1HXYD

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
total genus 66
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hxyD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hxyD02
1D5ZC 1JQYD 1PTOB 1PZJD 1STEA 5D3IB 2AQ2B 1ENFA 3KLSX 4RHRA 1JWMD 2R61A 1PRTD 1RD9D 2ICIA 3BZDB 1V1PA 4C56C 2G9HD 4RH6A 4OHJA 1ESFA 1KLGD 1PTOF 1TS4A 4DXGA 2NTSA 5ELDA 1FNVA 1S5DD 2XRSD 1PZKD 1JWSD 2XRQD 1PZID 1HQRD 1JR0D 1SJED 1HTLD 3SEBA 3MFGA 1UUPA 4NZLB 1EWCA 1EEFD 4RHSA 1RCVD 4RGOS 1TS5A 1T5XD 1YN4A 1FNWA 1XXGA 1LTID 3BVMA 2AQ3B 1DYQA 1LTSD 2Z8LA 1BCPB 1ET9A 1CK1A 1KTKA 1LLRD 1LT4D 3DWAA 2XNAC 1LT6D 1JCKB 1D5XC 2XN9C 4ZYSA 4K6LA 2NTTA 1TS2A 2RDHA 3R2IA 1PTOH 1PRTB 4TSSA 1MD2D 1HA5A 3O13A 1SEBD 1RDPD 1RF2D 1FGBD 4RGNA 1LTBD 3MC0B 5I4DA 3R2TA 1LO5D 3TSSA 1EEID 1EU4A 5FK9C 1CHQD 1I4QA 2CHBD 4RGTA 1JWUD 2WV6D 2SEBD 1I4HA 1SE3A 3BYTB 1LTGD 1L0YB 4DXFA 5TSSA 1EU3A 1TS3A 1LT5D 1F77A 1PTOC 1KLUD 1SE2A 2QILA 1PRTC 1ET6A 4RFBA 2J4XA 1LTAD 4L63B 4UDUC 1GOZA 1CT1D 3OWEB 1YN5A 1M4VA 3URYA 1LT3D 5ELCA 1PYWD 3CHBD 1QILA 5ELFA 1L0XB 1PTOD 1G8ZD 3EFXD 4RGMA 1I4GA 1HXYD 1D6EC 2IPKD 1YN3A 1PRTF 1V1PB 2IJ0A 1FD7D 1SXTA 1B1ZA 1I4RA 1I4XA 4Z9CB 3DWQA 1S5BD 1TY2A 2O2LD 2RDGA 5ELEA 3V05A 1SE4A 1BCPD 3BVGA 1BCPF 2TSSA 5FKAC 4RCOA 1D5MC 1XTCD 1TY0A 1SBBB 1DJRD 1UNSA 3EA6A 1S5CD 1SJHD 3BVZA 1BXTA 1I4PA 5D3DA 1LTRD 1S5ED 5ELBA 1AW7A 1CHPD 1LTTD 1S5FD 1CQVA 1V1OA 3R8BA 3DWPA 1FNUA 1EFID 2QEJC 4BWGB 4L6TB 3GP7A 1B44D 2AQ1B 3BYYB 1AN8A 3W2DA 4O1NA 1BCPC
chains in the Genus database with same CATH superfamily
3SHLA 4FBJB 3IXSA 2D5DA 5FLXL 4DAYB 1G291 2SNMA 3SFDB 5BN3A 2ICIA 4RH6A 4C3JH 4OHJA 1YX5B 3HFZB 2EIFA 2BYFA 2L52A 3U30A 1GKHA 3K80C 4DR7Q 1SRUA 1Q1OA 1XLQA 3RT3B 1FNVA 2KZRA 4LF8L 1L0VB 1B3QA 1GC7A 4GN5A 2H89B 3TMEA 2WXOA 3B0AA 3W3AA 2Y5PA 2K22A 2K05A 2NN6H 1TWCH 1SJED 4IUPA 1HTLD 3M7GA 3TREA 5K36H 2OCEA 3SXHA 3GTOB 3P63A 1EEFD 3G6EA 3K5LA 3NELA 4L5SA 4L5RC 2DYMA 1RCVD 4HJ7A 2IO3B 4JIOU 2FIDA 1PVOA 2LUMA 1F9QA 1WM3A 4EKUA 3OTOQ 3CP0A 3LWEA 4RWSC 3GTMB 4KKIA 1EF1A 4TQ1A 1T0YA 5IYBH 2N3SA 2GBRA 1OXUA 1TWAH 5G3LF 1VQCA 2D2CC 3IRBA 1KF6B 4IWOA 2LASA 1PTOH 3ZTDA 1KQSA 3K57A 1WYWB 3E0JA 2DN8A 3L3OC 4C3HB 1STYA 2NN6I 1FL0A 2WLBA 1XMOL 2VNUD 3N20C 3MC9A 1NMFA 3A56A 1JALA 3NZSA 3AEFB 1Y8RC 3UF8A 3P4QB 5CGKA 2GRIA 4M00A 2F0IA 3I3CA 3ITPA 3VR9B 2ZTCA 1QUQA 4XQQA 2JXTA 4DBGA 1I4QA 5ELOA 4DV2Q 4A3IG 1CZPA 1RAXA 2EYMA 4KZCA 4C2MH 3M4OB 1TWFH 3PUZA 1KC8C 1NJIC 5EBDA 2NBFA 4LAAA 3SK5A 1LT5D 1H9MA 2J0TD 2OF1A 2JA6B 5AUKA 3K8AA 5G55A 1MVKA 4GDLA 2FIFA 2MBEA 2HDLA 4H0LC 2I5HA 3KBXA 4QF4A 2UUAL 3X3MA 3T13A 3UE1A 4Y7NB 1YJNA 2WXHA 1TZOA 3CHBD 1QILA 4LNIA 3Q0AA 4RNAA 3ZGZA 4IFDH 1Q1BA 2PZTA 3OMCA 4DR1Q 5JH5C 1SN8A 4XYOA 1UEBA 1Q8IA 2IPKD 1WTPA 1AEXA 4KN7C 3QC8B 2B2WC 4PQXA 5C3EH 1G6PA 1XMOQ 3J81E 3VR2A 1GB1A 2ZPYA 4KDLB 3GD7A 4JV5L 1AZPA 1S5BD 2CW0C 5EAYA 3S2DH 4YCUA 4DHJD 3BVGA 1G6JA 1VS0A 3RZFA 5FKAC 2WB1E 4A3KG 3S1NB 3PQIA 2V4DA 1L2FA 4EVOA 1SFOH 4BXXG 2N88A 5D3DA 4AS1A 2GOWA 4QCLA 3JSVA 4HLEA 3S2HH 4ANUA 3C19A 2IYDB 4OO1I 3BZKA 3ZJUA 2K7VA 1JE5A 2PJHA 3KYDD 4NPNA 4FXKC 2ZJQA 3AMZA 4I6PA 3NQTA 5KYIA 4DR6Q 3DHGC 2N7DA 4IFDG 3MXGA 2LXJA 1D5ZC 1VR9A 1PZJD 1Q12A 2K01A 3DWGC 3I73A 1EY0A 1PRTD 1VQBA 3UQBA 1NVID 3N6RA 3FKIH 2DGYA 3OHXC 1NI3A 4H13C 2BF8B 1HTQA 1WXSA 1TS4A 2KMCA 1TIID 1SF0A 4FNFA 5CV7A 4BBRG 1M8AA 2UXCL 2HCIA 2KN4A 2JE6I 1BNZA 5EE9A 1NYQA 1AP0A 1UE1A 1J7BA 2N1VA 4B0EA 5BYSA 4RMFA 2OTLA 4JOIC 4JI7Q 1YNND 2HD5B 4NB3A 4M0WB 1EYCA 2I5MX 3HOYH 1TU2B 3RD2A 3MFGA 1BT0A 1U5KA 4ARCA 2YEPF 3AEGB 4K2KA 3RNFC 1LABA 1RJTA 5DM63 2K5NA 2KX3A 4JBKA 2KHSA 2NCNA 4KHPQ 1LXDA 1R4MB 1YN4A 1YJ9A 3RNAC 3BVMA 2RA4A 4NQLB 4BS9A 1PH1A 4EZLA 1TWGH 3C3LA 1GVPA 2NZ1D 3DVNU 3NE5B 1VCIA 2R6GA 3FKIB 5EJWA 5HGTA 2RDBC 4A20A 2KLGA 1V49A 4IUQA 5HY6A 2FXQA 4ZYSA 2PPHA 1P98A 5JPNC 1Y69U 3NOBA 1E7PB 4JQWC 1M94A 4MELA 1SR3A 3GE3C 1FGBD 4TQ0A 2FMCA 5I4DA 1YOVB 2BVCA 2DZMA 3HM6X 2JQRB 3PVLA 4ZDVA 4L8JA 2KDEB 4LJZC 1K28A 4MM3A 2K0PA 4R1JA 2K25A 2FMMA 2KFKB 3J80c 1EIGA 1OXTA 4II2B 5JHBA 2DZJA 1Y1WB 2F0UA 3P20A 3K0XA 4MDKE 1WGKA 2W82A 3QQ8B 1MJDA 4IALA 2LHEA 4R4IA 3WCQA 2D2QA 1PTOC 3PF5A 2LD9A 1WX9A 3NBIA 2DAFA 2V3NA 3QJYA 3LDZE 4HJGE 2WXQA 1XNQQ 1YMHE 1N32L 4WAFA 3WAOA 4DK1A 1YN5A 2R93G 5COYA 1WD1A 1V8CA 3Q8AA 1U9RA 1X6OA 3W1GA 4AOFA 2IY5B 5D2MB 5H92C 2GMIC 3A7AB 3DWMA 4JW0A 1EYAA 3CIRB 2A6ED 3PRPB 1IKLA 4W9HA 2ZVNA 3KLWA 3RN2A 1VQ9A 2M17A 3S15B 3T4AC 3C1FA 4GOPC 1TJEA 1E2VA 1JICA 1O7YA 2L76A 2NPTA 1J8CA 4LF7Q 3NPPA 2O2LD 1SYEA 1F9SA 4G3XB 2K52A 3HEJA 3ZO5B 3CPWA 2QGQA 2F0KA 1O7IA 4HRSA 3UINB 1DJRD 3EA6A 1WTWA 3I4MB 1C79A 4WWMA 2D9UA 5KHOA 3PREA 4ULLA 1C4QA 2K5PA 3I4NH 4G4KA 3DMUA 4F7XA 2UUBL 3TS0A 2PI2A 3AMUA 1K0RA 5HHDG 3K9PB 4ZRIA 2H5XA 2QCPX 4CDFC 1UZXB 1CFMA 3IT6B 1W6JA 1AE2A 1EIYB 4CKCA 4PYZA 4K3BA 3F1ZA 4QGUA 3MVVA 1UWMA 2XBBC 2V1YA 2UUCQ 3MTNB 2PZWA 2M0AA 1JWMD 2R61A 2UXCQ 2R2QA 4LW1A 3BZDB 3KUPA 1C0AA 2M1MA 1VRAB 3BIID 1PFSA 2AMCB 4FN2A 4N6EB 3LYYA 4HROA 3KH0A 1ENAA 