2KN4A

The structure of the rrm domain of sc35
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and selectivity of the SR protein SRSF2 RRM domain with RNA
pubmed doi rcsb
source organism Streptococcus sp. group g, homo sapiens
molecule tags Rna binding protein
molecule keywords Immunoglobulin G-binding protein G, Splicing factor; arginin
total genus 31
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kn4A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kn4A02
3UCGA 2PTLA 2CPDA 2KH9A 2LXIA 1DHMA 2DNMA 1OWXA 2U2FA 3UD3P 3MUVP 1UWXA 2KXFA 2X1BA 3S6EA 2DNKA 1DBDA 1VBZA 3CD6S 1FJEB 1NO8A 5D78A 1U1LA 1K52A 3G8SA 5CXTA 5IM0A 2DNPA 2MKKA 2JU6X 3MI7X 2ZJQQ 1GB1A 3MURP 2IGHA 1K8AT 1HA1A 2CQDA 4GLSC 2JZPA 2K8GA 3CCQS 2YTCA 1KQSR 1WHXA 1N52B 1UAWA 2E44A 1VQ6S 2MYFA 2DNRA 2ZJPQ 1X4DA 1SJQA 3VAFA 1WF1A 2NMQA 4YB1P 1ZH5A 2SXLA 2JVOA 2MJUA 1SJ3P 2JWUA 2KRRA 1X5SA 2ADCA 2VONA 2XS5A 2LECA 4RU2A 1WHWA 2CQIA 2M4MA 2PW9A 1WF2A 2DNNA 1HD1A 2N9LA 4UY8T 3ZZYA 2MZRA 1WG1A 1FD6A 5H1SV 2CQ1A 3TYTA 1VQPS 1WI6A 1U1NA 1X4HA 1FO1A 2IGGA 2UP1A 5IM0B 1X4FA 1U1MA 2DIUA 2DHAA 2EK1A 2LMIA 1HZ6A 3VAMA 2L41A 2DH8A 1H6KX 2G4BA 5JVHQ 2MQQA 1K9MT 4J5OA 1YJ9S 3FEXB 2XS2A 2ADBA 1OPIA 1IBXB 2RUGA 2CQ3A 2N7JA 4WFNQ 2LEBA 2N82B 3G9CA 1H2UX 3DLLQ 1WEZA 3VF0B 1Q10A 2EELA 1PGZA 1X5PA 2M8DB 5HG2A 2DGVA 1F9FA 1HZ5A 1X4AA 2CPJA 3H2UB 2MZQA 3J7YU 2CQBA 2RU3A 2DGSA 1A9NB 5DDOC 2JVRA 4WFAQ 1URNA 1HD0A 1JJ2R 2PE8A 1P7FA 2CPIA 1GB4A 3FILA 2RMMA 4WH4A 2L08A 1KOOA 2ERRA 2LKZA 1NU4A 1U1OA 2LXUA 3S7RA 2OTLS 4Z2XA 1YIJS 5DDQC 1H2TZ 2XNRA 3IWNC 5LSOA 2CQGA 3TP2A 2D9PA 1VQKS 5LXRA 1JJHA 3BEGB 1VQ9S 4QU7A 2DHXA 3P49B 2DGOA 3CCUS 2HGLA 2DISA 2A3JA 1U6BA 2GB1A 3SDEA 3P6YC 1K50A 2J52A 3CPWR 3V4MA 2AYGA 2FHOB 2AYBA 5EN1A 2HVZA 1UW4A 1YHQS 1X4EA 4KGTA 2DGTA 4F26A 3RW6A 1YI2S 2FPHX 4KGRA 2MY8A 1FCCC 2DHGA 5IQQA 4CH0S 5HI1A 1XF5L 2QA4S 2JX2A 1L3KA 1WHVA 2M52A 5DM7Q 1F2RI 2I38A 1S79A 5CYJA 3UCUP 1X0FA 1D9AA 2XSFA 3HHNB 1DZ5A 4IOAQ 3R27A 4U67Q 2E5GA 2DHSA 5HO4A 2M88A 1M5PC 3OW2R 1M1KT 3B4DA 1X5OA 3G71S 3VAIA 2OJ3A 2NZ4A 3J7ZT 5JXVA 1VC0A 4WKRA 3MP9A 2KU7A 1YTYA 1IQTA 2M70A 2I2YA 2F3JA 2MPUA 2GO9A 2JRSA 1SJFA 4FXVA 2RNEA 4TU9A 2DNOA 1M5VC 1WG5A 3NNAA 1U1PA 2DNZA 4Y0FA 5BMHA 2MSSA 2HGMA 3U1LA 2MQOA 3CCLS 1YWXA 4QPTA 2OEDA 1C9FA 1YJNS 2BZ2A 2DGXA 2E5HA 2KYXA 1XN9A 2JWNA 3CUNA 3I55S 4EGLA 3CMAS 5CA5A 2VOPA 3S8SA 4OZAA 2MQMA 4C0OC 2LCWA 2DGUA 3NMRA 1MVKA 5LJ5Y 3MUMP 2E5IA 5JVGQ 5BMGA 4CQ1A 3MXHP 2GI9A 2J53A 3US5A 1K73T 3G6ES 3EX7B 2KT5A 4D2KA 2M2BA 3L3CA 5BJRA 2CPYA 1PGXA 5HL7Q 1QVFR 3BS9A 1D4BA 4TU7A 3P3DA 2F9DA 1FHTA 2LHEA 5GMKa 2AYEA 2NLWA 1M5OC 2K3KA 2FC8A 1VQNS 2MKSA 3GB1A 3CF5Q 2MJNA 2D3OR 2RT3A 2EVZA 2CQ4A 5D77A 2RRAA 1VQ5S 2KM8B 2KM8C 3S01A 2AYMA 1UFWA 3CC4S 3NNCA 1PGAA 2DITA 3LPYA 4WF9Q 1WEYA 3H2VE 4QQBA 4ERDA 1FJCA 1VBXA 1O0PA 2HGNA 1MPEA 1H2VZ 2RS2A 1NJIT 1R8HA 2CPXA 4F02A 3THPA 3ZZZA 3I56S 1DRZA 1WWHA 2EK6A 1ZZFA 4KGSA 1WHYA 2RVJA 3UI3A 5ITHA 4OZBA 3UD4P 2JSVX 1M5KC 2ON8A 1WEXA 5BMIA 2KWDA 2KDMA 2G1DA 4OZ0A 3CULA 4OZ1A 2OTJS 1YNTE 2MMYA 1X4GA 3VAGA 3CCVS 3R1LA 4W92B 2CPHA 2M7SA 1BY9A 3LQVA 4CH1A 1VQ4S 3K0JA 2KXHA 2DK2A 3NNHA 1QM9A 2KRBA 2CJKA 2V94A 1VQ7S 4WCEQ 3CCJS 4LIRA 2KN4A 4IKGA 2N7CA 1IGCA 3UE2A 4FXWA 4IOIE 2D9OA 3MUTP 2N3LA 3G8TA 1VQOS 3UWTA 2OIHA 2J0SD 2M8HA 2E5JA 2OSQA 2X1AA 1JMLA 3PIOQ 2G0CA 3ULHA 1X4CA 2MKJA 1YJWS 2LQ5A 1RKJA 1SJRA 4A8XA 2KQ4X 3IRWP 1G2EA 2DNGA 1K51A 4IUFA 1XCQL 2HYIB 1U6FA 1QKZA 2DNQA 2CQHA 4HJGE 2LGIA 3P5TL 2YH1A 2MZTA 1AUDA 2KHCA 1VQLS 1FXLA 1P27B 2CPEA 4CIOA 2J8AA 1N88A 4WIIA 2RQ4A 5DM6Q 3FEYB 3CTRA 3Q2TC 3NS6A 5HHDG 2KI2A 1YITS 1FCLA 2KXNB 1OIAA 2M0GB 3CC2S 1B7FA 2YWKA 2MB0B 4IOCQ 2DH7A 1ZXHA 2YH0A 1CVJA 2QMTA 2VOOA 2Q79A 3MDFA 3VAJA 2RS8A 5GAGU 4C4WA 1FT8A 1KH0A 4UQTA 1SXLA 2N3OA 2MHNA 2AD9A 2K0PA 4YOEA 1XCTL 4F25A 3VALA 1Q7YT 3CXCR 4PRFA 2WBRA 4MACA 1WF0A 2CQ2A 3THTA 1OO0B 1WELA 4WFBQ 2KG0A 2FY1A 2LA6A 4M5DB 4C7QA 2MQPA 1PGBA 5IFMA 2MQNA 3CCES 4HKZE 1X5TA 2MZJA 4YUDA 4ED5A 1MHXA 3DXBA 1EM7A 5DDPC 3MOJB 2JXTA 5GADU 5GAHU 3V3XA 1KC8T 1JJ4A 1U1KA 2PEHA 1VC5A 1Q81T 3CCMS 5LSLA 2DIVA 2XNQA 2DO0A 3NS5A 1M90T 1JMTA 2XB2D 3U1MA 2QEXS 5DDRC 1WTBA 4QU6A 1IBXA 1WG4A 4Y00A 2KG1A 2ZW1A 3FILB 2MKCA 2RPVA 2MSTA 4LMZA 4TLQA 2F9JA 1QVGR 5DETA 2BOPA 2GHPA 3CCSS 4TU8A 4PR6A 3SMZA 4PKDB 2XS7A 1HEZE 2DB1A 1N8RT 2MZ1A 5FJ4A 2J0QD 2O3DA 3CMES 3UCZP 1U1QA 2QFJA 2RQCA 1R8PA 2HZCA 1RK8A 3Q2SC 2YKAA 1Q82T 3SXLA 1Q86T 1FJ7A 1F2RC 4W90B 2MGZA 2ZW0A 3TO8A 1VC6A 2IGDA 2OSRA 2U1AA 2MY7A 3VAHA 1SJ4P 1D8ZA 2DGWA 4BS2A 1ZZNA 1A7GE 3D2WA 1K53A 3EGZA 3CCRS 2L9WA 4V19X 3CC7S 2LA4A 2CQPA 5LJ3Y 5HFYA 4OZCA 2DNHA 1KOHA 3G96A 1VBYA 1S72S 2LYVA 3SDEB 1UP1A 2MKIA 3VAKA 2DNLA 2VODA 5GVQA 2DH9A 1P1TA 3EGNA 3JB9k 1MHHE 3PIPQ 3MD3A 2DNYA 3MD1A 2KACA 3N9UC 2DO4A 3BO3A 3RW7A 2PLPA 4P6QA 2FC9A 1YMHE 2KVIA 4IO9Q 2J76E 2QSDA 1WI8A 2RRBA 3G4SS 2LUMA 2LEAA 1IGDA 2B0GA 3BO2A 1U2FA 2MXYA 2MGZB 2CQCA 1PO6A 1MI0A 1N54B 1X4BA 5GAEU 1P7EA 2CPZA 4ZKAA 1VQMS 2MQLA 2CPFA 2MKHA 1HL6A 2N9KA 2LHDA 2KFYA 2DGQA 2M9KA 2X1FA 4LJMA 5LXYA 5MLCV 3HI9A 2X1GA 2MZSA 1VQ8S 1KD1T 2ONQA 1W2BR 1FNXH 2ZJRQ 1U1RA 3R1HA 3BO4A 3B4MA 2CQ0A
