1HXYD

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
total genus 66
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hxyD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hxyD02
3BYTB 2XN9C 1JQYD 2WV6D 1FD7D 2CHBD 2XNAC 2IJ0A 5ELCA 1JR0D 4RCOA 1LO5D 3BVMA 2QILA 1D5ZC 1F77A 1LTAD 1ESFA 1HA5A 1HXYD 1UUPA 5ELDA 3W2DA 1RF2D 1ET9A 1XTCD 5FK9C 1V1OA 1PYWD 1PRTD 1B1ZA 2RDGA 3MC0B 1I4GA 2IPKD 4DXFA 1SEBD 1BCPC 4L6TB 1PTOF 1XXGA 3BVGA 1LTGD 1FNUA 4L63B 1CHPD 1JWSD 1L0YB 2TSSA 1PRTF 3MFGA 4ZYSA 3SEBA 3BVZA 1D5XC 1EU3A 1JWUD 1LT6D 2XRSD 1I4QA 4O1NA 4RFBA 4RHSA 3URYA 1LT3D 1M4VA 3DWPA 1LTTD 1ENFA 3KLSX 2J4XA 1DJRD 1YN3A 1EEFD 1KLGD 1MD2D 1CK1A 1PZKD 1PTOC 3R2TA 1RCVD 1EEID 4RGMA 1SJHD 1I4HA 3GP7A 5D3DA 3V05A 1JWMD 1KLUD 1LTID 4RGTA 1LTRD 1GOZA 1EFID 1V1PB 1FGBD 4RGNA 1RD9D 5ELBA 1JCKB 1YN5A 1PRTB 1I4PA 1PRTC 1EU4A 1SXTA 1AW7A 4RGOS 3R8BA 1KTKA 1S5BD 1LT4D 1HQRD 1I4XA 3CHBD 1AN8A 1PZID 1V1PA 5D3IB 1D6EC 1S5ED 3R2IA 4UDUC 2NTTA 3TSSA 2ICIA 1TS4A 5ELEA 1B44D 5ELFA 3EFXD 2Z8LA 1BCPB 1DYQA 1SE3A 1I4RA 1TS2A 2QEJC 4NZLB 5TSSA 1YN4A 1D5MC 1LLRD 1EWCA 1T5XD 1FNVA 5FKAC 1LTSD 1LTBD 1PTOD 1S5CD 4OHJA 4TSSA 1ET6A 1STEA 1CQVA 1TY0A 2AQ1B 1SJED 1BCPF 2O2LD 3BZDB 1TY2A 3EA6A 1FNWA 3OWEB 3DWAA 4RH6A 1BCPD 4C56C 1PZJD 1S5FD 4BWGB 4DXGA 3DWQA 1HTLD 2AQ3B 2R61A 2G9HD 1L0XB 5I4DA 1TS3A 1PTOH 2NTSA 1CT1D 1BXTA 4K6LA 1SE2A 1UNSA 2RDHA 1SBBB 4RHRA 2SEBD 3BYYB 1RDPD 4Z9CB 1G8ZD 3O13A 1PTOB 1LT5D 2AQ2B 1CHQD 1TS5A 2XRQD 1SE4A 1S5DD 1QILA
chains in the Genus database with same CATH superfamily
3PUWA 3E3XA 3ZQ4A 5E4XA 1FFVA 1JQYD 3EROA 1VMCA 3HOUG 3PV0A 4DUYQ 1UGMA 2A6ED 4DNTB 4DR1Q 4N8FA 3OMCA 3HKZB 3DCGA 2F0PA 2JYEA 3HIZA 5TR5A 1G6JA 4WJOA 1HZBA 1V97A 3CIRB 4MT5A 5JJIA 1VQMA 1AZPA 2M56B 1K51A 5MPOA 1XX8A 2VXWA 5DNFA 1S1QB 1X6OA 2JA5B 1B3AA 2RPQA 3JVZX 4UPAA 3MJ5A 3Q3OC 1PUTA 1BO0A 2KQSA 5CTRC 5E4WC 1EF1A 2Y5PA 3AE4B 3L7ZC 3TN2A 4DGZA 3VTVA 4DU9A 3ULPA 2J0MA 3S2AA 3RCZA 1JJCB 2Q8RE 4WQOB 2WAQB 5CC4A 4CBVA 4YSYB 2LRWA 1IYJB 2CFMA 2C9WB 4KTAA 1TWFB 3M85A 2AWTA 3BDLA 2RSUA 1FFUA 2HJ8A 5JEAG 3PZ7A 1WJJA 1JWUD 3S1QH 4PQXA 1K83B 3M95A 3J80c 4JI1L 4A3GH 2Z9HA 4C3IH 1X3QA 3H6MA 4OONA 1J5EQ 2I38A 2LGXA 1XYIA 4GKJL 1FRDA 4BBRB 3ZTCA 2K33A 2OTJA 2HHHL 5HGQA 2UUCQ 4P1CC 4JVZA 3JAML 1SJHD 3GP7A 1EIFA 2MX2A 5CHWA 1D8LA 2OF1A 3RD2A 4BBRG 2VB2X 3RFZB 4HK2A 5K36H 2VL6A 1GUWA 1U9RA 4HJ7A 3S17B 2JQOA 2Y3AA 3GV3A 4B95A 4MTKA 2YU9H 3HOZH 1SXTA 4DNRB 4DV4L 4X6AH 4ZRIA 3NWTA 2FMMA 2I46A 5EJWA 1E90A 2EY2A 2QDBA 3AEBB 4KN4C 5BN4A 2LASA 1BBUA 3GZNI 2F52A 1IXRA 1OEYJ 1QB5D 2IGGA 3NHEB 2WXIA 1BCPB 2Q2HA 3HOXG 1JE4A 5M5XH 2V4IB 2JEAI 2KCNA 2J52A 2WX1A 2UU9Q 2JWZA 1KH0A 3L9AX 1N36L 1YN4A 3OIPA 2M19A 1NCVA 3RUZA 1TJEA 2PE6B 4RF0A 2LGYA 3FHWA 1EWIA 3BINA 2K1BA 4TSSA 1PTOD 1ET6A 2CCZA 4HR7B 4DK1A 4CJ2C 5I6WA 4L8JA 5E6JA 3G7LA 1Q5WB 2B63B 4DR7L 4LNIA 3TEXA 3HOXH 4JI7L 3SVMA 4EE2A 4NQLB 3CSFA 3I63C 4P7IA 4BKTA 1XJVA 1TIID 3ENEA 1QNUA 2D3BA 3DWQA 4HIDA 4B3RQ 1I6HB 3PIPA 4FJZA 4DF7A 1SE8A 2X6GA 4OWXB 1BDOA 3QO2A 4GKKL 1B53A 4FP5D 2ZTCA 2IT1A 1WY8A 4AQYQ 4TQ0A 1AEXA 5GAGC 1ZYRC 1S5DD 3GTOB 4P74A 1J7AA 1TWHH 4JI0Q 1KRSA 1YJJA 3NK9A 2A5HA 3VUWA 4LF8Q 4XZ4A 3K5OA 4I65A 2EPBA 1CZPA 5ISRA 1FD7D 4DR7Q 1VF7A 1JR0D 1WMHA 3A7LA 4ZRJA 3L0OA 3TBLD 3W5UB 4B3MQ 4IWPA 3FKYA 2NVTH 2B2YA 4O2DA 4KHPQ 1MG4A 4M8MA 1ROEA 2I07B 4LFAQ 2V3PA 3ZXRA 1E1TA 1D4BA 4W9HA 1RTOA 1AE2A 4HDQA 1PRTD 3CKIB 3GE8C 2PNHA 1QVFA 3K81C 4HRSA 2K32A 2PI2E 4DXFA 4HIOA 4DXAB 1YMHE 3FC4A 1QVCA 3BK1A 4YWKA 4GOCA 3BVGA 1SSNA 4L63B 5D65A 2W9NA 4M0WB 1MJDA 3NTHA 1X56A 2J7ZA 1N32L 2F0FA 1DD2A 5M3MG 1R4NB 3RNUA 4QL5A 2AKWB 1ZDXA 2EY6A 2FBWB 1Q1OA 3IAS1 3HS0C 1P0RA 4NAWA 1I94Q 5BMHA 1H9MA 2O5JC 2NN6H 3PQIA 2ZJPA 1C4CA 2I5MX 4DK0A 5I6YA 2N88A 2VUMH 4RA8A 4AIMA 1IYUA 4DHJD 3R2TA 1W3SA 1EEID 4RAUC 5D3DA 4OVVA 2CU1A 3EECA 1RTNA 4NXMQ 3ZNGC 3NBIA 5IGFA 3CC7A 1PGAA 2I5HA 5J1ZA 4RGTA 4JI3Q 3GTKB 4GDKA 1GOZA 1HTPA 4J15A 1DCZA 5EKLA 4DV4Q 4CDFC 1XNQQ 3HRZC 5KHQA 1YN5A 4US9A 4JI4L 4G11A 2H89B 3T3NA 2HDEA 1A6XA 2QC8A 3K80C 4HVBA 2EJMA 4C3IG 4WWOA 4ZCKA 2CJNA 3RR5A 2G5DA 3UDIA 5HI1A 1TKEA 1I42A 2EDGA 1VQ5A 3KF8A 3F2CA 4B3SL 4A93G 1A63A 3TSSA 5HURA 1HZ9A 4P75A 2KWVB 1QUQB 2N9EB 3U4EG 3K0YA 5JXVA 1TWAB 2OQKA 4QB4A 4LF6L 3Q8BA 2NPTB 2CKZB 1L5PA 4K3CA 4OELB 2N7JA 1PH3A 2IL8A 1VCIA 1MSGA 1ISNA 2FNJB 2GBRA 2WP9B 3IFWB 4NB3A 1X1MA 2GB1A 2O6VD 3CCSA 3MXPA 3X3NA 1H95A 2MRPA 1Q8KA 2BH8A 1UEBA 4JI2L 1LTSD 5C4XH 2ZJRA 1WTPA 3Q23A 1VQCA 1WD1A 2NMQA 4WWPA 4LNQA 1SJED 2O2LD 3E56A 2H1EA 4ZYNA 1GJZA 2KTRB 3NUCA 2KEDA 5A2QE 5EPLA 3Q8CA 4Y7NH 3RN9C 4JOIC 1NE3A 4WJWA 5C44G 3KBXA 1VQ6A 1WM2A 2OEOA 4ICVA 1HNWL 4JI5Q 4WFN3 4A3DH 4HPMB 1H9JA 3LNNA 2F0NA 2Q8IB 4A93H 4JI1Q 1CT1D 4AQYL 2Q2TA 4IM0A 1VZ7A 3EFUA 4H7BA 4DK5A 1G8ZD 4J6HA 4BOZB 4X65L 1BNZA 1A8VA 2LGSA 2MJDA 5IYCG 3R3MA 4TV3A 3HHMA 3EGRA 5IGEA 4N9PA 4B3TQ 3I4LA 4R4OA 1UWXA 4MELA 4A55A 2W3SA 1FR3A 3AEVA 4KHPL 4KIKB 2GI9A 4EQOA 1TWHB 3VA7A 5IWAL 3A7AB 4MM3B 4GLAC 1Y56A 4JIOU 3M3JA 