1HXYD

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
total genus 66
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hxyD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hxyD02
1LTGD 1L0XB 4RGNA 1I4XA 3DWAA 1DYQA 5ELEA 1KTKA 1I4GA 1RD9D 1L0YB 2QILA 1PRTB 1HTLD 1CHQD 1MD2D 3GP7A 1JWUD 2IJ0A 1F77A 1LLRD 4Z9CB 1BCPD 1M4VA 3URYA 1FNVA 1PZID 1BCPC 1BCPF 1YN5A 4RGMA 4RHSA 1EU4A 1D5MC 1LT6D 5FK9C 1LT5D 1D5XC 1S5CD 1TY2A 1FD7D 1PZJD 1AN8A 1LTAD 1RF2D 1PTOC 1PTOF 3V05A 4DXFA 2RDHA 1SE2A 3BYYB 3DWQA 1ET6A 1EFID 4OHJA 2TSSA 1CQVA 2XRSD 1BCPB 1ESFA 3MFGA 2R61A 1CK1A 1YN4A 1S5ED 1TS5A 3R8BA 1AW7A 1UUPA 3BVMA 5FKAC 1V1PB 1LT4D 2AQ3B 1YN3A 2RDGA 2ICIA 1CT1D 4L63B 1SBBB 1TY0A 4DXGA 1V1OA 3BZDB 1PRTF 1PRTC 1DJRD 1SXTA 1KLGD 1SE4A 4L6TB 1GOZA 1TS2A 1B44D 1JR0D 1FNUA 1HQRD 1SEBD 1PTOD 1STEA 1I4QA 1BXTA 2AQ1B 5TSSA 1I4PA 2XRQD 1S5BD 4C56C 1EWCA 1D6EC 3BVGA 5I4DA 2NTTA 4RFBA 1TS4A 1RCVD 3OWEB 1I4HA 1CHPD 1EEFD 1HA5A 2XNAC 3MC0B 4RGTA 1PTOH 3EFXD 5ELDA 4RGOS 4RHRA 1EEID 1LO5D 1UNSA 3BVZA 3R2IA 1QILA 1HXYD 1PTOB 4TSSA 1PYWD 2AQ2B 5ELFA 3DWPA 3BYTB 2IPKD 1LTRD 4K6LA 1JWSD 2O2LD 1XXGA 1JQYD 2CHBD 4NZLB 1LTBD 4BWGB 3SEBA 1I4RA 5D3IB 4UDUC 1LTTD 3W2DA 1JCKB 3CHBD 3KLSX 3TSSA 1RDPD 4RH6A 1LT3D 3O13A 1ET9A 1FGBD 1D5ZC 3R2TA 1EU3A 2NTSA 1S5FD 1T5XD 2QEJC 1SE3A 2WV6D 4RCOA 4O1NA 1S5DD 1G8ZD 2Z8LA 1KLUD 3EA6A 5ELBA 1LTID 1B1ZA 4ZYSA 1SJED 1PRTD 2J4XA 1XTCD 5ELCA 1SJHD 5D3DA 1LTSD 1FNWA 1V1PA 2XN9C 2SEBD 2G9HD 1PZKD 1TS3A 1JWMD 1ENFA
chains in the Genus database with same CATH superfamily
3I2ZA 4QAYA 3TL5A 1N32L 1K53A 4MNOA 2WP9B 1I4GA 2HHHL 2BQQA 2M0XA 5C3EH 2WP8J 1CSQA 1Q81C 1Z9FA 4IFDH 1Y8RC 2BB5A 3FILA 2ICEC 3ZNID 2V3NA 1N8RC 2JA5H 4L5RC 4IUTA 1DM0B 2Y5CA 1VQPA 1WGRA 2IJ0A 3Q3NC 1LLRD 5FJ8H 1YHBA 2VZKD 5EKIA 3VRBB 4JWUC 3PT2B 1L6UA 3V62A 1PH2A 4RHSA 1YX5B 4W9HA 3D32A 3H7PA 2N1WA 4A3FB 2K03A 3M85A 4WJNA 2J0JA 2OT2A 3HM6X 4IJHA 4X62Q 2M1MA 3Q14C 1H9KA 2TSSA 4IURA 4KX6B 4AUQC 3UQBA 2KVRA 1ESRA 1L5PA 1DOKA 2XRSD 4LMQD 2BCOA 2OXPA 3IT4B 3MFGA 4IQZA 1Y8OB 1S5ED 3R8BA 3M63B 2O2VA 1EY8A 4HTHA 4GKKL 5IN7A 1F2MA 2ZJRA 1NJIC 3E56A 1V5OA 2EYFA 4UHVA 1HZAA 2PW9A 3TP8A 1OXVA 1L1OB 1Q12A 4QCLA 1KLGD 4A20A 4B3ML 4L6TB 3J80c 4WJWA 3VA7A 3CCMA 3ZXRA 1TWHH 3K58A 4TRDA 4HPPA 1EWHA 1SMYD 2R7ZG 4W9CA 2AQ1B 1IBLQ 4KSKC 4DHJB 2JWUA 2RKSA 3U4VA 5I4DA 5C3EB 3H9DA 1PXUA 1R4NB 4GS3A 4QGUA 4S3SA 3PGEA 2N9KA 5COYA 2XNAC 1P7EA 4HLEA 3N3KB 1C3TA 1K50A 3D8GA 4KJNA 3T4AC 2V4IB 2FUG1 2J53A 4NXML 1HA6A 2QIEB 4LF4L 1E9MA 2XK5B 1N60A 3NXWA 1HNZL 4GDKA 2VQEQ 5IA7A 1VQGA 1WCMB 4HJKA 2ZEQA 1D7QA 2XK5A 2AL3A 2Q8TA 1AFPA 4NZLB 4CDEC 1KABA 3HGBA 1GUSA 1VQCA 3TZUA 4N6EB 1QT9A 3Q2AC 1LABA 1HEZE 1S40A 3AE1B 2WX0A 3ZYYX 2PQEA 2ZVOA 5CV5A 3PO3B 2R2QA 5BO4B 5HGTA 1HJPA 4E71A 3M3YH 3WAOA 4GNXA 2M17A 1LT3D 2KUMA 3TEHB 5JJZA 5IYBH 2MBHA 3GS2A 1S5FD 4HIMA 2QEJC 1O7ZA 1SE3A 2KC2A 3R3OA 1YJWA 1L0VB 1IYUA 2ZCCA 2LHEA 1WI0A 4HK2A 2DYMA 2B8GA 4RMAA 2I5LX 2WXOA 3PZDA 4DXAB 1H9SB 2V1CC 1LGRA 4NJ6A 1C9FA 3VUXA 1CI3M 2Y3AA 1XMQL 2WU2B 3GTLB 2F03A 2PW7A 4EOYA 4DR4Q 3S17H 3CCEA 2AMCB 3A7AB 2NVTH 2CS4A 2KFKA 5EE9A 4A90A 3J9CA 1IXRA 2N9PC 5H92C 1PZKD 2KDIA 4BA1I 2B39A 1GNUA 2NB0A 1JB3A 4DV6L 1FMAD 1SMXA 3PSIA 2FIDA 4C4VB 1DYQA 3V2TA 5GMVA 1VZ6A 3TJPA 4AYBB 5JPNC 1STBA 1AE3A 1YX6B 2CHWA 2L0FA 1XLNA 4TUUA 2N0SB 4IJLA 1XNQL 4I65A 4B95A 3AE4B 1WTVA 1K73C 2IHEA 1MD2D 1Q10A 4LDTD 3ND9A 3DCGA 4LNOA 3OMCA 4GLVB 2CW0D 4R4IA 2H89B 3HKZE 2RDFA 2IGGA 2JA7H 3S15H 1PZID 3VFKA 1TXYA 1DCZA 2JP1A 4NQLB 3HOUH 5M3MH 2R3ZA 5CHFA 4DV5L 4IALA 1ROEA 3HOVG 3PRMB 1JOQA 3WOEA 1PTOC 3LJ3A 1NAPA 2X8XX 4B6WA 1PGBA 2RMMA 1D4BA 2PNRC 2L4NA 4JI4L 3GTKB 1ET6A 2DNCA 5IE8A 5LXIB 1B53A 3EBEA 2BA1A 4BBRG 4DV4Q 4B3RL 3MXPA 1UEAB 4DV2L 2LXKA 1S3OA 3U4ZA 1A6XA 4W9KA 2DZJA 2B2WC 4PZ7A 4H02A 1SLJA 2K5WA 4IO9A 3B1LX 2PEAA 4NNJB 1H8CA 1DOLA 3AYHB 2E2IB 2VB2X 2E2DC 3PRPB 1SIJA 1VQMA 2HJ1A 3RFZB 3UF8A 3QC8B 3RNEC 2YEPF 4ZRIA 4Q0FA 2KHJA 3GO5A 1JR0D 4N9PA 4HIOA 1JMLA 4LTUA 4A3LG 2F0GA 2OTLA 2A68C 3ML9A 2IW3A 4KKUA 4X3SA 1VQ5A 2MP1A 1ISNA 3NVWA 1E2ZA 1Q5WB 2A5UA 1R9TB 3ZRCA 3IFWB 1AARA 1G91A 4YSZB 1CKNB 5K5PA 5FLMG 3T1HQ 2K1FA 4YIJA 3GTMH 3EFXD 1IBLL 1NE3A 2UUCL 1R4PB 3R2IA 2KLCA 1BO0A 4GN3B 3RYTA 3VH3B 2JEAI 4DR2L 2LASA 2AQ2B 4ICUA 3C1FA 3KBGA 3P75A 4GDKB 2F3WA 2Q2UA 2I1KA 2O2LD 3MTSA 2M9VA 1F2YA 3WA0A 1WTXA 5EKLA 5FLXL 3PLVA 2FNJB 2KCNA 4WAAA 2CW0C 4BBRH 1X6OA 4EKUA 5HY6A 5CC4A 5C5MA 3HRZC 1WZ3A 4K5XA 3W2DA 5DCNA 2UXDQ 1GVPA 4KN7C 2CKHB 3S1NB 2AL6A 1YQ3B 3A5ZB 1IBXA 3GQBA 2NVQB 5HI1A 2A74C 3KUZA 3OTOQ 4A3IB 2QEXA 2JSOA 4M0WA 1OQYA 2TMPA 4CJ2C 3NEMA 3DHIC 3EA6A 2G5DA 3VR6A 1Q46A 3OIQA 2A69D 3JAME 2B29A 1C48A 4K1RB 3MXGA 1XPUA 3HM3A 3CP0A 5A2QE 2JZPA 3Q8DA 4R4QA 4B9XA 3U7ZA 5GROA 4W9LA 4NPNA 3H94A 2N9LA 5J17A 2HD3A 5EAYA 1FNWA 3RD4A 3WOFA 2SEBD 3DWGC 2MH7A 3PHXB 4JGHB 2KWUB 5AJ3Q 3LNNA 2BTEA 2C5LC 4U673 4C4VA 1PYSB 2F3VA 4POFA 3KW5B 4X66L 3UDXA 4DR4L 2F0WA 2O4XA 1RD9D 2YYZA 4DUZQ 2MJ3A 2LGXA 4KTAA 3JAMc 1TWCB 2UU7A 