chains in the Genus database with same CATH superfamily
3ZYYX 1OWXA 2OEKA 5I42B 4UY85 4PS8A 2X1BA 1ZGUB 1DBDA 5K20B 1VBZA 1WNEA 2J42A 4MIWA 5BO4B 1GB1A 4IM3A 3CCQS 3MR6A 4I2QB 5KFZA 5D4OA 1RI7A 1UAWA 1BWEA 2UUBJ 2YKOA 4CO2A 2WX1A 5C2GA 3G87A 1N62A 1Q4RA 2HNYA 1E6YB 3V60A 2H5JB 4O4GB 2OI2A 2HTME 2ZD1A 2HWHA 3E01B 4RU2A 1FX2A 3FZ2A 2UXCJ 4B0MA 3VR1A 5KG0A 3LALA 1XIQA 2DR9A 2O2VA 2ZFHA 4KRWA 5DZ6A 1TY2A 3LUYA 1ZOYB 3AODA 3LGMA 1KLVA 2WGSA 3ETRA 2V9HA 4IQXA 4OX9F 3TX8A 4RH6A 3GLJA 2AEMA 4YL8A 2G4BA 3EXCX 2L9DA 1R43A 2RU9A 3DGVA 3JXOA 3Q3JA 3VV2B 5JH5C 1C4CA 4B3SF 4KSLC 1PGZA 1P9DU 1OY9A 4MEMA 3BQ0A 4FVCA 3W1YC 1SL0A 1RAFB 2OP5A 4R0EA 2KX0A 3D1OA 2Z2YB 1RA7A 2PE8A 5DLGA 4URQU 4NCGA 5J2PB 3OVSA 1S6QA 1V9OA 3CJ4A 1N36F 1FM0D 3C15A 4WWPA 1WMHB 1YQ4B 1GG3A 1FESA 3BSCA 3OVAA 3BH6B 4OX7A 2A3JA 3KDOA 4RW9B 2GJFA 3CDBA 3P4RB 4LVOP 1B7YB 2AYBA 2DGTA 1X1MA 5HLFB 3MPYA 2V0GA 1H73A 5B0AA 1BXTA 3DBRB 2YKPA 3NZSA 2B43A 3IG1A 3BV8A 4N59A 3UCUP 3UO0A 5GXGB 2HAIA 3TRGA 2IC3B 4DSKA 1XWLA 1EETA 2E5GA 3THVA 2QMUB 3IBWA 3OR1A 3NWRA 1G1XA 2M70A 3QATA 3ENAA 2VFVA 3AD9C 3PR4A 2BRKA 4TU9A 3PKMA 5IOLA 2E7XA 4Y6IA 1S9EA 1CJKB 1V3RA 1E9MA 4O1NA 1VR9A 2BWES 1XQQA 1S1WA 4ZVRB 3P4SB 2KAJA 3CUNA 1L0VB 2L76A 5ETVA 4EYIB 1D09B 5DPWA 4UOFA 1Q1KA 2L83A 1HNVA 3P4QB 2KT5A 1M94A 1RCOB 1IUEA 5BJRA 3OVBA 1U45A 1AARA 3P3DA 4YQWA 2PVOD 3CJKA 4BKGA 3KLGB 5GMKa 4PG6A 3VR9B 3ZNHB 1SGHA 4NZ6A 4NI2A 3JSMB 3QARA 2FGOA 4M95A 4ZP8A 1ZTWA 4FA6A 5A8KA 1O0PA 4KJIA 5KG6A 1WDDA 1NJIT 1S1TA 4U96A 3RNFC 4F02A 3I56S 2JPHA 2V34A 1ZZFA 2EG2A 3NGRA 4FYVB 4DR2J 1WOSA 4ZPBA 4HCPB 3DN9A 3GJRB 2TSSA 5EHHA 4CWBA 1PFDA 1HBUB 3NNHA 2HHXA 2CJ9A 1WJ6A 3BQ1A 2A5UA 4EWTA 2E5JA 3RZAA 4Y3CA 2GVZA 2E7WA 2QFIA 4OJ1A 2IA6A 1T95A 4C8OA 4JI0J 4PPDA 1KHVA 4RUHA 1K51A 2QL9B 2DXFA 1NAQA 4J9PA 2KK8A 3MEEA 4B9SA 2KHCA 1FDBA 2C1EB 4JI3J 5J2NA 2CPEA 1KHWA 4RNFA 4CLWA 4IO1A 2GQCA 1FXDA 3K9OB 1RWVB 4C8KA 4C4VA 2DZKA 2BRLA 1AA1B 4IRKA 2PGCA 4EYHB 1BUXA 2RS8A 1RT3B 2FJXA 1IJFB 2R7UA 4OYPA 1RTZA 5KG4A 2HZAA 3T8MA 2BKPA 2FY1A 4M5DB 1RWNB 2XEXA 2PO4A 4KY3A 1JXVA 5TR5A 1HXYD 4ELUA 4OZ2A 4AQYJ 1NK5A 3A1QB 1U1KA 4LF6F 3ALBA 3HM6X 1S9EB 4CLTA 1BMQB 2GMIC 5J2QB 2CHWA 2F63A 4USAA 2WHIA 2AYOB 2NS5A 2OO4A 1FNOA 4ZDVA 2ASJA 1N34J 3QYYA 3EFCA 3KTQA 1ZM2A 3UCZP 1U1QA 4QR2A 1HW9A 3AOAA 4WE1B 2IMOA 1IBLF 3PEJA 3PV1A 2HPUA 2RDIA 4KHPJ 4DV1F 3T6BA 1T9UA 1J0GA 2XCAA 1HYSB 5HFYA 4H4MB 3SDEB 1FRIA 2MKIA 3PM9A 5DQHA 3KNAA 3CSFA 4KIKA 5ETKA 1RLCL 1EUVB 2ZEQA 2LEAA 3Q23A 1E5WA 4B9UA 3BDEA 4PYAA 2I1JA 5AXLA 1B3TA 4W9HA 3V5RA 3FKBA 3KMQA 2DR6A 2Z8LA 2GHVC 1HQ2A 1IBKJ 2ZBIA 3TEWA 2M1MA 3T9LA 3TBLD 2DNMA 4YY3J 2PSZA 4RX6A 2PJHA 4CHKA 4EEYA 1AW7A 4CO4A 5RUBA 2Y1JA 5D78A 3T5LA 5CXTA 2DNPA 5C23A 3AMZA 2WXPA 2G1EA 4N41A 3MECB 5KT6A 1WHXA 4W9LA 4NRUA 3KK2B 4DL6A 1VQ6S 2ZJPQ 5E3PA 3E01A 1TTNA 4AL6A 4K2XA 2GAGC 2GJIA 2QT7A 2MJUA 4DS5A 3MCMA 4O4GA 1SJ3P 2JWUA 3PPAA 2JEJA 5HQMA 2VQFJ 2V8GA 5D7GA 2FUHB 4P2SA 2DNNA 2R2OA 3TANA 3DHIC 4AQ7A 2XMJA 3MPVA 4K7QA 4MTPA 3QLHB 3OXGA 1FO1A 3E3XA 3ZKJC 1S9GA 2E9ZA 5KFAA 4RW8B 4PYUA 4ZYSA 2F7VA 4F3MA 3I87A 6AT1B 3C6UB 1C1YB 2EG1A 3KLIB 4CO1A 3VCDA 2RHSB 4HHUA 1BQMA 2HBRB 3G9CA 2ZHBA 1RUSA 2WP9B 2YVSA 1S9GB 3ICLA 4TQRA 2M8DB 2PI4A 5HG2A 4IDIA 3R5JB 2KFNA 5MPOA 3OXLA 4M5KA 1ZW7A 2W7OA 4CLLA 1N32J 2DCUB 2LI5A 4NXMJ 3GJQB 3P42A 3LP0A 3R6GB 5KFSA 5AXNA 3UR3C 2E5LJ 3GS2A 1GNKA 1TL1A 3V81B 4ZS6A 3M8YA 4KB7A 2X38A 2BEFA 3JQKA 3ABVB 4W9DA 1JJHA 5SZTA 2QLBB 3IR7B 3TSSA 2XMWA 1LEOA 5HK4A 2HHSA 4KKOB 1HLWA 4URGA 1PAUB 1YHQS 3IVFA 4HH0A 4HT7A 3WBZA 4PQUA 4LNNA 3B0AA 1N34F 1L0YB 1F2RI 3AXKA 1NSQA 1M5PC 3MR5A 1SXTA 2OPQA 1SIJA 3UDVA 2NZ4A 4K5SA 2I2YA 4Q44A 4PXCA 3Q8YA 4DR7J 2WDQB 2QC8A 3QIJA 1C0UA 3DDKA 2KZMA 2G9OA 5C25B 1Z2LA 2MQOA 1JNZB 2ZH5A 5F8GA 2M8SA 4C3MA 2VB6A 2OPPB 3O5TB 5HN0A 3M2VB 2ZNVC 3PYEA 2E5IA 1FDAA 2HLUA 3DRSA 4H4MA 3G6ES 1RT6B 4D2KA 1HW8A 4DL5A 4OVZA 2CPYA 2BM1A 3PG9A 3CJTA 1PYSB 3BS9A 4L72B 5G0RB 3V2UC 2L32A 3JYUA 1R8CA 4IFVB 3H42A 3NOCA 4N8OA 4CO3A 1CJVB 1FI4A 4K4WA 2ZNYA 2EC0A 2EVZA 3IC1A 4R3DA 2PKOA 1UF0A 1HNIA 4YXDB 1PGAA 2PIIA 3D5MA 1R8HA 1ICEB 4YSZB 3AV8A 1WMHA 4I0WA 2DWQA 1G6BA 2QLFB 1RDRA 2CZ9A 3ZJVA 3HFKA 2BV3A 3AU4A 2AV5A 1ZTTA 5F41A 2OTJS 5IA7A 4LSZB 3ZJUA 1L5UA 4LF2A 3AN1A 4LFCF 1HBNB 3PO0A 4BBNF 2KN4A 4DFMA 2D9OA 4RW6A 1GC6A 4PUOA 1YQHA 3PW2A 1RBAA 1WOPA 5K14A 3GV5B 1Z5SB 2GNKA 2XO6A 5H9FK 4TKNA 4R25A 1NSKL 1AUDA 2J0MA 1RBOB 2QGFB 2I0XA 2YWHA 3LH2S 4WJBA 1P27B 2ZOGA 3EECA 1IWAA 1N88A 4F04B 3Q8PB 3P4PB 1W25A 2C5LC 5KT4A 1OIAA 4DX8H 4IOCQ 3W9JA 2JEFA 5LMUJ 1JLCA 3RCZA 2LXAA 2GVZB 3VALA 2MLXA 4NXMF 3I6PA 4MACA 2PT0A 4JI6J 1TTHB 4J7CA 4C7QA 2MQPA 2GW8A 4IUMB 4QW9A 2BS4B 4ED5A 1TKEA 3EVOA 2HDEA 4OYMA 5EX3A 1J5EJ 3W3SA 5J17A 1RHKB 5LSLA 1LM8B 2C42A 2JRHA 1JMTA 4USVA 4QU6A 4RKUC 1RYRA 4EE2A 2CRLA 5HVHA 3MMBA 3G82A 2RF2B 4NLSA 4X4OA 4LK0M 4HL9A 1EX8A 4F0KA 1NKBA 2YX4A 4YTPB 2O6VA 5F8NA 