1HXYD

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 66
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hxyD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hxyD02
1CK1A 2R61A 1JR0D 1S5FD 1I4HA 3O13A 4RH6A 2XRQD 4DXGA 1F77A 1TS4A 2O2LD 2IPKD 1PYWD 1QILA 4RGMA 5ELEA 1V1PB 1ESFA 3BVGA 4K6LA 1PTOF 1UNSA 4RHRA 1SJED 2QILA 1LTSD 3BVZA 1EU3A 3BYYB 3W2DA 5ELBA 1RD9D 5ELCA 3DWAA 3BVMA 3KLSX 1SJHD 1L0XB 1I4XA 1JQYD 1D5XC 1B1ZA 1GOZA 1T5XD 1RDPD 4TSSA 1PRTB 1BCPB 1L0YB 4DXFA 1I4RA 1LTGD 1CQVA 1PRTD 1BCPD 1HA5A 1JWSD 2NTTA 3OWEB 4Z9CB 2QEJC 3SEBA 1I4GA 1PRTF 1BCPF 1I4PA 1PTOB 1ENFA 1SEBD 1ET9A 2WV6D 1UUPA 3DWPA 3EFXD 3R2TA 4O1NA 1PTOD 1TY0A 1JWUD 1SE3A 1KTKA 1SE4A 1DYQA 5I4DA 4BWGB 2Z8LA 1PZKD 1HTLD 1HQRD 2XNAC 3DWQA 5FK9C 1EU4A 1LT4D 1STEA 2G9HD 3R2IA 1LLRD 3MC0B 1SXTA 1LTTD 3MFGA 1PZID 1V1PA 1D5MC 1DJRD 1TS3A 1YN4A 2AQ3B 2AQ1B 4RGOS 1M4VA 3CHBD 1EEFD 2RDHA 1G8ZD 2J4XA 1EFID 1JCKB 5ELDA 1YN3A 5FKAC 1YN5A 5ELFA 2ICIA 2RDGA 4L6TB 4RGNA 1RCVD 2TSSA 1S5DD 3GP7A 2AQ2B 1S5ED 5D3DA 4C56C 4RGTA 4NZLB 1PTOH 3BYTB 4RCOA 4UDUC 1BXTA 1PRTC 1BCPC 3URYA 1AN8A 1JWMD 1SE2A 1TS2A 1S5BD 1FGBD 4RHSA 1AW7A 1CHPD 1EEID 1PTOC 1LT3D 1B44D 1FNVA 1LT5D 4ZYSA 1CHQD 2XN9C 3TSSA 5TSSA 1PZJD 4RFBA 1D5ZC 2CHBD 5D3IB 1ET6A 1MD2D 1TY2A 1TS5A 2IJ0A 1V1OA 1RF2D 1XTCD 1KLUD 2NTSA 2SEBD 3EA6A 1I4QA 3BZDB 1CT1D 1LTRD 1FNUA 1HXYD 1LT6D 1SBBB 1LTAD 1FNWA 1LO5D 1KLGD 1LTBD 3R8BA 1FD7D 1D6EC 1XXGA 4OHJA 2XRSD 3V05A 1S5CD 1LTID 1EWCA 4L63B
chains in the Genus database with same CATH superfamily
2UUBL 2R2QA 4WH4A 5DPRA 3OHXC 2MSED 1A62A 4HDOA 4DXAB 5JH5C 1SF0A 1A3UA 1A2UA 1AEXA 1JE4A 1VQ8A 3O13A 4JBJA 1L4ZB 4DDID 4AYBE 4HJGE 5EBDA 5ELEA 4NXMQ 3E6ZX 1Y1WH 1ESFA 1E0BA 2I1JA 5LMNQ 4XGAB 3BVZA 4MACA 2P5ZX 3BDLA 3M4QA 1L6UA 1WMHA 1DD2A 2DYOA 4A3JH 5M5XB 1GO3E 4Y52H 2MGSA 3AEVA 2UWQA 3PHWB 1RKNA 1X56A 2UU9L 1ZP0B 4HSVA 1J19A 2BQQA 1G291 3RNGC 4J15A 4KJNA 3B1LX 1BCPB 5EE9A 2MWSB 5T8IA 3CW2C 3RUZA 1NMFA 2A1AA 3PO2H 1VQDA 2IHEA 3A56A 1JWSD 3F8TA 4OWTB 1LABA 4Z9CB 4JI5L 1C3TA 2IYDB 2CWPA 4XQJA 3Q69A 3GTGB 3NBHB 4GKJQ 1GHKA 2CR5A 2N9PC 1HH2P 5EPLA 4OX9L 4HJAA 2RPQA 3A9JA 3TMPB 3VH3B 4DGZA 5M3MG 5EKLA 3J80E 3V96A 4LNIA 2K1BA 4MSQB 1OXVA 4KV6A 1VQ9A 3K9PB 2GBJA 1JB3A 2I2YA 2F0SA 3CCMA 1Y14B 3RZOH 2VUMB 4USAA 4KN4C 2KCCA 2Q2TA 2LMCA 1D5MC 1VMPA 4N9F4 4URKA 4LNQA 2C7MB 2JQOA 2E2HB 2D3GA 2LEKA 1NY4A 1HA6A 4G0NB 2K8BA 1I5FA 5JJIA 1VCIA 1MI0A 1WXAA 4X3KA 5HG2A 5ELFA 1V8QA 4F7XA 1T6BX 3GP7A 4DKAC 2YEPB 1KDCA 1JC7A 4LF4L 4K7SA 1T0RC 2CU3A 3ECIA 2Z6BA 1T5EA 4LF5Q 3ND8A 3S2DB 1JRUA 1VQHA 2Z0EB 5BMGA 3AYHB 2F0DA 1Q10A 1WFYA 2L32A 4K7WA 5HI1A 2DLBA 4HMJA 4GOPC 2D9UA 2GN5A 3Q8EA 2JF5A 1EZ8A 4YCUA 3AE2B 1YJJA 5C4ZA 2ENBA 3M4OH 2FAZA 1IBKQ 1KAAA 1FGBD 3AFPA 1PH2A 4DR4L 1VQMA 4GDKB 1BBUA 1WGDA 5AZFA 4C4VA 2F0MA 3ZNZB 3AEAB 3EUB2 2L0TA 5LXHA 5J18A 3TSSA 1DM0B 2V1CC 3P42A 5EGTA 1F9RA 2N7DA 3WOEA 1U0LA 2PNHA 2K01A 1LGRA 2WXRA 4NAWA 3MXPA 1MD2D 1TY2A 3AE9B 1E3PA 4LJOB 1XTCD 3TP8A 2EJFC 3H8HA 3CSFA 2KFKA 1A8VA 3G7LA 3LWEA 1LTRD 2YU9B 5L37A 5IWAQ 3K57A 1PDQA 4IFDH 2L05A 3H7PA 3NVVA 4PYUA 1DOYA 4DV1L 3HM6X 4JGHB 3LNNA 1G2TA 1XNRQ 3A8IE 2K9XA 4OHJA 2PVOD 3M3JA 2CQAA 5DEHA 3V05A 3I56A 5COYA 2F4IA 3S9WA 2KHWB 1IKLA 3ZVVA 1WIAA 1TJEA 2AUJD 2KMAA 2K7VA 2WS3B 3CQZH 1NBWA 4BKTA 2KD0A 2PZTA 1FJGL 1H9KA 4P2CB 1TWFH 3CF5A 4G11A 1VMCA 5GQOA 3S1QH 4P74A 2NVTH 4TUUA 4DDGD 4DBGA 5JPMC 4EZLA 4CQNA 3WAMA 1WRDB 2FUHB 4GN5A 5EKIA 1XNQQ 1X65A 1Y1VG 2N9KA 3DWAA 3GV6A 4FVMA 2G5DA 3KFUA 4GZYC 1I4XA 1WI0A 1TXYA 4WJWA 1X6OA 4NQLB 3W5VB 3ML9A 3GTOH 2K0PA 4IG7B 4JI4Q 3W1SA 2K8HA 3AU4A 3VR9B 2KEDA 1XJVA 1PQSA 2LASA 2V4LA 1EUJA 5I2YA 2WX0A 1YNJC 4GDLB 5JEAH 2N4FA 4OELB 2MUYA 1VQ7A 5IYCH 3N30A 1ENFA 2NYZD 3L9AX 1WSPA 3AE1B 1JOKA 3C1EA 1TY0A 5HGQA 3V3XA 1UH6A 3RN2A 2Z6KA 1ZUD2 3HVDA 4G57A 4LUVA 1OEYJ 3LX0A 1A15A 2PYKA 3AFQA 4QGUA 1WR1A 1LT4D 3GOEA 4WORA 2L4NA 2FCQA 2JZZA 5AUIA 5IAAC 2FMCA 4X62L 3MFGA 3SR6A 1EM7A 4AUQC 1WX7A 4RF0A 5C3EH 4US9A 3CCQA 4WJQA 4YWLA 3W5OA 1FCLA 4OW0A 4MH0E 3VYTA 4GSWA 1G8ZD 4DV2L 1SYCA 3K81C 3K59A 5J1ZA 3OJ3A 4A3BH 1C7YA 5C4XB 1SNOA 2LJ5A 3Q3FA 1G2SA 2BA1A 4I65A 4L5TA 5LNK1 1PXUA 3H0GG 3WAOA 4CBVA 4FXDA 2PIAA 1S3OA 1VQEA 4LTUA 1WZ3A 2ZM6L 4BAXA 4B9KA 4X66Q 1WD0A 3Q2AC 1UZXB 1ZPSA 2BF8B 4KK7A 5JHAA 2BKFA 5DM63 2JA5B 3HRDD 4II2B 1PMRA 4PS8A 2B2TA 2JA8G 3GTMB 4JI3L 2JN4A 5IP9G 3T1HQ 2LUMA 4I6PA 3A33B 3IT6B 3RT3B 4ZKBB 4NXNQ 1NAPA 3FKIG 5JHBA 4FXGC 1FNVA 4LF7Q 1GB4A 4OO1H 1NVID 2Y0SE 2DJFC 2G1EA 3N1ZC 3CMEA 3FPUB 3PLVA 1SNMA 1EOVA 2NBUA 1VQOA 2E5LQ 3EJIA 4JI2L 3G71A 2D3AA 3W1BA 2DWQA 2SEBD 2LI5A 4LF8Q 4C3JG 2OCEA 1I94Q 2KC1A 5GXGB 3NE5B 3U30A 2WYQA 1HNWQ 2N8NA 1MJDA 2WDTB 2WGSA 4AQYL 3GTGH 2WACA 3A9KB 3KQ4A 1LO5D 1B3AA 2FIDA 4N58A 4DK6C 4X3SA 1PFSA 1NEKB 2J4XA 2E74C 2DNFA 1V6EA 1K28A 2VB3X 1QWYA 1JR0D 4PZ8A 5EAYA 2F4VL 3V60A 4RM9A 2I38A 2F0NA 2Y5PA 4KGTA 3FRPB 1TTNA 4A9AA 2JEAI 4JOIA 4MTKA 2JX5A 3UINB 4GNXC 2VUMH 2MBOA 3S2HB 4IO9A 4RMAA 2KEEA 3SK4A 5K36G 3TIXA 