3PVLA 2VUMG 4GLVB 1SMXA 3N6RA 4TKNA 1Y8OB 4PS8A 2V1CC 4ZLTF 1P1AA 2KD0A 3VXWA 2K75A 1EWHA 2A1AA 4K5XA 2ASBA 5EAYA 1IUEA 1Q10A 5IY0A 2LEKA 3AE2B 5IGDA 3OMGA 3HFZB 1E5WA 2N4FA 2UU9L 3R66C 4X3TA 5AUIA 2NVQH 3PF4A 1TWFH 4MSMB 1EY6A 1JWSD 3CC2A 3PLUA 4BBSH 1EQTA 4HPLB 3S1QB 3J81L 1PV4A 2MJEA 4I6LB 1EOTA 1SAPA 3AYHB 4JL9A 3FDTA 1DM0B 1GUOA 3A8JE 5IP7G 4WQMA 3U7DA 4CHKA 3GV6A 4KKIA 5L83A 2E5LL 2WAQG 4K5VA 4EFOA 3ZNHB 3FKIB 2F3WA 3I4MH 1WCMG 5JJZA 2CHZA 3TUOA 3RNFC 1FPYA 4PK1A 2E2DC 2CKHB 2ES2A 1J0GA 5G2NA 2D0PA 4IKGA 4KY6A 1KLGD 2KCTA 4XT3B 5ELNA 5HG2A 4MIUA 1PZKD 2YTVA 2K5VA 3DBHB 4EZJA 2DZJA 4LUVA 4MGIE 2ZTDA 1CKMA 2ENBA 4GS3A 3AEDB 2EYJA 4EUTA 4URKA 2BDNA 2YU9B 1EF5A 5AJ3Q 2XEWA 3GZNB 3ZNID 1EQQA 5CYUA 3DOWA 1E0ZA 1YQ3B 1K8AC 4PYZA 3J81j 3J81E 2R7DA 3N1ZC 2A8VA 1J7CA 1OQYA 2LXAA 3RN5A 1HZ6A 2LFNA 2ID0A 2PJHA 3W5VB 3ABVB 2VZKB 5IP4D 4FVMA 4A3BG 4A3MB 2MFIA 4JBKA 2L76A 4JGHB 2WDVB 1UH6A 5NUCA 2NPTA 2V0GA 3K58A 5JPNC 2EKEC 4GN5A 3LB8C 4RF1A 2FCNA 4G3XB 1A2UA 1V8QA 2AUKA 2UXDQ 2WB1B 1OEYA 1TVXA 1JC7A 4XX5A 3FP9A 4EQPA 1EZ8A 1FD6A 2JSVX 3HKZG 1C4PA 1KFYB 1KC8C 4HJ9A 3VR9B 1HJPA 1UWMA 2V4DA 4WJNA 4YTPB 4ZKCB 2VH2A 3U8ZA 1VQKA 5IIFA 2LFIA 1EM7A 4FF2A 1K0RA 5C5MA 5I9PA 3N52A 3AEEB 4H0LC 1HTOA 3TZUA 1LM0A 1N63A 2WINB 2M00A 4U673 2F0QA 2UXCQ 1Q1BA 3W9CB 4I7ZC 1E24A 4U68A 3APDA 4MGZE 4OL7A 1YHQA 5DPSA 3NG0A 3UF8A 2KQ7A 1NR2A 1SE2A 2B29A 3P7JA 2IGDA 1SBBB 2KZRA 4Q2JA 2WXFA 4RMAA 5KIXA 3OLMD 1XQQA 1LACA 4DK3C 1KOTA 4BY7B 1TKYA 2DJFC 1L1OC 1JWBD 4M01A 2PI2A 2JA6B 1FGUA 4X65Q 2XN9C 2YYZA 3QX1A 4C7ZA 4R9WA 3RULA 3B08A 1IBXB 3CCJA 3R3OA 1J19A 2L7RA 2JE6I 1OXTA 2BS2B 2HJ1A 2ZJDA 2WU2B 2JA5H 3U2SC 5ELDA 3GTPB 2MWSB 4JX1C 1ZXIA 5T8IA 2K4KA 2FIDA 2KK8A 1WF9A 4GN4B 3K9OB 4WURA 4IWOA 2E5LQ 1FXIA 3WANA 1SNDA 3HOYH 2WXOA 1BCPC 2K50A 2EMSA 3S1MB 3ULLA 1L0YB 1SNMA 3DM3A 2MHJA 4R1JA 1V2YA 2MBOA 4AJWA 4EZLA 1HNWQ 1YBYA 1VS0A 5FLMH 1F1HA 2F0HA 1ZKOA 2JQRB 1R4QB 2BCOA 4BBSB 3H94A 1AFPA 4HJKA 4DNIA 1XLPA 5I2XA 1TR5A 2R7ZB 1LT3D 1MHWC 2KWUB 4HKZE 4IOIE 4C1NK 3DUZA 2VQFL 4CYEA 4M00A 5BMGA 4K7UA 4POFA 1ENFA 3ND8A 2L11A 1C4AA 2IBIB 2Y5BB 1G291 1SYEA 3H0GG 3FKIH 1I6VC 2O6VB 4LDTD 5AZHA 1FMAD 2HE7A 4IFDI 1WRIA 3KQ4A 4LNFA 4FXKC 5JPMC 4A75A 1Y1WH 4OO1H 2DNFA 1CSPA 2SAKA 3K5MA 2UXBL 4DBGA 1Q7YC 1N5WA 2J7QB 3DWMA 3M63B 4MJSB 3Q2AC 5GMVA 1CFMA 2XBBC 2IZVB 3AB9A 2OTLA 2NWGA 2BVCA 5LXIB 2JYTA 5J22A 3J7YW 2F0IA 2ZM6Q 1HZ5A 3X0WA 4APVA 2GBJA 4L5TA 3PMFA 1CUKA 4H13C 2K1FA 3R2IA 4A3CG 2NTTA 3GTMB 5M5XB 2LKVA 1N34L 4Q0FA 2IO3B 3A8KE 3D0FA 3IT6B 5I9OA 2VW9A 1SYCA 1V80A 2ASQA 5E6OA 1HZCA 1DYQA 3LX0A 3HEJA 3A5UA 1I4RA 4ACFA 3CAMA 1A70A 3S16B 1KQSA 1ZPSA 5FKAC 1GUSA 1HR0W 2CH4A 3RI7C 3Q0AA 1VR9A 2E2IB 3M7NA 2CJOA 1YITA 3TMEA 1C77A 3A54A 2KVZA 3HOXB 1NBWA 1SMYD 2ONQA 2BB6A 3QIJA 4N59A 4DV6Q 3KK7A 1WGRA 4JWUC 1K8MA 5C3JB 3K8AA 5COYA 4R4TA 5EPJA 1AARA 2NBFA 1STAA 4LFBQ 1PH8A 2RSNA 4A3CH 1L0XB 3T51B 3DBHI 4ALPA 2NTSA 1XLQA 4NPSA 1NDDA 3HUIA 2KJRA 3C0RB 3PREA 1RJTA 3RLFA 3X23A 2SEBD 3GTOH 4AQ7A 4NKLA 3I4NG 2ZNVB 1CHQD 4KGSA 1IW7D 1FM0D 4QF4A 2A73B 3C19A 1CKNB 3ERQA 5FO8B 2VNUD 1L4DB 4BY7H 2J42A 5GAHC 3AE7B 4KV6A 3VYTA 4OIKA 3PS6A 1Q90A 1AYFA 2K5HA 2FFKB 2HDLA 1XNRQ 3L54A 3WA0A 2A6HD 4OWTB 2L9HA 5G3LF 4LJZC 1KJTA 4ZRZA 3E9HA 2ZT9C 5C4XG 2KNBA 2R2QA 2FMCA 1PYWD 1YIWA 1E2VA 1SYGA 1IZ6A 2KCMA 1BKBA 4JI7Q 3KWLA 1KL9A 3BDCA 5EBCA 3MC0B 4DAYB 3K7AH 1PH6A 2W55A 1PFBA 2A6EC 2KA7A 2DYMA 2K5DA 3PIO3 2QSDA 1OQRA 3IAYA 3HOYB 1L0VB 4ABNA 3AEFB 5BR8Q 3MFGA 1DONA 1WH3A 2YEPB 3BVZA 3I73A 3S1MH 3IRBA 2JP1A 4YIJA 1J5EL 4NNJB 2EE1A 3J81i 2C7MB 3QWZB 4GNXA 5DCNA 4JW0A 1IBLQ 4FHJA 3BIID 4PS3A 3TZDA 1WZ0A 3JAME 2L8JA 1QE6A 2R7ZH 3R7QA 4FO2A 4X64L 4K5WA 1CZWA 1RM6C 4A3PA 3MXNB 4CDCC 3J80E 1SROA 2KVMA 1V9JA 3MXGA 3GTKH 2JX5A 3FMCA 1SGHA 4CJ1B 1STBA 4HXDA 4GMVA 2QCZA 1C4QA 4A8XC 2WP8J 1F2LA 1J9OA 1ASYA 1EFID 1B3QA 4OX9L 2D9UA 1RD9D 2D3AA 1DOYA 3F2BA 1MI0A 2FE8A 3TDQA 3PO2B 3I72A 1V86A 3F1ZA 3STBD 1ENAA 3BS1A 1JICA 2DAFA 2ZNVC 4ZRKA 4DQOC 4YWGG 4LAAA 4G7HC 1KLVA 2RCNA 2KDFB 2JK8A 3VUYA 3T16A 1I4XA 1IHZA 4CDEC 5FOBB 2Y0SE 4TVAB 2IX1A 2KCCA 1DOIA 1K8RB 4DWFA 5FLMG 3MEFA 4R8IA 4WJ4A 1ML0D 4OXPA 1VF5C 3RUIB 3ZLZA 3CF5A 2B8GA 5FLXE 5CGKA 5FJ8G 1FCLA 1EYGA 2Z8LA 4R4IA 2C9OA 4IURA 2J53A 4XIGS 1SE3A 4GZYC 2PLPA 2XK5A 1SSOA 1VQLA 2L1BA 4JLCA 4PZ8A 5C4XB 3SU8X 2M9VA 2DBYA 1D5MC 4HIKA 5KHOA 3DBLI 1V81A 5KNDA 2BWES 4A3FG 3JSVA 1EO6A 1QT9A 4IO9A 4LFBL 3NVVA 1QQRA 1SRUA 1STEA 1ZDVA 3OWFA 4WORA 2ZPNA 1WXVA 3ML8A 1BVSA 1EYAA 2KLCA 4A3DB 2Q2UA 3BZDB 1HUMA 2GRIA 5GROA 1CA6A 1FVIA 5LL6S 2L5TA 1L0WA 4JYAL 1ENCA 1Q46A 5LMUQ 2Q8TA 3RT3B 1SIJA 4XYQA 2WNMA 2OJWA 3QOLA 2B3GA 4FYDA 2ZJQA 4OEMB 1Y1VB 1IGCA 5CV6A 3I57A 4IFDH 2RDHA 1T3QA 1WMHB 4RHRA 5IT9c 4BKSD 2AUJD 4FADA 4NMZA 1WGYA 1PA6A 3I4NB 4JPSA 1H9SB 3ONAB 1V6EA 2XRQD 4K2LA 4LF8L 2D5GA 3K5NA 2LGIA 1XNQL 4K1RB 1QILA 2KQ3A 4DV7L 1JRUA 4XDXA 2RQXA 3PO2G 2NCNA 2NZHA 3I3CA 2WLBA 3SXHA 2BA0A 4B3ML 3T9LA 4RCOA 2BB5A 4IUVA 1LO5D 3AU4A 3NS8A 1UGJA 1FYCA 