1HXYD

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 66
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hxyD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hxyD02
4Z9CB 1PTOD 3CHBD 3DWQA 5ELBA 2O2LD 3EFXD 1FNUA 4OHJA 1LT4D 3BZDB 1EU4A 1L0YB 1HQRD 1M4VA 1UNSA 4O1NA 2ICIA 2TSSA 1LTAD 2QILA 4TSSA 2G9HD 3URYA 1I4QA 2AQ3B 2WV6D 3BVGA 5D3IB 1JCKB 1I4PA 1SJHD 1UUPA 1ENFA 1FD7D 1RF2D 3DWPA 3R2TA 2RDHA 3DWAA 1PZJD 1EFID 3SEBA 1XXGA 4K6LA 1STEA 1CT1D 1DJRD 2NTTA 1FNWA 1ET6A 1D5XC 1PTOH 1KLGD 1PTOF 1BXTA 1BCPC 5I4DA 4ZYSA 2AQ2B 1SE4A 1PRTD 1BCPD 3V05A 2IJ0A 1CHQD 4DXFA 1TY2A 2XRQD 1I4XA 2RDGA 5D3DA 3KLSX 1S5ED 1L0XB 1CQVA 1I4RA 1PTOB 1TY0A 3MFGA 1YN4A 1MD2D 1LO5D 1TS3A 2NTSA 1EWCA 1KLUD 1LTRD 2CHBD 1RDPD 1SEBD 1SBBB 4UDUC 1HA5A 1SXTA 2R61A 1RCVD 4RGTA 5ELFA 1D5MC 1JWSD 1LT3D 1YN3A 1XTCD 5ELCA 1S5BD 2J4XA 4DXGA 1PRTC 1PYWD 1TS5A 1T5XD 3BVMA 2XN9C 1PRTF 1BCPF 4RCOA 5ELDA 2XRSD 3BYTB 3O13A 1QILA 1HTLD 1V1OA 1V1PB 1S5DD 4RH6A 3BYYB 3W2DA 4RGOS 1KTKA 2QEJC 4NZLB 1B44D 4RHRA 1EEID 1BCPB 1PRTB 3EA6A 4RHSA 3MC0B 1DYQA 2IPKD 1FNVA 1SE2A 1LTID 1RD9D 1SE3A 1LTGD 1TS4A 1ET9A 1D6EC 1LT5D 1EU3A 1LT6D 4RGNA 1D5ZC 1JQYD 1S5CD 1CHPD 1JR0D 4L6TB 1PZKD 1JWMD 1LTSD 3BVZA 1TS2A 3GP7A 3R2IA 1LTTD 4C56C 1B1ZA 4L63B 3R8BA 2Z8LA 2SEBD 1F77A 1G8ZD 1I4HA 1LLRD 1SJED 5FK9C 1V1PA 3TSSA 5TSSA 4RFBA 1CK1A 1HXYD 2XNAC 1FGBD 1GOZA 1AW7A 5FKAC 1JWUD 4RGMA 1EEFD 1LTBD 5ELEA 1YN5A 1I4GA 1S5FD 1PTOC 1AN8A 1PZID 1ESFA 3OWEB 4BWGB 2AQ1B
chains in the Genus database with same CATH superfamily
2B3AA 1I3QB 3HS0C 4IUNA 3EROA 2K6AA 1JMCA 2HTHA 2MCNB 4URKA 1WM2A 1R4PB 4K7WA 3B2GA 1WR1A 1LT4D 2KCNA 1TWAH 1EU4A 2EE1A 4IPGA 5J1ZA 3K58A 3L0OA 1PDXA 2FINB 2RQXA 3WOEA 5CBEE 3GTJB 4BY7G 2UXDL 5E4WC 3CC7A 2YLMA 5AEKB 1V86A 4AJWA 1IL8A 2B3GA 1P16A 2WAQE 2XIWA 4K2LA 5IE8A 5EPLA 3GTLH 1WZ3A 1GUSA 1FM0D 3T4AC 1V81A 3QA8A 5M3MH 1ENFA 1H9MA 4O0AA 4YSYB 5FO7B 2FXQA 3ZVVA 1TWGH 2VZKD 1IBMQ 3R2TA 2K8CA 2KTFA 3QIJA 1SE9A 1TWAB 3M4YA 3BG3A 3RUZA 2ZJQA 1ZW7A 1YI2A 4FNFA 4BS9A 4QL5A 1HNXQ 3GTLB 1NY4A 4EUTA 5AZHA 3KF6B 3CQZH 1IW7D 5M3MB 4WQOB 3BK2A 2NZ1D 2V9HA 1TWGB 1PUTA 2FHTA 4FLHA 4TKNA 1PFNA 5GAGC 3QAQA 1D4BA 4C2MH 1Y69U 4QQBX 2E6XA 2KFJA 2RDGA 3L4PA 1NNXA 1I4RA 2AMCB 3JC66 2N49A 4ZKBB 1KABA 5BN5A 5LMNQ 4R4QA 1YNTE 2NPTB 3CMMB 1LO5D 3ZQ4A 2PMVA 4QIWB 2VH2A 3CQZB 1X65A 2XK5A 5HG2A 1S40A 5JJIA 4UDUC 5A35A 2E76C 2WDQB 4C2MB 4NQKE 2B8GA 3CP0A 1N32Q 1TYGB 4DXGA 3K5MA 2N9KA 4EFOA 4TQUS 3BVMA 4LF8Q 1VQ4A 1WGRA 5KYLA 4LNOA 3MXNA 5ELDA 2NZOA 3CCJA 4HDQA 1DOMA 5C4XH 4X3SA 3KFUA 4LFAQ 3T9LA 2YV5A 1AH9A 1PFMA 5G5GA 1C79A 1YD8U 4FULA 2NR2A 1U5KA 4ID6A 4YY3Q 1JRUA 4MGZE 3L08A 1SR3A 1XO3A 4XDCA 3EA6A 5KYIA 2M8SA 1KD1C 2GBJA 4DFAA 1SE2A 1HZ9A 2WB1E 4JCVE 3DBRI 3R66C 4WAAA 5C4XB 3V6EB 5FO9B 4XXEA 4XYQA 5CV6A 4KHZA 1TIID 4PV1C 2KHSA 1WXMA 3EFCA 2F03A 3U52E 2FCQA 4NY0A 4C00A 2D07B 1JQYD 2UXBL 1C78A 3DXJC 1VQKA 4EZKA 1Y8PB 4A3IH 2KAJA 4XQQA 2ZW1A 4WJOA 3GV3A 3V60A 3GP7A 1F9SA 5IGDA 1ENCA 4K81A 2D3CA 5TR5A 5BYSA 3A56A 2CHWA 3V61A 2BB5A 1RRBA 4X57B 3M4PA 1B9MA 4IPHA 2IY5B 1V1PA 4G7HC 1EM7A 4LNIA 1KXLA 1KHIA 1HXYD 5CHWA 4UP8A 3UQAA 2F0TA 4GGQA 2H89B 4RGMA 2CJNA 3KJOA 3LWUA 5IT9E 2CH4W 2K6QA 4A3IB 5FLXc 2BA1A 1Y1WG 3HIZA 1PTOC 4IFDG 1DONA 4OVVA 1R4MB 1G6JA 2J0MA 5I6YA 2RCNA 3LX0A 3GTOH 4OZAA 5M3FG 3CSFA 3MC9A 5E3FA 2VB2X 4JPBW 1YHQA 4DR7Q 1I94L 1F9QA 5ELBA 2O2LD 3Q22A 1K50A 1L2FA 1MGSA 4HDOA 2DZMA 1EIYB 2ICIA 4XT3B 4XWTA 2K52A 4LJPB 1Q1OA 4I6LB 4RMAA 3DQVA 3MHBA 1LFDA 1Y8RC 1STYA 3FP9A 1EQTA 1XCQL 2EJMA 5EDSA 5MPOA 4ASWC 1NTGA 5JEAH 5FR3A 4LJZC 2Q2UA 4FHJA 4C7YA 1LV9A 2L15A 1BUIC 5J18A 3KUDB 1J6QA 1A3VA 4MGKE 2IO0B 2FUHB 4HJAA 1Y56A 3N20C 4ZYSA 1T9HA 4UP7A 3AFQA 2KXJA 3HM3A 1Y1VH 2BCOA 4LF9Q 2A6EC 5IA7A 3F2CA 3N1XC 5DPRA 2EXZA 2B2UC 2LI5A 1TT2A 4ICUA 2PPBC 5D6JB 4OX9L 3A7AB 1B53A 1Q7YC 4A3GG 4A3EH 1K83B 3RLOA 4YL8A 3VHTC 4A20A 2DN8A 1CQVA 1TY0A 4DR4Q 4RAUC 2B8FA 4I6PA 4BXXG 4JV5Q 3LYYA 1B9RA 3SK5A 1EWCA 3N6RA 4PS7A 3LB8C 5FR6A 1IBKQ 1W3SA 5BN3A 1Y1VB 4R4CA 1J8CA 3LWEA 2ON8A 1SEBD 2G4DB 3RT3B 4US8A 4KN4C 5EAYA 4JYAQ 4DK6C 3WAOA 2YEPF 2DYBA 3I63C 4MN3A 4FBJB 4IM0A 1WH3A 4A3EB 5C44G 1FYCA 2L9HA 5L37A 1T3QA 4H2AA 1PYWD 1OQQA 1LTLA 2KOXA 2E5LQ 4G7OC 2M1MA 4HPMB 3LGJA 4CDEC 3TCAA 4DV7L 1EQQA 4LF5L 3Q8CA 2L1AA 2PO4A 1JOKA 1KQSA 4PK1A 1GUGA 3U58A 3H09A 2C7NB 3MJ5A 3NWTA 1YBYA 4JI3Q 1Q8KA 1SMYC 2WDTB 3H7SA 4LCDE 4II2B 4WRDA 4B3RL 5D7GA 1WTVA 4LF4L 1VQ9A 1WE7A 5JHAA 2Q8IB 1X3PA 1HNZQ 1BCPB 3QJYA 3MEHA 3AE7B 1NAPA 3KDFA 2C7HA 2I07B 2N9EB 2N8NA 5M5WB 4IZ8A 3TP6A 3GB1A 3OW7A 1EYCA 1MG8A 1BF4A 1EFWA 2JQRB 1E9MA 1XPRA 2NBVB 1CTMA 1RAXA 4XE0A 4G50A 2KECA 4AYBG 2A4ZA 2B2TC 1LQBA 1LT6D 3ZW3A 4L5TA 3ZJYC 1B9NA 1VMCA 1BUVT 4JI8L 3I70A 4DR2L 1SGHA 2VQEL 1FO4A 2F0JA 3D6WA 4N8FA 4J3OD 2JK8A 4DR5Q 2MLBA 3RUIB 1MIUA 1F2ZA 1F2YA 4WFN3 3DM1A 1TVXA 5DAUA 4IPCA 4RFBA 1CK1A 1Q81C 3KF8A 3K5OA 1AE2A 1QVFA 3S2HB 4N9F4 3AE4B 2F4VL 5DNFA 4HJGE 1X3FA 4BKGA 1Z47A 4J6HA 4HEDA 3ZXRA 1J7AA 5EKIA 3ND9A 