1RWSA

Backbone solution structure of mixed alpha/beta protein pf1061
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
KMIKVKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PF1061
publication title Backbone solution structures of proteins using residual dipolar couplings: application to a novel structural genomics target.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 4
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2003-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1rwsA00
1XLPA 3NRZA 1FM0D 1FFUA 2WP9B 5EE3A 4WWMA 1QF6A 3RPFC 1L6UA 1FMAD 2HTME 2WLBA 2FBWB 1ROEA 3EUB2 1DGJA 2CU3A 4ZOHC 1I7HA 2PVOD 3CIRB 2K22A 1IUEA 1L6VA 1NYRA 2JQRB 1NVID 1KRHA 2KAJA 1T3QA 2K9XA 3AEDB 3ETRA 2PVGC 1GAQB 1UWMA 3HUIA 1J7BA 1V8CA 1ZP0B 1ZUD2 2BT6A 3AE4B 3KWLA 3LXFA 3P4QB 4KX6B 1QOAA 3SR6A 1JWBD 3W5UB 1F0ZA 1YQ4B 4C80A 1VDVA 3B9JA 1PDXA 1J7CA 1FRDA 1N5WA 4YTMB 1WWTA 3SFEB 2WDQB 1KF6B 2PKOA 2OHFA 3AEFB 1AWDA 2W3SA 4P6VF 4ZHOA 3P4RB 1FFVA 1L0VB 2H88B 2H89B 1JW9D 2W55A 2AX5A 2Y5CA 1QLBB 3FAHA 1KFYB 1YJIA 3P4SB 1N62A 5G5HA 5EE9A 5C3JB 1JRPA 1XO3A 2MJEA 3AE6B 1WYGA 3L4PA 2WU5B 3AEAB 1JALA 4USAA 2M56B 5H8YE 1GPXA 1JROA 1PFDA 1ZXIA 2WDRB 1CJEA 2QIEB 1SB3C 2CJNA 3AEEB 4US8A 3AEGB 3AM9A 1SIJA 3ABVB 2MH7A 4YSYB 5G5GA 2WQYB 1TYGB 1QOBA 3AE8B 4N59A 2WU2B 4YTNB 2K5PA 1RYJA 1PUTA 2M19A 4N58A 4YT0B 3PO0A 3AE7B 2E3TA 5H92C 1E0ZA 2W3RA 1NEKB 3AV8A 1OQQA 3LB8C 1JWAD 3HRDD 3CWIA 1J7AA 5AUKA 1DOYA 3NVVA 1R7SA 4C7YA 3VRBB 3VRAB 3DWMA 1FXIA 1E9MA 1RWSA 4YTPB 4YSXB 3AN1A 4WQMA 1WXQA 3P1MA 2DWQA 2WDVB 1E7PB 3AH7A 2G1EA 3VR9B 4JWUC 1SF0A 1B9RA 3NVWA 1EWYC 2KMMA 2BS4B 3AMZA 3AE9B 1L5PA 1VLBA 3FC4A 1JQ4A 4US9A 1N63A 3NVZA 1E6EB 1TKYA 1FRRA 1TJEA 2L83A 2LEKA 4N6EB 5EE0A 2BS3B 3B2FA 2BS2B 2JX5A 5C2TB 3AEBB 1RM6C 2DBYA 4ZHPA 2CJOA 4YXDB 1FO4A 1FIQA 1XLOA 1XLNA 4YSZB 3BIID 4HROA 5MPOA 1OQRA 4ITKA 1N61A 2ACZB 3W9CB 1VJKA 1N5XA 4JWSC 3P63A 2Q5WD 1AYFA 3AE5B 4LTUA 3NVYA 1DOXA 1V97A 1TKEA 4FXCA 3AE2B 1E10A 1FXAA 1QOFA 4IDIA 5EE1A 1OFFA 1RFKA 3ZYYX 2B76B 2MJDA 2W54A 3DWGC 3P4PB 3B2GA 1NENB 1WGKA 1XLQA 2PIAA 2QJLA 1TKGA 1A70A 4HRSA 2L52A 2MJ3A 1QOGA 3NS1A 1NYQA 4JX1C 4C7ZA 1ZOYB 5AUIA 3AE1B 3SFDB 3W5VB 3WCQA 2N0SB 3VR8B 1DOIA 1N60A 2WS3B 3AE3B 3HVZA 1NI3A 1QT9A 3AECB 5GXGB 3AB5A 1CZPA 1YJJA 2EKIA 1YQ3B 4A9AA 1WRIA
chains in the Genus database with same CATH superfamily
1XLPA 1SXTA 5D3DA 4CHKA 3TEXA 2N9EB 3RNGC 4I6PA 2FUG1 3MC9A 3P4QB 1V8CA 3ZLZA 2QCZA 1TY0A 1JWBD 1AARA 1UWXA 2DNFA 2GOWA 4BKGA 1KH0A 3RMKC 4ZHOA 2BYFA 2H88B 3ZIMA 1MPEA 1YJIA 3L08A 4HPMB 3W1SA 2M0AA 3AE6B 1WM2A 4GGQA 3AEEB 1SIJA 3RNFC 4A3PA 2ZPYA 1WX7A 3QHTA 2KK8A 2C5LC 2L1AA 2JZPA 1HXYD 1WJUA 1L4DB 3CF6E 1RLFA 1R4NB 1SEBD 3PTFC 3VR9B 3I9V1 4PT5A 5AZGA 2V1YA 4RMAA 1L5PA 2BTEA 1Z5SB 2L83A 5JH5C 2BS3B 3IXSA 2NMQA 2N9KA 3PRMB 3Q3OC 3TJPA 4GN1A 4F7ZA 3UQBA 4RGOS 4GOCA 2RPVA 4HWIB 1QKZA 2IY1B 1FXAA 2K39A 1OFFA 1RFKA 3VXWA 2W9NA 1QOGA 2IGGA 2WXNA 1ZOYB 4RM8A 2MW5A 2KN4A 4UDUC 3CSTA 3IT6B 5JZEB 3NRZA 4HCPB 3PHXB 2V4LA 2J4XA 4HDOA 1C9FA 5D6JB 4MSMB 2SAKA 3NY5A 2JUOA 4D2KA 1WZ0A 2MQJA 1FNUA 1L6VA 3FC4A 1NVID 3W5UB 2IO0B 2G4DB 4P16A 1WYWB 1F0ZA 1SE2A 3KW5B 1D5ZC 3SFEB 4S17A 4HK2A 3AULA 2O6VA 1L0VB 3EA6A 3V61A 3H7PA 1OEYA 4W9EA 2EMSA 1MHXA 2HJ8A 2KOXA 1TIFA 1I4HA 4GDKA 2KMAA 3RT3B 2KFJA 5JHAA 4P1CC 3JSVB 4US8A 2EELA 3RZWC 3PT2B 5BMIA 1KJTA 4IOIE 3RFZB 3V6EB 4PS8A 1K50A 1J7AA 2OEDA 1X1MA 4GU2A 1K52A 1P3QU 1PGAA 3DVNU 2BWFA 2C60A 1STEA 3P1MA 1WFYA 2NPTB 4M00A 4M8MA 1VRAB 2LHDA 4ZYNA 2WXMA 3AE9B 1E8ZA 4FLHA 3DHIC 2WXLA 2LEKA 5EE0A 4O1NA 1WR1A 4PYUA 4WAAA 3W2DA 2NTTA 1XLNA 2BB5A 1EU4A 2JYTA 4QAYA 3AE5B 4L1BA 4A20A 3DVNV 2WHIA 4CO7A 4YWGG 2LGDA 2REXA 1RRBA 4F8CB 3B2GA 2QJLA 2GBJA 2AEHA 2ONQA 1C1YB 4KSKC 4NJCA 1CZPA 2DZMA 2RDBC 2NBVB 4WAFA 3H7PB 2PE6B 1Q1OA 2HD5B 2JXXA 2QDFA 3QCAA 3CIRB 2A5UA 1V1PA 3Q3NC 5DPSA 3W1YA 4DWFA 3ML8A 3C8YA 2DAJA 2KHWB 3NUHB 4K3CA 2DENB 4W9DA 2W3SA 3WAPA 1HZ5A 4TKNA 4MELA 1N62A 2MCNB 1S3SG 2INDC 2CR5A 2WXIA 1YN3A 4MJSB 5H8YE 2CHWA 4PYZA 2FIDA 1WGHA 3N1XC 1OQYA 1K8RB 2E3TA 4E3CA 1NEKB 2IO3B 3U4EG 4P7IA 1WX9A 3KQ4A 3UI3A 1UBIA 2N9XA 1V6EA 4LJPB 4OVZA 2I1KA 4EZKA 2LVPA 5HI1A 4ARCA 1EWYC 4S0RA 3BYTB 2JY6A 1WSPA 2FCNA 1JQ4A 4KDIC 1IBXB 1E6EB 3U30A 3M62B 2K8BA 1GC6A 3ZGZA 4ARIA 4MH8A 3X0WA 3SD5A 3Q8CA 3VH3B 3PREA 2MBEA 3ZXVA 4WWPA 4RFBA 4FADA 4NY0A 1VZ6A 5KHOA 1NDDA 5E6PA 1E8YA 3AE2B 2W54A 1A5RA 3DWGC 2RSUA 2UYZB 1V1PB 2BVCA 1KOTA 1YD8U 3W5VB 5D3IB 3WCQA 3HVZA 2KTRB 1ZXHA 2GBNA 3DBSA 4XE0A 1YQBA 5LLIA 3EUB2 2WDTB 2N7JA 1C77A 2ICIA 4AUQC 1BT0A 3N20C 3V3XA 2WXOA 3AEDB 3H7SA 1T3QA 3ETRA 3ML9A 2PVGC 1ZUD2 3VTWA 2NVUI 5HKHA 3U8ZA 2PKOA 4NAWA 5E6JA 3RUIB 2MA9B 2KX3A 1I4XA 3UGBB 1YJ1A 2KFKB 4DHZB 3AEAB 3TEZA 3Q69A 1FNVA 3QA8A 4AS1A 2FUHB 4N59A 3IFWB 2INPE 5CHVC 4HVBA 3AE7B 2YEPB 1JWAD 5AUKA 4OZCA 5L95C 1WXSA 4JWUC 3R8BA 4IM3A 3APFA 3SU8X 1ET6A 2N9LA 3AMZA 3A9JB 2KWDA 4TV3A 4XGAB 3ZKJC 4L2YA 3ZDTA 2L00B 5HFYA 4FJYA 2G9HD 4ZHPA 2O6VD 1XQQA 1TZOA 4FJVB 3ZJUA 1L2NA 1EWCA 1OQRA 2BYVE 4RCOA 2ACZB 2QC8A 4IM2A 2YVCA 4ACFA 2BYTA 5G55A 2BKRB 4IDIA 1YN5A 2KDMA 4RGMA 3H9DA 2PIAA 1HQRD 3AE1B 3AE3B 3WIMA 4MT5A 4C4VA 2AYOB 2L8JA 2KJ6A 4FN2A 3T3NA 5IP4D 2W82A 2HTME 2G4SA 3U2SC 2KWUB 1BXTA 2KDEB 1TZ1A 1WM3A 1FCCC 4IWPA 4DDGD 3A1QB 1PGBA 1VDVA 4LNOA 4JQWC 4IKGA 4WJPA 1ZGUB 2KDIA 1JW9D 3FAHA 3PGEA 4A8XC 3NZUA 3KWVA 1P7FA 2MJEA 5IO9A 3RCZA 3CSFA 1WRDB 5BYQA 2LWPA 2JZZA 1UELA 2MBBB 4XX5A 1ZXIA 4MM3A 4AJYB 4MGKE 2WXKA 3VAWA 4EKUA 4LLGM 4NJ6A 4IWOA 1OQQA 1K51A 1P0RA 2M0XA 3CWIA 2X8XX 1VR9A 4PK1A 3DBLB 