4MJSB

Crystal structure of a pb1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
82
Chain Sequence
LTVKAYLLDAAREIRRFSFCPGPCERLLSRVAALFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C zeta type
publication title Structural and biochemical insights into the homotypic PB1-PB1 complex between PKC zeta and p62
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/protein binding
total genus 21
structure length 82
sequence length 99
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4mjsB00
4GU2A 1WE7A 2DZIA 2D07B 4NNJB 2MBQA 2KD0A 3IHPC 3W1SC 4EOYA 1C1YB 3U8ZA 2LRWA 3H7SA 3EFUA 1GNUA 4HCPB 2KX0A 2YLMA 4WQOB 3U30A 2BWFA 3SHQA 4ZRKA 5GMVA 5BO4B 1KJTA 1OQYA 2LZ6A 2CHWA 2MWSB 3A33B 4PYUA 5L83A 2WDTB 5J17A 2VRRB 1EF1A 3JVZX 1OEYA 3L16A 3APFA 2JRIB 2MSED 3VH3B 1Z2MA 3ZRFA 4BKTA 3R3MA 5D2MB 3QK0A 1WE6A 4K1RB 3UIOB 2MBBB 2RGFA 2KOXA 2DZMA 3UIPB 2GBRA 3NZSA 1UBIA 3KVFB 3PS6A 4IWQA 1SGHA 4FN2A 2K25A 3ONSA 5C1ZA 1RLFA 3QAQA 4ANXA 3VHTC 2MQJA 2I1KA 3KUDB 3DCGA 1TGZB 1LQBA 2I1JA 2HJ8A 3DVGY 2REXA 4ANWA 1FXTB 3RULA 2N1WA 1XQQA 3A9KB 3PSEB 4ICVA 2Z0DB 4WWOA 4W9HA 3B1LX 3ML9A 4GB9A 2ZEQA 1Q0WB 3C0RB 3ML8A 4HCNB 3VDZA 4BOZB 3K9PB 4MEMA 4FADA 4XX5A 5AZGA 3NOBA 3A4RA 2L0TA 3VH4B 3VXWA 2N9EB 1IPGA 2ASQA 4W9GA 1U4AA 2KDEB 2DENB 3VTWA 4II3B 2MX2A 3DVNV 3QA8A 1BT0A 4N9F4 4ICUA 1KLVA 4IM0A 4MJSB 2MP2B 1YX5B 2D10A 2BYFA 4KSLC 4E74A 3Q3FA 1WX8A 3B0AA 2R2OA 1WGHA 2GOWA 2KWUB 4KIKA 4KDLB 2FNJB 4MGKE 3ZIMA 2ZJDA 3ZNID 4E3CA 3TL5A 1WMHA 1WM3A 2N7DA 1WXVA 4LCDE 4AP4C 1V80A 3R7RA 1EF5A 2KQ7A 2L7RA 4A3OA 4AWJA 2AEHA 3A9JA 3SD5A 2NPTA 2WWZA 2XEWA 4G11A 1TBEA 5AZHA 1LFDA 1IYFA 3X23A 1YD8U 2C5LC 4TQ1A 5LXIB 4URKA 5CHVC 5CTRC 5C23A 1TZ1A 1WGRA 2J0JA 3DBHI 1R4MI 2BKFA 2O2VB 4LJOB 4PS8A 5G2NA 3ZO5B 1TTNA 2XK5A 4AJWA 3RCZA 2KFJA 2LGXA 3VQIA 1WX7A 2FCSA 3HHMA 1YQBA 2IY1B 4K7WA 2J0KA 4FHJA 3MHSD 2PJHA 2JF5A 3DBRI 4OVUA 3R7QA 3H7PB 3BINA 1T0YA 3WALA 3PV1A 3WAPA 3JW0X 3AU5A 3ZKJC 1R4NI 2RSUA 2DAFA 2GBMA 3DBLI 3S2AA 3BY4B 2CHZA 2N7EA 2MBOA 1P98A 4ANVA 2KTRB 4MDKE 4KZ0A 2HE7A 3W1YA 2KFKB 2AL6A 3H9DA 4M8NA 2LASA 4B6WA 4W9FA 4B95A 2GBKA 1WXAA 1GUAB 2MRPA 3K9OB 4GIVA 4MSMB 4II2B 1OTRB 1ZGUB 4TKNA 3T8MA 1V49A 1RRBA 4JLCA 2M0XA 1L7YA 3HM6X 2LXCA 3VTVA 3ZTCA 5AEKB 1WXMA 3WA0A 2AYOB 3H6NA 1WY8A 2ZPNA 2FIDA 4GDLA 3ZLZA 4EZKA 2FUHB 1J19A 2KKCA 3PHXB 1J8CA 5AZFA 4MGYE 1IP9A 3OAWA 3JSVA 4ANUA 3UQAA 5L95C 2LUEA 3NHEB 4EZJA 3IBEA 4G0NB 3KW5B 2DZKA 4LDTB 1UGMA 2JUOA 4KVGB 3PRMB 1ZW7A 2O6VD 1RAXA 4W9LA 1V2YA 1NBFC 2M17A 3IVFA 3ZNZB 5J18A 1I35A 2N9XA 1NDDA 2PPHA 4BFRA 2GBNA 3VUWA 2NBUA 2DYMA 1LM8B 1OGWA 3ZTDA 2KMAA 4GOCA 2DHZA 2DYBA 2KJHB 2AL3A 5DPRA 3KYCD 3QQ8B 3TCAA 2KX3A 2DZJA 1V5OA 2UYZB 3P2BA 2C9WB 2K8BA 2DAJA 3AU4A 3V62A 3JYUA 2EKEC 5IAAC 3OJ3A 2FCQA 2M4NA 3KUZA 3WANA 1WJ6A 2KJ6A 2JY6A 2L00B 4JIOU 4FBJB 3HM3A 2IYDB 2LI5A 5TR5A 2D11A 3NZUA 5DCNA 2J0MA 2ZNVC 1UH6A 3ALBA 3ECIA 4IM3A 1UELA 2NVUI 4BKGA 4M0WB 2K6QA 1WZ0A 1OEYJ 3ZDTA 3PRZA 4KV2A 3QIJA 4NAWA 4G3XB 3MJWA 5CHFA 3TJPA 4BBNF 2G4DB 2MLBA 2BWES 3PTFC 4DHZE 1V5TA 4GDKA 2IO2B 2A5UA 5JZEB 2C7NB 4FJZA 4LJPB 3V60A 4WWPA 1SIFA 2JZ3B 3VAWA 1E8ZA 2ZCBA 4NPNA 4LDTD 4DDGD 4MGZE 2KMCA 1WGDA 4IUMB 3V61A 4DDID 1WR6E 3V6CB 3DQVA 1WM2A 4HK2A 3UINB 4TQ0A 5LLIA 2BF8B 4KIKB 3IG3A 3DDCB 2DYOA 2KDFB 2K1FA 4CYEA 2QHOA 4IW0A 1M94A 2J7QB 4KSKC 4CO7A 5DPWA 1V9JA 1WMHB 3PLVA 3U7DA 3TBLD 1WYWB 2A4ZA 2LJ5A 3L54A 2C60A 2ZCCA 4XZ4A 2MP2A 3D32A 3RYTA 3A9JB 4A3PA 2NPTB 2BGFA 1J0GA 2GBJA 2K8HA 1KM7A 1WFYA 3VUXA 2MBHA 4WAAA 2NBVB 5IA7A 5EDSA 3UQBA 1H8CA 4HPMB 1I42A 2BPSA 1WXSA 2XK5B 3M62B 1GG3A 3ZNGC 3PT2B 1E8YA 4B9KA 1CMXB 3QX1A 1G6JA 1F9JA 3SU8X 3DPDA 1GC7A 2LGDA 4MM3A 2O6VA 2N4FA 2ZPYA 1UZXB 4FA6A 3O65B 3RD2A 4F8CB 5E6PA 4RM9A 3R66C 1WR1A 3ZRCA 2LWPA 1WJUA 1H4RA 4XC2A 4ZRJA 4HLEA 5DPTA 5HKHA 3UGBB 2G45B 1YIWA 1ISNA 3I3TB 2R2QA 2HTHA 3QC8B 2IBIB 4K81A 4EKUA 2LVQA 3L10B 2IO1B 2KK8A 1XD3B 5D94A 3AXCA 4NY0A 2V3SA 3KUCB 2LGYA 3DVGX 3ENEA 3PRPB 2XBBC 4WJQA 1V6EA 2KTFA 2L8JA 3QARA 4GXBA 1K8RB 5E6NA 3SDLC 3WIMA 5KHQA 3AI5A 1JRUA 4KZCA 1C3TA 4GDLB 4DBGA 3L17A 3L08A 1SE9A 2NR2A 2KTRA 2Y5BB 3HK0A 4WWNA 2ZVNA 3ZUNA 1PQSA 3N32A 2KLGA 2L0FA 2M8SA 3JSVB 2KXJA 4CHKA 4ZYNA 3ZVVA 4EUTA 3QWZB 2MCNB 5J2RA 4W9CA 2FIFA 2PEAA 2OOBB 3A1QA 4DHJB 3APCA 1WF9A 2RD0A 4PS7A 2G4SA 2JWZA 4ZRIA 1Z5SB 3DBSA 4ZDVA 4NQKE 4FHKA 2Z59B 3PPAA 1E5WA 3L13A 4AJYB 3PHWB 4JL9A 1E7VA 2G3QB 3AULA 4AOFA 1QZEA 1WJNA 4EFOA 5FR6A 4PS3A 3TIXA 2PE6B 5G55A 3H1UA 3X0WA 3VVWB 2KDIA 4IM2A 2IZVB 1V86A 1VD2A 4FJVB 2LVPA 4GGQA 4DK5A 3RZWC 4HDQA 4BKSD 4F7ZA 4RMAA 2ZZPB 4J6IA 3RZFA 4G50A 2KJRA 3GOEA 1AARA 3TMPB 4EZLA 1WJ4A 3LJ3A 3EC8A 2MW5A 4P7IA 4YL8A 2JPHA 3CF6E 1E8WA 3VTUA 1P3QU 1Q1OA 3DVNU 3OLMD 4FULA 1WI0A 4I6NB 4E71A 3CMMB 2WX0A 3PLUA 2MBEA 4K7UA 4W9EA 1WH3A 4NAWB 2BYEA 3VUYA 4ASWC 2KDBA 2K39A 4MELA 2ZVOA 3M95A 5D6JB 3A4SC 4DXAB 2W9NA 2UWQA 4HPLB 1V81A 4HJKA 4M8MA 3Q3JA 2C7HA 4GDKB 2KANA 4HDOA 4HVBA 2GMIC 4FLHA 5DPSA 5D7GA 3ZW3A 4GMVA 1Y8RC 4W9IA 2KVRA 3RUIB 2HD5B 1GJZA 1E90A 4DHJD 3A9KA 2V1YA 5JH5C 3KYDD 1YJ1A 4WJOA 2JZZA 2KWCA 2NCNA 2Z0EB 4DHZB 2LD9A 4MSQB 2KHWB 3LDZE 3N3KB 4TV3A 3WAMA 2CU1A 2KN5A 3HIZA 1D3ZA 4NJ6A 2JRHA 4IWPA 1S3SG 1WGYA 3B08A 4W9DA 2BYVE 2C7MB 3NY5A 2FCNA 4I6PA 4KDIC 3VFKA 2L3ZA 1L2NA 2EMTA 5JHBA 2D3GA 4FJYA 3EECA 4MJSA 3ZDMC 2WX1A 3QJZA 4K7SA 2FAZA 1HE8A 2RPQA 1NI2A 4F1SA 2K8CA 2RR9A 3QHTA 4IG7B 2JT4B 2K6DB 4W9KA 3WAOA 1XT9B 3CSFA 2JXXA 4RM8A 1KOTA 1Q5WB 2BKRB 4TUUA 5CHWA 1X1MA 1LXDA 2NBWB 2D2QA 2V4LA 3ZNHB 1GC6A 4NJ7A 4JQWC 2CKHB 3PVLA 2KZRA 2EMSA 2FCMA 1EUVB 2WYQA 3MTNB 2KC2A 3NS8A 5CX3A 1WGGA 1P9DU 2N9PC 2O6VB 1WRDB 4AUQC 4JGHB 1EO6A 3M63B 4MH0E 4A20A 2KO3A 2O2VA 3IFWB 4MGIE 4WJPA 4GN1A 3DOWA 3W1SA 2KWVB 3GZNI 3EHVA 3M3JA 2LVOA 2NS5A 2IY0B 3QCAA 1WZ3A 2CHXA 3PREA 3V6EB 3CSTA 1VCBA 2IO0B 4WJNA 4I6LB 1WX9A 3PGEA 3H7PA 2M1MA 1A5RA 1ZKHA 3RT3B 4BOSC 4DWFA 1E8XA 2YVCA 1MG8A 4HXDA 4BKSA 2ZNVB 4W9JA 3N30A 2CR5A 4BBNC 2KFKA 5LXHA 3UF8A 1WIAA 2LXAA 4HWIB 4IC7B 1P1AA 2L05A 2KLCA 4IWOA 1UD7A 1UBQA 2IO3B 4GSWA 3T9LA 3A1QB 2N1VA 2JVCA 2AWTA 2LRUA 4NQLB 2MA9B 2KC1A 2OJRA 3PZDA 1YX6B 2B3AA 3APDA 3KH0A 5E6OA 2L76A 2PE9A 4EEWA 1P0RA 3L0WB 3OJ4B 4OVVA 4PYZA 1S1QB 2DX5B 5JHAA 2KNBA 2KQSA 1E7UA 1RFAA 2CS4A 4X57B 4BVUC 5KHOA
chains in the Genus database with same CATH superfamily
