5C2TB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 64
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 5c2tB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5c2tB01
1WWTA 1F0ZA 3W5VB 1TKGA 2Q5WD 2Y5CA 3FC4A 1JRPA 4N6EB 2WLBA 3P4SB 1E7PB 1PDXA 3HVZA 3NVWA 1JALA 2W55A 4USAA 2BS4B 5C3JB 1H7XA 1E0ZA 4FXCA 3BIID 5G5GA 1SF0A 1NEKB 2MJEA 3EUB2 3SFEB 1EWYC 5H8YE 5MPOA 1E10A 1AYFA 4N59A 3P63A 1GTEA 3HRDD 3VR8B 3AE3B 4YSYB 4JWSC 3AM9A 1FRRA 3AE5B 1YJJA 2KMMA 2WDRB 3AEAB 1SB3C 3AB5A 1QF6A 2K5PA 1KRHA 4WWMA 1VJKA 1VLBA 4HRSA 4C7YA 4YTPB 3NRZA 1FXAA 2MJDA 3DWGC 1V8CA 3P4PB 3B2GA 1ZOYB 2WS3B 1NYRA 2E3TA 2W54A 1JQ4A 1H7WA 1N60A 5H92C 2ACZB 3WCQA 1GTHA 3VRBB 1NVID 1OFFA 3AN1A 1WGKA 3SFDB 1TKYA 1FO4A 2WU2B 2L83A 2L52A 3KWLA 4C80A 3CWIA 2QJLA 3AEBB 2QIEB 3AE1B 3PO0A 2WDVB 1RWSA 2DWQA 1L0VB 4YTMB 1V97A 4JX1C 3AECB 3AEGB 1GPXA 2K22A 3W9CB 5G5HA 1TJEA 3RPFC 4C7ZA 3AEDB 3AMZA 4A9AA 1E9MA 1RYJA 2W3RA 3ETRA 2JX5A 1DGJA 1SIJA 2FBWB 2CJOA 3AE7B 1I7HA 1FIQA 1FM0D 4ZHPA 1XO3A 1FMAD 1JROA 2OHFA 3NS1A 1ZP0B 4YXDB 1JWAD 1N61A 1QOGA 1E6EB 2HTME 2PVOD 3AH7A 3P4QB 1ZUD2 4ITKA 1L6UA 1QOBA 1AWDA 1QOFA 3AE6B 2G1EA 3P4RB 2M19A 3CF4A 1L6VA 2MH7A 2N0SB 4P6VF 3VR9B 2BS3B 3NVYA 2W3SA 3W5UB 1YJIA 4US9A 1PFDA 1ROEA 1J7AA 1DOYA 1N5WA 3NVVA 2H89B 1L5PA 3CIRB 1JW9D 2WQYB 3ABVB 1FFUA 2LEKA 1YQ4B 1A70A 3AE9B 2JQRB 1J7BA 3AEEB 2EKIA 5C2TB 1QLBB 2PKOA 1WRIA 4N58A 4WQMA 3ZYYX 2WP9B 1NYQA 1RFKA 2WU5B 1KF6B 1WXQA 2KAJA 2DBYA 2MJ3A 1GT8A 4YSXB 1QT9A 3LB8C 3L4PA 5GXGB 1IUEA 3AEFB 3AE2B 3AE4B 2H88B 1CJEA 1T3QA 5EE1A 4IDIA 1XLNA 4ZHOA 1NENB 1XLPA 1CZPA 1OQRA 3FAHA 1YQ3B 1FXIA 1XLQA 5EE3A 2PIAA 3P1MA 3NVZA 1N63A 1TKEA 1TYGB 4YT0B 1VDVA 2PVGC 4ZOHC 3DWMA 1R7SA 1QOAA 1B9RA 4KX6B 1DOIA 1NI3A 2K9XA 1JWBD 1UWMA 1N5XA 4YSZB 3B9JA 2AX5A 1GAQB 4LTUA 5AUKA 1WYGA 1DOXA 1RM6C 1XLOA 4JWUC 2B76B 1J7CA 1FFVA 2CU3A 1ZXIA 3B2FA 5AUIA 2BS2B 2CJNA 2BT6A 4US8A 3AE8B 2M56B 5EE9A 4HROA 3SR6A 3HUIA 1KFYB 5EE0A 3AV8A 3LXFA 2WDQB 1PUTA 3VRAB 1FRDA 1OQQA 1N62A 4YTNB
chains in the Genus database with same CATH superfamily
2NTSA 3IXSA 3N30A 2M0AA 4RGMA 3W5VB 1JRPA 4WWNA 5D6JB 1PDXA 4TKNA 3WAPA 4ANUA 4EFOA 2AL3A 5JH5C 1AYFA 5HKHA 3VR8B 2B3AA 5DPSA 1ET9A 3LDZE 4TUUA 4W9DA 4C7YA 3NRZA 4DHJD 2R2OA 2LZ6A 2J7QB 3KH0A 1JWUD 2ASQA 4JE3B 4XDDA 3V61A 5CX3A 3SD5A 2WXPA 2WU2B 4AJYB 5C1ZA 2KDBA 2KDIA 3NZSA 2CHWA 3BZDB 2ON8A 3O13A 3QC8B 2L76A 1SIJA 1PGXA 1QKZA 2C7MB 4B6WA 1SE2A 1EF5A 3NS1A 4KKJA 4F7ZA 2ICIA 5AEKB 3DPDA 2MH7A 4EOYA 2D5GA 1E90A 2GBMA 3NVVA 1R4MB 1V49A 5JHBA 3IHPC 5L83A 1A70A 2JQRB 4W9JA 1HTOA 1K51A 3WAOA 2EKIA 5C2TB 2YEPF 4AWJA 5DCNA 1J8CA 1XD3B 1NDDA 3V3XA 3PTFC 2H88B 1MFWA 3VDZA 3B0AA 1YQ3B 1JCKB 3IAM1 2ZPYA 4M0WA 2L0FA 3W1YA 4ZOHC 1NI3A 3BVMA 4ANVA 4DBGA 2KLCA 3B2FA 1KOTA 2C5LC 1MG8A 2IO0B 4MT5A 4KGRA 2J0MA 2WHIA 2Q5WD 2WLBA 1C77A 2OJRA 3A1QA 4M8NA 1V2YA 3MJ5A 2LXAA 4CQNA 1UD7A 3DQVA 4N9F4 4MSQB 2UWQA 2KC2A 4BFRA 3ZKJC 1T0QC 1OQYA 4ZRPA 3IFWB 2JVCA 2C7HA 2AYOB 3M62B 1JMLA 2AWTA 2W54A 1JQ4A 2KDMA 2IGGA 5J17A 3SFDB 2KK8A 3PV1A 4LLGM 1HZ6A 2IDYA 5BMGA 4GIVA 4NAWA 2KOXA 3VTUA 3DOWA 3SU8X 4NJ7A 3ZO5B 4HLEA 3VAWA 4W9KA 3H7PB 1WXVA 2IO1B 4D2KA 3TMPB 1WJUA 2O2VB 5J2RA 2HTME 1ZUD2 4W9IA 3DBRI 3RZWC 2M19A 1I4QA 1AARA 2G3QB 2ZCBA 2W3SA 2ZCCA 4BKSA 3U7ZA 3ABVB 2I1JA 2V0GA 1FPYA 1C4CA 3FKYA 2WU5B 2LGDA 2IGHA 2NPTA 3W1SA 5GXGB 3DVGX 3ZTCA 1V80A 5EE1A 1UNSA 1C3TA 2RGFA 1D4BA 5KHQA 1NENB 3WAMA 5EE3A 4GDLA 2KVRA 2BQQA 2DLBA 2KWCA 1RAXA 2DNFA 2K9XA 1JWBD 2HDEA 3B9JA 4BKTA 5FKAC 2INCC 4JWUC 1FFVA 1ACCA 1EU3A 1L4DB 3DVNV 2BF8B 3A9JB 4DXAB 4DXFA 2L00B 3ZUNA 2DENB 3QA8A 3PLVA 2W55A 3QK0A 2LGXA 2BPSA 4IUMB 5G5GA 3EUB2 4MJSA 1ZGUB 2FAZA 5BMIA 1HTQA 3HVDA 3I3TB 3AM9A 2L7RA 2LJIA 4BAXA 5CHWA 2KQ7A 3Q8CA 1ZE3D 2IZVB 2CHZA 3WCQA 1GTHA 1YIWA 2DAJA 2VZKD 2MX2A 5G2NA 4BOZB 4XGAB 2DWQA 2GBKA 2BYEA 3EA6A 1D3ZA 5AZFA 3W9CB 3AXCA 4TSSA 1TGZB 2D3BA 3GB1A 1N61A 4HPMB 3EHVA 3DBLI 3NG0A 1PGAA 4HKZE 4DHJB 1ROEA 1WM2A 1L5PA 2XK5B 3Q6BA 4PS8A 3AI5A 3B1LX 2KN4A 2ZJDA 2Z59B 4CO7A 4NPNA 2MQJA 1S3SG 3A9KB 3ONSA 4XC2A 4FADA 5DPRA 2KWUB 3K9PB 2JUOA 2N1VA 4FHJA 4YSXB 4HK2A 4BKSD 3MC8A 4S0RA 1T0RC 4K3BA 1CJEA 3RUIB 2AQ3B 2JT4B 3T3NA 4B95A 2FIDA 2IJ0A 3CSTA 4AUQC 3S2AA 3IT4B 1WYGA 4UDUC 4JPSA 1WYWB 4IG7B 3H9DA 3B08A 3MTNB 3TBLD 2IBIB 3UF8A 4B0MA 4XX5A 2KACA 4KDLB 4PT5A 2LI5A 2WXRA 2WXQA 4HXDA 4HDQA 2V9HA 4A6QA 4P16A 1E10A 3M63B 1JWSD 1SSNA 2K0PA 3VUXA 4WQOB 4W9LA 1FD6A 3AEAB 1SB3C 1BMLC 2YVCA 3JSVB 1KLVA 3APDA 1ET6A 4GLSC 3O65B 3DWGC 2EKEC 1ZOYB 2WS3B 1I4GA 1KTKA 1I42A 1UGMA 2JU6X 3VH3B 3UQBA 4BOSC 2WXGA 4MGIE 4TV3A 4C56C 2KFJA 4PS3A 3VUYA 2BYTA 3ETRA 2CJOA 1GC7A 2K8BA 1SJHD 1P7EA 1WE6A 4P6VF 1SE3A 1DOYA 2H89B 1X1MA 2DZMA 3R2TA 2C9WB 2LGIA 1TIFA 4KKIA 1IGCA 2V3SA 5I4DA 1MG4A 3AEFB 1WE7A 1YNTE 2WX1A 3NVZA 1I35A 1TKEA 2PVGC 2KMAA 1R7SA 1DOIA 2WWZA 4XWWA 3WIMA 1MHHE 1GB1A 1RM6C 1XLOA 4HJGE 1JRUA 2CS4A 2A4ZA 3L16A 3PRPB 4GDKA 4G50A 1F0ZA 2JYTA 1SBBB 3PZ8A 2N9EB 5C3JB 3HHMA 3PLUA 1TS3A 3V05A 1VZ6A 4HJKA 1K53A 1P9DU 3X0WA 3WALA 2K3UA 2KTFA 3T8MA 1KJTA 1PGBA 2KYWA 4IWPA 5BYQA 2VH1A 3ZRFA 3BY4B 4DXGA 1GOZA 1QF6A 5IN7A 1IGDA 4BBNF 2Y5BB 3RNGC 3TEYA 2Y3AA 2E3TA 3A33B 4M0WB 4I6PA 3ZGZA 5H92C 3EGRA 1YN4A 2GRIA 5IAAC 1WGKA 1OTRB 1R4NI 3TSSA 3ZJVA 2D3CA 2K39A 2L0TA 3RNFC 1YX5B 3Q14C 2LD9A 4WWPA 1RYJA 2W3RA 4W9HA 2JX5A 1E8ZA 3D32A 3A1QB 1ZP0B 4YXDB 3PHXB 1GJZA 3N3KB 1CQVA 3T3OA 1RFAA 3VUWA 3RYTA 3HIZA 2Z0EB 4GXBA 4NJCA 2WQYB 1B1ZA 3TEXA 2KWDA 2N4FA 3KLSX 2VZKB 4WWOA 3JW0X 1E8WA 3N32A 1KF6B 5FK9C 4LNIA 4JLCA 1RLFA 3ZJTA 3DHHC 3OAWA 