3V62A

Structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
73
Chain Sequence
PETHINLVSDGSSEIFFITTPLRRLMEAFARQGEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 73
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v62A00
4MJSA 2LRWA 2GBJA 1S1QB 3NS8A 4N9F4 5CHFA 1P1AA 3ZDMC 3ZTCA 1TBEA 4G3XB 3ZNGC 3C0RB 2KOXA 3ONSA 4HDQA 3L0WB 3H7SA 2KDEB 3TJPA 3BINA 3PVLA 2KJ6A 3H1UA 2LVOA 4IM2A 4CHKA 4FHKA 2DHZA 3NZUA 2DYMA 2KWUB 3X0WA 1WMHB 4XC2A 1ZW7A 4II2B 2HTHA 2REXA 3V6EB 5GMVA 4FA6A 3IG3A 3QJZA 4K7WA 4MGKE 1WR6E 3VUYA 3ECIA 1FXTB 2MA9B 4NJ6A 5JH5C 2PEAA 3TL5A 2MBBB 3RUIB 3ML9A 2I1KA 4K7UA 1V5TA 1YD8U 4M8NA 3AI5A 2K25A 4EKUA 2BKFA 2L8JA 3RCZA 5D6JB 4EZLA 1J19A 2CHWA 2N9EB 2BYVE 3W1SC 2KDBA 1JRUA 1IYFA 4KDIC 5D94A 4RM9A 2G4SA 2O6VA 3RZFA 3ZTDA 3PGEA 3ZNID 3K9PB 3UF8A 2LI5A 1D3ZA 3H7PA 2HE7A 2FCQA 4TKNA 4DHJD 1C1YB 5JHBA 2CR5A 4WJOA 2NCNA 5CX3A 4IUMB 1VD2A 2M4NA 1LQBA 4GDLB 2MBEA 2RGFA 2FCSA 4DDID 4DBGA 1WXAA 2Z59B 3JSVB 3UINB 3PRMB 1WRDB 4HWIB 3PRZA 3ZKJC 3TIXA 2MW5A 3DPDA 4TQ1A 1OEYA 2AL3A 4GDKA 2IO0B 1E8XA 4MSQB 4KIKA 2IZVB 2D10A 2L3ZA 1LFDA 4FJYA 2DAFA 2LGXA 1OEYJ 4NY0A 5BO4B 1X1MA 3M62B 1BT0A 3PV1A 4GXBA 2C7MB 3QX1A 2D07B 2JRHA 2ZVNA 2DAJA 4CO7A 2BKRB 1P98A 2XK5B 3LDZE 1WE7A 3VQIA 2QHOA 3RYTA 1YJ1A 3PRPB 2KFKB 2BYEA 4M0WB 4W9FA 4BVUC 2JF5A 3BY4B 2L76A 4G50A 4LJPB 2K8BA 2IYDB 2JWZA 2PPHA 4A3OA 4AOFA 2MBOA 1Z5SB 2N4FA 2DYOA 5J18A 4NJ7A 4DHJB 1M94A 4EOYA 3OJ3A 2ZEQA 3KUCB 1XQQA 3PHXB 5AZFA 4X57B 4KZCA 2KQSA 2UWQA 4FJZA 3W1YA 4YL8A 1J8CA 3EC8A 3PTFC 3HHMA 3VHTC 4NAWA 4HLEA 2XBBC 1E7UA 1WJ6A 4A3PA 2XEWA 5E6OA 3DBLI 2A5UA 3HIZA 5J17A 3PREA 3DOWA 4IC7B 1T0YA 2LASA 2PE6B 2ZNVC 3M3JA 3QWZB 4OVVA 1NI2A 2L00B 3WAPA 4B9KA 1E8WA 4ZYNA 2V3SA 5J2RA 3N30A 3APDA 2YLMA 2KDFB 2ZZPB 4WWPA 3A33B 3W1SA 3VTVA 2AEHA 2KTRA 1WGDA 3NOBA 3B08A 4GIVA 3SHQA 4ASWC 3R3MA 1J0GA 1SGHA 2DZIA 2L0FA 3R7RA 2KHWB 2MQJA 3PS6A 3A9JB 3QK0A 3PT2B 4LJOB 1WJNA 2O2VA 1WY8A 3AU4A 4AWJA 4BKGA 5L95C 4GN1A 2LXCA 3X23A 2N1VA 2K6QA 4FLHA 1OTRB 2MP2A 4AJWA 3QQ8B 4W9DA 1I35A 5JHAA 3QCAA 2KO3A 2K6DB 2Y5BB 5G55A 1Y8RC 3M95A 3N32A 3MTNB 2K39A 4IG7B 2K8CA 5IAAC 2BF8B 2WYQA 2NBVB 1GJZA 4KDLB 3QARA 4NQLB 2BPSA 4XZ4A 1TZ1A 4PS8A 2EMSA 2KDIA 1UELA 4WJNA 1XT9B 1UBQA 4BOZB 1Q5WB 3ZO5B 3MHSD 2PE9A 3WANA 1KJTA 4E74A 2A4ZA 3A1QA 4MDKE 1RLFA 3APFA 3TCAA 1WMHA 2D2QA 3ZNHB 4BBNC 3S2AA 3I3TB 2MBHA 4RM8A 3TMPB 4DHZE 3M63B 3DBHI 2NBWB 4EUTA 2ASQA 1V49A 5G2NA 3L54A 1RRBA 2KQ7A 3VUWA 1Q0WB 4IM0A 2IY0B 4K7SA 2LRUA 2BYFA 2LVPA 1G6JA 1E7VA 4IWOA 3ZLZA 3V61A 4KSKC 5CHWA 3R66C 4MJSB 1YQBA 3KVFB 4LCDE 1UGMA 2GBMA 2NPTA 4RMAA 4FBJB 3CSFA 4HCNB 2EKEC 5C23A 2BWFA 2ZCBA 3NY5A 2V4LA 3WAMA 1WE6A 2NBUA 2J7QB 4W9CA 2KX3A 3A9KB 3DBRI 1IP9A 4MGZE 2LUEA 1ZGUB 5DCNA 2MCNB 5KHOA 3UQAA 2KMAA 1LM8B 1P9DU 2LGDA 2ZCCA 3P2BA 4TQ0A 3KUDB 2HD5B 4ANWA 4GDLA 4GGQA 1P3QU 4ZRJA 2M1MA 1UD7A 4PS3A 2W9NA 3L10B 1VCBA 1ZKHA 2FCMA 3U30A 3MJWA 3GOEA 2JZZA 3RT3B 4BKSA 1YX6B 1V9JA 2MWSB 3ZNZB 1SE9A 2C60A 3IHPC 3CSTA 3DDCB 1V86A 4MGYE 5E6NA 4GOCA 1WJ4A 2M8SA 2D3GA 2K8HA 5EDSA 4F8CB 2YVCA 5C1ZA 4F1SA 3RZWC 1K8RB 2KFKA 2G4DB 4II3B 3LJ3A 2FCNA 2LWPA 4JLCA 1S3SG 3PZDA 4ICVA 4W9IA 5D7GA 4KV2A 2K1FA 2KNBA 2KLGA 2KWVB 2M0XA 4DWFA 1WFYA 4W9EA 2D11A 3QA8A 1WR1A 1A5RA 4GDKB 4FADA 4IM3A 4AUQC 2RSUA 4PYZA 3IFWB 3KYCD 2LXAA 3JW0X 3B1LX 4KZ0A 4ZDVA 2JT4B 3R7QA 3U7DA 2MLBA 2Z0DB 2RD0A 1WGRA 3Q3FA 1P0RA 4ANVA 4E71A 3VTUA 4NQKE 1YIWA 1YX5B 3PPAA 2IY1B 4AP4C 3D32A 4EFOA 2ZPYA 1WJUA 1U4AA 3A4RA 3V62A 4WAAA 2LVQA 1GNUA 1KM7A 2IO2B 2PJHA 2LGYA 4TV3A 2ZJDA 2GBNA 2Z0EB 3VAWA 4GU2A 5FR6A 4WWNA 2EMTA 4F7ZA 1UH6A 1UZXB 4JL9A 3ZVVA 2MBQA 5AZHA 1PQSA 2RPQA 3WALA 5IA7A 4FULA 4W9JA 3VTWA 3Q3JA 4W9HA 1E8YA 3ENEA 1EF5A 4W9GA 2JVCA 1WX8A 2J0KA 2KKCA 4K81A 4NAWB 3T9LA 2L0TA 1E90A 3A4SC 1TGZB 3H9DA 3QIJA 4W9LA 1ISNA 2KMCA 3UGBB 1E5WA 3ZUNA 2KANA 1EUVB 1WIAA 2N9XA 2UYZB 2DENB 3JYUA 4AJYB 2N7DA 1R4MI 1E8ZA 2KFJA 1C3TA 1V81A 3PLVA 4PS7A 3N3KB 4HPMB 1NBFC 2KD0A 2AWTA 5L83A 1WZ3A 2V1YA 1V6EA 2KC2A 3PSEB 2JZ3B 1Z2MA 2N7EA 4FJVB 1LXDA 1WXMA 2WDTB 3ZIMA 1I42A 1UBIA 1MG8A 2KJRA 3QHTA 1GUAB 3IVFA 4B6WA 2C7HA 2I1JA 4ANUA 4G0NB 3NZSA 4DDGD 2FIFA 2G45B 3L16A 2KWCA 4EZKA 3ZRFA 5D2MB 3APCA 1H4RA 2O6VD 3WIMA 3GZNI 4FHJA 3DVGY 3KYDD 4IW0A 4WQOB 2NR2A 2FIDA 2JUOA 4GMVA 4KSLC 4KVGB 3KUZA 2KJHB 3L13A 1WH3A 4NPNA 1WF9A 3HM6X 3A9KA 4WJPA 2VRRB 1EO6A 2FUHB 1QZEA 1NDDA 4B95A 2CHXA 3UQBA 3T8MA 3A1QB 2KVRA 2JXXA 2OJRA 3PLUA 4MH0E 3CF6E 4BKSD 2IO3B 1WGGA 3HM3A 2AYOB 4MELA 1GC6A 2DX5B 2GBRA 2N9PC 3RD2A 5DPWA 1WM3A 2JPHA 3JSVA 4TUUA 1WI0A 3JVZX 2RR9A 2C7NB 5DPSA 1L7YA 2HJ8A 2KTFA 4IWPA 1OQYA 4A20A 3PHWB 4HVBA 5HKHA 1KOTA 3DQVA 1KLVA 2LD9A 5CTRC 4OVUA 2MX2A 3TBLD 3WAOA 2NPTB 3SU8X 1GC7A 2FAZA 3ZDTA 3O65B 2CKHB 2GOWA 2WWZA 3DBSA 4BKTA 3DVNU 4HDOA 2R2QA 3NHEB 1V2YA 4HK2A 2O6VB 4J6IA 4DHZB 3V6CB 2XK5A 2ZVOA 2L7RA 3H7PB 3IBEA 2ZNVB 3QC8B 5DPRA 3VUXA 5AEKB 1RAXA 3VDZA 3L08A 3L17A 2N1WA 2DZKA 2J0JA 4I6NB 4IWQA 2BGFA 3OAWA 2KLCA 4JGHB 4JQWC 3V60A 2MRPA 2KK8A 3SDLC 4ICUA 3KW5B 1AARA 1WXSA 1HE8A 3WA0A 4GSWA 4EEWA 4BOSC 3OLMD 4BFRA 4KIKB 2G3QB 2WX1A 5AZGA 1RFAA 4WWOA 4CYEA 2M17A 1TTNA 1XD3B 2GMIC 3AXCA 2JRIB 1WYWB 4JIOU 1F9JA 3VFKA 1L2NA 3K9OB 4DXAB 5LXHA 4WJQA 4ANXA 2B3AA 4PYUA 2C9WB 3ZW3A 2NS5A 5LXIB 1H8CA 1R4NI 2AL6A 4MGIE 4GB9A 5CHVC 2LZ6A 3AULA 4HCPB 4NNJB 4HXDA 5TR5A 1CMXB 4HPLB 5LLIA 3UIPB 5DPTA 5JZEB 2CS4A 3AU5A 2ZPNA 2BWES 2C5LC 2CHZA 3VH4B 3VXWA 3U8ZA 4FN2A 4MEMA 2L05A 3EECA 2KC1A 4LDTD 3A9JA 3H6NA 4EZJA 2FNJB 4G11A 2DZMA 1GG3A 2KXJA 4ZRKA 2CU1A 4MM3A 1OGWA 4ZRIA 3RULA 4MSMB 3CMMB 3ALBA 1IPGA 2DZJA 3QAQA 1WGHA 2MSED 3DVGX 3HK0A 3VVWB 4E3CA 1EF1A 1WX9A 1WGYA 3ML8A 3DVNV 4K1RB 2IO1B 2KTRB 4P7IA 2IBIB 1V80A 3OJ4B 4DK5A 2KX0A 3B0AA 2WX0A 2KZRA 1WX7A 1WZ0A 4I6LB 3SD5A 3EFUA 3KH0A 4URKA 2JY6A 3VH3B 3EHVA 4W9KA 5KHQA 1WXVA 5E6PA 2O2VB 2LJ5A 1SIFA 3UIOB 1WM2A 4HJKA 2MP2B 2OOBB 2DYBA 1Q1OA 2J0MA 1V5OA 4I6PA 3ZRCA 2KN5A 2NVUI 2R2OA 3DCGA 4LDTB 4M8MA 2GBKA 4BBNF 4XX5A
chains in the Genus database with same CATH superfamily
3ZDMC 4RGNA 4G3XB 2V3PA 3ZNGC 4HDQA 1GB4A 3BINA 2KJ6A 3ZGZA 1HXYD 4P6VF 1FEHA 2DYMA 1VJKA 1WRIA 2KWUB 3X0WA 2IGHA 4LNFA 3NVVA 2AQ1B 4II2B 2REXA 4K7WA 2UU7A 1ZXHA 3ECIA 1FXTB 2MA9B 1IBXB 3RUIB 3BIID 4A8XC 2J42A 3PZ8A 4EKUA 4EZLA 1J19A 1IYFA 2BYVE 3E56A 4RM9A 4US9A 1FCCC 3RZFA 3PGEA 3ZNID 2LI5A 3AEFB 2FCQA 4DHJD 5CX3A 4LK0M 2RGFA 4DBGA 3R2IA 2Z59B 3SEBA 3JSVB 3AE3B 1XLPA 4KIKA 2QSDA 3KLSX 4FJYA 3RNFC 4MH8A 2LGSA 2DAFA 2LGXA 1OEYJ 2QEJC 3M62B 2D07B 2WLBA 1L4ZB 2D3BA 5IKCM 2WXIA 3BVZA 4G50A 2N0SB 3BY4B 4LJPB 5G5GA 3WCQA 2JWZA 2MBOA 4BZAA 2J52A 2DYOA 4DHJB 3OJ3A 3KUCB 3PHXB 4GLSC 5AZFA 4KZCA 1TS4A 2KQSA 3W1YA 3MC0B 2MHJA 3PTFC 3HHMA 3LXFA 2IDYA 5E6OA 5D3DA 3PREA 2L00B 2N7JA 3LB8C 4K3CA 3W2DA 2KDMA 1E8WA 1HZ6A 3N30A 3RNBC 2IPKD 3VTVA 3SHQA 1J0GA 1ESFA 2QIEB 5H92C 2L0FA 5IOIA 2MQJA 3N1YC 4LJOB 1WJNA 4B0MA 1WY8A 3X23A 4FLHA 1OTRB 4MM3B 5JHAA 1PGXA 2Y5BB 3M95A 3N32A 2K8CA 4M01A 4KX6B 1GJZA 1B1ZA 1DYQA 1UELA 1XT9B 4BOZB 1Q5WB 1N5WA 3MHSD 1KJTA 5FKAC 4MDKE 2WXQA 3APFA 3TCAA 3ZNHB 3U4EG 4DHZE 3TMPB 1F52A 1FCLA 3P42A 