3V62A

Structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
73
Chain Sequence
PETHINLVSDGSSEIFFITTPLRRLMEAFARQGEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
total genus 11
structure length 73
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v62A00
1WM3A 2XK5B 1V9JA 2ZEQA 4ANVA 3PLVA 3CSTA 1WRDB 3QQ8B 5AZGA 2IY0B 4MGZE 4BKSD 2KMAA 2MBOA 2MQJA 1Z2MA 4HDOA 3NZSA 2PE9A 4BKTA 1SE9A 4DK5A 2LVOA 3A9JA 1E7VA 1LQBA 1I35A 4AUQC 2LGXA 4ASWC 2Z0DB 3MTNB 4NAWA 2N9XA 2DX5B 5AEKB 3ZO5B 4W9CA 4BBNC 1V49A 1V5TA 2DYOA 2DZJA 2WX1A 2KX0A 3KUCB 4W9GA 5IAAC 3VXWA 4GXBA 1ISNA 3DDCB 4LDTB 3PHXB 4MGYE 1UGMA 4KV2A 2DZMA 2NPTB 4W9JA 2JRIB 1PQSA 1UH6A 2KJ6A 2IO1B 2MP2B 4FULA 1E8XA 3A33B 4DXAB 3BINA 2MW5A 1HE8A 4KSLC 3HM3A 2HD5B 2N1VA 1E8YA 3L54A 3QCAA 5LXIB 2L0TA 3PHWB 3UF8A 3V61A 3PRZA 2LUEA 2G45B 2I1KA 2R2QA 1E8ZA 4MELA 3DBHI 1NI2A 2QHOA 1YQBA 4WJPA 4AP4C 4RM8A 4PYUA 1WGRA 1Q1OA 4EZKA 4W9EA 5L95C 2WX0A 2LRWA 1WE7A 4B6WA 3IBEA 5BO4B 1WJ6A 2L8JA 4ANXA 4TQ1A 2MWSB 3P2BA 2J0MA 3NS8A 4NAWB 4NJ6A 4GMVA 1T0YA 2C7MB 3IVFA 3SU8X 2KD0A 2KK8A 2J0JA 2D10A 3L0WB 2LI5A 3ZNGC 4AOFA 4MSMB 3RZFA 3HHMA 2MCNB 2KWCA 1WJUA 5DPWA 2ZNVB 4G3XB 3Q3JA 2KX3A 2WWZA 3IFWB 2N7EA 5CHWA 2IYDB 4DBGA 2NVUI 4ZDVA 4HXDA 3PT2B 4KDIC 2MRPA 4YL8A 3VUXA 4A20A 5AZFA 4IG7B 4G0NB 3ZTDA 2RGFA 4URKA 3VDZA 2KWVB 4WAAA 2DZKA 3RUIB 4MDKE 4XX5A 2IBIB 4N9F4 3SD5A 3APCA 3SHQA 3CSFA 2ZJDA 2LGDA 1YJ1A 4KDLB 2G3QB 3ZTCA 3M3JA 2KFKB 3RZWC 1KM7A 1WYWB 3N32A 2O6VB 3TIXA 2K8CA 4KZCA 4HPLB 4IM2A 2BYVE 2KDIA 4HWIB 1V81A 1AARA 3UGBB 3WAMA 2FCSA 2D11A 1RRBA 2JZZA 2D3GA 1WGHA 3RT3B 2XBBC 1VCBA 1E8WA 4HLEA 2LVPA 4TUUA 1V80A 4EEWA 4PYZA 3R7RA 4BKGA 3NY5A 3W1SA 1MG8A 3QARA 4CO7A 3PZDA 1F9JA 1WGYA 2A5UA 4IM0A 3ML9A 4DHJD 5IA7A 1WI0A 3PS6A 3D32A 2M17A 4IWOA 3PRMB 2K8BA 3W1SC 2NBVB 3B08A 5E6NA 3A9JB 3LJ3A 3GZNI 3QK0A 4BOSC 2JT4B 3APDA 3RD2A 5KHOA 2K1FA 1V86A 2K25A 3ZNHB 3RCZA 4FHJA 1IP9A 4EKUA 2EMSA 3EFUA 2Z0EB 3VH3B 1OGWA 4HJKA 4JLCA 3AU5A 3JW0X 4KZ0A 2KJRA 3KUZA 1WX7A 1EO6A 4KIKB 1E5WA 2L05A 4FADA 3IHPC 1WMHA 3ZLZA 4NNJB 4LJOB 2KKCA 1GC7A 4TKNA 2OJRA 3ZDMC 2K6DB 3VHTC 1SIFA 2N1WA 2O2VA 3UIPB 4F1SA 2KOXA 2C5LC 4KSKC 4WJNA 4EOYA 1BT0A 3ZVVA 2LRUA 4K7UA 2M4NA 3A9KA 4W9HA 2CHZA 4DWFA 3GOEA 4XC2A 3PRPB 1P0RA 2D2QA 4PS7A 4XZ4A 3VUWA 3PGEA 2LD9A 4DHZE 4CYEA 1WR1A 2GBJA 3H1UA 4NQLB 5C1ZA 3DQVA 4JQWC 2KMCA 1WZ3A 1WM2A 3QIJA 4MJSA 5LLIA 3WANA 1WJ4A 3TCAA 2BPSA 2KFJA 1WR6E 4AJWA 2FUHB 3R3MA 3DPDA 3K9PB 3QHTA 1RLFA 2Z59B 3L10B 2NCNA 2BYEA 1WXVA 2L0FA 1RAXA 2JY6A 2JZ3B 4WQOB 3ZW3A 4DDGD 3K9OB 3QWZB 2AEHA 4ICVA 2LJ5A 2UWQA 2BWES 2CHWA 4GDLA 2J7QB 3WAOA 2MSED 1TTNA 2EMTA 5CHFA 1EUVB 3A9KB 3ZUNA 4GU2A 2GMIC 4MGKE 3EECA 2PJHA 4W9KA 4KVGB 4JGHB 3PVLA 3DOWA 4IW0A 1WXAA 4MEMA 5J17A 1WE6A 5DPRA 2MBBB 4M8NA 3N30A 3R66C 1XT9B 3ML8A 4IWQA 2O6VA 4AWJA 3EHVA 4DDID 3VTUA 4K7SA 5D7GA 2YLMA 2NPTA 3ZIMA 1P98A 2HE7A 4LDTD 1UBQA 3I3TB 4GOCA 1Z5SB 2LXAA 2MX2A 2N4FA 5LXHA 3DBLI 3IG3A 4HCPB 2K8HA 4PS3A 3ECIA 5G2NA 4IUMB 2ZCBA 5E6OA 2CKHB 2V1YA 4GDLB 3VH4B 2BF8B 2KC2A 5CHVC 1S3SG 4EZJA 2GBNA 1WIAA 2DAJA 4JL9A 2M1MA 2KTRB 1GG3A 3PPAA 2MA9B 3HIZA 4HDQA 1UELA 3U30A 2AYOB 2DYBA 1GJZA 1CMXB 2PPHA 2ZPYA 3H7PB 1E7UA 3AI5A 3T8MA 3TL5A 3B0AA 2KQ7A 4FJVB 2DAFA 2PEAA 4LJPB 2YVCA 2LGYA 3DVNV 1G6JA 4K81A 1K8RB 2GBRA 2V4LA 4PS8A 1UD7A 2BWFA 2C9WB 1LM8B 4MM3A 4KIKA 2LVQA 4M0WB 2GOWA 4OVVA 1D3ZA 3L08A 4NY0A 4BOZB 4GDKB 1KOTA 2C7HA 2EKEC 3VQIA 2AL3A 3OJ3A 2JPHA 4DHJB 4TV3A 2L3ZA 4W9DA 4RMAA 3LDZE 4E71A 3JVZX 3UINB 2KDBA 4FHKA 4BBNF 3DBRI 1WJNA 3TJPA 3ZNID 1EF1A 4E74A 4DHZB 1WFYA 1OQYA 1ZW7A 5G55A 2KLGA 4TQ0A 4IM3A 2IZVB 5FR6A 3KYCD 3L13A 2ZVOA 2IY1B 2B3AA 3A4RA 3PSEB 1U4AA 5D94A 2KNBA 2KXJA 4WWNA 3PTFC 4I6NB 5CX3A 2NBUA 3WALA 4GIVA 2KTFA 3QX1A 3EC8A 5JZEB 2KJHB 3CMMB 2LWPA 1ZGUB 1WXSA 3NZUA 3TMPB 3O65B 2MBEA 3R7QA 1OEYJ 2OOBB 4X57B 4BKSA 4GN1A 4E3CA 3M95A 4ZRJA 1H8CA 1LXDA 4LCDE 5J18A 1SGHA 2KZRA 2REXA 3V6CB 3WA0A 2BKFA 1P1AA 1R4MI 2HTHA 2VRRB 2J0KA 5DPTA 1I42A 3HK0A 3UQAA 1WY8A 2FCMA 2ZNVC 1L7YA 4II3B 4EZLA 1Q5WB 4P7IA 2RD0A 4FJZA 1GC6A 4FBJB 1RFAA 1M94A 3S2AA 1J0GA 3JSVA 1WZ0A 3L17A 2JUOA 3WAPA 2CS4A 4ANWA 4W9IA 1X1MA 2FCNA 2KLCA 1KJTA 4MSQB 4GGQA 3H9DA 5AZHA 3X0WA 2JWZA 4NQKE 2V3SA 3L16A 1IPGA 1WX8A 5GMVA 4OVUA 2D07B 2O2VB 3ZRFA 2FIFA 3X23A 1V5OA 3OAWA 3BY4B 3MHSD 2L7RA 5CTRC 3QA8A 4ZRIA 2IO3B 3HM6X 1WXMA 2KDEB 2XEWA 3KVFB 4ZYNA 3VTVA 3ZKJC 2JVCA 3W1YA 4HPMB 1TBEA 5E6PA 1KLVA 1UZXB 3U8ZA 2NBWB 3RYTA 2KQSA 2KWUB 2DHZA 3CF6E 3QC8B 5J2RA 2CU1A 4K7WA 2JRHA 4W9FA 1GUAB 1TZ1A 2LZ6A 4MJSB 3ONSA 5DPSA 1ZKHA 4NPNA 4IC7B 4A3OA 5L83A 3N3KB 2JXXA 3RULA 4HVBA 1WX9A 5JHAA 3JSVB 1NBFC 2IO2B 1Y8RC 3V62A 1J8CA 2C60A 2L00B 4J6IA 1OTRB 4HCNB 3NHEB 3KUDB 2UYZB 5D2MB 2FIDA 1WGGA 2CHXA 3AU4A 3OJ4B 4B95A 2ASQA 2FAZA 2ZPNA 4WWOA 3DVNU 2IO0B 4EUTA 1UBIA 2KFKA 1TGZB 4W9LA 1WH3A 3C0RB 3ALBA 4NJ7A 2R2OA 3H7SA 2K6QA 1J19A 1V2YA 2GBKA 3M63B 4WJOA 4B9KA 2KO3A 1JRUA 2HJ8A 3KYDD 2JF5A 2MP2A 2NR2A 2WYQA 2M8SA 3PV1A 1WF9A 3ZDTA 3AXCA 4G11A 4K1RB 3H6NA 1YD8U 4IWPA 3ZRCA 2DZIA 2CR5A 5C23A 3KW5B 3Q3FA 1C3TA 3MJWA 1L2NA 2N9EB 1NDDA 3UQBA 4I6LB 1YX6B 2RR9A 4JIOU 1GNUA 1WMHB 1YX5B 2I1JA 3OLMD 4ANUA 1OEYA 1V6EA 2O6VD 1H4RA 2ZCCA 3QAQA 3VFKA 3AULA 2KHWB 2K39A 2LXCA 3T9LA 1WGDA 2KN5A 1E90A 4II2B 4GSWA 2A4ZA 4FLHA 5TR5A 1IYFA 1A5RA 4RM9A 2DENB 4WWPA 2N7DA 4A3PA 2ZVNA 3ENEA 3PLUA 2Y5BB 4MH0E 2DYMA 2KTRA 3B1LX 5HKHA 2KDFB 3VAWA 1XD3B 3A1QB 4F8CB 1QZEA 5JHBA 4M8MA 2AL6A 2C7NB 4G50A 4AJYB 2KANA 3VUYA 1YIWA 2LASA 3DVGX 2FCQA 5JH5C 2RSUA 3DBSA 2XK5A 1Q0WB 2MBHA 1XQQA 4MGIE 5EDSA 2G4DB 4I6PA 4FJYA 3JYUA 1S1QB 2MLBA 3APFA 2RPQA 3UIOB 2KC1A 3DCGA 1C1YB 2ZZPB 3WIMA 5DCNA 3PREA 2KVRA 4GDKA 4GB9A 2WDTB 3QJZA 4ICUA 1FXTB 1EF5A 2BKRB 2N9PC 2NS5A 2MBQA 3U7DA 3KH0A 1R4NI 2L76A 3NOBA 2GBMA 4EFOA 4HK2A 3V60A 3A4SC 2BGFA 2G4SA 3DVGY 3H7PA 3VVWB 4CHKA 2W9NA 1P3QU 3A1QA 3V6EB 2BYFA 4WJQA 2PE6B 3TBLD 4ZRKA 2FNJB 4FN2A 4BVUC 3M62B 1LFDA 5KHQA 4F7ZA 1P9DU 1VD2A 4BFRA 3ZNZB 4FA6A 3SDLC 2AWTA 2M0XA 5D6JB 3VTWA
chains in the Genus database with same CATH superfamily
