1RWSA

Backbone solution structure of mixed alpha/beta protein pf1061
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
KMIKVKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords hypothetical protein PF1061
publication title Backbone solution structures of proteins using residual dipolar couplings: application to a novel structural genomics target.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 4
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2003-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1rwsA00
2PVOD 4YSXB 1WWTA 2KMMA 1N5XA 1T3QA 2CU3A 1TKGA 3SFEB 1VJKA 1N63A 1YQ3B 3AE6B 1PFDA 1QOGA 3VR9B 4C80A 1PDXA 1XLPA 1XLQA 1XLOA 3AN1A 5EE9A 4YSYB 3PO0A 2MH7A 1JW9D 2K22A 2JX5A 4YTPB 1QLBB 3L4PA 2JQRB 1TKEA 1CJEA 1PUTA 5C2TB 3SR6A 4US8A 4US9A 3CWIA 2WLBA 1GAQB 1SIJA 3FAHA 3AE1B 3HUIA 1KF6B 1NVID 1L6VA 3B2FA 2Q5WD 2PKOA 2WU5B 3RPFC 3W9CB 1RFKA 2W3RA 2MJEA 3AB5A 2K5PA 4ZOHC 3AECB 3W5VB 4YSZB 3AE8B 3VRAB 2QIEB 2BS4B 4C7YA 3AEGB 3AH7A 2MJDA 1ZOYB 2LEKA 3AEAB 3ZYYX 3AE5B 1QF6A 1NI3A 1FFUA 1TYGB 1ZUD2 2M56B 2N0SB 1L0VB 3VRBB 1JROA 2BS2B 2EKIA 2L52A 2L83A 4A9AA 4N59A 1AWDA 1OQRA 2MJ3A 2WU2B 5C3JB 1B9RA 4WQMA 1YQ4B 2W54A 4JWUC 2E3TA 1N60A 1RYJA 1WYGA 1SB3C 1V97A 1SF0A 3DWGC 2AX5A 2QJLA 4JWSC 1JQ4A 4KX6B 1ZXIA 3AV8A 3WCQA 3AEEB 1WRIA 3NVWA 1FFVA 5H8YE 1FM0D 5MPOA 1VDVA 1KRHA 1J7CA 1ZP0B 1RM6C 2PIAA 2WDQB 3P4SB 3P4PB 3AEFB 3NVZA 3B9JA 5AUIA 3DWMA 2WQYB 1JWBD 1UWMA 3HRDD 4N6EB 3FC4A 1FXIA 3AE2B 1TKYA 1XLNA 2M19A 4LTUA 2W3SA 4HRSA 2H88B 3NVYA 3P63A 3NVVA 2H89B 4HROA 4IDIA 3W5UB 2DBYA 4YTMB 1QOBA 1YJJA 1FRRA 2WDRB 1DOYA 1AYFA 2CJOA 1FIQA 2WS3B 2BS3B 1RWSA 1WXQA 4N58A 1GPXA 4C7ZA 2FBWB 5G5GA 4FXCA 1J7AA 1QOAA 1E9MA 1VLBA 1XO3A 3AMZA 3EUB2 4ZHOA 1FMAD 3NS1A 1J7BA 1TJEA 4YTNB 1NENB 3AEBB 4YT0B 3AE3B 5EE3A 2CJNA 1F0ZA 2WDVB 1NEKB 3AE7B 4ITKA 1L6UA 3VR8B 1WGKA 1OQQA 1E7PB 1FO4A 2WP9B 4ZHPA 2G1EA 4JX1C 1ROEA 1EWYC 1KFYB 1JWAD 3P1MA 5EE1A 1OFFA 3HVZA 1DOIA 1CZPA 4YXDB 1V8CA 1NYRA 3P4QB 1N62A 3AE9B 4P6VF 5EE0A 1N61A 1FXAA 1JRPA 1QOFA 1DGJA 5H92C 5GXGB 3ABVB 3BIID 3AE4B 2W55A 1FRDA 4WWMA 2DWQA 1JALA 2HTME 2OHFA 3AM9A 3LB8C 5G5HA 1E10A 3AEDB 3NRZA 3KWLA 2Y5CA 4USAA 2KAJA 1I7HA 1E6EB 2K9XA 3LXFA 3P4RB 2PVGC 1IUEA 3CIRB 1QT9A 3SFDB 1DOXA 1R7SA 1L5PA 2ACZB 3B2GA 1A70A 2BT6A 1YJIA 3ETRA 2B76B 1N5WA 5AUKA 1NYQA 1E0ZA
chains in the Genus database with same CATH superfamily
4NJCA 2LJIA 1PDXA 3W1SA 1V9JA 3C8YA 1C3TA 2BPSA 1K8RB 2Z0DB 5IKCM 4DHJB 1ACCA 2MBOA 2MEKA 3NZSA 2J7QB 3CWIA 4GB9A 2IPKD 1WY8A 4BZAA 1I42A 1UBQA 4A55A 3V05A 4MT5A 2K5PA 4AWJA 1SIFA 3PREA 2MJDA 4FJVB 2KKCA 3U52E 1P3QU 2JUOA 2PE6B 1E90A 4WQMA 3OWEB 4ZYNA 3V62A 3R3MA 3VFKA 3UIPB 1B1ZA 4JWSC 1Y56A 3AV8A 3C0RB 2KLCA 3KYDD 4ARIA 4CO7A 2JRHA 2L0FA 1IYFA 1I4GA 5AUIA 3DWMA 2M0AA 4N6EB 3A4SC 4IKGA 3U7DA 4PS8A 1JMLA 3IT4B 2M4NA 2QSDA 1WX7A 2DNFA 3IT6B 2JWZA 2KWCA 4ZRPA 2ICIA 2WXLA 4K7UA 4RCOA 3I3TB 2CJNA 1NEKB 3AE7B 2LGDA 1L6UA 3W2DA 2KC1A 2IO0B 1J8CA 2DZMA 2PMVA 4XWWA 1WE6A 1JWMD 3L10B 3APDA 2OHFA 5G5HA 1JWUD 3DBLI 5IN7A 1TTNA 3LXFA 4OVUA 4W9LA 2ACZB 2KN4A 4WIPA 2KX0A 1TBEA 2XK5A 4NQKE 1E0ZA 3BY4B 1FD6A 4G3XB 1LXDA 1N5XA 4ANVA 3U30A 2CHWA 1N63A 1PFDA 5AZFA 1KTKA 4LNKA 2K25A 2VZKD 2SEBD 2JX5A 1D5MC 1QQRA 1D4BA 1XEEA 4B0MA 3HIZA 5IA7A 3U7ZA 3QWZB 1WXAA 3ZNID 3N20C 2CR5A 3RNCC 4KIKB 2N9KA 3UF8A 2LVPA 5C1ZA 4AS1A 1SXTA 1YX5B 4ZRJA 5IP4D 3DBLB 2EKEC 1BMLC 1BUIC 3WA0A 2KDFB 3IVFA 4NNJB 1D5ZC 1SF0A 1WJUA 2LD9A 2QJLA 3RULA 2ONQA 2J53A 3NZ3A 4BKGA 2HJ1A 3R8BA 3ZJTA 4B6WA 2WNMA 3I63C 1ZP0B 2ZNVB 4LDTB 4JLCA 4M02A 5FR3A 1Z2MA 1TS2A 1EF5A 5LXIB 1C1YB 5DCNA 3N1YC 4HROA 1TS4A 2V1YA 1QOBA 2Z8LA 4B0EA 2BS3B 5BYSA 1C79A 2KX3A 1WRDB 4IM3A 4P1CC 3OJ3A 3NS1A 1I35A 4MJSA 3SEBA 1STEA 4DXAB 2ZNVC 3VR8B 2G9HD 4YWGG 4I6PA 3MC9A 5L95C 1CZPA 4XGAB 2OJRA 3A9KA 3AE9B 3SU8X 1WM3A 4KV2A 1T0SC 3ZDMC 2KFKB 3AEDB 2LWPA 4JIOU 3Q8EA 3PT2B 2L00B 2K9XA 1ENFA 1TGZB 1NYQA 3GZNI 2LRUA 3S2AA 5L83A 2CU3A 2DENB 2NTTA 2O6VD 3Q3OC 4M8MA 3KUCB 3AE1B 2EMSA 4MGIE 3Q2AC 5HFYA 2AWTA 2QDFA 2ZVNA 1P7EA 3EGRA 3RCZA 3RPFC 3VRAB 4MH0E 3B1LX 3VH4B 2BWES 2FCNA 2MJ3A 4TKNA 2D5GA 5I4DA 1UGMA 3ZQ4A 1TT5B 2J0JA 4NJ6A 2E6XA 1NBFC 3P4SB 2RDGA 1R4NI 1C78A 4ASWC 3CSTA 2J52A 1PGAA 3RUIB 4IM0A 2MP2B 3DBHI 3GOEA 1VD2A 4FHKA 3ZTDA 4E3CA 2D3CA 3ZNZB 1K51A 5DPRA 1XF5L 3OAWA 1ZKHA 4PYZA 1OQQA 4WJPA 1AW7A 1VCBA 2K3UA 1ROEA 4FJZA 1DOIA 2NVUI 2AL3A 4BKSA 3QAQA 2DWQA 1F52A 1OEYJ 1WYWB 2KJHB 5EDSA 1F77A 1R4NB 4RGNA 1QT9A 1UD7A 2NBVB 4II3B 3B08A 1A70A 2JF5A 3U4EG 4IG7B 5G2NA 2K8CA 2R61A 2JXXA 4C56C 4BFRA 1JW9D 2AYOB 3H7PA 1TKEA 1CJEA 4US8A 5C2TB 1EWCA 4RM8A 2D07B 5D94A 2JZ3B 2XK5B 2ZW1A 3LJ3A 3W5VB 2BS4B 2KQSA 4HLEA 2BWFA 1QF6A 4EUTA 2BW2A 2RD0A 3Q8CA 1ZUD2 1AWDA 2IO2B 2E3TA 3VVWB 3VTWA 3WANA 3DWGC 1L4ZB 4KX6B 2WXOA 1WGDA 3Q3FA 1GG3A 3NUHB 5H8YE 5IO9A 1R4MB 5HG2A 3QJZA 2FIFA 1ZXHA 3HK0A 1CMXB 3SD5A 4MDKE 4MEMA 2M19A 4DHZB 2ASQA 2KVRA 4DHJD 3E9SA 1HQRD 2KACA 2WXJA 5JZEB 1PYWD 1S1QB 5EE3A 2RMMA 3AEBB 2DYOA 4ITKA 1OTRB 1UELA 1EU3A 3ZDTA 2C9WB 1GNUA 3HVZA 3FILA 1HTOA 3PTFC 1T0YA 2WXQA 4KZCA 2RR9A 1DGJA 3ABVB 4ACFA 3L0WB 1YMHE 1SE4A 3L54A 3TUOA 3P4RB 4MJSB 4PS7A 4DHZE 2KD0A 2NS5A 1WR6E 3UIOB 3T3NA 3SFEB 1FCCC 2KOXA 1SGHA 3A9KB 2L05A 3ZVVA 3AN1A 2AEHA 4KSLC 2K22A 4M0WA 1MPEA 1E7VA 4TV3A 3WIMA 4JE3B 3MC0B 3NG0A 2KJRA 3QC8B 4GLSC 2Q5WD 2UWQA 2PKOA 4LLGM 2I1KA 4G0NB 2RGFA 1X1MA 1E5WA 4IM2A 5D3DA 2MA9B 4GSWA 2DZIA 4RGOS 4XDDA 3AE5B 2D11A 2PEAA 1JROA 3NJTA 4W9GA 5HKHA 4N59A 1GC7A 1UWXA 3IG3A 3RMKC 3BWUD 2JPHA 1OGWA 4OW0A 3GP7A 4MSQB 1KRHA 3X23A 2PIAA 1V49A 