3L54A 1RRBA 2AQ2B 3VUWA 2IY0B 1E7VA 1QF6A 3DWMA 1AN8A 1YQBA 4LCDE 1L6UA 1UGMA 4RMAA 3CSFA 1BXTA 1WE6A 3IT6B 5GXGB 2KAJA 3NUHB 1V1PA 3P4RB 1IP9A 3AE4B 2LUEA 1ZGUB 5DCNA 1ZDXA 3UQAA 1N63A 1P9DU 3P2BA 4TQ0A 3KUDB 3TEZA 4XDDA 3ZXRA 1P3QU 1F0ZA 1T3QA 3MJWA 4BKSA 1MHXA 1AWDA 2C60A 1VRAB 3P4QB 3DDCB 1JRPA 1F2RC 3N1XC 2M8SA 1XCTL 2K8HA 1AYFA 4F8CB 1ZDVA 4RGTA 2I38A 4F1SA 3RZWC 2BS2B 2JSVX 3MFGA 4P1CC 3LJ3A 3ZJVA 1MPEA 2KLGA 4A6QA 2BB5A 4GDKB 4AUQC 3KYCD 1NEKB 3EUB2 2VH2A 2LUMA 2RD0A 1WGRA 1TKGA 3U52E 4LNIA 1YIWA 3SFDB 2IY1B 3CIRB 1K51A 4EFOA 4A90A 1WJUA 1U4AA 3V62A 1SXTA 1ROEA 3VAWA 1K53A 2LGYA 3TEWA 2Z0EB 4GU2A 2EMTA 1UH6A 4JL9A 3WALA 3AECB 4W9HA 4RH6A 4LNOA 4NAMA 3QIJA 1OFFA 1HA5A 3ZUNA 1EUVB 2UYZB 3BVGA 3Q8BA 3JYUA 5EE3A 2N7DA 1V81A 2Y5PA 1NBFC 5L83A 1V6EA 2KC2A 3I5JC 2WXKA 1N62A 2N7EA 2BYTA 4HRSA 1GUAB 4B6WA 2C7HA 3GS2A 2ZW1A 3DVGY 4KGTA 2NR2A 4GMVA 2PLPA 3L13A 3A9KA 2N9LA 1XLOA 1NDDA 4RF1A 2KQ4X 2CHXA 1BMLC 4B95A 3T8MA 3A1QB 2OJRA 2XNAC 4MACA 2V4IB 4N59A 2L52A 1STEA 1WGGA 2WXPA 2AYOB 4MELA 3RD2A 1NENB 1WM3A 4IWPA 2WXLA 1KLVA 5CTRC 1I4GA 4OVUA 2GI9A 3WAOA 2NPTB 3GZNB 3SU8X 3ZDTA 3O65B 3MP9A 2CKHB 2GOWA 2WWZA 1L5PA 2QJLA 1RFKA 1YMHE 1V2YA 4J6IA 1SE4A 4OZBA 3DHIC 3IBEA 4IWQA 5MPOA 2BGFA 1L0YB 1PGBA 2WXGA 2KK8A 1AARA 4GSWA 3W5UB 4Q2JA 4DXFA 3LYYA 5AZGA 1EWYC 4WWOA 3AXCA 1WYWB 2GB1A 1I4HA 4DXAB 2JX5A 4ANXA 4PYUA 2C9WB 2KWDA 5LXIB 3AULA 4NNJB 4HXDA 5DPTA 5JZEB 1V97A 4HJGE 4C4VA 1FXAA 2L05A 2KC1A 5FK9C 2WNMA 1GG3A 1FMAD 1Y56A 1C78A 3BZDB 4HPPA 1IPGA 1R4NB 2DZJA 1WGHA 1ENFA 2WXOA 1FD6A 4E3CA 1F2RI 1WX9A 1SE3A 3ML8A 3NRZA 1ZE3D 2IO1B 3V05A 2IBIB 2Y5CA 3B2GA 2WU2B 2WX0A 2K5PA 3KH0A 4URKA 2JY6A 3PO0A 3MJ5A 4S17A 3EHVA 1PFDA 5KHQA 2O2VB 1SIFA 3SR6A 1JWMD 2MP2B 2E3TA 1DGJA 1B9RA 4BBNF 4XX5A 2KACA 2LRWA 1S1QB 1P1AA 1TBEA 2KOXA 1N60A 2W3RA 4US8A 2SEBD 3AE1B 1C77A 1UUPA 2KN4A 2HTHA 4FA6A 1J7CA 2PEAA 1I4RA 1V5TA 4P1BC 2K25A 2BKFA 3RCZA 3Q8FA 1JRUA 2O6VA 2DNFA 2IJ0A 2HE7A 2CR5A 2NCNA 1VD2A 1LQBA 2FCSA 1WXAA 4RCOA 4HWIB 4C7YA 2MW5A 2CU3A 3T3OA 2KMMA 2AL3A 2IO0B 1E8XA 4MSQB 2IZVB 2L3ZA 2XN9C 5BO4B 1X1MA 3RFZB 1BT0A 3PV1A 2Q5WD 1FO4A 2JRHA 4XWWA 2BKRB 1UWMA 2XK5B 1WE7A 3RYTA 4PT5A 3NJTA 1TIFA 2KFKB 2BYEA 4M0WB 4W9FA 2K8BA 4D2KA 1J7AA 4A3OA 3L4PA 4NJ7A 2ZEQA 2D3AA 2UWQA 4FJZA 4RFBA 4YL8A 1PDXA 3Q14C 4NAWA 4HLEA 3OG5A 1QILA 1RYJA 3DBLI 2A5UA 2J53A 5J17A 3DOWA 1T0YA 3WAPA 3W9CB 3APDA 4C7ZA 2KDFB 3W1SA 4GIVA 3NOBA 4ASWC 1CQVA 3R3MA 4XGAB 1T5XD 4BAXA 4DXGA 1SGHA 3R7RA 2KHWB 1FPYA 2WP9B 5L95C 1ZUD2 4BKGA 2N1VA 3QQ8B 4W9DA 3Q69A 2K6DB 1Y8RC 3MTNB 2NBVB 4KDLB 2YEPB 4XZ4A 1TKYA 4E74A 2A4ZA 1PYWD 3S2AA 2MBHA 4YTPB 3M63B 3GB1A 1FNVA 3URYA 5G2NA 1Q0WB 4K7SA 2BYFA 1IBXA 1OQQA 4IWOA 1TT5B 3R66C 4TMAB 3KVFB 4ZYSA 2GBMA 5C23A 2BWFA 3NY5A 2NBUA 4MGZE 2QILA 3RNGC 4YTNB 1LM8B 1MHHE 3AE2B 2LGDA 5D3IB 2WS3B 4GGQA 2V3NA 1UD7A 1OQRA 4PS3A 2W9NA 3L10B 5FR3A 4ITKA 2FCMA 4DQOC 2GLSA 3RPFC 3ZQ4A 1WJ4A 5IO9A 3Q3MC 1ZOYB 4USAA 1IGCA 1XLQA 2G4DB 4W9IA 2LWPA 4JLCA 1S3SG 3PZDA 1HTOA 3GE8C 4ICVA 2KNBA 2KWVB 4DWFA 2BT6A 1QOBA 1A5RA 1WR1A 2WGSA 4IM3A 2LXAA 3JW0X 3B1LX 4NJCA 3J9CA 5BYQA 2KYWA 1SJHD 3R7QA 4EE2A 4ANVA 1J7BA 3VTUA 4E71A 4NQKE 1UWXA 2WXJA 2ZPYA 4WH4A 1HTQA 1YNTE 1GNUA 3CWIA 4WWNA 1QOAA 4RNAA 4HROA 3ZVVA 1PQSA 5IA7A 4JPSA 3VTWA 5I4DA 1D5MC 3Q3JA 1E8YA 1EF5A 2JVCA 2KKCA 4XWTA 1TGZB 3H9DA 2MJEA 1ISNA 1V1OA 1UNSA 1E6EB 1E5WA 3DBLB 2BVCA 1WIAA 3FILB 2DWQA 2DENB 1SB3C 4P16A 2D3CA 4AJYB 3N3KB 1KH0A 4HPMB 1WZ3A 1FXIA 2V1YA 2JZ3B 3U2SC 4ZHPA 3GE3C 1LXDA 1WXQA 5EE1A 1FFUA 1UBIA 1YN3A 3AE6B 4XE0A 4ANUA 4G0NB 3NZSA 4DDGD 4EZKA 1L4DB 1YN5A 1H4RA 3FKYA 3GZNI 2ICIA 2PW9A 3KYDD 2FIDA 3C8YA 4KSLC 1WH3A 4NPNA 3HM6X 1TZOA 3PZ7A 3PLUA 1GPXA 2BBCA 2WDRB 3P1MA 5E6JA 4BKSD 3HM3A 1JCKB 4ZOHC 2N9PC 5DPWA 2JPHA 5DPSA 1WI0A 2C7NB 2QC8A 1L7YA 4A20A 3PHWB 1T0RC 4BKTA 1P7FA 2ONQA 1AW7A 4IDIA 1K50A 4DHZB 3V6CB 2ZVOA 3H7PB 2ZNVB 3QC8B 5DPRA 5AEKB 1RAXA 2DZKA 2J0JA 4LNKA 3V60A 1VZ7A 2ZW0A 1CJEA 4RF0A 3MC9A 4L2YA 4EEWA 4BOSC 4XDCA 2TSSA 1RFAA 4CYEA 1TTNA 1XD3B 2GMIC 3KWVA 3I57A 1L2NA 3BYTB 5LXHA 4WJQA 2B3AA 3ZW3A 2DLBA 1EM7A 1R4NI 3TEYA 2AQ3B 2IGGA 4HCPB 1CMXB 5LLIA 4PK1A 1EU3A 1FNUA 2QDFA 1FM0D 3A9JA 2JQRB 3H6NA 2BS4B 2WHIA 2KXJA 4ZRKA 2CU1A 4ACFA 3RULA 4MSMB 3ALBA 3QAQA 2MSED 3HK0A 3P4SB 2CJNA 4M02A 3VVWB 1EF1A 1KLGD 2KTRB 1V80A 1C79A 4DK5A 1FRRA 1WX7A 1WZ0A 4I6LB 4WAFA 1WXVA 5E6PA 2LJ5A 4HJKA 4AS1A 2OOBB 3ZRCA 2NVUI 2R2OA 3BK2A 2GBKA 4MJSA 5CHFA 4N9F4 3KWLA 3ONSA 2CJOA 1YJIA 2KDEB 2W82A 2LVOA 4CHKA 5JXVA 4FHKA 2DHZA 3NZUA 1JMLA 4ARCA 1WMHB 1ZW7A 3KQ4A 3ZJTA 3IG3A 3QJZA 4MGKE 4ZHOA 1WR6E 3VUYA 1T6BX 1KLUD 4NJ6A 5JH5C 4CQNA 1F77A 3ML9A 3DWGC 4K7UA 1YD8U 4M8NA 3AI5A 1NYRA 2L8JA 1XF5L 1N6ZA 2CHWA 2JWUA 1JROA 5G5HA 1SIJA 2WXMA 4KDIC 5D94A 2G4SA 3ZTDA 1ET9A 3K9PB 3UF8A 2K22A 4TKNA 3DHGC 1D5XC 4IUMB 4DDID 4GDLB 2E6XA 3BYYB 3UINB 3ZKJC 1QOGA 4TQ1A 1JWBD 2L1AA 4JWUC 4NY0A 5AUKA 3GP7A 1DOXA 3MHZA 3QX1A 2ZVNA 4CO7A 1JQ4A 2INCC 4LNNA 1P98A 2INPE 4M00A 3VQIA 1YJ1A 3PRPB 4BVUC 2JF5A 2H88B 2L76A 3ZYYX 2INDC 2VH1A 4AOFA 1Z5SB 2M19A 4EOYA 3E9SA 1MJDA 1XQQA 3AEBB 2WXRA 1SSNA 2WDQB 1J8CA 3EC8A 3VHTC 4A55A 3IXSA 3AN1A 2XBBC 3Q8CA 1WJ6A 2V9HA 4A3PA 1NYQA 2LASA 2RMMA 2ZNVC 3M3JA 1QQRA 3QWZB 1TY0A 4B9KA 2YLMA 1T0SC 2ZZPB 3A33B 3P4PB 2AEHA 4C4VB 1WGDA 4OVZA 3B08A 4IKGA 2RDBC 4L23A 1SJED 3PT2B 2O2VA 4YXDB 3AU4A 2K6QA 5BYSA 2MP2A 3QCAA 4KKJA 2KO3A 1KFYB 1L0XB 5G55A 1ZPSA 3RNAC 1V8CA 2K39A 4IG7B 2WYQA 1RM6C 2BPSA 1TZ1A 3NVWA 4WJNA 1UBQA 2PE9A 2H89B 2LJIA 1SEBD 1HEZE 2LHDA 2D2QA 3I3TB 4RM8A 3DBHI 1I4QA 2MEKA 2W54A 4EUTA 2ASQA 2KQ7A 1VZ8A 4HKZE 2LRUA 2LVPA 1G6JA 3ZLZA 3V61A 5CHWA 2LMCA 2VZKD 5C3JB 4HCNB 2EKEC 2LEKA 4RGMA 4W9CA 4YTMB 3DBRI 4L1BA 4OZAA 2WDVB 1TS3A 1WWTA 2RDHA 1TY2A 3R2TA 2ZCCA 2HD5B 1IGDA 3TUOA 4ZRJA 2M1MA 2M56B 1VCBA 3OWEB 1C4AA 3U30A 3GOEA 2JZZA 1YX6B 1V9JA 2MWSB 3ZNZB 1SE9A 3IHPC 3AE5B 4MGYE 4GOCA 5EDSA 4NZLB 2YVCA 3O13A 3MC8A 2OHFA 2VZKB 5EE0A 1K8RB 2KFKA 1D6EC 5HG2A 2FE8A 5D7GA 5EE9A 4KV2A 2K1FA 1WFYA 2D11A 3QA8A 2RSUA 4KZ0A 3NS1A 3U7DA 1P0RA 1YX5B 4AP4C 3D32A 3VR9B 2HTME 3A4RA 1TYGB 2LVQA 4WAAA 1E0ZA 4JE3B 1KM7A 2PJHA 4ZRPA 1D5ZC 4F7ZA 3SFEB 1UZXB 3BVMA 1WGKA 4FULA 3AB5A 3ENEA 4W9GA 4YWGG 3T9LA 2J0KA 4K81A 4NAWB 4OZCA 1GB1A 2N9KA 1I4PA 2L0TA 4W9LA 3A4SC 3Q6BA 2KMCA 3VR8B 2KANA 2N9XA 3AEGB 4YSYB 1CK1A 3DHHC 1C3TA 3PLVA 2OEDA 3IAS1 3PSEB 1FRDA 3I63C 1MVKA 3HVDA 1WXMA 2WDTB 2KVZA 1YQ4B 3T3NA 3AEEB 4H2AA 1MG8A 2KJRA 3QHTA 1FNWA 4RGOS 1VDVA 2FIFA 2KWCA 3APCA 3EFCA 4UDUC 4XYCA 1R4MB 3AV8A 2PVOD 3HUIA 4WQOB 2JUOA 2K3UA 4WJPA 2VRRB 3TSSA 4MH0E 1QLBB 2JXXA 1YJJA 2IO3B 4REZA 1GC6A 3DBHB 3H8HA 2W55A 3JSVA 3JVZX 1EU4A 2KTFA 4HVBA 3DQVA 2JYEA 3TBLD 2D5GA 2FAZA 2L32A 2QCZA 3V3XA 1JWSD 4LLGM 4HDOA 1XEEA 4HK2A 5H8YE 1ZP0B 4HKQA 3DBRB 2L7RA 3VUXA 2Y3AA 3VDZA 1YQ3B 1N5XA 3L17A 2N1WA 4I6NB 3L08A 2KLCA 4JGHB 2MRPA 3RMKC 3SDLC 2WU5B 4ICUA 3BWUD 1UF0A 1ZXIA 3KW5B 1WXSA 2RPVA 1HE8A 4K3BA 4BFRA 3EGRA 4KIKB 2X38A 1P7EA 2M17A 4AQ7A 1L0VB 2BS3B 2JRIB 4JIOU 1F9JA 3HRDD 2WQYB 1I4XA 3K9OB 2NS5A 1TS5A 3UI3A 1WYGA 2AL6A 4MGIE 4GB9A 5CHVC 1D4BA 4QAYA 2WXNA 