1UWVA 2KJHB 1KH0A 5ELDA 5I9PA 1IPGA 2L5TA 1NCVA 1PH5A 1QLBB 2XRQD 5C44G 2W9NA 1E9MA 4KSKC 3IT4B 3PS6A 3S1NH 2NVQB 1Q1EA 3ML9A 1HNZL 1F9PA 3SE0A 5IGBA 1K8RB 1MJCA 4LK1C 3TJPA 3KUCB 4RGOS 1VQ7A 1FCCC 4K1RB 1ZW7A 4X64Q 1PQSA 2KQSA 2O2VB 1VF5C 2JA5B 4OX9L 1YD8U 1DYQA 1J5EQ 4LNKA 5C3JB 1ZDVA 1EL0A 1HE8A 3EC8A 1CK1A 2Z6BA 4EQNA 2EQSA 2X6GA 2VQEQ 1IXRA 3S2AA 3FVQA 4DV7L 2TMPA 4M02A 5IWAQ 2K4KA 1X65A 3ULLA 2OJRA 2HE7A 4K6LA 2VH1A 2PTLA 3P4RB 3L17A 4GN1A 4OVZA 4HJ9A 3VH3B 3SK8A 4Y52H 3TEZA 3C46A 3H3VI 4GKKQ 5JAVA 5JHAA 2WAQB 4RGNA 2BA0A 2OQKA 1GUTA 2Q8RE 1U4AA 3AXCA 4PT5A 1A3VA 3RNBC 4EEWA 1M1KC 4DK0A 1CKOA 5HG2A 3VTUA 3KF8B 2Z4IA 1KRSA 4II3B 4LF5L 1YNTE 4IUMB 4LNFA 1GC6A 4M0WA 4C1NI 2WX1A 1FRDA 4A3CG 3B2GA 1EOVA 2VUMG 3TUOA 3PUVA 1CTMA 5EKIA 1N32Q 4DNIA 4IFDI 1XCTL 3H6NA 2WWZA 2NS5A 1N63A 3MJWA 1HTPA 4ZCKA 5I2YA 5IY0A 4BXXH 2JWZA 1SLJA 2NVTB 2PLPA 5CC4A 3VHTC 2LGYA 1UBQA 5L37A 2Q2TA 1Y8OB 4BY7G 4BZAA 3V96A 1V1PB 3HS0C 5BN5A 1K8OA 2V3SA 1IBXB 2WX0A 3TL5A 3DVNV 4BKGA 4MGYE 3RPFC 3I7FA 3TEYA 5I6YA 3QWNA 2PW7A 3NVYA 2CU1A 1SE4A 1BCPD 4DNTB 4F8CB 4R8NA 2L8JA 2PCFB 4BBNF 2QDFA 1JE4A 2ZCCA 1SYGA 4A3CH 4I7ZC 4QIWB 3ECIA 3PMFA 4YSZB 4HCNB 5JOBA 5C4ZA 1C4PA 2EY5A 1TZ1A 1GUAB 4XQJA 2AKWB 4DR5L 1V1OA 4C3JB 5KHQA 1HNWL 2A8VA 4DUYL 4N8X1 4DUZQ 1AWDA 1ZUD2 3GTJB 3APCA 2BB6A 1F9JA 2INNE 4BFRA 3N1XC 3STBD 4IPDA 1DOYA 1VQ4A 1WI5A 2FHTA 2C7MB 2OOBB 1WM2A 2QW7A 3GTJH 1X32A 3RZOH 1Y14B 2JY6A 2KOXA 1TXYA 2CQOA 3FKYA 1OO9B 2DNEA 3IL8A 2N55A 4A3GB 4PZ7A 5C2TB 3PO2H 2LKVA 1DGJA 3CCVA 1JMCA 3ZXVA 4N9PA 1VQOA 2VQFQ 3DCGA 4LLGM 3EBEA 4GZYC 4KKUA 1ZPSA 3DHIC 1Y1VH 1X1MA 2UXBQ 5GMVA 4OWTB 1TTNA 4EE2A 2B63B 4FHJA 1EQRA 1AARA 2M19A 2MX2A 1DGSA 3S1MB 5D94A 2WXNA 4HSVA 3F2UA 5C4JB 1IBLQ 3J7AF 2X8XX 5H8YE 1HQMC 1IW7D 2JA7B 1EIHA 2MBHA 2I46A 3N32A 1LTID 3PO3B 2B2UC 3NTHA 3DM3A 2HTHA 1LT4D 1EIFA 4RKLA 4CJ2C 3A1QA 2NR2A 2RQXA 4CJ0B 5JVH3 4KZ0A 2E2JH 4TQUS 4JK1C 2KN5A 1XCQL 3QARA 4X3UA 5G5HA 4ZHOA 4CDDC 1SNMA 4TSSA 1MD2D 3K59A 4ME5A 3O13A 2GB1A 1CM9A 2OQ0A 1CMXB 4HJ8A 3ZJVA 3S1MH 5DCNA 2Y3AA 2CS4A 3A9JB 2B63H 3JYUA 4FHKA 4XE0A 4S3SA 4CO7A 5HFYA 3EJIA 3A0JA 3TN2A 2K75A 1A0IA 4WJPA 4K5XA 2CFMA 4CGYB 3PO2B 4IWPA 2BT6A 2JXXA 3S16B 4DXFA 4X65L 4A3FH 2YLMA 1HNXL 3AEBB 4RCNA 2ZXPA 2K28A 1EU3A 3KJPA 3FMCA 1F77A 3RZOB 1QJOA 4UPAA 1PRTC 2N9PC 1KAAA 3U9SA 1D4BA 4KJOA 3AB5A 3E3XA 3CQZB 4X3KA 4G7OC 2G3QB 5GAGC 1FJGQ 1WGRA 2LVQA 4JGHB 3RYTA 3S9WA 5BR8Q 3PUXA 3AU4A 3HKZB 1RODA 2XWBB 4M1UB 2F0SA 2PQAB 3NUCA 2IWHA 5C0XG 4LUZA 2VH2A 4AQ7A 3H7PB 2AWNA 2CHWA 2XSCA 2KXJA 4LK0M 3P7JA 2IY1B 2BE5D 1MKHA 1Z7TA 1C76A 1H4RA 4OELB 3IHPC 4YCWA 2JA5H 4UP8A 2R2OA 1NNXA 4M8AA 1L0WA 3U4EG 5K5PA 4NXNQ 2UXDL 5KNBA 3ZRCA 4P72A 4NXML 1TY2A 2CH4W 2BTEA 2SDFA 1VQAA 3M3JA 4JI8L 5A35A 1PFMA 2PO4A 2FUG1 2JVCA 2NYZD 3MHSD 1N9WA 5AJ3L 4W9EA 1G2TA 1JJGA 3GDEA 1ZDXA 3KFUA 3HRZC 2FBWB 2IL8A 3AB9A 4IQZA 1DM0B 2A4ZA 3P2BA 4OXPA 4BY1H 1WFYA 1HRJA 2EOTA 1R4NI 1I7HA 2KKCA 3L10B 3OJ3A 2KEEA 1GHJA 4I6NB 1EM7A 3R3MA 3HIZA 1BO0A 1FGUA 1P9DU 3IG3A 1AN8A 1FCLA 4FF1A 5IN7A 2BKRB 3SK4A 3SR1A 3A4RA 4U673 2AQ2B 2DY7A 5IYCH 2JA8B 1L1OA 2FCSA 4W9GA 5EE1A 2MH7A 3Q69A 3GTLB 1KM7A 5IP4D 2MSED 1KLGD 2R92G 1TKEA 3DHQA 4B3SL 2Y0SE 2W54A 1V9PA 3I4NB 2L11A 1WD0A 4A3JG 1JOQA 4B3SQ 1ZXIA 1JWSD 2KAJA 2KUMA 2KYWA 2QKIC 3TMPB 4ACFA 2HIXA 3NBHB 5KYLA 1L4DB 2H88B 4L1BA 3TQYA 2ZJPA 1LTLA 3K5NA 3MHZA 1F2ZA 4X3SA 3SEBA 2JF5A 3AFQA 2F1MA 4E71A 1IL8A 3SFEB 1YNJC 1GO3E 4YWKA 3R66C 5DAUA 4WQOB 2MQHA 1VQNA 2ALYB 2MCNB 2KHIA 2R7ZG 1E90A 3CF6E 1BF4A 2O6VA 1STNA 1E0BA 2MP1A 4DV5L 4C3IB 4XTCS 1WR1A 4DR2Q 1V1QA 4XT3B 2NUCA 2RSNA 3JW0X 2XN9C 3TIXA 4NMZA 2P5ZX 2G9DA 5DPWA 3I90A 3I3TB 4TRDA 3MXUA 1V6EA 5DM73 1YQ3B 4FA6A 4JI0L 3G6JB 3PIP3 4JCVE 5IT9E 2PQAA 1LTBD 4FJVB 3U4ZA 4E74A 2NVQH 1X56A 3RLOA 3HOUH 1T0QC 3I9V1 4KSLC 3WIMA 4E3CA 1EEID 3PTFC 2JEBI 2ON8A 1OXXK 4RM9A 4A3EH 2ZNVB 3RD4A 2HDEA 1SE3A 4BY7H 4A8XC 1AE3A 1ZXHA 1IBKQ 3HOZG 3FC4A 3M3YB 1K8MA 3VR5A 4ZKBB 4K8IA 2YU9H 1VQGA 3IAYA 1FJGL 1G91A 1N36L 3B08A 3KWLA 5CHWA 4L63B 2RVLA 4ZK9B 4YTMB 4XWWA 3DUZA 1M4VA 5E3FA 4GKJQ 2A73B 1T3QA 2WKDA 2K9XA 1PTOD 1J5EL 1SYDA 4LFAL 3E56A 3ZYYX 4XQNA 3MP9A 2XK5A 5BMGA 3Q14C 2K50A 2K6DB 2R3ZA 3VA7A 1CQFA 4AIMA 3MA2B 1QCBD 1H9JA 1X3PA 2PMZB 2Z4HA 2B8FA 3K6OA 5C5MA 1Z5SB 3OW2A 3VYSA 3SU8X 1B9MA 4AUQC 3HP3A 1HNXQ 3HOZH 2DAJA 3U8ZA 4YIJA 2N7JA 1BR9A 3A55A 1B4OA 3D31A 3S15H 1WSPA 4KD4A 3SK6A 4IO9A 4K0KL 1U4LA 4X66Q 2L15A 2AEHA 2F52A 3JAML 1WXVA 3VA5A 2LI5A 1VQ8A 3WALA 2VXWA 5IP7H 1IL2A 1E7ZA 1FXAA 2J0MA 4W9CA 1HNZQ 3TP6A 2WDVB 1V80A 4DV4L 2BGFA 1BUVT 5M9OA 1H95A 5CBEE 4UDUC 4CJ1B 5KNDA 3WAMA 2F0EA 3AE6B 1C9FA 2CWPA 3M4YA 4LJPB 1GUGA 3ABVB 1RD9D 3PUWA 3F8TA 3AEAB 3L0WB 1S72A 2NVXH 2QHOA 5M3FH 5A2QE 2UU9Q 5CX3A 4PYUA 5L83A 2Q8IB 2EJMA 1KLVA 2E2DC 3NP8A 1ZXTA 3KDFA 3NWSA 2KWDA 2M4NA 3UDGA 4XDDA 1MSHA 4IPGA 1EWYC 1R4QB 1R9TH 2IX1A 2QMTA 1YHAA 3OMGA 1S3OA 4LF9Q 3D6WA 1Y8PB 3AE7B 2RDFA 1PH7A 2EYHA 3DHHC 1CKMA 1QOHA 2GVBA 1JJCB 1QNUA 3V61A 2XTIA 2NZOA 