4MJSB

Crystal structure of a pb1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
82
Chain Sequence
LTVKAYLLDAAREIRRFSFCPGPCERLLSRVAALFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/protein binding
molecule keywords Protein kinase C zeta type
publication title Structural and biochemical insights into the homotypic PB1-PB1 complex between PKC zeta and p62
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 82
sequence length 99
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4mjsB00
2C5LC 3LDZE 3H6NA 3QARA 2PPHA 4GDKA 1V86A 4N9F4 4KVGB 2NR2A 3VUXA 4HCPB 3U8ZA 1NDDA 2MX2A 2MP2B 3NOBA 3A4SC 2N9PC 3ENEA 3GZNI 5J2RA 4WJNA 2LZ6A 5DPRA 4DXAB 4A20A 3PV1A 2RR9A 2D10A 5LXIB 1WZ3A 2XEWA 1WX9A 1XQQA 1Y8RC 4BBNC 4BOZB 2LI5A 3KUZA 2C7NB 4F1SA 1S1QB 4MSMB 4F8CB 2LD9A 2M0XA 5E6NA 3KUDB 4NQLB 4ZRJA 2B3AA 3ZDMC 5E6PA 2M8SA 3V6EB 2DAJA 4DHZB 2KKCA 1SE9A 1SGHA 2LJ5A 3B1LX 4XZ4A 2JVCA 4EZKA 3VAWA 2N1VA 3VUYA 1V81A 2LXAA 3ZUNA 2K39A 4W9JA 1WF9A 2K6DB 3NY5A 2NPTB 2RSUA 3KUCB 1LXDA 3ZDTA 3WIMA 4LDTB 4DDID 2A4ZA 2BF8B 5EDSA 2L8JA 3W1SC 3OAWA 1E8XA 2L0TA 2V1YA 3RZWC 3ML8A 4ANVA 2R2QA 3A9KA 1WZ0A 1GJZA 3UGBB 4CO7A 1P98A 2RD0A 1YX5B 4KDIC 2KVRA 1EF1A 1YD8U 1WXVA 2KDFB 3DDCB 4IG7B 2HTHA 2FIFA 5JH5C 4OVUA 2C7HA 1G6JA 3B0AA 3QHTA 4TV3A 4G11A 2KC1A 4MM3A 4MJSA 2MBQA 3ZRFA 3R7RA 3M62B 2HD5B 3L08A 3NS8A 1VD2A 1E8WA 3ZKJC 4M8NA 1RAXA 5LXHA 3UIPB 3SD5A 3DCGA 3A33B 3PVLA 5D2MB 3QC8B 1WJ4A 3WAOA 4EKUA 4BKGA 2MRPA 2MBOA 3EHVA 1GNUA 3V60A 4ASWC 4NJ6A 2D2QA 1AARA 2IBIB 2LVOA 3BINA 1WH3A 2MWSB 4DDGD 1D3ZA 1RRBA 2LUEA 3VVWB 4HJKA 4WWOA 4URKA 4IM3A 2JRHA 5AEKB 2KX3A 2ZZPB 3ZNGC 1J0GA 3RUIB 4F7ZA 1FXTB 4K81A 3ZTCA 4KSKC 2DYMA 1UGMA 4LDTD 3H1UA 3ZW3A 4GB9A 3SDLC 2KJ6A 2N4FA 3SHQA 3CSFA 4MGYE 1PQSA 1UH6A 4NAWA 4PS8A 2O6VB 1UD7A 1CMXB 2BWES 3ZTDA 3A4RA 1WGHA 2DENB 1Q5WB 3K9PB 4MDKE 3H7PA 2V3SA 1RFAA 4AP4C 2GOWA 3R7QA 2JUOA 1WGDA 2C7MB 3JYUA 1P9DU 1WM3A 2AYOB 4KIKA 4B6WA 3CMMB 2KJRA 2AWTA 4MGZE 2LRWA 2BKRB 1UBQA 2LGXA 1KM7A 2IYDB 1WXSA 1WXMA 2G4DB 3IVFA 4WWNA 2O2VB 3BY4B 5HKHA 1BT0A 2DX5B 4W9KA 1KOTA 4PYUA 2BGFA 1UZXB 2ASQA 2NBUA 3R66C 5JZEB 1HE8A 2N1WA 4HK2A 4BOSC 4W9CA 1IP9A 1EO6A 1E8ZA 1C1YB 2BYFA 4WJOA 3M3JA 1ZKHA 3NZUA 2KTRB 2XK5B 3K9OB 2LWPA 1UBIA 2W9NA 5IAAC 4TUUA 3RCZA 4JQWC 3W1YA 1OEYA 4AOFA 2LASA 5LLIA 1WMHA 1WYWB 2L7RA 3HK0A 2GBKA 3MHSD 1RLFA 2N9XA 3L54A 4KZ0A 2BKFA 2D3GA 2JZ3B 3TJPA 2DZIA 5AZFA 1NI2A 2DAFA 2IO2B 4DBGA 3QCAA 5DPWA 2KC2A 3DBSA 1TTNA 3DVGY 3VTUA 4G50A 3DBHI 4EOYA 4BKSD 2KQSA 2FCMA 1E90A 3JSVB 4IM0A 3T8MA 1IYFA 1GUAB 2YLMA 2KN5A 1YX6B 2KFKB 2J0JA 3D32A 2NPTA 1WI0A 3Q3JA 4JIOU 5GMVA 4W9HA 2KDBA 3RD2A 3U7DA 3X0WA 2MA9B 4JL9A 4B95A 4DHJB 4HPLB 1Z2MA 2JF5A 2KANA 3RZFA 2C9WB 4WWPA 1QZEA 4W9LA 5G2NA 1WGGA 4IM2A 4WJPA 4TQ0A 4ZYNA 3OJ4B 4E74A 4A3OA 4KSLC 3CF6E 5DPSA 4LJPB 3QX1A 2ZVNA 3EC8A 3UQBA 3A1QB 2ZCBA 4HCNB 2K8CA 2LGYA 4K7SA 3M95A 2K8BA 3VDZA 3KYDD 1WRDB 1WY8A 2DYOA 4IWPA 4GDLA 3UF8A 5CTRC 3JW0X 3KH0A 2M1MA 2OOBB 4ZRIA 4HWIB 4GDKB 2ZEQA 3ZNID 2BPSA 1WE6A 2ZNVB 1VCBA 1P0RA 1E5WA 3ZLZA 5FR6A 1WE7A 4IWOA 3QIJA 3DVNU 4WAAA 3IFWB 2JT4B 2KNBA 2I1KA 1I42A 4FJVB 1A5RA 3VXWA 3M63B 3DVNV 1V6EA 2V4LA 1X1MA 4I6LB 3QQ8B 4IC7B 3OJ3A 2Y5BB 1WX8A 5CHFA 3O65B 4AUQC 2QHOA 1WIAA 2RGFA 1UELA 3N3KB 4BVUC 4AWJA 4KDLB 3TBLD 4DWFA 4GU2A 5D94A 3KYCD 4FLHA 2M4NA 3ML9A 3TL5A 3T9LA 1Q1OA 4FADA 2AL6A 2GBNA 1JRUA 2KLCA 4II3B 5L95C 1WJUA 2K8HA 2KLGA 2KWVB 4PYZA 2DHZA 1GG3A 4TQ1A 3TIXA 3JVZX 4W9DA 1XD3B 4BKSA 3X23A 5C23A 2G4SA 4DK5A 4FA6A 3MTNB 3QWZB 4FJYA 2EKEC 1V2YA 2JY6A 4I6PA 2DZJA 2PJHA 2KMAA 3PREA 4MEMA 2OJRA 4XC2A 3ZNZB 2J0MA 2WWZA 3R3MA 1EUVB 2N9EB 2PE9A 4II2B 4GOCA 1WX7A 3ZRCA 1ZW7A 3PPAA 4LCDE 2FUHB 4KV2A 3A9JB 3QJZA 2KK8A 3DPDA 2A5UA 2AL3A 2LVQA 2GMIC 4MGIE 4EZLA 2KFJA 1F9JA 2XK5A 3DBRI 2J7QB 2RPQA 2KX0A 3AULA 2HE7A 1TGZB 3HM6X 4JGHB 2CKHB 2KJHB 2FCNA 4W9GA 3UINB 3PLUA 2L0FA 3RULA 2L3ZA 3VTVA 1J19A 1L7YA 2GBJA 3AXCA 3AU4A 1LQBA 4EEWA 5D7GA 2GBMA 1R4MI 3PT2B 3TCAA 2MP2A 2KO3A 3H7SA 2CHZA 3WANA 5L83A 3L16A 3PRMB 1Q0WB 4IUMB 2I1JA 4GN1A 5DPTA 4NAWB 5CHWA 3UQAA 2EMTA 2KFKA 2MBEA 1LFDA 1SIFA 1T0YA 2CHXA 1K8RB 3H7PB 2YVCA 2R2OA 4W9EA 2LGDA 1TBEA 2O6VD 3B08A 2MBHA 2IZVB 1E7VA 1WFYA 2PEAA 1WGRA 4HDQA 4KIKB 3ZO5B 4RM8A 4G0NB 4CYEA 3V61A 1OEYJ 2BYEA 4ANXA 2D07B 5D6JB 1WR1A 2KMCA 4E71A 2MW5A 2WX0A 5JHAA 3APFA 4NY0A 2N7EA 3DQVA 3IBEA 3DVGX 5G55A 1WXAA 4I6NB 3AI5A 1V49A 3CSTA 2WYQA 4J6IA 3APCA 1J8CA 3EECA 1KJTA 3PRZA 5KHQA 3DOWA 3L13A 2MSED 3PLVA 4YL8A 2ZCCA 3U30A 4FULA 2PE6B 1Z5SB 4B9KA 2LXCA 3ZVVA 3SU8X 4HXDA 2JXXA 4ZRKA 4GGQA 2KDEB 2CHWA 4E3CA 3IHPC 2CU1A 1M94A 3C0RB 4M0WB 4HDOA 4MGKE 4RM9A 1E7UA 1V80A 2JPHA 4FJZA 3PSEB 4K7UA 1YJ1A 2G45B 3PHWB 1WMHB 2NVUI 2NBWB 3HHMA 3NHEB 2DZMA 2KOXA 3WAPA 2MQJA 4K7WA 3PZDA 4FBJB 1TZ1A 1WR6E 3MJWA 4K1RB 4NPNA 2KZRA 1H8CA 1P1AA 3VQIA 1EF5A 2HJ8A 2XBBC 4MSQB 1ISNA 2DZKA 3TMPB 3GOEA 1OQYA 5DCNA 4BKTA 3ZNHB 4M8MA 4WJQA 4EZJA 5C1ZA 2MLBA 2K25A 3L10B 3VHTC 4PS7A 2FCQA 1C3TA 2MBBB 4BFRA 2IO0B 2IY1B 3KVFB 4RMAA 4NQKE 1KLVA 4CHKA 2NCNA 2UWQA 4MELA 2WDTB 2M17A 3UIOB 4BBNF 2ZPYA 3ZIMA 4HLEA 3QK0A 3WA0A 4DHJD 2DYBA 2FAZA 2VRRB 1WGYA 2KWUB 1L2NA 4G3XB 3WALA 2JWZA 2O6VA 2KWCA 3QAQA 4ICVA 5JHBA 4A3PA 4ANWA 2EMSA 5IA7A 4ANUA 1GC7A 2N7DA 3DBLI 3WAMA 2K6QA 4FHJA 4GDLB 3A9JA 4W9IA 3IG3A 2MCNB 1E8YA 2KD0A 3A9KB 3VTWA 4P7IA 1WJNA 4IW0A 4KZCA 1NBFC 2D11A 1P3QU 2KDIA 2LVPA 3NZSA 1I35A 3LJ3A 2O2VA 4FHKA 5E6OA 4LJOB 3VUWA 3P2BA 3S2AA 2ZPNA 5J18A 2AEHA 3QA8A 4JLCA 2L00B 2L76A 2Z0DB 2IO3B 5AZGA 1WM2A 5TR5A 4MJSB 1YIWA 3HM3A 2JZZA 5KHOA 1ZGUB 3PTFC 2L05A 2ZNVC 4GXBA 5BO4B 3RT3B 1R4NI 4NNJB 3L0WB 3VH3B 2KTRA 4DHZE 2BYVE 4OVVA 1LM8B 4FN2A 1GC6A 1WJ6A 4AJYB 4EFOA 2UYZB 1YQBA 5CHVC 2KHWB 4EUTA 1V9JA 2JRIB 4MH0E 4GMVA 2J0KA 4X57B 1OTRB 2KTFA 2FCSA 1H4RA 5J17A 1IPGA 2WX1A 3W1SA 3ECIA 3ONSA 2C60A 2REXA 2ZVOA 3APDA 1MG8A 2FNJB 3H9DA 3HIZA 2KQ7A 3EFUA 3JSVA 1XT9B 2GBRA 2NBVB 5AZHA 3PGEA 3V62A 1V5TA 4HVBA 2FIDA 4XX5A 3VH4B 3ALBA 2KXJA 3PRPB 4ICUA 4NJ7A 4TKNA 4GSWA 3V6CB 3I3TB 4W9FA 1V5OA 1U4AA 3L17A 3VFKA 1OGWA 2ZJDA 3PHXB 3PS6A 2G3QB 2CS4A 1S3SG 5CX3A 3RYTA 3OLMD 2IO1B 2LRUA 3KW5B 2Z0EB 2NS5A 4WQOB 2CR5A 2IY0B 4PS3A 4AJWA 4ZDVA 3Q3FA 3N32A 2BWFA 3A1QA 2Z59B 4IWQA 4HPMB 3AU5A 4GIVA 3N30A 2K1FA
chains in the Genus database with same CATH superfamily
