3V62A

Structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
73
Chain Sequence
PETHINLVSDGSSEIFFITTPLRRLMEAFARQGEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
total genus 11
structure length 73
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v62A00
4WWNA 4IM0A 2CKHB 3Q3JA 2C60A 4NJ6A 3IHPC 1D3ZA 3L10B 2JVCA 3SDLC 1YX6B 3WAPA 5BO4B 3KYDD 4BFRA 4EZLA 3ZVVA 1Q0WB 5D94A 3A4RA 1LQBA 1KM7A 4WJNA 2A5UA 4YL8A 4IG7B 3BINA 3ECIA 4F7ZA 4EUTA 2J7QB 2KZRA 1V5TA 4W9GA 2IBIB 4J6IA 4W9EA 1H4RA 3H1UA 2CHZA 3NY5A 4JIOU 2IO3B 1P3QU 2EKEC 4EFOA 4IUMB 4JQWC 1HE8A 4GDLA 5L95C 2LGXA 1V49A 1YX5B 2MBOA 4ZRJA 2DYMA 3AU5A 2FCQA 2PEAA 4A3PA 1WH3A 3L08A 4HXDA 1YD8U 4NQKE 5D2MB 5E6NA 3PLUA 1WM2A 1ZKHA 2N9EB 3A4SC 1WX9A 2AEHA 2ZVNA 2NBUA 2AL6A 3OJ4B 3VUXA 1UBIA 4WWOA 3W1YA 4LJPB 3JSVA 2B3AA 3QCAA 1UH6A 2DZJA 4URKA 4MGYE 3A1QA 2JXXA 4FLHA 2D11A 2K39A 1VCBA 3M95A 1OQYA 2WX1A 1KOTA 2KHWB 2KTRA 4ZDVA 2GBRA 2L0FA 2LVOA 2BWFA 1T0YA 5JHBA 2ZNVB 3K9PB 3PS6A 1GC7A 3AI5A 5DCNA 3QC8B 1NI2A 3JVZX 4CHKA 2Y5BB 4ANVA 1I42A 2MA9B 3QARA 4I6PA 3V60A 4BOSC 2K8BA 3DCGA 3PRPB 2MP2A 4NNJB 2C7HA 2C5LC 1KJTA 4FHJA 4I6NB 4LDTB 2RPQA 4NJ7A 4W9HA 2DYOA 4N9F4 2D10A 4EEWA 2MBEA 2N4FA 1WM3A 3APCA 2XK5B 2BKFA 5EDSA 3PLVA 1E7VA 5J2RA 3R66C 3AULA 1JRUA 3VVWB 1Z5SB 3OLMD 3EECA 2KC2A 1WJNA 1WZ3A 3ALBA 2LASA 2CHXA 1GNUA 4IC7B 3KVFB 3ZRCA 2I1JA 2DENB 2KDIA 2DAJA 3QJZA 4ANXA 5DPRA 3DBLI 4K7WA 2V4LA 4RM9A 1V9JA 1XT9B 1X1MA 2NCNA 2KANA 1ISNA 1E5WA 2D07B 4DHZB 1YQBA 2DAFA 1QZEA 2KK8A 2KWUB 4M0WB 2KMCA 2DZKA 4OVVA 2IY0B 1WGYA 3SU8X 3AU4A 3V62A 3P2BA 3HM3A 4DWFA 4HJKA 2KN5A 1S1QB 4AWJA 3H9DA 2KJ6A 5AEKB 3ZNGC 2BGFA 2LGDA 1Q1OA 1FXTB 4WJPA 1I35A 4BBNF 4W9DA 4W9JA 2OOBB 3A9KA 4BKGA 3CSFA 3ML8A 3UIPB 3DBSA 1V6EA 2L7RA 2N1VA 3KYCD 2REXA 2J0MA 4TQ0A 2J0KA 1WX8A 2C7MB 5CTRC 4MJSB 4XC2A 2O6VD 1VD2A 2KKCA 1WR1A 4KZCA 5CHWA 3RYTA 2NPTA 4DDGD 1S3SG 1V80A 3IFWB 4AJYB 2KMAA 1YJ1A 2MQJA 2O6VA 2MWSB 2KWCA 2CHWA 1GC6A 1RFAA 1WE6A 2O6VB 3CSTA 2BYFA 2AYOB 3KH0A 3DVGX 1K8RB 1P0RA 1WJ6A 1WXAA 4MGZE 4JLCA 4BKTA 2L3ZA 4GOCA 1E8WA 4K7UA 2JPHA 2L05A 3X23A 2N9PC 2XEWA 4AOFA 2KQ7A 4HDQA 4MM3A 4TKNA 4K7SA 2M8SA 1WXSA 2K8CA 3RZWC 2LRUA 1CMXB 2M1MA 2KWVB 2KOXA 2JT4B 2JY6A 4HDOA 3QK0A 2MCNB 4GSWA 3B1LX 4II2B 5AZHA 3UGBB 2KXJA 5TR5A 3C0RB 5DPSA 5AZFA 3L17A 4GGQA 2OJRA 3KW5B 2HE7A 3K9OB 3KUCB 3N30A 4FJVB 3HM6X 1BT0A 2NBVB 2BYEA 4KZ0A 1XD3B 2O2VA 4DXAB 4HVBA 3ZO5B 4E71A 1WF9A 4GMVA 3IBEA 4GDLB 2ZPYA 1M94A 2KD0A 4EKUA 2KTFA 3ENEA 3QIJA 2BYVE 3SD5A 5E6OA 2LVPA 3ZUNA 1RRBA 1A5RA 3ZRFA 3JYUA 3L0WB 2ZCCA 4DHJD 1Z2MA 2DYBA 2UWQA 1NBFC 1P9DU 1V2YA 2L0TA 1IPGA 3PHWB 4GU2A 5CX3A 2JZZA 4KIKA 3JSVB 3PREA 1P98A 5D7GA 3NHEB 4KVGB 3A1QB 4HWIB 3EFUA 2J0JA 2YLMA 4IWOA 3R7QA 3W1SA 2MBBB 2ZJDA 3VUYA 4DHJB 2HD5B 2KTRB 2ZCBA 4GN1A 1ZW7A 2LD9A 1TZ1A 5JZEB 1V5OA 2KFJA 2MW5A 2ASQA 2CR5A 4CYEA 3X0WA 4PS7A 1L2NA 2IO0B 2MSED 2KDBA 5DPWA 2Z0DB 3PTFC 3VHTC 1C3TA 5JH5C 3L16A 5KHQA 3A9JA 3UQAA 2KDEB 5CHVC 2RGFA 3ML9A 2MP2B 2L8JA 4MSQB 3KUZA 3ZDTA 3HIZA 1GG3A 4HK2A 2FCMA 4RMAA 1V86A 2ZZPB 2BWES 2KLGA 4NQLB 5FR6A 1F9JA 4AP4C 1RLFA 5GMVA 3V6EB 3VDZA 2FIDA 4GDKA 1NDDA 2ZVOA 2NBWB 1EF1A 2RSUA 1E8ZA 4W9FA 3ZTCA 2IY1B 2LWPA 2JRIB 2D2QA 3DVNV 1WX7A 4OVUA 3QA8A 4X57B 3PGEA 3DDCB 3ZIMA 3RD2A 4BVUC 4LCDE 2KX0A 3DOWA 2KQSA 3W1SC 2RR9A 3PZDA 1XQQA 2A4ZA 1ZGUB 2M0XA 3CMMB 3H6NA 1J19A 4MGIE 4TQ1A 2KJRA 2MRPA 3DPDA 4HCNB 3QHTA 1Y8RC 3NS8A 1TBEA 2G4SA 2BF8B 3QAQA 1TGZB 4MEMA 3NZUA 4W9CA 4MGKE 3ZNZB 5IA7A 2LXCA 3H7SA 2RD0A 1E8YA 3PPAA 3TMPB 2KVRA 4E74A 2XBBC 4DBGA 1WIAA 2IZVB 4MDKE 1R4NI 3N32A 2L00B 2MBQA 2R2OA 3A9KB 4A20A 3PVLA 4IM2A 4FN2A 2W9NA 1WGDA 2MBHA 3A33B 4TUUA 1R4MI 4ICUA 2VRRB 1PQSA 2IO1B 2K6QA 3M63B 3NZSA 3UQBA 2LXAA 2FCSA 2KJHB 2QHOA 4IWQA 3B08A 3WAOA 1IP9A 3KUDB 4XX5A 2GBNA 3VH4B 1LFDA 2NPTB 1SE9A 2PE9A 4PS3A 4B95A 2KX3A 4BKSD 3DBHI 2N7DA 3PRMB 1EO6A 5E6PA 1WGHA 3EC8A 3QX1A 5CHFA 4CO7A 5DPTA 1WY8A 3DVGY 2KFKA 3DBRI 3HHMA 2BPSA 3H7PA 3QWZB 4HLEA 3BY4B 4BKSA 3PT2B 4MH0E 2LGYA 1EUVB 2G3QB 2K8HA 2R2QA 4ANWA 1WMHA 5C23A 4FHKA 4GXBA 3RULA 2JUOA 3DVNU 4FJZA 3LDZE 3T8MA 1J8CA 3EHVA 2PJHA 3NOBA 4F1SA 4II3B 4MSMB 3VQIA 1J0GA 4FADA 1UGMA 4EZKA 2C7NB 1WXVA 4WAAA 4P7IA 1H8CA 5HKHA 3LJ3A 4M8NA 4DHZE 5JHAA 2EMTA 2CS4A 2K1FA 4ICVA 2O2VB 3M62B 3TCAA 3ZW3A 3PRZA 1GUAB 3TJPA 3APFA 3UINB 2L76A 4IWPA 1RAXA 2GMIC 2BKRB 4ZRIA 1WGGA 1WJ4A 1OTRB 1WZ0A 2EMSA 2KNBA 2PE6B 3I3TB 4LJOB 4PYZA 3ZLZA 5IAAC 2I1KA 5LXIB 2DZMA 3T9LA 3B0AA 2DZIA 2G45B 4NAWA 2MX2A 4E3CA 1OEYJ 3D32A 2YVCA 4NAWB 4BOZB 2IYDB 4JL9A 4KIKB 1OEYA 1C1YB 2FAZA 4FULA 3GOEA 2KDFB 4KSKC 3MHSD 4MELA 2DX5B 1LM8B 2LZ6A 5L83A 2N7EA 1SGHA 2N9XA 4W9KA 2AL3A 2K6DB 1WJUA 3AXCA 2HJ8A 2JRHA 2UYZB 3TL5A 3O65B 4M8MA 1G6JA 4ANUA 2V3SA 4WQOB 2GBKA 4KDIC 3ZTDA 2D3GA 2FCNA 2C9WB 4RM8A 1OGWA 2JF5A 2MLBA 3VUWA 4B6WA 4IW0A 5KHOA 3U30A 4NY0A 3A9JB 1E8XA 1LXDA 3WAMA 2FNJB 4BBNC 2KO3A 5G55A 4G0NB 1E7UA 1Q5WB 1MG8A 2PPHA 2KC1A 1TTNA 3GZNI 2FUHB 4K1RB 4KSLC 4LDTD 3WA0A 4G3XB 4HPLB 3APDA 1EF5A 4DK5A 4ASWC 4G50A 4KV2A 3UF8A 3WIMA 5D6JB 2LUEA 3PHXB 4GDKB 1UELA 4GB9A 4IM3A 2DHZA 2KLCA 4EOYA 4FJYA 3R7RA 4FBJB 2JZ3B 3VFKA 2AWTA 2JWZA 2GOWA 3M3JA 2NS5A 3V61A 2XK5A 4HPMB 2GBJA 3L13A 1WR6E 4NPNA 1UD7A 1KLVA 1U4AA 3SHQA 1SIFA 2ZPNA 3OAWA 1UBQA 2CU1A 3VAWA 2FIFA 3WANA 1WE7A 2K25A 1V81A 1WYWB 3RT3B 3JW0X 3V6CB 1UZXB 4JGHB 1WI0A 5C1ZA 3PV1A 2LJ5A 3DQVA 4F8CB 3U7DA 2WX0A 4EZJA 2V1YA 3HK0A 3ONSA 2G4DB 4KDLB 4PYUA 4ZRKA 3L54A 4PS8A 3TBLD 3ZNID 1L7YA 5J17A 4XZ4A 2ZEQA 3IG3A 3ZDMC 3ZNHB 1WXMA 2ZNVC 3VTWA 4AUQC 3CF6E 4WJQA 2IO2B 2Z0EB 1P1AA 3N3KB 1GJZA 2WDTB 3MTNB 3ZKJC 1WGRA 2LI5A 3VTUA 4B9KA 5LLIA 3TIXA 3PSEB 3MJWA 2NR2A 4WJOA 5J18A 1E90A 5G2NA 4K81A 2LVQA 1YIWA 3IVFA 3S2AA 2M4NA 2GBMA 4DDID 2N1WA 4W9IA 2WWZA 1IYFA 2KFKB 4MJSA 3Q3FA 3H7PB 4G11A 3WALA 3RZFA 4HCPB 4ZYNA 1WRDB 1WMHB 3R3MA 3VXWA 3VTVA 5AZGA 4AJWA 2WYQA 3RCZA 2Z59B 3VH3B 1WFYA 5LXHA 2LRWA 4FA6A 4I6LB 1AARA 3OJ3A 3U8ZA 4GIVA 4A3OA 2NVUI 3QQ8B 4W9LA 3RUIB 2M17A 4TV3A 3UIOB 4WWPA 2HTHA
chains in the Genus database with same CATH superfamily
