2KN4A

The structure of the rrm domain of sc35
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSHHHHHHMDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G, Splicing factor; arginin
publication title The structure and selectivity of the SR protein SRSF2 RRM domain with RNA
pubmed doi rcsb
source organism Streptococcus sp. group g, homo sapiens
molecule tags Rna binding protein
total genus 31
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kn4A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kn4A02
4ERDA 2KXFA 2MSSA 2HGLA 2E5JA 2XSFA 2YWKA 1U1MA 2JRSA 1M5KC 4IUFA 2QSDA 1YMHE 4FXVA 1YIJS 2ERRA 2M52A 5BMGA 2Q79A 1P7EA 3G8TA 5D77A 2MKJA 1MI0A 4CIOA 2DGQA 4P6QA 4ZKAA 4TU9A 2AYMA 1JMLA 2LA6A 5GAEU 3CCVS 1FJEB 4QPTA 1YI2S 1QVGR 1U2FA 4U67Q 2G4BA 4D2KA 3UCUP 3FILA 2JX2A 1K51A 5IQQA 4TU8A 1W2BR 1RKJA 3MUTP 1Q86T 2KXNB 2PTLA 3GB1A 2RVJA 1PGAA 1YJ9S 1C9FA 3H2UB 1L3KA 4QU7A 4OZAA 1JJHA 1F2RI 2MZTA 2KFYA 1URNA 3DLLQ 2OSRA 5DDRC 3CCSS 1VBYA 2LXIA 2V94A 4IOAQ 3VAGA 3ZZYA 2DNNA 4LMZA 1Q10A 2PLPA 3CC2S 2E5GA 1IGCA 2XS7A 4HKZE 2CPDA 2ZW1A 2WBRA 2LGIA 4OZBA 4CH1A 2CQ4A 2KQ4X 3U1MA 5IM0A 3CCMS 2RMMA 1WG1A 3G9CA 4PRFA 1YHQS 1X4CA 2DNGA 4IOCQ 3UE2A 2LXUA 1MHHE 5GAHU 2E44A 2LEAA 2D9PA 1H6KX 3R1LA 2KVIA 1U1LA 2CQDA 1GB1A 2JVOA 1PGXA 4UY8T 1X5SA 3DXBA 3UD4P 2KG1A 5IFMA 3UD3P 3VAKA 2MY7A 4TU7A 3Q2TC 1FXLA 1NU4A 2MQNA 1M5VC 2LMIA 4HJGE 5LJ3Y 4EGLA 2SXLA 1VQLS 3TP2A 4CQ1A 2M2BA 2FC9A 2OSQA 3JB9k 1WHVA 1U1OA 2GI9A 1MHXA 1KOHA 1R8PA 2DGXA 2CQ3A 4GLSC 3IWNC 3I56S 2MKKA 5H1SV 1O0PA 2MQLA 2KACA 3MD1A 1VQOS 2MKHA 1K52A 2K8GA 2U1AA 2YTCA 3G8SA 3CPWR 2N7CA 1MVKA 3THTA 2DO4A 1K53A 2X1BA 3VAMA 3PIPQ 2KWDA 2KH9A 3V4MA 2ZJQQ 3EGZA 2M70A 3NNAA 1Q81T 2CQIA 2AYEA 3BEGB 1KH0A 1QM9A 1WEZA 2CQHA 4C4WA 2MGZA 1FJ7A 2M8HA 5EN1A 2MJUA 2HGNA 2DGUA 5HFYA 3CCUS 2YH1A 2AD9A 1FHTA 1VQKS 4A8XA 3MI7X 4IOIE 2JZPA 3EX7B 2QA4S 4IKGA 2PE8A 2DNLA 4QU6A 3NS6A 3EGNA 2CPXA 4C7QA 2ADCA 1DRZA 4KGSA 5CXTA 2X1AA 5GVQA 2KDMA 3BO3A 2F9DA 1WF1A 5LXYA 2RPVA 2CPFA 5HI1A 1WEYA 1U1RA 3TO8A 2DK2A 2DIVA 3CF5Q 1SJFA 2MQPA 1K8AT 1DZ5A 2YH0A 2UP1A 4WH4A 1U6FA 1P7FA 4OZ0A 1SJRA 2FC8A 5ITHA 2J8AA 1N88A 3MD3A 1OWXA 4BS2A 1P27B 2KXHA 4KGTA 3S8SA 2IGDA 1N54B 1H2VZ 3IRWP 1Q82T 3CULA 1X4EA 2VOPA 3SDEA 1SXLA 2KU7A 3THPA 4WKRA 2JVRA 3VALA 1WG4A 3R1HA 3ZZZA 2J0QD 1CVJA 2I38A 1FJCA 3CCES 1VC6A 3MUMP 2KM8C 2JSVX 2J76E 2N9LA 2RU3A 2GHPA 1S72S 2M0GB 2ZW0A 1UW4A 2RNEA 1OPIA 5DM7Q 2DHSA 2HZCA 2X1GA 3G71S 2QMTA 1ZZNA 1WELA 1N8RT 1VQ9S 2LECA 2MJNA 1R8HA 1KC8T 2MKIA 4WFBQ 3R27A 3UCZP 2AYGA 4LIRA 3VAFA 1YJNS 1VQ7S 2J52A 2CPHA 1SJQA 1NJIT 2KM8B 5CA5A 1AUDA 1VQ6S 1ZH5A 1OO0B 1IBXA 3CCLS 2XS2A 2JXTA 1QVFR 2MMYA 1FO1A 2E5IA 2CPJA 3H2VE 4WFAQ 1X4GA 1WF2A 3CC7S 2GO9A 3S7RA 5HG2A 1HD1A 4LJMA 3FEXB 1YJWS 1WTBA 5HL7Q 2DB1A 2HVZA 2DNHA 4YOEA 2MKCA 5DM6Q 4MACA 3S6EA 4FXWA 1KOOA 2PW9A 2RS2A 1DHMA 1VQNS 2BOPA 2MQMA 1S79A 3SXLA 5DDQC 2DNRA 2KG0A 5JXVA 3I55S 5BMHA 3OW2R 3D2WA 1F2RC 3NS5A 3CCQS 2CPYA 3CUNA 1X4FA 2OTLS 3MURP 1WG5A 2MZJA 2QFJA 5BJRA 1H2UX 2EVZA 1X4HA 1VQPS 4F02A 3Q2SC 2RT3A 1X5PA 2HGMA 2DNOA 2CQGA 3UWTA 1FD6A 5IM0B 3V3XA 3P49B 4F25A 2MZQA 3J7YU 2NZ4A 1H2TZ 2ADBA 3G4SS 4OZ1A 4W92B 2DGSA 2LA4A 2M88A 2OJ3A 3UCGA 1JMTA 2D9OA 2RUGA 2D3OR 1WWHA 1JJ2R 1JJ4A 1WF0A 3HI9A 1HD0A 4YB1P 2DNYA 1HEZE 4W90B 2RQ4A 1U1QA 2N3LA 2ZJPQ 4F26A 2F3JA 3BO2A 2LCWA 2DGTA 2VOOA 2KT5A 2CQ1A 2FPHX 2I2YA 2GB1A 1D8ZA 4WFNQ 1WHWA 1M1KT 1P1TA 2L41A 2OIHA 1VQ5S 1EM7A 1UAWA 4OZCA 1RK8A 2MPUA 2RRAA 3NMRA 5MLCV 2CJKA 1HL6A 1WEXA 3VAIA 1FCLA 5GMKa 2MSTA 2KRBA 1PO6A 3FEYB 1DBDA 1HA1A 2XS5A 3P6YC 2EK6A 2DISA 2XB2D 1F9FA 3MDFA 2VONA 4TLQA 2X1FA 1X5TA 2JWNA 4WIIA 4Y00A 5DDOC 2MKSA 1IQTA 2DGVA 2OTJS 1D4BA 2A3JA 2G0CA 3CMAS 2DGWA 3CTRA 2OEDA 3CMES 2XNQA 2DHAA 3CCJS 1XF5L 3TYTA 2MGZB 1WHYA 2DNPA 3MOJB 1UFWA 1XCTL 2ONQA 2MZ1A 1SJ3P 2LKZA 2LUMA 1WI6A 4PKDB 5HHDG 3VF0B 4PR6A 2CQBA 3LQVA 1U1PA 2N82B 4Y0FA 1N52B 1VQ4S 1YWXA 2N7JA 1XCQL 5BMIA 1XN9A 1YNTE 1X4AA 2MQOA 3CXCR 3G6ES 1G2EA 2DITA 1PGBA 5JVHQ 2NMQA 2O3DA 2CPZA 1VC0A 1UWXA 2CPIA 3G96A 2ON8A 1FCCC 2BZ2A 1UP1A 3RW6A 5GAGU 2LEBA 4V19X 2MQQA 2LHDA 4YUDA 2CQ2A 5LJ5Y 1A7GE 4C0OC 2K0PA 3RW7A 3UI3A 2DO0A 2MYFA 2L08A 2MZSA 3SDEB 5LSOA 4RU2A 2NLWA 2FHOB 1HZ6A 3CCRS 2U2FA 2MXYA 1B7FA 5GADU 3CD6S 2MHNA 1NO8A 1Q7YT 3NNCA 3FILB 2HYIB 3HHNB 4Z2XA 2DHXA 4J5OA 4M5DB 2DH7A 1VBZA 2K3KA 3MXHP 2DHGA 3BS9A 3MP9A 2M8DB 2DNKA 2M9KA 5FJ4A 5DDPC 2N3OA 2MY8A 1QKZA 3N9UC 2RRBA 1X0FA 4ED5A 2DH8A 2KN4A 3ULHA 4CH0S 2YKAA 2ZJRQ 1SJ4P 1U1NA 3B4DA 1HZ5A 2RS8A 1IGDA 1U1KA 1ZZFA 1M5OC 1VBXA 3NNHA 1YITS 1VC5A 2CPEA 5D78A 3VAJA 2N9KA 2G1DA 2J53A 4QQBA 1VQMS 3B4MA 2E5HA 1X5OA 1ZXHA 1A9NB 2IGGA 2KYXA 3S01A 1M90T 2FY1A 3US5A 5CYJA 2QEXS 1MPEA 1IBXB 1K9MT 1BY9A 1WI8A 2LHEA 2XNRA 2B0GA 1WHXA 2KHCA 1FT8A 2KRRA 2JWUA 4IO9Q 1KD1T 2J0SD 2CQ0A 2M4MA 5LSLA 2LQ5A 3L3CA 2VODA 3P5TL 5JVGQ 1FNXH 2IGHA 1KQSR 5HO4A 1K50A 1OIAA 2DH9A 1U6BA 3VAHA 2EELA 2PEHA 5DETA 4WCEQ 3LPYA 3CC4S 2L9WA 1VQ8S 1X4DA 2AYBA 3P3DA 2KI2A 1X4BA 2M7SA 2RQCA 3BO4A 1GB4A 5LXRA 3K0JA 2EK1A 2DIUA 2DNQA 2MZRA 2F9JA 3SMZA 4KGRA 1K73T 3PIOQ 1M5PC 4UQTA 1D9AA 2LYVA 3MUVP 4WF9Q 2DGOA 2DNZA 3J7ZT 2DNMA 1PGZA 2JU6X 2MB0B 2CQPA 3U1LA 1YTYA 2CQCA