2C5LC 4RCOA 3QARA 1YN4A 2PIAA 3NOBA 3A4SC 2G1EA 1VLBA 2AQ1B 2N9PC 3ENEA 2QDFA 3Q8AA 2LZ6A 2W54A 4BBNC 2C7NB 2WXFA 1Q10A 2LD9A 2M0XA 3KUDB 3GE8C 5E6PA 3V6EB 2KKCA 1SGHA 2YEPF 3B1LX 2K22A 1SE3A 4ZYSA 1I7HA 2N1VA 3J9CA 2MEKA 1WF9A 1LXDA 4XYCA 4DDID 1OQQA 5IP4D 2I2YA 2V1YA 2ICIA 5IN7A 3RNBC 2WXQA 4JX1C 1YX5B 3U7ZA 4XGAB 1K52A 1YD8U 2N0SB 3DDCB 2JYTA 5JH5C 2KC1A 4MM3A 1VD2A 1EU3A 1K50A 5LXHA 3AEGB 3DCGA 3PVLA 3V60A 4L2YA 3VRAB 2PKOA 5EE9A 1CZPA 2WXLA 2OHFA 4HJKA 4IM3A 3ZNGC 1XEEA 5BMGA 4K81A 1JRPA 1D4BA 2KJ6A 4JWSC 2O6VB 2PW9A 2BWES 1Q5WB 3H7PA 1VZ6A 2GOWA 1LGRA 1HQRD 2HJ1A 2G9HD 4KIKA 2IGDA 2KJRA 1PGBA 3BYTB 2K5PA 4MGZE 3W5VB 1L0VB 4W9KA 1KOTA 2WXMA 2BGFA 1ZP0B 4BOSC 4Q2JA 1C1YB 4L1BA 4WJOA 1ZKHA 3NZUA 1YMHE 2XK5B 1SXTA 3NRZA 1C76A 2LWPA 1UBIA 2W9NA 2WXNA 1L6VA 4TUUA 2B76B 2Q5WD 2K0PA 5LLIA 3MC0B 1RLFA 3TJPA 2D3GA 4DBGA 1T0SC 2DZIA 1DOYA 1NI2A 3QCAA 1TS4A 2KYWA 3OWEB 2DWQA 4BKSD 1VJKA 1E90A 2QEJC 1GUAB 3Q8BA 2OEDA 1HZ5A 3D32A 2J0JA 5GMVA 3U7DA 1L0XB 4JL9A 4B95A 3W2DA 1L0YB 4R3DA 3PZ7A 5G2NA 1ZUD2 2ON8A 4KSLC 2ZVNA 4PK1A 2ZCBA 2K8CA 1FRRA 3UF8A 3KH0A 3AEFB 3DBHB 2ZNVB 2WXRA 4RGMA 1E5WA 3QIJA 3DVNU 4LNKA 1I42A 4YSXB 4LNNA 3M63B 4IC7B 1V6EA 2KAJA 1V97A 3LYYA 1FPYA 1WIAA 1UELA 2WHIA 3ZXRA 4GU2A 5D94A 3KYCD 3L4PA 2M4NA 4FLHA 3ML9A 1QOAA 4RGOS 3TL5A 2J42A 4FADA 2KLGA 4PYZA 2RDGA 4TQ1A 3TIXA 4WURA 5C23A 2N9LA 3UI3A 1V2YA 2DZJA 3PREA 2KMAA 4YSZB 2OJRA 4XC2A 3AE5B 3AE8B 2WWZA 3PO0A 1F77A 4II2B 1WX7A 4YSYB 4LCDE 4MACA 2ZW1A 4MM3B 1TT5B 2KK8A 2A5UA 3KQ4A 2GMIC 4MGIE 1F9JA 4XDCA 3ZJVA 3T3NA 1C4PA 3DBLB 2KT7A 4K3CA 2RDBC 1J19A 1L7YA 1GOZA 2HTME 4EEWA 5D7GA 3TCAA 1R4MI 1KH0A 2W82A 3DWMA 3NJTA 2KO3A 3H7SA 2HDEA 4C4VA 4REZA 4IUMB 1PYWD 4GN1A 5DPTA 1XO3A 1LFDA 2EELA 3H7PB 4W9EA 2R2OA 2O6VD 2MBHA 2IZVB 1E7VA 1WFYA 1WGRA 4KIKB 4RGNA 2D07B 2Y5PA 1WRIA 4E71A 3HUIA 2WX0A 2UU7A 2N7EA 3DQVA 4NY0A 1WXAA 2LEKA 4I6NB 1QLBB 3AI5A 4YTNB 1HTQA 3PRZA 1JWAD 3DOWA 4O1NA 2MSED 1CK1A 2ZCCA 2AX5A 3AV8A 4B9KA 4HXDA 4GGQA 3IHPC 1MHXA 1NVID 2QMTA 3KLSX 4C00A 1XCTL 4FJZA 1P7FA 1YJ1A 2NVUI 3NVVA 3NHEB 1ESFA 1EU4A 2LUMA 4WIPA 4K1RB 2KZRA 1P1AA 1DOXA 4ITKA 1EF5A 1SE2A 1VR9A 1YQ3B 2HJ8A 4MSQB 4KGSA 2M0AA 5DCNA 2J4XA 4EZJA 3L10B 2EKIA 4PS7A 2IY1B 4NQKE 3Q6BA 2NCNA 4BBNF 3WA0A 1MFWA 2VRRB 1WGYA 1MHHE 1VZ8A 3QAQA 1A70A 3WAMA 3AB5A 3A9JA 3IG3A 1TJEA 3ABVB 3VTWA 4P7IA 4IW0A 2WNMA 3LJ3A 2O2VA 3VUWA 1KF6B 3P4SB 3S2AA 2AEHA 1JALA 2L00B 2L76A 5TR5A 1YIWA 2WQYB 2WXPA 4HROA 3NG0A 2L05A 4P1CC 1I4XA 4IDIA 3IAM1 3R8BA 2AQ3B 4UDUC 1WSPA 4EFOA 1UWMA 1YQBA 4EUTA 1V9JA 2BTEA 4MH0E 2J0KA 4HEA1 1DYQA 1NI3A 2L1AA 1E7PB 1IPGA 3ECIA 1SIJA 1B1ZA 2REXA 2ZVOA 3NVZA 1MG8A 3EFUA 1XT9B 5AZHA 4HVBA 2FIDA 3PRPB 2KXJA 1WXQA 4GSWA 1YN3A 4B0MA 1N5XA 1U4AA 4AQ7A 1F0ZA 1R4NB 3RNGC 5CX3A 3P1MA 4JPSA 2SAKA 5I4DA 2NS5A 1JW9D 3H8HA 1ZDXA 2KVZA 4LNFA 2V4IB 3LDZE 4OZCA 3H6NA 4YT0B 1ROEA 1V86A 4KVGB 1YN5A 1C77A 3U8ZA 5DPRA 4C4VB 3BK1A 4A20A 2RR9A 5LXIB 1WZ3A 1XQQA 3KUZA 1I4HA 4F1SA 4F8CB 5E6NA 4NQLB 4ZRJA 2B3AA 1HXYD 2M8SA 3AE4B 3NY5A 3SR6A 2V9HA 3ZDTA 5BMIA 3WIMA 2A4ZA 2L8JA 3NS1A 3OAWA 1E8XA 2L0TA 3RZWC 3ML8A 2QJLA 2R2QA 1RYJA 3A9KA 1WZ0A 1GJZA 2WU5B 2RD0A 4IOIE 2KVRA 2KDFB 4IG7B 2RDHA 3RI7C 1ET9A 1B9RA 4MJSA 1QKZA 1OQRA 1RAXA 3SD5A 2MRPA 2MBOA 4H2AA 3EHVA 1GNUA 4ASWC 5IO9A 2D2QA 2IBIB 2LVOA 3SEBA 1MJDA 2MWSB 1RRBA 2LUEA 1FEHA 1J0GA 5MPOA 4F7ZA 2JWUA 1LO5D 3EUB2 3TSSA 3H1UA 3ZW3A 4GB9A 1TY2A 4RGTA 1F1HA 1PQSA 2MJDA 1SJHD 2QC8A 3ZTDA 1WGHA 2CJNA 1RFAA 3CIRB 2Y3AA 1WGDA 3JYUA 2C7MB 1ACCA 1FXIA 2JYEA 3RPFC 1RFKA 1UBQA 2LGXA 1WXSA 1WXMA 2O2VB 2D5GA 3R66C 1K53A 4HK2A 4RFBA 3M3JA 5EE0A 1VZ7A 1TKYA 3K9OB 1QT9A 4AOFA 1WMHA 1WYWB 1QOGA 2IGHA 3HK0A 2GBKA 2KWDA 5AZFA 2DAFA 2JSVX 5DPWA 3VTUA 4G50A 3DBHI 4EOYA 1KFYB 4AS1A 2FCMA 1IYFA 2KFKB 2NPTA 2RPVA 4W9HA 1TS3A 1V8CA 5C2TB 2KANA 4LK0M 4W9LA 3RN9C 3OJ4B 5DPSA 3QX1A 4PT5A 1YJJA 3EC8A 1PGAA 1TS2A 3VDZA 3M95A 5CTRC 3JW0X 2M1MA 4LLGM 4HWIB 3ZNID 2BPSA 1KRHA 4ARCA 1ZOYB 1FM0D 5FR6A 1WE7A 4IWOA 1WYGA 2I1KA 4M02A 1X1MA 2Y5BB 1JROA 4AWJA 4KDLB 1GB4A 4DWFA 1F52A 3C8YA 2LMCA 3DHGC 2BB5A 1WJUA 2KWVB 2WS3B 2DHZA 1PFDA 1NENB 2E3TA 1XD3B 2D3BA 4DK5A 4FA6A 3MTNB 1IBXB 1XXGA 3KWLA 1XLOA 1N60A 1TKGA 1UF0A 1YNTE 2WDRB 1FO4A 4N58A 1YJIA 1RM6C 4GOCA 3GB1A 4KV2A 1Y56A 2AL3A 2LVQA 1T3QA 2RPQA 3AULA 2HE7A 1TGZB 3HM6X 4JGHB 2KJHB 1I4PA 1N5WA 1HTOA 2L3ZA 2N7JA 1TZOA 2GBJA 4N59A 5HHDG 2MP2A 4FXCA 3Q3MC 5CHWA 1T0YA 2CHXA 5E6JA 2PLPA 4RM8A 3DBRB 2BYEA 4ANXA 2H88B 2KMCA 5BYRA 5G55A 3IBEA 3CSTA 4J6IA 3APCA 1KJTA 1EWCA 3PLVA 2PVOD 1UNSA 2LXCA 5GXGB 2JXXA 4ZRKA 2CU1A 4A6QA 2JPHA 2WXIA 1WMHB 2NBWB 3VRBB 3WAPA 2MQJA 4K7WA 3PZDA 4FBJB 1WR6E 2LGIA 3ZQ4A 2XBBC 2DZKA 3GOEA 2L52A 4NJCA 4BKTA 3Q14C 4WJQA 1KTKA 5C1ZA 2K25A 3IT6B 2FCQA 2IO0B 1ZPSA 1TKEA 1BUIC 1BMLC 2UWQA 2WDTB 3LXFA 3UIOB 3URYA 2DYBA 2FAZA 2QIEB 2KWUB 1L2NA 1QF6A 2K9XA 4G3XB 2JWZA 1QOFA 4ICVA 3RNFC 5JHBA 3AEDB 4ANUA 2N7DA 2DLBA 1AYFA 4W9IA 3EFCA 1GPXA 2MCNB 1T0RC 1NYRA 2D11A 1D5MC 2KDIA 4BZAA 3BYYB 3FKYA 3ZXVA 4JLCA 2BYTA 1QILA 3O13A 3PTFC 1MG4A 2YEPB 2DBYA 2ZNVC 1R4NI 3L0WB 2LGSA 2W3SA 5JXVA 4JE3B 4DHZE 4C80A 4OVVA 3BZDB 4FN2A 2MJEA 2L83A 5CHVC 3B2FA 3LB8C 4ZHOA 3U2SC 1OTRB 2FCSA 3TEYA 2PVGC 3ONSA 3APDA 3BWUD 2GLSA 3H9DA 3P4QB 2NBVB 3ALBA 3AECB 4TKNA 4DXFA 4CQNA 2WDQB 1I4QA 1WWTA 2ZJDA 2CS4A 2L32A 3KW5B 2V3NA 4WQOB 2CR5A 3Q3FA 3N32A 2BWFA 2MH7A 1I4RA 5AUKA 4GIVA 2GB1A 1ZDVA 4N9F4 3VUXA 4HCPB 1NDDA 2MX2A 4KKJA 2MP2B 3W9CB 4LTUA 4K3BA 2D10A 5T8IA 1Y8RC 4WH4A 2VZKD 1S1QB 4MSMB 2WDVB 3ETRA 1MPEA 4DHZB 3FAHA 3N9YC 2JVCA 1FMAD 4XZ4A 3MJ5A 3VUYA 1V81A 2LXAA 3Q8EA 2K39A 1JWMD 2K6DB 2ACZB 2RSUA 3FILA 5TSSA 1ZXHA 3R2TA 4CO7A 4HJGE 3GZNB 4KDIC 4ZHPA 1XLNA 2MBQA 1N63A 3R7RA 3M62B 3L08A 4XDDA 1QOBA 5G5HA 4RH6A 5BYQA 3UIPB 4HRSA 5C3JB 5D2MB 3WAOA 3QC8B 1WJ4A 4EKUA 4BKGA 4NJ6A 1AARA 3BINA 1FXAA 4DDGD 4KGRA 2XNAC 3VVWB 4OHJA 3U52E 4YTMB 2JRHA 5AEKB 4NZLB 2LJIA 2ZZPB 4OVZA 5BYSA 3ZTCA 4KSKC 4RF0A 4LDTD 1EWYC 3SDLC 2N4FA 2IJ0A 1UH6A 3DHHC 3HVDA 4AP4C 2WXJA 4XWWA 2JUOA 3Q69A 1RWSA 1P9DU 2AYOB 4B6WA 2BW2A 1EM7A 3CMMB 1FCCC 2AWTA 4WWNA 2G4DB 2IGGA 5HKHA 2DX5B 3EA6A 3MC8A 3P4PB 1HZ6A 1UZXB 1SSNA 5JZEB 2N1WA 3EGRA 2KN4A 5EE3A 4A9AA 1IP9A 1EO6A 3MP9A 3FC4A 1FNWA 1N6ZA 3N20C 2INCC 2JXTA 4US8A 3RCZA 4JQWC 2LASA 4A90A 3AE3B 1QQRA 2N9XA 3L54A 2BKFA 2JZ3B 2MHJA 1ZXIA 2J52A 2IO2B 3AEBB 1J7CA 1DOIA 3CWIA 2Y5CA 3W5UB 2KQSA 3TUOA 4IM0A 3T8MA 1UWXA 2KN5A 1YX6B 3Q3JA 1WI0A 4JIOU 3Q3NC 1SBBB 2KDBA 3RD2A 3X0WA 1JMLA 4DHJB 1HA5A 2NMQA 4HPLB 1JWUD 1Z2MA 2DNFA 2JF5A 1GB1A 1FFUA 4WWPA 1WGGA 4WJPA 1D5XC 4TQ0A 4M00A 1NYQA 4LJPB 2AQ2B 3UQBA 2RMMA 3IT4B 1WY8A 2DYOA 4GDLA 1KLUD 2OOBB 4HKZE 2CU3A 4RF1A 2SEBD 2ZEQA 1WE6A 1IGDA 1P0RA 3ZLZA 3NUHB 3NZ3A 4WAAA 4FJVB 3DVNV 2V4LA 3AE2B 1WX8A 2QHOA 4A55A 3N3KB 4BVUC 3DHIC 4XWTA 3V05A 1AW7A 4ACFA 2WXOA 5EE1A 3T9LA 4XE0A 1Q1OA 2KLCA 2W3RA 3X23A 3I57A 3AEEB 1MI0A 4MEMA 3ZNZB 2J0MA 3B2GA 1N62A 1EUVB 2N9EB 2PE9A 3PPAA 2INNE 3ZGZA 3A9JB 3QJZA 3DPDA 3GS2A 4EZLA 2XK5A 3DBRI 2KX0A 4MH8A 2CKHB 4QAYA 4DQOC 4RNAA 1C79A 4J3OD 3PLUA 1SEBD 3AXCA 1LQBA 2GBMA 1J7BA 2CHZA 3WANA 5L83A 2W55A 4US9A 1R7SA 1Q0WB 1FD6A 2BS2B 3RNAC 1FCLA 1XCQL 2YVCA 1E6EB 3AN1A 2LGDA 1IGCA 3B08A 1TS5A 3ZO5B 1BXTA 5D6JB 1WR1A 2MW5A 3VR8B 3APFA 4BAXA 1FNUA 4L23A 2WYQA 2MJ3A 1J8CA 2WU2B 3U30A 4FULA 1Z5SB 2KDEB 4E3CA 3I5JC 1M94A 3C0RB 4MGKE 4HDOA 3AE6B 3TEXA 2IDYA 4K7UA 1FRDA 3VR9B 3HHMA 2DZMA 1V1OA 1UGJA 1E10A 1TZ1A 1IUEA 4NPNA 1H8CA 3AE9B 1NEKB 3VQIA 3GE3C 1ISNA 3TMPB 4MT5A 2MLBA 3VHTC 2FE8A 1C3TA 4BFRA 1AWDA 3BIID 3KVFB 4RMAA 2LHEA 5D3IB 1KLVA 4MELA 1ENFA 1L6UA 2KMMA 2ZPYA 5LNK1 4HLEA 3QK0A 4DHJD 4JWUC 3ZYYX 5HG2A 4A3PA 5IKCM 1PDXA 3DBLI 3B9JA 4GDLB 3KWVA 1E8YA 2KD0A 3A9KB 4KZCA 1NBFC 1C4CA 1P3QU 3P4RB 1I35A 4LNIA 5E6OA 4FHKA 2LHDA 4LJOB 4A8XC 3P2BA 5J18A 1OFFA 4IKGA 3QA8A 2Z0DB 3AE1B 2IO3B 4MJSB 1L5PA 5KHOA 1FIQA 3RT3B 4NNJB 4S17A 2KTRA 5FR3A 2NTTA 3U4EG 1WJ6A 3TEWA 4NAMA 2V0GA 1V1PA 3AM9A 1L4ZB 1H4RA 5HI1A 