3AE6B 1V9JA 3PLVA 1L0YB 1SIJA 3BWUD 3ZYYX 1I35A 1N6ZA 4AUQC 4ASWC 1ZUD2 3FKYA 4NAWA 2N9XA 2DX5B 2DZJA 2WX1A 3KUCB 2KWDA 2CJOA 2OEDA 4R3DA 5IAAC 1ZE3D 4LDTB 4KV2A 2DNFA 2KJ6A 2MP2B 1E8XA 3BINA 1HE8A 4KSLC 3L54A 3AE4B 4MM3B 1JALA 2W55A 4RF1A 2QHOA 2V9HA 5D3IB 4EZKA 1QQRA 2WX0A 2LRWA 4B6WA 4N6EB 1N62A 1E10A 2J0MA 4LNIA 3AH7A 3ZJTA 4NJ6A 4REZA 1T0YA 1M4VA 2KD0A 4AOFA 2D10A 3L0WB 2LI5A 4MSMB 1WJUA 2PLPA 2ZNVB 4JPSA 1E6EB 2KX3A 1PDXA 3IFWB 5CHWA 2FE8A 3IAS1 4HXDA 4KDIC 1FCCC 1MHXA 3WCQA 4KGTA 1TS2A 4MDKE 2IBIB 3J9CA 1XLPA 3SHQA 2LGDA 3W5VB 3LXFA 3ZTCA 1WYWB 3N32A 3TIXA 4HPLB 2D11A 2JZZA 3URYA 1FO4A 1N5XA 4LLGM 1JW9D 2LVPA 2BBCA 2QIEB 1I4QA 2JZPA 5IA7A 1WI0A 2M17A 1KF6B 4BOSC 4WURA 3ZNHB 1TIFA 4FHJA 1JMLA 3EFUA 2Z0EB 3AU5A 3JW0X 2QILA 1VZ7A 1WX7A 1E5WA 2L05A 3IHPC 2ON8A 4NNJB 2KKCA 1SIFA 4NZLB 4KSKC 3DHHC 4WJNA 1AN8A 1BT0A 3ZVVA 2M19A 4K7UA 2M4NA 1TKEA 3A9KA 4W9HA 3NVVA 4K3BA 2CHZA 4XDCA 3GOEA 4RGNA 5HI1A 1PGAA 4PS7A 4XZ4A 3PGEA 3RNGC 5JXVA 2WXLA 1HTOA 1UWXA 1WXQA 1WM2A 1Q10A 3H8HA 1WR6E 2FUHB 3QHTA 1RLFA 1CQVA 4B0MA 2JZ3B 1V1OA 1SJED 2CHWA 2G9HD 3WAOA 2KVZA 4KVGB 3DOWA 4A55A 2O6VA 1FNWA 3FILA 4AWJA 3VTUA 4K7SA 2KMMA 5D7GA 2NPTA 2INCC 3KLSX 1P98A 2IGDA 2DWQA 4J3OD 2JQRB 2LUMA 2XNAC 2HE7A 3I3TB 3P1MA 1Z5SB 4GOCA 2N4FA 3DBLI 4HCPB 2K8HA 4PS3A 2J53A 3L4PA 4LNKA 4GDLB 1GAQB 3TEZA 2M1MA 4HDQA 1GG3A 3I57A 3HIZA 1UELA 2N9KA 2PPHA 3AI5A 3W2DA 1OFFA 2PTLA 1CK1A 4N58A 4FJVB 4RGTA 2Z8LA 1T6BX 1G6JA 4PS8A 2WS3B 1ZDVA 4M01A 4C80A 3W5UB 3BK2A 1ET6A 2XN9C 1NI3A 3RFZB 1SJHD 4BOZB 1B1ZA 1RYJA 3VQIA 4DHJB 4TV3A 3T3OA 1F2RI 3JVZX 3UINB 3DBRI 3ZNID 4DHZB 1XO3A 2DBYA 1OQYA 4TSSA 4IM3A 5FR6A 2INDC 4JE3B 2B3AA 5EE0A 1I4PA 4I6NB 2NBUA 3EC8A 1FPYA 5JZEB 2M0AA 2LWPA 1MJDA 3RPFC 1T0QC 4C56C 2MBEA 1OEYJ 3BVGA 1SBBB 3M95A 4LCDE 3Q14C 1ZP0B 3V6CB 2BKFA 2J0KA 1WY8A 1V97A 4EZLA 4P7IA 2L52A 1DOIA 2H89B 4FJZA 1GC6A 3DHGC 4A8XC 4KKJA 1J0GA 3JSVA 1X1MA 2KLCA 1YOVB 1WYGA 3O13A 3X0WA 3AEDB 1WX8A 1JROA 4OVUA 1BUIC 3MHSD 2L7RA 2VH2A 3QA8A 1RFKA 1WXMA 2XEWA 4ZYNA 4DXGA 2N7JA 5TSSA 5E6PA 3ZJUA 3U8ZA 1I4GA 4PT5A 2LGIA 3QC8B 2CU1A 1TZ1A 4MJSB 1C4AA 5L83A 3N3KB 2JXXA 2BB6A 1NBFC 1J8CA 4UDUC 2C60A 1MVKA 4HROA 2IGHA 3KUDB 1K51A 5BYRA 1TYGB 4WWOA 1AWDA 1JWUD 3AE7B 4ARCA 2JWUA 1VR9A 3H7SA 1J19A 3M63B 2GBKA 3W9CB 2HJ8A 3KYDD 2JF5A 2N0SB 2K5PA 3PV1A 3EA6A 4K1RB 3ZRCA 1GNUA 3OLMD 3BVMA 1V6EA 2O6VD 1H4RA 4XWTA 2KHWB 2K39A 4ITKA 1E90A 3AE2B 2D5GA 1I4XA 2KTRA 1VZ8A 3KWVA 1GB4A 1QZEA 5JHBA 2KACA 3VUYA 2LASA 2WXNA 2HTME 1GPXA 1F1HA 4MGIE 4BZAA 4I6PA 3Q6BA 1E0ZA 1ENFA 3WIMA 3AEFB 5DCNA 3SFEB 2KVRA 2RDGA 4ICUA 1FXTB 2N9PC 2NS5A 1N63A 3NOBA 3OG5A 1J7AA 2BGFA 1ZPSA 3VVWB 2W9NA 4AS1A 3V6EB 1AW7A 2PE6B 4BVUC 2FNJB 1QLBB 1VD2A 4MACA 1JCKB 3KWLA 2M0XA 2W82A 2JYTA 3E56A 2ZEQA 3CSTA 4MGZE 4XWWA 1VLBA 2MBOA 2MQJA 2BVCA 4BKTA 3RNBC 3A9JA 1JRPA 3NVYA 2LGXA 2INPE 2PVGC 5AUIA 3SFDB 4DXFA 1YN4A 4HPPA 5AEKB 1V49A 2DYOA 4W9GA 3PHXB 4WAFA 2NPTB 1PQSA 2IO1B 2MW5A 3HM3A 3BYTB 2L0TA 3V61A 3AMZA 3PRZA 2LUEA 2G45B 2R2QA 3NJTA 2BQQA 3Q8EA 4MELA 1L0XB 1NI2A 4WJPA 1YQBA 4PYUA 3AE1B 4W9EA 5IN7A 1WE7A 2INNE 2L8JA 4TQ1A 4HRSA 1YN5A 2MWSB 3NS8A 4NAWB 4YSYB 1FMAD 2IDYA 3HHMA 5EE3A 4LTUA 2MCNB 4G3XB 2EELA 1TKYA 2WWZA 2L32A 3BZDB 4XDDA 3AECB 1HQRD 5G5GA 2NVUI 4ZDVA 3AEAB 2MRPA 4A20A 2Y3AA 4IG7B 3ZTDA 2BYTA 4WAAA 2DZKA 3RUIB 5BMGA 4NAMA 3SD5A 3APCA 5IP4D 2ZJDA 4KDLB 2G3QB 3BVZA 3M3JA 3RZWC 5C2TB 3DBLB 1KM7A 1K52A 2K8CA 1FD6A 1V81A 1AARA 3UGBB 3EGRA 1WGHA 3RT3B 3RNCC 4HLEA 4TUUA 1QOAA 4BKGA 3W1SA 2WXFA 4CO7A 3PZDA 2A5UA 4JX1C 2VH1A 3PS6A 3D32A 3PRMB 3W1SC 2WU5B 3MC9A 1TT5B 2JT4B 3RD2A 3RCZA 1T0SC 1IP9A 1TS5A 2ONQA 1OGWA 4JLCA 4KZ0A 3TEYA 2V0GA 2WHIA 1WMHA 3I63C 1SB3C 1L4ZB 2G1EA 4ARIA 3MHZA 2LRUA 1TY0A 4DWFA 3PRPB 1FXIA 1I4RA 4JWSC 3VUWA 4ZHOA 1NEKB 2LD9A 1WR1A 3WANA 1WZ3A 4MJSA 1WJ4A 3K9PB 1C4CA 2V3NA 3U2SC 2BYEA 1RAXA 1XF5L 1YNTE 3K9OB 3QWZB 4ICVA 4OW0A 2BWES 1FRRA 1L0VB 2FUG1 2LMCA 2MSED 2EMTA 2GMIC 4JGHB 3PVLA 1IBXB 4YWGG 5J17A 5DPRA 2MBBB 3U52E 1VJKA 3N30A 3R66C 3ML8A 4YTMB 1UNSA 4P16A 3ZIMA 4RFBA 4YXDB 2HDEA 4LDTD 1UBQA 2MX2A 1FEHA 3R8BA 3IG3A 2WGSA 2AQ1B 2EKIA 4L23A 1L5PA 4DQOC 4C4VA 2CKHB 3RN9C 1V1PB 2BS2B 2DAJA 2KTRB 2QDFA 4M00A 2DYBA 1GJZA 5FK9C 1ET9A 1E7UA 3T8MA 3AEGB 3TL5A 3B0AA 2VZKD 2W3SA 2PEAA 2LGYA 4K81A 1K8RB 2GBRA 2C9WB 1LM8B 4MM3A 4KIKA 5HHDG 4C7ZA 4M0WB 2GOWA 1TY2A 2BT6A 4GDKB 1KOTA 4IKGA 3OJ3A 2JPHA 3CIRB 3GB1A 1D4BA 2WXQA 4RMAA 1PYWD 2KDBA 4O1NA 4BBNF 3TJPA 1WJNA 2FBWB 3MC8A 1L6UA 4E74A 1F0ZA 1WFYA 3AN1A 3AE3B 2KLGA 5H92C 5G55A 3BYYB 1MFWA 2IZVB 3L13A 4OZAA 3PSEB 1TS3A 3Q3MC 5CX3A 3V3XA 3WALA 4S0RA 2WLBA 3I9V1 3NZUA 3RMKC 2R61A 1V8CA 2L1AA 4E3CA 4ZRJA 3GP7A 3PO0A 1Y56A 1P1AA 2HTHA 1I42A 2WDQB 4II3B 1Q5WB 4B0EA 5D3DA 2AQ2B 1KLUD 4N59A 1M94A 3S2AA 2GI9A 3WAPA 4ANWA 2FCNA 4YSZB 5AZHA 1NYRA 3NVWA 2D07B 3ZRFA 1V5OA 3OAWA 1PUTA 3HM6X 4C4VB 2B76B 3VTVA 4LNFA 1TBEA 5FKAC 3RYTA 2KQSA 2KWUB 1T0RC 2JRHA 4W9FA 1GUAB 3N1YC 4RH6A 1XLQA 3JSVB 4XYCA 5EE9A 4J6IA 5D2MB 2UYZB 2FIDA 2WDVB 2ZPNA 2QJLA 1R7SA 4EUTA 1UBIA 2KFKA 1N61A 4MT5A 2K6QA 2WXOA 4WJOA 4B9KA 2MP2A 4YTNB 3I5JC 3ZDTA 1YD8U 2DZIA 2CR5A 2K9XA 3B2FA 4LK0M 3P63A 3MJWA 2N9EB 2MJ3A 4I6LB 2RR9A 4P1CC 4ANUA 2BW2A 3IXSA 3QAQA 4M02A 2LXCA 3T9LA 2A4ZA 4FLHA 4YT0B 2IPKD 2PVOD 4WWPA 2N7DA 3NRZA 2Y5BB 3AEBB 2KDFB 4F8CB 3P4RB 1FNVA 2C7NB 4G50A 2KANA 1WGKA 1AYFA 5JH5C 2XK5A 3IT4B 2MBHA 5EDSA 3JYUA 3ZJVA 1XLNA 2RMMA 1QT9A 3QJZA 4A9AA 1PGXA 2JYEA 2MBQA 3KH0A 2AQ3B 4HK2A 3V60A 1IBXA 2I38A 4YTPB 1FFVA 2BYFA 4FN2A 4ACFA 1LFDA 1P9DU 4FA6A 3SDLC 3HVDA 5AZGA 2IY0B 5G5HA 3Q3NC 4BKSD 1Z2MA 3NZSA 3OWEB 5IOIA 1JWAD 4DK5A 1E7VA 2Z0DB 3V05A 4KGRA 5C3JB 1V5TA 1ISNA 3DDCB 4LNNA 4MGYE 1UGMA 2WXRA 1KTKA 2DZMA 4W9JA 2JRIB 3BIID 4DXAB 1WSPA 3NVZA 2HD5B 2N1VA 3AE5B 3QCAA 2ZW1A 1SXTA 2I1KA 1E8ZA 3DBHI 2QSDA 2RDHA 2W3RA 4AP4C 4RM8A 1Q1OA 1R4NB 1YMHE 1QOGA 1GB1A 3IVFA 2OJWA 3RZFA 2DLBA 1XEEA 3Q8BA 5DPWA 3Q3JA 1FFUA 4USAA 1VRAB 2N7EA 1K53A 4K3CA 3PT2B 3VUXA 3FC4A 4G0NB 1MG4A 2RGFA 4URKA 2NTSA 3AE8B 2MJEA 3DBHB 2V4IB 4XX5A 3CSFA 4TMAB 3GE3C 3C19A 3TEXA 4KKIA 1N60A 3HVZA 2O6VB 3FILB 2MHJA 4IM2A 4KZCA 2BYVE 4HWIB 3WAMA 2BS3B 1RRBA 2D3GA 3VR8B 2XBBC 1VCBA 1E8WA 4EEWA 4PYZA 3NY5A 1J7BA 1MG8A 3QARA 3EUB2 4IWOA 2NBVB 5E6NA 3QK0A 1SEBD 5KHOA 2K25A 2EMSA 4P1BC 2WP9B 2VZKB 2KJRA 3KUZA 2RDBC 4LJOB 4TKNA 1GC7A 3ZDMC 2K6DB 3UIPB 2O2VA 1HTQA 5BYQA 4WWMA 2WU2B 2LFIA 1D5XC 3AM9A 4KX6B 1YQ3B 3SEBA 1B9RA 3LYYA 2WXPA 3DQVA 2KMCA 3QIJA 2GB1A 1SE4A 2KFJA 4OZBA 4AJWA 2KT7A 1WWTA 2Z59B 2NCNA 1WXVA 2CJNA 3AEEB 4H2AA 2JY6A 3SR6A 1T3QA 3ZW3A 1C79A 1KH0A 1ZXHA 3ZUNA 4GU2A 2PJHA 1WXAA 1OQQA 4MEMA 1CJEA 1WE6A 2Y5CA 3EHVA 4DDID 1FXAA 3MJ5A 2D3AA 4M0WA 5BMHA 1JQ4A 5LXHA 3ECIA 1XLOA 2ZCBA 4C00A 2BS4B 1YJIA 4KGSA 2QCZA 2V1YA 2BF8B 2KC2A 1S3SG 4EZJA 4JL9A 1WIAA 3U30A 1LO5D 2ZPYA 1F52A 3H7PB 3N1ZC 3Q69A 1C78A 5IKCM 3Q2AC 2KQ7A 3FAHA 1I7HA 2DAFA 2YVCA 3DVNV 1PFDA 4JWUC 2MJDA 1HA5A 2BWFA 4OVVA 2IJ0A 3P4SB 4AQ7A 3B2GA 2C7HA 2AL3A 3RI7C 3N9YC 2NTTA 4W9DA 4E71A 3DWMA 1V1PA 1C9FA 1ZW7A 1PGBA 1A70A 3KYCD 2ZVOA 1HEZE 2IY1B 2E6XA 3A4RA 2KXJA 4WIPA 2LHEA 3QX1A 2WXJA 1K50A 2KJHB 5BYSA 1L4DB 2WXKA 5FR3A 5IO9A 1JWSD 4XGAB 3TMPB 3CWIA 2OOBB 1D6EC 1QILA 1H8CA 1LXDA 5J18A 1SGHA 2REXA 2VRRB 3HK0A 2FCMA 2HJ1A 2ZNVC 1L7YA 2RD0A 2UU7A 2E3TA 3Q3OC 2JUOA 2CS4A 3Q8FA 2I2YA 4D2KA 4GGQA 1DYQA 1QOBA 2JWZA 4NQKE 3L16A 1FRDA 1IPGA 5GMVA 2JSVX 4RGMA 5CTRC 3KVFB 2KDEB 2JVCA 1SF0A 4HPMB 1KLVA 3HRDD 1VZ6A 3CF6E 2DHZA 5J2RA 4K7WA 2IGGA 2LZ6A 3E9SA 3ONSA 5DPSA 1ZKHA 3ZXVA 4NPNA 2H88B 1STEA 1IGDA 2K22A 1SE3A 4MH8A 1WX9A 2K3UA 3P42A 1HXYD 3LB8C 2IO2B 2WXIA 3V62A 2L00B 4HCNB 3NHEB 2MEKA 4A90A 1WGGA 1KLGD 2CHXA 3AU4A 2FAZA 3DVNU 1FCLA 4W9LA 2Y5PA 2R2OA 3P4PB 3T3NA 1JRUA 1HZ6A 3ZQ4A 1WF9A 3AXCA 1OQRA 4G11A 3H6NA 4A6QA 1C4PA 1YQ4B 2JU6X 1ROEA 1L2NA 1NDDA 4JIOU 2I1JA 2ZCCA 3VFKA 3AULA 1EM7A 1WGDA 2KN5A 4II2B 3B9JA 1FIQA 4GSWA 5TR5A 3MC0B 4RM9A 2DENB 1E9MA 2ZVNA 3ENEA 3B1LX 5HKHA 1P7EA 3VAWA 1XD3B 3A1QB 2J52A 2JX5A 4M8MA 4AJYB 1R4MB 3DVGX 2RSUA 3EFCA 1TS4A 4FJYA 3ABVB 3APFA 2BTEA 3UIOB 2KC1A 1C1YB 2ZZPB 4GDKA 4EE2A 1C76A 2WDTB 2MH7A 1ZXIA 1R4NI 1MPEA 3A4SC 2G4SA 