chains in the Genus database with same CATH superfamily
4AUKA 3PTWA 4I1TA 3AOAA 5HROA 2JDJA 4DL0C 3A8IA 4O0IA 2WZ1A 4GC7A 1YIJS 5DZ7A 4MSMB 1N34F 4ZPCA 4OJHA 3G8TA 3QARA 4HK2A 1J2VA 1RZMA 1YI2S 2IPKD 1QVGR 4KDIC 1M0SA 4B9NA 3B0AA 4FN5A 3D6HB 1WDDA 1D0EA 1RKJA 3M9MB 2WGSA 2W25A 5KFUA 2RE1A 4NA1A 4OFZA 3CCSS 7AT1B 1PG5B 1ZAVA 4XO0A 5ETTA 2JLGA 5F8HA 4M8MA 2LGIA 4IWOA 4NQLB 4IOCQ 4DV1F 1WGGA 1KVIA 3UD4P 4ID5B 1FXLA 2IM3A 4JI5F 1KFDA 4RW4A 2VPWB 2QO3A 3VTVA 2JL9A 1RHUB 2ZVSA 3MPYA 1MHXA 4I4BA 3C2PA 2C3MA 2HRYA 2N1VA 3VUXA 3SD5A 2WRMA 3OL6A 3ZTOA 3G8SA 3APFA 3CJKB 5HATA 2ZNVC 2J6SA 2V9KA 1KSPA 4M5HA 1NPKA 3G87A 1GXLA 2F8EX 6FDRA 4RNNA 2J0XA 3BM7A 4IR9A 1CJVB 2ZPNA 4OW0A 2ASYA 3PZ8A 1SL0A 4LNNA 3ZNZB 3HHLD 2OPQB 2YH1A 2GGPB 1WFYA 4RKUC 2KTRA 2VG6B 4GRSA 3BN4A 3NAHA 1FDDA 3DOLA 4NLYA 2YNHA 3BBBA 5JZEB 3KLHB 4ICLB 3FGVA 4ANWA 4LNFA 2QA2A 3NVWA 4WE1B 3TW0A 5A2QY 3N6LA 2K3UA 2VA3A 4ALZA 4X2BA 1SJRA 3OL9A 5E33A 4NXMF 4N5SA 1XD3B 2IAJA 2KDIA 4KGTA 4MSQB 3PJ9A 3IRWP 2VOPA 2HZVA 1HMVA 4USHA 4F7VA 3PVLA 5BR8F 2J0QD 5EDSA 4R5PB 2J76E 4ICUA 1TU0B 1L7YA 1UW4A 1ZZNA 3BVGA 4BOSC 2DYOA 2LFVA 2R61A 3Q89A 4M8LA 3CDWA 3K5LA 2HLTA 1YJNS 3BZQA 2CKHB 3ONSA 4ANXA 4TXSA 1SKWA 3IAM1 4ZDVA 1VQ6S 1RT3B 2W2OP 4G50A 5CHFA 3HM6X 5CYMB 3KWMA 4A4JA 1TZOA 2R7OA 4FF1A 2MKCA 2XSJA 3VZIA 2H65B 3PACA 4RW6B 3QT7A 2VC0A 3A3NB 5KFTA 5KOXA 1YGYA 1XBWA 3RNBC 1ZBTA 1QSYA 3HFZB 1L0YB 3VUWA 2QLFB 5IT9Y 2KANA 2OD4A 3W1SC 2VRRB 1UBIA 4IDIA 4XGAB 1EQMA 3I5BA 2MEKA 4I6NB 3DHHC 4JI8J 4W92B 4WWOA 4LBHA 2PI5A 4ZPBA 2JUOA 3KLIA 3OV7A 1YDLA 2WU2B 1YX5B 3HI9A 4N9F4 1H0HB 3FNNA 4IR1A 2A1BA 2HNZB 1NEKB 3DOKA 1FE4A 4G1QA 3OLMD 5DPWA 4OZ2A 3OTOF 3KLFA 2RRAA 2AHOB 3VUYA 4O3OA 3PX0A 1DGJA 3JSVB 3C6TA 2VONA 4TYBA 3Q0AA 1IQTA 2NSCA 1TIFA 2LQ9A 2FYXA 4RH6A 1XF5L 3GFXA 1R6YA 1WHYA 1UFWA 2HFVA 3RAQA 5BYSA 1WRIA 2YNIA 2V8DA 1FDNA 2RQKA 4Z7CA 5E7OB 1CULB 1UCNA 2M4NA 3HSDA 1BD6A 3RBXA 1KLUD 3J7AN 2AQ2B 1NBEB 1KONA 3V81A 3CXCR 3KUHA 5ADZA 3OVSA 1QOBA 5JVHQ 3BIID 2NMQA 4PK1A 2QTWA 3AFGA 2LEPA 1F5BA 2IM1A 3D3CJ 2ON8A 2LUEA 1L5UA 2ZH9A 3BYYB 3RW6A 3OVBA 1HBOB 3CD7A 4V19X 1P3QU 3N5BA 2CQ2A 4DLEA 3GR1A 4M5JA 1HR0J 2V0NA 3ZZPA 3PKMA 2MP2B 2NLWA 2L32A 3AU4A 1LXDA 4EFOA 3QGPA 2OGUA 4FN2A 4PWDB 4DQPA 1VBZA 1DARA 3HJVA 5FJ4A 2G0IA 2N3OA 3N9UC 4JPSA 1HQRD 2VICA 4K7SA 4ED5A 3NGRA 2Y0SD 3A1QA 1RT4A 1XJWB 2W9CB 1SJ4P 5ETRA 4UOCA 4L72B 4DZDA 2I1JA 1RBAA 4DG1A 2YQ3A 2A6OA 4NA2A 3Q3JA 5HBMA 4RGTA 5LNK1 3U02A 1ZAWA 4FVMA 4EEWA 1KKHA 1HPZB 4IO9Q 1EWYC 4XX5A 2XK5B 3LP0B 2JLFA 2XHCA 3JYTA 4ZOHC 5DQHA 2CJQA 3QCAA 4ZCIA 2JF5A 1SC4B 1VQ8S 1X4DA 2UU7A 1TYGB 2NR0A 2HNYA 2WXJA 1WC1A 1RAIB 4DCPB 5L46A 4CI0B 3SFDB 1EQ0A 4ANUA 3LYYA 3ISND 1E8ZA 2JU6X 3P4PB 1T02A 2VG7A 3H90A 1MU2B 4LSZB 4S17A 3AE9B 3P4RB 4MK7A 1WORA 3QQCD 1HW9A 1UH6A 3KJFB 2QJLA 1JLFB 1YMHE 2ZBIA 1IKVB 3TR5A 2LD9A 1SKRA 2D41A 1TKTA 1NSKL 1R7SA 3Q83A 3KH0A 2H5JB 1JMLA 3FSYA 3Q8QB 1K8RB 4FZVA 1YN3A 2HHHJ 1ZE3D 3FILA 3DRSA 1GT8A 3ZXWA 3GB1A 1L2NA 1C9FA 2WVFA 3NWRA 1F2RI 4A8WA 3FBCA 1NSAA 1IKWA 3W8PA 2LP4A 2FCQA 1NDDA 3T5HA 2EG1A 2W2MP 2ZCBA 5GAHU 1Z2MA 2BQQA 3VFKA 4E98A 4USIA 3R1LA 3A33B 1YQHA 3OFHA 4W9DA 2GO8A 3OXLA 2FLPA 4HTJA 1HNIB 4MTPA 3KLSX 3NBPA 1XNQJ 4DLGA 1O51A 1H38A 2D1CA 5G0RA 4F4WA 3UNGC 4LF6F 4NE9C 4I7FA 2DXEA 2VDIA 3KK2B 4ZJQA 2Y8YA 2EG2A 4OX6A 3EJMA 5J1EB 3QIPA 3VAWA 3TAPA 2BQRA 2CNOB 2RMLA 1IWAA 1TL1B 2R7SA 2CIMA 2GRIA 3N6MA 2CQHA 3ILIA 1HNZJ 3ALBA 1LOUA 1VQKS 2KAJA 4OL8A 1UVIA 5KFJA 2V9WA 4DHJD 1H72C 1GC7A 4I2PA 2CPXA 2AV5A 2ADCA 2C2KB 4Y2IA 2NYIA 2K7JA 5IP4D 1EJ7L 3PZDA 1JNZB 4CRJA 1R0AA 4QAYA 2CNNB 2YWFA 5EX3A 3H4DA 1TKGA 2OO4A 1IPGA 4EU0A 2PIAA 1S6QB 1HQ2A 2FQQB 1N88A 2BVCA 1T3QA 2MRPA 4EUVA 4GOCA 3ZRCA 1LWXA 4QOTA 2PA8D 1KQFB 9ATCB 4EOYA 2D3UA 5A8RA 3IN5A 4JI2F 1YKWA 4NYZA 5T7LB 3MUMP 3Q8VA 2C2DA 2XBPA 5KFYA 1S72S 2ZWOA 1TK0A 5DM7Q 2COLA 4YL8A 1WJ6A 1TT5B 2VA2A 2P6SA 5J2PB 3GSIA 4WJPA 2DYAA 4DQIA 3JQJA 1Y0HA 1UVLA 4U95A 1UPPA 2ASDA 1AZSA 4RW7B 4NMLA 2RU9A 2AT1B 4WXWA 4NEZA 2MH7A 4BZAA 3AEAB 2QA1A 5L1KA 2E9TA 2R2OA 2N9PC 1Q8IA 1C4CA 2W8LA 2ATCB 1FI4A 4Y2MA 3MR2A 1WC4A 2LQ8A 2EEYA 2FGCA 2RDJA 2WLBA 1XR6A 3VH4B 3SFGA 3AY0A 2FJVA 2D3ZA 2J5AA 4C56C 1H2UX 2JYEA 4FPRA 5D0RA 1I35A 1GQEA 4LJPB 3G82A 1GJZA 5C7PA 3D0IE 4J7CA 2KT2A 5B0BA 5D2MB 1JMTA 1HBNB 2ZBQA 2VFVA 1UA1A 1APSA 1UA0A 1S1UA 1I94J 4DV2J 2RGFA 1T9VA 3U2SC 2IHR1 2RDBC 2HIYA 3WAMA 2LCWA 3EVWA 4WFNQ 3D67A 3GFZA 3TOQA 3P4SB 2OIHA 1QJHA 2IA0A 2AKWB 3OLAA 4ANDA 4PUOB 2P6TA 4UUXA 1UETA 2WSEC 1FCLA 1NZ8A 1Q5VA 3PYEA 2BTEA 5KFBA 1TL3A 3MDFA 3X23A 4HKQA 2GBRA 4K8RA 4DR2F 1U2RA 1NJYA 1Q1KA 2CHZA 1HBMB 2R42A 3HVAA 4DOZA 4G6VB 4ZRIA 4DUYF 1WC5A 3R8BA 2PN6A 4C7ZA 1MJDA 3D28A 3UIOB 4QWEA 4QR2A 2Y8WA 1C0TB 3DRRB 3VV2B 3BGLA 4HPPA 5JHAA 5F8GA 4LF7F 2XMVA 3FZ2A 1U8SA 5KFCA 3HP6A 2C42A 1FO4A 2BDPA 2B6AB 1RHJB 4DV6J 2BYVE 3JAMU 2QZ8A 3DBLI 3J80U 5KG7A 4B3OA 