3V62A

Structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
73
Chain Sequence
PETHINLVSDGSSEIFFITTPLRRLMEAFARQGEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
molecule keywords Ubiquitin-like protein SMT3
total genus 11
structure length 73
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v62A00
1P98A 1YD8U 1WR6E 3QAQA 4JGHB 4DHZB 4W9JA 1AARA 3R7RA 2KFKA 3IVFA 4URKA 3TJPA 2M4NA 3DVGX 3K9OB 2G3QB 4IC7B 4MDKE 4TKNA 2C9WB 1ZKHA 2L8JA 3H7PB 2A5UA 3HHMA 3N30A 2FIFA 3PHWB 4I6PA 2BYVE 3TL5A 1R4MI 3V61A 1WIAA 2K1FA 1WMHA 1WX9A 2KLGA 2L0FA 4MELA 4BFRA 4NJ7A 4IWQA 4IM0A 3H7PA 4LDTB 4F1SA 3DVNU 4ICUA 1UBQA 5TR5A 4EKUA 4FBJB 2IZVB 3AU4A 4G0NB 4KDIC 3WANA 4E71A 3VQIA 2D11A 1WI0A 3DVGY 4IM2A 2KWCA 2KTRA 4W9KA 3DDCB 3L17A 4HCNB 3QIJA 4MJSA 3ZNGC 2M1MA 3IHPC 3HIZA 3JYUA 5CTRC 3O65B 1I42A 2ZEQA 2PE9A 2KK8A 4J6IA 1J8CA 5AZFA 3APCA 2YLMA 5J2RA 3PV1A 2DYBA 4M0WB 2KJHB 4A3PA 4XZ4A 1OQYA 4K7UA 2KN5A 4TQ1A 5D2MB 1WM2A 3UIPB 2LGDA 3CMMB 2LASA 3QX1A 1EUVB 1Q0WB 1Z5SB 3VH4B 4NQKE 3M95A 4KZ0A 1KM7A 1WFYA 3VAWA 1WJUA 4EFOA 3T8MA 5J18A 2K6QA 4GB9A 4DWFA 1WJ4A 3WAMA 2N9PC 3UQAA 3W1SA 1Q5WB 3UIOB 1GC7A 1IPGA 3WALA 3ZVVA 3OJ4B 2NCNA 2LVOA 2GBNA 2AWTA 3NY5A 1TZ1A 4IG7B 3U30A 3X0WA 4AOFA 4GXBA 2KOXA 3L13A 1LXDA 2MBQA 2DZIA 3B08A 1V2YA 3KUZA 4NY0A 2FAZA 3ALBA 4BOZB 2Z0DB 3CF6E 2V1YA 3M63B 3A4SC 3RZWC 1YIWA 2CHXA 3KYCD 1TBEA 1GNUA 1WXAA 4BKSD 3NHEB 2O6VA 2LUEA 3WAPA 4DHJB 4KDLB 3CSFA 2KDEB 3HM3A 3JSVB 2CKHB 5DPWA 2W9NA 4TQ0A 1XD3B 3PRZA 2DX5B 4FHJA 1YX6B 3APFA 4HDOA 3QJZA 1WRDB 3R7QA 4ICVA 2KANA 2KC1A 1J19A 3UF8A 1WE7A 3PLVA 3B1LX 4ZRJA 2FCQA 2LGXA 2LI5A 2V4LA 3KH0A 4DHZE 4PYZA 4DDGD 2FCSA 3W1SC 4DXAB 3QCAA 4AWJA 4HLEA 2D07B 3A4RA 2GMIC 4NAWB 3RD2A 2MQJA 4HDQA 3I3TB 4CO7A 3P2BA 3QK0A 3KVFB 4HJKA 3PZDA 2JZ3B 3B0AA 5L83A 1YQBA 2O2VA 4WJPA 4LJPB 2LD9A 3EC8A 3TCAA 2N9XA 4DK5A 2N1WA 1S3SG 4GDLB 3PS6A 2DHZA 3ZNID 1Z2MA 2REXA 3ZW3A 2BYFA 2KJ6A 4JIOU 3NZSA 1F9JA 3EHVA 1LM8B 2Z0EB 1WGDA 1WM3A 5KHQA 3C0RB 4NPNA 1UH6A 4ZRIA 4GOCA 1IYFA 2XBBC 4TUUA 1X1MA 2L05A 1WYWB 4W9DA 4M8NA 2JWZA 2MW5A 2UWQA 2CHWA 2ZJDA 4MSQB 1UGMA 5IA7A 4K1RB 2D10A 1H8CA 2BKRB 4BOSC 2KLCA 3KYDD 3APDA 3V6CB 2BKFA 2PPHA 2KXJA 3A1QA 2NPTA 4MGKE 2GBKA 4LCDE 3AI5A 3ZIMA 5G2NA 5G55A 2LGYA 3ML9A 1OEYA 4MGZE 1ZGUB 2OOBB 3DBLI 4HPMB 4GDLA 4WWPA 5JHAA 4JL9A 4KIKB 4OVUA 2MBHA 3NS8A 3VH3B 4EZLA 1P3QU 5EDSA 3ZKJC 1CMXB 4E74A 3L0WB 3M62B 2LZ6A 2R2OA 3PGEA 4NNJB 4F8CB 3ZTDA 4K7WA 2L0TA 3H7SA 4MM3A 3H9DA 2K8BA 4IM3A 1GJZA 4IUMB 2IY0B 1YX5B 2JVCA 3L10B 3HK0A 4ANWA 3UQBA 3RYTA 2CU1A 3AU5A 4LJOB 3RT3B 2L3ZA 1WJ6A 2MX2A 4PS7A 4G3XB 2L7RA 2LRUA 3KW5B 2O6VD 2KMAA 2BWFA 4HWIB 4MGIE 2KD0A 3DPDA 2PJHA 4N9F4 3WA0A 3A9KB 4XC2A 2J7QB 3PT2B 2NBWB 4HXDA 4W9LA 1RAXA 4WJNA 2NR2A 3VTUA 1M94A 2AL3A 4BKGA 3RULA 2RSUA 3JW0X 4WWNA 1WXMA 2EMTA 1WH3A 1L2NA 4K7SA 2BPSA 2MA9B 4MEMA 4HCPB 3H6NA 3R3MA 1VD2A 5LLIA 3DBSA 4A20A 3LJ3A 1EF5A 2KFJA 4DBGA 3V6EB 3TIXA 1WE6A 3DQVA 1MG8A 3KUCB 4MJSB 2DYOA 5HKHA 4GGQA 1E8XA 4A3OA 2N1VA 3RUIB 2M8SA 2DYMA 2PEAA 2ZPYA 5D94A 2K8CA 4B9KA 2Y5BB 1NI2A 1VCBA 2C7NB 2NPTB 3A1QB 2YVCA 4II2B 4AJWA 4ZRKA 2MWSB 2D2QA 3Q3JA 3BINA 4IWOA 1U4AA 2K25A 2KVRA 4G11A 2JY6A 3N3KB 4W9GA 2VRRB 3EECA 4BKSA 1Y8RC 3ECIA 1UELA 2KTRB 1YJ1A 3CSTA 3IBEA 1UD7A 4JQWC 2JF5A 4AP4C 3AXCA 2K39A 4AUQC 3AULA 2FCNA 2LVPA 1NDDA 2G4SA 3MTNB 3A9JB 2KO3A 2KNBA 2DZMA 2IYDB 5CHVC 4GSWA 3VHTC 1T0YA 4W9HA 4JLCA 1UBIA 3V60A 2MCNB 1WGYA 2ZZPB 1E8ZA 2KC2A 2ASQA 3IG3A 4FHKA 3UINB 2N7EA 1WJNA 2KFKB 2RD0A 4BVUC 2IBIB 3WAOA 4ANVA 2EKEC 2WX1A 1KJTA 5CHWA 2ZCCA 2KKCA 1LQBA 3DCGA 4FLHA 2DZJA 4FJVB 1WXSA 3U8ZA 5DCNA 1P9DU 2V3SA 3SU8X 1BT0A 3EFUA 2DZKA 4KVGB 2RGFA 2HE7A 5D6JB 4NJ6A 4EZKA 3A33B 2DAJA 1XQQA 2NS5A 2OJRA 1WMHB 4WJOA 3TBLD 2LJ5A 1WF9A 3ONSA 4ANUA 1GUAB 2LVQA 2LRWA 1WX8A 2IO1B 4KIKA 2K8HA 2ZPNA 1H4RA 3OJ3A 2NBVB 3RZFA 4FA6A 2KMCA 5E6PA 3VTWA 4B95A 3GOEA 1TTNA 2BF8B 3Q3FA 1E8WA 3N32A 3NOBA 1P0RA 2C5LC 2IO3B 2J0MA 4MGYE 2I1KA 2NBUA 2AYOB 2UYZB 4NAWA 2BGFA 3OAWA 4K81A 1UZXB 4FJYA 1V80A 1EF1A 2K6DB 2LXAA 4RMAA 4WQOB 3H1UA 3VVWB 1NBFC 2C60A 2N9EB 2KWVB 3IFWB 3PRMB 2KJRA 1EO6A 1OTRB 5JZEB 1WX7A 4KZCA 3TMPB 2KTFA 4CYEA 1OGWA 2MLBA 2CHZA 4II3B 3QC8B 3L08A 5AZHA 5D7GA 1C1YB 1V9JA 1WR1A 5JHBA 2N7DA 2PE6B 4ZDVA 3JSVA 3R66C 1OEYJ 2JRHA 1XT9B 4FULA 1V6EA 4PYUA 1WZ3A 4ZYNA 2ZCBA 1V81A 2FIDA 4FN2A 5C23A 2MP2A 1WGHA 4DHJD 3KUDB 1HE8A 1E90A 2JZZA 4W9CA 3ZNZB 2NVUI 2RPQA 4WJQA 5JH5C 1K8RB 2C7HA 2B3AA 1JRUA 2HJ8A 3ML8A 2C7MB 3RCZA 4HVBA 4B6WA 5J17A 3VXWA 2JUOA 2JT4B 2KDBA 3ENEA 2GBRA 2ZVNA 1WY8A 2RR9A 2A4ZA 3QHTA 3QARA 4GIVA 1G6JA 3ZO5B 2IO0B 1KOTA 2J0KA 1E8YA 3MJWA 2GOWA 3ZRCA 1RLFA 2WYQA 3LDZE 4ANXA 3PLUA 4ASWC 4PS8A 4I6NB 3QWZB 4OVVA 5LXHA 2AEHA 3A9JA 3VUYA 4MH0E 5DPTA 1SGHA 3PSEB 3V62A 3VUXA 3VTVA 3VUWA 2QHOA 1E5WA 1KLVA 4KV2A 4EOYA 2R2QA 2ZNVB 1V49A 2L00B 3K9PB 3M3JA 1E7VA 4M8MA 2JXXA 3T9LA 5KHOA 4LDTD 2O2VB 2KHWB 4NQLB 1QZEA 3PHXB 4G50A 2KZRA 4GU2A 4BKTA 1D3ZA 1WGGA 1V5TA 1S1QB 2XEWA 3NZUA 4I6LB 4KSLC 1RRBA 5L95C 4YL8A 5E6NA 4E3CA 3X23A 2JRIB 3OLMD 1V86A 2KWUB 2I1JA 4IW0A 3ZTCA 2BWES 2KDIA 3PTFC 1PQSA 2M17A 2GBMA 2WX0A 4W9FA 1ISNA 3PRPB 2LXCA 3PPAA 4F7ZA 2HTHA 4GMVA 2KX3A 1LFDA 2MBOA 2KQ7A 5CHFA 3ZRFA 4EEWA 3HM6X 3QQ8B 2MSED 2BYEA 3SDLC 2IY1B 1WXVA 3ZUNA 1R4NI 4BBNC 2KDFB 4FADA 4P7IA 2ZVOA 2MP2B 2N4FA 2GBJA 2FCMA 4HPLB 1SIFA 4EUTA 5C1ZA 4GDKA 3JVZX 1WGRA 3DBRI 5LXIB 2WWZA 2KX0A 5FR6A 1L7YA 1P1AA 2L76A 5GMVA 5AEKB 4RM9A 4W9EA 1E7UA 4PS3A 2XK5B 1ZW7A 2XK5A 3A9KA 2G4DB 3ZLZA 5DPSA 2EMSA 3L54A 3S2AA 1Q1OA 4FJZA 1TGZB 3D32A 3MHSD 4RM8A 3ZDMC 2M0XA 3DOWA 5DPRA 3UGBB 5CX3A 3U7DA 1SE9A 5E6OA 1RFAA 3DBHI 4MSMB 1J0GA 3ZNHB 4XX5A 2J0JA 2AL6A 2CS4A 4TV3A 2IO2B 4BBNF 2DENB 4GDKB 4CHKA 2MRPA 3ZDTA 2O6VB 3VFKA 1GC6A 2DAFA 2MBBB 3BY4B 3W1YA 4DDID 1IP9A 4GN1A 4W9IA 4AJYB 1GG3A 2JPHA 2WDTB 2ZNVC 2D3GA 4X57B 5IAAC 2Z59B 4KSKC 1FXTB 3PREA 2CR5A 2LWPA 4HK2A 1I35A 1V5OA 1A5RA 3SHQA 2FNJB 4WWOA 3DVNV 3PVLA 3SD5A 4IWPA 3GZNI 3WIMA 3QA8A 3VDZA 2MBEA 5BO4B 2KQSA 5AZGA 2HD5B 3L16A 1C3TA 1WZ0A 2G45B 4EZJA 2FUHB 4WAAA
chains in the Genus database with same CATH superfamily
