2KN4A

The structure of the rrm domain of sc35
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Immunoglobulin G-binding protein G, Splicing factor; arginin
publication title The structure and selectivity of the SR protein SRSF2 RRM domain with RNA
pubmed doi rcsb
source organism Streptococcus sp. group g, homo sapiens
total genus 31
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kn4A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kn4A02
2OIHA 3P49B 5JVHQ 2YKAA 1IGDA 1WHVA 4Y0FA 1A9NB 2YH0A 2DNZA 1F9FA 2JU6X 1RKJA 4FXVA 1R8HA 2MPUA 3I55S 2MJNA 2UP1A 4C0OC 2DGQA 3THTA 5DDQC 2CPEA 2X1AA 1S79A 2XS7A 1O0PA 3D2WA 2MSTA 3MD1A 2CPYA 1FCLA 1VC5A 1HZ6A 3NS5A 1YMHE 2CQPA 2DNKA 2LXUA 2OTJS 3TYTA 2JWUA 3CCES 4BS2A 4F26A 3MOJB 1YITS 5HL7Q 2J0QD 1HA1A 2LGIA 1Q81T 2MQMA 1SXLA 3ZZZA 2KU7A 2M8DB 3THPA 3CPWR 2FY1A 5GADU 1M90T 1FCCC 2FC8A 1HZ5A 2HYIB 1WI6A 3R27A 1PGZA 2L41A 2DHSA 3CD6S 4W92B 2LA6A 5H1SV 3MI7X 1KOOA 3J7ZT 2MZRA 4UQTA 2ZJPQ 1ZH5A 4KGSA 1K73T 1N8RT 2DHXA 1OPIA 2DITA 1JMLA 1FHTA 2DISA 3MURP 3BO2A 1HL6A 2CQGA 1AUDA 1M5KC 2M2BA 4GLSC 2RU3A 3UCZP 2RPVA 3NNAA 3S8SA 3P6YC 1QVGR 1UW4A 2E5GA 2MMYA 1R8PA 2DNHA 2NLWA 2M52A 3VAJA 2FPHX 3MUMP 2KACA 1D4BA 1NJIT 3BO3A 1FJ7A 2F9JA 2MYFA 2RRBA 2RS8A 4CH1A 2E5HA 2MZTA 1QVFR 2JVRA 1UAWA 2PW9A 2PEHA 3B4DA 1PGAA 3CCLS 1U1OA 2CPDA 2DIVA 1WTBA 2LECA 3CCRS 4TU8A 2YWKA 4FXWA 4IO9Q 2MZQA 1DZ5A 2BZ2A 5GAGU 3FILB 1BY9A 2V94A 2X1FA 5LJ5Y 5JXVA 5HO4A 2MQPA 4CQ1A 5LSLA 3CF5Q 1VQ7S 2KRBA 1X5OA 3VAKA 2DGWA 4IOIE 1MHXA 2CQHA 5DDRC 2DNMA 2RVJA 2N7CA 2CJKA 2I38A 2M7SA 2XS2A 2LHDA 1M5VC 2ON8A 3IRWP 2E5JA 1VQNS 1WHYA 2DNNA 3NNHA 1OIAA 3CC4S 2VODA 3VAIA 3G8SA 3CCVS 2CPZA 1M5PC 2XNQA 3H2VE 1JJHA 5HG2A 1X4AA 1VBYA 1NU4A 1JJ2R 1VC0A 3G96A 4TLQA 2OSRA 2CQ0A 4C4WA 2CQ2A 3TP2A 1ZXHA 1P7FA 2ZW1A 1WF0A 2L08A 2QEXS 4WKRA 3GB1A 2AYEA 2GHPA 5LXYA 3VAFA 1OWXA 2DK2A 1KOHA 2RQ4A 5DM7Q 1MI0A 1JMTA 1WG4A 2RQCA 2XS5A 2MY7A 1D9AA 3G8TA 3EGZA 2OJ3A 2CPJA 2N9KA 2X1BA 3U1MA 1KH0A 2KVIA 1U1PA 3SDEA 2CQCA 2QA4S 4W90B 4YUDA 3NMRA 2M88A 2PE8A 1X5SA 2KG1A 2LHEA 4QU6A 2LYVA 4P6QA 5GMKa 5HHDG 1WHWA 1VQMS 2HZCA 2LMIA 2RNEA 2PTLA 2MHNA 4J5OA 4ZKAA 4KGTA 2KT5A 2DGXA 2ERRA 2QFJA 2MZ1A 3IWNC 2MQNA 2A3JA 3CTRA 4EGLA 1HD0A 2KDMA 2DGVA 2FHOB 2LCWA 3U1LA 1YJWS 1VQLS 3NNCA 2ONQA 2OEDA 1X4DA 2DNLA 2DGUA 1FJEB 1SJRA 4WH4A 2MSSA 5IM0A 1CVJA 2MKKA 1VC6A 4ERDA 1KC8T 1A7GE 2ADCA 2KI2A 2DNYA 3CMAS 3CCSS 3PIPQ 4HJGE 2IGGA 1FNXH 2JRSA 2DO4A 1VQKS 3OW2R 5GAEU 1N88A 2N3OA 5HI1A 1Q86T 3UWTA 1U1MA 4WFBQ 1B7FA 2IGDA 1N52B 2DNOA 1URNA 4ED5A 1MHHE 1KQSR 1IQTA 1H2UX 2DNQA 3TO8A 1SJ3P 3CCMS 2QSDA 1FXLA 2EK6A 2VONA 1X5TA 2BOPA 4M5DB 1Q10A 2M4MA 3G71S 2LQ5A 2MXYA 3VAMA 3H2UB 2DGTA 1C9FA 2J52A 4IOAQ 2M8HA 4WFNQ 2MB0B 2JZPA 1WI8A 2J53A 1YWXA 2JVOA 3FEYB 2GB1A 1H6KX 1YHQS 2MKJA 2J8AA 1WEXA 3US5A 2MKIA 1S72S 1NO8A 2M70A 2GI9A 3LQVA 3EGNA 2XNRA 2VOPA 4YOEA 2XSFA 2KYXA 1F2RC 1XN9A 3CXCR 4YB1P 3Q2TC 1DBDA 2I2YA 2MKSA 2AYGA 5ITHA 2K8GA 1VQ6S 1FT8A 1UWXA 4OZBA 2M9KA 1ZZFA 1SJFA 3DLLQ 2G4BA 1HEZE 2G0CA 2JWNA 1UFWA 5DETA 4WFAQ 4U67Q 4MACA 1WHXA 2KRRA 2G1DA 1X4CA 1FO1A 2IGHA 4QPTA 2DGSA 3P5TL 5FJ4A 3MP9A 4D2KA 4CH0S 3BS9A 1YI2S 3SMZA 5GAHU 3UI3A 1WEYA 3R1HA 3CCQS 2KQ4X 5CXTA 4TU7A 4LMZA 1FJCA 2ZJQQ 1U1KA 2OTLS 1P1TA 2D9OA 2KHCA 3VF0B 2DHAA 2HGLA 2CPHA 2DH9A 1WWHA 3MD3A 1X0FA 5D78A 3S7RA 3K0JA 3VAHA 4OZAA 1IBXA 2U1AA 4OZ0A 2AYMA 2PLPA 3UCUP 1Q82T 1X4HA 5HFYA 1M1KT 4PKDB 3V3XA 3G6ES 2DO0A 3PIOQ 3UD4P 1IGCA 2RT3A 5D77A 4WF9Q 1RK8A 2LXIA 3SDEB 2J0SD 1KD1T 1YTYA 4OZCA 1WG1A 5BMGA 1UP1A 2CQ3A 1W2BR 2CPIA 5EN1A 1JJ4A 1VBXA 1WG5A 3G4SS 2EVZA 2K0PA 3LPYA 2JX2A 1XCTL 2KXNB 2Q79A 2J76E 3HHNB 2KXHA 1X4FA 4A8XA 2K3KA 3CULA 1DHMA 4PRFA 4LIRA 1P7EA 2GO9A 2JSVX 3SXLA 3CCJS 2YTCA 1U2FA 1Q7YT 2FC9A 3CC7S 2XB2D 2N7JA 3VALA 2MY8A 4WIIA 5IM0B 2KH9A 2EK1A 4IUFA 3RW6A 2AD9A 3ULHA 1DRZA 1M5OC 5DDOC 1U1RA 1K51A 2X1GA 4F25A 2YH1A 5IQQA 4F02A 2F9DA 1G2EA 2AYBA 2U2FA 2KFYA 3VAGA 4RU2A 5MLCV 5DDPC 2CQ4A 1SJQA 1MVKA 1U6FA 3MDFA 1WEZA 1VQ9S 2LUMA 3CUNA 3V4MA 1N54B 2N9LA 2N3LA 2MGZA 4WCEQ 3MXHP 1SJ4P 3EX7B 4IKGA 2DNRA 1YJ9S 3UCGA 1U1LA 2CQBA 2E5IA 1P27B 2MGZB 2CQIA 3JB9k 1X4BA 3MUTP 1H2TZ 3S01A 4IOCQ 1K8AT 2KXFA 4KGRA 4TU9A 4Z2XA 1VQ5S 3CCUS 1K52A 1X5PA 1HD1A 2DH7A 2DNGA 1VQ4S 2LEAA 2N82B 1VQ8S 1U6BA 1EM7A 2EELA 1L3KA 5IFMA 2DH8A 5BMHA 5BMIA 2NMQA 1H2VZ 1VBZA 1PO6A 5CYJA 2ZJRQ 2D3OR 3FILA 4QQBA 3ZZYA 1X4GA 3MUVP 1YIJS 2D9PA 2WBRA 2HGMA 3P3DA 3N9UC 2HVZA 1YJNS 2JXTA 1GB4A 1GB1A 1X4EA 2HGNA 2MZJA 1VQPS 3UD3P 1ZZNA 1YNTE 5LSOA 2ADBA 2VOOA 2MQLA 1WF2A 4C7QA 2O3DA 2DGOA 1MPEA 2KM8C 3CC2S 2DIUA 3HI9A 2KG0A 1PGXA 3NS6A 3Q2SC 5LXRA 2KM8B 3J7YU 1WF1A 3BO4A 2DNPA 4PR6A 1D8ZA 2OSQA 1XCQL 2MKCA 1K53A 4Y00A 3FEXB 1U1QA 2KWDA 1PGBA 2MQOA 2M0GB 5CA5A 3UE2A 4LJMA 4CIOA 3L3CA 2NZ4A 2ZW0A 1K50A 2DB1A 2F3JA 1IBXB 3I56S 2L9WA 2CQDA 1XF5L 1FD6A 2MKHA 2QMTA 4OZ1A 1VQOS 5LJ3Y 2RRAA 1U1NA 3S6EA 4QU7A 2E44A 2RMMA 1K9MT 2LKZA 2MQQA 5GVQA 2RS2A 3G9CA 4HKZE 5JVGQ 2KN4A 2CPXA 2LA4A 1WELA 5BJRA 2CPFA 2DHGA 3BEGB 2RUGA 2MZSA 4UY8T 1F2RI 3CMES 1QM9A 1OO0B 2SXLA 2B0GA 1QKZA 2MJUA 3R1LA 3RW7A 3DXBA 5DM6Q 2CQ1A 4V19X 2LEBA 3B4MA
