1RWSA

Backbone solution structure of mixed alpha/beta protein pf1061
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
KMIKVKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PF1061
publication title Backbone solution structures of proteins using residual dipolar couplings: application to a novel structural genomics target.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 4
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2003-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1rwsA00
2M19A 2PVOD 1QOAA 2W3SA 3NS1A 1F0ZA 1N63A 2BS3B 3AE2B 1JWBD 1UWMA 3AEAB 2QJLA 4YSXB 1N60A 1JRPA 3HUIA 3EUB2 2BS2B 5AUIA 1XLOA 1OFFA 3W5UB 1L5PA 1J7BA 2KAJA 1WGKA 2MH7A 4LTUA 4US8A 1NVID 2KMMA 1AWDA 3W5VB 3AB5A 5C3JB 3LB8C 2Y5CA 4HRSA 3HRDD 2E3TA 1FXAA 2DWQA 2WLBA 1J7CA 3B9JA 1WWTA 3P4PB 1A70A 3AE6B 1JQ4A 2FBWB 1DGJA 2LEKA 3NVWA 3AE9B 1J7AA 1NYRA 2BS4B 1FO4A 1GAQB 1PFDA 2K22A 5EE9A 1N5XA 3AEFB 1QLBB 4YXDB 3AE7B 4N59A 2AX5A 1OQRA 1TKEA 2BT6A 3L4PA 3P63A 3VRAB 2OHFA 1XLNA 4C7ZA 1ROEA 1YJJA 3NVYA 1KRHA 1FRRA 4ZOHC 1PDXA 2CU3A 4YT0B 1E0ZA 1L6VA 2G1EA 4WQMA 1IUEA 3AEEB 4YTNB 2W3RA 1DOYA 1RWSA 1QOGA 2N0SB 1CZPA 1I7HA 3PO0A 1KF6B 1WYGA 2MJEA 4YTMB 1DOXA 1JROA 4N58A 1PUTA 2B76B 2EKIA 3AE8B 3P4RB 2K9XA 1N5WA 2QIEB 2JX5A 1FMAD 2Q5WD 3VR8B 4FXCA 2CJOA 1FM0D 4JX1C 2H89B 3NVZA 4HROA 1ZXIA 3VRBB 2WS3B 1QF6A 1L6UA 2CJNA 2K5PA 2WU2B 3WCQA 1JALA 2WDRB 3AE3B 1NYQA 2MJDA 2WQYB 3CWIA 1JW9D 4IDIA 5MPOA 1EWYC 2PIAA 2WP9B 3AE4B 3B2GA 1ZP0B 1T3QA 3NRZA 1WRIA 4KX6B 1B9RA 3AH7A 1VDVA 5C2TB 4C7YA 3FAHA 1GPXA 5H92C 1V8CA 1ZUD2 1RFKA 3LXFA 1QOBA 2W55A 1OQQA 1FFUA 5EE3A 1E10A 2WDQB 3AEDB 1FRDA 1SF0A 2JQRB 1E9MA 4JWSC 4N6EB 4P6VF 3P4SB 2HTME 1TJEA 1NEKB 1NI3A 3AECB 1SIJA 1AYFA 1R7SA 1CJEA 3DWGC 3HVZA 2WU5B 3AE1B 3SFEB 4YTPB 1WXQA 3BIID 3CIRB 1DOIA 1TKGA 1VLBA 1V97A 3ABVB 1RM6C 1JWAD 4JWUC 4C80A 3ZYYX 5G5GA 4ZHOA 1E6EB 3VR9B 1YQ4B 1E7PB 3AN1A 3AEGB 2PVGC 3SR6A 1TKYA 3RPFC 5GXGB 2DBYA 3AEBB 1FXIA 1VJKA 1ZOYB 4USAA 1L0VB 2L52A 5H8YE 3P4QB 3W9CB 3FC4A 1XLQA 1N61A 1FFVA 4YSZB 4ITKA 4YSYB 3AMZA 2PKOA 1YJIA 3AM9A 1QOFA 5EE0A 4WWMA 3ETRA 1QT9A 1NENB 3AV8A 2ACZB 2H88B 3B2FA 3KWLA 1FIQA 3SFDB 2MJ3A 2M56B 2WDVB 2W54A 3DWMA 2L83A 3P1MA 4ZHPA 1TYGB 1KFYB 5G5HA 5AUKA 1YQ3B 4A9AA 1N62A 1SB3C 1XLPA 1XO3A 1RYJA 3AE5B 4US9A 3NVVA 5EE1A
chains in the Genus database with same CATH superfamily
4AQ7A 1P9DU 1UD7A 5D3DA 3AE2B 3DHIC 2BYTA 3DBSA 3ZGZA 4G3XB 5LLIA 1H4RA 1TGZB 1IPGA 1AWDA 2LGIA 4OZBA 4KZ0A 1C78A 2KQ7A 2DWQA 2KOXA 1F77A 1JQ4A 2WXKA 2L3ZA 1RAXA 2BTEA 2ZJDA 3NVWA 1PGAA 1FO4A 1YMHE 3BYTB 3AE7B 1EF5A 2FIFA 3I3TB 4I6PA 1T0YA 4K7SA 2NR2A 1YJJA 2ZNVC 3J9CA 3JVZX 1R4NI 1BUIC 2BPSA 2KLGA 1IUEA 4G50A 4A8XC 1UBIA 3N1YC 4GLSC 3M62B 2DZKA 2BB5A 2KXJA 3K9OB 2MBOA 1FM0D 4TV3A 2K5PA 3WALA 2WDRB 3PREA 2K6QA 2WXNA 3NY5A 2ONQA 3KUDB 4C7YA 2JF5A 4B0EA 4BBNF 1WM3A 3UQBA 3APFA 1C3TA 1HQRD 3RNEC 1C77A 3W1SC 4XYCA 4ZRKA 1KLUD 1PGBA 2CR5A 2J0JA 2FCSA 3T3NA 3ABVB 3A9JB 2FE8A 3EFCA 4EOYA 2YLMA 4W9IA 3IT4B 2DLBA 1MG4A 3PVLA 3AMZA 4GDKA 4NPNA 4HVBA 2I2YA 1KTKA 1E8YA 2LXAA 1WJUA 2GLSA 2WXFA 4IUMB 2IY0B 2MLBA 2QJLA 5JHBA 4W9CA 3ZJTA 3FILA 5IAAC 3LYYA 3H7PB 4FHJA 4L2YA 4ZRJA 4ZYSA 2JU6X 3P4PB 4OHJA 3ZXRA 2FUG1 4W9HA 4AP4C 1YN3A 1WJNA 2EKEC 4K1RB 3L4PA 4PS3A 3VUYA 1SIFA 3AU5A 1PDXA 3N1XC 2IBIB 4GDLB 2L0FA 1I4XA 5BYSA 2HD5B 1UH6A 4JLCA 2D07B 4HROA 1C76A 1TIFA 2WQYB 1WRIA 3AU4A 1BXTA 3MC9A 1F1HA 4K7WA 2ON8A 1FFUA 2MBHA 4P6VF 3ZNGC 1V2YA 4K3BA 3Q2AC 1NEKB 1SIJA 4WWPA 2WU5B 4J6IA 4EUTA 1VLBA 3QHTA 1V1PA 4QAYA 1EUVB 1I35A 4LDTD 5I4DA 2JXTA 5GXGB 2FUHB 2MX2A 3MP9A 3OJ3A 4FN2A 5GMVA 1WZ0A 3P4QB 4E74A 1K8RB 2KDBA 3RZFA 1TS2A 4MH0E 3UI3A 3C19A 3ONSA 4FLHA 2W54A 3P1MA 1BT0A 3ZQ4A 3U30A 1SBBB 2PE6B 3AXCA 5EE1A 1TY0A 4WAFA 1JWBD 1HXYD 4ICUA 1WR6E 2CU1A 5C1ZA 2M4NA 3BVMA 2KLCA 1P7EA 4P16A 2CS4A 1OFFA 1FD6A 3ZNZB 1X1MA 5J2RA 2RDGA 4WURA 4DXGA 3AULA 3L17A 1MPEA 1NYRA 2N9KA 1WMHA 1R4NB 2AX5A 4FBJB 2BYFA 5L95C 1P3QU 1LGRA 1SE4A 1J8CA 5JZEB 1WGDA 1I7HA 4KDLB 2DAFA 1F2RC 1DOXA 1JROA 1WXMA 1UGMA 3QX1A 1S1QB 5J18A 3EA6A 1YOVB 1ET6A 2KD0A 5BMHA 2IJ0A 3C0RB 1L4DB 4OVZA 2V3PA 5D7GA 3B1LX 1FRDA 1YN5A 4ARIA 4N6EB 2JT4B 4FJVB 1TY2A 3EECA 4NQKE 2JSVX 2QILA 4RF0A 1S3SG 4GXBA 3AEGB 2ZPNA 1YD8U 1HTOA 1IBXA 1KH0A 1V6EA 3DHHC 1M4VA 2IO3B 4EEWA 2WGSA 4JPSA 4IWPA 1EF1A 2N1VA 3IXSA 2V4LA 3KWLA 1V81A 4LDTB 4KSKC 1UGJA 4NY0A 4ZHPA 3KQ4A 2L05A 3A1QA 2JYEA 4XWTA 2K1FA 2KDEB 1A5RA 3WAOA 4J3OD 1UWMA 3AEAB 4PS7A 1UELA 2SAKA 3L0WB 1E7UA 4LNKA 2VZKD 3S2AA 3PTFC 1J7BA 3WIMA 5C3JB 2Y5CA 2LGXA 2DZMA 4JL9A 1J7CA 1WZ3A 4P1BC 4DXAB 1DGJA 4FJYA 2QMTA 4RGTA 1GAQB 1QLBB 1OQRA 2BT6A 2MQJA 2JVCA 1KRHA 2KMCA 2G1EA 2KANA 1AARA 1C4CA 2B76B 2PTLA 4WJQA 1GJZA 3O13A 2D3CA 2Q5WD 1ZXIA 2KJRA 2IO1B 2WU2B 2Z59B 3NOBA 3V61A 5D3IB 1V8CA 3AI5A 1WR1A 1T0SC 1SF0A 4JWSC 4DBGA 1VCBA 2NBVB 3R2TA 3AE1B 3IAS1 3OLMD 4ARCA 1WXQA 4MELA 1Q0WB 1RM6C 1P7FA 1NI2A 2I38A 4MM3B 2KT7A 5KHOA 3RYTA 3VDZA 2KKCA 3AEBB 2RDHA 1D5MC 5H8YE 3VH4B 1V5OA 1I4GA 2WXHA 2H88B 3MFGA 2G4SA 2WXOA 1J0GA 1KOTA 2KK8A 1B1ZA 2D10A 3GZNI 1XO3A 4CO7A 5E6PA 3ALBA 2QDFA 1ENFA 4K7UA 1OEYJ 3ZRCA 1T5XD 4GN1A 3N20C 5J17A 3EUB2 4RFBA 5BMGA 1ZKHA 1L5PA 3GOEA 3U8ZA 2MH7A 2YEPB 4K3CA 2JZ3B 3AB5A 2KVZA 1LFDA 3PHXB 3AE6B 4EZJA 1FNVA 1V1PB 3WANA 3L13A 5EE9A 2VZKB 4PYZA 5AEKB 4GU2A 4DDID 1FRRA 3ZW3A 4C00A 4YT0B 4PYUA 3CSFA 3KLSX 4B95A 2RPQA 1C4AA 3Q3MC 2MJEA 2JZPA 1WJ6A 4N58A 3SU8X 5CX3A 2PLPA 1LM8B 2KN4A 4R3DA 4H2AA 5MPOA 2ZPYA 1ZP0B 1L7YA 2NBUA 4EZLA 4KIKB 4KX6B 4A90A 4NAWA 1XQQA 3URYA 3Q3NC 4KZCA 1YQBA 3U2SC 