2NTSA 1FRRA 4C7YA 3AH7A 1D3ZA 3VRBB 1RM6C 1UGJA 4EZLA 3ZVVA 1Q0WB 3FILA 5D94A 1LQBA 2A5UA 3BINA 2SAKA 2EKEC 4EFOA 4JQWC 4N59A 4YXDB 4OZBA 3AU5A 1T0SC 3U4EG 4A3PA 4B0MA 1WH3A 4WURA 3PLUA 1NI3A 2WXLA 5EE1A 2NBUA 1XLPA 4WWOA 3JSVA 5FR3A 3QCAA 1IGCA 2J53A 1VCBA 3TUOA 2KTRA 3NVZA 2LVOA 1JWAD 1T0YA 3FKYA 5JHBA 2ZNVB 3K9PB 1GC7A 4LNIA 3QC8B 1NI2A 4CHKA 3H8HA 1HQRD 2MA9B 4I6PA 4S17A 3TEXA 4BOSC 3DCGA 2C5LC 4FHJA 4I6NB 2RPQA 4W9HA 2DYOA 1BUIC 5EDSA 1TY0A 1WJNA 2VZKD 3KVFB 4ARCA 4KGTA 1UUPA 2KDIA 4ANXA 4K7WA 4UDUC 4XDCA 1QKZA 1V9JA 2NCNA 4KKJA 3PZ8A 5TSSA 2X8XX 4DHZB 1YQBA 2KK8A 2GB1A 2Y3AA 3BYYB 3V62A 3HM3A 3H9DA 3NVYA 3ZNGC 4OZAA 1Q1OA 1MHHE 2ONQA 1I35A 4BBNF 4W9DA 4W9JA 3A9KA 3J9CA 3UIPB 5IN7A 2REXA 2J0KA 1WX8A 1CK1A 2O6VD 2KKCA 4KZCA 5BYSA 2UU7A 3U7ZA 4DDGD 1V80A 2KWDA 1YJ1A 2MQJA 2D3CA 1T0QC 1GC6A 1TKEA 3CSTA 2AYOB 3DVGX 1P0RA 1WJ6A 2L3ZA 4C80A 2L05A 1Y56A 4AOFA 2KQ7A 4HDQA 4MM3A 1I4PA 2K8CA 2ZW0A 2OHFA 2JY6A 1MHXA 1R4NB 3UGBB 3B1LX 1ROEA 4GGQA 3C8YA 3KW5B 1E7PB 1R4MB 4R3DA 3ZQ4A 4DXGA 1N60A 1XD3B 2O2VA 4RNAA 4E71A 4GDLB 4XE0A 1PDXA 1V1OA 1XCTL 5E6OA 3AN1A 2DYBA 2MH7A 2UWQA 2M19A 2JSVX 5CX3A 4KIKA 3PREA 3IAS1 4HWIB 4OZCA 2J0JA 1GPXA 4YSZB 1FMAD 1VZ6A 2LD9A 1TZ1A 2KFJA 2CR5A 4PS7A 2BS4B 2KDBA 5DPWA 2Z0DB 3Q3OC 3ZYYX 3OWEB 4O1NA 3VHTC 2KDEB 3ML9A 2K5PA 2MP2B 5C2TB 4P1CC 4WH4A 2RDHA 3HIZA 4HK2A 1V86A 2ZZPB 5FR6A 2CJOA 4HKZE 1F9JA 2INPE 4REZA 1ESFA 2NBWB 2PW9A 4QAYA 1E8ZA 2LWPA 3AV8A 3DVNV 3ZIMA 3DOWA 1XQQA 2A4ZA 4TQ1A 3CMMB 1J19A 2INNE 3NS8A 3RMKC 3PPAA 2KVRA 4E74A 2D3AA 1R4NI 1JALA 1F2RI 4FN2A 2MBHA 3B2GA 1R4MI 2AQ3B 1DOXA 2FCSA 4IWQA 2KMMA 2Y5CA 1SBBB 2ON8A 1V8CA 2NPTB 2PE9A 1ZDXA 1XXGA 2N7DA 3PRMB 1EO6A 2QCZA 2VH2A 1STEA 3EC8A 5CHFA 5E6PA 1WY8A 3DVGY 1BXTA 5HHDG 1SJED 4BKSA 3NVWA 1QOGA 1WMHA 5C23A 4FHKA 1MI0A 4MACA 3RULA 1B1ZA 2BS2B 3DVNU 2ICIA 2WDVB 4FJZA 3GE3C 2H88B 3NOBA 4F1SA 2WXJA 5JXVA 2C7NB 2WXPA 4HEA1 4WAAA 3RNBC 1EU3A 1H8CA 4RF0A 4M8NA 3DHGC 2K3UA 3N1ZC 3ZW3A 1GUAB 4MH8A 2GMIC 2EKIA 1M4VA 4ZRIA 2K0PA 1WZ0A 4LJOB 5LXIB 4NAMA 1ZOYB 2MHJA 4Q2JA 2LFIA 2NMQA 4E3CA 2MEKA 4LK0M 3BZDB 2E6XA 4YSXB 1OEYA 2FAZA 3GOEA 1L4ZB 1C4CA 1WRIA 5L83A 2AL3A 1AW7A 1HZ5A 3O65B 4M8MA 4YT0B 4WQOB 2GBKA 3ZTDA 3RN9C 2N7JA 2PMVA 4RM8A 2MLBA 2W82A 3VUWA 4IW0A 2WXOA 3WAMA 1LXDA 1JWMD 1Q5WB 1C79A 2FUHB 4KSLC 2LGSA 3APDA 2W3RA 1GB4A 2LUEA 4IM3A 2KLCA 4FJYA 3R7RA 1T5XD 2GOWA 1YQ3B 3AMZA 3ZGZA 4A90A 2GBJA 3L13A 1U4AA 1UBQA 2V4IB 3WANA 2K25A 1UZXB 4XGAB 3U7DA 1CZPA 5FK9C 3TBLD 4PS8A 3IG3A 3TEZA 2QILA 1YMHE 3CF6E 3N3KB 1WGRA 2LI5A 3VTUA 2VH1A 2Q5WD 4K81A 2LVQA 2M4NA 4DDID 2N1WA 4W9IA 5HI1A 1IYFA 3H7PB 4G11A 3WALA 4TSSA 1JROA 2PIAA 2B76B 3IT6B 3NS1A 2IPKD 2Z59B 1WFYA 4IDIA 3KWLA 4DQOC 3U8ZA 4A3OA 3U52E 2NVUI 4TV3A 4WWPA 3AEAB 4M00A 1YQ4B 3KQ4A 3I9V1 3Q3JA 2C60A 4NJ6A 3L10B 2JVCA 1AN8A 1FEHA 3KYDD 3W5UB 1TS2A 3MHZA 2IGGA 3B2FA 2KAJA 4EUTA 2J7QB 2KZRA 4XWTA 4W9GA 2IBIB 3AB5A 4J6IA 2PVOD 3AE5B 4W9EA 1PYWD 2TSSA 2CHZA 4JIOU 2L52A 1TYGB 1V49A 1YX5B 2MBOA 3HUIA 4BZAA 1E10A 4HXDA 5D2MB 3ABVB 1ZKHA 2FE8A 3A4SC 2AEHA 2ZVNA 1HXYD 3OJ4B 1XLQA 4URKA 4MGYE 4L23A 4FLHA 2JXXA 3N1XC 1QQRA 3RNEC 1JQ4A 1V1PA 4P6VF 2WXKA 1OQYA 3HVDA 4B0EA 5LNK1 3LYYA 3PS6A 2KVZA 1NEKB 1ENFA 2Y5BB 1I42A 1I4QA 2BQQA 4C4VA 3ETRA 4P1BC 2C7HA 2WXGA 1SXTA 3MP9A 3ZXVA 4EEWA 2MBEA 1WM3A 2BKFA 3SFDB 1SIJA 5J2RA 3AULA 1Z5SB 3GE8C 1GAQB 2KC2A 3EECA 2N9KA 2BTEA 1GNUA 2DENB 2DAJA 5DPRA 2V4LA 4RM9A 2L83A 1XT9B 1ISNA 2BW2A 2KWUB 1QZEA 4M0WB 4OVVA 2IY0B 2WGSA 4DWFA 4HJKA 1S1QB 3P4PB 2KJ6A 2LEKA 1BMLC 4WJPA 2BB5A 2EELA 1KFYB 5MPOA 2DBYA 3DBSA 4LNNA 2N1VA 1FIQA 3KYCD 1DOIA 2YEPB 3TEYA 4XC2A 2LHDA 4RGNA 3RYTA 1V97A 4HPPA 1S3SG 4AJYB 1T3QA 2MWSB 3C19A 3KH0A 5HFYA 4JPSA 4GOCA 3X23A 4K7UA 2JPHA 2XEWA 1GOZA 4K7SA 2M8SA 1WXSA 2LRUA 2KWVB 5GXGB 2KOXA 5IOIA 2JT4B 2BS3B 3QK0A 1ZPSA 4GSWA 1SE3A 3FILB 1TZOA 5TR5A 5AZFA 2OJRA 1WYGA 2HE7A 2WXIA 2QDFA 2JX5A 3N30A 4FJVB 3HM6X 1BT0A 2NBVB 4KZ0A 4DXAB 4HVBA 2KN4A 1UWMA 3IBEA 2ZPYA 2KD0A 2KTFA 3ZUNA 1K53A 3DBRB 4DHJD 4GU2A 1IPGA 3PHWB 2JZZA 3JSVB 1C77A 3EFUA 2YLMA 2ZJDA 1VJKA 2KTRB 2ZCBA 1AYFA 3GS2A 1V5OA 1Q10A 2MW5A 1L2NA 1QOBA 1FNUA 3N1YC 5BYQA 1SEBD 2KDMA 5JH5C 1C3TA 3L16A 5KHQA 3A9JA 3UQAA 5CHVC 2RGFA 4MSQB 4RMAA 1HEZE 2BWES 1WGKA 2QMTA 1YNTE 1UWXA 1RLFA 5GMVA 3V6EB 3ZJVA 2YEPF 4L2YA 4GDKA 1NDDA 1EF1A 4LNOA 4W9FA 3ZJUA 2IY1B 3P4SB 3QA8A 4X57B 1XCQL 3RD2A 1L0XB 4BVUC 4LCDE 2KQSA 2M0XA 1ZGUB 3H6NA 4HCNB 3QHTA 4FXCA 2G4SA 2BF8B 3QAQA 1TGZB 3NZUA 2IGHA 2LXCA 1E8YA 4DBGA 1FM0D 1WIAA 3N32A 2L00B 3AEBB 3A9KB 4YSYB 4IM2A 3A33B 2LUMA 2K6QA 3GB1A 4ACFA 3NZSA 3AE7B 2QHOA 3KUDB 4XX5A 3VH4B 4B95A 2KX3A 4JWUC 1HTOA 3AEEB 1TS3A 1TKGA 1OQQA 2WS3B 1TT5B 2KFKA 3DBRI 3O13A 4LNKA 1K50A 1EUVB 2G3QB 3AECB 4MM3B 3IXSA 4K3BA 3T8MA 3WCQA 2PJHA 3Q8FA 1J0GA 4EZKA 3AE8B 1WXVA 1IBXA 1RYJA 2QC8A 2K1FA 4ICVA 4XWWA 2O2VB 2WXQA 3PRZA 2D5GA 4YTMB 1FCCC 4IWPA 1RAXA 2PE6B 1WJ4A 2KNBA 4PYZA 3EGRA 2MJDA 1ZDVA 2DZIA 1MG4A 2Z8LA 2ACZB 3R2TA 4BOZB 4KIKB 1K51A 2WHIA 1C1YB 4AQ7A 2KDFB 2DX5B 2SEBD 1F0ZA 2WXRA 3TL5A 4A8XC 2C9WB 3E9SA 1OGWA 3BYTB 3U30A 1QILA 2FNJB 4LLGM 2KO3A 4G0NB 1E7UA 3BK2A 1MG8A 2PPHA 1TTNA 1I7HA 4HPLB 1F2RC 4J3OD 4ASWC 5D6JB 2OEDA 1FFUA 4FBJB 1C4PA 3VFKA 2AWTA 2XK5A 4HPMB 2W54A 2KACA 1WR6E 1A70A 4NPNA 1CQVA 3LB8C 3Q8CA 1JRPA 1WE7A 1V81A 4JGHB 1NVID 1WI0A 3DQVA 2RMMA 3BVMA 2V1YA 4PT5A 2G4DB 4PYUA 4ZRKA 1VRAB 5J17A 1N5XA 1SE2A 3ZDMC 1RFKA 1MJDA 2CU3A 2IO2B 2WU2B 2Z0EB 3MTNB 4PK1A 4WQMA 5LLIA 3TIXA 2GBMA 2WWZA 1PFDA 2ZW1A 4MJSA 3Q3FA 2WU5B 1T6BX 3RZFA 4ZYNA 1WMHB 4YWGG 4AJWA 2WYQA 1QLBB 3DBLB 3OJ3A 1N61A 3QQ8B 3UIOB 2WXFA 3T3OA 2HTHA 4YTNB 1ET9A 4WWNA 2W55A 5E6JA 4ZOHC 3IHPC 3SDLC 1YX6B 3WAPA 4BFRA 1DYQA 3BIID 5IP4D 1KM7A 2N0SB 4WJNA 4YL8A 4IG7B 3ECIA 2IDYA 2JU6X 2CJNA 3VR8B 1J7CA 3NY5A 2IO3B 1P3QU 3VR9B 4OHJA 1DOYA 1WXQA 5L95C 2LGXA 4NQKE 1YD8U 2DWQA 4MT5A 4KKIA 2N9EB 1WX9A 1XO3A 1E9MA 3VUXA 1UBIA 4M01A 3OG5A 2B3AA 1UH6A 3A1QA 2MJ3A 3M95A 2WX1A 2KHWB 4ZDVA 2L0FA 4OW0A 2BWFA 3PZ7A 4HROA 2WXMA 1I4RA 3QARA 1TS4A 5EE3A 4M02A 2K8BA 3PRPB 4US8A 3DWMA 4LDTB 5BMHA 4ZHPA 4N9F4 2N4FA 4JWSC 1HTQA 3APCA 3PLVA 3DHHC 3NJTA 2LMCA 1L6UA 4A55A 3OLMD 1WZ3A 2LASA 4IC7B 2I1JA 3DBLI 2GI9A 4WAFA 1E5WA 2VZKB 2QEJC 2D07B 2KMCA 2DZKA 1VZ8A 2AX5A 1WSPA 3Q8BA 4AWJA 1I4HA 2BGFA 1EU4A 2WDRB 2OOBB 3ML8A 3Q2AC 2OJWA 1IGDA 1V6EA 2J0MA 4ZHOA 1C76A 5CTRC 1PUTA 5IKCM 1C9FA 1WR1A 2HTME 1KH0A 1UNSA 3IFWB 3P63A 1FFVA 3LXFA 2O6VA 2KWCA 1RFAA 1WE6A 2O6VB 1CJEA 1K8RB 1WXAA 4HJGE 2BVCA 2HDEA 3NUHB 4BKTA 3AEDB 1E8WA 1UF0A 4WIPA 2RDBC 1D6EC 2N9PC 4TKNA 1JMLA 3RZWC 2M1MA 2Y5PA 3UI3A 3AEGB 1NYRA 2MCNB 3MC9A 4II2B 5AZHA 5AUIA 1IUEA 3C0RB 1ZP0B 1TIFA 3L17A 1FRDA 3W5VB 3K9OB 3KUCB 2BYEA 4N6EB 2FBWB 2V9HA 1ZXHA 1FNWA 2JXTA 1EWCA 1M94A 3SR6A 2JYTA 3ENEA 2BYVE 3QIJA 2LJIA 1RRBA 2WNMA 1A5RA 3JYUA 4IKGA 5C3JB 2PLPA 3CIRB 2L0TA 1P98A 1PGBA 3AE9B 5D7GA 3NHEB 2L1AA 4KVGB 1D5XC 2JWUA 4IWOA 5D3DA 1V1PB 1ZW7A 5JZEB 3SEBA 3TEWA 4CYEA 2IO0B 2MSED 3AM9A 1L0YB 4KGRA 3P4RB 4C4VB 4USAA 1JW9D 2I2YA 1B9RA 2BBCA 2BB6A 4NQLB 1NYQA 1OFFA 2PKOA 4LNFA 3VDZA 2FIDA 4GLSC 2G1EA 2RSUA 3ZTCA 4XDDA 1F77A 2JRIB 1WX7A 2RDGA 1NENB 3HVZA 3PGEA 3Q69A 3NG0A 1TS5A 1ZXIA 2RR9A 3PZDA 4MGIE 2KJRA 2MRPA 3MFGA 1Y8RC 1TBEA 4W9CA 1FXIA 3I63C 2KYWA 3TMPB 4MDKE 4BAXA 1YN4A 1F52A 3RNGC 4A20A 2V3NA 3PVLA 1D5MC 1WGDA 3GZNB 4ICUA 2VRRB 2IO1B 1VR9A 3M63B 3UQBA 2KJHB 1IP9A 3WAOA 2GBNA 1E6EB 1LFDA 4BKSD 5EE0A 5T8IA 4A9AA 1WGHA 3QX1A 3IAM1 3I5JC 1L5PA 1HA5A 2K8HA 4ARIA 3HRDD 3Q3MC 1VZ7A 2XNAC 2WLBA 3LDZE 3N9YC 5BMGA 1GB1A 1J8CA 3EHVA 4II3B 3VQIA 3RNCC 2JQRB 2XN9C 1UGMA 1KLUD 4US9A 2KT7A 4DHZE 2EMTA 2CS4A 4NJCA 3TCAA 1ET6A 1FPYA 3DHIC 3TJPA 1DGJA 2L76A 2BKRB 3TSSA 4H2AA 1OTRB 3I3TB 2I1KA 2DZMA 5EE9A 1OEYJ 2RPVA 2BT6A 3D32A 2IYDB 1YJIA 3N20C 4LTUA 4KSKC 2LZ6A 1SGHA 3RNAC 1KTKA 4W9KA 1K52A 1WJUA 3AXCA 2E3TA 2HJ8A 2JRHA 2UYZB 4WWMA 4ANUA 4AS1A 2FCNA 2INDC 4B6WA 3U2SC 5KHOA 4NY0A 3A9JB 3NVVA 1AWDA 4BBNC 3Q8AA 3CWIA 3GZNI 4K1RB 4N58A 4LDTD 3WA0A 4G3XB 1KLGD 3WIMA 4GDKB 4GB9A 1UELA 3FC4A 2DHZA 2JZ3B 3FAHA 2JWZA 3P4QB 3M3JA 1FD6A 2NS5A 3V61A 2X38A 3BVGA 4A6QA 1C78A 1KLVA 1SIFA 3OAWA 3VAWA 2FIFA 3RT3B 