1HXYD

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hxyD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hxyD02
1CK1A 1EEID 1KLUD 2TSSA 1M4VA 3O13A 1PTOH 2ICIA 1HA5A 1V1PA 1STEA 3DWPA 4OHJA 1PRTF 4BWGB 2G9HD 1KLGD 4TSSA 1LT3D 1RCVD 2IPKD 4RGMA 1AN8A 1LT5D 3BVMA 3MC0B 1JWMD 1S5ED 1ESFA 1JQYD 2WV6D 4RH6A 4RGNA 1D6EC 1FNUA 2IJ0A 1BXTA 1L0XB 1YN3A 5ELCA 1LLRD 5TSSA 3KLSX 1LT4D 1LTSD 1PZID 3V05A 2RDGA 3OWEB 4L63B 1ET9A 1TS2A 3BYYB 1ENFA 1MD2D 1I4PA 4L6TB 1TS3A 2XRQD 3CHBD 1PRTD 2Z8LA 1B1ZA 1PZJD 2NTTA 3W2DA 1S5BD 4NZLB 4Z9CB 1CQVA 1B44D 1PRTC 1XXGA 3R2IA 5ELEA 3BVGA 5ELBA 2XRSD 1TY2A 1HQRD 2QEJC 1JR0D 1L0YB 3EFXD 1I4RA 1RDPD 3GP7A 4C56C 4RHSA 1LTTD 1PTOF 3R8BA 1PRTB 4RCOA 4DXFA 1FD7D 1D5MC 4UDUC 2AQ1B 1SE4A 3BYTB 2XNAC 1PZKD 5FK9C 1QILA 4RHRA 1SE3A 1LTGD 3SEBA 1FNVA 1D5XC 1SJED 2XN9C 1FNWA 1SXTA 1SEBD 1PTOB 3MFGA 4K6LA 2AQ3B 2AQ2B 1I4QA 1EU4A 3R2TA 1I4XA 1S5FD 2J4XA 1CT1D 3DWAA 1I4HA 3BVZA 3TSSA 1KTKA 1ET6A 5I4DA 1AW7A 1GOZA 2SEBD 3URYA 1BCPF 1EEFD 1PYWD 2CHBD 1G8ZD 1UUPA 5ELFA 1PTOD 1V1PB 2RDHA 1LTRD 5D3IB 1YN4A 2R61A 3EA6A 1XTCD 4RGOS 3BZDB 1PTOC 3DWQA 4O1NA 1SE2A 1SJHD 1S5DD 1EWCA 4DXGA 1CHPD 1TY0A 1YN5A 1HXYD 1RD9D 1HTLD 4RGTA 1F77A 1UNSA 1DJRD 5FKAC 1S5CD 4RFBA 2NTSA 1LTID 1JWUD 1T5XD 2O2LD 1LTAD 1SBBB 2QILA 1BCPD 1LT6D 1I4GA 1TS5A 5D3DA 1BCPC 1EFID 1LTBD 1JCKB 1V1OA 5ELDA 1LO5D 1DYQA 1TS4A 1EU3A 1RF2D 1FGBD 1BCPB 4ZYSA 1JWSD 1D5ZC 1CHQD
chains in the Genus database with same CATH superfamily
1CK1A 1EEID 3DM3A 3RR5A 2L11A 2JZPA 2F0GA 4IUPA 1E90A 4PS3A 3EGRA 1SB3C 3GTKH 1L7YA 2XK5B 3FRPB 1DOMA 2HTME 2BH8A 2EIFA 1I94Q 1MHWC 2R92B 4LF9L 1RM6C 1X1MA 4KY7A 2M8SA 1I50B 1STHA 1QQRA 3AM9A 1GUOA 1RKNA 3T9LA 1AE2A 3UDXA 2E76C 3AB9A 4XWWA 1QUQB 3Q8DA 3HM6X 2EZVA 4F7ZA 1PFBA 2KMMA 3JAME 1WTVA 3AB5A 4N59A 1YNJD 2ASQA 4LJZC 3TCAA 1D6EC 4YWGG 2WKCA 2E8GA 4JBMA 3VDZA 2N1VA 3LB8C 1LYLA 2K1BA 1WYDA 4L5QA 3GTJH 3QWZB 4CDCC 1C0AA 1U4RA 3QWNA 3I63C 4ZRJA 2Z6KA 2J0JA 3B2GA 3E9IA 4KSKC 2E2JB 3J7A5 2L4NA 1Y8PB 5M5YH 2WGSA 3W9CB 2R2OA 4A93H 3T3NA 2BS3B 3NENA 4C7YA 2OEDA 2KK8A 1UGMA 1J7BA 1DCZA 3BDOA 4DR3L 3R2IA 1XJVA 4BBSH 1WXMA 2L32A 4BA1I 2KVRA 3ERQA 1C77A 3V60A 3PQIA 4ME5A 3TJPA 1LTTD 1VDZA 2MLBA 2KN4A 1LUZA 5JVH3 3ZW3A 4JI8L 2I07B 1QILA 3L0WB 5C3EG 1IBXA 4EQPA 3GTKB 1TGZB 1H9RA 1G291 1UF0A 3IXSA 1DOXA 2AQ3B 2JN4A 3SK6A 1XEEA 5I9PA 2VQFQ 1EU4A 2K7VA 3BZKA 3G48A 3D6WA 4POFA 1FM0D 1WXAA 2DWQA 2W82A 2KC1A 5DNFA 2J4XA 3WOEA 5CHFA 4ZRQA 1CT1D 2ZTEA 1PXUA 1K3BC 4JK1C 3MAQA 3I90A 1V1QA 4K8IA 3M62B 5I4DA 3I72A 1SMYD 1Y14B 1N8RC 1TYGB 1TVXA 2WXKA 4A6QA 2WXFA 4ODGA 3HOZB 2A5UA 3QHTA 1I42A 2MBBB 2HD3A 3J80c 1Q1OA 4CHTB 1YN4A 3KUZA 4IM2A 2Z1CA 4ZOHC 4NQKE 5MPOA 4IURA 5CV6A 1C8CA 2UXDQ 2INNE 2DY8A 2M9VA 5C1ZA 3L16A 1G2SA 1K53A 4HCPB 4IALA 2KVZA 5AEKB 2MP2B 1WTOA 3HOUG 5M5YB 1BOSA 2XSCA 2JVCA 3Q22A 2K50A 2MFIA 2YTXA 1XX8A 3A8KE 1YITA 1Q10A 3Q2AC 3NELA 3T1YL 4BBSB 4C3JG 3E9HA 1EIHA 5LMNQ 3MHSD 2V1CC 2HDMA 2B3GA 5CBEE 3M7NA 4PMCA 4U68A 3JSVA 3KDFB 2ZNVC 4LF9Q 5M3MG 1K0SA 4CYEA 2ACZB 3R3OA 4DAMA 1OQRA 2ON8A 2RPQA 5AUIA 1MJDA 3MWYW 4X3TA 1NBWA 4F87A 4HJ8A 4NJ6A 3GTQH 4BOZB 2BW2A 1WM2A 3B1LX 2CH4W 3TS0A 3W1SA 1P1AA 4OO1H 3PGEA 1WJNA 1WTXA 3TZUA 2L0FA 1CZGA 2L5TA 2RMMA 1DD2A 1NDDA 1HA5A 2UUAQ 2KFKB 2J0MA 4W9CA 2PYKA 3AEGB 5BN5A 2INCC 1C4AA 5DPSA 2RBMA 5ELOA 1RCVD 1NAPA 1AN8A 1V9PA 4DV7L 2ONQA 2K6QA 2BTEA 1TT5B 1VS0A 2MPMA 4XGAB 4MN3A 4JOIC 4DR3Q 3OYYA 1EF5A 1GNUA 2J7QB 3AE6B 1YN3A 4HXDA 1F2YA 4BBRG 1XLOA 4I6NB 3J7YW 1SRUA 3AEAB 4QB4A 1G6PA 1JMLA 2Z9HA 3IHPC 4P2CB 1KD1C 5G5HA 4FDBA 3I73A 4L23A 3JVZX 1BO0A 2D0PA 4CKBA 3H15A 1G91A 2LKVA 4JI8Q 2N9KA 3H7PB 1BBWA 2XTIA 4K7SA 3NWTA 2M0AA 3G6JB 1WTQA 2RDBC 3QJYA 5C5LA 2PEAA 3J80E 4L5RC 1SNQA 2BPSA 4BKSA 2KCMA 2C5LC 1Q1BA 3UIOB 4PYUA 1PLFA 1KNAA 2ZXOA 3I8ZA 2LWPA 4XC2A 3GTQB 2A73B 4OX9Q 2WQYB 1Q1EA 2H4OA 4AQ7A 2B2TC 2FNJB 1IBLL 4ICVA 1BBXC 2M56B 2DJFC 4IDIA 1WI5A 4O0AA 3TEZA 3Q3FA 5EQ0A 1N6ZA 4NJCA 4FVMA 1PMRA 2X6LA 5C4XH 4ZAIA 1FJGQ 2XBBC 4FJVB 1QCBD 5FLMH 1XPOA 4BA2I 4H7BA 3RFZB 3FILA 3EJIA 4XE0A 5L83A 3VUWA 2ZM6L 1QNUA 5C4JH 1FEHA 5M9OA 1II3A 2PW5A 4IUNA 5NUCA 3A5UA 1WFYA 4JI2Q 3PCOB 1VCIA 1M8AA 4R4OA 3T1YQ 2QDBA 4BY7B 2CW0D 3H8HA 4B9KA 1NR4A 1WCMH 2QW7A 4NY0A 4AJWA 1S5DD 2VZKB 3DBHB 1I5FA 5CTRC 2RPVA 3ZNID 4DDGD 2F0QA 3S1RH 1YN5A 5E6JA 4MNOA 1JWAD 4WJPA 3TEXA 4QIWE 1HR0W 4DV5L 2F52A 1SSNA 4OVUA 1EWIA 4RFBA 2DY7A 3Q8BA 4A55A 5COYA 2WINB 4J1MA 4O42A 2WXIA 1JOOA 1RL2A 3NK9A 4CDEC 3F2BA 1E1OA 2J0TD 2ES2A 3GTPB 4A9AA 4WH4A 1CTMA 5D3DA 4XT1B 1KJTA 4I7AA 3VFKA 5JAVA 1FGUA 2KDBA 1EY5A 4NMZA 2F0NA 1MG8A 4DNRB 2CQAA 4DV7Q 3IAYA 1IXRA 3K0YA 1V2YA 3ZNGC 3QG1A 2GVBA 4DV1L 3ZTCA 4IPCA 5BMHA 4WJOA 4DR1L 3F1ZA 4A3JG 2K5PA 4HMJA 2V4IB 3CWIA 5C4XB 4W9IA 3RUIB 2IWHA 5AZFA 1SMXA 3SK4A 2K28A 4C3HG 4QIWB 5GXGB 4GB9A 4OGQC 2KEEA 5C4JB 4IG7B 2G9HD 2MUYA 1S4ZA 4CDDC 2GBJA 1EY4A 1RTNA 5D7GA 2AYOB 1IW7C 4GDKA 3ZXVA 3NVZA 4IJLA 5CGKA 3D31A 2YTYA 5D14A 3PO3H 1WCMB 2WXOA 3DBLB 4LAAA 1E2VA 5ELCA 