1VDVA 3DVGY 4CHKA 1P3QU 4WJQA 3TBLD 4ZRKA 3M62B 1TZOA 5KHQA 4BFRA 2WXHA 2LJIA 3ZNZB 2AWTA 1IUEA 5D6JB 1QF6A 1WM3A 2XK5B 4ANVA 3N20C 1WRDB 1N5WA 3QQ8B 2KMAA 4HDOA 2PE9A 1SE9A 1RWSA 2LVOA 1LQBA 3U4EG 3MTNB 5MPOA 3ZO5B 4W9CA 4BBNC 3VXWA 2KX0A 3C8YA 4GXBA 2PW9A 1KFYB 5GXGB 1UH6A 4FULA 3A33B 2BB5A 2WNMA 1E8YA 1XCQL 5E6JA 5LXIB 3PHWB 3UF8A 3NUHB 4ZYSA 1LGRA 1WGRA 2KAJA 5L95C 1C77A 3IBEA 5BO4B 1ESFA 1WJ6A 4ANXA 5EE1A 3P2BA 4ZRPA 5HFYA 4GMVA 1J7CA 2C7MB 2PMVA 3KQ4A 3RNAC 3SU8X 3ZNGC 2KK8A 2J0JA 4RF0A 2KWCA 3AB5A 3IT6B 4ZOHC 1EWYC 2IYDB 4DBGA 1YJJA 3NG0A 4FXCA 2LHDA 4YL8A 5AZFA 2AX5A 1KRHA 3RNFC 3VDZA 4L2YA 2KWVB 2YEPB 4N9F4 1YJ1A 4HEA1 2N9LA 1L6VA 3TEWA 2KFKB 2W54A 4OVZA 2KDIA 2Q5WD 2FCSA 1RM6C 1UGJA 3GS2A 2NMQA 1V80A 4HKZE 5H8YE 3R7RA 4RNAA 2OHFA 1TKGA 1F77A 1F9JA 2J4XA 1WGYA 4IM0A 3NZ3A 3ML9A 4DHJD 5HG2A 2K8BA 3B08A 3A9JB 3LJ3A 1NVID 3GZNI 1NYQA 3APDA 2K1FA 1V86A 1EU3A 1BMLC 4EKUA 3VH3B 4HJKA 2M56B 1EU4A 2SAKA 1D5MC 1EO6A 4KIKB 4FADA 4YSXB 3ZLZA 1D5ZC 2OJRA 3N1XC 3PZ8A 4US9A 3VHTC 2N1WA 4F1SA 2KOXA 2C5LC 4HKQA 4EOYA 2D3BA 4NJCA 2WQYB 4S17A 4XC2A 1P0RA 1ACCA 3R2IA 2D2QA 4DHZE 4CYEA 1SE2A 2GBJA 3H1UA 4NQLB 5C1ZA 4JQWC 5LLIA 3U7ZA 3TCAA 2BPSA 3R3MA 3DPDA 3UI3A 1UUPA 3L10B 1UWMA 4RGOS 2L0FA 4WQOB 1BXTA 4DDGD 2AEHA 3GE8C 2LJ5A 2UWQA 4GDLA 2LEKA 2J7QB 1TTNA 2QC8A 5CHFA 1EUVB 3A9KB 4MGKE 3EECA 4XE0A 4W9KA 4IW0A 1SSNA 4M8NA 2GRIA 1XT9B 4IWQA 2YLMA 2QMTA 2V3PA 1QKZA 2ACZB 2LXAA 1TJEA 1DGJA 1XCTL 5G2NA 4IUMB 5E6OA 3ZXRA 3VH4B 5CHVC 3Q8CA 4LNOA 1CZPA 2GBNA 1FNUA 3PPAA 3GZNB 2MA9B 1ZDXA 2WDRB 2AYOB 1CMXB 3RNEC 1T5XD 2ZW0A 5AUKA 4LJPB 1WRIA 1XXGA 2V4LA 3PZ7A 1UD7A 1E7PB 2LVQA 5I4DA 4C7YA 2JXTA 4L1BA 1D3ZA 3L08A 4BAXA 4NY0A 2EKEC 1NENB 5T8IA 2L3ZA 3VRBB 3HUIA 3DWGC 3LDZE 1ZOYB 4CQNA 4FHKA 4GLSC 1EF1A 1MHHE 4TQ0A 3ZGZA 2WXMA 1GOZA 4Q2JA 1U4AA 5D94A 2KNBA 4WWNA 3PTFC 2X38A 4GIVA 2KTFA 4RCOA 3CMMB 4WH4A 3ETRA 1ZGUB 1I4HA 1WXSA 3O65B 3R7QA 4OZCA 4X57B 4BKSA 4GN1A 4HJGE 1JWMD 2KZRA 3WA0A 1R4MI 5DPTA 1YN3A 2ICIA 3UQAA 2KN4A 4FBJB 1RFAA 2KDMA 3BK1A 1WZ0A 3L17A 4W9IA 1KJTA 4MSQB 3H9DA 2V3SA 1QOFA 2O2VB 2FIFA 3X23A 3BY4B 4ZRIA 2IO3B 3ZKJC 3W1YA 2PIAA 1UZXB 2NBWB 4ZHPA 3MP9A 2KYWA 1DOYA 4PK1A 2PKOA 2L83A 4IC7B 4A3OA 1UF0A 3DHIC 4IDIA 3RULA 4HVBA 3MFGA 5JHAA 1Y8RC 4P6VF 4QAYA 1OTRB 3OJ4B 4B95A 2ASQA 2LGSA 2IO0B 1TGZB 1WH3A 3C0RB 3ALBA 4IOIE 4NJ7A 3TUOA 1V2YA 3Q8AA 2KO3A 2RPVA 2WYQA 2NR2A 2M8SA 4US8A 4IWPA 5C23A 3KW5B 3Q3FA 1C3TA 1EWCA 3UQBA 1YX6B 3IAM1 1WMHB 1YX5B 1OEYA 3AE9B 2D3CA 3R2TA 2TSSA 2K0PA 1IYFA 1MI0A 1A5RA 1JWBD 1HZ5A 1P7FA 5LNK1 4A3PA 3VRAB 3PLUA 4MH0E 2DYMA 4ZRQA 2CU3A 2AL6A 3AV8A 1YIWA 2FCQA 1IGCA 2X8XX 2J42A 3DBSA 2GLSA 1Q0WB 2QEJC 1XQQA 2G4DB 5BMIA 1S1QB 2MLBA 2RPQA 3DCGA 3P4QB 3PREA 4WQMA 4GB9A 2KQ4X 3VR9B 1EF5A 2BKRB 4OHJA 3U7DA 3NS1A 2L76A 2GBMA 4EFOA 3H7PA 3TSSA 3A1QA 1F2RC 2SEBD 3DBRB 4F7ZA 1DOXA 2WXGA 2YEPF 1FM0D 3VTWA
chains in the Genus database with same CATH topology
1WM3A 2XK5B 1V9JA 2ZEQA 4ANVA 3PLVA 3CSTA 1WRDB 3QQ8B 5AZGA 2IY0B 4MGZE 4BKSD 2KMAA 2MBOA 2MQJA 1Z2MA 4HDOA 3NZSA 2PE9A 4BKTA 1SE9A 4DK5A 2LVOA 3A9JA 1E7VA 1LQBA 1I35A 4AUQC 2LGXA 4ASWC 2Z0DB 3MTNB 4NAWA 2N9XA 2DX5B 5AEKB 3ZO5B 4W9CA 4BBNC 1V49A 1V5TA 2DYOA 2DZJA 2WX1A 2KX0A 3KUCB 4W9GA 5IAAC 3VXWA 4GXBA 1ISNA 3DDCB 4LDTB 3PHXB 4MGYE 1UGMA 4KV2A 2DZMA 2NPTB 4W9JA 2JRIB 1PQSA 1UH6A 2KJ6A 2IO1B 2MP2B 4FULA 1E8XA 3A33B 4DXAB 3BINA 2MW5A 1HE8A 4KSLC 3HM3A 2HD5B 2N1VA 1E8YA 3L54A 3QCAA 5LXIB 2L0TA 3PHWB 3UF8A 3V61A 3PRZA 2LUEA 2G45B 2I1KA 2R2QA 1E8ZA 4MELA 3DBHI 1NI2A 2QHOA 1YQBA 4WJPA 4AP4C 4RM8A 4PYUA 1WGRA 1Q1OA 4EZKA 4W9EA 5L95C 2WX0A 2LRWA 1WE7A 4B6WA 3IBEA 5BO4B 1WJ6A 2L8JA 4ANXA 4TQ1A 2MWSB 3P2BA 2J0MA 3NS8A 4NAWB 4NJ6A 4GMVA 1T0YA 2C7MB 3IVFA 3SU8X 2KD0A 2KK8A 2J0JA 2D10A 3L0WB 2LI5A 3ZNGC 4AOFA 4MSMB 3RZFA 3HHMA 2MCNB 2KWCA 1WJUA 5DPWA 2ZNVB 4G3XB 3Q3JA 2KX3A 2WWZA 3IFWB 2N7EA 5CHWA 2IYDB 4DBGA 2NVUI 4ZDVA 4HXDA 3PT2B 4KDIC 2MRPA 4YL8A 3VUXA 4A20A 5AZFA 4IG7B 4G0NB 3ZTDA 2RGFA 4URKA 3VDZA 2KWVB 4WAAA 2DZKA 3RUIB 4MDKE 4XX5A 2IBIB 4N9F4 3SD5A 3APCA 3SHQA 3CSFA 2ZJDA 2LGDA 1YJ1A 4KDLB 2G3QB 3ZTCA 3M3JA 2KFKB 3RZWC 1KM7A 1WYWB 3N32A 2O6VB 3TIXA 2K8CA 4KZCA 4HPLB 4IM2A 2BYVE 2KDIA 4HWIB 1V81A 1AARA 3UGBB 3WAMA 2FCSA 2D11A 1RRBA 2JZZA 2D3GA 1WGHA 3RT3B 2XBBC 1VCBA 1E8WA 4HLEA 2LVPA 4TUUA 1V80A 4EEWA 4PYZA 3R7RA 4BKGA 3NY5A 3W1SA 1MG8A 3QARA 4CO7A 3PZDA 1F9JA 1WGYA 2A5UA 4IM0A 3ML9A 4DHJD 5IA7A 1WI0A 3PS6A 3D32A 2M17A 4IWOA 3PRMB 2K8BA 3W1SC 2NBVB 3B08A 5E6NA 3A9JB 3LJ3A 3GZNI 3QK0A 4BOSC 2JT4B 3APDA 3RD2A 5KHOA 2K1FA 1V86A 2K25A 3ZNHB 3RCZA 4FHJA 1IP9A 4EKUA 2EMSA 3EFUA 2Z0EB 3VH3B 1OGWA 4HJKA 4JLCA 3AU5A 3JW0X 4KZ0A 2KJRA 3KUZA 1WX7A 1EO6A 4KIKB 1E5WA 2L05A 4FADA 3IHPC 1WMHA 3ZLZA 4NNJB 4LJOB 2KKCA 1GC7A 4TKNA 2OJRA 3ZDMC 2K6DB 3VHTC 1SIFA 2N1WA 2O2VA 3UIPB 4F1SA 2KOXA 2C5LC 4KSKC 4WJNA 4EOYA 1BT0A 3ZVVA 2LRUA 4K7UA 2M4NA 3A9KA 4W9HA 2CHZA 4DWFA 3GOEA 4XC2A 3PRPB 1P0RA 2D2QA 4PS7A 4XZ4A 3VUWA 3PGEA 2LD9A 4DHZE 4CYEA 1WR1A 2GBJA 3H1UA 4NQLB 5C1ZA 3DQVA 4JQWC 2KMCA 1WZ3A 1WM2A 3QIJA 4MJSA 5LLIA 3WANA 1WJ4A 3TCAA 2BPSA 2KFJA 1WR6E 4AJWA 2FUHB 3R3MA 3DPDA 3K9PB 3QHTA 1RLFA 2Z59B 3L10B 2NCNA 2BYEA 1WXVA 2L0FA 1RAXA 2JY6A 2JZ3B 4WQOB 3ZW3A 4DDGD 3K9OB 3QWZB 2AEHA 4ICVA 2LJ5A 2UWQA 2BWES 2CHWA 4GDLA 2J7QB 3WAOA 2MSED 1TTNA 2EMTA 5CHFA 1EUVB 3A9KB 3ZUNA 4GU2A 2GMIC 4MGKE 3EECA 2PJHA 4W9KA 4KVGB 4JGHB 3PVLA 3DOWA 4IW0A 1WXAA 4MEMA 5J17A 1WE6A 5DPRA 2MBBB 4M8NA 3N30A 3R66C 1XT9B 3ML8A 4IWQA 2O6VA 4AWJA 3EHVA 4DDID 3VTUA 4K7SA 5D7GA 2YLMA 2NPTA 3ZIMA 1P98A 2HE7A 4LDTD 1UBQA 3I3TB 4GOCA 1Z5SB 2LXAA 2MX2A 2N4FA 5LXHA 3DBLI 3IG3A 4HCPB 2K8HA 4PS3A 3ECIA 5G2NA 4IUMB 2ZCBA 5E6OA 2CKHB 2V1YA 4GDLB 3VH4B 2BF8B 2KC2A 5CHVC 1S3SG 4EZJA 2GBNA 1WIAA 2DAJA 4JL9A 2M1MA 2KTRB 1GG3A 3PPAA 2MA9B 3HIZA 4HDQA 1UELA 3U30A 2AYOB 2DYBA 1GJZA 1CMXB 2PPHA 2ZPYA 3H7PB 1E7UA 3AI5A 3T8MA 3TL5A 3B0AA 2KQ7A 4FJVB 2DAFA 2PEAA 4LJPB 2YVCA 2LGYA 3DVNV 1G6JA 4K81A 1K8RB 2GBRA 2V4LA 4PS8A 1UD7A 2BWFA 2C9WB 1LM8B 4MM3A 4KIKA 2LVQA 4M0WB 2GOWA 4OVVA 1D3ZA 3L08A 4NY0A 4BOZB 4GDKB 1KOTA 2C7HA 2EKEC 3VQIA 2AL3A 3OJ3A 2JPHA 4DHJB 4TV3A 2L3ZA 4W9DA 4RMAA 3LDZE 4E71A 3JVZX 3UINB 2KDBA 4FHKA 4BBNF 3DBRI 1WJNA 3TJPA 3ZNID 1EF1A 4E74A 4DHZB 1WFYA 1OQYA 1ZW7A 5G55A 2KLGA 4TQ0A 4IM3A 2IZVB 5FR6A 3KYCD 3L13A 2ZVOA 2IY1B 2B3AA 3A4RA 3PSEB 1U4AA 5D94A 2KNBA 2KXJA 4WWNA 3PTFC 4I6NB 5CX3A 2NBUA 3WALA 4GIVA 2KTFA 3QX1A 3EC8A 5JZEB 2KJHB 3CMMB 2LWPA 1ZGUB 1WXSA 3NZUA 3TMPB 3O65B 2MBEA 3R7QA 1OEYJ 2OOBB 4X57B 4BKSA 4GN1A 4E3CA 3M95A 4ZRJA 1H8CA 1LXDA 4LCDE 5J18A 1SGHA 2KZRA 2REXA 3V6CB 3WA0A 2BKFA 1P1AA 1R4MI 2HTHA 2VRRB 2J0KA 5DPTA 1I42A 3HK0A 3UQAA 1WY8A 2FCMA 2ZNVC 1L7YA 4II3B 4EZLA 1Q5WB 4P7IA 2RD0A 4FJZA 1GC6A 4FBJB 1RFAA 1M94A 3S2AA 1J0GA 3JSVA 1WZ0A 3L17A 2JUOA 3WAPA 2CS4A 4ANWA 4W9IA 1X1MA 2FCNA 2KLCA 1KJTA 4MSQB 4GGQA 3H9DA 5AZHA 3X0WA 2JWZA 4NQKE 2V3SA 3L16A 1IPGA 1WX8A 5GMVA 4OVUA 2D07B 2O2VB 3ZRFA 2FIFA 3X23A 1V5OA 3OAWA 3BY4B 3MHSD 2L7RA 5CTRC 3QA8A 4ZRIA 2IO3B 3HM6X 1WXMA 2KDEB 2XEWA 3KVFB 4ZYNA 3VTVA 3ZKJC 2JVCA 3W1YA 4HPMB 1TBEA 5E6PA 