1RWSA

Backbone solution structure of mixed alpha/beta protein pf1061
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
KMIKVKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Backbone solution structures of proteins using residual dipolar couplings: application to a novel structural genomics target.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
molecule keywords hypothetical protein PF1061
total genus 4
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2003-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1rwsA00
1J7CA 1QT9A 1SB3C 2FBWB 3AB5A 1JRPA 1NI3A 1ZXIA 2MJEA 1E10A 1JW9D 1QOAA 1N5XA 1YQ3B 1ZOYB 3P4RB 1QOGA 1N62A 1N60A 1PDXA 4ZHOA 1TKGA 1E6EB 3DWMA 4USAA 5H92C 1I7HA 2K5PA 4C7ZA 1NVID 2M56B 2MJ3A 1SIJA 2WP9B 2WS3B 2K22A 3ABVB 3NVWA 1FRRA 2W55A 3AEGB 1E0ZA 2WU5B 1F0ZA 1JROA 2ACZB 3W5VB 2MH7A 1UWMA 2BS3B 2Q5WD 1DOYA 3AE2B 2BT6A 2H89B 2WDQB 1XLQA 1XLNA 2WQYB 2E3TA 3AEEB 4A9AA 1L0VB 4HRSA 4YTNB 1GPXA 2JX5A 5G5GA 1DOIA 2WDVB 3L4PA 1XLPA 3AEAB 1VDVA 2MJDA 3HVZA 3LXFA 3AE6B 4WQMA 1ZUD2 3AN1A 3VR9B 2PKOA 1RM6C 5C2TB 4YTMB 1B9RA 1KFYB 3AE4B 2PIAA 4ZOHC 1TYGB 3CIRB 3ETRA 1FM0D 1OQQA 3AMZA 4JX1C 1V97A 3NVZA 3FC4A 1FFUA 1E9MA 2DWQA 2PVGC 2WDRB 3HRDD 3KWLA 3VRBB 1NENB 1TJEA 1YQ4B 1FFVA 2H88B 1L6UA 1WGKA 2CJNA 1SF0A 1AWDA 4N58A 1EWYC 3FAHA 5AUIA 4US8A 1V8CA 3RPFC 1AYFA 1N61A 2QJLA 1JQ4A 1CZPA 5G5HA 1QF6A 1QOBA 4ITKA 4LTUA 3WCQA 2B76B 3P4SB 2CU3A 4JWSC 3P4PB 3CWIA 3P63A 3AE9B 1PUTA 5EE3A 3B2FA 3LB8C 3VRAB 3AECB 1KF6B 3BIID 3AE5B 1TKYA 1JWBD 5GXGB 2AX5A 1VJKA 2EKIA 3HUIA 2QIEB 3NS1A 1E7PB 3P1MA 4C80A 4YSYB 5AUKA 2DBYA 1FMAD 1XLOA 4YSXB 1DOXA 1J7AA 1TKEA 1PFDA 1IUEA 1QOFA 2K9XA 1J7BA 1FXIA 1T3QA 1RYJA 2BS2B 2OHFA 5H8YE 1OQRA 3P4QB 4N59A 4P6VF 2Y5CA 3AE3B 1KRHA 3B9JA 1VLBA 1GAQB 2N0SB 4WWMA 1XO3A 3NRZA 1WYGA 3AEBB 1YJIA 3NVYA 4C7YA 2KMMA 1NYRA 2L52A 3AE1B 4FXCA 1WWTA 3SFDB 1RFKA 1RWSA 2JQRB 3ZYYX 2HTME 1ZP0B 3AH7A 1L6VA 1FO4A 3AEFB 4YT0B 1FIQA 1JWAD 3NVVA 2CJOA 4YTPB 2G1EA 3W5UB 1N63A 1FRDA 1NEKB 1FXAA 1R7SA 3PO0A 2KAJA 4KX6B 4N6EB 5EE0A 4ZHPA 1N5WA 1OFFA 3AE7B 1CJEA 5EE9A 3SFEB 5C3JB 3AM9A 3SR6A 2M19A 3AEDB 3B2GA 3AV8A 2L83A 4IDIA 1WXQA 1JALA 1WRIA 2WLBA 2WU2B 3EUB2 4YSZB 2LEKA 1QLBB 1ROEA 2W3RA 5EE1A 5MPOA 3DWGC 2PVOD 1L5PA 4HROA 4JWUC 4US9A 3W9CB 1NYQA 2BS4B 4YXDB 1YJJA 1DGJA 2W54A 2W3SA 3AE8B 1A70A 3VR8B
chains in the Genus database with same CATH superfamily
3AB5A 3H8HA 2KLCA 1NI3A 4F8CB 1ZXHA 3H7SA 1E5WA 2PLPA 4GLSC 3JSVB 2XBBC 2ZJDA 2Q5WD 2NR2A 3CSTA 4EZJA 2JY6A 1V49A 1L7YA 3CF6E 4LDTB 4JL9A 1EWCA 1T0SC 3A9KA 1ENFA 1FFUA 3N1XC 1YN5A 1YQ4B 5BO4B 1AWDA 1V8CA 1WGHA 4G50A 1QF6A 1E8YA 3EC8A 2N9KA 1KLVA 5EE3A 5KHQA 2L3ZA 4FJVB 1HXYD 3I5JC 2INCC 5GXGB 2ZNVB 2KQSA 2X8XX 1XLOA 1T6BX 1J0GA 2LWPA 1PGAA 3MJ5A 4WURA 3P4QB 2D3CA 5HHDG 2JU6X 3I3TB 3W1SA 2WX0A 1QZEA 2BYEA 2AL3A 4GMVA 1D3ZA 2HTME 2WXGA 2A4ZA 4MGZE 3TIXA 5J17A 3KW5B 3APDA 4M01A 4MACA 1FXAA 1N5WA 1WX7A 2NBVB 1UBQA 1S3SG 2L00B 4BBNF 3C19A 1T0YA 3DBHB 3RNCC 3DWGC 4JWUC 2JXTA 3RT3B 1DGJA 1C76A 4W9DA 2W3SA 4W9CA 2WWZA 1ZW7A 2ZNVC 1N5XA 2RPQA 2JRHA 3AU4A 5LNK1 2DLBA 2LASA 1ET9A 2D3AA 4IG7B 1HEZE 2SAKA 1HZ6A 4AS1A 3VDZA 4TUUA 2DAJA 2DZMA 1L0VB 1I4PA 3QA8A 5CHWA 5E6PA 4NJCA 2AWTA 3DPDA 1WI0A 2CR5A 4K7UA 3U52E 5IA7A 3C8YA 4FHJA 1DYQA 3VVWB 3N20C 3E9SA 1ZPSA 4DXAB 1F2RC 5IO9A 1L6UA 4B95A 1WXAA 1T0RC 4KDIC 1Q5WB 3NZUA 3DBRI 1WMHA 5IOIA 5E6JA 4KZ0A 1JWSD 5CTRC 3Q3JA 3K9OB 4C4VA 3R2TA 3DVGY 3L13A 2EKIA 3APCA 2Z8LA 2KD0A 1H8CA 4TMAB 4IM2A 3HHMA 1V2YA 2MP2B 1HA5A 3RULA 2JYTA 2KLGA 2VH2A 1VLBA 2Z0EB 4XDDA 1WYGA 3Q6BA 2L52A 4EOYA 3DDCB 2EKEC 4RM9A 3AH7A 3TJPA 3BK1A 2FCQA 1IP9A 2KDBA 4YTPB 2NS5A 4OHJA 2KXJA 4XX5A 3UGBB 4ZHPA 1K51A 3TUOA 3B2GA 3ECIA 4LLGM 3N30A 2LEKA 5EE1A 5MPOA 1L0YB 4DBGA 4XWTA 3UIOB 3ZKJC 2W54A 1QOAA 2BF8B 3ZIMA 2O6VB 2KVZA 3DWMA 2N9PC 3BWUD 5BYSA 1FXTB 3DBRB 3QK0A 2W9NA 2WS3B 4DXGA 2DX5B 1C1YB 2WU5B 3WIMA 1UWMA 2BS3B 2C7HA 4G3XB 1ZUD2 4KIKB 2DYOA 4NZLB 3RFZB 2C5LC 1XCTL 1TYGB 3NS8A 2G4DB 3NVZA 1GJZA 2WDRB 3MC9A 5BMHA 2PE6B 2WNMA 3U4EG 1D5XC 1JQ4A 3JYUA 1MJDA 1P7EA 3H9DA 3TL5A 4W9LA 1K52A 2ON8A 2A5UA 2XK5A 1KF6B 4W9JA 4ANVA 2LUEA 3A1QA 5GMVA 2AQ1B 2LUMA 2N1WA 2KN4A 1WX8A 5DPWA 4NNJB 3R7QA 3PRPB 3FKYA 4ANXA 3ZTCA 1KRHA 5AZGA 2BKRB 1LM8B 1V1OA 2LVQA 4HEA1 4KX6B 2KANA 1GG3A 4HJGE 1SSNA 1ACCA 3AE7B 2AEHA 4II2B 3ZQ4A 3AV8A 2BB5A 2WLBA 4X57B 5D3DA 5EDSA 2D10A 1YN3A 3HM6X 3NY5A 3VTUA 3X0WA 2MW5A 1BMLC 2MSED 3ZO5B 3ENEA 2PTLA 3BK2A 3Q3NC 2V3SA 1NVID 3K9PB 4EFOA 5CHVC 2KMCA 2WXJA 2FUG1 4W9HA 1P0RA 2GBMA 3BVMA 5G5GA 3GE8C 2QCZA 1V1PA 3ZXRA 4AJYB 1SGHA 2KQ4X 3PGEA 3V61A 1M94A 2PVGC 1TZOA 1EUVB 1GNUA 1NENB 2IO0B 2K25A 2KHWB 2CJNA 3H1UA 4N58A 4RCOA 1IBXB 2K6QA 4US8A 1TGZB 4HJKA 4NQKE 2HJ8A 1Y8RC 4URKA 3DOWA 3KVFB 2LHDA 4KGSA 1WJ4A 2DENB 3TSSA 1L0XB 3ONSA 1FMAD 3IG3A 1WX9A 3ZVVA 2KWVB 3ZNGC 2LXAA 3ZLZA 1EF1A 2FCMA 4GN1A 1SJED 3V05A 4DDGD 1C4AA 3OAWA 1I4HA 5D6JB 3KYDD 1F9JA 2BVCA 3QAQA 2ZCBA 3VUXA 1V9JA 3W2DA 2IGHA 2WXPA 2J52A 5TSSA 4LJPB 3SFDB 4E3CA 1G6JA 2KDFB 3NVVA 2DAFA 1VRAB 2KWUB 2KDIA 1CJEA 4ZRJA 2KJHB 1YX5B 4WQOB 3DQVA 1A5RA 2BBCA 3I9V1 3IBEA 4GDKA 2SEBD 4TQ0A 4EKUA 3V60A 3MP9A 4US9A 2FE8A 3KUZA 4ZRQA 1V5OA 1SEBD 3VR8B 2ASQA 1V6EA 2KACA 2XEWA 5T8IA 3ZJTA 1P3QU 1SIJA 2LGIA 2K3UA 1E90A 3ABVB 3NVWA 2ZEQA 1MHXA 3FILA 3W5VB 3PLVA 2LGSA 4ZYNA 2E3TA 4BZAA 3HK0A 2WDVB 4I6NB 5HFYA 4WQMA 3AN1A 4LDTD 3PSEB 3Q8EA 4Q2JA 2L7RA 3RNAC 4DHZE 1E9MA 1QKZA 4EEWA 2IGGA 2GB1A 3PS6A 5DPRA 3ZRFA 2DZKA 1P1AA 5JHAA 1CQVA 3H7PA 4YSXB 1FXIA 4C56C 2BB6A 3Q8AA 4HXDA 3ZNHB 3B9JA 4XYCA 1L4ZB 