4QMGA 2VB3X 4C2MH 2SNMA 3M4PA 4RCNA 3PMFA 4FLHA 1A15A 3S1RB 1N34L 3A0JA 1XPRA 2K5DA 4LLGM 2X6GA 4L6TB 3J9CA 1TWHB 2JA8H 4QGUA 5IT9c 4OL7A 4NZLB 4G57A 1MJEA 2E75C 4AOFA 5M5WH 5ELEA 1EQQA 2K5NA 4R1JA 2CS4A 3B08A 1FR3A 2PNHA 4FULA 3ZQ4A 1EFWA 4C56C 3HG9A 3R7QA 1PRTB 1PH1A 4UDUC 5JOBA 2ZM6Q 4IFDI 5IOIA 4TMAB 5EE0A 3TEWA 4A3JH 5I6YA 1WE7A 2KDFB 4E71A 3AYHB 4BKGA 5E6NA 2O6VD 1SJED 3VR5A 3M3YH 2LGXA 1WYWB 5IAAC 2RDFA 3VH3B 2Z4IA 4DU9A 1ZYRD 1YMHE 4G4KA 4WWPA 4MDKE 1B9MA 1KOTA 1J6QA 5KNDA 4R8NA 4A3FG 1HFNA 1V86A 4D2KA 2PI2A 3MC9A 3NHEB 1VMCA 1NMGA 3FPPA 3IKJA 3A55A 5AJ3L 3G6EA 4A3KH 1PH4A 3PO3B 2ZTCA 4P73A 2KX0A 1RFAA 1RLFA 4C2MB 2VXWA 3CCQA 1H9SA 5E7NA 1DOLA 1QZEA 2GI9A 2K5VA 1DZ1A 5KGUA 3AEEB 2JXXA 5BYQA 1IBML 3TEYA 3JSVB 1IGCA 3DXJC 3J81i 3RZOH 3PIP3 4XYQA 2JA8B 1TY0A 3PRZA 5FR3A 1GJZA 3L13A 4B3ML 2K25A 3S2HH 3SHLA 4DV1Q 3OLMD 1F77A 2KHJA 1K0RA 4G50A 3I5JC 3QJZA 3SGIA 4C1NI 3H91A 4IUVA 1PV4A 4AIMA 2JXMB 2CCZA 2KDEB 3V6CB 4C3IB 4B3RQ 5BN4A 1R9TH 4J3OD 5KEEA 4DAVA 1Y1VH 4A3CG 2V9HA 1MVKA 1YNTE 4JLCA 1Z47A 3IT6B 4B0EA 2F4VL 4LK1C 4HIDA 5DPTA 1YJWA 1E7UA 3M3YB 1FGBD 4GLVB 3PF5A 4PZ8A 4R4IA 4HJ7A 4LUOA 1EIYB 4DR6L 4JI6Q 1QJOA 1KDCA 5IT9E 1J7CA 1N63A 2LGDA 2F0VA 1F0ZA 2EJFC 4DV2Q 3KF8A 3FDTA 2LXJA 4PT5A 3B9JA 3U7DA 4FP5D 1PDXA 4A3KB 1NSNS 2GVAA 2BKRB 1AP0A 2JX5A 4HDOA 2RKSA 4OIJA 2A1AA 4XTCS 4F88A 3Q6BA 4IC7B 1CKNA 4DA2A 1SAPA 2F0PA 1MKHA 4J6HA 1EL0A 3FKIH 3RZOB 3D0FA 1OEYA 1X3GA 3H6MA 4DAYA 5DCNA 1X54A 3GQBA 2LHDA 2I5HA 1LTLA 2EJGC 1ENFA 2WAQG 1Y1WH 5D94A 5KHQA 3HOXG 1VQ5A 2JA9A 3K0XA 5HKHA 3FHWA 4FADA 2QKIC 1TWFH 2RR9A 5LMNW 1IUEA 4IJHA 1S1QB 2EDGA 1BUVT 2O6VB 2N9PC 5CR3A 1R9TB 4A3CH 3Q3OC 3A56A 3H3VI 1Y1VB 2NZOA 1MHXA 2HJ8A 2O4XA 3KH0A 1VQAA 4RHSA 2HTHA 2VUMH 3K59A 3MXGA 2XK5A 2AQ1B 2R93B 4HCEA 1XMOL 3W3AA 3ZIMA 3ZRCA 1Q46A 1PZKD 5AJ3Q 2WWZA 3PUZA 2CWPA 1WE6A 1PGBA 2Q8RE 1QUQA 1ZXIA 4ULLA 4II3B 2CJOA 3DWGC 3X3NA 3VA7A 1IBMQ 2F0HA 4AYBB 4EEWA 4BY1G 5H8YE 3BVZA 4A3BG 3M95A 5LMUL 3H94A 1VR9A 2CU3A 2V4LA 2OEOA 4NKLA 4B3MQ 4TKOB 2Z0EB 1PYWD 4BXXG 4YCWA 4F7XA 1ZDXA 4WQMA 2EOTA 3MXUA 1AZPA 5H92C 5C3JB 4RKBA 3FKIB 3E0JA 2V4DA 1OGWA 2KWVB 3AE8B 3SK8A 4B08A 2KUMA 2BYTA 1FIQA 3HOXH 2FIFA 1Y1WB 3RZDB 1STNA 3ITPA 3FEWX 4A3MB 2F4VQ 1E6EB 4P1CC 2OXPA 2K5WA 2ZJDA 4ZRKA 3Q8EA 5C0XI 2M2LA 3PRMB 3QIJA 4K1RB 4CHKA 1W3SA 3RPFC 4JI5L 3FP9A 4MM3B 3U9SA 3I70A 4QUFA 5IE8A 3OW2A 2BH2A 4DFAA 2A69C 3HUIA 2I46A 5FOBB 1H9MA 1A63A 3EQLC 4DUZL 4DV0L 2VUMB 1TTNA 2GBKA 1JCKB 2NN6I 3TL5A 4PV1C 2QIEB 1E2ZA 2EPBA 3S17B 3PT2B 1DONA 2D9UA 2VB2X 4E6IA 5KYIA 3J7ZC 5K36H 3EC8A 2AUJD 3AEFB 4MGYE 1JWSD 1JALA 4Q2JA 2F0IA 1EY0A 2KBNA 3T4AC 1SYFA 2E2IH 2UU9L 1OFFA 1LFDA 1GUSA 4BBNC 3IAM1 4U673 5J2RA 1V80A 4XQQA 1JQ4A 1O7IA 1EQRA 1U4MA 5IWAL 3JAMi 4OHJA 3UDFA 4HIMA 1L4ZB 2XIWA 3H0GH 2VW9A 3GTGH 3MA2B 2HQEA 2KTRA 1VQJA 2INDC 1QNKA 3ULLA 3I4NH 4PYZA 3UQAA 5J1ZA 3CMMB 3AI5A 2MP2A 4MH8A 1JQYD 1Y8NB 1VZ8A 1O7LA 3AULA 1LQBA 4OEMB 5IP9H 3WAMA 2L0CA 1E0ZA 4M02A 5M3FB 2WDQB 2TMPA 3W5UB 4B95A 2PI2E 1PZID 3ZYYX 1PUTA 3WA0A 2D5DA 2LMCB 4MACA 4C00A 1PH3A 3KDFA 4G7ZC 1K28A 3HKZB 3U4VA 1ZGUB 2GMIC 3EN2A 2Q2HA 4IM0A 1PA6A 4R8IA 1GD7A 1RYJA 1EYGA 1E2WA 2K32A 3ZTDA 1D2BA 1L0VB 2GBMA 2VH1A 1VD2A 4KD4A 1IL8A 2AL6A 2MQHA 1HQRD 1XO3A 4WJNA 4AJYB 2KCNA 1UWMA 3PGZA 4R9WA 2EYFA 2CU1A 4DR4L 2H1EA 5LMUQ 2IY1B 4ARIA 1FD7D 1NBFC 4EZJA 2KFKA 2JYEA 4KHZA 5FK9C 3RD2A 1V43A 3SEBA 4HTHA 1TKWB 4OO1I 2E2IB 1WGDA 5FLXE 1HZ5A 2NWGA 1NYRA 1PQSA 2F0KA 3PIO3 1K9MC 4DV4L 1JORA 5LLIA 2AQ2B 3H0GB 4EE2A 3GTGB 2PE9A 3H09A 1P8LA 2PW7A 1H9SB 1HZ9A 2MJEA 4ME3A 3I4NB 4OONA 3P1MA 1E3PA 3MVVA 3WIMA 1QKZA 3IAS1 4M00A 4JI5Q 4LW1A 4HEDA 2DUDA 2YYZA 4PZ6A 5IYCG 1T6BX 2C9WB 2LGYA 1V1PB 2RSUA 2A19A 5T8IA 4KY6A 3H7PA 4B3TL 3MJWA 1V5OA 3K9PB 3KFUA 5IP4D 1B3AA 4DUZQ 2PQAB 3OIQA 4DV0Q 4WORA 2D2QA 3K5MA 3PO2G 4OZCA 2JU6X 2LI5A 5DAUA 2JYTA 3BIID 4QUCA 4GOPB 3DBHI 4YCUA 4IPGA 1SFOH 3Q8AA 1WR1A 3P63A 3S16B 4IWOA 4FA6A 4A3IG 1H8CA 3NE5B 4GNXB 1FFUA 1EO6A 1SLJA 2JRHA 3I3CA 3ZVVA 1GUWA 1I4GA 1ROEA 5IWAQ 1UWXA 4M8NA 3QC8B 4BS9A 4HR7B 2VL6A 1OQQA 3NOBA 1V1OA 5AZGA 4IO9A 2XWBB 4KLKA 1FCCC 3AE4B 4IZ8A 3KF8B 2EKEC 3NHHA 4RMFA 1LABA 2RSOA 3VYSA 2MBOA 3F8TA 1BCPB 1EY7A 2VQFL 3B2FA 1XNQQ 4AQYQ 2L12A 3BK2A 2B39A 3M7GA 1EQVA 2V3NA 3VYTA 5EBDA 3ZJYC 4HK2A 3VUXA 1OXVA 1SR3A 3Q3NC 1YNXA 3A8IE 4L1BA 2A6HD 2M0XA 2WP8J 1CKNB 4TQUS 1WMHA 1D1IA 3CMEA 3HIZA 2L1BA 4H13C 2LVOA 2Q2TA 4DR7L 2WB1G 2LS01 3K7UC 4XQNA 3L2PA 2OHFA 1A3UA 3EVQA 3N32A 2JY6A 5CHWA 2C60A 3I9V1 4RGMA 3CC7A 3RNUA 4ASWC 4LF6Q 2B2YA 1YIJA 2UXDL 2D11A 1JOKA 4NDXA 3AECB 4ZRPA 2IT1A 1PGXA 3TEHB 1PYSB 1VZ7A 1P0RA 2L00B 3PO2H 3ZNZB 3B6YA 4J15A 1Q86C 3OMGA 2D3AA 3DBLI 3VQIA 1WJJA 3KYHC 4MELA 1HA6A 4DR4Q 1WY8A 3P1HA 2WDRB 4OZBA 1P7EA 1NI3A 2HDLA 3CC2A 1I4PA 3L9AX 4CJ2C 5LMNL 4JQWC 4WQOB 1KDAA 3J80i 1NNXA 1Z7TA 4CKEA 1XD3B 4FF1A 3RZWC 1R4NB 4H2AA 2XWJB 2KT7A 2OQKA 3GE8C 1PRTC 4DV4Q 4H44C 2MJDA 4KX6B 3ZDMC 1SSOA 3KK7A 1I7HA 1QLBB 5E4XA 3WANA 2MH7A 1TIID 3MFYA 