1MVKA 3B0AA 2NTSA 1FXIA 4NY0A 4F7ZA 3NVVA 1WX9A 1P98A 2WDRB 2CHXA 2LRWA 5HHDG 3T8MA 1WJ6A 2JSVX 4GXBA 4L2YA 3PPAA 4W9JA 4A3OA 4MGKE 2ZPNA 4IOIE 3WAMA 4WJQA 4FULA 2WXNA 3BYTB 1LFDA 2X8XX 1JRPA 5GMVA 3AE4B 4RF0A 2N7DA 2W9NA 1KLVA 2KVZA 3HM6X 1VZ6A 2LZ6A 1IUEA 1C4AA 1DOXA 2XBBC 4HKQA 5FR6A 3A9JA 4RFBA 3TEXA 2YEPB 4YSXB 3BVZA 1QOGA 1UBIA 2GRIA 1XLOA 2INDC 3BZDB 3M63B 1F2RI 3MTNB 3SR6A 4TQ1A 5TSSA 5E6PA 2GBJA 3PZ8A 1TZ1A 5BMGA 2WU5B 3PSEB 2G4SA 4P16A 2IY1B 2M8SA 2QC8A 3Q8AA 4JQWC 4AOFA 2N1VA 2L52A 3H7PB 1ZDVA 1OQRA 5CX3A 4IWPA 3R7RA 2KZRA 3ZW3A 1L7YA 2AX5A 1UZXB 1VZ7A 3WCQA 5JH5C 1J7CA 4P1BC 3P4PB 1I4QA 3AEFB 3KYCD 1DYQA 2V3SA 3B9JA 3DHHC 3OJ4B 2N9PC 2N7JA 4DDID 4B95A 2K6QA 1E7UA 1YJJA 1AYFA 4OZBA 4HJGE 3EHVA 1KH0A 4A6QA 1QOAA 2J0KA 4NAWA 3EA6A 1FNWA 3VHTC 2DAFA 3AE3B 2WDVB 4MGYE 1F2RC 4RM9A 3TCAA 2BF8B 2I2YA 3PHWB 1NYRA 4WH4A 3ZKJC 4RH6A 1WZ3A 4ZRKA 3V6EB 4HXDA 2GI9A 4AJWA 1E6EB 3VTVA 4WWPA 4KKJA 4HK2A 1K50A 1E8XA 1TKGA 3HM3A 4AP4C 3FILB 3TEYA 4ZDVA 3V61A 2ZPYA 5DPSA 3PO0A 4W9IA 4MSMB 2VH1A 3KH0A 4H2AA 2LHEA 2ZJDA 2ZCBA 1WGRA 3VXWA 2GBNA 2XNAC 1LGRA 4GGQA 5J18A 2V9HA 1CQVA 3N32A 2I1JA 3X0WA 4W9DA 4RMAA 3DVGX 2BVCA 2QIEB 4E71A 2PJHA 3M62B 2R2QA 1FXTB 2M56B 3RZFA 3GB1A 2EKIA 2JXTA 4KKIA 4M0WB 1YQ4B 1ZPSA 1C77A 1HXYD 2LXAA 4EKUA 5J17A 1XD3B 4FBJB 1WRIA 2GBMA 3NVWA 2KNBA 3DBRI 4KGTA 3TL5A 4EEWA 4FJYA 4HPLB 3ZRFA 1QILA 1WGYA 4HRSA 3BVGA 4X57B 1XCQL 1M4VA 4M8NA 1H8CA 4N58A 3Q8BA 2JRIB 5CHWA 2BGFA 1J19A 4O1NA 4LNOA 2AQ3B 4BOZB 3ZGZA 3ZRCA 3K9OB 4YTNB 3C19A 1WMHA 2FCMA 4OVVA 1WGHA 2C7MB 2IO1B 4ICVA 2G1EA 1AN8A 1V6EA 3KVFB 1JWAD 2PTLA 3P4QB 1FXAA 1PGBA 3O13A 2N4FA 2K8HA 1E8ZA 3HHMA 4HEA1 4ZRIA 2Y5CA 1I7HA 1KJTA 1I4RA 4S17A 1EF1A 1V80A 5HI1A 2WX0A 2D3BA 1LQBA 1WZ0A 1WWTA 4ICUA 5E6JA 2K39A 2HDEA 4C00A 1WJ4A 2BB6A 4YL8A 3V60A 2PPHA 2ZZPB 2LFIA 4US9A 5D2MB 2WLBA 2O6VA 4OVZA 2K6DB 2GMIC 3ZIMA 1L2NA 3A9JB 2LXCA 1V5OA 1T6BX 1L4DB 3AEAB 4K3BA 1TYGB 2J4XA 3VRBB 4DXFA 4KGSA 4R3DA 1T5XD 1RYJA 1SE9A 3Q3NC 1XXGA 3W1YA 3MHZA 3UI3A 2VRRB 1FFVA 1YX6B 3ENEA 4RGTA 3BK2A 1GB4A 4KDLB 1WGGA 1A5RA 2KT7A 4LCDE 3NVYA 3W5UB 4GDLA 1F9JA 1FIQA 1E8YA 4LJPB 1HZ6A 4C7ZA 2FBWB 4W9FA 3OG5A 3GZNB 1GJZA 3H6NA 2M0XA 4CYEA 1AARA 2WXRA 3KUZA 5CHVC 2KLGA 2GB1A 4LJOB 4XE0A 1UGJA 3LYYA 4RNAA 1KFYB 2XEWA 4YXDB 5BYQA 5D7GA 2LUEA 3GE3C 1FNVA 2HTME 3AM9A 4CHKA 1E10A 1GC6A 2INPE 3MP9A 4NAWB 3ZXRA 2L76A 3CIRB 1JCKB 2JYTA 1MFWA 1IP9A 1QZEA 3GS2A 2RSUA 4DDGD 4KZ0A 4WJNA 4HCPB 1KM7A 1ET9A 1Z5SB 3J9CA 3SHQA 2NR2A 3APFA 2SAKA 3HVDA 2V3NA 4ZRQA 3AULA 2WXGA 5CTRC 3M95A 3HUIA 4KGRA 2KTRA 4J6IA 4HCNB 3DBHB 1TZOA 3Q6BA 4KSKC 4PS3A 4AUQC 4GN1A 4YSZB 3AEGB 2JWUA 1MI0A 2L1AA 2BYTA 2MQJA 3QX1A 3VUXA 2VZKB 2L83A 2C5LC 3WAPA 1WF9A 4REZA 4EZJA 2FIDA 4PYUA 2BQQA 2JY6A 2LMCA 3ML8A 4MACA 1EO6A 3DQVA 3APCA 3MHSD 2WXIA 3FC4A 4KVGB 4TSSA 2FUHB 1TIFA 1WXMA 1YNTE 2H89B 1V81A 1SJHD 1YJ1A 1RWSA 4PK1A 1ET6A 1YQBA 4DXGA 3BK1A 3JVZX 2LGYA 2QMTA 1VLBA 1FMAD 5BMIA 4DK5A 1V1OA 3ONSA 1FO4A 2WP9B 1WI0A 1ZDXA 2L32A 4JX1C 1SE3A 1EWYC 5EE1A 1NI2A 3Q69A 4LNIA 4GU2A 4P6VF 5KHQA 3DDCB 3CF6E 4EFOA 1XCTL 2W55A 3UINB 2KJ6A 3RNAC 1MG8A 4IC7B 4EZLA 1F1HA 2Y5PA 2NMQA 1YN5A 2MRPA 2IGDA 3H8HA 1WMHB 2C7HA 2B76B 2WGSA 2TSSA 4G50A 3RNBC 3CMMB 3VUYA 2CU1A 2LJ5A 3FKYA 3ZNGC 1PUTA 1UH6A 2KK8A 5T8IA 2KXJA 5DPTA 3AU4A 1WIAA 3U8ZA 2ZVOA 1Q5WB 1EM7A 1TS3A 3QARA 4P7IA 3A1QA 1FNUA 2FUG1 1GOZA 4BKTA 2LVQA 4HDQA 4A9AA 4LNFA 3NOBA 4L1BA 5C3JB 3ZJVA 1SJED 1WYGA 2KN5A 5AEKB 2O6VB 5JHBA 2MBHA 5TR5A 1HE8A 2WDQB 4DQOC 1MG4A 2FCSA 2MW5A 5E6OA 1KLGD 1UWMA 1T0RC 1Y8RC 4EE2A 5D6JB 2EELA 2MBBB 4F8CB 2L0TA 3ML9A 2KDBA 4HKZE 3H1UA 1Q0WB 1C4CA 2LUMA 1I4PA 1XO3A 2GLSA 3EUB2 2FAZA 1TJEA 2CHZA 2INNE 1WGKA 1YN3A 2C60A 1IGDA 3T3OA 3VUWA 4GDLB 2DX5B 1JALA 2NPTA 4NZLB 1WSPA 2KFJA 4A8XC 2WXPA 3H7SA 1M94A 3DHIC 2BTEA 4HVBA 1L0YB 3L17A 2KMMA 3TSSA 2KWUB 1YQ3B 3UQAA 3I57A 2KHWB 1XLPA 4A90A 2GOWA 4J3OD 2M1MA 5JXVA 3ZXVA 3A33B 3VH3B 3TEWA 1SEBD 3N1ZC 4WJOA 4L23A 2QEJC 5AZGA 1VZ8A 1C9FA 3RN9C 2YVCA 2RPQA 3D32A 3Q14C 4LDTD 2W3RA 5LNK1 4GIVA 1L0VB 4CQNA 2W54A 1N60A 3K9PB 2WX1A 1SSNA 2YLMA 3VQIA 2KWVB 4D2KA 4XX5A 2KTRB 2ZW0A 2JZZA 1VDVA 1D3ZA 4BOSC 4XDCA 4K81A 3AE2B 2H88B 2MHJA 1DOYA 2WS3B 3RFZB 3H9DA 1LO5D 1D6EC 4ZHOA 2KMAA 1YOVB 1J0GA 3LDZE 1NENB 2K0PA 2DHZA 2KDIA 1I4XA 4K3CA 4BBNF 1JWSD 3RNGC 1NDDA 2V4IB 3ZJUA 3DCGA 2NBWB 1V8CA 2OOBB 4ARCA 2QCZA 3BIID 1P7FA 3LB8C 2IJ0A 4OZAA 3RNFC 3DOWA 2WWZA 2Z0EB 5CHFA 3AXCA 2LGXA 3ZNHB 3AB5A 1OQYA 3A4RA 3DVNU 3BINA 5FK9C 2MP2A 3PLVA 4A3PA 4MGZE 4GOCA 4RGMA 4K7SA 3L4PA 4JGHB 2FNJB 4QAYA 4WURA 1SIJA 2WXMA 1FCLA 3ZTCA 3B2FA 5D3IB 3R2TA 3RD2A 3AU5A 3U2SC 3P2BA 4BBNC 3QCAA 2N9EB 3TIXA 1NI3A 1VR9A 1GB1A 3N9YC 1WX8A 2WU2B 1B9RA 1UUPA 4S0RA 4M00A 1V97A 2QILA 4K1RB 2IO3B 1K52A 1JQ4A 1BXTA 2UYZB 3PRZA 5J2RA 5E6NA 3KQ4A 3CSFA 1EUVB 3ALBA 2IYDB 3L13A 3MFGA 2GBRA 2HD5B 3DHGC 3NS8A 2DLBA 3A1QB 3KWVA 1WXSA 3R66C 4FLHA 4IWQA 1JRUA 2MBEA 3IBEA 1QKZA 1E8WA 3EC8A 3P42A 1V1PA 2X38A 4YT0B 1IPGA 3M3JA 3VAWA 1MJDA 2CS4A 3MC8A 2MBQA 1C4PA 2Y3AA 2R2OA 3PRMB 3BVMA 3PRPB 1FRDA 1WXVA 3RT3B 2DYMA 5KHOA 1FEHA 1WH3A 2BT6A 2BB5A 2L8JA 2L7RA 3NZUA 1T3QA 4N9F4 3AE6B 5IAAC 4FN2A 1VRAB 4C80A 4I6NB 3DVNV 2KQ7A 1Q1OA 3R7QA 2NPTB 4HPPA 5BO4B 4GDKA 3DBRB 2KC2A 3R2IA 1KOTA 2WXKA 1ESFA 1KF6B 1L6VA 2RPVA 3W9CB 1WE7A 1V5TA 4EZKA 1FFUA 2IGHA 2G45B 2GBKA 2K8BA 4LK0M 2REXA 4IW0A 4W9HA 2IY0B 4C4VA 3AEEB 2MCNB 2LASA 5MPOA 3TBLD 2DAJA 3V3XA 1GUAB 1YD8U 4HPMB 3PGEA 2NCNA 2Z59B 4RF1A 2DBYA 2DYBA 1WM2A 1GPXA 2HTHA 5G5GA 4FXCA 2G4DB 2WDTB 2KANA 3RNEC 2LHDA 2B3AA 3P1MA 2OEDA 