2DGYA 4LF4Q 4NQKE 1LTAD 2L52A 1UBQA 3PV1A 4TQ1A 1MGSA 2INNE 2QW7A 1XPOA 2B2WA 3PSIA 4LMQD 4C2MB 4YY3Q 2AYOB 1ZYRD 5FLXL 2V3NA 2M2LA 4UAIA 2R93B 4ASWC 1JMLA 4XDDA 1MSHA 2LVOA 1O80A 3BWUD 1F2RC 4X3SA 5IP7H 1PTOF 4Y52H 2M0XA 4DR3Q 2RBMA 4EQ5A 2CW0D 4EEWA 1XPUA 2WYQA 2DZMA 3CCEA 4ICUA 4IM2A 2B2WC 2EYPA 2ZTEA 3S2HH 2IY0B 4B0MA 1Q3LA 4YHHL 4BZAA 3K5LA 1GPXA 1NYQA 4RFBA 1QOBA 1PFSA 3A9KA 3DHIC 1R9TB 4Q5VA 4WH4A 3CC4A 2Z4IA 3DPDA 3NBHA 2LWPA 4YT0B 3V61A 2WWZA 1T0RC 3N1YC 2N3SA 4ZKBB 1CZGA 3P4QB 1B9RA 2RDFA 4QMGA 1MKHA 2MH7A 1QOAA 1PH2A 4ZHOA 1CTMA 3WOFA 1YNTE 1GG3A 1B9MA 2NN6I 2M1MA 2BOSA 2KC2A 2EZVA 4MEMA 3LJ3A 3NE5B 3TL5A 1V1PB 2PQAB 1CJEA 4C00A 3ZYYX 5ELBA 1KM7A 3AE5B 1EU4A 4RGOS 5F2DA 3AI5A 1WCMH 2LSSA 3S1RH 5HKHA 1AH9A 4OVUA 2X69A 4G0NB 4IFDJ 1E6EB 3AU7A 3B6YA 2D62A 2OHFA 5KNCA 3Q69A 5H1SE 3PUXA 2BBCA 5FR3A 3NZSA 3P2BA 4JI0L 3QWNA 5J3BA 2LMCB 4TKOB 1O7ZA 3QJYA 5DEHA 5M5YH 3NVZA 1B70B 2LGDA 5TSSA 1IBKL 4JK1C 5D7GA 2WXJA 1TT5B 3H7PA 2N78A 1QOHA 4A3LG 5LMNL 2N0SB 1Z5SB 3VHTC 3EFCA 5HGTA 1JB3A 2H88B 3F8TA 4IUTA 3VVWB 4N9F4 2NZOA 3P1HA 2PMZB 1FEHA 1C3TA 2F03A 1NNXA 3ERSX 1BT0A 5EDSA 4WIPA 2GN5A 5FO9B 1YI2A 1WSPA 1SYBA 3E0EA 4DAPA 1Q81C 3M4OH 1L7YA 1M94A 3ZJYC 2I1JA 4GLSC 5DPTA 1X32A 3MZ5A 4AH6A 4C56C 1S4ZA 4FHKA 4FF4A 1JOKA 2L00B 4IJHA 2X8XX 1GM5A 1JMCA 1PHJA 2ACZB 1K8GA 1PTOH 5G5HA 4RNAA 1SNQA 5KEEA 4GGQA 3PZDA 1G51A 4NXNL 3L2PA 2A5UA 3CP0A 2JA6H 2ON8A 3KF6B 1TQOA 5CX3A 4KJNA 3VH3B 1LM8B 5DM73 3KYCD 4IPCA 4A3DG 4XWTA 3CU7A 2DHZA 2XNAC 3GTPH 4A76A 4EKUA 3IG3A 4E6IA 4V190 2OQ0A 1DGJA 1EUVB 2D3GA 2QEXA 2K5NA 1SYFA 1BBXC 2VZAA 1QOGA 3H7SA 3LYYA 2OT2A 1N62A 1K73C 4ZK9B 2WB1G 3K7AB 5FK9C 2A19A 2BS3B 4KDIC 2K8HA 1WWTA 4KHZA 3N20C 1I4GA 4YTMB 3H1UA 4UHVA 2XK5B 2ZM6L 1E7ZA 3BG3A 2JVCA 2K03A 4NJ6A 4UP8A 3AFQA 3CPWA 4DR4Q 2PPBC 3AM9A 4II3B 1K83H 3DEPA 1WYGA 3OPOA 5IT9L 1ZW7A 3GTQH 4O1NA 3HOYG 3S2HB 1QCBD 2DENB 2G1EA 1YJIA 1EFWA 5CBAE 4DDGD 2D07B 3CCMA 5IA7A 2R6GA 1NYRA 2QHOA 4OZCA 4DV5Q 1RFAA 1OXXK 4GN3B 2E6XA 3KVFB 4N6EB 1Y1WB 4DPGA 4A4IA 1PTOC 1LTLA 1E0BA 3T1YQ 4GDLA 1T0YA 1MHXA 4NPNA 4C1NI 1WTXA 3DHGC 4BA1I 4DAVA 3OTOQ 2DN8A 4KJOA 5BN5A 3PO2H 4JQWC 4ZRPA 2IX0A 4DV0L 1HNZQ 5FO7B 3WCQA 5AEKB 3AB5A 5ELOA 1VDVA 3BZCA 3G6EA 1HUNA 1UAPA 2IHEA 2K6AA 3OJ3A 1O7IA 2F0GA 2XGTA 5LLIA 3PO3G 3QCAA 1Q82C 1PGXA 2N7DA 1AN8A 5M3MH 1PXUA 3RD4A 4ARCA 1H9SA 1L2FA 3M7GA 4QUCA 2I5LX 1PFDA 2IY1B 2LI5A 4KLKA 2ZCCA 4USAA 3M9BA 4M02A 1X65A 4GOPB 2PO4A 1VJKA 1I35A 1I94L 2M17A 3KJPA 4GNXC 3S16H 1HTQA 1SF0A 1ZXTA 4KVGB 2MSED 3ZRFA 2KDBA 2PZWA 4XXEA 1WZ3A 2V3SA 1X3GA 5M5YB 1K50A 2B2TC 2E2IH 2KAJA 1WGDA 1ZE3D 5CMDA 2PYKA 3MWYW 3PSEB 2B63H 1VZ6A 5M5WH 5BYQA 4A3FH 4B9XA 3IXSA 3AQQA 5DM63 3AU5A 2KHWB 3DXJC 1XCTL 3V6EB 1RIPA 1PH5A 3KF8B 1P98A 4A3MG 1WGHA 1ESRA 1G2TA 1TTNA 4BY1G 3W1YA 2O4XA 5D94A 2PPHA 4R4QA 2PW9A 3TP8A 1U4MA 1XLOA 2LVPA 3D3RA 4II2B 1HEZE 1ONLA 3E9IA 3SE0A 3MJWA 2R92G 1EL0A 4Z9CB 2VZKD 1PTOB 1L6UA 2IGHA 3NQTA 3HOZG 1E8ZA 1VZ8A 2BTEA 2DYOA 4EGVA 3NUHB 3RZOB 2KACA 5JJLA 1R4PB 1KDCA 3L08A 2CHBD 3W1SC 2NVTB 4UY8C 5IGGA 3TCAA 4A3EG 3BVMA 4QIWE 3H3VI 4NAWB 1Y8NB 2EY5A 2JJQA 2K52A 4MHEA 1VQOA 1ET9A 1YNND 4FXDA 3VYSA 2ZW1A 3S14H 1U4LA 1R4MB 1J6QA 3VDZA 4MGKE 4M0WA 2WDQB 2WXLA 3H7PB 5L37A 3MVVA 2RMMA 5IWAQ 5C3EH 1LABA 3I91A 2I0QA 2F0WA 4L6TB 2PEAA 2JEBI 3HZXA 1FNUA 1PMRA 2VB3X 2MW5A 2O6VA 3QC8B 2EMTA 1ZGUB 1S3OA 1TWCH 4JBJA 1D5XC 3HRDD 1MG8A 1WJ6A 3C1EA 4HJAA 1HRJA 4KKJA 5FR6A 2BE5D 1HQMC 3TQYA 4J1MA 4HIMA 3N32A 4RCNA 1QZEA 1QOFA 3VH4B 2Z6BA 2G3QB 2INCC 3CCRA 4GIVA 1LTTD 1V5TA 2QDLA 1FXAA 1BUVT 1HA6A 4TQUS 3ITPA 4P6VF 4FA6A 5IYDG 3I8ZA 4R3DA 2F0DA 3TJPA 2C7HA 4HMJA 3B2FA 4E74A 4LFCL 3HOVH 5T1GA 4NXNQ 3ALBA 2JA8H 4GDKB 1QZHA 4IQZA 2A69C 4LTUA 5L95C 2WXPA 2A68D 4JI2Q 2GBKA 1RHPA 2EY1A 3JAMc 4XQQA 4F88A 4LFAL 2JA6G 1JT8A 5T1IA 3P20A 2IO0B 3DVNV 1EUJA 3RNBC 4S3SA 3AE1B 1V1PA 2PQAA 3EN2A 4S17A 1A62A 3CRKC 4LF6Q 3AEAB 4C4VA 4RKLA 4HPPA 2QDFA 3ZNZB 4QIWB 1JQ4A 2KN4A 5ELFA 2BW2A 3EFXD 3G6JB 5C44H 1L2NA 2CR5A 1TS2A 2DUDA 3TREA 3MA2B 3GTGH 4BFRA 1N32Q 4ID6A 2MO1A 3KUDB 3QB3A 2WU5B 4KSKC 2GBMA 4IPDA 3SK6A 1LTBD 1MPEA 3SGIA 2Z0DB 4I7AA 1L4ZB 3MC9A 2DY8A 1CQVA 2MJ8A 3EJIA 2WACA 3M4OB 1VMPA 4E3CA 2KMAA 5M5WB 2AL6A 4AJYB 1D1IA 4A93B 4LF9L 3DWAA 1J8IA 2DNCA 1PZJD 1WXAA 4BWGB 2GBNA 1IL8A 4XQJA 2IO2B 3AH7A 3QARA 5H92C 3ZDMC 1S72A 2Z59B 2WFWA 1ZUD2 3I4NH 1BXTA 4AYBG 4MM3A 4MZ9A 4CKCA 3AE6B 2LJ5A 4KIKA 4WRDA 1AWDA 2B2VC 3RYTA 4QUFA 1EQRA 1U5KA 1GUGA 1N9WA 4DV2L 1TGZB 3H9DA 2IO1B 4I6PA 3D8GA 4XQNA 3PLVA 2WAQE 3I5JC 1Y1WG 4OO1G 4XC2A 3D4DA 2O2VA 3MEHA 2L0TA 1HCZA 2XIWA 4PMCA 3IAM1 5EE3A 2PVOD 4NDXA 5IT9E 1RF2D 2RSOA 4DHJB 4HCNB 2UU7A 2ZXPA 4IPGA 5JVG3 3D31A 2L0FA 1U0LA 3RZWC 1CQFA 4HEDA 3DVGY 4FJVB 3RN2A 2RDGA 5M3FB 1NBFC 2AHOB 1P7EA 1V5OA 4LUZA 4P1BC 1UE5A 1X54A 2RR9A 2K9XA 3EQLC 4A90A 3DWGC 1WXSA 2LJIA 3EC8A 5IP9H 5C3EB 2EYMA 4KK7A 2V1YA 4G50A 1NVID 1R9TH 4JOIA 4JI5L 1AZQA 3NPPA 3HOWG 3L16A 2C35B 2EVBA 3I4MB 4KGRA 4WWMA 4C7YA 4DV6L 1JROA 5C0XJ 1T6BX 