2PE6B 3U4EG 1E7UA 1YJ1A 3FAHA 4LCDE 4NAWB 3DWMA 4HVBA 4C4VA 4LTUA 1UWXA 3N20C 2GBNA 2CJNA 2N7EA 3NOBA 1VRAB 3NZ3A 2DZJA 4KSLC 1K8RB 4I6LB 1Y8RC 4LDTD 1UELA 3RZFA 3FC4A 3RN9C 4HEA1 1M4VA 4F1SA 2WX0A 2R2QA 4LJPB 1ZDVA 4M01A 3NS8A 2WXJA 4K3CA 5LXHA 3MP9A 5LNK1 1N6ZA 2DZIA 2KO3A 2QCZA 2NPTB 2KANA 3DBRB 3KUDB 3RNEC 1MVKA 2MSED 3NUHB 4MGYE 4GDLB 2LVOA 3I9V1 1ISNA 1IP9A 1FO4A 3MFGA 2L52A 3IAS1 1BXTA 2EELA 2QSDA 4GMVA 1C79A 1KH0A 2CKHB 2K22A 2V3PA 3MC0B 3AEDB 2BB5A 2O6VA 3Q3OC 4GN1A 2PTLA 4YL8A 1FNVA 1FM0D 2XBBC 2BTEA 1LQBA 2EMSA 2LVPA 1E6EB 5FR6A 1L6UA 2RD0A 3P4RB 4MJSB 3BVZA 3E9SA 2BW2A 2LEKA 3ZNGC 2PKOA 1NYQA 1F2RC 4S17A 2KJHB 2LHEA 4MM3A 4K7SA 4Q2JA 4DHZE 1B9RA 4L1BA 4KX6B 2KFKA 3V6CB 3GZNB 3ZXVA 1L4ZB 1V1PA 2KX3A 3Q8BA 1T0SC 3VFKA 2M17A 2BKFA 2WDQB 1FRDA 2FUG1 4YTNB 2G9HD 1PQSA 2K6QA 1E7PB 2JZPA 4PYUA 3VTVA 2ZNVC 3PGEA 2SEBD 3SEBA 1EM7A 1VD2A 4IM2A 2N1WA 1L0YB 3DBLB 3N9YC 1VR9A 4PS7A 3AB5A 4WAAA 4ZYSA 1KRHA 1VLBA 2IY0B 3P4PB 2J4XA 3RNBC 3RFZB 3Q8EA 4DDID 4OVZA 1OFFA 5TSSA 3RNAC 1YN3A 4ANWA 3CWIA 3U8ZA 1QQRA 4G3XB 4QAYA 2LASA 2DHZA 5G55A 1EUVB 2JRHA 1I4XA 4C7ZA 4G0NB 3C8YA 1V6EA 1DGJA 1P98A 1I7HA 4ZHPA 2MP2A 2HTHA 2INNE 1GC6A 4KIKA 2MBOA 1QOGA 4MGZE 1K50A 2O6VD 2JZ3B 4XZ4A 4REZA 2M4NA 3AEEB 3I63C 3UQAA 2FUHB 4P1CC 1E8XA 3RULA 3AE2B 1I4RA 2X8XX 2NS5A 4BVUC 3IBEA 1GAQB 1E8YA 1DOXA 3OWEB 2WYQA 3P42A 5L95C 3WA0A 3MC9A 1KLUD 1WGGA 1E5WA 2QEJC 1MHXA 1AN8A 5HFYA 3IVFA 4FXCA 3CSFA 2JXXA 4JGHB 3BIID 2L8JA 2CHXA 4OZCA 4NNJB 3QWZB 5H8YE 5DPWA 3PT2B 2V4IB 2LHDA 2L05A 4ICUA 4GOCA 4EZLA 3AE3B 4KZCA 5IA7A 1ZKHA 4JWSC 1FRRA 4K1RB 1IYFA 4EZKA 3J9CA 4L23A 5AZGA 4FJYA 1GB4A 4A90A 4WJPA 4KV2A 1P1AA 2PE9A 3GS2A 3KWVA 3LYYA 3DVGY 1ZPSA 1TKYA 4LDTB 2AQ1B 2G4DB 3R3MA 2QIEB 3AE1B 4JX1C 2KN5A 4GDKB 4EZJA 3FILA 4KVGB 3A4RA 2RDGA 2AEHA 3UINB 5LXIB 2LGSA 3NHEB 1EWCA 4K7WA 4BKGA 5IP4D 1WXSA 2JYEA 2UYZB 2L3ZA 2G1EA 3BWUD 2NTTA 1HEZE 1RRBA 2N7DA 4I6NB 3PRMB 4IM3A 4AJWA 1J7BA 1TT5B 4N58A 4KZ0A 3RI7C 4CYEA 3L4PA 2LXCA 1R4MI 3W1SC 3AE4B 3KUZA 5D3DA 3TJPA 3ZDMC 4AP4C 2LGYA 2QC8A 1XLQA 4FULA 1UWMA 4ZDVA 2SAKA 2ZPNA 3C19A 2BS2B 5IKCM 2BT6A 4US8A 3AE8B 1D5MC 3QHTA 3VVWB 4EKUA 1R4NB 5E6PA 3L10B 4HRSA 2TSSA 1WMHA 4HPPA 3ZLZA 3DHIC 4RGNA 1UUPA 3Q8AA 3SHQA 4NQKE 1SF0A 2INDC 4XWTA 1OEYA 4ZRJA 4MSMB 4NQLB 3H1UA 3L13A 4LNOA 3B2GA 2IGDA 1HE8A 3TEWA 4C4VB 4F8CB 3URYA 2OJWA 1S1QB 1C76A 2N9LA 1L0VB 4MH0E 1C4PA 4PYZA 1P7FA 3ZQ4A 2UU7A 4WAFA 1WGYA 2FBWB 4JL9A 1JROA 1JWAD 2PVOD 3ZW3A 3AE6B 4OVVA 1L6VA 5E6OA 2RSUA 2INPE 2NCNA 3AU5A 2RPVA 1YJIA 1PFDA 3VQIA 4ZYNA 2FCMA 3CIRB 2E6XA 2FIFA 2BWES 2KWVB 3ZYYX 1C78A 1RFKA 4P7IA 2MW5A 1GT8A 2A5UA 1IUEA 1SE4A 2ZNVB 4H2AA 3IT6B 4HCNB 3ALBA 1TYGB 3PRZA 2BYFA 4IOIE 4ARCA 2Z0DB 2NMQA 1KLGD 2O6VB 5AUKA 2R61A 1STEA 3BYYB 1WM3A 4HROA 2LRWA 3HUIA 2Z8LA 5EE0A 5AZHA 2IPKD 4FN2A 1TKGA 1Q1OA 4ANXA 1XCQL 2HE7A 5EDSA 3H8HA 4WH4A 1E0ZA 4M02A 2EMTA 2WXOA 3SFEB 1ENFA 1EWYC 2LWPA 4N59A 3P63A 2GBJA 3K9OB 2RR9A 1SEBD 1YJJA 3TIXA 2I38A 4P1BC 1TZ1A 4BZAA 4MM3B 4LNFA 2CR5A 1V8CA 3JYUA 5D3IB 4YWGG 1N60A 2KFKB 5HI1A 3R7RA 2J0KA 5DPTA 3KWLA 1V1PB 3CMMB 2KTRA 2BGFA 5D94A 1RWSA 3Q3JA 3AEGB 1TJEA 4KDIC 3A4SC 4A3PA 3Q2AC 1IBXA 4W9CA 4ARIA 1WIAA 1FIQA 2ZW0A 1XO3A 1FMAD 2N9PC 4EE2A 4L2YA 2LMCA 1AWDA 3ZNZB 3DBHI 4RMAA 1WI0A 2LRUA 2J42A 1FFUA 4LJOB 5HHDG 4URKA 1XCTL 1WRIA 2KVZA 2K6DB 2D07B 3R8BA 2PIAA 2X38A 2CU1A 3PPAA 3BINA 3NJTA 1FCLA 2JF5A 3MHSD 1J19A 3R2IA 5C23A 1HQRD 1Q10A 2QILA 2KLGA 1YD8U 3C0RB 2BWFA 2MP2B 4HCPB 3KQ4A 3LXFA 4KIKB 1WH3A 1N62A 1OQRA 1Y56A 1WWTA 2Y5CA 1V86A 2RDHA 2RMMA 5CHVC 1WGDA 3MJWA 3U7DA 1ZW7A 3RMKC 2KT7A 1NEKB 3DHGC 4C00A 3OG5A 2W9NA 2DX5B 4RNAA 3AE5B 4OZAA 5KHOA 4YTPB 1F77A 4LNKA 4RH6A 1H7WA 4FA6A 4DQOC 3VRBB 3ZIMA 2C7NB 1H4RA 3HK0A 1TY2A 1V97A 2LUEA 1Z2MA 1GPXA 2PLPA 1D5ZC 1HXYD 3LJ3A 2N9KA 2NBWB 3ECIA 4MGKE 1TTNA 2V4LA 4E3CA 1MJDA 4ITKA 1QOBA 3TUOA 4JQWC 2FE8A 3H6NA 4HDOA 1C4AA 2QHOA 3JVZX 1JW9D 1WZ3A 3RD2A 5FR3A 4RGOS 1YN5A 2KZRA 2C60A 2XNAC 3BVGA 3PZDA 1G6JA 1WXQA 2DBYA 4RM8A 3UI3A 3Q3MC 2JWZA 3PZ7A 1JWMD 3GE8C 1CZPA 2LUMA 1SIFA 3P1MA 3VHTC 3KYCD 3Q3NC 2HD5B 2PMVA 1N5XA 1L2NA 3FILB 1KM7A 2CU3A 1SGHA 1F9JA 1YOVB 2QMTA 4E74A 2WXHA 2KHWB 1LO5D 2J53A 1H8CA 1VZ8A 2MLBA 4N6EB 3P4SB 3L08A 3PHWB 2G4SA 3EFCA 2BS4B 2AL6A 4WJQA 3QX1A 4HWIB 2MJEA 1L7YA 4II3B 4TQ0A 2DYBA 2YEPB 3OJ3A 1GTEA 5CTRC 3OJ4B 5J18A 2WDTB 4KGSA 4YSYB 4OHJA 1SXTA 2D2QA 2I1KA 2K5PA 4WWMA 2DZKA 3HM3A 2WNMA 1J0GA 1FXAA 3MHZA 1Q0WB 2N9XA 2BKRB 2K8HA 2NVUI 5BYSA 1WXMA 4RM9A 1NVID 3AN1A 3EFUA 4FJVB 1D5XC 1WR1A 2MWSB 1XEEA 3RPFC 1V5OA 2D11A 4MH8A 1WMHB 4LK0M 1WX9A 4KGTA 2OHFA 3I57A 4OW0A 2REXA 1V5TA 2N0SB 1LXDA 3NVYA 1D6EC 1WX7A 1N5WA 2PEAA 1LFDA 2NBVB 4J3OD 3V6EB 3N1ZC 1EF1A 4XDCA 1WZ0A 1I4PA 1Q5WB 3LB8C 4AOFA 4ICVA 1T3QA 4W9EA 4ZRIA 1ZXHA 3L54A 2KNBA 4ZRKA 4W9GA 1E7VA 3V62A 1GG3A 3APFA 4PK1A 1J7CA 5AUIA 2KDFB 2LJ5A 4RF0A 1LM8B 5EE9A 3SR6A 1K52A 3VRAB 4BBNC 4HPLB 1TS2A 3APCA 2DYMA 1WFYA 4IKGA 1A5RA 5IOIA 2LFIA 2WXFA 1XF5L 3DVNU 3PREA 3ZNID 1WF9A 2LVQA 4K81A 3UIOB 2N7JA 2BBCA 1FEHA 2KMCA 2YLMA 1U4AA 4MEMA 2KQ4X 1T0YA 3ML9A 3KYDD 4J6IA 2KDEB 3PS6A 2VRRB 3DDCB 2WDVB 2FCSA 3AECB 2ZVNA 3AULA 2GMIC 2JPHA 5G5HA 1F1HA 5JHAA 5IO9A 1VZ7A 3HM6X 2KJRA 3UGBB 3IG3A 3ZXRA 3W5UB 2IYDB 2KX0A 3OLMD 1IPGA 1YQ4B 3AE9B 2MBHA 1HA5A 3E56A 2JZZA 2K1FA 4WQMA 3TCAA 1XT9B 1Z5SB 1V9JA 2V3NA 1UBQA 2XN9C 4E71A 2MBQA 2KTRB 1N63A 2PW9A 4YT0B 1T5XD 4IC7B 2IY1B 3KVFB 1IBXB 1UGJA 4KSKC 2M56B 2JRIB 3AV8A 4MDKE 1TS4A 1PUTA 2KD0A 2ZZPB 3GZNI 2ONQA 1C1YB 1MI0A 3NVWA 1JALA 1DYQA 3R7QA 2D10A 5TR5A 5MPOA 1WXAA 3T9LA 