1IBXA 1N62A 2J0MA 3MJ5A 5EE0A 1QOFA 5H92C 2EMTA 4WWMA 1HA5A 4W9EA 2PW9A 3JSVA 3E56A 4LNNA 2INCC 2K1FA 2PLPA 3UQBA 4NJ7A 2O2VA 4NQLB 4USAA 2J42A 4WWNA 2LGSA 2JZPA 2PVGC 4MM3A 1C76A 1P0RA 2DZJA 1L5PA 4MELA 3PHXB 5AUKA 2Y5BB 1ZE3D 1UF0A 1U4AA 3DBSA 1YN4A 3VR9B 3DPDA 1XLQA 4DWFA 1S3SG 4YSYB 1L0XB 3Q3MC 4JPSA 4YTPB 1PGXA 3N30A 2UU7A 3NY5A 1K53A 2LVOA 1NVID 1V86A 1G6JA 2M17A 3EFCA 1RFKA 3PZ7A 3W1SC 4C7YA 3MJWA 2D3GA 2ON8A 2N0SB 4TQ0A 3EFUA 3RZWC 2BKRB 3JYUA 4HDOA 1SB3C 1ZXIA 4XYCA 2AQ2B 3TJPA 2N9XA 2AQ1B 1RM6C 2D2QA 2A5UA 2WQYB 1RAXA 1SE2A 1XT9B 2PE9A 4IDIA 3T9LA 2CKHB 2CJOA 4TUUA 1Q10A 2JVCA 2N9LA 4AJYB 4EOYA 3KUDB 3QK0A 1V2YA 4OHJA 1ZW7A 1RLFA 3PVLA 5BMHA 5FKAC 4ZHPA 3N1XC 2HJ8A 1MHHE 2KTFA 1R4MI 3L08A 4BKSD 5IOIA 3I5JC 1N61A 1TY2A 2MX2A 3PZDA 3JW0X 2IGGA 3L16A 2XN9C 4BVUC 1LM8B 2RDBC 3IAS1 1V1PB 3QHTA 5BYRA 2BYEA 1R7SA 3B2GA 1YJIA 3ETRA 1N5WA 4PT5A 2BBCA 1XQQA 2PVOD 2NBUA 1D5XC 1VJKA 1EU4A 4HWIB 5EE9A 4HJKA 2JQRB 2WHIA 2KDEB 2I38A 1ISNA 2LI5A 1GAQB 4OZCA 3URYA 1UNSA 3FAHA 4UDUC 3IXSA 4GMVA 1TS5A 4ANWA 1BT0A 3VTUA 2MSED 3AE8B 4NAMA 4W9CA 2LEKA 2IBIB 1N6ZA 2BS2B 2V3PA 2BYVE 2G3QB 3O65B 4WAFA 4JWUC 4TMAB 4GDKB 4XWTA 4WAAA 3GE8C 2A4ZA 1FM0D 2KDMA 3RI7C 1CK1A 3QIJA 3NVZA 1P1AA 3HRDD 1XLNA 4LTUA 2BYFA 2DZKA 4YTMB 2KYWA 2AL6A 3Q8FA 4KDIC 3BYYB 3DVGY 4C4VB 1FPYA 3IFWB 4M01A 1F0ZA 3AI5A 3PLUA 2FCQA 1E7PB 2JYEA 4NPNA 4I6LB 3NHEB 1SBBB 3PS6A 4URKA 5GXGB 3IAM1 3ZO5B 3PV1A 1PQSA 1RRBA 3NRZA 3WAOA 1WR1A 3KWLA 2WXHA 4BAXA 3UGBB 2HE7A 3SDLC 5LXHA 4JL9A 4IUMB 4KIKA 1HTQA 5DPWA 2D3AA 2ZCCA 2ZEQA 1IBXB 3VDZA 1RFAA 3WALA 4II2B 4FADA 4ZYSA 1T0QC 2RDHA 3ZUNA 2MH7A 4B9KA 4AQ7A 2FE8A 1P9DU 1QLBB 3JSVB 4W9KA 3RYTA 1HZ5A 2O2VB 1WJNA 2KMCA 3TEZA 4MM3B 5C23A 3V6CB 4XC2A 2QHOA 3KLSX 2W82A 2MJEA 1MHXA 2JU6X 4ZOHC 3AECB 3AH7A 1ZOYB 3ZYYX 2VH2A 2KQ4X 4A20A 2N1WA 4ANXA 2MWSB 5JHAA 2WXFA 4FA6A 5G55A 2YEPF 4IWOA 1KLUD 3OLMD 1ZGUB 3QQ8B 2IZVB 4WWOA 2N7EA 1JWBD 4K7WA 1TKYA 2KWDA 2W3SA 3P63A 3Q3JA 1FRRA 4WQOB 3I9V1 1WXQA 2KFKA 2BKFA 2V0GA 2OJWA 5AZHA 5LLIA 1J7AA 1E9MA 3AMZA 1J7BA 4G11A 1I4HA 1H4RA 3TMPB 3IHPC 4DBGA 3ZLZA 1IGCA 2WYQA 2KO3A 1OFFA 2LGIA 2V4LA 2C7NB 2IDYA 3QA8A 2JT4B 2MLBA 3ECIA 3N3KB 1TY0A 4XZ4A 2L3ZA 2D10A 3KW5B 4ANUA 4F1SA 1OEYA 1HEZE 4FHJA 4MH8A 2KAJA 3EECA 1YIWA 3SFDB 4Q2JA 4E74A 1WFYA
chains in the Genus database with same CATH topology
4NJCA 1T3QA 3SFEB 2LJIA 1FCCC 3AE6B 1VRAB 4C80A 1PDXA 3W1SA 3AN1A 1ET9A 3C8YA 2K22A 3J9CA 1ACCA 2MEKA 4M0WA 2SAKA 3HVDA 1MPEA 2V3NA 3CWIA 4JE3B 4ZRQA 3MC0B 3R2IA 2WXGA 2IPKD 2WXKA 3HUIA 4KGRA 1ESFA 1KF6B 1L6VA 4GLSC 2Q5WD 2PKOA 4LLGM 2RPVA 4A55A 1TZOA 3V05A 3W9CB 4MT5A 2K5PA 4YSZB 3AEGB 2JWUA 2MJDA 5D3DA 4RGOS 4XDDA 1MI0A 3AE5B 1FFUA 2IGHA 2L1AA 2BYTA 3U52E 1JROA 2VZKB 2L83A 4N59A 4REZA 1UWXA 4LK0M 4WQMA 3OWEB 3BWUD 1B1ZA 2LMCA 4JWSC 1Y56A 3AV8A 3AEEB 4MACA 4OW0A 3GP7A 5MPOA 1KRHA 3V3XA 4ARIA 2PIAA 1I4GA 1MVKA 5AUIA 2NTSA 2M0AA 2WXIA 3DWMA 4IKGA 4N6EB 3FC4A 1FXIA 4TSSA 1JMLA 3IT4B 4RF1A 1YNTE 2H89B 2QSDA 3NVVA 2DBYA 1SJHD 2WDRB 1RWSA 1GPXA 3IT6B 1ET6A 5HHDG 4DXGA 2JSVX 3BK1A 4FXCA 4ZRPA 5G5GA 2QMTA 1VLBA 1FMAD 4L2YA 5BMIA 2ICIA 2WXLA 4RCOA 1V1OA 2CJNA 2LHDA 1NEKB 3AE7B 4IOIE 1L6UA 3W2DA 1FO4A 2WP9B 1ZDXA 2L32A 4JX1C 1SE3A 2WXNA 1EWYC 2PMVA 2OEDA 3P1MA 5EE1A 1IBXA 4XWWA 3Q69A 3BYTB 1N62A 4P6VF 1JWMD 3MJ5A 5EE0A 1JRPA 1QOFA 5H92C 3AE4B 4RF0A 1XCTL 2W55A 1HA5A 4WWMA 2OHFA 5G5HA 2PW9A 3E56A 2PLPA 4USAA 1VZ6A 1JWUD 2J42A 2Y5PA 2JZPA 2NMQA 3LXFA 2PVGC 1IUEA 1C76A 1C4AA 1DOXA 1YN5A 3H8HA 2IGDA 1L5PA 2ACZB 2KN4A 4WIPA 4HKQA 2B76B 5AUKA 1E0ZA 4RFBA 3TEXA 2YEPB 1FD6A 1ZE3D 4YSXB 1N5XA 3BVZA 1N63A 1YN4A 2TSSA 1PFDA 1QOGA 3VR9B 2GRIA 1KTKA 1XLQA 1XLOA 3BZDB 4YSYB 2VZKD 1L0XB 2SEBD 1F2RI 2JX5A 4JPSA 4YTPB 1PGXA 1D5MC 1QQRA 1D4BA 1PUTA 5T8IA 3SR6A 4TQ1A 1XEEA 4B0MA 5TSSA 3U7ZA 1K53A 3PZ8A 1NVID 5BMGA 2WU5B 2N9KA 1RFKA 3PZ7A 4AS1A 1EM7A 4C7YA 1TS3A 1SXTA 4P16A 1FNUA 2FUG1 3Q8AA 2ON8A 2N0SB 1BMLC 1GOZA 4TQ0A 2L52A 1BUIC 4A9AA 1ZDVA 3ZJVA 4L1BA 1OQRA 5C3JB 1SJED 1WYGA 1SB3C 1D5ZC 1SF0A 2AX5A 2QJLA 2ONQA 2J53A 3NZ3A 1ZXIA 1VZ7A 2AQ2B 3WCQA 3R8BA 3ZJTA 2WNMA 2AQ1B 1J7CA 1ZP0B 1RM6C 2WDQB 3P4PB 1I4QA 4DQOC 3AEFB 5FR3A 1DYQA 3B9JA 1KLGD 2WQYB 1TS2A 1UWMA 2N7JA 4EE2A 1SE2A 4IDIA 4HROA 1TS4A 1QOBA 1YJJA 2EELA 1AYFA 2CJOA 2Z8LA 4OZBA 4B0EA 4HKZE 2BS3B 4HJGE 5BYSA 1C79A 1KH0A 1Q10A 2N9LA 4A6QA 1C4CA 2LUMA 1I4PA 1QOAA 1XO3A 3EUB2 3NS1A 3SEBA 1TJEA 3EA6A 1FNWA 4OHJA 1STEA 2INNE 3AE3B 2WDVB 3VR8B 2G9HD 1F2RC 1WGKA 4YWGG 1YN3A 5BMHA 5FKAC 4ZHPA 1MHHE 2I2YA 1CZPA 1NYRA 4WH4A 3AE9B 1N61A 4RH6A 1TY2A 1IGDA 3T3OA 4GDLB 2IGGA 1JALA 2XN9C 2GI9A 3AEDB 4NZLB 1WSPA 3IAS1 3Q8EA 4A8XC 1E6EB 2K9XA 2WXPA 1V1PB 4KKJA 5BYRA 1R7SA 1ENFA 3B2GA 2BTEA 1YJIA 3ETRA 1L0YB 1N5WA 4PT5A 1NYQA 2BBCA 1K50A 2PVOD 1D5XC 2KMMA 3TSSA 2CU3A 1TKGA 1VJKA 1EU4A 1YQ3B 3FILB 3TEYA 3I57A 1XLPA 4A90A 4J3OD 5EE9A 3PO0A 5JXVA 2JQRB 4H2AA 2LHEA 2NTTA 3TEWA 2I38A 1SEBD 4L23A 1GAQB 4OZCA 2QEJC 3URYA 1UNSA 2XNAC 3FAHA 1VZ8A 3AE1B 4UDUC 1C9FA 3IXSA 1TS5A 5HFYA 1CQVA 1P7EA 3EGRA 3RPFC 2W3RA 3AE8B 4NAMA 2QIEB 3VRAB 2LEKA 5LNK1 2M56B 1L0VB 3GB1A 4CQNA 2BS2B 2EKIA 2V3PA 2JXTA 4KKIA 2MJ3A 1YQ4B 1ZPSA 1C77A 2W54A 4JWUC 4TMAB 1N60A 1HXYD 4GDKB 4XWTA 4WAFA 2D5GA 5I4DA 1SSNA 3ZQ4A 3VQIA 4D2KA 1WRIA 2E6XA 3NVWA 2ZW0A 1FM0D 2KDMA 1VDVA 1CK1A 4KGTA 3P4SB 2RDGA 3NVZA 4XDCA 1C78A 3HRDD 1QILA 2J52A 1XLNA 3AE2B 4LTUA 4HRSA 1PGAA 2H88B 3BVGA 4YTMB 1DOYA 1XCQL 1M4VA 3Q8FA 2WS3B 3RFZB 3BYYB 4N58A 3Q8BA 1LO5D 4O1NA 1D6EC 2AQ3B 4ZHOA 1K51A 3ZGZA 1XF5L 4YTNB 1NENB 1F0ZA 2K0PA 1I4XA 1OQQA 1E7PB 1AW7A 