2KN4A

The structure of the rrm domain of sc35
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G, Splicing factor; arginin
publication title The structure and selectivity of the SR protein SRSF2 RRM domain with RNA
pubmed doi rcsb
source organism Streptococcus sp. group g, homo sapiens
molecule tags Rna binding protein
total genus 31
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kn4A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kn4A02
5D78A 1WI6A 4WF9Q 2DISA 5DM7Q 1PGAA 5IQQA 2RNEA 3THTA 3V4MA 4A8XA 1IBXA 1RK8A 2OSRA 1BY9A 2LYVA 4YUDA 2YH0A 2CJKA 4PR6A 2AYGA 3NMRA 2KM8B 5HFYA 1U1RA 2E5HA 2YWKA 3U1MA 1WHVA 3J7YU 3UCUP 2O3DA 2LEAA 3UE2A 1P7FA 1XCTL 2N3LA 4EGLA 4C4WA 4ZKAA 2DO4A 2HZCA 3CCVS 1K50A 2RT3A 3TYTA 1YITS 2DGUA 2DITA 3Q2TC 3CCQS 1JMLA 3FEXB 2RQCA 3H2UB 2KT5A 2ON8A 4TU8A 1ZZFA 2GHPA 1HZ6A 1MHXA 4OZBA 1U1QA 4W92B 1IGDA 2LCWA 1VBXA 2QMTA 2DGQA 3SDEA 3BO4A 3CCSS 4OZAA 1P1TA 2DH7A 2CQBA 5IFMA 2M0GB 3VAGA 1KD1T 4F25A 2OEDA 4PKDB 2MJUA 2N7CA 1OWXA 2CQCA 1D4BA 2CQ3A 2LECA 2KWDA 4M5DB 1VQKS 1QKZA 1YTYA 2DGTA 2KXNB 3CPWR 1WG4A 1IBXB 1YIJS 1YJNS 1WF0A 2M52A 4QQBA 4Y0FA 1XCQL 4QU6A 1NO8A 2MKKA 1CVJA 1H2UX 1VC6A 2OIHA 2DO0A 1M5KC 2LHEA 1Q81T 1XN9A 3EGZA 2FC8A 4WFAQ 3D2WA 5GAEU 2MQNA 2G4BA 2FC9A 2MB0B 3VAJA 1HD1A 3SXLA 2MQPA 1X0FA 1W2BR 2F9JA 2NLWA 1QVGR 5HL7Q 2ERRA 3DLLQ 2GI9A 2OJ3A 3MD1A 4IUFA 2KN4A 4RU2A 1N88A 1VQOS 1VQ4S 2KM8C 1X4EA 1Q7YT 2RRBA 3CULA 1P27B 2KXFA 1K9MT 3UD3P 3MOJB 4FXWA 1FCCC 3THPA 3SDEB 5MLCV 4IOIE 3BO2A 1U1OA 5JVGQ 1X4FA 2B0GA 5DDRC 2MGZA 2KVIA 5IM0A 2KRBA 2VOPA 1N8RT 2G1DA 2VOOA 2YTCA 3P5TL 1UAWA 2MQMA 1VQ9S 4TU7A 1O0PA 1WF2A 1WHYA 2UP1A 2LMIA 2MXYA 4CH0S 2RUGA 2CPXA 1SJRA 2XB2D 5JXVA 1VBZA 1ZZNA 2PE8A 2OSQA 2M4MA 1KOHA 5GVQA 4CQ1A 3G8SA 2CQIA 4MACA 1MPEA 2VODA 2DHXA 1K51A 1H2TZ 4FXVA 4WCEQ 2J76E 1HD0A 4CIOA 3CD6S 1AUDA 2ZW1A 2DGOA 2DGVA 5LSOA 5DDOC 2HVZA 2JXTA 2CQ4A 2J8AA 2NZ4A 3VAIA 2NMQA 1IQTA 1VQ6S 2VONA 2IGHA 3LQVA 3IRWP 1DHMA 2MJNA 4W90B 1FHTA 2MGZB 1ZXHA 3IWNC 1Q82T 3R1LA 2MKSA 4LJMA 1WEZA 4KGRA 5BMGA 2F3JA 5IM0B 1HZ5A 3HI9A 5LXYA 1FO1A 3S6EA 4D2KA 5LXRA 2KG0A 3I55S 3BO3A 4V19X 3LPYA 1U1KA 1FNXH 1VQLS 3P3DA 2MMYA 3G8TA 2N9LA 1YWXA 1JMTA 2RS8A 1VQ5S 1WG5A 1MI0A 2LUMA 3MURP 1QVFR 1U6FA 1WHWA 3CXCR 1OO0B 4IKGA 2KRRA 2MQQA 2MZTA 3S7RA 1M5VC 1U6BA 4QU7A 1VQ8S 2L08A 2MY7A 2LKZA 2N3OA 3OW2R 1X4DA 4ED5A 2LQ5A 3UWTA 1YJWS 4LMZA 3VAMA 3TO8A 1M5OC 2KXHA 1KOOA 3DXBA 4BS2A 3TP2A 1K73T 3CF5Q 2CPZA 2QA4S 1B7FA 1PO6A 2KACA 2LA4A 5GAHU 2CPIA 3N9UC 2RPVA 2JU6X 2CPYA 2M70A 1UFWA 3CCLS 2M9KA 2AYMA 2ONQA 1X4CA 4WKRA 1K53A 4QPTA 1Q86T 2D3OR 2YH1A 3MDFA 3MP9A 2EVZA 2QFJA 2XS7A 1WELA 3GB1A 1X4AA 4TU9A 5CXTA 2QSDA 2MKIA 2JWUA 4KGTA 2DNPA 3I56S 2M2BA 3EGNA 1HEZE 2ADCA 1K52A 1WG1A 1F2RI 2DNGA 2E44A 1K8AT 2JVOA 1H6KX 2CPFA 1F9FA 2KHCA 2FY1A 2XS2A 2MKHA 2CPDA 3BEGB 2DH8A 3MXHP 4WFNQ 2KG1A 4KGSA 1XF5L 2IGGA 1FD6A 3R27A 3V3XA 3CMES 2DGSA 2D9OA 4IO9Q 2DNRA 2OTJS 3CMAS 2CQ1A 1YNTE 2CPEA 5GADU 1NJIT 1DRZA 4HKZE 2AD9A 5GAGU 1HA1A 2MYFA 5H1SV 3G96A 1JJ2R 2CQ0A 3G4SS 1WWHA 1WF1A 2MKJA 1NU4A 5HHDG 4UQTA 1M90T 1WHXA 2JX2A 2IGDA 5LJ3Y 1RKJA 2U1AA 2ZW0A 1R8PA 2M7SA 2KQ4X 2DIUA 2XS5A 3G6ES 2JRSA 1OPIA 2N82B 2DNOA 3MD3A 1SJ4P 1SJQA 3ZZZA 2KYXA 2CQHA 5DDPC 1QM9A 2F9DA 2CQPA 3PIOQ 3UD4P 2DGXA 4YB1P 2SXLA 3RW7A 2ZJPQ 2J52A 5HI1A 2RU3A 2CPJA 2ZJQQ 2ZJRQ 1YHQS 1X5TA 4Y00A 5LSLA 3L3CA 2LGIA 3NNAA 3P6YC 1FT8A 2J0SD 1X5PA 5GMKa 2BOPA 4F26A 2E5IA 1YJ9S 1VBYA 1P7EA 4J5OA 2JVRA 3G9CA 1WI8A 3B4DA 4P6QA 3CTRA 2MZJA 2MY8A 1GB4A 2MZSA 3EX7B 1KC8T 2ADBA 1FCLA 1WEXA 1KQSR 2RMMA 2DNKA 2Q79A 5HG2A 2DB1A 2M8HA 2DNMA 2M88A 3NS6A 2G0CA 2K0PA 2MPUA 2GB1A 2M8DB 1VQMS 2KU7A 5JVHQ 2X1GA 5CA5A 1DZ5A 1VQNS 3CCRS 1PGZA 2K3KA 3K0JA 1KH0A 2EELA 4HJGE 1X5OA 3Q2SC 3MUVP 2OTLS 2JSVX 2EK6A 3VAFA 4PRFA 1VC5A 1U1LA 1L3KA 5DETA 2RVJA 1M1KT 3MI7X 1U1PA 4LIRA 1HL6A 2LXIA 4Z2XA 2I2YA 3S8SA 3P49B 4UY8T 1SJ3P 1UP1A 5ITHA 1X4GA 2GO9A 1EM7A 2L41A 2DK2A 1VC0A 2PTLA 2LXUA 2CQGA 3FILA 3FEYB 1IGCA 3CCES 2WBRA 1A9NB 2A3JA 4IOCQ 1JJ4A 2DNYA 3B4MA 3VF0B 2QEXS 1GB1A 2FPHX 5LJ5Y 2L9WA 2X1BA 2J53A 1PGXA 3SMZA 3UI3A 1PGBA 2E5GA 2PEHA 1UW4A 4C7QA 2MSTA 1Q10A 2MHNA 3JB9k 3ULHA 3CUNA 3S01A 2HGLA 2MSSA 5DM6Q 3UCZP 1YMHE 1X4HA 2MKCA 1SJFA 1OIAA 2JZPA 3CC2S 2MQOA 2DNQA 3NNHA 4CH1A 1S79A 1U2FA 3CC7S 1A7GE 3VAKA 4ERDA 5DDQC 1URNA 2CQDA 2YKAA 1VQ7S 2DIVA 4TLQA 3BS9A 2LEBA 1S72S 4OZCA 1C9FA 4U67Q 4F02A 3VALA 2X1AA 5FJ4A 2KFYA 2MQLA 2D9PA 1MVKA 3FILB 2DNLA 2N9KA 2CQ2A 2HGMA 2CPHA 2KI2A 2I38A 4WH4A 5BMIA 3UCGA 2HYIB 3J7ZT 5BJRA 3MUMP 1WTBA 2MZ1A 2DNHA 1UWXA 1D8ZA 5EN1A 5BMHA 1U1MA 2EK1A 1YI2S 4YOEA 2RQ4A 1SXLA 1ZH5A 2KDMA 1MHHE 5CYJA 3G71S 3HHNB 2J0QD 2KH9A 2JWNA 2XNQA 2XSFA 1X4BA 2HGNA 3CCMS 2V94A 3CC4S 1DBDA 4OZ0A 3RW6A 1N54B 1N52B 1G2EA 2MZQA 2FHOB 2DHAA 2DHGA 4WFBQ 3PIPQ 1R8HA 1VQPS 2RRAA 1FXLA 1F2RC 2N7JA 1D9AA 2BZ2A 2DNZA 3CCJS 4IOAQ 2DHSA 2LA6A 4OZ1A 2DNNA 2MZRA 2K8GA 2LHDA 2PW9A 1JJHA 1WEYA 1M5PC 3VAHA 4WIIA 3US5A 2DH9A 4GLSC 3MUTP 3CCUS 5HO4A 2RS2A 1FJCA 3U1LA 5D77A 2AYEA 1FJ7A 3H2VE 3NNCA 3NS5A 2PLPA 3ZZYA 3R1HA 2XNRA 1H2VZ 2DGWA 4C0OC 1U1NA 2E5JA 2AYBA 2X1FA 2U2FA 1X5SA 1FJEB