4IOIE 5FR6A 5KHQA 1OQQA 5IN7A 1ZW7A 4LNIA 4ANWA 2QHOA 5C23A 3TMPB 3SFEB 4XE0A 1HZ6A 1ZXHA 3Q14C 3RZWC 1MFWA 1WMHB 3BINA 1NDDA 4PS8A 3V6CB 4RGNA 3VTWA 4LNOA 4MACA 1FCLA 2KACA 1IP9A 1L0VB 2KNBA 2LWPA 4IM3A 4MEMA 2PPHA 4WWMA 2HJ1A 4A3OA 2INNE 1WGYA 2M56B 3MC8A 3IT6B 1VZ8A 5G5HA 1L4ZB 1N6ZA 4A9AA 5HHDG 2NTTA 3DVGY 2KC1A 4B9KA 1CK1A 1WRDB 3VUWA 4KGRA 4HXDA 1I4RA 4HEA1 5TSSA 4I6LB 2M1MA 2W9NA 2LMCA 4IG7B 3ZDMC 3JSVB 4HWIB 2J53A 4LK0M 2N7JA 2C7MB 4WJNA 2BS4B 1V49A 5T8IA 1UNSA 4XDCA 4YXDB 4FJZA 3VRAB 1IBXB 4E3CA 2KWVB 2MSED 3DVGX 3CMMB 3AEEB 2N7DA 2NPTA 4E71A 1KF6B 3APCA 2LJ5A 5DPSA 1FPYA 2QIEB 4M02A 3ML9A 3A9KA 4RNAA 1SGHA 3CWIA 3GE3C 3JW0X 4GSWA 4IDIA 2LASA 3Q8BA 5C2TB 1WX8A 2RMMA 2KWCA 3MHSD 2PW9A 2N1WA 1LQBA 1WY8A 2BYEA 2WXIA 3P4SB 1KLVA 3OJ4B 1TZ1A 1R7SA 1UZXB 3QK0A 3UGBB 1TKGA 1TS3A 2WXRA 3BK1A 3P42A 4ANVA 1TZOA 2MW5A 4OZCA 4N9F4 1VD2A 3I63C 1WXAA 3RNFC 3QARA 1TS4A 1QOFA 2MEKA 3GZNB 3QQ8B 2KX3A 2MHJA 1YNTE 3NJTA 4MGKE 3BZDB 4BBNC 1N62A 5CHVC 1E5WA 3EC8A 2M19A 3KVFB 1RLFA 2ASQA 2UU7A 2LJIA 3LDZE 3R7QA 2VH2A 2K6DB 1XLOA 1WGKA 4LTUA 2KMMA 1JWMD 3PRPB 2OOBB 1CMXB 1FXAA 4A6QA 5AZGA 4IWQA 2LEKA 2VRRB 1WE7A 5E6OA 1N5XA 2XK5A 5IP4D 4ACFA 2L00B 2KN5A 4MJSA 2RGFA 3SDLC 3KYCD 2LUMA 3W1YA 2HDEA 3KW5B 1C79A 1HA5A 1FMAD 4EFOA 3ZVVA 3NVZA 1L6UA 3DVNU 4A55A 5DPWA 2KTRA 3I57A 2MWSB 2WX1A 4MH8A 3KWVA 2INCC 2JQRB 1P98A 2G4DB 2RSUA 3L08A 3IG3A 2KFKA 1QQRA 3ZYYX 3V3XA 1E6EB 3SR6A 2HE7A 4BAXA 4G11A 1LXDA 1WXVA 2RPVA 3OWEB 4W9GA 2MCNB 2O6VA 1XLQA 4MGZE 3TBLD 2K0PA 3JYUA 4M8NA 3NUHB 1F9JA 2KDFB 2WDVB 4JE3B 2IGDA 1SB3C 1T0RC 1L0YB 2GBRA 3NS1A 4W9FA 3ZLZA 1WXSA 4HKQA 3H8HA 5E6NA 2NVUI 2DYOA 1FEHA 2L32A 2BGFA 4US8A 3WAMA 4AS1A 2WNMA 1MI0A 1PYWD 1SJHD 4W9LA 2IO2B 4IM2A 3PLUA 3ZNHB 3RNAC 3GP7A 2K22A 4W9JA 2BBCA 4B0MA 3P63A 2A4ZA 3EHVA 1G6JA 4LNFA 1ROEA 1U4AA 1K51A 4WIPA 1YX5B 2UWQA 3VAWA 1DOYA 1QOGA 1CZPA 4NAMA 3TEZA 3A4RA 3PS6A 4S0RA 2R61A 3D32A 1RFAA 4GB9A 1C9FA 2EMTA 1T3QA 3PPAA 1VDVA 3FAHA 2M8SA 2PMVA 3VTVA 1BMLC 2NCNA 1D5XC 4CYEA 2XNAC 4HDOA 4S17A 4DHZE 2LZ6A 2OJRA 4YTPB 2MBEA 3B0AA 2LHEA 2DYBA 1FNWA 3H6NA 4F8CB 1WE6A 3ZJUA 4USAA 4XWWA 3CSTA 1JWUD 2WXJA 4IW0A 3FC4A 1N61A 1HE8A 1JCKB 4YSZB 5D6JB 2FNJB 3M3JA 4REZA 2LGDA 3N32A 4GOCA 3WAPA 4EKUA 1VR9A 2IGHA 3RD2A 1ZPSA 3M95A 2Y5PA 3NVVA 2PVOD 5D2MB 3ZDTA 1F0ZA 2I1KA 5JXVA 2DZJA 1Y56A 3M63B 2ZVOA 4JIOU 3U4EG 1V1OA 3U7DA 2D3BA 3KUZA 3IHPC 2E3TA 1DYQA 2RDBC 4RM8A 3VTUA 3APDA 2CHWA 4N59A 1RRBA 1I4HA 1XLNA 4C7ZA 3T3OA 1MHXA 3UF8A 4ZOHC 3DDCB 4EZKA 5CTRC 5JHAA 1EM7A 4BKSA 2NS5A 3A33B 2G45B 4G0NB 1SEBD 3KH0A 4AWJA 4CHKA 2Z8LA 3RNBC 3X0WA 2LVOA 2A5UA 4GIVA 3RFZB 1ET9A 2GMIC 2J0KA 2O2VA 3AE4B 4WJPA 3R66C 1FXTB 2GBJA 4IWOA 1YJ1A 3U7ZA 4P1CC 1E10A 1XCQL 4OVVA 2HTME 2ZW1A 4GDKB 3BK2A 3AECB 3DWGC 4NQLB 2GI9A 2LGSA 3MTNB 5FK9C 4F1SA 3NHEB 2OJWA 3H9DA 5DPTA 2V3NA 4DK5A 4MJSB 3RUIB 1ZOYB 1Z5SB 4XX5A 3FILB 1ZDXA 4YSYB 2MA9B 2NBWB 1WM2A 1GG3A 2FIDA 1ESFA 1VZ6A 5HFYA 1K52A 2IPKD 5AUKA 3OG5A 3L54A 1QKZA 2KJ6A 3DCGA 3ML8A 4HCPB 1KLGD 1IYFA 3DBLI 4P7IA 1N60A 3ECIA 1HEZE 3LJ3A 3CF6E 3E56A 2C5LC 4GMVA 3IVFA 3B9JA 1K53A 4DHJB 2KFKB 4WAAA 2K3UA 2V3SA 3KYDD 2GB1A 1GC6A 3Q8EA 2KZRA 3X23A 2IDYA 4XDDA 4W9EA 3EFUA 1WGHA 3H7PA 4WQMA 3PZDA 3R8BA 1WYGA 4C4VA 2GOWA 2KO3A 4DQOC 3TEWA 2IY1B 2VH1A 2OEDA 2H89B 5BYQA 3AE3B 4HJKA 1STEA 1EWYC 2WP9B 2BWES 3AH7A 1QZEA 1GB1A 1ACCA 2C9WB 4GDLA 5EE3A 3SEBA 3AEDB 1MVKA 3W2DA 3UQAA 4HLEA 2WXQA 1OGWA 2BYVE 4IM0A 2AL3A 4A3PA 4DXFA 3BYYB 3NZUA 2PE9A 4XC2A 1WF9A 1FXIA 3H7SA 3DBRB 2R2QA 2DX5B 1HTQA 5FKAC 1V86A 2ZCBA 2AL6A 1WIAA 3ENEA 5HKHA 4ICVA 2KDIA 1AN8A 4WWNA 4US9A 5BMIA 2V9HA 1QOAA 2W3SA 4BVUC 1WSPA 1L2NA 1JRPA 4W9DA 2WXMA 4RH6A 3OAWA 2BS2B 2IZVB 3P2BA 1EWCA 2N9EB 1XXGA 4KSLC 3VVWB 3Q8FA 4CQNA 1YX6B 2JRIB 4RCOA 3R3MA 3MJWA 3ZRFA 4KKJA 4X57B 4ZRIA 4XZ4A 1MG8A 1L6VA 1VRAB 2D3GA 4W9KA 2Z0DB 3PO0A 4GGQA 2QC8A 4YTMB 4M8MA 1PUTA 1WH3A 3RMKC 3PHWB 3ZJVA 4MSQB 2WDTB 3TUOA 2WS3B 2CJNA 1JALA 1NYQA 2WXGA 5D94A 1NBFC 2BVCA 2KMAA 4AOFA 2JWUA 2KJHB 1RFKA 2KWDA 2NMQA 3TJPA 4RMAA 4ZRPA 1CJEA 1UBQA 4IKGA 4LJOB 1DOIA 3A1QB 1V97A 2JWZA 4JWUC 4MGIE 2KC2A 3RN9C 5IA7A 3L16A 5DPRA 3PGEA 2L1AA 1VJKA 1SE3A 2K8BA 4NZLB 2JY6A 4TSSA 4FA6A 3AV8A 2ZCCA 2Z0EB 1GB4A 1SSNA 3DBLB 1KFYB 4O1NA 2JXXA 4KKIA 4ZYNA 2O2VB 3RI7C 1N63A 2BS3B 3HHMA 4BKGA 4IC7B 3HUIA 2LVQA 2D3AA 1E8ZA 2SEBD 4MDKE 2KAJA 2WXPA 3W5VB 3BWUD 3FKYA 3VXWA 1WWTA 1ZDVA 2X8XX 3QC8B 2AQ1B 2BB6A 1EU4A 2G9HD 4HJGE 4TQ0A 3AE9B 3PZ8A 2N9XA 5G2NA 5EDSA 2Y3AA 1WGRA 3NVYA 4BKTA 2EMSA 4TQ1A 1E0ZA 2K39A 2TSSA 1L0XB 2JUOA 5DCNA 3IAM1 3U52E 1GC7A 4MGYE 4RGOS 1WJ4A 3AE8B 1JRUA 2JX5A 3DOWA 4FXCA 4TKNA 4KGTA 3PRZA 2NTSA 2GBNA 5CHWA 4A20A 4KGSA 1AW7A 2MJDA 1JWSD 2PIAA 4ANXA 1C1YB 2IYDB 1GPXA 4HPPA 1QOBA 3GE8C 3VQIA 4DWFA 2V0GA 4HPMB 1NI3A 4KV2A 3RNGC 2MRPA 2HJ8A 2EELA 1JMLA 3PT2B 4KVGB 1TKYA 3RPFC 2X38A 3A4SC 4RM9A 3N1ZC 1Q10A 4L1BA 4FADA 3PRMB 1XT9B 5JH5C 1PQSA 4RF1A 4HDQA 4C4VB 1P0RA 1Y8RC 2N4FA 4D2KA 3VUXA 3ZNID 2AYOB 2DZIA 1WYWB 1I42A 5LXHA 1KJTA 1RYJA 1T6BX 2G3QB 1D3ZA 2KDMA 3GB1A 4MM3A 4RGMA 2CHZA 4YSXB 4DDGD 4AJYB 1E7VA 3DBHI 3NZSA 3LB8C 2QSDA 4YL8A 3BY4B 1TS5A 4TUUA 3HM3A 3C8YA 1PFDA 1R4MI 3ZXVA 1E8XA 3DHGC 2B3AA 2JYTA 1TKEA 5FR3A 4BZAA 4NAWB 3QA8A 3R7RA 1SJED 2M0XA 4YTNB 2FCMA 2KQSA 2FCNA 2QEJC 2QCZA 5G55A 2K9XA 3RT3B 1N5WA 1UF0A 3E9SA 3DPDA 3VRBB 3WCQA 2LFIA 1JW9D 3RNCC 3PLVA 1M94A 2E6XA 2XBBC 2LHDA 2IO0B 4KDIC 1E9MA 2FCQA 3R2IA 4WWOA 1AYFA 3HVZA 3UINB 2CHXA 1PGXA 3CIRB 3BIID 3MC0B 5G5GA 3ZTCA 3VR9B 1YQ4B 1P1AA 1E7PB 2GRIA 3ZKJC 4NJCA 2LVPA 4KIKA 5BO4B 5L83A 2J42A 2K8CA 