2JYEA 1JWSD 2K3UA 2G1EA 1AN8A 1ROEA 1JWAD 2PTLA 2V4IB 3ZJUA 1DOIA 1V8CA 1SBBB 3P4QB 1FXAA 1PGBA 5GXGB 4ARCA 3O13A 3BIID 3IAM1 1P7FA 2DWQA 3LB8C 2IJ0A 4OZAA 4HEA1 3NRZA 3KWLA 2Y5CA 2WXHA 1I7HA 1I4RA 1F77A 4RGNA 1QT9A 5HI1A 1A70A 3AB5A 3U4EG 1WWTA 5E6JA 2R61A 5FK9C 2HDEA 1IBXB 4C56C 4ZYSA 2RDHA 2MH7A 1JW9D 4AQ7A 2FE8A 4RGMA 1QLBB 2BB6A 3L4PA 1TKEA 1CJEA 4US8A 5C2TB 2LFIA 1HZ5A 4US9A 1EWCA 4WURA 3TEZA 2WLBA 1SIJA 2WXMA 4OVZA 4MM3B 1FCLA 3B2FA 5D3IB 3R2TA 2ZW1A 3KLSX 2W82A 2MJEA 1MHXA 2JU6X 4ZOHC 1T6BX 3AECB 3W5VB 3U2SC 2BS4B 3AH7A 1L4DB 1ZOYB 3AEAB 3ZYYX 1QF6A 1NI3A 2BW2A 1TYGB 2J4XA 1ZUD2 2KQ4X 3Q8CA 3VRBB 1VR9A 4DXFA 1GB1A 3N9YC 4KGSA 1AWDA 2WU2B 4R3DA 1B9RA 1UUPA 1T5XD 1RYJA 2E3TA 1V97A 2WXFA 2QILA 1XXGA 3DWGC 1L4ZB 1K52A 2YEPF 1JQ4A 4KX6B 3MHZA 3UI3A 2WXOA 1KLUD 1BXTA 1FFVA 3NUHB 5H8YE 3KQ4A 5HG2A 4RGTA 3BK2A 1GB4A 1ZXHA 3MFGA 1JWBD 1TKYA 2DLBA 2M19A 2KWDA 2W3SA 3NVYA 3P63A 3W5UB 3KWVA 1FRRA 3E9SA 1FIQA 3I9V1 1WXQA 1HQRD 1HZ6A 4C7ZA 1QKZA 2FBWB 2V0GA 2KACA 1J7AA 1E9MA 3AMZA 3P42A 2WXJA 1V1PA 1J7BA 1PYWD 1I4HA 2WXRA 2RMMA 2X38A 2DYOA 3AEBB 4YT0B 5EE3A 4ITKA 2GB1A 1IGCA 1EU3A 1C4PA 4XE0A 1UGJA 2Y3AA 3LYYA 1KFYB 4RNAA 1OFFA 2LGIA 3FILA 3HVZA 4YXDB 2WXQA 5BYQA 2IDYA 5D7GA 3BVMA 1DGJA 1TY0A 3ABVB 1FNVA 1FRDA 1HEZE 2HTME 3AM9A 1E10A 4MH8A 2INPE 2KAJA 1YMHE 1SE4A 3MP9A 2DYMA 4NAWB 3TUOA 3P4RB 3CIRB 1FEHA 1JCKB 3SFDB 2JYTA 4Q2JA 2BT6A 3GS2A 2BB5A 3T3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVO D;  4YSX B;  1WWT A;  2KMM A;  1N5X A;  1T3Q A;  2CU3 A;  1TKG A;  3SFE B;  1VJK A;  1N63 A;  1YQ3 B;  3AE6 B;  1PFD A;  1QOG A;  3VR9 B;  4C80 A;  1PDX A;  1XLP A;  1XLQ A;  1XLO A;  3AN1 A;  5EE9 A;  4YSY B;  3PO0 A;  2MH7 A;  1JW9 D;  2K22 A;  2JX5 A;  4YTP B;  1QLB B;  3L4P A;  2JQR B;  1TKE A;  1CJE A;  1PUT A;  5C2T B;  3SR6 A;  4US8 A;  4US9 A;  3CWI A;  2WLB A;  1GAQ B;  1SIJ A;  3FAH A;  3AE1 B;  3HUI A;  1KF6 B;  1NVI D;  1L6V A;  3B2F A;  2Q5W D;  2PKO A;  2WU5 B;  3RPF C;  3W9C B;  1RFK A;  2W3R A;  2MJE A;  3AB5 A;  2K5P A;  4ZOH C;  3AEC B;  3W5V B;  4YSZ B;  3AE8 B;  3VRA B;  2QIE B;  2BS4 B;  4C7Y A;  3AEG B;  3AH7 A;  2MJD A;  1ZOY B;  2LEK A;  3AEA B;  3ZYY X;  3AE5 B;  1QF6 A;  1NI3 A;  1FFU A;  1TYG B;  1ZUD 2;  2M56 B;  2N0S B;  1L0V B;  3VRB B;  1JRO A;  2BS2 B;  2EKI A;  2L52 A;  2L83 A;  4A9A A;  4N59 A;  1AWD A;  1OQR A;  2MJ3 A;  2WU2 B;  5C3J B;  1B9R A;  4WQM A;  1YQ4 B;  2W54 A;  4JWU C;  2E3T A;  1N60 A;  1RYJ A;  1WYG A;  1SB3 C;  1V97 A;  1SF0 A;  3DWG C;  2AX5 A;  2QJL A;  4JWS C;  1JQ4 A;  4KX6 B;  1ZXI A;  3AV8 A;  3WCQ A;  3AEE B;  1WRI A;  3NVW A;  1FFV A;  5H8Y E;  1FM0 D;  5MPO A;  1VDV A;  1KRH A;  1J7C A;  1ZP0 B;  1RM6 C;  2PIA A;  2WDQ B;  3P4S B;  3P4P B;  3AEF B;  3NVZ A;  3B9J A;  5AUI A;  3DWM A;  2WQY B;  1JWB D;  1UWM A;  3HRD D;  4N6E B;  3FC4 A;  1FXI A;  3AE2 B;  1TKY A;  1XLN A;  2M19 A;  4LTU A;  2W3S A;  4HRS A;  2H88 B;  3NVY A;  3P63 A;  3NVV A;  2H89 B;  4HRO A;  4IDI A;  3W5U B;  2DBY A;  4YTM B;  1QOB A;  1YJJ A;  1FRR A;  2WDR B;  1DOY A;  1AYF A;  2CJO A;  1FIQ A;  2WS3 B;  2BS3 B;  1RWS A;  1WXQ A;  4N58 A;  1GPX A;  4C7Z A;  2FBW B;  5G5G A;  4FXC A;  1J7A A;  1QOA A;  1E9M A;  1VLB A;  1XO3 A;  3AMZ A;  3EUB 2;  4ZHO A;  1FMA D;  3NS1 A;  1J7B A;  1TJE A;  4YTN B;  1NEN B;  3AEB B;  4YT0 B;  3AE3 B;  5EE3 A;  2CJN A;  1F0Z A;  2WDV B;  1NEK B;  3AE7 B;  4ITK A;  1L6U A;  3VR8 B;  1WGK A;  1OQQ A;  1E7P B;  1FO4 A;  2WP9 B;  4ZHP A;  2G1E A;  4JX1 C;  1ROE A;  1EWY C;  1KFY B;  1JWA D;  3P1M A;  5EE1 A;  1OFF A;  3HVZ A;  1DOI A;  1CZP A;  4YXD B;  1V8C A;  1NYR A;  3P4Q B;  1N62 A;  3AE9 B;  4P6V F;  5EE0 A;  1N61 A;  1FXA A;  1JRP A;  1QOF A;  1DGJ A;  5H92 C;  5GXG B;  3ABV B;  3BII D;  3AE4 B;  2W55 A;  1FRD A;  4WWM A;  2DWQ A;  1JAL A;  2HTM E;  2OHF A;  3AM9 A;  3LB8 C;  5G5H A;  1E10 A;  3AED B;  3NRZ A;  3KWL A;  2Y5C A;  4USA A;  2KAJ A;  1I7H A;  1E6E B;  2K9X A;  3LXF A;  3P4R B;  2PVG C;  1IUE A;  3CIR B;  1QT9 A;  3SFD B;  1DOX A;  1R7S A;  1L5P A;  2ACZ B;  3B2G A;  1A70 A;  2BT6 A;  1YJI A;  3ETR A;  2B76 B;  1N5W A;  5AUK A;  1NYQ A;  1E0Z A; 
#chains in the Genus database with same CATH topology
 4NJC A;  2LJI A;  1PDX A;  3W1S A;  1V9J A;  3C8Y A;  1C3T A;  2BPS A;  1K8R B;  2Z0D B;  5IKC M;  4DHJ B;  1ACC A;  2MBO A;  2MEK A;  3NZS A;  2J7Q B;  3CWI A;  4GB9 A;  2IPK D;  1WY8 A;  4BZA A;  1I42 A;  1UBQ A;  4A55 A;  3V05 A;  4MT5 A;  2K5P A;  4AWJ A;  1SIF A;  3PRE A;  2MJD A;  4FJV B;  2KKC A;  3U52 E;  1P3Q U;  2JUO A;  2PE6 B;  1E90 A;  4WQM A;  3OWE B;  4ZYN A;  3V62 A;  3R3M A;  3VFK A;  3UIP B;  1B1Z A;  4JWS C;  1Y56 A;  3AV8 A;  3C0R B;  2KLC A;  3KYD D;  4ARI A;  4CO7 A;  2JRH A;  2L0F A;  1IYF A;  1I4G A;  5AUI A;  3DWM A;  2M0A A;  4N6E B;  3A4S C;  4IKG A;  3U7D A;  4PS8 A;  1JML A;  3IT4 B;  2M4N A;  2QSD A;  1WX7 A;  2DNF A;  3IT6 B;  2JWZ A;  2KWC A;  4ZRP A;  2ICI A;  2WXL A;  4K7U A;  4RCO A;  3I3T B;  2CJN A;  1NEK B;  3AE7 B;  2LGD A;  1L6U A;  3W2D A;  2KC1 A;  2IO0 B;  1J8C A;  2DZM A;  2PMV A;  4XWW A;  1WE6 A;  1JWM D;  3L10 B;  3APD A;  2OHF A;  5G5H A;  1JWU D;  3DBL I;  5IN7 A;  1TTN A;  3LXF A;  4OVU A;  4W9L A;  2ACZ B;  2KN4 A;  4WIP A;  2KX0 A;  1TBE A;  2XK5 A;  4NQK E;  1E0Z A;  3BY4 B;  1FD6 A;  4G3X B;  1LXD A;  1N5X A;  4ANV A;  3U30 A;  2CHW A;  1N63 A;  1PFD A;  5AZF A;  1KTK A;  4LNK A;  2K25 A;  2VZK D;  2SEB D;  2JX5 A;  1D5M C;  1QQR A;  1D4B A;  1XEE A;  4B0M A;  3HIZ A;  5IA7 A;  3U7Z A;  3QWZ B;  1WXA