5C2TB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
250
structure length
250
Chain Sequence
b'KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 64
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 5c2tB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5c2tB01
5MPOA 1AWDA 3HUIA 2FBWB 1N5XA 3AMZA 1FMAD 4YTNB 1VLBA 1XLPA 1XLNA 2K22A 3RPFC 1GTHA 2MJ3A 1ZXIA 3AEEB 2L52A 1OQRA 1F0ZA 1QLBB 1PFDA 2WLBA 2HTME 1ZOYB 3B9JA 4IDIA 3L4PA 3NRZA 3P4QB 4KX6B 1EWYC 3VRAB 1JRPA 2H88B 1N60A 3DWMA 5C2TB 3AM9A 1QOGA 2Y5CA 4WQMA 5GXGB 1L6UA 1GT8A 2CU3A 1L5PA 1RWSA 1QOBA 1TJEA 1R7SA 5EE3A 1B9RA 3NVWA 1JQ4A 1J7CA 1A70A 3LB8C 2WU2B 4ITKA 1JW9D 1WYGA 4C7YA 5C3JB 4N58A 3BIID 4FXCA 3AE4B 3B2FA 1QOFA 3AEBB 1FRDA 3WCQA 2KMMA 1GPXA 4JWSC 3AECB 2WDVB 1SF0A 1RM6C 3B2GA 4WWMA 2PIAA 4LTUA 1TKGA 1L6VA 1JWBD 4YSXB 2W3RA 1V8CA 4USAA 1WGKA 2BS3B 3AV8A 3SR6A 3AE7B 4YSZB 1DOXA 1J7AA 1YJJA 2WP9B 2E3TA 1UWMA 2B76B 4US9A 1XLOA 3DWGC 1NEKB 1OFFA 3NVZA 3AB5A 5G5HA 3VR8B 1GTEA 3AE2B 1N61A 1DGJA 1T3QA 1WWTA 2K5PA 2M56B 3AN1A 2WDRB 4YTPB 3HRDD 5EE9A 1FXIA 4HROA 1L0VB 1E6EB 2JX5A 3NS1A 3NVVA 4N59A 4N6EB 3W9CB 3P4PB 3AE1B 3AEGB 4C7ZA 1NYQA 4P6VF 2WU5B 4US8A 3NVYA 3SFEB 1TKEA 1XLQA 2PKOA 1KRHA 1H7WA 3P4RB 3SFDB 2N0SB 2MJEA 3W5VB 2MH7A 3CF4A 4ZOHC 3FC4A 3P4SB 1FFVA 4ZHOA 5AUIA 1YQ3B 4YXDB 1DOYA 1OQQA 1JROA 1J7BA 2WS3B 1GAQB 1PUTA 3CIRB 2AX5A 1N62A 1NVID 1SIJA 3W5UB 1VDVA 1E9MA 3CWIA 1KF6B 5H92C 3VR9B 4YSYB 4ZHPA 1AYFA 5H8YE 1I7HA 1PDXA 2W55A 3ETRA 2QIEB 2PVOD 1E0ZA 1XO3A 1FXAA 1N5WA 3P63A 3AEFB 2BT6A 1FFUA 5EE1A 1SB3C 1NI3A 1WRIA 3KWLA 4JWUC 1QT9A 2WQYB 3ABVB 1NYRA 1NENB 2KAJA 4YT0B 1CZPA 1TYGB 1E10A 3AE3B 1E7PB 1VJKA 1ZUD2 3AEDB 4C80A 2CJOA 2DWQA 1QF6A 2OHFA 1CJEA 5EE0A 2L83A 5G5GA 2K9XA 2BS4B 2W3SA 1TKYA 1RYJA 1FM0D 1N63A 2G1EA 3EUB2 2H89B 1V97A 4HRSA 2WDQB 3FAHA 1ZP0B 1QOAA 3LXFA 2ACZB 2QJLA 3P1MA 3AH7A 1DOIA 2MJDA 2DBYA 1FRRA 1JWAD 2CJNA 3VRBB 1YJIA 1WXQA 1FO4A 2W54A 3AE8B 3AE6B 1ROEA 3HVZA 4A9AA 1H7XA 2JQRB 1IUEA 1YQ4B 1RFKA 2LEKA 2Q5WD 3AE9B 1JALA 1KFYB 2BS2B 3AE5B 1FIQA 2M19A 4JX1C 5AUKA 2PVGC 3PO0A 4YTMB 3ZYYX 3AEAB 2EKIA
chains in the Genus database with same CATH superfamily
4F8CB 1IBXA 4WWOA 4CYEA 3ZIMA 2K22A 4G0NB 2IGGA 4LNFA 1FPYA 1EWYC 2ONQA 3OAWA 1WX7A 2G3QB 1VD2A 1N6ZA 4MGIE 1JW9D 3BVGA 4C7YA 2KJRA 2NMQA 3PHWB 3H6NA 1SE4A 4HJGE 1Z5SB 2AYOB 1XT9B 3AU5A 2PTLA 3WAOA 1WGKA 1LO5D 3RNFC 4CQNA 5C1ZA 4W9CA 3DBRB 2WP9B 2MW5A 2FCNA 3RFZB 2IO0B 1ET6A 2M4NA 4P6VF 2WU5B 3KUDB 4OVZA 2GLSA 1XLQA 3WA0A 2PKOA 3M62B 5HG2A 3W1SA 2LJIA 3PRPB 3R2IA 4GIVA 3QAQA 2IBIB 2KN5A 1SJED 1AYFA 2X8XX 1E8YA 1E0ZA 2O6VB 2WWZA 4W9HA 3RZFA 5JHAA 1WXAA 1TY0A 1VZ8A 1NI3A 1WRIA 4AQ7A 3M3JA 4BKSA 3RNGC 4M8MA 3A9JB 1UGMA 2IDYA 4C80A 2LZ6A 2JYTA 3C0RB 2C60A 3DBLB 2IO1B 2IY1B 3A9KA 3AH7A 5EE1A 4E74A 2OJRA 4DXFA 2W54A 4PYUA 2J7QB 1I4GA 3AULA 2BGFA 1TT5B 3UINB 3CSTA 1HEZE 4BBNC 4JE3B 4GU2A 3VDZA 3AEAB 4L1BA 2FBWB 1XLPA 2BQQA 2MJ3A 2KWUB 4GGQA 1CK1A 3NRZA 3VH4B 2QC8A 4NQLB 1GT8A 2PJHA 2N1WA 4CO7A 2WU2B 2IJ0A 1UUPA 1QOFA 2C7NB 4FHJA 2KDFB 4IKGA 3C19A 3R3MA 3DHIC 4XDDA 3IXSA 4AWJA 2V3PA 1VR9A 2J4XA 2IPKD 3TJPA 4K7UA 4ZRIA 4JGHB 2EMTA 2G45B 2SEBD 3AE2B 1T3QA 4IG7B 4ACFA 2D3CA 3NVYA 1SXTA 2PMVA 5GMVA 2V3SA 1WGDA 2KC2A 3DOWA 1YQ3B 1ZE3D 4QAYA 2KYWA 3N9YC 1UBIA 3GS2A 2LMCA 2CR5A 4B9KA 4HKQA 3PRMB 2PVOD 4M0WA 1JWMD 3AI5A 2GBKA 3HHMA 2HD5B 3ABVB 3BVZA 1NENB 3IT6B 4YT0B 5L83A 2CKHB 2J0KA 3KQ4A 3L0WB 5IKCM 2XBBC 1TY2A 2L0TA 2G1EA 4DDID 2WX0A 1QOAA 3WIMA 2ZNVC 2V4IB 3E56A 5AZFA 1H7XA 1V9JA 4HJKA 1IUEA 1TGZB 4ZDVA 1P9DU 2JXTA 4JX1C 2WXOA 2KHWB 4YTMB 2RD0A 1Z2MA 3JW0X 4FA6A 1T6BX 1SEBD 4IM3A 1XLNA 1WZ3A 1GTHA 2LRWA 2L52A 1F0ZA 2HTME 4HVBA 5GXGB 3RUIB 1GG3A 3W1YA 2CU3A 3H7SA 3WAMA 2W82A 