CTMA 3ONAB 1C4QA 2BW2A 3NUHB 4RGMA 4XIGS 2FJ2A 3FMCA 2M19A 3QIAA 4KGSA 2LMCA 1NENB 1AYFA 3VR5A 5C4ZA 1A70A 2WXMA 5C0XI 1F0ZA 2IGHA 1QF6A 4A3MB 3J7AV 1DD2A 3W3AA 4PQXA 1JROA 2MEKA 3O13A 4TQ1A 2GRIA 3HS0C 1ZPSA 2NVTB 3E9SA 4USAA 1UNSA 1TWAB 5C0XJ 1I4RA 1HZ6A 1TKEA 5GXGB 3EFXD 5EQ0A 3TZDA 2E74C 3HOXB 1CI3M 1UWXA 1C79A 2ZT9C 1RD9D 2B2YA 3KBXA 4KN7C 3ZJUA 3MXGA 1GHJA 1ZXTA 3NRZA 3Q8AA 3IFTA 2L1AA 4EVOA 1HTPA 5C4HA 5HFYA 4B9WA 1V97A 3AE4B 4OIJA 4H0LC 1I4HA 4TKOB 5FK9C 2F0PA 1C8CA 3Q6SA 4XXEA 3P4SB 1FEHA 1PRTB 1EY5A 2IT1A 3R3OA 3KLRA 1BF4A 1SE3A 3SHLA 1STAA 3MFGA 1IGCA 2JWUA 2PVGC 1Z6HA 3HOYB 2PYKA 2L52A 2B63B 3K5MA 1Q8IA 4NAMA 2WXGA 1JOOA 1EL0A 4K5VA 4FXCA 5M9OA 4ZHOA 1WD0A 4L23A 1TU2B 3EJIA 3J80L 4J8QA 2W3SA 3U7ZA 2JA5B 1KLGD 1C9FA 2WXJA 1JICA 3AN1A 2K33A 2I2YA 4Z9CB 5KRUA 3GTGB 1PFDA 3AECB 1KDBA 5DM73 3K5LA 1V1PA 2HDEA 3UI3A 3GB1A 1DOYA 3LNNA 1IBXA 1RFKA 1TIID 4QUCA 3HGBA 2NBFA 2HDLA 1FNUA 3PIP3 1AN8A 1BCPB 2ICEC 5D14A 2CW0D 4K8JA 1CQVA 5DEHA 1QOAA 4US8A 2HCCA 2A73B 1SNQA 3CU7A 1M4VA 2LUMA 3B2GA 1SNPA 1BDOA 2PW7A 3ZJTA 1XLQA 4RNAA 1HZ5A 2RDFA 2VB2X 2K05A 2JEAI 2M00A 1C4AA 1ZEQX 1ROEA 1STNA 3OIQA 3BVZA 1FNWA 4V0BA 1BNZA 1VDVA 1Y1VB 5AUKA 5KIXA 1YNNC 4IFDI 3DWGC 1DCZA 2A6HC 3M3YB 2F0OA 3AB5A 2V3NA 3MHBA 2LFIA 4E6IA 4B0MA 4OL7A 1FFUA 2F4IA 1FD7D 1LTBD 4N59A 4KKUA 4EE2A 1TWCB 3X3NA 2F3VA 4CJ2C 4N6EB 1SSNA 4C3IB 2K03A 1QILA 4IFDJ 1C76A 1SE4A 3GTOB 2OT2A 1RKNA 4N9PA 3Q8CA 4KD3A 2NN6H 2EKIA 1AW7A 4MACA 3GO5A 4YIJA 2HCIA 4A93B 2B2UA 1Y8OB 4YSYB 3NP8A 5C6AA 2RPVA 2E2DC 1TQOA 2LGIA 4YWGG 4MHEA 5I9OA 1KFYB 1PXUA 1OXSC 2GI9A 2K0PA 3I73A 2R92B 1M8AA 2A6ED 