1KLVA 1UZXB 3U8ZA 2NBWB 3RYTA 2KQSA 2KWUB 2DHZA 3CF6E 3QC8B 5J2RA 2CU1A 4K7WA 2JRHA 4W9FA 1GUAB 1TZ1A 2LZ6A 4MJSB 3ONSA 5DPSA 1ZKHA 4NPNA 4IC7B 4A3OA 5L83A 3N3KB 2JXXA 3RULA 4HVBA 1WX9A 5JHAA 3JSVB 1NBFC 2IO2B 1Y8RC 3V62A 1J8CA 2C60A 2L00B 4J6IA 1OTRB 4HCNB 3NHEB 3KUDB 2UYZB 5D2MB 2FIDA 1WGGA 2CHXA 3AU4A 3OJ4B 4B95A 2ASQA 2FAZA 2ZPNA 4WWOA 3DVNU 2IO0B 4EUTA 1UBIA 2KFKA 1TGZB 4W9LA 1WH3A 3C0RB 3ALBA 4NJ7A 2R2OA 3H7SA 2K6QA 1J19A 1V2YA 2GBKA 3M63B 4WJOA 4B9KA 2KO3A 1JRUA 2HJ8A 3KYDD 2JF5A 2MP2A 2NR2A 2WYQA 2M8SA 3PV1A 1WF9A 3ZDTA 3AXCA 4G11A 4K1RB 3H6NA 1YD8U 4IWPA 3ZRCA 2DZIA 2CR5A 5C23A 3KW5B 3Q3FA 1C3TA 3MJWA 1L2NA 2N9EB 1NDDA 3UQBA 4I6LB 1YX6B 2RR9A 4JIOU 1GNUA 1WMHB 1YX5B 2I1JA 3OLMD 4ANUA 1OEYA 1V6EA 2O6VD 1H4RA 2ZCCA 3QAQA 3VFKA 3AULA 2KHWB 2K39A 2LXCA 3T9LA 1WGDA 2KN5A 1E90A 4II2B 4GSWA 2A4ZA 4FLHA 5TR5A 1IYFA 1A5RA 4RM9A 2DENB 4WWPA 2N7DA 4A3PA 2ZVNA 3ENEA 3PLUA 2Y5BB 4MH0E 2DYMA 2KTRA 3B1LX 5HKHA 2KDFB 3VAWA 1XD3B 3A1QB 4F8CB 1QZEA 5JHBA 4M8MA 2AL6A 2C7NB 4G50A 4AJYB 2KANA 3VUYA 1YIWA 2LASA 3DVGX 2FCQA 5JH5C 2RSUA 3DBSA 2XK5A 1Q0WB 2MBHA 1XQQA 4MGIE 5EDSA 2G4DB 4I6PA 4FJYA 3JYUA 1S1QB 2MLBA 3APFA 2RPQA 3UIOB 2KC1A 3DCGA 1C1YB 2ZZPB 3WIMA 5DCNA 3PREA 2KVRA 4GDKA 4GB9A 2WDTB 3QJZA 4ICUA 1FXTB 1EF5A 2BKRB 2N9PC 2NS5A 2MBQA 3U7DA 3KH0A 1R4NI 2L76A 3NOBA 2GBMA 4EFOA 4HK2A 3V60A 3A4SC 2BGFA 2G4SA 3DVGY 3H7PA 3VVWB 4CHKA 2W9NA 1P3QU 3A1QA 3V6EB 2BYFA 4WJQA 2PE6B 3TBLD 4ZRKA 2FNJB 4FN2A 4BVUC 3M62B 1LFDA 5KHQA 4F7ZA 1P9DU 1VD2A 4BFRA 3ZNZB 4FA6A 3SDLC 2AWTA 2M0XA 5D6JB 3VTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WM3 A;  2XK5 B;  1V9J A;  2ZEQ A;  4ANV A;  3PLV A;  3CST A;  1WRD B;  3QQ8 B;  5AZG A;  2IY0 B;  4MGZ E;  4BKS D;  2KMA A;  2MBO A;  2MQJ A;  1Z2M A;  4HDO A;  3NZS A;  2PE9 A;  4BKT A;  1SE9 A;  4DK5 A;  2LVO A;  3A9J A;  1E7V A;  1LQB A;  1I35 A;  4AUQ C;  2LGX A;  4ASW C;  2Z0D B;  3MTN B;  4NAW A;  2N9X A;  2DX5 B;  5AEK B;  3ZO5 B;  4W9C A;  4BBN C;  1V49 A;  1V5T A;  2DYO A;  2DZJ A;  2WX1 A;  2KX0 A;  3KUC B;  4W9G A;  5IAA C;  3VXW A;  4GXB A;  1ISN A;  3DDC B;  4LDT B;  3PHX B;  4MGY E;  1UGM A;  4KV2 A;  2DZM A;  2NPT B;  4W9J A;  2JRI B;  1PQS A;  1UH6 A;  2KJ6 A;  2IO1 B;  2MP2 B;  4FUL A;  1E8X A;  3A33 B;  4DXA B;  3BIN A;  2MW5 A;  1HE8 A;  4KSL C;  3HM3 A;  2HD5 B;  2N1V A;  1E8Y A;  3L54 A;  3QCA A;  5LXI B;  2L0T A;  3PHW B;  3UF8 A;  3V61 A;  3PRZ A;  2LUE A;  2G45 B;  2I1K A;  2R2Q A;  1E8Z A;  4MEL A;  3DBH I;  1NI2 A;  2QHO A;  1YQB A;  4WJP A;  4AP4 C;  4RM8 A;  4PYU A;  1WGR A;  1Q1O A;  4EZK A;  4W9E A;  5L95 C;  2WX0 A;  2LRW A;  1WE7 A;  4B6W A;  3IBE A;  5BO4 B;  1WJ6 A;  2L8J A;  4ANX A;  4TQ1 A;  2MWS B;  3P2B A;  2J0M A;  3NS8 A;  4NAW B;  4NJ6 A;  4GMV A;  1T0Y A;  2C7M B;  3IVF A;  3SU8 X;  2KD0 A;  2KK8 A;  2J0J A;  2D10 A;  3L0W B;  2LI5 A;  3ZNG C;  4AOF A;  4MSM B;  3RZF A;  3HHM A;  2MCN B;  2KWC A;  1WJU A;  5DPW A;  2ZNV B;  4G3X B;  3Q3J A;  2KX3 A;  2WWZ A;  3IFW B;  2N7E A;  5CHW A;  2IYD B;  4DBG A;  2NVU I;  4ZDV A;  4HXD A;  3PT2 B;  4KDI C;  2MRP A;  4YL8 A;  3VUX A;  4A20 A;  5AZF A;  4IG7 B;  4G0N B;  3ZTD A;  2RGF A;  4URK A;  3VDZ A;  2KWV B;  4WAA A;  2DZK A;  3RUI B;  4MDK E;  4XX5 A;  2IBI B;  4N9F 4;  3SD5 A;  3APC A;  3SHQ A;  3CSF A;  2ZJD A;  2LGD A;  1YJ1 A;  4KDL B;  2G3Q B;  3ZTC A;  3M3J A;  2KFK B;  3RZW C;  1KM7 A;  1WYW B;  3N32 A;  2O6V B;  3TIX A;  2K8C A;  4KZC A;  4HPL B;  4IM2 A;  2BYV E;  2KDI A;  4HWI B;  1V81 A;  1AAR A;  3UGB B;  3WAM A;  2FCS A;  2D11 A;  1RRB A;  2JZZ A;  2D3G A;  1WGH A;  3RT3 B;  2XBB C;  1VCB A;  1E8W A;  4HLE A;  2LVP A;  4TUU A;  1V80 A;  4EEW A;  4PYZ A;  3R7R A;  4BKG A;  3NY5 A;  3W1S A;  1MG8 A;  3QAR A;  4CO7 A;  3PZD A;  1F9J A;  1WGY A;  2A5U A;  4IM0 A;  3ML9 A;  4DHJ D;  5IA7 A;  1WI0 A;  3PS6 A;  3D32 A;  2M17 A;  4IWO A;  3PRM B;  2K8B A;  3W1S C;  2NBV B;  3B08 A;  5E6N A;  3A9J B;  3LJ3 A;  3GZN I;  3QK0 A;  4BOS C;  2JT4 B;  3APD A;  3RD2 A;  5KHO A;  2K1F A;  1V86 A;  2K25 A;  3ZNH B;  3RCZ A;  4FHJ A;  1IP9 A;  4EKU A;  2EMS A;  3EFU A;  2Z0E B;  3VH3 B;  1OGW A;  4HJK A;  4JLC A;  3AU5 A;  3JW0 X;  4KZ0 A;  2KJR A;  3KUZ A;  1WX7 A;  1EO6 A;  4KIK B;  1E5W A;  2L05 A;  4FAD A;  3IHP C;  1WMH A;  3ZLZ A;  4NNJ B;  4LJO B;  2KKC A;  1GC7 A;  4TKN A;  2OJR A;  3ZDM C;  2K6D B;  3VHT C;  1SIF A;  2N1W A;  2O2V A;  3UIP B;  4F1S A;  2KOX A;  2C5L C;  4KSK C;  4WJN A;  4EOY A;  1BT0 A;  3ZVV A;  2LRU A;  4K7U A;  2M4N A;  3A9K A;  4W9H A;  2CHZ A;  4DWF A;  3GOE A;  4XC2 A;  3PRP B;  1P0R A;  2D2Q A;  4PS7 A;  4XZ4 A;  3VUW A;  3PGE A;  2LD9 A;  4DHZ E;  4CYE A;  1WR1 A;  2GBJ A;  3H1U A;  4NQL B;  5C1Z A;  3DQV A;  4JQW C;  2KMC A;  1WZ3 A;  1WM2 A;  3QIJ A;  4MJS A;  5LLI A;  3WAN A;  1WJ4 A;  3TCA A;  2BPS A;  2KFJ A;  1WR6 E;  4AJW A;  2FUH B;  3R3M A;  3DPD A;  3K9P B;  3QHT A;  1RLF A;  2Z59 B;  3L10 B;  2NCN A;  2BYE A;  1WXV A;  2L0F A;  1RAX A;  2JY6 A;  2JZ3 B;  4WQO B;  3ZW3 A;  4DDG D;  3K9O B;  3QWZ B;  2AEH A;  4ICV A;  2LJ5 A;  2UWQ A;  2BWE S;  2CHW A;  4GDL A;  2J7Q B;  3WAO A;  2MSE D;  1TTN A;  2EMT A;  5CHF A;  1EUV B;  3A9K B;  3ZUN A;  4GU2 A;  2GMI C;  4MGK E;  3EEC A;  2PJH A;  4W9K A;  4KVG B;  4JGH B;  3PVL A;  3DOW A;  4IW0 A;  1WXA A;  4MEM A;  5J17 A;  1WE6 A;  5DPR A;  2MBB B;  4M8N A;  3N30 A;  3R66 C;  1XT9 B;  3ML8 A;  4IWQ A;  2O6V A;  4AWJ A;  3EHV A;  4DDI D;  3VTU A;  4K7S A;  5D7G A;  2YLM A;  2NPT A;  3ZIM A;  1P98 A;  2HE7 A;  4LDT D;  1UBQ A;  3I3T B;  4GOC A;  1Z5S B;  2LXA A;  2MX2 A;  2N4F A;  5LXH A;  3DBL I;  3IG3 A;  4HCP B;  2K8H A;  4PS3 A;  3ECI A;  5G2N A;  4IUM B;  2ZCB A;  5E6O A;  2CKH B;  2V1Y A;  4GDL B;  3VH4 B;  2BF8 B;  2KC2 A;  5CHV C;  1S3S G;  4EZJ A;  2GBN A;  1WIA A;  2DAJ A;  4JL9 A;  2M1M A;  2KTR B;  1GG3 A;  3PPA A;  2MA9 B;  3HIZ A;  4HDQ A;  1UEL A;  3U30 A;  2AYO B;  2DYB A;  1GJZ A;  1CMX B;  2PPH A;  2ZPY A;  3H7P B;  1E7U A;  3AI5 A;  3T8M A;  3TL5 A;  3B0A A;  2KQ7 A;  4FJV B;  2DAF A;  2PEA A;  4LJP B;  2YVC A;  2LGY A;  3DVN V;  1G6J A;  4K81 A;  1K8R B;  2GBR A;  2V4L A;  4PS8 A;  1UD7 A;  2BWF A;  2C9W B;  1LM8 B;  4MM3 A;  4KIK A;  2LVQ A;  4M0W B;  2GOW A;  4OVV A;  1D3Z A;  3L08 A;  4NY0 A;  4BOZ B;  4GDK B;  1KOT A;  2C7H A;  2EKE C;  3VQI A;  2AL3 A;  3OJ3 A;  2JPH A;  4DHJ B;  4TV3 A;  2L3Z A;  4W9D A;  4RMA A;  3LDZ E;  4E71 A;  3JVZ X;  3UIN B;  2KDB A;  4FHK A;  4BBN F;  3DBR I;  1WJN A;  3TJP A;  3ZNI D;  1EF1 A;  4E74 A;  4DHZ B;  1WFY A;  1OQY A;  1ZW7 A;  5G55 A;  2KLG A;  4TQ0 A;  4IM3 A;  2IZV B;  5FR6 A;  3KYC D;  3L13 A;  2ZVO A;  2IY1 B;  2B3A A;  3A4R A;  3PSE B;  1U4A A;  5D94 A;  2KNB A;  2KXJ A;  4WWN A;  3PTF C;  4I6N B;  5CX3 A;  2NBU A;  3WAL A;  4GIV A;  2KTF A;  3QX1 A;  3EC8 A;  5JZE B;  2KJH B;  3CMM B;  2LWP A;  1ZGU B;  1WXS A;  3NZU A;  3TMP B;  3O65 B;  2MBE A;  3R7Q A;  1OEY J;  2OOB B;  4X57 B;  4BKS A;  4GN1 A;  4E3C A;  3M95 A;  4ZRJ A;  1H8C A;  1LXD A;  4LCD E;  5J18 A;  1SGH A;  2KZR A;  2REX A;  3V6C B;  