4GU2A 1WE7A 2DZIA 2WXKA 4NNJB 4ZRPA 1C1YB 4JPSA 3H7SA 3EFUA 1GNUA 4HCPB 2KX0A 4WQOB 1STEA 1LO5D 1GOZA 2MWSB 5J17A 2VRRB 4P6VF 2FBWB 1OEYA 3JVZX 2JRIB 3VH3B 3VR9B 1VRAB 4BKTA 1WXQA 3NVZA 2KOXA 2DZMA 1UBIA 1SB3C 2FE8A 2INCC 3AV8A 4M0WA 1QOGA 2BVCA 2REXA 3GE3C 2WDRB 3ZJVA 4ICVA 3A9KB 4WWOA 5IKCM 4W9HA 3B1LX 1E7PB 3C0RB 3VDZA 3K9PB 4YSXB 2KYWA 5AZGA 3A4RA 2L0TA 3VXWA 3VTWA 1BT0A 3AE9B 4ICUA 4IM0A 4MJSB 2MP2B 2D10A 4E74A 3Q3FA 4KIKA 4KDLB 4C7YA 4L1BA 3NZ3A 4KKIA 2CJNA 3SFEB 3B2FA 3EGRA 1WXVA 4A3OA 2WWZA 1TBEA 5LXIB 2HJ1A 1TTNA 1KFYB 4LNOA 2JF5A 1MFWA 2D3CA 5BYQA 2MJDA 1TY2A 4C80A 1GB4A 3ZKJC 1TKEA 1R4NI 2RSUA 1RWSA 2CHZA 3TSSA 4KZ0A 3H9DA 4B6WA 1GUAB 4J3OD 3K9OB 4II2B 3UI3A 3DHGC 2M0XA 1L7YA 3VTVA 3ZLZA 2ZPNA 2FUHB 3PHXB 5AZFA 1IP9A 4RF1A 3OAWA 3I9V1 3UQAA 1FO4A 2LUEA 1YQ3B 3KW5B 1GB1A 4P16A 2JUOA 2QIEB 2O6VD 1NBFC 2W3SA 2M17A 5J18A 1I35A 1V1PB 2N9XA 2LUMA 2PPHA 1LM8B 1SF0A 4YWGG 1GAQB 2KMAA 4KGSA 3TEWA 2R61A 1DYQA 2LHDA 4ZOHC 4L2YA 4IKGA 3V62A 2WQYB 3N1ZC 5IAAC 3BYTB 3OJ3A 3DHHC 2FCQA 4LK0M 2M4NA 3WANA 3RNEC 4FBJB 3HM3A 5TR5A 1T0SC 2IGGA 3Q8FA 1QQRA 2ZNVC 1UELA 1D6EC 4BKGA 2K6QA 1WZ0A 1OEYJ 4D2KA 3W2DA 2K3UA 1WWTA 3AEEB 2I38A 2JZPA 2VH2A 2GRIA 4DHZE 3AEAB 2A5UA 5JZEB 2C7NB 4LNIA 1T3QA 3I5JC 1NI3A 1SIFA 1E8ZA 4NPNA 3MHZA 2KMCA 2EKIA 1JCKB 4DXFA 1WGDA 4DDID 2INPE 3DQVA 4HK2A 4TQ0A 5LLIA 1ZP0B 3IG3A 4AQ7A 4IW0A 2PLPA 4K3BA 1FCCC 1WMHB 3PLVA 3AE6B 3L54A 1TS2A 2ZCCA 1QOAA 3A9JB 4A3PA 2NPTB 2BGFA 3NJTA 2KN4A 2MBHA 4WAAA 3DBHB 1H8CA 2BS2B 3AEFB 1GG3A 3ZNGC 3HUIA 3PT2B 5G5GA 3NS1A 3DBRB 1F9JA 2DLBA 3MP9A 1GC7A 2LGDA 2WDVB 4MM3A 2Y3AA 4HROA 4RM9A 2Q5WD 1WJUA 5DPTA 5HKHA 4EKUA 3L10B 2DBYA 2PKOA 1AN8A 2V3SA 2LGYA 4XDDA 3ENEA 3L4PA 3E9SA 2KTFA 2L8JA 4H2AA 1QLBB 3GB1A 1XCTL 5BMHA 1SE9A 2JXTA 4RCOA 1PQSA 3JSVB 4OZCA 5J2RA 5C2TB 4W9CA 2PEAA 3A1QA 4ZHOA 1WF9A 4PS7A 2KT7A 2JWZA 4ZRIA 1GPXA 2J4XA 3PHWB 4JL9A 1LGRA 5FR6A 2BBCA 2PE6B 4UDUC 3Q8AA 1F2RI 1KTKA 4GGQA 1KLUD 2MH7A 2LGIA 4TMAB 3GOEA 1AARA 4EZLA 2VZKB 3CWIA 4YTNB 2H88B 3EC8A 1L6UA 2JPHA 1E8WA 3OLMD 1WI0A 4MH8A 3ZXVA 1IBXB 2WX0A 4W9EA 2J42A 4ASWC 2KDBA 4IOIE 2V9HA 2ZVOA 3M95A 1M4VA 1V81A 4HJKA 4YT0B 2C7HA 4GDKB 1WYGA 4FLHA 5D7GA 3ZW3A 1Y8RC 2KVRA 1PGBA 1FNUA 2NCNA 1FFUA 4KGTA 4TV3A 2CU1A 1N60A 2JRHA 1S3SG 4DQOC 1WGYA 1VLBA 3DWMA 1L5PA 1F1HA 1UNSA 3EECA 2WX1A 4K7SA 1KF6B 1NI2A 1AWDA 2K6DB 1PGAA 4RGNA 4TUUA 1FEHA 1XCQL 2V4LA 3ZNHB 2BTEA 4XDCA 2WS3B 4XGAB 2EMSA 5CX3A 1JMLA 1UWXA 1C77A 2N9PC 4JGHB 1EO6A 4MH0E 2BB5A 1WZ3A 2WXIA 4A8XC 2IPKD 1VCBA 5JXVA 3PGEA 4BOSC 1ZUD2 4BKSA 1MG8A 2KAJA 3U7ZA 4REZA 2CR5A 1EU4A 2LXAA 1P1AA 2SAKA 4US9A 3NVVA 1P7FA 2MA9B 3PZDA 1I7HA 2B3AA 3KH0A 2ZW0A 5EE1A 5E6OA 3ZJTA 1PUTA 1TZOA 3L0WB 5IN7A 4X57B 2CS4A 3BK1A 2KD0A 3IHPC 2LRWA 1HZ5A 2JU6X 3SHQA 3KWLA 2N0SB 2LZ6A 3A33B 4PYUA 5L83A 5H92C 3APFA 1D4BA 3R3MA 2TSSA 1HQRD 1WE6A 4K1RB 3UIPB 1SGHA 5C1ZA 3QAQA 4ANXA 2QDFA 2ONQA 3KUDB 2I1JA 1YJJA 3FILA 4ANWA 1K50A 3RULA 1JWAD 2LFIA 2K0PA 2ZEQA 1B1ZA 3ML8A 4FADA 4QAYA 5BYSA 4WQMA 3NOBA 4RNAA 3VH4B 2ASQA 2DENB 2PTLA 3DVNV 3IXSA 4YSYB 1N5XA 1J7CA 4US8A 3B0AA 2GOWA 2BYTA 3GE8C 1K52A 3TL5A 4C4VA 5TSSA 1WM3A 2M56B 4LCDE 3T3OA 1V80A 1UWMA 2L7RA 4G11A 1LFDA 2OHFA 4TQ1A 4URKA 3AB5A 5CTRC 5C23A 3TUOA 2E6XA 2J0JA 2ACZB 1R4MI 2BKFA 1FM0D 2O2VB 5G2NA 3RCZA 1WX7A 3HHMA 1YQBA 4K7WA 2J0KA 3ZGZA 3MHSD 3MC0B 1NVID 3BINA 3H7PB 1T0YA 3DBLI 4HRSA 3RFZB 4B0EA 1TY0A 2MRPA 2GI9A 1TKYA 1OTRB 1ZGUB 4TKNA 3T8MA 1V49A 1DOYA 1WXMA 3WA0A 2AYOB 1WY8A 2FIDA 2KKCA 1QT9A 2DZKA 5IP4D 2SEBD 4KVGB 1WGKA 4M00A 4W9LA 1V2YA 4K3CA 3ZNZB 1NDDA 2VH1A 2GBNA 3RMKC 2DYMA 1OGWA 1ZOYB 1FRRA 4GOCA 1ZDVA 2DHZA 2DYBA 2KJHB 1JWBD 3QQ8B 4KKJA 3P2BA 2C9WB 2K8BA 3AU4A 1WSPA 1OQQA 2IYDB 3BWUD 2J0MA 3ECIA 4IM3A 1L4ZB 2NVUI 4M0WB 3PRZA 4NAWA 4NJCA 4BBNF 2E3TA 1V1OA 4GLSC 1C4AA 2OJWA 2AQ2B 3VAWA 4XE0A 4MGZE 1WR6E 1WM2A 1HTOA 4KIKB 2QHOA 1EU3A 2J7QB 5DPWA 3R2TA 3AH7A 3U7DA 2A4ZA 3HRDD 2LJ5A 5MPOA 1DGJA 2MP2A 1J0GA 2GBJA 1WFYA 2FUG1 2NBVB 5EDSA 3UQBA 1I42A 4HPMB 3GZNB 2BPSA 3M62B 1CMXB 4LNNA 3QX1A 5I4DA 3DPDA 2O6VA 4FA6A 1FNVA 3O65B 1KH0A 4ITKA 2HDEA 5E6PA 1JROA 2LWPA 4PT5A 4S0RA 4XC2A 4ZRJA 3LYYA 3I3TB 3O13A 4A55A 3P4QB 3QC8B 2IBIB 3Q8EA 5D94A 2X38A 4NY0A 4RGTA 1V6EA 3QARA 4GXBA 1K8RB 2BB6A 5E6NA 5KHQA 1SJHD 1I4RA 3BYYB 2NR2A 2Y5BB 1SE4A 1TS4A 2M8SA 2WDQB 4CHKA 4EUTA 3QWZB 1FPYA 2FIFA 3APCA 2LEKA 2RD0A 1YN3A 3VRAB 3SR6A 1E7VA 4M02A 1VR9A 5HI1A 1ACCA 5G55A 3DWGC 4IM2A 2IZVB 4DK5A 3RZWC 4F7ZA 4RMAA 2MHJA 4G50A 2D3AA 2D5GA 1QOBA 2HTME 1MHHE 1YN5A 4YL8A 2D3BA 4FULA 2PW9A 5GXGB 4K7UA 2BYEA 2AQ1B 4DXAB 4HPLB 4M8MA 3ETRA 2KANA 3IT4B 4HDOA 4HVBA 1HA5A 1TIFA 4W9IA 3RUIB 2HD5B 3KYDD 1RM6C 2KWCA 2Z0EB 4DHZB 3LB8C 2KHWB 3LDZE 1JWMD 2WLBA 3B08A 4W9DA 3VFKA 1V97A 2FCNA 1MG4A 2W55A 2EMTA 4FJYA 3TEXA 2WP9B 4F1SA 2K8CA 2RR9A 3QHTA 3C19A 1E9MA 1KOTA 4B0MA 5CHWA 1WRIA 4MACA 5D3DA 4WAFA 4JQWC 2CKHB 2WU2B 4MT5A 3PZ8A 3H8HA 2KZRA 1JWSD 1EUVB 3RPFC 4MM3B 4C00A 3GP7A 2PMVA 3M63B 1QILA 4A20A 2KO3A 2IJ0A 3DOWA 3W1SA 3MFGA 2CHXA 2WXQA 4I6LB 3AN1A 1IGDA 1ET9A 2QMTA 3RT3B 4HXDA 1TS5A 3N1YC 1FD6A 2KFKA 3UF8A 2LJIA 4HWIB 2MJEA 1CK1A 1N63A 1BXTA 1UBQA 4GSWA 3IAM1 1UUPA 3A1QB 1TKGA 2LRUA 2N1VA 4NQLB 2OJRA 3ZYYX 2L83A 1CZPA 4OVZA 4RH6A 4OVVA 1N62A 1S1QB 5JHAA 4XYCA 2KQSA 1RFAA 5KHOA 2MBQA 3W1SC 3Q8CA 3BVGA 3FAHA 4ZHPA 1Q10A 2BWFA 4ZRKA 5GMVA 5T8IA 4ZYSA 1KJTA 2WDTB 2IDYA 3L16A 2V3NA 3J9CA 4L23A 1Z2MA 2AQ3B 3ZRFA 5D2MB 2GBRA 1N61A 2BT6A 3PS6A 2QILA 2W54A 2MQJA 1JW9D 2CU3A 1FRDA 3DCGA 1TGZB 4N59A 4P1BC 3MC9A 4TSSA 3DVGY 1YN4A 2WGSA 1XQQA 2BW2A 2JYEA 1VDVA 3ML9A 4GB9A 2RDHA 1Q0WB 3Q2AC 1YNTE 4BOZB 1JWUD 4MEMA 3I63C 4BZAA 5H8YE 3W5VB 4XX5A 4YTMB 2N9EB 1IPGA 3N1XC 2MX2A 3E56A 1YX5B 3RNCC 1L0YB 2BYFA 1KRHA 2WU5B 3TEYA 1MVKA 2R2OA 1WGHA 2KWUB 3WCQA 3ZIMA 2ZJDA 4CQNA 2VZKD 1TJEA 4AP4C 3R7RA 1EF5A 2KQ7A 4AWJA 2AEHA 3SD5A 5AZHA 1IYFA 1YD8U 1CQVA 5CHVC 1TZ1A 1WGRA 3CIRB 4LJOB 4PS8A 1IGCA 2XK5A 3KWVA 3KLSX 3PO0A 2LGXA 4DXGA 2FCSA 1YMHE 4FHJA 2WXFA 1ZXHA 2K22A 2RPVA 3P1MA 4O1NA 3PV1A 3WAPA 3JW0X 2GBMA 1FNWA 2N7EA 2KTRB 4MDKE 3W1YA 2AL6A 4W9FA 4B95A 1YOVB 1E0ZA 1RRBA 4RF0A 5AEKB 2LXCA 3H6NA 4GDLA 1SJED 2H89B 4MGYE 5IO9A 5L95C 1JRPA 3NHEB 4EZJA 3PRMB 2LHEA 1OFFA 1RAXA 3AEDB 3IVFA 2BQQA 4HJGE 4BFRA 1N5WA 3ZTDA 2AX5A 2EELA 2MJ3A 1RFKA 2AL3A 5DPRA 2ON8A 1C4CA 2DAJA 3JYUA 3OG5A 1E10A 3B2GA 1T0QC 2JY6A 2L00B 4JIOU 1AW7A 1ESFA 1I4QA 2D11A 3NZUA 3T3NA 5DCNA 1F0ZA 3ZXRA 2G9HD 3FILB 4EE2A 3QIJA 1FFVA 3MJWA 2RDGA 2G4DB 2BWES 1C78A 1C76A 1V5TA 5BYRA 4LJPB 3V60A 4WWPA 1MI0A 2GLSA 4IUMB 3V61A 3UINB 2WXHA 1VZ8A 2DYOA 4ARCA 4CYEA 4C4VB 3V3XA 3P63A 1JALA 3TBLD 1WYWB 1JQ4A 4P1CC 3RYTA 3P4PB 1KM7A 3Q8BA 5IA7A 1B9RA 1R4MB 2PVOD 4ACFA 1WXSA 3Q14C 1VZ6A 2JSVX 1E8YA 1SBBB 2G1EA 1Y56A 3SU8X 4KGRA 3RD2A 1P7EA 3DBLB 1WR1A 3NG0A 1SXTA 1SE3A 1H4RA 5IOIA 3UGBB 2G45B 1YIWA 1ISNA 3Q3OC 4K81A 4HEA1 2W82A 2KK8A 2B76B 3PRPB 4WJQA 2JWUA 1HTQA 1KLGD 3SDLC 2ICIA 3AI5A 4KZCA 4C7ZA 1C3TA 4DBGA 3L08A 3N20C 1C9FA 3HK0A 1SE2A 3BVZA 4WWNA 2QEJC 1BUIC 2L0FA 3AEBB 4ZYNA 3IT6B 4DHJB 2OOBB 2G4SA 1Z5SB 4NQKE 2Z59B 3PPAA 1E5WA 4AJYB 4OW0A 3P4RB 2G3QB 5HG2A 4AOFA 2JX5A 2PVGC 1VJKA 3TIXA 4PS3A 3H1UA 3RNBC 1NEKB 1VD2A 4FJVB 4RGOS 2LVPA 4HDQA 3URYA 3RI7C 4J6IA 5EE3A 3TMPB 4P7IA 3OWEB 3VTUA 2J52A 1P3QU 1Q1OA 4E71A 3CMMB 2MBEA 1WH3A 4NAWB 3VUYA 2X8XX 2K39A 4MELA 1QOFA 5D6JB 2W9NA 1T0RC 2UWQA 2GMIC 4OZAA 4FXCA 5DPSA 4GMVA 1GJZA 4DHJD 3A9KA 2V1YA 4WJOA 4USAA 2JZZA 3NRZA 3HIZA 3SEBA 3Q69A 4Q2JA 4I6PA 4KDIC 2BYVE 2C7MB 2YEPB 1L2NA 1XLPA 2D3GA 4JE3B 4MJSA 3ZJUA 3U2SC 3QJZA 4S17A 1HE8A 2RPQA 2DNFA 4IG7B 4HKQA 2JT4B 3BZDB 3WAOA 2RMMA 3CSFA 2JXXA 4RM8A 1X1MA 1LXDA 2NBWB 2D2QA 1VZ7A 4NJ7A 3ZQ4A 4ARIA 3AE5B 2L52A 3MTNB 2WYQA 1XLOA 2KC2A 4YSZB 1WGGA 1C79A 1P9DU 2O6VB 1WRDB 4AUQC 1R4NB 4GN1A 2KWVB 3GZNI 4RGMA 2NS5A 3AE4B 2IGHA 1ET6A 3V6EB 3CSTA 3ABVB 2IO0B 4WJNA 1WX9A 2M1MA 1ZKHA 2KACA 1TT5B 1E8XA 3AECB 2OEDA 2ZNVB 4W9JA 5LXHA 3NVWA 1WIAA 5AUIA 3EA6A 2KLCA 2IO3B 3C8YA 