3V62A

Structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
73
Chain Sequence
b'PETHINLVSDGSSEIFFITTPLRRLMEAFARQGEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
molecule tags Protein binding/dna binding protein
source organism Saccharomyces cerevisiae
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
total genus 11
structure length 73
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v62A00
2LZ6A 3B08A 4LCDE 3A4SC 5E6NA 3QARA 3PHWB 4ZYNA 3DCGA 3X23A 2JZZA 2NBWB 5D2MB 3WAPA 2O2VA 2PJHA 3H6NA 4FADA 2G4SA 3RD2A 3DDCB 4II3B 3KH0A 3RT3B 4W9CA 3SU8X 1GC6A 1R4NI 2BWES 3PPAA 1KJTA 4DHJB 2FUHB 2GBKA 3ZRCA 3PLVA 3R7RA 1GJZA 1SGHA 1YD8U 2W9NA 5C1ZA 2N9XA 3DQVA 5J18A 5AZHA 1PQSA 4DDID 1WR1A 3JSVA 3APDA 2VRRB 1WH3A 2C7MB 2LRUA 4PYUA 1KOTA 4HCPB 4B9KA 4GIVA 1WXVA 3ZO5B 5TR5A 2M0XA 3PTFC 3A9JA 5D94A 4LJPB 1V9JA 4MGKE 1XD3B 2M1MA 3U8ZA 1GNUA 2FIFA 3ZTDA 1LFDA 3ZW3A 4CHKA 2NS5A 2MP2A 5LXIB 1OEYA 1KM7A 2LXAA 1JRUA 2WX1A 3DVNU 1LM8B 2FCNA 5J17A 3EC8A 4PYZA 1Z2MA 4WWPA 2EMTA 3VVWB 3ZUNA 4AWJA 4ASWC 3TJPA 1WGDA 2JF5A 1UGMA 1Z5SB 4WJQA 3O65B 2KDBA 1YJ1A 2IZVB 2NBUA 2LWPA 4NJ7A 4II2B 3ZTCA 4DDGD 1G6JA 3BINA 1WGYA 1F9JA 2DENB 1CMXB 2LVPA 3H7PA 1SE9A 1EF1A 1J8CA 1C3TA 2L3ZA 3MTNB 2C5LC 4GDKA 1V49A 4DHJD 2WYQA 2DZJA 1WM3A 5CHFA 1E8ZA 1Y8RC 3P2BA 3PT2B 1UBIA 1ZKHA 2UYZB 3A1QA 2PE6B 2KTFA 2ZZPB 2L76A 4BOSC 2WDTB 4KIKA 4HJKA 2IO1B 4PS3A 4HWIB 4ZRJA 2LVOA 3EECA 1E90A 1P3QU 2AWTA 3HIZA 3A33B 3C0RB 2NCNA 2L8JA 2FCQA 3ZNHB 4KV2A 2IYDB 2JY6A 2KXJA 2JRIB 2L0FA 3PS6A 4FA6A 2K25A 5JZEB 4DBGA 3ZVVA 2GOWA 5CX3A 1TGZB 2R2OA 3VAWA 3OLMD 4ANXA 2KWCA 3W1SA 2BYVE 2V4LA 3TCAA 3RUIB 1Q0WB 1WMHA 1IPGA 2I1KA 2ZCBA 4M0WB 2LUEA 2ASQA 4YL8A 3DPDA 3JVZX 2RPQA 2OJRA 2Z0EB 1V2YA 4PS8A 1J0GA 2DAFA 2N9PC 2ZEQA 3DOWA 2KDIA 4LDTB 2KJRA 2YVCA 4G0NB 4NPNA 5C23A 1X1MA 2C7NB 1RLFA 2V1YA 2NVUI 4N9F4 3WANA 3ZDMC 3UQAA 2MBHA 4M8MA 2O2VB 2DZIA 5DPWA 1WI0A 1LXDA 3I3TB 3S2AA 2IBIB 3NS8A 3RZWC 3L08A 3H9DA 1V5TA 2KDFB 4MEMA 2PEAA 2EKEC 3VH4B 1TBEA 2R2QA 5BO4B 2LGXA 4W9DA 3WA0A 4BKSD 3QQ8B 1SIFA 3UIPB 1WX8A 1E8WA 1WXMA 2DAJA 2N7DA 5EDSA 2ZVNA 4ZRKA 4A20A 1AARA 5JHAA 4F1SA 4NNJB 1IYFA 4MSMB 2KJ6A 4MM3A 3SDLC 2NPTA 2K1FA 2G3QB 1WJUA 4BKGA 4MH0E 3KUDB 2CR5A 2KQSA 2A5UA 4WJOA 1WZ0A 2PPHA 1EUVB 1UD7A 2J7QB 3H7PB 3LDZE 3OJ3A 4HPMB 2CKHB 1LQBA 3D32A 4W9FA 2JPHA 2IY0B 4KIKB 5FR6A 1YX6B 2L7RA 2ZNVC 3AU5A 4AOFA 5JH5C 3UGBB 3VQIA 2BPSA 4B95A 3WIMA 4EKUA 3ZRFA 2Z59B 2ZJDA 1HE8A 4W9EA 4OVVA 4BVUC 2MW5A 2IO3B 1V5OA 3TMPB 2L00B 3ECIA 1WIAA 3IVFA 1C1YB 3CSTA 2D3GA 4E74A 3ZIMA 2K8CA 4GDLB 2C7HA 2LRWA 2DHZA 1RFAA 3Q3FA 2RSUA 5D7GA 3X0WA 3APFA 3ZNGC 4JIOU 2K6DB 2K6QA 2KK8A 3VDZA 4FHKA 3NY5A 2KO3A 2DX5B 2MBQA 3TBLD 3SHQA 3VUYA 1Q5WB 3MJWA 2ZPYA 1WYWB 4HDQA 4WWNA 2IY1B 3L10B 2O6VB 4WAAA 2KFJA 3UIOB 4A3OA 2KMCA 2A4ZA 4RM8A 3ZLZA 1KLVA 2LGDA 3BY4B 3L13A 5LLIA 3DBRI 3KW5B 4HDOA 1L2NA 3A9JB 2CU1A 2K8HA 2FNJB 4HPLB 3M3JA 2KLGA 3B1LX 4MJSB 4ZDVA 2BF8B 2GMIC 4MGZE 4W9IA 2KWUB 3JSVB 3DBLI 3B0AA 4FN2A 4XX5A 4TUUA 2EMSA 3TL5A 4FJZA 5DPRA 3L16A 4ANUA 2KC2A 1UZXB 1ISNA 2FAZA 1OQYA 2AEHA 3H1UA 3QJZA 3OAWA 4TQ1A 4F8CB 3NHEB 1P9DU 4GDLA 3W1YA 3QAQA 4EFOA 3DVGX 4A3PA 2MRPA 5L95C 2O6VD 1WR6E 1WJ4A 1V81A 3OJ4B 2M4NA 2OOBB 4M8NA 4PS7A 2DYOA 2GBRA 4ICVA 1GG3A 1P1AA 3NZUA 1QZEA 3ZNID 1E5WA 1XQQA 1OGWA 4FHJA 3A1QB 4DWFA 2BWFA 2FIDA 5AZFA 1WMHB 2J0MA 3ALBA 3VFKA 1WGGA 4MDKE 1OEYJ 3QHTA 3R66C 2MCNB 1WY8A 5LXHA 2XEWA 3SD5A 2G45B 4MJSA 4ANVA 3HM6X 3H7SA 4W9LA 4I6NB 3EHVA 1WGHA 4NAWB 2D07B 1TZ1A 2IO2B 1YX5B 5DCNA 4K7WA 2CS4A 3W1SC 1WZ3A 3PRZA 5J2RA 5AZGA 2V3SA 2N7EA 4NQLB 4BOZB 4DK5A 1RAXA 4AJYB 1Q1OA 2NBVB 3K9PB 4IC7B 2XK5A 3A9KB 2NPTB 4HXDA 4EOYA 2CHXA 2GBMA 4I6PA 2UWQA 4G11A 3KYCD 2BKRB 5L83A 1EO6A 2G4DB 4URKA 1E8XA 2M8SA 4K81A 2RR9A 1M94A 2KMAA 3HHMA 3NOBA 3PHXB 3IG3A 2M17A 2KJHB 3ENEA 2MLBA 2K8BA 5JHBA 4JGHB 1D3ZA 3RCZA 4HCNB 3VXWA 2K39A 4BKTA 3V62A 4GOCA 4GMVA 2HJ8A 2CHWA 4RMAA 5G55A 4XZ4A 4RM9A 4G3XB 1GC7A 2I1JA 2LJ5A 4GN1A 3ZDTA 4WQOB 3ZNZB 5E6OA 3KVFB 3PZDA 4K7SA 4LJOB 5G2NA 2J0JA 4K1RB 3Q3JA 2NR2A 4IW0A 4W9KA 4OVUA 4KVGB 4MELA 3KUZA 3M63B 3VTVA 4AUQC 3VTWA 3UINB 2JRHA 3V60A 5HKHA 1E7VA 4LDTD 2WWZA 4WJPA 3T9LA 3AXCA 4X57B 3U30A 4DHZB 2KHWB 2KTRB 5KHOA 2DYMA 2JVCA 1VD2A 1P98A 1WF9A 4K7UA 1I35A 2ZPNA 2QHOA 3NZSA 1K8RB 4IM2A 1H8CA 5DPSA 2LD9A 3WAMA 2HD5B 2D11A 2JUOA 4GDKB 4TKNA 4DHZE 4NY0A 3N30A 2ZNVB 3QK0A 2MBEA 2DZMA 3PRMB 4BKSA 4MGIE 2LI5A 2L0TA 3K9OB 4BBNF 3RULA 4BFRA 2KLCA 1WX9A 2N4FA 3PREA 4IM3A 4KDLB 4F7ZA 2DZKA 2MSED 3AU4A 2LVQA 5DPTA 2LASA 3A9KA 2MX2A 4GU2A 1V86A 3T8MA 3MHSD 1S3SG 2FCMA 2Z0DB 3KYDD 4IUMB 3WAOA 2BKFA 3VTUA 2AYOB 3V6CB 3DVGY 2AL6A 4AP4C 3M95A 2MP2B 4W9JA 4DXAB 4EZKA 1XT9B 2JZ3B 2BGFA 3N3KB 4WWOA 1V6EA 3CMMB 2KFKA 4JQWC 2MWSB 4TV3A 3VUXA 3PGEA 2KX3A 1RRBA 2KZRA 3JYUA 4GXBA 2KX0A 1IP9A 3QCAA 2MBOA 5CHVC 3PVLA 2GBJA 2ZVOA 4TQ0A 1MG8A 4E3CA 2REXA 3DVNV 3PV1A 1GUAB 3CSFA 3GZNI 1WJNA 3IFWB 2MA9B 3AI5A 2BYFA 5E6PA 4HK2A 3V61A 3IBEA 1UELA 1E8YA 2KANA 4GGQA 4MGYE 1I42A 3PLUA 3CF6E 3HK0A 3R3MA 2JT4B 2IO0B 5KHQA 3LJ3A 4WJNA 2CHZA 2KOXA 1NBFC 2Y5BB 4HLEA 5GMVA 4HVBA 5IA7A 4GSWA 2KQ7A 4J6IA 3ZKJC 1UH6A 2N9EB 4FLHA 4I6LB 2RD0A 3U7DA 4XC2A 1ZGUB 3JW0X 4JLCA 3IHPC 3ML8A 1R4MI 4KZCA 2BYEA 2HE7A 3QWZB 2KFKB 4G50A 2XBBC 1YIWA 1YQBA 3EFUA 4EZJA 2PE9A 3N32A 2B3AA 3AULA 3L54A 2N1VA 4KSKC 4NJ6A 4P7IA 1P0RA 2O6VA 4JL9A 1VCBA 3RYTA 3ONSA 1J19A 3DBHI 3V6EB 5CTRC 1OTRB 2D10A 2L05A 4BBNC 1NDDA 3VH3B 1H4RA 1WJ6A 2KD0A 1T0YA 2KC1A 1WX7A 1ZW7A 4IG7B 2KNBA 1TTNA 1EF5A 1E7UA 2GBNA 4W9GA 4CYEA 5CHWA 2KVRA 3APCA 2KDEB 4NAWA 2LXCA 3R7QA 1WRDB 2MQJA 2FCSA 1WXSA 1A5RA 4B6WA 2D2QA 4MSQB 1NI2A 4FULA 1BT0A 4EZLA 1UBQA 1WE7A 2C60A 3A4RA 1WFYA 3HM3A 3TIXA 1WE6A 4W9HA 2C9WB 4EUTA 4GB9A 2JXXA 2RGFA 3L0WB 2KWVB 2YLMA 3QA8A 4FJVB 2DYBA 5AEKB 2KN5A 3QIJA 4KSLC 3UF8A 1WGRA 2KTRA 2XK5B 3ML9A 4ZRIA 3KUCB 2ZCCA 2N1WA 4IM0A 4FBJB 1WXAA 3VUWA 3UQBA 2KKCA 2JWZA 2LGYA 3QX1A 3WALA 4CO7A 4IWOA 2MBBB 4AJWA 1L7YA 3PSEB 4E71A 5IAAC 4KDIC 4EEWA 2WX0A 1V80A 3RZFA 4NQKE 3PRPB 4ICUA 2HTHA 4IWQA 3L17A 2AL3A 4KZ0A 3VHTC 1WM2A 4FJYA 4ANWA 1FXTB 2J0KA 3GOEA 3QC8B 1U4AA 3DBSA 5D6JB 3M62B 4IWPA 1S1QB
chains in the Genus database with same CATH superfamily