chains in the Genus database with same CATH superfamily
1TKYA 2CJ9A 1KRPA 4MMOA 1MW7A 3NS8A 5KG7A 2E7VA 3BQ0A 3DRYA 3J9CA 2WZ1A 4XPCA 4EWTA 4LJPB 3WANA 1TKZB 2XMTA 3ETMA 3V6DB 3EE3A 2K1FA 4JV2A 1PC4A 5HJXA 2KAJA 4EK2A 3MAQA 3GOEA 2XBPA 1SPBP 3DYAB 2FTRA 2ZKUA 4QBUA 5G4DA 4PKDB 2N7CA 4S17A 2Y5CA 2QFIA 3SSRA 2BTEA 3ZTQA 1N61A 1OS5A 4OYIA 3QX1A 1RAAB 4B3MF 3ILOA 3DBHB 3ENWA 5M2RA 3H7PB 4JV0A 3DVNV 4X84A 3NGSA 5FD1A 2MQPA 1JCKB 1FWPA 4P10A 3V6CB 1WJ4A 1B0VA 3TUOA 1FFGB 4AT1B 1BD6A 1FXDA 3ZZOA 4F50A 5F8MA 4PYUA 4ITSA 2ATCB 1Q5VA 4JE3B 1E7UA 1HBOB 4WURA 4ZPCA 4DR3J 3DCGA 4USAA 1WHYA 4OI2A 2J7WA 2L0FA 2XMJA 8RUCA 2VPYB 1WGKA 4RKUC 2PN6A 5JXVA 1Z5SB 3BSOA 4I2QB 3N20C 4O23A 1DOXA 2VG5B 4ILRA 2BF8B 4NEZA 4RGNA 4N58A 4MGIE 2YKNA 5AJ3F 3ZO7A 3SCKE 2Z2ZA 4IC7B 2YNHB 1JLBB 2ZW1A 1NMEB 1U0SA 2CQ4A 2AEJA 4PABA 3SCLE 5DPSA 1XQIA 1KTVA 1FHTA 1ZXHA 1OYEA 4OJHA 3GQCA 3DHHC 3D67A 3F44A 1S1WA 5DPWA 2DT9A 3EICA 2PMHA 3C2PA 1G3OA 4U7UK 5AXNA 2KT7A 2HEKA 1MWYA 1MI0A 4LSNB 2J7QB 3CXCR 4TMAB 4TVAB 5E6JA 1HQ2A 3IS9A 1Z2MA 3KH0A 2GFFA 3MTKA 1T03B 1URRA 1UFWA 2C3PA 3PJ9A 3R8BA 1C1BA 2W7PA 2W3SA 2EVZA 4CM2A 4B3RJ 3N1XC 4TU9A 2IM2A 1U2RA 3M8PB 2HQFA 1NDCA 5E6NA 3SHQA 8ATCB 1FKPA 2XZTB 3UFCX 1RTIB 5GAEI 4ARIA 3ALBA 5G0RB 2GJFA 2MKYA 2UUCJ 4CT9A 3AY0A 5FKAC 2DH8A 1VZ7A 4ZJLA 2VH2A 3EDQB 2OTJS 1C0UA 4RO0A 4K1RB 1F9EB 4G1QB 3AQOA 1M1HA 3DLKA 5H1SV 3A3NB 2NTSA 1XJWB 4NYOA 3MGJA 2DENB 1FCAA 3AU5A 3QRRA 1GX6A 4X4VA 2W7AA 1HNIB 4P74A 3AB4B 1R8PA 1ZOYB 2KWUB 1X9SA 4Q2JA 1H98A 2W01A 4DR2F 1SJ4P 1FDBA 3ZRFA 2CQPA 1JX4A 2DGXA 2SXLA 2OLWA 4ZPAA 3OR1B 1CJUB 3GONA 1JWAD 2V50A 3Q83A 1GT8A 3VWSA 4G3IA 3P6YC 4NLXA 4ZYNA 1Q8LA 4A55A 3U1NA 3BVMA 3W1YC 4LFBJ 1XNRJ 2N4CA 4J9SA 3OVSA 3LP2A 2CHZA 4ATNA 4DCOB 1LWCB 2Q79A 3MHSD 3R97A 2M8HA 1NJYA 4PPZA 3RAXA 4LSLB 4Y3CA 4PRFA 4HT7A 3R5DA 2J0JA 1M1KT 1BWVA 3BWUD 5CZXA 2VFRA 3AD9C 3W9CB 5HATA 5IWAJ 1HYSB 1P9QC 2DK2A 2WSEC 2V8PA 1VRUA 2J9DE 1RU2A 1FEHA 3GU0A 1OFFA 2PIAA 2CZ9A 2WW8A 2CNKB 2QEXS 3CSKA 3OVBA 4HPLB 4ETZA 1ZTWA 2E5GA 3VRAB 3IFEA 3FJ2A 1YMHE 1JALA 3L7OA 3K5OA 2CJBA 2RR9A 3TRGA 4K7SA 3LP0B 2F4FA 2L05A 1WSVA 1NBFC 4HPPA 2XZDB 2E29A 4C4VB 5L1IA 5HROB 4OZNA 2DAJA 4FJYA 1YJ1A 3UQBA 5HMWA 2IO3B 5IT9U 2HNYB 2B6AA 4B08A 2VKZG 1WC0A 3R5BA 5BJRA 2OOBB 5G5GA 4O3RA 3IWLA 5EN1A 2H51B 5FLXU 2LVWA 3HZGA 2ZCCA 2UYZB 4XWWA 1SIZA 5BYQA 4ELVA 1EWYC 4HI1A 2AJQA 1X4BA 3CC4S 2R61A 3KLGB 5JZEB 2ACYA 4DQSA 2NUHA 1MJDA 1J2VA 4IOAQ 4CM0A 2DHSA 2XY6A 2F1FA 3PLVA 4DX8H 7FD1A 4B9MA 3US5A 4GLSC 4AFFA 1XO3A 3OL7A 2WP9B 1VZ6A 2AX5A 4R0EA 2KTRB 1CQVA 4LBIA 1NYQA 3PSEB 2AYBA 3WIVA 2R2SA 2U2FA 2WNMA 4PZVA 1LXJA 4WF9Q 2BS3B 4WJPA 3RULA 3ETRA 4ZVGA 1U45A 3V81A 2YKPA 1K44A 3GV8B 2KFKA 1E10A 2ZFHA 2LEAA 1LO5D 4KIAA 2R2UA 4EGLA 4FKXA 2DHHA 5HLFB 3OFFA 1VQSA 1IN0A 2WXRA 2QMWA 4GOCA 1JRPA 5LNK1 3BZDB 4DCJB 5HVHA 4AL6A 1C78A 3NY5A 3BYYB 3SCJE 1S6QB 3KLFB 3SDEA 2CQBA 3I5JC 2AJ1A 6FDRA 3AEDB 2OEDA 2ASQA 3AXMA 5DPTA 1V5TA 1VR6A 2LECA 4JLCA 3QCAA 3I9V1 2DHZA 5EE3A 3CPWR 1XR5A 1RWVB 5IC6B 4A3OA 3OSNA 1RTDA 5M2UA 1FRHA 2VA2A 2LHEA 2ZPNA 2QC3A 1XN9A 2CYYA 3WC2A 3ILIA 2W1BA 3GFHA 4TLRA 4JI5F 5GAEU 1C2PA 1HD1A 4ZVQB 1N62A 1SSNA 3SXLA 3ONSA 1IBKF 4Q2LA 2PEBA 2ZOGA 1V6HA 5J2MA 4IH5A 4IUFA 4NOHA 1R0BG 1X4EA 5BYSA 1P27B 3UD3P 1IR0A 2AF6A 5B7WA 1D8YA 4YTMB 2RQKA 1I94F 3TWZA 4W98A 1Q8KA 4GVLA 5IM0A 4NLOA 4DQRA 2DLBA 4RW8A 3RU0A 3PHTA 5EX3A 3RPFC 2BJ3A 4JI1F 4K4VA 3BN7A 4NXMJ 2N4DA 1W25A 3SFUA 4CH0S 5J1EA 1LEOA 1FRIA 3EVMA 1G6BA 2PE8A 2OSQA 5AZHA 5DGBA 1ZA2B 4BCAA 2KKCA 4X66F 3H6NA 4NJCA 3C3LA 1T9TA 4ED1A 4GDKA 1VRAB 2MLYA 3TI0A 2DGOA 4K7QA 2NZ4A 5CZVA 3TJAA 1NPRA 4OYXA 4BKSA 1N56A 3TEGA 1N32F 4RNNA 4FA6A 1U0HB 2BA9A 4D2KA 4ZP9A 3CIMA 2YKMA 5E3CA 2BE9B 2MMYA 2B9WA 4ZPTR 2IJRA 1JLCA 3GFZA 4KSLC 1CSJA 1PYSB 1RT3B 3DOMB 2E5LJ 3PEHA 3ZJTA 4P2MA 1K73T 1E5WA 2DYOA 5IC4B 2CPIA 2GVDB 2RPVA 2M70A 4KVGB 1HMVA 4KR0B 4ZCLA 3VVUA 1KF6B 4NE9C 4CQNA 1NSAA 1FI4A 4C8ZA 1S1TB 2KYWA 5CXTA 3VVTA 2W2OP 4M01A 3VGUA 3FRYA 1IBLF 2VQFJ 4LBPA 2W4DA 4GKJJ 4XAKA 1J0GA 2XYPB 1H38A 4TQSA 3QLHA 4ILLA 2Z2YB 4X65J 1NSKL 1T6BX 2XS2A 4DV0F 5I42A 2CPDA 3URYA 2ZZTA 1H3DA 2DGSA 2KK8A 4PG4A 2DRBA 2LEKA 1UVMA 1HKAA 3FZBA 4HVBA 4RBUA 1S9FA 3LYYA 2HSEB 3PFOA 1OTRB 1C4PA 3FEZA 4DQIA 5HI7A 4TYAA 5A6WA 4DR1F 3IGVA 4RW6B 1XEEA 3ML9A 3CDUA 4XO0A 2FVRA 2KVQE 5E0OA 3ISNC 3V05A 4DL2A 5F8GA 1RJJA 2NXEA 1SKUB 1DLOA 3MECA 1A5RA 2MY8A 3KUZA 3RZAA 3QWPA 3EX7B 3RB4A 3JSMB 1UNSA 5L1JA 4MIWA 1F5CA 1JROA 3ZNZB 4Q43A 2B4UA 2JSVX 5HMZA 4JI0J 1SE3A 4X64F 1HHSA 3NCRA 5DETA 2ZBQA 2Z30B 1U7LA 4BFRA 2BJ7A 5K8PA 2EFGA 3S8SA 2OAUA 1OYDA 4KFBB 5FIIA 2L41A 1QJHA 5CYQA 4QJVA 1VIXA 4CLZA 2MRPA 2KFNA 1R27B 4PWUA 2A2CA 5GMDA 2FBWB 2HTHA 4BBNF 3ZC4A 4O3PA 2J9EA 1GB1A 2IA0A 3O13A 1HNZJ 2OPSB 3O8WA 2BM0A 5A8WA 3WC0A 2I0XA 3RBDA 3OJ4B 3EDRB 3G82A 2CZVC 3RNEC 2QLWA 2JRIB 4AXIA 4WIPA 1R8AA 5EGYA 3DRRB 3VAKA 4EOYA 2LJ5A 2IC3B 4ICLB 4DBGA 4K2JA 2DBBA 2Y5BB 