4MJSB

Crystal structure of a pb1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
82
Chain Sequence
LTVKAYLLDAAREIRRFSFCPGPCERLLSRVAALFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the homotypic PB1-PB1 complex between PKC zeta and p62
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/protein binding
molecule keywords Protein kinase C zeta type
total genus 21
structure length 82
sequence length 99
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4mjsB00
2KFKB 2L00B 3K9OB 1RAXA 4GMVA 2UWQA 1KOTA 4BBNC 2PE9A 1V5TA 3AU4A 3DPDA 1XQQA 4MGKE 4CYEA 4K7SA 4W9HA 2NBVB 2CHWA 4NJ7A 4LCDE 3L13A 1WY8A 3KW5B 2KC1A 3ZVVA 1UH6A 3Q3FA 4DK5A 2XEWA 4HVBA 3VH4B 2DYMA 1GJZA 1VD2A 1J8CA 3VTVA 5LLIA 2D3GA 4HPLB 3MHSD 1J0GA 4FADA 3IG3A 4LJOB 3X23A 4NY0A 1IP9A 5L95C 3KUDB 1GG3A 1WIAA 1P9DU 3K9PB 4W9JA 3GZNI 1Z5SB 4KZCA 2KJHB 3WA0A 4BKTA 3LJ3A 4FN2A 2AL6A 2JRIB 3EHVA 4MJSA 1WGHA 1WXMA 5CHVC 4NQLB 4X57B 4G3XB 1WGRA 2ZEQA 4EFOA 3NZSA 1ZGUB 1T0YA 1WJ4A 2L76A 3PPAA 3Q3JA 2JUOA 2KDIA 3VTWA 5CTRC 5DPRA 2CHZA 5D6JB 5D94A 3M63B 5J18A 2MBOA 1L2NA 1P3QU 2N7EA 1HE8A 3L08A 4KZ0A 2HE7A 5E6NA 4IM0A 1U4AA 1I42A 1P1AA 4XZ4A 1D3ZA 3X0WA 3APDA 3V62A 5KHQA 2FUHB 3ENEA 1WGYA 2LWPA 2M0XA 2M17A 3ML8A 1C3TA 3CF6E 5D2MB 4WJNA 2BWES 2LRWA 2DHZA 1V81A 1PQSA 1EF1A 1NI2A 3AI5A 4II2B 2KJRA 2IO3B 2LVOA 1KM7A 1AARA 2JRHA 2DZIA 1UZXB 2JZZA 4IM2A 4KSLC 5CHFA 1LXDA 1V86A 2JVCA 3UIPB 3B1LX 3SHQA 2KX0A 1RFAA 3PZDA 1R4MI 4GGQA 2NS5A 3PHWB 4A3PA 1OEYJ 3UINB 1WJUA 4AJWA 4ANUA 4P7IA 3PV1A 1YJ1A 1LQBA 2LVPA 3ML9A 4GOCA 1ISNA 4K7WA 2YLMA 4JIOU 3R7QA 5JH5C 3HIZA 4NJ6A 2DZKA 2HTHA 2UYZB 4MELA 2KWUB 4A3OA 3PRPB 1SIFA 4WJPA 2D2QA 4HDQA 1S3SG 1WYWB 3L0WB 4WAAA 4IWPA 2LGYA 4PS8A 1WXSA 4B9KA 3JSVB 2BPSA 2MWSB 2Z59B 4DHJB 4K7UA 3PSEB 3DDCB 1V80A 1NDDA 3R3MA 4ICVA 2KDEB 3PLVA 2ZZPB 2BKFA 4GN1A 1OEYA 1SGHA 3VAWA 3TCAA 4TKNA 5E6OA 2K8CA 1TGZB 3QARA 4GXBA 4ZYNA 2W9NA 5AZFA 4M8NA 2K8HA 2ZCBA 3VFKA 4EZLA 2EMTA 2ZPNA 2J7QB 3OJ3A 4K1RB 3ZNID 1YX5B 3A1QA 3DBSA 4CO7A 4BKGA 2RSUA 3IHPC 3NS8A 2DYBA 3ZNGC 2KN5A 1WH3A 2JZ3B 2C9WB 2K6QA 3NY5A 2KK8A 3HM6X 2LD9A 1JRUA 3DBRI 1UELA 1E90A 4HLEA 4PYZA 4TV3A 4B6WA 4WQOB 2Z0EB 3W1YA 2K8BA 4W9GA 1WX9A 4MH0E 4E71A 5GMVA 3VUXA 3VXWA 3ECIA 3EFUA 2B3AA 2MBBB 4MDKE 4MSQB 1RLFA 3ZNHB 2AYOB 4LDTB 4FULA 2KTFA 1WE7A 2MCNB 2C7MB 3PLUA 2C7HA 1WXVA 2DZMA 3QJZA 2DX5B 2C60A 3SU8X 1J19A 3ZNZB 1Y8RC 2N1VA 1WR1A 1EF5A 1WR6E 2JF5A 4GDKA 3QIJA 2GBMA 5LXIB 1IYFA 2WX1A 2JXXA 1E7VA 1SE9A 2PEAA 2ZVNA 2XBBC 3EECA 5D7GA 2D11A 4HJKA 2LXAA 3H6NA 5DPTA 2BYEA 3OLMD 3QA8A 2D10A 2G4DB 4IWOA 4KVGB 4BKSD 1WZ0A 4DDGD 2GBNA 3W1SC 3N32A 3VUWA 1L7YA 2R2OA 2FNJB 3WAOA 1H8CA 4FJVB 2MW5A 1P98A 2N9PC 2LI5A 3PRZA 2BKRB 1WXAA 1ZW7A 3A9KB 1ZKHA 3PVLA 2MQJA 2J0JA 3W1SA 2NBUA 2LASA 2G3QB 1C1YB 1K8RB 3PGEA 4BOZB 3PTFC 4K81A 2MA9B 5IAAC 4DDID 1V5OA 3WALA 5JHAA 3WIMA 4ZDVA 3ZDMC 4GDKB 2FIFA 5C23A 2GBRA 4E74A 1WM3A 2N9XA 4BFRA 2ZNVB 4IWQA 1WGGA 3MTNB 3M3JA 4OVVA 4W9CA 2KLGA 4ZRJA 4RM9A 4F1SA 3O65B 4M0WB 3PS6A 1GNUA 2G45B 2KZRA 3V60A 1WZ3A 2MP2A 2KDFB 2XK5A 3L16A 4HPMB 1FXTB 2FAZA 3QQ8B 2KX3A 2ZJDA 3KYDD 2L0TA 3L54A 2IY0B 4B95A 1WMHB 5DPWA 3QK0A 2FCMA 2OOBB 3RCZA 1WJ6A 2KXJA 4EKUA 1H4RA 1WI0A 2AL3A 3JVZX 2JPHA 3OAWA 2JT4B 4AWJA 3PREA 2KWCA 2WX0A 3B08A 4FJZA 2MSED 2O2VB 2ZPYA 4JGHB 3NOBA 5EDSA 1LFDA 1OQYA 2N1WA 3JW0X 4BOSC 3MJWA 5J17A 3OJ4B 1NBFC 2L05A 2L3ZA 1MG8A 3AULA 4FHKA 3A33B 1WM2A 3QWZB 3N3KB 2GBJA 3PT2B 4ANWA 4DWFA 4WWOA 2BYFA 1F9JA 2EKEC 4WJQA 3TMPB 3P2BA 3S2AA 3I3TB 3TIXA 3QX1A 4HXDA 3U8ZA 4BBNF 1G6JA 3R66C 1E8XA 1XD3B 2BYVE 4YL8A 2BGFA 3VQIA 4MJSB 4MGYE 5HKHA 1UBQA 2KQSA 4GIVA 3A4SC 3ZRFA 4LJPB 3ZKJC 2GBKA 3H1UA 1XT9B 3TBLD 4F7ZA 1M94A 1X1MA 3M62B 3H7PB 2O2VA 4E3CA 5CHWA 3ZTCA 1WX7A 1WMHA 2NR2A 4XX5A 3T9LA 2LGDA 1TTNA 5AZGA 4DHJD 2PPHA 2KQ7A 4FHJA 3VDZA 4AOFA 2I1KA 2J0MA 4NAWA 2FCNA 1RRBA 3ZTDA 2LUEA 2KTRA 1E8ZA 2RPQA 1WGDA 3HM3A 1WJNA 4NPNA 3ALBA 3L10B 3KH0A 3UGBB 2KVRA 3CSFA 3JSVA 2J0KA 1EO6A 1YD8U 4IG7B 4NQKE 2KC2A 2WYQA 3KUZA 2FCQA 2QHOA 4W9LA 3RZWC 4IM3A 1V49A 1UD7A 4TQ0A 3QC8B 4ICUA 4G0NB 3R7RA 1TZ1A 2LRUA 2IY1B 2Y5BB 2Z0DB 3QHTA 3RD2A 4ZRIA 5FR6A 3BINA 2RD0A 3VVWB 1GC6A 4MEMA 1KLVA 2BF8B 3A1QB 2KLCA 3ZW3A 3RULA 3JYUA 4FLHA 4JL9A 4G11A 4W9EA 2CU1A 3QAQA 4J6IA 3ZDTA 2KJ6A 2DENB 3U30A 1A5RA 2A4ZA 2KDBA 2MLBA 5J2RA 2IO0B 2A5UA 4W9DA 3WAMA 3BY4B 3ZIMA 5DCNA 2BWFA 4KIKA 5E6PA 1GUAB 4NNJB 2N9EB 5AZHA 4LDTD 3KYCD 4II3B 4M8MA 5IA7A 1E8WA 5JZEB 4GSWA 3HHMA 4MSMB 5C1ZA 1V2YA 3ZO5B 4BVUC 4A20A 2V4LA 4KDIC 2R2QA 2NCNA 3DBLI 1E8YA 2HD5B 4AP4C 4AUQC 4HWIB 3PHXB 2KANA 2V3SA 3CMMB 3APFA 3UQBA 3RUIB 1Q5WB 3C0RB 3ZRCA 1YIWA 3H7SA 3VTUA 2CR5A 4JLCA 2ZCCA 4N9F4 1Q0WB 3H7PA 3DQVA 2K39A 2ZNVC 3DVGX 3ZLZA 1QZEA 5L83A 4MGIE 3NZUA 1UBIA 3B0AA 3KVFB 2KHWB 4HCNB 2NPTA 2XK5B 1E7UA 2N4FA 1OGWA 4I6LB 4RMAA 4W9FA 3EC8A 3HK0A 1Q1OA 3SD5A 4JQWC 4ASWC 3TJPA 4PYUA 2KTRB 2MP2B 2KO3A 3DCGA 1TBEA 3M95A 2IZVB 4FJYA 4NAWB 5G55A 4KIKB 5G2NA 3SDLC 4CHKA 4HDOA 2KD0A 2N7DA 2LJ5A 5BO4B 3T8MA 1CMXB 2FCSA 2K1FA 3VHTC 3DVGY 2MBHA 1R4NI 4EUTA 3QCAA 1WE6A 4EZKA 2KMCA 2AWTA 2CS4A 3A9JA 4I6PA 2MX2A 4HCPB 4G50A 4ANXA 2LVQA 3ONSA 4MGZE 2HJ8A 4W9KA 3V6CB 4PS3A 2G4SA 2YVCA 4ANVA 3DBHI 3LDZE 2MRPA 1P0RA 1IPGA 2C5LC 4WJOA 2LXCA 2M1MA 2O6VB 1V9JA 2O6VD 2NBWB 2LGXA 4KDLB 2AEHA 3GOEA 2RR9A 2IYDB 2L8JA 4RM8A 2NVUI 3UF8A 2I1JA 4I6NB 2ASQA 3CSTA 3TL5A 3RYTA 3V6EB 3UIOB 3A4RA 5KHOA 3DVNV 1V6EA 2D07B 5CX3A 2PE6B 1WRDB 1GC7A 4OVUA 4XC2A 3WANA 4GDLA 1EUVB 1OTRB 4DBGA 4EZJA 4IC7B 4TUUA 4F8CB 5AEKB 2EMSA 2NPTB 5DPSA 2LZ6A 3UQAA 5LXHA 1YX6B 4TQ1A 4BKSA 4URKA 2IBIB 1YQBA 3L17A 4DXAB 4WWNA 1LM8B 2DAFA 2JWZA 1Z2MA 3KUCB 3D32A 4MM3A 3APCA 2V1YA 3ZUNA 3H9DA 4PS7A 2WWZA 2MBEA 2KNBA 2CKHB 3DOWA 4DHZE 4FA6A 3IFWB 2KMAA 3AXCA 3RT3B 4DHZB 3N30A 3A9KA 2IO2B 4KSKC 3VH3B 3V61A 2KKCA 3NHEB 4AJYB 4IW0A 3AU5A 2L7RA 2DZJA 2L0FA 1S1QB 3IVFA 2KWVB 2PJHA 2CHXA 2GMIC 2K25A 2ZVOA 2GOWA 2M8SA 2VRRB 4GU2A 1I35A 2K6DB 4GB9A 1WF9A 1VCBA 2OJRA 5TR5A 2REXA 2JY6A 2O6VA 1UGMA 1WX8A 2RGFA 2DYOA 3DVNU 1WFYA 4KV2A 4FBJB 2KOXA 1E5WA 4EEWA 2C7NB 2KFJA 4IUMB 2DAJA 3IBEA 4GDLB 4HK2A 3PRMB 4W9IA 3RZFA 3U7DA 2WDTB 4EOYA 2FIDA 3WAPA 5JHBA 4ZRKA 3VUYA 1KJTA 3A9JB 4WWPA 2IO1B 2MBQA 1BT0A 2KFKA 2M4NA
chains in the Genus database with same CATH superfamily