3KYDD 2LGXA 2PW9A 3P4QB 4KKUA 2DAFA 1RKNA 2OJWA 3KBXA 2L7RA 3PT2B 4UP9A 3PUYA 2CWAA 4W9LA 2A6ED 3CPWA 2V4LA 1GKHA 4O1NA 5EBDA 1I5FA 4RMFA 1CKOA 1EOTA 4G3XB 4NNJB 3T16A 2V3PA 2YYZA 4GKJL 1SJHD 1XF5L 3TBLD 3DWAA 3J9CA 3W1SC 5EPKA 3HOXH 1QCBD 4OIKA 1XNQL 2CFMA 3LXFA 3MXUA 1CKNB 1PDQA 4XZ4A 1ONLA 1LGRA 2BYEA 4YWGG 2O2VA 2RSOA 2K39A 1KFYB 5I6WA 4MACA 3NBHB 1WX8A 4JWSC 3UI3A 1FMAD 3QX1A 1S3SG 5C1ZA 3U4ZA 3ZNID 2KLGA 4DR1Q 3CSTA 3NVYA 3BDCA 1UEBA 4DHJB 3HOXB 2QF7A 2XRQD 2A8VA 5D3DA 1VQ7A 3KLSX 3PRPB 1SF0A 3M3JA 4L8JA 2NTSA 1SMYD 2F3IA 2NBWB 1KM7A 4CJ2C 3TP5A 4JI7L 5KHOA 1Z6HA 2PZUA 3A1QB 2AWNA 4BOZB 1Y14B 4RGTA 3RYTA 3HM6X 5EKKA 1Z7TA 1YJNA 4S0RA 3SD5A 2MJ3A 1T0YA 2RHQB 3ULLA 3DHHC 4O2DA 2MQJA 4ZRIA 1UE6A 4PG3A 2I2YA 4RCOA 1N8RC 3AU7A 2KQ7A 1FCLA 3H0GH 4KV2A 2XRSD 4LNFA 3RNFC 4RCNA 3T1YQ 3ZGZA 3F2BA 3RD4A 5IYDG 1J7BA 1IYJB 1S4ZA 4JK1C 1T6BX 2INDC 3W2DA 2QCPX 1KTKA 4IWPA 4MSQB 1B44D 2JA7G 2J53A 4N9TA 3BS1A 4RHSA 2INNE 1YVCA 4F8CB 3E0EA 3HRZC 1JORA 4IKGA 3H0GB 5CV9A 4JE3B 3NHEB 3E9HA 2UXCL 4JIOU 4HTHA 3ZNHB 2ENBA 3MP9A 1GAQB 4K6DA 1MI2A 4GKKL 2FJ2A 5H92C 5DPWA 3UDGA 1MKHA 3DWGC 1ZKHA 4MELA 5CBAE 2KMAA 5EJWA 1Q90A 2XWJB 5C0XG 4KZ0A 2BTEA 1HR0W 2IW3A 5D94A 3AI5A 4DV5L 2EYMA 3J80L 1GO3E 1VQBA 2F0KA 3A8KE 1D3ZA 2VZAA 4YSXB 2I46A 2KENA 4EQPA 2RF4A 2FBWB 2Z8LA 2KDIA 4W9DA 1G8ZD 2LUEA 4OL7A 3FRPB 2QKIC 3PRMB 1IKLA 3DHQA 1H9JA 2VQFQ 1RODA 4LFCL 3A5UA 1X3GA 3NUCA 2EYLA 3NPPA 2JSVX 1JB3A 3CRLC 4YSZB 4B95A 2KHJA 3OIPA 2JUOA 4IUMB 1S5FD 4X62L 1VJKA 3IVFA 1PZID 1CZWA 3NHHA 1FRRA 2PKOA 1XWEA 2G5DA 3BZKA 4LMQD 3KLRA 4DR3Q 2IGHA 4GLVB 3CCUA 3DVGX 3P2BA 1YX5B 5IYBH 3HOVG 5KNCA 2R92H 2W82A 1KNEA 4B0EA 4PYZA 4ULLA 4ILWA 2RCFA 1F9JA 4UHVA 4ARCA 1ILPA 2ASBA 1I4PA 3MZ5A 4OVZA 4II3B 2L76A 5D14A 3QC8B 4ITKA 2H5XA 2KTRB 2ZCCA 1HR0L 2ZJPA 2R92B 1WI0A 4DNTB 1CT1D 3C1EA 3RNUA 2YU9H 1E0BA 1BXTA 1EIGA 4AP4C 4NP5A 2QDLA 4GOCA 3CW2C 2WXJA 3V05A 3I4NB 1GC7A 3W5OA 1RLFA 1WJUA 2D5DA 4CKEA 1K3BC 5IGEA 3HOUG 2KC2A 3VQIA 3EC8A 3PGZA 1WTHA 1C48A 2WU5B 2YU9B 1E7VA 2JA8H 4DR6Q 2QIEB 1Z5SB 4JL9A 5IN7A 3CAMA 1PH9A 2N1WA 1SXTA 3U50C 2PQAB 3WOFA 2BQQA 2R93H 1CMXB 2LFNA 2A69C 4G4KA 2JZ3B 3PHWB 1IKMA 3A4SC 2EDGA 3H7PB 4M00A 5BN4A 4HN7A 1YQBA 4BBNC 1OXTA 2K32A 3DEOA 4ZCKA 1CM9A 2Q2TA 4L23A 2JA8B 4C80A 3S24A 4YHHL 1HE8A 3EJIA 1JRPA 1BCPF 1VCBA 3RR5A 4A4IA 3VR6A 1ZXIA 3PPAA 2VY3A 1HTLD 4Y7NH 3STBC 3I55A 2R93B 2BH2A 3IT4B 3MJWA 4DV6Q 4C3HH 4FXGC 3NS1A 2DNFA 4LNNA 3H91A 4DV1Q 3ZJVA 4IQZA 1NMFA 4RHRA 1YQ3B 3I90A 3JSVB 1KF6B 3K0YA 3F1ZA 1XLNA 3HK0A 5M3MG 2NCNA 3VUWA 3V2TA 2QC8A 4CKCA 2VW9A 4JI4Q 5LL6S 3AE2B 5JOBA 2OXPA 2VL6A 4Y7NB 3R7QA 4KY5A 3I8ZA 3Q3MC 4K7UA 5EE1A 3J81c 3T8MA 4R4TA 3WWVA 4C3HB 4Q2JA 3KUZA 5J3BA 2ONQA 2Z6BA 1WFYA 4RGNA 2NWGA 4S3SA 3IFWB 1SLJA 2F0VA 3H3VH 2BWFA 1TKYA 4G11A 4KGTA 1FEHA 3FC4A 1C4QA 2KWVB 3W5UB 3I4LA 1XMOQ 2BKFA 2KD0A 1EYGA 1HNWQ 3CD6A 3TP8A 1UH6A 1QUQA 2KFKB 2AEHA 2GBMA 2JY6A 3TSSA 3RZOH 3PF4A 4IFDJ 2PNRC 1TIFA 1GOZA 3IFDA 2F0UA 2C7MB 1XCTL 2WS3B 4DHZE 3GD7A 3EECA 1G291 4ODGA 1JWAD 1XTDA 3WAMA 4IN3A 5G55A 2MSED 2PE9A 1JOQA 2BB6A 1SSOA 4K8JA 4M1UB 3RI7C 1JOOA 2LJ5A 4IUTA 1YIWA 3JVZX 3RZOB 1PXUA 1WYGA 1S1QB 3ZLZA 3NY5A 1AEXA 2A5UA 1L0YB 2CQAA 5AUIA 1WGDA 4A3KH 1LTAD 1MFWA 2MBQA 1E8XA 2G9HD 2KKCA 4KVGB 5C4XG 2QHOA 2JXMB 1EZ8A 4LTUA 2D62A 1PFDA 2GOWA 3X23A 2LJIA 4OZCA 1V1QA 5E4XA 1WMHB 1IBLL 5GAEC 3CCLA 4W9GA 2EJGC 5IAAC 2LS01 2ALYB 1N33L 4HROA 2JN4A 1QKZA 1WCMH 4GB9A 1PZJD 2NVYH 3I91A 4W9JA 1B8AA 2KCMA 4A3KB 5BYRA 4B9KA 3DLLA 3DBLI 1PTOH 2A69D 4J1MA 3P1MA 4GZYC 2GI9A 3A8JE 1R9TH 4P1CC 2K5QA 4IG7B 4U673 3C8YA 5IP7H 1BCPD 1UWXA 1HFNA 2NVYB 3ZDMC 4A3IG 1XX8A 1C4CA 1I4XA 1NDDA 3FVQA 3S9WA 2BS3B 3TQYA 5L95C 4W9CA 1PTOB 3STBD 4QB4A 2QW7A 2OF1A 1MVKA 2MO1A 2FCSA 2EMTA 4DK3C 1CSQA 3W1GA 3MEFA 1QB5D 2C60A 3VUXA 2KMMA 1YNJC 2MW5A 1R9TB 1UBQA 3TEYA 1PLFA 4OZBA 3ER0A 1ZEQX 3A1QA 2R3ZA 2MBEA 4JC0A 3D4DA 4HRSA 3C2PA 5EKLA 3CC4A 4XX5A 2PQEA 2PW5A 5T8IA 1K53A 5D65A 2XN9C 2WNMA 1HZBA 5EQ0A 3Q24A 1AWDA 3NOBA 4X65Q 4C3JB 1OGWA 2ZVOA 3MC8A 3UDIA 3DHIC 4P16A 2ZTCA 2GBKA 3W5VB 2Y0SB 2UUAL 3UI2A 3APCA 5JHBA 4NZLB 2L5TA 4OIJA 2DENB 3DOWA 3UQBA 2EY2A 4M02A 4ZKCB 3UF8A 1FJGQ 2E2HH 3AB5A 5LNK1 5D2MB 5C0XI 3TRZA 4JI2L 1QNKA 4BA2I 1HZAA 1Q82C 1VQOA 5JEAG 4MDKE 3ITPA 5LMNW 1KIXA 4H7BA 1OXUA 3L2PA 2F0NA 4MJSB 4KKSA 3WIMA 2DNCA 4WJNA 3AFPA 1OQYA 2K01A 3WALA 4TKOB 1JWBD 1Y1VG 2MPMA 5CC4A 2E2HB 2NN6H 1TKGA 1JMLA 2WX0A 4LDTB 4J15A 2RSNA 1DM0B 3IRBA 1WTRA 1L0WA 4IUUA 2F3VA 4A3PA 4A3EG 5TSSA 3SHLA 1VF5C 2M0XA 4PMCA 4CGYB 5JAVA 4HIDA 2KVMA 3TL5A 5FJ8H 1Q1BA 4EX5A 1QOFA 2PIAA 4X3TA 1IBML 2KWDA 3UINB 5BMIA 2DY7A 1YJWA 2O5JC 2H4OA 1X9NA 2LEKA 2M56B 3WA0A 4DGZA 2BA0A 2D2CC 2V1YA 1HNXL 3DBHI 5A2QE 3NZUA 3Q3OC 1DOYA 1BT0A 4XIGS 1BBXC 4JGHB 1EWHA 4OHJA 3TDQA 2XVSA 3T1HQ 3AMZA 5I9OA 3A33B 4KD4A 4BKTA 1OTRB 1L6VA 3OAWA 1GB4A 2DLBA 1VQHA 1A2UA 4B6WA 3TMEA 1SNMA 4GOPC 5LMNL 4L5RC 4RM9A 5IYCH 3IKJA 3SR6A 1L1OC 4EQNA 3PLVA 2B2YA 2KTRA 2HQLA 2WKCA 1VQMA 3TS0A 1FNWA 1D5XC 