3L09A 5IC4B 4RPFA 2LMCA 1RU2A 1Q86T 2RJZA 3RUBL 2BR0A 5DCNA 5A76A 3EYZA 3MM9A 1E6VA 4TV3A 2ZWPA 4TKTA 1D8ZA 4JQWC 2HMIB 2QILA 3TJPA 4Y2KA 2JWZA 4DHZB 3OFFA 2L9WA 3P96A 1Y3JA 2XZTB 3Q8SB 2FZKB 3GIKA 2C7HA 2Q6BA 3D66A 4P72A 5CYMB 3M6VA 2GA7A 2DH9A 3JB9k 3Q83A 2KX3A 3MD1A 4ETXA 2G9HD 3HLUA 3ZXRA 2KVIA 4UOCA 2V4JB 5KAKA 1VMBA 4II2B 1U2FA 1N54B 1I3OB 4DK5A 2VPXB 2CPFA 1S76D 1DOIA 2W9BA 2FLPA 3QWZB 2DGQA 1TZ1A 2KLCA 2VZ9A 3T3FA 2X1GA 4Y28C 2HVEA 3BPDA 3V05A 2ACYA 2YKMB 2PE9A 3POTB 3Q22A 2VV5A 1KSPA 2KH9A 1EP4A 4RF0A 2VHGA 2U2FA 2JLFA 5KFRA 2VKRA 3IFWB 3MUVP 4YR0A 1MLAA 4DV2J 1QE1A 3S6EA 1IR0A 3CD6S 2XNAC 4BC9A 1K52A 3GIIA 1T0TV 2PEBA 3MURP 2KVQE 2MQJA 1MG8A 1KQSR 1F9EB 4ECWA 4DSLA 3C15B 2KDBA 3PW7A 4FVMA 1EO6A 3FRZA 4RNMA 1OFFA 4NPOA 2YXLA 2BE2B 4LF7F 1T0QC 2KRRA 5HSPA 4NCGB 3NGUA 2ADCA 2VONA 3KHLA 3Q3NC 3DBLB 4OJHA 3TZYA 1AXQA 2DY1A 1JALA 1VZ7A 3ZZYA 1WG1A 1FD6A 1I94J 1ZP0B 3T1AA 2CQ1A 2NTSA 2HFSA 3TZWA 3LTOA 5D3GB 3HX9A 4LNIA 1FDDA 4J5OA 2ADBA 1OPIA 4PG7A 2CQ3A 4E2FB 1VDHA 5D0EA 4NA1A 2UVWA 1UA1A 2B56A 1X4AA 2CPJA 3H2UB 3MPUB 1VHFA 3KDNA 2GJ2A 3DNCA 2DHZA 5CHVC 4M5DA 2BGFA 2IPKD 1URNA 3KYLA 2YEPB 2B8PA 2NXUA 2CPIA 4O0IA 2R7XA 3IGNA 2JRIB 8AT1B 2ZCBA 1H38A 1NU4A 1CSJA 1FNWA 2LQ9A 4WBFA 1J19A 1N5YB 4QU7A 2V3SA 4LNFA 1MW7A 3KQ4A 2QJ3A 3RJMB 1QT9A 5KT7A 3QT6A 5HBMB 1HE8A 1HQEB 2V4RA 1SBBB 4ICLA 3FCVA 4NXNF 2NPTA 4K0KJ 3C6TB 2B9YA 2PDAA 1KLGD 4GOCA 3FDSA 5HI1A 4L23A 4ID8A 1L3KA 2XM3A 4H4KC 4PYZA 1U25A 2HQ3A 4DXLA 3OR2A 1JROA 4NYZA 3CDUA 4B3TJ 3APCA 3BKUA 1HMVB 2G0IA 2KTRB 3WX8A 1LW0B 2QMWA 3BWUD 4F67A 2MX2A 2WDVB 4DFJA 2EC2A 2NUHA 2DVIA 1YJNS 2BZ2A 1E0ZA 1HBMB 2DGXA 3KKFA 4MM3A 1T05A 1MMDA 1TUWA 1CK1A 1WSVA 3K2YA 4QOTA 3RRKA 4K4UA 4MGIE 5KFCA 3KK1B 1F0ZA 1OSCA 4MJKA 2BKOA 3MTKA 4JI7F 1N61A 4I6AA 1P0RA 1ITPA 1QTMA 1Q5VA 3EUB2 5H9EK 2ILYA 3U8ZA 3MC8A 4X4NA 1FJGJ 2AYEA 2K3KA 2FC8A 3ZZPA 2GBRA 3OTEA 3PRBA 2RRAA 1WGGA 4KBIA 4HLBA 3A3OB 1HPZA 2DLBA 4ANDA 4QQBA 3B78A 4WK1A 5ETTA 2H5IB 3JQJA 2MBQA 1CJUA 3A8IA 3N20C 1UPMB 5J1NA 3GIMA 3CB4A 4ZJOA 1QUVA 2IPOB 3IRXB 1KVJA 2V94A 1T94A 4LIRA 2VBXA 4F1SA 2ZITA 1D8YA 1A0OB 1RRBA 1VQOS 3AB4B 2X1AA 4DDID 1GXTA 1YJRA 5AZFA 1SIFA 1NJZA 2G2YA 1O5JA 4W9FA 4C00A 2DKOB 4NCAA 5M2PA 4WIQA 1WX9A 2JYTA 1RWUA 4R8UA 4W9KA 3M9NB 1P9YA 3PX4A 1UPPA 1S7IA 4Y65A 1P1AA 4DXGA 1RJJA 4KE5A 5AE1A 2K1RA 3AE3B 1TMJA 4GVBA 2C2EA 3PSEB 3PLVA 2WRMA 3QC8B 2M0GB 5K8OA 1DTQA 4IFYB 1I4QA 1JXLA 1IJEB 3PZ8A 1VRQC 4DPYA 3BVZA 4LTUA 2R7OA 2X3DA 2VBYA 3WIMA 3FFIA 3ZZUA 2J9DA 3T1HF 1OEYA 4ZVPB 2X8XX 5GAHU 4M00A 4RNNA 2H88B 3KLEB 3CCMS 3A9JA 4C8LA 4JI5F 3M62B 3EA6A 3WCQA 2OJWA 4LVNP 1CQNA 4ZN3A 5D15A 1S1UB 3AD7C 4LMZA 1BUIC 3DLEA 3GZNB 2BOPA 2N1WA 4FNIA 4PKDB 4H4OB 2O3DA 2LRWA 4DPOA 2DPIA 1BLUA 2FHJD 3C19A 1L3UA 1DFDA 1U02A 3TUJC 2VD3A 4LFCJ 4BS2A 3OV7A 4NA2A 4LSNB 1I4HA 3DOMB 4GGQA 1WOOA 2LD9A 2YLMA 1SH0A 1S72S 2LYVA 2FBWB 3PY8A 2BT6A 3TVZA 1VLBA 1QUPA 3BO3A 4UT4A 1HARA 3DDNA 2VH7A 2KXJA 3W60A 4ZOHC 3BM7A 4P74A 3I57A 4DUYF 2W7AA 2IYGA 3DMJB 3BO2A 1YX2A 1FIQA 5GAEU 2ALZA 2ACZB 3OT9A 4A8QA 3GFZA 3NP5A 1Y11A 2DHHA 4KHRA 3W5YA 1RACB 3GPAA 2KFYA 3QFWA 3E9SA 2F4VF 2YWGA 2YVCA 2H5EA 2FJDB 2LDIA 3AHPA 2ACMA 4DV6J 1VGYA 2B3AA 1UZHA 4US9A 4KFBA 1YRXA 4EI2A 3EDRB 2KXFA 3VRAB 1UCNA 3JQMA 4MYTA 1E10A 1V86A 2HG4A 2DBYA 2XY5A 3KK3A 1NJWA 3MI7X 2XLJA 1TKZA 1SUQA 1S0OA 1FPYA 2NMQA 2B51A 3SSRA 5CQGA 3N1XC 4C8NA 1AFJA 2KQSA 1EARA 2VFSA 1RT2B 1KLNA 3Q8VA 4FULA 3MMCB 5HANA 1R31A 1FFUA 3OJUA 4CNZA 1RTIA 1EKSA 1L4DB 3VAMA 2DH8A 4ICUA 4ZVHA 1S59A 1VK8A 1FKOB 2AZ3A 2A1BA 3RBZA 4OI0A 1UZXB 3GOEA 1ISNA 4U9RA 2N7JA 3AEGB 2LEBA 2VZKD 3DLLQ 1JWBD 2R2UA 3M8ZA 4HRSA 5KFHA 4QCLA 5JZEB 1WC3A 3L4PA 1TZ0A 4HH1A 1X8DA 2J7KA 4KHPF 2UU9J 4HACA 4IH6A 2IBKA 3FILA 4XAKA 2IRYA 4BVUC 4KDLB 4WJOA 3S7RA 1CG2A 1NCLA 3SSSA 1EZZB 1K1SA 1WI0A 1FFWB 3ZRCA 2UUCJ 4P16A 3MR2A 4AFFA 1U6BA 3MEGA 2DJWA 1VRTB 2ZE2A 4LSLA 2XTJP 1ZXIA 1L2NA 4RLEA 4FXDA 4F4WA 1PKUA 2Q3PA 1DTTA 2ZZTA 2QYCA 3UR0A 1U6ZA 2HNZB 2K39A 3RAMA 3WA0A 3DLHA 2OFGX 2XSFA 3HHNB 1MG4A 5K9FA 1UD7A 3TUPA 5BR8J 4C7YA 3VAIA 4WZQA 3TJAA 4A47A 2G4DB 4F3OA 2N9XA 4FYXB 3QIPB 2AKWB 2Y3AA 4NAWA 2DNOA 4TSSA 1FNUA 2HNDB 1U1PA 5BMHA 3WAPA 2N7DA 4PZVA 3CCLS 2R8HA 2JVCA 1H7WA 3CMAS 2UZAA 4RGMA 4LFAJ 3A8EA 2QEJC 1D5ZC 4ZP6A 1LKZA 2NXCA 1MFWA 2IA0A 5GMEA 4JI4F 7FDRA 1SQGA 2D3UA 1RAHB 1J2VA 1ET9A 4HHHA 2WXQA 4DCPB 5FDLB 1RQ0A 1VFJA 5DG7A 2KM8B 4GC6A 3SEOA 3LPYA 3QRPA 3EM1A 2YKQA 1FJCA 3I4HX 4IR1A 2RS2A 1MPEA 3M8QB 3MEDA 3ETOA 2R7QA 2FVCA 2HFVA 2P9EA 5AXKA 4ZYNA 3AECB 4KGXB 2K2PA 3EE3A 3Q8AA 2BJ9A 1VQ4S 4TY9A 4CM0A 1EU4A 1LW0A 5AEKB 3TL5A 1YBTA 3SCJE 4ZVOB 5EE0A 3L9ZA 4HLEA 4DR2F 2JZZA 3DGPA 1RT7A 2N7YA 1U2RA 1MMLA 2MKJA 2W7PA 1SSNA 4XE0A 1KVIA 3BJYA 1RAAB 3B6BA 5FD1A 3PREA 2KQ7A 3JS9A 1SB6A 1QOBA 3IXQA 4M02A 2DENB 3RBDA 3KUEA 4ICLB 4CT8A 3OHBA 3RZWC 2FGCA 2I8EA 2ZBPA 4DCOB 4CIOA 3LWMA 1GAQB 1HNWJ 1D6EC 2FIUA 3A3PB 4DLEA 1FCLA 5L39A 3N28A 3HJFA 3AE9B 5DRKA 1PDXA 1TL5A 1YDLA 3SFUA 1DURA 1ELOA 2NZCA 1WGKA 4BAXA 3CXCR 2XZDB 4I4BA 1PGBA 1Q5WB 2JC0A 