4BBNC 2EY2A 1ZE3D 4RKLA 2KBNA 1HUMA 4RHRA 4ZDVA 2JA6G 3DM1A 3FP9A 2FNJB 2D3BA 2VH2A 3W2DA 1OQRA 3B2GA 5HY6A 4YHHQ 3K0XA 1ROEA 4MJSA 4FULA 4CHTB 3ZXVA 2B8FA 1XX8A 1EZ6A 3TMEA 1T5XD 2ZJQA 4KV2A 3KUDB 4DR7Q 4M01A 1CQVA 2EJGC 1YIJA 4PS3A 5C1ZA 3ZDTA 3G48A 1SRUA 1Z9FA 1RODA 1C8CA 1IKMA 5IO9A 3PF4A 2JA9A 2JK8A 4PZ6A 3DWPA 4J6HA 2BB6A 4K2LA 3BDOA 5FLXE 2ZCBA 4E71A 1SE3A 1GAQB 1PFMA 2ZJDA 4JYAL 1J8IA 2DJGC 3MVVA 2JA7B 1XF5L 2MW5A 2B2YA 2H5XA 3S1MB 5AZHA 4QUFA 3VR8B 1HTLD 3P4PB 3QOJA 4A3LH 4LJPB 1W6KA 5FLMG 2Y0SB 3PZ8A 3J80i 1LLRD 1NBFC 4UP9A 4K81A 4CGYB 2JEBI 2CJOA 4P6VF 2Q5WD 1Z5SB 4M02A 1X9NA 3ZTDA 4IPGA 4RGOS 2BGFA 4KGRA 1M4VA 4HKZE 1A63A 3U7DA 1TWHB 1VQBA 3BZCA 3RI7C 3IG3A 5G3LD 3OWFA 5BN5A 2YU9H 1UE6A 3RZDB 4BXXG 2H4OA 3GO5A 1K73C 3MTNB 4F1SA 2WB1B 3I3CA 2OEOA 1S5DD 2JQRB 1OEYA 2PMVA 4GOCA 1GUAB 2B2UC 2J52A 1SE9A 3E5SA 1TBEA 2LJIA 2C5LC 2WDRB 2I5HA 3J81i 2L7RA 4IUMB 4KZCA 2OJRA 2WXLA 2Q8RE 3D4DA 3OYYA 1TS2A 2GBRA 1I6VC 1S5BD 2ZTCA 3LXFA 2UUAQ 4TQUS 1F2YA 3RNCC 1RFKA 2E6XA 2LXCA 3TEHB 4C1NI 2KDIA 3C19A 4HR7B 3B6YA 2I0QA 1I6HH 3OPOA 1MFWA 2VQEL 3GTQB 4BBRG 1Z7TA 1CMXB 1FEHA 1U5KA 4WWOA 4TKOB 4Q0FA 2GI9A 1CT1D 3HOYB 3MHBA 1WRIA 5J22A 2LZ6A 4BZAA 3WIMA 1SBBB 2PEAA 1SNDA 1VD2A 4P16A 4ANWA 4UY8C 3NK9A 1YOVB 3CIRB 4HPLB 4ANXA 4L63B 4A3KG 2RHQB 3DVNV 3FEWX 5LMNL 3QCAA 4XE0A 2WKCA 5CMDA 2HCCA 1EYAA 1ICFB 1KM7A 2WP8J 4C7ZA 3P20A 2E76C 2HUGA 1O7YA 2JYTA 3GTLH 3Q0AA 3M63B 4IPHA 1E8WA 4ZCKA 4I6LB 3A7LA 4JCVE 4HJ9A 1R4NB 4DV4L 3HOZB 2M56B 5I6YA 4DAPA 2G9DA 2MFIA 4NB3A 4DHZE 1PGAA 2M1MA 1B1ZA 3HP3A 4NKLA 4C3IG 4XWWA 3HGBA 1AWDA 4GOPB 2DYMA 1E90A 1EUVB 4K0KL 5BYQA 2K5QA 5EBCA 3A1QB 3EIVA 4B0MA 3P1MA 5CV6A 1ML0D 4C2MB 4EGVA 4CKEA 1BMLC 1WXVA 3CC7A 4GXBA 4DNRB 1AZPA 4MZ9A 2ZW0A 3OMGA 3A9KA 2JA5H 2KVRA 2Z0DB 1C48A 3PQIA 4HIDA 4RCNA 4ZLTF 1YHBA 1B7YB 3X23A 1VF7A 3AH7A 1F2RC 2EELA 2WFWA 3DVNU 2NBVB 2RMMA 3VUXA 1E10A 3ZW3A 3PREA 1HNXL 3AE7B 3TEXA 1U4PA 5JAVA 2INPE 2ZNVC 3L4PA 3ZO5B 1Q46A 1X55A 3PIOA 5FLXc 1GKHA 2LY7A 1PHJA 4FJZA 5JOBA 1QJOA 2C5CA 4A3IG 3EGRA 4RWSC 2AQ1B 4A3GB 1VDVA 1STAA 4FF3A 2BOSA 2Z0SA 2LGIA 3I63C 2UXCQ 5IT9c 2WXHA 2OQ0A 3EN2A 1JJ2A 2F0LA 1JJGA 1DCZA 4JI0Q 4ILWA 4ICUA 2WAQB 2ICIA 4OIKA 4A3CG 4L6TB 1ZXHA 3IAM1 4YSZB 2KDMA 2BE5D 2JSOA 5H1SE 1VQKA 1IBKL 3H15A 1B9MA 3S24A 4C56C 1TKWB 4RGTA 4L1BA 4GKKQ 3APDA 3UI3A 2K6QA 5C0XH 1S72A 2Z1CA 3NXWA 3PVLA 2IGHA 3APFA 2KCTA 1HR0L 2QCPX 1SE2A 2A8VA 4BBNF 4MM3B 1E2WA 5FO8B 4H2AA 4II3B 2KHIA 3J81L 1TZ1A 1WXMA 2DX5B 2L1AA 4YTPB 2V4IB 4ZRJA 1LT3D 3R3OA 2O6VD 1FCCC 2R7DA 3I5JC 2YYZA 1B2TA 3P4SB 1KRSA 2K5VA 2MLBA 1ZKOA 3J7ZC 4X57B 4IC7B 4XDCA 1J5EL 1RTOA 4DHZB 4AQ7A 1UWVA 4POGA 4ZAIA 4QUCA 1D3ZA 3D8GA 4AJYB 2NR2A 2EPBA 2RSNA 3PT2B 1B50A 1TS5A 3M7NA 1OXUA 3RNBC 2KLGA 1SMXA 3VTUA 3J7YW 3DHGC 3PO2B 2D2QA 5G55A 1F2MA 4BY1G 2K1FA 2R93G 1J9OA 2YVCA 3I57A 3VUWA 5AEKB 4YXDB 4CDEC 1PH8A 3W3AA 1A2TA 2KX3A 4JI7Q 3S1MH 3W1GA 1S1QB 2K4KA 2L1BA 2YLMA 4X3TA 3FC4A 2D5DA 4X64L 4EZJA 1YD8U 1K83H 2LSSA 4P72A 2WXPA 4CYEA 1QOFA 4IM0A 2FCMA 2WU5B 3ONAB 4IOCA 3A0JA 5CV8A 4A3FG 1WJ6A 1ZW7A 3GS2A 4LDTD 4MH8A 3MC8A 1JICA 1UNSA 2D2CC 4LF6Q 4JWSC 3DVGY 1G6JA 3NZUA 4YSYB 3HZXA 4JI1Q 2QW7A 2FCSA 1KF6B 2LHDA 1Q12A 4A3KB 2B3GA 4IDIA 2AUKA 1EYDA 5IE8A 2LGDA 2E8GA 3HFZB 1P16A 2KJRA 4FLHA 1QOGA 3BK2A 3KLRA 1VQAA 3K6OA 1VLBA 3AB5A 2NTTA 3ENEA 1STBA 1HZAA 3DHQA 3OWEB 1XCTL 4MGIE 5HKHA 3PO3G 1E7ZA 3R2TA 1JORA 1LFDA 1NYQA 4A3MG 3C1FA 1GUSA 2JZ3B 3ZIMA 1NR4A 5LHY1 3MA2B 2PW9A 3M4OB 2Z8LA 1PZKD 1UGJA 3NY5A 2L15A 3CRLC 1PH4A 5E3FA 1GXDC 1VJKA 1GUGA 3DWQA 1SDFA 3H0GH 3E0EA 2HTHA 2O2VB 4HCEA 1LTTD 3T1YQ 4IOAA 2PTLA 4HVBA 2BYFA 3UDIA 2OWOA 2IL8A 1SROA 3RLOA 4U673 1CFMA 3CHBD 3MXNA 1Y8PB 2HJ1A 4EKUA 3STBD 2N9XA 3OMCA 2JA8H 1TIFA 1MSGA 5IP9H 2DZIA 1X3PA 2MP1A 1O7IA 4X65Q 1IL2A 1N61A 2M0XA 4FJYA 2KDBA 5LLIA 3ZNHB 1EYCA 2RDGA 3FKIH 1TWGB 2RDBC 4DR6L 2TSSA 2KA7A 4KKTA 3O65B 3VRBB 3TP6A 3GDEA 5D3DA 4B3RL 3R66C 4S3SA 4GNXB 3T1HL 2JWZA 3A1QA 2O4XA 1XMQQ 4JWUC 3OW2A 4DR2L 2K3UA 4KKJA 2KHSA 4IOIE 1YZ6A 1G6ZA 2O5JC 4OZCA 1Q1EA 3J7A5 5JZEB 4UP8A 1KNAA 4KGSA 3JAML 3SVMA 4C3JH 2WQYB 2NBFA 3CQZB 3S15B 3AEFB 2E5LL 5MPOA 5IY0A 3NVYA 3HOZH 3HOVG 1D1IA 3U9OA 3I55A 4LF8L 3DBSA 3K80C 2EXZA 5DAUA 1VCBA 2WLBA 5EE0A 1R9TB 3Q3JA 2GLSA 3UDGA 1R4MB 4A3EB 3OTOQ 1HNWL 1IYVA 2MH7A 2KUMA 3FVQA 1IGCA 2ZVOA 1EOTA 2DY7A 3K5OA 1MJEA 3Q8CA 3NUCA 2RSOA 2CHZA 2NVXH 1EWHA 1AYFA 1CKNA 1GM5A 3GTOB 2KFJA 4A93G 1G6PA 3VHTC 2L0FA 4C2MH 2WINB 5F2DA 1KFYB 4ZHOA 3M9BA 1WR6E 2K25A 2R7ZG 4B3TQ 1LV9A 1PGBA 1SLJA 2UXBQ 2DZMA 4A3OA 4FA6A 3S1NH 2VXWA 2N1VA 2LGXA 3RNAC 4HJ8A 2RQXA 4RKBA 2Q2IA 3OOCA 2RPVA 5EQ0A 2BW2A 3A4RA 4B9WA 2PMZE 3BY4B 3JSVB 4LK0M 5AFWA 4LNOA 3VA5A 2BE5C 4TKNA 5JEAJ 3ML8A 1M90C 3IBEA 5NUCA 2HQEA 4IURA 5J39A 2IPKD 2ZXRA 4A3GH 1E2ZA 3OJ4B 1YNND 1V8CA 3FMCA 3MEFA 3DVGX 2HDEA 2R93B 1LTSD 4DR7L 1EU3A 1UEAB 2KOXA 5IGDA 4JIOU 1EY9A 4I7ZC 2X38A 3H94A 4YCWA 3PUWA 4A3BB 2L76A 2KVZA 4DV5L 5FLMH 2F0HA 4DWFA 1E8XA 2KDFB 1VQFA 5L95C 2KQ4X 2PW7A 2WXOA 