3PZDA 4XYCA 2R61A 5CTRC 1C4CA 1D4BA 4TMAB 3ALBA 5AZHA 2LASA 4W9GA 3TMPB 3T8MA 3BYYB 4JGHB 4YXDB 3ZNGC 3PZ8A 1FCLA 1ACCA 4KDLB 4JWSC 4LTUA 3CMMB 2ZW0A 1WJ6A 3IBEA 3MHSD 1T0QC 1UZXB 2BB6A 2MHJA 1WGKA 2KTFA 4REZA 4JX1C 3SFDB 5AUIA 1SSNA 2N0SB 4ZYSA 3TIXA 5IA7A 2WXHA 3IHPC 3MP9A 2LGXA 4EE2A 1YQ3B 3OLMD 1VCBA 3B1LX 2ZVOA 2MEKA 1FFUA 4TQ0A 1YX5B 4WWNA 4KGSA 1OTRB 1L6UA 3ECIA 4W9CA 2GMIC 3KUZA 2LRUA 1ROEA 1DGJA 3TUOA 3AEFB 4HKZE 5I4DA 1CMXB 5GMVA 3P4PB 4RGNA 3QQ8B 4M01A 2IZVB 3N9YC 2LFIA 2MLBA 3P4RB 1FPYA 3E56A 3APDA 2W55A 4KKJA 1KFYB 1H4RA 3DBRI 1YN4A 1R4MB 2IPKD 2LVOA 4KIKA 1EU3A 2Y5PA 3P2BA 1P7EA 2JWUA 3M63B 1GPXA 2WWZA 1PFDA 2HE7A 2KO3A 3AM9A 5BMHA 3ZNZB 3AE8B 1I4QA 4EZJA 2L0TA 1LXDA 4ZRQA 2KD0A 3LJ3A 1IYFA 1JCKB 3KLSX 1I4RA 4LNFA 2DWQA 1F1HA 3RYTA 5JXVA 1P1AA 3GE3C 3H6NA 2LHEA 1LQBA 2KMCA 2MBOA 1S1QB 1TKYA 2YEPF 4N6EB 3VQIA 3AEBB 3ZW3A 5IN7A 1M94A 1IGDA 2NS5A 3PPAA 1D5XC 4L23A 1WE7A 5IKCM 1VZ8A 2FAZA 4A6QA 2L05A 4NNJB 2NCNA 5IOIA 3Q8FA 4GLSC 2AWTA 3IAM1 1XCQL 4EUTA 2MJ3A 2K6DB 4IC7B 1SJHD 1YNTE 5TR5A 4WWOA 2KXJA 2N7DA 1QF6A 4BZAA 4B95A 3MFGA 2WXFA 3BY4B 3N1ZC 3J9CA 2PVOD 4LDTD 3GZNB 2LGIA 1DOXA 3I57A 4IUMB 1JWMD 2IGDA 2V9HA 4JIOU 2NR2A 3TCAA 4BBNC 4RGTA 4YTMB 1I42A 1AWDA 2XNAC 4F1SA 3KVFB 3LDZE 5C3JB 3R3MA 2K25A 2LVQA 4KSLC 3N32A 4XC2A 2M19A 4GB9A 2W3RA 5L83A 3ZNID 3PRPB 4C7YA 4EZLA 3ZVVA 3C0RB 4MGIE 3MJWA 2J0MA 2Z8LA 2KMMA 3EFUA 3TBLD 1ET9A 4A3OA 4DDID 4FBJB 2DYMA 1WGRA 4RF0A 5C2TB 1F52A 1C4AA 1LO5D 2JZ3B 4AP4C 5EDSA 3E9SA 1U4AA 3BZDB 1XLOA 4M0WA 4K7WA 4J3OD 2NBWB 2AL3A 1P98A 2DZJA 4BOZB 1XLQA 1KLGD 4DHJB 4WIPA 2WS3B 1VZ7A 3AU5A 2E6XA 3PS6A 1WRIA 1WJ4A 3N1YC 4ANWA 2KWCA 4FJZA 4WWMA 3RPFC 5DPRA 2I2YA 2ON8A 1NBFC 2M1MA 4TQ1A 3OJ4B 1ZE3D 1NYRA 2K9XA 1XD3B 3KWLA 2Z0EB 4DXFA 2NBUA 4URKA 3GP7A 3SEBA 3HK0A 2K0PA 2IYDB 2IY0B 1WWTA 1UD7A 2OHFA 1QILA 2DZIA 2O6VB 2DAFA 4OZBA 4BAXA 3L0WB 3V6CB 2VZKB 1WMHA 3DCGA 3U7ZA 4LNNA 3PLVA 3AU4A 3KUCB 4GDKB 4CYEA 4HPPA 4W9HA 3NZ3A 3NHEB 5BO4B 2K3UA 2WU2B 5FR6A 2LD9A 3APCA 3TSSA 4NJ7A 3I63C 1Y8RC 2JSVX 2PLPA 3IT4B 3PVLA 2JXTA 4EFOA 2DX5B 2PJHA 3VRAB 3ZRCA 1KTKA 3DWMA 1C3TA 1F77A 2PMVA 1CK1A 3IG3A 3DVGY 3OWEB 4US9A 2MSED 3D32A 2KT7A 1LFDA 2JU6X 3V60A 2DHZA 4A90A 4KZ0A 1XXGA 2SEBD 2YLMA 4ITKA 2GI9A 1RFAA 2I1JA 3AI5A 2L0FA 1T0SC 1D6EC 4B6WA 1WGYA 4WURA 5BYRA 3U7DA 3GB1A 1HA5A 4HRSA 1L0XB 3VUXA 4C7ZA 3O13A 4LJOB 2FCMA 2MP2A 3ZRFA 1FEHA 3PV1A 5DPTA 2J7QB 2AQ3B 1HE8A 3ENEA 2XK5A 1JWSD 3UF8A 1C76A 3HHMA 4BKSA 2D3BA 2CU3A 2ZEQA 4LNKA 1WX8A 3HUIA 5BMGA 2LI5A 2WGSA 1L4ZB 3EHVA 1Q0WB 4C80A 4OVUA 4H2AA 1C4PA 1FRDA 1N5WA 2PE9A 2OJRA 2Y5CA 3URYA 2Y5BB 3WAOA 1WXMA 2VH1A 2IDYA 3JYUA 5C23A 3X23A 2LGYA 3UIOB 2CHZA 1E7VA 1RYJA 4JL9A 5FKAC 1DYQA 5TSSA 4RNAA 1WGDA 3UINB 2N1WA 1J19A 4DHZE 2L3ZA 2G1EA 2JRIB 3EGRA 1Z2MA 1SE3A 2RDHA 1R4NI 1EO6A 3IAS1 2KDBA 2DBYA 4HCNB 2LGSA 4KVGB 1WE6A 3A9KA 3W9CB 4K3BA 1P9DU 3NVYA 1QOFA 5EE1A 2KC1A 3NOBA 2ASQA 2KYWA 2BPSA 1DOIA 3DHGC 2KNBA 3AB5A 1YJJA 2B3AA 4A9AA 2LUEA 3GZNI 4FHJA 1YX6B 2KX0A 3GOEA 3W1SC 1L0YB 2WP9B 5E6NA 3MTNB 3QIJA 2Z0DB 4ZOHC 4P1BC 2GRIA 1TTNA 4J6IA 3PLUA 1GAQB 1KLUD 1ZP0B 1ZDVA 1GUAB 4WJOA 1PDXA 1J7CA 1PYWD 2V3SA 3VUWA 1OGWA 4P6VF 3QJZA 1UGMA 4NAWB 1ENFA 3Q3JA 4GDLA 3Q2AC 1XO3A 4HJKA 3K9PB 4N9F4 4OHJA 1JRUA 5D7GA 1CJEA 4HXDA 2RPQA 1SB3C 2MH7A 1PUTA 4YT0B 3NG0A 5H92C 2M4NA 2JWZA 3A4RA 3KH0A 3ZQ4A 3VHTC 3VRBB 1GC7A 2G45B 4BVUC 1WXQA 1C78A 1D3ZA 4KGTA 2AQ2B 4R3DA 5FK9C 1I4PA 1V86A 3T3OA 2C9WB 1TS4A 1TJEA 4Q2JA 3Q14C 2KN5A 2CJOA 4W9KA 3VUYA 1SGHA 4HROA 1E8XA 2FIFA 3ZTDA 5CHFA 4II3B 3AXCA 1V9JA 2R2QA 2ZPNA 4KGRA 2KWVB 1TS5A 3MHZA 2IO1B 1V97A 3QX1A 4ZRKA 1E10A 5D94A 2BKFA 5LNK1 1FD6A 3OAWA 1TKGA 4MGYE 1V80A 4W9IA 2C7NB 2KKCA 4K7SA 2BQQA 2PPHA 2V3NA 2WXJA 4C4VB 1UF0A 2HTHA 4E74A 1FM0D 1MG8A 3VVWB 2FBWB 1WR6E 3L16A 4AJWA 3RNBC 2KANA 2LXAA 3L10B 2JQRB 1LM8B 3A33B 3S2AA 2J0JA 5HHDG 3WA0A 3B9JA 3FILA 1SE4A 3M3JA 5AEKB 2INCC 5DCNA 3P4SB 1WY8A 5EE9A 3N3KB 1JRPA 1MVKA 4HPLB 4USAA 3V05A 1I35A 3EFCA 2QIEB 4RH6A 2LUMA 4MM3B 1F2RC 2VRRB 3Q8AA 2D2QA 3MJ5A 1AW7A 3LB8C 2CKHB 1E5WA 1V81A 3RI7C 4G3XB 1HZ6A 4HJGE 1YMHE 1RWSA 4BKSD 1E7PB 1IPGA 1OEYJ 1SF0A 2MX2A 4JPSA 2XN9C 2N1VA 4XWWA 1VLBA 2INNE 1F2RI 1YIWA 4ZDVA 1JWUD 1QQRA 1EM7A 2BS2B 2PW9A 1E7UA 3EECA 1RM6C 2QMTA 1FO4A 2IGHA 4M02A 2L32A 4AOFA 1UNSA 5FR3A 2X38A 5CX3A 5C1ZA 2CU1A 2DZKA 5T8IA 4XDDA 4FA6A 1A70A 1XEEA 3RZFA 1PQSA 3L13A 4NPNA 2J53A 4BBNF 1UBQA 3FILB 2CHXA 1PGXA 3QARA 1Q10A 4CQNA 3QC8B 3BK2A 3R2TA 1GB1A 4K81A 4B9KA 2KC2A 2BBCA 1TS3A 4ANUA 3RNEC 4OZAA 4BKTA 1YQ4B 2FE8A 2RD0A 4B0EA 4KZCA 4K7UA 2I38A 2AX5A 3KYDD 2M17A 2D3GA 1E8WA 1WZ3A 3BK1A 1MJDA 3JSVA 1JROA 2KQ7A 4KIKB 4YL8A 4MSQB 2RR9A 5G2NA 4XDCA 4KV2A 5G5GA 1MHHE 1IGCA 3HVDA 1UH6A 2K5PA 2N9PC 1ZKHA 1GOZA 3NVVA 2NPTA 4YTPB 2QHOA 3BVMA 2EKEC 2WX1A 1J0GA 3KUDB 2D3CA 1T6BX 2HJ1A 1N63A 3I3TB 1FRRA 1TGZB 2V3PA 2OOBB 2WYQA 3H1UA 3R7QA 1TS2A 4GSWA 1KLVA 2J0KA 3DBHB 5J17A 3JVZX 3WANA 1AYFA 2AQ1B 4EEWA 4FULA 4KKIA 2Z59B 2KVRA 1GJZA 2MJDA 4I6LB 2KDFB 3NZSA 1N6ZA 4X57B 3Q6BA 4W9LA 5E6OA 4FHKA 2L52A 1NYQA 4BOSC 4ASWC 3PHWB 1B1ZA 2KZRA 3GS2A 3AECB 5GXGB 1E90A 2IBIB 1WIAA 1WH3A 3PRZA 2J42A 2BYEA 1H8CA 3TL5A 4TSSA 4MH0E 4GMVA 2M8SA 3R66C 1SBBB 3B08A 2LJ5A 3PSEB 3HM6X 1J7BA 2BT6A 1BMLC 2KQ4X 2GBKA 2LRWA 4GIVA 2RDGA 2IO2B 4TUUA 4C56C 2FCQA 3B0AA 4HDQA 1T0RC 4MJSA 1JMLA 1V1OA 4HEA1 2ZNVB 2J52A 2WQYB 3FKYA 2NTSA 4YTNB 2N4FA 1SIFA 3JW0X 1TY2A 5LXIB 4HKQA 2LJIA 4G50A 1DOYA 4OW0A 4K1RB 3RNAC 5DPWA 4WQMA 2WDVB 1SJED 4JE3B 1IBXA 2BS4B 3R2IA 2IJ0A 1T5XD 1LGRA 3VTVA 4MACA 2V4IB 3NVZA 3QWZB 4IWQA 