1CJEA 3Q69A 3NCRA 3RI7C 4JYAJ 1RHRB 2IYIA 2BYTA 2K6DB 1TKYA 4F3QA 4F7ZA 3M2RA 4JV0A 4ZVSB 3D1HA 1JKHA 3UD5A 1E8ZA 5DDRC 2BX6A 2ABYA 4HWIB 1WGYA 4ZPTR 4M1KA 2LQJA 5DETA 3EPGA 4DF4A 1RHMB 2CYYA 2QZ8A 4WU3A 3TEHB 2XS7A 2LFIA 2GO8A 2R2SA 5FJ4A 3P4UB 4DR6F 4LF9J 1ZYQA 1VBKA 1XNQF 1R8PA 3D6MB 1REVB 4ZHRB 3JAMU 1W26A 3MJ5A 1VQSA 2R7SA 2OKQA 4W90B 2INPE 5D0RA 1S77D 3VAHA 1XERA 2G13A 5AUKA 4UTGA 3MEDB 4YTNB 1X0PA 2LA4A 3BGLA 2DNHA 4JV5J 5HVGA 3O13A 1LW2B 1SKSA 3MD3A 5CYQA 1B0PA 1TY0A 4N8NA 1NDPA 3BGRA 4QWEA 4P6QA 3PRMB 1FFVA 2OD6A 3GG1A 3VGSA 2EKEC 3MCSA 5KFEA 1LWEA 1YLXA 4I64A 1IBMF 2KANA 1FKPB 1MU2A 3K58A 3PR5B 2M9KA 1JWSD 3HHLD 3QA8A 2ZVSA 2V4QA 4TYBA 4ED1A 1OMSA 1KD1T 1Z2MA 2KC1A 1U1RA 2N4CA 3R1HA 4A3PA 2CNKB 2B6AA 5KTQA 4WWNA 3TJ9A 4TY8B 2GZOA 3NVZA 1UWXA 2DNKA 2F1FA 1Y9OA 2CAJA 4ZCKA 2L0TA 2MKKA 3ZXWA 4GMVA 2P9CA 1N52B 1VRUB 2J6UA 2IVYA 4ZVGA 4EMDA 2HMIA 4HI2A 3CVKA 1FRXA 1NPRA 5AJ3J 3G6VA 4X66J 1KR4A 2IJRA 4GDLB 4DX7A 2RAQA 3H8YA 4WWOA 3FSIA 5BYSA 3MZIA 1WKJA 3NWGA 1TKGA 2N0SB 2UP1A 5IV4A 3HK2A 1Q78A 4RBTA 4BCAA 1AROP 5JXSA 4YEAA 1YJ9S 2A2CA 3RAXA 5IV3A 2ILZA 2KVRA 2MZQA 1HR0F 4KKIA 3A8KA 3HZEA 4KQZA 1VIXA 2YWEA 2BABA 3I0SA 4USMA 4YB6A 4EUVA 1KOOA 2RKIB 1SE9A 1ACMB 4REZA 3I0RB 2V5HG 5LM7E 4MIAA 1GH8A 1SH3A 1TS2A 3CDEA 2QJLA 3OFGA 2LEPA 4M5LA 3AJ1A 4S17A 5E3AA 4QIEA 4DWFA 2HHTA 3IXSA 4OHWA 1SJED 2PIAA 4K1RB 1F52A 1VI7A 5A8WB 3MWBA 4LNKA 3V4IA 1RT2A 1E7PB 2DAFA 4KGTA 4F26A 3DHXA 3OLBA 1RTJA 4OI6A 1NLKL 3GFYA 2KDOA 2AT1B 2ZCCA 3QFHA 1NENB 4IOAQ 1QILA 5G5GA 3J7ZT 1VC0A 3IT6B 3W9HA 3L4BC 1YTYA 3MHSD 3B9JA 1RAEB 5JHAA 2ZH6A 4LLGM 4B9KA 3DLKA 5ETSA 2KDEB 2M19A 1RTDA 4XWWA 4QPXA 4JV5F 3BSAA 2N7EA 3DRRA 4A48A 1BT0A 1PBAA 1ROFA 4FS2A 2AJ0A 5BYQA 4NLOA 3ZW3A 1MVKA 3RUIB 4IG0B 4M0WA 3LB8C 1CEZA 4HR2A 1FTCA 4B9VA 3U52E 3AA9A 1VZ8A 3NY5A 1HQRD 2VPWB 2KT7A 3DI6A 2GHWA 4ANUA 4Q45A 5CCLA 4B3MF 5IT0A 2F5GA 4KGZB 1WC0A 5D8HB 1TUGB 2ICIA 3HM9A 1M5OC 3R7NB 3RB4A 1VHIA 3PTFC 2ZKUA 3CF5Q 1WZ0A 2CQ4A 2IM2A 1X60A 4ZOSA 3NZ3A 1ZPSA 4ZJLA 1H2VZ 3BDPA 2AX5A 4F4ZA 2UUWA 4TMAB 4PEOA 1T9YA 3BF4A 1HI0P 2B6AB 2Z30B 5KFJA 3R7QA 3PACA 4Y2IA 2M7SA 3W2VB 3KNGA 2FQQB 4KTQA 1UNSA 2VKZG 4MGZE 1QM9A 4Y2AA 1D3ZA 2JDJA 4ES2A 4YN3B 2PFDA 1ZPVA 4IOIE 1E8WA 2WBMA 2ZZNA 4I6YA 2JXXA 2F40A 2E9TA 4DL0C 3ZNID 1R0CB 1Z1ZA 1S0MA 3N01A 3CEDA 5AJ3F 3W5VB 3RT3B 2HHWA 2LQ5A 4C3LA 4K7SA 4BFRA 1VR6A 4ES3A 3ZRFA 3BGRB 3DWGC 2LGIA 1UA0A 2CHXA 2YH1A 2M0XA 1VZ6A 3DCAA 2LU1A 5KFBA 1DOXA 4I56A 3DRXA 5A2QU 1RE1B 3F73A 5DM6Q 4DI6A 2ASQA 3FFIB 1WC5A 3H40A 3BQ2A 3D68A 1A5RA 1D0EA 2ZH3A 2BVZA 3UQSA 1YJTA 4CH7A 2C22A 1ZXHA 3GCWP 1DAXA 3VTWA 1Q7YT 4ID5B 4GVBB 2OEMA 2RSUA 2ASLA 1KFDA 4OYBA 1SE4A 4I2QA 4YUDA 1Q8BA 3MOJB 3EC8A 5GADU 3HHKA 3QNWB 2DO0A 4XDDA 3I4PA 1CMXB 2QLWA 4ZRKA 2ZUAA 2MKCA 2RPVA 4PXEA 1FK9B 1WGRA 2F9JA 2R8GA 4C8YA 1RADB 4GDKA 4OVVA 4TU8A 3ZTQA 1FE0A 5L46A 3W62A 4I69A 2KZZA 2XLIA 1RK8A 1C77A 3S1TA 1N56A 2NUUG 3N1ZC 3OWEB 2W01A 1Q5YA 2MGZA 4FBUA 4AJWA 1CULB 1FERA 1APSA 3OUYA 1SJ4P 1NKEA 4DSJA 1G4CA 3CWJA 1TFWA 2SAKA 1C0TB 1PUTA 3I9V1 2CQPA 1Y5NB 1T11A 1T9XA 3VAKA 1FFGB 1AYFA 2R8JA 4A8YA 2R7RA 4NA3A 5L1LA 4ECVA 3HKZD 2A0FB 2O6VD 4NQKE 1WI8A 3H7PB 3G4SS 3IHPC 3QIDA 5KFTA 2IY0B 4HVBA 4MK8A 2Z2LA 3TEYA 3CD7A 9ATCB 5BR8F 2IHR1 3W63A 3O2IA 4CLKA 2Z56B 3BBBA 1SC1B 3DOKB 2E3TA 1N5WA 4IWQA 5A8RB 4J9QA 4W9GA 3GSIA 1YJJA 3PJXA 2ZJRQ 2WX0A 2CQ0A 2PTLA 4DHVA 4FN2A 4HCNB 4FF2A 4JI0F 4WP3A 1HMVA 3UDEA 1NO8A 1UKUA 2R2TA 3A3NB 2XWXA 2B4VA 2K8GA 3CIZA 4L3KA 4N56A 4WKYA 1QAXA 2G4SA 1PYTA 2MYFA 1IN0A 3RTVA 3W5ZA 3B08A 2BQRA 1HNWF 2XBPA 4DR1F 2JVOA 2PEAA 3AJDA 3HT3A 4HDGA 5IKCM 3PZPA 1HQEA 4HYKA 1HA5A 2WXRA 1L0XB 3AOCA 2M4MA 3R5CA 5H1SV 1VQPS 1V3ZA 1ZPWX 5IM0B 4DV4J 1NI3A 2EK1A 2WOMB 2LMIA 1HZ6A 4PCQA 4ZVEA 4LR8A 4MELA 2LVPA 1V80A 5IAAC 3M1VB 4KHMA 1IBCB 2FYXA 4BC7A 4P1BC 2BYEA 3CO0P 1YSJA 3MC0B 1GXUA 4B3RF 4AUQC 3KWMA 4WXWA 4NX9A 2WTFA 1OQYA 3J7YU 2DGSA 3K7RA 3X0WA 5ETPA 2E29A 5CD4H 1PILA 2FB0A 3A9KB 3DLBA 1RT4A 1BQNA 2V67A 2L08A 1I4XA 4W9JA 3GSDA 3TP2A 2BS3B 5H9EJ 3BEGB 1UJ4A 2PMHA 3FSXA 2BVCA 4Z7CA 4MKBA 2NR2A 4OV1A 1GC7A 5D6GA 2GB1A 4FF1A 4NEYA 1T6BX 2VG7A 2LVOA 4ETZA 2QDFA 1R0BG 2BYFA 2R8IA 1TL3B 1IBMJ 3MEEB 3GMGA 3Q14C 2J0JA 1FEEA 1Y56A 4KGMA 2HHQA 1Y8RC 1B1ZA 5IOIA 4IC7B 2FVSA 1SIZA 3KJNB 1SH2A 2BANA 3UNYA 1IM6A 1GNUA 4UZCA 2XMMA 2XMUA 3AFGA 1XD3B 4GIVA 5HQLA 2ZNZA 4US8A 1SC3B 2Y8YA 1BXNA 2MSSA 1V6EA 4Q7AA 3VQIA 5CHCB 4YB5A 2D10A 2MQMA 5EDSA 2ZNVB 1YJIA 4X62F 2GFFA 2C9WB 4DF8A 1VQYA 2GMLA 1WX8A 3D0IE 1XT9B 3KFWX 1HWKA 3CJKB 1ZDVA 2B9EA 2MJNA 2C7MB 4K7WA 4LCDE 1UFWA 2QV6A 3VHQA 1VBXA 2W25A 2CPXA 4WAAA 4NOHA 4U95A 5KFXA 2V2ZA 3VH3B 4D3GA 1CC8A 5KOWA 3UQBA 3OUYB 2FHJA 5ITHA 2FJVA 2JSVX 1FVQA 3M7VA 1S1WB 1SKWA 2BTEA 3ZTSA 4J9SA 2NQPA 2NBVB 1YKWA 1V97A 4B02A 3KUHA 4K4SA 4OIXA 4ANWA 1HTQA 4NYOA 5E0OA 3MF5A 2N7CA 1VCTA 1S5ZA 2WVCA 3OFEA 3BGUA 4CLYA 2XI2A 4X4UA 2JNJA 3KLHA 4FP9A 2HK3A 3WAMA 4OZ5A 1OY6A 2DNGA 4YR3A 2YNHB 4IUFA 1ZUD2 2CQHA 5J18A 3BINA 3SV4A 3P5TL 2LQBA 4ZVFA 4OHZA 3MM6A 4OVUA 1F2HA 