chains in the Genus database with same CATH superfamily
2ZEQA 2P9CA 5E3CA 5KFBA 1VCTA 4NPOA 1G3OA 2DNZA 1YG0A 3MECA 3PYGA 1W26A 2DGQA 4A8XC 1O0PA 1C1YB 5F9NA 2V3PA 1V5IB 2W55A 1AROP 2V67A 4BBYA 1LWFB 4BAXA 5C5JA 1UD7A 5E2QA 3N6NA 4USVA 1OYEA 1QAXA 3L7UA 2N9PC 5E41A 1SI9A 5A6WA 1JKHB 2HZAA 3FBBA 1S99A 1W25A 1TK5A 4ALZA 1K73T 4M8NA 1FERA 4LDTD 2CQGA 1T9YA 1JROA 1TL5A 2ZCBA 1V3ZA 2V68A 4ECUA 4M5DA 3TW0A 1K0TA 5D8HB 4DR3J 2MMYA 3PX0A 1HTQA 5FIIA 2FPHX 3N6LA 4DV4J 2IC3A 5CH7B 4FJVB 1EETB 2MZTA 3Q86A 5C23A 1GNKA 3PNIA 4LR8A 1KQGB 4DF4A 1EUVB 2J7QB 4MFBB 1IM4A 3OTEA 5GAGU 3MCOA 4DSIA 1CULA 2KRBA 2GJ2A 1M1HA 2CJKA 4O3RA 3RAXA 3IS9B 4C0HA 4KE5A 4IH5A 1UWAA 3EFUA 3VGSA 3NZUA 3HLUA 3MM6A 3Q83A 3W5UB 1EU4A 1LXNA 2FNJB 2P9GA 4PYAA 2HG4A 4X62F 5DLFA 1RYJA 4GRSA 3DOKB 4TKTA 4GXBA 5JXSA 1I94J 3W8GA 5KFUA 2XO6A 1R4NI 4DV2J 3I4PA 2E9ZA 1KOHA 3QBCA 4WWPA 4NLQA 5DM7Q 4JX1C 2HKEA 2Z2LA 3EE3A 3CJ5A 3BY4B 1N4LA 1LWEB 2X1BA 1TY2A 4KBIA 2QA4S 1K44A 1UZDA 3T9NA 2PE8A 3TBLD 4B3MF 2UXDF 4ELVA 2RH3A 4OYWA 1I4RA 4UUXA 1GMWD 2HZCA 1A0OB 3NG8A 2OPSB 3ONQA 3DVGX 4N7TA 2ERRA 4H2AA 1GX6A 1NNDA 2C3UA 2KJVA 4UT4A 4KGKA 1BXNA 1VK8A 2WXRA 3OR1A 1RTHA 4C8MA 3NNCA 2CZVC 5LNK1 4PG4A 4ANWA 4G65A 1S0NA 5HVFA 1WC6A 3CWJA 3TZYA 2ADCA 3I4HX 3ECIA 4K5RA 3NZ3A 4EYIB 3AHPA 4P2FA 3JYTB 4DQSA 1URNA 4WAAA 1MHHE 5CYMA 4M00A 2QSDA 2BOPA 4J6IA 3QRQA 3H2UB 4KHRA 4QJVA 1Q8IA 3HZGA 4IG0B 2BF8B 4AFFA 3I57A 4K4VA 2BUNA 3PRMB 3S1TA 1RCXB 3MR5A 4DR1J 4TSSA 2DRAA 1H6KX 1T03A 2HAIA 5F3TA 4CQNA 1RT3B 1XBWA 4BKSA 5J2NB 4ZVHA 3OTOF 2KYXA 4MGYE 1V3RA 1S6QA 2G1EA 2O5DA 3VUYA 4HACA 2MKSA 3TZXA 3NWRA 4MKAA 3ET6B 2DR8A 4BOZB 1E8YA 4OL8A 5FJ4A 4OW0A 1J5EF 2RD5C 2JZZA 1L5UA 2RDJA 4BBNF 2WONB 4LMZA 4PXCA 2LMCA 1TY0A 1HHTP 3MMBB 3DRSB 4OZAA 2U1AA 4DQOC 4P7TA 5U47A 2DCUB 3VUWA 1I7HA 3IA0A 3KG1A 4V1Ak 4ES2A 3OLBA 4I2QA 2HDEA 1WWTA 1IM6A 3RUBL 2MH7A 5KFVA 4PWDA 4EEWA 1ZM9A 2CNLB 5AT1B 3TCAA 3VRBB 2IM2A 3V6DB 4PQUB 1VLYA 1YJVA 2QMXA 1WG5A 2HHQA 1P9DU 2FVQA 3EXCX 1JW9D 1TTNA 3OR2A 4A8XA 2XSJB 1RWOB 3JSMA 3AM9A 2TSSA 1LO5D 5DZ7A 2ABYA 2GVDA 4ICLA 4U7UK 2I1RA 3WCQA 4UDUC 3BK1A 5I42A 2E7VA 3CJ4A 3MM8A 2C2MB 2H48B 2AQ2B 2RR9A 5J2MA 1P1AA 1WKJA 2KFYA 1QOAA 5HVHA 1NENB 1RAIB 3TX8A 2WSCC 4ZLLA 1NB7A 3DBRB 4MAKA 4R5PB 2MJ3A 3PJ9A 4JV0A 1N0UA 1FTCA 1X4BA 1K8AT 1R7SA 2UWQA 3C2PA 3CCUS 2FJDB 1EQ0A 4XTTA 3ZLZA 1Q79A 2ZKUA 1TKZB 1Q8LA 2FUHB 2YKMA 2J0WA 4LNNA 4MSQB 2BW2A 2O66A 3H59A 2HHXA 5IOLA 3WIMA 2KWUB 3H9DA 4D3GA 4LFBF 2HVZA 5LOQA 1X4EA 3D28A 3QWZB 1SE3A 2KM8C 3UQSA 5GAHI 3AB5A 4NLSA 1F5BA 1VR9A 3JQKA 2BJEA 1LXJA 1FKPB 4KSEB 3KLIB 1ACMB 1X60A 1YJJA 3JSBA 3BGLA 2OPRA 3AXMA 5BYQA 3ITHA 1RWKB 3VWSA 2BWES 4PYUA 4LJMA 2KDEB 3GIIA 2ZPNA 3BK2A 2EMSA 1O6XA 3ENQA 3BVGA 3RB4A 3IP0A 4YR0A 2VQFF 4DPWA 2KZMA 4U96A 1VS3A 3HD1A 2FQQB 1FPYA 2OEJA 4W9GA 4JOUA 1EKRA 4NXMJ 3BQ1A 1MG8A 4NL5A 4M5HA 2BS2B 2OIHA 2HQ3A 1C1BB 4MEMA 2V4IB 2W2QP 2MJNA 1WX7A 2OD4A 4DL6A 2KX3A 1RWNB 3NS5A 1YMHE 5AJ3F 1YN5A 3HVTB 2WDQB 2JWUA 4C8NA 4DR3F 1HA1A 2ASYA 3AE5B 1Q81T 3ENAA 4ACFA 1Y3KA 3GJQB 5D4PA 2P6TA 4DV4F 3ELHA 1NMEB 3MEEB 3H2LA 3GIRA 3NWGA 1AYFA 3FQLA 1F9JA 2A18A 2HYIB 2Z0EB 2UVRA 2DHSA 3R6GB 5ETMA 4XWWA 2BVZA 4A3OA 1ZH5A 4LVNP 4QAYA 5C42A 1RTDA 3U2SC 3N4WA 3PACA 3MTJA 2W1BA 2VFSA 1GC7A 4A90A 2OELA 3J80Y 2KACA 3QK0A 3A8KA 3BO3A 2FGCA 4I2PA 2JVRA 2VG7A 2F4FA 4WIQA 3AE9B 2IAJA 1KHVA 4IWPA 4TU8A 5LSRA 3PV1A 1LW0A 4WAFA 2V94A 4DV2F 2HQIA 4IDKB 4NLRA 3GILA 2LASA 4IOIE 4DHZB 4IDIA 4KSLC 2W4PA 1KKHA 2E5JA 4TVAB 3R7BB 2DYMA 5KFGA 4CNYA 4CWBA 1T94A 2N4CA 1T9VA 2FJEB 1IPGA 4PS7A 3W8PA 1XO3A 4DL4A 4NMXA 1R0CB 2DLBA 3AOCA 4MH8A 2W9CA 3W5XA 3CJRA 4H4OB 1EF1A 2ZNYA 5JUMA 1D9AA 1TKTB 4GN1A 3ILIA 3A8IA 3NMRA 2YQ0A 3CIMA 2BE2B 3OJ3A 4H4KA 1FDAA 4ZVPB 1VQYA 4CO7A 4BWMA 2BT6A 1AZSB 4J5OA 2HHHF 1CJUB 2B7BB 4IM3A 1E6VA 1NK9A 3P1MA 4MIBA 3PSEB 1N36J 3M2UB 3MHSD 4W9DA 2Y5BB 2DGUA 3DCAA 4WTYA 1FNVA 1NAQA 4G3XB 4DOZA 1TKEA 2NXCA 3U02A 5GXGB 4OZ2A 1T7PA 1F2HA 4I1TA 3A1YG 3Q89A 1Q4RA 1U1MA 3QJJA 4PG5A 1N56A 3J7A1 3TJ8A 2D5GA 3BBBA 1SKSA 3G87A 2DGTA 2YNIB 4FJYA 4U7CA 1HWJA 2DY1A 4KR0B 1G1XA 2GB1A 1RHRB 4ZN3A 3B82A 1Z5SB 3HF5A 1C78A 2R8GA 3D0HE 3JQJA 4OFZA 1SV5A 1JRUA 3N5BA 2E5LJ 1JLBB 2DEJA 4C48A 4LFAJ 3DMJA 2YNGA 2AYGA 2G4BA 4YXDB 1MU2B 1UFWA 4MM3A 4NJCA 4LR9A 1N33F 4WQMA 4EKUA 3H5XA 5A0YA 2EEYA 4FKYA 2K6DB 4N5SA 1Y3JA 5CHCB 4LCDE 1KVKA 1FX4A 3MEDA 1RTIB 1YD8U 4NZLB 2MRPA 2D9OA 4GVBB 3M6WA 3RB6A 2FTRA 2VG6A 1Z2LA 4NAWB 4LSLA 4LF5F 2UUBF 1M1KT 1ZAVA 2XCAA 2JEJA 3D68A 5A2QY 3APCA 4ZVSB 3G6ES 3N6MA 1AB8A 5D77A 1J19A 4IC7B 2IO3B 1TS3A 3DHXA 2ZWOA 1H98A 3QAEA 1TZ1A 2HRYA 1KLVA 1CC7A 3BYTB 2IFXA 4ZPDA 3KWMA 1EP4B 2DT9A 4ANXA 2Z59B 4MK7A 4USIA 1W2BR 2A6MA 1S10A 3UIPB 3DHIC 2NPTB 3B2GA 2HQGA 4KFBA 3CULA 5M2UA 1P7EA 4MGIE 2XHCA 4EO8A 3A12A 1NBEB 1RT1A 2IIHA 3EVMA 3FBFA 3R7SB 4LFCF 6AT1B 2DXDA 3ULHA 1DRZA 3KG0A 2N0SB 3GR1A 1Y00A 4F02A 3PZ7A 2XMKA 4NLPA 4L75A 1V6EA 3RNFC 3G82B 