4MJSB

Crystal structure of a pb1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
82
Chain Sequence
LTVKAYLLDAAREIRRFSFCPGPCERLLSRVAALFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the homotypic PB1-PB1 complex between PKC zeta and p62
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/protein binding
molecule keywords Protein kinase C zeta type
total genus 21
structure length 82
sequence length 99
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4mjsB00
5D2MB 3VUXA 2KANA 1SIFA 4BKTA 2JWZA 2ZVNA 3ZNGC 2M1MA 2JVCA 4JQWC 2LVPA 2A4ZA 2LD9A 2GBRA 4NPNA 3ZW3A 4K7WA 1WFYA 3HM6X 3OAWA 4GGQA 4ANWA 4F1SA 1V81A 3QQ8B 3B08A 1UD7A 3A9JB 4DK5A 2KQSA 4LJOB 1TTNA 2D2QA 3EHVA 2N7DA 5DPWA 2MX2A 2CHZA 2LGDA 4W9GA 4B6WA 4NAWB 2K6DB 2KJRA 4N9F4 3TIXA 3QJZA 4HPMB 4BOSC 2MQJA 2WYQA 4FHJA 3NY5A 2MLBA 2NBUA 4MGIE 2MBEA 5G2NA 4OVVA 3BINA 3UGBB 5DPTA 3VAWA 3PLVA 2MRPA 5AEKB 3APFA 4MM3A 2KLCA 2A5UA 2XK5B 1V9JA 2JF5A 1BT0A 1V80A 2UYZB 3VFKA 2KDBA 2V3SA 4URKA 4W9FA 2ZPNA 3SD5A 3KH0A 4M8NA 1OQYA 1C1YB 1WE7A 1YX6B 1HE8A 4GN1A 4AJYB 1WR1A 5L95C 4FA6A 3N3KB 4GSWA 4BOZB 5HKHA 5E6NA 1IPGA 5CHFA 5LXIB 2MBHA 2C7HA 3VTUA 1K8RB 3B1LX 3JW0X 2JUOA 2JPHA 2NBWB 3W1SC 1WX9A 4TUUA 1XT9B 3OLMD 4XC2A 3VUWA 2D07B 4W9KA 1ZKHA 2KMAA 2M8SA 4K1RB 3VDZA 3MTNB 2J0MA 2AWTA 2KD0A 4ZYNA 1WI0A 4MSQB 1YIWA 4KDIC 2O6VA 3DBSA 4HPLB 4KDLB 1WR6E 2IO2B 3PHXB 4FLHA 2DYOA 2YVCA 2KJ6A 2ZPYA 3U8ZA 3QC8B 2PEAA 1UBQA 2NPTB 4XX5A 3VHTC 3ZIMA 2L7RA 2AYOB 2FCQA 4EKUA 2KDEB 3Q3FA 2KKCA 4GDLA 5L83A 4WWOA 4RM8A 3PRPB 2Z0DB 3LDZE 4BKSA 2RR9A 2BWES 2K8HA 3JYUA 2ZZPB 4FJVB 4AJWA 4HWIB 4FULA 2KJHB 3RZFA 2AL3A 1Q1OA 2NBVB 2YLMA 2L05A 4W9DA 1UGMA 1WZ3A 3B0AA 3VH4B 1S1QB 2O6VD 4A3OA 2LXAA 3RZWC 4NQKE 1M94A 2BKFA 2HTHA 2N1WA 5CHWA 2N9PC 3EC8A 3U7DA 4BBNC 4ZRJA 3L08A 4YL8A 3NZSA 4NJ7A 2EMTA 3QA8A 2K8CA 3L13A 1EF1A 1OTRB 3A9KB 3PZDA 4FN2A 2MP2B 2KTFA 4HDOA 4MEMA 2GBNA 4ZDVA 2DAFA 3M95A 1V5OA 1L2NA 5D7GA 4ASWC 4FBJB 4DHZB 4TV3A 2C5LC 1GNUA 2M4NA 3QARA 4I6NB 2ZCBA 4EOYA 5J2RA 3IHPC 3M63B 3V6CB 4B95A 3QIJA 3UF8A 3QWZB 2LGYA 3AI5A 3CF6E 5KHOA 4E71A 2K39A 4PS7A 3PLUA 2BGFA 3DVGX 2MCNB 2KXJA 3I3TB 1WGGA 3QCAA 2WX1A 1D3ZA 1SE9A 1LM8B 2L3ZA 2L0FA 2N1VA 3NZUA 4NAWA 3L0WB 1V2YA 2KC2A 4XZ4A 4BBNF 1RRBA 4DBGA 1OEYJ 2LRWA 1OGWA 3AXCA 4FJYA 1ISNA 5CTRC 4JGHB 2I1KA 2M0XA 1GUAB 1YD8U 2N9EB 4W9HA 4NJ6A 2CKHB 1AARA 4TKNA 1WY8A 3ZVVA 1RLFA 3UINB 2D3GA 3KUDB 4PS3A 1E8YA 1UZXB 4MDKE 4OVUA 3NOBA 2KK8A 2WWZA 4WJPA 3ONSA 4FADA 1YX5B 2KTRA 1S3SG 1H4RA 4G3XB 1WGHA 1LQBA 1Q5WB 4MGYE 2C9WB 4W9EA 4LCDE 3RUIB 1WE6A 1KLVA 3EFUA 4II3B 2FCNA 1WIAA 3EECA 3TMPB 3OJ4B 4AOFA 4AWJA 1E7VA 4LDTD 4HVBA 4G50A 2KWUB 4MGKE 1ZGUB 2BKRB 2KDFB 2QHOA 2XBBC 1YQBA 2Z59B 4WWPA 2N9XA 3JVZX 3VTVA 1J8CA 4PYUA 2JZ3B 2KX3A 3T8MA 4F7ZA 1XD3B 1KM7A 3ENEA 3H6NA 4KIKA 5D6JB 3WA0A 3AU4A 2R2OA 4DDID 3H7PB 3DPDA 4GB9A 4FHKA 3SHQA 1P98A 4W9LA 1T0YA 3M62B 4EZKA 1RAXA 1WF9A 3HHMA 2AL6A 2J0JA 5BO4B 2DENB 5JZEB 1WH3A 2HJ8A 2LUEA 1UELA 4KVGB 2G4DB 4LJPB 3QX1A 2L0TA 1J19A 2AEHA 5DCNA 4DHZE 4E3CA 4BFRA 3H1UA 3RCZA 3WALA 2KC1A 2JRIB 2JT4B 1V5TA 4JL9A 2KQ7A 3RULA 3CSFA 2B3AA 2WX0A 2IO1B 3APCA 4CHKA 1Z2MA 3DVNU 2RSUA 1TZ1A 1WJUA 1R4NI 3MJWA 1V86A 1WGDA 3ZDTA 3VXWA 3PGEA 3DCGA 5GMVA 3ZRCA 3PT2B 1SGHA 5TR5A 3A9KA 2D10A 2DX5B 3LJ3A 4RMAA 1G6JA 1E8WA 2V1YA 1OEYA 1WX7A 2C7MB 4IWQA 2DZMA 3DBLI 4WJNA 3ZRFA 3N30A 3R7QA 1NBFC 1P3QU 2LASA 3PS6A 1QZEA 5DPSA 2IY1B 4BKSD 3L54A 4ANXA 3KW5B 2PJHA 2JXXA 1WJ4A 2LVOA 2EKEC 2HE7A 2JRHA 2C60A 2NR2A 3H7PA 2V4LA 4AP4C 3ALBA 3L17A 4WJOA 1WJ6A 3IFWB 3SDLC 4DXAB 2LWPA 2ASQA 2C7NB 2DZIA 2O2VA 3DQVA 2LGXA 1WRDB 4MH0E 4G0NB 4CO7A 4WAAA 4GU2A 4HDQA 2MBOA 3CMMB 3N32A 4IWOA 2KDIA 3KYDD 3A4SC 2K1FA 2K6QA 3V61A 2FIFA 4GXBA 2LZ6A 1I35A 3TL5A 2ZNVC 2K8BA 2EMSA 4ANUA 3PTFC 2XEWA 1EUVB 3AULA 4W9JA 1EO6A 3KUZA 3PSEB 1TBEA 2IY0B 3VUYA 4NY0A 1MG8A 1TGZB 2KTRB 4ICVA 1GC7A 2GBJA 3W1YA 3R3MA 4I6PA 2MA9B 4EEWA 1L7YA 1IYFA 1Q0WB 2KWVB 1C3TA 4K7UA 4J6IA 4TQ0A 3RYTA 4WJQA 5IAAC 3Q3JA 3VVWB 1VCBA 3DOWA 1R4MI 2FNJB 4HXDA 1UH6A 2CU1A 3UQAA 2ZCCA 4MSMB 1GJZA 1P1AA 3PV1A 3R7RA 4IC7B 1WMHB 2DYMA 2KMCA 5G55A 3S2AA 3OJ3A 3P2BA 2RD0A 3QK0A 3UIOB 3ZNZB 4ANVA 3V62A 2XK5A 2M17A 2FIDA 3C0RB 2OJRA 3VTWA 2KHWB 1LFDA 1UBIA 4IWPA 4TQ1A 4G11A 2GBMA 1E8XA 5J17A 3CSTA 1E8ZA 2IO0B 2MWSB 2MSED 5FR6A 3UQBA 3WAMA 2CHXA 2LVQA 3HM3A 2KNBA 3DVNV 4IM3A 2FAZA 5IA7A 1WGRA 2LXCA 2Z0EB 3QHTA 3IBEA 4KV2A 3DDCB 2HD5B 4K7SA 1RFAA 2RPQA 3V6EB 2BYEA 4F8CB 3PHWB 3A9JA 2GMIC 2ZVOA 1P0RA 2IZVB 1CMXB 2I1JA 3PRZA 4IG7B 1WMHA 2N7EA 1E5WA 2J0KA 5KHQA 5LXHA 3H9DA 3DBRI 3DVGY 2CHWA 2G3QB 2ZJDA 5E6OA 1WYWB 3W1SA 3VH3B 4KSLC 2PE9A 1E90A 2MP2A 3X0WA 1E7UA 3K9OB 4HK2A 2KZRA 3WANA 1J0GA 4EZLA 5JH5C 2LJ5A 2KVRA 2NCNA 3L16A 2BWFA 4E74A 2BPSA 3X23A 2NS5A 3A1QB 3O65B 4W9CA 3DBHI 5DPRA 5JHAA 4GDKB 3QAQA 3PREA 1WM2A 2GOWA 2JZZA 1JRUA 3PRMB 2J7QB 4WWNA 4BKGA 4X57B 1PQSA 4HCNB 4MJSA 2BYVE 4KZ0A 2KWCA 2VRRB 2KFKB 1YJ1A 5C1ZA 4GDLB 1X1MA 2LRUA 3ECIA 3APDA 5J18A 2CS4A 1H8CA 5CX3A 4CYEA 2FUHB 1FXTB 3A33B 2O2VB 2NPTA 3WIMA 3ZTCA 1WXAA 2KOXA 2N4FA 2KFKA 4GIVA 4IM2A 3HIZA 5D94A 3WAOA 4EZJA 1WXVA 4MJSB 4WQOB 5AZFA 4A3PA 3ZDMC 2O6VB 1I42A 1VD2A 5CHVC 1WXSA 3K9PB 3ML8A 3NS8A 1KJTA 3A1QA 2LI5A 2L76A 1Y8RC 1EF5A 3ZTDA 4NQLB 2MBBB 4IM0A 4DHJB 1WM3A 4PYZA 2RGFA 3JSVB 2G4SA 4ICUA 1Z5SB 3SU8X 3ZKJC 1A5RA 3PPAA 2OOBB 3D32A 4AUQC 4GMVA 2KFJA 1P9DU 1WXMA 3ZNID 2K25A 2PE6B 2L8JA 2WDTB 1ZW7A 2DZJA 1NI2A 2REXA 2IBIB 5EDSA 3A4RA 3HK0A 3L10B 4KSKC 4BVUC 5AZGA 2PPHA 4PS8A 3GOEA 2BYFA 3BY4B 3M3JA 3JSVA 1WZ0A 3RT3B 3U30A 1F9JA 1V49A 3IG3A 2L00B 4JLCA 4IW0A 5JHBA 2DZKA 2FCMA 2IO3B 2KX0A 1V6EA 2FCSA 4EUTA 1LXDA 5LLIA 2D11A 4MELA 3TBLD 4M0WB 5AZHA 2UWQA 1IP9A 3UIPB 4ZRKA 1XQQA 2ZEQA 4MGZE 3ZUNA 4EFOA 3H7SA 2MBQA 3RD2A 2DHZA 4HLEA 3IVFA 3MHSD 3VQIA 4I6LB 4KZCA 1KOTA 3ZNHB 4HJKA 2KLGA 4W9IA 3GZNI 4A20A 3R66C 3KVFB 2R2QA 4JIOU 4KIKB 3TCAA 1WJNA 4P7IA 2DAJA 4B9KA 4DDGD 2Y5BB 3ML9A 1U4AA 5E6PA 2CR5A 3NHEB 1WX8A 2KN5A 3TJPA 4DWFA 2DYBA 4FJZA 3ZLZA 1GC6A 2GBKA 2NVUI 2ZNVB 3KYCD 3AU5A 4GOCA 2G45B 4NNJB 3V60A 4M8MA 4IUMB 3KUCB 4RM9A 3T9LA 4K81A 3WAPA 1GG3A 2MW5A 2BF8B 4II2B 2IYDB 4ZRIA 4HCPB 3PVLA 2W9NA 4LDTB 3ZO5B 1NDDA 2KO3A 4GDKA 5C23A 1WGYA 2JY6A 4DHJD
chains in the Genus database with same CATH superfamily
