3V62A

Structure of the s. cerevisiae srs2 c-terminal domain in complex with pcna conjugated to sumo on lysine 164
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
73
Chain Sequence
PETHINLVSDGSSEIFFITTPLRRLMEAFARQGEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3
publication title Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/dna binding protein
total genus 11
structure length 73
sequence length 79
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3v62A00
3DPDA 3PRMB 2NR2A 1I35A 5LLIA 2FUHB 1GJZA 2FCNA 2L76A 1RRBA 3DOWA 3GOEA 4W9LA 3MHSD 1Z5SB 4M8NA 2C9WB 2NPTA 2DENB 1WE6A 2KFKA 4GN1A 4HVBA 5E6PA 1GNUA 4ZYNA 1KLVA 3CSFA 4RMAA 3P2BA 4A3PA 4WJNA 3ZTCA 4W9IA 3IFWB 3QX1A 5L83A 3PHXB 2G3QB 3LJ3A 1YX5B 4GSWA 4MSMB 4BBNF 3TBLD 3T8MA 3WAPA 2K8CA 4FJZA 3PVLA 3WIMA 2L3ZA 2GBRA 2KLCA 4TQ0A 4OVUA 2GBMA 2BKFA 3TJPA 1UH6A 2MP2A 2IYDB 4GU2A 4W9GA 3QK0A 1YIWA 2KC1A 3U30A 3PTFC 2NS5A 1E8YA 3PSEB 2CU1A 5KHQA 1UBIA 2O2VB 4NQLB 2WX1A 1GC7A 4IM3A 5LXIB 1C1YB 2KHWB 2FCMA 2KTFA 2J0KA 3DDCB 3UIPB 1E7UA 3ENEA 1S3SG 2K8BA 2KTRA 4HXDA 5AZGA 3V6EB 2ASQA 2ZZPB 1GG3A 2KOXA 1PQSA 1TGZB 2MRPA 4K7UA 5IA7A 4PS3A 2R2OA 1E90A 1Q0WB 2LUEA 3VUXA 3RYTA 4GGQA 3DVGY 2L8JA 1EF1A 4X57B 4LCDE 2LVOA 3TL5A 3AU4A 2J7QB 1IYFA 4NY0A 3CF6E 3OAWA 5G55A 3ZNZB 4TQ1A 4W9HA 2L7RA 4CHKA 3LDZE 1K8RB 1WGGA 3RZFA 1VCBA 3N3KB 2KJHB 2EMTA 4GXBA 3ZIMA 4IUMB 4ANUA 3DVNU 1LQBA 1RAXA 1WXVA 1SIFA 3DVNV 5J18A 4W9DA 4DDGD 2NBUA 3TMPB 4K1RB 3V60A 3PLVA 4MDKE 1H8CA 4ASWC 3CMMB 2AYOB 4KDLB 3QQ8B 4A3OA 1NI2A 4AJYB 5AZFA 1YJ1A 4AJWA 3UGBB 4B9KA 3VHTC 3ONSA 3B08A 3PLUA 4MH0E 2MA9B 1WYWB 2KD0A 2A4ZA 2LD9A 3L0WB 2LGDA 3VQIA 3L10B 2WX0A 4IC7B 2KWUB 1JRUA 2KANA 2LVQA 5G2NA 4ZRIA 3B0AA 1WMHB 4WAAA 2Z59B 2L00B 3VDZA 3HHMA 3H1UA 3GZNI 2W9NA 2KNBA 2MBQA 4MSQB 3VVWB 3W1SA 2RD0A 4BVUC 1UELA 4K7SA 4MJSA 2J0MA 4DDID 3NZUA 3VAWA 3AULA 3JVZX 1ZW7A 4EFOA 4J6IA 2CHWA 1WX9A 1IPGA 5GMVA 2KK8A 1X1MA 2IZVB 3PV1A 3PS6A 1XT9B 4NPNA 3DVGX 1S1QB 3APDA 3W1YA 2JZZA 1WXSA 2LRWA 3RUIB 1L7YA 4FBJB 1OGWA 2IO0B 3N30A 3O65B 4GDKA 5DPTA 2K39A 3EC8A 1D3ZA 3QWZB 2D2QA 1F9JA 2LGXA 3A4RA 4YL8A 2LJ5A 5DCNA 1Q1OA 2AEHA 3QARA 4EZJA 1E8ZA 2KLGA 4ICVA 4K7WA 3L54A 3APCA 2O6VB 2KFKB 2KQ7A 1XD3B 2PE6B 1WFYA 3JYUA 2JVCA 2LWPA 1LM8B 3PPAA 2DZMA 5C23A 5JHBA 1KM7A 4WWPA 4E3CA 2V4LA 3A9JA 2C60A 2ZCBA 5D7GA 5DPRA 4ZRKA 3RT3B 2DYOA 1WJ4A 3C0RB 4KIKA 4EZKA 1WM3A 2C7NB 2LXCA 3IBEA 3T9LA 2BYEA 4JGHB 4MGKE 3NHEB 3NOBA 1R4NI 3V61A 3VTWA 2BGFA 3UF8A 1ZKHA 2ZEQA 1OEYA 1QZEA 3KH0A 4W9CA 4HLEA 2RSUA 4XC2A 2EKEC 2PJHA 2MP2B 3EFUA 1WX7A 2V3SA 4AP4C 4AWJA 2O6VD 1GC6A 1UZXB 2RR9A 2N7DA 4TKNA 2BYVE 3M3JA 3IHPC 4WJQA 1YD8U 3OJ3A 1V2YA 1WGRA 1P0RA 2XK5A 3A4SC 1V5OA 2M17A 4FN2A 3UQBA 3HM3A 2KTRB 4M8MA 3A9KA 1LFDA 2JWZA 3PRPB 2M0XA 2LZ6A 3EHVA 3SU8X 3WANA 2GBJA 3N32A 2N9EB 1WR6E 2CHXA 2L0TA 4MGYE 3VH3B 3ZVVA 2BPSA 4DHJB 4JL9A 4BKSD 3QA8A 3SDLC 1U4AA 2ZNVC 4GB9A 1P9DU 1OEYJ 3RCZA 4ZDVA 4HDQA 1Q5WB 4FLHA 3WAMA 1TTNA 1WM2A 2BWFA 5CHWA 3S2AA 3ZKJC 2M1MA 2RPQA 3JSVA 5TR5A 3TCAA 3VFKA 4BOSC 3ZRCA 1SE9A 3KUCB 2KMAA 4CYEA 4W9KA 2MLBA 3Q3JA 3DBLI 3VTUA 2DAJA 2GBKA 2BKRB 5E6NA 1V86A 3IVFA 5FR6A 4ANXA 2FAZA 1WIAA 3ZW3A 5L95C 2Z0EB 4WWNA 2ZNVB 2FIFA 3AXCA 3QHTA 3VH4B 2L0FA 4MM3A 3H6NA 3W1SC 1Y8RC 2CR5A 2O2VA 5J17A 2FNJB 2JY6A 5JH5C 1P1AA 3L08A 4FJVB 4DXAB 4IM2A 2MBHA 2XBBC 2MBEA 1A5RA 5AZHA 2G4DB 4ANVA 2FCQA 3WALA 1J8CA 2NBVB 2GOWA 2KWCA 3ALBA 4IWPA 4EEWA 3KYDD 4I6NB 3NY5A 4LDTB 4F8CB 4EUTA 3PT2B 2K1FA 3QAQA 1WRDB 2LASA 5CX3A 1WR1A 4HWIB 5JZEB 2KJRA 1SGHA 4OVVA 2LGYA 2N9PC 2DAFA 3TIXA 2PE9A 3BY4B 1NDDA 4MJSB 1L2NA 4HDOA 2N7EA 2WDTB 3I3TB 4RM9A 4G11A 4JQWC 1ZGUB 3JW0X 2K6DB 3KVFB 2BYFA 1EUVB 2D11A 1H4RA 4BKGA 3VTVA 2KDFB 2Y5BB 3RZWC 1RFAA 4WQOB 1KOTA 2LVPA 3NS8A 2KJ6A 4EKUA 1WJUA 3ZUNA 2JZ3B 2JRIB 4IWQA 1E8XA 3A1QA 2N1WA 4GDKB 4E71A 3KYCD 2MBBB 3ZTDA 2JRHA 4NAWB 4F1SA 3L17A 4DHZE 3NZSA 2LI5A 3MTNB 3WAOA 2K25A 1M94A 2J0JA 1WXAA 2N9XA 4KV2A 4HJKA 4HPMB 4ANWA 4W9EA 4HK2A 5BO4B 2DYMA 4MGIE 2G4SA 3UQAA 1LXDA 4FHJA 1P3QU 5IAAC 2ZPYA 1E8WA 3DBHI 4M0WB 4WJPA 5E6OA 3ZNID 2KWVB 1V81A 2I1KA 3WA0A 4HCPB 1NBFC 3MJWA 1WGYA 3A9JB 2HD5B 3V62A 3SD5A 4FADA 2YLMA 2DHZA 2G45B 3DBSA 4KZCA 5DPSA 1E5WA 4KIKB 3OLMD 4XX5A 2NPTB 4EOYA 4ICUA 4P7IA 1WZ0A 2REXA 4A20A 4I6PA 3ZRFA 1V80A 3PRZA 2KFJA 4KVGB 2VRRB 4G50A 4JIOU 4KSKC 3ZDMC 2FCSA 4NNJB 2OOBB 3PHWB 4IM0A 3DQVA 2KZRA 4ZRJA 4G3XB 4WJOA 4BBNC 3R66C 5EDSA 3H7PA 4BFRA 4EZLA 4NJ7A 2HTHA 4HPLB 4AUQC 1OTRB 4GDLA 1WF9A 4G0NB 1I42A 2MBOA 2K6QA 1CMXB 3IG3A 4E74A 2Z0DB 3A9KB 3L13A 4PS8A 1T0YA 2CKHB 3EECA 1GUAB 1G6JA 2ZJDA 3QJZA 2IO1B 3R7QA 1KJTA 2ZCCA 3QCAA 1HE8A 2FIDA 2KVRA 2C7HA 1FXTB 1C3TA 1EO6A 5CTRC 2M4NA 4FJYA 2UYZB 1WH3A 2PPHA 2O6VA 4WWOA 1WGDA 1V9JA 2JPHA 3CSTA 4URKA 2MCNB 4LJOB 2YVCA 2BF8B 4PYZA 2DX5B 2IBIB 1XQQA 3JSVB 3R3MA 3L16A 2NVUI 1J0GA 3HK0A 2KC2A 3AI5A 3ML8A 1V6EA 1WZ3A 2KX3A 4NQKE 1TZ1A 1OQYA 5KHOA 3R7RA 3ZNGC 2R2QA 2JF5A 2IY1B 1UD7A 2DZKA 3PGEA 3V6CB 1IP9A 4IWOA 4BOZB 2KDEB 2MQJA 3A33B 3QC8B 3VXWA 4BKSA 5LXHA 5DPWA 4MELA 2M8SA 5J2RA 2JUOA 1WY8A 2HJ8A 4B95A 1EF5A 2NCNA 2D10A 5D6JB 4K81A 4PS7A 1MG8A 2RGFA 5AEKB 1WGHA 1V49A 5HKHA 2AL3A 2KDBA 2UWQA 2WWZA 2WYQA 3DCGA 3KUZA 4W9FA 3ML9A 4DHJD 2MW5A 2KDIA 3ECIA 1WE7A 2IY0B 2DYBA 4LJPB 1YQBA 2N1VA 4N9F4 1WJNA 4GOCA 4I6LB 4AOFA 4KZ0A 5C1ZA 4II3B 4GMVA 2KX0A 3ZO5B 2DZIA 1AARA 3ZDTA 1RLFA 2CHZA 4PYUA 3PZDA 4B6WA 2D3GA 3M63B 3ZLZA 1P98A 2GMIC 3M95A 3K9OB 2MWSB 3H9DA 2MSED 2PEAA 3H7SA 3X0WA 4JLCA 3A1QB 5CHFA 4GIVA 3APFA 3SHQA 2C7MB 4RM8A 2OJRA 2IO2B 1WI0A 5D2MB 4MGZE 3OJ4B 2B3AA 2JXXA 4HCNB 4LDTD 3UIOB 4KSLC 1E7VA 3RD2A 3Q3FA 1J19A 2KMCA 4KDIC 1UGMA 4W9JA 2C5LC 2V1YA 2K8HA 3QIJA 5D94A 3VUWA 2EMSA 1WJ6A 4TV3A 3DBRI 3M62B 2AL6A 4MEMA 3AU5A 3HIZA 1VD2A 4NJ6A 4FHKA 4FA6A 3UINB 2I1JA 2KKCA 2LXAA 3B1LX 4DK5A 4CO7A 4DHZB 2ZVNA 1R4MI 2GBNA 1UBQA 3RULA 2JT4B 3U8ZA 1WMHA 3KUDB 1BT0A 2IO3B 2KO3A 2AWTA 3U7DA 2DZJA 3PREA 2KN5A 4II2B 2N4FA 2L05A 4F7ZA 5JHAA 3VUYA 2ZPNA 3KW5B 4TUUA 2HE7A 3H7PB 4IG7B 3ZNHB 2MX2A 2KQSA 2NBWB 3BINA 4GDLB 4XZ4A 1TBEA 3X23A 4FULA 1Z2MA 3D32A 4DBGA 4NAWA 3K9PB 4DWFA 2BWES 1V5TA 2A5UA 1WX8A 2KXJA 5CHVC 1WXMA 4BKTA 2XK5B 4IW0A 1ISNA 2D07B 2LRUA 2CS4A 1YX6B 2QHOA 2XEWA 3HM6X 2ZVOA
chains in the Genus database with same CATH superfamily