2IO2B 5D94A 4BKTA 5C3JB 2PW9A 3ZDTA 1L4ZB 2OJWA 2L0FA 3BINA 4ANUA 2UWQA 3SR6A 4FULA 4YWGG 3MHSD 3AE7B 1Y8RC 2A4ZA 1IYFA 3DWGC 4I6LB 1FXIA 3NS1A 3Q8BA 3SFEB 1GJZA 3P4RB 1IP9A 2HE7A 3A33B 3TMPB 1WMHA 2KJHB 4W9FA 2RR9A 2QDFA 3SDLC 4Q2JA 2JZPA 2AQ1B 4HWIB 5C23A 2OOBB 4MM3B 1E8ZA 2LGDA 5CX3A 3FKYA 2KACA 1JMLA 2D07B 1CZPA 3K9PB 3NY5A 3ZTCA 4KDIC 3PLUA 2M0XA 3Q8EA 3KLSX 3VUXA 3DBLI 2RDBC 3FAHA 4JWUC 4F7ZA 2BTEA 3ZRFA 4BVUC 1SSNA 1SBBB 3AE6B 2WXLA 3HVDA 4KKJA 5BMHA 1I4HA 4EZLA 2FCSA 2FCMA 5CTRC 1UD7A 2LUEA 4PS3A 1MG8A 2ZCBA 4TUUA 5BMIA 2NPTB 5KHOA 3OJ4B 4M0WB 3B9JA 4LJPB 4KX6B 1P98A 3TEYA 4AJWA 5E6OA 3EFCA 1R7SA 2MRPA 3NVWA 3C8YA 4MH0E 4N58A 4FXCA 3TEXA 2NVUI 3DCGA 2WX1A 4H2AA 1GPXA 4ARCA 4WH4A 3Q3MC 4C4VB 2MP2B 1V2YA 4IWOA 2J0MA 5BMGA 3RNAC 3MP9A 2E3TA 5FK9C 2N9PC 1P7EA 3VR8B 4B0MA 1KLUD 3O65B 2TSSA 1TZOA 5D2MB 5DCNA 1VCBA 2LVOA 2GOWA 4RCOA 2FAZA 2LGXA 4W9LA 1UELA 4RGTA 3NJTA 5KHQA 3T3NA 2BBCA 3PZ8A 3VR9B 4YSYB 4K3BA 1A5RA 4JPSA 2JWZA 4FN2A 3S2AA 1FXAA 2D10A 4G50A 4M02A 5BYSA 1PGAA 1L2NA 5HFYA 2WQYB 3AXCA 3RN9C 1TYGB 1GNUA 2XK5A 3PREA 3X0WA 2MBBB 4XWWA 3PLVA 1H8CA 2W3SA 1RAXA 3UIPB 3QARA 2FCQA 3OWEB 2ZEQA 4HRSA 1ZP0B 3P1MA 2ACZB 2LHEA 2J52A 4K7SA 4KSKC 2BYFA 3AE8B 5DPRA 1FNWA 4HK2A 1E7VA 3RMKC 4D2KA 1RFKA 4MEMA 3IBEA 4K1RB 2INCC 2JF5A 5IP4D 2G4SA 4BOZB 5AUKA 4GDLA 1WYWB 2ZVNA 4K81A 1OTRB 1I4QA 1AWDA 3TEWA 3VQIA 2K1FA 1MJDA 2INNE 2BKFA 2AQ2B 4DHZB 2N9XA 2XEWA 5FR6A 4AP4C 5L95C 2ZPNA 4P1BC 3QCAA 1Q10A 2WXNA 3B2GA 3PTFC 3PRZA 4W9EA 2BYEA 3ZGZA 1TS4A 4WAAA 3Q8CA 5LLIA 2LJ5A 2ZCCA 5E6NA 1PQSA 3VFKA 2QEJC 3RZWC 1C4PA 4OZBA 4US8A 2DZIA 2R2OA 4MSQB 2MH7A 1CMXB 4K7WA 4ZOHC 3N3KB 5DPWA 2ON8A 3RYTA 3A9JA 1FEHA 3KWVA 1E9MA 3CWIA 5G2NA 2KWCA 1UH6A 2L7RA 1V80A 4S0RA 4IM2A 2DNFA 4ZRJA 1C1YB 3PVLA 4IM0A 4EKUA 3B0AA 3R66C 2MWSB 1V5TA 2BS4B 3IT4B 3R7RA 3ZDMC 1YMHE 1RLFA 3GOEA 3B08A 3DDCB 1FCCC 2LGSA 2SAKA 2K8BA 2HJ8A 2QSDA 4BKSD 4WWPA 2INDC 1KFYB 1G6JA 3BK1A 2PVGC 5MPOA 2FUG1 3ZQ4A 3H1UA 4GXBA 5BYRA 1WGHA 2NS5A 4NJCA 1PFDA 4DXGA 2V4LA 4OVVA 1N60A 2H88B 2DAJA 1UNSA 2ZNVB 3O13A 1I4RA 1L5PA 1RWSA 1JQ4A 2XK5B 4ITKA 1HZ5A 2K25A 3B2FA 1KM7A 1FRDA 2ZPYA 3A1QB 4P1CC 4IUMB 1RM6C 1CQVA 2Z59B 3QA8A 4WJPA 1YN4A 1WX8A 1V8CA 1C4CA 2DHZA 1HE8A 1SE2A 1PGXA 1F2RC 5H8YE 2UYZB 3HRDD 2JX5A 2GB1A 4GDLB 3A4RA 4AJYB 3TUOA 2D3BA 3FC4A 3P4SB 1WJNA 4URKA 2DZKA 4NJ7A 1PDXA 1XO3A 4E3CA 1NI2A 3ZKJC 3H9DA 3H7PB 1D4BA 2KT7A 5LXIB 1TIFA 2JVCA 2K8CA 2DWQA 4A20A 3GZNB 3PZ7A 4WQOB 4RGNA 3MTNB 1E8WA 4WWNA 2CJNA 3DVNV 1ROEA 3ZVVA 2MA9B 4M00A 1T0SC 2LEKA 2NCNA 3UF8A 1JALA 2ZW1A 2YEPB 2M17A 4KV2A 1N5XA 3AMZA 3MC9A 3I3TB 2D11A 2OEDA 1BUIC 2EKEC 2GI9A 2L1AA 2DLBA 3DWMA 2Y5CA 4B95A 1TBEA 2JRHA 4YL8A 1L0YB 4ASWC 3ZXVA 1R4MB 1GB1A 1D6EC 3NZ3A 5JXVA 1ENFA 2FE8A 4HXDA 5DPTA 3VHTC 2KMMA 1J0GA 1SF0A 4WWMA 5IA7A 4NZLB 1L0XB 1R4NB 1BXTA 1TTNA 1TZ1A 4AUQC 3VXWA 3RT3B 1WM3A 1F9JA 4MM3A 3NVVA 3AEGB 2BB5A 4IC7B 2WGSA 2UU7A 2BKRB 3IFWB 4XE0A 1DOYA 1OQQA 2K39A 2CS4A 3IAS1 2CHWA 2K8HA 2LRUA 4MH8A 4WJNA 3MJWA 3BWUD 4P7IA 1WF9A 2WDTB 2AL6A 1DYQA 2AQ3B 2VRRB 1YX6B 1SE3A 1FCLA 2NBWB 3RNCC 3ENEA 4B0EA 2CU1A 1C3TA 1OEYJ 4DHZE 3UQBA 3GE3C 1SJHD 1N63A 3IAM1 2EMSA 2KMAA 3EUB2 3UIOB 2X38A 1DOIA 1FRRA 2NPTA 1H4RA 3Q2AC 4HDOA 1M4VA 1TS5A 4OVUA 3VAWA 1YD8U 1EWCA 3AE5B 2KANA 1YQBA 3GE8C 1I4XA 3DBSA 4GN1A 1FMAD 4YTNB 4ANVA 4WJQA 4BFRA 3VVWB 3NHEB 4C4VA 3RD2A 2MP2A 2I38A 4GB9A 3CF6E 4IWQA 3PGEA 4IWPA 2MEKA 3B1LX 1TJEA 4R3DA 1OGWA 3TEZA 4EUTA 2LASA 3KYDD 3OJ3A 1WE6A 3ZRCA 4KGTA 1DOXA 1UWMA 1HQRD 1I42A 1XLOA 1IPGA 2IYDB 5TR5A 1ZXHA 4PT5A 4KSLC 4C7ZA 1LQBA 3M63B 3QJZA 3Q3JA 1KRHA 3W5VB 4RMAA 5HHDG 4B6WA 2WS3B 1TS3A 2A5UA 4MSMB 2PLPA 4XYCA 4G3XB 3TIXA 5H92C 2KDBA 4BAXA 4ZHPA 4A55A 5DPSA 1T0RC 3DBRI 3AEFB 