3IAS1 4C80A 1A70A 1OQQA 2JWZA 1YQ3B 3ZW3A 2RPVA 3HM6X 3AMZA 2WDRB 3LXFA 1PGXA 3B08A 1FRDA 3A9JB 4DK5A 2KQSA 2LHDA 4B6WA 1YN5A 2K6DB 1I7HA 4N9F4 3TIXA 2WYQA 2HDEA 2MRPA 5AEKB 3APFA 2KLCA 2XK5B 1V9JA 4URKA 2SEBD 2ZPNA 3KH0A 1OQYA 2BT6A 2VH2A 1JWSD 2W54A 4GSWA 3TEZA 4EE2A 5LXIB 4ZHOA 3VTUA 2JUOA 3W1SC 1ZUD2 1XT9B 4W9KA 4K1RB 3VDZA 4KDLB 2IGGA 2IO2B 2ZPYA 2BS3B 2DLBA 1MG4A 2PEAA 3U2SC 3NVZA 3ZIMA 1JWBD 1ZOYB 2L7RA 5BYQA 4EKUA 2KDEB 3Q3FA 2KKCA 4GDLA 5L83A 4WWOA 5IOIA 4RM8A 4P16A 5HHDG 2BWES 2ZZPB 4W9DA 1S1QB 4A3OA 5I4DA 3KQ4A 2HTHA 4BBNC 2N9PC 3EC8A 4IKGA 2RDHA 4LNNA 2EMTA 3QA8A 3L13A 1LO5D 1EF1A 1OTRB 3A9KB 4FN2A 4MEMA 2MP2B 4FBJB 2PVOD 4DHZB 1HA5A 1HEZE 1OFFA 2E3TA 3CF6E 1KLGD 4E71A 2GB1A 2BGFA 3DVGX 3IT4B 1D3ZA 5EE3A 1SE9A 4NAWA 1GOZA 4K3CA 4BBNF 1RRBA 3AXCA 1OGWA 4FJYA 4M01A 5CTRC 4JGHB 2I1KA 1YD8U 3RNCC 2H88B 1AARA 1WY8A 1RLFA 3UINB 1FM0D 2D3GA 2ONQA 2BB6A 1E8YA 5EE9A 1ZE3D 1JWMD 2BBCA 5G5GA 1CZPA 2PIAA 1Q5WB 2C9WB 4W9EA 3RUIB 1STEA 1KLVA 4II3B 4AWJA 2ICIA 3OJ4B 4WWPA 4PT5A 1ZGUB 1XLPA 1R4NB 4L23A 4PYUA 3ZJVA 1TYGB 1AN8A 3H6NA 1KM7A 4L1BA 3WA0A 2TSSA 2EELA 1E6EB 1E10A 3SHQA 4MH8A 2INDC 2JYEA 3HHMA 2J0JA 5BO4B 2LUEA 2QC8A 3AEBB 2J42A 5IN7A 2DWQA 2QIEB 3ETRA 2JT4B 1V5TA 2M19A 2WX0A 3NRZA 4DQOC 3ZXVA 2RSUA 3AB5A 4BAXA 3ZDTA 2V3NA 3PGEA 5HI1A 4MM3B 1YNTE 3W2DA 1YJIA 2MHJA 4MT5A 4IWQA 1OEYA 2DZMA 3DBLI 2X38A 2GI9A 2RDGA 5T8IA 4BKSD 2ZW0A 2GLSA 2NR2A 2V4LA 4LLGM 3L17A 3SDLC 2WXOA 3SFEB 2C7NB 3MHZA 4MH0E 3AE7B 1I4QA 3Q14C 1YQ4B 3Q8BA 1D5MC 1F2RC 2MBOA 1FMAD 3CMMB 3NVVA 2D3BA 3A4SC 2FIFA 3T3NA 4GXBA 3NVYA 3TL5A 3PTFC 1HTOA 4W9JA 1EUVB 2WXRA 1FD6A 3PSEB 3TEYA 1MG8A 1TGZB 2MH7A 3BK2A 4B0EA 1T3QA 3R3MA 4EEWA 1L7YA 1EWCA 4WJQA 1L6VA 1VCBA 2CU1A 3AEGB 4S17A 1WMHB 2DYMA 2WXKA 3QK0A 3ZNZB 2FIDA 3C0RB 1E9MA 3AE2B 1LFDA 2GBMA 5J17A 2IO0B 2MWSB 2INNE 3HM3A 4OW0A 1K52A 1KF6B 3N1XC 4JPSA 5BYRA 3GZNB 4L2YA 2RPQA 3KWLA 3L4PA 1TS4A 4IG7B 1UWXA 2N7EA 3NS1A 2MJEA 2J0KA 1RM6C 2ZJDA 3W1SA 3VH3B 1F77A 3X0WA 3WANA 1EM7A 2WXFA 2BPSA 3X23A 3O65B 4GDKB 5IP4D 3PREA 1WM2A 3AV8A 4BKGA 4X57B 1Q10A 2KFKB 5C1ZA 2DNFA 1ZDVA 4KGSA 1H8CA 3APDA 3V3XA 3TEXA 4CYEA 2FUHB 2O2VB 4GIVA 3HIZA 3WAOA 4EZJA 2INCC 4WQOB 4PK1A 4US8A 1I42A 3FILA 3NS8A 1EF5A 4YTPB 2MBBB 3BVGA 3AEDB 4IM0A 4DXFA 3AE8B 2RGFA 3ZKJC 1N61A 5AUIA 1D4BA 2PKOA 3PPAA 3D32A 3CWIA 3HRDD 2NTTA 4DXGA 1P9DU 3ZNID 1NVID 2PE6B 1FIQA 2L8JA 3MFGA 2KN4A 2OJWA 2BYTA 1XLOA 1R4MB 4PS8A 3M3JA 1WZ0A 3U30A 1V49A 4IW0A 2IO3B 5FK9C 3R2TA 1P7FA 2D11A 4MELA 3TBLD 4RH6A 1NYQA 5AZHA 2UWQA 4ZHPA 5BYSA 1C4CA 2YEPF 1ZP0B 2DHZA 1SB3C 4KGRA 3MHSD 2SAKA 2UU7A 4WQMA 2R2QA 3TCAA 2ZW1A 4B9KA 4DDGD 5D3IB 5E6PA 2CR5A 1FNVA 1WXQA 2KN5A 2DYBA 3ZLZA 2ZNVB 3AU5A 4IUMB 3KUCB 2X8XX 2MW5A 1TY0A 2IYDB 4HCPB 4GDKA 1WGYA 2N9LA 4RFBA 1WSPA 3VUXA 5E6JA 1T0SC 3BVMA 2ZVNA 3ZNGC 2M1MA 2JVCA 2LVPA 1M4VA 4NPNA 2WXMA 1WFYA 4ANWA 4GGQA 4F1SA 4ZOHC 4YSYB 3BZDB 4LNFA 5HFYA 5DPWA 1SE4A 2IDYA 3QJZA 1V1OA 2MQJA 4FHJA 4MGIE 2NBUA 2MBEA 4OVVA 3VAWA 2A5UA 2JF5A 1BT0A 1V80A 4TMAB 3RNEC 3IAM1 4W9FA 3SD5A 2QDFA 3MC9A 1YX6B 2G9HD 4GN1A 4AJYB 4FA6A 3N3KB 1DOXA 5HKHA 1IPGA 3O13A 5CHFA 3ZQ4A 2MBHA 1LGRA 1K8RB 2NMQA 2JPHA 2NBWB 4TUUA 3VUWA 2HJ1A 2LFIA 2D07B 3MTNB 1WI0A 4MSQB 1YIWA 4KDIC 3Q8CA 2O6VA 3DBSA 4HPLB 3PHXB 4FLHA 4N58A 2DYOA 3U8ZA 1GB4A 3QC8B 4XX5A 2CJOA 2FCQA 3I63C 1VDVA 2JX5A 3N1YC 4XE0A 4BKSA 3Q3MC 4WH4A 4FULA 1Q1OA 1ZPSA 1WZ3A 3B0AA 3VH4B 4C56C 2LXAA 3RZWC 4NQKE 2BKFA 1OQRA 1SF0A 1D5XC 2V4IB 5EE1A 4YL8A 2WDVB 4OVZA 3DHIC 2DAFA 1V5OA 2BQQA 1YJJA 4TV3A 3R8BA 1QILA 2N7JA 2ZCBA 4HROA 5J2RA 1N60A 3QWZB 1KLUD 3RI7C 1F2RI 3PLUA 2KXJA 3I3TB 1SJHD 1DOYA 4ZYSA 1WGGA 4XGAB 2CU3A 2BTEA 2Y5PA 2N1VA 2KC2A 4XZ4A 4DBGA 1YOVB 2LRWA 4KKIA 2M0XA 2J53A 2K22A 4NJ6A 2CKHB 3ZVVA 1QT9A 1UZXB 4OVUA 1BUIC 3ZGZA 3R2IA 4XWWA 3NOBA 4IDIA 1SIJA 2KK8A 3ONSA 1YX5B 2KTRA 3BVZA 1IUEA 1H4RA 1LQBA 4LCDE 1GB1A 2FCNA 1WIAA 3EECA 3TMPB 2KACA 2KWUB 2OEDA 2KDFB 4MGKE 2QHOA 2XBBC 4YWGG 1HZ5A 1IGDA 2JZ3B 2KX3A 3T8MA 3FC4A 1I4HA 2AQ2B 3AE6B 2BB5A 3AU4A 4GB9A 1T0YA 4EZKA 5FKAC 2G1EA 4KVGB 1VRAB 4LJPB 2AEHA 3Q69A 4DHZE 4BFRA 4A9AA 2J52A 2KC1A 1XLQA 2JRIB 4ARCA 2KQ7A 3RULA 2EKIA 3APCA 4CHKA 3UI3A 5G5HA 1I4GA 1WJUA 3MJWA 3LB8C 1MHHE 3N9YC 3PT2B 1SGHA 3A9KA 2D10A 3LJ3A 4RMAA 1E8WA 3URYA 3PZ7A 2LEKA 2C7MB 2W55A 3AEFB 3R7QA 1NBFC 3PS6A 4KX6B 2D3AA 2YEPB 3B9JA 2IY1B 2LVOA 2JRHA 3ALBA 1WJ6A 2KMMA 2QEJC 2O2VA 4WAAA 3RMKC 2W82A 2KDIA 5FR3A 2K1FA 3V61A 1N63A 4ZRQA 3Q6BA 4OZAA 3DBRB 2K8BA 3MC0B 3KWVA 2XEWA 3AULA 1EO6A 1TBEA 3VUYA 3N1ZC 5BMIA 2KTRB 4RNAA 1IYFA 3P63A 4K7UA 2RMMA 3RYTA 1WYGA 1XXGA 3DOWA 2FNJB 4HJGE 4HXDA 3UQAA 2ZCCA 1GJZA 1D6EC 3RNGC 2KMCA 3S2AA 3OJ3A 3P2BA 3UIOB 4ANVA 3Q8EA 2XK5A 2PMVA 2Y5CA 4TQ1A 1KRHA 1SBBB 5FR6A 3UQBA 1EU4A 4IM3A 5IA7A 2LXCA 2Z0EB 4OZBA 1T0QC 5LNK1 2N9KA 3A9JA 4JWSC 2IZVB 1CMXB 2LGIA 4P1BC 3P1MA 1WMHA 3DVGY 1K53A 5E6OA 1WYWB 1E90A 3K9OB 2KZRA 2E6XA 1J0GA 1YMHE 3B2GA 2LJ5A 2FUG1 2BWFA 5JHAA 2NS5A 4W9CA 3NG0A 2GOWA 3PRMB 4REZA 4WWNA 3ZJUA 1PQSA 4LNOA 2IGDA 1F52A 2VRRB 1Y56A 4ITKA 1J7BA 1FEHA 3ECIA 5J18A 2CS4A 1FXTB 1HQRD 3WIMA 4Q2JA 5AZFA 3ZDMC 4AQ7A 2O6VB 1WGKA 3P4QB 2FBWB 2OHFA 1WXSA 4M0WA 1NI3A 1FCLA 1T6BX 4DHJB 4PYZA 3DBHB 1A5RA 3SU8X 5HG2A 4GMVA 1JWUD 2KFJA 1WXMA 2Z8LA 3TEWA 3B2FA 4OZCA 2WXGA 1ZW7A 3A4RA 4KSKC 4BVUC 5AZGA 2PPHA 3GOEA 2BYFA 1VLBA 2L00B 2LHEA 1TIFA 3AEEB 3OWEB 4HKZE 3UIPB 1XQQA 2ZEQA 4JWUC 4MGZE 3J9CA 1KFYB 2MBQA 3U7ZA 1WRIA 2WXLA 3KVFB 1WJNA 3ML9A 1I4PA 1WX8A 1XLNA 1GC6A 2WXIA 4GOCA 2G45B 4YSXB 2AQ3B 4RM9A 2QJLA 2LMCA 4K81A 2WXHA 1MVKA 1GG3A 3BK1A 2BF8B 3WAPA 3AE1B 4II2B 4ZRIA 4LDTB 1YN3A 3ZO5B 1TY2A 3RNFC 3DBLB 5C23A 2JY6A 1UWMA 2KANA 4BKTA 2LJIA 1CQVA 3OG5A 4JQWC 2A4ZA 3W9CB 3OAWA 2WNMA 1HXYD 1V97A 3WCQA 4LJOB 1TTNA 2J4XA 2D2QA 3EHVA 2N7DA 1UNSA 2MX2A 2CHZA 2L1AA 2K5PA 4W9GA 4NAWB 2KJRA 1FCCC 4HPMB 4BOSC 3NY5A 2MLBA 1L4ZB 3BINA 2BW2A 3PLVA 1MHXA 1FFUA 2UYZB 4C7ZA 2KDBA 1AWDA 2D3CA 3P4SB 3W5UB 1HE8A 3RPFC 5L95C 4BOZB 5E6NA 2WXPA 2C7HA 3MP9A 3VRBB 1WX9A 1RWSA 1ZKHA 2KMAA 2AWTA 2KD0A 4ZYNA 4AS1A 1FFVA 1WR6E 2YVCA 1SE3A 1V8CA 2HTME 3VHTC 2AYOB 2N0SB 5GXGB 1UUPA 3NVWA 3PRPB 2QCZA 2RR9A 2K8HA 4KKJA 2KJHB 3I5JC 2AL3A 1K50A 1C78A 1RYJA 1SSNA 2NBVB 2YLMA 2L05A 4P6VF 5CHWA 1TS3A 4ZRJA 2K8CA 1QQRA 3AM9A 2W3RA 2KTFA 2WXJA 4ZDVA 1FPYA 3M95A 1L2NA 1XF5L 5D7GA 1JRPA 4ASWC 1GNUA 2AX5A 2M4NA 3QARA 3IHPC 3M63B 3QIJA 1TZOA 1TJEA 2K39A 1N6ZA 3QCAA 2WX1A 1JQ4A 1UGJA 4RF0A 1LM8B 2L3ZA 2L0FA 1XCQL 3NZUA 5IKCM 2QMTA 1OEYJ 4RGMA 1RFKA 3ABVB 1GUAB 4W9HA 1F0ZA 4PS3A 1T0RC 4MDKE 2WWZA 4WJPA 4FADA 4M02A 1S3SG 1N62A 1WGHA 2M0AA 1C79A 3EFUA 4AOFA 4HVBA 4G50A 2WU2B 1EWYC 1J8CA 2Z59B 2M56B 3JVZX 4NJCA 4F7ZA 4D2KA 2WLBA 1XD3B 3ENEA 1VJKA 3AE4B 4IOIE 4XDCA 4DDID 1PFDA 1F1HA 3DPDA 4FHKA 2WU5B 1P98A 4W9LA 3M62B 1RAXA 2DENB 4YXDB 5JZEB 1WH3A 1ET6A 2HJ8A 1L0VB 2G4DB 3QX1A 2L0TA 1J19A 4GLSC 1YN4A 2LUMA 1JCKB 3CSFA 5BMGA 2WDQB 4A90A 1JROA 1TZ1A 2PVGC 1WGDA 3DCGA 5GMVA 1V1PA 1ENFA 3FKYA 3Q3OC 2VZKD 5TR5A 3PO0A 1FRRA 2V1YA 4WJNA 2DBYA 4UDUC 3ZRFA 3N30A 1P3QU 2LASA 1C77A 3V05A 5DPSA 4BZAA 3AH7A 4ANXA 2PJHA 2JXXA 1WJ4A 2ACZB 1TKGA 4AP4C 3IFWB 2JZPA 4DXAB 2LWPA 2LGXA 4G0NB 4GU2A 3TUOA 4RGTA 1TKEA 4IWOA 4LNKA 1VZ6A 1AW7A 1ROEA 4RGOS 2ZNVC 4HKQA 5JXVA 1PYWD 2IY0B 4NY0A 4H2AA 4LTUA 1QOAA 4ICVA 1GC7A 2GBJA 4B0MA 1C3TA 2KWVB 4J6IA 4TQ0A 1KH0A 5IAAC 2XNAC 2PTLA 1P1AA 2JU6X 2Y3AA 2VZKB 1C4PA 2LGSA 3VTWA 2OJRA 2IJ0A 4G11A 3U4EG 3CSTA 2MSED 4FXCA 2CHXA 2R61A 2KNBA 3DVNV 1CJEA 1DGJA 2FAZA 1WGRA 3QHTA 4KV2A 3DDCB 5EE0A 2HD5B 2AQ1B 1RFAA 1J7CA 2BYEA 3PHWB 1XO3A 2I1JA 3PRZA 1VZ7A 3VR9B 3H9DA 2G3QB 1P7EA 2V3PA 2KT7A 2IPKD 4KSLC 2PE9A 3EA6A 3MJ5A 2MP2A 1E7UA 1FNWA 5JH5C 4A6QA 3L16A 2JXTA 1TS5A 3NJTA 5DPRA 2K9XA 3QAQA 3FILB 2JZZA 1JRUA 1E0ZA 3Q3NC 4HCNB 4KZ0A 2KWCA 1YJ1A 3N20C 1DOIA 2KDMA 4GDLB 1X1MA 2LRUA 5CX3A 4LK0M 3A33B 3ZTCA 2V0GA 1WXAA 2KOXA 1E7PB 2KFKA 4RCOA 5D94A 4QAYA 1WXVA 3T3OA 4A3PA 1C4AA 2FE8A 1GPXA 2WXQA 5CHVC 3K9PB 3ML8A 2INPE 2LI5A 2L76A 1L0XB 