3B08A 2N0SB 5E6NA 2JZZA 2PTLA 4W9CA 1TKEA 1JRPA 1KJTA 4HPPA 2FUHB 3N1ZC 5FK9C 4XYCA 3R7RA 1GJZA 5AUIA 2W9NA 5J18A 1TS2A 3SFDB 4DDID 1EWYC 2VRRB 1WH3A 2C7MB 4PYUA 5HFYA 4JWUC 3KLSX 1F2RI 1CQVA 4LJPB 4MGKE 1HA5A 1GNUA 2FIFA 3ZTDA 2NS5A 3IXSA 5LXIB 1KM7A 1A70A 4WWPA 2EMTA 1PUTA 4WURA 2WP9B 3O65B 1YJ1A 1SJED 2IZVB 4NJ7A 4II2B 1NVID 3BINA 3H7PA 1DOXA 3IAM1 1KLUD 4KGSA 1V97A 3MTNB 3R8BA 4DHJD 1YJIA 1UGJA 1E8ZA 1Y8RC 1STEA 1CJEA 1FM0D 1WSPA 2W3SA 1TY2A 4C7ZA 4IKGA 4HWIB 4ZRJA 3P4RB 1E90A 2QSDA 1P3QU 3HIZA 1F2RC 2IYDB 2JY6A 2KXJA 1P7EA 3PS6A 4S0RA 2BYVE 2V4LA 3TCAA 3RUIB 1WMHA 1IPGA 3P63A 1HXYD 2WXFA 4YL8A 3ZGZA 1ZUD2 2N9PC 2ZEQA 4LDTB 2INPE 3BVMA 4N9F4 3WANA 3ZDMC 3TEZA 2PW9A 2QJLA 1QT9A 3S2AA 1RM6C 3NS8A 2Y5CA 2LFIA 3H9DA 3FAHA 2KDFB 3WCQA 2PEAA 2EKEC 2R2QA 2NTTA 3LB8C 2WU2B 2WHIA 5EDSA 1AARA 1IYFA 4US9A 4MM3A 2G3QB 3NJTA 5BYSA 4BKGA 4MH0E 1JWMD 3RNAC 1L0XB 1QOFA 2PPHA 1EUVB 3H7PB 2CKHB 1LQBA 1QILA 1YX6B 3NVYA 3VQIA 2BVCA 4EKUA 1D5MC 1HE8A 2MW5A 2IO3B 4XWTA 3NVVA 1JROA 1C1YB 1NI3A 1QQRA 4GDLB 2C7HA 2RSUA 1BUIC 1ZXHA 3VDZA 2LUMA 1SE4A 2DX5B 3R2TA 3TBLD 3VUYA 3AEFB 3MJWA 2IY1B 2ICIA 3UIOB 1FFUA 4RM8A 3ZLZA 1KLVA 2LGDA 3TEXA 3KW5B 1QOAA 3M3JA 4OVZA 5BMGA 4BAXA 4ZDVA 1K52A 3AN1A 3B0AA 2PVOD 3AE8B 3L16A 1OQYA 3W1YA 1SEBD 5HI1A 5L95C 1IBXA 4M8NA 2OOBB 3GB1A 2GBRA 4ICVA 1OQRA 3ZNID 4DWFA 2BWFA 3ALBA 2E6XA 3QHTA 2MCNB 2L83A 2XEWA 1VRAB 2G45B 3HM6X 3H7SA 4W9LA 4NAWB 3ETRA 1SE3A 1ET9A 1WZ3A 2V3SA 2ZW1A 2BS2B 4KGTA 1Q1OA 3K9PB 4IC7B 1TKGA 2NPTB 2JWUA 1YNTE 3Q3MC 2UWQA 3KYCD 2BKRB 2G4DB 2WDVB 4K81A 4ZHPA 3ENEA 2WNMA 1UWXA 3VXWA 2K39A 5IP4D 4BKTA 1TT5B 2HJ8A 1FNWA 4RM9A 2PIAA 3SEBA 1GC7A 2LJ5A 1QOBA 4GN1A 1FMAD 4WQOB 2CJOA 3NUHB 4LJOB 4P16A 4UDUC 5IN7A 1F52A 4W9KA 4Q2JA 2WXOA 4YTMB 5G5HA 4AUQC 1C4AA 5HKHA 3V60A 2WWZA 4WJPA 1R4MB 3T9LA 2KTRB 2DYMA 1P98A 2WS3B 1H8CA 4M00A 3RN9C 4GDKB 2J4XA 4NY0A 1K51A 3N30A 3ZQ4A 2MBEA 2DZMA 4BKSA 4XDCA 3U7ZA 4BFRA 3P42A 2N4FA 3SR6A 5GXGB 1C4PA 1UF0A 5DPTA 2LASA 1I4PA 4GU2A 3AEBB 1V86A 2CU3A 3T8MA 4JX1C 3VTUA 2WXRA 3V6CB 1SF0A 4EZKA 2JZ3B 2LJIA 4YSYB 3VUXA 2KX3A 2KZRA 1F1HA 5BYRA 2MBOA 1DOIA 2GBJA 3DVNV 2INNE 3GZNI 1WJNA 1JW9D 1Y56A 1N61A 3RNFC 5E6PA 4HK2A 4MGYE 3PLUA 3KWLA 1ET6A 3BVZA 2IO0B 5KHQA 2CHZA 1NBFC 2Y5BB 5AUKA 4HLEA 5GMVA 1T6BX 1HEZE 4PK1A 4FLHA 3U7DA 1ZDXA 1R4MI 3QWZB 1TKYA 2MJDA 3EFUA 1PDXA 1C77A 2B3AA 1VCBA 1QF6A 4MT5A 1JALA 1N5XA 2D3AA 4P1BC 1BXTA 3ZXVA 1OTRB 2G9HD 1NDDA 1WJ6A 2ONQA 4YTPB 1E10A 3GE8C 2QIEB 1EF5A 4W9GA 4XDDA 4YT0B 1A5RA 3ZJTA 4RGNA 1BT0A 1ZOYB 3TIXA 1WE6A 2JXXA 2RGFA 2YLMA 2KN5A 5T8IA 4ZRIA 2ZCCA 1WXAA 4M01A 3UQBA 4REZA 5D3DA 4CO7A 3U52E 3P4PB 2INDC 4EEWA 3PRPB 4ICUA 3VHTC 2DWQA 2AQ1B 4FJYA 3GOEA 3DBSA 5D6JB 4W9DA 2LMCA 4IWPA 4LCDE 3PHWB 4ZYNA 1PGBA 3RNCC 2NBWB 4FADA 4II3B 4ZYSA 1R4NI 2W3RA 5AZHA 1C79A 1WR1A 3JSVA 1XLOA 1XCQL 1KOTA 4B9KA 3O13A 1V9JA 2PVGC 1XD3B 3U8ZA 4TSSA 3URYA 1AYFA 1I4QA 1LFDA 3BVGA 2MP2A 4KGRA 2FCNA 3RI7C 1TS3A 2X38A 3MP9A 1Z2MA 3L4PA 3ZUNA 4AWJA 2KMMA 2JF5A 1UGMA 1Z5SB 3ZTCA 1G6JA 1F9JA 1EF1A 1VR9A 4L23A 2DZJA 5CHFA 3P2BA 3PT2B 3SFEB 3A1QA 3Q14C 1KFYB 2PE6B 2GB1A 4BZAA 1EU3A 2WDTB 2VH1A 2W54A 3AE4B 2IO1B 3P4QB 3EECA 2YEPB 2XN9C 3C0RB 4ARIA 2JRIB 2GOWA 5CX3A 1TGZB 2R2OA 3VAWA 3OLMD 4ANXA 3RFZB 3W1SA 2WXNA 1CK1A 3DPDA 3JVZX 2Z0EB 5TSSA 2WXKA 1VLBA 2KDIA 5HHDG 3I57A 4G0NB 1X1MA 2V1YA 2KT7A 1J7BA 4M8MA 5DPWA 1WI0A 1LXDA 1L4DB 1MPEA 2IBIB 2D3BA 2KVZA 1BMLC 2AQ2B 3L08A 4C4VB 1V5TA 5BO4B 1ZE3D 2LGXA 1SIFA 2J53A 1E8WA 2ZVNA 4F1SA 2Y3AA 3HRDD 2QILA 4ZRQA 1EWCA 1V1PA 3KUDB 2KQSA 4WJOA 2RPVA 2BW2A 2J7QB 3LDZE 5IOIA 2OHFA 4KIKB 4RFBA 4HRSA 2EKIA 4MH8A 2BPSA 1V1PB 3WIMA 3GP7A 2Z59B 2KQ4X 1V5OA 3BK1A 1WIAA 1XLQA 4K3BA 3CSTA 4A90A 4E74A 3ZIMA 5D7GA 3X0WA 4JIOU 4LNOA 2MBQA 3E9SA 2R61A 4WWNA 4N58A 2O6VB 2JYTA 1FNUA 3OG5A 2KMCA 1RWSA 3BY4B 5LLIA 3DBRI 3A9JB 3B1LX 4MJSB 2GMIC 4W9IA 1OFFA 2KWUB 3JSVB 4TUUA 2K5PA 2MEKA 2FAZA 1ISNA 2AEHA 3QJZA 4R3DA 2DBYA 4TQ1A 3NHEB 1P9DU 4GDLA 2RDGA 4M0WA 4OZAA 4EFOA 3RPFC 1WRIA 2MRPA 1ESFA 2O6VD 1KH0A 1B1ZA 1XF5L 1QZEA 4HKZE 3Q2AC 3A1QB 5EE9A 2FIDA 1WMHB 2J0MA 3R66C 4DQOC 1D5ZC 3SD5A 4ANVA 2MJ3A 4I6NB 3EHVA 2KN4A 1WGHA 1YX5B 2CS4A 1HTQA 1RAXA 4AJYB 2Z8LA 2VZKB 1AN8A 3A9KB 1XO3A 4HXDA 3TEWA 2CHXA 4HJGE 4JWSC 3AM9A 5L83A 2KMAA 3HHMA 3IG3A 3T3OA 4IDIA 4CQNA 2MLBA 2BYTA 4JGHB 1D3ZA 3RCZA 3FKYA 4HROA 4GOCA 4GMVA 5G55A 4XZ4A 2LGIA 2I1JA 4MM3B 1T3QA 3ZDTA 3ZNZB 4P6VF 3KVFB 4K7SA 5G2NA 2J0JA 2BTEA 4K1RB 3Q3JA 4IW0A 2K9XA 2M0AA 2KWDA 2KAJA 3M63B 4N6EB 1SJHD 3UI3A 3N1XC 3PZ7A 4LDTD 1TYGB 4ITKA 4X57B 1VD2A 1JWSD 2D5GA 1WF9A 4HKQA 1FRDA 3NZSA 1SSNA 5BMIA 2J52A 2JQRB 4RF0A 2D11A 3BIID 2MHJA 4TKNA 1FCLA 2ZNVB 3CWIA 3QK0A 2B76B 4K3CA 1L4ZB 3R2IA 1TIFA 4F7ZA 2DZKA 2MSED 3AU4A 2LVQA 3A9KA 2MX2A 3W5VB 2WDQB 3VR8B 1UNSA 3MHSD 3KYDD 1R4NB 2BKFA 1RYJA 3DVGY 2AL6A 3M95A 2HDEA 4W9JA 4DXAB 1M4VA 1V6EA 3CMMB 2MWSB 3PGEA 4WQMA 3JYUA 2KX0A 1ZP0B 1KRHA 2ZVOA 4YWGG 1MG8A 1UUPA 1FD6A 3W5UB 3I5JC 4XWWA 3IBEA 1UELA 1E8YA 1MFWA 1N62A 1K50A 1Q10A 1MHHE 3DWMA 2N9KA 4GSWA 2RDHA 1L5PA 3JW0X 3IHPC 1AW7A 4KZCA 2YEPF 2BYEA 1FO4A 1EM7A 4EZJA 3NRZA 3L54A 3BYYB 4NJ6A 4KSKC 4P7IA 1ZXIA 4JL9A 1J19A 2WXIA 2L52A 5HG2A 2D10A 4BBNC 3NS1A 1SXTA 2KC1A 1WX7A 4IG7B 3AE5B 2KNBA 2WXMA 3TSSA 1I4HA 1ZDVA 3IAS1 2KDEB 1VZ8A 3R7QA 1WRDB 2FCSA 1WXSA 2QDFA 2D2QA 1NI2A 4EZLA 3HM3A 1UBQA 4XE0A 4YSZB 5H92C 2KWVB 5AEKB 3I9V1 3QIJA 4KSLC 3UF8A 3ZJVA 4IM0A 2N1WA 3QX1A 2QCZA 4IWOA 5EE3A 4KDIC 4ZOHC 4QAYA 3RZFA 1WWTA 3GZNB 2HTHA 4IWQA 2FUG1 2AL3A 1LGRA 2E3TA 4ANWA 2J0KA 1KF6B 3IT4B 1U4AA 2LZ6A 3A4SC 3DCGA 5D3IB 5D2MB 3WAPA 2O2VA 3Q3NC 2G4SA 3RD2A 4S17A 2IJ0A 3DDCB 3RT3B 1GC6A 2BWES 3PPAA 4DHJB 2GBKA 5C1ZA 1SIJA 2N9XA 3VR9B 3N1YC 2Q5WD 4HCPB 2M0XA 2JYEA 5D94A 3DBRB 2M1MA 2BS3B 4RGOS 3ZW3A 4CHKA 3NG0A 1OEYA 1PGAA 1JRUA 2WX1A 3DVNU 1LM8B 2WXJA 3GE3C 2V4IB 2D3CA 3VVWB 4ASWC 1WGDA 3DBHB 4FXCA 2M19A 4H2AA 3RNBC 2LWPA 4DDGD 1D4BA 1WGYA 2DENB 1CMXB 2LVPA 1SE9A 4A8XC 1J8CA 1L0VB 5MPOA 2BB6A 4GDKA 3DBLB 2WYQA 1WM3A 1UBIA 1ZKHA 2UYZB 3AE2B 2KTFA 4KIKA 2ZW0A 5IKCM 4HJKA 4PS3A 1I4GA 1TS5A 3A33B 2NCNA 2L0FA 2LHDA 2K25A 5JZEB 4DBGA 3ZVVA 2KWCA 3AE7B 1Q0WB 2I1KA 2ZCBA 4M0WB 2LUEA 2ASQA 4IOIE 2RPQA 4OW0A 1V2YA 4PS8A 2DAFA 2KJRA 2YVCA 2PLPA 5C23A 2C7NB 1LO5D 1NYQA 2L1AA 1RLFA 2NVUI 3UQAA 2MBHA 2O2VB 1D5XC 1L6VA 2WLBA 3I3TB 4LK0M 3RZWC 3W2DA 4MEMA 1E7PB 4C56C 3FC4A 1TBEA 3QQ8B 3UIPB 2QEJC 1WXMA 1YOVB 2DAJA 4ZRPA 1FNVA 5JHAA 1WYGA 3IT6B 2KJ6A 2NPTA 4TMAB 1YMHE 2K1FA 3AV8A 4C00A 4RNAA 1E9MA 3LYYA 1WZ0A 2NTSA 2KYWA 3VRBB 3OJ3A 1PGXA 3D32A 3Q6BA 2JPHA 2IY0B 2L7RA 1DYQA 2V3PA 4AOFA 3UGBB 4M02A 4B95A 4C7YA 3ZRFA 2ZJDA 1FXAA 4NAMA 4OVVA 4BVUC 3ECIA 3RNEC 1MI0A 3HUIA 4RGTA 3IVFA 2D3GA 4GLSC 3V3XA 1RFAA 1KTKA 3APFA 2KK8A 4FHKA 4LNIA 1VZ6A 3SHQA 1WYWB 3L10B 1B9RA 4KX6B 2A4ZA 4HDOA 4N59A 1L2NA 2CU1A 4HPLB 4ZHOA 2KLGA 1HZ5A 3DBLI 4FN2A 2EMSA 3TL5A 2Y5PA 1OQQA 5DPRA 2KC2A 3AE1B 4F8CB 1MHXA 4JE3B 1PFDA 1WR6E 3OJ4B 4FA6A 2M4NA 5BMHA 2DYOA 1P1AA 2RMMA 2KACA 4FHJA 1R7SA 5AZFA 2X8XX 3BZDB 4D2KA 1C9FA 1WGGA 3Q8FA 1OEYJ 4MDKE 5LXHA 1XLPA 1ZPSA 2IO2B 5DCNA 4K7WA 3W1SC 3W9CB 5J2RA 5AZGA 3PZ8A 1YQ3B 4C80A 2N7EA 4B0EA 3Q69A 2XK5A 5LNK1 4I6PA 2RR9A 1T0SC 3NOBA 3PHXB 2L32A 2KJHB 2V0GA 3AE6B 4HCNB 1FEHA 2CHWA 1I4XA 4L2YA 2JX5A 3AEAB 2N7JA 1XCTL 5E6OA 3PZDA 1FPYA 2NR2A 4OVUA 3KUZA 4EE2A 1VDVA 2BT6A 5JXVA 3VTWA 3UINB 4RCOA 2LEKA 3AXCA 3U30A 2KHWB 2JVCA 4RH6A 1QKZA 1I35A 1K8RB 3C8YA 3MC8A 2LD9A 3BYTB 3ZJUA 3PRMB 2LI5A 2L0TA 3K9OB 3RULA 2MJEA 2SAKA 2KLCA 4B0MA 3DWGC 4LLGM 1VZ7A 3KWVA 2Z0DB 2AYOB 3HVZA 3RNGC 4AP4C 2MP2B 2BGFA 2KFKA 4TV3A 1RRBA 1ROEA 2WXHA 4OZBA 4E3CA 4AQ7A 3PV1A 1GUAB 3CSFA 3IFWB 2JSVX 2MA9B 4GGQA 1I42A 3CF6E 3AEDB 3R3MA 2JT4B 1IUEA 4WAFA 5EE1A 3LJ3A 2BB5A 4WJNA 2KOXA 3V05A 4HVBA 2KQ7A 1UH6A 2N9EB 4I6LB 2RD0A 4JLCA 1E6EB 2HE7A 4G50A 1YIWA 1YQBA 4YSXB 2N1VA 1WXQA 3Q8AA 1P0RA 2LHEA 2O6VA 2IDYA 3ONSA 4LNNA 2L05A 1GB4A 4OZCA 3VH3B 1H4RA 5I4DA 1FFVA 2KD0A 3AMZA 1T0YA 4YXDB 2QMTA 2KVRA 1DOYA 1SB3C 3APCA 5C3JB 2LXCA 4DXGA 3Q8BA 2WXPA 3TEYA 