2OJRA 4MK7A 4QBUA 2AX1A 4RGTA 4DHJB 1VLYA 3IFEA 1NM2A 4LSNA 3W65A 3SFEB 5KG2A 3GYNA 4IOBA 2YH0A 1EJ7L 3G6XA 4WWSA 2VOOA 3BVGA 2V2QA 3QJPA 2APOA 4UQTA 4I2PB 1ZA1B 4YOEA 3CD0A 3R7RA 2DR5A 2AGOA 3MOZA 4DS4A 3JYTB 3THTA 4YSYB 1QF6A 2PMZD 2RRNA 4FHJA 2CG4A 1NRKA 2OMOA 3Q89A 1DLOB 5DDPC 3RGIA 4C0BA 1QD1A 1VC5A 1WE6A 3GQCA 3AE6B 4P7IA 1A70A 4O3OA 1R3NA 5MAOA 3HHLC 3KLSX 1BQNB 1L4ZB 4FN5A 4WJQA 1YRTA 3EPIA 4LF6J 3CCSS 3PXGa 3TA2A 1UBIA 1SF0A 3PCOB 4DQQA 3EICA 1UBQA 1V5VA 1FKAF 2G2OA 3TCAA 2P2CB 3VXWA 2A2DA 3H25A 1U48A 2EFGA 3PFEA 2L7RA 1WORA 2INCC 2HRUA 1F2RC 3APDA 3M6XA 3DVGY 1DYQA 4ZRIA 2U1AA 3QGIA 5F0UA 4TQ0A 2GVDB 4J9RA 1XMOF 1I7HA 2KD0A 3HMJG 2D7SA 2E1MC 5F8LA 2H1YA 3LP2A 1HNIB 4NL5A 4FZVA 2ZVNA 5EWFA 2DYOA 3M4XA 3IAM9 3V6JA 4BKSA 4R8UB 4J9KA 4ZVUB 1IWGA 2CJNA 1X4BA 4IW0A 2WXOA 1GK8A 2EFOA 2XY6A 3DU5A 2MQLA 2MKHA 3ZZOA 2V3NA 2CKWA 4NMLA 4ZCLA 1IQZA 1MROB 2MJDA 2ONQA 3VWSA 2FDNA 2YNIB 3VUYA 4B6WA 3R8YA 3V6HA 2C3YA 2CPDA 4DV0J 1FXTB 5D0HA 2NCKL 5DGAA 4CO7A 2N4FA 4J90A 3R5DA 1XC9A 2HW3A 1VRAB 4ZLNA 4R5PB 2JU6X 2N1VA 2EXUA 3C14A 3BYTB 4Z37A 1SCJB 4GLSC 1T03B 2E44A 2RSQA 2D41A 2VUGA 2M4NA 5C24B 1EQMA 2QSWA 3L54A 1C4AA 3EXYA 3ZTOA 4DUZJ 4KKOA 2XQCA 1M0SA 2OPSB 4UY8T 2RILA 3ZFVA 1N6QB 2IRUA 1TS3A 1RISA 1SIWB 4MKVA 1F1HA 1RBLA 1X4FA 1WXVA 3RB0A 1C0TA 3J80Y 1YZ6A 3QT8A 2HVHA 3EJMA 3DHGC 3Q0AA 4XWTA 4WFNQ 4ED4A 4ZPVR 4RNHA 3ITHA 4JI7J 3NCQA 2IJNA 1KFYB 3M30A 3LXFA 3DBHI 2MQ8A 2FZCB 1TKTA 3VGTA 1V5TA 1XEEA 2KDIA 4NLXA 1WH3A 3M6WA 1RAJA 3IWNC 3B54A 4RW8A 3RN9C 3KXDA 2VG7B 2B5JB 3SQOP 3CDWA 4ZRQA 2P9GA 1TKXB 2J52A 3M8PB 1UMJA 5I3PA 1WRDB 1FA0A 1UW4A 4I1TA 3MGJA 2D5GA 2FPHX 2YWWA 1KF6B 1O6XA 2CDQA 5IQQA 2UV8G 4JI8F 3J80U 3R2TA 3TI0A 3DLGB 1WHVA 5ETOA 5CYJA 2V1YA 4OYIA 1X0FA 1VJWA 3ISZA 2LGXA 1FRKA 3R27A 3AQPA 3MTNB 2YKNB 3B4DA 2PA3A 3R3TA 2E7VA 3MP9A 1N6ZA 4WFXA 2K7KA 4IRCA 3AH6A 2RNEA 4B3SJ 4ILLA 4Q0BB 1J7CA 3KG1A 3H20A 2QRRA 1T3NA 5TSSA 2AQ1B 4XDCA 3W2DA 3NY0A 2C2ZB 1JNRB 4AQYF 2HQIA 1RCXB 4DSIA 3F0NA 3AT1B 1WM3A 4OZAA 4TUUA 4F50A 1KTVA 2RDJA 4OHJA 1Q0NA 2KFKA 3DPDA 1AZSB 5JVGQ 3MXHP 2N9PC 4WPAA 4X4SA 1OSDA 5CTRC 1LWEB 1GOZA 3PHTA 1HI1A 3AB2B 1SVDA 4TU7A 1ZM9A 5T7LA 3LGHA 4ZPAA 4LFBF 1SV5A 3UGBB 2PC6A 3OHAA 2C3UA 2FUG9 1VQNS 2KJVA 5CYQB 4CYEA 3MR3A 3NNCA 2BYVE 3HFVA 3TZXA 2HGNA 4JI5J 1C79A 1BD6A 4J9LA 1EWCA 3THPA 1I94F 1SL2A 2DYBA 1DRZA 2EK6A 1I51B 1TU0B 4MAKA 3U4EG 4ZPDA 3POTA 2G1DA 5HKHA 1YNTE 2BA9A 2MMYA 2YKMA 3R1LA 3DI6B 3QT5A 4E98A 4JWSC 2GS8A 4UOHA 1LXDA 1IGCA 3AE1B 3DOKA 1N5SA 1S6UA 4LF7J 1YRUA 2QLJB 4AYBD 1QSSA 4W9IA 4GKKJ 4MDKE 1O8BA 1XR6A 3FBCA 3J7A1 2G0CA 3D0HE 4ECUA 1B70B 1G2EA 3CMQA 3DM2A 4K5RA 3WZ0A 1FMAD 2L52A 1N5XA 3NS8A 1R4NI 1WGDA 4HJGE 4RWWA 3PYFA 4UUXA 2P6TA 4MKAA 4XYCA 4P75A 4FKXA 4YDDB 1E6EB 4W9EA 2EFQA 4CLUA 1RU1A 1VQLS 1RLDA 1TKDA 4WIIA 1U0HA 4P2FA 4K7UA 3HIZA 2OAUA 3VDZA 1IYFA 3CNQP 4HVZA 2XGQA 1B7FA 4QWBA 2YWKA 3RMKC 2BJ3A 2XSJB 1E6VB 2ROPA 1WJ4A 3RNBC 4UZBA 3H98A 2IY5B 2R8KA 3CCWA 3EZOA 4KIAA 1WF0A 2CQ2A 2YX7A 4G3XB 2VF3A 4RU9A 1FJGF 3EZUA 4NZ0A 4LNOA 2XG8A 1JJ4A 2OUGA 3U27A 2Q1LA 1X31C 4P10A 1XMQJ 1JLQB 5GMVA 4Y00A 3N6NA 5A6WA 1AB8A 5D4LA 2K6QA 4DV6F 2UUBF 5ADZA 1WZ3A 1EKRA 4BKSD 2DRDA 2V8DA 3NGDA 2H51B 2ALYB 1IKWB 2HQFA 3QPIA 3V6EB 2D3ZA 4OW0A 2HZCA 4LDTB 2ZH2A 3APFA 4LRFA 1U2CA 2AJQA 1S57A 1N32F 1VC6A 2RHQB 5J1EB 3C2PA 1V81A 3PX0A 1ZZNA 3D2WA 4HXDA 2K8BA 4V19X 3F56A 2JJ4D 4M5MA 4PG5A 3LGNA 4A8KA 4ECYA 3E56A 3N6MA 1E90A 2R3VA 3LW5C 4PQAA 3WHIA 3HVTA 1YMHE 2DNFA 2QSDA 2NXEA 2WXKA 2ZBQA 1CS4B 2B0GA 2ZH9A 4NAMA 4KSEB 3U02A 2QC3A 2JT4B 1XXGA 4YHHF 1VQMS 4ZKAA 3MHYA 3MM7B 1FNMA 4WXOA 2G1HA 1FFSB 1QLNA 5DLFA 3HRDD 2F8HA 2GIRA 3OSPA 1SQFA 4HI1A 5F8JA 4ECRA 2OOBB 5DGBA 4ZP9A 5IT9Y 1M1HA 4ZLPA 2RQMA 4C98A 3TJ8A 2IJ0A 4NWBA 3G6YA 4AT1B 1WF9A 1WFYA 1JLGA 3IAS9 4BWMA 2IGHA 1WUUA 2KFZA 3D7SB 3NEKA 2M56B 2HBZB 3MM7A 1JK9B 2YNFA 4X66F 1VLOA 4RFBA 3CSTA 3D32A 1SJQA 4FS1A 2XZWA 1DTTB 3DLJA 4ARIA 4DL3A 1KTKA 2AWZA 1R8BA 4JL9A 3KLFB 1B4SA 1RTHB 2Q5WD 1RZMA 4XPEA 1XBWA 1JLGB 4NLWA 5EGYA 1UWMA 2DHAA 2RDHA 4RMAA 3UIPB 3WALA 1LK7A 4HACB 2JZ5A 1MJDA 2AX0A 3MM5A 4GRSA 5CHWA 5E6JA 1WX7A 2ZOFA 5HVFA 4A20A 4N76A 1UJ6A 4LBIA 1S3SG 2RPQA 2V2KA 1TQLA 3MR7A 3LF0A 4WH4A 1FXRA 4L73A 1T9WA 1YIJS 2LGSA 2ZVOA 2I6WA 5A8WA 1FRMA 3DOWA 5KT3A 5AE3A 1VQ9S 1HNXF 3PHWB 4HROA 1RFAA 3CCUS 5F9LA 3PW0A 2AU0A 2JEGA 3NLCA 1NPPA 6FD1A 1KRPA 4H54A 3SQGA 3TNVA 3FK4A 2FCQA 1FCCC 2HQGA 2OGUA 4CH0S 1UFKA 4ASWC 3V6CB 2WXHA 2HNYB 5ETRA 3DVNU 4CNYA 2C2KB 3UNGC 1D9AA 3AB5A 2AJ2A 4N47A 3CJ2A 5LMUF 1M1KT 3W1YA 1OQRA 2CJYB 3QGHA 4DJBA 4RL1A 4LRAA 4NPNA 1BQMB 2COLA 2JRSA 2DTJA 2XCPA 4A8WA 1IP9A 4IQMA 1M5VC 3M9OB 2JC1A 3HZGA 2KT3A 2D1CA 2WSCC 4Y0FA 4I7FB 2KLGA 1KLMA 5KG1A 2YY3A 1A6LA 3I55S 1XLPA 3S8SA 2BOAA 1N33J 2RH3A 1FRDA 1HWLA 2DGUA 1HI8A 2L1AA 4HT5A 3EX7B 4EO6A 3D0GE 4V19J 3P8BB 3VQSA 1C2PA 2GQQA 4ZRJA 4KC5A 5ETQA 3GU0A 2ASDA 2PMVA 4M5JA 1FDNA 4HPLB 2WS3B 1OEYJ 4DQOC 1H98A 3PJ9A 4OFZA 5IS2A 3PV8A 2ASYA 3IG3A 2VPYB 2KM8C 1T5XD 2HRTA 2DITA 3H2VE 3I9V9 1UVKA 3X3UA 1Y5IB 