2F0GA 4A3FB 5C3WA 2F1MA 4NZLB 3S17B 2WV6D 1W3SA 1IL8A 2SNSA 3J7AF 3UF8A 4IUNA 1JMLA 3QARA 1GVPA 4IUTA 2XK5B 3V6EB 3GD7A 4V0BA 2QDLA 2C35B 2C7HA 2MO0A 4P1CC 2N9EB 3KWVA 4BXXH 1X3GA 1O7ZA 5M9OA 4TRDA 4JV5Q 5IOIA 1P7EA 5FK9C 3LJ3A 4GN1A 3R2IA 1GJXA 2HT1A 4IFDI 4L5SA 2OTLA 1N34Q 3EHVA 2IGGA 5BR8Q 2N78A 4PNYA 3M95A 1XMOL 1X3FA 2AQ3B 1JMCA 4LFAL 2VW9A 3I4MG 3PO3B 1YN3A 2HJ8A 2LKVA 3MJ5A 4BVUC 3KYDD 3A7AB 2R7FA 4EQNA 4U68A 2FCNA 2GBMA 2KN4A 3BZKA 5G3LF 4B08A 3HOUG 4DK5A 2B3AA 3B08A 1ENAA 2EJMA 3SK6A 1WM3A 2A68D 3H09A 4B3SQ 4H02A 2K33A 3QA8A 5GMVA 2PMZB 4DV6Q 5M5WH 3T3NA 1SNPA 1BR9A 4LFCL 4LNKA 3VVWB 4RCOA 2R2OA 1K0SA 3TCAA 1IPGA 2KDEB 1A3TA 1GUTA 4FBJB 2A6EC 2V3SA 3ONSA 2ID0A 1WTQA 2F03A 4N6EB 1AE3A 5IOCA 4HJKA 5DPWA 2F0IA 1QCBD 1CHQD 1XLQA 4A3KH 1WYDA 3VR3A 1DOMA 4M0WB 1WGYA 2GA4B 3ZLZA 1KL9A 5HGTA 3RD4A 2D3CA 3V61A 2ATWA 1PYBA 1XPUA 1V1OA 3CPFA 2M4NA 2BBCA 1CUKA 2XWBB 3J81E 1ZDXA 1HHVA 4DUYL 1WCMG 1A5RA 2I07B 1FNUA 1SNCA 3STBC 5H92C 4AYBB 3KF8B 3HIZA 1DZ1A 2ZNVB 5C44G 4L8JA 1DONA 4ASWC 1Z2MA 2XRSD 4GNXA 4G50A 5JXVA 3Q8DA 2G4SA 3TL5A 2RKSA 5FR6A 3G4SA 4IM2A 1Q8IA 3T16A 3CCJA 4C3IH 3C46A 2CHXA 1SIFA 3KJOA 1OTRB 1A6XA 3AE6B 3N32A 1PTOF 1GC7A 1EWIA 1SB3C 5CBEE 3KBXA 1JRPA 3TEZA 2QF7A 1FRDA 1RD9D 3N1XC 4KSLC 2VQFQ 3CCEA 5E1FA 1WXQA 2MRPA 3TEWA 3VDZA 4EEWA 1TWGH 3TUOA 1AH9A 4KIKB 1JQYD 4L5QA 4HEA1 2EYMA 3HS0C 1QZGA 2WDQB 2BT6A 4WJOA 4WWMA 5BYRA 2DZJA 2CFMA 2NPTB 3KF6B 1TKYA 2BA0A 4OO1I 3DBHB 1PVOA 3E9IA 2N49A 4A3IH 1V86A 2XSCA 1TIID 5IYDG 3SU8X 4O1NA 1FGUA 1UUPA 5BN4A 4BBSG 1K8OA 5EDSA 3S15H 2I1KA 4FP5D 3M62B 2N7EA 1SE4A 1N33L 2K22A 3KUPA 1E22A 4S17A 1LACA 2TMPA 1R4PB 1T9HA 4R1JA 1C9OA 3SE0A 5IP7H 1IBMQ 2MP2B 1J7CA 4HWIB 3NZSA 4KDIC 2INNE 3VUYA 5IA7A 1STEA 1IBXA 1R9TH 2X6LA 3GE8C 4A3EH 3KK7A 4JI0L 4KVGB 1I6HB 2LUEA 2Q8TA 3UQAA 4HTHA 1VQJA 1R7SA 4F7ZA 5G5HA 2AWTA 5G5GA 2A6HD 3QIAA 2C7NB 3KYCD 4UHVA 2X6GA 4OIJA 2LD9A 4CDFC 2PE9A 2B2UA 3H6MA 4JBKA 4DFAA 2BDNA 1RCVD 3GE3C 4JI8L 4KN7C 2B2WC 3OG5A 2B63G 1FD6A 1Q1BA 5D65A 1Y8RC 1FYCA 2KCMA 1FR3A 1P0RA 3NS8A 4FF4A 1TZOA 4TQ1A 3V2TA 3BYTB 4ZRPA 1BXTA 1ZYRD 1LM8B 3EROA 3F1ZA 1XWEA 1PH9A 3NS1A 4BY1H 1V2YA 3HOWG 2AYOB 4RHSA 5KNBA 3GTLB 3I9V1 2R93H 3J80c 1HTOA 1RAXA 1B44D 3I4NG 4GGQA 2J0KA 3HOUB 1KIXA 4G4KA 1K51A 3KLSA 1UELA 4NPSA 5I6WA 3Q24A 5D6JB 4NW2A 2K05A 3TREA 1MI2A 3S1RB 2LXKA 3Q8BA 4DQOC 5M3MB 1L2NA 1MHHE 2KN5A 4C1NK 1VQGA 2ON8A 4LK1C 4M00A 1IZ6A 3JAME 2A5HA 1UF0A 1K53A 3BZDB 1DGJA 1N32Q 3K58A 1VQ5A 4A3FH 3EQLC 3SK5A 5LMUL 3CWIA 1VZ7A 1NI3A 2UXDQ 3S17H 2IT1A 4DUZL 1H9RA 1LT6D 1GNUA 2W3SA 1UD7A 3M3YB 4JL9A 1YIWA 3SHQA 3GTPH 1OFFA 3NBHA 2B2VC 1M1KC 2KENA 2ASQA 3CSTA 1EWCA 4C3HG 2WXKA 4JK1C 3RLFA 1M8AA 3VR4A 3K9OB 4WQOB 5CR3A 1NCVA 2EMTA 5DCNA 4DR1Q 4DV7Q 1AARA 4AJWA 1EQVA 3M4YA 5E6NA 3VFKA 4JI1L 3Q3NC 4H13C 5CGKA 2WP9B 1TS4A 4IKGA 4BA1I 3T3OA 4K6LA 2Z59B 2MJDA 3PO3H 2UUCQ 2D10A 2KNBA 3BYYB 4DPGA 4A3MH 1FMAD 1C76A 3FKYA 4EX5A 2ZXOA 3IAS1 5C44B 3M85A 4A6QA 4LF9L 1SJHD 4M8AA 5JVH3 4WAAA 2A4ZA 1LQBA 2FINB 3K0YA 1K8GA 3F2DA 1L0YB 2FHTA 5KGUA 1PRTD 1K8MA 2MJ3A 1YQ4B 4HIMA 4IPDA 1IBLL 1KOTA 2MPMA 2N7JA 4IUUA 4DK3C 3EFXD 1HTPA 4IPCA 5T1GA 1EQQA 2IX1A 4QQBX 1F9JA 2WXGA 3IHPC 2JP1A 4KKSA 2KJXA 1XLPA 5TR5A 3T1YL 4IJLA 4BWGB 1ZXIA 2HTME 4YY3Q 4TQ0A 4QF4A 2NVYH 1V97A 4GDKA 3SR1A 2MHVA 4B3MQ 4A20A 3NTIA 2RBMA 4QCLA 2KK8A 5DNFA 2G9HD 2OHFA 5C0XJ 1K9MC 1N36Q 1V1QA 4PYZA 1NTGA 1U9RA 3KWLA 2EYHA 3MHZA 2X8XX 1H9JA 1VQCA 1SMYD 3QX1A 1B9NA 1XMQL 2CQOA 2NN6I 2VZAA 4KD4A 2HIVA 2VNUD 4KIKA 2QKIC 2QA4A 3IAYA 3HOVH 2CKZB 1B70B 4F88A 1TGZB 1CZWA 3LB8C 2AQ2B 3DM3A 3ULPA 2NPTA 1NJIC 3PCOB 2KWUB 2RVLA 2A69D 1V9PA 1K50A 1Y1VB 3AU5A 4J3OD 3SDLC 5HFYA 4N9TA 2PI2E 5BN3A 1A70A 2MBBB 1OO9B 3PUYA 2K6DB 1KHIA 3AXCA 3T51B 2F0TA 4MSMB 1K83B 2YTYA 4A93H 2QIEB 1RHPA 4MGKE 2KWCA 3ZJYC 4DAVA 1JW9D 2KQ7A 2R7ZH 3RFZB 4GLAC 3HOXG 1WGHA 2O6VB 4ULLA 4BKSD 1VQIA 3S16B 2MP2A 3X0WA 4GMVA 1EY6A 4M8MA 2VL6A 4RAUC 2XBBC 3QR8A 3QAQA 3IKJA 2F0OA 2B63B 4P71A 1YJ1A 4ZYSA 1EF5A 1N8RC 1ACCA 1PH5A 1TKGA 1IW7D 3CCUA 1QF6A 2PLPA 4K8IA 1P1AA 4CKCA 1KLUD 5GAHC 3I8ZA 3P1HA 3KUCB 4GDLA 4US8A 1FM0D 1OQYA 3NTHA 3U7ZA 4PMCA 4CJ1B 1GHJA 5JJLA 1WJNA 1D4BA 4DV0Q 5AJ3Q 2AMCB 2HD3A 1L1OB 1HZ5A 5AUKA 2JE6I 2KAJA 1ENCA 2R61A 1VZ6A 4YTNB 4ZQ3A 3G6JB 3U52E 2K04A 2V1YA 3H0GB 3ZNGC 4DXGA 2LVPA 1KH0A 2IWHA 1UWXA 3ERQA 4LDTB 5HURA 3PIP3 1CSQA 1GG3A 1FIQA 1ZKHA 2NBWB 1EQTA 4A3JG 1II3A 1ZYRC 3NWTA 1FXAA 2BVCA 1WH3A 3VQIA 1X1MA 1IXRA 2ZPNA 2DNCA 4F8MA 4JI5Q 2HDMA 2SNMA 1OXTA 5GAEC 5C0XI 1I3QB 5ELCA 2JXTA 1E1TA 3BVMA 2JA8B 3AV8A 1SE8A 5A35A 1Q81C 1XO3A 4JW0A 2Z6KC 2OOBB 3ZQ4A 2R92G 4OX9Q 3ZJUA 1L0VB 1HZCA 3PGZA 3FKIB 2L12A 2HDLA 1SYGA 3HG9A 5FO9B 3AMZA 2KWVB 3EC8A 3SD5A 2JXXA 4LUZA 4RA8A 1H9SB 4H7BA 1WGRA 1E5WA 4NXML 4GLXA 1BDOA 1DXMA 1L2FA 3CCRA 3W9CB 4JV5L 2IDYA 4Y7NB 1I4GA 3MWYW 1C4CA 3AULA 4HIOA 1ET9A 2I5LX 3I4MH 1PTOD 4B0EA 4O42A 1N34L 2V3PA 4A55A 2UU7A 4C3JB 3GTJB 1XLNA 1ZXTA 2GBNA 2AL6A 4MNOA 3AEDB 2M2LA 2KOLA 1D8LA 1PDXA 3KLWA 3HOUH 