1UF0A 2ZVNA 2D07B 3A9KB 2WXRA 3QX1A 1YX6B 2G1EA 3W5UB 1N63A 3OG5A 1B9RA 2NCNA 5C3JB 2KC2A 2FIDA 1WGDA 2ZW1A 3N1YC 1QLBB 1C77A 1EM7A 3N1ZC 5J2RA 2J53A 1LXDA 1ZXIA 2UYZB 2FCSA 3P4RB 2KKCA 2RGFA 3ZTDA 3DHIC 5H92C 4USAA 4ZRKA 2VZKD 3RI7C 2CKHB 2K22A 3EECA 1FNWA 1IGCA 4IOIE 5D94A 4DHJD 3TEXA 4AOFA 4HKZE 3U7DA 1WXMA 2HD5B 3HVZA 2MBQA 2I38A 1WE7A 4A6QA 1RM6C 2DNFA 4RGNA 1UH6A 1OTRB 1WGYA 2CS4A 2JPHA 3VH3B 3A1QB 3KWLA 2J4XA 5IN7A 1UUPA 3V6EB 5DPTA 1VZ7A 1EWYC 5AUIA 2W82A 2K8BA 2YEPF 2MX2A 2R2OA 2HTHA 1C4CA 1RAXA 4PT5A 1M4VA 2N7JA 3VRAB 1RLFA 3BIID 2O2VB 3MFGA 4ACFA 4AUQC 1DOXA 3B0AA 4ZRIA 1MFWA 2BS2B 3Q8FA 2GRIA 5H8YE 3PHXB 2WXLA 3QQ8B 2UU7A 2JWUA 2RDGA 2ZPYA 4XE0A 2MEKA 3NRZA 4S0RA 2TSSA 1WWTA 4REZA 3U2SC 3SD5A 1UGJA 3PTFC 2GBJA 2LVOA 4NAWA 1J8CA 1YJ1A 2Z0DB 2J0MA 4BKSA 3PO0A 5JZEB 1OFFA 4WWPA 1VZ8A 2IY1B 1ROEA 2W3RA 3AE8B 1AW7A 2WP9B 4LNOA 2KWCA 1KTKA 1PYWD 1WJ6A 2J7QB 2O2VA 1F2RI 2V9HA 4AWJA 2M1MA 2L76A 4BVUC 4XZ4A 1TY0A 2O6VA 2WX1A 4ANUA 3DVNV 4KV2A 3A4SC 4JQWC 2MJ3A 2N9EB 4HK2A 2BQQA 1QILA 4HCNB 4KDLB 1F0ZA 3MTNB 5AEKB 2WDQB 2H89B 3RNFC 2ONQA 4A3PA 2UWQA 5D2MB 2AQ2B 2MRPA 4HRSA 4YTNB 2JX5A 2DZJA 2L32A 1D5MC 4BAXA 5IKCM 4CQNA 3WAPA 3QIJA 4M8NA 2KFJA 5FK9C 1IBXA 3ZJVA 4RNAA 4KIKA 2NTTA 2DYBA 3QWZB 2DWQA 1Y56A 2LFIA 2J42A 1V1PB 1ZGUB 1X1MA 2V0GA 2RD0A 2GLSA 3AXCA 2KO3A 4TQ1A 4KKJA 3P4SB 5HG2A 1JRUA 2HDEA 1K50A 1XXGA 1VJKA 2AX5A 2KJ6A 3P1MA 2KTRB 2BWFA 2MA9B 2YLMA 2DBYA 4CYEA 1VCBA 2K9XA 1LGRA 2MBOA 1OQRA 4P6VF 1R4NB 4NJ6A 4WWMA 3LDZE 3RN9C 2KTFA 4KKIA 4LJOB 1WY8A 1HTOA 2NMQA 4GB9A 1I4XA 1T0QC 2CJOA 2GMIC 1FRDA 4LNKA 2INDC 3ZGZA 5JXVA 2N7DA 3PHWB 5L83A 3JSVA 1WXQA 5DCNA 1SE9A 4IWOA 3NZ3A 2LRUA 4W9EA 2N9LA 1K8RB 1QT9A 2M8SA 4BKSD 1VZ6A 2CHXA 4GDKB 1E6EB 2KK8A 3RZWC 4IWPA 3T8MA 1E0ZA 2AQ3B 2INPE 2RPVA 3AE2B 4A20A 3QJZA 3U7ZA 2V3NA 3WAMA 1IYFA 1TS2A 3Q3FA 3Q2AC 4GSWA 3M95A 2B3AA 3A33B 3AE4B 3UF8A 3T9LA 1TS3A 3FILB 4P1BC 3VFKA 3VRBB 2DHZA 4AJWA 4MJSB 2BGFA 3IT6B 4NAWB 3VXWA 4KSKC 1Q1OA 2M4NA 5G5HA 4ZYSA 2LHEA 3PVLA 2V4IB 3M63B 2KX3A 2CU3A 2JUOA 2BTEA 1TT5B 1JWMD 1Q0WB 1UWXA 2RDHA 1TKYA 2V1YA 3IAM1 3Q3MC 1OGWA 1WM2A 3KLSX 3URYA 2C7NB 3KUDB 1V5TA 3RCZA 2AL6A 4BBNC 3TEYA 4IC7B 1FPYA 3WAOA 3EHVA 1WJNA 3N3KB 2GI9A 1OEYA 1FNUA 1RWSA 2G45B 5FKAC 3RUIB 4GU2A 4F1SA 5J18A 1YMHE 4JE3B 3PPAA 5EE0A 1QQRA 3NG0A 4D2KA 5CHFA 3R66C 3HVDA 2L83A 1JALA 1MG4A 1BUIC 1JMLA 2RR9A 4E74A 4HPLB 3VHTC 2NVUI 2KX0A 1E10A 1SIFA 5BYRA 4II3B 4MGIE 1KJTA 3VTWA 2IO2B 4IWQA 3RMKC 3WA0A 4BFRA 3KYCD 2MH7A 4A9AA 1XD3B 4HPMB 2R61A 3L4PA 2LGYA 1TY2A 4C4VB 3BYYB 4IM0A 1I4GA 3ALBA 4YTMB 5L95C 4ZOHC 2QC8A 1CK1A 1WXSA 1V97A 3AI5A 3V3XA 1TS5A 2FNJB 4L2YA 5TR5A 3T3OA 2MP2A 2XK5B 4NAMA 2QEJC 3B08A 2IDYA 4FJZA 4LTUA 4JWSC 2FIFA 1S1QB 2PJHA 1PUTA 5C1ZA 2CU1A 2O6VD 4AP4C 1UELA 3ZW3A 4GDLA 1JWBD 2JZZA 4OVUA 1MVKA 5AUKA 1MHHE 1J7AA 1FNVA 1IUEA 2D2QA 3MC8A 3R7RA 4O1NA 1XO3A 1P98A 2L8JA 5E6NA 2MBBB 4FA6A 4FBJB 1ZP0B 1L6VA 1MI0A 3O65B 1JWAD 3TMPB 3N9YC 4FLHA 3S2AA 4WH4A 1Q10A 1WZ0A 3VAWA 2QILA 4IDIA 1WRIA 4TKNA 3AU5A 2LZ6A 3PRZA 1UZXB 3W9CB 1WF9A 1H4RA 5FR6A 4H2AA 2MJEA 1YQ3B 1N62A 1GUAB 2FAZA 2MQJA 2KJRA 4RF0A 1WGRA 1WH3A 2OOBB 3Q8CA 2M56B 3IVFA 2ZPNA 3CSFA 3RZFA 2W55A 2KDMA 2JSVX 1UD7A 2KZRA 3AEEB 4DHJB 1OQYA 2QDFA 4FJYA 4BKGA 4ZDVA 4XDCA 2ZCCA 1EU3A 3CIRB 5JHBA 1E7UA 3ZUNA 4JX1C 1FCCC 2KVRA 2L0TA 1TIFA 1C79A 4K7WA 1L2NA 1I4RA 4UDUC 1WSPA 2NPTB 4RM8A 4ARIA 3PZDA 3CWIA 3BZDB 2C60A 5IP4D 1EF5A 3L54A 2D11A 3IAS1 3OWEB 2HJ1A 3LJ3A 3HUIA 4C80A 3M3JA 4R3DA 2PMVA 5E6OA 2Y5CA 1I35A 4HVBA 2EELA 2KMMA 2KOXA 3AE1B 5D7GA 3ZYYX 3QCAA 3AEFB 4GIVA 4K7SA 4GGQA 2BWES 2KAJA 3TCAA 4K1RB 2KFKB 5EE9A 4WWNA 2DYMA 3SFEB 4J6IA 5IAAC 3NUHB 3RD2A 3EUB2 1L5PA 4RGOS 1YJJA 4FHKA 3DVGX 2WXKA 4OZBA 3A4RA 1QOGA 1N60A 5CX3A 4HWIB 1FCLA 4MH8A 3HIZA 4HKQA 2V4LA 1I7HA 2K5PA 2GBKA 1VD2A 4GOCA 3J9CA 4P1CC 3VUWA 1HZ5A 2WXNA 3PLUA 2VH1A 4DXFA 3QC8B 1IGDA 1STEA 3PT2B 4M02A 2IBIB 3C0RB 3AE6B 2N7EA 1YNTE 2PKOA 2RMMA 1KFYB 2LJ5A 1EO6A 1HQRD 4W9GA 2PIAA 4PYZA 1R4MI 3ZXVA 4CO7A 3DBHI 1MG8A 4M0WA 2K6DB 4RGMA 4HDQA 4PS7A 1CMXB 1FD6A 2LJIA 3GOEA 3RPFC 3ZDTA 1AYFA 3Q69A 1QOBA 2B76B 3SU8X 2Y5BB 3P63A 3BVZA 4FULA 3B2FA 3LB8C 2ZZPB 2L1AA 3H6NA 1NDDA 4DK5A 2OHFA 4MJSA 1GC6A 3NOBA 5KHOA 1TZ1A 3AE3B 1AN8A 1C9FA 1KH0A 3AEBB 1P7FA 4DDID 3BVGA 1FO4A 4MELA 4PS3A 3ZRCA 5DPSA 1BXTA 3CMMB 1TBEA 4BOZB 1NI2A 3RNEC 3U30A 4HROA 2WXOA 1NYQA 5AZFA 1UGMA 3N32A 3VQIA 3WALA 1PDXA 4ZHOA 1F77A 2N1VA 4M00A 2JF5A 2FUHB 1E8WA 4OVVA 1SXTA 2FCNA 4C7ZA 2CHWA 3NJTA 2LI5A 3GB1A 4WAFA 4HDOA 1JROA 1UBIA 2ACZB 2M0XA 1DOYA 1I4QA 2PPHA 2WQYB 5HKHA 2IO1B 4OVZA 5I4DA 3MHSD 2PEAA 3VR9B 3APFA 4DHZB 3AMZA 3H7PB 1GOZA 2ZVOA 2BYTA 1TJEA 1FFVA 3PRMB 1JWUD 2M17A 3FAHA 3DHGC 1WRDB 1CZPA 4ITKA 3SHQA 3IFWB 1C4PA 4L1BA 2K8HA 1SE2A 1XCQL 1YIWA 3AECB 4TSSA 5BMIA 2WXHA 3NS1A 2C9WB 2WXFA 3V6CB 3X23A 2E6XA 3EFUA 4YSYB 1TKEA 4RGTA 2LD9A 4KVGB 1GC7A 4N59A 1YOVB 1GB4A 1ZDXA 3BYTB 3NZSA 1SBBB 3W1SC 2N0SB 2MBHA 2IYDB 3NVYA 5HI1A 1NYRA 3JW0X 4FXCA 4EZLA 4KGRA 3LYYA 2JQRB 2WGSA 1NEKB 4JIOU 2WHIA 1HTQA 2EMTA 3AM9A 3DCGA 1B1ZA 1L4DB 3PZ8A 1WIAA 1TTNA 1KM7A 2WXIA 4A3OA 3T3NA 1KLUD 3GE3C 4WWOA 4YXDB 4E71A 4WJOA 2FBWB 1SB3C 2V3PA 1JRPA 3KWVA 2KDEB 3NHEB 1T5XD 4LNNA 3D32A 2WXQA 3GP7A 2G4SA 1C3TA 5LLIA 1FRRA 2PW9A 2LMCA 2MHJA 3GS2A 3MJWA 4CHKA 4F7ZA 1DOIA 1N6ZA 1PGXA 2LGXA 2JVCA 4WJPA 4YL8A 1WFYA 4RH6A 2BYVE 3KH0A 1ESFA 2CHZA 3ETRA 1FM0D 2KC1A 4RMAA 2K0PA 2OEDA 4MEMA 5BMGA 2IY0B 2REXA 4WAAA 1N61A 3O13A 1V86A 2Y3AA 2EMSA 3P4PB 5G55A 2IJ0A 3AE9B 4B0EA 3DVNU 5LXIB 3R8BA 1MPEA 4FADA 4JPSA 4NY0A 1E7PB 