1HXYD 1KOTA 2LGSA 3HUIA 2INNE 3DPDA 3ABVB 4MGKE 2MJEA 4NJ7A 3Q3FA 3R2TA 1QOGA 3VH4B 1EWCA 1VD2A 5LLIA 2WXFA 3MHSD 1J0GA 4LJOB 3Q3MC 3X23A 1WIAA 3K9PB 1Z5SB 2KJHB 2KN4A 2QDFA 3LJ3A 1NI3A 4NQLB 1WYGA 2L76A 3PPAA 1F0ZA 2JUOA 2KDIA 3L4PA 3VTWA 5DPRA 2CHZA 5D6JB 4C7YA 4YTNB 3GS2A 4ZOHC 1D3ZA 3X0WA 3APDA 3ENEA 2Y5PA 3ML8A 1QILA 3NJTA 1YN5A 4XYCA 3PZ8A 1V81A 1PQSA 4US9A 1NEKB 3VR8B 2NTSA 3BVMA 2LVOA 4IM2A 2JRHA 3AEAB 4KSLC 1PGAA 1V86A 4ARIA 3UIPB 3B1LX 1R4MI 1OEYJ 3UINB 1WJUA 1SEBD 1I4RA 1XXGA 3Q8AA 2LVPA 2JXTA 1ISNA 2E6XA 3FILA 2DZKA 2UYZB 4MELA 1T6BX 1YQ3B 3DHIC 2KWUB 3HRDD 1N5WA 4B9KA 1NDDA 4ICVA 2ZZPB 1OEYA 4A9AA 3U52E 1QLBB 1TGZB 4GXBA 2K8HA 1L5PA 3MC9A 4M00A 4EZLA 1NYRA 1VJKA 3IAM1 2ACZB 1KFYB 1L4DB 4BKGA 3E9SA 2W82A 3NS8A 1QQRA 3HM6X 3DBRI 2L1AA 4HLEA 2IJ0A 2X38A 1VZ8A 1WX9A 4MH0E 2UU7A 3EFUA 2MBBB 1FFVA 2MCNB 1WE7A 3QJZA 1C78A 1Y8RC 3Q3NC 2JF5A 3TEYA 3CIRB 1YN4A 3EECA 2PEAA 5D7GA 2XBBC 5DPTA 2BYEA 4L23A 3QA8A 3IXSA 1D4BA 4DDGD 3MC8A 3RNBC 4AQ7A 1XLPA 2BKRB 1FNWA 3A9KB 3RNFC 4K81A 2MA9B 4RF0A 4REZA 3E56A 1WM3A 2N9XA 1SJHD 3M3JA 4AS1A 1TY2A 4RM9A 2KDFB 3L16A 2WS3B 3L54A 3KYDD 2L0TA 4WWMA 2IY0B 4B95A 4OHJA 4HJGE 4P16A 3RCZA 4EKUA 1WJ6A 1WI0A 3JVZX 3OAWA 2L83A 1F77A 1LGRA 3AECB 2N1WA 3JW0X 5J17A 3BZDB 3OJ4B 2L05A 1MG8A 4FHKA 1LO5D 3AE9B 3N3KB 3NG0A 2WXQA 4ANWA 2M19A 4WJQA 3TMPB 3TIXA 1IUEA 1UF0A 1G6JA 3R66C 1E8XA 1UWXA 4MGYE 5HKHA 3ZRFA 4LJPB 4F7ZA 1M94A 3M62B 3H7PB 2O2VA 4DHJD 1XLNA 2DLBA 4TMAB 2JWUA 1E8ZA 4OVZA 1WGDA 3U2SC 3ALBA 3UGBB 3JSVA 4NQKE 1N61A 3NRZA 2W3RA 2WNMA 3C8YA 1L4ZB 3QC8B 2BS3B 3T3NA 2WU2B 4KGRA 5FR6A 3KLSX 1GC6A 1KLVA 2BF8B 1SJED 2WXLA 4PT5A 3RULA 4JL9A 2CU1A 1D5ZC 1P7FA 1A5RA 2KDBA 2MLBA 1RYJA 2A5UA 2IO0B 3WAMA 2W54A 2BWFA 2GB1A 4RGTA 1ESFA 1FXIA 5AZHA 2N0SB 2BB6A 1E8WA 2QCZA 4B0MA 4GSWA 2CJNA 3CWIA 4MSMB 3ZO5B 4NJCA 4LK0M 2NCNA 3VR9B 4WAFA 3PHXB 2KANA 3APFA 2BVCA 3W9CB 1Q5WB 3KWLA 4MM3B 1YIWA 4JLCA 1JWAD 3DVGX 3NZUA 1UBIA 5EE9A 1E6EB 2N4FA 1OGWA 4I6LB 2DNFA 3HK0A 2PW9A 4JQWC 3TJPA 4LNOA 1TBEA 3IT6B 4FJYA 5G55A 4KIKB 1MI0A 1C9FA 1CMXB 2K1FA 2V3PA 2WU5B 3DVGY 4EZKA 4I6PA 2AWTA 3URYA 1E7PB 4ANXA 3ONSA 2HJ8A 3PO0A 4ANVA 2MRPA 2LXCA 2WXIA 3GOEA 2OJWA 3RNCC 3UF8A 2I1JA 3P42A 4I6NB 1N5XA 4WIPA 3TL5A 3V6EB 2INCC 3ZJTA 5KHOA 3DVNV 5BMGA 5CX3A 1OTRB 4OZCA 4DBGA 3AEGB 2NPTB 2LZ6A 1RFKA 4TQ1A 4M01A 4URKA 4ARCA 5BMIA 2IBIB 1YQBA 2QSDA 1Z2MA 3H9DA 2KNBA 2CKHB 4WURA 4FA6A 3P63A 4DHZB 1CK1A 1AWDA 3P4QB 3SFDB 2VRRB 2LJIA 2W3SA 1T0SC 2JY6A 3DVNU 3W5VB 2JSVX 3Q8BA 4ACFA 2JZPA 4FBJB 3SEBA 4IUMB 1D5XC 2MHJA 4HK2A 2WDTB 2FIDA 4MT5A 3RPFC 3ZJVA 2FBWB 4WWPA 1V8CA 2VH1A 2KFKA 2M4NA 3K9OB 4PK1A 4GMVA 2UWQA 4BBNC 2PE9A 3MP9A 2WDQB 4K7SA 1HTOA 1GPXA 1RM6C 2CHWA 2X8XX 3L13A 3GP7A 2KC1A 1UH6A 4DK5A 1GJZA 1J8CA 3VTVA 1IP9A 3EFCA 4NY0A 5L95C 3GZNI 3WA0A 4BKTA 4BZAA 2JRIB 1WGHA 1WXMA 4G3XB 2ZEQA 3NZSA 3HVZA 3Q3JA 5CTRC 4TSSA 4ZHOA 3M63B 4ITKA 3DBHB 1P3QU 2N7EA 3L08A 4JE3B 1I42A 4NZLB 5KHQA 1WGYA 2LWPA 1DOXA 2M17A 3PZ7A 2H88B 2KMMA 3CF6E 5D2MB 2PIAA 1P7EA 1JWBD 1NI2A 3AI5A 4II2B 1JWSD 3AB5A 2KJRA 2LEKA 1PUTA 2JZZA 4LLGM 1FD6A 2PLPA 2KX0A 1RFAA 4GGQA 2KDMA 2Z8LA 4JPSA 4ANUA 2WXOA 3Q8CA 2D5GA 1TZOA 1YJ1A 3ML9A 3I5JC 3R7QA 5JH5C 3N1YC 4NJ6A 2HTHA 4S0RA 2KYWA 3PRPB 4M02A 2D2QA 1WYWB 3L0WB 3AH7A 3NVWA 2H89B 4K7UA 3TEZA 1V80A 2LMCA 2WXHA 2PKOA 3TCAA 1C76A 3V3XA 3LXFA 2K8CA 3N1XC 1KLGD 2K3UA 3AN1A 1D6EC 4M8NA 1N6ZA 1NVID 1PDXA 2EMTA 2LFIA 3OJ3A 3ZNID 3A1QA 4CO7A 1XEEA 5IOIA 3AM9A 1ENFA 3IHPC 2DYBA 4QAYA 1WH3A 2C9WB 2K6QA 2LD9A 3ZYYX 1QT9A 4B6WA 3BIID 4R3DA 1YJIA 2K8BA 4E71A 5GMVA 2EKIA 3ECIA 1RLFA 2GLSA 1N63A 5G5HA 2DZMA 3P4SB 3SU8X 3ZNZB 3NVYA 1WR1A 1WR6E 4GDKA 5LXIB 1IYFA 1TS3A 4RF1A 2D11A 4RFBA 4C7ZA 1A70A 2G4DB 4KVGB 3P4RB 1WZ0A 4FJVB 2MW5A 1P98A 2LI5A 3PRZA 2BW2A 3PVLA 4C00A 1EU3A 2LASA 3LYYA 1C1YB 1I4XA 1K8RB 1FRRA 1V1PA 3PTFC 4ZDVA 1PGXA 4E74A 4LNKA 2ZNVB 1Q10A 3MTNB 4W9CA 5HHDG 4KKJA 4ZRJA 4F1SA 2J53A 3DWMA 1JW9D 1GNUA 2G45B 1BUIC 2JX5A 1QKZA 1FXTB 2XNAC 2ZJDA 5BYRA 1L6UA 1TKYA 2FCMA 2JT4B 1SE3A 3PREA 1TS5A 2KWCA 3B08A 4FJZA 1KLUD 3MJWA 3AULA 1WM2A 3QWZB 2GBJA 3PT2B 1MHHE 3P2BA 2BS2B 3I3TB 5E6JA 2BGFA 3VQIA 2GRIA 2AX5A 4YSYB 3A4SC 2GI9A 3GE8C 3ZXVA 1CJEA 3MFGA 3ZKJC 2AQ3B 3H1UA 1HTQA 4LNIA 1X1MA 1F2RC 1WX7A 4P6VF 3T9LA 5AZGA 2PPHA 2I1KA 3MC0B 3NVVA 2KTRA 3TUOA 1YJJA 4NPNA 3L10B 2N9LA 2WLBA 1TKEA 4RGOS 2J0KA 1YD8U 4IG7B 2FUG1 2KVZA 4W9LA 2L52A 4IM3A 3RFZB 2LRUA 4BAXA 2IY1B 1HEZE 3BINA 3DBLB 4XE0A 1FEHA 4FLHA 4J6IA 2A4ZA 2LGIA 3BY4B 3ZIMA 5DCNA 2LHDA 1C4PA 2G9HD 4NNJB 2N9EB 4LDTD 3KYCD 4II3B 4M8MA 5JZEB 1V2YA 2K0PA 3DBLI 4NAMA 3Q8FA 1QOBA 2V3SA 3CMMB 3UQBA 1T0QC 2QMTA 2N7JA 3ZRCA 2JQRB 2CR5A 3H7PA 3ZLZA 1QZEA 5G5GA 3KQ4A 3U4EG 1ROEA 3KVFB 4LNFA 2NPTA 1E7UA 4RMAA 4ASWC 3EC8A 1Q1OA 2KTRB 1MJDA 4CHKA 2MJDA 4HDOA 2M56B 4N59A 3VHTC 1R4NI 3QCAA 2CS4A 3A9JA 3NUHB 4CQNA 2LVQA 2W55A 2YEPF 3V6CB 4PS3A 2YVCA 3DHGC 3T3OA 4WJOA 2M1MA 2O6VB 2PVGC 1V9JA 2O6VD 2LGXA 4KDLB 2RR9A 2NVUI 1SF0A 3CSTA 1V6EA 2D07B 1WRDB 4XC2A 4FXCA 5FKAC 1SE2A 3AE2B 1WRIA 4IC7B 4USAA 1UNSA 1SIJA 1CZPA 2WXRA 3MHZA 1IGCA 4BKSA 2DWQA 2J4XA 3DBRB 3L17A 4WWNA 2JWZA 3WCQA 1NENB 4MM3A 2BBCA 3APCA 2V1YA 1J7CA 2WWZA 1OFFA 2E3TA 3IFWB 3RT3B 3N30A 4KSKC 3NHEB 4AJYB 1K50A 2DZJA 2L0FA 3IVFA 4WQMA 1VRAB 2Y3AA 1WGKA 2M8SA 2NTTA 4GB9A 1WF9A 2OJRA 1YNTE 2O6VA 4KGTA 2DYOA 2KOXA 2WXGA 1E5WA 4EEWA 4JWUC 2KFJA 4W9IA 3IBEA 5BYQA 3PRMB 3RZFA 3WAPA 1SBBB 3A9JB 4K3CA 2EELA 2QJLA 2JU6X 4W9JA 2KFKB 2L00B 1V5TA 1ET9A 3AU4A 1XQQA 4LCDE 5LNK1 3ZVVA 4HVBA 2XEWA 2D3GA 4YT0B 3IG3A 4FADA 1GG3A 1JWMD 1L0VB 2MEKA 4KZCA 4FN2A 4GLSC 1XO3A 2AL6A 3EHVA 3B2GA 5CHVC 4X57B 1QF6A 1WGRA 1T0YA 1L0XB 4L1BA 5D94A 1DOYA 5J18A 2MBOA 1HE8A 4IM0A 1U4AA 1P1AA 1YQ4B 2WDVB 4WJNA 2DHZA 2INDC 1K53A 1N62A 3Q14C 3R2IA 1AARA 5CHFA 2V3NA 3FILB 3PZDA 1UUPA 1AN8A 3PHWB 5IO9A 3BK2A 4GOCA 4H2AA 4OZAA 2YLMA 1GB4A 3AMZA 3H8HA 4A3OA 1SIFA 3AEFB 4WJPA 1I4QA 1T5XD 4WAAA 4IWPA 1F1HA 1WXSA 2WXPA 2BPSA 4DHJB 3RI7C 3PSEB 3DDCB 3FAHA 1C79A 5C3JB 1EWYC 3R3MA 2KDEB 3GZNB 1SGHA 3VAWA 3BK1A 5FR3A 1J7BA 5E6OA 5D3DA 3TEWA 4ZYNA 2W9NA 3EGRA 2ZCBA 3AEEB 4IDIA 3VFKA 2ZPNA 2J7QB 1YX5B 3DBSA 2RSUA 3ZNGC 2JZ3B 2Q5WD 4HPPA 4C80A 2KK8A 1JRUA 1SE4A 2QC8A 4J3OD 4PYZA 4TV3A 4WQOB 4OZBA 2Z0EB 4HEA1 2KWDA 4W9GA 5C2TB 1C4CA 3VUXA 4MDKE 2B3AA 3ZNHB 4FULA 2KTFA 2C7MB 2C7HA 2DX5B 1WXQA 2C60A 2N1VA 3U7ZA 3EUB2 2HJ1A 1EF5A 3QIJA 2BYTA 2WX1A 2JXXA 1E7VA 1SE9A 2ZVNA 3H6NA 3C19A 4YTPB 2GBNA 1ZPSA 3N32A 3FKYA 3VUWA 1JRPA 2R2OA 2FNJB 2N9PC 2RPVA 2SEBD 1FIQA 1ZKHA 2J0JA 3W1SA 2NBUA 3VRBB 1GOZA 1GAQB 3PGEA 5JHAA 3WIMA 3ZDMC 5C23A 2GBRA 4BFRA 1WGGA 4OVVA 1UGJA 2KLGA 2V0GA 1C77A 3PS6A 3N1ZC 3NVZA 3V60A 2MP2A 4HPMB 3QQ8B 2KX3A 4KKIA 1WMHB 5DPWA 3QK0A 3RNGC 2KXJA 3KWVA 2AL3A 2JPHA 4AWJA 4HROA 2O2VB 4UDUC 3AV8A 3NOBA 3P4PB 5EDSA 1LFDA 1OQYA 4BOSC 1ZXIA 1T0RC 3A33B 2I2YA 5HG2A 4DWFA 1F9JA 2EKEC 1E0ZA 2I38A 3U8ZA 4HXDA 4YXDB 4YL8A 5H92C 1FRDA 1UBQA 2WXJA 2INPE 1PYWD 1KRHA 1T3QA 2GBKA 1XT9B 3B2FA 5MPOA 5CHWA 1WMHA 4FHJA 1ZUD2 4AOFA 4NAWA 1RRBA 1JQ4A 2ON8A 1FFUA 3HM3A 3KH0A 2KVRA 3AE5B 2KC2A 3KUZA 2FCQA 1SXTA 3BWUD 3RZWC 3SFEB 4TQ0A 3RNEC 3DWGC 4ICUA 4G0NB 1TZ1A 5EE3A 1K52A 3VVWB 1FXAA 4MEMA 3A1QB 2KLCA 3ZW3A 3JYUA 4W9EA 4G11A 3QAQA 3BYYB 2DENB 1AYFA 4YSZB 4KIKA 1ZXHA 5E6PA 5IA7A 3HHMA 4RNAA 3LB8C 4ZRQA 4KDIC 3BVGA 2BT6A 4AP4C 4AUQC 4OW0A 2JYEA 5AUIA 3C0RB 3H7SA 4N9F4 1Q0WB 1WSPA 3DQVA 2ZNVC 3B0AA 1TY0A 2XK5B 4AJWA 3SD5A 1B1ZA 3GB1A 1ZDVA 2KO3A 3M95A 2IZVB 4NAWB 5G2NA 3SDLC 2N7DA 2WXNA 4YWGG 3T8MA 4YSXB 2FCSA 3EA6A 2MBHA 4EUTA 1WE6A 4HRSA 2MX2A 2WP9B 4HCPB 1IGDA 2G1EA 4EE2A 1F2RI 2ONQA 4D2KA 1NYQA 3LDZE 3Q3OC 1J7AA 1P0RA 5EE0A 3B9JA 3ZQ4A 4RM8A 2AEHA 1HA5A 2L8JA 2PTLA 2PMVA 3MJ5A 3UIOB 4ZHPA 1GC7A 2WQYB 4OVUA 3WANA 1BXTA 5T8IA 2RMMA 4GDLA 4TUUA 4F8CB 5DPSA 1YMHE 3UQAA 5LXHA 1LM8B 2DAFA 3D32A 4PS7A 1TIFA 1XLQA 2KMAA 3AXCA 3W5UB 2RDBC 5JXVA 1IBXB 2KKCA 3O13A 1ET6A 4IW0A 3AU5A 2L7RA 1MHXA 2AQ1B 2PJHA 3J9CA 2K25A 2GMIC 1RWSA 1XLOA 4XWWA 