2JVCA 3AE3B 1MPEA 2KC1A 4JX1C 3APDA 3EUB2 4EEWA 1P0RA 1K53A 1V8CA 2KNBA 1E7UA 4BVUC 2D07B 3B9JA 1AYFA 3RNFC 4EOYA 3U8ZA 4RFBA 1PFDA 2YLMA 1V1PA 1J7BA 5C3JB 3U30A 5BO4B 1TS3A 1OQYA 2CHWA 4WH4A 5LNK1 3PZ7A 1EF1A 4NZLB 2WHIA 2NTSA 2MSED 1L6VA 1RYJA 3QK0A 3UIOB 2MBBB 2RGFA 2L32A 3NZSA 1OQRA 3KVFB 4IWQA 2NTTA 2MEKA 4FN2A 2K25A 1XO3A 3ONSA 1RLFA 2RDBC 3VHTC 2I1KA 2YEPF 1LQBA 4LTUA 2HJ8A 1FXTB 2N1WA 3PSEB 2Z0DB 3VR8B 4HCNB 1R7SA 2INDC 2KQ4X 1L4DB 1EWCA 4PK1A 2UU7A 4W9GA 1U4AA 2KDEB 4II3B 2INNE 3QA8A 4N9F4 1KLVA 1NENB 3U52E 2KVZA 4KSLC 1WX8A 2N9LA 4OZBA 2FNJB 4MGKE 3ZNID 4E3CA 2XN9C 1WMHA 2BS3B 1MJDA 2N7DA 2QSDA 2Y5CA 3A9JA 2NPTA 2XEWA 3X23A 1NYQA 2C5LC 4AS1A 3DBHI 3FKYA 4WURA 3ZO5B 4AJWA 1FIQA 2KFJA 3VQIA 2IY1B 2PJHA 3DBRI 4M01A 4OVUA 5BMGA 3R7QA 4R3DA 3WALA 1TYGB 3AU5A 2DAFA 3S2AA 1XXGA 3BY4B 1YQ4B 4HPPA 2MBOA 1P98A 4ANVA 1E6EB 2HE7A 2KFKB 4M8NA 2WXJA 2LASA 3NUHB 2GBKA 1WXAA 4XWTA 1I4GA 4GIVA 1MHXA 4MSMB 2CJOA 4JLCA 4OHJA 3ZTCA 3HM6X 2I2YA 1L0VB 4EZKA 3AE1B 1D5MC 2V3PA 2JQRB 1J19A 1J8CA 3AE8B 3JSVA 4ANUA 1F77A 4ZRQA 3W5UB 3IBEA 4G0NB 4HKZE 4LDTB 1UGMA 3HVZA 1ZW7A 3AE2B 2N7JA 5BMIA 2Y5PA 5AUKA 1A70A 3VUWA 2NBUA 1EM7A 2WXGA 3BIID 2V4IB 1IUEA 3KYCD 3TCAA 2KX3A 2DZJA 1V5OA 1I4HA 2UYZB 2JYTA 1SIJA 2WXPA 3U4EG 1EWYC 1FXIA 3W9CB 2EKEC 1F52A 5E6JA 1D5ZC 3KUZA 1XLNA 1WJ6A 2KJ6A 1SSNA 2LI5A 2LGSA 1UH6A 3ALBA 2DWQA 2NMQA 1IBXA 3ZDTA 2WNMA 4KV2A 4G3XB 5CHFA 3TJPA 1FXAA 1L0XB 2MLBA 3PTFC 4GDKA 2IO2B 3MC8A 4XWWA 4FJZA 3N9YC 3GS2A 2JZ3B 3BVMA 2ZCBA 4DDGD 4LDTD 4IDIA 4YXDB 4BAXA 3V6CB 1ENFA 3AMZA 4A9AA 3IAS1 2LMCA 2BF8B 3DDCB 2KDFB 1FMAD 2K1FA 5FKAC 3AE7B 3LXFA 1D5XC 1M94A 1J7AA 1F2RC 4KSKC 4CO7A 1V9JA 1ZE3D 4C56C 2C60A 4XZ4A 3D32A 5HFYA 1XEEA 2K8HA 3VUXA 3Q3NC 3SFDB 2XK5B 4B9KA 1DOIA 5G5HA 1G6JA 2K5PA 2N4FA 2ZPYA 1UZXB 3DHIC 4F8CB 2W3RA 3R66C 3ZRCA 4HLEA 3VRBB 2R2QA 2HTHA 2Z8LA 1ZDXA 2LVQA 2IO1B 1XD3B 3AXCA 1NYRA 3KUCB 3DVGX 3R2IA 2XBBC 3TEZA 2WXLA 3NVYA 3WIMA 1I4XA 1JRUA 3MJ5A 3RN9C 4GDLB 3L17A 2V0GA 1HXYD 2KTRA 2ZVNA 5EE9A 3ZUNA 4JWUC 3N32A 2KLGA 2BS4B 2KXJA 3ZVVA 2MCNB 5FR3A 4N58A 1ZXIA 4WIPA 3DBSA 4ZDVA 3RNAC 4FHKA 3L13A 1T6BX 3AULA 1QZEA 1WJNA 4EFOA 2WXRA 2PIAA 3X0WA 3VVWB 1T5XD 1HZ6A 2KDIA 1V86A 3FC4A 2M0AA 1K51A 4BKSD 5EE0A 2ZZPB 3RZFA 2QJLA 2KJRA 1XF5L 2N9KA 1WJ4A 3LJ3A 2MW5A 3CF6E 2KDMA 1CJEA 1SEBD 3DVNU 4I6NB 3PLUA 2QCZA 3KQ4A 3A4SC 1C4PA 1BMLC 4LLGM 3Q3JA 1FCLA 2IGDA 1DOXA 4JWSC 1E90A 2WXMA 5JH5C 3AEGB 1XLQA 3EFCA 1YJ1A 4NAMA 4N6EB 2LD9A 4A6QA 4MSQB 3N3KB 2K9XA 4WWMA 3WAMA 2KN5A 1D3ZA 4YTPB 4NJ6A 3HVDA 4IWPA 5HHDG 3RNGC 3NY5A 1UF0A 2L3ZA 5JHBA 3ZDMC 2FAZA 1ROEA 2L1AA 4W9KA 1PDXA 1XT9B 3V05A 3Q6BA 1QF6A 1Q5WB 2BKRB 2ZW1A 1GC6A 3PVLA 5FK9C 2KMMA 2FCMA 1ZPSA 3I57A 3NS8A 2QC8A 2J53A 2WXNA 1HEZE 2GB1A 2O2VA 3IFWB 4MGIE 4WJPA 1N6ZA 4KX6B 3M3JA 3EHVA 2LVOA 2IY0B 3QCAA 1PYWD 3PREA 3H7PA 2M19A 1A5RA 4DWFA 2YVCA 1PGXA 3P4SB 5D3IB 2XNAC 3N30A 4BBNC 4IC7B 1QKZA 2L05A 3P42A 1I4PA 4IWOA 1UD7A 2KWDA 3R8BA 4LNKA 4A90A 3T9LA 2AWTA 3Q3MC 1YX6B 3BK2A 2L76A 2PE9A 4LNFA 3OJ4B 1YJIA 4PYZA 1UGJA 2DX5B 3AM9A 2WXOA
chains in the Genus database with same CATH topology
4GU2A 1WE7A 2DZIA 2D07B 4NNJB 2MBQA 2KD0A 3IHPC 3W1SC 4EOYA 1C1YB 3U8ZA 2LRWA 3H7SA 3EFUA 1GNUA 4HCPB 2KX0A 2YLMA 4WQOB 3U30A 2BWFA 3SHQA 4ZRKA 5GMVA 5BO4B 1KJTA 1OQYA 2LZ6A 2CHWA 2MWSB 3A33B 4PYUA 5L83A 2WDTB 5J17A 2VRRB 1EF1A 3JVZX 1OEYA 3L16A 3APFA 2JRIB 2MSED 3VH3B 1Z2MA 3ZRFA 4BKTA 3R3MA 5D2MB 3QK0A 1WE6A 4K1RB 3UIOB 2MBBB 2RGFA 2KOXA 2DZMA 3UIPB 2GBRA 3NZSA 1UBIA 3KVFB 3PS6A 4IWQA 1SGHA 4FN2A 2K25A 3ONSA 5C1ZA 1RLFA 3QAQA 4ANXA 3VHTC 2MQJA 2I1KA 3KUDB 3DCGA 1TGZB 1LQBA 2I1JA 2HJ8A 3DVGY 2REXA 4ANWA 1FXTB 3RULA 2N1WA 1XQQA 3A9KB 3PSEB 4ICVA 2Z0DB 4WWOA 4W9HA 3B1LX 3ML9A 4GB9A 2ZEQA 1Q0WB 3C0RB 3ML8A 4HCNB 3VDZA 4BOZB 3K9PB 4MEMA 4FADA 4XX5A 5AZGA 3NOBA 3A4RA 2L0TA 3VH4B 3VXWA 2N9EB 1IPGA 2ASQA 4W9GA 1U4AA 2KDEB 2DENB 3VTWA 4II3B 2MX2A 3DVNV 3QA8A 1BT0A 4N9F4 4ICUA 1KLVA 4IM0A 4MJSB 2MP2B 1YX5B 2D10A 2BYFA 4KSLC 4E74A 3Q3FA 1WX8A 3B0AA 2R2OA 1WGHA 2GOWA 2KWUB 4KIKA 4KDLB 2FNJB 4MGKE 3ZIMA 2ZJDA 3ZNID 4E3CA 3TL5A 1WMHA 1WM3A 2N7DA 1WXVA 4LCDE 4AP4C 1V80A 3R7RA 1EF5A 2KQ7A 2L7RA 4A3OA 4AWJA 2AEHA 3A9JA 3SD5A 2NPTA 2WWZA 2XEWA 4G11A 1TBEA 5AZHA 1LFDA 1IYFA 3X23A 1YD8U 2C5LC 4TQ1A 5LXIB 4URKA 5CHVC 5CTRC 5C23A 1TZ1A 1WGRA 2J0JA 3DBHI 1R4MI 2BKFA 2O2VB 4LJOB 4PS8A 5G2NA 3ZO5B 1TTNA 2XK5A 4AJWA 3RCZA 2KFJA 2LGXA 3VQIA 1WX7A 2FCSA 3HHMA 1YQBA 2IY1B 4K7WA 2J0KA 4FHJA 3MHSD 2PJHA 2JF5A 3DBRI 4OVUA 3R7QA 3H7PB 3BINA 1T0YA 3WALA 3PV1A 3WAPA 3JW0X 3AU5A 3ZKJC 1R4NI 2RSUA 2DAFA 2GBMA 3DBLI 3S2AA 3BY4B 2CHZA 2N7EA 2MBOA 1P98A 4ANVA 2KTRB 4MDKE 4KZ0A 2HE7A 3W1YA 2KFKB 2AL6A 3H9DA 4M8NA 2LASA 4B6WA 4W9FA 4B95A 2GBKA 1WXAA 1GUAB 2MRPA 3K9OB 4GIVA 4MSMB 4II2B 1OTRB 1ZGUB 4TKNA 3T8MA 1V49A 1RRBA 4JLCA 2M0XA 1L7YA 3HM6X 2LXCA 3VTVA 3ZTCA 5AEKB 1WXMA 3WA0A 2AYOB 3H6NA 1WY8A 2ZPNA 2FIDA 4GDLA 3ZLZA 4EZKA 2FUHB 1J19A 2KKCA 3PHXB 1J8CA 5AZFA 4MGYE 1IP9A 3OAWA 3JSVA 4ANUA 3UQAA 5L95C 2LUEA 3NHEB 4EZJA 3IBEA 4G0NB 3KW5B 2DZKA 4LDTB 1UGMA 2JUOA 4KVGB 3PRMB 1ZW7A 2O6VD 1RAXA 4W9LA 1V2YA 1NBFC 2M17A 3IVFA 3ZNZB 5J18A 1I35A 2N9XA 1NDDA 2PPHA 4BFRA 2GBNA 3VUWA 2NBUA 2DYMA 1LM8B 1OGWA 3ZTDA 2KMAA 4GOCA 2DHZA 2DYBA 2KJHB 2AL3A 5DPRA 3KYCD 3QQ8B 3TCAA 2KX3A 2DZJA 1V5OA 2UYZB 3P2BA 2C9WB 2K8BA 2DAJA 3AU4A 3V62A 3JYUA 2EKEC 5IAAC 3OJ3A 2FCQA 2M4NA 3KUZA 3WANA 1WJ6A 2KJ6A 2JY6A 2L00B 4JIOU 4FBJB 3HM3A 2IYDB 2LI5A 5TR5A 2D11A 3NZUA 5DCNA 2J0MA 2ZNVC 1UH6A 3ALBA 3ECIA 4IM3A 1UELA 2NVUI 4BKGA 4M0WB 2K6QA 1WZ0A 1OEYJ 3ZDTA 3PRZA 4KV2A 3QIJA 4NAWA 4G3XB 3MJWA 5CHFA 3TJPA 4BBNF 2G4DB 2MLBA 2BWES 3PTFC 4DHZE 1V5TA 4GDKA 2IO2B 2A5UA 5JZEB 2C7NB 4FJZA 4LJPB 3V60A 4WWPA 1SIFA 2JZ3B 3VAWA 1E8ZA 2ZCBA 4NPNA 4LDTD 4DDGD 4MGZE 2KMCA 1WGDA 4IUMB 3V61A 4DDID 1WR6E 3V6CB 3DQVA 1WM2A 4HK2A 3UINB 4TQ0A 5LLIA 2BF8B 4KIKB 3IG3A 3DDCB 2DYOA 2KDFB 2K1FA 4CYEA 2QHOA 4IW0A 1M94A 2J7QB 4KSKC 4CO7A 5DPWA 1V9JA 1WMHB 3PLVA 3U7DA 3TBLD 1WYWB 2A4ZA 2LJ5A 3L54A 2C60A 2ZCCA 4XZ4A 2MP2A 3D32A 3RYTA 3A9JB 4A3PA 2NPTB 2BGFA 1J0GA 2GBJA 2K8HA 1KM7A 1WFYA 3VUXA 2MBHA 4WAAA 2NBVB 5IA7A 5EDSA 3UQBA 1H8CA 4HPMB 1I42A 2BPSA 1WXSA 2XK5B 3M62B 1GG3A 3ZNGC 3PT2B 1E8YA 4B9KA 1CMXB 3QX1A 1G6JA 1F9JA 3SU8X 3DPDA 1GC7A 2LGDA 4MM3A 2O6VA 2N4FA 2ZPYA 1UZXB 4FA6A 3O65B 3RD2A 4F8CB 5E6PA 4RM9A 3R66C 1WR1A 3ZRCA 2LWPA 1WJUA 1H4RA 4XC2A 4ZRJA 4HLEA 5DPTA 5HKHA 3UGBB 2G45B 1YIWA 1ISNA 3I3TB 2R2QA 2HTHA 3QC8B 2IBIB 4K81A 4EKUA 2LVQA 3L10B 2IO1B 2KK8A 1XD3B 5D94A 3AXCA 4NY0A 2V3SA 3KUCB 2LGYA 3DVGX 3ENEA 3PRPB 2XBBC 4WJQA 1V6EA 2KTFA 2L8JA 3QARA 4GXBA 1K8RB 5E6NA 3SDLC 3WIMA 5KHQA 3AI5A 1JRUA 4KZCA 1C3TA 4GDLB 4DBGA 3L17A 3L08A 1SE9A 2NR2A 2KTRA 2Y5BB 3HK0A 4WWNA 2ZVNA 3ZUNA 1PQSA 3N32A 2KLGA 2L0FA 2M8SA 3JSVB 2KXJA 4CHKA 4ZYNA 3ZVVA 4EUTA 3QWZB 2MCNB 5J2RA 4W9CA 2FIFA 2PEAA 2OOBB 3A1QA 4DHJB 3APCA 1WF9A 2RD0A 4PS7A 2G4SA 2JWZA 4ZRIA 1Z5SB 3DBSA 4ZDVA 4NQKE 4FHKA 2Z59B 3PPAA 1E5WA 3L13A 4AJYB 3PHWB 4JL9A 1E7VA 2G3QB 3AULA 4AOFA 1QZEA 1WJNA 4EFOA 5FR6A 4PS3A 3TIXA 2PE6B 5G55A 3H1UA 3X0WA 3VVWB 2KDIA 4IM2A 2IZVB 1V86A 1VD2A 4FJVB 2LVPA 