1V97A 5E4XA 2Z9HA 1Q1BA 3PO2G 3CCRA 1I94Q 2R93B 2OEDA 2ZNVB 1O7IA 4MIUA 1ZDXA 4FJVB 1F77A 5IGBA 2W3SA 3PZ7A 4FJZA 2ES2A 2MP2A 1Y1VG 2CU1A 3PRZA 1VJKA 2HT1A 1GUOA 1IHZA 3H0GG 1QOAA 4QIWE 2R92B 3A1QA 4DNIA 4MM3B 2BS2B 1MBYA 2PI2E 4OWWB 1SE2A 2WWZA 1A8VA 4JI0L 2LZ6A 2F4VL 1U4RA 2XTIA 4ZKCB 3HS0C 1E10A 1HCZA 1UAPA 2BOSA 1VQDA 2EXZA 4XWWA 3JAMi 3AH7A 3NG0A 1UWMA 2N7EA 1B3QA 3ER0A 1TWGB 2JQOA 2HD5B 3J7ZC 2JXXA 3EC8A 4JBKA 4K0KQ 4J8QA 1RRBA 3I72A 2V3SA 2ZTCA 1HFGA 1QNKA 3CD6A 1E1TA 3OPOA 4IUVA 1TWHB 2EIFA 1NVID 4DHZB 3PUYA 2IY1B 3OYYA 4MTKA 4HMIA 3PVLA 2CQOA 3S24A 3NY5A 5AFWA 5C44B 1EYCA 1STEA 2WX1A 2H5XA 1II3A 2I07B 1CQFA 4DAPA 3TREA 1F9RA 1QZGA 3P2BA 2EY1A 4HAEA 1GUAB 4ZUIA 4JYAQ 4PYZA 2CQAA 4DF7A 4CDDC 1HA5A 4CHKA 1RKNA 2EYHA 1J7CA 1NDDA 5HHDG 1E22A 3P1HA 3IG3A 3I3TB 1WZ0A 5EBDA 1JMCA 1OTCA 3Q24A 2ZNVC 3VUYA 1DZ1A 4F88A 4A3MH 1LTRD 1X1MA 4CJ0B 1WR1A 1WMHB 3D0FA 2LVPA 3HZXA 3CC2A 3WDNA 4GLXA 4Y52H 4E3CA 1WVLA 1JORA 4N58A 4BXXH 2F0HA 1Q82C 1MI0A 5KNCA 2MWSB 3ERSX 5IYBG 4YCWA 2FFKB 3E6ZX 3ND8A 3Q3MC 3AE2B 5FLXE 2R2OA 2L52A 3UI2A 4FADA 2K5VA 1NR4A 3SVMA 4BY1B 1A70A 1VDZA 1DGSA 1SNQA 2CKZB 4HJ9A 2OTJA 4A3OA 2EZVA 1J7AA 4O1NA 2OOBB 2L15A 3ITPA 2WU5B 3S2HH 2OF1A 4A55A 4KHPL 2UXDL 1QZEA 2FE8A 5AZHA 3MZ5A 4R4OA 2JPHA 4GZYC 1LTID 3ULPA 2JXMB 4OVZA 1HHVA 1QUQB 1F9JA 4KDLB 1ILQA 3OTOL 3Q8FA 4MSMB 4BKSD 1QOFA 1Z5SB 5BYSA 2UXCL 3U52E 1J6QA 2EKIA 1PDQA 1T0YA 4K8IA 4POGA 2H88B 1A2TA 3TS0A 3SHQA 2JT4B 3LB8C 2GBMA 4KK7A 1VF5C 2DJGC 4E6IA 4G7OC 2CVRA 1NYRA 3GTGH 2R7DA 1PRTB 1UELA 3QARA 4ZRZA 4F8CB 1GAQB 5LXHA 1UH6A 4OX9L 1L1OC 2N7JA 4GOPA 3ZLZA 3QB3A 3K80C 3OHXC 3SDLC 4Z9CB 4DV1Q 4NJCA 3F2CA 1VCBA 1P1AA 4C3IG 1YJJA 1T0QC 2D10A 1BCPF 3HK0A 4AJWA 3NS1A 3M4PA 3GTJH 5FK9C 4A93H 4WWPA 1S5CD 3SDZA 5KIXA 1VQBA 3SK5A 1STGA 3IBEA 1KF6B 2NN6I 3TEZA 2EYMA 2QA4A 4IFDG 1ZGUB 2DY8A 1OEYA 2RHQB 1MFWA 4M02A 5J3BA 2EQSA 2BH8A 2A19A 3MEHA 1TZ1A 3KK7A 4ANVA 4DV7Q 5BMIA 1EQVA 3SXHA 3G4SA 4H7BA 1ESFA 1XPOA 3DWMA 5DEHA 4DR3L 3S2DB 2KYWA 3QOLA 4FDBA 1B70B 3NK9A 1PFBA 2RVLA 2QF7A 2IT1A 1Y56A 2ON8A 5JJKA 3ZKJC 1WX9A 1Q1EA 5ELOA 2KK8A 2CWPA 3L0WB 2JZ3B 1ONLA 3L17A 3WALA 2N88A 3T13A 2LEKA 1ICWA 4JPBW 3KUCB 1WRIA 2B63B 1XLQA 4EFOA 3KDFA 4WJ3M 4FF1A 1X54A 5JPMC 1J5EQ 4PMBA 4BBNC 4OEMB 4JI6Q 3L08A 4G4KA 3BIID 4YWMA 5BN3A 3KYCD 3VDYA 2IO1B 3CCQA 2MQHA 1YJNA 4WRDA 4J15A 3CC7A 3N6RA 3TUOA 4IUNA 3X3NA 4NXMQ 2PPBC 1F2LA 1F52A 1S1QB 2Y5BB 4WWNA 4IM0A 2BYFA 2N49A 4RAUC 5JHAA 1EEFD 2ZTDA 3UDFA 3S2DH 2K4KA 4HKQA 1X3EA 2VQEL 4MN3A 2F0VA 1RHPA 3TEWA 2VQFQ 3AEDB 1HXYD 3M4OB 5FO9B 4G0NB 1H9SA 4ZRPA 4A3PA 1WIAA 2RCNA 1V6EA 2ZVNA 5KYLA 5CMDA 2WB1E 3G7LA 4HN7A 2MLBA 4K7SA 4BY7B 3NTHA 3RNUA 1HTPA 2BWES 2E2JH 1CKMA 1HH2P 5CV4A 4LJZC 1I4RA 1VQ6A 1ACCA 1SNPA 3ZDTA 2RHSB 3S1MB 3GE3C 3P4SB 3DHGC 2NBVB 2JYEA 2K5HA 2WYQA 1Q0WB 4GU2A 4PS7A 3MHSD 4AIMA 3HKZG 2BVCA 1WE6A 2SDFA 4O42A 4QIWB 1XJVA 1VRAB 1RLFA 3DVGX 1QNUA 2DENB 2ZM6Q 1R4MI 3L7ZC 3AFQA 4W9IA 3V96A 2X69A 3HIZA 1RJTA 1MHWC 1WTRA 4ME3A 2MP2B 3UIOB 2OQ0A 4EGVA 3TDQA 3C46A 2I46A 3E0EA 4ULLA 3PHWB 4WH4A 4D2KA 2BE5D 5E1FA 5IY0A 2FCNA 1M90C 4REZA 2DY7A 2YEPB 2QDLA 2L3ZA 1BR9A 1PV4A 2M0AA 3SHLA 4LF6L 3U2SC 1QILA 1VQKA 4K2LA 1RFKA 3K5MA 1UEBA 4HIKA 2BPSA 1P8LA 4RGNA 3PO3H 3C19A 4GDLB 3EUB2 3EHVA 1TWCH 3A74A 4K8JA 3VYUA 1N63A 2YVCA 2EELA 3CCSA 1L0YB 2A5HA 1IYVA 1AWDA 1F2ZA 3WWVA 1TZOA 2K5PA 2MW5A 2O6VB 2JA6H 3ZQ4A 4XZ4A 2KQ4X 3AEAB 3I57A 3ZGZA 1FEHA 4DAVA 1JWBD 3H0GH 1TYGB 4JOIA 5EQ0A 4RWSC 1Y1WH 4P16A 1RODA 4XX5A 3AB9A 1W6KA 5MPOA 1D5XC 4DV4L 3E9IA 4M0WB 2K9XA 3CSTA 4DV1L 3V6EB 2JN4A 3DWQA 2PZTA 1IYJB 4M8MA 3HOZB 2PVOD 2VL6A 3APDA 5EE1A 4DV3L 4G3XB 2CCZA 3P7JA 1VQEA 1E8WA 5LHY1 1BBUA 5IT9E 3ONSA 3RNCC 1QVGA 5FKAC 1C4CA 4A3MG 1G291 3UE1A 4X64Q 4FVMA 1NYQA 3P4PB 3EJIA 3H3VI 3W1SC 4JWSC 1U4MA 4EVOA 1Z2MA 4MELA 4NKLA 4XQNA 1PGAA 5FO7B 1YBYA 4OZBA 2Y0SG 4OIJA 3OWFA 3UDGA 4FF3A 2B2UC 3I56A 1B44D 1K8AC 3TRZA 3JW0X 3T1HL 2B2UA 4PK1A 1TU2B 3FHWA 4A3DH 4R8IA 5CHWA 4BBRB 4OO1I 2JVCA 4C56C 3AE6B 4J6IA 1EOVA 4JI6L 2NBWB 3AEFB 2F0PA 2BH2A 4A3JH 4S0RA 3MAQA 3I4NH 1PTOH 2LMCA 3L4PA 4B3SQ 3FRPB 4XDXA 5L95C 3AI5A 1X65A 3VR3A 4GKJQ 1WYWB 1YNNC 3DQVA 1B9RA 1GB1A 2Y0SB 4ID6A 2LVOA 3DWPA 2LWPA 1UF0A 3L16A 1BNZA 4US9A 3HKSA 2N78A 2EJMA 5IGGA 1WM3A 3HHMA 1HQMC 1J8CA 3TP6A 4A3KH 2SNMA 3GDEA 2FMCA 1CM9A 4KV6A 1U9RA 2QJLA 3ZNZB 1FO4A 2I2YA 3RZWC 3ZJTA 2BGFA 3SEBA 3SU8X 1LTTD 3A54A 5IP4D 1XCTL 1Q90A 1ILPA 1Q86C 3U30A 2G3QB 5C0XH 3X23A 4KV2A 1WJ6A 1WTOA 4AQYL 4DAYA 3IL8A 2ID0A 2ZJQA 1KNEA 2F4IA 2L1BA 4I7ZC 4HSPA 5J39A 1GJZA 2LRWA 2A8VA 3V3XA 2LGSA 3J81L 4A3DG 1W2BA 1MI2A 4R9WA 4X66Q 1VQ4A 4P74A 4MGIE 5JVH3 2MGSA 3NVYA 4XTCS 3QHTA 3S17B 2MUYA 2ZPNA 4LFCL 1I35A 4A3JB 1I94L 3P4RB 4MTNA 1H9MA 5CYUA 3QX1A 1BBWA 4NPSA 2YTXA 2QILA 3HVZA 1YNXA 1MJCA 4JE3B 2NVQH 4P2CB 4GIVA 5AZGA 2KOLA 4NB3A 2V3PA 4MH0E 2BA0A 3J7A5 1M4VA 4DNRB 1V8CA 2ZXRA 3D31A 1BCPC 4DK0A 3NOBA 4DUYL 2LUEA 1STAA 3NTIA 5IGDA 3AE8B 3K0YA 3HOXB 2N7DA 4FNFA 2KDBA 2Q2HA 3NQTA 2WKCA 1TY2A 