3HRDD 3ZJUA 2KC1A 3DBHB 2K8CA 1CMXB 2L1AA 2WXIA 4ACFA 1VJKA 1HZ5A 4RFBA 2PJHA 1XXGA 1M94A 5CHFA 4GGQA 3W2DA 1I4HA 5T8IA 3QJZA 2ACZB 1OEYJ 2W82A 1PYWD 4FBJB 1SE9A 1TY0A 2QJLA 3U2SC 4DDGD 3PO0A 1XQQA 1WRDB 1L0XB 3DCGA 3QIJA 1UF0A 1UH6A 4A8XC 3BK1A 3EECA 2KJ6A 3VTWA 3CF6E 3PVLA 3QCAA 1GNUA 4GU2A 4TQ1A 3TL5A 3RNCC 4A20A 2VH2A 4LNNA 4B0EA 3DBSA 1ZDXA 4O1NA 2WP9B 3U30A 2MJ3A 2KKCA 2KQSA 2GI9A 2MRPA 1QILA 4MELA 2MA9B 2D3GA 3ZNHB 2MBBB 4II2B 1ESFA 1QOAA 4A3OA 1TBEA 3BYTB 2GLSA 4G11A 2DAFA 1SJED 1ZXIA 3Q3FA 1WSPA 1WX8A 1NI2A 3SDLC 1KFYB 2G45B 4IM0A 1AW7A 1YQBA 1UBIA 2OOBB 3P2BA 4A55A 3VXWA 2RPQA 1WJNA 4NAMA 4CHKA 3H7PA 3HVZA 3RCZA 3M95A 1H7XA 2O2VA 4M00A 3BK2A 2MBEA 4ZRQA 2BYVE 3L0WB 4FLHA 2XEWA 4W9FA 3ZRCA 3RT3B 3AU4A 2FCQA 3QARA 1T6BX 2Y5PA 4RF1A 1LGRA 4R3DA 2M1MA 3L17A 1P0RA 2JWUA 1TS5A 5BO4B 2L83A 3V60A 2MHJA 2JSVX 2FNJB 1CK1A 5BYRA 3TEZA 1WJ4A 5BMHA 4A9AA 4WJNA 4DHZB 4FJZA 3AE7B 1YMHE 2FCNA 4IWQA 2M8SA 1F52A 3A9JA 3P4QB 1YX6B 1QOFA 4WJOA 3UIPB 2ZVOA 2ZW1A 2DYOA 4GB9A 1J7AA 4NZLB 2PPHA 2NR2A 5D7GA 4HKQA 2M0XA 2L32A 1NBFC 1EU4A 2J52A 2WXKA 2WXNA 2HJ1A 1QT9A 2QDFA 4X57B 1EO6A 4MACA 1XLNA 4ZHOA 4GSWA 1FXIA 4M8MA 2I2YA 3VH4B 4YSZB 2WXLA 4WURA 1WGRA 2MCNB 4NJ6A 3ZTDA 2JY6A 3KW5B 1UZXB 3N1YC 4EUTA 1OQQA 1TZOA 4RGTA 4IWOA 4B9KA 4USAA 1FXTB 4IW0A 3ENEA 1V1OA 1WJ6A 1FNWA 3ZDTA 1FCCC 4NY0A 4JIOU 1C9FA 1WR6E 4FHKA 3NZUA 2XK5A 2GOWA 3ZVVA 2KMMA 2WDRB 5JZEB 3A9KA 4TMAB 5JXVA 2MJDA 1NYRA 3Q8FA 3I5JC 3N1XC 1FNUA 2BB6A 2NBUA 3QQ8B 4WIPA 2IO3B 1BUIC 3EC8A 4EEWA 4OVUA 2IO2B 3AEBB 4C80A 3GOEA 2K25A 4YTMB 3H7SA 1QZEA 5E6NA 3AMZA 2JXTA 2WGSA 1E9MA 2MEKA 3X23A 2V1YA 5LLIA 2RDBC 1F2RI 3AH7A 1GUAB 2KXJA 3CF4A 4DK5A 4K7UA 3VR9B 2BS3B 3R66C 2BVCA 3NY5A 4RCOA 4US9A 1V81A 5E6JA 1MPEA 5HG2A 1P3QU 1QLBB 1OGWA 1VCBA 2GBRA 3M3JA 1BT0A 2KAJA 3Q69A 1WGHA 2AQ2B 2WXMA 4ASWC 4DWFA 3JSVA 4IDIA 2J0JA 1XLPA 2OEDA 4XE0A 4AS1A 2GB1A 1VDVA 2HJ8A 3GP7A 3PSEB 2AX5A 5GMVA 3QAQA 2B76B 1WY8A 4OZBA 3ML8A 4AQ7A 3U52E 3GE3C 4XYCA 3KUCB 3WANA 2D3AA 2ZEQA 5D2MB
chains in the Genus database with same CATH topology
2NTSA 3IXSA 1F0ZA 2M0AA 2JYTA 4RGMA 2TSSA 3W5VB 1JRPA 1SBBB 2DYMA 1PDXA 3PZ8A 4IKGA 5C3JB 4RGNA 1UUPA 3V05A 1TS3A 1VZ6A 1K53A 3Q8AA 2LFIA 2WXFA 1XF5L 1SF0A 4XWTA 2K3UA 1AYFA 1PGBA 3VR8B 5BYQA 2N7JA 2BBCA 4DXGA 1QF6A 1GOZA 1FEHA 1ET9A 1IGDA 4C7YA 3NRZA 3TEYA 2Y3AA 3B2GA 2IGDA 2KQ4X 2E3TA 3ZGZA 3TEWA 1JWUD 5H92C 3EGRA 4JE3B 4XDDA 1YN4A 2GRIA 3URYA 1WGKA 2WXPA 1C76A 2WU2B 3TSSA 3ZJVA 2N9LA 2WDVB 1L0VB 1C4PA 3AECB 1P7FA 5G5HA 3ZQ4A 4WAFA 1RYJA 3BZDB 2W3RA 2ON8A 3O13A 2JX5A 1SIJA 1PGXA 1QKZA 2FBWB 1VZ7A 1SE2A 1JROA 3NS1A 1ZP0B 4YXDB 1JWAD 2PVOD 4KKJA 2ICIA 3AE6B 2MH7A 1L6VA 1CQVA 3T3OA 2INPE 3W5UB 2RPVA 1YJIA 1PFDA 3VQIA 2D5GA 3NVVA 4NJCA 3CIRB 2WQYB 2E6XA 1YQ4B 1A70A 3AE9B 1B1ZA 1HA5A 2JQRB 3E56A 3TEXA 2KWDA 1K51A 3KLSX 2EKIA 5C2TB 2VZKB 2YEPF 4WQMA 3ZYYX 1C78A 1RFKA 1KF6B 5FK9C 1GT8A 3V3XA 3ZJTA 1IUEA 1SE4A 2H88B 4H2AA 3U4EG 2V3NA 2XN9C 3IT6B 3FAHA 1YQ3B 1JCKB 3IAM1 1N63A 1TYGB 4M0WA 2PW9A 4YT0B 1T5XD 4NAWB 4ZOHC 4IOIE 3DWMA 4ARCA 1NI3A 2NMQA 3BVMA 4LTUA 1UWXA 1KLGD 5AUKA 2R61A 3B2FA 1STEA 1IBXB 1UGJA 2CJNA 3BYYB 1VRAB 3NZ3A 2M56B 4HROA 3HUIA 2Z8LA 5EE0A 3AV8A 1TS4A 1PUTA 4MT5A 4KGRA 2IPKD 1TKGA 2Q5WD 3FC4A 2ONQA 2WLBA 1XCQL 1MI0A 4HEA1 3H8HA 1M4VA 3NVWA 4WH4A 1JALA 1C77A 1E0ZA 1DYQA 3MJ5A 2WXOA 4CQNA 1ZDVA 3SFEB 1ENFA 1EWYC 2WXJA 5MPOA 3MP9A 4N59A 3P63A 5LNK1 3HRDD 3ZJUA 1SEBD 1YJJA 4ZRPA 1MVKA 2I38A 2L1AA 2WXIA 3NUHB 1VJKA 1HZ5A 4MM3B 4RFBA 1JMLA 1V8CA 4GDLB 1XXGA 5D3IB 2W54A 3I9V1 3W2DA 1JQ4A 1I4HA 4YWGG 5T8IA 1N60A 5HI1A 2ACZB 2KDMA 2IGGA 2W82A 1PYWD 3SFDB 1FO4A 4LLGM 1TY0A 3MFGA 1V1PB 2L52A 1BXTA 1HZ6A 2IDYA 2QJLA 2EELA 3IAS1 3KWLA 3U2SC 5BMGA 2QSDA 3PO0A 1RWSA 1C79A 1KH0A 3AEGB 2K22A 1L0XB 2V3PA 3MC0B 1TJEA 3AEDB 2BB5A 4A8XC 2PTLA 3BK1A 1IBXA 4ARIA 1FNVA 1FIQA 1FM0D 2BTEA 2ZW0A 4D2KA 1XO3A 1FMAD 4TQ1A 1E6EB 2HTME 4EE2A 4L2YA 1ZUD2 1L6UA 2LMCA 1AWDA 2M19A 3P4RB 1I4QA 3BVZA 2W3SA 2J42A 3E9SA 2BW2A 3U7ZA 3ABVB 1FFUA 2LEKA 4B0EA 5HHDG 1XCTL 1ZDXA 4O1NA 2PKOA 1WRIA 2V0GA 2WP9B 1C4CA 1NYQA 2WU5B 1F2RC 2MJ3A 2IGHA 3W1SA 5GXGB 3R8BA 5EE1A 1UNSA 2GI9A 1D4BA 1QILA 1NENB 2LHEA 5EE3A 2PIAA 2X38A 4Q2JA 2DLBA 1B9RA 1ESFA 1QOAA 4KX6B 4L1BA 2K9XA 1JWBD 1FCLA 2HDEA 3B9JA 3BYTB 3R2IA 1SJED 1HQRD 5FKAC 1L4ZB 1V1PA 4JWUC 1FFVA 1Q10A 2QILA 1ZXIA 3Q8BA 1WSPA 1ACCA 1EU3A 1L4DB 3KQ4A 1KFYB 3LXFA 1AW7A 2WDQB 1FRDA 2FUG1 1N62A 1Y56A 1OQRA 1WWTA 4YTNB 4DXFA 4A55A 2G9HD 2Y5CA 4NAMA 1E7PB 3HVZA 2JZPA 2RDHA 2RMMA 2W55A 1H7XA 2SEBD 3SEBA 1EM7A 5G5GA 1NEKB 3EUB2 3BK2A 4ZRQA 5BMIA 1L0YB 3N9YC 3HVDA 1VR9A 4RNAA 3AM9A 3AE5B 3AB5A 4OZAA 2LJIA 1KRHA 4ZYSA 1VLBA 4HRSA 4YTPB 1F77A 3P4PB 2J4XA 3Q8CA 1ZE3D 4RH6A 1T6BX 2Y5PA 4RF1A 1H7WA 3RFZB 3Q8EA 4R3DA 4DQOC 3WCQA 4OVZA 1GTHA 3VRBB 1OFFA 2JWUA 1TS5A 2VZKD 5TSSA 2L83A 1YN3A 1TY2A 3CWIA 1QQRA 2DWQA 1V97A 2JSVX 3EA6A 1GPXA 1CK1A 5BYRA 2PLPA 3W9CB 1D5ZC 1I4XA 5BMHA 3TEZA 1HXYD 4C7ZA 4A9AA 3C8YA 2N9KA 4TSSA 1DGJA 3AE7B 1I7HA 4ZHPA 3GB1A 1YMHE 2INNE 1N61A 1QOGA 1K50A 3P4QB 4ITKA 1QOBA 3TUOA 1QOFA 2FE8A 1PGAA 2ZW1A 2DYOA 4HKZE 4REZA 1ROEA 1C4AA 1J7AA 4NZLB 1L5PA 5D7GA 1JW9D 4HKQA 5FR3A 2KN4A 4RGOS 2L32A 1YN5A 3AEEB 1EU4A 2XNAC 2J52A 2WXKA 3BVGA 2WXNA 1WXQA 2DBYA 4YSXB 1QT9A 3UI3A 3AE2B 1CJEA 3PZ7A 4MACA 1JWMD 1XLNA 4ZHOA 1I4RA 1CZPA 2LUMA 2AQ3B 1FXIA 3P1MA 3T3NA 2IJ0A 2I2YA 2PMVA 1N5XA 4YSZB 1GAQB 2WXLA 4WURA 3IT4B 1WYGA 3FILB 1DOXA 3OWEB 3P42A 2CU3A 4UDUC 1KLUD 4JPSA 2QMTA 2QEJC 2WXHA 1MHXA 1OQQA 1LO5D 1TZOA 2J53A 4RGTA 1VZ8A 1AN8A 4N6EB 3P4SB 