2ZCCA 2C7HA 5D2MB 3DBLI 1FIQA 3RULA 3BIID 4ICVA 5MPOA 3DQVA 2AL6A 1WJNA 2MBHA 4M0WB 1VJKA 5LXHA 3RN9C 1XF5L 2XEWA 2WNMA 2LXCA 3ZTCA 3DPDA 3VH4B 2K8CA 3ZXRA 2KJHB 2KTRA 2VH2A 4RM9A 3VR8B 2BF8B 4ANXA 1WF9A 3DDCB 2K6QA 1M4VA 2EMTA 2ZZPB 2R2OA 1FMAD 4DBGA 4MGZE 2ZCBA 2WX0A 4ICUA 3DBRB 2D10A 4DXGA 4ZRIA 1UWMA 3BWUD 4KX6B 3LXFA 3ZNHB 3DVGX 2LMCA 3ZDMC 3HIZA 2WDQB 1KF6B 4C00A 2Y3AA 2KFKA 5HG2A 4G11A 1EF5A 1UUPA 3WAMA 3A4SC 1MG4A 3L17A 1JALA 3RNCC 3KYCD 1WMHB 2KVZA 2FNJB 2WDRB 3K9OB 4NAMA 3ABVB 4YSYB 4B0MA 4LCDE 2WXPA 4JLCA 2FCSA 2JVCA 1R4MI 5KHQA 3V62A 2L7RA 1FXIA 2PEAA 1MFWA 3AH7A 2KLCA 3A9JA 3NJTA 4NQLB 1WI0A 3HM3A 2K1FA 4DQOC 2D11A 4AWJA 4DXAB 1KM7A 2RMMA 2GBRA 3P42A 2XBBC 4G0NB 1YOVB 3ZUNA 4M8NA 2JRHA 3Q8EA 4LNIA 2MWSB 2K8HA 4MDKE 4MEMA 3ONSA 1N5XA 2Q5WD 2CS4A 2KQSA 3BVZA 3ZJTA 3L54A 1L7YA 1MI0A 4ANVA 2D07B 2KJRA 3ZYYX 3VDZA 4PS7A 4IW0A 4NZLB 3SHQA 1N60A 1QT9A 3ZO5B 1Q5WB 4GXBA 2MP2B 2QSDA 2KLGA 5EE3A 2DYOA 2XK5B 3VFKA 2GBMA 4DHJD 2K22A 2O2VA 2KAJA 1KRHA 1V2YA 3A1QA 4ZRPA 2GB1A 3SR6A 4BFRA 2JT4B 3TEYA 3PZ7A 2MBQA 3OG5A 1FFVA 2TSSA 3M95A 3TEWA 1WXAA 1C79A 3Q8BA 2HDEA 1WGGA 3L4PA 2WU5B 3NS8A 1J8CA 4XWTA 3RD2A 2ZVNA 5J18A 1TYGB 2BW2A 4NQKE 3ZJVA 3VTUA 3LYYA 4XZ4A 2VZKD 2RGFA 1VD2A 1R7SA 1TT5B 3UIPB 4YSXB 3BINA 3I5JC 3WALA 1B9RA 3NVWA 1GG3A 1NI2A 3DHHC 3DBHI 2WXRA 1TBEA 4WJNA 2JX5A 2JPHA 1ZDXA 2DLBA 3IVFA 4YSZB 1F9JA 1D5MC 1UGJA 1FXTB 2UU7A 1N61A 2BWES 3Q3MC 1HTQA 1GNUA 1HEZE 3A9KB 2MRPA 3R7RA 1BUIC 4W9JA 2B76B 4AQ7A 4WH4A 1ZPSA 1NENB 1ZW7A 2O2VB 4N58A 3NS1A 1CQVA 4LDTB 1NI3A 4PS3A 2C7MB 2EKIA 4E71A 4IG7B 2KACA 4WJQA 4A55A 4II2B 2ZW1A 1K53A 2WLBA 1Y56A 2ZNVC 1ISNA 1I7HA 2G3QB 1T0YA 3Q3FA 4EOYA 1IUEA 3OJ3A 3AE4B 1EF1A 2GLSA 2WXGA 1QOAA 1XCTL 3QK0A 2QEJC 2V0GA 1V5OA 4IM0A 2N7EA 4W9FA 2A4ZA 2QILA 1EUVB 5BYSA 2H89B 1QLBB 2JF5A 5G5HA 3U52E 2L76A 3H8HA 4WQOB 1WYGA 2D3AA 4GDLB 3BVGA 4ZRJA 2M56B 5AZFA 3DOWA 1V49A 3T9LA 2CJNA 3AEGB 2LZ6A 1V5TA 1GB4A 1RAXA 1QOBA 2ZJDA 3MC8A 1QZEA 3PO0A 2JYEA 2PTLA 1E0ZA 3AV8A 3HRDD 3MC0B 1E9MA 3AN1A 2WXQA 1HTOA 3QAQA 3UQAA 2D5GA 1AN8A 1WXVA 3B2FA 4DK5A 4OVVA 3EC8A 1ESFA 2OJWA 1G6JA 1XT9B 3SDLC 5JHBA 4LK0M 2BGFA 3P63A 1FNWA 3C19A 1SE9A 5J2RA 1TKEA 4FXCA 5IAAC 3N30A 2DYBA 1IP9A 2UWQA 3O65B 5CHWA 4RF1A 3GE8C 1I4GA 4I6NB 4HLEA
chains in the Genus database with same CATH topology
1XLPA 1JWSD 2J42A 3T3NA 1SXTA 2W82A 2HTME 5D3DA 1C76A 4TSSA 3TEXA 2CU3A 3U2SC 1SBBB 2FUG1 3HUIA 1BXTA 5BMGA 3P4QB 1J7BA 1V8CA 2BT6A 1TY0A 1FCCC 1JWBD 1L4ZB 1BMLC 1PGBA 2KQ4X 1UWXA 1VDVA 4H2AA 4C80A 1C4PA 1FRDA 1N5WA 2RDGA 4IKGA 1KH0A 4ZHOA 2H88B 4C56C 1JW9D 2Y5CA 1MPEA 3FAHA 3URYA 4A8XC 1YJIA 3KWVA 2IDYA 3W1SA 2M0AA 1P7FA 2MJEA 3AE6B 5BYQA 1JMLA 1ZXIA 1V1OA 3AEEB 4HEA1 2WXKA 1SIJA 2J52A 2WQYB 2NTSA 4LLGM 4YTNB 1RYJA 1TY2A 2L1AA 4HKQA 2JZPA 1HXYD 1OQQA 5FKAC 1DYQA 1K51A 3CWIA 1L4DB 2LJIA 5TSSA 4RNAA 1DOYA 1SEBD 4OW0A 1VR9A 4WQMA 2WDVB 3VR9B 1SJED 2G1EA 2R61A 3I9V1 4JE3B 1C4CA 4PT5A 3EGRA 1D4BA 1IBXA 2BS4B 3R2IA 1SE3A 2IJ0A 1T5XD 1L5PA 4TMAB 2BTEA 4MACA 2V4IB 2RDHA 3NVZA 2L83A 2BS3B 3BYYB 3IXSA 3IAS1 2DBYA 2NMQA 4YXDB 2N9KA 1FIQA 3BIID 3PZ8A 5MPOA 4RGOS 1FCLA 1ACCA 3W9CB 1VJKA 4JWSC 2RPVA 1XF5L 4LTUA 2WNMA 3NVYA 1QKZA 2ZW0A 1FXAA 1QOFA 5EE1A 1OFFA 1RFKA 2BB6A 1WGKA 4REZA 4JX1C 1QOGA 2IGGA 2WXNA 1ZOYB 5AUIA 1SSNA 3SFDB 2N0SB 3VR8B 1DOIA 4ZYSA 2KN4A 2WXHA 3AB5A 3MP9A 1YJJA 4UDUC 4EE2A 1YQ3B 3IT6B 4A9AA 2MEKA 1M4VA 3NRZA 1FFUA 1L0YB 2WP9B 4TQ0A 4KGSA 1L6UA 2J4XA 1FMAD 1C9FA 1ROEA 1DGJA 4ZOHC 3TUOA 2SAKA 4D2KA 2GRIA 1FNUA 3AEFB 1L6VA 3FC4A 4HKZE 1NVID 3W5UB 5I4DA 4DXGA 1GAQB 1UWMA 1KLUD 3BWUD 1ZP0B 3P4PB 3LXFA 4KX6B 4P16A 1ZDVA 4RGNA 1F0ZA 1SE2A 1PDXA 1J7CA 1PYWD 1D5ZC 2LMCA 3SFEB 3N9YC 2WDQB 1KF6B 4P6VF 2LFIA 2Y3AA 3P4RB 1L0VB 3E56A 3EA6A 5HG2A 2W55A 4KKJA 1ENFA 1KFYB 4NAWB 1UUPA 1YN4A 1MHXA 1XO3A 2IPKD 1EU3A 2Y5PA 1I4HA 1JALA 1P7EA 2JWUA 4OHJA 1GPXA 1PFDA 5D7GA 2WDRB 1CJEA 1SB3C 4NAMA 4US8A 3AM9A 5BMHA 3ABVB 2MH7A 4YSYB 4B0MA 3AE8B 1I4QA 2EELA 2WXPA 1PUTA 4YT0B 5BMIA 5H92C 3ZQ4A 4IOIE 3RFZB 4ZRQA 1K50A 1J7AA 2OEDA 1JCKB 1K52A 1PGAA 3VRBB 3KLSX 1I4RA 1FXIA 1STEA 1WXQA 3P1MA 1C78A 2DWQA 4KGTA 3AH7A 2AQ2B 1VRAB 4R3DA 5JXVA 5FK9C 1I4PA 2LHDA 2LHEA 2WXMA 3AE9B 3T3OA 2YEPF 1TKYA 2WXLA 4DQOC 1TS4A 1TJEA 2LEKA 4N6EB 4Q2JA 2RMMA 5EE0A 3VQIA 4O1NA 3P42A 3AEBB 2CJOA 3W2DA 2NTTA 1XLNA 2BB5A 4HROA 1IGDA 3Q8EA 1EU4A 2JYTA 1D5XC 1N5XA 2Q5WD 3AE5B 3BVZA 3ZJTA 4L1BA 4L23A 4KGRA 1VZ8A 4A6QA 1TS5A 3MHZA 1V97A 1MI0A 1E10A 4YWGG 3Q8FA 3ZYYX 5LNK1 4GLSC 1FD6A 3B2GA 3IAM1 1XCQL 2QJLA 1TKGA 2ONQA 2MJ3A 4NZLB 4NJCA 1N60A 1SJHD 1YNTE 1QT9A 1CZPA 2V3NA 2WXJA 2QSDA 1FM0D 4WAFA 5EE3A 1QF6A 2DYOA 3MFGA 2FBWB 2WXFA 3J9CA 2PVOD 3CIRB 2K22A 1V1PA 2JQRB 2KAJA 1KRHA 2LGIA 1DOXA 3I57A 1JWMD 2IGDA 4ZRPA 2GB1A 3SR6A 5HHDG 3C8YA 3TEYA 3B9JA 3FILA 4RGTA 1SE4A 3NUHB 4YTMB 3PZ7A 1AWDA 2W3SA 1FFVA 2TSSA 1HZ5A 3TEWA 2XNAC 1C79A 3P4SB 1N62A 3Q8BA 5EE9A 5C3JB 1JRPA 1MVKA 2HDEA 3L4PA 2WU5B 2WXIA 4USAA 1YN3A 5H8YE 4XWTA 3V05A 2QIEB 4RH6A 2LUMA 4MM3B 1TYGB 2BW2A 1F2RC 3ZJVA 2M19A 3Q8AA 2E3TA 2W3RA 3LYYA 1NEKB 3MJ5A 1AW7A 3LB8C 3U4EG 2VZKD 3KQ4A 3UI3A 1R7SA 4C7YA 1HZ6A 4HJGE 4OVZA 1YMHE 1RWSA 4YSXB 1E7PB 1SF0A 4JPSA 3NVWA 2XN9C 5HI1A 4XWWA 4ARCA 1EWYC 2KMMA 2Z8LA 3BYTB 1ET9A 1WSPA 1VLBA 1JQ4A 2INNE 1F2RI 1IBXB 1E6EB 1JWUD 2DYMA 2WXRA 1QQRA 4RF0A 1EM7A 3ZGZA 5C2TB 2BS2B 2JX5A 1LO5D 1C4AA 2PW9A 4MH8A 4ARIA 1RM6C 1ZDXA 2QMTA 2DLBA 3E9SA 1FO4A 3BZDB 1XLOA 3Q8CA 4M0WA 4YSZB 4J3OD 1D5MC 1UGJA 2IGHA 1N61A 4RFBA 2L32A 1HEZE 1UNSA 1VZ6A 5FR3A 2X38A 3AE2B 1BUIC 5T8IA 2B76B 2W54A 4WH4A 