4GOPB 1FD7D 1TWFB 5CV8A 4Y7NH 1WH3A 2K1BA 1EWIA 4LW1A 2KC1A 2O6VD 3OLMD 3HOUG 3L9AX 4LJPB 5HFYA 1ZEQX 4K0KL 2J42A 2BYEA 1V43A 5GADC 1N9WA 1T5EA 4FXKC 2WXHA 3HOZH 3B0AA 5M3FH 4HPMB 1E90A 4JBWA 1ZXHA 1SNOA 2AQ3B 4BY1H 2NVXH 2E5LL 5G5HA 3DBHI 2L11A 4IFDJ 1YJIA 2RSUA 4YHHQ 5IT9L 2Z6KC 3NBIA 5IGCA 4YCUA 1RAXA 2VRRB 1WGDA 1SYEA 1QUQA 1ZYRC 5HKHA 4HEDA 2KJRA 3Q3FA 1GOZA 5C3WA 1UE6A 3OJ3A 4V190 2VUMB 4HXDA 3T16A 3ZDMC 4BBNF 3K0XA 1SF0A 1AP0A 4X65L 1OTRB 1CFMA 4C3JG 3QIJA 2DUDA 4UY8C 2ZCBA 3SD5A 3OW2A 4K81A 4O0AA 4F8MA 3AECB 1C78A 3A8IE 1BKBA 5M3FB 3BJUA 1PH5A 4F1SA 2N3SA 2ONQA 2P5ZX 1H9RA 5EKKA 1TWAB 3R3MA 3J80E 5KNDA 4A3GH 2VUMG 3JVZX 4QL5A 3H15A 5I2YA 4XT1B 1BUIC 1YQ4B 3ZJYC 1GUTA 2DLBA 2J52A 3RNGC 4XQJA 3PV1A 2F0KA 1E7UA 5G3LF 1BT0A 4NXNQ 1VQLA 1ZDVA 4TMAB 5D2MB 2JA5G 2VXWA 2HQLA 2G9DA 3CRKC 3P42A 4RF1A 4GKJL 1IL2A 3RNBC 1PH6A 2QCZA 1VR9A 3WAMA 1BQQT 2NCNA 3IRBA 4GNXC 3HOWG 4WAFA 3VQIA 2JA8G 1FCCC 1VQFA 3VR8B 4RH6A 2H1EA 2FXQA 2D3BA 4GMVA 4HWIB 1X3QA 1A3UA 3SK8A 2NTSA 5HGQA 2WXGA 5F2DA 3HP3A 5C4JB 5M5YB 2JA5B 4HCSA 2PIAA 4DK3C 2HCCA 4C3HH 4BVUC 3DOWA 4WFN3 3NWSA 3B6YA 1HRJA 1ASYA 1SB3C 2DZMA 2YU9H 2J4XA 1WTWA 2KAJA 3D3RA 1WXVA 5L83A 1EY9A 3KF6B 4JI2L 3RZOH 4MSQB 3FILB 2EYOA 2Q8RE 3GP7A 4M00A 2WXNA 3N1XC 4KI0A 4OX9Q 1ZPSA 2IO2B 3GD7A 1ZYRD 1SRUA 1V1QA 1Q8KA 1OXSC 1XO3A 1I50H 2RPQA 1XPRA 1HTLD 2LGDA 2L12A 5JZEB 4W9JA 1ML0D 3A9JA 3FKIG 2Y5PA 1BMLC 2OQKA 1JWUD 4DDID 2N55A 4RCNA 3MXNA 1DD2A 1AYFA 2L00B 5I9OA 3GTOB 3KYDD 4P7IA 3JC66 1XT9B 1P16A 4QMGA 1L7YA 4YXDB 1MHHE 3PMFA 3QWZB 1XQQA 4ANUA 2QMTA 4LJOB 1GUNA 1WCMH 1JRUA 4KDIC 1AN8A 2RSOA 3AEBB 1NR2A 5IYDG 2D3GA 1RTOA 1PFNA 3HOYB 4C7YA 1XEEA 1C8CA 4GNXB 1EUJA 1LM8B 5M5WB 4DV5Q 2EDGA 3H1UA 3W3AA 2IY0B 4EZJA 4MM3A 4LFAQ 1YEZA 2H4OA 3U9OA 1AW7A 2D2CC 2F1MA 3U4EG 2G4SA 1ENCA 3SR1A 1QVFA 3ABVB 1QOGA 1SBBB 3FP9A 2WLBA 2NVUI 4HKZE 4DK6C 2F0SA 1YOVB 4W9FA 5DM73 5CV6A 2AHOB 3QR8A 4AWJA 4BA2I 2F0LA 1BDOA 2B2TC 3A5UA 2E5LQ 4IOAA 3AE5B 4DGZA 2O6VA 3QA8A 4X3UA 1IKMA 5TSSA 3IVFA 3L2PA 4EX5A 3GTGB 4M1UB 3STBD 3LGJA 4RFBA 4HJ5A 2D3AA 4GDLA 4DR5Q 3HEJA 3F2UA 3Q3JA 3NHEB 3M7GA 4LF7Q 3F2DA 5JAVA 4OO1G 2KFKB 1JICA 2PMZB 4TSSA 4HJAA 4K2KA 1PYWD 3KWVA 3DHQA 3TMPB 1DOMA 1WTHA 2JE6I 5IYDH 3W9CB 3DEOA 3NZSA 4JBJA 3KJPA 3M7NA 2KMCA 3QQ8B 3GB1A 3WCQA 1CA6A 4A4IA 3HOYH 3GTLH 1KRHA 3VHTC 2KN4A 2QHOA 1IP9A 4BKSA 4B08A 4F7XA 5JJLA 1VMPA 5CORA 5C0XG 1FL0A 2GA4B 1C76A 5DLQE 2JRHA 2RQXA 4ZQ3A 4QQBX 1T0RC 3STBC 2KNBA 2RD0A 3JSVB 3W5VB 3R2TA 1G51A 1VCIA 1WWTA 1K0RA 2XIWA 2LY7A 3OIPA 1B50A 2MPMA 1G8ZD 2WXMA 3A7LA 2KJXA 4KIKB 4KY5A 2J7QB 5C3EG 4CBVA 2I38A 3DLLA 5C44H 4IC7B 4LF6Q 3T53B 2LRUA 5ELCA 3VR5A 1VZ8A 2KLGA 2R7ZB 4OW0A 4CYEA 1HZ6A 2EY2A 4LUVA 2ZT9C 1EFWA 4C2MH 1LTSD 1CUKA 1JC7A 2MCNB 5ISRA 1ENFA 2N9EB 4K14A 3A56A 3PV0A 3I91A 1U5KA 1I4XA 2Q8IB 2KCTA 3J7YW 4WJQA 3IFDA 2E3TA 4OWXB 2WB1B 2D0OA 4JI2Q 4XE0A 2EYPA 4YY3Q 2K75A 4IPDA 2CHZA 3E3XA 5GAGC 1NUCA 1HR0L 1EM7A 1WXSA 1IZ6A 1YIJA 1K28A 1GHKA 2QGQA 1NSNS 4LAAA 2LFNA 3SFDB 1LTLA 2RBMA 3D4DA 4DK1A 2HDMA 2RSNA 3M62B 1KAWA 2IBIB 1EU4A 5EDSA 1S4ZA 3HOVB 2DJFC 1HE8A 3PO3G 1NNXA 3HG9A 1EL0A 3A0JA 3S1RH 1EZ6A 4DHZE 3K57A 3RZOB 1T3QA 2KDMA 1YHAA 3BS1A 3HOZG 2K28A 3EECA 3AB5A 1EFID 2MO0A 4LUZA 2JA6G 2F0FA 3H09A 5EPLA 4JW0A 5IYCG 1SIFA 1A62A 3TQYA 1Z7TA 1QVCA 4QF4A 4R4TA 5BR8Q 2KQ7A 3MP9A 2KEDA 3MVVA 2F4VQ 1UE7A 1KDBA 2E74C 4OXPA 1KD1C 4I6LB 4NW2A 4US8A 3FPPA 1PH7A 4AH6A 1SE4A 1EQRA 4APVA 4KGTA 2K6QA 1SE8A 4WJ4A 2MSED 2K50A 1PTOD 3CRLC 3DBSA 2LVQA 4UP9A 1IBML 4A3BB 5J18A 5M5XB 1YZ6A 2K0PA 4A8XC 2EXDA 4A3CG 1A63A 3QG1A 1TIFA 4PV1C 2NTTA 3ONAB 1BVSA 1B7YB 1L2FA 4BS9A 1S72A 1E5WA 1M1KC 1MHXA 4IWQA 1FVIA 3CPFA 2BYVE 5H1SE 5IGFA 2JZZA 1JT8A 3BK2A 1EQQA 2IX1A 2JSVX 2HDEA 3PO0A 2M00A 3QAQA 1FJGL 1GC6A 4PS3A 3W5UB 5C5LA 4JI5Q 2C9WB 5CBAE 4WQOB 5EPKA 2NVYH 1P9DU 3RD2A 1R7SA 1SFOB 3IAM1 1RL2A 1HUMA 2D0PA 4M8NA 4L1BA 4LNNA 1SYCA 2UYZB 2ZXPA 1GUWA 1A0IA 3SK4A 2FUHB 1MG8A 4A3BH 2BS4B 3C0RB 1N33Q 4N59A 5E4WC 4AQYQ 3TEXA 3ULJA 1JJCB 2B2WA 3KLSX 3NE5B 1FPYA 2AYOB 2GI9A 1K8RB 2GLSA 2KWVB 3VR2A 4C3HG 4RCOA 1KXLA 1S5DD 2WB1G 4JV5Q 1RWSA 4MGYE 4MGZE 2MHVA 1TT2A 3K5OA 2K5QA 5E6OA 3V61A 3RMHA 4AYBG 4GB9A 5AUKA 2PZWA 2KCCA 1RTNA 5LMNQ 2F0DA 3DVGY 2FJ2A 4FLHA 2ZW1A 1EYAA 2DN8A 5DPWA 2K7VA 2WXFA 4YSXB 3CF5A 1C4QA 1X3PA 4KHPQ 3F8TA 3I90A 2JXTA 1UD7A 2KQSA 2B3GA 3I8ZA 2Z0SA 3PUZA 4ZLTF 3Q69A 4I6NB 2PW5A 1KAAA 1JJ2A 1YNJC 2K6DB 2WNMA 3TS2A 4L8JA 4ZYNA 3NTKA 3G6EA 4DUYQ 1JW9D 5IODA 2HCIA 2MO1A 5IT9c 1ZXTA 3J81j 1ZW7A 2L32A 2OEOA 1F1HA 1BCPD 3FDTA 3NRZA 3RR5A 2I0QA 4K7UA 4RA8A 1TKWB 2EYJA 1VQNA 1L6VA 4HCPB 4RNAA 4OGQC 3W1YA 1GJXA 2Z4HA 4A3IG 4JI3L 2JYOA 2BDOA 4GLSC 1KLVA 3HKZB 1KM7A 1SGHA 1NY4A 2LMCB 3S1QH 4LDTB 3RN9C 2HE7A 3VVWB 4A3LH 4KHZA 1J9OA 4DR6Q 4H44C 3NENA 3NVVA 4NQKE 4PMCA 3CMMB 4JL9A 4PZ8A 3CSFA 4DU9A 3A1QB 1LYLA 5C3XA 3Q0AA 1I3QB 4A3GB 2FAZA 4IPGA 2OJWA 3KF6A 1E8ZA 3BINA 5D7GA 2BDNA 3VTUA 2W54A 2LI5A 2L05A 4URKA 4X65Q 2DGYA 1EIGA 5G55A 3S2HB 3ZNGC 2JUOA 1WGKA 