3WA0 A;  2BKF A;  1P1A A;  1R4M I;  2HTH A;  2VRR B;  2J0K A;  5DPT A;  1I42 A;  3HK0 A;  3UQA A;  1WY8 A;  2FCM A;  2ZNV C;  1L7Y A;  4II3 B;  4EZL A;  1Q5W B;  4P7I A;  2RD0 A;  4FJZ A;  1GC6 A;  4FBJ B;  1RFA A;  1M94 A;  3S2A A;  1J0G A;  3JSV A;  1WZ0 A;  3L17 A;  2JUO A;  3WAP A;  2CS4 A;  4ANW A;  4W9I A;  1X1M A;  2FCN A;  2KLC A;  1KJT A;  4MSQ B;  4GGQ A;  3H9D A;  5AZH A;  3X0W A;  2JWZ A;  4NQK E;  2V3S A;  3L16 A;  1IPG A;  1WX8 A;  5GMV A;  4OVU A;  2D07 B;  2O2V B;  3ZRF A;  2FIF A;  3X23 A;  1V5O A;  3OAW A;  3BY4 B;  3MHS D;  2L7R A;  5CTR C;  3QA8 A;  4ZRI A;  2IO3 B;  3HM6 X;  1WXM A;  2KDE B;  2XEW A;  3KVF B;  4ZYN A;  3VTV A;  3ZKJ C;  2JVC A;  3W1Y A;  4HPM B;  1TBE A;  5E6P A;  1KLV A;  1UZX B;  3U8Z A;  2NBW B;  3RYT A;  2KQS A;  2KWU B;  2DHZ A;  3CF6 E;  3QC8 B;  5J2R A;  2CU1 A;  4K7W A;  2JRH A;  4W9F A;  1GUA B;  1TZ1 A;  2LZ6 A;  4MJS B;  3ONS A;  5DPS A;  1ZKH A;  4NPN A;  4IC7 B;  4A3O A;  5L83 A;  3N3K B;  2JXX A;  3RUL A;  4HVB A;  1WX9 A;  5JHA A;  3JSV B;  1NBF C;  2IO2 B;  1Y8R C;  3V62 A;  1J8C A;  2C60 A;  2L00 B;  4J6I A;  1OTR B;  4HCN B;  3NHE B;  3KUD B;  2UYZ B;  5D2M B;  2FID A;  1WGG A;  2CHX A;  3AU4 A;  3OJ4 B;  4B95 A;  2ASQ A;  2FAZ A;  2ZPN A;  4WWO A;  3DVN U;  2IO0 B;  4EUT A;  1UBI A;  2KFK A;  1TGZ B;  4W9L A;  1WH3 A;  3C0R B;  3ALB A;  4NJ7 A;  2R2O A;  3H7S A;  2K6Q A;  1J19 A;  1V2Y A;  2GBK A;  3M63 B;  4WJO A;  4B9K A;  2KO3 A;  1JRU A;  2HJ8 A;  3KYD D;  2JF5 A;  2MP2 A;  2NR2 A;  2WYQ A;  2M8S A;  3PV1 A;  1WF9 A;  3ZDT A;  3AXC A;  4G11 A;  4K1R B;  3H6N A;  1YD8 U;  4IWP A;  3ZRC A;  2DZI A;  2CR5 A;  5C23 A;  3KW5 B;  3Q3F A;  1C3T A;  3MJW A;  1L2N A;  2N9E B;  1NDD A;  3UQB A;  4I6L B;  1YX6 B;  2RR9 A;  4JIO U;  1GNU A;  1WMH B;  1YX5 B;  2I1J A;  3OLM D;  4ANU A;  1OEY A;  1V6E A;  2O6V D;  1H4R A;  2ZCC A;  3QAQ A;  3VFK A;  3AUL A;  2KHW B;  2K39 A;  2LXC A;  3T9L A;  1WGD A;  2KN5 A;  1E90 A;  4II2 B;  4GSW A;  2A4Z A;  4FLH A;  5TR5 A;  1IYF A;  1A5R A;  4RM9 A;  2DEN B;  4WWP A;  2N7D A;  4A3P A;  2ZVN A;  3ENE A;  3PLU A;  2Y5B B;  4MH0 E;  2DYM A;  2KTR A;  3B1L X;  5HKH A;  2KDF B;  3VAW A;  1XD3 B;  3A1Q B;  4F8C B;  1QZE A;  5JHB A;  4M8M A;  2AL6 A;  2C7N B;  4G50 A;  4AJY B;  2KAN A;  3VUY A;  1YIW A;  2LAS A;  3DVG X;  2FCQ A;  5JH5 C;  2RSU A;  3DBS A;  2XK5 A;  1Q0W B;  2MBH A;  1XQQ A;  4MGI E;  5EDS A;  2G4D B;  4I6P A;  4FJY A;  3JYU A;  1S1Q B;  2MLB A;  3APF A;  2RPQ A;  3UIO B;  2KC1 A;  3DCG A;  1C1Y B;  2ZZP B;  3WIM A;  5DCN A;  3PRE A;  2KVR A;  4GDK A;  4GB9 A;  2WDT B;  3QJZ A;  4ICU A;  1FXT B;  1EF5 A;  2BKR B;  2N9P C;  2NS5 A;  2MBQ A;  3U7D A;  3KH0 A;  1R4N I;  2L76 A;  3NOB A;  2GBM A;  4EFO A;  4HK2 A;  3V60 A;  3A4S C;  2BGF A;  2G4S A;  3DVG Y;  3H7P A;  3VVW B;  4CHK A;  2W9N A;  1P3Q U;  3A1Q A;  3V6E B;  2BYF A;  4WJQ A;  2PE6 B;  3TBL D;  4ZRK A;  2FNJ B;  4FN2 A;  4BVU C;  3M62 B;  1LFD A;  5KHQ A;  4F7Z A;  1P9D U;  1VD2 A;  4BFR A;  3ZNZ B;  4FA6 A;  3SDL C;  2AWT A;  2M0X A;  5D6J B;  3VTW A; 
#chains in the Genus database with same CATH topology
 3AE6 B;  1V9J A;  3PLV A;  1L0Y B;  1SIJ A;  3BWU D;  3ZYY X;  1I35 A;  1N6Z A;  4AUQ C;  4ASW C;  1ZUD 2;  3FKY A;  4NAW A;  2N9X A;  2DX5 B;  2DZJ A;  2WX1 A;  3KUC B;  2KWD A;  2CJO A;  2OED A;  4R3D A;  5IAA C;  1ZE3 D;  4LDT B;  4KV2 A;  2DNF A;  2KJ6 A;  2MP2 B;  1E8X A;  3BIN A;  1HE8 A;  4KSL C;  3L54 A;  3AE4 B;  4MM3 B;  1JAL A;  2W55 A;  4RF1 A;  2QHO A;  2V9H A;  5D3I B;  4EZK A;  1QQR A;  2WX0 A;  2LRW A;  4B6W A;  4N6E B;  1N62 A;  1E10 A;  2J0M A;  4LNI A;  3AH7 A;  3ZJT A;  4NJ6 A;  4REZ A;  1T0Y A;  1M4V A;  2KD0 A;  4AOF A;  2D10 A;  3L0W B;  2LI5 A;  4MSM B;  1WJU A;  2PLP A;  2ZNV B;  4JPS A;  1E6E B;  2KX3 A;  1PDX A;  3IFW B;  5CHW A;  2FE8 A;  3IAS 1;  4HXD A;  4KDI C;  1FCC C;  1MHX A;  3WCQ A;  4KGT A;  1TS2 A;  4MDK E;  2IBI B;  3J9C A;  1XLP A;  3SHQ A;  2LGD A;  3W5V B;  3LXF A;  3ZTC A;  1WYW B;  3N32 A;  3TIX A;  4HPL B;  2D11 A;  2JZZ A;  3URY A;  1FO4 A;  1N5X A;  4LLG M;  1JW9 D;  2LVP A;  2BBC A;  2QIE B;  1I4Q A;  2JZP A;  5IA7 A;  1WI0 A;  2M17 A;  1KF6 B;  4BOS C;  4WUR A;  3ZNH B;  1TIF A;  4FHJ A;  1JML A;  3EFU A;  2Z0E B;  3AU5 A;  3JW0 X;  2QIL A;  1VZ7 A;  1WX7 A;  1E5W A;  2L05 A;  3IHP C;  2ON8 A;  4NNJ B;  2KKC A;  1SIF A;  4NZL B;  4KSK C;  3DHH C;  4WJN A;  1AN8 A;  1BT0 A;  3ZVV A;  2M19 A;  4K7U A;  2M4N A;  1TKE A;  3A9K A;  4W9H A;  3NVV A;  4K3B A;  2CHZ A;  4XDC A;  3GOE A;  4RGN A;  5HI1 A;  1PGA A;  4PS7 A;  4XZ4 A;  3PGE A;  3RNG C;  5JXV A;  2WXL A;  1HTO A;  1UWX A;  1WXQ A;  1WM2 A;  1Q10 A;  3H8H A;  1WR6 E;  2FUH B;  3QHT A;  1RLF A;  1CQV A;  4B0M A;  2JZ3 B;  1V1O A;  1SJE D;  2CHW A;  2G9H D;  3WAO A;  2KVZ A;  4KVG B;  3DOW A;  4A55 A;  2O6V A;  1FNW A;  3FIL A;  4AWJ A;  3VTU A;  4K7S A;  2KMM A;  5D7G A;  2NPT A;  2INC C;  3KLS X;  1P98 A;  2IGD A;  2DWQ A;  4J3O D;  2JQR B;  2LUM A;  2XNA C;  2HE7 A;  3I3T B;  3P1M A;  1Z5S B;  4GOC A;  2N4F A;  3DBL I;  4HCP B;  2K8H A;  4PS3 A;  2J53 A;  3L4P A;  4LNK A;  4GDL B;  1GAQ B;  3TEZ A;  2M1M A;  4HDQ A;  1GG3 A;  3I57 A;  3HIZ A;  1UEL A;  2N9K A;  2PPH A;  3AI5 A;  3W2D A;  1OFF A;  2PTL A;  1CK1 A;  4N58 A;  4FJV B;  4RGT A;  2Z8L A;  1T6B X;  1G6J A;  4PS8 A;  2WS3 B;  1ZDV A;  4M01 A;  4C80 A;  3W5U B;  3BK2 A;  1ET6 A;  2XN9 C;  1NI3 A;  3RFZ B;  1SJH D;  4BOZ B;  1B1Z A;  1RYJ A;  3VQI A;  4DHJ B;  4TV3 A;  3T3O A;  1F2R I;  3JVZ X;  3UIN B;  3DBR I;  3ZNI D;  4DHZ B;  1XO3 A;  2DBY A;  1OQY A;  4TSS A;  4IM3 A;  5FR6 A;  2IND C;  4JE3 B;  2B3A A;  5EE0 A;  1I4P A;  4I6N B;  2NBU A;  3EC8 A;  1FPY A;  5JZE B;  2M0A A;  2LWP A;  1MJD A;  3RPF C;  1T0Q C;  4C56 C;  2MBE A;  1OEY J;  3BVG A;  1SBB B;  3M95 A;  4LCD E;  3Q14 C;  1ZP0 B;  3V6C B;  2BKF A;  2J0K A;  1WY8 A;  1V97 A;  4EZL A;  4P7I A;  2L52 A;  1DOI A;  2H89 B;  4FJZ A;  1GC6 A;  3DHG C;  4A8X C;  4KKJ A;  1J0G A;  3JSV A;  1X1M A;  2KLC A;  1YOV B;  1WYG A;  3O13 A;  3X0W A;  3AED B;  1WX8 A;  1JRO A;  4OVU A;  1BUI C;  3MHS D;  2L7R A;  2VH2 A;  3QA8 A;  1RFK A;  1WXM A;  2XEW A;  4ZYN A;  4DXG A;  2N7J A;  5TSS A;  5E6P A;  3ZJU A;  3U8Z A;  1I4G A;  4PT5 A;  2LGI A;  3QC8 B;  2CU1 A;  1TZ1 A;  4MJS B;  1C4A A;  5L83 A;  3N3K B;  2JXX A;  2BB6 A;  1NBF C;  1J8C A;  4UDU C;  2C60 A;  1MVK A;  4HRO A;  2IGH A;  3KUD B;  1K51 A;  5BYR A;  1TYG B;  4WWO A;  1AWD A;  1JWU D;  3AE7 B;  4ARC A;  2JWU A;  1VR9 A;  3H7S A;  1J19 A;  3M63 B;  2GBK A;  3W9C B;  2HJ8 A;  3KYD D;  2JF5 A;  2N0S B;  2K5P A;  3PV1 A;  3EA6 A;  4K1R B;  3ZRC A;  1GNU A;  3OLM D;  3BVM A;  1V6E A;  2O6V D;  1H4R A;  4XWT A;  2KHW B;  2K39 A;  4ITK A;  1E90 A;  3AE2 B;  2D5G A;  1I4X A;  2KTR A;  1VZ8 A;  3KWV A;  1GB4 A;  1QZE A;  5JHB A;  2KAC A;  3VUY A;  2LAS A;  2WXN A;  2HTM E;  1GPX A;  1F1H A;  4MGI E;  4BZA A;  4I6P A;  3Q6B A;  1E0Z A;  1ENF A;  3WIM A;  3AEF B;  5DCN A;  3SFE B;  2KVR A;  2RDG A;  4ICU A;  1FXT B;  2N9P C;  2NS5 