1WYWB 3V6CB 3JW0X 1KF6B 5C1ZA 3PV1A 4F8CB 2WX0A 3VRAB 4EZJA 2JYEA 1WWTA 3HK0A 3ONSA 1R7SA 3ZNHB 1FCLA 1WXMA 2ZNVC 3VTWA 1PGXA 2INCC 1MPEA 4AUQC 1P1AA 1GJZA 3ZKJC 4B9KA 2LHEA 1JWBD 3AEFB 2NR2A 3V05A 4EE2A 1E90A 5J18A 5IO9A 1YIWA 3IVFA 2LGIA 2KFKB 2HJ1A 4DXFA 3P42A 1JWSD 3R3MA 3VXWA 3VTVA 5AZGA 3VH3B 5LXHA 2LRWA 2GRIA 1PGAA 1AARA 4GIVA 3RUIB 1F1HA 4IM0A 2CKHB 1IBXB 1P7EA 2QIEB 3BK1A 2FUG1 5BO4B 3EA6A 3A4RA 4F7ZA 4CQNA 5BYRA 1V5TA 1KRHA 1L6VA 1H4RA 3H1UA 3E56A 3URYA 4IUMB 3Q6BA 1L0VB 1N63A 1HE8A 1TKYA 4GDLA 4ZRJA 2DYMA 2FCQA 2PEAA 3L08A 5E6NA 2J42A 1LO5D 1WM2A 3RNFC 2AL6A 2WQYB 3W1YA 4LJPB 2DZJA 4KX6B 3V3XA 2D11A 4HKQA 4ZYSA 2K39A 1KOTA 2GBRA 2QJLA 5DCNA 3AI5A 3JVZX 4ANVA 1RWSA 4L1BA 3V60A 2MP2A 4NNJB 1KJTA 3RPFC 4NJ7A 2D10A 2XK5B 1E7VA 3R66C 1XLOA 1JRUA 3VVWB 3ZXRA 3ALBA 2CHXA 3ZRCA 1J7BA 3QJZA 3IT4B 1SF0A 1N6ZA 4YTPB 2K22A 1X1MA 2KANA 3P1MA 2DAFA 3SFEB 4RGTA 1C4AA 1E0ZA 3SU8X 1WGYA 1T0RC 3AU4A 3P2BA 2KN5A 5AEKB 4P16A 2LGDA 1FXTB 3MJ5A 4C00A 3NZ3A 4BKGA 3CSFA 4JE3B 1QF6A 4JX1C 2L7RA 4TQ0A 2C7MB 1ACCA 1JWUD 2GLSA 4MJSB 1VD2A 5CHWA 2MJEA 2NPTA 3EFCA 2KMAA 2H89B 3R8BA 4ZRPA 1D5ZC 2CHWA 3AE3B 2BYFA 3DWGC 4RGMA 4XYCA 4MGZE 4NZLB 4JLCA 3AE2B 3I57A 1SSNA 1VLBA 3B9JA 4OVZA 1LGRA 1CMXB 5G5HA 4HDOA 2KXJA 5DPSA 4RGOS 2L32A 3ZO5B 1WF9A 4GMVA 4C56C 1MFWA 4EKUA 3DBHB 3SD5A 2M56B 3KWVA 2LVPA 3ZRFA 3L0WB 2ZCCA 5H8YE 1Z2MA 1NBFC 1P9DU 1V2YA 3ZJTA 4K3CA 3A1QB 3R7QA 3W1SA 3EUB2 2MBBB 3VUYA 4DHJB 2HD5B 4GN1A 2D3BA 2AQ1B 4RCOA 2ASQA 3X0WA 3AE6B 2WXNA 2AQ2B 3PTFC 2N9LA 2DLBA 1FNVA 3R2IA 1YN5A 3AE4B 5BMIA 2L8JA 3KUZA 4ITKA 3ZDTA 2V3PA 1GG3A 2JZPA 2FCMA 2QSDA 2KLGA 4AP4C 1EM7A 2IGDA 2ZVOA 5FKAC 2D2QA 2PVGC 4OVUA 5AUKA 3DDCB 1TY2A 2PTLA 2KX0A 3W1SC 2BYTA 3DPDA 2K9XA 4MEMA 2I38A 4MGKE 3ZNZB 4C7ZA 5IA7A 3H7SA 3Q8EA 2RD0A 4KGSA 1YOVB 2XBBC 3MC8A 1N5WA 2IZVB 1I4XA 2MBQA 2R2OA 2W9NA 2M0AA 4TUUA 1PQSA 1TJEA 1P7FA 2LXAA 3B08A 3BVZA 4PS3A 1SE9A 1YN3A 3DBHI 3PO0A 4HRSA 4CO7A 4TMAB 5DPTA 2J4XA 3HHMA 2BPSA 3H7PA 3QWZB 4HLEA 3BY4B 4RFBA 1MVKA 3PT2B 4MH0E 2LGYA 2R2QA 4ANWA 2KQ4X 1J7AA 4GXBA 2JUOA 1FO4A 2NTTA 1QOFA 5I4DA 4MSMB 1SJHD 4FADA 2J52A 4RH6A 4P7IA 5HKHA 4S0RA 3LJ3A 5JHAA 3M62B 3APFA 3UINB 5H92C 1WGGA 2EMSA 3ZLZA 5IAAC 3T9LA 3B0AA 2G45B 4NAWA 2MX2A 2YVCA 4NAWB 4JL9A 4FULA 4MELA 3MHSD 1LM8B 2N7EA 2N9XA 1QOAA 2K6DB 2WDQB 1XEEA 1G6JA 2V3SA 3GP7A 4KDIC 2R61A 2D3GA 1ZUD2 2JF5A 1E8XA 1OQRA 1VDVA 5G55A 2WXHA 3NRZA 2KC1A 3BWUD 1QT9A 5HG2A 1EF5A 4DK5A 4G50A 4KV2A 3UF8A 3W2DA 1SE4A 1L4DB 3PHXB 4EOYA 3KLSX 4D2KA 1FXAA 1UD7A 3RFZB 3SHQA 2ZPNA 2CU1A 1XF5L 3L4PA 2LJ5A 3Q14C 1YJJA 2WP9B 3W9CB 4KDLB 3L54A 4M0WA 1L7YA 3ZNID 4XZ4A 2ZEQA 3AE1B 2W3SA 3MC0B 3RI7C 4WJQA 1N62A 2WDTB 3PSEB 1EWYC 1JCKB 5D3IB 3MJWA 4WJOA 4IOIE 5G2NA 3S2AA 2IJ0A 4ZRQA 1SB3C 2DNFA 2G9HD 1D4BA 3Q3NC 1ZE3D 1HZ6A 4HCPB 1WRDB 4RF1A 5G5GA 3T3NA 3RCZA 2V0GA 4FA6A 1I4GA 4I6LB 4W9LA 2M17A 1XLNA
chains in the Genus database with same CATH topology
4WWNA 4IM0A 2CKHB 3Q3JA 2C60A 4NJ6A 3IHPC 1D3ZA 3L10B 2JVCA 3SDLC 1YX6B 3WAPA 5BO4B 3KYDD 4BFRA 4EZLA 3ZVVA 1Q0WB 5D94A 3A4RA 1LQBA 1KM7A 4WJNA 2A5UA 4YL8A 4IG7B 3BINA 3ECIA 4F7ZA 4EUTA 2J7QB 2KZRA 1V5TA 4W9GA 2IBIB 4J6IA 4W9EA 1H4RA 3H1UA 2CHZA 3NY5A 4JIOU 2IO3B 1P3QU 2EKEC 4EFOA 4IUMB 4JQWC 1HE8A 4GDLA 5L95C 2LGXA 1V49A 1YX5B 2MBOA 4ZRJA 2DYMA 3AU5A 2FCQA 2PEAA 4A3PA 1WH3A 3L08A 4HXDA 1YD8U 4NQKE 5D2MB 5E6NA 3PLUA 1WM2A 1ZKHA 2N9EB 3A4SC 1WX9A 2AEHA 2ZVNA 2NBUA 2AL6A 3OJ4B 3VUXA 1UBIA 4WWOA 3W1YA 4LJPB 3JSVA 2B3AA 3QCAA 1UH6A 2DZJA 4URKA 4MGYE 3A1QA 2JXXA 4FLHA 2D11A 2K39A 1VCBA 3M95A 1OQYA 2WX1A 1KOTA 2KHWB 2KTRA 4ZDVA 2GBRA 2L0FA 2LVOA 2BWFA 1T0YA 5JHBA 2ZNVB 3K9PB 3PS6A 1GC7A 3AI5A 5DCNA 3QC8B 1NI2A 3JVZX 4CHKA 2Y5BB 4ANVA 1I42A 2MA9B 3QARA 4I6PA 3V60A 4BOSC 2K8BA 3DCGA 3PRPB 2MP2A 4NNJB 2C7HA 2C5LC 1KJTA 4FHJA 4I6NB 4LDTB 2RPQA 4NJ7A 4W9HA 2DYOA 4N9F4 2D10A 4EEWA 2MBEA 2N4FA 1WM3A 3APCA 2XK5B 2BKFA 5EDSA 3PLVA 1E7VA 5J2RA 3R66C 3AULA 1JRUA 3VVWB 1Z5SB 3OLMD 3EECA 2KC2A 1WJNA 1WZ3A 3ALBA 2LASA 2CHXA 1GNUA 4IC7B 3KVFB 3ZRCA 2I1JA 2DENB 2KDIA 2DAJA 3QJZA 4ANXA 5DPRA 3DBLI 4K7WA 2V4LA 4RM9A 1V9JA 1XT9B 1X1MA 2NCNA 2KANA 1ISNA 1E5WA 2D07B 4DHZB 1YQBA 2DAFA 1QZEA 2KK8A 2KWUB 4M0WB 2KMCA 2DZKA 4OVVA 2IY0B 1WGYA 3SU8X 3AU4A 3V62A 3P2BA 3HM3A 4DWFA 4HJKA 2KN5A 1S1QB 4AWJA 3H9DA 2KJ6A 5AEKB 3ZNGC 2BGFA 2LGDA 1Q1OA 1FXTB 4WJPA 1I35A 4BBNF 4W9DA 4W9JA 2OOBB 3A9KA 4BKGA 3CSFA 3ML8A 3UIPB 3DBSA 1V6EA 2L7RA 2N1VA 3KYCD 2REXA 2J0MA 4TQ0A 2J0KA 1WX8A 2C7MB 5CTRC 4MJSB 4XC2A 2O6VD 1VD2A 2KKCA 1WR1A 4KZCA 5CHWA 3RYTA 2NPTA 4DDGD 1S3SG 1V80A 3IFWB 4AJYB 2KMAA 1YJ1A 2MQJA 2O6VA 2MWSB 2KWCA 2CHWA 1GC6A 1RFAA 1WE6A 2O6VB 3CSTA 2BYFA 2AYOB 3KH0A 3DVGX 1K8RB 1P0RA 1WJ6A 1WXAA 4MGZE 4JLCA 4BKTA 2L3ZA 4GOCA 1E8WA 4K7UA 2JPHA 2L05A 3X23A 2N9PC 2XEWA 4AOFA 2KQ7A 4HDQA 4MM3A 4TKNA 4K7SA 2M8SA 1WXSA 2K8CA 3RZWC 2LRUA 1CMXB 2M1MA 2KWVB 2KOXA 2JT4B 2JY6A 4HDOA 3QK0A 2MCNB 4GSWA 3B1LX 4II2B 5AZHA 3UGBB 2KXJA 5TR5A 3C0RB 5DPSA 5AZFA 3L17A 4GGQA 2OJRA 3KW5B 2HE7A 3K9OB 3KUCB 3N30A 4FJVB 3HM6X 1BT0A 2NBVB 2BYEA 4KZ0A 1XD3B 2O2VA 4DXAB 4HVBA 3ZO5B 4E71A 1WF9A 4GMVA 3IBEA 4GDLB 2ZPYA 1M94A 2KD0A 4EKUA 2KTFA 3ENEA 3QIJA 2BYVE 3SD5A 5E6OA 2LVPA 3ZUNA 1RRBA 1A5RA 3ZRFA 3JYUA 3L0WB 2ZCCA 4DHJD 1Z2MA 2DYBA 2UWQA 1NBFC 1P9DU 1V2YA 2L0TA 1IPGA 3PHWB 4GU2A 5CX3A 2JZZA 4KIKA 3JSVB 3PREA 1P98A 5D7GA 3NHEB 4KVGB 3A1QB 4HWIB 3EFUA 2J0JA 2YLMA 4IWOA 3R7QA 3W1SA 2MBBB 2ZJDA 3VUYA 4DHJB 2HD5B 2KTRB 2ZCBA 4GN1A 1ZW7A 2LD9A 1TZ1A 5JZEB 1V5OA 2KFJA 2MW5A 2ASQA 2CR5A 4CYEA 3X0WA 4PS7A 1L2NA 2IO0B 2MSED 2KDBA 5DPWA 2Z0DB 3PTFC 3VHTC 1C3TA 5JH5C 3L16A 5KHQA 3A9JA 3UQAA 2KDEB 5CHVC 2RGFA 3ML9A 2MP2B 2L8JA 4MSQB 3KUZA 3ZDTA 3HIZA 1GG3A 4HK2A 2FCMA 4RMAA 1V86A 2ZZPB 2BWES 2KLGA 4NQLB 5FR6A 1F9JA 4AP4C 1RLFA 5GMVA 3V6EB 3VDZA 2FIDA 4GDKA 1NDDA 2ZVOA 2NBWB 1EF1A 2RSUA 1E8ZA 4W9FA 3ZTCA 2IY1B 2LWPA 2JRIB 2D2QA 3DVNV 1WX7A 4OVUA 3QA8A 4X57B 3PGEA 3DDCB 3ZIMA 3RD2A 4BVUC 4LCDE 2KX0A 3DOWA 2KQSA 3W1SC 2RR9A 3PZDA 1XQQA 2A4ZA 1ZGUB 2M0XA 3CMMB 3H6NA 1J19A 4MGIE 4TQ1A 2KJRA 2MRPA 3DPDA 4HCNB 3QHTA 1Y8RC 3NS8A 1TBEA 2G4SA 2BF8B 3QAQA 1TGZB 4MEMA 3NZUA 4W9CA 4MGKE 3ZNZB 5IA7A 2LXCA 3H7SA 2RD0A 1E8YA 3PPAA 3TMPB 2KVRA 4E74A 2XBBC 4DBGA 1WIAA 2IZVB 4MDKE 1R4NI 3N32A 2L00B 2MBQA 2R2OA 3A9KB 4A20A 3PVLA 4IM2A 4FN2A 2W9NA 1WGDA 2MBHA 3A33B 4TUUA 1R4MI 4ICUA 2VRRB 1PQSA 2IO1B 2K6QA 3M63B 3NZSA 3UQBA 2LXAA 2FCSA 2KJHB 2QHOA 4IWQA 3B08A 3WAOA 1IP9A 3KUDB 4XX5A 2GBNA 3VH4B 1LFDA 2NPTB 1SE9A 2PE9A 4PS3A 4B95A 2KX3A 4BKSD 3DBHI 2N7DA 3PRMB 1EO6A 5E6PA 1WGHA 3EC8A 3QX1A 5CHFA 4CO7A 5DPTA 1WY8A 3DVGY 2KFKA 3DBRI 3HHMA 2BPSA 3H7PA 3QWZB 4HLEA 3BY4B 4BKSA 3PT2B 4MH0E 2LGYA 1EUVB 2G3QB 2K8HA 2R2QA 4ANWA 1WMHA 5C23A 4FHKA 4GXBA 3RULA 2JUOA 3DVNU 4FJZA 3LDZE 3T8MA 1J8CA 3EHVA 2PJHA 3NOBA 4F1SA 4II3B 4MSMB 3VQIA 1J0GA 4FADA 1UGMA 4EZKA 2C7NB 1WXVA 4WAAA 4P7IA 1H8CA 5HKHA 3LJ3A 4M8NA 4DHZE 5JHAA 2EMTA 2CS4A 2K1FA 4ICVA 2O2VB 3M62B 3TCAA 3ZW3A 3PRZA 1GUAB 3TJPA 3APFA 3UINB 2L76A 4IWPA 1RAXA 2GMIC 2BKRB 4ZRIA 1WGGA 1WJ4A 1OTRB 1WZ0A 2EMSA 2KNBA 2PE6B 3I3TB 4LJOB 4PYZA 3ZLZA 