4OZAA 3BVZA 4L23A 3SHQA 1YJIA 4JQWC 3ETRA 1NENB 5AZHA 3Q3JA 1CQVA 2MJ3A 4EE2A 3DWMA 2L83A 4II2B 2DNFA 2MP2A 1XLPA 3AE5B 3QWZB 2CKHB 3DQVA 2J52A 2V1YA 4Q2JA 2LGYA 2DENB 2KHWB 3ZUNA 3W1SA 2C60A 3Q3FA 5AUIA 2J0MA 3HIZA 2NPTB 2LUEA 2WHIA 3I5JC 1C4PA 2WLBA 4HCNB 1XD3B 1LO5D 3DBRI 1A70A 2D2QA 3QIJA 3A9KB 3AEFB 2AQ2B 3TEXA 3VFKA 4DHJD 3Q6BA 4ANUA 3IFWB 3HM6X 1RWSA 2ZEQA 3JSVA 4LLGM 2O6VD 3L10B 3V6EB 2KFJA 1QF6A 1YIWA 4M0WA 4BOZB 4ASWC 2WWZA 4HKZE 1V5TA 4ZRQA 5AZFA 4MT5A 1YN4A 4M01A 2AEHA 5LXIB 1ZUD2 2W82A 2KTFA 2W55A 5HI1A 2C7NB 2J4XA 2WYQA 2M0AA 4AJWA 4OVUA 2GBKA 1EO6A 1TJEA 4AUQC 3DVNV 2BKFA 1J19A 1H8CA 3B08A 2L0TA 3HVDA 4C80A 2BKRB 3ZTDA 1I4QA 3AN1A 3Q8AA 4XGAB 3Q3OC 4WQOB 4YWGG 4ITKA 2PKOA 4OW0A 2ZVNA 5EE0A 4NJ7A 3B2FA 1WX9A 1FIQA 2HTHA 3O65B 1TYGB 2M17A 5IO9A 1YQ3B 1F52A 1IGDA 2WXLA 3IBEA 2XK5B 1SXTA 2PEAA 3DBHB 1K50A 2DYMA 2JZZA 2FAZA 4F7ZA 3KUCB 3I9V1 1E8WA 1NVID 5BYRA 1R4MB 3TEYA 3HRDD 2DAJA 1OTRB 3TSSA 1OEYA 2FBWB 4M00A 1GOZA 1XF5L 2YVCA 1J7AA 2XN9C 3QAQA 3A9JA 4FULA 1Q1OA 1V9JA 2KTRB 2ZW0A 3Q8CA 1TT5B 1GUAB 1UUPA 1ZE3D 2K8HA 2N9LA 4BFRA 2W3RA 1MJDA 2N0SB 2KX0A 3PSEB 3TL5A 4NNJB 1D5ZC 3H1UA 2K25A 2CJOA 3N30A 1SE2A 3UIPB 3NS8A 5IOIA 3MJ5A 1I4PA 4DHZB 2O6VB 3LXFA 2LD9A 2WDQB 3SD5A 3ZO5B 2R2OA 2D11A 1FCCC 4B6WA 3N9YC 2N7EA 2V4IB 2ZZPB 1TTNA 2REXA 1D6EC 3PV1A 4HK2A 1JWAD 4ZHOA 1UWXA 2UYZB 2PVGC 2DBYA 2L8JA 4PT5A 1FNUA 2BWFA 4MSMB 1MHHE 1ZGUB 1FFVA 3N3KB 1QT9A 3BVGA 1D4BA 3RULA 2KQ4X 1XCTL 4BKSD 3MHZA 3T9LA 3VR8B 3TIXA 1OQYA 5E6JA 1EU3A 4WJOA 2IGGA 2L7RA 2LRUA 4URKA 3W5UB 1WFYA 4I6NB 2KYWA 4HRSA 3VHTC 4PK1A 5TR5A 3EGRA 3QCAA 2INDC 5CHFA 2LRWA 3HK0A 1KM7A 1WI0A 3NZ3A 2ZNVB 1GNUA 2OHFA 2PJHA 4FHKA 2CU3A 3WA0A 2LI5A 4TMAB 2MBQA 1Q5WB 2L76A 2GBMA 2RR9A 2JRHA 2RD0A 4LNNA 2EKIA 3P4RB 2JPHA 2MP2B 2MBBB 1F2RI 1QILA 4JX1C 3UIOB 4LCDE 3K9PB 1WX7A 1TBEA 2LXCA 5IKCM 4JGHB 2INPE 3V05A 4C56C 3B2GA 1SE9A 3V60A 3NRZA 1B9RA 4ZDVA 2XEWA 5H92C 1T0QC 1HZ5A 2N9PC 5HG2A 1Z2MA 1VZ7A 4WH4A 3NG0A 3VH3B 2ICIA 2BF8B 2I1JA 3GS2A 2WX0A 1XEEA 4HPLB 4BOSC 5LNK1 3Q69A 2C7HA 3PZ7A 4II3B 3QJZA 3T8MA 2AQ3B 2YEPF 3RCZA 2D5GA 2KWUB 2L52A 4LJPB 1V80A 2AWTA 3W9CB 2BW2A 3TCAA 2BQQA 2KVRA 3AM9A 4UDUC 4K81A 2Y5BB 1ISNA 1WGGA 2ACZB 3SFDB 1E90A 2J7QB 3V62A 1IGCA 4M0WB 3ZIMA 2DHZA 4NJ6A
chains in the Genus database with same CATH topology
4AQ7A 2PVOD 2KDMA 1F0ZA 5D3DA 3AE2B 3GB1A 5JXVA 4RGMA 2BYTA 1ENFA 4YSXB 1Y56A 1T5XD 3EUB2 3U4EG 4RFBA 5BMGA 3ZGZA 1V1OA 1L5PA 2MH7A 2YEPB 1AWDA 2LGIA 3AB5A 4OZBA 3LB8C 2QSDA 2E3TA 1C78A 1DYQA 2DWQA 1F77A 1TS5A 3AE6B 1JQ4A 2WXKA 2BTEA 3NVWA 1FNVA 1V1PB 1PGAA 3C8YA 1FO4A 1YMHE 1PFDA 5EE9A 2VZKB 3BYTB 3AE7B 4N59A 2JYTA 1TKEA 5FR3A 1I4HA 1XLNA 4C7ZA 3T3OA 1YJJA 4NAWB 1MHXA 1FRRA 4ZOHC 4YT0B 1SJED 3J9CA 3KLSX 1BUIC 1EM7A 1IUEA 4YTNB 1C4AA 1SEBD 2QEJC 4A8XC 2MJEA 4GLSC 2JZPA 4N58A 2BB5A 2K9XA 2Z8LA 1N5WA 1FM0D 2PLPA 3E9SA 2KN4A 4R3DA 4H2AA 3VRBB 3RFZB 2K5PA 3WCQA 2LFIA 2WDRB 5MPOA 1ET9A 2WXNA 1JW9D 3AE4B 2ONQA 1ZP0B 4KX6B 4A90A 4C7YA 2E6XA 3URYA 3U2SC 4IOIE 3U7ZA 2LHDA 4B0EA 1OQQA 1E10A 1XCQL 1HQRD 1E9MA 1C77A 2HTME 2ZW1A 4GDKB 3BK2A 3R2IA 3AECB 3DWGC 1AYFA 3HVZA 2GI9A 3SFEB 1PGXA 4XE0A 1KLUD 1HZ6A 1ZXHA 3BIID 3CIRB 1PGBA 5FK9C 3T3NA 3ABVB 3MC0B 5G5GA 4RGNA 3VR9B 1YQ4B 1E7PB 2GRIA 2FE8A 4NJCA 4MACA 2V3NA 3IT4B 1FCLA 2KACA 2DLBA 1ZOYB 1L0VB 3FILB 2J42A 4OZAA 3BVZA 1ZDXA 4YSYB 3AMZA 4L23A 1YJIA 4WWMA 3ETRA 1NENB 2INNE 1ESFA 1VZ6A 1CQVA 2MJ3A 2M56B 4EE2A 5HFYA 3DWMA 2L83A 1K52A 2I2YA 3IT6B 1KTKA 1VZ8A 2IPKD 5G5HA 5AUKA 1L4ZB 4A9AA 1QKZA 1XLPA 3AE5B 5HHDG 2WXFA 2J52A 2NTTA 1KLGD 4Q2JA 1CK1A 4KGRA 2QJLA 1I4RA 1N60A 4HEA1 5TSSA 3ZJTA 3FILA 3W1SA 3LYYA 1HEZE 5AUIA 2LMCA 3E56A 4L2YA 4ZYSA 1C4PA 2JU6X 2WLBA 1LO5D 1K53A 3B9JA 3P4PB 1A70A 2J53A 4OHJA 2FUG1 4LK0M 2N7JA 2K3UA 1YN3A 2BS4B 5T8IA 2GB1A 1UNSA 3AEFB 4XDCA 4YXDB 3Q8EA 2AQ2B 3TEXA 3VRAB 3L4PA 2IDYA 1IBXB 4XDDA 1PDXA 4GDLB 4WQMA 3AEEB 1RWSA 3R8BA 1KF6B 1WYGA 4LLGM 1I4XA 4DQOC 3TEWA 5BYSA 2OEDA 2QIEB 1QF6A 4RNAA 2H89B 4HROA 5BYQA 4M0WA 3AE3B 1C76A 3CWIA 2WQYB 1STEA 4HKZE 4IDIA 1EWYC 2WP9B 4ZRQA 1WRIA 3Q8BA 4MT5A 3AH7A 5C2TB 2RMMA 1GB1A 1YN4A 1BXTA 1ACCA 2PW9A 1ZUD2 2W82A 2ON8A 2W55A 5HI1A 5EE3A 1FFUA 2J4XA 3SEBA 3AEDB 2WXIA 1MVKA 4P6VF 2M0AA 3P4SB 3W2DA 1TJEA 1NEKB 1SIJA 2WXQA 1R7SA 2WU5B 1TKGA 1VLBA 4DXFA 3HVDA 1TS3A 1V1PA 3BYYB 4C80A 1I4QA 2WXRA 3BK1A 3AN1A 3P42A 5I4DA 2JXTA 5GXGB 1TZOA 3Q8AA 1FXIA 3MP9A 4OZCA 3P4QB 5FKAC 4YWGG 4ITKA 2PKOA 4OW0A 1TS4A 1QOFA 2MEKA 5EE0A 1TS2A 3UI3A 3B2FA 1FIQA 2W54A 1YNTE 3P1MA 1TYGB 3ZQ4A 1YQ3B 1AN8A 3BZDB 1N62A 1IGDA 1SBBB 4US9A 2WXLA 5BMIA 1SXTA 5EE1A 2M19A 1TY0A 1QOAA 2W3SA 4WAFA 1K50A 1JWBD 2DYMA 1WSPA 1HXYD 1JRPA 2LJIA 2WXMA 3BVMA 1P7EA 4P16A 4RH6A 2BS2B 1EWCA 1OFFA 1XLOA 3I9V1 1WGKA 1FD6A 4LTUA 1NVID 2KMMA 1XXGA 5BYRA 1JWMD 3Q8FA 3TEYA 3HRDD 1FXAA 4A6QA 4CQNA 3TSSA 2FBWB 2RDGA 4WURA 4DXGA 2LEKA 1GOZA 1XF5L 1MPEA 1J7AA 1NYRA 2N9KA 2XN9C 1N5XA 4RCOA 2AX5A 2ZW0A 4KKJA 3Q8CA 1SE4A 1UUPA 1ZE3D 1L6VA 2LUMA 1VRAB 2N9LA 2W3RA 2HDEA 2N0SB 3PO0A 1I7HA 1F2RC 4YTMB 1DOXA 1JROA 1C79A 1PUTA 1HA5A 1D5ZC 3ZJVA 1FMAD 2CJOA 3NVZA 3TUOA 1SE2A 2WS3B 1L6UA 2CJNA 3EA6A 1JALA 1NYQA 2WXGA 1ET6A 4A55A 5BMHA 2IJ0A 3MJ5A 1L4DB 1I4PA 3I57A 4OVZA 2JWUA 1RFKA 2KWDA 3LXFA 2V3PA 5D7GA 2NMQA 4MH8A 3KWVA 2WDQB 1FRDA 1YN5A 2JQRB 4ARIA 4N6EB 1TY2A 4ZRPA 1CJEA 1FCCC 3N9YC 2JSVX 2V4IB 4IKGA 1DOIA 2QILA 1D6EC 1V97A 1QQRA 1JWAD 4JWUC 4ZHOA 3ZYYX 3V3XA 1E6EB 4RF0A 1UWXA 3AEGB 2PVGC 3SR6A 2DBYA 4PT5A 2RPVA 2L1AA 3OWEB 1FNUA 1VJKA 1IBXA 1KH0A 1SE3A 1MHHE 1M4VA 1XLQA 4NZLB 1FFVA 4JPSA 