3DXJC 2BKFA 3MZ5A 2K6AA 3BY4B 2A74C 1C4AA 1T0RC 2AQ3B 3E9IA 2MEKA 2PMVA 2V4IB 2LXKA 4DA2A 1RWSA 3DBLI 2A69D 1W2BA 3H09A 3WOFA 3ULPA 1F52A 3PT2B 1J9OA 5FO8B 3PV1A 5M5YH 4MM3B 3LWUA 3VXWA 3UIOB 4GOCA 1O78A 3OJ4B 4JBMA 2JQOA 2JJQA 3APDA 3WAPA 3K0YA 2FE8A 1WH3A 1HA5A 3RNCC 4EQ5A 2KTRA 1RDPD 1NR4A 1K3RA 3ERQA 2ZW0A 2BS3B 4HDOA 4ZRQA 3OYYA 4NKLA 5GAHC 2Z59B 1EYDA 3N1YC 1A3UA 1OTRB 1EU4A 3PIOA 3AV8A 4MSQB 3VDYA 3AH7A 3UE0A 4X66L 2HIVA 2OHFA 4AJWA 4KKSA 2CHBD 4N9F4 3SDLC 1WXMA 2N9LA 3J81c 4B3TQ 2ASBA 3QHTA 3KBGA 5TSSA 1W3SA 4K3CA 1VQJA 2JPHA 1ET6A 2J4XA 5GXGB 2WNMA 4A3MG 2N8NA 1CT1D 2K33A 4DHZE 2LMCB 2MP2A 1A2TA 4HIMA 4DU9A 3NEMA 2C5LC 2YTVA 4R4QA 4JI5L 4KI0A 3ZDTA 4F1SA 3QG1A 3AEVA 1WR6E 4LFCQ 4LF5Q 3JSVB 1E8WA 1WJUA 3GTMH 2BYVE 2FNJB 1K8GA 1PGXA 2JYTA 3VR4A 4M8MA 2GBNA 3J7YW 4FP5D 2O5IC 3RZWC 2HD3A 4JI3L 4DV1L 1QKZA 2E74C 1GXDC 4WJOA 2KHWB 3UQAA 2EMTA 1H9SB 1ENCA 3ZNGC 2MBQA 4US8A 1XO3A 3F2CA 2ZNVC 4A3MB 1R7SA 3FILA 4G50A 4A3JB 1XTCD 2F3IA 1TY0A 2KVZA 5BMHA 1GUOA 1L5PA 3M85A 3D0FA 2R92B 1ICFB 5J39A 1YIJA 1IBKL 2EMSA 2LJIA 4ITKA 3VR8B 2Z0SA 2JA8G 2C35B 1WF9A 4BKSA 2KJ6A 2O6VB 4EUTA 4W9FA 1FMAD 1MJEA 1BMLC 3I72A 3PHWB 4Y7NH 3PIPA 4ZRZA 2D3BA 4C7YA 1SMYD 3BYYB 3W2DA 4JI7L 2XEWA 3CCEA 4AYBE 2PYKA 3W1SA 3RZDB 4P75A 4RHRA 1K8AC 2ZM6Q 3AU5A 1HEZE 2B2TC 5E4WC 3HZXA 3PV0A 2N9EB 2A6HC 2E5LQ 2JP1A 3EFUA 1Z47A 1ESFA 1VQ6A 4NPSA 2Q5WD 3Q3OC 2HQLA 3RNEC 3G4SA 2X38A 4IM0A 4GOPB 5J18A 2GA4B 1J8IA 4A3LH 1MPEA 5CMDA 1JR0D 4JI2L 3R3OA 2R7DA 4DR3L 2KWCA 1UWXA 1X55A 4DK3C 4B3RL 1YHBA 5JJIA 1UUPA 4QUCA 4NJ7A 4TV3A 4RHSA 3ZTCA 4XT1B 4WURA 4R8IA 4DPGA 2AUKA 3T53B 3J80E 2B76B 1TWAB 3NG0A 2NPTB 1QVCA 4GDKB 5CTRC 2HJ1A 2IX3A 4FJYA 2MBOA 1DOXA 2MJ8A 4EZKA 4QUFA 4EGVA 3NUHB 2BDOA 2JT4B 4LNNA 1E1TA 2KLCA 5C4JH 3PO2G 4MT5A 5M5WB 1CZGA 1Z9FA 2C7HA 3R2TA 1Z2MA 1FXTB 3T1HL 3BG3A 1JOKA 1UF0A 2PE9A 1MG4A 2NBWB 3A8KE 5FK9C 4DNRB 1U4PA 4Q5VA 4BBNC 2RBMA 2HJ8A 1K83B 2FJ2A 4PS8A 3GTQH 2MJ3A 4BAXA 2UUAQ 2VUMH 4RGTA 5JZEB 3RULA 2WV6D 2SEBD 3T1HQ 2J52A 3IFWB 4OWXB 2D3CA 3Q2AC 4KHZA 2B29A 2KEDA 2OTJA 2F03A 2Z1CA 3C8YA 1DCZA 1KLUD 2AWOA 3ND9A 3TEHB 2MFIA 1KAWA 2E8GA 3VR6A 4V190 1XNQL 1AH9A 2CHXA 2KFKA 3W5UB 5IKCM 1K3BC 3J7A5 4POFA 5IGDA 3URYA 1I6VC 1LV9A 2X69A 5ELCA 5LMNW 2KC1A 4JC0A 1BBWA 2WINB 4DV5Q 2PKOA 5M5XH 1RTOA 3PO3G 2KDIA 1I6HB 3B2FA 4YSYB 2JA7G 2CJNA 4IG7B 2B2UA 4QB4A 1XLOA 4HJKA 1HPCA 5LMUQ 4A55A 5IGCA 1J7AA 3HK0A 3U7DA 2IJ0A 1WGHA 1R4PB 1B1ZA 4RKBA 1IYFA 4PMWA 5DPRA 2X6LA 1STAA 5ELEA 3D6CA 3H9DA 3NS8A 4JI2Q 2OEDA 1BCPF 1A63A 1SIJA 2TSSA 2YYZA 3ONAB 1SGHA 3JVZX 3OIQA 1S5CD 2XIWA 4X65Q 3DBRI 3T1YQ 2KDFB 2RPVA 1PV4A 3HM3A 4I7AA 2UYZB 3HOZB 1K53A 4IW0A 5JVG3 1CHPD 3UDXA 1LTTD 3K7AH 1Q90A 4DV0Q 1V9JA 5AFWA 1CKNA 2Z6KC 1EFID 1WTHA 1CJEA 1LGRA 2LWPA 4FYDA 3ZIMA 3SD5A 4P6VF 4KX6B 2HT1A 5LHY1 3ER0A 1V2YA 5J3BA 4MNOA 4MSMB 3NVZA 4OIJA 1EY8A 2WS3B 3VDZA 1ENFA 1A3TA 1E1OA 2ZTDA 2CKHB 2YTXA 1PHJA 5BMIA 2FCMA 1N5XA 1EY5A 5CORA 1QVFA 2K03A 3CRLC 1DOIA 3BU2A 4KY6A 3DBSA 1PTOF 4ME3A 2K5DA 4DF7A 3NTKA 1C3TA 3M95A 1L1OB 1EZ8A 4C3IG 3Q3JA 2BBCA 1LACA 5T8IA 5D14A 1YEZA 5KRUA 2DBYA 2R7ZB 2KQ7A 3NJTA 4DDID 3HKSA 1Z6HA 3RLNA 5C6AA 2WU2B 3AEDB 4IURA 3AI5A 4K5WA 3V6CB 4YXDB 5BO4B 4BY7B 3AE4B 2D3AA 2K32A 1VMCA 3UI3A 3I2ZA 1T6BX 4H2AA 5FO9B 2LRUA 2RCFA 4B9XA 1FXIA 3U52E 1V97A 1FPYA 2PVOD 2F0JA 2PQEA 4OEMB 4BOSC 2BOSA 1XD3B 1F2YA 4WORA 1BQQT 1XJVA 1I42A 2DWQA 3I4NG 5E6OA 1IZ6A 3TP8A 3ICEA 1N60A 4JG2A 2ZXRA 3L0OA 1I94L 2L3ZA 2A6EC 3RI7C 1VZ6A 1E2ZA 1X3QA 2REXA 2RSUA 2LFNA 2G5DA 1XMQL 4HMIA 4HCPB 4LNQA 5GADC 3TEWA 3AM9A 5GROA 1WTQA 3CU7A 1KABA 4PMBA 3Q3NC 1I50B 1JRPA 3QIJA 1A5RA 1GNUA 2E75C 2WXLA 1QB5D 1N34Q 3ALBA 4ZYNA 2BH2A 2PMZE 1HNWQ 3PZ8A 4HTHA 3I63C 1FR3A 4YHHL 2JZ3B 4DV0L 2L00B 4ICVA 5NUCA 3A9KA 2M8SA 1QNKA 2WAQG 4DR1L 3BYTB 4RA8A 4B95A 1X54A 2F3VA 2F0VA 2RKSA 3FDTA 5AEKB 4YWGG 1SAPA 2IY0B 3WWVA 3U7ZA 1II3A 1MHWC 1ONLA 3NVVA 5JJZA 4RG1A 1P7FA 2WXRA 4LDTB 4X62L 4LNOA 3A74A 3VYUA 4IOCA 2XWJB 1XTDA 4LMQD 2JA5G 4S0RA 5JEAJ 1L0XB 4RGMA 4B9WA 4F8MA 2F0FA 4LF6Q 3GTKB 3VYTA 1YN3A 4WRDA 1WTVA 4V0BA 1K0SA 2MHJA 1YITA 3ZJTA 3UDFA 4A3KH 2AL6A 4HPPA 3DWQA 3HKZG 4KD3A 1SYFA 3NENA 4AJYB 1ZP0B 4F88A 4P74A 2CQAA 3QCAA 3X3NA 1UGJA 4IM3A 1FEHA 5C0XI 4MHEA 2A69C 4XDXA 4UP9A 3WOEA 3O65B 3U2SC 3UIPB 1CKNB 2M0XA 5LXHA 4J3OD 3S17B 4B3MQ 1VJKA 3JAME 2GBKA 2YEPB 4YTPB 5FLXE 3DM1A 3EHVA 1RHPA 3S1QH 3GS2A 4PV1C 4CYEA 1B8AA 4HR7B 3U58A 4N8FA 1FNUA 5C5LA 1UEAB 3OTOL 3RNGC 4FO2A 1ZKHA 2O2VA 4JPSA 2LXAA 1KDBA 1Q8KA 4AP4C 3Q6SA 4HCEA 1OEYA 1WGGA 2F0OA 2CJOA 2SOBA 1P8LA 1UE7A 1STEA 1PYSB 4B3RQ 4KY5A 5EGTA 1SSOA 2KACA 1EYGA 2I0QA 3M62B 1MG8A 3ZQ4A 1FRRA 1RTNA 1U4RA 2L32A 5KIXA 2WHIA 4URKA 2CU3A 4DV7Q 3K7UC 1K73C 4B08A 3I4MG 2F0TA 4G7ZC 3L2PA 2KBNA 4LF8Q 4HN7A 1HZBA 5JJLA 2K8BA 2PIAA 4C4VA 3TP5A 2I07B 4XX5A 2KWUB 2EKEC 3QB3A 3CQZH 2F0QA 3VUXA 2LRWA 1STGA 1ZGUB 2W55A 2JN4A 3JC66 2E5LL 2KX0A 1O7ZA 4X64L 4YL8A 2B2WA 4UHVA 2PZUA 1IGCA 1C77A 2Z0EB 1KL9A 2BW2A 3CW2C 2R7ZH 4J15A 1E2WA 2BB5A 