3DWGC 4AQ7A 1ZPSA 1V1PB 1NENB 1XLQA 4N58A 4XDDA 1A70A 1KLGD 1XEEA 3NS1A 1CQVA 3W5VB 5D3IB 4WIPA 3WCQA 2WS3B 2J53A 3HVZA 1NI3A 1VZ7A 3FILB 1ZXHA 2EKIA 2E6XA 2KACA 1WRIA 1PGXA 4A55A 1Q10A 4XE0A 4CQNA 2ZW1A 4WWMA 3RPFC 2I2YA 1K53A 2ON8A 2WLBA 3BK2A 3R2TA 3EUB2 1Y56A 1C77A 2ICIA 2N7JA 4TQ1A 1GB1A 1I7HA 3V3XA 2WXOA 1IUEA 1ZE3D 1NYRA 2BBCA 1TS3A 3AEDB 1T3QA 2K9XA 3ETRA 2PVGC 3KWLA 1ZUD2 3AE4B 4DXFA 4OZAA 2WXGA 1QOAA 1XCTL 3GP7A 2QEJC 3SEBA 2V0GA 1YQ4B 2FE8A 2K0PA 1WWTA 2PKOA 2OHFA 2QILA 1QILA 5E6JA 5BYSA 4B0EA 2H89B 2I38A 2AX5A 1QLBB 4OZBA 5G5HA 1I4XA 3U52E 3H8HA 1WYGA 2VZKB 4GDLB 3BK1A 3BVGA 3AEAB 3U7ZA 2M56B 3TEZA 1JROA 3Q69A 4GDKB 1FNVA 2CJNA 4XDCA 3AEGB 3NZ3A 4AS1A 5G5GA 1MHHE 1GB4A 1IGCA 1QOBA 3HVDA 4N59A 2K3UA 2WU2B 2INPE 2K5PA 3PO0A 2JYEA 2PTLA 3AE7B 1E0ZA 2YEPB 3TSSA 3AV8A 1JWAD 3HRDD 2JSVX 2PLPA 3IT4B 3MC0B 1GOZA 5AUKA 3NVVA 4OZCA 2JXTA 3VRAB 1KTKA 3DWMA 1E9MA 4YTPB 3AN1A 1F77A 3BVMA 2PMVA 4JWUC 3R8BA 1CK1A 1ET6A 2N9LA 2WXQA 3AMZA 3OWEB 2KWDA 4L2YA 1T6BX 4US9A 1N63A 5HFYA 1FRRA 2G9HD 2D5GA 2JU6X 1AN8A 3B2FA 2V3PA 4ZHPA 1TZOA 1ESFA 1TS2A 4A90A 3ZJUA 1EWCA 1XXGA 1OQRA 2SEBD 4ITKA 4LK0M 4RCOA 2GI9A 2ACZB 3P63A 1AYFA 1FNWA 1D6EC 2AQ1B 2BYTA 4KKIA 1TKEA 4FXCA 1B9RA 4WURA 4IDIA 1YN5A 5BYRA 2KDMA 2MJDA 4RGMA 3GB1A 1HA5A 4HRSA 2PIAA 1HQRD 1L0XB 2L52A 4C7ZA 1NYQA 3O13A 4RF1A 3AE1B 1B1ZA 3AE3B 3GS2A 4MT5A 1FEHA 3AECB 5GXGB 2AQ3B 1I4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLP A;  3NRZ A;  1FM0 D;  1FFU A;  2WP9 B;  5EE3 A;  4WWM A;  1QF6 A;  3RPF C;  1L6U A;  1FMA D;  2HTM E;  2WLB A;  2FBW B;  1ROE A;  3EUB 2;  1DGJ A;  2CU3 A;  4ZOH C;  1I7H A;  2PVO D;  3CIR B;  2K22 A;  1IUE A;  1L6V A;  1NYR A;  2JQR B;  1NVI D;  1KRH A;  2KAJ A;  1T3Q A;  2K9X A;  3AED B;  3ETR A;  2PVG C;  1GAQ B;  1UWM A;  3HUI A;  1J7B A;  1V8C A;  1ZP0 B;  1ZUD 2;  2BT6 A;  3AE4 B;  3KWL A;  3LXF A;  3P4Q B;  4KX6 B;  1QOA A;  3SR6 A;  1JWB D;  3W5U B;  1F0Z A;  1YQ4 B;  4C80 A;  1VDV A;  3B9J A;  1PDX A;  1J7C A;  1FRD A;  1N5W A;  4YTM B;  1WWT A;  3SFE B;  2WDQ B;  1KF6 B;  2PKO A;  2OHF A;  3AEF B;  1AWD A;  2W3S A;  4P6V F;  4ZHO A;  3P4R B;  1FFV A;  1L0V B;  2H88 B;  2H89 B;  1JW9 D;  2W55 A;  2AX5 A;  2Y5C A;  1QLB B;  3FAH A;  1KFY B;  1YJI A;  3P4S B;  1N62 A;  5G5H A;  5EE9 A;  5C3J B;  1JRP A;  1XO3 A;  2MJE A;  3AE6 B;  1WYG A;  3L4P A;  2WU5 B;  3AEA B;  1JAL A;  4USA A;  2M56 B;  5H8Y E;  1GPX A;  1JRO A;  1PFD A;  1ZXI A;  2WDR B;  1CJE A;  2QIE B;  1SB3 C;  2CJN A;  3AEE B;  4US8 A;  3AEG B;  3AM9 A;  1SIJ A;  3ABV B;  2MH7 A;  4YSY B;  5G5G A;  2WQY B;  1TYG B;  1QOB A;  3AE8 B;  4N59 A;  2WU2 B;  4YTN B;  2K5P A;  1RYJ A;  1PUT A;  2M19 A;  4N58 A;  4YT0 B;  3PO0 A;  3AE7 B;  2E3T A;  5H92 C;  1E0Z A;  2W3R A;  1NEK B;  3AV8 A;  1OQQ A;  3LB8 C;  1JWA D;  3HRD D;  3CWI A;  1J7A A;  5AUK A;  1DOY A;  3NVV A;  1R7S A;  4C7Y A;  3VRB B;  3VRA B;  3DWM A;  1FXI A;  1E9M A;  1RWS A;  4YTP B;  4YSX B;  3AN1 A;  4WQM A;  1WXQ A;  3P1M A;  2DWQ A;  2WDV B;  1E7P B;  3AH7 A;  2G1E A;  3VR9 B;  4JWU C;  1SF0 A;  1B9R A;  3NVW A;  1EWY C;  2KMM A;  2BS4 B;  3AMZ A;  3AE9 B;  1L5P A;  1VLB A;  3FC4 A;  1JQ4 A;  4US9 A;  1N63 A;  3NVZ A;  1E6E B;  1TKY A;  1FRR A;  1TJE A;  2L83 A;  2LEK A;  4N6E B;  5EE0 A;  2BS3 B;  3B2F A;  2BS2 B;  2JX5 A;  5C2T B;  3AEB B;  1RM6 C;  2DBY A;  4ZHP A;  2CJO A;  4YXD B;  1FO4 A;  1FIQ A;  1XLO A;  1XLN A;  4YSZ B;  3BII D;  4HRO A;  5MPO A;  1OQR A;  4ITK A;  1N61 A;  2ACZ B;  3W9C B;  1VJK A;  1N5X A;  4JWS C;  3P63 A;  2Q5W D;  1AYF A;  3AE5 B;  4LTU A;  3NVY A;  1DOX A;  1V97 A;  1TKE A;  4FXC A;  3AE2 B;  1E10 A;  1FXA A;  1QOF A;  4IDI A;  5EE1 A;  1OFF A;  1RFK A;  3ZYY X;  2B76 B;  2MJD A;  2W54 A;  3DWG C;  3P4P B;  3B2G A;  1NEN B;  1WGK A;  1XLQ A;  2PIA A;  2QJL A;  1TKG A;  1A70 A;  4HRS A;  2L52 A;  2MJ3 A;  1QOG A;  3NS1 A;  1NYQ A;  4JX1 C;  4C7Z A;  1ZOY B;  5AUI A;  3AE1 B;  3SFD B;  3W5V B;  3WCQ A;  2N0S B;  3VR8 B;  1DOI A;  1N60 A;  2WS3 B;  3AE3 B;  3HVZ A;  1NI3 A;  1QT9 A;  3AEC B;  5GXG B;  3AB5 A;  1CZP A;  1YJJ A;  2EKI A;  1YQ3 B;  4A9A A;  1WRI A; 
#chains in the Genus database with same CATH topology
 1XLP A;  1SXT A;  5D3D A;  4CHK A;  3TEX A;  2N9E B;  3RNG C;  4I6P A;  2FUG 1;  3MC9 A;  3P4Q B;  1V8C A;  3ZLZ A;  2QCZ A;  1TY0 A;  1JWB D;  1AAR A;  1UWX A;  2DNF A;  2GOW A;  4BKG A;  1KH0 A;  3RMK C;  4ZHO A;  2BYF A;  2H88 B;  3ZIM A;  1MPE A;  1YJI A;  3L08 A;  4HPM B;  3W1S A;  2M0A A;  3AE6 B;  1WM2 A;  4GGQ A;  3AEE B;  1SIJ A;  3RNF C;  4A3P A;  2ZPY A;  1WX7 A;  3QHT A;  2KK8 A;  2C5L C;  2L1A A;  2JZP A;  1HXY D;  1WJU A;  1L4D B;  3CF6 E;  1RLF A;  1R4N B;  1SEB D;  3PTF C;  3VR9 B;  3I9V 1;  4PT5 A;  5AZG A;  2V1Y A;  4RMA A;  1L5P A;  2BTE A;  1Z5S B;  2L83 A;  5JH5 C;  2BS3 B;  3IXS A;  2NMQ A;  2N9K A;  3PRM B;  3Q3O C;  3TJP A;  4GN1 A;  4F7Z A;  3UQB A;  4RGO S;  4GOC A;  2RPV A;  4HWI B;  1QKZ A;  2IY1 B;  1FXA A;  2K39 A;  1OFF A;  1RFK A;  3VXW A;  2W9N A;  1QOG A;  2IGG A;  2WXN A;  1ZOY B;  4RM8 A;  2MW5 A;  2KN4 A;  4UDU C;  3CST A;  3IT6 B;  5JZE B;  3NRZ A;  4HCP B;  3PHX B;  2V4L A;  2J4X A;  4HDO A;  1C9F A;  5D6J B;  4MSM B;  2SAK A;  3NY5 A;  2JUO A;  4D2K A;  1WZ0 A;  2MQJ A;  1FNU A;  1L6V A;  3FC4 A;  1NVI D;  3W5U B;  2IO0 B;  2G4D B;  4P16 A;  1WYW B;  1F0Z A;  1SE2 A;  3KW5 B;  1D5Z C;  3SFE B;  4S17 A;  4HK2 A;  3AUL A;  2O6V A;  1L0V B;  3EA6 A;  3V61 A;  3H7P A;  1OEY A;  4W9E A;  2EMS A;  1MHX A;  2HJ8 A;  2KOX A;  1TIF A;  