3VYUA 2K28A 5BYQA 1WGKA 3H8HA 2HTME 3WCQA 3AEGB 2GA4B 3IFDA 4C3JG 3NQTA 1RHPA 1SIJA 5IGCA 1GUOA 4KJOA 3OPOA 5ELCA 4IUUA 3DWMA 3I9V1 4ZYSA 2CVRA 2W54A 3S2HB 1IUEA 5IT9L 1FGBD 3NTKA 1HXYD 3M85A 4MH8A 1JMLA 1Y56A 2EDGA 5JAVA 3PO2B 1EYCA 4L8JA 3OMGA 2KMMA 1F2MA 4A55A 2Y5PA 2MJEA 2B2TA 2QCPX 4XTCS 2EYOA 3Q23A 3KWVA 2AQ2B 1WYGA 3GTKB 2KEDA 4JX1C 1HFGA 1CT1D 1OXVA 2B2WC 2DN8A 4JK1C 2YU9B 3BK1A 2CQAA 1SYCA 3AU7A 5AFWA 1GUGA 2JXMB 3IKJA 2XVSA 1CM9A 4JWUC 1O78A 2N9KA 5KEEA 1ONLA 3I4MB 1QCBD 4YSXB 4BBSB 1O7YA 5KYLA 1STHA 1WTWA 2JYEA 5D3DA 2F0SA 2XRSD 1UAPA 3PUYA 1AEXA 2QEJC 2LHEA 3TEXA 3MTSA 4DN4M 2ON8A 3HUIA 4CKBA 5A2QE 2K5PA 2Z4IA 1RF2D 1YN3A 2WDQB 5JVH3 3GV3A 1T5XD 2NN6G 1ET9A 1Q90A 4RGTA 1OFFA 2O4XA 3AMUA 5BYSA 2RBMA 1L4DB 1HA6A 3A8JE 1QKZA 3PZ7A 1E0ZA 4O1NA 5BN3A 3HP3A 3V96A 3L4PA 1GUWA 3NTHA 4LTUA 4Q2JA 5IODA 1WTRA 1U4PA 1DZ1A 1SNOA 3DUZA 3D4DA 4A3GB 2OHFA 1ML0D 2YEPF 2XSCA 3K5OA 4RGOS 1UUPA 1JORA 4TMAB 5C3WA 5LHY1 1FYCA 2WDVB 5ELDA 2WXKA 2DYMA 2WXNA 5M3MB 3MXPA 3DWQA 3U9OA 1SNMA 2JXTA 1S5FD 4DAPA 2Z4HA 1BUIC 2K22A 1NAPA 1J9OA 1QJOA 4ARIA 2KQ4X 2JQRB 3CQZB 2EYHA 1E6EB 3BK2A 4BY1B 4YXDB 2MGSA 1B2TA 1QOFA 2RMMA 1ZYRC 1ZKOA 1NR4A 3SXHA 3C1EA 3FPPA 2WXLA 5BMIA 1E9MA 3VYTA 1EY7A 2BE5D 4PMBA 2F0DA 1I6VC 5E4XA 1DOIA 1KH0A 2WXQA 1GAQB 1A15A 5I2XA 1FXAA 1IYUA 4YSZB 1SYGA 4A3FB 2M0AA 3AE3B 4OZCA 1ET6A 2JU6X 5CBAE 1J7BA 2WXIA 1MVKA 3H94A 2K6AA 5EKIA 2D2CC 3BIID 3LB8C 5EKKA 1C77A 1STBA 1QWYA 1WSPA 3DWAA 2KQ3A 4HTHA 3VRAB 1LACA 3TZUA 4NDXA 4NKLA 3P42A 1SYFA 5CMDA 1XLPA 3BG3A 1IW7D 2BA1A 3MC0B 1Y8NB 5IOCA 3U4EG 1BQQT 1K8MA 4ME5A 4MN3A 4FF4A 4IQZA 4FF1A 