2KN4A

The structure of the rrm domain of sc35
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and selectivity of the SR protein SRSF2 RRM domain with RNA
pubmed doi rcsb
source organism Streptococcus sp. group g, homo sapiens
molecule tags Rna binding protein
molecule keywords Immunoglobulin G-binding protein G, Splicing factor; arginin
total genus 31
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kn4A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kn4A02
1FT8A 4F26A 5LSLA 5H1SV 4Y0FA 5DDPC 3ZZZA 1K52A 1VBYA 1QVGR 2FY1A 3SDEA 3CC7S 3S01A 4F25A 1WF0A 2CQDA 2E5GA 2ZJQQ 3G9CA 2D9PA 2I2YA 1FXLA 1S79A 3UE2A 2MXYA 2QMTA 2LEAA 2BZ2A 2MJUA 2CQIA 1F2RC 4FXWA 1R8HA 5JXVA 4IUFA 2KQ4X 2N9LA 4IO9Q 2RUGA 2AD9A 1HD1A 2GB1A 2GHPA 2J0SD 4ED5A 2KU7A 2JRSA 3K0JA 5HFYA 3DXBA 1JMTA 1D4BA 2EVZA 1N8RT 1MPEA 3HI9A 1Q86T 3VAFA 1P1TA 4IOIE 5JVHQ 1YITS 2DNYA 5DM7Q 2E5IA 3B4DA 3BS9A 1H2VZ 5GAGU 4J5OA 3UCGA 2FPHX 4OZBA 4C7QA 3CCQS 2KI2A 3MUTP 3MOJB 1XCQL 2KM8C 5MLCV 2DH7A 3CMES 2ZW1A 3CCUS 1YMHE 2ON8A 2ZW0A 3TYTA 2VOPA 2OSRA 2LXIA 4MACA 4OZAA 4F02A 4WFBQ 2JVOA 1WHWA 2FHOB 2MPUA 2MY7A 2B0GA 5GMKa 2J52A 5GAEU 2HZCA 3Q2SC 3P49B 1VBZA 2X1BA 2AYGA 1H2UX 3THTA 4TLQA 3CCRS 1WTBA 2XS5A 3L3CA 2PTLA 2JZPA 1K9MT 1UFWA 2DGSA 2F3JA 3CCVS 2M2BA 3MD3A 5DM6Q 2DO0A 5HHDG 1FCLA 3NNAA 2MZJA 5D77A 4YOEA 3TP2A 2MZSA 2LMIA 5IFMA 3H2UB 1WG1A 2ONQA 4U67Q 1DHMA 1VQ7S 2AYEA 1KQSR 1P7FA 1ZH5A 2YH0A 3G8SA 2DHAA 3NS6A 1VQ5S 2KG1A 2J8AA 3CCSS 2LYVA 2MGZA 4M5DB 1C9FA 2VODA 4OZ0A 1W2BR 2CQPA 2M88A 1K51A 2N9KA 2MKIA 2KXHA 2MQMA 5CYJA 1X4BA 5CA5A 3MUMP 2XS2A 2U2FA 2QA4S 1HEZE 3BO4A 2HGNA 3VAKA 1VQNS 1PO6A 1MHXA 3LQVA 1FHTA 1ZXHA 2DGXA 2D3OR 4TU9A 1NJIT 2CQ3A 5IM0A 2DNGA 2RPVA 1N52B 2YKAA 2FC9A 3Q2TC 2PLPA 3R27A 2DH9A 2E44A 5EN1A 2MSSA 1X4AA 4CIOA 2F9DA 1B7FA 2Q79A 5LXYA 2M0GB 2SXLA 3SXLA 2D9OA 2M70A 5LXRA 1BY9A 2MHNA 2MQOA 2MQNA 2CPYA 4PR6A 3NS5A 2XB2D 1WEYA 3J7YU 2OEDA 2DNPA 1M5VC 1HZ5A 1F2RI 2JWUA 1MI0A 3CD6S 2CPFA 2J0QD 2RRAA 4C0OC 2NLWA 2MMYA 2CPJA 1X4CA 2LHEA 1M5PC 1FJ7A 2OTLS 1U1NA 3P6YC 3UI3A 3S6EA 1XF5L 3NNCA 2DNZA 5BMIA 1VC0A 2LHDA 1MHHE 2KRBA 3D2WA 3CCJS 1QVFR 2PEHA 2X1FA 2HGMA 3IRWP 2I38A 2DNLA 2KH9A 2JSVX 1UWXA 4GLSC 2LKZA 2N3LA 5BJRA 1X4DA 1U1QA 1X0FA 1QM9A 4PKDB 1X5SA 2DNKA 2ZJRQ 1U2FA 2KT5A 1URNA 3MP9A 3VAJA 1Q10A 2M4MA 1K53A 5LJ3Y 3VF0B 1PGXA 3ZZYA 1ZZFA 2DIUA 4LIRA 5GADU 2YTCA 2KG0A 2OSQA 1Q7YT 4Z2XA 1WHVA 5ITHA 1JJ2R 2YH1A 5GAHU 3J7ZT 1IBXB 3S7RA 1SJRA 2LA4A 3U1LA 3S8SA 2MYFA 1M5KC 2ZJPQ 2MSTA 2OJ3A 4BS2A 2MZQA 2G0CA 4ZKAA 1WHYA 3CXCR 2DNRA 1WWHA 2KDMA 4OZCA 1YJNS 2MB0B 3P3DA 2CQHA 3G96A 1KC8T 1X4HA 1YHQS 1SJ3P 1FJEB 2JXTA 3RW7A 4TU7A 2MZ1A 2YWKA 4WIIA 1WG4A 3B4MA 2LEBA 4IOAQ 1NU4A 1WEXA 1VQ6S 3VAHA 4PRFA 3EGZA 3PIPQ 1P7EA 2X1AA 1XN9A 2DITA 1OO0B 2CQ2A 3R1HA 3SMZA 2EK1A 1P27B 3MUVP 1RKJA 2CJKA 2MKJA 1VQPS 2ADBA 2EELA 2KWDA 4WH4A 3I55S 2LA6A 1KH0A 1VC5A 2DK2A 3MI7X 3G4SS 1FCCC 4HKZE 5DETA 1VQMS 2E5JA 1R8PA 3CPWR 1IGCA 1X5TA 3VALA 1VQKS 5D78A 1VQ4S 1VC6A 1WEZA 2DNNA 2AYMA 2CQGA 4ERDA 3G8TA 1YI2S 1GB4A 1K73T 1YIJS 3EX7B 1HL6A 1VQ9S 3GB1A 2MKSA 1SJFA 4D2KA 1NO8A 2CQCA 3TO8A 2RT3A 1SJ4P 5CXTA 1D9AA 5LJ5Y 1YJ9S 4KGSA 3MXHP 4QU7A 2MZRA 2DNHA 4YB1P 4UY8T 1SJQA 2OIHA 3RW6A 2M52A 4W90B 1WF2A 4CQ1A 3BO3A 1YTYA 3HHNB 1JMLA 2RNEA 3FEYB 2VONA 2LECA 2RRBA 4KGRA 3FILB 2KYXA 2UP1A 3UD3P 1D8ZA 1X4FA 2M8DB 1H6KX 2CQ0A 2RVJA 2ADCA 1SXLA 4IOCQ 1QKZA 4P6QA 3SDEB 1VBXA 2HYIB 1HA1A 2CQBA 2AYBA 1M5OC 2JX2A 3CC2S 2XNRA 2DGQA 3N9UC 4TU8A 2MQPA 5HG2A 1N54B 2WBRA 2RQCA 3U1MA 1UW4A 2KACA 2CPDA 3EGNA 2J76E 2K8GA 4CH0S 3BO2A 1AUDA 1CVJA 2NMQA 2CQ1A 3CF5Q 2DGVA 1VQ8S 2KRRA 2XSFA 1H2TZ 2M7SA 2RQ4A 1U1PA 1S72S 1N88A 1U1RA 1GB1A 3BEGB 2DO4A 1M90T 3P5TL 1FO1A 3UWTA 3FEXB 2F9JA 5BMGA 3CCES 2QFJA 3NMRA 2PW9A 1WHXA 4IKGA 1K50A 2RMMA 2CPXA 3UCUP 2XS7A 1A7GE 5HL7Q 3PIOQ 4WFNQ 2LCWA 1IGDA 2ERRA 2L41A 1YNTE 2DH8A 2RS2A 1Q82T 3CC4S 1O0PA 1VQOS 2VOOA 2HGLA 2CPIA 1L3KA 2LGIA 1X4GA 2M9KA 4V19X 5DDRC 2BOPA 2DGWA 2FC8A 1X5OA 2DGTA 2JVRA 1WG5A 2MQQA 4WFAQ 2K0PA 2E5HA 3VAMA 4C4WA 2U1AA 1OIAA 1DZ5A 2DB1A 3IWNC 2DGUA 2KHCA 1KOHA 5IM0B 1YWXA 1MVKA 3CUNA 2RS8A 3DLLQ 4QU6A 1U1KA 2N82B 2HVZA 2PE8A 2G1DA 2MZTA 3CTRA 3THPA 1M1KT 4LJMA 2DNQA 3MURP 3CMAS 2GO9A 2KN4A 4UQTA 1G2EA 2MY8A 5JVGQ 1IQTA 1KD1T 3G6ES 3LPYA 3CULA 3VAGA 4EGLA 1WI8A 2J53A 1X5PA 2JU6X 1A9NB 1X4EA 2KVIA 5HI1A 4W92B 2MGZB 1U1OA 3NNHA 1U6BA 1KOOA 1OPIA 2EK6A 2V94A 2QEXS 2A3JA 1YJWS 2KXFA 2IGGA 3CCMS 2KXNB 1EM7A 2N7CA 2IGHA 3MDFA 1FJCA 1JJ4A 2N3OA 2DISA 5HO4A 3V3XA 2MKKA 1DRZA 4Y00A 1JJHA 1U6FA 2DGOA 5GVQA 3G71S 3VAIA 1HZ6A 2M8HA 2MKHA 2CPZA 2NZ4A 5FJ4A 5LSOA 3US5A 1DBDA 2K3KA 5DDQC 1K8AT 2LUMA 2O3DA 4YUDA 1PGZA 4QQBA 4FXVA 4KGTA 2JWNA 1FD6A 2IGDA 1U1MA 2X1GA 2G4BA 3H2VE 1RK8A 4WKRA 2XNQA 2MQLA 1IBXA 4A8XA 3CCLS 3V4MA 2OTJS 1UP1A 2L9WA 1Q81T 3I56S 1OWXA 4OZ1A 2MJNA 4WF9Q 2DNOA 3OW2R 5IQQA 1FNXH 1XCTL 2DIVA 1U1LA 1PGAA 3FILA 2GI9A 1F9FA 4QPTA 2KFYA 1VQLS 4LMZA 5DDOC 2QSDA 2DHSA 4HJGE 2N7JA 4CH1A 1PGBA 5BMHA 3MD1A 1HD0A 1UAWA 2DNMA 3UCZP 1WI6A 2CPHA 3ULHA 2CQ4A 4WCEQ 3R1LA 2LXUA 2DHXA 2RU3A 4RU2A 1ZZNA 3UD4P 1WF1A 1WELA 2KM8B 2MKCA 2CPEA 2DHGA 2LQ5A 2L08A 3JB9k