4CQNA 5AUKA 3JSVB 2G4SA 1XCTL 1Z5SB 2L32A 3E9SA 4AUQC 2V9HA 2WDTB 1DYQA 2IBIB 5EDSA 2KYWA 3HK0A 3AE5B 3L10B 4KGTA 2KWDA 2WGSA 1KTKA 3JSVA 3AECB 1I4RA 2D5GA 2JSVX 2KX0A 3GS2A 2XN9C 1V6EA 1HTQA 1IP9A 3H8HA 4ZRKA 3ZUNA 4EFOA 1QKZA 3VQIA 1KOTA 3C8YA 4HPPA 1QLBB 4W9IA 4C4VB 3R66C 4KIKB 2I38A 3PZ8A 2DAJA 2Y5BB 1U4AA 1UF0A 3NHEB 1BMLC 4DWFA 4FJZA 2NVUI 2GBKA 3KYCD 3V60A 4XDDA 2WQYB 1SXTA 3PVLA 2W9NA 3Q2AC 2KO3A 1MFWA 2K3UA 4P7IA 4F8CB 2BS4B 3FAHA 5D2MB 1TKYA 1SIFA 2QSDA 2LD9A 2GBRA 3BIID 4K7WA 1B9RA 1V81A 3QQ8B 4N6EB 1UD7A 3NUHB 3ZJTA 1T5XD 2LGDA 3IT6B 4YTMB 5G2NA 4NZLB 3UGBB 5DPTA 4MM3A 2B76B 3VFKA 1PGAA 2V3SA 4M8NA 1C1YB 1WE7A 3P4PB 1WR1A 4XYCA 1XEEA 3EUB2 1JALA 3MC8A 3B1LX 3JW0X 2ON8A 1QOFA 3RNBC 3OLMD 2MJDA 3AEAB 4XC2A 2M8SA 3BWUD 2J0MA 1TT5B 1FO4A 1ZXHA 3GE8C 2KJ6A 1QF6A 1FNUA 1D5ZC 4ACFA 1IGCA 1UBQA 2NPTB 4K3BA 1QOGA 2BVCA 2Z0DB 3HVDA 3LDZE 3JYUA 1I4XA 4FJVB 4AJWA 1VZ8A 4HWIB 4WWMA 3RZFA 4YT0B 3EGRA 4WURA 1B1ZA 1TS2A 1UGMA 4JX1C 2O6VD 3U7DA 1M94A 2N1WA 4TSSA 1HZ6A 1L0YB 3L08A 3NZSA 4NJ7A 3PZDA 4HDOA 2GBNA 2GRIA 4WAFA 2C5LC 4I6NB 3RN9C 4EOYA 4B95A 3V6CB 3UF8A 2LGYA 3AI5A 3W5VB 5KHOA 4PS7A 4OHJA 2MCNB 1J7AA 5H8YE 3AN1A 1SJED 3L0WB 1V2YA 1ISNA 1IBXB 3GB1A 1CK1A 2N9EB 4TKNA 2WXNA 3KUDB 3P4RB 3ZYYX 4HEA1 2CJNA 4G3XB 1L4DB 4A8XC 4MGYE 2K0PA 2L52A 1WE6A 1EU3A 2IGHA 1E7VA 3DWMA 4LDTD 4NAMA 2BKRB 3VTVA 1YQBA 2N9XA 2W3SA 4KIKA 1NEKB 3C19A 5D6JB 3VRAB 2R2OA 4MACA 4C4VA 3H7PB 2PLPA 5TSSA 5C2TB 1WF9A 2AL6A 2KVZA 3DHHC 1MI0A 1ZXIA 1UELA 3SEBA 4J3OD 5DCNA 4E3CA 3H1UA 2WHIA 2I2YA 3RCZA 3WALA 3CIRB 4LNIA 4JL9A 2B3AA 2IO1B 1Z2MA 3DVNU 2MJ3A 1R4NI 1V86A 3VXWA 4US9A 1ET9A 3ZRCA 2PW9A 2DX5B 1R7SA 4RGNA 4USAA 1G6JA 1ACCA 1WX7A 5BMHA 4A55A 2L83A 4P1CC 3DHGC 3E56A 1QZEA 4ZRPA 1JW9D 2JQRB 3L54A 3KW5B 2EKEC 2HE7A 2C60A 1JWAD 3H7PA 4WJOA 4RF1A 1MPEA 2ASQA 2DZIA 3DQVA 1WRDB 3VR8B 4CO7A 4HDQA 3BYTB 3N32A 1WWTA 3KYDD 2K6QA 3Q8FA 3AE9B 1PUTA 2LZ6A 1I35A 2EMSA 3HVZA 4ANUA 3SR6A 3KUZA 3Q8AA 3W1YA 5C3JB 4I6PA 1JMLA 2MA9B 1Q0WB 3Q3JA 3VVWB 1R4MI 2KAJA 1UH6A 4MSMB 3PV1A 3R7RA 4IC7B 5G55A 1IBXA 2RD0A 3V62A 2M17A 2KHWB 1UBIA 3AE3B 4IWPA 1ESFA 1E8XA 1E8ZA 1FXIA 3WAMA 2LVQA 2WS3B 3RNAC 2QILA 3IBEA 4K7SA 3V6EB 2JYTA 2GMIC 2ZVOA 1P0RA 1E5WA 5KHQA 5H92C 5LXHA 3DBRI 4R3DA 2CHWA 3U52E 3IXSA 3NZ3A 4HK2A 4EZLA 1C9FA 2KVRA 2NCNA 1QOBA 3P42A 4E74A 3A1QB 2NTSA 3DBHI 4N59A 2WP9B 1SEBD 4S0RA 2J7QB 4C7YA 4MJSA 1ZDXA 2BYVE 3DWGC 1MJDA 2BS2B 2H89B 2NPTA 2RDBC 1PDXA 2N4FA 5IO9A 3I9V1 4IM2A 3I57A 4MJSB 3SFDB 4ARIA 3LYYA 1VD2A 1KJTA 3A1QA 1Y8RC 1NENB 1GAQB 4JE3B 3ZTDA 4NQLB 1SE2A 1WM3A 4YTNB 4O1NA 4ICUA 5MPOA 1V1PB 3GP7A 2OOBB 3KLSX 2K25A 4M00A 3BYYB 2DZJA 1NI2A 2REXA 1FXAA 1K51A 1N5XA 3BY4B 4WIPA 1L5PA 3RT3B 1F9JA 2JWUA 3IG3A 4JLCA 2VH1A 5JHBA 2DZKA 2FCMA 4XWTA 2FCSA 4EUTA 1LXDA 5LLIA 3TSSA 4M0WB 1NYRA 2MEKA 1L6UA 1N5WA 3H7SA 3RD2A 4HLEA 3IVFA 1VR9A 3GE3C 4I6LB 4KZCA 3ZNHB 4HJKA 1AYFA 2KLGA 2Q5WD 3GZNI 4A20A 3EFCA 4JIOU 1PGBA 4YSZB 3TJPA 3RFZB 4NNJB 1C76A 2KQ4X 4C00A 4M8MA 1BXTA 3T9LA 4HRSA 3ZXRA 5D3DA 3HUIA 1NDDA 4DHJD
chains in the Genus database with same CATH topology
5D2MB 3VUXA 2KANA 1SIFA 4BKTA 2JWZA 2ZVNA 3ZNGC 2M1MA 2JVCA 4JQWC 2LVPA 2A4ZA 2LD9A 2GBRA 4NPNA 3ZW3A 4K7WA 1WFYA 3HM6X 3OAWA 4GGQA 4ANWA 4F1SA 1V81A 3QQ8B 3B08A 1UD7A 3A9JB 4DK5A 2KQSA 4LJOB 1TTNA 2D2QA 3EHVA 2N7DA 5DPWA 2MX2A 2CHZA 2LGDA 4W9GA 4B6WA 4NAWB 2K6DB 2KJRA 4N9F4 3TIXA 3QJZA 4HPMB 4BOSC 2MQJA 2WYQA 4FHJA 3NY5A 2MLBA 2NBUA 4MGIE 2MBEA 5G2NA 4OVVA 3BINA 3UGBB 5DPTA 3VAWA 3PLVA 2MRPA 5AEKB 3APFA 4MM3A 2KLCA 2A5UA 2XK5B 1V9JA 2JF5A 1BT0A 1V80A 2UYZB 3VFKA 2KDBA 2V3SA 4URKA 4W9FA 2ZPNA 3SD5A 3KH0A 4M8NA 1OQYA 1C1YB 1WE7A 1YX6B 1HE8A 4GN1A 4AJYB 1WR1A 5L95C 4FA6A 3N3KB 4GSWA 4BOZB 5HKHA 5E6NA 1IPGA 5CHFA 5LXIB 2MBHA 2C7HA 3VTUA 1K8RB 3B1LX 3JW0X 2JUOA 2JPHA 2NBWB 3W1SC 1WX9A 4TUUA 1XT9B 3OLMD 4XC2A 3VUWA 2D07B 4W9KA 1ZKHA 2KMAA 2M8SA 4K1RB 3VDZA 3MTNB 2J0MA 2AWTA 2KD0A 4ZYNA 1WI0A 4MSQB 1YIWA 4KDIC 2O6VA 3DBSA 4HPLB 4KDLB 1WR6E 2IO2B 3PHXB 4FLHA 2DYOA 2YVCA 2KJ6A 2ZPYA 3U8ZA 3QC8B 2PEAA 1UBQA 2NPTB 4XX5A 3VHTC 3ZIMA 2L7RA 2AYOB 2FCQA 4EKUA 2KDEB 3Q3FA 2KKCA 4GDLA 5L83A 4WWOA 4RM8A 3PRPB 2Z0DB 3LDZE 4BKSA 2RR9A 2BWES 2K8HA 3JYUA 2ZZPB 4FJVB 4AJWA 4HWIB 4FULA 2KJHB 3RZFA 2AL3A 1Q1OA 2NBVB 2YLMA 2L05A 4W9DA 1UGMA 1WZ3A 3B0AA 3VH4B 1S1QB 2O6VD 4A3OA 2LXAA 3RZWC 4NQKE 1M94A 2BKFA 2HTHA 2N1WA 5CHWA 2N9PC 3EC8A 3U7DA 4BBNC 4ZRJA 3L08A 4YL8A 3NZSA 4NJ7A 2EMTA 3QA8A 2K8CA 3L13A 1EF1A 1OTRB 3A9KB 3PZDA 4FN2A 2MP2B 2KTFA 4HDOA 4MEMA 2GBNA 4ZDVA 2DAFA 3M95A 1V5OA 1L2NA 5D7GA 4ASWC 4FBJB 4DHZB 4TV3A 2C5LC 1GNUA 2M4NA 3QARA 4I6NB 2ZCBA 4EOYA 5J2RA 3IHPC 3M63B 3V6CB 4B95A 3QIJA 3UF8A 3QWZB 2LGYA 3AI5A 3CF6E 5KHOA 4E71A 2K39A 4PS7A 3PLUA 2BGFA 3DVGX 2MCNB 2KXJA 3I3TB 1WGGA 3QCAA 2WX1A 1D3ZA 1SE9A 1LM8B 2L3ZA 2L0FA 2N1VA 3NZUA 4NAWA 3L0WB 1V2YA 2KC2A 4XZ4A 4BBNF 1RRBA 4DBGA 1OEYJ 2LRWA 1OGWA 3AXCA 4FJYA 1ISNA 5CTRC 4JGHB 2I1KA 2M0XA 1GUAB 1YD8U 2N9EB 4W9HA 4NJ6A 2CKHB 1AARA 4TKNA 1WY8A 3ZVVA 1RLFA 3UINB 2D3GA 3KUDB 4PS3A 1E8YA 1UZXB 4MDKE 4OVUA 3NOBA 2KK8A 2WWZA 4WJPA 3ONSA 4FADA 1YX5B 2KTRA 1S3SG 1H4RA 4G3XB 1WGHA 1LQBA 1Q5WB 4MGYE 2C9WB 4W9EA 4LCDE 3RUIB 1WE6A 1KLVA 3EFUA 4II3B 2FCNA 1WIAA 3EECA 3TMPB 3OJ4B 4AOFA 4AWJA 1E7VA 4LDTD 4HVBA 4G50A 2KWUB 4MGKE 1ZGUB 2BKRB 2KDFB 2QHOA 2XBBC 1YQBA 2Z59B 4WWPA 2N9XA 3JVZX 3VTVA 1J8CA 4PYUA 2JZ3B 2KX3A 3T8MA 4F7ZA 1XD3B 1KM7A 3ENEA 3H6NA 4KIKA 5D6JB 3WA0A 3AU4A 2R2OA 4DDID 3H7PB 3DPDA 4GB9A 4FHKA 3SHQA 1P98A 4W9LA 1T0YA 3M62B 4EZKA 1RAXA 1WF9A 3HHMA 2AL6A 2J0JA 5BO4B 2DENB 5JZEB 1WH3A 2HJ8A 2LUEA 1UELA 4KVGB 2G4DB 4LJPB 3QX1A 2L0TA 1J19A 2AEHA 5DCNA 4DHZE 4E3CA 4BFRA 3H1UA 3RCZA 3WALA 2KC1A 2JRIB 2JT4B 1V5TA 4JL9A 2KQ7A 3RULA 3CSFA 2B3AA 2WX0A 2IO1B 3APCA 4CHKA 1Z2MA 3DVNU 2RSUA 1TZ1A 1WJUA 1R4NI 3MJWA 1V86A 1WGDA 3ZDTA 3VXWA 3PGEA 3DCGA 5GMVA 3ZRCA 3PT2B 1SGHA 5TR5A 3A9KA 2D10A 2DX5B 3LJ3A 4RMAA 1G6JA 1E8WA 2V1YA 1OEYA 1WX7A 2C7MB 4IWQA 2DZMA 3DBLI 4WJNA 3ZRFA 3N30A 3R7QA 1NBFC 1P3QU 2LASA 3PS6A 1QZEA 5DPSA 2IY1B 4BKSD 3L54A 4ANXA 3KW5B 2PJHA 2JXXA 1WJ4A 2LVOA 2EKEC 2HE7A 2JRHA 2C60A 2NR2A 3H7PA 2V4LA 4AP4C 3ALBA 3L17A 4WJOA 1WJ6A 3IFWB 3SDLC 4DXAB 2LWPA 2ASQA 2C7NB 2DZIA 2O2VA 3DQVA 2LGXA 1WRDB 4MH0E 4G0NB 4CO7A 4WAAA 4GU2A 4HDQA 2MBOA 3CMMB 3N32A 4IWOA 2KDIA 3KYDD 3A4SC 2K1FA 2K6QA 3V61A 2FIFA 4GXBA 2LZ6A 1I35A 3TL5A 2ZNVC 2K8BA 2EMSA 4ANUA 3PTFC 2XEWA 1EUVB 3AULA 4W9JA 1EO6A 3KUZA 3PSEB 1TBEA 2IY0B 3VUYA 4NY0A 1MG8A 1TGZB 2KTRB 4ICVA 1GC7A 2GBJA 3W1YA 3R3MA 4I6PA 2MA9B 4EEWA 1L7YA 1IYFA 1Q0WB 2KWVB 1C3TA 4K7UA 4J6IA 4TQ0A 3RYTA 4WJQA 5IAAC 3Q3JA 3VVWB 1VCBA 3DOWA 1R4MI 2FNJB 4HXDA 1UH6A 2CU1A 3UQAA 2ZCCA 4MSMB 1GJZA 1P1AA 3PV1A 3R7RA 4IC7B 1WMHB 2DYMA 2KMCA 5G55A 3S2AA 3OJ3A 3P2BA 2RD0A 3QK0A 3UIOB 3ZNZB 4ANVA 3V62A 2XK5A 2M17A 2FIDA 3C0RB 2OJRA 3VTWA 2KHWB 1LFDA 1UBIA 4IWPA 4TQ1A 4G11A 2GBMA 1E8XA 5J17A 3CSTA 1E8ZA 2IO0B 2MWSB 2MSED 5FR6A 3UQBA 3WAMA 2CHXA 2LVQA 3HM3A 2KNBA 3DVNV 4IM3A 2FAZA 5IA7A 1WGRA 2LXCA 2Z0EB 3QHTA 3IBEA 4KV2A 3DDCB 2HD5B 4K7SA 1RFAA 2RPQA 3V6EB 2BYEA 4F8CB 3PHWB 3A9JA 2GMIC 2ZVOA 1P0RA 2IZVB 1CMXB 2I1JA 