4MSQB 3OWEB 4FULA 1AWDA 3A4RA 1TJEA 2C60A 1WFYA 4J3OD 3DHGC 4W9HA 3L0WB 3QA8A 4FJVB 1JWUD 1WGRA 3BWUD 1SE2A 2XK5B 3ML9A 1NEKB 3Q8CA 3NZ3A 2UU7A 4FBJB 3VUWA 2KKCA 2JWZA 2LGYA 3P1MA 3WALA 2MBBB 4AJWA 3PSEB 1YN3A 4E71A 1NENB 1QOGA 4NQKE 5IO9A 4KZ0A 1WM2A 1FXTB 2AQ3B 1I4RA 1EU4A 1TZOA 2WU5B 4C4VA 4ARCA 3QARA 3BK2A 3X23A 2WXLA 2PJHA 3H6NA 3KH0A 3SU8X 2EELA 3ZRCA 3PLVA 1SGHA 1YD8U 1NYRA 3DQVA 1JQ4A 1PQSA 4KKJA 1XLNA 3APDA 2LRUA 1N63A 5C2TB 4GIVA 1WXVA 3ZO5B 5TR5A 4USAA 1QLBB 3P4SB 3A9JA 3PTFC 2CJNA 1N6ZA 2WDRB 3AB5A 1J7CA 2LXAA 1GOZA 1RFKA 5J17A 3EC8A 2H89B 4PYZA 1C78A 2W55A 3Q3OC 2ON8A 5EE0A 3EUB2 1T0RC 3TJPA 1JWBD 4YTNB 4WJQA 1XXGA 3Q8EA 2KDBA 1FXIA 2NBUA 2IGDA 4LNKA 1C3TA 2L3ZA 2C5LC 1V49A 2XNAC 2WGSA 2ZZPB 3B2FA 2L76A 4BOSC 2OEDA 1YQ4B 1MJDA 2LVOA 1K53A 2AWTA 1YJJA 1FCCC 2FCQA 2L8JA 3ZNHB 4KV2A 1CZPA 2NMQA 2V9HA 2GLSA 1TS4A 2I38A 1C4CA 2N9LA 2TSSA 2OJRA 1J0GA 3E56A 3DOWA 4KKIA 4NPNA 1E0ZA 2AX5A 1YN5A 3VRAB 2DZIA 4A9AA 2PKOA 1WGKA 3VH4B 3WA0A 4BKSD 2OJWA 1WX8A 2N7DA 4ZRKA 4A20A 4NNJB 4MSMB 2G1EA 3DHHC 4WH4A 3SDLC 1N60A 1WJUA 1HZ6A 2K22A 2CR5A 2A5UA 4HPMB 3DHIC 1UD7A 4W9FA 1F77A 5FR6A 2ZNVC 3AU5A 5JH5C 3AEGB 2GI9A 2VZKD 3AE3B 4NZLB 4US8A 2ACZB 2M56B 2I2YA 4W9EA 3TMPB 1YN4A 2L00B 1VJKA 1L0YB 2K8CA 2LRWA 2DHZA 3KQ4A 3Q3FA 4XGAB 1IBXB 3ZNGC 2K6DB 2K6QA 4RF1A 3NY5A 2KO3A 1MVKA 5H8YE 1Q5WB 2ZPYA 3AEEB 4HDQA 4WAAA 2KFJA 4A3OA 1MG4A 2K0PA 3L13A 2K8HA 2FNJB 1FRRA 2WXQA 3ZYYX 3C19A 2BF8B 5FKAC 4MGZE 4XX5A 2INCC 1HQRD 4FJZA 4MACA 1C76A 4ANUA 1UZXB 3H1UA 3OAWA 3H8HA 3QAQA 1UWMA 3DVGX 4A3PA 5FR3A 4PS7A 1WJ4A 1V81A 3U4EG 4LTUA 1V1OA 1SBBB 1GG3A 3NZUA 1E5WA 1XQQA 1OGWA 3MHZA 3VFKA 1WY8A 3HVDA 4MJSA 3J9CA 2D07B 2SEBD 1TZ1A 2JU6X 3PRZA 1L6UA 2WQYB 3GS2A 3PO0A 4NQLB 4BOZB 4DK5A 2NBVB 2V3NA 3AH7A 1GB1A 1JCKB 1PYWD 4DXFA 4EOYA 1P7FA 2GBMA 1JWAD 2IGGA 4G11A 2HJ1A 1EO6A 4URKA 1E8XA 3LXFA 2M8SA 1M94A 1JMLA 5E6JA 2M17A 3N20C 2K8BA 5JHBA 3CIRB 2H88B 2FBWB 3V62A 1KLGD 1D6EC 2RDBC 4RMAA 2JZPA 4G3XB 2BBCA 1HTOA 1N5WA 1TY0A 4KVGB 4MELA 2DNFA 3VTVA 2IPKD 4WWMA 3ZXRA 2JRHA 4JPSA 1E7VA 4A55A 2IGHA 4DHZB 2PMVA 5KHOA 3FILB 1I7HA 4K7UA 2ZPNA 2QHOA 4IM2A 5DPSA 3WAMA 2HD5B 2FE8A 3MJ5A 4HEA1 4AS1A 2JUOA 4DHZE 4RGMA 4MGIE 3MC9A 4BBNF 3RMKC 2W82A 1WX9A 4LNFA 4O1NA 3PREA 4IM3A 4KDLB 2WXGA 3B2GA 4ACFA 1S3SG 2FCMA 3WAOA 4IUMB 1ENFA 1XT9B 3N3KB 4WWOA 4WIPA 4JQWC 3AE9B 3EFCA 2VH2A 4GXBA 1IP9A 3QCAA 5CHVC 3PVLA 4TQ0A 3MFGA 2REXA 4PT5A 3EGRA 4A6QA 2LGSA 3AI5A 2BYFA 3V61A 4P1CC 2KANA 3HK0A 2BS4B 1J7AA 2K3UA 3N9YC 3NVWA 5IA7A 2QC8A 1F0ZA 2HTME 4J6IA 1GAQB 3AECB 3MC0B 3ZKJC 1V8CA 4XC2A 1ZGUB 3ML8A 4OHJA 3ABVB 2KFKB 2XBBC 2PE9A 3N32A 1T0QC 3FILA 3AULA 3RYTA 3DBHI 5G5GA 3V6EB 5CTRC 1DGJA 2KDMA 1ZW7A 1FIQA 1TTNA 1IGCA 1E7UA 2GBNA 4CYEA 5CHWA 4NAWA 2MQJA 4B6WA 3I63C 3EA6A 2J42A 3B9JA 1ACCA 1WE7A 3U2SC 2C9WB 5BYQA 2DLBA 4EUTA 2BQQA 4GB9A 2DYBA 2MH7A 1IGDA 2JXTA 3NVZA 2KTRA 3KUCB 3TUOA 4NJCA 4L1BA 1L7YA 2GRIA 5IAAC 1XEEA 2WX0A 1GPXA 1V80A 3L17A 1T5XD 3T3NA 3QC8B 3M62B 1S1QB
chains in the Genus database with same CATH topology
2LZ6A 3B08A 4LCDE 3A4SC 5E6NA 3QARA 3PHWB 4ZYNA 3DCGA 3X23A 2JZZA 2NBWB 5D2MB 3WAPA 2O2VA 2PJHA 3H6NA 4FADA 2G4SA 3RD2A 3DDCB 4II3B 3KH0A 3RT3B 4W9CA 3SU8X 1GC6A 1R4NI 2BWES 3PPAA 1KJTA 4DHJB 2FUHB 2GBKA 3ZRCA 3PLVA 3R7RA 1GJZA 1SGHA 1YD8U 2W9NA 5C1ZA 2N9XA 3DQVA 5J18A 5AZHA 1PQSA 4DDID 1WR1A 3JSVA 3APDA 2VRRB 1WH3A 2C7MB 2LRUA 4PYUA 1KOTA 4HCPB 4B9KA 4GIVA 1WXVA 3ZO5B 5TR5A 2M0XA 3PTFC 3A9JA 5D94A 4LJPB 1V9JA 4MGKE 1XD3B 2M1MA 3U8ZA 1GNUA 2FIFA 3ZTDA 1LFDA 3ZW3A 4CHKA 2NS5A 2MP2A 5LXIB 1OEYA 1KM7A 2LXAA 1JRUA 2WX1A 3DVNU 1LM8B 2FCNA 5J17A 3EC8A 4PYZA 1Z2MA 4WWPA 2EMTA 3VVWB 3ZUNA 4AWJA 4ASWC 3TJPA 1WGDA 2JF5A 1UGMA 1Z5SB 4WJQA 3O65B 2KDBA 1YJ1A 2IZVB 2NBUA 2LWPA 4NJ7A 4II2B 3ZTCA 4DDGD 1G6JA 3BINA 1WGYA 1F9JA 2DENB 1CMXB 2LVPA 3H7PA 1SE9A 1EF1A 1J8CA 1C3TA 2L3ZA 3MTNB 2C5LC 4GDKA 1V49A 4DHJD 2WYQA 2DZJA 1WM3A 5CHFA 1E8ZA 1Y8RC 3P2BA 3PT2B 1UBIA 1ZKHA 2UYZB 3A1QA 2PE6B 2KTFA 2ZZPB 2L76A 4BOSC 2WDTB 4KIKA 4HJKA 2IO1B 4PS3A 4HWIB 4ZRJA 2LVOA 3EECA 1E90A 1P3QU 2AWTA 3HIZA 3A33B 3C0RB 2NCNA 2L8JA 2FCQA 3ZNHB 4KV2A 2IYDB 2JY6A 2KXJA 2JRIB 2L0FA 3PS6A 4FA6A 2K25A 5JZEB 4DBGA 3ZVVA 2GOWA 5CX3A 1TGZB 2R2OA 3VAWA 3OLMD 4ANXA 2KWCA 3W1SA 2BYVE 2V4LA 3TCAA 3RUIB 1Q0WB 1WMHA 1IPGA 2I1KA 2ZCBA 4M0WB 2LUEA 2ASQA 4YL8A 3DPDA 3JVZX 2RPQA 2OJRA 2Z0EB 1V2YA 4PS8A 1J0GA 2DAFA 2N9PC 2ZEQA 3DOWA 2KDIA 4LDTB 2KJRA 2YVCA 4G0NB 4NPNA 5C23A 1X1MA 2C7NB 1RLFA 2V1YA 2NVUI 4N9F4 3WANA 3ZDMC 3UQAA 2MBHA 4M8MA 2O2VB 2DZIA 5DPWA 1WI0A 1LXDA 3I3TB 3S2AA 2IBIB 3NS8A 3RZWC 3L08A 3H9DA 1V5TA 2KDFB 4MEMA 2PEAA 2EKEC 3VH4B 1TBEA 2R2QA 5BO4B 2LGXA 4W9DA 3WA0A 4BKSD 3QQ8B 1SIFA 3UIPB 1WX8A 1E8WA 1WXMA 2DAJA 2N7DA 5EDSA 2ZVNA 4ZRKA 4A20A 1AARA 5JHAA 4F1SA 4NNJB 1IYFA 4MSMB 2KJ6A 4MM3A 3SDLC 2NPTA 2K1FA 2G3QB 1WJUA 4BKGA 4MH0E 3KUDB 2CR5A 2KQSA 2A5UA 4WJOA 1WZ0A 2PPHA 1EUVB 1UD7A 2J7QB 3H7PB 3LDZE 3OJ3A 4HPMB 2CKHB 1LQBA 3D32A 4W9FA 2JPHA 2IY0B 4KIKB 5FR6A 1YX6B 2L7RA 2ZNVC 3AU5A 4AOFA 5JH5C 3UGBB 3VQIA 2BPSA 4B95A 3WIMA 4EKUA 3ZRFA 2Z59B 2ZJDA 1HE8A 4W9EA 4OVVA 4BVUC 2MW5A 2IO3B 1V5OA 3TMPB 2L00B 3ECIA 1WIAA 3IVFA 1C1YB 3CSTA 2D3GA 4E74A 3ZIMA 2K8CA 4GDLB 2C7HA 2LRWA 2DHZA 1RFAA 3Q3FA 2RSUA 5D7GA 3X0WA 3APFA 3ZNGC 4JIOU 2K6DB 2K6QA 2KK8A 3VDZA 4FHKA 3NY5A 2KO3A 2DX5B 2MBQA 3TBLD 3SHQA 3VUYA 1Q5WB 3MJWA 2ZPYA 1WYWB 4HDQA 4WWNA 2IY1B 3L10B 2O6VB 4WAAA 2KFJA 3UIOB 4A3OA 2KMCA 2A4ZA 4RM8A 3ZLZA 1KLVA 2LGDA 3BY4B 3L13A 5LLIA 3DBRI 3KW5B 4HDOA 1L2NA 3A9JB 2CU1A 2K8HA 2FNJB 4HPLB 3M3JA 2KLGA 3B1LX 4MJSB 4ZDVA 2BF8B 2GMIC 4MGZE 4W9IA 2KWUB 3JSVB 3DBLI 3B0AA 4FN2A 4XX5A 4TUUA 2EMSA 3TL5A 4FJZA 5DPRA 3L16A 4ANUA 2KC2A 1UZXB 1ISNA 2FAZA 1OQYA 2AEHA 3H1UA 3QJZA 3OAWA 4TQ1A 4F8CB 3NHEB 1P9DU 4GDLA 3W1YA 3QAQA 4EFOA 3DVGX 4A3PA 2MRPA 5L95C 2O6VD 1WR6E 1WJ4A 1V81A 3OJ4B 2M4NA 2OOBB 4M8NA 4PS7A 2DYOA 2GBRA 4ICVA 1GG3A 1P1AA 3NZUA 1QZEA 3ZNID 1E5WA 1XQQA 1OGWA 4FHJA 3A1QB 4DWFA 2BWFA 2FIDA 5AZFA 1WMHB 2J0MA 3ALBA 3VFKA 1WGGA 4MDKE 1OEYJ 3QHTA 3R66C 2MCNB 1WY8A 5LXHA 2XEWA 3SD5A 2G45B 4MJSA 4ANVA 3HM6X 3H7SA 4W9LA 4I6NB 3EHVA 1WGHA 4NAWB 2D07B 1TZ1A 2IO2B 1YX5B 5DCNA 4K7WA 2CS4A 3W1SC 1WZ3A 3PRZA 5J2RA 5AZGA 2V3SA 2N7EA 4NQLB 4BOZB 4DK5A 1RAXA 4AJYB 1Q1OA 2NBVB 3K9PB 4IC7B 2XK5A 3A9KB 2NPTB 4HXDA 4EOYA 2CHXA 2GBMA 4I6PA 2UWQA 4G11A 3KYCD 2BKRB 5L83A 1EO6A 2G4DB 4URKA 1E8XA 2M8SA 4K81A 2RR9A 1M94A 2KMAA 3HHMA 3NOBA 3PHXB 3IG3A 2M17A 2KJHB 3ENEA 2MLBA 2K8BA 5JHBA 4JGHB 1D3ZA 3RCZA 4HCNB 3VXWA 2K39A 4BKTA 3V62A 4GOCA 4GMVA 2HJ8A 2CHWA 4RMAA 5G55A 4XZ4A 4RM9A 4G3XB 1GC7A 2I1JA 2LJ5A 4GN1A 3ZDTA 4WQOB 3ZNZB 5E6OA 3KVFB 3PZDA 4K7SA 4LJOB 5G2NA 2J0JA 4K1RB 3Q3JA 2NR2A 4IW0A 4W9KA 4OVUA 4KVGB 4MELA 3KUZA 3M63B 3VTVA 4AUQC 3VTWA 3UINB 2JRHA 3V60A 5HKHA 1E7VA 4LDTD 2WWZA 4WJPA 3T9LA 3AXCA 4X57B 3U30A 4DHZB 2KHWB 2KTRB 5KHOA 2DYMA 2JVCA 1VD2A 1P98A 1WF9A 4K7UA 1I35A 2ZPNA 2QHOA 3NZSA 1K8RB 4IM2A 1H8CA 5DPSA 2LD9A 3WAMA 2HD5B 2D11A 2JUOA 4GDKB 4TKNA 4DHZE 4NY0A 3N30A 2ZNVB 3QK0A 2MBEA 2DZMA 3PRMB 4BKSA 4MGIE 2LI5A 2L0TA 3K9OB 4BBNF 3RULA 4BFRA 2KLCA 1WX9A 2N4FA 3PREA 