2BPSA 1OEYA 3HM3A 3Q6BA 1SB3C 4DDGD 2Z0DB 2J0JA 2CJOA 5FR3A 5G5GA 2K9XA 2JY6A 4J3OD 3P42A 1WM2A 4HCNB 3DPDA 2QJLA 2WXMA 3VUYA 4FHKA 1AARA 1WXQA 3BYYB 3UGBB 1HTQA 5CHFA 4I6PA 2ICIA 1SE9A 3Q8AA 2O2VA 2R61A 3SU8X 3L54A 2RMMA 3TL5A 1JWSD 3Q3OC 4RGOS 1D3ZA 2WXPA 2REXA 3VUWA 4LNIA 1WYGA 2KWVB 4LNKA 3AE4B 2I1JA 4PS8A 3WCQA 3RNBC 3V61A 2PIAA 4LTUA 4NPNA 4XDCA 3AV8A 3V05A 4S17A 3IVFA 1YJJA 4US9A 4W9KA 5CHVC 4PS7A 1WFYA 3P63A 4ZYSA 3VTUA 4MELA 2WDRB 4YTPB 3ZO5B 4M8NA 3FILB 3R2TA 2MBHA 4TKNA 1WR1A 4FLHA 2FIDA 1KH0A 2PE9A 5D3DA 2C7MB 3U2SC 2AX5A 1WH3A 2KK8A 3UI3A 1WSPA 4J6IA 2C5LC 3ETRA 1K53A 2IY0B 2L3ZA 2IGDA 3D32A 5JH5C 2KJ6A 4P16A 2KWDA 4OZAA 2BF8B 2DZJA 4IW0A 5IOIA 2MBQA 1V97A 4KZCA 2Y5BB 2VH1A 2KKCA 4I6NB 4MACA 3L16A 5AZHA 2KQ7A 5E6PA 3MC0B 4A9AA 2RPQA 3I9V1 1IGCA 2Q5WD 3IG3A 5TSSA 3AE9B 2QMTA 2BVCA 4BZAA 1FD6A 1V6EA 1F52A 3HUIA 3DVGY 3A1QA 4M01A 3WALA 3AEEB 3R8BA 4OHJA 3L4PA 1LXDA 1YN5A 2L8JA 2KX0A 3EECA 1J7CA 3EA6A 3L10B 3LB8C 3TBLD 1D5XC 3KUZA 1KTKA 2NTSA 5CHWA 1V5OA 3AECB 3ZNID 1MPEA 2MBOA 2K0PA 3DHHC 2LXAA 2GBJA 2KLGA 4A3OA 1WI0A 4N9F4 1QQRA 4XZ4A 4PYZA 1ZPSA 1NEKB 1RFAA 3NVZA 3ZXRA 2O2VB 2WXFA 5G5HA 1EM7A 3U30A 3IHPC 1L0VB 1E6EB 1U4AA 1QZEA 4GDKA 1HA5A 1ZDXA 3KW5B 4HDQA 2KDEB 3CF4A 3BYTB 2KO3A 4PK1A 3H7PA 1J7BA 2KFKB 3SHQA 3QQ8B 4EZJA 2VH2A 1KF6B 2N9LA 1SIFA 2MQJA 1E90A 2JXXA 2PPHA 2WYQA 4JL9A 1N5WA 2BT6A 1JCKB 4II2B 3ML9A 1F1HA 1MVKA 1AW7A 1V49A 1E7PB 3U7DA 2DAFA 2KTFA 4REZA 3ONSA 4BBNF 1WY8A 2WXIA 5E6JA 1L7YA 4RGMA 4L2YA 2MCNB 3L13A 4A3PA 2LD9A 3MFGA 2ZW0A 4MDKE 4ANWA 2RSUA 4DXAB 1GC7A 4FADA 3QIJA 4RH6A 2JPHA 1J19A 3DVNU 2QILA 1EUVB 1LM8B 2JU6X 1VLBA 2FUHB 4ZRQA 3BK2A 5HKHA 4IDIA 4A6QA 2KZRA 3P4QB 3AM9A 3VRAB 3Q3FA 2I1KA 2LVQA 1S1QB 4KZ0A 4TV3A 1QOBA 3BY4B 3NG0A 2KFJA 3AEBB 4WIPA 2WDVB 1T5XD 1D5MC 2C7HA 1L6VA 3U52E 3HM6X 2ZVOA 4A90A 4O1NA 4XX5A 3HK0A 2B76B 2RGFA 1OFFA 1WWTA 1GTEA 1N61A 3ZTDA 2DYMA 1P3QU 3LYYA 4DWFA 3W9CB 1XD3B 4LCDE 4XC2A 2WXQA 2WXRA 2D2QA 1GC6A 2BW2A 4MGKE 3DBHB 2KNBA 2KQ4X 1GAQB 1WJ4A 3V3XA 3W5UB 1VDVA 4MJSB 3HIZA 2HDEA 1NBFC 2V3NA 1P7FA 1K51A 1Q1OA 4NJ6A 5IAAC 2KLCA 4RFBA 4A8XC 2KOXA 4AS1A 4C56C 1F2RI 1P1AA 2LGIA 3ZLZA 3AE3B 2EELA 2C9WB 2KC1A 2OHFA 2L83A 1TKYA 1VRAB 4MGYE 4OW0A 2R2QA 2N7EA 1EO6A 4TMAB 1JWAD 2QCZA 3HVZA 4GDKB 2JQRB 3QC8B 3E9SA 2CHXA 3N30A 2AEHA 2KQSA 2FIFA 1EF1A 3APDA 1WXSA 2N7JA 3RULA 2WLBA 1KOTA 4WQMA 4MT5A 5C2TB 2KN4A 1QOGA 2Z0EB 2LHDA 1WX9A 1GB4A 2ZZPB 5HI1A 3QX1A 3BIID 2MBEA 1WIAA 1KLVA 4HPPA 4E71A 2W3RA 1MHHE 1HXYD 2KTRA 1OQYA 2D5GA 2PE6B 4K3CA 4W9DA 1EF5A 3BVMA 4W9JA 4XGAB 4RM8A 2BYVE 2WNMA 3BZDB 1V86A 1FNVA 3APFA 2CHZA 1MI0A 4G11A 1TKEA 2WHIA 1AN8A 1PGBA 4W9IA 4AOFA 3X23A 4ZHOA 2YEPF 4NNJB 1PUTA 4EOYA 1MFWA 3PT2B 5J2RA 1SIJA 3N1ZC 1WRDB 1C4AA 3MC8A 1FXTB 2DYBA 2W55A 3I5JC 3URYA 3I57A 1WJ6A 3RCZA 2LUMA 5JZEB 1E10A 1F77A 2XNAC 2ASQA 2NBUA 2BYTA 1FM0D 4C00A 1XF5L 2QHOA 4BOSC 3PV1A 4HEA1 5J17A 3JSVB 4DK5A 5D7GA 2GRIA 2ZJDA 4LLGM 3CMMB 1PYWD 4LNOA 4CHKA 4OZCA 2NTTA 4KVGB 3QK0A 2GBMA 2LI5A 2M19A 1IGDA 4FJVB 2RDGA 1OQRA 1YNTE 4NQKE 1ZOYB 5D6JB 1XCTL 4LDTD 1KJTA 1IBXB 3ALBA 1T0YA 3SEBA 5J18A 3FILA 1YIWA 4ZRKA 2MSED 4JWSC 4RNAA 4RF0A 4GLSC 4YSXB 4XWTA 4USAA 2N7DA 1V1OA 1T0QC 2G9HD 1EU4A 1GOZA 1WXMA 2N4FA 1ISNA 4N6EB 1NYQA 2JZZA 1D5ZC 1ZKHA 1YOVB 4II3B 3SFDB 4NAWA 5I4DA 3APCA 3V6CB 1STEA 4TSSA 3DBHI 3CIRB 2J42A 2BWFA 3A4SC 2LWPA 1JWUD 1K52A 3GP7A 1WJUA 3N20C 2LVPA 2KDIA 4WJOA 1ZGUB 3KUCB 2VZKB 2KAJA 3ML8A 1E8XA 1VJKA 1ZUD2 1LGRA 5FKAC 2KTRB 4KKIA 3U8ZA 4RF1A 1L4DB 4HPLB 1WXVA 2H89B 3GB1A 3LXFA 2NR2A 2DBYA 3V6EB 1YJIA 3OLMD 1FO4A 4NAMA 2IZVB 3Q14C 3SD5A 2KMCA 4JQWC 2RDHA 2I2YA 2M0AA 2JSVX 1QILA 5IN7A 1UGJA 3AU4A 3A9KB 3NUHB 2JWUA 4TQ1A 3GZNI 4HLEA 1ZXIA 1S3SG 3QWZB 3PSEB 