2H89B 2LGSA 5LLIA 2FUHB 3Q14C 3MJ5A 2NPTA 3DBRB 2DENB 2ON8A 4GN1A 4B0MA 1GNUA 4N58A 4ZYNA 4WJNA 2IJ0A 4D2KA 4YSZB 1FMAD 4PK1A 3PHXB 4GSWA 3ZXVA 3NG0A 1ACCA 3AEEB 1FRDA 4IKGA 1VR9A 4OVUA 4TSSA 1J7BA 2GBMA 2MP2A 1I4RA 4GU2A 4O1NA 4W9GA 3PSEB 3Q8EA 1UBIA 4NQLB 1SIJA 1E7PB 5LXIB 4LNFA 2J0KA 2WU5B 3UIPB 2K8BA 3ZYYX 2ASQA 3FC4A 2KOXA 3EFCA 1TGZB 4K7UA 3AE8B 2R2OA 1E90A 1L0XB 2LUEA 2L1AA 3DVGY 2WXQA 2L8JA 1EF1A 4RF1A 2L7RA 3N9YC 3NUHB 2CJNA 1NYQA 1VCBA 3ZIMA 3BVGA 4QAYA 4A8XC 2QEJC 2INDC 3AE3B 3V60A 4MDKE 1MHHE 2AYOB 4HRSA 3TEYA 1I4HA 4AJWA 4B9KA 3VHTC 3B9JA 3B08A 2KQ4X 2A4ZA 3RN9C 2EELA 3VQIA 3L10B 1WXQA 2BTEA 3ZJVA 3OG5A 4WAAA 2L00B 3VDZA 3H1UA 3AEFB 3W1SA 4WAFA 4BVUC 4K7SA 1K52A 2HTME 3W5UB 3VAWA 3JVZX 4LNIA 3MFGA 4NPNA 4RGMA 3R2IA 2IO0B 3O65B 2K39A 1R7SA 1F9JA 2KN4A 3VR9B 5DCNA 3QARA 3U7ZA 4K7WA 4KKJA 3LYYA 2KQ7A 1VZ6A 1XD3B 1TKEA 2MH7A 1KM7A 1V1OA 3A9JA 5DPRA 4ARIA 5BMGA 2JYTA 3RT3B 3C0RB 4S0RA 2C7NB 3RMKC 3T9LA 4JGHB 3NHEB 3NOBA 2WDQB 1E9MA 2EKEC 5BMIA 2RR9A 3I5JC 1C79A 3IHPC 1YJJA 1V2YA 1N60A 3A4SC 2M17A 2N9LA 2J53A 2I38A 2KTRB 3BZDB 1SE3A 2JWZA 5JXVA 2GBJA 3VH3B 4JL9A 3QA8A 3SDLC 2ZNVC 1OEYJ 3NVWA 4RCOA 1E6EB 4FLHA 2DWQA 3ZKJC 5L83A 3S2AA 2M1MA 3JSVA 1L0YB 2N0SB 4YXDB 2HJ1A 3VTUA 2MLBA 3Q3JA 2DAJA 5EE9A 4BAXA 5E6NA 1V86A 1DGJA 2BB5A 1J7CA 2ZNVB 4JPSA 3Q6BA 1JWSD 3C8YA 3QHTA 5J17A 2FNJB 1P1AA 3L08A 4IM2A 2MBHA 4ANVA 2G4DB 1PFDA 2WXLA 4XWWA 1FPYA 2JXTA 2N9KA 3ALBA 3KYDD 2GLSA 3NY5A 4LDTB 1VDVA 2FBWB 4EUTA 3KLSX 3QAQA 3RNAC 5CX3A 4WURA 1YN3A 2LMCA 3N20C 3BIID 5JZEB 1SJHD 1T3QA 1PGAA 3MC8A 1D5MC 1XXGA 1KLGD 4M00A 2KMMA 4MJSB 2WDTB 4RM9A 4G11A 1QOGA 3VTVA 3RZWC 2QSDA 1RFAA 2LVPA 3NS8A 3MP9A 3ZUNA 4UDUC 3A1QA 2N1WA 4GDKB 3L17A 4LNKA 2E6XA 2J0JA 3AEDB 4ANWA 1XF5L 4HK2A 1HTQA 2DYMA 5HI1A 1HEZE 1LXDA 2MHJA 2OHFA 5IAAC 2ZPYA 3DBHI 4K3CA 4M0WB 4WJPA 2CJOA 2NTTA 4M02A 1NBFC 3V62A 1WWTA 3SD5A 4C4VA 2G45B 3OLMD 4XX5A 2REXA 4A20A 3PRZA 1HTOA 4RF0A 3AE2B 3DWMA 1T6BX 2VH1A 1FFUA 4KSKC 3Q3NC 4IM0A 3DQVA 2KAJA 2KZRA 4ZRJA 4G3XB 1EM7A 4REZA 1JW9D 2L52A 4NJ7A 1N5XA 4HPLB 1C4CA 3IT6B 4CQNA 1KFYB 1T0YA 1ZPSA 2ZCCA 1HE8A 2GI9A 5IN7A 3W9CB 4OZAA 3DBHB 2K0PA 2YVCA 2BF8B 2IBIB 3R3MA 1D5ZC 3RPFC 1J0GA 3HK0A 2KC2A 2MJEA 1V6EA 1FNVA 1OQQA 2MQJA 1BMLC 5LXHA 4BKSA 5J2RA 5H8YE 1GB1A 2HJ8A 3DHGC 2NCNA 2G9HD 2RGFA 2L32A 5AEKB 4MACA 2D3BA 4XWTA 2AL3A 3DCGA 4W9FA 3KUZA 2G1EA 2MW5A 4IDIA 1WGKA 2IY0B 4AOFA 1FIQA 5FK9C 2AQ1B 2IGGA 2TSSA 4YTPB 3C19A 3M63B 1P98A 1GAQB 2NMQA 3AE7B 1SEBD 3H7SA 4JLCA 1DYQA 3APFA 2C7MB 4OZBA 2IO2B 1MPEA 3OJ4B 2B3AA 4HCNB 3NVVA 4LDTD 3Q3FA 2KMCA 1CK1A 4W9JA 1QOAA 3M62B 3AMZA 3HIZA 3B1LX 4CO7A 2KDMA 1R4MI 4L1BA 1UBQA 3UI3A 1MI0A 3U8ZA 1WMHA 3KUDB 3DHIC 2AWTA 5JHAA 4TUUA 3KW5B 3H7PB 3ZNHB 3AB5A 3TEWA 3AM9A 4XZ4A 1FD6A 3CWIA 3D32A 4DBGA 4NAWA 3V05A 2AQ3B 2A5UA 3GB1A 4BKTA 1ISNA 1QKZA 1GB4A 2CS4A 5G5GA 2ZVOA 4KKIA 3DPDA 2FCNA 2L76A 1JROA 4W9LA 2XN9C 1WE6A 2KFKA 4HVBA 5E6PA 5HFYA 1R4MB 1E0ZA 4XE0A 4MSMB 3ZGZA 1SJED 3AEBB 1I4QA 3PVLA 4LNOA 4P1BC 4TQ0A 2BYTA 4BZAA 3Q69A 4GLSC 1XLNA 4KGSA 3URYA 2NS5A 1XEEA 1E8YA 5KHQA 2DLBA 2WXNA 2KHWB 3DDCB 1PQSA 4PS3A 3VUXA 1A70A 3J9CA 4X57B 1IYFA 2J7QB 4NY0A 3CF6E 3ZNZB 1WYGA 3RNGC 2LGIA 3LDZE 3RZFA 3N3KB 4WWMA 2D5GA 1SIFA 3DVNV 5J18A 3T3NA 4W9DA 4DDGD 1E10A 3TMPB 3PLVA 2V4IB 4ASWC 3TUOA 4HJGE 5EE0A 1VJKA 2MA9B 1WYWB 2LD9A 2IDYA 3L0WB 1V1PA 4IC7B 2KWUB 3E9SA 2KANA 4RGTA 2Z59B 1PUTA 2W9NA 2WS3B 4DDID 4USAA 2MJDA 3PV1A 3I9V1 1XT9B 1N61A 3APDA 2DNFA 2JZZA 2LRWA 4FBJB 1OGWA 2BBCA 1T0SC 2PVOD 1ESFA 2WXMA 3BVMA 3QWZB 2WNMA 1E8ZA 3V3XA 2YEPB 3L54A 3AEAB 1SBBB 1WFYA 2JQRB 3JYUA 3P4QB 2JVCA 2VH2A 4WWPA 4E3CA 2V4LA 3Q3OC 2ZCBA 4ZRKA 1WJ4A 1J7AA 2LXCA 1QLBB 1ET9A 3VTWA 3HRDD 1QT9A 1QOFA 2LJIA 2MP2B 2PJHA 2W54A 3EFUA 2V3SA 4AWJA 2QJLA 1FO4A 2O6VD 2XK5A 4YTNB 4FN2A 1ZUD2 1YN4A 2LZ6A 3EHVA 3B2GA 4ZOHC 3BWUD 1WR6E 4YWGG 3ZVVA 3RCZA 1Q5WB 3ZXRA 5CHWA 4BOSC 3TCAA 3ZRCA 4NAMA 2E3TA 2KMAA 4W9KA 1OQRA 2GBKA 4RGNA 2BKRB 3IVFA 5FR6A 4ANXA 2Y5CA 1WIAA 2Z0EB 1FXAA 2Q5WD 5D3IB 3VRBB 2FIFA 1M4VA 4AQ7A 2L0FA 4MM3A 3W1SC 2CR5A 2WXRA 1FFVA 1C9FA 5JH5C 4DXAB 4FJVB 2XBBC 2MBEA 4XYCA 5AZHA 1JWAD 1J8CA 2FCQA 3WALA 2NBVB 4IWPA 4EEWA 3PT2B 2K1FA 1WRDB 1C78A 4HWIB 3P42A 1AYFA 2BB6A 3P4SB 3TIXA 1SSNA 2INPE 1NDDA 2WXPA 3BY4B 1L2NA 2GB1A 3AE9B 1KH0A 4C7ZA 3JW0X 2BYFA 4OZCA 4BKGA 2KDFB 1JQ4A 5LNK1 1EU3A 1KOTA 5BMHA 2KJ6A 1WJUA 2JZ3B 4N59A 4IWQA 3ZTDA 2J42A 2JRHA 4Q2JA 3MTNB 1M94A 1WXAA 2V3PA 1P3QU 1F77A 1E8WA 3AE6B 3ZNID 2KWVB 1SXTA 4HCPB 1WGYA 3A9JB 5AUKA 2YLMA 4ICUA 1TKYA 1V80A 3H8HA 1UUPA 4C00A 3PHWB 4HPPA 4WJOA 4LTUA 3R66C 5C2TB 4BFRA 2HTHA 1TIFA 4GDLA 1I42A 4ZYSA 4E74A 2ACZB 3QJZA 5IP4D 3QCAA 2FIDA 4A55A 2UYZB 4WWOA 4A90A 4DQOC 2MCNB 3JSVB 3MHZA 2WXHA 2NVUI 3E56A 2BS2B 4MT5A 2KX3A 2BT6A 2N7JA 5KHOA 2IY1B 3MC9A 2KDEB 4MELA 3AE4B 1BXTA 1VZ7A 1D4BA 3AV8A 5D6JB 4K81A 4PS7A 2JX5A 4LLGM 2H88B 2ONQA 2JZPA 1P7EA 1XCQL 4YSYB 2KDBA 2INNE 3FILA 3N1ZC 4LJPB 1TKGA 4GOCA 5FR3A 2DZIA 4XGAB 4US9A 2JYEA 1ZOYB 3ZDTA 2CHZA 3PZDA 4B6WA 3ZLZA 3KWLA 2PTLA 3RNFC 3K9OB 5BYSA 1T0QC 2PEAA 3X0WA 3A1QB 5CHFA 1F1HA 2FE8A 4JX1C 1JALA 4MGZE 1WRIA 2JXXA 3UIOB 4KSLC 1E7VA 3RD2A 1QQRA 1J19A 2C5LC 4R3DA 5D94A 4C4VB 1JMLA 4MEMA 3AU5A 1EWYC 2W3RA 4FA6A 2I1JA 1MHXA 2KKCA 2KYWA 4DHZB 3Q8BA 3RULA 5G5HA 4II2B 2L05A 2HE7A 4IG7B 2L83A 2XNAC 4FULA 4ZRQA 4DWFA 1WX8A 1WSPA 4IW0A 2D07B 2VZKB 1YX6B 2QHOA 2M19A 1C4AA 5IKCM 3HM6X 2WHIA 2NR2A 1GJZA 1XLPA 3GOEA 1RRBA 3OWEB 4M8NA 1NENB 4RMAA 3P2BA 4A3PA 4XDDA 1IGDA 2KWDA 1I7HA 2B76B 3LJ3A 5C3JB 4BBNF 3T8MA 3WAPA 4FJZA 3WIMA 2KLCA 2WXFA 2OEDA 1UF0A 1SE4A 1UH6A 2IYDB 5HHDG 3RNBC 3PTFC 4J3OD 3FKYA 2O2VB 2JWUA 2WX1A 1GC7A 3CIRB 2KTFA 1T0RC 1E7UA 2Z8LA 2PMVA 3ENEA 5AZGA 3WCQA 4OVZA 2ZZPB 1GG3A 4WH4A 3Q8FA 1Q0WB 4LCDE 2LVOA 3AE1B 3OAWA 1ET6A 2WDVB 4CHKA 2KJHB 2EMTA 3KQ4A 1LQBA 2WXGA 1RAXA 3B2FA 1UWXA 1QOBA 2NTSA 1ZXHA 4KDLB 2K3UA 1D6EC 3PZ8A 3QQ8B 1NI2A 4AJYB 5AZFA 3UGBB 3ONSA 2WGSA 3PLUA 4WIPA 2LGDA 1V8CA 1RFKA 1JRUA 1VLBA 2UU7A 2ZW0A 2LVQA 1ROEA 3KWVA 5G2NA 4ZRIA 1WMHB 1FCLA 3GZNI 2KNBA 2MBQA 2RD0A 3FAHA 1UELA 2QC8A 5EE3A 1XO3A 4EFOA 1WX9A 2KK8A 1X1MA 5D3DA 3SEBA 3GE3C 3PS6A 3W1YA 3DVGX 1L4DB 3GP7A 2BS4B 1YN5A 5DPTA 2D2QA 2AX5A 3A4RA 3U2SC 3P63A 4A6QA 1Q1OA 2AEHA 3LB8C 2O6VB 2KFKB 5AUIA 3PO0A 2LWPA 1LM8B 2RPVA 1IBXA 2HDEA 1XLQA 3PPAA 5C23A 5JHBA 3TEZA 1AW7A 2DYOA 4KIKA 4EZKA 1WM3A 2W3SA 1TS4A 3IBEA 2BYEA 4MGKE 3V61A 1R4NI 3GZNB 3VRAB 4HLEA 3KH0A 4W9CA 3NRZA 4JWSC 4AP4C 3AEGB 2VZKD 1GC6A 1UZXB 2IGDA 4TKNA 2N7DA 2BYVE 4WJQA 2SEBD 1YD8U 3R8BA 1V5OA 3UQBA 3HM3A 4M8MA 3A9KA 4ZHPA 1L4ZB 3PRPB 2M0XA 5TSSA 2V3NA 3SU8X 4US8A 3VR8B 4YTMB 5T8IA 4KX6B 2BPSA 4BKSD 1U4AA 4GB9A 4HDQA 1WM2A 4YSXB 4PT5A 2PVGC 5TR5A 3VFKA 1TS3A 3PZ7A 1LGRA 3KUCB 5IO9A 4CYEA 1R4NB 3NVYA 1T5XD 2FAZA 5L95C 3BVZA 4ARCA 2ZW1A 1LO5D 3AXCA 3VH4B 1Y8RC 2KT7A 3I57A 1ENFA 3Q8AA 2WDRB 3TSSA 2QDFA 1PGBA 1A5RA 1V1PB 2JU6X 2KWCA 2RMMA 2MEKA 4F8CB 2LASA 4ZRPA 3ZJTA 3P4PB 3AECB 1YMHE 2DAFA 1V97A 4HDOA 2N7EA 3I3TB 4JQWC 1ZGUB 1F2RI 3KVFB 3NZ3A 2D11A 4WQOB 4EKUA 1ZE3D 1L5PA 2JRIB 3KYCD 1I4XA 4L23A 1GOZA 2LI5A 3NZSA 3WAOA 2K25A 4W9EA 5BO4B 1D5XC 4MGIE 2LUMA 3UQAA 4FHJA 1IGCA 4DXFA 3WA0A 4P6VF 1F2RC 1TY2A 3MJWA 2HD5B 1Y56A 4A9AA 2DHZA 4EOYA 2AQ2B 2NPTB 1WZ0A 2OJWA 4KVGB 2VRRB 4G50A 4JIOU 1XCTL 2DBYA 3T3OA 2FCSA 4NNJB 1K50A 3NJTA 1UGJA 4HROA 5EDSA 4EZLA 4AUQC 1OTRB 1CMXB 3IG3A 1RWSA 2Z0DB 3EECA 2ZJDA 2IO1B 3R7QA 2KVRA 5CTRC 2M4NA 4FJYA 1B1ZA 1WGDA 3CSTA 1YOVB 4LJOB 1XQQA 1KTKA 5IOIA 3AI5A 3ML8A 2LHEA 3RFZB 1KLUD 4NQKE 1TZ1A 1OQYA 3R7RA 3V6CB 1UD7A 2DZKA 3BK1A 4IWOA 3A33B 1PGXA 3QC8B 3VXWA 5I4DA 2FUG1 2M8SA 1TT5B 4MM3B 1EF5A 2D10A 1YQ4B 1MG8A 2X8XX 1V49A 3U52E 2QIEB 3SFDB 2UWQA 2WYQA 3ML9A 1HA5A 1WE7A 2DYBA 1YQBA 2N1VA 4N9F4 4C7YA 3AN1A 3I63C 4KZ0A 1DOXA 4GMVA 1AARA 1RLFA 3GE8C 1F0ZA 3M95A 2MWSB 3H9DA 1ZDVA 1K53A 4C56C 5EE1A 2WXIA 2J4XA 3SHQA 4RM8A 5E6JA 4K3BA 2WP9B 1FM0D 1NEKB 3EGRA 1UNSA 4KDIC 1UGMA 3ETRA 2V1YA 3QIJA 2WU2B 1ZDXA 3VUWA 