2K0PA 4TSSA 3NUHB 3IXSA 1QT9A 3AV8A 3KWLA 3BVGA 2WDVB 1GB4A 1UGJA 1SSNA 1D4BA 4ZHPA 1KFYB 4O1NA 2KQ4X 4JE3B 1XCTL 2IGDA 3KQ4A 2JYEA 4KKIA 4XWTA 1SB3C 3MHZA 1L0YB 3VR8B 3NS1A 1N63A 2BS3B 4J3OD 5E6JA 3H8HA 4HKQA 1UWMA 1EU3A 3AEAB 3HUIA 2IGGA 2SAKA 2DYOA 1FEHA 2L32A 2VZKD 2SEBD 3W5UB 2KAJA 1J7BA 4US8A 4AS1A 2WXPA 3W5VB 2WNMA 1MI0A 3BWUD 5C3JB 1PYWD 1SJHD 2Y5CA 4HRSA 1J7CA 3EGRA 1WWTA 1ZDVA 2AQ1B 1DGJA 2BB6A 1EU4A 2G9HD 2QMTA 4HJGE 4TQ0A 3AE9B 4RGTA 3GP7A 1GAQB 2K22A 3NZ3A 3PZ8A 1QLBB 2BBCA 2Y3AA 1OQRA 3P63A 2BT6A 4B0MA 2OHFA 1ROEA 3NVYA 1KRHA 1K51A 2CU3A 4WIPA 1E0ZA 4TQ1A 2TSSA 4TMAB 2G1EA 1L0XB 1DOYA 1QOGA 1CZPA 3IAM1 1C4CA 4NAMA 3U52E 3TEZA 4RGOS 2B76B 2PTLA 2EKIA 3AE8B 3O13A 3P4RB 2R61A 1F2RI 1QILA 2JX5A 2Q5WD 4FXCA 4JX1C 4KGTA 1ZXIA 2NTSA 1C9FA 2WU2B 4KGSA 1AW7A 2MJDA 2INPE 3V05A 1JWSD 4C56C 3B2GA 2PIAA 1T3QA 3NRZA 1B9RA 1VDVA 3FAHA 1GPXA 5H92C 5D3IB 1V8CA 2PMVA 1BMLC 1QOBA 3VQIA 1HZ5A 1D5XC 5HG2A 2V0GA 1SF0A 4JWSC 1VZ7A 4WH4A 1NI3A 2XNAC 3R2TA 2ICIA 3AE1B 2EELA 4YTPB 3IAS1 3GS2A 1XEEA 4ARCA 1WXQA 2LHEA 1FNWA 1RM6C 1JMLA 1P7FA 5LNK1 3Q69A 2I38A 3PZ7A 1TKYA 3RPFC 4MM3B 2X38A 3ZJUA 2AQ3B 3AEBB 2YEPF 2RDHA 4USAA 2D5GA 4XWWA 1D5MC 2L52A 1JWUD 2WXJA 5H8YE 3W9CB 3FC4A 1N61A 1Q10A 2BW2A 1JCKB 4YSZB 4L1BA 3AM9A 1I4GA 4UDUC 4RF1A 2WXHA 4REZA 2ACZB 2H88B 3MFGA 3SFDB 4D2KA 2WXOA 1IGCA 1VR9A 2IGHA 1ZPSA 1B1ZA 1XO3A 1RYJA 1T6BX 2Y5PA 3NVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M19 A;  2PVO D;  1QOA A;  2W3S A;  3NS1 A;  1F0Z A;  1N63 A;  2BS3 B;  3AE2 B;  1JWB D;  1UWM A;  3AEA B;  2QJL A;  4YSX B;  1N60 A;  1JRP A;  3HUI A;  3EUB 2;  2BS2 B;  5AUI A;  1XLO A;  1OFF A;  3W5U B;  1L5P A;  1J7B A;  2KAJ A;  1WGK A;  2MH7 A;  4LTU A;  4US8 A;  1NVI D;  2KMM A;  1AWD A;  3W5V B;  3AB5 A;  5C3J B;  3LB8 C;  2Y5C A;  4HRS A;  3HRD D;  2E3T A;  1FXA A;  2DWQ A;  2WLB A;  1J7C A;  3B9J A;  1WWT A;  3P4P B;  1A70 A;  3AE6 B;  1JQ4 A;  2FBW B;  1DGJ A;  2LEK A;  3NVW A;  3AE9 B;  1J7A A;  1NYR A;  2BS4 B;  1FO4 A;  1GAQ B;  1PFD A;  2K22 A;  5EE9 A;  1N5X A;  3AEF B;  1QLB B;  4YXD B;  3AE7 B;  4N59 A;  2AX5 A;  1OQR A;  1TKE A;  2BT6 A;  3L4P A;  3P63 A;  3VRA B;  2OHF A;  1XLN A;  4C7Z A;  1ROE A;  1YJJ A;  3NVY A;  1KRH A;  1FRR A;  4ZOH C;  1PDX A;  2CU3 A;  4YT0 B;  1E0Z A;  1L6V A;  2G1E A;  4WQM A;  1IUE A;  3AEE B;  4YTN B;  2W3R A;  1DOY A;  1RWS A;  1QOG A;  2N0S B;  1CZP A;  1I7H A;  3PO0 A;  1KF6 B;  1WYG A;  2MJE A;  4YTM B;  1DOX A;  1JRO A;  4N58 A;  1PUT A;  2B76 B;  2EKI A;  3AE8 B;  3P4R B;  2K9X A;  1N5W A;  2QIE B;  2JX5 A;  1FMA D;  2Q5W D;  3VR8 B;  4FXC A;  2CJO A;  1FM0 D;  4JX1 C;  2H89 B;  3NVZ A;  4HRO A;  1ZXI A;  3VRB B;  2WS3 B;  1QF6 A;  1L6U A;  2CJN A;  2K5P A;  2WU2 B;  3WCQ A;  1JAL A;  2WDR B;  3AE3 B;  1NYQ A;  2MJD A;  2WQY B;  3CWI A;  1JW9 D;  4IDI A;  5MPO A;  1EWY C;  2PIA A;  2WP9 B;  3AE4 B;  3B2G A;  1ZP0 B;  1T3Q A;  3NRZ A;  1WRI A;  4KX6 B;  1B9R A;  3AH7 A;  1VDV A;  5C2T B;  4C7Y A;  3FAH A;  1GPX A;  5H92 C;  1V8C A;  1ZUD 2;  1RFK A;  3LXF A;  1QOB A;  2W55 A;  1OQQ A;  1FFU A;  5EE3 A;  1E10 A;  2WDQ B;  3AED B;  1FRD A;  1SF0 A;  2JQR B;  1E9M A;  4JWS C;  4N6E B;  4P6V F;  3P4S B;  2HTM E;  1TJE A;  1NEK B;  1NI3 A;  3AEC B;  1SIJ A;  1AYF A;  1R7S A;  1CJE A;  3DWG C;  3HVZ A;  2WU5 B;  3AE1 B;  3SFE B;  4YTP B;  1WXQ A;  3BII D;  3CIR B;  1DOI A;  1TKG A;  1VLB A;  1V97 A;  3ABV B;  1RM6 C;  1JWA D;  4JWU C;  4C80 A;  3ZYY X;  5G5G A;  4ZHO A;  1E6E B;  3VR9 B;  1YQ4 B;  1E7P B;  3AN1 A;  3AEG B;  2PVG C;  3SR6 A;  1TKY A;  3RPF C;  5GXG B;  2DBY A;  3AEB B;  1FXI A;  1VJK A;  1ZOY B;  4USA A;  1L0V B;  2L52 A;  5H8Y E;  3P4Q B;  3W9C B;  3FC4 A;  1XLQ A;  1N61 A;  1FFV A;  4YSZ B;  4ITK A;  4YSY B;  3AMZ A;  2PKO A;  1YJI A;  3AM9 A;  1QOF A;  5EE0 A;  4WWM A;  3ETR A;  1QT9 A;  1NEN B;  3AV8 A;  2ACZ B;  2H88 B;  3B2F A;  3KWL A;  1FIQ A;  3SFD B;  2MJ3 A;  2M56 B;  2WDV B;  2W54 A;  3DWM A;  2L83 A;  3P1M A;  4ZHP A;  1TYG B;  1KFY B;  5G5H A;  5AUK A;  1YQ3 B;  4A9A A;  1N62 A;  1SB3 C;  1XLP A;  1XO3 A;  1RYJ A;  3AE5 B;  4US9 A;  3NVV A;  5EE1 A; 
#chains in the Genus database with same CATH topology
 4AQ7 A;  1P9D U;  1UD7 A;  5D3D A;  3AE2 B;  3DHI C;  2BYT A;  3DBS A;  3ZGZ A;  4G3X B;  5LLI A;  1H4R A;  1TGZ B;  1IPG A;  1AWD A;  2LGI A;  4OZB A;  4KZ0 A;  1C78 A;  2KQ7 A;  2DWQ A;  2KOX A;  1F77 A;  1JQ4 A;  2WXK A;  2L3Z A;  1RAX A;  2BTE A;  2ZJD A;  3NVW A;  1PGA A;  1FO4 A;  1YMH E;  3BYT B;  3AE7 B;  1EF5 A;  2FIF A;  3I3T B;  4I6P A;  1T0Y A;  4K7S A;  2NR2 A;  1YJJ A;  2ZNV C;  3J9C A;  3JVZ X;  1R4N I;  1BUI C;  2BPS A;  2KLG A;  1IUE A;  4G50 A;  4A8X C;  1UBI A;  3N1Y C;  4GLS C;  3M62 B;  2DZK A;  2BB5 A;  2KXJ A;  3K9O B;  2MBO A;  1FM0 D;  4TV3 A;  2K5P A;  3WAL A;  2WDR B;  3PRE A;  2K6Q A;  2WXN A;  3NY5 A;  2ONQ A;  3KUD B;  4C7Y A;  2JF5 A;  4B0E A;  4BBN F;  1WM3 A;  3UQB A;  3APF A;  1C3T A;  1HQR D;  3RNE C;  1C77 A;  3W1S C;  4XYC A;  4ZRK A;  1KLU D;  1PGB A;  2CR5 A;  2J0J A;  2FCS A;  3T3N A;  3ABV B;  3A9J B;  2FE8 A;  3EFC A;  4EOY A;  2YLM A;  4W9I A;  3IT4 B;  2DLB A;  1MG4 A;  3PVL A;  3AMZ A;  4GDK A;  4NPN A;  4HVB A;  2I2Y A;  1KTK A;  1E8Y A;  2LXA A;  1WJU A;  2GLS A;  2WXF A;  4IUM B;  2IY0 B;  2MLB A;  2QJL A;  5JHB A;  4W9C A;  3ZJT A;  3FIL A;  5IAA C;  3LYY A;  3H7P B;  4FHJ A;  4L2Y A;  4ZRJ A;  4ZYS A;  2JU6 X;  3P4P B;  4OHJ A;  3ZXR A;  2FUG 1;  4W9H A;  4AP4 C;  1YN3 A;  1WJN A;  2EKE C;  4K1R B;  3L4P A;  4PS3 