1IYJB 4G7HC 3KJPA 4PQXA 1XTDA 3DEPA 3NUHB 3CC2A 5IKCM 5IGGA 3S1RH 3GB1A 1NR2A 5KRUA 1SXTA 1YNTE 3PUVA 4LF4Q 5M3MH 3H3VI 4A3DG 1RLFA 2VZKD 1EY8A 2BKRB 3ZRFA 4NY0A 4OZAA 1Z6HA 4NQKE 3MHSD 1KLVA 2NVXB 3D0FA 2R6GA 4DF7A 4GKJL 2DUDA 1EFID 2KECA 1SYEA 2B2TC 4DV6L 4ANUA 1F0ZA 3F2CA 2I46A 3H1UA 3M3YH 3FHWA 4K14A 2C60A 3N9YC 3PRZA 3JW0X 3G6EA 2FUG1 3DBLB 4RGNA 5DPSA 4GN3B 2JA6B 3S1NB 1V9JA 4R3DA 2JYOA 2N3SA 1E7PB 2J7QB 3GZNB 3U9SA 1MVKA 2OEDA 3BS1A 4QMGA 1PTOH 1BKBA 2KANA 1C77A 1BBXC 5CHFA 1PRTC 5IYBG 2OXPA 1BQQT 3URYA 5KYLA 1B9RA 1J0GA 2NZOA 4LUOA 3RZWC 4JBWA 1WCMH 2HE7A 4MGYE 5IN7A 4HAEA 3A54A 1MGSA 2W9NA 2IO0B 1WX9A 1YBYA 1TU2B 3CU7A 1XPOA 4HEDA 3VR6A 5C44H 3CCVA 1OTCA 1FL0A 1WJUA 1I42A 4QIWE 4LF5L 1ONLA 1WE6A 2ZVNA 4R4OA 3GTKH 3LGJA 2G4DB 4MIUA 3VYRA 2PQAB 5D3IB 3HRZC 4FXCA 1B4OA 1FPYA 3T56B 3JAMi 4ID6A 3Q6BA 4N59A 1CZPA 1N6ZA 2K5DA 3S14B 5C3XA 2F3VA 1LTBD 2ZTDA 1YQBA 1H9MA 1E2VA 1XXGA 2FIFA 2JPHA 4ALPA 2BH2A 4K1RB 5CX3A 5I2XA 2JUOA 1K3RA 1I35A 3FDTA 1MPEA 4K7UA 1AP0A 1WTHA 2A69C 4IUVA 4QB4A 2XRQD 3ZUNA 1DOLA 4MDKE 1F2LA 4BY7G 3ZRCA 4HK2A 1T3QA 1PYWD 5IWAL 4CKBA 4QL5A 1V1PB 2O6VA 2YTVA 5L83A 4IWOA 2HHHQ 1XNRL 3A8KE 4BBSH 4FHJA 1RRBA 3NELA 3JYUA 1K8AC 4ZK9B 2KZRA 5CORA 2OF1A 4XDXA 2AKWB 2ALYB 3NBIA 3UE0A 4DR5Q 5IYCG 2L52A 1IHZA 3I2ZA 4TSSA 1R4NI 1Y1VH 5JJKA 2CWAA 2G45B 3Q8FA 4JPSA 1V49A 3NTKA 5C23A 3KUZA 4X62Q 5M5WB 3D6CA 1QUQB 1ISNA 4BBRB 4MTNA 2QDFA 3TS0A 2K14A 5M3FG 1XNQL 3AEGB 4XTCS 5IODA 3Q22A 2L5TA 1ILQA 1P8LA 1QT9A 3ND9A 4DV2Q 1M94A 2NMQA 3D32A 4DN4M 4EE2A 3S16H 1HR0W 4OVVA 1T0QC 1Y56A 4JI4L 1PYSB 3HEJA 3AE4B 2WDVB 1STGA 4W9EA 2B63H 4QIWB 2IY1B 4OXPA 1W2BA 3EBEA 1YN4A 4I6NB 1EEFD 4MELA 5FR3A 4DR3Q 1WMHB 4R8IA 2MQHA 4JI3Q 1U4RA 5CHWA 3QG1A 3I4NH 3CMAA 3K8AA 1VQLA 1CI3M 3AI5A 1SNQA 4BFRA 4ABNA 1V5OA 1OGWA 4BOZB 1SIJA 2JWUA 1H9SA 1JT8A 1N63A 4RF1A 5FJ8G 2H89B 2BYTA 1NNXA 1IUEA 3NZ3A 2DGYA 4XYCA 2BS4B 5IP4D 3NQTA 4UDUC 3TDQA 4C3IB 3U8ZA 4JI2Q 4DA2A 3AN1A 4ZRZA 2XGTA 5BO4B 3IFWB 4WURA 1WGKA 1JALA 2BPSA 1YITA 5KNDA 2JSVX 3MJWA 3OW7A 1DOIA 1F9PA 1PTOC 2PE6B 1I3QH 4ZRIA 3UGBB 3A74A 4AQYQ 2BTEA 1V80A 1F52A 3J81j 1E8ZA 1LUZA 3RD2A 1X3EA 4PMWA 4C3HH 4X66L 2UXDL 3EVQA 4A4IA 2H88B 2KO3A 3DOWA 4RFBA 3VAWA 2J0TD 4ZUIA 5AZGA 3RNFC 1E0ZA 4GOPA 2DAJA 2F4VQ 2PPBC 5CBAE 2D62A 3WANA 1HTQA 4TV3A 2PZUA 4NJCA 2NZHA 3VA7A 4HIKA 3ZYYX 4Y7NH 2M9VA 4NXNL 4A3IB 4LF7L 4DV7L 2KX0A 1JOQA 1KABA 4LAAA 1YJNA 3LWUA 3GTJH 1NE3A 1BBWA 1QB5D 2K03A 4IFDJ 4IQZA 3D6WA 2VUMG 3TP7A 2VRRB 3L16A 3IL8A 2E2JH 3H9DA 1KDAA 1KDBA 1KRHA 4ANVA 1L0WA 4K5VA 2ZJRA 2EE1A 3BINA 5DM73 3OAWA 1I94L 1B3QA 5C4HA 3DPDA 5EE1A 1STHA 1PGXA 1WYWB 1EFWA 3A5ZB 4CHKA 1MHXA 1UBQA 1EQRA 1J7BA 3U2SC 1GUWA 1YX6B 5EPKA 4ODGA 2M0AA 5K36H 2W82A 2EYPA 4YTMB 3K5MA 3ZKJC 2DNEA 4N9PA 4JYAQ 4KHVA 4PG3A 2AX5A 3PS6A 1F9QA 2JA6H 4NAWB 2PQAA 2AWOA 5D14A 1RDPD 4K5WA 1EIHA 3AE5B 2DZKA 2HD5B 4FO2A 1WJJA 4RMFA 2K52A 2ONQA 1HA5A 2N55A 2KFKB 2QHOA 2RCNA 3F2BA 4BY7B 4YY3L 1YVCA 5GAGC 4LJZC 3U58A 5EPJA 5M5YH 3SEBA 1PRTF 5EKKA 3H7PB 2ZCCA 2ES2A 4DHJD 1RM6C 4FJVB 4A3LG 5C5MA 4Q2JA 3ZGZA 1FRRA 2WXNA 2G3QB 2JRHA 4YHHL 5GADC 4MM3A 3K7AH 2QMTA 4KY5A 3NP8A 1HZ6A 1CZGA 1X54A 1QQRA 4KY6A 1FFVA 4BY1B 3K7UC 3KOJA 4XQNA 1AFPA 2K32A 4WRDA 1WTRA 2K50A 3H6NA 4AH6A 3NJTA 1TWCH 1V1PA 3L10B 2REXA 3QJYA 3RCZA 3HHMA 2C9OA 4QY7A 4OWWB 2NS5A 2B2WA 2GVBA 4WWPA 2EIFA 5ELDA 1C1YB 2F0EA 5FKAC 1OQQA 4A90A 4IN3A 3HOXH 2RSUA 3FPPA 3S14H 1C79A 1A3VA 5CHVC 1ZGUB 2EDGA 2FE8A 5CV4A 1AE2A 2MCNB 2B76B 4NAMA 3GTPB 5BMHA 2N1WA 1Q5WB 2L11A 1SFOH 3SGIA 3ICEA 3S2AA 4K3BA 1K52A 1QUQA 4I7AA 1KC8C 4P1BC 4PZ7A 1NSNS 3SFEB 2FJ2A 4L23A 1AN8A 1L1OC 3AECB 2EOTA 2FMMA 1JOOA 1Y8NB 2EYJA 4LNFA 2F0KA 5IIFA 4HCPB 1L5PA 2D11A 1K8RB 3RLNA 4FXKC 2MBQA 5E7NA 4OEMB 2K75A 1C9FA 3VTVA 4A3MB 3CPWA 3I4LA 1KD1C 1KQSA 2CJNA 2KQSA 4DU9A 1L7YA 3PHXB 3RYTA 1D5ZC 1FVIA 2BCOA 3QQ8B 2CH4W 4APVA 4DV0L 4HLEA 2KJ6A 5AJ3L 3KDFB 2B2VA 1WD1A 5FLXL 3AMUA 2H1EA 2UUAL 5CV5A 2GVAA 4K3CA 4BBRH 4C00A 1R4MI 1YJIA 1V5TA 2KMCA 3QJZA 2FFKB 2BDOA 2XVSA 4PT5A 3WDNA 3A4SC 2CW0D 4P73A 2E2IB 2PNRC 1FD7D 1D6EC 1HFGA 1I50H 2NN6G 3MTSA 3NSWA 5IT9L 4DV4Q 3R7QA 4EOYA 4KKUA 2R92H 3P7JA 4IWQA 2CVRA 3VYUA 2EYLA 2K39A 2NVYB 4TMAB 2JT4B 4ARCA 2EYFA 3JVZX 5BMIA 4ME3A 1D2BA 2O2VA 5CV7A 4K0KQ 4G3XB 3DLLA 4XX5A 5C4XG 5IGFA 5CTRC 3Q14C 3PTFC 1SJED 4DAYB 4NJ6A 1JQ4A 5JPNC 2Q2UA 3UE1A 2EZVA 2V3NA 3CC4A 4YIJA 4PK1A 2NVQB 1Q1OA 2BYEA 5A2QL 1L4DB 1CTMA 1HNXQ 1BUVT 3HOVB 1XCQL 1SSNA 1PRTB 3HKZG 3P2BA 1K0RA 2JA5G 2EQSA 2MNAA 1FXTB 1LTLA 2JRIB 2V0GA 1SYBA 2X69A 1WY8A 3IXSA 3QC8B 4M8NA 4C80A 4G7ZC 4A3DH 2MBEA 2NCNA 3MEHA 2W55A 2IO2B 3J7AV 3AQQA 3UDXA 2JYEA 3E56A 3QIJA 4POFA 2INDC 4L5RC 2GOWA 2KT7A 4A93B 1E9MA 2LGYA 1T0SC 3RPFC 3CF6E 1SGHA 2XEWA 5J2RA 3TEYA 2RA4A 3DUZA 5DLQE 4RG1A 3NENA 3VYSA 1S40A 2PVGC 4C7YA 2R7ZB 3TZUA 3PZ7A 1LXDA 3ZJTA 1HQRD 3IFTA 2LFIA 3R7RA 4XT1B 1HCZA 2WXFA 3P75A 3MXUA 2QDBA 2WWZA 4AIMA 2RGFA 1Q3LA 3AM9A 1X32A 3D3RA 5IYBH 1NENB 1Q82C 2RDHA 4P75A 2F0WA 4OGQC 1HR0Q 1QLBB 