4IM3A 4KDLB 4F7ZA 2DZKA 2MSED 3AU4A 2LVQA 5DPTA 2LASA 3A9KA 2MX2A 4GU2A 1V86A 3T8MA 3MHSD 1S3SG 2FCMA 2Z0DB 3KYDD 4IUMB 3WAOA 2BKFA 3VTUA 2AYOB 3V6CB 3DVGY 2AL6A 4AP4C 3M95A 2MP2B 4W9JA 4DXAB 4EZKA 1XT9B 2JZ3B 2BGFA 3N3KB 4WWOA 1V6EA 3CMMB 2KFKA 4JQWC 2MWSB 4TV3A 3VUXA 3PGEA 2KX3A 1RRBA 2KZRA 3JYUA 4GXBA 2KX0A 1IP9A 3QCAA 2MBOA 5CHVC 3PVLA 2GBJA 2ZVOA 4TQ0A 1MG8A 4E3CA 2REXA 3DVNV 3PV1A 1GUAB 3CSFA 3GZNI 1WJNA 3IFWB 2MA9B 3AI5A 2BYFA 5E6PA 4HK2A 3V61A 3IBEA 1UELA 1E8YA 2KANA 4GGQA 4MGYE 1I42A 3PLUA 3CF6E 3HK0A 3R3MA 2JT4B 2IO0B 5KHQA 3LJ3A 4WJNA 2CHZA 2KOXA 1NBFC 2Y5BB 4HLEA 5GMVA 4HVBA 5IA7A 4GSWA 2KQ7A 4J6IA 3ZKJC 1UH6A 2N9EB 4FLHA 4I6LB 2RD0A 3U7DA 4XC2A 1ZGUB 3JW0X 4JLCA 3IHPC 3ML8A 1R4MI 4KZCA 2BYEA 2HE7A 3QWZB 2KFKB 4G50A 2XBBC 1YIWA 1YQBA 3EFUA 4EZJA 2PE9A 3N32A 2B3AA 3AULA 3L54A 2N1VA 4KSKC 4NJ6A 4P7IA 1P0RA 2O6VA 4JL9A 1VCBA 3RYTA 3ONSA 1J19A 3DBHI 3V6EB 5CTRC 1OTRB 2D10A 2L05A 4BBNC 1NDDA 3VH3B 1H4RA 1WJ6A 2KD0A 1T0YA 2KC1A 1WX7A 1ZW7A 4IG7B 2KNBA 1TTNA 1EF5A 1E7UA 2GBNA 4W9GA 4CYEA 5CHWA 2KVRA 3APCA 2KDEB 4NAWA 2LXCA 3R7QA 1WRDB 2MQJA 2FCSA 1WXSA 1A5RA 4B6WA 2D2QA 4MSQB 1NI2A 4FULA 1BT0A 4EZLA 1UBQA 1WE7A 2C60A 3A4RA 1WFYA 3HM3A 3TIXA 1WE6A 4W9HA 2C9WB 4EUTA 4GB9A 2JXXA 2RGFA 3L0WB 2KWVB 2YLMA 3QA8A 4FJVB 2DYBA 5AEKB 2KN5A 3QIJA 4KSLC 3UF8A 1WGRA 2KTRA 2XK5B 3ML9A 4ZRIA 3KUCB 2ZCCA 2N1WA 4IM0A 4FBJB 1WXAA 3VUWA 3UQBA 2KKCA 2JWZA 2LGYA 3QX1A 3WALA 4CO7A 4IWOA 2MBBB 4AJWA 1L7YA 3PSEB 4E71A 5IAAC 4KDIC 4EEWA 2WX0A 1V80A 3RZFA 4NQKE 3PRPB 4ICUA 2HTHA 4IWQA 3L17A 2AL3A 4KZ0A 3VHTC 1WM2A 4FJYA 4ANWA 1FXTB 2J0KA 3GOEA 3QC8B 1U4AA 3DBSA 5D6JB 3M62B 4IWPA 1S1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LZ6 A;  3B08 A;  4LCD E;  3A4S C;  5E6N A;  3QAR A;  3PHW B;  4ZYN A;  3DCG A;  3X23 A;  2JZZ A;  2NBW B;  5D2M B;  3WAP A;  2O2V A;  2PJH A;  3H6N A;  4FAD A;  2G4S A;  3RD2 A;  3DDC B;  4II3 B;  3KH0 A;  3RT3 B;  4W9C A;  3SU8 X;  1GC6 A;  1R4N I;  2BWE S;  3PPA A;  1KJT A;  4DHJ B;  2FUH B;  2GBK A;  3ZRC A;  3PLV A;  3R7R A;  1GJZ A;  1SGH A;  1YD8 U;  2W9N A;  5C1Z A;  2N9X A;  3DQV A;  5J18 A;  5AZH A;  1PQS A;  4DDI D;  1WR1 A;  3JSV A;  3APD A;  2VRR B;  1WH3 A;  2C7M B;  2LRU A;  4PYU A;  1KOT A;  4HCP B;  4B9K A;  4GIV A;  1WXV A;  3ZO5 B;  5TR5 A;  2M0X A;  3PTF C;  3A9J A;  5D94 A;  4LJP B;  1V9J A;  4MGK E;  1XD3 B;  2M1M A;  3U8Z A;  1GNU A;  2FIF A;  3ZTD A;  1LFD A;  3ZW3 A;  4CHK A;  2NS5 A;  2MP2 A;  5LXI B;  1OEY A;  1KM7 A;  2LXA A;  1JRU A;  2WX1 A;  3DVN U;  1LM8 B;  2FCN A;  5J17 A;  3EC8 A;  4PYZ A;  1Z2M A;  4WWP A;  2EMT A;  3VVW B;  3ZUN A;  4AWJ A;  4ASW C;  3TJP A;  1WGD A;  2JF5 A;  1UGM A;  1Z5S B;  4WJQ A;  3O65 B;  2KDB A;  1YJ1 A;  2IZV B;  2NBU A;  2LWP A;  4NJ7 A;  4II2 B;  3ZTC A;  4DDG D;  1G6J A;  3BIN A;  1WGY A;  1F9J A;  2DEN B;  1CMX B;  2LVP A;  3H7P A;  1SE9 A;  1EF1 A;  1J8C A;  1C3T A;  2L3Z A;  3MTN B;  2C5L C;  4GDK A;  1V49 A;  4DHJ D;  2WYQ A;  2DZJ A;  1WM3 A;  5CHF A;  1E8Z A;  1Y8R C;  3P2B A;  3PT2 B;  1UBI A;  1ZKH A;  2UYZ B;  3A1Q A;  2PE6 B;  2KTF A;  2ZZP B;  2L76 A;  4BOS C;  2WDT B;  4KIK A;  4HJK A;  2IO1 B;  4PS3 A;  4HWI B;  4ZRJ A;  2LVO A;  3EEC A;  1E90 A;  1P3Q U;  2AWT A;  3HIZ A;  3A33 B;  3C0R B;  2NCN A;  2L8J A;  2FCQ A;  3ZNH B;  4KV2 A;  2IYD B;  2JY6 A;  2KXJ A;  2JRI B;  2L0F A;  3PS6 A;  4FA6 A;  2K25 A;  5JZE B;  4DBG A;  3ZVV A;  2GOW A;  5CX3 A;  1TGZ B;  2R2O A;  3VAW A;  3OLM D;  4ANX A;  2KWC A;  3W1S A;  2BYV E;  2V4L A;  3TCA A;  3RUI B;  1Q0W B;  1WMH A;  1IPG A;  2I1K A;  2ZCB A;  4M0W B;  2LUE A;  2ASQ A;  4YL8 A;  3DPD A;  3JVZ X;  2RPQ A;  2OJR A;  2Z0E B;  1V2Y A;  4PS8 A;  1J0G A;  2DAF A;  2N9P C;  2ZEQ A;  3DOW A;  2KDI A;  4LDT B;  2KJR A;  2YVC A;  4G0N B;  4NPN A;  5C23 A;  1X1M A;  2C7N B;  1RLF A;  2V1Y A;  2NVU I;  4N9F 4;  3WAN A;  3ZDM C;  3UQA A;  2MBH A;  4M8M A;  2O2V B;  2DZI A;  5DPW A;  1WI0 A;  1LXD A;  3I3T B;  3S2A A;  2IBI B;  3NS8 A;  3RZW C;  3L08 A;  3H9D A;  1V5T A;  2KDF B;  4MEM A;  2PEA A;  2EKE C;  3VH4 B;  1TBE A;  2R2Q A;  5BO4 B;  2LGX A;  4W9D A;  3WA0 A;  4BKS D;  3QQ8 B;  1SIF A;  3UIP B;  1WX8 A;  1E8W A;  1WXM A;  2DAJ A;  2N7D A;  5EDS A;  2ZVN A;  4ZRK A;  4A20 A;  1AAR A;  5JHA A;  4F1S A;  4NNJ B;  1IYF A;  4MSM B;  2KJ6 A;  4MM3 A;  3SDL C;  2NPT A;  2K1F A;  2G3Q B;  1WJU A;  4BKG A;  4MH0 E;  3KUD B;  2CR5 A;  2KQS A;  2A5U A;  4WJO A;  1WZ0 A;  2PPH A;  1EUV B;  1UD7 A;  2J7Q B;  3H7P B;  3LDZ E;  3OJ3 A;  4HPM B;  2CKH B;  1LQB A;  3D32 A;  4W9F A;  2JPH A;  2IY0 B;  4KIK B;  5FR6 A;  1YX6 B;  2L7R A;  2ZNV C;  3AU5 A;  4AOF A;  5JH5 C;  3UGB B;  3VQI A;  2BPS A;  4B95 A;  3WIM A;  4EKU A;  3ZRF A;  2Z59 B;  2ZJD A;  1HE8 A;  4W9E A;  4OVV A;  4BVU C;  2MW5 A;  2IO3 B;  1V5O A;  3TMP B;  2L00 B;  3ECI A;  1WIA A;  3IVF A;  1C1Y B;  3CST A;  2D3G A;  4E74 A;  3ZIM A;  2K8C A;  4GDL B;  2C7H A;  2LRW A;  2DHZ A;  1RFA A;  3Q3F A;  2RSU A;  5D7G A;  3X0W A;  3APF A;  3ZNG C;  4JIO U;  2K6D B;  2K6Q A;  2KK8 A;  3VDZ A;  4FHK A;  3NY5 A;  2KO3 A;  2DX5 B;  2MBQ A;  3TBL D;  3SHQ A;  3VUY A;  1Q5W B;  3MJW A;  2ZPY A;  1WYW B;  4HDQ A;  4WWN A;  2IY1 B;  3L10 B;  2O6V B;  4WAA A;  2KFJ A;  3UIO B;  4A3O A;  2KMC A;  2A4Z A;  4RM8 A;  3ZLZ A;  1KLV A;  2LGD A;  3BY4 B;  3L13 A;  5LLI A;  3DBR I;  3KW5 B;  4HDO A;  1L2N A;  3A9J B;  2CU1 A;  2K8H A;  2FNJ B;  4HPL B;  3M3J A;  2KLG A;  3B1L X;  4MJS B;  4ZDV A;  2BF8 B;  2GMI C;  4MGZ E;  4W9I A;  2KWU B;  3JSV B;  3DBL I;  3B0A A;  4FN2 A;  4XX5 A;  4TUU A;  2EMS A;  3TL5 A;  4FJZ A;  5DPR A;  3L16 A;  4ANU A;  2KC2 A;  1UZX B;  1ISN A;  2FAZ A;  1OQY A;  2AEH A;  3H1U A;  3QJZ A;  3OAW A;  4TQ1 A;  4F8C B;  3NHE B;  1P9D U;  4GDL A;  3W1Y A;  3QAQ A;  4EFO A;  3DVG X;  4A3P A;  2MRP A;  5L95 C;  2O6V D;  1WR6 E;  1WJ4 A;  1V81 A;  3OJ4 B;  2M4N A;  2OOB B;  4M8N A;  4PS7 A;  2DYO A;  2GBR A;  4ICV A;  1GG3 A;  1P1A A;  3NZU A;  1QZE A;  3ZNI D;  1E5W A;  1XQQ A;  1OGW A;  4FHJ A;  3A1Q B;  4DWF A;  2BWF A;  2FID A;  5AZF A;  1WMH B;  2J0M A;  3ALB A;  3VFK A;  1WGG A;  4MDK E;  1OEY J;  3QHT A;  3R66 C;  2MCN B;  1WY8 A;  5LXH A;  2XEW A;  3SD5 A;  2G45 B;  4MJS A;  4ANV A;  3HM6 X;  3H7S A;  4W9L A;  4I6N B;  3EHV A;  1WGH A;  4NAW B;  2D07 B;  1TZ1 A;  2IO2 B;  1YX5 B;  5DCN A;  4K7W A;  2CS4 A;  3W1S C;  1WZ3 A;  3PRZ A;  5J2R A;  5AZG A;  2V3S A;  2N7E A;  4NQL B;  4BOZ B;  4DK5 A;  1RAX A;  4AJY B;  1Q1O A;  2NBV B;  3K9P B;  4IC7 B;  2XK5 A;  3A9K B;  2NPT B;  4HXD A;  4EOY A;  2CHX A;  2GBM A;  4I6P A;  2UWQ A;  4G11 A;  3KYC D;  2BKR B;  5L83 A;  1EO6 A;  2G4D B;  4URK A;  1E8X A;  2M8S A;  4K81 A;  2RR9 A;  1M94 A;  2KMA A;  3HHM A;  3NOB A;  3PHX B;  3IG3 A;  2M17 A;  2KJH B;  3ENE A;  2MLB A;  2K8B A;  5JHB A;  4JGH B;  1D3Z A;  3RCZ A;  4HCN B;  3VXW A;  2K39 A;  4BKT A;  3V62 A;  4GOC A;  4GMV A;  2HJ8 A;  2CHW A;  4RMA A;  5G55 A;  4XZ4 A;  4RM9 A;  4G3X B;  1GC7 A;  2I1J A;  2LJ5 A;  4GN1 A;  3ZDT A;  4WQO B;  3ZNZ B;  5E6O A;  3KVF B;  3PZD A;  4K7S A;  4LJO