A;  3ZNI D;  3N20 C;  2CR5 A;  3RNC C;  4KIK B;  2N9K A;  3UF8 A;  2LVP A;  5C1Z A;  4AS1 A;  1SXT A;  1YX5 B;  4ZRJ A;  5IP4 D;  3DBL B;  2EKE C;  1BML C;  1BUI C;  3WA0 A;  2KDF B;  3IVF A;  4NNJ B;  1D5Z C;  1SF0 A;  1WJU A;  2LD9 A;  2QJL A;  3RUL A;  2ONQ A;  2J53 A;  3NZ3 A;  4BKG A;  2HJ1 A;  3R8B A;  3ZJT A;  4B6W A;  2WNM A;  3I63 C;  1ZP0 B;  2ZNV B;  4LDT B;  4JLC A;  4M02 A;  5FR3 A;  1Z2M A;  1TS2 A;  1EF5 A;  5LXI B;  1C1Y B;  5DCN A;  3N1Y C;  4HRO A;  1TS4 A;  2V1Y A;  1QOB A;  2Z8L A;  4B0E A;  2BS3 B;  5BYS A;  1C79 A;  2KX3 A;  1WRD B;  4IM3 A;  4P1C C;  3OJ3 A;  3NS1 A;  1I35 A;  4MJS A;  3SEB A;  1STE A;  4DXA B;  2ZNV C;  3VR8 B;  2G9H D;  4YWG G;  4I6P A;  3MC9 A;  5L95 C;  1CZP A;  4XGA B;  2OJR A;  3A9K A;  3AE9 B;  3SU8 X;  1WM3 A;  4KV2 A;  1T0S C;  3ZDM C;  2KFK B;  3AED B;  2LWP A;  4JIO U;  3Q8E A;  3PT2 B;  2L00 B;  2K9X A;  1ENF A;  1TGZ B;  1NYQ A;  3GZN I;  2LRU A;  3S2A A;  5L83 A;  2CU3 A;  2DEN B;  2NTT A;  2O6V D;  3Q3O C;  4M8M A;  3KUC B;  3AE1 B;  2EMS A;  4MGI E;  3Q2A C;  5HFY A;  2AWT A;  2QDF A;  2ZVN A;  1P7E A;  3EGR A;  3RCZ A;  3RPF C;  3VRA B;  4MH0 E;  3B1L X;  3VH4 B;  2BWE S;  2FCN A;  2MJ3 A;  4TKN A;  2D5G A;  5I4D A;  1UGM A;  3ZQ4 A;  1TT5 B;  2J0J A;  4NJ6 A;  2E6X A;  1NBF C;  3P4S B;  2RDG A;  1R4N I;  1C78 A;  4ASW C;  3CST A;  2J52 A;  1PGA A;  3RUI B;  4IM0 A;  2MP2 B;  3DBH I;  3GOE A;  1VD2 A;  4FHK A;  3ZTD A;  4E3C A;  2D3C A;  3ZNZ B;  1K51 A;  5DPR A;  1XF5 L;  3OAW A;  1ZKH A;  4PYZ A;  1OQQ A;  4WJP A;  1AW7 A;  1VCB A;  2K3U A;  1ROE A;  4FJZ A;  1DOI A;  2NVU I;  2AL3 A;  4BKS A;  3QAQ A;  2DWQ A;  1F52 A;  1OEY J;  1WYW B;  2KJH B;  5EDS A;  1F77 A;  1R4N B;  4RGN A;  1QT9 A;  1UD7 A;  2NBV B;  4II3 B;  3B08 A;  1A70 A;  2JF5 A;  3U4E G;  4IG7 B;  5G2N A;  2K8C A;  2R61 A;  2JXX A;  4C56 C;  4BFR A;  1JW9 D;  2AYO B;  3H7P A;  1TKE A;  1CJE A;  4US8 A;  5C2T B;  1EWC A;  4RM8 A;  2D07 B;  5D94 A;  2JZ3 B;  2XK5 B;  2ZW1 A;  3LJ3 A;  3W5V B;  2BS4 B;  2KQS A;  4HLE A;  2BWF A;  1QF6 A;  4EUT A;  2BW2 A;  2RD0 A;  3Q8C A;  1ZUD 2;  1AWD A;  2IO2 B;  2E3T A;  3VVW B;  3VTW A;  3WAN A;  3DWG C;  1L4Z B;  4KX6 B;  2WXO A;  1WGD A;  3Q3F A;  1GG3 A;  3NUH B;  5H8Y E;  5IO9 A;  1R4M B;  5HG2 A;  3QJZ A;  2FIF A;  1ZXH A;  3HK0 A;  1CMX B;  3SD5 A;  4MDK E;  4MEM A;  2M19 A;  4DHZ B;  2ASQ A;  2KVR A;  4DHJ D;  3E9S A;  1HQR D;  2KAC A;  2WXJ A;  5JZE B;  1PYW D;  1S1Q B;  5EE3 A;  2RMM A;  3AEB B;  2DYO A;  4ITK A;  1OTR B;  1UEL A;  1EU3 A;  3ZDT A;  2C9W B;  1GNU A;  3HVZ A;  3FIL A;  1HTO A;  3PTF C;  1T0Y A;  2WXQ A;  4KZC A;  2RR9 A;  1DGJ A;  3ABV B;  4ACF A;  3L0W B;  1YMH E;  1SE4 A;  3L54 A;  3TUO A;  3P4R B;  4MJS B;  4PS7 A;  4DHZ E;  2KD0 A;  2NS5 A;  1WR6 E;  3UIO B;  3T3N A;  3SFE B;  1FCC C;  2KOX A;  1SGH A;  3A9K B;  2L05 A;  3ZVV A;  3AN1 A;  2AEH A;  4KSL C;  2K22 A;  4M0W A;  1MPE A;  1E7V A;  4TV3 A;  3WIM A;  4JE3 B;  3MC0 B;  3NG0 A;  2KJR A;  3QC8 B;  4GLS C;  2Q5W D;  2UWQ A;  2PKO A;  4LLG M;  2I1K A;  4G0N B;  2RGF A;  1X1M A;  1E5W A;  4IM2 A;  5D3D A;  2MA9 B;  4GSW A;  2DZI A;  4RGO S;  4XDD A;  3AE5 B;  2D11 A;  2PEA A;  1JRO A;  3NJT A;  4W9G A;  5HKH A;  4N59 A;  1GC7 A;  1UWX A;  3IG3 A;  3RMK C;  3BWU D;  2JPH A;  1OGW A;  4OW0 A;  3GP7 A;  4MSQ B;  1KRH A;  3X23 A;  2PIA A;  1V49 A;  1MVK A;  3B0A A;  2NTS A;  1FXI A;  4NY0 A;  4F7Z A;  3NVV A;  1WX9 A;  1P98 A;  2WDR B;  2CHX A;  2LRW A;  5HHD G;  3T8M A;  1WJ6 A;  2JSV X;  4GXB A;  4L2Y A;  3PPA A;  4W9J A;  4A3O A;  4MGK E;  2ZPN A;  4IOI E;  3WAM A;  4WJQ A;  4FUL A;  2WXN A;  3BYT B;  1LFD A;  2X8X X;  1JRP A;  5GMV A;  3AE4 B;  4RF0 A;  2N7D A;  2W9N A;  1KLV A;  2KVZ A;  3HM6 X;  1VZ6 A;  2LZ6 A;  1IUE A;  1C4A A;  1DOX A;  2XBB C;  4HKQ A;  5FR6 A;  3A9J A;  4RFB A;  3TEX A;  2YEP B;  4YSX B;  3BVZ A;  1QOG A;  1UBI A;  2GRI A;  1XLO A;  2IND C;  3BZD B;  3M63 B;  1F2R I;  3MTN B;  3SR6 A;  4TQ1 A;  5TSS A;  5E6P A;  2GBJ A;  3PZ8 A;  1TZ1 A;  5BMG A;  2WU5 B;  3PSE B;  2G4S A;  4P16 A;  2IY1 B;  2M8S A;  2QC8 A;  3Q8A A;  4JQW C;  4AOF A;  2N1V A;  2L52 A;  3H7P B;  1ZDV A;  1OQR A;  5CX3 A;  4IWP A;  3R7R A;  2KZR A;  3ZW3 A;  1L7Y A;  2AX5 A;  1UZX B;  1VZ7 A;  3WCQ A;  5JH5 C;  1J7C A;  4P1B C;  3P4P B;  1I4Q A;  3AEF B;  3KYC D;  1DYQ A;  2V3S A;  3B9J A;  3DHH C;  3OJ4 B;  2N9P C;  2N7J A;  4DDI D;  4B95 A;  2K6Q A;  1E7U A;  1YJJ A;  1AYF A;  4OZB A;  4HJG E;  3EHV A;  1KH0 A;  4A6Q A;  1QOA A;  2J0K A;  4NAW A;  3EA6 A;  1FNW A;  3VHT C;  2DAF A;  3AE3 B;  2WDV B;  4MGY E;  1F2R C;  4RM9 A;  3TCA A;  2BF8 B;  2I2Y A;  3PHW B;  1NYR A;  4WH4 A;  3ZKJ C;  4RH6 A;  1WZ3 A;  4ZRK A;  3V6E B;  4HXD A;  2GI9 A;  4AJW A;  1E6E B;  3VTV A;  4WWP A;  4KKJ A;  4HK2 A;  1K50 A;  1E8X A;  1TKG A;  3HM3 A;  4AP4 C;  3FIL B;  3TEY A;  4ZDV A;  3V61 A;  2ZPY A;  5DPS A;  3PO0 A;  4W9I A;  4MSM B;  2VH1 A;  3KH0 A;  4H2A A;  2LHE A;  2ZJD A;  2ZCB A;  1WGR A;  3VXW A;  2GBN A;  2XNA C;  1LGR A;  4GGQ A;  5J18 A;  2V9H A;  1CQV A;  3N32 A;  2I1J A;  3X0W A;  4W9D A;  4RMA A;  3DVG X;  2BVC A;  2QIE B;  4E71 A;  2PJH A;  3M62 B;  2R2Q A;  1FXT B;  2M56 B;  3RZF A;  3GB1 A;  2EKI A;  2JXT A;  4KKI A;  4M0W B;  1YQ4 B;  1ZPS A;  1C77 A;  1HXY D;  2LXA A;  4EKU A;  5J17 A;  1XD3 B;  4FBJ B;  1WRI A;  2GBM A;  3NVW A;  2KNB A;  3DBR I;  4KGT A;  3TL5 A;  4EEW A;  4FJY A;  4HPL B;  3ZRF A;  1QIL A;  1WGY A;  4HRS A;  3BVG A;  4X57 B;  1XCQ L;  1M4V A;  4M8N A;  1H8C A;  