1I4H A;  4GDK A;  2KMA A;  3RT3 B;  2KFJ A;  5JHA A;  4P1C C;  3JSV B;  4US8 A;  2EEL A;  3RZW C;  3PT2 B;  5BMI A;  1KJT A;  4IOI E;  3RFZ B;  3V6E B;  4PS8 A;  1K50 A;  1J7A A;  2OED A;  1X1M A;  4GU2 A;  1K52 A;  1P3Q U;  1PGA A;  3DVN U;  2BWF A;  2C60 A;  1STE A;  3P1M A;  1WFY A;  2NPT B;  4M00 A;  4M8M A;  1VRA B;  2LHD A;  4ZYN A;  2WXM A;  3AE9 B;  1E8Z A;  4FLH A;  3DHI C;  2WXL A;  2LEK A;  5EE0 A;  4O1N A;  1WR1 A;  4PYU A;  4WAA A;  3W2D A;  2NTT A;  1XLN A;  2BB5 A;  1EU4 A;  2JYT A;  4QAY A;  3AE5 B;  4L1B A;  4A20 A;  3DVN V;  2WHI A;  4CO7 A;  4YWG G;  2LGD A;  2REX A;  1RRB A;  4F8C B;  3B2G A;  2QJL A;  2GBJ A;  2AEH A;  2ONQ A;  1C1Y B;  4KSK C;  4NJC A;  1CZP A;  2DZM A;  2RDB C;  2NBV B;  4WAF A;  3H7P B;  2PE6 B;  1Q1O A;  2HD5 B;  2JXX A;  2QDF A;  3QCA A;  3CIR B;  2A5U A;  1V1P A;  3Q3N C;  5DPS A;  3W1Y A;  4DWF A;  3ML8 A;  3C8Y A;  2DAJ A;  2KHW B;  3NUH B;  4K3C A;  2DEN B;  4W9D A;  2W3S A;  3WAP A;  1HZ5 A;  4TKN A;  4MEL A;  1N62 A;  2MCN B;  1S3S G;  2IND C;  2CR5 A;  2WXI A;  1YN3 A;  4MJS B;  5H8Y E;  2CHW A;  4PYZ A;  2FID A;  1WGH A;  3N1X C;  1OQY A;  1K8R B;  2E3T A;  4E3C A;  1NEK B;  2IO3 B;  3U4E G;  4P7I A;  1WX9 A;  3KQ4 A;  3UI3 A;  1UBI A;  2N9X A;  1V6E A;  4LJP B;  4OVZ A;  2I1K A;  4EZK A;  2LVP A;  5HI1 A;  4ARC A;  1EWY C;  4S0R A;  3BYT B;  2JY6 A;  1WSP A;  2FCN A;  1JQ4 A;  4KDI C;  1IBX B;  1E6E B;  3U30 A;  3M62 B;  2K8B A;  1GC6 A;  3ZGZ A;  4ARI A;  4MH8 A;  3X0W A;  3SD5 A;  3Q8C A;  3VH3 B;  3PRE A;  2MBE A;  3ZXV A;  4WWP A;  4RFB A;  4FAD A;  4NY0 A;  1VZ6 A;  5KHO A;  1NDD A;  5E6P A;  1E8Y A;  3AE2 B;  2W54 A;  1A5R A;  3DWG C;  2RSU A;  2UYZ B;  1V1P B;  2BVC A;  1KOT A;  1YD8 U;  3W5V B;  5D3I B;  3WCQ A;  3HVZ A;  2KTR B;  1ZXH A;  2GBN A;  3DBS A;  4XE0 A;  1YQB A;  5LLI A;  3EUB 2;  2WDT B;  2N7J A;  1C77 A;  2ICI A;  4AUQ C;  1BT0 A;  3N20 C;  3V3X A;  2WXO A;  3AED B;  3H7S A;  1T3Q A;  3ETR A;  3ML9 A;  2PVG C;  1ZUD 2;  3VTW A;  2NVU I;  5HKH A;  3U8Z A;  2PKO A;  4NAW A;  5E6J A;  3RUI B;  2MA9 B;  2KX3 A;  1I4X A;  3UGB B;  1YJ1 A;  2KFK B;  4DHZ B;  3AEA B;  3TEZ A;  3Q69 A;  1FNV A;  3QA8 A;  4AS1 A;  2FUH B;  4N59 A;  3IFW B;  2INP E;  5CHV C;  4HVB A;  3AE7 B;  2YEP B;  1JWA D;  5AUK A;  4OZC A;  5L95 C;  1WXS A;  4JWU C;  3R8B A;  4IM3 A;  3APF A;  3SU8 X;  1ET6 A;  2N9L A;  3AMZ A;  3A9J B;  2KWD A;  4TV3 A;  4XGA B;  3ZKJ C;  4L2Y A;  3ZDT A;  2L00 B;  5HFY A;  4FJY A;  2G9H D;  4ZHP A;  2O6V D;  1XQQ A;  1TZO A;  4FJV B;  3ZJU A;  1L2N A;  1EWC A;  1OQR A;  2BYV E;  4RCO A;  2ACZ B;  2QC8 A;  4IM2 A;  2YVC A;  4ACF A;  2BYT A;  5G55 A;  2BKR B;  4IDI A;  1YN5 A;  2KDM A;  4RGM A;  3H9D A;  2PIA A;  1HQR D;  3AE1 B;  3AE3 B;  3WIM A;  4MT5 A;  4C4V A;  2AYO B;  2L8J A;  2KJ6 A;  4FN2 A;  3T3N A;  5IP4 D;  2W82 A;  2HTM E;  2G4S A;  3U2S C;  2KWU B;  1BXT A;  2KDE B;  1TZ1 A;  1WM3 A;  1FCC C;  4IWP A;  4DDG D;  3A1Q B;  1PGB A;  1VDV A;  4LNO A;  4JQW C;  4IKG A;  4WJP A;  1ZGU B;  2KDI A;  1JW9 D;  3FAH A;  3PGE A;  4A8X C;  3NZU A;  3KWV A;  1P7F A;  2MJE A;  5IO9 A;  3RCZ A;  3CSF A;  1WRD B;  5BYQ A;  2LWP A;  2JZZ A;  1UEL A;  2MBB B;  4XX5 A;  1ZXI A;  4MM3 A;  4AJY B;  4MGK E;  2WXK A;  3VAW A;  4EKU A;  4LLG M;  4NJ6 A;  4IWO A;  1OQQ A;  1K51 A;  1P0R A;  2M0X A;  3CWI A;  2X8X X;  1VR9 A;  4PK1 A;  3DBL B;  3PZD A;  4XYC A;  2R61 A;  5CTR C;  1C4C A;  1D4B A;  4TMA B;  3ALB A;  5AZH A;  2LAS A;  4W9G A;  3TMP B;  3T8M A;  3BYY B;  4JGH B;  4YXD B;  3ZNG C;  3PZ8 A;  1FCL A;  1ACC A;  4KDL B;  4JWS C;  4LTU A;  3CMM B;  2ZW0 A;  1WJ6 A;  3IBE A;  3MHS D;  1T0Q C;  1UZX B;  2BB6 A;  2MHJ A;  1WGK A;  2KTF A;  4REZ A;  4JX1 C;  3SFD B;  5AUI A;  1SSN A;  2N0S B;  4ZYS A;  3TIX A;  5IA7 A;  2WXH A;  3IHP C;  3MP9 A;  2LGX A;  4EE2 A;  1YQ3 B;  3OLM D;  1VCB A;  3B1L X;  2ZVO A;  2MEK A;  1FFU A;  4TQ0 A;  1YX5 B;  4WWN A;  4KGS A;  1OTR B;  1L6U A;  3ECI A;  4W9C A;  2GMI C;  3KUZ A;  2LRU A;  1ROE A;  1DGJ A;  3TUO A;  3AEF B;  4HKZ E;  5I4D A;  1CMX B;  5GMV A;  3P4P B;  4RGN A;  3QQ8 B;  4M01 A;  2IZV B;  3N9Y C;  2LFI A;  2MLB A;  3P4R B;  1FPY A;  3E56 A;  3APD A;  2W55 A;  4KKJ A;  1KFY B;  1H4R A;  3DBR I;  1YN4 A;  1R4M B;  2IPK D;  2LVO A;  4KIK A;  1EU3 A;  2Y5P A;  3P2B A;  1P7E A;  2JWU A;  3M63 B;  1GPX A;  2WWZ A;  1PFD A;  2HE7 A;  2KO3 A;  3AM9 A;  5BMH A;  3ZNZ B;  3AE8 B;  1I4Q A;  4EZJ A;  2L0T A;  1LXD A;  4ZRQ A;  2KD0 A;  3LJ3 A;  1IYF A;  1JCK B;  3KLS X;  1I4R A;  4LNF A;  2DWQ A;  1F1H A;  3RYT A;  5JXV A;  1P1A A;  3GE3 C;  3H6N A;  2LHE A;  1LQB A;  2KMC A;  2MBO A;  1S1Q B;  1TKY A;  2YEP F;  4N6E B;  3VQI A;  3AEB B;  3ZW3 A;  5IN7 A;  1M94 A;  1IGD A;  2NS5 A;  3PPA A;  1D5X C;  4L23 A;  1WE7 A;  5IKC M;  1VZ8 A;  2FAZ A;  4A6Q A;  2L05 A;  4NNJ B;  2NCN A;  5IOI A;  3Q8F A;  4GLS C;  2AWT A;  3IAM 1;  1XCQ L;  4EUT A;  2MJ3 A;  2K6D B;  4IC7 B;  1SJH D;  1YNT E;  5TR5 A;  4WWO A;  2KXJ A;  2N7D A;  1QF6 A;  4BZA A;  4B95 A;  3MFG A;  2WXF A;  3BY4 B;  3N1Z C;  3J9C A;  2PVO D;  4LDT D;  3GZN B;  2LGI A;  1DOX A;  3I57 A;  4IUM B;  1JWM D;  2IGD A;  2V9H A;  4JIO U;  2NR2 A;  3TCA A;  4BBN C;  4RGT A;  4YTM B;  1I42 A;  1AWD A;  2XNA C;  4F1S A;  3KVF B;  3LDZ E;  5C3J B;  3R3M A;  2K25 A;  2LVQ A;  4KSL C;  3N32 A;  4XC2 A;  2M19 A;  4GB9 A;  2W3R A;  5L83 A;  3ZNI D;  3PRP B;  4C7Y A;  4EZL A;  3ZVV A;  3C0R B;  4MGI E;  3MJW A;  2J0M A;  2Z8L A;  2KMM A;  3EFU A;  3TBL D;  1ET9 A;  4A3O A;  