2HCIA 3RZDH 2KDMA 2HE7A 2J7QB 2A19A 5FOBB 1N32L 1VCIA 1QF6A 2SDFA 2EOTA 2EXDA 4LF8L 2D0PA 2IX3A 3BDLA 1WJJA 4K0KQ 4LFAL 3HOYH 2CS4A 3D4RA 3S16B 1FPYA 1GD7A 3MFGA 2G1EA 3RZDB 3U9OA 1MD2D 1D1KA 1JJGA 3QG1A 4YY3L 3ZRFA 1I35A 1IYVA 1ZPSA 5JPMC 3S1MH 2QDBA 3HOYB 1XTCD 4CKBA 5C2TB 3C0RB 3NVWA 1RWSA 2AHOB 4U68A 4CJ1B 4JWUC 2KO3A 1PH3A 1MHHE 4K3BA 5BYQA 4CHKA 1ACCA 1UGJA 1VMPA 2MBHA 2B63H 4GN1A 3S1MB 1V80A 3NXWA 4ZOHC 5IKCM 4B0MA 2C5CA 3G4SA 2OCEA 1VRAB 2KLCA 4ZRQA 4JX1C 1GVPA 5DPSA 3GE8C 4OELB 3GZNB 2AWTA 3AE8B 1NUCA 2AUKA 4DAPA 3JSVA 1JROA 3NRZA 4ARIA 2IO3B 3P7JA 2IZVB 2IY1B 2R7FA 2O5IC 2ZCBA 3QJZA 5C0XJ 3A55A 3FILB 1SE3A 3HOXG 4OVUA 3L9AX 1WZ0A 1O78A 1EQVA 1A63A 1WOCA 5HGQA 1UAPA 4A3BH 3SK4A 2OT2A 2ZNVC 1O7ZA 2K7VA 1D5ZC 4AYBE 5BR8L 4HSPA 3H15A 1N60A 1YOVB 2Z9HA 2LMCB 3H3VC 2BBCA 4DR7L 3CF6E 3ZNZB 4C56C 1MI0A 2W3RA 1LTTD 5KEEA 1I50H 3CMAA 4N8X1 1I4HA 2KN4A 4ZUJA 4ZYNA 3GO5A 2L1BA 4MNOA 3EN2A 3C3LA 2N3SA 3JAMc 1QOBA 2GVBA 4R8IA 4JI5Q 4PNYA 2BF8B 3KVFB 1I50B 3L54A 2AUJD 4RNAA 2ZXOA 3A9KB 2HJ8A 4PZ7A 4EKUA 2HHHL 2WX1A 3GDEA 4OW0A 4P75A 1N5WA 3GTQH 1IHZA 3DWQA 1UD7A 4MGYE 1YMHE 4LF9L 2WXMA 3PSEB 4PT5A 3H0GG 2IBIB 1WR6E 1G2TA 1V8CA 2K05A 4R3DA 4DR4L 4DWFA 2OTLA 4JV5L 3GTQB 2LKVA 4H0LC 5HGTA 1IBKL 4HIMA 1DD2A 1XNRL 1C76A 2LVQA 3NENA 4B3TQ 1SMXA 2B29A 2DUDA 1STEA 4DV4Q 4JYAL 2GBRA 3J7ZC 3J7YW 2BVCA 3KW5B 1PTOF 3AE1B 4NAMA 1MJDA 3PLUA 5LXIB 1VQCA 1R4MI 5IT9L 2KNBA 3FKYA 2E5LL 4KN7C 2WXNA 4DXAB 4HPPA 4PYUA 3TZDA 4GDLB 2Z6KC 4AH6A 5C3XA 1GB1A 4JI6Q 1J9OA 2HUGA 4JI3L 3MVVA 3NZSA 1STGA 3PO0A 2E2IH 1C0AA 2KN5A 2LZ6A 1JW9D 2CHBD 1YJ1A 2HD3A 1V97A 3S2AA 3ZJTA 3GTOB 4RKLA 2JT4B 1V9PA 3J81i 3SK6A 1HNZL 1WXVA 4TUUA 1SROA 1A8VA 1Z9FA 1TWFH 3B08A 1IBXA 5C6AA 2KDFB 3C1FA 2MWSB 1EF5A 3LNNA 3HVZA 2JZPA 3UIOB 2OWOA 2N9PC 3C19A 3K57A 1EOVA 2E2IB 4FN2A 2D5GA 1WJ4A 5C3WA 1X56A 4A3CH 1KAWA 4FHKA 5J2RA 2A1AA 2OQ0A 4B3MQ 2RSUA 4JLCA 4DNIA 2CH4A 2JYTA 2N55A 3I3TB 3NUHB 4YTMB 5IYBG 1TWFB 1UELA 3OJ3A 2R92G 3Q69A 1VQFA 4RH6A 1A2TA 3VR5A 2KHWB 4DR5L 2VB3X 4KJOA 3ERSX 4RGOS 3SGIA 1WTQA 1SFOH 4JBMA 4X6AH 1IUEA 1N63A 1WIAA 3AXCA 2R7ZH 1HJPA 1O80A 5KIXA 1TKEA 2KVRA 2KZRA 1DYQA 2D2QA 2WP9B 5EE3A 3Q6SA 2UUCQ 3IG3A 3I4NG 5CGKA 2L00B 3AM9A 3DPDA 3M62B 2KVZA 1F9PA 2J52A 2UXBQ 2CR5A 2CKHB 2I1KA 3VH3B 1P7EA 1M94A 3T3NA 2DY8A 4KIKB 1SFOB 2J0TD 4MJSA 2V4IB 3MXPA 2R7ZB 1AYFA 2RR9A 3MTNB 3OIQA 4LF7Q 2MP2B 4LUVA 1P3QU 3EVQA 3ERQA 2Z4HA 4R4OA 5CV7A 5FO8B 3FMCA 2EYPA 4WJ4A 3BY4B 3BU2A 5FK9C 2DJGC 4JI0Q 2ID0A 5HHDG 1MPEA 2NVQH 3ML9A 1BMLC 2A6HC 2WACA 4QF4A 4X66Q 2JA8G 2KK8A 1IP9A 2N9XA 3NEMA 4B3SL 2KC1A 4OWXB 1EY6A 2FUG1 1Q0WB 1L0VB 1PFSA 1ZDXA 2FIFA 2R93G 1KNAA 1XJVA 2FE8A 2LGYA 1I94Q 4Z9CB 1PTOD 1T0QC 1VZ6A 3IT6B 2NVQB 1WGHA 3J81E 1ZDVA 3GOEA 2WXOA 4KHPQ 2DJFC 5EPJA 3VTWA 4DV2Q 3H6MA 4DR1L 1F52A 3H9DA 1QVCA 2O4XA 1E3PA 4FF4A 2LVOA 4X3UA 3URYA 3TS2A 4XYOA 1VR9A 2K8BA 3KUCB 1UWVA 4NJ7A 1F2RI 4C3HG 4WWPA 1N36Q 3CXCA 1PH4A 2KA7A 1VQNA 2B2TA 4QUCA 4AIMA 2XEWA 3AEFB 4KK7A 3SEBA 1WYDA 2E2JH 1HA6A 1PA6A 1E6EB 3DCGA 2B76B 1XXGA 4K6LA 3DDCB 3ECIA 3E0JA 1GG3A 3QHTA 3NTKA 4RM8A 4UAIA 5CYUA 1KLGD 4M0WA 4LF6Q 2EY1A 1ASYA 3NQTA 4ZRZA 1RTOA 2PMZE 3A74A 5E7NA 4XDDA 2XBBC 3RULA 2QMTA 4DQOC 3DWMA 2E2JB 4AQYQ 3SHQA 4GU2A 1G91A 4PQXA 2JXXA 3AH7A 3T1YL 3HUIA 4DBGA 4A3JH 3K9PB 3CKIB 1TT5B 1L2NA 1HTPA 3N52A 2RVLA 2BS2B 1YIJA 1JE4A 1LTRD 1OXXK 3RNAC 3CCEA 4F87A 1PH5A 4BBSH 1K8GA 1M1KC 5CHFA 4K5XA 4ZHPA 1YITA 1TQOA 2R61A 2LHDA 3OLMD 2RDBC 3NTIA 2KQSA 3NG0A 3TIXA 2L32A 4LDTD 3NZ3A 2E2DC 4A3JB 1VLBA 3JYUA 4LK0M 2CKZB 3L3OC 4N58A 2WXHA 2L8JA 3RNGC 1L4ZB 4P72A 4IWOA 1KLVA 3H6NA 3KF6A 3E9SA 4BBSB 2BW2A 2MA9B 3B6YA 4JI1Q 3R93A 1X3EA 3U9SA 4YT0B 2MJ8A 3J80i 2L05A 2KEDA 5IP9H 2JYEA 2WXKA 5H8YE 5C4JH 1ZXHA 1WY8A 1HZ6A 4B08A 3SDZA 4A3KG 3MHZA 2R2OA 2SNMA 5C3EH 3CCQA 1BO0A 2NPTA 2VQFL 5JEAJ 5LMUQ 1CJEA 2PVGC 3A9JB 4RF1A 1PQSA 2EVBA 2LGDA 1K51A 5IOIA 2DZIA 2KJXA 2PYKA 3NWSA 3NELA 3VYRA 3FEWX 1CZPA 1NEKB 2A6HD 1EWYC 3ABVB 3B0AA 4JQWC 3CF5A 3QK0A 3T3OA 3PHXB 1WCMG 2MUYA 4KJNA 1RL2A 5HY6A 3QB3A 1L4DB 3FILA 3TZUA 5C4JB 5GROA 1VDZA 2ICEC 5C3EB 1SDFA 2VXWA 4DR3L 1CSPA 2LUMA 1PHJA 4FXKC 4L6TB 3TEXA 2Z1CA 3T56B 5IP7G 1STNA 4QIWE 2SEBD 4EZJA 4DNRB 2PLPA 2UUBQ 2CW0C 3H94A 4K14A 2LHEA 3R3MA 4AS1A 2WXPA 3EGRA 3M7NA 5L83A 4DN4M 2KT7A 1AW7A 1CZGA 1UBIA 4PZ8A 4A75A 3OSOA 2WXQA 2B2VC 4QUFA 4C3JG 3A4RA 2KANA 3S14H 4NXNQ 2CU3A 1SAPA 5CV5A 3A9KA 4GN5A 3TP7A 2Y0SG 3FAHA 1E8WA 4YCWA 2I0QA 3VR8B 3EHVA 2IO1B 4IM3A 2ZTDA 4FVMA 3HKZG 1F9RA 2NYZD 4KY7A 1N6ZA 4TSSA 2RMMA 1IYUA 3VTUA 3X0WA 4P71A 3S14B 5D3IB 4PS8A 5K36H 2MBOA 4HKZE 1K8OA 4IFDI 5JJKA 1C4PA 5EBCA 1RF2D 5JJZA 2LD9A 1PYSB 3AEAB 2RDHA 3J80E 1HHVA 2J42A 1P98A 3AULA 4F8MA 4C1NI 3PIP3 4IOAA 4OONA 4H02A 4BKSD 3TN2A 4GDKB 2IWHA 3VXWA 3JW0X 4FYDA 3DMUA 3I2ZA 1BBUA 1EWIA 3DHGC 2MQHA 3K7AH 4TRDA 3J7A5 2KWCA 4P7IA 1Q46A 1C1YB 1VQ8A 5JXVA 2YTYA 2PZTA 4KKJA 4HCEA 1XEEA 4ZAIA 3PZ7A 3RLFA 2O6VB 5KRUA 4US9A 1CUKA 5EGTA 5CR3A 2N0SB 4FA6A 3TEWA 1RFKA 2MX2A 2ZVNA 