2GOWA 1I35A 4MACA 1VCBA 4A6QA 4KV2A 1WX8A 1Y56A 1WFYA 3Q8EA 2WDRB 4GDLB 4Q2JA 3GE3C 5JHBA 1TKGA 1VR9A 2MBQA 1VDVA 3Q6BA 5IP4D 1RAXA 1VZ7A 1L6VA 1UWMA 4CYEA 4W9HA 2NBVB 1L0YB 1WY8A 1HQRD 1JALA 3OG5A 3KW5B 2D3AA 2KT7A 3N9YC 2B76B 1VLBA 2DYMA 3AE3B 3DHHC 3ETRA 2NMQA 4HPLB 3RMKC 3KUDB 2KQ4X 1P9DU 3NZ3A 2OHFA 4N6EB 4MJSA 4EFOA 5BYSA 5HFYA 1ZGUB 1OQQA 1WJ4A 2D3BA 2OEDA 3IAS1 1E10A 1L2NA 4KZ0A 5E6NA 2HE7A 4XZ4A 3AE6B 3V62A 2FUHB 2M0XA 2ZW1A 1C3TA 1JMLA 2BWES 2LRWA 2IGGA 1GB1A 1KF6B 2AQ2B 1EF1A 2LUMA 2IO3B 2V4IB 1KM7A 2DZIA 1UZXB 3I57A 3R8BA 1LXDA 2JVCA 1ZDXA 2BB5A 4B0EA 3SHQA 3ZXRA 2NS5A 4A3PA 3RN9C 4P7IA 1PGBA 3PV1A 1LQBA 4K7WA 1DGJA 4JIOU 4C4VB 3HIZA 5H8YE 1KH0A 1TS4A 4DQOC 1FPYA 2QEJC 4HDQA 1S3SG 1SB3C 1TT5B 2LGYA 4PS8A 3JSVB 2MWSB 2Z59B 4JX1C 2R61A 1FNUA 1FCCC 1JROA 4HKQA 3PLVA 1YN3A 2BKFA 4GN1A 4TKNA 4YTMB 2J52A 1XCTL 3QARA 5AZFA 1MG4A 4LTUA 1R4MB 1ACCA 4K1RB 3FC4A 1V97A 2KN5A 3NY5A 3AE4B 1E90A 1UELA 1VZ6A 2TSSA 1I7HA 3Q69A 3W1YA 1IBXA 5TSSA 3SR6A 3I63C 4MSQB 2BTEA 2AYOB 2CU3A 4LDTB 3AEDB 1HZ5A 3PLUA 1WXVA 1ZOYB 1J19A 1PFDA 1AW7A 1FMAD 3IT4B 3AE7B 2GBMA 2BS4B 5I4DA 4HJKA 3AE8B 2IGDA 2LXAA 4K3BA 3OLMD 4A55A 2D10A 4IWOA 4BKSD 1FM0D 4IOIE 3W1SC 2K22A 2M0AA 1L7YA 1H8CA 3WAOA 1R4NB 1QOFA 1WXAA 1ZW7A 4L2YA 2MQJA 2G3QB 1MPEA 2IDYA 2MJ3A 4BOZB 5IAAC 4DDID 1XF5L 1V5OA 3WALA 4GDKB 1KTKA 2FIFA 1JWUD 4IWQA 1FCLA 2K5PA 3O65B 4M0WB 2ZW0A 4ZRPA 2KZRA 1MFWA 1WZ3A 1XCQL 3HVDA 2XK5A 4P1BC 1D5MC 2FAZA 2VZKB 2OOBB 1H4RA 2WX0A 4JGHB 2MSED 2ZPYA 5FK9C 1NBFC 2L3ZA 2DBYA 4RGNA 5HI1A 1TYGB 2L32A 1EU4A 4WWOA 2BYFA 3S2AA 2JYTA 1CQVA 3QX1A 4BBNF 2CJOA 1XD3B 2BYVE 4A90A 1YOVB 4MJSB 3UI3A 2PVOD 2KQSA 2YEPB 4GIVA 2ICIA 3TSSA 3TBLD 3BYTB 4E3CA 3ZTCA 2MH7A 2NR2A 3BVZA 4MH8A 2LGDA 1TTNA 4XX5A 3W2DA 1FNVA 2KQ7A 3VDZA 5GXGB 4C4VA 2VH2A 1C4AA 4XGAB 2J0MA 5IKCM 2FCNA 4RCOA 3ZTDA 4DXFA 2LUEA 3RNAC 2RPQA 1V1OA 4XWTA 1WJNA 2WHIA 3CSFA 1OQRA 1EO6A 3AEBB 4M0WA 1FO4A 2WYQA 2QHOA 2Y5CA 3NS1A 2RDHA 1V49A 1UD7A 4N58A 1V1PB 2HTME 3R7RA 2Y5BB 2Z0DB 3QHTA 3RD2A 4ZRIA 4KGSA 2RD0A 3P1MA 4IKGA 4O1NA 4XDDA 4RGMA 1EM7A 4HKZE 2RDGA 3ZDTA 2KJ6A 3U30A 1M4VA 5J2RA 4W9DA 1HZ6A 1R7SA 2V9HA 1GUAB 3ZGZA 2J42A 4US8A 5C1ZA 4BVUC 4A20A 2V4LA 2R2QA 1E8YA 1TJEA 2HD5B 4HWIB 2WXKA 3I9V1 2KAJA 3RUIB 2FE8A 3VTUA 2ZCCA 1N60A 1MVKA 2K39A 4MGIE 1F52A 3TEXA 2SAKA 2KHWB 4HCNB 2D3CA 3VXWA 4W9FA 2IGHA 5D3IB 4PYUA 2MP2B 3DCGA 2KD0A 5BO4B 1JCKB 2LJ5A 4P1CC 5AUKA 2VZKD 3VRAB 2QILA 1ZE3D 4KX6B 2WXMA 1QOAA 2KMCA 2LHEA 3Q2AC 4G50A 1DYQA 4MGZE 4W9KA 1I4GA 2G4SA 1BMLC 4A8XC 3DBHI 1DOIA 1IPGA 2C5LC 5EE1A 2NBWB 2IYDB 2XN9C 5BMHA 2ASQA 3RYTA 3A4RA 1K51A 3N20C 4LNNA 1STEA 2PE6B 1EUVB 4EZJA 5AEKB 2EMSA 2K9XA 2N9KA 1YX6B 3OWEB 3V05A 4DXAB 3ZJUA 3KUCB 2WGSA 3ZUNA 4WH4A 2MBEA 3DOWA 2IPKD 2QIEB 4DHZE 1ZP0B 4RH6A 3AE1B 3A9KA 2IO2B 3VH3B 3V61A 1I4HA 1WWTA 2HDEA 1S1QB 1TS2A 2KWVB 2CHXA 1SSNA 2ZVOA 4JWSC 4GU2A 2K6DB 5IN7A 5TR5A 4S17A 1B9RA 2REXA 2RGFA 1UGMA 4XDCA 2C7NB 2DAJA 5L83A 3U7DA 4EOYA 4ZRKA 3VUYA 1KJTA 1I4PA 1E9MA 2IO1B 4ZYSA 2KACA 1BT0A 4C56C 4DXGA 2BQQA
chains in the Genus database with same CATH topology
2KFKB 2L00B 3K9OB 1RAXA 4GMVA 2UWQA 1KOTA 4BBNC 2PE9A 1V5TA 3AU4A 3DPDA 1XQQA 4MGKE 4CYEA 4K7SA 4W9HA 2NBVB 2CHWA 4NJ7A 4LCDE 3L13A 1WY8A 3KW5B 2KC1A 3ZVVA 1UH6A 3Q3FA 4DK5A 2XEWA 4HVBA 3VH4B 2DYMA 1GJZA 1VD2A 1J8CA 3VTVA 5LLIA 2D3GA 4HPLB 3MHSD 1J0GA 4FADA 3IG3A 4LJOB 3X23A 4NY0A 1IP9A 5L95C 3KUDB 1GG3A 1WIAA 1P9DU 3K9PB 4W9JA 3GZNI 1Z5SB 4KZCA 2KJHB 3WA0A 4BKTA 3LJ3A 4FN2A 2AL6A 2JRIB 3EHVA 4MJSA 1WGHA 1WXMA 5CHVC 4NQLB 4X57B 4G3XB 1WGRA 2ZEQA 4EFOA 3NZSA 1ZGUB 1T0YA 1WJ4A 2L76A 3PPAA 3Q3JA 2JUOA 2KDIA 3VTWA 5CTRC 5DPRA 2CHZA 5D6JB 5D94A 3M63B 5J18A 2MBOA 1L2NA 1P3QU 2N7EA 1HE8A 3L08A 4KZ0A 2HE7A 5E6NA 4IM0A 1U4AA 1I42A 1P1AA 4XZ4A 1D3ZA 3X0WA 3APDA 3V62A 5KHQA 2FUHB 3ENEA 1WGYA 2LWPA 2M0XA 2M17A 3ML8A 1C3TA 3CF6E 5D2MB 4WJNA 2BWES 2LRWA 2DHZA 1V81A 1PQSA 1EF1A 1NI2A 3AI5A 4II2B 2KJRA 2IO3B 2LVOA 1KM7A 1AARA 2JRHA 2DZIA 1UZXB 2JZZA 4IM2A 4KSLC 5CHFA 1LXDA 1V86A 2JVCA 3UIPB 3B1LX 3SHQA 2KX0A 1RFAA 3PZDA 1R4MI 4GGQA 2NS5A 3PHWB 4A3PA 1OEYJ 3UINB 1WJUA 4AJWA 4ANUA 4P7IA 3PV1A 1YJ1A 1LQBA 2LVPA 3ML9A 4GOCA 1ISNA 4K7WA 2YLMA 4JIOU 3R7QA 5JH5C 3HIZA 4NJ6A 2DZKA 2HTHA 2UYZB 4MELA 2KWUB 4A3OA 3PRPB 1SIFA 4WJPA 2D2QA 4HDQA 1S3SG 1WYWB 3L0WB 4WAAA 4IWPA 2LGYA 4PS8A 1WXSA 4B9KA 3JSVB 2BPSA 2MWSB 2Z59B 4DHJB 4K7UA 3PSEB 3DDCB 1V80A 1NDDA 3R3MA 4ICVA 2KDEB 3PLVA 2ZZPB 2BKFA 4GN1A 1OEYA 1SGHA 3VAWA 3TCAA 4TKNA 5E6OA 2K8CA 1TGZB 3QARA 4GXBA 4ZYNA 2W9NA 5AZFA 4M8NA 2K8HA 2ZCBA 3VFKA 4EZLA 2EMTA 2ZPNA 2J7QB 3OJ3A 4K1RB 3ZNID 1YX5B 3A1QA 3DBSA 4CO7A 4BKGA 2RSUA 3IHPC 3NS8A 2DYBA 3ZNGC 2KN5A 1WH3A 2JZ3B 2C9WB 2K6QA 3NY5A 2KK8A 3HM6X 2LD9A 1JRUA 3DBRI 1UELA 1E90A 4HLEA 4PYZA 4TV3A 4B6WA 4WQOB 2Z0EB 3W1YA 2K8BA 4W9GA 1WX9A 4MH0E 4E71A 5GMVA 3VUXA 3VXWA 3ECIA 3EFUA 2B3AA 2MBBB 4MDKE 4MSQB 1RLFA 3ZNHB 2AYOB 4LDTB 4FULA 2KTFA 1WE7A 2MCNB 2C7MB 3PLUA 2C7HA 1WXVA 2DZMA 3QJZA 2DX5B 2C60A 3SU8X 1J19A 3ZNZB 1Y8RC 2N1VA 1WR1A 1EF5A 1WR6E 2JF5A 4GDKA 3QIJA 2GBMA 5LXIB 1IYFA 2WX1A 2JXXA 1E7VA 1SE9A 2PEAA 2ZVNA 2XBBC 3EECA 5D7GA 2D11A 4HJKA 2LXAA 3H6NA 5DPTA 2BYEA 3OLMD 3QA8A 2D10A 2G4DB 4IWOA 4KVGB 4BKSD 1WZ0A 4DDGD 2GBNA 3W1SC 3N32A 3VUWA 1L7YA 2R2OA 2FNJB 3WAOA 1H8CA 4FJVB 2MW5A 1P98A 2N9PC 2LI5A 3PRZA 2BKRB 1WXAA 1ZW7A 3A9KB 1ZKHA 3PVLA 2MQJA 2J0JA 3W1SA 2NBUA 2LASA 2G3QB 1C1YB 1K8RB 3PGEA 4BOZB 3PTFC 4K81A 2MA9B 5IAAC 4DDID 1V5OA 3WALA 5JHAA 3WIMA 4ZDVA 3ZDMC 4GDKB 2FIFA 5C23A 2GBRA 4E74A 1WM3A 2N9XA 4BFRA 2ZNVB 4IWQA 1WGGA 3MTNB 3M3JA 4OVVA 4W9CA 2KLGA 4ZRJA 4RM9A 4F1SA 3O65B 4M0WB 3PS6A 1GNUA 2G45B 2KZRA 3V60A 1WZ3A 2MP2A 2KDFB 2XK5A 3L16A 4HPMB 1FXTB 2FAZA 3QQ8B 2KX3A 2ZJDA 3KYDD 2L0TA 3L54A 2IY0B 4B95A 1WMHB 5DPWA 3QK0A 2FCMA 2OOBB 3RCZA 1WJ6A 2KXJA 4EKUA 1H4RA 1WI0A 2AL3A 3JVZX 2JPHA 3OAWA 2JT4B 4AWJA 3PREA 2KWCA 2WX0A 3B08A 4FJZA 2MSED 2O2VB 2ZPYA 4JGHB 3NOBA 5EDSA 1LFDA 1OQYA 2N1WA 3JW0X 4BOSC 3MJWA 5J17A 3OJ4B 1NBFC 2L05A 2L3ZA 1MG8A 3AULA 4FHKA 3A33B 1WM2A 3QWZB 3N3KB 2GBJA 3PT2B 4ANWA 4DWFA 4WWOA 2BYFA 1F9JA 2EKEC 4WJQA 3TMPB 3P2BA 3S2AA 3I3TB 3TIXA 3QX1A 4HXDA 3U8ZA 4BBNF 1G6JA 3R66C 1E8XA 1XD3B 2BYVE 4YL8A 2BGFA 3VQIA 4MJSB 4MGYE 5HKHA 1UBQA 2KQSA 4GIVA 3A4SC 3ZRFA 4LJPB 3ZKJC 2GBKA 3H1UA 1XT9B 3TBLD 4F7ZA 1M94A 1X1MA 3M62B 3H7PB 2O2VA 4E3CA 5CHWA 3ZTCA 1WX7A 1WMHA 2NR2A 4XX5A 3T9LA 2LGDA 1TTNA 5AZGA 4DHJD 2PPHA 2KQ7A 4FHJA 3VDZA 4AOFA 2I1KA 2J0MA 4NAWA 2FCNA 1RRBA 3ZTDA 2LUEA 2KTRA 1E8ZA 2RPQA 1WGDA 3HM3A 1WJNA 4NPNA 3ALBA 3L10B 3KH0A 3UGBB 2KVRA 3CSFA 3JSVA 2J0KA 1EO6A 1YD8U 4IG7B 4NQKE 2KC2A 2WYQA 3KUZA 2FCQA 2QHOA 4W9LA 3RZWC 4IM3A 1V49A 1UD7A 4TQ0A 3QC8B 4ICUA 4G0NB 3R7RA 1TZ1A 2LRUA 2IY1B 2Y5BB 2Z0DB 3QHTA 3RD2A 4ZRIA 5FR6A 3BINA 2RD0A 3VVWB 1GC6A 4MEMA 1KLVA 2BF8B 3A1QB 2KLCA 3ZW3A 3RULA 3JYUA 4FLHA 4JL9A 4G11A 4W9EA 2CU1A 3QAQA 4J6IA 3ZDTA 2KJ6A 2DENB 3U30A 1A5RA 2A4ZA 2KDBA 2MLBA 5J2RA 2IO0B 2A5UA 4W9DA 3WAMA 3BY4B 3ZIMA 5DCNA 2BWFA 4KIKA 5E6PA 1GUAB 4NNJB 2N9EB 5AZHA 4LDTD 3KYCD 4II3B 4M8MA 5IA7A 1E8WA 5JZEB 4GSWA 3HHMA 4MSMB 5C1ZA 1V2YA 3ZO5B 4BVUC 4A20A 2V4LA 