A;  3VUY A;  1SIF A;  3AU5 A;  1PDX A;  3N1X C;  2IBI B;  4GDL B;  2L0F A;  1I4X A;  5BYS A;  2HD5 B;  1UH6 A;  4JLC A;  2D07 B;  4HRO A;  1C76 A;  1TIF A;  2WQY B;  1WRI A;  3AU4 A;  1BXT A;  3MC9 A;  1F1H A;  4K7W A;  2ON8 A;  1FFU A;  2MBH A;  4P6V F;  3ZNG C;  1V2Y A;  4K3B A;  3Q2A C;  1NEK B;  1SIJ A;  4WWP A;  2WU5 B;  4J6I A;  4EUT A;  1VLB A;  3QHT A;  1V1P A;  4QAY A;  1EUV B;  1I35 A;  4LDT D;  5I4D A;  2JXT A;  5GXG B;  2FUH B;  2MX2 A;  3MP9 A;  3OJ3 A;  4FN2 A;  5GMV A;  1WZ0 A;  3P4Q B;  4E74 A;  1K8R B;  2KDB A;  3RZF A;  1TS2 A;  4MH0 E;  3UI3 A;  3C19 A;  3ONS A;  4FLH A;  2W54 A;  3P1M A;  1BT0 A;  3ZQ4 A;  3U30 A;  1SBB B;  2PE6 B;  3AXC A;  5EE1 A;  1TY0 A;  4WAF A;  1JWB D;  1HXY D;  4ICU A;  1WR6 E;  2CU1 A;  5C1Z A;  2M4N A;  3BVM A;  2KLC A;  1P7E A;  4P16 A;  2CS4 A;  1OFF A;  1FD6 A;  3ZNZ B;  1X1M A;  5J2R A;  2RDG A;  4WUR A;  4DXG A;  3AUL A;  3L17 A;  1MPE A;  1NYR A;  2N9K A;  1WMH A;  1R4N B;  2AX5 A;  4FBJ B;  2BYF A;  5L95 C;  1P3Q U;  1LGR A;  1SE4 A;  1J8C A;  5JZE B;  1WGD A;  1I7H A;  4KDL B;  2DAF A;  1F2R C;  1DOX A;  1JRO A;  1WXM A;  1UGM A;  3QX1 A;  1S1Q B;  5J18 A;  3EA6 A;  1YOV B;  1ET6 A;  2KD0 A;  5BMH A;  2IJ0 A;  3C0R B;  1L4D B;  4OVZ A;  2V3P A;  5D7G A;  3B1L X;  1FRD A;  1YN5 A;  4ARI A;  4N6E B;  2JT4 B;  4FJV B;  1TY2 A;  3EEC A;  4NQK E;  2JSV X;  2QIL A;  4RF0 A;  1S3S G;  4GXB A;  3AEG B;  2ZPN A;  1YD8 U;  1HTO A;  1IBX A;  1KH0 A;  1V6E A;  3DHH C;  1M4V A;  2IO3 B;  4EEW A;  2WGS A;  4JPS A;  4IWP A;  1EF1 A;  2N1V A;  3IXS A;  2V4L A;  3KWL A;  1V81 A;  4LDT B;  4KSK C;  1UGJ A;  4NY0 A;  4ZHP A;  3KQ4 A;  2L05 A;  3A1Q A;  2JYE A;  4XWT A;  2K1F A;  2KDE B;  1A5R A;  3WAO A;  4J3O D;  1UWM A;  3AEA B;  4PS7 A;  1UEL A;  2SAK A;  3L0W B;  1E7U A;  4LNK A;  2VZK D;  3S2A A;  3PTF C;  1J7B A;  3WIM A;  5C3J B;  2Y5C A;  2LGX A;  2DZM A;  4JL9 A;  1J7C A;  1WZ3 A;  4P1B C;  4DXA B;  1DGJ A;  4FJY A;  2QMT A;  4RGT A;  1GAQ B;  1QLB B;  1OQR A;  2BT6 A;  2MQJ A;  2JVC A;  1KRH A;  2KMC A;  2G1E A;  2KAN A;  1AAR A;  1C4C A;  2B76 B;  2PTL A;  4WJQ A;  1GJZ A;  3O13 A;  2D3C A;  2Q5W D;  1ZXI A;  2KJR A;  2IO1 B;  2WU2 B;  2Z59 B;  3NOB A;  3V61 A;  5D3I B;  1V8C A;  3AI5 A;  1WR1 A;  1T0S C;  1SF0 A;  4JWS C;  4DBG A;  1VCB A;  2NBV B;  3R2T A;  3AE1 B;  3IAS 1;  3OLM D;  4ARC A;  1WXQ A;  4MEL A;  1Q0W B;  1RM6 C;  1P7F A;  1NI2 A;  2I38 A;  4MM3 B;  2KT7 A;  5KHO A;  3RYT A;  3VDZ A;  2KKC A;  3AEB B;  2RDH A;  1D5M C;  5H8Y E;  3VH4 B;  1V5O A;  1I4G A;  2WXH A;  2H88 B;  3MFG A;  2G4S A;  2WXO A;  1J0G A;  1KOT A;  2KK8 A;  1B1Z A;  2D10 A;  3GZN I;  1XO3 A;  4CO7 A;  5E6P A;  3ALB A;  2QDF A;  1ENF A;  4K7U A;  1OEY J;  3ZRC A;  1T5X D;  4GN1 A;  3N20 C;  5J17 A;  3EUB 2;  4RFB A;  5BMG A;  1ZKH A;  1L5P A;  3GOE A;  3U8Z A;  2MH7 A;  2YEP B;  4K3C A;  2JZ3 B;  3AB5 A;  2KVZ A;  1LFD A;  3PHX B;  3AE6 B;  4EZJ A;  1FNV A;  1V1P B;  3WAN A;  3L13 A;  5EE9 A;  2VZK B;  4PYZ A;  5AEK B;  4GU2 A;  4DDI D;  1FRR A;  3ZW3 A;  4C00 A;  4YT0 B;  4PYU A;  3CSF A;  3KLS X;  4B95 A;  2RPQ A;  1C4A A;  3Q3M C;  2MJE A;  2JZP A;  1WJ6 A;  4N58 A;  3SU8 X;  5CX3 A;  2PLP A;  1LM8 B;  2KN4 A;  4R3D A;  4H2A A;  5MPO A;  2ZPY A;  1ZP0 B;  1L7Y A;  2NBU A;  4EZL A;  4KIK B;  4KX6 B;  4A90 A;  4NAW A;  1XQQ A;  3URY A;  3Q3N C;  4KZC A;  1YQB A;  3U2S C;  4IOI E;  5FR6 A;  5KHQ A;  1OQQ A;  5IN7 A;  1ZW7 A;  4LNI A;  4ANW A;  2QHO A;  5C23 A;  3TMP B;  3SFE B;  4XE0 A;  1HZ6 A;  1ZXH A;  3Q14 C;  3RZW C;  1MFW A;  1WMH B;  3BIN A;  1NDD A;  4PS8 A;  3V6C B;  4RGN A;  3VTW A;  4LNO A;  4MAC A;  1FCL A;  2KAC A;  1IP9 A;  1L0V B;  2KNB A;  2LWP A;  4IM3 A;  4MEM A;  2PPH A;  4WWM A;  2HJ1 A;  4A3O A;  2INN E;  1WGY A;  2M56 B;  3MC8 A;  3IT6 B;  1VZ8 A;  5G5H A;  1L4Z B;  1N6Z A;  4A9A A;  5HHD G;  2NTT A;  3DVG Y;  2KC1 A;  4B9K A;  1CK1 A;  1WRD B;  3VUW A;  4KGR A;  4HXD A;  1I4R A;  4HEA 1;  5TSS A;  4I6L B;  2M1M A;  2W9N A;  2LMC A;  4IG7 B;  3ZDM C;  3JSV B;  4HWI B;  2J53 A;  4LK0 M;  2N7J A;  2C7M B;  4WJN A;  2BS4 B;  1V49 A;  5T8I A;  1UNS A;  4XDC A;  4YXD B;  4FJZ A;  3VRA B;  1IBX B;  4E3C A;  2KWV B;  2MSE D;  3DVG X;  3CMM B;  3AEE B;  2N7D A;  2NPT A;  4E71 A;  1KF6 B;  3APC A;  2LJ5 A;  5DPS A;  1FPY A;  2QIE B;  4M02 A;  3ML9 A;  3A9K A;  4RNA A;  1SGH A;  3CWI A;  3GE3 C;  3JW0 X;  4GSW A;  4IDI A;  2LAS A;  3Q8B A;  5C2T B;  1WX8 A;  2RMM A;  2KWC A;  3MHS D;  2PW9 A;  2N1W A;  1LQB A;  1WY8 A;  2BYE A;  2WXI A;  3P4S B;  1KLV A;  3OJ4 B;  1TZ1 A;  1R7S A;  1UZX B;  3QK0 A;  3UGB B;  1TKG A;  1TS3 A;  2WXR A;  3BK1 A;  3P42 A;  4ANV A;  1TZO A;  2MW5 A;  4OZC A;  4N9F 4;  1VD2 A;  3I63 C;  1WXA A;  3RNF C;  3QAR A;  1TS4 A;  1QOF A;  2MEK A;  3GZN B;  3QQ8 B;  2KX3 A;  2MHJ A;  1YNT E;  3NJT A;  4MGK E;  3BZD B;  4BBN C;  1N62 A;  5CHV C;  1E5W A;  3EC8 A;  2M19 A;  3KVF B;  1RLF A;  2ASQ A;  2UU7 A;  2LJI A;  3LDZ E;  3R7Q A;  2VH2 A;  2K6D B;  1XLO A;  1WGK A;  4LTU A;  2KMM A;  1JWM D;  3PRP B;  2OOB B;  1CMX B;  1FXA A;  4A6Q A;  5AZG A;  4IWQ A;  2LEK A;  2VRR B;  1WE7 A;  5E6O A;  1N5X A;  2XK5 A;  5IP4 D;  4ACF A;  2L00 B;  2KN5 A;  4MJS A;  2RGF A;  3SDL C;  3KYC D;  2LUM A;  3W1Y A;  2HDE A;  3KW5 B;  1C79 A;  1HA5 A;  1FMA D;  4EFO A;  3ZVV A;  3NVZ A;  1L6U A;  3DVN U;  4A55 A;  5DPW A;  2KTR A;  3I57 A;  2MWS B;  2WX1 A;  4MH8 A;  3KWV A;  2INC C;  2JQR B;  1P98 A;  2G4D B;  2RSU A;  3L08 A;  3IG3 A;  2KFK A;  1QQR A;  3ZYY X;  3V3X A;  