5HFYA 4USAA 4B0MA 2BS4B 2KACA 4PT5A 4FXCA 2WXRA 1V1OA 2WXQA 3BIID 4OZCA 1FNWA 2MJEA 4A6QA 5H8YE 4P16A 1E10A 1FCCC 2V4IB 4TQ0A 2LHDA 2YEPB 1C9FA 1GTEA 1JWSD 1SSNA 2K0PA 4KGSA 3AE3B 4YSYB 4OHJA 1SXTA 4JWSC 1FD6A 1FRRA 2KMMA 2WDRB 3AEAB 1SB3C 1BMLC 2K5PA 4WWMA 1ET6A 4GLSC 4TMAB 2WNMA 5JXVA 3J9CA 1FXAA 3MHZA 4L23A 2MJDA 3DWGC 1ZOYB 2WS3B 1NYRA 3Q8FA 1I4GA 1GB4A 4A90A 1KTKA 5BYSA 2JU6X 1FNUA 2BB6A 3GS2A 3KWVA 1NVID 3AN1A 3LYYA 1ZPSA 4WIPA 1BUIC 1TKYA 1D5XC 2AQ1B 3AEBB 2QIEB 3AE1B 4C80A 2WXGA 4YTMB 4JX1C 1XEEA 4GDKB 4C56C 3RPFC 3AMZA 2JXTA 2BYTA 3FILA 1E9MA 2MEKA 2RDGA 4MH8A 3ETRA 4LK0M 2CJOA 1EWCA 4KGTA 1F2RI 2OHFA 1SJHD 2JYEA 3AH7A 3I57A 4OW0A 1P7EA 2G1EA 2N0SB 3BWUD 3CF4A 2NTTA 4P6VF 1SE3A 3VR9B 1HEZE 2BS3B 3NVYA 4RCOA 1D6EC 4US9A 1DOYA 1N5WA 2H89B 4J3OD 5E6JA 1MPEA 5HG2A 3R2TA 1J7BA 4XDCA 1QLBB 1I4PA 2LGIA 4KKIA 4N58A 1IGCA 2KAJA 3Q69A 5I4DA 3LB8C 2AQ2B 2WXMA 3L4PA 3AEFB 3AE4B 1T3QA 4IDIA 5D3DA 1XLPA 2OEDA 1YNTE 4XE0A 4AS1A 1XLQA 1ZXHA 2GB1A 3NVZA 1TKEA 1VDVA 2PVGC 1R7SA 3GP7A 1DOIA 1UWMA 2AX5A 4XWWA 1MHHE 1GB1A 1RM6C 1XLOA 2SAKA 2B76B 1J7CA 4HJGE 4OZBA 5AUIA 4AQ7A 2BS2B 2BT6A 4RF0A 4US8A 3AE8B 1D5MC 5EE9A 3U52E 3SR6A 1K52A 3VRAB 1TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWT A;  1F0Z A;  3W5V B;  1TKG A;  2Q5W D;  2Y5C A;  3FC4 A;  1JRP A;  4N6E B;  2WLB A;  3P4S B;  1E7P B;  1PDX A;  3HVZ A;  3NVW A;  1JAL A;  2W55 A;  4USA A;  2BS4 B;  5C3J B;  1H7X A;  1E0Z A;  4FXC A;  3BII D;  5G5G A;  1SF0 A;  1NEK B;  2MJE A;  3EUB 2;  3SFE B;  1EWY C;  5H8Y E;  5MPO A;  1E10 A;  1AYF A;  4N59 A;  3P63 A;  1GTE A;  3HRD D;  3VR8 B;  3AE3 B;  4YSY B;  4JWS C;  3AM9 A;  1FRR A;  3AE5 B;  1YJJ A;  2KMM A;  2WDR B;  3AEA B;  1SB3 C;  3AB5 A;  1QF6 A;  2K5P A;  1KRH A;  4WWM A;  1VJK A;  1VLB A;  4HRS A;  4C7Y A;  4YTP B;  3NRZ A;  1FXA A;  2MJD A;  3DWG C;  1V8C A;  3P4P B;  3B2G A;  1ZOY B;  2WS3 B;  1NYR A;  2E3T A;  2W54 A;  1JQ4 A;  1H7W A;  1N60 A;  5H92 C;  2ACZ B;  3WCQ A;  1GTH A;  3VRB B;  1NVI D;  1OFF A;  3AN1 A;  1WGK A;  3SFD B;  1TKY A;  1FO4 A;  2WU2 B;  2L83 A;  2L52 A;  3KWL A;  4C80 A;  3CWI A;  2QJL A;  3AEB B;  2QIE B;  3AE1 B;  3PO0 A;  2WDV B;  1RWS A;  2DWQ A;  1L0V B;  4YTM B;  1V97 A;  4JX1 C;  3AEC B;  3AEG B;  1GPX A;  2K22 A;  3W9C B;  5G5H A;  1TJE A;  3RPF C;  4C7Z A;  3AED B;  3AMZ A;  4A9A A;  1E9M A;  1RYJ A;  2W3R A;  3ETR A;  2JX5 A;  1DGJ A;  1SIJ A;  2FBW B;  2CJO A;  3AE7 B;  1I7H A;  1FIQ A;  1FM0 D;  4ZHP A;  1XO3 A;  1FMA D;  1JRO A;  2OHF A;  3NS1 A;  1ZP0 B;  4YXD B;  1JWA D;  1N61 A;  1QOG A;  1E6E B;  2HTM E;  2PVO D;  3AH7 A;  3P4Q B;  1ZUD 2;  4ITK A;  1L6U A;  1QOB A;  1AWD A;  1QOF A;  3AE6 B;  2G1E A;  3P4R B;  2M19 A;  3CF4 A;  1L6V A;  2MH7 A;  2N0S B;  4P6V F;  3VR9 B;  2BS3 B;  3NVY A;  2W3S A;  3W5U B;  1YJI A;  4US9 A;  1PFD A;  1ROE A;  1J7A A;  1DOY A;  1N5W A;  3NVV A;  2H89 B;  1L5P A;  3CIR B;  1JW9 D;  2WQY B;  3ABV B;  1FFU A;  2LEK A;  1YQ4 B;  1A70 A;  3AE9 B;  2JQR B;  1J7B A;  3AEE B;  2EKI A;  5C2T B;  1QLB B;  2PKO A;  1WRI A;  4N58 A;  4WQM A;  3ZYY X;  2WP9 B;  1NYQ A;  1RFK A;  2WU5 B;  1KF6 B;  1WXQ A;  2KAJ A;  2DBY A;  2MJ3 A;  1GT8 A;  4YSX B;  1QT9 A;  3LB8 C;  3L4P A;  5GXG B;  1IUE A;  3AEF B;  3AE2 B;  3AE4 B;  2H88 B;  1CJE A;  1T3Q A;  5EE1 A;  4IDI A;  1XLN A;  4ZHO A;  1NEN B;  1XLP A;  1CZP A;  1OQR A;  3FAH A;  1YQ3 B;  1FXI A;  1XLQ A;  5EE3 A;  2PIA A;  3P1M A;  3NVZ A;  1N63 A;  1TKE A;  1TYG B;  4YT0 B;  1VDV A;  2PVG C;  4ZOH C;  3DWM A;  1R7S A;  1QOA A;  1B9R A;  4KX6 B;  1DOI A;  1NI3 A;  2K9X A;  1JWB D;  1UWM A;  1N5X A;  4YSZ B;  3B9J A;  2AX5 A;  1GAQ B;  4LTU A;  5AUK A;  1WYG A;  1DOX A;  1RM6 C;  1XLO A;  4JWU C;  2B76 B;  1J7C A;  1FFV A;  2CU3 A;  1ZXI A;  3B2F A;  5AUI A;  2BS2 B;  2CJN A;  2BT6 A;  4US8 A;  3AE8 B;  2M56 B;  5EE9 A;  4HRO A;  3SR6 A;  3HUI A;  1KFY B;  5EE0 A;  3AV8 A;  3LXF A;  2WDQ B;  1PUT A;  3VRA B;  1FRD A;  1OQQ A;  1N62 A;  4YTN B; 
#chains in the Genus database with same CATH topology
 2NTS A;  3IXS A;  3N30 A;  2M0A A;  4RGM A;  3W5V B;  1JRP A;  4WWN A;  5D6J B;  1PDX A;  4TKN A;  3WAP A;  4ANU A;  4EFO A;  2AL3 A;  5JH5 C;  1AYF A;  5HKH A;  3VR8 B;  2B3A A;  5DPS A;  1ET9 A;  3LDZ E;  4TUU A;  4W9D A;  4C7Y A;  3NRZ A;  4DHJ D;  2R2O A;  2LZ6 A;  2J7Q B;  3KH0 A;  1JWU D;  2ASQ A;  4JE3 B;  4XDD A;  3V61 A;  5CX3 A;  3SD5 A;  2WXP A;  2WU2 B;  4AJY B;  5C1Z A;  2KDB A;  2KDI A;  3NZS A;  2CHW A;  3BZD B;  2ON8 A;  3O13 A;  3QC8 B;  2L76 A;  1SIJ A;  1PGX A;  1QKZ A;  2C7M B;  4B6W A;  1SE2 A;  1EF5 A;  3NS1 A;  4KKJ A;  4F7Z A;  2ICI A;  5AEK B;  3DPD A;  2MH7 A;  4EOY A;  2D5G A;  1E90 A;  2GBM A;  3NVV A;  1R4M B;  1V49 A;  5JHB A;  3IHP C;  5L83 A;  1A70 A;  2JQR B;  4W9J A;  1HTO A;  1K51 A;  3WAO A;  2EKI A;  5C2T B;  2YEP F;  4AWJ A;  5DCN A;  1J8C A;  1XD3 B;  1NDD A;  3V3X A;  3PTF C;  2H88 B;  1MFW A;  3VDZ A;  3B0A A;  1YQ3 B;  1JCK B;  3IAM 1;  2ZPY A;  4M0W A;  2L0F A;  3W1Y A;  4ZOH C;  1NI3 A;  3BVM A;  4ANV A;  4DBG A;  2KLC A;  3B2F A;  1KOT A;  2C5L C;  1MG8 A;  2IO0 B;  4MT5 A;  4KGR A;  2J0M A;  2WHI A;  2Q5W D;  2WLB A;  1C77 A;  2OJR A;  3A1Q A;  4M8N A;  1V2Y A;  3MJ5 A;  2LXA A;  4CQN A;  1UD7 A;  3DQV A;  4N9F 4;  4MSQ B;  2UWQ A;  2KC2 A;  4BFR A;  3ZKJ C;  1T0Q C;  1OQY A;  4ZRP A;  3IFW B;  2JVC A;  2C7H A;  2AYO B;  3M62 B;  1JML A;  2AWT A;  2W54 A;  1JQ4 A;  2KDM A;  2IGG A;  5J17 A;  3SFD B;  2KK8 A;  3PV1 A;  4LLG M;  1HZ6 A;  2IDY A;  5BMG A;  