1WJ6A 4EE2A 4TV3A 2INCC 1VD2A 4NJ6A 2GRIA 3UINB 4DK5A 2ZVNA 2D3AA 2GBNA 3Q8CA 1PDXA 2JT4B 1VZ8A 2IO3B 3BK2A 3U7DA 1KF6B 2KN5A 4F7ZA 2N4FA 3VUYA 2ZPNA 1N5WA 2LHDA 5GXGB 2KQSA 3BINA 4GDLB 3X23A 4HKZE 3DHHC 4OW0A 3K9PB 2BWES 1V5TA 4TMAB 4LNNA 1IUEA 2KXJA 4ZHOA 3EA6A 4WQMA 2LRUA 4ITKA 1HQRD 2XEWA 4JE3B 1BUIC 3PRMB 3R2TA 5H92C 3DOWA 4B0EA 3MHSD 1Z5SB 2CU3A 2C9WB 3ABVB 1KLVA 3CSFA 4IOIE 1JCKB 3ZTCA 4W9IA 3IFWB 3QX1A 4RH6A 2G3QB 1YX5B 3TBLD 1L6UA 2KACA 2K8CA 1DOYA 3SR6A 1NYRA 2L3ZA 2I2YA 2GBRA 3TJPA 2BKFA 1CQVA 4KGTA 3QK0A 1YIWA 2KC1A 3U30A 1C76A 5BYRA 1NI3A 3FILB 2CU1A 3ZQ4A 4IM3A 1C1YB 2FCMA 1S3SG 2JSVX 2KTRA 2PLPA 4HXDA 3V6EB 1QILA 2BQQA 5IA7A 2MRPA 3IXSA 3RYTA 4GGQA 1CZPA 3TL5A 3AU4A 5G55A 4TQ1A 4W9HA 1OFFA 3W5VB 2RDHA 1K8RB 1WGGA 1TZOA 1PYWD 1AWDA 4GXBA 4IUMB 4ANUA 1JRPA 3DVNU 4OHJA 1WXVA 2NBUA 1SE2A 4K1RB 2RDBC 1H8CA 3CMMB 1MJDA 1MG4A 3N1XC 4A3OA 2Y5PA 1RM6C 1YJ1A 2K5PA 4MH0E 1TS5A 2KD0A 2W55A 2WX0A 1FEHA 4L2YA 3B0AA 1B9RA 3HHMA 3VVWB 4MSQB 1VRAB 2KVZA 4MJSA 2J0MA 2R61A 3NZUA 4JWUC 3AULA 1ZW7A 1P7FA 4J6IA 2CHWA 1IPGA 5GMVA 2IZVB 2PW9A 1S1QB 1WXSA 3RUIB 1L7YA 3N30A 4GDKA 3EC8A 1D3ZA 1F52A 2LGXA 4YL8A 2LJ5A 4EZJA 2KLGA 4ICVA 1N62A 3APCA 2PE6B 4M0WA 3GS2A 2DZMA 1TY0A 2C60A 5D7GA 3P4RB 2SAKA 2BGFA 3UF8A 1ZKHA 2ZEQA 1OEYA 1QZEA 1JWMD 1EU4A 2RSUA 4RGOS 4XC2A 1YNTE 1QF6A 1WX7A 1YJIA 3M3JA 1FNUA 3OJ3A 1WGRA 1P0RA 1YQ3B 4MH8A 1LFDA 2IPKD 5BYQA 1K51A 3WANA 3N32A 2K9XA 2N9EB 2CHXA 2L0TA 4MGYE 4DHJB 1HZ6A 1P9DU 4ZDVA 1N6ZA 3WAMA 2IGHA 1TTNA 1N63A 2BWFA 1I4PA 2RPQA 1STEA 1I4GA 4NZLB 1SE9A 3W2DA 1EWCA 3DBLI 1KRHA 3ZW3A 4WWNA 1C4PA 4S17A 1L6VA 1CJEA 3H6NA 2O2VA 2JY6A 3BYYB 4RFBA 2M0AA 3U4EG 5MPOA 3O13A 1HZ5A 2GOWA 1C77A 4HEA1 4I6NB 2M56B 3Q3MC 3NVZA 2WXKA 1WR1A 2BVCA 1SGHA 2KJRA 4OVVA 2LGYA 2N9PC 1TJEA 4N6EB 2PE9A 3IT4B 1TYGB 1MVKA 2K6DB 1EUVB 4LK0M 1FCCC 2QMTA 1H4RA 2Y5BB 3DBLB 1FXIA 5FKAC 2W82A 1E8XA 4E71A 3Q2AC 2MBBB 4NAWB 4F1SA 4DHZE 4AS1A 4KGRA 2N9XA 4KV2A 4HJKA 4HPMB 2G4SA 3SFEB 2EKIA 5E6OA 2Y3AA 1V81A 2I1KA 1IBXB 2BW2A 4FADA 3IAM1 2X38A 4KZCA 3DBSA 5DPSA 1E5WA 4KIKB 4NJCA 4P7IA 1RYJA 4I6PA 3ZRFA 1JWBD 2KFJA 3LXFA 2YEPF 3ZDMC 3AH7A 2OOBB 3BYTB 1SF0A 1L0VB 4BBNC 3H7PA 1WF9A 4G0NB 4ACFA 2MBOA 2K6QA 2WXOA 1AN8A 3A9KB 3L13A 4PS8A 2CKHB 1G6JA 1GUAB 1ZP0B 2LEKA 1KJTA 2C7HA 1FXTB 1C3TA 1EO6A 1WH3A 2PPHA 2O6VA 2V9HA 3EUB2 1V9JA 2JPHA 1FNWA 2PIAA 4URKA 4XDCA 4PYZA 1TS2A 2DX5B 3L16A 4M01A 2BS3B 3DWGC 4P16A 1WZ3A 3RNEC 2QILA 3ZNGC 2R2QA 2JF5A 2K22A 3PGEA 1IP9A 4BOZB 3HUIA 4DXGA 5DPWA 3HVZA 1I35A 2JUOA 4HKQA 1WY8A 4B95A 1FRRA 1Q10A 1WGHA 1UWMA 1NVID 5HKHA 2PKOA 2WWZA 4DHJD 2V0GA 3MC0B 2KDIA 3ECIA 3IAS1 1WJNA 4I6LB 5C1ZA 4II3B 3ZO5B 2KX0A 2J52A 4PYUA 2MJ3A 2D3GA 1ZXIA 2GMIC 2LFIA 2MSED 4YT0B 3HVDA 2WLBA 2RDGA 4GIVA 2OJRA 3N1YC 1WI0A 5D2MB 1SB3C 5HG2A 2K8HA 1GPXA 2EMSA 4FXCA 1MFWA 3NS1A 3DBRI 2AL6A 3AE5B 2QCZA 4FHKA 3L4PA 2LXAA 2WXJA 1JWUD 3RI7C 4P1CC 2D3CA 1BT0A 2KO3A 1XLOA 2DZJA 3PREA 4RNAA 2MX2A 2NBWB 3TEXA 1TBEA 4H2AA 1Z2MA 1HXYD 1DOIA 3RNCC 3ZJUA 5CHVC 1WXMA 2ICIA 2WQYB 2XK5B 3P1MA 4C80A
chains in the Genus database with same CATH topology
3DPDA 3PRMB 2NR2A 1I35A 5LLIA 2FUHB 1GJZA 2FCNA 2L76A 1RRBA 3DOWA 3GOEA 4W9LA 3MHSD 1Z5SB 4M8NA 2C9WB 2NPTA 2DENB 1WE6A 2KFKA 4GN1A 4HVBA 5E6PA 1GNUA 4ZYNA 1KLVA 3CSFA 4RMAA 3P2BA 4A3PA 4WJNA 3ZTCA 4W9IA 3IFWB 3QX1A 5L83A 3PHXB 2G3QB 3LJ3A 1YX5B 4GSWA 4MSMB 4BBNF 3TBLD 3T8MA 3WAPA 2K8CA 4FJZA 3PVLA 3WIMA 2L3ZA 2GBRA 2KLCA 4TQ0A 4OVUA 2GBMA 2BKFA 3TJPA 1UH6A 2MP2A 2IYDB 4GU2A 4W9GA 3QK0A 1YIWA 2KC1A 3U30A 3PTFC 2NS5A 1E8YA 3PSEB 2CU1A 5KHQA 1UBIA 2O2VB 4NQLB 2WX1A 1GC7A 4IM3A 5LXIB 1C1YB 2KHWB 2FCMA 2KTFA 2J0KA 3DDCB 3UIPB 1E7UA 3ENEA 1S3SG 2K8BA 2KTRA 4HXDA 5AZGA 3V6EB 2ASQA 2ZZPB 1GG3A 2KOXA 1PQSA 1TGZB 2MRPA 4K7UA 5IA7A 4PS3A 2R2OA 1E90A 1Q0WB 2LUEA 3VUXA 3RYTA 4GGQA 3DVGY 2L8JA 1EF1A 4X57B 4LCDE 2LVOA 3TL5A 3AU4A 2J7QB 1IYFA 4NY0A 3CF6E 3OAWA 5G55A 3ZNZB 4TQ1A 4W9HA 2L7RA 4CHKA 3LDZE 1K8RB 1WGGA 3RZFA 1VCBA 3N3KB 2KJHB 2EMTA 4GXBA 3ZIMA 4IUMB 4ANUA 3DVNU 1LQBA 1RAXA 1WXVA 1SIFA 3DVNV 5J18A 4W9DA 4DDGD 2NBUA 3TMPB 4K1RB 3V60A 3PLVA 4MDKE 1H8CA 4ASWC 3CMMB 2AYOB 4KDLB 3QQ8B 4A3OA 1NI2A 4AJYB 5AZFA 1YJ1A 4AJWA 3UGBB 4B9KA 3VHTC 3ONSA 3B08A 3PLUA 4MH0E 2MA9B 1WYWB 2KD0A 2A4ZA 2LD9A 3L0WB 2LGDA 3VQIA 3L10B 2WX0A 4IC7B 2KWUB 1JRUA 2KANA 2LVQA 5G2NA 4ZRIA 3B0AA 1WMHB 4WAAA 2Z59B 2L00B 3VDZA 3HHMA 3H1UA 3GZNI 2W9NA 2KNBA 2MBQA 4MSQB 3VVWB 3W1SA 2RD0A 4BVUC 1UELA 4K7SA 4MJSA 2J0MA 4DDID 3NZUA 3VAWA 3AULA 3JVZX 1ZW7A 4EFOA 4J6IA 2CHWA 1WX9A 1IPGA 5GMVA 2KK8A 1X1MA 2IZVB 3PV1A 3PS6A 1XT9B 4NPNA 3DVGX 1S1QB 3APDA 3W1YA 2JZZA 1WXSA 2LRWA 3RUIB 1L7YA 4FBJB 1OGWA 2IO0B 3N30A 3O65B 4GDKA 5DPTA 2K39A 3EC8A 1D3ZA 3QWZB 2D2QA 1F9JA 2LGXA 3A4RA 4YL8A 2LJ5A 5DCNA 1Q1OA 2AEHA 3QARA 4EZJA 1E8ZA 2KLGA 4ICVA 4K7WA 3L54A 3APCA 2O6VB 2KFKB 2KQ7A 1XD3B 2PE6B 1WFYA 3JYUA 2JVCA 2LWPA 1LM8B 3PPAA 2DZMA 5C23A 5JHBA 1KM7A 4WWPA 4E3CA 2V4LA 3A9JA 2C60A 2ZCBA 5D7GA 5DPRA 4ZRKA 3RT3B 2DYOA 1WJ4A 3C0RB 4KIKA 4EZKA 1WM3A 2C7NB 2LXCA 3IBEA 3T9LA 2BYEA 4JGHB 4MGKE 3NHEB 3NOBA 1R4NI 3V61A 3VTWA 2BGFA 3UF8A 1ZKHA 2ZEQA 1OEYA 1QZEA 3KH0A 4W9CA 4HLEA 2RSUA 4XC2A 2EKEC 2PJHA 2MP2B 3EFUA 1WX7A 2V3SA 4AP4C 4AWJA 2O6VD 1GC6A 1UZXB 2RR9A 2N7DA 4TKNA 2BYVE 3M3JA 3IHPC 4WJQA 1YD8U 3OJ3A 1V2YA 1WGRA 1P0RA 2XK5A 3A4SC 1V5OA 2M17A 4FN2A 3UQBA 3HM3A 2KTRB 4M8MA 3A9KA 1LFDA 2JWZA 3PRPB 2M0XA 2LZ6A 3EHVA 3SU8X 3WANA 2GBJA 3N32A 2N9EB 1WR6E 2CHXA 2L0TA 4MGYE 3VH3B 3ZVVA 2BPSA 4DHJB 4JL9A 4BKSD 3QA8A 3SDLC 1U4AA 2ZNVC 4GB9A 1P9DU 1OEYJ 3RCZA 4ZDVA 4HDQA 1Q5WB 4FLHA 3WAMA 1TTNA 1WM2A 2BWFA 5CHWA 3S2AA 3ZKJC 2M1MA 2RPQA 3JSVA 5TR5A 3TCAA 3VFKA 4BOSC 3ZRCA 1SE9A 3KUCB 2KMAA 4CYEA 4W9KA 2MLBA 3Q3JA 3DBLI 3VTUA 2DAJA 2GBKA 2BKRB 5E6NA 1V86A 3IVFA 5FR6A 4ANXA 2FAZA 1WIAA 3ZW3A 5L95C 2Z0EB 4WWNA 2ZNVB 2FIFA 3AXCA 3QHTA 3VH4B 2L0FA 4MM3A 3H6NA 3W1SC 1Y8RC 2CR5A 2O2VA 5J17A 2FNJB 2JY6A 5JH5C 1P1AA 3L08A 4FJVB 4DXAB 4IM2A 2MBHA 2XBBC 2MBEA 1A5RA 5AZHA 2G4DB 4ANVA 2FCQA 3WALA 1J8CA 2NBVB 2GOWA 2KWCA 3ALBA 4IWPA 4EEWA 3KYDD 4I6NB 3NY5A 4LDTB 4F8CB 4EUTA 3PT2B 2K1FA 3QAQA 1WRDB 2LASA 5CX3A 1WR1A 4HWIB 5JZEB 2KJRA 1SGHA 4OVVA 2LGYA 2N9PC 2DAFA 3TIXA 2PE9A 3BY4B 1NDDA 4MJSB 1L2NA 4HDOA 2N7EA 2WDTB 3I3TB 4RM9A 4G11A 4JQWC 1ZGUB 3JW0X 2K6DB 3KVFB 2BYFA 1EUVB 2D11A 1H4RA 4BKGA 3VTVA 2KDFB 2Y5BB 3RZWC 1RFAA 4WQOB 1KOTA 2LVPA 3NS8A 2KJ6A 4EKUA 1WJUA 3ZUNA 2JZ3B 2JRIB 4IWQA 1E8XA 3A1QA 2N1WA 4GDKB 4E71A 3KYCD 2MBBB 3ZTDA 2JRHA 4NAWB 4F1SA 3L17A 4DHZE 3NZSA 2LI5A 3MTNB 3WAOA 2K25A 1M94A 2J0JA 1WXAA 2N9XA 4KV2A 4HJKA 4HPMB 4ANWA 4W9EA 4HK2A 5BO4B 2DYMA 4MGIE 2G4SA 3UQAA 1LXDA 4FHJA 1P3QU 5IAAC 2ZPYA 1E8WA 3DBHI 4M0WB 4WJPA 5E6OA 3ZNID 2KWVB 1V81A 2I1KA 3WA0A 4HCPB 1NBFC 3MJWA 1WGYA 3A9JB 2HD5B 3V62A 3SD5A 4FADA 2YLMA 2DHZA 2G45B 3DBSA 4KZCA 5DPSA 1E5WA 4KIKB 3OLMD 4XX5A 2NPTB 4EOYA 4ICUA 4P7IA 1WZ0A 2REXA 4A20A 4I6PA 3ZRFA 1V80A 3PRZA 2KFJA 4KVGB 2VRRB 4G50A 4JIOU 4KSKC 3ZDMC 2FCSA 4NNJB 2OOBB 3PHWB 4IM0A 3DQVA 2KZRA 4ZRJA 4G3XB 4WJOA 4BBNC 3R66C 5EDSA 3H7PA 4BFRA 4EZLA 4NJ7A 2HTHA 4HPLB 4AUQC 1OTRB 4GDLA 1WF9A 4G0NB 1I42A 2MBOA 2K6QA 