1E6E B;  3SR6 A;  2HE7 A;  4BAX A;  4G11 A;  1LXD A;  1WXV A;  2RPV A;  3OWE B;  4W9G A;  2MCN B;  2O6V A;  1XLQ A;  4MGZ E;  3TBL D;  2K0P A;  3JYU A;  4M8N A;  3NUH B;  1F9J A;  2KDF B;  2WDV B;  4JE3 B;  2IGD A;  1SB3 C;  1T0R C;  1L0Y B;  2GBR A;  3NS1 A;  4W9F A;  3ZLZ A;  1WXS A;  4HKQ A;  3H8H A;  5E6N A;  2NVU I;  2DYO A;  1FEH A;  2L32 A;  2BGF A;  4US8 A;  3WAM A;  4AS1 A;  2WNM A;  1MI0 A;  1PYW D;  1SJH D;  4W9L A;  2IO2 B;  4IM2 A;  3PLU A;  3ZNH B;  3RNA C;  3GP7 A;  2K22 A;  4W9J A;  2BBC A;  4B0M A;  3P63 A;  2A4Z A;  3EHV A;  1G6J A;  4LNF A;  1ROE A;  1U4A A;  1K51 A;  4WIP A;  1YX5 B;  2UWQ A;  3VAW A;  1DOY A;  1QOG A;  1CZP A;  4NAM A;  3TEZ A;  3A4R A;  3PS6 A;  4S0R A;  2R61 A;  3D32 A;  1RFA A;  4GB9 A;  1C9F A;  2EMT A;  1T3Q A;  3PPA A;  1VDV A;  3FAH A;  2M8S A;  2PMV A;  3VTV A;  1BML C;  2NCN A;  1D5X C;  4CYE A;  2XNA C;  4HDO A;  4S17 A;  4DHZ E;  2LZ6 A;  2OJR A;  4YTP B;  2MBE A;  3B0A A;  2LHE A;  2DYB A;  1FNW A;  3H6N A;  4F8C B;  1WE6 A;  3ZJU A;  4USA A;  4XWW A;  3CST A;  1JWU D;  2WXJ A;  4IW0 A;  3FC4 A;  1N61 A;  1HE8 A;  1JCK B;  4YSZ B;  5D6J B;  2FNJ B;  3M3J A;  4REZ A;  2LGD A;  3N32 A;  4GOC A;  3WAP A;  4EKU A;  1VR9 A;  2IGH A;  3RD2 A;  1ZPS A;  3M95 A;  2Y5P A;  3NVV A;  2PVO D;  5D2M B;  3ZDT A;  1F0Z A;  2I1K A;  5JXV A;  2DZJ A;  1Y56 A;  3M63 B;  2ZVO A;  4JIO U;  3U4E G;  1V1O A;  3U7D A;  2D3B A;  3KUZ A;  3IHP C;  2E3T A;  1DYQ A;  2RDB C;  4RM8 A;  3VTU A;  3APD A;  2CHW A;  4N59 A;  1RRB A;  1I4H A;  1XLN A;  4C7Z A;  3T3O A;  1MHX A;  3UF8 A;  4ZOH C;  3DDC B;  4EZK A;  5CTR C;  5JHA A;  1EM7 A;  4BKS A;  2NS5 A;  3A33 B;  2G45 B;  4G0N B;  1SEB D;  3KH0 A;  4AWJ A;  4CHK A;  2Z8L A;  3RNB C;  3X0W A;  2LVO A;  2A5U A;  4GIV A;  3RFZ B;  1ET9 A;  2GMI C;  2J0K A;  2O2V A;  3AE4 B;  4WJP A;  3R66 C;  1FXT B;  2GBJ A;  4IWO A;  1YJ1 A;  3U7Z A;  4P1C C;  1E10 A;  1XCQ L;  4OVV A;  2HTM E;  2ZW1 A;  4GDK B;  3BK2 A;  3AEC B;  3DWG C;  4NQL B;  2GI9 A;  2LGS A;  3MTN B;  5FK9 C;  4F1S A;  3NHE B;  2OJW A;  3H9D A;  5DPT A;  2V3N A;  4DK5 A;  4MJS B;  3RUI B;  1ZOY B;  1Z5S B;  4XX5 A;  3FIL B;  1ZDX A;  4YSY B;  2MA9 B;  2NBW B;  1WM2 A;  1GG3 A;  2FID A;  1ESF A;  1VZ6 A;  5HFY A;  1K52 A;  2IPK D;  5AUK A;  3OG5 A;  3L54 A;  1QKZ A;  2KJ6 A;  3DCG A;  3ML8 A;  4HCP B;  1KLG D;  1IYF A;  3DBL I;  4P7I A;  1N60 A;  3ECI A;  1HEZ E;  3LJ3 A;  3CF6 E;  3E56 A;  2C5L C;  4GMV A;  3IVF A;  3B9J A;  1K53 A;  4DHJ B;  2KFK B;  4WAA A;  2K3U A;  2V3S A;  3KYD D;  2GB1 A;  1GC6 A;  3Q8E A;  2KZR A;  3X23 A;  2IDY A;  4XDD A;  4W9E A;  3EFU A;  1WGH A;  3H7P A;  4WQM A;  3PZD A;  3R8B A;  1WYG A;  4C4V A;  2GOW A;  2KO3 A;  4DQO C;  3TEW A;  2IY1 B;  2VH1 A;  2OED A;  2H89 B;  5BYQ A;  3AE3 B;  4HJK A;  1STE A;  1EWY C;  2WP9 B;  2BWE S;  3AH7 A;  1QZE A;  1GB1 A;  1ACC A;  2C9W B;  4GDL A;  5EE3 A;  3SEB A;  3AED B;  1MVK A;  3W2D A;  3UQA A;  4HLE A;  2WXQ A;  1OGW A;  2BYV E;  4IM0 A;  2AL3 A;  4A3P A;  4DXF A;  3BYY B;  3NZU A;  2PE9 A;  4XC2 A;  1WF9 A;  1FXI A;  3H7S A;  3DBR B;  2R2Q A;  2DX5 B;  1HTQ A;  5FKA C;  1V86 A;  2ZCB A;  2AL6 A;  1WIA A;  3ENE A;  5HKH A;  4ICV A;  2KDI A;  1AN8 A;  4WWN A;  4US9 A;  5BMI A;  2V9H A;  1QOA A;  2W3S A;  4BVU C;  1WSP A;  1L2N A;  1JRP A;  4W9D A;  2WXM A;  4RH6 A;  3OAW A;  2BS2 B;  2IZV B;  3P2B A;  1EWC A;  2N9E B;  1XXG A;  4KSL C;  3VVW B;  3Q8F A;  4CQN A;  1YX6 B;  2JRI B;  4RCO A;  3R3M A;  3MJW A;  3ZRF A;  4KKJ A;  4X57 B;  4ZRI A;  4XZ4 A;  1MG8 A;  1L6V A;  1VRA B;  2D3G A;  4W9K A;  2Z0D B;  3PO0 A;  4GGQ A;  2QC8 A;  4YTM B;  4M8M A;  1PUT A;  1WH3 A;  3RMK C;  3PHW B;  3ZJV A;  4MSQ B;  2WDT B;  3TUO A;  2WS3 B;  2CJN A;  1JAL A;  1NYQ A;  2WXG A;  5D94 A;  1NBF C;  2BVC A;  2KMA A;  4AOF A;  2JWU A;  2KJH B;  1RFK A;  2KWD A;  2NMQ A;  3TJP A;  4RMA A;  4ZRP A;  1CJE A;  1UBQ A;  4IKG A;  4LJO B;  1DOI A;  3A1Q B;  1V97 A;  2JWZ A;  4JWU C;  4MGI E;  2KC2 A;  3RN9 C;  5IA7 A;  3L16 A;  5DPR A;  3PGE A;  2L1A A;  1VJK A;  1SE3 A;  2K8B A;  4NZL B;  2JY6 A;  4TSS A;  4FA6 A;  3AV8 A;  2ZCC A;  2Z0E B;  1GB4 A;  1SSN A;  3DBL B;  1KFY B;  4O1N A;  2JXX A;  4KKI A;  4ZYN A;  2O2V B;  3RI7 C;  1N63 A;  2BS3 B;  3HHM A;  4BKG A;  4IC7 B;  3HUI A;  2LVQ A;  2D3A A;  1E8Z A;  2SEB D;  4MDK E;  2KAJ A;  2WXP A;  3W5V B;  3BWU D;  3FKY A;  3VXW A;  1WWT A;  1ZDV A;  2X8X X;  3QC8 B;  2AQ1 B;  2BB6 A;  1EU4 A;  2G9H D;  4HJG E;  4TQ0 A;  3AE9 B;  3PZ8 A;  2N9X A;  5G2N A;  5EDS A;  2Y3A A;  1WGR A;  3NVY A;  4BKT A;  2EMS A;  4TQ1 A;  1E0Z A;  2K39 A;  2TSS A;  1L0X B;  2JUO A;  5DCN A;  3IAM 1;  3U52 E;  1GC7 A;  4MGY E;  4RGO S;  1WJ4 A;  3AE8 B;  1JRU A;  2JX5 A;  3DOW A;  4FXC A;  4TKN A;  4KGT A;  3PRZ A;  2NTS A;  2GBN A;  5CHW A;  4A20 A;  4KGS A;  1AW7 A;  2MJD A;  1JWS D;  2PIA A;  4ANX A;  1C1Y B;  2IYD B;  1GPX A;  4HPP A;  1QOB A;  3GE8 C;  3VQI A;  4DWF A;  2V0G A;  4HPM B;  1NI3 A;  4KV2 A;  3RNG C;  2MRP A;  2HJ8 A;  2EEL A;  1JML A;  3PT2 B;  4KVG B;  1TKY A;  3RPF C;  2X38 A;  3A4S C;  4RM9 A;  3N1Z C;  1Q10 A;  4L1B A;  4FAD A;  3PRM B;  1XT9 B;  5JH5 C;  1PQS A;  4RF1 A;  4HDQ A;  4C4V B;  1P0R A;  1Y8R C;  2N4F A;  4D2K A;  3VUX A;  3ZNI D;  2AYO B;  2DZI A;  1WYW B;  1I42 A;  5LXH A;  1KJT A;  1RYJ A;  1T6B X;  2G3Q B;  1D3Z A;  2KDM A;  3GB1 A;  4MM3 A;  4RGM A;  2CHZ A;  4YSX B;  4DDG D;  4AJY B;  1E7V A;  3DBH I;  3NZS A;  3LB8 C;  2QSD A;  4YL8 A;  3BY4 B;  1TS5 A;  4TUU A;  3HM3 A;  