5I2XA 4B9WA 5KNBA 2D0OA 1A3TA 1QLBB 4KDIC 5IP4D 2SNSA 4DV6L 4GNXC 1PH6A 1EY4A 3PZ8A 1DOLA 3PO2H 4DV1L 4HMJA 2GB1A 1Q12A 3K7AB 2PVOD 3K80C 4BA1I 3NVZA 1XPOA 1XMQQ 3V96A 3Q8FA 1A62A 1GJZA 1HZ5A 4X64Q 1H8CA 5FJ8G 2N7EA 2A68C 1JWSD 4JI4L 1A6XA 4DUYQ 1KC8C 1TBEA 3N9YC 3I4OA 3TMPB 3VR9B 4N9PA 4EVOA 1SNQA 2E74C 1AFPA 1TS5A 3I72A 2EELA 2L4NA 2MHVA 4FF1A 5GXGB 3PO2B 2K9XA 3P20A 1MSHA 4JOIC 4GOPB 5DCNA 3PRZA 4TQ0A 2GVAA 4A3FH 3SK8A 1WF9A 2CWPA 5LLIA 2L12A 1GUWA 1L1OB 1S5DD 4EGVA 1H95A 1QQRA 1XMOL 3PGEA 3U4VA 2KDBA 3JAMi 1HNWL 3KOJA 3ZJUA 5G5HA 1EZ6A 5GAHC 1L7YA 1SIFA 3DM3A 1V5OA 5JH5C 5HI1A 4E71A 1A5RA 2IGDA 3PS6A 2WAQB 1Z2MA 1K0RA 4A3MH 4A3FB 5IYCG 1F0ZA 2KYWA 3X3MA 2C9WB 2AL6A 4K3CA 2X6GA 1QT9A 5LXHA 4GLAC 1NSNS 2KHIA 1EU3A 2V4DA 3NBIA 1E8ZA 3B9JA 4BBNF 5DM63 1GHKA 5AJ3Q 4KIKA 1VS0A 1YJJA 1KDBA 1JR0D 1EIHA 1FR3A 4DAYB 2QCZA 1STAA 4NDXA 3S1RH 1DOIA 4A3MB 1X55A 2KQ3A 3IXSA 2FIDA 3U4EG 3K8AA 3RFZB 1WGYA 4I65A 3BIID 3OG5A 3ND8A 3HOYG 3E9IA 2WP8J 2JWUA 1WVLA 1FGBD 2P5ZX 3DVNV 1SB3C 1EEFD 1MSGA 1DZ1A 1B70B 1Q8IA 1S3OA 1U9RA 1H9RA 2JVCA 2X6LA 1YNNC 1I4GA 3S1RB 1EY7A 3AE9B 1PV4A 2JA6H 1NI3A 2H88B 1WD0A 1RIPA 3AU4A 2KCCA 2F0DA 2HDMA 4O42A 4QGUA 3CHBD 1MG4A 2KWUB 1B3AA 3F2DA 3D6CA 2ES2A 2M17A 3L0WB 3MA2B 1P0RA 1XD3B 3QARA 2FFKB 4EZLA 1M4VA 3HFZB 4MTNA 1H4RA 2MFIA 3AN1A 1H9SB 2WV6D 2B63G 2B2WC 4ZUIA 2SOBA 4DAVA 4BY1H 4RA8A 1TZ1A 1BKBA 4DV3Q 2XK5B 1W6KA 3FHWA 1I42A 1M8AA 1J5EQ 3OW2A 3A8IE 2OJRA 3T51B 2ZNVB 3D0FA 3VAWA 2FCNA 1FCCC 1ZOYB 3OMCA 2PZWA 4DUZQ 2NTTA 2Q8TA 1HEZE 3JAME 1MHXA 3N3KB 1RFAA 4XWWA 2A68D 1AZPA 3H3VI 5DLQE 4BY1B 3MXNB 1E7PB 2ZEQA 4F1SA 5JJLA 3P1HA 4LWCA 4HVBA 4A3BG 1O7YA 2A74C 3OPOA 4X65L 3J81j 5G2NA 1E7UA 1N61A 2DYOA 5C3JB 3G71A 2I5LX 4JW0A 1EO6A 1GPXA 3S1NH 3DUZA 1D2BA 3KLSA 1WE6A 1K28A 2DYMA 3A54A 1FJGL 2QJLA 2AYOB 3G6JB 5I2YA 1K8MA 1EQRA 1NBWA 1SNOA 3KUPA 1CKNA 5ELCA 1L6UA 4XYCA 3S2DH 2BPSA 2K03A 1II3A 4X3KA 2F0PA 3U7ZA 3S1NB 3NBHA 4CBVA 1N34Q 2DX5B 5IWAL 3PTFC 1K8RB 5CTRC 1WCMB 1V2YA 2E3TA 1V1PB 4P73A 5FLXL 3BYYB 3AEVA 1LACA 1DOKA 4MEMA 4EOYA 1I6HH 1PGAA 3S2DB 2WXGA 1WRDB 3CPFA 1K3RA 2HJ1A 2BWES 5IOCA 1HZCA 3MC0B 3I5JC 4QJFA 3A9JA 2BYVE 1WJ6A 1ZUD2 2WLBA 1D7QA 4MZ9A 1JQ4A 4HJ8A 1TKWB 4YCUA 4LNQA 1E90A 4ANXA 1VZ8A 2MGSA 4CHTB 4YTNB 1XLQA 3Q23A 2XGTA 2LXCA 1D6EC 2K04A 4LFBQ 3N1YC 4L1BA 1EY9A 2JSOA 4LAAA 2JXTA 2EYOA 1I6HB 2JQOA 2M19A 3LJ3A 3VUYA 5M5YH 2HTME 1WTXA 2JWZA 1O7LA 2I1JA 3T1HL 1RTNA 1B1ZA 3Q14C 1NCVA 4IC7B 3I3CA 2UYZB 3RD2A 4ZRPA 2L0FA 2X8XX 4ZQ3A 5CORA 1QZHA 1GUTA 2F0QA 4K2KA 2N4FA 3ZXVA 2GA4B 1TWCH 2HCCA 3CC2A 2D3GA 4BBRH 5M5YB 2WDVB 5NUCA 3HKZB 5ELEA 2BH8A 3EBEA 2E8GA 1WTOA 4W9KA 4HJKA 4XC2A 3W1BA 4ME3A 1TZOA 5AFWA 2AQ1B 4LW1A 1UWMA 2KMCA 2NS5A 1B2TA 2Z4IA 3Q3JA 3PIPA 1PH8A 3FKIH 3U8ZA 2ZXRA 4A3LH 1TWCB 2K5DA 1J8IA 3EFXD 2KACA 3DVNU 4BBRB 4YIJA 2BGFA 1PGXA 4IUQA 5COYA 3UE0A 4A3CG 1F2LA 3M4OH 3B2FA 2TSSA 5GMVA 4C3IH 2B39A 5T1GA 2L83A 4C7ZA 4K0KL 1KJTA 3VYSA 1YHAA 3R3OA 1T0SC 2PCFB 5C5MA 3J80c 2PNHA 3DVGY 2Z0DB 1Q5WB 3FKIB 1WJNA 2C5LC 2R7ZG 2RD0A 5CV8A 1IGCA 1R4NB 2J0JA 1K8AC 4C3IB 1IW7C 1M90C 1UZXB 3Q8EA 1PYBA 4PZ6A 4W9EA 4K1RB 4IJLA 1PVOA 2K6DB 4WWNA 1VQGA 3GTMH 4CO7A 1DOXA 2K8HA 3S17H 2KJ6A 1TY2A 3QWZB 1BR9A 4J6IA 4KHVA 2ZM6Q 3HOZH 4XQJA 3J7AV 1FVIA 2UU9Q 4OO1H 5A2QL 3NP8A 4NKLA 3CCMA 1NYRA 3KDFB 4YWLA 4ZDVA 4LUOA 1A70A 3APFA 3ONSA 4DU9A 4AUQC 3GTMB 1V9JA 4W9FA 3HOWH 1SBBB 2M4NA 3ZDTA 3S17B 2F0SA 1QG7A 1YNJD 2F0IA 2KCTA 3QR8A 3OTOQ 3U2SC 4CDCC 4HAEA 4E6IA 2PJHA 3HOZB 3E56A 4CYEA 1GJXA 5E6PA 1X6OA 2LXJA 1EY0A 3HOWB 4GOPA 2UUAQ 1FRDA 2D11A 1NJIC 1DCZA 2K5HA 1SYDA 2N9LA 3H1UA 3MHSD 1L1OA 2R6GA 4REZA 1SRUA 3KF8B 3PF5A 1WFQA 1VQIA 1K52A 1V49A 1WGGA 5DEHA 4FJZA 4GLXA 2QDFA 1ZXTA 1SSNA 4ANWA 3ZYYX 2E75C 1XLOA 3E6ZX 2K0PA 1EL0A 5C4ZA 4NXMQ 2WQYB 2EZVA 4IOIE 3RNBC 3NE5B 4LJOB 4JI5L 5E6JA 1GUOA 2PQAA 4A93H 1LM8B 2ZPYA 1ROEA 1R7SA 2OEOA 3H7PA 4ME5A 2M0AA 3QWNA 3OOCA 1LM0A 4WJWA 4GN3B 1C4AA 4KGRA 1VQEA 4MH0E 1UE5A 3ZNGC 4DAYA 1JT8A 1G6ZA 4DV0Q 3AV8A 1G2SA 2BYTA 1F77A 3QO2A 2CQOA 4A93B 4DF7A 2LGSA 4K7SA 1P1AA 2RKSA 2JF5A 2L55A 3PSIA 1XQQA 1ML0D 4A3JG 2IX0A 1C3TA 3ETRA 4OWWB 1JWUD 3KQ4A 1ZP0B 4WQMA 4RKBA 4RWSC 1A15A 1OO9B 4BBSG 2Y5BB 4IM2A 4A8XC 2Q5WD 2O6VD 2VS1A 3DBSA 3GZNI 4B3TL 1QOGA 2O2VB 4Q0FA 4A3DH 4Y52H 4DV4L 2B63B 1SNDA 3VR4A 3I4MH 1WXSA 4EEWA 5J39A 1VDVA 1QJOA 4HIKA 2JRHA 3R7RA 2K5VA 4E74A 1N62A 1FIQA 2RHSB 2WHIA 4AOFA 3NVVA 2EPBA 3ZIMA 1IYFA 4GS3A 1X3QA 2M00A 2ZJDA 3VH4B 1JB7A 4YWKA 1WI5A 2VH1A 1ESRA 3VYUA 3BVGA 4P74A 5IP9G 4A3DB 2G3QB 1H9SA 2WDRB 2V3SA 4FXDA 1UF0A 1Q3LA 4JI6L 1JCKB 3I4MB 2KFKA 1Y8NB 1FD7D 2KX0A 2LVPA 5C3EG 1FL0A 4A3BB 1B50A 1IZ6A 1EYDA 3CRKC 4OXPA 3SE0A 4KDLB 3SVMA 2NMQA 5G3LF 4P2CB 2HT1A 4R1JA 2JRIB 4KSLC 4FADA 5J17A 1E1OA 4B9XA 2M9VA 1WX7A 2IDYA 2CHXA 3PZDA 4ZRKA 3UDXA 2IY0B 4GLSC 3V6CB 3RNEC 2LWPA 5FLMH 3KJPA 4RF0A 3N30A 4KMUC 4MM3B 2UXDQ 1A0IA 1C8CA 4B3ML 1X1MA 4HK2A 4JBJA 4GN4B 2K5NA 1BQQT 4D2KA 2J7ZA 3TEZA 4HIOA 1JALA 4S17A 2CVRA 3RN2A 3DBRB 2V0GA 3KLWA 