2WXGA 1X3EA 2DX5B 3F2BA 2Q2IA 2NMQA 1TS5A 1C78A 4AWJA 2Q8TA 1FNWA 4GB9A 3CMEA 1K83H 2B63G 4HPLB 3A9JA 4DV6Q 5IE8A 4GSWA 2LXCA 2N7EA 1UBIA 2IZVB 5HGQA 4R9WA 2R93B 2VZKD 2N0SB 3PSEB 2XNAC 2GVAA 5IGFA 1EY9A 1D5XC 1M90C 4A3GG 2KQ4X 3ZW3A 2BA1A 4JBWA 4W9KA 4IPHA 1XPOA 3BWUD 1KNEA 1QOAA 2K8CA 5FR3A 4JI1Q 2BS4B 1PDXA 4HDQA 3RLFA 3AYHB 1ILPA 2NZHA 3PUYA 2M2LA 1Y1WG 1IBXA 2IW3A 5ISRA 1KNAA 4LFAQ 1E8XA 2N9KA 2HHHL 3I5JC 1YQBA 1O7LA 4P7IA 4P73A 2VB2X 3M7NA 2MO1A 4C3JG 3V2TA 1QOGA 2C9WB 1I4HA 3HOWH 1LTGD 4IFDJ 2EJFC 3J9CA 4DR4L 1V8QA 2L83A 1FFVA 5I6WA 4R4OA 2KCMA 1IBML 1A70A 3NWTA 2NN6G 1B9NA 2INDC 4DR4Q 5G5GA 2K3UA 2JZZA 2QC8A 1N6ZA 2V4LA 3A7LA 4GOPA 3NRZA 4KKJA 2G4DB 4IDIA 3KF8A 5ELFA 4JI6L 3EFXD 1SNDA 5M5XB 4OX9Q 3H1UA 2KMAA 4ID6A 4MACA 3OW7A 4BBSH 4JOIA 3F2DA 3CRKC 1HTOA 3ETRA 4XWTA 3AN1A 3A54A 1I4XA 3SVMA 2SAKA 1SFOB 4MJSB 4PS7A 4Z9CB 4QAYA 3P1HA 1MHXA 1FM0D 4HK2A 4BBRB 3S1RH 1U4MA 2C5CA 4DR2L 2EPBA 3BDLA 2BYTA 2V1CC 4DKAC 2PE6B 3QX1A 2VUMB 1V5TA 3GTQB 1TT2A 3KYHC 2WYQA 1RIPA 1JC7A 5LL6S 3PIO3 4D2KA 1KHIA 2D10A 2ZPNA 2MP2B 4DHJB 1VCBA 1P3QU 3MC8A 2AL3A 3MXPA 4A3MH 3VTVA 2FCNA 4L6TB 5M5WH 2F0MA 4GN3B 3LXFA 1RM6C 3PRMB 1HFNA 2JX5A 1TGZB 1KIXA 2C60A 4ZRKA 3CCMA 1H9SA 2WU5B 3VRBB 1Q46A 4TKOB 4C7ZA 3T3NA 5E1FA 4C56C 2MLBA 5HKHA 2RHQB 2E2HB 1SIFA 3N52A 5C44H 4HJ5A 2H4OA 4L5QA 5C0XH 5EPLA 1YJWA 1TKGA 2ID0A 1S5DD 2IT1A 5AZFA 3NXWA 3VQIA 1PZKD 2QCZA 4DK5A 2LMCA 2B3GA 2ZW1A 2DJFC 2KECA 1C7YA 2A6HD 5IOIA 1F2RI 5DLQE 3STBC 2K6QA 1A2UA 3ZVVA 5E7NA 4C00A 4LF7L 3M4PA 5IT9c 3D4RA 2EXZA 5EBCA 4LF9L 4C3HH 5EPKA 4DWFA 3NZUA 4FJZA 3LGJA 2MWSB 1PH2A 1LTSD 3JAMc 5C44B 5MPOA 2E2HH 3Q22A 1EY7A 2M9VA 2QJLA 1PXUA 2N4FA 4A3PA 3NQIA 4GLAC 1WI0A 3ZXRA 2EYLA 4JI8Q 4OWWB 2MO0A 1TS2A 2OT2A 2JA6G 2JA9A 1WFQA 2L55A 1GUWA 3ONSA 3H15A 1ZEQX 4NXNL 3B6YA 2UXDQ 3FPUB 4O0AA 3ZKJC 4NNJB 1HA6A 5KEEA 4NW2A 3CD6A 2A5UA 3MC0B 3VYRA 3NY5A 1O80A 4OZAA 4YSXB 4XYCA 3RCZA 3TBIB 3KDFB 1T5EA 2DYBA 2N49A 4C80A 1WX7A 3NSWA 4Q0FA 3OOCA 2WDRB 3ZNZB 5BR8L 5LL6X 3D3RA 1UH6A 2G45B 2HCCA 2PNHA 4KN4C 4M8NA 3M4QA 4BOZB 4PZ6A 1L0YB 3KK7A 4C3HG 3I70A 4ZUJA 4JI6Q 3CAMA 1NEKB 2QA4A 3QO2A 4A3JH 1KXLA 1V5OA 3ERSX 3DBHB 4TMAB 4H7BA 1JWAD 4MIUA 4XGAB 2LHDA 4RFBA 2BS2B 4G11A 4ARIA 5BN4A 4XYQA 2F0GA 4CQNA 4YHHQ 2N1WA 2VB3X 4JVZA 2BWES 4IKGA 1S4ZA 5JJKA 1N34L 1LYLA 1MHHE 4A75A 1E24A 2EY2A 4FF4A 3HVZA 1BDOA 1QUQB 2EYFA 4EQPA 3CC7A 5LNK1 1FD7D 3W9CB 3FAHA 2KVMA 4A4IA 4EQOA 2JUOA 3JAMi 3ENEA 1NDDA 2LUEA 4JL9A 3AU7A 3HGBA 4I65A 1FIQA 1PUTA 2N9XA 3H7SA 1JROA 3H8HA 4PS3A 4DV3Q 4IPCA 3ZNID 4HCSA 1RKNA 2DHZA 1I4PA 1F1HA 1WGDA 1STHA 2EZVA 5GAEC 1OGWA 1T0SC 2INPE 3T16A 1OQRA 3I4MH 3R93A 4KGRA 3BINA 4DV2L 2BPSA 5EE3A 5EDSA 5CR3A 4JI4Q 2J53A 1L6UA 5FJ8H 2SNSA 2INCC 2HQEA 4O1NA 3A1QB 3KF6A 4OL7A 4AYBG 4U68A 4DUYQ 4DUZL 3CC4A 1PH6A 5M5YB 5FLMG 4DR5Q 2XK5B 4F7ZA 5DPSA 3FRPB 2NBUA 1GUNA 4LUVA 1XWEA 4WWOA 4X3TA 2WACA 4DXGA 3A5UA 4ZQ3A 4ZOHC 3QWZB 4OONA 2J0KA 2IX0A 1F2MA 3CKIB 3FKIG 3L16A 1V86A 2ZTEA 5L95C 1NBWA 1PZID 2LY7A 1HZ6A 1WJJA 3QOJA 3J81L 3MJ5A 1FD6A 3MAQA 4WJ4A 1FFUA 2F4VL 4REZA 3FP9A 1R9TB 4K14A 1EWCA 2IHFA 2R7FA 3TP7A 4GLXA 5BYRA 3D4DA 2OEOA 3AQQA 4IUTA 5CV5A 5H1SE 2KC2A 2MQJA 1L2NA 1XXGA 2Q2HA 4A3EB 4OZCA 5C3WA 5IGGA 4JI4L 1DXMA 2MHVA 1F2RC 2CR5A 2D3GA 1CSPA 3HOXG 2B2VA 5IP9G 4G7HC 2C9OA 3X23A 2JXMB 4DR7L 4P1CC 4WAAA 1LT6D 1WJ4A 3RN9C 2JU6X 1GUSA 1HUMA 3J7ZC 1WRDB 3GV6A 4RF1A 4BA1I 1BBXC 1JB7A 4LFBQ 3Q3MC 1I5FA 1GPXA 3MWYW 3LJ3A 1N8RC 1XLPA 5LLIA 1RF2D 2LFIA 1YNJD 1WXQA 2QIEB 3Q24A 5LMUL 4MTKA 1KRHA 3U50C 3HG9A 4MGZE 3HOWB 1TWGB 1WTOA 2NVYB 4A3FG 1K9MC 1WXAA 2MRPA 4HEA1 3RMKC 1ZE3D 5DEHA 3H0GH 3I91A 1F2LA 1Y8NB 2LGIA 5IYDH 4GMVA 1B50A 4W9IA 1MIUA 3VVWB 4A3BB 1HZ5A 4NAWB 3PCOB 4OGQC 1P1AA 2F0HA 1TS3A 2DYOA 3P42A 3CCQA 1AZQA 2PW5A 3W1SC 1XT9B 1CI3M 2QILA 3GOEA 1E8ZA 3KQ4A 1TKWB 2I2YA 4OIKA 1T9HA 1PGBA 4P1BC 4A3KB 4NXMQ 1VD2A 1SNCA 2KJRA 5IWAL 1VQKA 1QZEA 1LT3D 3WDNA 4GGQA 2VQEL 1PYWD 1OFFA 3PF4A 5LXIB 2KD0A 1I4GA 3G7LA 1IYJB 4UAIA 3ULJA 2JA8H 1ESRA 2PEAA 3DBLB 1PRTF 2Z6KA 1NUCA 1N62A 1SNPA 1LFDA 1SXTA 2WB1B 2PPBC 4GKKL 1Q0WB 4R3DA 4TUUA 4XZ4A 4W9LA 1OXSC 2ICEC 1SMYC 2YU9B 2J42A 3APFA 4GS3A 5HI1A 3AE3B 3DEOA 1R4MI 2KDMA 1XMQQ 1DOLA 4XXEA 2IO1B 1BOSA 3CCSA 1WTXA 4K81A 5E6JA 3GTPB 3S2HB 3EROA 1PDQA 4HPMB 3R7RA 4G0NB 2WXPA 5IYBG 1VQHA 5D65A 2EYPA 1S5FD 3AE9B 3V62A 2I38A 2F0LA 1ACCA 3IAM1 3K81C 5LMNL 1A62A 4GIVA 4WIPA 4ANVA 3A5ZB 2KQ3A 4A3IB 2JK8A 1RFKA 2UWQA 4H44C 2IHEA 1WMHB 2D5GA 1JMLA 1PFDA 2WKCA 4TVAB 1TR5A 3A8JE 3KLSX 2L0TA 3P4SB 5C4XG 2O6VD 2K5WA 4A3IH 4HMJA 1ASZA 1TYGB 2UXBL 4JYAQ 4HKQA 1WRIA 4APVA 3MXNB 3S1QB 2NTSA 4JWUC 2DUDA 1EO6A 4N58A 2DZIA 3Q8DA 2DJGC 4L23A 1G51A 4ZRJA 2F4IA 1CA6A 4OO1G 2VY3A 1FO4A 5CYUA 4R4TA 2VW9A 4LUOA 2JZPA 5IIFA 1TWFB 2V3PA 4CHKA 1T5XD 4C2MB 3M4OH 1B7YB 3KW5B 3KJOA 3P1MA 3RUIB 5C3XA 2BWFA 1QG7A 4LFCL 4KDIC 3RUZA 1TWHB 2IDYA 1VLBA 2RGFA 3KF6B 3DWAA 1VDZA 4E6IA 1PFNA 5J2RA 2KWVB 1IW7C 1TWHH 2KO3A 4TKNA 3E9SA 3VR3A 1JJ2A 1GG3A 1PRTB 3BDCA 2BCOA 