2HE7A 3M62B 1WZ3A 4FN2A 1R4MB 3IXSA 3R3MA 1XT9B 3GZNB 3A9JB 4GDLB 4MSMB 4BKTA 2KT7A 1GAQB 1ZKHA 1WR6E 4YWGG 4ARCA 1RRBA 4AQ7A 2I1JA 2NBUA 2N9XA 1YQBA 2NTSA 2OJWA 4I6LB 4N6EB 2IO3B 4GXBA 1LQBA 4MH0E 1ZDVA 2IGDA 1PGBA 2JXXA 3ZJUA 4RFBA 4C00A 3PV1A 2LVPA 4OZCA 2J0JA 2QHOA 1ZOYB 4K3CA 3MC0B 2KFKA 4HCPB 1XQQA 3GZNI 2VZKB 4IKGA 4P7IA 1V80A 1K53A 3QHTA 2IZVB 2KWDA 4ICUA 3A9JA 1OEYJ 2ICIA 4XGAB 3RYTA 3B1LX 2M0AA 4OW0A 2JYEA 4WJQA 1WR1A 1GPXA 2R2QA 2MWSB 2MJDA 4K81A 3W1YA 3U8ZA 2KMAA 1NBFC 4NQLB 4PK1A 4ZRPA 2KTRA 2INNE 2YEPB 1OQQA 1UNSA 3I63C 2X38A 1I42A 4LCDE 1SF0A 2KYWA 2BKFA 3TEZA 2NBWB 3VTVA 4LNIA 2WYQA 4DQOC 1SE4A 3QARA 1C78A 4P16A 1E8XA 5AZHA 4S17A 3AE5B 3R2IA 3ZDMC 2QMTA 4M0WB 1WM3A 1D4BA 1QOFA 3OJ3A 3IT4B 1T3QA 1RYJA 1ZE3D 1E7VA 4MT5A 3ZNZB 3SEBA 4C7YA 4MGYE 4G0NB 4NPNA 2N4FA 1FEHA 2YVCA 1RFKA 4KGTA 1TS4A 2AYOB 4HPPA 2PE9A 3DBSA 2ZW0A 1XEEA 3SR6A 1ISNA 4RF1A 1IPGA 2WU2B 1ET6A 4MSQB 4MDKE 4M8MA 3Q14C 3WANA 2JZ3B 1EU4A 1A70A 4J3OD 1JW9D 2LRWA 2K39A 1TKGA 3ML8A 1WJUA 4L23A 3AULA 2BPSA 3L16A 3AEGB 2LGDA 2BT6A 1XLNA 3DHHC 2L05A 2Y5PA 4DWFA 1LFDA 4I6PA 4G11A 1VDVA 2I1KA 2JRIB 1WGGA 5C2TB 1WE6A 4IW0A 5BYQA 1PQSA 3FC4A 1R4NI 2H88B 4EE2A 1WGKA 4XC2A 4W9KA 4LK0M 2BYFA 2RDBC 3SDLC 3E56A 3WCQA 3Q3OC 4MGKE 1SJHD 2J0KA 3L17A 1J19A 3BINA 3EA6A 3OLMD 4KZCA 1V81A 3V62A 3P2BA 2QIEB 4JGHB 3L0WB 2I2YA 3PZ7A 4EUTA 4IUMB 2JT4B 4K3BA 3EGRA 3TBLD 3ML9A 2KNBA 4JLCA 1WMHB 3UQBA 1YJIA 2C7MB 3OJ4B 4TV3A 1U4AA 4BOSC 4A55A 4YT0B 1FIQA 4WJNA 4B0MA 3VUYA 3UIPB 4ASWC 4LNFA 5LXHA 3AEDB 3KQ4A 4WIPA 1HE8A 4OZAA 3UINB 4YSZB 2IPKD 2LXCA 3EFCA 2BW2A 3ZNID 5D3IB 3MHZA 3DBLB 4XWWA 4MM3B 2WXMA 4W9IA 1J7CA 2JWZA 3RNBC 2KQ7A 2G9HD 2QSDA 1GB1A 4HLEA 4ANWA 2NPTA 3BY4B 2D5GA 2KN5A 4QAYA 1WXVA 1XLQA 4B6WA 1F52A 4EZKA 1SE3A 1XLPA 3AEAB 4ICVA 4A8XC 3LXFA 5JH5C 3I57A 2OJRA 4W9FA 2GBRA 3KUCB 2GOWA 2L0FA 3HRDD 2K1FA 4A90A 1D5ZC 1BT0A 3DBLI 3TEWA 2DZIA 2MLBA 3VH4B 2RSUA 4PS8A 2QJLA 4PYUA 2XN9C 1JCKB 1RFAA 2GBNA 3UQAA 4KSLC 4IM3A 2MBEA 2XNAC 3HM3A 1KOTA 1Z5SB 1WYWB 2Z59B 1D6EC 4B9KA 1PFDA 1J7BA 2G3QB 1KLGD 3PREA 3JVZX 3P42A 1VR9A 3UI3A 3RNGC 1Z2MA 2VRRB 1YD8U 1P9DU 1E8ZA 1LO5D 5G2NA 4MM3A 2D3BA 2WDTB 3L08A 5FR3A 1R7SA 1F1HA 5C23A 1XF5L 2M19A 4NJ7A 3Q8BA 1AARA 4N9F4 3L10B 2MCNB 2K8CA 2PVOD 2D3GA 2BS4B 1YN4A 2JZPA 3IHPC
chains in the Genus database with same CATH topology
2FBWB 1SB3C 3AB5A 3H8HA 2V3PA 1JRPA 1NI3A 1E10A 3KWVA 2KACA 1T5XD 5BYRA 5T8IA 1ZXHA 3ZJTA 2WXQA 3GP7A 2PLPA 4GLSC 1SIJA 2LGIA 2K3UA 3ABVB 3NVWA 1FRRA 2PW9A 1MHXA 2LMCA 3GS2A 3FILA 3W5VB 2MH7A 2Q5WD 4A9AA 2E3TA 2R61A 1DOIA 2WDVB 3L4PA 1PGXA 5HFYA 1TY2A 3BYYB 4WQMA 1I4GA 3AN1A 4YTMB 3Q8EA 4RH6A 4Q2JA 4ZOHC 1ESFA 3ETRA 1CK1A 1EWCA 1FM0D 1V97A 3V3XA 1E9MA 1ENFA 1FFUA 1QKZA 1TS5A 2K0PA 2OEDA 4L2YA 1YN5A 1YQ4B 5BMGA 3T3OA 4NAMA 1AWDA 2IGGA 1V8CA 1N61A 2QEJC 3O13A 1QF6A 2IDYA 4LTUA 2GB1A 2Y3AA 4JWSC 3P4PB 2N9KA 2IJ0A 3AE9B 4B0EA 1PUTA 5EE3A 1HXYD 3R8BA 1MPEA 1JWBD 5GXGB 4JPSA 1CQVA 1E7PB 1MVKA 5AUKA 1XLOA 1T6BX 4YSXB 1MHHE 1J7AA 1FNVA 1IUEA 1FXIA 4C56C 1PGAA 2BB6A 3MJ5A 3Q8AA 4WURA 3P4QB 3IXSA 4GDLB 5HHDG 2JU6X 3W1SA 3B9JA 4O1NA 1GAQB 1L4ZB 1XO3A 4YWGG 4ARCA 2HTME 1ZP0B 4AQ7A 1L6VA 2WXGA 1MI0A 2WXRA 2NTSA 1JWAD 3N9YC 2G1EA 3W5UB 1N63A 4MACA 1B9RA 1FXAA 4N6EB 1N5WA 5C3JB 4WH4A 1Q10A 2QILA 2ZW1A 1WRIA 4IDIA 1ZDVA 2IGDA 1QLBB 1PGBA 1C77A 3DWGC 1EM7A 4JWUC 3ZJUA 4RFBA 3W9CB 2JXTA 1DGJA 1C76A 2W3SA 2J53A 4H2AA 1ZXIA 4OZCA 2MJEA 1YQ3B 1N5XA 1ZOYB 3P4RB 1N62A 3MC0B 5H92C 4USAA 4RF0A 2VZKB 4IKGA 2VZKD 2M56B 1K53A 3Q8CA 5LNK1 2DLBA 2K22A 1ET9A 2KWDA 2W55A 1FNWA 1HEZE 1IGCA 2SAKA 2KDMA 4IOIE 2ICIA 1HZ6A 4AS1A 2JSVX 2M0AA 4OW0A 3TEXA 3AEEB 2JYEA 1L0VB 1I4PA 1GPXA 4HKZE 4NJCA 2MJDA 3HVZA 4XDCA 2I38A 4A6QA 1RM6C 4RGNA 1EU3A 4ZRPA 3CIRB 3U52E 2INNE 2YEPB 1OQQA 1UNSA 3C8YA 4JX1C 1DYQA 2X38A 1FCCC 3E9SA 1ZPSA 3KWLA 2J4XA 1C79A 1F2RC 1UUPA 1L6UA 1SF0A 1EWYC 1VZ7A 5AUIA 1I4RA 2W82A 4UDUC 5E6JA 1JWSD 2YEPF 1WSPA 1C4CA 4ARIA 3R2TA 4PT5A 3TEZA 3CWIA 1M4VA 3BZDB 2N7JA 4DQOC 1SE4A 1C78A 3VRAB 3IAS1 4P16A 3OWEB 3BIID 3AE5B 3MFGA 3R2IA 4C80A 2EKIA 3HUIA 2QMTA 2Z8LA 4TMAB 1DOXA 1D4BA 1QOFA 3IT4B 1T3QA 1RYJA 2BS2B 3Q8FA 1HA5A 4R3DA 1ZE3D 2GRIA 5H8YE 2WXLA 2PMVA 2JYTA 2Y5CA 2JWUA 1VLBA 2RDGA 4MT5A 4XE0A 3SEBA 2MEKA 4XDDA 3NRZA 1WYGA 2TSSA 2EELA 4C7YA 2KMMA 2L52A 3AE1B 1WWTA 5D7GA 1FEHA 4KGTA 1RFKA 4REZA 1TS4A 3U2SC 3ZYYX 3AH7A 1UGJA 3AEFB 3BK1A 4YTPB 4OHJA 3PO0A 2ZW0A 2KAJA 4ZHPA 1OFFA 1K51A 1XEEA 5EE9A 2DYMA 1VZ8A 3SFEB 3TUOA 3SR6A 3B2GA 4RF1A 3NUHB 3EUB2 2WU2B 4LLGM 2LEKA 1ROEA 2W3RA 1ET6A 5EE1A 5MPOA 1L0YB 1L5PA 4XWTA 4RGOS 1YJJA 2W54A 3AE8B 1EU4A 1AW7A 1A70A 2WP9B 4J3OD 1KTKA 1PYWD 2WXKA 4OZBA 1JW9D 1QOAA 1QOGA 1N60A 1F2RI 1FCLA 1TKGA 4MH8A 3DWMA 4HKQA 1I7HA 1TY0A 4L23A 3BWUD 5BYSA 2K5PA 2MJ3A 2WS3B 4DXGA 3AEGB 1QILA 3J9CA 2WU5B 1F0ZA 1HZ5A 2WXNA 1UWMA 2BS3B 4DXFA 2BT6A 2H89B 2WDQB 2ONQA 1XLNA 2Y5PA 2AQ2B 1IGDA 4HRSA 4YTNB 2JX5A 1STEA 2L32A 1VDVA 1D5MC 3AE6B 4CQNA 1ZUD2 1YNTE 2PKOA 5C2TB 1IBXA 5FK9C 2RMMA 1KFYB 2DYOA 4NZLB 3RFZB 3ZJVA 1HQRD 2PIAA 1XCTL 4RNAA 1TYGB 5BYQA 2NTTA 4M0WA 3NVZA 4RGMA 3FC4A 2DWQA 1Y56A 2WDRB 2LFIA 1FD6A 2H88B 2J42A 5BMHA 2WNMA 4EE2A 1WGKA 3U4EG 1V1PB 2LJIA 4LK0M 1D5XC 3RPFC 1AYFA 1JQ4A 2V0GA 3Q69A 1QOBA 3E56A 3WCQA 4TQ1A 2B76B 4KKJA 3P4SB 1P7EA 5HG2A 1SJHD 3BVZA 3P63A 1K52A 3B2FA 3LB8C 2HDEA 2ON8A 3EA6A 1KF6B 2L1AA 1K50A 1XXGA 1VJKA 2AX5A 3P1MA 2QIEB 2I2YA 2DBYA 3PZ7A 2AQ1B 2LUMA 2KN4A 2K9XA 2OHFA 1OQRA 3EGRA 4P6VF 3AE3B 1AN8A 1KRHA 1C9FA 1KH0A 4WWMA 4KKIA 3AEBB 1P7FA 1YJIA 3BVGA 2NMQA 1V1OA 1FO4A 1I4XA 4A55A 4HEA1 1FIQA 4YT0B 2CJOA 4KX6B 1FRDA 4B0MA 4HJGE 1SSNA 1ACCA 3AE7B 3ZQ4A 3ZGZA 5JXVA 3AEDB 3KQ4A 3AV8A 4WIPA 4OZAA 2BB5A 1WXQA 2WLBA 5D3DA 4YSZB 1BXTA 2IPKD 1YN3A 2BW2A 4HROA 5D3IB 2WXOA 3NZ3A 3MHZA 1NYQA 4XWWA 4MM3B 3VQIA 2N9LA 1BMLC 2WXMA 1J7CA 1QT9A 1VZ6A 4GDKB 1PDXA 4ZHOA 1F77A 2PTLA 1E6EB 2G9HD 3BK2A 2QSDA 1GB1A 1SXTA 4C7ZA 1NVID 1E0ZA 3GB1A 2D5GA 4WAFA 2AQ3B 2INPE 1JROA 2ACZB 2WXJA 1DOYA 2RPVA 3AE2B 2FUG1 1I4QA 1XLQA 3U7ZA 2WQYB 2V3NA 3BVMA 5G5GA 1SE3A 1XLPA 3AEAB 4OVZA 4A8XC 5I4DA 1TS2A 3LXFA 3VR9B 1V1PA 3I57A 3AE4B 2KQ4X 3AMZA 1TS3A 3FILB 1GOZA 2PVGC 1TZOA 3HRDD 4A90A 1D5ZC 3VRBB 2BYTA 1NENB 1TJEA 1FFVA 4NAWB 3IT6B 3TEWA 2CJNA 1IBXB 4N58A 4RCOA 1JWUD 3FAHA 4US8A 2QJLA 1CZPA 5G5HA 4ZYSA 2LHEA 2V4IB 2XN9C 1JCKB 4ITKA 2CU3A 1C4PA 4L1BA 1SE2A 1XCQL 2BTEA 3AECB 4TSSA 1JWMD 1UWXA 2LHDA 2RDHA 2XNAC 5BMIA 1TKYA 2WXHA 4KGSA 3TSSA 3NS1A 2WXFA 3IAM1 1L0XB 2E6XA 1D6EC 3KLSX 4YSYB 3URYA 1FMAD 1TKEA 1PFDA 4RGTA 1J7BA 1SJED 3V05A 1C4AA 4N59A 1I4HA 1KLGD 3TEYA 1GB4A 3P42A 1ZDXA 3BYTB 1VR9A 1SBBB 3UI3A 2N0SB 3W2DA 2GI9A 2IGHA 1FNUA 1LO5D 2WXPA 2J52A 3NVYA 5HI1A 5TSSA 1NYRA 4FXCA 4KGRA 3LYYA 3SFDB 1RWSA 2JQRB 5FKAC 1YMHE 3NVVA 4JE3B 5FR3A 1R7SA 1NEKB 1VRAB 5EE0A 1QQRA 4D2KA 1CJEA 3AM9A 1XF5L 2M19A 3HVDA 3Q8BA 1B1ZA 2BBCA 2L83A 3I9V1 1JALA 1L4DB 3PZ8A 2SEBD 1BUIC 4TQ0A 1JMLA 3MP9A 2WXIA 2PVOD 3T3NA 4US9A 2FE8A 1KLUD 4ZRQA 2BS4B 1YN4A 4YXDB 1SEBD 2JZPA 3VR8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7C A;  1QT9 A;  1SB3 C;  2FBW B;  3AB5 A;  1JRP A;  1NI3 A;  1ZXI A;  2MJE A;  1E10 A;  1JW9 D;  1QOA A;  1N5X A;  1YQ3 B;  1ZOY B;  3P4R B;  1QOG A;  1N62 A;  1N60 A;  1PDX A;  4ZHO A;  1TKG A;  1E6E B;  3DWM A;  4USA A;  5H92 C;  1I7H A;  2K5P A;  4C7Z A;  1NVI D;  2M56 B;  2MJ3 A;  1SIJ A;  2WP9 B;  2WS3 B;  2K22 A;  3ABV B;  3NVW A;  1FRR A;  2W55 A;  3AEG B;  1E0Z A;  2WU5 B;  1F0Z A;  1JRO A;  2ACZ B;  3W5V B;  2MH7 A;  1UWM A;  2BS3 B;  2Q5W D;  1DOY A;  3AE2 B;  2BT6 A;  2H89 B;  2WDQ B;  1XLQ A;  1XLN A;  2WQY B;  2E3T A;  3AEE B;  4A9A A;  1L0V B;  4HRS A;  4YTN B;  1GPX A;  2JX5 A;  5G5G A;  1DOI A;  2WDV B;  3L4P A;  1XLP A;  3AEA B;  1VDV A;  2MJD A;  3HVZ A;  3LXF A;  3AE6 B;  4WQM A;  1ZUD 2;  3AN1 A;  3VR9 B;  2PKO A;  1RM6 C;  5C2T B;  4YTM B;  1B9R A;  1KFY B;  3AE4 B;  2PIA A;  4ZOH C;  1TYG B;  3CIR B;  3ETR A;  1FM0 D;  1OQQ A;  3AMZ A;  4JX1 C;  1V97 A;  3NVZ A;  3FC4 A;  1FFU A;  1E9M A;  2DWQ A;  2PVG C;  2WDR B;  3HRD D;  3KWL A;  3VRB B;  1NEN B;  1TJE A;  1YQ4 B;  1FFV A;  2H88 B;  1L6U A;  1WGK A;  2CJN A;  1SF0 A;  1AWD A;  4N58 A;  1EWY C;  3FAH A;  5AUI A;  4US8 A;  1V8C A;  3RPF C;  1AYF A;  1N61 A;  2QJL A;  1JQ4 A;  1CZP A;  5G5H A;  1QF6 A;  1QOB A;  4ITK A;  4LTU A;  3WCQ A;  2B76 B;  3P4S B;  2CU3 A;  4JWS C;  3P4P B;  3CWI A;  3P63 A;  3AE9 B;  1PUT A;  5EE3 A;  3B2F A;  3LB8 C;  3VRA B;  3AEC B;  1KF6 B;  3BII D;  3AE5 B;  1TKY A;  1JWB D;  5GXG B;  2AX5 A;  1VJK A;  2EKI A;  3HUI A;  2QIE B;  3NS1 A;  1E7P B;  3P1M A;  4C80 A;  4YSY B;  5AUK A;  2DBY A;  1FMA D;  1XLO A;  4YSX B;  1DOX A;  1J7A A;  1TKE A;  1PFD A;  1IUE A;  1QOF A;  2K9X A;  1J7B A;  1FXI A;  1T3Q A;  1RYJ A;  2BS2 B;  2OHF A;  5H8Y E;  1OQR A;  3P4Q B;  4N59 A;  4P6V F;  2Y5C A;  3AE3 B;  1KRH A;  3B9J A;  1VLB A;  1GAQ B;  2N0S B;  4WWM A;  1XO3 A;  3NRZ A;  1WYG A;  3AEB B;  1YJI A;  3NVY A;  4C7Y A;  2KMM A;  1NYR A;  2L52 A;  3AE1 B;  4FXC A;  1WWT A;  3SFD B;  1RFK A;  1RWS A;  2JQR B;  3ZYY X;  2HTM E;  1ZP0 B;  3AH7 A;  1L6V A;  1FO4 A;  3AEF B;  4YT0 B;  1FIQ A;  1JWA D;  3NVV A;  2CJO A;  4YTP B;  2G1E A;  3W5U B;  1N63 A;  1FRD A;  1NEK B;  1FXA A;  1R7S A;  3PO0 A;  2KAJ A;  4KX6 B;  4N6E B;  5EE0 A;  4ZHP A;  1N5W A;  1OFF A;  3AE7 B;  1CJE A;  5EE9 A;  3SFE B;  5C3J B;  3AM9 A;  3SR6 A;  2M19 A;  3AED B;  3B2G A;  3AV8 A;  2L83 A;  4IDI A;  1WXQ A;  1JAL A;  1WRI A;  2WLB A;  2WU2 B;  3EUB 2;  4YSZ B;  2LEK A;  1QLB B;  1ROE A;  2W3R A;  5EE1 A;  5MPO A;  3DWG C;  2PVO D;  1L5P A;  4HRO A;  4JWU C;  4US9 A;  3W9C B;  1NYQ A;  2BS4 B;  4YXD B;  1YJJ A;  1DGJ A;  2W54 A;  2W3S A;  3AE8 B;  1A70 A;  3VR8 B; 
#chains in the Genus database with same CATH topology
 3AB5 A;  3H8H A;  2KLC A;  1NI3 A;  4F8C B;  1ZXH A;  3H7S A;  1E5W A;  2PLP A;  4GLS C;  3JSV B;  2XBB C;  2ZJD A;  2Q5W D;  2NR2 A;  3CST A;  4EZJ A;  2JY6 A;  1V49 A;  1L7Y A;  3CF6 E;  4LDT B;  4JL9 A;  1EWC A;  1T0S C;  3A9K A;  1ENF A;  1FFU A;  3N1X C;  1YN5 A;  1YQ4 B;  5BO4 B;  1AWD A;  1V8C A;  1WGH A;  4G50 A;  1QF6 A;  1E8Y A;  3EC8 A;  2N9K A;  1KLV A;  5EE3 A;  5KHQ A;  2L3Z A;  4FJV B;  1HXY D;  3I5J C;  2INC C;  5GXG B;  2ZNV B;  2KQS A;  2X8X X;  1XLO A;  1T6B X;  1J0G A;  2LWP A;  1PGA A;  3MJ5 A;  4WUR A;  3P4Q B;  2D3C A;  5HHD G;  2JU6 X;  3I3T B;  3W1S A;  2WX0 A;  1QZE A;  2BYE A;  2AL3 A;  4GMV A;  1D3Z A;  2HTM E;  2WXG A;  2A4Z A;  4MGZ E;  3TIX A;  5J17 A;  3KW5 B;  3APD A;  4M01 A;  4MAC A;  1FXA A;  1N5W A;  1WX7 A;  2NBV B;  1UBQ A;  1S3S G;  2L00 B;  4BBN F;  3C19 A;  1T0Y A;  3DBH B;  3RNC C;  3DWG C;  4JWU C;  2JXT A;  3RT3 B;  1DGJ A;  1C76 A;  4W9D A;  2W3S A;  4W9C A;  2WWZ A;  1ZW7 A;  2ZNV C;  1N5X A;  2RPQ A;  2JRH A;  3AU4 A;  5LNK 1;  2DLB A;  2LAS A;  1ET9 A;  2D3A A;  4IG7 B;  1HEZ E;  2SAK A;  1HZ6 A;  4AS1 A;  3VDZ A;  4TUU A;  2DAJ A;  2DZM A;  1L0V B;  1I4P A;  3QA8 A;  5CHW A;  5E6P A;  4NJC A;  2AWT A;  3DPD A;  1WI0 A;  2CR5 A;  4K7U A;  3U52 E;  5IA7 A;  3C8Y A;  4FHJ A;  1DYQ A;  3VVW B;  3N20 C;  