4GIV A;  4NAW A;  2KOX A;  3VTU A;  3DOW A;  3SU8 X;  4NJ7 A;  3ZO5 B;  4HLE A;  3VAW A;  4W9K A;  3H7P B;  1WXV A;  2IO1 B;  4D2K A;  3TMP B;  1WJU A;  2O2V B;  5J2R A;  2HTM E;  1ZUD 2;  4W9I A;  3DBR I;  3RZW C;  2M19 A;  1I4Q A;  1AAR A;  2G3Q B;  2ZCB A;  2W3S A;  2ZCC A;  4BKS A;  3U7Z A;  3ABV B;  2I1J A;  2V0G A;  1FPY A;  1C4C A;  3FKY A;  2WU5 B;  2LGD A;  2IGH A;  2NPT A;  3W1S A;  5GXG B;  3DVG X;  3ZTC A;  1V80 A;  5EE1 A;  1UNS A;  1C3T A;  2RGF A;  1D4B A;  5KHQ A;  1NEN B;  3WAM A;  5EE3 A;  4GDL A;  2KVR A;  2BQQ A;  2DLB A;  2KWC A;  1RAX A;  2DNF A;  2K9X A;  1JWB D;  2HDE A;  3B9J A;  4BKT A;  5FKA C;  2INC C;  4JWU C;  1FFV A;  1ACC A;  1EU3 A;  1L4D B;  3DVN V;  2BF8 B;  3A9J B;  4DXA B;  4DXF A;  2L00 B;  3ZUN A;  2DEN B;  3QA8 A;  3PLV A;  2W55 A;  3QK0 A;  2LGX A;  2BPS A;  4IUM B;  5G5G A;  3EUB 2;  4MJS A;  1ZGU B;  2FAZ A;  5BMI A;  1HTQ A;  3HVD A;  3I3T B;  3AM9 A;  2L7R A;  2LJI A;  4BAX A;  5CHW A;  2KQ7 A;  3Q8C A;  1ZE3 D;  2IZV B;  2CHZ A;  3WCQ A;  1GTH A;  1YIW A;  2DAJ A;  2VZK D;  2MX2 A;  5G2N A;  4BOZ B;  4XGA B;  2DWQ A;  2GBK A;  2BYE A;  3EA6 A;  1D3Z A;  5AZF A;  3W9C B;  3AXC A;  4TSS A;  1TGZ B;  2D3B A;  3GB1 A;  1N61 A;  4HPM B;  3EHV A;  3DBL I;  3NG0 A;  1PGA A;  4HKZ E;  4DHJ B;  1ROE A;  1WM2 A;  1L5P A;  2XK5 B;  3Q6B A;  4PS8 A;  3AI5 A;  3B1L X;  2KN4 A;  2ZJD A;  2Z59 B;  4CO7 A;  4NPN A;  2MQJ A;  1S3S G;  3A9K B;  3ONS A;  4XC2 A;  4FAD A;  5DPR A;  2KWU B;  3K9P B;  2JUO A;  2N1V A;  4FHJ A;  4YSX B;  4HK2 A;  4BKS D;  3MC8 A;  4S0R A;  1T0R C;  4K3B A;  1CJE A;  3RUI B;  2AQ3 B;  2JT4 B;  3T3N A;  4B95 A;  2FID A;  2IJ0 A;  3CST A;  4AUQ C;  3S2A A;  3IT4 B;  1WYG A;  4UDU C;  4JPS A;  1WYW B;  4IG7 B;  3H9D A;  3B08 A;  3MTN B;  3TBL D;  2IBI B;  3UF8 A;  4B0M A;  4XX5 A;  2KAC A;  4KDL B;  4PT5 A;  2LI5 A;  2WXR A;  2WXQ A;  4HXD A;  4HDQ A;  2V9H A;  4A6Q A;  4P16 A;  1E10 A;  3M63 B;  1JWS D;  1SSN A;  2K0P A;  3VUX A;  4WQO B;  4W9L A;  1FD6 A;  3AEA B;  1SB3 C;  1BML C;  2YVC A;  3JSV B;  1KLV A;  3APD A;  1ET6 A;  4GLS C;  3O65 B;  3DWG C;  2EKE C;  1ZOY B;  2WS3 B;  1I4G A;  1KTK A;  1I42 A;  1UGM A;  2JU6 X;  3VH3 B;  3UQB A;  4BOS C;  2WXG A;  4MGI E;  4TV3 A;  4C56 C;  2KFJ A;  4PS3 A;  3VUY A;  2BYT A;  3ETR A;  2CJO A;  1GC7 A;  2K8B A;  1SJH D;  1P7E A;  1WE6 A;  4P6V F;  1SE3 A;  1DOY A;  2H89 B;  1X1M A;  2DZM A;  3R2T A;  2C9W B;  2LGI A;  1TIF A;  4KKI A;  1IGC A;  2V3S A;  5I4D A;  1MG4 A;  3AEF B;  1WE7 A;  1YNT E;  2WX1 A;  3NVZ A;  1I35 A;  1TKE A;  2PVG C;  2KMA A;  1R7S A;  1DOI A;  2WWZ A;  4XWW A;  3WIM A;  1MHH E;  1GB1 A;  1RM6 C;  1XLO A;  4HJG E;  1JRU A;  2CS4 A;  2A4Z A;  3L16 A;  3PRP B;  4GDK A;  4G50 A;  1F0Z A;  2JYT A;  1SBB B;  3PZ8 A;  2N9E B;  5C3J B;  3HHM A;  3PLU A;  1TS3 A;  3V05 A;  1VZ6 A;  4HJK A;  1K53 A;  1P9D U;  3X0W A;  3WAL A;  2K3U A;  2KTF A;  3T8M A;  1KJT A;  1PGB A;  2KYW A;  4IWP A;  5BYQ A;  2VH1 A;  3ZRF A;  3BY4 B;  4DXG A;  1GOZ A;  1QF6 A;  5IN7 A;  1IGD A;  4BBN F;  2Y5B B;  3RNG C;  3TEY A;  2Y3A A;  2E3T A;  3A33 B;  4M0W B;  4I6P A;  3ZGZ A;  5H92 C;  3EGR A;  1YN4 A;  2GRI A;  5IAA C;  1WGK A;  1OTR B;  1R4N I;  3TSS A;  3ZJV A;  2D3C A;  2K39 A;  2L0T A;  3RNF C;  1YX5 B;  3Q14 C;  2LD9 A;  4WWP A;  1RYJ A;  2W3R A;  4W9H A;  2JX5 A;  1E8Z A;  3D32 A;  3A1Q B;  1ZP0 B;  4YXD B;  3PHX B;  1GJZ A;  3N3K B;  1CQV A;  3T3O A;  1RFA A;  3VUW A;  3RYT A;  3HIZ A;  2Z0E B;  4GXB A;  4NJC A;  2WQY B;  1B1Z A;  3TEX A;  2KWD A;  2N4F A;  3KLS X;  2VZK B;  4WWO A;  3JW0 X;  1E8W A;  3N32 A;  1KF6 B;  5FK9 C;  4LNI A;  4JLC A;  1RLF A;  3ZJT A;  3DHH C;  3OAW A;  2PE6 B;  3U4E G;  1E7U A;  1YJ1 A;  3FAH A;  4LCD E;  4NAW B;  3DWM A;  4HVB A;  4C4V A;  4LTU A;  1UWX A;  3N20 C;  2GBN A;  2CJN A;  2N7E A;  3NOB A;  1VRA B;  3NZ3 A;  2DZJ A;  4KSL C;  1K8R B;  4I6L B;  1Y8R C;  4LDT D;  1UEL A;  3RZF A;  3FC4 A;  3RN9 C;  4HEA 1;  1M4V A;  4F1S A;  2WX0 A;  2R2Q A;  4LJP B;  1ZDV A;  4M01 A;  3NS8 A;  2WXJ A;  4K3C A;  5LXH A;  3MP9 A;  5LNK 1;  1N6Z A;  2DZI A;  2KO3 A;  2QCZ A;  2NPT B;  2KAN A;  3DBR B;  3KUD B;  3RNE C;  1MVK A;  2MSE D;  3NUH B;  4MGY E;  4GDL B;  2LVO A;  3I9V 1;  1ISN A;  1IP9 A;  1FO4 A;  3MFG A;  2L52 A;  3IAS 1;  1BXT A;  2EEL A;  2QSD A;  4GMV A;  1C79 A;  1KH0 A;  2CKH B;  2K22 A;  2V3P A;  3MC0 B;  3AED B;  2BB5 A;  2O6V A;  3Q3O C;  4GN1 A;  2PTL A;  4YL8 A;  1FNV A;  1FM0 D;  2XBB C;  2BTE A;  1LQB A;  2EMS A;  2LVP A;  1E6E B;  5FR6 A;  1L6U A;  2RD0 A;  3P4R B;  4MJS B;  3BVZ A;  3E9S A;  2BW2 A;  2LEK A;  3ZNG C;  2PKO A;  1NYQ A;  1F2R C;  4S17 A;  2KJH B;  2LHE A;  4MM3 A;  4K7S A;  4Q2J A;  4DHZ E;  1B9R A;  4L1B A;  4KX6 B;  2KFK A;  3V6C B;  3GZN B;  3ZXV A;  1L4Z B;  1V1P A;  2KX3 A;  3Q8B A;  1T0S C;  3VFK A;  2M17 A;  2BKF A;  2WDQ B;  1FRD A;  2FUG 1;  4YTN B;  2G9H D;  1PQS A;  2K6Q A;  1E7P B;  2JZP A;  4PYU A;  3VTV A;  2ZNV C;  3PGE A;  2SEB D;  3SEB A;  1EM7 A;  1VD2 A;  4IM2 A;  2N1W A;  1L0Y B;  3DBL B;  3N9Y C;  1VR9 A;  4PS7 A;  3AB5 A;  4WAA A;  4ZYS A;  1KRH A;  1VLB A;  2IY0 B;  3P4P B;  2J4X A;  3RNB C;  3RFZ B;  3Q8E A;  4DDI D;  4OVZ A;  1OFF A;  5TSS A;  3RNA C;  1YN3 A;  4ANW A;  3CWI A;  3U8Z A;  1QQR A;  4G3X B;  4QAY A;  2LAS A;  2DHZ A;  5G55 A;  1EUV B;  2JRH A;  1I4X A;  4C7Z A;  4G0N B;  3C8Y A;  1V6E A;  1DGJ A;  1P98 A;  1I7H A;  4ZHP A;  2MP2 A;  2HTH A;  2INN E;  1GC6 A;  4KIK A;  2MBO A;  1QOG A;  4MGZ E;  1K50 A;  2O6V