3W2DA 3R7RA 4YTPB 4URKA 3TJPA 3DVGX 3H7PB 4OHJA 3N30A 1R4NB 2BB6A 2K1FA 1WMHA 3BK2A 1WRIA 4FXCA 4NJ7A 4IWQA 4MELA 4IM0A 3H7PA 4F1SA 5TR5A 1TKGA 4FBJB 5BMGA 4E71A 3VQIA 1K53A 2JYEA 2KTRA 3DDCB 4HCNB 3JYUA 2ICIA 2INCC 5J2RA 2W82A 2Q5WD 1QKZA 1OQYA 5D2MB 2LGDA 1Z5SB 3B2GA 3M95A 1WFYA 2K3UA 1A70A 2Y5CA 5LNK1 3WAMA 2YEPF 4HKZE 3UQAA 3UIOB 1IPGA 1SXTA 4KGSA 1KFYB 1JCKB 1TZ1A 1QOAA 4AOFA 4C80A 4OZAA 2MBQA 3B08A 3I9V1 3IAM1 3VR8B 2FAZA 3URYA 2Z0DB 1QF6A 1GNUA 1FO4A 1WXAA 1NEKB 3P42A 5IP4D 2V4IB 4KDLB 2WLBA 3CSFA 1SF0A 2VZKB 2W9NA 1XD3B 2WXQA 1YX6B 3APFA 3QJZA 2PMVA 1SSNA 2KANA 3UF8A 2Y3AA 2LUMA 4DDGD 2FCSA 3QCAA 1UNSA 2RDGA 3A4RA 4NAWB 2MQJA 4HDQA 3R8BA 2PW9A 3KVFB 2QDFA 5L83A 1YQBA 2O2VA 2CU3A 4LJPB 1OFFA 3TCAA 1YOVB 2N9XA 2X38A 4GDLB 2DHZA 3P63A 2REXA 2V9HA 3ZW3A 2LFIA 1E9MA 2WDQB 3C0RB 4ZRIA 2KWDA 1X1MA 2L05A 1WYWB 4W9DA 4M8NA 5T8IA 4EE2A 2JWZA 4MSQB 4K1RB 1FFUA 1HZ6A 1L4DB 4C56C 2BKRB 2KLCA 1E0ZA 1C4AA 2PPHA 2K0PA 1ZXHA 2NPTA 2I38A 4LCDE 3DHHC 1OEYA 3GE8C 1BXTA 1ZGUB 2RMMA 1FD6A 3GP7A 3SR6A 3NRZA 1T6BX 1F2RC 2MBHA 4M00A 1HXYD 4HEA1 4E74A 3L0WB 3UI3A 1T5XD 4JE3B 1EU4A 2L0TA 3H7SA 4MM3A 2GRIA 4IM3A 5C3JB 1XEEA 1QT9A 1YX5B 4ANWA 3UQBA 4LJOB 3RT3B 1OQRA 1JWUD 2KMAA 4MGIE 1OQQA 3HVDA 3E56A 1MG4A 4PK1A 4HXDA 3VTUA 2NR2A 3ABVB 3JW0X 2EMTA 2I2YA 2MA9B 3N1YC 4A20A 1WE6A 3KUCB 3P4SB 4KKJA 2NTTA 5HKHA 4B0MA 2PEAA 3AE7B 4B9KA 4LNIA 3EGRA 1NI2A 3DBRB 1VCBA 2C7NB 2NPTB 5EE0A 2D2QA 2LHEA 1U4AA 4G11A 1PUTA 4BKSA 3N1ZC 1UELA 3CSTA 3IBEA 1UD7A 2JF5A 4AUQC 2DBYA 3AULA 1SE3A 2FCNA 1T3QA 2LVPA 2MJ3A 3A9JB 2DZMA 2IYDB 4K3CA 2ON8A 3VHTC 2WXRA 4W9HA 3AMZA 4JLCA 4ZHPA 2WXFA 3IG3A 4OZCA 3VRAB 1IBXA 1KJTA 4KGTA 2DZJA 1KLGD 1FNWA 5DCNA 1F1HA 2SEBD 3NG0A 1P9DU 4RGTA 3L4PA 3P4PB 3EFUA 5D6JB 3KLSX 2IGHA 4ACFA 3MHZA 2OJRA 3CIRB 4YSYB 1WF9A 1NENB 2LRWA 3U52E 1QOGA 2ZPNA 1H4RA 4FA6A 1AW7A 1Y56A 1RFKA 3NOBA 2C5LC 2NBUA 2UYZB 4K81A 1EF1A 4WQOB 2KWVB 4A6QA 3BWUD 1SJHD 1UF0A 2MLBA 5AZHA 1NYQA 1WR1A 2N7DA 4ZDVA 1HEZE 3JSVA 1UGJA 2J42A 4PYUA 1JROA 1WZ3A 4JWUC 1L6VA 4FN2A 5EE3A 4DHJD 4NAMA 1HE8A 3N20C 4RGOS 3U4EG 1FRDA 3DBHB 1AYFA 3GS2A 4WJQA 1K8RB 2C7HA 1JRUA 5J17A 4B6WA 3VXWA 1I4XA 1WWTA 2JQRB 2GBRA 1G6JA 2A4ZA 3QHTA 3ZO5B 1TS4A 3Q8EA 2GOWA 1RLFA 1V8CA 4I6NB 3A9JA 3VUYA 1V1PB 1UWXA 1ET9A 1SGHA 1L6UA 1WYGA 1VZ6A 3K9PB 3ETRA 2JXXA 3T9LA 5AUIA 5KHOA 4LDTD 2KHWB 2BQQA 2HJ1A 2JYTA 4KX6B 4HJGE 5E6NA 3OLMD 2I1JA 2PLPA 3ZTCA 2INNE 3EA6A 1LFDA 2MBOA 2KQ7A 3ZRFA 2WXPA 4EEWA 3FILA 3QQ8B 2MSED 2BYEA 1T0RC 3RNFC 4BBNC 2KDFB 4P7IA 1FM0D 2ZVOA 4XDCA 2GLSA 5HG2A 4GDKA 3BK1A 2MHJA 2KX0A 1K51A 1L7YA 2L76A 4ARCA 4L23A 3T3OA 4WH4A 1E7UA 3MC9A 1ZW7A 1T0QC 3A9KA 5DPSA 1WGKA 2JWUA 1EM7A 3IAS1 1SBBB 3DOWA 5E6OA 2D3AA 1UUPA 2J0JA 4BBNF 3ZDTA 2O6VB 1GC6A 2DAFA 2L32A 3W1YA 2UU7A 4W9IA 3IXSA 2WDTB 3KWLA 2Z59B 1SIJA 2CR5A 1I35A 2WS3B 5TSSA 1PGAA 3C19A 4WWOA 4MACA 2FUG1 3BYYB 3WIMA 2HD5B 3L16A 4WAAA 1K50A 4S0RA 1ENFA 1P98A 4BZAA 1WR6E 4DHZB 4W9JA 2BS3B 4IC7B 4MDKE 4TKNA 5JZEB 1ZKHA 1JQ4A 3HHMA 4I6PA 4BOZB 2FIFA 3V61A 4BFRA 4Q2JA 3AE5B 3H8HA 3U2SC 2ZW1A 4ZHOA 2WXHA 2PVGC 4W9KA 4ZOHC 4PT5A 1I42A 2ZEQA 3RNBC 1KLUD 4J6IA 2YLMA 4M0WB 2KJHB 2WXOA 2KN5A 4TQ1A 3DWMA 3CMMB 2PVOD 5BMIA 4NQKE 1QILA 3EFCA 3VAWA 4GB9A 4DWFA 1C9FA 2KACA 1NI3A 3AECB 1NYRA 2GBNA 2AWTA 1XLOA 3X0WA 1LO5D 2DZIA 1V2YA 4TSSA 5HI1A 3RNEC 3M63B 1MJDA 4QAYA 4OW0A 3NHEB 2LUEA 3WAPA 2GB1A 2QIEB 1ESFA 3AEBB 3JSVB 4TQ0A 1DOIA 2V3NA 4JX1C 1J19A 1WE7A 3PLVA 4IDIA 1P7FA 1ZDVA 4ZRJA 2LI5A 2V4LA 5IO9A 4HLEA 3RD2A 1AWDA 2YEPB 3DHGC 2MJDA 1IGDA 4A55A 3QK0A 4M01A 1YJIA 4LTUA 1N6ZA 3AM9A 3ZNID 1TKEA 2H89B 1Z2MA 4JIOU 1LM8B 3BYTB 2N9LA 2XBBC 3V3XA 1L4ZB 3Q69A 2MW5A 5IA7A 1QOBA 3SEBA 2BKFA 3A1QA 2GBKA 3AI5A 5G55A 4MGZE 3FAHA 3GZNB 2ZW0A 4RGMA 1ZE3D 4JL9A 4HPPA 1I4PA 4OVUA 3VH3B 2WP9B 4EZLA 4HKQA 5EDSA 4WURA 1CMXB 2DNFA 2WU5B 2G9HD 4RGNA 4J3OD 4K7WA 3H9DA 2K8BA 1GJZA 2IY0B 2JVCA 3L10B 3HK0A 4D2KA 5BYSA 1JWBD 1WJ6A 4PS7A 2AQ2B 4G3XB 2L7RA 3KW5B 4WWMA 2N0SB 2WU2B 3A9KB 3PT2B 2NBWB 4H2AA 1RAXA 4BKGA 1M94A 2AL3A 2QJLA 3RULA 2VH1A 1WH3A 3AH7A 4HCPB 3H6NA 3R3MA 5GXGB 1VD2A 1XLQA 3V6EB 1PGXA 2W54A 3TIXA 4WAFA 4MJSB 4GGQA 2M8SA 2ZPYA 5D94A 2K8CA 3IT6B 1JMLA 1V1OA 4II2B 4AJWA 4ZRKA 4IWOA 2K25A 5G5GA 2ACZB 4W9GA 3EECA 3E9SA 5E6JA 3I5JC 1NVID 2KTRB 1YJ1A 4JQWC 2LJIA 5MPOA 2K39A 3HUIA 3MTNB 1D5ZC 3MC8A 2L83A 3AEDB 2HDEA 2VH2A 4HRSA 3V60A 1WGYA 3UINB 1V1PA 4XWWA 2WX1A 5CHWA 4FJVB 1WXSA 2R61A 2J52A 2DZKA 2RGFA 3GB1A 1XQQA 5FK9C 2NS5A 3SFDB 4WJOA 2LJ5A 2XN9C 2INDC 2LVQA 2IO1B 3O13A 3Q14C 4YTNB 3RNGC 3VTWA 4B95A 1ZDXA 2GI9A 3GOEA 2BF8B 1E8WA 1FIQA 3B9JA 1TJEA 4NAWA 4M0WA 3OAWA 1I4HA 1UZXB 1C4PA 4FJYA 1V80A 2W3RA 1T0SC 3VVWB 1EO6A 3B2FA 4KZCA 3TMPB 1L0VB 3WCQA 1SEBD 2RDBC 3QC8B 3KQ4A 1MHHE 1C1YB 5I4DA 4TMAB 5JHBA 1JRPA 4WIPA 1V6EA 4ZYNA 3BVMA 1E90A 2NVUI 2RPQA 2B3AA 2HJ8A 3OWEB 1VJKA 3MJWA 3Q8FA 3ZRCA 2WYQA 4ASWC 2AEHA 5DPTA 4C7ZA 3V62A 3VUXA 3Q8BA 3Q6BA 1KLVA 2QILA 2ZNVB 3M3JA 3V05A 2JSVX 1XLNA 1JWMD 4GU2A 2H88B 1V5TA 1S1QB 1M4VA 4KSLC 1RRBA 5L95C 1DYQA 3RI7C 4R3DA 2BWES 2KDIA 1RWSA 2M17A 3P4QB 1C4CA 1VZ8A 1ISNA 3DHIC 4LNOA 2HTHA 2KX3A 1YQ4B 4KGRA 2BS4B 3KWVA 1L0XB 3SDLC 3T3NA 3AE8B 2FCMA 4HPLB 1SIFA 1ZP0B 3JVZX 3VR9B 3DBRI 1TZOA 2KN4A 1TT5B 1P1AA 1VR9A 4RM9A 4P16A 2XK5B 2XK5A 3ZLZA 3S2AA 3TEWA 4IOIE 1TGZB 3MHSD 3ZDMC 5DPRA 4ARIA 3AEFB 4HROA 1XCQL 1TS5A 1SE9A 1J0GA 1SE4A 1ET6A 3TEXA 2LMCA 5FR3A 3NJTA 2AL6A 4TV3A 2DENB 4N6EB 2MRPA 1JALA 1IP9A 4GN1A 2JPHA 2ZNVC 2D3GA 4X57B 2Z8LA 2LWPA 3SHQA 2FNJB 3SD5A 4IWPA 4DXFA 2MBEA 5BO4B 2KQSA 4A8XC 1WZ0A 3HVZA 1D6EC 4JPSA 1YD8U 4JGHB 2OEDA 2KFKA 3IVFA 2M4NA 2G3QB 3N9YC 3PHWB 3TL5A 2BYVE 1R4MI 3BVZA 2DWQA 4LDTB 5H8YE 3DVNU 4ICUA 1UBQA 3RFZB 4EKUA 2IZVB 1VZ7A 3AU4A 1FFVA 4KDIC 2D11A 1WI0A 3DVGY 4LK0M 2KWCA 2OJWA 3W5UB 1KRHA 5CTRC 3O65B 1XO3A 2PE9A 1J8CA 5AZFA 3APCA 4RF0A 1CQVA 2TSSA 4XZ4A 1FNVA 1WM2A 3UIPB 1FCCC 3QX1A 1EUVB 3VH4B 1KM7A 1WJUA 5J18A 3T8MA 2KT7A 2N9PC 5C2TB 1GOZA 3W1SA 1LGRA 3OJ4B 2NCNA 2LVOA 1ACCA 3NY5A 3U30A 3C8YA 2KOXA 3L13A 2WDVB 3KUZA 2J53A 3ALBA 3RZWC 1YIWA 3KYCD 1TBEA 4P1BC 2BT6A 2E3TA 3R2TA 1C78A 4N58A 2M0AA 4MH8A 2KDEB 2M56B 3HM3A 5DPWA 2CKHB 3P4RB 5H92C 3AEAB 1R4MB 4NJCA 2DX5B 1WRDB 1KH0A 1BUIC 3R7QA 1HTQA 3NVVA 2KC1A 3B1LX 2FCQA 4DHZE 3KH0A 4DQOC 5D3IB 2D07B 2GMIC 3AE9B 1MI0A 2L1AA 4HJKA 2QMTA 3AE3B 2JZ3B 4WJPA 4DK5A 2LD9A 1L5PA 2PKOA 3Q3NC 2BYFA 2KJ6A 3NZSA 3EHVA 3ZXVA 3I57A 5D3DA 1UH6A 3AN1A 4GOCA 1IYFA 2K9XA 1ZXIA 1MVKA 2RPVA 2UWQA 1C76A 2CHWA 2ZJDA 1UGMA 3BVGA 1H8CA 2W3SA 4BOSC 2E6XA 3KYDD 3V6CB 3NS1A 4YT0B 1FXIA 2G1EA 5IOIA 3ZJTA 4MGKE 4UDUC 2BS2B 3ML9A 2WXNA 3EUB2 2FE8A 3DBLI 4GDLA 4WWPA 5JHAA 1PFDA 2DLBA 3M62B 2LZ6A 2R2OA 3AE6B 3PGEA 2J4XA 3ZTDA 2WGSA 3AB5A 2WXGA 3AU5A 3ZGZA 1C79A 2L3ZA 2MX2A 4XGAB 2INPE 1P7EA 1B9RA 2JX5A 2KD0A 4ZRPA 4XC2A 4W9LA 4F7ZA 1F77A 1JWAD 4WWNA 3RNAC 1WXMA 4RNAA 4MEMA 2KFJA 5HHDG 3DQVA 1E8XA 1CZPA 3AV8A 1IBXB 2Y5BB 1HTOA 2YVCA 2MWSB 2KVRA 3TEYA 2VRRB 3ECIA 1E10A 1JWSD 3AEGB 4AP4C 3AXCA 4XDDA 4NZLB 1NDDA 2G4SA 2KO3A 4O1NA 1FPYA 3TSSA 3NZ3A 4GSWA 1T0YA 2WDRB 3Q8CA 1UBIA 3MFGA 4ITKA 2ZZPB 2N7EA 2WXMA 3Q3MC 2RD0A 1PGBA 2IBIB 4ANVA 2ZCCA 2KKCA 4US9A 3DCGA 2ONQA 3U8ZA 2N9KA 2V3SA 3SU8X 4KVGB 3N1XC 2HE7A 4EZKA 2WXJA 1WMHB 3TBLD 2Y5PA 3ONSA 4ANUA 1QQRA 2PTLA 1N63A 4KIKA 1SE2A 2K8HA 4JWSC 2BBCA 2NBVB 1RM6C 1FMAD 3AE4B 4MGYE 3ZQ4A 1VLBA 1J7AA 2K6DB 2LXAA 4RMAA 2KYWA 1N61A 1NBFC 2C60A 3IFWB 3PRMB 1OTRB 1AN8A 2CHZA 4II3B 3L08A 1N5WA 3MJ5A 3MC0B 1DGJA 5D7GA 4LNKA 2WXKA 3IT4B 3R66C 2JRHA 1XT9B 4LLGM 4FULA 2IPKD 4ZRQA 5BMHA 2ZCBA 2FIDA 5C23A 2MP2A 2BYTA 2JZZA 1I4QA 4W9CA 3ZNZB 3W5VB 3ML8A 4OZBA 2AQ3B 1GB1A 2JUOA 2JT4B 1KTKA 2KDBA 3ENEA 1XCTL 3QARA 2ZVNA 1B1ZA 2RR9A 4GIVA 2IO0B 1E8YA 3DWGC 3PLUA 4PS8A 2CJNA 5LXHA 3AE2B 3PSEB 3VTVA 3VUWA 2QHOA 2SAKA 2KAJA 2EELA 4KV2A 1QLBB 4EOYA 2R2QA 2L00B 4USAA 1E7VA 3DBLB 3GE3C 1CK1A 4NQLB 4BKTA 1WGGA 3NZUA 2MEKA 3TUOA 4YL8A 4YXDB 3X23A 2KWUB 3HRDD 2WX0A 2GBMA 3PRPB 1QOFA 2LXCA 3PPAA 4GMVA 3AEEB 5CHFA 1N60A 3HM6X 4RFBA 3Q2AC 1MHXA 1WXVA 3ZUNA 2QCZA 2MP2B 1XXGA 5C1ZA 2JXTA 1WGRA 5LXIB 5GMVA 4W9EA 4PS3A 3BIID 1XF5L 