1CMXB 3IG3A 4E74A 2Z0DB 3A9KB 3L13A 4PS8A 1T0YA 2CKHB 3EECA 1GUAB 1G6JA 2ZJDA 3QJZA 2IO1B 3R7QA 1KJTA 2ZCCA 3QCAA 1HE8A 2FIDA 2KVRA 2C7HA 1FXTB 1C3TA 1EO6A 5CTRC 2M4NA 4FJYA 2UYZB 1WH3A 2PPHA 2O6VA 4WWOA 1WGDA 1V9JA 2JPHA 3CSTA 4URKA 2MCNB 4LJOB 2YVCA 2BF8B 4PYZA 2DX5B 2IBIB 1XQQA 3JSVB 3R3MA 3L16A 2NVUI 1J0GA 3HK0A 2KC2A 3AI5A 3ML8A 1V6EA 1WZ3A 2KX3A 4NQKE 1TZ1A 1OQYA 5KHOA 3R7RA 3ZNGC 2R2QA 2JF5A 2IY1B 1UD7A 2DZKA 3PGEA 3V6CB 1IP9A 4IWOA 4BOZB 2KDEB 2MQJA 3A33B 3QC8B 3VXWA 4BKSA 5LXHA 5DPWA 4MELA 2M8SA 5J2RA 2JUOA 1WY8A 2HJ8A 4B95A 1EF5A 2NCNA 2D10A 5D6JB 4K81A 4PS7A 1MG8A 2RGFA 5AEKB 1WGHA 1V49A 5HKHA 2AL3A 2KDBA 2UWQA 2WWZA 2WYQA 3DCGA 3KUZA 4W9FA 3ML9A 4DHJD 2MW5A 2KDIA 3ECIA 1WE7A 2IY0B 2DYBA 4LJPB 1YQBA 2N1VA 4N9F4 1WJNA 4GOCA 4I6LB 4AOFA 4KZ0A 5C1ZA 4II3B 4GMVA 2KX0A 3ZO5B 2DZIA 1AARA 3ZDTA 1RLFA 2CHZA 4PYUA 3PZDA 4B6WA 2D3GA 3M63B 3ZLZA 1P98A 2GMIC 3M95A 3K9OB 2MWSB 3H9DA 2MSED 2PEAA 3H7SA 3X0WA 4JLCA 3A1QB 5CHFA 4GIVA 3APFA 3SHQA 2C7MB 4RM8A 2OJRA 2IO2B 1WI0A 5D2MB 4MGZE 3OJ4B 2B3AA 2JXXA 4HCNB 4LDTD 3UIOB 4KSLC 1E7VA 3RD2A 3Q3FA 1J19A 2KMCA 4KDIC 1UGMA 4W9JA 2C5LC 2V1YA 2K8HA 3QIJA 5D94A 3VUWA 2EMSA 1WJ6A 4TV3A 3DBRI 3M62B 2AL6A 4MEMA 3AU5A 3HIZA 1VD2A 4NJ6A 4FHKA 4FA6A 3UINB 2I1JA 2KKCA 2LXAA 3B1LX 4DK5A 4CO7A 4DHZB 2ZVNA 1R4MI 2GBNA 1UBQA 3RULA 2JT4B 3U8ZA 1WMHA 3KUDB 1BT0A 2IO3B 2KO3A 2AWTA 3U7DA 2DZJA 3PREA 2KN5A 4II2B 2N4FA 2L05A 4F7ZA 5JHAA 3VUYA 2ZPNA 3KW5B 4TUUA 2HE7A 3H7PB 4IG7B 3ZNHB 2MX2A 2KQSA 2NBWB 3BINA 4GDLB 4XZ4A 1TBEA 3X23A 4FULA 1Z2MA 3D32A 4DBGA 4NAWA 3K9PB 4DWFA 2BWES 1V5TA 2A5UA 1WX8A 2KXJA 5CHVC 1WXMA 4BKTA 2XK5B 4IW0A 1ISNA 2D07B 2LRUA 2CS4A 1YX6B 2QHOA 2XEWA 3HM6X 2ZVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPD A;  3PRM B;  2NR2 A;  1I35 A;  5LLI A;  2FUH B;  1GJZ A;  2FCN A;  2L76 A;  1RRB A;  3DOW A;  3GOE A;  4W9L A;  3MHS D;  1Z5S B;  4M8N A;  2C9W B;  2NPT A;  2DEN B;  1WE6 A;  2KFK A;  4GN1 A;  4HVB A;  5E6P A;  1GNU A;  4ZYN A;  1KLV A;  3CSF A;  4RMA A;  3P2B A;  4A3P A;  4WJN A;  3ZTC A;  4W9I A;  3IFW B;  3QX1 A;  5L83 A;  3PHX B;  2G3Q B;  3LJ3 A;  1YX5 B;  4GSW A;  4MSM B;  4BBN F;  3TBL D;  3T8M A;  3WAP A;  2K8C A;  4FJZ A;  3PVL A;  3WIM A;  2L3Z A;  2GBR A;  2KLC A;  4TQ0 A;  4OVU A;  2GBM A;  2BKF A;  3TJP A;  1UH6 A;  2MP2 A;  2IYD B;  4GU2 A;  4W9G A;  3QK0 A;  1YIW A;  2KC1 A;  3U30 A;  3PTF C;  2NS5 A;  1E8Y A;  3PSE B;  2CU1 A;  5KHQ A;  1UBI A;  2O2V B;  4NQL B;  2WX1 A;  1GC7 A;  4IM3 A;  5LXI B;  1C1Y B;  2KHW B;  2FCM A;  2KTF A;  2J0K A;  3DDC B;  3UIP B;  1E7U A;  3ENE A;  1S3S G;  2K8B A;  2KTR A;  4HXD A;  5AZG A;  3V6E B;  2ASQ A;  2ZZP B;  1GG3 A;  2KOX A;  1PQS A;  1TGZ B;  2MRP A;  4K7U A;  5IA7 A;  4PS3 A;  2R2O A;  1E90 A;  1Q0W B;  2LUE A;  3VUX A;  3RYT A;  4GGQ A;  3DVG Y;  2L8J A;  1EF1 A;  4X57 B;  4LCD E;  2LVO A;  3TL5 A;  3AU4 A;  2J7Q B;  1IYF A;  4NY0 A;  3CF6 E;  3OAW A;  5G55 A;  3ZNZ B;  4TQ1 A;  4W9H A;  2L7R A;  4CHK A;  3LDZ E;  1K8R B;  1WGG A;  3RZF A;  1VCB A;  3N3K B;  2KJH B;  2EMT A;  4GXB A;  3ZIM A;  4IUM B;  4ANU A;  3DVN U;  1LQB A;  1RAX A;  1WXV A;  1SIF A;  3DVN V;  5J18 A;  4W9D A;  4DDG D;  2NBU A;  3TMP B;  4K1R B;  3V60 A;  3PLV A;  4MDK E;  1H8C A;  4ASW C;  3CMM B;  2AYO B;  4KDL B;  3QQ8 B;  4A3O A;  1NI2 A;  4AJY B;  5AZF A;  1YJ1 A;  4AJW A;  3UGB B;  4B9K A;  3VHT C;  3ONS A;  3B08 A;  3PLU A;  4MH0 E;  2MA9 B;  1WYW B;  2KD0 A;  2A4Z A;  2LD9 A;  3L0W B;  2LGD A;  3VQI A;  3L10 B;  2WX0 A;  4IC7 B;  2KWU B;  1JRU A;  2KAN A;  2LVQ A;  5G2N A;  4ZRI A;  3B0A A;  1WMH B;  4WAA A;  2Z59 B;  2L00 B;  3VDZ A;  3HHM A;  3H1U A;  3GZN I;  2W9N A;  2KNB A;  2MBQ A;  4MSQ B;  3VVW B;  3W1S A;  2RD0 A;  4BVU C;  1UEL A;  4K7S A;  4MJS A;  2J0M A;  4DDI D;  3NZU A;  3VAW A;  3AUL A;  3JVZ X;  1ZW7 A;  4EFO A;  4J6I A;  2CHW A;  1WX9 A;  1IPG A;  5GMV A;  2KK8 A;  1X1M A;  2IZV B;  3PV1 A;  3PS6 A;  1XT9 B;  4NPN A;  3DVG X;  1S1Q B;  3APD A;  3W1Y A;  2JZZ A;  1WXS A;  2LRW A;  3RUI B;  1L7Y A;  4FBJ B;  1OGW A;  2IO0 B;  3N30 A;  3O65 B;  4GDK A;  5DPT A;  2K39 A;  3EC8 A;  1D3Z A;  3QWZ B;  2D2Q A;  1F9J A;  2LGX A;  3A4R A;  4YL8 A;  2LJ5 A;  5DCN A;  1Q1O A;  2AEH A;  3QAR A;  4EZJ A;  1E8Z A;  2KLG A;  4ICV A;  4K7W A;  3L54 A;  3APC A;  2O6V B;  2KFK B;  2KQ7 A;  1XD3 B;  2PE6 B;  1WFY A;  3JYU A;  2JVC A;  2LWP A;  1LM8 B;  3PPA A;  2DZM A;  5C23 A;  5JHB A;  1KM7 A;  4WWP A;  4E3C A;  2V4L A;  3A9J A;  2C60 A;  2ZCB A;  5D7G A;  5DPR A;  4ZRK A;  3RT3 B;  2DYO A;  1WJ4 A;  3C0R B;  4KIK A;  4EZK A;  1WM3 A;  2C7N B;  2LXC A;  3IBE A;  3T9L A;  2BYE A;  4JGH B;  4MGK E;  3NHE B;  3NOB A;  1R4N I;  3V61 A;  3VTW A;  2BGF A;  3UF8 A;  1ZKH A;  2ZEQ A;  1OEY A;  1QZE A;  3KH0 A;  4W9C A;  4HLE A;  2RSU A;  4XC2 A;  2EKE C;  2PJH A;  2MP2 B;  3EFU A;  1WX7 A;  2V3S A;  4AP4 C;  4AWJ A;  2O6V D;  1GC6 A;  1UZX B;  2RR9 A;  2N7D A;  4TKN A;  2BYV E;  3M3J A;  3IHP C;  4WJQ A;  1YD8 U;  3OJ3 A;  1V2Y A;  1WGR A;  1P0R A;  2XK5 A;  3A4S C;  1V5O A;  2M17 A;  4FN2 A;  3UQB A;  3HM3 A;  2KTR B;  4M8M A;  3A9K A;  1LFD A;  2JWZ A;  3PRP B;  2M0X A;  2LZ6 A;  3EHV A;  3SU8 X;  3WAN A;  2GBJ A;  3N32 A;  2N9E B;  1WR6 E;  2CHX A;  2L0T A;  4MGY E;  3VH3 B;  3ZVV A;  2BPS A;  4DHJ B;  4JL9 A;  4BKS D;  3QA8 A;  3SDL C;  1U4A A;  2ZNV C;  4GB9 A;  1P9D U;  1OEY J;  3RCZ A;  4ZDV A;  4HDQ A;  1Q5W B;  4FLH A;  3WAM A;  1TTN A;  1WM2 A;  2BWF A;  5CHW A;  3S2A A;  3ZKJ C;  2M1M A;  2RPQ A;  3JSV A;  5TR5 A;  3TCA A;  3VFK A;  4BOS C;  3ZRC A;  1SE9 A;  3KUC B;  2KMA A;  4CYE A;  4W9K A;  2MLB A;  3Q3J A;  3DBL I;  3VTU A;  2DAJ A;  2GBK A;  2BKR B;  5E6N A;  1V86 A;  3IVF A;  5FR6 A;  4ANX A;  2FAZ A;  1WIA A;  3ZW3 A;  5L95 C;  2Z0E B;  4WWN A;  2ZNV B;  2FIF A;  3AXC A;  3QHT A;  3VH4 B;  2L0F A;  4MM3 A;  3H6N A;  3W1S C;  1Y8R C;  2CR5 A;  2O2V A;  5J17 A;  2FNJ B;  2JY6 A;  5JH5 C;  1P1A A;  3L08 A;  4FJV B;  4DXA B;  4IM2 A;  2MBH A;  2XBB C;  2MBE A;  1A5R A;  5AZH A;  2G4D B;  4ANV A;  2FCQ A;  3WAL A;  1J8C A;  2NBV B;  2GOW A;  2KWC A;  3ALB A;  4IWP A;  4EEW A;  3KYD D;  4I6N B;  3NY5 A;  4LDT B;  4F8C B;  4EUT A;  3PT2 B;  2K1F A;  3QAQ A;  1WRD B;  2LAS A;  5CX3 A;  1WR1 A;  4HWI B;  5JZE B;  2KJR A;  1SGH A;  4OVV A;  2LGY A;  2N9P C;  2DAF A;  3TIX A;  2PE9 A;  3BY4 B;  1NDD A;  4MJS B;  1L2N A;  4HDO A;  2N7E A;  2WDT B;  3I3T B;  4RM9 A;  4G11 A;  4JQW C;  1ZGU B;  3JW0 X;  2K6D B;  3KVF B;  2BYF A;  1EUV B;  2D11 A;  1H4R A;  4BKG A;  3VTV A;  2KDF B;  2Y5B B;  3RZW C;  1RFA A;  4WQO B;  1KOT A;  2LVP A;  3NS8 A;  2KJ6 A;  4EKU A;  1WJU A;  3ZUN A;  2JZ3 B;  2JRI B;  4IWQ A;  1E8X A;  3A1Q A;  2N1W A;  4GDK B;  4E71 A;  3KYC D;  2MBB B;  3ZTD A;  2JRH A;  4NAW B;  4F1S A;  3L17 A;  4DHZ E;  3NZS A;  2LI5 A;  3MTN B;  3WAO A;  2K25 A;  1M94 A;  2J0J A;  1WXA A;  2N9X A;  4KV2 A;  4HJK A;  4HPM B;  4ANW A;  4W9E A;  4HK2 A;  5BO4 B;  2DYM A;  4MGI E;  2G4S A;  3UQA A;  1LXD A;  4FHJ A;  1P3Q U;  5IAA C;  2ZPY A;  1E8W A;  3DBH I;  4M0W B;  4WJP A;  5E6O A;  