B;  5G2N A;  2J0J A;  4K1R B;  3Q3J A;  2NR2 A;  4IW0 A;  4W9K A;  4OVU A;  4KVG B;  4MEL A;  3KUZ A;  3M63 B;  3VTV A;  4AUQ C;  3VTW A;  3UIN B;  2JRH A;  3V60 A;  5HKH A;  1E7V A;  4LDT D;  2WWZ A;  4WJP A;  3T9L A;  3AXC A;  4X57 B;  3U30 A;  4DHZ B;  2KHW B;  2KTR B;  5KHO A;  2DYM A;  2JVC A;  1VD2 A;  1P98 A;  1WF9 A;  4K7U A;  1I35 A;  2ZPN A;  2QHO A;  3NZS A;  1K8R B;  4IM2 A;  1H8C A;  5DPS A;  2LD9 A;  3WAM A;  2HD5 B;  2D11 A;  2JUO A;  4GDK B;  4TKN A;  4DHZ E;  4NY0 A;  3N30 A;  2ZNV B;  3QK0 A;  2MBE A;  2DZM A;  3PRM B;  4BKS A;  4MGI E;  2LI5 A;  2L0T A;  3K9O B;  4BBN F;  3RUL A;  4BFR A;  2KLC A;  1WX9 A;  2N4F A;  3PRE A;  4IM3 A;  4KDL B;  4F7Z A;  2DZK A;  2MSE D;  3AU4 A;  2LVQ A;  5DPT A;  2LAS A;  3A9K A;  2MX2 A;  4GU2 A;  1V86 A;  3T8M A;  3MHS D;  1S3S G;  2FCM A;  2Z0D B;  3KYD D;  4IUM B;  3WAO A;  2BKF A;  3VTU A;  2AYO B;  3V6C B;  3DVG Y;  2AL6 A;  4AP4 C;  3M95 A;  2MP2 B;  4W9J A;  4DXA B;  4EZK A;  1XT9 B;  2JZ3 B;  2BGF A;  3N3K B;  4WWO A;  1V6E A;  3CMM B;  2KFK A;  4JQW C;  2MWS B;  4TV3 A;  3VUX A;  3PGE A;  2KX3 A;  1RRB A;  2KZR A;  3JYU A;  4GXB A;  2KX0 A;  1IP9 A;  3QCA A;  2MBO A;  5CHV C;  3PVL A;  2GBJ A;  2ZVO A;  4TQ0 A;  1MG8 A;  4E3C A;  2REX A;  3DVN V;  3PV1 A;  1GUA B;  3CSF A;  3GZN I;  1WJN A;  3IFW B;  2MA9 B;  3AI5 A;  2BYF A;  5E6P A;  4HK2 A;  3V61 A;  3IBE A;  1UEL A;  1E8Y A;  2KAN A;  4GGQ A;  4MGY E;  1I42 A;  3PLU A;  3CF6 E;  3HK0 A;  3R3M A;  2JT4 B;  2IO0 B;  5KHQ A;  3LJ3 A;  4WJN A;  2CHZ A;  2KOX A;  1NBF C;  2Y5B B;  4HLE A;  5GMV A;  4HVB A;  5IA7 A;  4GSW A;  2KQ7 A;  4J6I A;  3ZKJ C;  1UH6 A;  2N9E B;  4FLH A;  4I6L B;  2RD0 A;  3U7D A;  4XC2 A;  1ZGU B;  3JW0 X;  4JLC A;  3IHP C;  3ML8 A;  1R4M I;  4KZC A;  2BYE A;  2HE7 A;  3QWZ B;  2KFK B;  4G50 A;  2XBB C;  1YIW A;  1YQB A;  3EFU A;  4EZJ A;  2PE9 A;  3N32 A;  2B3A A;  3AUL A;  3L54 A;  2N1V A;  4KSK C;  4NJ6 A;  4P7I A;  1P0R A;  2O6V A;  4JL9 A;  1VCB A;  3RYT A;  3ONS A;  1J19 A;  3DBH I;  3V6E B;  5CTR C;  1OTR B;  2D10 A;  2L05 A;  4BBN C;  1NDD A;  3VH3 B;  1H4R A;  1WJ6 A;  2KD0 A;  1T0Y A;  2KC1 A;  1WX7 A;  1ZW7 A;  4IG7 B;  2KNB A;  1TTN A;  1EF5 A;  1E7U A;  2GBN A;  4W9G A;  4CYE A;  5CHW A;  2KVR A;  3APC A;  2KDE B;  4NAW A;  2LXC A;  3R7Q A;  1WRD B;  2MQJ A;  2FCS A;  1WXS A;  1A5R A;  4B6W A;  2D2Q A;  4MSQ B;  1NI2 A;  4FUL A;  1BT0 A;  4EZL A;  1UBQ A;  1WE7 A;  2C60 A;  3A4R A;  1WFY A;  3HM3 A;  3TIX A;  1WE6 A;  4W9H A;  2C9W B;  4EUT A;  4GB9 A;  2JXX A;  2RGF A;  3L0W B;  2KWV B;  2YLM A;  3QA8 A;  4FJV B;  2DYB A;  5AEK B;  2KN5 A;  3QIJ A;  4KSL C;  3UF8 A;  1WGR A;  2KTR A;  2XK5 B;  3ML9 A;  4ZRI A;  3KUC B;  2ZCC A;  2N1W A;  4IM0 A;  4FBJ B;  1WXA A;  3VUW A;  3UQB A;  2KKC A;  2JWZ A;  2LGY A;  3QX1 A;  3WAL A;  4CO7 A;  4IWO A;  2MBB B;  4AJW A;  1L7Y A;  3PSE B;  4E71 A;  5IAA C;  4KDI C;  4EEW A;  2WX0 A;  1V80 A;  3RZF A;  4NQK E;  3PRP B;  4ICU A;  2HTH A;  4IWQ A;  3L17 A;  2AL3 A;  4KZ0 A;  3VHT C;  1WM2 A;  4FJY A;  4ANW A;  1FXT B;  2J0K A;  3GOE A;  3QC8 B;  1U4A A;  3DBS A;  5D6J B;  3M62 B;  4IWP A;  1S1Q B; 
#chains in the Genus database with same CATH topology
 3B08 A;  2N0S B;  5E6N A;  2JZZ A;  2PTL A;  4W9C A;  1TKE A;  1JRP A;  1KJT A;  4HPP A;  2FUH B;  3N1Z C;  5FK9 C;  4XYC A;  3R7R A;  1GJZ A;  5AUI A;  2W9N A;  5J18 A;  1TS2 A;  3SFD B;  4DDI D;  1EWY C;  2VRR B;  1WH3 A;  2C7M B;  4PYU A;  5HFY A;  4JWU C;  3KLS X;  1F2R I;  1CQV A;  4LJP B;  4MGK E;  1HA5 A;  1GNU A;  2FIF A;  3ZTD A;  2NS5 A;  3IXS A;  5LXI B;  1KM7 A;  1A70 A;  4WWP A;  2EMT A;  1PUT A;  4WUR A;  2WP9 B;  3O65 B;  1YJ1 A;  1SJE D;  2IZV B;  4NJ7 A;  4II2 B;  1NVI D;  3BIN A;  3H7P A;  1DOX A;  3IAM 1;  1KLU D;  4KGS A;  1V97 A;  3MTN B;  3R8B A;  4DHJ D;  1YJI A;  1UGJ A;  1E8Z A;  1Y8R C;  1STE A;  1CJE A;  1FM0 D;  1WSP A;  2W3S A;  1TY2 A;  4C7Z A;  4IKG A;  4HWI B;  4ZRJ A;  3P4R B;  1E90 A;  2QSD A;  1P3Q U;  3HIZ A;  1F2R C;  2IYD B;  2JY6 A;  2KXJ A;  1P7E A;  3PS6 A;  4S0R A;  2BYV E;  2V4L A;  3TCA A;  3RUI B;  1WMH A;  1IPG A;  3P63 A;  1HXY D;  2WXF A;  4YL8 A;  3ZGZ A;  1ZUD 2;  2N9P C;  2ZEQ A;  4LDT B;  2INP E;  3BVM A;  4N9F 4;  3WAN A;  3ZDM C;  3TEZ A;  2PW9 A;  2QJL A;  1QT9 A;  3S2A A;  1RM6 C;  3NS8 A;  2Y5C A;  2LFI A;  3H9D A;  3FAH A;  2KDF B;  3WCQ A;  2PEA A;  2EKE C;  2R2Q A;  2NTT A;  3LB8 C;  2WU2 B;  2WHI A;  5EDS A;  1AAR A;  1IYF A;  4US9 A;  4MM3 A;  2G3Q B;  3NJT A;  5BYS A;  4BKG A;  4MH0 E;  1JWM D;  3RNA C;  1L0X B;  1QOF A;  2PPH A;  1EUV B;  3H7P B;  2CKH B;  1LQB A;  1QIL A;  1YX6 B;  3NVY A;  3VQI A;  2BVC A;  4EKU A;  1D5M C;  1HE8 A;  2MW5 A;  2IO3 B;  4XWT A;  3NVV A;  1JRO A;  1C1Y B;  1NI3 A;  1QQR A;  4GDL B;  2C7H A;  2RSU A;  1BUI C;  1ZXH A;  3VDZ A;  2LUM A;  1SE4 A;  2DX5 B;  3R2T A;  3TBL D;  3VUY A;  3AEF B;  3MJW A;  2IY1 B;  2ICI A;  3UIO B;  1FFU A;  4RM8 A;  3ZLZ A;  1KLV A;  2LGD A;  3TEX A;  3KW5 B;  1QOA A;  3M3J A;  4OVZ A;  5BMG A;  4BAX A;  4ZDV A;  1K52 A;  3AN1 A;  3B0A A;  2PVO D;  3AE8 B;  3L16 A;  1OQY A;  3W1Y A;  1SEB D;  5HI1 A;  5L95 C;  1IBX A;  4M8N A;  2OOB B;  3GB1 A;  2GBR A;  4ICV A;  1OQR A;  3ZNI D;  4DWF A;  2BWF A;  3ALB A;  2E6X A;  3QHT A;  2MCN B;  2L83 A;  2XEW A;  1VRA B;  2G45 B;  3HM6 X;  3H7S A;  4W9L A;  4NAW B;  3ETR A;  1SE3 A;  1ET9 A;  1WZ3 A;  2V3S A;  2ZW1 A;  2BS2 B;  4KGT A;  1Q1O A;  3K9P B;  4IC7 B;  1TKG A;  2NPT B;  2JWU A;  1YNT E;  3Q3M C;  2UWQ A;  3KYC D;  2BKR B;  2G4D B;  2WDV B;  4K81 A;  4ZHP A;  3ENE A;  2WNM A;  1UWX A;  3VXW A;  2K39 A;  5IP4 D;  4BKT A;  1TT5 B;  2HJ8 A;  1FNW A;  4RM9 A;  2PIA A;  3SEB A;  1GC7 A;  2LJ5 A;  1QOB A;  4GN1 A;  1FMA D;  4WQO B;  2CJO A;  3NUH B;  4LJO B;  4P16 A;  4UDU C;  5IN7 A;  1F52 A;  4W9K A;  4Q2J A;  2WXO A;  4YTM B;  5G5H A;  4AUQ C;  1C4A A;  5HKH A;  3V60 A;  2WWZ A;  4WJP A;  1R4M B;  3T9L A;  2KTR B;  2DYM A;  1P98 A;  2WS3 B;  1H8C A;  4M00 A;  3RN9 C;  4GDK B;  2J4X A;  4NY0 A;  1K51 A;  3N30 A;  3ZQ4 A;  2MBE A;  2DZM A;  4BKS A;  4XDC A;  3U7Z A;  4BFR A;  3P42 A;  2N4F A;  3SR6 A;  5GXG B;  1C4P A;  1UF0 A;  5DPT A;  2LAS A;  1I4P A;  4GU2 A;  3AEB B;  1V86 A;  2CU3 A;  3T8M A;  4JX1 C;  3VTU A;  2WXR A;  3V6C B;  1SF0 A;  4EZK A;  2JZ3 B;  2LJI A;  4YSY B;  3VUX A;  2KX3 A;  2KZR A;  1F1H A;  5BYR A;  2MBO A;  1DOI A;  2GBJ A;  3DVN V;  2INN E;  3GZN I;  1WJN A;  1JW9 D;  1Y56 A;  1N61 A;  3RNF C;  5E6P A;  4HK2 A;  4MGY E;  3PLU A;  3KWL A;  1ET6 A;  3BVZ A;  2IO0 B;  5KHQ A;  2CHZ A;  1NBF C;  2Y5B B;  5AUK A;  4HLE A;  5GMV A;  1T6B X;  1HEZ E;  4PK1 A;  4FLH A;  3U7D A;  1ZDX A;  1R4M I;  3QWZ B;  1TKY A;  2MJD A;  3EFU A;  1PDX A;  1C77 A;  2B3A A;  1VCB A;  1QF6 A;  4MT5 A;  1JAL A;  1N5X A;  2D3A A;  4P1B C;  1BXT A;  3ZXV A;  1OTR B;  2G9H D;  1NDD A;  1WJ6 A;  2ONQ A;  4YTP B;  1E10 A;  3GE8 C;  2QIE B;  1EF5 A;  4W9G A;  4XDD A;  4YT0 B;  1A5R A;  3ZJT A;  4RGN A;  1BT0 A;  1ZOY B;  3TIX A;  1WE6 A;  2JXX A;  2RGF A;  2YLM A;  2KN5 A;  5T8I