4DR3Q 3ULLA 5BR8L 1E7PB 3EVQA 1IGCA 1NI2A 1XNRL 4DKAC 2EJFC 4EE2A 1TS2A 1HQRD 2CJNA 5LMNW 4BOSC 2C5CA 3D6WA 4DR1Q 2KANA 5KHOA 2UUCQ 3J7AF 5DPRA 4OONA 3DBHB 3PIP3 1EWCA 4FO2A 2G45B 3EQLC 1DONA 4YTNB 5EE3A 1LXDA 1SYBA 1EY6A 4QUCA 3GZNI 4AJYB 2UU9Q 4AQ7A 4ARIA 1FRRA 2V4DA 3E9HA 3RN5A 2X38A 2GB1A 2ACZB 1X9NA 1Q8IA 2NZOA 3QO2A 4JLCA 2MQJA 5ELDA 4RGOS 1EEID 4C3HB 1J8IA 4USAA 1KFYB 2EY6A 1PTOB 2L76A 4TV3A 4ZRJA 2I5MX 3HOYG 2FCQA 3VAWA 4K6LA 4JI8Q 1OFFA 2PPHA 3NQIA 3U8ZA 1MGSA 1B4OA 3PLUA 2KTRB 5LL6S 2GBRA 2PKOA 1LTBD 1Y8NB 4DNTB 4KGRA 1FJGQ 3FAHA 4P6VF 3MC8A 3NJTA 4JI5L 2ATWA 4QUFA 3CMEA 2LUMA 4A3KG 4FULA 3T1YL 2WGSA 1HFNA 3MC9A 4IKGA 2AUKA 2ZTEA 5BMHA 5E3FA 3M3JA 5ELNA 4LNFA 1WTQA 2Z6KA 4FJYA 5CHVC 5M5WH 3K7AH 4KKJA 4E74A 3KLSA 3IAYA 1E7VA 4CGYB 1SNDA 3I4MH 1N33L 4CQNA 3S9WA 2Z8LA 1V86A 5C23A 3V6CB 1KLUD 1H9JA 2LJ5A 2A6ED 3BZKA 3M95A 5BYRA 3KDFB 1SJED 3IKJA 1SFOH 5CGKA 5D14A 1G6ZA 1P7FA 2INDC 3AEGB 4IOIE 4KSLC 2E2HB 1YD8U 3GV3A 3HOWH 2LGYA 3X0WA 3T9LA 4DAYB 4KIKA 3RT3B 3DBRB 4LF5L 2KJ6A 2G9HD 5GAEC 4ZK9B 2D2QA 4JBMA 3ZTCA 3Q8EA 1JWMD 3NUCA 3R7RA 3O65B 4FA6A 2SOBA 2RR9A 5G3LD 2JRIB 3VYTA 1FD6A 4JC0A 5IIFA 2O5IC 3KJOA 1NMGA 1QZHA 4WWMA 3OOCA 1PA6A 3T51B 2QCPX 1HR0W 1RM6C 1EYGA 2K25A 3AEEB 2E75C 4TVAB 1CJEA 4W9DA 2KA7A 4CDCC 4J3OD 4EEWA 1U4LA 5JVG3 3KYHC 4X3KA 3UQAA 2BT6A 4DBGA 2Z0EB 3MHBA 5M3MB 4V0BA 3B2FA 4TKOB 2WDVB 1A15A 3HOWB 3ZJVA 2B8FA 3S1RB 1GC7A 4DR7L 3W5OA 4BZAA 2GN5A 3AM9A 1B9NA 1SYDA 2NZHA 3C1EA 2YLMA 3ZRFA 1EYDA 2C7HA 2JWZA 2J7ZA 4DXFA 1X32A 1HUNA 2E76C 3TZDA 3S1NH 1LFDA 2IO0B 2OJRA 3A9KB 4P1CC 4OHJA 2O5JC 3K81C 3QIAA 3H6MA 1FXIA 3LX0A 2AWNA 3I4MG 2LSSA 1BCPB 4H2AA 2L0TA 1WJNA 2INPE 4ZHPA 4ME5A 4NP5A 1LQBA 2BBCA 4II2B 1UUPA 2NWGA 1OQRA 3I63C 1V1PB 3TIXA 2W9NA 1WD0A 2E2IH 4X62L 3DVNV 2WFWA 4C00A 3FMCA 5M3FG 2AWTA 1JROA 1TY0A 3TP5A 2FHTA 4DXGA 5IP7G 3CPWA 1PRTC 1T0SC 4HJ8A 1FXAA 3DMUA 2MJDA 5EBCA 4RKLA 2XWJB 4GKKQ 4DR5L 3A4SC 1SMYC 3I55A 5J1ZA 5IAAC 4TQ0A 2JA7G 2QDBA 5K36H 3EFUA 4CJ1B 1TIID 2WDRB 2E2JB 2WQYB 3IXSA 2XRQD 2OWOA 5IKCM 1E8XA 1CHPD 3M3YB 2C7NB 4EQOA 1GD7A 2FIFA 3MC0B 2VS1A 3J81i 4HCEA 3M4OH 4GGQA 4DR1L 1D1KA 1GKHA 4G11A 1L0WA 3BVZA 4HDOA 1FCLA 3PIPA 1CA5A 4TQUS 2HJ8A 3IT6B 4ITKA 2JA6B 3RMKC 3IHPC 2IX3A 4IZ8A 2UU9L 4GSWA 1PFDA 3UGBB 1E0ZA 1GO3E 2R7ZH 2XGTA 2XWBB 1TWFH 4Y7NB 2VUMH 4B3SL 5KHQA 1YI2A 4IN3A 2LHDA 1PDXA 2WXIA 1UWXA 2C7MB 1PFMA 4IPCA 5KYIA 5DPSA 5IP9G 4UDUC 2A1AA 3DM3A 1NBFC 3CWIA 5AEKB 3TSSA 1JJGA 2F0TA 3HRDD 3PO2H 2WAQE 1GB4A 4FHKA 1D5ZC 2F3IA 2JA9A 4BAXA 1TGZB 2PQAA 2NR2A 2WV6D 4KD3A 2UUBL 4LUOA 1HZCA 3PPAA 4WURA 2KHSA 1EY5A 1HNWL 4JI1L 3T1YQ 2M8SA 3B2GA 4A9AA 1VF7A 2LXJA 5LMUQ 3S15B 2JA7B 1GPXA 1MKHA 1YNJD 4JCVE 4C3JB 4JX1C 1XTCD 1SJHD 4C1NI 2KX3A 4WJPA 5D3DA 3PTFC 4XQQA 3BDLA 3NELA 3S14B 4GOCA 2GBKA 3PIO3 4NAMA 4XYOA 1TVXA 4K3BA 5D65A 4YY3L 1PLFA 3LYYA 1NENB 1AEXA 4LCDE 1KTKA 3DVNU 1YJ1A 2PNHA 3OJ4B 4LF5Q 1V8QA 4S17A 1A5RA 1IW7D 2KCMA 2BB6A 4K5VA 4GXBA 4HJGE 2EPBA 3CXCA 2IYDB 2J0KA 4IG7B 4A3EG 4HROA 4LNIA 4LFCQ 4ZRQA 4C80A 2B2VC 2L7RA 4A3MB 2ZW0A 2K52A 1KRSA 3I4OA 3G71A 4LNKA 4DWFA 2FBWB 4GN4B 3FKIH 2HUGA 2K05A 5A35A 1KH0A 2MBBB 3L54A 2WXLA 3DBLI 3QCAA 1VQAA 1LT5D 4A76A 1SDFA 4DV7L 3RN2A 1PZJD 4IUMB 1VMCA 4HEA1 3HOXH 3OSOA 3MEFA 3JYUA 1VZ7A 2RDHA 1HTOA 1E2WA 3PQIA 1SSOA 4YTMB 2DYOA 3VR4A 3MJ5A 3ZJUA 1WCMG 5JJIA 4DR7Q 3KVFB 3CCVA 4YL8A 1N5WA 3S16B 3KQ4A 3IAS1 4KKTA 2MBEA 1QCBD 2PZUA 1J5EL 4OIKA 4K3CA 4X57B 1PQSA 1R4NI 1LT4D 4B9KA 1K83H 1N62A 3DUZA 3P63A 1LM0A 5M3MG 4L63B 1IBMQ 2B63G 4JPSA 4B3RQ 1SXTA 3RLNA 1PH1A 2MX2A 3X3MA 3L3OC 3HUIA 4B9WA 3GTOH 1QLBB 3Q8BA 1E24A 1XYIA 2NVYB 3J81c 4LK0M 4BKGA 3VR9B 1F9QA 1I42A 5E6NA 1XF5L 2WXKA 3E5SA 1SNCA 1DOXA 4U68A 4PNYA 2PMZE 1PH4A 4KHVA 2F0QA 2VQFL 4LF8Q 3S2AA 1PFSA 2B76B 2RPVA 1UBQA 2RCFA 3CQZH 5T8IA 2L9HA 4DDGD 1ZP0B 3DDCB 1OXXK 1PGXA 4KN4C 2WDTB 3KF8B 4WQMA 1L2NA 1EUVB 5IO9A 3QJYA 1T9HA 3H7PB 1LO5D 3AU5A 2V0GA 2A68D 5GQOA 3J81E 1K3BC 4P1BC 5I6WA 1KJTA 1Q1OA 1MIUA 2R7FA 3SK6A 1MJDA 3BYTB 3AV8A 2IPKD 4B3TL 3IFTA 1UE5A 2G4DB 1FYCA 2B2VA 5D6JB 4G7HC 2Y0SE 4XYQA 1QB5D 4FF2A 5D3IB 4OZCA 4ILWA 4R1JA 4FHJA 2ZM6L 3HFZB 3A4RA 1HZBA 5CBEE 1K8OA 4NJ7A 2K22A 1VS0A 1SN8A 4ODGA 4ZUJA 1X3FA 1IKLA 3N20C 5CV7A 3PZ8A 4ZCKA 4A3FG 1YNND 4AOFA 1IUEA 1ZOYB 2PJHA 3H7SA 5ELBA 3SGIA 1V2YA 2B2YC 3DHHC 2WS3B 2VW9A 5HG2A 2XBBC 2UUBQ 2JU6X 3MHZA 2KEEA 4A3BG 4L5TA 5BN4A 2CU3A 2HHHQ 3H3VC 2XN9C 2O2VB 3EGRA 1RFAA 5CR3A 3PUXA 3UE0A 2X6GA 1WJUA 1FR3A 4P71A 3FC4A 4CHTB 4LFBQ 1KOTA 3WAPA 4X6AH 1MG4A 4L5SA 3P1MA 2CJOA 1YJ9A 4UPAA 5IP7H 3SR6A 2K3UA 3PF4A 4M8AA 3QWNA 5FOBB 5C4XH 3N9YC 4ZOHC 2LXCA 3EROA 1L1OA 2DAFA 3R66C 2DBYA 5C6AA 3DPDA 1K9MC 4ZDVA 2PCFB 3K59A 3N32A 4RGMA 4JOIC 5HURA 4A3GG 1EF1A 1YIWA 2PE9A 1BF4A 1M94A 1STYA 3BDOA 3BWUD 1ASZA 2K04A 3ML8A 2KBNA 3FPUB 1PTOF 2KMMA 1GUGA 3S14H 4RF0A 5CX3A 3CCJA 1VQIA 1AH9A 2NUCA 2M4NA 1XLOA 4X64L 4A3FH 2RDBC 4J1MA 4WIPA 2LGIA 3UIPB 4PMWA 5C0XI 3VDZA 2PMVA 3H6NA 1CTMA 4IOCA 3AE7B 2R61A 1C79A 1CK1A 3FVQA 4JVZA 