1I4PA 3OG5A 3WAPA 5EE9A 1JRPA 3CSFA 3ZJTA 3MHZA 2N1VA 1E7UA 2V1YA 2AWTA 3LDZE 4LK0M 4DBGA 5G55A 4DHJD 2IGHA 2HJ1A 5AEKB 1MHXA 3ZNGC 4YSZB 2KFKA 4ICUA 4HPMB 2M56B 1DGJA 4NY0A 2KX3A 3P4PB 3AE1B 4GMVA 2WXKA 4EZKA 4ZYNA 1R4MI 1V1PA 4FJZA 2N0SB 3T8MA 1UF0A 4X57B 3PHXB 1JROA 1NVID 3ZW3A 1MG4A 1R4NI 3Q3NC 1VZ7A 3PPAA 5D3IB 3H8HA 1WZ0A 4HCPB 2G4DB 3J9CA 3VTWA 1NYRA 1M94A 3I63C 5IO9A 1E5WA 3KH0A 5JHBA 4LJOB 1XEEA 3T9LA 1X1MA 3NZSA 2LXCA 3RNEC 2WDQB 3L17A 5EDSA 1WGYA 4ANXA 2Y5PA 3W2DA 3K9OB 3ZNHB 4NAWB 2BWES 2LFIA 1C78A 3JVZX 3ZUNA 1Y56A 1FIQA 4FJYA 3DQVA 1YJ1A 4L23A 3PO0A 4F1SA 3EGRA 4EEWA 2K6DB 3V62A 3UQAA 3RPFC 4ZRPA 1TS2A 2BB6A 1QLBB 3VTVA 3EC8A 1C77A 3ECIA 1HZ6A 2JYEA 2AL3A 1L6UA 2O6VD 1B9RA 1WGRA 3JYUA 2DENB 1A70A 1GUAB 2K3UA 2L00B 2JZ3B 4KIKA 4EFOA 4KGRA 3R7QA 2Y3AA 1P0RA 2DX5B 3TSSA 5T8IA 2BS3B 3N1YC 4UDUC 1YX5B 2D3AA 2KVRA 4KGSA 1WE7A 2PEAA 4MJSA 1C9FA 5BO4B 5LNK1 2INPE 3Q8FA 2GMIC 1H7WA 1XQQA 1JRUA 4EE2A 3TCAA 3EHVA 4YXDB 1YN3A 1UBQA 3U7ZA 1K8RB 1I7HA 4FBJB 2L32A 3NOBA 4KDLB 3DHGC 3ZJVA 1B1ZA 4LDTB 3W1SC 3N1XC 3KWLA 1WR6E 3U4EG 1QT9A 1I35A 1WMHB 2WXJA 3AEDB 2KVZA 2WXHA 1Q5WB 3VH3B 1QF6A 2KXJA 1CJEA 4WURA 3T3OA 4ICVA 2KDMA 5LXHA 2GBNA 1SGHA 1BT0A 2L76A 1UZXB 3QHTA 3L08A 1V81A 3ZJUA 1V1PB 1YQ4B 1ESFA 1ZW7A 1ACCA 3DVGX 2YLMA 2JUOA 2K6QA 2J53A 2BS2B 4W9GA 2N9EB 3EFUA 1WGGA 3N32A 5AZGA 3Q69A 3P2BA 4MGZE 3NS8A 1XCQL 2DYOA 2IO3B 1RRBA 1K50A 1VZ6A 3RI7C 2O6VA 2MX2A 4ARIA 4RM9A 2M1MA 2JT4B 4GOCA 1TKGA 2W9NA 2D3GA 1JWBD 1XXGA 4IOIE 3KYCD 3M95A 1J7AA 4BKGA 2N9KA 1KLGD 2L05A 3AB5A 1ET9A 3AN1A 4TQ0A 2K5PA 3LJ3A 2GBRA 2JRIB 4HROA 4N59A 1C76A 2XN9C 2VZKD 5BYQA 2MJEA 1C79A 1FFVA 3ZNZB 2NBVB 5AUIA 3WANA 1UWXA 1ZDVA 4GSWA 1N62A 2Z8LA 3V60A 2DZMA 2WXGA 4JIOU 1FNUA 4WAFA 2KD0A 4LNNA 4DQOC 2QIEB 4HKZE 1QKZA 3JSVA 4KIKB 1FFUA 2RPVA 2E6XA 3KVFB 1Q0WB 2B3AA 1BMLC 2YVCA 4JLCA 2M8SA 5EE0A 3PS6A 4DHJB 2HTHA 1RYJA 2V0GA 2LGYA 1LFDA 5EE3A 2MJDA 3VRBB 3MJ5A 1HTOA 2MLBA 1NDDA 1J8CA 3PZDA 1EU3A 2FNJB 3NZUA 2V9HA 2MHJA 3ZYYX 2EKIA
chains in the Genus database with same CATH topology
1IGDA 1I4QA 1AWDA 2RMMA 1IBXA 1JWSD 4RGOS 2K22A 2RDGA 2IGGA 3TEWA 1OQRA 1YNTE 3VQIA 1ZOYB 2WXPA 1EWYC 2ONQA 2INNE 2AQ2B 1XCTL 1JW9D 1WYGA 3BVGA 4C7YA 1IBXB 2NMQA 3AE4B 3SEBA 3WCQA 3FILA 1Q10A 1SE4A 2WXNA 4JWSC 3B2GA 4HJGE 2PIAA 4LTUA 4RNAA 4RF0A 2PTLA 4GLSC 4YSXB 1TS4A 4XDCA 4USAA 4XWTA 1WGKA 3ZGZA 3AV8A 3V05A 3Q8CA 1LO5D 4CQNA 1V1OA 1YJJA 2G9HD 2WP9B 4US9A 1EU4A 2QEJC 3RFZB 3P63A 4ZYSA 1C4PA 2WDRB 4YTPB 4OZBA 1GOZA 3FILB 4N6EB 1ET6A 3R2TA 4US8A 1NYQA 4P6VF 2WU5B 4OVZA 1D5ZC 1XLQA 2PKOA 3SFDB 2MH7A 1KH0A 5I4DA 5D3DA 4ZOHC 5HG2A 3W1SA 1STEA 4TSSA 2LJIA 3U2SC 2ON8A 3R2IA 3CIRB 2AX5A 2J42A 3UI3A 1FEHA 3KWVA 1JWUD 1WSPA 1K52A 1E9MA 3CWIA 1SJED 1AYFA 3GP7A 3ETRA 1K53A 1E0ZA 2IGDA 1TY0A 1VZ8A 2VZKB 1NI3A 1WRIA 4AQ7A 4P16A 2KAJA 2KWDA 4OZAA 1VJKA 1ZUD2 5FKAC 4KKIA 2IDYA 4C80A 4RF1A 2JYTA 1L4DB 2BS4B 3IT4B 1YMHE 2H89B 1V97A 3GB1A 3LXFA 5EE1A 1FCCC 3AH7A 2DBYA 4MACA 1YJIA 2SAKA 4DXFA 1FO4A 4NAMA 2W54A 3MC0B 4A9AA 1I4GA 2QSDA 2RDHA 3I9V1 1IGCA 2Q5WD 2I2YA 5TSSA 3AE9B 1HEZE 1KFYB 2QMTA 2M0AA 4JE3B 3BK1A 2PVGC 2JSVX 1FD6A 1QILA 3AEAB 4L1BA 1UGJA 5MPOA 2FUG1 3HUIA 2FBWB 3ZQ4A 3NUHB 2JWUA 5BYRA 1XLPA 4TQ1A 2MJ3A 1ZXIA 4NJCA 3AEEB 3R8BA 4OHJA 1PFDA 1I4PA 1CK1A 4DXGA 3L4PA 3NRZA 5EE9A 1JRPA 1N60A 2H88B 1YN5A 1UNSA 3ZJTA 3MHZA 1GT8A 3O13A 1I4RA 1L5PA 1RWSA 1JQ4A 1J7CA 3EA6A 3LB8C 2WU2B 4ITKA 1HZ5A 1D5XC 2IJ0A 1UUPA 3B2FA 1KTKA 1QOFA 2NTSA 1FRDA 4LK0M 3AECB 1RM6C 1CQVA 1MPEA 4IKGA 2K0PA 4XDDA 1YN4A 3IXSA 1V8CA 2V3PA 1VR9A 2IGHA 1C4CA 2J4XA 2IPKD 1QQRA 1MHXA 4YSZB 1SE2A 1PGXA 1ZPSA 1NEKB 3NVZA 2SEBD 5G5HA 2WXFA 3AE2B 1T3QA 1DGJA 1EM7A 1F2RC 2M56B 5H8YE 3HRDD 1L0VB 1E6EB 2JX5A 3P4PB 