1OO9B 2A69D 4IUTA 4HMIA 3EVQA 4KJNA 2CJOA 1I4QA 3TSSA 4L2YA 1ZDXA 2BYTA 4ZUIA 2Z1CA 4YTPB 4CJ1B 1LT6D 1D5XC 1S5BD 1D2BA 3RUZA 1WWTA 3JAML 2R61A 1PRTD 2VZKB 4X3SA 2A68D 3HG9A 2WP8J 2F0LA 5BMHA 3I70A 3QOLA 4IZ8A 4DK0A 1EQTA 3A7AB 4LAAA 4OO1H 1EY8A 2ACZB 3TP8A 2J52A 2R6GA 2B2VA 2L12A 1TJEA 5C5LA 2KHSA 1QOGA 2EPBA 2F0WA 2WXHA 1NR2A 4ARCA 1K83B 3L9AX 2JA7B 4OIKA 1PLFA 2EJFC 2AQ1B 3L3OC 1QT9A 2IGGA 3IT4B 4C1NK 5K5PA 3RFZB 2M2LA 4FNFA 4K5WA 1VMCA 2EYFA 3LX0A 4A6QA 1Q1BA 1D1IA 2LHDA 1MGSA 1RTOA 1F9PA 3NQIA 4KMUC 3VYSA 1SXTA 2DLBA 1SYDA 4CQNA 2LKVA 4BA1I 1EY4A 1EYAA 5FR3A 3J9CA 3OOCA 3DMUA 3K59A 2Q8TA 5KNDA 1YJIA 2PZTA 2L9HA 3AB9A 1EZ6A 2EELA 3ZJVA 2BB5A 2LFNA 4IOIE 4OW0A 4RHRA 2X69A 1TS3A 1I7HA 1L6VA 1NSNS 1Y69U 5F2DA 5BN4A 1UWMA 4KD4A 2NZ1D 3AEBB 5T1GA 4QF4A 2KDMA 2TMPA 2B76B 1PDXA 2ICIA 3B9JA 2R7ZB 1PFNA 5JEAJ 1TR5A 2V3PA 1SMYC 2G9HD 2FMCA 3I4NB 2BS3B 2WS3B 5JXVA 3OMCA 1RYJA 2FBWB 4OZBA 2LJIA 1FCLA 1VR9A 2WACA 2ID0A 2EY6A 4FXKC 1H9JA 2BTEA 3SE0A 4OO1G 2WLBA 2FMMA 1S5CD 1F2ZA 1X3QA 2WP9B 1EZ8A 3V2TA 5HGTA 4C7YA 5I9PA 1PGBA 3K0YA 3WOFA 2KWDA 3BDOA 3AE2B 2WKDA 1WD1A 2MH7A 1SNCA 4G7OC 2MHVA 4MT5A 1STEA 1D5MC 4DAVA 1B50A 3FPUB 1JWAD 3M7GA 4TQUS 4KV6A 3K57A 1FMAD 4IN3A 1KAAA 3X3MA 3EA6A 3NVZA 1N5XA 2K01A 1ILPA 4MIUA 2DNEA 2D5DA 4I65A 1N62A 1EYDA 3VR6A 1HEZE 1AP0A 1EY6A 1L4ZB 3BS1A 3E0JA 2Z8LA 1P7FA 2BA0A 5A35A 3AE1B 3K58A 4QUFA 1PYWD 4CBVA 3AEDB 1R4QB 3RLFA 3VRBB 3Q0AA 2Q8IB 3TP6A 1AZQA 4LK0M 4GDKB 4J3OD 4QMGA 4N9TA 5CGKA 3I8ZA 3MEHA 1VMPA 2VNUD 2M9VA 1IKLA 3OW7A 1ACCA 4WH4A 2IGDA 2QSDA 1JB3A 2FUG1 1SBBB 4ITKA 1Y1WB 3VR9B 1Z7TA 3C1FA 3RZOB 2A5HA 