3HOYG 4OWXB 1I4RA 2A74C 1DOKA 1PTOF 4RCOA 4LNFA 2FXQA 3GD7A 3BS1A 4OWWB 3W5VB 2L55A 3K7AH 1HJPA 4I7ZC 2Q8TA 2UUAL 4HSPA 1AYFA 4B3TQ 2ZZPB 1WTRA 4DV6L 3L3OC 3IT4B 1YHQA 4XYCA 3T56B 1TJEA 1I4QA 2H5XA 3J81j 1WTWA 2C7HA 1RHPA 4F1SA 4MGZE 1F9PA 2LSSA 5CHVC 2JA6H 2SEBD 4N9PA 1KAWA 1UUPA 2YTVA 1SYGA 2F0UA 1FYCA 5HGTA 1PTOD 2CFMA 3ICEA 5J22A 1E8ZA 2GBRA 4YXDB 1YOVB 4EUTA 1V49A 4OELB 3TZDA 3RN2A 2NR2A 4II2B 3L08A 5JXVA 2JXTA 2RA4A 5EPLA 1HEZE 2ZW0A 3A4RA 1SF0A 1MSHA 1SJHD 4V190 1V5TA 5TR5A 1QVGA 3I3TB 1UELA 2J42A 2GLSA 4YT0B 3W1SC 1TKEA 3APFA 1T3QA 1QB5D 1KAAA 2X69A 2E5LQ 4LK0M 5C6AA 3K5OA 3N30A 3OJ4B 1GHJA 2AHOB 2ZW1A 1YBYA 4Q5VA 3T1HQ 1HFGA 1LT6D 1B7YB 4OX9L 4S3SA 1TS5A 4KKJA 2B29A 2N49A 3RMHA 1HNZL 1HZCA 2K6DB 4LFCQ 4JL9A 4DR7Q 5ELNA 4WURA 1T5EA 1IYFA 2EYHA 1EIFA 2BCOA 4XT3B 3GTJB 3TUOA 3K7AB 2N55A 3OWFA 4X66Q 1EZ6A 3ZUNA 1NENB 4JE3B 2KTRB 4MSMB 4DR5Q 1GM5A 2BVCA 2M19A 4LFAQ 1FJGL 3MXPA 4KI0A 3I55A 2DYOA 4E74A 5GMVA 4A93B 1PTOH 2ICIA 2CJNA 3PSIA 2BS4B 2D3CA 4BWGB 4JI2L 2JA6B 1I6VC 3IFDA 4K5VA 1ACCA 5J17A 1J9OA 2NB0A 4UP8A 1WI0A 3DVGX 5LXHA 4HMIA 2WLBA 4AS1A 2K5QA 2RVLA 5C3WA 1VQHA 4APVA 1GC6A 2ZTDA 4N9TA 2OF1A 5EPJA 2KJ6A 2EQSA 2L76A 5TSSA 1MFWA 1C48A 5C3EH 4F8CB 3NWSA 1LTSD 3J81L 3FVQA 4M8MA 2KDMA 2RDGA 4MT5A 4F8MA 2BKFA 5HHDG 2EYJA 2WXPA 2ZXPA 2LRWA 4OW0A 1A0IA 1O7ZA 2A8VA 1EYCA 2LUEA 2D2CC 1VRAB 2QGQA 4KGSA 2A68C 2ATWA 2C7NB 4ZRZA 3VR4A 3O65B 4DV6Q 1K8GA 5C44G 2KXJA 1ENAA 3S24A 2EY1A 3TREA 1H4RA 2G3QB 5G55A 4BKTA 4DHJD 4K3CA 5HY6A 2WXQA 5E6OA 1R4QB 3C3LA 3GTMH 3EFUA 4DXFA 5JEAG 3R8BA 2PZWA 1STGA 3VR9B 1WIAA 3PO0A 3AEBB 3DWMA 1WGYA 3Q23A 2XNAC 1FXTB 3HOUH 3CF5A 1YJ1A 1CFMA 2BOSA 3NUCA 2OOBB 4H02A 1RODA 2XN9C 1CA5A 2BYVE 1W6KA 5IGGA 2YEPF 1WH3A 1PTOB 3P2BA 4YSXB 1X3FA 1SDFA 3OTOQ 1B4OA 4KMUC 4K6LA 3S15H 1T0YA 1WJ4A 3VYUA 4XQJA 1IKMA 2UWQA 3AV8A 1Y8OB 1Z5SB 4C3JH 2I0QA 3V61A 3FAHA 1S5FD 3CPWA 2BT6A 3NVYA 4EKUA 2G5DA 3Q6SA 4HPPA 5M3MH 3MTNB 2PE6B 4IUTA 1YHBA 1UE5A 3KLSA 4L2YA 1EEFD 2KHIA 2PO4A 1G8ZD 4Y7NH 2UUCL 2MBHA 3DPDA 2CKZB 2ICEC 2LZ6A 4P75A 1SE8A 1VQEA 2RGFA 3ZJUA 2B2WA 2Q5WD 3HGBA 5C3EB 3OPOA 2WXMA 3STBC 5BO4B 2BS2B 3I4MG 1PFDA 4A3DG 3D4WA 4JGHB 1HNZQ 2F4IA 2EYLA 3R66C 2G45B 3J7AF 2O6VA 2LY7A 4JC0A 3E6ZX 4KZCA 3W1YA 2RQXA 2BYEA 1WWTA 3OMCA 4YTMB 1S3OA 1HTLD 4FNFA 1YVCA 1ZE3D 2JSVX 3IG3A 3D4RA 3RI7C 1DJRD 1B9RA 2K14A 2XGTA 4GLAC 4FXKC 1WXQA 4O2DA 2DLBA 2K01A 2B8GA 2I5LX 2K52A 4ZUIA 1YD8U 2JRIB 4W9FA 5T1IA 2W3SA 2VZAA 1FXIA 3WDNA 1OXXK 5ELDA 4BBRH 4YTPB 3UI3A 3GV3A 1WMHB 2Y5CA 1ILQA 3A9KA 2BE5C 3HOUB 1IBKL 2WDVB 1OO9B 1RF2D 1BR9A 3BG3A 4YY3Q 2FBWB 3S14H 2M1MA 3RNCC 5E6PA 4ACFA 2GB1A 4RM8A 3I56A 1M1KC 3B0AA 3SU8X 1C3TA 4MTNA 3PUWA 2VY3A 3S15B 3DBRB 4GXBA 1AEXA 5BMIA 2MRPA 2WX0A 5IP7G 5CORA 2WP9B 3AEVA 1IKLA 2W3RA 2Y3AA 1VQPA 1WOCA 1G51A 1JOQA 1X6OA 1CI3M 1STYA 5M3MB 3RCZA 2F0TA 3TQYA 5FJ8G 1ZOYB 3P4QB 3U58A 4A3EG 1LT3D 2AUKA 1F2RI 1F52A 2HCCA 1LT5D 2VNUD 4IKGA 4X62L 4LF4L 1JWMD 4B9WA 3S2DH 1A5RA 4A3DH 1ZXTA 5GAHC 2GBNA 1WX7A 3DOWA 4XWTA 4DUYL 3TP5A 2M00A 3TN2A 3PZ8A 4MM3A 4K5WA 1A62A 2HE7A 4DHJB 2WDTB 1XTDA 3P4RB 1WD1A 4DNTB 4KHPQ 2K8CA 4EX5A 2PZUA 4WJ3M 2LD9A 2KLGA 4FHJA 2UXBL 2KJXA 4ZUJA 2LRUA 3CHBD 2WYQA 2QSDA 2WXNA 1NMFA 4AP4C 2CHZA 1HQMC 2A4ZA 4B3RL 2UU7A 1ZW7A 4P1BC 4BBRB 1C78A 1L0YB 2B2TA 3AQQA 4A3LG 3HOWG 2EKIA 2I2YA 1YNNC 2FCNA 3S14B 1EYAA 2R7ZG 1K83H 4JI6L 3V2TA 2UUCQ 4LF5L 4DHZB 1RJTA 1FRDA 3PRPB 1Y8RC 3VTWA 4ZHPA 2D62A 4X65L 3FKYA 4DV2L 1SEBD 1TBEA 2QCZA 3MFGA 3UINB 4ZHOA 2ZEQA 1TIFA 2I38A 3JAML 3CCSA 2RHQB 2CHXA 3QB3A 1GUNA 5HURA 4HJAA 5IIFA 3HOVG 1ML0D 2K6AA 1YIWA 2N0SB 4ZYNA 3Q0AA 1N5WA 2INPE 4LJPB 4JI1Q 1ZP0B 2K0PA 2YEPB 2B8FA 2VQEQ 4GLSC 1K8MA 5KIXA 5DM63 2ASBA 5EPKA 3S2DB 2N7DA 2V3PA 3N1ZC 4KIKA 3MEFA 4LJOB 1JRPA 2K04A 2PMZE 2LMCA 3N1YC 4NAWB 5LNK1 1WR6E 1P7FA 1Q90A 1B70B 4UPAA 4CKCA 1MSGA 1Q81C 1UGJA 4REZA 2ZJQA 3A9JB 2K8HA 5M5XH 3DWQA 3CF6E 1E7PB 4RM9A 4W9KA 4HJ9A 4J6IA 3APCA 2JA7G 1VQ8A 4JCVE 4V0BA 2AX5A 3OJ3A 5IGEA 5AFWA 4ZKCB 5IGBA 4DXGA 1IBKQ 2IBIB 1Y69U 4N58A 1BF4A 4LF8L 4C3HH 2QHOA 1IYVA 3R93A 2JZZA 4RGTA 1Q3LA 3NTIA 1VLBA 3NTHA 4CJ0B 3UDIA 4EZKA 2JA5G 1JWUD 2F3VA 1VQDA 1XPUA 4A3LH 2NPTA 2L9HA 4KV2A 5GROA 1TT2A 2R7ZH 4NNJB 2J7ZA 3DUZA 3RLNA 1BCPC 2FCSA 3Q8CA 1K83B 2PMZB 3C2PA 1LO5D 5C4HA 3HKSA 2LXKA 3MXNB 1GPXA 3E0EA 3DHIC 1VQ9A 2MSED 3A1QB 4MEMA 4X62Q 4LF4Q 2MQJA 3AU5A 1H9JA 2NVTH 3CSTA 1LM0A 3JW0X 3NTKA 1IP9A 1L6UA 4M0WB 4DUYQ 2JZ3B 3M3JA 1J8IA 2DAJA 4W9EA 3HOVH 2E2DC 1QOGA 3MP9A 1E7ZA 2IO3B 2KNBA 1B50A 3O13A 4WWMA 1V1PA 1QE6A 4KGTA 4EOYA 4OWTB 3AE9B 3DWPA 2KHWB 3QOJA 5DPRA 4JPBW 3T13A 2KQ3A 5M5WB 4DN4M 1ASZA 4ID6A 2H89B 2PQAA 1CA6A 2PPHA 2UXBQ 1M94A 3CC4A 4IUUA 2NVXH 2NVYH 1SYBA 2YVCA 4HVBA 4DK6C 2CKHB 4HCNB 3DEOA 2MP1A 4GOPA 4UP7A 1WYGA 3NZSA 4KDIC 5M5XB 3E3XA 4A90A 1EOVA 2L0TA 4A3JB 1TKGA 4A3GG 2BDOA 1N60A 3KLSX 1ESRA 4X57B 4DR2Q 1XCQL 2PTLA 3IVFA 4GNXA 1XF5L 3S9WA 2ZPYA 4C3HB 4IM3A 4HKZE 4M01A 3EUB2 4PMBA 2C9OA 1UE1A 2OWOA 4LF5Q 1TS3A 2EYOA 1E8XA 2MBEA 