2G4DB 2EMSA 3L54A 3ZXRA 2BW2A 2WXIA 3UGBB 2IGDA 3U7DA 1KF6B 4MSMB 3I63C 3ZNHB 4XX5A 2BTEA 1CJEA 3FKYA 4YTMB 1F0ZA 2CS4A 2IO2B 4CHKA 1TKYA 3VFKA 1YMHE 4DDID 4RH6A 2V0GA 2KQ4X 4AJYB 1J7CA 5IAAC 4US8A 4KSKC 1FXTB 3PREA 4HK2A 5HFYA 2LEKA 1TYGB 1HA5A 4ZYSA 3DVNV 3QA8A 1MPEA 2D3BA 1C3TA 4XE0A 1N5XA 4KKIA 2G45B 4EZJA 2FUHB 2MH7A 1ZUD2 1JW9D 2NMQA 3QAQA 1AARA 2OHFA 3K9OB 2C9WB 2L8JA 2A5UA 1ZPSA 4P1CC 1WIAA 2KLGA 1WX9A 2L0FA 2KMMA 1TY0A 4G0NB 3WANA 1XLPA 4C7YA 1YN4A 2V3PA 2WNMA 4IM2A 1VDVA 5BYRA 3L17A 4MJSA 3ZNGC 3QIJA 2M1MA 3IHPC 1C77A 3HIZA 2BB5A 2KK8A 4MM3B 3PV1A 2DYBA 2K22A 4A3PA 3W9CB 4K7UA 2LASA 1Q0WB 4KZ0A 4EFOA 3U7ZA 2K6QA 1WJ4A 2RDHA 1Q5WB 2MJEA 1GC7A 1FCLA 3WALA 3ZVVA 4OVZA 4IG7B 4GXBA 1LXDA 4NY0A 1FNUA 3CF6E 2V1YA 3A4SC 2CHXA 4BKSD 1VRAB 2O6VA 5G5HA 4L1BA 4DHJB 3Q3OC 1RYJA 1HZ5A 3PRZA 4FHJA 4HDOA 1E6EB 3MP9A 4ICVA 1TS2A 2LGXA 3NVWA 4PYZA 3W1SC 4AS1A 4AWJA 2AX5A 3I3TB 3TEZA 4C4VB 4CO7A 3P2BA 3PZDA 4YSXB 3B0AA 4A9AA 3PZ8A 3SFEB 3RPFC 3EC8A 2N1WA 1S3SG 1TIFA 3PS6A 3AE1B 4CQNA 1F9JA 4P6VF 2Z0EB 1WGDA 1WM3A 5IKCM 5KHQA 4S17A 4NPNA 4TUUA 2QEJC 2WXLA 1DOYA 4N59A 2D10A 3APDA 2KXJA 1V97A 1GB4A 3ZIMA 1FXAA 5G2NA 2IDYA 2LGYA 2OOBB 2N7JA 4HPMB 5IN7A 4A90A 1GAQB 1TS3A 4KIKB 2LHDA 3NS8A 1P3QU 3ZKJC 1EWYC 1SB3C 1WXQA 4NNJB 4F8CB 4IUMB 1PYWD 3RYTA 2CU1A 1MFWA 3NVYA 1SJED 2LRUA 2AQ1B 2O6VD 2BWFA 4HWIB 3DPDA 2PJHA 4N9F4 2LGIA 4WQMA 3WA0A 4YWGG 2J7QB 4DXAB 4WJNA 2RSUA 3LB8C 1L2NA 4K7SA 2BPSA 2NTSA 5LLIA 3DBSA 3LJ3A 1EF5A 4DBGA 2D5GA 4K3BA 1MG8A 3ZJUA 2DYOA 4C4VA 1I4RA 4A3OA 2N1VA 3RUIB 2DYMA 2WHIA 3A1QB 2X8XX 3Q3JA 3BINA 4XYCA 2JY6A 3N3KB 4B0EA 1Y8RC 1TY2A 2KNBA 3VRBB 5AUKA 5CHVC 1D5XC 2IGGA 2MCNB 1E8ZA 2KC2A 2ASQA 1K52A 4FHKA 1WJNA 2KFKB 1DOXA 4BVUC 3WAOA 2EKEC 2IJ0A 1LQBA 4FLHA 1ROEA 1BT0A 2HTME 3PO0A 4M02A 1BMLC 4NJ6A 3A33B 2DAJA 3RNCC 3CWIA 1GUAB 1D5MC 1WX8A 1I7HA 3OJ3A 3RZFA 5BYQA 2KMCA 5E6PA 1TTNA 3Q3FA 3N32A 1P0RA 2IO3B 2J0MA 1J7BA 3LXFA 2I1KA 2AYOB 1HQRD 1YN5A 2BGFA 4DXGA 3H1UA 5JXVA 1E7PB 2N9EB 2KJRA 1D4BA 1WX7A 4C00A 2KTFA 4IKGA 2BVCA 4CYEA 1OGWA 3PZ7A 1STEA 3P1MA 1V9JA 2PE6B 2D3CA 1OEYJ 2XNAC 3FILB 4YSZB 2VZKD 2EKIA 3RN9C 1V81A 1WGHA 3KUDB 2JZPA 3J9CA 4LNFA 2W55A 5JH5C 3RCZA 2C7MB 4HVBA 1WY8A 1KOTA 2M19A 2J0KA 3LDZE 2JU6X 4ANXA 1UWMA 4XWTA 1IGCA 2L52A 3QWZB 4OVVA 4MH0E 2LGSA 1YNTE 1I4GA 3RMKC 1E5WA 5FKAC 1V49A 4RCOA 4M8MA 2O2VB 1D3ZA 1QZEA 3PHXB 4G50A 2KZRA 5EE1A 4L2YA 2XEWA 4I6LB 2KVZA 1EWCA 4E3CA 1R7SA 2JRIB 1V86A 4IW0A 2WQYB 1F52A 3BZDB 3PTFC 1PQSA 4W9FA 2QC8A 3Q8AA 1F2RI 3FC4A 2CJOA 1Q10A 2IY1B 1R4NI 4FADA 3ZJVA 2N4FA 2GBJA 2K5PA 4EUTA 1GPXA 4REZA 2PIAA 2B76B 2WWZA 5FR6A 5AEKB 3OG5A 1N62A 1L0YB 1Q1OA 1EU3A 4FJZA 4RF1A 3D32A 4BAXA 1YN3A 1WSPA 4RM8A 2QSDA 1FEHA 2M0XA 5CX3A 1FRRA 1ZOYB 1RFAA 3DBHI 3NVZA 4GLSC 4LNNA 4GDKB 3NUHB 1YQ3B 2MBBB 3BY4B 3R2IA 4MT5A 1GG3A 2KDMA 1IUEA 1V5OA 1A5RA 4AQ7A 5EE9A 3PVLA 1PDXA 2FBWB 3GZNI 3LYYA 3VDZA 5AZGA 1YJJA 3ZYYX
chains in the Genus database with same CATH topology
1P98A 1YD8U 1WR6E 3QAQA 4JGHB 4DHZB 4W9JA 1AARA 3R7RA 2KFKA 3IVFA 4URKA 3TJPA 2M4NA 3DVGX 3K9OB 2G3QB 4IC7B 4MDKE 4TKNA 2C9WB 1ZKHA 2L8JA 3H7PB 2A5UA 3HHMA 3N30A 2FIFA 3PHWB 4I6PA 2BYVE 3TL5A 1R4MI 3V61A 1WIAA 2K1FA 1WMHA 1WX9A 2KLGA 2L0FA 4MELA 4BFRA 4NJ7A 4IWQA 4IM0A 3H7PA 4LDTB 4F1SA 3DVNU 4ICUA 1UBQA 5TR5A 4EKUA 4FBJB 2IZVB 3AU4A 4G0NB 4KDIC 3WANA 4E71A 3VQIA 2D11A 1WI0A 3DVGY 4IM2A 2KWCA 2KTRA 4W9KA 3DDCB 3L17A 4HCNB 3QIJA 4MJSA 3ZNGC 2M1MA 3IHPC 3HIZA 3JYUA 5CTRC 3O65B 1I42A 2ZEQA 2PE9A 2KK8A 4J6IA 1J8CA 5AZFA 3APCA 2YLMA 5J2RA 3PV1A 2DYBA 4M0WB 2KJHB 4A3PA 4XZ4A 1OQYA 4K7UA 2KN5A 4TQ1A 5D2MB 1WM2A 3UIPB 2LGDA 3CMMB 2LASA 3QX1A 1EUVB 1Q0WB 1Z5SB 3VH4B 4NQKE 3M95A 4KZ0A 1KM7A 1WFYA 3VAWA 1WJUA 4EFOA 3T8MA 5J18A 2K6QA 4GB9A 4DWFA 1WJ4A 3WAMA 2N9PC 3UQAA 3W1SA 1Q5WB 3UIOB 1GC7A 1IPGA 3WALA 3ZVVA 3OJ4B 2NCNA 2LVOA 2GBNA 2AWTA 3NY5A 1TZ1A 4IG7B 3U30A 3X0WA 4AOFA 4GXBA 2KOXA 3L13A 1LXDA 2MBQA 2DZIA 3B08A 1V2YA 3KUZA 4NY0A 2FAZA 3ALBA 4BOZB 2Z0DB 3CF6E 2V1YA 3M63B 3A4SC 3RZWC 1YIWA 2CHXA 3KYCD 1TBEA 1GNUA 1WXAA 4BKSD 3NHEB 2O6VA 2LUEA 3WAPA 4DHJB 4KDLB 3CSFA 2KDEB 3HM3A 3JSVB 2CKHB 5DPWA 2W9NA 4TQ0A 1XD3B 3PRZA 2DX5B 4FHJA 1YX6B 3APFA 4HDOA 3QJZA 1WRDB 3R7QA 4ICVA 2KANA 2KC1A 1J19A 3UF8A 1WE7A 3PLVA 3B1LX 4ZRJA 2FCQA 2LGXA 2LI5A 2V4LA 3KH0A 4DHZE 4PYZA 4DDGD 2FCSA 3W1SC 4DXAB 3QCAA 4AWJA 4HLEA 2D07B 3A4RA 2GMIC 4NAWB 3RD2A 2MQJA 4HDQA 3I3TB 4CO7A 3P2BA 3QK0A 3KVFB 4HJKA 3PZDA 2JZ3B 3B0AA 5L83A 1YQBA 2O2VA 4WJPA 4LJPB 2LD9A 3EC8A 3TCAA 2N9XA 4DK5A 2N1WA 1S3SG 4GDLB 3PS6A 2DHZA 3ZNID 1Z2MA 2REXA 3ZW3A 2BYFA 2KJ6A 4JIOU 3NZSA 1F9JA 3EHVA 1LM8B 2Z0EB 1WGDA 1WM3A 5KHQA 3C0RB 4NPNA 1UH6A 4ZRIA 4GOCA 1IYFA 2XBBC 4TUUA 1X1MA 2L05A 1WYWB 4W9DA 4M8NA 2JWZA 2MW5A 2UWQA 2CHWA 2ZJDA 4MSQB 1UGMA 5IA7A 4K1RB 2D10A 1H8CA 2BKRB 4BOSC 2KLCA 3KYDD 3APDA 3V6CB 2BKFA 2PPHA 2KXJA 3A1QA 2NPTA 4MGKE 2GBKA 4LCDE 3AI5A 3ZIMA 5G2NA 5G55A 2LGYA 3ML9A 1OEYA 4MGZE 1ZGUB 2OOBB 3DBLI 4HPMB 4GDLA 4WWPA 5JHAA 4JL9A 4KIKB 4OVUA 2MBHA 3NS8A 3VH3B 4EZLA 1P3QU 5EDSA 3ZKJC 1CMXB 4E74A 3L0WB 3M62B 2LZ6A 2R2OA 3PGEA 4NNJB 4F8CB 3ZTDA 4K7WA 2L0TA 3H7SA 4MM3A 3H9DA 2K8BA 4IM3A 1GJZA 4IUMB 2IY0B 1YX5B 2JVCA 3L10B 3HK0A 4ANWA 3UQBA 3RYTA 2CU1A 3AU5A 4LJOB 3RT3B 2L3ZA 1WJ6A 2MX2A 4PS7A 4G3XB 2L7RA 2LRUA 3KW5B 2O6VD 2KMAA 2BWFA 4HWIB 4MGIE 2KD0A 3DPDA 2PJHA 4N9F4 3WA0A 3A9KB 4XC2A 2J7QB 3PT2B 2NBWB 4HXDA 4W9LA 1RAXA 4WJNA 2NR2A 3VTUA 1M94A 2AL3A 4BKGA 3RULA 2RSUA 3JW0X 4WWNA 1WXMA 2EMTA 1WH3A 1L2NA 4K7SA 2BPSA 2MA9B 4MEMA 4HCPB 3H6NA 3R3MA 1VD2A 5LLIA 3DBSA 4A20A 3LJ3A 1EF5A 2KFJA 4DBGA 3V6EB 3TIXA 1WE6A 3DQVA 1MG8A 3KUCB 4MJSB 2DYOA 5HKHA 4GGQA 1E8XA 4A3OA 2N1VA 3RUIB 2M8SA 2DYMA 2PEAA 2ZPYA 5D94A 2K8CA 4B9KA 2Y5BB 1NI2A 1VCBA 2C7NB 2NPTB 3A1QB 2YVCA 4II2B 4AJWA 4ZRKA 2MWSB 2D2QA 3Q3JA 3BINA 4IWOA 1U4AA 2K25A 2KVRA 4G11A 2JY6A 3N3KB 4W9GA 2VRRB 3EECA 4BKSA 1Y8RC 3ECIA 1UELA 2KTRB 1YJ1A 3CSTA 3IBEA 1UD7A 4JQWC 2JF5A 4AP4C 3AXCA 2K39A 4AUQC 3AULA 2FCNA 2LVPA 1NDDA 2G4SA 3MTNB 3A9JB 2KO3A 2KNBA 2DZMA 2IYDB 5CHVC 4GSWA 3VHTC 1T0YA 4W9HA 4JLCA 1UBIA 3V60A 2MCNB 1WGYA 2ZZPB 1E8ZA 2KC2A 2ASQA 3IG3A 4FHKA 3UINB 2N7EA 1WJNA 2KFKB 2RD0A 4BVUC 2IBIB 3WAOA 4ANVA 2EKEC 2WX1A 1KJTA 5CHWA 2ZCCA 2KKCA 1LQBA 3DCGA 4FLHA 2DZJA 4FJVB 1WXSA 3U8ZA 5DCNA 1P9DU 2V3SA 3SU8X 1BT0A 3EFUA 2DZKA 4KVGB 2RGFA 2HE7A 5D6JB 4NJ6A 4EZKA 3A33B 2DAJA 1XQQA 2NS5A 2OJRA 1WMHB 4WJOA 3TBLD 2LJ5A 1WF9A 3ONSA 4ANUA 1GUAB 2LVQA 2LRWA 1WX8A 2IO1B 4KIKA 2K8HA 2ZPNA 1H4RA 3OJ3A 2NBVB 3RZFA 4FA6A 2KMCA 5E6PA 3VTWA 4B95A 3GOEA 1TTNA 2BF8B 3Q3FA 1E8WA 3N32A 3NOBA 1P0RA 2C5LC 2IO3B 2J0MA 4MGYE 2I1KA 2NBUA 2AYOB 2UYZB 4NAWA 2BGFA 3OAWA 4K81A 1UZXB 4FJYA 1V80A 1EF1A 2K6DB 2LXAA 4RMAA 4WQOB 3H1UA 3VVWB 1NBFC 2C60A 2N9EB 2KWVB 3IFWB 3PRMB 2KJRA 1EO6A 1OTRB 5JZEB 1WX7A 4KZCA 3TMPB 2KTFA 4CYEA 1OGWA 2MLBA 2CHZA 4II3B 3QC8B 3L08A 5AZHA 5D7GA 1C1YB 1V9JA 1WR1A 5JHBA 2N7DA 2PE6B 4ZDVA 3JSVA 3R66C 1OEYJ 2JRHA 1XT9B 4FULA 1V6EA 4PYUA 1WZ3A 4ZYNA 2ZCBA 1V81A 2FIDA 4FN2A 5C23A 2MP2A 1WGHA 4DHJD 3KUDB 1HE8A 1E90A 2JZZA 4W9CA 3ZNZB 2NVUI 2RPQA 4WJQA 5JH5C 1K8RB 2C7HA 2B3AA 