2WGSA 5J17A 3RNEC 4M01A 2WX1A 3HIZA 2KQ7A 2VZKB 3JSVA 3V62A 2WXKA 3VH4B 2LFIA 1XF5L 3V6CB 1XLPA 3I3TB 4W9FA 3L17A 3VFKA 1OGWA 1C78A 3PS6A 3E9SA 1S3SG 1STEA 2LRUA 5HFYA 2Z0EB 3AH7A 2IY0B 4PS3A 4AJWA 1GAQB 1CJEA 1XLQA 1D5ZC 3A1QA 4IWQA 2WP9B 4EE2A 3BVGA 4P1BC 2PPHA 4GDKA 2NR2A 1SJED 1PUTA 3GZNI 5J2RA 4WJNA 2FUG1 3E56A 4DXAB 3PV1A 2K3UA 4OZBA 4BOZB 2XEWA 1WX9A 3R2IA 2LI5A 4TMAB 4KX6B 3ZDMC 5G5GA 2DAJA 1SE9A 2LJ5A 4EZKA 3VAWA 3ZUNA 2R61A 4W9JA 3SFDB 2NPTB 3KUCB 4LDTB 2BF8B 5BMHA 5EDSA 3W1SC 4ANVA 1JWBD 2BBCA 2D3CA 3UGBB 3WCQA 1P98A 4B0EA 4TSSA 1EF1A 1WXVA 2HTHA 2FIFA 4OVUA 2C7HA 1G6JA 2QCZA 3B0AA 2J53A 3QHTA 4TV3A 4G11A 3Q3OC 3ZRFA 4ARIA 1FNVA 2HD5B 3NS8A 3PZ8A 1E8WA 3ZKJC 4WWMA 4M8NA 3AE7B 3A33B 4USAA 2OJWA 1WH3A 4C56C 1D3ZA 4WWOA 4URKA 2KX3A 3RUIB 1FXTB 2JU6X 1I4GA 1N61A 2DYMA 1JCKB 1UGMA 3I63C 3SHQA 3CSFA 3N1YC 4MGYE 3P42A 4NAWA 4PS8A 2INDC 1UD7A 1CMXB 3A4RA 2DENB 3K9PB 4MDKE 2VH1A 2V3SA 3DWGC 3R7QA 1WM3A 2PTLA 1DGJA 2LRWA 2BKRB 1KM7A 2IYDB 3IVFA 3BY4B 2D3AA 1BT0A 4PYUA 1TIFA 2ASQA 2NBUA 4P6VF 1HE8A 2H89B 1T6BX 4W9CA 1E0ZA 3T3OA 4HKQA 1E8ZA 2BYFA 3Q8CA 4M0WA 2KTRB 4KGTA 5IAAC 2V3PA 3W1YA 3ZJUA 1OEYA 1V1PB 2L7RA 3MHSD 4KZ0A 2NTSA 2KC2A 3DBSA 1TTNA 3DVGY 5IOIA 3JSVB 2E6XA 4GLSC 2YLMA 2KACA 4C7ZA 2I38A 2MA9B 2M56B 2WXHA 3RZFA 2C9WB 1QZEA 4IM2A 4ZYNA 4E74A 4A3OA 3CF6E 2BVCA 3A1QB 4HCNB 2LGYA 4K7SA 2K8BA 3KYDD 1WRDB 4IWPA 3N1XC 2GRIA 4ZRIA 4GDKB 1VCBA 3IFWB 2JT4B 2KNBA 2JQRB 1A5RA 3VXWA 1F2RI 1CQVA 4WQMA 5H8YE 4I6LB 3QQ8B 2BS3B 3OJ3A 4KKIA 3O65B 5CHFA 4AUQC 2RGFA 3HRDD 4YWGG 4ZRPA 2CJOA 4D2KA 3TBLD 3RMKC 1T0QC 4DXGA 3AEAB 3AMZA 1P7EA 2AL6A 4II3B 2GBNA 1JRUA 2BT6A 5L95C 2K8HA 3TEZA 1GG3A 1C9FA 3JVZX 3MC9A 4W9DA 2QSDA 4BKSA 4YXDB 2G4SA 3QWZB 4FJYA 1MVKA 2EKEC 2JY6A 4I6PA 3SFEB 2PJHA 2WXGA 1UUPA 2M19A 3R3MA 3ZJTA 2BQQA 2Z8LA 4ZOHC 2INPE 3ZRCA 1ZW7A 2FUHB 2X8XX 2KFJA 2J7QB 2FCNA 4W9GA 5D3DA 3UINB 2XN9C 2L0FA 3RULA 3VTVA 1YOVB 3AU4A 3PT2B 3L16A 3PRMB 3RFZB 1SB3C 2I1JA 3RNCC 4NAWB 3UQAA 3HVZA 2EMTA 2KFKA 2MBEA 1KLGD 1SIFA 1VDVA 5FK9C 3IXSA 1K8RB 1TBEA 3Q8FA 2PEAA 4HDQA 4G0NB 2JX5A 4CYEA 3V61A 1OEYJ 3BVMA 1ET6A 2IPKD 2TSSA 3MFGA 4YTPB 5JHAA 1J7AA 1JWSD 3DVGX 1V49A 1TYGB 2VH2A 1FFVA 3EECA 5KHQA 3L13A 4YL8A 1R4MB 2PE6B 3ZVVA 3SU8X 2CHWA 4M0WB 4RM9A 2X38A 4OZAA 5FKAC 1E7UA 1V80A 1TY0A 3P63A 3PSEB 3GP7A 2BS4B 2G45B 3PHWB 2KOXA 3NVYA 4LNOA 3MJWA 1C4AA 2BB6A 1OQYA 5H92C 3ZNHB 4M8MA 4P16A 3Q2AC 2MBBB 2KQ4X 4CHKA 3BVZA 1IBXA 2M17A 2GI9A 3ZIMA 3OG5A 1AN8A 3WALA 2O6VA 2KWCA 3NVWA 4ANWA 2EMSA 5IA7A 1D6EC 3FILB 1GC7A 2K6QA 4FHJA 2ZW0A 2N9KA 1WJNA 3NZSA 2LVPA 3V3XA 2ZPNA 3I9V1 2WLBA 5AZGA 1WM2A 1WGKA 4HPPA 3HM3A 2JZZA 1ZGUB 4S0RA 4GXBA 4N6EB 5BO4B 3VH3B 1YQ4B 2BYVE 1LM8B 4AJYB 1GC6A 2UYZB 2KHWB 2JRIB 4GMVA 1JQ4A 4X57B 2KDMA 2QILA 2KTFA 1VRAB 5AUIA 1K51A 3W1SA 4ZRQA 4C7YA 2C60A 2FNJB 1T5XD 2FBWB 2JZPA 2GBRA 3PGEA 1V5TA 1L4DB 4XX5A 3N1ZC 4ICUA 4NJ7A 4WAFA 1SE4A 2PMVA 1SF0A 1V5OA 1PGXA 1ZE3D 1HEZE 1M4VA 3BK2A 3PHXB 2ONQA 2G3QB 3IAS1 3RYTA 3OLMD 2IO1B 3C19A 1F2RC 4ZDVA 4OW0A 3MHZA 2Z59B 1E9MA 4HPMB 3AU5A 3N30A 2K1FA
chains in the Genus database with same CATH topology
2C5LC 3LDZE 3H6NA 3QARA 2PPHA 4GDKA 1V86A 4N9F4 4KVGB 2NR2A 3VUXA 4HCPB 3U8ZA 1NDDA 2MX2A 2MP2B 3NOBA 3A4SC 2N9PC 3ENEA 3GZNI 5J2RA 4WJNA 2LZ6A 5DPRA 4DXAB 4A20A 3PV1A 2RR9A 2D10A 5LXIB 1WZ3A 2XEWA 1WX9A 1XQQA 1Y8RC 4BBNC 4BOZB 2LI5A 3KUZA 2C7NB 4F1SA 1S1QB 4MSMB 4F8CB 2LD9A 2M0XA 5E6NA 3KUDB 4NQLB 4ZRJA 2B3AA 3ZDMC 5E6PA 2M8SA 3V6EB 2DAJA 4DHZB 2KKCA 1SE9A 1SGHA 2LJ5A 3B1LX 4XZ4A 2JVCA 4EZKA 3VAWA 2N1VA 3VUYA 1V81A 2LXAA 3ZUNA 2K39A 4W9JA 1WF9A 2K6DB 3NY5A 2NPTB 2RSUA 3KUCB 1LXDA 3ZDTA 3WIMA 4LDTB 4DDID 2A4ZA 2BF8B 5EDSA 2L8JA 3W1SC 3OAWA 1E8XA 2L0TA 2V1YA 3RZWC 3ML8A 4ANVA 2R2QA 3A9KA 1WZ0A 1GJZA 3UGBB 4CO7A 1P98A 2RD0A 1YX5B 4KDIC 2KVRA 1EF1A 1YD8U 1WXVA 2KDFB 3DDCB 4IG7B 2HTHA 2FIFA 5JH5C 4OVUA 2C7HA 1G6JA 3B0AA 3QHTA 4TV3A 4G11A 2KC1A 4MM3A 4MJSA 2MBQA 3ZRFA 3R7RA 3M62B 2HD5B 3L08A 3NS8A 1VD2A 1E8WA 3ZKJC 4M8NA 1RAXA 5LXHA 3UIPB 3SD5A 3DCGA 3A33B 3PVLA 5D2MB 3QC8B 1WJ4A 3WAOA 4EKUA 4BKGA 2MRPA 2MBOA 3EHVA 1GNUA 3V60A 4ASWC 4NJ6A 2D2QA 1AARA 2IBIB 2LVOA 3BINA 1WH3A 2MWSB 4DDGD 1D3ZA 1RRBA 2LUEA 3VVWB 4HJKA 4WWOA 4URKA 4IM3A 2JRHA 5AEKB 2KX3A 2ZZPB 3ZNGC 1J0GA 3RUIB 4F7ZA 1FXTB 4K81A 3ZTCA 4KSKC 2DYMA 1UGMA 4LDTD 3H1UA 3ZW3A 4GB9A 3SDLC 2KJ6A 2N4FA 3SHQA 3CSFA 4MGYE 1PQSA 1UH6A 4NAWA 4PS8A 2O6VB 1UD7A 1CMXB 2BWES 3ZTDA 3A4RA 1WGHA 2DENB 1Q5WB 3K9PB 4MDKE 3H7PA 2V3SA 1RFAA 4AP4C 2GOWA 3R7QA 2JUOA 1WGDA 2C7MB 3JYUA 1P9DU 1WM3A 2AYOB 4KIKA 4B6WA 3CMMB 2KJRA 2AWTA 4MGZE 2LRWA 2BKRB 1UBQA 2LGXA 1KM7A 2IYDB 1WXSA 1WXMA 2G4DB 3IVFA 4WWNA 2O2VB 3BY4B 5HKHA 1BT0A 2DX5B 4W9KA 1KOTA 4PYUA 2BGFA 1UZXB 2ASQA 2NBUA 3R66C 5JZEB 1HE8A 2N1WA 4HK2A 4BOSC 4W9CA 1IP9A 1EO6A 1E8ZA 1C1YB 2BYFA 4WJOA 3M3JA 1ZKHA 3NZUA 2KTRB 2XK5B 3K9OB 2LWPA 1UBIA 2W9NA 5IAAC 4TUUA 3RCZA 4JQWC 3W1YA 1OEYA 4AOFA 2LASA 5LLIA 1WMHA 1WYWB 2L7RA 3HK0A 2GBKA 3MHSD 1RLFA 2N9XA 3L54A 4KZ0A 2BKFA 2D3GA 2JZ3B 3TJPA 2DZIA 5AZFA 1NI2A 2DAFA 2IO2B 4DBGA 3QCAA 5DPWA 2KC2A 3DBSA 1TTNA 3DVGY 3VTUA 4G50A 3DBHI 4EOYA 4BKSD 2KQSA 2FCMA 1E90A 3JSVB 4IM0A 3T8MA 1IYFA 1GUAB 2YLMA 2KN5A 1YX6B 2KFKB 2J0JA 3D32A 2NPTA 1WI0A 3Q3JA 4JIOU 5GMVA 4W9HA 2KDBA 3RD2A 3U7DA 3X0WA 2MA9B 4JL9A 4B95A 4DHJB 4HPLB 1Z2MA 2JF5A 2KANA 3RZFA 2C9WB 4WWPA 1QZEA 4W9LA 5G2NA 1WGGA 4IM2A 4WJPA 4TQ0A 4ZYNA 3OJ4B 4E74A 4A3OA 4KSLC 3CF6E 5DPSA 4LJPB 3QX1A 2ZVNA 3EC8A 3UQBA 3A1QB 2ZCBA 4HCNB 2K8CA 2LGYA 4K7SA 3M95A 2K8BA 3VDZA 3KYDD 1WRDB 1WY8A 2DYOA 4IWPA 4GDLA 3UF8A 5CTRC 3JW0X 3KH0A 2M1MA 2OOBB 4ZRIA 4HWIB 4GDKB 2ZEQA 3ZNID 2BPSA 1WE6A 2ZNVB 1VCBA 1P0RA 1E5WA 3ZLZA 5FR6A 1WE7A 4IWOA 3QIJA 3DVNU 4WAAA 3IFWB 2JT4B 2KNBA 2I1KA 1I42A 4FJVB 1A5RA 3VXWA 3M63B 3DVNV 1V6EA 2V4LA 1X1MA 4I6LB 3QQ8B 4IC7B 3OJ3A 2Y5BB 1WX8A 5CHFA 3O65B 4AUQC 2QHOA 1WIAA 2RGFA 1UELA 3N3KB 4BVUC 4AWJA 4KDLB 3TBLD 4DWFA 4GU2A 5D94A 3KYCD 4FLHA 2M4NA 3ML9A 3TL5A 3T9LA 1Q1OA 4FADA 2AL6A 2GBNA 1JRUA 2KLCA 4II3B 5L95C 1WJUA 2K8HA 2KLGA 2KWVB 4PYZA 2DHZA 1GG3A 4TQ1A 3TIXA 3JVZX 4W9DA 1XD3B 4BKSA 3X23A 5C23A 2G4SA 4DK5A 4FA6A 3MTNB 3QWZB 4FJYA 2EKEC 1V2YA 2JY6A 4I6PA 2DZJA 2PJHA 2KMAA 3PREA 4MEMA 2OJRA 4XC2A 3ZNZB 2J0MA 2WWZA 3R3MA 1EUVB 2N9EB 2PE9A 4II2B 4GOCA 1WX7A 3ZRCA 1ZW7A 3PPAA 4LCDE 2FUHB 4KV2A 3A9JB 3QJZA 2KK8A 3DPDA 2A5UA 2AL3A 2LVQA 2GMIC 4MGIE 4EZLA 2KFJA 1F9JA 2XK5A 3DBRI 2J7QB 2RPQA 2KX0A 3AULA 2HE7A 1TGZB 3HM6X 4JGHB 2CKHB 2KJHB 2FCNA 4W9GA 3UINB 3PLUA 2L0FA 3RULA 2L3ZA 3VTVA 1J19A 1L7YA 2GBJA 3AXCA 3AU4A 1LQBA 4EEWA 5D7GA 2GBMA 1R4MI 3PT2B 3TCAA 2MP2A 2KO3A 3H7SA 2CHZA 3WANA 5L83A 3L16A 3PRMB 1Q0WB 4IUMB 2I1JA 4GN1A 5DPTA 4NAWB 5CHWA 3UQAA 2EMTA 2KFKA 2MBEA 1LFDA 1SIFA 1T0YA 2CHXA 1K8RB 3H7PB 2YVCA 2R2OA 4W9EA 2LGDA 1TBEA 2O6VD 3B08A 2MBHA 2IZVB 1E7VA 1WFYA 2PEAA 1WGRA 4HDQA 4KIKB 3ZO5B 4RM8A 4G0NB 4CYEA 3V61A 1OEYJ 2BYEA 4ANXA 2D07B 5D6JB 1WR1A 2KMCA 4E71A 2MW5A 2WX0A 5JHAA 3APFA 4NY0A 2N7EA 3DQVA 3IBEA 3DVGX 5G55A 1WXAA 4I6NB 3AI5A 1V49A 3CSTA 2WYQA 4J6IA 3APCA 1J8CA 3EECA 1KJTA 3PRZA 5KHQA 3DOWA 3L13A 2MSED 3PLVA 4YL8A 2ZCCA 3U30A 4FULA 2PE6B 1Z5SB 