3AE1B 2GB1A 4GDLB 3NVYA 1HA5A 2WXKA 1V1PA 1ZDXA 1SXTA 2N0SB 2PMVA 3TUOA 3CF4A 3BYTB 3FC4A 3P4SB 1YQ3B 1ZE3D 1JROA 1J7BA 3N9YC 1NVID 1KF6B 2N9LA 3GS2A 2LMCA 1PDXA 4HKQA 1VZ7A 4M0WA 2PVOD 3H8HA 5D3IB 1XO3A 1N5WA 1JWMD 2BT6A 1JCKB 3J9CA 1NYRA 3ABVB 3BVZA 1NENB 3IT6B 4YT0B 1D4BA 1MVKA 1AW7A 1E7PB 3KQ4A 4REZA 2DWQA 1XEEA 1TY2A 2G1EA 2WXIA 3PZ7A 4RGNA 2WDQB 5E6JA 1QOAA 2CJNA 4RGMA 4L2YA 2V4IB 1ROEA 3E56A 3MFGA 2ZW0A 1H7XA 2Y5PA 1IUEA 3W2DA 4NAWB 2LEKA 2LFIA 1C78A 1JALA 2ZW1A 1Y56A 1FIQA 2JXTA 4JX1C 4RH6A 4L23A 2WXOA 3PO0A 4YTMB 2YEPB 2QILA 3EGRA 1N5XA 1T6BX 3AMZA 2JU6X 1SEBD 1VLBA 2OEDA 1BUIC 1XLNA 3RPFC 1GTHA 4ZRPA 1TS2A 2BB6A 2L52A 1F0ZA 1QLBB 4ZRQA 2HTME 3BK2A 2GI9A 2L1AA 4IDIA 4A6QA 3P4QB 2DLBA 1C77A 3VRAB 3AM9A 3DWMA 5GXGB 2Y5CA 1HZ6A 2JYEA 1L6UA 2CU3A 1L0YB 1QOBA 1B9RA 1A70A 2W82A 1GB1A 1D6EC 3NZ3A 2K3UA 5C3JB 5JXVA 1ENFA 2FE8A 2PW9A 3AEBB 2KMMA 4KGRA 4WIPA 1L4ZB 2WDVB 1SF0A 1T5XD 4WWMA 1D5MC 2Y3AA 3TSSA 1L6VA 4NZLB 5T8IA 3U52E 3SR6A 2BS3B 4YWGG 1L0XB 4UDUC 3AE7B 1BXTA 4A90A 4O1NA 2B76B 3DWGC 4KGSA 1OFFA 1WWTA 1GTEA 1N61A 1C9FA 2DYMA 1FXIA 3LYYA 5LNK1 2INPE 3NS1A 3NVVA 3Q8FA 3Q8BA 3W9CB 3AEGB 2BB5A 3SFEB 2WXQA 1H7WA 3P4RB 2WXRA 4EE2A 2BW2A 4XE0A 4YXDB 1DOYA 1OQQA 2KQ4X 1GAQB 1YN3A 3IAS1 4MH8A 3V3XA 3W5UB 4Q2JA 3U7ZA 3BWUD 1VDVA 2JZPA 2AQ1B 2HDEA 4MM3B 2V3NA 1I7HA 1P7FA 1K51A 2L32A 1DYQA 2AQ3B 3ZJVA 1B1ZA 1SE3A 2KACA 1FCLA 4RFBA 4A8XC 3KWLA 3U4EG 4B0EA 1QT9A 4AS1A 4C56C 1JMLA 1F2RI 2WXJA 2LGIA 1CZPA 3AE3B 2EELA 3AEDB 2WXHA 3Q8EA 1QF6A 2OHFA 3KLSX 1CJEA 2L83A 1SJHD 1TKYA 1VRAB 4WURA 3T3OA 1N63A 3IAM1 2KDMA 3EUB2 4OW0A 3FAHA 4JWUC 2X38A 1DOIA 2BTEA 4TMAB 1FRRA 1JWAD 1SSNA 1SBBB 3AE6B 2WXLA 3HVZA 3HVDA 4GDKB 4KKJA 5BMHA 1I4HA 1M4VA 2JQRB 3ZJUA 1TS5A 1YQ4B 1ESFA 1V1PB 3E9SA 1ACCA 1EWCA 2J53A 2BS2B 3AE5B 1I4XA 1FMAD 4YTNB 5BMIA 3Q69A 2N7JA 2WLBA 3B9JA 4KX6B 4WQMA 4MT5A 3TEYA 5C2TB 2KN4A 1QOGA 2I38A 1XCQL 2DYOA 2LHDA 2MEKA 1TJEA 1R7SA 4R3DA 1K50A 3NVWA 1GB4A 1VZ6A 3C8YA 5HI1A 4N58A 3TEZA 3BIID 4FXCA 3TEXA 4ARIA 4H2AA 1GPXA 4ARCA 4WH4A 1TKGA 1JWBD 1XXGA 2W3RA 1MHHE 1HXYD 4IOIE 5BMGA 3MP9A 2D5GA 1DOXA 1J7AA 4KGTA 2N9KA 2E3TA 1UWMA 3BVMA 1KLGD 1HQRD 5FK9C 1XLOA 2WNMA 3BZDB 1P7EA 3AB5A 3VR8B 1ET9A 3AN1A 4B0MA 1FNVA 4TQ0A 1ZXHA 2K5PA 1KLUD 4PT5A 2TSSA 1TZOA 4HROA 4C7ZA 4N59A 1MI0A 1TKEA 1C76A 1KRHA 2VZKD 2XN9C 5BYQA 2MJEA 1AN8A 3W5VB 4RCOA 1PGBA 1C79A 1FFVA 4ZHOA 2YEPF 5AUIA 5HHDG 1UWXA 1PUTA 2WS3B 1TS3A 1ZDVA 4RGTA 1N62A 2Z8LA 3T3NA 1SIJA 2PLPA 2WXGA 2BBCA 1C4AA 3PZ8A 5H92C 3VR9B 4YSYB 1FNUA 4WAFA 4ZHPA 4JPSA 4A55A 2W55A 4DQOC 2QIEB 4HKZE 1FXAA 1QKZA 3AEFB 3URYA 5BYSA 3I57A 1FFUA 1PGAA 1SB3C 2RPVA 2E6XA 5HFYA 2WQYB 2LUMA 1TYGB 1BMLC 1E10A 1F77A 2XNAC 4XWWA 2BYTA 2CJOA 5FR3A 5EE0A 5G5GA 2K9XA 2W3SA 1RYJA 1FM0D 4J3OD 1XF5L 3P42A 2V0GA 3OWEB 4HEA1 4HRSA 1ZP0B 3P1MA 2ACZB 2QJLA 5EE3A 2LHEA 2MJDA 2J52A 2WXMA 3VRBB 1WXQA 3MJ5A 5D7GA 3BYYB 2GRIA 3AE8B 4LLGM 1FNWA 2ICIA 1EU3A 4D2KA 1PYWD 1RFKA 3Q8AA 2R61A 4OZCA 2NTTA 2M19A 5AUKA 3ZYYX 2EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MPO A;  1AWD A;  3HUI A;  2FBW B;  1N5X A;  3AMZ A;  1FMA D;  4YTN B;  1VLB A;  1XLP A;  1XLN A;  2K22 A;  3RPF C;  1GTH A;  2MJ3 A;  1ZXI A;  3AEE B;  2L52 A;  1OQR A;  1F0Z A;  1QLB B;  1PFD A;  2WLB A;  2HTM E;  1ZOY B;  3B9J A;  4IDI A;  3L4P A;  3NRZ A;  3P4Q B;  4KX6 B;  1EWY C;  3VRA B;  1JRP A;  2H88 B;  1N60 A;  3DWM A;  5C2T B;  3AM9 A;  1QOG A;  2Y5C A;  4WQM A;  5GXG B;  1L6U A;  1GT8 A;  2CU3 A;  1L5P A;  1RWS A;  1QOB A;  1TJE A;  1R7S A;  5EE3 A;  1B9R A;  3NVW A;  1JQ4 A;  1J7C A;  1A70 A;  3LB8 C;  2WU2 B;  4ITK A;  1JW9 D;  1WYG A;  4C7Y A;  5C3J B;  4N58 A;  3BII D;  4FXC A;  3AE4 B;  3B2F A;  1QOF A;  3AEB B;  1FRD A;  