4P1CC 3LGHA 2WXFA 3VAGA 2CKHB 2G1HA 1UNSA 5K14B 5HQLA 1QZEA 1V9OA 1H38A 4DFMA 2MBOA 1N5TA 2LUMA 3BKFA 4GKKF 3V4MA 2MGZA 1AN8A 1RACB 2CWXA 3OPKA 1QF6A 2IYIA 3UDLA 5G4DA 3B8HA 4NMLA 3HK0A 3I0SA 4RW4B 1ELOA 3OBIA 4P2XA 3SV4A 2FJAB 4LQ9A 4JI2F 1EM7A 5BMHA 2E9RX 2DPIA 4KH1B 1V5TA 3BYYB 1TP7A 5B0AA 2WDVB 1YIJS 3R8BA 3VGUA 4IR1A 4EBDA 1RB0A 3BSOA 1YJNS 3HSDA 1ZZNA 1IKYB 1R0BG 1RJJA 3V61A 2WDRB 2AJ2A 2LJIA 4B3TJ 1U26A 1UGMA 2XNAC 3IBFB 2WVBA 2RQMA 4JI4J 3L08A 5M2PA 1TFYA 5CA5A 5KFMA 1G7CB 3NRBA 3NOCA 3L3CA 3NS7B 1D8YA 4USJC 1AT1B 3PR5B 5LJ3Y 4NLGA 1TT5B 2L48A 3C16A 2HVHA 3BEGB 4UY8T 4M5IA 3H4BA 4OX9J 2LGDA 3DKDA 3RUIB 4FYXB 2VJUA 3RW7A 2LQ9A 4CZCA 2FB0A 3AEAB 1MROA 2LEBA 4RUBA 2V2KA 2C2ZB 3H6NA 2Y0BB 4RW9A 4PUOB 5DPWA 1RKJA 1NK6A 3I55S 1UJ5A 4O3SA 2MSTA 1RBLA 3MD1A 4WKYA 2CPYA 4DX7A 2HHPA 2BM1A 2C7MB 3KXDA 2MBHA 1IBLJ 1KS2A 1SJED 3SR6A 3ZZZA 4A8WA 2IM0A 1R31A 1L3UA 2FBWB 2X3DA 1B70B 2OFHX 2FC8A 2VKRA 3Q8PB 1Q8BA 1N5WA 2GO8A 5E3RA 5LL6d 2I6WA 4JI8F 3MI7X 2QTWA 5JMNA 2A1BA 2V9WA 1U0SA 2UXBF 3IN5A 1QQRA 3U7ZA 1XJWB 3AE7B 2BA9A 4CO0A 2F4VJ 4HEA9 3T6BA 1M5KC 4IQMA 1T6BX 5D0RA 3IGNA 1HBNB 4N77A 1ITPA 1QUVA 3TUJC 3LWMA 5KFDA 2BYVE 1RFKA 5IS2A 1REVA 3ML9A 1HBMA 1WYWB 3B4DA 2E1CA 1ET9A 3KQ4A 2D3ZA 3V81B 4A55A 4IM0A 4NY0A 2BZ2A 2N4FA 1DOYA 4DUYJ 2C3MA 1SB6A 2LDIA 3ZZUA 3DLGB 2CJAA 3SFEB 4DV7F 1WRDB 5IV3A 2C3OA 2N7CA 3KNGA 3SQOP 2K7KA 4KKIA 3EM1A 2FCNA 3ADAC 4F7ZA 3PG9A 2GBJA 3FCHA 2KVRA 2K39A 3QT5A 2C2KB 4QWCA 1VRUA 3UPFA 3G6XA 2KFKB 2MSED 1Y9OA 1JQGA 2ZHAA 3OUYB 3I87A 4WKRA 3TI0A 4PYDA 4CYUA 1DQ9A 4M5NA 3CF6E 3FQKA 1N36F 1R89A 1UZHA 2C7HA 2LZ6A 1N6ZA 3LPEA 5F8HA 1HNWJ 1YVFA 1J5OA 1S48A 1C79A 5GMDA 1Y10A 2VF3A 2XY7A 3ZNHB 2KMCA 3NS1A 1DTQB 2DY9A 4B3OA 2N1VA 3MF5A 2QLFB 3N1XC 2ZUGA 2PTLA 4GMVA 4RNHA 1N5YB 3NVWA 2NUHA 2RSQA 3AEDB 2A3JA 3CTRA 1TL7B 4IR9A 4X4NA 2QYGA 3MM5B 1MFWA 1TL4A 2VJVA 2ONQA 3B0AA 1YKWA 1XK8A 5HLFB 2W25A 1UJ4A 2BDPA 8ATCB 2D3CA 4I69A 2GMHA 5L1LA 2KTQA 3OW2R 3NP5A 2YWEA 2AEHA 5G0RB 3NAIA 2BQRA 4P75A 4ED4A 2QL9B 2LJ5A 4FHJA 3TJAA 4LFAF 1SIZA 3M8WA 2JEIA 3FUYA 2HQDA 3MPYA 3OXFA 2LQ5A 4DV0F 4WJNA 2DENB 4X84A 3RBZA 4C8LA 3SQGA 2G2ZA 2J53A 1QJHA 4XPEA 2R7SA 2W3SA 2KC1A 3CE8A 3GG1A 2F63A 2XMMA 2EKYA 2DAFA 1YBAA 3KH0A 1VDVA 5K8PA 2GMLA 1V49A 1JLFA 2ZKTA 2DR6A 1JWUD 4FF2A 3BZDB 3G8QA 4C3LA 3MP9A 1SUQB 4H4MB 5E0OA 4NZ6A 2XLIA 4WXWA 2FJXA 4KX6B 3PM9A 4QR1A 4P71A 1B0PA 1RCOB 4HCPB 2KZRA 2ZJQQ 4JWUC 3UNYA 3VF0B 4HROA 3R5CA 4DL3A 2ZOGA 1T0TV 3AE1B 3MM7B 3PFEA 4KPYA 4URGA 1IGCA 4KTQA 4DZ6A 4C7YA 4WF9Q 1I4HA 1HBUB 1R4MB 1TVRA 4A8FA 1WYGA 1VIOA 5CQGA 3T3FA 1N62A 4J9NA 1UP1A 4OLOA 4ZMMA 1VBXA 2DHZA 2JX2A 2VPZB 4R0EA 2VL1A 4XYCA 2LVWA 2OPPB 1N5XA 3R6LB 1X9SA 3M6UA 1YIWA 5BYRA 2WXOA 4BWJA 1SC6A 3EVOA 1FK9B 4WIIA 2RKIA 4A6QA 1M5OC 5J2PB 4F25A 4OVVA 3RYTA 2YX4A 2W9BB 1SL1A 1HMVB 4QWDA 2W82A 4YP3A 5A76A 3DBLB 1PBAA 3WQPA 4KZCA 2QEJC 5CYQA 2QL5B 4ZRJA 2ZNVC 3H0PA 1NEEA 2V63A 1RABB 2WCXA 1SXTA 4C56C 3KLFA 3PO0A 4DHZE 1NYRA 1D5MC 5G2NA 4NRUA 2CQIA 2WP9B 4KHMA 5DG7A 1FFSB 1RTJB 1JWWA 3T5LA 1HKAA 2GCFA 1F2GA 3A8JA 3UNGC 3APFA 3GOEA 4KAIA 4K50A 1KQFB 4P2SA 2ALZA 5BMIA 4P52A 2KJ6A 3VCDA 2UYZB 2J9DE 2RJZA 3T5HA 3IM9A 1UCNA 3M2RB 1TS4A 5HN0A 1YNTE 2VOOA 1DAXA 2DGOA 2BQUA 2DZJA 3Q2SC 1WNEA 3KNAA 3A8EA 1Q1KA 3GCXP 2QRRA 2GX8A 4Y2MA 4XPCA 3FRYA 3QJLA 3IFWB 1XLOA 1IP9A 3JQMA 2X51A 2W7OA 2ZW0A 3QFHA 1FKOA 3VGTA 1F5CA 1VQOS 2CVEA 3D6HB 4BC9A 2GVZA 2IVYA 1K9MT 2LKZA 3NGRA 2RS2A 3M30A 2VPXB 2CPXA 1C1CA 3U8ZA 2JWZA 5D0EA 3CMES 2R7TA 4OHJA 4LF8F 4YWGG 4V19X 3ZJTA 3DRXA 2YKAA 1IGDA 4CLLA 4DL0C 2UU7A 1T3NA 4YSZB 2ZE2A 3ZTOA 3E51A 2Z8LA 4C0OC 4I6PA 3R2IA 5D3IB 2IM3A 4O4RA 2JFKA 3E01B 2OTJS 1RXOB 5GMVA 1QAIA 3MOJB 3ILOA 1X8DA 3M9NB 3TOQA 1Q1OA 4DFKA 2P9EA 1OQ6A 3THPA 3CCZA 4M5LA 2UUTA 4RGMA 1T9WA 1CS4A 3I6PA 2D3AA 2E3TA 1S1UB 1OEYA 3M32A 3W64A 4HPMB 4WJPA 4GLSC 4KGMA 3LGNA 5G5HA 1XIQA 5D3DA 2GQ2A 3TRGA 2V9KA 4ZVEA 2FVSA 1WJNA 1JQ4A 1FJ7A 1QVFR 4B3SJ 4RUCA 4TV3A 5LT5A 1ENFA 3PX6A 1JWBD 2EKNA 1NLKL 1N6QA 2N7DA 2WXHA 2B43A 1PJ6A 2BANB 4CQ1A 2YNHA 2RVJA 1HWLA 2XS2A 4ER8A 2XULA 1FXIA 3KUGA 1HNWF 3OXGA 2Z57B 1TFWA 1KRHA 2XNQA 3WZ0A 2JEGA 1JJ2R 3K8VA 1WOPA 2J7UA 3V05A 4DX6A 4NLWA 4TLQA 4NCGA 4JWSC 4XK8C 1P7FA 4C3KA 1NSKL 5LMNF 2B6AB 4LRDA 2XBPA 1GG3A 2DK2A 2XY5A 3J81j 3T1YJ 2R8JA 4YB6A 2IJ0A 4ED8A 2VU5A 1KLMA 5J2QA 2R2RA 3NGKA 3AEEB 2R2QA 3NOGA 1OEYJ 1FRXA 5KHQA 4A47A 2IPOB 1RLFA 3BBCA 3K59A 2AX5A 1FWPA 4DSFA 5HHDG 4DEZA 5LMUJ 4JYAJ 2BBEA 2I8EA 4Q2LA 2UUAJ 1V1PA 2HFOA 3QLHA 1FRKA 2YXLA 2GBRA 2KDMA 2DGVA 5AXMA 4S0MA 3W5ZA 4C80A 1HNVA 4B6WA 1IBMF 4URQU 1Y5IB 1VC6A 4HEA1 4DU7A 2HBYB 3ONSA 2KFNA 3CMAS 5DZ6A 2WXPA 2NYIA 1N88A 1AW0A 3S2AA 4OJ3A 2DJWA 1E6YA 1I4XA 1NDLA 2LD9A 5B09A 2PIIA 4RZRA 3BKUA 4DV6F 4M5DB 1OJ4A 1TL3A 4DJBA 4IOAQ 5CZVA 4OVUA 2MB0B 1KONA 2JX5A 2BB6A 2IC3B 2JVOA 5I3UA 1HYSA 2D74B 2QN6B 4ZRIA 1YHQS 5EUHA 3UN5A 2CADA 1TS2A 1NRKA 5HMZA 4U7UD 2K8HA 1CULB 3AQPA 4DPXA 3KJNB 2AU0A 2K8GA 4RMAA 3MCNA 3I96A 2AEMA 3OLMD 1FO1A 2IGHA 5IQ6A 4D2KA 3SFDB 4FP9A 4HYKA 2HFNA 