4WWNA 1ZOYB 2BGFA 3M4YA 2HD3A 2WHIA 4YCWA 2UUAQ 3Q3NC 4PMBA 1FIQA 2BKFA 4DAMA 5C2TB 3LWUA 4DV2Q 4TRDA 3SFEB 4ANUA 4JV5Q 1RCVD 1X3FA 4P73A 1I4HA 1BBWA 1JWMD 3HGBA 2IX3A 3GE3C 4FDBA 2K7VA 1QJOA 1EY0A 2LZ6A 2RVLA 3EBEA 1WX7A 1D1KA 1ILPA 1XD3B 2B39A 2QA4A 3H3VC 1I4PA 4RG1A 3JC66 1GXDC 5KYIA 2HTHA 3TMPB 1FCCC 3A55A 3ZVVA 2OOBB 1HQRD 3H0GB 2R92H 2A4ZA 4N58A 4EX5A 1UD7A 5D3IB 1TKWB 2KC1A 2Y0SB 2CH4W 2GVBA 3S1NH 4DDID 2HHHQ 4IALA 2ALYB 1OFFA 2KLGA 1JW9D 4EOYA 4ARIA 4P16A 4BY1H 2KXJA 2M4NA 1H4RA 5CV9A 4QGUA 2INDC 3CD6A 2K0PA 4ZUJA 4IM3A 2F0UA 5EKIA 3VR4A 1I3QH 3V3XA 4KN7C 2BS4B 3E0JA 1S5CD 4OHJA 5M3FG 2E76C 1TZOA 2PKOA 1K3RA 4BA2I 5BYSA 4LUOA 3FVQA 1EY9A 2B8FA 1XT9B 2BPSA 5LNK1 1EY4A 3AFPA 2CU3A 2TMPA 1UE7A 1C0AA 4MH8A 3N9YC 4PT5A 1UWVA 2DJGC 3ZTDA 3PGZA 4X62L 4RM8A 3NY5A 3H91A 2RHSB 4LK1C 2LXKA 1BCPD 5G3LD 1H9KA 2MA9B 4XWWA 3ER0A 4IZ8A 4G7ZC 2KMMA 4A3BH 4BKSA 3I2ZA 1TS3A 3H8HA 2N9PC 1N61A 1IBLL 2ZZPB 3ECIA 4WAFA 1NI2A 1WX9A 1FRRA 3TP5A 2UYZB 4W9FA 5EQ0A 2JA7B 1IL2A 2GA4B 3S15B 1OO9B 3KLWA 2HT1A 1Q0WB 3H15A 2FUG1 4D2KA 2AWNA 1Y1VG 5AFWA 5EPKA 4ZRQA 5D2MB 5LMNQ 4P71A 2OXPA 2N9LA 4OIJA 3ZUNA 2N7EA 5ELCA 3KDFA 1VQJA 1NI3A 1K28A 3W5OA 4YTNB 3HM3A 3VA5A 2KBNA 4HJ8A 1HXYD 2KANA 3UIPB 4YWLA 2PVGC 4EVOA 2FJ2A 1CM9A 1ASZA 4YSZB 1EWYC 4OO1I 3Q8AA 2B2TA 1KIXA 3H3VH 3A9KB 1Q8IA 2F0JA 2IPKD 1UEAB 1SEBD 3PUZA 3WOEA 1K3BC 1IBKQ 1GC6A 2Y5CA 1E10A 1EY5A 4AWJA 1XXGA 3NSWA 1LTGD 4W9CA 2TSSA 2GOWA 1N8RC 1BQQT 4ZYSA 3GTQB 5IP9G 3NTIA 3SEBA 3HOWB 2HD5B 5EGTA 4BBNF 1EU3A 1X55A 3G4SA 5IO9A 3CRLC 3QOJA 4JI6Q 4RHSA 3ONSA 1M4VA 2NZ1D 1B8AA 2N49A 4DUZQ 4J3OD 4HSVA 4N9TA 3U50C 4TUUA 3BJUA 4WJPA 4NW2A 1VQ8A 3J81c 4OZAA 5LMUL 2Z1CA 2UXCL 1NAPA 4MJSA 2CW0C 1WTOA 1WX8A 3OW7A 1PH9A 2B76B 1IBXA 4FBJB 4IOCA 1KNEA 3U9SA 3G48A 3KFUA 3GS2A 3DQVA 4HJ5A 1NUCA 2WDTB 3MTNB 4XYOA 1SMYC 3GTLB 1J7BA 1SIFA 4W9LA 2KMCA 4MSQB 4A3KB 1F0ZA 4X64Q 4JBWA 1WI5A 1NEKB 1BUIC 1WTRA 1R7SA 2YLMA 4YXDB 2Q5WD 5M3MB 4CDDC 1SFOH 3N1XC 4LDTB 4A3GG 3AEGB 3RLOA 2W54A 3GTMH 1HNXQ 2MPMA 2MP2B 2F0SA 3AMUA 1K8OA 1WRDB 2KEEA 1A3UA 2UWQA 4LJPB 4MGYE 2Q2IA 3PUVA 1L1OB 2NR2A 3B0AA 1IW7C 1Y14B 1OXVA 2XVSA 3PTFC 3RMHA 3MFYA 4IUNA 3S1NB 1T0SC 1F2YA 2KFKB 3DM1A 4BOSC 4L5QA 1PVOA 4JI8L 3T13A 4IUPA 4A3FB 2CHXA 2YEPF 4L2YA 1FNVA 2C5CA 3K7UC 2KKCA 1A3TA 2MP1A 2A6HC 4A3EB 2OJRA 5IYBG 2XSCA 2ZCBA 1SB3C 2C60A 2MO0A 2F4VL 1Z6HA 5GXGB 3NJTA 5A35A 3P4SB 2EXDA 1BOSA 3AV8A 3GB1A 1WFYA 5C3WA 2PMVA 3EA6A 3KUZA 2NVXB 1QNKA 2RKSA 1KRTA 4DV0Q 1JALA 5IYCH 3CQZH 1EIYB 1B4OA 4EZKA 1EY7A 1VQDA 4FF3A 1NTGA 2VQFQ 1E7VA 4P72A 5C0XG 5C0XH 2MGSA 2NYZD 3V6CB 3DLLA 1E9MA 1WXMA 3DVNU 1F9JA 3TEYA 4A3JG 4JCVE 1J8CA 3DHHC 4CHTB 1LYLA 4C3HB 5LMNW 4KD3A 2F0KA 3C3LA 5HY6A 1YHAA 3TP7A 2UUBQ 4A3OA 1EZ6A 2RD0A 2MLBA 5JEAJ 4LK0M 2Z6KA 3VTWA 3BDOA 5IOIA 3PPAA 4GNXB 1YZ6A 1UZXB 5GADC 3W2DA 1N34Q 4IG7B 4KI0A 4EQNA 3MAQA 1V1OA 3KYHC 1WE7A 2PW7A 5D14A 2NN6G 3W1BA 1XMOQ 2F4IA 3I55A 1AP0A 3CCUA 3EUB2 4E71A 2LHDA 1F9QA 2JU6X 3TIXA 3A4SC 4IC7B 4XTCS 2BF8B 3FEWX 3Q24A 1E3PA 2Z0SA 1X3PA 5IGBA 2MBBB 1TWCB 4XGAB 1IP9A 3MXNA 3KLRA 2QGQA 3TRZA 1PRTF 3KUCB 2R7FA 4W9IA 3F2DA 4ANWA 3NVYA 3IL8A 1SR3A 2D2QA 2KT7A 4XYCA 3PO3B 1H9RA 4DV3L 5C3EG 1QVGA 4HN7A 1YQ4B 3HKSA 2K5QA 3QG1A 4IWQA 4JWSC 4L5RC 2KENA 2WIIB 3W1GA 3DBLB 2B2UA 3NXWA 2LUEA 1W6KA 5IE8A 1C9FA 1VLBA 2E2JB 2R93G 1YQBA 5CR3A 4C3IB 1P7FA 3ZJTA 4KKTA 3HOVB 4KKUA 1CK1A 4GKJQ 2OEDA 4ME3A 2JA5G 3TEHB 2LRUA 3PT2B 4DA2A 2EOTA 1SDFA 2FAZA 4KY7A 3EHVA 4DV1Q 2YTXA 1WJNA 2UUBL 1IYVA 2ICEC 1V49A 1IBMQ 1CKNA 2KOXA 1RLFA 2AMCB 2PMZE 3H0GH 2R92B 4S0RA 3R8BA 4A3KH 1U4RA 2NBUA 2FXQA 3IBEA 4QAYA 4LF5L 1EIGA 2J0JA 2LUMA 3HOZB 4IFDG 3CCLA 2I2YA 1YNXA 1SFOB 1JE5A 4BY1B 1PQSA 4YWMA 1HZAA 2ZXOA 2ICIA 2JWUA 2VH1A 1YJWA 2FINB 3A5ZB 2HUGA 3VR3A 1C1YB 2N9XA 3GTGB 5CBEE 1WR6E 2HIXA 4FULA 4DV1L 4L1BA 1I50H 3F2UA 5E3FA 2YVCA 4HMIA 1NENB 1XTDA 3Q22A 4BKGA 1YOVB 1LLRD 2F1MA 1OGWA 1T5XD 2RCFA 1OTCA 2F0OA 4DN4M 3L0WB 1PYSB 3MHBA 2G4SA 1EOVA 1CSQA 1U4PA 4B9KA 1O7LA 1B50A 4PS7A 2MBEA 1ICWA 2PZUA 1KHIA 4A3EH 1DOMA 2R2OA 4DR2Q 2PCFB 3ML9A 2BYFA 2BYEA 1M8AA 3D4WA 3ICEA 2G9DA 3C8YA 2JYOA 1TY2A 2F4VQ 4A3IB 3VR8B 1WTVA 2KO3A 1Y1VH 1S5FD 5C4HA 4H44C 3L10B 3QR8A 4REZA 4IUMB 1UE6A 3OG5A 4BAXA 3QA8A 3RNCC 4K6LA 1YNJD 2JA7H 3ZIMA 4IW0A 2IWHA 4CKBA 3U30A 2YTYA 3M4QA 2PIAA 3NOBA 4RWSC 3P1MA 1QF6A 1GVPA 4CKEA 5LXHA 3JW0X 5DAUA 3U7ZA 5DPWA 2EYFA 5K36G 1VQ9A 1PH1A 5IAAC 1WD0A 1D3ZA 4WJQA 2MHVA 1TT2A 4JV5L 4C2MH 1HA5A 1UUPA 4FXGC 2ZPYA 5HFYA 1C8CA 3SR1A 1A3VA 1XTCD 2ZXRA 5M3FH 5K5PA 2R93H 2R7ZG 3AE9B 4JG2A 3PHWB 2F0VA 4BS9A 3P63A 1RFKA 3A56A 1ZP0B 1SNOA 1PH4A 3SFDB 2QKIC 3A9JB 5JEAH 2V4LA 3SK5A 5C23A 4IN3A 2SNSA 3HOWH 5JJKA 4G7OC 1NMFA 3Q8EA 1CHPD 4YHHQ 2RGFA 3AE8B 1Y8PB 4NP5A 4FF1A 2JRIB 2AL3A 1CA5A 1HPCA 2H5XA 4JE3B 2GMIC 3A74A 2KJXA 2IY5B 1I4QA 3URYA 2D10A 2KJ6A 4PZ7A 2DX5B 2JZ3B 5JAVA 3PO3H 3DWPA 4G57A 5KYLA 4PYUA 5D6JB 2QF7A 4HSPA 3UINB 3M3YH 4DAYA 2N1WA 4BVUC 1V1QA 2E2JH 4C3JB 5KNBA 4GXBA 1KLUD 5CHFA 1C78A 1Y69U 4KY5A 