2V0GA 3HOUG 2KK8A 1QZGA 2V9HA 3K58A 3NHHA 3GO5A 5I2XA 2E2JB 3J80i 1GJXA 5J22A 1WZ3A 4LF6L 1J0GA 3K7AB 3EQLC 1P16A 4MH0E 1NAPA 4MGKE 4JI5Q 4BY1G 4WJQA 4K6DA 3H0GB 1QOFA 1E22A 3D8GA 4AH6A 1ZOYB 3V3XA 1X9NA 3GTOH 2ZZPB 1SB3C 2YV5A 3PPAA 3K5MA 4KMUC 3PGZA 5KGUA 4EX5A 1N33L 5EQ0A 1F0ZA 3ND8A 5CV6A 5TR5A 1GOZA 1IBMQ 4A93B 4CBVA 4HAEA 1MGSA 3V6EB 1D1KA 3J80L 5J1ZA 1HXYD 2KHJA 4FXGC 4J8QA 4JX1C 4MH8A 2PI2E 5JEAH 2K04A 1X3GA 1HZAA 4KY7A 1Q10A 1E8YA 1I4RA 2B2YC 3GV3A 2A68C 5E6NA 2F0NA 2GN5A 2LGXA 2RF4A 2OWOA 2VZKB 3G48A 2CH4A 4JI1L 5CHVC 4HSPA 4OW0A 2IO2B 2L0FA 1LTRD 3CMMB 3K5OA 4WJWA 4I6LB 2GLSA 4BKSD 1HFGA 1BUIC 2ZVOA 4KHPL 3L08A 2E6XA 1S1QB 1RL2A 1N61A 3EIVA 2ZJRA 4B0MA 2HHHQ 2K5HA 3CSTA 4LF4Q 3SHQA 1E10A 3GP7A 2WDQB 2AQ1B 3L7ZC 5F2DA 4ZKCB 1YI2A 2KTFA 4DR6L 3MEFA 4MZ9A 4DV4Q 1Q5WB 4ASWC 5D3IB 1J19A 4C1NK 2CHZA 4PZ8A 2K5QA 1E7UA 2WXKA 4NAWA 1V1PA 5C4HA 2G9HD 2O5JC 2KOLA 2UU9L 2BYEA 3KUZA 5IODA 2H1EA 2MUYA 3FPPA 5GQOA 2GBJA 3VTWA 4YWLA 4A3BH 1CZWA 3S14B 3GZNB 1SROA 3PO3H 3H3VC 2XRSD 1WZ0A 2NBVB 3TEXA 2BH8A 5FO7B 4DAPA 1QZHA 1SSNA 1YHQA 1HQRD 3VRAB 4ICUA 5M3MG 3C1EA 4LWCA 1B70B 2EY6A 2M00A 2N78A 4JV5Q 1EUVB 3A9KB 1Y1VG 2PW9A 3DBHI 4NZLB 5G2NA 5LMNQ 1VQEA 1QOBA 1E5WA 1A8VA 2EELA 2KT7A 2WDTB 4LF4L 3MFYA 3J81j 2Z8LA 1SMXA 4JLCA 4K2LA 1YX6B 2IGHA 2K1BA 4A3GH 1SE9A 1HR0L 1PFBA 2MPMA 4CHTB 2KFJA 3KWVA 3N30A 2UUBQ 4KV2A 4S17A 2J7ZA 3DOWA 3BDOA 4HVBA 3T3OA 1GJZA 3R2IA 2BE5C 3H91A 1YNNC 3GB1A 4KIKA 4HWIB 1JOOA 1G6ZA 2DENB 2UUCL 1B53A 1SEBD 2AWTA 3BK1A 3H7PA 3W5OA 1GM5A 4KKTA 2QEXA 3Q8FA 4KGTA 2K1FA 2CVRA 1I3QH 2BDNA 1XQQA 3IBEA 3UDIA 4FF2A 3L13A 1OXVA 3DVGX 2FCQA 1STBA 1CHQD 1ZYRD 1CUKA 1KJTA 2KNBA 4KV6A 5JXVA 2HDMA 1UELA 2R92H 4ANWA 2KCNA 4CDEC 2G1EA 3N1ZC 4IUVA 3J81i 2E2IB 2FINB 4IOAA 2JYEA 3T56B 3MTSA 4FADA 3CCUA 4OVVA 3KLSA 2RPQA 4USAA 3DDCB 4K7WA 1D8LA 1LTAD 4P71A 3HOVH 4A3DG 1N33Q 3VH4B 3VUWA 2Z9HA 3CWIA 4QY7A 1WYDA 2Y0SG 2A1AA 3I56A 5FLXc 1WCMG 2ZT9C 1ILQA 1XX8A 1VMPA 5KNCA 1D6EC 2XVSA 2KDBA 1PLFA 1GD7A 2JSVX 2Z0DB 4JI0Q 3E9HA 4CDCC 3SGIA 1PMRA 1GB4A 3DPDA 1ICWA 1D1IA 4LFBL 1GHKA 3V05A 4QQBX 3I4OA 5C3EG 2F0DA 4ANXA 2ATWA 3HKZE 1HJPA 3A8IE 4XIGS 4HXDA 3U9OA 1UNSA 1DOKA 1QWYA 1UE5A 1Q82C 3QIAA 2WIIB 1I94Q 3ML8A 1LM0A 1RLFA 4GDKA 1Y56A 4RMAA 3CCRA 5K36G 1WOCA 3AE8B 3EN2A 2F0WA 3DLLA 1HR0W 4GNXA 3R8BA 3HOVG 4A3DH 1YIWA 1X3FA 1PH9A 4A3OA 1C48A 1EUJA 1P7EA 4HEDA 2IO0B 4DR3Q 3MXNA 1NTGA 2DNCA 3RZDH 3V60A 3HRDD 3IVFA 3CCLA 1SNQA 1JQYD 1NY4A 4DAVA 2JEAI 3HOVB 3C0RB 4K7UA 3PSIA 4YTNB 4P2CB 5IA7A 5T1IA 3NS1A 1FVIA 4IZ8A 3UGBB 2HTME 3A33B 4A90A 1RFAA 5CHFA 2RCNA 4A76A 2WFWA 1LUZA 2WXIA 2E2IH 5EE0A 2WXMA 2KJXA 1WMHA 4J6IA 5AJ3Q 1TT5B 2VRRB 2B8GA 1ASYA 4O42A 3PLUA 2A5HA 4DV3L 2EYJA 3T9LA 1YZ6A 1ZKOA 3OSOA 4BBRH 2Y5BB 3OPOA 4C4VB 1L6VA 4ABNA 3OG5A 1ML0D 3CSFA 1UD7A 4F87A 2FUHB 1NR2A 1Y1WH 1WCMB 3LNNA 4HIOA 5C1ZA 3HOYG 4GU2A 4Q2JA 1IP9A 2LGDA 3LB8C 4BBSB 1L4ZB 4N59A 2Y0SB 2HUGA 3OLMD 1ET9A 1LLRD 3I8ZA 4PNYA 5M3FB 1K50A 1N5WA 1YJJA 4LDTD 4OZBA 3W1YA 3ZUNA 4PG3A 1OQQA 4ZRPA 3T1YL 4MEMA 1HCZA 5FLMH 1EQVA 4R4CA 4JE3B 1B9RA 1KDAA 4X57B 4NDXA 1H9RA 1I35A 5JPMC 1KRTA 2QDBA 1KFYB 4ALPA 2MA9B 3PZ7A 4DV1Q 4JI3Q 1K52A 4PMCA 3DBRB 2ZCBA 3N9YC 5C23A 4NQKE 3Q8BA 4LJOB 1JWBD 4G57A 1KDCA 3D4WA 4ILWA 3PZDA 1UE6A 2W3SA 3AECB 3N3KB 3QAQA 4GLVB 1JWUD 4K8JA 3S14H 3WA0A 4KLKA 4ODGA 4GLSC 3AFPA 2YTYA 5ELNA 5D6JB 3R7QA 1P0RA 3AE1B 1XPUA 2LGSA 1MFWA 4US9A 1PH4A 4CKBA 1XPRA 1B3AA 1E0ZA 4BVUC 1G2SA 1VQMA 1CSQA 1Q86C 1C8CA 2CKZB 2KCTA 2PNRC 3CC2A 3RN5A 2AHOB 2GBMA 5AZGA 2E3TA 2IBIB 3X0WA 1F9RA 4ZUIA 4K5VA 1IBLL 5CBAE 3H94A 4DK6C 1AYFA 2DLBA 3S1RB 1ISNA 2QDLA 1VZ7A 1V81A 1MI2A 1QF6A 4WFN3 3B9JA 1PA6A 3M3YH 4BA2I 2A19A 1WJ6A 3BS1A 3H6MA 4KK7A 3EECA 2WAQE 4KIKB 1XF5L 3HHMA 3PGEA 4IC7B 3NVWA 1PYBA 2EYOA 2D62A 4QL5A 5G3LD 1NI2A 3EGRA 1V43A 3FILB 1VQDA 4DGZA 1WVLA 1JORA 2RHSB 2JRIB 3SR6A 4YWMA 2NVXB 1DONA 1RYJA 2QEJC 4B9KA 2ZXOA 4BWGB 2WQYB 2I1KA 3S2DB 1EZ6A 4N9TA 1B44D 2FFKB 1VDVA 4YCVA 1PH8A 2ES2A 4A93H 2L4NA 1BCPC 2DNFA 3E0EA 1HZCA 2RD0A 5J17A 4DXAB 1U0LA 4MJSA 4KJNA 3GQBA 1YNXA 2L9HA 5EKKA 2UU7A 2JWUA 1QQRA 3DVGY 3UI2A 3G71A 3C2PA 1HHVA 1OEYJ 3P75A 2D11A 3HUIA 4WJ3M 4L5TA 1HR0Q 4MGIE 3L9AX 5A2QL 2J7QB 4H02A 2MGSA 1A15A 1VQIA 5M3FG 1TIFA 2M56B 2EXDA 1WIAA 2WGSA 1UAPA 4FXCA 1IYUA 4BBSG 4QMGA 1WWTA 2IGDA 1SNOA 3FHWA 3HOYB 3VAWA 1YVCA 4KHVA 4DAMA 2K8HA 4RF0A 2KANA 3TZUA 2F4VQ 3EVQA 3RMHA 3W5VB 1PH3A 2RR9A 1S40A 2JYOA 1L7YA 2L0CA 3QR8A 4GNXB 1OTCA 3L4PA 2I1JA 1NMGA 1JW9D 4W9DA 2D0OA 4MTNA 1ZYRC 1XYIA 3BZCA 1JT8A 2MJEA 3AULA 4QIWE 3KLRA 4A93G 5D7GA 1RRBA 3K9OB 2MJDA 2DY8A 3GTLH 4JWSC 4DQOC 1HH2P 2R93H 1DZ1A 1WE7A 2VS1A 5BYQA 1SYCA 2ENBA 3IFDA 2D07B 2FAZA 1WY8A 2ZM6L 5AUIA 2B39A 3OWFA 4NY0A 2E76C 3RFZB 2W3RA 1XLNA 3L54A 3OAWA 1D3ZA 1IGDA 3QK0A 3H0GG 2AUJD 2CW0D 5EKLA 3TSSA 1J7CA 2G4SA 4BY1B 4IWQA 3I4LA 1WYGA 2WP9B 1WGYA 3BJUA 2DZKA 3OIPA 4GNXC 4EOYA 1DD2A 2LVOA 1WCMH 3I55A 3IFTA 4GKJL 1XNRQ 1HUNA 1GAQB 2ASQA 5DNFA 1TKYA 4P16A 4HKZE 1VQPA 1EQQA 1BVSA 