chains in the Genus database with same CATH superfamily
2OEJA 5J2MB 3M4XA 3OFFA 2YY3A 2IO0B 2GJ2A 2G3QB 2YWEA 2LEAA 3HFZB 1UWAA 5IKCM 3OHBA 4IUFA 1FFVA 2N9LA 4USAA 4JI2F 2IY0B 1JMTA 4N76A 1WKLA 4ETXA 2P5VA 4GXBA 3TUZC 1RT1A 1FI4A 2ASJA 3H7HB 2J7UA 3T1HF 1UBIA 2XMTA 1UW9A 4C7QA 1H72C 4NEYA 3MM7A 2ZE2A 3R5CA 4CNYA 1YMHE 2VOPA 3DRSB 2N7EA 1P0RA 1Q4RA 4GDKB 2BRKA 1XERA 1TFYA 1JNZB 1RBOB 2WSCC 3V60A 3PDNA 4BZAA 1IWGA 1I4QA 2Q5WD 3L3CA 2PTLA 4YY3F 3CCVS 1JW9D 3LW5C 5H9FK 1WTFA 2W54A 4PPZA 5JHBA 1RAGB 3OG5A 5M2UA 2IY5B 3KHHA 1P7FA 2PDAA 2KG1A 4G1QB 4M5DB 1JLGA 4M8LA 1HQUB 3LUYA 1FRJA 3ZGZA 1K51A 2CWKA 4W9EA 2IJFA 4M1KA 2I6WA 4XPEA 1GMUA 5FDLA 3BO4A 4ILLA 2IO1B 3LF0A 1TELA 2PMWA 2V5HG 2VZKD 1MN7A 4WJBA 7FD1A 2FLLA 1LWFA 1QAXA 1VS3A 1WR6E 1Y5NB 5CD4H 1UA1A 2QLBB 1GMWD 2M70A 3B2FA 2MQOA 3MM8A 3GZNB 4K0KJ 1WEYA 4IR9A 4M5HA 3W5UB 1HTQA 2ZH6A 3MEEA 2IO2B 2UUBJ 4E3CA 3T3FA 4DR1F 2ZC4A 1ZA1B 3BBCA 2X3DA 2JRIB 4CM2A 2C7NB 1U1QA 3RZAA 1X5SA 1SH0A 4OX9F 4PG8A 2X38A 2V63A 4RW4A 3CIMA 3ZJVA 4ENOA 3QCAA 3EJMA 1ZZFA 5GADU 2WCXA 4Z7YA 3NBPA 5CHVC 3L7PA 2FJEB 4FS1A 1T0TV 3J7ZT 3NZUA 3S8SA 5HLFB 3GR0A 2CFXA 2K39A 2KVQE 1FE0A 2G4SA 1X7VA 4LBPA 1XEEA 4EZ6A 1UFLA 1FNWA 1E7PB 3B6BA 5D6GA 1BUIC 4I4BA 2PFFB 1FJEB 1YHQS 4LTUA 3E01A 3MOZA 3LP2A 3KH0A 2LEBA 4AQ7A 2BANB 3DM2A 1EZZB 2UXBF 2ROPA 4KSEB 3BGUA 2DITA 4JI0J 1UETA 4CLSA 2XYGB 4R5PA 3WANA 2KLGA 4C4VB 2LA6A 4Y2CA 9RUBA 1N56A 3UR3C 4HKZE 3MEKA 3H7PB 4Q7AA 4RW7B 1L3TA 1I94F 1YX6B 3NEKA 1WGKA 4FHJA 1JLFB 4I68A 1QJHA 3AE6B 3VTIA 3BSAA 4ZPAA 2EW9A 2AX1A 3W7BA 1VQ9S 2CQCA 5KFPA 4DSFA 3OLBA 2CJAA 1AFJA 2DHHA 2OMLA 4K4ZA 5CXTA 1YJ9S 2AL6A 1S1WB 2D7SA 1U4BA 2YX4A 2QMUB 4LJOB 4UY8T 2XK5B 4W98A 1VDHA 4WK1A 3GMGA 2K7JA 3BQ0A 3TAQA 3GFXA 3FEYB 2V3NA 1FX2A 4KY3A 1RTHA 2LECA 5KHQA 3FBEA 2PMZD 4OYZA 2WTFA 2UU9F 2VPWB 4IOCQ 4DG1B 3NJTA 1S10A 4DL3A 4DR7F 1H73A 2FB0A 5HMZA 2H65B 3RPFC 1MW7A 2A0FB 4I6PA 3B9JA 3CVKA 1F60B 3EGNA 3BO2A 2NMQA 2CQ1A 5ETQA 2HEKA 2EG1A 3AOAA 3TARA 4ZYNA 4DU7A 4USHA 2CJXB 3T8MA 5GAGI 4KT0C 3L7OA 4M63A 3V6CB 2BE2B 3NMRA 2ZNVB 2AQ1B 2ZBPA 1KVIA 5K9FA 4NAWB 5AT1B 1SPBP 1YNTE 3LOUA 3ZFVA 4URKA 4KYZA 4WJPA 3TZWA 2FC8A 2OD6A 1TR0A 4C3MA 5LT5A 2SEBD 5AE3A 1EF5A 1WM3A 1OIAA 4RUAA 4M02A 2W9BB 4GVLA 1MVKA 3DOLB 1TTHB 1WJ4A 2ZWOA 4WAFA 3DLLQ 3KUCB 2H89B 2HVZA 3Q8CA 3MF5A 3FRYA 4L23A 3DLEB 3CCWA 3TI0A 1T0YA 2EBEA 2KANA 2V69A 2REXA 4K7UA 3HZEA 2KVRA 3I5AA 1V6EA 4ZCIA 2LWPA 4MKVA 2UUCJ 3W5YA 3ZO7A 2G45B 2GMLA 2HVEA 1JJ4A 3QSYB 4ZVGA 1ROEA 2Z2ZA 3QARA 4HCNB 1DARA 2YKMB 4NOHA 4EWTA 4X62F 1WFYA 1PUTA 2K3KA 3PKYA 1TS2A 2VDIA 3SI8A 2QLJB 4IYQA 3HP6A 2F40A 4KGTA 4JI8F 1QY7A 3TJ8A 2BJ1A 1S4FA 5ETSA 2C5LC 3I56S 1OTRB 3AEFB 2NXCA 2BJ8A 3GV7B 2ZC3A 3OXGA 1J7CA 1T5XD 2YNHA 4OJHA 5K14B 3GU0A 1KRHA 1P6TA 1FF2A 3HHEA 2CPHA 2XYPB 4ZVPB 1LW2A 1L5UA 1PKUA 1WKKA 1J5OA 4HPMB 2VH2A 5EHHA 3JB9k 4ELUA 4K4UA 1FT8A 4ZJLA 4F3OA 2M3DA 3OL7A 5MPOA 2RU9A 1W26A 4CP5A 1BQMB 3IVFA 4XK8C 2MJUA 1F2RC 3OR1A 4N77A 2HPUA 4RGOS 2XY6A 1D0EA 3RNFC 2B9YA 1MN9A 3NS1A 1WI0A 4RMAA 1H8CA 3BR8A 2IJRA 1JCKB 4QIFA 1R3NA 4DN0A 1RAHB 4DV5J 3BN4A 1H2VZ 1SIJA 5GAGU 1S12A 2EFOA 2HMIB 5EDSA 3PX0A 2ZW1A 2C2KB 2V50A 4KKIA 2Z8LA 2PE6B 1S48A 2FHOB 4OJGA 5F0UA 1YSJA 2E5LF 1XBWA 4JI4J 2CZ9A 1L4ZB 3LO3A 3KTQA 3MM6B 1HNVA 1WACA 1PG5B 3GIMA 2JEGA 3UNGC 4ECYA 5EE9A 1VQ7S 4NA1A 2KN5A 1R7IA 2YEPF 3NS6A 1VQ5S 1YN3A 2QMXA 3IG1A 2PE9A 3L13A 3ZTDA 2YNIA 2CQPA 1JLCB 3KK1B 1XMOJ 4NJCA 2KDFB 1RAEB 2YWGA 4RX6A 2XS2A 3CMMB 4NLXA 3GYNA 1FHTA 3LGNA 4ID5A 2YKAA 4I56A 4LDTD 2E44A 4L76A 2NUUG 2A18A 2BOAA 4FS2A 3Q3MC 3ZNHB 1B0TA 3MPVA 2B9EA 2V8DA 4O4RA 4RWWA 3I9V1 2HFUA 4K4XA 2WVBA 1YKWA 4Y2IA 4P71A 3AFGA 2RRAA 1X4CA 3S6EA 1JJCB 1ICEB 3NNCA 1VC0A 1JKHA 1EKRA 2KFZA 4LVNP 4QJVA 3APCA 4LF9J 4L2YA 5C24B 4URSA 5L1LA 4LF1A 1X0FA 2FUHB 2JYEA 1SE2A 1B0PA 1URNA 2OPRB 5D7GA 4ECVA 4OLPA 3MC9A 1HR0J 2FCQA 2ZOFA 3I87A 3BYRA 4B17A 4WIQA 4DL5A 5L1JA 3CDAA 1WOSA 3NOBA 4OW0A 5HVGA 2QA4G 3V62A 3VQSA 1Z2ZA 1Q8BA 3MC0B 1RTIA 4DR2J 3ECIA 5SZTA 3KK3A 4WIIA 1LOUA 4RKUC 2WOMB 1T0RC 3D32A 4TYBA 1Y0HA 4F7VA 2Z2MA 4YDXA 2Z0EB 5EWGA 3WHIA 1FKOA 1BXNA 2KX0A 4QW8A 2BPSA 5C25B 4QIEA 5DETA 4CLYA 4NLDA 3FC9A 1T03A 1SUQA 1K73T 3I9ZA 3KLGA 2ZBCA 4PYUA 1N5YA 4P6VF 1NZAA 1F6TA 3DDNA 1L3SA 3J81j 1IM4A 4LF8F 3AEGB 4KGSA 3I32A 4IG3B 3AT1B 2MZRA 3QLHB 3J80U 4IC7B 3KUZA 3F44A 4KGRA 1BQMA 4C7ZA 3FJ2A 1ITPA 1U26A 2OGUA 2NS5A 3GJRB 2EKYA 4WTOB 3N9UC 3WAPA 2N4CA 1E90A 3AI5A 1P1AA 2DY9A 4BBNF 4X4NA 4J9VA 3LWLA 3RAMA 4QZVB 2W24A 2Z56B 3T1AA 2RMLA 3PACA 1I6JA 2PW9A 3DLGA 5DJBA 3EGRA 2V3PA 2YNHB 4WFNQ 2QFIA 4ED8A 1FEEA 2RQMA 4B9VA 4V19X 2GS8A 3ZKJC 4OHXA 1AROP 5L83A 4OHZA 3DBRB 3VAMA 1RU1A 4BWJA 2JPHA 1DQ9A 2QZ8A 2HNZA 1CJVB 1U1KA 4HHHA 2W7OA 4W9IA 2G13A 2MJEA 1IQTA 1KD1T 1T3QA 3G6ES 1ZUD2 4ACFA 4EGLA 4BKSA 3SV3A 4GC7A 1X4EA 2DPJA 2KVIA 2ZNZA 2KNBA 2KJVA 3U02A 3QO9A 1SQFA 2GVDB 3CCMS 2HHUA 3OJ4B 2VB6A 3DWMA 5ETTA 