4B9KA 2LXCA 3ZVVA 3SU8X 4HXDA 2JXXA 4ZRKA 4GGQA 2KDEB 2CHWA 4E3CA 3IHPC 2CU1A 1M94A 3C0RB 4M0WB 4HDOA 4MGKE 4RM9A 1E7UA 1V80A 2JPHA 4FJZA 3PSEB 4K7UA 1YJ1A 2G45B 3PHWB 1WMHB 2NVUI 2NBWB 3HHMA 3NHEB 2DZMA 2KOXA 3WAPA 2MQJA 4K7WA 3PZDA 4FBJB 1TZ1A 1WR6E 3MJWA 4K1RB 4NPNA 2KZRA 1H8CA 1P1AA 3VQIA 1EF5A 2HJ8A 2XBBC 4MSQB 1ISNA 2DZKA 3TMPB 3GOEA 1OQYA 5DCNA 4BKTA 3ZNHB 4M8MA 4WJQA 4EZJA 5C1ZA 2MLBA 2K25A 3L10B 3VHTC 4PS7A 2FCQA 1C3TA 2MBBB 4BFRA 2IO0B 2IY1B 3KVFB 4RMAA 4NQKE 1KLVA 4CHKA 2NCNA 2UWQA 4MELA 2WDTB 2M17A 3UIOB 4BBNF 2ZPYA 3ZIMA 4HLEA 3QK0A 3WA0A 4DHJD 2DYBA 2FAZA 2VRRB 1WGYA 2KWUB 1L2NA 4G3XB 3WALA 2JWZA 2O6VA 2KWCA 3QAQA 4ICVA 5JHBA 4A3PA 4ANWA 2EMSA 5IA7A 4ANUA 1GC7A 2N7DA 3DBLI 3WAMA 2K6QA 4FHJA 4GDLB 3A9JA 4W9IA 3IG3A 2MCNB 1E8YA 2KD0A 3A9KB 3VTWA 4P7IA 1WJNA 4IW0A 4KZCA 1NBFC 2D11A 1P3QU 2KDIA 2LVPA 3NZSA 1I35A 3LJ3A 2O2VA 4FHKA 5E6OA 4LJOB 3VUWA 3P2BA 3S2AA 2ZPNA 5J18A 2AEHA 3QA8A 4JLCA 2L00B 2L76A 2Z0DB 2IO3B 5AZGA 1WM2A 5TR5A 4MJSB 1YIWA 3HM3A 2JZZA 5KHOA 1ZGUB 3PTFC 2L05A 2ZNVC 4GXBA 5BO4B 3RT3B 1R4NI 4NNJB 3L0WB 3VH3B 2KTRA 4DHZE 2BYVE 4OVVA 1LM8B 4FN2A 1GC6A 1WJ6A 4AJYB 4EFOA 2UYZB 1YQBA 5CHVC 2KHWB 4EUTA 1V9JA 2JRIB 4MH0E 4GMVA 2J0KA 4X57B 1OTRB 2KTFA 2FCSA 1H4RA 5J17A 1IPGA 2WX1A 3W1SA 3ECIA 3ONSA 2C60A 2REXA 2ZVOA 3APDA 1MG8A 2FNJB 3H9DA 3HIZA 2KQ7A 3EFUA 3JSVA 1XT9B 2GBRA 2NBVB 5AZHA 3PGEA 3V62A 1V5TA 4HVBA 2FIDA 4XX5A 3VH4B 3ALBA 2KXJA 3PRPB 4ICUA 4NJ7A 4TKNA 4GSWA 3V6CB 3I3TB 4W9FA 1V5OA 1U4AA 3L17A 3VFKA 1OGWA 2ZJDA 3PHXB 3PS6A 2G3QB 2CS4A 1S3SG 5CX3A 3RYTA 3OLMD 2IO1B 2LRUA 3KW5B 2Z0EB 2NS5A 4WQOB 2CR5A 2IY0B 4PS3A 4AJWA 4ZDVA 3Q3FA 3N32A 2BWFA 3A1QA 2Z59B 4IWQA 4HPMB 3AU5A 4GIVA 3N30A 2K1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5L C;  3LDZ E;  3H6N A;  3QAR A;  2PPH A;  4GDK A;  1V86 A;  4N9F 4;  4KVG B;  2NR2 A;  3VUX A;  4HCP B;  3U8Z A;  1NDD A;  2MX2 A;  2MP2 B;  3NOB A;  3A4S C;  2N9P C;  3ENE A;  3GZN I;  5J2R A;  4WJN A;  2LZ6 A;  5DPR A;  4DXA B;  4A20 A;  3PV1 A;  2RR9 A;  2D10 A;  5LXI B;  1WZ3 A;  2XEW A;  1WX9 A;  1XQQ A;  1Y8R C;  4BBN C;  4BOZ B;  2LI5 A;  3KUZ A;  2C7N B;  4F1S A;  1S1Q B;  4MSM B;  4F8C B;  2LD9 A;  2M0X A;  5E6N A;  3KUD B;  4NQL B;  4ZRJ A;  2B3A A;  3ZDM C;  5E6P A;  2M8S A;  3V6E B;  2DAJ A;  4DHZ B;  2KKC A;  1SE9 A;  1SGH A;  2LJ5 A;  3B1L X;  4XZ4 A;  2JVC A;  4EZK A;  3VAW A;  2N1V A;  3VUY A;  1V81 A;  2LXA A;  3ZUN A;  2K39 A;  4W9J A;  1WF9 A;  2K6D B;  3NY5 A;  2NPT B;  2RSU A;  3KUC B;  1LXD A;  3ZDT A;  3WIM A;  4LDT B;  4DDI D;  2A4Z A;  2BF8 B;  5EDS A;  2L8J A;  3W1S C;  3OAW A;  1E8X A;  2L0T A;  2V1Y A;  3RZW C;  3ML8 A;  4ANV A;  2R2Q A;  3A9K A;  1WZ0 A;  1GJZ A;  3UGB B;  4CO7 A;  1P98 A;  2RD0 A;  1YX5 B;  4KDI C;  2KVR A;  1EF1 A;  1YD8 U;  1WXV A;  2KDF B;  3DDC B;  4IG7 B;  2HTH A;  2FIF A;  5JH5 C;  4OVU A;  2C7H A;  1G6J A;  3B0A A;  3QHT A;  4TV3 A;  4G11 A;  2KC1 A;  4MM3 A;  4MJS A;  2MBQ A;  3ZRF A;  3R7R A;  3M62 B;  2HD5 B;  3L08 A;  3NS8 A;  1VD2 A;  1E8W A;  3ZKJ C;  4M8N A;  1RAX A;  5LXH A;  3UIP B;  3SD5 A;  3DCG A;  3A33 B;  3PVL A;  5D2M B;  3QC8 B;  1WJ4 A;  3WAO A;  4EKU A;  4BKG A;  2MRP A;  2MBO A;  3EHV A;  1GNU A;  3V60 A;  4ASW C;  4NJ6 A;  2D2Q A;  1AAR A;  2IBI B;  2LVO A;  3BIN A;  1WH3 A;  2MWS B;  4DDG D;  1D3Z A;  1RRB A;  2LUE A;  3VVW B;  4HJK A;  4WWO A;  4URK A;  4IM3 A;  2JRH A;  5AEK B;  2KX3 A;  2ZZP B;  3ZNG C;  1J0G A;  3RUI B;  4F7Z A;  1FXT B;  4K81 A;  3ZTC A;  4KSK C;  2DYM A;  1UGM A;  4LDT D;  3H1U A;  3ZW3 A;  4GB9 A;  3SDL C;  2KJ6 A;  2N4F A;  3SHQ A;  3CSF A;  4MGY E;  1PQS A;  1UH6 A;  4NAW A;  4PS8 A;  2O6V B;  1UD7 A;  1CMX B;  2BWE S;  3ZTD A;  3A4R A;  1WGH A;  2DEN B;  1Q5W B;  3K9P B;  4MDK E;  3H7P A;  2V3S A;  1RFA A;  4AP4 C;  2GOW A;  3R7Q A;  2JUO A;  1WGD A;  2C7M B;  3JYU A;  1P9D U;  1WM3 A;  2AYO B;  4KIK A;  4B6W A;  3CMM B;  2KJR A;  2AWT A;  4MGZ E;  2LRW A;  2BKR B;  1UBQ A;  2LGX A;  1KM7 A;  2IYD B;  1WXS A;  1WXM A;  2G4D B;  3IVF A;  4WWN A;  2O2V B;  3BY4 B;  5HKH A;  1BT0 A;  2DX5 B;  4W9K A;  1KOT A;  4PYU A;  2BGF A;  1UZX B;  2ASQ A;  2NBU A;  3R66 C;  5JZE B;  1HE8 A;  2N1W A;  4HK2 A;  4BOS C;  4W9C A;  1IP9 A;  1EO6 A;  1E8Z A;  1C1Y B;  2BYF A;  4WJO A;  3M3J A;  1ZKH A;  3NZU A;  2KTR B;  2XK5 B;  3K9O B;  2LWP A;  1UBI A;  2W9N A;  5IAA C;  4TUU A;  3RCZ A;  4JQW C;  3W1Y A;  1OEY A;  4AOF A;  2LAS A;  5LLI A;  1WMH A;  1WYW B;  2L7R A;  3HK0 A;  2GBK A;  3MHS D;  1RLF A;  2N9X A;  3L54 A;  4KZ0 A;  2BKF A;  2D3G A;  2JZ3 B;  3TJP A;  2DZI A;  5AZF A;  1NI2 A;  2DAF A;  2IO2 B;  4DBG A;  3QCA A;  5DPW A;  2KC2 A;  3DBS A;  1TTN A;  3DVG Y;  3VTU A;  4G50 A;  3DBH I;  4EOY A;  4BKS D;  2KQS A;  2FCM A;  1E90 A;  3JSV B;  4IM0 A;  3T8M A;  1IYF A;  1GUA B;  2YLM A;  2KN5 A;  1YX6 B;  2KFK B;  2J0J A;  3D32 A;  2NPT A;  1WI0 A;  3Q3J A;  4JIO U;  5GMV A;  4W9H A;  2KDB A;  3RD2 A;  3U7D A;  3X0W A;  2MA9 B;  4JL9 A;  4B95 A;  4DHJ B;  4HPL B;  1Z2M A;  2JF5 A;  2KAN A;  3RZF A;  2C9W B;  4WWP A;  1QZE A;  4W9L A;  5G2N A;  1WGG A;  4IM2 A;  4WJP A;  4TQ0 A;  4ZYN A;  3OJ4 B;  4E74 A;  4A3O A;  4KSL C;  3CF6 E;  5DPS A;  4LJP B;  3QX1 A;  2ZVN A;  3EC8 A;  3UQB A;  3A1Q B;  2ZCB A;  4HCN B;  2K8C A;  2LGY A;  4K7S A;  3M95 A;  2K8B A;  3VDZ A;  3KYD D;  1WRD B;  1WY8 A;  2DYO A;  4IWP A;  4GDL A;  3UF8 A;  5CTR C;  3JW0 X;  3KH0 A;  2M1M A;  2OOB B;  4ZRI A;  4HWI B;  4GDK B;  2ZEQ A;  3ZNI D;  2BPS A;  1WE6 A;  2ZNV B;  1VCB A;  1P0R A;  1E5W A;  3ZLZ A;  5FR6 A;  1WE7 A;  4IWO A;  3QIJ A;  3DVN U;  4WAA A;  3IFW B;  2JT4 B;  2KNB A;  2I1K A;  1I42 A;  4FJV B;  1A5R A;  3VXW A;  3M63 B;  3DVN V;  1V6E A;  2V4L A;  1X1M A;  4I6L B;  3QQ8 B;  4IC7 B;  3OJ3 A;  2Y5B B;  1WX8 A;  5CHF A;  3O65 B;  4AUQ C;  2QHO A;  1WIA A;  2RGF A;  1UEL A;  3N3K B;  4BVU C;  4AWJ A;  4KDL B;  3TBL D;  4DWF A;  4GU2 A;  5D94 A;  3KYC D;  4FLH A;  2M4N A;  3ML9 A;  3TL5 A;  3T9L A;  1Q1O A;  4FAD A;  2AL6 A;  2GBN A;  1JRU A;  2KLC A;  4II3 B;  5L95 C;  1WJU A;  2K8H A;  2KLG A;  2KWV B;  4PYZ A;  2DHZ A;  1GG3 A;  4TQ1 A;  3TIX A;  3JVZ X;  4W9D A;  1XD3 B;  4BKS A;  3X23 A;  5C23 A;  2G4S A;  4DK5 A;  4FA6 A;  3MTN B;  3QWZ B;  4FJY A;  2EKE C;  1V2Y A;  2JY6 A;  4I6P A;  2DZJ A;  2PJH A;  2KMA A;  3PRE A;  4MEM A;  2OJR A;  4XC2 A;  3ZNZ B;  2J0M A;  2WWZ A;  3R3M A;  1EUV B;  2N9E B;  2PE9 A;  4II2 B;  4GOC A;  1WX7 A;  3ZRC A;  1ZW7 A;  3PPA A;  4LCD E;  2FUH B;  4KV2 A;  3A9J B;  3QJZ A;  2KK8 A;  3DPD A;  2A5U A;  2AL3 A;  2LVQ A;  2GMI C;  4MGI E;  4EZL A;  2KFJ A;  1F9J A;  2XK5 A;  3DBR I;  2J7Q B;  2RPQ A;  2KX0 A;  3AUL A;  2HE7 A;  1TGZ B;  3HM6 X;  4JGH B;  2CKH B;  2KJH B;  2FCN A;  4W9G A;  3UIN B;  3PLU A;  2L0F A;  3RUL A;  2L3Z A;  3VTV A;  1J19 A;  1L7Y A;  2GBJ A;  3AXC A;  3AU4 A;  1LQB A;  4EEW A;  5D7G A;  2GBM A;  1R4M I;  3PT2 B;  3TCA A;  2MP2 A;  2KO3 A;  3H7S A;  2CHZ A;  3WAN A;  5L83 A;  3L16 A;  3PRM B;  1Q0W B;  4IUM B;  2I1J A;  4GN1 A;  5DPT A;  4NAW B;  5CHW A;  3UQA A;  2EMT A;  2KFK