A;  1N63 A;  3NOB A;  3OG5 A;  1J7A A;  2BGF A;  1ZPS A;  3VVW B;  2W9N A;  4AS1 A;  3V6E B;  1AW7 A;  2PE6 B;  4BVU C;  2FNJ B;  1QLB B;  1VD2 A;  4MAC A;  1JCK B;  3KWL A;  2M0X A;  2W82 A;  2JYT A;  3E56 A;  2ZEQ A;  3CST A;  4MGZ E;  4XWW A;  1VLB A;  2MBO A;  2MQJ A;  2BVC A;  4BKT A;  3RNB C;  3A9J A;  1JRP A;  3NVY A;  2LGX A;  2INP E;  2PVG C;  5AUI A;  3SFD B;  4DXF A;  1YN4 A;  4HPP A;  5AEK B;  1V49 A;  2DYO A;  4W9G A;  3PHX B;  4WAF A;  2NPT B;  1PQS A;  2IO1 B;  2MW5 A;  3HM3 A;  3BYT B;  2L0T A;  3V61 A;  3AMZ A;  3PRZ A;  2LUE A;  2G45 B;  2R2Q A;  3NJT A;  2BQQ A;  3Q8E A;  4MEL A;  1L0X B;  1NI2 A;  4WJP A;  1YQB A;  4PYU A;  3AE1 B;  4W9E A;  5IN7 A;  1WE7 A;  2INN E;  2L8J A;  4TQ1 A;  4HRS A;  1YN5 A;  2MWS B;  3NS8 A;  4NAW B;  4YSY B;  1FMA D;  2IDY A;  3HHM A;  5EE3 A;  4LTU A;  2MCN B;  4G3X B;  2EEL A;  1TKY A;  2WWZ A;  2L32 A;  3BZD B;  4XDD A;  3AEC B;  1HQR D;  5G5G A;  2NVU I;  4ZDV A;  3AEA B;  2MRP A;  4A20 A;  2Y3A A;  4IG7 B;  3ZTD A;  2BYT A;  4WAA A;  2DZK A;  3RUI B;  5BMG A;  4NAM A;  3SD5 A;  3APC A;  5IP4 D;  2ZJD A;  4KDL B;  2G3Q B;  3BVZ A;  3M3J A;  3RZW C;  5C2T B;  3DBL B;  1KM7 A;  1K52 A;  2K8C A;  1FD6 A;  1V81 A;  1AAR A;  3UGB B;  3EGR A;  1WGH A;  3RT3 B;  3RNC C;  4HLE A;  4TUU A;  1QOA A;  4BKG A;  3W1S A;  2WXF A;  4CO7 A;  3PZD A;  2A5U A;  4JX1 C;  2VH1 A;  3PS6 A;  3D32 A;  3PRM B;  3W1S C;  2WU5 B;  3MC9 A;  1TT5 B;  2JT4 B;  3RD2 A;  3RCZ A;  1T0S C;  1IP9 A;  1TS5 A;  2ONQ A;  1OGW A;  4JLC A;  4KZ0 A;  3TEY A;  2V0G A;  2WHI A;  1WMH A;  3I63 C;  1SB3 C;  1L4Z B;  2G1E A;  4ARI A;  3MHZ A;  2LRU A;  1TY0 A;  4DWF A;  3PRP B;  1FXI A;  1I4R A;  4JWS C;  3VUW A;  4ZHO A;  1NEK B;  2LD9 A;  1WR1 A;  3WAN A;  1WZ3 A;  4MJS A;  1WJ4 A;  3K9P B;  1C4C A;  2V3N A;  3U2S C;  2BYE A;  1RAX A;  1XF5 L;  1YNT E;  3K9O B;  3QWZ B;  4ICV A;  4OW0 A;  2BWE S;  1FRR A;  1L0V B;  2FUG 1;  2LMC A;  2MSE D;  2EMT A;  2GMI C;  4JGH B;  3PVL A;  1IBX B;  4YWG G;  5J17 A;  5DPR A;  2MBB B;  3U52 E;  1VJK A;  3N30 A;  3R66 C;  3ML8 A;  4YTM B;  1UNS A;  4P16 A;  3ZIM A;  4RFB A;  4YXD B;  2HDE A;  4LDT D;  1UBQ A;  2MX2 A;  1FEH A;  3R8B A;  3IG3 A;  2WGS A;  2AQ1 B;  2EKI A;  4L23 A;  1L5P A;  4DQO C;  4C4V A;  2CKH B;  3RN9 C;  1V1P B;  2BS2 B;  2DAJ A;  2KTR B;  2QDF A;  4M00 A;  2DYB A;  1GJZ A;  5FK9 C;  1ET9 A;  1E7U A;  3T8M A;  3AEG B;  3TL5 A;  3B0A A;  2VZK D;  2W3S A;  2PEA A;  2LGY A;  4K81 A;  1K8R B;  2GBR A;  2C9W B;  1LM8 B;  4MM3 A;  4KIK A;  5HHD G;  4C7Z A;  4M0W B;  2GOW A;  1TY2 A;  2BT6 A;  4GDK B;  1KOT A;  4IKG A;  3OJ3 A;  2JPH A;  3CIR B;  3GB1 A;  1D4B A;  2WXQ A;  4RMA A;  1PYW D;  2KDB A;  4O1N A;  4BBN F;  3TJP A;  1WJN A;  2FBW B;  3MC8 A;  1L6U A;  4E74 A;  1F0Z A;  1WFY A;  3AN1 A;  3AE3 B;  2KLG A;  5H92 C;  5G55 A;  3BYY B;  1MFW A;  2IZV B;  3L13 A;  4OZA A;  3PSE B;  1TS3 A;  3Q3M C;  5CX3 A;  3V3X A;  3WAL A;  4S0R A;  2WLB A;  3I9V 1;  3NZU A;  3RMK C;  2R61 A;  1V8C A;  2L1A A;  4E3C A;  4ZRJ A;  3GP7 A;  3PO0 A;  1Y56 A;  1P1A A;  2HTH A;  1I42 A;  2WDQ B;  4II3 B;  1Q5W B;  4B0E A;  5D3D A;  2AQ2 B;  1KLU D;  4N59 A;  1M94 A;  3S2A A;  2GI9 A;  3WAP A;  4ANW A;  2FCN A;  4YSZ B;  5AZH A;  1NYR A;  3NVW A;  2D07 B;  3ZRF A;  1V5O A;  3OAW A;  1PUT A;  3HM6 X;  4C4V B;  2B76 B;  3VTV A;  4LNF A;  1TBE A;  5FKA C;  3RYT A;  2KQS A;  2KWU B;  1T0R C;  2JRH A;  4W9F A;  1GUA B;  3N1Y C;  4RH6 A;  1XLQ A;  3JSV B;  4XYC A;  5EE9 A;  4J6I A;  5D2M B;  2UYZ B;  2FID A;  2WDV B;  2ZPN A;  2QJL A;  1R7S A;  4EUT A;  1UBI A;  2KFK A;  1N61 A;  4MT5 A;  2K6Q A;  2WXO A;  4WJO A;  4B9K A;  2MP2 A;  4YTN B;  3I5J C;  3ZDT A;  1YD8 U;  2DZI A;  2CR5 A;  2K9X A;  3B2F A;  4LK0 M;  3P63 A;  3MJW A;  2N9E B;  2MJ3 A;  4I6L B;  2RR9 A;  4P1C C;  4ANU A;  2BW2 A;  3IXS A;  3QAQ A;  4M02 A;  2LXC A;  3T9L A;  2A4Z A;  4FLH A;  4YT0 B;  2IPK D;  2PVO D;  4WWP A;  2N7D A;  3NRZ A;  2Y5B B;  3AEB B;  2KDF B;  4F8C B;  3P4R B;  1FNV A;  2C7N B;  4G50 A;  2KAN A;  1WGK A;  1AYF A;  5JH5 C;  2XK5 A;  3IT4 B;  2MBH A;  5EDS A;  3JYU A;  3ZJV A;  1XLN A;  2RMM A;  1QT9 A;  3QJZ A;  4A9A A;  1PGX A;  2JYE A;  2MBQ A;  3KH0 A;  2AQ3 B;  4HK2 A;  3V60 A;  1IBX A;  2I38 A;  4YTP B;  1FFV A;  2BYF A;  4FN2 A;  4ACF A;  1LFD A;  1P9D U;  4FA6 A;  3SDL C;  3HVD A;  5AZG A;  2IY0 B;  5G5H A;  3Q3N C;  4BKS D;  1Z2M A;  3NZS A;  3OWE B;  5IOI A;  1JWA D;  4DK5 A;  1E7V A;  2Z0D B;  3V05 A;  4KGR A;  5C3J B;  1V5T A;  1ISN A;  3DDC B;  4LNN A;  4MGY E;  1UGM A;  2WXR A;  1KTK A;  2DZM A;  4W9J A;  2JRI B;  3BII D;  4DXA B;  1WSP A;  3NVZ A;  2HD5 B;  2N1V A;  3AE5 B;  3QCA A;  2ZW1 A;  1SXT A;  2I1K A;  1E8Z A;  3DBH I;  2QSD A;  2RDH A;  2W3R A;  4AP4 C;  4RM8 A;  1Q1O A;  1R4N B;  1YMH E;  1QOG A;  1GB1 A;  3IVF A;  2OJW A;  3RZF A;  2DLB A;  1XEE A;  3Q8B A;  5DPW A;  3Q3J A;  1FFU A;  4USA A;  1VRA B;  2N7E A;  1K53 A;  4K3C A;  3PT2 B;  3VUX A;  3FC4 A;  4G0N B;  1MG4 A;  2RGF A;  4URK A;  2NTS A;  3AE8 B;  2MJE A;  3DBH B;  2V4I B;  4XX5 A;  3CSF A;  4TMA B;  3GE3 C;  3C19 A;  3TEX A;  4KKI A;  1N60 A;  3HVZ A;  2O6V B;  3FIL B;  2MHJ A;  4IM2 A;  4KZC A;  2BYV E;  4HWI B;  3WAM A;  2BS3 B;  1RRB A;  2D3G A;  3VR8 B;  2XBB C;  1VCB A;  1E8W A;  4EEW A;  4PYZ A;  3NY5 A;  1J7B A;  1MG8 A;  3QAR A;  3EUB 2;  4IWO A;  2NBV B;  5E6N A;  3QK0 A;  1SEB D;  5KHO A;  2K25 A;  2EMS A;  4P1B C;  2WP9 B;  2VZK B;  2KJR A;  3KUZ A;  2RDB C;  4LJO B;  4TKN A;  1GC7 A;  3ZDM C;  2K6D B;  3UIP B;  2O2V A;  1HTQ A;  5BYQ A;  4WWM A;  2WU2 B;  2LFI A;  1D5X C;  3AM9 A;  4KX6 B;  1YQ3 B;  3SEB A;  1B9R A;  3LYY A;  2WXP A;  3DQV A;  2KMC A;  3QIJ A;  2GB1 A;  1SE4 A;  2KFJ A;  4OZB A;  4AJW A;  2KT7 A;  1WWT A;  2Z59 B;  2NCN A;  1WXV A;  2CJN A;  3AEE B;  4H2A A;  2JY6 A;  3SR6 A;  1T3Q A;  3ZW3 A;  1C79 A;  1KH0 A;  1ZXH A;  3ZUN A;  4GU2 A;  2PJH A;  1WXA A;  1OQQ A;  4MEM A;  1CJE A;  1WE6 A;  2Y5C A;  3EHV A;  4DDI D;  1FXA A;  3MJ5 A;  2D3A A;  4M0W A;  5BMH A;  1JQ4 A;  5LXH A;  3ECI A;  1XLO A;  2ZCB A;  4C00 A;  2BS4 B;  1YJI A;  4KGS A;  2QCZ A;  2V1Y A;  2BF8 B;  2KC2 A;  1S3S G;  4EZJ A;  4JL9 A;  1WIA A;  3U30 A;  1LO5 D;  2ZPY A;  1F52 A;  3H7P B;  3N1Z C;  3Q69 A;  1C78 A;  5IKC M;  3Q2A C;  2KQ7 A;  3FAH A;  1I7H A;  2DAF A;  2YVC A;  3DVN V;  1PFD A;  4JWU C;  2MJD A;  1HA5 A;  2BWF A;  4OVV A;  2IJ0 A;  3P4S B;  4AQ7 A;  3B2G A;  2C7H A;  2AL3 A;  3RI7 C;  3N9Y C;  2NTT A;  4W9D A;  4E71 A;  3DWM A;  1V1P A;  1C9F A;  1ZW7 A;  1PGB A;  1A70 A;  3KYC D;  2ZVO A;  1HEZ E;  2IY1 B;  2E6X A;  3A4R A;  2KXJ A;  4WIP A;  2LHE A;  3QX1 A;  2WXJ A;  1K50 A;  2KJH B;  5BYS A;  1L4D B;  2WXK A;  5FR3 A;  5IO9 A;  1JWS D;  4XGA B;  3TMP B;  3CWI A;  2OOB B;  1D6E C;  1QIL A;  1H8C A;  1LXD A;  5J18 A;  1SGH A;  2REX A;  2VRR B;  3HK0 A;  2FCM A;  2HJ1 A;  2ZNV C;  1L7Y A;  2RD0 A;  2UU7 A;  2E3T A;  3Q3O C;  2JUO A;  2CS4 A;  3Q8F A;  2I2Y A;  4D2K A;  4GGQ A;  1DYQ A;  1QOB A;  2JWZ A;  4NQK E;  3L16 A;  