5AXLA 2E5LJ 3G71S 3JAMU 5DG9A 4ZVRB 1RB0A 2O5DA 3IN5A 5HMWA 1VRAB 3US5A 4EU0A 1WOOA 3ZZ0A 3QIPB 1BC6A 1K8RB 3RUIB 3L4PA 1PQSA 1N33F 2NBVB 4A3OA 4USIA 3PYEA 4H4OA 3W1SC 1T0SC 1TZOA 3SQOP 3DYAA 4PYAA 2RH3A 1OWXA 4DR5J 1OFFA 2MJNA 1WSVA 5C7PA 4PS8A 1U1LA 3ZTRA 1YG0A 1RT4A 1RAJA 4NAWA 4DSJA 3M30B 3UW1A 2BB6A 3NGSA 5E0OA 2N7JA 2KTRB 4CH1A 1TAUA 3SV4A 3MD1A 2DNMA 5B0DA 3UCZP 3V81A 1Q16B 4MKAA 3PR4A 3A4RA 5G55A 5ETRA 3UD4P 5KFQA 1YX2A 2CPEA 4LF2A 3W60A 4JV5J 2GMHA 1TVRA 4YDDB 2FY1A 1S1XB 4MM3A 2UUAJ 1WSRA 2LQBA 3KUGA 4F25A 2ZEJA 5DPTA 2I2YA 2ZVIA 1N32J 2O67A 1KS2A 2CQIA 1R8HA 4I7FB 1Q1KA 1QLBB 4IO9Q 2J0SD 3M8YA 2XMMA 1RHUB 2BWFA 2CYYA 2WZ1A 2KKHA 4ZPVR 1D4BA 5A2QY 1MPEA 2WNMA 1TZ1A 2QX0A 3EE3A 4IOIE 4QIVA 4ZVEA 1FRLA 3SQGB 2CVEA 1RDRA 3KLHA 1EWYC 3T9ZA 1RT7A 4K2JA 3CDWA 3SCLE 5GAHI 2INPE 2ON8A 3QO9B 2R61A 1TU0B 2FZKB 5AXNA 2V3SA 4C4VA 4DV4J 2XWXA 2MPUA 2YWFA 2XSJA 2HZCA 1VBZA 1T95A 2KO1A 1DAXA 4KC5A 1VIOA 2JZPA 1CJVA 4P16A 2M2BA 3OR2A 1R6VA 4IG0A 2RR9A 1T9UA 4KKOA 3E01B 5D77A 2YLMA 3AU4A 3DOKB 4DX6A 1AT1B 1TV6A 4O3SA 2ONQA 1RT6A 1I7HA 1ZXIA 3L9ZA 1GT8A 2ZCCA 1U0HA 2ZDPA 4NQLB 3Q8BA 2C42A 2XGQA 4ED4A 3PRPB 3W3SA 2C9WB 4BC9A 2U2FA 3PVLA 1ZETA 3DRYA 3CCZA 2B8PA 1PO6A 3ZTOA 2V4QA 1TQLA 1RHQB 2B9XA 1JWAD 4LRCA 4QIWD 5D0GA 1PBUA 2Q79A 3FUYA 1XLPA 4RM9A 1NRKA 2SXLA 4K50A 4USJC 1BXTA 4NYZA 4ZP9A 2BR0A 3AB4B 2JWUA 4TXSA 1F77A 1N61A 3GE8C 1XR7A 4FXCA 2LHEA 2OTLS 1JLBB 3WZ0A 2JFDA 3I82A 4GC6A 3UN3A 1V97A 1HBMA 4PUOA 1S6PB 1AWDA 3NLCA 2DNLA 3VFKA 1GNKA 1VQSA 2XMJA 3Q69A 3MAAA 3ITHA 4M8NA 3HT0A 1C4CA 1JJ2R 2MEWA 3ZJUA 4IH7A 1FKOB 3QGPA 1JLGB 2C1EB 4ATNA 4HT5A 2OJ3A 1XLQA 2AJ1A 1JROA 3ZZUA 2VC1A 5BXIA 2W8LA 1S49A 1VR6A 3P3DA 3SCJE 1Q79A 1I94J 2XLKA 3I0SA 3ETOA 1WG4A 2C2MB 5TR5A 1XMQJ 2DWQA 4OZLA 3EXCX 2DAFA 3VAHA 4QWCA 5E3AA 3PIPQ 4EE2A 4EBEA 1S0VA 5IA7A 4FNHA 1I3OB 3K7RA 4NEZA 1RHJB 4QWBA 1MU2A 4GGQA 3T5HA 5KTQA 2WU2B 2A2DA 3A13A 2F65A 3FRZA 2PMHA 2V68A 3RB3A 1VC5A 4XAKA 4J9LA 3LB8C 4N47A 1AA1B 2HFOA 1U6ZA 1WEZA 2W3RA 4F8CB 1UEKA 2BJEA 4X2BA 4MSQB 5LMNF 2IMOA 1HHTP 3QRRA 5A76A 3MR7A 2V4LA 2R2RA 3PX4A 4A8MP 5JUMA 1RCXB 1EKSA 1RWXB 2ZCBA 3MXHP 3QQ8B 4PWUA 8AT1B 3CWIA 2VA3A 4N9F4 1XQQA 4OYAA 3FILB 1HQEA 1N5TA 1D8ZA 1SL0A 1YRTA 1EARA 4G1IA 2FD2A 2ZH3A 4WWMA 2BW2A 2XNRA 5F8GA 2J8SA 1QQRA 4XWWA 3KLEB 1F9EB 2VL1A 3U52E 3UVJA 3H5XA 1KBRA 2TSSA 3ML9A 1XWLA 5CYMA 2KYZA 3QJJA 1OYEA 2LMCA 3VHQA 2IBIB 2DO4A 3P5TL 4MGKE 1TP7A 3BVGA 2CKHB 3RULA 2ASQA 4IFVA 2QILA 3W1SA 1VRUA 4CLKA 2W7PA 2L1AA 5LMUF 2J0JA 4MIWA 3ZXWA 2BXJA 4US8A 5IM0B 1E6VA 1YWXA 1KLMB 4ZMMA 1UTAA 2DBBA 4PG6A 1D5ZC 3C16B 1MWYA 2FLNA 2G1DA 5AUIA 5L1KA 1G2EA 4E71A 2GJIA 3I3TB 1U25A 3HVWA 1QILA 2W4DA 3BBFA 5KT7A 3BSCA 2MGZB 1CS4A 1DFDA 3NRBA 2DX5B 4USVA 4TQSA 2NPFA 1YBTA 3DQVA 3G6XA 5L9NA 3EGWB 1W2IA 2JNJA 1K8AT 4NLQA 1L0YB 2G0JA 2F7VA 3EMTA 2OJRA 2IGDA 3KYCD 4IWQA 4I6WA 2KHDA 2XNQA 4IWOA 3MEDB 1HBNA 1XCTL 2VA2A 2DIVA 1TL3B 4RFBA 3U7DA 5HI7A 3D6TB 1X9WA 1HXYD 3FKYA 4NLTA 1EAYC 1NJYA 3KYDD 3O8WA 2XTJP 4TKTA 4PG7A 1TS3A 2MLXA 3AJ2A 4KH1B 3URYA 4ES2A 4FPRA 3C19A 3RBEA 5LSLA 2ZUGA 5H1SV 4Y0FA 5T7LA 2HQFA 2CQDA 3OJSA 5LMUJ 2NPTB 4YMEA 3A1QA 5D4NA 3LJ3A 5HAOA 1WM2A 2IAJB 3NZ3A 1UVIA 4WE1B 4HPLB 2RF2B 1V5TA 4G6VB 2NBUA 2OH2A 4ED2A 1N8RT 3GJTB 3RN9C 4LSLA 1NDCA 1OQ3A 2JL9A 5DG8A 1WXVA 5JVHQ 1GAQB 3R8YA 2IBOA 1QE1B 3I4HX 2NXNA 3KUEA 3A9KA 3HM9A 3DDCB 3PW4A 5D94A 2GQ2A 3QIDA 2VPYB 4ZRIA 5G4DA 4CO4A 2ICIA 1RBAA 4K8RA 3UVJB 3M2VB 4RNNA 5IOIA 2ZITA 2EXUA 3PRVA 3CCRS 1N6QB 5J1EB 4ANWA 3CDUA 3MD3A 4LFBJ 2VBZA 1IXKA 4D3GA 1S9FA 1F3FA 2E1CA 1UCNA 1S1QB 1YIWA 3AN1A 4YOEA 2K6QA 1FJGJ 4WK3A 2V2VA 3Q83A 2VIHA 1A0OB 2KXJA 4DS5A 1LFPA 3Q22A 1TKZA 2VODA 3T5KA 3CW2C 2N9KA 5KFOA 2LRUA 5CYJA 1UVLA 1X4BA 5FD1A 1JWUD 1G7CB 2WXGA 1RACB 3RG6A 1P98A 3OSPA 4Q8EA 1LFDA 2C7MB 4TU9A 2UWQA 1WWTA 3L09A 1MU2B 4ASWC 3GG1A 4R8UA 4NLSA 3X3UA 1FWKA 4L3NA 4NCBA 2V2ZA 5LXRA 1T9XA 5D2MB 2ALZA 4DK5A 1RISA 2YPZA 2XK5A 2A2CA 3G82B 3TR5A 3DRRA 3BYTB 1UJ6A 4F4XA 1REVA 1FJ7A 3D1OA 4ANDA 4ZIWA 5BMIA 1KFDA 3Q6BA 4LDTB 1H0HB 1QUPA 3C46A 3GFHA 4KGMA 1M4VA 1K53A 2WVEA 4RW7A 4ALZA 1SC3B 4C8MA 1ZBTA 4UZCA 3MAAB 2J7WA 1YGYA 2GAHC 4IFYA 1U2RA 1PJ6A 1SJRA 4B9KA 3NGUA 1MFWA 2LU2A 3MCMA 5KFKA 1VFJA 3HO1A 2YNGB 3CEDA 3DVGX 2V8PA 1RWWB 3W64A 2L00B 2F8MA 3TAMB 3G96A 2HHQA 2WXIA 5ETOA 5H92C 1N60A 3ZRFA 1V8CA 3M9NB 1VQ6S 4RBTA 4DFMA 4G0NB 1ZE3D 1JLQB 1Y10A 4M5MA 3W61A 4J9NA 1TIFA 2X1AA 1XN9A 4X84A 3C14B 7FDRA 1NM2A 2OAUA 5HLFA 2GW8A 3EVOA 1SIWB 3I55S 2XMVA 4O4GB 3TZZA 3GFZA 2WSEC 4DFKA 2Q43A 2LVOA 2KZZA 4AT1B 3HSGA 3AE8B 2FJAB 4HTIA 4NMXA 2HAIA 2KFKA 2IVFB 1SC4B 4NZ6A 1B1ZA 3CO9A 2OO4A 3M6VA 4GKJF 1D9AA 1PYSB 3TEZA 5LJ5Y 5I4DA 1FX4A 4EEYA 3K8WA 1TKEA 4ZVOB 4XTTA 3IXQA 1P9YA 1HWLA 4NRTA 2PKOA 4A55A 3QGIA 1HIYA 4FF2A 1WKJA 2CJQA 2J42A 4CO7A 2FYXA 3K8VA 4LUBA 2HD5B 2VG7A 1N54B 3U1MA 3OJUA 3M6UA 2KACA 1UW4A 2CPDA 3BPSP 2J76E 3WALA 2O01C 3TANA 1OPZA 2DGVA 4ICLB 1U1PA 4JI3F 3H8HA 5FDLB 5TSSA 3FEXB 3UWTA 1RT7B 3C2PA 4ANVA 3ZJTA 3KLHB 3ONQA 2QG9B 2D1CA 2IY1B 3V6EB 1V81A 