A;  4ZRI A;  2ZCC A;  1WXA A;  4M01 A;  3UQB A;  4REZ A;  5D3D A;  4CO7 A;  3U52 E;  3P4P B;  2IND C;  4EEW A;  3PRP B;  4ICU A;  3VHT C;  2DWQ A;  2AQ1 B;  4FJY A;  3GOE A;  3DBS A;  5D6J B;  4W9D A;  2LMC A;  4IWP A;  4LCD E;  3PHW B;  4ZYN A;  1PGB A;  3RNC C;  2NBW B;  4FAD A;  4II3 B;  4ZYS A;  1R4N I;  2W3R A;  5AZH A;  1C79 A;  1WR1 A;  3JSV A;  1XLO A;  1XCQ L;  1KOT A;  4B9K A;  3O13 A;  1V9J A;  2PVG C;  1XD3 B;  3U8Z A;  4TSS A;  3URY A;  1AYF A;  1I4Q A;  1LFD A;  3BVG A;  2MP2 A;  4KGR A;  2FCN A;  3RI7 C;  1TS3 A;  2X38 A;  3MP9 A;  1Z2M A;  3L4P A;  3ZUN A;  4AWJ A;  2KMM A;  2JF5 A;  1UGM A;  1Z5S B;  3ZTC A;  1G6J A;  1F9J A;  1EF1 A;  1VR9 A;  4L23 A;  2DZJ A;  5CHF A;  3P2B A;  3PT2 B;  3SFE B;  3A1Q A;  3Q14 C;  1KFY B;  2PE6 B;  2GB1 A;  4BZA A;  1EU3 A;  2WDT B;  2VH1 A;  2W54 A;  3AE4 B;  2IO1 B;  3P4Q B;  3EEC A;  2YEP B;  2XN9 C;  3C0R B;  4ARI A;  2JRI B;  2GOW A;  5CX3 A;  1TGZ B;  2R2O A;  3VAW A;  3OLM D;  4ANX A;  3RFZ B;  3W1S A;  2WXN A;  1CK1 A;  3DPD A;  3JVZ X;  2Z0E B;  5TSS A;  2WXK A;  1VLB A;  2KDI A;  5HHD G;  3I57 A;  4G0N B;  1X1M A;  2V1Y A;  2KT7 A;  1J7B A;  4M8M A;  5DPW A;  1WI0 A;  1LXD A;  1L4D B;  1MPE A;  2IBI B;  2D3B A;  2KVZ A;  1BML C;  2AQ2 B;  3L08 A;  4C4V B;  1V5T A;  5BO4 B;  1ZE3 D;  2LGX A;  1SIF A;  2J53 A;  1E8W A;  2ZVN A;  4F1S A;  2Y3A A;  3HRD D;  2QIL A;  4ZRQ A;  1EWC A;  1V1P A;  3KUD B;  2KQS A;  4WJO A;  2RPV A;  2BW2 A;  2J7Q B;  3LDZ E;  5IOI A;  2OHF A;  4KIK B;  4RFB A;  4HRS A;  2EKI A;  4MH8 A;  2BPS A;  1V1P B;  3WIM A;  3GP7 A;  2Z59 B;  2KQ4 X;  1V5O A;  3BK1 A;  1WIA A;  1XLQ A;  4K3B A;  3CST A;  4A90 A;  4E74 A;  3ZIM A;  5D7G A;  3X0W A;  4JIO U;  4LNO A;  2MBQ A;  3E9S A;  2R61 A;  4WWN A;  4N58 A;  2O6V B;  2JYT A;  1FNU A;  3OG5 A;  2KMC A;  1RWS A;  3BY4 B;  5LLI A;  3DBR I;  3A9J B;  3B1L X;  4MJS B;  2GMI C;  4W9I A;  1OFF A;  2KWU B;  3JSV B;  4TUU A;  2K5P A;  2MEK A;  2FAZ A;  1ISN A;  2AEH A;  3QJZ A;  4R3D A;  2DBY A;  4TQ1 A;  3NHE B;  1P9D U;  4GDL A;  2RDG A;  4M0W A;  4OZA A;  4EFO A;  3RPF C;  1WRI A;  2MRP A;  1ESF A;  2O6V D;  1KH0 A;  1B1Z A;  1XF5 L;  1QZE A;  4HKZ E;  3Q2A C;  3A1Q B;  5EE9 A;  2FID A;  1WMH B;  2J0M A;  3R66 C;  4DQO C;  1D5Z C;  3SD5 A;  4ANV A;  2MJ3 A;  4I6N B;  3EHV A;  2KN4 A;  1WGH A;  1YX5 B;  2CS4 A;  1HTQ A;  1RAX A;  4AJY B;  2Z8L A;  2VZK B;  1AN8 A;  3A9K B;  1XO3 A;  4HXD A;  3TEW A;  2CHX A;  4HJG E;  4JWS C;  3AM9 A;  5L83 A;  2KMA A;  3HHM A;  3IG3 A;  3T3O A;  4IDI A;  4CQN A;  2MLB A;  2BYT A;  4JGH B;  1D3Z A;  3RCZ A;  3FKY A;  4HRO A;  4GOC A;  4GMV A;  5G55 A;  4XZ4 A;  2LGI A;  2I1J A;  4MM3 B;  1T3Q A;  3ZDT A;  3ZNZ B;  4P6V F;  3KVF B;  4K7S A;  5G2N A;  2J0J A;  2BTE A;  4K1R B;  3Q3J A;  4IW0 A;  2K9X A;  2M0A A;  2KWD A;  2KAJ A;  3M63 B;  4N6E B;  1SJH D;  3UI3 A;  3N1X C;  3PZ7 A;  4LDT D;  1TYG B;  4ITK A;  4X57 B;  1VD2 A;  1JWS D;  2D5G A;  1WF9 A;  4HKQ A;  1FRD A;  3NZS A;  1SSN A;  5BMI A;  2J52 A;  2JQR B;  4RF0 A;  2D11 A;  3BII D;  2MHJ A;  4TKN A;  1FCL A;  2ZNV B;  3CWI A;  3QK0 A;  2B76 B;  4K3C A;  1L4Z B;  3R2I A;  1TIF A;  4F7Z A;  2DZK A;  2MSE D;  3AU4 A;  2LVQ A;  3A9K A;  2MX2 A;  3W5V B;  2WDQ B;  3VR8 B;  1UNS A;  3MHS D;  3KYD D;  1R4N B;  2BKF A;  1RYJ A;  3DVG Y;  2AL6 A;  3M95 A;  2HDE A;  4W9J A;  4DXA B;  1M4V A;  1V6E A;  3CMM B;  2MWS B;  3PGE A;  4WQM A;  3JYU A;  2KX0 A;  1ZP0 B;  1KRH A;  2ZVO A;  4YWG G;  1MG8 A;  1UUP A;  1FD6 A;  3W5U B;  3I5J C;  4XWW A;  3IBE A;  1UEL A;  1E8Y A;  1MFW A;  1N62 A;  1K50 A;  1Q10 A;  1MHH E;  3DWM A;  2N9K A;  4GSW A;  2RDH A;  1L5P A;  3JW0 X;  3IHP C;  1AW7 A;  4KZC A;  2YEP F;  2BYE A;  1FO4 A;  1EM7 A;  4EZJ A;  3NRZ A;  3L54 A;  3BYY B;  4NJ6 A;  4KSK C;  4P7I A;  1ZXI A;  4JL9 A;  1J19 A;  2WXI A;  2L52 A;  5HG2 A;  2D10 A;  4BBN C;  3NS1 A;  1SXT A;  2KC1 A;  1WX7 A;  4IG7 B;  3AE5 B;  2KNB A;  2WXM A;  3TSS A;  1I4H A;  1ZDV A;  3IAS 1;  2KDE B;  1VZ8 A;  3R7Q A;  1WRD B;  2FCS A;  1WXS A;  2QDF A;  2D2Q A;  1NI2 A;  4EZL A;  3HM3 A;  1UBQ A;  4XE0 A;  4YSZ B;  5H92 C;  2KWV B;  5AEK B;  3I9V 1;  3QIJ A;  4KSL C;  3UF8 A;  3ZJV A;  4IM0 A;  2N1W A;  3QX1 A;  2QCZ A;  4IWO A;  5EE3 A;  4KDI C;  4ZOH C;  4QAY A;  3RZF A;  1WWT A;  3GZN B;  2HTH A;  4IWQ A;  2FUG 1;  2AL3 A;  1LGR A;  2E3T A;  4ANW A;  2J0K A;  1KF6 B;  3IT4 B;  1U4A A;  2LZ6 A;  3A4S C;  3DCG A;  5D3I B;  5D2M B;  3WAP A;  2O2V A;  3Q3N C;  2G4S A;  3RD2 A;  4S17 A;  2IJ0 A;  3DDC B;  3RT3 B;  1GC6 A;  2BWE S;  3PPA A;  4DHJ B;  2GBK A;  5C1Z A;  1SIJ A;  2N9X A;  3VR9 B;  3N1Y C;  2Q5W D;  4HCP B;  2M0X A;  2JYE A;  5D94 A;  3DBR B;  2M1M A;  2BS3 B;  4RGO S;  3ZW3 A;  4CHK A;  3NG0 A;  1OEY A;  1PGA A;  1JRU A;  2WX1 A;  3DVN U;  1LM8 B;  2WXJ A;  3GE3 C;  2V4I B;  2D3C A;  3VVW B;  4ASW C;  1WGD A;  3DBH B;  4FXC A;  2M19 A;  4H2A A;  3RNB C;  2LWP A;  4DDG D;  1D4B A;  1WGY A;  2DEN B;  1CMX B;  2LVP A;  1SE9 A;  4A8X C;  1J8C A;  1L0V B;  5MPO A;  2BB6 A;  4GDK A;  3DBL B;  2WYQ A;  1WM3 A;  1UBI A;  1ZKH A;  2UYZ B;  3AE2 B;  2KTF A;  4KIK A;  2ZW0 A;  5IKC M;  4HJK A;  4PS3 A;  1I4G A;  1TS5 A;  3A33 B;  2NCN A;  2L0F A;  2LHD A;  2K25 A;  5JZE B;  4DBG A;  3ZVV A;  2KWC A;  3AE7 B;  1Q0W B;  2I1K A;  2ZCB A;  4M0W B;  2LUE A;  2ASQ A;  4IOI E;  2RPQ A;  4OW0 A;  1V2Y A;  4PS8 A;  2DAF A;  2KJR A;  2YVC A;  2PLP A;  5C23 A;  2C7N B;  1LO5 D;  1NYQ A;  2L1A A;  1RLF A;  2NVU I;  3UQA A;  2MBH A;  2O2V B;  1D5X C;  1L6V A;  2WLB A;  3I3T B;  4LK0 M;  3RZW C;  3W2D A;  4MEM A;  1E7P B;  4C56 C;  3FC4 A;  1TBE A;  3QQ8 B;  3UIP B;  2QEJ C;  1WXM A;  1YOV B;  2DAJ A;  4ZRP A;  1FNV A;  5JHA A;  1WYG A;  3IT6 B;  2KJ6 A;  2NPT A;  4TMA B;  1YMH E;  2K1F A;  3AV8 A;  4C00 A;  4RNA A;  1E9M A;  3LYY A;  1WZ0 A;  2NTS A;  2KYW A;  3VRB B;  3OJ3 A;  1PGX A;  3D32 A;  3Q6B A;  2JPH A;  2IY0 B;  2L7R A;  1DYQ A;  2V3P A;  4AOF A;  3UGB B;  4M02 A;  4B95 A;  4C7Y A;  3ZRF A;  2ZJD A;  1FXA A;  4NAM A;  4OVV A;  4BVU C;  3ECI A;  3RNE C;  1MI0 A;  3HUI A;  4RGT A;  3IVF A;  2D3G A;  4GLS C;  3V3X A;  1RFA A;  1KTK A;  3APF A;  2KK8 A;  4FHK A;  4LNI A;  1VZ6 A;  3SHQ A;  1WYW B;  3L10 B;  1B9R A;  4KX6 B;  2A4Z A;  4HDO A;  4N59 A;  1L2N A;  2CU1 A;  4HPL B;  4ZHO A;  2KLG A;  1HZ5 A;  3DBL I;  4FN2 A;  2EMS A;  3TL5 A;  2Y5P A;  1OQQ A;  5DPR A;  2KC2 A;  3AE1 B;  4F8C B;  1MHX A;  4JE3 B;  1PFD A;  1WR6 E;  3OJ4 B;  4FA6 A;  2M4N A;  5BMH A;  2DYO A;  1P1A A;  2RMM A;  2KAC A;  4FHJ A;  1R7S A;  5AZF A;  2X8X X;  3BZD B;  4D2K A;  1C9F A;  1WGG A;  3Q8F A;  1OEY J;  4MDK E;  5LXH A;  1XLP A;  1ZPS A;  2IO2 B;  5DCN A;  4K7W A;  3W1S C;  3W9C B;  5J2R A;  5AZG A;  3PZ8 A;  1YQ3 B;  4C80 A;  2N7E A;  4B0E A;  3Q69 A;  2XK5 A;  5LNK 1;  4I6P A;  2RR9 A;  1T0S C;  3NOB A;  3PHX B;  2L32 A;  2KJH B;  2V0G A;  3AE6 B;  4HCN B;  1FEH A;  2CHW A;  1I4X A;  4L2Y A;  2JX5 A;  3AEA B;  2N7J A;  1XCT L;  5E6O A;  3PZD A;  1FPY A;  2NR2 A;  4OVU A;  3KUZ A;  4EE2 A;  1VDV A;  2BT6 A;  