1FRD A;  1IPG A;  5GMV A;  2JSV X;  4RGM A;  5CTR C;  3KVF B;  2KDE B;  2JVC A;  1SF0 A;  4HPM B;  1KLV A;  3HRD D;  1VZ6 A;  3CF6 E;  2DHZ A;  5J2R A;  4K7W A;  2IGG A;  2LZ6 A;  3E9S A;  3ONS A;  5DPS A;  1ZKH A;  3ZXV A;  4NPN A;  2H88 B;  1STE A;  1IGD A;  2K22 A;  1SE3 A;  4MH8 A;  1WX9 A;  2K3U A;  3P42 A;  1HXY D;  3LB8 C;  2IO2 B;  2WXI A;  3V62 A;  2L00 B;  4HCN B;  3NHE B;  2MEK A;  4A90 A;  1WGG A;  1KLG D;  2CHX A;  3AU4 A;  2FAZ A;  3DVN U;  1FCL A;  4W9L A;  2Y5P A;  2R2O A;  3P4P B;  3T3N A;  1JRU A;  1HZ6 A;  3ZQ4 A;  1WF9 A;  3AXC A;  1OQR A;  4G11 A;  3H6N A;  4A6Q A;  1C4P A;  1YQ4 B;  2JU6 X;  1ROE A;  1L2N A;  1NDD A;  4JIO U;  2I1J A;  2ZCC A;  3VFK A;  3AUL A;  1EM7 A;  1WGD A;  2KN5 A;  4II2 B;  3B9J A;  1FIQ A;  4GSW A;  5TR5 A;  3MC0 B;  4RM9 A;  2DEN B;  1E9M A;  2ZVN A;  3ENE A;  3B1L X;  5HKH A;  1P7E A;  3VAW A;  1XD3 B;  3A1Q B;  2J52 A;  2JX5 A;  4M8M A;  4AJY B;  1R4M B;  3DVG X;  2RSU A;  3EFC A;  1TS4 A;  4FJY A;  3ABV B;  3APF A;  2BTE A;  3UIO B;  2KC1 A;  1C1Y B;  2ZZP B;  4GDK A;  4EE2 A;  1C76 A;  2WDT B;  2MH7 A;  1ZXI A;  1R4N I;  1MPE A;  3A4S C;  2G4S A;  1VDV A;  3DVG Y;  4CHK A;  1P3Q U;  4WJQ A;  3TBL D;  4ZRK A;  3M62 B;  1TZO A;  5KHQ A;  4BFR A;  2WXH A;  2LJI A;  3ZNZ B;  2AWT A;  1IUE A;  5D6J B;  1QF6 A;  1WM3 A;  2XK5 B;  4ANV A;  3N20 C;  1WRD B;  1N5W A;  3QQ8 B;  2KMA A;  4HDO A;  2PE9 A;  1SE9 A;  1RWS A;  2LVO A;  1LQB A;  3U4E G;  3MTN B;  5MPO A;  3ZO5 B;  4W9C A;  4BBN C;  3VXW A;  2KX0 A;  3C8Y A;  4GXB A;  2PW9 A;  1KFY B;  5GXG B;  1UH6 A;  4FUL A;  3A33 B;  2BB5 A;  2WNM A;  1E8Y A;  1XCQ L;  5E6J A;  5LXI B;  3PHW B;  3UF8 A;  3NUH B;  4ZYS A;  1LGR A;  1WGR A;  2KAJ A;  5L95 C;  1C77 A;  3IBE A;  5BO4 B;  1ESF A;  1WJ6 A;  4ANX A;  5EE1 A;  3P2B A;  4ZRP A;  5HFY A;  4GMV A;  1J7C A;  2C7M B;  2PMV A;  3KQ4 A;  3RNA C;  3SU8 X;  3ZNG C;  2KK8 A;  2J0J A;  4RF0 A;  2KWC A;  3AB5 A;  3IT6 B;  4ZOH C;  1EWY C;  2IYD B;  4DBG A;  1YJJ A;  3NG0 A;  4FXC A;  2LHD A;  4YL8 A;  5AZF A;  2AX5 A;  1KRH A;  3RNF C;  3VDZ A;  4L2Y A;  2KWV B;  2YEP B;  4N9F 4;  1YJ1 A;  4HEA 1;  2N9L A;  1L6V A;  3TEW A;  2KFK B;  2W54 A;  4OVZ A;  2KDI A;  2Q5W D;  2FCS A;  1RM6 C;  1UGJ A;  3GS2 A;  2NMQ A;  1V80 A;  4HKZ E;  5H8Y E;  3R7R A;  4RNA A;  2OHF A;  1TKG A;  1F77 A;  1F9J A;  2J4X A;  1WGY A;  4IM0 A;  3NZ3 A;  3ML9 A;  4DHJ D;  5HG2 A;  2K8B A;  3B08 A;  3A9J B;  3LJ3 A;  1NVI D;  3GZN I;  1NYQ A;  3APD A;  2K1F A;  1V86 A;  1EU3 A;  1BML C;  4EKU A;  3VH3 B;  4HJK A;  2M56 B;  1EU4 A;  2SAK A;  1D5M C;  1EO6 A;  4KIK B;  4FAD A;  4YSX B;  3ZLZ A;  1D5Z C;  2OJR A;  3N1X C;  3PZ8 A;  4US9 A;  3VHT C;  2N1W A;  4F1S A;  2KOX A;  2C5L C;  4HKQ A;  4EOY A;  2D3B A;  4NJC A;  2WQY B;  4S17 A;  4XC2 A;  1P0R A;  1ACC A;  3R2I A;  2D2Q A;  4DHZ E;  4CYE A;  1SE2 A;  2GBJ A;  3H1U A;  4NQL B;  5C1Z A;  4JQW C;  5LLI A;  3U7Z A;  3TCA A;  2BPS A;  3R3M A;  3DPD A;  3UI3 A;  1UUP A;  3L10 B;  1UWM A;  4RGO S;  2L0F A;  4WQO B;  1BXT A;  4DDG D;  2AEH A;  3GE8 C;  2LJ5 A;  2UWQ A;  4GDL A;  2LEK A;  2J7Q B;  1TTN A;  2QC8 A;  5CHF A;  1EUV B;  3A9K B;  4MGK E;  3EEC A;  4XE0 A;  4W9K A;  4IW0 A;  1SSN A;  4M8N A;  2GRI A;  1XT9 B;  4IWQ A;  2YLM A;  2QMT A;  2V3P A;  1QKZ A;  2ACZ B;  2LXA A;  1TJE A;  1DGJ A;  1XCT L;  5G2N A;  4IUM B;  5E6O A;  3ZXR A;  3VH4 B;  5CHV C;  3Q8C A;  4LNO A;  1CZP A;  2GBN A;  1FNU A;  3PPA A;  3GZN B;  2MA9 B;  1ZDX A;  2WDR B;  2AYO B;  1CMX B;  3RNE C;  1T5X D;  2ZW0 A;  5AUK A;  4LJP B;  1WRI A;  1XXG A;  2V4L A;  3PZ7 A;  1UD7 A;  1E7P B;  2LVQ A;  5I4D A;  4C7Y A;  2JXT A;  4L1B A;  1D3Z A;  3L08 A;  4BAX A;  4NY0 A;  2EKE C;  1NEN B;  5T8I A;  2L3Z A;  3VRB B;  3HUI A;  3DWG C;  3LDZ E;  1ZOY B;  4CQN A;  4FHK A;  4GLS C;  1EF1 A;  1MHH E;  4TQ0 A;  3ZGZ A;  2WXM A;  1GOZ A;  4Q2J A;  1U4A A;  5D94 A;  2KNB A;  4WWN A;  3PTF C;  2X38 A;  4GIV A;  2KTF A;  4RCO A;  3CMM B;  4WH4 A;  3ETR A;  1ZGU B;  1I4H A;  1WXS A;  3O65 B;  3R7Q A;  4OZC A;  4X57 B;  4BKS A;  4GN1 A;  4HJG E;  1JWM D;  2KZR A;  3WA0 A;  1R4M I;  5DPT A;  1YN3 A;  2ICI A;  3UQA A;  2KN4 A;  4FBJ B;  1RFA A;  2KDM A;  3BK1 A;  1WZ0 A;  3L17 A;  4W9I A;  1KJT A;  4MSQ B;  3H9D A;  2V3S A;  1QOF A;  2O2V B;  2FIF A;  3X23 A;  3BY4 B;  4ZRI A;  2IO3 B;  3ZKJ C;  3W1Y A;  2PIA A;  1UZX B;  2NBW B;  4ZHP A;  3MP9 A;  2KYW A;  1DOY A;  4PK1 A;  2PKO A;  2L83 A;  4IC7 B;  4A3O A;  1UF0 A;  3DHI C;  4IDI A;  3RUL A;  4HVB A;  3MFG A;  5JHA A;  1Y8R C;  4P6V F;  4QAY A;  1OTR B;  3OJ4 B;  4B95 A;  2ASQ A;  2LGS A;  2IO0 B;  1TGZ B;  1WH3 A;  3C0R B;  3ALB A;  4IOI E;  4NJ7 A;  3TUO A;  1V2Y A;  3Q8A A;  2KO3 A;  2RPV A;  2WYQ A;  2NR2 A;  2M8S A;  4US8 A;  4IWP A;  5C23 A;  3KW5 B;  3Q3F A;  1C3T A;  1EWC A;  3UQB A;  1YX6 B;  3IAM 1;  1WMH B;  1YX5 B;  1OEY A;  3AE9 B;  2D3C A;  3R2T A;  2TSS A;  2K0P A;  1IYF A;  1MI0 A;  1A5R A;  1JWB D;  1HZ5 A;  1P7F A;  5LNK 1;  4A3P A;  3VRA B;  3PLU A;  4MH0 E;  2DYM A;  4ZRQ A;  2CU3 A;  2AL6 A;  3AV8 A;  1YIW A;  2FCQ A;  1IGC A;  2X8X X;  2J42 A;  3DBS A;  2GLS A;  1Q0W B;  2QEJ C;  1XQQ A;  2G4D B;  5BMI A;  1S1Q B;  2MLB A;  2RPQ A;  3DCG A;  3P4Q B;  3PRE A;  4WQM A;  4GB9 A;  2KQ4 X;  3VR9 B;  1EF5 A;  2BKR B;  4OHJ A;  3U7D A;  3NS1 A;  2L76 A;  2GBM A;  4EFO A;  3H7P A;  3TSS A;  3A1Q A;  1F2R C;  2SEB D;  3DBR B;  4F7Z A;  1DOX A;  2WXG A;  2YEP F;  1FM0 D;  3VTW A; 
#chains in the Genus database with same CATH homology
 1WM3 A;  2XK5 B;  1V9J A;  2ZEQ A;  4ANV A;  3PLV A;  3CST A;  1WRD B;  3QQ8 B;  5AZG A;  2IY0 B;  4MGZ E;  4BKS D;  2KMA A;  2MBO A;  2MQJ A;  1Z2M A;  4HDO A;  3NZS A;  2PE9 A;  4BKT A;  1SE9 A;  4DK5 A;  2LVO A;  3A9J A;  1E7V A;  1LQB A;  1I35 A;  4AUQ C;  2LGX A;  4ASW C;  2Z0D B;  3MTN B;  4NAW A;  2N9X A;  2DX5 B;  5AEK B;  3ZO5 B;  4W9C A;  4BBN C;  1V49 A;  1V5T A;  2DYO A;  2DZJ A;  2WX1 A;  2KX0 A;  3KUC B;  4W9G A;  5IAA C;  3VXW A;  4GXB A;  1ISN A;  3DDC B;  4LDT B;  3PHX B;  4MGY E;  1UGM A;  4KV2 A;  2DZM A;  2NPT B;  4W9J A;  2JRI B;  1PQS A;  1UH6 A;  2KJ6 A;  2IO1 B;  2MP2 B;  4FUL A;  1E8X A;  3A33 B;  4DXA B;  3BIN A;  2MW5 A;  1HE8 A;  4KSL C;  3HM3 A;  2HD5 B;  2N1V A;  1E8Y A;  3L54 A;  3QCA A;  5LXI B;  2L0T A;  3PHW B;  3UF8 A;  3V61 A;  3PRZ A;  2LUE A;  2G45 B;  2I1K A;  2R2Q A;  1E8Z A;  4MEL A;  3DBH I;  1NI2 A;  2QHO A;  1YQB A;  4WJP A;  4AP4 C;  4RM8 A;  4PYU A;  1WGR A;  1Q1O A;  4EZK A;  4W9E A;  5L95 C;  2WX0 A;  2LRW A;  1WE7 A;  4B6W A;  3IBE A;  5BO4 B;  1WJ6 A;  2L8J A;  4ANX A;  4TQ1 A;  2MWS B;  3P2B A;  2J0M A;  3NS8 A;  4NAW B;  4NJ6 A;  4GMV A;  1T0Y A;  2C7M B;  3IVF A;  3SU8 X;  2KD0 A;  2KK8 A;  2J0J A;  2D10 A;  3L0W B;  2LI5 A;  3ZNG C;  4AOF A;  4MSM B;  3RZF A;  3HHM A;  2MCN B;  2KWC A;  1WJU A;  5DPW A;  2ZNV B;  4G3X B;  3Q3J A;  2KX3 A;  2WWZ A;  3IFW B;  2N7E A;  5CHW A;  2IYD B;  4DBG A;  2NVU I;  4ZDV A;  4HXD A;  3PT2 B;  4KDI C;  2MRP A;  4YL8 A;  3VUX A;  4A20 A;  5AZF A;  4IG7 B;  