5IAAC 2I1KA 5LXIB 2DZMA 3T9LA 3B0AA 2DZIA 2G45B 4NAWA 2MX2A 4E3CA 1OEYJ 3D32A 2YVCA 4NAWB 4BOZB 2IYDB 4JL9A 4KIKB 1OEYA 1C1YB 2FAZA 4FULA 3GOEA 2KDFB 4KSKC 3MHSD 4MELA 2DX5B 1LM8B 2LZ6A 5L83A 2N7EA 1SGHA 2N9XA 4W9KA 2AL3A 2K6DB 1WJUA 3AXCA 2HJ8A 2JRHA 2UYZB 3TL5A 3O65B 4M8MA 1G6JA 4ANUA 2V3SA 4WQOB 2GBKA 4KDIC 3ZTDA 2D3GA 2FCNA 2C9WB 4RM8A 1OGWA 2JF5A 2MLBA 3VUWA 4B6WA 4IW0A 5KHOA 3U30A 4NY0A 3A9JB 1E8XA 1LXDA 3WAMA 2FNJB 4BBNC 2KO3A 5G55A 4G0NB 1E7UA 1Q5WB 1MG8A 2PPHA 2KC1A 1TTNA 3GZNI 2FUHB 4K1RB 4KSLC 4LDTD 3WA0A 4G3XB 4HPLB 3APDA 1EF5A 4DK5A 4ASWC 4G50A 4KV2A 3UF8A 3WIMA 5D6JB 2LUEA 3PHXB 4GDKB 1UELA 4GB9A 4IM3A 2DHZA 2KLCA 4EOYA 4FJYA 3R7RA 4FBJB 2JZ3B 3VFKA 2AWTA 2JWZA 2GOWA 3M3JA 2NS5A 3V61A 2XK5A 4HPMB 2GBJA 3L13A 1WR6E 4NPNA 1UD7A 1KLVA 1U4AA 3SHQA 1SIFA 2ZPNA 3OAWA 1UBQA 2CU1A 3VAWA 2FIFA 3WANA 1WE7A 2K25A 1V81A 1WYWB 3RT3B 3JW0X 3V6CB 1UZXB 4JGHB 1WI0A 5C1ZA 3PV1A 2LJ5A 3DQVA 4F8CB 3U7DA 2WX0A 4EZJA 2V1YA 3HK0A 3ONSA 2G4DB 4KDLB 4PYUA 4ZRKA 3L54A 4PS8A 3TBLD 3ZNID 1L7YA 5J17A 4XZ4A 2ZEQA 3IG3A 3ZDMC 3ZNHB 1WXMA 2ZNVC 3VTWA 4AUQC 3CF6E 4WJQA 2IO2B 2Z0EB 1P1AA 3N3KB 1GJZA 2WDTB 3MTNB 3ZKJC 1WGRA 2LI5A 3VTUA 4B9KA 5LLIA 3TIXA 3PSEB 3MJWA 2NR2A 4WJOA 5J18A 1E90A 5G2NA 4K81A 2LVQA 1YIWA 3IVFA 3S2AA 2M4NA 2GBMA 4DDID 2N1WA 4W9IA 2WWZA 1IYFA 2KFKB 4MJSA 3Q3FA 3H7PB 4G11A 3WALA 3RZFA 4HCPB 4ZYNA 1WRDB 1WMHB 3R3MA 3VXWA 3VTVA 5AZGA 4AJWA 2WYQA 3RCZA 2Z59B 3VH3B 1WFYA 5LXHA 2LRWA 4FA6A 4I6LB 1AARA 3OJ3A 3U8ZA 4GIVA 4A3OA 2NVUI 3QQ8B 4W9LA 3RUIB 2M17A 4TV3A 3UIOB 4WWPA 2HTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWN A;  4IM0 A;  2CKH B;  3Q3J A;  2C60 A;  4NJ6 A;  3IHP C;  1D3Z A;  3L10 B;  2JVC A;  3SDL C;  1YX6 B;  3WAP A;  5BO4 B;  3KYD D;  4BFR A;  4EZL A;  3ZVV A;  1Q0W B;  5D94 A;  3A4R A;  1LQB A;  1KM7 A;  4WJN A;  2A5U A;  4YL8 A;  4IG7 B;  3BIN A;  3ECI A;  4F7Z A;  4EUT A;  2J7Q B;  2KZR A;  1V5T A;  4W9G A;  2IBI B;  4J6I A;  4W9E A;  1H4R A;  3H1U A;  2CHZ A;  3NY5 A;  4JIO U;  2IO3 B;  1P3Q U;  2EKE C;  4EFO A;  4IUM B;  4JQW C;  1HE8 A;  4GDL A;  5L95 C;  2LGX A;  1V49 A;  1YX5 B;  2MBO A;  4ZRJ A;  2DYM A;  3AU5 A;  2FCQ A;  2PEA A;  4A3P A;  1WH3 A;  3L08 A;  4HXD A;  1YD8 U;  4NQK E;  5D2M B;  5E6N A;  3PLU A;  1WM2 A;  1ZKH A;  2N9E B;  3A4S C;  1WX9 A;  2AEH A;  2ZVN A;  2NBU A;  2AL6 A;  3OJ4 B;  3VUX A;  1UBI A;  4WWO A;  3W1Y A;  4LJP B;  3JSV A;  2B3A A;  3QCA A;  1UH6 A;  2DZJ A;  4URK A;  4MGY E;  3A1Q A;  2JXX A;  4FLH A;  2D11 A;  2K39 A;  1VCB A;  3M95 A;  1OQY A;  2WX1 A;  1KOT A;  2KHW B;  2KTR A;  4ZDV A;  2GBR A;  2L0F A;  2LVO A;  2BWF A;  1T0Y A;  5JHB A;  2ZNV B;  3K9P B;  3PS6 A;  1GC7 A;  3AI5 A;  5DCN A;  3QC8 B;  1NI2 A;  3JVZ X;  4CHK A;  2Y5B B;  4ANV A;  1I42 A;  2MA9 B;  3QAR A;  4I6P A;  3V60 A;  4BOS C;  2K8B A;  3DCG A;  3PRP B;  2MP2 A;  4NNJ B;  2C7H A;  2C5L C;  1KJT A;  4FHJ A;  4I6N B;  4LDT B;  2RPQ A;  4NJ7 A;  4W9H A;  2DYO A;  4N9F 4;  2D10 A;  4EEW A;  2MBE A;  2N4F A;  1WM3 A;  3APC A;  2XK5 B;  2BKF A;  5EDS A;  3PLV A;  1E7V A;  5J2R A;  3R66 C;  3AUL A;  1JRU A;  3VVW B;  1Z5S B;  3OLM D;  3EEC A;  2KC2 A;  1WJN A;  1WZ3 A;  3ALB A;  2LAS A;  2CHX A;  1GNU A;  4IC7 B;  3KVF B;  3ZRC A;  2I1J A;  2DEN B;  2KDI A;  2DAJ A;  3QJZ A;  4ANX A;  5DPR A;  3DBL I;  4K7W A;  2V4L A;  4RM9 A;  1V9J A;  1XT9 B;  1X1M A;  2NCN A;  2KAN A;  1ISN A;  1E5W A;  2D07 B;  4DHZ B;  1YQB A;  2DAF A;  1QZE A;  2KK8 A;  2KWU B;  4M0W B;  2KMC A;  2DZK A;  4OVV A;  2IY0 B;  1WGY A;  3SU8 X;  3AU4 A;  3V62 A;  3P2B A;  3HM3 A;  4DWF A;  4HJK A;  2KN5 A;  1S1Q B;  4AWJ A;  3H9D A;  2KJ6 A;  5AEK B;  3ZNG C;  2BGF A;  2LGD A;  1Q1O A;  1FXT B;  4WJP A;  1I35 A;  4BBN F;  4W9D A;  4W9J A;  2OOB B;  3A9K A;  4BKG A;  3CSF A;  3ML8 A;  3UIP B;  3DBS A;  1V6E A;  2L7R A;  2N1V A;  3KYC D;  2REX A;  2J0M A;  4TQ0 A;  2J0K A;  1WX8 A;  2C7M B;  5CTR C;  4MJS B;  4XC2 A;  2O6V D;  1VD2 A;  2KKC A;  1WR1 A;  4KZC A;  5CHW A;  3RYT A;  2NPT A;  4DDG D;  1S3S G;  1V80 A;  3IFW B;  4AJY B;  2KMA A;  1YJ1 A;  2MQJ A;  2O6V A;  2MWS B;  2KWC A;  2CHW A;  1GC6 A;  1RFA A;  1WE6 A;  2O6V B;  3CST A;  2BYF A;  2AYO B;  3KH0 A;  3DVG X;  1K8R B;  1P0R A;  1WJ6 A;  1WXA A;  4MGZ E;  4JLC A;  4BKT A;  2L3Z A;  4GOC A;  1E8W A;  4K7U A;  2JPH A;  2L05 A;  3X23 A;  2N9P C;  2XEW A;  4AOF A;  2KQ7 A;  4HDQ A;  4MM3 A;  4TKN A;  4K7S A;  2M8S A;  1WXS A;  2K8C A;  3RZW C;  2LRU A;  1CMX B;  2M1M A;  2KWV B;  2KOX A;  2JT4 B;  2JY6 A;  4HDO A;  3QK0 A;  2MCN B;  4GSW A;  3B1L X;  4II2 B;  5AZH A;  3UGB B;  2KXJ A;  5TR5 A;  3C0R B;  5DPS A;  5AZF A;  3L17 A;  4GGQ A;  2OJR A;  3KW5 B;  2HE7 A;  3K9O B;  3KUC B;  3N30 A;  4FJV B;  3HM6 X;  1BT0 A;  2NBV B;  2BYE A;  4KZ0 A;  1XD3 B;  2O2V A;  4DXA B;  4HVB A;  3ZO5 B;  4E71 A;  1WF9 A;  4GMV A;  3IBE A;  4GDL B;  2ZPY A;  1M94 A;  2KD0 A;  4EKU A;  2KTF A;  3ENE A;  3QIJ A;  2BYV E;  3SD5 A;  5E6O A;  2LVP A;  3ZUN A;  1RRB A;  1A5R A;  3ZRF A;  3JYU A;  3L0W B;  2ZCC A;  4DHJ D;  1Z2M A;  2DYB A;  2UWQ A;  1NBF C;  1P9D U;  1V2Y A;  2L0T A;  1IPG A;  3PHW B;  4GU2 A;  5CX3 A;  2JZZ A;  4KIK A;  3JSV B;  3PRE A;  1P98 A;  5D7G A;  3NHE B;  4KVG B;  3A1Q B;  4HWI B;  3EFU A;  2J0J A;  2YLM A;  4IWO A;  3R7Q A;  3W1S A;  2MBB B;  2ZJD A;  3VUY A;  4DHJ B;  2HD5 B;  2KTR B;  2ZCB A;  4GN1 A;  1ZW7 A;  2LD9 A;  1TZ1 A;  5JZE B;  1V5O A;  2KFJ A;  2MW5 A;  2ASQ A;  2CR5 A;  4CYE A;  3X0W A;  4PS7 A;  1L2N A;  2IO0 B;  2MSE D;  2KDB A;  5DPW A;  2Z0D B;  3PTF C;  3VHT C;  1C3T A;  5JH5 C;  3L16 A;  5KHQ A;  3A9J A;  3UQA A;  2KDE B;  5CHV C;  2RGF A;  3ML9 A;  2MP2 B;  2L8J A;  4MSQ B;  3KUZ A;  3ZDT A;  3HIZ A;  1GG3 A;  4HK2 A;  2FCM A;  4RMA A;  1V86 A;  2ZZP B;  2BWE S;  2KLG A;  4NQL B;  5FR6 A;  1F9J A;  4AP4 C;  1RLF A;  5GMV A;  3V6E B;  3VDZ A;  2FID A;  4GDK A;  1NDD A;  2ZVO A;  2NBW B;  1EF1 A;  2RSU A;  1E8Z A;  4W9F A;  3ZTC A;  2IY1 B;  2LWP A;  2JRI B;  2D2Q A;  3DVN V;  1WX7 A;  4OVU A;  3QA8 A;  4X57 B;  3PGE A;  3DDC B;  3ZIM A;  3RD2 A;  4BVU C;  4LCD E;  2KX0 A;  3DOW A;  2KQS A;  3W1S C;  2RR9 A;  3PZD A;  1XQQ A;  2A4Z A;  1ZGU B;  2M0X A;  3CMM B;  3H6N A;  1J19 A;  4MGI E;  4TQ1 A;  2KJR A;  2MRP A;  3DPD A;  4HCN B;  3QHT A;  1Y8R C;  3NS8 A;  1TBE A;  2G4S A;  2BF8 B;  3QAQ A;  1TGZ B;  4MEM A;  3NZU A;  4W9C A;  4MGK E;  3ZNZ B;  5IA7 A;  2LXC A;  3H7S A;  2RD0 A;  1E8Y A;  3PPA A;  3TMP B;  2KVR A;  4E74 A;  2XBB C;  4DBG A;  1WIA A;  2IZV B;  4MDK E;  1R4N I;  3N32 A;  2L00 B;  2MBQ A;  2R2O A;  3A9K B;  4A20 A;  3PVL A;  4IM2 A;  4FN2 A;  2W9N A;  1WGD A;  2MBH A;  3A33 B;  4TUU A;  1R4M I;  4ICU A;  2VRR B;  1PQS A;  2IO1 B;  2K6Q A;  3M63 B;  3NZS A;  3UQB A;  2LXA A;  2FCS A;  2KJH B;  2QHO A;  4IWQ A;  3B08 A;  3WAO A;  1IP9 A;  3KUD B;  4XX5 A;  2GBN A;  3VH4 B;  1LFD A;  2NPT B;  1SE9 A;  2PE9 A;  4PS3 A;  4B95 A;  2KX3 A;  4BKS D;  3DBH I;  2N7D A;  3PRM B;  1EO6 A;  5E6P A;  1WGH A;  3EC8 A;  3QX1 A;  5CHF A;  4CO7 A;  5DPT A;  1WY8 A;  3DVG Y;  