2WVEA 1WC1A 3NCPA 2QZ8A 3VRAB 1WM3A 2C60A 5IT9Y 2GBKA 2PLPA 1BQMA 1HQ2A 1GK8A 1WKLA 2AT1B 1ZP0B 4CRJA 3RYLA 5KFCA 4TKNA 3D66A 3PJWA 4OI0A 4YB7A 3GYNA 3U1NA 2K8BA 3KHRA 4ZVFA 3MR2A 1FTRA 2D07B 2AQ1B 4OZCA 3FK4A 2UVVA 5D4NA 4PYZA 1NSPA 1Q5YA 1R6VA 2LEKA 4ICUA 3M1VA 1LXDA 1DHMA 2XG8A 2OLWA 3SXLA 1PQSA 2CJ9A 1Q7YT 4ECVA 3OR1B 2XB2D 1RTHB 4JP8A 2RF2A 5L1JA 3RNGC 2YH1A 5HP1A 4YY3J 5I3PA 1IYFA 4C8ZA 4YHHF 1HQUA 4B02A 4UW2A 1QE1B 2XMAA 1MVKA 1DGJA 5CYMB 1Y56A 4DR7F 1U4BA 1N54B 4MT5A 3ZJVA 4F36A 4NXNJ 3CMMB 1NDCA 4CT9A 1IBCB 4NYZA 4QCLA 3HHEA 4DV5J 3EC8A 1REGX 2IO0B 4X66F 1T03B 1R4NB 1DY3A 1VQ8S 3N28A 1S1VA 2ACYA 1TJEA 3TL5A 1AWDA 1FKAF 1RAAB 1NKEA 5KFZA 1Y7PA 1H8CA 2D9PA 1S6QB 2WBRA 4HACB 2JXTA 1IKXA 1GB1A 2XMJA 4FYWB 2FYXA 3Q8EA 5EX3A 4MMOA 1N60A 1D8ZA 1X1MA 1PYOB 4RUAA 4LR7A 1OSCA 2MQOA 4X64J 4CLWA 5A8RA 4OX8A 2IA0A 2AEFA 3ZZTA 1F9EB 2R7XA 3C8YA 3QNWB 2M56B 3TAQA 4NQKE 3E2EA 1WELA 3M05A 2R2SA 2MZSA 1J27A 1OO0B 4PWDB 2ZDOA 2ZVSA 5BXIA 3PZ8A 1ZXIA 2KVQE 2NS1B 2JNJA 2NSCA 1YK9A 1CEZA 3JSRA 2H88B 2Q5WD 3OR2B 2J6SA 1BMQB 2BQ3A 3TZWA 3D3CJ 1V81A 1HZ6A 3CO0P 3JSMB 1TIFA 1YITS 4RW7A 2GVDB 4ICLB 1FDDA 1LOUA 2EBGA 2CJOA 2E66A 4PCQA 1OQ3A 2FY1A 5I42B 1HHQA 5IC6B 4B3SF 2ZBPA 1XWLA 5L9XA 3MM8B 3KK2A 2WNMA 5J2MB 9ATCB 1OY9A 4F3OA 4HWIB 1S49A 4EZ6A 3GJRB 1FHTA 3S8SA 1A70A 2WAQD 3NVVA 1OYDA 1UPMB 3J7Z5 2RHSB 4OI2A 3CJSA 3K58A 4AL7A 2ALYB 2RRBA 2DIVA 2YKMB 3Q8CA 3NBPA 2HWIA 2MWSB 3TUZC 2KVZA 4IWQA 2JLGA 2YPZA 4ZPTR 2Z2MA 4WZMA 5IO9A 2AX0A 3W1YC 4LRFA 3T1YF 1KBRA 4TMAB 2INCC 2R7VA 3PRBA 2K7JA 4W9EA 4ASWC 1S1WA 4YMEA 2GV1A 1SGHA 1NU4A 3MMCA 3HVRA 1F9HA 3TAMA 4X4SA 2OUGA 4C0BA 2OPRB 3NGTA 2QJ3A 5LMUF 2D7SA 2OSRA 3ITHB 1U48A 4KKJA 2UUAF 2KYWA 2L3MA 4N47A 2E9TA 2MBEA 3GU0A 3R8YA 3K5LA 5IOIA 2LI5A 3LAKA 3GWCA 3LP1A 3M9OB 4FBUA 2AZ1A 1KH0A 1WJ9A 3DM2A 1U1PA 2PN6A 2EC2A 3J9CA 2VQEF 4ZJLA 1XNQJ 3POTA 4B9SA 2JLEA 5F41A 4N41A 3CD7A 1I4QA 3FMBA 2D3GA 3IWNC 4JV2A 1MN7A 2X38A 5DLGA 4USAA 4JI5J 1D9DA 1SBBB 4WWSA 4W9HA 3R97A 4KHPJ 1LQBA 1VQKS 5ETQA 1XMOJ 2KO1A 1Q86T 1VOMA 4O44A 1LQ9A 4WFBQ 4I68A 2B5JA 1EF5A 3FJ2A 1X9MA 1RTDB 1SJ3P 3DHHC 1UBQA 4MJSA 2V6AA 3D5MA 4GB9A 4FVMA 1BUIC 7AT1B 2FHMA 1YWXA 4I2PB 2VG7B 3MFHA 4PAAA 2IAJB 4OI4A 3HSJA 2VC0A 2XSFA 3QARA 1LW0B 1F2RC 3CXCR 2R7RA 4U8YA 1OFFA 2BGFA 2HE7A 2MQJA 1JK9B 2WBMA 3DN9A 5ITHA 4G3IA 3UD5A 1Q95G 4AP4C 3L4BC 4LNKA 5E6JA 4GDKA 5G55A 4RX6A 4O3OA 3OT9A 3BS9A 3VQTA 4OYMA 4ED2A 1UVKA 4M8LA 1O51A 2ASJA 3D67A 4X65J 1VDHA 2W9CB 1RRBA 4M5MA 2AWTA 2IJFA 1PYWD 2G4SA 2B51A 2IRXA 3K8WA 2NTTA 2DYAA 1GFWB 4XWTA 4WU3A 1FEHA 3GP7A 1VFJA 4HHJA 1K0VA 4G11A 2Y3YA 3QGIA 1HQRD 2HNYA 1MG4A 4W9KA 2NXJA 3VV2B 3TAPA 2XC9A 2CPIA 3PLVA 4AWJA 4ZHPA 3C6UA 4KY3A 2WVFA 1IBKJ 2JYEA 5HJYA 1E6VB 1WDDA 3ZUNA 1NM2A 3TSSA 2JSVX 2IVMA 3DDKA 3PS6A 1U2FA 3NVYA 2HJ8A 4NXNF 3HKWA 3KUZA 3V6HA 3VZHA 5IP4D 2B56A 2HQCA 1TS5A 2Y9HA 5C2GA 5HQ8A 3M8RA 5E5NA 4G1PA 5C25A 5DPRA 3FSIA 3IR6B 1BQXA 4II2B 4PG8A 4DR5J 2DTJA 2LXFA 1UJ6A 2HAFA 3EX7B 1HIYA 3BGUA 4HDGA 2VC1A 3L54A 2IDLA 4F50A 1HD1A 4MTPA 3KK3A 2DNGA 2BYFA 4X4VA 3I32A 2PVOD 1GMVA 1SV5B 4URKA 2DH8A 1VBZA 1FFGB 3FILA 4ZLPA 1WORA 5F8MA 1FCAA 3DMJB 4LF7F 2YNGB 2WTFA 2QGFB 2NBWB 1A5RA 4MM3B 5IXUA 1MPEA 3ZNID 2BVCA 2BRKA 5A0YB 2KM8B 3J7YU 2L00B 5L8RC 3MEDB 1U1QA 3EWGA 2VG6B 3AFGA 4LSLB 4YDXA 4HLEA 3O13A 2CQDA 1NDPA 3GYXB 2PEAA 3GV5B 2RMMA 5DPTA 5HVGA 2XEXA 2J6TA 4K0KJ 1C4PA 2CDRB 3QT7A 5LM7E 1F2RI 1SE4A 2V0NA 3A4TA 2MEWA 4PG7A 4B3RJ 1MLAA 4RW6A 3SIPB 1Z2ZA 2NSBA 1FE0A 2W4CA 1S1XA 2JU6X 2V8HA 3A9KA 2MHEA 1I3OB 1DYQA 4KFBB 2IVFB 2PEBA 4ED0A 1RT1B 2LLZA 3C66A 3GQCA 2AYOB 1B64A 3AECB 4A3PA 3PYDA 3DBHI 3QFWA 3CPWR 4L2YA 5GADU 4KGXB 1GMWA 2UUCJ 3RZWC 2EWHA 4L74A 4ZIWA 4BKSD 4W92B 3J7ZT 4DF8A 2H5JB 3LW5C 4CLPA 3KDNA 3R2DJ 5DQHA 3AE3B 1SKRA 2CJXB 2KDFB 2HFSA 2B4OA 4NLOA 5F8NA 3I0SB 4M5JA 1J7CA 2XZWA 3QIJA 3HM9A 4Q7AA 2MYFA 3OJ4B 4HTIA 5D94A 1GEHA 1AA1B 1YJ7A 5KFXA 2AGPA 2W2MP 4MSMB 1QOBA 2EG1A 3A4RA 3BPSP 3KHGA 3V5RA 1LW2A 3DI6A 3CF5Q 1VQ7S 2DGWA 1WH3A 1VJQA 4X4QA 2ON8A 1GTHA 3QX1A 2W24A 1QSSA 2VODA 5HJXA 5KFRA 5HQMA 3CCVS 2HS3A 1WJUA 1UEKA 3DQVA 4REZA 4KKOA 3H2VE 5HG2A 4DPTA 5E6OA 3IHPC 1F3FA 4ECSA 1XNQF 3PYEA 1XEEA 2KT7A 3KW5B 1U0HA 3DHGC 3H7HB 3NRZA 5DPSA 1WGKA 1ZDXA 4OHYA 1IR0A 1HBOA 3THVA 4AQYJ 2HD5B 4DCPB 3MJWA 4LBHA 3C16B 5KFSA 2RIJA 4MK8A 1YJ1A 1YX6B 2K3UA 3SDEA 3D9BA 2ROEA 2M88A 3T41A 4KHPF 1MROB 1VR6A 1DARA 2YKQA 2PE9A 5GMKa 4RW9B 3HSZA 3EZUA 3K9PB 3J7AN 3QC8B 2Z56B 4ZRPA 4EBCA 2FZKB 1F5AA 2EFGA 1Q53A 3U1LA 2DNLA 4NI2A 2KJHB 1FVQA 1FJEB 2Y5CA 2DRDA 3T19A 1TKYA 3GE3C 4ENOA 3H25A 1LM8B 3RTVA 2KI2A 2R61A 4IO1A 2XHWA 4PQAA 5J2RA 5KFIA 4HI2A 3Q69A 4M95A 2AHOB 4J37A 2AQ3B 3WAOA 3LP2A 1WKKA 3SDLC 3GCWP 1RAFB 3GZ7A 3V60A 1UW9A 2V8DA 1FWKA 4RUHA 2H5IB 4OJ1A 4LF6J 2MA9B 1FFWB 4W9JA 2WYQA 2V4RA 5KFNA 1R8BA 2OD6A 3AT1B 4PWUA 2P2CB 3US5A 3AH6A 2XZTB 2MKIA 5IN7A 1XMBA 2XI3A 4YOEA 1SE2A 4X65F 2ZBCA 1D9FA 4OQJA 2AL6A 1MW7A 1DBDA 4ECZA 2R9LA 3ZYYX 4LF4F 1FT8A 1XEZA 4HK2A 4J90A 1WHXA 3CJ0A 4F3MA 3P8BB 3I5BA 4ZPBA 3SMZA 