1JRUA 2HJ8A 3ML8A 2C7MB 3RCZA 4HVBA 4B6WA 5J17A 3VXWA 2JUOA 2JT4B 2KDBA 3ENEA 2GBRA 2ZVNA 1WY8A 2RR9A 2A4ZA 3QHTA 3QARA 4GIVA 1G6JA 3ZO5B 2IO0B 1KOTA 2J0KA 1E8YA 3MJWA 2GOWA 3ZRCA 1RLFA 2WYQA 3LDZE 4ANXA 3PLUA 4ASWC 4PS8A 4I6NB 3QWZB 4OVVA 5LXHA 2AEHA 3A9JA 3VUYA 4MH0E 5DPTA 1SGHA 3PSEB 3V62A 3VUXA 3VTVA 3VUWA 2QHOA 1E5WA 1KLVA 4KV2A 4EOYA 2R2QA 2ZNVB 1V49A 2L00B 3K9PB 3M3JA 1E7VA 4M8MA 2JXXA 3T9LA 5KHOA 4LDTD 2O2VB 2KHWB 4NQLB 1QZEA 3PHXB 4G50A 2KZRA 4GU2A 4BKTA 1D3ZA 1WGGA 1V5TA 1S1QB 2XEWA 3NZUA 4I6LB 4KSLC 1RRBA 5L95C 4YL8A 5E6NA 4E3CA 3X23A 2JRIB 3OLMD 1V86A 2KWUB 2I1JA 4IW0A 3ZTCA 2BWES 2KDIA 3PTFC 1PQSA 2M17A 2GBMA 2WX0A 4W9FA 1ISNA 3PRPB 2LXCA 3PPAA 4F7ZA 2HTHA 4GMVA 2KX3A 1LFDA 2MBOA 2KQ7A 5CHFA 3ZRFA 4EEWA 3HM6X 3QQ8B 2MSED 2BYEA 3SDLC 2IY1B 1WXVA 3ZUNA 1R4NI 4BBNC 2KDFB 4FADA 4P7IA 2ZVOA 2MP2B 2N4FA 2GBJA 2FCMA 4HPLB 1SIFA 4EUTA 5C1ZA 4GDKA 3JVZX 1WGRA 3DBRI 5LXIB 2WWZA 2KX0A 5FR6A 1L7YA 1P1AA 2L76A 5GMVA 5AEKB 4RM9A 4W9EA 1E7UA 4PS3A 2XK5B 1ZW7A 2XK5A 3A9KA 2G4DB 3ZLZA 5DPSA 2EMSA 3L54A 3S2AA 1Q1OA 4FJZA 1TGZB 3D32A 3MHSD 4RM8A 3ZDMC 2M0XA 3DOWA 5DPRA 3UGBB 5CX3A 3U7DA 1SE9A 5E6OA 1RFAA 3DBHI 4MSMB 1J0GA 3ZNHB 4XX5A 2J0JA 2AL6A 2CS4A 4TV3A 2IO2B 4BBNF 2DENB 4GDKB 4CHKA 2MRPA 3ZDTA 2O6VB 3VFKA 1GC6A 2DAFA 2MBBB 3BY4B 3W1YA 4DDID 1IP9A 4GN1A 4W9IA 4AJYB 1GG3A 2JPHA 2WDTB 2ZNVC 2D3GA 4X57B 5IAAC 2Z59B 4KSKC 1FXTB 3PREA 2CR5A 2LWPA 4HK2A 1I35A 1V5OA 1A5RA 3SHQA 2FNJB 4WWOA 3DVNV 3PVLA 3SD5A 4IWPA 3GZNI 3WIMA 3QA8A 3VDZA 2MBEA 5BO4B 2KQSA 5AZGA 2HD5B 3L16A 1C3TA 1WZ0A 2G45B 4EZJA 2FUHB 4WAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P98 A;  1YD8 U;  1WR6 E;  3QAQ A;  4JGH B;  4DHZ B;  4W9J A;  1AAR A;  3R7R A;  2KFK A;  3IVF A;  4URK A;  3TJP A;  2M4N A;  3DVG X;  3K9O B;  2G3Q B;  4IC7 B;  4MDK E;  4TKN A;  2C9W B;  1ZKH A;  2L8J A;  3H7P B;  2A5U A;  3HHM A;  3N30 A;  2FIF A;  3PHW B;  4I6P A;  2BYV E;  3TL5 A;  1R4M I;  3V61 A;  1WIA A;  2K1F A;  1WMH A;  1WX9 A;  2KLG A;  2L0F A;  4MEL A;  4BFR A;  4NJ7 A;  4IWQ A;  4IM0 A;  3H7P A;  4LDT B;  4F1S A;  3DVN U;  4ICU A;  1UBQ A;  5TR5 A;  4EKU A;  4FBJ B;  2IZV B;  3AU4 A;  4G0N B;  4KDI C;  3WAN A;  4E71 A;  3VQI A;  2D11 A;  1WI0 A;  3DVG Y;  4IM2 A;  2KWC A;  2KTR A;  4W9K A;  3DDC B;  3L17 A;  4HCN B;  3QIJ A;  4MJS A;  3ZNG C;  2M1M A;  3IHP C;  3HIZ A;  3JYU A;  5CTR C;  3O65 B;  1I42 A;  2ZEQ A;  2PE9 A;  2KK8 A;  4J6I A;  1J8C A;  5AZF A;  3APC A;  2YLM A;  5J2R A;  3PV1 A;  2DYB A;  4M0W B;  2KJH B;  4A3P A;  4XZ4 A;  1OQY A;  4K7U A;  2KN5 A;  4TQ1 A;  5D2M B;  1WM2 A;  3UIP B;  2LGD A;  3CMM B;  2LAS A;  3QX1 A;  1EUV B;  1Q0W B;  1Z5S B;  3VH4 B;  4NQK E;  3M95 A;  4KZ0 A;  1KM7 A;  1WFY A;  3VAW A;  1WJU A;  4EFO A;  3T8M A;  5J18 A;  2K6Q A;  4GB9 A;  4DWF A;  1WJ4 A;  3WAM A;  2N9P C;  3UQA A;  3W1S A;  1Q5W B;  3UIO B;  1GC7 A;  1IPG A;  3WAL A;  3ZVV A;  3OJ4 B;  2NCN A;  2LVO A;  2GBN A;  2AWT A;  3NY5 A;  1TZ1 A;  4IG7 B;  3U30 A;  3X0W A;  4AOF A;  4GXB A;  2KOX A;  3L13 A;  1LXD A;  2MBQ A;  2DZI A;  3B08 A;  1V2Y A;  3KUZ A;  4NY0 A;  2FAZ A;  3ALB A;  4BOZ B;  2Z0D B;  3CF6 E;  2V1Y A;  3M63 B;  3A4S C;  3RZW C;  1YIW A;  2CHX A;  3KYC D;  1TBE A;  1GNU A;  1WXA A;  4BKS D;  3NHE B;  2O6V A;  2LUE A;  3WAP A;  4DHJ B;  4KDL B;  3CSF A;  2KDE B;  3HM3 A;  3JSV B;  2CKH B;  5DPW A;  2W9N A;  4TQ0 A;  1XD3 B;  3PRZ A;  2DX5 B;  4FHJ A;  1YX6 B;  3APF A;  4HDO A;  3QJZ A;  1WRD B;  3R7Q A;  4ICV A;  2KAN A;  2KC1 A;  1J19 A;  3UF8 A;  1WE7 A;  3PLV A;  3B1L X;  4ZRJ A;  2FCQ A;  2LGX A;  2LI5 A;  2V4L A;  3KH0 A;  4DHZ E;  4PYZ A;  4DDG D;  2FCS A;  3W1S C;  4DXA B;  3QCA A;  4AWJ A;  4HLE A;  2D07 B;  3A4R A;  2GMI C;  4NAW B;  3RD2 A;  2MQJ A;  4HDQ A;  3I3T B;  4CO7 A;  3P2B A;  3QK0 A;  3KVF B;  4HJK A;  3PZD A;  2JZ3 B;  3B0A A;  5L83 A;  1YQB A;  2O2V A;  4WJP A;  4LJP B;  2LD9 A;  3EC8 A;  3TCA A;  2N9X A;  4DK5 A;  2N1W A;  1S3S G;  4GDL B;  3PS6 A;  2DHZ A;  3ZNI D;  1Z2M A;  2REX A;  3ZW3 A;  2BYF A;  2KJ6 A;  4JIO U;  3NZS A;  1F9J A;  3EHV A;  1LM8 B;  2Z0E B;  1WGD A;  1WM3 A;  5KHQ A;  3C0R B;  4NPN A;  1UH6 A;  4ZRI A;  4GOC A;  1IYF A;  2XBB C;  4TUU A;  1X1M A;  2L05 A;  1WYW B;  4W9D A;  4M8N A;  2JWZ A;  2MW5 A;  2UWQ A;  2CHW A;  2ZJD A;  4MSQ B;  1UGM A;  5IA7 A;  4K1R B;  2D10 A;  1H8C A;  2BKR B;  4BOS C;  2KLC A;  3KYD D;  3APD A;  3V6C B;  2BKF A;  2PPH A;  2KXJ A;  3A1Q A;  2NPT A;  4MGK E;  2GBK A;  4LCD E;  3AI5 A;  3ZIM A;  5G2N A;  5G55 A;  2LGY A;  3ML9 A;  1OEY A;  4MGZ E;  1ZGU B;  2OOB B;  3DBL I;  4HPM B;  4GDL A;  4WWP A;  5JHA A;  4JL9 A;  4KIK B;  4OVU A;  2MBH A;  3NS8 A;  3VH3 B;  4EZL A;  1P3Q U;  5EDS A;  3ZKJ C;  1CMX B;  4E74 A;  3L0W B;  3M62 B;  2LZ6 A;  2R2O A;  3PGE A;  4NNJ B;  4F8C B;  3ZTD A;  4K7W A;  2L0T A;  3H7S A;  4MM3 A;  3H9D A;  2K8B A;  4IM3 A;  1GJZ A;  4IUM B;  2IY0 B;  1YX5 B;  2JVC A;  3L10 B;  3HK0 A;  4ANW A;  3UQB A;  3RYT A;  2CU1 A;  3AU5 A;  4LJO B;  3RT3 B;  2L3Z A;  1WJ6 A;  2MX2 A;  4PS7 A;  4G3X B;  2L7R A;  2LRU A;  3KW5 B;  2O6V D;  2KMA A;  2BWF A;  4HWI B;  4MGI E;  2KD0 A;  3DPD A;  2PJH A;  4N9F 4;  3WA0 A;  3A9K B;  4XC2 A;  2J7Q B;  3PT2 B;  2NBW B;  4HXD A;  4W9L A;  1RAX A;  4WJN A;  2NR2 A;  3VTU A;  1M94 A;  2AL3 A;  4BKG A;  3RUL A;  2RSU A;  3JW0 X;  4WWN A;  1WXM A;  2EMT A;  1WH3 A;  1L2N A;  4K7S A;  2BPS A;  2MA9 B;  4MEM A;  4HCP B;  3H6N A;  3R3M A;  1VD2 A;  5LLI A;  3DBS A;  4A20 A;  3LJ3 A;  1EF5 A;  2KFJ A;  4DBG A;  3V6E B;  3TIX A;  1WE6 A;  3DQV A;  1MG8 A;  3KUC B;  4MJS B;  2DYO A;  5HKH A;  4GGQ A;  1E8X A;  4A3O A;  2N1V A;  3RUI B;  2M8S A;  2DYM A;  2PEA A;  2ZPY A;  5D94 A;  2K8C A;  4B9K A;  2Y5B B;  1NI2 A;  1VCB A;  2C7N B;  2NPT B;  3A1Q B;  2YVC A;  4II2 B;  4AJW A;  4ZRK A;  2MWS B;  2D2Q A;  3Q3J A;  3BIN A;  4IWO A;  1U4A A;  2K25 A;  2KVR A;  4G11 A;  2JY6 A;  3N3K B;  4W9G A;  2VRR B;  3EEC A;  4BKS A;  1Y8R C;  3ECI A;  1UEL A;  2KTR B;  1YJ1 A;  3CST A;  3IBE A;  1UD7 A;  4JQW C;  2JF5 A;  4AP4 C;  3AXC A;  2K39 A;  4AUQ C;  3AUL A;  2FCN A;  2LVP A;  1NDD A;  2G4S A;  3MTN B;  3A9J B;  2KO3 A;  2KNB A;  2DZM A;  2IYD B;  5CHV C;  4GSW A;  3VHT C;  1T0Y A;  4W9H A;  4JLC A;  1UBI A;  3V60 A;  2MCN B;  1WGY A;  2ZZP B;  1E8Z A;  2KC2 A;  2ASQ A;  3IG3 A;  4FHK A;  3UIN B;  2N7E A;  1WJN A;  2KFK B;  2RD0 A;  4BVU C;  2IBI B;  3WAO A;  4ANV A;  2EKE C;  2WX1 A;  1KJT A;  5CHW A;  2ZCC A;  2KKC A;  1LQB A;  3DCG A;  4FLH A;  2DZJ A;  4FJV B;  1WXS A;  3U8Z A;  5DCN A;  1P9D U;  2V3S A;  3SU8 X;  1BT0 A;  3EFU A;  2DZK A;  4KVG B;  2RGF A;  2HE7 A;  5D6J B;  4NJ6 A;  4EZK A;  3A33 B;  2DAJ A;  1XQQ A;  2NS5 A;  2OJR A;  1WMH B;  4WJO A;  3TBL D;  2LJ5 A;  1WF9 A;  3ONS A;  4ANU A;  1GUA B;  2LVQ A;  2LRW A;  1WX8 A;  2IO1 B;  4KIK A;  2K8H A;  2ZPN A;  1H4R A;  3OJ3 A;  2NBV B;  3RZF A;  4FA6 A;  2KMC A;  5E6P A;  3VTW A;  4B95 A;  3GOE A;  1TTN A;  2BF8 B;  3Q3F A;  1E8W A;  3N32 A;  3NOB A;  1P0R A;  2C5L C;  2IO3 B;  2J0M A;  4MGY E;  2I1K A;  2NBU