4U7CA 3IHPC 2NYIA 4KKOA 4QWEA 2YXLA 4RUBA 3IR5B 2BEFA 2CRLA 2D3GA 2ZD1B 2HPUA 2ZVIA 2VZKD 2FVSA 3J7ZT 3TJ9A 2NPFA 3UIOB 4K4WA 1NBEB 2LDYA 2C3UA 4X4NA 3VTUA 1F6TA 1MHHE 3G71S 1Q0WB 2KH9A 1VRTB 2XSFA 3GJQB 3D32A 3QYYA 4LF4J 2ZWPA 2HHUA 1SCJB 3TIXA 4C6AA 1R8HA 2LMCA 2OGUA 3M9OB 5KTQA 4USKA 2N7DA 2QC8A 3G6VA 5F3ZA 2GQQA 1SJ1A 2FHJD 3A8JA 4B95A 3RBZA 4DV2F 4LQ3A 4L76A 3DC2A 3U2SC 1KVJA 1YJVA 4W9IA 1UWMA 1D1UA 4G0NB 3CJQA 1JIHA 5C25A 1IBXA 1RK8A 2HQ3A 4RW7A 3KK1A 3Q89A 2MBHA 2DPIA 4GDLA 2HIYA 5THWA 1GK8A 3D7SB 5JXSA 3UCUP 5J2QB 3AULA 2C3OA 3AA8A 4KPCA 1NK0A 1XCTL 1LW2A 2ZEQA 2BJ9A 4DSFA 1EETA 2FDNA 2INNE 1XBWA 2J9DA 2ZHBA 3ZW3A 3FK4A 4IRCA 3LGMA 1OY9A 2DGQA 1L5UA 4IM0A 2M0GB 2W9AA 3DRSA 1SUQA 1TY0A 2MJUA 2ZE2A 2L83A 1KNZA 1PYWD 1WJ9A 2OEKA 1TL1A 2W8LA 1ZW7A 4QQBA 2RE1A 3EZOA 2E9TA 3NVVA 2HS3A 2A0FB 3GTYX 3AE3B 4N77A 1P8GA 4M8NA 2LXCA 3HHLB 4MIBA 2MQNA 2KLCA 3Q23A 4FBUA 2G4BA 1EP4B 1D5ZC 3VAJA 4UOFA 4PAAA 3SR6A 2B3TB 4NZ0A 4C0BA 5KG5A 3MM8B 3DLLQ 4FYDA 4RM8A 3MD1A 1T0QC 1VQ4S 4QCLA 4USWA 1Q7YT 2ILZA 4CLKA 3A13A 4EZKA 2FCNA 2C42A 4C8MA 3W8PA 2RJZA 2QZ8A 1WJ6A 2G1DA 4JI7J 2F40A 3HJFA 3IRXB 2IMWP 4CLTA 5KFWA 2ZZMA 3GIKA 4LQ9A 1EAYC 2VF3A 1CG2A 3G8SA 1U26A 2K39A 3E51A 3D3BJ 2CADA 1FESA 2QX0A 2M4NA 5IOIA 1EZZB 4DR7J 3TAMB 2JEJA 2N9PC 3W2WB 3P4RB 5HK4A 1JKHB 2W9NA 4MEMA 1VCTA 3W1YA 2BACA 2KMMA 1RAOA 3I55S 3AD8C 4DHZB 2FIDA 2M0AA 1IVZA 3EZUA 3AE8B 2JZ3B 2MQQA 1VQ8S 2L08A 2J0MA 1STEA 2BV3A 1UELA 3JVZX 4PS3A 3DGPA 4NXNJ 4L3NA 4ZVOB 4FF3A 1IJFB 1JWSD 4DV6J 3I0SA 3HT0A 4K0KF 2E66A 3HSGA 1K53A 4CLPA 2BKRB 4A90A 1RT2B 4FXDA 4C8NA 4EMDA 2HE7A 4DF4A 1RGVA 1NK5A 1XMOF 1B0TA 1QOAA 3HSJA 1S77D 4WP9A 3H2LA 1S12A 1HQEB 2CZ4A 2ADCA 5KFHA 2G0JA 4PXDA 3KUHA 5A6PA 2V68A 4I6NB 2NR0A 4W9HA 4DV4F 2PGCA 5A0YA 2B9YA 1F2GA 3EFCA 4IFVB 3NS1A 2LJIA 2OPPA 2GJ2A 3MXHP 2G2ZA 4ZIWA 1PDXA 3CMAS 5D94A 4HKZE 1TR0A 1FRXA 2MYFA 4ZHRB 3VDZA 1T8EA 3FMBA 5G5HA 4RF0A 1RACB 4UQTA 4JI6F 2BGFA 2YVSA 2QT7A 1S0MA 2WHIA 3ZZPA 2O6VD 4B0MA 1RKIA 3MD3A 3A9JA 1TMMA 3PIOQ 2K06A 4W9FA 1D5MC 3EVWA 2CG8A 1T0TV 4URSA 3BSNA 4CP5A 4Y00A 2LGIA 2AEFA 1C1CB 4A9AA 4OHZA 1V5OA 1VBYA 3QJJA 1BQNA 3UN3A 4JUZA 1GNUA 1SV5B 3OPKA 1GB4A 4WAAA 3C15B 3B54A 2FY8A 4YSYB 3JSRA 3UD5A 4LF8J 2E3TA 2VFUA 1I5OB 1AT1B 1SL2A 5F3TA 3D0HE 1ZA1B 4REZA 3Q3NC 1SH0A 2ACMA 3W2VA 2EFPA 3HKWA 3RYLA 3BB5A 1FXAA 2XTJP 1HBMB 2BDPA 3GIRA 2I2YA 3RRGA 2YNGA 1EM7A 2AQ2B 3I96A 5M2PA 4ILMA 1JLEA 4MAKA 1RT4B 1UFKA 1YQHA 2AGPA 2KZZA 2YEPB 4K4YA 4HH1A 2NQPA 1RA6A 1UW4A 4U8YA 2AGQA 2H1YA 3PX6A 2AQ1B 2XMWA 1F9HA 3M95A 5CX3A 1FTCA 3C46A 1QAJA 1S10A 5IP4D 4F4AA 2DVIA 3W5VB 2PFFB 3ZNJ1 2EW9A 5KFEA 2LEBA 3RN9C 3OTDA 4J9MA 3QFHA 4DF8A 2G4SA 1J5OB 5IWAF 2LWPA 3LA0A 2C7HA 2CQ2A 2RKIB 1FD2A 5CQGA 5KOXA 1NRKA 3W61A 2MZ1A 1UUPA 1UWXA 3FKYA 2UXBF 3M2UA 3CD7A 4JOUA 2YEPF 2XNQA 7AT1B 2VRRB 4FPIA 4KB7A 1HW8A 1UWBB 1DBDA 1TKZA 1KLUD 3HKZD 3V6DA 2DNZA 1HBNB 4IWQA 2QILA 4JB8B 2JZ5A 2CWXA 2RS2A 1UTAA 3DYAA 1G7CB 5KFGA 1S0NA 2UZAA 3I0RB 1WX9A 1YQBA 3CCZA 3QQ8B 4MK7A 3PVLA 2R8GA 3FSXA 4ES1A 4H4MB 4YMEA 4B3OB 4QOTA 3NMRA 2YPZA 3C6UB 2LP4A 4HDGA 3TANA 4DZ6A 3T5JA 1ZAVA 4NL5A 2Z4PA 4BKTA 5E3RA 2AL3A 3MR5A 2VPWB 3N6NA 3CCQS 3D6HB 1Z2LA 3H1UA 4HTJA 1TP7A 3PM9A 1HZ6A 1SF0A 2KWVB 1CEZA 3GFYA 2BE7D 4TQRA 1IKVB 1XK8A 3AFGA 4IYQA 1WDDA 4KV2A 4HT5A 1TKDA 1ROFA 1EB0A 1RBOB 3TA2A 3PV8A 1HBOA 2J6UA 4UZCA 5C42B 3CJ4A 2P5VA 3GPAA 3ABVB 4KY3A 1YIJS 3Q8AA 2MKKA 4HL9A 2ROGA 4YTPB 3P8BB 2OIHA 5E7OB 2HQIA 4I2QA 1OPZA 3ZZUA 4WFAQ 4OI6A 1FFVA 2VG5A 2HZVA 2FC9A 4TUUA 3NWRA 5HL7Q 1WDTA 4RNMA 2YNHA 2N7EA 2HK2A 4R5PB 1K9MT 2NR2A 1XWLA 2GZOA 1I4XA 1NK6A 1K0TA 1WKJA 3R5JB 4EO6A 1X31C 5LMNJ 1L3UA 4KHPF 4JI4F 1FRDA 2EMSA 1M4VA 1Y9OA 4MTPA 4LSNA 3RBXA 3DHIC 3OUYB 3IR6B 2KZRA 1P1LA 2XB2D 3KK3B 2B76B 5HQ8A 3TR5A 4PUOA 4OYMA 3MFGA 2F8MA 2CQIA 3Q14C 3K5NA 1TK5A 4LR9A 3O1LA 1UMJA 1T03A 2W24A 4ID5A 1S4EA 1WC6A 4KH1B 1KLNA 2BJEA 2DGVA 5LSOA 5JUMA 3PTFC 3HHLC 2IGHA 4MGKE 1SC4B 5C3JB 3P4QB 2H65B 4I7FB 2IYIA 1ENFA 5KFZA 1WEZA 2DR6A 2F3JA 2M5YA 2NSCA 1YX6B 3BO3A 5LXRA 1RT7B 1RE1B 1T9VA 1RTIA 3DMJB 1MG4A 5G0RA 3M62B 4EUTA 3P3DA 3MURP 2C3YA 3NOCA 1U6FA 2Q3PA 1U6BA 1SIFA 3HDSA 3S7RA 2MY7A 5I4DA 3NWGA 4RNFA 4DL6A 1S97A 1HTQA 3PX4A 1M5OC 1BMLC 2C3MA 2ZPYA 1TUGB 4O1NA 4G1QA 2OEMA 3NEKA 3UN2A 2XEXA 3D54A 2VA3A 3T5HA 3Q8UA 2FVPA 3MP9A 2VBXA 2V63A 3TVYA 4XE0A 3ILLA 1GJZA 4FVMA 2HHHJ 1HXYD 3OR1A 1CJUA 2WU5B 2K9XA 4CRJA 3B0AA 4Y34A 2HBYB 4DSKA 1S9GA 5CD4A 4JI8J 2L52A 4F67A 2LZ6A 4LJOB 5L1LA 3EA6A 1G6JA 2K22A 1LWCA 5CCMA 1MFWA 3M6UA 1S4FA 4FYVB 2XSJB 4WP3A 4EBCA 2BKOA 3Q2AC 1NU4A 5HHDG 3K5MA 4E0DA 2IGDA 4DL7A 4LSLA 1V1OA 3P5BP 2EKYA 2GA7A 2QIFA 2AKWB 2RQMA 3OR2B 3ZZZA 1TT5B 5HMYA 3JSVB 1QM9A 2ZZNA 2F9DA 4LF9F 4WTYA 3GZ7A 1ZETA 4UT4A 4TYBA 2ZJPQ 4J91A 2VQFF 1SBRA 3V6EB 2E6XA 2RMLA 4KTQA 4KIKB 2OKQA 2R8KA 5GMKa 1YD8U 2MLZA 1P7EA 1JXLA 3J80Y 4QW9A 4LNFA 1LV5A 4F0MA 1WORA 3PKMA 3HULA 5CH7B 3QPIA 5ETSA 3WAPA 1B70B 3LP0A 4B9SA 2KFZA 4ECTA 3DFEA 3IMQJ 2KTQA 4HPMB 1NZAA 2DR7A 3A4SC 4C4VA 3P49B 3IT4B 1RWXB 4QIVA 