1XWEA 2BDNA 4X65Q 4A3FH 1SNMA 3N6RA 3MHZA 5CV5A 1NTGA 4DDID 3EROA 1X65A 1R4NI 4RG1A 1TZOA 2D3GA 5I9OA 2PMVA 2H88B 1N36Q 4DXAB 2N88A 1WX9A 4HRSA 5DLQE 3VA5A 4LTUA 1SN8A 1FRRA 2NZHA 1X9NA 5C4ZA 2HT1A 3P20A 2NVTB 3A33B 2EXZA 3GTLH 3PF4A 4NXNL 2D07B 2L3ZA 1LTGD 3GS2A 4OVZA 1D5XC 2MNAA 1XMQQ 5HG2A 4WAFA 5A35A 2IY5B 2F0DA 2B2UA 4RKLA 3TBLD 4I65A 3S2HB 1GJXA 4XDDA 1SROA 3H3VC 1FO4A 3R2TA 2PW9A 2LXCA 4US8A 5FO7B 4L8JA 3RUZA 3T53B 4AYBE 5A2QE 3PLVA 4R3DA 4NW2A 5DEHA 4DWFA 4NPSA 3AFQA 1O80A 4LF8Q 2NVYB 2JEBI 4AH6A 2KHSA 4HKQA 4ZRIA 1WZ3A 1FMAD 2JT4B 2DZJA 4HIKA 2JPHA 1LTRD 3EA6A 4RGOS 5JJLA 1YQ3B 4ZDVA 1HTOA 2ZNVB 3KQ4A 1WGKA 4O1NA 4YL8A 3AMUA 1L6VA 5FO9B 2LGIA 4ANWA 4JX1C 4A20A 4KHVA 1GKHA 3J80L 3A4SC 3VR6A 5JPMC 3K9OB 3N3KB 4KKIA 1ENCA 4A3FB 3A9KB 3DQVA 1IGDA 1HZBA 2X8XX 3RNFC 3GE3C 4DK3C 3H9DA 2MWSB 4DK1A 2KVMA 2KFJA 1SBBB 2FMCA 3GOEA 1N33L 5IYDG 3LJ3A 1FL0A 5JJKA 1K51A 5E3FA 4JVZA 4IOAA 3UGBB 2JQOA 5IKCM 5KHOA 1DYQA 5FO8B 2AWNA 3GTLB 2IYDB 2QJLA 1VQFA 1YZ6A 2I5MX 2RCFA 4YSYB 5BYRA 1YI2A 3BWUD 5EAYA 2NBFA 4KDLB 1CHQD 5I2YA 2O5IC 3HVDA 3VRBB 1TWFB 1RRBA 3IFTA 5FLXc 2IX0A 2BGFA 4G0NB 2KQ4X 2KTFA 3K57A 1IW7D 4W9JA 2B63G 1N32L 4JBWA 3ML9A 3GTOH 1B8AA 2G9DA 5IOCA 3JYUA 3TS2A 4N8FA 3RN5A 3BVMA 2WV6D 4MTKA 2Y0SG 1YX5B 3SK5A 3H7SA 3KBGA 4GGQA 2KA7A 4A75A 4LF7L 3A54A 1YNJC 1C9FA 4P71A 3GDEA 2IHEA 1TR5A 1TXYA 2O5JC 1Q8KA 1Q5WB 3LWEA 1LV9A 2BB6A 4IFDG 2BBCA 2FCQA 2LUMA 1JICA 3PV1A 2W54A 4OZAA 3KYDD 2EJMA 2F3IA 4KD3A 3U2SC 4BOSC 5JHAA 3CCVA 3HKZE 1CKOA 2ZJRA 2DNEA 3VAWA 4BY1H 4G7OC 4JBJA 3M4QA 2IGDA 4HWIB 5C0XJ 4NXNQ 4BVUC 2JYOA 4A3BH 2Z8LA 5EKLA 2NTTA 1JJGA 3VXWA 3RNAC 1S5BD 4GMVA 5IYDH 2KWCA 4QY7A 4LMQD 3W1GA 4BXXH 2DJGC 2DN8A 1Q7YC 1IPGA 2JK8A 3BVGA 1QOFA 4I6LB 5AUKA 1XNRQ 1TY2A 1IYUA 1UAPA 3K81C 3DLLA 4DKAC 2K03A 3EFXD 4K6DA 2BB5A 1RDPD 4K14A 3GP7A 5JPNC 4BZAA 4IUQA 3GB1A 1XNQL 1D5MC 2FJ2A 4AQYL 5EE9A 2WAQB 3AU7A 3HOXB 2WXLA 1AZQA 3D6CA 4RHRA 3RNBC 2B2VA 1FNVA 1NYQA 4KIKB 1TKYA 4MH0E 1Q82C 2FHTA 4FJYA 2K5HA 3HS0C 1FXAA 1T0QC 2DAFA 3NSWA 3V96A 1HUNA 4FHKA 1D3ZA 4GU2A 4IQZA 4R4CA 3K80C 3F2CA 1H9KA 1I4XA 1G2TA 1EUVB 4LF6L 1S3SG 1SIFA 3SR1A 1I4HA 4UY8C 3M63B 2MHJA 3SR6A 4YWKA 1XLQA 1K8AC 4A3OA 1ZDVA 1UEAB 2R6GA 1AW7A 1KRHA 2LHEA 4GN1A 3URYA 3SVMA 1OQYA 2IZVB 2BA1A 2BA0A 2DENB 1SYDA 3V62A 2Y5BB 1VDVA 1SMYC 3J7AV 3LDZE 2REXA 5AZHA 1XTCD 3VHTC 1N33Q 2DX5B 2CWAA 4KV6A 3BINA 1YQBA 1SE2A 3ND8A 5GAGC 2HUGA 2NPTB 4G7HC 3FMCA 1PH9A 2JUOA 4BY1B 1YEZA 5I2XA 4XXEA 3A5ZB 2QEXA 3EFCA 4XDXA 4A3BB 3ONAB 3HHMA 3KUCB 1RD9D 1A2TA 4OXPA 3U30A 1R4PB 3HP3A 1GO3E 1N62A 2PKOA 3EECA 2ID0A 3RT3B 1A6XA 2JWZA 3QARA 2CHWA 4MGKE 1UBQA 1NEKB 2F0FA 4LNQA 2IX1A 2R92G 4DQOC 2L05A 2KD0A 1HUMA 2K33A 1ASYA 4JYAQ 1N32Q 1HZ6A 1MGSA 1TS4A 5EKIA 1WSPA 2CH4A 2ZCCA 2I1KA 2L52A 4GDLA 3CU7A 4W9DA 3C8YA 2NVQH 2AL3A 3OG5A 4FF4A 4EQNA 3LNNA 1VQBA 4LF7Q 2RSNA 1M4VA 3DBRI 5IODA 2GOWA 3DBSA 3DMUA 3EBEA 2IDYA 1MI2A 1VQGA 3HRZC 4JI4L 2SAKA 1A70A 4QL5A 4HDQA 4DPGA 3CCLA 2CQOA 3H6NA 3D8GA 2HD5B 3QAQA 4JV5L 1E8YA 1GC7A 2SOBA 1C76A 4PS7A 1C1YB 5D65A 5K5PA 5J18A 4X6AH 2B3AA 1S5ED 1ESFA 2W9NA 1U4PA 2EXDA 2NBVB 4A76A 5BYSA 3PSEB 1VMPA 3FPUB 2WU2B 4ANXA 3WOFA 3V05A 2IX3A 1R4MB 1QOBA 2FAZA 3NY5A 4FXCA 5JZEB 2E5LL 2LJ5A 2GN5A 1ET9A 3NVVA 4JBKA 3BZCA 3OHXC 4NXMQ 1E1TA 5CV8A 3TIXA 3T1HL 2NS5A 4J8QA 4PZ7A 2Z6KC 1PH5A 3W2DA 1Q8IA 4P72A 1L1OA 4LFCL 1XXGA 3DCGA 5JH5C 5IYCH 1V9JA 3ZGZA 1WXVA 5JEAJ 1BNZA 1EY6A 3E56A 3NQTA 1QWYA 4X66L 1LGRA 4MHEA 5IT9L 4JPSA 1U9RA 4DR5L 2OT2A 4LFAL 3HOZG 2NVQB 2MEKA 1VQCA 4DV3Q 2M17A 4AUQC 1PH7A 3C46A 2KC2A 2KMAA 4PNYA 1LXDA 2MBQA 3DVNV 2XEWA 3CP0A 1NUCA 1GB4A 3ZJVA 4GLXA 1SFOB 4K0KL 3VTUA 3SE0A 4KN7C 4A3IH 4ICUA 4M1UB 1Z9FA 2A5HA 2KWDA 2E3TA 4C4VB 4EGVA 2Z0SA 3CW2C 4C1NK 5C0XG 3TSSA 5LL6X 4ARCA 1ET6A 5IGCA 2L15A 3P7JA 4Y52H 4BBSG 4ZQ3A 2MX2A 4HJ5A 1KRSA 1UE7A 2EY2A 2R61A 2YV5A 2V3SA 3L10B 1BUIC 2D10A 4YWLA 3C1EA 2NN6G 1JB3A 1F9JA 1YX6B 4WJQA 2CW0C 2D5GA 2KECA 4BBNF 4W9GA 4QAYA 2GA4B 3L7ZC 4ZCKA 3AMZA 3OIPA 2GRIA 2JQRB 3V6EB 4YCVA 3MC8A 4EQOA 4P16A 5D2MB 1HXYD 5HGQA 4X3SA 4DK0A 4YHHL 1UNSA 2AWOA 1CZPA 2A69D 5FKAC 2O2VB 3DVNU 1IL2A 1CSQA 3QQ8B 1V8QA 4H0LC 4JI7L 4IOIE 1T5XD 3ZKJC 2O2LD 1NE3A 5KYLA 1K52A 2QILA 1SNOA 3KLWA 1WVLA 1UWVA 1JT8A 1C9OA 4JI4Q 3HOZH 1GVPA 1K50A 2D3BA 3PO2B 2WU5B 2ZPNA 3E9SA 1WJ6A 3L4PA 1BVSA 1CM9A 2ZCBA 4JV5Q 3EHVA 1C4QA 1U4LA 4NP5A 4ZK9B 3RLOA 4KTAA 4CJ1B 3M85A 2Q2UA 4MZ9A 3OTOL 3KF6A 1MG4A 1VQMA 1PH2A 2WXHA 1HPCA 4BAXA 2WB1E 4A3IB 3CCRA 1QG7A 2K1FA 4W9LA 5D6JB 5C0XH 4NAWA 3ALBA 2IO1B 3HVZA 3PPAA 2ENBA 4GKKQ 5EE1A 3NRZA 3A9JA 3K6OA 4OIKA 3F2UA 3HOYH 3UF8A 1I6HH 2FE8A 2EMSA 2IL8A 1XLNA 1STAA 2NN6H 2P5ZX 2EYPA 3VH4B 4LNNA 2IJ0A 5JVG3 4C80A 1UD7A 4KZ0A 2F3WA 4IW0A 2BWFA 4L5SA 3KWLA 4CQNA 2K8BA 3Q69A 1MJCA 1HTQA 1D8LA 2Z59B 2WIIB 2ZJPA 2F0SA 3T3OA 1B2TA 4FO2A 4JIOU 4OO1G 2WB1B 1MD2D 1D4BA 4NPNA 4CBVA 2XRQD 1P98A 2QCPX 2EMTA 1F1HA 3KW5B 3RN9C 1E22A 1NI2A 4IWQA 1E7VA 3MXNA 2AWTA 3SDZA 1EY9A 2QDLA 4Z9CB 1CQVA 3A1QA 3I91A 