2KFK A;  3DBR I;  3HHM A;  2BPS A;  3H7P A;  3QWZ B;  4HLE A;  3BY4 B;  4BKS A;  3PT2 B;  4MH0 E;  2LGY A;  1EUV B;  2G3Q B;  2K8H A;  2R2Q A;  4ANW A;  1WMH A;  5C23 A;  4FHK A;  4GXB A;  3RUL A;  2JUO A;  3DVN U;  4FJZ A;  3LDZ E;  3T8M A;  1J8C A;  3EHV A;  2PJH A;  3NOB A;  4F1S A;  4II3 B;  4MSM B;  3VQI A;  1J0G A;  4FAD A;  1UGM A;  4EZK A;  2C7N B;  1WXV A;  4WAA A;  4P7I A;  1H8C A;  5HKH A;  3LJ3 A;  4M8N A;  4DHZ E;  5JHA A;  2EMT A;  2CS4 A;  2K1F A;  4ICV A;  2O2V B;  3M62 B;  3TCA A;  3ZW3 A;  3PRZ A;  1GUA B;  3TJP A;  3APF A;  3UIN B;  2L76 A;  4IWP A;  1RAX A;  2GMI C;  2BKR B;  4ZRI A;  1WGG A;  1WJ4 A;  1OTR B;  1WZ0 A;  2EMS A;  2KNB A;  2PE6 B;  3I3T B;  4LJO B;  4PYZ A;  3ZLZ A;  5IAA C;  2I1K A;  5LXI B;  2DZM A;  3T9L A;  3B0A A;  2DZI A;  2G45 B;  4NAW A;  2MX2 A;  4E3C A;  1OEY J;  3D32 A;  2YVC A;  4NAW B;  4BOZ B;  2IYD B;  4JL9 A;  4KIK B;  1OEY A;  1C1Y B;  2FAZ A;  4FUL A;  3GOE A;  2KDF B;  4KSK C;  3MHS D;  4MEL A;  2DX5 B;  1LM8 B;  2LZ6 A;  5L83 A;  2N7E A;  1SGH A;  2N9X A;  4W9K A;  2AL3 A;  2K6D B;  1WJU A;  3AXC A;  2HJ8 A;  2JRH A;  2UYZ B;  3TL5 A;  3O65 B;  4M8M A;  1G6J A;  4ANU A;  2V3S A;  4WQO B;  2GBK A;  4KDI C;  3ZTD A;  2D3G A;  2FCN A;  2C9W B;  4RM8 A;  1OGW A;  2JF5 A;  2MLB A;  3VUW A;  4B6W A;  4IW0 A;  5KHO A;  3U30 A;  4NY0 A;  3A9J B;  1E8X A;  1LXD A;  3WAM A;  2FNJ B;  4BBN C;  2KO3 A;  5G55 A;  4G0N B;  1E7U A;  1Q5W B;  1MG8 A;  2PPH A;  2KC1 A;  1TTN A;  3GZN I;  2FUH B;  4K1R B;  4KSL C;  4LDT D;  3WA0 A;  4G3X B;  4HPL B;  3APD A;  1EF5 A;  4DK5 A;  4ASW C;  4G50 A;  4KV2 A;  3UF8 A;  3WIM A;  5D6J B;  2LUE A;  3PHX B;  4GDK B;  1UEL A;  4GB9 A;  4IM3 A;  2DHZ A;  2KLC A;  4EOY A;  4FJY A;  3R7R A;  4FBJ B;  2JZ3 B;  3VFK A;  2AWT A;  2JWZ A;  2GOW A;  3M3J A;  2NS5 A;  3V61 A;  2XK5 A;  4HPM B;  2GBJ A;  3L13 A;  1WR6 E;  4NPN A;  1UD7 A;  1KLV A;  1U4A A;  3SHQ A;  1SIF A;  2ZPN A;  3OAW A;  1UBQ A;  2CU1 A;  3VAW A;  2FIF A;  3WAN A;  1WE7 A;  2K25 A;  1V81 A;  1WYW B;  3RT3 B;  3JW0 X;  3V6C B;  1UZX B;  4JGH B;  1WI0 A;  5C1Z A;  3PV1 A;  2LJ5 A;  3DQV A;  4F8C B;  3U7D A;  2WX0 A;  4EZJ A;  2V1Y A;  3HK0 A;  3ONS A;  2G4D B;  4KDL B;  4PYU A;  4ZRK A;  3L54 A;  4PS8 A;  3TBL D;  3ZNI D;  1L7Y A;  5J17 A;  4XZ4 A;  2ZEQ A;  3IG3 A;  3ZDM C;  3ZNH B;  1WXM A;  2ZNV C;  3VTW A;  4AUQ C;  3CF6 E;  4WJQ A;  2IO2 B;  2Z0E B;  1P1A A;  3N3K B;  1GJZ A;  2WDT B;  3MTN B;  3ZKJ C;  1WGR A;  2LI5 A;  3VTU A;  4B9K A;  5LLI A;  3TIX A;  3PSE B;  3MJW A;  2NR2 A;  4WJO A;  5J18 A;  1E90 A;  5G2N A;  4K81 A;  2LVQ A;  1YIW A;  3IVF A;  3S2A A;  2M4N A;  2GBM A;  4DDI D;  2N1W A;  4W9I A;  2WWZ A;  1IYF A;  2KFK B;  4MJS A;  3Q3F A;  3H7P B;  4G11 A;  3WAL A;  3RZF A;  4HCP B;  4ZYN A;  1WRD B;  1WMH B;  3R3M A;  3VXW A;  3VTV A;  5AZG A;  4AJW A;  2WYQ A;  3RCZ A;  2Z59 B;  3VH3 B;  1WFY A;  5LXH A;  2LRW A;  4FA6 A;  4I6L B;  1AAR A;  3OJ3 A;  3U8Z A;  4GIV A;  4A3O A;  2NVU I;  3QQ8 B;  4W9L A;  3RUI B;  2M17 A;  4TV3 A;  3UIO B;  4WWP A;  2HTH A; 
#chains in the Genus database with same CATH topology
 2NTS A;  1FRR A;  4C7Y A;  3AH7 A;  1D3Z A;  3VRB B;  1RM6 C;  1UGJ A;  4EZL A;  3ZVV A;  1Q0W B;  3FIL A;  5D94 A;  1LQB A;  2A5U A;  3BIN A;  2SAK A;  2EKE C;  4EFO A;  4JQW C;  4N59 A;  4YXD B;  4OZB A;  3AU5 A;  1T0S C;  3U4E G;  4A3P A;  4B0M A;  1WH3 A;  4WUR A;  3PLU A;  1NI3 A;  2WXL A;  5EE1 A;  2NBU A;  1XLP A;  4WWO A;  3JSV A;  5FR3 A;  3QCA A;  1IGC A;  2J53 A;  1VCB A;  3TUO A;  2KTR A;  3NVZ A;  2LVO A;  1JWA D;  1T0Y A;  3FKY A;  5JHB A;  2ZNV B;  3K9P B;  1GC7 A;  4LNI A;  3QC8 B;  1NI2 A;  4CHK A;  3H8H A;  1HQR D;  2MA9 B;  4I6P A;  4S17 A;  3TEX A;  4BOS C;  3DCG A;  2C5L C;  4FHJ A;  4I6N B;  2RPQ A;  4W9H A;  2DYO A;  1BUI C;  5EDS A;  1TY0 A;  1WJN A;  2VZK D;  3KVF B;  4ARC A;  4KGT A;  1UUP A;  2KDI A;  4ANX A;  4K7W A;  4UDU C;  4XDC A;  1QKZ A;  1V9J A;  2NCN A;  4KKJ A;  3PZ8 A;  5TSS A;  2X8X X;  4DHZ B;  1YQB A;  2KK8 A;  2GB1 A;  2Y3A A;  3BYY B;  3V62 A;  3HM3 A;  3H9D A;  3NVY A;  3ZNG C;  4OZA A;  1Q1O A;  1MHH E;  2ONQ A;  1I35 A;  4BBN F;  4W9D A;  4W9J A;  3A9K A;  3J9C A;  3UIP B;  5IN7 A;  2REX A;  2J0K A;  1WX8 A;  1CK1 A;  2O6V D;  2KKC A;  4KZC A;  5BYS A;  2UU7 A;  3U7Z A;  4DDG D;  1V80 A;  2KWD A;  1YJ1 A;  2MQJ A;  2D3C A;  1T0Q C;  1GC6 A;  1TKE A;  3CST A;  2AYO B;  3DVG X;  1P0R A;  1WJ6 A;  2L3Z A;  4C80 A;  2L05 A;  1Y56 A;  4AOF A;  2KQ7 A;  4HDQ A;  4MM3 A;  1I4P A;  2K8C A;  2ZW0 A;  2OHF A;  2JY6 A;  1MHX A;  1R4N B;  3UGB B;  3B1L X;  1ROE A;  4GGQ A;  3C8Y A;  3KW5 B;  1E7P B;  1R4M B;  4R3D A;  3ZQ4 A;  4DXG A;  1N60 A;  1XD3 B;  2O2V A;  4RNA A;  4E71 A;  4GDL B;  4XE0 A;  1PDX A;  1V1O A;  1XCT L;  5E6O A;  3AN1 A;  2DYB A;  2MH7 A;  2UWQ A;  2M19 A;  2JSV X;  5CX3 A;  4KIK A;  3PRE A;  3IAS 1;  4HWI B;  4OZC A;  2J0J A;  1GPX A;  4YSZ B;  1FMA D;  1VZ6 A;  2LD9 A;  1TZ1 A;  2KFJ A;  2CR5 A;  4PS7 A;  2BS4 B;  2KDB A;  5DPW A;  2Z0D B;  3Q3O C;  3ZYY X;  3OWE B;  4O1N A;  3VHT C;  2KDE B;  3ML9 A;  2K5P A;  2MP2 B;  5C2T B;  4P1C C;  4WH4 A;  2RDH A;  3HIZ A;  4HK2 A;  1V86 A;  2ZZP B;  5FR6 A;  2CJO A;  4HKZ E;  1F9J A;  2INP E;  4REZ A;  1ESF A;  2NBW B;  2PW9 A;  4QAY A;  1E8Z A;  2LWP A;  3AV8 A;  3DVN V;  3ZIM A;  3DOW A;  1XQQ A;  2A4Z A;  4TQ1 A;  3CMM B;  1J19 A;  2INN E;  3NS8 A;  3RMK C;  3PPA A;  2KVR A;  4E74 A;  2D3A A;  1R4N I;  1JAL A;  1F2R I;  4FN2 A;  2MBH A;  3B2G A;  1R4M I;  2AQ3 B;  1DOX A;  2FCS A;  4IWQ A;  2KMM A;  2Y5C A;  1SBB B;  2ON8 A;  1V8C A;  2NPT B;  2PE9 A;  1ZDX A;  1XXG A;  2N7D A;  3PRM B;  1EO6 A;  2QCZ A;  2VH2 A;  1STE A;  3EC8 A;  5CHF A;  5E6P A;  1WY8 A;  3DVG Y;  1BXT A;  5HHD G;  1SJE D;  4BKS A;  3NVW A;  1QOG A;  1WMH A;  5C23 A;  4FHK A;  1MI0 A;  4MAC A;  3RUL A;  1B1Z A;  2BS2 B;  3DVN U;  2ICI A;  2WDV B;  4FJZ A;  3GE3 C;  2H88 B;  3NOB A;  4F1S A;  2WXJ A;  5JXV A;  2C7N B;  2WXP A;  4HEA 1;  4WAA A;  3RNB C;  1EU3 A;  1H8C A;  4RF0 A;  4M8N A;  3DHG C;  2K3U A;  3N1Z C;  3ZW3 A;  1GUA B;  4MH8 A;  2GMI C;  2EKI A;  1M4V A;  4ZRI A;  2K0P A;  1WZ0 A;  4LJO B;  5LXI B;  4NAM A;  1ZOY B;  2MHJ A;  4Q2J A;  2LFI A;  2NMQ A;  4E3C A;  2MEK A;  4LK0 M;  3BZD B;  2E6X A;  4YSX B;  1OEY A;  2FAZ A;  3GOE A;  1L4Z B;  1C4C A;  1WRI A;  5L83 A;  2AL3 A;  1AW7 A;  1HZ5 A;  3O65 B;  4M8M A;  4YT0 B;  4WQO B;  2GBK A;  3ZTD A;  3RN9 C;  2N7J A;  2PMV A;  4RM8 A;  2MLB A;  2W82 A;  3VUW A;  4IW0 A;  2WXO A;  3WAM A;  1LXD A;  1JWM D;  1Q5W B;  1C79 A;  2FUH B;  4KSL C;  2LGS A;  3APD A;  2W3R A;  1GB4 A;  2LUE A;  4IM3 A;  2KLC A;  4FJY A;  3R7R A;  1T5X D;  2GOW A;  1YQ3 B;  3AMZ A;  3ZGZ A;  4A90 A;  2GBJ A;  3L13 A;  1U4A A;  1UBQ A;  2V4I B;  3WAN A;  2K25 A;  1UZX B;  4XGA B;  3U7D A;  1CZP A;  5FK9 C;  3TBL D;  4PS8 A;  3IG3 A;  3TEZ A;  2QIL A;  1YMH E;  3CF6 E;  3N3K B;  1WGR A;  2LI5 A;  3VTU A;  2VH1 A;  2Q5W D;  4K81 A;  2LVQ A;  2M4N A;  4DDI D;  2N1W A;  4W9I A;  5HI1 A;  1IYF