4KDIC 2R2QA 2NCNA 3DBLI 1E8YA 2HD5B 4AP4C 4AUQC 4HWIB 3PHXB 2KANA 2V3SA 3CMMB 3APFA 3UQBA 3RUIB 1Q5WB 3C0RB 3ZRCA 1YIWA 3H7SA 3VTUA 2CR5A 4JLCA 2ZCCA 4N9F4 1Q0WB 3H7PA 3DQVA 2K39A 2ZNVC 3DVGX 3ZLZA 1QZEA 5L83A 4MGIE 3NZUA 1UBIA 3B0AA 3KVFB 2KHWB 4HCNB 2NPTA 2XK5B 1E7UA 2N4FA 1OGWA 4I6LB 4RMAA 4W9FA 3EC8A 3HK0A 1Q1OA 3SD5A 4JQWC 4ASWC 3TJPA 4PYUA 2KTRB 2MP2B 2KO3A 3DCGA 1TBEA 3M95A 2IZVB 4FJYA 4NAWB 5G55A 4KIKB 5G2NA 3SDLC 4CHKA 4HDOA 2KD0A 2N7DA 2LJ5A 5BO4B 3T8MA 1CMXB 2FCSA 2K1FA 3VHTC 3DVGY 2MBHA 1R4NI 4EUTA 3QCAA 1WE6A 4EZKA 2KMCA 2AWTA 2CS4A 3A9JA 4I6PA 2MX2A 4HCPB 4G50A 4ANXA 2LVQA 3ONSA 4MGZE 2HJ8A 4W9KA 3V6CB 4PS3A 2G4SA 2YVCA 4ANVA 3DBHI 3LDZE 2MRPA 1P0RA 1IPGA 2C5LC 4WJOA 2LXCA 2M1MA 2O6VB 1V9JA 2O6VD 2NBWB 2LGXA 4KDLB 2AEHA 3GOEA 2RR9A 2IYDB 2L8JA 4RM8A 2NVUI 3UF8A 2I1JA 4I6NB 2ASQA 3CSTA 3TL5A 3RYTA 3V6EB 3UIOB 3A4RA 5KHOA 3DVNV 1V6EA 2D07B 5CX3A 2PE6B 1WRDB 1GC7A 4OVUA 4XC2A 3WANA 4GDLA 1EUVB 1OTRB 4DBGA 4EZJA 4IC7B 4TUUA 4F8CB 5AEKB 2EMSA 2NPTB 5DPSA 2LZ6A 3UQAA 5LXHA 1YX6B 4TQ1A 4BKSA 4URKA 2IBIB 1YQBA 3L17A 4DXAB 4WWNA 1LM8B 2DAFA 2JWZA 1Z2MA 3KUCB 3D32A 4MM3A 3APCA 2V1YA 3ZUNA 3H9DA 4PS7A 2WWZA 2MBEA 2KNBA 2CKHB 3DOWA 4DHZE 4FA6A 3IFWB 2KMAA 3AXCA 3RT3B 4DHZB 3N30A 3A9KA 2IO2B 4KSKC 3VH3B 3V61A 2KKCA 3NHEB 4AJYB 4IW0A 3AU5A 2L7RA 2DZJA 2L0FA 1S1QB 3IVFA 2KWVB 2PJHA 2CHXA 2GMIC 2K25A 2ZVOA 2GOWA 2M8SA 2VRRB 4GU2A 1I35A 2K6DB 4GB9A 1WF9A 1VCBA 2OJRA 5TR5A 2REXA 2JY6A 2O6VA 1UGMA 1WX8A 2RGFA 2DYOA 3DVNU 1WFYA 4KV2A 4FBJB 2KOXA 1E5WA 4EEWA 2C7NB 2KFJA 4IUMB 2DAJA 3IBEA 4GDLB 4HK2A 3PRMB 4W9IA 3RZFA 3U7DA 2WDTB 4EOYA 2FIDA 3WAPA 5JHBA 4ZRKA 3VUYA 1KJTA 3A9JB 4WWPA 2IO1B 2MBQA 1BT0A 2KFKA 2M4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFK B;  2L00 B;  3K9O B;  1RAX A;  4GMV A;  2UWQ A;  1KOT A;  4BBN C;  2PE9 A;  1V5T A;  3AU4 A;  3DPD A;  1XQQ A;  4MGK E;  4CYE A;  4K7S A;  4W9H A;  2NBV B;  2CHW A;  4NJ7 A;  4LCD E;  3L13 A;  1WY8 A;  3KW5 B;  2KC1 A;  3ZVV A;  1UH6 A;  3Q3F A;  4DK5 A;  2XEW A;  4HVB A;  3VH4 B;  2DYM A;  1GJZ A;  1VD2 A;  1J8C A;  3VTV A;  5LLI A;  2D3G A;  4HPL B;  3MHS D;  1J0G A;  4FAD A;  3IG3 A;  4LJO B;  3X23 A;  4NY0 A;  1IP9 A;  5L95 C;  3KUD B;  1GG3 A;  1WIA A;  1P9D U;  3K9P B;  4W9J A;  3GZN I;  1Z5S B;  4KZC A;  2KJH B;  3WA0 A;  4BKT A;  3LJ3 A;  4FN2 A;  2AL6 A;  2JRI B;  3EHV A;  4MJS A;  1WGH A;  1WXM A;  5CHV C;  4NQL B;  4X57 B;  4G3X B;  1WGR A;  2ZEQ A;  4EFO A;  3NZS A;  1ZGU B;  1T0Y A;  1WJ4 A;  2L76 A;  3PPA A;  3Q3J A;  2JUO A;  2KDI A;  3VTW A;  5CTR C;  5DPR A;  2CHZ A;  5D6J B;  5D94 A;  3M63 B;  5J18 A;  2MBO A;  1L2N A;  1P3Q U;  2N7E A;  1HE8 A;  3L08 A;  4KZ0 A;  2HE7 A;  5E6N A;  4IM0 A;  1U4A A;  1I42 A;  1P1A A;  4XZ4 A;  1D3Z A;  3X0W A;  3APD A;  3V62 A;  5KHQ A;  2FUH B;  3ENE A;  1WGY A;  2LWP A;  2M0X A;  2M17 A;  3ML8 A;  1C3T A;  3CF6 E;  5D2M B;  4WJN A;  2BWE S;  2LRW A;  2DHZ A;  1V81 A;  1PQS A;  1EF1 A;  1NI2 A;  3AI5 A;  4II2 B;  2KJR A;  2IO3 B;  2LVO A;  1KM7 A;  1AAR A;  2JRH A;  2DZI A;  1UZX B;  2JZZ A;  4IM2 A;  4KSL C;  5CHF A;  1LXD A;  1V86 A;  2JVC A;  3UIP B;  3B1L X;  3SHQ A;  2KX0 A;  1RFA A;  3PZD A;  1R4M I;  4GGQ A;  2NS5 A;  3PHW B;  4A3P A;  1OEY J;  3UIN B;  1WJU A;  4AJW A;  4ANU A;  4P7I A;  3PV1 A;  1YJ1 A;  1LQB A;  2LVP A;  3ML9 A;  4GOC A;  1ISN A;  4K7W A;  2YLM A;  4JIO U;  3R7Q A;  5JH5 C;  3HIZ A;  4NJ6 A;  2DZK A;  2HTH A;  2UYZ B;  4MEL A;  2KWU B;  4A3O A;  3PRP B;  1SIF A;  4WJP A;  2D2Q A;  4HDQ A;  1S3S G;  1WYW B;  3L0W B;  4WAA A;  4IWP A;  2LGY A;  4PS8 A;  1WXS A;  4B9K A;  3JSV B;  2BPS A;  2MWS B;  2Z59 B;  4DHJ B;  4K7U A;  3PSE B;  3DDC B;  1V80 A;  1NDD A;  3R3M A;  4ICV A;  2KDE B;  3PLV A;  2ZZP B;  2BKF A;  4GN1 A;  1OEY A;  1SGH A;  3VAW A;  3TCA A;  4TKN A;  5E6O A;  2K8C A;  1TGZ B;  3QAR A;  4GXB A;  4ZYN A;  2W9N A;  5AZF A;  4M8N A;  2K8H A;  2ZCB A;  3VFK A;  4EZL A;  2EMT A;  2ZPN A;  2J7Q B;  3OJ3 A;  4K1R B;  3ZNI D;  1YX5 B;  3A1Q A;  3DBS A;  4CO7 A;  4BKG A;  2RSU A;  3IHP C;  3NS8 A;  2DYB A;  3ZNG C;  2KN5 A;  1WH3 A;  2JZ3 B;  2C9W B;  2K6Q A;  3NY5 A;  2KK8 A;  3HM6 X;  2LD9 A;  1JRU A;  3DBR I;  1UEL A;  1E90 A;  4HLE A;  4PYZ A;  4TV3 A;  4B6W A;  4WQO B;  2Z0E B;  3W1Y A;  2K8B A;  4W9G A;  1WX9 A;  4MH0 E;  4E71 A;  5GMV A;  3VUX A;  3VXW A;  3ECI A;  3EFU A;  2B3A A;  2MBB B;  4MDK E;  4MSQ B;  1RLF A;  3ZNH B;  2AYO B;  4LDT B;  4FUL A;  2KTF A;  1WE7 A;  2MCN B;  2C7M B;  3PLU A;  2C7H A;  1WXV A;  2DZM A;  3QJZ A;  2DX5 B;  2C60 A;  3SU8 X;  1J19 A;  3ZNZ B;  1Y8R C;  2N1V A;  1WR1 A;  1EF5 A;  1WR6 E;  2JF5 A;  4GDK A;  3QIJ A;  2GBM A;  5LXI B;  1IYF A;  2WX1 A;  2JXX A;  1E7V A;  1SE9 A;  2PEA A;  2ZVN A;  2XBB C;  3EEC A;  5D7G A;  2D11 A;  4HJK A;  2LXA A;  3H6N A;  5DPT A;  2BYE A;  3OLM D;  3QA8 A;  2D10 A;  2G4D B;  4IWO A;  4KVG B;  4BKS D;  1WZ0 A;  4DDG D;  2GBN A;  3W1S C;  3N32 A;  3VUW A;  1L7Y A;  2R2O A;  2FNJ B;  3WAO A;  1H8C A;  4FJV B;  2MW5 A;  1P98 A;  2N9P C;  2LI5 A;  3PRZ A;  2BKR B;  1WXA A;  1ZW7 A;  3A9K B;  1ZKH A;  3PVL A;  2MQJ A;  2J0J A;  3W1S A;  2NBU A;  2LAS A;  2G3Q B;  1C1Y B;  1K8R B;  3PGE A;  4BOZ B;  3PTF C;  4K81 A;  2MA9 B;  5IAA C;  4DDI D;  1V5O A;  3WAL A;  5JHA A;  3WIM A;  4ZDV A;  3ZDM C;  4GDK B;  2FIF A;  5C23 A;  2GBR A;  4E74 A;  1WM3 A;  2N9X A;  4BFR A;  2ZNV B;  4IWQ A;  1WGG A;  3MTN B;  3M3J A;  4OVV A;  4W9C A;  2KLG A;  4ZRJ A;  4RM9 A;  4F1S A;  3O65 B;  4M0W B;  3PS6 A;  1GNU A;  2G45 B;  2KZR A;  3V60 A;  1WZ3 A;  2MP2 A;  2KDF B;  2XK5 A;  3L16 A;  4HPM B;  1FXT B;  2FAZ A;  3QQ8 B;  2KX3 A;  2ZJD A;  3KYD D;  2L0T A;  3L54 A;  2IY0 B;  4B95 A;  1WMH B;  5DPW A;  3QK0 A;  2FCM A;  2OOB B;  3RCZ A;  1WJ6 A;  2KXJ A;  4EKU A;  1H4R A;  1WI0 A;  2AL3 A;  3JVZ X;  2JPH A;  3OAW A;  2JT4 B;  4AWJ A;  3PRE A;  2KWC A;  2WX0 A;  3B08 A;  4FJZ A;  2MSE D;  2O2V B;  2ZPY A;  4JGH B;  3NOB A;  5EDS A;  1LFD A;  1OQY A;  2N1W A;  3JW0 X;  4BOS C;  3MJW A;  5J17 A;  3OJ4 B;  1NBF C;  2L05 A;  2L3Z A;  1MG8 A;  3AUL A;  4FHK A;  3A33 B;  1WM2 A;  3QWZ B;  3N3K B;  2GBJ A;  3PT2 B;  4ANW A;  4DWF A;  4WWO A;  2BYF A;  1F9J A;  2EKE C;  4WJQ A;  3TMP B;  3P2B A;  3S2A A;  3I3T B;  3TIX A;  3QX1 A;  4HXD A;  3U8Z A;  4BBN F;  1G6J A;  3R66 C;  1E8X A;  1XD3 B;  2BYV E;  4YL8 A;  2BGF A;  3VQI A;  4MJS B;  4MGY E;  5HKH A;  1UBQ A;  2KQS A;  4GIV A;  3A4S C;  3ZRF A;  4LJP B;  3ZKJ C;  2GBK A;  3H1U A;  1XT9 B;  3TBL D;  4F7Z A;  1M94 A;  1X1M A;  3M62 B;  3H7P B;  2O2V A;  4E3C A;  5CHW A;  3ZTC A;  1WX7 A;  1WMH A;  2NR2 A;  4XX5 A;  3T9L A;  2LGD A;  1TTN A;  5AZG A;  4DHJ D;  2PPH A;  2KQ7 A;  4FHJ A;  3VDZ A;  4AOF A;  2I1K A;  2J0M A;  4NAW A;  2FCN A;  1RRB A;  3ZTD A;  2LUE A;  2KTR A;  1E8Z A;  2RPQ A;  1WGD A;  3HM3 A;  1WJN A;  4NPN A;  3ALB A;  3L10 B;  3KH0 A;  3UGB B;  2KVR A;  3CSF A;  3JSV A;  2J0K A;  1EO6 A;  1YD8 U;  4IG7 B;  4NQK E;  2KC2 A;  2WYQ A;  3KUZ A;  2FCQ A;  2QHO A;  4W9L A;  3RZW C;  4IM3 A;  1V49 A;  1UD7 A;  4TQ0 A;  3QC8 B;  4ICU A;  