2E1MC 4OX8A 2CS4A 1L3KA 2LRWA 1F5AA 1FK9A 2M9KA 2EFNA 2BS2B 2WXOA 3Q8QB 1Q0WB 5J17A 2U1AA 3RR8A 2DRAA 2DGUA 1KOHA 4IDKA 3IT6B 2RS8A 2BYEA 3PW2A 1I4HA 3D3CJ 2K2PA 2PVGC 2WWZA 4MM3B 1S1XA 1RYSA 3R2CJ 4YP3A 1TVRB 4ES3A 3NG8A 1QOAA 4YSXB 3KG4A 4IDKB 3SSSA 2RAQA 2DNFA 5HQ8A 2I1RA 4ZYSA 2A3JA 3APDA 2IGGA 2KXNB 5GADI 2HVDA 3MM7B 2HWIA 4BKSD 1NDLA 1HW9A 2FCSA 3DVGY 4LNIA 3V81B 4NY0A 1JJHA 2FAZA 2NXEA 5CX3A 3EA6A 3OSNA 4NE9C 1VCBA 2LEKA 3UN5A 1RT4B 1H74A 2NZ4A 5LSOA 2VICA 1E6YB 4DUZF 2W9NA 3ZDMC 5T14A 3AAWB 2QLFB 5IQ6A 3JYUA 2R4FA 2MJDA 1RAAB 1W7WA 2GNKA 1GOZA 1SB6A 1IBXA 2J6TA 4PWDA 3BGFA 2FUG1 2J7QB 2FJVA 1FKPA 4J9QA 2L0FA 3AJDA 3EDQB 1KQKA 2ACYA 1B0VA 2IJ0A 1FXAA 1KR4A 1LXDA 1KLGD 3RJMB 1ZM9A 1BWVA 4IM3A 4X4OA 4PABA 1O8BA 3EZUA 4HH1A 1MLAA 2ACMA 4MSMB 1OSCA 4IQMA 2MP2A 3S01A 2JDJA 4EO8A 3MJ5A 4AL7A 1KLNA 2HNZB 4O4GA 2MHJA 1RT2B 2VQFF 3V6DA 4ED5A 3VTVA 3C14A 2KU7A 4NJ6A 1SKRA 2AJFE 5U47A 4AJYB 2FE8A 2YBVA 2FIUA 2HBQB 3UDLA 1MG7A 2QO3A 3MWBA 2HE7A 3UCGA 2QJ3A 1EWCA 2KI2A 1GX5A 2VF3A 3W5XA 2OI2A 5IAAC 4GO7X 2AHOB 3RYTA 3KJNB 2D74B 4CNZA 3BVZA 4WWNA 3PHTA 5KFFA 1A6LA 1NSPA 2EFPA 4DQRA 1WGRA 4RF1A 3O44A 3D1QA 3P8BB 1NEKB 1IBMJ 3IRXA 5A8RA 1LO5D 1KKHA 3GIKA 4J9PA 2EKEC 2LQJA 1CZPA 5K20B 2QGFB 2J8AA 2HTHA 2PFDA 1Q53A 1NXIA 2ZHOA 2BACA 3Q89A 3OJ3A 3X0WA 1T9VA 1A70A 1RWUA 1ZXHA 2D3OR 2ACZB 2CQ3A 1ZPVA 2MSSA 1B7FA 5M2RA 3AEDB 3IFEA 3MHSD 4KV8B 5E6NA 2K6DB 1GTEA 1PDXA 1WOPA 3P4SB 3P45B 3NS5A 1VJKA 1M5VC 1GG3A 2KTFA 2GBKA 4GOCA 3KK3B 1HI1A 4K59A 3TA1A 5AUKA 4N6EB 5LOQA 3GIIA 1LWEB 1L0VB 2KRBA 3SSRA 4DV7F 3AE4B 4GLSC 4B9UA 4LF9F 1CBKA 1LXJA 1X4DA 5FLXY 1RQ0A 2DNKA 4ZN3A 3VAJA 3TCAA 4B0MA 2M4MA 1N6QA 1N0VC 3VF0B 3DLKB 4LIRA 3CE8A 4Q0BB 4HXDA 3OHAA 4ECXA 4KE5A 3S7RA 2LEPA 3M2UB 2XY5A 2DTJA 2MSTA 1VRTB 5K8MA 2L8JA 2E3TA 2KDMA 2CQHA 3UD5A 2FHJA 3RW7A 2MZ1A 4DHZE 4RW8A 3K9OB 4ID8A 5KG6A 3GG0A 3MPDA 1IBKF 3AE7B 1U8SA 5RUBA 4BHQA 3I0RA 4RNHA 2INCC 4W9FA 3VCDA 1TJEA 1D9FA 4HROA 2YQ0A 2KWDA 4F3MA 5E6OA 4FN5A 4DHZB 1S1TB 1FFSB 4M5GA 3BKTA 1HKAA 5F8HA 3PZ7A 3BGOP 1D8YA 1NO8A 2ZM6J 1X1MA 1E5WA 1UPMB 3RT3B 3OPKA 3Q3JA 2M1MA 4DBQA 1NEEA 2FZGB 3KLIB 4J3OD 2VONA 2OEMA 3MMCA 5B0AA 3VQIA 3PW5A 3ZZRA 3MM6A 2ADCA 2QIFA 3L7UA 1XNQJ 1C0UA 2J0MA 2FJWA 2JX2A 3DBSA 1VHIA 2DGQA 2K1FA 5J2RA 2QC8A 4OI0A 2W7AA 8ATCB 1KTVA 1JIHA 2XSFA 1H2TZ 1FVSA 4AFFA 5DZ6A 2VFRA 1XO3A 3PREA 2FHMA 2HHHF 3AXMA 5KOXA 2BS3B 3PCOB 5HL7Q 2EMSA 4ZP7A 1RWMB 3DHGC 5KFLA 1O0PA 4YFUA 2IA6A 4JGHB 3FSYA 2NYIA 4AUKA 3LPEA 3H42A 3OVBA 1ELOA 3W5VB 1N34J 3C15A 3IAM1 3OTEA 5E41A 4HRSA 2XI2A 1NZ8A 1WJNA 3KHGA 4QW9A 4DU8A 3R7NB 2ZNVC 1VOMA 4KBIA 4KDLB 3W62A 1WJ6A 2IGHA 3MDFA 2DISA 4ZLJA 2FLPA 1KONA 3TA0A 3ENVA 1S1VA 2JYTA 4ZVUB 2MQ8A 4MTPA 5KG1A 1HZ6A 4GMVA 4Q45A 3W65A 2BKOA 2IC3B 3JSYA 2XO7A 2ZH8A 2PEAA 2DPIA 1NMEB 3DDKA 4GIVA 2Z30B 2FIFA 2L3ZA 3PJ9A 1SC1B 5CYMB 1WGDA 3IGNA 4FYVB 4GN1A 4RNMA 3PRMB 3WIVA 4MJKA 2OPSA 4DF8A 3Q8AA 3PHXB 1IVZA 1SE9A 1UP1A 4IQXA 1FESA 4TMAB 1CK1A 4DR4J 3I0RB 2WGSA 3FILA 3JQJA 3W2WB 2IM1A 1K0TA 2J9EA 2LU1A 3T3OA 4X4RA 2L9DA 1NB2A 3CSTA 1Q0NA 2QEJC 3NGDA 1WXQA 2CQ4A 3ULHA 1VBKA 2LXUA 1UF0A 3V6HA 3MMBB 2DHXA 2KKCA 1ZZNA 1WC4A 2BS4B 2DR9A 3FC4A 1W25A 3M8QA 2JLGA 2MW5A 1JWMD 4Q0BA 4CO0A 3G9CA 3R3TA 3Q3FA 1VLYA 1FXLA 2BB5A 3UE2A 3R2IA 3L95X 2VBXA 4HK2A 2IA0A 2W9BA 3RRGA 4NYOA 4NX9A 2JT4B 3HCXA 4DX5A 2DZJA 4C80A 1YITS 4YTNB 1K47A 2E5IA 3B4DA 3I0SB 2IZVB 1IWAA 4OZBA 4MIBA 2WXQA 5MLCV 1QSYA 3PVXA 4I6LB 4JI5J 1Q95G 3PX6A 2PIIA 2E7VA 2WVCA 4WFBQ 2PSZA 3NY5A 1QTNB 4C3LA 2UU7A 3DBLB 1LQ9A 4C11B 3G6VA 2B0GA 3V6KA 2GBNA 3OT9A 4MJSA 4AP4C 2Q6BA 2WXNA 4FPIA 2DAJA 3IP0A 3TBLD 2KDBA 1TKTB 3C6UB 2BKPA 4OZNA 3CD7A 3MPWA 4X65F 3I63C 3H1UA 1S6PA 3NWGA 5IFMA 4YTMB 2LFIA 1HWIA 4DL7A 4CLZA 3DCAA 3HIZA 5B0FA 2GHVC 1V3RA 2VKZG 2OPPB 4F4YA 2RSQA 1FWLA 2PN6A 1QLNA 2DBYA 3ABVB 1WMHB 2IRYA 1FTCA 1YN4A 3MM5A 2MKIA 2BX6A 2XZTB 4JI0F 3GWCA 4C8ZA 1OY8A 4NLOA 3QMQA 4Y3CA 3D6HB 2FC9A 2MWSB 3MFIA 3R27A 2ZH2A 1JK9B 4ZJOA 3R97A 1FNMA 4R5PB 3M9MB 4CIOA 4XDDA 4GVBB 3DHIC 3HSJA 3EYZA 2D9OA 2W25A 3TZYA 4ZLLA 4C9DA 3D6FB 3W5ZA 3DLBA 4PAAA 2VHGA 2MMYA 2GMJA 2NZCA 2XN9C 1I35A 4DZDA 1IKWA 2R7QA 3O1LA 4B02A 4FBUA 1NPKA 3H5UA 3HVAA 5HQLA 3UDCA 1SCJB 4MGZE 2ATLA 3RBZA 4B3TJ 3GONA 4UZBA 3V4IA 1E8ZA 4X4QA 3RB4A 2HVIA 1WHVA 3GJSB 2OKQA 5D3IB 2YVSA 3F0NA 3PEJA 3HXMA 1WWHA 3KDNA 2HQ3A 4PQAA 2JXTA 4DBGA 5L39A 3B4MA 4ER8A 2K8BA 1SJ1A 2VU5A 1NYRA 3DRPB 4GKKF 2B6AA 4P9SA 1CPZA 3DOMB 3EPIA 1QAIA 3KWLA 3PLUA 4B3RF 2PO4A 2GHWA 4DPTA 2E5JA 3IFWB 2C2NA 4P1BC 2CZVC 4AL6A 1VQKS 1VRQC 1WZ0A 2D3CA 4USKA 1KFYB 1PBAA 4C11A 5CCLA 2BABA 4M00A 1R0AB 1FNUA 3A3NB 3GZNI 4B9LA 1S0OA 1NLKL 4AOFA 2KT7A 3MEGA 2R7VA 2DYOA 4LQ9A 2XC9A 2HNYB 2RNEA 4ZCKA 4JV5F 4TQ0A 1FFUA 5GXGB 3UD3P 3PLVA 2D3O1 1H6KX 4C8KA 1VZ8A 2GX8A 1C76A 1H4RA 1TL5A 5F8MA 2EG2A 1O6XA 2FJXA 3HZGA 2QJLA 4YB7A 1VQ8S 1HPZB 4OVUA 2M7SA 4HI1A 4LRDA 2WHOA 3CJKA 4JI2J 4NCAA 1U1RA 2O1PA 3PFEA 2XMKA 2CNLB 3HD2A 2L7RA 1FK9B 4NLUA 5F0WA 5DQGA 4KGKA 2K8HA 3UCUP 2XS7A 4ZCMA 2HLTA 1TS5A 3MAQA 2VOOA 