A;  3H7P B;  4G11 A;  3WAL A;  4TSS A;  1JRO A;  2PIA A;  2B76 B;  3IT6 B;  3NS1 A;  2IPK D;  2Z59 B;  1WFY A;  4IDI A;  3KWL A;  4DQO C;  3U8Z A;  4A3O A;  3U52 E;  2NVU I;  4TV3 A;  4WWP A;  3AEA B;  4M00 A;  1YQ4 B;  3KQ4 A;  3I9V 1;  3Q3J A;  2C60 A;  4NJ6 A;  3L10 B;  2JVC A;  1AN8 A;  1FEH A;  3KYD D;  3W5U B;  1TS2 A;  3MHZ A;  2IGG A;  3B2F A;  2KAJ A;  4EUT A;  2J7Q B;  2KZR A;  4XWT A;  4W9G A;  2IBI B;  3AB5 A;  4J6I A;  2PVO D;  3AE5 B;  4W9E A;  1PYW D;  2TSS A;  2CHZ A;  4JIO U;  2L52 A;  1TYG B;  1V49 A;  1YX5 B;  2MBO A;  3HUI A;  4BZA A;  1E10 A;  4HXD A;  5D2M B;  3ABV B;  1ZKH A;  2FE8 A;  3A4S C;  2AEH A;  2ZVN A;  1HXY D;  3OJ4 B;  1XLQ A;  4URK A;  4MGY E;  4L23 A;  4FLH A;  2JXX A;  3N1X C;  1QQR A;  3RNE C;  1JQ4 A;  1V1P A;  4P6V F;  2WXK A;  1OQY A;  3HVD A;  4B0E A;  5LNK 1;  3LYY A;  3PS6 A;  2KVZ A;  1NEK B;  1ENF A;  2Y5B B;  1I42 A;  1I4Q A;  2BQQ A;  4C4V A;  3ETR A;  4P1B C;  2C7H A;  2WXG A;  1SXT A;  3MP9 A;  3ZXV A;  4EEW A;  2MBE A;  1WM3 A;  2BKF A;  3SFD B;  1SIJ A;  5J2R A;  3AUL A;  1Z5S B;  3GE8 C;  1GAQ B;  2KC2 A;  3EEC A;  2N9K A;  2BTE A;  1GNU A;  2DEN B;  2DAJ A;  5DPR A;  2V4L A;  4RM9 A;  2L83 A;  1XT9 B;  1ISN A;  2BW2 A;  2KWU B;  1QZE A;  4M0W B;  4OVV A;  2IY0 B;  2WGS A;  4DWF A;  4HJK A;  1S1Q B;  3P4P B;  2KJ6 A;  2LEK A;  1BML C;  4WJP A;  2BB5 A;  2EEL A;  1KFY B;  5MPO A;  2DBY A;  3DBS A;  4LNN A;  2N1V A;  1FIQ A;  3KYC D;  1DOI A;  2YEP B;  3TEY A;  4XC2 A;  2LHD A;  4RGN A;  3RYT A;  1V97 A;  4HPP A;  1S3S G;  4AJY B;  1T3Q A;  2MWS B;  3C19 A;  3KH0 A;  5HFY A;  4JPS A;  4GOC A;  3X23 A;  4K7U A;  2JPH A;  2XEW A;  1GOZ A;  4K7S A;  2M8S A;  1WXS A;  2LRU A;  2KWV B;  5GXG B;  2KOX A;  5IOI A;  2JT4 B;  2BS3 B;  3QK0 A;  1ZPS A;  4GSW A;  1SE3 A;  3FIL B;  1TZO A;  5TR5 A;  5AZF A;  2OJR A;  1WYG A;  2HE7 A;  2WXI A;  2QDF A;  2JX5 A;  3N30 A;  4FJV B;  3HM6 X;  1BT0 A;  2NBV B;  4KZ0 A;  4DXA B;  4HVB A;  2KN4 A;  1UWM A;  3IBE A;  2ZPY A;  2KD0 A;  2KTF A;  3ZUN A;  1K53 A;  3DBR B;  4DHJ D;  4GU2 A;  1IPG A;  3PHW B;  2JZZ A;  3JSV B;  1C77 A;  3EFU A;  2YLM A;  2ZJD A;  1VJK A;  2KTR B;  2ZCB A;  1AYF A;  3GS2 A;  1V5O A;  1Q10 A;  2MW5 A;  1L2N A;  1QOB A;  1FNU A;  3N1Y C;  5BYQ A;  1SEB D;  2KDM A;  5JH5 C;  1C3T A;  3L16 A;  5KHQ A;  3A9J A;  3UQA A;  5CHV C;  2RGF A;  4MSQ B;  4RMA A;  1HEZ E;  2BWE S;  1WGK A;  2QMT A;  1YNT E;  1UWX A;  1RLF A;  5GMV A;  3V6E B;  3ZJV A;  2YEP F;  4L2Y A;  4GDK A;  1NDD A;  1EF1 A;  4LNO A;  4W9F A;  3ZJU A;  2IY1 B;  3P4S B;  3QA8 A;  4X57 B;  1XCQ L;  3RD2 A;  1L0X B;  4BVU C;  4LCD E;  2KQS A;  2M0X A;  1ZGU B;  3H6N A;  4HCN B;  3QHT A;  4FXC A;  2G4S A;  2BF8 B;  3QAQ A;  1TGZ B;  3NZU A;  2IGH A;  2LXC A;  1E8Y A;  4DBG A;  1FM0 D;  1WIA A;  3N32 A;  2L00 B;  3AEB B;  3A9K B;  4YSY B;  4IM2 A;  3A33 B;  2LUM A;  2K6Q A;  3GB1 A;  4ACF A;  3NZS A;  3AE7 B;  2QHO A;  3KUD B;  4XX5 A;  3VH4 B;  4B95 A;  2KX3 A;  4JWU C;  1HTO A;  3AEE B;  1TS3 A;  1TKG A;  1OQQ A;  2WS3 B;  1TT5 B;  2KFK A;  3DBR I;  3O13 A;  4LNK A;  1K50 A;  1EUV B;  2G3Q B;  3AEC B;  4MM3 B;  3IXS A;  4K3B A;  3T8M A;  3WCQ A;  2PJH A;  3Q8F A;  1J0G A;  4EZK A;  3AE8 B;  1WXV A;  1IBX A;  1RYJ A;  2QC8 A;  2K1F A;  4ICV A;  4XWW A;  2O2V B;  2WXQ A;  3PRZ A;  2D5G A;  4YTM B;  1FCC C;  4IWP A;  1RAX A;  2PE6 B;  1WJ4 A;  2KNB A;  4PYZ A;  3EGR A;  2MJD A;  1ZDV A;  2DZI A;  1MG4 A;  2Z8L A;  2ACZ B;  3R2T A;  4BOZ B;  4KIK B;  1K51 A;  2WHI A;  1C1Y B;  4AQ7 A;  2KDF B;  2DX5 B;  2SEB D;  1F0Z A;  2WXR A;  3TL5 A;  4A8X C;  2C9W B;  3E9S A;  1OGW A;  3BYT B;  3U30 A;  1QIL A;  2FNJ B;  4LLG M;  2KO3 A;  4G0N B;  1E7U A;  3BK2 A;  1MG8 A;  2PPH A;  1TTN A;  1I7H A;  4HPL B;  1F2R C;  4J3O D;  4ASW C;  5D6J B;  2OED A;  1FFU A;  4FBJ B;  1C4P A;  3VFK A;  2AWT A;  2XK5 A;  4HPM B;  2W54 A;  2KAC A;  1WR6 E;  1A70 A;  4NPN A;  1CQV A;  3LB8 C;  3Q8C A;  1JRP A;  1WE7 A;  1V81 A;  4JGH B;  1NVI D;  1WI0 A;  3DQV A;  2RMM A;  3BVM A;  2V1Y A;  4PT5 A;  2G4D B;  4PYU A;  4ZRK A;  1VRA B;  5J17 A;  1N5X A;  1SE2 A;  3ZDM C;  1RFK A;  1MJD A;  2CU3 A;  2IO2 B;  2WU2 B;  2Z0E B;  3MTN B;  4PK1 A;  4WQM A;  5LLI A;  3TIX A;  2GBM A;  2WWZ A;  1PFD A;  2ZW1 A;  4MJS A;  3Q3F A;  2WU5 B;  1T6B X;  3RZF A;  4ZYN A;  1WMH B;  4YWG G;  4AJW A;  2WYQ A;  1QLB B;  3DBL B;  3OJ3 A;  1N61 A;  3QQ8 B;  3UIO B;  2WXF A;  3T3O A;  2HTH A;  4YTN B;  1ET9 A;  4WWN A;  2W55 A;  5E6J A;  4ZOH C;  3IHP C;  3SDL C;  1YX6 B;  3WAP A;  4BFR A;  1DYQ A;  3BII D;  5IP4 D;  1KM7 A;  2N0S B;  4WJN A;  4YL8 A;  4IG7 B;  3ECI A;  2IDY A;  2JU6 X;  2CJN A;  3VR8 B;  1J7C A;  3NY5 A;  2IO3 B;  1P3Q U;  3VR9 B;  4OHJ A;  1DOY A;  1WXQ A;  5L95 C;  2LGX A;  4NQK E;  1YD8 U;  2DWQ A;  4MT5 A;  4KKI A;  2N9E B;  1WX9 A;  1XO3 A;  1E9M A;  3VUX A;  1UBI A;  4M01 A;  3OG5 A;  2B3A A;  1UH6 A;  3A1Q A;  2MJ3 A;  3M95 A;  2WX1 A;  2KHW B;  4ZDV A;  2L0F A;  4OW0 A;  2BWF A;  3PZ7 A;  4HRO A;  2WXM A;  1I4R A;  3QAR A;  1TS4 A;  5EE3 A;  4M02 A;  2K8B A;  3PRP B;  4US8 A;  3DWM A;  4LDT B;  5BMH A;  4ZHP A;  4N9F 4;  2N4F A;  4JWS C;  1HTQ A;  3APC A;  3PLV A;  3DHH C;  3NJT A;  2LMC A;  1L6U A;  4A55 A;  3OLM D;  1WZ3 A;  2LAS A;  4IC7 B;  2I1J A;  3DBL I;  2GI9 A;  4WAF A;  1E5W A;  2VZK B;  2QEJ C;  2D07 B;  2KMC A;  2DZK A;  1VZ8 A;  2AX5 A;  1WSP A;  3Q8B A;  4AWJ A;  1I4H A;  2BGF A;  1EU4 A;  2WDR B;  2OOB B;  3ML8 A;  3Q2A C;  2OJW A;  1IGD A;  1V6E A;  2J0M A;  4ZHO A;  1C76 A;  5CTR C;  1PUT A;  5IKC M;  1C9F A;  1WR1 A;  2HTM E;  1KH0 A;  1UNS A;  3IFW B;  3P63 A;  1FFV A;  3LXF A;  2O6V A;  2KWC A;  1RFA A;  1WE6 A;  2O6V B;  1CJE A;  1K8R B;  1WXA A;  4HJG E;  2BVC A;  2HDE A;  3NUH B;  4BKT A;  3AED B;  1E8W A;  1UF0 A;  4WIP A;  2RDB C;  1D6E C;  2N9P C;  4TKN A;  1JML A;  3RZW C;  2M1M A;  2Y5P A;  3UI3 A;  3AEG B;  1NYR A;  2MCN B;  3MC9 A;  4II2 B;  5AZH A;  5AUI A;  1IUE A;  3C0R B;  1ZP0 B;  1TIF A;  3L17 A;  1FRD A;  3W5V B;  3K9O B;  3KUC B;  2BYE A;  4N6E B;  2FBW B;  2V9H A;  1ZXH A;  1FNW A;  2JXT A;  1EWC A;  1M94 A;  3SR6 A;  2JYT A;  3ENE A;  2BYV E;  3QIJ A;  2LJI A;  1RRB A;  2WNM A;  1A5R A;  3JYU A;  4IKG A;  5C3J B;  2PLP A;  3CIR B;  2L0T A;  1P98 A;  1PGB A;  3AE9 B;  5D7G A;  3NHE B;  2L1A A;  4KVG B;  1D5X C;  2JWU A;  4IWO A;  5D3D A;  1V1P B;  1ZW7 A;  5JZE B;  3SEB A;  3TEW A;  4CYE A;  2IO0 B;  2MSE D;  3AM9 A;  1L0Y B;  4KGR A;  3P4R B;  4C4V B;  4USA A;  1JW9 D;  2I2Y A;  1B9R A;  2BBC A;  2BB6 A;  4NQL B;  1NYQ A;  1OFF A;  2PKO A;  4LNF A;  3VDZ A;  2FID A;  4GLS C;  2G1E A;  2RSU A;  3ZTC A;  4XDD A;  1F77 A;  2JRI B;  1WX7 A;  2RDG A;  1NEN B;  3HVZ A;  3PGE A;  3Q69 A;  3NG0 A;  1TS5 A;  1ZXI A;  2RR9 A;  3PZD A;  4MGI E;  2KJR A;  2MRP A;  3MFG A;  1Y8R C;  1TBE A;  4W9C A;  1FXI A;  3I63 C;  2KYW A;  3TMP B;  4MDK E;  4BAX A;  1YN4 A;  1F52 A;  3RNG C;  4A20 A;  2V3N A;  3PVL A;  1D5M C;  1WGD A;  3GZN B;  4ICU A;  2VRR B;  2IO1 B;  1VR9 A;  3M63 B;  3UQB A;  