D;  2JZ3 B;  4XZ4 A;  4REZ A;  2M4N A;  3AEE B;  3I63 C;  3UQA A;  2FUH B;  4P1C C;  1E8X A;  3RUL A;  3AE2 B;  1I4R A;  2X8X X;  2NS5 A;  4BVU C;  3IBE A;  1GAQ B;  1E8Y A;  1DOX A;  3OWE B;  2WYQ A;  3P42 A;  5L95 C;  3WA0 A;  3MC9 A;  1KLU D;  1WGG A;  1E5W A;  2QEJ C;  1MHX A;  1AN8 A;  5HFY A;  3IVF A;  4FXC A;  3CSF A;  2JXX A;  4JGH B;  3BII D;  2L8J A;  2CHX A;  4OZC A;  4NNJ B;  3QWZ B;  5H8Y E;  5DPW A;  3PT2 B;  2V4I B;  2LHD A;  2L05 A;  4ICU A;  4GOC A;  4EZL A;  3AE3 B;  4KZC A;  5IA7 A;  1ZKH A;  4JWS C;  1FRR A;  4K1R B;  1IYF A;  4EZK A;  3J9C A;  4L23 A;  5AZG A;  4FJY A;  1GB4 A;  4A90 A;  4WJP A;  4KV2 A;  1P1A A;  2PE9 A;  3GS2 A;  3KWV A;  3LYY A;  3DVG Y;  1ZPS A;  1TKY A;  4LDT B;  2AQ1 B;  2G4D B;  3R3M A;  2QIE B;  3AE1 B;  4JX1 C;  2KN5 A;  4GDK B;  4EZJ A;  3FIL A;  4KVG B;  3A4R A;  2RDG A;  2AEH A;  3UIN B;  5LXI B;  2LGS A;  3NHE B;  1EWC A;  4K7W A;  4BKG A;  5IP4 D;  1WXS A;  2JYE A;  2UYZ B;  2L3Z A;  2G1E A;  3BWU D;  2NTT A;  1HEZ E;  1RRB A;  2N7D A;  4I6N B;  3PRM B;  4IM3 A;  4AJW A;  1J7B A;  1TT5 B;  4N58 A;  4KZ0 A;  3RI7 C;  4CYE A;  3L4P A;  2LXC A;  1R4M I;  3W1S C;  3AE4 B;  3KUZ A;  5D3D A;  3TJP A;  3ZDM C;  4AP4 C;  2LGY A;  2QC8 A;  1XLQ A;  4FUL A;  1UWM A;  4ZDV A;  2SAK A;  2ZPN A;  3C19 A;  2BS2 B;  5IKC M;  2BT6 A;  4US8 A;  3AE8 B;  1D5M C;  3QHT A;  3VVW B;  4EKU A;  1R4N B;  5E6P A;  3L10 B;  4HRS A;  2TSS A;  1WMH A;  4HPP A;  3ZLZ A;  3DHI C;  4RGN A;  1UUP A;  3Q8A A;  3SHQ A;  4NQK E;  1SF0 A;  2IND C;  4XWT A;  1OEY A;  4ZRJ A;  4MSM B;  4NQL B;  3H1U A;  3L13 A;  4LNO A;  3B2G A;  2IGD A;  1HE8 A;  3TEW A;  4C4V B;  4F8C B;  3URY A;  2OJW A;  1S1Q B;  1C76 A;  2N9L A;  1L0V B;  4MH0 E;  1C4P A;  4PYZ A;  1P7F A;  3ZQ4 A;  2UU7 A;  4WAF A;  1WGY A;  2FBW B;  4JL9 A;  1JRO A;  1JWA D;  2PVO D;  3ZW3 A;  3AE6 B;  4OVV A;  1L6V A;  5E6O A;  2RSU A;  2INP E;  2NCN A;  3AU5 A;  2RPV A;  1YJI A;  1PFD A;  3VQI A;  4ZYN A;  2FCM A;  3CIR B;  2E6X A;  2FIF A;  2BWE S;  2KWV B;  3ZYY X;  1C78 A;  1RFK A;  4P7I A;  2MW5 A;  1GT8 A;  2A5U A;  1IUE A;  1SE4 A;  2ZNV B;  4H2A A;  3IT6 B;  4HCN B;  3ALB A;  1TYG B;  3PRZ A;  2BYF A;  4IOI E;  4ARC A;  2Z0D B;  2NMQ A;  1KLG D;  2O6V B;  5AUK A;  2R61 A;  1STE A;  3BYY B;  1WM3 A;  4HRO A;  2LRW A;  3HUI A;  2Z8L A;  5EE0 A;  5AZH A;  2IPK D;  4FN2 A;  1TKG A;  1Q1O A;  4ANX A;  1XCQ L;  2HE7 A;  5EDS A;  3H8H A;  4WH4 A;  1E0Z A;  4M02 A;  2EMT A;  2WXO A;  3SFE B;  1ENF A;  1EWY C;  2LWP A;  4N59 A;  3P63 A;  2GBJ A;  3K9O B;  2RR9 A;  1SEB D;  1YJJ A;  3TIX A;  2I38 A;  4P1B C;  1TZ1 A;  4BZA A;  4MM3 B;  4LNF A;  2CR5 A;  1V8C A;  3JYU A;  5D3I B;  4YWG G;  1N60 A;  2KFK B;  5HI1 A;  3R7R A;  2J0K A;  5DPT A;  3KWL A;  1V1P B;  3CMM B;  2KTR A;  2BGF A;  5D94 A;  1RWS A;  3Q3J A;  3AEG B;  1TJE A;  4KDI C;  3A4S C;  4A3P A;  3Q2A C;  1IBX A;  4W9C A;  4ARI A;  1WIA A;  1FIQ A;  2ZW0 A;  1XO3 A;  1FMA D;  2N9P C;  4EE2 A;  4L2Y A;  2LMC A;  1AWD A;  3ZNZ B;  3DBH I;  4RMA A;  1WI0 A;  2LRU A;  2J42 A;  1FFU A;  4LJO B;  5HHD G;  4URK A;  1XCT L;  1WRI A;  2KVZ A;  2K6D B;  2D07 B;  3R8B A;  2PIA A;  2X38 A;  2CU1 A;  3PPA A;  3BIN A;  3NJT A;  1FCL A;  2JF5 A;  3MHS D;  1J19 A;  3R2I A;  5C23 A;  1HQR D;  1Q10 A;  2QIL A;  2KLG A;  1YD8 U;  3C0R B;  2BWF A;  2MP2 B;  4HCP B;  3KQ4 A;  3LXF A;  4KIK B;  1WH3 A;  1N62 A;  1OQR A;  1Y56 A;  1WWT A;  2Y5C A;  1V86 A;  2RDH A;  2RMM A;  5CHV C;  1WGD A;  3MJW A;  3U7D A;  1ZW7 A;  3RMK C;  2KT7 A;  1NEK B;  3DHG C;  4C00 A;  3OG5 A;  2W9N A;  2DX5 B;  4RNA A;  3AE5 B;  4OZA A;  5KHO A;  4YTP B;  1F77 A;  4LNK A;  4RH6 A;  1H7W A;  4FA6 A;  4DQO C;  3VRB B;  3ZIM A;  2C7N B;  1H4R A;  3HK0 A;  1TY2 A;  1V97 A;  2LUE A;  1Z2M A;  1GPX A;  2PLP A;  1D5Z C;  1HXY D;  3LJ3 A;  2N9K A;  2NBW B;  3ECI A;  4MGK E;  1TTN A;  2V4L A;  4E3C A;  1MJD A;  4ITK A;  1QOB A;  3TUO A;  4JQW C;  2FE8 A;  3H6N A;  4HDO A;  1C4A A;  2QHO A;  3JVZ X;  1JW9 D;  1WZ3 A;  3RD2 A;  5FR3 A;  4RGO S;  1YN5 A;  2KZR A;  2C60 A;  2XNA C;  3BVG A;  3PZD A;  1G6J A;  1WXQ A;  2DBY A;  4RM8 A;  3UI3 A;  3Q3M C;  2JWZ A;  3PZ7 A;  1JWM D;  3GE8 C;  1CZP A;  2LUM A;  1SIF A;  3P1M A;  3VHT C;  3KYC D;  3Q3N C;  2HD5 B;  2PMV A;  1N5X A;  1L2N A;  3FIL B;  1KM7 A;  2CU3 A;  1SGH A;  1F9J A;  1YOV B;  2QMT A;  4E74 A;  2WXH A;  2KHW B;  1LO5 D;  2J53 A;  1H8C A;  1VZ8 A;  2MLB A;  4N6E B;  3P4S B;  3L08 A;  3PHW B;  2G4S A;  3EFC A;  2BS4 B;  2AL6 A;  4WJQ A;  3QX1 A;  4HWI B;  2MJE A;  1L7Y A;  4II3 B;  4TQ0 A;  2DYB A;  2YEP B;  3OJ3 A;  1GTE A;  5CTR C;  3OJ4 B;  5J18 A;  2WDT B;  4KGS A;  4YSY B;  4OHJ A;  1SXT A;  2D2Q A;  2I1K A;  2K5P A;  4WWM A;  2DZK A;  3HM3 A;  2WNM A;  1J0G A;  1FXA A;  3MHZ A;  1Q0W B;  2N9X A;  2BKR B;  2K8H A;  2NVU I;  5BYS A;  1WXM A;  4RM9 A;  1NVI D;  3AN1 A;  3EFU A;  4FJV B;  1D5X C;  1WR1 A;  2MWS B;  1XEE A;  3RPF C;  1V5O A;  2D11 A;  4MH8 A;  1WMH B;  4LK0 M;  1WX9 A;  4KGT A;  2OHF A;  3I57 A;  4OW0 A;  2REX A;  1V5T A;  2N0S B;  1LXD A;  3NVY A;  1D6E C;  1WX7 A;  1N5W A;  2PEA A;  1LFD A;  2NBV B;  4J3O D;  3V6E B;  3N1Z C;  1EF1 A;  4XDC A;  1WZ0 A;  1I4P A;  1Q5W B;  3LB8 C;  4AOF A;  4ICV A;  1T3Q A;  4W9E A;  4ZRI A;  1ZXH A;  3L54 A;  2KNB A;  4ZRK A;  4W9G A;  1E7V A;  3V62 A;  1GG3 A;  3APF A;  4PK1 A;  1J7C A;  5AUI A;  2KDF B;  2LJ5 A;  4RF0 A;  1LM8 B;  5EE9 A;  3SR6 A;  1K52 A;  3VRA B;  4BBN C;  4HPL B;  1TS2 A;  3APC A;  2DYM A;  1WFY