3OHAA 2AJ1A 3M8QA 3CCQS 1VRUB 5CXTA 2ASQA 3TJPA 2FZCB 2V1YA 3UN2A 3HRDD 1X0FA 4RFBA 3VAHA 3J80U 5KFLA 2UV8G 3FKYA 1VD2A 2WB4A 1D09B 1TTHB 4CYUB 2PT0A 3DDCB 3KTQA 4YSXB 1MJDA 1KOTA 4ED1A 1FF2A 3HZEA 2V4QA 1U4AA 1GPXA 4XZ4A 1J5OB 2CNOB 4E2FB 2XO7A 2G0IA 3KLVA 1WG1A 4B3OB 4GO5X 4TNOA 3LANA 1VISA 3LPYA 1VRQC 4ED7A 2ROGA 1UA1A 3SD5A 4PRFA 2KNBA 2BJ7A 4MKBA 1F77A 2R8IA 2VV5A 3MC0B 4ZN1A 3Q3OC 2EK1A 4ANUA 2G45B 3SSQA 4LREA 2MP2A 4LIWA 4J91A 1K51A 4B9UA 5M2RA 3ISNC 3NUHB 4EI2A 2R8HA 1WY8A 2FCQA 4AJYB 1SJQA 3RI7C 3W2WA 4A48A 5H8YE 4J9RA 1JIHA 4CO2A 2XCPA 3OSNA 1BGXT 2CU1A 1ZBTA 3HVAA 4KZ0A 3GJSB 3SQGB 1H2TZ 3RBXA 3PRVA 4GVLA 2CG4A 1L2NA 1AUSL 3IXSA 5HMXA 1J7AA 3RULA 3D0GE 2BOAA 3HMJG 3EA6A 1JLFB 2FUG1 5CABA 3P3DA 3M6XA 2YLMA 2HGNA 5LSOA 2W3RA 3HK2A 3GR0A 3D3BJ 1QLBB 3B6BA 1ICEB 3CIZA 1ZOYB 2L0TA 4HVZA 1WF9A 2OSQA 3G2XA 1E7UA 2UVUA 1I6JA 4M63A 3R5AA 2WOMA 1R8CA 4NOHA 3L09A 1N61A 3DDNA 3UE2A 5HANA 1HNZJ 2D10A 1UTAA 5K8MA 4WWNA 4M8MA 3M3JA 3U30A 1ZM3A 4H54A 3V4IA 2DCLA 5JVGQ 1P3QU 2DHGA 2KOXA 1SSNA 2M8SA 1TVRB 4Y2IA 5AXNA 2UUCF 1FD2A 3BM7A 3WDOA 2BYTA 4GC7A 5KFAA 1WHVA 2GNKA 4FXVA 2MPUA 2XS7A 1HI8A 4I6NB 4J9VA 3WIVA 4A8OA 2BXJA 4OV1A 3AB4B 3TVYA 3QJZA 1WUUA 2ZH7A 2GZOA 2J0QD 3GE8C 3PHTA 1NK7A 2RKIB 2WW8A 2KB2A 2HPUA 2ZM6F 4FS2A 3RU0A 3JSVA 5A2QU 3F0NA 2XMUA 4N59A 3V6EB 5CYQB 3URYA 1U24A 4J9PA 1WXVA 3DVNU 2M2BA 1YZ7A 4KH0B 4HKQA 3HFVA 3KLFB 3C19A 4O3PA 4NAMA 4UTGA 2WHIA 2M52A 2B9WA 1UA0A 1VI7A 2O1PA 3AJDA 4AE5A 4HT5A 3PHWB 2PW9A 4IWOA 1NYQA 3VFKA 2CPDA 2V3NA 5HROA 1P9YA 1LFWA 3VTVA 3H7SA 4IO9Q 3DWMA 3W65A 1A6LA 5AZHA 4R0JA 1WI0A 1S7IA 2AJFE 3HJVA 3Q3MC 5AE2A 4WURA 3VAKA 1NSAA 1HFEL 3TEWA 2LHDA 4I6AA 3QO9A 4DDGD 4LRCA 1L7YA 4F67A 2M17A 3VAIA 3RJMB 2G3QB 3OJUA 1NHUA 2HQFA 3PEJA 3PW7A 1F6TA 4ILRA 1UWBA 2KKCA 4YTNB 2RPQA 2WXIA 1FKOB 2FJVA 5ETRA 3LA0A 2GVZB 1OWXA 1JJCB 2ZVNA 4B08A 3M30B 3X3UA 4EUVA 1M0SA 3ZQ4A 1C1CB 2L76A 1F60B 2YKOA 2X8XX 2IM1A 3U1MA 4X4OA 1B3TA 5EE3A 1X5SA 2OPSA 4ZLJA 3V6CB 1T05A 2ZE2B 1VZ8A 3CIRB 2C2EA 3OSPA 3N32A 4UOFA 3TX0A 2XI2A 3RB0A 3L95X 4WPAA 2E7WA 4LJOB 2KXJA 1IKWA 1IR1A 4NLXA 2J9CA 6FD1A 2PIAA 4CH7A 3NY5A 2XN9C 3UDCA 4KRWA 5GAEU 1YRXA 1HHSA 4OMFG 1CS4B 2QILA 5H9EJ 1WSPA 3ZTCA 3GV8B 2DBBA 1NK8A 4QIEA 3CCMS 3GYGA 1C0UA 2J52A 2F8HA 5IWAF 2M8HA 3GIJA 2HHUA 3ICLA 4IFYA 1XNRF 4LK0M 4X4RA 2NCKL 3I5CA 1U2CA 1RT3A 3OG5A 1WEXA 4IYQA 1QTNB 1ROFA 2XNRA 1N6QB 4CLKA 2UU9F 2A0FB 4P16A 2HNDA 4N9F4 2C22A 2V8PA 2W2OP 4AQ7A 2EKIA 3B2FA 2YNHB 1VZ6A 1NEKB 1QD1A 2Q6CA 1HNXF 1OSDA 1FX2A 1X4CA 1JLEB 1FXTB 4B95A 4RW8A 2NQPA 2GQQA 1YJUA 2EFQA 4K4XA 1FM0D 1UF0A 1E7VA 2H54B 4NCGB 1P1TA 1VHIA 5CAAA 3VH4B 1CZPA 4OZLA 3K0JA 3Q22A 3DGVA 2XLKA 4PWWA 3CJKA 5HFYA 2O01C 2XGQA 2WK4A 4N8NA 1XT9B 4HI1A 5B0GA 3ENEA 1KLMB 5J2QB 2N7YA 3RR8A 3EMTA 2OOBB 2OEKA 3PW0A 1CQMA 2QDFA 3GFHA 1FJGJ 4OYIA 5L46A 3AXCA 2QLBB 3DLBA 1CLFA 2GMJA 4OI3A 2KJRA 1XCTL 2J76E 1V1PB 3D1OA 3QLHB 4BVUC 3BGRA 3CCJS 3WX8A 3DOLB 1HNVB 2KDOA 1EKSA 1YDLA 4AD6A 2KH9A 2BJDA 2LQ8A 3TUIC 3TA0A 2FVPA 2BEFA 4O3QA 1RWPB 4G1QA 2VHGA 1NJYA 1KFSA 3Q8FA 4FNHA 2FCSA 4QIWD 4LF9F 1WFYA 5KHOA 4M1KA 1E6YB 2ZNVB 4EUTA 3FFIA 3MC8A 4F8RA 1PIEA 2DNRA 1TL3B 2KD0A 3LOUA 3P4RB 3Q8RB 1EARA 4EE2A 2SEBD 5DO2A 1HYSB 4ECXA 4WP3A 2Y3AA 4GKJF 3NCRA 3NLCA 1Q5VA 1L3KA 5IFMA 3TANA 3PW5A 2RDBC 4ZLNA 1H2VZ 2ZJRQ 1HNZF 3M8PA 1B4SA 2LQJA 1T9XA 1RT7A 1XR6A 1EU3A 3AEGB 3A3PB 1R3NA 2L9NA 3F73A 3ZDTA 3ZVVA 3KHHA 3TUPA 1ZDVA 3BVMA 1FRJA 5K8NA 2PGCA 2KG0A 3KHLA 4J3OD 1FFUA 2X3GA 4P74A 1E9MA 2QLXA 4Y2CA 2HMIA 2KFZA 2EW9A 3ZGZA 2OKQA 2LVPA 3SI8A 3HFZB 1QOFA 2MDAA 1HNIB 3B08A 5K20B 1RWXB 3ZJUA 3N0VA 2YEPB 2NZ4A 2ZFHA 2MKHA 1BQMB 2K9XA 5F8GA 1YOVB 1D3WA 2WS3B 5BJRA 3O5TB 5KFOA 3AI5A 3OTDA 3N5FA 1WM2A 2LU2A 2SXLA 3W61A 2VBZA 4AYBD 3SFUA 1P9QC 1T9TA 3R2CJ 4JV1A 2MQ8A 2ACZB 1H0HB 3QWUA 4C6AA 5JVHQ 2WDTB 3HHLD 4FF3A 4KIKA 3PGEA 3M1VB 2CPEA 3HVTA 1QSLA 3BR8A 2CHZA 3OL6A 1FCLA 2LXUA 1SJ1A 1PJ5A 4F26A 4URSA 1TMMA 4A8KA 1SC3B 4AXJA 1LV5A 2RF2B 3UGBB 3Q0AA 3BWUD 3C3LA 2PA3A 2K1RA 5HP1B 3QWPA 1WI6A 2ZJPQ 2KWCA 1HQUB 4ZJOA 4ANEA 4IW0A 2QG9B 2VH2A 2WXJA 4RGNA 3DLKA 3QATA 4ECTA 3QQCD 1TL1A 4K4UA 4ZITA 2WHOA 3DRYA 1N32J 4LSNA 1EWCA 4UOHA 2RQKA 2HIQA 1E10A 1S1VB 3PXGa 3JTNA 1DQ8A 2MZQA 2CJBA 3PHEA 2E1PA 3SCLE 2YX7A 3O3LA 4HTJA 5HO4A 1SKWA 2MQPA 1WXMA 3RD2A 2UXCF 1E8WA 1NI2A 1IKXB 1VMBA 4ZHOA 4O0IA 3W2DA 1TV6B 1VQNS 3OL7A 3TEXA 1C3TA 4JI1J 2ZEJA 5EE9A 4KJIA 1I4PA 3T5KA 3VDZA 4PS3A 4K4ZA 1YRUA 3UDVA 3JVZX 4JI0J 2QJLA 2I0XA 3HM3A 3PTWA 4H4OA 2ASLA 5A8RB 4QYZJ 2DZIA 2C28A 3O2IA 2C2DA 1RLDA 2BABA 2BJ1A 1MI0A 2RQCA 4JI7F 3P4PB 4LUBA 3EGZA 1BWEA 1RYSA 4OX6A 2N9KA 1RWMB 3PCOB 1Y5NB 4OHZA 1XERA 4ZHRA 4FS1A 4FADA 3KK1A 3U4EG 3AOBA 2YWFA 2XK5A 2NXUA 4WIPA 1RA6A 3RMKC 4ITKA 3H42A 3FAHA 4IFVA 5KG2A 2GIRA 1WE6A 4K2XA 3H8HA 2O6VD 4UOCA 3OVSA 3QRRA 4RW7B 2YBVA 5KG7A 3L17A 3KK2B 2Y1LB 4K4TA 2VZKB 1Q78A 1ZAXA 1IUJA 4WE1A 1IQTA 3H8YA 2VONA 1SEBD 2L32A 4GGQA 4HH1A 4DLEA 4RR5A 4NPNA 4LBIA 1HR0J 4JGHB 1C2PA 4A8QA 4RGOS 5G5GA 2CUYA 5E6PA 1RT6B 3AE2B 3C6TA 1RAHB 