3PRZA 4IG7B 1WMHA 2N7EA 1E5WA 2J0KA 5KHQA 5LXHA 3H9DA 3DBRI 3DVGY 2CHWA 2G3QB 2ZJDA 5E6OA 1WYWB 3W1SA 3VH3B 4KSLC 2PE9A 1E90A 2MP2A 3X0WA 1E7UA 3K9OB 4HK2A 2KZRA 3WANA 1J0GA 4EZLA 5JH5C 2LJ5A 2KVRA 2NCNA 3L16A 2BWFA 4E74A 2BPSA 3X23A 2NS5A 3A1QB 3O65B 4W9CA 3DBHI 5DPRA 5JHAA 4GDKB 3QAQA 3PREA 1WM2A 2GOWA 2JZZA 1JRUA 3PRMB 2J7QB 4WWNA 4BKGA 4X57B 1PQSA 4HCNB 4MJSA 2BYVE 4KZ0A 2KWCA 2VRRB 2KFKB 1YJ1A 5C1ZA 4GDLB 1X1MA 2LRUA 3ECIA 3APDA 5J18A 2CS4A 1H8CA 5CX3A 4CYEA 2FUHB 1FXTB 3A33B 2O2VB 2NPTA 3WIMA 3ZTCA 1WXAA 2KOXA 2N4FA 2KFKA 4GIVA 4IM2A 3HIZA 5D94A 3WAOA 4EZJA 1WXVA 4MJSB 4WQOB 5AZFA 4A3PA 3ZDMC 2O6VB 1I42A 1VD2A 5CHVC 1WXSA 3K9PB 3ML8A 3NS8A 1KJTA 3A1QA 2LI5A 2L76A 1Y8RC 1EF5A 3ZTDA 4NQLB 2MBBB 4IM0A 4DHJB 1WM3A 4PYZA 2RGFA 3JSVB 2G4SA 4ICUA 1Z5SB 3SU8X 3ZKJC 1A5RA 3PPAA 2OOBB 3D32A 4AUQC 4GMVA 2KFJA 1P9DU 1WXMA 3ZNID 2K25A 2PE6B 2L8JA 2WDTB 1ZW7A 2DZJA 1NI2A 2REXA 2IBIB 5EDSA 3A4RA 3HK0A 3L10B 4KSKC 4BVUC 5AZGA 2PPHA 4PS8A 3GOEA 2BYFA 3BY4B 3M3JA 3JSVA 1WZ0A 3RT3B 3U30A 1F9JA 1V49A 3IG3A 2L00B 4JLCA 4IW0A 5JHBA 2DZKA 2FCMA 2IO3B 2KX0A 1V6EA 2FCSA 4EUTA 1LXDA 5LLIA 2D11A 4MELA 3TBLD 4M0WB 5AZHA 2UWQA 1IP9A 3UIPB 4ZRKA 1XQQA 2ZEQA 4MGZE 3ZUNA 4EFOA 3H7SA 2MBQA 3RD2A 2DHZA 4HLEA 3IVFA 3MHSD 3VQIA 4I6LB 4KZCA 1KOTA 3ZNHB 4HJKA 2KLGA 4W9IA 3GZNI 4A20A 3R66C 3KVFB 2R2QA 4JIOU 4KIKB 3TCAA 1WJNA 4P7IA 2DAJA 4B9KA 4DDGD 2Y5BB 3ML9A 1U4AA 5E6PA 2CR5A 3NHEB 1WX8A 2KN5A 3TJPA 4DWFA 2DYBA 4FJZA 3ZLZA 1GC6A 2GBKA 2NVUI 2ZNVB 3KYCD 3AU5A 4GOCA 2G45B 4NNJB 3V60A 4M8MA 4IUMB 3KUCB 4RM9A 3T9LA 4K81A 3WAPA 1GG3A 2MW5A 2BF8B 4II2B 2IYDB 4ZRIA 4HCPB 3PVLA 2W9NA 4LDTB 3ZO5B 1NDDA 2KO3A 4GDKA 5C23A 1WGYA 2JY6A 4DHJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2M B;  3VUX A;  2KAN A;  1SIF A;  4BKT A;  2JWZ A;  2ZVN A;  3ZNG C;  2M1M A;  2JVC A;  4JQW C;  2LVP A;  2A4Z A;  2LD9 A;  2GBR A;  4NPN A;  3ZW3 A;  4K7W A;  1WFY A;  3HM6 X;  3OAW A;  4GGQ A;  4ANW A;  4F1S A;  1V81 A;  3QQ8 B;  3B08 A;  1UD7 A;  3A9J B;  4DK5 A;  2KQS A;  4LJO B;  1TTN A;  2D2Q A;  3EHV A;  2N7D A;  5DPW A;  2MX2 A;  2CHZ A;  2LGD A;  4W9G A;  4B6W A;  4NAW B;  2K6D B;  2KJR A;  4N9F 4;  3TIX A;  3QJZ A;  4HPM B;  4BOS C;  2MQJ A;  2WYQ A;  4FHJ A;  3NY5 A;  2MLB A;  2NBU A;  4MGI E;  2MBE A;  5G2N A;  4OVV A;  3BIN A;  3UGB B;  5DPT A;  3VAW A;  3PLV A;  2MRP A;  5AEK B;  3APF A;  4MM3 A;  2KLC A;  2A5U A;  2XK5 B;  1V9J A;  2JF5 A;  1BT0 A;  1V80 A;  2UYZ B;  3VFK A;  2KDB A;  2V3S A;  4URK A;  4W9F A;  2ZPN A;  3SD5 A;  3KH0 A;  4M8N A;  1OQY A;  1C1Y B;  1WE7 A;  1YX6 B;  1HE8 A;  4GN1 A;  4AJY B;  1WR1 A;  5L95 C;  4FA6 A;  3N3K B;  4GSW A;  4BOZ B;  5HKH A;  5E6N A;  1IPG A;  5CHF A;  5LXI B;  2MBH A;  2C7H A;  3VTU A;  1K8R B;  3B1L X;  3JW0 X;  2JUO A;  2JPH A;  2NBW B;  3W1S C;  1WX9 A;  4TUU A;  1XT9 B;  3OLM D;  4XC2 A;  3VUW A;  2D07 B;  4W9K A;  1ZKH A;  2KMA A;  2M8S A;  4K1R B;  3VDZ A;  3MTN B;  2J0M A;  2AWT A;  2KD0 A;  4ZYN A;  1WI0 A;  4MSQ B;  1YIW A;  4KDI C;  2O6V A;  3DBS A;  4HPL B;  4KDL B;  1WR6 E;  2IO2 B;  3PHX B;  4FLH A;  2DYO A;  2YVC A;  2KJ6 A;  2ZPY A;  3U8Z A;  3QC8 B;  2PEA A;  1UBQ A;  2NPT B;  4XX5 A;  3VHT C;  3ZIM A;  2L7R A;  2AYO B;  2FCQ A;  4EKU A;  2KDE B;  3Q3F A;  2KKC A;  4GDL A;  5L83 A;  4WWO A;  4RM8 A;  3PRP B;  2Z0D B;  3LDZ E;  4BKS A;  2RR9 A;  2BWE S;  2K8H A;  3JYU A;  2ZZP B;  4FJV B;  4AJW A;  4HWI B;  4FUL A;  2KJH B;  3RZF A;  2AL3 A;  1Q1O A;  2NBV B;  2YLM A;  2L05 A;  4W9D A;  1UGM A;  1WZ3 A;  3B0A A;  3VH4 B;  1S1Q B;  2O6V D;  4A3O A;  2LXA A;  3RZW C;  4NQK E;  1M94 A;  2BKF A;  2HTH A;  2N1W A;  5CHW A;  2N9P C;  3EC8 A;  3U7D A;  4BBN C;  4ZRJ A;  3L08 A;  4YL8 A;  3NZS A;  4NJ7 A;  2EMT A;  3QA8 A;  2K8C A;  3L13 A;  1EF1 A;  1OTR B;  3A9K B;  3PZD A;  4FN2 A;  2MP2 B;  2KTF A;  4HDO A;  4MEM A;  2GBN A;  4ZDV A;  2DAF A;  3M95 A;  1V5O A;  1L2N A;  5D7G A;  4ASW C;  4FBJ B;  4DHZ B;  4TV3 A;  2C5L C;  1GNU A;  2M4N A;  3QAR A;  4I6N B;  2ZCB A;  4EOY A;  5J2R A;  3IHP C;  3M63 B;  3V6C B;  4B95 A;  3QIJ A;  3UF8 A;  3QWZ B;  2LGY A;  3AI5 A;  3CF6 E;  5KHO A;  4E71 A;  2K39 A;  4PS7 A;  3PLU A;  2BGF A;  3DVG X;  2MCN B;  2KXJ A;  3I3T B;  1WGG A;  3QCA A;  2WX1 A;  1D3Z A;  1SE9 A;  1LM8 B;  2L3Z A;  2L0F A;  2N1V A;  3NZU A;  4NAW A;  3L0W B;  1V2Y A;  2KC2 A;  4XZ4 A;  4BBN F;  1RRB A;  4DBG A;  1OEY J;  2LRW A;  1OGW A;  3AXC A;  4FJY A;  1ISN A;  5CTR C;  4JGH B;  2I1K A;  2M0X A;  1GUA B;  1YD8 U;  2N9E B;  4W9H A;  4NJ6 A;  2CKH B;  1AAR A;  4TKN A;  1WY8 A;  3ZVV A;  1RLF A;  3UIN B;  2D3G A;  3KUD B;  4PS3 A;  1E8Y A;  1UZX B;  4MDK E;  4OVU A;  3NOB A;  2KK8 A;  2WWZ A;  4WJP A;  3ONS A;  4FAD A;  1YX5 B;  2KTR A;  1S3S G;  1H4R A;  4G3X B;  1WGH A;  1LQB A;  1Q5W B;  4MGY E;  2C9W B;  4W9E A;  4LCD E;  3RUI B;  1WE6 A;  1KLV A;  3EFU A;  4II3 B;  2FCN A;  1WIA A;  3EEC A;  3TMP B;  3OJ4 B;  4AOF A;  4AWJ A;  1E7V A;  4LDT D;  4HVB A;  4G50 A;  2KWU B;  4MGK E;  1ZGU B;  2BKR B;  2KDF B;  2QHO A;  2XBB C;  1YQB A;  2Z59 B;  4WWP A;  2N9X A;  3JVZ X;  3VTV A;  1J8C A;  4PYU A;  2JZ3 B;  2KX3 A;  3T8M A;  4F7Z A;  1XD3 B;  1KM7 A;  3ENE A;  3H6N A;  4KIK A;  5D6J B;  3WA0 A;  3AU4 A;  2R2O A;  4DDI D;  3H7P B;  3DPD A;  4GB9 A;  4FHK A;  3SHQ A;  1P98 A;  4W9L A;  1T0Y A;  3M62 B;  4EZK A;  1RAX A;  1WF9 A;  3HHM A;  2AL6 A;  2J0J A;  5BO4 B;  2DEN B;  5JZE B;  1WH3 A;  2HJ8 A;  2LUE A;  1UEL A;  4KVG B;  2G4D B;  4LJP B;  3QX1 A;  2L0T A;  1J19 A;  2AEH A;  5DCN A;  4DHZ E;  4E3C A;  4BFR A;  3H1U A;  3RCZ A;  3WAL A;  2KC1 A;  2JRI B;  2JT4 B;  1V5T A;  4JL9 A;  2KQ7 A;  3RUL A;  3CSF A;  2B3A A;  2WX0 A;  2IO1 B;  3APC A;  4CHK A;  1Z2M A;  3DVN U;  2RSU A;  1TZ1 A;  1WJU A;  1R4N I;  3MJW A;  1V86 A;  1WGD A;  3ZDT A;  3VXW A;  3PGE A;  3DCG A;  5GMV A;  3ZRC A;  3PT2 B;  1SGH A;  5TR5 A;  3A9K A;  2D10 A;  2DX5 B;  3LJ3 A;  4RMA A;  1G6J A;  1E8W A;  2V1Y A;  1OEY A;  1WX7 A;  2C7M B;  4IWQ A;  2DZM A;  3DBL I;  4WJN A;  3ZRF A;  3N30 A;  3R7Q A;  1NBF C;  1P3Q U;  2LAS A;  3PS6 A;  1QZE A;  5DPS A;  2IY1 B;  4BKS D;  3L54 A;  4ANX A;  3KW5 B;  2PJH A;  2JXX A;  1WJ4 A;  2LVO A;  2EKE C;  2HE7 A;  2JRH A;  2C60 A;  2NR2 A;  3H7P A;  2V4L A;  4AP4 C;  3ALB A;  3L17 A;  4WJO A;  1WJ6 A;  3IFW B;  3SDL C;  4DXA B;  2LWP A;  2ASQ A;  2C7N B;  2DZI A;  2O2V A;  3DQV A;  2LGX A;  1WRD B;  4MH0 E;  4G0N B;  4CO7 A;  4WAA A;  4GU2 A;  4HDQ A;  2MBO A;  3CMM B;  3N32 A;  4IWO A;  2KDI A;  3KYD D;  3A4S C;  2K1F A;  2K6Q A;  3V61 A;  2FIF A;  4GXB A;  2LZ6 A;  1I35 A;  3TL5 A;  2ZNV C;  2K8B A;  2EMS A;  4ANU A;  3PTF C;  2XEW A;  1EUV B;  3AUL A;  4W9J A;  1EO6 A;  3KUZ A;  3PSE B;  1TBE A;  2IY0 B;  3VUY A;  4NY0 A;  1MG8 A;  1TGZ B;  2KTR B;  4ICV A;  1GC7 A;  2GBJ A;  3W1Y A;  3R3M A;  4I6P A;  2MA9 B;  4EEW A;  1L7Y A;  1IYF A;  1Q0W B;  2KWV B;  1C3T A;  4K7U A;  4J6I A;  4TQ0 A;  3RYT A;  4WJQ A;  5IAA C;  3Q3J A;  3VVW B;  1VCB A;  3DOW A;  1R4M I;  2FNJ B;  4HXD A;  1UH6 A;  2CU1 A;  3UQA A;  2ZCC A;  4MSM B;  1GJZ A;  