4G0N B;  3R7R A;  1TZ1 A;  2LRU A;  2IY1 B;  2Y5B B;  2Z0D B;  3QHT A;  3RD2 A;  4ZRI A;  5FR6 A;  3BIN A;  2RD0 A;  3VVW B;  1GC6 A;  4MEM A;  1KLV A;  2BF8 B;  3A1Q B;  2KLC A;  3ZW3 A;  3RUL A;  3JYU A;  4FLH A;  4JL9 A;  4G11 A;  4W9E A;  2CU1 A;  3QAQ A;  4J6I A;  3ZDT A;  2KJ6 A;  2DEN B;  3U30 A;  1A5R A;  2A4Z A;  2KDB A;  2MLB A;  5J2R A;  2IO0 B;  2A5U A;  4W9D A;  3WAM A;  3BY4 B;  3ZIM A;  5DCN A;  2BWF A;  4KIK A;  5E6P A;  1GUA B;  4NNJ B;  2N9E B;  5AZH A;  4LDT D;  3KYC D;  4II3 B;  4M8M A;  5IA7 A;  1E8W A;  5JZE B;  4GSW A;  3HHM A;  4MSM B;  5C1Z A;  1V2Y A;  3ZO5 B;  4BVU C;  4A20 A;  2V4L A;  4KDI C;  2R2Q A;  2NCN A;  3DBL I;  1E8Y A;  2HD5 B;  4AP4 C;  4AUQ C;  4HWI B;  3PHX B;  2KAN A;  2V3S A;  3CMM B;  3APF A;  3UQB A;  3RUI B;  1Q5W B;  3C0R B;  3ZRC A;  1YIW A;  3H7S A;  3VTU A;  2CR5 A;  4JLC A;  2ZCC A;  4N9F 4;  1Q0W B;  3H7P A;  3DQV A;  2K39 A;  2ZNV C;  3DVG X;  3ZLZ A;  1QZE A;  5L83 A;  4MGI E;  3NZU A;  1UBI A;  3B0A A;  3KVF B;  2KHW B;  4HCN B;  2NPT A;  2XK5 B;  1E7U A;  2N4F A;  1OGW A;  4I6L B;  4RMA A;  4W9F A;  3EC8 A;  3HK0 A;  1Q1O A;  3SD5 A;  4JQW C;  4ASW C;  3TJP A;  4PYU A;  2KTR B;  2MP2 B;  2KO3 A;  3DCG A;  1TBE A;  3M95 A;  2IZV B;  4FJY A;  4NAW B;  5G55 A;  4KIK B;  5G2N A;  3SDL C;  4CHK A;  4HDO A;  2KD0 A;  2N7D A;  2LJ5 A;  5BO4 B;  3T8M A;  1CMX B;  2FCS A;  2K1F A;  3VHT C;  3DVG Y;  2MBH A;  1R4N I;  4EUT A;  3QCA A;  1WE6 A;  4EZK A;  2KMC A;  2AWT A;  2CS4 A;  3A9J A;  4I6P A;  2MX2 A;  4HCP B;  4G50 A;  4ANX A;  2LVQ A;  3ONS A;  4MGZ E;  2HJ8 A;  4W9K A;  3V6C B;  4PS3 A;  2G4S A;  2YVC A;  4ANV A;  3DBH I;  3LDZ E;  2MRP A;  1P0R A;  1IPG A;  2C5L C;  4WJO A;  2LXC A;  2M1M A;  2O6V B;  1V9J A;  2O6V D;  2NBW B;  2LGX A;  4KDL B;  2AEH A;  3GOE A;  2RR9 A;  2IYD B;  2L8J A;  4RM8 A;  2NVU I;  3UF8 A;  2I1J A;  4I6N B;  2ASQ A;  3CST A;  3TL5 A;  3RYT A;  3V6E B;  3UIO B;  3A4R A;  5KHO A;  3DVN V;  1V6E A;  2D07 B;  5CX3 A;  2PE6 B;  1WRD B;  1GC7 A;  4OVU A;  4XC2 A;  3WAN A;  4GDL A;  1EUV B;  1OTR B;  4DBG A;  4EZJ A;  4IC7 B;  4TUU A;  4F8C B;  5AEK B;  2EMS A;  2NPT B;  5DPS A;  2LZ6 A;  3UQA A;  5LXH A;  1YX6 B;  4TQ1 A;  4BKS A;  4URK A;  2IBI B;  1YQB A;  3L17 A;  4DXA B;  4WWN A;  1LM8 B;  2DAF A;  2JWZ A;  1Z2M A;  3KUC B;  3D32 A;  4MM3 A;  3APC A;  2V1Y A;  3ZUN A;  3H9D A;  4PS7 A;  2WWZ A;  2MBE A;  2KNB A;  2CKH B;  3DOW A;  4DHZ E;  4FA6 A;  3IFW B;  2KMA A;  3AXC A;  3RT3 B;  4DHZ B;  3N30 A;  3A9K A;  2IO2 B;  4KSK C;  3VH3 B;  3V61 A;  2KKC A;  3NHE B;  4AJY B;  4IW0 A;  3AU5 A;  2L7R A;  2DZJ A;  2L0F A;  1S1Q B;  3IVF A;  2KWV B;  2PJH A;  2CHX A;  2GMI C;  2K25 A;  2ZVO A;  2GOW A;  2M8S A;  2VRR B;  4GU2 A;  1I35 A;  2K6D B;  4GB9 A;  1WF9 A;  1VCB A;  2OJR A;  5TR5 A;  2REX A;  2JY6 A;  2O6V A;  1UGM A;  1WX8 A;  2RGF A;  2DYO A;  3DVN U;  1WFY A;  4KV2 A;  4FBJ B;  2KOX A;  1E5W A;  4EEW A;  2C7N B;  2KFJ A;  4IUM B;  2DAJ A;  3IBE A;  4GDL B;  4HK2 A;  3PRM B;  4W9I A;  3RZF A;  3U7D A;  2WDT B;  4EOY A;  2FID A;  3WAP A;  5JHB A;  4ZRK A;  3VUY A;  1KJT A;  3A9J B;  4WWP A;  2IO1 B;  2MBQ A;  1BT0 A;  2KFK A;  2M4N A; 
#chains in the Genus database with same CATH topology
 1HXY D;  1KOT A;  2LGS A;  3HUI A;  2INN E;  3DPD A;  3ABV B;  4MGK E;  2MJE A;  4NJ7 A;  3Q3F A;  3R2T A;  1QOG A;  3VH4 B;  1EWC A;  1VD2 A;  5LLI A;  2WXF A;  3MHS D;  1J0G A;  4LJO B;  3Q3M C;  3X23 A;  1WIA A;  3K9P B;  1Z5S B;  2KJH B;  2KN4 A;  2QDF A;  3LJ3 A;  1NI3 A;  4NQL B;  1WYG A;  2L76 A;  3PPA A;  1F0Z A;  2JUO A;  2KDI A;  3L4P A;  3VTW A;  5DPR A;  2CHZ A;  5D6J B;  4C7Y A;  4YTN B;  3GS2 A;  4ZOH C;  1D3Z A;  3X0W A;  3APD A;  3ENE A;  2Y5P A;  3ML8 A;  1QIL A;  3NJT A;  1YN5 A;  4XYC A;  3PZ8 A;  1V81 A;  1PQS A;  4US9 A;  1NEK B;  3VR8 B;  2NTS A;  3BVM A;  2LVO A;  4IM2 A;  2JRH A;  3AEA B;  4KSL C;  1PGA A;  1V86 A;  4ARI A;  3UIP B;  3B1L X;  1R4M I;  1OEY J;  3UIN B;  1WJU A;  1SEB D;  1I4R A;  1XXG A;  3Q8A A;  2LVP A;  2JXT A;  1ISN A;  2E6X A;  3FIL A;  2DZK A;  2UYZ B;  4MEL A;  1T6B X;  1YQ3 B;  3DHI C;  2KWU B;  3HRD D;  1N5W A;  4B9K A;  1NDD A;  4ICV A;  2ZZP B;  1OEY A;  4A9A A;  3U52 E;  1QLB B;  1TGZ B;  4GXB A;  2K8H A;  1L5P A;  3MC9 A;  4M00 A;  4EZL A;  1NYR A;  1VJK A;  3IAM 1;  2ACZ B;  1KFY B;  1L4D B;  4BKG A;  3E9S A;  2W82 A;  3NS8 A;  1QQR A;  3HM6 X;  3DBR I;  2L1A A;  4HLE A;  2IJ0 A;  2X38 A;  1VZ8 A;  1WX9 A;  4MH0 E;  2UU7 A;  3EFU A;  2MBB B;  1FFV A;  2MCN B;  1WE7 A;  3QJZ A;  1C78 A;  1Y8R C;  3Q3N C;  2JF5 A;  3TEY A;  3CIR B;  1YN4 A;  3EEC A;  2PEA A;  5D7G A;  2XBB C;  5DPT A;  2BYE A;  4L23 A;  3QA8 A;  3IXS A;  1D4B A;  4DDG D;  3MC8 A;  3RNB C;  4AQ7 A;  1XLP A;  2BKR B;  1FNW A;  3A9K B;  3RNF C;  4K81 A;  2MA9 B;  4RF0 A;  4REZ A;  3E56 A;  1WM3 A;  2N9X A;  1SJH D;  3M3J A;  4AS1 A;  1TY2 A;  4RM9 A;  2KDF B;  3L16 A;  2WS3 B;  3L54 A;  3KYD D;  2L0T A;  4WWM A;  2IY0 B;  4B95 A;  4OHJ A;  4HJG E;  4P16 A;  3RCZ A;  4EKU A;  1WJ6 A;  1WI0 A;  3JVZ X;  3OAW A;  2L83 A;  1F77 A;  1LGR A;  3AEC B;  2N1W A;  3JW0 X;  5J17 A;  3BZD B;  3OJ4 B;  2L05 A;  1MG8 A;  4FHK A;  1LO5 D;  3AE9 B;  3N3K B;  3NG0 A;  2WXQ A;  4ANW A;  2M19 A;  4WJQ A;  3TMP B;  3TIX A;  1IUE A;  1UF0 A;  1G6J A;  3R66 C;  1E8X A;  1UWX A;  4MGY E;  5HKH A;  3ZRF A;  4LJP B;  4F7Z A;  1M94 A;  3M62 B;  3H7P B;  2O2V A;  4DHJ D;  1XLN A;  2DLB A;  4TMA B;  2JWU A;  1E8Z A;  4OVZ A;  1WGD A;  3U2S C;  3ALB A;  3UGB B;  3JSV A;  4NQK E;  1N61 A;  3NRZ A;  2W3R A;  2WNM A;  3C8Y A;  1L4Z B;  3QC8 B;  2BS3 B;  3T3N A;  2WU2 B;  4KGR A;  5FR6 A;  3KLS X;  1GC6 A;  1KLV A;  2BF8 B;  1SJE D;  2WXL A;  4PT5 A;  3RUL A;  4JL9 A;  2CU1 A;  1D5Z C;  1P7F A;  1A5R A;  2KDB A;  2MLB A;  1RYJ A;  2A5U A;  2IO0 B;  3WAM A;  2W54 A;  2BWF A;  2GB1 A;  4RGT A;  1ESF A;  1FXI A;  5AZH A;  2N0S B;  2BB6 A;  1E8W A;  2QCZ A;  4B0M A;  4GSW A;  2CJN A;  3CWI A;  4MSM B;  3ZO5 B;  4NJC A;  4LK0 M;  2NCN A;  3VR9 B;  4WAF A;  3PHX B;  2KAN A;  3APF A;  2BVC A;  3W9C B;  1Q5W B;  3KWL A;  4MM3 B;  1YIW A;  4JLC A;  1JWA D;  3DVG X;  3NZU A;  1UBI A;  5EE9 A;  1E6E B;  2N4F A;  1OGW A;  4I6L B;  2DNF A;  3HK0 A;  2PW9 A;  4JQW C;  3TJP A;  4LNO A;  1TBE A;  3IT6 B;  4FJY A;  5G55 A;  4KIK B;  1MI0 A;  1C9F A;  1CMX B;  2K1F A;  2V3P A;  2WU5 B;  3DVG Y;  4EZK A;  4I6P A;  2AWT A;  3URY A;  1E7P B;  4ANX A;  3ONS A;  2HJ8 A;  3PO0 A;  4ANV A;  2MRP A;  2LXC A;  2WXI A;  3GOE A;  2OJW A;  3RNC C;  3UF8 A;  2I1J A;  3P42 A;  4I6N B;  1N5X A;  4WIP A;  3TL5 A;  3V6E B;  2INC C;  3ZJT A;  5KHO A;  3DVN V;  5BMG A;  5CX3 A;  1OTR B;  4OZC A;  4DBG A;  3AEG B;  2NPT B;  2LZ6 A;  1RFK A;  4TQ1 A;  4M01 A;  4URK A;  4ARC A;  5BMI A;  2IBI B;  1YQB A;  2QSD A;  1Z2M A;  3H9D A;  2KNB A;  2CKH B;  4WUR A;  4FA6 A;  3P63 A;  4DHZ B;  1CK1 A;  1AWD A;  3P4Q B;  3SFD B;  2VRR B;  2LJI A;  2W3S A;  1T0S C;  2JY6 A;  3DVN U;  3W5V B;  2JSV X;  3Q8B A;  4ACF A;  2JZP A;  4FBJ B;  3SEB A;  4IUM B;  1D5X C;  2MHJ A;  4HK2 A;  