4DDI D;  4FBJ B;  2DYM A;  1WGR A;  4RF0 A;  5C2T B;  1F52 A;  1C4A A;  1LO5 D;  2JZ3 B;  4AP4 C;  5EDS A;  3E9S A;  1U4A A;  3BZD B;  1XLO A;  4M0W A;  4K7W A;  4J3O D;  2NBW B;  2AL3 A;  1P98 A;  2DZJ A;  4BOZ B;  1XLQ A;  1KLG D;  4DHJ B;  4WIP A;  2WS3 B;  1VZ7 A;  3AU5 A;  2E6X A;  3PS6 A;  1WRI A;  1WJ4 A;  3N1Y C;  4ANW A;  2KWC A;  4FJZ A;  4WWM A;  3RPF C;  5DPR A;  2I2Y A;  2ON8 A;  1NBF C;  2M1M A;  4TQ1 A;  3OJ4 B;  1ZE3 D;  1NYR A;  2K9X A;  1XD3 B;  3KWL A;  2Z0E B;  4DXF A;  2NBU A;  4URK A;  3GP7 A;  3SEB A;  3HK0 A;  2K0P A;  2IYD B;  2IY0 B;  1WWT A;  1UD7 A;  2OHF A;  1QIL A;  2DZI A;  2O6V B;  2DAF A;  4OZB A;  4BAX A;  3L0W B;  3V6C B;  2VZK B;  1WMH A;  3DCG A;  3U7Z A;  4LNN A;  3PLV A;  3AU4 A;  3KUC B;  4GDK B;  4CYE A;  4HPP A;  4W9H A;  3NZ3 A;  3NHE B;  5BO4 B;  2K3U A;  2WU2 B;  5FR6 A;  2LD9 A;  3APC A;  3TSS A;  4NJ7 A;  3I63 C;  1Y8R C;  2JSV X;  2PLP A;  3IT4 B;  3PVL A;  2JXT A;  4EFO A;  2DX5 B;  2PJH A;  3VRA B;  3ZRC A;  1KTK A;  3DWM A;  1C3T A;  1F77 A;  2PMV A;  1CK1 A;  3IG3 A;  3DVG Y;  3OWE B;  4US9 A;  2MSE D;  3D32 A;  2KT7 A;  1LFD A;  2JU6 X;  3V60 A;  2DHZ A;  4A90 A;  4KZ0 A;  1XXG A;  2SEB D;  2YLM A;  4ITK A;  2GI9 A;  1RFA A;  2I1J A;  3AI5 A;  2L0F A;  1T0S C;  1D6E C;  4B6W A;  1WGY A;  4WUR A;  5BYR A;  3U7D A;  3GB1 A;  1HA5 A;  4HRS A;  1L0X B;  3VUX A;  4C7Z A;  3O13 A;  4LJO B;  2FCM A;  2MP2 A;  3ZRF A;  1FEH A;  3PV1 A;  5DPT A;  2J7Q B;  2AQ3 B;  1HE8 A;  3ENE A;  2XK5 A;  1JWS D;  3UF8 A;  1C76 A;  3HHM A;  4BKS A;  2D3B A;  2CU3 A;  2ZEQ A;  4LNK A;  1WX8 A;  3HUI A;  5BMG A;  2LI5 A;  2WGS A;  1L4Z B;  3EHV A;  1Q0W B;  4C80 A;  4OVU A;  4H2A A;  1C4P A;  1FRD A;  1N5W A;  2PE9 A;  2OJR A;  2Y5C A;  3URY A;  2Y5B B;  3WAO A;  1WXM A;  2VH1 A;  2IDY A;  3JYU A;  5C23 A;  3X23 A;  2LGY A;  3UIO B;  2CHZ A;  1E7V A;  1RYJ A;  4JL9 A;  5FKA C;  1DYQ A;  5TSS A;  4RNA A;  1WGD A;  3UIN B;  2N1W A;  1J19 A;  4DHZ E;  2L3Z A;  2G1E A;  2JRI B;  3EGR A;  1Z2M A;  1SE3 A;  2RDH A;  1R4N I;  1EO6 A;  3IAS 1;  2KDB A;  2DBY A;  4HCN B;  2LGS A;  4KVG B;  1WE6 A;  3A9K A;  3W9C B;  4K3B A;  1P9D U;  3NVY A;  1QOF A;  5EE1 A;  2KC1 A;  3NOB A;  2ASQ A;  2KYW A;  2BPS A;  1DOI A;  3DHG C;  2KNB A;  3AB5 A;  1YJJ A;  2B3A A;  4A9A A;  2LUE A;  3GZN I;  4FHJ A;  1YX6 B;  2KX0 A;  3GOE A;  3W1S C;  1L0Y B;  2WP9 B;  5E6N A;  3MTN B;  3QIJ A;  2Z0D B;  4ZOH C;  4P1B C;  2GRI A;  1TTN A;  4J6I A;  3PLU A;  1GAQ B;  1KLU D;  1ZP0 B;  1ZDV A;  1GUA B;  4WJO A;  1PDX A;  1J7C A;  1PYW D;  2V3S A;  3VUW A;  1OGW A;  4P6V F;  3QJZ A;  1UGM A;  4NAW B;  1ENF A;  3Q3J A;  4GDL A;  3Q2A C;  1XO3 A;  4HJK A;  3K9P B;  4N9F 4;  4OHJ A;  1JRU A;  5D7G A;  1CJE A;  4HXD A;  2RPQ A;  1SB3 C;  2MH7 A;  1PUT A;  4YT0 B;  3NG0 A;  5H92 C;  2M4N A;  2JWZ A;  3A4R A;  3KH0 A;  3ZQ4 A;  3VHT C;  3VRB B;  1GC7 A;  2G45 B;  4BVU C;  1WXQ A;  1C78 A;  1D3Z A;  4KGT A;  2AQ2 B;  4R3D A;  5FK9 C;  1I4P A;  1V86 A;  3T3O A;  2C9W B;  1TS4 A;  1TJE A;  4Q2J A;  3Q14 C;  2KN5 A;  2CJO A;  4W9K A;  3VUY A;  1SGH A;  4HRO A;  1E8X A;  2FIF A;  3ZTD A;  5CHF A;  4II3 B;  3AXC A;  1V9J A;  2R2Q A;  2ZPN A;  4KGR A;  2KWV B;  1TS5 A;  3MHZ A;  2IO1 B;  1V97 A;  3QX1 A;  4ZRK A;  1E10 A;  5D94 A;  2BKF A;  5LNK 1;  1FD6 A;  3OAW A;  1TKG A;  4MGY E;  1V80 A;  4W9I A;  2C7N B;  2KKC A;  4K7S A;  2BQQ A;  2PPH A;  2V3N A;  2WXJ A;  4C4V B;  1UF0 A;  2HTH A;  4E74 A;  1FM0 D;  1MG8 A;  3VVW B;  2FBW B;  1WR6 E;  3L16 A;  4AJW A;  3RNB C;  2KAN A;  2LXA A;  3L10 B;  2JQR B;  1LM8 B;  3A33 B;  3S2A A;  2J0J A;  5HHD G;  3WA0 A;  3B9J A;  3FIL A;  1SE4 A;  3M3J A;  5AEK B;  2INC C;  5DCN A;  3P4S B;  1WY8 A;  5EE9 A;  3N3K B;  1JRP A;  1MVK A;  4HPL B;  4USA A;  3V05 A;  1I35 A;  3EFC A;  2QIE B;  4RH6 A;  2LUM A;  4MM3 B;  1F2R C;  2VRR B;  3Q8A A;  2D2Q A;  3MJ5 A;  1AW7 A;  3LB8 C;  2CKH B;  1E5W A;  1V81 A;  3RI7 C;  4G3X B;  1HZ6 A;  4HJG E;  1YMH E;  1RWS A;  4BKS D;  1E7P B;  1IPG A;  1OEY J;  1SF0 A;  2MX2 A;  4JPS A;  2XN9 C;  2N1V A;  4XWW A;  1VLB A;  2INN E;  1F2R I;  1YIW A;  4ZDV A;  1JWU D;  1QQR A;  1EM7 A;  2BS2 B;  2PW9 A;  1E7U A;  3EEC A;  1RM6 C;  2QMT A;  1FO4 A;  2IGH A;  4M02 A;  2L32 A;  4AOF A;  1UNS A;  5FR3 A;  2X38 A;  5CX3 A;  5C1Z A;  2CU1 A;  2DZK A;  5T8I A;  4XDD A;  4FA6 A;  1A70 A;  1XEE A;  3RZF A;  1PQS A;  3L13 A;  4NPN A;  2J53 A;  4BBN F;  1UBQ A;  3FIL B;  2CHX A;  1PGX A;  3QAR A;  1Q10 A;  4CQN A;  3QC8 B;  3BK2 A;  3R2T A;  1GB1 A;  4K81 A;  4B9K A;  2KC2 A;  2BBC A;  1TS3 A;  4ANU A;  3RNE C;  4OZA A;  4BKT A;  1YQ4 B;  2FE8 A;  2RD0 A;  4B0E A;  4KZC A;  4K7U A;  2I38 A;  2AX5 A;  3KYD D;  2M17 A;  2D3G A;  1E8W A;  1WZ3 A;  3BK1 A;  1MJD A;  3JSV A;  1JRO A;  2KQ7 A;  4KIK B;  4YL8 A;  4MSQ B;  2RR9 A;  5G2N A;  4XDC A;  4KV2 A;  5G5G A;  1MHH E;  1IGC A;  3HVD A;  1UH6 A;  2K5P A;  2N9P C;  1ZKH A;  1GOZ A;  3NVV A;  2NPT A;  4YTP B;  2QHO A;  3BVM A;  2EKE C;  2WX1 A;  1J0G A;  3KUD B;  2D3C A;  1T6B X;  2HJ1 A;  1N63 A;  3I3T B;  1FRR A;  1TGZ B;  2V3P A;  2OOB B;  2WYQ A;  3H1U A;  3R7Q A;  1TS2 A;  4GSW A;  1KLV A;  2J0K A;  3DBH B;  5J17 A;  3JVZ X;  3WAN A;  1AYF A;  2AQ1 B;  4EEW A;  4FUL A;  4KKI A;  2Z59 B;  2KVR A;  1GJZ A;  2MJD A;  4I6L B;  2KDF B;  3NZS A;  1N6Z A;  4X57 B;  3Q6B A;  4W9L A;  5E6O A;  4FHK A;  2L52 A;  1NYQ A;  4BOS C;  4ASW C;  3PHW B;  1B1Z A;  2KZR A;  3GS2 A;  3AEC B;  5GXG B;  1E90 A;  2IBI B;  1WIA A;  1WH3 A;  3PRZ A;  