2KJH B;  1IP9 A;  3WAO A;  2GBN A;  1E6E B;  1LFD A;  4BKS D;  5EE0 A;  5T8I A;  4A9A A;  1WGH A;  3QX1 A;  3IAM 1;  3I5J C;  1L5P A;  1HA5 A;  2K8H A;  4ARI A;  3HRD D;  3Q3M C;  1VZ7 A;  2XNA C;  2WLB A;  3LDZ E;  3N9Y C;  5BMG A;  1GB1 A;  1J8C A;  3EHV A;  4II3 B;  3VQI A;  3RNC C;  2JQR B;  2XN9 C;  1UGM A;  1KLU D;  4US9 A;  2KT7 A;  4DHZ E;  2EMT A;  2CS4 A;  4NJC A;  3TCA A;  1ET6 A;  1FPY A;  3DHI C;  3TJP A;  1DGJ A;  2L76 A;  2BKR B;  3TSS A;  4H2A A;  1OTR B;  3I3T B;  2I1K A;  2DZM A;  5EE9 A;  1OEY J;  2RPV A;  2BT6 A;  3D32 A;  2IYD B;  1YJI A;  3N20 C;  4LTU A;  4KSK C;  2LZ6 A;  1SGH A;  3RNA C;  1KTK A;  4W9K A;  1K52 A;  1WJU A;  3AXC A;  2E3T A;  2HJ8 A;  2JRH A;  2UYZ B;  4WWM A;  4ANU A;  4AS1 A;  2FCN A;  2IND C;  4B6W A;  3U2S C;  5KHO A;  4NY0 A;  3A9J B;  3NVV A;  1AWD A;  4BBN C;  3Q8A A;  3CWI A;  3GZN I;  4K1R B;  4N58 A;  4LDT D;  3WA0 A;  4G3X B;  1KLG D;  3WIM A;  4GDK B;  4GB9 A;  1UEL A;  3FC4 A;  2DHZ A;  2JZ3 B;  3FAH A;  2JWZ A;  3P4Q B;  3M3J A;  1FD6 A;  2NS5 A;  3V61 A;  2X38 A;  3BVG A;  4A6Q A;  1C78 A;  1KLV A;  1SIF A;  3OAW A;  3VAW A;  2FIF A;  3RT3 B;  1WYW B;  3V6C B;  3JW0 X;  1KF6 B;  5C1Z A;  3PV1 A;  4F8C B;  2WX0 A;  3VRA B;  4EZJ A;  2JYE A;  1WWT A;  3HK0 A;  3ONS A;  1R7S A;  3ZNH B;  1FCL A;  1WXM A;  2ZNV C;  3VTW A;  1PGX A;  2INC C;  1MPE A;  4AUQ C;  1P1A A;  1GJZ A;  3ZKJ C;  4B9K A;  2LHE A;  1JWB D;  3AEF B;  2NR2 A;  3V05 A;  4EE2 A;  1E90 A;  5J18 A;  5IO9 A;  1YIW A;  3IVF A;  2LGI A;  2KFK B;  2HJ1 A;  4DXF A;  3P42 A;  1JWS D;  3R3M A;  3VXW A;  3VTV A;  5AZG A;  3VH3 B;  5LXH A;  2LRW A;  2GRI A;  1PGA A;  1AAR A;  4GIV A;  3RUI B;  1F1H A;  4IM0 A;  2CKH B;  1IBX B;  1P7E A;  2QIE B;  3BK1 A;  2FUG 1;  5BO4 B;  3EA6 A;  3A4R A;  4F7Z A;  4CQN A;  5BYR A;  1V5T A;  1KRH A;  1L6V A;  1H4R A;  3H1U A;  3E56 A;  3URY A;  4IUM B;  3Q6B A;  1L0V B;  1N63 A;  1HE8 A;  1TKY A;  4GDL A;  4ZRJ A;  2DYM A;  2FCQ A;  2PEA A;  3L08 A;  5E6N A;  2J42 A;  1LO5 D;  1WM2 A;  3RNF C;  2AL6 A;  2WQY B;  3W1Y A;  4LJP B;  2DZJ A;  4KX6 B;  3V3X A;  2D11 A;  4HKQ A;  4ZYS A;  2K39 A;  1KOT A;  2GBR A;  2QJL A;  5DCN A;  3AI5 A;  3JVZ X;  4ANV A;  1RWS A;  4L1B A;  3V60 A;  2MP2 A;  4NNJ B;  1KJT A;  3RPF C;  4NJ7 A;  2D10 A;  2XK5 B;  1E7V A;  3R66 C;  1XLO A;  1JRU A;  3VVW B;  3ZXR A;  3ALB A;  2CHX A;  3ZRC A;  1J7B A;  3QJZ A;  3IT4 B;  1SF0 A;  1N6Z A;  4YTP B;  2K22 A;  1X1M A;  2KAN A;  3P1M A;  2DAF A;  3SFE B;  4RGT A;  1C4A A;  1E0Z A;  3SU8 X;  1WGY A;  1T0R C;  3AU4 A;  3P2B A;  2KN5 A;  5AEK B;  4P16 A;  2LGD A;  1FXT B;  3MJ5 A;  4C00 A;  3NZ3 A;  4BKG A;  3CSF A;  4JE3 B;  1QF6 A;  4JX1 C;  2L7R A;  4TQ0 A;  2C7M B;  1ACC A;  1JWU D;  2GLS A;  4MJS B;  1VD2 A;  5CHW A;  2MJE A;  2NPT A;  3EFC A;  2KMA A;  2H89 B;  3R8B A;  4ZRP A;  1D5Z C;  2CHW A;  3AE3 B;  2BYF A;  3DWG C;  4RGM A;  4XYC A;  4MGZ E;  4NZL B;  4JLC A;  3AE2 B;  3I57 A;  1SSN A;  1VLB A;  3B9J A;  4OVZ A;  1LGR A;  1CMX B;  5G5H A;  4HDO A;  2KXJ A;  5DPS A;  4RGO S;  2L32 A;  3ZO5 B;  1WF9 A;  4GMV A;  4C56 C;  1MFW A;  4EKU A;  3DBH B;  3SD5 A;  2M56 B;  3KWV A;  2LVP A;  3ZRF A;  3L0W B;  2ZCC A;  5H8Y E;  1Z2M A;  1NBF C;  1P9D U;  1V2Y A;  3ZJT A;  4K3C A;  3A1Q B;  3R7Q A;  3W1S A;  3EUB 2;  2MBB B;  3VUY A;  4DHJ B;  2HD5 B;  4GN1 A;  2D3B A;  2AQ1 B;  4RCO A;  2ASQ A;  3X0W A;  3AE6 B;  2WXN A;  2AQ2 B;  3PTF C;  2N9L A;  2DLB A;  1FNV A;  3R2I A;  1YN5 A;  3AE4 B;  5BMI A;  2L8J A;  3KUZ A;  4ITK A;  3ZDT A;  2V3P A;  1GG3 A;  2JZP A;  2FCM A;  2QSD A;  2KLG A;  4AP4 C;  1EM7 A;  2IGD A;  2ZVO A;  5FKA C;  2D2Q A;  2PVG C;  4OVU A;  5AUK A;  3DDC B;  1TY2 A;  2PTL A;  2KX0 A;  3W1S C;  2BYT A;  3DPD A;  2K9X A;  4MEM A;  2I38 A;  4MGK E;  3ZNZ B;  4C7Z A;  5IA7 A;  3H7S A;  3Q8E A;  2RD0 A;  4KGS A;  1YOV B;  2XBB C;  3MC8 A;  1N5W A;  2IZV B;  1I4X A;  2MBQ A;  2R2O A;  2W9N A;  2M0A A;  4TUU A;  1PQS A;  1TJE A;  1P7F A;  2LXA A;  3B08 A;  3BVZ A;  4PS3 A;  1SE9 A;  1YN3 A;  3DBH I;  3PO0 A;  4HRS A;  4CO7 A;  4TMA B;  5DPT A;  2J4X A;  3HHM A;  2BPS A;  3H7P A;  3QWZ B;  4HLE A;  3BY4 B;  4RFB A;  1MVK A;  3PT2 B;  4MH0 E;  2LGY A;  2R2Q A;  4ANW A;  2KQ4 X;  1J7A A;  4GXB A;  2JUO A;  1FO4 A;  2NTT A;  1QOF A;  5I4D A;  4MSM B;  1SJH D;  4FAD A;  2J52 A;  4RH6 A;  4P7I A;  5HKH A;  4S0R A;  3LJ3 A;  5JHA A;  3M62 B;  3APF A;  3UIN B;  5H92 C;  1WGG A;  2EMS A;  3ZLZ A;  5IAA C;  3T9L A;  3B0A A;  2G45 B;  4NAW A;  2MX2 A;  2YVC A;  4NAW B;  4JL9 A;  4FUL A;  4MEL A;  3MHS D;  1LM8 B;  2N7E A;  2N9X A;  1QOA A;  2K6D B;  2WDQ B;  1XEE A;  1G6J A;  2V3S A;  3GP7 A;  4KDI C;  2R61 A;  2D3G A;  1ZUD 2;  2JF5 A;  1E8X A;  1OQR A;  1VDV A;  5G55 A;  2WXH A;  3NRZ A;  2KC1 A;  3BWU D;  1QT9 A;  5HG2 A;  1EF5 A;  4DK5 A;  4G50 A;  4KV2 A;  3UF8 A;  3W2D A;  1SE4 A;  1L4D B;  3PHX B;  4EOY A;  3KLS X;  4D2K A;  1FXA A;  1UD7 A;  3RFZ B;  3SHQ A;  2ZPN A;  2CU1 A;  1XF5 L;  3L4P A;  2LJ5 A;  3Q14 C;  1YJJ A;  2WP9 B;  3W9C B;  4KDL B;  3L54 A;  4M0W A;  1L7Y A;  3ZNI D;  4XZ4 A;  2ZEQ A;  3AE1 B;  2W3S A;  3MC0 B;  3RI7 C;  4WJQ A;  1N62 A;  2WDT B;  3PSE B;  1EWY C;  1JCK B;  5D3I B;  3MJW A;  4WJO A;  4IOI E;  5G2N A;  3S2A A;  2IJ0 A;  4ZRQ A;  1SB3 C;  2DNF A;  2G9H D;  1D4B A;  3Q3N C;  1ZE3 D;  1HZ6 A;  4HCP B;  1WRD B;  4RF1 A;  5G5G A;  3T3N A;  3RCZ A;  2V0G A;  4FA6 A;  1I4G A;  4I6L B;  4W9L A;  2M17 A;  1XLN A; 
#chains in the Genus database with same CATH homology
 4WWN A;  4IM0 A;  2CKH B;  3Q3J A;  2C60 A;  4NJ6 A;  3IHP C;  1D3Z A;  3L10 B;  2JVC A;  3SDL C;  1YX6 B;  3WAP A;  5BO4 B;  3KYD D;  4BFR A;  4EZL A;  3ZVV A;  1Q0W B;  5D94 A;  3A4R A;  1LQB A;  1KM7 A;  4WJN A;  2A5U A;  4YL8 A;  4IG7 B;  3BIN A;  3ECI A;  4F7Z A;  4EUT A;  2J7Q B;  2KZR A;  1V5T A;  4W9G A;  2IBI B;  4J6I A;  4W9E A;  1H4R A;  3H1U A;  2CHZ A;  3NY5 A;  4JIO U;  2IO3 B;  1P3Q U;  2EKE C;  4EFO A;  4IUM B;  4JQW C;  1HE8 A;  4GDL A;  5L95 C;  2LGX A;  1V49 A;  1YX5 B;  2MBO A;  4ZRJ A;  2DYM A;  3AU5 A;  2FCQ A;  2PEA A;  4A3P A;  1WH3 A;  3L08 A;  4HXD A;  1YD8 U;  4NQK E;  5D2M B;  5E6N A;  3PLU A;  1WM2 A;  1ZKH A;  2N9E B;  3A4S C;  1WX9 A;  2AEH A;  2ZVN A;  2NBU A;  2AL6 A;  3OJ4 B;  3VUX A;  1UBI A;  4WWO A;  3W1Y A;  4LJP B;  3JSV A;  2B3A A;  3QCA A;  1UH6 A;  2DZJ A;  4URK A;  4MGY E;  3A1Q A;  2JXX A;  4FLH A;  2D11 A;  2K39 A;  1VCB A;  3M95 A;  1OQY A;  2WX1 A;  1KOT A;  2KHW B;  2KTR A;  4ZDV A;  2GBR A;  2L0F A;  2LVO A;  2BWF A;  1T0Y A;  5JHB A;  2ZNV B;  3K9P B;  3PS6 A;  1GC7 A;  3AI5 A;  5DCN A;  3QC8 B;  1NI2 A;  3JVZ X;  4CHK A;  2Y5B B;  4ANV A;  1I42 A;  2MA9 B;  3QAR A;  4I6P A;  3V60 A;  4BOS C;  2K8B A;  3DCG A;  3PRP B;  2MP2 A;  4NNJ B;  2C7H A;  2C5L C;  1KJT A;  4FHJ A;  4I6N B;  4LDT B;  2RPQ A;  4NJ7 A;  4W9H A;  2DYO A;  4N9F 4;  2D10 A;  4EEW A;  2MBE A;  2N4F A;  1WM3 A;  3APC A;  2XK5 B;  2BKF A;  5EDS A;  3PLV A;  1E7V A;  5J2R A;  3R66 C;  3AUL A;  1JRU A;  3VVW B;  1Z5S B;  3OLM D;  