3ZNI D;  2KWV B;  1V81 A;  2I1K A;  3WA0 A;  4HCP B;  1NBF C;  3MJW A;  1WGY A;  3A9J B;  2HD5 B;  3V62 A;  3SD5 A;  4FAD A;  2YLM A;  2DHZ A;  2G45 B;  3DBS A;  4KZC A;  5DPS A;  1E5W A;  4KIK B;  3OLM D;  4XX5 A;  2NPT B;  4EOY A;  4ICU A;  4P7I A;  1WZ0 A;  2REX A;  4A20 A;  4I6P A;  3ZRF A;  1V80 A;  3PRZ A;  2KFJ A;  4KVG B;  2VRR B;  4G50 A;  4JIO U;  4KSK C;  3ZDM C;  2FCS A;  4NNJ B;  2OOB B;  3PHW B;  4IM0 A;  3DQV A;  2KZR A;  4ZRJ A;  4G3X B;  4WJO A;  4BBN C;  3R66 C;  5EDS A;  3H7P A;  4BFR A;  4EZL A;  4NJ7 A;  2HTH A;  4HPL B;  4AUQ C;  1OTR B;  4GDL A;  1WF9 A;  4G0N B;  1I42 A;  2MBO A;  2K6Q A;  1CMX B;  3IG3 A;  4E74 A;  2Z0D B;  3A9K B;  3L13 A;  4PS8 A;  1T0Y A;  2CKH B;  3EEC A;  1GUA B;  1G6J A;  2ZJD A;  3QJZ A;  2IO1 B;  3R7Q A;  1KJT A;  2ZCC A;  3QCA A;  1HE8 A;  2FID A;  2KVR A;  2C7H A;  1FXT B;  1C3T A;  1EO6 A;  5CTR C;  2M4N A;  4FJY A;  2UYZ B;  1WH3 A;  2PPH A;  2O6V A;  4WWO A;  1WGD A;  1V9J A;  2JPH A;  3CST A;  4URK A;  2MCN B;  4LJO B;  2YVC A;  2BF8 B;  4PYZ A;  2DX5 B;  2IBI B;  1XQQ A;  3JSV B;  3R3M A;  3L16 A;  2NVU I;  1J0G A;  3HK0 A;  2KC2 A;  3AI5 A;  3ML8 A;  1V6E A;  1WZ3 A;  2KX3 A;  4NQK E;  1TZ1 A;  1OQY A;  5KHO A;  3R7R A;  3ZNG C;  2R2Q A;  2JF5 A;  2IY1 B;  1UD7 A;  2DZK A;  3PGE A;  3V6C B;  1IP9 A;  4IWO A;  4BOZ B;  2KDE B;  2MQJ A;  3A33 B;  3QC8 B;  3VXW A;  4BKS A;  5LXH A;  5DPW A;  4MEL A;  2M8S A;  5J2R A;  2JUO A;  1WY8 A;  2HJ8 A;  4B95 A;  1EF5 A;  2NCN A;  2D10 A;  5D6J B;  4K81 A;  4PS7 A;  1MG8 A;  2RGF A;  5AEK B;  1WGH A;  1V49 A;  5HKH A;  2AL3 A;  2KDB A;  2UWQ A;  2WWZ A;  2WYQ A;  3DCG A;  3KUZ A;  4W9F A;  3ML9 A;  4DHJ D;  2MW5 A;  2KDI A;  3ECI A;  1WE7 A;  2IY0 B;  2DYB A;  4LJP B;  1YQB A;  2N1V A;  4N9F 4;  1WJN A;  4GOC A;  4I6L B;  4AOF A;  4KZ0 A;  5C1Z A;  4II3 B;  4GMV A;  2KX0 A;  3ZO5 B;  2DZI A;  1AAR A;  3ZDT A;  1RLF A;  2CHZ A;  4PYU A;  3PZD A;  4B6W A;  2D3G A;  3M63 B;  3ZLZ A;  1P98 A;  2GMI C;  3M95 A;  3K9O B;  2MWS B;  3H9D A;  2MSE D;  2PEA A;  3H7S A;  3X0W A;  4JLC A;  3A1Q B;  5CHF A;  4GIV A;  3APF A;  3SHQ A;  2C7M B;  4RM8 A;  2OJR A;  2IO2 B;  1WI0 A;  5D2M B;  4MGZ E;  3OJ4 B;  2B3A A;  2JXX A;  4HCN B;  4LDT D;  3UIO B;  4KSL C;  1E7V A;  3RD2 A;  3Q3F A;  1J19 A;  2KMC A;  4KDI C;  1UGM A;  4W9J A;  2C5L C;  2V1Y A;  2K8H A;  3QIJ A;  5D94 A;  3VUW A;  2EMS A;  1WJ6 A;  4TV3 A;  3DBR I;  3M62 B;  2AL6 A;  4MEM A;  3AU5 A;  3HIZ A;  1VD2 A;  4NJ6 A;  4FHK A;  4FA6 A;  3UIN B;  2I1J A;  2KKC A;  2LXA A;  3B1L X;  4DK5 A;  4CO7 A;  4DHZ B;  2ZVN A;  1R4M I;  2GBN A;  1UBQ A;  3RUL A;  2JT4 B;  3U8Z A;  1WMH A;  3KUD B;  1BT0 A;  2IO3 B;  2KO3 A;  2AWT A;  3U7D A;  2DZJ A;  3PRE A;  2KN5 A;  4II2 B;  2N4F A;  2L05 A;  4F7Z A;  5JHA A;  3VUY A;  2ZPN A;  3KW5 B;  4TUU A;  2HE7 A;  3H7P B;  4IG7 B;  3ZNH B;  2MX2 A;  2KQS A;  2NBW B;  3BIN A;  4GDL B;  4XZ4 A;  1TBE A;  3X23 A;  4FUL A;  1Z2M A;  3D32 A;  4DBG A;  4NAW A;  3K9P B;  4DWF A;  2BWE S;  1V5T A;  2A5U A;  1WX8 A;  2KXJ A;  5CHV C;  1WXM A;  4BKT A;  2XK5 B;  4IW0 A;  1ISN A;  2D07 B;  2LRU A;  2CS4 A;  1YX6 B;  2QHO A;  2XEW A;  3HM6 X;  2ZVO A; 
#chains in the Genus database with same CATH topology
 2H89 B;  2LGS A;  5LLI A;  2FUH B;  3Q14 C;  3MJ5 A;  2NPT A;  3DBR B;  2DEN B;  2ON8 A;  4GN1 A;  4B0M A;  1GNU A;  4N58 A;  4ZYN A;  4WJN A;  2IJ0 A;  4D2K A;  4YSZ B;  1FMA D;  4PK1 A;  3PHX B;  4GSW A;  3ZXV A;  3NG0 A;  1ACC A;  3AEE B;  1FRD A;  4IKG A;  1VR9 A;  4OVU A;  4TSS A;  1J7B A;  2GBM A;  2MP2 A;  1I4R A;  4GU2 A;  4O1N A;  4W9G A;  3PSE B;  3Q8E A;  1UBI A;  4NQL B;  1SIJ A;  1E7P B;  5LXI B;  4LNF A;  2J0K A;  2WU5 B;  3UIP B;  2K8B A;  3ZYY X;  2ASQ A;  3FC4 A;  2KOX A;  3EFC A;  1TGZ B;  4K7U A;  3AE8 B;  2R2O A;  1E90 A;  1L0X B;  2LUE A;  2L1A A;  3DVG Y;  2WXQ A;  2L8J A;  1EF1 A;  4RF1 A;  2L7R A;  3N9Y C;  3NUH B;  2CJN A;  1NYQ A;  1VCB A;  3ZIM A;  3BVG A;  4QAY A;  4A8X C;  2QEJ C;  2IND C;  3AE3 B;  3V60 A;  4MDK E;  1MHH E;  2AYO B;  4HRS A;  3TEY A;  1I4H A;  4AJW A;  4B9K A;  3VHT C;  3B9J A;  3B08 A;  2KQ4 X;  2A4Z A;  3RN9 C;  2EEL A;  3VQI A;  3L10 B;  1WXQ A;  2BTE A;  3ZJV A;  3OG5 A;  4WAA A;  2L00 B;  3VDZ A;  3H1U A;  3AEF B;  3W1S A;  4WAF A;  4BVU C;  4K7S A;  1K52 A;  2HTM E;  3W5U B;  3VAW A;  3JVZ X;  4LNI A;  3MFG A;  4NPN A;  4RGM A;  3R2I A;  2IO0 B;  3O65 B;  2K39 A;  1R7S A;  1F9J A;  2KN4 A;  3VR9 B;  5DCN A;  3QAR A;  3U7Z A;  4K7W A;  4KKJ A;  3LYY A;  2KQ7 A;  1VZ6 A;  1XD3 B;  1TKE A;  2MH7 A;  1KM7 A;  1V1O A;  3A9J A;  5DPR A;  4ARI A;  5BMG A;  2JYT A;  3RT3 B;  3C0R B;  4S0R A;  2C7N B;  3RMK C;  3T9L A;  4JGH B;  3NHE B;  3NOB A;  2WDQ B;  1E9M A;  2EKE C;  5BMI A;  2RR9 A;  3I5J C;  1C79 A;  3IHP C;  1YJJ A;  1V2Y A;  1N60 A;  3A4S C;  2M17 A;  2N9L A;  2J53 A;  2I38 A;  2KTR B;  3BZD B;  1SE3 A;  2JWZ A;  5JXV A;  2GBJ A;  3VH3 B;  4JL9 A;  3QA8 A;  3SDL C;  2ZNV C;  1OEY J;  3NVW A;  4RCO A;  1E6E B;  4FLH A;  2DWQ A;  3ZKJ C;  5L83 A;  3S2A A;  2M1M A;  3JSV A;  1L0Y B;  2N0S B;  4YXD B;  2HJ1 A;  3VTU A;  2MLB A;  3Q3J A;  2DAJ A;  5EE9 A;  4BAX A;  5E6N A;  1V86 A;  1DGJ A;  2BB5 A;  1J7C A;  2ZNV B;  4JPS A;  3Q6B A;  1JWS D;  3C8Y A;  3QHT A;  5J17 A;  2FNJ B;  1P1A A;  3L08 A;  4IM2 A;  2MBH A;  4ANV A;  2G4D B;  1PFD A;  2WXL A;  4XWW A;  1FPY A;  2JXT A;  2N9K A;  3ALB A;  3KYD D;  2GLS A;  3NY5 A;  4LDT B;  1VDV A;  2FBW B;  4EUT A;  3KLS X;  3QAQ A;  3RNA C;  5CX3 A;  4WUR A;  1YN3 A;  2LMC A;  3N20 C;  3BII D;  5JZE B;  1SJH D;  1T3Q A;  1PGA A;  3MC8 A;  1D5M C;  1XXG A;  1KLG D;  4M00 A;  2KMM A;  4MJS B;  2WDT B;  4RM9 A;  4G11 A;  1QOG A;  3VTV A;  3RZW C;  2QSD A;  1RFA A;  2LVP A;  3NS8 A;  3MP9 A;  3ZUN A;  4UDU C;  3A1Q A;  2N1W A;  4GDK B;  3L17 A;  4LNK A;  2E6X A;  2J0J A;  3AED B;  4ANW A;  1XF5 L;  4HK2 A;  1HTQ A;  2DYM A;  5HI1 A;  1HEZ E;  1LXD A;  2MHJ A;  2OHF A;  5IAA C;  2ZPY A;  3DBH I;  4K3C A;  4M0W B;  4WJP A;  2CJO A;  2NTT A;  4M02 A;  1NBF C;  3V62 A;  1WWT A;  3SD5 A;  4C4V A;  2G45 B;  3OLM D;  4XX5 A;  2REX A;  4A20 A;  3PRZ A;  1HTO A;  4RF0 A;  3AE2 B;  3DWM A;  1T6B X;  2VH1 A;  1FFU A;  4KSK C;  3Q3N C;  4IM0 A;  3DQV A;  2KAJ A;  2KZR A;  4ZRJ A;  4G3X B;  1EM7 A;  4REZ A;  1JW9 D;  2L52 A;  4NJ7 A;  1N5X A;  4HPL B;  1C4C A;  3IT6 B;  4CQN A;  1KFY B;  1T0Y A;  1ZPS A;  2ZCC A;  1HE8 A;  2GI9 A;  5IN7 A;  3W9C B;  4OZA A;  3DBH B;  2K0P A;  2YVC A;  2BF8 B;  2IBI B;  3R3M A;  1D5Z C;  3RPF C;  1J0G A;  3HK0 A;  2KC2 A;  2MJE A;  1V6E A;  1FNV A;  1OQQ A;  2MQJ A;  1BML C;  5LXH A;  4BKS A;  5J2R A;  5H8Y E;  1GB1 A;  2HJ8 A;  3DHG C;  2NCN A;  2G9H D;  2RGF A;  2L32 A;  5AEK B;  4MAC A;  2D3B A;  4XWT A;  2AL3 A;  3DCG A;  4W9F A;  3KUZ A;  2G1E A;  2MW5 A;  4IDI A;  1WGK A;  2IY0 B;  4AOF A;  1FIQ A;  5FK9 C;  2AQ1 B;  2IGG A;  2TSS A;  4YTP B;  3C19 A;  3M63 B;  1P98 A;  1GAQ B;  2NMQ A;  3AE7 B;  1SEB D;  3H7S A;  4JLC A;  1DYQ A;  3APF A;  2C7M B;  4OZB A;  2IO2 B;  1MPE A;  3OJ4 B;  2B3A A;  4HCN