1NO8A 5I4MA 5FD1A 2M70A 3NHEB 1XLNA 3NBPB 4JUZA 1UVIA 3PLUA 2KDIA 3Q2TC 2C42A 2IJNA 4J9SA 4LTUA 1UUPA 4OZBA 4MIAA 5IV4A 8RUCA 2JWNA 1NB2A 1S1WB 4P1BC 2WXMA 3KVFB 2HNZA 2J0JA 3CDEA 1FJGF 5GAHU 3MMCB 3OL9A 3TAMB 2KTFA 2RU9A 5SUHA 3FSXA 4DFJA 1N34F 3Q8VA 1HARA 2KHCA 1RWSA 3FC9A 3AULA 4RNFA 4OZ0A 3SSRA 1HW8A 1H74A 4EZKA 4K5SA 3AE6B 1JX4A 2VBWA 3NGDA 3IG1A 1IJEB 4K2JA 3LP1B 4DQIA 2DVIA 1TMJA 2XMVA 3CJTA 3OV7A 1EP4A 1KFYB 3DM2B 5D15A 2J0SD 4CHKA 2H5EA 2JY6A 5BMGA 2MLZA 2M19A 3POTB 3EZOA 2CNNB 4DWFA 4C4VA 1RLCL 3W63A 2R2TA 4MKVA 3D6FB 3PRPB 4E98A 3K57A 4UY85 2GO9A 5GADI 1VLBA 1KF6B 3HFKA 5F0UA 2ZBRA 1EZZB 2LGXA 3VXWA 4Q0BA 3OTBA 3T3OA 2JC1A 4BC7A 3O65B 4N8OA 3U27A 3QMQA 3NEKA 2GQCA 5IQQA 3GFXA 3TQEA 3VQIA 4O44B 2B5JB 1F0XA 1T3QA 3DYAA 3OHBA 1KTKA 3RRHA 3O1LA 1WEZA 2NR2A 2CKWA 3ZXWA 2CWKA 3Q8BA 4WCEQ 4MJSB 3HT0A 3JAMY 3CO9A 4ZVUB 2CQBA 2QSFA 2J6UA 3EICA 3MUTP 1XR5A 2ZHBA 3IAM9 1VQ5S 1PAEX 1JWMD 2AGQA 2WXQA 1TU0B 2BM0A 2K5PA 1SQGA 1ZE3D 2XMTA 3BDEA 2WVCA 5KOXA 3M4XA 4ZYNA 5CYJA 1ZPVA 1VRTA 4I7FA 2EFOA 2DZKA 2HGMA 3K17A 1I94F 2MZJA 3DVNV 1WF2A 2ZH5A 4GDKB 2MLXA 3LP0A 3VUXA 1WACA 4USKA 2FIDA 5HMYA 2JZ5A 2HWHA 1IR2A 3FEXB 4NA1A 2FY8A 2HFUA 2V34A 1L3VA 1K50A 3RCZA 3I56S 3MZIA 4M0WA 4Q43A 2NXNA 1TKXA 3S6EA 3AJ2A 5HK4A 1SBRA 5JJBA 4OHXA 3I3TB 4E74A 3DRPA 4LJPB 2RUGA 1WSRA 2Q3PA 2HNYB 4MGZE 1N63A 2IZVB 4K7QA 3B4MA 2YWWA 5H9EK 5ETNA 4UUWA 3C6UB 4OJHA 2YH0A 5C24A 1VYAA 1RAGB 4P6VF 2KJWA 2HHSA 2HSEB 4YDDB 4C8KA 3U7DA 1IN0A 3H7PA 1VC5A 1UBIA 4DXLA 1BHNA 2RRNA 5F3ZA 4CT8A 4CM2A 3B1LX 4ZCMA 5IT9U 4ECQA 1N32F 1RU1A 1M90T 3HJFA 4DHVA 1HTOA 2V9HA 2KT2A 3OL8A 1KTQA 2GW8A 1NXIA 1RT4A 4DR1F 4BBNC 3LJ3A 3D32A 5C25B 1L5PA 4CO4A 2ZWPA 1GAQB 2DHXA 2DITA 3TNVA 2QHOA 2W4DA 4JV5J 2PMVA 4K8RA 4CNZA 1XTZA 1DURA 4FXDA 1IVZA 4K3CA 1H4RA 2ZPYA 1YRTA 1SH0A 3KK3B 2F9JA 4CH1A 2E5HA 1P0RA 1UAWA 5A6PA 2FD2A 1PGAA 4JI0F 1T0SC 4A8MP 2R3VA 1ZOTA 4WWMA 3FILB 3KUEA 2X1FA 4ID5A 1HWKA 1YBTA 2M7SA 2QO3A 1NHVA 1JLQA 4WZQA 1ZPWX 3EGRA 1XQIA 2BKFA 3AXKA 3TR5A 1UVMA 3ZXVA 2GIFA 1VBKA 2CQ0A 3MGJA 2K8CA 3DU6A 3TARA 5AZFA 1KTVA 3Q2AC 1S9GA 4WBFA 1I51B 2AEJA 3UINB 2Q6BA 2AIRB 4R8UA 1OPZA 5DQGA 3CD5A 4XO0A 3AOAA 4JBCA 1WXSA 2D3BA 2MW5A 4RW6B 3W7BA 3G86A 3VTUA 4WK1A 2KG1A 1ZPSA 2XEWA 2HFZA 4Y2KA 2YX1A 3UQBA 2B76B 1S1XB 3JW0X 2AMCB 2MCNB 4FN2A 2BJ3A 1WDTA 2LDYA 3A9KB 5A8WA 1U6ZA 4GO7X 3RFZB 4EEYA 2GLSA 2WXKA 2LFIA 1ZYQA 4WP9A 4EGLA 2CYYA 1RT2A 1SKUB 1ZTTA 1WOOA 3HVDA 4CO3A 2DX5B 4WH4A 4TQ1A 1CPZA 4NYOA 3HCXA 4F4XA 1R4MI 4B9NA 3I5JC 1AXQA 5HI1A 1XMQJ 1U09A 1X0PA 2BYEA 1IQZA 3V6JA 4YR2A 3L4PA 1B7FA 3UW1A 3QA8A 1FRHA 3K7RA 2W9AA 3MR6A 3BN7A 1H2UX 1VRAB 4BZAA 3FDSA 3R5GA 2EK6A 2ZBQA 4ZIVA 2M0XA 3VHTC 4ZCIA 3VTIA 4ID8A 1LWXA 1RWWB 3AV8A 3CCWA 4ZPVR 2DZMA 2ICIA 3AH7A 1TUGB 2VA3A 2PMZD 2MJDA 3MMJA 1LW2B 5D4LA 2K2PA 4AT1B 3DI6B 3DBLI 3MOZA 1MWZA 1UWXA 1V5OA 1ZZFA 3I82A 2ZVOA 3MPDA 4MIWA 1LWCA 4WFAQ 3NY0A 3GJTB 3NS8A 4P9SA 3P5TL 4KKOB 1X7VA 4KDIC 3QSYB 2GHVC 1GTEA 4W9FA 4WJBA 1URRA 4NXMF 3T5JA 3ZW3A 3LUYA 5F0WA 5H92C 5T8IA 5CCMA 1U1KA 4N76A 1U0HB 3VQSA 2NUUG 2PJHA 2OI2A 3S7RA 5AXKA 3DBHB 2AYMA 3K5OA 1HBOB 3HHKA 3IGVA 1X4HA 3HHMA 3RZFA 3RGIA 2DHHA 3T1HJ 1MG7A 1GXTA 1RP5A 3NKYA 1ULRA 5CCLA 3O44A 3QYYA 3SDEB 4E0DA 4X62J 4FNIA 5DQIA 3VVUA 2J7WA 1B99A 2CQ3A 3BR9A 3SSSA 5EN1A 5FK9C 3MPVA 2OMLA 3IBCB 2VZKD 3AA8A 3G4SS 1NHKL 3E8OA 2K0PA 2J7KA 2PFDA 3PW2A 3DGPA 1I35A 5IKCM 3GMGA 4WJQA 3RNEC 1D0EA 3OFFA 4NI2B 3MR3A 1NPRA 4B3MJ 2UXDJ 3SCIE 3MM9A 4NA2A 4U8VA 4OIXA 1U1RA 1S77D 4B17A 3GTYX 1MMDA 3RZAA 3OVBA 1NCLA 4O4GA 3HDSA 4BDPA 3LP2B 2D41A 1SQEA 2I1KA 1N48A 3NAHA 2JOQA 4KPCA 2QLWA 3OXLA 5I4DA 1STEA 1RTJA 3TEGA 2BB5A 4QYRA 3D0IE 5E7OB 4J9KA 2QA4G 2EC0A 3KJQB 4F3QA 5KG3A 4NLUA 3P4UB 3OWEB 4QYZK 3PY8A 3WBZA 1RZMA 1T9UA 3ETOA 4KQZA 1X4GA 1OTRB 4DXAB 1WGHA 4X4PA 1UVLA 4DS4A 2AL3A 3MCSA 3EHVA 3BPDA 5B0CA 2QYCA 3GE9A 1NPKA 3M8QB 3MPWA 2ZZPB 2BMBA 1R0AA 3IAS1 2Y1IA 1BWVA 1CJKA 3ALBA 3LF0A 3KWLA 2QMTA 1MMNA 2QC3A 4MJKA 2G4DB 4L73A 2IBIB 2NR0A 1C0TA 2J5AA 2EPIA 1J5EJ 3HD2A 1SL2A 2B0GA 4OYAA 5KG4A 2YWHA 3R1LA 5DM6Q 4PPDA 4DR2J 1RDRA 1RUSA 4QBUA 4E3CA 5B0DA 2DAJA 5IA7A 2INPE 3OFGA 2V4LA 4ZVOB 3PO5A 3ZRFA 2CS4A 2VB6A 4L3NA 3KLEB 3QT8A 4E8UA 1N0VC 2ATCB 5GAEI 4PZVA 3VVWB 4GC6A 3PVXA 5ETKA 1TGZB 2LGSA 1HZ5A 3PW4A 3IFEA 5IT0A 1FWLA 2BR0A 4GIVA 4NJ7A 2VKZG 2MZRA 1B0TA 1HWIA 5J1EA 3IAM1 3W2WB 2K6QA 2J8SA 3DXSX 1K1SA 1P8GA 4DMZA 2E5LF 4WFZA 3UCZP 3DWGC 1TKGA 4M02A 3VH3B 4LRAA 5L1KA 2DKOB 4DZDA 5EDSA 3MUMP 2BS4B 4U95A 1RAEB 1S12A 4IG3B 4AS1A 5EWEA 2AF6A 4C9DA 2QMWA 3MWBA 4HR2A 1RBOB 1JALA 1D5ZC 2EBEA 4ATNA 3K89A 1RYRA 1GH8A 1AARA 3AU5A 4YN3B 3GZNB 3PKMA 2E29A 3I9ZA 2CRLA 4RM9A 1VBYA 1X4AA 1JXVA 2SAKA 1YBUA 3WX4A 4KGVB 4DCJB 3FZBA 4IM2A 1QDUB 5C7PA 4QIFA 4OV6A 4LFBJ 2L08A 4FXCA 1GUAB 4ZK7M 3EVWA 3V4IB 2RGFA 2CDQA 4QIGA 2PFFB 5FR6A 2V5HG 5EWFA 1LEOA 3N9YC 1SC4B 2R2OA 3TEZA 2LUEA 1T0YA 2FLLA 4RWXA 4WFXA 1XMQF 2CHWA 2Z4PA 2RNEA 2MHNA 2INNE 1IUEA 2VQFJ 4EU0A 3EXYA 1FIQA 3H4DA 1CK1A 1V5VA 4PABA 3BSAA 2GGPA 3AA9A 1EQMA 2VBYA 