5JXV A;  3VTW A;  3UIN B;  4RCO A;  2LEK A;  3AXC A;  3U30 A;  2KHW B;  2JVC A;  4RH6 A;  1QKZ A;  1I35 A;  1K8R B;  3C8Y A;  3MC8 A;  2LD9 A;  3BYT B;  3ZJU A;  3PRM B;  2LI5 A;  2L0T A;  3K9O B;  3RUL A;  2MJE A;  2SAK A;  2KLC A;  4B0M A;  3DWG C;  4LLG M;  1VZ7 A;  3KWV A;  2Z0D B;  2AYO B;  3HVZ A;  3RNG C;  4AP4 C;  2MP2 B;  2BGF A;  2KFK A;  4TV3 A;  1RRB A;  1ROE A;  2WXH A;  4OZB A;  4E3C A;  4AQ7 A;  3PV1 A;  1GUA B;  3CSF A;  3IFW B;  2JSV X;  2MA9 B;  4GGQ A;  1I42 A;  3CF6 E;  3AED B;  3R3M A;  2JT4 B;  1IUE A;  4WAF A;  5EE1 A;  3LJ3 A;  2BB5 A;  4WJN A;  2KOX A;  3V05 A;  4HVB A;  2KQ7 A;  1UH6 A;  2N9E B;  4I6L B;  2RD0 A;  4JLC A;  1E6E B;  2HE7 A;  4G50 A;  1YIW A;  1YQB A;  4YSX B;  2N1V A;  1WXQ A;  3Q8A A;  1P0R A;  2LHE A;  2O6V A;  2IDY A;  3ONS A;  4LNN A;  2L05 A;  1GB4 A;  4OZC A;  3VH3 B;  1H4R A;  5I4D A;  1FFV A;  2KD0 A;  3AMZ A;  1T0Y A;  4YXD B;  2QMT A;  2KVR A;  1DOY A;  1SB3 C;  3APC A;  5C3J B;  2LXC A;  4DXG A;  3Q8B A;  2WXP A;  3TEY A;  4MSQ B;  3OWE B;  4FUL A;  1AWD A;  3A4R A;  1TJE A;  2C60 A;  1WFY A;  4J3O D;  3DHG C;  4W9H A;  3L0W B;  3QA8 A;  4FJV B;  1JWU D;  1WGR A;  3BWU D;  1SE2 A;  2XK5 B;  3ML9 A;  1NEK B;  3Q8C A;  3NZ3 A;  2UU7 A;  4FBJ B;  3VUW A;  2KKC A;  2JWZ A;  2LGY A;  3P1M A;  3WAL A;  2MBB B;  4AJW A;  3PSE B;  1YN3 A;  4E71 A;  1NEN B;  1QOG A;  4NQK E;  5IO9 A;  4KZ0 A;  1WM2 A;  1FXT B;  2AQ3 B;  1I4R A;  1EU4 A;  1TZO A;  2WU5 B;  4C4V A;  4ARC A;  3QAR A;  3BK2 A;  3X23 A;  2WXL A;  2PJH A;  3H6N A;  3KH0 A;  3SU8 X;  2EEL A;  3ZRC A;  3PLV A;  1SGH A;  1YD8 U;  1NYR A;  3DQV A;  1JQ4 A;  1PQS A;  4KKJ A;  1XLN A;  3APD A;  2LRU A;  1N63 A;  5C2T B;  4GIV A;  1WXV A;  3ZO5 B;  5TR5 A;  4USA A;  1QLB B;  3P4S B;  3A9J A;  3PTF C;  2CJN A;  1N6Z A;  2WDR B;  3AB5 A;  1J7C A;  2LXA A;  1GOZ A;  1RFK A;  5J17 A;  3EC8 A;  2H89 B;  4PYZ A;  1C78 A;  2W55 A;  3Q3O C;  2ON8 A;  5EE0 A;  3EUB 2;  1T0R C;  3TJP A;  1JWB D;  4YTN B;  4WJQ A;  1XXG A;  3Q8E A;  2KDB A;  1FXI A;  2NBU A;  2IGD A;  4LNK A;  1C3T A;  2L3Z A;  2C5L C;  1V49 A;  2XNA C;  2WGS A;  2ZZP B;  3B2F A;  2L76 A;  4BOS C;  2OED A;  1YQ4 B;  1MJD A;  2LVO A;  1K53 A;  2AWT A;  1YJJ A;  1FCC C;  2FCQ A;  2L8J A;  3ZNH B;  4KV2 A;  1CZP A;  2NMQ A;  2V9H A;  2GLS A;  1TS4 A;  2I38 A;  1C4C A;  2N9L A;  2TSS A;  2OJR A;  1J0G A;  3E56 A;  3DOW A;  4KKI A;  4NPN A;  1E0Z A;  2AX5 A;  1YN5 A;  3VRA B;  2DZI A;  4A9A A;  2PKO A;  1WGK A;  3VH4 B;  3WA0 A;  4BKS D;  2OJW A;  1WX8 A;  2N7D A;  4ZRK A;  4A20 A;  4NNJ B;  4MSM B;  2G1E A;  3DHH C;  4WH4 A;  3SDL C;  1N60 A;  1WJU A;  1HZ6 A;  2K22 A;  2CR5 A;  2A5U A;  4HPM B;  3DHI C;  1UD7 A;  4W9F A;  1F77 A;  5FR6 A;  2ZNV C;  3AU5 A;  5JH5 C;  3AEG B;  2GI9 A;  2VZK D;  3AE3 B;  4NZL B;  4US8 A;  2ACZ B;  2M56 B;  2I2Y A;  4W9E A;  3TMP B;  1YN4 A;  2L00 B;  1VJK A;  1L0Y B;  2K8C A;  2LRW A;  2DHZ A;  3KQ4 A;  3Q3F A;  4XGA B;  1IBX B;  3ZNG C;  2K6D B;  2K6Q A;  4RF1 A;  3NY5 A;  2KO3 A;  1MVK A;  5H8Y E;  1Q5W B;  2ZPY A;  3AEE B;  4HDQ A;  4WAA A;  2KFJ A;  4A3O A;  1MG4 A;  2K0P A;  3L13 A;  2K8H A;  2FNJ B;  1FRR A;  2WXQ A;  3ZYY X;  3C19 A;  2BF8 B;  5FKA C;  4MGZ E;  4XX5 A;  2INC C;  1HQR D;  4FJZ A;  4MAC A;  1C76 A;  4ANU A;  1UZX B;  3H1U A;  3OAW A;  3H8H A;  3QAQ A;  1UWM A;  3DVG X;  4A3P A;  5FR3 A;  4PS7 A;  1WJ4 A;  1V81 A;  3U4E G;  4LTU A;  1V1O A;  1SBB B;  1GG3 A;  3NZU A;  1E5W A;  1XQQ A;  1OGW A;  3MHZ A;  3VFK A;  1WY8 A;  3HVD A;  4MJS A;  3J9C A;  2D07 B;  2SEB D;  1TZ1 A;  2JU6 X;  3PRZ A;  1L6U A;  2WQY B;  3GS2 A;  3PO0 A;  4NQL B;  4BOZ B;  4DK5 A;  2NBV B;  2V3N A;  3AH7 A;  1GB1 A;  1JCK B;  1PYW D;  4DXF A;  4EOY A;  1P7F A;  2GBM A;  1JWA D;  2IGG A;  4G11 A;  2HJ1 A;  1EO6 A;  4URK A;  1E8X A;  3LXF A;  2M8S A;  1M94 A;  1JML A;  5E6J A;  2M17 A;  3N20 C;  2K8B A;  5JHB A;  3CIR B;  2H88 B;  2FBW B;  3V62 A;  1KLG D;  1D6E C;  2RDB C;  4RMA A;  2JZP A;  4G3X B;  2BBC A;  1HTO A;  1N5W A;  1TY0 A;  4KVG B;  4MEL A;  2DNF A;  3VTV A;  2IPK D;  4WWM A;  3ZXR A;  2JRH A;  4JPS A;  1E7V A;  4A55 A;  2IGH A;  4DHZ B;  2PMV A;  5KHO A;  3FIL B;  1I7H A;  4K7U A;  2ZPN A;  2QHO A;  4IM2 A;  5DPS A;  3WAM A;  2HD5 B;  2FE8 A;  3MJ5 A;  4HEA 1;  4AS1 A;  2JUO A;  4DHZ E;  4RGM A;  4MGI E;  3MC9 A;  4BBN F;  3RMK C;  2W82 A;  1WX9 A;  4LNF A;  4O1N A;  3PRE A;  4IM3 A;  4KDL B;  2WXG A;  3B2G A;  4ACF A;  1S3S G;  2FCM A;  3WAO A;  4IUM B;  1ENF A;  1XT9 B;  3N3K B;  4WWO A;  4WIP A;  4JQW C;  3AE9 B;  3EFC A;  2VH2 A;  4GXB A;  1IP9 A;  3QCA A;  5CHV C;  3PVL A;  4TQ0 A;  3MFG A;  2REX A;  4PT5 A;  3EGR A;  4A6Q A;  2LGS A;  3AI5 A;  2BYF A;  3V61 A;  4P1C C;  2KAN A;  3HK0 A;  2BS4 B;  1J7A A;  2K3U A;  3N9Y C;  3NVW A;  5IA7 A;  2QC8 A;  1F0Z A;  2HTM E;  4J6I A;  1GAQ B;  3AEC B;  3MC0 B;  3ZKJ C;  1V8C A;  4XC2 A;  1ZGU B;  3ML8 A;  4OHJ A;  3ABV B;  2KFK B;  2XBB C;  2PE9 A;  3N32 A;  1T0Q C;  3FIL A;  3AUL A;  3RYT A;  3DBH I;  5G5G A;  3V6E B;  5CTR C;  1DGJ A;  2KDM A;  1ZW7 A;  1FIQ A;  1TTN A;  1IGC A;  1E7U A;  2GBN A;  4CYE A;  5CHW A;  4NAW A;  2MQJ A;  4B6W A;  3I63 C;  3EA6 A;  2J42 A;  3B9J A;  1ACC A;  1WE7 A;  3U2S C;  2C9W B;  5BYQ A;  2DLB A;  4EUT A;  2BQQ A;  4GB9 A;  2DYB A;  2MH7 A;  1IGD A;  2JXT A;  3NVZ A;  2KTR A;  3KUC B;  3TUO A;  4NJC A;  4L1B A;  1L7Y A;  2GRI A;  5IAA C;  1XEE A;  2WX0 A;  1GPX A;  1V80 A;  3L17 A;  1T5X D;  3T3N A;  3QC8 B;  3M62 B;  1S1Q B; 
#chains in the Genus database with same CATH homology
 2LZ6 A;  3B08 A;  4LCD E;  3A4S C;  5E6N A;  3QAR A;  3PHW B;  4ZYN A;  3DCG A;  3X23 A;  2JZZ A;  2NBW B;  5D2M B;  3WAP A;  2O2V A;  2PJH A;  3H6N A;  4FAD A;  2G4S A;  3RD2 A;  3DDC B;  4II3 B;  3KH0 A;  3RT3 B;  4W9C A;  3SU8 X;  1GC6 A;  1R4N I;  2BWE S;  3PPA A;  1KJT A;  4DHJ B;  2FUH B;  2GBK A;  3ZRC A;  3PLV A;  3R7R A;  1GJZ A;  1SGH A;  1YD8 U;  2W9N A;  5C1Z A;  2N9X A;  3DQV A;  5J18 A;  5AZH A;  1PQS A;  4DDI D;  1WR1 A;  3JSV A;  3APD A;  2VRR B;  1WH3 A;  2C7M B;  2LRU A;  4PYU A;  1KOT A;  4HCP B;  4B9K A;  4GIV A;  1WXV A;  3ZO5 B;  5TR5 A;  2M0X A;  3PTF C;  3A9J A;  5D94 A;  4LJP B;  1V9J A;  4MGK E;  1XD3 B;  2M1M A;  3U8Z A;  1GNU A;  2FIF A;  3ZTD A;  1LFD A;  3ZW3 A;  4CHK A;  2NS5 A;  2MP2 A;  5LXI B;  1OEY A;  1KM7 A;  2LXA A;  1JRU A;  2WX1 A;  3DVN U;  1LM8 B;  2FCN A;  5J17 A;  3EC8 A;  4PYZ A;  1Z2M A;  4WWP A;  2EMT A;  3VVW B;  3ZUN A;  4AWJ A;  4ASW C;  3TJP A;  1WGD A;  2JF5 A;  1UGM A;  1Z5S B;  4WJQ A;  3O65 B;  2KDB A;  1YJ1 A;  2IZV B;  2NBU A;  2LWP A;  4NJ7 A;  4II2 B;  3ZTC A;  4DDG D;  1G6J A;  3BIN A;  1WGY A;  1F9J A;  2DEN B;  1CMX B;  2LVP A;  3H7P A;  1SE9 A;  1EF1 A;  1J8C A;  1C3T A;  2L3Z A;  3MTN B;  2C5L C;  4GDK A;  1V49 A;  4DHJ D;  2WYQ A;  2DZJ A;  1WM3 A;  5CHF A;  1E8Z A;  1Y8R C;  3P2B A;  3PT2 B;  1UBI A;  1ZKH A;  2UYZ B;  3A1Q A;  2PE6 B;  2KTF A;  2ZZP B;  2L76 A;  4BOS C;  2WDT B;  4KIK A;  4HJK A;  2IO1 B;  4PS3 A;  4HWI B;  4ZRJ A;  2LVO A;  3EEC A;  1E90 A;  