2CVIA 5HROA 2GO9A 4EYHB 3WBZA 2C2EA 2CQGA 1BC6A 3FC9A 3BQ1A 2RF2A 4DX5A 3QSIA 4RW9B 3OG5A 3AB2B 1F0XA 4B3TF 4USMA 3KFWX 3W65A 2L9WA 5D2MB 2JQRB 3MMBB 4A4JA 4J9QA 2RGFA 3JB9k 3AEBB 2PKOA 4DXAB 1X4HA 3NUHB 2O1PA 3IXQA 4CZCA 3NBPB 3T6BA 3R5GA 1SH2A 1EUVB 1V49A 1N5QA 4J7CA 2Y0SD 2M1MA 4IH6A 3KDOA 5T41A 2HGMA 4TY8B 2WXHA 1FPYA 1T95A 3T1HJ 1SBBB 5E6OA 3C6TB 4HWIB 2K3UA 3U8ZA 4Y28C 2HRYA 2Q1LA 3I6PA 1FNUA 2YQ1A 4LLGM 2VU5A 2B5JB 2Y3YA 5HP1B 4B9VA 3CT9A 4N56A 2A4ZA 3GZNI 5HLFA 1VQPS 1NK9A 5F8NA 2RRAA 3MMCB 3CCJS 2L48A 2X3GA 1YRUA 4CI0B 3MFIA 4KGKA 2GBKA 1RB0A 3KLFA 2B3AA 3HVWA 3VUXA 4NX9A 3H25A 3APCA 3M1VB 1Q1KA 2E5JA 2OJWA 2B9EA 3QK0A 5D78A 5KFAA 2XCAA 1JXEA 3PZDA 1E8ZA 1YJ7A 2HZAA 5FR6A 4DSLA 3DBLI 4LUBA 4QIWD 2BYFA 2BQRA 2WVFA 3KMQA 3RUBL 4XIUA 3TYTA 4AE5A 1JXVA 2PI5A 2KT5A 2R7TA 2ROPA 3IGNA 3ZDTA 4E71A 1YGYA 4DWIA 3KDNA 4W92B 3ZVVA 1IGDA 5D0GA 2DPJA 1VBXA 2Z58B 3SEBA 4FP9A 5IFMA 1SQFA 2FE8A 4BZAA 1MU2B 2GIRA 1K1QA 4NMLA 1GMVA 5EUHA 4CLLA 1Y8RC 1TMJA 2GHVC 5KFPA 3MEGB 4GO7X 1HIYA 2KHDA 3TZXA 2HBQB 2X38A 4NLVA 4YTNB 1Q81T 2OPQB 1FNMA 3ZXWA 2V3SA 2CHWA 2BB6A 3WX8A 4MT1A 1RHUB 5IZHA 2BB5A 3Q8VA 2N9XA 4PK1A 3SIPB 4X4SA 4ZN1A 3A1QB 3ML8A 1DFDA 3AJDA 2ZBIA 4OQJA 4PQAA 3TW0A 4O3OA 1SC3B 1U0HA 1N8RT 2YTCA 2AJ2A 4HYKA 3AV8A 1DARA 5ETKA 4DV3J 4V1Ak 3PHWB 3HXMA 4WBFA 2IVYA 4WU3A 1RRBA 5IV4A 2PA8D 1OQ6A 2XULA 3DCAA 3DOMA 2RILA 2NBWB 4R8UB 1HD0A 2GVDA 3PDNA 3UR0A 3G6YA 3L17A 4LRFA 4C8LA 1F1HA 2NTTA 3OXFA 2LGXA 3NG0A 1NZ8A 3EGWB 5H9FJ 4C80A 1S1TA 2R7UA 4JV5F 3VGVA 2DY9A 3ONQA 5ETQA 3M05A 4J6IA 1NH7A 3APFA 3HI9A 3HMJG 3QIPA 4GU2A 4ZP7A 4P2SA 3QWUA 1FNXH 1N5YB 1IPGA 3G8TA 2N9LA 2D07B 5GXGB 5D0RA 1HR0F 3UWTA 3VAMA 2CJAA 4YDDB 1RT1B 3HVTB 4Q2MA 1JQGA 4MSMB 3N0VA 2KACA 2LA4A 3MMJA 4N76A 5GAHI 4WFYA 2KJVA 1CS4B 3QAUA 1KLGD 5IXUA 4DR7F 3MDFA 2E7XA 1GNKA 2INDC 2V0GA 1WELA 4LNIA 1RWWB 2KDOA 1U47A 4RW6A 2QG9B 1HW9A 2DCLA 3BBCA 5KFBA 4PXBA 4A8OA 5DRKA 2C5LC 1F9FA 1A0OB 4OZ5A 3MFHA 1HNVA 1VYAA 2XNAC 3N28A 3SV4A 2HVHA 1QE1B 3UF8A 4DEZA 3JSMA 5EX0A 1WGRA 1XTZA 1WF1A 4GC7A 1TK0A 4FXCA 4QR0A 3HLUA 2ZH5A 2LVPA 1UETA 1YVFA 3GE3C 4UQGA 2C60A 2JOQA 3C8YA 1U09A 3HHEA 3W1SC 4IFYB 2X51A 1SE2A 1YJJA 4KFBA 4DQPA 2H89B 4YWGG 3UN5A 3QC8B 4MK8A 2CJOA 2A6OA 4PT5A 2OPSA 3UO0A 2DB1A 1DTQB 4UUXA 1IKYA 2OPRB 2DEJA 2X1GA 1PGZA 1JLFB 2WU2B 3Q2SC 1ZPWX 1MWQA 3W5ZA 1TS3A 2I9SA 1W26A 3AH7A 3T8MA 3BGUA 3SFGA 1KSPA 2FLPA 4ICLA 3R7RA 2GIFA 1Y11A 3AODA 1VC0A 3BKUA 3HM9A 1UGMA 1TKTB 5AXLA 3CCES 1C77A 4B9KA 2VQEJ 4II3B 3G87A 3ENQA 2ZD1A 4OX9F 3VF0B 1V1PB 1RQ0A 3ZJVA 3MM5B 5LJ5Y 3Q8EA 3CF6E 2GAHC 4DV7F 4JYAF 1UZHA 4M8LA 3J81j 3ULHA 2BM1A 2BANB 3CEDA 1VRTA 3UCZP 3GCWP 3CD0A 3LW5C 5ADZA 3CC2S 4ED6A 2V2QA 1GXUA 4WWOA 3GJRB 2ZNVB 1U25A 1J19A 4FS2A 4JP8A 3D1HA 4O4GB 1YN3A 1TQLA 1TK8A 1AWDA 3AECB 3DBHI 4F36A 3N79A 2R7QA 2D3AA 4J9UE 5K8NA 1LW0B 4N8NA 2X1AA 3ZRCA 2HHXA 4CO1A 4WXOA 4IWPA 3EYZA 1Q8IA 4HACB 4ZVRB 1QAYA 5KG4A 1QOBA 4RL1A 2D2QA 1WC3A 4X2BA 4J9RA 4OZJA 3UDVA 2J42A 5BMHA 4I2PB 3Q22A 4P73A 4C48A 2K25A 2RDGA 4RFBA 2JEFA 1GEHA 5J2QA 2V8HA 1ET9A 2C9WB 4UUWA 1N52B 2IBKA 2C2DA 4BKSD 1FVQA 1D9AA 3PR4A 4ECZA 1UVNA 4FYWB 1T11A 2PW9A 2OMLA 5LMUJ 1NHKL 2DH9A 1RAIB 4MM3B 1S48A 1IWAA 1CBKA 5A2QU 3CJKB 1B0PA 4WJBA 3DHWC 4YHHJ 2X1FA 1X5SA 3TX0A 2BRKA 1PQSA 1KLMB 2AIRB 4P1BC 2ZUAA 4W9LA 1UWAA 3KUGA 1TAUA 3CCWA 2AYGA 2V8DA 4YP3A 5JHAA 1RADB 2E5HA 2KT3A 4OI1A 2WHOA 4DPWA 2WWZA 4B0EA 3RI7C 3HHLA 3PACA 4ZK7M 1EP4A 4PPDA 4B3SJ 3GLJA 2DZIA 4YB5A 3MM8A 3W7BA 3Q2TC 4FADA 1JMLA 2INCC 3DLBA 4WJOA 2XC9A 4DDGD 3HUIA 1RUSA 4RJVA 2HQDA 1RWMB 2RDJA 4JI2J 1AZSB 4YT0B 3EZ5A 3H5SA 1UEVA 4YEAA 5HBMA 3T1YJ 2GIQA 1U8SA 3KLIB 4O44B 4A3PA 4ZA1A 3IRXA 5MAOA 1IM4A 1H2UX 1WH3A 1ZAWA 2P2CB 2L1AA 4K4SA 3KUCB 4K8RA 3GYNA 2KD0A 3CJTA 3NZSA 5J18A 2VBWA 4ZP6A 2KDBA 3RUIB 3W3SA 2KQ7A 1RWKB 3TZZA 2NLWA 3DM2B 5D3DA 1QVGR 5I3QA 4EYIB 3POTB 1QQRA 3TAMA 4MELA 1UEKA 1IYFA 2ASYA 3Q6BA 3W2WA 4HHHA 2CNOB 4N9F4 1JKHA 3T5LA 4CO0A 5DDRC 4M1KA 8AT1B 2R7XA 2CU3A 2A6MA 4DS5A 4DQOC 4RZRA 1F5BA 4ZLNA 1E7VA 3FBCA 2LDIA 1UH6A 2BW7A 2MXYA 3M8WA 1Y0HA 3IR7B 2YNFB 2L7RA 1S3SG 4MACA 4PG6A 3LOUA 1FRMA 5BR8F 5F8JA 4XC2A 1RT2A 2LQ8A 1Y5NB 2OO4A 2W3RA 1BWEA 1T3NA 4W9CA 3RNGC 4AL7A 3E8OA 2MGZB 4MYUA 1WY8A 1HQEA 3LO3A 3PRBA 1ZE3D 2LUMA 4IKGA 4IFVA 2UUBJ 1KTQA 4XZ4A 3TO8A 1Q79A 2BRLA 3N9YC 4OHVA 4ECWA 1RT5B 2QA4S 4U9RA 2HVIA 3HVZA 4ZHRA 2M9KA 2GC8A 2ONQA 1KWMA 1JWBD 2KWCA 3GB1A 4O3SA 2BUNA 1AN8A 2KO3A 2M2BA 3MCOA 1AFIA 3X1LB 3D6MB 4NJ6A 3SSSA 3GJSB 3FDSA 2LLZA 4CWBA 2V1YA 3AOCA 2KL8A 2Y3AA 1I51B 1C1CA 3JSBA 2FY1A 2WXPA 3IBWA 3KLSX 1EQMA 2P6SA 3DWGC 2KTFA 2CQ1A 4C11B 2XMAA 2R2OA 3C15A 1HWJA 4QWDA 2GS8A 1M90T 3FSYA 4ALZA 2AEHA 4K7WA 3I5BA 3N6MA 1HBMA 1JRUA 3FFIB 4KDIC 1NDLA 2FGCA 2CDQA 1VISA 2D41A 4CNYA 1RWSA 3LWLA 4ZDNA 4M5JA 1RT4A 3CDAA 4OFZA 1R7SA 1NNDA 3RBEA 1XEZA 2N4FA 2W4CA 4P6QA 2LVOA 2UUWA 1FCLA 3EWGA 3PVXA 3NS6A 2M88A 2AT1B 4OV6A 4IWOA 2KU7A 4ANVA 5CA5A 5KFYA 4C98A 3TUZC 3RB6A 1ZPVA 1JLGB 4JI3J 2H5EA 4ECYA 3DLGB 2XMMA 2K3IA 5LLIA 1FEEA 1X4GA 4X62J 