4GGQA 4DK5A 3RZWC 4HDQA 4BKSD 4F7ZA 4RMAA 2ZZPB 4J6IA 3RZFA 4G50A 2KJRA 3GOEA 1AARA 3TMPB 4EZLA 1WJ4A 3LJ3A 3EC8A 2MW5A 4P7IA 4YL8A 2JPHA 3CF6E 1E8WA 3VTUA 1P3QU 1Q1OA 3DVNU 3OLMD 4FULA 1WI0A 4I6NB 4E71A 3CMMB 2WX0A 3PLUA 2MBEA 4K7UA 4W9EA 1WH3A 4NAWB 2BYEA 3VUYA 4ASWC 2KDBA 2K39A 4MELA 2ZVOA 3M95A 5D6JB 3A4SC 4DXAB 2W9NA 2UWQA 4HPLB 1V81A 4HJKA 4M8MA 3Q3JA 2C7HA 4GDKB 2KANA 4HDOA 4HVBA 2GMIC 4FLHA 5DPSA 5D7GA 3ZW3A 4GMVA 1Y8RC 4W9IA 2KVRA 3RUIB 2HD5B 1GJZA 1E90A 4DHJD 3A9KA 2V1YA 5JH5C 3KYDD 1YJ1A 4WJOA 2JZZA 2KWCA 2NCNA 2Z0EB 4DHZB 2LD9A 4MSQB 2KHWB 3LDZE 3N3KB 4TV3A 3WAMA 2CU1A 2KN5A 3HIZA 1D3ZA 4NJ6A 2JRHA 4IWPA 1S3SG 1WGYA 3B08A 4W9DA 2BYVE 2C7MB 3NY5A 2FCNA 4I6PA 4KDIC 3VFKA 2L3ZA 1L2NA 2EMTA 5JHBA 2D3GA 4FJYA 3EECA 4MJSA 3ZDMC 2WX1A 3QJZA 4K7SA 2FAZA 1HE8A 2RPQA 1NI2A 4F1SA 2K8CA 2RR9A 3QHTA 4IG7B 2JT4B 2K6DB 4W9KA 3WAOA 1XT9B 3CSFA 2JXXA 4RM8A 1KOTA 1Q5WB 2BKRB 4TUUA 5CHWA 1X1MA 1LXDA 2NBWB 2D2QA 2V4LA 3ZNHB 1GC6A 4NJ7A 4JQWC 2CKHB 3PVLA 2KZRA 2EMSA 2FCMA 1EUVB 2WYQA 3MTNB 2KC2A 3NS8A 5CX3A 1WGGA 1P9DU 2N9PC 2O6VB 1WRDB 4AUQC 4JGHB 1EO6A 3M63B 4MH0E 4A20A 2KO3A 2O2VA 3IFWB 4MGIE 4WJPA 4GN1A 3DOWA 3W1SA 2KWVB 3GZNI 3EHVA 3M3JA 2LVOA 2NS5A 2IY0B 3QCAA 1WZ3A 2CHXA 3PREA 3V6EB 3CSTA 1VCBA 2IO0B 4WJNA 4I6LB 1WX9A 3PGEA 3H7PA 2M1MA 1A5RA 1ZKHA 3RT3B 4BOSC 4DWFA 1E8XA 2YVCA 1MG8A 4HXDA 4BKSA 2ZNVB 4W9JA 3N30A 2CR5A 4BBNC 2KFKA 5LXHA 3UF8A 1WIAA 2LXAA 4HWIB 4IC7B 1P1AA 2L05A 2KLCA 4IWOA 1UD7A 1UBQA 2IO3B 4GSWA 3T9LA 3A1QB 2N1VA 2JVCA 2AWTA 2LRUA 4NQLB 2MA9B 2KC1A 2OJRA 3PZDA 1YX6B 2B3AA 3APDA 3KH0A 5E6OA 2L76A 2PE9A 4EEWA 1P0RA 3L0WB 3OJ4B 4OVVA 4PYZA 1S1QB 2DX5B 5JHAA 2KNBA 2KQSA 1E7UA 1RFAA 2CS4A 4X57B 4BVUC 5KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GU2 A;  1WE7 A;  2DZI A;  2D07 B;  4NNJ B;  2MBQ A;  2KD0 A;  3IHP C;  3W1S C;  4EOY A;  1C1Y B;  3U8Z A;  2LRW A;  3H7S A;  3EFU A;  1GNU A;  4HCP B;  2KX0 A;  2YLM A;  4WQO B;  3U30 A;  2BWF A;  3SHQ A;  4ZRK A;  5GMV A;  5BO4 B;  1KJT A;  1OQY A;  2LZ6 A;  2CHW A;  2MWS B;  3A33 B;  4PYU A;  5L83 A;  2WDT B;  5J17 A;  2VRR B;  1EF1 A;  3JVZ X;  1OEY A;  3L16 A;  3APF A;  2JRI B;  2MSE D;  3VH3 B;  1Z2M A;  3ZRF A;  4BKT A;  3R3M A;  5D2M B;  3QK0 A;  1WE6 A;  4K1R B;  3UIO B;  2MBB B;  2RGF A;  2KOX A;  2DZM A;  3UIP B;  2GBR A;  3NZS A;  1UBI A;  3KVF B;  3PS6 A;  4IWQ A;  1SGH A;  4FN2 A;  2K25 A;  3ONS A;  5C1Z A;  1RLF A;  3QAQ A;  4ANX A;  3VHT C;  2MQJ A;  2I1K A;  3KUD B;  3DCG A;  1TGZ B;  1LQB A;  2I1J A;  2HJ8 A;  3DVG Y;  2REX A;  4ANW A;  1FXT B;  3RUL A;  2N1W A;  1XQQ A;  3A9K B;  3PSE B;  4ICV A;  2Z0D B;  4WWO A;  4W9H A;  3B1L X;  3ML9 A;  4GB9 A;  2ZEQ A;  1Q0W B;  3C0R B;  3ML8 A;  4HCN B;  3VDZ A;  4BOZ B;  3K9P B;  4MEM A;  4FAD A;  4XX5 A;  5AZG A;  3NOB A;  3A4R A;  2L0T A;  3VH4 B;  3VXW A;  2N9E B;  1IPG A;  2ASQ A;  4W9G A;  1U4A A;  2KDE B;  2DEN B;  3VTW A;  4II3 B;  2MX2 A;  3DVN V;  3QA8 A;  1BT0 A;  4N9F 4;  4ICU A;  1KLV A;  4IM0 A;  4MJS B;  2MP2 B;  1YX5 B;  2D10 A;  2BYF A;  4KSL C;  4E74 A;  3Q3F A;  1WX8 A;  3B0A A;  2R2O A;  1WGH A;  2GOW A;  2KWU B;  4KIK A;  4KDL B;  2FNJ B;  4MGK E;  3ZIM A;  2ZJD A;  3ZNI D;  4E3C A;  3TL5 A;  1WMH A;  1WM3 A;  2N7D A;  1WXV A;  4LCD E;  4AP4 C;  1V80 A;  3R7R A;  1EF5 A;  2KQ7 A;  2L7R A;  4A3O A;  4AWJ A;  2AEH A;  3A9J A;  3SD5 A;  2NPT A;  2WWZ A;  2XEW A;  4G11 A;  1TBE A;  5AZH A;  1LFD A;  1IYF A;  3X23 A;  1YD8 U;  2C5L C;  4TQ1 A;  5LXI B;  4URK A;  5CHV C;  5CTR C;  5C23 A;  1TZ1 A;  1WGR A;  2J0J A;  3DBH I;  1R4M I;  2BKF A;  2O2V B;  4LJO B;  4PS8 A;  5G2N A;  3ZO5 B;  1TTN A;  2XK5 A;  4AJW A;  3RCZ A;  2KFJ A;  2LGX A;  3VQI A;  1WX7 A;  2FCS A;  3HHM A;  1YQB A;  2IY1 B;  4K7W A;  2J0K A;  4FHJ A;  3MHS D;  2PJH A;  2JF5 A;  3DBR I;  4OVU A;  3R7Q A;  3H7P B;  3BIN A;  1T0Y A;  3WAL A;  3PV1 A;  3WAP A;  3JW0 X;  3AU5 A;  3ZKJ C;  1R4N I;  2RSU A;  2DAF A;  2GBM A;  3DBL I;  3S2A A;  3BY4 B;  2CHZ A;  2N7E A;  2MBO A;  1P98 A;  4ANV A;  2KTR B;  4MDK E;  4KZ0 A;  2HE7 A;  3W1Y A;  2KFK B;  2AL6 A;  3H9D A;  4M8N A;  2LAS A;  4B6W A;  4W9F A;  4B95 A;  2GBK A;  1WXA A;  1GUA B;  2MRP A;  3K9O B;  4GIV A;  4MSM B;  4II2 B;  1OTR B;  1ZGU B;  4TKN A;  3T8M A;  1V49 A;  1RRB A;  4JLC A;  2M0X A;  1L7Y A;  3HM6 X;  2LXC A;  3VTV A;  3ZTC A;  5AEK B;  1WXM A;  3WA0 A;  2AYO B;  3H6N A;  1WY8 A;  2ZPN A;  2FID A;  4GDL A;  3ZLZ A;  4EZK A;  2FUH B;  1J19 A;  2KKC A;  3PHX B;  1J8C A;  5AZF A;  4MGY E;  1IP9 A;  3OAW A;  3JSV A;  4ANU A;  3UQA A;  5L95 C;  2LUE A;  3NHE B;  4EZJ A;  3IBE A;  4G0N B;  3KW5 B;  2DZK A;  4LDT B;  1UGM A;  2JUO A;  4KVG B;  3PRM B;  1ZW7 A;  2O6V D;  1RAX A;  4W9L A;  1V2Y A;  1NBF C;  2M17 A;  3IVF A;  3ZNZ B;  5J18 A;  1I35 A;  2N9X A;  1NDD A;  2PPH A;  4BFR A;  2GBN A;  3VUW A;  2NBU A;  2DYM A;  1LM8 B;  1OGW A;  3ZTD A;  2KMA A;  4GOC A;  2DHZ A;  2DYB A;  2KJH B;  2AL3 A;  5DPR A;  3KYC D;  3QQ8 B;  3TCA A;  2KX3 A;  2DZJ A;  1V5O A;  2UYZ B;  3P2B A;  2C9W B;  2K8B A;  2DAJ A;  3AU4 A;  3V62 A;  3JYU A;  2EKE C;  5IAA C;  3OJ3 A;  2FCQ A;  2M4N A;  3KUZ A;  3WAN A;  1WJ6 A;  2KJ6 A;  2JY6 A;  2L00 B;  4JIO U;  4FBJ B;  3HM3 A;  2IYD B;  2LI5 A;  5TR5 A;  2D11 A;  3NZU A;  5DCN A;  2J0M A;  2ZNV C;  1UH6 A;  3ALB A;  3ECI A;  4IM3 A;  1UEL A;  2NVU I;  4BKG A;  4M0W B;  2K6Q A;  1WZ0 A;  1OEY J;  3ZDT A;  3PRZ A;  4KV2 A;  3QIJ A;  4NAW A;  4G3X B;  3MJW A;  5CHF A;  3TJP A;  4BBN F;  2G4D B;  2MLB A;  2BWE S;  3PTF C;  4DHZ E;  1V5T A;  4GDK A;  2IO2 B;  2A5U A;  5JZE B;  2C7N B;  4FJZ A;  4LJP B;  3V60 A;  4WWP A;  1SIF A;  2JZ3 B;  3VAW A;  1E8Z A;  2ZCB A;  4NPN A;  4LDT D;  4DDG D;  4MGZ E;  2KMC A;  1WGD A;  4IUM B;  3V61 A;  4DDI D;  1WR6 E;  3V6C B;  3DQV A;  1WM2 A;  4HK2 A;  3UIN B;  4TQ0 A;  5LLI A;  2BF8 B;  4KIK B;  3IG3 A;  3DDC B;  2DYO A;  2KDF B;  2K1F A;  4CYE A;  2QHO A;  4IW0 A;  1M94 A;  2J7Q B;  4KSK C;  4CO7 A;  5DPW A;  1V9J A;  1WMH B;  3PLV A;  3U7D A;  3TBL D;  1WYW B;  2A4Z A;  2LJ5 A;  3L54 A;  2C60 A;  2ZCC A;  4XZ4 A;  2MP2 A;  3D32 A;  3RYT A;  3A9J B;  4A3P A;  2NPT B;  2BGF A;  1J0G A;  2GBJ A;  2K8H A;  1KM7 A;  1WFY A;  3VUX A;  2MBH A;  4WAA A;  2NBV B;  5IA7 A;  5EDS A;  3UQB A;  1H8C A;  4HPM B;  1I42 A;  2BPS A;  1WXS A;  2XK5 B;  3M62 B;  1GG3 A;  3ZNG C;  3PT2 B;  1E8Y A;  4B9K A;  1CMX B;  3QX1 A;  1G6J A;  1F9J A;  3SU8 X;  3DPD A;  1GC7 A;  2LGD A;  4MM3 A;  2O6V A;  2N4F A;  2ZPY A;  1UZX B;  4FA6 A;  3O65 B;  3RD2 A;  4F8C B;  5E6P A;  4RM9 A;  3R66 C;  1WR1 A;  3ZRC A;  2LWP A;  1WJU A;  1H4R A;  4XC2 A;  4ZRJ A;  4HLE A;  5DPT A;  5HKH A;  3UGB B;  2G45 B;  1YIW A;  1ISN A;  3I3T B;  2R2Q A;  2HTH A;  3QC8 B;  2IBI B;  4K81 A;  4EKU A;  2LVQ A;  3L10 B;  2IO1 B;  2KK8 A;  1XD3 B;  5D94 A;  3AXC A;  4NY0 A;  2V3S A;  3KUC B;  2LGY A;  3DVG X;  3ENE A;  3PRP B;  2XBB C;  4WJQ A;  1V6E A;  2KTF A;  2L8J A;  3QAR A;  4GXB A;  1K8R B;  5E6N A;  3SDL C;  3WIM A;  5KHQ A;  3AI5 A;  1JRU A;  4KZC A;  1C3T A;  4GDL B;  4DBG A;  3L17 A;  3L08 A;  1SE9 