1N34L 2D11A 1PMRA 2JA8H 3RZDB 1IPGA 3OMGA 3CMAA 2GBNA 2REXA 4A3IH 1WTPA 5C4XB 2K39A 1GXDC 3BZDB 4TQ1A 2D62A 5KNBA 4XT3B 2B2TA 2NS5A 5IP9H 5JOBA 4F7ZA 2D5DA 2W3RA 1FFUA 3Q6SA 4C3IH 2OHFA 2Q2IA 2VNUD 4KZCA 5LL6X 2XVSA 1FM0D 4HDQA 2D9UA 2B3AA 1BXTA 3C3LA 1QQRA 1CKOA 4G57A 1J19A 2K32A 3BY4B 3DBRI 3JSVA 2MNAA 4FXCA 2NYZD 2LS01 1GM5A 5C4XG 3ECIA 2IO3B 4X3TA 1HNZQ 4BBSH 4JI8L 4K7WA 2AKWB 2N1VA 3CQZB 4H0LC 3J80i 2K8CA 3B9JA 2DYBA 2NN6H 1LUZA 1K0SA 1WE7A 1UNSA 3DM1A 1N61A 5C2TB 1V49A 1F0ZA 1R4MB 1W3SA 3BZCA 2YTVA 3HOVH 4G50A 1EY4A 1UGMA 2Z6BA 3MFYA 1JQYD 2L83A 4GOPC 3KLRA 2DZIA 2VH2A 1WSPA 2AWOA 3NS8A 1E6EB 5BYQA 4BWGB 3BDCA 2KMAA 3KWLA 3N52A 5T1IA 3EN2A 3P20A 1OXTA 2R92G 1UZXB 2NPTB 1KDCA 1FXTB 1XMOL 1JCKB 1L4ZB 3NWTA 5JEAH 1DOIA 3NSWA 1G6JA 3PSEB 2JA8B 1FGBD 3GE8C 2KECA 4GN5A 1EU3A 3RI7C 2EJGC 3NBHA 4R8NA 2EYLA 4L23A 5J22A 1XMQQ 1C4AA 2JJQA 4BBSB 4ANXA 4LF9L 3A8JE 1A2UA 2ASQA 3DEPA 1BBXC 5AUIA 4P75A 4UP7A 1YHQA 4ZYSA 3Q23A 1Y14B 1OQQA 1XD3B 3PGZA 1PRTD 2HQEA 2Z0DB 3J7AV 4LNQA 3APCA 2WAQB 4A93B 3LXFA 3RCZA 3CU7A 1GG3A 1MPEA 1ZE3D 2KVZA 3WANA 2NZ1D 3GZNB 4IUQA 4OVUA 5DNFA 3ZVVA 1JOOA 1PUTA 1V1PA 1R9TH 1K3RA 2UWQA 3ZXVA 1CMXB 3ICEA 2M19A 1JE4A 1XLPA 2MBQA 4BBSG 3NVZA 1FRDA 1WGYA 4MHEA 2G1EA 3WIMA 1WXQA 2CH4W 4A3EH 3CIRB 2Q2TA 1ZXIA 4BOZB 5J2RA 2UXCQ 3B08A 2KXJA 2A73B 2QC8A 4M01A 1KC8C 3Q8AA 3L13A 1EZ8A 1QF6A 4LFBL 5JEAJ 3I4MB 1V9JA 4JIOU 1K83B 5BN5A 2KJHB 4OO1H 1TKYA 3KH0A 1N36L 2KD0A 3HOXG 4JI4Q 1QKZA 2HTHA 3JAML 5DM63 1LT6D 4KKSA 4JI7Q 4DN4M 3TBIB 1I7HA 3VUWA 1SR3A 1LTAD 4XDCA 2A6HD 5A2QL 1QJOA 1P3QU 1UBIA 4G7ZC 4L2YA 3AMZA 4HJ7A 1Z47A 1KQSA 2MFIA 3U50C 1TR5A 1WYDA 1AZQA 1YN4A 4KKIA 3PO2B 3K5LA 4AP4C 4HIDA 3PS6A 4YTPB 4RKBA 2VB3X 3KUPA 3KBXA 3K9OB 1DJRD 1QG7A 1SROA 1E1OA 1C0AA 4ASWC 4ARCA 1G6PA 3VYSA 4FP5D 1SEBD 5C44G 4BY7H 1UWVA 4ALPA 2IGDA 1I4PA 1KL9A 3S1QB 2I1JA 3Q3OC 3PUWA 3LDZE 2GBJA 2LKVA 1I4HA 3T56B 3M9BA 4N9TA 2DNFA 1IGDA 5FLXc 3N30A 2XSCA 4NXNL 3TMEA 1I50B 2K6AA 3MTNB 4RHRA 4DQOC 1PVOA 2KTRA 2OCEA 2CWAA 5CV9A 1WYGA 3FKYA 5G5GA 1B9MA 2HIVA 2CFMA 1VQ9A 1WX8A 5K36G 1IL8A 4OELB 1HZ9A 3T3OA 2GVBA 2GMIC 3CCUA 2IHFA 4C3IB 2CHBD 3ZIMA 3GTPB 1A3VA 3LWEA 1JQ4A 4ZHOA 4MDKE 2RGFA 3AE3B 1EY0A 1HNWQ 2A4ZA 2N8NA 4NAWB 5DAUA 4GN1A 4CO7A 1FFVA 1ENAA 5GAHC 3PUVA 4KLKA 1PYBA 1P98A 1O7YA 3UDIA 1D3ZA 3TBLD 2KKCA 1NI3A 1HNXL 5E6PA 1PHJA 1NTGA 5EGTA 1XMOQ 2C35B 3K7AB 3I4NG 4II3B 4YWGG 5AJ3L 1IBKQ 3FEWX 2FCMA 1C77A 4KZ0A 3AE9B 2WKDA 4JV5L 4FF4A 4K5WA 3K9PB 2YU9B 2Z4IA 1F2RC 5FJ8G 1DOYA 4YCVA 3N1YC 3OAWA 3KF8A 3T8MA 1X56A 1UGJA 1DXMA 2QKIC 3DXJC 4HSVA 2L1AA 3L0OA 5LMNL 1CKNA 2F0NA 2RF4A 1L0XB 3VH4B 3SE0A 3ZTDA 3I7FA 5ELEA 1J0GA 4MT5A 1TWAH 1YQBA 4BY1G 3TP7A 4CKEA 4A75A 3I3CA 4LWCA 1C7YA 2KQ3A 1VQ7A 1WGGA 2KDFB 2L55A 1WX7A 2W82A 2K5DA 4W9GA 1YMHE 1MVKA 2INCC 1B3AA 2FINB 4YWKA 1N32Q 4MEMA 4XC2A 4KY6A 4IPHA 2BKFA 1FNVA 4BXXG 2N4FA 3GTPH 1P0RA 2QDFA 2SNSA 4FN2A 2K01A 3CF6E 3E9SA 3N1ZC 4PS8A 4ZAIA 4AYBE 3U7DA 2KVMA 3GTKH 1C1YB 4ANWA 1RF2D 2PO4A 3V05A 3C8YA 5KRUA 2KDEB 2PVGC 3BYYB 2RA4A 1EIYB 3RZFA 4MJSB 5AZFA 4I6PA 4A3EB 1TWGH 3GTMB 1XTDA 1CZWA 4DAMA 3VTVA 3QOJA 2UUAQ 3D4WA 4P72A 1Y1WG 3L10B 2D5GA 1RIPA 2FMMA 2A6EC 2WINB 4R4CA 2RDGA 1U4AA 2EKEC 4LK1C 3LWUA 1O7LA 1CSPA 2CH4A 2UXBQ 1V1OA 1ZKOA 3A55A 4J6HA 3PF5A 1V80A 2V1YA 4EZKA 4ZKBB 3RULA 2BYTA 1D8LA 2F52A 2R92H 5IGEA 2E6XA 2GOWA 2PYKA 2KTFA 4EZLA 1EIHA 1C4PA 3K8AA 4FYDA 1CZPA 2F0UA 3CC4A 1I4QA 1F9SA 4PZ6A 3P4QB 2ZZPB 3BVGA 1AZPA 3CKIB 3I4NB 1TS4A 3HVDA 1MSHA 1TQOA 2F0MA 1JRPA 4RGTA 1N6ZA 1ICFB 2JK8A 1A3TA 1BUVT 1E3PA 1OXUA 1K52A 5JH5C 4GLAC 1Y8PB 2K5NA 3OG5A 4NY0A 4IUUA 5C1ZA 2CHXA 3KOJA 1V9PA 1WXMA 3MXNB 2BE5C 3DBLB 1O80A 4O2DA 2BF8B 2DWQA 2PQAB 3R93A 1TJEA 3A9JB 3UI3A 1AE2A 5NUCA 4P73A 4CDFC 3G48A 3ZW3A 4NAWA 2D07B 4XDDA 1X55A 3GV6A 1ET9A 3EIVA 3PREA 5GXGB 1SYFA 3AN1A 3AU4A 1YNTE 2Z1CA 4N8FA 3W1GA 3H3VH 4DHJD 2MRPA 1U4PA 4PT5A 1Q3LA 3ALBA 4WJOA 2LJIA 5EJWA 3H8HA 2KFJA 3MJWA 2NVXB 1WY8A 2AX5A 2Q5WD 2WACA 1G2TA 2IL8A 1KHIA 4NMZA 1JALA 2N9XA 4DK5A 1HNXQ 4JQWC 4DV0L 2SAKA 1IYFA 4IM3A 3KFUA 1K8GA 1TS3A 4EUTA 1R4QB 1IBKL 4EQPA 4C2MB 1WRDB 4C7ZA 3M4QA 1HR0Q 4QY7A 2JEBI 2MJEA 4HMJA 2WDQB 3I70A 5DPTA 4KD4A 2NMQA 3BU2A 1BOSA 5I9PA 4WORA 2R93H 4KGSA 1HZ5A 4R3DA 3ZO5B 1KRTA 4YT0B 5LNK1 2MJ8A 1CHQD 4JG2A 4DV6Q 4I7AA 4XWTA 1E7ZA 3M4YA 4IWPA 5G2NA 1WI5A 3CW2C 4BY7G 4A3KB 3F2BA 1YN5A 1WGHA 2WXRA 3Q6BA 1CZGA 1D5MC 4WWOA 1ZUD2 2ZJDA 3G6JB 4RM9A 3I73A 1EQTA 1SYGA 3U9SA 4F87A 2L0CA 1EIFA 1I6HH 4ICVA 1N34Q 2EMSA 2LXAA 2HIXA 2F0EA 1IBXB 1ZKHA 1SSNA 1QOHA 3TN2A 5FO8B 1WFYA 1WM2A 1CQVA 4YSYB 1D1IA 1F9PA 3RNAC 1I5FA 2ZJPA 3TCAA 3A33B 3AQQA 3NUHB 1STHA 2R6GA 1YITA 4EQ5A 1D2BA 3NZ3A 1G2SA 3RLFA 1PH9A 3BVMA 3AU7A 1MJEA 2KHWB 5T1GA 4IDIA 2ICIA 1L4DB 5L37A 1Z6HA 3I4LA 2AEHA 2WXQA 3ENEA 2INNE 1RYJA 3ZUNA 4QB4A 2F0JA 4DV2Q 2UUAL 4B0MA 2WXJA 3NZUA 4Q2JA 2MBOA 4EQNA 2B63H 3QJZA 1FNUA 2YTYA 2PLPA 1NBWA 3K7UC 2UXBL 4YHHL 2XEWA 4MH8A 2DX5B 4A6QA 1S5BD 4ABNA 1HTQA 1RCVD 5KEEA 1K51A 4H13C 4AS1A 4UAIA 