3LANA 2YBVA 4BBYA 1F9HA 1LFWA 2J9EA 1Y0HA 1I6JA 1SBRA 3WQPA 4WJPA 2KXHA 2DK2A 4FXWA 4FYWB 2VG5B 1GQEA 1AZSA 2OIHA 1Y10A 2OSQA 2ZM6F 1JMLA 2B4OA 3TVYA 5D4NA 1RKJA 1SJRA 3FCHA 3GV8B 3HCXA 4DBGA 2P5VA 2VJUA 2D69A 4C7ZA 3BYPA 3AEDB 2MLYA 1NK9A 2HURA 3SYZA 3V6DA 4CLPA 5CD4A 4DL4A 1YD8U 3NS6A 3R7BB 5D0GA 3GYGA 4C9DA 2O67A 1YITS 1NK4A 2KXNB 2PMWA 3E51A 2Y1LB 2FCNA 5K5MA 4MGYE 2DH7A 3V62A 2IAJB 1JWWA 1R6VA 4ELTA 2RR9A 4PRFA 1U8WA 1RM6C 1URRA 4PAAA 1Y5LB 1OY8A 2FIDA 2J9CA 5FIIA 2YNGB 3R66C 4ZPWR 4F4AA 1IBKF 2RD0A 3DXBA 2JLGA 3CJRA 5KG3A 5J2QA 2B5JA 3NS5A 1S6PB 1Q8KA 3U1MA 1U8SA 1VOMA 1HQUB 2HFNA 4LFAF 1EIYB 4MH0E 1OQQA 2C3MA 3FILB 1QVGR 3GP9A 2V0NA 4PR6A 2WW8A 3M30B 4WAFA 3JAMY 3UVJA 1M5HA 1QAYA 3PFOA 3TZZA 4NJ7A 4LJOB 1RT3A 2RQKA 1VK3A 4PWUA 4M5NA 5KFGA 1N60A 2C2OB 1FKOA 5THWA 2EBEA 3K89A 3RNEC 3SQGB 4NJCA 1K53A 4MH8A 3OL6A 4DBQA 4DR7F 1TKXA 1BWVA 3ML8A 5C3JB 4NZLB 1RAGB 1FF2A 2DR7A 4FDFA 4IKAA 4NY0A 1P1TA 3IWXA 2OPSA 3T3OA 3N30A 2HRYA 3N9UC 3L7OA 2DO4A 4YR2A 1KLMB 2D07B 2PFFB 4JI1J 3ET6A 4ICVA 3ZO7A 4RGOS 1MI0A 4A55A 2CPZA 4F2RA 3DGPB 1SC6A 4EUTA 2WSFC 2FLNA 2MBBB 1NH7A 1IKXB 1V8CA 2HS3A 5G55A 2OFHX 4GVLA 4JI6F 3C14B 2BJ8A 4R5PA 4II3B 2L9NA 1RHUB 3M32B 3FUYA 5K8NA 5LT5A 4NLUA 3RNCC 4WYWA 5L8RC 2ZKTA 3RPFC 2CJXB 2NXJA 3IGVA 3WANA 3M6UA 2GCFA 2BDPA 1S10A 4QR0A 3Q8RB 1HWIA 1S97A 2G2ZA 4O23A 2P6SA 5SUHA 2VZKB 3WC2A 3KLGA 2XWYA 4C11B 1SI9A 2LECA 1E8XA 3SCLE 3I32A 1UVIA 2VG6A 4UUWA 2W2OP 2UUAF 2V4IB 1JWUD 1YZ7A 4ZCMA 2IO1B 2GV1A 2EFNA 4I6NB 2L8JA 1WJUA 5AT1B 5KG5A 1F77A 4YHHJ 1FWKA 1L6VA 1AUSL 3ETMA 2XBBC 1CJKA 1JIHA 2REXA 2AQ3B 3NCPA 4DV7F 4DPTA 4KZCA 2RUGA 5FLXY 3HDSA 5B7WA 3PKYA 3R5GA 4OYAA 1WEZA 3BK2A 4MT5A 4DV4F 3ILLA 2RU3A 4U6PA 5DDOC 2JVRA 2BW2A 2MSED 1XMBA 3PLUA 2V3PA 2BM0A 2OPRB 3IG1B 1QJHA 4JV2A 3GP7A 2LASA 3RBXA 2VA2A 2KTFA 4JYAF 3ZJTA 1UWBA 1G7CB 1H4RA 3AXMA 2OTLS 1JB0C 1IXKA 3HVTB 4KPYA 1VYAA 3KYCD 1U7LA 4DLGA 5LXRA 5IQ6A 4U8VA 2W8KA 2DHXA 2ZC4A 3LYYA 3TUOA 4XO0A 1RLFA 1WC4A 2K25A 4C0HA 3LWLA 3EGWB 3FSYA 1AN8A 4I67A 3NVYA 4MFBB 3AJ2A 3H5XA 3AE2B 1DTQB 2KMMA 3I96A 4ZHRA 1Q7LB 5J1PA 4KDIC 3IM9A 5J2MA 1YJ1A 2OJ3A 1IR1A 4IDKB 4ED7A 1M1GA 1IQTA 2A10A 1CC7A 1CS4A 3U1LA 2ZH4A 1CQMA 1RA6A 2RUSA 1V1PB 2NYIA 2V8HA 2XY7A 3D9BA 2N4DA 4MSQB 1YX5B 4CQ1A 1KRHA 1NYQA 4JI1F 5CCMA 2CZ4A 1KOTA 2Y5BB 4RW4B 5E3QA 2V4JA 2E6XA 3OSNA 2CS4A 3BR9A 3ILJA 2XSJA 3GB1A 2AL6A 1VCBA 4G1QB 4ZDNA 1S1QB 4DV0F 4F7VA 1UGMA 4USJC 1H8CA 4ZITA 2Y8WA 4YTMB 4CI0B 4KH1B 1BE4A 5HJYA 1K0VA 4RM8A 1N63A 2ON8A 3MM9B 4C8MA 2KDMA 3J9CA 1TZOA 3N79A 5GMDA 2W54A 3DM2B 2WVDA 4YSXB 4RUAA 4L74A 2UXBJ 2FUG1 4UF4A 5LL6d 3CCJS 1FRLA 1FVSA 4J91A 1QAJA 3FMBA 1RWOB 4G1IA 3W66A 3UWTA 4NMXA 1T8EA 3U7ZA 3BYYB 3RBEA 3PYDA 4FJVB 3TUZC 1I42A 1PSDA 2KYZA 5E33A 2AEJA 2KTQA 2Y0BB 2Z58B 2W4DA 2A4ZA 3Q6BA 1WKLA 3MJWA 2HJ8A 3LPEA 2BF8B 2GMJA 5IXUA 3DOMA 3C46A 4NLPA 1Q95G 3ENWA 4ZIVA 3PVXA 4OJGA 1JLCB 5DPSA 3KWVA 4RW4A 1N0UA 2VC1A 2W82A 1FT8A 1NHVA 2D3AA 2N3OA 3ZZRA 1XJWB 3H5UA 1TGZB 4F25A 4G6VB 2JOQA 3GFXA 3NKYA 3W5UB 3BREA 4HKQA 2MQNA 3BBFA 4X64J 1X5TA 2WXIA 2JFDA 2G45B 1ZDXA 2VFRA 3BGFA 3M3JA 4TXSA 1NDKA 2DIVA 4DX6A 1U47A 2MTLA 3EFUA 1RKIA 2GGPA 2RMLA 5HROB 2KG1A 3I5CA 2V8VA 3DVNV 4TLQA 2Z8QA 2WNMA 5E5NA 2EI5A 4MT1A 5EE9A 5LMNF 2L48A 3VRBB 2DB1A 4DEZA 3M8SA 2YQ0A 2J6TA 4DCJB 1HBNA 3PHXB 3NG8A 3NS7B 4DFKA 4WU2A 4PG8A 1EF1A 3OJ3A 3VTUA 4MFBA 1NSPA 3CWIA 3T1YF 3RB3A 2UUAJ 4PS3A 2BWFA 3DWMA 3SV3A 3C0RB 3BR8A 4BOZB 7AT1B 1VRTA 2XI3A 5KFMA 5GVQA 2LQ8A 2ZHAA 1QY7A 5EWGA 4ZLLA 3NHEB 1AYEA 2PLPA 3Q8UA 2LVWA 4OL8A 5G0RA 1SE2A 1UWBB 3OTOF 2QMXA 2BE2A 2H54B 3D6FB 2MXYA 1PO6A 2HSEB 4CCHA 1XLNA 1M4VA 2MCNB 1P7EA 4OI4A 1ZS6A 3H9DA 1SC4B 4AP4C 3U7DA 3HI9A 4YP3A 3QWPA 3DDCB 2HEKA 2MZSA 1W2BR 1YN5A 3NL0A 4LRCA 3ZDMC 5D3DA 5C25A 1U24A 1QE1B 3N9YC 1DHMA 4OZ3A 1JRUA 1OQ6A 2VDHA 2FY8A 4K81A 1F1BB 1RTIB 1K8AT 4LF8J 1HPZB 1ROEA 2YTCA 1RXOB 3TQEA 2JSXA 5DPTA 1K47A 3MMCA 3IWLA 2LU2A 2EEYA 3H1UA 3VAFA 2Z0GA 1FWLA 5C24A 3CIRB 2VL1A 4C11A 3ZNUA 2KT2A 4DV5F 4A90A 1NEKB 2CQIA 3QAQA 1W7WA 5DG9A 2NYHA 3RB6A 1HD1A 8ATCB 2WONB 1WJNA 1WXQA 2L05A 3TYTA 1TKZB 1U1NA 2VBZA 4KT0C 4OZJA 4A4JA 1U1MA 2DIUA 3T9ZA 1MSWD 2EFVA 2I1RA 1V5IB 3BSOA 2PI5A 2UXCF 3CD5A 5HATA 2MJEA 4Y2MA 2FVQA 3UN2A 5CZVA 2KTRA 3TA1A 2GRIA 3NAHA 1H2UX 3VF0B 1GTEA 4USIA 3CSKA 2XMVA 3D28A 2K8HA 1LGRA 3OR2B 5JMNA 1KBRA 2KJRA 4RWXA 2XO7A 1NVID 5E2QA 3H7HB 5LLIA 4B08A 1Q1OA 2MDAA 2GQ2A 2ZOMA 3GONA 2HK2A 2LDYA 2MEKA 1TUVA 3BB5A 4ANEA 4XC2A 5HMWA 1GPXA 5IC6B 3OD2A 1LO5D 3EDQB 3ZGZA 2E1PA 3ELHA 2Z59B 3MFIA 3TVKA 4NASA 2MP2B 1UVJA 4DUZF 2ZVIA 3CO9A 2IJFA 5M2RA 3CJ3A 4Q2MA 4QW8A 2QA4S 4ZHPA 1B99A 5KG7A 3VH4B 4I6WA 1L7YA 3A4RA 4B9LA 1S79A 3M95A 4NYPA 4U67Q 2DHSA 1XK8A 3T5HA 3N0VA 2Y5PA 4HDOA 2D3O1 2DBBA 4LUBA 5H92C 2YPYA 4L6V3 4FXVA 4X57B 5D3IB 2F4VJ 4KX6B 1Z2ZA 1XEZA 1B0TA 4URSA 4C8ZA 5AE2A 1S6PA 1YWXA 1UETA 3K59A 2OEDA 2JX5A 2JWNA 3TEXA 2HHHJ 4OYOA 1S4FA 3B8HA 3MAAA 4A9AA 3HSDA 1WC1A 3US5A 3K8WA 3HM3A 2AQ4A 3BIID 4O3SA 2O5DA 3NZUA 1Z4UA 4I2PA 4DZ6A 2F9DA 2JF5A 3U2SC 1V49A 