2J42 A;  2BYE A;  1H8C A;  3TL5 A;  4TSS A;  4MH0 E;  4GMV A;  2M8S A;  3R66 C;  1SBB B;  3B08 A;  2LJ5 A;  3PSE B;  3HM6 X;  1J7B A;  2BT6 A;  1BML C;  2KQ4 X;  2GBK A;  2LRW A;  4GIV A;  2RDG A;  2IO2 B;  4TUU A;  4C56 C;  2FCQ A;  3B0A A;  4HDQ A;  1T0R C;  4MJS A;  1JML A;  1V1O A;  4HEA 1;  2ZNV B;  2J52 A;  2WQY B;  3FKY A;  2NTS A;  4YTN B;  2N4F A;  1SIF A;  3JW0 X;  1TY2 A;  5LXI B;  4HKQ A;  2LJI A;  4G50 A;  1DOY A;  4OW0 A;  4K1R B;  3RNA C;  5DPW A;  4WQM A;  2WDV B;  1SJE D;  4JE3 B;  1IBX A;  2BS4 B;  3R2I A;  2IJ0 A;  1T5X D;  1LGR A;  3VTV A;  4MAC A;  2V4I B;  3NVZ A;  3QWZ B;  4IWQ A;  2ZCC A;  2C7H A;  5D2M B;  3DBL I;  1FIQ A;  3RUL A;  3BII D;  4ICV A;  5MPO A;  3DQV A;  2AL6 A;  1WJN A;  2MBH A;  4M0W B;  1VJK A;  5LXH A;  3RN9 C;  1XF5 L;  2XEW A;  2WNM A;  2LXC A;  3ZTC A;  3DPD A;  3VH4 B;  2K8C A;  3ZXR A;  2KJH B;  2KTR A;  2VH2 A;  4RM9 A;  3VR8 B;  2BF8 B;  4ANX A;  1WF9 A;  3DDC B;  2K6Q A;  1M4V A;  2EMT A;  2ZZP B;  2R2O A;  1FMA D;  4DBG A;  4MGZ E;  2ZCB A;  2WX0 A;  4ICU A;  3DBR B;  2D10 A;  4DXG A;  4ZRI A;  1UWM A;  3BWU D;  4KX6 B;  3LXF A;  3ZNH B;  3DVG X;  2LMC A;  3ZDM C;  3HIZ A;  2WDQ B;  1KF6 B;  4C00 A;  2Y3A A;  2KFK A;  5HG2 A;  4G11 A;  1EF5 A;  1UUP A;  3WAM A;  3A4S C;  1MG4 A;  3L17 A;  1JAL A;  3RNC C;  3KYC D;  1WMH B;  2KVZ A;  2FNJ B;  2WDR B;  3K9O B;  4NAM A;  3ABV B;  4YSY B;  4B0M A;  4LCD E;  2WXP A;  4JLC A;  2FCS A;  2JVC A;  1R4M I;  5KHQ A;  3V62 A;  2L7R A;  1FXI A;  2PEA A;  1MFW A;  3AH7 A;  2KLC A;  3A9J A;  3NJT A;  4NQL B;  1WI0 A;  3HM3 A;  2K1F A;  4DQO C;  2D11 A;  4AWJ A;  4DXA B;  1KM7 A;  2RMM A;  2GBR A;  3P42 A;  2XBB C;  4G0N B;  1YOV B;  3ZUN A;  4M8N A;  2JRH A;  3Q8E A;  4LNI A;  2MWS B;  2K8H A;  4MDK E;  4MEM A;  3ONS A;  1N5X A;  2Q5W D;  2CS4 A;  2KQS A;  3BVZ A;  3ZJT A;  3L54 A;  1L7Y A;  1MI0 A;  4ANV A;  2D07 B;  2KJR A;  3ZYY X;  3VDZ A;  4PS7 A;  4IW0 A;  4NZL B;  3SHQ A;  1N60 A;  1QT9 A;  3ZO5 B;  1Q5W B;  4GXB A;  2MP2 B;  2QSD A;  2KLG A;  5EE3 A;  2DYO A;  2XK5 B;  3VFK A;  2GBM A;  4DHJ D;  2K22 A;  2O2V A;  2KAJ A;  1KRH A;  1V2Y A;  3A1Q A;  4ZRP A;  2GB1 A;  3SR6 A;  4BFR A;  2JT4 B;  3TEY A;  3PZ7 A;  2MBQ A;  3OG5 A;  1FFV A;  2TSS A;  3M95 A;  3TEW A;  1WXA A;  1C79 A;  3Q8B A;  2HDE A;  1WGG A;  3L4P A;  2WU5 B;  3NS8 A;  1J8C A;  4XWT A;  3RD2 A;  2ZVN A;  5J18 A;  1TYG B;  2BW2 A;  4NQK E;  3ZJV A;  3VTU A;  3LYY A;  4XZ4 A;  2VZK D;  2RGF A;  1VD2 A;  1R7S A;  1TT5 B;  3UIP B;  4YSX B;  3BIN A;  3I5J C;  3WAL A;  1B9R A;  3NVW A;  1GG3 A;  1NI2 A;  3DHH C;  3DBH I;  2WXR A;  1TBE A;  4WJN A;  2JX5 A;  2JPH A;  1ZDX A;  2DLB A;  3IVF A;  4YSZ B;  1F9J A;  1D5M C;  1UGJ A;  1FXT B;  2UU7 A;  1N61 A;  2BWE S;  3Q3M C;  1HTQ A;  1GNU A;  1HEZ E;  3A9K B;  2MRP A;  3R7R A;  1BUI C;  4W9J A;  2B76 B;  4AQ7 A;  4WH4 A;  1ZPS A;  1NEN B;  1ZW7 A;  2O2V B;  4N58 A;  3NS1 A;  1CQV A;  4LDT B;  1NI3 A;  4PS3 A;  2C7M B;  2EKI A;  4E71 A;  4IG7 B;  2KAC A;  4WJQ A;  4A55 A;  4II2 B;  2ZW1 A;  1K53 A;  2WLB A;  1Y56 A;  2ZNV C;  1ISN A;  1I7H A;  2G3Q B;  1T0Y A;  3Q3F A;  4EOY A;  1IUE A;  3OJ3 A;  3AE4 B;  1EF1 A;  2GLS A;  2WXG A;  1QOA A;  1XCT L;  3QK0 A;  2QEJ C;  2V0G A;  1V5O A;  4IM0 A;  2N7E A;  4W9F A;  2A4Z A;  2QIL A;  1EUV B;  5BYS A;  2H89 B;  1QLB B;  2JF5 A;  5G5H A;  3U52 E;  2L76 A;  3H8H A;  4WQO B;  1WYG A;  2D3A A;  4GDL B;  3BVG A;  4ZRJ A;  2M56 B;  5AZF A;  3DOW A;  1V49 A;  3T9L A;  2CJN A;  3AEG B;  2LZ6 A;  1V5T A;  1GB4 A;  1RAX A;  1QOB A;  2ZJD A;  3MC8 A;  1QZE A;  3PO0 A;  2JYE A;  2PTL A;  1E0Z A;  3AV8 A;  3HRD D;  3MC0 B;  1E9M A;  3AN1 A;  2WXQ A;  1HTO A;  3QAQ A;  3UQA A;  2D5G A;  1AN8 A;  1WXV A;  3B2F A;  4DK5 A;  4OVV A;  3EC8 A;  1ESF A;  2OJW A;  1G6J A;  1XT9 B;  3SDL C;  5JHB A;  4LK0 M;  2BGF A;  3P63 A;  1FNW A;  3C19 A;  1SE9 A;  5J2R A;  1TKE A;  4FXC A;  5IAA C;  3N30 A;  2DYB A;  1IP9 A;  2UWQ A;  3O65 B;  5CHW A;  4RF1 A;  3GE8 C;  1I4G A;  4I6N B;  4HLE A; 
#chains in the Genus database with same CATH homology
 1XLP A;  1JWS D;  2J42 A;  3T3N A;  1SXT A;  2W82 A;  2HTM E;  5D3D A;  1C76 A;  4TSS A;  3TEX A;  2CU3 A;  3U2S C;  1SBB B;  2FUG 1;  3HUI A;  1BXT A;  5BMG A;  3P4Q B;  1J7B A;  1V8C A;  2BT6 A;  1TY0 A;  1FCC C;  1JWB D;  1L4Z B;  1BML C;  1PGB A;  2KQ4 X;  1UWX A;  1VDV A;  4H2A A;  4C80 A;  1C4P A;  1FRD A;  1N5W A;  2RDG A;  4IKG A;  1KH0 A;  4ZHO A;  2H88 B;  4C56 C;  1JW9 D;  2Y5C A;  1MPE A;  3FAH A;  3URY A;  4A8X C;  1YJI A;  3KWV A;  2IDY A;  3W1S A;  2M0A A;  1P7F A;  2MJE A;  3AE6 B;  5BYQ A;  1JML A;  1ZXI A;  1V1O A;  3AEE B;  4HEA 1;  2WXK A;  1SIJ A;  2J52 A;  2WQY B;  2NTS A;  4LLG M;  4YTN B;  1RYJ A;  1TY2 A;  2L1A A;  4HKQ A;  2JZP A;  1HXY D;  1OQQ A;  5FKA C;  1DYQ A;  1K51 A;  3CWI A;  1L4D B;  2LJI A;  5TSS A;  4RNA A;  1DOY A;  1SEB D;  4OW0 A;  1VR9 A;  4WQM A;  2WDV B;  3VR9 B;  1SJE D;  2G1E A;  2R61 A;  3I9V 1;  4JE3 B;  1C4C A;  4PT5 A;  3EGR A;  1D4B A;  1IBX A;  2BS4 B;  3R2I A;  1SE3 A;  2IJ0 A;  1T5X D;  1L5P A;  4TMA B;  2BTE A;  4MAC A;  2V4I B;  2RDH A;  3NVZ A;  2L83 A;  2BS3 B;  3BYY B;  3IXS A;  3IAS 1;  2DBY A;  2NMQ A;  4YXD B;  2N9K A;  1FIQ A;  3BII D;  3PZ8 A;  5MPO A;  4RGO S;  1FCL A;  1ACC A;  3W9C B;  1VJK A;  4JWS C;  2RPV A;  1XF5 L;  4LTU A;  2WNM A;  3NVY A;  1QKZ A;  2ZW0 A;  1FXA A;  1QOF A;  5EE1 A;  1OFF A;  1RFK A;  2BB6 A;  1WGK A;  4REZ A;  4JX1 C;  1QOG A;  2IGG A;  2WXN A;  1ZOY B;  5AUI A;  1SSN