1WFQA 2I5HA 2WIIB 2K8HA 3W1BA 1KNAA 4DA2A 3AULA 2JY6A 3I9V1 1SNMA 3MXUA 2EMTA 3VXWA 2A6HC 4IW0A 3GTQH 3PIOA 4PQXA 4QJFA 4HVBA 1KIXA 3VTWA 3ERQA 2K33A 5JXVA 3TEYA 1S3SG 1JWSD 2ENBA 3A8KE 4HCNB 4C3JH 2V9HA 1Q7YC 3VYRA 5IWAL 4OVVA 3CCLA 4MACA 5JHBA 1U0LA 4HR7B 4DPGA 4FXGC 4CKBA 5FR6A 3H91A 3E0JA 3NPPA 4DR2Q 5LLIA 3RLOA 1Y1VB 3MA2B 4XIGS 1FGUA 2IDYA 1FIQA 5M5XH 2AUJD 4LF9Q 2WHIA 4ZRKA 5M9OA 5FR3A 1RDPD 2KOXA 3APFA 2C9OA 3PCOB 2DZKA 2NBUA 2K14A 2ASBA 4PG3A 3RUZA 1T5XD 3NP8A 2YV5A 1H4RA 3K5NA 1JWAD 3AXCA 4OL7A 4KJOA 3RNFC 1WMHA 2LFIA 1VD2A 2IGHA 1TKEA 2J0MA 1I3QH 1B1ZA 4ACFA 4N9F4 3Q22A 1JB7A 1WR6E 2KZRA 4XGAB 5C4HA 2KENA 2BWFA 3K6OA 2IX0A 1B8AA 2PI2A 2KT7A 4NDXA 4JI1Q 1PH8A 3U58A 5JEAG 2L5TA 1Y1VH 3VA5A 5LMUL 1NEKB 3OW7A 4JK1C 4TKNA 2ALYB 4KY7A 2VZKB 4K6DA 4A3JG 1QOBA 4L5QA 1WD1A 1LTGD 2VZAA 1VDVA 2D3CA 3Q8CA 2E8GA 3KUDB 1SAPA 3DWAA 4B0EA 2LD9A 4DV0Q 2J0TD 2MHJA 2DHZA 1OO9B 4HPLB 4RG1A 1N36Q 1EOTA 3GTQB 3BK1A 2HTME 5E7NA 4Q5VA 4JI7L 1Y1WB 4JI3Q 2PTLA 4BKTA 4HRSA 3AFPA 1VQHA 4YWLA 2WAQG 4A93G 1E0BA 2X6LA 3GTJB 1VLBA 2JF5A 3URYA 3ETRA 1NMFA 4DUZL 4CKCA 1C9OA 1VQ8A 1T6BX 1V5TA 2KX0A 4IWOA 4LLGM 2L8JA 4DV3Q 5C3JB 2NVTB 4DR6L 4A3CH 2Z59B 4DFAA 1K8MA 1IW7C 5I2XA 2WXPA 3HOUB 2BKRB 3R7QA 2F0IA 2IWHA 2QSDA 4FBJB 2F0OA 1STNA 3D6CA 4BFRA 3ZNHB 3S16H 2ZXOA 1QE6A 1I6HB 1WF9A 2MA9B 1LV9A 3S1MH 5E6JA 1EF5A 4KVGB 1H95A 1WJJA 4IM2A 3MWYW 2EY5A 4B3MQ 1EY7A 1TS5A 2K8BA 4JI0Q 1XNRQ 2VY3A 2M56B 4RMFA 1XWEA 3D4RA 3H0GB 1YN3A 2FCSA 2DAJA 1CT1D 2ZPYA 1XCQL 5D94A 2KN5A 3RPFC 4OWTB 1PRTF 3RZDH 2M2LA 4LFAL 4FXDA 4N8X1 2EE1A 2KHIA 3F1ZA 3NHHA 3AMUA 1OEYJ 2QW7A 2E2HH 4XYCA 4OZAA 5KGUA 1O78A 1VQOA 3UINB 1B2TA 1WJ4A 1DGJA 1UE1A 2EOTA 5I6YA 1VQJA 4MGKE 1TT5B 1D6EC 4LF4Q 4RM8A 5C0XJ 5TR5A 3T3NA 5C4ZA 1XX8A 3OWEB 1E2VA 4A3DB 2IY5B 5IOIA 3V60A 4MJSA 1JE5A 2NPTA 5EE0A 1I6VC 4KMUC 3VRAB 1F2RI 1TTNA 1HPCA 3AEVA 4JYAL 4LF8L 2HDLA 1GHJA 5IYCH 1OGWA 2JQRB 2GVAA 3BG3A 5ELFA 1EO6A 2KWDA 4LF7L 2NN6G 1XXGA 4IFDI 2GRIA 5CTRC 3FKIB 4XXEA 1J7BA 5H8YE 2MEKA 3GOEA 1WXAA 3NBHB 2CR5A 3I5JC 1X3GA 1TBEA 2JYTA 2A69C 2R93G 2KO3A 1EWYC 4B3TQ 3EFCA 2PE6B 3CHBD 3KLWA 2JX5A 3SFEB 5IWAQ 3O13A 1E8YA 3A9KA 3W1SA 1PH3A 4IUPA 3RUIB 2BW2A 5EPJA 1NCVA 1LACA 1WOCA 2EVBA 3CAMA 2W55A 5FLMH 2B2YA 1N5XA 2V4LA 4PYUA 1M8AA 1YVCA 5M5YH 5C4JH 1QWYA 1SE9A 3J80L 2BS3B 4W9EA 2KACA 1W6JA 1MSGA 1KDAA 2KWCA 4C1NK 3QK0A 3C2PA 2VH1A 1JOKA 5BMGA 4MZ9A 4UP8A 2IZVB 5IOCA 1XNQQ 2DNEA 2NBFA 1Y69U 1TKGA 2C60A 1V81A
chains in the Genus database with same CATH topology
1K53A 2WP9B 1I4GA 2WP8J 4IFDH 2BB5A 3FILA 2ICEC 2V3NA 4IUTA 1DM0B 2Y5CA 2IJ0A 1LLRD 2VZKD 5EKIA 3VRBB 4JWUC 1L6UA 4RHSA 4A3FB 2K03A 3M85A 2OT2A 1H9KA 2TSSA 4IURA 4KX6B 1ESRA 1L5PA 1DOKA 2XRSD 4LMQD 2BCOA 2OXPA 3IT4B 3MFGA 4IQZA 1Y8OB 1S5ED 3R8BA 1EY8A 4HTHA 1F2MA 3E56A 2EYFA 2PW9A 3TP8A 1OXVA 1Q12A 4QCLA 1KLGD 4L6TB 4WJWA 3VA7A 3K58A 4TRDA 1EWHA 1SMYD 2AQ1B 2JWUA 2RKSA 5I4DA 5C3EB 1PXUA 4S3SA 2N9KA 5COYA 2XNAC 1P7EA 1K50A 3D8GA 4KJNA 3T4AC 2V4IB 2FUG1 2J53A 1HA6A 2QIEB 1E9MA 1N60A 3NXWA 1WCMB 2Q8TA 1AFPA 4NZLB 1KABA 3HGBA 1GUSA 3TZUA 4N6EB 1QT9A 1LABA 1HEZE 3AE1B 3ZYYX 2PQEA 5CV5A 3PO3B 5HGTA 1LT3D 2KUMA 5JJZA 3GS2A 1S5FD 2QEJC 1O7ZA 1SE3A 3R3OA 1L0VB 1IYUA 2LHEA 2DYMA 2B8GA 2WXOA 1H9SB 1C9FA 1CI3M 2Y3AA 2WU2B 3GTLB 2F03A 2PW7A 3A7AB 5EE9A 4A90A 3J9CA 5H92C 1PZKD 4BA1I 2B39A 2NB0A 1JB3A 1FMAD 1DYQA 3V2TA 1VZ6A 4AYBB 5JPNC 1STBA 1XLNA 2N0SB 4I65A 3AE4B 1WTVA 1MD2D 1Q10A 3ND9A 3OMCA 2CW0D 2H89B 2RDFA 2IGGA 1PZID 1DCZA 2JP1A 2R3ZA 4IALA 1ROEA 1JOQA 3WOEA 1PTOC 1NAPA 1PGBA 2RMMA 1D4BA 2PNRC 2L4NA 3GTKB 1ET6A 2DNCA 1B53A 2BA1A 3MXPA 1UEAB 1A6XA 2B2WC 2K5WA 1DOLA 2E2IB 2VB2X 2E2DC 1SIJA 3RFZB 2YEPF 4Q0FA 3GO5A 1JR0D 4N9PA 1JMLA 4LTUA 2F0GA 2A68C 2IW3A 4KKUA 4X3SA 4MT5A 2MP1A 3NVWA 1E2ZA 1R9TB 1G91A 4YSZB 5K5PA 4YIJA 3EFXD 1R4PB 3R2IA 1BO0A 2JEAI 2AQ2B 3C1FA 3KBGA 3P75A 4GDKB 2F3WA 2O2LD 3MTSA 2M9VA 1F2YA 1WTXA 5EKLA 5FLXL 2KCNA 2CW0C 5CC4A 5C5MA 3HRZC 4K5XA 3W2DA 4KN7C 3S1NB 1YQ3B 1IBXA 3GQBA 2NVQB 5HI1A 2A74C 4A3IB 4M0WA 2JSOA 2TMPA 4CJ2C 3EA6A 3VR6A 3JAME 3OIQA 2A69D 1C48A 3MXGA 5A2QE 2JZPA 4B9XA 3U7ZA 3H94A 2N9LA 1FNWA 3RD4A 3WOFA 2SEBD 3DWGC 2MH7A 3LNNA 2BTEA 4U673 2F3VA 2F0WA 2O4XA 1RD9D 2YYZA 2MJ3A 4KTAA 1TWCB 1V97A 5E4XA 2R93B 1Q1BA 2OEDA 4MIUA 1ZDXA 1F77A 5IGBA 2W3SA 3PZ7A 1VJKA 1GUOA 1IHZA 1QOAA 2R92B 4MM3B 2BS2B 1MBYA 1SE2A 1U4RA 4ZKCB 3HS0C 1E10A 1HCZA 1UAPA 2BOSA 2EXZA 4XWWA 3AH7A 1UWMA 1TWGB 4J8QA 3I72A 1HFGA 1QNKA 3OPOA 4IUVA 1TWHB 1NVID 3PUYA 4HMIA 5AFWA 5C44B 1EYCA 1STEA 1II3A 2I07B 1CQFA 4DAPA 1F9RA 2EY1A 4HAEA 4ZUIA 2CQAA 4DF7A 1HA5A 1RKNA 2EYHA 1J7CA 5HHDG 3P1HA 5EBDA 3Q24A 1DZ1A 4F88A 1LTRD 4CJ0B 3HZXA 3WDNA 1WVLA 1JORA 4N58A 1MI0A 2F0HA 5KNCA 2FFKB 3E6ZX 3ND8A 3AE2B 5FLXE 2L52A 3UI2A 1NR4A 3SVMA 4BY1B 1A70A 1VDZA 1SNQA 2EZVA 1J7AA 4O1NA 3ITPA 2WU5B 2OF1A 4A55A 2FE8A 3MZ5A 4GZYC 1LTID 2JXMB 4OVZA 1HHVA 1ILQA 3Q8FA 1QOFA 5BYSA 3U52E 2EKIA 1PDQA 4K8IA 2H88B 1A2TA 3LB8C 4KK7A 1VF5C 4E6IA 4G7OC 2CVRA 1NYRA 1PRTB 