4N58 A;  3Q8B A;  2JRI B;  5CHW A;  2BGF A;  1J19 A;  4O1N A;  4LNO A;  2AQ3 B;  4BOZ B;  3ZGZ A;  3ZRC A;  3K9O B;  4YTN B;  3C19 A;  1WMH A;  2FCM A;  4OVV A;  1WGH A;  2C7M B;  2IO1 B;  4ICV A;  2G1E A;  1AN8 A;  1V6E A;  3KVF B;  1JWA D;  2PTL A;  3P4Q B;  1FXA A;  1PGB A;  3O13 A;  2N4F A;  2K8H A;  1E8Z A;  3HHM A;  4HEA 1;  4ZRI A;  2Y5C A;  1I7H A;  1KJT A;  1I4R A;  4S17 A;  1EF1 A;  1V80 A;  5HI1 A;  2WX0 A;  2D3B A;  1LQB A;  1WZ0 A;  1WWT A;  4ICU A;  5E6J A;  2K39 A;  2HDE A;  4C00 A;  1WJ4 A;  2BB6 A;  4YL8 A;  3V60 A;  2PPH A;  2ZZP B;  2LFI A;  4US9 A;  5D2M B;  2WLB A;  2O6V A;  4OVZ A;  2K6D B;  2GMI C;  3ZIM A;  1L2N A;  3A9J B;  2LXC A;  1V5O A;  1T6B X;  1L4D B;  3AEA B;  4K3B A;  1TYG B;  2J4X A;  3VRB B;  4DXF A;  4KGS A;  4R3D A;  1T5X D;  1RYJ A;  1SE9 A;  3Q3N C;  1XXG A;  3W1Y A;  3MHZ A;  3UI3 A;  2VRR B;  1FFV A;  1YX6 B;  3ENE A;  4RGT A;  3BK2 A;  1GB4 A;  4KDL B;  1WGG A;  1A5R A;  2KT7 A;  4LCD E;  3NVY A;  3W5U B;  4GDL A;  1F9J A;  1FIQ A;  1E8Y A;  4LJP B;  1HZ6 A;  4C7Z A;  2FBW B;  4W9F A;  3OG5 A;  3GZN B;  1GJZ A;  3H6N A;  2M0X A;  4CYE A;  1AAR A;  2WXR A;  3KUZ A;  5CHV C;  2KLG A;  2GB1 A;  4LJO B;  4XE0 A;  1UGJ A;  3LYY A;  4RNA A;  1KFY B;  2XEW A;  4YXD B;  5BYQ A;  5D7G A;  2LUE A;  3GE3 C;  1FNV A;  2HTM E;  3AM9 A;  4CHK A;  1E10 A;  1GC6 A;  2INP E;  3MP9 A;  4NAW B;  3ZXR A;  2L76 A;  3CIR B;  1JCK B;  2JYT A;  1MFW A;  1IP9 A;  1QZE A;  3GS2 A;  2RSU A;  4DDG D;  4KZ0 A;  4WJN A;  4HCP B;  1KM7 A;  1ET9 A;  1Z5S B;  3J9C A;  3SHQ A;  2NR2 A;  3APF A;  2SAK A;  3HVD A;  2V3N A;  4ZRQ A;  3AUL A;  2WXG A;  5CTR C;  3M95 A;  3HUI A;  4KGR A;  2KTR A;  4J6I A;  4HCN B;  3DBH B;  1TZO A;  3Q6B A;  4KSK C;  4PS3 A;  4AUQ C;  4GN1 A;  4YSZ B;  3AEG B;  2JWU A;  1MI0 A;  2L1A A;  2BYT A;  2MQJ A;  3QX1 A;  3VUX A;  2VZK B;  2L83 A;  2C5L C;  3WAP A;  1WF9 A;  4REZ A;  4EZJ A;  2FID A;  4PYU A;  2BQQ A;  2JY6 A;  2LMC A;  3ML8 A;  4MAC A;  1EO6 A;  3DQV A;  3APC A;  3MHS D;  2WXI A;  3FC4 A;  4KVG B;  4TSS A;  2FUH B;  1TIF A;  1WXM A;  1YNT E;  2H89 B;  1V81 A;  1SJH D;  1YJ1 A;  1RWS A;  4PK1 A;  1ET6 A;  1YQB A;  4DXG A;  3BK1 A;  3JVZ X;  2LGY A;  2QMT A;  1VLB A;  1FMA D;  5BMI A;  4DK5 A;  1V1O A;  3ONS A;  1FO4 A;  2WP9 B;  1WI0 A;  1ZDX A;  2L32 A;  4JX1 C;  1SE3 A;  1EWY C;  5EE1 A;  1NI2 A;  3Q69 A;  4LNI A;  4GU2 A;  4P6V F;  5KHQ A;  3DDC B;  3CF6 E;  4EFO A;  1XCT L;  2W55 A;  3UIN B;  2KJ6 A;  3RNA C;  1MG8 A;  4IC7 B;  4EZL A;  1F1H A;  2Y5P A;  2NMQ A;  1YN5 A;  2MRP A;  2IGD A;  3H8H A;  1WMH B;  2C7H A;  2B76 B;  2WGS A;  2TSS A;  4G50 A;  3RNB C;  3CMM B;  3VUY A;  2CU1 A;  2LJ5 A;  3FKY A;  3ZNG C;  1PUT A;  1UH6 A;  2KK8 A;  5T8I A;  2KXJ A;  5DPT A;  3AU4 A;  1WIA A;  3U8Z A;  2ZVO A;  1Q5W B;  1EM7 A;  1TS3 A;  3QAR A;  4P7I A;  3A1Q A;  1FNU A;  2FUG 1;  1GOZ A;  4BKT A;  2LVQ A;  4HDQ A;  4A9A A;  4LNF A;  3NOB A;  4L1B A;  5C3J B;  3ZJV A;  1SJE D;  1WYG A;  2KN5 A;  5AEK B;  2O6V B;  5JHB A;  2MBH A;  5TR5 A;  1HE8 A;  2WDQ B;  4DQO C;  1MG4 A;  2FCS A;  2MW5 A;  5E6O A;  1KLG D;  1UWM A;  1T0R C;  1Y8R C;  4EE2 A;  5D6J B;  2EEL A;  2MBB B;  4F8C B;  2L0T A;  3ML9 A;  2KDB A;  4HKZ E;  3H1U A;  1Q0W B;  1C4C A;  2LUM A;  1I4P A;  1XO3 A;  2GLS A;  3EUB 2;  2FAZ A;  1TJE A;  2CHZ A;  2INN E;  1WGK A;  1YN3 A;  2C60 A;  1IGD A;  3T3O A;  3VUW A;  4GDL B;  2DX5 B;  1JAL A;  2NPT A;  4NZL B;  1WSP A;  2KFJ A;  4A8X C;  2WXP A;  3H7S A;  1M94 A;  3DHI C;  2BTE A;  4HVB A;  1L0Y B;  3L17 A;  2KMM A;  3TSS A;  2KWU B;  1YQ3 B;  3UQA A;  3I57 A;  2KHW B;  1XLP A;  4A90 A;  2GOW A;  4J3O D;  2M1M A;  5JXV A;  3ZXV A;  3A33 B;  3VH3 B;  3TEW A;  1SEB D;  3N1Z C;  4WJO A;  4L23 A;  2QEJ C;  5AZG A;  1VZ8 A;  1C9F A;  3RN9 C;  2YVC A;  2RPQ A;  3D32 A;  3Q14 C;  4LDT D;  2W3R A;  5LNK 1;  4GIV A;  1L0V B;  4CQN A;  2W54 A;  1N60 A;  3K9P B;  2WX1 A;  1SSN A;  2YLM A;  3VQI A;  2KWV B;  4D2K A;  4XX5 A;  2KTR B;  2ZW0 A;  2JZZ A;  1VDV A;  1D3Z A;  4BOS C;  4XDC A;  4K81 A;  3AE2 B;  2H88 B;  2MHJ A;  1DOY A;  2WS3 B;  3RFZ B;  3H9D A;  1LO5 D;  1D6E C;  4ZHO A;  2KMA A;  1YOV B;  1J0G A;  3LDZ E;  1NEN B;  2K0P A;  2DHZ A;  2KDI A;  1I4X A;  4K3C A;  4BBN F;  1JWS D;  3RNG C;  1NDD A;  2V4I B;  3ZJU A;  3DCG A;  2NBW B;  1V8C A;  2OOB B;  4ARC A;  2QCZ A;  3BII D;  1P7F A;  3LB8 C;  2IJ0 A;  4OZA A;  3RNF C;  3DOW A;  2WWZ A;  2Z0E B;  5CHF A;  3AXC A;  2LGX A;  3ZNH B;  3AB5 A;  1OQY A;  3A4R A;  3DVN U;  3BIN A;  5FK9 C;  2MP2 A;  3PLV A;  4A3P A;  4MGZ E;  4GOC A;  4RGM A;  4K7S A;  3L4P A;  4JGH B;  2FNJ B;  4QAY A;  4WUR A;  1SIJ A;  2WXM A;  1FCL A;  3ZTC A;  3B2F A;  5D3I B;  3R2T A;  3RD2 A;  3AU5 A;  3U2S C;  3P2B A;  4BBN C;  3QCA A;  2N9E B;  3TIX A;  1NI3 A;  1VR9 A;  1GB1 A;  3N9Y C;  1WX8 A;  2WU2 B;  1B9R A;  1UUP A;  4S0R A;  4M00 A;  1V97 A;  2QIL A;  4K1R B;  2IO3 B;  1K52 A;  1JQ4 A;  1BXT A;  2UYZ B;  3PRZ A;  5J2R A;  5E6N A;  3KQ4 A;  3CSF A;  1EUV B;  3ALB A;  2IYD B;  3L13 A;  3MFG A;  2GBR A;  2HD5 B;  3DHG C;  3NS8 A;  2DLB A;  3A1Q B;  3KWV A;  1WXS A;  3R66 C;  4FLH A;  4IWQ A;  1JRU A;  2MBE A;  3IBE A;  1QKZ A;  1E8W A;  3EC8 A;  3P42 A;  1V1P A;  2X38 A;  4YT0 B;  1IPG A;  3M3J A;  3VAW A;  1MJD A;  2CS4 A;  3MC8 A;  2MBQ A;  1C4P A;  2Y3A A;  2R2O A;  3PRM B;  3BVM A;  3PRP B;  1FRD A;  1WXV A;  3RT3 B;  2DYM A;  5KHO A;  1FEH A;  1WH3 A;  2BT6 A;  2BB5 A;  2L8J A;  2L7R A;  3NZU A;  1T3Q A;  4N9F 4;  3AE6 B;  5IAA C;  4FN2 