4RU9A 2DO0A 2K06A 2FHOB 3LAMA 1HI1A 1VR6A 2KD0A 3OWEB 5B0GA 4O0NA 4LR7A 4J5OA 2OUGA 2B3TB 3FMBA 2MY8A 3Q3FA 2W54A 2BANB 1GMWA 1V1PA 4KIKB 1E8XA 4OJGA 3N01A 3V4IB 2D07B 3H6NA 2KX3A 2GBJA 2IM0A 1WGYA 3DU5A 1MPEA 5KFFA 1D3WA 4I6WA 3L54A 4ZP6A 3QRQA 2QSWA 5IQ6A 2P8IA 3JS9A 1HE8A 1WXAA 2ZJDA 3DU6A 4L2YA 1J7CA 2NBVB 4P72A 3AHPA 2M0XA 1WXSA 1TKXB 3Q3OC 2EK1A 5A8KB 1WE6A 1V5OA 1V9JA 5KT3A 1K73T 3APCA 5L8RC 1V3SA 5DPRA 2EFNA 4BKGA 3PW7A 1X9SA 3H1UA 2MB0B 4Y6IA 1S4EA 4KHRA 4DHVA 1WGRA 1EARA 4PQUB 1S7HA 1JXLA 2V34A 2RAQA 5D77A 1HNWF 1VK8A 3PRPB 3FBFA 5GAEU 3PHXB 1ZPVA 3CB4A 3BJYA 1T9YA 4B3RJ 1S7IA 4OZAA 4MEMA 1WX8A 4IOAQ 4LMZA 5M2PA 1PFDA 1KF6B 3HVRA 2ZZPB 1T9XA 4MJKA 2IC3B 4XZ4A 2HD5B 4IFYB 1B0PA 4YFUA 1RWKB 1GPXA 1BWEA 1IBLJ 2E44A 5GXGB 4LDTD 1Y7PA 1RAEB 4WU2A 1CQMA 3DXBA 4OV1A 1S49A 3JSYA 3D1QA 3N5FA 2GHVC 1RHRB 4DV3F 4ZVUB 2YPYA 3KJVB 1FXIA 3W1SA 3ZVVA 4DK5A 4MIAA 2KN5A 3TRGA 2DRDA 2MCNB 1KOHA 2PMWA 2WSFC 2DGXA 2FD2A 3T3FA 2L9DA 1D5XC 1XMOF 3KWVA 2KXJA 1F77A 5HLFB 4X4VA 2J7QB 5M2RA 3L0WB 2HMIA 4B9TA 2RF2B 2KWDA 3NUHB 3TA2A 3V4MA 2C2OB 3BH7B 1S1XA 2WX0A 1KH0A 1NK9A 4BAXA 2ILZA 2L0TA 2QLXA 2R7TA 3BSCA 3VWSA 5F8IA 4XYCA 2OPSA 2HAIA 5EE9A 3MI7X 4ECVA 1R8BA 1WDTA 3EGNA 1RWWB 2PPHA 2UV8G 3OUYB 1NCLA 3QSIA 1QOFA 2DVIA 2D3AA 3EUNA 2FZKB 2FCNA 1X9MA 3HO1A 2ZD1B 3DMJA 4ZOSA 2LQBA 4LQ9A 2LASA 5ITHA 3B6BA 4PYAA 4GVBB 1OY8A 5KT2A 3GYNA 1EAYC 2B7BB 1KR4A 3EECA 1IR1A 4IFVA 5I3UB 1UWBB 1S5ZA 3MAHA 2R2UA 2BE2B 3KHLA 4S0RA 4L76A 5B0DA 3NG0A 1E10A 4MYUA 2MBEA 1XQIA 1FRXA 3TZXA 1HI0P 4OHVA 2L1AA 1KJTA 2P2CB 3RT3B 1VRUB 4NPOA 4GDLB 4DX7A 1IBXA 1TELA 5KG5A 3PX4A 3IBEA 2A2DA 1HNVB 1HYSA 2KWCA 3PRMB 4XK8C 3IWXA 3W63A 2YQ0A 2GMJA 4KAIA 3CUNA 2VFRA 1TZ1A 2QC3A 2H51B 3DBRI 1NDKA 1Q4RA 1RTHA 1LW2A 2ZKTA 2DNOA 3NMAA 3V6EB 3CJ2A 3M4XA 2HQFA 3H8YA 5D4NA 3FRZA 1P98A 5HKHA 2L05A 3QZ8A 5HAOA 1S12A 1WF0A 2LMCA 5L1IA 2DNYA 4JI6J 5DQGA 4I67A 3H98A 3I4PA 2N3LA 5DO2A 2GZOA 2J7KA 4IG0B 2BQ3A 1D8ZA 4KTQA 3DC2A 2L41A 1VDVA 3TUJC 1XLOA 3UIPB 3ZKJC 3LOUA 5MLCV 1XNRJ 2L76A 2CG8A 1PO6A 4A8XC 3P6YC 2FJBB 1ET6A 3UR3C 3L4BC 4LSLA 5B08A 2JWNA 1QE1A 3BINA 2BYFA 3HF5A 5JXSA 3CMAS 4LTUA 4B3TJ 4HEA1 3TCAA 1ZDVA 3AD9C 3LW5C 5H9FJ 3QIDA 2IMWP 4NJ7A 3LANA 2ONQA 2E6XA 2I9SA 3VR9B 1V81A 1VQ4S 4X62J 3V6JA 4ECXA 2KJRA 2C3YA 1XN9A 3MHYA 1X4AA 5F3TA 1T11A 3SCLE 3EDRB 4CO4A 4TQ0A 2XMWA 3OTBA 4YUDA 2RB7A 2WVBA 1DLOB 2VQEJ 2GNKA 2HE7A 3J81U 2GVZB 1PCAA 4F7ZA 1VZ6A 1N5VA 1JLBB 1NPPA 2XMUA 1B7FA 4K4TA 3TZWA 1SE4A 3CJKA 4OYMA 5JHBA 1YRUA 3VXWA 2J0KA 4FYVB 4I64A 3QYYA 3MP9A 5F3ZA 3KLVA 4F2RA 1WSRA 4RUHA 5J2QB 2B3AA 3MECB 1CJVA 5D4OA 2W24A 3DXSX 3M6XA 1EP4A 1IGDA 4ZCLA 2CZ4A 4G3IA 2LGSA 1RAHB 3UQSA 2HDEA 2OPQA 2GGPA 4ZN3A 4JV5J 9RUBA 1NYQA 1DJ0A 4MIBA 1FX4A 2FB0A 3F0NA 4QW9A 1U48A 2CQ0A 2BB5A 4WE1A 2O5DA 3BYTB 3HHMA 3JSMA 1OIAA 1SJED 2FAZA 4C80A 4DV5J 4CQNA 5AUIA 1BQNB 4FPIA 2NTTA 3CC4S 3GCWP 2PKOA 4N76A 2DBBA 2M7SA 1RT5A 1H74A 1ZA1B 3QNWB 5J17A 1PUTA 2KDEB 2LRWA 2WDRB 4I6AA 3ZTPA 4R5PA 4M5IA 2L83A 1KVJA 2KTQA 3K57A 4USAA 2ALYB 3MC8A 3ETRA 2HKEA 1GH8A 4C4VB 1RT1A 1VIOA 3KNGA 1RAJA 2QSFA 2CJXB 2DAFA 5KAKA 4WJQA 1TMMA 4A55A 2AZ1A 1BT0A 4DV7F 3PY8A 1K44A 1R0CB 3UDVA 1NB7A 1UL3A 3I6PA 4FHKA 3HKZD 2ZDOA 1Q5WB 2IO3B 3I31A 4D2KA 2MBQA 2R8KA 4IW0A 4FF2A 1RXOB 4NI2B 2MLYA 1NNDA 3TARA 1L6UA 2E29A 4NLDA 4QU7A 4QIEA 4W98A 2Z0GA 4RW6A 4ITKA 2OSRA 3NWGA 4R3DA 2LXIA 1S9EB 3M8PB 2XS7A 3AE4B 5EE0A 2HFZA 3J7YI 4BBYA 2PC6A 2C2RA 1VBKA 3UE2A 1L3SA 1MHHE 3ZZOA 1ZKHA 4L3KA 2UUWA 3UW1A 4YWGG 5JMNA 2VASA 2HHTA 4X4RA 2IJNA 2H54B 2SXLA 3D6MB 1AT1B 3RYTA 3SV4A 4I69A 1FMAD 3DRPB 3A9JB 3IWNC 5H1SV 1RFKA 4ZA1A 4KY3A 4ED6A 4DL5A 1OYEA 2IDYA 3A13A 4MGKE 3W9HA 4BFRA 3JSVA 2XMAA 2KH9A 4G1IA 4AFFA 3K8VA 3AE8B 3DPDA 3NNAA 2M70A 3KHRA 3A12A 3DBLB 4DR1F 1V5IB 1FNWA 2EFPA 1JLAA 2MJUA 3DLKB 3QAUA 3OAWA 2WNMA 3OJ4B 4PT5A 3EX7B 4LFBJ 4YQWA 1W2IA 2MBOA 3HJFA 5RUBA 4EBCA 2BUNA 1E90A 1S9GB 1ENFA 2G4DB 1WIAA 1OFFA 3DVGX 1AN8A 2ZWPA 5AXMA 2DR8A 3OTEA 2Q6BA 2CXEA 5EWFA 3V5RA 3OFFA 4NLGA 2IGDA 3I9ZA 1MN9A 4PS3A 4URKA 4JIOU 2MP2A 2E1AA 2UU9J 5CYQB 1WMHA 1OPZA 3I5AA 2CJBA 2W82A 3IS9B 1T8EA 4PWDA 1KLMA 3BKFA 2MLXA 3L16A 4LREA 5KFKA 2NS5A 2W2QP 1BXTA 4I0WA 2W9CA 3KUCB 3IRXB 1VGYA 4USJC 2YPZA 3JYUA 2AEFA 2A18A 4CT8A 4K50A 2MTLA 4BC9A 1XMQF 3UN2A 5G2NA 1A5RA 2JXTA 4KV8B 1LKZA 2VG5B 2X51A 1FO1A 4FADA 1HPZA 1SH3A 2CPJA 4KC5A 1XO3A 2QYGA 4RNMA 2XK5A 2VFTA 3LP0A 3SSSA 4CM2A 4LSNB 1UBQA 4FXWA 1VD2A 1N60A 4AL5A 2OPRA 4OZJA 1T03B 3C15A 2EFVA 1RBLA 2XC9A 1F2RC 5IXUA 1LV5A 4AP4C 2EPIA 1CC8A 2WU5B 3GCXP 3MURP 2MZJA 2ZBPA 1HTQA 2RT3A 1HQEA 3RBZA 2BJEA 1P1LA 3GJRB 3NRZA 2MZQA 5L83A 4OZ1A 4MKVA 1T7PA 1WX9A 3OHBA 3KNAA 5LT5A 2R3VA 5LSRA 5AZFA 3CSKA 2BW2A 1ZPWX 2HRTA 3HRDD 2P5VA 2E5LF 3QRPA 5A8WB 2ZM6J 1JLFA 4DS5A 4QIWD 1MG4A 8AT1B 3O2IA 3W7BA 4OYAA 3ZO7A 1U24A 3IAM9 3VCDA 4X65F 2GIQA 3TA1A 1U0HB 3CJ5A 3LGNA 1IR2A 4HI1A 5KFLA 1VLYA 4MK8A 3RU0A 4LFCF 2CJOA 4O4RA 3EA6A 3CTRA 4FXDA 4R25A 2XNQA 3FEZA 4NLSA 2OFHX 3SQGB 4C7YA 1HHSA 1SJ3P 3KHHA 4OJ1A 4PWWA 3EZ5A 3O13A 3AB2B 