1YJ1A 4DAYA 1N36Q 3HOUB 4WWPA 4ZAIA 1I50H 4A6QA 4DDGD 1KOTA 2EKIA 1HZ9A 4ZLTF 4PK1A 1D2BA 5IYCG 1C1YB 4X6AH 1L1OC 1H8CA 2AX5A 3PLVA 4L2YA 5FOBB 5C3EB 3OWEB 2GI9A 1TQOA 4IN3A 1YJIA 3NK9A 1Q81C 1K51A 1EQTA 1MSGA 4B3TL 3I57A 3NTIA 4C3IH 1EFWA 2B3AA 1E6EB 5AZHA 3M63B 2Y5CA 3D32A 5CV9A 4JPBW 2LEKA 4EFOA 3S17H 3ZRFA 5HURA 3ZJYC 4O2DA 1KD1C 3VFKA 3WANA 4IUNA 3KUDB 3GTPH 2ONQA 3QJZA 4KTAA 2RDGA 2LSSA 5FJ8G 2JA6H 2WXFA 4IOIE 5CV4A 3B1LX 1VZ8A 3KOJA 4WQMA 3TBLD 3HVDA 1D5MC 4A3DB 4FVMA 1SBBB 2QSDA 4EZJA 3BVZA 1BXTA 3DEPA 2VL6A 5ELBA 1NENB 5C4XB 2L7RA 3VUYA 2K39A 3GTKH 4AQYQ 3CCJA 2JRHA 3BK2A 2EJGC 4MN3A 1E3PA 5IAAC 4OVUA 2A68D 3P4PB 4RM8A 2QF7A 2KENA 3IAS1 3AE2B 4GXBA 5IT9L 3TDQA 1PTOB 2EDGA 2L1AA 4K7SA 3GTGH 2KVRA 5JEAG 4YT0B 2EY1A 3MEHA 5C0XJ 3RNUA 1IKMA 4QJFA 1BBUA 4YY3Q 1WJNA 1MI0A 3AEEB 2K14A 4FXDA 2MBBB 1IYVA 2VQFL 1Q7YC 3A4SC 5IP9H 3EUB2 1EF5A 1WE6A 4OO1H 4GN4B 1OQYA 4NJ6A 3LX0A 4LTUA 2JA7H 3PO0A 2NVYH 2NB0A 4YY3L 5I9OA 2BQQA 4NP5A 5IOCA 4A9AA 2B2TA 3Q23A 1LM8B 1EOTA 1VQ5A 4HIKA 2WB1G 4UY8C 1NYRA 2B2YA 1DOMA 1TWCB 2RSOA 1D7QA 4UP7A 3J7AV 3PRZA 4A3LG 4HIDA 1NBFC 4WH4A 1Y1VB 4B6WA 3TRZA 2WP8J 1NSNS 2KCCA 1H9KA 2XGTA 4FDBA 2AYOB 5M3MB 3Q8CA 2L05A 3T51B 2O4XA 4B3ML 1C4CA 3NZ3A 1BCPB 2MNAA 1R4NB 1KTKA 1FYCA 1Q3LA 3S24A 2IGGA 1I3QB 1EWIA 2EE1A 5CV8A 2LZ6A 1JCKB 4K0KQ 4X62Q 5FR6A 2KA7A 4HJAA 2NTTA 1SYBA 2RDHA 3CXCA 1WTRA 1JRUA 2J0JA 2ACZB 2KMMA 1VQFA 2RMMA 2ZJDA 3Q3FA 1JB3A 4WWNA 3T8MA 2VZAA 3U4VA 2CCZA 5E4XA 4A3BG 2NWGA 1LO5D 4M01A 1EY6A 2LS01 2YVCA 4A3FB 3S16H 2OJWA 3HOWG 3AE5B 3Q6BA 2L1BA 2C7NB 4GDLB 1SDFA 4AQYL 5M3MH 1UGMA 5IP7G 1VQLA 5T1GA 4FLHA 4IJLA 2WXJA 4WJNA 2LJ5A 3NBHA 3ZNHB 5E6PA 1BKBA 3CPFA 2F0PA 5IGEA 3TCAA 4J6HA 4DHZB 1JQ4A 1CA5A 1W6KA 4ZHPA 4RAUC 1SE2A 3Q8EA 1A6XA 1SE8A 1EWHA 4KGSA 1IUEA 2B2VC 5EPJA 1ROEA 1NE3A 3QA8A 3H3VH 2LVPA 2L12A 2I5LX 1AFPA 2NVUI 2EVBA 1J6QA 3HOXB 2D0PA 4LCDE 1YBYA 4A3EG 1G8ZD 4KVGB 4JBJA 5DPTA 2NVTH 1XNRL 4XC2A 3KYCD 3HOXH 3GTGB 4DN4M 1YQ4B 1S3SG 3GE8C 3NHEB 1XEEA 3DQVA 3QOLA 2JSOA 4BKTA 1QVGA 1EY4A 2K5VA 3GZNI 1VF7A 2OXPA 1MBYA 3W1BA 2MW5A 4NJCA 4XDCA 5IO9A 4POGA 1B2TA 4IUUA 4CKEA 3E6ZX 4RCOA 1IHZA 4IM2A 3TS2A 3PHXB 3TZDA 3RR5A 1SJHD 3E5SA 5C4XH 1PGAA 4J1MA 1S5ED 3EFCA 4JYAL 1AW7A 3M9BA 3MHBA 1WX8A 2KTRB 1TBEA 1QE6A 3FEWX 1CQVA 2F3WA 3CMAA 3KVFB 3DWPA 4AYBB 4DFAA 1QT9A 2PVGC 1I6HH 3IKJA 5IYDG 2ZEQA 4DV6L 4W9JA 3ZDMC 2Q2UA 3ZLZA 4IJHA 1C9OA 1TVXA 3CF5A 4NAMA 4FULA 1LQBA 1E7VA 4FF3A 3SDZA 2CWAA
chains in the Genus database with same CATH topology
3SHLA 3IXSA 2D5DA 5FLXL 1G291 2SNMA 3SFDB 5BN3A 2ICIA 4RH6A 4OHJA 2L52A 1XLQA 1FNVA 1L0VB 2H89B 3TMEA 2WXOA 3W3AA 2Y5PA 2K22A 2K05A 2NN6H 1SJED 4IUPA 1HTLD 3M7GA 5K36H 3SXHA 3GTOB 3P63A 1EEFD 3K5LA 2DYMA 1RCVD 2LUMA 1F9QA 4RWSC 3LWEA 3GTMB 4KKIA 4TQ1A 1OXUA 5G3LF 2D2CC 1KF6B 1PTOH 3K57A 3E0JA 2DN8A 3L3OC 4C3HB 1STYA 2NN6I 2WLBA 2VNUD 3A56A 1JALA 3AEFB 3P4QB 5CGKA 2GRIA 2F0IA 3I3CA 3ITPA 3VR9B 2JXTA 4XQQA 1I4QA 1CZPA 2EYMA 3M4OB 3PUZA 5EBDA 2NBFA 4LAAA 3SK5A 1LT5D 1H9MA 2J0TD 2OF1A 2JA6B 5AUKA 1MVKA 2HDLA 4H0LC 3KBXA 4QF4A 3X3MA 3T13A 4Y7NB 2WXHA 3ZGZA 1TZOA 3CHBD 1QILA 3Q0AA 4RNAA 4IFDH 1Q1BA 2PZTA 3OMCA 4XYOA 1Q8IA 2IPKD 1WTPA 1AEXA 4KN7C 2B2WC 4PQXA 3J81E 3VR2A 1GB1A 3GD7A 1AZPA 1S5BD 2CW0C 3BVGA 5FKAC 3S1NB 2V4DA 4EVOA 2N88A 5D3DA 4AS1A 4QCLA 4OO1I 3ZJUA 2K7VA 4FXKC 3AMZA 3NQTA 5KYIA 4IFDG 3MXGA 1D5ZC 1VR9A 1PZJD 1Q12A 2K01A 3DWGC 3I73A 1EY0A 1PRTD 1NVID 3N6RA 3OHXC 1NI3A 4H13C 1TS4A 1TIID 1SF0A 4FNFA 5CV7A 1M8AA 2HCIA 2KN4A 2JE6I 1BNZA 5EE9A 1NYQA 1AP0A 1J7BA 5BYSA 4B0EA 1YNND 1EYCA 1TU2B 3MFGA 4ARCA 2YEPF 3AEGB 4K2KA 1LABA 1RJTA 5DM63 2KHSA 1YN4A 3BVMA 2RA4A 4BS9A 3C3LA 2NZ1D 3NE5B 1VCIA 2R6GA 3FKIB 5EJWA 5HGTA 4IUQA 4ZYSA 5JPNC 1Y69U 1E7PB 1FGBD 4TQ0A 2FMCA 5I4DA 2JQRB 4L8JA 4LJZC 2K0PA 2FMMA 1EIGA 1OXTA 1Y1WB 2F0UA 3P20A 1WGKA 2W82A 4IALA 2LHEA 3WCQA 1PTOC 3NBIA 2V3NA 3QJYA 4HJGE 2WXQA 1YMHE 4WAFA 4DK1A 1YN5A 5COYA 1WD1A 1V8CA 3Q8AA 1U9RA 5H92C 3A7AB 3DWMA 1EYAA 3CIRB 2A6ED 1IKLA 3S15B 3T4AC 3C1FA 1TJEA 1E2VA 1JICA 1O7YA 3NPPA 2O2LD 1SYEA 1F9SA 3HEJA 2F0KA 4HRSA 1DJRD 3EA6A 1WTWA 3I4MB 1C79A 4WWMA 2D9UA 4ULLA 1C4QA 2K5PA 4G4KA 3DMUA 4F7XA 3AMUA 5HHDG 2QCPX 3IT6B 1CFMA 1W6JA 4CKCA 3MVVA 1UWMA 2PZWA 2M0AA 1JWMD 2R61A 3BZDB 3KUPA 3BIID 1VRAB 4N6EB 3LYYA 4HROA 1ENAA 1KH0A 5ELDA 5I9PA 2L5TA 1NCVA 1QLBB 2XRQD 1E9MA 3IT4B 2NVQB 1Q1EA 1F9PA 3SE0A 5IGBA 4LK1C 4RGOS 1FCCC 1VF5C 2JA5B 1DYQA 5C3JB 1ZDVA 1EL0A 1CK1A 4EQNA 2X6GA 3FVQA 2TMPA 4K6LA 2PTLA 3P4RB 4OVZA 3SK8A 3TEZA 3C46A 5JAVA 2WAQB 4RGNA 2BA0A 1GUTA 2Q8RE 4PT5A 1A3VA 4DK0A 5HG2A 2Z4IA 1YNTE 4M0WA 4C1NI 1FRDA 3B2GA 3TUOA 3PUVA 1CTMA 5EKIA 4IFDI 1XCTL 1N63A 1HTPA 5I2YA 2NVTB 2PLPA 5CC4A 1Y8OB 3V96A 1V1PB 3HS0C 5BN5A 1K8OA 1IBXB 3RPFC 3TEYA 5I6YA 3QWNA 2PW7A 3NVYA 1SE4A 1BCPD 4DNTB 4R8NA 2PCFB 1JE4A 1SYGA 4I7ZC 4QIWB 3PMFA 4YSZB 5JOBA 5C4ZA 1C4PA 2EY5A 4XQJA 1V1OA 4C3JB 1AWDA 1ZUD2 3GTJB 2BB6A 2INNE 1DOYA 2FHTA 1X32A 1OO9B 2DNEA 3IL8A 2N55A 4A3GB 5C2TB 2LKVA 1DGJA 4N9PA 