4ZRZA 1GAQB 2N7JA 3QB3A 3OHXC 4Z9CB 4NJCA 1YJJA 4C3IG 1BCPF 3NS1A 5FK9C 1S5CD 3SDZA 5KIXA 3SK5A 1STGA 1KF6B 2NN6I 3TEZA 2EYMA 4IFDG 2DY8A 3MEHA 3KK7A 5BMIA 1EQVA 3SXHA 4H7BA 1ESFA 3DWMA 5DEHA 3S2DB 3QOLA 3NK9A 1PFBA 2RVLA 2QF7A 2IT1A 1Y56A 2ON8A 1Q1EA 1ONLA 2N88A 3T13A 2LEKA 1ICWA 1WRIA 2B63B 1XLQA 4FF1A 5JPMC 4PMBA 4G4KA 3BIID 5BN3A 4WRDA 3N6RA 3TUOA 4IUNA 3X3NA 2PPBC 1F2LA 4RAUC 1EEFD 4HKQA 4MN3A 2F0VA 1RHPA 3TEWA 3AEDB 1HXYD 3M4OB 5FO9B 1H9SA 4ZRPA 5KYLA 5CMDA 4HN7A 3G7LA 4BY7B 3NTHA 1HTPA 5CV4A 4LJZC 1I4RA 1ACCA 1SNPA 3S1MB 3P4SB 2JYEA 2SDFA 4O42A 4QIWB 1VRAB 1QNUA 3L7ZC 3V96A 2X69A 1RJTA 1WTRA 4EGVA 3TDQA 3C46A 2I46A 4ULLA 4WH4A 4D2KA 2BE5D 5E1FA 4REZA 2DY7A 2YEPB 1BR9A 2M0AA 3SHLA 3U2SC 1QILA 4K2LA 1RFKA 3K5MA 4GDLB 4RGNA 3EUB2 4K8JA 3VYUA 1N63A 2EELA 1IYVA 1L0YB 2A5HA 1TZOA 1AWDA 1F2ZA 2K5PA 4Q2JA 3ZQ4A 2KQ4X 3AEAB 3I57A 3ZGZA 1FEHA 4DAVA 1JWBD 1TYGB 5EQ0A 4RWSC 4P16A 1RODA 3AB9A 1W6KA 5MPOA 1D5XC 2K9XA 3DWQA 2PZTA 3HOZB 2PVOD 5EE1A 3P7JA 5LHY1 5IT9E 5FKAC 1C4CA 1G291 4FVMA 1NYQA 3P4PB 3EJIA 4JWSC 1U4MA 4EVOA 4NKLA 4XQNA 1PGAA 5FO7B 4OZBA 4OIJA 3OWFA 4FF3A 2B2UC 1B44D 2B2UA 1TU2B 4R8IA 4BBRB 4OO1I 4C56C 3AE6B 3AEFB 2F0PA 3MAQA 2LMCA 1PTOH 3L4PA 3FRPB 4XDXA 3VR3A 1GB1A 1B9RA 1YNNC 2Y0SB 4ID6A 3DWPA 4US9A 1BNZA 2EJMA 5IGGA 1HQMC 3TP6A 2SNMA 2I2YA 2FMCA 1CM9A 4KV6A 1U9RA 2QJLA 1FO4A 3ZJTA 3SEBA 1LTTD 3A54A 1XCTL 1Q90A 1ILPA 5C0XH 1WTOA 4DAYA 3IL8A 2ID0A 1KNEA 2F4IA 2L1BA 4I7ZC 4HSPA 5J39A 3V3XA 3J81L 1MI2A 4R9WA 5JVH3 2MGSA 3NVYA 4XTCS 3S17B 2MUYA 4A3JB 3P4RB 1H9MA 5CYUA 2QILA 3HVZA 4JE3B 4P2CB 2KOLA 2V3PA 2BA0A 1M4VA 4DNRB 1V8CA 2ZXRA 3D31A 1BCPC 4DK0A 1STAA 3NTIA 5IGDA 3AE8B 3K0YA 3HOXB 4FNFA 3NQTA 2WKCA 1TY2A 1FD7D 1TWFB 5CV8A 2K1BA 3L9AX 5HFYA 1ZEQX 2J42A 1V43A 1T5EA 4FXKC 2WXHA 4JBWA 1ZXHA 1SNOA 2AQ3B 5G5HA 2L11A 4IFDJ 1YJIA 5IT9L 3NBIA 5IGCA 1SYEA 1ZYRC 4HEDA 1GOZA 5C3WA 4V190 2VUMB 3T16A 1SF0A 1AP0A 1CFMA 4C3JG 4F8MA 3AECB 1C78A 3A8IE 5M3FB 2ONQA 5EKKA 1H9RA 1TWAB 3J80E 5KNDA 2DLBA 5I2YA 4XT1B 1BUIC 1YQ4B 2J52A 1GUTA 4XQJA 2F0KA 5G3LF 1ZDVA 4TMAB 2VXWA 2G9DA 3CRKC 3P42A 4RF1A 1VR9A 1BQQT 4WAFA 3VQIA 1FCCC 3VR8B 4RH6A 2H1EA 1X3QA 1A3UA 3SK8A 2NTSA 2WXGA 5F2DA 3HP3A 5C4JB 5M5YB 2JA5B 4HCSA 2PIAA 2HCCA 4WFN3 3NWSA 1HRJA 1SB3C 2J4XA 1WTWA 2KAJA 3D3RA 1EY9A 3FILB 2EYOA 2Q8RE 3GP7A 2WXNA 4KI0A 1ZPSA 3GD7A 1ZYRD 1XO3A 1OXSC 1HTLD 2L12A 1ML0D 2Y5PA 1BMLC 1JWUD 2N55A 4RCNA 3MXNA 1DD2A 1AYFA 5I9OA 3GTOB 4YXDB 4QMGA 1MHHE 3PMFA 2QMTA 1GUNA 1AN8A 2RSOA 3AEBB 1NR2A 1RTOA 1PFNA 3HOYB 4C7YA 1XEEA 1C8CA 5M5WB 2EDGA 3W3AA 2H4OA 3U9OA 1AW7A 2D2CC 2F1MA 3U4EG 1ENCA 3SR1A 3ABVB 1QOGA 1SBBB 2WLBA 4HKZE 2F0SA 5DM73 5CV6A 4BA2I 2F0LA 1BDOA 2B2TC 3AE5B 4DGZA 4X3UA 1IKMA 5TSSA 3GTGB 4M1UB 4RFBA 3HEJA 3F2UA 3M7GA 5JAVA 4OO1G 1JICA 2PMZB 4TSSA 4K2KA 1PYWD 3KWVA 3DHQA 1DOMA 2JE6I 3W9CB 3DEOA 3M7NA 3GB1A 3WCQA 1CA6A 1KRHA 2KN4A 4B08A 4F7XA 1VMPA 5CORA 5C0XG 1C76A 2GA4B 2RQXA 4ZQ3A 3W5VB 3R2TA 1VCIA 1WWTA 2XIWA 2LY7A 3OIPA 1B50A 2MPMA 1G8ZD 2WXMA 3A7LA 2KJXA 4KY5A 4CBVA 2I38A 3T53B 5ELCA 3VR5A 1VZ8A 2R7ZB 4OW0A 1HZ6A 2EY2A 2ZT9C 1LTSD 1JC7A 5ISRA 1ENFA 4K14A 3A56A 3PV0A 3I91A 2Q8IB 1I4XA 3J7YW 3IFDA 2E3TA 2WB1B 4XE0A 2EYPA 1NUCA 1EM7A 1GHKA 1NSNS 4LAAA 2LFNA 3SFDB 2RBMA 3D4DA 4DK1A 2HDMA 2RSNA 1EU4A 1S4ZA 3HOVB 3HG9A 1EL0A 1EZ6A 3K57A 3RZOB 1T3QA 2KDMA 3BS1A 2K28A 3AB5A 1EFID 2F0FA 3H09A 5EPLA 1Z7TA 4QF4A 3MP9A 2KEDA 3MVVA 2E74C 1KDBA 4NW2A 4US8A 3FPPA 1SE4A 4KGTA 1PTOD 3CRLC 4A3BB 5M5XB 4A8XC 2K0PA 3QG1A 4PV1C 2NTTA 3ONAB 4BS9A 1MHXA 5IGFA 3BK2A 2IX1A 2JSVX 2HDEA 3PO0A 2M00A 3W5UB 5C5LA 5CBAE 5EPKA 1R7SA 1SFOB 3IAM1 1HUMA 4L1BA 1SYCA 2ZXPA 1GUWA 3SK4A 2BS4B 4N59A 5E4WC 3TEXA 2B2WA 3KLSX 3NE5B 2GI9A 3VR2A 4C3HG 4RCOA 1S5DD 1RWSA 2MHVA 1TT2A 3K5OA 2K5QA 3RMHA 5AUKA 2PZWA 2KCCA 1RTNA 2F0DA 2FJ2A 2ZW1A 1EYAA 2DN8A 2K7VA 2WXFA 4YSXB 1C4QA 1X3PA 3I90A 2JXTA 3PUZA 3I8ZA 4ZLTF 3Q69A 2PW5A 1KAAA 1YNJC 2WNMA 4L8JA 3NTKA 1JW9D 5IODA 2HCIA 1ZXTA 2L32A 2OEOA 1BCPD 3FDTA 3NRZA 4RA8A 1TKWB 2EYJA 1L6VA 4RNAA 4OGQC 1GJXA 2Z4HA 2JYOA 2BDOA 4GLSC 3HKZB 2LMCB 4KHZA 1J9OA 4H44C 3NVVA 4PMCA 4DU9A 5C3XA 3Q0AA 4A3GB 1I3QB 5D7GA 2BDNA 2W54A 1EIGA 3S2HB 1WGKA 1IGCA 1E7PB 3EVQA 4EE2A 2EJFC 1TS2A 1HQRD 2CJNA 2C5CA 3D6WA 3J7AF 3PIP3 1EWCA 4FO2A 3EQLC 1DONA 4YTNB 5EE3A 4AQ7A 1SYBA 1EY6A 4QUCA 4ARIA 1FRRA 2V4DA 2X38A 2GB1A 2ACZB 1Q8IA 3QO2A 5ELDA 4RGOS 1EEID 4C3HB 1J8IA 4USAA 1KFYB 2EY6A 1PTOB 4K6LA 1OFFA 3NQIA 1MGSA 1B4OA 4KGRA 5LL6S 2PKOA 1LTBD 1Y8NB 4DNTB 3FAHA 4P6VF 4QUFA 2LUMA 1HFNA 4IKGA 2AUKA 5BMHA 5E3FA 1WTQA 4KKJA 3KLSA 3IAYA 4CGYB 1SNDA 4CQNA 3S9WA 2Z8LA 1KLUD 1H9JA 2A6ED 5BYRA 1SJED 3IKJA 1G6ZA 5CGKA 5D14A 1P7FA 3AEGB 4IOIE 2E2HB 3GV3A 2G9HD 4ZK9B 3Q8EA 1JWMD 3NUCA 2SOBA 5G3LD 3VYTA 1FD6A 5IIFA 2O5IC 4WWMA 3OOCA 1RM6C 3T51B 2QCPX 3AEEB 2E75C 1CJEA 2KA7A 4J3OD 1U4LA 5JVG3 4X3KA 2BT6A 3MHBA 5M3MB 4V0BA 3B2FA 4TKOB 2WDVB 1A15A 3HOWB 3ZJVA 2B8FA 3S1RB 3AM9A 1B9NA 1SYDA 3C1EA 1EYDA 2J7ZA 4DXFA 1X32A 1HUNA 2E76C 3TZDA 4OHJA 2O5JC 