3C8Y A;  1PFD A;  1R4M I;  3ZXV A;  1E8X A;  3DHG C;  2B3A A;  2JYT A;  1TKE A;  5FR3 A;  4BZA A;  4NAW B;  3QA8 A;  3R7R A;  1SJE D;  2M0X A;  4YTN B;  2FCM A;  2KQS A;  2FCN A;  2QEJ C;  2QCZ A;  5G55 A;  2K9X A;  3RT3 B;  1N5W A;  1UF0 A;  3E9S A;  3DPD A;  3VRB B;  3WCQ A;  2LFI A;  1JW9 D;  3RNC C;  3PLV A;  1M94 A;  2E6X A;  2XBB C;  2LHD A;  2IO0 B;  4KDI C;  1E9M A;  2FCQ A;  3R2I A;  4WWO A;  1AYF A;  3HVZ A;  3UIN B;  2CHX A;  1PGX A;  3CIR B;  3BII D;  3MC0 B;  5G5G A;  3ZTC A;  3VR9 B;  1YQ4 B;  1P1A A;  1E7P B;  2GRI A;  3ZKJ C;  4NJC A;  2LVP A;  4KIK A;  5BO4 B;  5L83 A;  2J42 A;  2K8C A;  4OZA A;  3BVZ A;  4L23 A;  3SHQ A;  1YJI A;  4JQW C;  3ETR A;  1NEN B;  5AZH A;  3Q3J A;  1CQV A;  2MJ3 A;  4EE2 A;  3DWM A;  2L83 A;  4II2 B;  2DNF A;  2MP2 A;  1XLP A;  3AE5 B;  3QWZ B;  2CKH B;  3DQV A;  2J52 A;  2V1Y A;  4Q2J A;  2LGY A;  2DEN B;  2KHW B;  3ZUN A;  3W1S A;  2C60 A;  3Q3F A;  5AUI A;  2J0M A;  3HIZ A;  2NPT B;  2LUE A;  2WHI A;  3I5J C;  1C4P A;  2WLB A;  4HCN B;  1XD3 B;  1LO5 D;  3DBR I;  1A70 A;  2D2Q A;  3QIJ A;  3A9K B;  3AEF B;  2AQ2 B;  3TEX A;  3VFK A;  4DHJ D;  3Q6B A;  4ANU A;  3IFW B;  3HM6 X;  1RWS A;  2ZEQ A;  3JSV A;  4LLG M;  2O6V D;  3L10 B;  3V6E B;  2KFJ A;  1QF6 A;  1YIW A;  4M0W A;  4BOZ B;  4ASW C;  2WWZ A;  4HKZ E;  1V5T A;  4ZRQ A;  5AZF A;  4MT5 A;  1YN4 A;  4M01 A;  2AEH A;  5LXI B;  1ZUD 2;  2W82 A;  2KTF A;  2W55 A;  5HI1 A;  2C7N B;  2J4X A;  2WYQ A;  2M0A A;  4AJW A;  4OVU A;  2GBK A;  1EO6 A;  1TJE A;  4AUQ C;  3DVN V;  2BKF A;  1J19 A;  1H8C A;  3B08 A;  2L0T A;  3HVD A;  4C80 A;  2BKR B;  3ZTD A;  1I4Q A;  3AN1 A;  3Q8A A;  4XGA B;  3Q3O C;  4WQO B;  4YWG G;  4ITK A;  2PKO A;  4OW0 A;  2ZVN A;  5EE0 A;  4NJ7 A;  3B2F A;  1WX9 A;  1FIQ A;  2HTH A;  3O65 B;  1TYG B;  2M17 A;  5IO9 A;  1YQ3 B;  1F52 A;  1IGD A;  2WXL A;  3IBE A;  2XK5 B;  1SXT A;  2PEA A;  3DBH B;  1K50 A;  2DYM A;  2JZZ A;  2FAZ A;  4F7Z A;  3KUC B;  3I9V 1;  1E8W A;  1NVI D;  5BYR A;  1R4M B;  3TEY A;  3HRD D;  2DAJ A;  1OTR B;  3TSS A;  1OEY A;  2FBW B;  4M00 A;  1GOZ A;  1XF5 L;  2YVC A;  1J7A A;  2XN9 C;  3QAQ A;  3A9J A;  4FUL A;  1Q1O A;  1V9J A;  2KTR B;  2ZW0 A;  3Q8C A;  1TT5 B;  1GUA B;  1UUP A;  1ZE3 D;  2K8H A;  2N9L A;  4BFR A;  2W3R A;  1MJD A;  2N0S B;  2KX0 A;  3PSE B;  3TL5 A;  4NNJ B;  1D5Z C;  3H1U A;  2K25 A;  2CJO A;  3N30 A;  1SE2 A;  3UIP B;  3NS8 A;  5IOI A;  3MJ5 A;  1I4P A;  4DHZ B;  2O6V B;  3LXF A;  2LD9 A;  2WDQ B;  3SD5 A;  3ZO5 B;  2R2O A;  2D11 A;  1FCC C;  4B6W A;  3N9Y C;  2N7E A;  2V4I B;  2ZZP B;  1TTN A;  2REX A;  1D6E C;  3PV1 A;  4HK2 A;  1JWA D;  4ZHO A;  1UWX A;  2UYZ B;  2PVG C;  2DBY A;  2L8J A;  4PT5 A;  1FNU A;  2BWF A;  4MSM B;  1MHH E;  1ZGU B;  1FFV A;  3N3K B;  1QT9 A;  3BVG A;  1D4B A;  3RUL A;  2KQ4 X;  1XCT L;  4BKS D;  3MHZ A;  3T9L A;  3VR8 B;  3TIX A;  1OQY A;  5E6J A;  1EU3 A;  4WJO A;  2IGG A;  2L7R A;  2LRU A;  4URK A;  3W5U B;  1WFY A;  4I6N B;  2KYW A;  4HRS A;  3VHT C;  4PK1 A;  5TR5 A;  3EGR A;  3QCA A;  2IND C;  5CHF A;  2LRW A;  3HK0 A;  1KM7 A;  1WI0 A;  3NZ3 A;  2ZNV B;  1GNU A;  2OHF A;  2PJH A;  4FHK A;  2CU3 A;  3WA0 A;  2LI5 A;  4TMA B;  2MBQ A;  1Q5W B;  2L76 A;  2GBM A;  2RR9 A;  2JRH A;  2RD0 A;  4LNN A;  2EKI A;  3P4R B;  2JPH A;  2MP2 B;  2MBB B;  1F2R I;  1QIL A;  4JX1 C;  3UIO B;  4LCD E;  3K9P B;  1WX7 A;  1TBE A;  2LXC A;  5IKC M;  4JGH B;  2INP E;  3V05 A;  4C56 C;  3B2G A;  1SE9 A;  3V60 A;  3NRZ A;  1B9R A;  4ZDV A;  2XEW A;  5H92 C;  1T0Q C;  1HZ5 A;  2N9P C;  5HG2 A;  1Z2M A;  1VZ7 A;  4WH4 A;  3NG0 A;  3VH3 B;  2ICI A;  2BF8 B;  2I1J A;  3GS2 A;  2WX0 A;  1XEE A;  4HPL B;  4BOS C;  5LNK 1;  3Q69 A;  2C7H A;  3PZ7 A;  4II3 B;  3QJZ A;  3T8M A;  2AQ3 B;  2YEP F;  3RCZ A;  2D5G A;  2KWU B;  2L52 A;  4LJP B;  1V80 A;  2AWT A;  3W9C B;  2BW2 A;  3TCA A;  2BQQ A;  2KVR A;  3AM9 A;  4UDU C;  4K81 A;  2Y5B B;  1ISN A;  1WGG A;  2ACZ B;  3SFD B;  1E90 A;  2J7Q B;  3V62 A;  1IGC A;  4M0W B;  3ZIM A;  2DHZ A;  4NJ6 A; 
#chains in the Genus database with same CATH homology
 4AQ7 A;  2PVO D;  2KDM A;  1F0Z A;  5D3D A;  3AE2 B;  3GB1 A;  5JXV A;  4RGM A;  2BYT A;  1ENF A;  4YSX B;  1Y56 A;  1T5X D;  3EUB 2;  3U4E G;  4RFB A;  5BMG A;  3ZGZ A;  1V1O A;  1L5P A;  2MH7 A;  2YEP B;  1AWD A;  2LGI A;  3AB5 A;  4OZB A;  3LB8 C;  2QSD A;  2E3T A;  1C78 A;  1DYQ A;  2DWQ A;  1F77 A;  1TS5 A;  3AE6 B;  1JQ4 A;  2WXK A;  2BTE A;  3NVW A;  1FNV A;  1V1P B;  1PGA A;  3C8Y A;  1FO4 A;  1YMH E;  1PFD A;  5EE9 A;  2VZK B;  3BYT B;  3AE7 B;  4N59 A;  2JYT A;  1TKE A;  5FR3 A;  1I4H A;  1XLN A;  4C7Z A;  3T3O A;  1YJJ A;  4NAW B;  1MHX A;  1FRR A;  4ZOH C;  4YT0 B;  1SJE D;  3J9C A;  3KLS X;  1BUI C;  1EM7 A;  1IUE A;  4YTN B;  1C4A A;  1SEB D;  2QEJ C;  4A8X C;  2MJE A;  4GLS C;  2JZP A;  4N58 A;  2BB5 A;  2K9X A;  2Z8L A;  1N5W A;  1FM0 D;  2PLP A;  3E9S A;  2KN4 A;  4R3D A;  4H2A A;  3VRB B;  3RFZ B;  2K5P A;  3WCQ A;  2LFI A;  2WDR B;  5MPO A;  1ET9 A;  2WXN A;  1JW9 D;  3AE4 B;  2ONQ A;  1ZP0 B;  4KX6 B;  4A90 A;  4C7Y A;  2E6X A;  3URY A;  3U2S C;  4IOI E;  3U7Z A;  2LHD A;  4B0E A;  1OQQ A;  1E10 A;  1XCQ L;  1HQR D;  1E9M A;  1C77 A;  2HTM E;  2ZW1 A;  4GDK B;  3BK2 A;  3R2I A;  3AEC B;  3DWG C;  1AYF A;  3HVZ A;  2GI9 A;  3SFE B;  1PGX A;  4XE0 A;  1KLU D;  1HZ6 A;  1ZXH A;  3BII D;  3CIR B;  1PGB A;  5FK9 C;  3T3N A;  3ABV B;  3MC0 B;  5G5G A;  4RGN A;  3VR9 B;  1YQ4 B;  1E7P B;  2GRI A;  2FE8 A;  4NJC A;  4MAC A;  2V3N A;  3IT4 B;  1FCL