A;  3SFD B;  2N0S B;  3VR8 B;  1DOI A;  4ZYS A;  2KN4 A;  2WXH A;  3AB5 A;  3MP9 A;  1YJJ A;  4UDU C;  4EE2 A;  1YQ3 B;  3IT6 B;  4A9A A;  2MEK A;  1M4V A;  3NRZ A;  1FFU A;  1L0Y B;  2WP9 B;  4TQ0 A;  4KGS A;  1L6U A;  2J4X A;  1FMA D;  1C9F A;  1ROE A;  1DGJ A;  4ZOH C;  3TUO A;  2SAK A;  4D2K A;  2GRI A;  1FNU A;  3AEF B;  1L6V A;  3FC4 A;  4HKZ E;  1NVI D;  3W5U B;  5I4D A;  4DXG A;  1GAQ B;  1UWM A;  1KLU D;  3BWU D;  1ZP0 B;  3P4P B;  3LXF A;  4KX6 B;  4P16 A;  1ZDV A;  4RGN A;  1F0Z A;  1SE2 A;  1PDX A;  1J7C A;  1PYW D;  1D5Z C;  2LMC A;  3SFE B;  3N9Y C;  2WDQ B;  1KF6 B;  4P6V F;  2LFI A;  2Y3A A;  3P4R B;  1L0V B;  3E56 A;  3EA6 A;  5HG2 A;  2W55 A;  4KKJ A;  1ENF A;  1KFY B;  4NAW B;  1UUP A;  1YN4 A;  1MHX A;  1XO3 A;  2IPK D;  1EU3 A;  2Y5P A;  1I4H A;  1JAL A;  1P7E A;  2JWU A;  4OHJ A;  1GPX A;  1PFD A;  5D7G A;  2WDR B;  1CJE A;  1SB3 C;  4NAM A;  4US8 A;  3AM9 A;  5BMH A;  3ABV B;  2MH7 A;  4YSY B;  4B0M A;  3AE8 B;  1I4Q A;  2EEL A;  2WXP A;  1PUT A;  4YT0 B;  5BMI A;  5H92 C;  3ZQ4 A;  4IOI E;  3RFZ B;  4ZRQ A;  1K50 A;  1J7A A;  2OED A;  1JCK B;  1K52 A;  1PGA A;  3VRB B;  3KLS X;  1I4R A;  1FXI A;  1STE A;  1WXQ A;  3P1M A;  1C78 A;  2DWQ A;  4KGT A;  3AH7 A;  2AQ2 B;  1VRA B;  4R3D A;  5JXV A;  5FK9 C;  1I4P A;  2LHD A;  2LHE A;  2WXM A;  3AE9 B;  3T3O A;  2YEP F;  1TKY A;  2WXL A;  4DQO C;  1TS4 A;  1TJE A;  2LEK A;  4N6E B;  4Q2J A;  2RMM A;  5EE0 A;  3VQI A;  4O1N A;  3P42 A;  3AEB B;  2CJO A;  3W2D A;  2NTT A;  1XLN A;  2BB5 A;  4HRO A;  1IGD A;  3Q8E A;  1EU4 A;  2JYT A;  1D5X C;  1N5X A;  2Q5W D;  3AE5 B;  3BVZ A;  3ZJT A;  4L1B A;  4L23 A;  4KGR A;  1VZ8 A;  4A6Q A;  1TS5 A;  3MHZ A;  1V97 A;  1MI0 A;  1E10 A;  4YWG G;  3Q8F A;  3ZYY X;  5LNK 1;  4GLS C;  1FD6 A;  3B2G A;  3IAM 1;  1XCQ L;  2QJL A;  1TKG A;  2ONQ A;  2MJ3 A;  4NZL B;  4NJC A;  1N60 A;  1SJH D;  1YNT E;  1QT9 A;  1CZP A;  2V3N A;  2WXJ A;  2QSD A;  1FM0 D;  4WAF A;  5EE3 A;  1QF6 A;  2DYO A;  3MFG A;  2FBW B;  2WXF A;  3J9C A;  2PVO D;  3CIR B;  2K22 A;  1V1P A;  2JQR B;  2KAJ A;  1KRH A;  2LGI A;  1DOX A;  3I57 A;  1JWM D;  2IGD A;  4ZRP A;  2GB1 A;  3SR6 A;  5HHD G;  3C8Y A;  3TEY A;  3B9J A;  3FIL A;  4RGT A;  1SE4 A;  3NUH B;  4YTM B;  3PZ7 A;  1AWD A;  2W3S A;  1FFV A;  2TSS A;  1HZ5 A;  3TEW A;  2XNA C;  1C79 A;  3P4S B;  1N62 A;  3Q8B A;  5EE9 A;  5C3J B;  1JRP A;  1MVK A;  2HDE A;  3L4P A;  2WU5 B;  2WXI A;  4USA A;  1YN3 A;  5H8Y E;  4XWT A;  3V05 A;  2QIE B;  4RH6 A;  2LUM A;  4MM3 B;  1TYG B;  2BW2 A;  1F2R C;  3ZJV A;  2M19 A;  3Q8A A;  2E3T A;  2W3R A;  3LYY A;  1NEK B;  3MJ5 A;  1AW7 A;  3LB8 C;  3U4E G;  2VZK D;  3KQ4 A;  3UI3 A;  1R7S A;  4C7Y A;  1HZ6 A;  4HJG E;  4OVZ A;  1YMH E;  1RWS A;  4YSX B;  1E7P B;  1SF0 A;  4JPS A;  3NVW A;  2XN9 C;  5HI1 A;  4XWW A;  4ARC A;  1EWY C;  2KMM A;  2Z8L A;  3BYT B;  1ET9 A;  1WSP A;  1VLB A;  1JQ4 A;  2INN E;  1F2R I;  1IBX B;  1E6E B;  1JWU D;  2DYM A;  2WXR A;  1QQR A;  4RF0 A;  1EM7 A;  3ZGZ A;  5C2T B;  2BS2 B;  2JX5 A;  1LO5 D;  1C4A A;  2PW9 A;  4MH8 A;  4ARI A;  1RM6 C;  1ZDX A;  2QMT A;  2DLB A;  3E9S A;  1FO4 A;  3BZD B;  1XLO A;  3Q8C A;  4M0W A;  4YSZ B;  4J3O D;  1D5M C;  1UGJ A;  2IGH A;  1N61 A;  4RFB A;  2L32 A;  1HEZ E;  1UNS A;  1VZ6 A;  5FR3 A;  2X38 A;  3AE2 B;  1BUI C;  5T8I A;  2B76 B;  2W54 A;  4WH4 A;  3DWG C;  4AQ7 A;  1ZPS A;  1V1P B;  1NEN B;  1XLQ A;  4N58 A;  4XDD A;  1A70 A;  1KLG D;  1XEE A;  3NS1 A;  1CQV A;  3W5V B;  5D3I B;  4WIP A;  3WCQ A;  2WS3 B;  2J53 A;  3HVZ A;  1NI3 A;  1VZ7 A;  3FIL B;  1ZXH A;  2EKI A;  2E6X A;  2KAC A;  1WRI A;  1PGX A;  4A55 A;  1Q10 A;  4XE0 A;  4CQN A;  2ZW1 A;  4WWM A;  3RPF C;  2I2Y A;  1K53 A;  2ON8 A;  2WLB A;  3BK2 A;  3R2T A;  3EUB 2;  1Y56 A;  1C77 A;  2ICI A;  2N7J A;  4TQ1 A;  1GB1 A;  1I7H A;  3V3X A;  2WXO A;  1IUE A;  1ZE3 D;  1NYR A;  2BBC A;  1TS3 A;  3AED B;  1T3Q A;  2K9X A;  3ETR A;  2PVG C;  3KWL A;  1ZUD 2;  3AE4 B;  4DXF A;  4OZA A;  2WXG A;  1QOA A;  1XCT L;  3GP7 A;  2QEJ C;  3SEB A;  2V0G A;  1YQ4 B;  2FE8 A;  2K0P A;  1WWT A;  2PKO A;  2OHF A;  2QIL A;  1QIL A;  5E6J A;  5BYS A;  4B0E A;  2H89 B;  2I38 A;  2AX5 A;  1QLB B;  4OZB A;  5G5H A;  1I4X A;  3U52 E;  3H8H A;  1WYG A;  2VZK B;  4GDL B;  3BK1 A;  3BVG A;  3AEA B;  3U7Z A;  2M56 B;  3TEZ A;  1JRO A;  3Q69 A;  4GDK B;  1FNV A;  2CJN A;  4XDC A;  3AEG B;  3NZ3 A;  4AS1 A;  5G5G A;  1MHH E;  1GB4 A;  1IGC A;  1QOB A;  3HVD A;  4N59 A;  2K3U A;  2WU2 B;  2INP E;  2K5P A;  3PO0 A;  2JYE A;  2PTL A;  3AE7 B;  1E0Z A;  2YEP B;  3TSS A;  3AV8 A;  1JWA D;  3HRD D;  2JSV X;  2PLP A;  3IT4 B;  3MC0 B;  1GOZ A;  5AUK A;  3NVV A;  4OZC A;  2JXT A;  3VRA B;  1KTK A;  3DWM A;  1E9M A;  4YTP B;  3AN1 A;  1F77 A;  3BVM A;  2PMV A;  4JWU C;  3R8B A;  1CK1 A;  1ET6 A;  2N9L A;  2WXQ A;  3AMZ A;  3OWE B;  2KWD A;  4L2Y A;  1T6B X;  4US9 A;  1N63 A;  5HFY A;  1FRR A;  2G9H D;  2D5G A;  2JU6 X;  1AN8 A;  3B2F A;  2V3P A;  4ZHP A;  1TZO A;  1ESF A;  1TS2 A;  4A90 A;  3ZJU A;  1EWC A;  1XXG A;  1OQR A;  2SEB D;  4ITK A;  4LK0 M;  4RCO A;  2GI9 A;  2ACZ B;  3P63 A;  1AYF A;  1FNW A;  1D6E C;  2AQ1 B;  2BYT A;  4KKI A;  1TKE A;  4FXC A;  1B9R A;  4WUR A;  4IDI A;  1YN5 A;  5BYR A;  2KDM A;  2MJD A;  4RGM A;  3GB1 A;  1HA5 A;  4HRS A;  2PIA A;  1HQR D;  1L0X B;  2L52 A;  4C7Z A;  1NYQ A;  3O13 A;  4RF1 A;  3AE1 B;  1B1Z A;  3AE3 B;  3GS2 A;  4MT5 A;  1FEH A;  3AEC B;  5GXG B;  2AQ3 B;  1I4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...