4B3SL 4K0KQ 2IHFA 1RFKA 3A7LA 4X3KA 4A3PA 1LM8B 4USAA 5F2DA 1VCBA 4FYDA 4YY3L 1WFQA 2WKDA 4YIJA 3D32A 4M0WA 1V6EA 1UE6A 5EGTA 3G4SA 2I1JA 3ER0A 1VQ4A 3BYTB 2KWUB 2B2WC 3U4EG 4URKA 3U4ZA 4X64L 4BY7G 2R2QA 2MW5A 4LUVA 5EBCA 4ANUA 3UQBA 1OXTA 2KACA 1B53A 2R3ZA 3ECIA 5JJZA 1K8RB 1F2ZA 2V1YA 4K8JA 4EVOA 4JI3Q 3PUXA 1XLPA 3HOYB 2FMMA 1I6HB 2E74C 1KTKA 1ZYRC 1FVIA 2VZKD 4US9A 3WALA 1EOTA 4YHHQ 1GXDC 5ELFA 3GZNB 3PZDA 4S17A 2PIAA 4RWSC 2JF5A 4JI7Q 2N4FA 4XDCA 1O7YA 3CD6A 3T8MA 4KJNA 3DM1A 2V0GA 4EQ5A 3P42A 4KHPL 3HM3A 1ZPSA 2VH2A 3LGJA 4ILWA 2DYMA 2PLPA 4LCDE 3TMPB 4K5XA 4WFN3 1YJNA 2AEHA 2MGSA 4IPDA 1WM3A 2N1WA 1DOIA 2F0WA 2DBYA 2E2HH 5CX3A 5GAEC 4ZKBB 2IO2B 4GDLB 1AE3A 1CMXB 1LTID 1PVOA 3AFPA 5C4XG 2BWES 2OTJA 2KQSA 5FLMG 3BK1A 4CDFC 3PUVA 4IOCA 1A3VA 2NZ1D 3BU2A 2C5CA 1E10A 5FLXL 2L7RA 5KRUA 2JP1A 3C1FA 2IGHA 2KQ7A 3CAMA 3I57A 3MTSA 5CV7A 2L83A 2N9LA 3QK0A 4BY7H 3BJUA 1WD0A 3JC66 3ZDTA 2E6XA 4GIVA 1TWGH 5GQOA 5CBAE 2MJ3A 4LUZA 1WCMG 1VJKA 1OXSC 1KLUD 2TSSA 1JC7A 3UI2A 4JI1L 1CQFA 2VQEL 4N9F4 5C44H 3N52A 1YQ4B 2N7EA 2N3SA 2HQLA 1PYBA 1PRTF 4POGA 2ZVNA 1HE8A 1SNDA 4RA8A 2IO0B 3N20C 1MBYA 3MJ5A 1A3TA 1KLGD 4TSSA 1ISNA 4LNKA 2IPKD 2KENA 2NYZD 1WZ0A 1X55A 5JEAH 1T9HA 3GTMB 2PQEA 5CMDA 2PZTA 2QDFA 4IWPA 4RH6A 3GTPH 1FNUA 1W6JA 4B3SQ 1HNWL 1JROA 4ITKA 1L1OB 1T0SC 1WTHA 4HLEA 1S72A 1OTCA 4ZLTF 2OJWA 4LNIA 1QZHA 1MHHE 3ZO5B 3OWEB 3BDCA 1QF6A 1PDQA 3NBIA 4MSQB 1GHKA 3VR3A 2E2HB 1TS2A 2Z0DB 3AE5B 2FCMA 1F2RC 4C3JB 4PK1A 1ICWA 3HRDD 4X64Q 5G3LF 3PS6A 4K2KA 3T51B 2X38A 1PRTD 1MIUA 2LGSA 3CPFA 2BQQA 2F0EA 4DNIA 3CSFA 3DHGC 2Z6BA 4Y7NB 3QR8A 2SDFA 1EY8A 4JOIA 4L5TA 5BN3A 4FF3A 1UBIA 4UAIA 4UHVA 3I4MH 2R7FA 1HH2P 1QZGA 3L0OA 1ZUD2 2KO3A 1TWGB 2PNRC 5H1SE 3QOLA 4DHZE 3PO3G 3U9OA 5CV9A 3P4PB 3QO2A 2PVGC 4W9HA 1PGAA 1VQOA 1IZ6A 3NBHB 4GN4B 2EYMA 2KEDA 3CCJA 3W1BA 3U8ZA 1NVID 1YJ9A 5C44B 3K58A 4GKJL 2KLCA 1X3PA 2DZIA 5G3LD 4KKSA 1KRTA 1FD6A 3GO5A 3Q3JA 4GOCA 2CVRA 2JE6I 2ZVOA 3ND9A 1Q12A 2K9XA 2RHSB 1TWHH 1JJ2A 3BY4B 4CGYB 3NUHB 1G6ZA 3E5SA 2JA8G 4S0RA 1IYJB 3VTVA 3ZRFA 2OQ0A 2EVBA 2C35B 2KCTA 3ABVB 3PHXB 3CRKC 2WACA 3CCEA 2JEAI 3CRLC 5L37A 4DR2L 1KQSA 2L8JA 2K05A 1PH6A 4TVAB 3BZDB 1RWSA 1QVCA 5IGDA 4C3IG 2MA9B 3M4OH 5IP7H 2DZMA 4PS8A 4K2LA 3HEJA 3RZFA 4DF7A 1VQNA 3N1XC 4NB3A 2N78A 4CO7A 3PHWB 2WHIA 2KMCA 4TUUA 2LXAA 3OAWA 1IHZA 5FJ8H 1W2BA 3K8AA 1JE5A 3I4LA 1L4DB 3DHHC 1KFYB 2FUHB 1NY4A 3NXWA 3CXCA 1S5CD 3K5LA 1F9QA 1P16A 1F9SA 3KF6B 3RD4A 4A3EH 1N36L 3R3MA 1QOHA 1LTAD 1EYDA 1JW9D 2HHHL 3I4MB 4UP9A 4A3DB 5JJIA 1WGRA 4P6VF 1N9WA 3ETRA 1ONLA 2R7DA 1VQKA 3AEDB 2KJRA 5IGFA 2LVQA 1EQTA 4WWOA 2PCFB 1XMQL 4A3KG 4TQ0A 4K7UA 1TWCH 4GOPC 1ZEQX 3M4YA 3SXHA 1GAQB 1DGJA 1OTRB 1JE4A 2LFNA 2N8NA 3PIPA 1UH6A 4FN2A 4KSLC 3UIPB 3MZ5A 4ALPA 1JRUA 5EE3A 2EY5A 2MJ8A 4KGRA 1E24A 1HNWQ 1GG3A 2SNSA 3A7AB 1IBLQ 1KH0A 4M8AA 3AE3B 3WAOA 3D4DA 4GNXC 1HTPA 1P9DU 2MHVA 4NJ7A 1CSPA 2ALYB 4RAUC 3AH7A 3WWVA 4AWJA 1BMLC 1IBXB 3CMAA 3HOWH 4XIGS 3DVGY 4WIPA 4BKSD 3F2DA 4KY5A 2KKCA 1EWYC 4I6PA 5J3BA 3X3MA 5E1FA 4C3IH 5CC4A 4MJSA 4RGNA 4ABNA 1BXTA 4KJOA 3CQZH 3M4OB 1V81A 2JWUA 1YHAA 4MIUA 4IFDJ 1Y1VG 2W55A 3ONSA 1LT4D 3KWVA 3TMEA 1UZXB 2M4NA 4L63B 2R93G 1R4MI 2LFIA 2UUBL 2A68D 4LFBL 3PLUA 2F03A 4A3EB 4K3BA 3NZ3A 3TP7A 2MCNB 2HJ1A 1TZ1A 2B2UC 1B1ZA 1PZJD 3TDQA 2K22A 1VQIA 1AARA 1GB1A 2D0OA 4GKJQ 2NBWB 1RAXA 2DNCA 1PHJA 4DV5Q 3FC4A 2XRSD 4AYBG 1VZ6A 1JR0D 5I6WA 1ZKHA 3NVWA 1TWCB 2K4KA 1U4AA 1UEBA 4HPMB 4DBGA 3VR2A 1E0BA 2HDEA 3U50C 1GUGA 2Z4HA 5KNCA 2JA7H 3U7ZA 1KF6B 3AE2B 1A2UA 3LWUA 1J7AA 1SE3A 5DPWA 2DGYA 3HK0A 3FKIG 2F1MA 5T1GA 4B9XA 3AE1B 4KVGB 5C3XA 4TQ1A 4IPHA 1A8VA 3IBEA 2ZXRA 2YU9H 1JB7A 1AWDA 2WXJA 2OTLA 2JA5H 1VF5C 3ZXRA 4XX5A 4DR1Q 1Y1WG 4HJGE 1SGHA 1V8CA 4A3MG 3HOWB 1ILPA 5HFYA 1HZAA 5CV4A 3Q8FA 4GSWA 2R7ZB 1OEYJ 1OXUA 2PPBC 3STBD 1XT9B 3IFWB 3CQZB 5L95C 4TKNA 1SYEA 1KABA 4YWMA 3QCAA 2HCIA 1WGHA 2KYWA 2FFKB 4B6WA 2HHHQ 1HCZA 2VUMG 2R93H 3VVWB 1I3QH 2G4DB 4LDTD 1AH9A 2FIDA 1Y56A 4TV3A 3HOVB 1JWBD 1BBUA 4HSVA 1XQQA 4GN3B 2F0LA 5LHY1 1N34Q 1WGGA 3P75A 1XNRL 1KL9A 3NG0A 1J19A 2EY6A 3KBXA 2ZT9C 4IN3A 1TU2B 1C7YA 2NVXB 1FFVA 2Q2IA 2WFWA 4PQXA 3VDYA 1WXSA 2DNFA 1PH8A 1XYIA 2DYBA 2BE5D 2F0MA 3ULJA 2JA7B 4P74A 4A3GH 1H95A 1KXLA 2OCEA 2EE1A 3LXFA 1EU3A 2LASA 4PG3A 1E9MA 4C4VA 1YJJA 1Q0WB 1V97A 5E4WC 3U52E 5FR6A 3PTFC 3DEPA 5G5GA 5LXIB 2AKWB 2YU9B 3D3RA 5M3FG 3RZDH 2JA5B 1GUTA 3P4SB 3PZ7A 1L2FA 4WWNA 4RF0A 4A3MH 3PUYA 3OW7A 2G4SA 3Q14C 3KJOA 1EM7A 3SFEB 1VQLA 1STEA 3BDLA 1J8CA 2A6HC 2UUBQ 3HKZG 4LFBQ 5IO9A 1D1KA 3GV6A 4QF4A 3J81c 5EJWA 4FJZA 3MHBA 4RF1A 2K3UA 4FXGC 2AMCB 1L0XB 1I3QB 1LLRD 2JJQA 1N5XA 2A6EC 2O2VA 3FILB 2VS1A 3SDLC 3S17H 3AN1A 4IUMB 2MO1A 4HROA 2BF8B 1PFNA 1L0WA 1Z6HA 2HIXA 3W5OA 5K36G 1E5WA 1KDBA 3C19A 3N9YC 4NQLB 5KNBA 1YJIA 2B2VC 2G1EA 1DOYA 4A4IA 3KUPA 2Q8IB 3ZJTA 3Q3MC 3HZXA 1B44D 4K7WA 3I2ZA 4KK7A 4JYAL 3H0GG 1S40A 1KM7A 2KZRA 1PFMA 1YNND 3HFZB 4A3GB 1SE9A 3ENEA 3I4NG 1EIGA 5C2TB 3IL8A 3TBIB 3RULA 2MO0A 1FPYA 1C79A 2WAQE 