1E6EB 2CA9A 3W3SA 2WLBA 1VQLS 2C1EB 2INDC 3VVTA 1KRPA 4O1NA 4F0KA 4LSZB 1L4DB 3JSVB 3UDEA 1GOZA 2IGGA 3Q8YA 2NBVB 3B9JA 3BDPA 1SH2A 3UWTA 1Z4UA 5DJBA 5AJ3J 1Z1ZA 2IGDA 5D3GA 1U7LA 3B54A 3BZQA 2LFVA 3IBWA 4K3BA 3GIKA 4WFNQ 4B9KA 3DU5A 2UZAA 4M01A 2H4WB 3IMQJ 5KT2A 3FVYA 4ZA1A 4C7ZA 4B3TF 3EPGA 2AZ3A 5HROB 5GAGI 1S57A 3ZTQA 2JRIB 2VOPA 2KLCA 1M5HA 3A3NB 4JI4F 5FDLA 1BMLC 4YB1P 5KT7A 2PA8D 3T1HF 2YWGA 2ZOMA 3DLLQ 3QO9B 3CSFA 3AD7C 1IWAA 2PPHA 2A2DA 3ILJA 1F52A 3IR5B 3PYFA 1WEYA 2F1FA 4OX9F 1NI3A 4TU7A 1FJCA 4US8A 2OP5A 1SQFA 2HGLA 1KLUD 3MD3A 1UWBB 1CJTA 4DN9A 1PUTA 4PEOA 4O0NA 2JXXA 4HHHA 4I67A 4UQGA 4JPSA 3O6QA 5EE0A 3ZTSA 4L3KA 1DTTA 1SIJA 3QPIA 4BLGA 3ZNGC 1IBLF 3ZDMC 2YVCA 1HE8A 1NBFC 1T05B 4OJGA 2VIHA 2EVZA 3LWLA 2WRMA 3D1QA 3EJMA 5F9LA 1TZ0A 2KXNB 2Q79A 1X4FA 2KX0A 3RRKA 4LIRA 3H5UA 4C98A 1UKUA 2D69A 4ZDNA 1IKWB 2F4VF 3SV3A 2IBKA 4II3B 3QQ8B 2VH7A 9RUBA 3KJFB 4IUFA 5DRKA 3MAHA 1OY8A 5EWGA 2VH1A 5BO4B 3N30A 1V6HA 2C9WB 3R5JB 2PC6A 2HHHJ 4KV8A 1XR7A 1G2EA 1JLCA 1QE1A 2KMAA 2WVDA 2CQ4A 4X57B 2FLPA 4DUYF 3A9JA 1C0UB 1GX5A 3AB2B 2MTLA 4IFYB 4YT0B 1GMUA 4IOCQ 1CC8A 5C2TB 3X23A 3A1QA 2LEAA 3ZZOA 2KANA 1DLOA 1PDXA 3QIDA 3C15A 3QGHA 3RPFC 3J81Y 1BLUA 4MYTA 1PO6A 3PVLA 4FF4A 2WX1A 2HNDB 1JNZB 4NWBA 3Q3FA 2IDEA 1SB3C 2ZZTA 3UVJA 2BS3B 3CC2S 4G50A 3SHQA 4RW8B 3U52E 4F8CB 4ZP6A 4DR2F 1U8WA 2HURA 1B0VA 4ANDA 2RB7A 1DJ0A 2VFTA 3FMWA 3VR9B 1IXKA 4ZYSA 4CIOA 2QFIA 2CFXA 5CHFA 1FD6A 5K9FA 3TVKA 3CJKB 1JLAA 2RRAA 3P4QB 1W7WA 1N33J 3KLHA 1PSDA 2E7XA 2D2QA 4F04B 1U8SA 4H4KC 4QWEA 1R7IA 2MJUA 1LFPA 2W8LA 2D3O1 2CQ1A 4NZ7A 5DGAA 4U9RA 1AYEA 2YNFA 3Q3NC 2CVIA 1DFDA 4LF5J 2UUBJ 2F5GA 3GP9A 4PT5A 1Y4ZB 2FLNA 4HH0A 5L39A 2UP1A 4DK5A 3W9HA 3MECB 3KG4A 1QAJA 3BGRB 2KWVB 3UIOB 1WD6A 4WTOB 3QZ8A 2B3AA 2F8EX 2UUWA 2PI4A 2N7EA 2BKOA 4DXGA 4G1QB 2KQSA 3QGPA 4FJZA 4DU8A 4YTPB 1ZM2A 3FFIB 1AUDA 1EJ7L 4LFCJ 4LVOP 2QV6A 1QVGR 1JB0C 4IQXA 2K06A 1WGDA 4LQ3A 2RDDA 4OYBA 1FNUA 3V2UC 1D4BA 1NJIT 2NREA 2PEHA 1U1OA 2M5YA 2LECA 4A46A 1TBEA 2Y1RI 2YWKA 5TR5A 2IYDB 4GKKJ 3M8PB 1RT7B 1ZM4A 1TYGB 2CQHA 2ZC4A 1N5VA 3PDNA 4KSKC 2C3YA 2RDIA 3NOBA 5AUIA 2COLA 3BKTA 3CC4S 1S6UA 1E7PB 2HMIB 2BJ9A 1N5SA 4JI2J 1YJRA 3PX4A 3FKBA 3KUCB 4ZDVA 3MM6B 3KUHA 4NLTA 1RE1B 1TAUA 1ZXHA 2FZGB 3RNAC 3GB1A 4KGZB 5LXYA 4AL6A 1X31C 3K5NA 2XS5A 2MLYA 3G8TA 1IKVA 2DXEA 3AN1A 2AJ4A 4QWAA 1B1ZA 3DOWA 3B78A 2WU2B 4KIKB 4XDDA 1WZ3A 2DGXA 4FYYB 2QFJA 4J9MA 3EFCA 2QSWA 1RAOA 4DSEA 1JWSD 3I0RA 4B9VA 4RNAA 3M7VA 2MKYA 2G2YA 2KMMA 4ZP8A 4ERDA 4EMDA 2K1RB 2DNYA 3W60A 1TK0A 4HJGE 3W62A 3BSNA 1APSA 4ZJQA 1RAXA 3K2YA 4ED5A 2HLTA 1FNOA 1CBKA 1FXLA 3DLKB 4NJ6A 3CCTA 1WMHA 2M4MA 2JRHA 2MXYA 3VAMA 3KYDD 5IC4B 2HHVA 2G9OA 1TL1B 2KFJA 4ZPWR 3X1LB 5D6GA 4EO6A 4LSNB 4RO0A 4JI8J 5B0BA 2AP6A 2CIMA 1P98A 2UXBJ 2GI9A 1WGYA 3EGNA 5DCNA 5J17A 5L95C 3KJVA 1EO6A 2L0FA 2BW7A 2GRIA 1FD8A 3HIZA 1RM6C 2R7WA 3EDRB 3ZZ0A 2BKPA 3BVZA 1P1LA 2L7RA 5AUKA 2DGSA 5I3QA 2H9ZA 3BBFA 4EZJA 4FZVA 1NPPA 4DR6J 4BHQA 2L83A 1B9RA 2DH9A 5D78A 4DV7J 3ML8A 1GJZA 2HJ1A 4DV3J 5LXHA 4BCAA 3PRZA 2BE7D 5JH5C 3UN3A 5D0GA 4DI6A 3PJXA 5FR3A 4I2QB 1KD1T 4FYVB 5KFKA 4ZHRB 3PR4A 3DOMA 3KK1B 4XE0A 3AD8C 1SPBP 1EB0A 5FLXY 2XK5B 1OY6A 4WQOB 3HO1A 4RKUC 2ZITA 3CMQA 4IFVB 3R7NB 1NJZA 3Q8QB 3RNCC 5THWA 1QAYA 1NUEA 2LXAA 2MY8A 5EDWA 4RPFA 1L3TA 1UELA 3MFGA 1LK5A 4DFPA 2WWZA 5JHAA 3RRGA 2IRYA 3ZO5B 2Q1LA 2W01A 3NZSA 4AUQC 3I9V9 2U2FA 2AWZA 4HVBA 4WE1B 1E90A 1JRPA 1S9EA 5JHBA 4B9LA 1RBAA 1UEUA 2Q66A 1NJXA 3ZIMA 2HBQB 3CUNA 3MXHP 2AX1A 3OD2A 4IKGA 1S0OA 1YLXA 1BT0A 4RCOA 5L9NA 1U02A 4OYZA 3S01A 2IY5B 2KXFA 3ZNUA 4DQRA 1K52A 3FNNA 1WC3A 3CDUA 3C6TB 1S0VA 1EHWA 4MKYA 2RHQB 1RT5A 3MCMA 1FRIA 1VK3A 3MUVP 4DV0J 2W2NP 2KTRA 4B0EA 4RNMA 4F7VA 1S9FA 1RAJA 2XWYA 2FVCA 3BV8A 2MQLA 3CB4A 2HNZB 3KKFA 4IKAA 2QMUB 4PR6A 2XGPA 4Q2MA 2B8QA 2C2RA 5HBMA 3LDZE 4EZ9A 4C11A 5CD4A 4K1RB 3Q8SB 4RWWA 4JYAF 1XF5L 2FHJD 3HKZD 1MN9A 2I1JA 5L1IA 3KLGA 2MQQA 3IG1B 4HKZE 2E1MC 2LA4A 2REXA 2CPFA 2NPIA 2WSFC 1SL0A 2HWTA 2G2OA 2JL9A 3UF8A 1T3OA 4A20A 2I9SA 4HXDA 2CR5A 1YJTA 4XC2A 3ISND 4WFYA 3TA1A 1A9NB 4C4VB 1TQLA 1KVJA 5K5MA 5IZHA 4P7VA 2JFDA 3THTA 2FIFA 3FZ2A 2DR7A 5HSPA 1H73A 2CQPA 2H89B 3TYTA 3CCES 2PMHA 1F3VA 1S1TA 1EWYC 4Q0BB 3LB8C 2W7AA 2A4ZA 2KU7A 3K9OB 2B8PA 4IH6A 2GAGC 3HHLC 3P63A 3GLJA 4C8OA 1MMLA 2KHDA 1T95A 3CD6S 2VA2A 1KOOA 4QIVA 3DYAB 2KO3A 1KEKA 4QZVB 4RLEA 3BO2A 1HL6A 2JJ4D 3GG0A 5C42B 2ZNZA 3IRXA 4CLYA 4MT1A 2HHTA 2HS4A 4Q45A 1Q16B 5J1NA 4DX8H 2ZJDA 1F1HA 3CCRS 4USUA 4ECWA 2V2ZA 5KOWA 2KLGA 4LBPA 4OZ3A 1VRTB 1BY9A 4I7FB 3IT6B 4M5KA 2Z0DB 1QOGA 3IRWP 3LXFA 4J9OA 1WHYA 2VG5A 3NNHA 3LP0B 2CPZA 2KK8A 4A4JA 2FAZA 2N9XA 3IWLA 4NLYA 2OJWA 1JJHA 4HT7A 1H3DA 4F1SA 1ET6A 3PPAA 5E33A 2OEMA 4NEZA 4MDKE 2NTSA 2FUG9 1V80A 4DSLA 4KT0C 2ZW1A 1LGRA 3ETRA 4M0WB 7FDRA 3HVWA 4XX5A 1TKXB 4NEYA 2J0MA 4NLVA 3AODA 4A8SA 3WC2A 3GFZA 1HQEA 3LAMA 3M2VA 1WR6E 4US9A 2XTJP 3DRPB 3RNBC 5EGYA 2VASA 2ZVIA 5A8KA 3D1HA 1CJEA 1S6OA 2P8IA 3OAWA 4USHA 2CQCA 2DWQA 2B9YA 3JTPA 4Q2JA 1GNUA 2LHEA 4ZP7A 1SCJB 1B7YB 1WHWA 