3E9S A;  1ZPS A;  4DXA B;  1F2R C;  5IO9 A;  1L6U A;  4B95 A;  1WXA A;  1T0R C;  4KDI C;  1Q5W B;  3NZU A;  3DBR I;  1WMH A;  5IOI A;  5E6J A;  4KZ0 A;  1JWS D;  5CTR C;  3Q3J A;  3K9O B;  4C4V A;  3R2T A;  3DVG Y;  3L13 A;  2EKI A;  3APC A;  2Z8L A;  2KD0 A;  1H8C A;  4TMA B;  4IM2 A;  3HHM A;  1V2Y A;  2MP2 B;  1HA5 A;  3RUL A;  2JYT A;  2KLG A;  2VH2 A;  1VLB A;  2Z0E B;  4XDD A;  1WYG A;  3Q6B A;  2L52 A;  4EOY A;  3DDC B;  2EKE C;  4RM9 A;  3AH7 A;  3TJP A;  3BK1 A;  2FCQ A;  1IP9 A;  2KDB A;  4YTP B;  2NS5 A;  4OHJ A;  2KXJ A;  4XX5 A;  3UGB B;  4ZHP A;  1K51 A;  3TUO A;  3B2G A;  3ECI A;  4LLG M;  3N30 A;  2LEK A;  5EE1 A;  5MPO A;  1L0Y B;  4DBG A;  4XWT A;  3UIO B;  3ZKJ C;  2W54 A;  1QOA A;  2BF8 B;  3ZIM A;  2O6V B;  2KVZ A;  3DWM A;  2N9P C;  3BWU D;  5BYS A;  1FXT B;  3DBR B;  3QK0 A;  2W9N A;  2WS3 B;  4DXG A;  2DX5 B;  1C1Y B;  2WU5 B;  3WIM A;  1UWM A;  2BS3 B;  2C7H A;  4G3X B;  1ZUD 2;  4KIK B;  2DYO A;  4NZL B;  3RFZ B;  2C5L C;  1XCT L;  1TYG B;  3NS8 A;  2G4D B;  3NVZ A;  1GJZ A;  2WDR B;  3MC9 A;  5BMH A;  2PE6 B;  2WNM A;  3U4E G;  1D5X C;  1JQ4 A;  3JYU A;  1MJD A;  1P7E A;  3H9D A;  3TL5 A;  4W9L A;  1K52 A;  2ON8 A;  2A5U A;  2XK5 A;  1KF6 B;  4W9J A;  4ANV A;  2LUE A;  3A1Q A;  5GMV A;  2AQ1 B;  2LUM A;  2N1W A;  2KN4 A;  1WX8 A;  5DPW A;  4NNJ B;  3R7Q A;  3PRP B;  3FKY A;  4ANX A;  3ZTC A;  1KRH A;  5AZG A;  2BKR B;  1LM8 B;  1V1O A;  2LVQ A;  4HEA 1;  4KX6 B;  2KAN A;  1GG3 A;  4HJG E;  1SSN A;  1ACC A;  3AE7 B;  2AEH A;  4II2 B;  3ZQ4 A;  3AV8 A;  2BB5 A;  2WLB A;  4X57 B;  5D3D A;  5EDS A;  2D10 A;  1YN3 A;  3HM6 X;  3NY5 A;  3VTU A;  3X0W A;  2MW5 A;  1BML C;  2MSE D;  3ZO5 B;  3ENE A;  2PTL A;  3BK2 A;  3Q3N C;  2V3S A;  1NVI D;  3K9P B;  4EFO A;  5CHV C;  2KMC A;  2WXJ A;  2FUG 1;  4W9H A;  1P0R A;  2GBM A;  3BVM A;  5G5G A;  3GE8 C;  2QCZ A;  1V1P A;  3ZXR A;  4AJY B;  1SGH A;  2KQ4 X;  3PGE A;  3V61 A;  1M94 A;  2PVG C;  1TZO A;  1EUV B;  1GNU A;  1NEN B;  2IO0 B;  2K25 A;  2KHW B;  2CJN A;  3H1U A;  4N58 A;  4RCO A;  1IBX B;  2K6Q A;  4US8 A;  1TGZ B;  4HJK A;  4NQK E;  2HJ8 A;  1Y8R C;  4URK A;  3DOW A;  3KVF B;  2LHD A;  4KGS A;  1WJ4 A;  2DEN B;  3TSS A;  1L0X B;  3ONS A;  1FMA D;  3IG3 A;  1WX9 A;  3ZVV A;  2KWV B;  3ZNG C;  2LXA A;  3ZLZ A;  1EF1 A;  2FCM A;  4GN1 A;  1SJE D;  3V05 A;  4DDG D;  1C4A A;  3OAW A;  1I4H A;  5D6J B;  3KYD D;  1F9J A;  2BVC A;  3QAQ A;  2ZCB A;  3VUX A;  1V9J A;  3W2D A;  2IGH A;  2WXP A;  2J52 A;  5TSS A;  4LJP B;  3SFD B;  4E3C A;  1G6J A;  2KDF B;  3NVV A;  2DAF A;  1VRA B;  2KWU B;  2KDI A;  1CJE A;  4ZRJ A;  2KJH B;  1YX5 B;  4WQO B;  3DQV A;  1A5R A;  2BBC A;  3I9V 1;  3IBE A;  4GDK A;  2SEB D;  4TQ0 A;  4EKU A;  3V60 A;  3MP9 A;  4US9 A;  2FE8 A;  3KUZ A;  4ZRQ A;  1V5O A;  1SEB D;  3VR8 B;  2ASQ A;  1V6E A;  2KAC A;  2XEW A;  5T8I A;  3ZJT A;  1P3Q U;  1SIJ A;  2LGI A;  2K3U A;  1E90 A;  3ABV B;  3NVW A;  2ZEQ A;  1MHX A;  3FIL A;  3W5V B;  3PLV A;  2LGS A;  4ZYN A;  2E3T A;  4BZA A;  3HK0 A;  2WDV B;  4I6N B;  5HFY A;  4WQM A;  3AN1 A;  4LDT D;  3PSE B;  3Q8E A;  4Q2J A;  2L7R A;  3RNA C;  4DHZ E;  1E9M A;  1QKZ A;  4EEW A;  2IGG A;  2GB1 A;  3PS6 A;  5DPR A;  3ZRF A;  2DZK A;  1P1A A;  5JHA A;  1CQV A;  3H7P A;  4YSX B;  1FXI A;  4C56 C;  2BB6 A;  3Q8A A;  4HXD A;  3ZNH B;  3B9J A;  4XYC A;  1L4Z B;  1UF0 A;  2ZVN A;  2D07 B;  3A9K B;  2WXR A;  3QX1 A;  1YX6 B;  2G1E A;  3W5U B;  1N63 A;  3OG5 A;  1B9R A;  2NCN A;  5C3J B;  2KC2 A;  2FID A;  1WGD A;  2ZW1 A;  3N1Y C;  1QLB B;  1C77 A;  1EM7 A;  3N1Z C;  5J2R A;  2J53 A;  1LXD A;  1ZXI A;  2UYZ B;  2FCS A;  3P4R B;  2KKC A;  2RGF A;  3ZTD A;  3DHI C;  5H92 C;  4USA A;  4ZRK A;  2VZK D;  3RI7 C;  2CKH B;  2K22 A;  3EEC A;  1FNW A;  1IGC A;  4IOI E;  5D94 A;  4DHJ D;  3TEX A;  4AOF A;  4HKZ E;  3U7D A;  1WXM A;  2HD5 B;  3HVZ A;  2MBQ A;  2I38 A;  1WE7 A;  4A6Q A;  1RM6 C;  2DNF A;  4RGN A;  1UH6 A;  1OTR B;  1WGY A;  2CS4 A;  2JPH A;  3VH3 B;  3A1Q B;  3KWL A;  2J4X A;  5IN7 A;  1UUP A;  3V6E B;  5DPT A;  1VZ7 A;  1EWY C;  5AUI A;  2W82 A;  2K8B A;  2YEP F;  2MX2 A;  2R2O A;  2HTH A;  1C4C A;  1RAX A;  4PT5 A;  1M4V A;  2N7J A;  3VRA B;  1RLF A;  3BII D;  2O2V B;  3MFG A;  4ACF A;  4AUQ C;  1DOX A;  3B0A A;  4ZRI A;  1MFW A;  2BS2 B;  3Q8F A;  2GRI A;  5H8Y E;  3PHX B;  2WXL A;  3QQ8 B;  2UU7 A;  2JWU A;  2RDG A;  2ZPY A;  4XE0 A;  2MEK A;  3NRZ A;  4S0R A;  2TSS A;  1WWT A;  4REZ A;  3U2S C;  3SD5 A;  1UGJ A;  3PTF C;  2GBJ A;  2LVO A;  4NAW A;  1J8C A;  1YJ1 A;  2Z0D B;  2J0M A;  4BKS A;  3PO0 A;  5JZE B;  1OFF A;  4WWP A;  1VZ8 A;  2IY1 B;  1ROE A;  2W3R A;  3AE8 B;  1AW7 A;  2WP9 B;  4LNO A;  2KWC A;  1KTK A;  1PYW D;  1WJ6 A;  2J7Q B;  2O2V A;  1F2R I;  2V9H A;  4AWJ A;  2M1M A;  2L76 A;  4BVU C;  4XZ4 A;  1TY0 A;  2O6V A;  2WX1 A;  4ANU A;  3DVN V;  4KV2 A;  3A4S C;  4JQW C;  2MJ3 A;  2N9E B;  4HK2 A;  2BQQ A;  1QIL A;  4HCN B;  4KDL B;  1F0Z A;  3MTN B;  5AEK B;  2WDQ B;  2H89 B;  3RNF C;  2ONQ A;  4A3P A;  2UWQ A;  5D2M B;  2AQ2 B;  2MRP A;  4HRS A;  4YTN B;  2JX5 A;  2DZJ A;  2L32 A;  1D5M C;  4BAX A;  5IKC M;  4CQN A;  3WAP A;  3QIJ A;  4M8N A;  2KFJ A;  5FK9 C;  1IBX A;  3ZJV A;  4RNA A;  4KIK A;  2NTT A;  2DYB A;  3QWZ B;  2DWQ A;  1Y56 A;  2LFI A;  2J42 A;  1V1P B;  1ZGU B;  1X1M A;  2V0G A;  2RD0 A;  2GLS A;  3AXC A;  2KO3 A;  4TQ1 A;  4KKJ A;  3P4S B;  5HG2 A;  1JRU A;  2HDE A;  1K50 A;  1XXG A;  1VJK A;  2AX5 A;  2KJ6 A;  3P1M A;  2KTR B;  2BWF A;  2MA9 B;  2YLM A;  2DBY