A;  2KAC A;  2DLB A;  1ZOY B;  1L0V B;  3FIL B;  2J42 A;  4OZA A;  3BVZ A;  1ZDX A;  4YSY B;  3AMZ A;  4L23 A;  1YJI A;  4WWM A;  3ETR A;  1NEN B;  2INN E;  1ESF A;  1VZ6 A;  1CQV A;  2MJ3 A;  2M56 B;  4EE2 A;  5HFY A;  3DWM A;  2L83 A;  1K52 A;  2I2Y A;  3IT6 B;  1KTK A;  1VZ8 A;  2IPK D;  5G5H A;  5AUK A;  1L4Z B;  4A9A A;  1QKZ A;  1XLP A;  3AE5 B;  5HHD G;  2WXF A;  2J52 A;  2NTT A;  1KLG D;  4Q2J A;  1CK1 A;  4KGR A;  2QJL A;  1I4R A;  1N60 A;  4HEA 1;  5TSS A;  3ZJT A;  3FIL A;  3W1S A;  3LYY A;  1HEZ E;  5AUI A;  2LMC A;  3E56 A;  4L2Y A;  4ZYS A;  1C4P A;  2JU6 X;  2WLB A;  1LO5 D;  1K53 A;  3B9J A;  3P4P B;  1A70 A;  2J53 A;  4OHJ A;  2FUG 1;  4LK0 M;  2N7J A;  2K3U A;  1YN3 A;  2BS4 B;  5T8I A;  2GB1 A;  1UNS A;  3AEF B;  4XDC A;  4YXD B;  3Q8E A;  2AQ2 B;  3TEX A;  3VRA B;  3L4P A;  2IDY A;  1IBX B;  4XDD A;  1PDX A;  4GDL B;  4WQM A;  3AEE B;  1RWS A;  3R8B A;  1KF6 B;  1WYG A;  4LLG M;  1I4X A;  4DQO C;  3TEW A;  5BYS A;  2OED A;  2QIE B;  1QF6 A;  4RNA A;  2H89 B;  4HRO A;  5BYQ A;  4M0W A;  3AE3 B;  1C76 A;  3CWI A;  2WQY B;  1STE A;  4HKZ E;  4IDI A;  1EWY C;  2WP9 B;  4ZRQ A;  1WRI A;  3Q8B A;  4MT5 A;  3AH7 A;  5C2T B;  2RMM A;  1GB1 A;  1YN4 A;  1BXT A;  1ACC A;  2PW9 A;  1ZUD 2;  2W82 A;  2ON8 A;  2W55 A;  5HI1 A;  5EE3 A;  1FFU A;  2J4X A;  3SEB A;  3AED B;  2WXI A;  1MVK A;  4P6V F;  2M0A A;  3P4S B;  3W2D A;  1TJE A;  1NEK B;  1SIJ A;  2WXQ A;  1R7S A;  2WU5 B;  1TKG A;  1VLB A;  4DXF A;  3HVD A;  1TS3 A;  1V1P A;  3BYY B;  4C80 A;  1I4Q A;  2WXR A;  3BK1 A;  3AN1 A;  3P42 A;  5I4D A;  2JXT A;  5GXG B;  1TZO A;  3Q8A A;  1FXI A;  3MP9 A;  4OZC A;  3P4Q B;  5FKA C;  4YWG G;  4ITK A;  2PKO A;  4OW0 A;  1TS4 A;  1QOF A;  2MEK A;  5EE0 A;  1TS2 A;  3UI3 A;  3B2F A;  1FIQ A;  2W54 A;  1YNT E;  3P1M A;  1TYG B;  3ZQ4 A;  1YQ3 B;  1AN8 A;  3BZD B;  1N62 A;  1IGD A;  1SBB B;  4US9 A;  2WXL A;  5BMI A;  1SXT A;  5EE1 A;  2M19 A;  1TY0 A;  1QOA A;  2W3S A;  4WAF A;  1K50 A;  1JWB D;  2DYM A;  1WSP A;  1HXY D;  1JRP A;  2LJI A;  2WXM A;  3BVM A;  1P7E A;  4P16 A;  4RH6 A;  2BS2 B;  1EWC A;  1OFF A;  1XLO A;  3I9V 1;  1WGK A;  1FD6 A;  4LTU A;  1NVI D;  2KMM A;  1XXG A;  5BYR A;  1JWM D;  3Q8F A;  3TEY A;  3HRD D;  1FXA A;  4A6Q A;  4CQN A;  3TSS A;  2FBW B;  2RDG A;  4WUR A;  4DXG A;  2LEK A;  1GOZ A;  1XF5 L;  1MPE A;  1J7A A;  1NYR A;  2N9K A;  2XN9 C;  1N5X A;  4RCO A;  2AX5 A;  2ZW0 A;  4KKJ A;  3Q8C A;  1SE4 A;  1UUP A;  1ZE3 D;  1L6V A;  2LUM A;  1VRA B;  2N9L A;  2W3R A;  2HDE A;  2N0S B;  3PO0 A;  1I7H A;  1F2R C;  4YTM B;  1DOX A;  1JRO A;  1C79 A;  1PUT A;  1HA5 A;  1D5Z C;  3ZJV A;  1FMA D;  2CJO A;  3NVZ A;  3TUO A;  1SE2 A;  2WS3 B;  1L6U A;  2CJN A;  3EA6 A;  1JAL A;  1NYQ A;  2WXG A;  1ET6 A;  4A55 A;  5BMH A;  2IJ0 A;  3MJ5 A;  1L4D B;  1I4P A;  3I57 A;  4OVZ A;  2JWU A;  1RFK A;  2KWD A;  3LXF A;  2V3P A;  5D7G A;  2NMQ A;  4MH8 A;  3KWV A;  2WDQ B;  1FRD A;  1YN5 A;  2JQR B;  4ARI A;  4N6E B;  1TY2 A;  4ZRP A;  1CJE A;  1FCC C;  3N9Y C;  2JSV X;  2V4I B;  4IKG A;  1DOI A;  2QIL A;  1D6E C;  1V97 A;  1QQR A;  1JWA D;  4JWU C;  4ZHO A;  3ZYY X;  3V3X A;  1E6E B;  4RF0 A;  1UWX A;  3AEG B;  2PVG C;  3SR6 A;  2DBY A;  4PT5 A;  2RPV A;  2L1A A;  3OWE B;  1FNU A;  1VJK A;  1IBX A;  1KH0 A;  1SE3 A;  1MHH E;  1M4V A;  1XLQ A;  4NZL B;  1FFV A;  4JPS A;  2K0P A;  4TSS A;  3NUH B;  3IXS A;  1QT9 A;  3AV8 A;  3KWL A;  3BVG A;  2WDV B;  1GB4 A;  1UGJ A;  1SSN A;  1D4B A;  4ZHP A;  1KFY B;  4O1N A;  2KQ4 X;  4JE3 B;  1XCT L;  2IGD A;  3KQ4 A;  2JYE A;  4KKI A;  4XWT A;  1SB3 C;  3MHZ A;  1L0Y B;  3VR8 B;  3NS1 A;  1N63 A;  2BS3 B;  4J3O D;  5E6J A;  3H8H A;  4HKQ A;  1UWM A;  1EU3 A;  3AEA B;  3HUI A;  2IGG A;  2SAK A;  2DYO A;  1FEH A;  2L32 A;  2VZK D;  2SEB D;  3W5U B;  2KAJ A;  1J7B A;  4US8 A;  4AS1 A;  2WXP A;  3W5V B;  2WNM A;  1MI0 A;  3BWU D;  5C3J B;  1PYW D;  1SJH D;  2Y5C A;  4HRS A;  1J7C A;  3EGR A;  1WWT A;  1ZDV A;  2AQ1 B;  1DGJ A;  2BB6 A;  1EU4 A;  2G9H D;  2QMT A;  4HJG E;  4TQ0 A;  3AE9 B;  4RGT A;  3GP7 A;  1GAQ B;  2K22 A;  3NZ3 A;  3PZ8 A;  1QLB B;  2BBC A;  2Y3A A;  1OQR A;  3P63 A;  2BT6 A;  4B0M A;  2OHF A;  1ROE A;  3NVY A;  1KRH A;  1K51 A;  2CU3 A;  4WIP A;  1E0Z A;  4TQ1 A;  2TSS A;  4TMA B;  2G1E A;  1L0X B;  1DOY A;  1QOG A;  1CZP A;  3IAM 1;  1C4C A;  4NAM A;  3U52 E;  3TEZ A;  4RGO S;  2B76 B;  2PTL A;  2EKI A;  3AE8 B;  3O13 A;  3P4R B;  2R61 A;  1F2R I;  1QIL A;  2JX5 A;  2Q5W D;  4FXC A;  4JX1 C;  4KGT A;  1ZXI A;  2NTS A;  1C9F A;  2WU2 B;  4KGS A;  1AW7 A;  2MJD A;  2INP E;  3V05 A;  1JWS D;  4C56 C;  3B2G A;  2PIA A;  1T3Q A;  3NRZ A;  1B9R A;  1VDV A;  3FAH A;  1GPX A;  5H92 C;  5D3I B;  1V8C A;  2PMV A;  1BML C;  1QOB A;  3VQI A;  1HZ5 A;  1D5X C;  5HG2 A;  2V0G A;  1SF0 A;  4JWS C;  1VZ7 A;  4WH4 A;  1NI3 A;  2XNA C;  3R2T A;  2ICI A;  3AE1 B;  2EEL A;  4YTP B;  3IAS 1;  3GS2 A;  1XEE A;  4ARC A;  1WXQ A;  2LHE A;  1FNW A;  1RM6 C;  1JML A;  1P7F A;  5LNK 1;  3Q69 A;  2I38 A;  3PZ7 A;  1TKY A;  3RPF C;  4MM3 B;  2X38 A;  3ZJU A;  2AQ3 B;  3AEB B;  2YEP F;  2RDH A;  4USA A;  2D5G A;  4XWW A;  1D5M C;  2L52 A;  1JWU D;  2WXJ A;  5H8Y E;  3W9C B;  3FC4 A;  1N61 A;  1Q10 A;  2BW2 A;  1JCK B;  4YSZ B;  4L1B A;  3AM9 A;  1I4G A;  4UDU C;  4RF1 A;  2WXH A;  4REZ A;  2ACZ B;  2H88 B;  3MFG A;  3SFD B;  4D2K A;  2WXO A;  1IGC A;  1VR9 A;  2IGH A;  1ZPS A;  1B1Z A;  1XO3 A;  1RYJ A;  1T6B X;  2Y5P A;  3NVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...