1P1A A;  3PV1 A;  3R7R A;  4IC7 B;  1WMH B;  2DYM A;  2KMC A;  5G55 A;  3S2A A;  3OJ3 A;  3P2B A;  2RD0 A;  3QK0 A;  3UIO B;  3ZNZ B;  4ANV A;  3V62 A;  2XK5 A;  2M17 A;  2FID A;  3C0R B;  2OJR A;  3VTW A;  2KHW B;  1LFD A;  1UBI A;  4IWP A;  4TQ1 A;  4G11 A;  2GBM A;  1E8X A;  5J17 A;  3CST A;  1E8Z A;  2IO0 B;  2MWS B;  2MSE D;  5FR6 A;  3UQB A;  3WAM A;  2CHX A;  2LVQ A;  3HM3 A;  2KNB A;  3DVN V;  4IM3 A;  2FAZ A;  5IA7 A;  1WGR A;  2LXC A;  2Z0E B;  3QHT A;  3IBE A;  4KV2 A;  3DDC B;  2HD5 B;  4K7S A;  1RFA A;  2RPQ A;  3V6E B;  2BYE A;  4F8C B;  3PHW B;  3A9J A;  2GMI C;  2ZVO A;  1P0R A;  2IZV B;  1CMX B;  2I1J A;  3PRZ A;  4IG7 B;  1WMH A;  2N7E A;  1E5W A;  2J0K A;  5KHQ A;  5LXH A;  3H9D A;  3DBR I;  3DVG Y;  2CHW A;  2G3Q B;  2ZJD A;  5E6O A;  1WYW B;  3W1S A;  3VH3 B;  4KSL C;  2PE9 A;  1E90 A;  2MP2 A;  3X0W A;  1E7U A;  3K9O B;  4HK2 A;  2KZR A;  3WAN A;  1J0G A;  4EZL A;  5JH5 C;  2LJ5 A;  2KVR A;  2NCN A;  3L16 A;  2BWF A;  4E74 A;  2BPS A;  3X23 A;  2NS5 A;  3A1Q B;  3O65 B;  4W9C A;  3DBH I;  5DPR A;  5JHA A;  4GDK B;  3QAQ A;  3PRE A;  1WM2 A;  2GOW A;  2JZZ A;  1JRU A;  3PRM B;  2J7Q B;  4WWN A;  4BKG A;  4X57 B;  1PQS A;  4HCN B;  4MJS A;  2BYV E;  4KZ0 A;  2KWC A;  2VRR B;  2KFK B;  1YJ1 A;  5C1Z A;  4GDL B;  1X1M A;  2LRU A;  3ECI A;  3APD A;  5J18 A;  2CS4 A;  1H8C A;  5CX3 A;  4CYE A;  2FUH B;  1FXT B;  3A33 B;  2O2V B;  2NPT A;  3WIM A;  3ZTC A;  1WXA A;  2KOX A;  2N4F A;  2KFK A;  4GIV A;  4IM2 A;  3HIZ A;  5D94 A;  3WAO A;  4EZJ A;  1WXV A;  4MJS B;  4WQO B;  5AZF A;  4A3P A;  3ZDM C;  2O6V B;  1I42 A;  1VD2 A;  5CHV C;  1WXS A;  3K9P B;  3ML8 A;  3NS8 A;  1KJT A;  3A1Q A;  2LI5 A;  2L76 A;  1Y8R C;  1EF5 A;  3ZTD A;  4NQL B;  2MBB B;  4IM0 A;  4DHJ B;  1WM3 A;  4PYZ A;  2RGF A;  3JSV B;  2G4S A;  4ICU A;  1Z5S B;  3SU8 X;  3ZKJ C;  1A5R A;  3PPA A;  2OOB B;  3D32 A;  4AUQ C;  4GMV A;  2KFJ A;  1P9D U;  1WXM A;  3ZNI D;  2K25 A;  2PE6 B;  2L8J A;  2WDT B;  1ZW7 A;  2DZJ A;  1NI2 A;  2REX A;  2IBI B;  5EDS A;  3A4R A;  3HK0 A;  3L10 B;  4KSK C;  4BVU C;  5AZG A;  2PPH A;  4PS8 A;  3GOE A;  2BYF A;  3BY4 B;  3M3J A;  3JSV A;  1WZ0 A;  3RT3 B;  3U30 A;  1F9J A;  1V49 A;  3IG3 A;  2L00 B;  4JLC A;  4IW0 A;  5JHB A;  2DZK A;  2FCM A;  2IO3 B;  2KX0 A;  1V6E A;  2FCS A;  4EUT A;  1LXD A;  5LLI A;  2D11 A;  4MEL A;  3TBL D;  4M0W B;  5AZH A;  2UWQ A;  1IP9 A;  3UIP B;  4ZRK A;  1XQQ A;  2ZEQ A;  4MGZ E;  3ZUN A;  4EFO A;  3H7S A;  2MBQ A;  3RD2 A;  2DHZ A;  4HLE A;  3IVF A;  3MHS D;  3VQI A;  4I6L B;  4KZC A;  1KOT A;  3ZNH B;  4HJK A;  2KLG A;  4W9I A;  3GZN I;  4A20 A;  3R66 C;  3KVF B;  2R2Q A;  4JIO U;  4KIK B;  3TCA A;  1WJN A;  4P7I A;  2DAJ A;  4B9K A;  4DDG D;  2Y5B B;  3ML9 A;  1U4A A;  5E6P A;  2CR5 A;  3NHE B;  1WX8 A;  2KN5 A;  3TJP A;  4DWF A;  2DYB A;  4FJZ A;  3ZLZ A;  1GC6 A;  2GBK A;  2NVU I;  2ZNV B;  3KYC D;  3AU5 A;  4GOC A;  2G45 B;  4NNJ B;  3V60 A;  4M8M A;  4IUM B;  3KUC B;  4RM9 A;  3T9L A;  4K81 A;  3WAP A;  1GG3 A;  2MW5 A;  2BF8 B;  4II2 B;  2IYD B;  4ZRI A;  4HCP B;  3PVL A;  2W9N A;  4LDT B;  3ZO5 B;  1NDD A;  2KO3 A;  4GDK A;  5C23 A;  1WGY A;  2JY6 A;  4DHJ D; 
#chains in the Genus database with same CATH topology
 3IAS 1;  4C80 A;  1A70 A;  1OQQ A;  2JWZ A;  1YQ3 B;  3ZW3 A;  2RPV A;  3HM6 X;  3AMZ A;  2WDR B;  3LXF A;  1PGX A;  3B08 A;  1FRD A;  3A9J B;  4DK5 A;  2KQS A;  2LHD A;  4B6W A;  1YN5 A;  2K6D B;  1I7H A;  4N9F 4;  3TIX A;  2WYQ A;  2HDE A;  2MRP A;  5AEK B;  3APF A;  2KLC A;  2XK5 B;  1V9J A;  4URK A;  2SEB D;  2ZPN A;  3KH0 A;  1OQY A;  2BT6 A;  2VH2 A;  1JWS D;  2W54 A;  4GSW A;  3TEZ A;  4EE2 A;  5LXI B;  4ZHO A;  3VTU A;  2JUO A;  3W1S C;  1ZUD 2;  1XT9 B;  4W9K A;  4K1R B;  3VDZ A;  4KDL B;  2IGG A;  2IO2 B;  2ZPY A;  2BS3 B;  2DLB A;  1MG4 A;  2PEA A;  3U2S C;  3NVZ A;  3ZIM A;  1JWB D;  1ZOY B;  2L7R A;  5BYQ A;  4EKU A;  2KDE B;  3Q3F A;  2KKC A;  4GDL A;  5L83 A;  4WWO A;  5IOI A;  4RM8 A;  4P16 A;  5HHD G;  2BWE S;  2ZZP B;  4W9D A;  1S1Q B;  4A3O A;  5I4D A;  3KQ4 A;  2HTH A;  4BBN C;  2N9P C;  3EC8 A;  4IKG A;  2RDH A;  4LNN A;  2EMT A;  3QA8 A;  3L13 A;  1LO5 D;  1EF1 A;  1OTR B;  3A9K B;  4FN2 A;  4MEM A;  2MP2 B;  4FBJ B;  2PVO D;  4DHZ B;  1HA5 A;  1HEZ E;  1OFF A;  2E3T A;  3CF6 E;  1KLG D;  4E71 A;  2GB1 A;  2BGF A;  3DVG X;  3IT4 B;  1D3Z A;  5EE3 A;  1SE9 A;  4NAW A;  1GOZ A;  4K3C A;  4BBN F;  1RRB A;  3AXC A;  1OGW A;  4FJY A;  4M01 A;  5CTR C;  4JGH B;  2I1K A;  1YD8 U;  3RNC C;  2H88 B;  1AAR A;  1WY8 A;  1RLF A;  3UIN B;  1FM0 D;  2D3G A;  2ONQ A;  2BB6 A;  1E8Y A;  5EE9 A;  1ZE3 D;  1JWM D;  2BBC A;  5G5G A;  1CZP A;  2PIA A;  1Q5W B;  2C9W B;  4W9E A;  3RUI B;  1STE A;  1KLV A;  4II3 B;  4AWJ A;  2ICI A;  3OJ4 B;  4WWP A;  4PT5 A;  1ZGU B;  1XLP A;  1R4N B;  4L23 A;  4PYU A;  3ZJV A;  1TYG B;  1AN8 A;  3H6N A;  1KM7 A;  4L1B A;  3WA0 A;  2TSS A;  2EEL A;  1E6E B;  1E10 A;  3SHQ A;  4MH8 A;  2IND C;  2JYE A;  3HHM A;  2J0J A;  5BO4 B;  2LUE A;  2QC8 A;  3AEB B;  2J42 A;  5IN7 A;  2DWQ A;  2QIE B;  3ETR A;  2JT4 B;  1V5T A;  2M19 A;  2WX0 A;  3NRZ A;  4DQO C;  3ZXV A;  2RSU A;  3AB5 A;  4BAX A;  3ZDT A;  2V3N A;  3PGE A;  5HI1 A;  4MM3 B;  1YNT E;  3W2D A;  1YJI A;  2MHJ A;  4MT5 A;  4IWQ A;  1OEY A;  2DZM A;  3DBL I;  2X38 A;  2GI9 A;  2RDG A;  5T8I A;  4BKS D;  2ZW0 A;  2GLS A;  2NR2 A;  2V4L A;  4LLG M;  3L17 A;  3SDL C;  2WXO A;  3SFE B;  2C7N B;  3MHZ A;  4MH0 E;  3AE7 B;  1I4Q A;  3Q14 C;  1YQ4 B;  3Q8B A;  1D5M C;  1F2R C;  2MBO A;  1FMA D;  3CMM B;  3NVV A;  2D3B A;  3A4S C;  2FIF A;  3T3N A;  4GXB A;  3NVY A;  3TL5 A;  3PTF C;  1HTO A;  4W9J A;  1EUV B;  2WXR A;  1FD6 A;  3PSE B;  3TEY A;  1MG8 A;  1TGZ B;  2MH7 A;  3BK2 A;  4B0E A;  1T3Q A;  3R3M A;  4EEW A;  1L7Y A;  1EWC A;  4WJQ A;  1L6V A;  1VCB A;  2CU1 A;  3AEG B;  4S17 A;  1WMH B;  2DYM A;  2WXK A;  3QK0 A;  3ZNZ B;  2FID A;  3C0R B;  1E9M A;  3AE2 B;  1LFD A;  2GBM A;  5J17 A;  2IO0 B;  2MWS B;  2INN E;  3HM3 A;  4OW0 A;  1K52 A;  1KF6 B;  3N1X C;  4JPS A;  5BYR A;  3GZN B;  4L2Y A;  2RPQ A;  3KWL A;  3L4P A;  1TS4 A;  4IG7 B;  1UWX A;  2N7E A;  3NS1 A;  2MJE A;  2J0K A;  1RM6 C;  2ZJD A;  3W1S A;  3VH3 B;  1F77 A;  3X0W A;  3WAN A;  1EM7 A;  2WXF A;  2BPS A;  3X23 A;  3O65 B;  4GDK B;  5IP4 D;  3PRE A;  1WM2 A;  3AV8 A;  4BKG A;  4X57 B;  1Q10 A;  2KFK B;  5C1Z A;  2DNF A;  1ZDV A;  4KGS A;  1H8C A;  3APD A;  3V3X A;  3TEX A;  4CYE A;  2FUH B;  2O2V B;  4GIV A;  3HIZ A;  3WAO A;  4EZJ A;  2INC C;  4WQO B;  4PK1 A;  4US8 A;  1I42 A;  3FIL A;  3NS8 A;  1EF5 A;  4YTP B;  2MBB B;  3BVG A;  3AED B;  4IM0 A;  4DXF A;  3AE8 B;  2RGF A;  3ZKJ C;  1N61 A;  5AUI A;  1D4B A;  2PKO A;  3PPA A;  3D32 A;  3CWI A;  3HRD D;  2NTT A;  4DXG A;  1P9D U;  3ZNI D;  1NVI D;  2PE6 B;  1FIQ A;  2L8J A;  3MFG A;  2KN4 A;  2OJW A;  2BYT A;  1XLO A;  1R4M B;  4PS8 A;  3M3J A;  1WZ0 A;  3U30 A;  1V49 A;  4IW0 A;  2IO3 B;  5FK9 C;  3R2T A;  1P7F A;  2D11 A;  4MEL A;  3TBL D;  4RH6 A;  1NYQ A;  5AZH A;  2UWQ A;  4ZHP A;  5BYS A;  1C4C A;  2YEP F;  