A;  2NR2 A;  2KTR A;  2Y5B B;  3HK0 A;  4WWN A;  2ZVN A;  3ZUN A;  1PQS A;  3N32 A;  2KLG A;  2L0F A;  2M8S A;  3JSV B;  2KXJ A;  4CHK A;  4ZYN A;  3ZVV A;  4EUT A;  3QWZ B;  2MCN B;  5J2R A;  4W9C A;  2FIF A;  2PEA A;  2OOB B;  3A1Q A;  4DHJ B;  3APC A;  1WF9 A;  2RD0 A;  4PS7 A;  2G4S A;  2JWZ A;  4ZRI A;  1Z5S B;  3DBS A;  4ZDV A;  4NQK E;  4FHK A;  2Z59 B;  3PPA A;  1E5W A;  3L13 A;  4AJY B;  3PHW B;  4JL9 A;  1E7V A;  2G3Q B;  3AUL A;  4AOF A;  1QZE A;  1WJN A;  4EFO A;  5FR6 A;  4PS3 A;  3TIX A;  2PE6 B;  5G55 A;  3H1U A;  3X0W A;  3VVW B;  2KDI A;  4IM2 A;  2IZV B;  1V86 A;  1VD2 A;  4FJV B;  2LVP A;  4GGQ A;  4DK5 A;  3RZW C;  4HDQ A;  4BKS D;  4F7Z A;  4RMA A;  2ZZP B;  4J6I A;  3RZF A;  4G50 A;  2KJR A;  3GOE A;  1AAR A;  3TMP B;  4EZL A;  1WJ4 A;  3LJ3 A;  3EC8 A;  2MW5 A;  4P7I A;  4YL8 A;  2JPH A;  3CF6 E;  1E8W A;  3VTU A;  1P3Q U;  1Q1O A;  3DVN U;  3OLM D;  4FUL A;  1WI0 A;  4I6N B;  4E71 A;  3CMM B;  2WX0 A;  3PLU A;  2MBE A;  4K7U A;  4W9E A;  1WH3 A;  4NAW B;  2BYE A;  3VUY A;  4ASW C;  2KDB A;  2K39 A;  4MEL A;  2ZVO A;  3M95 A;  5D6J B;  3A4S C;  4DXA B;  2W9N A;  2UWQ A;  4HPL B;  1V81 A;  4HJK A;  4M8M A;  3Q3J A;  2C7H A;  4GDK B;  2KAN A;  4HDO A;  4HVB A;  2GMI C;  4FLH A;  5DPS A;  5D7G A;  3ZW3 A;  4GMV A;  1Y8R C;  4W9I A;  2KVR A;  3RUI B;  2HD5 B;  1GJZ A;  1E90 A;  4DHJ D;  3A9K A;  2V1Y A;  5JH5 C;  3KYD D;  1YJ1 A;  4WJO A;  2JZZ A;  2KWC A;  2NCN A;  2Z0E B;  4DHZ B;  2LD9 A;  4MSQ B;  2KHW B;  3LDZ E;  3N3K B;  4TV3 A;  3WAM A;  2CU1 A;  2KN5 A;  3HIZ A;  1D3Z A;  4NJ6 A;  2JRH A;  4IWP A;  1S3S G;  1WGY A;  3B08 A;  4W9D A;  2BYV E;  2C7M B;  3NY5 A;  2FCN A;  4I6P A;  4KDI C;  3VFK A;  2L3Z A;  1L2N A;  2EMT A;  5JHB A;  2D3G A;  4FJY A;  3EEC A;  4MJS A;  3ZDM C;  2WX1 A;  3QJZ A;  4K7S A;  2FAZ A;  1HE8 A;  2RPQ A;  1NI2 A;  4F1S A;  2K8C A;  2RR9 A;  3QHT A;  4IG7 B;  2JT4 B;  2K6D B;  4W9K A;  3WAO A;  1XT9 B;  3CSF A;  2JXX A;  4RM8 A;  1KOT A;  1Q5W B;  2BKR B;  4TUU A;  5CHW A;  1X1M A;  1LXD A;  2NBW B;  2D2Q A;  2V4L A;  3ZNH B;  1GC6 A;  4NJ7 A;  4JQW C;  2CKH B;  3PVL A;  2KZR A;  2EMS A;  2FCM A;  1EUV B;  2WYQ A;  3MTN B;  2KC2 A;  3NS8 A;  5CX3 A;  1WGG A;  1P9D U;  2N9P C;  2O6V B;  1WRD B;  4AUQ C;  4JGH B;  1EO6 A;  3M63 B;  4MH0 E;  4A20 A;  2KO3 A;  2O2V A;  3IFW B;  4MGI E;  4WJP A;  4GN1 A;  3DOW A;  3W1S A;  2KWV B;  3GZN I;  3EHV A;  3M3J A;  2LVO A;  2NS5 A;  2IY0 B;  3QCA A;  1WZ3 A;  2CHX A;  3PRE A;  3V6E B;  3CST A;  1VCB A;  2IO0 B;  4WJN A;  4I6L B;  1WX9 A;  3PGE A;  3H7P A;  2M1M A;  1A5R A;  1ZKH A;  3RT3 B;  4BOS C;  4DWF A;  1E8X A;  2YVC A;  1MG8 A;  4HXD A;  4BKS A;  2ZNV B;  4W9J A;  3N30 A;  2CR5 A;  4BBN C;  2KFK A;  5LXH A;  3UF8 A;  1WIA A;  2LXA A;  4HWI B;  4IC7 B;  1P1A A;  2L05 A;  2KLC A;  4IWO A;  1UD7 A;  1UBQ A;  2IO3 B;  4GSW A;  3T9L A;  3A1Q B;  2N1V A;  2JVC A;  2AWT A;  2LRU A;  4NQL B;  2MA9 B;  2KC1 A;  2OJR A;  3PZD A;  1YX6 B;  2B3A A;  3APD A;  3KH0 A;  5E6O A;  2L76 A;  2PE9 A;  4EEW A;  1P0R A;  3L0W B;  3OJ4 B;  4OVV A;  4PYZ A;  1S1Q B;  2DX5 B;  5JHA A;  2KNB A;  2KQS A;  1E7U A;  1RFA A;  2CS4 A;  4X57 B;  4BVU C;  5KHO A; 
#chains in the Genus database with same CATH topology
 4GU2 A;  1WE7 A;  2DZI A;  2WXK A;  4NNJ B;  4ZRP A;  1C1Y B;  4JPS A;  3H7S A;  3EFU A;  1GNU A;  4HCP B;  2KX0 A;  4WQO B;  1STE A;  1LO5 D;  1GOZ A;  2MWS B;  5J17 A;  2VRR B;  4P6V F;  2FBW B;  1OEY A;  3JVZ X;  2JRI B;  3VH3 B;  3VR9 B;  1VRA B;  4BKT A;  1WXQ A;  3NVZ A;  2KOX A;  2DZM A;  1UBI A;  1SB3 C;  2FE8 A;  2INC C;  3AV8 A;  4M0W A;  1QOG A;  2BVC A;  2REX A;  3GE3 C;  2WDR B;  3ZJV A;  4ICV A;  3A9K B;  4WWO A;  5IKC M;  4W9H A;  3B1L X;  1E7P B;  3C0R B;  3VDZ A;  3K9P B;  4YSX B;  2KYW A;  5AZG A;  3A4R A;  2L0T A;  3VXW A;  3VTW A;  1BT0 A;  3AE9 B;  4ICU A;  4IM0 A;  4MJS B;  2MP2 B;  2D10 A;  4E74 A;  3Q3F A;  4KIK A;  4KDL B;  4C7Y A;  4L1B A;  3NZ3 A;  4KKI A;  2CJN A;  3SFE B;  3B2F A;  3EGR A;  1WXV A;  4A3O A;  2WWZ A;  1TBE A;  5LXI B;  2HJ1 A;  1TTN A;  1KFY B;  4LNO A;  2JF5 A;  1MFW A;  2D3C A;  5BYQ A;  2MJD A;  1TY2 A;  4C80 A;  1GB4 A;  3ZKJ C;  1TKE A;  1R4N I;  2RSU A;  1RWS A;  2CHZ A;  3TSS A;  4KZ0 A;  3H9D A;  4B6W A;  1GUA B;  4J3O D;  3K9O B;  4II2 B;  3UI3 A;  3DHG C;  2M0X A;  1L7Y A;  3VTV A;  3ZLZ A;  2ZPN A;  2FUH B;  3PHX B;  5AZF A;  1IP9 A;  4RF1 A;  3OAW A;  3I9V 1;  3UQA A;  1FO4 A;  2LUE A;  1YQ3 B;  3KW5 B;  1GB1 A;  4P16 A;  2JUO A;  2QIE B;  2O6V D;  1NBF C;  2W3S A;  2M17 A;  5J18 A;  1I35 A;  1V1P B;  2N9X A;  2LUM A;  2PPH A;  1LM8 B;  1SF0 A;  4YWG G;  1GAQ B;  2KMA A;  4KGS A;  3TEW A;  2R61 A;  1DYQ A;  2LHD A;  4ZOH C;  4L2Y A;  4IKG A;  3V62 A;  2WQY B;  3N1Z C;  5IAA C;  3BYT B;  3OJ3 A;  3DHH C;  2FCQ A;  4LK0 M;  2M4N A;  3WAN A;  3RNE C;  4FBJ B;  3HM3 A;  5TR5 A;  1T0S C;  2IGG A;  3Q8F A;  1QQR A;  2ZNV C;  1UEL A;  1D6E C;  4BKG A;  2K6Q A;  1WZ0 A;  1OEY J;  4D2K A;  3W2D A;  2K3U A;  1WWT A;  3AEE B;  2I38 A;  2JZP A;  2VH2 A;  2GRI A;  4DHZ E;  3AEA B;  2A5U A;  5JZE B;  2C7N B;  4LNI A;  1T3Q A;  3I5J C;  1NI3 A;  1SIF A;  1E8Z A;  4NPN A;  3MHZ A;  2KMC A;  2EKI A;  1JCK B;  4DXF A;  1WGD A;  4DDI D;  2INP E;  3DQV A;  4HK2 A;  4TQ0 A;  5LLI A;  1ZP0 B;  3IG3 A;  4AQ7 A;  4IW0 A;  2PLP A;  4K3B A;  1FCC C;  1WMH B;  3PLV A;  3AE6 B;  3L54 A;  1TS2 A;  2ZCC A;  1QOA A;  3A9J B;  4A3P A;  2NPT B;  2BGF A;  3NJT A;  2KN4 A;  2MBH A;  4WAA A;  3DBH B;  1H8C A;  2BS2 B;  3AEF B;  1GG3 A;  3ZNG C;  3HUI A;  3PT2 B;  5G5G A;  3NS1 A;  3DBR B;  1F9J A;  2DLB A;  3MP9 A;  1GC7 A;  2LGD A;  2WDV B;  4MM3 A;  2Y3A A;  4HRO A;  4RM9 A;  2Q5W D;  1WJU A;  5DPT A;  5HKH A;  4EKU A;  3L10 B;  2DBY A;  2PKO A;  1AN8 A;  2V3S A;  2LGY A;  4XDD A;  3ENE A;  3L4P A;  3E9S A;  2KTF A;  2L8J A;  4H2A A;  1QLB B;  3GB1 A;  1XCT L;  5BMH A;  1SE9 A;  2JXT A;  4RCO A;  1PQS A;  3JSV B;  4OZC A;  5J2R A;  5C2T B;  4W9C A;  2PEA A;  3A1Q A;  4ZHO A;  1WF9 A;  4PS7 A;  2KT7 A;  2JWZ A;  4ZRI A;  1GPX A;  2J4X A;  3PHW B;  4JL9 A;  1LGR A;  5FR6 A;  2BBC A;  2PE6 B;  4UDU C;  3Q8A A;  1F2R I;  1KTK A;  4GGQ A;  1KLU D;  2MH7 A;  2LGI A;  4TMA B;  3GOE A;  1AAR A;  4EZL A;  2VZK B;  3CWI A;  4YTN B;  2H88 B;  3EC8 A;  1L6U A;  2JPH A;  1E8W A;  3OLM D;  1WI0 A;  4MH8 A;  3ZXV A;  1IBX B;  2WX0 A;  4W9E A;  2J42 A;  4ASW C;  2KDB A;  4IOI E;  2V9H A;  2ZVO A;  3M95 A;  1M4V A;  1V81 A;  4HJK A;  4YT0 B;  2C7H A;  4GDK B;  1WYG A;  4FLH A;  5D7G A;  3ZW3 A;  1Y8R C;  2KVR A;  1PGB A;  1FNU A;  2NCN A;  1FFU A;  4KGT A;  4TV3 A;  2CU1 A;  1N60 A;  2JRH A;  1S3S G;  4DQO C;  1WGY A;  1VLB A;  3DWM A;  1L5P A;  1F1H A;  1UNS A;  3EEC A;  2WX1 A;  4K7S A;  1KF6 B;  1NI2 A;  1AWD A;  2K6D B;  1PGA A;  4RGN A;  4TUU A;  1FEH A;  1XCQ L;  2V4L A;  3ZNH B;  2BTE A;  4XDC A;  2WS3 B;  4XGA B;  2EMS A;  5CX3 A;  1JML A;  1UWX A;  1C77 A;  2N9P C;  4JGH B;  1EO6 A;  4MH0 E;  2BB5 A;  1WZ3 A;  2WXI A;  4A8X C;  2IPK D;  1VCB A;  5JXV A;  3PGE A;  4BOS C;  1ZUD 2;  4BKS