2WDT B;  2FID A;  4MT5 A;  3RPF C;  3ZJV A;  2FBW B;  4WWP A;  1V8C A;  2VH1 A;  2KFK A;  2M4N A;  3K9O B;  4PK1 A;  4GMV A;  2UWQ A;  4BBN C;  2PE9 A;  3MP9 A;  2WDQ B;  4K7S A;  1HTO A;  1GPX A;  1RM6 C;  2CHW A;  2X8X X;  3L13 A;  3GP7 A;  2KC1 A;  1UH6 A;  4DK5 A;  1GJZ A;  1J8C A;  3VTV A;  1IP9 A;  3EFC A;  4NY0 A;  5L95 C;  3GZN I;  3WA0 A;  4BKT A;  4BZA A;  2JRI B;  1WGH A;  1WXM A;  4G3X B;  2ZEQ A;  3NZS A;  3HVZ A;  3Q3J A;  5CTR C;  4TSS A;  4ZHO A;  3M63 B;  4ITK A;  3DBH B;  1P3Q U;  2N7E A;  3L08 A;  4JE3 B;  1I42 A;  4NZL B;  5KHQ A;  1WGY A;  2LWP A;  1DOX A;  2M17 A;  3PZ7 A;  2H88 B;  2KMM A;  3CF6 E;  5D2M B;  2PIA A;  1P7E A;  1JWB D;  1NI2 A;  3AI5 A;  4II2 B;  1JWS D;  3AB5 A;  2KJR A;  2LEK A;  1PUT A;  2JZZ A;  4LLG M;  1FD6 A;  2PLP A;  2KX0 A;  1RFA A;  4GGQ A;  2KDM A;  2Z8L A;  4JPS A;  4ANU A;  2WXO A;  3Q8C A;  2D5G A;  1TZO A;  1YJ1 A;  3ML9 A;  3I5J C;  3R7Q A;  5JH5 C;  3N1Y C;  4NJ6 A;  2HTH A;  4S0R A;  2KYW A;  3PRP B;  4M02 A;  2D2Q A;  1WYW B;  3L0W B;  3AH7 A;  3NVW A;  2H89 B;  4K7U A;  3TEZ A;  1V80 A;  2LMC A;  2WXH A;  2PKO A;  3TCA A;  1C76 A;  3V3X A;  3LXF A;  2K8C A;  3N1X C;  1KLG D;  2K3U A;  3AN1 A;  1D6E C;  4M8N A;  1N6Z A;  1NVI D;  1PDX A;  2EMT A;  2LFI A;  3OJ3 A;  3ZNI D;  3A1Q A;  4CO7 A;  1XEE A;  5IOI A;  3AM9 A;  1ENF A;  3IHP C;  2DYB A;  4QAY A;  1WH3 A;  2C9W B;  2K6Q A;  2LD9 A;  3ZYY X;  1QT9 A;  4B6W A;  3BII D;  4R3D A;  1YJI A;  2K8B A;  4E71 A;  5GMV A;  2EKI A;  3ECI A;  1RLF A;  2GLS A;  1N63 A;  5G5H A;  2DZM A;  3P4S B;  3SU8 X;  3ZNZ B;  3NVY A;  1WR1 A;  1WR6 E;  4GDK A;  5LXI B;  1IYF A;  1TS3 A;  4RF1 A;  2D11 A;  4RFB A;  4C7Z A;  1A70 A;  2G4D B;  4KVG B;  3P4R B;  1WZ0 A;  4FJV B;  2MW5 A;  1P98 A;  2LI5 A;  3PRZ A;  2BW2 A;  3PVL A;  4C00 A;  1EU3 A;  2LAS A;  3LYY A;  1C1Y B;  1I4X A;  1K8R B;  1FRR A;  1V1P A;  3PTF C;  4ZDV A;  1PGX A;  4E74 A;  4LNK A;  2ZNV B;  1Q10 A;  3MTN B;  4W9C A;  5HHD G;  4KKJ A;  4ZRJ A;  4F1S A;  2J53 A;  3DWM A;  1JW9 D;  1GNU A;  2G45 B;  1BUI C;  2JX5 A;  1QKZ A;  1FXT B;  2XNA C;  2ZJD A;  5BYR A;  1L6U A;  1TKY A;  2FCM A;  2JT4 B;  1SE3 A;  3PRE A;  1TS5 A;  2KWC A;  3B08 A;  4FJZ A;  1KLU D;  3MJW A;  3AUL A;  1WM2 A;  3QWZ B;  2GBJ A;  3PT2 B;  1MHH E;  3P2B A;  2BS2 B;  3I3T B;  5E6J A;  2BGF A;  3VQI A;  2GRI A;  2AX5 A;  4YSY B;  3A4S C;  2GI9 A;  3GE8 C;  3ZXV A;  1CJE A;  3MFG A;  3ZKJ C;  2AQ3 B;  3H1U A;  1HTQ A;  4LNI A;  1X1M A;  1F2R C;  1WX7 A;  4P6V F;  3T9L A;  5AZG A;  2PPH A;  2I1K A;  3MC0 B;  3NVV A;  2KTR A;  3TUO A;  1YJJ A;  4NPN A;  3L10 B;  2N9L A;  2WLB A;  1TKE A;  4RGO S;  2J0K A;  1YD8 U;  4IG7 B;  2FUG 1;  2KVZ A;  4W9L A;  2L52 A;  4IM3 A;  3RFZ B;  2LRU A;  4BAX A;  2IY1 B;  1HEZ E;  3BIN A;  3DBL B;  4XE0 A;  1FEH A;  4FLH A;  4J6I A;  2A4Z A;  2LGI A;  3BY4 B;  3ZIM A;  5DCN A;  2LHD A;  1C4P A;  2G9H D;  4NNJ B;  2N9E B;  4LDT D;  3KYC D;  4II3 B;  4M8M A;  5JZE B;  1V2Y A;  2K0P A;  3DBL I;  4NAM A;  3Q8F A;  1QOB A;  2V3S A;  3CMM B;  3UQB A;  1T0Q C;  2QMT A;  2N7J A;  3ZRC A;  2JQR B;  2CR5 A;  3H7P A;  3ZLZ A;  1QZE A;  5G5G A;  3KQ4 A;  3U4E G;  1ROE A;  3KVF B;  4LNF A;  2NPT A;  1E7U A;  4RMA A;  4ASW C;  3EC8 A;  1Q1O A;  2KTR B;  1MJD A;  4CHK A;  2MJD A;  4HDO A;  2M56 B;  4N59 A;  3VHT C;  1R4N I;  3QCA A;  2CS4 A;  3A9J A;  3NUH B;  4CQN A;  2LVQ A;  2W55 A;  2YEP F;  3V6C B;  4PS3 A;  2YVC A;  3DHG C;  3T3O A;  4WJO A;  2M1M A;  2O6V B;  2PVG C;  1V9J A;  2O6V D;  2LGX A;  4KDL B;  2RR9 A;  2NVU I;  1SF0 A;  3CST A;  1V6E A;  2D07 B;  1WRD B;  4XC2 A;  4FXC A;  5FKA C;  1SE2 A;  3AE2 B;  1WRI A;  4IC7 B;  4USA A;  1UNS A;  1SIJ A;  1CZP A;  2WXR A;  3MHZ A;  1IGC A;  4BKS A;  2DWQ A;  2J4X A;  3DBR B;  3L17 A;  4WWN A;  2JWZ A;  3WCQ A;  1NEN B;  4MM3 A;  2BBC A;  3APC A;  2V1Y A;  1J7C A;  2WWZ A;  1OFF A;  2E3T A;  3IFW B;  3RT3 B;  3N30 A;  4KSK C;  3NHE B;  4AJY B;  1K50 A;  2DZJ A;  2L0F A;  3IVF A;  4WQM A;  1VRA B;  2Y3A A;  1WGK A;  2M8S A;  2NTT A;  4GB9 A;  1WF9 A;  2OJR A;  1YNT E;  2O6V A;  4KGT A;  2DYO A;  2KOX A;  2WXG A;  1E5W A;  4EEW A;  4JWU C;  2KFJ A;  4W9I A;  3IBE A;  5BYQ A;  3PRM B;  3RZF A;  3WAP A;  1SBB B;  3A9J B;  4K3C A;  2EEL A;  2QJL A;  2JU6 X;  4W9J A;  2KFK B;  2L00 B;  1V5T A;  1ET9 A;  3AU4 A;  1XQQ A;  4LCD E;  5LNK 1;  3ZVV A;  4HVB A;  2XEW A;  2D3G A;  4YT0 B;  3IG3 A;  4FAD A;  1GG3 A;  1JWM D;  1L0V B;  2MEK A;  4KZC A;  4FN2 A;  4GLS C;  1XO3 A;  2AL6 A;  3EHV A;  3B2G A;  5CHV C;  4X57 B;  1QF6 A;  1WGR A;  1T0Y A;  1L0X B;  4L1B A;  5D94 A;  1DOY A;  5J18 A;  2MBO A;  1HE8 A;  4IM0 A;  1U4A A;  1P1A A;  1YQ4 B;  2WDV B;  4WJN A;  2DHZ A;  2IND C;  1K53 A;  1N62 A;  3Q14 C;  3R2I A;  1AAR A;  5CHF A;  2V3N A;  3FIL B;  3PZD A;  1UUP A;  1AN8 A;  3PHW B;  5IO9 A;  3BK2 A;  4GOC A;  4H2A A;  4OZA A;  2YLM A;  1GB4 A;  3AMZ A;  3H8H A;  4A3O A;  1SIF A;  3AEF B;  4WJP A;  1I4Q A;  1T5X D;  4WAA A;  4IWP A;  1F1H A;  1WXS A;  2WXP A;  2BPS A;  4DHJ B;  3RI7 C;  3PSE B;  3DDC B;  3FAH A;  1C79 A;  5C3J B;  1EWY C;  3R3M A;  2KDE B;  3GZN B;  1SGH A;  3VAW A;  3BK1 A;  5FR3 A;  1J7B A;  5E6O A;  5D3D A;  3TEW A;  4ZYN A;  2W9N A;  3EGR A;  2ZCB A;  3AEE B;  4IDI A;  3VFK A;  2ZPN A;  2J7Q B;  1YX5 B;  3DBS A;  2RSU A;  3ZNG C;  2JZ3 B;  2Q5W D;  4HPP A;  4C80 A;  2KK8 A;  1JRU A;  1SE4 A;  2QC8 A;  4J3O D;  4PYZ A;  4TV3 A;  4WQO B;  4OZB A;  2Z0E B;  4HEA 1;  2KWD A;  4W9G A;  5C2T B;  1C4C A;  3VUX A;  4MDK E;  2B3A A;  3ZNH B;  4FUL A;  2KTF A;  2C7M B;  2C7H A;  2DX5 B;  1WXQ A;  2C60 A;  2N1V A;  3U7Z A;  3EUB 2;  2HJ1 A;  1EF5 A;  3QIJ A;  2BYT A;  2WX1 A;  2JXX A;  1E7V A;  1SE9 A;  2ZVN A;  3H6N A;  3C19 A;  4YTP B;  2GBN A;  1ZPS A;  3N32 A;  3FKY A;  3VUW A;  1JRP A;  2R2O A;  2FNJ B;  2N9P C;  2RPV A;  2SEB D;  1FIQ A;  1ZKH A;  2J0J A;  3W1S A;  2NBU A;  3VRB B;  1GOZ A;  1GAQ B;  3PGE A;  5JHA A;  3WIM A;  3ZDM C;  5C23 A;  2GBR A;  4BFR A;  1WGG A;  4OVV A;  1UGJ A;  2KLG A;  2V0G A;  1C77 A;  3PS6 A;  3N1Z C;  3NVZ A;  3V60 A;  2MP2 A;  4HPM B;  3QQ8 B;  2KX3 A;  4KKI A;  1WMH B;  5DPW A;  3QK0 A;  3RNG C;  2KXJ A;  3KWV A;  2AL3 A;  2JPH A;  4AWJ A;  4HRO A;  2O2V B;  4UDU C;  3AV8 A;  3NOB A;  3P4P B;  5EDS A;  1LFD A;  1OQY A;  4BOS C;  1ZXI A;  1T0R C;  3A33 B;  2I2Y A;  5HG2 A;  4DWF A;  1F9J A;  2EKE C;  1E0Z A;  2I38 A;  3U8Z A;  4HXD A;  4YXD B;  4YL8 A;  5H92 C;  1FRD A;  1UBQ A;  2WXJ A;  2INP E;  1PYW D;  1KRH A;  1T3Q A;  2GBK A;  1XT9 B;  3B2F A;  5MPO A;  5CHW A;  1WMH A;  4FHJ A;  1ZUD 2;  4AOF A;  4NAW A;  1RRB A;  1JQ4 A;  2ON8 A;  1FFU A;  3HM3 A;  3KH0 A;  2KVR A;  3AE5 B;  2KC2 A;  3KUZ A;  2FCQ A;  1SXT A;  3BWU D;  3RZW C;  3SFE B;  4TQ0 A;  3RNE C;  3DWG C;  4ICU A;  4G0N B;  1TZ1 A;  5EE3 A;  1K52 A;  3VVW B;  1FXA A;  4MEM A;  3A1Q B;  2KLC A;  3ZW3 A;  3JYU A;  4W9E A;  4G11 A;  3QAQ A;  3BYY B;  2DEN B;  1AYF A;  4YSZ B;  4KIK A;  1ZXH A;  5E6P A;  5IA7 A;  3HHM A;  4RNA A;  3LB8 C;  4ZRQ A;  4KDI C;  3BVG A;  2BT6 A;  4AP4 