A;  2AYO B;  2UYZ B;  4NAW A;  2BGF A;  3OAW A;  4K81 A;  1UZX B;  4FJY A;  1V80 A;  1EF1 A;  2K6D B;  2LXA A;  4RMA A;  4WQO B;  3H1U A;  3VVW B;  1NBF C;  2C60 A;  2N9E B;  2KWV B;  3IFW B;  3PRM B;  2KJR A;  1EO6 A;  1OTR B;  5JZE B;  1WX7 A;  4KZC A;  3TMP B;  2KTF A;  4CYE A;  1OGW A;  2MLB A;  2CHZ A;  4II3 B;  3QC8 B;  3L08 A;  5AZH A;  5D7G A;  1C1Y B;  1V9J A;  1WR1 A;  5JHB A;  2N7D A;  2PE6 B;  4ZDV A;  3JSV A;  3R66 C;  1OEY J;  2JRH A;  1XT9 B;  4FUL A;  1V6E A;  4PYU A;  1WZ3 A;  4ZYN A;  2ZCB A;  1V81 A;  2FID A;  4FN2 A;  5C23 A;  2MP2 A;  1WGH A;  4DHJ D;  3KUD B;  1HE8 A;  1E90 A;  2JZZ A;  4W9C A;  3ZNZ B;  2NVU I;  2RPQ A;  4WJQ A;  5JH5 C;  1K8R B;  2C7H A;  2B3A A;  1JRU A;  2HJ8 A;  3ML8 A;  2C7M B;  3RCZ A;  4HVB A;  4B6W A;  5J17 A;  3VXW A;  2JUO A;  2JT4 B;  2KDB A;  3ENE A;  2GBR A;  2ZVN A;  1WY8 A;  2RR9 A;  2A4Z A;  3QHT A;  3QAR A;  4GIV A;  1G6J A;  3ZO5 B;  2IO0 B;  1KOT A;  2J0K A;  1E8Y A;  3MJW A;  2GOW A;  3ZRC A;  1RLF A;  2WYQ A;  3LDZ E;  4ANX A;  3PLU A;  4ASW C;  4PS8 A;  4I6N B;  3QWZ B;  4OVV A;  5LXH A;  2AEH A;  3A9J A;  3VUY A;  4MH0 E;  5DPT A;  1SGH A;  3PSE B;  3V62 A;  3VUX A;  3VTV A;  3VUW A;  2QHO A;  1E5W A;  1KLV A;  4KV2 A;  4EOY A;  2R2Q A;  2ZNV B;  1V49 A;  2L00 B;  3K9P B;  3M3J A;  1E7V A;  4M8M A;  2JXX A;  3T9L A;  5KHO A;  4LDT D;  2O2V B;  2KHW B;  4NQL B;  1QZE A;  3PHX B;  4G50 A;  2KZR A;  4GU2 A;  4BKT A;  1D3Z A;  1WGG A;  1V5T A;  1S1Q B;  2XEW A;  3NZU A;  4I6L B;  4KSL C;  1RRB A;  5L95 C;  4YL8 A;  5E6N A;  4E3C A;  3X23 A;  2JRI B;  3OLM D;  1V86 A;  2KWU B;  2I1J A;  4IW0 A;  3ZTC A;  2BWE S;  2KDI A;  3PTF C;  1PQS A;  2M17 A;  2GBM A;  2WX0 A;  4W9F A;  1ISN A;  3PRP B;  2LXC A;  3PPA A;  4F7Z A;  2HTH A;  4GMV A;  2KX3 A;  1LFD A;  2MBO A;  2KQ7 A;  5CHF A;  3ZRF A;  4EEW A;  3HM6 X;  3QQ8 B;  2MSE D;  2BYE A;  3SDL C;  2IY1 B;  1WXV A;  3ZUN A;  1R4N I;  4BBN C;  2KDF B;  4FAD A;  4P7I A;  2ZVO A;  2MP2 B;  2N4F A;  2GBJ A;  2FCM A;  4HPL B;  1SIF A;  4EUT A;  5C1Z A;  4GDK A;  3JVZ X;  1WGR A;  3DBR I;  5LXI B;  2WWZ A;  2KX0 A;  5FR6 A;  1L7Y A;  1P1A A;  2L76 A;  5GMV A;  5AEK B;  4RM9 A;  4W9E A;  1E7U A;  4PS3 A;  2XK5 B;  1ZW7 A;  2XK5 A;  3A9K A;  2G4D B;  3ZLZ A;  5DPS A;  2EMS A;  3L54 A;  3S2A A;  1Q1O A;  4FJZ A;  1TGZ B;  3D32 A;  3MHS D;  4RM8 A;  3ZDM C;  2M0X A;  3DOW A;  5DPR A;  3UGB B;  5CX3 A;  3U7D A;  1SE9 A;  5E6O A;  1RFA A;  3DBH I;  4MSM B;  1J0G A;  3ZNH B;  4XX5 A;  2J0J A;  2AL6 A;  2CS4 A;  4TV3 A;  2IO2 B;  4BBN F;  2DEN B;  4GDK B;  4CHK A;  2MRP A;  3ZDT A;  2O6V B;  3VFK A;  1GC6 A;  2DAF A;  2MBB B;  3BY4 B;  3W1Y A;  4DDI D;  1IP9 A;  4GN1 A;  4W9I A;  4AJY B;  1GG3 A;  2JPH A;  2WDT B;  2ZNV C;  2D3G A;  4X57 B;  5IAA C;  2Z59 B;  4KSK C;  1FXT B;  3PRE A;  2CR5 A;  2LWP A;  4HK2 A;  1I35 A;  1V5O A;  1A5R A;  3SHQ A;  2FNJ B;  4WWO A;  3DVN V;  3PVL A;  3SD5 A;  4IWP A;  3GZN I;  3WIM A;  3QA8 A;  3VDZ A;  2MBE A;  5BO4 B;  2KQS A;  5AZG A;  2HD5 B;  3L16 A;  1C3T A;  1WZ0 A;  2G45 B;  4EZJ A;  2FUH B;  4WAA A; 
#chains in the Genus database with same CATH topology
 3W2D A;  3R7R A;  4YTP B;  4URK A;  3TJP A;  3DVG X;  3H7P B;  4OHJ A;  3N30 A;  1R4N B;  2BB6 A;  2K1F A;  1WMH A;  3BK2 A;  1WRI A;  4FXC A;  4NJ7 A;  4IWQ A;  4MEL A;  4IM0 A;  3H7P A;  4F1S A;  5TR5 A;  1TKG A;  4FBJ B;  5BMG A;  4E71 A;  3VQI A;  1K53 A;  2JYE A;  2KTR A;  3DDC B;  4HCN B;  3JYU A;  2ICI A;  2INC C;  5J2R A;  2W82 A;  2Q5W D;  1QKZ A;  1OQY A;  5D2M B;  2LGD A;  1Z5S B;  3B2G A;  3M95 A;  1WFY A;  2K3U A;  1A70 A;  2Y5C A;  5LNK 1;  3WAM A;  2YEP F;  4HKZ E;  3UQA A;  3UIO B;  1IPG A;  1SXT A;  4KGS A;  1KFY B;  1JCK B;  1TZ1 A;  1QOA A;  4AOF A;  4C80 A;  4OZA A;  2MBQ A;  3B08 A;  3I9V 1;  3IAM 1;  3VR8 B;  2FAZ A;  3URY A;  2Z0D B;  1QF6 A;  1GNU A;  1FO4 A;  1WXA A;  1NEK B;  3P42 A;  5IP4 D;  2V4I B;  4KDL B;  2WLB A;  3CSF A;  1SF0 A;  2VZK B;  2W9N A;  1XD3 B;  2WXQ A;  1YX6 B;  3APF A;  3QJZ A;  2PMV A;  1SSN A;  2KAN A;  3UF8 A;  2Y3A A;  2LUM A;  4DDG D;  2FCS A;  3QCA A;  1UNS A;  2RDG A;  3A4R A;  4NAW B;  2MQJ A;  4HDQ A;  3R8B A;  2PW9 A;  3KVF B;  2QDF A;  5L83 A;  1YQB A;  2O2V A;  2CU3 A;  4LJP B;  1OFF A;  3TCA A;  1YOV B;  2N9X A;  2X38 A;  4GDL B;  2DHZ A;  3P63 A;  2REX A;  2V9H A;  3ZW3 A;  2LFI A;  1E9M A;  2WDQ B;  3C0R B;  4ZRI A;  2KWD A;  1X1M A;  2L05 A;  1WYW B;  4W9D A;  4M8N A;  5T8I A;  4EE2 A;  2JWZ A;  4MSQ B;  4K1R B;  1FFU A;  1HZ6 A;  1L4D B;  4C56 C;  2BKR B;  2KLC A;  1E0Z A;  1C4A A;  2PPH A;  2K0P A;  1ZXH A;  2NPT A;  2I38 A;  4LCD E;  3DHH C;  1OEY A;  3GE8 C;  1BXT A;  1ZGU B;  2RMM A;  1FD6 A;  3GP7 A;  3SR6 A;  3NRZ A;  1T6B X;  1F2R C;  2MBH A;  4M00 A;  1HXY D;  4HEA 1;  4E74 A;  3L0W B;  3UI3 A;  1T5X D;  4JE3 B;  1EU4 A;  2L0T A;  3H7S A;  4MM3 A;  2GRI A;  4IM3 A;  5C3J B;  1XEE A;  1QT9 A;  1YX5 B;  4ANW A;  3UQB A;  4LJO B;  3RT3 B;  1OQR A;  1JWU D;  2KMA A;  4MGI E;  1OQQ A;  3HVD A;  3E56 A;  1MG4 A;  4PK1 A;  4HXD A;  3VTU A;  2NR2 A;  3ABV B;  3JW0 X;  2EMT A;  2I2Y A;  2MA9 B;  3N1Y C;  4A20 A;  1WE6 A;  3KUC B;  3P4S B;  4KKJ A;  2NTT A;  5HKH A;  4B0M A;  2PEA A;  3AE7 B;  4B9K A;  4LNI A;  3EGR A;  1NI2 A;  3DBR B;  1VCB A;  2C7N B;  2NPT B;  5EE0 A;  2D2Q A;  2LHE A;  1U4A A;  4G11 A;  1PUT A;  4BKS A;  3N1Z C;  1UEL A;  3CST A;  3IBE A;  1UD7 A;  2JF5 A;  4AUQ C;  2DBY A;  3AUL A;  1SE3 A;  2FCN A;  1T3Q A;  2LVP A;  2MJ3 A;  3A9J B;  2DZM A;  2IYD B;  4K3C A;  2ON8 A;  3VHT C;  2WXR A;  4W9H A;  3AMZ A;  4JLC A;  4ZHP A;  2WXF A;  3IG3 A;  4OZC A;  3VRA B;  1IBX A;  1KJT A;  4KGT A;  2DZJ A;  1KLG D;  1FNW A;  5DCN A;  1F1H A;  2SEB D;  3NG0 A;  1P9D U;  4RGT A;  3L4P A;  3P4P B;  3EFU A;  5D6J B;  3KLS X;  2IGH A;  4ACF A;  3MHZ A;  2OJR A;  3CIR B;  4YSY B;  1WF9 A;  1NEN B;  2LRW A;  3U52 E;  1QOG A;  2ZPN A;  1H4R A;  4FA6 A;  1AW7 A;  1Y56 A;  1RFK A;  3NOB A;  2C5L C;  2NBU A;  2UYZ B;  4K81 A;  1EF1 A;  4WQO B;  2KWV B;  4A6Q A;  3BWU D;  1SJH D;  1UF0 A;  2MLB A;  5AZH A;  1NYQ A;  1WR1 A;  2N7D A;  4ZDV A;  1HEZ E;  3JSV A;  1UGJ A;  2J42 A;  4PYU A;  1JRO A;  1WZ3 A;  4JWU C;  1L6V A;  4FN2 A;  5EE3 A;  4DHJ D;  4NAM A;  1HE8 A;  3N20 C;  4RGO S;  3U4E G;  1FRD A;  3DBH B;  1AYF A;  3GS2 A;  4WJQ A;  1K8R B;  2C7H A;  1JRU A;  5J17 A;  4B6W A;  3VXW A;  1I4X A;  1WWT A;  2JQR B;  2GBR A;  1G6J A;  2A4Z A;  3QHT A;  3ZO5 B;  1TS4 A;  3Q8E A;  2GOW A;  1RLF A;  1V8C A;  4I6N B;  3A9J A;  3VUY A;  1V1P B;  1UWX A;  1ET9 A;  1SGH A;  1L6U A;  1WYG A;  1VZ6 A;  3K9P B;  3ETR A;  2JXX A;  3T9L A;  5AUI A;  5KHO A;  4LDT D;  2KHW B;  2BQQ A;  2HJ1 A;  2JYT A;  4KX6 B;  4HJG E;  5E6N A;  3OLM D;  2I1J A;  2PLP A;  3ZTC A;  2INN E;  3EA6 A;  1LFD A;  2MBO A;  2KQ7 A;  3ZRF A;  2WXP A;  4EEW A;  3FIL A;  3QQ8 B;  2MSE D;  2BYE A;  1T0R C;  3RNF C;  4BBN C;  2KDF B;  4P7I A;  1FM0 D;  2ZVO A;  4XDC A;  2GLS A;  5HG2 A;  4GDK A;  3BK1 A;  2MHJ A;  2KX0 A;  1K51 A;  1L7Y A;  2L76 A;  4ARC