A;  1MG8 A;  2KAJ A;  3U7Z A;  4REZ A;  2CR5 A;  1EU4 A;  2LXA A;  1P1A A;  2SAK A;  4US9 A;  3NVV A;  1P7F A;  2MA9 B;  3PZD A;  1I7H A;  2B3A A;  3KH0 A;  2ZW0 A;  5EE1 A;  5E6O A;  3ZJT A;  1PUT A;  1TZO A;  3L0W B;  5IN7 A;  4X57 B;  2CS4 A;  3BK1 A;  2KD0 A;  3IHP C;  2LRW A;  1HZ5 A;  2JU6 X;  3SHQ A;  3KWL A;  2N0S B;  2LZ6 A;  3A33 B;  4PYU A;  5L83 A;  5H92 C;  3APF A;  1D4B A;  3R3M A;  2TSS A;  1HQR D;  1WE6 A;  4K1R B;  3UIP B;  1SGH A;  5C1Z A;  3QAQ A;  4ANX A;  2QDF A;  2ONQ A;  3KUD B;  2I1J A;  1YJJ A;  3FIL A;  4ANW A;  1K50 A;  3RUL A;  1JWA D;  2LFI A;  2K0P A;  2ZEQ A;  1B1Z A;  3ML8 A;  4FAD A;  4QAY A;  5BYS A;  4WQM A;  3NOB A;  4RNA A;  3VH4 B;  2ASQ A;  2DEN B;  2PTL A;  3DVN V;  3IXS A;  4YSY B;  1N5X A;  1J7C A;  4US8 A;  3B0A A;  2GOW A;  2BYT A;  3GE8 C;  1K52 A;  3TL5 A;  4C4V A;  5TSS A;  1WM3 A;  2M56 B;  4LCD E;  3T3O A;  1V80 A;  1UWM A;  2L7R A;  4G11 A;  1LFD A;  2OHF A;  4TQ1 A;  4URK A;  3AB5 A;  5CTR C;  5C23 A;  3TUO A;  2E6X A;  2J0J A;  2ACZ B;  1R4M I;  2BKF A;  1FM0 D;  2O2V B;  5G2N A;  3RCZ A;  1WX7 A;  3HHM A;  1YQB A;  4K7W A;  2J0K A;  3ZGZ A;  3MHS D;  3MC0 B;  1NVI D;  3BIN A;  3H7P B;  1T0Y A;  3DBL I;  4HRS A;  3RFZ B;  4B0E A;  1TY0 A;  2MRP A;  2GI9 A;  1TKY A;  1OTR B;  1ZGU B;  4TKN A;  3T8M A;  1V49 A;  1DOY A;  1WXM A;  3WA0 A;  2AYO B;  1WY8 A;  2FID A;  2KKC A;  1QT9 A;  2DZK A;  5IP4 D;  2SEB D;  4KVG B;  1WGK A;  4M00 A;  4W9L A;  1V2Y A;  4K3C A;  3ZNZ B;  1NDD A;  2VH1 A;  2GBN A;  3RMK C;  2DYM A;  1OGW A;  1ZOY B;  1FRR A;  4GOC A;  1ZDV A;  2DHZ A;  2DYB A;  2KJH B;  1JWB D;  3QQ8 B;  4KKJ A;  3P2B A;  2C9W B;  2K8B A;  3AU4 A;  1WSP A;  1OQQ A;  2IYD B;  3BWU D;  2J0M A;  3ECI A;  4IM3 A;  1L4Z B;  2NVU I;  4M0W B;  3PRZ A;  4NAW A;  4NJC A;  4BBN F;  2E3T A;  1V1O A;  4GLS C;  1C4A A;  2OJW A;  2AQ2 B;  3VAW A;  4XE0 A;  4MGZ E;  1WR6 E;  1WM2 A;  1HTO A;  4KIK B;  2QHO A;  1EU3 A;  2J7Q B;  5DPW A;  3R2T A;  3AH7 A;  3U7D A;  2A4Z A;  3HRD D;  2LJ5 A;  5MPO A;  1DGJ A;  2MP2 A;  1J0G A;  2GBJ A;  1WFY A;  2FUG 1;  2NBV B;  5EDS A;  3UQB A;  1I42 A;  4HPM B;  3GZN B;  2BPS A;  3M62 B;  1CMX B;  4LNN A;  3QX1 A;  5I4D A;  3DPD A;  2O6V A;  4FA6 A;  1FNV A;  3O65 B;  1KH0 A;  4ITK A;  2HDE A;  5E6P A;  1JRO A;  2LWP A;  4PT5 A;  4S0R A;  4XC2 A;  4ZRJ A;  3LYY A;  3I3T B;  3O13 A;  4A55 A;  3P4Q B;  3QC8 B;  2IBI B;  3Q8E A;  5D94 A;  2X38 A;  4NY0 A;  4RGT A;  1V6E A;  3QAR A;  4GXB A;  1K8R B;  2BB6 A;  5E6N A;  5KHQ A;  1SJH D;  1I4R A;  3BYY B;  2NR2 A;  2Y5B B;  1SE4 A;  1TS4 A;  2M8S A;  2WDQ B;  4CHK A;  4EUT A;  3QWZ B;  1FPY A;  2FIF A;  3APC A;  2LEK A;  2RD0 A;  1YN3 A;  3VRA B;  3SR6 A;  1E7V A;  4M02 A;  1VR9 A;  5HI1 A;  1ACC A;  5G55 A;  3DWG C;  4IM2 A;  2IZV B;  4DK5 A;  3RZW C;  4F7Z A;  4RMA A;  2MHJ A;  4G50 A;  2D3A A;  2D5G A;  1QOB A;  2HTM E;  1MHH E;  1YN5 A;  4YL8 A;  2D3B A;  4FUL A;  2PW9 A;  5GXG B;  4K7U A;  2BYE A;  2AQ1 B;  4DXA B;  4HPL B;  4M8M A;  3ETR A;  2KAN A;  3IT4 B;  4HDO A;  4HVB A;  1HA5 A;  1TIF A;  4W9I A;  3RUI B;  2HD5 B;  3KYD D;  1RM6 C;  2KWC A;  2Z0E B;  4DHZ B;  3LB8 C;  2KHW B;  3LDZ E;  1JWM D;  2WLB A;  3B08 A;  4W9D A;  3VFK A;  1V97 A;  2FCN A;  1MG4 A;  2W55 A;  2EMT A;  4FJY A;  3TEX A;  2WP9 B;  4F1S A;  2K8C A;  2RR9 A;  3QHT A;  3C19 A;  1E9M A;  1KOT A;  4B0M A;  5CHW A;  1WRI A;  4MAC A;  5D3D A;  4WAF A;  4JQW C;  2CKH B;  2WU2 B;  4MT5 A;  3PZ8 A;  3H8H A;  2KZR A;  1JWS D;  1EUV B;  3RPF C;  4MM3 B;  4C00 A;  3GP7 A;  2PMV A;  3M63 B;  1QIL A;  4A20 A;  2KO3 A;  2IJ0 A;  3DOW A;  3W1S A;  3MFG A;  2CHX A;  2WXQ A;  4I6L B;  3AN1 A;  1IGD A;  1ET9 A;  2QMT A;  3RT3 B;  4HXD A;  1TS5 A;  3N1Y C;  1FD6 A;  2KFK A;  3UF8 A;  2LJI A;  4HWI B;  2MJE A;  1CK1 A;  1N63 A;  1BXT A;  1UBQ A;  4GSW A;  3IAM 1;  1UUP A;  3A1Q B;  1TKG A;  2LRU A;  2N1V A;  4NQL B;  2OJR A;  3ZYY X;  2L83 A;  1CZP A;  4OVZ A;  4RH6 A;  4OVV A;  1N62 A;  1S1Q B;  5JHA A;  4XYC A;  2KQS A;  1RFA A;  5KHO A;  2MBQ A;  3W1S C;  3Q8C A;  3BVG A;  3FAH A;  4ZHP A;  1Q10 A;  2BWF A;  4ZRK A;  5GMV A;  5T8I A;  4ZYS A;  1KJT A;  2WDT B;  2IDY A;  3L16 A;  2V3N A;  3J9C A;  4L23 A;  1Z2M A;  2AQ3 B;  3ZRF A;  5D2M B;  2GBR A;  1N61 A;  2BT6 A;  3PS6 A;  2QIL A;  2W54 A;  2MQJ A;  1JW9 D;  2CU3 A;  1FRD A;  3DCG A;  1TGZ B;  4N59 A;  4P1B C;  3MC9 A;  4TSS A;  3DVG Y;  1YN4 A;  2WGS A;  1XQQ A;  2BW2 A;  2JYE A;  1VDV A;  3ML9 A;  4GB9 A;  2RDH A;  1Q0W B;  3Q2A C;  1YNT E;  4BOZ B;  1JWU D;  4MEM A;  3I63 C;  4BZA A;  5H8Y E;  3W5V B;  4XX5 A;  4YTM B;  2N9E B;  1IPG A;  3N1X C;  2MX2 A;  3E56 A;  1YX5 B;  3RNC C;  1L0Y B;  2BYF A;  1KRH A;  2WU5 B;  3TEY A;  1MVK A;  2R2O A;  1WGH A;  2KWU B;  3WCQ A;  3ZIM A;  2ZJD A;  4CQN A;  2VZK D;  1TJE A;  4AP4 C;  3R7R A;  1EF5 A;  2KQ7 A;  4AWJ A;  2AEH A;  3SD5 A;  5AZH A;  1IYF A;  1YD8 U;  1CQV A;  5CHV C;  1TZ1 A;  1WGR A;  3CIR B;  4LJO B;  4PS8 A;  1IGC A;  2XK5 A;  3KWV A;  3KLS X;  3PO0 A;  2LGX A;  4DXG A;  2FCS A;  1YMH E;  4FHJ A;  2WXF A;  1ZXH A;  2K22 A;  2RPV A;  3P1M A;  4O1N A;  3PV1 A;  3WAP A;  3JW0 X;  2GBM A;  1FNW A;  2N7E A;  2KTR B;  4MDK E;  3W1Y A;  2AL6 A;  4W9F A;  4B95 A;  1YOV B;  1E0Z A;  1RRB A;  4RF0 A;  5AEK B;  2LXC A;  3H6N A;  4GDL A;  1SJE D;  2H89 B;  4MGY E;  5IO9 A;  5L95 C;  1JRP A;  3NHE B;  4EZJ A;  3PRM B;  2LHE A;  1OFF A;  1RAX A;  3AED B;  3IVF A;  2BQQ A;  4HJG E;  4BFR A;  1N5W A;  3ZTD A;  2AX5 A;  2EEL A;  2MJ3 A;  1RFK A;  2AL3 A;  5DPR A;  2ON8 A;  1C4C A;  2DAJ A;  3JYU A;  3OG5 A;  1E10 A;  3B2G A;  1T0Q C;  2JY6 A;  2L00 B;  4JIO U;  1AW7 A;  1ESF A;  1I4Q A;  2D11 A;  3NZU A;  3T3N A;  5DCN A;  1F0Z A;  3ZXR A;  2G9H D;  3FIL B;  4EE2 A;  3QIJ A;  1FFV A;  3MJW A;  2RDG A;  2G4D B;  2BWE S;  1C78 A;  1C76 A;  1V5T A;  5BYR A;  4LJP B;  3V60 A;  4WWP A;  1MI0 A;  2GLS A;  4IUM B;  3V61 A;  3UIN B;  2WXH A;  1VZ8 A;  2DYO A;  4ARC A;  4CYE A;  4C4V B;  3V3X A;  3P63 A;  1JAL A;  3TBL D;  1WYW B;  1JQ4 A;  4P1C C;  3RYT A;  3P4P B;  1KM7 A;  3Q8B A;  5IA7 A;  1B9R A;  1R4M B;  2PVO D;  4ACF A;  1WXS A;  3Q14 C;  1VZ6 A;  2JSV X;  1E8Y A;  1SBB B;  2G1E A;  1Y56 A;  3SU8 X;  4KGR A;  3RD2 A;  1P7E A;  3DBL B;  1WR1 A;  3NG0 A;  1SXT A;  1SE3 A;  1H4R A;  5IOI A;  3UGB B;  2G45 B;  1YIW A;  1ISN A;  3Q3O C;  4K81 A;  4HEA 1;  2W82 A;  2KK8 A;  2B76 B;  3PRP B;  4WJQ A;  2JWU A;  1HTQ A;  1KLG D;  3SDL C;  2ICI A;  3AI5 A;  4KZC A;  4C7Z A;  1C3T A;  4DBG A;  3L08 A;  3N20 C;  1C9F A;  3HK0 A;  1SE2 A;  3BVZ A;  4WWN A;  2QEJ C;  1BUI C;  2L0F A;  3AEB B;  4ZYN A;  3IT6 B;  4DHJ B;  2OOB B;  2G4S A;  1Z5S B;  4NQK E;  2Z59 B;  3PPA A;  1E5W A;  4AJY B;  4OW0 A;  3P4R B;  2G3Q B;  5HG2 A;  4AOF A;  2JX5 A;  2PVG C;  1VJK A;  3TIX A;  4PS3 A;  3H1U A;  3RNB C;  1NEK B;  1VD2 A;  4FJV B;  4RGO S;  2LVP A;  4HDQ A;  3URY A;  3RI7 C;  4J6I A;  5EE3 A;  3TMP B;  4P7I A;  3OWE B;  3VTU A;  2J52 A;  1P3Q U;  1Q1O A;  4E71 A;  3CMM B;  2MBE A;  1WH3 A;  4NAW B;  3VUY A;  2X8X X;  2K39 A;  4MEL