3QIAA 3H6MA 1FXIA 3LX0A 2AWNA 1BCPB 4H2AA 4ZHPA 2INPE 4ME5A 4NP5A 2BBCA 1UUPA 2NWGA 1OQRA 1V1PB 1WD0A 3FMCA 1JROA 1TY0A 3TP5A 2FHTA 4DXGA 1PRTC 1FXAA 3DMUA 2MJDA 5EBCA 4RKLA 2XWJB 4TQ0A 1SMYC 5J1ZA 2QDBA 5K36H 4CJ1B 1TIID 2WDRB 2E2JB 2WQYB 3IXSA 2XRQD 1CHPD 3M3YB 4EQOA 3MC0B 4HCEA 1D1KA 3BVZA 1FCLA 1CA5A 3IT6B 4TQUS 4ITKA 2JA6B 2IX3A 4IZ8A 1PFDA 1E0ZA 2XWBB 4Y7NB 4IN3A 2LHDA 1PDXA 2WXIA 1UWXA 1PFMA 5KYIA 4UDUC 3CWIA 3TSSA 2F0TA 3HRDD 1GB4A 1D5ZC 2WV6D 4KD3A 4WURA 2KHSA 1EY5A 3B2GA 4A9AA 1VF7A 3S15B 2JA7B 1GPXA 1YNJD 4C3JB 4JX1C 1XTCD 1SJHD 4C1NI 5D3DA 4XQQA 3BDLA 3S14B 3PIO3 4NAMA 4XYOA 1TVXA 5D65A 1PLFA 3LYYA 1NENB 1AEXA 1KTKA 1V8QA 1IW7D 2BB6A 4K5VA 4HJGE 2EPBA 4ZRQA 4HROA 4C80A 2B2VC 4A3MB 2ZW0A 2FBWB 2HUGA 2K05A 5A35A 1KH0A 2WXLA 1LT5D 1SDFA 1PZJD 1VMCA 4HEA1 3OSOA 1VZ7A 2RDHA 1E2WA 1SSOA 4YTMB 2DYOA 3VR4A 3MJ5A 3ZJUA 1N5WA 3S16B 3KQ4A 3IAS1 4KKTA 1QCBD 2PZUA 4OIKA 1LT4D 1N62A 3DUZA 3P63A 4L63B 4JPSA 1SXTA 3X3MA 3L3OC 3HUIA 4B9WA 1QLBB 3Q8BA 1XYIA 2NVYB 4LK0M 3VR9B 1F9QA 1XF5L 2WXKA 3E5SA 1SNCA 1DOXA 4U68A 4PNYA 4KHVA 2F0QA 2RPVA 2B76B 5T8IA 2L9HA 1ZP0B 1OXXK 1PGXA 4KN4C 4WQMA 3QJYA 2V0GA 1LO5D 2A68D 3J81E 5I6WA 3SK6A 3AV8A 3BYTB 2IPKD 3IFTA 1FYCA 2B2VA 4G7HC 4XYQA 1QB5D 4FF2A 5D3IB 4OZCA 4ILWA 5CBEE 1K8OA 2K22A 4ODGA 4ZUJA 1IKLA 5CV7A 3PZ8A 1YNND 1IUEA 1ZOYB 5ELBA 2B2YC 2WS3B 5HG2A 2JU6X 3MHZA 2KEEA 5BN4A 2CU3A 3H3VC 2XN9C 3EGRA 5CR3A 3PUXA 2X6GA 1FR3A 3FC4A 4CHTB 3P1MA 2CJOA 3SR6A 2K3UA 4M8AA 3QWNA 5FOBB 3N9YC 4ZOHC 3EROA 2DBYA 5C6AA 2PCFB 3K59A 4RGMA 5HURA 1BF4A 1STYA 3BDOA 3BWUD 2K04A 3FPUB 1PTOF 2KMMA 1GUGA 4RF0A 2NUCA 4WIPA 1XLOA 4J1MA 2LGIA 4PMWA 5C0XI 2PMVA 1CTMA 3AE7B 2R61A 1C79A 1CK1A 3FVQA 1PMRA 3RZDB 3OMGA 1WTPA 5C4XB 1GXDC 3BZDB 4TQ1A 2D62A 5KNBA 4XT3B 2B2TA 5JOBA 2D5DA 2W3RA 1FFUA 3Q6SA 2OHFA 2VNUD 5LL6X 2XVSA 1FM0D 2D9UA 1BXTA 3C3LA 1QQRA 4G57A 2K32A 4FXCA 2NYZD 2LS01 4X3TA 3B9JA 3CQZB 4H0LC 2NN6H 1UNSA 3DM1A 1N61A 5C2TB 1F0ZA 1EY4A 3MFYA 1JQYD 2L83A 3KLRA 1WSPA 2AWOA 1E6EB 5BYQA 4BWGB 3BDCA 3KWLA 3N52A 5T1IA 3P20A 1OXTA 1KDCA 1L4ZB 1JCKB 3NWTA 5JEAH 1DOIA 3NSWA 2JA8B 1FGBD 2KECA 1EU3A 2EJGC 3NBHA 4R8NA 2EYLA 4L23A 5J22A 1C4AA 4BBSB 3A8JE 1A2UA 3DEPA 1BBXC 5AUIA 4ZYSA 3Q23A 1OQQA 1PRTD 2HQEA 3J7AV 2WAQB 4A93B 3LXFA 3CU7A 1MPEA 1ZE3D 2NZ1D 4IUQA 5DNFA 1JOOA 1PUTA 1V1PA 2M19A 1JE4A 1XLPA 3NVZA 1FRDA 2G1EA 4MHEA 1WXQA 3CIRB 1ZXIA 2A73B 3Q8AA 1EZ8A 1QF6A 5JEAJ 3I4MB 1K83B 5BN5A 4OO1H 1TKYA 1QKZA 3JAML 5DM63 1LT6D 4KKSA 4DN4M 3TBIB 1I7HA 1LTAD 4XDCA 2A6HD 5A2QL 1QJOA 4G7ZC 4L2YA 3AMZA 1Z47A 1TR5A 1AZQA 1YN4A 4KKIA 3PO2B 3K5LA 4YTPB 4RKBA 2VB3X 3KUPA 3KBXA 1DJRD 1QG7A 4ARCA 3VYSA 4FP5D 1SEBD 2IGDA 1I4PA 3S1QB 3PUWA 2LKVA 1I4HA 3T56B 4N9TA 1IGDA 2XSCA 3TMEA 1I50B 2K6AA 4RHRA 4DQOC 5CV9A 1WYGA 5G5GA 1B9MA 5K36G 1IL8A 3T3OA 4C3IB 2CHBD 3GTPB 1A3VA 3LWEA 1JQ4A 4ZHOA 3AE3B 1EY0A 4NAWB 5DAUA 1FFVA 1ENAA 3PUVA 1O7YA 1NI3A 5EGTA 3K7AB 4YWGG 3FEWX 1C77A 3AE9B 2WKDA 4FF4A 4K5WA 2YU9B 2Z4IA 1F2RC 1DOYA 3KF8A 1UGJA 1DXMA 2QKIC 3DXJC 4HSVA 2L1AA 2F0NA 1L0XB 3SE0A 5ELEA 3TP7A 4CKEA 3I3CA 2KQ3A 2L55A 2W82A 2K5DA 1YMHE 1MVKA 1B3AA 2FINB 4KY6A 1FNVA 2SNSA 2K01A 3E9SA 4ZAIA 2KVMA 1RF2D 2PO4A 3V05A 3C8YA 5KRUA 2PVGC 3BYYB 2RA4A 4A3EB 3GTMB 1CZWA 3QOJA 3D4WA 2D5GA 2FMMA 2A6EC 2WINB 2RDGA 3LWUA 1O7LA 4LK1C 1V1OA 1ZKOA 3A55A 4J6HA 4ZKBB 2BYTA 5IGEA 2E6XA 2PYKA 1EIHA 1C4PA 4FYDA 1CZPA 2F0UA 1I4QA 1F9SA 3P4QB 3BVGA 1AZPA 3CKIB 3I4NB 1TS4A 3HVDA 1MSHA 1TQOA 2F0MA 1JRPA 4RGTA 1A3TA 1BUVT 1OXUA 1K52A 1Y8PB 4IUUA 2BE5C 1O80A 2DWQA 3R93A 1TJEA 3UI3A 5NUCA 4XDDA 3GV6A 1ET9A 5GXGB 1SYFA 3AN1A 1YNTE 2Z1CA 4PT5A 1U4PA 1Q3LA 2LJIA 5EJWA 3H8HA 2NVXB 2AX5A 2Q5WD 2WACA 1G2TA 2IL8A 4NMZA 1JALA 2SAKA 1TS3A 1R4QB 4EQPA 4C2MB 4C7ZA 2JEBI 2MJEA 4HMJA 2WDQB 3I70A 4KD4A 2NMQA 1BOSA 5I9PA 4WORA 4KGSA 1HZ5A 4R3DA 4YT0B 5LNK1 2MJ8A 1CHQD 4XWTA 3M4YA 4A3KB 1YN5A 2WXRA 1CZGA 1D5MC 1ZUD2 3G6JB 3I73A 1EQTA 1SYGA 3U9SA 4F87A 2L0CA 2F0EA 1IBXB 1SSNA 1QOHA 3TN2A 5FO8B 1CQVA 4YSYB 1D1IA 1F9PA 3NUHB 1STHA 2R6GA 1D2BA 3NZ3A 1G2SA 3RLFA 3BVMA 3AU7A 5T1GA 4IDIA 2ICIA 1L4DB 1Z6HA 3I4LA 2WXQA 2INNE 1RYJA 4B0MA 4QB4A 2F0JA 2WXJA 4EQNA 1FNUA 2PLPA 4MH8A 4A6QA 1S5BD 4ABNA 1RCVD 5KEEA 1K51A 4H13C 4AS1A 4UAIA 2WIIB 1KNAA 4DA2A 3I9V1 1SNMA 3MXUA 2A6HC 4PQXA 3ERQA 2K33A 5JXVA 3TEYA 1JWSD 2ENBA 3A8KE 3VYRA 4MACA 4HR7B 4FXGC 4CKBA 3H91A 3E0JA 3NPPA 1Y1VB 3MA2B 4XIGS 2IDYA 1FIQA 2AUJD 5M9OA 5FR3A 1RDPD 2C9OA 3RUZA 1T5XD 3NP8A 3K5NA 1JWAD 4OL7A 4KJOA 2LFIA 2IGHA 1TKEA 1B1ZA 3Q22A 5C4HA 3K6OA 2IX0A 4NDXA 5JEAG 2L5TA 3VA5A 1NEKB 3OW7A 4JK1C 4KY7A 2VZKB 4K6DA 1QOBA 3Q8CA 1WD1A 1LTGD 1VDVA 1SAPA 3DWAA 4B0EA 2J0TD 1OO9B 1EOTA 3GTQB 3BK1A 2HTME 4Q5VA 1Y1WB 2PTLA 4HRSA 1E0BA 2X6LA 3GTJB 1VLBA 3URYA 3ETRA 4CKCA 1T6BX 4LLGM 5C3JB 2NVTB 4DFAA 1K8MA 1IW7C 5I2XA 2WXPA 3HOUB 2F0IA 2IWHA 2QSDA 2F0OA 1STNA 3D6CA 2ZXOA 1QE6A 1I6HB 1LV9A 5E6JA 3MWYW 2EY5A 1EY7A 1TS5A 2M56B 1XWEA 3D4RA 3H0GB 1YN3A 1CT1D 1XCQL 3RPFC 1PRTF 2M2LA 4FXDA 2EE1A 3NHHA 3AMUA 4OZAA 5KGUA