1NBFC 2L52A 2Z0SA 4POFA 3W1YA 2KJRA 1WMHA 3U7DA 3E5SA 1TJEA 4YCVA 2UUCL 1D5MC 4E3CA 5K5PA 3P4RB 3QQ8B 1STBA 3M95A 1GC6A 1QE6A 1E1TA 2VUMH 2EKEC 1JICA 4ZRJA 2IL8A 4BFRA 3TREA 3IAS1 4FJYA 4K5VA 5JVH3 3UGBB 1YNXA 1OXSC 1YHBA 3BYTB 3O13A 2C35B 4OEMB 1BVSA 1ZYRC 2JA5H 4DKAC 4LF7L 5HKHA 5JZEB 3WDNA 3BWUD 1XLPA 2UU7A 4BZAA 1K73C 1BBWA 3UIPB 3KBGA 1XYIA 2VUMB 1KRHA 1AZQA 2QEJC 3T13A 1L5PA 4JI0L 1WTPA 2YVCA 2HDEA 2GN5A 5K36G 1X54A 4TQ1A 1WXAA 4X66L 3VA5A 1PFBA 4V190 1HTQA 4XQNA 2JA5B 1VZ7A 1SIJA 4H13C 2NBUA 1OEYJ 1G51A 2F0OA 2BT6A 5BR8Q 1VQ6A 4A6QA 2EY6A 4DDID 1UEAB 2Y5CA 3X3NA 2Z6KA 1HUNA 4GNXB 3WCQA 1NMGA 3MWYW 3AECB 4NAWB 5CV4A 1JWMD 1KOTA 5AUKA 4KKTA 5DM73 4KHPL 4L63B 4DV2L 2KBNA 4CJ0B 1E2ZA 2QA4A 1SJED 1C7YA 1U4AA 3C46A 3VR2A 3ZKJC 3KH0A 3M9BA 1TU2B 2HIVA 3RZWC 4HMIA 4WAFA 1N36L 2FMMA 4A76A 3PO2G 3RMHA 5EE9A 4JVZA 1K83H 1ZKOA 2QEXA 1VQLA 5G3LD 2HHHQ 4P1BC 2QGQA 4FF3A 3V3XA 2B2UA 4KGSA 4DK5A 1SNPA 1E22A 2G9DA 3KWLA 4LF6L 3PUXA 2K28A 2Y0SE 2WXRA 3OWFA 3QIAA 4NPSA 3G6EA 4N59A 1JC7A 1TTNA 1HQRD 2OEDA 3K7UC 2WAQG 1E5WA 4AQYL 2ZPNA 3HKZE 4A3FG 1YEZA 2BYFA 3HHMA 3PUVA 1XNRQ 4C1NK 1SYGA 1RHPA 3L7ZC 1DGJA 4M8AA 2LRUA 2ZZPB 1U4LA 2LY7A 2OQKA 1GHJA 3IAYA 4F7ZA 4CDDC 3IAM1 3Q8DA 1DJRD 2ATWA 3E3XA 4A3MG 3K9OB 3GQBA 2A73B 3IL8A 5GADC 3VYTA 3M85A 4K8IA 2VRRB 2RGFA 3KYCD 1XT9B 2IT1A 2GBNA 3VTVA 2F0GA 5M5WH 4AQ7A 4WORA 5BMGA 3RN9C 3AYHB 4JI1L 2V1CC 1P9DU 1P8LA 3SDLC 4NQLB 4YTPB 1L0XB 2F0FA 3I7FA 1ZYRD 2FMCA 4IOCA 1VQPA 1S72A 5AZGA 1WXQA 2QSDA 3J81L 1KLUD 2I5HA 1FXIA 1CKMA 5C5LA 2L3ZA 2AKWB 3I73A 5LMUL 2K50A 1W2BA 2NVXH 3PO3H 3L17A 4KKIA 3P4PB 4NW2A 5KGUA 4EE2A 2EQSA 3PQIA 2D10A 3I9V1 3ONAB 1J19A 2MJDA 2RPQA 1MJCA 2Q2HA 1C77A 3AQQA 4DHZB 3DEPA 4IALA 3Q8BA 2JA6G 3S2HH 4HPLB 4ICVA 1B7YB 4BY7H 3F8TA 4OX9Q 1VQJA 4FP5D 2CHZA 4PMBA 3PO3B 2NVXB 1QUQB 2TMPA 2F0HA 3CCVA 3D3RA 3BINA 2NZHA 1ZE3D 5M5XH 1G6PA 4UPAA 2UUBL 3BK1A 1E8YA 3OJ4B 5IGFA 1TWHH 1PRTB 1B3QA 2WB1G 1E2VA 3ULPA 1LUZA 4BY1G 1OEYA 4G7ZC 2XWBB 3RLNA 4BY7B 3N32A 1RD9D 1ENAA 4JPSA 1HQMC 1DGSA 1VQDA 1TS4A 2XSCA 2GMIC 5IIFA 3NSWA 4K5WA 4NXNL 2AWOA 3AB9A 5M5XB 1FFVA 1HTOA 5LHY1 1X32A 2XTIA 4DV7Q 1TWHB 4LF5Q 1YX6B 2KEEA 3Q0AA 3HZXA 1OQRA 1EF1A 5HURA 2VNUD 3K0XA 1MJEA 3KWVA 4BKSA 2K25A 1LLRD 1NR4A 4B3RQ 2F52A 4LNKA 4LF4Q 3RZFA 3W1SA 1F1HA 3L13A 2AX5A 3OMGA 4B3SQ 4I6NB 2Y3AA 4I7ZC 4J8QA 1E2WA 2ZXPA 2Q8RE 1KH0A 1LTBD 2EJFC 2HD5B 3M63B 3RNCC 1QOHA 4HSVA 3RPFC 4WURA 1HFGA 4KSKC 1AN8A 1D1IA 1VQAA 4I7AA 2MO0A 4M01A 3MFYA 1VD2A 3MTSA 2N7JA 2N7DA 1B4OA 2NBFA 3LDZE 3Q3FA 5IODA 4L5QA 2IHFA 4JI8Q 4DR2Q 1ASZA 2N88A 3M7GA 1N5XA 2VQEQ 1QZGA 5M9OA 3BZCA 4F88A 1P7FA 1QNUA 2L0CA 2LMCA 4MHEA 3SFEB 1WTWA 2QILA 2RPVA 3CIRB 4HXDA 1I4QA 1N9WA 4IWQA 3M3YH 1JJCB 3VDZA 1RJTA 4JBKA 1K9MC 1IPGA 4PS3A 3P75A 2G4SA 1HRJA 2ZW0A 3UDFA 4WIPA 1E0ZA 5IGBA 2F4VQ 4TMAB 1PH1A 2NVTH 1XMQL 1AP0A 2REXA 1LXDA 1SN8A 1U0LA 4X64L 3FPUB 4DUYL 3M3YB 1RM6C 2PPHA 3P63A 3J7AF 2FNJB 3ML8A 2JJQA 4G0NB 3P42A 1SE4A 3A0JA 3I56A 4ABNA 1CFMA 2IJ0A 2NUCA 2NVTB 4TVAB 4MM3A 3CU7A 4NB3A 3KK7A 4HCSA 2R7DA 1SYBA 2IYDB 1S5ED 4GKJQ 4RG1A 1IGDA 2B2VA 5AZFA 1YN4A 3PV0A 3ENEA 2KOLA 3NK9A 4G57A 1TS3A 5GQOA 5C4HA 4IUPA 3ALBA 3GTPH 3A7LA 1Y1WH 1YJ9A 1XNQQ 4DR6L 4IFDH 3D31A 4HKQA 2DZKA 3RMKC 1O7IA 2INPE 4BBRG 2JYOA 3IHPC 3W9CB 2A5HA 1GXDC 4GXBA 2EYHA 2JP1A 1GM5A 1A3UA 2F1MA 2K4KA 5M3FH 2IX1A 4WJQA 1S5BD 3VA7A 1FXAA 2EYJA 1QZEA 2DBYA 2F0WA 4IW0A 2VZKB 1KDAA 4BAXA 1WSPA 4HEA1 4XGAB 1KL9A 1E7ZA 2LXKA 5AJ3L 1Y1WB 3GTPB 3FKIG 4DAMA 1QILA 2EYFA 4A3LG 1JE5A 2KDEB 2N78A 4PMWA 2H1EA 1FGUA 1BDOA 2NN6G 3ICEA 5M3FB 1CA5A 4WH4A 4C3IG 5IT9c 1Y8OB 4GDLA 2HDLA 3PIO3 4JI7Q 1WYWB 1KAAA 4KY6A 1NENB 1EEID 1OXVA 2F4IA 2WXIA 2IPKD 4AWJA 1SE8A 2MNAA 1I7HA 3TUOA 5F2DA 4Q5VA 3Q8AA 3ULJA 4LUZA 4MGIE 1FD6A 2K14A 3GTKH 2PW7A 5C23A 4BVUC 1PMRA 4FDBA 4WJ3M 1ICWA 4GNXA 3K6OA 3F2UA 3BVZA 4A3GH 1LTSD 4NAWA 1TS2A 2W3SA 1LABA 4QAYA 4IJHA 1VQ5A 4YXDB 3QOJA 4BXXH 1UE7A 3SXHA 3AE5B 2F0MA 4R9WA 4DK0A 3GTKB 3HOZG 3G48A 3WANA 3I4NH 4A3OA 2BOSA 2CW0D 4IUVA 1NR2A 4DV3L 4OO1G 2Z59B 4M8NA 2UXCQ 1SNCA 2C9OA 4W9IA 2ZTEA 4A3GB 2I38A 4C4VB 5C44H 1J5EL 4GKKQ 3HOWG 4JOIA 5DPTA 3VRAB 1ESFA 3OHXC 1NVID 1SYEA 4BWGB 1CQFA 2XNAC 4DUZL 2SAKA 2V3NA 3ZTDA 1EY8A 3GTGH 4HJ9A 1J7CA 3K5LA 1NE3A 3T53B 2BKRB 4DV5Q 1LYLA 2L11A 4L5SA 2JPHA 2CJOA 1UNSA 1AE3A 4MTKA 5C44B 2KJHB 2KQ4X 2MP2A 3CCSA 1C9OA 1KRTA 3TBIB 3Q6BA 1T5EA 4CDFC 4LFCQ 2UWQA 4HR7B 1BNZA 5IGGA 2GRIA 1UUPA 2JE6I 3AE3B 1HCZA 3GTGB 3PV1A 1V5TA 1WD1A 4X62Q 1EFID 4LLGM 3EUB2 4TV3A 3M4QA 2AL3A 4EQOA 2K3UA 2Q2IA 1ET6A 1R4QB 2LRWA 4HCNB 5JPNC 2K5PA 1BCPC 2WKDA 1F2MA 4XTCS 4A93G 4POGA 1WGKA 2AQ2B 1IXRA 1VF7A 3Q2AC 3KYHC 5HFYA 3OYYA 3NS8A 2FAZA 4ALPA 2N1VA 3NTHA 4A90A 4KX6B 2HQEA 2MP1A 1N34L 4DXFA 5KHQA 4L2YA 3AU5A 2RA4A 4AYBB 4APVA 4W9HA 2JA6B 2X69A 1CA6A 2MHJA 1HH2P 4KV6A 3L16A 1TGZB 1RDPD 1YZ6A 2F3WA 1ILQA 1Q1EA 1HR0Q 1F2RC 1YJIA 2DZJA 3ZRCA 2WXLA 4HJ7A 4A55A 1HA5A 3O65B 4IURA 4WWMA 1LT3D 3PCOB 4JBWA 5IGCA 3GE3C 3HKSA 2WU2B 3D8GA 1PH7A 2WXFA 