2NTTA 4BA2I 1CQFA 1B53A 3QO2A 5EE9A 2EY2A 4KGRA 1GJXA 2EOTA 3SK4A 3CIRB 1RTNA 4KKTA 4X3TA 3TEZA 1Q3LA 1KF6B 1JR0D 1JOQA 2WU2B 1SE2A 4ODGA 3E6ZX 1UEAB 3FRPB 2F0MA 1KRHA 1LT4D 1LTGD 1PZKD 4DXGA 3H6MA 1EU3A 1R7SA 1YNJC 1XTCD 4R8IA 3U9SA 2Q8RE 1GUTA 2BBCA 1EWCA 2L11A 4RFBA 4KY6A 5KGUA 1HA5A 1ICWA 3BWUD 2EXZA 3FILB 2JYTA 5HHDG 4F87A 2VXWA 1V1PB 4XDXA 5FO9B 2WNMA 1L0VB 5JPNC 1L5PA 1IBXB 1BUVT 1I4XA 3BVGA 4US9A 4C3IG 1QNKA 2H89B 5HG2A 2K5WA 2NVYB 5E1FA 1H9MA 2XN9C 2H1EA 1CA6A 1DONA 1NYQA 4JPSA 4OGQC 1IL8A 2JP1A 5ELFA 3VA5A 5CR3A 1YNND 5COYA 2A6HD 4H7BA 3K5NA 1VZ6A 3C2PA 4ZK9B 5LL6X 3FKIB 5IGGA 2L4NA 2VUMB 2ZXOA 3NVWA 4Q5VA 4XQJA 2HDMA 1Q10A 1OQRA 2E2HB 4ZKCB 5FOBB 3S1MB 3OWEB 4HAEA 5D65A 4EQOA 1JE4A 3D6WA 4WORA 5FKAC 3A54A 3NUCA 1BXTA 4D2KA 2M56B 4OHJA 5E4WC 3SK5A 2E2IB 1GUNA 2NWGA 1NYRA 4GLSC 2JA6B 2EE1A 2OXPA 1PUTA 5CV4A 3PO3B 1FIQA 5LNK1 1Y8PB 2I38A 2DBYA 4WAFA 1L0YB 1TS4A 2PZWA 1VRAB 4UDUC 3N6RA 3HZXA 1YJJA 3NPPA 3GTPB 1STGA 1V43A 1H9SA 1YMHE 3SK8A 3S1RB 3W5UB 1FM0D 5J39A 4A90A 3MXNA 1ENCA 1B1ZA 1XO3A 1JCKB 4NJCA 1A2UA 1Z47A 2B8GA 5M5WB 4HEA1 4L1BA 1PTOD 1B44D 2IX3A 2PIAA 2SOBA 3S15B 4K6DA 1RODA 4WURA 4C7ZA 5MPOA 2RDHA 3T4AC 4V190 1TWFB 1UGJA 4RA8A 3PZ8A 4C3HG 1RM6C 3N9YC 4EQNA 2WV6D 1PGXA 2D9UA 4NP5A 3FDTA 2N9LA 3AEAB 4C3HB 5J1ZA 3T3NA 2FINB 3P75A 3Q8FA 1IGDA 5C3JB 3PUXA 2WAQB 4RAUC 1GHKA 4C2MB 1XCQL 3HVZA 5ELEA 3TN2A 5EE0A 1PTOF 1WCMB 2PLPA 1XWEA 3MAQA 2IDYA 1XEEA 2NN6I 1TKWB 2EVBA 2Y5CA 1A2TA 2F0QA 4K14A 2X38A 3ZQ4A 3RZDB 3A55A 5CC4A 3W1SA 1ESFA 3D31A 3W9CB 4REZA 4IUNA 1FXIA 2V4DA 1SFOB 4TRDA 3J80E 5M5YB 3J7YW 1OXTA 1F2RC 5G3LD 1GOZA 1R4PB 