3MEHA 5IP9G 5J39A 1MPEA 5M3FH 2DHZA 4B0MA 3ML8A 4GS3A 4BFRA 4GZYC 1SNCA 4HPLB 1SXTA 1HR0L 1B9NA 1BKBA 1HHVA 4LNOA 2KOLA 1DXMA 3CKIB 3Q24A 2N9EB 4KKUA 2QA4A 2OJRA 4YSZB 3UE1A 3KYCD 1NJIC 4DR6Q 2K75A 2IY0B 1T0RC 4FBJB 4LDTB 3RMKC 3SFDB 3DHQA 3WCQA 1F2MA 1Z2MA 3KUDB 1BCPF 2CHBD 3M9BA 2DZKA 3RNGC 1EUJA 3CCMA 2C7MB 2RDHA 2XVSA 3GZNI 3C0RB 3NZUA 3X0WA 3VYRA 1PTOC 1QOAA 4PMWA 1K3RA 3PIOA 4NXML 2NBUA 3ZNHB 4C7ZA 4GDKB 2UXCL 3NS1A 2LVPA 1EWCA 5IA7A 4G3XB 4HIOA 4XZ4A 5C23A 1QVFA 1ZXHA 4RNAA 2KJHB 1SIJA 1WRIA 2B63H 1HRJA 1WJUA 1L5PA 4GN5A 3SHQA 1U0LA 3J81E 3GTOB 5IY0A 2NCNA 3G71A 1BCPD 4JWUC 1CUKA 1KNEA 2HIVA 1VF7A 1FCLA 3SD5A 1LTBD 1EFID 5GADC 3IRBA 1DM0B 4DV3L 1XCTL 2J0KA 2L1AA 3R7RA 1STBA 2KX3A 3RLFA 1X56A 1WX8A 4DGZA 4IFDH 2KOXA 3LX0A 1JJCB 4YTNB 3RNEC 4LWCA 2KN5A 4KKTA 4R4QA 1WTPA 2N7JA 2F0JA 1P3QU 3ERSX 1D5ZC 5BR8L 1CJEA 1NCVA 3OOCA 1XMOQ 4MJSB 2KCCA 1HNXL 2RF4A 3NPPA 2RCNA 3ULPA 1VQ7A 4OVVA 4X3UA 3ZLZA 2Y0SE 3NQIA 2KAJA 3S16H 4QQBX 1VQ6A 4FXDA 1C4PA 3VRAB 4HJKA 2RD0A 3TP6A 4HEA1 1L2NA 4NAMA 1L1OC 3MC0B 1J5EL 4E3CA 2IW3A 3AXCA 2PVOD 4JI0L 1WRDB 1ZKOA 3NP8A 3NS8A 5G2NA 2VRRB 1J0GA 4Q0FA 1R7SA 5JHBA 1I35A 4WAAA 4TRDA 3G7LA 2B2YC 4WRDA 4KN4C 1EWHA 2FINB 1I94L 1AFPA 4JWSC 1QT9A 4JW0A 2KANA 2J52A 3TRZA 5BMGA 2UYZB 2NUCA 3BYYB 3UDGA 2B63B 3V3XA 3L54A 4XYOA 1F2LA 3KJPA 1K73C 2LJIA 2K39A 1TWAH 5IYBG 5EDSA 5CYUA 4RMAA 2WXRA 1HR0Q 1ICFB 2Y0SB 4N8X1 2IGGA 3H1UA 3APDA 3S1MH 2WXGA 1F9RA 3KLRA 5ELBA 1C4CA 4MGIE 1CKMA 2QEJC 4HCSA 1O78A 3KVFB 4QCLA 1PFSA 1MI0A 2CR5A 4HAEA 2NMQA 3PREA 4EFOA 1B3QA 3VR8B 3S1QH 4WJWA 3JAMc 1KIXA 1EF1A 4P7IA 4DAPA 1SE4A 3NEMA 3A8JE 4QJFA 4ANVA 3LYYA 2YLMA 5ISRA 2NVUI 3AU4A 1DGSA 3S1NH 1K8OA 1FNWA 5EKKA 1JMCA 4GKKL 1N61A 3X23A 5DM73 2FUG1 3PV0A 2QF7A 4K81A 2QC8A 2UXCQ 3OSOA 2KDIA 4G11A 3KOJA 2UU9Q 3DWAA 2R92H 1E8WA 2J53A 3DDCB 4DK5A 5IN7A 1KHIA 1I50H 1GOZA 1SYCA 3VUYA 1EZ8A 1RIPA 3AE7B 3UE0A 2EELA 3RYTA 5D3IB 1M90C 1RTOA 3EIVA 1U5KA 3QA8A 4A8XC 3TP8A 3QX1A 1G6JA 5HI1A 4N6EB 3I7FA 4WJ4A 2F0OA 4FF2A 2JSOA 4EZLA 3S2AA 4JG2A 5IYBH 3WAPA 1CHPD 1TWAB 1X3EA 1WF9A 3T16A 3PVLA 4HN7A 4R4TA 2QMTA 2Y5PA 2LEKA 3QIAA 2E2JH 3S1MB 5BR8Q 2WNMA 2NTSA 1X3QA 4DAYB 1NR2A 3NJTA 1KLVA 4A93G 1HNXQ 2N9XA 5LL6S 1CZWA 1D7QA 3K5NA 2PJHA 3NBHA 3H3VH 1KC8C 3S1QB 2BYFA 2JA6G 2A6ED 1GUAB 3CCUA 2B76B 2WX1A 3L17A 1LACA 3CIRB 3A74A 1BT0A 2WS3B 1BQQT 5C5MA 1SNPA 1BDOA 5A2QL 1J5EQ 3S1NB 4JI0Q 1X32A 1TQOA 3I4OA 4ZYSA 4JI3L
chains in the Genus database with same CATH topology
1CK1A 1EEID 2JZPA 2L11A 2F0GA 4IUPA 3EGRA 1SB3C 3FRPB 1DOMA 2HTME 2R92B 1RM6C 3AM9A 4KY7A 1I50B 1STHA 1QQRA 1GUOA 1RKNA 2E76C 3AB9A 4XWWA 2EZVA 1PFBA 2KMMA 3JAME 1WTVA 3AB5A 4N59A 1YNJD 4LJZC 1D6EC 4YWGG 2WKCA 3LB8C 2K1BA 1U4RA 3QWNA 3B2GA 2E2JB 2L4NA 1Y8PB 3W9CB 3T3NA 2BS3B 4C7YA 2OEDA 1J7BA 1DCZA 3BDOA 3R2IA 2L32A 4BA1I 3ERQA 1C77A 4ME5A 1LTTD 1VDZA 2KN4A 5JVH3 2I07B 1QILA 1IBXA 4EQPA 3GTKB 1H9RA 1G291 1DOXA 3IXSA 2AQ3B 3SK6A 1XEEA 5I9PA 1EU4A 2K7VA 2W82A 3D6WA 1FM0D 2DWQA 4ZRQA 5DNFA 2J4XA 3WOEA 1CT1D 1PXUA 3MAQA 4JK1C 3I90A 4K8IA 5I4DA 3I72A 1SMYD 1TYGB 2WXKA 4A6QA 1TVXA 2WXFA 4ODGA 3HOZB 4CHTB 1YN4A 4ZOHC 2Z1CA 5MPOA 4IURA 5CV6A 1C8CA 2INNE 2DY8A 2M9VA 1G2SA 1K53A 4IALA 1WTOA 5M5YB 1BOSA 2XSCA 3Q22A 1XX8A 3A8KE 1Q10A 1EIHA 4BBSB 4C3JG 2HDMA 3M7NA 5CBEE 4PMCA 4U68A 2ACZB 3R3OA 2ON8A 1OQRA 5AUIA 3MWYW 4X3TA 4F87A 2BW2A 3W1SA 4OO1H 1WTXA 3TZUA 1CZGA 2L5TA 2RMMA 1DD2A 1HA5A 2PYKA 3AEGB 5BN5A 1C4AA 2RBMA 1RCVD 1NAPA 1AN8A 2ONQA 2BTEA 2MPMA 4MN3A 3AE6B 1YN3A 1F2YA 1XLOA 3J7YW 3AEAB 4QB4A 1JMLA 4P2CB 5G5HA 3I73A 4L23A 1BO0A 1G91A 4CKBA 2N9KA 2LKVA 3NWTA 2M0AA 3G6JB 1WTQA 3QJYA 5C5LA 3J80E 1SNQA 1Q1BA 1PLFA 1KNAA 2ZXOA 3I8ZA 3GTQB 2A73B 2WQYB 1Q1EA 2H4OA 4AQ7A 2B2TC 1BBXC 2M56B 4IDIA 3TEZA 5EQ0A 4NJCA 4FVMA 1PMRA 2X6LA 4ZAIA 1QCBD 4BA2I 4H7BA 3RFZB 3FILA 3EJIA 4XE0A 1QNUA 1FEHA 5M9OA 1II3A 2PW5A 4IUNA 5NUCA 1VCIA 1M8AA 2QDBA 4BY7B 2CW0D 3H8HA 1NR4A 1S5DD 2VZKB 2RPVA 2F0QA 5E6JA 1YN5A 1JWAD 3TEXA 1SSNA 4RFBA 2DY7A 3Q8BA 4A55A 5COYA 2WINB 4J1MA 4O42A 2WXIA 1JOOA 3NK9A 2J0TD 4A9AA 3GTPB 4WH4A 1CTMA 5D3DA 4XT1B 5JAVA 1EY5A 4NMZA 2F0NA 4DNRB 2CQAA 3IAYA 3K0YA 3QG1A 5BMHA 2K5PA 4HMJA 2V4IB 3CWIA 5C4XB 2IWHA 3SK4A 2K28A 4C3HG 4QIWB 5GXGB 4OGQC 2KEEA 5C4JB 2G9HD 2MUYA 1S4ZA 1EY4A 1RTNA 5D7GA 1IW7C 3NVZA 5CGKA 3D31A 5D14A 1WCMB 2WXOA 4LAAA 1E2VA 5ELCA 4QMGA 2VB3X 2SNMA 4RCNA 3PMFA 1A15A 3S1RB 2K5DA 4LLGM 2X6GA 4L6TB 3J9CA 1TWHB 4OL7A 4NZLB 4G57A 2E75C 5ELEA 1FR3A 3ZQ4A 4C56C 3HG9A 1PRTB 4UDUC 5JOBA 4IFDI 4TMAB 5EE0A 3TEWA 5I6YA 1SJED 3VR5A 2RDFA 2Z4IA 4DU9A 1ZYRD 1YMHE 4G4KA 1B9MA 5KNDA 4R8NA 1HFNA 4D2KA 1VMCA 3FPPA 3PO3B 3IKJA 3A55A 4C2MB 2VXWA 1H9SA 2GI9A 1DOLA 1DZ1A 5KGUA 3AEEB 5BYQA 3TEYA 1IGCA 3DXJC 3PIP3 4XYQA 2JA8B 1TY0A 5FR3A 3SHLA 1F77A 4C1NI 3H91A 4IUVA 2JXMB 4C3IB 5BN4A 4J3OD 5KEEA 4DAVA 1MVKA 1YNTE 1Z47A 3IT6B 4B0EA 4LK1C 3M3YB 1FGBD 1QJOA 1KDCA 5IT9E 1J7CA 1N63A 2F0VA 1F0ZA 2EJFC 3KF8A 3FDTA 4PT5A 3B9JA 4FP5D 1PDXA 4A3KB 1NSNS 1AP0A 