5C24B 2LMIA 2YKPA 3H5YA 2WZ1A 3ZKJC 4YY3F 2MQNA 2J42A 3H7PB 2B3TB 3Q23A 3BSCA 2V50A 2ZUAA 4JIOU 3CGIA 3QCAA 2MSSA 2GA7A 2LVOA 3SYZA 1DQAA 1CVJA 4LF8J 2WXGA 2VUGA 2MKKA 2R7OA 4OYPA 4R3DA 3DRRA 4WWOA 4DV5F 2YEPF 1UEVA 1RT4B 2LVQA 2YY3A 2V2VA 1FA0A 5EHHA 2IPKD 3N1ZC 1HPZA 3C14A 3Q14C 5HKHA 5HI7A 1KQSR 2DEIA 4K7SA 2HIYA 3WIUA 2L1AA 1CMXB 1D5XC 1ESFA 1XD3B 2JZPA 3WAPA 1TZOA 3NJTA 4K59A 4RJVA 4EFAC 1PILA 1NK0A 3H20A 2C2OB 3GSDA 5C3JB 4DR6F 1I1GA 4NRTA 4J9UE 5IT4A 2DR9A 3I5AA 2ZH2A 4OYXA 1Y8RC 3E3XA 4ID5B 4X64F 4DV3F 5T7LA 2M9KA 1SJFA 2RSUA 1JLQB 3SCJE 3GSIA 4CTAA 3W1YA 1Q5WB 2KRRA 1CG2A 4L6V3 1T5XD 2X7IA 2YKNA 3Q8UA 1YI2S 4DQQA 1ZW7A 4OI1A 4EFOA 2ZD1A 1T11A 4TN2A 1U45A 1QLNA 4DLGA 4ECYA 4FVCA 4D3HA 1JCKB 1WWHA 3MFIA 5D2MB 1VIXA 3HM6X 1VGYA 2FHKA 1S9GB 3EGWB 3ZNZB 3CWIA 4KO0A 2V2QA 3LYYA 1LNQA 1Q0NA 1KWMA 4ZPCA 5L83A 4R8UB 4CCHA 3PHXB 2EG2A 2LXIA 3ZZPA 2J4XA 1YTYA 2DYOA 2H51B 2LRUA 2V8GA 1S6PA 5LMNJ 5A8WB 4Z7CA 4NE9C 2NS5A 1IJFB 2K3KA 3NGUA 1RT2B 2ZDPA 2YTCA 2FC9A 1HW9A 3VALA 3UQAA 3BQ2A 5DGBA 3SFGA 4CLSA 4ZRKA 1QILA 5DG9A 1V2YA 1MWYA 2J0XA 1RSCA 1KFDA 4FLHA 2KQ7A 3HHLA 1ZGUB 1QSYA 2G9HD 4HPPA 5KT4A 1L0XB 2KYZA 2VDHA 3EPIA 4IG7B 4ES3A 1UPPA 3CEDA 4Z37A 2GBNA 1IBMJ 2N9LA 5J18A 2N3LA 3KFWX 1UGJA 1QUPA 2BRLA 2K1FA 4P73A 2MGZB 4GSWA 1NK5A 3N1YC 3JB9k 1HI1A 4KGRA 4TU9A 4NQLB 5J1PA 2JZ3B 2N82B 2R7UA 2IHR1 3RR7A 2EELA 1KSPA 4WK3A 3DHWC 3R66C 2NMQA 4EZLA 2GBMA 4DV6J 4QQBA 4FYDA 2HK3A 1WR1A 2OHDA 3P45B 1WX8A 4Y65A 3DVGY 4DG1A 1BUXA 1GB4A 3ZXRA 1Q8KA 3K5PA 1CJVA 1RTZA 3P42A 3F44A 1LWCB 4ILLA 3HI9A 5LXRA 4DPYA 4N58A 5ADZA 1U25A 4L72B 1S0MA 3T6JA 1WX9A 4QOTA 2OO4A 1G4CA 4Y00A 4CYEA 3JSYA 4I6LB 4Y3CA 2OPQA 1SE9A 4FBJB 4ZRQA 3APDA 4IOBA 2WB1D 4X4TA 4G0NB 5GVQA 1RWVB 4S17A 4GDLA 5H9FJ 3WA0A 2KKHA 2KC2A 3EUNA 2M4NA 3G6VA 3KYCD 4YTMB 4JI5F 1GXUA 3GS2A 7FD1A 3P49B 4CO1A 2Y1JA 3RN9C 3PV8A 1R8HA 4F4WA 1XMOF 3MEGA 1YJIA 5E3PA 1S79A 3D2WA 2VFVA 3HX9A 3DBSA 2V4JA 1FRRA 1VZ7A 3CT9A 4NCBA 4XGAB 2CAJA 3DGPB 1ZA2B 4JQWC 5ETSA 2RD0A 4UZCA 5HL7Q 3I9V1 3CJ8A 1UVNA 3MTKA 1SXLA 4C2MA 4JI3J 2M8DB 3MM9B 4BKTA 1UETA 3IVFA 1RU2A 1ACCA 3W2VA 1NKCA 3R27A 3JS9A 2L41A 4QPXA 2XZDB 4O4GB 4UQTA 4LNFA 4KGSA 5JZEB 2O6VA 1RHQB 2WXNA 2QL7B 2JSXA 2MBQA 3MURP 2RU3A 2RPVA 3P6YC 3DLJA 1UW4A 1AFJA 3ZTDA 1RFAA 2JC0A 4C97A 2ZH4A 2DXFA 3H5SA 3R3MA 2VRRB 2CJYB 2RS8A 3QIPA 3N20C 4N6EB 4DWIA 4YHHJ 3VR1A 3RT3B 3EDQB 1REVB 1HBMB 2ROPA 2N1WA 2AW0A 4DR7J 2ZBIA 5LJ5Y 2BE9B 4Z7YA 3GB0A 1FXDA 2JEFA 5EE1A 3E56A 1FRDA 2DNMA 4ELUA 1M5VC 1S97A 1OGWA 2V0GA 4X66J 4DX5A 4MH0E 4Y6IA 2DD8S 3C46A 2CHXA 4HLBA 1VC0A 3JAMU 1FFVA 3AMZA 1R0AB 3DLEA 1UH6A 1ZKHA 1CJKB 4DPOA 3MAAA 3DC2A 2QEXS 2AYEA 2HBRB 2H1YA 1IBKF 2RQ4A 1WG4A 1C0TB 2HRTA 3W1SC 3R9LA 2ASDA 4YUDA 5ETVA 2IO2B 1YGYA 4PS8A 3FRZA 4P2MA 1BQNA 4OVZA 4QU6A 2KN5A 1K1QA 4U6PA 1KJTA 4KGTA 2KT5A 1FNMA 2WQYB 4G6VB 4NX9A 2JHEA 2LCWA 4IH7A 1YJWS 1WGRA 3OJSA 4DR5F 1YQBA 3PFOA 4ARIA 5IM0A 2GIQA 4RGTA 1H72C 3T1AA 1FRLA 3FCWA 2XM3A 2K22A 2N3OA 3DFEA 4A9AA 1KQKA 4HJKA 1JLGA 5J1EB 1N52B 2DNOA 1WC0A 2AJQA 2MX2A 4RBUA 1X5TA 2PE6B 3VR8B 3TVZA 1C9FA 2ZZMA 1S1QB 2IY0B 3L16A 2O2VA 2GS8A 5KT6A 5MPOA 2FVRA 2W54A 3HP6A 2BV3A 2MKJA 2OAUA 2A2CA 3AAWB 1S72S 2PVGC 1EX8A 3CW2C 4NLDA 3M6VA 1OQRA 3R7QA 4FBTA 4I64A 1JLEA 2ZHOA 5L38A 2B4VA 4USMA 2XLJA 4K0KF 2B9EA 2IRUA 3MMAA 4IUMB 4OZ5A 3UI3A 2I5JA 6FDRA 4ILMA 2GC8A 3N79A 3L7PA 1NZAA 4YS2A 2KQ4X 4B3RF 3BGFA 3IBEA 1UZXB 5CZXA 1CQNA 3AEFB 4TY8A 4DSKA 3IXQA 1IBXA 1KDNA 1WC4A 3H98A 3OFHA 3UCUP 1Q82T 3ILLA 5KFHA 4P7IA 2CJQA 3WAMA 2DO0A 4RBVA 2KL8A 1PKUA 1SH3A 1JNRB 3ABVB 4HCNB 3L9ZA 1BE4A 2N9EB 3A13A 4RM8A 3GPAA 3LH2S 1JJ4A 1VJWA 4JE3B 5B08A 3OLAA 1C77A 2IY1B 2GJIA 3HHNB 3DOLA 4ED6A 2GGPB 2OGUA 5D6JB 5KAKA 1LWFA 3HHDA 4AXIA 4ECRA 1NK4A 3ETMA 4V19J 3RW6A 3RAQA 3BJYA 2VQEJ 2ZCCA 1JKHA 3A3OB 1ZUD2 4DR4J 5MLCV 3RBEA 5D3GB 3A33B 3AU4A 5AEKB 1RHMB 1KVIA 1HXYD 2GJFA 4F4AA 2BKRB 3QHTA 1YJ9S 1D3ZA 1P27B 1VJKA 4Z2XA 1JXLA 2NXEA 2FJBB 4HHUA 3ZTPA 1VQ4S 1EETA 1E5WA 2CXEA 2HFVA 5KFEA 1PBUA 3WHIA 2NYHA 4RNOA 3NMAA 2P5VA 4MFBA 5FDLB 4K81A 2OH2A 4J7CA 2IBOA 1O5JA 3N9UC 2VPWB 1V9JA 1S59A 1NH8A 2NPFA 3UD3P 2ADBA 5MAOA 4AQYF 3IS9A 3NS6A 5B7WA 4M94A 4KVGB 3BN4A 2AQ4A 2DNPA 2FIUA 1PYSB 2JLFA 1HNIA 3D6MB 4X4UA 5C1ZA 4UF4A 3FC4A 1GQEA 3FGVA 4FA6A 3DOKA 3HULA 1U2RA 4RF0A 2BWFA 2F3JA 1CJTB 1I5OB 2E44A 1ISNA 2ZC3A 2DNFA 1FMAD 4DBQA 2L05A 1YN3A 1DTTB 1LWEA 4JI3F 4YL8A 3MC9A 3W1SA 3DXBA 2LWPA 2BQQA 4BOSC 2WGSA 2VDIA 3O8WA 3IG3A 4FKXA 1HLWA 4K7UA 4PXEA 2CG8A 2A6OA 4TY9A 4CLUA 4RNNA 2EFPA 2JT4B 3AJ1A 4Q8FA 3M8ZA 2DNKA 4E71A 1WIAA 2LGIA 5RUBA 1FVSA 2ZH9A 4HDOA 1TK8A 3UFCX 2IMOA 2L9DA 4ES1A 4LF6F 5TSSA 4R25A 2G13A 3BYPA 4KV8B 3QJPA 1V3SA 1JLCB 3R2TA 2LA6A 5H1SV 1Y11A 2DRBA 3JYTA 2N4DA 1N8RT 3Q24A 1HI0P 3BINA 4W4MA 4YEAA 4RL1A 3A9JB 3M32B 1I4GA 4IG0A 3H1UA 3PKYA 3VAJA 1ZA1B 4OYOA 3A1QB 4M5GA 3FBCA 1DLOB 3C15B 4TYAA 1TUWA 5J2NA 3TZZA 2Z2YB 2RDHA 1WOSA 2M1MA 2YQ3A 5E6NA 2JQRB 1TV6A 3BF4A 2QX0A 3MJ5A 4Y2AA 3ET6A 1L4ZB 3UVJB 5CX3A 1C4AA 3LGMA 2H3EB 5CHVC 3DBRI 4I4BA