1VZ6A 2V0GA 1SE2A 2CS4A 5BMGA 3AU5A 3HVZA 1C9FA 2CHZA 3VH4B 1F1HA 2JZPA 4MEMA 4YT0B 4EZJA 2FNJB 4G11A 2DZMA 4KGRA 1C76A 3FILA 4MM3A 1OGWA 4N58A 3CMMB 3Q3NC 3FAHA 3VRBB 5IP4D 1E10A 3W5VB 4ZRQA 4P7IA 3OJ4B 4OW0A 1C4CA 3B0AA 3SD5A 3EFUA 3VH3B 4W9KA 2MJ3A 3UIOB 1WM2A 1KF6B 3FC4A 1XCQL 4C80A 2J0MA 1V5OA 3NVYA 4I6PA 4M8MA 3DCGA 3R8BA 3AE7B 2GBJA 3NS8A 3ZTCA 5LNK1 1GOZA 1SBBB 3C0RB 3U7ZA 3L0WB 3H7SA 3TJPA 3PVLA 1SF0A 3H1UA 4IM2A 4WURA 4OHJA 1DOYA 1MI0A 2PIAA 3NVZA 5T8IA 4XC2A 1QOFA 3V6EB 5GMVA 1VLBA 3BK1A 4FXCA 2BQQA 3AEDB 4S0RA 2G1EA 3TL5A 3Q3OC 2MBBB 2I1KA 3C19A 5D6JB 1YOVB 2N9EB 3W1SC 2KDBA 1NI3A 1PGAA 1V1PB 2NTTA 1D3ZA 3H7PA 1JWAD 1VR9A 1C1YB 5JHBA 1UGJA 4WJOA 2JU6X 2M4NA 2MBEA 1DOIA 3PRMB 1WRDB 3PRZA 3TIXA 3DPDA 1OEYA 4GDKA 5IN7A 2B76B 2D10A 1LFDA 2I2YA 1MFWA 4A9AA 5BMIA 2IGDA 2C7MB 4GXBA 2DAJA 3LDZE 5HI1A 2QHOA 2J4XA 2MJDA 2Z8LA 1T0QC 2IYDB 2PPHA 2N4FA 5J18A 1M94A 4C56C 1JWUD 4X57B 3AE9B 1JALA 1E7UA 2XEWA 4JWSC 2L83A 3B9JA 3HIZA 4IC7B 2PE6B 4OVVA 3RNCC 1NI2A 4ZYNA 2V3SA 2AX5A 5J2RA 1HZ5A 3Q8AA 2ON8A 4WWPA 3IT4B 2KTRA 4KGSA 2DZIA 1WSPA 3PS6A 3A9JB 3QK0A 4AWJA 4GN1A 2LXCA 4N6EB 4AJWA 3EA6A 1I35A 4WWMA 2OJWA 3ETRA 2LHEA 5IAAC 3B2FA 2BF8B 4NQLB 3QARA 1EWCA 4PS8A 2EMSA 2KDIA 3VRAB 2PVGC 3ZO5B 3WANA 3A1QA 2HDEA 3Q2AC 1RLFA 1WMHA 4BBNC 2NBWB 1QKZA 3N20C 1V49A 3AMZA 2BB6A 4IM0A 1GAQB 4KSKC 4MJSB 2NPTA 4FBJB 1E7PB 2ZCBA 2X8XX 2V4LA 3WAMA 2J7QB 2KX3A 2PKOA 3A9KB 3ABVB 1Q10A 2MCNB 2GRIA 1XXGA 5KHOA 2KMAA 5BYRA 4ANWA 4GDLA 2YEPF 1ZKHA 2HJ1A 2KT7A 3CSTA 4LTUA 1V86A 5E6NA 2EKIA 1E9MA 3AEAB 2D3GA 1N61A 5C1ZA 5HFYA 4HEA1 1IUEA 4II3B 2FCNA 2M0XA 1A70A 4W9EA 1JW9D 4FADA 2W3SA 5TSSA 4PYZA 3IFWB 2PMVA 4J3OD 4O1NA 4ZDVA 2JT4B 4WIPA 2MLBA 2Z0DB 4B0EA 2BTEA 3Q3FA 2LFIA 3PPAA 1HQRD 1C4PA 3NG0A 1LO5D 2IO2B 4TV3A 2ZJDA 2GBNA 5FR6A 4TSSA 2MBQA 5AZHA 2RPQA 1L6VA 1R7SA 4IOIE 4W9JA 1WX8A 1E90A 3UGBB 1TKEA 2NMQA 1XLNA 2FUG1 1R4MI 4YSXB 1E8ZA 1NVID 2KFJA 4PS7A 2FBWB 1KRHA 2AWTA 2KD0A 1Z2MA 3ZJUA 4FJVB 1MG4A 2JXTA 3ZIMA 1I42A 3IVFA 1PUTA 2I1JA 1FIQA 4R3DA 3RI7C 1TS2A 2PTLA 3N1ZC 3L16A 2G45B 1ET6A 3ZRFA 5D2MB 2O6VD 1QT9A 3AH7A 4FHJA 4IW0A 4KVGB 3KUZA 2KJHB 1WF9A 3ZXVA 1EO6A 2FUHB 1QZEA 3UQBA 2KVRA 3CF6E 2BW2A 2DX5B 2GBRA 4TUUA 3RT3B 3WIMA 2RR9A 5HKHA 2HJ8A 1KOTA 1OQYA 2LD9A 2M0AA 2MX2A 1GC7A 3IAM1 3P63A 3DBSA 3NZ3A 3AE8B 3DVNU 2R61A 2R2QA 3NHEB 2O6VB 2JYTA 2WXFA 2XK5A 1KTKA 4ARIA 2WXHA 3RN9C 4M0WA 1FFVA 3OAWA 5BMHA 2EELA 4JQWC 2RDGA 5C2TB 3WA0A 2K0PA 3OLMD 3I9V1 1M4VA 2G3QB 2WX1A 3TEXA 1YN4A 1BUIC 1TJEA 1I7HA 3VFKA 4JX1C 1CZPA 1LGRA 1H8CA 4WQMA 2ACZB 2LZ6A 2DBYA 5TR5A 4HPLB 5HHDG 3UIPB 2G9HD 1XO3A 2INNE 2ZPNA 3RNEC 2BWES 2C5LC 3VXWA 3U8ZA 4FN2A 3EECA 4LDTD 2K9XA 2SAKA 4ZRIA 3DVGX 4YSZB 1RWSA 3AM9A 1WGYA 2NTSA 5AUIA 3DVNV 4K1RB 4KKIA 2KX0A 3N9YC 1ACCA 2KZRA 4C00A 2QMTA 1K52A 3Q8EA 4MT5A 2MH7A 2DYBA 1Q1OA 2KN5A 4LDTB 2LGIA
chains in the Genus database with same CATH topology
4MJSA 2LRWA 2GBJA 1S1QB 3NS8A 4N9F4 5CHFA 1P1AA 3ZDMC 3ZTCA 1TBEA 4G3XB 3ZNGC 3C0RB 2KOXA 3ONSA 4HDQA 3L0WB 3H7SA 2KDEB 3TJPA 3BINA 3PVLA 2KJ6A 3H1UA 2LVOA 4IM2A 4CHKA 4FHKA 2DHZA 3NZUA 2DYMA 2KWUB 3X0WA 1WMHB 4XC2A 1ZW7A 4II2B 2HTHA 2REXA 3V6EB 5GMVA 4FA6A 3IG3A 3QJZA 4K7WA 4MGKE 1WR6E 3VUYA 3ECIA 1FXTB 2MA9B 4NJ6A 5JH5C 2PEAA 3TL5A 2MBBB 3RUIB 3ML9A 2I1KA 4K7UA 1V5TA 1YD8U 4M8NA 3AI5A 2K25A 4EKUA 2BKFA 2L8JA 3RCZA 5D6JB 4EZLA 1J19A 2CHWA 2N9EB 2BYVE 3W1SC 2KDBA 1JRUA 1IYFA 4KDIC 5D94A 4RM9A 2G4SA 2O6VA 3RZFA 3ZTDA 3PGEA 3ZNID 3K9PB 3UF8A 2LI5A 1D3ZA 3H7PA 2HE7A 2FCQA 4TKNA 4DHJD 1C1YB 5JHBA 2CR5A 4WJOA 2NCNA 5CX3A 4IUMB 1VD2A 2M4NA 1LQBA 4GDLB 2MBEA 2RGFA 2FCSA 4DDID 4DBGA 1WXAA 2Z59B 3JSVB 3UINB 3PRMB 1WRDB 4HWIB 3PRZA 3ZKJC 3TIXA 2MW5A 3DPDA 4TQ1A 1OEYA 2AL3A 4GDKA 2IO0B 1E8XA 4MSQB 4KIKA 2IZVB 2D10A 2L3ZA 1LFDA 4FJYA 2DAFA 2LGXA 1OEYJ 4NY0A 5BO4B 1X1MA 3M62B 1BT0A 3PV1A 4GXBA 2C7MB 3QX1A 2D07B 2JRHA 2ZVNA 2DAJA 4CO7A 2BKRB 1P98A 2XK5B 3LDZE 1WE7A 3VQIA 2QHOA 3RYTA 1YJ1A 3PRPB 2KFKB 2BYEA 4M0WB 4W9FA 4BVUC 2JF5A 3BY4B 2L76A 4G50A 4LJPB 2K8BA 2IYDB 2JWZA 2PPHA 4A3OA 4AOFA 2MBOA 1Z5SB 2N4FA 2DYOA 5J18A 4NJ7A 4DHJB 1M94A 4EOYA 3OJ3A 2ZEQA 3KUCB 1XQQA 3PHXB 5AZFA 4X57B 4KZCA 2KQSA 2UWQA 4FJZA 3W1YA 4YL8A 1J8CA 3EC8A 3PTFC 3HHMA 3VHTC 4NAWA 4HLEA 2XBBC 1E7UA 1WJ6A 4A3PA 2XEWA 5E6OA 3DBLI 2A5UA 3HIZA 5J17A 3PREA 3DOWA 4IC7B 1T0YA 2LASA 2PE6B 2ZNVC 3M3JA 3QWZB 4OVVA 1NI2A 2L00B 3WAPA 4B9KA 1E8WA 4ZYNA 2V3SA 5J2RA 3N30A 3APDA 2YLMA 2KDFB 2ZZPB 4WWPA 3A33B 3W1SA 3VTVA 2AEHA 2KTRA 1WGDA 3NOBA 3B08A 4GIVA 3SHQA 4ASWC 3R3MA 1J0GA 1SGHA 2DZIA 2L0FA 3R7RA 2KHWB 2MQJA 3PS6A 3A9JB 3QK0A 3PT2B 4LJOB 1WJNA 2O2VA 1WY8A 3AU4A 4AWJA 4BKGA 5L95C 4GN1A 2LXCA 3X23A 2N1VA 2K6QA 4FLHA 1OTRB 2MP2A 4AJWA 3QQ8B 4W9DA 1I35A 5JHAA 3QCAA 2KO3A 2K6DB 2Y5BB 5G55A 1Y8RC 3M95A 3N32A 3MTNB 2K39A 4IG7B 2K8CA 5IAAC 2BF8B 2WYQA 2NBVB 1GJZA 4KDLB 3QARA 4NQLB 2BPSA 4XZ4A 1TZ1A 4PS8A 2EMSA 2KDIA 1UELA 4WJNA 1XT9B 1UBQA 4BOZB 1Q5WB 3ZO5B 3MHSD 2PE9A 3WANA 1KJTA 4E74A 2A4ZA 3A1QA 4MDKE 1RLFA 3APFA 3TCAA 1WMHA 2D2QA 3ZNHB 4BBNC 3S2AA 3I3TB 2MBHA 4RM8A 3TMPB 4DHZE 3M63B 3DBHI 2NBWB 4EUTA 2ASQA 1V49A 5G2NA 3L54A 1RRBA 2KQ7A 3VUWA 1Q0WB 4IM0A 2IY0B 4K7SA 2LRUA 2BYFA 2LVPA 1G6JA 1E7VA 4IWOA 3ZLZA 3V61A 4KSKC 5CHWA 3R66C 4MJSB 1YQBA 3KVFB 4LCDE 1UGMA 2GBMA 2NPTA 4RMAA 4FBJB 3CSFA 4HCNB 2EKEC 5C23A 2BWFA 2ZCBA 3NY5A 2V4LA 3WAMA 1WE6A 2NBUA 2J7QB 4W9CA 2KX3A 3A9KB 3DBRI 1IP9A 4MGZE 2LUEA 1ZGUB 5DCNA 2MCNB 5KHOA 3UQAA 2KMAA 1LM8B 1P9DU 2LGDA 2ZCCA 3P2BA 4TQ0A 3KUDB 2HD5B 4ANWA 4GDLA 4GGQA 1P3QU 4ZRJA 2M1MA 1UD7A 4PS3A 2W9NA 3L10B 1VCBA 1ZKHA 2FCMA 3U30A 3MJWA 3GOEA 2JZZA 3RT3B 4BKSA 1YX6B 1V9JA 2MWSB 3ZNZB 1SE9A 2C60A 3IHPC 3CSTA 3DDCB 1V86A 4MGYE 5E6NA 4GOCA 1WJ4A 2M8SA 2D3GA 2K8HA 5EDSA 4F8CB 2YVCA 5C1ZA 4F1SA 3RZWC 1K8RB 2KFKA 2G4DB 4II3B 3LJ3A 2FCNA 2LWPA 4JLCA 1S3SG 3PZDA 4ICVA 4W9IA 5D7GA 4KV2A 2K1FA 2KNBA 2KLGA 2KWVB 2M0XA 4DWFA 1WFYA 4W9EA 2D11A 3QA8A 1WR1A 1A5RA 4GDKB 4FADA 4IM3A 4AUQC 2RSUA 4PYZA 3IFWB 3KYCD 2LXAA 3JW0X 3B1LX 4KZ0A 4ZDVA 2JT4B 3R7QA 3U7DA 2MLBA 2Z0DB 2RD0A 1WGRA 3Q3FA 1P0RA 4ANVA 4E71A 3VTUA 4NQKE 1YIWA 1YX5B 3PPAA 2IY1B 4AP4C 3D32A 4EFOA 2ZPYA 1WJUA 1U4AA 3A4RA 3V62A 4WAAA 2LVQA 1GNUA 1KM7A 2IO2B 2PJHA 2LGYA 4TV3A 2ZJDA 2GBNA 2Z0EB 3VAWA 4GU2A 5FR6A 4WWNA 2EMTA 4F7ZA 1UH6A 1UZXB 4JL9A 3ZVVA 2MBQA 5AZHA 1PQSA 2RPQA 3WALA 5IA7A 4FULA 4W9JA 3VTWA 3Q3JA 4W9HA 1E8YA 3ENEA 1EF5A 4W9GA 2JVCA 1WX8A 2J0KA 2KKCA 4K81A 4NAWB 3T9LA 2L0TA 1E90A 3A4SC 1TGZB 3H9DA 3QIJA 4W9LA 1ISNA 2KMCA 3UGBB 1E5WA 3ZUNA 2KANA 1EUVB 1WIAA 2N9XA 2UYZB 2DENB 3JYUA 4AJYB 2N7DA 1R4MI 1E8ZA 2KFJA 1C3TA 1V81A 3PLVA 4PS7A 3N3KB 4HPMB 1NBFC 2KD0A 2AWTA 5L83A 1WZ3A 2V1YA 1V6EA 2KC2A 3PSEB 2JZ3B 1Z2MA 2N7EA 4FJVB 1LXDA 1WXMA 2WDTB 3ZIMA 1I42A 1UBIA 1MG8A 2KJRA 3QHTA 1GUAB 3IVFA 4B6WA 2C7HA 2I1JA 4ANUA 4G0NB 3NZSA 4DDGD 2FIFA 2G45B 3L16A 2KWCA 4EZKA 3ZRFA 5D2MB 3APCA 1H4RA 2O6VD 3WIMA 3GZNI 4FHJA 3DVGY 3KYDD 4IW0A 4WQOB 2NR2A 2FIDA 2JUOA 4GMVA 4KSLC 4KVGB 3KUZA 2KJHB 3L13A 1WH3A 4NPNA 1WF9A 3HM6X 3A9KA 4WJPA 2VRRB 1EO6A 2FUHB 1QZEA 1NDDA 4B95A 2CHXA 3UQBA 3T8MA 3A1QB 2KVRA 