3EEC A;  2KC2 A;  1WJN A;  1WZ3 A;  3ALB A;  2LAS A;  2CHX A;  1GNU A;  4IC7 B;  3KVF B;  3ZRC A;  2I1J A;  2DEN B;  2KDI A;  2DAJ A;  3QJZ A;  4ANX A;  5DPR A;  3DBL I;  4K7W A;  2V4L A;  4RM9 A;  1V9J A;  1XT9 B;  1X1M A;  2NCN A;  2KAN A;  1ISN A;  1E5W A;  2D07 B;  4DHZ B;  1YQB A;  2DAF A;  1QZE A;  2KK8 A;  2KWU B;  4M0W B;  2KMC A;  2DZK A;  4OVV A;  2IY0 B;  1WGY A;  3SU8 X;  3AU4 A;  3V62 A;  3P2B A;  3HM3 A;  4DWF A;  4HJK A;  2KN5 A;  1S1Q B;  4AWJ A;  3H9D A;  2KJ6 A;  5AEK B;  3ZNG C;  2BGF A;  2LGD A;  1Q1O A;  1FXT B;  4WJP A;  1I35 A;  4BBN F;  4W9D A;  4W9J A;  2OOB B;  3A9K A;  4BKG A;  3CSF A;  3ML8 A;  3UIP B;  3DBS A;  1V6E A;  2L7R A;  2N1V A;  3KYC D;  2REX A;  2J0M A;  4TQ0 A;  2J0K A;  1WX8 A;  2C7M B;  5CTR C;  4MJS B;  4XC2 A;  2O6V D;  1VD2 A;  2KKC A;  1WR1 A;  4KZC A;  5CHW A;  3RYT A;  2NPT A;  4DDG D;  1S3S G;  1V80 A;  3IFW B;  4AJY B;  2KMA A;  1YJ1 A;  2MQJ A;  2O6V A;  2MWS B;  2KWC A;  2CHW A;  1GC6 A;  1RFA A;  1WE6 A;  2O6V B;  3CST A;  2BYF A;  2AYO B;  3KH0 A;  3DVG X;  1K8R B;  1P0R A;  1WJ6 A;  1WXA A;  4MGZ E;  4JLC A;  4BKT A;  2L3Z A;  4GOC A;  1E8W A;  4K7U A;  2JPH A;  2L05 A;  3X23 A;  2N9P C;  2XEW A;  4AOF A;  2KQ7 A;  4HDQ A;  4MM3 A;  4TKN A;  4K7S A;  2M8S A;  1WXS A;  2K8C A;  3RZW C;  2LRU A;  1CMX B;  2M1M A;  2KWV B;  2KOX A;  2JT4 B;  2JY6 A;  4HDO A;  3QK0 A;  2MCN B;  4GSW A;  3B1L X;  4II2 B;  5AZH A;  3UGB B;  2KXJ A;  5TR5 A;  3C0R B;  5DPS A;  5AZF A;  3L17 A;  4GGQ A;  2OJR A;  3KW5 B;  2HE7 A;  3K9O B;  3KUC B;  3N30 A;  4FJV B;  3HM6 X;  1BT0 A;  2NBV B;  2BYE A;  4KZ0 A;  1XD3 B;  2O2V A;  4DXA B;  4HVB A;  3ZO5 B;  4E71 A;  1WF9 A;  4GMV A;  3IBE A;  4GDL B;  2ZPY A;  1M94 A;  2KD0 A;  4EKU A;  2KTF A;  3ENE A;  3QIJ A;  2BYV E;  3SD5 A;  5E6O A;  2LVP A;  3ZUN A;  1RRB A;  1A5R A;  3ZRF A;  3JYU A;  3L0W B;  2ZCC A;  4DHJ D;  1Z2M A;  2DYB A;  2UWQ A;  1NBF C;  1P9D U;  1V2Y A;  2L0T A;  1IPG A;  3PHW B;  4GU2 A;  5CX3 A;  2JZZ A;  4KIK A;  3JSV B;  3PRE A;  1P98 A;  5D7G A;  3NHE B;  4KVG B;  3A1Q B;  4HWI B;  3EFU A;  2J0J A;  2YLM A;  4IWO A;  3R7Q A;  3W1S A;  2MBB B;  2ZJD A;  3VUY A;  4DHJ B;  2HD5 B;  2KTR B;  2ZCB A;  4GN1 A;  1ZW7 A;  2LD9 A;  1TZ1 A;  5JZE B;  1V5O A;  2KFJ A;  2MW5 A;  2ASQ A;  2CR5 A;  4CYE A;  3X0W A;  4PS7 A;  1L2N A;  2IO0 B;  2MSE D;  2KDB A;  5DPW A;  2Z0D B;  3PTF C;  3VHT C;  1C3T A;  5JH5 C;  3L16 A;  5KHQ A;  3A9J A;  3UQA A;  2KDE B;  5CHV C;  2RGF A;  3ML9 A;  2MP2 B;  2L8J A;  4MSQ B;  3KUZ A;  3ZDT A;  3HIZ A;  1GG3 A;  4HK2 A;  2FCM A;  4RMA A;  1V86 A;  2ZZP B;  2BWE S;  2KLG A;  4NQL B;  5FR6 A;  1F9J A;  4AP4 C;  1RLF A;  5GMV A;  3V6E B;  3VDZ A;  2FID A;  4GDK A;  1NDD A;  2ZVO A;  2NBW B;  1EF1 A;  2RSU A;  1E8Z A;  4W9F A;  3ZTC A;  2IY1 B;  2LWP A;  2JRI B;  2D2Q A;  3DVN V;  1WX7 A;  4OVU A;  3QA8 A;  4X57 B;  3PGE A;  3DDC B;  3ZIM A;  3RD2 A;  4BVU C;  4LCD E;  2KX0 A;  3DOW A;  2KQS A;  3W1S C;  2RR9 A;  3PZD A;  1XQQ A;  2A4Z A;  1ZGU B;  2M0X A;  3CMM B;  3H6N A;  1J19 A;  4MGI E;  4TQ1 A;  2KJR A;  2MRP A;  3DPD A;  4HCN B;  3QHT A;  1Y8R C;  3NS8 A;  1TBE A;  2G4S A;  2BF8 B;  3QAQ A;  1TGZ B;  4MEM A;  3NZU A;  4W9C A;  4MGK E;  3ZNZ B;  5IA7 A;  2LXC A;  3H7S A;  2RD0 A;  1E8Y A;  3PPA A;  3TMP B;  2KVR A;  4E74 A;  2XBB C;  4DBG A;  1WIA A;  2IZV B;  4MDK E;  1R4N I;  3N32 A;  2L00 B;  2MBQ A;  2R2O A;  3A9K B;  4A20 A;  3PVL A;  4IM2 A;  4FN2 A;  2W9N A;  1WGD A;  2MBH A;  3A33 B;  4TUU A;  1R4M I;  4ICU A;  2VRR B;  1PQS A;  2IO1 B;  2K6Q A;  3M63 B;  3NZS A;  3UQB A;  2LXA A;  2FCS A;  2KJH B;  2QHO A;  4IWQ A;  3B08 A;  3WAO A;  1IP9 A;  3KUD B;  4XX5 A;  2GBN A;  3VH4 B;  1LFD A;  2NPT B;  1SE9 A;  2PE9 A;  4PS3 A;  4B95 A;  2KX3 A;  4BKS D;  3DBH I;  2N7D A;  3PRM B;  1EO6 A;  5E6P A;  1WGH A;  3EC8 A;  3QX1 A;  5CHF A;  4CO7 A;  5DPT A;  1WY8 A;  3DVG Y;  2KFK A;  3DBR I;  3HHM A;  2BPS A;  3H7P A;  3QWZ B;  4HLE A;  3BY4 B;  4BKS A;  3PT2 B;  4MH0 E;  2LGY A;  1EUV B;  2G3Q B;  2K8H A;  2R2Q A;  4ANW A;  1WMH A;  5C23 A;  4FHK A;  4GXB A;  3RUL A;  2JUO A;  3DVN U;  4FJZ A;  3LDZ E;  3T8M A;  1J8C A;  3EHV A;  2PJH A;  3NOB A;  4F1S A;  4II3 B;  4MSM B;  3VQI A;  1J0G A;  4FAD A;  1UGM A;  4EZK A;  2C7N B;  1WXV A;  4WAA A;  4P7I A;  1H8C A;  5HKH A;  3LJ3 A;  4M8N A;  4DHZ E;  5JHA A;  2EMT A;  2CS4 A;  2K1F A;  4ICV A;  2O2V B;  3M62 B;  3TCA A;  3ZW3 A;  3PRZ A;  1GUA B;  3TJP A;  3APF A;  3UIN B;  2L76 A;  4IWP A;  1RAX A;  2GMI C;  2BKR B;  4ZRI A;  1WGG A;  1WJ4 A;  1OTR B;  1WZ0 A;  2EMS A;  2KNB A;  2PE6 B;  3I3T B;  4LJO B;  4PYZ A;  3ZLZ A;  5IAA C;  2I1K A;  5LXI B;  2DZM A;  3T9L A;  3B0A A;  2DZI A;  2G45 B;  4NAW A;  2MX2 A;  4E3C A;  1OEY J;  3D32 A;  2YVC A;  4NAW B;  4BOZ B;  2IYD B;  4JL9 A;  4KIK B;  1OEY A;  1C1Y B;  2FAZ A;  4FUL A;  3GOE A;  2KDF B;  4KSK C;  3MHS D;  4MEL A;  2DX5 B;  1LM8 B;  2LZ6 A;  5L83 A;  2N7E A;  1SGH A;  2N9X A;  4W9K A;  2AL3 A;  2K6D B;  1WJU A;  3AXC A;  2HJ8 A;  2JRH A;  2UYZ B;  3TL5 A;  3O65 B;  4M8M A;  1G6J A;  4ANU A;  2V3S A;  4WQO B;  2GBK A;  4KDI C;  3ZTD A;  2D3G A;  2FCN A;  2C9W B;  4RM8 A;  1OGW A;  2JF5 A;  2MLB A;  3VUW A;  4B6W A;  4IW0 A;  5KHO A;  3U30 A;  4NY0 A;  3A9J B;  1E8X A;  1LXD A;  3WAM A;  2FNJ B;  4BBN C;  2KO3 A;  5G55 A;  4G0N B;  1E7U A;  1Q5W B;  1MG8 A;  2PPH A;  2KC1 A;  1TTN A;  3GZN I;  2FUH B;  4K1R B;  4KSL C;  4LDT D;  3WA0 A;  4G3X B;  4HPL B;  3APD A;  1EF5 A;  4DK5 A;  4ASW C;  4G50 A;  4KV2 A;  3UF8 A;  3WIM A;  5D6J B;  2LUE A;  3PHX B;  4GDK B;  1UEL A;  4GB9 A;  4IM3 A;  2DHZ A;  2KLC A;  4EOY A;  4FJY A;  3R7R A;  4FBJ B;  2JZ3 B;  3VFK A;  2AWT A;  2JWZ A;  2GOW A;  3M3J A;  2NS5 A;  3V61 A;  2XK5 A;  4HPM B;  2GBJ A;  3L13 A;  1WR6 E;  4NPN A;  1UD7 A;  1KLV A;  1U4A A;  3SHQ A;  1SIF A;  2ZPN A;  3OAW A;  1UBQ A;  2CU1 A;  3VAW A;  2FIF A;  3WAN A;  1WE7 A;  2K25 A;  1V81 A;  1WYW B;  3RT3 B;  3JW0 X;  3V6C B;  1UZX B;  4JGH B;  1WI0 A;  5C1Z A;  3PV1 A;  2LJ5 A;  3DQV A;  4F8C B;  3U7D A;  2WX0 A;  4EZJ A;  2V1Y A;  3HK0 A;  3ONS A;  2G4D B;  4KDL B;  4PYU A;  4ZRK A;  3L54 A;  4PS8 A;  3TBL D;  3ZNI D;  1L7Y A;  5J17 A;  4XZ4 A;  2ZEQ A;  3IG3 A;  3ZDM C;  3ZNH B;  1WXM A;  2ZNV C;  3VTW A;  4AUQ C;  3CF6 E;  4WJQ A;  2IO2 B;  2Z0E B;  1P1A A;  3N3K B;  1GJZ A;  2WDT B;  3MTN B;  3ZKJ C;  1WGR A;  2LI5 A;  3VTU A;  4B9K A;  5LLI A;  3TIX A;  3PSE B;  3MJW A;  2NR2 A;  4WJO A;  5J18 A;  1E90 A;  5G2N A;  4K81 A;  2LVQ A;  1YIW A;  3IVF A;  3S2A A;  2M4N A;  2GBM A;  4DDI D;  2N1W A;  4W9I A;  2WWZ A;  1IYF A;  2KFK B;  4MJS A;  3Q3F A;  3H7P B;  4G11 A;  3WAL A;  3RZF A;  4HCP B;  4ZYN A;  1WRD B;  1WMH B;  3R3M A;  3VXW A;  3VTV A;  5AZG A;  4AJW A;  2WYQ A;  3RCZ A;  2Z59 B;  3VH3 B;  1WFY A;  5LXH A;  2LRW A;  4FA6 A;  4I6L B;  1AAR A;  3OJ3 A;  3U8Z A;  4GIV A;  4A3O A;  2NVU I;  3QQ8 B;  4W9L A;  3RUI B;  2M17 A;  4TV3 A;  3UIO B;  4WWP A;  2HTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...