A;  4CYE A;  1VCB A;  2K9X A;  1LGR A;  2MBO A;  1OQR A;  4P6V F;  1R4N B;  4NJ6 A;  4WWM A;  3LDZ E;  3RN9 C;  2KTF A;  4KKI A;  4LJO B;  1WY8 A;  1HTO A;  2NMQ A;  4GB9 A;  1I4X A;  1T0Q C;  2CJO A;  2GMI C;  1FRD A;  4LNK A;  2IND C;  3ZGZ A;  5JXV A;  2N7D A;  3PHW B;  5L83 A;  3JSV A;  1WXQ A;  5DCN A;  1SE9 A;  4IWO A;  3NZ3 A;  2LRU A;  4W9E A;  2N9L A;  1K8R B;  1QT9 A;  2M8S A;  4BKS D;  1VZ6 A;  2CHX A;  4GDK B;  1E6E B;  2KK8 A;  3RZW C;  4IWP A;  3T8M A;  1E0Z A;  2AQ3 B;  2INP E;  2RPV A;  3AE2 B;  4A20 A;  3QJZ A;  3U7Z A;  2V3N A;  3WAM A;  1IYF A;  1TS2 A;  3Q3F A;  3Q2A C;  4GSW A;  3M95 A;  2B3A A;  3A33 B;  3AE4 B;  3UF8 A;  3T9L A;  1TS3 A;  3FIL B;  4P1B C;  3VFK A;  3VRB B;  2DHZ A;  4AJW A;  4MJS B;  2BGF A;  3IT6 B;  4NAW B;  3VXW A;  4KSK C;  1Q1O A;  2M4N A;  5G5H A;  4ZYS A;  2LHE A;  3PVL A;  2V4I B;  3M63 B;  2KX3 A;  2CU3 A;  2JUO A;  2BTE A;  1TT5 B;  1JWM D;  1Q0W B;  1UWX A;  2RDH A;  1TKY A;  2V1Y A;  3IAM 1;  3Q3M C;  1OGW A;  1WM2 A;  3KLS X;  3URY A;  2C7N B;  3KUD B;  1V5T A;  3RCZ A;  2AL6 A;  4BBN C;  3TEY A;  4IC7 B;  1FPY A;  3WAO A;  3EHV A;  1WJN A;  3N3K B;  2GI9 A;  1OEY A;  1FNU A;  1RWS A;  2G45 B;  5FKA C;  3RUI B;  4GU2 A;  4F1S A;  5J18 A;  1YMH E;  4JE3 B;  3PPA A;  5EE0 A;  1QQR A;  3NG0 A;  4D2K A;  5CHF A;  3R66 C;  3HVD A;  2L83 A;  1JAL A;  1MG4 A;  1BUI C;  1JML A;  2RR9 A;  4E74 A;  4HPL B;  3VHT C;  2NVU I;  2KX0 A;  1E10 A;  1SIF A;  5BYR A;  4II3 B;  4MGI E;  1KJT A;  3VTW A;  2IO2 B;  4IWQ A;  3RMK C;  3WA0 A;  4BFR A;  3KYC D;  2MH7 A;  4A9A A;  1XD3 B;  4HPM B;  2R61 A;  3L4P A;  2LGY A;  1TY2 A;  4C4V B;  3BYY B;  4IM0 A;  1I4G A;  3ALB A;  4YTM B;  5L95 C;  4ZOH C;  2QC8 A;  1CK1 A;  1WXS A;  1V97 A;  3AI5 A;  3V3X A;  1TS5 A;  2FNJ B;  4L2Y A;  5TR5 A;  3T3O A;  2MP2 A;  2XK5 B;  4NAM A;  2QEJ C;  3B08 A;  2IDY A;  4FJZ A;  4LTU A;  4JWS C;  2FIF A;  1S1Q B;  2PJH A;  1PUT A;  5C1Z A;  2CU1 A;  2O6V D;  4AP4 C;  1UEL A;  3ZW3 A;  4GDL A;  1JWB D;  2JZZ A;  4OVU A;  1MVK A;  5AUK A;  1MHH E;  1J7A A;  1FNV A;  1IUE A;  2D2Q A;  3MC8 A;  3R7R A;  4O1N A;  1XO3 A;  1P98 A;  2L8J A;  5E6N A;  2MBB B;  4FA6 A;  4FBJ B;  1ZP0 B;  1L6V A;  1MI0 A;  3O65 B;  1JWA D;  3TMP B;  3N9Y C;  4FLH A;  3S2A A;  4WH4 A;  1Q10 A;  1WZ0 A;  3VAW A;  2QIL A;  4IDI A;  1WRI A;  4TKN A;  3AU5 A;  2LZ6 A;  3PRZ A;  1UZX B;  3W9C B;  1WF9 A;  1H4R A;  5FR6 A;  4H2A A;  2MJE A;  1YQ3 B;  1N62 A;  1GUA B;  2FAZ A;  2MQJ A;  2KJR A;  4RF0 A;  1WGR A;  1WH3 A;  2OOB B;  3Q8C A;  2M56 B;  3IVF A;  2ZPN A;  3CSF A;  3RZF A;  2W55 A;  2KDM A;  2JSV X;  1UD7 A;  2KZR A;  3AEE B;  4DHJ B;  1OQY A;  2QDF A;  4FJY A;  4BKG A;  4ZDV A;  4XDC A;  2ZCC A;  1EU3 A;  3CIR B;  5JHB A;  1E7U A;  3ZUN A;  4JX1 C;  1FCC C;  2KVR A;  2L0T A;  1TIF A;  1C79 A;  4K7W A;  1L2N A;  1I4R A;  4UDU C;  1WSP A;  2NPT B;  4RM8 A;  4ARI A;  3PZD A;  3CWI A;  3BZD B;  2C60 A;  5IP4 D;  1EF5 A;  3L54 A;  2D11 A;  3IAS 1;  3OWE B;  2HJ1 A;  3LJ3 A;  3HUI A;  4C80 A;  3M3J A;  4R3D A;  2PMV A;  5E6O A;  2Y5C A;  1I35 A;  4HVB A;  2EEL A;  2KMM A;  2KOX A;  3AE1 B;  5D7G A;  3ZYY X;  3QCA A;  3AEF B;  4GIV A;  4K7S A;  4GGQ A;  2BWE S;  2KAJ A;  3TCA A;  4K1R B;  2KFK B;  5EE9 A;  4WWN A;  2DYM A;  3SFE B;  4J6I A;  5IAA C;  3NUH B;  3RD2 A;  3EUB 2;  1L5P A;  4RGO S;  1YJJ A;  4FHK A;  3DVG X;  2WXK A;  4OZB A;  3A4R A;  1QOG A;  1N60 A;  5CX3 A;  4HWI B;  1FCL A;  4MH8 A;  3HIZ A;  4HKQ A;  2V4L A;  1I7H A;  2K5P A;  2GBK A;  1VD2 A;  4GOC A;  3J9C A;  4P1C C;  3VUW A;  1HZ5 A;  2WXN A;  3PLU A;  2VH1 A;  4DXF A;  3QC8 B;  1IGD A;  1STE A;  3PT2 B;  4M02 A;  2IBI B;  3C0R B;  3AE6 B;  2N7E A;  1YNT E;  2PKO A;  2RMM A;  1KFY B;  2LJ5 A;  1EO6 A;  1HQR D;  4W9G A;  2PIA A;  4PYZ A;  1R4M I;  3ZXV A;  4CO7 A;  3DBH I;  1MG8 A;  4M0W A;  2K6D B;  4RGM A;  4HDQ A;  4PS7 A;  1CMX B;  1FD6 A;  2LJI A;  3GOE A;  3RPF C;  3ZDT A;  1AYF A;  3Q69 A;  1QOB A;  2B76 B;  3SU8 X;  2Y5B B;  3P63 A;  3BVZ A;  4FUL A;  3B2F A;  3LB8 C;  2ZZP B;  2L1A A;  3H6N A;  1NDD A;  4DK5 A;  2OHF A;  4MJS A;  1GC6 A;  3NOB A;  5KHO A;  1TZ1 A;  3AE3 B;  1AN8 A;  1C9F A;  1KH0 A;  3AEB B;  1P7F A;  4DDI D;  3BVG A;  1FO4 A;  4MEL A;  4PS3 A;  3ZRC A;  5DPS A;  1BXT A;  3CMM B;  1TBE A;  4BOZ B;  1NI2 A;  3RNE C;  3U30 A;  4HRO A;  2WXO A;  1NYQ A;  5AZF A;  1UGM A;  3N32 A;  3VQI A;  3WAL A;  1PDX A;  4ZHO A;  1F77 A;  2N1V A;  4M00 A;  2JF5 A;  2FUH B;  1E8W A;  4OVV A;  1SXT A;  2FCN A;  4C7Z A;  2CHW A;  3NJT A;  2LI5 A;  3GB1 A;  4WAF A;  4HDO A;  1JRO A;  1UBI A;  2ACZ B;  2M0X A;  1DOY A;  1I4Q A;  2PPH A;  2WQY B;  5HKH A;  2IO1 B;  4OVZ A;  5I4D A;  3MHS D;  2PEA A;  3VR9 B;  3APF A;  4DHZ B;  3AMZ A;  3H7P B;  1GOZ A;  2ZVO A;  2BYT A;  1TJE A;  1FFV A;  3PRM B;  1JWU D;  2M17 A;  3FAH A;  3DHG C;  1WRD B;  1CZP A;  4ITK A;  3SHQ A;  3IFW B;  1C4P A;  4L1B A;  2K8H A;  1SE2 A;  1XCQ L;  1YIW A;  3AEC B;  4TSS A;  5BMI A;  2WXH A;  3NS1 A;  2C9W B;  2WXF A;  3V6C B;  3X23 A;  2E6X A;  3EFU A;  4YSY B;  1TKE A;  4RGT A;  2LD9 A;  4KVG B;  1GC7 A;  4N59 A;  1YOV B;  1GB4 A;  1ZDX A;  3BYT B;  3NZS A;  1SBB B;  3W1S C;  2N0S B;  2MBH A;  2IYD B;  3NVY A;  5HI1 A;  1NYR A;  3JW0 X;  4FXC A;  4EZL A;  4KGR A;  3LYY A;  2JQR B;  2WGS A;  1NEK B;  4JIO U;  2WHI A;  1HTQ A;  2EMT A;  3AM9 A;  3DCG A;  1B1Z A;  1L4D B;  3PZ8 A;  1WIA A;  1TTN A;  1KM7 A;  2WXI A;  4A3O A;  3T3N A;  1KLU D;  3GE3 C;  4WWO A;  4YXD B;  4E71 A;  4WJO A;  2FBW