C;  4AUQ C;  4OW0 A;  2JYE A;  5AUI A;  3C0R B;  3H7S A;  4N9F 4;  1Q0W B;  1WSP A;  3DQV A;  2ZNV C;  3B0A A;  1TY0 A;  2XK5 B;  4AJW A;  3SD5 A;  1B1Z A;  3GB1 A;  1ZDV A;  2KO3 A;  3M95 A;  2IZV B;  4NAW B;  5G2N A;  3SDL C;  2N7D A;  2WXN A;  4YWG G;  3T8M A;  4YSX B;  2FCS A;  3EA6 A;  2MBH A;  4EUT A;  1WE6 A;  4HRS A;  2MX2 A;  2WP9 B;  4HCP B;  1IGD A;  2G1E A;  4EE2 A;  1F2R I;  2ONQ A;  4D2K A;  1NYQ A;  3LDZ E;  3Q3O C;  1J7A A;  1P0R A;  5EE0 A;  3B9J A;  3ZQ4 A;  4RM8 A;  2AEH A;  1HA5 A;  2L8J A;  2PTL A;  2PMV A;  3MJ5 A;  3UIO B;  4ZHP A;  1GC7 A;  2WQY B;  4OVU A;  3WAN A;  1BXT A;  5T8I A;  2RMM A;  4GDL A;  4TUU A;  4F8C B;  5DPS A;  1YMH E;  3UQA A;  5LXH A;  1LM8 B;  2DAF A;  3D32 A;  4PS7 A;  1TIF A;  1XLQ A;  2KMA A;  3AXC A;  3W5U B;  2RDB C;  5JXV A;  1IBX B;  2KKC A;  3O13 A;  1ET6 A;  4IW0 A;  3AU5 A;  2L7R A;  1MHX A;  2AQ1 B;  2PJH A;  3J9C A;  2K25 A;  2GMI C;  1RWS A;  1XLO A;  4XWW A;  2GOW A;  1I35 A;  4MAC A;  1VCB A;  4A6Q A;  4KV2 A;  1WX8 A;  1Y56 A;  1WFY A;  3Q8E A;  2WDR B;  4GDL B;  4Q2J A;  3GE3 C;  5JHB A;  1TKG A;  1VR9 A;  2MBQ A;  1VDV A;  3Q6B A;  5IP4 D;  1RAX A;  1VZ7 A;  1L6V A;  1UWM A;  4CYE A;  4W9H A;  2NBV B;  1L0Y B;  1WY8 A;  1HQR D;  1JAL A;  3OG5 A;  3KW5 B;  2D3A A;  2KT7 A;  3N9Y C;  2B76 B;  1VLB A;  2DYM A;  3AE3 B;  3DHH C;  3ETR A;  2NMQ A;  4HPL B;  3RMK C;  3KUD B;  2KQ4 X;  1P9D U;  3NZ3 A;  2OHF A;  4N6E B;  4MJS A;  4EFO A;  5BYS A;  5HFY A;  1ZGU B;  1OQQ A;  1WJ4 A;  2D3B A;  2OED A;  3IAS 1;  1E10 A;  1L2N A;  4KZ0 A;  5E6N A;  2HE7 A;  4XZ4 A;  3AE6 B;  3V62 A;  2FUH B;  2M0X A;  2ZW1 A;  1C3T A;  1JML A;  2BWE S;  2LRW A;  2IGG A;  1GB1 A;  1KF6 B;  2AQ2 B;  1EF1 A;  2LUM A;  2IO3 B;  2V4I B;  1KM7 A;  2DZI A;  1UZX B;  3I57 A;  3R8B A;  1LXD A;  2JVC A;  1ZDX A;  2BB5 A;  4B0E A;  3SHQ A;  3ZXR A;  2NS5 A;  4A3P A;  3RN9 C;  4P7I A;  1PGB A;  3PV1 A;  1LQB A;  4K7W A;  1DGJ A;  4JIO U;  4C4V B;  3HIZ A;  5H8Y E;  1KH0 A;  1TS4 A;  4DQO C;  1FPY A;  2QEJ C;  4HDQ A;  1S3S G;  1SB3 C;  1TT5 B;  2LGY A;  4PS8 A;  3JSV B;  2MWS B;  2Z59 B;  4JX1 C;  2R61 A;  1FNU A;  1FCC C;  1JRO A;  4HKQ A;  3PLV A;  1YN3 A;  2BKF A;  4GN1 A;  4TKN A;  4YTM B;  2J52 A;  1XCT L;  3QAR A;  5AZF A;  1MG4 A;  4LTU A;  1R4M B;  1ACC A;  4K1R B;  3FC4 A;  1V97 A;  2KN5 A;  3NY5 A;  3AE4 B;  1E90 A;  1UEL A;  1VZ6 A;  2TSS A;  1I7H A;  3Q69 A;  3W1Y A;  1IBX A;  5TSS A;  3SR6 A;  3I63 C;  4MSQ B;  2BTE A;  2AYO B;  2CU3 A;  4LDT B;  3AED B;  1HZ5 A;  3PLU A;  1WXV A;  1ZOY B;  1J19 A;  1PFD A;  1AW7 A;  1FMA D;  3IT4 B;  3AE7 B;  2GBM A;  2BS4 B;  5I4D A;  4HJK A;  3AE8 B;  2IGD A;  2LXA A;  4K3B A;  3OLM D;  4A55 A;  2D10 A;  4IWO A;  4BKS D;  1FM0 D;  4IOI E;  3W1S C;  2K22 A;  2M0A A;  1L7Y A;  1H8C A;  3WAO A;  1R4N B;  1QOF A;  1WXA A;  1ZW7 A;  4L2Y A;  2MQJ A;  2G3Q B;  1MPE A;  2IDY A;  2MJ3 A;  4BOZ B;  5IAA C;  4DDI D;  1XF5 L;  1V5O A;  3WAL A;  4GDK B;  1KTK A;  2FIF A;  1JWU D;  4IWQ A;  1FCL A;  2K5P A;  3O65 B;  4M0W B;  2ZW0 A;  4ZRP A;  2KZR A;  1MFW A;  1WZ3 A;  1XCQ L;  3HVD A;  2XK5 A;  4P1B C;  1D5M C;  2FAZ A;  2VZK B;  2OOB B;  1H4R A;  2WX0 A;  4JGH B;  2MSE D;  2ZPY A;  5FK9 C;  1NBF C;  2L3Z A;  2DBY A;  4RGN A;  5HI1 A;  1TYG B;  2L32 A;  1EU4 A;  4WWO A;  2BYF A;  3S2A A;  2JYT A;  1CQV A;  3QX1 A;  4BBN F;  2CJO A;  1XD3 B;  2BYV E;  4A90 A;  1YOV B;  4MJS B;  3UI3 A;  2PVO D;  2KQS A;  2YEP B;  4GIV A;  2ICI A;  3TSS A;  3TBL D;  3BYT B;  4E3C A;  3ZTC A;  2MH7 A;  2NR2 A;  3BVZ A;  4MH8 A;  2LGD A;  1TTN A;  4XX5 A;  3W2D A;  1FNV A;  2KQ7 A;  3VDZ A;  5GXG B;  4C4V A;  2VH2 A;  1C4A A;  4XGA B;  2J0M A;  5IKC M;  2FCN A;  4RCO A;  3ZTD A;  4DXF A;  2LUE A;  3RNA C;  2RPQ A;  1V1O A;  4XWT A;  1WJN A;  2WHI A;  3CSF A;  1OQR A;  1EO6 A;  3AEB B;  4M0W A;  1FO4 A;  2WYQ A;  2QHO A;  2Y5C A;  3NS1 A;  2RDH A;  1V49 A;  1UD7 A;  4N58 A;  1V1P B;  2HTM E;  3R7R A;  2Y5B B;  2Z0D B;  3QHT A;  3RD2 A;  4ZRI A;  4KGS A;  2RD0 A;  3P1M A;  4IKG A;  4O1N A;  4XDD A;  4RGM A;  1EM7 A;  4HKZ E;  2RDG A;  3ZDT A;  2KJ6 A;  3U30 A;  1M4V A;  5J2R A;  4W9D A;  1HZ6 A;  1R7S A;  2V9H A;  1GUA B;  3ZGZ A;  2J42 A;  4US8 A;  5C1Z A;  4BVU C;  4A20 A;  2V4L A;  2R2Q A;  1E8Y A;  1TJE A;  2HD5 B;  4HWI B;  2WXK A;  3I9V 1;  2KAJ A;  3RUI B;  2FE8 A;  3VTU A;  2ZCC A;  1N60 A;  1MVK A;  2K39 A;  4MGI E;  1F52 A;  3TEX A;  2SAK A;  2KHW B;  4HCN B;  2D3C A;  3VXW A;  4W9F A;  2IGH A;  5D3I B;  4PYU A;  2MP2 B;  3DCG A;  2KD0 A;  5BO4 B;  1JCK B;  2LJ5 A;  4P1C C;  5AUK A;  2VZK D;  3VRA B;  2QIL A;  1ZE3 D;  4KX6 B;  2WXM A;  1QOA A;  2KMC A;  2LHE A;  3Q2A C;  4G50 A;  1DYQ A;  4MGZ E;  4W9K A;  1I4G A;  2G4S A;  1BML C;  4A8X C;  3DBH I;  1DOI A;  1IPG A;  2C5L C;  5EE1 A;  2NBW B;  2IYD B;  2XN9 C;  5BMH A;  2ASQ A;  3RYT A;  3A4R A;  1K51 A;  3N20 C;  4LNN A;  1STE A;  2PE6 B;  1EUV B;  4EZJ A;  5AEK B;  2EMS A;  2K9X A;  2N9K A;  1YX6 B;  3OWE B;  3V05 A;  4DXA B;  3ZJU A;  3KUC B;  2WGS A;  3ZUN A;  4WH4 A;  2MBE A;  3DOW A;  2IPK D;  2QIE B;  4DHZ E;  1ZP0 B;  4RH6 A;  3AE1 B;  3A9K A;  2IO2 B;  3VH3 B;  3V61 A;  1I4H A;  1WWT A;  2HDE A;  1S1Q B;  1TS2 A;  2KWV B;  2CHX A;  1SSN A;  2ZVO A;  4JWS C;  4GU2 A;  2K6D B;  5IN7 A;  5TR5 A;  4S17 A;  1B9R A;  2REX A;  2RGF A;  1UGM A;  4XDC A;  2C7N B;  2DAJ A;  5L83 A;  3U7D A;  4EOY A;  4ZRK A;  3VUY A;  1KJT A;  1I4P A;  1E9M A;  2IO1 B;  4ZYS A;  2KAC A;  1BT0 A;  4C56 C;  4DXG A;  2BQQ A; 
#chains in the Genus database with same CATH homology
 2KFK B;  2L00 B;  3K9O B;  1RAX A;  4GMV A;  2UWQ A;  1KOT A;  4BBN C;  2PE9 A;  1V5T A;  3AU4 A;  3DPD A;  1XQQ A;  4MGK E;  4CYE A;  4K7S A;  4W9H A;  2NBV B;  2CHW A;  4NJ7 A;  4LCD E;  3L13 A;  1WY8 A;  3KW5 B;  2KC1 A;  3ZVV A;  1UH6 A;  3Q3F A;  4DK5 A;  2XEW A;  4HVB A;  3VH4 B;  2DYM A;  1GJZ A;  1VD2 A;  1J8C A;  3VTV A;  5LLI A;  2D3G A;  4HPL B;  3MHS D;  1J0G A;  4FAD A;  3IG3 A;  4LJO B;  3X23 A;  4NY0 A;  1IP9 A;  5L95 C;  3KUD B;  1GG3 A;  1WIA A;  1P9D U;  3K9P B;  4W9J A;  3GZN I;  1Z5S B;  4KZC A;  2KJH B;  3WA0 A;  4BKT A;  3LJ3 A;  4FN2 A;  2AL6 A;  2JRI B;  3EHV A;  4MJS A;  1WGH A;  1WXM A;  5CHV C;  4NQL B;  4X57 B;  4G3X B;  1WGR A;  2ZEQ A;  4EFO A;  3NZS A;  1ZGU B;  1T0Y A;  1WJ4 A;  2L76 A;  3PPA A;  3Q3J A;  2JUO A;  2KDI A;  3VTW A;  5CTR C;  5DPR A;  2CHZ A;  5D6J B;  5D94 A;  3M63 B;  5J18 A;  2MBO A;  1L2N A;  1P3Q U;  2N7E A;  1HE8 A;  3L08 A;  4KZ0 A;  2HE7 A;  5E6N A;  4IM0 A;  1U4A A;  1I42 A;  1P1A A;  4XZ4 A;  1D3Z A;  3X0W A;  3APD A;  3V62 A;  5KHQ A;  2FUH B;  3ENE A;  1WGY A;  2LWP A;  2M0X A;  2M17 A;  3ML8 A;  1C3T A;  3CF6 E;  5D2M B;  4WJN A;  2BWE S;  2LRW A;  2DHZ A;  1V81 A;  1PQS A;  1EF1 A;  1NI2 A;  3AI5 A;  4II2 B;  2KJR A;  2IO3 B;  2LVO A;  1KM7 A;  1AAR A;  2JRH A;  2DZI A;  1UZX B;  2JZZ A;  4IM2 A;  4KSL C;  5CHF A;  1LXD A;  1V86 A;  2JVC A;  3UIP B;  3B1L X;  3SHQ A;  2KX0 A;  1RFA A;  3PZD A;  1R4M I;  4GGQ A;  2NS5 A;  3PHW B;  4A3P A;  1OEY J;  3UIN B;  