A;  1VRA B;  4C80 A;  4I6N B;  3DVN V;  2KQ7 A;  1Q1O A;  3R7Q A;  2NPT B;  4HPP A;  5BO4 B;  4GDK A;  3DBR B;  2KC2 A;  3R2I A;  1KOT A;  2WXK A;  1ESF A;  1KF6 B;  1L6V A;  2RPV A;  3W9C B;  1WE7 A;  1V5T A;  4EZK A;  1FFU A;  2IGH A;  2G45 B;  2GBK A;  2K8B A;  4LK0 M;  2REX A;  4IW0 A;  4W9H A;  2IY0 B;  4C4V A;  3AEE B;  2MCN B;  2LAS A;  5MPO A;  3TBL D;  2DAJ A;  3V3X A;  1GUA B;  1YD8 U;  4HPM B;  3PGE A;  2NCN A;  2Z59 B;  4RF1 A;  2DBY A;  2DYB A;  1WM2 A;  1GPX A;  2HTH A;  5G5G A;  4FXC A;  2G4D B;  2WDT B;  2KAN A;  3RNE C;  2LHD A;  2B3A A;  3P1M A;  2OED A;  1IBX A;  1N62 A;  2J0M A;  3MJ5 A;  5EE0 A;  1QOF A;  5H92 C;  2EMT A;  4WWM A;  1HA5 A;  4W9E A;  2PW9 A;  3JSV A;  3E56 A;  4LNN A;  2INC C;  2K1F A;  2PLP A;  3UQB A;  4NJ7 A;  2O2V A;  4NQL B;  4USA A;  2J42 A;  4WWN A;  2LGS A;  2JZP A;  2PVG C;  4MM3 A;  1C76 A;  1P0R A;  2DZJ A;  1L5P A;  4MEL A;  3PHX B;  5AUK A;  2Y5B B;  1ZE3 D;  1UF0 A;  1U4A A;  3DBS A;  1YN4 A;  3VR9 B;  3DPD A;  1XLQ A;  4DWF A;  1S3S G;  4YSY B;  1L0X B;  3Q3M C;  4JPS A;  4YTP B;  1PGX A;  3N30 A;  2UU7 A;  3NY5 A;  1K53 A;  2LVO A;  1NVI D;  1V86 A;  1G6J A;  2M17 A;  3EFC A;  1RFK A;  3PZ7 A;  3W1S C;  4C7Y A;  3MJW A;  2D3G A;  2ON8 A;  2N0S B;  4TQ0 A;  3EFU A;  3RZW C;  2BKR B;  3JYU A;  4HDO A;  1SB3 C;  1ZXI A;  4XYC A;  2AQ2 B;  3TJP A;  2N9X A;  2AQ1 B;  1RM6 C;  2D2Q A;  2A5U A;  2WQY B;  1RAX A;  1SE2 A;  1XT9 B;  2PE9 A;  4IDI A;  3T9L A;  2CKH B;  2CJO A;  4TUU A;  1Q10 A;  2JVC A;  2N9L A;  4AJY B;  4EOY A;  3KUD B;  3QK0 A;  1V2Y A;  4OHJ A;  1ZW7 A;  1RLF A;  3PVL A;  5BMH A;  5FKA C;  4ZHP A;  3N1X C;  2HJ8 A;  1MHH E;  2KTF A;  1R4M I;  3L08 A;  4BKS D;  5IOI A;  3I5J C;  1N61 A;  1TY2 A;  2MX2 A;  3PZD A;  3JW0 X;  2IGG A;  3L16 A;  2XN9 C;  4BVU C;  1LM8 B;  2RDB C;  3IAS 1;  1V1P B;  3QHT A;  5BYR A;  2BYE A;  1R7S A;  3B2G A;  1YJI A;  3ETR A;  1N5W A;  4PT5 A;  2BBC A;  1XQQ A;  2PVO D;  2NBU A;  1D5X C;  1VJK A;  1EU4 A;  4HWI B;  5EE9 A;  4HJK A;  2JQR B;  2WHI A;  2KDE B;  2I38 A;  1ISN A;  2LI5 A;  1GAQ B;  4OZC A;  3URY A;  1UNS A;  3FAH A;  4UDU C;  3IXS A;  4GMV A;  1TS5 A;  4ANW A;  1BT0 A;  3VTU A;  2MSE D;  3AE8 B;  4NAM A;  4W9C A;  2LEK A;  2IBI B;  1N6Z A;  2BS2 B;  2V3P A;  2BYV E;  2G3Q B;  3O65 B;  4WAF A;  4JWU C;  4TMA B;  4GDK B;  4XWT A;  4WAA A;  3GE8 C;  2A4Z A;  1FM0 D;  2KDM A;  3RI7 C;  1CK1 A;  3QIJ A;  3NVZ A;  1P1A A;  3HRD D;  1XLN A;  4LTU A;  2BYF A;  2DZK A;  4YTM B;  2KYW A;  2AL6 A;  3Q8F A;  4KDI C;  3BYY B;  3DVG Y;  4C4V B;  1FPY A;  3IFW B;  4M01 A;  1F0Z A;  3AI5 A;  3PLU A;  2FCQ A;  1E7P B;  2JYE A;  4NPN A;  4I6L B;  3NHE B;  1SBB B;  3PS6 A;  4URK A;  5GXG B;  3IAM 1;  3ZO5 B;  3PV1 A;  1PQS A;  1RRB A;  3NRZ A;  3WAO A;  1WR1 A;  3KWL A;  2WXH A;  4BAX A;  3UGB B;  2HE7 A;  3SDL C;  5LXH A;  4JL9 A;  4IUM B;  4KIK A;  1HTQ A;  5DPW A;  2D3A A;  2ZCC A;  2ZEQ A;  1IBX B;  3VDZ A;  1RFA A;  3WAL A;  4II2 B;  4FAD A;  4ZYS A;  1T0Q C;  2RDH A;  3ZUN A;  2MH7 A;  4B9K A;  4AQ7 A;  2FE8 A;  1P9D U;  1QLB B;  3JSV B;  4W9K A;  3RYT A;  1HZ5 A;  2O2V B;  1WJN A;  2KMC A;  3TEZ A;  4MM3 B;  5C23 A;  3V6C B;  4XC2 A;  2QHO A;  3KLS X;  2W82 A;  2MJE A;  1MHX A;  2JU6 X;  4ZOH C;  3AEC B;  3AH7 A;  1ZOY B;  3ZYY X;  2VH2 A;  2KQ4 X;  4A20 A;  2N1W A;  4ANX A;  2MWS B;  5JHA A;  2WXF A;  4FA6 A;  5G55 A;  2YEP F;  4IWO A;  1KLU D;  3OLM D;  1ZGU B;  3QQ8 B;  2IZV B;  4WWO A;  2N7E A;  1JWB D;  4K7W A;  1TKY A;  2KWD A;  2W3S A;  3P63 A;  3Q3J A;  1FRR A;  4WQO B;  3I9V 1;  1WXQ A;  2KFK A;  2BKF A;  2V0G A;  2OJW A;  5AZH A;  5LLI A;  1J7A A;  1E9M A;  3AMZ A;  1J7B A;  4G11 A;  1I4H A;  1H4R A;  3TMP B;  3IHP C;  4DBG A;  3ZLZ A;  1IGC A;  2WYQ A;  2KO3 A;  1OFF A;  2LGI A;  2V4L A;  2C7N B;  2IDY A;  3QA8 A;  2JT4 B;  2MLB A;  3ECI A;  3N3K B;  1TY0 A;  4XZ4 A;  2L3Z A;  2D10 A;  3KW5 B;  4ANU A;  4F1S A;  1OEY A;  1HEZ E;  4FHJ A;  4MH8 A;  2KAJ A;  3EEC A;  1YIW A;  3SFD B;  4Q2J A;  4E74 A;  1WFY A; 
#chains in the Genus database with same CATH homology
 4NJC A;  1T3Q A;  3SFE B;  2LJI A;  1FCC C;  3AE6 B;  1VRA B;  4C80 A;  1PDX A;  3W1S A;  3AN1 A;  1ET9 A;  3C8Y A;  2K22 A;  3J9C A;  1ACC A;  2MEK A;  4M0W A;  2SAK A;  3HVD A;  1MPE A;  2V3N A;  3CWI A;  4JE3 B;  4ZRQ A;  3MC0 B;  3R2I A;  2WXG A;  2IPK D;  2WXK A;  3HUI A;  4KGR A;  1ESF A;  1KF6 B;  1L6V A;  4GLS C;  2Q5W D;  2PKO A;  4LLG M;  2RPV A;  4A55 A;  1TZO A;  3V05 A;  3W9C B;  4MT5 A;  2K5P A;  4YSZ B;  3AEG B;  2JWU A;  2MJD A;  5D3D A;  4RGO S;  4XDD A;  1MI0 A;  3AE5 B;  1FFU A;  2IGH A;  2L1A A;  2BYT A;  3U52 E;  1JRO A;  2VZK B;  2L83 A;  4N59 A;  4REZ A;  1UWX A;  4LK0 M;  4WQM A;  3OWE B;  3BWU D;  1B1Z A;  2LMC A;  4JWS C;  1Y56 A;  3AV8 A;  3AEE B;  4MAC A;  4OW0 A;  3GP7 A;  5MPO A;  1KRH A;  3V3X A;  4ARI A;  2PIA A;  1I4G A;  1MVK A;  5AUI A;  2NTS A;  2M0A A;  2WXI A;  3DWM A;  4IKG A;  4N6E B;  3FC4 A;  1FXI A;  4TSS A;  1JML A;  3IT4 B;  4RF1 A;  1YNT E;  2H89 B;  2QSD A;  3NVV A;  2DBY A;  1SJH D;  2WDR B;  1RWS A;  1GPX A;  3IT6 B;  1ET6 A;  5HHD G;  4DXG A;  2JSV X;  3BK1 A;  4FXC A;  4ZRP A;  5G5G A;  2QMT A;  1VLB A;  1FMA D;  4L2Y A;  5BMI A;  2ICI A;  2WXL A;  4RCO A;  1V1O A;  2CJN A;  2LHD A;  1NEK B;  3AE7 B;  4IOI E;  1L6U A;  3W2D A;  1FO4 A;  2WP9 B;  1ZDX A;  2L32 A;  4JX1 C;  1SE3 A;  2WXN A;  1EWY C;  2PMV A;  2OED A;  3P1M A;  5EE1 A;  1IBX A;  4XWW A;  3Q69 A;  3BYT B;  1N62 A;  4P6V F;  1JWM D;  3MJ5 A;  