A;  4IKG A;  1A5R A;  5IOI A;  2LFI A;  2WXF A;  1XF5 L;  3DVN U;  3PRE A;  3ZNI D;  1WF9 A;  2LVQ A;  4K81 A;  3UIO B;  2N7J A;  2BBC A;  1FEH A;  2KMC A;  2YLM A;  1U4A A;  4MEM A;  2KQ4 X;  1T0Y A;  3ML9 A;  3KYD D;  4J6I A;  2KDE B;  3PS6 A;  2VRR B;  3DDC B;  2WDV B;  2FCS A;  3AEC B;  2ZVN A;  3AUL A;  2GMI C;  2JPH A;  5G5H A;  1F1H A;  5JHA A;  5IO9 A;  1VZ7 A;  3HM6 X;  2KJR A;  3UGB B;  3IG3 A;  3ZXR A;  3W5U B;  2IYD B;  2KX0 A;  3OLM D;  1IPG A;  1YQ4 B;  3AE9 B;  2MBH A;  1HA5 A;  3E56 A;  2JZZ A;  2K1F A;  4WQM A;  3TCA A;  1XT9 B;  1Z5S B;  1V9J A;  2V3N A;  1UBQ A;  2XN9 C;  4E71 A;  2MBQ A;  2KTR B;  1N63 A;  2PW9 A;  4YT0 B;  1T5X D;  4IC7 B;  2IY1 B;  3KVF B;  1IBX B;  1UGJ A;  4KSK C;  2M56 B;  2JRI B;  3AV8 A;  4MDK E;  1TS4 A;  1PUT A;  2KD0 A;  2ZZP B;  3GZN I;  2ONQ A;  1C1Y B;  1MI0 A;  3NVW A;  1JAL A;  1DYQ A;  3R7Q A;  2D10 A;  5TR5 A;  5MPO A;  1WXA A;  3T9L A;  3HRD D;  3ZJU A;  2KC1 A;  3DBH B;  2K8C A;  1CMX B;  2L1A A;  2WXI A;  4ACF A;  1VJK A;  1HZ5 A;  4RFB A;  2PJH A;  1XXG A;  1M94 A;  5CHF A;  4GGQ A;  3W2D A;  1I4H A;  5T8I A;  3QJZ A;  2ACZ B;  1OEY J;  2W82 A;  1PYW D;  4FBJ B;  1SE9 A;  1TY0 A;  2QJL A;  3U2S C;  4DDG D;  3PO0 A;  1XQQ A;  1WRD B;  1L0X B;  3DCG A;  3QIJ A;  1UF0 A;  1UH6 A;  4A8X C;  3BK1 A;  3EEC A;  2KJ6 A;  3VTW A;  3CF6 E;  3PVL A;  3QCA A;  1GNU A;  4GU2 A;  4TQ1 A;  3TL5 A;  3RNC C;  4A20 A;  2VH2 A;  4LNN A;  4B0E A;  3DBS A;  1ZDX A;  4O1N A;  2WP9 B;  3U30 A;  2MJ3 A;  2KKC A;  2KQS A;  2GI9 A;  2MRP A;  1QIL A;  4MEL A;  2MA9 B;  2D3G A;  3ZNH B;  2MBB B;  4II2 B;  1ESF A;  1QOA A;  4A3O A;  1TBE A;  3BYT B;  2GLS A;  4G11 A;  2DAF A;  1SJE D;  1ZXI A;  3Q3F A;  1WSP A;  1WX8 A;  1NI2 A;  3SDL C;  1KFY B;  2G45 B;  4IM0 A;  1AW7 A;  1YQB A;  1UBI A;  2OOB B;  3P2B A;  4A55 A;  3VXW A;  2RPQ A;  1WJN A;  4NAM A;  4CHK A;  3H7P A;  3HVZ A;  3RCZ A;  3M95 A;  1H7X A;  2O2V A;  4M00 A;  3BK2 A;  2MBE A;  4ZRQ A;  2BYV E;  3L0W B;  4FLH A;  2XEW A;  4W9F A;  3ZRC A;  3RT3 B;  3AU4 A;  2FCQ A;  3QAR A;  1T6B X;  2Y5P A;  4RF1 A;  1LGR A;  4R3D A;  2M1M A;  3L17 A;  1P0R A;  2JWU A;  1TS5 A;  5BO4 B;  2L83 A;  3V60 A;  2MHJ A;  2JSV X;  2FNJ B;  1CK1 A;  5BYR A;  3TEZ A;  1WJ4 A;  5BMH A;  4A9A A;  4WJN A;  4DHZ B;  4FJZ A;  3AE7 B;  1YMH E;  2FCN A;  4IWQ A;  2M8S A;  1F52 A;  3A9J A;  3P4Q B;  1YX6 B;  1QOF A;  4WJO A;  3UIP B;  2ZVO A;  2ZW1 A;  2DYO A;  4GB9 A;  1J7A A;  4NZL B;  2PPH A;  2NR2 A;  5D7G A;  4HKQ A;  2M0X A;  2L32 A;  1NBF C;  1EU4 A;  2J52 A;  2WXK A;  2WXN A;  2HJ1 A;  1QT9 A;  2QDF A;  4X57 B;  1EO6 A;  4MAC A;  1XLN A;  4ZHO A;  4GSW A;  1FXI A;  4M8M A;  2I2Y A;  3VH4 B;  4YSZ B;  2WXL A;  4WUR A;  1WGR A;  2MCN B;  4NJ6 A;  3ZTD A;  2JY6 A;  3KW5 B;  1UZX B;  3N1Y C;  4EUT A;  1OQQ A;  1TZO A;  4RGT A;  4IWO A;  4B9K A;  4USA A;  1FXT B;  4IW0 A;  3ENE A;  1V1O A;  1WJ6 A;  1FNW A;  3ZDT A;  1FCC C;  4NY0 A;  4JIO U;  1C9F A;  1WR6 E;  4FHK A;  3NZU A;  2XK5 A;  2GOW A;  3ZVV A;  2KMM A;  2WDR B;  5JZE B;  3A9K A;  4TMA B;  5JXV A;  2MJD A;  1NYR A;  3Q8F A;  3I5J C;  3N1X C;  1FNU A;  2BB6 A;  2NBU A;  3QQ8 B;  4WIP A;  2IO3 B;  1BUI C;  3EC8 A;  4EEW A;  4OVU A;  2IO2 B;  3AEB B;  4C80 A;  3GOE A;  2K25 A;  4YTM B;  3H7S A;  1QZE A;  5E6N A;  3AMZ A;  2JXT A;  2WGS A;  1E9M A;  2MEK A;  3X23 A;  2V1Y A;  5LLI A;  2RDB C;  1F2R I;  3AH7 A;  1GUA B;  2KXJ A;  3CF4 A;  4DK5 A;  4K7U A;  3VR9 B;  2BS3 B;  3R66 C;  2BVC A;  3NY5 A;  4RCO A;  4US9 A;  1V81 A;  5E6J A;  1MPE A;  5HG2 A;  1P3Q U;  1QLB B;  1OGW A;  1VCB A;  2GBR A;  3M3J A;  1BT0 A;  2KAJ A;  3Q69 A;  1WGH A;  2AQ2 B;  2WXM A;  4ASW C;  4DWF A;  3JSV A;  4IDI A;  2J0J A;  1XLP A;  2OED A;  4XE0 A;  4AS1 A;  2GB1 A;  1VDV A;  2HJ8 A;  3GP7 A;  3PSE B;  2AX5 A;  5GMV A;  3QAQ A;  2B76 B;  1WY8 A;  4OZB A;  3ML8 A;  4AQ7 A;  3U52 E;  3GE3 C;  4XYC A;  3KUC B;  3WAN A;  2D3A A;  2ZEQ A;  5D2M B; 
#chains in the Genus database with same CATH homology
 2NTS A;  3IXS A;  1F0Z A;  2M0A A;  2JYT A;  4RGM A;  2TSS A;  3W5V B;  1JRP A;  1SBB B;  2DYM A;  1PDX A;  3PZ8 A;  4IKG A;  5C3J B;  4RGN A;  1UUP A;  3V05 A;  1TS3 A;  1VZ6 A;  1K53 A;  3Q8A A;  2LFI A;  2WXF A;  1XF5 L;  1SF0 A;  4XWT A;  2K3U A;  1AYF A;  1PGB A;  3VR8 B;  5BYQ A;  2N7J A;  2BBC A;  4DXG A;  1QF6 A;  1GOZ A;  1FEH A;  1ET9 A;  1IGD A;  4C7Y A;  3NRZ A;  3TEY A;  2Y3A A;  3B2G A;  2IGD A;  2KQ4 X;  2E3T A;  3ZGZ A;  3TEW A;  1JWU D;  5H92 C;  3EGR A;  4JE3 B;  4XDD A;  1YN4 A;  2GRI A;  3URY A;  1WGK A;  2WXP A;  1C76 A;  2WU2 B;  3TSS A;  3ZJV A;  2N9L A;  2WDV B;  1L0V B;  1C4P A;  3AEC B;  1P7F A;  5G5H A;  3ZQ4 A;  4WAF A;  1RYJ A;  3BZD B;  2W3R A;  2ON8 A;  3O13 A;  2JX5 A;  1SIJ A;  1PGX A;  1QKZ A;  2FBW B;  1VZ7 A;  1SE2 A;  1JRO A;  3NS1 A;  1ZP0 B;  4YXD B;  1JWA D;  2PVO D;  4KKJ A;  2ICI A;  3AE6 B;  2MH7 A;  1L6V A;  1CQV A;  3T3O A;  2INP E;  3W5U B;  2RPV A;  1YJI A;  1PFD A;  3VQI A;  2D5G A;  3NVV A;  4NJC A;  3CIR B;  2WQY B;  2E6X A;  1YQ4 B;  1A70 A;  3AE9 B;  1B1Z A;  1HA5 A;  2JQR B;  3E56 A;  3TEX A;  2KWD A;  1K51 A;  3KLS X;  2EKI A;  5C2T B;  2VZK B;  2YEP F;  4WQM A;  3ZYY X;  1C78 A;  1RFK A;  1KF6 B;  5FK9 C;  1GT8 A;  3V3X A;  3ZJT A;  1IUE A;  1SE4 A;  2H88 B;  4H2A A;  3U4E G;  2V3N A;  2XN9 C;  3IT6 B;  3FAH A;  1YQ3 B;  1JCK B;  3IAM 1;  1N63 A;  1TYG B;  4M0W A;  2PW9 A;  4YT0 B;  1T5X D;  4NAW B;  4ZOH C;  4IOI E;  3DWM A;  4ARC A;  1NI3 A;  2NMQ A;  3BVM A;  