3WCQ A;  2KMM A;  1GPX A;  4JWS C;  3AEC B;  2WDV B;  1SF0 A;  1RM6 C;  3B2G A;  4WWM A;  2PIA A;  4LTU A;  1TKG A;  1L6V A;  1JWB D;  4YSX B;  2W3R A;  1V8C A;  4USA A;  1WGK A;  2BS3 B;  3AV8 A;  3SR6 A;  3AE7 B;  4YSZ B;  1DOX A;  1J7A A;  1YJJ A;  2WP9 B;  2E3T A;  1UWM A;  2B76 B;  4US9 A;  1XLO A;  3DWG C;  1NEK B;  1OFF A;  3NVZ A;  3AB5 A;  5G5H A;  3VR8 B;  1GTE A;  3AE2 B;  1N61 A;  1DGJ A;  1T3Q A;  1WWT A;  2K5P A;  2M56 B;  3AN1 A;  2WDR B;  4YTP B;  3HRD D;  5EE9 A;  1FXI A;  4HRO A;  1L0V B;  1E6E B;  2JX5 A;  3NS1 A;  3NVV A;  4N59 A;  4N6E B;  3W9C B;  3P4P B;  3AE1 B;  3AEG B;  4C7Z A;  1NYQ A;  4P6V F;  2WU5 B;  4US8 A;  3NVY A;  3SFE B;  1TKE A;  1XLQ A;  2PKO A;  1KRH A;  1H7W A;  3P4R B;  3SFD B;  2N0S B;  2MJE A;  3W5V B;  2MH7 A;  3CF4 A;  4ZOH C;  3FC4 A;  3P4S B;  1FFV A;  4ZHO A;  5AUI A;  1YQ3 B;  4YXD B;  1DOY A;  1OQQ A;  1JRO A;  1J7B A;  2WS3 B;  1GAQ B;  1PUT A;  3CIR B;  2AX5 A;  1N62 A;  1NVI D;  1SIJ A;  3W5U B;  1VDV A;  1E9M A;  3CWI A;  1KF6 B;  5H92 C;  3VR9 B;  4YSY B;  4ZHP A;  1AYF A;  5H8Y E;  1I7H A;  1PDX A;  2W55 A;  3ETR A;  2QIE B;  2PVO D;  1E0Z A;  1XO3 A;  1FXA A;  1N5W A;  3P63 A;  3AEF B;  2BT6 A;  1FFU A;  5EE1 A;  1SB3 C;  1NI3 A;  1WRI A;  3KWL A;  4JWU C;  1QT9 A;  2WQY B;  3ABV B;  1NYR A;  1NEN B;  2KAJ A;  4YT0 B;  1CZP A;  1TYG B;  1E10 A;  3AE3 B;  1E7P B;  1VJK A;  1ZUD 2;  3AED B;  4C80 A;  2CJO A;  2DWQ A;  1QF6 A;  2OHF A;  1CJE A;  5EE0 A;  2L83 A;  5G5G A;  2K9X A;  2BS4 B;  2W3S A;  1TKY A;  1RYJ A;  1FM0 D;  1N63 A;  2G1E A;  3EUB 2;  2H89 B;  1V97 A;  4HRS A;  2WDQ B;  3FAH A;  1ZP0 B;  1QOA A;  3LXF A;  2ACZ B;  2QJL A;  3P1M A;  3AH7 A;  1DOI A;  2MJD A;  2DBY A;  1FRR A;  1JWA D;  2CJN A;  3VRB B;  1YJI A;  1WXQ A;  1FO4 A;  2W54 A;  3AE8 B;  3AE6 B;  1ROE A;  3HVZ A;  4A9A A;  1H7X A;  2JQR B;  1IUE A;  1YQ4 B;  1RFK A;  2LEK A;  2Q5W D;  3AE9 B;  1JAL A;  1KFY B;  2BS2 B;  3AE5 B;  1FIQ A;  2M19 A;  4JX1 C;  5AUK A;  2PVG C;  3PO0 A;  4YTM B;  3ZYY X;  3AEA B;  2EKI A; 
#chains in the Genus database with same CATH topology
 4F8C B;  1IBX A;  4WWO A;  4CYE A;  3ZIM A;  2K22 A;  4G0N B;  2IGG A;  4LNF A;  1FPY A;  1EWY C;  2ONQ A;  3OAW A;  1WX7 A;  2G3Q B;  1VD2 A;  1N6Z A;  4MGI E;  1JW9 D;  3BVG A;  4C7Y A;  2KJR A;  2NMQ A;  3PHW B;  3H6N A;  1SE4 A;  4HJG E;  1Z5S B;  2AYO B;  1XT9 B;  3AU5 A;  2PTL A;  3WAO A;  1WGK A;  1LO5 D;  3RNF C;  4CQN A;  5C1Z A;  4W9C A;  3DBR B;  2WP9 B;  2MW5 A;  2FCN A;  3RFZ B;  2IO0 B;  1ET6 A;  2M4N A;  4P6V F;  2WU5 B;  3KUD B;  4OVZ A;  2GLS A;  1XLQ A;  3WA0 A;  2PKO A;  3M62 B;  5HG2 A;  3W1S A;  2LJI A;  3PRP B;  3R2I A;  4GIV A;  3QAQ A;  2IBI B;  2KN5 A;  1SJE D;  1AYF A;  2X8X X;  1E8Y A;  1E0Z A;  2O6V B;  2WWZ A;  4W9H A;  3RZF A;  5JHA A;  1WXA A;  1TY0 A;  1VZ8 A;  1NI3 A;  1WRI A;  4AQ7 A;  3M3J A;  4BKS A;  3RNG C;  4M8M A;  3A9J B;  1UGM A;  2IDY A;  4C80 A;  2LZ6 A;  2JYT A;  3C0R B;  2C60 A;  3DBL B;  2IO1 B;  2IY1 B;  3A9K A;  3AH7 A;  5EE1 A;  4E74 A;  2OJR A;  4DXF A;  2W54 A;  4PYU A;  2J7Q B;  1I4G A;  3AUL A;  2BGF A;  1TT5 B;  3UIN B;  3CST A;  1HEZ E;  4BBN C;  4JE3 B;  4GU2 A;  3VDZ A;  3AEA B;  4L1B A;  2FBW B;  1XLP A;  2BQQ A;  2MJ3 A;  2KWU B;  4GGQ A;  1CK1 A;  3NRZ A;  3VH4 B;  2QC8 A;  4NQL B;  1GT8 A;  2PJH A;  2N1W A;  4CO7 A;  2WU2 B;  2IJ0 A;  1UUP A;  1QOF A;  2C7N B;  4FHJ A;  2KDF B;  4IKG A;  3C19 A;  3R3M A;  3DHI C;  4XDD A;  3IXS A;  4AWJ A;  2V3P A;  1VR9 A;  2J4X A;  2IPK D;  3TJP A;  4K7U A;  4ZRI A;  4JGH B;  2EMT A;  2G45 B;  2SEB D;  3AE2 B;  1T3Q A;  4IG7 B;  4ACF A;  2D3C A;  3NVY A;  1SXT A;  2PMV A;  5GMV A;  2V3S A;  1WGD A;  2KC2 A;  3DOW A;  