1ZP0 B;  2DHZ A;  1SB3 C;  4KGR A;  3MHS D;  2SAK A;  2UU7 A;  4WQM A;  2R2Q A;  3TCA A;  2ZW1 A;  4B9K A;  4DDG D;  5D3I B;  5E6P A;  2CR5 A;  1FNV A;  1WXQ A;  2KN5 A;  2DYB A;  3ZLZ A;  2ZNV B;  3AU5 A;  4IUM B;  3KUC B;  2X8X X;  2MW5 A;  1TY0 A;  2IYD B;  4HCP B;  4GDK A;  1WGY A;  2N9L A;  4RFB A;  1WSP A;  3VUX A;  5E6J A;  1T0S C;  3BVM A;  2ZVN A;  3ZNG C;  2M1M A;  2JVC A;  2LVP A;  1M4V A;  4NPN A;  2WXM A;  1WFY A;  4ANW A;  4GGQ A;  4F1S A;  4ZOH C;  4YSY B;  3BZD B;  4LNF A;  5HFY A;  5DPW A;  1SE4 A;  2IDY A;  3QJZ A;  1V1O A;  2MQJ A;  4FHJ A;  4MGI E;  2NBU A;  2MBE A;  4OVV A;  3VAW A;  2A5U A;  2JF5 A;  1BT0 A;  1V80 A;  4TMA B;  3RNE C;  3IAM 1;  4W9F A;  3SD5 A;  2QDF A;  3MC9 A;  1YX6 B;  2G9H D;  4GN1 A;  4AJY B;  4FA6 A;  3N3K B;  1DOX A;  5HKH A;  1IPG A;  3O13 A;  5CHF A;  3ZQ4 A;  2MBH A;  1LGR A;  1K8R B;  2NMQ A;  2JPH A;  2NBW B;  4TUU A;  3VUW A;  2HJ1 A;  2LFI A;  2D07 B;  3MTN B;  1WI0 A;  4MSQ B;  1YIW A;  4KDI C;  3Q8C A;  2O6V A;  3DBS A;  4HPL B;  3PHX B;  4FLH A;  4N58 A;  2DYO A;  3U8Z A;  1GB4 A;  3QC8 B;  4XX5 A;  2CJO A;  2FCQ A;  3I63 C;  1VDV A;  2JX5 A;  3N1Y C;  4XE0 A;  4BKS A;  3Q3M C;  4WH4 A;  4FUL A;  1Q1O A;  1ZPS A;  1WZ3 A;  3B0A A;  3VH4 B;  4C56 C;  2LXA A;  3RZW C;  4NQK E;  2BKF A;  1OQR A;  1SF0 A;  1D5X C;  2V4I B;  5EE1 A;  4YL8 A;  2WDV B;  4OVZ A;  3DHI C;  2DAF A;  1V5O A;  2BQQ A;  1YJJ A;  4TV3 A;  3R8B A;  1QIL A;  2N7J A;  2ZCB A;  4HRO A;  5J2R A;  1N60 A;  3QWZ B;  1KLU D;  3RI7 C;  1F2R I;  3PLU A;  2KXJ A;  3I3T B;  1SJH D;  1DOY A;  4ZYS A;  1WGG A;  4XGA B;  2CU3 A;  2BTE A;  2Y5P A;  2N1V A;  2KC2 A;  4XZ4 A;  4DBG A;  1YOV B;  2LRW A;  4KKI A;  2M0X A;  2J53 A;  2K22 A;  4NJ6 A;  2CKH B;  3ZVV A;  1QT9 A;  1UZX B;  4OVU A;  1BUI C;  3ZGZ A;  3R2I A;  4XWW A;  3NOB A;  4IDI A;  1SIJ A;  2KK8 A;  3ONS A;  1YX5 B;  2KTR A;  3BVZ A;  1IUE A;  1H4R A;  1LQB A;  4LCD E;  1GB1 A;  2FCN A;  1WIA A;  3EEC A;  3TMP B;  2KAC A;  2KWU B;  2OED A;  2KDF B;  4MGK E;  2QHO A;  2XBB C;  4YWG G;  1HZ5 A;  1IGD A;  2JZ3 B;  2KX3 A;  3T8M A;  3FC4 A;  1I4H A;  2AQ2 B;  3AE6 B;  2BB5 A;  3AU4 A;  4GB9 A;  1T0Y A;  4EZK A;  5FKA C;  2G1E A;  4KVG B;  1VRA B;  4LJP B;  2AEH A;  3Q69 A;  4DHZ E;  4BFR A;  4A9A A;  2J52 A;  2KC1 A;  1XLQ A;  2JRI B;  4ARC A;  2KQ7 A;  3RUL A;  2EKI A;  3APC A;  4CHK A;  3UI3 A;  5G5H A;  1I4G A;  1WJU A;  3MJW A;  3LB8 C;  1MHH E;  3N9Y C;  3PT2 B;  1SGH A;  3A9K A;  2D10 A;  3LJ3 A;  4RMA A;  1E8W A;  3URY A;  3PZ7 A;  2LEK A;  2C7M B;  2W55 A;  3AEF B;  3R7Q A;  1NBF C;  3PS6 A;  4KX6 B;  2D3A A;  2YEP B;  3B9J A;  2IY1 B;  2LVO A;  2JRH A;  3ALB A;  1WJ6 A;  2KMM A;  2QEJ C;  2O2V A;  4WAA A;  3RMK C;  2W82 A;  2KDI A;  5FR3 A;  2K1F A;  3V61 A;  1N63 A;  4ZRQ A;  3Q6B A;  4OZA A;  3DBR B;  2K8B A;  3MC0 B;  3KWV A;  2XEW A;  3AUL A;  1EO6 A;  1TBE A;  3VUY A;  3N1Z C;  5BMI A;  2KTR B;  4RNA A;  1IYF A;  3P63 A;  4K7U A;  2RMM A;  3RYT A;  1WYG A;  1XXG A;  3DOW A;  2FNJ B;  4HJG E;  4HXD A;  3UQA A;  2ZCC A;  1GJZ A;  1D6E C;  3RNG C;  2KMC A;  3S2A A;  3OJ3 A;  3P2B A;  3UIO B;  4ANV A;  3Q8E A;  2XK5 A;  2PMV A;  2Y5C A;  4TQ1 A;  1KRH A;  1SBB B;  5FR6 A;  3UQB A;  1EU4 A;  4IM3 A;  5IA7 A;  2LXC A;  2Z0E B;  4OZB A;  1T0Q C;  5LNK 1;  2N9K A;  3A9J A;  4JWS C;  2IZV B;  1CMX B;  2LGI A;  4P1B C;  3P1M A;  1WMH A;  3DVG Y;  1K53 A;  5E6O A;  1WYW B;  1E90 A;  3K9O B;  2KZR A;  2E6X A;  1J0G A;  1YMH E;  3B2G A;  2LJ5 A;  2FUG 1;  2BWF A;  5JHA A;  2NS5 A;  4W9C A;  3NG0 A;  2GOW A;  3PRM B;  4REZ A;  4WWN A;  3ZJU A;  1PQS A;  4LNO A;  2IGD A;  1F52 A;  2VRR B;  1Y56 A;  4ITK A;  1J7B A;  1FEH A;  3ECI A;  5J18 A;  2CS4 A;  1FXT B;  1HQR D;  3WIM A;  4Q2J A;  5AZF A;  3ZDM C;  4AQ7 A;  2O6V B;  1WGK A;  3P4Q B;  2FBW B;  2OHF A;  1WXS A;  4M0W A;  1NI3 A;  1FCL A;  1T6B X;  4DHJ B;  4PYZ A;  3DBH B;  1A5R A;  3SU8 X;  5HG2 A;  4GMV A;  1JWU D;  2KFJ A;  1WXM A;  2Z8L A;  3TEW A;  3B2F A;  4OZC A;  2WXG A;  1ZW7 A;  3A4R A;  4KSK C;  4BVU C;  5AZG A;  2PPH A;  3GOE A;  2BYF A;  1VLB A;  2L00 B;  2LHE A;  1TIF A;  3AEE B;  3OWE B;  4HKZ E;  3UIP B;  1XQQ A;  2ZEQ A;  4JWU C;  4MGZ E;  3J9C A;  1KFY B;  2MBQ A;  3U7Z A;  1WRI A;  2WXL A;  3KVF B;  1WJN A;  3ML9 A;  1I4P A;  1WX8 A;  1XLN A;  1GC6 A;  2WXI A;  4GOC A;  2G45 B;  4YSX B;  2AQ3 B;  4RM9 A;  2QJL A;  2LMC A;  4K81 A;  2WXH A;  1MVK A;  1GG3 A;  3BK1 A;  2BF8 B;  3WAP A;  3AE1 B;  4II2 B;  4ZRI A;  4LDT B;  1YN3 A;  3ZO5 B;  1TY2 A;  3RNF C;  3DBL B;  5C23 A;  2JY6 A;  1UWM A;  2KAN A;  4BKT A;  2LJI A;  1CQV A;  3OG5 A;  4JQW C;  2A4Z A;  3W9C B;  3OAW A;  2WNM A;  1HXY D;  1V97 A;  3WCQ A;  4LJO B;  1TTN A;  2J4X A;  2D2Q A;  3EHV A;  2N7D A;  1UNS A;  2MX2 A;  2CHZ A;  2L1A A;  2K5P A;  4W9G A;  4NAW B;  2KJR A;  1FCC C;  4HPM B;  4BOS C;  3NY5 A;  2MLB A;  1L4Z B;  3BIN A;  2BW2 A;  3PLV A;  1MHX A;  1FFU A;  2UYZ B;  4C7Z A;  2KDB A;  1AWD A;  2D3C A;  3P4S B;  3W5U B;  1HE8 A;  3RPF C;  5L95 C;  4BOZ B;  5E6N A;  2WXP A;  2C7H A;  3MP9 A;  3VRB B;  1WX9 A;  1RWS A;  1ZKH A;  2KMA A;  2AWT A;  2KD0 A;  4ZYN A;  4AS1 A;  1FFV A;  1WR6 E;  2YVC A;  1SE3 A;  1V8C A;  2HTM E;  3VHT C;  2AYO B;  2N0S B;  5GXG B;  1UUP A;  3NVW A;  3PRP B;  2QCZ A;  2RR9 A;  2K8H A;  4KKJ A;  2KJH B;  3I5J C;  2AL3 A;  1K50 A;  1C78 A;  1RYJ A;  1SSN A;  2NBV B;  2YLM A;  2L05 A;  4P6V F;  5CHW A;  1TS3 A;  4ZRJ A;  2K8C A;  1QQR A;  3AM9 A;  2W3R A;  2KTF A;  2WXJ A;  4ZDV A;  1FPY A;  3M95 A;  1L2N A;  1XF5 L;  5D7G A;  1JRP A;  4ASW C;  1GNU A;  2AX5 A;  2M4N A;  3QAR A;  3IHP C;  3M63 B;  3QIJ A;  1TZO A;  1TJE A;  2K39 A;  1N6Z A;  3QCA A;  2WX1 A;  1JQ4 A;  1UGJ A;  4RF0 A;  1LM8 B;  2L3Z A;  2L0F A;  1XCQ L;  3NZU A;  5IKC M;  2QMT A;  1OEY J;  4RGM A;  1RFK A;  3ABV B;  1GUA B;  4W9H A;  1F0Z A;  4PS3 A;  1T0R C;  4MDK E;  2WWZ A;  4WJP A;  4FAD A;  4M02 A;  1S3S G;  1N62 A;  1WGH A;  2M0A A;  1C79 A;  3EFU A;  4AOF A;  4HVB A;  4G50 A;  2WU2 B;  1EWY C;  1J8C A;  2Z59 B;  2M56 B;  3JVZ X;  4NJC A;  4F7Z A;  4D2K A;  2WLB A;  1XD3 B;  3ENE A;  1VJK A;  3AE4 B;  4IOI E;  4XDC A;  4DDI D;  1PFD A;  1F1H A;  3DPD A;  4FHK A;  2WU5 B;  1P98 A;  4W9L A;  3M62 B;  1RAX A;  2DEN B;  4YXD B;  5JZE B;  1WH3 A;  1ET6 A;  2HJ8 A;  1L0V B;  2G4D B;  3QX1 A;  2L0T A;  1J19 A;  4GLS C;  1YN4 A;  2LUM A;  1JCK B;  3CSF A;  5BMG A;  2WDQ B;  4A90 A;  1JRO A;  1TZ1 A;  2PVG C;  1WGD A;  3DCG A;  5GMV A;  1V1P A;  1ENF A;  3FKY A;  3Q3O C;  2VZK D;  5TR5 A;  3PO0 A;  1FRR A;  2V1Y A;  4WJN A;  2DBY A;  4UDU C;  3ZRF A;  3N30 A;  1P3Q U;  2LAS A;  1C77 A;  3V05 A;  5DPS A;  4BZA A;  3AH7 A;  4ANX A;  2PJH A;  2JXX A;  1WJ4 A;  2ACZ B;  1TKG A;  4AP4 C;  3IFW B;  2JZP A;  4DXA B;  2LWP A;  2LGX A;  4G0N B;  4GU2 A;  3TUO A;  4RGT A;  1TKE A;  4IWO A;  4LNK A;  1VZ6 A;  1AW7 A;  1ROE A;  4RGO S;  2ZNV C;  4HKQ A;  5JXV A;  1PYW D;  2IY0 B;  4NY0 A;  4H2A A;  4LTU A;  1QOA A;  4ICV A;  1GC7 A;  2GBJ A;  4B0M A;  1C3T A;  2KWV B;  4J6I A;  4TQ0 A;  1KH0 