A;  2MBE A;  1LFD A;  1SIF A;  1T0Y A;  2CHX A;  1K8R B;  3H7P B;  2YVC A;  2R2O A;  4W9E A;  2LGD A;  1TBE A;  2O6V D;  3B08 A;  2MBH A;  2IZV B;  1E7V A;  1WFY A;  2PEA A;  1WGR A;  4HDQ A;  4KIK B;  3ZO5 B;  4RM8 A;  4G0N B;  4CYE A;  3V61 A;  1OEY J;  2BYE A;  4ANX A;  2D07 B;  5D6J B;  1WR1 A;  2KMC A;  4E71 A;  2MW5 A;  2WX0 A;  5JHA A;  3APF A;  4NY0 A;  2N7E A;  3DQV A;  3IBE A;  3DVG X;  5G55 A;  1WXA A;  4I6N B;  3AI5 A;  1V49 A;  3CST A;  2WYQ A;  4J6I A;  3APC A;  1J8C A;  3EEC A;  1KJT A;  3PRZ A;  5KHQ A;  3DOW A;  3L13 A;  2MSE D;  3PLV A;  4YL8 A;  2ZCC A;  3U30 A;  4FUL A;  2PE6 B;  1Z5S B;  4B9K A;  2LXC A;  3ZVV A;  3SU8 X;  4HXD A;  2JXX A;  4ZRK A;  4GGQ A;  2KDE B;  2CHW A;  4E3C A;  3IHP C;  2CU1 A;  1M94 A;  3C0R B;  4M0W B;  4HDO A;  4MGK E;  4RM9 A;  1E7U A;  1V80 A;  2JPH A;  4FJZ A;  3PSE B;  4K7U A;  1YJ1 A;  2G45 B;  3PHW B;  1WMH B;  2NVU I;  2NBW B;  3HHM A;  3NHE B;  2DZM A;  2KOX A;  3WAP A;  2MQJ A;  4K7W A;  3PZD A;  4FBJ B;  1TZ1 A;  1WR6 E;  3MJW A;  4K1R B;  4NPN A;  2KZR A;  1H8C A;  1P1A A;  3VQI A;  1EF5 A;  2HJ8 A;  2XBB C;  4MSQ B;  1ISN A;  2DZK A;  3TMP B;  3GOE A;  1OQY A;  5DCN A;  4BKT A;  3ZNH B;  4M8M A;  4WJQ A;  4EZJ A;  5C1Z A;  2MLB A;  2K25 A;  3L10 B;  3VHT C;  4PS7 A;  2FCQ A;  1C3T A;  2MBB B;  4BFR A;  2IO0 B;  2IY1 B;  3KVF B;  4RMA A;  4NQK E;  1KLV A;  4CHK A;  2NCN A;  2UWQ A;  4MEL A;  2WDT B;  2M17 A;  3UIO B;  4BBN F;  2ZPY A;  3ZIM A;  4HLE A;  3QK0 A;  3WA0 A;  4DHJ D;  2DYB A;  2FAZ A;  2VRR B;  1WGY A;  2KWU B;  1L2N A;  4G3X B;  3WAL A;  2JWZ A;  2O6V A;  2KWC A;  3QAQ A;  4ICV A;  5JHB A;  4A3P A;  4ANW A;  2EMS A;  5IA7 A;  4ANU A;  1GC7 A;  2N7D A;  3DBL I;  3WAM A;  2K6Q A;  4FHJ A;  4GDL B;  3A9J A;  4W9I A;  3IG3 A;  2MCN B;  1E8Y A;  2KD0 A;  3A9K B;  3VTW A;  4P7I A;  1WJN A;  4IW0 A;  4KZC A;  1NBF C;  2D11 A;  1P3Q U;  2KDI A;  2LVP A;  3NZS A;  1I35 A;  3LJ3 A;  2O2V A;  4FHK A;  5E6O A;  4LJO B;  3VUW A;  3P2B A;  3S2A A;  2ZPN A;  5J18 A;  2AEH A;  3QA8 A;  4JLC A;  2L00 B;  2L76 A;  2Z0D B;  2IO3 B;  5AZG A;  1WM2 A;  5TR5 A;  4MJS B;  1YIW A;  3HM3 A;  2JZZ A;  5KHO A;  1ZGU B;  3PTF C;  2L05 A;  2ZNV C;  4GXB A;  5BO4 B;  3RT3 B;  1R4N I;  4NNJ B;  3L0W B;  3VH3 B;  2KTR A;  4DHZ E;  2BYV E;  4OVV A;  1LM8 B;  4FN2 A;  1GC6 A;  1WJ6 A;  4AJY B;  4EFO A;  2UYZ B;  1YQB A;  5CHV C;  2KHW B;  4EUT A;  1V9J A;  2JRI B;  4MH0 E;  4GMV A;  2J0K A;  4X57 B;  1OTR B;  2KTF A;  2FCS A;  1H4R A;  5J17 A;  1IPG A;  2WX1 A;  3W1S A;  3ECI A;  3ONS A;  2C60 A;  2REX A;  2ZVO A;  3APD A;  1MG8 A;  2FNJ B;  3H9D A;  3HIZ A;  2KQ7 A;  3EFU A;  3JSV A;  1XT9 B;  2GBR A;  2NBV B;  5AZH A;  3PGE A;  3V62 A;  1V5T A;  4HVB A;  2FID A;  4XX5 A;  3VH4 B;  3ALB A;  2KXJ A;  3PRP B;  4ICU A;  4NJ7 A;  4TKN A;  4GSW A;  3V6C B;  3I3T B;  4W9F A;  1V5O A;  1U4A A;  3L17 A;  3VFK A;  1OGW A;  2ZJD A;  3PHX B;  3PS6 A;  2G3Q B;  2CS4 A;  1S3S G;  5CX3 A;  3RYT A;  3OLM D;  2IO1 B;  2LRU A;  3KW5 B;  2Z0E B;  2NS5 A;  4WQO B;  2CR5 A;  2IY0 B;  4PS3 A;  4AJW A;  4ZDV A;  3Q3F A;  3N32 A;  2BWF A;  3A1Q A;  2Z59 B;  4IWQ A;  4HPM B;  3AU5 A;  4GIV A;  3N30 A;  2K1F A; 
#chains in the Genus database with same CATH topology
 2C5L C;  4RCO A;  3QAR A;  1YN4 A;  2PIA A;  3NOB A;  3A4S C;  2G1E A;  1VLB A;  2AQ1 B;  2N9P C;  3ENE A;  2QDF A;  3Q8A A;  2LZ6 A;  2W54 A;  4BBN C;  2C7N B;  2WXF A;  1Q10 A;  2LD9 A;  2M0X A;  3KUD B;  3GE8 C;  5E6P A;  3V6E B;  2KKC A;  1SGH A;  2YEP F;  3B1L X;  2K22 A;  1SE3 A;  4ZYS A;  1I7H A;  2N1V A;  3J9C A;  2MEK A;  1WF9 A;  1LXD A;  4XYC A;  4DDI D;  1OQQ A;  5IP4 D;  2I2Y A;  2V1Y A;  2ICI A;  5IN7 A;  3RNB C;  2WXQ A;  4JX1 C;  1YX5 B;  3U7Z A;  4XGA B;  1K52 A;  1YD8 U;  2N0S B;  3DDC B;  2JYT A;  5JH5 C;  2KC1 A;  4MM3 A;  1VD2 A;  1EU3 A;  1K50 A;  5LXH A;  3AEG B;  3DCG A;  3PVL A;  3V60 A;  4L2Y A;  3VRA B;  2PKO A;  5EE9 A;  1CZP A;  2WXL A;  2OHF A;  4HJK A;  4IM3 A;  3ZNG C;  1XEE A;  5BMG A;  4K81 A;  1JRP A;  1D4B A;  2KJ6 A;  4JWS C;  2O6V B;  2PW9 A;  2BWE S;  1Q5W B;  3H7P A;  1VZ6 A;  2GOW A;  1LGR A;  1HQR D;  2HJ1 A;  2G9H D;  4KIK A;  2IGD A;  2KJR A;  1PGB A;  3BYT B;  2K5P A;  4MGZ E;  3W5V B;  1L0V B;  4W9K A;  1KOT A;  2WXM A;  2BGF A;  1ZP0 B;  4BOS C;  4Q2J A;  1C1Y B;  4L1B A;  4WJO A;  1ZKH A;  3NZU A;  1YMH E;  2XK5 B;  1SXT A;  3NRZ A;  1C76 A;  2LWP A;  1UBI A;  2W9N A;  2WXN A;  1L6V A;  4TUU A;  2B76 B;  2Q5W D;  2K0P A;  5LLI A;  3MC0 B;  1RLF A;  3TJP A;  2D3G A;  4DBG A;  1T0S C;  2DZI A;  1DOY A;  1NI2 A;  3QCA A;  1TS4 A;  2KYW A;  3OWE B;  2DWQ A;  4BKS D;  1VJK A;  1E90 A;  2QEJ C;  1GUA B;  3Q8B A;  2OED A;  1HZ5 A;  3D32 A;  2J0J A;  5GMV A;  3U7D A;  1L0X B;  4JL9 A;  4B95 A;  3W2D A;  1L0Y B;  4R3D A;  3PZ7 A;  5G2N A;  1ZUD 2;  2ON8 A;  4KSL C;  2ZVN A;  4PK1 A;  2ZCB A;  2K8C A;  1FRR A;  3UF8 A;  3KH0 A;  3AEF B;  3DBH B;  2ZNV B;  2WXR A;  4RGM A;  1E5W A;  3QIJ A;  3DVN U;  4LNK A;  1I42 A;  4YSX B;  4LNN A;  3M63 B;  4IC7 B;  1V6E A;  2KAJ A;  1V97 A;  3LYY A;  1FPY A;  1WIA A;  1UEL A;  2WHI A;  3ZXR A;  4GU2 A;  5D94 A;  3KYC D;  3L4P A;  2M4N A;  4FLH A;  3ML9 A;  1QOA A;  4RGO S;  3TL5 A;  2J42 A;  4FAD A;  2KLG A;  4PYZ A;  2RDG A;  4TQ1 A;  3TIX A;  4WUR A;  5C23 A;  2N9L A;  3UI3 A;  1V2Y A;  2DZJ A;  3PRE A;  2KMA A;  4YSZ B;  2OJR A;  4XC2 A;  3AE5 B;  3AE8 B;  2WWZ A;  3PO0 A;  1F77 A;  4II2 B;  1WX7 A;  4YSY B;  4LCD E;  4MAC A;  2ZW1 A;  4MM3 B;  1TT5 B;  2KK8 A;  2A5U A;  3KQ4 A;  2GMI C;  4MGI E;  1F9J A;  4XDC A;  3ZJV A;  3T3N A;  1C4P A;  3DBL B;  2KT7 A;  4K3C A;  2RDB C;  1J19 A;  1L7Y A;  1GOZ A;  2HTM E;  4EEW A;  5D7G A;  3TCA A;  1R4M I;  1KH0 A;  2W82 A;  3DWM A;  3NJT A;  2KO3 A;  3H7S A;  2HDE A;  4C4V A;  4REZ A;  4IUM B;  1PYW D;  4GN1 A;  5DPT A;  1XO3 A;  1LFD A;  2EEL A;  3H7P B;  4W9E A;  2R2O A;  2O6V D;  2MBH A;  2IZV B;  1E7V A;  1WFY A;  1WGR A;  4KIK B;  4RGN A;  2D07 B;  2Y5P A;  1WRI A;  4E71 A;  3HUI A;  2WX0 A;  2UU7 A;  2N7E A;  3DQV A;  4NY0 A;  1WXA A;  2LEK A;  4I6N B;  1QLB B;  3AI5 A;  4YTN B;  1HTQ A;  3PRZ A;  1JWA D;  3DOW A;  4O1N A;  2MSE D;  1CK1 A;  2ZCC A;  2AX5 A;  3AV8 A;  4B9K A;  4HXD A;  4GGQ A;  3IHP C;  1MHX A;  1NVI D;  2QMT A;  3KLS X;  4C00 A;  1XCT L;  4FJZ A;  1P7F A;  1YJ1 A;  2NVU I;  3NVV A;  3NHE B;  1ESF A;  1EU4 A;  2LUM A;  4WIP A;  4K1R B;  2KZR A;  1P1A A;  1DOX A;  4ITK A;  1EF5 A;  1SE2 A;  1VR9 A;  1YQ3 B;  2HJ8 A;  4MSQ B;  4KGS A;  2M0A A;  5DCN A;  2J4X A;  4EZJ A;  3L10 B;  2EKI A;  4PS7 A;  2IY1 B;  4NQK E;  3Q6B A;  2NCN A;  4BBN F;  3WA0 A;  1MFW A;  2VRR B;  1WGY A;  1MHH E;  1VZ8 A;  3QAQ A;  1A70 A;  3WAM A;  3AB5 A;  3A9J A;  3IG3 A;  1TJE A;  3ABV B;  3VTW A;  4P7I A;  4IW0 A;  2WNM A;  3LJ3 A;  2O2V A;  3VUW A;  1KF6 B;  3P4S B;  3S2A A;  2AEH A;  1JAL A;  2L00 B;  2L76 A;  5TR5 A;  1YIW A;  2WQY B;  2WXP A;  4HRO A;  3NG0 A;  2L05 A;  4P1C C;  1I4X A;  4IDI A;  3IAM 1;  3R8B A;  2AQ3 B;  4UDU C;  1WSP A;  4EFO A;  1UWM A;  1YQB A;  4EUT A;  1V9J