3DQVA 3W5UB 4JLCA 5CYUA 4MJSB 4AOFA 2EYOA 2J7ZA 4EQ5A 5KIXA 4KHPQ 1YEZA 1NUCA 2N88A 4XIGS 3T13A 5C0XG 4HPMB 5ELOA 4CJ0B 2K28A 4DV3Q 2VB2X 4R4QA 1WTVA 3U4ZA 2MQJA 3NVWA 3JSVA 3M4PA 4NDXA 4A3CH 2KWDA 4R4IA 1J5EQ 3I4OA 4WJ4A 2BS3B 4IM3A 1HNZQ 2UXCL 3W1YA 3L13A 2IO3B 4XXEA 4W9FA 2M8SA 1WTOA 2PO4A 3NEMA 4NMZA 1SR3A 2F0UA 1VS0A 4K2KA 3QHTA 1WWTA 3AE8B 1LM0A 5FO7B 1G91A 4PS7A 2WXIA 1G51A 2RHSB 4JG2A 1N5WA 2KTRB 4ZOHC 5IGEA 2IO1B 1LT5D 2C9WB 5BYSA 4REZA 3WOFA 2BS2B 1TR5A 1YNNC 1KXLA 1BUIC 3NOBA 4HCNB 3HKZE 4GKKL 2XN9C 3I72A 4JBMA 2KJHB 3T4AC 1JROA 3I3TB 1CM9A 2QSDA 4W9KA 1ET6A 3HVZA 1GJZA 4X64Q 3AEBB 2GB1A 4BY7H 1QKZA 1TT5B 3L17A 2F0JA 3E9HA 1N9WA 4ZKCB 2JA7G 4W9DA 3PV1A 4WWNA 3D4RA 3ITPA 1HQMC 1CJEA 3DWMA 2KC2A 1QG7A 4H0LC 2IZVB 2Y0SG 2XIWA 3BWUD 2INCC 2XK5A 3R8BA 2B29A 2OJWA 3I4MB 2VH1A 1TT2A 1WI5A 1E8YA 3PIO3 1F2RI 4KJOA 1O7LA 4HN7A 1S5FD 1YJ9A 2HHHL 1D1KA 1CKOA 3CKIB 1YMHE 5DPTA 2IX3A 2IBIB 4J8QA 4V190 2PPHA 2SAKA 3UIPB 1XLOA 3TP5A 1WX8A 3J9CA 2D0PA 1TVXA 2WB1G 3UQBA 4XZ4A 4DR5L 3QWNA 3SK8A 4K8JA 3A5UA 2F3IA 2QILA 3TZDA 5M3FH 1Y8OB 1ILPA 1V81A 2SOBA 3L3OC 4JI7L 4CDCC 2GBKA 5D7GA 4WJ3M 4YT0B 3K5LA 5I9PA 4JE3B 2L83A 3KYHC 4O0AA 3NWSA 4HXDA 1RFAA 1S4ZA 3VH4B 3I7FA 2KLCA 5J3BA 2LRWA 1JJCB 2DY8A 3KDFA 1PA6A 3PUXA 1ICWA 1PFDA 1BCPD 3ZNID 3I70A 3L7ZC 4LFBQ 3QK0A 3RZFA 1YJWA 1U4LA 1Z47A 3J81c 4JPBW 1XEEA 2J53A 3EFUA 1QNKA 3APCA 2A68C 4LF6L 2E2DC 2NZ1D 1DOKA 1PTOB 2L9HA 2SDFA 3ULLA 1BOSA 3C2PA 4HMIA 4OWXB 4AS1A 3M7GA 2BH8A 3X3NA 3DWGC 4JI6Q 3L0WB 2OTJA 1WCMB 4WQMA 1YI2A 2ZT9C 1WTXA 2CW0C 3DBHI 3KW5B 4UPAA 2DHZA 3B2FA 3RNUA 4DR6Q 3R93A 4DR3L 2YTXA 2J0MA 3HKZB 3CXCA 2VZKB 5FJ8H 3OIPA 2FXQA 4B3RQ 3DCGA 4M0WA 3HOYG 4IUPA 1DJRD 4DR2Q 1QOAA 3GTKB 3NVZA 1GPXA 1I7HA 4DAYA 1PUTA 2V9HA 2JY6A 5M5XH 1NMGA 2DBYA 4TVAB 3DDCB 1NI2A 4MHEA 5CV9A 2CCZA 3B9JA 3KF8A 2E2IH 5GROA 1RTNA 4GS3A 4E6IA 4S0RA 4K5XA 1YHQA 1QOHA 2JU6X 4NPNA 4DNIA 4P7IA 1ZDVA 1BNZA 2KYWA 3E9SA 5KNCA 2KHJA 4LMQD 5LXIB 4YWKA 2WB1E 3HOZG 1H8CA 2A5UA 3L2PA 4X65L 1J7AA 1QZHA 5KHOA 3N6RA 1YNXA 3SHLA 4XDDA 1EIFA 1J6QA 1WM2A 4KDLB 3U4EG 2MEKA 5H8YE 1RWSA 2AL3A 2AWNA 3VRAB 1CHPD 2XWJB 1ASYA 2V4DA 2PKOA 4BBSB 3MP9A 1QOBA 1EL0A 1VQ6A 2NVQH 3Q6SA 2LXJA 4EQPA 2W3RA 4HRSA 1QVCA 1JWBD 1VQ4A 4OVUA 1Y69U 1SAPA 1T0YA 4ACFA 3DHIC 2E2HH 2CHBD 1WOCA 1RF2D 4BS9A 2NVUI 3KF6A 5C3JB 1YX5B 4L2YA 3KVFB 2IW3A 2Z4IA 3HK0A 2KXJA 1WTWA 3OSOA 2IY5B 2QGQA 1DGSA 1KLGD 1RL2A 1STNA 1EYGA 3WA0A 3KBGA 3OTOL 4A76A 4ZRQA 2JJQA 4ZYNA 4HROA 3S2DH 3BIID 3PZDA 1EY4A 5KYIA 4GIVA 3DEOA 2IX0A 4A3GG 1E7UA 2RD0A 2B39A 3HUIA 4BOSC 4DV5Q 3L08A 4KZ0A 4RH6A 3NPPA 3QB3A 3TN2A 3ZDMC 4BKSA 1EIGA 1E1OA 3TBIB 2L55A 2Z9HA 4B3TL 2WAQG 4RGMA 2UUBQ 2UXBL 1FO4A 4ARIA 2KTRA 3P4QB 5IT9E 4OVZA 3PRPB 1YHAA 3RN5A 1HUNA 1C4QA 2WXJA 4FN2A 3KLSX 2CKHB 2OT2A 3H7SA 1L0XB 1JE5A 2XTIA 2A6HC 4J1MA 3HOWB 1GOZA 1UAPA 2L0CA 2ZPYA 3I4NB 3BJUA 3JAMc 2K5HA 1I4RA 1JB7A 2JZPA 2W54A 3TJPA 4EFOA 2KKCA 4FNFA 1QVFA 1D7QA 3FILB 3PPAA 5EE3A 1Y1WG 2QEJC 2M17A 2UU9Q 1HZ9A 1OXSC 1XMOQ 1SEBD 3W1SC 1UGMA 5HHDG 3TS2A 4LFAQ 4J6IA 1E24A 3AE3B 5ELNA 1KRTA 1P3QU 1KTKA 2BB5A 3IVFA 3T8MA 1KNEA 1U4MA 4PV1C 2KMMA 4HKQA 2O5IC 3ZXRA 5A2QE 1BT0A 3P63A 2MHJA 2M00A 4KY7A 1VQPA 3MFYA 1EU4A 1SSOA 3V6CB 5CC4A 3Q23A 2EMSA 2A19A 4LWCA 3PO2G 2RDFA 4C3HB 2IY0B 1H4RA 1PZID 2K5NA 4HPPA 4ITKA 4BKGA 4XC2A 3C3LA 4LW1A 4LFCQ 1Q8KA 3RUIB 2MJEA 4UP7A 4YWGG 1PV4A 1C4PA 2IGDA 3P4RB 2ZZPB 1UE1A 2HQLA 1YN5A 3L54A 1QNUA 4DK1A 4E3CA 4YWMA 3BK1A 4HJ7A 2F0QA 1XQQA 2M19A 4JX1C 1O78A 3A55A 2QCZA 4XQQA 5BR8L 3T53B 1TQOA 1N62A 1UEBA 5C4JB 3TRZA 3E3XA 3KH0A 4KSKC 1CSPA 3DHHC 3T9LA 2E2JB 4JQWC 4YSXB 1H95A 2WAQE 1EO6A 2AHOB 1BCPC 1L6VA 3ALBA 4JVZA 3PO0A 1JWMD 3Q8AA 4FYDA 2Q8IB 3UDFA 1GD7A 2N9LA 3V62A 1AW7A 3N20C 1PH7A 4DUYQ 3N1YC 1VF5C 1CA6A 4B3SL 1VQNA 4KHZA 2CHWA 4MEMA 2NN6H 4N8FA 2MBHA 4F8CB 3ERSX 1RJTA 4XYQA 1WE7A 2K5PA 1PFNA 2A73B 1X3QA 4Q5VA 4B9XA 1K3BC 1KJTA 2L3ZA 3WWVA 5LL6S 2CU1A 2Y3AA 3SFDB 1RYJA 4DR4Q 3MXNB 3EA6A 4JC0A 1WVLA 1E6EB 1GUNA 1I4QA 4GLVB 5ISRA 2N0SB 1F1HA 2KACA 2KCNA 4FADA 5C4XH 4E74A 4ZHPA 2FBWB 3QWZB 2LWPA 5M5YB 1P9DU 4RM8A 1N60A 2F0FA 3H91A 2GRIA 4X3UA 3D31A 2RR9A 4WIPA 3B0AA 5LMNW 5LL6X 5JVG3 2L8JA 2NB0A 3K7AB 1CK1A 1U4AA 2L00B 3E0JA 1C4AA 2QC8A 3PGEA 3VXWA 2EY5A 5E4XA 4AWJA 4FHKA 1EWYC 1E7VA 4KKIA 4IJHA 2Y5BB 4DV1Q 2PJHA 2D0OA 1XPRA 3GTMH 2LHEA 3RNEC 1QE6A 3NHHA 4PMBA 1XT9B 2F52A 2QEXA 4NNJB 1QILA 3I73A 4W9CA 3CD6A 2LRUA 4CDDC 1TWAB 3BVGA 1TWCB 2MO1A 2CS4A 4IFDG 3U4VA 1HE8A 3DBRB 1EY0A 3OLMD 4JOIC 3HKSA 5ELBA 3EFCA 4XWTA 1MG4A 1Q7YC 5D94A 3CCSA 1QZEA 4IUQA 2HCIA 1FJGQ 3CMMB 1SMYC 2OQKA 1N33Q 3MZ5A 2GMIC 3HOXB 3UIOB 1D5XC 1RIPA 3WALA 1PLFA 3PLUA 1WTPA 3J80L 4DXFA 1V43A 1EIYB 1CKNB 4EVOA 1O80A 1SYFA 3A8JE 2LGSA 3ETRA 3PRMB 4O2DA 2BWFA 1SFOB 4W9HA 4DHJB 4CJ2C 1I4PA 5IP7G 2WX1A 4R9WA 2VQFL 4IALA 1BO0A 2KVMA 2ZXPA 4XYOA 3GV3A 3VDYA 1FXIA 3IRBA 4LCDE 1WXSA 2E3TA 1DYQA 2HIXA 4DNTB 4A3EG 3N52A 1CKMA 1B8AA 5IYDH 2Q2HA 2MA9B 2F3WA 2MX2A 2BWES 1J8CA 1EY5A 4WJNA 1ZEQX 