A;  5IAA C;  2XNA C;  2PTL A;  1P1A A;  2JU6 X;  2Y3A A;  2VZK B;  1C4P A;  2LGS A;  3VTW A;  2OJR A;  2IJ0 A;  4G11 A;  3U4E G;  3CST A;  2MSE D;  4FXC A;  2CHX A;  2R61 A;  2KNB A;  3DVN V;  1CJE A;  1DGJ A;  2FAZ A;  1WGR A;  3QHT A;  4KV2 A;  3DDC B;  5EE0 A;  2HD5 B;  2AQ1 B;  1RFA A;  1J7C A;  2BYE A;  3PHW B;  1XO3 A;  2I1J A;  3PRZ A;  1VZ7 A;  3VR9 B;  3H9D A;  2G3Q B;  1P7E A;  2V3P A;  2KT7 A;  2IPK D;  4KSL C;  2PE9 A;  3EA6 A;  3MJ5 A;  2MP2 A;  1E7U A;  1FNW A;  5JH5 C;  4A6Q A;  3L16 A;  2JXT A;  1TS5 A;  3NJT A;  5DPR A;  2K9X A;  3QAQ A;  3FIL B;  2JZZ A;  1JRU A;  1E0Z A;  3Q3N C;  4HCN B;  4KZ0 A;  2KWC A;  1YJ1 A;  3N20 C;  1DOI A;  2KDM A;  4GDL B;  1X1M A;  2LRU A;  5CX3 A;  4LK0 M;  3A33 B;  3ZTC A;  2V0G A;  1WXA A;  2KOX A;  1E7P B;  2KFK A;  4RCO A;  5D94 A;  4QAY A;  1WXV A;  3T3O A;  4A3P A;  1C4A A;  2FE8 A;  1GPX A;  2WXQ A;  5CHV C;  3K9P B;  3ML8 A;  2INP E;  2LI5 A;  2L76 A;  1L0X B;  4CQN A;  5AUK A;  3JSV B;  2G4S A;  1XCT L;  1Z5S B;  2L32 A;  3E9S A;  4AUQ C;  2V9H A;  2WDT B;  1DYQ A;  2IBI B;  5EDS A;  2KYW A;  3HK0 A;  3AE5 B;  3L10 B;  4KGT A;  2KWD A;  2WGS A;  1KTK A;  3JSV A;  3AEC B;  1I4R A;  2D5G A;  2JSV X;  2KX0 A;  3GS2 A;  2XN9 C;  1V6E A;  1HTQ A;  1IP9 A;  3H8H A;  4ZRK A;  3ZUN A;  4EFO A;  1QKZ A;  3VQI A;  1KOT A;  3C8Y A;  4HPP A;  1QLB B;  4W9I A;  4C4V B;  3R66 C;  4KIK B;  2I38 A;  3PZ8 A;  2DAJ A;  2Y5B B;  1U4A A;  1UF0 A;  3NHE B;  1BML C;  4DWF A;  4FJZ A;  2NVU I;  2GBK A;  3KYC D;  3V60 A;  4XDD A;  2WQY B;  1SXT A;  3PVL A;  2W9N A;  3Q2A C;  2KO3 A;  1MFW A;  2K3U A;  4P7I A;  4F8C B;  2BS4 B;  3FAH A;  5D2M B;  1TKY A;  1SIF A;  2QSD A;  2LD9 A;  2GBR A;  3BII D;  4K7W A;  1B9R A;  1V81 A;  3QQ8 B;  4N6E B;  1UD7 A;  3NUH B;  3ZJT A;  1T5X D;  2LGD A;  3IT6 B;  4YTM B;  5G2N A;  4NZL B;  3UGB B;  5DPT A;  4MM3 A;  2B76 B;  3VFK A;  1PGA A;  2V3S A;  4M8N A;  1C1Y B;  1WE7 A;  3P4P B;  1WR1 A;  4XYC A;  1XEE A;  3EUB 2;  1JAL A;  3MC8 A;  3B1L X;  3JW0 X;  2ON8 A;  1QOF A;  3RNB C;  3OLM D;  2MJD A;  3AEA B;  4XC2 A;  2M8S A;  3BWU D;  2J0M A;  1TT5 B;  1FO4 A;  1ZXH A;  3GE8 C;  2KJ6 A;  1QF6 A;  1FNU A;  1D5Z C;  4ACF A;  1IGC A;  1UBQ A;  2NPT B;  4K3B A;  1QOG A;  2BVC A;  2Z0D B;  3HVD A;  3LDZ E;  3JYU A;  1I4X A;  4FJV B;  4AJW A;  1VZ8 A;  4HWI B;  4WWM A;  3RZF A;  4YT0 B;  3EGR A;  4WUR A;  1B1Z A;  1TS2 A;  1UGM A;  4JX1 C;  2O6V D;  3U7D A;  1M94 A;  2N1W A;  4TSS A;  1HZ6 A;  1L0Y B;  3L08 A;  3NZS A;  4NJ7 A;  3PZD A;  4HDO A;  2GBN A;  2GRI A;  4WAF A;  2C5L C;  4I6N B;  3RN9 C;  4EOY A;  4B95 A;  3V6C B;  3UF8 A;  2LGY A;  3AI5 A;  3W5V B;  5KHO A;  4PS7 A;  4OHJ A;  2MCN B;  1J7A A;  5H8Y E;  3AN1 A;  1SJE D;  3L0W B;  1V2Y A;  1ISN A;  1IBX B;  3GB1 A;  1CK1 A;  2N9E B;  4TKN A;  2WXN A;  3KUD B;  3P4R B;  3ZYY X;  4HEA 1;  2CJN A;  4G3X B;  1L4D B;  4A8X C;  4MGY E;  2K0P A;  2L52 A;  1WE6 A;  1EU3 A;  2IGH A;  1E7V A;  3DWM A;  4LDT D;  4NAM A;  2BKR B;  3VTV A;  1YQB A;  2N9X A;  2W3S A;  4KIK A;  1NEK B;  3C19 A;  5D6J B;  3VRA B;  2R2O A;  4MAC A;  4C4V A;  3H7P B;  2PLP A;  5TSS A;  5C2T B;  1WF9 A;  2AL6 A;  2KVZ A;  3DHH C;  1MI0 A;  1ZXI A;  1UEL A;  3SEB A;  4J3O D;  5DCN A;  4E3C A;  3H1U A;  2WHI A;  2I2Y A;  3RCZ A;  3WAL A;  3CIR B;  4LNI A;  4JL9 A;  2B3A A;  2IO1 B;  1Z2M A;  3DVN U;  2MJ3 A;  1R4N I;  1V86 A;  3VXW A;  4US9 A;  1ET9 A;  3ZRC A;  2PW9 A;  2DX5 B;  1R7S A;  4RGN A;  4USA A;  1G6J A;  1ACC A;  1WX7 A;  5BMH A;  4A55 A;  2L83 A;  4P1C C;  3DHG C;  3E56 A;  1QZE A;  4ZRP A;  1JW9 D;  2JQR B;  3L54 A;  3KW5 B;  2EKE C;  2HE7 A;  2C60 A;  1JWA D;  3H7P A;  4WJO A;  4RF1 A;  1MPE A;  2ASQ A;  2DZI A;  3DQV A;  1WRD B;  3VR8 B;  4CO7 A;  4HDQ A;  3BYT B;  3N32 A;  1WWT A;  3KYD D;  2K6Q A;  3Q8F A;  3AE9 B;  1PUT A;  2LZ6 A;  1I35 A;  2EMS A;  3HVZ A;  4ANU A;  3SR6 A;  3KUZ A;  3Q8A A;  3W1Y A;  5C3J B;  4I6P A;  1JML A;  2MA9 B;  1Q0W B;  3Q3J A;  3VVW B;  1R4M I;  2KAJ A;  1UH6 A;  4MSM B;  3PV1 A;  3R7R A;  4IC7 B;  5G55 A;  1IBX A;  2RD0 A;  3V62 A;  2M17 A;  2KHW B;  1UBI A;  3AE3 B;  4IWP A;  1ESF A;  1E8X A;  1E8Z A;  1FXI A;  3WAM A;  2LVQ A;  2WS3 B;  3RNA C;  2QIL A;  3IBE A;  4K7S A;  3V6E B;  2JYT A;  2GMI C;  2ZVO A;  1P0R A;  1E5W A;  5KHQ A;  5H92 C;  5LXH A;  3DBR I;  4R3D A;  2CHW A;  3U52 E;  3IXS A;  3NZ3 A;  4HK2 A;  4EZL A;  1C9F A;  2KVR A;  2NCN A;  1QOB A;  3P42 A;  4E74 A;  3A1Q B;  2NTS A;  3DBH I;  4N59 A;  2WP9 B;  1SEB D;  4S0R A;  2J7Q B;  4C7Y A;  4MJS A;  1ZDX A;  2BYV E;  3DWG C;  1MJD A;  2BS2 B;  2H89 B;  2NPT A;  2RDB C;  1PDX A;  2N4F A;  5IO9 A;  3I9V 1;  4IM2 A;  3I57 A;  4MJS B;  3SFD B;  4ARI A;  3LYY A;  1VD2 A;  1KJT A;  3A1Q A;  1Y8R C;  1NEN B;  1GAQ B;  4JE3 B;  3ZTD A;  4NQL B;  1SE2 A;  1WM3 A;  4YTN B;  4O1N A;  4ICU A;  5MPO A;  1V1P B;  3GP7 A;  2OOB B;  3KLS X;  2K25 A;  4M00 A;  3BYY B;  2DZJ A;  1NI2 A;  2REX A;  1FXA A;  1K51 A;  1N5X A;  3BY4 B;  4WIP A;  1L5P A;  3RT3 B;  1F9J A;  2JWU A;  3IG3 A;  4JLC A;  2VH1 A;  5JHB A;  2DZK A;  2FCM A;  4XWT A;  2FCS A;  4EUT A;  1LXD A;  5LLI A;  3TSS A;  4M0W B;  1NYR A;  2MEK A;  1L6U A;  1N5W A;  3H7S A;  3RD2 A;  4HLE A;  3IVF A;  1VR9 A;  3GE3 C;  4I6L B;  4KZC A;  3ZNH B;  4HJK A;  1AYF A;  2KLG A;  2Q5W D;  3GZN I;  4A20 A;  3EFC A;  4JIO U;  1PGB A;  4YSZ B;  3TJP A;  3RFZ B;  4NNJ B;  1C76 A;  2KQ4 X;  4C00 A;  4M8M A;  1BXT A;  3T9L A;  4HRS A;  3ZXR A;  5D3D A;  3HUI A;  1NDD A;  4DHJ D; 
#chains in the Genus database with same CATH homology
 5D2M B;  3VUX A;  2KAN A;  1SIF A;  4BKT A;  2JWZ A;  2ZVN A;  3ZNG C;  2M1M A;  2JVC A;  4JQW C;  2LVP A;  2A4Z A;  2LD9 A;  2GBR A;  4NPN A;  3ZW3 A;  4K7W A;  1WFY A;  3HM6 X;  3OAW A;  4GGQ A;  4ANW A;  4F1S A;  1V81 A;  3QQ8 B;  3B08 A;  1UD7 A;  3A9J B;  4DK5 A;  2KQS A;  4LJO B;  1TTN A;  2D2Q A;  3EHV A;  2N7D A;  5DPW A;  2MX2 A;  2CHZ A;  2LGD A;  4W9G A;  4B6W A;  4NAW B;  2K6D B;  2KJR A;  4N9F 4;  3TIX A;  3QJZ A;  4HPM B;  4BOS C;  2MQJ A;  2WYQ A;  4FHJ A;  3NY5 A;  2MLB A;  2NBU A;  4MGI E;  2MBE A;  5G2N A;  4OVV A;  3BIN A;  3UGB B;  5DPT A;  3VAW A;  3PLV A;  2MRP A;  5AEK B;  3APF A;  4MM3 A;  2KLC A;  2A5U A;  2XK5 B;  1V9J A;  2JF5 A;  1BT0 A;  1V80 A;  2UYZ B;  3VFK A;  2KDB A;  2V3S A;  4URK A;  4W9F A;  2ZPN A;  3SD5 A;  3KH0 A;  4M8N A;  1OQY A;  1C1Y B;  1WE7 A;  1YX6 B;  1HE8 A;  4GN1 A;  4AJY B;  1WR1 A;  5L95 C;  4FA6 A;  3N3K B;  4GSW A;  4BOZ B;  5HKH A;  5E6N A;  1IPG A;  5CHF A;  5LXI B;  2MBH A;  2C7H A;  3VTU A;  1K8R B;  3B1L X;  3JW0 X;  2JUO A;  2JPH A;  2NBW B;  3W1S C;  1WX9 A;  4TUU A;  1XT9 B;  3OLM D;  4XC2 A;  3VUW A;  2D07 B;  4W9K A;  1ZKH A;  2KMA A;  2M8S A;  4K1R B;  3VDZ A;  3MTN B;  2J0M A;  2AWT A;  2KD0 A;  4ZYN A;  1WI0 A;  4MSQ B;  1YIW A;  4KDI C;  2O6V A;  3DBS A;  4HPL B;  4KDL B;  1WR6 E;  2IO2 B;  3PHX B;  4FLH A;  2DYO A;  2YVC A;  2KJ6 A;  2ZPY A;  3U8Z A;  3QC8 B;  2PEA A;  1UBQ A;  2NPT B;  4XX5 A;  3VHT C;  3ZIM A;  2L7R A;  2AYO B;  2FCQ A;  4EKU A;  