A;  4L23 A;  3T3O A;  4WH4 A;  1E7U A;  3MC9 A;  1ZW7 A;  1T0Q C;  3A9K A;  5DPS A;  1WGK A;  2JWU A;  1EM7 A;  3IAS 1;  1SBB B;  3DOW A;  5E6O A;  2D3A A;  1UUP A;  2J0J A;  4BBN F;  3ZDT A;  2O6V B;  1GC6 A;  2DAF A;  2L32 A;  3W1Y A;  2UU7 A;  4W9I A;  3IXS A;  2WDT B;  3KWL A;  2Z59 B;  1SIJ A;  2CR5 A;  1I35 A;  2WS3 B;  5TSS A;  1PGA A;  3C19 A;  4WWO A;  4MAC A;  2FUG 1;  3BYY B;  3WIM A;  2HD5 B;  3L16 A;  4WAA A;  1K50 A;  4S0R A;  1ENF A;  1P98 A;  4BZA A;  1WR6 E;  4DHZ B;  4W9J A;  2BS3 B;  4IC7 B;  4MDK E;  4TKN A;  5JZE B;  1ZKH A;  1JQ4 A;  3HHM A;  4I6P A;  4BOZ B;  2FIF A;  3V61 A;  4BFR A;  4Q2J A;  3AE5 B;  3H8H A;  3U2S C;  2ZW1 A;  4ZHO A;  2WXH A;  2PVG C;  4W9K A;  4ZOH C;  4PT5 A;  1I42 A;  2ZEQ A;  3RNB C;  1KLU D;  4J6I A;  2YLM A;  4M0W B;  2KJH B;  2WXO A;  2KN5 A;  4TQ1 A;  3DWM A;  3CMM B;  2PVO D;  5BMI A;  4NQK E;  1QIL A;  3EFC A;  3VAW A;  4GB9 A;  4DWF A;  1C9F A;  2KAC A;  1NI3 A;  3AEC B;  1NYR A;  2GBN A;  2AWT A;  1XLO A;  3X0W A;  1LO5 D;  2DZI A;  1V2Y A;  4TSS A;  5HI1 A;  3RNE C;  3M63 B;  1MJD A;  4QAY A;  4OW0 A;  3NHE B;  2LUE A;  3WAP A;  2GB1 A;  2QIE B;  1ESF A;  3AEB B;  3JSV B;  4TQ0 A;  1DOI A;  2V3N A;  4JX1 C;  1J19 A;  1WE7 A;  3PLV A;  4IDI A;  1P7F A;  1ZDV A;  4ZRJ A;  2LI5 A;  2V4L A;  5IO9 A;  4HLE A;  3RD2 A;  1AWD A;  2YEP B;  3DHG C;  2MJD A;  1IGD A;  4A55 A;  3QK0 A;  4M01 A;  1YJI A;  4LTU A;  1N6Z A;  3AM9 A;  3ZNI D;  1TKE A;  2H89 B;  1Z2M A;  4JIO U;  1LM8 B;  3BYT B;  2N9L A;  2XBB C;  3V3X A;  1L4Z B;  3Q69 A;  2MW5 A;  5IA7 A;  1QOB A;  3SEB A;  2BKF A;  3A1Q A;  2GBK A;  3AI5 A;  5G55 A;  4MGZ E;  3FAH A;  3GZN B;  2ZW0 A;  4RGM A;  1ZE3 D;  4JL9 A;  4HPP A;  1I4P A;  4OVU A;  3VH3 B;  2WP9 B;  4EZL A;  4HKQ A;  5EDS A;  4WUR A;  1CMX B;  2DNF A;  2WU5 B;  2G9H D;  4RGN A;  4J3O D;  4K7W A;  3H9D A;  2K8B A;  1GJZ A;  2IY0 B;  2JVC A;  3L10 B;  3HK0 A;  4D2K A;  5BYS A;  1JWB D;  1WJ6 A;  4PS7 A;  2AQ2 B;  4G3X B;  2L7R A;  3KW5 B;  4WWM A;  2N0S B;  2WU2 B;  3A9K B;  3PT2 B;  2NBW B;  4H2A A;  1RAX A;  4BKG A;  1M94 A;  2AL3 A;  2QJL A;  3RUL A;  2VH1 A;  1WH3 A;  3AH7 A;  4HCP B;  3H6N A;  3R3M A;  5GXG B;  1VD2 A;  1XLQ A;  3V6E B;  1PGX A;  2W54 A;  3TIX A;  4WAF A;  4MJS B;  4GGQ A;  2M8S A;  2ZPY A;  5D94 A;  2K8C A;  3IT6 B;  1JML A;  1V1O A;  4II2 B;  4AJW A;  4ZRK A;  4IWO A;  2K25 A;  5G5G A;  2ACZ B;  4W9G A;  3EEC A;  3E9S A;  5E6J A;  3I5J C;  1NVI D;  2KTR B;  1YJ1 A;  4JQW C;  2LJI A;  5MPO A;  2K39 A;  3HUI A;  3MTN B;  1D5Z C;  3MC8 A;  2L83 A;  3AED B;  2HDE A;  2VH2 A;  4HRS A;  3V60 A;  1WGY A;  3UIN B;  1V1P A;  4XWW A;  2WX1 A;  5CHW A;  4FJV B;  1WXS A;  2R61 A;  2J52 A;  2DZK A;  2RGF A;  3GB1 A;  1XQQ A;  5FK9 C;  2NS5 A;  3SFD B;  4WJO A;  2LJ5 A;  2XN9 C;  2IND C;  2LVQ A;  2IO1 B;  3O13 A;  3Q14 C;  4YTN B;  3RNG C;  3VTW A;  4B95 A;  1ZDX A;  2GI9 A;  3GOE A;  2BF8 B;  1E8W A;  1FIQ A;  3B9J A;  1TJE A;  4NAW A;  4M0W A;  3OAW A;  1I4H A;  1UZX B;  1C4P A;  4FJY A;  1V80 A;  2W3R A;  1T0S C;  3VVW B;  1EO6 A;  3B2F A;  4KZC A;  3TMP B;  1L0V B;  3WCQ A;  1SEB D;  2RDB C;  3QC8 B;  3KQ4 A;  1MHH E;  1C1Y B;  5I4D A;  4TMA B;  5JHB A;  1JRP A;  4WIP A;  1V6E A;  4ZYN A;  3BVM A;  1E90 A;  2NVU I;  2RPQ A;  2B3A A;  2HJ8 A;  3OWE B;  1VJK A;  3MJW A;  3Q8F A;  3ZRC A;  2WYQ A;  4ASW C;  2AEH A;  5DPT A;  4C7Z A;  3V62 A;  3VUX A;  3Q8B A;  3Q6B A;  1KLV A;  2QIL A;  2ZNV B;  3M3J A;  3V05 A;  2JSV X;  1XLN A;  1JWM D;  4GU2 A;  2H88 B;  1V5T A;  1S1Q B;  1M4V A;  4KSL C;  1RRB A;  5L95 C;  1DYQ A;  3RI7 C;  4R3D A;  2BWE S;  2KDI A;  1RWS A;  2M17 A;  3P4Q B;  1C4C A;  1VZ8 A;  1ISN A;  3DHI C;  4LNO A;  2HTH A;  2KX3 A;  1YQ4 B;  4KGR A;  2BS4 B;  3KWV A;  1L0X B;  3SDL C;  3T3N A;  3AE8 B;  2FCM A;  4HPL B;  1SIF A;  1ZP0 B;  3JVZ X;  3VR9 B;  3DBR I;  1TZO A;  2KN4 A;  1TT5 B;  1P1A A;  1VR9 A;  4RM9 A;  4P16 A;  2XK5 B;  2XK5 A;  3ZLZ A;  3S2A A;  3TEW A;  4IOI E;  1TGZ B;  3MHS D;  3ZDM C;  5DPR A;  4ARI A;  3AEF B;  4HRO A;  1XCQ L;  1TS5 A;  1SE9 A;  1J0G A;  1SE4 A;  1ET6 A;  3TEX A;  2LMC A;  5FR3 A;  3NJT A;  2AL6 A;  4TV3 A;  2DEN B;  4N6E B;  2MRP A;  1JAL A;  1IP9 A;  4GN1 A;  2JPH A;  2ZNV C;  2D3G A;  4X57 B;  2Z8L A;  2LWP A;  3SHQ A;  2FNJ B;  3SD5 A;  4IWP A;  4DXF A;  2MBE A;  5BO4 B;  2KQS A;  4A8X C;  1WZ0 A;  3HVZ A;  1D6E C;  4JPS A;  1YD8 U;  4JGH B;  2OED A;  2KFK A;  3IVF A;  2M4N A;  2G3Q B;  3N9Y C;  3PHW B;  3TL5 A;  2BYV E;  1R4M I;  3BVZ A;  2DWQ A;  4LDT B;  5H8Y E;  3DVN U;  4ICU A;  1UBQ A;  3RFZ B;  4EKU A;  2IZV B;  1VZ7 A;  3AU4 A;  1FFV A;  4KDI C;  2D11 A;  1WI0 A;  3DVG Y;  4LK0 M;  2KWC A;  2OJW A;  3W5U B;  1KRH A;  5CTR C;  3O65 B;  1XO3 A;  2PE9 A;  1J8C A;  5AZF A;  3APC A;  4RF0 A;  1CQV A;  2TSS A;  4XZ4 A;  1FNV A;  1WM2 A;  3UIP B;  1FCC C;  3QX1 A;  1EUV B;  3VH4 B;  1KM7 A;  1WJU A;  5J18 A;  3T8M A;  2KT7 A;  2N9P C;  5C2T B;  1GOZ A;  3W1S A;  1LGR A;  3OJ4 B;  2NCN A;  2LVO A;  1ACC A;  3NY5 A;  3U30 A;  3C8Y A;  2KOX A;  3L13 A;  2WDV B;  3KUZ A;  2J53 A;  3ALB A;  3RZW C;  1YIW A;  3KYC D;  1TBE A;  4P1B C;  2BT6 A;  2E3T A;  3R2T A;  1C78 A;  4N58 A;  2M0A A;  4MH8 A;  2KDE B;  2M56 B;  3HM3 A;  5DPW A;  2CKH B;  3P4R B;  5H92 C;  3AEA B;  1R4M B;  4NJC A;  2DX5 B;  1WRD B;  1KH0 A;  1BUI C;  3R7Q A;  1HTQ A;  3NVV A;  2KC1 A;  3B1L X;  2FCQ A;  4DHZ E;  3KH0 A;  4DQO C;  5D3I B;  2D07 B;  2GMI C;  3AE9 B;  1MI0 A;  2L1A A;  4HJK A;  2QMT A;  3AE3 B;  2JZ3 B;  4WJP A;  4DK5 A;  2LD9 A;  1L5P A;  2PKO A;  3Q3N C;  2BYF A;  2KJ6 A;  3NZS A;  3EHV A;  3ZXV A;  3I57 A;  5D3D A;  1UH6 A;  3AN1 A;  4GOC A;  1IYF A;  2K9X A;  1ZXI A;  1MVK A;  2RPV A;  2UWQ A;  1C76 A;  2CHW A;  2ZJD A;  1UGM A;  3BVG A;  1H8C A;  2W3S A;  4BOS C;  2E6X A;  3KYD D;  3V6C B;  3NS1 A;  4YT0 B;  1FXI A;  2G1E A;  5IOI A;  3ZJT A;  4MGK E;  4UDU C;  2BS2 B;  3ML9 A;  2WXN A;  3EUB 2;  2FE8 A;  3DBL I;  4GDL A;  4WWP A;  5JHA A;  1PFD A;  2DLB A;  3M62 B;  2LZ6 A;  2R2O A;  3AE6 B;  3PGE A;  2J4X A;  3ZTD A;  2WGS A;  3AB5 A;  2WXG A;  3AU5 A;  3ZGZ A;  1C79 A;  2L3Z A;  2MX2 A;  4XGA B;  2INP E;  1P7E A;  1B9R A;  2JX5 A;  2KD0 A;  4ZRP A;  4XC2 A;  4W9L A;  4F7Z A;  1F77 A;  1JWA D;  4WWN A;  3RNA C;  1WXM A;  4RNA A;  4MEM A;  2KFJ A;  5HHD G;  3DQV A;  1E8X A;  1CZP A;  3AV8 A;  1IBX B;  2Y5B B;  1HTO A;  2YVC A;  2MWS B;  2KVR A;  3TEY A;  2VRR B;  3ECI A;  1E10 A;  1JWS D;  3AEG B;  4AP4 C;  3AXC A;  4XDD A;  4NZL B;  1NDD A;  2G4S A;  2KO3 A;  4O1N A;  1FPY A;  3TSS A;  3NZ3 A;  4GSW A;  1T0Y A;  2WDR B;  3Q8C A;  1UBI A;  3MFG A;  4ITK A;  2ZZP B;  2N7E A;  2WXM A;  3Q3M C;  2RD0 A;  1PGB A;  2IBI B;  4ANV A;  2ZCC A;  2KKC A;  4US9 A;  3DCG A;  2ONQ A;  3U8Z A;  2N9K A;  2V3S A;  3SU8 X;  4KVG B;  3N1X C;  2HE7 A;  4EZK A;  2WXJ A;  1WMH B;  3TBL D;  2Y5P A;  3ONS A;  4ANU A;  1QQR A;  2PTL A;  1N63 A;  4KIK A;  1SE2 A;  2K8H A;  4JWS C;  2BBC A;  2NBV B;  1RM6 C;  1FMA D;  3AE4 B;  4MGY E;  3ZQ4 A;  1VLB A;  1J7A A;  