4KI0A 2ZTEA 3MC0B 4JI8Q 3S2HH 3IT4B 3U50C 4GLSC 4YCVA 1OXXK 2B2YC 2LS01 5JEAG 1GUOA 4GN4B 4KHPL 1TS3A 1WJ4A 4W9GA 3UI2A 3CAMA 1Y1WB 4DV3L 1DOXA 1P7FA 1IW7C 1JCKB 2D07B 3BU2A 1IBML 3PMFA 3AEEB 3AU7A 4A3JB 1JWAD 1HNZL 3RN9C 1GB1A 3VR5A 5G2NA 2CH4A 1S5ED 2J0JA 1MKHA 3HM3A 1MBYA 1L1OA 1I50B 1IYUA 3WAPA 3FILA 1MIUA 3ULJA 2WIIB 4KMUC 1Q0WB 2R92B 5C3EG 4X6AH 3Q3OC 4R4TA 4HSPA 3DBLI 1WGGA 3X3MA 4WAFA 3H3VH 1C0AA 2DAFA 2K8CA 2JA7H 3MAQA 2PW5A 1NYRA 3GZNI 3QOLA 2ZM6Q 4A3PA 5LMUQ 4A3BG 3ZJVA 1TKEA 2EKEC 3PSIA 4DUZQ 1IGDA 4EQOA 1F9SA 2PZWA 5KHQA 2RCFA 4FF1A 3GQBA 3HOWH 4KTAA 4ZUJA 1PZJD 3RZOB 3TBLD 1MJCA 1TWHH 2F0VA 2IJ0A 5EJWA 1XYIA 4OZBA 2NTSA 2PI2A 1R4QB 2MJ8A 3MC9A 4IZ8A 3RZDH 2ZW1A 1B53A 3DXJC 4A3DB 1ESRA 5C6AA 3C8YA 3NG0A 4W9JA 1HXYD 2J42A 3IFDA 3TQYA 1PH6A 2JVCA 2WNMA 3PUZA 1WZ0A 1HPCA 3DBRI 1UBIA 4UAIA 4OO1G 1PH1A 1YQ3B 4RNAA 4A75A 5I9OA 1LTID 3PSEB 3I91A 3A9JB 5C5LA 4LF9Q 4W9LA 3WCQA 1C78A 3AB9A 1I4HA 1PH3A 4D2KA 2A6ED 3RMHA 1N32L 1IP9A 4IW0A 1F77A 1UE5A 2A74C 2LFNA 1LYLA 3F2UA 5K5PA 2O2LD 4CO7A 2NUCA 2D5GA 2LMCB 1UWMA 5FOBB 5T1IA 3I90A 1IBLQ 4FF2A 2BYVE 2YV5A 2AEHA 4FDBA 1ZOYB 4LFBL 1VZ8A 2R3ZA 1PFBA 1Q90A 1HEZE 3GTQH 4B6WA 2RF4A 4OONA 4DR1L 1EY7A 3OIQA 2KQ3A 1FFUA 5C4JH 1HFNA 4IWPA 1LTGD 2K5WA 1HZBA 1S3SG 2EXDA 1NDDA 3NRZA 4QAYA 4JI6L 4MN3A 3SDZA 1QVGA 3HOYH 1WYGA 4W9IA 5E6OA 2WKDA 2UUCL 4YL8A 1BCPF 1UE7A 2ASBA 4NJ7A 5C2TB 3ZTCA 3JC66 1JWUD 3ER0A 5IGBA 4HJ5A 5I4DA 2EKIA 1HJPA 1WF9A 1KAWA 2I5MX 3LDZE 4KD3A 1IYFA 3K5NA 1VRAB 2IHFA 2XNAC 5E6PA 4N8X1 4BA2I 4C4VB 3BDCA 2F0PA 4R8NA 1MHWC 3BG3A 3RMKC 3L0OA 4A8XC 1SYDA 4ZRKA 3CP0A 2EY1A 4DK0A 1Q86C 4AYBG 1TWFB 4G7OC 3S1QB 3CRKC 5E6JA 4B95A 2NVTB 4OL7A 3PIPA 2WXMA 1A0IA 1SN8A 2PCFB 1F2ZA 4HCSA 1CA5A 2WU2B 1CQFA 1GC6A 1WFQA 2VY3A 4K6DA 4LLGM 4DAMA 2LXAA 4WFN3 4B3ML 1VR9A 2ACZB 2QJLA 2Y5CA 4ICVA 2K6AA 1BF4A 5E4WC 4XT3B 2E75C 1N36L 2LVOA 3QO2A 3LYYA 2LVQA 4EZKA 1BVSA 5KEEA 4R4CA 3PV0A 4QJFA 2YEPF 2ZEQA 2DYBA 2DENB 3FAHA 1N5XA 3N3KB 1MG8A 4MGZE 3VTWA 2PQEA 2WXQA 3RR5A 1STYA 4NP5A 1TWAH 1TYGB 4F87A 1EF1A 1W6JA 2VS1A 4KLKA 2KTFA 4KX6B 1EEID 3D4WA 5IGCA 2EY6A 4MT5A 4LNNA 5M3FB 2JXMB 4GU2A 1IBXB 3CCLA 3H3VC 4EUTA 4WJPA 4AP4C 2Z4HA 3PF5A 5TSSA 3NHEB 1YNJD 3VR2A 5C3EB 5D2MB 2EVBA 5J17A 3MXGA 5JJZA 3C0RB 1AZQA 4HDQA 1P98A 2NWGA 2DN8A 3RULA 3Q3MC 3R3MA 1ASZA 3SXHA 1XD3B 1VDZA 2VQEQ 2B8GA 1MSHA 3DMUA 1LTAD 1HRJA 2WHIA 3NQIA 1FNWA 2ZJPA 3EECA 4H44C 2UYZB 4GB9A 4M1UB 1S5CD 2ICEC 3ABVB 4ME5A
chains in the Genus database with same CATH topology
4WH4A 3OHXC 1SF0A 1A3UA 1A2UA 1AEXA 1JE4A 1L4ZB 3O13A 4HJGE 5EBDA 5ELEA 3E6ZX 1ESFA 1E0BA 3BVZA 4MACA 3BDLA 1L6UA 1DD2A 2DYOA 5M5XB 2MGSA 1RKNA 1ZP0B 4HSVA 1G291 4KJNA 5EE9A 1BCPB 5T8IA 3RUZA 3A56A 1JWSD 1LABA 4Z9CB 4XQJA 3Q69A 3GTGB 1GHKA 5EPLA 4DGZA 5EKLA 3J80E 3V96A 2K1BA 1OXVA 4KV6A 1JB3A 2I2YA 2F0SA 4USAA 2VUMB 4KN4C 2KCCA 2LMCA 1D5MC 1VMPA 2E2HB 2LEKA 1HA6A 1VCIA 1MI0A 4X3KA 5HG2A 5ELFA 1V8QA 4F7XA 1T6BX 3GP7A 2YEPB 1KDCA 1JC7A 2CU3A 1T5EA 3ND8A 3S2DB 5BMGA 2L32A 2F0DA 1Q10A 5HI1A 2DLBA 4HMJA 2D9UA 3Q8EA 1EZ8A 3AE2B 1YJJA 5C4ZA 2ENBA 1KAAA 1FGBD 4GDKB 2F0MA 3AEAB 3EUB2 3TSSA 1DM0B 3P42A 5EGTA 1F9RA 3WOEA 2WXRA 2K01A 3MXPA 1MD2D 1TY2A 3AE9B 1XTCD 3TP8A 2EJFC 3H8HA 3G7LA 3LWEA 1LTRD 2YU9B 3K57A 4IFDH 1PDQA 3NVVA 1DOYA 3LNNA 1G2TA 3A8IE 2K9XA 4OHJA 2PVOD 2CQAA 5DEHA 3V05A 5COYA 2F4IA 3S9WA 1IKLA 1TJEA 2AUJD 2K7VA 2WS3B 2PZTA 1H9KA 4P2CB 1VMCA 5JPMC 4CQNA 5EKIA 2N9KA 3DWAA 3GV6A 4FVMA 4GZYC 1I4XA 4WJWA 3W5VB 2K0PA 3W1SA 3VR9B 2KEDA 5I2YA 4GDLB 1YNJC 5JEAH 2MUYA 1ENFA 2NYZD 3L9AX 1WSPA 3AE1B 1JOKA 3C1EA 1TY0A 3V3XA 1ZUD2 3HVDA 4G57A 3LX0A 1A15A 2PYKA 1LT4D 4WORA 2L4NA 5AUIA 2FMCA 3MFGA 3SR6A 1EM7A 4RF0A 4US9A 4OW0A 3VYTA 1G8ZD 1SYCA 3K59A 5J1ZA 5C4XB 1SNOA 1G2SA 2BA1A 4I65A 5LNK1 1PXUA 4CBVA 4FXDA 2PIAA 4LTUA 1WD0A 1ZPSA 4KK7A 5DM63 2JA5B 3HRDD 1PMRA 2B2TA 3GTMB 2LUMA 3IT6B 4ZKBB 1NAPA 4FXGC 1FNVA 1GB4A 4OO1H 1NVID 2G1EA 3FPUB 1SNMA 3EJIA 2DWQA 2SEBD 4C3JG 5GXGB 3NE5B 2WACA 3KQ4A 1LO5D 1B3AA 4N58A 4X3SA 1NEKB 2J4XA 2E74C 2VB3X 1QWYA 1JR0D 2I38A 2F0NA 2Y5PA 4KGTA 3FRPB 4A9AA 2JEAI 2JX5A 3S2HB 2KEEA 3SK4A 5K36G 2EY2A 1ZE3D 4RKLA 4RHRA 1HUMA 3DM1A 3B2GA 3W2DA 1OQRA 1ROEA 4CHTB 2B8FA 1XX8A 1EZ6A 3TMEA 1T5XD 1CQVA 2EJGC 1RODA 1C8CA 1IKMA 3DWPA 4J6HA 2BB6A 4K2LA 3BDOA 5FLXE 1SE3A 1GAQB 1PFMA 1J8IA 1XF5L 3MVVA 2JA7B 2B2YA 3S1MB 3VR8B 4QUFA 1HTLD 3P4PB 3QOJA 1W6KA 2Y0SB 3PZ8A 1LLRD 4CGYB 2JEBI 2CJOA 4P6VF 2Q5WD 4RGOS 4KGRA 1M4VA 4HKZE 1TWHB 5G3LD 3OWFA 5BN5A 3RZDB 2H4OA 3GO5A 2WB1B 3I3CA 2OEOA 1S5DD 2JQRB 2PMVA 2B2UC 2J52A 2LJIA 3E5SA 2WDRB 2WXLA 2Q8RE 3D4DA 1TS2A 1I6VC 1S5BD 3LXFA 4TQUS 1F2YA 1RFKA 2E6XA 4C1NI 4HR7B 3OPOA 3GTQB 1Z7TA 1FEHA 4TKOB 4Q0FA 2GI9A 1CT1D 3HOYB 3MHBA 1WRIA 5J22A 1SBBB 1SNDA 4P16A 3NK9A 3CIRB 4L63B 3FEWX 4XE0A 2WKCA 5CMDA 2HCCA 1EYAA 2WP8J 4C7ZA 3P20A 2E76C 2HUGA 1O7YA 2JYTA 3Q0AA 3A7LA 3HOZB 2M56B 5I6YA 4DAPA 2G9DA 1PGAA 1B1ZA 3HP3A 4NKLA 4C3IG 4XWWA 3HGBA 1AWDA 2DYMA 5BYQA 2K5QA 5EBCA 4B0MA 3P1MA 5CV6A 