2KDEB 1LUZA 2KTFA 4QCLA 1WCMB 1FGBD 2QCPX 2FCSA 3SDLC 1C79A 1PRTC 5EKKA 4KX6B 1WGGA 3T8MA 3C2PA 3VQIA 4LW1A 1FJGL 1R4NI 2KQ4X 5JHBA 3V2TA 4CJ0B 1F2ZA 2N9KA 3CHBD 4BXXG 3B9JA 2CWPA 1E22A 1D6EC 3CXCA 2G45B 2IHFA 4B3TL 3HG9A 2K39A 4ZQ3A 3K57A 3Q8FA 2N8NA 4LJOB 5CV7A 1LFDA 3GTJH 4G4KA 3RNEC 5ELEA 4HCEA 3M4PA 1GJXA 1B44D 1TWGB 1C9OA 2BDOA 5EBDA 4XT1B 3BZKA 1P9DU 2O5IC 4NZLB 3UQBA 3L13A 2CQAA 1G6PA 2ZVNA 2JXXA 3MTSA 1EWCA 3NBHB 3L17A 3R7RA 3WDNA 2C7NB 1I7HA 2I1KA 5IYBH 2K22A 3I9V1 2OCEA 4JI8Q 4TMAB 2M0AA 2F0TA 4DR5L 3DBRB 4AP4C 5JH5C 4F87A 3N3KB 2E3TA 4ILWA 2PZTA 4ULLA 3QK0A 1YJ1A 4OZBA 2NVXH 2NVUI 2KDMA 3CQZB 3WAMA 4RH6A 1T5EA 5E1FA 3PRZA 4Y7NB 1YX6B 2BT6A 1K0SA 4ITKA 3NELA 4A3JH 1HTLD 4UP7A 2WS3B 1P3QU 2F0MA 3VRAB 4A3IH 5BMIA 2FUHB 2KX0A 4F1SA 4R8NA 5C4ZA 2DYBA 1VQEA 2C5LC 2RF4A 3IFTA 1YJ9A 4JBMA 4LF5Q 4DKAC 3S15H 3A4RA 4O0AA 3VYRA 1TYGB 1UF0A 1HFGA 1TS5A 2MCNB 1HR0Q 4B9WA 2EQSA 1SE4A 3O65B 4OVZA 3SDZA 2JUOA 3WALA 2ZVOA 2WV6D 3C1FA 4HCSA 2L32A 2IJ0A 3HOVG 1K9MC 1M1KC 4OWWB 4DUYL 1GNUA 3PO0A 1F77A 2N1VA 4X57B 2Z4HA 4OGQC 3BU2A 3DVGX 1EQVA 3ZW3A 1P16A 1ILQA 2AWOA 4LCDE 2MUYA 1YJNA 2G4DB 2ATWA 4X62Q 4POGA 3W3AA 1E8XA 2BWFA 2FCMA 2FIFA 1ICFB 3KW5B 3J7AF 1QLBB 3PZ8A 3Q3FA 4I6NB 1XMQL 4DR5Q 4MDKE 1C76A 2WXHA 4GN1A 2JZPA 2JRHA 1A5RA 3GDEA 4QY7A 4B6WA 3DHQA 3T3OA 5J39A 4OX9Q 4K0KL 1S40A 1V43A 4HKQA 3E6ZX 2EYHA 3Q6BA 1PLFA 2KUMA 1SNPA 3ETRA 1DXMA 1CI3M 3LXFA 4BXXH 2VQEQ 4RMFA 1XNRL 2FHTA 4PG3A 2KX3A 2XWJB 4DR2L 4HCPB 2RHQB 2P5ZX 1XO3A 2B3AA 4ANXA 3P4PB 4JI4Q 1VRAB 1W6JA 3IHPC 3K9PB 3T1HQ 3J7A5 4NY0A 2Z6KC 1VQBA 2WB1E 3NS1A 4W9DA 3GTLH 5BYRA 3EVQA 3HOUB 3PCOB 4HEA1 1WOCA 2K01A 4GKKQ 1LTID 1JOOA 3KH0A 1XLNA 1OXSC 5JZEB 5IYDH 1D2BA 2DY7A 1JCKB 1JJ2A 1PRTB 3DBRI 1O78A 2JXTA 3WAOA 1LV9A 1PDQA 2LY7A 3NHHA 1VQ4A 3S2DB 5J2RA 1FO4A 2R3ZA 4LF9Q 2M8SA 1LT4D 1PH7A 2E75C 4LLGM 5FLXc 1VQIA 2XTIA 1PZID 3DMUA 2INPE 2JT4B 1WXQA 2ZW0A 4M8NA 4FNFA 4UDUC 1GB4A 4KKSA 1A0IA 4AYBB 2K05A 2K14A 2B2UC 4QJFA 4DR4L 1G2SA 1VQFA 1B2TA 4A3MH 2JXMB 2KTRA 1E7UA 2LD9A 2QEJC 2RDBC 1PGBA 1GD7A 1VQHA 3U4ZA 4DR6L 1TZ1A 2K6DB 4FN2A 4C4VB 2KHSA 4PNYA 3T56B 2CQOA 3SHQA 3CCQA 3FILB 1EIHA 3MHZA 4A20A 1STNA 4CGYB 1GB1A 2K5WA 3VR2A 2WXRA 4K7SA 3NZUA 5CV8A 3HM6X 1YNNC 4JI3L 3TS0A 4W9JA 3U58A 3RNGC 2BYTA 3KLSA 4IPHA 2L3ZA 3L4PA 4K8JA 5IN7A 2JSOA 4YSXB 2KVRA 4H2AA 1MHHE 3IT4B 4QQBX 1F9SA 4ZAIA 3DDCB 2PQEA 4B3RL 1OQQA 1SNCA 4DHZE 2DZKA 2JN4A 1FNWA 3NZ3A 2BH2A 3MXUA 3BK2A 1EYDA 5I4DA 1LXDA 1KF6B 1K53A 1U4AA 3AULA 3IVFA 2OWOA 4DR6Q 1MBYA 3RNAC 1MVKA 4A3JB 5AUKA 3SD5A 2BE5C 3OIQA 2EKIA 1DGSA 3O13A 4KZCA 4MTNA 1XF5L 3TP6A 4DHZB 4LWCA 3QQ8B 3KJOA 2HIVA 3I4OA 4A3KG 3NP8A 3RZOH 2K3UA 2BYVE 2UUCL 1QWYA 4RKBA 5C5LA 3A1QA 3D4RA 1N33L 2VS1A 3BYTB 3RMKC 3NWSA 1DOLA 3KUPA 4ZHPA 3UIOB 1K52A 1Z9FA 3H09A 1XMQQ 2W82A 2L55A 1G91A 2KFKA 4ZDVA 2WXNA 3S14B 3K59A 2N55A 5G5GA 2MNAA 3P4RB 4AOFA 3L3OC 1ACCA 3CSTA 3SHLA 2A69D 1KAAA 1WM3A 4O42A 4MACA 1A15A 3PRPB 3Q6SA 2D2CC 2A68C 1B1ZA 3T4AC 2VQEL 4GOPA 2REXA 1TKGA 5EE0A 4GB9A 1GC7A 3U9OA 3NQIA 5IOCA 4W9EA 1RODA 1WJUA 4K3BA 5E6PA 3ZJUA 2BQQA 3NEMA 5EE9A 2NB0A 3Q3JA 5J17A 5HHDG 1WJ4A 1XEEA 2DLBA 3K6OA 1WFQA 1GUTA 2KYWA 3ULJA 3I3TB 2BA1A 4F7ZA 3CMMB 3OHXC 3A9JA 1C48A 1LT6D 3J7ZC 4ZOHC 3I70A 2O2VB 3RPFC 3HK0A 1BMLC 1H8CA 2E2HH 1GO3E 2WGSA 3M3YB 5J18A 1NSNS 1W2BA 4K2KA 1PDXA 1VD2A 3J80i 2AX5A 4CO7A 2K6QA 4R4CA 1KDAA 2GVAA 4A3GB 2BKRB 2E8GA 1KABA 1C7YA 1HHVA 1G6ZA 1IGDA 1SN8A 1WYDA 2D5DA 3G71A 2JA8B 4BBRH 1UBIA 4F8MA 2VRRB 3AE3B 2QJLA 3HVDA 1T9HA 2SOBA 4MH0E 4HJGE 1LTRD 4F8CB 4X3UA 5GAEC 2A74C 3HOUH 1D7QA 3NENA 4ANVA 1HR0L 4C3JG 1M90C 4LNKA 1KAWA 2EJFC 2UXBQ 5BO4B 1EYCA 1AW7A 3OTOL 1GUAB 2B2VA 4C3HG 3ZKJC 2YV5A 3S17H 2D3CA 5JOBA 1YHBA 3UI2A 3T1YL 3S2DH 4IUUA 2MQHA 2UXDL 2NVYH 4K81A 3VR5A 2CVRA 2F3VA 1WIAA 1KXLA 1S5ED 3D32A 3JSVB 3P75A 4US8A 3TEZA 5C44B 3SK4A 3OSOA 1GUNA 4BBSG 1NR4A 1I50B 1Q86C 1O7YA 4AYBE 5GQOA 1II3A 3TS2A 2MBQA 3PIOA 3V62A 2DNEA 3ZJVA 4DFAA 1GHKA 1LGRA 4X66L 4KD4A 2QIEB 1TBEA 1E8YA 2D0OA 2JA9A 1STHA 2SNMA 4NAMA 1BR9A 1QUQA 2X6LA 2EIFA 1GKHA 4L23A 3TBIB 4IDIA 2L4NA 1TY0A 3D6CA 3N30A 4LNOA 2F3IA 5AJ3L 2IDYA 4K7WA 3NRZA 3CWIA 1STYA 4DUZL 2PNRC 4JC0A 4YCUA 5IODA 2K25A 2KJHB 3J9CA 1F9RA 2KN5A 4BY7G 3MC8A 3OWEB 3UDXA 1HFNA 2VY3A 1BF4A 3RZDH 2AQ3B 3BY4B 1IKMA 1RAXA 1SLJA 5CV5A 4LF7Q 4NXML 1Q1EA 3AMZA 1MJCA 3VDYA 2KDIA 2AQ2B 1F2MA 3HP3A 4OW0A 3H6NA 1JOQA 2IW3A 4YY3L 1E8WA 1T0QC 4LFCQ 1QZGA 1GAQB 5BN3A 3PRMB 1HNXL 3U52E 2QILA 3APCA 3PIP3 1D5ZC 2E74C 2HTME 1ESFA 4FJYA 2CWAA 4ODGA 1IYFA 3I56A 2UUAL 4FLHA 4A6QA 2D11A 2NBVB 2J0KA 1SYDA 3UGBB 2SDFA 5JVH3 3TEWA 4A3LH 1F2RI 2JZZA 4GDLB 1MIUA 1P8LA 3R93A 2K8BA 1E2WA 1FJGQ 2W3RA 3QAQA 3AECB 5LHY1 1S3SG 2HDMA 2KECA 3Q3MC 2WKCA 4NJ7A 5IGCA 3ZRCA 2L83A 2RA4A 4DR3L 1WYWB 1NY4A 3IFDA 1WTQA 1DZ1A 5C1ZA 3D6WA 5CORA 1KD1C 1F9PA 2DWQA 1TXYA 3A0JA 1VCBA 1MJEA 4RM9A 2K5PA 1YX5B 4DV3Q 1V8CA 3S9WA 3KLSX 3LWEA 2J4XA 1JWAD 1N60A 3GOEA 4C3JH 1NMGA 2EELA 1N6ZA 2E2HB 2WXMA 4K6DA 1KNAA 4X3KA 3PF5A 