2JXXA 2OJRA 3PLUA 4MH0E 3CF6E 4BKSD 2IO3B 1WGGA 3HM3A 2AYOB 4MELA 1GC6A 2DX5B 2GBRA 2N9PC 3RD2A 5DPWA 1WM3A 2JPHA 3JSVA 4TUUA 1WI0A 3JVZX 2RR9A 2C7NB 5DPSA 1L7YA 2HJ8A 2KTFA 4IWPA 1OQYA 4A20A 3PHWB 4HVBA 5HKHA 1KOTA 3DQVA 1KLVA 2LD9A 5CTRC 4OVUA 2MX2A 3TBLD 3WAOA 2NPTB 3SU8X 1GC7A 2FAZA 3ZDTA 3O65B 2CKHB 2GOWA 2WWZA 3DBSA 4BKTA 3DVNU 4HDOA 2R2QA 3NHEB 1V2YA 4HK2A 2O6VB 4J6IA 4DHZB 3V6CB 2XK5A 2ZVOA 2L7RA 3H7PB 3IBEA 2ZNVB 3QC8B 5DPRA 3VUXA 5AEKB 1RAXA 3VDZA 3L08A 3L17A 2N1WA 2DZKA 2J0JA 4I6NB 4IWQA 2BGFA 3OAWA 2KLCA 4JGHB 4JQWC 3V60A 2MRPA 2KK8A 3SDLC 4ICUA 3KW5B 1AARA 1WXSA 1HE8A 3WA0A 4GSWA 4EEWA 4BOSC 3OLMD 4BFRA 4KIKB 2G3QB 2WX1A 5AZGA 1RFAA 4WWOA 4CYEA 2M17A 1TTNA 1XD3B 2GMIC 3AXCA 2JRIB 1WYWB 4JIOU 1F9JA 3VFKA 1L2NA 3K9OB 4DXAB 5LXHA 4WJQA 4ANXA 2B3AA 4PYUA 2C9WB 3ZW3A 2NS5A 5LXIB 1H8CA 1R4NI 2AL6A 4MGIE 4GB9A 5CHVC 2LZ6A 3AULA 4HCPB 4NNJB 4HXDA 5TR5A 1CMXB 4HPLB 5LLIA 3UIPB 5DPTA 5JZEB 2CS4A 3AU5A 2ZPNA 2BWES 2C5LC 2CHZA 3VH4B 3VXWA 3U8ZA 4FN2A 4MEMA 2L05A 3EECA 2KC1A 4LDTD 3A9JA 3H6NA 4EZJA 2FNJB 4G11A 2DZMA 1GG3A 2KXJA 4ZRKA 2CU1A 4MM3A 1OGWA 4ZRIA 3RULA 4MSMB 3CMMB 3ALBA 1IPGA 2DZJA 3QAQA 1WGHA 2MSED 3DVGX 3HK0A 3VVWB 4E3CA 1EF1A 1WX9A 1WGYA 3ML8A 3DVNV 4K1RB 2IO1B 2KTRB 4P7IA 2IBIB 1V80A 3OJ4B 4DK5A 2KX0A 3B0AA 2WX0A 2KZRA 1WX7A 1WZ0A 4I6LB 3SD5A 3EFUA 3KH0A 4URKA 2JY6A 3VH3B 3EHVA 4W9KA 5KHQA 1WXVA 5E6PA 2O2VB 2LJ5A 1SIFA 3UIOB 1WM2A 4HJKA 2MP2B 2OOBB 2DYBA 1Q1OA 2J0MA 1V5OA 4I6PA 3ZRCA 2KN5A 2NVUI 2R2OA 3DCGA 4LDTB 4M8MA 2GBKA 4BBNF 4XX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS A;  2LRW A;  2GBJ A;  1S1Q B;  3NS8 A;  4N9F 4;  5CHF A;  1P1A A;  3ZDM C;  3ZTC A;  1TBE A;  4G3X B;  3ZNG C;  3C0R B;  2KOX A;  3ONS A;  4HDQ A;  3L0W B;  3H7S A;  2KDE B;  3TJP A;  3BIN A;  3PVL A;  2KJ6 A;  3H1U A;  2LVO A;  4IM2 A;  4CHK A;  4FHK A;  2DHZ A;  3NZU A;  2DYM A;  2KWU B;  3X0W A;  1WMH B;  4XC2 A;  1ZW7 A;  4II2 B;  2HTH A;  2REX A;  3V6E B;  5GMV A;  4FA6 A;  3IG3 A;  3QJZ A;  4K7W A;  4MGK E;  1WR6 E;  3VUY A;  3ECI A;  1FXT B;  2MA9 B;  4NJ6 A;  5JH5 C;  2PEA A;  3TL5 A;  2MBB B;  3RUI B;  3ML9 A;  2I1K A;  4K7U A;  1V5T A;  1YD8 U;  4M8N A;  3AI5 A;  2K25 A;  4EKU A;  2BKF A;  2L8J A;  3RCZ A;  5D6J B;  4EZL A;  1J19 A;  2CHW A;  2N9E B;  2BYV E;  3W1S C;  2KDB A;  1JRU A;  1IYF A;  4KDI C;  5D94 A;  4RM9 A;  2G4S A;  2O6V A;  3RZF A;  3ZTD A;  3PGE A;  3ZNI D;  3K9P B;  3UF8 A;  2LI5 A;  1D3Z A;  3H7P A;  2HE7 A;  2FCQ A;  4TKN A;  4DHJ D;  1C1Y B;  5JHB A;  2CR5 A;  4WJO A;  2NCN A;  5CX3 A;  4IUM B;  1VD2 A;  2M4N A;  1LQB A;  4GDL B;  2MBE A;  2RGF A;  2FCS A;  4DDI D;  4DBG A;  1WXA A;  2Z59 B;  3JSV B;  3UIN B;  3PRM B;  1WRD B;  4HWI B;  3PRZ A;  3ZKJ C;  3TIX A;  2MW5 A;  3DPD A;  4TQ1 A;  1OEY A;  2AL3 A;  4GDK A;  2IO0 B;  1E8X A;  4MSQ B;  4KIK A;  2IZV B;  2D10 A;  2L3Z A;  1LFD A;  4FJY A;  2DAF A;  2LGX A;  1OEY J;  4NY0 A;  5BO4 B;  1X1M A;  3M62 B;  1BT0 A;  3PV1 A;  4GXB A;  2C7M B;  3QX1 A;  2D07 B;  2JRH A;  2ZVN A;  2DAJ A;  4CO7 A;  2BKR B;  1P98 A;  2XK5 B;  3LDZ E;  1WE7 A;  3VQI A;  2QHO A;  3RYT A;  1YJ1 A;  3PRP B;  2KFK B;  2BYE A;  4M0W B;  4W9F A;  4BVU C;  2JF5 A;  3BY4 B;  2L76 A;  4G50 A;  4LJP B;  2K8B A;  2IYD B;  2JWZ A;  2PPH A;  4A3O A;  4AOF A;  2MBO A;  1Z5S B;  2N4F A;  2DYO A;  5J18 A;  4NJ7 A;  4DHJ B;  1M94 A;  4EOY A;  3OJ3 A;  2ZEQ A;  3KUC B;  1XQQ A;  3PHX B;  5AZF A;  4X57 B;  4KZC A;  2KQS A;  2UWQ A;  4FJZ A;  3W1Y A;  4YL8 A;  1J8C A;  3EC8 A;  3PTF C;  3HHM A;  3VHT C;  4NAW A;  4HLE A;  2XBB C;  1E7U A;  1WJ6 A;  4A3P A;  2XEW A;  5E6O A;  3DBL I;  2A5U A;  3HIZ A;  5J17 A;  3PRE A;  3DOW A;  4IC7 B;  1T0Y A;  2LAS A;  2PE6 B;  2ZNV C;  3M3J A;  3QWZ B;  4OVV A;  1NI2 A;  2L00 B;  3WAP A;  4B9K A;  1E8W A;  4ZYN A;  2V3S A;  5J2R A;  3N30 A;  3APD A;  2YLM A;  2KDF B;  2ZZP B;  4WWP A;  3A33 B;  3W1S A;  3VTV A;  2AEH A;  2KTR A;  1WGD A;  3NOB A;  3B08 A;  4GIV A;  3SHQ A;  4ASW C;  3R3M A;  1J0G A;  1SGH A;  2DZI A;  2L0F A;  3R7R A;  2KHW B;  2MQJ A;  3PS6 A;  3A9J B;  3QK0 A;  3PT2 B;  4LJO B;  1WJN A;  2O2V A;  1WY8 A;  3AU4 A;  4AWJ A;  4BKG A;  5L95 C;  4GN1 A;  2LXC A;  3X23 A;  2N1V A;  2K6Q A;  4FLH A;  1OTR B;  2MP2 A;  4AJW A;  3QQ8 B;  4W9D A;  1I35 A;  5JHA A;  3QCA A;  2KO3 A;  2K6D B;  2Y5B B;  5G55 A;  1Y8R C;  3M95 A;  3N32 A;  3MTN B;  2K39 A;  4IG7 B;  2K8C A;  5IAA C;  2BF8 B;  2WYQ A;  2NBV B;  1GJZ A;  4KDL B;  3QAR A;  4NQL B;  2BPS A;  4XZ4 A;  1TZ1 A;  4PS8 A;  2EMS A;  2KDI A;  1UEL A;  4WJN A;  1XT9 B;  1UBQ A;  4BOZ B;  1Q5W B;  3ZO5 B;  3MHS D;  2PE9 A;  3WAN A;  1KJT A;  4E74 A;  2A4Z A;  3A1Q A;  4MDK E;  1RLF A;  3APF A;  3TCA A;  1WMH A;  2D2Q A;  3ZNH B;  4BBN C;  3S2A A;  3I3T B;  2MBH A;  4RM8 A;  3TMP B;  4DHZ E;  3M63 B;  3DBH I;  2NBW B;  4EUT A;  2ASQ A;  1V49 A;  5G2N A;  3L54 A;  1RRB A;  2KQ7 A;  3VUW A;  1Q0W B;  4IM0 A;  2IY0 B;  4K7S A;  2LRU A;  2BYF A;  2LVP A;  1G6J A;  1E7V A;  4IWO A;  3ZLZ A;  3V61 A;  4KSK C;  5CHW A;  3R66 C;  4MJS B;  1YQB A;  3KVF B;  4LCD E;  1UGM A;  2GBM A;  2NPT A;  4RMA A;  4FBJ B;  3CSF A;  4HCN B;  2EKE C;  5C23 A;  2BWF A;  2ZCB A;  3NY5 A;  2V4L A;  3WAM A;  1WE6 A;  2NBU A;  2J7Q B;  4W9C A;  2KX3 A;  3A9K B;  3DBR I;  1IP9 A;  4MGZ E;  2LUE A;  1ZGU B;  5DCN A;  2MCN B;  5KHO A;  3UQA A;  2KMA A;  1LM8 B;  1P9D U;  2LGD A;  2ZCC A;  3P2B A;  4TQ0 A;  3KUD B;  2HD5 B;  4ANW A;  4GDL A;  4GGQ A;  1P3Q U;  4ZRJ A;  2M1M A;  1UD7 A;  4PS3 A;  2W9N A;  3L10 B;  1VCB A;  1ZKH A;  2FCM A;  3U30 A;  3MJW A;  3GOE A;  2JZZ A;  3RT3 B;  4BKS A;  1YX6 B;  1V9J A;  2MWS B;  3ZNZ B;  1SE9 A;  2C60 A;  3IHP C;  3CST A;  3DDC B;  1V86 A;  4MGY E;  5E6N A;  4GOC A;  1WJ4 A;  2M8S A;  2D3G A;  2K8H A;  5EDS A;  4F8C B;  2YVC A;  5C1Z A;  4F1S A;  3RZW C;  1K8R B;  2KFK A;  2G4D B;  4II3 B;  3LJ3 A;  2FCN A;  2LWP A;  4JLC A;  1S3S G;  3PZD A;  4ICV A;  4W9I A;  5D7G A;  4KV2 A;  2K1F A;  2KNB A;  2KLG A;  2KWV B;  2M0X A;  4DWF A;  1WFY A;  4W9E A;  2D11 A;  3QA8 A;  1WR1 A;  1A5R A;  4GDK B;  4FAD A;  4IM3 A;  4AUQ C;  2RSU A;  4PYZ A;  3IFW B;  3KYC D;  2LXA A;  3JW0 X;  3B1L X;  4KZ0 A;  4ZDV A;  2JT4 B;  3R7Q A;  3U7D A;  2MLB A;  2Z0D B;  2RD0 A;  1WGR A;  3Q3F A;  1P0R A;  4ANV A;  4E71 A;  3VTU A;  4NQK E;  1YIW A;  1YX5 B;  3PPA A;  2IY1 B;  4AP4 C;  3D32 A;  4EFO A;  2ZPY A;  1WJU A;  1U4A A;  3A4R A;  3V62 A;  4WAA A;  2LVQ A;  1GNU A;  1KM7 A;  2IO2 B;  2PJH A;  2LGY A;  4TV3 A;  2ZJD A;  2GBN A;  2Z0E B;  3VAW A;  4GU2 A;  5FR6 A;  4WWN A;  2EMT A;  4F7Z A;  1UH6 A;  1UZX B;  4JL9 A;  3ZVV A;  2MBQ A;  5AZH A;  1PQS A;  2RPQ A;  3WAL A;  5IA7 A;  4FUL A;  4W9J A;  3VTW A;  3Q3J A;  4W9H A;  1E8Y A;  3ENE A;  1EF5 A;  4W9G A;  2JVC A;  1WX8 A;  2J0K A;  2KKC A;  4K81 A;  4NAW B;  3T9L A;  2L0T A;  1E90 A;  3A4S C;  1TGZ B;  3H9D A;  3QIJ A;  4W9L A;  1ISN A;  2KMC A;  3UGB B;  1E5W A;  3ZUN A;  2KAN A;  1EUV B;  1WIA A;  2N9X A;  2UYZ B;  2DEN B;  3JYU A;  4AJY B;  2N7D A;  1R4M I;  1E8Z