1WJU A;  4AJW A;  4ANU A;  4P7I A;  3PV1 A;  1YJ1 A;  1LQB A;  2LVP A;  3ML9 A;  4GOC A;  1ISN A;  4K7W A;  2YLM A;  4JIO U;  3R7Q A;  5JH5 C;  3HIZ A;  4NJ6 A;  2DZK A;  2HTH A;  2UYZ B;  4MEL A;  2KWU B;  4A3O A;  3PRP B;  1SIF A;  4WJP A;  2D2Q A;  4HDQ A;  1S3S G;  1WYW B;  3L0W B;  4WAA A;  4IWP A;  2LGY A;  4PS8 A;  1WXS A;  4B9K A;  3JSV B;  2BPS A;  2MWS B;  2Z59 B;  4DHJ B;  4K7U A;  3PSE B;  3DDC B;  1V80 A;  1NDD A;  3R3M A;  4ICV A;  2KDE B;  3PLV A;  2ZZP B;  2BKF A;  4GN1 A;  1OEY A;  1SGH A;  3VAW A;  3TCA A;  4TKN A;  5E6O A;  2K8C A;  1TGZ B;  3QAR A;  4GXB A;  4ZYN A;  2W9N A;  5AZF A;  4M8N A;  2K8H A;  2ZCB A;  3VFK A;  4EZL A;  2EMT A;  2ZPN A;  2J7Q B;  3OJ3 A;  4K1R B;  3ZNI D;  1YX5 B;  3A1Q A;  3DBS A;  4CO7 A;  4BKG A;  2RSU A;  3IHP C;  3NS8 A;  2DYB A;  3ZNG C;  2KN5 A;  1WH3 A;  2JZ3 B;  2C9W B;  2K6Q A;  3NY5 A;  2KK8 A;  3HM6 X;  2LD9 A;  1JRU A;  3DBR I;  1UEL A;  1E90 A;  4HLE A;  4PYZ A;  4TV3 A;  4B6W A;  4WQO B;  2Z0E B;  3W1Y A;  2K8B A;  4W9G A;  1WX9 A;  4MH0 E;  4E71 A;  5GMV A;  3VUX A;  3VXW A;  3ECI A;  3EFU A;  2B3A A;  2MBB B;  4MDK E;  4MSQ B;  1RLF A;  3ZNH B;  2AYO B;  4LDT B;  4FUL A;  2KTF A;  1WE7 A;  2MCN B;  2C7M B;  3PLU A;  2C7H A;  1WXV A;  2DZM A;  3QJZ A;  2DX5 B;  2C60 A;  3SU8 X;  1J19 A;  3ZNZ B;  1Y8R C;  2N1V A;  1WR1 A;  1EF5 A;  1WR6 E;  2JF5 A;  4GDK A;  3QIJ A;  2GBM A;  5LXI B;  1IYF A;  2WX1 A;  2JXX A;  1E7V A;  1SE9 A;  2PEA A;  2ZVN A;  2XBB C;  3EEC A;  5D7G A;  2D11 A;  4HJK A;  2LXA A;  3H6N A;  5DPT A;  2BYE A;  3OLM D;  3QA8 A;  2D10 A;  2G4D B;  4IWO A;  4KVG B;  4BKS D;  1WZ0 A;  4DDG D;  2GBN A;  3W1S C;  3N32 A;  3VUW A;  1L7Y A;  2R2O A;  2FNJ B;  3WAO A;  1H8C A;  4FJV B;  2MW5 A;  1P98 A;  2N9P C;  2LI5 A;  3PRZ A;  2BKR B;  1WXA A;  1ZW7 A;  3A9K B;  1ZKH A;  3PVL A;  2MQJ A;  2J0J A;  3W1S A;  2NBU A;  2LAS A;  2G3Q B;  1C1Y B;  1K8R B;  3PGE A;  4BOZ B;  3PTF C;  4K81 A;  2MA9 B;  5IAA C;  4DDI D;  1V5O A;  3WAL A;  5JHA A;  3WIM A;  4ZDV A;  3ZDM C;  4GDK B;  2FIF A;  5C23 A;  2GBR A;  4E74 A;  1WM3 A;  2N9X A;  4BFR A;  2ZNV B;  4IWQ A;  1WGG A;  3MTN B;  3M3J A;  4OVV A;  4W9C A;  2KLG A;  4ZRJ A;  4RM9 A;  4F1S A;  3O65 B;  4M0W B;  3PS6 A;  1GNU A;  2G45 B;  2KZR A;  3V60 A;  1WZ3 A;  2MP2 A;  2KDF B;  2XK5 A;  3L16 A;  4HPM B;  1FXT B;  2FAZ A;  3QQ8 B;  2KX3 A;  2ZJD A;  3KYD D;  2L0T A;  3L54 A;  2IY0 B;  4B95 A;  1WMH B;  5DPW A;  3QK0 A;  2FCM A;  2OOB B;  3RCZ A;  1WJ6 A;  2KXJ A;  4EKU A;  1H4R A;  1WI0 A;  2AL3 A;  3JVZ X;  2JPH A;  3OAW A;  2JT4 B;  4AWJ A;  3PRE A;  2KWC A;  2WX0 A;  3B08 A;  4FJZ A;  2MSE D;  2O2V B;  2ZPY A;  4JGH B;  3NOB A;  5EDS A;  1LFD A;  1OQY A;  2N1W A;  3JW0 X;  4BOS C;  3MJW A;  5J17 A;  3OJ4 B;  1NBF C;  2L05 A;  2L3Z A;  1MG8 A;  3AUL A;  4FHK A;  3A33 B;  1WM2 A;  3QWZ B;  3N3K B;  2GBJ A;  3PT2 B;  4ANW A;  4DWF A;  4WWO A;  2BYF A;  1F9J A;  2EKE C;  4WJQ A;  3TMP B;  3P2B A;  3S2A A;  3I3T B;  3TIX A;  3QX1 A;  4HXD A;  3U8Z A;  4BBN F;  1G6J A;  3R66 C;  1E8X A;  1XD3 B;  2BYV E;  4YL8 A;  2BGF A;  3VQI A;  4MJS B;  4MGY E;  5HKH A;  1UBQ A;  2KQS A;  4GIV A;  3A4S C;  3ZRF A;  4LJP B;  3ZKJ C;  2GBK A;  3H1U A;  1XT9 B;  3TBL D;  4F7Z A;  1M94 A;  1X1M A;  3M62 B;  3H7P B;  2O2V A;  4E3C A;  5CHW A;  3ZTC A;  1WX7 A;  1WMH A;  2NR2 A;  4XX5 A;  3T9L A;  2LGD A;  1TTN A;  5AZG A;  4DHJ D;  2PPH A;  2KQ7 A;  4FHJ A;  3VDZ A;  4AOF A;  2I1K A;  2J0M A;  4NAW A;  2FCN A;  1RRB A;  3ZTD A;  2LUE A;  2KTR A;  1E8Z A;  2RPQ A;  1WGD A;  3HM3 A;  1WJN A;  4NPN A;  3ALB A;  3L10 B;  3KH0 A;  3UGB B;  2KVR A;  3CSF A;  3JSV A;  2J0K A;  1EO6 A;  1YD8 U;  4IG7 B;  4NQK E;  2KC2 A;  2WYQ A;  3KUZ A;  2FCQ A;  2QHO A;  4W9L A;  3RZW C;  4IM3 A;  1V49 A;  1UD7 A;  4TQ0 A;  3QC8 B;  4ICU A;  4G0N B;  3R7R A;  1TZ1 A;  2LRU A;  2IY1 B;  2Y5B B;  2Z0D B;  3QHT A;  3RD2 A;  4ZRI A;  5FR6 A;  3BIN A;  2RD0 A;  3VVW B;  1GC6 A;  4MEM A;  1KLV A;  2BF8 B;  3A1Q B;  2KLC A;  3ZW3 A;  3RUL A;  3JYU A;  4FLH A;  4JL9 A;  4G11 A;  4W9E A;  2CU1 A;  3QAQ A;  4J6I A;  3ZDT A;  2KJ6 A;  2DEN B;  3U30 A;  1A5R A;  2A4Z A;  2KDB A;  2MLB A;  5J2R A;  2IO0 B;  2A5U A;  4W9D A;  3WAM A;  3BY4 B;  3ZIM A;  5DCN A;  2BWF A;  4KIK A;  5E6P A;  1GUA B;  4NNJ B;  2N9E B;  5AZH A;  4LDT D;  3KYC D;  4II3 B;  4M8M A;  5IA7 A;  1E8W A;  5JZE B;  4GSW A;  3HHM A;  4MSM B;  5C1Z A;  1V2Y A;  3ZO5 B;  4BVU C;  4A20 A;  2V4L A;  4KDI C;  2R2Q A;  2NCN A;  3DBL I;  1E8Y A;  2HD5 B;  4AP4 C;  4AUQ C;  4HWI B;  3PHX B;  2KAN A;  2V3S A;  3CMM B;  3APF A;  3UQB A;  3RUI B;  1Q5W B;  3C0R B;  3ZRC A;  1YIW A;  3H7S A;  3VTU A;  2CR5 A;  4JLC A;  2ZCC A;  4N9F 4;  1Q0W B;  3H7P A;  3DQV A;  2K39 A;  2ZNV C;  3DVG X;  3ZLZ A;  1QZE A;  5L83 A;  4MGI E;  3NZU A;  1UBI A;  3B0A A;  3KVF B;  2KHW B;  4HCN B;  2NPT A;  2XK5 B;  1E7U A;  2N4F A;  1OGW A;  4I6L B;  4RMA A;  4W9F A;  3EC8 A;  3HK0 A;  1Q1O A;  3SD5 A;  4JQW C;  4ASW C;  3TJP A;  4PYU A;  2KTR B;  2MP2 B;  2KO3 A;  3DCG A;  1TBE A;  3M95 A;  2IZV B;  4FJY A;  4NAW B;  5G55 A;  4KIK B;  5G2N A;  3SDL C;  4CHK A;  4HDO A;  2KD0 A;  2N7D A;  2LJ5 A;  5BO4 B;  3T8M A;  1CMX B;  2FCS A;  2K1F A;  3VHT C;  3DVG Y;  2MBH A;  1R4N I;  4EUT A;  3QCA A;  1WE6 A;  4EZK A;  2KMC A;  2AWT A;  2CS4 A;  3A9J A;  4I6P A;  2MX2 A;  4HCP B;  4G50 A;  4ANX A;  2LVQ A;  3ONS A;  4MGZ E;  2HJ8 A;  4W9K A;  3V6C B;  4PS3 A;  2G4S A;  2YVC A;  4ANV A;  3DBH I;  3LDZ E;  2MRP A;  1P0R A;  1IPG A;  2C5L C;  4WJO A;  2LXC A;  2M1M A;  2O6V B;  1V9J A;  2O6V D;  2NBW B;  2LGX A;  4KDL B;  2AEH A;  3GOE A;  2RR9 A;  2IYD B;  2L8J A;  4RM8 A;  2NVU I;  3UF8 A;  2I1J A;  4I6N B;  2ASQ A;  3CST A;  3TL5 A;  3RYT A;  3V6E B;  3UIO B;  3A4R A;  5KHO A;  3DVN V;  1V6E A;  2D07 B;  5CX3 A;  2PE6 B;  1WRD B;  1GC7 A;  4OVU A;  4XC2 A;  3WAN A;  4GDL A;  1EUV B;  1OTR B;  4DBG A;  4EZJ A;  4IC7 B;  4TUU A;  4F8C B;  5AEK B;  2EMS A;  2NPT B;  5DPS A;  2LZ6 A;  3UQA A;  5LXH A;  1YX6 B;  4TQ1 A;  4BKS A;  4URK A;  2IBI B;  1YQB A;  3L17 A;  4DXA B;  4WWN A;  1LM8 B;  2DAF A;  2JWZ A;  1Z2M A;  3KUC B;  3D32 A;  4MM3 A;  3APC A;  2V1Y A;  3ZUN A;  3H9D A;  4PS7 A;  2WWZ A;  2MBE A;  2KNB A;  2CKH B;  3DOW A;  4DHZ E;  4FA6 A;  3IFW B;  2KMA A;  3AXC A;  3RT3 B;  4DHZ B;  3N30 A;  3A9K A;  2IO2 B;  4KSK C;  3VH3 B;  3V61 A;  2KKC A;  3NHE B;  4AJY B;  4IW0 A;  3AU5 A;  2L7R A;  2DZJ A;  2L0F A;  1S1Q B;  3IVF A;  2KWV B;  2PJH A;  2CHX A;  2GMI C;  2K25 A;  2ZVO A;  2GOW A;  2M8S A;  2VRR B;  4GU2 A;  1I35 A;  2K6D B;  4GB9 A;  1WF9 A;  1VCB A;  2OJR A;  5TR5 A;  2REX A;  2JY6 A;  2O6V A;  1UGM A;  1WX8 A;  2RGF A;  2DYO A;  3DVN U;  1WFY A;  4KV2 A;  4FBJ B;  2KOX A;  1E5W A;  4EEW A;  2C7N B;  2KFJ A;  4IUM B;  2DAJ A;  3IBE A;  4GDL B;  4HK2 A;  3PRM B;  4W9I A;  3RZF A;  3U7D A;  2WDT B;  4EOY A;  2FID A;  3WAP A;  5JHB A;  4ZRK A;  3VUY A;  1KJT A;  3A9J B;  4WWP A;  2IO1 B;  2MBQ A;  1BT0 A;  2KFK A;  2M4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...