2KHIA 2WXGA 2JA8G 4J6IA 4RGMA 2KOLA 1WE6A 2GLSA 3KBGA 4CQNA 4KSLC 4JI6L 3LDZE 4MNOA 2AEHA 2QMTA 1WTWA 3ZGZA 1KDBA 2EYOA 4BBNC 3NTKA 4K0KQ 4M1UB 3FKIG 1IBML 1KTKA 1S5BD 3FAHA 4P2CB 2KWDA 4IUQA 3RZFA 4H02A 1HH2P 4M8AA 3GTJB 2JA7G 4HROA 1TIFA 2NUCA 2WKDA 1YIJA 1QKZA 1L6VA 4DV5L 1TWGH 2NS5A 3CW2C 3SR6A 2PTLA 1TS4A 2NVYB 1ZKHA 3QHTA 2CS4A 2WXQA 3X3MA 2WQYB 3ZDTA 4X66Q 5C0XI 5C4JB 1N36Q 3UI3A 1I3QB 2MBHA 3LGJA 3B2GA 2MP2A 1ZEQX 5CV4A 2L05A 1TWAH 4KZ0A 1HE8A 4FXCA 2MEKA 2HQLA 3T53B 1Y8RC 4XDCA 4GOPC 3MHSD 2Z0EB 3APFA 2B63G 1KRHA 2XWBB 1CMXB 3U4VA 2JF5A 2X38A 2L1AA 1CKOA 3Q14C 5A2QL 1RYJA 5C3XA 2WDRB 4LF7L 1VQNA 2DAJA 5IKCM 3FRPB 1JRPA 3PHXB 4YCVA 2CHWA 3FILA 1N5XA 1QG7A 4KMUC 1XMOL 2IYDB 2Y0SG 1NJIC 4A3BB 4WJ3M 3STBC 3GQBA 4W9KA 1L1OA 5KRUA 3VRBB 3Q8DA 2G9HD 5AZGA 5LL6X 4B3SQ 1YEZA 4IJLA 5JHAA 4HTHA 3FPPA 3RZDB 2F0EA 1B9NA 3BYYB 3VYUA 2L12A 1OXUA 4ZUIA 3UQAA 3KYDD 1LT5D 1AE3A 3EIVA 2MJ3A 5M9OA 3AN1A 3IKJA 1DOKA 4B08A 3B1LX 1EY8A 2WX0A 5AZFA 3MP9A 1X9NA 2KHJA 2PW5A 2ZEQA 3VFKA 4K14A 3UDFA 3KOJA 1YNJC 3UE1A 1IKLA 1YVCA 2L0CA 3DEOA 4IOAA 1VQPA 1SE9A 2K8CA 4NJCA 3KWVA 2LVQA 5DLQE 3ZO5B 5BR8L 3I90A 5I2YA 5H8YE 4XE0A 4KGTA 3CMAA 3CMEA 4N8X1 1JB7A 3V96A 3I4MG 3VAWA 4AUQC 2H4OA 1WGKA 5EE1A 4DR1L 3OYYA 1R4MI 3AXCA 3WAPA 5CHVC 1TU2B 3ND9A 3I7FA 3SK8A 3J80L 5G55A 1A2TA 1RL2A 1N33Q 5FJ8H 3HVZA 1DOXA 3T1HL 1VDZA 1VQGA 2NVQB 3A8IE 3OOCA 4PV1C 4PMWA 4GSWA 1RKNA 3VUXA 1E1OA 3CPFA 1JJGA 3C46A 2XRSD 1E7PB 4HWIB 4J8QA 3UDGA 3WWVA 3VR6A 4F7XA 3RLNA 4B0EA 1FL0A 1DJRD 1YN3A 3JAMi 5DPRA 1EEFD 3OAWA 1MD2D 3OJ4B 1B7YB 2B2YC 4AS1A 2MQJA 1ZXHA 4GLXA 1PFMA 1Z7TA 1MI2A 2LXJA 3V05A 1E2ZA 3KDFB 2VUMB 3K0XA 4HDOA 1YD8U 3CCVA 1OTRB 2EYLA 2K28A 1PYBA 3HKZE 4RGNA 5E6NA 3NVWA 2J0TD 2LXCA 1XWEA 4V0BA 3S24A 4DK6C 3J7AV 4KDLB 4W9GA 2LHEA 5C6AA 1VQAA 3UE0A 4JYAQ 1FXTB 4ME5A 4MN3A 4C80A 1PFNA 3PGEA 2HCIA 3S1RB 4HAEA 3KF6A 2KWCA 2F0LA 3QJZA 4GU2A 1F52A 2HQEA 4KV2A 2K04A 1RRBA 2KFJA 2L15A 1IPGA 3V60A 1UE1A 3DBSA 4L5SA 4WAAA 4JPBW 4HLEA 2RPVA 1Z47A 5C4JH 2DZIA 3M62B 4K8IA 3E9SA 3QIAA 2LMCA 1WR1A 1Z2MA 1MFWA 3A33B 1UELA 4LF4L 2AQ1B 3PUYA 1BCPF 2EJGC 1XPRA 4LNNA 3GD7A 2PE9A 2HCCA 3ZXVA 4KHVA 3VTUA 1Q12A 3FPUB 1V9PA 1I6HH 2V9HA 2EXZA 2WXKA 3OW2A 4DV7Q 1LQBA 3WIMA 1GHJA 4DXGA 5E7NA 2JPHA 1X3EA 4YL8A 2R61A 1WVLA 1XCQL 2NBWB 1I5FA 5KGUA 2FCQA 3A1QB 4A9AA 1WTHA 3P42A 1UNSA 3CF6E 3W1SA 3GO5A 1RDPD 3E5SA 2LS01 1JORA 4A3IG 4C3HH 1RWSA 3JYUA 4PZ6A 4UP9A 1STGA 1HNZL 1VQ7A 1WI0A 2JY6A
chains in the Genus database with same CATH topology
3PUWA 3ZQ4A 5E4XA 1FFVA 1JQYD 3EROA 1VMCA 3PV0A 2A6ED 4DNTB 3OMCA 3HKZB 2F0PA 2JYEA 1V97A 3CIRB 4MT5A 2M56B 1AZPA 1K51A 5MPOA 1XX8A 2VXWA 5DNFA 2JA5B 1B3AA 3MJ5A 1PUTA 1BO0A 5E4WC 2Y5PA 3AE4B 3L7ZC 3TN2A 4DGZA 4DU9A 2Q8RE 2WAQB 5CC4A 4CBVA 4YSYB 4KTAA 1TWFB 3M85A 3BDLA 1FFUA 3PZ7A 5JEAG 1JWUD 4PQXA 1K83B 1X3QA 3H6MA 2I38A 1XYIA 1FRDA 4BBRB 2K33A 3JAML 1SJHD 3GP7A 2OF1A 2VB2X 3RFZB 5K36H 1GUWA 1U9RA 3S17B 2Y3AA 3GV3A 1SXTA 4DNRB 3NWTA 2FMMA 2I46A 5EJWA 2EY2A 2QDBA 3AEBB 4KN4C 5BN4A 1QB5D 2IGGA 2WXIA 1BCPB 1JE4A 2V4IB 2JEAI 2KCNA 2J52A 1KH0A 3L9AX 1YN4A 3OIPA 2M19A 1NCVA 3RUZA 1TJEA 4RF0A 2K1BA 4TSSA 1PTOD 1ET6A 4HR7B 4DK1A 4CJ2C 5I6WA 4L8JA 5E6JA 3G7LA 2B63B 3TEXA 4EE2A 3SVMA 1TIID 1QNUA 3DWQA 1I6HB 4DF7A 2X6GA 1BDOA 3QO2A 1B53A 4FP5D 2IT1A 4TQ0A 1AEXA 1ZYRC 1S5DD 3GTOB 1J7AA 1YJJA 3NK9A 2A5HA 3K5OA 4I65A 2EPBA 1CZPA 5ISRA 1FD7D 1VF7A 1JR0D 3A7LA 3W5UB 2B2YA 1ROEA 2I07B 2V3PA 1D4BA 1RTOA 1PRTD 3CKIB 4HRSA 2K32A 4DXFA 1YMHE 3FC4A 3BK1A 3BVGA 1SSNA 4L63B 5D65A 3NTHA 2J7ZA 2F0FA 1DD2A 1ZDXA 2EY6A 2FBWB 3IAS1 3HS0C 5BMHA 1H9MA 2O5JC 2NN6H 1C4CA 4DK0A 5I6YA 2N88A 4RA8A 1IYUA 3R2TA 1EEID 4RAUC 5D3DA 1RTNA 3NBIA 5IGFA 1PGAA 5J1ZA 3GTKB 4RGTA 1GOZA 1HTPA 1DCZA 5EKLA 3HRZC 1YN5A 4US9A 2H89B 3T3NA 2HDEA 1A6XA 2EJMA 4C3IG 2CJNA 5HI1A 1TKEA 2EDGA 3KF8A 3TSSA 5HURA 3U4EG 3K0YA 5JXVA 1TWAB 4QB4A 3Q8BA 1L5PA 2N7JA 2IL8A 1VCIA 1MSGA 2WP9B 2GB1A 3MXPA 3X3NA 1LTSD 1WTPA 1WD1A 2NMQA 3Q23A 1SJED 2O2LD 3E56A 2H1EA 3NUCA 2KEDA 5A2QE 5EPLA 3Q8CA 4WJWA 3KBXA 2OEOA 4WFN3 1H9JA 3LNNA 2F0NA 2Q8IB 1CT1D 1VZ7A 4H7BA 1G8ZD 4J6HA 1BNZA 2MJDA 3EGRA 5IGEA 4N9PA 1UWXA 3I4LA 4A55A 2W3SA 1FR3A 2GI9A 4EQOA 1TWHB 3VA7A 3A7AB 4MM3B 1Y56A 3N6RA 1Y8OB 4ZLTF 1EWHA 4K5XA 1IUEA 1Q10A 3AE2B 2LEKA 5IGDA 3OMGA 4X3TA 5AUIA 1EY6A 1JWSD 1EQTA 3S1QB 3J81L 2MJEA 1EOTA 1SAPA 3FDTA 1DM0B 1GUOA 3A8JE 4WQMA 3GV6A 4KKIA 4K5VA 3FKIB 2F3WA 5JJZA 3TUOA 2E2DC 4IKGA 4KY6A 1KLGD 5HG2A 4XT3B 4MIUA 1PZKD 2ENBA 3AEDB 2EYJA 2BDNA 2YU9B 5CYUA 1E0ZA 1YQ3B 3J81E 1J7CA 1HZ6A 2LFNA 2ID0A 3W5VB 3ABVB 2VZKB 4FVMA 4A3MB 2WDVB 5NUCA 2V0GA 3K58A 5JPNC 3LB8C 4RF1A 1A2UA 1V8QA 2AUKA 2WB1B 1TVXA 1JC7A 4EQPA 1EZ8A 1FD6A 2JSVX 1C4PA 1KFYB 3VR9B 1UWMA 2V4DA 4YTPB 4ZKCB 5IIFA 2LFIA 1EM7A 4FF2A 5C5MA 5I9PA 3N52A 3AEEB 4H0LC 3TZUA 1N63A 2WINB 2M00A 4U673 2F0QA 1Q1BA 4I7ZC 4U68A 4OL7A 1NR2A 1SE2A 3P7JA 2IGDA 1SBBB 4Q2JA 2WXFA 5KIXA 1LACA 4BY7B 1TKYA 1JWBD 2JA6B 2XN9C 2YYZA 4C7ZA 4R9WA 1IBXB 3R3OA 2JE6I 1OXTA 