A;  2KFJ A;  1C3T A;  1V81 A;  3PLV A;  4PS7 A;  3N3K B;  4HPM B;  1NBF C;  2KD0 A;  2AWT A;  5L83 A;  1WZ3 A;  2V1Y A;  1V6E A;  2KC2 A;  3PSE B;  2JZ3 B;  1Z2M A;  2N7E A;  4FJV B;  1LXD A;  1WXM A;  2WDT B;  3ZIM A;  1I42 A;  1UBI A;  1MG8 A;  2KJR A;  3QHT A;  1GUA B;  3IVF A;  4B6W A;  2C7H A;  2I1J A;  4ANU A;  4G0N B;  3NZS A;  4DDG D;  2FIF A;  2G45 B;  3L16 A;  2KWC A;  4EZK A;  3ZRF A;  5D2M B;  3APC A;  1H4R A;  2O6V D;  3WIM A;  3GZN I;  4FHJ A;  3DVG Y;  3KYD D;  4IW0 A;  4WQO B;  2NR2 A;  2FID A;  2JUO A;  4GMV A;  4KSL C;  4KVG B;  3KUZ A;  2KJH B;  3L13 A;  1WH3 A;  4NPN A;  1WF9 A;  3HM6 X;  3A9K A;  4WJP A;  2VRR B;  1EO6 A;  2FUH B;  1QZE A;  1NDD A;  4B95 A;  2CHX A;  3UQB A;  3T8M A;  3A1Q B;  2KVR A;  2JXX A;  2OJR A;  3PLU A;  4MH0 E;  3CF6 E;  4BKS D;  2IO3 B;  1WGG A;  3HM3 A;  2AYO B;  4MEL A;  1GC6 A;  2DX5 B;  2GBR A;  2N9P C;  3RD2 A;  5DPW A;  1WM3 A;  2JPH A;  3JSV A;  4TUU A;  1WI0 A;  3JVZ X;  2RR9 A;  2C7N B;  5DPS A;  1L7Y A;  2HJ8 A;  2KTF A;  4IWP A;  1OQY A;  4A20 A;  3PHW B;  4HVB A;  5HKH A;  1KOT A;  3DQV A;  1KLV A;  2LD9 A;  5CTR C;  4OVU A;  2MX2 A;  3TBL D;  3WAO A;  2NPT B;  3SU8 X;  1GC7 A;  2FAZ A;  3ZDT A;  3O65 B;  2CKH B;  2GOW A;  2WWZ A;  3DBS A;  4BKT A;  3DVN U;  4HDO A;  2R2Q A;  3NHE B;  1V2Y A;  4HK2 A;  2O6V B;  4J6I A;  4DHZ B;  3V6C B;  2XK5 A;  2ZVO A;  2L7R A;  3H7P B;  3IBE A;  2ZNV B;  3QC8 B;  5DPR A;  3VUX A;  5AEK B;  1RAX A;  3VDZ A;  3L08 A;  3L17 A;  2N1W A;  2DZK A;  2J0J A;  4I6N B;  4IWQ A;  2BGF A;  3OAW A;  2KLC A;  4JGH B;  4JQW C;  3V60 A;  2MRP A;  2KK8 A;  3SDL C;  4ICU A;  3KW5 B;  1AAR A;  1WXS A;  1HE8 A;  3WA0 A;  4GSW A;  4EEW A;  4BOS C;  3OLM D;  4BFR A;  4KIK B;  2G3Q B;  2WX1 A;  5AZG A;  1RFA A;  4WWO A;  4CYE A;  2M17 A;  1TTN A;  1XD3 B;  2GMI C;  3AXC A;  2JRI B;  1WYW B;  4JIO U;  1F9J A;  3VFK A;  1L2N A;  3K9O B;  4DXA B;  5LXH A;  4WJQ A;  4ANX A;  2B3A A;  4PYU A;  2C9W B;  3ZW3 A;  2NS5 A;  5LXI B;  1H8C A;  1R4N I;  2AL6 A;  4MGI E;  4GB9 A;  5CHV C;  2LZ6 A;  3AUL A;  4HCP B;  4NNJ B;  4HXD A;  5TR5 A;  1CMX B;  4HPL B;  5LLI A;  3UIP B;  5DPT A;  5JZE B;  2CS4 A;  3AU5 A;  2ZPN A;  2BWE S;  2C5L C;  2CHZ A;  3VH4 B;  3VXW A;  3U8Z A;  4FN2 A;  4MEM A;  2L05 A;  3EEC A;  2KC1 A;  4LDT D;  3A9J A;  3H6N A;  4EZJ A;  2FNJ B;  4G11 A;  2DZM A;  1GG3 A;  2KXJ A;  4ZRK A;  2CU1 A;  4MM3 A;  1OGW A;  4ZRI A;  3RUL A;  4MSM B;  3CMM B;  3ALB A;  1IPG A;  2DZJ A;  3QAQ A;  1WGH A;  2MSE D;  3DVG X;  3HK0 A;  3VVW B;  4E3C A;  1EF1 A;  1WX9 A;  1WGY A;  3ML8 A;  3DVN V;  4K1R B;  2IO1 B;  2KTR B;  4P7I A;  2IBI B;  1V80 A;  3OJ4 B;  4DK5 A;  2KX0 A;  3B0A A;  2WX0 A;  2KZR A;  1WX7 A;  1WZ0 A;  4I6L B;  3SD5 A;  3EFU A;  3KH0 A;  4URK A;  2JY6 A;  3VH3 B;  3EHV A;  4W9K A;  5KHQ A;  1WXV A;  5E6P A;  2O2V B;  2LJ5 A;  1SIF A;  3UIO B;  1WM2 A;  4HJK A;  2MP2 B;  2OOB B;  2DYB A;  1Q1O A;  2J0M A;  1V5O A;  4I6P A;  3ZRC A;  2KN5 A;  2NVU I;  2R2O A;  3DCG A;  4LDT B;  4M8M A;  2GBK A;  4BBN F;  4XX5 A; 
#chains in the Genus database with same CATH topology
 3ZDM C;  4RGN A;  4G3X B;  2V3P A;  3ZNG C;  4HDQ A;  1GB4 A;  3BIN A;  2KJ6 A;  3ZGZ A;  1HXY D;  4P6V F;  1FEH A;  2DYM A;  1VJK A;  1WRI A;  2KWU B;  3X0W A;  2IGH A;  4LNF A;  3NVV A;  2AQ1 B;  4II2 B;  2REX A;  4K7W A;  2UU7 A;  1ZXH A;  3ECI A;  1FXT B;  2MA9 B;  1IBX B;  3RUI B;  3BII D;  4A8X C;  2J42 A;  3PZ8 A;  4EKU A;  4EZL A;  1J19 A;  1IYF A;  2BYV E;  3E56 A;  4RM9 A;  4US9 A;  1FCC C;  3RZF A;  3PGE A;  3ZNI D;  2LI5 A;  3AEF B;  2FCQ A;  4DHJ D;  5CX3 A;  4LK0 M;  2RGF A;  4DBG A;  3R2I A;  2Z59 B;  3SEB A;  3JSV B;  3AE3 B;  1XLP A;  4KIK A;  2QSD A;  3KLS X;  4FJY A;  3RNF C;  4MH8 A;  2LGS A;  2DAF A;  2LGX A;  1OEY J;  2QEJ C;  3M62 B;  2D07 B;  2WLB A;  1L4Z B;  2D3B A;  5IKC M;  2WXI A;  3BVZ A;  4G50 A;  2N0S B;  3BY4 B;  4LJP B;  5G5G A;  3WCQ A;  2JWZ A;  2MBO A;  4BZA A;  2J52 A;  2DYO A;  4DHJ B;  3OJ3 A;  3KUC B;  3PHX B;  4GLS C;  5AZF A;  4KZC A;  1TS4 A;  2KQS A;  3W1Y A;  3MC0 B;  2MHJ A;  3PTF C;  3HHM A;  3LXF A;  2IDY A;  5E6O A;  5D3D A;  3PRE A;  2L00 B;  2N7J A;  3LB8 C;  4K3C A;  3W2D A;  2KDM A;  1E8W A;  1HZ6 A;  3N30 A;  3RNB C;  2IPK D;  3VTV A;  3SHQ A;  1J0G A;  1ESF A;  2QIE B;  5H92 C;  2L0F A;  5IOI A;  2MQJ A;  3N1Y C;  4LJO B;  1WJN A;  4B0M A;  1WY8 A;  3X23 A;  4FLH A;  1OTR B;  4MM3 B;  5JHA A;  1PGX A;  2Y5B B;  3M95 A;  3N32 A;  2K8C A;  4M01 A;  4KX6 B;  1GJZ A;  1B1Z A;  1DYQ A;  1UEL A;  1XT9 B;  4BOZ B;  1Q5W B;  1N5W A;  3MHS D;  1KJT A;  5FKA C;  4MDK E;  2WXQ A;  3APF A;  3TCA A;  3ZNH B;  3U4E G;  4DHZ E;  3TMP B;  1F52 A;  1FCL A;  3P42 A;  3L54 A;  1RRB A;  2AQ2 B;  3VUW A;  2IY0 B;  1E7V A;  1QF6 A;  3DWM A;  1AN8 A;  1YQB A;  4LCD E;  1L6U A;  1UGM A;  4RMA A;  3CSF A;  1BXT A;  1WE6 A;  3IT6 B;  5GXG B;  2KAJ A;  3NUH B;  1V1P A;  3P4R B;  1IP9 A;  3AE4 B;  2LUE A;  1ZGU B;  5DCN A;  1ZDX A;  3UQA A;  1N63 A;  1P9D U;  3P2B A;  4TQ0 A;  3KUD B;  3TEZ A;  4XDD A;  3ZXR A;  1P3Q U;  1F0Z A;  1T3Q A;  3MJW A;  4BKS A;  1MHX A;  1AWD A;  2C60 A;  1VRA B;  3P4Q B;  3DDC B;  1JRP A;  1F2R C;  3N1X C;  2M8S A;  1XCT L;  2K8H A;  1AYF A;  4F8C B;  1ZDV A;  4RGT A;  2I38 A;  4F1S A;  3RZW C;  2BS2 B;  2JSV X;  3MFG A;  4P1C C;  3LJ3 A;  3ZJV A;  1MPE A;  2KLG A;  4A6Q A;  2BB5 A;  4GDK B;  4AUQ C;  3KYC D;  1NEK B;  3EUB 2;  2VH2 A;  2LUM A;  2RD0 A;  1WGR A;  1TKG A;  3U52 E;  4LNI A;  1YIW A;  3SFD B;  2IY1 B;  3CIR B;  1K51 A;  4EFO A;  4A90 A;  1WJU A;  1U4A A;  3V62 A;  1SXT A;  1ROE A;  3VAW A;  1K53 A;  2LGY A;  3TEW A;  2Z0E B;  4GU2 A;  2EMT A;  1UH6 A;  4JL9 A;  3WAL A;  3AEC B;  4W9H A;  4RH6 A;  4LNO A;  4NAM A;  3QIJ A;  1OFF A;  1HA5 A;  3ZUN A;  1EUV B;  2UYZ B;  3BVG A;  3Q8B A;  3JYU A;  5EE3 A;  2N7D A;  1V81 A;  2Y5P A;  1NBF C;  5L83 A;  1V6E A;  2KC2 A;  3I5J C;  2WXK A;  1N62 A;  2N7E A;  2BYT A;  4HRS A;  1GUA B;  4B6W A;  2C7H A;  3GS2 A;  2ZW1 A;  3DVG Y;  4KGT A;  2NR2 A;  4GMV A;  2PLP A;  3L13 A;  3A9K A;  2N9L A;  1XLO A;  1NDD A;  4RF1 A;  2KQ4 X;  2CHX A;  1BML C;  4B95 A;  3T8M A;  3A1Q B;  2OJR A;  2XNA C;  4MAC A;  2V4I B;  4N59 A;  2L52 A;  1STE A;  1WGG A;  2WXP A;  2AYO B;  4MEL A;  3RD2 A;  1NEN B;  1WM3 A;  4IWP A;  2WXL A;  1KLV A;  5CTR C;  1I4G A;  4OVU A;  2GI9 A;  3WAO A;  2NPT B;  3GZN B;  3SU8 X;  3ZDT A;  3O65 B;  3MP9 A;  2CKH B;  2GOW A;  2WWZ A;  1L5P A;  2QJL A;  1RFK A;  1YMH E;  1V2Y A;  4J6I A;  1SE4 A;  4OZB A;  3DHI C;  3IBE A;  4IWQ A;  5MPO A;  2BGF A;  1L0Y B;  1PGB A;  2WXG A;  2KK8 A;  1AAR A;  4GSW A;  3W5U B;  4Q2J A;  4DXF A;  3LYY A;  5AZG A;  1EWY C;  4WWO A;  3AXC A;  1WYW B;  2GB1 A;  1I4H A;  4DXA B;  2JX5 A;  4ANX A;  4PYU A;  2C9W B;  2KWD A;  5LXI B;  3AUL A;  4NNJ B;  4HXD A;  5DPT A;  5JZE B;  1V97 A;  4HJG E;  4C4V A;  1FXA A;  2L05 A;  2KC1 A;  5FK9 C;  2WNM A;  1GG3 A;  1FMA D;  1Y56 A;  1C78 A;  3BZD B;  4HPP A;  1IPG A;  1R4N B;  2DZJ A;  1WGH A;  1ENF A;  2WXO A;  