1YQ3 B;  1ZE3 D;  4QAY A;  2KYW A;  3N9Y C;  1UBI A;  3GS2 A;  2LMC A;  2CR5 A;  4B9K A;  4HKQ A;  3PRM B;  2PVO D;  4M0W A;  1JWM D;  3AI5 A;  2GBK A;  3HHM A;  2HD5 B;  3ABV B;  3BVZ A;  1NEN B;  3IT6 B;  4YT0 B;  5L83 A;  2CKH B;  2J0K A;  3KQ4 A;  3L0W B;  5IKC M;  2XBB C;  1TY2 A;  2L0T A;  2G1E A;  4DDI D;  2WX0 A;  1QOA A;  3WIM A;  2ZNV C;  2V4I B;  3E56 A;  5AZF A;  1H7X A;  1V9J A;  4HJK A;  1IUE A;  1TGZ B;  4ZDV A;  1P9D U;  2JXT A;  4JX1 C;  2WXO A;  2KHW B;  4YTM B;  2RD0 A;  1Z2M A;  3JW0 X;  4FA6 A;  1T6B X;  1SEB D;  4IM3 A;  1XLN A;  1WZ3 A;  1GTH A;  2LRW A;  2L52 A;  1F0Z A;  2HTM E;  4HVB A;  5GXG B;  3RUI B;  1GG3 A;  3W1Y A;  2CU3 A;  3H7S A;  3WAM A;  2W82 A;  2IO2 B;  5D94 A;  4BKT A;  5C3J B;  2PW9 A;  3ZDT A;  1L4Z B;  2OJW A;  2L0F A;  3BIN A;  4ANU A;  2UWQ A;  3SR6 A;  4FUL A;  4YWG G;  3MHS D;  3AE7 B;  1Y8R C;  2A4Z A;  1IYF A;  3DWG C;  4I6L B;  1FXI A;  3NS1 A;  3Q8B A;  3SFE B;  1GJZ A;  3P4R B;  1IP9 A;  2HE7 A;  3A33 B;  3TMP B;  1WMH A;  2KJH B;  4W9F A;  2RR9 A;  2QDF A;  3SDL C;  4Q2J A;  2JZP A;  2AQ1 B;  4HWI B;  5C23 A;  2OOB B;  4MM3 B;  1E8Z A;  2LGD A;  5CX3 A;  3FKY A;  2KAC A;  1JML A;  2D07 B;  1CZP A;  3K9P B;  3NY5 A;  3ZTC A;  4KDI C;  3PLU A;  2M0X A;  3Q8E A;  3KLS X;  3VUX A;  3DBL I;  2RDB C;  3FAH A;  4JWU C;  4F7Z A;  2BTE A;  3ZRF A;  4BVU C;  1SSN A;  1SBB B;  3AE6 B;  2WXL A;  3HVD A;  4KKJ A;  5BMH A;  1I4H A;  4EZL A;  2FCS A;  2FCM A;  5CTR C;  1UD7 A;  2LUE A;  4PS3 A;  1MG8 A;  2ZCB A;  4TUU A;  5BMI A;  2NPT B;  5KHO A;  3OJ4 B;  4M0W B;  3B9J A;  4LJP B;  4KX6 B;  1P98 A;  3TEY A;  4AJW A;  5E6O A;  3EFC A;  1R7S A;  2MRP A;  3NVW A;  3C8Y A;  4MH0 E;  4N58 A;  4FXC A;  3TEX A;  2NVU I;  3DCG A;  2WX1 A;  4H2A A;  1GPX A;  4ARC A;  4WH4 A;  3Q3M C;  4C4V B;  2MP2 B;  1V2Y A;  4IWO A;  2J0M A;  5BMG A;  3RNA C;  3MP9 A;  2E3T A;  5FK9 C;  2N9P C;  1P7E A;  3VR8 B;  4B0M A;  1KLU D;  3O65 B;  2TSS A;  1TZO A;  5D2M B;  5DCN A;  1VCB A;  2LVO A;  2GOW A;  4RCO A;  2FAZ A;  2LGX A;  4W9L A;  1UEL A;  4RGT A;  3NJT A;  5KHQ A;  3T3N A;  2BBC A;  3PZ8 A;  3VR9 B;  4YSY B;  4K3B A;  1A5R A;  4JPS A;  2JWZ A;  4FN2 A;  3S2A A;  1FXA A;  2D10 A;  4G50 A;  4M02 A;  5BYS A;  1PGA A;  1L2N A;  5HFY A;  2WQY B;  3AXC A;  3RN9 C;  1TYG B;  1GNU A;  2XK5 A;  3PRE A;  3X0W A;  2MBB B;  4XWW A;  3PLV A;  1H8C A;  2W3S A;  1RAX A;  3UIP B;  3QAR A;  2FCQ A;  3OWE B;  2ZEQ A;  4HRS A;  1ZP0 B;  3P1M A;  2ACZ B;  2LHE A;  2J52 A;  4K7S A;  4KSK C;  2BYF A;  3AE8 B;  5DPR A;  1FNW A;  4HK2 A;  1E7V A;  3RMK C;  4D2K A;  1RFK A;  4MEM A;  3IBE A;  4K1R B;  2INC C;  2JF5 A;  5IP4 D;  2G4S A;  4BOZ B;  5AUK A;  4GDL A;  1WYW B;  2ZVN A;  4K81 A;  1OTR B;  1I4Q A;  1AWD A;  3TEW A;  3VQI A;  2K1F A;  1MJD A;  2INN E;  2BKF A;  2AQ2 B;  4DHZ B;  2N9X A;  2XEW A;  5FR6 A;  4AP4 C;  5L95 C;  2ZPN A;  4P1B C;  3QCA A;  1Q10 A;  2WXN A;  3B2G A;  3PTF C;  3PRZ A;  4W9E A;  2BYE A;  3ZGZ A;  1TS4 A;  4WAA A;  3Q8C A;  5LLI A;  2LJ5 A;  2ZCC A;  5E6N A;  1PQS A;  3VFK A;  2QEJ C;  3RZW C;  1C4P A;  4OZB A;  4US8 A;  2DZI A;  2R2O A;  4MSQ B;  2MH7 A;  1CMX B;  4K7W A;  4ZOH C;  3N3K B;  5DPW A;  2ON8 A;  3RYT A;  3A9J A;  1FEH A;  3KWV A;  1E9M A;  3CWI A;  5G2N A;  2KWC A;  1UH6 A;  2L7R A;  1V80 A;  4S0R A;  4IM2 A;  2DNF A;  4ZRJ A;  1C1Y B;  3PVL A;  4IM0 A;  4EKU A;  3B0A A;  3R66 C;  2MWS B;  1V5T A;  2BS4 B;  3IT4 B;  3R7R A;  3ZDM C;  1YMH E;  1RLF A;  3GOE A;  3B08 A;  3DDC B;  1FCC C;  2LGS A;  2SAK A;  2K8B A;  2HJ8 A;  2QSD A;  4BKS D;  4WWP A;  2IND C;  1KFY B;  1G6J A;  3BK1 A;  2PVG C;  5MPO A;  2FUG 1;  3ZQ4 A;  3H1U A;  4GXB A;  5BYR A;  1WGH A;  2NS5 