1YBAA 1J5OA 2C1EB 3APDA 1RM6C 1OQRA 3GE8C 4EZJA 4ZN3A 2D7SA 2BQQA 1CK1A 3A4RA 2RRNA 1H74A 1HPZB 3M2RB 1UA1A 4FN2A 3X0WA 1ZM4A 2K7JA 4OI4A 4H4OB 2XWYA 2MKCA 2CJXB 1D3ZA 1SJFA 1XMQJ 2VL1A 5A8RA 3OL8A 3MHZA 1R43A 2LU2A 2GQCA 4KKJA 3IT6B 1HBNA 2JRHA 2PEAA 1BE4A 4KO0B 4U96A 4ZOHC 3B2FA 2HK3A 2CNLB 1VCBA 1RLFA 2V67A 2EC0A 1UPPA 3FCVA 5GAGI 2WXKA 5GMEA 3VV2B 2PMVA 1NHVA 3I0RA 3VTIA 2DKOB 2DR8A 2DX5B 3RD2A 1V80A 2CS4A 2EI5A 4V19J 4QIFA 3M30B 2WONA 4H4MA 3NGDA 3A9KB 1BQMB 1FDDA 2XG8A 2CFXA 4B3OA 4PXCA 1WSPA 3HO1A 4H54A 4ZIVA 2BPSA 1ZM2A 1L7YA 3C6UA 1B7YB 3CCMS 2VPZB 3ITHB 2Y1JA 2CKWA 2FHOB 3OFEA 2HHWA 1RT6B 1U24A 1CQNA 3JYTB 2R2RA 3VAHA 4YXDB 1IKVA 1Q5YA 4DR4J 2ZNVC 1TUWA 4DLGA 1WM2A 3O6QA 3CJ2A 1IBMJ 2UUAF 2QHOA 1FJEB 3A4TA 4FPRA 2DISA 3TQEA 5C42A 1HWKA 2JF5A 3BVZA 2O67A 3ZUNA 4EFAC 5D6JB 3OFGA 4RX6A 2DYAA 3EJMA 4ZKAA 5F8LA 1YITS 1UEUA 2GBMA 1YOVB 1UFLA 3H2UB 1NAQA 4DUTA 1ZZFA 5T7LB 4B02A 3MAAB 4R5PA 2G9HD 2Y0BB 1DGJA 3FRZA 4DR6F 1Q16B 3EUB2 3CCSS 4ZVHA 5DCNA 2BYCA 3TVZA 2LQ9A 1HLWA 2ZM6F 3CJSA 3CGIA 2JLEA 3TUJC 2CJNA 3D28A 1EKSA 5DJBA 4DV1F 5IA7A 5KFSA 1HNXF 1YJNS 1HNWJ 1XCQL 3VHQA 4MGZE 4KV8A 3KLEA 4ED7A 5IKCM 3OUYA 2GMIC 1XXGA 3KK3A 1KM7A 1KDNA 4FULA 1ET6A 1WOPA 1C4AA 4DPTA 3X3UA 2ZH9A 1VQOS 1YJTA 3IG1A 3PW4A 3I5AA 5DGAA 3MPWA 4ZRKA 4DL3A 2OI2A 2PIIA 1TFWA 2R42A 5HVFA 1WXVA 2HG4A 4WJNA 3Q8YA 1RTHB 3Q86A 4I7FA 2V4RA 3W63A 3CNQP 5A76A 4ZPDA 3CMMB 1RT7A 2CXEA 5AUKA 1KFYB 4IM3A 4A46A 4OW0A 1N33F 2J9CA 3GYGA 3MC8A 2E1RA 2OD4A 1KFSA 2QA1A 4A8YA 3TZWA 2VC1A 4CTAA 3LF0A 2H5JB 4A8XC 2VODA 1K51A 3UINB 4C7ZA 4USJC 2HLTA 1CPZA 3K5PA 3QJZA 3MM9B 3CD6S 4NLGA 2Z2MA 4B9NA 2HRTA 1XR6A 3W1SA 4J90A 2XO7A 3DN9A 1N0UA 2VONA 2G0IA 2B9XA 1Q82T 3HFZB 4LJMA 4KGRA 1NEEA 3J7YI 4G1IA 4P2FA 2XMVA 2HWIA 3VGSA 1VQLS 1N34J 5KT5A 3VFKA 1YWXA 1J7AA 1FIQA 4L74A 1X9MA 1TL7B 4NAMA 4BS2A 1P6TA 2OP5A 2CPZA 3GSDA 1Z2ZA 4DFKA 3OVAA 1REVA 2XSJA 4RWWA 4L23A 2IRYA 2VH1A 2K5PA 3OR2A 4DLEA 3IA0A 3AE1B 2DNGA 3CDEA 2AJ0A 4GKKJ 2KQSA 3MM7B 3WA0A 3RT3B 1N5XA 3OV7A 3M8RA 4M02A 2GAGC 3LANA 1DTTB 4KIKA 4IDKA 4FHKA 1RTJB 1UZDA 5HQMA 2KG1A 1GQEA 3V3XA 2ZBPA 3WALA 4AYBD 1NJIT 2AJ4A 1UVJA 2WVDA 3LP1B 5GAGU 3AOAA 3MEEB 3KK2B 1TYGB 3HVDA 1ELOA 2WOMB 3Q3FA 3R5CA 3FUYA 1NLKL 2DIUA 3M8ZA 4HLEA 2IRXA 4NLUA 3W62A 3O5TB 3PO4A 1VK3A 2RDBC 4AUQC 1Y5IB 1JLQA 4G6VB 3RW7A 1YQ4B 5HI1A 2RU3A 1WOOA 2CPJA 5CTRC 2IPKD 1FT8A 2J0SD 2QRRA 4ICVA 4I6WA 1HI1A 4OHXA 4CLSA 1T3QA 3X23A 2NCNA 3SV3A 5LM7E 2MZSA 3MMBA 2DNKA 4TSSA 4LVNP 4A8SA 2D11A 2MPUA 2QSFA 1PAEX 4GXBA 1ESFA 4HJGE 4FS1A 1WR1A 1ZKHA 2EK6A 1XNQJ 1VC5A 4ECRA 2JVCA 2FUHB 2VUGA 4IQMA 2YKNB 2OJRA 4WWSA 1ZTTA 3Q8SB 4UOGA 1ZPSA 4EE2A 1ZM9A 1EIYB 2ZVSA 4W4MA 4TY8A 4GVBB 4PEOA 3L09A 4LR8A 2G4DB 2UU9J 3A1YG 3C6TA 1PGBA 4QPXA 2PEHA 4X4PA 4C7QA 3H7SA 1S1WB 4WZQA 2W2QP 5IT9Y 1VMBA 2SEBD 2B7CB 2DWQA 1S79A 2B5JA 5HP1A 2MP2B 2WSCC 3EXCX 2LRUA 3CC7S 4F8RA 2G2OA 4ERDA 2Q6BA 3RNBC 3MZIA 5D3GB 5FLXY 1S72S 2IO2B 4OX7A 4K3BA 2MH7A 4PCQA 5GADI 2CDRB 3D3CJ 4LFAF 3ZZ0A 3AE9B 2CJQA 3M1VA 3BK1A 2PMWA 5IV3A 3W66A 5A8KB 1C1BB 2HYIB 1TS5A 2ACZB 1Q8BA 3L7PA 3PW7A 1UJ6A 1D8ZA 1SXLA 2WXMA 2HKEA 1TTNA 3DHGC 2V2ZA 1FO4A 3R6GB 2BABA 1N54B 4P16A 3ISND 3K5LA 2V3PA 1F1BB 1WD6A 3VTVA 2YKOA 2JSXA 2HIQA 3CMQA 3MPUB 3Q3MC 3CCUS 1FXTB 2FJDB 1UJ5A 3W5UB 4I6YA 3NNCA 3NHEB 1MU2A 4NZ7A 3G6XA 1T0YA 1FFSB 1SQGA 2FCMA 1DQ9A 3SYZA 4YR3A 1WI6A 1V3SA 3ZXVA 2YLMA 3IFWB 5K14B 3DOKB 4LF7F 3ENEA 2XZWA 3C16B 1T7PA 1PYTA 2F63A 4URKA 3PLUA 2OPQA 4AJWA 5IS2A 3J7YU 2QTWA 2IBOA 2ZITA 2LXAA 2FJEB 2DO4A 3M32B 1YX2A 3QZ7A 2EPIA 3GS2A 2XY5A 1TZ1A 2WB4A 1CJKB 2ATLA 2DNFA 4NZLB 3A1QA 3LP2B 3DKDA 2FHMA 3GSIA 3UDCA 1W2IA 3OJ3A 1XR7A 3NOGA 4MT5A 3T3NA 3MM6A 2HFSA 3KUDB 4L3KA 3J7Z5 4MKVA 3HD1A 4ELTA 3KJFB 1NO8A 1VC6A 4C3LA 3D9BA 4OVUA 4HDQA 1WXSA 4W9EA 3TJPA 1R0AB 2AL6A 1LXDA 2B4VA 1NKEA 3R2IA 2D69A 2KO1A 3E01A 5IQ6A 4R8UA 2HRUA 2ERRA 3ZQ4A 4ID8A 2FHKA 3N1YC 2KN4A 4JBCA 3EGRA 4RU2A 2KMAA 4CH7A 1SKSA 3ZJUA 3BH6B 5F8HA 1R31A 3U4EG 3FVYA 3P4SB 2FJXA 4JI2F 4EUVA 2CAJA 3OXGA 4DK5A 1IR2A 1LNQA 4ED3A 1GMUA 2WDVB 2V9KA 4BOSC 3T1YF 1N5YA 1FFUA 4BWMA 3L16A 2CPXA 3AEGB 2KHWB 3K8VA 4MJKA 1V86A 1UVLA 1RT1A 4CQ1A 3HVTA 4LREA 1MPEA 3BSAA 4FNHA 3MEDB 3BVGA 4RM9A 4Q45A 2J76E 4CIOA 2DRAA 2B6AB 3OTBA 1GUAB 2O2VB 4GC6A 4B3MJ 1VD2A 3R8YA 1CS4A 3DU6A 3KHLA 3TAQA 5AUIA 3V61A 1WF9A 3IRWP 1FRKA 4M5LA 2KLGA 3PCOB 4IUMB 3VH3B 3PFEA 5BMGA 3P45B 2JLGA 4RWXA 5LXYA 1S76D 2V5HG 1U4AA 3ZFVA 4RUAA 4FBJB 3QJLA 1Q1OA 4PXEA 1QVFR 1AB8A 2ZH7A 4F4ZA 3VHTC 2W25A 3U02A 3DXBA 3ENVA 3FGVA 4ZRPA 4NLPA 3MTJA 1C1YB 2UXCF 2IHR1 3AOBA 1H4RA 1SJHD 2JUOA 4UTGA 1KONA 3TA1A 1UBIA 3PS6A 3IAS1 1F77A 1X4AA 4MFBB 2AJFE 2JWUA 3I56S 5AJ3J 4IFYA 3EM1A 1A70A 2M56B 4ED2A 1QAXA 1WX7A 2Y1LB 3SEOA 4US9A 3BEGB 1E6VB 1QOFA 4GO5X 2UUBF 5GADU 3DLHA 2F4VF 2MBBB 3KUEA 2MA9B 1DTQA 4NAWA 2OPRA 5ETTA 5TSSA 4WK1A 1LFWA 5IO9A 1JLFA 1GC6A 1WMHA 4MSQB 3W9IA 2NS5A 2V34A 4XTTA 1RTDB 3VXWA 3P2BA 5DQHA 4RGTA 1RISA 4LNNA 3I32A 1KKHA 5KFLA 4LR7A 4RH6A 4XYCA 1V6EA 3W9HA 1XD3B 3WZ0A 2NCKL 5J2MB 