B;  1SB3 C;  2V3P A;  1JRP A;  3KWV A;  2KDE B;  3NHE B;  1T5X D;  4LNN A;  3D32 A;  2WXQ A;  3GP7 A;  2G4S A;  1C3T A;  5LLI A;  1FRR A;  2PW9 A;  2LMC A;  2MHJ A;  3GS2 A;  3MJW A;  4CHK A;  4F7Z A;  1DOI A;  1N6Z A;  1PGX A;  2LGX A;  2JVC A;  4WJP A;  4YL8 A;  1WFY A;  4RH6 A;  2BYV E;  3KH0 A;  1ESF A;  2CHZ A;  3ETR A;  1FM0 D;  2KC1 A;  4RMA A;  2K0P A;  2OED A;  4MEM A;  5BMG A;  2IY0 B;  2REX A;  4WAA A;  1N61 A;  3O13 A;  1V86 A;  2Y3A A;  2EMS A;  3P4P B;  5G55 A;  2IJ0 A;  3AE9 B;  4B0E A;  3DVN U;  5LXI B;  3R8B A;  1MPE A;  4FAD A;  4JPS A;  4NY0 A;  1E7P B;  2HE7 A;  3M62 B;  1WZ3 A;  4FN2 A;  1R4M B;  3IXS A;  3R3M A;  1XT9 B;  3GZN B;  3A9J B;  4GDL B;  4MSM B;  4BKT A;  2KT7 A;  1GAQ B;  1ZKH A;  1WR6 E;  4YWG G;  4ARC A;  1RRB A;  4AQ7 A;  2I1J A;  2NBU A;  2N9X A;  1YQB A;  2NTS A;  2OJW A;  4I6L B;  4N6E B;  2IO3 B;  4GXB A;  1LQB A;  4MH0 E;  1ZDV A;  2IGD A;  1PGB A;  2JXX A;  3ZJU A;  4RFB A;  4C00 A;  3PV1 A;  2LVP A;  4OZC A;  2J0J A;  2QHO A;  1ZOY B;  4K3C A;  3MC0 B;  2KFK A;  4HCP B;  1XQQ A;  3GZN I;  2VZK B;  4IKG A;  4P7I A;  1V80 A;  1K53 A;  3QHT A;  2IZV B;  2KWD A;  4ICU A;  3A9J A;  1OEY J;  2ICI A;  4XGA B;  3RYT A;  3B1L X;  2M0A A;  4OW0 A;  2JYE A;  4WJQ A;  1WR1 A;  1GPX A;  2R2Q A;  2MWS B;  2MJD A;  4K81 A;  3W1Y A;  3U8Z A;  2KMA A;  1NBF C;  4NQL B;  4PK1 A;  4ZRP A;  2KTR A;  2INN E;  2YEP B;  1OQQ A;  1UNS A;  3I63 C;  2X38 A;  1I42 A;  4LCD E;  1SF0 A;  2KYW A;  2BKF A;  3TEZ A;  2NBW B;  3VTV A;  4LNI A;  2WYQ A;  4DQO C;  1SE4 A;  3QAR A;  1C78 A;  4P16 A;  1E8X A;  5AZH A;  4S17 A;  3AE5 B;  3R2I A;  3ZDM C;  2QMT A;  4M0W B;  1WM3 A;  1D4B A;  1QOF A;  3OJ3 A;  3IT4 B;  1T3Q A;  1RYJ A;  1ZE3 D;  1E7V A;  4MT5 A;  3ZNZ B;  3SEB A;  4C7Y A;  4MGY E;  4G0N B;  4NPN A;  2N4F A;  1FEH A;  2YVC A;  1RFK A;  4KGT A;  1TS4 A;  2AYO B;  4HPP A;  2PE9 A;  3DBS A;  2ZW0 A;  1XEE A;  3SR6 A;  1ISN A;  4RF1 A;  1IPG A;  2WU2 B;  1ET6 A;  4MSQ B;  4MDK E;  4M8M A;  3Q14 C;  3WAN A;  2JZ3 B;  1EU4 A;  1A70 A;  4J3O D;  1JW9 D;  2LRW A;  2K39 A;  1TKG A;  3ML8 A;  1WJU A;  4L23 A;  3AUL A;  2BPS A;  3L16 A;  3AEG B;  2LGD A;  2BT6 A;  1XLN A;  3DHH C;  2L05 A;  2Y5P A;  4DWF A;  1LFD A;  4I6P A;  4G11 A;  1VDV A;  2I1K A;  2JRI B;  1WGG A;  5C2T B;  1WE6 A;  4IW0 A;  5BYQ A;  1PQS A;  3FC4 A;  1R4N I;  2H88 B;  4EE2 A;  1WGK A;  4XC2 A;  4W9K A;  4LK0 M;  2BYF A;  2RDB C;  3SDL C;  3E56 A;  3WCQ A;  3Q3O C;  4MGK E;  1SJH D;  2J0K A;  3L17 A;  1J19 A;  3BIN A;  3EA6 A;  3OLM D;  4KZC A;  1V81 A;  3V62 A;  3P2B A;  2QIE B;  4JGH B;  3L0W B;  2I2Y A;  3PZ7 A;  4EUT A;  4IUM B;  2JT4 B;  4K3B A;  3EGR A;  3TBL D;  3ML9 A;  2KNB A;  4JLC A;  1WMH B;  3UQB A;  1YJI A;  2C7M B;  3OJ4 B;  4TV3 A;  1U4A A;  4BOS C;  4A55 A;  4YT0 B;  1FIQ A;  4WJN A;  4B0M A;  3VUY A;  3UIP B;  4ASW C;  4LNF A;  5LXH A;  3AED B;  3KQ4 A;  4WIP A;  1HE8 A;  4OZA A;  3UIN B;  4YSZ B;  2IPK D;  2LXC A;  3EFC A;  2BW2 A;  3ZNI D;  5D3I B;  3MHZ A;  3DBL B;  4XWW A;  4MM3 B;  2WXM A;  4W9I A;  1J7C A;  2JWZ A;  3RNB C;  2KQ7 A;  2G9H D;  2QSD A;  1GB1 A;  4HLE A;  4ANW A;  2NPT A;  3BY4 B;  2D5G A;  2KN5 A;  4QAY A;  1WXV A;  1XLQ A;  4B6W A;  1F52 A;  4EZK A;  1SE3 A;  1XLP A;  3AEA B;  4ICV A;  4A8X C;  3LXF A;  5JH5 C;  3I57 A;  2OJR A;  4W9F A;  2GBR A;  3KUC B;  2GOW A;  2L0F A;  3HRD D;  2K1F A;  4A90 A;  1D5Z C;  1BT0 A;  3DBL I;  3TEW A;  2DZI A;  2MLB A;  3VH4 B;  2RSU A;  4PS8 A;  2QJL A;  4PYU A;  2XN9 C;  1JCK B;  1RFA A;  2GBN A;  3UQA A;  4KSL C;  4IM3 A;  2MBE A;  2XNA C;  3HM3 A;  1KOT A;  1Z5S B;  1WYW B;  2Z59 B;  1D6E C;  4B9K A;  1PFD A;  1J7B A;  2G3Q B;  1KLG D;  3PRE A;  3JVZ X;  3P42 A;  1VR9 A;  3UI3 A;  3RNG C;  1Z2M A;  2VRR B;  1YD8 U;  1P9D U;  1E8Z A;  1LO5 D;  5G2N A;  4MM3 A;  2D3B A;  2WDT B;  3L08 A;  5FR3 A;  1R7S A;  1F1H A;  5C23 A;  1XF5 L;  2M19 A;  4NJ7 A;  3Q8B A;  1AAR A;  4N9F 4;  3L10 B;  2MCN B;  2K8C A;  2PVO D;  2D3G A;  2BS4 B;  1YN4 A;  2JZP A;  3IHP C; 
#chains in the Genus database with same CATH homology
 2FBW B;  1SB3 C;  3AB5 A;  3H8H A;  2V3P A;  1JRP A;  1NI3 A;  1E10 A;  3KWV A;  2KAC A;  1T5X D;  5BYR A;  5T8I A;  1ZXH A;  3ZJT A;  2WXQ A;  3GP7 A;  2PLP A;  4GLS C;  1SIJ A;  2LGI A;  2K3U A;  3ABV B;  3NVW A;  1FRR A;  2PW9 A;  1MHX A;  2LMC A;  3GS2 A;  3FIL A;  3W5V B;  2MH7 A;  2Q5W D;  4A9A A;  2E3T A;  2R61 A;  1DOI A;  2WDV B;  3L4P A;  1PGX A;  5HFY A;  1TY2 A;  3BYY B;  4WQM A;  1I4G A;  3AN1 A;  4YTM B;  3Q8E A;  4RH6 A;  4Q2J A;  4ZOH C;  1ESF A;  3ETR A;  1CK1 A;  1EWC A;  1FM0 D;  1V97 A;  3V3X A;  1E9M A;  1ENF A;  1FFU A;  1QKZ A;  1TS5 A;  2K0P A;  2OED A;  4L2Y A;  1YN5 A;  1YQ4 B;  5BMG A;  3T3O A;  4NAM A;  1AWD A;  2IGG A;  1V8C A;  1N61 A;  2QEJ C;  3O13 A;  1QF6 A;  2IDY A;  4LTU A;  2GB1 A;  2Y3A A;  4JWS C;  3P4P B;  2N9K A;  2IJ0 A;  3AE9 B;  4B0E A;  1PUT A;  5EE3 A;  1HXY D;  3R8B A;  1MPE A;  1JWB D;  5GXG B;  4JPS A;  1CQV A;  1E7P B;  1MVK A;  5AUK A;  1XLO A;  1T6B X;  4YSX B;  1MHH E;  1J7A A;  1FNV A;  1IUE A;  1FXI A;  4C56 C;  1PGA A;  2BB6 A;  3MJ5 A;  3Q8A A;  4WUR A;  3P4Q B;  3IXS A;  4GDL B;  5HHD G;  2JU6 X;  3W1S A;  3B9J A;  4O1N A;  1GAQ B;  1L4Z B;  1XO3 A;  4YWG G;  4ARC A;  2HTM E;  1ZP0 B;  4AQ7 A;  1L6V A;  2WXG A;  1MI0 A;  2WXR A;  2NTS A;  1JWA D;  3N9Y C;  2G1E A;  3W5U B;  1N63 A;  4MAC A;  1B9R A;  1FXA A;  4N6E B;  1N5W A;  5C3J B;  4WH4 A;  1Q10 A;  2QIL A;  2ZW1 A;  1WRI A;  4IDI A;  1ZDV A;  