4LTU A;  1UWX A;  1KLG D;  5AUK A;  2R61 A;  3B2F A;  1STE A;  1IBX B;  1UGJ A;  2CJN A;  3BYY B;  1VRA B;  3NZ3 A;  2M56 B;  4HRO A;  3HUI A;  2Z8L A;  5EE0 A;  3AV8 A;  1TS4 A;  1PUT A;  4MT5 A;  4KGR A;  2IPK D;  1TKG A;  2Q5W D;  3FC4 A;  2ONQ A;  2WLB A;  1XCQ L;  1MI0 A;  4HEA 1;  3H8H A;  1M4V A;  3NVW A;  4WH4 A;  1JAL A;  1C77 A;  1E0Z A;  1DYQ A;  3MJ5 A;  2WXO A;  4CQN A;  1ZDV A;  3SFE B;  1ENF A;  1EWY C;  2WXJ A;  5MPO A;  3MP9 A;  4N59 A;  3P63 A;  5LNK 1;  3HRD D;  3ZJU A;  1SEB D;  1YJJ A;  4ZRP A;  1MVK A;  2I38 A;  2L1A A;  2WXI A;  3NUH B;  1VJK A;  1HZ5 A;  4MM3 B;  4RFB A;  1JML A;  1V8C A;  4GDL B;  1XXG A;  5D3I B;  2W54 A;  3I9V 1;  3W2D A;  1JQ4 A;  1I4H A;  4YWG G;  5T8I A;  1N60 A;  5HI1 A;  2ACZ B;  2KDM A;  2IGG A;  2W82 A;  1PYW D;  3SFD B;  1FO4 A;  4LLG M;  1TY0 A;  3MFG A;  1V1P B;  2L52 A;  1BXT A;  1HZ6 A;  2IDY A;  2QJL A;  2EEL A;  3IAS 1;  3KWL A;  3U2S C;  5BMG A;  2QSD A;  3PO0 A;  1RWS A;  1C79 A;  1KH0 A;  3AEG B;  2K22 A;  1L0X B;  2V3P A;  3MC0 B;  1TJE A;  3AED B;  2BB5 A;  4A8X C;  2PTL A;  3BK1 A;  1IBX A;  4ARI A;  1FNV A;  1FIQ A;  1FM0 D;  2BTE A;  2ZW0 A;  4D2K A;  1XO3 A;  1FMA D;  4TQ1 A;  1E6E B;  2HTM E;  4EE2 A;  4L2Y A;  1ZUD 2;  1L6U A;  2LMC A;  1AWD A;  2M19 A;  3P4R B;  1I4Q A;  3BVZ A;  2W3S A;  2J42 A;  3E9S A;  2BW2 A;  3U7Z A;  3ABV B;  1FFU A;  2LEK A;  4B0E A;  5HHD G;  1XCT L;  1ZDX A;  4O1N A;  2PKO A;  1WRI A;  2V0G A;  2WP9 B;  1C4C A;  1NYQ A;  2WU5 B;  1F2R C;  2MJ3 A;  2IGH A;  3W1S A;  5GXG B;  3R8B A;  5EE1 A;  1UNS A;  2GI9 A;  1D4B A;  1QIL A;  1NEN B;  2LHE A;  5EE3 A;  2PIA A;  2X38 A;  4Q2J A;  2DLB A;  1B9R A;  1ESF A;  1QOA A;  4KX6 B;  4L1B A;  2K9X A;  1JWB D;  1FCL A;  2HDE A;  3B9J A;  3BYT B;  3R2I A;  1SJE D;  1HQR D;  5FKA C;  1L4Z B;  1V1P A;  4JWU C;  1FFV A;  1Q10 A;  2QIL A;  1ZXI A;  3Q8B A;  1WSP A;  1ACC A;  1EU3 A;  1L4D B;  3KQ4 A;  1KFY B;  3LXF A;  1AW7 A;  2WDQ B;  1FRD A;  2FUG 1;  1N62 A;  1Y56 A;  1OQR A;  1WWT A;  4YTN B;  4DXF A;  4A55 A;  2G9H D;  2Y5C A;  4NAM A;  1E7P B;  3HVZ A;  2JZP A;  2RDH A;  2RMM A;  2W55 A;  1H7X A;  2SEB D;  3SEB A;  1EM7 A;  5G5G A;  1NEK B;  3EUB 2;  3BK2 A;  4ZRQ A;  5BMI A;  1L0Y B;  3N9Y C;  3HVD A;  1VR9 A;  4RNA A;  3AM9 A;  3AE5 B;  3AB5 A;  4OZA A;  2LJI A;  1KRH A;  4ZYS A;  1VLB A;  4HRS A;  4YTP B;  1F77 A;  3P4P B;  2J4X A;  3Q8C A;  1ZE3 D;  4RH6 A;  1T6B X;  2Y5P A;  4RF1 A;  1H7W A;  3RFZ B;  3Q8E A;  4R3D A;  4DQO C;  3WCQ A;  4OVZ A;  1GTH A;  3VRB B;  1OFF A;  2JWU A;  1TS5 A;  2VZK D;  5TSS A;  2L83 A;  1YN3 A;  1TY2 A;  3CWI A;  1QQR A;  2DWQ A;  1V97 A;  2JSV X;  3EA6 A;  1GPX A;  1CK1 A;  5BYR A;  2PLP A;  3W9C B;  1D5Z C;  1I4X A;  5BMH A;  3TEZ A;  1HXY D;  4C7Z A;  4A9A A;  3C8Y A;  2N9K A;  4TSS A;  1DGJ A;  3AE7 B;  1I7H A;  4ZHP A;  3GB1 A;  1YMH E;  2INN E;  1N61 A;  1QOG A;  1K50 A;  3P4Q B;  4ITK A;  1QOB A;  3TUO A;  1QOF A;  2FE8 A;  1PGA A;  2ZW1 A;  2DYO A;  4HKZ E;  4REZ A;  1ROE A;  1C4A A;  1J7A A;  4NZL B;  1L5P A;  5D7G A;  1JW9 D;  4HKQ A;  5FR3 A;  2KN4 A;  4RGO S;  2L32 A;  1YN5 A;  3AEE B;  1EU4 A;  2XNA C;  2J52 A;  2WXK A;  3BVG A;  2WXN A;  1WXQ A;  2DBY A;  4YSX B;  1QT9 A;  3UI3 A;  3AE2 B;  1CJE A;  3PZ7 A;  4MAC A;  1JWM D;  1XLN A;  4ZHO A;  1I4R A;  1CZP A;  2LUM A;  2AQ3 B;  1FXI A;  3P1M A;  3T3N A;  2IJ0 A;  2I2Y A;  2PMV A;  1N5X A;  4YSZ B;  1GAQ B;  2WXL A;  4WUR A;  3IT4 B;  1WYG A;  3FIL B;  1DOX A;  3OWE B;  3P42 A;  2CU3 A;  4UDU C;  1KLU D;  4JPS A;  2QMT A;  2QEJ C;  2WXH A;  1MHX A;  1OQQ A;  1LO5 D;  1TZO A;  2J53 A;  4RGT A;  1VZ8 A;  1AN8 A;  4N6E B;  3P4S B;  5HFY A;  4USA A;  4B0M A;  2BS4 B;  2KAC A;  4PT5 A;  4FXC A;  2WXR A;  1V1O A;  2WXQ A;  3BII D;  4OZC A;  1FNW A;  2MJE A;  4A6Q A;  5H8Y E;  4P16 A;  1E10 A;  1FCC C;  2V4I B;  4TQ0 A;  2LHD A;  2YEP B;  1C9F A;  1GTE A;  1JWS D;  1SSN A;  2K0P A;  4KGS A;  3AE3 B;  4YSY B;  4OHJ A;  1SXT A;  4JWS C;  1FD6 A;  1FRR A;  2KMM A;  2WDR B;  3AEA B;  1SB3 C;  1BML C;  2K5P A;  4WWM A;  1ET6 A;  4GLS C;  4TMA B;  2WNM A;  5JXV A;  3J9C A;  1FXA A;  3MHZ A;  4L23 A;  2MJD A;  3DWG C;  1ZOY B;  2WS3 B;  1NYR A;  3Q8F A;  1I4G A;  1GB4 A;  4A90 A;  1KTK A;  5BYS A;  2JU6 X;  1FNU A;  2BB6 A;  3GS2 A;  3KWV A;  1NVI D;  3AN1 A;  3LYY A;  1ZPS A;  4WIP A;  1BUI C;  1TKY A;  1D5X C;  2AQ1 B;  3AEB B;  2QIE B;  3AE1 B;  4C80 A;  2WXG A;  4YTM B;  4JX1 C;  1XEE A;  4GDK B;  4C56 C;  3RPF C;  3AMZ A;  2JXT A;  2BYT A;  3FIL A;  1E9M A;  2MEK A;  2RDG A;  4MH8 A;  3ETR A;  4LK0 M;  2CJO A;  1EWC A;  4KGT A;  1F2R I;  2OHF A;  1SJH D;  2JYE A;  3AH7 A;  3I57 A;  4OW0 A;  1P7E A;  2G1E A;  2N0S B;  3BWU D;  3CF4 A;  2NTT A;  4P6V F;  1SE3 A;  3VR9 B;  1HEZ E;  2BS3 B;  3NVY A;  4RCO A;  1D6E C;  4US9 A;  1DOY A;  1N5W A;  2H89 B;  4J3O D;  5E6J A;  1MPE A;  5HG2 A;  3R2T A;  1J7B A;  4XDC A;  1QLB B;  1I4P A;  2LGI A;  4KKI A;  4N58 A;  1IGC A;  2KAJ A;  3Q69 A;  5I4D A;  3LB8 C;  2AQ2 B;  2WXM A;  3L4P A;  3AEF B;  3AE4 B;  1T3Q A;  4IDI A;  5D3D A;  1XLP A;  2OED A;  1YNT E;  4XE0 A;  4AS1 A;  1XLQ A;  1ZXH A;  2GB1 A;  3NVZ A;  1TKE A;  1VDV A;  2PVG C;  1R7S A;  3GP7 A;  1DOI A;  1UWM A;  2AX5 A;  4XWW A;  1MHH E;  1GB1 A;  1RM6 C;  1XLO A;  2SAK A;  2B76 B;  1J7C A;  4HJG E;  4OZB A;  5AUI A;  4AQ7 A;  2BS2 B;  2BT6 A;  4RF0 A;  4US8 A;  3AE8 B;  1D5M C;  5EE9 A;  3U52 E;  3SR6 A;  1K52 A;  3VRA B;  1TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...