2K6D B;  2LXA A;  4RMA A;  2KYW A;  1N61 A;  1NBF C;  2C60 A;  3IFW B;  3PRM B;  1OTR B;  1AN8 A;  2CHZ A;  4II3 B;  3L08 A;  1N5W A;  3MJ5 A;  3MC0 B;  1DGJ A;  5D7G A;  4LNK A;  2WXK A;  3IT4 B;  3R66 C;  2JRH A;  1XT9 B;  4LLG M;  4FUL A;  2IPK D;  4ZRQ A;  5BMH A;  2ZCB A;  2FID A;  5C23 A;  2MP2 A;  2BYT A;  2JZZ A;  1I4Q A;  4W9C A;  3ZNZ B;  3W5V B;  3ML8 A;  4OZB A;  2AQ3 B;  1GB1 A;  2JUO A;  2JT4 B;  1KTK A;  2KDB A;  3ENE A;  1XCT L;  3QAR A;  2ZVN A;  1B1Z A;  2RR9 A;  4GIV A;  2IO0 B;  1E8Y A;  3DWG C;  3PLU A;  4PS8 A;  2CJN A;  5LXH A;  3AE2 B;  3PSE B;  3VTV A;  3VUW A;  2QHO A;  2SAK A;  2KAJ A;  2EEL A;  4KV2 A;  1QLB B;  4EOY A;  2R2Q A;  2L00 B;  4USA A;  1E7V A;  3DBL B;  3GE3 C;  1CK1 A;  4NQL B;  4BKT A;  1WGG A;  3NZU A;  2MEK A;  3TUO A;  4YL8 A;  4YXD B;  3X23 A;  2KWU B;  3HRD D;  2WX0 A;  2GBM A;  3PRP B;  1QOF A;  2LXC A;  3PPA A;  4GMV A;  3AEE B;  5CHF A;  1N60 A;  3HM6 X;  4RFB A;  3Q2A C;  1MHX A;  1WXV A;  3ZUN A;  2QCZ A;  2MP2 B;  1XXG A;  5C1Z A;  2JXT A;  1WGR A;  5LXI B;  5GMV A;  4W9E A;  4PS3 A;  3BII D;  1XF5 L;  2G4D B;  2EMS A;  3L54 A;  3ZXR A;  2BW2 A;  2WXI A;  3UGB B;  2IGD A;  3U7D A;  1KF6 B;  4MSM B;  3I63 C;  3ZNH B;  4XX5 A;  2BTE A;  1CJE A;  3FKY A;  4YTM B;  1F0Z A;  2CS4 A;  2IO2 B;  4CHK A;  1TKY A;  3VFK A;  1YMH E;  4DDI D;  4RH6 A;  2V0G A;  2KQ4 X;  4AJY B;  1J7C A;  5IAA C;  4US8 A;  4KSK C;  1FXT B;  3PRE A;  4HK2 A;  5HFY A;  2LEK A;  1TYG B;  1HA5 A;  4ZYS A;  3DVN V;  3QA8 A;  1MPE A;  2D3B A;  1C3T A;  4XE0 A;  1N5X A;  4KKI A;  2G45 B;  4EZJ A;  2FUH B;  2MH7 A;  1ZUD 2;  1JW9 D;  2NMQ A;  3QAQ A;  1AAR A;  2OHF A;  3K9O B;  2C9W B;  2L8J A;  2A5U A;  1ZPS A;  4P1C C;  1WIA A;  2KLG A;  1WX9 A;  2L0F A;  2KMM A;  1TY0 A;  4G0N B;  3WAN A;  1XLP A;  4C7Y A;  1YN4 A;  2V3P A;  2WNM A;  4IM2 A;  1VDV A;  5BYR A;  3L17 A;  4MJS A;  3ZNG C;  3QIJ A;  2M1M A;  3IHP C;  1C77 A;  3HIZ A;  2BB5 A;  2KK8 A;  4MM3 B;  3PV1 A;  2DYB A;  2K22 A;  4A3P A;  3W9C B;  4K7U A;  2LAS A;  1Q0W B;  4KZ0 A;  4EFO A;  3U7Z A;  2K6Q A;  1WJ4 A;  2RDH A;  1Q5W B;  2MJE A;  1GC7 A;  1FCL A;  3WAL A;  3ZVV A;  4OVZ A;  4IG7 B;  4GXB A;  1LXD A;  4NY0 A;  1FNU A;  3CF6 E;  2V1Y A;  3A4S C;  2CHX A;  4BKS D;  1VRA B;  2O6V A;  5G5H A;  4L1B A;  4DHJ B;  3Q3O C;  1RYJ A;  1HZ5 A;  3PRZ A;  4FHJ A;  4HDO A;  1E6E B;  3MP9 A;  4ICV A;  1TS2 A;  2LGX A;  3NVW A;  4PYZ A;  3W1S C;  4AS1 A;  4AWJ A;  2AX5 A;  3I3T B;  3TEZ A;  4C4V B;  4CO7 A;  3P2B A;  3PZD A;  4YSX B;  3B0A A;  4A9A A;  3PZ8 A;  3SFE B;  3RPF C;  3EC8 A;  2N1W A;  1S3S G;  1TIF A;  3PS6 A;  3AE1 B;  4CQN A;  1F9J A;  4P6V F;  2Z0E B;  1WGD A;  1WM3 A;  5IKC M;  5KHQ A;  4S17 A;  4NPN A;  4TUU A;  2QEJ C;  2WXL A;  1DOY A;  4N59 A;  2D10 A;  3APD A;  2KXJ A;  1V97 A;  1GB4 A;  3ZIM A;  1FXA A;  5G2N A;  2IDY A;  2LGY A;  2OOB B;  2N7J A;  4HPM B;  5IN7 A;  4A90 A;  1GAQ B;  1TS3 A;  4KIK B;  2LHD A;  3NS8 A;  1P3Q U;  3ZKJ C;  1EWY C;  1SB3 C;  1WXQ A;  4NNJ B;  4F8C B;  4IUM B;  1PYW D;  3RYT A;  2CU1 A;  1MFW A;  3NVY A;  1SJE D;  2LRU A;  2AQ1 B;  2O6V D;  2BWF A;  4HWI B;  3DPD A;  2PJH A;  4N9F 4;  2LGI A;  4WQM A;  3WA0 A;  4YWG G;  2J7Q B;  4DXA B;  4WJN A;  2RSU A;  3LB8 C;  1L2N A;  4K7S A;  2BPS A;  2NTS A;  5LLI A;  3DBS A;  3LJ3 A;  1EF5 A;  4DBG A;  2D5G A;  4K3B A;  1MG8 A;  3ZJU A;  2DYO A;  4C4V A;  1I4R A;  4A3O A;  2N1V A;  3RUI B;  2DYM A;  2WHI A;  3A1Q B;  2X8X X;  3Q3J A;  3BIN A;  4XYC A;  2JY6 A;  3N3K B;  4B0E A;  1Y8R C;  1TY2 A;  2KNB A;  3VRB B;  5AUK A;  5CHV C;  1D5X C;  2IGG A;  2MCN B;  1E8Z A;  2KC2 A;  2ASQ A;  1K52 A;  4FHK A;  1WJN A;  2KFK B;  1DOX A;  4BVU C;  3WAO A;  2EKE C;  2IJ0 A;  1LQB A;  4FLH A;  1ROE A;  1BT0 A;  2HTM E;  3PO0 A;  4M02 A;  1BML C;  4NJ6 A;  3A33 B;  2DAJ A;  3RNC C;  3CWI A;  1GUA B;  1D5M C;  1WX8 A;  1I7H A;  3OJ3 A;  3RZF A;  5BYQ A;  2KMC A;  5E6P A;  1TTN A;  3Q3F A;  3N32 A;  1P0R A;  2IO3 B;  2J0M A;  1J7B A;  3LXF A;  2I1K A;  2AYO B;  1HQR D;  1YN5 A;  2BGF A;  4DXG A;  3H1U A;  5JXV A;  1E7P B;  2N9E B;  2KJR A;  1D4B A;  1WX7 A;  4C00 A;  2KTF A;  4IKG A;  2BVC A;  4CYE A;  1OGW A;  3PZ7 A;  1STE A;  3P1M A;  1V9J A;  2PE6 B;  2D3C A;  1OEY J;  2XNA C;  3FIL B;  4YSZ B;  2VZK D;  2EKI A;  3RN9 C;  1V81 A;  1WGH A;  3KUD B;  2JZP A;  3J9C A;  4LNF A;  2W55 A;  5JH5 C;  3RCZ A;  2C7M B;  4HVB A;  1WY8 A;  1KOT A;  2M19 A;  2J0K A;  3LDZ E;  2JU6 X;  4ANX A;  1UWM A;  4XWT A;  1IGC A;  2L52 A;  3QWZ B;  4OVV A;  4MH0 E;  2LGS A;  1YNT E;  1I4G A;  3RMK C;  1E5W A;  5FKA C;  1V49 A;  4RCO A;  4M8M A;  2O2V B;  1D3Z A;  1QZE A;  3PHX B;  4G50 A;  2KZR A;  5EE1 A;  4L2Y A;  2XEW A;  4I6L B;  2KVZ A;  1EWC A;  4E3C A;  1R7S A;  2JRI B;  1V86 A;  4IW0 A;  2WQY B;  1F52 A;  3BZD B;  3PTF C;  1PQS A;  4W9F A;  2QC8 A;  3Q8A A;  1F2R I;  3FC4 A;  2CJO A;  1Q10 A;  2IY1 B;  1R4N I;  4FAD A;  3ZJV A;  2N4F A;  2GBJ A;  2K5P A;  4EUT A;  1GPX A;  4REZ A;  2PIA A;  2B76 B;  2WWZ A;  5FR6 A;  5AEK B;  3OG5 A;  1N62 A;  1L0Y B;  1Q1O A;  1EU3 A;  4FJZ A;  4RF1 A;  3D32 A;  4BAX A;  1YN3 A;  1WSP A;  4RM8 A;  2QSD A;  1FEH A;  2M0X A;  5CX3 A;  1FRR A;  1ZOY B;  1RFA A;  3DBH I;  3NVZ A;  4GLS C;  4LNN A;  4GDK B;  3NUH B;  1YQ3 B;  2MBB B;  3BY4 B;  3R2I A;  4MT5 A;  1GG3 A;  2KDM A;  1IUE A;  1V5O A;  1A5R A;  4AQ7 A;  5EE9 A;  3PVL A;  1PDX A;  2FBW B;  3GZN I;  3LYY A;  3VDZ A;  5AZG A;  1YJJ A;  3ZYY X; 
#chains in the Genus database with same CATH homology
 1P98 A;  1YD8 U;  1WR6 E;  3QAQ A;  4JGH B;  4DHZ B;  4W9J A;  1AAR A;  3R7R A;  2KFK A;  3IVF A;  4URK A;  3TJP A;  2M4N A;  3DVG X;  3K9O B;  2G3Q B;  4IC7 B;  4MDK E;  4TKN A;  2C9W B;  1ZKH A;  2L8J A;  3H7P B;  2A5U A;  3HHM A;  3N30 A;  2FIF A;  3PHW B;  4I6P A;  2BYV E;  3TL5 A;  1R4M I;  3V61 A;  1WIA A;  2K1F A;  1WMH A;  1WX9 A;  2KLG A;  2L0F A;  4MEL A;  4BFR A;  4NJ7 A;  4IWQ A;  4IM0 A;  3H7P A;  4LDT B;  4F1S A;  3DVN U;  4ICU A;  1UBQ A;  5TR5 A;  4EKU A;  4FBJ B;  2IZV B;  3AU4 A;  4G0N B;  4KDI C;  3WAN A;  4E71 A;  3VQI A;  2D11 A;  1WI0 A;  3DVG Y;  4IM2 A;  2KWC A;  2KTR A;  4W9K A;  3DDC B;  3L17 A;  4HCN B;  3QIJ A;  4MJS A;  3ZNG C;  2M1M A;  3IHP C;  3HIZ A;  3JYU A;  5CTR C;  3O65 B;  1I42 A;  2ZEQ A;  2PE9 A;  2KK8 A;  4J6I A;  1J8C A;  5AZF A;  3APC A;  2YLM A;  5J2R A;  3PV1 A;  2DYB A;  4M0W B;  2KJH B;  4A3P A;  4XZ4 A;  1OQY A;  4K7U A;  2KN5 A;  4TQ1 A;  5D2M B;  1WM2 A;  3UIP B;  2LGD A;  3CMM B;  2LAS A;  3QX1 A;  1EUV B;  1Q0W B;  1Z5S B;  3VH4 B;  4NQK E;  3M95 A;  4KZ0 A;  1KM7 A;  1WFY A;  3VAW A;  1WJU A;  4EFO A;  3T8M A;  5J18 A;  2K6Q A;  4GB9 A;  4DWF A;  1WJ4 A;  3WAM A;  2N9P C;  3UQA A;  3W1S A;  1Q5W B;  3UIO B;  1GC7 A;  1IPG A;  3WAL A;  3ZVV A;  3OJ4 B;  2NCN A;  2LVO A;  2GBN A;  2AWT A;  3NY5 A;  1TZ1 A;  4IG7 B;  3U30 A;  3X0W A;  4AOF A;  4GXB A;  2KOX A;  3L13 A;  1LXD A;  2MBQ A;  2DZI A;  3B08 A;  1V2Y A;  3KUZ A;  4NY0 A;  2FAZ A;  3ALB A;  4BOZ B;  2Z0D B;  3CF6 E;  2V1Y A;  