2J4XA 2HIXA 2JU6X 5BO4B 1PRTC 4A3DG 1T0RC 2WWZA 1Q86C 4LFBL 3TJPA 2WB1B 1T5XD 1XPUA 1PRTF 3I4MG 2B2WA 4JG2A 2G45B 2LXAA 2ACZB 1BOSA 3HP3A 4R4IA 4NJ6A 1HPCA 1V1OA 4EQ5A 4FXCA 3RN5A 3JAML 1WM3A 4MSMB 5J22A 4MIUA 4DA2A 4ZLTF 4CQNA 3GV6A 1V6EA 4HWIB 4KD3A 4WWOA 3HG9A 4FJVB 4ANVA 2KX3A 4H44C 4MT5A 1DXMA 3D32A 3L10B 2WFWA 3HEJA 5EE0A 5KNDA 4HCPB 1I6VC 2I5MX 3MXGA 1MBYA 2NVUI 2MH7A 1OFFA 1FXTB 1LTGD 3S15H 4UY8C 4YHHQ 1LT5D 3EFUA 3AEBB 2K5WA 2JEAI 1K0SA 4QY7A 3K59A 1WWTA 1S5CD 4M8MA 1EYAA 2K1BA 1GUAB 3S1QH 4ZHOA 1CHPD 2YTVA 2LSSA 3R2IA 1EIFA 5FLMG 2X38A 4NPNA 3EQLC 2JEBI 2CCZA 3N1ZC 4GSWA 1ISNA 2L0TA 2JX5A 3AMUA 3S15B 3AE6B 1E10A 3G7LA 3SR1A 1HUMA 3RCZA 2BE5C 1YQ4B 2K33A 1WRIA 3AEEB 1V8QA 5CMDA 3DBLB 3SFDB 3A5ZB 3S1QB 5E1FA 3CMEA 1IL2A 2RBMA 1NYQA 2D3AA 3GS2A 5CHVC 3U30A 1EUJA 2IGGA 1EUVB 5FLXE 1J0GA 3HGBA 2WIIB 2FCMA 2EMSA 2OHFA 1YNND 3EIVA 2WINB 5ELNA 4YWMA 1FFUA 2VUMG 3ZTCA 4ACFA 1U4RA 2ZJRA 2D3BA 3V62A 1OTCA 1KDCA 2RDFA 4V0BA 4NMZA 1FNUA 2F0LA 3BZDB 2JZZA 4GIVA 5IYDH 1ICFB 3HVDA 5IY0A 4IPDA 2DHZA 5IO9A 4A9AA 2AQ3B 2JA7H 2INCC 1CI3M 2JA5G 3UE1A 1UGMA 2ZM6L 4NJCA 2ZT9C 2UU9L 3DWPA 4C3JH 1IBXB 2W54A 3CCRA 4P6VF 2IHEA 3ZUNA 4KLKA 3W3AA 3SU8X 2PE6B 2R2QA 2Z0EB 5E6OA 3TEHB 1KRSA 3OTOL 2W55A 5C0XH 2F0EA 3D4WA 2JA7B 2K1FA 2WYQA 5I4DA 3PUWA 1H9KA 1PRTD 1V43A 3PVLA 1CHQD 3VRBB 3APDA 2LASA 4LK1C 2D9UA 5H1SE 2PTLA 1IBLQ 4N6EB 1SYCA 4BOSC 2ASQA 2OOBB 1SYFA 1N33Q 3QCAA 5E6NA 2EY5A 2DNEA 2M2LA 3FPPA 4OWTB 1Q10A 3QOLA 3I57A 1C9FA 5ELOA 1RCVD 1TR5A 2J0KA 3PIOA 4NXML 3NJTA 3M4OB 3VR3A 1YN3A 2DAJA 3ZO5B 1RYJA 4GDKA 2IO2B 1R4NI 3IFTA 2Y5PA 2NN6I 5IWAQ 3HOVH 3B1LX 4AJYB 2NB0A 1GUNA 4R8NA 1UE1A 5I9PA 2MBBB 3VVWB 3WAPA 2LGIA 1MHWC 1GNUA 2YEPB 4OGQC 1D8LA 2LFIA 4F7XA 2BDNA 2O6VA 4DDGD 2MRPA 1PH2A 4DV0L 3NQIA 3FDTA 2MEKA 2W9NA 4DK1A 3K5NA 2BS4B 2MJEA 3BJUA 4KZCA 1U4PA 4XDXA 4DPGA 3HOVB 1W6JA 4USAA 5ISRA 1FNVA 2GLSA 2BE5D 3VDYA 3MAQA 1LTID 3DBHB 4DHJD 2KUMA 5CX3A 4FO2A 3AEGB 3H8HA 1U4MA 1AARA 1ET9A 1PGBA 4HLEA 2EIFA 1E24A 2JA9A 1QOAA 1EY5A 2K22A 2B2YC 1TXYA 4KTAA 2CU1A 1ZGUB 3Q3NC 1JJ2A 4XT1B 5LL6X 2OTJA 1PZKD 2DWQA 5T1IA 3HOUH 1WX9A 2K75A 2PI2A 1QVGA 4OO1I 2WGSA 3AEDB 3HRDD 5BMHA 4KI0A 4FF2A 1NI2A 3R8BA 3PUZA 4HJ5A 2PMZB 2BDOA 3IBEA 5JVG3 3VFKA 1I3QH 3PMFA 4MH8A 3P4SB 4ANUA 3K81C 4ZK9B 5FKAC 4QCLA 2DGYA 2PEAA 4JI2Q 4IDIA 4IO9A 1YN5A 3CWIA 2YTXA 3GTJH 4GMVA 3HOUB 4C4VA 3S16H 1QWYA 4WJPA 4M0WB 3PO3G 2PI2E 2EKIA 3OWEB 1STHA 3PREA 5ELFA 4QMGA 3BDOA
chains in the Genus database with same CATH topology
1I3QB 3HS0C 4IUNA 3EROA 2K6AA 1R4PB 3B2GA 1LT4D 2KCNA 5J1ZA 1EU4A 2EE1A 3K58A 1PDXA 2FINB 2RQXA 3WOEA 5CBEE 3GTJB 5E4WC 1IL8A 2XIWA 4K2LA 5EPLA 1GUSA 1FM0D 3T4AC 1ENFA 1H9MA 5FO7B 2VZKD 3R2TA 1TWAB 3M4YA 3BG3A 3RUZA 4FNFA 4BS9A 3GTLB 5M3MB 1IW7D 3BK2A 2NZ1D 1TWGB 1PUTA 2FHTA 1PFNA 1D4BA 2E6XA 1Y69U 2RDGA 3L4PA 1I4RA 5BN5A 4ZKBB 1YNTE 1KABA 3ZQ4A 1LO5D 2PMVA 4QIWB 3CQZB 5HG2A 4UDUC 5A35A 2E76C 2WDQB 4C2MB 2B8GA 1TYGB 4DXGA 3K5MA 2N9KA 4TQUS 3BVMA 5KYLA 3MXNA 5ELDA 1DOMA 4X3SA 1PFMA 5G5GA 1C79A 4ID6A 1XO3A 4XDCA 3EA6A 5KYIA 4DFAA 1SE2A 5C4XB 5FO9B 4XXEA 4XYQA 5CV6A 4KHZA 4PV1C 1TIID 2KHSA 2F03A 3U52E 1JQYD 1C78A 3DXJC 1Y8PB 2KAJA 4XQQA 2ZW1A 3GV3A 3GP7A 1F9SA 5IGDA 1ENCA 5BYSA 3A56A 2BB5A 1B9MA 1V1PA 4G7HC 1EM7A 1HXYD 2F0TA 2H89B 4RGMA 2CJNA 5IT9E 3LWUA 4A3IB 2BA1A 1PTOC 4IFDG 1DONA 5I6YA 3LX0A 4OZAA 5E3FA 2VB2X 4YSYB 1K50A 1F9QA 5ELBA 2O2LD 3Q22A 1MGSA 2ICIA 4XT3B 4XWTA 3MHBA 1STYA 1EQTA 1XCQL 2EJMA 5MPOA 5JEAH 5FR3A 4LJZC 4C7YA 1LV9A 1BUIC 1A3VA 1Y56A 4ZYSA 2BCOA 2A6EC 2EXZA 2B2UC 1TT2A 2PPBC 3A7AB 1B53A 1K83B 2DN8A 1CQVA 1TY0A 4RAUC 2B8FA 3LYYA 1B9RA 3SK5A 1EWCA 3N6RA 3LB8C 5BN3A 1Y1VB 3LWEA 2ON8A 1SEBD 4US8A 4KN4C 2YEPF 4MN3A 4A3EB 1FYCA 2L9HA 1T3QA 4H2AA 1PYWD 1OQQA 4G7OC 3Q8CA 2L1AA 2PO4A 1JOKA 1GUGA 3H09A 3MJ5A 3NWTA 1SMYC 5D7GA 4WRDA 1WTVA 2Q8IB 1X3PA 1BCPB 3QJYA 3MEHA 3AE7B 1NAPA 2I07B 5M5WB 4IZ8A 3TP6A 3GB1A 3OW7A 1EYCA 1BF4A 2JQRB 1E9MA 1CTMA 4XE0A 2KECA 2B2TC 1LT6D 1B9NA 1VMCA 1BUVT 3I70A 1FO4A 2F0JA 3D6WA 4J3OD 1F2ZA 1F2YA 4WFN3 3DM1A 1TVXA 5DAUA 4RFBA 1CK1A 3KF8A 3K5OA 3S2HB 3AE4B 5DNFA 4HJGE 1Z47A 4J6HA 4HEDA 1J7AA 5EKIA 3ND9A 3P4QB 2PW9A 4KKUA 1RKNA 3KBXA 3PUYA 2A6ED 4O1NA 5EBDA 1EOTA 3T16A 2V3PA 2YYZA 1SJHD 1XF5L 3DWAA 3J9CA 5EPKA 1QCBD 4OIKA 3LXFA 3MXUA 1PDQA 1ONLA 4YWGG 2RSOA 1KFYB 5I6WA 4MACA 4JWSC 3UI3A 1FMAD 3NVYA 3BDCA 3HOXB 2QF7A 2XRQD 5D3DA 3KLSX 1SF0A 4L8JA 2NTSA 1SMYD 4CJ2C 3TP5A 1Z6HA 2PZUA 2AWNA 4RGTA 5EKKA 1Z7TA 2MJ3A 2I2YA 4RCOA 3AU7A 1FCLA 2XRSD 4RCNA 3ZGZA 3RD4A 1J7BA 1S4ZA 4JK1C 1T6BX 3W2DA 2QCPX 1KTKA 1B44D 2J53A 4N9TA 3BS1A 4RHSA 2INNE 1JORA 3HRZC 4IKGA 3H0GB 5CV9A 4JE3B 4HTHA 2ENBA 3MP9A 1GAQB 4K6DA 1MI2A 2FJ2A 5H92C 3DWGC 5CBAE 5EJWA 1Q90A 2XWJB 5C0XG 2BTEA 2IW3A 2EYMA 3J80L 3A8KE 2F0KA 4YSXB 2I46A 4EQPA 2FBWB 2Z8LA 1G8ZD 4OL7A 3FRPB 2QKIC 1IKLA 3DHQA 1H9JA 1RODA 3NUCA 2EYLA 3NPPA 2JSVX 1JB3A 3CRLC 4YSZB 3OIPA 1S5FD 1VJKA 1PZID 1CZWA 3NHHA 1FRRA 2PKOA 1XWEA 4LMQD 2IGHA 3KLRA 5KNCA 2W82A 