A;  2BTE A;  4MH0 E;  2J0K A;  4HEA 1;  1DYQ A;  1NI3 A;  2L1A A;  1E7P B;  1IPG A;  3ECI A;  1SIJ A;  1B1Z A;  2REX A;  2ZVO A;  3NVZ A;  1MG8 A;  3EFU A;  1XT9 B;  5AZH A;  4HVB A;  2FID A;  3PRP B;  2KXJ A;  1WXQ A;  4GSW A;  1YN3 A;  4B0M A;  1N5X A;  1U4A A;  4AQ7 A;  1F0Z A;  1R4N B;  3RNG C;  5CX3 A;  3P1M A;  4JPS A;  2SAK A;  5I4D A;  2NS5 A;  1JW9 D;  3H8H A;  1ZDX A;  2KVZ A;  4LNF A;  2V4I B;  3LDZ E;  4OZC A;  3H6N A;  4YT0 B;  1ROE A;  1V86 A;  4KVG B;  1YN5 A;  1C77 A;  3U8Z A;  5DPR A;  4C4V B;  3BK1 A;  4A20 A;  2RR9 A;  5LXI B;  1WZ3 A;  1XQQ A;  3KUZ A;  1I4H A;  4F1S A;  4F8C B;  5E6N A;  4NQL B;  4ZRJ A;  2B3A A;  1HXY D;  2M8S A;  3AE4 B;  3NY5 A;  3SR6 A;  2V9H A;  3ZDT A;  5BMI A;  3WIM A;  2A4Z A;  2L8J A;  3NS1 A;  3OAW A;  1E8X A;  2L0T A;  3RZW C;  3ML8 A;  2QJL A;  2R2Q A;  1RYJ A;  3A9K A;  1WZ0 A;  1GJZ A;  2WU5 B;  2RD0 A;  4IOI E;  2KVR A;  2KDF B;  4IG7 B;  2RDH A;  3RI7 C;  1ET9 A;  1B9R A;  4MJS A;  1QKZ A;  1OQR A;  1RAX A;  3SD5 A;  2MRP A;  2MBO A;  4H2A A;  3EHV A;  1GNU A;  4ASW C;  5IO9 A;  2D2Q A;  2IBI B;  2LVO A;  3SEB A;  1MJD A;  2MWS B;  1RRB A;  2LUE A;  1FEH A;  1J0G A;  5MPO A;  4F7Z A;  2JWU A;  1LO5 D;  3EUB 2;  3TSS A;  3H1U A;  3ZW3 A;  4GB9 A;  1TY2 A;  4RGT A;  1F1H A;  1PQS A;  2MJD A;  1SJH D;  2QC8 A;  3ZTD A;  1WGH A;  2CJN A;  1RFA A;  3CIR B;  2Y3A A;  1WGD A;  3JYU A;  2C7M B;  1ACC A;  1FXI A;  2JYE A;  3RPF C;  1RFK A;  1UBQ A;  2LGX A;  1WXS A;  1WXM A;  2O2V B;  2D5G A;  3R66 C;  1K53 A;  4HK2 A;  4RFB A;  3M3J A;  5EE0 A;  1VZ7 A;  1TKY A;  3K9O B;  1QT9 A;  4AOF A;  1WMH A;  1WYW B;  1QOG A;  2IGH A;  3HK0 A;  2GBK A;  2KWD A;  5AZF A;  2DAF A;  2JSV X;  5DPW A;  3VTU A;  4G50 A;  3DBH I;  4EOY A;  1KFY B;  4AS1 A;  2FCM A;  1IYF A;  2KFK B;  2NPT A;  2RPV A;  4W9H A;  1TS3 A;  1V8C A;  5C2T B;  2KAN A;  4LK0 M;  4W9L A;  3RN9 C;  3OJ4 B;  5DPS A;  3QX1 A;  4PT5 A;  1YJJ A;  3EC8 A;  1PGA A;  1TS2 A;  3VDZ A;  3M95 A;  5CTR C;  3JW0 X;  2M1M A;  4LLG M;  4HWI B;  3ZNI D;  2BPS A;  1KRH A;  4ARC A;  1ZOY B;  1FM0 D;  5FR6 A;  1WE7 A;  4IWO A;  1WYG A;  2I1K A;  4M02 A;  1X1M A;  2Y5B B;  1JRO A;  4AWJ A;  4KDL B;  1GB4 A;  4DWF A;  1F52 A;  3C8Y A;  2LMC A;  3DHG C;  2BB5 A;  1WJU A;  2KWV B;  2WS3 B;  2DHZ A;  1PFD A;  1NEN B;  2E3T A;  1XD3 B;  2D3B A;  4DK5 A;  4FA6 A;  3MTN B;  1IBX B;  1XXG A;  3KWL A;  1XLO A;  1N60 A;  1TKG A;  1UF0 A;  1YNT E;  2WDR B;  1FO4 A;  4N58 A;  1YJI A;  1RM6 C;  4GOC A;  3GB1 A;  4KV2 A;  1Y56 A;  2AL3 A;  2LVQ A;  1T3Q A;  2RPQ A;  3AUL A;  2HE7 A;  1TGZ B;  3HM6 X;  4JGH B;  2KJH B;  1I4P A;  1N5W A;  1HTO A;  2L3Z A;  2N7J A;  1TZO A;  2GBJ A;  4N59 A;  5HHD G;  2MP2 A;  4FXC A;  3Q3M C;  5CHW A;  1T0Y A;  2CHX A;  5E6J A;  2PLP A;  4RM8 A;  3DBR B;  2BYE A;  4ANX A;  2H88 B;  2KMC A;  5BYR A;  5G55 A;  3IBE A;  3CST A;  4J6I A;  3APC A;  1KJT A;  1EWC A;  3PLV A;  2PVO D;  1UNS A;  2LXC A;  5GXG B;  2JXX A;  4ZRK A;  2CU1 A;  4A6Q A;  2JPH A;  2WXI A;  1WMH B;  2NBW B;  3VRB B;  3WAP A;  2MQJ A;  4K7W A;  3PZD A;  4FBJ B;  1WR6 E;  2LGI A;  3ZQ4 A;  2XBB C;  2DZK A;  3GOE A;  2L52 A;  4NJC A;  4BKT A;  3Q14 C;  4WJQ A;  1KTK A;  5C1Z A;  2K25 A;  3IT6 B;  2FCQ A;  2IO0 B;  1ZPS A;  1TKE A;  1BUI C;  1BML C;  2UWQ A;  2WDT B;  3LXF A;  3UIO B;  3URY A;  2DYB A;  2FAZ A;  2QIE B;  2KWU B;  1L2N A;  1QF6 A;  2K9X A;  4G3X B;  2JWZ A;  1QOF A;  4ICV A;  3RNF C;  5JHB A;  3AED B;  4ANU A;  2N7D A;  2DLB A;  1AYF A;  4W9I A;  3EFC A;  1GPX A;  2MCN B;  1T0R C;  1NYR A;  2D11 A;  1D5M C;  2KDI A;  4BZA A;  3BYY B;  3FKY A;  3ZXV A;  4JLC A;  2BYT A;  1QIL A;  3O13 A;  3PTF C;  1MG4 A;  2YEP B;  2DBY A;  2ZNV C;  1R4N I;  3L0W B;  2LGS A;  2W3S A;  5JXV A;  4JE3 B;  4DHZ E;  4C80 A;  4OVV A;  3BZD B;  4FN2 A;  2MJE A;  2L83 A;  5CHV C;  3B2F A;  3LB8 C;  4ZHO A;  3U2S C;  1OTR B;  2FCS A;  3TEY A;  2PVG C;  3ONS A;  3APD A;  3BWU D;  2GLS A;  3H9D A;  3P4Q B;  2NBV B;  3ALB A;  3AEC B;  4TKN A;  4DXF A;  4CQN A;  2WDQ B;  1I4Q A;  1WWT A;  2ZJD A;  2CS4 A;  2L32 A;  3KW5 B;  2V3N A;  4WQO B;  2CR5 A;  3Q3F A;  3N32 A;  2BWF A;  2MH7 A;  1I4R A;  5AUK A;  4GIV A;  2GB1 A;  1ZDV A;  4N9F 4;  3VUX A;  4HCP B;  1NDD A;  2MX2 A;  4KKJ A;  2MP2 B;  3W9C B;  4LTU A;  4K3B A;  2D10 A;  5T8I A;  1Y8R C;  4WH4 A;  2VZK D;  1S1Q B;  4MSM B;  2WDV B;  3ETR A;  1MPE A;  4DHZ B;  3FAH A;  3N9Y C;  2JVC A;  1FMA D;  4XZ4 A;  3MJ5 A;  3VUY A;  1V81 A;  2LXA A;  3Q8E A;  2K39 A;  1JWM D;  2K6D B;  2ACZ B;  2RSU A;  3FIL A;  5TSS A;  1ZXH A;  3R2T A;  4CO7 A;  4HJG E;  3GZN B;  4KDI C;  4ZHP A;  1XLN A;  2MBQ A;  1N63 A;  3R7R A;  3M62 B;  3L08 A;  4XDD A;  1QOB A;  5G5H A;  4RH6 A;  5BYQ A;  3UIP B;  4HRS A;  5C3J B;  5D2M B;  3WAO A;  3QC8 B;  1WJ4 A;  4EKU A;  4BKG A;  4NJ6 A;  1AAR A;  3BIN A;  1FXA A;  4DDG D;  4KGR A;  2XNA C;  3VVW B;  4OHJ A;  3U52 E;  4YTM B;  2JRH A;  5AEK B;  4NZL B;  2LJI A;  2ZZP B;  4OVZ A;  5BYS A;  3ZTC A;  4KSK C;  4RF0 A;  4LDT D;  1EWY C;  3SDL C;  2N4F A;  2IJ0 A;  1UH6 A;  3DHH C;  3HVD A;  4AP4 C;  2WXJ A;  4XWW A;  2JUO A;  3Q69 A;  1RWS A;  1P9D U;  2AYO B;  4B6W A;  2BW2 A;  1EM7 A;  3CMM B;  1FCC C;  2AWT A;  4WWN A;  2G4D B;  2IGG A;  5HKH A;  2DX5 B;  3EA6 A;  3MC8 A;  3P4P B;  1HZ6 A;  1UZX B;  1SSN A;  5JZE B;  2N1W A;  3EGR A;  2KN4 A;  5EE3 A;  4A9A A;  1IP9 A;  1EO6 A;  3MP9 A;  3FC4 A;  1FNW A;  1N6Z A;  3N20 C;  2INC C;  2JXT A;  4US8 A;  3RCZ A;  4JQW C;  2LAS A;  4A90 A;  3AE3 B;  1QQR A;  2N9X A;  3L54 A;  2BKF A;  2JZ3 B;  2MHJ A;  1ZXI A;  2J52 A;  2IO2 B;  3AEB B;  1J7C A;  1DOI A;  3CWI A;  2Y5C A;  3W5U B;  2KQS A;  3TUO A;  4IM0 A;  3T8M A;  1UWX A;  2KN5 A;  1YX6 B;  3Q3J A;  1WI0 A;  4JIO U;  3Q3N C;  1SBB B;  2KDB A;  3RD2 A;  3X0W A;  1JML A;  4DHJ B;  1HA5 A;  2NMQ A;  4HPL B;  1JWU D;  1Z2M A;  2DNF A;  2JF5 A;  1GB1 A;  1FFU A;  4WWP A;  1WGG A;  4WJP A;  1D5X C;  4TQ0 A;  4M00 A;  1NYQ A;  4LJP B;  2AQ2 B;  3UQB A;  2RMM A;  3IT4 B;  1WY8 A;  2DYO A;  4GDL A;  1KLU D;  2OOB B;  4HKZ E;  2CU3 A;  4RF1 A;  2SEB D;  2ZEQ A;  1WE6 A;  1IGD A;  1P0R A;  3ZLZ A;  3NUH B;  3NZ3 A;  4WAA A;  4FJV B;  3DVN V;  2V4L A;  3AE2 B;  1WX8 A;  2QHO A;  4A55 A;  3N3K B;  4BVU C;  3DHI C;  4XWT A;  3V05 A;  1AW7 A;  4ACF A;  2WXO A;  5EE1 A;  3T9L A;  4XE0 A;  1Q1O A;  2KLC A;  2W3R A;  3X23 A;  3I57 A;  3AEE B;  1MI0 A;  4MEM A;  3ZNZ B;  2J0M A;  3B2G A;  1N62 A;  1EUV B;  2N9E B;  2PE9 A;  3PPA A;  2INN E;  3ZGZ A;  3A9J B;  3QJZ A;  3DPD A;  3GS2 A;  4EZL A;  2XK5 A;  3DBR I;  2KX0 A;  4MH8 A;  2CKH B;  4QAY A;  4DQO C;  4RNA A;  1C79 A;  4J3O D;  3PLU A;  1SEB D;  3AXC A;  1LQB A;  2GBM A;  1J7B A;  2CHZ A;  3WAN A;  5L83 A;  2W55 A;  4US9 A;  1R7S A;  1Q0W B;  1FD6 A;  2BS2 B;  3RNA C;  1FCL A;  1XCQ L;  2YVC A;  1E6E B;  3AN1 A;  2LGD A;  1IGC A;  3B08 A;  1TS5 A;  3ZO5 B;  1BXT A;  5D6J B;  1WR1 A;  2MW5 A;  3VR8 B;  3APF A;  4BAX A;  1FNU A;  4L23 A;  2WYQ A;  2MJ3 A;  1J8C A;  2WU2 B;  3U30 A;  4FUL A;  1Z5S B;  2KDE B;  4E3C A;  3I5J