1P3Q U;  2AWT A;  3HIZ A;  3A33 B;  3C0R B;  2NCN A;  2L8J A;  2FCQ A;  3ZNH B;  4KV2 A;  2IYD B;  2JY6 A;  2KXJ A;  2JRI B;  2L0F A;  3PS6 A;  4FA6 A;  2K25 A;  5JZE B;  4DBG A;  3ZVV A;  2GOW A;  5CX3 A;  1TGZ B;  2R2O A;  3VAW A;  3OLM D;  4ANX A;  2KWC A;  3W1S A;  2BYV E;  2V4L A;  3TCA A;  3RUI B;  1Q0W B;  1WMH A;  1IPG A;  2I1K A;  2ZCB A;  4M0W B;  2LUE A;  2ASQ A;  4YL8 A;  3DPD A;  3JVZ X;  2RPQ A;  2OJR A;  2Z0E B;  1V2Y A;  4PS8 A;  1J0G A;  2DAF A;  2N9P C;  2ZEQ A;  3DOW A;  2KDI A;  4LDT B;  2KJR A;  2YVC A;  4G0N B;  4NPN A;  5C23 A;  1X1M A;  2C7N B;  1RLF A;  2V1Y A;  2NVU I;  4N9F 4;  3WAN A;  3ZDM C;  3UQA A;  2MBH A;  4M8M A;  2O2V B;  2DZI A;  5DPW A;  1WI0 A;  1LXD A;  3I3T B;  3S2A A;  2IBI B;  3NS8 A;  3RZW C;  3L08 A;  3H9D A;  1V5T A;  2KDF B;  4MEM A;  2PEA A;  2EKE C;  3VH4 B;  1TBE A;  2R2Q A;  5BO4 B;  2LGX A;  4W9D A;  3WA0 A;  4BKS D;  3QQ8 B;  1SIF A;  3UIP B;  1WX8 A;  1E8W A;  1WXM A;  2DAJ A;  2N7D A;  5EDS A;  2ZVN A;  4ZRK A;  4A20 A;  1AAR A;  5JHA A;  4F1S A;  4NNJ B;  1IYF A;  4MSM B;  2KJ6 A;  4MM3 A;  3SDL C;  2NPT A;  2K1F A;  2G3Q B;  1WJU A;  4BKG A;  4MH0 E;  3KUD B;  2CR5 A;  2KQS A;  2A5U A;  4WJO A;  1WZ0 A;  2PPH A;  1EUV B;  1UD7 A;  2J7Q B;  3H7P B;  3LDZ E;  3OJ3 A;  4HPM B;  2CKH B;  1LQB A;  3D32 A;  4W9F A;  2JPH A;  2IY0 B;  4KIK B;  5FR6 A;  1YX6 B;  2L7R A;  2ZNV C;  3AU5 A;  4AOF A;  5JH5 C;  3UGB B;  3VQI A;  2BPS A;  4B95 A;  3WIM A;  4EKU A;  3ZRF A;  2Z59 B;  2ZJD A;  1HE8 A;  4W9E A;  4OVV A;  4BVU C;  2MW5 A;  2IO3 B;  1V5O A;  3TMP B;  2L00 B;  3ECI A;  1WIA A;  3IVF A;  1C1Y B;  3CST A;  2D3G A;  4E74 A;  3ZIM A;  2K8C A;  4GDL B;  2C7H A;  2LRW A;  2DHZ A;  1RFA A;  3Q3F A;  2RSU A;  5D7G A;  3X0W A;  3APF A;  3ZNG C;  4JIO U;  2K6D B;  2K6Q A;  2KK8 A;  3VDZ A;  4FHK A;  3NY5 A;  2KO3 A;  2DX5 B;  2MBQ A;  3TBL D;  3SHQ A;  3VUY A;  1Q5W B;  3MJW A;  2ZPY A;  1WYW B;  4HDQ A;  4WWN A;  2IY1 B;  3L10 B;  2O6V B;  4WAA A;  2KFJ A;  3UIO B;  4A3O A;  2KMC A;  2A4Z A;  4RM8 A;  3ZLZ A;  1KLV A;  2LGD A;  3BY4 B;  3L13 A;  5LLI A;  3DBR I;  3KW5 B;  4HDO A;  1L2N A;  3A9J B;  2CU1 A;  2K8H A;  2FNJ B;  4HPL B;  3M3J A;  2KLG A;  3B1L X;  4MJS B;  4ZDV A;  2BF8 B;  2GMI C;  4MGZ E;  4W9I A;  2KWU B;  3JSV B;  3DBL I;  3B0A A;  4FN2 A;  4XX5 A;  4TUU A;  2EMS A;  3TL5 A;  4FJZ A;  5DPR A;  3L16 A;  4ANU A;  2KC2 A;  1UZX B;  1ISN A;  2FAZ A;  1OQY A;  2AEH A;  3H1U A;  3QJZ A;  3OAW A;  4TQ1 A;  4F8C B;  3NHE B;  1P9D U;  4GDL A;  3W1Y A;  3QAQ A;  4EFO A;  3DVG X;  4A3P A;  2MRP A;  5L95 C;  2O6V D;  1WR6 E;  1WJ4 A;  1V81 A;  3OJ4 B;  2M4N A;  2OOB B;  4M8N A;  4PS7 A;  2DYO A;  2GBR A;  4ICV A;  1GG3 A;  1P1A A;  3NZU A;  1QZE A;  3ZNI D;  1E5W A;  1XQQ A;  1OGW A;  4FHJ A;  3A1Q B;  4DWF A;  2BWF A;  2FID A;  5AZF A;  1WMH B;  2J0M A;  3ALB A;  3VFK A;  1WGG A;  4MDK E;  1OEY J;  3QHT A;  3R66 C;  2MCN B;  1WY8 A;  5LXH A;  2XEW A;  3SD5 A;  2G45 B;  4MJS A;  4ANV A;  3HM6 X;  3H7S A;  4W9L A;  4I6N B;  3EHV A;  1WGH A;  4NAW B;  2D07 B;  1TZ1 A;  2IO2 B;  1YX5 B;  5DCN A;  4K7W A;  2CS4 A;  3W1S C;  1WZ3 A;  3PRZ A;  5J2R A;  5AZG A;  2V3S A;  2N7E A;  4NQL B;  4BOZ B;  4DK5 A;  1RAX A;  4AJY B;  1Q1O A;  2NBV B;  3K9P B;  4IC7 B;  2XK5 A;  3A9K B;  2NPT B;  4HXD A;  4EOY A;  2CHX A;  2GBM A;  4I6P A;  2UWQ A;  4G11 A;  3KYC D;  2BKR B;  5L83 A;  1EO6 A;  2G4D B;  4URK A;  1E8X A;  2M8S A;  4K81 A;  2RR9 A;  1M94 A;  2KMA A;  3HHM A;  3NOB A;  3PHX B;  3IG3 A;  2M17 A;  2KJH B;  3ENE A;  2MLB A;  2K8B A;  5JHB A;  4JGH B;  1D3Z A;  3RCZ A;  4HCN B;  3VXW A;  2K39 A;  4BKT A;  3V62 A;  4GOC A;  4GMV A;  2HJ8 A;  2CHW A;  4RMA A;  5G55 A;  4XZ4 A;  4RM9 A;  4G3X B;  1GC7 A;  2I1J A;  2LJ5 A;  4GN1 A;  3ZDT A;  4WQO B;  3ZNZ B;  5E6O A;  3KVF B;  3PZD A;  4K7S A;  4LJO B;  5G2N A;  2J0J A;  4K1R B;  3Q3J A;  2NR2 A;  4IW0 A;  4W9K A;  4OVU A;  4KVG B;  4MEL A;  3KUZ A;  3M63 B;  3VTV A;  4AUQ C;  3VTW A;  3UIN B;  2JRH A;  3V60 A;  5HKH A;  1E7V A;  4LDT D;  2WWZ A;  4WJP A;  3T9L A;  3AXC A;  4X57 B;  3U30 A;  4DHZ B;  2KHW B;  2KTR B;  5KHO A;  2DYM A;  2JVC A;  1VD2 A;  1P98 A;  1WF9 A;  4K7U A;  1I35 A;  2ZPN A;  2QHO A;  3NZS A;  1K8R B;  4IM2 A;  1H8C A;  5DPS A;  2LD9 A;  3WAM A;  2HD5 B;  2D11 A;  2JUO A;  4GDK B;  4TKN A;  4DHZ E;  4NY0 A;  3N30 A;  2ZNV B;  3QK0 A;  2MBE A;  2DZM A;  3PRM B;  4BKS A;  4MGI E;  2LI5 A;  2L0T A;  3K9O B;  4BBN F;  3RUL A;  4BFR A;  2KLC A;  1WX9 A;  2N4F A;  3PRE A;  4IM3 A;  4KDL B;  4F7Z A;  2DZK A;  2MSE D;  3AU4 A;  2LVQ A;  5DPT A;  2LAS A;  3A9K A;  2MX2 A;  4GU2 A;  1V86 A;  3T8M A;  3MHS D;  1S3S G;  2FCM A;  2Z0D B;  3KYD D;  4IUM B;  3WAO A;  2BKF A;  3VTU A;  2AYO B;  3V6C B;  3DVG Y;  2AL6 A;  4AP4 C;  3M95 A;  2MP2 B;  4W9J A;  4DXA B;  4EZK A;  1XT9 B;  2JZ3 B;  2BGF A;  3N3K B;  4WWO A;  1V6E A;  3CMM B;  2KFK A;  4JQW C;  2MWS B;  4TV3 A;  3VUX A;  3PGE A;  2KX3 A;  1RRB A;  2KZR A;  3JYU A;  4GXB A;  2KX0 A;  1IP9 A;  3QCA A;  2MBO A;  5CHV C;  3PVL A;  2GBJ A;  2ZVO A;  4TQ0 A;  1MG8 A;  4E3C A;  2REX A;  3DVN V;  3PV1 A;  1GUA B;  3CSF A;  3GZN I;  1WJN A;  3IFW B;  2MA9 B;  3AI5 A;  2BYF A;  5E6P A;  4HK2 A;  3V61 A;  3IBE A;  1UEL A;  1E8Y A;  2KAN A;  4GGQ A;  4MGY E;  1I42 A;  3PLU A;  3CF6 E;  3HK0 A;  3R3M A;  2JT4 B;  2IO0 B;  5KHQ A;  3LJ3 A;  4WJN A;  2CHZ A;  2KOX A;  1NBF C;  2Y5B B;  4HLE A;  5GMV A;  4HVB A;  5IA7 A;  4GSW A;  2KQ7 A;  4J6I A;  3ZKJ C;  1UH6 A;  2N9E B;  4FLH A;  4I6L B;  2RD0 A;  3U7D A;  4XC2 A;  1ZGU B;  3JW0 X;  4JLC A;  3IHP C;  3ML8 A;  1R4M I;  4KZC A;  2BYE A;  2HE7 A;  3QWZ B;  2KFK B;  4G50 A;  2XBB C;  1YIW A;  1YQB A;  3EFU A;  4EZJ A;  2PE9 A;  3N32 A;  2B3A A;  3AUL A;  3L54 A;  2N1V A;  4KSK C;  4NJ6 A;  4P7I A;  1P0R A;  2O6V A;  4JL9 A;  1VCB A;  3RYT A;  3ONS A;  1J19 A;  3DBH I;  3V6E B;  5CTR C;  1OTR B;  2D10 A;  2L05 A;  4BBN C;  1NDD A;  3VH3 B;  1H4R A;  1WJ6 A;  2KD0 A;  1T0Y A;  2KC1 A;  1WX7 A;  1ZW7 A;  4IG7 B;  2KNB A;  1TTN A;  1EF5 A;  1E7U A;  2GBN A;  4W9G A;  4CYE A;  5CHW A;  2KVR A;  3APC A;  2KDE B;  4NAW A;  2LXC A;  3R7Q A;  1WRD B;  2MQJ A;  2FCS A;  1WXS A;  1A5R A;  4B6W A;  2D2Q A;  4MSQ B;  1NI2 A;  4FUL A;  1BT0 A;  4EZL A;  1UBQ A;  1WE7 A;  2C60 A;  3A4R A;  1WFY A;  3HM3 A;  3TIX A;  1WE6 A;  4W9H A;  2C9W B;  4EUT A;  4GB9 A;  2JXX A;  2RGF A;  3L0W B;  2KWV B;  2YLM A;  3QA8 A;  4FJV B;  2DYB A;  5AEK B;  2KN5 A;  3QIJ A;  4KSL C;  3UF8 A;  1WGR A;  2KTR A;  2XK5 B;  3ML9 A;  4ZRI A;  3KUC B;  2ZCC A;  2N1W A;  4IM0 A;  4FBJ B;  1WXA A;  3VUW A;  3UQB A;  2KKC A;  2JWZ A;  2LGY A;  3QX1 A;  3WAL A;  4CO7 A;  4IWO A;  2MBB B;  4AJW A;  1L7Y A;  3PSE B;  4E71 A;  5IAA C;  4KDI C;  4EEW A;  2WX0 A;  1V80 A;  3RZF A;  4NQK E;  3PRP B;  4ICU A;  2HTH A;  4IWQ A;  3L17 A;  2AL3 A;  4KZ0 A;  3VHT C;  1WM2 A;  4FJY A;  4ANW A;  1FXT B;  2J0K A;  3GOE A;  3QC8 B;  1U4A A;  3DBS A;  5D6J B;  3M62 B;  4IWP A;  1S1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...