4LLGM 4GZYC 4KKUA 1ZPSA 4EE2A 2B63B 2M19A 3S1MB 2WXNA 4HSVA 3F2UA 5C4JB 3J7AF 5H8YE 1HQMC 1IW7D 2JA7B 1EIHA 2I46A 1LTID 3PO3B 2B2UC 3NTHA 1LT4D 4RKLA 4CJ2C 4CJ0B 5JVH3 2RQXA 4TQUS 4JK1C 1XCQL 5G5HA 4X3UA 4ZHOA 1SNMA 4TSSA 1MD2D 3K59A 4ME5A 3O13A 2GB1A 1CM9A 3ZJVA 2Y3AA 4XE0A 5HFYA 4S3SA 3EJIA 3TN2A 4K5XA 4CGYB 3PO2B 2BT6A 3S16B 4DXFA 3AEBB 4RCNA 2ZXPA 2K28A 1EU3A 3FMCA 1F77A 3RZOB 1QJOA 1PRTC 1KAAA 3U9SA 1D4BA 4KJOA 3AB5A 3CQZB 4X3KA 4G7OC 3S9WA 3PUXA 3HKZB 1RODA 2XWBB 4M1UB 2F0SA 2IWHA 3NUCA 5C0XG 4AQ7A 2AWNA 2XSCA 4LK0M 3P7JA 2BE5D 1Z7TA 1C76A 4M8AA 3U4EG 5K5PA 5KNBA 1TY2A 2BTEA 2SDFA 5A35A 1PFMA 2PO4A 2FUG1 2NYZD 1G2TA 1ZDXA 3HRZC 2FBWB 2IL8A 3AB9A 4IQZA 1DM0B 1HRJA 2EOTA 1I7HA 2KEEA 1GHJA 1EM7A 1BO0A 1FCLA 1AN8A 4FF1A 3SK4A 3SR1A 4U673 2AQ2B 2DY7A 2JA8B 5EE1A 2MH7A 3Q69A 3GTLB 1KLGD 1TKEA 3DHQA 2W54A 3I4NB 2L11A 1WD0A 1JOQA 1ZXIA 1JWSD 2KAJA 2KUMA 2QKIC 5KYLA 1L4DB 4L1BA 3K5NA 3MHZA 1F2ZA 4X3SA 3SEBA 2F1MA 1IL8A 3SFEB 1YNJC 5DAUA 1BF4A 1STNA 1E0BA 2MP1A 4C3IB 4XTCS 4XT3B 2NUCA 2RSNA 2XN9C 4NMZA 2G9DA 3I90A 4TRDA 3MXUA 1YQ3B 5DM73 3G6JB 3PIP3 5IT9E 1LTBD 3I9V1 1EEID 2JEBI 2ON8A 1OXXK 3RD4A 2HDEA 1SE3A 4A8XC 1ZXHA 3FC4A 3M3YB 1K8MA 3VR5A 4ZKBB 4K8IA 3IAYA 1G91A 4YTMB 3KWLA 4L63B 2RVLA 4ZK9B 4XWWA 3DUZA 1M4VA 5E3FA 2A73B 1T3QA 2WKDA 2K9XA 1PTOD 1SYDA 3E56A 3ZYYX 4XQNA 3MP9A 5BMGA 2R3ZA 3VA7A 1CQFA 3MA2B 1QCBD 1H9JA 1X3PA 2PMZB 2Z4HA 2B8FA 3K6OA 5C5MA 3VYSA 1B9MA 3HP3A 4YIJA 2N7JA 1BR9A 3A55A 1B4OA 3D31A 1WSPA 4KD4A 3SK6A 1U4LA 3JAML 3VA5A 2VXWA 1FXAA 2WDVB 3TP6A 1BUVT 5M9OA 5CBEE 4UDUC 4CJ1B 5KNDA 2F0EA 3AE6B 1C9FA 3M4YA 1GUGA 3ABVB 1RD9D 3PUWA 3AEAB 5A2QE 2Q8IB 2EJMA 2E2DC 3NP8A 1ZXTA 3NWSA 2KWDA 4XDDA 1MSHA 1EWYC 1R4QB 2IX1A 2QMTA 3OMGA 3D6WA 1Y8PB 3AE7B 2RDFA 2EYHA 1QOHA 1QNUA 3DXJC 3MZ5A 2K6AA 2A74C 1C4AA 2AQ3B 2MEKA 2PMVA 2V4IB 4DA2A 1RWSA 2A69D 3H09A 3WOFA 1J9OA 5FO8B 4MM3B 3LWUA 1O78A 3K0YA 2FE8A 1HA5A 1RDPD 1NR4A 3ERQA 2ZW0A 2BS3B 4ZRQA 4NKLA 1EYDA 1A3UA 1EU4A 3AV8A 3AH7A 2OHFA 4KKSA 2CHBD 2N9LA 3KBGA 5TSSA 1ET6A 2J4XA 5GXGB 2WNMA 1CT1D 2K33A 2LMCB 1A2TA 4DU9A 4KI0A 3QG1A 2JYTA 1PGXA 3VR4A 3J7YW 4FP5D 2O5IC 1QKZA 2E74C 1GXDC 1H9SB 1ENCA 4US8A 1XO3A 4A3MB 1R7SA 3FILA 4A3JB 1XTCD 1TY0A 5BMHA 1GUOA 1L5PA 3M85A 2R92B 2LJIA 5J39A 4ITKA 3VR8B 1FMAD 1BMLC 3I72A 4ZRZA 4C7YA 1SMYD 3BYYB 3W2DA 2PYKA 3W1SA 3RZDB 4RHRA 1HEZE 2B2TC 5E4WC 3HZXA 3PV0A 2A6HC 2JP1A 1Z47A 1ESFA 2Q5WD 2X38A 2GA4B 1J8IA 1MPEA 5CMDA 1JR0D 3R3OA 1UWXA 1UUPA 4QUCA 4RHSA 4XT1B 4WURA 4R8IA 2AUKA 3T53B 3J80E 2B76B 1TWAB 4GDKB 2IX3A 1DOXA 2MJ8A 4QUFA 4EGVA 3NUHB 2BDOA 4MT5A 5M5WB 1CZGA 3R2TA 3BG3A 1JOKA 3A8KE 5FK9C 4DNRB 1U4PA 4Q5VA 2RBMA 1K83B 2FJ2A 2MJ3A 4RGTA 2WV6D 2SEBD 2J52A 4KHZA 2KEDA 2F03A 2Z1CA 3C8YA 1DCZA 1KLUD 2AWOA 3ND9A 3VR6A 4V190 3W5UB 5IGDA 3URYA 1I6VC 1LV9A 2X69A 5ELCA 2WINB 2PKOA 1RTOA 1I6HB 3B2FA 4YSYB 2CJNA 2B2UA 4QB4A 1XLOA 1HPCA 4A55A 5IGCA 1J7AA 2IJ0A 1R4PB 1B1ZA 4RKBA 4PMWA 2X6LA 1STAA 5ELEA 3D6CA 2OEDA 1BCPF 1SIJA 2TSSA 2YYZA 3ONAB 3OIQA 1S5CD 2XIWA 2RPVA 3HOZB 1K53A 5JVG3 1CHPD 1LTTD 1Q90A 5AFWA 1CJEA 1EFID 4FYDA 4P6VF 4KX6B 5LHY1 3NVZA 4OIJA 1EY8A 2WS3B 1ENFA 1A3TA 5BMIA 1N5XA 1EY5A 5CORA 2K03A 3CRLC 1DOIA 4KY6A 1PTOF 2K5DA 4DF7A 3NTKA 1EZ8A 4C3IG 2BBCA 1LACA 5T8IA 5D14A 5KRUA 2DBYA 2R7ZB 1Z6HA 5C6AA 2WU2B 3AEDB 4IURA 4K5WA 4YXDB 4BY7B 3AE4B 2K32A 1VMCA 3UI3A 1T6BX 4H2AA 5FO9B 4B9XA 1FXIA 3U52E 1V97A 2PVOD 2F0JA 2PQEA 2BOSA 1F2YA 4WORA 1BQQT 2DWQA 3TP8A 1N60A 2ZXRA 2A6EC 1VZ6A 1E2ZA 1X3QA 2LFNA 3TEWA 4HMIA 3AM9A 1WTQA 3CU7A 1KABA 4PMBA 1I50B 1JRPA 2E75C 2WXLA 1QB5D 3PZ8A 4HTHA 1FR3A 5NUCA 1QNKA 3BYTB 4RA8A 2F3VA 2F0VA 2RKSA 3FDTA 4YWGG 1SAPA 3U7ZA 1II3A 1ONLA 3NVVA 5JJZA 1P7FA 2WXRA 3VYUA 2XWJB 4LMQD 5JEAJ 1L0XB 4RGMA 4B9WA 4F8MA 2F0FA 3GTKB 3VYTA 1YN3A 4WRDA 1WTVA 4V0BA 3ZJTA 3DWQA 1SYFA 4KD3A 1ZP0B 4F88A 2CQAA 3X3NA 1UGJA 1FEHA 5C0XI 4MHEA 2A69C 4XDXA 3WOEA 3U2SC 4J3OD 3S17B 1VJKA 2YEPB 3JAME 4YTPB 5FLXE 3DM1A 1RHPA 3GS2A 4PV1C 4HR7B 5C5LA 1FNUA 1UEAB 4FO2A 4JPSA 1KDBA 3Q6SA 4HCEA 2F0OA 2CJOA 2SOBA 1STEA 4KY5A 5EGTA 1SSOA 2KACA 3ZQ4A 1FRRA 1RTNA 1U4RA 2L32A 5KIXA 2CU3A 4B08A 2H88B 2F0TA 4G7ZC 2PIAA 4HN7A 3TP5A 2I07B 3QB3A 2F0QA 1STGA 2W55A 1O7ZA 2B2WA 2PZUA 1IGCA 1C77A 2BW2A 2WXGA 1E2WA 2BB5A 2NMQA 1TS5A 1C78A 2Q8TA 1FNWA 2VZKD 4R9WA 2R93B 2N0SB 2XNAC 5IGFA 1EY9A 1D5XC 2KQ4X 2BA1A 4JBWA 3BWUD 1KNEA 1QOAA 5FR3A 2BS4B 1PDXA 3RLFA 1ILPA 3PUYA 2M2LA 1IBXA 2IW3A 5ISRA 1KNAA 2N9KA 1O7LA 3M7NA 2VB2X 4C3JG 3V2TA 1QOGA 1I4HA 1LTGD 4IFDJ 2EJFC 3J9CA 1V8QA 2L83A 1FFVA 5I6WA 1A70A 3NWTA 2NN6G 1B9NA 5G5GA 2K3UA 3A7LA 3NRZA 4KKJA 4IDIA 3KF8A 5ELFA 3EFXD 1SNDA 5M5XB 4ID6A 4MACA 3OW7A 3CRKC 3ETRA 4XWTA 3AN1A 3A54A 1I4XA 3SVMA 2SAKA 1SFOB 4Z9CB 3P1HA 1MHXA 1FM0D 4BBRB 1U4MA 2C5CA 2EPBA 3BDLA 2BYTA 2VUMB 3GTQB 1TT2A 1JC7A 5LL6S 3PIO3 4D2KA 3MXPA 4L6TB 2F0MA 3LXFA 1RM6C 1HFNA 2JX5A 1H9SA 2WU5B 3VRBB 4TKOB 4C7ZA 3T3NA 5E1FA 4C56C 2E2HB 3N52A 2H4OA 5C0XH 5EPLA 1TKGA 2ID0A 1S5DD 2IT1A 3VQIA 3NXWA 1PZKD 2LMCA 2ZW1A 