3PLVA 2CQBA 1U1PA 3KTQA 1JWBD 3H7PB 2JRIB 1ZS6A 2CS4A 2NUHA 2GAGC 5D0GA 5IKCM 3U1NA 1XEZA 5KT7A 1IQZA 4JP8A 3WC2A 4NRUA 2FZGB 2XY6A 4ZLLA 3PNIA 3KWLA 1RWUA 1GC6A 4JV2A 4UQGA 2QRRA 3CD6S 2CNKB 5KG6A 1RTZA 3P96A 2FY8A 3TVYA 3QSYB 3HHNB 1KTQA 3KK2A 4K4SA 4LF4J 1WJ4A 3P4UB 4DR7F 3MXHP 2DHGA 5MPOA 2C2EA 3EFCA 4IWQA 4ACFA 1F9HA 3W3SA 1HZ5A 2IJFA 4W9EA 3FC9A 4USMA 3J9CA 4OX8A 3LP2B 2HQGA 4F04B 1PQSA 5FDLA 5CHVC 1GMWD 2K8HA 1ZXIA 2PO4A 4Z7YA 1D1UA 4A3PA 2QL9B 2R2TA 5HANA 2WXOA 4C3MA 1JX4A 3LAKA 5DG9A 2NCNA 3GR0A 1E0ZA 3HDSA 4DV4J 1FWPA 1OQ3A 2HHUA 1WZ3A 3PVXA 1KQSR 4OI0A 4ZLPA 3DVGY 3ZGZA 1S6QA 4PQAA 3EYZA 2M1MA 2BMBA 3MR5A 2L9WA 3ZXRA 5FKAC 1FXRA 1TL7B 1G4CA 1GAQB 2V3PA 3D6TB 4TLRA 3IM9A 2FIUA 4ICVA 4L74A 1T0YA 4JI7F 3ZUNA 2DGOA 5T7LA 3DVNV 3KW5B 4Q45A 1WR1A 4KKOA 2LI5A 2G45B 2KYZA 1QAYA 3NP5A 3GJQB 3DBRB 1U1MA 1L5PA 4ZS6A 2HTME 4P1BC 1XK8A 4ES1A 4RW7A 2UUCJ 1JRPA 4YHHJ 4BLGA 1OYDA 2ILYA 4WU3A 3H9DA 4OMFG 3R7SB 4LNOA 2EFQA 4DR6J 3NOCA 3ZZRA 3HXMA 4USTA 2N9EB 3CNQP 2CWXA 2L48A 3IP0A 5AJ3F 2JC0A 3PO0A 4UW2A 3SIPB 4AOFA 4IDKB 2OMOA 1JJHA 2FHJA 4I68A 1FRMA 3U1MA 3UVJA 3W1YC 2RMMA 5TR5A 1U45A 1X4CA 4RNFA 2K9XA 2LXUA 4HCNB 5G55A 4NXNJ 4JI0J 1FTRA 3I96A 1F5AA 2G4SA 1J5OA 4JI3J 1X5SA 2JEIA 4KB7A 2WDQB 2V8HA 3HSJA 2ROEA 2LEKA 3HCXA 4AWJA 4LF5J 2GI9A 1PC4A 4PYUA 3GIRA 4PG6A 3T41A 2ZKUA 3APDA 4HT5A 4HR2A 3T19A 3ZC4A 1WC3A 1S48A 3NG8A 1MROA 2WXKA 2DXFA 5DGBA 2DJWA 2ZJQQ 3TEYA 3MM8B 3R5CA 2ZC4A 4LT6A 3Q3NC 3MC0B 5MAOA 1WEZA 1BXNA 3VGVA 1I7HA 2ZPYA 1FJ7A 3JW0X 4ZVEA 1Y4ZB 1TKYA 4A8XA 2JZ5A 2WHOA 4F0MA 1QTMA 4NQKE 1C0TA 3DRRA 1R0BG 3AA8A 2L52A 5K14B 2KDMA 2VZKB 2KO1A 2B43A 3QO9B 4K5SA 4URQU 2UUAF 2BVZA 4DPWA 1R4NI 1ZTWA 1KFYB 3QJLA 1FPYA 1HHQA 2VPYB 1UW9A 3Q8RB 2HS4A 1N62A 3AEFB 1YJ1A 4L3NA 3P8BB 3OG5A 1JIHA 1RT6A 2XGQA 3CWJA 3L7UA 1ZA2B 5D4LA 3Q8FA 4K59A 4GKJF 1CVJA 4DWIA 1W26A 4F3OA 4IH6A 3DLEA 4FYDA 1JWWA 1DOIA 3MTNB 3G86A 2BANA 3D32A 1KC8T 3NEKA 4W9HA 5ETLA 4KIKA 3HFKA 2GQCA 1ZM2A 3CD5A 4BBNF 2KO3A 3V4IA 1GNUA 3K9PB 1E6VB 1ZYQA 2RD0A 2JZZA 2O6VD 1OO0B 2ZCCA 2HQDA 1T05A 4LF9F 4F4ZA 1RAAB 2RDGA 4DR3J 3UGBB 3T5JA 5M2UA 1K0TA 4JI1F 3NVVA 4OIXA 2BOPA 4I6YA 5JXVA 4UTGA 2DAJA 4B95A 5B7WA 4FNHA 3TNVA 2QJ3A 2PIIA 1RCOB 2ZH3A 1TKXA 3UD5A 5BYQA 5IM0B 2JJ4D 4F8CB 5J2NA 5F8LA 2FVRA 5KFOA 3RN9C 2JT4B 1NKBA 2R2SA 5LM7E 3KK3A 3EC8A 1WWHA 1YBTA 3CO0P 3FKYA 4US8A 4M94A 3ILOA 2PEBA 1PILA 4MDKE 1DURA 2KT5A 4HDHA 1NJXA 1WHWA 1BQMB 5HP1B 2OI2A 3PREA 4LNKA 1GTHA 4DWFA 2Z8QA 4N77A 2J0JA 2ZZTA 1DBDA 2AEHA 3KMSA 1J7AA 4Y00A 2PJHA 3EXYA 3E3XA 3UDLA 1GXUA 4ZRJA 2LKZA 5AEKB 1VJQA 1WYWB 3PR5B 4IFYA 1LO5D 4J9NA 2W7AA 3WX8A 2FE8A 2AJ0A 1QT9A 1UZHA 4L6V3 1S9FA 2L8JA 3M30B 2YKMB 5GAGU 3Q8YA 4X4PA 3KJVA 2LHDA 4GIVA 3R5DA 2HJ1A 1EO6A 2MZSA 4ZPAA 2YVCA 4NLWA 3I82A 5DG8A 5GADU 1MMDA 1EKRA 3KUEA 4LRAA 4HDOA 3OR1B 1UJ4A 2HYIB 2DHXA 2CNLB 3UN5A 2Z30B 2POKA 2VH2A 1FKOB 4B3SJ 2V67A 2ZM6F 1UKUA 1KOTA 1U1NA 1M1HA 3ZTDA 3BREA 5ETQA 1NPRA 4X4TA 1IJFB 2XZDB 4KO0B 1A9NB 1WKLA 4O3PA 3OUYA 1WOOA 4LBIA 1YJRA 2M4MA 1DFDA 2YWHA 2ZH6A 3RFZB 2D3BA 3GE9A 4B3MJ 2QHOA 2PEHA 1U6ZA 4C8KA 4Q8FA 1RM6C 2VHGA 1SB3C 2EBGA 1JKHB 2RQCA 2VPXB 3MM6B 4RGOS 3MEDB 2MZRA 3NGUA 3HHLB 4OZLA 3FFIB 2INPE 1U2CA 1UWBA 3DBSA 3ISZA 4MFBB 2VUGA 2CQCA 2J6TA 4NA3A 4DHZB 1DTQB 1RWNB 3MCMA 1PJ7A 3M1VB 1YQ4B 1RWOB 2QSDA 1V6HA 1RTDB 2M52A 1TS3A 2OP5A 2AZ3A 1TBEA 4K0KJ 4PXCA 3L7PA 4GO5X 4M95A 4KBIA 3GP7A 2HSEB 4TVAB 3MMCB 2LU2A 4O1NA 5DZ6A 3BDPA 3MUTP 1LGRA 4I2QB 2KXNB 5AE1A 4E8UA 2UYZB 1QUVA 4ZJLA 3WIUA 4N7TA 1VBYA 5BXIA 3ZO5B 2MHJA 1RU2A 1Z2ZA 3X0WA 2W9AA 3R6GB 1E5WA 3V60A 4M0WB 3GIMA 1WY8A 2HFNA 4I56A 4ZPTR 1WUUA 3VAKA 2MY7A 4XE0A 1I42A 4HJGE 1IP9A 3DHXA 2IBIB 4AXJA 1VQLS 3TP2A 1IBMJ 2OSQA 2H5IB 2N0SB 2DRAA 3DI6A 4QYZJ 3AE3B 1VQOS 1FFWB 4Q0BB 1OQQA 4L73A 2XLKA 4O4GA 1YBAA 1T0TV 1Y3JA 3H25A 2OLWA 4OHXA 1CLFA 4GVLA 2YNFA 3GG0A 1FFUA 4FYXB 4OI1A 4NLXA 2CQIA 4TKTA 3RB0A 4KHPF 3BEGB 1CQNA 2AYOB 4MYTA 2FDNA 2CU1A 2CU3A 2XLIA 3C46A 4WBFA 3M32B 5EN1A 2UUCF 1FK9A 3B82A 1FIQA 3MEEB 2KL8A 3WA0A 4JWSC 2WAQD 1O8BA 4ZRQA 4ZCMA 4RL1A 1ELOA 4ZVTB 3PHEA 2W7PA 1VRQC 4DFPA 3FK4A 2W3RA 4M01A 2FJAB 2QMXA 4K7QA 5H9EJ 4BS2A 4LCDE 3FRYA 3S8SA 2BS3B 2GVZA 2VFUA 2XWXA 4ECTA 1NK8A 1ET9A 3MR6A 4DPXA 1JLBA 4ZVPB 2RQMA 5L9NA 3TJ9A 1U09A 2I5JA 4TNOA 4CLWA 4JI3F 2XMKA 1SSNA 3MAQA 5LMUF 2GHPA 4MIWA 4OHZA 1WGKA 3BDEA 3MECA 4G65A 4N41A 4F0HA 4A47A 3UCZP 4I6LB 4HACB 1NB2A 1VQ7S 2K8BA 3M8RA 3CJ3A 3MM9B 1L3VA 4QZVB 1HXYD 1AUDA 2F63A 4N8OA 1WYGA 2ZZMA 3DLGB 4FLHA 4KGMA 1BE4A 2HVZA 1FWKA 3IFWB 5ETPA 1TR0A 2OKQA 4A8FA 2MQMA 1RT7A 3WALA 2IBOA 3EUB2 3A9KA 3I0SA 3QJZA 4DR4J 1VRTB 4K2JA 3HSZA 3M8SA 2CZVC 2ZNZA 3H42A 2HGMA 3AAWB 1FD6A 1UGJA 3O44A 2E7VA 4F25A 2W9BA 5H92C 4H4OB 2LA4A 1STEA 4DSKA 3EZUA 4KR0B 1N0VC 3AXMA 5KTQA 4DUZJ 2I2YA 1M1KT 4Y2KA 3KDOA 3JTPA 1YN5A 4WYWA 1WEXA 3ZTCA 4LR8A 2DD8S 3AE2B 4ES2A 2MSTA 2KRBA 3PW0A 4HJKA 1SBRA 2D3CA 4AL7A 4TLQA 2X1FA 3FBBA 4MKYA 5DDOC 4OX7A 4CYUB 2DGVA 2G0CA 3W2VA 2OEDA 2V2QA 3TA0A 2WX1A 3OJSA 4EO8A 5C24B 2JWZA 2GA7A 2B9YA 1RQ0A 2LUMA 