2KDE B;  3Q3F A;  2KKC A;  4GDL A;  5L83 A;  4WWO A;  4RM8 A;  3PRP B;  2Z0D B;  3LDZ E;  4BKS A;  2RR9 A;  2BWE S;  2K8H A;  3JYU A;  2ZZP B;  4FJV B;  4AJW A;  4HWI B;  4FUL A;  2KJH B;  3RZF A;  2AL3 A;  1Q1O A;  2NBV B;  2YLM A;  2L05 A;  4W9D A;  1UGM A;  1WZ3 A;  3B0A A;  3VH4 B;  1S1Q B;  2O6V D;  4A3O A;  2LXA A;  3RZW C;  4NQK E;  1M94 A;  2BKF A;  2HTH A;  2N1W A;  5CHW A;  2N9P C;  3EC8 A;  3U7D A;  4BBN C;  4ZRJ A;  3L08 A;  4YL8 A;  3NZS A;  4NJ7 A;  2EMT A;  3QA8 A;  2K8C A;  3L13 A;  1EF1 A;  1OTR B;  3A9K B;  3PZD A;  4FN2 A;  2MP2 B;  2KTF A;  4HDO A;  4MEM A;  2GBN A;  4ZDV A;  2DAF A;  3M95 A;  1V5O A;  1L2N A;  5D7G A;  4ASW C;  4FBJ B;  4DHZ B;  4TV3 A;  2C5L C;  1GNU A;  2M4N A;  3QAR A;  4I6N B;  2ZCB A;  4EOY A;  5J2R A;  3IHP C;  3M63 B;  3V6C B;  4B95 A;  3QIJ A;  3UF8 A;  3QWZ B;  2LGY A;  3AI5 A;  3CF6 E;  5KHO A;  4E71 A;  2K39 A;  4PS7 A;  3PLU A;  2BGF A;  3DVG X;  2MCN B;  2KXJ A;  3I3T B;  1WGG A;  3QCA A;  2WX1 A;  1D3Z A;  1SE9 A;  1LM8 B;  2L3Z A;  2L0F A;  2N1V A;  3NZU A;  4NAW A;  3L0W B;  1V2Y A;  2KC2 A;  4XZ4 A;  4BBN F;  1RRB A;  4DBG A;  1OEY J;  2LRW A;  1OGW A;  3AXC A;  4FJY A;  1ISN A;  5CTR C;  4JGH B;  2I1K A;  2M0X A;  1GUA B;  1YD8 U;  2N9E B;  4W9H A;  4NJ6 A;  2CKH B;  1AAR A;  4TKN A;  1WY8 A;  3ZVV A;  1RLF A;  3UIN B;  2D3G A;  3KUD B;  4PS3 A;  1E8Y A;  1UZX B;  4MDK E;  4OVU A;  3NOB A;  2KK8 A;  2WWZ A;  4WJP A;  3ONS A;  4FAD A;  1YX5 B;  2KTR A;  1S3S G;  1H4R A;  4G3X B;  1WGH A;  1LQB A;  1Q5W B;  4MGY E;  2C9W B;  4W9E A;  4LCD E;  3RUI B;  1WE6 A;  1KLV A;  3EFU A;  4II3 B;  2FCN A;  1WIA A;  3EEC A;  3TMP B;  3OJ4 B;  4AOF A;  4AWJ A;  1E7V A;  4LDT D;  4HVB A;  4G50 A;  2KWU B;  4MGK E;  1ZGU B;  2BKR B;  2KDF B;  2QHO A;  2XBB C;  1YQB A;  2Z59 B;  4WWP A;  2N9X A;  3JVZ X;  3VTV A;  1J8C A;  4PYU A;  2JZ3 B;  2KX3 A;  3T8M A;  4F7Z A;  1XD3 B;  1KM7 A;  3ENE A;  3H6N A;  4KIK A;  5D6J B;  3WA0 A;  3AU4 A;  2R2O A;  4DDI D;  3H7P B;  3DPD A;  4GB9 A;  4FHK A;  3SHQ A;  1P98 A;  4W9L A;  1T0Y A;  3M62 B;  4EZK A;  1RAX A;  1WF9 A;  3HHM A;  2AL6 A;  2J0J A;  5BO4 B;  2DEN B;  5JZE B;  1WH3 A;  2HJ8 A;  2LUE A;  1UEL A;  4KVG B;  2G4D B;  4LJP B;  3QX1 A;  2L0T A;  1J19 A;  2AEH A;  5DCN A;  4DHZ E;  4E3C A;  4BFR A;  3H1U A;  3RCZ A;  3WAL A;  2KC1 A;  2JRI B;  2JT4 B;  1V5T A;  4JL9 A;  2KQ7 A;  3RUL A;  3CSF A;  2B3A A;  2WX0 A;  2IO1 B;  3APC A;  4CHK A;  1Z2M A;  3DVN U;  2RSU A;  1TZ1 A;  1WJU A;  1R4N I;  3MJW A;  1V86 A;  1WGD A;  3ZDT A;  3VXW A;  3PGE A;  3DCG A;  5GMV A;  3ZRC A;  3PT2 B;  1SGH A;  5TR5 A;  3A9K A;  2D10 A;  2DX5 B;  3LJ3 A;  4RMA A;  1G6J A;  1E8W A;  2V1Y A;  1OEY A;  1WX7 A;  2C7M B;  4IWQ A;  2DZM A;  3DBL I;  4WJN A;  3ZRF A;  3N30 A;  3R7Q A;  1NBF C;  1P3Q U;  2LAS A;  3PS6 A;  1QZE A;  5DPS A;  2IY1 B;  4BKS D;  3L54 A;  4ANX A;  3KW5 B;  2PJH A;  2JXX A;  1WJ4 A;  2LVO A;  2EKE C;  2HE7 A;  2JRH A;  2C60 A;  2NR2 A;  3H7P A;  2V4L A;  4AP4 C;  3ALB A;  3L17 A;  4WJO A;  1WJ6 A;  3IFW B;  3SDL C;  4DXA B;  2LWP A;  2ASQ A;  2C7N B;  2DZI A;  2O2V A;  3DQV A;  2LGX A;  1WRD B;  4MH0 E;  4G0N B;  4CO7 A;  4WAA A;  4GU2 A;  4HDQ A;  2MBO A;  3CMM B;  3N32 A;  4IWO A;  2KDI A;  3KYD D;  3A4S C;  2K1F A;  2K6Q A;  3V61 A;  2FIF A;  4GXB A;  2LZ6 A;  1I35 A;  3TL5 A;  2ZNV C;  2K8B A;  2EMS A;  4ANU A;  3PTF C;  2XEW A;  1EUV B;  3AUL A;  4W9J A;  1EO6 A;  3KUZ A;  3PSE B;  1TBE A;  2IY0 B;  3VUY A;  4NY0 A;  1MG8 A;  1TGZ B;  2KTR B;  4ICV A;  1GC7 A;  2GBJ A;  3W1Y A;  3R3M A;  4I6P A;  2MA9 B;  4EEW A;  1L7Y A;  1IYF A;  1Q0W B;  2KWV B;  1C3T A;  4K7U A;  4J6I A;  4TQ0 A;  3RYT A;  4WJQ A;  5IAA C;  3Q3J A;  3VVW B;  1VCB A;  3DOW A;  1R4M I;  2FNJ B;  4HXD A;  1UH6 A;  2CU1 A;  3UQA A;  2ZCC A;  4MSM B;  1GJZ A;  1P1A A;  3PV1 A;  3R7R A;  4IC7 B;  1WMH B;  2DYM A;  2KMC A;  5G55 A;  3S2A A;  3OJ3 A;  3P2B A;  2RD0 A;  3QK0 A;  3UIO B;  3ZNZ B;  4ANV A;  3V62 A;  2XK5 A;  2M17 A;  2FID A;  3C0R B;  2OJR A;  3VTW A;  2KHW B;  1LFD A;  1UBI A;  4IWP A;  4TQ1 A;  4G11 A;  2GBM A;  1E8X A;  5J17 A;  3CST A;  1E8Z A;  2IO0 B;  2MWS B;  2MSE D;  5FR6 A;  3UQB A;  3WAM A;  2CHX A;  2LVQ A;  3HM3 A;  2KNB A;  3DVN V;  4IM3 A;  2FAZ A;  5IA7 A;  1WGR A;  2LXC A;  2Z0E B;  3QHT A;  3IBE A;  4KV2 A;  3DDC B;  2HD5 B;  4K7S A;  1RFA A;  2RPQ A;  3V6E B;  2BYE A;  4F8C B;  3PHW B;  3A9J A;  2GMI C;  2ZVO A;  1P0R A;  2IZV B;  1CMX B;  2I1J A;  3PRZ A;  4IG7 B;  1WMH A;  2N7E A;  1E5W A;  2J0K A;  5KHQ A;  5LXH A;  3H9D A;  3DBR I;  3DVG Y;  2CHW A;  2G3Q B;  2ZJD A;  5E6O A;  1WYW B;  3W1S A;  3VH3 B;  4KSL C;  2PE9 A;  1E90 A;  2MP2 A;  3X0W A;  1E7U A;  3K9O B;  4HK2 A;  2KZR A;  3WAN A;  1J0G A;  4EZL A;  5JH5 C;  2LJ5 A;  2KVR A;  2NCN A;  3L16 A;  2BWF A;  4E74 A;  2BPS A;  3X23 A;  2NS5 A;  3A1Q B;  3O65 B;  4W9C A;  3DBH I;  5DPR A;  5JHA A;  4GDK B;  3QAQ A;  3PRE A;  1WM2 A;  2GOW A;  2JZZ A;  1JRU A;  3PRM B;  2J7Q B;  4WWN A;  4BKG A;  4X57 B;  1PQS A;  4HCN B;  4MJS A;  2BYV E;  4KZ0 A;  2KWC A;  2VRR B;  2KFK B;  1YJ1 A;  5C1Z A;  4GDL B;  1X1M A;  2LRU A;  3ECI A;  3APD A;  5J18 A;  2CS4 A;  1H8C A;  5CX3 A;  4CYE A;  2FUH B;  1FXT B;  3A33 B;  2O2V B;  2NPT A;  3WIM A;  3ZTC A;  1WXA A;  2KOX A;  2N4F A;  2KFK A;  4GIV A;  4IM2 A;  3HIZ A;  5D94 A;  3WAO A;  4EZJ A;  1WXV A;  4MJS B;  4WQO B;  5AZF A;  4A3P A;  3ZDM C;  2O6V B;  1I42 A;  1VD2 A;  5CHV C;  1WXS A;  3K9P B;  3ML8 A;  3NS8 A;  1KJT A;  3A1Q A;  2LI5 A;  2L76 A;  1Y8R C;  1EF5 A;  3ZTD A;  4NQL B;  2MBB B;  4IM0 A;  4DHJ B;  1WM3 A;  4PYZ A;  2RGF A;  3JSV B;  2G4S A;  4ICU A;  1Z5S B;  3SU8 X;  3ZKJ C;  1A5R A;  3PPA A;  2OOB B;  3D32 A;  4AUQ C;  4GMV A;  2KFJ A;  1P9D U;  1WXM A;  3ZNI D;  2K25 A;  2PE6 B;  2L8J A;  2WDT B;  1ZW7 A;  2DZJ A;  1NI2 A;  2REX A;  2IBI B;  5EDS A;  3A4R A;  3HK0 A;  3L10 B;  4KSK C;  4BVU C;  5AZG A;  2PPH A;  4PS8 A;  3GOE A;  2BYF A;  3BY4 B;  3M3J A;  3JSV A;  1WZ0 A;  3RT3 B;  3U30 A;  1F9J A;  1V49 A;  3IG3 A;  2L00 B;  4JLC A;  4IW0 A;  5JHB A;  2DZK A;  2FCM A;  2IO3 B;  2KX0 A;  1V6E A;  2FCS A;  4EUT A;  1LXD A;  5LLI A;  2D11 A;  4MEL A;  3TBL D;  4M0W B;  5AZH A;  2UWQ A;  1IP9 A;  3UIP B;  4ZRK A;  1XQQ A;  2ZEQ A;  4MGZ E;  3ZUN A;  4EFO A;  3H7S A;  2MBQ A;  3RD2 A;  2DHZ A;  4HLE A;  3IVF A;  3MHS D;  3VQI A;  4I6L B;  4KZC A;  1KOT A;  3ZNH B;  4HJK A;  2KLG A;  4W9I A;  3GZN I;  4A20 A;  3R66 C;  3KVF B;  2R2Q A;  4JIO U;  4KIK B;  3TCA A;  1WJN A;  4P7I A;  2DAJ A;  4B9K A;  4DDG D;  2Y5B B;  3ML9 A;  1U4A A;  5E6P A;  2CR5 A;  3NHE B;  1WX8 A;  2KN5 A;  3TJP A;  4DWF A;  2DYB A;  4FJZ A;  3ZLZ A;  1GC6 A;  2GBK A;  2NVU I;  2ZNV B;  3KYC D;  3AU5 A;  4GOC A;  2G45 B;  4NNJ B;  3V60 A;  4M8M A;  4IUM B;  3KUC B;  4RM9 A;  3T9L A;  4K81 A;  3WAP A;  1GG3 A;  2MW5 A;  2BF8 B;  4II2 B;  2IYD B;  4ZRI A;  4HCP B;  3PVL A;  2W9N A;  4LDT B;  3ZO5 B;  1NDD A;  2KO3 A;  4GDK A;  5C23 A;  1WGY A;  2JY6 A;  4DHJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...