2X7IA 3TEXA 1RLCL 1SEBD 4RGMA 1J8CA 1Y5LB 3UGBB 1SH3A 3DDNA 1V1PA 4HLBA 3MM5A 4F1SA 1HQUB 2ADBA 4UZBA 2BANA 2PMZD 3QQCD 4RW8B 4NRTA 1X5OA 1S5ZA 2WSFC 3FQLA 2G13A 3OLBA 5AE3A 2FUG1 1HFEL 2PI4A 2AQ3B 1PC5A 2LXIA 1WM3A 1T0RC 3LB8C 3I4HX 3Q8BA 3F56A 1IXKA 2OHFA 2OHDA 1ACCA 4DI6A 4GDKB 5KOWA 3FQKA 4HACA 2YWWA 3PYGA 2KX3A 2Z56B 4U6PA 4FBTA 2CA9A 1MG8A 2EFQA 2FZCB 5KHQA 1IBCB 3KYLA 4KRWA 4C0HA 3QATA 4P75A 1UW9A 3AAWB 2ZH8A 4I2PA 3R3TA 4A8FA 4ANXA 3Q3JA 4NCGB 3FBFA 5DZ7A 4RBVA 1LWEA 4C97A 3DLEB 1WYGA 3MC9A 3PRVA 3BS9A 4RBTA 1I42A 4MM3A 3VGTA 3DI6B 3VALA 5FJ4A 4W9DA 1VHFA 3FILB 2J0XA 2HWTA 1GPXA 1KHWA 4QW8A 3CJKA 3H4DA 1R7IA 2J8SA 1OQQA 3I9ZA 5J2RA 2LEPA 1KLMA 3H8HA 1L3TA 4AQYJ 1WGYA 4K50A 3OD2A 3V4IB 2EK1A 2R8HA 2J0QD 2BKNA 3HIZA 2H9ZA 3NLCA 2PE6B 2HGNA 3FCWA 5D4OA 2VG6B 2IYGA 1R8BA 3W5XA 2K1RA 4LBHA 3I57A 3JQKA 5I42B 3H40A 1X7VA 1C3TA 2JHEA 2MZRA 3PRMB 5L39A 4NCAA 4WIIA 3T9ZA 2IFXA 3MUTP 4OHWA 5SUHA 3U1LA 2K7KA 5KFMA 2XNRA 4KX6B 1WC5A 1YN5A 3ZDMC 1TUVA 3I3TB 3PTWA 3MR2A 2DGWA 1U1NA 5HANA 2PSZA 3JYUA 4YY3F 4M94A 2FJVA 4O44A 1Y3JA 2HNDB 4A8XA 2XLKA 3RCZA 3CJ8A 1NI2A 4YUDA 4J9PA 2YH0A 3RJMB 1RU1A 4ZS6A 2MWSB 3DQVA 2MHJA 1LFPA 3N30A 1VIOA 3DM2A 1I35A 3POTA 1N60A 1DLOB 4DZDA 3GWCA 3SQGB 4DR5F 3BO4A 1TV6B 5BXIA 2DH7A 4M63A 3VAGA 3M8SA 4A8KA 3HFVA 1OWXA 1EU4A 4X4UA 4KT0C 4M5DB 1QY7A 3O2IA 3QRQA 2KVRA 1WG4A 2GJIA 1WF0A 3SFEB 2B7BB 1OQ3A 1T9XA 1AFJA 1J5EF 1W2BR 5E3PA 2VHGA 4DPXA 3T9NA 3DXSX 2OJ3A 5IOLA 2QEJC 1N88A 3IAM1 3Q8RB 3PZ7A 4OHJA 2A2DA 1FCCC 1ZDXA 2JC0A 1AROP 1RCOB 4IOIE 3T3OA 1OJ4A 3H42A 2MGZA 3QMQA 1CMXB 5J2PA 3G82B 2O5DA 1VGYA 1DOIA 2AX1A 4X4RA 4TU7A 1FM0D 2UP1A 2DYMA 2ASJA 4AS1A 4NYZA 5KFTA 1I3OB 5B0EA 1ZZNA 3V6JA 3NVYA 2E1CA 4F4YA 4LDTD 4KQZA 3QJPA 1N5WA 4DU7A 1GAQB 4FJVB 4LRAA 3AT1B 1WTFA 4DXFA 2F8HA 4P7VA 5EDSA 2XLJA 1NDDA 1DHMA 2I1JA 4F8CB 2BKFA 4JI5J 4ZVPB 3WX4A 1GOZA 1IBKJ 2CKHB 4DU8A 4WQMA 4LT6A 3PW0A 3GJTB 4LF6F 3DVNU 1WC4A 1SKWA 2QYGA 2WXNA 3VR1A 2KANA 3E2EA 3J7AN 1FJGF 5ETPA 5KT6A 1Y00A 3J7A1 4C11A 4ELUA 3PPAA 1AYFA 1I7HA 3OBIA 3OTOJ 3JQMA 1Y4ZB 4JI1J 2AYMA 1EJ7L 1KS2A 4Z7CA 1Q86T 2ZBCA 5IT0A 4K4TA 2BWFA 1WOSA 4UDUC 3N4WA 3KK1B 1FERA 1NKBA 4GDLB 2NREA 2WX1A 3FFIA 3QAQA 5F9LA 4XDDA 1S9EB 4DS4A 4EFOA 4QIGA 2W7OA 4E3CA 4LTUA 4OHYA 1TBEA 5C1ZA 3OHBA 1N32J 1VZ8A 4KGXB 4KGSA 2UVUA 3IAS9 2CPEA 4RW4A 1JJ2R 4A20A 1RAFB 2ZE2B 3G4SS 3JAMU 1HI0P 1X1MA 4KZCA 1J7BA 4PWWA 1WHXA 2JX2A 2Z8QA 4WTOB 1M1GA 2F5GA 2KQ4X 1JLGA 4IG0B 2JRSA 3TBLD 4KSKC 3KYCD 3DLGA 5LOQA 2H5IB 5MPOA 2HFVA 4KYZA 4Q7AA 2KDEB 4YB1P 1RWOB 2J52A 3RR8A 2PVOD 4KZ0A 4KAIA 2ZJQQ 4MKAA 1X5TA 4K4ZA 3NNAA 4TV3A 4XWTA 2HBRB 1NDKA 3EUNA 2MBOA 4USHA 4WKYA 1SB6A 2E5IA 3UVJB 4YN3B 2IZVB 4UY85 2V8GA 3M2VA 3HHLD 3IC1A 2HHVA 1HPZA 3M2RA 2K0PA 4H4OA 3IXSA 1VQNS 1Q4RA 3K0JA 2RU9A 2DAFA 4DV0J 2R4FA 2VFTA 1FWKA 4US8A 3SFDB 1IM6A 4GB9A 3GMGA 1B9RA 4FYYB 3BJYA 2ZBRA 4GSWA 3U7DA 1YIWA 4OYAA 2A10A 2HHTA 4KO0A 4M5NA 1R89A 3MAHA 2J7KA 3RNAC 1TS4A 3A8IA 2PTLA 2VKRA 4BLGA 2HNZB 1PIEA 3O65B 4DR1J 2P6TA 5AZFA 3PO5A 3M30A 2UXDF 4PWDB 4QYZJ 1LM8B 3ET6B 2FUG9 3A9KA 4CLYA 1BQMA 1EO6A 1WYWB 2QO3A 4IQXA 3VQIA 4RU9A 1VK8A 1KTKA 4NWBA 1BGXT 2ZKTA 1F3VA 2GMJA 3Q69A 3ITHA 3MEKA 1IP9A 3NAHA 1KQFB 4YL8A 1RT6A 4IR9A 1T9YA 4J9LA 2CHXA 2AWZA 2YKAA 1TVRA 1JWWA 3DGPB 1FE0A 1VQ7S 4OZCA 1WRIA 2D3O1 4F02A 1Q53A 2G2YA 4L73A 4NRUA 2MQLA 2D9PA 1MVKA 4R0JA 1CQMA 4X64J 4ZPWR 2KI2A 2I38A 4YB7A 1YSJA 2XO6A 3I9V9 3GP7A 3UCGA 1NM2A 4FNIA 1RHRB 2KJWA 4ZHPA 3ZO5B 4O4RA 2KN5A 1KP6A 1WIAA 4OVVA 5KT7A 2NXJA 2XEWA 1RHKB 3PEJA 2UUTA 1TIFA 2D1CA 2JYTA 2BMBA 2DHAA 1FXLA 4O0IA 5KT4A 3OSPA 2XHCA 4AUKA 2HHSA 2K8HA 4ZCMA 2DNNA 4ZCKA 4ARCA 5T7LA 2W54A 2CIMA 5D77A 1FJ7A 2MQJA 4BVUC 4C0OC 3MJWA 3PY8A 2IY0B 2QCZA 5K20B 2HBZB 4CLUA 3M63B 3V4MA 5DQGA 1T5XD 2OSRA 2YWEA 5J2NB 3A9JB 4ZCIA 1K1SA 3A3PB 5KFJA 1U1RA 2G9OA 4ZP8A 1FD8A 3M6XA 5D0EA 2N3LA 5LT5A 4UW2A 1TL3B 3W2DA 2WVBA 1P1AA 2DITA 1GMWD 4DR3F 2Y8YA 4N47A 2GHPA 4OZBA 3V2UC 3SU8X 4N8OA 1Q5WB 3EVOA 4K5SA 4MH0E 3G2XA 1P1TA 2WBMA 1JLAB 1HE8A 3DBSA 1RTHA 2GNKA 4A8QA 1AXQA 1VQKS 1WXMA 3CWJA 1UKUA 3ZKJC 2DGTA 3CE8A 2HURA 2H88B 3OL6A 2XK5B 2EKNA 5CYMA 2W2NP 2YNGB 1RFAA 1HA5A 4I6AA 5B0AA 4FDFA 2AZ3A 1R4NB 5I3PA 3MM9A 3VZIA 2GI9A 2RRBA 3RRHA 3T1AA 1U02A 1GC7A 3BO2A 4JPSA 3TEWA 2B0GA 2FGOA 2WQYB 2XBBC 1I4QA 2WXOA 2VOOA 3TA0A 4DDID 1YJUA 3G86A 1U4BA 2LMIA 3HX9A 3IAM9 3JTOA 2QLBB 3I4PA 1D9FA 4B3RF 1V9OA 1T94A 2DHXA 4LRDA 4WCEQ 2O01C 2L9NA 4FHJA 4ETXA 3ZZRA 4C3KA 2ZDOA 2ZC3A 5DDOC 1XMBA 3OHAA 1L3VA 5C24A 1P9YA 3IM9A 3PR5B 2UUCF 5E41A 3V6KA 1QZEA 1DAXA 3PJWA 3M2UB 4MJSB 1AA1B 3UNYA 4WFZA 2WTFA 1KBRA 2YWGA 4V19X 4B9UA 4HVZA 2M8SA 3VRBB 3MM7A 4F7VA 1ZS6A 4HCPB 1WGDA 1RLDA 2RS8A 4W9JA 1M5VC 1DTTA 2N3OA 1QTMA 1RTJA 2C2KB 1KOOA 3LGHA 3FKBA 2Y1IA 1C76A 2V9WA 4Q8FA 1PO6A 1L0YB 3FAHA 3LP1A 3MEEA 3KK2A 2JU6X 1MROB 4ENOA 2WOMA 4OLOA 1NB2A 4WKRA 4BBNC 2OELA 4ZVTB 3NY0A 2D3OR 2YH1A 5FDLA 4K81A 4ED8A 4LFBF 2PT0A 1XNRF 2ZWOA 2MKIA 4M5GA 5DS7A 4KGTA 2KMCA 3IVFA 2DNPA 3D4JA 5DLGA 3T9LA 5AE2A 3PRDA 4TN2A 1KQKA 