1ML0D 4C2MB 4EGVA 4CKEA 1BMLC 4DNRB 1AZPA 2ZW0A 3OMGA 1C48A 4RCNA 4ZLTF 1VF7A 3AH7A 1F2RC 2EELA 1E10A 2RMMA 3AE7B 3TEXA 1U4PA 5JAVA 2INPE 3L4PA 2LY7A 5JOBA 1QJOA 2C5CA 3EGRA 4RWSC 2AQ1B 4A3GB 1VDVA 1STAA 4FF3A 2BOSA 2LGIA 2WXHA 2F0LA 1DCZA 4ILWA 2WAQB 2ICIA 4OIKA 4L6TB 1ZXHA 3IAM1 4YSZB 2KDMA 2BE5D 2JSOA 3UI3A 1B9MA 4C56C 1TKWB 4RGTA 4L1BA 5C0XH 2Z1CA 3NXWA 2IGHA 2QCPX 1SE2A 4MM3B 1E2WA 5FO8B 4H2AA 3J81L 4YTPB 2L1AA 2V4IB 1LT3D 3R3OA 1FCCC 2YYZA 1B2TA 3P4SB 1ZKOA 1RTOA 4AQ7A 4ZAIA 4QUCA 3D8GA 2EPBA 2RSNA 1B50A 1TS5A 3M7NA 1OXUA 3J7YW 3PO2B 1F2MA 3I57A 1J9OA 4YXDB 3W3AA 1A2TA 2L1BA 4X3TA 3FC4A 2D5DA 2WXPA 1QOFA 2WU5B 3ONAB 5CV8A 3GS2A 4MH8A 1JICA 1UNSA 2D2CC 4JWSC 4YSYB 3HZXA 1KF6B 2LHDA 1Q12A 4A3KB 4IDIA 2AUKA 1EYDA 1QOGA 3BK2A 3KLRA 3K6OA 1VLBA 3AB5A 2NTTA 1STBA 3DHQA 1XCTL 3OWEB 3R2TA 1JORA 1NYQA 3C1FA 1GUSA 1NR4A 5LHY1 3MA2B 2PW9A 3M4OB 2Z8LA 1PZKD 1UGJA 3CRLC 5E3FA 1GXDC 1VJKA 1GUGA 3DWQA 1SDFA 4HCEA 1LTTD 2PTLA 2IL8A 4U673 1CFMA 3CHBD 3MXNA 1Y8PB 3OMCA 1MSGA 1X3PA 2MP1A 1N61A 1EYCA 2RDGA 1TWGB 2TSSA 2KA7A 4KKTA 3VRBB 3TP6A 5D3DA 4S3SA 4JWUC 2O4XA 4KKJA 2K3UA 2KHSA 4IOIE 1G6ZA 2O5JC 4OZCA 1Q1EA 1KNAA 4KGSA 3JAML 3SVMA 2WQYB 2NBFA 3CQZB 3S15B 3AEFB 5MPOA 3NVYA 1D1IA 3U9OA 2EXZA 5DAUA 2WLBA 5EE0A 1R9TB 4A3EB 1IYVA 2MH7A 2KUMA 3FVQA 1IGCA 1EOTA 2DY7A 3K5OA 3Q8CA 3NUCA 2RSOA 1EWHA 1AYFA 3GTOB 2WINB 5F2DA 1KFYB 4ZHOA 1LV9A 1PGBA 2VXWA 2RQXA 4RKBA 3OOCA 2RPVA 5EQ0A 2BW2A 4B9WA 4LK0M 5AFWA 3VA5A 2BE5C 5JEAJ 5NUCA 2HQEA 4IURA 5J39A 2IPKD 2ZXRA 1E2ZA 1YNND 1V8CA 3FMCA 2HDEA 2R93B 1LTSD 1EU3A 1UEAB 5IGDA 1EY9A 4I7ZC 2X38A 3H94A 3PUWA 4A3BB 2F0HA 2KQ4X 2PW7A 2WXOA 2F0GA 4A3FB 5C3WA 2F1MA 4NZLB 3S17B 2WV6D 2SNSA 1IL8A 3J7AF 4IUNA 1JMLA 4IUTA 3GD7A 4V0BA 3KWVA 1O7ZA 5M9OA 4TRDA 1P7EA 5FK9C 3R2IA 1GJXA 4IFDI 2IGGA 4PNYA 2AQ3B 3PO3B 1YN3A 2LKVA 3MJ5A 3A7AB 4EQNA 4U68A 2KN4A 4B08A 5G3LF 1ENAA 2EJMA 3SK6A 2A68D 3H09A 2K33A 2PMZB 3T3NA 1SNPA 1BR9A 4RCOA 1A3TA 1GUTA 2A6EC 2ID0A 1WTQA 2F03A 4N6EB 5IOCA 2F0IA 1QCBD 1CHQD 1XLQA 3VR3A 1DOMA 2GA4B 5HGTA 3RD4A 1V1OA 2BBCA 2XWBB 3J81E 1ZDXA 1HHVA 2I07B 1FNUA 1SNCA 5H92C 4AYBB 1DZ1A 4L8JA 1DONA 2XRSD 5JXVA 2RKSA 1Q8IA 3T16A 3C46A 1A6XA 3AE6B 1PTOF 1SB3C 5CBEE 3KBXA 1JRPA 3TEZA 2QF7A 1FRDA 1RD9D 5E1FA 1WXQA 3TUOA 1JQYD 4HEA1 2EYMA 3HS0C 2WDQB 4WWMA 2BT6A 5BYRA 1TKYA 2BA0A 4OO1I 2XSCA 1TIID 4O1NA 1UUPA 5BN4A 1K8OA 4FP5D 1SE4A 2K22A 3KUPA 1LACA 1R4PB 2TMPA 3SE0A 1J7CA 2INNE 1STEA 1IBXA 2X6LA 3KK7A 1I6HB 2Q8TA 4HTHA 1R7SA 5G5HA 5G5GA 2A6HD 3QIAA 2X6GA 4OIJA 2B2UA 3H6MA 4DFAA 2BDNA 1RCVD 4KN7C 2B2WC 1FD6A 1Q1BA 5D65A 1FYCA 1FR3A 4FF4A 1TZOA 4TQ1A 3V2TA 3BYTB 4ZRPA 1BXTA 1ZYRD 3EROA 1XWEA 3NS1A 4RHSA 5KNBA 3GTLB 3I9V1 1B44D 3HOUB 1K51A 4G4KA 3KLSA 5I6WA 3Q24A 4NW2A 2K05A 1MI2A 3S1RB 3Q8BA 4DQOC 5M3MB 1MHHE 4C1NK 2ON8A 4LK1C 3JAME 2A5HA 1K53A 3BZDB 1DGJA 3K58A 3EQLC 3SK5A 3CWIA 1VZ7A 1NI3A 2IT1A 1H9RA 1LT6D 2W3SA 3M3YB 1OFFA 3NBHA 2B2VC 1EWCA 4C3HG 2WXKA 4JK1C 3RLFA 1M8AA 3VR4A 5CR3A 1NCVA 1EQVA 3M4YA 4H13C 5CGKA 2WP9B 1TS4A 4IKGA 4BA1I 3T3OA 4K6LA 2MJDA 3BYYB 1FMAD 3IAS1 1C76A 2ZXOA 5C44B 3M85A 4A6QA 1SJHD 4M8AA 5JVH3 2FINB 3K0YA 1L0YB 2FHTA 5KGUA 1PRTD 1K8MA 2MJ3A 1YQ4B 2MPMA 2N7JA 4IUUA 3EFXD 1HTPA 5T1GA 2IX1A 2WXGA 2JP1A 4KKSA 2KJXA 1XLPA 4BWGB 1ZXIA 2HTME 4TQ0A 4QF4A 1V97A 3SR1A 2MHVA 3NTIA 2RBMA 4QCLA 5DNFA 2G9HD 2OHFA 5C0XJ 1U9RA 3KWLA 2EYHA 3MHZA 1H9JA 1SMYD 1B9NA 2NN6I 4KD4A 2VNUD 2QKIC 3IAYA 4F88A 3LB8C 1CZWA 2AQ2B 2RVLA 2A69D 1K50A 5HFYA 1Y1VB 4J3OD 4N9TA 5BN3A 1A70A 1OO9B 3PUYA 3T51B 2F0TA 1K83B 2QIEB 1RHPA 4DAVA 1JW9D 3RFZB 4ULLA 3S16B 1EY6A 4RAUC 3IKJA 2F0OA 2B63B 4ZYSA 1ACCA 1TKGA 1IW7D 1QF6A 2PLPA 4K8IA 4CKCA 1KLUD 3I8ZA 3P1HA 4US8A 1FM0D 3NTHA 3U7ZA 4PMCA 4CJ1B 1GHJA 1D4BA 1HZ5A 5AUKA 2JE6I 2KAJA 1ENCA 2R61A 1VZ6A 4YTNB 4ZQ3A 3G6JB 3U52E 2K04A 3H0GB 4DXGA 1KH0A 2IWHA 1UWXA 3ERQA 5HURA 3PIP3 1FIQA 1EQTA 1II3A 1ZYRC 3NWTA 1FXAA 3VQIA 2DNCA 4F8MA 2HDMA 2SNMA 1OXTA 5C0XI 1I3QB 5ELCA 2JXTA 2JA8B 3BVMA 3AV8A 5A35A 1XO3A 3ZQ4A 3ZJUA 1L0VB 3FKIB 2L12A 2HDLA 1SYGA 3HG9A 5FO9B 3AMZA 4RA8A 1H9SB 4H7BA 1BDOA 1DXMA 3W9CB 2IDYA 4Y7NB 1I4GA 3MWYW 1C4CA 1ET9A 1PTOD 4B0EA 4O42A 2V3PA 4A55A 4C3JB 3GTJB 1XLNA 1ZXTA 3AEDB 2M2LA 2KOLA 1PDXA 4G7HC 4PQXA 3DEPA 3NUHB 5IGGA 3GB1A 1NR2A 5KRUA 1SXTA 1YNTE 3PUVA 2VZKD 1EY8A 4OZAA 1Z6HA 2NVXB 2R6GA 4DF7A 2KECA 1EFID 1SYEA 2B2TC 1F0ZA 2I46A 3N9YC 4K14A 2FUG1 4RGNA 2JA6B 3S1NB 4R3DA 2JYOA 1E7PB 3U9SA 1MVKA 2OEDA 3BS1A 4QMGA 1PTOH 1C77A 1BBXC 1PRTC 2OXPA 1BQQT 3URYA 5KYLA 1B9RA 4JBWA 4HAEA 3A54A 1MGSA 1TU2B 3CU7A 4HEDA 3VR6A 1ONLA 4MIUA 3VYRA 5D3IB 3HRZC 4FXCA 1B4OA 3T56B 4ID6A 4N59A 1CZPA 2K5DA 3S14B 5C3XA 2F3VA 1LTBD 1H9MA 1E2VA 1XXGA 5I2XA 3FDTA 1MPEA 1AP0A 2A69C 4IUVA 4QB4A 2XRQD 1DOLA 1F2LA 1T3QA 1PYWD 4CKBA 1V1PB 3A8KE 4ZK9B 5CORA 2OF1A 4XDXA 3NBIA 2L52A 1IHZA 4TSSA 3Q8FA 4JPSA 3NTKA 5M5WB 3D6CA 4BBRB 3AEGB 4XTCS 5IODA 3Q22A 2L5TA 1ILQA 1QT9A 3ND9A 2NMQA 4EE2A 4DN4M 1Y56A 3HEJA 3AE4B 2WDVB 1STGA 4QIWB 1YN4A 1EEFD 5FR3A 4R8IA 