2DYMA 5IWAJ 1GAOA 2DLBA 3RYLA 1UPMB 1N52B 3VH3B 1CMXB 1SC1B 2YQ1A 2V4LA 2J42A 3GMGA 2OPPB 4GKKF 5ETKA 4KDLB 3AOBA 3W1YA 1H73A 6FD1A 4H4MB 2QILA 2NXEA 4WWNA 4X4NA 2L08A 2UZAA 4D3HA 3RAXA 2XM3A 4RBUA 3C14B 2CHXA 1R4NB 2DNKA 1EETA 5CQGA 3SSQA 1VDHA 2YKAA 3OHAA 2RS8A 3NY0A 1WC0A 4W9JA 3NAIA 2E7WA 2N9KA 1C77A 5LXHA 1RWXB 1X5OA 2H3EB 3PV1A 2FY1A 2NCKL 3FQKA 3C8YA 2F65A 2WHIA 1NENB 1RU1A 3HHLC 3NS1A 1D09B 1C3TA 2E1PA 2DY9A 4YSYB 1SVDA 1TS4A 2E1CA 3R5GA 3RGIA 2JLEA 1TAUA 3A3OB 2KI2A 1NK4A 1VLOA 3MAAA 4NNJB 3DM2A 3CJ4A 4UOFA 4OI3A 1YOVB 3OJ3A 3MEGA 4Q43A 2GBKA 4DX8H 4ELVA 2DNZA 1TL4A 1N5SA 3J7ZT 3IS9A 2GBNA 4DHJB 1X9WA 1OSCA 3BH6B 1KLGD 2ZH7A 4G3XB 1FERA 3PLUA 1YQBA 4HXDA 2AIRB 3RB6A 4USKA 4IRDA 1KRPA 3IRXA 1F60B 5AXKA 2KX0A 3CIMA 2YKOA 2Q79A 1VRAB 4B17A 1HKAA 2DR6A 4JX1C 4ZKAA 1KHVA 2W4CA 4KV8A 2VG5A 3TANA 2O2VB 3JSBA 2ZHBA 3QHTA 4JI4J 2Y5CA 1BHNA 2G4BA 4B3SF 1IM6A 5IQQA 4X66J 3ABVB 5K9FA 1X60A 2DPJA 2D74B 1HBUB 2NXJA 3DLLQ 4CO2A 5DQIA 2V94A 1N32J 4X64F 4DFMA 2F5GA 2E5GA 1Y11A 3VVTA 2ZW1A 1RAFB 3M95A 2CJNA 1HWJA 3D1HA 2XCPA 3LTOA 4ZHRA 2FHJD 4RW9B 3Q2TC 2MQNA 2LXAA 2LMIA 4W9KA 4A8QA 5A8WA 2XYHB 3HVDA 1JK9B 2HVEA 3C6UB 1O5JA 2YWEA 1EIYB 3T9ZA 3A3PB 1E9MA 2V8PA 4AJWA 3FQLA 2HRUA 2DPIA 1JJCB 1LWCA 2UUBF 4ZPDA 4C98A 2XY5A 1TK8A 1SH0A 3PW2A 5HN0A 2V69A 3R7QA 3K9OB 4KGKA 1J5EJ 1FHTA 1XC9A 3MMBB 4Y3CA 2GQQA 3I87A 1N36F 2JZPA 5J18A 3TMPB 2DNLA 4QU6A 3CSTA 4C11A 5IT0A 1S77D 2BBCA 3DOMB 3BGRB 3BO3A 4D3GA 3ETMA 2J0WA 4ED0A 4O3RA 2XQCA 3RMKC 1M94A 3KUDB 2DK2A 2I6WA 3VQSA 5THWA 3M2UB 1SE9A 1CS4B 3M62B 3AB5A 2GV1A 2J8AA 5G4DA 2IY1B 2XY7A 2V4QA 2ZBCA 4J90A 3ITHB 2BS2B 2BYCA 2BOAA 3WANA 1SH2A 1OSDA 3D9BA 4K5RA 3OSNA 1UELA 4C97A 2C3UA 5SZTA 5HVHA 3DGPB 3FAHA 2JSVX 3G6XA 2OMLA 5EDWA 3QLHA 2X1GA 4EUTA 3G71S 4KE5A 5LMNJ 3BBCA 4TYAA 3HVZA 2ACZB 1Z5SB 3OVAA 2AYGA 4K2XA 3IGNA 1ZPSA 4LFAJ 1JLGB 4IYQA 1S1VB 2UVWA 1NJIT 4O3QA 4F4XA 4OYPA 3I3TB 2WVCA 1QVFR 2IVYA 3R9LA 3H2VE 1RAOA 1YZ6A 1FKPA 4U9RA 2DB1A 1B99A 4MACA 4ZYNA 1KOOA 5EX0A 5HVGA 4WJBA 2F40A 2MQ8A 4F1SA 1T3NA 1TL7A 4OX9F 1EF1A 2MLZA 4DV0J 3KLEB 1WJ9A 5C5JA 3MPDA 1J27A 4JV0A 2F7VA 3GG1A 4O44A 2G9OA 4EYHB 2Z2YB 4KPYA 1Y10A 1XLNA 3B78A 3W9JA 1UZDA 1N33F 4OYXA 1GX6A 4XIUA 3Q22A 1TMJA 4OZNA 1TV6B 2WP9B 4F26A 1NKEA 1K1SA 2BJ7A 5KFXA 3HVTB 1RK8A 4PS8A 1RDRA 4K4ZA 3UO0A 2CJYB 3OR2B 1UJ5A 1GXTA 4U8YA 2EK6A 1RAGB 4DXLA 4JYAJ 3WBZA 1S6UA 1PKUA 4WIIA 3EFUA 2KFNA 1Q16B 4X4QA 3RBDA 4F3QA 4IDKA 3QJPA 3I0RB 3GFYA 3QIJA 4QWBA 1REGX 4KFBA 1TK5A 1P0RA 3SI8A 2BEFA 4ED7A 4KKJA 3QGHA 4QIVA 3Q14C 3TL5A 5D3GA 5EHHA 3P45B 8ATCB 3PPAA 1XXGA 3V6DA 4DXAB 2GIFA 3ZQ4A 1OTRB 1XWLA 5HROB 4WURA 5F8MA 1RKIA 5F0WA 1BUIC 2NTSA 2D5GA 2E66A 4DR4F 2YNGA 1SGHA 2Y5BB 3Q8EA 3CJ0A 5JJBA 5LJ5Y 1AWDA 1KTKA 4CWBA 3UDCA 1NM2A 2O1PA 2M19A 4RMAA 4P75A 1SPBP 4WIPA 3LWMA 3K17A 1P9QC 3TUPA 2NYHA 3NNCA 3N9YC 4C3KA 3RD2A 4M8NA 5J2MB 1XR7A 5CD4A 1IBCB 1YN4A 4C8OA 4MM3A 3MM8A 3TZYA 3H7SA 4ZPVR 2V3SA 4CH0S 4DF8A 2AQ4A 3B4DA 1LW0B 4J9QA 2Q66A 2V4IB 2GC8A 4BHQA 4PAAA 1FEEA 1ZOYB 2QEXS 5K14A 4MH0E 1EWCA 2LHEA 2ACMA 3HZEA 2KRRA 2JWUA 3HHDA 2WS3B 3QO9A 2LQ5A 1F2GA 5E6PA 5DPTA 3ET6A 1T5XD 4TKNA 2NREA 2R2QA 1Q95G 3A4RA 2QYCA 3MF5A 2EELA 5C42A 1HQUA 2ZVOA 2C22A 4HVZA 4RFBA 1WOPA 2NPFA 1TL5A 3BSNA 4H54A 2V63A 3D4JA 4UQTA 5F9NA 1JROA 1UFLA 4WYLA 1LXNA 4IG3B 1TQLA 2HBQB 1LWEA 2L3MA 1B4SA 4K4WA 1IBKF 2JRSA 2KQ7A 4DU7A 5B09A 2HTHA 5EE3A 1N5TA 1S57A 4BVUC 2NPTB 3J81j 2KKCA 3B2FA 2DTJA 1GEHA 3TAMA 1M5HA 4CIOA 1AYFA 1ISNA 2A10A 2YNHB 2AJFE 4TU9A 4WZMA 4JQWC 2E7XA 3W65A 2KYWA 1FJEB 5HQ8A 2GFFA 3UCUP 3EGVA 2AQ1B 3UF8A 3W2DA 2D2QA 3Q8BA 2K2PA 4M5DA 4CLKA 3Q23A 2IAJB 3OXFA 4LF8F 1QSLA 1MG8A 4KHMA 1VQSA 3KKFA 4MK9A 5IM0A 3V6KA 4OV6A 2EW9A 1MMLA 3JQKA 5KHOA 1GK8A 2WCXA 3GFHA 3UD3P 5E3PA 3JQMA 5F41A 1M5VC 4EGLA 2DEIA 2M2BA 2NR2A 2FC9A 3IG1B 2RPQA 2QL5B 2MWSB 1U1OA 2DR5A 2UXCJ 1FDBA 4H4KC 3B9JA 3W66A 2AW0A 5HP1A 4TUUA 2GW8A 2K8GA 5KFSA 2DT9A 3R3TA 2XSJB 4DCOB 2DHZA 2E1MC 2BJ9A 4L1BA 3KYCD 3LGHA 5KFQA 1ZP0B 3OBIA 4YTNB 4P74A 4FS2A 5C3JB 4HYKA 4IKGA 2PE8A 2NUUG 1WSVA 3SR6A 4I6PA 4KGSA 1T94A 1FRRA 3POTA 3KLIB 2ABYA 2K25A 4GGQA 1WF1A 1RISA 3DDNA 2AEJA 1R27B 4TY9A 5K20B 2FBWB 1FM0D 3DOKB 4ZHOA 1NVID 5EWGA 1N32F 4G1QB 3K59A 3M30A 1MWZA 2YKMA 2VIHA 4CM0A 3KLFB 1Q8LA 1E7PB 2AJ1A 1WD6A 3SEOA 4B02A 2JC1A 3DWGC 3PDNA 3C6TB 4J37A 3ICLA 3LA0A 2BJ3A 3Q24A 1CPZA 2VV5A 3TEWA 2H89B 2JQRB 3FKBA 1UUPA 1FKOA 4DJBA 2F4VJ 3N0VA 2YNIB 3R27A 2PMHA 4KSEB 5I4MA 4NWBA 1S6PA 1CJKA 5CCMA 5FK9C 4KO0A 2GJ2A 3SHQA 3V81B 3NS8A 5KT4A 3CJTA 2V2VA 3ML9A 4DDGD 3RNCC 3MEKA 3BGOP 3VTWA 1W25A 2JNJA 2UXBJ 4II2B 3M8QA 5DGAA 1NZAA 3E2EA 5C23A 2M3DA 4CT9A 1V3ZA 2OTLS 3MFIA 1JKHA 1VQPS 3MM6A 3MEDA 4Y2CA 2X3DA 1HTOA 3HHLA 2BA9A 2YXLA 2B51A 1FNUA 3N6NA 3AM9A 1ZM3A 3FFIA 1SV5A 2LVQA 2A5UA 3ZZTA 2IDLA 3A1QB 4XC2A 1RT4B 2BBEA 1S10A 3S1TA 1AFJA 4RM9A 1DTQA 4DG1B 1DTTA 2JEGA 4OVVA 1WTFA 3JTOA 3M1VA 2UWQA 3M3JA 4J6IA 3AT1B 5AZHA 2IDEA 4F0KA 2MLBA 2VFSA 2GB1A 2RDDA 2BW7A 2L0FA 1EM7A 2UVRA 3ZYYX 1AB8A 2H9ZA 2CJKA 1FJGJ 4YR3A 4U96A 