2JX5A 2RKSA 4OIJA 4XTCS 4F88A 4DA2A 1SAPA 2F0PA 4J6HA 1EL0A 3RZOB 3H6MA 4DAYA 3GQBA 2LHDA 2EJGC 1ENFA 2QKIC 1IUEA 2EDGA 1BUVT 5CR3A 1R9TB 3A56A 1Y1VB 1MHXA 2O4XA 4RHSA 3K59A 3MXGA 2AQ1B 2R93B 4HCEA 3W3AA 1PZKD 3PUZA 1PGBA 2Q8RE 1ZXIA 4ULLA 2CJOA 3DWGC 3X3NA 3VA7A 2F0HA 4AYBB 5H8YE 3BVZA 1VR9A 3H94A 2CU3A 2OEOA 4NKLA 4TKOB 1PYWD 4F7XA 1ZDXA 4WQMA 2EOTA 3MXUA 1AZPA 5H92C 5C3JB 4RKBA 3FKIB 3E0JA 2V4DA 3AE8B 3SK8A 4B08A 2KUMA 2BYTA 1FIQA 1Y1WB 3RZDB 1STNA 3ITPA 3FEWX 4A3MB 1E6EB 2OXPA 2K5WA 3Q8EA 5C0XI 2M2LA 3RPFC 4MM3B 3U9SA 3I70A 4QUFA 4DFAA 2A69C 3HUIA 2I46A 5FOBB 1H9MA 3EQLC 2VUMB 1JCKB 2NN6I 4PV1C 2QIEB 1E2ZA 2EPBA 3S17B 1DONA 2D9UA 2VB2X 4E6IA 5KYIA 5K36H 2AUJD 3AEFB 1JWSD 1JALA 2F0IA 1EY0A 3T4AC 1OFFA 1SYFA 1GUSA 3IAM1 4U673 1JQ4A 4XQQA 1U4MA 1L4ZB 4OHJA 2XIWA 3MA2B 2HQEA 1QNKA 5J1ZA 4MH8A 1JQYD 1Y8NB 1VZ8A 1O7LA 2L0CA 1E0ZA 5M3FB 2WDQB 2TMPA 3W5UB 1PZID 3ZYYX 1PUTA 2D5DA 2LMCB 4MACA 4G7ZC 3HKZB 4R8IA 1RYJA 1E2WA 2K32A 1D2BA 1L0VB 4KD4A 1IL8A 1HQRD 1XO3A 2KCNA 1UWMA 4R9WA 2EYFA 2H1EA 4ARIA 1FD7D 2JYEA 4KHZA 5FK9C 1V43A 3SEBA 4HTHA 1TKWB 4OO1I 2E2IB 5FLXE 1HZ5A 2NWGA 1NYRA 2F0KA 3PIO3 1JORA 2AQ2B 3H0GB 4EE2A 3GTGB 3H09A 2PW7A 1H9SB 2MJEA 3I4NB 3P1MA 3MVVA 1QKZA 3IAS1 4HEDA 2YYZA 1T6BX 1V1PB 5T8IA 4KY6A 1B3AA 3OIQA 4WORA 3K5MA 4OZCA 2JU6X 5DAUA 2JYTA 3BIID 4QUCA 3Q8AA 3P63A 3S16B 3NE5B 1FFUA 3I3CA 1GUWA 1I4GA 1ROEA 1UWXA 4BS9A 4HR7B 1OQQA 1V1OA 2XWBB 1FCCC 3AE4B 4IZ8A 3NHHA 1LABA 2RSOA 3VYSA 1BCPB 1EY7A 3B2FA 3BK2A 2L12A 2B39A 3M7GA 1EQVA 2V3NA 3VYTA 5EBDA 1OXVA 3A8IE 4L1BA 2A6HD 2WP8J 4TQUS 1D1IA 2L1BA 4H13C 4XQNA 2LS01 2OHFA 1A3UA 3EVQA 3I9V1 4RGMA 2B2YA 1JOKA 4NDXA 3AECB 4ZRPA 2IT1A 1PGXA 1VZ7A 3OMGA 3VQIA 1HA6A 2WDRB 3P1HA 4OZBA 1P7EA 1NI3A 2HDLA 1I4PA 3L9AX 4CJ2C 1KDAA 1Z7TA 4CKEA 4FF1A 4H2AA 2XWJB 1PRTC 4H44C 2MJDA 4KX6B 1SSOA 3KK7A 1I7HA 1QLBB 5E4XA 2MH7A 1TIID 3MFYA 1I4RA 2A74C 1DOKA 1PTOF 4RCOA 3GD7A 3BS1A 3W5VB 2L55A 4I7ZC 2Q8TA 1AYFA 4HSPA 1WTRA 3L3OC 3IT4B 3T56B 1TJEA 1I4QA 1WTWA 1RHPA 1F9PA 2SEBD 4N9PA 1UUPA 1SYGA 2F0UA 1FYCA 5HGTA 1PTOD 4YXDB 5J22A 3TZDA 5JXVA 2JXTA 2RA4A 5EPLA 1HEZE 2ZW0A 1SF0A 1MSHA 1SJHD 4V190 2J42A 4YT0B 1TKEA 1T3QA 1QB5D 1KAAA 2X69A 4LK0M 5C6AA 3K5OA 1GHJA 2ZW1A 4Q5VA 1HFGA 1LT6D 4S3SA 1TS5A 4KKJA 3RMHA 4WURA 1T5EA 2EYHA 2BCOA 4XT3B 3GTJB 3TUOA 3K7AB 2N55A 3OWFA 1EZ6A 1NENB 4JE3B 2M19A 3MXPA 4KI0A 2DYOA 4A93B 1PTOH 2ICIA 2CJNA 2BS4B 4BWGB 2JA6B 1I6VC 3IFDA 4K5VA 1ACCA 1J9OA 2NB0A 4HMIA 2WLBA 4AS1A 2K5QA 2RVLA 5C3WA 4N9TA 2OF1A 5EPJA 5TSSA 1C48A 3NWSA 1LTSD 3J81L 3FVQA 4MT5A 2KDMA 2RDGA 4F8MA 5HHDG 2EYJA 2WXPA 2ZXPA 4OW0A 1O7ZA 1EYCA 2D2CC 1VRAB 4KGSA 2A68C 4ZRZA 3VR4A 1ENAA 2EY1A 2WXQA 1R4QB 3C3LA 4DXFA 5JEAG 3R8BA 2PZWA 1STGA 3VR9B 3PO0A 3AEBB 3DWMA 3Q23A 2XNAC 1CFMA 2BOSA 3NUCA 1CA5A 1RODA 2XN9C 1W6KA 5IGGA 2YEPF 4YSXB 1PTOB 1SDFA 1B4OA 4KMUC 4K6LA 3VYUA 4XQJA 1IKMA 3AV8A 1Y8OB 3FAHA 1S5FD 2BT6A 3NVYA 3Q6SA 4IUTA 3KLSA 4L2YA 1EEFD 2PO4A 1G8ZD 2ICEC 3ZJUA 2B2WA 2Q5WD 3HGBA 5C3EB 3OPOA 2WXMA 2BS2B 1PFDA 3D4WA 2F4IA 2EYLA 3J7AF 2LY7A 3E6ZX 2RQXA 1WWTA 3OMCA 4YTMB 1HTLD 4FNFA 1ZE3D 2JSVX 3D4RA 1B9RA 1DJRD 4FXKC 1WXQA 2DLBA 2K01A 2B8GA 4ZUIA 5T1IA 2W3SA 1FXIA 3WDNA 1OXXK 5ELDA 4YTPB 3UI3A 3GV3A 2Y5CA 1ILQA 2BE5C 3HOUB 2WDVB 1OO9B 1RF2D 1BR9A 3BG3A 2FBWB 2GB1A 3PUWA 3S15B 1AEXA 5BMIA 5CORA 2WP9B 1IKLA 2W3RA 2Y3AA 1JOQA 1CI3M 1STYA 5M3MB 2F0TA 1ZOYB 3P4QB 1LT3D 2AUKA 1F2RI 2HCCA 1LT5D 2VNUD 4IKGA 1JWMD 4B9WA 1ZXTA 4XWTA 3TP5A 2M00A 3TN2A 3PZ8A 4K5WA 3P4RB 1WD1A 4DNTB 2PZUA 2KJXA 4ZUJA 3CHBD 2QSDA 2WXNA 1HQMC 4BBRB 1C78A 1L0YB 2B2TA 2EKIA 2I2YA 1YNNC 3S14B 1EYAA 3V2TA 1RJTA 1FRDA 4ZHPA 2D62A 1SEBD 4ZHOA 3MFGA 2I38A 3JAML 3QB3A 1GUNA 5HURA 5IIFA 1ML0D 2K6AA 2N0SB 3Q0AA 1N5WA 2INPE 1ZP0B 2K0PA 2YEPB 2B8FA 4GLSC 1K8MA 5KIXA 5DM63 3S2DB 5EPKA 2V3PA 1JRPA 2K04A 2LMCA 4NAWB 5LNK1 1P7FA 1Q90A 4CKCA 1UGJA 4REZA 1MSGA 3DWQA 1E7PB 4V0BA 2AX5A 5IGEA 5AFWA 4ZKCB 5IGBA 4DXGA 1Y69U 4N58A 1BF4A 1IYVA 3R93A 4RGTA 1Q3LA 3NTIA 1VLBA 3NTHA 4CJ0B 1JWUD 2F3VA 2L9HA 1TT2A 2J7ZA 3DUZA 3Q8CA 1BCPC 1K83B 2PMZB 3C2PA 1LO5D 5C4HA 1GPXA 1H9JA 3NTKA 1L6UA 1J8IA 2E2DC 1QOGA 3MP9A 1B50A 3O13A 4WWMA 1V1PA 1QE6A 4KGTA 3AE9B 3DWPA 3QOJA 3T13A 2KQ3A 5M5WB 4DN4M 4ID6A 2H89B 1CA6A 4IUUA 1SYBA 3DEOA 2MP1A 1WYGA 5M5XB 4A90A 4A3JB 1TKGA 2BDOA 1N60A 3KLSX 1ESRA 1XCQL 2PTLA 1XF5L 3S9WA 4C3HB 4HKZE 3EUB2 4PMBA 2C9OA 1TS3A 2EYOA 1XWEA 2BDNA 1SNMA 3N6RA 3MHZA 5CV5A 3EROA 1TZOA 5I9OA 2PMVA 2H88B 2N88A 4HRSA 3VA5A 4LTUA 1FRRA 5C4ZA 3P20A 2NVTB 2EXZA 1LTGD 3GS2A 4OVZA 1D5XC 5HG2A 4WAFA 5A35A 2F0DA 2B2UA 4RKLA 4I65A 3S2HB 1GJXA 4XDDA 1FO4A 3H3VC 3R2TA 2PW9A 4US8A 5FO7B 4L8JA 3T53B 3RUZA 5A2QE 4R3DA 4NW2A 5DEHA 1O80A 2NVYB 2JEBI 2KHSA 4HKQA 1FMAD 1LTRD 3EA6A 4RGOS 1YQ3B 3KQ4A 1WGKA 4O1NA 3AMUA 1L6VA 5FO9B 2LGIA 4KHVA 3J80L 3VR6A 5JPMC 4KKIA 1ENCA 4A3FB 1IGDA 4DK1A 2KVMA 1SBBB 2FMCA 1K51A 5E3FA 1DYQA 5FO8B 2AWNA 3GTLB 2QJLA 4YSYB 5BYRA 3BWUD 2NBFA 1CHQD 5I2YA 2O5IC 3HVDA 3VRBB 1TWFB 3IFTA 2IX0A 2KQ4X 