1FD6 A;  4E3C A;  1F2R I;  1WX9 A;  1SE3 A;  3ML8 A;  3NRZ A;  1ZE3 D;  2IO1 B;  3V05 A;  2IBI B;  2Y5C A;  3B2G A;  2WU2 B;  2WX0 A;  2K5P A;  3KH0 A;  4URK A;  2JY6 A;  3PO0 A;  3MJ5 A;  4S17 A;  3EHV A;  1PFD A;  5KHQ A;  2O2V B;  1SIF A;  3SR6 A;  1JWM D;  2MP2 B;  2E3T A;  1DGJ A;  1B9R A;  4BBN F;  4XX5 A;  2KAC A;  2LRW A;  1S1Q B;  1P1A A;  1TBE A;  2KOX A;  1N60 A;  2W3R A;  4US8 A;  2SEB D;  3AE1 B;  1C77 A;  1UUP A;  2KN4 A;  2HTH A;  4FA6 A;  1J7C A;  2PEA A;  1I4R A;  1V5T A;  4P1B C;  2K25 A;  2BKF A;  3RCZ A;  3Q8F A;  1JRU A;  2O6V A;  2DNF A;  2IJ0 A;  2HE7 A;  2CR5 A;  2NCN A;  1VD2 A;  1LQB A;  2FCS A;  1WXA A;  4RCO A;  4HWI B;  4C7Y A;  2MW5 A;  2CU3 A;  3T3O A;  2KMM A;  2AL3 A;  2IO0 B;  1E8X A;  4MSQ B;  2IZV B;  2L3Z A;  2XN9 C;  5BO4 B;  1X1M A;  3RFZ B;  1BT0 A;  3PV1 A;  2Q5W D;  1FO4 A;  2JRH A;  4XWW A;  2BKR B;  1UWM A;  2XK5 B;  1WE7 A;  3RYT A;  4PT5 A;  3NJT A;  1TIF A;  2KFK B;  2BYE A;  4M0W B;  4W9F A;  2K8B A;  4D2K A;  1J7A A;  4A3O A;  3L4P A;  4NJ7 A;  2ZEQ A;  2D3A A;  2UWQ A;  4FJZ A;  4RFB A;  4YL8 A;  1PDX A;  3Q14 C;  4NAW A;  4HLE A;  3OG5 A;  1QIL A;  1RYJ A;  3DBL I;  2A5U A;  2J53 A;  5J17 A;  3DOW A;  1T0Y A;  3WAP A;  3W9C B;  3APD A;  4C7Z A;  2KDF B;  3W1S A;  4GIV A;  3NOB A;  4ASW C;  1CQV A;  3R3M A;  4XGA B;  1T5X D;  4BAX A;  4DXG A;  1SGH A;  3R7R A;  2KHW B;  1FPY A;  2WP9 B;  5L95 C;  1ZUD 2;  4BKG A;  2N1V A;  3QQ8 B;  4W9D A;  3Q69 A;  2K6D B;  1Y8R C;  3MTN B;  2NBV B;  4KDL B;  2YEP B;  4XZ4 A;  1TKY A;  4E74 A;  2A4Z A;  1PYW D;  3S2A A;  2MBH A;  4YTP B;  3M63 B;  3GB1 A;  1FNV A;  3URY A;  5G2N A;  1Q0W B;  4K7S A;  2BYF A;  1IBX A;  1OQQ A;  4IWO A;  1TT5 B;  3R66 C;  4TMA B;  3KVF B;  4ZYS A;  2GBM A;  5C23 A;  2BWF A;  3NY5 A;  2NBU A;  4MGZ E;  2QIL A;  3RNG C;  4YTN B;  1LM8 B;  1MHH E;  3AE2 B;  2LGD A;  5D3I B;  2WS3 B;  4GGQ A;  2V3N A;  1UD7 A;  1OQR A;  4PS3 A;  2W9N A;  3L10 B;  5FR3 A;  4ITK A;  2FCM A;  4DQO C;  2GLS A;  3RPF C;  3ZQ4 A;  1WJ4 A;  5IO9 A;  3Q3M C;  1ZOY B;  4USA A;  1IGC A;  1XLQ A;  2G4D B;  4W9I A;  2LWP A;  4JLC A;  1S3S G;  3PZD A;  1HTO A;  3GE8 C;  4ICV A;  2KNB A;  2KWV B;  4DWF A;  2BT6 A;  1QOB A;  1A5R A;  1WR1 A;  2WGS A;  4IM3 A;  2LXA A;  3JW0 X;  3B1L X;  4NJC A;  3J9C A;  5BYQ A;  2KYW A;  1SJH D;  3R7Q A;  4EE2 A;  4ANV A;  1J7B A;  3VTU A;  4E71 A;  4NQK E;  1UWX A;  2WXJ A;  2ZPY A;  4WH4 A;  1HTQ A;  1YNT E;  1GNU A;  3CWI A;  4WWN A;  1QOA A;  4RNA A;  4HRO A;  3ZVV A;  1PQS A;  5IA7 A;  4JPS A;  3VTW A;  5I4D A;  1D5M C;  3Q3J A;  1E8Y A;  1EF5 A;  2JVC A;  2KKC A;  4XWT A;  1TGZ B;  3H9D A;  2MJE A;  1ISN A;  1V1O A;  1UNS A;  1E6E B;  1E5W A;  3DBL B;  2BVC A;  1WIA A;  3FIL B;  2DWQ A;  2DEN B;  1SB3 C;  4P16 A;  2D3C A;  4AJY B;  3N3K B;  1KH0 A;  4HPM B;  1WZ3 A;  1FXI A;  2V1Y A;  2JZ3 B;  3U2S C;  4ZHP A;  3GE3 C;  1LXD A;  1WXQ A;  5EE1 A;  1FFU A;  1UBI A;  1YN3 A;  3AE6 B;  4XE0 A;  4ANU A;  4G0N B;  3NZS A;  4DDG D;  4EZK A;  1L4D B;  1YN5 A;  1H4R A;  3FKY A;  3GZN I;  2ICI A;  2PW9 A;  3KYD D;  2FID A;  3C8Y A;  4KSL C;  1WH3 A;  4NPN A;  3HM6 X;  1TZO A;  3PZ7 A;  3PLU A;  1GPX A;  2BBC A;  2WDR B;  3P1M A;  5E6J A;  4BKS D;  3HM3 A;  1JCK B;  4ZOH C;  2N9P C;  5DPW A;  2JPH A;  5DPS A;  1WI0 A;  2C7N B;  2QC8 A;  1L7Y A;  4A20 A;  3PHW B;  1T0R C;  4BKT A;  1P7F A;  2ONQ A;  1AW7 A;  4IDI A;  1K50 A;  4DHZ B;  3V6C B;  2ZVO A;  3H7P B;  2ZNV B;  3QC8 B;  5DPR A;  5AEK B;  1RAX A;  2DZK A;  2J0J A;  4LNK A;  3V60 A;  1VZ7 A;  2ZW0 A;  1CJE A;  4RF0 A;  3MC9 A;  4L2Y A;  4EEW A;  4BOS C;  4XDC A;  2TSS A;  1RFA A;  4CYE A;  1TTN A;  1XD3 B;  2GMI C;  3KWV A;  3I57 A;  1L2N A;  3BYT B;  5LXH A;  4WJQ A;  2B3A A;  3ZW3 A;  2DLB A;  1EM7 A;  1R4N I;  3TEY A;  2AQ3 B;  2IGG A;  4HCP B;  1CMX B;  5LLI A;  4PK1 A;  1EU3 A;  1FNU A;  2QDF A;  1FM0 D;  3A9J A;  2JQR B;  3H6N A;  2BS4 B;  2WHI A;  2KXJ A;  4ZRK A;  2CU1 A;  4ACF A;  3RUL A;  4MSM B;  3ALB A;  3QAQ A;  2MSE D;  3HK0 A;  3P4S B;  2CJN A;  4M02 A;  3VVW B;  1EF1 A;  1KLG D;  2KTR B;  1V80 A;  1C79 A;  4DK5 A;  1FRR A;  1WX7 A;  1WZ0 A;  4I6L B;  4WAF A;  1WXV A;  5E6P A;  2LJ5 A;  4HJK A;  4AS1 A;  2OOB B;  3ZRC A;  2NVU I;  2R2O A;  3BK2 A;  2GBK A;  4MJS A;  5CHF A;  4N9F 4;  3KWL A;  3ONS A;  2CJO A;  1YJI A;  2KDE B;  2W82 A;  2LVO A;  4CHK A;  5JXV A;  4FHK A;  2DHZ A;  3NZU A;  1JML A;  4ARC A;  1WMH B;  1ZW7 A;  3KQ4 A;  3ZJT A;  3IG3 A;  3QJZ A;  4MGK E;  4ZHO A;  1WR6 E;  3VUY A;  1T6B X;  1KLU D;  4NJ6 A;  5JH5 C;  4CQN A;  1F77 A;  3ML9 A;  3DWG C;  4K7U A;  1YD8 U;  4M8N A;  3AI5 A;  1NYR A;  2L8J A;  1XF5 L;  1N6Z A;  2CHW A;  2JWU A;  1JRO A;  5G5H A;  1SIJ A;  2WXM A;  4KDI C;  5D94 A;  2G4S A;  3ZTD A;  1ET9 A;  3K9P B;  3UF8 A;  2K22 A;  4TKN A;  3DHG C;  1D5X C;  4IUM B;  4DDI D;  4GDL B;  2E6X A;  3BYY B;  3UIN B;  3ZKJ C;  1QOG A;  4TQ1 A;  1JWB D;  2L1A A;  4JWU C;  4NY0 A;  5AUK A;  3GP7 A;  1DOX A;  3MHZ A;  3QX1 A;  2ZVN A;  4CO7 A;  1JQ4 A;  2INC C;  4LNN A;  1P98 A;  2INP E;  4M00 A;  3VQI A;  1YJ1 A;  3PRP B;  4BVU C;  2JF5 A;  2H88 B;  2L76 A;  3ZYY X;  2IND C;  2VH1 A;  4AOF A;  1Z5S B;  2M19 A;  4EOY A;  3E9S A;  1MJD A;  1XQQ A;  3AEB B;  2WXR A;  1SSN A;  2WDQ B;  1J8C A;  3EC8 A;  3VHT C;  4A55 A;  3IXS A;  3AN1 A;  2XBB C;  3Q8C A;  1WJ6 A;  2V9H A;  4A3P A;  1NYQ A;  2LAS A;  2RMM A;  2ZNV C;  3M3J A;  1QQR A;  3QWZ B;  1TY0 A;  4B9K A;  2YLM A;  1T0S C;  2ZZP B;  3A33 B;  3P4P B;  2AEH A;  4C4V B;  1WGD A;  4OVZ A;  3B08 A;  4IKG A;  2RDB C;  4L23 A;  1SJE D;  3PT2 B;  2O2V A;  4YXD B;  3AU4 A;  2K6Q A;  5BYS A;  2MP2 A;  3QCA A;  4KKJ A;  2KO3 A;  1KFY B;  1L0X B;  5G55 A;  1ZPS A;  3RNA C;  1V8C A;  2K39 A;  4IG7 B;  2WYQ A;  1RM6 C;  2BPS A;  1TZ1 A;  3NVW A;  4WJN A;  1UBQ A;  2PE9 A;  2H89 B;  2LJI A;  1SEB D;  1HEZ E;  2LHD A;  2D2Q A;  3I3T B;  4RM8 A;  3DBH I;  1I4Q A;  2MEK A;  2W54 A;  4EUT A;  2ASQ A;  2KQ7 A;  1VZ8 A;  4HKZ E;  2LRU A;  2LVP A;  1G6J A;  3ZLZ A;  3V61 A;  5CHW A;  2LMC A;  2VZK D;  5C3J B;  4HCN B;  2EKE C;  2LEK A;  4RGM A;  4W9C A;  4YTM B;  3DBR I;  4L1B A;  4OZA A;  2WDV B;  1TS3 A;  1WWT A;  2RDH A;  1TY2 A;  3R2T A;  2ZCC A;  2HD5 B;  1IGD A;  3TUO A;  4ZRJ A;  2M1M A;  2M56 B;  1VCB A;  3OWE B;  1C4A A;  3U30 A;  3GOE A;  2JZZ A;  1YX6 B;  1V9J A;  2MWS B;  3ZNZ B;  1SE9 A;  3IHP C;  3AE5 B;  4MGY E;  4GOC A;  5EDS A;  4NZL B;  2YVC A;  3O13 A;  3MC8 A;  2OHF A;  2VZK B;  5EE0 A;  1K8R B;  2KFK A;  1D6E C;  5HG2 A;  2FE8 A;  5D7G A;  5EE9 A;  4KV2 A;  2K1F A;  1WFY A;  2D11 A;  3QA8 A;  2RSU A;  4KZ0 A;  3NS1 A;  3U7D A;  1P0R A;  1YX5 B;  4AP4 C;  3D32 A;  3VR9 B;  2HTM E;  3A4R A;  1TYG B;  2LVQ A;  4WAA A;  1E0Z A;  4JE3 B;  1KM7 A;  2PJH A;  4ZRP A;  1D5Z C;  4F7Z A;  3SFE B;  1UZX B;  3BVM A;  1WGK A;  4FUL A;  3AB5 A;  3ENE A;  4W9G A;  4YWG G;  3T9L A;  2J0K A;  4K81 A;  4NAW B;  4OZC A;  1GB1 A;  2N9K A;  1I4P A;  2L0T A;  4W9L A;  3A4S C;  3Q6B A;  2KMC A;  3VR8 B;  2KAN A;  