1U4RA 3QG1A 1CI3M 1SNQA 4ABNA 1SIJA 2JWUA 1H9SA 4RF1A 1N63A 2H89B 2BYTA 1IUEA 3NZ3A 2BS4B 3NQTA 4UDUC 3TDQA 4C3IB 4DA2A 3AN1A 4ZRZA 4WURA 1WGKA 1JALA 2JSVX 5KNDA 3OW7A 1DOIA 1F9PA 1PTOC 2BTEA 4PMWA 2H88B 3EVQA 4RFBA 2J0TD 4ZUIA 1E0ZA 2PPBC 5CBAE 2D62A 2PZUA 4NJCA 3VA7A 3ZYYX 2M9VA 4A3IB 1JOQA 1KABA 4LAAA 3LWUA 2K03A 1QB5D 4IFDJ 4IQZA 3D6WA 3TP7A 3IL8A 1KDAA 1KDBA 1KRHA 4K5VA 2EE1A 5DM73 5C4HA 5EE1A 1STHA 1PGXA 1MHXA 1J7BA 3U2SC 1GUWA 5EPKA 4ODGA 2M0AA 5K36H 2W82A 2EYPA 4YTMB 3K5MA 2DNEA 4N9PA 4KHVA 2AX5A 1F9QA 4NAWB 2AWOA 5D14A 1RDPD 4K5WA 1EIHA 3AE5B 4FO2A 2ONQA 1HA5A 2N55A 4BY7B 4LJZC 5EPJA 3SEBA 1PRTF 5EKKA 3ZGZA 1RM6C 5C5MA 4Q2JA 1FRRA 2WXNA 2QMTA 4KY5A 3NP8A 1HZ6A 1CZGA 1QQRA 4KY6A 1FFVA 4BY1B 4XQNA 1AFPA 2K32A 4WRDA 1WTRA 1V1PA 3QJYA 2C9OA 2B2WA 5ELDA 2F0EA 5FKAC 1OQQA 4A90A 4IN3A 3FPPA 1C79A 1A3VA 2EDGA 2FE8A 5CV4A 2B76B 4NAMA 3GTPB 5BMHA 2L11A 1K52A 1NSNS 3SFEB 2FJ2A 4L23A 1AN8A 3AECB 2EOTA 2FMMA 1JOOA 1Y8NB 2EYJA 2F0KA 5IIFA 1L5PA 4FXKC 1C9FA 4A3MB 3I4LA 2CJNA 4DU9A 1D5ZC 2BCOA 2B2VA 1WD1A 5FLXL 3AMUA 2H1EA 5CV5A 1YJIA 2FFKB 2BDOA 2XVSA 4PT5A 3WDNA 2CW0D 3TEWA 2E2IB 2PNRC 1FD7D 1D6EC 1HFGA 2NN6G 3MTSA 3NSWA 5IT9L 4KKUA 3P7JA 2CVRA 3VYUA 2EYLA 2NVYB 4TMAB 4ARCA 2EYFA 5BMIA 1D2BA 5CV7A 5IGFA 1SJED 1JQ4A 5JPNC 2EZVA 2V3NA 4YIJA 2NVQB 5A2QL 1L4DB 1CTMA 3HOVB 1BUVT 1XCQL 1FCLA 1SSNA 1PRTB 2V0GA 1SYBA 2X69A 3IXSA 4C80A 4G7ZC 3MEHA 2W55A 3J7AV 2JYEA 3E56A 4A93B 1E9MA 3RPFC 3TEYA 2RA4A 3DUZA 2PVGC 3VYSA 4C7YA 2R7ZB 3TZUA 3PZ7A 3ZJTA 1HQRD 3IFTA 2LFIA 4XT1B 1HCZA 2WXFA 3P75A 3MXUA 2QDBA 1Q3LA 3AM9A 1X32A 3D3RA 1NENB 2RDHA 2F0WA 4OGQC 1QLBB 3W5UB 5CYUA 2EYOA 2J7ZA 5KIXA 2N88A 1NUCA 4XIGS 3T13A 5C0XG 4CJ0B 2K28A 3NVWA 2VB2X 1WTVA 4NDXA 2KWDA 2BS3B 4XXEA 1WTOA 2PO4A 4NMZA 2F0UA 4K2KA 1WWTA 3AE8B 5FO7B 1G91A 2WXIA 1N5WA 4ZOHC 5IGEA 5BYSA 1LT5D 4REZA 3WOFA 2BS2B 1TR5A 1YNNC 1BUIC 2XN9C 3I72A 3T4AC 1JROA 1CM9A 2QSDA 1ET6A 3HVZA 3AEBB 2GB1A 1QKZA 2F0JA 4ZKCB 3D4RA 3ITPA 1HQMC 1CJEA 3DWMA 1QG7A 4H0LC 2XIWA 3BWUD 3R8BA 3I4MB 1TT2A 3PIO3 1F2RI 4KJOA 1O7LA 4HN7A 1S5FD 1D1KA 3CKIB 1YMHE 2IX3A 4J8QA 4V190 2SAKA 1XLOA 3TP5A 3J9CA 1TVXA 3QWNA 3SK8A 4K8JA 2QILA 3TZDA 1ILPA 1Y8OB 2SOBA 3L3OC 5D7GA 4YT0B 3K5LA 5I9PA 4JE3B 2L83A 3NWSA 1S4ZA 2DY8A 3PUXA 1ICWA 1PFDA 1BCPD 3I70A 3L7ZC 1U4LA 1Z47A 2J53A 1XEEA 1QNKA 2A68C 2E2DC 2NZ1D 1DOKA 1PTOB 2L9HA 2SDFA 1BOSA 3C2PA 4HMIA 4AS1A 3M7GA 3X3NA 3DWGC 1WCMB 4WQMA 2ZT9C 1WTXA 2CW0C 3B2FA 3R93A 3HKZB 2VZKB 3OIPA 4M0WA 4IUPA 1DJRD 1QOAA 3GTKB 3NVZA 1GPXA 1I7HA 4DAYA 1PUTA 2DBYA 4MHEA 5CV9A 3B9JA 3KF8A 1RTNA 4E6IA 4K5XA 2JU6X 1QOHA 1ZDVA 1BNZA 3E9SA 5KNCA 4LMQD 1J7AA 3N6RA 3SHLA 4XDDA 3U4EG 2MEKA 5H8YE 1RWSA 3VRAB 2AWNA 1CHPD 2XWJB 2V4DA 2PKOA 4BBSB 3MP9A 1QOBA 1EL0A 4HRSA 3Q6SA 4EQPA 2W3RA 1JWBD 1Y69U 1SAPA 2CHBD 1RF2D 4BS9A 5C3JB 4L2YA 2IW3A 2Z4IA 1WTWA 3OSOA 1KLGD 1STNA 3KBGA 4ZRQA 4HROA 3BIID 1EY4A 5KYIA 3DEOA 2IX0A 2B39A 3HUIA 4RH6A 3NPPA 3QB3A 3TN2A 1EIGA 3TBIB 2L55A 4RGMA 1FO4A 4ARIA 3P4QB 5IT9E 4OVZA 1HUNA 1C4QA 2WXJA 3KLSX 2OT2A 1L0XB 2A6HC 4J1MA 3HOWB 1GOZA 1UAPA 2L0CA 3I4NB 1I4RA 2JZPA 2W54A 4FNFA 3FILB 5EE3A 2QEJC 1OXSC 1SEBD 5HHDG 3AE3B 2BB5A 1KTKA 1KNEA 1U4MA 4PV1C 2KMMA 4HKQA 2O5IC 5A2QE 3P63A 2M00A 4KY7A 3MFYA 1EU4A 1SSOA 5CC4A 3Q23A 2RDFA 4C3HB 1PZID 4ITKA 3C3LA 2MJEA 4YWGG 1C4PA 2IGDA 3P4RB 1YN5A 1QNUA 4DK1A 3BK1A 2F0QA 4JX1C 2M19A 1O78A 3A55A 4XQQA 3T53B 1TQOA 1N62A 5C4JB 2E2JB 4YSXB 1BCPC 1L6VA 3PO0A 1JWMD 3Q8AA 4FYDA 2Q8IB 2N9LA 1AW7A 1VF5C 1CA6A 4KHZA 2NN6H 4XYQA 1RJTA 2K5PA 1PFNA 2A73B 1X3QA 4Q5VA 4B9XA 3SFDB 2Y3AA 5LL6S 1RYJA 1E6EB 3EA6A 1WVLA 1GUNA 1I4QA 5ISRA 2N0SB 2KACA 2KCNA 4ZHPA 2FBWB 5M5YB 1N60A 2F0FA 3H91A 2GRIA 4X3UA 3D31A 4WIPA 5LL6X 5JVG3 2NB0A 3K7AB 1CK1A 3E0JA 1C4AA 2EY5A 5E4XA 1EWYC 4KKIA 2LHEA 1QE6A 3NHHA 4PMBA 1QILA 3I73A 1TWAB 3BVGA 1TWCB 4IFDG 1EY0A 5ELBA 4XWTA 4IUQA 2HCIA 1SMYC 3MZ5A 3HOXB 1D5XC 1PLFA 1WTPA 3J80L 4DXFA 1V43A 4EVOA 1O80A 1SYFA 3A8JE 3ETRA 1SFOB 4CJ2C 1I4PA 4R9WA 4IALA 1BO0A 2KVMA 2ZXPA 4XYOA 3GV3A 1FXIA 2E3TA 1DYQA 4DNTB 3N52A 2F3WA 1EY5A 1ZEQX 4KI0A 3IT4B 3MC0B 4GLSC 1OXXK 2B2YC 2LS01 5JEAG 1GUOA 1TS3A 3UI2A 1Y1WB 1DOXA 1P7FA 1IW7C 1JCKB 3PMFA 3AEEB 3AU7A 4A3JB 1JWAD 1GB1A 3VR5A 1S5ED 1MBYA 1I50B 1IYUA 3FILA 2WIIB 4KMUC 2R92B 4HSPA 3X3MA 4WAFA 3MAQA 2PW5A 1NYRA 3QOLA 3ZJVA 1TKEA 1IGDA 4EQOA 1F9SA 2PZWA 4FF1A 3GQBA 4KTAA 4ZUJA 1PZJD 3RZOB 5EJWA 2IJ0A 2F0VA 1XYIA 4OZBA 2NTSA 1R4QB 2MJ8A 4IZ8A 2ZW1A 1B53A 3DXJC 4A3DB 1ESRA 5C6AA 3C8YA 1HXYD 2J42A 3IFDA 2WNMA 3PUZA 1HPCA 4UAIA 4OO1G 1YQ3B 4RNAA 5I9OA 1LTID 3I91A 5C5LA 3WCQA 1C78A 3AB9A 1I4HA 4D2KA 2A6ED 3RMHA 1F77A 2A74C 2LFNA 5K5PA 3F2UA 2O2LD 2NUCA 2D5GA 2LMCB 1UWMA 5FOBB 5T1IA 3I90A 4FF2A 1ZOYB 1VZ8A 2R3ZA 1PFBA 1Q90A 1HEZE 1EY7A 3OIQA 2KQ3A 1FFUA 1HFNA 1LTGD 2K5WA 3NRZA 4MN3A 3SDZA 1WYGA 2WKDA 1BCPF 5C2TB 1JWUD 5IGBA 5I4DA 2EKIA 4KD3A 3K5NA 1VRAB 2XNAC 4BA2I 3BDCA 2F0PA 4R8NA 3BG3A 4A8XC 1SYDA 2EY1A 4DK0A 1TWFB 4G7OC 3S1QB 3CRKC 5E6JA 2NVTB 4OL7A 2WXMA 2PCFB