1KNEA 4B0EA 4ULLA 4ILWA 4ARCA 1ILPA 1I4PA 3MZ5A 4OVZA 5D14A 4ITKA 2R92B 4DNTB 1CT1D 3C1EA 1E0BA 1EIGA 1BXTA 4NP5A 2WXJA 3V05A 3I4NB 2D5DA 4CKEA 5IGEA 3VQIA 2WU5B 1C48A 2YU9B 2QIEB 1SXTA 3WOFA 2LFNA 2A69C 4G4KA 1IKMA 2EDGA 5BN4A 4HN7A 1OXTA 2K32A 3DEOA 1CM9A 4L23A 2JA8B 4C80A 3EJIA 1JRPA 1BCPF 3VR6A 1ZXIA 1HTLD 2R93B 3IT4B 4FXGC 3NS1A 3H91A 3ZJVA 4IQZA 4RHRA 1YQ3B 3I90A 1KF6B 3K0YA 1XLNA 3V2TA 3AE2B 4CKCA 5LL6S 5JOBA 2OXPA 4Y7NB 4KY5A 3I8ZA 5EE1A 4C3HB 4Q2JA 2ONQA 4RGNA 2NWGA 4S3SA 2F0VA 1TKYA 4KGTA 1FEHA 3FC4A 1C4QA 3W5UB 3I4LA 3TP8A 3TSSA 4IFDJ 2PNRC 1GOZA 3IFDA 2F0UA 1XCTL 2WS3B 3GD7A 1G291 4ODGA 1JWAD 4IN3A 1JOQA 2BB6A 1SSOA 4K8JA 4M1UB 1JOOA 4IUTA 3RZOB 1PXUA 1WYGA 1AEXA 1L0YB 2CQAA 5AUIA 1LTAD 2G9HD 2JXMB 1EZ8A 4LTUA 2D62A 1PFDA 2LJIA 4OZCA 5E4XA 2EJGC 2LS01 4HROA 1QKZA 1PZJD 3I91A 4A3KB 5BYRA 1PTOH 2A69D 4J1MA 3P1MA 4GZYC 2GI9A 3A8JE 2K5QA 4U673 3C8YA 1BCPD 1UWXA 1HFNA 2NVYB 1XX8A 1C4CA 1I4XA 3FVQA 3S9WA 2BS3B 1PTOB 4QB4A 2OF1A 1MVKA 1QB5D 2KMMA 1YNJC 1R9TB 3TEYA 1PLFA 4OZBA 1ZEQX 2R3ZA 4HRSA 3D4DA 3C2PA 5EKLA 2PQEA 2PW5A 5T8IA 1K53A 5D65A 2XN9C 2WNMA 5EQ0A 3Q24A 1AWDA 4C3JB 4P16A 3W5VB 2Y0SB 3UI2A 4NZLB 2L5TA 4OIJA 2EY2A 4ZKCB 3AB5A 5LNK1 5C0XI 4BA2I 1QNKA 5JEAG 3ITPA 4H7BA 1OXUA 2F0NA 4KKSA 2DNCA 2K01A 4TKOB 1JWBD 5CC4A 2MPMA 2E2HB 2NN6H 1TKGA 1JMLA 2RSNA 1DM0B 1WTRA 4IUUA 2F3VA 5TSSA 3SHLA 1VF5C 4PMCA 4CGYB 5JAVA 2KVMA 1Q1BA 1QOFA 2PIAA 4X3TA 2KWDA 5BMIA 2DY7A 2O5JC 2H4OA 2LEKA 2M56B 4DGZA 2BA0A 2D2CC 1DOYA 5A2QE 4XIGS 1BBXC 1EWHA 4OHJA 3TDQA 2XVSA 3AMZA 5I9OA 4KD4A 1GB4A 1L6VA 2DLBA 1A2UA 3TMEA 1SNMA 3IKJA 3SR6A 4EQNA 2B2YA 2WKCA 1FNWA 1D5XC 2HCIA 2KDMA 5FOBB 1QF6A 1VCIA 2SDFA 2EOTA 2IX3A 3BDLA 3D4RA 3S16B 2G1EA 3MFGA 3RZDB 3U9OA 1MD2D 1D1KA 3QG1A 1IYVA 1ZPSA 5JPMC 2QDBA 3HOYB 1XTCD 4CKBA 5C2TB 3NVWA 1RWSA 4U68A 4CJ1B 4JWUC 1MHHE 5BYQA 1ACCA 1UGJA 1VMPA 3S1MB 3NXWA 4ZOHC 4B0MA 2C5CA 1VRAB 4ZRQA 4JX1C 3AE8B 1NUCA 2AUKA 4DAPA 3NRZA 1JROA 4ARIA 3P7JA 2O5IC 5C0XJ 3A55A 3FILB 1SE3A 3L9AX 1O78A 1EQVA 1UAPA 3SK4A 2OT2A 1O7ZA 2K7VA 1D5ZC 4HSPA 1N60A 3H3VC 2LMCB 2BBCA 4C56C 1MI0A 2W3RA 1LTTD 5KEEA 1I4HA 2KN4A 4ZUJA 3GO5A 2L1BA 3C3LA 1QOBA 4R8IA 4PNYA 1I50B 2AUJD 4RNAA 2ZXOA 4OW0A 1N5WA 1IHZA 3DWQA 1YMHE 2WXMA 4PT5A 1G2TA 1V8CA 2K05A 4R3DA 3GTQB 2LKVA 4H0LC 5HGTA 1DD2A 1C76A 1STEA 3J7YW 1PTOF 3AE1B 4NAMA 5IT9L 4KN7C 2WXNA 3TZDA 4GDLB 5C3XA 1GB1A 1J9OA 2HUGA 3PO0A 3MVVA 1STGA 1JW9D 2CHBD 1V97A 3ZJTA 3GTOB 4RKLA 3SK6A 1IBXA 5C6AA 3C1FA 3LNNA 3HVZA 2JZPA 3K57A 2E2IB 2D5GA 5C3WA 2JYTA 2N55A 4YTMB 3NUHB 1TWFB 3Q69A 4RH6A 1A2TA 3VR5A 2VB3X 4KJOA 4RGOS 1IUEA 1N63A 1WTQA 1O80A 5KIXA 1TKEA 1DYQA 5EE3A 2WP9B 3Q6SA 5CGKA 3AM9A 1F9PA 2J52A 3T3NA 1P7EA 2DY8A 1SFOB 2J0TD 2V4IB 3MXPA 2R7ZB 1AYFA 3OIQA 3EVQA 3ERQA 2Z4HA 5CV7A 5FO8B 3FMCA 2EYPA 5FK9C 2ID0A 5HHDG 1MPEA 1BMLC 2A6HC 2WACA 4QF4A 1EY6A 2FUG1 1L0VB 1ZDXA 1KNAA 2FE8A 4Z9CB 1PTOD 1VZ6A 3IT6B 2NVQB 3J81E 1ZDVA 2WXOA 5EPJA 3H6MA 2O4XA 4FF4A 4X3UA 3URYA 4XYOA 1VR9A 1F2RI 4C3HG 2KA7A 3AEFB 2B2TA 4QUCA 4KK7A 3SEBA 1HA6A 1E6EB 2B76B 1XXGA 4K6LA 3E0JA 3NTKA 4UAIA 5CYUA 1KLGD 4M0WA 2EY1A 3NQTA 4ZRZA 1RTOA 4XDDA 2QMTA 4DQOC 3DWMA 2E2JB 1G91A 4PQXA 3AH7A 3HUIA 3CKIB 1HTPA 3N52A 2RVLA 2BS2B 1JE4A 1LTRD 1OXXK 4F87A 4K5XA 4ZHPA 1TQOA 2R61A 2LHDA 3NTIA 2L32A 3NZ3A 2E2DC 4A3JB 1VLBA 4LK0M 4N58A 3L3OC 2WXHA 1L4ZB 3E9SA 4BBSB 2BW2A 4YT0B 3R93A 3U9SA 2MJ8A 2KEDA 2JYEA 2WXKA 5H8YE 1ZXHA 1HZ6A 4B08A 3SDZA 3MHZA 2SNMA 1BO0A 5JEAJ 1CJEA 2PVGC 4RF1A 2EVBA 1K51A 2KJXA 3VYRA 2PYKA 3NWSA 1CZPA 3FEWX 1NEKB 3ABVB 2A6HD 1EWYC 4MT5A 3T3OA 2MUYA 4KJNA 3QB3A 1L4DB 3FILA 3TZUA 5C4JB 1VDZA 2ICEC 5C3EB 1SDFA 2VXWA 2LUMA 4FXKC 4L6TB 3TEXA 2Z1CA 3T56B 1STNA 2SEBD 4DNRB 2PLPA 2CW0C 3H94A 4K14A 2LHEA 4AS1A 2WXPA 3EGRA 3M7NA 4DN4M 1AW7A 1CZGA 3OSOA 2WXQA 2B2VC 4QUFA 4C3JG 2CU3A 5CV5A 1SAPA 3TP7A 3FAHA 3VR8B 4FVMA 1F9RA 2NYZD 4KY7A 4TSSA 2RMMA 1IYUA 3S14B 5D3IB 5K36H 4HKZE 1K8OA 4IFDI 1C4PA 5EBCA 1RF2D 5JJZA 3AEAB 2RDHA 3J80E 1HHVA 2J42A 4F8MA 4C1NI 3PIP3 3TN2A 4GDKB 2IWHA 4FYDA 3DMUA 4TRDA 5JXVA 2PZTA 4KKJA 4HCEA 1XEEA 4ZAIA 3PZ7A 3RLFA 4US9A 5KRUA 2N0SB 5EGTA 5CR3A 3TEWA 1RFKA 5I2XA 4B9WA 5KNBA 1QLBB 1A3TA 2SNSA 1EY4A 3PZ8A 1DOLA 2GB1A 4HMJA 1Q12A 3K7AB 2PVOD 4BA1I 3NVZA 3V96A 3Q8FA 1HZ5A 2A68C 1JWSD 1A6XA 3N9YC 3VR9B 4N9PA 4EVOA 1SNQA 2E74C 1AFPA 1TS5A 3I72A 2EELA 2L4NA 2MHVA 4FF1A 5GXGB 3PO2B 2K9XA 3P20A 1MSHA 4TQ0A 3SK8A 2L12A 1GUWA 1QQRA 1S5DD 4EGVA 3ZJUA 5G5HA 1EZ6A 5HI1A 2IGDA 2WAQB 4A3FB 1F0ZA 3X3MA 2X6GA 1QT9A 1NSNS 3NBIA 1EU3A 2V4DA 3B9JA 5DM63 1GHKA 1YJJA 1KDBA 1JR0D 1EIHA 1FR3A 1STAA 4NDXA 1DOIA 4A3MB 2KQ3A 3IXSA 3U4EG 3RFZB 4I65A 3BIID 3ND8A 2WP8J 2JWUA 1WVLA 1FGBD 1SB3C 1EEFD 1MSGA 1DZ1A 1Q8IA 1U9RA 1H9RA 2X6LA 1YNNC 1I4GA 3S1RB 1EY7A 3AE9B 1NI3A 2H88B 1WD0A 2KCCA 2F0DA 2HDMA 4O42A 3CHBD 1B3AA 3D6CA 3MA2B 2FFKB 1M4VA 3AN1A 1H9SB 2WV6D 2B2WC 4ZUIA 2SOBA 4DAVA 4RA8A 1W6KA 1M8AA 3A8IE 3T51B 1FCCC 1ZOYB 3OMCA 2PZWA 2NTTA 2Q8TA 1HEZE 3JAME 1MHXA 4XWWA 2A68D 1AZPA 4BY1B 1E7PB 