C;  1M94 A;  3C0R B;  4MGK E;  4HDO A;  3AE6 B;  3TEX A;  2IDY A;  4K7U A;  1FRD A;  3VR9 B;  3HHM A;  2DZM A;  1V1O A;  1UGJ A;  1E10 A;  1TZ1 A;  1IUE A;  4NPN A;  1H8C A;  3AE9 B;  1NEK B;  3VQI A;  3GE3 C;  1ISN A;  3TMP B;  4MT5 A;  2MLB A;  3VHT C;  2FE8 A;  1C3T A;  4BFR A;  1AWD A;  3BII D;  3KVF B;  4RMA A;  2LHE A;  5D3I B;  1KLV A;  4MEL A;  1ENF A;  1L6U A;  2KMM A;  2ZPY A;  5LNK 1;  4HLE A;  3QK0 A;  4DHJ D;  4JWU C;  3ZYY X;  5HG2 A;  4A3P A;  5IKC M;  1PDX A;  3DBL I;  3B9J A;  4GDL B;  3KWV A;  1E8Y A;  2KD0 A;  3A9K B;  4KZC A;  1NBF C;  1C4C A;  1P3Q U;  3P4R B;  1I35 A;  4LNI A;  5E6O A;  4FHK A;  2LHD A;  4LJO B;  4A8X C;  3P2B A;  5J18 A;  1OFF A;  4IKG A;  3QA8 A;  2Z0D B;  3AE1 B;  2IO3 B;  4MJS B;  1L5P A;  5KHO A;  1FIQ A;  3RT3 B;  4NNJ B;  4S17 A;  2KTR A;  5FR3 A;  2NTT A;  3U4E G;  1WJ6 A;  3TEW A;  4NAM A;  2V0G A;  1V1P A;  3AM9 A;  1L4Z B;  1H4R A;  5HI1 A;  2WGS A;  5J17 A;  3RNE C;  4M01 A;  2WX1 A;  3HIZ A;  2KQ7 A;  2VZK B;  3JSV A;  3V62 A;  2WXK A;  3VH4 B;  2LFI A;  1XF5 L;  3V6C B;  1XLP A;  3I3T B;  4W9F A;  3L17 A;  3VFK A;  1OGW A;  1C78 A;  3PS6 A;  3E9S A;  1S3S G;  1STE A;  2LRU A;  5HFY A;  2Z0E B;  3AH7 A;  2IY0 B;  4PS3 A;  4AJW A;  1GAQ B;  1CJE A;  1XLQ A;  1D5Z C;  3A1Q A;  4IWQ A;  2WP9 B;  4EE2 A;  3BVG A;  4P1B C;  2PPH A;  4GDK A;  2NR2 A;  1SJE D;  1PUT A;  3GZN I;  5J2R A;  4WJN A;  2FUG 1;  3E56 A;  4DXA B;  3PV1 A;  2K3U A;  4OZB A;  4BOZ B;  2XEW A;  1WX9 A;  3R2I A;  2LI5 A;  4TMA B;  4KX6 B;  3ZDM C;  5G5G A;  2DAJ A;  1SE9 A;  2LJ5 A;  4EZK A;  3VAW A;  3ZUN A;  2R61 A;  4W9J A;  3SFD B;  2NPT B;  3KUC B;  4LDT B;  2BF8 B;  5BMH A;  5EDS A;  3W1S C;  4ANV A;  1JWB D;  2BBC A;  2D3C A;  3UGB B;  3WCQ A;  1P98 A;  4B0E A;  4TSS A;  1EF1 A;  1WXV A;  2HTH A;  2FIF A;  4OVU A;  2C7H A;  1G6J A;  2QCZ A;  3B0A A;  2J53 A;  3QHT A;  4TV3 A;  4G11 A;  3Q3O C;  3ZRF A;  4ARI A;  1FNV A;  2HD5 B;  3NS8 A;  3PZ8 A;  1E8W A;  3ZKJ C;  4WWM A;  4M8N A;  3AE7 B;  3A33 B;  4USA A;  2OJW A;  1WH3 A;  4C56 C;  1D3Z A;  4WWO A;  4URK A;  2KX3 A;  3RUI B;  1FXT B;  2JU6 X;  1I4G A;  1N61 A;  2DYM A;  1JCK B;  1UGM A;  3I63 C;  3SHQ A;  3CSF A;  3N1Y C;  4MGY E;  3P42 A;  4NAW A;  4PS8 A;  2IND C;  1UD7 A;  1CMX B;  3A4R A;  2DEN B;  3K9P B;  4MDK E;  2VH1 A;  2V3S A;  3DWG C;  3R7Q A;  1WM3 A;  2PTL A;  1DGJ A;  2LRW A;  2BKR B;  1KM7 A;  2IYD B;  3IVF A;  3BY4 B;  2D3A A;  1BT0 A;  4PYU A;  1TIF A;  2ASQ A;  2NBU A;  4P6V F;  1HE8 A;  2H89 B;  1T6B X;  4W9C A;  1E0Z A;  3T3O A;  4HKQ A;  1E8Z A;  2BYF A;  3Q8C A;  4M0W A;  2KTR B;  4KGT A;  5IAA C;  2V3P A;  3W1Y A;  3ZJU A;  1OEY A;  1V1P B;  2L7R A;  3MHS D;  4KZ0 A;  2NTS A;  2KC2 A;  3DBS A;  1TTN A;  3DVG Y;  5IOI A;  3JSV B;  2E6X A;  4GLS C;  2YLM A;  2KAC A;  4C7Z A;  2I38 A;  2MA9 B;  2M56 B;  2WXH A;  3RZF A;  2C9W B;  1QZE A;  4IM2 A;  4ZYN A;  4E74 A;  4A3O A;  3CF6 E;  2BVC A;  3A1Q B;  4HCN B;  2LGY A;  4K7S A;  2K8B A;  3KYD D;  1WRD B;  4IWP A;  3N1X C;  2GRI A;  4ZRI A;  4GDK B;  1VCB A;  3IFW B;  2JT4 B;  2KNB A;  2JQR B;  1A5R A;  3VXW A;  1F2R I;  1CQV A;  4WQM A;  5H8Y E;  4I6L B;  3QQ8 B;  2BS3 B;  3OJ3 A;  4KKI A;  3O65 B;  5CHF A;  4AUQ C;  2RGF A;  3HRD D;  4YWG G;  4ZRP A;  2CJO A;  4D2K A;  3TBL D;  3RMK C;  1T0Q C;  4DXG A;  3AEA B;  3AMZ A;  1P7E A;  2AL6 A;  4II3 B;  2GBN A;  1JRU A;  2BT6 A;  5L95 C;  2K8H A;  3TEZ A;  1GG3 A;  1C9F A;  3JVZ X;  3MC9 A;  4W9D A;  2QSD A;  4BKS A;  4YXD B;  2G4S A;  3QWZ B;  4FJY A;  1MVK A;  2EKE C;  2JY6 A;  4I6P A;  3SFE B;  2PJH A;  2WXG A;  1UUP A;  2M19 A;  3R3M A;  3ZJT A;  2BQQ A;  2Z8L A;  4ZOH C;  2INP E;  3ZRC A;  1ZW7 A;  2FUH B;  2X8X X;  2KFJ A;  2J7Q B;  2FCN A;  4W9G A;  5D3D A;  3UIN B;  2XN9 C;  2L0F A;  3RUL A;  3VTV A;  1YOV B;  3AU4 A;  3PT2 B;  3L16 A;  3PRM B;  3RFZ B;  1SB3 C;  2I1J A;  3RNC C;  4NAW B;  3UQA A;  3HVZ A;  2EMT A;  2KFK A;  2MBE A;  1KLG D;  1SIF A;  1VDV A;  5FK9 C;  3IXS A;  1K8R B;  1TBE A;  3Q8F A;  2PEA A;  4HDQ A;  4G0N B;  2JX5 A;  4CYE A;  3V61 A;  1OEY J;  3BVM A;  1ET6 A;  2IPK D;  2TSS A;  3MFG A;  4YTP B;  5JHA A;  1J7A A;  1JWS D;  3DVG X;  1V49 A;  1TYG B;  2VH2 A;  1FFV A;  3EEC A;  5KHQ A;  3L13 A;  4YL8 A;  1R4M B;  2PE6 B;  3ZVV A;  3SU8 X;  2CHW A;  4M0W B;  4RM9 A;  2X38 A;  4OZA A;  5FKA C;  1E7U A;  1V80 A;  1TY0 A;  3P63 A;  3PSE B;  3GP7 A;  2BS4 B;  2G45 B;  3PHW B;  2KOX A;  3NVY A;  4LNO A;  3MJW A;  1C4A A;  2BB6 A;  1OQY A;  5H92 C;  3ZNH B;  4M8M A;  4P16 A;  3Q2A C;  2MBB B;  2KQ4 X;  4CHK A;  3BVZ A;  1IBX A;  2M17 A;  2GI9 A;  3ZIM A;  3OG5 A;  1AN8 A;  3WAL A;  2O6V A;  2KWC A;  3NVW A;  4ANW A;  2EMS A;  5IA7 A;  1D6E C;  3FIL B;  1GC7 A;  2K6Q A;  4FHJ A;  2ZW0 A;  2N9K A;  1WJN A;  3NZS A;  2LVP A;  3V3X A;  2ZPN A;  3I9V 1;  2WLB A;  5AZG A;  1WM2 A;  1WGK A;  4HPP A;  3HM3 A;  2JZZ A;  1ZGU B;  4S0R A;  4GXB A;  4N6E B;  5BO4 B;  3VH3 B;  1YQ4 B;  2BYV E;  1LM8 B;  4AJY B;  1GC6 A;  2UYZ B;  2KHW B;  2JRI B;  4GMV A;  1JQ4 A;  4X57 B;  2KDM A;  2QIL A;  2KTF A;  1VRA B;  5AUI A;  1K51 A;  3W1S A;  4ZRQ A;  4C7Y A;  2C60 A;  2FNJ B;  1T5X D;  2FBW B;  2JZP A;  2GBR A;  3PGE A;  1V5T A;  1L4D B;  4XX5 A;  3N1Z C;  4ICU A;  4NJ7 A;  4WAF A;  1SE4 A;  2PMV A;  1SF0 A;  1V5O A;  1PGX A;  1ZE3 D;  1HEZ E;  1M4V A;  3BK2 A;  3PHX B;  2ONQ A;  2G3Q B;  3IAS 1;  3RYT A;  3OLM D;  2IO1 B;  3C19 A;  1F2R C;  4ZDV A;  4OW0 A;  3MHZ A;  2Z59 B;  1E9M A;  4HPM B;  3AU5 A;  3N30 A;  2K1F A; 
#chains in the Genus database with same CATH homology
 2C5L C;  3LDZ E;  3H6N A;  3QAR A;  2PPH A;  4GDK A;  1V86 A;  4N9F 4;  4KVG B;  2NR2 A;  3VUX A;  4HCP B;  3U8Z A;  1NDD A;  2MX2 A;  2MP2 B;  3NOB A;  3A4S C;  2N9P C;  3ENE A;  3GZN I;  5J2R A;  4WJN A;  2LZ6 A;  5DPR A;  4DXA B;  4A20 A;  3PV1 A;  2RR9 A;  2D10 A;  5LXI B;  1WZ3 A;  2XEW A;  1WX9 A;  1XQQ A;  1Y8R C;  4BBN C;  4BOZ B;  2LI5 A;  3KUZ A;  2C7N B;  4F1S A;  1S1Q B;  4MSM B;  4F8C B;  2LD9 A;  2M0X A;  5E6N A;  3KUD B;  4NQL B;  4ZRJ A;  2B3A A;  3ZDM C;  5E6P A;  2M8S A;  3V6E B;  2DAJ A;  4DHZ B;  2KKC A;  1SE9 A;  1SGH A;  2LJ5 A;  3B1L X;  4XZ4 A;  2JVC A;  4EZK A;  3VAW A;  2N1V A;  3VUY A;  1V81 A;  2LXA A;  3ZUN A;  2K39 A;  4W9J A;  1WF9 A;  2K6D B;  3NY5 A;  2NPT B;  2RSU A;  3KUC B;  1LXD A;  3ZDT A;  3WIM A;  4LDT B;  4DDI D;  2A4Z A;  2BF8 B;  5EDS A;  2L8J A;  3W1S C;  3OAW A;  1E8X A;  2L0T A;  2V1Y A;  3RZW C;  3ML8 A;  4ANV A;  2R2Q A;  3A9K A;  1WZ0 A;  1GJZ A;  3UGB B;  4CO7 A;  1P98 A;  2RD0 A;  1YX5 B;  4KDI C;  2KVR A;  1EF1 A;  1YD8 U;  1WXV A;  2KDF B;  3DDC B;  4IG7 B;  2HTH A;  2FIF A;  5JH5 C;  4OVU A;  2C7H A;  1G6J A;  3B0A A;  3QHT A;  4TV3 A;  4G11 A;  2KC1 A;  4MM3 A;  4MJS A;  2MBQ A;  3ZRF A;  3R7R A;  3M62 B;  2HD5 B;  3L08 A;  3NS8 A;  1VD2 A;  1E8W A;  3ZKJ C;  4M8N A;  1RAX A;  5LXH A;  3UIP B;  3SD5 A;  3DCG A;  3A33 B;  3PVL A;  5D2M B;  3QC8 B;  1WJ4 A;  3WAO A;  4EKU A;  4BKG A;  2MRP A;  2MBO A;  3EHV A;  1GNU A;  3V60 A;  4ASW C;  4NJ6 A;  2D2Q A;  1AAR