2N9X A;  3AEG B;  4YSY B;  1CK1 A;  3DHH C;  1C3T A;  3PLV A;  2OED A;  3IAS 1;  3PSE B;  1FRD A;  3I63 C;  1MVK A;  3HVD A;  1WXM A;  2WDT B;  2KVZ A;  1YQ4 B;  3T3N A;  3AEE B;  4H2A A;  1MG8 A;  2KJR A;  3QHT A;  1FNW A;  4RGO S;  1VDV A;  2FIF A;  2KWC A;  3APC A;  3EFC A;  4UDU C;  4XYC A;  1R4M B;  3AV8 A;  2PVO D;  3HUI A;  4WQO B;  2JUO A;  2K3U A;  4WJP A;  2VRR B;  3TSS A;  4MH0 E;  1QLB B;  2JXX A;  1YJJ A;  2IO3 B;  4REZ A;  1GC6 A;  3DBH B;  3H8H A;  2W55 A;  3JSV A;  3JVZ X;  1EU4 A;  2KTF A;  4HVB A;  3DQV A;  2JYE A;  3TBL D;  2D5G A;  2FAZ A;  2L32 A;  2QCZ A;  3V3X A;  1JWS D;  4LLG M;  4HDO A;  1XEE A;  4HK2 A;  5H8Y E;  1ZP0 B;  4HKQ A;  3DBR B;  2L7R A;  3VUX A;  2Y3A A;  3VDZ A;  1YQ3 B;  1N5X A;  3L17 A;  2N1W A;  4I6N B;  3L08 A;  2KLC A;  4JGH B;  2MRP A;  3RMK C;  3SDL C;  2WU5 B;  4ICU A;  3BWU D;  1UF0 A;  1ZXI A;  3KW5 B;  1WXS A;  2RPV A;  1HE8 A;  4K3B A;  4BFR A;  3EGR A;  4KIK B;  2X38 A;  1P7E A;  2M17 A;  4AQ7 A;  1L0V B;  2BS3 B;  2JRI B;  4JIO U;  1F9J A;  3HRD D;  2WQY B;  1I4X A;  3K9O B;  2NS5 A;  1TS5 A;  3UI3 A;  1WYG A;  2AL6 A;  4MGI E;  4GB9 A;  5CHV C;  1D4B A;  4QAY A;  2WXN A;  1VZ6 A;  2V0G A;  1SE2 A;  2CS4 A;  5BMG A;  3AU5 A;  3HVZ A;  1C9F A;  2CHZ A;  3VH4 B;  1F1H A;  2JZP A;  4MEM A;  4YT0 B;  4EZJ A;  2FNJ B;  4G11 A;  2DZM A;  4KGR A;  1C76 A;  3FIL A;  4MM3 A;  1OGW A;  4N58 A;  3CMM B;  3Q3N C;  3FAH A;  3VRB B;  5IP4 D;  1E10 A;  3W5V B;  4ZRQ A;  4P7I A;  3OJ4 B;  4OW0 A;  1C4C A;  3B0A A;  3SD5 A;  3EFU A;  3VH3 B;  4W9K A;  2MJ3 A;  3UIO B;  1WM2 A;  1KF6 B;  3FC4 A;  1XCQ L;  4C80 A;  2J0M A;  1V5O A;  3NVY A;  4I6P A;  4M8M A;  3DCG A;  3R8B A;  3AE7 B;  2GBJ A;  3NS8 A;  3ZTC A;  5LNK 1;  1GOZ A;  1SBB B;  3C0R B;  3U7Z A;  3L0W B;  3H7S A;  3TJP A;  3PVL A;  1SF0 A;  3H1U A;  4IM2 A;  4WUR A;  4OHJ A;  1DOY A;  1MI0 A;  2PIA A;  3NVZ A;  5T8I A;  4XC2 A;  1QOF A;  3V6E B;  5GMV A;  1VLB A;  3BK1 A;  4FXC A;  2BQQ A;  3AED B;  4S0R A;  2G1E A;  3TL5 A;  3Q3O C;  2MBB B;  2I1K A;  3C19 A;  5D6J B;  1YOV B;  2N9E B;  3W1S C;  2KDB A;  1NI3 A;  1PGA A;  1V1P B;  2NTT A;  1D3Z A;  3H7P A;  1JWA D;  1VR9 A;  1C1Y B;  5JHB A;  1UGJ A;  4WJO A;  2JU6 X;  2M4N A;  2MBE A;  1DOI A;  3PRM B;  1WRD B;  3PRZ A;  3TIX A;  3DPD A;  1OEY A;  4GDK A;  5IN7 A;  2B76 B;  2D10 A;  1LFD A;  2I2Y A;  1MFW A;  4A9A A;  5BMI A;  2IGD A;  2C7M B;  4GXB A;  2DAJ A;  3LDZ E;  5HI1 A;  2QHO A;  2J4X A;  2MJD A;  2Z8L A;  1T0Q C;  2IYD B;  2PPH A;  2N4F A;  5J18 A;  1M94 A;  4C56 C;  1JWU D;  4X57 B;  3AE9 B;  1JAL A;  1E7U A;  2XEW A;  4JWS C;  2L83 A;  3B9J A;  3HIZ A;  4IC7 B;  2PE6 B;  4OVV A;  3RNC C;  1NI2 A;  4ZYN A;  2V3S A;  2AX5 A;  5J2R A;  1HZ5 A;  3Q8A A;  2ON8 A;  4WWP A;  3IT4 B;  2KTR A;  4KGS A;  2DZI A;  1WSP A;  3PS6 A;  3A9J B;  3QK0 A;  4AWJ A;  4GN1 A;  2LXC A;  4N6E B;  4AJW A;  3EA6 A;  1I35 A;  4WWM A;  2OJW A;  3ETR A;  2LHE A;  5IAA C;  3B2F A;  2BF8 B;  4NQL B;  3QAR A;  1EWC A;  4PS8 A;  2EMS A;  2KDI A;  3VRA B;  2PVG C;  3ZO5 B;  3WAN A;  3A1Q A;  2HDE A;  3Q2A C;  1RLF A;  1WMH A;  4BBN C;  2NBW B;  1QKZ A;  3N20 C;  1V49 A;  3AMZ A;  2BB6 A;  4IM0 A;  1GAQ B;  4KSK C;  4MJS B;  2NPT A;  4FBJ B;  1E7P B;  2ZCB A;  2X8X X;  2V4L A;  3WAM A;  2J7Q B;  2KX3 A;  2PKO A;  3A9K B;  3ABV B;  1Q10 A;  2MCN B;  2GRI A;  1XXG A;  5KHO A;  2KMA A;  5BYR A;  4ANW A;  4GDL A;  2YEP F;  1ZKH A;  2HJ1 A;  2KT7 A;  3CST A;  4LTU A;  1V86 A;  5E6N A;  2EKI A;  1E9M A;  3AEA B;  2D3G A;  1N61 A;  5C1Z A;  5HFY A;  4HEA 1;  1IUE A;  4II3 B;  2FCN A;  2M0X A;  1A70 A;  4W9E A;  1JW9 D;  4FAD A;  2W3S A;  5TSS A;  4PYZ A;  3IFW B;  2PMV A;  4J3O D;  4O1N A;  4ZDV A;  2JT4 B;  4WIP A;  2MLB A;  2Z0D B;  4B0E A;  2BTE A;  3Q3F A;  2LFI A;  3PPA A;  1HQR D;  1C4P A;  3NG0 A;  1LO5 D;  2IO2 B;  4TV3 A;  2ZJD A;  2GBN A;  5FR6 A;  4TSS A;  2MBQ A;  5AZH A;  2RPQ A;  1L6V A;  1R7S A;  4IOI E;  4W9J A;  1WX8 A;  1E90 A;  3UGB B;  1TKE A;  2NMQ A;  1XLN A;  2FUG 1;  1R4M I;  4YSX B;  1E8Z A;  1NVI D;  2KFJ A;  4PS7 A;  2FBW B;  1KRH A;  2AWT A;  2KD0 A;  1Z2M A;  3ZJU A;  4FJV B;  1MG4 A;  2JXT A;  3ZIM A;  1I42 A;  3IVF A;  1PUT A;  2I1J A;  1FIQ A;  4R3D A;  3RI7 C;  1TS2 A;  2PTL A;  3N1Z C;  3L16 A;  2G45 B;  1ET6 A;  3ZRF A;  5D2M B;  2O6V D;  1QT9 A;  3AH7 A;  4FHJ A;  4IW0 A;  4KVG B;  3KUZ A;  2KJH B;  1WF9 A;  3ZXV A;  1EO6 A;  2FUH B;  1QZE A;  3UQB A;  2KVR A;  3CF6 E;  2BW2 A;  2DX5 B;  2GBR A;  4TUU A;  3RT3 B;  3WIM A;  2RR9 A;  5HKH A;  2HJ8 A;  1KOT A;  1OQY A;  2LD9 A;  2M0A A;  2MX2 A;  1GC7 A;  3IAM 1;  3P63 A;  3DBS A;  3NZ3 A;  3AE8 B;  3DVN U;  2R61 A;  2R2Q A;  3NHE B;  2O6V B;  2JYT A;  2WXF A;  2XK5 A;  1KTK A;  4ARI A;  2WXH A;  3RN9 C;  4M0W A;  1FFV A;  3OAW A;  5BMH A;  2EEL A;  4JQW C;  2RDG A;  5C2T B;  3WA0 A;  2K0P A;  3OLM D;  3I9V 1;  1M4V A;  2G3Q B;  2WX1 A;  3TEX A;  1YN4 A;  1BUI C;  1TJE A;  1I7H A;  3VFK A;  4JX1 C;  1CZP A;  1LGR A;  1H8C A;  4WQM A;  2ACZ B;  2LZ6 A;  2DBY A;  5TR5 A;  4HPL B;  5HHD G;  3UIP B;  2G9H D;  1XO3 A;  2INN E;  2ZPN A;  3RNE C;  2BWE S;  2C5L C;  3VXW A;  3U8Z A;  4FN2 A;  3EEC A;  4LDT D;  2K9X A;  2SAK A;  4ZRI A;  3DVG X;  4YSZ B;  1RWS A;  3AM9 A;  1WGY A;  2NTS A;  5AUI A;  3DVN V;  4K1R B;  4KKI A;  2KX0 A;  3N9Y C;  1ACC A;  2KZR A;  4C00 A;  2QMT A;  1K52 A;  3Q8E A;  4MT5 A;  2MH7 A;  2DYB A;  1Q1O A;  2KN5 A;  4LDT B;  2LGI A; 
#chains in the Genus database with same CATH homology
 4MJS A;  2LRW A;  2GBJ A;  1S1Q B;  3NS8 A;  4N9F 4;  5CHF A;  1P1A A;  3ZDM C;  3ZTC A;  1TBE A;  4G3X B;  3ZNG C;  3C0R B;  2KOX A;  3ONS A;  4HDQ A;  3L0W B;  3H7S A;  2KDE B;  3TJP A;  3BIN A;  3PVL A;  2KJ6 A;  3H1U A;  2LVO A;  4IM2 A;  4CHK A;  4FHK A;  2DHZ A;  3NZU A;  2DYM A;  2KWU B;  3X0W A;  1WMH B;  4XC2 A;  1ZW7 A;  4II2 B;  2HTH A;  2REX A;  3V6E B;  5GMV A;  4FA6 A;  3IG3 A;  3QJZ A;  4K7W A;  4MGK E;  1WR6 E;  3VUY A;  3ECI A;  1FXT B;  2MA9 B;  4NJ6 A;  5JH5 C;  2PEA A;  3TL5 A;  2MBB B;  3RUI B;  3ML9 A;  2I1K A;  4K7U A;  1V5T A;  1YD8 U;  4M8N A;  3AI5 A;  2K25 A;  4EKU A;  2BKF A;  2L8J A;  3RCZ A;  5D6J B;  4EZL A;  1J19 A;  2CHW A;  2N9E B;  2BYV E;  3W1S C;  2KDB A;  1JRU A;  1IYF A;  4KDI C;  5D94 A;  4RM9 A;  2G4S A;  2O6V A;  3RZF A;  3ZTD A;  3PGE A;  3ZNI D;  3K9P B;  3UF8 A;  2LI5 A;  1D3Z A;  3H7P A;  2HE7 A;  2FCQ A;  4TKN A;  4DHJ D;  1C1Y B;  5JHB A;  2CR5 A;  4WJO A;  2NCN A;  5CX3 A;  4IUM B;  1VD2 A;  2M4N A;  1LQB A;  4GDL B;  2MBE A;  2RGF A;  2FCS A;  4DDI D;  4DBG A;  1WXA A;  2Z59 B;  3JSV B;  3UIN B;  3PRM B;  1WRD B;  4HWI B;  3PRZ A;  3ZKJ C;  3TIX A;  2MW5 A;  3DPD A;  4TQ1 A;  1OEY A;  2AL3 A;  4GDK A;  2IO0 B;  1E8X A;  4MSQ B;  4KIK A;  2IZV B;  2D10 A;  2L3Z A;  1LFD A;  4FJY A;  2DAF A;  2LGX A;  1OEY J;  4NY0 A;  5BO4 B;  1X1M A;  3M62 B;  1BT0 A;  3PV1 A;  4GXB A;  2C7M B;  3QX1 A;  2D07 B;  2JRH A;  2ZVN A;  2DAJ A;  4CO7 A;  2BKR B;  1P98 A;  2XK5 B;  3LDZ E;  1WE7 A;  3VQI A;  2QHO A;  3RYT