3K9PB 2CPFA 4X4TA 2MKHA 2IAJB 1NJWA 1V5IB 3TQ1A 2GHWA 1ROEA 1E7PB 1CLFA 2W9CB 3DVGX 4II2B 3MC0B 2IJNA 2CQ0A 3QRPA 5ETRA 1VOMA 2MKJA 5L83A 4WZMA 4TKNA 1HHTP 1RKJA 1UCNA 1S49A 3CB4A 5ETNA 5L95C 2ZH1A 4OYWA 5B08A 3G6ES 3BH7B 2ZNYA 1M94A 2KX0A 4G11A 1OEYA 1ZBTA 1AW7A 4WAFA 4QWCA 4K0KJ 3E3XA 4KKIA 2DEIA 2D3CA 3H8YA 3Q8PB 2MSED 2REXA 3WAMA 2EEYA 3GP9A 2ZHOA 1XMOJ 2HQGA 1J27A 2IY1B 3BR8A 1XIQA 2IDLA 4GVBA 3JQJA 2ZNZA 1HWIA 3LJ3A 1FWLA 3UQAA 3NG8A 4DV4J 1DZ5A 1V97A 4Y6IA 1GX5A 3MCMA 4FKYA 4NPOA 4DDFA 4JV1A 1WZ0A 2MP2A 3RNCC 3BYTB 5RUBA 1AW0A 1V2YA 2IMOA 5KFCA 3ZTCA 5D3GA 3AD7C 3H7PA 3AM9A 4I1TA 4PUOB 3NZUA 2WXLA 1PAUB 2NPIA 3I31A 3D1QA 4JI6J 4ID5B 4ZYSA 1ZM3A 1H73A 4NEYA 3MR6A 3UPFA 5A8KA 1E8WA 1JJ4A 3ECIA 4FZVA 4NLQA 1L6VA 2JWZA 3M3JA 2FCQA 2X1BA 3UI3A 4FN5A 1T0SC 1T9WA 2MSTA 1Q10A 4DUYJ 3HK0A 3LUYA 3N3KB 2C7NB 3PXGa 2J6TA 3ELHA 5LL6d 4DN9A 4NLTA 3MCSA 3V5RA 2EBGA 1NK4A 5DDQC 1URNA 3KNAA 1JWUD 3QSYB 3HHKA 3U7ZA 2WS3B 3EC8A 3OWEB 1NEKB 2JYEA 4Z7YA 2RDIA 5AXMA 2EWHA 2WDQB 1R4MB 1G1XA 4WYWA 4J37A 2DNLA 1TY2A 2QA4G 1JLBA 5AE1A 1WTBA 5K14A 3RB3A 3DOKA 1XERA 1YBTA 1RABB 3CCTA 2FIUA 1TKGA 3PYDA 5IN7A 2NXNA 1TELA 2K8CA 4ZRJA 3C16A 4NA1A 2HFZA 2KNBA 5SZTA 4PYZA 1DQAA 1C4CA 2HJ1A 4J9VA 4C8KA 1H7XA 3RW6A 2AP6A 4WFBQ 3M32A 1S9GB 2OFHX 3BPDA 2R8IA 1RSCA 1YX5B 2LHDA 2WK4A 6AT1B 5K8OA 1CJKA 5KFFA 3BREA 4LF1A 3KJQB 5F0WA 4OYPA 2NYHA 1QAIA 2JFDA 4O3QA 3ZZYA 3R1HA 3LGNA 3VCDA 1O8BA 3DBRB 2VFVA 2RNEA 3HP6A 3Q8QB 3BGRB 4F2RA 1LWXA 3CIRB 4AQYF 1DYQA 2POKA 2QMUB 3V6HA 3DVGY 3PREA 3M8PA 1NHUA 1V5VA 4OX8A 1UD7A 1RHQB 4QZVB 1RTZA 1P7FA 2MHEA 4PYAA 1R0AA 2EC2A 2AMCB 1O6XA 3CCVS 1QSYA 4WPAA 2ON8A 3L10B 1S57A 4AOFA 2UXBJ 1B64A 1RI7A 4NXMF 1TFYA 5HQLA 4PG5A 2RPQA 2JH3A 1D4BA 1VDHA 1WACA 2KWDA 1YTYA 5F0UA 4ANCA 3R2TA 1QDUB 1HNIA 2WB1D 1U49A 5KFRA 4CYEA 2ROEA 5I3UB 4ED4A 1TL4A 3TSSA 2GRIA 3H98A 3MEDA 2RF2B 2PDAA 3QO9B 2ASLA 2O2VA 1WX8A 4YB6A 2W4PA 1S1QB 2HFNA 3KJVB 1FK9B 4FXWA 1U1OA 4KBIA 1LFDA 1FRRA 2E5LF 4ZMMA 3MCNA 2M17A 1YDLA 5E6PA 2MQMA 4RUCA 4DBQA 2JEIA 2QN6B 4USUA 4CO4A 3P63A 1HYSA 5H9EJ 3VTWA 1TAQA 3TEYA 4GKJF 2VBZA 1AUDA 1UBQA 4X65F 2D3UA 4OYOA 1VQ6S 3LQVA 3PZPA 2A18A 2MJNA 5AT1B 2H4YB 4LIWA 3IWNC 4MFBA 4A47A 3R1LA 5EWEA 1ZOTA 2NBVB 2KT2A 2G1HA 1HZ5A 2R7VA 4RMAA 5KG6A 3S6EA 2KG0A 4MK9A 1JK9B 2K6QA 1X8DA 2XYHB 1FKAF 3PRZA 2KRRA 4QU7A 1VJWA 1L6UA 1UVIA 1X4DA 3K7RA 1E6VA 3K17A 3MPDA 3CF5Q 1RZMA 3BINA 1SIJA 2QL5B 4KHPJ 9ATCB 4JI4J 2HNYA 4DN0A 2NSBA 1UZXB 4M5MA 2ZDPA 4URQU 2CWKA 2E7WA 1PSDA 2NVUI 2RD0A 3PKYA 4GMVA 1NB7A 4X57B 4OJ1A 1HEZE 2XWXA 1WG1A 3CJ3A 2V4QA 3QHTA 4HDOA 3L4BC 3M8QB 3KLGA 2JVOA 2L32A 2NPTB 2B8QA 2XYGB 3RTVA 2JFKA 3K58A 2D3ZA 4J3OD 4PG7A 4JI0F 1VLBA 1FXRA 4N7TA 1AARA 1AUSL 3R27A 1D3WA 2E9ZA 2DNRA 4Y2KA 1YNTE 1WFYA 5GMVA 1HQUA 4E98A 3OAWA 4I0WA 3M6VA 1FA0A 2LASA 1M0SA 2KTRA 3P4PB 3KLHB 4WWMA 5CHWA 5E3QA 4ECSA 1ZYQA 1C0TB 3I5CA 3OTOF 3B1LX 4QIEA 1XLPA 4K4XA 2GX8A 2M7SA 2GQ2A 3DRPB 1SJQA 4O0NA 1HNZF 3A8EA 1SJED 2MEKA 5LSLA 5TR5A 2H3EB 1X5PA 1OGWA 2KKHA 3OL9A 1IKXB 3G9CA 2HHPA 3B4DA 2WW4A 1S6QA 3RZWC 3BGFA 3HF5A 1RAEB 4WP8A 2GB1A 2MJ3A 4NCGA 1YQ3B 4CLFA 3AI5A 2EELA 3VAFA 1YZ7A 3LAMA 1U1LA 2PA3A 3DLEA 4YR2A 3QGGA 4LIRA 3ZNUA 2GMHA 4H4KC 3GIIA 1NJXA 4NA3A 1E90A 2C22A 3HD2A 3DI6A 4TQ1A 4KPYA 3FILA 4NCBA 3T5KA 2KC2A 1E6EB 1EARA 4HK2A 2AHOB 4LF4F 1A9NB 3BSCA 1EU3A 2R2QA 3B4MA 2FPHX 3H20A 2ZH2A 2RSUA 3D6TB 4LF5J 1KVKA 1ZDVA 4LF9J 2IA6A 1S99A 3ZTOA 3V4IA 3DHXA 2GBNA 2BE2B 1VHIA 4DJBA 4FF2A 3AH6A 5DM6Q 4DL0C 3QIPB 2JZPA 3D1OA 2MJDA 2ZJDA 3AU4A 2DNQA 3NNHA 1DQ8A 2VG6A 4EU0A 4IW0A 2G45B 3TL5A 1TKXB 1ZAXA 2CQDA 3OJUA 3AN1A 1XLOA 2DIVA 3KHGA 1PBUA 1S6PB 2XGPA 2L76A 2P8IA 1DOYA 2EG2A 4B9TA 2IJ0A 5BMIA 4I6PA 4P7IA 2HNDA 2VDHA 4ES2A 4YOEA 5JJBA 1WGHA 2JZZA 3HHNB 5CYJA 3EHVA 1EX8A 1FNWA 5A2QY 1N63A 4S0MA 1BUIC 3QGPA 4LNOA 3V60A 4BOZB 4B3TJ 3N6LA 2PD1A 3AA9A 1F2RC 1TJEA 1HNVB 4DUZJ 1WEYA 2DCUB 2INPE 4LRBA 2AU0A 1FVSA 1RT3A 3SQGA 2OUGA 5J1NA 1TV6A 3DDKA 4ITKA 3C14B 3HZEA 1E6YB 4IM2A 1SGHA 4F4WA 4HTIA 1I6JA 4M5DA 4R3DA 5DZ6A 2FNJB 2KB2A 4HR2A 3KQ4A 5JHBA 2PJHA 1FDAA 5IAAC 4OIXA 4AWJA 3CSTA 3HHDA 1KOTA 4BC9A 5BO4B 1F5AA 4BHQA 5KHOA 2Z8LA 4JI7F 3FEXB 4DMZA 5KFKA 4M95A 1FKOB 2VD3A 4OI0A 3TMPB 4EEWA 1Q95G 3A3OB 4I4BA 3ZNHB 3KHRA 1IKYB 4F25A 4AXJA 2GMLA 3WDOA 1L5PA 2VASA 4LDTB 2EBEA 1JB0C 1IUJA 3ADAC 3VR9B 4HH0A 5L9XA 3JSYA 4IDIA 2DO0A 4QYZK 5DQIA 3V62A 4W9GA 3EGZA 3L13A 5LXHA 3MPYA 4IG3B 5AZGA 3MMAB 2GW8A 5EE1A 2FVCA 2K8BA 3CWIA 4Q5VA 3R2DJ 3D6FB 3HSZA 4DFPA 4ZJOA 1FX2A 4P7TA 1Y10A 2BOAA 4GGQA 2HDEA 5MLCV 4Q44A 4YR0A 3RRKA 2IDYA 1LGRA 2DYBA 1L0VB 2YY3A 4NXNF 3DDIA 2KVIA 2KRBA 2VOPA 4OLPA 4DV6F 4DHVA 4LF2A 2Y9HA 1VQ9S 1WNEA 4N41A 4L72B 1NVID 4G50A 1R8CA 3CJ0A 4RLEA 2MQ8A 5B0GA 3KG4A 4ICUA 4DX6A 1J7CA 4EZ9A 2OFGX 3QWZB 2KOXA 2DXFA 1TS2A 1N6QB 2D10A 1M5HA 1NI3A 2J8AA 2ZVNA 2N1VA 3TZYA 3HRDD 1N48A 4OYZA 3U7JA 2BYEA 5L46A 3ZNGC 1S9EA 5L38A 4BKGA 1FXIA 1SB3C 1R0CB 2COLA 5KFVA 2W8KA 4F04B 5CD4H 2QJ3A 3DRRA 4E2FB 1OO0B 1T02A 1SI9A 3ILJA 2VZKB 4HXDA 1BUXA 2IC3A 4FYXB 1FRLA 