2LHEA 2NLWA 4IR9A 3H5YA 2RT3A 2XK5B 5D77A 4LRDA 2ZH7A 3S01A 4TVAB 3BY4B 3E2EA 3BYRA 2K1RB 4LJPB 3V6DB 1RWPB 5I4MA 3ZZZA 3QAEA 2CNOB 1WHYA 1CJVA 2KN5A 1T3QA 1WEXA 2WHOA 1E8YA 2KWDA 2ZWOA 3BVMA 5AZHA 4UDUC 5KFOA 2XULA 1XR5A 3KLHB 3I3TB 3KJFB 2D2QA 2KRBA 1VQ7S 4WCEQ 2UWQA 4URKA 1PIEA 1DLOA 4ARCA 1EAYC 3UE2A 3M63B 4BDPA 5GAHI 3TEGA 2FAZA 2J0SD 2F4FA 4P7TA 3R97A 4N6EB 4A46A 3AY0A 2KQ4X 2CJAA 3QK0A 1MN9A 3G8QA 1QKZA 4LREA 2W4CA 3HF5A 1RAOA 4G3IA 1GX5A 5B0EA 3OFHA 1WD6A 1UELA 3GE9A 4DR5F 2MP2A 5E6OA 4RGNA 2BE9B 2QA1A 1UL3A 3CTRA 2KI2A 3MTJA 3EGRA 4FBTA 4P6VF 5LXIB 5B0BA 1NB2A 2BJ7A 2YNHA 5KFUA 3SFGA 2VBWA 4DSFA 4F4KA 4KSKC 3WIVA 4C4VB 4F8RA 5AXMA 1TT5B 1LXJA 1P9QC 3FNNA 1WELA 2LA6A 4EK2A 4GU2A 2O6VB 3VFKA 3KYDD 3HT0A 2W55A 2AMCB 4XPCA 1MHXA 1EM7A 4EU0A 4OX9J 3GCXP 3KHHA 1JX4A 1PJ7A 4AJYB 5BYRA 3J7Z5 4P1CC 1IBXA 5C42B 3HHLB 1KWMA 2EW9A 5EX0A 1YJVA 2MSTA 3M32A 5LXHA 2W9CA 1WXSA 3LAKA 1HEZE 5HJXA 4IH5A 4HJKA 2J0QD 2BJ1A 3O1LA 2DAJA 2CUYA 2DXDA 3SDLC 2EWHA 1Q82T 2H4YB 2RDBC 2QCZA 3PVLA 3I9ZA 4LRBA 2YEPF 1LFDA 3H59A 3AD8C 5A6PA 5KFYA 2IGDA 3OL9A 4BLGA 2DGWA 4AXJA 2WW4A 3NGKA 1VBYA 1PYWD 1DY3A 2WXNA 3DBHB 3CCTA 2NR0A 5ETNA 2AHOB 4RBVA 4NJ6A 4C80A 4F4YA 3DKDA 3IAS1 2B4PA 4QYRA 4K3BA 4X4TA 4FJZA 2J76E 1BQXA 1XQIA 2LUMA 2ZJDA 4GXBA 1RT4B 1RGVA 4ENOA 2R7TA 1NH8A 1VRUA 4DL7A 4DG1B 3IS9B 5KFWA 3PYGA 2R2RA 1FNXH 2LGDA 3G86A 3AM9A 1DOYA 3T1HJ 3UCGA 1EWYC 2KC2A 1X9SA 4L3NA 1UVNA 3M1VA 4I6PA 2LP4A 3N5BA 1ZM4A 1WTFA 4CT9A 5IM0A 1HNZJ 1RP5A 4EZJA 5E3RA 4DV5J 1BC6A 1Y4ZB 2QN6B 1QOAA 1FKPA 4GDLA 2HFOA 2DNRA 4E71A 1YGYA 2W24A 4QYZK 1ZH5A 4OLOA 1NPKA 4Q8FA 3SIPB 5B0FA 4K59A 4J9UE 1R8AA 3EZ5A 2XS5A 2V69A 2YNFB 3MAQA 3H90A 2GX8A 1TAQA 1MMNA 3NRZA 1R7IA 2EMTA 2HWIA 4JB8B 2CWXA 4LR7A 4Q2JA 4EBEA 3L10B 2OPPA 1WI6A 3H7SA 3OG5A 2IGGA 1T7PA 3CCZA 1TIFA 3VTIA 3FC4A 1R7SA 1SKRA 1SL1A 2V9WA 4WE1A 1WM2A 1OTRB 1GX6A 3FCWA 4V1Ak 5M2UA 2Q6CA 3DQVA 3TAQA 3CJ5A 1XMOJ 4ITKA 4O0NA 1DARA 1CJTA 3PT2B 2GIQA 3H0PA 1FXAA 1H2TZ 2H65B 2ZEJA 2HBYB 1SE3A 4YT0B 2JHEA 1F3FA 4BBNC 2KJWA 3CDAA 3SCIE 2DISA 5CYMA 2BXJA 1JWMD 5J1EA 5GAGI 2W8LA 3Q3OC 1XF5L 3P1MA 2CNLB 1E6YA 2XHWA 3LP0B 3B1LX 4K8RA 3PEHA 1YIWA 1L3TA 2CKHB 3LJ3A 3AEAB 4JX1C 2AWTA 3R2CJ 2KVZA 2HAFA 2UXBF 4KO0A 5EDWA 4Z7YA 1TP7A 3G82B 4X62J 3QAUA 1WG5A 3NG0A 5IP4D 2IFXA 4I7FA 5IN7A 4QPTA 2E5HA 3M2RB 2OD4A 1NXIA 4EGLA 2VOPA 3P2BA 4FBJB 4KO0B 2WU5B 5E41A 5BMGA 4NZ7A 3KVFB 1MG7A 1UZDA 2VRRB 1C1CB 2W2NP 1F5AA 2LZ6A 4ZVTB 2FCMA 4ACFA 5IWAF 1CULA 2KOXA 1NBEB 2MA9B 2B3TB 2WB1D 4PABA 1TS5A 2R61A 2IMWP 3AH7A 2HD5B 4OYXA 3MECA 3EUNA 4WF9Q 4ERDA 4JP8A 2XLKA 4GDKB 3CJ8A 1OPZA 4N77A 2WU2B 1WWHA 5A0YA 4R0JA 2EPIA 3HVRA 4EZKA 4X4PA 1M5KC 2LJIA 3V6KA 2E9RX 1NSAA 1S1XA 3HD2A 2AGQA 4L1BA 1JLAB 4N5SA 4A8XC 1RWMB 4WTYA 4X4RA 1BY9A 3MFHA 4CH1A 1RT7B 3O65B 5JUMA 1XNQJ 1WR6E 3TAPA 2QSFA 4IDKA 2FE8A 4PS7A 1PG5B 3G8TA 1RHQB 1E7UA 1NEEA 2QTWA 5I3QA 2HBQB 4RNAA 4QZVB 2A6MA 3U1NA 2HTHA 3W2VA 4A8XA 2JEIA 4YWGG 2UUCF 1XCQL 4KYZA 4W9CA 4KV2A 3EWGA 2Y0SD 3O8WA 4WWMA 2BW7A 3CJSA 4ECTA 2W1BA 5L38A 4MK9A 1N5QA 4C3KA 3OL8A 4B9NA 2NTTA 3Q2TC 4WURA 4QWCA 4IM0A 3HHEA 3RFZB 5DQGA 3E8OA 4P52A 1NNDA 3H4DA 2MB0B 1S9FA 1WDTA 5B0CA 1KH0A 3IA0A 1T9VA 2BYCA 2J0WA 2OPRA 3FGVA 1SB3C 2J4XA 2VPZB 2VG5A 3ZTRA 1UJ5A 2C3PA 2JXTA 1KC8T 5CH7B 1JLFA 4JGHB 3NOBA 1Q81T 2CDRB 4M8NA 4I68A 3ZNJ1 4WQOB 1NKCA 1R89A 1EU3A 1WGHA 2AJFE 1RTDB 2KJHB 2HWTA 2MBHA 4FF4A 3VZHA 2IM1A 1AT1B 3T3NA 2ROGA 4X2BA 5F0WA 2WVFA 4B17A 2OPQB 2POKA 4DG1A 4FJYA 4RUBA 3SXLA 3SBMA 4OZLA 3ILIA 1NBFC 2ZW0A 3Q24A 2D3BA 1F5CA 2H89B 1RTJB 1OS5A 3FKYA 4O3QA 3R5BA 1HNXJ 3CCRS 4EZ9A 5LJ3Y 4M0WB 3K5NA 1U0SA 4U8YA 1KKHA 3MEGB 3QZ7A 4J9OA 3TMPB 4EZLA 3PIPQ 2Y5CA 4O44B 3W2WB 4IO9Q 4DHJD 1H74A 1TKTB 5D4PA 1IGDA 3DLKB 2DY9A 1HFEL 2QA2A 5GAEI 1DQ8A 2VFUA 2N9KA 2LHDA 2LUEA 4CO0A 1RWSA 3TA0A 3NUHB 2OLWA 2K9XA 5EUHA 3B4MA 3UF8A 3PGEA 1RABB 4CTAB 4PK1A 3KJVA 3FRYA 2JZ3B 2QX0A 4C2MA 2XEWA 2CU3A 4ALZA 2GBJA 3V4IB 1NYRA 1U1LA 3G8SA 1GAOA 2ZJQQ 5A8KB 4GKJJ 1HA1A 1N5TA 4JUZA 3V61A 4FKYA 3J81j 3QLHA 3U30A 3OLMD 3GE3C 2XYHB 2IYDB 3N32A 1N33F 5C5JA 1WF1A 2D3CA 3EHVA 3I0SB 1TELA 2NSCA 4TNOA 2I5JA 4TLRA 4W4MA 3C8YA 3HVDA 1WHWA 3DOLB 5AUIA 3VUXA 2MHJA 2CVIA 2N9LA 4DR6J 4P7VA 2L3MA 3O44A 5H8YE 1X4HA 3UVJB 3BK1A 4AL5A 3NVWA 2XHCA 1C78A 3MM5B 2GAHC 1YX6B 1F5BA 2INNE 5CX3A 3ZZTA 1RYJA 3OAWA 1D1UA 3ZNGC 2MQQA 4ED6A 4TY8A 1GXLA 3GILA 3UFCX 3ZUNA 2DX5B 3SFDB 2NPFA 4QJVA 4HEA1 2DZIA 1F9FA 1PJ6A 3L16A 2CQBA 2YNGA 5JJBA 3KLFA 2E1RA 2J5AA 2MHEA 1HD0A 3RG6A 1JJ2R 5C1ZA 3FJ2A 4DFPA 2BACA 4EOYA 4M5HA 1HR0J 3PO4A 4Z2XA 2HVDA 4WK3A 3IR6B 2IAJA 3ZDTA 4F0HA 2ZUGA 2D9PA 4DZDA 3P49B 4USKA 1ZAWA 3JVZX 5DO2A 4S0RA 3LAMA 3SDEA 3BN7A 1FEHA 1ULRA 2GIFA 3ZNZB 4OMFG 3VZIA 3GFHA 3DBSA 2YPZA 1CPZA 2GVDA 1H7XA 2F8EX 1HHQA 2MY8A 1R6YA 1B9RA 1SV5B 1NJYA 3SSQA 3KUGA 5T7LB 3K5MA 1ZKHA 2I38A 4BKTA 3ECIA 3AEEB 4JBCA 4PWDA 1QQRA 2EMSA 2K8CA 4OI2A 3G71S 4ECXA 4AOFA 3VVWB 4IRDA 3TWZA 3IT4B 1BHNA 5B0GA 3GE8C 3D3BJ 2PPHA 5I4DA 3IAM1 3DLEB 3UQAA 1IVZA 4C97A 1N0VC 2VH1A 1CQVA 