5LL6S 1S5DD 1SJED 3GQBA 1NI3A 2WKCA 1DOLA 4HKZE 4JWSC 5KNCA 1YN4A 1G291 4XWWA 2V0GA 3R2TA 2XWJB 3KLSX 3CHBD 3RD4A 1WTXA 4FF3A 3KQ4A 3GD7A 2IX0A 3DXJC 4K6LA 3N52A 3J7AF 3RPFC 1PZID 4UAIA 1V8CA 2PO4A 2RA4A 3KWLA 3EROA 3H91A 4HEDA 4HJGE 4C1NI 1H9RA 5JPMC 1TWGB 1VCIA 4ZUJA 4B08A 4IALA 4KTAA 3CRKC 1N63A 4KY5A 3AH7A 5G3LF 2RSOA 2J0TD 4A3JB 4FF2A 1J8IA 2SAKA 3DWPA 2O2LD 2KACA 1B9RA 1EIHA 4CKEA 2DY8A 5EBCA 3Q69A 4LLGM 3P4RB 1PZJD 2KOLA 1QE6A 4YTNB 4ZHPA 2E3TA 4FP5D 1LLRD 2K7VA 3T3OA 3KK7A 5C44B 2EZVA 1O7ZA 2QIEB 3NBIA 3MWYW 4K2LA 3G7LA 5CV5A 5IGEA 5FO7B 4WFN3 3AE7B 1OXUA 2O5IC 2GB1A 2E75C 4J6HA 2I46A 1EU4A 1LV9A 4A3KB 4DNRB 3TBIB 3C46A 4HN7A 3I91A 3BVMA 3BDCA 1QB5D 3VA7A 3E5SA 1ZYRD 1CHQD 4RH6A 3C3LA 1FFVA 2OEDA 1A3VA 3IAS1 4RKLA 2WB1B 1HRJA 5C2TB 3DEPA 1NVID 1G8ZD 2KCCA 1EIGA 3V3XA 1G6ZA 1MD2D 1NUCA 1PMRA 2ENBA 4R3DA 4NW2A 1F77A 3UI2A 2BDOA 4HSPA 3OIPA 2RVLA 3PUVA 2KJXA 2F0IA 3I90A 3E56A 4M0WA 4HCSA 4KK7A 2F0FA 2JX5A 3NHHA 2B2YC 1BR9A 5IT9E 1HTLD 5CORA 5JOBA 4JE3B 3P20A 1E2ZA 2KN4A 1VZ7A 1FCCC 4DAYA 1DOMA 3EUB2 2WXRA 5D7GA 2IL8A 2BOSA 2B2WA 4HR7B 4CJ0B 3IAYA 1XYIA 3URYA 2XNAC 1MI2A 3I3CA 4OZAA 3NE5B 3HOWB 5JEAH 1U4MA 2V4IB 3LYYA 1A3TA 4F7XA 4WIPA 5CV6A 1MHHE 4R9WA 3AMZA 4ZRPA 4CGYB 2K04A 1IYVA 5FO8B 2N0SB 2H88B 1TS2A 2K1BA 3D8GA 2QKIC 4DA2A 2C5CA 1JWUD 2WDRB 1OXXK 1PRTF 2LS01 3W5VB 4DU9A 1LABA 5C0XH 1K51A 1S4ZA 1O7LA 1G2TA 5FLXL 1C48A 1YN5A 1MHXA 3NZ3A 5I4DA 4WJWA 1VDZA 1EWYC 4LK1C 3TEYA 1BCPD 4H13C 5G5HA 3R2IA 4CHTB 4A3IB 4CKCA 2YEPB 1T5EA 2WIIB 5T1IA 2EJMA 3WOEA 2N7JA 4PMCA 1WRIA 3LWUA 1LTSD 3ITPA 4B9XA 4IUPA 3Q8EA 5CYUA 1SAPA 3NVVA 1B3AA 