A;  1QOF A;  5D6J B;  2W9N A;  1T0R C;  2UWQ A;  2GMI C;  4OZA A;  4FXC A;  5DPS A;  4GMV A;  1GJZ A;  4DHJ D;  3A9K A;  2V1Y A;  4WJO A;  4USA A;  2JZZ A;  3NRZ A;  3HIZ A;  3SEB A;  3Q69 A;  4Q2J A;  4I6P A;  4KDI C;  2BYV E;  2C7M B;  2YEP B;  1L2N A;  1XLP A;  2D3G A;  4JE3 B;  4MJS A;  3ZJU A;  3U2S C;  3QJZ A;  4S17 A;  1HE8 A;  2RPQ A;  2DNF A;  4IG7 B;  4HKQ A;  2JT4 B;  3BZD B;  3WAO A;  2RMM A;  3CSF A;  2JXX A;  4RM8 A;  1X1M A;  1LXD A;  2NBW B;  2D2Q A;  1VZ7 A;  4NJ7 A;  3ZQ4 A;  4ARI A;  3AE5 B;  2L52 A;  3MTN B;  2WYQ A;  1XLO A;  2KC2 A;  4YSZ B;  1WGG A;  1C79 A;  1P9D U;  2O6V B;  1WRD B;  4AUQ C;  1R4N B;  4GN1 A;  2KWV B;  3GZN I;  4RGM A;  2NS5 A;  3AE4 B;  2IGH A;  1ET6 A;  3V6E B;  3CST A;  3ABV B;  2IO0 B;  4WJN A;  1WX9 A;  2M1M A;  1ZKH A;  2KAC A;  1TT5 B;  1E8X A;  3AEC B;  2OED A;  2ZNV B;  4W9J A;  5LXH A;  3NVW A;  1WIA A;  5AUI A;  3EA6 A;  2KLC A;  2IO3 B;  3C8Y A;  2JVC A;  3AE3 B;  1MPE A;  2KC1 A;  4JX1 C;  3APD A;  3EUB 2;  4EEW A;  1P0R A;  1K53 A;  1V8C A;  2KNB A;  1E7U A;  4BVU C;  2D07 B;  3B9J A;  1AYF A;  3RNF C;  4EOY A;  3U8Z A;  4RFB A;  1PFD A;  2YLM A;  1V1P A;  1J7B A;  5C3J B;  3U30 A;  5BO4 B;  1TS3 A;  1OQY A;  2CHW A;  4WH4 A;  5LNK 1;  3PZ7 A;  1EF1 A;  4NZL B;  2WHI A;  2NTS A;  2MSE D;  1L6V A;  1RYJ A;  3QK0 A;  3UIO B;  2MBB B;  2RGF A;  2L32 A;  3NZS A;  1OQR A;  3KVF B;  4IWQ A;  2NTT A;  2MEK A;  4FN2 A;  2K25 A;  1XO3 A;  3ONS A;  1RLF A;  2RDB C;  3VHT C;  2I1K A;  2YEP F;  1LQB A;  4LTU A;  2HJ8 A;  1FXT B;  2N1W A;  3PSE B;  2Z0D B;  3VR8 B;  4HCN B;  1R7S A;  2IND C;  2KQ4 X;  1L4D B;  1EWC A;  4PK1 A;  2UU7 A;  4W9G A;  1U4A A;  2KDE B;  4II3 B;  2INN E;  3QA8 A;  4N9F 4;  1KLV A;  1NEN B;  3U52 E;  2KVZ A;  4KSL C;  1WX8 A;  2N9L A;  4OZB A;  2FNJ B;  4MGK E;  3ZNI D;  4E3C A;  2XN9 C;  1WMH A;  2BS3 B;  1MJD A;  2N7D A;  2QSD A;  2Y5C A;  3A9J A;  2NPT A;  2XEW A;  3X23 A;  1NYQ A;  2C5L C;  4AS1 A;  3DBH I;  3FKY A;  4WUR A;  3ZO5 B;  4AJW A;  1FIQ A;  2KFJ A;  3VQI A;  2IY1 B;  2PJH A;  3DBR I;  4M01 A;  4OVU A;  5BMG A;  3R7Q A;  4R3D A;  3WAL A;  1TYG B;  3AU5 A;  2DAF A;  3S2A A;  1XXG A;  3BY4 B;  1YQ4 B;  4HPP A;  2MBO A;  1P98 A;  4ANV A;  1E6E B;  2HE7 A;  2KFK B;  4M8N A;  2WXJ A;  2LAS A;  3NUH B;  2GBK A;  1WXA A;  4XWT A;  1I4G A;  4GIV A;  1MHX A;  4MSM B;  2CJO A;  4JLC A;  4OHJ A;  3ZTC A;  3HM6 X;  2I2Y A;  1L0V B;  4EZK A;  3AE1 B;  1D5M C;  2V3P A;  2JQR B;  1J19 A;  1J8C A;  3AE8 B;  3JSV A;  4ANU A;  1F77 A;  4ZRQ A;  3W5U B;  3IBE A;  4G0N B;  4HKZ E;  4LDT B;  1UGM A;  3HVZ A;  1ZW7 A;  3AE2 B;  2N7J A;  5BMI A;  2Y5P A;  5AUK A;  1A70 A;  3VUW A;  2NBU A;  1EM7 A;  2WXG A;  3BII D;  2V4I B;  1IUE A;  3KYC D;  3TCA A;  2KX3 A;  2DZJ A;  1V5O A;  1I4H A;  2UYZ B;  2JYT A;  1SIJ A;  2WXP A;  3U4E G;  1EWY C;  1FXI A;  3W9C B;  2EKE C;  1F52 A;  5E6J A;  1D5Z C;  3KUZ A;  1XLN A;  1WJ6 A;  2KJ6 A;  1SSN A;  2LI5 A;  2LGS A;  1UH6 A;  3ALB A;  2DWQ A;  2NMQ A;  1IBX A;  3ZDT A;  2WNM A;  4KV2 A;  4G3X B;  5CHF A;  3TJP A;  1FXA A;  1L0X B;  2MLB A;  3PTF C;  4GDK A;  2IO2 B;  3MC8 A;  4XWW A;  4FJZ A;  3N9Y C;  3GS2 A;  2JZ3 B;  3BVM A;  2ZCB A;  4DDG D;  4LDT D;  4IDI A;  4YXD B;  4BAX A;  3V6C B;  1ENF A;  3AMZ A;  4A9A A;  3IAS 1;  2LMC A;  2BF8 B;  3DDC B;  2KDF B;  1FMA D;  2K1F A;  5FKA C;  3AE7 B;  3LXF A;  1D5X C;  1M94 A;  1J7A A;  1F2R C;  4KSK C;  4CO7 A;  1V9J A;  1ZE3 D;  4C56 C;  2C60 A;  4XZ4 A;  3D32 A;  5HFY A;  1XEE A;  2K8H A;  3VUX A;  3Q3N C;  3SFD B;  2XK5 B;  4B9K A;  1DOI A;  5G5H A;  1G6J A;  2K5P A;  2N4F A;  2ZPY A;  1UZX B;  3DHI C;  4F8C B;  2W3R A;  3R66 C;  3ZRC A;  4HLE A;  3VRB B;  2R2Q A;  2HTH A;  2Z8L A;  1ZDX A;  2LVQ A;  2IO1 B;  1XD3 B;  3AXC A;  1NYR A;  3KUC B;  3DVG X;  3R2I A;  2XBB C;  3TEZ A;  2WXL A;  3NVY A;  3WIM A;  1I4X A;  1JRU A;  3MJ5 A;  3RN9 C;  4GDL B;  3L17 A;  2V0G A;  1HXY D;  2KTR A;  2ZVN A;  5EE9 A;  3ZUN A;  4JWU C;  3N32 A;  2KLG A;  2BS4 B;  2KXJ A;  3ZVV A;  2MCN B;  5FR3 A;  4N58 A;  1ZXI A;  4WIP A;  3DBS A;  4ZDV A;  3RNA C;  4FHK A;  3L13 A;  1T6B X;  3AUL A;  1QZE A;  1WJN A;  4EFO A;  2WXR A;  2PIA A;  3X0W A;  3VVW B;  1T5X D;  1HZ6 A;  2KDI A;  1V86 A;  3FC4 A;  2M0A A;  1K51 A;  4BKS D;  5EE0 A;  2ZZP B;  3RZF A;  2QJL A;  2KJR A;  1XF5 L;  2N9K A;  1WJ4 A;  3LJ3 A;  2MW5 A;  3CF6 E;  2KDM A;  1CJE A;  1SEB D;  3DVN U;  4I6N B;  3PLU A;  2QCZ A;  3KQ4 A;  3A4S C;  1C4P A;  1BML C;  4LLG M;  3Q3J A;  1FCL A;  2IGD A;  1DOX A;  4JWS C;  1E90 A;  2WXM A;  5JH5 C;  3AEG B;  1XLQ A;  3EFC A;  1YJ1 A;  4NAM A;  4N6E B;  2LD9 A;  4A6Q A;  4MSQ B;  3N3K B;  2K9X A;  4WWM A;  3WAM A;  2KN5 A;  1D3Z A;  4YTP B;  4NJ6 A;  3HVD A;  4IWP A;  5HHD G;  3RNG C;  3NY5 A;  1UF0 A;  2L3Z A;  5JHB A;  3ZDM C;  2FAZ A;  1ROE A;  2L1A A;  4W9K A;  1PDX A;  1XT9 B;  3V05 A;  3Q6B A;  1QF6 A;  1Q5W B;  2BKR B;  2ZW1 A;  1GC6 A;  3PVL A;  5FK9 C;  2KMM A;  2FCM A;  1ZPS A;  3I57 A;  3NS8 A;  2QC8 A;  2J53 A;  2WXN A;  1HEZ E;  2GB1 A;  2O2V A;  3IFW B;  4MGI E;  4WJP A;  1N6Z A;  4KX6 B;  3M3J A;  3EHV A;  2LVO A;  2IY0 B;  3QCA A;  1PYW D;  3PRE A;  3H7P A;  2M19 A;  1A5R A;  4DWF A;  2YVC A;  1PGX A;  3P4S B;  5D3I B;  2XNA C;  3N30 A;  4BBN C;  4IC7 B;  1QKZ A;  2L05 A;  3P42 A;  1I4P A;  4IWO A;  1UD7 A;  2KWD A;  3R8B A;  4LNK A;  4A90 A;  3T9L A;  2AWT A;  3Q3M C;  1YX6 B;  3BK2 A;  2L76 A;  2PE9 A;  4LNF A;  3OJ4 B;  1YJI A;  4PYZ A;  1UGJ A;  2DX5 B;  3AM9 A;  2WXO A; 
#chains in the Genus database with same CATH homology
 4GU2 A;  1WE7 A;  2DZI A;  2D07 B;  4NNJ B;  2MBQ A;  2KD0 A;  3IHP C;  3W1S C;  4EOY A;  1C1Y B;  3U8Z A;  2LRW A;  3H7S A;  3EFU A;  1GNU A;  4HCP B;  2KX0 A;  2YLM A;  4WQO B;  3U30 A;  2BWF A;  3SHQ A;  4ZRK A;  5GMV A;  5BO4 B;  1KJT A;  1OQY A;  2LZ6 A;  2CHW A;  2MWS B;  3A33 B;  4PYU A;  5L83 A;  2WDT B;  5J17 A;  2VRR B;  1EF1 A;  3JVZ X;  1OEY A;  3L16 A;  3APF A;  2JRI B;  2MSE D;  3VH3 B;  1Z2M A;  3ZRF A;  4BKT A;  3R3M A;  5D2M B;  3QK0 A;  1WE6 A;  4K1R B;  3UIO B;  2MBB B;  2RGF A;  2KOX A;  2DZM A;  3UIP B;  2GBR A;  3NZS A;  1UBI A;  3KVF B;  3PS6 A;  4IWQ A;  1SGH A;  4FN2 A;  2K25 A;  3ONS A;  5C1Z A;  1RLF A;  3QAQ A;  4ANX A;  3VHT C;  2MQJ A;  2I1K A;  3KUD B;  3DCG A;  1TGZ B;  1LQB A;  2I1J A;  2HJ8 A;  3DVG Y;  2REX A;  4ANW A;  1FXT B;  3RUL A;  2N1W A;  1XQQ A;  3A9K B;  3PSE B;  4ICV A;  2Z0D B;  4WWO A;  4W9H A;  3B1L X;  3ML9 A;  4GB9 A;  2ZEQ A;  1Q0W B;  3C0R B;  3ML8 A;  4HCN B;  3VDZ A;  4BOZ B;  3K9P B;  4MEM A;  4FAD A;  4XX5 A;  5AZG A;  3NOB A;  3A4R A;  2L0T A;  3VH4 B;  3VXW A;  2N9E B;  1IPG A;  2ASQ A;  4W9G A;  1U4A A;  2KDE B;  2DEN B;  3VTW A;  4II3 B;  2MX2 A;  3DVN V;  3QA8 A;  1BT0 A;  4N9F 4;  4ICU A;  1KLV A;  4IM0 A;  4MJS B;  2MP2 B;  1YX5 B;  2D10 A;  2BYF A;  4KSL C;  4E74 A;  3Q3F A;  1WX8 A;  3B0A A;  2R2O A;  1WGH A;  2GOW A;  2KWU B;  4KIK A;  4KDL B;  2FNJ B;  4MGK E;  3ZIM A;  2ZJD A;  3ZNI D;  4E3C A;  3TL5 A;  1WMH A;  1WM3 A;  2N7D A;  1WXV A;  4LCD