2BS2B 2WU2B 3U2SC 5ELDA 3GTPB 4JX1C 1ZXIA 5T8IA 4WURA 1FXIA 1SNDA 2WXOA 1BCPC 3S1MB 1L0YB 1SNMA 2JQRB 2F0HA 1ZKOA 1R4QB 2BCOA 4BBSB 3H94A 1AFPA 1XLPA 5I2XA 1TR5A 2R7ZB 1LT3D 4HKZE 4IOIE 4C1NK 3DUZA 5BMGA 1ENFA 3ND8A 2L11A 1C4AA 1G291 1SYEA 1I6VC 1FMAD 4IFDI 1WRIA 3KQ4A 4FXKC 5JPMC 4OO1H 2SAKA 3K5MA 1N5WA 3DWMA 1CFMA 3AB9A 2NWGA 2JYTA 5J22A 3J7YW 2F0IA 1HZ5A 3PMFA 4H13C 3R2IA 2NTTA 3GTMB 5M5XB 2LKVA 4Q0FA 3A8KE 3IT6B 5I9OA 1SYCA 1DYQA 3LX0A 3HEJA 1I4RA 1A70A 3S16B 1ZPSA 5FKAC 1GUSA 3Q0AA 1VR9A 2E2IB 3M7NA 2CJOA 3TMEA 1C77A 3A54A 3HOXB 1SMYD 2ONQA 2BB6A 4N59A 3KK7A 4JWUC 1K8MA 5C3JB 5COYA 5EPJA 2NBFA 1STAA 2RSNA 1L0XB 3T51B 2NTSA 1XLQA 3HUIA 1RJTA 3RLFA 2SEBD 4AQ7A 4NKLA 1CHQD 4KGSA 1IW7D 1FM0D 4QF4A 2A73B 3ERQA 5FO8B 2VNUD 1L4DB 2J42A 3AE7B 4KV6A 3VYTA 4OIKA 1Q90A 1AYFA 2FFKB 2HDLA 2A6HD 2L9HA 5G3LF 4LJZC 4ZRZA 2ZT9C 2FMCA 1PYWD 3KWLA 1E2VA 1SYGA 3BDCA 5EBCA 3MC0B 2W55A 1PFBA 2A6EC 2KA7A 2DYMA 2K5DA 3PIO3 2QSDA 1OQRA 3IAYA 3HOYB 1L0VB 4ABNA 3AEFB 3MFGA 1DONA 2YEPB 3BVZA 3I73A 2JP1A 4YIJA 2EE1A 3BIID 3TZDA 3JAME 1QE6A 4FO2A 1RM6C 4K5WA 1CZWA 3J80E 2KVMA 3MXGA 2JX5A 3FMCA 4CJ1B 1STBA 1C4QA 4A8XC 2WP8J 1F2LA 1J9OA 1EFID 2D9UA 1RD9D 1DOYA 1MI0A 2FE8A 3TDQA 3PO2B 3I72A 4YTMB 1ENAA 3BS1A 1JICA 4DQOC 4YWGG 4LAAA 4G7HC 3T16A 1I4XA 1IHZA 5FOBB 2IX1A 2KCCA 1DOIA 4R8IA 1ML0D 1VF5C 1FCLA 2B8GA 5FLXE 5CGKA 2Z8LA 2C9OA 4IURA 2J53A 4XIGS 1SE3A 4GZYC 2PLPA 1SSOA 2L1BA 5C4XB 2M9VA 2DBYA 1D5MC 5KNDA 1QT9A 3NVVA 1QQRA 1ZDVA 1STEA 3OWFA 4WORA 1EYAA 4A3DB 3BZDB 1HUMA 2GRIA 1CA6A 5LL6S 2L5TA 1ENCA 2Q8TA 1SIJA 4XYQA 2WNMA 3QOLA 4FYDA 1Y1VB 1IGCA 5CV6A 3I57A 4IFDH 2RDHA 1T3QA 4RHRA 2AUJD 4NMZA 3I4NB 4JPSA 1H9SB 3ONAB 2XRQD 4K2LA 2D5GA 2LGIA 3K5NA 1QILA 2KQ3A 4XDXA 2RQXA 3I3CA 2WLBA 3SXHA 2BA0A 4RCOA 2BB5A 4IUVA 1LO5D 1UGJA 1FYCA 1LTAD 2L52A 4TQ1A 1MGSA 2INNE 2B2WA 4LMQD 4C2MB 1ZYRD 5FLXL 2V3NA 2M2LA 4UAIA 2R93B 1JMLA 4XDDA 1MSHA 3BWUD 1O80A 1F2RC 4X3SA 1PTOF 2RBMA 2CW0D 2B2WC 2EYPA 4B0MA 1Q3LA 3K5LA 1GPXA 1NYQA 4RFBA 1QOBA 4WH4A 1R9TB 4Q5VA 2Z4IA 3NBHA 4YT0B 4ZKBB 1CZGA 3P4QB 1B9RA 2RDFA 4QMGA 2MH7A 1QOAA 4ZHOA 1CTMA 3WOFA 1YNTE 1B9MA 2NN6I 2BOSA 2EZVA 3NE5B 1V1PB 1CJEA 3ZYYX 5ELBA 3AE5B 1EU4A 4RGOS 5F2DA 2X69A 4IFDJ 1E6EB 3AU7A 2OHFA 2D62A 5KNCA 3Q69A 3PUXA 2BBCA 5FR3A 3QWNA 2LMCB 4TKOB 1O7ZA 3QJYA 5DEHA 3NVZA 5TSSA 5D7GA 4JK1C 2WXJA 1QOHA 2N0SB 5HGTA 1JB3A 2H88B 4IUTA 3P1HA 2PMZB 1FEHA 2F03A 4WIPA 5FO9B 1WSPA 1SYBA 4DAPA 4GLSC 1X32A 3MZ5A 4C56C 1S4ZA 4FF4A 1JOKA 2ACZB 1PTOH 5G5HA 4RNAA 1SNQA 5KEEA 2ON8A 1TQOA 4KJNA 5DM73 4XWTA 3CU7A 2XNAC 4E6IA 4V190 1DGJA 3LYYA 1SYFA 1BBXC 1QOGA 2OT2A 1N62A 4ZK9B 3K7AB 5FK9C 2BS3B 1WWTA 4KHZA 1I4GA 3BG3A 2K03A 2PPBC 3AM9A 3DEPA 1WYGA 3OPOA 5IT9L 4O1NA 3S2HB 1QCBD 2G1EA 1YJIA 5CBAE 2R6GA 1NYRA 4OZCA 1OXXK 4N6EB 2E6XA 1Y1WB 1PTOC 1E0BA 1MHXA 4C1NI 1WTXA 4BA1I 4DAVA 2DN8A 4KJOA 5BN5A 4ZRPA 2IX0A 5FO7B 3WCQA 3AB5A 1VDVA 1HUNA 1UAPA 2K6AA 2F0GA 1PGXA 1AN8A 1PXUA 3RD4A 1H9SA 3M7GA 4QUCA 1PFDA 4USAA 2PO4A 1VJKA 1SF0A 1ZXTA 2PZWA 4XXEA 5M5YB 1K50A 2B2TC 2KAJA 1ZE3D 5CMDA 2PYKA 3MWYW 1VZ6A 5BYQA 4B9XA 3IXSA 5DM63 3DXJC 1XCTL 1ESRA 1G2TA 2O4XA 2PW9A 3TP8A 1U4MA 1XLOA 3D3RA 1HEZE 1ONLA 3SE0A 1EL0A 4Z9CB 2VZKD 1PTOB 1L6UA 2IGHA 3NQTA 1VZ8A 2BTEA 2DYOA 4EGVA 3NUHB 3RZOB 2KACA 1R4PB 1KDCA 2CHBD 2NVTB 5IGGA 3BVMA 4NAWB 1Y8NB 2EY5A 4MHEA 2ZW1A 1ET9A 1YNND 4FXDA 3VYSA 1U4LA 4M0WA 2WDQB 2WXLA 3MVVA 2RMMA 1LABA 3I91A 2F0WA 4L6TB 2JEBI 1FNUA 1PMRA 2VB3X 3HZXA 1D5XC 3HRDD 3C1EA 1HRJA 4KKJA 2BE5D 1HQMC 4J1MA 4RCNA 1QOFA 1LTTD 1FXAA 1BUVT 1HA6A 4TQUS 3ITPA 4P6VF 3I8ZA 4R3DA 2F0DA 4HMJA 3B2FA 5T1GA 4GDKB 4IQZA 2A69C 4LTUA 2WXPA 2A68D 1RHPA 2EY1A 4XQQA 4F88A 5T1IA 3P20A 4S3SA 3AE1B 1V1PA 3CRKC 3AEAB 4RKLA 1JQ4A 4QIWB 2KN4A 5ELFA 2BW2A 3EFXD 3G6JB 1TS2A 3MA2B 4ID6A 3QB3A 2WU5B 3SK6A 1LTBD 1MPEA 1L4ZB 2DY8A 1CQVA 2MJ8A 3EJIA 2WACA 3M4OB 1VMPA 5M5WB 1D1IA 4A93B 3DWAA 1J8IA 2DNCA 1PZJD 4BWGB 1IL8A 4XQJA 5H92C 3AH7A 1ZUD2 1BXTA 4CKCA 3AE6B 4WRDA 1AWDA 2B2VC 4QUFA 1GUGA 3D8GA 4XQNA 4OO1G 3D4DA 3MEHA 1HCZA 2XIWA 4PMCA 3IAM1 5EE3A 2PVOD 4NDXA 5IT9E 1RF2D 2RSOA 2ZXPA 5JVG3 3D31A 1CQFA 4HEDA 2RDGA 5M3FB 1P7EA 2K9XA 3EQLC 4A90A 3DWGC 2LJIA 5C3EB 2EYMA 4KK7A 1NVID 1AZQA 3NPPA 4KGRA 2EVBA 3I4MB 4WWMA 4C7YA 1JROA 5C0XJ 1T6BX 1ZOYB 3M4YA 4PMBA 1FIQA 5C2TB 3LWUA 3SFEB 4TRDA 1RCVD 1I4HA 1JWMD 3HGBA 2IX3A 2K7VA 1QJOA 1EY0A 2RVLA 1D1KA 1ILPA 2B39A 3H3VC 1I4PA 1GXDC 5KYIA 1FCCC 3A55A 1HQRD 3H0GB 4N58A 5D3IB 1TKWB 2Y0SB 4IALA 1OFFA 1JW9D 4ARIA 4P16A 5CV9A 2K0PA 4ZUJA 2F0UA 5EKIA 3VR4A 3V3XA 4KN7C 2BS4B 3E0JA 1S5CD 4OHJA 1TZOA 2E76C 2PKOA 4BA2I 5BYSA 3FVQA 1EY9A 2B8FA 5LNK1 1EY4A 2CU3A 2TMPA 4MH8A 3N9YC 4PT5A 3H91A 4LK1C 5G3LD 1BCPD 1H9KA 4XWWA 4IZ8A 4G7ZC 2KMMA 3H8HA 1TS3A 1N61A 4WAFA 1FRRA 3TP5A 5EQ0A 2JA7B 2GA4B 3S15B 1OO9B 2FUG1 4D2KA 2AWNA 5AFWA 5EPKA 4ZRQA 2N9LA 2OXPA 4OIJA 5ELCA 1NI3A 4YTNB 3VA5A 1HXYD 2PVGC 4EVOA 2FJ2A 1CM9A 4YSZB 1EWYC 4OO1I 3Q8AA 2B2TA 1Q8IA 2F0JA 2IPKD 1UEAB 1SEBD 3PUZA 3WOEA 2Y5CA 1E10A 1EY5A 