5C2CA 4WWSA 4ZRKA 3RRHA 2UXDF 1HA1A 3JYTB 1FKAF 2HFSA 1VQYA 4NL5A 1I1GA 4I2QA 4IRKA 3MJWA 3ENVA 2IM2A 4ECWA 1SQEA 3CCJS 3EICA 3IG3A 3LO3A 2MGZB 1SBBB 4EKUA 3MOJB 1XCTL 3RULA 1D3ZA 3NL0A 2GIRA 3NGKA 4N47A 1WI6A 2MDAA 2GVDA 2N82B 4A9AA 4FYWB 1UD7A 1I4GA 4M0WA 4KT0C 1JQ4A 2HNDB 4UT4A 2N7EA 2RHQB 5E0OA 1YNTE 1DQ8A 4AJYB 4NYOA 1OQ6A 2R8GA 3CGIA 2Q6CA 1FCCC 2CYYA 1XT9B 1TKTB 4CH7A 2PDAA 4CP5A 3IBWA 4QR0A 4AQ7A 2VQFJ 5LSOA 2C3PA 1TUWA 2U2FA 2V3NA 5HMYA 1YX6B 3FILB 1JQGA 3DCAA 3GJTB 4HLBA 2BGFA 1XTZA 1IKWB 2KN4A 2K1FA 3RUBL 1Y00A 2J7WA 1RHQB 3AB4B 1FE0A 1T0RC 4FXCA 1I4RA 5FR6A 1F1BB 5AXNA 3TUOA 3MEEA 2ZZNA 3HFVA 3T1HF 5JUMA 2IPOB 4L75A 4IM2A 3L9ZA 1HWUA 2DYBA 3SU8X 2J0SD 2DNFA 3RB4A 3NBPB 4RJVA 3QT8A 1MMNA 2Y3AA 1U6BA 2W1BA 4WCEQ 1RB0A 1Q7LB 3GE8C 2CAJA 1VMBA 4ZPWR 3KK1A 2HHXA 3W2WA 2N7YA 4I7FB 1BUXA 3SMZA 2BT6A 1RUSA 4QBUA 2F4FA 3W60A 2AGOA 1F3VA 3QIPB 1HNXJ 3VQTA 4ES3A 4IKAA 2N4DA 1FRKA 2HK3A 4V1Ak 2BF8B 3FDSA 1KN6A 3BY4B 3HHKA 4I2PB 1U0SA 4PG7A 2MKJA 4E74A 2DGQA 4TN2A 3RR7A 3H4BA 2L7RA 2Z57B 1R0AB 1R6VA 2DXDA 4QPTA 1Y5LB 2C7MB 4YS2A 4ZVFA 4TU8A 3I9V9 1W2BR 2V2ZA 3K5MA 2BJ1A 1QAIA 2FVQA 4IQMA 2KDOA 2KWUB 5A8RB 2BM0A 1N34J 2PLPA 2BACA 4Q2JA 3EZOA 3LH2S 2CZ9A 4OZBA 5KFEA 1I4QA 1YHQS 2RSUA 2NSBA 2Z2ZA 7FDRA 4H4OA 3DLBA 4UY8T 3CWIA 3H7HB 4CDIA 5IFMA 1FNVA 1V3RA 4PXBA 4HPMB 1AZSB 1XMBA 2ZEQA 2JYTA 3QT5A 3D0GE 1GFWB 4L23A 2WXIA 4JWUC 2NXUA 2QL7B 2MKHA 3OTDA 1YG0A 2DZKA 2DO4A 4ZVOB 4DV1J 3PIPQ 4MKBA 5B0FA 2G2YA 1WKJA 4WAAA 5I3QA 4CYUA 4P2SA 3EGZA 1I4XA 3GONA 1I6JA 4JI5J 5HSPA 1QM9A 1E6EB 5FLXY 2KKHA 1FXTB 1RLDA 3AV8A 2HGNA 1CC7A 3HIZA 2AD9A 5AT1B 1WR6E 5KFGA 2QA4S 2BE9B 4QYZK 3Q6BA 3IWLA 4NCGA 2M56B 4FKYA 2IJRA 1IUEA 3UN3A 2F9DA 5KFAA 1S1UB 2CPFA 2HS3A 4CZCA 4ZMMA 1UF0A 2V8GA 2XMJA 1K8AT 5KFDA 2OPPA 4OLPA 1P7FA 4CHKA 5FIIA 1E6YA 2WXNA 2GX8A 2QGFB 3MR7A 4TY8B 2KFZA 1DOXA 1S0NA 4PZVA 4ECYA 4ANVA 2DEJA 1UJ6A 4GN1A 3IVFA 3IBFB 1N6QA 2N9LA 1NSPA 2M0GB 1WNEA 2ZW0A 2I1RA 1RJJA 1K47A 4N58A 1VQ9S 4YY3J 3KYLA 2H48B 4NXMJ 5H9EK 3AE7B 4RCOA 3BR8A 1PAEX 4CO3A 1FA0A 4F50A 4BDPA 1FD8A 4ZITA 5CA5A 3LWLA 3TUZC 4EO6A 2K1RB 5BR8J 4MJSB 2IO2B 1UMJA 1YRTA 5CH7B 2WYQA 1KVKA 4NLPA 4JI8F 4J9LA 3QBCA 5IAAC 5CABA 1C0UA 4WWMA 1HD1A 1WTBA 3M9NB 1WGHA 2I1KA 1WC6A 2B4UA 3T1YJ 5DM6Q 1VCBA 3CVKA 4J9KA 5T14A 1IXKA 5DDQC 1X4FA 3H5XA 5BJRA 4F02A 3PRVA 3W5VB 2XGPA 4ZLNA 2NZ4A 4QR1A 1AUSL 1FFSB 3NRBA 3D5MA 3GYGA 2PT0A 2D3OR 2QMWA 1V1PB 3AJDA 3WDOA 1I4PA 1A70A 2RQ4A 1FTCA 2ZNVB 3S2AA 1FESA 3ZTSA 4HI2A 2Z2LA 2A2CA 2QLJB 4QIFA 1EF5A 2LJ5A 5GMKa 4LF1A 3FSXA 1WXQA 4LBPA 2ZUAA 4ZVQB 2HK2A 1F9FA 4YDDB 5EUHA 2C7NB 3V61A 4IRCA 5D15A 1HBUA 1F9JA 5DLGA 2BYTA 2IZVB 1VR9A 2KVQE 1KTVA 2MZ1A 4RF1A 4YEAA 1HR0F 2ALZA 3OTOJ 2WOMB 3K89A 4P2XA 5A0YB 1U4BA 3LB8C 2KK8A 1LQ9A 3PZ7A 4YN3B 4ECQA 2BWFA 4AQYJ 4YT0B 4RW9A 4DR5J 2FTRA 1VFJA 2VL1A 2CWKA 4RUBA 2GOWA 3W5ZA 4LUBA 2FNJB 3A4SC 3C6UA 2HLUA 3MCNA 5HJXA 2A6MA 3SDEB 2J6UA 1HZ6A 1CSJA 4ENOA 3D1OA 5KG3A 4NX9A 1Q7YT 2DH7A 4U7UD 4JB8B 1YRXA 1Q53A 2RRBA 4H4KA 4ED8A 1PBUA 1YK9A 4B9LA 2KJ6A 1VC5A 1NJWA 3VAJA 3OQ2A 2E9RX 4F4KA 3K5OA 3OJUA 4M5KA 2B76B 3DDIA 2HIQA 2IGGA 3AEBB 2JHEA 4USVA 3US5A 3AECB 3GWCA 1LEOA 4DPYA 2XNRA 1KP6A 3B8HA 1FT8A 2D3O1 1EU4A 3EXCX 2L9NA 1LWFB 3ONQA 1JLQA 1FRDA 1YJTA 1OQYA 3SBMA 3CMQA 3PV8A 1R89A 4RM8A 3ZNUA 1K50A 1PYSB 4W9GA 3PHTA 2FJEB 3PXGa 3NZSA 1VI7A 1V97A 1RTIB 2VBYA 3ITHA 1CJTA 4M5NA 1R8CA 3FVYA 4KGZB 1GB4A 4FBTA 2DR9A 4LRCA 2Z56B 2RIJA 1D9AA 3MUVP 2JEJA 3DGPA 1PDXA 5CHWA 3GLJA 2HHHF 3HX9A 1LK5A 1YJVA 2HHWA 3P1MA 2OPSB 4OYWA 3AD7C 5A2QU 1S1VA 4HT7A 1N4LA 2KDBA 2AP6A 2VD3A 3CT9A 3QGGA 1V5TA 2J9EA 4WJNA 3PX6A 1TY0A 2W55A 5DRKA 2ZOGA 1D8YA 5EE1A 3DMJB 2NXNA 2JX2A 1SE3A 2QEJC 3ZDTA 1PGAA 4FYYB 3HT0A 3SCKE 4M1KA 1URNA 3X1LB 3N1XC 4W9LA 1XNQF 1IGCA 4USUA 2CPDA 3KLGA 5DJBA 2CQ4A 3RBEA 2A4ZA 1RI7A 1U4AA 1EZZB 3LGMA 2MW5A 1TKDA 2VJUA 3L4PA 1V6EA 3W64A 2QX0A 2EFGA 4HHHA 2O6VB 2QC8A 4ZP9A 1S1WA 2KFKB 5CZXA 3CCZA 1TV6A 2AMCB 3CIZA 1RLCL 1HNZF 2B9WA 4UUWA 4KYZA 4P73A 3ZXVA 2BE7D 3GS2A 2IO0B 2OEKA 4WPAA 4IOBA 2RKIB 2BRLA 1VCTA 4FKXA 1PBAA 1MVKA 2G1HA 2K22A 2UVVA 1HYSB 4DPOA 1ROEA 3F41A 4FVCA 5IT9U 4P1CC 2ZEJA 1KFSA 4AT1B 2BYEA 1IWGA 4DF4A 3ZIMA 1T9WA 1RTHB 1LW2B 2DGUA 3UFCX 2AX0A 1JNRB 2OD6A 3ZNHB 2IYIA 3NCQA 4LF6J 1KDNA 4C7QA 3WIMA 3ECIA 4IWPA 1SI9A 4WXOA 1ULRA 4BKTA 4ZJOA 1TFWA 4JL9A 2GMLA 2RUSA 1Q0NA 4RO0A 3HK0A 2HVIA 4Q7AA 1YD8U 3AN1A 2KXHA 4OI4A 3V6HA 2ZC3A 3CULA 1SXLA 4UDUC 2JH3A 3Q3MC 4A6QA 2ZHOA 4XDCA 2DCUB 1FJCA 4LSLB 5IT4A 4PG4A 1QE1B 5J2MA 2RU3A 4GMVA 3U7ZA 2YKNB 7FD1A 1N8RT 4C6AA 3BVMA 1R3NA 2NXCA 2MKIA 4J91A 4ID5A 5DLFA 1LW0A 4ECSA 4LIRA 4PXDA 4TV3A 3QRRA 4P71A 3ML8A 4JI2J 2OAUA 3E8OA 3U8ZA 4YSZB 2O67A 2N1WA 3SFUA 3S7RA 5DCNA 3HLUA 4CNZA 2DNHA 5E2QA 1JWAD 4PPDA 1I94F 3SXLA 4DV2F 2M8SA 2VBXA 3RRGA 3T3NA 3I55S 1SKSA 3NS5A 3MCOA 1UNSA 4KGXB 3IMQJ 3N28A 2QFJA 4R8UB 4OYBA 1MWQA 2OJRA 3P49B 1Q1OA 2VG6A 3R7BB 1QF6A 4WK3A 4IG3A 1C1BB 4QCLA 4LRFA 1EP4B 4ZIVA 1JJ2R 1N5YB 2ZVNA 3KLHA 2GBMA 4ICLA 4HHJA 4W90B 2D7SA 1U1QA 1TVRB 2G0JA 2INDC 