E;  4AP4 C;  1V80 A;  3R7R A;  1EF5 A;  2KQ7 A;  2L7R A;  4A3O A;  4AWJ A;  2AEH A;  3A9J A;  3SD5 A;  2NPT A;  2WWZ A;  2XEW A;  4G11 A;  1TBE A;  5AZH A;  1LFD A;  1IYF A;  3X23 A;  1YD8 U;  2C5L C;  4TQ1 A;  5LXI B;  4URK A;  5CHV C;  5CTR C;  5C23 A;  1TZ1 A;  1WGR A;  2J0J A;  3DBH I;  1R4M I;  2BKF A;  2O2V B;  4LJO B;  4PS8 A;  5G2N A;  3ZO5 B;  1TTN A;  2XK5 A;  4AJW A;  3RCZ A;  2KFJ A;  2LGX A;  3VQI A;  1WX7 A;  2FCS A;  3HHM A;  1YQB A;  2IY1 B;  4K7W A;  2J0K A;  4FHJ A;  3MHS D;  2PJH A;  2JF5 A;  3DBR I;  4OVU A;  3R7Q A;  3H7P B;  3BIN A;  1T0Y A;  3WAL A;  3PV1 A;  3WAP A;  3JW0 X;  3AU5 A;  3ZKJ C;  1R4N I;  2RSU A;  2DAF A;  2GBM A;  3DBL I;  3S2A A;  3BY4 B;  2CHZ A;  2N7E A;  2MBO A;  1P98 A;  4ANV A;  2KTR B;  4MDK E;  4KZ0 A;  2HE7 A;  3W1Y A;  2KFK B;  2AL6 A;  3H9D A;  4M8N A;  2LAS A;  4B6W A;  4W9F A;  4B95 A;  2GBK A;  1WXA A;  1GUA B;  2MRP A;  3K9O B;  4GIV A;  4MSM B;  4II2 B;  1OTR B;  1ZGU B;  4TKN A;  3T8M A;  1V49 A;  1RRB A;  4JLC A;  2M0X A;  1L7Y A;  3HM6 X;  2LXC A;  3VTV A;  3ZTC A;  5AEK B;  1WXM A;  3WA0 A;  2AYO B;  3H6N A;  1WY8 A;  2ZPN A;  2FID A;  4GDL A;  3ZLZ A;  4EZK A;  2FUH B;  1J19 A;  2KKC A;  3PHX B;  1J8C A;  5AZF A;  4MGY E;  1IP9 A;  3OAW A;  3JSV A;  4ANU A;  3UQA A;  5L95 C;  2LUE A;  3NHE B;  4EZJ A;  3IBE A;  4G0N B;  3KW5 B;  2DZK A;  4LDT B;  1UGM A;  2JUO A;  4KVG B;  3PRM B;  1ZW7 A;  2O6V D;  1RAX A;  4W9L A;  1V2Y A;  1NBF C;  2M17 A;  3IVF A;  3ZNZ B;  5J18 A;  1I35 A;  2N9X A;  1NDD A;  2PPH A;  4BFR A;  2GBN A;  3VUW A;  2NBU A;  2DYM A;  1LM8 B;  1OGW A;  3ZTD A;  2KMA A;  4GOC A;  2DHZ A;  2DYB A;  2KJH B;  2AL3 A;  5DPR A;  3KYC D;  3QQ8 B;  3TCA A;  2KX3 A;  2DZJ A;  1V5O A;  2UYZ B;  3P2B A;  2C9W B;  2K8B A;  2DAJ A;  3AU4 A;  3V62 A;  3JYU A;  2EKE C;  5IAA C;  3OJ3 A;  2FCQ A;  2M4N A;  3KUZ A;  3WAN A;  1WJ6 A;  2KJ6 A;  2JY6 A;  2L00 B;  4JIO U;  4FBJ B;  3HM3 A;  2IYD B;  2LI5 A;  5TR5 A;  2D11 A;  3NZU A;  5DCN A;  2J0M A;  2ZNV C;  1UH6 A;  3ALB A;  3ECI A;  4IM3 A;  1UEL A;  2NVU I;  4BKG A;  4M0W B;  2K6Q A;  1WZ0 A;  1OEY J;  3ZDT A;  3PRZ A;  4KV2 A;  3QIJ A;  4NAW A;  4G3X B;  3MJW A;  5CHF A;  3TJP A;  4BBN F;  2G4D B;  2MLB A;  2BWE S;  3PTF C;  4DHZ E;  1V5T A;  4GDK A;  2IO2 B;  2A5U A;  5JZE B;  2C7N B;  4FJZ A;  4LJP B;  3V60 A;  4WWP A;  1SIF A;  2JZ3 B;  3VAW A;  1E8Z A;  2ZCB A;  4NPN A;  4LDT D;  4DDG D;  4MGZ E;  2KMC A;  1WGD A;  4IUM B;  3V61 A;  4DDI D;  1WR6 E;  3V6C B;  3DQV A;  1WM2 A;  4HK2 A;  3UIN B;  4TQ0 A;  5LLI A;  2BF8 B;  4KIK B;  3IG3 A;  3DDC B;  2DYO A;  2KDF B;  2K1F A;  4CYE A;  2QHO A;  4IW0 A;  1M94 A;  2J7Q B;  4KSK C;  4CO7 A;  5DPW A;  1V9J A;  1WMH B;  3PLV A;  3U7D A;  3TBL D;  1WYW B;  2A4Z A;  2LJ5 A;  3L54 A;  2C60 A;  2ZCC A;  4XZ4 A;  2MP2 A;  3D32 A;  3RYT A;  3A9J B;  4A3P A;  2NPT B;  2BGF A;  1J0G A;  2GBJ A;  2K8H A;  1KM7 A;  1WFY A;  3VUX A;  2MBH A;  4WAA A;  2NBV B;  5IA7 A;  5EDS A;  3UQB A;  1H8C A;  4HPM B;  1I42 A;  2BPS A;  1WXS A;  2XK5 B;  3M62 B;  1GG3 A;  3ZNG C;  3PT2 B;  1E8Y A;  4B9K A;  1CMX B;  3QX1 A;  1G6J A;  1F9J A;  3SU8 X;  3DPD A;  1GC7 A;  2LGD A;  4MM3 A;  2O6V A;  2N4F A;  2ZPY A;  1UZX B;  4FA6 A;  3O65 B;  3RD2 A;  4F8C B;  5E6P A;  4RM9 A;  3R66 C;  1WR1 A;  3ZRC A;  2LWP A;  1WJU A;  1H4R A;  4XC2 A;  4ZRJ A;  4HLE A;  5DPT A;  5HKH A;  3UGB B;  2G45 B;  1YIW A;  1ISN A;  3I3T B;  2R2Q A;  2HTH A;  3QC8 B;  2IBI B;  4K81 A;  4EKU A;  2LVQ A;  3L10 B;  2IO1 B;  2KK8 A;  1XD3 B;  5D94 A;  3AXC A;  4NY0 A;  2V3S A;  3KUC B;  2LGY A;  3DVG X;  3ENE A;  3PRP B;  2XBB C;  4WJQ A;  1V6E A;  2KTF A;  2L8J A;  3QAR A;  4GXB A;  1K8R B;  5E6N A;  3SDL C;  3WIM A;  5KHQ A;  3AI5 A;  1JRU A;  4KZC A;  1C3T A;  4GDL B;  4DBG A;  3L17 A;  3L08 A;  1SE9 A;  2NR2 A;  2KTR A;  2Y5B B;  3HK0 A;  4WWN A;  2ZVN A;  3ZUN A;  1PQS A;  3N32 A;  2KLG A;  2L0F A;  2M8S A;  3JSV B;  2KXJ A;  4CHK A;  4ZYN A;  3ZVV A;  4EUT A;  3QWZ B;  2MCN B;  5J2R A;  4W9C A;  2FIF A;  2PEA A;  2OOB B;  3A1Q A;  4DHJ B;  3APC A;  1WF9 A;  2RD0 A;  4PS7 A;  2G4S A;  2JWZ A;  4ZRI A;  1Z5S B;  3DBS A;  4ZDV A;  4NQK E;  4FHK A;  2Z59 B;  3PPA A;  1E5W A;  3L13 A;  4AJY B;  3PHW B;  4JL9 A;  1E7V A;  2G3Q B;  3AUL A;  4AOF A;  1QZE A;  1WJN A;  4EFO A;  5FR6 A;  4PS3 A;  3TIX A;  2PE6 B;  5G55 A;  3H1U A;  3X0W A;  3VVW B;  2KDI A;  4IM2 A;  2IZV B;  1V86 A;  1VD2 A;  4FJV B;  2LVP A;  4GGQ A;  4DK5 A;  3RZW C;  4HDQ A;  4BKS D;  4F7Z A;  4RMA A;  2ZZP B;  4J6I A;  3RZF A;  4G50 A;  2KJR A;  3GOE A;  1AAR A;  3TMP B;  4EZL A;  1WJ4 A;  3LJ3 A;  3EC8 A;  2MW5 A;  4P7I A;  4YL8 A;  2JPH A;  3CF6 E;  1E8W A;  3VTU A;  1P3Q U;  1Q1O A;  3DVN U;  3OLM D;  4FUL A;  1WI0 A;  4I6N B;  4E71 A;  3CMM B;  2WX0 A;  3PLU A;  2MBE A;  4K7U A;  4W9E A;  1WH3 A;  4NAW B;  2BYE A;  3VUY A;  4ASW C;  2KDB A;  2K39 A;  4MEL A;  2ZVO A;  3M95 A;  5D6J B;  3A4S C;  4DXA B;  2W9N A;  2UWQ A;  4HPL B;  1V81 A;  4HJK A;  4M8M A;  3Q3J A;  2C7H A;  4GDK B;  2KAN A;  4HDO A;  4HVB A;  2GMI C;  4FLH A;  5DPS A;  5D7G A;  3ZW3 A;  4GMV A;  1Y8R C;  4W9I A;  2KVR A;  3RUI B;  2HD5 B;  1GJZ A;  1E90 A;  4DHJ D;  3A9K A;  2V1Y A;  5JH5 C;  3KYD D;  1YJ1 A;  4WJO A;  2JZZ A;  2KWC A;  2NCN A;  2Z0E B;  4DHZ B;  2LD9 A;  4MSQ B;  2KHW B;  3LDZ E;  3N3K B;  4TV3 A;  3WAM A;  2CU1 A;  2KN5 A;  3HIZ A;  1D3Z A;  4NJ6 A;  2JRH A;  4IWP A;  1S3S G;  1WGY A;  3B08 A;  4W9D A;  2BYV E;  2C7M B;  3NY5 A;  2FCN A;  4I6P A;  4KDI C;  3VFK A;  2L3Z A;  1L2N A;  2EMT A;  5JHB A;  2D3G A;  4FJY A;  3EEC A;  4MJS A;  3ZDM C;  2WX1 A;  3QJZ A;  4K7S A;  2FAZ A;  1HE8 A;  2RPQ A;  1NI2 A;  4F1S A;  2K8C A;  2RR9 A;  3QHT A;  4IG7 B;  2JT4 B;  2K6D B;  4W9K A;  3WAO A;  1XT9 B;  3CSF A;  2JXX A;  4RM8 A;  1KOT A;  1Q5W B;  2BKR B;  4TUU A;  5CHW A;  1X1M A;  1LXD A;  2NBW B;  2D2Q A;  2V4L A;  3ZNH B;  1GC6 A;  4NJ7 A;  4JQW C;  2CKH B;  3PVL A;  2KZR A;  2EMS A;  2FCM A;  1EUV B;  2WYQ A;  3MTN B;  2KC2 A;  3NS8 A;  5CX3 A;  1WGG A;  1P9D U;  2N9P C;  2O6V B;  1WRD B;  4AUQ C;  4JGH B;  1EO6 A;  3M63 B;  4MH0 E;  4A20 A;  2KO3 A;  2O2V A;  3IFW B;  4MGI E;  4WJP A;  4GN1 A;  3DOW A;  3W1S A;  2KWV B;  3GZN I;  3EHV A;  3M3J A;  2LVO A;  2NS5 A;  2IY0 B;  3QCA A;  1WZ3 A;  2CHX A;  3PRE A;  3V6E B;  3CST A;  1VCB A;  2IO0 B;  4WJN A;  4I6L B;  1WX9 A;  3PGE A;  3H7P A;  2M1M A;  1A5R A;  1ZKH A;  3RT3 B;  4BOS C;  4DWF A;  1E8X A;  2YVC A;  1MG8 A;  4HXD A;  4BKS A;  2ZNV B;  4W9J A;  3N30 A;  2CR5 A;  4BBN C;  2KFK A;  5LXH A;  3UF8 A;  1WIA A;  2LXA A;  4HWI B;  4IC7 B;  1P1A A;  2L05 A;  2KLC A;  4IWO A;  1UD7 A;  1UBQ A;  2IO3 B;  4GSW A;  3T9L A;  3A1Q B;  2N1V A;  2JVC A;  2AWT A;  2LRU A;  4NQL B;  2MA9 B;  2KC1 A;  2OJR A;  3PZD A;  1YX6 B;  2B3A A;  3APD A;  3KH0 A;  5E6O A;  2L76 A;  2PE9 A;  4EEW A;  1P0R A;  3L0W B;  3OJ4 B;  4OVV A;  4PYZ A;  1S1Q B;  2DX5 B;  5JHA A;  2KNB A;  2KQS A;  1E7U A;  1RFA A;  2CS4 A;  4X57 B;  4BVU C;  5KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...