4EI2A 4CNZA 1LQBA 1SXTA 2IVFB 4NLDA 3OLMD 4ZLPA 2QL7B 4GRSA 3H59A 5EHHA 2HMIB 3IM8A 1TTHB 5KG2A 2LGDA 2QFJA 3QA8A 2XS7A 1N5VA 4JX1C 1FE4A 4IG0A 3TX8A 2N1WA 2HWHA 1WJNA 2B56A 4TKTA 1K52A 3KWMA 1YLXA 5F8IA 3WQPA 1D9DA 1CZPA 2Q6CA 3NL0A 4LF8F 3L54A 4LNKA 2V6AA 3UVJA 3IWXA 4JV5J 3CMES 1HBUB 2D9OA 4I67A 3MJ5A 4CYUB 4FF4A 3NP5A 1RYJA 4L75A 3R7NB 3G96A 2L00B 5HBMB 3NRBA 2ASDA 5LJ3Y 3ZLZA 4K59A 1NSPA 1KHVA 1HR0J 2EKEC 2C2ZB 2JPHA 2V3NA 2UVVA 3KYDD 2A5UA 5HSPA 1H72C 4M5IA 1L3SA 4CO7A 3E9SA 2I5JB 4DL4A 1KVIA 3VQSA 2VPXB 1KQGB 2HNZA 5IT4A 1YJ9S 4NLWA 1WI8A 1HARA 2JL9A 4LCDE 2B4PA 4PWDA 4F4XA 4ZRQA 4BC7A 3ET6A 3CO9A 2YVCA 1KQSR 2ALZA 4QYRA 2G0CA 3PNIA 3SSQA 3FC4A 1IR1A 3KTQA 3SQOP 3F73A 2UV8A 3MR7A 5L8RC 2AX0A 2LXFA 1UP1A 3PW5A 3JW0X 4JGHB 4CCHA 2LQBA 2Y1RI 2BYTA 3L0WB 3MPVA 3FEYB 4RR5A 1ZXIA 2YNIB 5CHFA 3OTEA 1R6YA 2A3JA 1WKKA 3CO0P 3FZ2A 1ISNA 1G4CA 1PJ6A 3GYXB 3SMZA 3DPDA 5KFIA 1XC9A 4KGVB 2MHNA 2ZH3A 3CUNA 2ICIA 4Y2AA 2Y8WA 3RYTA 3H5YA 4MYTA 1U2FA 1NENB 5EWGA 2Q5WD 3KXDA 2R7WA 2AV5A 2HW3A 4TLQA 2XHWA 4MIAA 3BDEA 4A8MP 1NKCA 4ANEA 2LI5A 2PFDA 2EMTA 2J0WA 4DHJD 2V4JB 1GFWB 2NXCA 4H2AA 1ITPA 2L8JA 2W9BB 2YX4A 3KVFB 3HSDA 1D0EA 1TL5A 3R7BB 2F7VA 4AD6A 3EGVA 1B1ZA 1U1MA 4OVZA 5J2NA 4MGYE 2XQCA 4BDPA 3KW5B 2KDMA 7FDRA 4K2XA 5KFQA 2V94A 2MCNB 4ZPBA 2RDDA 4DUYF 3TUIC 4OX9J 2WYQA 1TL3A 1QLBB 3WCQA 3L4PA 2R7RA 1PJ5A 3CD5A 4OZ1A 5KT2A 3CJRA 5DO2A 4DV7J 4JYAJ 2IDEA 3C19A 2N7YA 2BJ8A 5HO4A 1MMLA 1YN4A 2DD8S 5E3AA 1T05B 1JLAA 2PLPA 4NI2B 4AQ7A 3TCAA 3ZGZA 1CJTB 3EXYA 2XLIA 1BY9A 3H9DA 1R6VA 3HHMA 4Q8EA 2XK5A 2WLBA 1GTHA 5U47A 2KJRA 1CC8A 5LMNF 4AP4C 3AXCA 1FX4A 2IVMA 3HK2A 3THVA 1K0VA 1UVKA 2YX1A 3K89A 2D74B 3I87A 2ZH6A 3NVZA 4XGAB 1CULB 4OZAA 2O6VB 3UNGC 2CQ3A 3A33B 1BXTA 2H54B 3FBEA 1F2HA 1HWUA 5HAOA 3L95X 4RF1A 1WSRA 3NCPA 1M5KC 5D4LA 2FC8A 3PYEA 2FZKB 5D4NA 1VLOA 3DOLB 2QIEB 4C00A 2RHSB 5CABA 4M0WB 3CULA 3D0IE 3IP0A 1CJVB 2AYOB 1GG3A 2GBRA 1SV5A 2QL9B 2LVQA 1UJ4A 1S7IA 4MJSA 3CDBA 3AB5A 3QIJA 3W64A 3RG6A 4X4QA 3P5TL 5A8RB 3SI8A 3U30A 1O0PA 1YZ6A 4OMFG 2BT6A 3NGUA 3RAMA 2IO1B 1F52A 5EDWA 3KWVA 2WXGA 3P42A 2DTJA 1YK9A 4RPFA 2HHHF 1MROA 5C23A 3B2GA 4F0HA 2PC6A 3ZYYX 2HVZA 3NZ3A 2WONB 1X60A 3OJSA 2FVQA 4W90B 4JI8F 1FRJA 1RP5A 4Z37A 4CHKA 1H8CA 1HHQA 4ANUA 3NAIA 2LRWA 2BXJA 1U1KA 1VLYA 1SL0A 5K9FA 3GV5B 3OLAA 1JMTA 2DR5A 5CHVC 1VS3A 1QTNB 2IAJA 3AEAB 2E1MC 4ED5A 4EZ6A 4LMZA 1FMAD 2NXUA 2KXHA 4ZVFA 2W9CA 1R3NA 3H7HB 4DG1B 3TNVA 1B7FA 3DNCA 3NXZA 4BWJA 4M5HA 4PQUB 4CO5A 4H4KA 2Z59B 2RKIA 4NZ6A 4DV5J 4LVOP 3JTPA 4TNOA 2QSDA 2GGPB 3AJ2A 4HI2A 3AE2B 2JC1A 2QLJB 1A6LA 2HD5B 1IKWB 5BR8J 1UWBA 4AL5A 1JQ4A 2W82A 2KHCA 4NPNA 3ZZTA 4UOHA 2J7UA 1IJEB 3AQPA 5T8IA 1FD6A 3FMWA 1RAXA 2HAFA 4NMXA 5L1KA 2BKPA 2IIHA 5CHCB 3P4UB 4ECUA 3K8WA 3AE7B 1N36J 3QBCA 3SCIE 4KDLB 3LALA 4KV8B 3KLEB 2XM3A 2XI3A 4CDIA 2P9GA 1S1XB 1RWPB 3PHEA 3SD5A 2CQHA 2YWHA 1SIWB 3QNWB 5KAKA 1NSQA 1NUEA 2VV5A 4LFCJ 3B9JA 3NS7B 2ZJRQ 3IBFB 4ZVEA 1VFJA 3IG1B 2PPHA 3VAWA 3BKTA 3D66A 1DY3A 3A8KA 3HCXA 1BT0A 2JDJA 1KC8T 4HKQA 2FLOA 5HG2A 1S59A 2DNMA 3MOZA 2GCFA 5H9EK 1OSDA 2DZKA 3QZ8A 3B78A 3CCRS 2K3KA 4OZLA 4P2XA 3MUVP 2VG7B 4WE1B 1L3KA 1MNEA 2ZH4A 4KHRA 3HFKA 2ZZPB 4ZPVR 4UY8T 4JIOU 3T1HF 4CTAB 5B09A 3PZ8A 4C9DA 4N59A 4DX7A 3GFXA 1IGCA 1Y7PA 2YWFA 3LAKA 1RAGB 2F8EX 4YQWA 3KG0A 1HI8A 1APSA 1S1VB 1PGXA 4Q0BB 2AGOA 2UWQA 4USTA 2PE9A 4WIQA 3S01A 4EBDA 1RYRA 2WDRB 1RXOB 4UF4A 1F0ZA 2BR0A 2MQOA 4CH1A 2IJFA 2DBYA 3HVAA 4M00A 3Q8FA 4B17A 1A7GE 1RHMB 3DDCB 3M7VA 1RFKA 2P9CA 2GVZB 1ZUD2 5HKHA 4DCPB 3K2YA 2KFYA 2UVRA 4BAXA 1REVB 2CU1A 2CPHA 4OZ2A 3PW2A 4DOZA 2J0KA 2WXFA 2YQ3A 3BGRA 1TGZB 3RMKC 4LF5F 1O51A 3U52E 4XK8C 4NLYA 1E0ZA 4DSIA 3L08A 3DMJA 2DHGA 1WE6A 3VVWB 4F4KA 4A48A 3GE9A 4P52A 1V81A 4Y2CA 4IDKB 1SVDA 1KLVA 1XLQA 3O3LA 2XGQA 4RNAA 3CW2C 1S1UB 2AYEA 2LQJA 2V8VA 3UW1A 1OY8A 5D7GA 4ZHOA 3THTA 1CJEA 2MTLA 1UGJA 5I3UA 2BS4B 1REGX 1I1GA 1JLQB 3T19A 1RAJA 1YRXA 1WKLA 4EZLA 3VH4B 4C8OA 4GIVA 2HZCA 2BVCA 5FK9C 2RT3A 4G3XB 4YSXB 1WUUA 1QF6A 3QO9A 3TUPA 4TU8A 4DV3F 1LWFB 3OQ2A 3MTNB 2LUEA 1KR4A 1MHXA 1E9MA 3KJVA 1FK9A 3NGTA 1FNVA 1PYOB 3RR7A 4DUZF 3RGIA 2VC0A 2JXXA 1JNZB 4MKBA 1SC6A 2CQCA 2YBVA 2APOA 2QE5A 2C28A 2XN9C 3B82A 2KXNB 1FNOA 4E74A 2JEGA 4U7UD 2D5GA 2FCSA 2V4LA 2I6WA 1QUVA 4RGOS 3UIPB 1SL1A 3GG1A 1N5TA 3JSVA 1VBKA 2R3VA 3WAOA 5KFXA 2QJLA 3EFUA 2ZUGA 4J9KA 4RNHA 2KVZA 2MB0B 2UUAJ 1X0FA 2NZCA 2F9JA 2EFVA 2ZEJA 4DSEA 4S0RA 3FCHA 2KXFA 3MHYA 4EO8A 3IG3A 3THPA 3HT3A 1S7HA 4NYPA 2R8JA 2LGSA 1MMNA 5JVGQ 1X4FA 4UOCA 3HVRA 4J9NA 3F41A 1E8XA 3GR1A 2XMKA 4J9OA 2HJ8A 2UV8G 4DHZE 3M9NB 3ZNID 1UAWA 5E5NA 3RZFA 3TEHB 9RUBA 4P6VF 4DR6J 4ZRIA 2CR5A 1IUEA 1KJTA 3JS9A 1HQRD 1KOHA 2M4MA 4DSJA 2ZM6J 1TZOA 3BF4A 4L6V3 2F65A 4DV1J 4DFMA 2BBCA 4FF1A 1HNXJ 3T6JA 3PHXB 4RW9A 5KFNA 2QA2A 3W9JA 2ILYA 2MLBA 5AEKB 2L3MA 2BQ3A 1L2NA 2ZOFA 2C2RA 3TJ8A 4YFUA 2JJ4D 4HJKA 2ZCBA 4QAYA 1LOUA 3R3MA 2JY6A 2WX0A 2I8EA 1RAHB 3N01A 2CJYB 3WIUA 3NBPA 3M8QA 2NPTA 1Q7LB 4USVA 3IO1A 4D3GA 1RWNB 5H9FK 1P98A 2LKZA 5F9NA 1EWCA 1T3OA 2FJAB