B;  3NVV A;  4LDT D;  3Q3F A;  2KMC A;  1CK1 A;  4W9J A;  1QOA A;  3M62 B;  3AMZ A;  3HIZ A;  3B1L X;  4CO7 A;  2KDM A;  1R4M I;  4L1B A;  1UBQ A;  3UI3 A;  1MI0 A;  3U8Z A;  1WMH A;  3KUD B;  3DHI C;  2AWT A;  5JHA A;  4TUU A;  3KW5 B;  3H7P B;  3ZNH B;  3AB5 A;  3TEW A;  3AM9 A;  4XZ4 A;  1FD6 A;  3CWI A;  3D32 A;  4DBG A;  4NAW A;  3V05 A;  2AQ3 B;  2A5U A;  3GB1 A;  4BKT A;  1ISN A;  1QKZ A;  1GB4 A;  2CS4 A;  5G5G A;  2ZVO A;  4KKI A;  3DPD A;  2FCN A;  2L76 A;  1JRO A;  4W9L A;  2XN9 C;  1WE6 A;  2KFK A;  4HVB A;  5E6P A;  5HFY A;  1R4M B;  1E0Z A;  4XE0 A;  4MSM B;  3ZGZ A;  1SJE D;  3AEB B;  1I4Q A;  3PVL A;  4LNO A;  4P1B C;  4TQ0 A;  2BYT A;  4BZA A;  3Q69 A;  4GLS C;  1XLN A;  4KGS A;  3URY A;  2NS5 A;  1XEE A;  1E8Y A;  5KHQ A;  2DLB A;  2WXN A;  2KHW B;  3DDC B;  1PQS A;  4PS3 A;  3VUX A;  1A70 A;  3J9C A;  4X57 B;  1IYF A;  2J7Q B;  4NY0 A;  3CF6 E;  3ZNZ B;  1WYG A;  3RNG C;  2LGI A;  3LDZ E;  3RZF A;  3N3K B;  4WWM A;  2D5G A;  1SIF A;  3DVN V;  5J18 A;  3T3N A;  4W9D A;  4DDG D;  1E10 A;  3TMP B;  3PLV A;  2V4I B;  4ASW C;  3TUO A;  4HJG E;  5EE0 A;  1VJK A;  2MA9 B;  1WYW B;  2LD9 A;  2IDY A;  3L0W B;  1V1P A;  4IC7 B;  2KWU B;  3E9S A;  2KAN A;  4RGT A;  2Z59 B;  1PUT A;  2W9N A;  2WS3 B;  4DDI D;  4USA A;  2MJD A;  3PV1 A;  3I9V 1;  1XT9 B;  1N61 A;  3APD A;  2DNF A;  2JZZ A;  2LRW A;  4FBJ B;  1OGW A;  2BBC A;  1T0S C;  2PVO D;  1ESF A;  2WXM A;  3BVM A;  3QWZ B;  2WNM A;  1E8Z A;  3V3X A;  2YEP B;  3L54 A;  3AEA B;  1SBB B;  1WFY A;  2JQR B;  3JYU A;  3P4Q B;  2JVC A;  2VH2 A;  4WWP A;  4E3C A;  2V4L A;  3Q3O C;  2ZCB A;  4ZRK A;  1WJ4 A;  1J7A A;  2LXC A;  1QLB B;  1ET9 A;  3VTW A;  3HRD D;  1QT9 A;  1QOF A;  2LJI A;  2MP2 B;  2PJH A;  2W54 A;  3EFU A;  2V3S A;  4AWJ A;  2QJL A;  1FO4 A;  2O6V D;  2XK5 A;  4YTN B;  4FN2 A;  1ZUD 2;  1YN4 A;  2LZ6 A;  3EHV A;  3B2G A;  4ZOH C;  3BWU D;  1WR6 E;  4YWG G;  3ZVV A;  3RCZ A;  1Q5W B;  3ZXR A;  5CHW A;  4BOS C;  3TCA A;  3ZRC A;  4NAM A;  2E3T A;  2KMA A;  4W9K A;  1OQR A;  2GBK A;  4RGN A;  2BKR B;  3IVF A;  5FR6 A;  4ANX A;  2Y5C A;  1WIA A;  2Z0E B;  1FXA A;  2Q5W D;  5D3I B;  3VRB B;  2FIF A;  1M4V A;  4AQ7 A;  2L0F A;  4MM3 A;  3W1S C;  2CR5 A;  2WXR A;  1FFV A;  1C9F A;  5JH5 C;  4DXA B;  4FJV B;  2XBB C;  2MBE A;  4XYC A;  5AZH A;  1JWA D;  1J8C A;  2FCQ A;  3WAL A;  2NBV B;  4IWP A;  4EEW A;  3PT2 B;  2K1F A;  1WRD B;  1C78 A;  4HWI B;  3P42 A;  1AYF A;  2BB6 A;  3P4S B;  3TIX A;  1SSN A;  2INP E;  1NDD A;  2WXP A;  3BY4 B;  1L2N A;  2GB1 A;  3AE9 B;  1KH0 A;  4C7Z A;  3JW0 X;  2BYF A;  4OZC A;  4BKG A;  2KDF B;  1JQ4 A;  5LNK 1;  1EU3 A;  1KOT A;  5BMH A;  2KJ6 A;  1WJU A;  2JZ3 B;  4N59 A;  4IWQ A;  3ZTD A;  2J42 A;  2JRH A;  4Q2J A;  3MTN B;  1M94 A;  1WXA A;  2V3P A;  1P3Q U;  1F77 A;  1E8W A;  3AE6 B;  3ZNI D;  2KWV B;  1SXT A;  4HCP B;  1WGY A;  3A9J B;  5AUK A;  2YLM A;  4ICU A;  1TKY A;  1V80 A;  3H8H A;  1UUP A;  4C00 A;  3PHW B;  4HPP A;  4WJO A;  4LTU A;  3R66 C;  5C2T B;  4BFR A;  2HTH A;  1TIF A;  4GDL A;  1I42 A;  4ZYS A;  4E74 A;  2ACZ B;  3QJZ A;  5IP4 D;  3QCA A;  2FID A;  4A55 A;  2UYZ B;  4WWO A;  4A90 A;  4DQO C;  2MCN B;  3JSV B;  3MHZ A;  2WXH A;  2NVU I;  3E56 A;  2BS2 B;  4MT5 A;  2KX3 A;  2BT6 A;  2N7J A;  5KHO A;  2IY1 B;  3MC9 A;  2KDE B;  4MEL A;  3AE4 B;  1BXT A;  1VZ7 A;  1D4B A;  3AV8 A;  5D6J B;  4K81 A;  4PS7 A;  2JX5 A;  4LLG M;  2H88 B;  2ONQ A;  2JZP A;  1P7E A;  1XCQ L;  4YSY B;  2KDB A;  2INN E;  3FIL A;  3N1Z C;  4LJP B;  1TKG A;  4GOC A;  5FR3 A;  2DZI A;  4XGA B;  4US9 A;  2JYE A;  1ZOY B;  3ZDT A;  2CHZ A;  3PZD A;  4B6W A;  3ZLZ A;  3KWL A;  2PTL A;  3RNF C;  3K9O B;  5BYS A;  1T0Q C;  2PEA A;  3X0W A;  3A1Q B;  5CHF A;  1F1H A;  2FE8 A;  4JX1 C;  1JAL A;  4MGZ E;  1WRI A;  2JXX A;  3UIO B;  4KSL C;  1E7V A;  3RD2 A;  1QQR A;  1J19 A;  2C5L C;  4R3D A;  5D94 A;  4C4V B;  1JML A;  4MEM A;  3AU5 A;  1EWY C;  2W3R A;  4FA6 A;  2I1J A;  1MHX A;  2KKC A;  2KYW A;  4DHZ B;  3Q8B A;  3RUL A;  5G5H A;  4II2 B;  2L05 A;  2HE7 A;  4IG7 B;  2L83 A;  2XNA C;  4FUL A;  4ZRQ A;  4DWF A;  1WX8 A;  1WSP A;  4IW0 A;  2D07 B;  2VZK B;  1YX6 B;  2QHO A;  2M19 A;  1C4A A;  5IKC M;  3HM6 X;  2WHI A;  2NR2 A;  1GJZ A;  1XLP A;  3GOE A;  1RRB A;  3OWE B;  4M8N A;  1NEN B;  4RMA A;  3P2B A;  4A3P A;  4XDD A;  1IGD A;  2KWD A;  1I7H A;  2B76 B;  3LJ3 A;  5C3J B;  4BBN F;  3T8M A;  3WAP A;  4FJZ A;  3WIM A;  2KLC A;  2WXF A;  2OED A;  1UF0 A;  1SE4 A;  1UH6 A;  2IYD B;  5HHD G;  3RNB C;  3PTF C;  4J3O D;  3FKY A;  2O2V B;  2JWU A;  2WX1 A;  1GC7 A;  3CIR B;  2KTF A;  1T0R C;  1E7U A;  2Z8L A;  2PMV A;  3ENE A;  5AZG A;  3WCQ A;  4OVZ A;  2ZZP B;  1GG3 A;  4WH4 A;  3Q8F A;  1Q0W B;  4LCD E;  2LVO A;  3AE1 B;  3OAW A;  1ET6 A;  2WDV B;  4CHK A;  2KJH B;  2EMT A;  3KQ4 A;  1LQB A;  2WXG A;  1RAX A;  3B2F A;  1UWX A;  1QOB A;  2NTS A;  1ZXH A;  4KDL B;  2K3U A;  1D6E C;  3PZ8 A;  3QQ8 B;  1NI2 A;  4AJY B;  5AZF A;  3UGB B;  3ONS A;  2WGS A;  3PLU A;  4WIP A;  2LGD A;  1V8C A;  1RFK A;  1JRU A;  1VLB A;  2UU7 A;  2ZW0 A;  2LVQ A;  1ROE A;  3KWV A;  5G2N A;  4ZRI A;  1WMH B;  1FCL A;  3GZN I;  2KNB A;  2MBQ A;  2RD0 A;  3FAH A;  1UEL A;  2QC8 A;  5EE3 A;  1XO3 A;  4EFO A;  1WX9 A;  2KK8 A;  1X1M A;  5D3D A;  3SEB A;  3GE3 C;  3PS6 A;  3W1Y A;  3DVG X;  1L4D B;  3GP7 A;  2BS4 B;  1YN5 A;  5DPT A;  2D2Q A;  2AX5 A;  3A4R A;  3U2S C;  3P63 A;  4A6Q A;  1Q1O A;  2AEH A;  3LB8 C;  2O6V B;  2KFK B;  5AUI A;  3PO0 A;  2LWP A;  1LM8 B;  2RPV A;  1IBX A;  2HDE A;  1XLQ A;  3PPA A;  5C23 A;  5JHB A;  3TEZ A;  1AW7 A;  2DYO A;  4KIK A;  4EZK A;  1WM3 A;  2W3S A;  1TS4 A;  3IBE A;  2BYE A;  4MGK E;  3V61 A;  1R4N I;  3GZN B;  3VRA B;  4HLE A;  3KH0 A;  4W9C A;  3NRZ A;  4JWS C;  4AP4 C;  3AEG B;  2VZK D;  1GC6 A;  1UZX B;  2IGD A;  4TKN A;  2N7D A;  2BYV E;  4WJQ A;  2SEB D;  1YD8 U;  3R8B A;  1V5O A;  3UQB A;  3HM3 A;  4M8M A;  3A9K A;  4ZHP A;  1L4Z B;  3PRP B;  2M0X A;  5TSS A;  2V3N A;  3SU8 X;  4US8 A;  3VR8 B;  4YTM B;  5T8I A;  4KX6 B;  2BPS A;  4BKS D;  1U4A A;  4GB9 A;  4HDQ A;  1WM2 A;  4YSX B;  4PT5 A;  2PVG C;  5TR5 A;  3VFK A;  1TS3 A;  3PZ7 A;  1LGR A;  3KUC B;  5IO9 A;  4CYE A;  1R4N B;  3NVY A;  1T5X D;  2FAZ A;  5L95 C;  3BVZ A;  4ARC A;  2ZW1 A;  1LO5 D;  3AXC A;  3VH4 B;  1Y8R C;  2KT7 A;  3I57 A;  1ENF A;  3Q8A A;  2WDR B;  3TSS A;  2QDF A;  1PGB A;  1A5R A;  1V1P B;  2JU6 X;  2KWC A;  2RMM A;  2MEK A;  4F8C B;  2LAS A;  4ZRP A;  3ZJT A;  3P4P B;  3AEC B;  1YMH E;  2DAF A;  1V97 A;  4HDO A;  2N7E A;  3I3T B;  4JQW C;  1ZGU B;  1F2R I;  3KVF B;  3NZ3 A;  2D11 A;  4WQO B;  4EKU A;  1ZE3 D;  1L5P A;  2JRI B;  3KYC D;  1I4X A;  4L23 A;  1GOZ A;  2LI5 A;  3NZS A;  3WAO A;  2K25 A;  4W9E A;  5BO4 B;  1D5X C;  4MGI E;  2LUM A;  3UQA A;  4FHJ A;  1IGC A;  4DXF A;  3WA0 A;  4P6V F;  1F2R C;  1TY2 A;  3MJW A;  2HD5 B;  1Y56 A;  4A9A A;  2DHZ A;  4EOY A;  2AQ2 B;  2NPT B;  1WZ0 A;  2OJW A;  4KVG B;  2VRR B;  4G50 A;  4JIO U;  1XCT L;  2DBY A;  3T3O A;  2FCS A;  4NNJ B;  1K50 A;  3NJT A;  1UGJ A;  4HRO A;  5EDS A;  4EZL A;  4AUQ C;  1OTR B;  1CMX B;  3IG3 A;  1RWS A;  2Z0D B;  3EEC A;  2ZJD A;  2IO1 B;  3R7Q A;  2KVR A;  5CTR C;  2M4N A;  4FJY A;  1B1Z A;  1WGD A;  3CST A;  1YOV B;  4LJO B;  1XQQ A;  1KTK A;  5IOI A;  3AI5 A;  3ML8 A;  2LHE A;  3RFZ B;  1KLU D;  4NQK E;  1TZ1 A;  1OQY A;  3R7R A;  3V6C B;  1UD7 A;  2DZK A;  3BK1 A;  4IWO A;  3A33 B;  1PGX A;  3QC8 B;  3VXW A;  5I4D A;  2FUG 1;  2M8S A;  1TT5 B;  4MM3 B;  1EF5 A;  2D10 A;  1YQ4 B;  1MG8 A;  2X8X X;  1V49 A;  3U52 E;  2QIE B;  3SFD B;  2UWQ A;  2WYQ A;  3ML9 A;  1HA5 A;  1WE7 A;  2DYB A;  1YQB A;  2N1V A;  4N9F 4;  4C7Y A;  3AN1 A;  3I63 C;  4KZ0 A;  1DOX A;  4GMV A;  1AAR A;  1RLF A;  3GE8 C;  1F0Z A;  3M95 A;  2MWS B;  3H9D A;  1ZDV A;  1K53 A;  4C56 C;  5EE1 A;  2WXI A;  2J4X A;  3SHQ A;  4RM8 A;  5E6J A;  4K3B A;  2WP9 B;  1FM0 D;  1NEK B;  3EGR A;  1UNS A;  4KDI C;  1UGM A;  3ETR A;  2V1Y A;  3QIJ A;  2WU2 B;  1ZDX A;  3VUW A;  1WJ6 A;  4EE2 A;  4TV3 A;  2INC C;  1VD2 A;  4NJ6 A;  2GRI A;  3UIN B;  4DK5 A;  2ZVN A;  2D3A A;  2GBN A;  3Q8C A;  1PDX A;  2JT4 B;  1VZ8 A;  2IO3 B;  3BK2 A;  3U7D A;  1KF6 B;  2KN5 A;  4F7Z A;  2N4F A;  3VUY A;  2ZPN A;  1N5W A;  2LHD A;  5GXG B;  2KQS A;  3BIN A;  4GDL B;  3X23 A;  4HKZ E;  3DHH C;  4OW0 A;  3K9P B;  2BWE S;  1V5T A;  4TMA B;  4LNN A;  1IUE A;  2KXJ A;  4ZHO A;  3EA6 A;  4WQM A;  2LRU A;  4ITK A;  1HQR D;  2XEW A;  4JE3 B;  1BUI C;  3PRM B;  3R2T A;  5H92 C;  3DOW A;  4B0E A;  3MHS D;  1Z5S B;  2CU3 A;  2C9W B;  3ABV B;  1KLV A;  3CSF A;  4IOI E;  1JCK B;  3ZTC A;  4W9I A;  3IFW B;  3QX1 A;  4RH6 A;  2G3Q B;  1YX5 B;  3TBL D;  1L6U A;  2KAC A;  2K8C A;  1DOY A;  3SR6 A;  1NYR A;  2L3Z A;  2I2Y A;  2GBR A;  3TJP A;  2BKF A;  1CQV A;  4KGT A;  3QK0 A;  1YIW A;  2KC1 A;  3U30 A;  1C76 A;  5BYR A;  1NI3 A;  3FIL B;  2CU1 A;  3ZQ4 A;  4IM3 A;  1C1Y B;  2FCM A;  1S3S G;  2JSV X;  2KTR A;  2PLP A;  4HXD A;  3V6E B;  1QIL A;  2BQQ A;  5IA7 A;  2MRP A;  3IXS A;  3RYT A;  4GGQ A;  1CZP A;  3TL5 A;  3AU4 A;  5G55 A;  4TQ1 A;  4W9H A;  1OFF A;  3W5V B;  2RDH A;  1K8R B;  1WGG A;  1TZO A;  1PYW D;  1AWD A;  4GXB A;  4IUM B;  4ANU A;  1JRP A;  3DVN U;  4OHJ A;  1WXV A;  2NBU A;  1SE2 A;  4K1R B;  2RDB C;  1H8C A;  3CMM B;  1MJD A;  1MG4 A;  3N1X C;  4A3O A;  2Y5P A;  1RM6 C;  1YJ1 A;  2K5P A;  4MH0 E;  1TS5 A;  2KD0 A;  2W55 A;  2WX0 A;  1FEH A;  4L2Y A;  3B0A A;  1B9R A;  3HHM A;  3VVW B;  4MSQ B;  1VRA B;  2KVZ A;  4MJS A;  2J0M A;  2R61 A;  3NZU A;  4JWU C;  3AUL A;  1ZW7 A;  1P7F A;  4J6I A;  2CHW A;  1IPG A;  5GMV A;  2IZV B;  2PW9 A;  1S1Q B;  1WXS A;  3RUI B;  1L7Y A;  3N30 A;  4GDK A;  3EC8 A;  1D3Z A;  1F52 A;  2LGX A;  4YL8 A;  2LJ5 A;  4EZJ A;  2KLG A;  4ICV A;  1N62 A;  3APC A;  2PE6 B;  4M0W A;  3GS2 A;  2DZM A;  1TY0 A;  2C60 A;  5D7G A;  3P4R B;  2SAK A;  2BGF A;  3UF8 A;  1ZKH A;  2ZEQ A;  1OEY A;  1QZE A;  1JWM D;  1EU4 A;  2RSU A;  4RGO S;  4XC2 A;  1YNT E;  1QF6 A;  1WX7 A;  1YJI A;  3M3J A;  1FNU A;  3OJ3 A;  1WGR A;  1P0R A;  1YQ3 B;  4MH8 A;  1LFD A;  2IPK D;  5BYQ A;  1K51 A;  3WAN A;  3N32 A;  2K9X A;  2N9E B;  2CHX A;  2L0T A;  4MGY E;  4DHJ B;  1HZ6 A;  1P9D U;  4ZDV A;  1N6Z A;  3WAM A;  2IGH A;  1TTN A;  1N63 A;  2BWF A;  1I4P A;  2RPQ A;  1STE A;  1I4G A;  4NZL B;  1SE9 A;  3W2D A;  1EWC A;  3DBL I;  1KRH A;  3ZW3 A;  4WWN A;  1C4P A;  4S17 A;  1L6V A;  1CJE A;  3H6N A;  2O2V A;  2JY6 A;  3BYY B;  4RFB A;  2M0A A;  3U4E G;  5MPO A;  3O13 A;  1HZ5 A;  2GOW A;  1C77 A;  4HEA 1;  4I6N B;  2M56 B;  3Q3M C;  3NVZ A;  2WXK A;  1WR1 A;  2BVC A;  1SGH A;  2KJR A;  4OVV A;  2LGY A;  2N9P C;  1TJE A;  4N6E B;  2PE9 A;  3IT4 B;  1TYG B;  1MVK A;  2K6D B;  1EUV B;  4LK0 M;  1FCC C;  2QMT A;  1H4R A;  2Y5B B;  3DBL B;  1FXI A;  5FKA C;  2W82 A;  1E8X A;  4E71 A;  3Q2A C;  2MBB B;  4NAW B;  4F1S A;  4DHZ E;  4AS1 A;  4KGR A;  2N9X A;  4KV2 A;  4HJK A;  4HPM B;  2G4S A;  3SFE B;  2EKI A;  5E6O A;  2Y3A A;  1V81 A;  2I1K A;  1IBX B;  2BW2 A;  4FAD A;  3IAM 1;  2X38 A;  4KZC A;  3DBS A;  5DPS A;  1E5W A;  4KIK B;  4NJC A;  4P7I A;  1RYJ A;  4I6P A;  3ZRF A;  1JWB D;  2KFJ A;  3LXF A;  2YEP F;  3ZDM C;  3AH7 A;  2OOB B;  3BYT B;  1SF0 A;  1L0V B;  4BBN C;  3H7P A;  1WF9 A;  4G0N B;  4ACF A;  2MBO A;  2K6Q A;  2WXO A;  1AN8 A;  3A9K B;  3L13 A;  4PS8 A;  2CKH B;  1G6J A;  1GUA B;  1ZP0 B;  2LEK A;  1KJT A;  2C7H A;  1FXT B;  1C3T A;  1EO6 A;  1WH3 A;  2PPH A;  2O6V A;  2V9H A;  3EUB 2;  1V9J A;  2JPH A;  1FNW A;  2PIA A;  4URK A;  4XDC A;  4PYZ A;  1TS2 A;  2DX5 B;  3L16 A;  4M01 A;  2BS3 B;  3DWG C;  4P16 A;  1WZ3 A;  3RNE C;  2QIL A;  3ZNG C;  2R2Q A;  2JF5 A;  2K22 A;  3PGE A;  1IP9 A;  4BOZ B;  3HUI A;  4DXG A;  5DPW A;  3HVZ A;  1I35 A;  2JUO A;  4HKQ A;  1WY8 A;  4B95 A;  1FRR A;  1Q10 A;  1WGH A;  1UWM A;  1NVI D;  5HKH A;  2PKO A;  2WWZ A;  4DHJ D;  2V0G A;  3MC0 B;  2KDI A;  3ECI A;  3IAS 1;  1WJN A;  4I6L B;  5C1Z A;  4II3 B;  3ZO5 B;  2KX0 A;  2J52 A;  4PYU A;  2MJ3 A;  2D3G A;  1ZXI A;  2GMI C;  2LFI A;  2MSE D;  4YT0 B;  3HVD A;  2WLB A;  2RDG A;  4GIV A;  2OJR A;  3N1Y C;  1WI0 A;  5D2M B;  1SB3 C;  5HG2 A;  2K8H A;  1GPX A;  2EMS A;  4FXC A;  1MFW A;  3NS1 A;  3DBR I;  2AL6 A;  3AE5 B;  2QCZ A;  4FHK A;  3L4P A;  2LXA A;  2WXJ A;  1JWU D;  3RI7 C;  4P1C C;  2D3C A;  1BT0 A;  2KO3 A;  1XLO A;  2DZJ A;  3PRE A;  4RNA A;  2MX2 A;  2NBW B;  3TEX A;  1TBE A;  4H2A A;  1Z2M A;  1HXY D;  1DOI A;  3RNC C;  3ZJU A;  5CHV C;  1WXM A;  2ICI A;  2WQY B;  2XK5 B;  3P1M A;  4C80 A; 
#chains in the Genus database with same CATH homology
 3DPD A;  3PRM B;  2NR2 A;  1I35 A;  5LLI A;  2FUH B;  1GJZ A;  2FCN A;  2L76 A;  1RRB A;  3DOW A;  3GOE A;  4W9L A;  3MHS D;  1Z5S B;  4M8N A;  2C9W B;  2NPT A;  2DEN B;  1WE6 A;  2KFK A;  4GN1 A;  4HVB A;  5E6P A;  1GNU A;  4ZYN A;  1KLV A;  3CSF A;  4RMA A;  3P2B A;  4A3P A;  4WJN A;  3ZTC A;  4W9I A;  3IFW B;  3QX1 A;  5L83 A;  3PHX B;  2G3Q B;  3LJ3 A;  1YX5 B;  4GSW A;  4MSM B;  4BBN F;  3TBL D;  3T8M A;  3WAP A;  2K8C A;  4FJZ A;  3PVL A;  3WIM A;  2L3Z A;  2GBR A;  2KLC A;  4TQ0 A;  4OVU A;  2GBM A;  2BKF A;  3TJP A;  1UH6 A;  2MP2 A;  2IYD B;  4GU2 A;  4W9G A;  3QK0 A;  1YIW A;  2KC1 A;  3U30 A;  3PTF C;  2NS5 A;  1E8Y A;  3PSE B;  2CU1 A;  5KHQ A;  1UBI A;  2O2V B;  4NQL B;  2WX1 A;  1GC7 A;  4IM3 A;  5LXI B;  1C1Y B;  2KHW B;  2FCM A;  2KTF A;  2J0K A;  3DDC B;  3UIP B;  1E7U A;  3ENE A;  1S3S G;  2K8B A;  2KTR A;  4HXD A;  5AZG A;  3V6E B;  2ASQ A;  2ZZP B;  1GG3 A;  2KOX A;  1PQS A;  1TGZ B;  2MRP A;  4K7U A;  5IA7 A;  4PS3 A;  2R2O A;  1E90 A;  1Q0W B;  2LUE A;  3VUX A;  3RYT A;  4GGQ A;  3DVG Y;  2L8J A;  1EF1 A;  4X57 B;  4LCD E;  2LVO A;  3TL5 A;  3AU4 A;  2J7Q B;  1IYF A;  4NY0 A;  3CF6 E;  3OAW A;  5G55 A;  3ZNZ B;  4TQ1 A;  4W9H A;  2L7R A;  4CHK A;  3LDZ E;  1K8R B;  1WGG A;  3RZF A;  1VCB A;  3N3K B;  2KJH B;  2EMT A;  4GXB A;  3ZIM A;  4IUM B;  4ANU A;  3DVN U;  1LQB A;  1RAX A;  1WXV A;  1SIF A;  3DVN V;  5J18 A;  4W9D A;  4DDG D;  2NBU A;  3TMP B;  4K1R B;  3V60 A;  3PLV A;  4MDK E;  1H8C A;  