4G0N B;  3ZTD A;  2RGF A;  4URK A;  3VDZ A;  2KWV B;  4WAA A;  2DZK A;  3RUI B;  4MDK E;  4XX5 A;  2IBI B;  4N9F 4;  3SD5 A;  3APC A;  3SHQ A;  3CSF A;  2ZJD A;  2LGD A;  1YJ1 A;  4KDL B;  2G3Q B;  3ZTC A;  3M3J A;  2KFK B;  3RZW C;  1KM7 A;  1WYW B;  3N32 A;  2O6V B;  3TIX A;  2K8C A;  4KZC A;  4HPL B;  4IM2 A;  2BYV E;  2KDI A;  4HWI B;  1V81 A;  1AAR A;  3UGB B;  3WAM A;  2FCS A;  2D11 A;  1RRB A;  2JZZ A;  2D3G A;  1WGH A;  3RT3 B;  2XBB C;  1VCB A;  1E8W A;  4HLE A;  2LVP A;  4TUU A;  1V80 A;  4EEW A;  4PYZ A;  3R7R A;  4BKG A;  3NY5 A;  3W1S A;  1MG8 A;  3QAR A;  4CO7 A;  3PZD A;  1F9J A;  1WGY A;  2A5U A;  4IM0 A;  3ML9 A;  4DHJ D;  5IA7 A;  1WI0 A;  3PS6 A;  3D32 A;  2M17 A;  4IWO A;  3PRM B;  2K8B A;  3W1S C;  2NBV B;  3B08 A;  5E6N A;  3A9J B;  3LJ3 A;  3GZN I;  3QK0 A;  4BOS C;  2JT4 B;  3APD A;  3RD2 A;  5KHO A;  2K1F A;  1V86 A;  2K25 A;  3ZNH B;  3RCZ A;  4FHJ A;  1IP9 A;  4EKU A;  2EMS A;  3EFU A;  2Z0E B;  3VH3 B;  1OGW A;  4HJK A;  4JLC A;  3AU5 A;  3JW0 X;  4KZ0 A;  2KJR A;  3KUZ A;  1WX7 A;  1EO6 A;  4KIK B;  1E5W A;  2L05 A;  4FAD A;  3IHP C;  1WMH A;  3ZLZ A;  4NNJ B;  4LJO B;  2KKC A;  1GC7 A;  4TKN A;  2OJR A;  3ZDM C;  2K6D B;  3VHT C;  1SIF A;  2N1W A;  2O2V A;  3UIP B;  4F1S A;  2KOX A;  2C5L C;  4KSK C;  4WJN A;  4EOY A;  1BT0 A;  3ZVV A;  2LRU A;  4K7U A;  2M4N A;  3A9K A;  4W9H A;  2CHZ A;  4DWF A;  3GOE A;  4XC2 A;  3PRP B;  1P0R A;  2D2Q A;  4PS7 A;  4XZ4 A;  3VUW A;  3PGE A;  2LD9 A;  4DHZ E;  4CYE A;  1WR1 A;  2GBJ A;  3H1U A;  4NQL B;  5C1Z A;  3DQV A;  4JQW C;  2KMC A;  1WZ3 A;  1WM2 A;  3QIJ A;  4MJS A;  5LLI A;  3WAN A;  1WJ4 A;  3TCA A;  2BPS A;  2KFJ A;  1WR6 E;  4AJW A;  2FUH B;  3R3M A;  3DPD A;  3K9P B;  3QHT A;  1RLF A;  2Z59 B;  3L10 B;  2NCN A;  2BYE A;  1WXV A;  2L0F A;  1RAX A;  2JY6 A;  2JZ3 B;  4WQO B;  3ZW3 A;  4DDG D;  3K9O B;  3QWZ B;  2AEH A;  4ICV A;  2LJ5 A;  2UWQ A;  2BWE S;  2CHW A;  4GDL A;  2J7Q B;  3WAO A;  2MSE D;  1TTN A;  2EMT A;  5CHF A;  1EUV B;  3A9K B;  3ZUN A;  4GU2 A;  2GMI C;  4MGK E;  3EEC A;  2PJH A;  4W9K A;  4KVG B;  4JGH B;  3PVL A;  3DOW A;  4IW0 A;  1WXA A;  4MEM A;  5J17 A;  1WE6 A;  5DPR A;  2MBB B;  4M8N A;  3N30 A;  3R66 C;  1XT9 B;  3ML8 A;  4IWQ A;  2O6V A;  4AWJ A;  3EHV A;  4DDI D;  3VTU A;  4K7S A;  5D7G A;  2YLM A;  2NPT A;  3ZIM A;  1P98 A;  2HE7 A;  4LDT D;  1UBQ A;  3I3T B;  4GOC A;  1Z5S B;  2LXA A;  2MX2 A;  2N4F A;  5LXH A;  3DBL I;  3IG3 A;  4HCP B;  2K8H A;  4PS3 A;  3ECI A;  5G2N A;  4IUM B;  2ZCB A;  5E6O A;  2CKH B;  2V1Y A;  4GDL B;  3VH4 B;  2BF8 B;  2KC2 A;  5CHV C;  1S3S G;  4EZJ A;  2GBN A;  1WIA A;  2DAJ A;  4JL9 A;  2M1M A;  2KTR B;  1GG3 A;  3PPA A;  2MA9 B;  3HIZ A;  4HDQ A;  1UEL A;  3U30 A;  2AYO B;  2DYB A;  1GJZ A;  1CMX B;  2PPH A;  2ZPY A;  3H7P B;  1E7U A;  3AI5 A;  3T8M A;  3TL5 A;  3B0A A;  2KQ7 A;  4FJV B;  2DAF A;  2PEA A;  4LJP B;  2YVC A;  2LGY A;  3DVN V;  1G6J A;  4K81 A;  1K8R B;  2GBR A;  2V4L A;  4PS8 A;  1UD7 A;  2BWF A;  2C9W B;  1LM8 B;  4MM3 A;  4KIK A;  2LVQ A;  4M0W B;  2GOW A;  4OVV A;  1D3Z A;  3L08 A;  4NY0 A;  4BOZ B;  4GDK B;  1KOT A;  2C7H A;  2EKE C;  3VQI A;  2AL3 A;  3OJ3 A;  2JPH A;  4DHJ B;  4TV3 A;  2L3Z A;  4W9D A;  4RMA A;  3LDZ E;  4E71 A;  3JVZ X;  3UIN B;  2KDB A;  4FHK A;  4BBN F;  3DBR I;  1WJN A;  3TJP A;  3ZNI D;  1EF1 A;  4E74 A;  4DHZ B;  1WFY A;  1OQY A;  1ZW7 A;  5G55 A;  2KLG A;  4TQ0 A;  4IM3 A;  2IZV B;  5FR6 A;  3KYC D;  3L13 A;  2ZVO A;  2IY1 B;  2B3A A;  3A4R A;  3PSE B;  1U4A A;  5D94 A;  2KNB A;  2KXJ A;  4WWN A;  3PTF C;  4I6N B;  5CX3 A;  2NBU A;  3WAL A;  4GIV A;  2KTF A;  3QX1 A;  3EC8 A;  5JZE B;  2KJH B;  3CMM B;  2LWP A;  1ZGU B;  1WXS A;  3NZU A;  3TMP B;  3O65 B;  2MBE A;  3R7Q A;  1OEY J;  2OOB B;  4X57 B;  4BKS A;  4GN1 A;  4E3C A;  3M95 A;  4ZRJ A;  1H8C A;  1LXD A;  4LCD E;  5J18 A;  1SGH A;  2KZR A;  2REX A;  3V6C B;  3WA0 A;  2BKF A;  1P1A A;  1R4M I;  2HTH A;  2VRR B;  2J0K A;  5DPT A;  1I42 A;  3HK0 A;  3UQA A;  1WY8 A;  2FCM A;  2ZNV C;  1L7Y A;  4II3 B;  4EZL A;  1Q5W B;  4P7I A;  2RD0 A;  4FJZ A;  1GC6 A;  4FBJ B;  1RFA A;  1M94 A;  3S2A A;  1J0G A;  3JSV A;  1WZ0 A;  3L17 A;  2JUO A;  3WAP A;  2CS4 A;  4ANW A;  4W9I A;  1X1M A;  2FCN A;  2KLC A;  1KJT A;  4MSQ B;  4GGQ A;  3H9D A;  5AZH A;  3X0W A;  2JWZ A;  4NQK E;  2V3S A;  3L16 A;  1IPG A;  1WX8 A;  5GMV A;  4OVU A;  2D07 B;  2O2V B;  3ZRF A;  2FIF A;  3X23 A;  1V5O A;  3OAW A;  3BY4 B;  3MHS D;  2L7R A;  5CTR C;  3QA8 A;  4ZRI A;  2IO3 B;  3HM6 X;  1WXM A;  2KDE B;  2XEW A;  3KVF B;  4ZYN A;  3VTV A;  3ZKJ C;  2JVC A;  3W1Y A;  4HPM B;  1TBE A;  5E6P A;  1KLV A;  1UZX B;  3U8Z A;  2NBW B;  3RYT A;  2KQS A;  2KWU B;  2DHZ A;  3CF6 E;  3QC8 B;  5J2R A;  2CU1 A;  4K7W A;  2JRH A;  4W9F A;  1GUA B;  1TZ1 A;  2LZ6 A;  4MJS B;  3ONS A;  5DPS A;  1ZKH A;  4NPN A;  4IC7 B;  4A3O A;  5L83 A;  3N3K B;  2JXX A;  3RUL A;  4HVB A;  1WX9 A;  5JHA A;  3JSV B;  1NBF C;  2IO2 B;  1Y8R C;  3V62 A;  1J8C A;  2C60 A;  2L00 B;  4J6I A;  1OTR B;  4HCN B;  3NHE B;  3KUD B;  2UYZ B;  5D2M B;  2FID A;  1WGG A;  2CHX A;  3AU4 A;  3OJ4 B;  4B95 A;  2ASQ A;  2FAZ A;  2ZPN A;  4WWO A;  3DVN U;  2IO0 B;  4EUT A;  1UBI A;  2KFK A;  1TGZ B;  4W9L A;  1WH3 A;  3C0R B;  3ALB A;  4NJ7 A;  2R2O A;  3H7S A;  2K6Q A;  1J19 A;  1V2Y A;  2GBK A;  3M63 B;  4WJO A;  4B9K A;  2KO3 A;  1JRU A;  2HJ8 A;  3KYD D;  2JF5 A;  2MP2 A;  2NR2 A;  2WYQ A;  2M8S A;  3PV1 A;  1WF9 A;  3ZDT A;  3AXC A;  4G11 A;  4K1R B;  3H6N A;  1YD8 U;  4IWP A;  3ZRC A;  2DZI A;  2CR5 A;  5C23 A;  3KW5 B;  3Q3F A;  1C3T A;  3MJW A;  1L2N A;  2N9E B;  1NDD A;  3UQB A;  4I6L B;  1YX6 B;  2RR9 A;  4JIO U;  1GNU A;  1WMH B;  1YX5 B;  2I1J A;  3OLM D;  4ANU A;  1OEY A;  1V6E A;  2O6V D;  1H4R A;  2ZCC A;  3QAQ A;  3VFK A;  3AUL A;  2KHW B;  2K39 A;  2LXC A;  3T9L A;  1WGD A;  2KN5 A;  1E90 A;  4II2 B;  4GSW A;  2A4Z A;  4FLH A;  5TR5 A;  1IYF A;  1A5R A;  4RM9 A;  2DEN B;  4WWP A;  2N7D A;  4A3P A;  2ZVN A;  3ENE A;  3PLU A;  2Y5B B;  4MH0 E;  2DYM A;  2KTR A;  3B1L X;  5HKH A;  2KDF B;  3VAW A;  1XD3 B;  3A1Q B;  4F8C B;  1QZE A;  5JHB A;  4M8M A;  2AL6 A;  2C7N B;  4G50 A;  4AJY B;  2KAN A;  3VUY A;  1YIW A;  2LAS A;  3DVG X;  2FCQ A;  5JH5 C;  2RSU A;  3DBS A;  2XK5 A;  1Q0W B;  2MBH A;  1XQQ A;  4MGI E;  5EDS A;  2G4D B;  4I6P A;  4FJY A;  3JYU A;  1S1Q B;  2MLB A;  3APF A;  2RPQ A;  3UIO B;  2KC1 A;  3DCG A;  1C1Y B;  2ZZP B;  3WIM A;  5DCN A;  3PRE A;  2KVR A;  4GDK A;  4GB9 A;  2WDT B;  3QJZ A;  4ICU A;  1FXT B;  1EF5 A;  2BKR B;  2N9P C;  2NS5 A;  2MBQ A;  3U7D A;  3KH0 A;  1R4N I;  2L76 A;  3NOB A;  2GBM A;  4EFO A;  4HK2 A;  3V60 A;  3A4S C;  2BGF A;  2G4S A;  3DVG Y;  3H7P A;  3VVW B;  4CHK A;  2W9N A;  1P3Q U;  3A1Q A;  3V6E B;  2BYF A;  4WJQ A;  2PE6 B;  3TBL D;  4ZRK A;  2FNJ B;  4FN2 A;  4BVU C;  3M62 B;  1LFD A;  5KHQ A;  4F7Z A;  1P9D U;  1VD2 A;  4BFR A;  3ZNZ B;  4FA6 A;  3SDL C;  2AWT A;  2M0X A;  5D6J B;  3VTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...