3I9V9 4DEZA 1IR0A 2LUEA 1X4GA 4N8OA 1TL7B 2BOPA 1VD2A 3CNQP 1XIQA 2MQQA 4LFAJ 2ZVOA 4I0WA 2IO3B 2V4IB 3PZ8A 3X1LB 3CMAS 4UQTA 1SL1A 4PEOA 3JSMA 2D41A 2RHSB 3PRBA 2MRPA 1KLVA 1HWKA 5K8OA 1DLOA 2G9OA 5IV4A 3TIXA 4W9DA 1ZPSA 2EC0A 2FVPA 3NG0A 3E8OA 2MKKA 1CQMA 2VFVA 3J80Y 3KK2A 3DBRI 4O3NA 2WS3B 1S1VB 1C0TA 5DDQC 1MROB 2KFKB 4ECZA 2JH3A 3T1YF 3M8RA 3AH6A 4EMDA 4E98A 1OS5A 3HJVA 4L72B 3MJWA 2G4BA 5E2QA 5DLGA 3T6BA 3FCHA 1S59A 2MCNB 2RDJA 3N1YC 4WF9Q 3FQKA 4ANCA 3U27A 2V9WA 3Q8FA 3LP1A 5DDOC 3P2BA 4DPOA 4DS4A 1PGBA 2INNE 2IPOB 5LM7E 1PC5A 2UV8G 3H7SA 1YRXA 2AT1B 2W1BA 5KFSA 1WRIA 2VZ9A 1IKVB 4DQOC 2KM8B 2JC1A 2PGCA 2LQ5A 3G8QA 1UELA 3B78A 2O6VA 2ZH5A 4DL0C 4LR7A 2LGDA 4KGVB 1VBYA 1K52A 4KHPF 1T03B 1TL1A 4NI2A 4KH0B 2BJ7A 2MXYA 3GYXB 3OV7A 4N41A 2LASA 3CWJA 5KFDA 3H98A 3UDVA 1C0UB 3FCWA 2XMWA 1REVB 2ZHAA 2IDLA 3MMCB 4EYHB 1SI9A 2J9DE 3MOJB 2YNFB 1S9EB 3HHKA 2G0IA 2A1BA 4CWBA 3LAKA 5HP1B 3TYTA 2Y8WA 4MACA 1N5WA 2JVOA 1TFWA 4W9LA 1V3SA 5KFRA 3EDRB 3BF4A 5LL6d 1C78A 5I3UB 5F3ZA 2LGYA 4M5JA 3SYZA 4N8NA 5KT2A 3TAPA 2Q66A 2QYCA 1DQ8A 5F3TA 5DS7A 3B0AA 2VRRB 2KD0A 2Y0SD 2BQRA 2RGFA 1RTZA 2R8HA 3P1MA 1KQSR 4DMZA 4K3CA 3TX0A 2WB4A 5GAEI 1RTDB 1RTJA 2R2TA 1TUGB 3TW0A 4RW8B 5D3DA 2VKRA 2HGNA 3VAKA 5F41A 3R2DJ 1TKDA 1VRTA 3HLUA 5E3CA 1G3OA 3SSQA 1VK3A 2ZJDA 2F1FA 5A8KA 2PLPA 2I5JB 2DH9A 3M2UA 1F9HA 2JEIA 2Y5CA 2JLFA 3K5MA 4LF5J 4P7IA 4TUUA 3EECA 2HG4A 3N6NA 4DQPA 2JY6A 2BM1A 3IR5B 1P9DU 1ISNA 3A9KB 3ENAA 4ZPTR 2HDEA 4OVVA 2YNIB 3ET6B 4K1RB 3M2RB 3JXOA 4C0OC 1FXRA 4B3TF 4J9RA 2RF2A 2NSCA 3EVWA 4WE1A 3ENQA 4OV1A 5J1PA 2C2RA 3IR7B 1JQ4A 1FXTB 4KKJA 4UOGA 2KH9A 1NKBA 3A1QB 5IOLA 3EFCA 2VQEF 3PO0A 4TVAB 4DSIA 1XLOA 1ZKHA 3M8SA 1R31A 5H9FJ 2BUNA 3KW5B 3NRZA 3GJQB 4DXFA 3J7Z5 1T94A 4OX6A 2DYMA 4BS2A 3OLMD 1VMBA 2BW7A 3E51A 3ZXVA 4LF4F 4DL4A 3JQKA 4KV2A 1M5HA 1R43A 1KFSA 3KKFA 4NLWA 2GLSA 3WCQA 4OZ2A 3R1HA 3H5YA 5IWAJ 2CJKA 2X3GA 2QT7A 1VQPS 3OR1B 3OTOF 3MTJA 3W2DA 5J2QB 2I1KA 4LF4J 4IM2A 4I67A 3DI6A 3VALA 3VV2B 2VG5B 1H7WA 1IKXA 4K4TA 1H3DA 2DRBA 4LBHA 3KLVA 4ZK7M 1C1YB 4EZLA 1SJFA 2VFTA 4HKQA 4K4VA 1HQRD 4RCOA 2RDGA 3RNCC 3K89A 4URQU 4YB1P 1KVKA 1SJQA 1RBLA 5EE3A 4CQ1A 2DXFA 2RRBA 1L7YA 2W2QP 3PW0A 3UGBB 6AT1B 4M8MA 3SDEB 2XHWA 4C97A 3PXGa 3TX8A 4A8OA 1AXQA 4R25A 1T05B 2CG4A 3FKBA 5IC4B 2WDQB 3R5DA 1SV5A 1CJEA 1EX8A 2MH7A 4XYCA 4CRJA 4JI3J 3HF5A 2MP2B 4RJVA 5KFJA 4CO3A 1QT9A 2CPXA 1CULB 4RWXA 2DR6A 4WJQA 4FKYA 4Q2JA 1WGHA 1LWXA 1HI8A 4LRBA 3DDIA 4XPCA 3H25A 2D10A 2IM3A 4G1PA 2A4ZA 1YN5A 1X5OA 5B0GA 4CZCA 2ZKTA 5F8NA 1FRKA 3TQ1A 2N82B 2MZTA 1YOVB 4FP9A 4WP9A 2JRHA 4ZLPA 1E8YA 1BHNA 4LNFA 1OJ4A 2JU6X 3ADAC 4PYZA 4RUBA 2FHKA 1CG2A 2XEXA 3PEHA 3C66A 1YJWS 4DR4F 4HDHA 3VDZA 4WWPA 1UBQA 3D7SB 1SIZA 2FQQB 1Y8RC 1NJWA 1KM7A 3BGLA 2MQJA 4ZVQB 4RUHA 1LFWA 2WRMA 1WF9A 4J90A 2M8HA 4KZ0A 4P52A 2O6VD 5FJ4A 2Y8YA 2UVWA 2L3MA 2W9CB 4J91A 2R7WA 2O3DA 3ILLA 3MMAB 1IJFB 4P2SA 2WLBA 1ZOTA 3TUOA 1KQFB 3BKUA 2X1GA 4MH8A 3ISZA 1UWBA 2MQLA 4BVUC 3VVWB 2GO8A 3NS8A 1BE4A 1MWZA 1AW0A 2F4FA 4OZ1A 3OW2R 1Q5WB 4CYUB 2VUGA 2PA8D 1RTHB 4BFRA 2C2DA 5E3RA 2EKNA 4IW0A 1HE8A 3A4SC 1ESFA 1NDPA 1XK8A 5AZFA 3HPOA 1JWWA 3N6LA 3QJLA 2HVHA 2ZHBA 5HK4A 4Y28C 4KHPJ 4L3KA 1F2HA 1NAQA 3VWSA 2N4FA 5DDPC 3R7QA 1EP4B 4L75A 2IM2A 3A3PB 2E5GA 1ZTTA 1X31C 1NPPA 4TSSA 2KJRA 1RAOA 1Y00A 4KSLC 2BZ2A 4FXWA 3PKMA 3GSIA 2BWES 1VLBA 4FDFA 3MECB 2FVSA 1R7SA 1ZM2A 2WVDA 1V5VA 2JFKA 4HEA9 3RGIA 4ARIA 3I5JC 4HVBA 3HI9A 1P1TA 3LDZE 2AZ3A 2QL5B 2AEFA 4OLOA 4ED1A 4YHHJ 2ZZNA 4FVMA 3U8ZA 1XNQF 3RNEC 2IYDB 2DH7A 3CMES 1GEHA 3O5TB 2GMIC 1M94A 4A47A 2QTWA 4JYAF 4NAMA 2J9DA 5LXIB 5GMKa 4UY85 2XYHB 2KC1A 2APOA 3FGVA 4LR9A 1ZTWA 2FHJD 4EI2A 1WTBA 2XS5A 2KQ7A 4RW4B 1YBAA 2F3JA 1VHFA 1PYWD 4OYWA 2M19A 2HKEA 4JI1F 4F2RA 2IVYA 3PTFC 2ZEQA 4LR8A 2ZOMA 4PS7A 2C2ZB 1T8EA 2ZZMA 2VFUA 5JH5C 2KX3A 1XMBA 5J2NA 3GIJA 4K2XA 1NI3A 2Y5BB 1NK9A 4OZ0A 1RT6B 4C2MA 2DRDA 3T41A 2HZAA 4RGNA 3NCQA 1HHSA 4IG0B 3TAMA 3PZPA 4FN2A 1Z2LA 3VQTA 3M32B 1S97A 2YNGA 1TK5A 2N9XA 1IBKJ 4FF1A 3CGIA 2WXJA 2DNGA 2RPVA 3KMQA 4EUVA 2EMTA 5AXMA 2HURA 3GIRA 2B7CB 2F9DA 4DR3J 2GBRA 4G50A 4F36A 1KHVA 4NL5A 1D3ZA 2XWYA 3HVTA 3JTPA 1S6UA 2WW8A 3EICA 2C7HA 2XB2D 4ZP6A 1MI0A 3SQGA 1TKYA 1F3VA 3V5RA 4O44B 2MBEA 3VH4B 3WQPA 4LK0M 1U1NA 4P72A 2UZAA 3CJ4A 2IDYA 3HHLA 1U2CA 3IRWP 4C0BA 2LKZA 2ZKUA 4DV7J 4I7FA 4QIGA 3J7AN 1X0PA 1QSSA 2R8GA 3NS7B 1SVDA 1QF6A 2WXHA 2YTCA 4R8UB 4OHJA 1UD7A 3S2AA 4C8LA 3GPAA 5ITHA 2R2UA 4JWUC 1SQEA 4FZVA 1GC6A 3VGUA 2MLYA 2ZBQA 2UV8A 4YY3J 1WYWB 1NHUA 1EHWA 1Y3JA 4OZCA 3AE9B 3IC1A 2W9CA 4XDCA 1WEXA 2YX7A 1S9GA 2LD9A 1J5EJ 3WC0A 2V9KA 2OFGX 1NK8A 4E2FB 2CQ2A 4TLRA 3R6GB 2AW0A 4KVGB 4OI4A 2MKJA 3DYAB 5HBMB 4WH4A 1RLFA 1V86A 4ED3A 1YX5B 2R7TA 1RT3A 4OMFG 5DPRA 4YT0B 1IKYA 4A4JA 1GXLA 2H4WB 3ZXRA 3C6TA 4ZVFA 5J2MA 5K8NA 3QIPA 1S9GB 3IS9A 2K7KA 2POKA 3M2VA 2AX5A 4EFAC 1T3NA 3PHEA 4RL1A 4H4KC 1Q78A 2R8KA 3R5GA 1RAIB 2GVDA 2CJNA 1YTYA 1JMLA 3RNAC 2XY7A 3FZ2A 4P7TA 1SJED 5AJ3J 4B9TA 4IH5A 4BCAA 4XE0A 3ILJA 1TGZB 4DSKA 1VBXA 3W8PA 4QYZK 2W9AA 4TU8A 