4ASW C;  3CMM B;  2AYO B;  4KDL B;  3QQ8 B;  4A3O A;  1NI2 A;  4AJY B;  5AZF A;  1YJ1 A;  4AJW A;  3UGB B;  4B9K A;  3VHT C;  3ONS A;  3B08 A;  3PLU A;  4MH0 E;  2MA9 B;  1WYW B;  2KD0 A;  2A4Z A;  2LD9 A;  3L0W B;  2LGD A;  3VQI A;  3L10 B;  2WX0 A;  4IC7 B;  2KWU B;  1JRU A;  2KAN A;  2LVQ A;  5G2N A;  4ZRI A;  3B0A A;  1WMH B;  4WAA A;  2Z59 B;  2L00 B;  3VDZ A;  3HHM A;  3H1U A;  3GZN I;  2W9N A;  2KNB A;  2MBQ A;  4MSQ B;  3VVW B;  3W1S A;  2RD0 A;  4BVU C;  1UEL A;  4K7S A;  4MJS A;  2J0M A;  4DDI D;  3NZU A;  3VAW A;  3AUL A;  3JVZ X;  1ZW7 A;  4EFO A;  4J6I A;  2CHW A;  1WX9 A;  1IPG A;  5GMV A;  2KK8 A;  1X1M A;  2IZV B;  3PV1 A;  3PS6 A;  1XT9 B;  4NPN A;  3DVG X;  1S1Q B;  3APD A;  3W1Y A;  2JZZ A;  1WXS A;  2LRW A;  3RUI B;  1L7Y A;  4FBJ B;  1OGW A;  2IO0 B;  3N30 A;  3O65 B;  4GDK A;  5DPT A;  2K39 A;  3EC8 A;  1D3Z A;  3QWZ B;  2D2Q A;  1F9J A;  2LGX A;  3A4R A;  4YL8 A;  2LJ5 A;  5DCN A;  1Q1O A;  2AEH A;  3QAR A;  4EZJ A;  1E8Z A;  2KLG A;  4ICV A;  4K7W A;  3L54 A;  3APC A;  2O6V B;  2KFK B;  2KQ7 A;  1XD3 B;  2PE6 B;  1WFY A;  3JYU A;  2JVC A;  2LWP A;  1LM8 B;  3PPA A;  2DZM A;  5C23 A;  5JHB A;  1KM7 A;  4WWP A;  4E3C A;  2V4L A;  3A9J A;  2C60 A;  2ZCB A;  5D7G A;  5DPR A;  4ZRK A;  3RT3 B;  2DYO A;  1WJ4 A;  3C0R B;  4KIK A;  4EZK A;  1WM3 A;  2C7N B;  2LXC A;  3IBE A;  3T9L A;  2BYE A;  4JGH B;  4MGK E;  3NHE B;  3NOB A;  1R4N I;  3V61 A;  3VTW A;  2BGF A;  3UF8 A;  1ZKH A;  2ZEQ A;  1OEY A;  1QZE A;  3KH0 A;  4W9C A;  4HLE A;  2RSU A;  4XC2 A;  2EKE C;  2PJH A;  2MP2 B;  3EFU A;  1WX7 A;  2V3S A;  4AP4 C;  4AWJ A;  2O6V D;  1GC6 A;  1UZX B;  2RR9 A;  2N7D A;  4TKN A;  2BYV E;  3M3J A;  3IHP C;  4WJQ A;  1YD8 U;  3OJ3 A;  1V2Y A;  1WGR A;  1P0R A;  2XK5 A;  3A4S C;  1V5O A;  2M17 A;  4FN2 A;  3UQB A;  3HM3 A;  2KTR B;  4M8M A;  3A9K A;  1LFD A;  2JWZ A;  3PRP B;  2M0X A;  2LZ6 A;  3EHV A;  3SU8 X;  3WAN A;  2GBJ A;  3N32 A;  2N9E B;  1WR6 E;  2CHX A;  2L0T A;  4MGY E;  3VH3 B;  3ZVV A;  2BPS A;  4DHJ B;  4JL9 A;  4BKS D;  3QA8 A;  3SDL C;  1U4A A;  2ZNV C;  4GB9 A;  1P9D U;  1OEY J;  3RCZ A;  4ZDV A;  4HDQ A;  1Q5W B;  4FLH A;  3WAM A;  1TTN A;  1WM2 A;  2BWF A;  5CHW A;  3S2A A;  3ZKJ C;  2M1M A;  2RPQ A;  3JSV A;  5TR5 A;  3TCA A;  3VFK A;  4BOS C;  3ZRC A;  1SE9 A;  3KUC B;  2KMA A;  4CYE A;  4W9K A;  2MLB A;  3Q3J A;  3DBL I;  3VTU A;  2DAJ A;  2GBK A;  2BKR B;  5E6N A;  1V86 A;  3IVF A;  5FR6 A;  4ANX A;  2FAZ A;  1WIA A;  3ZW3 A;  5L95 C;  2Z0E B;  4WWN A;  2ZNV B;  2FIF A;  3AXC A;  3QHT A;  3VH4 B;  2L0F A;  4MM3 A;  3H6N A;  3W1S C;  1Y8R C;  2CR5 A;  2O2V A;  5J17 A;  2FNJ B;  2JY6 A;  5JH5 C;  1P1A A;  3L08 A;  4FJV B;  4DXA B;  4IM2 A;  2MBH A;  2XBB C;  2MBE A;  1A5R A;  5AZH A;  2G4D B;  4ANV A;  2FCQ A;  3WAL A;  1J8C A;  2NBV B;  2GOW A;  2KWC A;  3ALB A;  4IWP A;  4EEW A;  3KYD D;  4I6N B;  3NY5 A;  4LDT B;  4F8C B;  4EUT A;  3PT2 B;  2K1F A;  3QAQ A;  1WRD B;  2LAS A;  5CX3 A;  1WR1 A;  4HWI B;  5JZE B;  2KJR A;  1SGH A;  4OVV A;  2LGY A;  2N9P C;  2DAF A;  3TIX A;  2PE9 A;  3BY4 B;  1NDD A;  4MJS B;  1L2N A;  4HDO A;  2N7E A;  2WDT B;  3I3T B;  4RM9 A;  4G11 A;  4JQW C;  1ZGU B;  3JW0 X;  2K6D B;  3KVF B;  2BYF A;  1EUV B;  2D11 A;  1H4R A;  4BKG A;  3VTV A;  2KDF B;  2Y5B B;  3RZW C;  1RFA A;  4WQO B;  1KOT A;  2LVP A;  3NS8 A;  2KJ6 A;  4EKU A;  1WJU A;  3ZUN A;  2JZ3 B;  2JRI B;  4IWQ A;  1E8X A;  3A1Q A;  2N1W A;  4GDK B;  4E71 A;  3KYC D;  2MBB B;  3ZTD A;  2JRH A;  4NAW B;  4F1S A;  3L17 A;  4DHZ E;  3NZS A;  2LI5 A;  3MTN B;  3WAO A;  2K25 A;  1M94 A;  2J0J A;  1WXA A;  2N9X A;  4KV2 A;  4HJK A;  4HPM B;  4ANW A;  4W9E A;  4HK2 A;  5BO4 B;  2DYM A;  4MGI E;  2G4S A;  3UQA A;  1LXD A;  4FHJ A;  1P3Q U;  5IAA C;  2ZPY A;  1E8W A;  3DBH I;  4M0W B;  4WJP A;  5E6O A;  3ZNI D;  2KWV B;  1V81 A;  2I1K A;  3WA0 A;  4HCP B;  1NBF C;  3MJW A;  1WGY A;  3A9J B;  2HD5 B;  3V62 A;  3SD5 A;  4FAD A;  2YLM A;  2DHZ A;  2G45 B;  3DBS A;  4KZC A;  5DPS A;  1E5W A;  4KIK B;  3OLM D;  4XX5 A;  2NPT B;  4EOY A;  4ICU A;  4P7I A;  1WZ0 A;  2REX A;  4A20 A;  4I6P A;  3ZRF A;  1V80 A;  3PRZ A;  2KFJ A;  4KVG B;  2VRR B;  4G50 A;  4JIO U;  4KSK C;  3ZDM C;  2FCS A;  4NNJ B;  2OOB B;  3PHW B;  4IM0 A;  3DQV A;  2KZR A;  4ZRJ A;  4G3X B;  4WJO A;  4BBN C;  3R66 C;  5EDS A;  3H7P A;  4BFR A;  4EZL A;  4NJ7 A;  2HTH A;  4HPL B;  4AUQ C;  1OTR B;  4GDL A;  1WF9 A;  4G0N B;  1I42 A;  2MBO A;  2K6Q A;  1CMX B;  3IG3 A;  4E74 A;  2Z0D B;  3A9K B;  3L13 A;  4PS8 A;  1T0Y A;  2CKH B;  3EEC A;  1GUA B;  1G6J A;  2ZJD A;  3QJZ A;  2IO1 B;  3R7Q A;  1KJT A;  2ZCC A;  3QCA A;  1HE8 A;  2FID A;  2KVR A;  2C7H A;  1FXT B;  1C3T A;  1EO6 A;  5CTR C;  2M4N A;  4FJY A;  2UYZ B;  1WH3 A;  2PPH A;  2O6V A;  4WWO A;  1WGD A;  1V9J A;  2JPH A;  3CST A;  4URK A;  2MCN B;  4LJO B;  2YVC A;  2BF8 B;  4PYZ A;  2DX5 B;  2IBI B;  1XQQ A;  3JSV B;  3R3M A;  3L16 A;  2NVU I;  1J0G A;  3HK0 A;  2KC2 A;  3AI5 A;  3ML8 A;  1V6E A;  1WZ3 A;  2KX3 A;  4NQK E;  1TZ1 A;  1OQY A;  5KHO A;  3R7R A;  3ZNG C;  2R2Q A;  2JF5 A;  2IY1 B;  1UD7 A;  2DZK A;  3PGE A;  3V6C B;  1IP9 A;  4IWO A;  4BOZ B;  2KDE B;  2MQJ A;  3A33 B;  3QC8 B;  3VXW A;  4BKS A;  5LXH A;  5DPW A;  4MEL A;  2M8S A;  5J2R A;  2JUO A;  1WY8 A;  2HJ8 A;  4B95 A;  1EF5 A;  2NCN A;  2D10 A;  5D6J B;  4K81 A;  4PS7 A;  1MG8 A;  2RGF A;  5AEK B;  1WGH A;  1V49 A;  5HKH A;  2AL3 A;  2KDB A;  2UWQ A;  2WWZ A;  2WYQ A;  3DCG A;  3KUZ A;  4W9F A;  3ML9 A;  4DHJ D;  2MW5 A;  2KDI A;  3ECI A;  1WE7 A;  2IY0 B;  2DYB A;  4LJP B;  1YQB A;  2N1V A;  4N9F 4;  1WJN A;  4GOC A;  4I6L B;  4AOF A;  4KZ0 A;  5C1Z A;  4II3 B;  4GMV A;  2KX0 A;  3ZO5 B;  2DZI A;  1AAR A;  3ZDT A;  1RLF A;  2CHZ A;  4PYU A;  3PZD A;  4B6W A;  2D3G A;  3M63 B;  3ZLZ A;  1P98 A;  2GMI C;  3M95 A;  3K9O B;  2MWS B;  3H9D A;  2MSE D;  2PEA A;  3H7S A;  3X0W A;  4JLC A;  3A1Q B;  5CHF A;  4GIV A;  3APF A;  3SHQ A;  2C7M B;  4RM8 A;  2OJR A;  2IO2 B;  1WI0 A;  5D2M B;  4MGZ E;  3OJ4 B;  2B3A A;  2JXX A;  4HCN B;  4LDT D;  3UIO B;  4KSL C;  1E7V A;  3RD2 A;  3Q3F A;  1J19 A;  2KMC A;  4KDI C;  1UGM A;  4W9J A;  2C5L C;  2V1Y A;  2K8H A;  3QIJ A;  5D94 A;  3VUW A;  2EMS A;  1WJ6 A;  4TV3 A;  3DBR I;  3M62 B;  2AL6 A;  4MEM A;  3AU5 A;  3HIZ A;  1VD2 A;  4NJ6 A;  4FHK A;  4FA6 A;  3UIN B;  2I1J A;  2KKC A;  2LXA A;  3B1L X;  4DK5 A;  4CO7 A;  4DHZ B;  2ZVN A;  1R4M I;  2GBN A;  1UBQ A;  3RUL A;  2JT4 B;  3U8Z A;  1WMH A;  3KUD B;  1BT0 A;  2IO3 B;  2KO3 A;  2AWT A;  3U7D A;  2DZJ A;  3PRE A;  2KN5 A;  4II2 B;  2N4F A;  2L05 A;  4F7Z A;  5JHA A;  3VUY A;  2ZPN A;  3KW5 B;  4TUU A;  2HE7 A;  3H7P B;  4IG7 B;  3ZNH B;  2MX2 A;  2KQS A;  2NBW B;  3BIN A;  4GDL B;  4XZ4 A;  1TBE A;  3X23 A;  4FUL A;  1Z2M A;  3D32 A;  4DBG A;  4NAW A;  3K9P B;  4DWF A;  2BWE S;  1V5T A;  2A5U A;  1WX8 A;  2KXJ A;  5CHV C;  1WXM A;  4BKT A;  2XK5 B;  4IW0 A;  1ISN A;  2D07 B;  2LRU A;  2CS4 A;  1YX6 B;  2QHO A;  2XEW A;  3HM6 X;  2ZVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...