2IGD A;  1QLB B;  1PGB A;  1C77 A;  3DWG C;  1EM7 A;  4JWU C;  3ZJU A;  4RFB A;  3W9C B;  2JXT A;  1DGJ A;  1C76 A;  2W3S A;  2J53 A;  4H2A A;  1ZXI A;  4OZC A;  2MJE A;  1YQ3 B;  1N5X A;  1ZOY B;  3P4R B;  1N62 A;  3MC0 B;  5H92 C;  4USA A;  4RF0 A;  2VZK B;  4IKG A;  2VZK D;  2M56 B;  1K53 A;  3Q8C A;  5LNK 1;  2DLB A;  2K22 A;  1ET9 A;  2KWD A;  2W55 A;  1FNW A;  1HEZ E;  1IGC A;  2SAK A;  2KDM A;  4IOI E;  2ICI A;  1HZ6 A;  4AS1 A;  2JSV X;  2M0A A;  4OW0 A;  3TEX A;  3AEE B;  2JYE A;  1L0V B;  1I4P A;  1GPX A;  4HKZ E;  4NJC A;  2MJD A;  3HVZ A;  4XDC A;  2I38 A;  4A6Q A;  1RM6 C;  4RGN A;  1EU3 A;  4ZRP A;  3CIR B;  3U52 E;  2INN E;  2YEP B;  1OQQ A;  1UNS A;  3C8Y A;  4JX1 C;  1DYQ A;  2X38 A;  1FCC C;  3E9S A;  1ZPS A;  3KWL A;  2J4X A;  1C79 A;  1F2R C;  1UUP A;  1L6U A;  1SF0 A;  1EWY C;  1VZ7 A;  5AUI A;  1I4R A;  2W82 A;  4UDU C;  5E6J A;  1JWS D;  2YEP F;  1WSP A;  1C4C A;  4ARI A;  3R2T A;  4PT5 A;  3TEZ A;  3CWI A;  1M4V A;  3BZD B;  2N7J A;  4DQO C;  1SE4 A;  1C78 A;  3VRA B;  3IAS 1;  4P16 A;  3OWE B;  3BII D;  3AE5 B;  3MFG A;  3R2I A;  4C80 A;  2EKI A;  3HUI A;  2QMT A;  2Z8L A;  4TMA B;  1DOX A;  1D4B A;  1QOF A;  3IT4 B;  1T3Q A;  1RYJ A;  2BS2 B;  3Q8F A;  1HA5 A;  4R3D A;  1ZE3 D;  2GRI A;  5H8Y E;  2WXL A;  2PMV A;  2JYT A;  2Y5C A;  2JWU A;  1VLB A;  2RDG A;  4MT5 A;  4XE0 A;  3SEB A;  2MEK A;  4XDD A;  3NRZ A;  1WYG A;  2TSS A;  2EEL A;  4C7Y A;  2KMM A;  2L52 A;  3AE1 B;  1WWT A;  5D7G A;  1FEH A;  4KGT A;  1RFK A;  4REZ A;  1TS4 A;  3U2S C;  3ZYY X;  3AH7 A;  1UGJ A;  3AEF B;  3BK1 A;  4YTP B;  4OHJ A;  3PO0 A;  2ZW0 A;  2KAJ A;  4ZHP A;  1OFF A;  1K51 A;  1XEE A;  5EE9 A;  2DYM A;  1VZ8 A;  3SFE B;  3TUO A;  3SR6 A;  3B2G A;  4RF1 A;  3NUH B;  3EUB 2;  2WU2 B;  4LLG M;  2LEK A;  1ROE A;  2W3R A;  1ET6 A;  5EE1 A;  5MPO A;  1L0Y B;  1L5P A;  4XWT A;  4RGO S;  1YJJ A;  2W54 A;  3AE8 B;  1EU4 A;  1AW7 A;  1A70 A;  2WP9 B;  4J3O D;  1KTK A;  1PYW D;  2WXK A;  4OZB A;  1JW9 D;  1QOA A;  1QOG A;  1N60 A;  1F2R I;  1FCL A;  1TKG A;  4MH8 A;  3DWM A;  4HKQ A;  1I7H A;  1TY0 A;  4L23 A;  3BWU D;  5BYS A;  2K5P A;  2MJ3 A;  2WS3 B;  4DXG A;  3AEG B;  1QIL A;  3J9C A;  2WU5 B;  1F0Z A;  1HZ5 A;  2WXN A;  1UWM A;  2BS3 B;  4DXF A;  2BT6 A;  2H89 B;  2WDQ B;  2ONQ A;  1XLN A;  2Y5P A;  2AQ2 B;  1IGD A;  4HRS A;  4YTN B;  2JX5 A;  1STE A;  2L32 A;  1VDV A;  1D5M C;  3AE6 B;  4CQN A;  1ZUD 2;  1YNT E;  2PKO A;  5C2T B;  1IBX A;  5FK9 C;  2RMM A;  1KFY B;  2DYO A;  4NZL B;  3RFZ B;  3ZJV A;  1HQR D;  2PIA A;  1XCT L;  4RNA A;  1TYG B;  5BYQ A;  2NTT A;  4M0W A;  3NVZ A;  4RGM A;  3FC4 A;  2DWQ A;  1Y56 A;  2WDR B;  2LFI A;  1FD6 A;  2H88 B;  2J42 A;  5BMH A;  2WNM A;  4EE2 A;  1WGK A;  3U4E G;  1V1P B;  2LJI A;  4LK0 M;  1D5X C;  3RPF C;  1AYF A;  1JQ4 A;  2V0G A;  3Q69 A;  1QOB A;  3E56 A;  3WCQ A;  4TQ1 A;  2B76 B;  4KKJ A;  3P4S B;  1P7E A;  5HG2 A;  1SJH D;  3BVZ A;  3P63 A;  1K52 A;  3B2F A;  3LB8 C;  2HDE A;  2ON8 A;  3EA6 A;  1KF6 B;  2L1A A;  1K50 A;  1XXG A;  1VJK A;  2AX5 A;  3P1M A;  2QIE B;  2I2Y A;  2DBY A;  3PZ7 A;  2AQ1 B;  2LUM A;  2KN4 A;  2K9X A;  2OHF A;  1OQR A;  3EGR A;  4P6V F;  3AE3 B;  1AN8 A;  1KRH A;  1C9F A;  1KH0 A;  4WWM A;  4KKI A;  3AEB B;  1P7F A;  1YJI A;  3BVG A;  2NMQ A;  1V1O A;  1FO4 A;  1I4X A;  4A55 A;  4HEA 1;  1FIQ A;  4YT0 B;  2CJO A;  4KX6 B;  1FRD A;  4B0M A;  4HJG E;  1SSN A;  1ACC A;  3AE7 B;  3ZQ4 A;  3ZGZ A;  5JXV A;  3AED B;  3KQ4 A;  3AV8 A;  4WIP A;  4OZA A;  2BB5 A;  1WXQ A;  2WLB A;  5D3D A;  4YSZ B;  1BXT A;  2IPK D;  1YN3 A;  2BW2 A;  4HRO A;  5D3I B;  2WXO A;  3NZ3 A;  3MHZ A;  1NYQ A;  4XWW A;  4MM3 B;  3VQI A;  2N9L A;  1BML C;  2WXM A;  1J7C A;  1QT9 A;  1VZ6 A;  4GDK B;  1PDX A;  4ZHO A;  1F77 A;  2PTL A;  1E6E B;  2G9H D;  3BK2 A;  2QSD A;  1GB1 A;  1SXT A;  4C7Z A;  1NVI D;  1E0Z A;  3GB1 A;  2D5G A;  4WAF A;  2AQ3 B;  2INP E;  1JRO A;  2ACZ B;  2WXJ A;  1DOY A;  2RPV A;  3AE2 B;  2FUG 1;  1I4Q A;  1XLQ A;  3U7Z A;  2WQY B;  2V3N A;  3BVM A;  5G5G A;  1SE3 A;  1XLP A;  3AEA B;  4OVZ A;  4A8X C;  5I4D A;  1TS2 A;  3LXF A;  3VR9 B;  1V1P A;  3I57 A;  3AE4 B;  2KQ4 X;  3AMZ A;  1TS3 A;  3FIL B;  1GOZ A;  2PVG C;  1TZO A;  3HRD D;  4A90 A;  1D5Z C;  3VRB B;  2BYT A;  1NEN B;  1TJE A;  1FFV A;  4NAW B;  3IT6 B;  3TEW A;  2CJN A;  1IBX B;  4N58 A;  4RCO A;  1JWU D;  3FAH A;  4US8 A;  2QJL A;  1CZP A;  5G5H A;  4ZYS A;  2LHE A;  2V4I B;  2XN9 C;  1JCK B;  4ITK A;  2CU3 A;  1C4P A;  4L1B A;  1SE2 A;  1XCQ L;  2BTE A;  3AEC B;  4TSS A;  1JWM D;  1UWX A;  2LHD A;  2RDH A;  2XNA C;  5BMI A;  1TKY A;  2WXH A;  4KGS A;  3TSS A;  3NS1 A;  2WXF A;  3IAM 1;  1L0X B;  2E6X A;  1D6E C;  3KLS X;  4YSY B;  3URY A;  1FMA D;  1TKE A;  1PFD A;  4RGT A;  1J7B A;  1SJE D;  3V05 A;  1C4A A;  4N59 A;  1I4H A;  1KLG D;  3TEY A;  1GB4 A;  3P42 A;  1ZDX A;  3BYT B;  1VR9 A;  1SBB B;  3UI3 A;  2N0S B;  3W2D A;  2GI9 A;  2IGH A;  1FNU A;  1LO5 D;  2WXP A;  2J52 A;  3NVY A;  5HI1 A;  5TSS A;  1NYR A;  4FXC A;  4KGR A;  3LYY A;  3SFD B;  1RWS A;  2JQR B;  5FKA C;  1YMH E;  3NVV A;  4JE3 B;  5FR3 A;  1R7S A;  1NEK B;  1VRA B;  5EE0 A;  1QQR A;  4D2K A;  1CJE A;  3AM9 A;  1XF5 L;  2M19 A;  3HVD A;  3Q8B A;  1B1Z A;  2BBC A;  2L83 A;  3I9V 1;  1JAL A;  1L4D B;  3PZ8 A;  2SEB D;  1BUI C;  4TQ0 A;  1JML A;  3MP9 A;  2WXI A;  2PVO D;  3T3N A;  4US9 A;  2FE8 A;  1KLU D;  4ZRQ A;  2BS4 B;  1YN4 A;  4YXD B;  1SEB D;  2JZP A;  3VR8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...