4I2QB 4CLTA 3PJXA 2MQPA 5EDWA 3JSVB 1SKUB 8RUCA 1NJXA 3BB5A 2NPTA 3ZIMA 3I6PA 4U8VA 2V8HA 3BEGB 3IR6B 5GMVA 2VQFJ 3BINA 1XR6A 2W55A 5C1ZA 2AF6A 2WK4A 3PNIA 3Q0AA 4ZRKA 4C6AA 1HBUB 3DLGB 4ZVSB 3OTCA 2XCAA 3WC2A 3BDPA 4LFCJ 1FA0A 1N0UA 4USWA 4OZ5A 5HANA 3D0IE 5D4LA 3VXWA 4F0MA 2VFSA 1M5SA 3HT3A 2N9EB 5KFCA 2KN4A 1RA6A 3AXKA 3P96A 1HBNB 1MG8A 2PI5A 3CULA 2AV5A 4RM8A 1OSDA 3ISND 3MEDA 1YJUA 3UDEA 5E6PA 3VTWA 3WAOA 5J2NB 2EK6A 2X51A 3QLHA 3Q3NC 4ILMA 1WH3A 5KAKA 3SHQA 4BLGA 4ZRJA 1RGVA 3AQPA 3GQCA 2V0NA 1IYFA 1DQAA 5E3QA 3QNWB 3R66C 3O6QA 1PGZA 1SUQB 1TY2A 2QC3A 5HMYA 1FD6A 1FRXA 4P2XA 4YS2A 2DCLA 2HIYA 1KEKA 4J9UE 2Q1LA 4AE5A 2BVCA 2QDFA 1WGYA 2RDBC 2Y0BB 2L48A 2CVIA 5IQQA 4HLBA 1T6BX 1PGAA 1MSWD 2HIQA 3DN9A 4LF7J 5G0RB 3C16A 2QSDA 1BWEA 5BMHA 3F56A 2WDRB 1HD0A 4O0IA 1FRDA 2UUTA 4WPAA 2HQCA 3W63A 2JEJA 2FZCB 4HI2A 1FWPA 1WELA 1JRPA 2ALYB 3P4UB 2L08A 5F8IA 4GSWA 3ZZZA 4MFBA 3IBWA 3CC7S 2ILYA 2IJNA 3MR6A 4GDLA 2ZOGA 1N5XA 2H54B 2QMTA 4NMLA 4JI7F 4UF4A 3DLHA 3AMZA 5JXVA 1UH6A 3IAS9 1HD1A 4JI6F 4QWAA 1EJ7L 3PG9A 3QT8A 2NVUI 1NSQA 1Z1ZA 1OYDA 4MK8A 4WKYA 3VAFA 1HW8A 2ZBIA 3W1YA 4CYUA 3OLAA 1PYOB 4HL9A 1R8CA 3M05A 1KOTA 1SBBB 3G2XA 3MUTP 4YSZB 2YPYA 2WXKA 2O66A 2LXIA 4YL8A 3TEWA 5CABA 3BQ2A 3GYGA 4I6YA 1V1PB 1UL3A 5ETKA 3MMAA 3BGRA 4C56C 3M8ZA 2CJ9A 1WY8A 2K5PA 1NNDA 2VD3A 4EEWA 5HQMA 4W9CA 5HHDG 3M8WA 2CUYA 4DQSA 2KFNA 1RYRA 1WG1A 2ASYA 2ROGA 3BH7B 2VH1A 1DHMA 3IG1B 2HFSA 1ZH5A 1WRDB 1NYQA 3ZTSA 2DHAA 4EK2A 3RTVA 2W01A 3CCSS 4FBTA 3TUIC 4L73A 3P4QB 2VPXB 3VRAB 1Y3KA 2XMAA 3BY4B 2QA4S 3H9DA 3V6JA 4K4SA 1HNVB 4I1TA 4MIAA 1QAYA 1WE7A 1KN6A 3OXFA 3WAMA 2OELA 4JWSC 2K22A 2GOWA 4CM0A 3QWPA 4LSZB 1TK8A 2KYWA 1FRRA 1DGJA 1CMXB 2MHNA 3CJQA 4LCDE 3AM9A 2V8VA 3DVNV 2DY1A 4YWGG 1FFGB 4Q5VA 1F1HA 1HBMB 4PUOB 1SXTA 4UUWA 3P6YC 3A8IA 3RFZB 3Q8UA 1T9TA 5I3PA 3FSIA 1Y9OA 2I38A 3BWUD 4PKDB 3D67A 1E8XA 3QZ7A 3AEEB 3ZZYA 5F8LA 5KFMA 2BYFA 4N59A 2HHTA 3WDOA 2HQDA 1V6HA 5EWFA 4KFBB 5KFXA 3BVMA 1E7UA 3M8PA 1SSNA 4ZKAA 3OWEB 2IM0A 3W9CB 3JS9A 2IYIA 1YJNS 1FE4A 2GC8A 4N7TA 1KC8T 3I5BA 3A9JB 4AXJA 4JX1C 2LLZA 3BDEA 3RZWC 1IKXB 5K14A 1N33J 4PRFA 2MSED 3RAXA 4PWWA 3H8YA 4WP8A 1P7EA 1U0SA 1C4AA 4ILRA 1RJJA 5J2QA 3CCTA 3MUVP 5B0CA 5KG5A 1UNSA 2HK2A 3OL9A 3DOKA 2J0WA 2NYHA 4KKOB 2L0TA 4J6IA 3CSKA 3G4SS 4PG5A 1OEYJ 1OEYA 1UZHA 4MK9A 3OR2B 1YJIA 3GE3C 1KF6B 3U4EG 1VQ4S 4A8WA 4OYBA 2HS4A 2ZH7A 3KLSX 2XSJB 1XR5A 2MKSA 1IM6A 1OQRA 1K1SA 2CZ4A 1Y7PA 1U02A 3OFEA 2FGOA 5C23A 4J37A 2PMVA 1NSKL 3RRHA 3X23A 1TL7A 2KWCA 3A8EA 2QLXA 1RAFB 3CJ2A 4LFCF 3SFGA 2QRRA 2VH7A 4ZLNA 4Y65A 5HSPA 4KQZA 4P6QA 2HYIB 5E7OB 2AYBA 4MKYA 4KDIC 3HD1A 1Q8IA 1Y5LB 3TWZA 2YEPB 4S17A 5A6PA 3DOLA 2R8JA 1ZP0B 3ELHA 3AE5B 1S72S 3VUXA 1XNRJ 3SFEB 1FO1A 1PILA 5GMDA 4IKGA 3KDOA 1K50A 3HDSA 1ZAWA 4S0MA 1FPYA 4K7SA 3QJPA 3JSRA 2ASDA 2DH8A 1GPXA 3CC4S 3W1YC 3N20C 4YEAA 3LWMA 4JV2A 1T0QC 3GSDA 3U2SC 2DGWA 3L0WB 1V5IB 3FCVA 5HROB 4C4WA 2H5EA 1KRPA 3M30A 4IRDA 1O51A 1UGJA 5CYQA 4HYKA 3ZW3A 4Q8FA 2AGOA 3DVNU 2BGFA 5HKHA 2FJBB 2HZVA 3VAGA 4X66F 2J53A 3EFUA 3OVSA 5KG3A 3UQAA 4FJYA 3P5BP 5E5NA 4ZA1A 4WFXA 1LNQA 2C2OB 3TRGA 1WGGA 3LH2S 4EO6A 1YD8U 4DXGA 4NWBA 3BYYB 1S1UA 2DGOA 3KVFB 2LDIA 1RT5A 3HVRA 4AS1A 4PXDA 3GE9A 4UQGA 5I3UA 3G87A 2HHVA 4IR1A 3TSSA 1JLFA 3FDSA 2H4YB 4RO0A 4ZPBA 4BOZB 3JSBA 1HNZJ 4CO1A 2H1YA 3AA8A 4WKRA 4LIWA 5BR8J 3CCLS 4U95A 1KTQA 1S9EA 1RWKB 3MCOA 1NHKL 2E9TA 3L16A 2GI9A 3J81Y 3AXCA 5I4MA 5D0EA 3UIPB 4TV3A 2IDEA 3PM9A 4QOTA 1RLCL 1WI6A 4NLYA 2J6SA 4B3MF 2KJ6A 1G6BA 3AB5A 2WDTB 1R4NI 1WC6A 3KOAA 4JBCA 4LF6F 3HKZD 2FJDB 3ILIA 1Q1OA 4YB6A 1L2NA 2O6VB 3OL6A 5AXKA 3KMSA 1S79A 2CAJA 2XMUA 4KO0B 4ITSA 1RUSA 1IBLF 1OQQA 1VCTA 2D3GA 1YJJA 1FRMA 2AD9A 4CTAB 3HM6X 2GHPA 3FAHA 3KG1A 4DR3F 1CLFA 3W8GA 1BD6A 3K5LA 2EVZA 3LP1B 4P10A 1RXOB 2DZKA 3QFWA 4KSKC 3MM5B 1LQBA 3HVDA 4FJZA 2E66A 2KM8C 3L08A 1QUVA 5C2TB 3CCUS 4KZCA 1KWMA 1UGMA 3SZ2A 2HS0A 2MBOA 2OMOA 3QC8B 1WNEA 2MY7A 2J52A 5A0YB 5GAEU 3KLGB 2AYGA 4P1CC 1I4RA 1ZAXA 1EETB 4OJ3A 3MAHA 1B3TA 2AGQA 2OJWA 4JI1J 5C25A 3WIMA 2WXLA 2UVUA 5FR6A 4ZS6A 3Q2AC 3LP0B 1VJWA 1HQUA 4K3BA 2WB1D 4M5DA 1B64A 3J7A1 2AP6A 1ET9A 2YH0A 1JLEA 2E9ZA 1NK7A 2LYVA 1DLOB 4DUTA 4FF3A 2KB2A 2JHEA 4DV3J 1VI7A 1QAJA 2K9XA 4YHHF 1TKXB 1AN8A 1YQ4B 1R27B 4DV5F 3Q2TC 2H51B 1L0XB 4ZITA 4QBUA 5EN1A 1TT5B 3BBBA 4BC7A 5D3GB 1NCLA 3AHPA 3SXLA 1KLUD 2OPRA 4WYWA 2ZE2B 1GXUA 4PR6A 2BJDA 3TMPB 3OXLA 2W3SA 1V2YA 2Y5PA 3EZOA 3CD6S 1ZYQA 2RSUA 4PPDA 2N4DA 4K4WA 1SL2A 3MMBA 4DHJD 1HPZA 4LRAA 2NR0A 4P2FA 2AYOB 5D3GA 4DV6F 5D0RA 3R5JB 4WFYA 3Q8SB 4JQWC 4F4AA 2N0SB 3VHTC 4JB8B 2LGXA 4YSYB 3MMJA 4TY8A 4U8YA 4KPYA 1PGXA 1REGX 1PJ7A 3FQLA 4ZDNA 4ECQA 4GKJJ 2HNYA 1RWPB 1SE4A 3B2GA 1P1LA 1J7BA 3MEGB 4H4MB 1JLEB 2CG8A 1WHYA 4L1BA 1LK7A 3DLJA 1VR9A 2BEFA 1PYTA 5MAOA 2NCNA 3GOEA 3RNGC 2BV3A 2K1RA 4C98A 1YJ7A 3BZDB 4XWTA 1M1HA 4QAYA 3R8BA 2MJ3A 3EUB2 2XI3A 4NZLB 2N1WA 2UVVA 2P9EA 4ZPCA 4X62J 1P27B 3I96A 4PG4A 4WURA 4FYWB 3UQSA 3POTB 1WUUA 3DOMA 4PT5A 4MT5A 1VQMS 4NRUA 3DRPA 1MJDA 2AQ3B 2V2KA 1O5JA 2AYMA 3CIRB 