A;  1YJ1 A;  3PRP B;  2KFK B;  2BYE A;  4M0W B;  4W9F A;  4BVU C;  2JF5 A;  3BY4 B;  2L76 A;  4G50 A;  4LJP B;  2K8B A;  2IYD B;  2JWZ A;  2PPH A;  4A3O A;  4AOF A;  2MBO A;  1Z5S B;  2N4F A;  2DYO A;  5J18 A;  4NJ7 A;  4DHJ B;  1M94 A;  4EOY A;  3OJ3 A;  2ZEQ A;  3KUC B;  1XQQ A;  3PHX B;  5AZF A;  4X57 B;  4KZC A;  2KQS A;  2UWQ A;  4FJZ A;  3W1Y A;  4YL8 A;  1J8C A;  3EC8 A;  3PTF C;  3HHM A;  3VHT C;  4NAW A;  4HLE A;  2XBB C;  1E7U A;  1WJ6 A;  4A3P A;  2XEW A;  5E6O A;  3DBL I;  2A5U A;  3HIZ A;  5J17 A;  3PRE A;  3DOW A;  4IC7 B;  1T0Y A;  2LAS A;  2PE6 B;  2ZNV C;  3M3J A;  3QWZ B;  4OVV A;  1NI2 A;  2L00 B;  3WAP A;  4B9K A;  1E8W A;  4ZYN A;  2V3S A;  5J2R A;  3N30 A;  3APD A;  2YLM A;  2KDF B;  2ZZP B;  4WWP A;  3A33 B;  3W1S A;  3VTV A;  2AEH A;  2KTR A;  1WGD A;  3NOB A;  3B08 A;  4GIV A;  3SHQ A;  4ASW C;  3R3M A;  1J0G A;  1SGH A;  2DZI A;  2L0F A;  3R7R A;  2KHW B;  2MQJ A;  3PS6 A;  3A9J B;  3QK0 A;  3PT2 B;  4LJO B;  1WJN A;  2O2V A;  1WY8 A;  3AU4 A;  4AWJ A;  4BKG A;  5L95 C;  4GN1 A;  2LXC A;  3X23 A;  2N1V A;  2K6Q A;  4FLH A;  1OTR B;  2MP2 A;  4AJW A;  3QQ8 B;  4W9D A;  1I35 A;  5JHA A;  3QCA A;  2KO3 A;  2K6D B;  2Y5B B;  5G55 A;  1Y8R C;  3M95 A;  3N32 A;  3MTN B;  2K39 A;  4IG7 B;  2K8C A;  5IAA C;  2BF8 B;  2WYQ A;  2NBV B;  1GJZ A;  4KDL B;  3QAR A;  4NQL B;  2BPS A;  4XZ4 A;  1TZ1 A;  4PS8 A;  2EMS A;  2KDI A;  1UEL A;  4WJN A;  1XT9 B;  1UBQ A;  4BOZ B;  1Q5W B;  3ZO5 B;  3MHS D;  2PE9 A;  3WAN A;  1KJT A;  4E74 A;  2A4Z A;  3A1Q A;  4MDK E;  1RLF A;  3APF A;  3TCA A;  1WMH A;  2D2Q A;  3ZNH B;  4BBN C;  3S2A A;  3I3T B;  2MBH A;  4RM8 A;  3TMP B;  4DHZ E;  3M63 B;  3DBH I;  2NBW B;  4EUT A;  2ASQ A;  1V49 A;  5G2N A;  3L54 A;  1RRB A;  2KQ7 A;  3VUW A;  1Q0W B;  4IM0 A;  2IY0 B;  4K7S A;  2LRU A;  2BYF A;  2LVP A;  1G6J A;  1E7V A;  4IWO A;  3ZLZ A;  3V61 A;  4KSK C;  5CHW A;  3R66 C;  4MJS B;  1YQB A;  3KVF B;  4LCD E;  1UGM A;  2GBM A;  2NPT A;  4RMA A;  4FBJ B;  3CSF A;  4HCN B;  2EKE C;  5C23 A;  2BWF A;  2ZCB A;  3NY5 A;  2V4L A;  3WAM A;  1WE6 A;  2NBU A;  2J7Q B;  4W9C A;  2KX3 A;  3A9K B;  3DBR I;  1IP9 A;  4MGZ E;  2LUE A;  1ZGU B;  5DCN A;  2MCN B;  5KHO A;  3UQA A;  2KMA A;  1LM8 B;  1P9D U;  2LGD A;  2ZCC A;  3P2B A;  4TQ0 A;  3KUD B;  2HD5 B;  4ANW A;  4GDL A;  4GGQ A;  1P3Q U;  4ZRJ A;  2M1M A;  1UD7 A;  4PS3 A;  2W9N A;  3L10 B;  1VCB A;  1ZKH A;  2FCM A;  3U30 A;  3MJW A;  3GOE A;  2JZZ A;  3RT3 B;  4BKS A;  1YX6 B;  1V9J A;  2MWS B;  3ZNZ B;  1SE9 A;  2C60 A;  3IHP C;  3CST A;  3DDC B;  1V86 A;  4MGY E;  5E6N A;  4GOC A;  1WJ4 A;  2M8S A;  2D3G A;  2K8H A;  5EDS A;  4F8C B;  2YVC A;  5C1Z A;  4F1S A;  3RZW C;  1K8R B;  2KFK A;  2G4D B;  4II3 B;  3LJ3 A;  2FCN A;  2LWP A;  4JLC A;  1S3S G;  3PZD A;  4ICV A;  4W9I A;  5D7G A;  4KV2 A;  2K1F A;  2KNB A;  2KLG A;  2KWV B;  2M0X A;  4DWF A;  1WFY A;  4W9E A;  2D11 A;  3QA8 A;  1WR1 A;  1A5R A;  4GDK B;  4FAD A;  4IM3 A;  4AUQ C;  2RSU A;  4PYZ A;  3IFW B;  3KYC D;  2LXA A;  3JW0 X;  3B1L X;  4KZ0 A;  4ZDV A;  2JT4 B;  3R7Q A;  3U7D A;  2MLB A;  2Z0D B;  2RD0 A;  1WGR A;  3Q3F A;  1P0R A;  4ANV A;  4E71 A;  3VTU A;  4NQK E;  1YIW A;  1YX5 B;  3PPA A;  2IY1 B;  4AP4 C;  3D32 A;  4EFO A;  2ZPY A;  1WJU A;  1U4A A;  3A4R A;  3V62 A;  4WAA A;  2LVQ A;  1GNU A;  1KM7 A;  2IO2 B;  2PJH A;  2LGY A;  4TV3 A;  2ZJD A;  2GBN A;  2Z0E B;  3VAW A;  4GU2 A;  5FR6 A;  4WWN A;  2EMT A;  4F7Z A;  1UH6 A;  1UZX B;  4JL9 A;  3ZVV A;  2MBQ A;  5AZH A;  1PQS A;  2RPQ A;  3WAL A;  5IA7 A;  4FUL A;  4W9J A;  3VTW A;  3Q3J A;  4W9H A;  1E8Y A;  3ENE A;  1EF5 A;  4W9G A;  2JVC A;  1WX8 A;  2J0K A;  2KKC A;  4K81 A;  4NAW B;  3T9L A;  2L0T A;  1E90 A;  3A4S C;  1TGZ B;  3H9D A;  3QIJ A;  4W9L A;  1ISN A;  2KMC A;  3UGB B;  1E5W A;  3ZUN A;  2KAN A;  1EUV B;  1WIA A;  2N9X A;  2UYZ B;  2DEN B;  3JYU A;  4AJY B;  2N7D A;  1R4M I;  1E8Z A;  2KFJ A;  1C3T A;  1V81 A;  3PLV A;  4PS7 A;  3N3K B;  4HPM B;  1NBF C;  2KD0 A;  2AWT A;  5L83 A;  1WZ3 A;  2V1Y A;  1V6E A;  2KC2 A;  3PSE B;  2JZ3 B;  1Z2M A;  2N7E A;  4FJV B;  1LXD A;  1WXM A;  2WDT B;  3ZIM A;  1I42 A;  1UBI A;  1MG8 A;  2KJR A;  3QHT A;  1GUA B;  3IVF A;  4B6W A;  2C7H A;  2I1J A;  4ANU A;  4G0N B;  3NZS A;  4DDG D;  2FIF A;  2G45 B;  3L16 A;  2KWC A;  4EZK A;  3ZRF A;  5D2M B;  3APC A;  1H4R A;  2O6V D;  3WIM A;  3GZN I;  4FHJ A;  3DVG Y;  3KYD D;  4IW0 A;  4WQO B;  2NR2 A;  2FID A;  2JUO A;  4GMV A;  4KSL C;  4KVG B;  3KUZ A;  2KJH B;  3L13 A;  1WH3 A;  4NPN A;  1WF9 A;  3HM6 X;  3A9K A;  4WJP A;  2VRR B;  1EO6 A;  2FUH B;  1QZE A;  1NDD A;  4B95 A;  2CHX A;  3UQB A;  3T8M A;  3A1Q B;  2KVR A;  2JXX A;  2OJR A;  3PLU A;  4MH0 E;  3CF6 E;  4BKS D;  2IO3 B;  1WGG A;  3HM3 A;  2AYO B;  4MEL A;  1GC6 A;  2DX5 B;  2GBR A;  2N9P C;  3RD2 A;  5DPW A;  1WM3 A;  2JPH A;  3JSV A;  4TUU A;  1WI0 A;  3JVZ X;  2RR9 A;  2C7N B;  5DPS A;  1L7Y A;  2HJ8 A;  2KTF A;  4IWP A;  1OQY A;  4A20 A;  3PHW B;  4HVB A;  5HKH A;  1KOT A;  3DQV A;  1KLV A;  2LD9 A;  5CTR C;  4OVU A;  2MX2 A;  3TBL D;  3WAO A;  2NPT B;  3SU8 X;  1GC7 A;  2FAZ A;  3ZDT A;  3O65 B;  2CKH B;  2GOW A;  2WWZ A;  3DBS A;  4BKT A;  3DVN U;  4HDO A;  2R2Q A;  3NHE B;  1V2Y A;  4HK2 A;  2O6V B;  4J6I A;  4DHZ B;  3V6C B;  2XK5 A;  2ZVO A;  2L7R A;  3H7P B;  3IBE A;  2ZNV B;  3QC8 B;  5DPR A;  3VUX A;  5AEK B;  1RAX A;  3VDZ A;  3L08 A;  3L17 A;  2N1W A;  2DZK A;  2J0J A;  4I6N B;  4IWQ A;  2BGF A;  3OAW A;  2KLC A;  4JGH B;  4JQW C;  3V60 A;  2MRP A;  2KK8 A;  3SDL C;  4ICU A;  3KW5 B;  1AAR A;  1WXS A;  1HE8 A;  3WA0 A;  4GSW A;  4EEW A;  4BOS C;  3OLM D;  4BFR A;  4KIK B;  2G3Q B;  2WX1 A;  5AZG A;  1RFA A;  4WWO A;  4CYE A;  2M17 A;  1TTN A;  1XD3 B;  2GMI C;  3AXC A;  2JRI B;  1WYW B;  4JIO U;  1F9J A;  3VFK A;  1L2N A;  3K9O B;  4DXA B;  5LXH A;  4WJQ A;  4ANX A;  2B3A A;  4PYU A;  2C9W B;  3ZW3 A;  2NS5 A;  5LXI B;  1H8C A;  1R4N I;  2AL6 A;  4MGI E;  4GB9 A;  5CHV C;  2LZ6 A;  3AUL A;  4HCP B;  4NNJ B;  4HXD A;  5TR5 A;  1CMX B;  4HPL B;  5LLI A;  3UIP B;  5DPT A;  5JZE B;  2CS4 A;  3AU5 A;  2ZPN A;  2BWE S;  2C5L C;  2CHZ A;  3VH4 B;  3VXW A;  3U8Z A;  4FN2 A;  4MEM A;  2L05 A;  3EEC A;  2KC1 A;  4LDT D;  3A9J A;  3H6N A;  4EZJ A;  2FNJ B;  4G11 A;  2DZM A;  1GG3 A;  2KXJ A;  4ZRK A;  2CU1 A;  4MM3 A;  1OGW A;  4ZRI A;  3RUL A;  4MSM B;  3CMM B;  3ALB A;  1IPG A;  2DZJ A;  3QAQ A;  1WGH A;  2MSE D;  3DVG X;  3HK0 A;  3VVW B;  4E3C A;  1EF1 A;  1WX9 A;  1WGY A;  3ML8 A;  3DVN V;  4K1R B;  2IO1 B;  2KTR B;  4P7I A;  2IBI B;  1V80 A;  3OJ4 B;  4DK5 A;  2KX0 A;  3B0A A;  2WX0 A;  2KZR A;  1WX7 A;  1WZ0 A;  4I6L B;  3SD5 A;  3EFU A;  3KH0 A;  4URK A;  2JY6 A;  3VH3 B;  3EHV A;  4W9K A;  5KHQ A;  1WXV A;  5E6P A;  2O2V B;  2LJ5 A;  1SIF A;  3UIO B;  1WM2 A;  4HJK A;  2MP2 B;  2OOB B;  2DYB A;  1Q1O A;  2J0M A;  1V5O A;  4I6P A;  3ZRC A;  2KN5 A;  2NVU I;  2R2O A;  3DCG A;  4LDT B;  4M8M A;  2GBK A;  4BBN F;  4XX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...