3M63 B;  3A4S C;  3RZW C;  1YIW A;  2CHX A;  3KYC D;  1TBE A;  1GNU A;  1WXA A;  4BKS D;  3NHE B;  2O6V A;  2LUE A;  3WAP A;  4DHJ B;  4KDL B;  3CSF A;  2KDE B;  3HM3 A;  3JSV B;  2CKH B;  5DPW A;  2W9N A;  4TQ0 A;  1XD3 B;  3PRZ A;  2DX5 B;  4FHJ A;  1YX6 B;  3APF A;  4HDO A;  3QJZ A;  1WRD B;  3R7Q A;  4ICV A;  2KAN A;  2KC1 A;  1J19 A;  3UF8 A;  1WE7 A;  3PLV A;  3B1L X;  4ZRJ A;  2FCQ A;  2LGX A;  2LI5 A;  2V4L A;  3KH0 A;  4DHZ E;  4PYZ A;  4DDG D;  2FCS A;  3W1S C;  4DXA B;  3QCA A;  4AWJ A;  4HLE A;  2D07 B;  3A4R A;  2GMI C;  4NAW B;  3RD2 A;  2MQJ A;  4HDQ A;  3I3T B;  4CO7 A;  3P2B A;  3QK0 A;  3KVF B;  4HJK A;  3PZD A;  2JZ3 B;  3B0A A;  5L83 A;  1YQB A;  2O2V A;  4WJP A;  4LJP B;  2LD9 A;  3EC8 A;  3TCA A;  2N9X A;  4DK5 A;  2N1W A;  1S3S G;  4GDL B;  3PS6 A;  2DHZ A;  3ZNI D;  1Z2M A;  2REX A;  3ZW3 A;  2BYF A;  2KJ6 A;  4JIO U;  3NZS A;  1F9J A;  3EHV A;  1LM8 B;  2Z0E B;  1WGD A;  1WM3 A;  5KHQ A;  3C0R B;  4NPN A;  1UH6 A;  4ZRI A;  4GOC A;  1IYF A;  2XBB C;  4TUU A;  1X1M A;  2L05 A;  1WYW B;  4W9D A;  4M8N A;  2JWZ A;  2MW5 A;  2UWQ A;  2CHW A;  2ZJD A;  4MSQ B;  1UGM A;  5IA7 A;  4K1R B;  2D10 A;  1H8C A;  2BKR B;  4BOS C;  2KLC A;  3KYD D;  3APD A;  3V6C B;  2BKF A;  2PPH A;  2KXJ A;  3A1Q A;  2NPT A;  4MGK E;  2GBK A;  4LCD E;  3AI5 A;  3ZIM A;  5G2N A;  5G55 A;  2LGY A;  3ML9 A;  1OEY A;  4MGZ E;  1ZGU B;  2OOB B;  3DBL I;  4HPM B;  4GDL A;  4WWP A;  5JHA A;  4JL9 A;  4KIK B;  4OVU A;  2MBH A;  3NS8 A;  3VH3 B;  4EZL A;  1P3Q U;  5EDS A;  3ZKJ C;  1CMX B;  4E74 A;  3L0W B;  3M62 B;  2LZ6 A;  2R2O A;  3PGE A;  4NNJ B;  4F8C B;  3ZTD A;  4K7W A;  2L0T A;  3H7S A;  4MM3 A;  3H9D A;  2K8B A;  4IM3 A;  1GJZ A;  4IUM B;  2IY0 B;  1YX5 B;  2JVC A;  3L10 B;  3HK0 A;  4ANW A;  3UQB A;  3RYT A;  2CU1 A;  3AU5 A;  4LJO B;  3RT3 B;  2L3Z A;  1WJ6 A;  2MX2 A;  4PS7 A;  4G3X B;  2L7R A;  2LRU A;  3KW5 B;  2O6V D;  2KMA A;  2BWF A;  4HWI B;  4MGI E;  2KD0 A;  3DPD A;  2PJH A;  4N9F 4;  3WA0 A;  3A9K B;  4XC2 A;  2J7Q B;  3PT2 B;  2NBW B;  4HXD A;  4W9L A;  1RAX A;  4WJN A;  2NR2 A;  3VTU A;  1M94 A;  2AL3 A;  4BKG A;  3RUL A;  2RSU A;  3JW0 X;  4WWN A;  1WXM A;  2EMT A;  1WH3 A;  1L2N A;  4K7S A;  2BPS A;  2MA9 B;  4MEM A;  4HCP B;  3H6N A;  3R3M A;  1VD2 A;  5LLI A;  3DBS A;  4A20 A;  3LJ3 A;  1EF5 A;  2KFJ A;  4DBG A;  3V6E B;  3TIX A;  1WE6 A;  3DQV A;  1MG8 A;  3KUC B;  4MJS B;  2DYO A;  5HKH A;  4GGQ A;  1E8X A;  4A3O A;  2N1V A;  3RUI B;  2M8S A;  2DYM A;  2PEA A;  2ZPY A;  5D94 A;  2K8C A;  4B9K A;  2Y5B B;  1NI2 A;  1VCB A;  2C7N B;  2NPT B;  3A1Q B;  2YVC A;  4II2 B;  4AJW A;  4ZRK A;  2MWS B;  2D2Q A;  3Q3J A;  3BIN A;  4IWO A;  1U4A A;  2K25 A;  2KVR A;  4G11 A;  2JY6 A;  3N3K B;  4W9G A;  2VRR B;  3EEC A;  4BKS A;  1Y8R C;  3ECI A;  1UEL A;  2KTR B;  1YJ1 A;  3CST A;  3IBE A;  1UD7 A;  4JQW C;  2JF5 A;  4AP4 C;  3AXC A;  2K39 A;  4AUQ C;  3AUL A;  2FCN A;  2LVP A;  1NDD A;  2G4S A;  3MTN B;  3A9J B;  2KO3 A;  2KNB A;  2DZM A;  2IYD B;  5CHV C;  4GSW A;  3VHT C;  1T0Y A;  4W9H A;  4JLC A;  1UBI A;  3V60 A;  2MCN B;  1WGY A;  2ZZP B;  1E8Z A;  2KC2 A;  2ASQ A;  3IG3 A;  4FHK A;  3UIN B;  2N7E A;  1WJN A;  2KFK B;  2RD0 A;  4BVU C;  2IBI B;  3WAO A;  4ANV A;  2EKE C;  2WX1 A;  1KJT A;  5CHW A;  2ZCC A;  2KKC A;  1LQB A;  3DCG A;  4FLH A;  2DZJ A;  4FJV B;  1WXS A;  3U8Z A;  5DCN A;  1P9D U;  2V3S A;  3SU8 X;  1BT0 A;  3EFU A;  2DZK A;  4KVG B;  2RGF A;  2HE7 A;  5D6J B;  4NJ6 A;  4EZK A;  3A33 B;  2DAJ A;  1XQQ A;  2NS5 A;  2OJR A;  1WMH B;  4WJO A;  3TBL D;  2LJ5 A;  1WF9 A;  3ONS A;  4ANU A;  1GUA B;  2LVQ A;  2LRW A;  1WX8 A;  2IO1 B;  4KIK A;  2K8H A;  2ZPN A;  1H4R A;  3OJ3 A;  2NBV B;  3RZF A;  4FA6 A;  2KMC A;  5E6P A;  3VTW A;  4B95 A;  3GOE A;  1TTN A;  2BF8 B;  3Q3F A;  1E8W A;  3N32 A;  3NOB A;  1P0R A;  2C5L C;  2IO3 B;  2J0M A;  4MGY E;  2I1K A;  2NBU A;  2AYO B;  2UYZ B;  4NAW A;  2BGF A;  3OAW A;  4K81 A;  1UZX B;  4FJY A;  1V80 A;  1EF1 A;  2K6D B;  2LXA A;  4RMA A;  4WQO B;  3H1U A;  3VVW B;  1NBF C;  2C60 A;  2N9E B;  2KWV B;  3IFW B;  3PRM B;  2KJR A;  1EO6 A;  1OTR B;  5JZE B;  1WX7 A;  4KZC A;  3TMP B;  2KTF A;  4CYE A;  1OGW A;  2MLB A;  2CHZ A;  4II3 B;  3QC8 B;  3L08 A;  5AZH A;  5D7G A;  1C1Y B;  1V9J A;  1WR1 A;  5JHB A;  2N7D A;  2PE6 B;  4ZDV A;  3JSV A;  3R66 C;  1OEY J;  2JRH A;  1XT9 B;  4FUL A;  1V6E A;  4PYU A;  1WZ3 A;  4ZYN A;  2ZCB A;  1V81 A;  2FID A;  4FN2 A;  5C23 A;  2MP2 A;  1WGH A;  4DHJ D;  3KUD B;  1HE8 A;  1E90 A;  2JZZ A;  4W9C A;  3ZNZ B;  2NVU I;  2RPQ A;  4WJQ A;  5JH5 C;  1K8R B;  2C7H A;  2B3A A;  1JRU A;  2HJ8 A;  3ML8 A;  2C7M B;  3RCZ A;  4HVB A;  4B6W A;  5J17 A;  3VXW A;  2JUO A;  2JT4 B;  2KDB A;  3ENE A;  2GBR A;  2ZVN A;  1WY8 A;  2RR9 A;  2A4Z A;  3QHT A;  3QAR A;  4GIV A;  1G6J A;  3ZO5 B;  2IO0 B;  1KOT A;  2J0K A;  1E8Y A;  3MJW A;  2GOW A;  3ZRC A;  1RLF A;  2WYQ A;  3LDZ E;  4ANX A;  3PLU A;  4ASW C;  4PS8 A;  4I6N B;  3QWZ B;  4OVV A;  5LXH A;  2AEH A;  3A9J A;  3VUY A;  4MH0 E;  5DPT A;  1SGH A;  3PSE B;  3V62 A;  3VUX A;  3VTV A;  3VUW A;  2QHO A;  1E5W A;  1KLV A;  4KV2 A;  4EOY A;  2R2Q A;  2ZNV B;  1V49 A;  2L00 B;  3K9P B;  3M3J A;  1E7V A;  4M8M A;  2JXX A;  3T9L A;  5KHO A;  4LDT D;  2O2V B;  2KHW B;  4NQL B;  1QZE A;  3PHX B;  4G50 A;  2KZR A;  4GU2 A;  4BKT A;  1D3Z A;  1WGG A;  1V5T A;  1S1Q B;  2XEW A;  3NZU A;  4I6L B;  4KSL C;  1RRB A;  5L95 C;  4YL8 A;  5E6N A;  4E3C A;  3X23 A;  2JRI B;  3OLM D;  1V86 A;  2KWU B;  2I1J A;  4IW0 A;  3ZTC A;  2BWE S;  2KDI A;  3PTF C;  1PQS A;  2M17 A;  2GBM A;  2WX0 A;  4W9F A;  1ISN A;  3PRP B;  2LXC A;  3PPA A;  4F7Z A;  2HTH A;  4GMV A;  2KX3 A;  1LFD A;  2MBO A;  2KQ7 A;  5CHF A;  3ZRF A;  4EEW A;  3HM6 X;  3QQ8 B;  2MSE D;  2BYE A;  3SDL C;  2IY1 B;  1WXV A;  3ZUN A;  1R4N I;  4BBN C;  2KDF B;  4FAD A;  4P7I A;  2ZVO A;  2MP2 B;  2N4F A;  2GBJ A;  2FCM A;  4HPL B;  1SIF A;  4EUT A;  5C1Z A;  4GDK A;  3JVZ X;  1WGR A;  3DBR I;  5LXI B;  2WWZ A;  2KX0 A;  5FR6 A;  1L7Y A;  1P1A A;  2L76 A;  5GMV A;  5AEK B;  4RM9 A;  4W9E A;  1E7U A;  4PS3 A;  2XK5 B;  1ZW7 A;  2XK5 A;  3A9K A;  2G4D B;  3ZLZ A;  5DPS A;  2EMS A;  3L54 A;  3S2A A;  1Q1O A;  4FJZ A;  1TGZ B;  3D32 A;  3MHS D;  4RM8 A;  3ZDM C;  2M0X A;  3DOW A;  5DPR A;  3UGB B;  5CX3 A;  3U7D A;  1SE9 A;  5E6O A;  1RFA A;  3DBH I;  4MSM B;  1J0G A;  3ZNH B;  4XX5 A;  2J0J A;  2AL6 A;  2CS4 A;  4TV3 A;  2IO2 B;  4BBN F;  2DEN B;  4GDK B;  4CHK A;  2MRP A;  3ZDT A;  2O6V B;  3VFK A;  1GC6 A;  2DAF A;  2MBB B;  3BY4 B;  3W1Y A;  4DDI D;  1IP9 A;  4GN1 A;  4W9I A;  4AJY B;  1GG3 A;  2JPH A;  2WDT B;  2ZNV C;  2D3G A;  4X57 B;  5IAA C;  2Z59 B;  4KSK C;  1FXT B;  3PRE A;  2CR5 A;  2LWP A;  4HK2 A;  1I35 A;  1V5O A;  1A5R A;  3SHQ A;  2FNJ B;  4WWO A;  3DVN V;  3PVL A;  3SD5 A;  4IWP A;  3GZN I;  3WIM A;  3QA8 A;  3VDZ A;  2MBE A;  5BO4 B;  2KQS A;  5AZG A;  2HD5 B;  3L16 A;  1C3T A;  1WZ0 A;  2G45 B;  4EZJ A;  2FUH B;  4WAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...