4X84A 1ZGUB 3SFEB 2V4RA 3BF4A 4WTYA 2NPTA 1RLFA 4G11A 2PA3A 1WACA 1UGMA 1TKZB 2G1EA 2JZ3B 3OFGA 1QOAA 4KIAA 2XO7A 2DISA 3KG4A 4MH8A 4YY3F 2PE9A 3CJQA 3JSMB 3GZ7A 3HSGA 1TUVA 1DY3A 5KG2A 2RSQA 4DV6F 1RT5B 4PABA 2PD1A 1G1XA 2R7VA 3MM5B 1WH3A 3PGEA 5DPSA 3GYXB 4WFYA 3W62A 1NHVA 2NS1B 4PXEA 5GAHI 2I8EA 1RT3A 3T1YF 2LFIA 4PG5A 5AXLA 1TGZB 3WX4A 2PI4A 5CYMA 4DR2J 2W7OA 1RT1B 3VHQA 3G96A 2F8MA 4P2FA 1VYAA 3VGUA 4NOHA 2MQQA 3IG1A 1A7GE 4DUYJ 5A6WA 3FUYA 4NAMA 1TJEA 2ZOFA 4YXDB 4DSEA 2HHSA 3DYAB 4PYDA 2FLNA 4ECRA 5KFZA 1YJ7A 2W4DA 4DBQA 4Z2XA 4RX6A 2RR9A 1RYSA 3PO5A 4LF7J 1V80A 2C3OA 2M9KA 3ULHA 3BQ1A 3DRYA 3HHEA 3RG6A 1VBXA 2K6DB 5AZGA 2HNZA 3OLBA 1C78A 2LXCA 2L3ZA 2HPUA 1VIXA 2ASJA 4H2AA 1NI3A 4EZJA 2ASLA 3W8GA 1QZEA 3URYA 2WB1D 1KD1T 4DN0A 2JOQA 4C8NA 4W9CA 1AA1B 2I0XA 2RH3A 2EKEC 4XWWA 2XMMA 3ILLA 5JVGQ 3R2IA 4ZVRB 5G5GA 3QPIA 1SUQB 4DZ6A 3ZTRA 3GTYX 4QWAA 2CRLA 5KHQA 2DNQA 2HVHA 4F4YA 4AQYF 3T9NA 4NCBA 4KKIA 3GB0A 1CULA 2C9WB 2HZAA 3U4EG 4DR5F 1QLNA 4DL3A 1AARA 3EPIA 2DX5B 3U1LA 2Y1JA 4B3RF 3L08A 1JLAB 4XAKA 4OJ3A 1M4VA 3CW2C 2HEKA 1YZ7A 1HBOA 2NBWB 1NDPA 3E56A 4ZRPA 5CZVA 1MI0A 2KFJA 3Q69A 3TJPA 2PGCA 3F73A 4NMXA 5D3DA 1IBLF 1NJZA 1Q8KA 1VS3A 4BBNC 3J81Y 2RVJA 3H2UB 2X3GA 1RAXA 4Y65A 1EX8A 2HJ8A 1HHTP 3ZZYA 2GQ2A 2Y1IA 3Q8UA 1WMHB 3NGDA 1WSPA 2AX1A 1HNWJ 2YBVA 3HT3A 4HWIB 2WXHA 4K7WA 1WG1A 1SC3B 2DHHA 1RADB 1KLMB 3G9CA 2O66A 3P2BA 2ZFHA 2JPHA 4EZ9A 5HMZA 2NZCA 1AXQA 2WQYB 2KVIA 2CQDA 5KT6A 5I42B 4RWWA 3D7SB 4CLPA 1X0PA 4DX6A 4RBTA 1UZXB 4DSLA 1B3TA 3B54A 5LJ3Y 4NPNA 2MBHA 4DL7A 3ZJTA 3JB9k 2WXLA 1WHVA 4CLSA 3LPEA 3X3UA 5G5HA 4GLSC 4TQRA 3I56S 1O0PA 4KZ0A 2KACA 3FZBA 2C2NA 2U1AA 4NJ6A 1J8CA 4F36A 4ILRA 3RZAA 2B5JB 4EK2A 5IZHA 2IBKA 2FUG1 4RUCA 5U47A 4JE3B 4KRWA 2OPRB 3C15B 2Y3YA 4K4VA 3DCGA 3AOCA 3N32A 2UVUA 2RILA 4FA6A 1ACCA 4DV3J 2MGZA 2M8HA 5FLXU 1RT2B 1HQEB 1MU2A 4AXIA 5HFYA 5GMEA 3CCUS 4NAWB 3RAMA 3MGJA 3RB3A 3ZRFA 1XMOJ 3FMWA 4PS7A 2B8PA 1IKVA 2P9EA 1HFEL 5D0HA 2R2RA 2HNDA 5GVQA 2X1AA 2KHWB 4TMAB 4E3CA 5HI1A 2WDTB 2OHDA 1H3DA 5IOLA 3TX8A 1LK7A 3TO8A 2LGXA 4HTIA 1FWLA 1U6FA 4DUTA 3ZFVA 1TFYA 4GB9A 3RCZA 3GPAA 2FC8A 3SZ2A 4J9PA 5K8PA 3AEGB 3D0HE 5KFRA 3W5YA 4BOZB 2LRUA 3NHEB 1X7VA 3U52E 1Q82T 2KU7A 3BK2A 3THPA 3R2DJ 1SJ1A 1AYEA 1SF0A 1SXTA 1S97A 5D7GA 3PYFA 1TAQA 3VR1A 1Y56A 1JLEB 3MPVA 4MMOA 3PHWB 5K8OA 2AF6A 1CG2A 4ID8A 4GXBA 2J9DE 1HNIA 2V6AA 2J52A 2J9DA 3M2VB 1KLVA 3OD2A 4RLEA 1ZH5A 5F8NA 3CCLS 2XS2A 4Z37A 2E5IA 4WFAQ 2GO9A 2QN6B 3R97A 4X4UA 1E8WA 3MR3A 3VQIA 2A0FB 4JI6F 4F67A 4WQOB 5J1EA 2ZH8A 1GMVA 1TL1A 2EI5A 2LGDA 3KG1A 4YR2A 1D9FA 1NK7A 1Y5NB 1FX2A 1MSWD 4KGVB 2Z58B 3I5JC 2R7WA 2UUTA 1XNRF 2Q5WD 3QWPA 1QOGA 3J7YU 1SKUB 1EUVB 1U26A 2RUGA 3BVZA 1ZAXA 1UEVA 4B3TF 2BPSA 5BYRA 4B0MA 3BO2A 2V68A 2IRUA 2Q1LA 3BN7A 5FDLB 2PFFB 1JALA 1P1TA 1VHIA 3D54A 3IXSA 1HL6A 3CDBA 2GJFA 5GAEI 4X62F 1RBOB 4DBGA 1ESFA 4URGA 1L0VB 1RTJB 2C28A 3P4QB 2G9HD 4U7UK 3QMQA 5ETOA 3TYTA 3NZUA 5J2PA 2RRNA 4EEYA 2VQEF 2QG9B 4DEZA 1UVNA 2WXFA 3LQVA 4AD6A 4X4SA 2HBRB 2ZE2B 4KKOB 5E6JA 1HA5A 2MQOA 3G6ES 1SL1A 3FBEA 4UOHA 2CPIA 3C19A 1HI8A 2HFOA 1UP1A 1GX5A 3DDCB 3HMJG 4ZK7M 3RW7A 2YX1A 3DKDA 2IY5B 1LNQA 2MYFA 2YKPA 4JV5F 2FHKA 3RNEC 1LM8B 4NLRA 2KOXA 1JWMD 3WCQA 1RWPB 2VBZA 4P7TA 1HBNA 3KUGA 3L95X 1CJUB 4S0MA 4DV5F 4P10A 2CPEA 4QWDA 1IYFA 4DCJB 5HMXA 3UVJB 4PPZA 5A6PA 5IS2A 3SV3A 1M90T 2KYXA 1E7UA 2CVIA 1K9MT 2KJVA 4PUOA 5KFNA 1J5OB 2EWHA 4EWTA 3GOEA 4RR5A 2B0GA 1WHXA 1T0QC 2V4JB 1P1AA 3N79A 2VODA 3CJRA 3T9LA 4LRBA 1F5CA 2IGHA 3PS6A 1REVB 4F2SA 1HBMA 4TY8A 4ECZA 4ZHPA 1QY7A 3P3DA 4A8MP 4XPEA 2WXRA 2IVFB 5F9LA 3O65B 1B0TA 1MROB 5KFWA 3AD8C 1M5PC 3PIOQ 3BSAA 3RRKA 2ZHAA 2CJAA 3RNGC 3CJSA 4C8YA 3WQPA 4OLOA 2J4XA 4ED2A 2HGLA 4FJZA 1F52A 2B9XA 3MM7B 3UNYA 2ERRA 2B6AA 1L3UA 2AQ3B 4W9IA 2X7IA 4XPCA 3LALA 1P7EA 3AXKA 2G3QB 2AWZA 2K1RA 4MJSA 2X38A 8RUCA 2WB4A 4U8VA 5ETSA 1JCKB 1U47A 4UOGA 5HI7A 1NDLA 1NI2A 1K0VA 4REZA 3QWZB 4NEYA 2MZTA 4QPXA 1XQQA 2VDHA 3MJ5A 1HW8A 1RT6B 1NLKL 3DN9A 3CC2S 4IG7B 3IBCB 2QLWA 1VISA 3NGTA 4DV7J 1MNEA 2H4WB 2KQ4X 2K3IA 3DLEB 1C79A 3O3LA 4PRFA 2HVDA 3HZGA 2VZ9A 4YTPB 3AE6B 2D9PA 1H6KX 2VKZG 3Q8AA 1I4HA 3ZZ0A 4ZLJA 4BKSA 3GIIA 4FULA 4ELTA 1ZW7A 3J7A1 1RGVA 1YLXA 3ETOA 1KEKA 1YIWA 1R8PA 4A8OA 1T05B 2EKIA 3BKTA 2R4FA 4LFBF 2BQUA 2R7QA 2GS8A 5A8KA 2AEMA 4JGHB 2G2ZA 1GNKA 1RYJA 3HKWA 1FXAA 1N5WA 3ELHA 1YSJA 4NCAA 1FFGB 3M8ZA 3TX0A 2QV6A 4PQUA 4US9A 2HBZB 3TBLD 5J2NB 2WOMA 1ZUD2 4RWXA 1VZ8A 5A0YA 3KK3B 4GDKB 2UU9F 4CO5A 3PEJA 4PEOA 2XN9C 3ZZUA 1U25A 2RPVA 3ZJVA 2FLOA 1WEYA 2DIVA 2MQPA 5L38A 2UP1A 3H59A 5ETMA 4DR1J 4GO7X 4YP3A 4HL9A 3MD3A 2WXPA 1BQXA 1X4EA 1VJWA 3SDEA 1JXVA 4AUQC 1R8AA 3FSIA 2R7RA 4WKRA 3BR9A 5KFVA 1WE7A 3VDZA 5E6OA 5E3CA 2IRXA 3RPFC 3CCES 1VC6A 2DY1A 2IC3A 1H4RA 1C76A 1G7CB 1FFVA 2DHSA 4CLYA 1QAJA 1WELA 4OVZA 4URSA 4WKYA 4DI6A 5CCLA 1F1HA 2WW8A 2GMHA 3Q86A 1S0MA 2QA4G 1M1GA 2VBWA 2WBMA 5EWEA 3W9IA 3K5NA 4LRDA 2KM8B 2XZTB 3IAS9 3AH7A 1AROP 4LF2A 4B9UA 1WZ0A 3H8HA 1CZPA 5AUKA 5HLFA 2FGOA 4C2MA 1LWFA 1RACB 1WJNA 1ICEB 2RF2A 