5EPLA 1EEFD 2BS2B 1W6KA 4NMZA 2IPKD 5I2YA 2IX1A 1CZGA 1VF5C 3LXFA 2K3UA 1O80A 2INNE 1BCPF 1I4GA 3SEBA 2F0HA 1ZP0B 2PNRC 1J7AA 1LTID 3EGRA 1WTQA 4P6VF 3NBHA 4NAWB 4PMWA 3SR1A 5DAUA 1TWHB 4ULLA 3SK6A 1KTKA 1TVXA 2WXOA 3GTQB 3D6CA 4ILWA 5KNBA 3GS2A 1BOSA 4BWGB 2RKSA 1Q1EA 1AZPA 2O5JC 5JEAG 3PUZA 1MSHA 4WRDA 1L0XB 1QOBA 4OO1I 1JWBD 4DNTB 2R3ZA 2EY1A 3QB3A 2J4XA 4XDCA 1FRRA 3NS1A 1D6EC 3HOVB 2F03A 4KGTA 1T6BX 3PV0A 2H4OA 4IDIA 5CV9A 4KY7A 1SMYD 1JWMD 1CZPA 2B2UC 1KDAA 3W2DA 5C4JB 1QG7A 1GPXA 4DF7A 4A3DB 5C0XG 2RSNA 1J7CA 3IT6B 3S9WA 2AUKA 3QG1A 3J81L 2W3RA 1SB3C 5BN5A 2VB3X 3NWSA 2ZW1A 1F9RA 4AQ7A 4PNYA 1QNUA 2LMCB 2NYZD 5IGDA 4B0EA 2XWBB 5CV7A 2CU3A 3AM9A 5I6YA 1PFBA 2JE6I 1S5ED 4WQMA 4EGVA 3R8BA 2BS4B 2OF1A 1TKYA 4KN4C 5M3FB 1K52A 3NTIA 1TY0A 2WU5B 2PZUA 2E76C 3VYRA 3AE5B 3GP7A 1KNEA 1SEBD 2C9OA 5EE3A 2B2TC 4NZLB 3HOUB 4P2CB 4XE0A 4HMJA 3IAM1 3KBGA 2Y0SB 4FVMA 4DK1A 4IFDH 4A3EB 1LO5D 4IUQA 2JZPA 4C80A 3B2FA 2B39A 3ABVB 2DYOA 4KKSA 2AWOA 4LMQD 3JAME 5C3EB 1K8OA 3AE9B 1ZOYB 1JW9D 4K5XA 3AE8B 2K32A 2YYZA 1LT3D 2PW5A 1TT2A 1BBXC 4LJZC 3TP7A 2WXPA 4DXFA 4KKIA 4K8IA 1WTOA 2WQYB 3Q24A 3S1NB 1D1KA 4KHZA 2X6GA 2MJ8A 3HKZB 1E10A 4TQ0A 1HHVA 5A2QL 1JQ4A 3H0GB 1IKMA 1CZWA 3DM1A 3S16B 3IXSA 4WWMA 1CFMA 2AUJD 2SDFA 2F0VA 1SJHD 3VQIA 4FO2A 5ELBA 3TEWA 1GXDC 2MUYA 3SVMA 3HOZB 1ZUD2 3MHZA 5EJWA 3MZ5A 1ZE3D 2F0NA 2ZXRA 4DFAA 5ISRA 1PGAA 3PMFA 1C4CA 4HSVA 5EE1A 1OQQA 1IHZA 4I7ZC 4BY7B 4H2AA 1I4PA 5FLXE 5KYIA 1D5ZC 2JSVX 1B4OA 1SSOA 2CW0C 3MXUA 1U4LA 4L63B 1P7EA 2PKOA 3I72A 5BYRA 1DM0B 1VLBA 2F3WA 3FILA 4KHVA 4H44C 2IW3A 2F0TA 4AS1A 3D4WA 2R93B 1RWSA 4QCLA 