5EE0 A;  1JRP A;  1QOF A;  5H92 C;  3AE4 B;  4RF0 A;  1XCT L;  2W55 A;  1HA5 A;  4WWM A;  2OHF A;  5G5H A;  2PW9 A;  3E56 A;  2PLP A;  4USA A;  1VZ6 A;  1JWU D;  2J42 A;  2Y5P A;  2JZP A;  2NMQ A;  3LXF A;  2PVG C;  1IUE A;  1C76 A;  1C4A A;  1DOX A;  1YN5 A;  3H8H A;  2IGD A;  1L5P A;  2ACZ B;  2KN4 A;  4WIP A;  4HKQ A;  2B76 B;  5AUK A;  1E0Z A;  4RFB A;  3TEX A;  2YEP B;  1FD6 A;  1ZE3 D;  4YSX B;  1N5X A;  3BVZ A;  1N63 A;  1YN4 A;  2TSS A;  1PFD A;  1QOG A;  3VR9 B;  2GRI A;  1KTK A;  1XLQ A;  1XLO A;  3BZD B;  4YSY B;  2VZK D;  1L0X B;  2SEB D;  1F2R I;  2JX5 A;  4JPS A;  4YTP B;  1PGX A;  1D5M C;  1QQR A;  1D4B A;  1PUT A;  5T8I A;  3SR6 A;  4TQ1 A;  1XEE A;  4B0M A;  5TSS A;  3U7Z A;  1K53 A;  3PZ8 A;  1NVI D;  5BMG A;  2WU5 B;  2N9K A;  1RFK A;  3PZ7 A;  4AS1 A;  1EM7 A;  4C7Y A;  1TS3 A;  1SXT A;  4P16 A;  1FNU A;  2FUG 1;  3Q8A A;  2ON8 A;  2N0S B;  1BML C;  1GOZ A;  4TQ0 A;  2L52 A;  1BUI C;  4A9A A;  1ZDV A;  3ZJV A;  4L1B A;  1OQR A;  5C3J B;  1SJE D;  1WYG A;  1SB3 C;  1D5Z C;  1SF0 A;  2AX5 A;  2QJL A;  2ONQ A;  2J53 A;  3NZ3 A;  1ZXI A;  1VZ7 A;  2AQ2 B;  3WCQ A;  3R8B A;  3ZJT A;  2WNM A;  2AQ1 B;  1J7C A;  1ZP0 B;  1RM6 C;  2WDQ B;  3P4P B;  1I4Q A;  4DQO C;  3AEF B;  5FR3 A;  1DYQ A;  3B9J A;  1KLG D;  2WQY B;  1TS2 A;  1UWM A;  2N7J A;  4EE2 A;  1SE2 A;  4IDI A;  4HRO A;  1TS4 A;  1QOB A;  1YJJ A;  2EEL A;  1AYF A;  2CJO A;  2Z8L A;  4OZB A;  4B0E A;  4HKZ E;  2BS3 B;  4HJG E;  5BYS A;  1C79 A;  1KH0 A;  1Q10 A;  2N9L A;  4A6Q A;  1C4C A;  2LUM A;  1I4P A;  1QOA A;  1XO3 A;  3EUB 2;  3NS1 A;  3SEB A;  1TJE A;  3EA6 A;  1FNW A;  4OHJ A;  1STE A;  2INN E;  3AE3 B;  2WDV B;  3VR8 B;  2G9H D;  1F2R C;  1WGK A;  4YWG G;  1YN3 A;  5BMH A;  5FKA C;  4ZHP A;  1MHH E;  2I2Y A;  1CZP A;  1NYR A;  4WH4 A;  3AE9 B;  1N61 A;  4RH6 A;  1TY2 A;  1IGD A;  3T3O A;  4GDL B;  2IGG A;  1JAL A;  2XN9 C;  2GI9 A;  3AED B;  4NZL B;  1WSP A;  3IAS 1;  3Q8E A;  4A8X C;  1E6E B;  2K9X A;  2WXP A;  1V1P B;  4KKJ A;  5BYR A;  1R7S A;  1ENF A;  3B2G A;  2BTE A;  1YJI A;  3ETR A;  1L0Y B;  1N5W A;  4PT5 A;  1NYQ A;  2BBC A;  1K50 A;  2PVO D;  1D5X C;  2KMM A;  3TSS A;  2CU3 A;  1TKG A;  1VJK A;  1EU4 A;  1YQ3 B;  3FIL B;  3TEY A;  3I57 A;  1XLP A;  4A90 A;  4J3O D;  5EE9 A;  3PO0 A;  5JXV A;  2JQR B;  4H2A A;  2LHE A;  2NTT A;  3TEW A;  2I38 A;  1SEB D;  4L23 A;  1GAQ B;  4OZC A;  2QEJ C;  3URY A;  1UNS A;  2XNA C;  3FAH A;  1VZ8 A;  3AE1 B;  4UDU C;  1C9F A;  3IXS A;  1TS5 A;  5HFY A;  1CQV A;  1P7E A;  3EGR A;  3RPF C;  2W3R A;  3AE8 B;  4NAM A;  2QIE B;  3VRA B;  2LEK A;  5LNK 1;  2M56 B;  1L0V B;  3GB1 A;  4CQN A;  2BS2 B;  2EKI A;  2V3P A;  2JXT A;  4KKI A;  2MJ3 A;  1YQ4 B;  1ZPS A;  1C77 A;  2W54 A;  4JWU C;  4TMA B;  1N60 A;  1HXY D;  4GDK B;  4XWT A;  4WAF A;  2D5G A;  5I4D A;  1SSN A;  3ZQ4 A;  3VQI A;  4D2K A;  1WRI A;  2E6X A;  3NVW A;  2ZW0 A;  1FM0 D;  2KDM A;  1VDV A;  1CK1 A;  4KGT A;  3P4S B;  2RDG A;  3NVZ A;  4XDC A;  1C78 A;  3HRD D;  1QIL A;  2J52 A;  1XLN A;  3AE2 B;  4LTU A;  4HRS A;  1PGA A;  2H88 B;  3BVG A;  4YTM B;  1DOY A;  1XCQ L;  1M4V A;  3Q8F A;  2WS3 B;  3RFZ B;  3BYY B;  4N58 A;  3Q8B A;  1LO5 D;  4O1N A;  1D6E C;  2AQ3 B;  4ZHO A;  1K51 A;  3ZGZ A;  1XF5 L;  4YTN B;  1NEN B;  1F0Z A;  2K0P A;  1I4X A;  1OQQ A;  1E7P B;  1AW7 A;  2JYE A;  1JWS D;  2K3U A;  2G1E A;  1AN8 A;  1ROE A;  1JWA D;  2PTL A;  2V4I B;  3ZJU A;  1DOI A;  1V8C A;  1SBB B;  3P4Q B;  1FXA A;  1PGB A;  5GXG B;  4ARC A;  3O13 A;  3BII D;  3IAM 1;  1P7F A;  2DWQ A;  3LB8 C;  2IJ0 A;  4OZA A;  4HEA 1;  3NRZ A;  3KWL A;  2Y5C A;  2WXH A;  1I7H A;  1I4R A;  1F77 A;  4RGN A;  1QT9 A;  5HI1 A;  1A70 A;  3AB5 A;  3U4E G;  1WWT A;  5E6J A;  2R61 A;  5FK9 C;  2HDE A;  1IBX B;  4C56 C;  4ZYS A;  2RDH A;  2MH7 A;  1JW9 D;  4AQ7 A;  2FE8 A;  4RGM A;  1QLB B;  2BB6 A;  3L4P A;  1TKE A;  1CJE A;  4US8 A;  5C2T B;  2LFI A;  1HZ5 A;  4US9 A;  1EWC A;  4WUR A;  3TEZ A;  2WLB A;  1SIJ A;  2WXM A;  4OVZ A;  4MM3 B;  1FCL A;  3B2F A;  5D3I B;  3R2T A;  2ZW1 A;  3KLS X;  2W82 A;  2MJE A;  1MHX A;  2JU6 X;  4ZOH C;  1T6B X;  3AEC B;  3W5V B;  3U2S C;  2BS4 B;  3AH7 A;  1L4D B;  1ZOY B;  3AEA B;  3ZYY X;  1QF6 A;  1NI3 A;  2BW2 A;  1TYG B;  2J4X A;  1ZUD 2;  2KQ4 X;  3Q8C A;  3VRB B;  1VR9 A;  4DXF A;  1GB1 A;  3N9Y C;  4KGS A;  1AWD A;  2WU2 B;  4R3D A;  1B9R A;  1UUP A;  1T5X D;  1RYJ A;  2E3T A;  1V97 A;  2WXF A;  2QIL A;  1XXG A;  3DWG C;  1L4Z B;  1K52 A;  2YEP F;  1JQ4 A;  4KX6 B;  3MHZ A;  3UI3 A;  2WXO A;  1KLU D;  1BXT A;  1FFV A;  3NUH B;  5H8Y E;  3KQ4 A;  5HG2 A;  4RGT A;  3BK2 A;  1GB4 A;  1ZXH A;  3MFG A;  1JWB D;  1TKY A;  2DLB A;  2M19 A;  2KWD A;  2W3S A;  3NVY A;  3P63 A;  3W5U B;  3KWV A;  1FRR A;  3E9S A;  1FIQ A;  3I9V 1;  1WXQ A;  1HQR D;  1HZ6 A;  4C7Z A;  1QKZ A;  2FBW B;  2V0G A;  2KAC A;  1J7A A;  1E9M A;  3AMZ A;  3P42 A;  2WXJ A;  1V1P A;  1J7B A;  1PYW D;  1I4H A;  2WXR A;  2RMM A;  2X38 A;  2DYO A;  3AEB B;  4YT0 B;  5EE3 A;  4ITK A;  2GB1 A;  1IGC A;  1EU3 A;  1C4P A;  4XE0 A;  1UGJ A;  2Y3A A;  3LYY A;  1KFY B;  4RNA A;  1OFF A;  2LGI A;  3FIL A;  3HVZ A;  4YXD B;  2WXQ A;  5BYQ A;  2IDY A;  5D7G A;  3BVM A;  1DGJ A;  1TY0 A;  3ABV B;  1FNV A;  1FRD A;  1HEZ E;  2HTM E;  3AM9 A;  1E10 A;  4MH8 A;  2INP E;  2KAJ A;  1YMH E;  1SE4 A;  3MP9 A;  2DYM A;  4NAW B;  3TUO A;  3P4R B;  3CIR B;  1FEH A;  1JCK B;  3SFD B;  2JYT A;  4Q2J A;  2BT6 A;  3GS2 A;  2BB5 A;  3T3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...