4II3B 2WONA 1B7YB 3TO8A 4D3HA 3OQ2A 2ZZPB 3C15B 1TKGA 2PIAA 2DZMA 4OI6A 3TUPA 2BQQA 4OZJA 3WIUA 2QCZA 2RE1A 1FERA 3KLFB 1I4XA 4C48A 4WJOA 4KO0A 4I2PA 2A6OA 3V4IB 5CHCB 4DV6J 2RVJA 1GJZA 1NH7A 5CZVA 2NTTA 2CQBA 4XO0A 1RFKA 3T9NA 4F4KA 3KQ4A 2RQCA 1IKWB 4A8FA 6FD1A 2QYGA 1AUDA 3TEYA 1ACMB 2KRRA 2D11A 1N88A 1A5RA 1HWJA 1T9WA 2YQ3A 4DV0F 3CJRA 4JUZA 3PRDA 3DPDA 4KHMA 2L05A 5CTRC 4A46A 1WD6A 4BBNC 4PK1A 2HBRB 1H38A 4G3IA 1N32F 3HSZA 2L41A 1J5OB 4KIAA 4CQNA 4J9OA 3KLIA 1IJEB 3S1TA 2UU9J 4GVBA 3ZNJ1 4F50A 2K0PA 3NAIA 2G1HA 2JOQA 4B3OA 3MM9B 2PE8A 1M1KT 3CTRA 1FXIA 3OVAA 2DEJA 2GO9A 4OYMA 4K4YA 3JTNA 1RWNB 1WI8A 2LXCA 1RT5B 3NOCA 1WMHA 2ILZA 1I4GA 3W2VB 4NYPA 1S1UB 2OPPA 4WP3A 4E74A 5DO2A 2Z2LA 2FTRA 2IPKD 4NLPA 2XM3A 3C6UA 1TKTA 1VLOA 2GGPB 3UFCX 4GB9A 3PY8A 2CPZA 5L46A 3CDBA 3BSOA 3IAS1 3TL5A 2IBKA 2QSFA 3KNAA 5HMXA 4QQBA 3E9SA 3SU8X 2JWNA 2FVRA 4ANXA 2EEYA 1T02A 5BYQA 3FEZA 5HROA 2UYZB 1C1CA 2OTJS 4FHKA 3DLKA 3CB4A 3AD7C 3UINB 4OHYA 1J2VA 4TYAA 1NKCA 1D9DA 4EZJA 4XIUA 1L4DB 3CSFA 3PTWA 3NGRA 4HTJA 1LWEA 1QOGA 1YQHA 5AJ3F 4NZ7A 2HJ8A 4ZP8A 2DHGA 1S6OA 3QRPA 2M0XA 4FXDA 2C3OA 2B4PA 4F67A 3VVTA 2UUBF 4Y6IA 3LAMA 1HBOB 4O3OA 1U24A 2HRYA 4DCOB 3GV8B 3HFVA 1RP5A 4E0DA 2N9PC 3W9HA 3GV5B 2KQ4X 4DHVA 4B9MA 2KK8A 4RF0A 2Y3AA 3CJ0A 2B4UA 2XBPA 2NS1B 5BR8F 3EUNA 3C0RB 2GZOA 2V0GA 2JSXA 1TZ0A 2AIRB 3B8HA 4OZAA 1J5EF 3MFGA 1SGHA 3AEBB 2WAQD 5AZHA 1V9JA 3GP7A 3DNCA 5A8RB 2M17A 1FDNA 4TLQA 3HHDA 3H59A 1UFWA 4JV0A 1GUAB 2LJIA 3H2LA 3MM9A 3ZO5B 4XX5A 4M0WA 1ZM3A 4BWMA 2BTEA 2HBZB 1FDAA 4DHJB 4KRWA 4W9HA 3TOQA 2G2YA 4U67Q 2WU5B 1C79A 4X66J 1R4MI 4X4TA 4NCGB 2HWHA 2FUG9 1RWSA 3SFDB 4KFBA 3AU5A 2RHQB 3HSDA 3LP2B 1YJVA 5CA5A 2WXRA 2Q3PA 5E33A 1DOYA 4DFPA 3T1HJ 2NXJA 3NGKA 1MHXA 4RNAA 5EX3A 1NJIT 4MEMA 2GQCA 5A2QU 2P6SA 2DD8S 2W4CA 4LREA 2JZ3B 5KFTA 2BBCA 4DXAB 5LXYA 1S6QB 4YB5A 1IUEA 3H6NA 2GCFA 2LDYA 3LANA 3LA0A 4PCQA 1QSLA 1NDDA 4ZHPA 3CJ3A 3QSIA 2D07B 1K0VA 4P74A 2MDAA 2JVCA 4OVZA 4ZPDA 2H5IB 1BQXA 2KWVB 4CO2A 2LQ9A 2CPJA 1MNEA 1JNRB 1WE6A 4CLLA 3SD5A 3D2WA 2PEHA 1B70B 5D0HA 3MEEB 7AT1B 1C1BB 2P2CB 3AEAB 4ED7A 2WONB 1CEZA 2DENB 4H4KA 3MM8B 1U2FA 4HPPA 1B4SA 4ZRPA 3FFIA 1HA5A 2MBQA 2DIUA 1R89A 3P4RB 2KQSA 4DQIA 1IBXB 3U1LA 1WC1A 2AQ2B 1TBEA 2L52A 4FJVB 2LP4A 3P63A 2H88B 2G0CA 3BM7A 2AJ0A 2ZD1A 4O3PA 5LNK1 4DPYA 5DGAA 3AD8C 2UXCJ 1F2GA 1E6YA 3D9BA 2IFXA 5D4PA 2I0XA 3K57A 1YK9A 3HK0A 4JYAJ 4G1QA 3RUBL 2LJ5A 1BLUA 4RW6A 3P4PB 4ZN1A 3IHPC 2B4OA 4HCPB 3JYTA 1V1PA 1Y4ZB 4NLVA 5B0EA 4KR0B 2AEJA 1B9RA 1GNUA 4IM0A 4DLEA 1XMQF 1HTOA 1UEVA 1Q5YA 3CPWR 4NASA 1U49A 2MTLA 3T19A 3A33B 4YXDB 3MPYA 3AQOA 5H9EK 1K1QA 3N79A 3Q8EA 4D2KA 1S7IA 4HDQA 3DRSA 1XEZA 4GU2A 1GH8A 3A12A 1EQ0A 2OIHA 3RW6A 4Z7CA 3PR5B 1RT1B 2VV5A 4GDLB 4JP8A 1S0MA 1X4FA 3AE1B 4KX6B 2HQIA 4DDID 5EWEA 1WXAA 5B09A 1UKUA 2DVIA 1FEHA 4CYEA 3EM1A 3Q8YA 1LKZA 4BDPA 3J81U 2R2SA 4M94A 2CJBA 1MG4A 1ULRA 2VG7B 3VGTA 2GA7A 3VGVA 5BMGA 4WU2A 1NK4A 2KMMA 1WHXA 5ETMA 2RMMA 3O13A 1Q7LB 3A1YG 5G0RA 3LGHA 5KFZA 2ERRA 2OHDA 5IS2A 2RS2A 4MK7A 4KV8A 1S5ZA 2JLEA 5IT9U 5CH7B 1CJKB 2DXDA 3LP0A 1IR2A 2RB7A 3RAQA 1SC6A 2HNDA 2AWZA 4MT1A 4RGMA 1VZ7A 1BQNB 2C3UA 2HSEB 1TMJA 4DX8H 1WC5A 3LPYA 5A0YA 2VC0A 3QGHA 1X5PA 4HLEA 5KG2A 4ZVTB 1A9NB 5HI1A 1RRBA 5D15A 1KOOA 1OPIA 2LZ6A 3PV1A 3ZDTA 3AA9A 4DDFA 2HHPA 2H9ZA 4H54A 4B3RJ 2WX0A 1HMVB 1R4NB 1U6FA 4JI8J 3WX4A 2LVPA 4DV4F 4RW9A 4GKKJ 3D1HA 2HS3A 3WBZA 1FVQA 4YUDA 2LVWA 4CTAA 5HJYA 1E0ZA 1AB8A 2NBWB 2Z57B 4NLRA 4P75A 4FYYB 5I42B 3R7RA 1HNWF 2YKOA 2B4VA 2HAFA 4K81A 1SH3A 3AJ1A 1BGXT 1PC4A 4YTPB 2AKWB 3TEHB 2P8IA 4LMZA 3N1XC 2DHSA 3N1ZC 3D66A 4A3PA 3PHWB 2ZFHA 1UAWA 3C8YA 3RR7A 4UOCA 1HYSA 1GQEA 3V6DB 1QOFA 4MKBA 3CO0P 3HHMA 3JVZX 2ZUAA 5CZXA 4F1SA 2E1PA 1DTTB 3K17A 4ZHRA 1C4PA 3ZNID 3A8JA 3DFEA 4DZ6A 1WF0A 3PSEB 3A3OB 1WORA 3KNGA 1NB7A 2B76B 2D9PA 3R5AA 3IBCB 3HK2A 5DGBA 1HHQA 2OPQB 1S4EA 3DHWC 1ZOYB 3R9LA 1CJUA 1SJHD 2JXXA 1CJKA 4DR5F 2RD5C 2CNOB 2FDNA 4YR2A 1Q86T 5KG4A 2JC0A 5A8WA 3V2UC 1UPPA 3IS9B 2FLOA 1NENB 2FPHX 3QAUA 1TKZB 3O2IA 4DR7J 5IWAF 3M3JA 2OSRA 4DSEA 4RNFA 2V4JB 2KMAA 1RSCA 4RUCA 1RT3B 2FCMA 3WX8A 2X1BA 2NR2A 2E1RA 4O1NA 2HRUA 4N56A 2DEIA 4WZQA 4Y34A 1CC7A 5DCNA 2DHZA 2KMCA 4AD6A 1FCLA 2PA3A 4OYPA 3A8KA 2G9HD 3GP9A 5KHOA 3AOCA 1FXDA 1RM6C 4I6NB 2F5GA 2R2QA 3CJSA 4NXMF 1AYFA 1C9FA 3Q86A 3OAWA 3CDEA 4FYDA 4KTQA 2GJFA 3HJFA 3MUMP 1FNOA 3EXYA 1UFKA 4A8QA 5AE1A 3M9OB 1VQNS 3G6YA 3VGSA 3ENEA 5EUHA 4WJNA 2IAJA 1MMLA 2CDRB 1FNVA 4W9KA 1PAEX 1X4AA 3HHLB 3B08A 1WDTA 2L9NA 3ZTCA 3ONSA 1VYAA 4RU9A 2WP9B 3PO4A 4DV2J 3N6MA 4O44A 2KFJA 2GIRA 4LF5F 4ZOSA 2DNPA 1HZ5A 4ICVA 2K06A 2CPFA 3HVTB 1TAQA 5FIIA 1M5PC 2Z0DB 1K44A 4RBVA 3APFA 3SCIE 4OX9J 1NSAA 4FADA 2HGMA 2HFVA 1YJTA 1NBEB 1JXVA 3VZIA 3RRKA 1YQ3B 1QM9A 2KVZA 2KT5A 1CQVA 5LJ3Y 1C2PA 4DR1J 1QTMA 4QR2A 2KG0A 1Q7YT 2W2PP 2YH1A 2NREA 2DKOB 3CT9A 2P9CA 3L10B 2G2ZA 1DJ0A 2MZQA 1L3UA 2AX0A 4U6PA 3MZIA 3J9CA 2BE9B 2MB0B 3RD2A 5EGYA 1X4HA 2XCPA 5CCMA 4TU7A 2YWKA 2OFHX 1KP6A 4ETZA 5IN7A 3QWZB 4HEA1 2BVZA 4FKXA 1G6JA 2CHWA 2B5JA 