4A8XC 3DEOA 3Q22A 1R9TB 3CWIA 1HUMA 2BT6A 1KLUD 3T53B 2K5QA 5CBEE 2J53A 4ZQ3A 2I07B 1FNVA 2KEEA 2SNSA 2G1EA 2PTLA 3P1HA 1SNDA 4ZLTF 1YNJD 1L6UA 1JQYD 3HEJA 2AX5A 3SFEB 2QILA 2L55A 5E3FA 1HPCA 5D3IB 3KUPA 2EYMA 2WXFA 3U52E 4IFDG 4RKBA 2EYJA 4U68A 3C8YA 3T13A 1TY2A 4JBWA 1F2YA 4ID6A 4A3BB 1I3QB 4RCNA 3ND9A 4XQQA 3M7NA 4RWSC 1Q12A 3SR6A 4ABNA 1N5WA 2A6EC 5EGTA 1EQVA 1HQRD 3HRZC 5EKLA 1DOKA 4KI0A 3P4PB 4EQPA 5DM63 2F0UA 1QLBB 1U9RA 3U2SC 3T51B 1XLOA 1LTRD 2B8FA 2D5GA 2K9XA 3M4OB 3MA2B 3D4RA 4HROA 4G4KA 4TSSA 2JYOA 1HFNA 3ETRA 1E0BA 3R93A 4GZYC 2L1BA 3T16A 3BYTB 2DWQA 2PW9A 2EY5A 4R8NA 3BDLA 3J81E 1E2WA 2LEKA 3P4QB 1ZXIA 1A6XA 3A8KE 4C3JB 5EPJA 1DXMA 2FFKB 2PMZB 2XIWA 1SDFA 5EPKA 3NK9A 3P7JA 1RCVD 2NVQB 1KDCA 1PTOC 4A9AA 1C4PA 1CHPD 1TKGA 2JSOA 1EM7A 3GTJB 1MBYA 3FEWX 2VZKD 2OEOA 5EBDA 4XT3B 4X3UA 3GV6A 1CA5A 2EYPA 3KF8A 1SF0A 3MP9A 3LWEA 3H09A 2ZXPA 4L6TB 4S3SA 3TUOA 2BDNA 2DY7A 1H9SB 4PV1C 2AQ3B 1DGJA 2WINB 2A74C 2RDGA 3VR2A 4G7ZC 3K6OA 4F88A 3S1QB 3I4LA 1QQRA 2F1MA 3QJYA 3GTMB 5IGFA 2FHTA 3S14B 4O42A 1W6JA 1EWHA 1N60A 1E7PB 4ZKBB 1JALA 4RHSA 4FXDA 1QOHA 2B2VC 1STYA 3FVQA 2W82A 2MP1A 4YTMB 1FD6A 3AE6B 1B9MA 3VR8B 1JRPA 2MJDA 2AWNA 3SFDB 1ENAA 4FYDA 1ZDVA 5JJZA 4MM3B 1V8QA 3MFYA 2QMTA 4C56C 3BZDB 3CKIB 3K7AB 3KLSA 3TDQA 3M4YA 1LTAD 5K36H 4ZRZA 1X3PA 5T8IA 3TP5A 4X3KA 1VJKA 2J42A 2MJ3A 1N61A 2IWHA 1A3UA 1LTTD 1XLNA 5JVG3 1E2VA 3QOJA 4BBRB 1D4BA 2W55A 1PTOH 2KVMA 4QIWB 5HI1A 3PO0A 2PCFB 4RGNA 3PUWA 3V05A 1X32A 4XT1B 1TZOA 2KCNA 3D3RA 2QJLA 5NUCA 1G91A 5IIFA 5H92C 4G57A 1WTVA 3CRLC 2JEBI 1HQMC 4M8AA 2QF7A 3SDZA 5C3XA 5C4XB 4HKQA 1NCVA 5J22A 3AEEB