3P1HA 1O7YA 2A74C 3OPOA 1N61A 2DYOA 5C3JB 1GPXA 3DUZA 1D2BA 3KLSA 2DYMA 3A54A 2QJLA 3G6JB 5I2YA 1K8MA 1SNOA 3KUPA 1L6UA 5ELCA 2K03A 1II3A 4X3KA 2F0PA 3U7ZA 3S1NB 3NBHA 4CBVA 1WCMB 2E3TA 1V1PB 5FLXL 3BYYB 1LACA 1DOKA 1PGAA 3S2DB 2WXGA 5IOCA 3MC0B 1ZUD2 2WLBA 1JQ4A 1TKWB 1VZ8A 2MGSA 4CHTB 4YTNB 1XLQA 3Q23A 1D6EC 2K04A 4L1BA 1EY9A 2JSOA 4LAAA 2JXTA 2EYOA 1I6HB 2M19A 2HTME 1WTXA 1O7LA 1RTNA 1B1ZA 1NCVA 3I3CA 4ZRPA 4ZQ3A 5CORA 1GUTA 2F0QA 4K2KA 2GA4B 2HCCA 5M5YB 2WDVB 5NUCA 3HKZB 5ELEA 1WTOA 1TZOA 5AFWA 2AQ1B 1UWMA 1B2TA 2Z4IA 2ZXRA 2KACA 1TWCB 2K5DA 1J8IA 3EFXD 4BBRB 4YIJA 1PGXA 4IUQA 5COYA 3B2FA 1F2LA 2TSSA 2B39A 5T1GA 2L83A 4C7ZA 3VYSA 3R3OA 2PCFB 5C5MA 3FKIB 5CV8A 1IGCA 4C3IB 1IW7C 3Q8EA 1DOXA 1TY2A 1BR9A 4KHVA 4XQJA 3J7AV 4OO1H 1NYRA 5A2QL 3NP8A 4NKLA 1A70A 4DU9A 3GTMB 1SBBB 3S17B 2F0SA 1QG7A 1YNJD 2F0IA 3U2SC 4HAEA 4E6IA 3HOZB 3E56A 1GJXA 1EY0A 3HOWB 1FRDA 1DCZA 1SYDA 2N9LA 2R6GA 4REZA 1K52A 5DEHA 1ZXTA 1SSNA 3ZYYX 2E75C 1XLOA 3E6ZX 2K0PA 1EL0A 5C4ZA 2WQYB 2EZVA 4IOIE 3NE5B 5E6JA 1GUOA 1ROEA 1R7SA 2OEOA 4ME5A 2M0AA 3QWNA 3OOCA 4WJWA 1C4AA 4KGRA 4DAYA 1G6ZA 3AV8A 1G2SA 2BYTA 1F77A 3QO2A 4A93B 4DF7A 2RKSA 2L55A 1ML0D 2IX0A 3ETRA 1JWUD 3KQ4A 1ZP0B 4WQMA 4RKBA 4RWSC 1A15A 1OO9B 4A8XC 2Q5WD 1QOGA 4Q0FA 2B63B 1SNDA 3VR4A 5J39A 1VDVA 1QJOA 1N62A 1FIQA 3NVVA 2EPBA 1X3QA 2M00A 1ESRA 3VYUA 3BVGA 4A3DB 2WDRB 1H9SA 4FXDA 1Q3LA 3I4MB 1JCKB 1Y8NB 1FD7D 4A3BB 1B50A 1EYDA 3CRKC 3SE0A 3SVMA 2NMQA 5G3LF 4P2CB 4B9XA 2M9VA 2IDYA 4GLSC 4RF0A 4KMUC 4MM3B 1C8CA 4D2KA 1BQQT 3TEZA 2J7ZA 1JALA 2CVRA 2V0GA 2L52A 3E5SA 1TJEA 1D5MC 5K5PA 3P4RB 1STBA 1QE6A 1JICA 2IL8A 3IAS1 4K5VA 5JVH3 1OXSC 3BYTB 3O13A 1ZYRC 3WDNA 3BWUD 1XLPA 3KBGA 1XYIA 2VUMB 1KRHA 1AZQA 2QEJC 3T13A 1L5PA 1WTPA 2HDEA 5K36G 4TQ1A 3VA5A 1PFBA 4V190 4XQNA 2JA5B 1VZ7A 1SIJA 4H13C 2F0OA 2BT6A 4A6QA 2EY6A 1UEAB 2Y5CA 3X3NA 1HUNA 3WCQA 3MWYW 3AECB 4NAWB 5CV4A 1JWMD 5AUKA 4KKTA 5DM73 4L63B 4CJ0B 1E2ZA 1SJED 3C46A 3VR2A 1TU2B 4HMIA 4WAFA 2FMMA 3RMHA 5EE9A 1ZKOA 5G3LD 4FF3A 3V3XA 2B2UA 4KGSA 1SNPA 2G9DA 3KWLA 3PUXA 2K28A 2WXRA 3OWFA 3QIAA 4N59A 1JC7A 1HQRD 2OEDA 3PUVA 4C1NK 1SYGA 1RHPA 3L7ZC 1DGJA 4M8AA 1U4LA 2LY7A 3IAYA 1GHJA 3IAM1 1DJRD 3GQBA 2A73B 3IL8A 3VYTA 3M85A 4K8IA 2IT1A 2F0GA 4AQ7A 4WORA 5BMGA 4YTPB 1L0XB 2F0FA 1ZYRD 2FMCA 1WXQA 2QSDA 3J81L 1KLUD 1FXIA 5C5LA 3I73A 4KKIA 3P4PB 4NW2A 5KGUA 4EE2A 3I9V1 3ONAB 2MJDA 1C77A 3DEPA 4IALA 3Q8BA 4FP5D 4PMBA 3PO3B 2NVXB 2TMPA 2F0HA 3D3RA 1ZE3D 3BK1A 5IGFA 1PRTB 1E2VA 4G7ZC 2XWBB 4BY7B 1RD9D 1ENAA 4JPSA 1HQMC 1TS4A 2XSCA 5IIFA 3NSWA 4K5WA 2AWOA 3AB9A 5M5XB 1FFVA 5LHY1 1X32A 1TWHB 2KEEA 3Q0AA 3HZXA 1OQRA 5HURA 2VNUD 3KWVA 1LLRD 1NR4A 3W1SA 2AX5A 3OMGA 2Y3AA 4I7ZC 4J8QA 1E2WA 2ZXPA 2Q8RE 1KH0A 1LTBD 2EJFC 3RPFC 1QOHA 4HSVA 4WURA 1HFGA 1AN8A 1D1IA 3MFYA 3MTSA 2N7JA 1B4OA 2NBFA 5IODA 2N88A 3M7GA 1N5XA 5M9OA 4F88A 1P7FA 1QNUA 2L0CA 2LMCA 4MHEA 3SFEB 1WTWA 2QILA 2RPVA 3CIRB 1I4QA 1RJTA 3P75A 1HRJA 2ZW0A 4WIPA 1E0ZA 5IGBA 4TMAB 1AP0A 3FPUB 3M3YB 1RM6C 3P63A 3J7AF 3P42A 1SE4A 4ABNA 1CFMA 2IJ0A 2NUCA 2NVTB 3CU7A 3KK7A 4HCSA 1SYBA 1S5ED 1IGDA 2B2VA 1YN4A 3PV0A 2KOLA 3NK9A 4G57A 1TS3A 5C4HA 4IUPA 3A7LA 4IFDH 3D31A 4HKQA 2INPE 2JYOA 3W9CB 2A5HA 1GXDC 2EYHA 2JP1A 1A3UA 2F1MA 2IX1A 1S5BD 3VA7A 1FXAA 2EYJA 2DBYA 2F0WA 2VZKB 1KDAA 1WSPA 4HEA1 3GTPB 1Y1WB 1QILA 2EYFA 4PMWA 2H1EA 1BDOA 2NN6G 5M3FB 1CA5A 4WH4A 4C3IG 1Y8OB 2HDLA 3PIO3 2WXIA 1KAAA 4KY6A 1NENB 1EEID 1OXVA 2F4IA 2IPKD 1I7HA 3TUOA 5F2DA 4Q5VA 3Q8AA 1FD6A 2PW7A 1PMRA 1ICWA 3K6OA 3F2UA 3BVZA 1LTSD 1TS2A 2W3SA 1LABA 3QOJA 3SXHA 3AE5B 2F0MA 4R9WA 4DK0A 3GTKB 2BOSA 2CW0D 4IUVA 1NR2A 4OO1G 1SNCA 2C9OA 4A3GB 2I38A 3VRAB 1ESFA 3OHXC 1NVID 1SYEA 4BWGB 1CQFA 2XNAC 2SAKA 2V3NA 1EY8A 1J7CA 3K5LA 3T53B 2L11A 2CJOA 1UNSA 4YXDB 5C44B 2KQ4X 3TBIB 1T5EA 4HR7B 1BNZA 5IGGA 2GRIA 1UUPA 2JE6I 3AE3B 1HCZA 3GTGB 1WD1A 1EFID 4LLGM 3EUB2 4EQOA 2K3UA 1ET6A 1R4QB 5JPNC 2K5PA 1BCPC 2WKDA 1F2MA 4XTCS 1WGKA 2AQ2B 1VF7A 5HFYA 3NTHA 4A90A 4KX6B 2HQEA 2MP1A 4DXFA 4L2YA 2RA4A 4AYBB 2JA6B 2X69A 1CA6A 4KV6A 1RDPD 2F3WA 1ILQA 1Q1EA 1F2RC 1YJIA 2WXLA 4A55A 1HA5A 4IURA 4WWMA 1LT3D 5IGCA 4JBWA 2WU2B 3D8GA 2WXFA 2J4XA 2JU6X 1PRTC 2WB1B 1T5XD 1PRTF 2B2WA 2ACZB 1BOSA 3HP3A 1HPCA 1V1OA 4FXCA 3JAML 5J22A 4MIUA 4DA2A 4ZLTF 4CQNA 3GV6A 4KD3A 3HG9A 4H44C 1DXMA 3HEJA 5EE0A 5KNDA 1I6VC 3MXGA 1MBYA 2MH7A 1OFFA 1LTGD 1LT5D 3AEBB 2K5WA 2JEAI 3K59A 1WWTA 1S5CD 1EYAA 2K1BA 4ZHOA 1CHPD 2X38A 3R2IA 3EQLC 2JEBI 2JX5A 3AMUA 3S15B 3AE6B 1E10A 3G7LA 3SR1A 1HUMA 2BE5C 1YQ4B 2K33A 1WRIA 3AEEB 1V8QA 5CMDA 3SFDB 3S1QB 5E1FA 1NYQA 2RBMA 3GS2A 2IGGA 5FLXE 3HGBA 2WIIB 2OHFA 1YNND 2WINB 1FFUA 1U4RA 1KDCA 2RDFA 4V0BA 4NMZA 1FNUA 2F0LA 3BZDB 3HVDA 4A9AA 2AQ3B 1CI3M 4NJCA 2ZT9C 3DWPA 1IBXB 2W54A 4P6VF 3W3AA 2W55A 5C0XH 2F0EA 3D4WA 2JA7B 5I4DA 3PUWA 1H9KA 1PRTD 1V43A 1CHQD 3VRBB 4LK1C 2D9UA 2PTLA 4N6EB 1SYCA 1SYFA 2EY5A 2DNEA 2M2LA 3FPPA 1Q10A 3QOLA 3I57A 1C9FA 1RCVD 1TR5A 3M4OB 3VR3A 1YN3A 1RYJA 3IFTA 2Y5PA 2NN6I 2NB0A 1GUNA 4R8NA 5I9PA