3SMZA 1E6EB 1RFAA 2WXPA 4W9GA 5G2NA 3CJTA 4DF4A 2EELA 3QJZA 3MI7X 1R8PA 1RHRB 5D78A 2QL7B 4AQYF 2DNNA 2CQGA 3CD0A 3CD5A 3Q8VA 1S0NA 3BKFA 1KLMA 2RT3A 2KHWB 3K5NA 1SJ4P 2A5UA 3EZ5A 2VZKB 1F9JA 4NCGA 1VDVA 1HR0F 3MECA 4EYIB 1U47A 4CO5A 4PXEA 3C3LA 3I57A 4W90B 2M52A 4LT6A 1WF2A 3E3XA 4OQJA 4PQUA 1APSA 2C3MA 4ICUA 2NXUA 4M0WB 3OTDA 2RQKA 2D69A 2GAGC 2M8DB 2CQ0A 4WQOB 1BMQB 2W2MP 3PFOA 9ATCB 3CC2S 2R7OA 4CT8A 2GIFA 5HG2A 1NK5A 3QA8A 4G11A 3L54A 3AB2B 4L74A 2K8GA 3JW0X 2KT3A 2AU0A 2ZDOA 3H4DA 3KLEA 2CHXA 4K7WA 2J0KA 3DBLI 1M90T 1EU4A 3SCKE 2QFJA 2V1YA 5IT4A 2D5GA 4WXOA 1ENFA 4ZPWR 3PIOQ 2RJZA 2WXFA 4X64F 2DR7A 1JLAA 1EO6A 2CPIA 2OUGA 3KJFB 5DDRC 4KAIA 3ZZTA 5KFVA 4DDGD 1VISA 5E3PA 4USTA 3AODA 2DB1A 3KJVA 4M5IA 3IA0A 3BH6B 3IGVA 3R7SB 4QU6A 1XMOF 3HM3A 3QT6A 3QATA 1N48A 2KDIA 3BGRB 4LBIA 1LK5A 2ZM6F 3QK0A 4A20A 4MYTA 5HVFA 3JQMA 2CDQA 2W2NP 2Y9HA 2ATCB 1IP9A 3KG0A 5G5GA 2MEKA 3V3XA 2NUHA 2AJ2A 3QAEA 2XO6A 1OGWA 2Z0GA 4U7CA 4K5SA 4KJIA 1PAUB 5KFBA 4EZ9A 1VGYA 2LXAA 2A10A 3MTNB 1DTQB 2SAKA 1JRUA 1C1CB 3ZZPA 1IQZA 4X64J 3FBFA 4ANUA 2WSFC 1PIEA 4RPFA 3N5FA 4TKNA 2QA1A 2EWHA 4IOBA 3GILA 2L9WA 4F0KA 4MFBB 3R7BB 2IRUA 4KIKA 1QE1A 3DRXA 1F9FA 4EUTA 4QPTA 4DN9A 2GGPA 4MMOA 4PQUB 4LSLB 1CJTA 4E8UA 1S7HA 1AW7A 1EU3A 2BQ3A 3UF8A 1GC7A 1JLBA 1SV5B 2XG8A 3K5PA 4V1Ak 1L6VA 3W2VA 2V2QA 1I42A 4F3QA 3SDEA 2C3YA 3BSNA 1P9QC 3NWRA 4QWEA 1UJ5A 2OP5A 4WQMA 4LRFA 3TZXA 1WZ3A 4CLWA 1OY6A 3BZQA 4JV1A 3KUHA 3DXSX 4WAAA 3EVMA 3ZTQA 4DV0J 2JRSA 4QYRA 5HFYA 4AQYJ 1HARA 3PYFA 3R6LB 5DM7Q 1NDKA 1C77A 5C2GA 5FR3A 3BS9A 1KDNA 2JEFA 4RGTA 1HNIA 4J5OA 3QRQA 1P8GA 3CCQS 3LYYA 2C3PA 4AXIA 5BYRA 1U0HB 2WDVB 2VPZB 5DZ7A 2IIHA 1F0XA 5L9XA 4MAKA 2R7RA 2COLA 3ENWA 3Q2SC 2M8SA 2ZVSA 1H2UX 2WW4A 2MX2A 1N63A 4A48A 3TEXA 2DGSA 1XT9B 4TNOA 2DO0A 3UIOB 2DLBA 4B3SF 2MZJA 4DI6A 2UUCF 1KNZA 2GRIA 1FD2A 2LMIA 4OI2A 2E1AA 3I5CA 4PS3A 3ETMA 1KQGB 2CHZA 5D6JB 3MCSA 4FYXB 1HBUA 2V67A 1X9SA 3A4TA 2MGZA 2N1VA 2RDIA 4NQKE 2CA9A 4A8KA 1V9OA 4I6AA 3BK2A 2KJWA 2MQMA 2R7SA 4ZVHA 4X4UA 2YWHA 5IM0A 3TUJC 2PD1A 4I2QA 1JWBD 1PFDA 1G4CA 5KFGA 1DY3A 2GIQA 4OV6A 2UXDF 3SEBA 4DV2F 3W9IA 4Y2MA 2M0GB 1WIAA 3I4PA 3M2RA 2CPYA 2AGPA 3K9PB 4X4VA 3CF6E 2YKQA 1JXEA 2UUWA 2K1RB 3ZNUA 4WWOA 3E56A 4ZRQA 2BQUA 4NJ7A 1QZEA 2F63A 2YXLA 1QD1A 4IO1A 2LHDA 1MHHE 1QVFR 4ZIVA 2X1FA 1WXSA 2VJVA 2I5JA 2PEBA 3W66A 5A8KB 2JSVX 1RWOB 1I5OB 1Z2MA 5CQGA 4CCHA 4WYLA 1SKSA 3PO5A 3HFKA 2XGPA 3N0VA 4F0HA 2CXEA 3D0GE 4EKUA 4F7ZA 1HQEB 4R0EA 1SKWA 1XQIA 2OSQA 4F04B 4NXNJ 4Z2XA 1EIYB 5GAHU 3NAHA 2XLJA 3PYDA 4H4OB 5B7WA 4J9KA 1RZMA 2MYFA 1M5KC 3KHLA 3UO0A 3G86A 5AZGA 4WBFA 1JWSD 1J7AA 4LVOP 4OZ3A 4DL2A 4JL9A 4OYOA 4A9AA 1N36F 4DOZA 5A8WB 1KSPA 5DPWA 3VUYA 1NU4A 3OTOJ 3U30A 2G4DB 4DUZJ 4DCPB 4JI5F 1CJUB 1F5CA 2EK1A 2ADBA 4DV3F 4JPSA 1FRHA 2UXBJ 2OPQA 3BQ1A 1HLWA 5J1NA 3VTUA 4UOFA 5HP1A 1TKXA 3H0PA 3PV8A 1VC6A 1RWVB 3NL0A 2DT9A 3VAWA 3NXZA 1YIJS 3EX7B 4IKAA 1RU2A 2KO3A 3N28A 3JTOA 3AY0A 2HLUA 1HYSB 2XHCA 4QU7A 4DWFA 3TVZA 4CT9A 3M62B 4WWSA 4ELTA 3ILOA 3ITHB 3MTKA 1NKEA 1EETA 4P7VA 2JJ4D 4DXLA 5I3QA 5ETNA 1TYGB 4YQWA 2KWUB 2AEHA 2YKPA 4EOYA 4ZJQA 2XEWA 2LXFA 4O3RA 1IKVA 5E6JA 1H98A 4K0KF 1AFIA 1HQ2A 3GR1A 4J7CA 4DCJB 1V5OA 4FVCA 1A7GE 2P6TA 2YQ1A 1OQYA 1ZGUB 2BF8B 4UUXA 1UEUA 2ZWPA 2HJ1A 4LQ3A 4DSLA 2DGTA 5JHAA 3IMQJ 4QR0A 2B9WA 2AQ4A 1DZ5A 3IWNC 2BKNA 4QCLA 3CUNA 4I69A 4MDKE 3THPA 1N5YB 4LJMA 2DCUB 4KGZB 2MY8A 1BQNA 3M6XA 2Y3YA 2OD4A 4BKTA 3DMJA 3NHEB 2JWZA 3KK2B 4W92B 2EPIA 2Y1RI 1U1OA 1KJTA 2IRXA 3JAMY 2QEXS 1N62A 3CJ8A 3DGPB 2KXFA 3FSXA 1EM7A 2N7CA 5H9EJ 3P42A 3THVA 2F8EX 4U7UD 1TV6B 5HO4A 4C8YA 1OY9A 5KT5A 5KFHA 4DPWA 1TUWA 2WOMA 1D5XC 1N34F 4ECRA 4ECWA 2MA9B 3O65B 1XXGA 4A90A 5L38A 2Z8QA 2LUMA 4ARCA 4HHJA 1RTIB 1RHMB 2OEKA 2Y1IA 2GFFA 1CC8A 4ES1A 2C60A 1RK8A 3FZBA 3H2VE 4AL5A 2CWXA 3QHTA 4REZA 1UVNA 3UN2A 3LGMA 3OBIA 2HHWA 4DR6J 4B08A 2KFYA 3CIZA 1J19A 2B51A 1PJ5A 4WU3A 4ANEA 4U7UK 2GQQA 1VK8A 2CU3A 2R3VA 1JKHB 2ZH4A 3PYGA 3R1LA 3HHLD 5DQHA 4ECUA 4P2MA 2ZVNA 2JQRB 4AYBD 2QHOA 3DCGA 3KYLA 1NK6A 2CKWA 2V8GA 3NZSA 3HKWA 1TMMA 3V61A 3ZQ4A 1FD8A 2AZ1A 4M5KA 1R0CB 2VASA 3CJ5A 3NVVA 2FY8A 1NBFC 4FBJB 5LLIA 2GB1A 1EUVB 4FNIA 2N7DA 3K2YA 4ID5B 3K0JA 1XNRF 1WJUA 3RB0A 2KTRA 2ZNYA 2Y1JA 3ZLZA 2B3TB 5F9LA 4Z37A 2YKNB 2EBGA 1JLCA 5KG0A 2GBMA 3KK1A 1XCQL 3T1YJ 1YQBA 5ADZA 1EB0A 2ZW0A 1XD3B 4F02A 3J7YI 1RE1B 1WC3A 1V1OA 2W2OP 5EE1A 4M5NA 2AJQA 4EFOA 4F4WA 5THWA 4ITKA 1KTKA 3BJYA 1K9MT 3IBEA 2MHEA 4A6QA 2D3AA 5J2PB 3BK1A 3MPUB 5KT6A 2VBYA 4CDIA 3ML8A 3DU6A 4DJBA 3NNAA 4LFBF 2YWWA 2BDPA 5IV3A 4IDIA 3H2UB 4HT7A 2RIJA 1SB3C 3Q14C 4X4PA 3KHRA 4FA6A 1PSDA 1CULA 1JX4A 2CJOA 3OUYA 2KXHA 4GMKA 3RB6A 3AD9C 4LFAF 2LVQA 1T3OA 3AOBA 2WHIA 3HHLC 2ZH1A 3E2EA 2DGXA 3Q8PB 1NH8A 1J27A 3MHYA 1Y56A 1R0BG 2L32A 1MMNA 2GBJA 5FKAC 4NA3A 5KFAA 2XZDB 4L6V3 4OX7A 2NPIA 2MQNA 2HFNA 3J7YU 1D3WA 4Q2MA 1F2RI 1HNIB 4OJ1A 4G3XB 2NLWA 4DLGA 1ZDVA 4J9MA 1XF5L 1LW2B 5HN0A 2DNZA 4C7YA 2V4RA 3M8PB 2V34A 5DLFA 4ELVA 5L8RC 2N3LA 1ET6A 4DX7A 4DWIA 3DI6B 1Q10A 4U9RA 2H3EB 2Q6CA 2XQCA