2KECA 2A6HD 1F2RI 1A2UA 3D4RA 2EXZA 5EBCA 5EPKA 1LTSD 5C44B 5MPOA 3Q22A 1EY7A 2M9VA 2QJLA 1PXUA 3NQIA 2EYLA 1TS2A 2OT2A 2L55A 1GUWA 1ZEQX 3FPUB 1HA6A 5KEEA 4NW2A 3MC0B 3VYRA 1O80A 4OZAA 4YSXB 3TBIB 1T5EA 4C80A 3NSWA 4Q0FA 3OOCA 2WDRB 5LL6X 3D3RA 2HCCA 4KN4C 1L0YB 3KK7A 4C3HG 3I70A 4ZUJA 1NEKB 3QO2A 4TMAB 4H7BA 1JWAD 4MIUA 2LHDA 4RFBA 2BS2B 4ARIA 5BN4A 4XYQA 2F0GA 4CQNA 2VB3X 4IKGA 1S4ZA 3HVZA 1MHHE 2EY2A 4FF4A 1BDOA 2EYFA 4EQPA 5LNK1 1FD7D 3W9CB 3FAHA 2KVMA 4EQOA 3AU7A 3HGBA 4I65A 1FIQA 1PUTA 1JROA 3H8HA 4HCSA 1RKNA 1I4PA 1STHA 2EZVA 2INPE 3T16A 1OQRA 3R93A 4KGRA 5EE3A 5CR3A 2J53A 1L6UA 2SNSA 2HQEA 4O1NA 4OL7A 4U68A 5M5YB 3FRPB 1GUNA 1XWEA 4X3TA 2WACA 4DXGA 4ZQ3A 4ZOHC 2IX0A 1F2MA 3CKIB 1PZID 2LY7A 1HZ6A 3QOJA 3MJ5A 3J81L 1FD6A 3MAQA 1FFUA 4REZA 1R9TB 4K14A 1EWCA 3TP7A 5BYRA 3D4DA 2OEOA 4IUTA 5CV5A 1XXGA 4OZCA 4A3EB 5C3WA 5IGGA 1F2RC 1DXMA 2MHVA 2B2VA 4G7HC 2C9OA 2JXMB 1LT6D 2JU6X 1GUSA 1HUMA 3GV6A 4RF1A 4BA1I 1BBXC 1GPXA 3MWYW 1XLPA 1RF2D 2LFIA 1YNJD 1WXQA 2QIEB 3Q24A 1KRHA 3HG9A 3HOWB 1TWGB 1WTOA 2NVYB 4HEA1 1ZE3D 5DEHA 3I91A 2LGIA 1F2LA 1Y8NB 1B50A 4A3BB 1HZ5A 4NAWB 4OGQC 2F0HA 1TS3A 2DYOA 3P42A 1AZQA 2PW5A 1CI3M 2QILA 3KQ4A 2I2YA 1TKWB 4OIKA 1PGBA 4A3KB 1SNCA 1LT3D 3WDNA 1PYWD 1OFFA 1I4GA 3G7LA 4UAIA 1ESRA 1PRTF 1NUCA 1N62A 1SNPA 1SXTA 2WB1B 2PPBC 4R3DA 1OXSC 2ICEC 1SMYC 2YU9B 2J42A 5HI1A 3AE3B 3DEOA 2KDMA 1DOLA 4XXEA 1BOSA 1WTXA 5E6JA 3GTPB 3S2HB 3EROA 1PDQA 2WXPA 5D65A 2EYPA 1S5FD 3AE9B 2I38A 2F0LA 1ACCA 3IAM1 4WIPA 2KQ3A 4A3IB 1RFKA 4H44C 2D5GA 1JMLA 1PFDA 2WKCA 1TR5A 3A8JE 3KLSX 3P4SB 2K5WA 4HMJA 1TYGB 4HKQA 1WRIA 4JWUC 3S1QB 2NTSA 4N58A 4L23A 2F4IA 1CA6A 4OO1G 1FO4A 5CYUA 2JZPA 5IIFA 1TWFB 2V3PA 1T5XD 4C2MB 3P1MA 5C3XA 1QG7A 3RUZA 1TWHB 2IDYA 1VLBA 3DWAA 1VDZA 4E6IA 1PFNA 1IW7C 3E9SA 3VR3A 1PRTB 3BDCA 2BCOA 2V0GA 3K58A 3NHHA 3GO5A 5I2XA 2E2JB 1GJXA 5J22A 3K7AB 3EQLC 1NAPA 4K6DA 3H0GB 1QOFA 3D8GA 1ZOYB 3V3XA 1SB3C 3K5MA 4KMUC 5KGUA 5EQ0A 1F0ZA 3ND8A 5CV6A 1GOZA 4A93B 4CBVA 1MGSA 4HAEA 1D1KA 3J80L 5J1ZA 1HXYD 4FXGC 4J8QA 4JX1C 4MH8A 5JEAH 2K04A 4KY7A 1Q10A 1I4RA 2B2YC 3GV3A 2A68C 2F0NA 2VZKB 4HSPA 1LTRD 3K5OA 4WJWA 1HFGA 1BUIC 2E6XA 1N61A 4B0MA 1E10A 3GP7A 2WDQB 2AQ1B 3L7ZC 5F2DA 4ZKCB 5D3IB 4C1NK 2K5QA 2WXKA 1V1PA 5C4HA 2G9HD 2O5JC 2KOLA 5IODA 2H1EA 2MUYA 3FPPA 1CZWA 3S14B 3H3VC 2XRSD 3TEXA 5FO7B 4DAPA 1SSNA 1HQRD 3VRAB 3C1EA 4DQOC 2EY6A 2M00A 2PW9A 4NZLB 1QOBA 2EELA 3MFYA 2Z8LA 4K2LA 2IGHA 2K1BA 1PFBA 2MPMA 4CHTB 3KWVA 2J7ZA 3BDOA 3T3OA 3R2IA 2BE5C 3H91A 1YNNC 3GB1A 1JOOA 1G6ZA 1B53A 1SEBD 3BK1A 4KKTA 3Q8FA 4KGTA 2CVRA 2BDNA 4FF2A 1OXVA 1STBA 1CHQD 1ZYRD 4KV6A 5JXVA 2HDMA 2KCNA 2G1EA 4IUVA 2E2IB 2FINB 2JYEA 3T56B 3MTSA 3KLSA 4USAA 1LTAD 3CWIA 2ZT9C 1ILQA 1XX8A 1VMPA 5KNCA 1D6EC 2XVSA 1PLFA 2JSVX 1PMRA 1GB4A 1ICWA 1D1IA 1GHKA 3V05A 2F0DA 3A8IE 4XIGS 3U9OA 1UNSA 1DOKA 1QWYA 3QIAA 2WIIB 1Y56A 5K36G 3AE8B 2F0WA 3R8BA 1C48A 1P7EA 4HEDA 3MXNA 2DNCA 3HRDD 1SNQA 1JQYD 3HOVB 4DAVA 2JEAI 4YTNB 4P2CB 5T1IA 3NS1A 4IZ8A 2HTME 4A90A 2WXIA 5EE0A 2WXMA 2KJXA 2B8GA 4O42A 2A5HA 2EYJA 1ZKOA 3OSOA 3OPOA 1L6VA 4ABNA 1ML0D 4F87A 1NR2A 1WCMB 3LNNA 4Q2JA 3LB8C 4BBSB 1L4ZB 4N59A 2Y0SB 2HUGA 1ET9A 1LLRD 3I8ZA 4PNYA 5M3FB 1K50A 1N5WA 1YJJA 4OZBA 1OQQA 4ZRPA 1HCZA 1EQVA 4JE3B 1B9RA 1KDAA 4NDXA 1H9RA 5JPMC 1KFYB 2QDBA 3PZ7A 1K52A 4PMCA 3N9YC 3Q8BA 1JWBD 4G57A 1KDCA 3D4WA 4ILWA 2W3SA 3AECB 1JWUD 4K8JA 4ODGA 4GLSC 3AE1B 4US9A 4CKBA 1B3AA 1E0ZA 1G2SA 1C8CA 2PNRC 2E3TA 1F9RA 4ZUIA 4K5VA 5CBAE 3H94A 1AYFA 2DLBA 3S1RB 1VZ7A 1MI2A 1QF6A 4WFN3 3B9JA 4BA2I 3BS1A 3H6MA 4KK7A 1XF5L 3NVWA 5G3LD 2EYOA 2D62A 3EGRA 3FILB 1V43A 1JORA 4DGZA 1WVLA 3SR6A 1DONA 2NVXB 1RYJA 2QEJC 2ZXOA 4BWGB 2WQYB 3S2DB 1EZ6A 4N9TA 1B44D 2FFKB 1VDVA 2L4NA 1BCPC 4KJNA 3GQBA 2L9HA 5EKKA 2JWUA 1QQRA 3UI2A 3C2PA 1HHVA 3P75A 3HUIA 3L9AX 5A2QL 2MGSA 1A15A 2M56B 4FXCA 1UAPA 1IYUA 4QMGA 1WWTA 2IGDA 1SNOA 3HOYB 4KHVA 4RF0A 3TZUA 3EVQA 3RMHA 3W5VB 2JYOA 2L0CA 3L4PA 1JW9D 2MJEA 1ZYRC 1XYIA 4OW0A 5D7GA 3KLRA 2MJDA 2DY8A 4JWSC 1DZ1A 5BYQA 1SYCA 2ENBA 3IFDA 2B39A 3OWFA 2E76C 3RFZB 2W3RA 1XLNA 1IGDA 2AUJD 2CW0D 5EKLA 3TSSA 1J7CA 4BY1B 3I4LA 1WYGA 2WP9B 3OIPA 1DD2A 2PVGC 1HUNA 1GAQB 3IFTA 4P16A 5DNFA 1TKYA 4HKZE 4DAYA 3HOUB 4ZAIA 4A6QA 2EKIA 4ZLTF 1D2BA 2AX5A 4L2YA 5FOBB 5C3EB 3OWEB 2GI9A 1TQOA 4IN3A 1YJIA 3NK9A 1K51A 1EQTA 1MSGA 3I57A 3NTIA 1E6EB 2Y5CA 5CV9A 2LEKA 5HURA 4IUNA 2ONQA 5AUIA 4KTAA 2RDGA 2WXFA 4IOIE 5CV4A 4WQMA 1VZ8A 3HVDA 1D5MC 4A3DB 4FVMA 1SBBB 2QSDA 3BVZA 1BXTA 3DEPA 5ELBA 1NENB 5C4XB 3BK2A 2EJGC 4MN3A 2A68D 3P4PB 2QF7A 3IAS1 3AE2B 5IT9L 3TDQA 1PTOB 2EDGA 2L1AA 5JEAG 4YT0B 2EY1A 3MEHA 5C0XJ 1IKMA 1MI0A 3AEEB 4FXDA 1IYVA 3EUB2 4OO1H 3LX0A 4LTUA 3PO0A 2NB0A 5I9OA 4NP5A 5IOCA 4A9AA 2B2TA 3Q23A 1EOTA 1NYRA 2B2YA 1DOMA 1TWCB 2RSOA 3J7AV 4WH4A 1Y1VB 1NSNS 2KCCA 2WP8J 1H9KA 5M3MB 3Q8CA 3T51B 2O4XA 1C4CA 3NZ3A 1BCPB 2IGGA 1KTKA 1FYCA 1Q3LA 1I3QB 2EE1A 5CV8A 1JCKB 2KA7A 2NTTA 1SYBA 2RDHA 1WTRA 2KMMA 2ACZB 2RMMA 1JB3A 5E4XA 2NWGA 1LO5D 1EY6A 2LS01 4A3FB