1XXGA 3NSWA 1LTGD 2TSSA 1BQQT 4ZYSA 3GTQB 3HOWB 3NTIA 3SEBA 5EGTA 1EU3A 3CRLC 3QOJA 4RHSA 1M4VA 2NZ1D 4J3OD 4HSVA 4N9TA 4NW2A 4OZAA 2Z1CA 1NAPA 2CW0C 1WTOA 3OW7A 2B76B 1IBXA 1KNEA 3U9SA 3GS2A 1NUCA 4XYOA 1SMYC 3GTLB 1J7BA 4A3KB 1F0ZA 4YXDB 4JBWA 1NEKB 1BUIC 1WTRA 1R7SA 2Q5WD 5M3MB 3AEGB 2W54A 2MPMA 2F0SA 3AMUA 1K8OA 2KEEA 1A3UA 3PUVA 1IW7C 1OXVA 2XVSA 3RMHA 3MFYA 4IUNA 3S1NB 1F2YA 3DM1A 3T13A 4IUPA 4A3FB 2YEPF 4L2YA 1FNVA 2C5CA 1A3TA 2MP1A 2A6HC 4A3EB 2XSCA 1SB3C 1Z6HA 5GXGB 5A35A 3P4SB 1BOSA 3AV8A 3GB1A 5C3WA 2PMVA 3EA6A 2NVXB 1QNKA 2RKSA 1JALA 1B4OA 1EY7A 4FF3A 5C0XH 5C0XG 2MGSA 2NYZD 1E9MA 3TEYA 4CHTB 4C3HB 4KD3A 2F0KA 3C3LA 3TP7A 1EZ6A 5JEAJ 4LK0M 3BDOA 3W2DA 4KI0A 4EQNA 3MAQA 1V1OA 2N9KA 2PW7A 5D14A 2NN6G 3EUB2 2F4IA 1AP0A 2LHDA 1F9QA 2JU6X 4XTCS 3FEWX 3Q24A 1X3PA 5IGBA 1TWCB 3MXNA 3KLRA 1PRTF 3NVYA 3IL8A 3PO3B 1H9RA 4HN7A 1YQ4B 3QG1A 2K5QA 4JWSC 2WIIB 2B2UA 3NXWA 1W6KA 1C9FA 1VLBA 2E2JB 5CR3A 4C3IB 1P7FA 3ZJTA 4KKTA 3HOVB 4KKUA 1CK1A 2OEDA 4DA2A 2EOTA 1SDFA 4KY7A 1IYVA 2ICEC 2R92B 3R8BA 1U4RA 1EIGA 2LUMA 3HOZB 4IFDG 2I2YA 1SFOB 4BY1B 2ZXOA 2ICIA 2JWUA 2FINB 2HUGA 3VR3A 3GTGB 5CBEE 4L1BA 3F2UA 5E3FA 4HMIA 1NENB 3Q22A 1LLRD 2F1MA 1T5XD 2F0OA 4DN4M 3MHBA 1U4PA 1O7LA 1B50A 1ICWA 2PZUA 1DOMA 2PCFB 1M8AA 3D4WA 2G9DA 3C8YA 2JYOA 1TY2A 4A3IB 3VR8B 1WTVA 1S5FD 5C4HA 4H44C 4REZA 1YNJD 4K6LA 2IWHA 4CKBA 2PIAA 4RWSC 3P1MA 1QF6A 4CKEA 5DAUA 3U7ZA 2EYFA 5K36G 1WD0A 2MHVA 1TT2A 1HA5A 1UUPA 4FXGC 5HFYA 1C8CA 3SR1A 1A3VA 1XTCD 2ZXRA 5K5PA 3AE9B 2F0VA 4BS9A 3P63A 1RFKA 3A56A 1ZP0B 1SNOA 3SFDB 2QKIC 5JEAH 3SK5A 4IN3A 2SNSA 4G7OC 3Q8EA 1CHPD 3AE8B 1Y8PB 4NP5A 4FF1A 1CA5A 1HPCA 4JE3B 2KJXA 1I4QA 3URYA 5JAVA 3DWPA 4G57A 5KYLA 2QF7A 4HSPA 4DAYA 4C3JB 5KNBA 1KLUD 1C78A 1Y69U 4KY5A 4QCLA 1WCMB 1FGBD 2QCPX 1C79A 1PRTC 5EKKA 4KX6B 3C2PA 3VQIA 2KQ4X 3V2TA 4CJ0B 1F2ZA 3B9JA 3CHBD 1D6EC 3HG9A 3Q8FA 4ZQ3A 3K57A 3W9CB 5CV7A 4G4KA 5ELEA 4HCEA 1GJXA 1B44D 1TWGB 2BDOA 5EBDA 4XT1B 4NZLB 2O5IC 2CQAA 3MTSA 1EWCA 3WDNA 2K22A 1I7HA 3I9V1 4TMAB 2M0AA 2F0TA 4F87A 2E3TA 4ILWA 2PZTA 4ULLA 4OZBA 2KDMA 3CQZB 4RH6A 1T5EA 5E1FA 4Y7NB 2BT6A 4ITKA 1HTLD 2WS3B 2F0MA 3VRAB 5BMIA 4R8NA 5C4ZA 3IFTA 3VYRA 1TYGB 1HFGA 1TS5A 4B9WA 1SE4A 4OVZA 3SDZA 2WV6D 3C1FA 4HCSA 2L32A 2IJ0A 3PO0A 1F77A 2Z4HA 4OGQC 1EQVA 1ILQA 2AWOA 2MUYA 3W3AA 3J7AF 1QLBB 3PZ8A 1C76A 2WXHA 2JZPA 3DHQA 3T3OA 5J39A 1V43A 4HKQA 3E6ZX 2EYHA 1PLFA 2KUMA 1SNPA 3ETRA 1DXMA 1CI3M 3LXFA 2FHTA 2XWJB 1XO3A 3P4PB 1VRAB 1W6JA 3NS1A 5BYRA 3EVQA 3HOUB 4HEA1 2K01A 1LTID 1JOOA 1XLNA 1OXSC 1D2BA 2DY7A 1JCKB 1PRTB 1O78A 2JXTA 1LV9A 1PDQA 2LY7A 3NHHA 3S2DB 1FO4A 2R3ZA 1LT4D 2E75C 4LLGM 1PZID 3DMUA 2INPE 1WXQA 2ZW0A 4FNFA 4UDUC 1GB4A 4KKSA 4AYBB 2K05A 2B2UC 1G2SA 1B2TA 2JXMB 2QEJC 1PGBA 2KHSA 4PNYA 3T56B 3FILB 1EIHA 3MHZA 1STNA 4CGYB 1GB1A 2K5WA 3VR2A 2WXRA 5CV8A 1YNNC 2BYTA 3KLSA 3L4PA 4K8JA 2JSOA 4YSXB 4H2AA 1MHHE 3IT4B 1F9SA 4ZAIA 4ARCA 2PQEA 1OQQA 1SNCA 1FNWA 3NZ3A 3MXUA 3BK2A 1EYDA 5I4DA 1KF6B 1K53A 1MBYA 1MVKA 4A3JB 5AUKA 2BE5C 3OIQA 2EKIA 3O13A 1XF5L 3TP6A 3NP8A 2K3UA 1QWYA 4RKBA 5C5LA 3D4RA 3BYTB 3NWSA 1DOLA 3KUPA 4ZHPA 1K52A 3H09A 2W82A 2L55A 1G91A 2WXNA 3S14B 3K59A 2N55A 5G5GA 3P4RB 3L3OC 1ACCA 3SHLA 2A69D 1KAAA 4O42A 4MACA 1A15A 3Q6SA 2D2CC 2A68C 1B1ZA 3T4AC 1TKGA 5EE0A 3U9OA 3NQIA 5IOCA 1RODA 3ZJUA 5EE9A 2NB0A 5HHDG 1XEEA 2DLBA 3K6OA 1GUTA 2BA1A 3OHXC 4ZOHC 1C48A 1LT6D 3I70A 3RPFC 1BMLC 3M3YB 1NSNS 4K2KA 1PDXA 2AX5A 1KDAA 4A3GB 1KABA 1HHVA 1G6ZA 1IGDA 2D5DA 2JA8B 4F8MA 3AE3B 3HVDA 2QJLA 2SOBA 4HJGE 1LTRD 4X3UA 2A74C 4C3JG 2EJFC 1EYCA 1AW7A 2B2VA 4C3HG 5JOBA 3UI2A 4IUUA 3VR5A 2CVRA 2F3VA 1S5ED 3P75A 4US8A 3TEZA 5C44B 3SK4A 3OSOA 1GUNA 1NR4A 1I50B 1O7YA 1II3A 2DNEA 3ZJVA 4DFAA 1GHKA 4KD4A 2QIEB 2SNMA 1STHA 4NAMA 1BR9A 2X6LA 4L23A 3TBIB 4IDIA 2L4NA 1TY0A 3D6CA 2IDYA 3NRZA 3CWIA 1STYA 2PNRC 5IODA 3J9CA 1F9RA 3OWEB 1HFNA 1BF4A 2AQ3B 1IKMA 5CV5A 1Q1EA 3AMZA 2AQ2B 1F2MA 3HP3A 4OW0A 1JOQA 2IW3A 1GAQB 5BN3A 3U52E 2QILA 3PIP3 1D5ZC 2E74C 2HTME 1ESFA 4ODGA 4A6QA 1SYDA 3TEWA 2SDFA 5JVH3 1F2RI 4GDLB 3R93A 1E2WA 2W3RA 3AECB 5LHY1 2HDMA 2KECA 2WKCA 5IGCA 2L83A 2RA4A 3IFDA 1WTQA 1DZ1A 3D6WA 5CORA 1F9PA 2DWQA 2K5PA 1V8CA 3S9WA 3KLSX 3LWEA 2J4XA 1JWAD 1N60A 2EELA 2E2HB 2WXMA 4K6DA 1KNAA 4X3KA 2WXGA 4RGMA 2KOLA 3KBGA 4CQNA 2QMTA 1WTWA 3ZGZA 1KDBA 2EYOA 3NTKA 4M1UB 1KTKA 1S5BD 3FAHA 4P2CB 2KWDA 4IUQA 4M8AA 3GTJB 4HROA 2NUCA 2WKDA 1QKZA 3SR6A 1L6VA 2PTLA 1TS4A 2NVYB 2WXQA 3X3MA 2WQYB 5C0XI 5C4JB 3UI3A 1I3QB 3B2GA 1ZEQX 5CV4A 4FXCA 2MEKA 3T53B 4XDCA 1KRHA 2XWBB 2X38A 2L1AA 5A2QL 1RYJA 5C3XA 2WDRB 3FRPB 1JRPA 3FILA 1N5XA 1QG7A 4KMUC 4A3BB 3GQBA 5KRUA 3VRBB 2G9HD 5LL6X 4HTHA 3FPPA 3RZDB 2F0EA 1B9NA 3BYYB 3VYUA 2L12A 1OXUA 4ZUIA 1LT5D 2MJ3A 5M9OA 3AN1A 3IKJA 1DOKA 4B08A 1EY8A 3MP9A 2PW5A 4K14A 1YNJC 1IKLA 2L0CA 3DEOA 4NJCA 3KWVA 3I90A 5I2YA 5H8YE 4XE0A 4KGTA 3V96A 2H4OA 1WGKA 5EE1A 1TU2B 3J80L 3SK8A 3ND9A 1A2TA 3HVZA 1DOXA 1VDZA 2NVQB 3A8IE 3OOCA 4PV1C 4PMWA 1RKNA 3C46A 2XRSD 1E7PB 4J8QA 4F7XA 3VR6A