2RS2A 3GV5B 4ZVGA 4ASWC 3WIVA 2BKPA 2KG0A 2FCMA 5BMHA 1URRA 3PFEA 1RTIA 4BWMA 2MSED 4RZRA 1XMQJ 4RW8B 1IN0A 5KG0A 2PSZA 2ADBA 1A6LA 2X8XX 4QIGA 5HQLA 3QFHA 2BWES 1FRIA 1SC6A 2ATLA 1HD0A 3A8JA 5E3AA 3I9V1 3QJJA 2KVZA 1PYTA 4C3LA 2WVEA 2ZD1A 2N7DA 1JXEA 1H98A 5C25B 4II3B 4OHJA 2JRHA 4MT5A 1UAWA 1SB6A 3R5JB 4GVBA 4XWTA 2FVPA 3DLHA 3H20A 4DQQA 3CSFA 3FEYB 2VH7A 4WP8A 6AT1B 3E01B 2XB2D 1YQ3B 3A4TA 5C2TB 1X5TA 2MA9B 3V05A 1FXDA 5I3UA 2DGWA 4HROA 2E1RA 2FIDA 2E5LJ 2G2OA 1NH7A 4EMDA 1D5ZC 3JTNA 2GCFA 2BE2A 4FP9A 4WWPA 3Q8CA 3EM1A 5J1NA 2AGQA 3JSRA 4Q2LA 3TAQA 2VPZB 3GP9A 1KWMA 3AEDB 3LF0A 4X65J 1VRUA 2W9NA 4GDLA 3H5UA 4OHYA 2EMTA 5J1PA 2O6VA 4LF4F 1ZOTA 1PGBA 2BXJA 2JX5A 1VC0A 4LFCJ 2KFKA 3LDZE 3CD0A 4HHUA 4IQXA 1HNVA 5DG7A 1L3TA 3D66A 1TTNA 4ILLA 4F3MA 4C0OC 2K0PA 2W8KA 3CE8A 2XI3A 3HUIA 5JH5C 2RKIA 3RJMB 1T0SC 2CDQA 3CCRS 4W9FA 4J9UE 5IV4A 4DXFA 1UWMA 3H5SA 3EHVA 1IKXB 4J9OA 4WFZA 1U8WA 2RHSB 5DDPC 4DV4F 2FJDB 3KOAA 1IR0A 1V5VA 2CDRB 4O3SA 1RE1B 1I51B 4IH7A 5KG1A 1RHMB 4MKAA 5D78A 1R4MI 2MJDA 2M17A 1CJEA 3ILJA 3OL7A 3T6JA 4ER8A 3PFOA 4IG0A 2YWGA 5CYJA 1BY9A 2AWTA 1FVSA 5E5NA 2KJWA 1TS2A 4DR7J 3RR8A 2IMOA 2UV8A 4NLOA 4DPTA 1DQ9A 4EZKA 2IIHA 4IH5A 5HO4A 2XI2A 1MFWA 2QLBB 4P7IA 2B8QA 1S1TB 2R7XA 3EDQB 4FF4A 2LVOA 3DI6B 2P9GA 4CLZA 2DKOB 1X4BA 1UVJA 3BO4A 4O4GB 1VHFA 4CO7A 4YHHF 1N48A 2KZMA 3NKYA 3CDEA 1Z4UA 2YNFB 4DR6F 4DFJA 2Y1RI 3MMAB 3GQCA 2YKNA 4OVUA 5KFHA 2MSSA 2ZH2A 3D3BJ 3I57A 3DBHI 1J0GA 1FK9B 1UEKA 3IR7B 3HM9A 4IUFA 1S76D 1RHKB 2F8HA 1DLOA 4JI7J 4ARIA 1VOMA 3TI0A 2B4OA 4P52A 4ZDNA 3W5XA 4BCAA 4NXNF 4JI0F 3EGRA 1IKYB 2BABA 1YJ9S 4LLGM 3T5KA 5J2QA 3MPWA 2FHMA 1S3SG 5D94A 1F3FA 4LF5F 1AW0A 4KPCA 4R8UA 2I5JB 2EBEA 2WONB 3PRBA 2HWHA 2IY0B 1U1LA 1C1BA 1NRKA 4KVGB 1PGXA 5AJ3J 4X57B 1N5YA 2J8SA 1EB0A 4IO1A 3AH6A 2EC0A 3HPOA 1PYOB 4TQ1A 1TVRA 3K2YA 4OYOA 2DR7A 4DU8A 1BQNA 3MC9A 5CHCB 3CPWR 1K52A 1TKZA 1S1QB 3QZ7A 3T3OA 3VAMA 1SEBD 3KVFB 3G2XA 5FR3A 2V5HG 2KMMA 1RT7B 3A9KB 3JVZX 3I0SB 4FJYA 4A3OA 2PVGC 4C4WA 4CLTA 2QCZA 2EMSA 3MM5A 2WWZA 4C4VA 4DQRA 3KYDD 3GJSB 2W9BB 4NY0A 3MTKA 3IHPC 4HRSA 1IVZA 3NVYA 4NJCA 2KMAA 2Q3PA 3U27A 2BB6A 2WK4A 3VGTA 1U1RA 1DZ5A 3K7RA 4WH4A 2SAKA 3NS7B 2H5EA 4C0BA 4NI2A 3IR6B 3FC4A 3OTCA 3VR8B 1P27B 2MBBB 1Q8BA 3TIXA 3DYAA 1S9EA 4UZBA 3M8PA 3QATA 1AW7A 2Y1LB 1KBRA 2KM8C 3M6UA 4DR3F 2OJWA 2RNEA 3W2VB 1OPIA 2UUAJ 3VGSA 2C7HA 2MJNA 4W4MA 2LJIA 4EI2A 4WFBQ 2K6QA 2J0MA 4J9RA 2ZH5A 4ATNA 3NY5A 4NZLB 3LP1B 2QFIA 3DRPA 4GKJJ 2XCAA 3AJ1A 4K1RB 4G1PA 3A9JA 2MMYA 1X4GA 2MEWA 2W01A 3CC7S 3RUIB 1NH8A 4LJMA 4M5MA 3FEXB 2XEWA 5HL7Q 3PW5A 4YOEA 3TEZA 2FVCA 3S6EA 3GIKA 1DHMA 3H0PA 2OEMA 4KX6B 2DNRA 4OZ5A 1SUQA 1OEYA 1WG5A 1K1QA 2ACYA 3L17A 3Q2SC 1X5PA 1KRHA 4CYEA 3DLKA 4ZVSB 1YJUA 2HQIA 4ZP8A 3TEXA 4LF9J 2HQCA 1EETB 2OJ3A 2D9OA 2R8IA 1LQBA 3OL8A 4JI1J 2APOA 1S9GA 4KQZA 3SCJE 3CDUA 3U7JA 4BC7A 1HEZE 3TEHB 2IYGA 4CO0A 2JFKA 3PM9A 3M2RB 4DL4A 4E71A 3T5LA 3ZNID 5CAAA 2XWYA 3TJ8A 1TZ0A 2Z0DB 2R9LA 4DQSA 3CDAA 5CYQA 5H8YE 4P9SA 2H88B 3VZHA 1U7LA 4FF3A 3PYDA 4ED3A 3R2TA 2MKSA 4C8LA 1S0OA 1Q78A 1ZM4A 2FJXA 1D6EC 4ZP7A 3K8WA 4JUZA 2RJZA 1JLCB 4E2FB 3MAAB 1UVKA 3DM2B 4WQMA 3QAQA 3SCIE 2ZBRA 2G13A 3MEGB 1TTHB 1N63A 1HWIA 4DFKA 4LR9A 1G3OA 3GILA 2WTFA 5L95C 3VTIA 2DITA 4G0NB 1DOYA 5I42A 2M0AA 3PTFC 4A46A 4WK1A 2CPZA 1C1YB 1U49A 4ANEA 2B56A 1L0XB 3HVWA 1DAXA 3RNFC 4R0EA 4LSNA 1S0VA 3PRDA 3PKYA 1T03A 3CIRB 3UI3A 5TSSA 5F0UA 4RU2A 3AODA 2MXYA 3DVNU 2B5JA 2MHNA 1Q79A 2NQPA 3M8YA 1Y9OA 1UVMA 2K3KA 1P6TA 1SIZA 2M8DB 1QTNB 4YR0A 2ZJRQ 2DZJA 4OYZA 4B3MF 1M5OC 2K39A 1DYQA 2XULA 3NNHA 4YMEA 1RT2A 3MPUB 4NAWA 1PIEA 4YB6A 1VQMS 2BR0A 4B9VA 3R6LB 2E5HA 3LJ3A 3I32A 2ROGA 2FLLA 4ZHRB 5HK4A 4J9MA 4TQSA 4JLCA 1EKSA 1SIJA 1RABB 5LSLA 2XO6A 4A8KA 3BWUD 1U0HA 1FNXH 2ZNYA 2Y9HA 3VVUA 1JB0C 2RDHA 1T9TA 4N59A 3BYPA 3SQGA 3TUIC 5LXRA 3K0JA 4K0KF 4OHWA 3D68A 2OEJA 3SDLC 1LWCB 3Q8PB 4WF9Q 3KUZA 3CO9A 3H7PA 3MWBA 2DNMA 1MW7A 4FBUA 2E3TA 5KFIA 3WAOA 2Z0EB 1S6OA 4FBJB 1JLEA 1UTAA 3PT2B 3U7DA 2YWKA 3E9SA 2L00B 4X4OA 4FXVA 4OI2A 4C11B 3UQAA 3M2VA 4P7VA 1ZM9A 2ROPA 3HM3A 3MHSD 2FCSA 2NVUI 3T6BA 4A20A 3EVOA 1R7IA 4CTAB 3CCVS 1LFWA 3NXZA 2AL6A 3T1AA 1U2FA 4U67Q 4LNIA 1L4DB 4Q2MA 3BYRA 5E6NA 4KSLC 4AL6A 2KFYA 3TQEA 1LXJA 1IBMF 2DNNA 1Q10A 5D6GA 2KZZA 4JV1A 3LP2A 3CCMS 1PJ5A 1S99A 5L1LA 3QLHB 1NK5A 3QK0A 2N4CA 4NZ7A 2DWQA 2KG1A 1R43A 3OT9A 4C9DA 3D6FB 4K7UA 1KM7A 4NASA 3ZW3A 3FCHA 2MHEA 2XNAC 3DLJA 3DGVA 3IO1A 4CQ1A 5DS7A 2FIFA 2CQ3A 2MQLA 5EGYA 3UQBA 3O6QA 1FKPB 1RSCA 1K53A 4MT1A 3WC0A 2ZUGA 3R8YA 4BKSD 1RCXB 3AULA 1YJJA 3PJWA 3KG0A 1OY6A 3UDEA 1RTJA 4PYZA 4R0JA 1ZETA 1B64A 3CJ8A 2PMZD 2AYEA 4ECUA 3L09A 2WVDA 3GZNI 5B0EA 1QD1A 2ZITA 2MJEA 3EWGA 1X1MA 1FRJA 3NOBA 3ISNC 1NMEB 2XMTA 1QILA 2KQSA 1J7BA 2ZE2A 4O44B 1L4ZB 5I4DA 4F4AA 3VRBB 4HLEA 1AFIA 1BMLC 4CLFA 1XLPA 2HG4A 3KXDA 3GU0A 5CTRC 2D69A 1T6BX 1WF9A 3CF5Q 1SJFA 3FJ2A 4KHPJ 2YH0A 1OEYJ 1R4MB 3K5PA 4EFAC 3O1LA 4OZ0A 3BGUA 5GAGI 2DENB 1KHWA 1OWXA 2LWPA 4CNYA 5LL6d 4WJOA 3IR5B 1C2PA 4EZ6A 1C1CB 3BK1A 4PCQA 5KOWA 2Z2MA 5GADI