4DR5J 1JLAA 2HGMA 3QRRA 1S1XB 3TIXA 1C9FA 1JKHB 3M2UB 2FVPA 3KLEA 4Q0BA 5A0YB 4A6QA 1NZ8A 2FJAB 3GV7B 4C0OC 4AS1A 3W64A 2O2VB 3N6LA 1WKKA 4IM2A 4F0MA 4ED3A 3TQ1A 1IM4A 3R6LB 3N1YC 3OBIA 4J37A 3UPFA 1MWQA 1LWFB 3MPWA 4ANXA 2HS0A 3HFZB 4PXDA 3HVWA 2BKFA 2VFTA 3R8BA 2ZHOA 2D3OR 4JPSA 4NE9C 2Y1RI 3ZQ4A 4DR3J 2HKEA 5FKAC 2K06A 4DDFA 1D9FA 1STEA 3A33B 4ZJQA 4RBUA 2RVJA 5KFKA 3FBBA 4DU8A 2ZM6J 5BMIA 5KFVA 1X4GA 3CCVS 1FD2A 2CPHA 4C48A 2W2MP 3GR1A 3JTNA 3LQVA 4HDQA 1KQFB 3TUIC 3FMWA 1GMVA 2DYMA 5KT5A 3D1QA 2DZMA 2RB7A 4KV8B 2KWCA 4WFYA 5FR3A 5GADI 3MUTP 1JQGA 3KG0A 1C4PA 1FE4A 1RT1A 3D67A 3DXSX 2DEJA 3IRXA 2K7JA 1X4CA 2ZBCA 2MRPA 4ZVQB 4DWIA 5J2RA 4OLPA 1RSCA 4Q5VA 3Q86A 4H2AA 1CBKA 5T8IA 2J8SA 2UXDJ 5KFFA 3DVGX 1I4PA 2JLEA 3M8QA 2OHFA 3HPOA 4C56C 2RQ4A 3Q3FA 1K8RB 3G2XA 2AW0A 3JSMA 4EBDA 4QWDA 1KNZA 1R4MI 1C3TA 3J7YI 4FF3A 1X9WA 3RAQA 3HSGA 4RF1A 1H0HB 2LFVA 1VS3A 3MDFA 4JI3F 3WC0A 1SXLA 2MHNA 1D9DA 1CJTB 2RE1A 2IO3B 4G0NB 2BPSA 1WXAA 5DJBA 3KHRA 2GBMA 1IPGA 1FRHA 4WFBQ 4DQRA 3PRDA 3ENVA 4CQNA 3TW0A 2HVIA 2YX1A 4ILMA 4DPWA 2CHZA 4ZHOA 2J7QB 2KHDA 4M63A 1L6UA 2VQEF 1PAEX 2V8PA 2WLBA 3GB0A 2IDYA 4ER8A 3L17A 4RM9A 3ZZ0A 1RT5B 2GHPA 4PG4A 4OHVA 5T14A 3SMZA 2QLXA 3PRVA 3T1YJ 3SD5A 4KV8A 3PZ7A 2IBIB 1I4RA 3CMES 4AL7A 3A12A 3MCOA 2QL5B 1EETB 2RQCA 2UVVA 2IC3A 4B3RJ 2HNZA 3TO8A 1TL7B 4KR0B 4ED8A 2CVEA 1A7GE 5D3GA 1GFWB 2UU9F 3CC7S 1TVRB 2B76B 2RDDA 4Q2LA 4OZCA 1NI2A 1ZM3A 3KUDB 1D5XC 4MJSB 2WWZA 2WVEA 3JTOA 4DN0A 1N5YA 4J9MA 4A8OA 4OX6A 4M94A 2AJ4A 2C2MB 4IH7A 3PX6A 3L0WB 4RW7A 3QJJA 3HSZA 3HHDA 3QGPA 3HJVA 1JLEA 3DRYA 2MW5A 5DG8A 4K4VA 4LT6A 4U7UD 3RNAC 1DQ9A 3QX1A 2V50A 3QJLA 5MLCV 1KS2A 3MEKA 3ONSA 4FNHA 2NXNA 1X9MA 4FPIA 3RRHA 4USUA 1J5OB 3I31A 3NMAA 3KG4A 4G11A 3P5BP 4DMZA 4LSLB 4K3CA 1KTQA 3M8PA 4U7CA 4KZ0A 1VIOA 3Q8FA 3QMQA 2JZPA 5IZHA 4PWDB 4ATNA 3R9LA 1C1BA 3BN4A 3ZTPA 3QSYB 2B4UA 3W1SA 1KFSA 2BBCA 4G50A 4YB1P 5HMZA 2C7NB 4LDTD 2I1KA 1X5SA 1ZAXA 1QSLA 2WXLA 3JSVA 1Q8IA 1K44A 1OQ3A 3HP6A 2EKIA 1WF2A 4B3TF 2HQCA 4X4QA 1WY8A 1IKWA 1NDCA 4ZLJA 3ITHB 2IO2B 4NLTA 1T0RC 4CLSA 3KK3B 2W9CB 2KZRA 2L41A 3MAHA 1OGWA 2J0XA 4Y34A 4KFBB 3FEXB 2XS2A 3NS1A 1QDUB 1IBXB 3VR8B 5C42A 1L3VA 5B09A 2AEFA 4P9SA 3MFGA 3ISNC 2BJDA 1GMWA 2CG8A 3OQ2A 3AA8A 1A9NB 2W9BB 3Q2AC 2ROEA 2QYGA 3VHTC 2IIHA 4EO8A 4CO5A 1DQAA 3H7PA 2ERRA 5KT2A 4X64F 1JLBA 3M9MB 2MH7A 3FEZA 5L1KA 1RAIB 2BKNA 2WXJA 1P1LA 4WJNA 4FPRA 2LVQA 2W3RA 2F8MA 4OYWA 5L83A 2DGOA 5ETLA 2V4LA 1Q16B 2WCXA 3DOLA 1WR1A 2F65A 5IO9A 2QA4G 2CNNB 2KJ6A 2Y9HA 3LP1A 4IG3B 3L13A 2JX2A 2M52A 5DM7Q 3L08A 5BXIA 4Q8EA 4B95A 3N4WA 5KHOA 3JSBA 4ZRPA 1DZ5A 1MROA 2R7VA 3CJ0A 3AI5A 3D6HB 2M88A 2BJEA 3OW2R 1T0YA 3K8VA 4WKRA 4N7TA 2KU7A 1V5OA 2FZGB 2MPUA 2GO9A 2Q43A 4RCOA 3DU6A 3TEZA 1V9JA 5F8IA 2FJWA 3R2IA 2KL8A 3GG0A 2SEBD 2KHWB 2BB5A 2E1AA 3NXZA 4OYZA 5LMNJ 3A9JB 2V6AA 3HSJA 4O3PA 5K8PA 4WFZA 2DR8A 2WZ1A 3C66A 3LP2B 4PUOB 2GI9A 4RW6B 5G4DA 3UDLA 2WYQA 4LF5J 3AEFB 2V2VA 1OJ4A 2KB2A 3OTBA 2XK5A 5HL7Q 5FR6A 4AWJA 3QO9B 1FHTA 3OTCA 1UW9A 4ILRA 2MKSA 3J81Y 4OQJA 1TBEA 1KJTA 5KFNA 4M01A 4XTTA 1TL3A 2BBEA 4CZCA 1YQBA 3GZNI 1NB7A 1D3WA 3AE8B 3AXCA 1WSRA 2HS4A 3FQLA 4DV7J 1S1VB 2KFKB 2VQEJ 4U7UK 1IUJA 4KGSA 1FRJA 2IZVB 4BWJA 4OZBA 1S1UA 2ZDPA 2R9LA 1R4NB 5IT4A 1QSYA 1R0AA 4PWWA 3WDOA 3P45B 2C60A 3K0JA 2WB4A 3SZ2A 2CJKA 3Q8QB 2XC9A 2W9NA 1V2YA 3W8GA 3AU5A 1REGX 5EWEA 1TMMA 2ZZMA 1TR0A 2MKYA 4ZMMA 2IBOA 3SCKE 4P2XA 4XZ4A 2PVGC 2C28A 4IWPA 3TR5A 5KOXA 2MZTA 1JLFB 4ZCIA 4ELVA 4USHA 1GEHA 3NJTA 2H48B 2I9SA 3KLVA 2EBGA 4LQ3A 4H4KA 2FHKA 2VG6B 2PE6B 1FTRA 3PRPB 1MN7A 1CVJA 4CYUA 4C4WA 5GAGU 3NAIA 5FLXU 3VVTA 4KKJA 2KNBA 3HD1A 3GWCA 2AD9A 1N4LA 2WBRA 1T9TA 2Z57B 1NK8A 3DRSB 3M2VA 4NLYA 5F8MA 3CIMA 3BKFA 1SJHD 2MZJA 4WTOB 3ENQA 4WZMA 2MJ3A 2UVRA 2XNQA 3OPKA 3DRRB 4AUKA 9RUBA 3A4SC 1HBMA 2IDEA 4FHKA 2X7IA 4O3NA 2QEXS 3VQTA 1WG4A 1V1OA 5C2TB 3R3MA 4P2MA 1FWPA 3AEBB 3B2FA 4K4TA 4QIGA 1BGXT 4YY3F 2MZ1A 4MSMB 1SPBP 1JW9D 2B7CB 1IKXA 2NSBA 1HBOA 2QFJA 2KFJA 4GO7X 3KUCB 3AAWB 2YKAA 1PYOB 3D54A 3OL7A 5FK9C 1FJ7A 1NK0A 3O6QA 2GBKA 1NZAA 4DR3F 5HP1A 1NJXA 2CJBA 3AQOA 2V63A 3MM8A 5HBMA 4WYLA 3LDZE 3DHWC 2VJVA 4KGVB 4DUYJ 2IO0B 2JL9A 3QJZA 2MBEA 4MM3B 1NHKL 1T05B 5E6PA 1WJ9A 2EKNA 3RW7A 2FC9A 2HIQA 5C2CA 2RKIA 1ZOTA 2RRBA 4DHZE 2W9AA 3BPSP 2MGZB 1IKVA 4JOUA 5AZGA 1C1CA 2YNIA 1UEUA 1QLBB 2D74B 2WXFA 1HL6A 4DUTA 2BANB 4QWAA 4USTA 1EQ0A 2X1FA 1EHWA 3PHEA 1M5SA 2HQDA 1LNQA 2KWVB 2LRUA 3CE8A 3OLAA 3PTWA 1HHSA 2R2QA 3BO4A 1FK9A 4IWOA 3C6TA 3UD3P 2BQQA 4GN1A 5EE3A 1RYSA 3D6TB 2AZ1A 2CXEA 4DQSA 1FJEB 4MMOA 3BKTA 4DQIA 3KOAA 2ZH8A 2OMLA 4OZNA 1IBLJ 4M8MA 1JXEA 1S0VA 3I5AA 2XMKA 1ZBTA 1C76A 2DCLA 3OJSA 3UW1A 4ITSA 1B0VA 2IVMA 4IYQA 3FQKA 1EB0A 4TYAA 3KK2A 4JE3B 1JWAD 1U4AA 2J7WA 3J7AN 4AE5A 1H3DA 4QR1A 2QE5A 1HYSA 4DR4J 1KDNA 2KMAA 4JI4J 1H6KX 3FAHA 3TAMA 4RO0A 3MCNA 1UEKA 3I82A 2KDFB 2E5LF 3JTPA 1X5PA 5JHBA 1HZ5A 3X23A 1RWWB 3J81U 5L1IA 1ZAVA 3RYTA 4LBHA 1JCKB 4Q43A 4LF1A 2IY1B 4QIVA 3JYTA 2XYGB 2D11A 2AP6A 3JSYA 2RMMA 1V3SA 3DHHC 3ISND 1JJCB 2QIEB 2XNRA