A;  2IBI B;  2LVO A;  3BIN A;  1WH3 A;  2MWS B;  4DDG D;  1D3Z A;  1RRB A;  2LUE A;  3VVW B;  4HJK A;  4WWO A;  4URK A;  4IM3 A;  2JRH A;  5AEK B;  2KX3 A;  2ZZP B;  3ZNG C;  1J0G A;  3RUI B;  4F7Z A;  1FXT B;  4K81 A;  3ZTC A;  4KSK C;  2DYM A;  1UGM A;  4LDT D;  3H1U A;  3ZW3 A;  4GB9 A;  3SDL C;  2KJ6 A;  2N4F A;  3SHQ A;  3CSF A;  4MGY E;  1PQS A;  1UH6 A;  4NAW A;  4PS8 A;  2O6V B;  1UD7 A;  1CMX B;  2BWE S;  3ZTD A;  3A4R A;  1WGH A;  2DEN B;  1Q5W B;  3K9P B;  4MDK E;  3H7P A;  2V3S A;  1RFA A;  4AP4 C;  2GOW A;  3R7Q A;  2JUO A;  1WGD A;  2C7M B;  3JYU A;  1P9D U;  1WM3 A;  2AYO B;  4KIK A;  4B6W A;  3CMM B;  2KJR A;  2AWT A;  4MGZ E;  2LRW A;  2BKR B;  1UBQ A;  2LGX A;  1KM7 A;  2IYD B;  1WXS A;  1WXM A;  2G4D B;  3IVF A;  4WWN A;  2O2V B;  3BY4 B;  5HKH A;  1BT0 A;  2DX5 B;  4W9K A;  1KOT A;  4PYU A;  2BGF A;  1UZX B;  2ASQ A;  2NBU A;  3R66 C;  5JZE B;  1HE8 A;  2N1W A;  4HK2 A;  4BOS C;  4W9C A;  1IP9 A;  1EO6 A;  1E8Z A;  1C1Y B;  2BYF A;  4WJO A;  3M3J A;  1ZKH A;  3NZU A;  2KTR B;  2XK5 B;  3K9O B;  2LWP A;  1UBI A;  2W9N A;  5IAA C;  4TUU A;  3RCZ A;  4JQW C;  3W1Y A;  1OEY A;  4AOF A;  2LAS A;  5LLI A;  1WMH A;  1WYW B;  2L7R A;  3HK0 A;  2GBK A;  3MHS D;  1RLF A;  2N9X A;  3L54 A;  4KZ0 A;  2BKF A;  2D3G A;  2JZ3 B;  3TJP A;  2DZI A;  5AZF A;  1NI2 A;  2DAF A;  2IO2 B;  4DBG A;  3QCA A;  5DPW A;  2KC2 A;  3DBS A;  1TTN A;  3DVG Y;  3VTU A;  4G50 A;  3DBH I;  4EOY A;  4BKS D;  2KQS A;  2FCM A;  1E90 A;  3JSV B;  4IM0 A;  3T8M A;  1IYF A;  1GUA B;  2YLM A;  2KN5 A;  1YX6 B;  2KFK B;  2J0J A;  3D32 A;  2NPT A;  1WI0 A;  3Q3J A;  4JIO U;  5GMV A;  4W9H A;  2KDB A;  3RD2 A;  3U7D A;  3X0W A;  2MA9 B;  4JL9 A;  4B95 A;  4DHJ B;  4HPL B;  1Z2M A;  2JF5 A;  2KAN A;  3RZF A;  2C9W B;  4WWP A;  1QZE A;  4W9L A;  5G2N A;  1WGG A;  4IM2 A;  4WJP A;  4TQ0 A;  4ZYN A;  3OJ4 B;  4E74 A;  4A3O A;  4KSL C;  3CF6 E;  5DPS A;  4LJP B;  3QX1 A;  2ZVN A;  3EC8 A;  3UQB A;  3A1Q B;  2ZCB A;  4HCN B;  2K8C A;  2LGY A;  4K7S A;  3M95 A;  2K8B A;  3VDZ A;  3KYD D;  1WRD B;  1WY8 A;  2DYO A;  4IWP A;  4GDL A;  3UF8 A;  5CTR C;  3JW0 X;  3KH0 A;  2M1M A;  2OOB B;  4ZRI A;  4HWI B;  4GDK B;  2ZEQ A;  3ZNI D;  2BPS A;  1WE6 A;  2ZNV B;  1VCB A;  1P0R A;  1E5W A;  3ZLZ A;  5FR6 A;  1WE7 A;  4IWO A;  3QIJ A;  3DVN U;  4WAA A;  3IFW B;  2JT4 B;  2KNB A;  2I1K A;  1I42 A;  4FJV B;  1A5R A;  3VXW A;  3M63 B;  3DVN V;  1V6E A;  2V4L A;  1X1M A;  4I6L B;  3QQ8 B;  4IC7 B;  3OJ3 A;  2Y5B B;  1WX8 A;  5CHF A;  3O65 B;  4AUQ C;  2QHO A;  1WIA A;  2RGF A;  1UEL A;  3N3K B;  4BVU C;  4AWJ A;  4KDL B;  3TBL D;  4DWF A;  4GU2 A;  5D94 A;  3KYC D;  4FLH A;  2M4N A;  3ML9 A;  3TL5 A;  3T9L A;  1Q1O A;  4FAD A;  2AL6 A;  2GBN A;  1JRU A;  2KLC A;  4II3 B;  5L95 C;  1WJU A;  2K8H A;  2KLG A;  2KWV B;  4PYZ A;  2DHZ A;  1GG3 A;  4TQ1 A;  3TIX A;  3JVZ X;  4W9D A;  1XD3 B;  4BKS A;  3X23 A;  5C23 A;  2G4S A;  4DK5 A;  4FA6 A;  3MTN B;  3QWZ B;  4FJY A;  2EKE C;  1V2Y A;  2JY6 A;  4I6P A;  2DZJ A;  2PJH A;  2KMA A;  3PRE A;  4MEM A;  2OJR A;  4XC2 A;  3ZNZ B;  2J0M A;  2WWZ A;  3R3M A;  1EUV B;  2N9E B;  2PE9 A;  4II2 B;  4GOC A;  1WX7 A;  3ZRC A;  1ZW7 A;  3PPA A;  4LCD E;  2FUH B;  4KV2 A;  3A9J B;  3QJZ A;  2KK8 A;  3DPD A;  2A5U A;  2AL3 A;  2LVQ A;  2GMI C;  4MGI E;  4EZL A;  2KFJ A;  1F9J A;  2XK5 A;  3DBR I;  2J7Q B;  2RPQ A;  2KX0 A;  3AUL A;  2HE7 A;  1TGZ B;  3HM6 X;  4JGH B;  2CKH B;  2KJH B;  2FCN A;  4W9G A;  3UIN B;  3PLU A;  2L0F A;  3RUL A;  2L3Z A;  3VTV A;  1J19 A;  1L7Y A;  2GBJ A;  3AXC A;  3AU4 A;  1LQB A;  4EEW A;  5D7G A;  2GBM A;  1R4M I;  3PT2 B;  3TCA A;  2MP2 A;  2KO3 A;  3H7S A;  2CHZ A;  3WAN A;  5L83 A;  3L16 A;  3PRM B;  1Q0W B;  4IUM B;  2I1J A;  4GN1 A;  5DPT A;  4NAW B;  5CHW A;  3UQA A;  2EMT A;  2KFK A;  2MBE A;  1LFD A;  1SIF A;  1T0Y A;  2CHX A;  1K8R B;  3H7P B;  2YVC A;  2R2O A;  4W9E A;  2LGD A;  1TBE A;  2O6V D;  3B08 A;  2MBH A;  2IZV B;  1E7V A;  1WFY A;  2PEA A;  1WGR A;  4HDQ A;  4KIK B;  3ZO5 B;  4RM8 A;  4G0N B;  4CYE A;  3V61 A;  1OEY J;  2BYE A;  4ANX A;  2D07 B;  5D6J B;  1WR1 A;  2KMC A;  4E71 A;  2MW5 A;  2WX0 A;  5JHA A;  3APF A;  4NY0 A;  2N7E A;  3DQV A;  3IBE A;  3DVG X;  5G55 A;  1WXA A;  4I6N B;  3AI5 A;  1V49 A;  3CST A;  2WYQ A;  4J6I A;  3APC A;  1J8C A;  3EEC A;  1KJT A;  3PRZ A;  5KHQ A;  3DOW A;  3L13 A;  2MSE D;  3PLV A;  4YL8 A;  2ZCC A;  3U30 A;  4FUL A;  2PE6 B;  1Z5S B;  4B9K A;  2LXC A;  3ZVV A;  3SU8 X;  4HXD A;  2JXX A;  4ZRK A;  4GGQ A;  2KDE B;  2CHW A;  4E3C A;  3IHP C;  2CU1 A;  1M94 A;  3C0R B;  4M0W B;  4HDO A;  4MGK E;  4RM9 A;  1E7U A;  1V80 A;  2JPH A;  4FJZ A;  3PSE B;  4K7U A;  1YJ1 A;  2G45 B;  3PHW B;  1WMH B;  2NVU I;  2NBW B;  3HHM A;  3NHE B;  2DZM A;  2KOX A;  3WAP A;  2MQJ A;  4K7W A;  3PZD A;  4FBJ B;  1TZ1 A;  1WR6 E;  3MJW A;  4K1R B;  4NPN A;  2KZR A;  1H8C A;  1P1A A;  3VQI A;  1EF5 A;  2HJ8 A;  2XBB C;  4MSQ B;  1ISN A;  2DZK A;  3TMP B;  3GOE A;  1OQY A;  5DCN A;  4BKT A;  3ZNH B;  4M8M A;  4WJQ A;  4EZJ A;  5C1Z A;  2MLB A;  2K25 A;  3L10 B;  3VHT C;  4PS7 A;  2FCQ A;  1C3T A;  2MBB B;  4BFR A;  2IO0 B;  2IY1 B;  3KVF B;  4RMA A;  4NQK E;  1KLV A;  4CHK A;  2NCN A;  2UWQ A;  4MEL A;  2WDT B;  2M17 A;  3UIO B;  4BBN F;  2ZPY A;  3ZIM A;  4HLE A;  3QK0 A;  3WA0 A;  4DHJ D;  2DYB A;  2FAZ A;  2VRR B;  1WGY A;  2KWU B;  1L2N A;  4G3X B;  3WAL A;  2JWZ A;  2O6V A;  2KWC A;  3QAQ A;  4ICV A;  5JHB A;  4A3P A;  4ANW A;  2EMS A;  5IA7 A;  4ANU A;  1GC7 A;  2N7D A;  3DBL I;  3WAM A;  2K6Q A;  4FHJ A;  4GDL B;  3A9J A;  4W9I A;  3IG3 A;  2MCN B;  1E8Y A;  2KD0 A;  3A9K B;  3VTW A;  4P7I A;  1WJN A;  4IW0 A;  4KZC A;  1NBF C;  2D11 A;  1P3Q U;  2KDI A;  2LVP A;  3NZS A;  1I35 A;  3LJ3 A;  2O2V A;  4FHK A;  5E6O A;  4LJO B;  3VUW A;  3P2B A;  3S2A A;  2ZPN A;  5J18 A;  2AEH A;  3QA8 A;  4JLC A;  2L00 B;  2L76 A;  2Z0D B;  2IO3 B;  5AZG A;  1WM2 A;  5TR5 A;  4MJS B;  1YIW A;  3HM3 A;  2JZZ A;  5KHO A;  1ZGU B;  3PTF C;  2L05 A;  2ZNV C;  4GXB A;  5BO4 B;  3RT3 B;  1R4N I;  4NNJ B;  3L0W B;  3VH3 B;  2KTR A;  4DHZ E;  2BYV E;  4OVV A;  1LM8 B;  4FN2 A;  1GC6 A;  1WJ6 A;  4AJY B;  4EFO A;  2UYZ B;  1YQB A;  5CHV C;  2KHW B;  4EUT A;  1V9J A;  2JRI B;  4MH0 E;  4GMV A;  2J0K A;  4X57 B;  1OTR B;  2KTF A;  2FCS A;  1H4R A;  5J17 A;  1IPG A;  2WX1 A;  3W1S A;  3ECI A;  3ONS A;  2C60 A;  2REX A;  2ZVO A;  3APD A;  1MG8 A;  2FNJ B;  3H9D A;  3HIZ A;  2KQ7 A;  3EFU A;  3JSV A;  1XT9 B;  2GBR A;  2NBV B;  5AZH A;  3PGE A;  3V62 A;  1V5T A;  4HVB A;  2FID A;  4XX5 A;  3VH4 B;  3ALB A;  2KXJ A;  3PRP B;  4ICU A;  4NJ7 A;  4TKN A;  4GSW A;  3V6C B;  3I3T B;  4W9F A;  1V5O A;  1U4A A;  3L17 A;  3VFK A;  1OGW A;  2ZJD A;  3PHX B;  3PS6 A;  2G3Q B;  2CS4 A;  1S3S G;  5CX3 A;  3RYT A;  3OLM D;  2IO1 B;  2LRU A;  3KW5 B;  2Z0E B;  2NS5 A;  4WQO B;  2CR5 A;  2IY0 B;  4PS3 A;  4AJW A;  4ZDV A;  3Q3F A;  3N32 A;  2BWF A;  3A1Q A;  2Z59 B;  4IWQ A;  4HPM B;  3AU5 A;  4GIV A;  3N30 A;  2K1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...