3K57A 1IW7D 4JBWA 2G9DA 5IOCA 3BVMA 2WV6D 3SK5A 3KBGA 2KA7A 1C9FA 3A54A 1YNJC 1TR5A 2O5JC 2LUMA 3LWEA 1LV9A 2BB6A 4IFDG 2BBCA 1JICA 2W54A 4OZAA 2EJMA 4KD3A 3U2SC 2DNEA 4G7OC 2IGDA 5C0XJ 2JYOA 2Z8LA 5EKLA 2NTTA 1S5BD 4LMQD 2DN8A 1QOFA 5AUKA 3BVGA 1TY2A 1IYUA 1UAPA 2K03A 3EFXD 4K6DA 2BB5A 1RDPD 4K14A 5JPNC 3GP7A 4IUQA 3GB1A 5EE9A 1D5MC 2FJ2A 2WAQB 3AU7A 3HOXB 2WXLA 1AZQA 3D6CA 4RHRA 2B2VA 1FNVA 1NYQA 1TKYA 2FHTA 3HS0C 1FXAA 3NSWA 3V96A 1HUNA 4IQZA 1G2TA 1H9KA 1I4XA 3SR1A 1I4HA 3SR6A 1XLQA 1ZDVA 1UEAB 2R6GA 1AW7A 1KRHA 2LHEA 3URYA 3SVMA 2BA1A 2BA0A 1SYDA 1VDVA 1SMYC 3J7AV 1XTCD 4KV6A 1SE2A 3ND8A 2HUGA 4G7HC 3FMCA 4BY1B 5I2XA 4XXEA 4XDXA 4A3BB 3ONAB 1RD9D 1A2TA 1R4PB 3HP3A 2PKOA 1N62A 2ID0A 1A6XA 1NEKB 2F0FA 4DQOC 2IX1A 1HUMA 2K33A 1HZ6A 1MGSA 1TS4A 5EKIA 1WSPA 2L52A 3CU7A 3C8YA 4FF4A 4EQNA 3LNNA 2RSNA 1M4VA 5IODA 3DMUA 2IDYA 1MI2A 3HRZC 2SAKA 1A70A 3D8GA 2SOBA 1C76A 5D65A 5K5PA 1S5ED 1ESFA 1U4PA 5BYSA 1VMPA 3FPUB 2WU2B 3WOFA 3V05A 2IX3A 4FXCA 1QOBA 1ET9A 3NVVA 3OHXC 5CV8A 4J8QA 3W2DA 1Q8IA 1XXGA 3ZGZA 5JEAJ 1BNZA 1EY6A 3E56A 3NQTA 1QWYA 4MHEA 5IT9L 4JPSA 1U9RA 2OT2A 2NVQB 2MEKA 3C46A 4PNYA 1NUCA 1GB4A 3ZJVA 1SFOB 3SE0A 4KN7C 4M1UB 2KWDA 2A5HA 2E3TA 4EGVA 4C1NK 5C0XG 3TSSA 5LL6X 4ARCA 1ET6A 5IGCA 3P7JA 4ZQ3A 2EY2A 2R61A 1BUIC 3C1EA 2NN6G 1JB3A 2CW0C 2D5GA 2KECA 2GA4B 3L7ZC 3AMZA 3OIPA 2GRIA 2JQRB 4EQOA 4P16A 1HXYD 4X3SA 4DK0A 1UNSA 2AWOA 1CZPA 2A69D 5FKAC 4IOIE 1V8QA 4H0LC 1T5XD 2O2LD 5KYLA 1K52A 2QILA 1SNOA 1WVLA 3E9SA 1K50A 2WU5B 3PO2B 3L4PA 1CM9A 1C4QA 4CJ1B 1U4LA 4NP5A 4ZK9B 4KTAA 3M85A 2WXHA 1HPCA 4A3IB 1QG7A 5C0XH 3HVZA 2ENBA 5EE1A 3NRZA 3K6OA 4OIKA 3F2UA 2FE8A 2IL8A 1XLNA 1STAA 2NN6H 2EYPA 2IJ0A 5JVG3 4C80A 2F3WA 3KWLA 4CQNA 3Q69A 2WIIB 2F0SA 3T3OA 1B2TA 4FO2A 4OO1G 2WB1B 1MD2D 1D4BA 4CBVA 2XRQD 2QCPX 3MXNA 3SDZA 1EY9A 4Z9CB 1CQVA 3I91A 1RFKA 3A7LA 4X3KA 4USAA 5F2DA 4FYDA 4M0WA 2WKDA 4YIJA 5EGTA 3BYTB 3U4EG 2B2WC 5EBCA 1OXTA 2KACA 1B53A 2R3ZA 5JJZA 1F2ZA 4K8JA 4EVOA 3PUXA 1XLPA 3HOYB 2FMMA 1I6HB 2E74C 1KTKA 1ZYRC 2VZKD 4US9A 1EOTA 1GXDC 5ELFA 2PIAA 4RWSC 4XDCA 1O7YA 4KJNA 3DM1A 2V0GA 3P42A 1ZPSA 4ILWA 2DYMA 2PLPA 4K5XA 4WFN3 2MGSA 1DOIA 2F0WA 2DBYA 4ZKBB 4GDLB 1LTID 3BK1A 3PUVA 1A3VA 2NZ1D 2C5CA 1E10A 5FLXL 5KRUA 2JP1A 3C1FA 2IGHA 3I57A 3MTSA 5CV7A 2L83A 2N9LA 1WD0A 2E6XA 5CBAE 2MJ3A 1VJKA 1OXSC 1KLUD 2TSSA 1JC7A 3UI2A 1CQFA 3N52A 1YQ4B 1PRTF 1SNDA 4RA8A 1MBYA 3MJ5A 1A3TA 1KLGD 4TSSA 2IPKD 2NYZD 5JEAH 3GTMB 2PQEA 5CMDA 2PZTA 4RH6A 1FNUA 1W6JA 1JROA 4ITKA 4ZLTF 1MHHE 3OWEB 3BDCA 1QF6A 1PDQA 3NBIA 1GHKA 3VR3A 2E2HB 1TS2A 3AE5B 1F2RC 4C3JB 1ICWA 3HRDD 5G3LF 4K2KA 3T51B 2X38A 1PRTD 2F0EA 4Y7NB 2SDFA 1EY8A 4FF3A 5BN3A 4UAIA 1ZUD2 1TWGB 2PNRC 3QOLA 3U9OA 5CV9A 3P4PB 3QO2A 2PVGC 1PGAA 2EYMA 2KEDA 1NVID 5C44B 3K58A 1FD6A 1X3PA 5G3LD 4KKSA 3GO5A 2CVRA 2JE6I 3ND9A 1Q12A 2K9XA 4CGYB 3NUHB 1G6ZA 3E5SA 2EVBA 3ABVB 3CRKC 2WACA 2JEAI 3CRLC 2K05A 3BZDB 1RWSA 5IGDA 4C3IG 4K2LA 3HEJA 4DF7A 1IHZA 1L4DB 3I4LA 1KFYB 4Q2JA 3NXWA 1S5CD 3K5LA 1F9QA 1F9SA 3RD4A 1QOHA 1LTAD 1EYDA 1JW9D 3I4MB 4A3DB 4P6VF 3ETRA 1ONLA 3AEDB 5IGFA 1EQTA 2PCFB 4TQ0A 1ZEQX 3M4YA 3SXHA 1GAQB 1DGJA 1JE4A 2LFNA 3MZ5A 5EE3A 2EY5A 2MJ8A 4KGRA 2SNSA 3A7AB 1KH0A 4M8AA 3AE3B 3D4DA 1HTPA 2MHVA 4RAUC 3AH7A 1BMLC 1IBXB 4XIGS 4WIPA 4KY5A 1EWYC 3X3MA 5CC4A 5E1FA 4RGNA 4ABNA 1BXTA 4KJOA 3M4OB 2JWUA 4MIUA 4IFDJ 2W55A 1LT4D 3KWVA 3TMEA 4L63B 2LFIA 2A68D 2F03A 4A3EB 3NZ3A 3TP7A 2B2UC 1B1ZA 1PZJD 3TDQA 2K22A 1GB1A 2DNCA 3FC4A 2XRSD 1VZ6A 1JR0D 5I6WA 3NVWA 1TWCB 3VR2A 1E0BA 2HDEA 1GUGA 2Z4HA 5KNCA 3U7ZA 1KF6B 3AE2B 1A2UA 3LWUA 1J7AA 1SE3A 5T1GA 2F1MA 4B9XA 3AE1B 4TQ1A 5C3XA 2ZXRA 1AWDA 2WXJA 1VF5C 4HJGE 1V8CA 1ILPA 3HOWB 5HFYA 5CV4A 3Q8FA 2R7ZB 1OXUA 2PPBC 3CQZB 1SYEA 1KABA 2HCIA 2FFKB 1HCZA 1Y56A 3HOVB 1JWBD 4HSVA 2F0LA 5LHY1 3P75A 2EY6A 3KBXA 2ZT9C 4IN3A 1TU2B 2NVXB 1FFVA 4JX1C 4PQXA 1XYIA 2BE5D 2F0MA 2JA7B 3LXFA 2EE1A 1EU3A 1E9MA 1YJJA 1V97A 5E4WC 3U52E 3DEPA 5G5GA 2YU9B 3D3RA 2JA5B 1GUTA 3P4SB 3PZ7A 4RF0A 3PUYA 3OW7A 1EM7A 3SFEB 1STEA 3BDLA 2A6HC 1D1KA 3GV6A 4QF4A 5EJWA 3MHBA 4RF1A 2K3UA 4FXGC 1L0XB 1I3QB 1LLRD 1N5XA 2A6EC 3FILB 3AN1A 4HROA 1PFNA 1Z6HA 5K36G 1KDBA 3N9YC 5KNBA 1YJIA 2B2VC 2G1EA 1DOYA 3KUPA 2Q8IB 3ZJTA 3HZXA 1B44D 4KK7A 1PFMA 1YNND 4A3GB 5C2TB 1EIGA 3IL8A 3TBIB 1C79A 4B0MA 3MEHA 5J39A 1MPEA 4GZYC 1SNCA 1SXTA 1B9NA 1HHVA 2KOLA 1DXMA 3CKIB 3Q24A 4KKUA 4YSZB 3SFDB 3DHQA 3WCQA 1F2MA 1BCPF 2CHBD 2RDHA 2XVSA 3VYRA 1PTOC 1QOAA 4PMWA 4C7ZA 4GDKB 3NS1A 1EWCA 1ZXHA 4RNAA 1SIJA 1WRIA 1HRJA 1L5PA 3J81E 3GTOB 1BCPD 4JWUC 1KNEA 1VF7A 1FCLA 1LTBD 1EFID 1XCTL 1DM0B 2L1AA 1STBA 3RLFA 4DGZA 4IFDH 3LX0A 4YTNB 4KKTA 1WTPA 2N7JA 2F0JA 1D5ZC 1CJEA 1NCVA 3OOCA 2KCCA 3NPPA 4X3UA 3NQIA 2KAJA 3VRAB 1C4PA 4FXDA 3TP6A 4HEA1 4NAMA 3MC0B 2IW3A 2PVOD 1ZKOA 3NP8A 4Q0FA 1R7SA 4TRDA 3G7LA 2B2YC 4WRDA 4KN4C 1EWHA 2FINB 1AFPA 4JWSC 1QT9A 2J52A 5BMGA 2NUCA 3BYYB 2B63B 3V3XA 4XYOA 1F2LA 2LJIA 5CYUA 2WXRA 2Y0SB 2IGGA 2WXGA 1F9RA 3KLRA 5ELBA 1C4CA 2QEJC 4HCSA 1O78A