A;  4NJC A;  1PFD A;  4DXG A;  2V4L A;  4OVV A;  1N60 A;  2H88 B;  2DAJ A;  1UNS A;  2ZNV B;  3O13 A;  1I4R A;  1L5P A;  1RWS A;  1JQ4 A;  2XK5 B;  4ITK A;  1HZ5 A;  2K25 A;  3B2F A;  1KM7 A;  1FRD A;  2ZPY A;  3A1Q B;  4P1C C;  4IUM B;  1RM6 C;  1CQV A;  2Z59 B;  3QA8 A;  4WJP A;  1YN4 A;  1WX8 A;  1V8C A;  1C4C A;  2DHZ A;  1HE8 A;  1SE2 A;  1PGX A;  1F2R C;  5H8Y E;  2UYZ B;  3HRD D;  2JX5 A;  2GB1 A;  4GDL B;  3A4R A;  4AJY B;  3TUO A;  2D3B A;  3FC4 A;  3P4S B;  1WJN A;  4URK A;  2DZK A;  4NJ7 A;  1PDX A;  1XO3 A;  4E3C A;  1NI2 A;  3ZKJ C;  3H9D A;  3H7P B;  1D4B A;  2KT7 A;  5LXI B;  1TIF A;  2JVC A;  2K8C A;  2DWQ A;  4A20 A;  3GZN B;  3PZ7 A;  4WQO B;  4RGN A;  3MTN B;  1E8W A;  4WWN A;  2CJN A;  3DVN V;  1ROE A;  3ZVV A;  2MA9 B;  4M00 A;  1T0S C;  2LEK A;  2NCN A;  3UF8 A;  1JAL A;  2ZW1 A;  2YEP B;  2M17 A;  4KV2 A;  1N5X A;  3AMZ A;  3MC9 A;  3I3T B;  2D11 A;  2OED A;  1BUI C;  2EKE C;  2GI9 A;  2L1A A;  2DLB A;  3DWM A;  2Y5C A;  4B95 A;  1TBE A;  2JRH A;  4YL8 A;  1L0Y B;  4ASW C;  3ZXV A;  1R4M B;  1GB1 A;  1D6E C;  3NZ3 A;  5JXV A;  1ENF A;  2FE8 A;  4HXD A;  5DPT A;  3VHT C;  2KMM A;  1J0G A;  1SF0 A;  4WWM A;  5IA7 A;  4NZL B;  1L0X B;  1R4N B;  1BXT A;  1TTN A;  1TZ1 A;  4AUQ C;  3VXW A;  3RT3 B;  1WM3 A;  1F9J A;  4MM3 A;  3NVV A;  3AEG B;  2BB5 A;  4IC7 B;  2WGS A;  2UU7 A;  2BKR B;  3IFW B;  4XE0 A;  1DOY A;  1OQQ A;  2K39 A;  2CS4 A;  3IAS 1;  2CHW A;  2K8H A;  2LRU A;  4MH8 A;  4WJN A;  3MJW A;  3BWU D;  4P7I A;  1WF9 A;  2WDT B;  2AL6 A;  1DYQ A;  2AQ3 B;  2VRR B;  1YX6 B;  1SE3 A;  1FCL A;  2NBW B;  3RNC C;  3ENE A;  4B0E A;  2CU1 A;  1C3T A;  1OEY J;  4DHZ E;  3UQB A;  3GE3 C;  1SJH D;  1N63 A;  3IAM 1;  2EMS A;  2KMA A;  3EUB 2;  3UIO B;  2X38 A;  1DOI A;  1FRR A;  2NPT A;  1H4R A;  3Q2A C;  4HDO A;  1M4V A;  1TS5 A;  4OVU A;  3VAW A;  1YD8 U;  1EWC A;  3AE5 B;  2KAN A;  1YQB A;  3GE8 C;  1I4X A;  3DBS A;  4GN1 A;  1FMA D;  4YTN B;  4ANV A;  4WJQ A;  4BFR A;  3VVW B;  3NHE B;  4C4V A;  3RD2 A;  2MP2 A;  2I38 A;  4GB9 A;  3CF6 E;  4IWQ A;  3PGE A;  4IWP A;  2MEK A;  3B1L X;  1TJE A;  4R3D A;  1OGW A;  3TEZ A;  4EUT A;  2LAS A;  3KYD D;  3OJ3 A;  1WE6 A;  3ZRC A;  4KGT A;  1DOX A;  1UWM A;  1HQR D;  1I42 A;  1XLO A;  1IPG A;  2IYD B;  5TR5 A;  1ZXH A;  4PT5 A;  4KSL C;  4C7Z A;  1LQB A;  3M63 B;  3QJZ A;  3Q3J A;  1KRH A;  3W5V B;  4RMA A;  5HHD G;  4B6W A;  2WS3 B;  1TS3 A;  2A5U A;  4MSM B;  2PLP A;  4XYC A;  4G3X B;  3TIX A;  5H92 C;  2KDB A;  4BAX A;  4ZHP A;  4A55 A;  5DPS A;  1T0R C;  3DBR I;  3AEF B;  2BPS A;  1OEY A;  3HM3 A;  3Q6B A;  1SB3 C;  4DDG D;  2Z0D B;  2J0J A;  2CJO A;  5FR3 A;  5G5G A;  2K9X A;  2JY6 A;  4J3O D;  3P42 A;  1WM2 A;  4HCN B;  3DPD A;  2QJL A;  2WXM A;  3VUY A;  4FHK A;  1AAR A;  1WXQ A;  3BYY B;  3UGB B;  1HTQ A;  5CHF A;  4I6P A;  2ICI A;  1SE9 A;  3Q8A A;  2O2V A;  2R61 A;  3SU8 X;  3L54 A;  2RMM A;  3TL5 A;  1JWS D;  3Q3O C;  4RGO S;  1D3Z A;  2WXP A;  2REX A;  3VUW A;  4LNI A;  1WYG A;  2KWV B;  4LNK A;  3AE4 B;  2I1J A;  4PS8 A;  3WCQ A;  3RNB C;  3V61 A;  2PIA A;  4LTU A;  4NPN A;  4XDC A;  3AV8 A;  3V05 A;  4S17 A;  3IVF A;  1YJJ A;  4US9 A;  4W9K A;  5CHV C;  4PS7 A;  1WFY A;  3P63 A;  4ZYS A;  3VTU A;  4MEL A;  2WDR B;  4YTP B;  3ZO5 B;  4M8N A;  3FIL B;  3R2T A;  2MBH A;  4TKN A;  1WR1 A;  4FLH A;  2FID A;  1KH0 A;  2PE9 A;  5D3D A;  2C7M B;  3U2S C;  2AX5 A;  1WH3 A;  2KK8 A;  3UI3 A;  1WSP A;  4J6I A;  2C5L C;  3ETR A;  1K53 A;  2IY0 B;  2L3Z A;  2IGD A;  3D32 A;  5JH5 C;  2KJ6 A;  4P16 A;  2KWD A;  4OZA A;  2BF8 B;  2DZJ A;  4IW0 A;  5IOI A;  2MBQ A;  1V97 A;  4KZC A;  2Y5B B;  2VH1 A;  2KKC A;  4I6N B;  4MAC A;  3L16 A;  5AZH A;  2KQ7 A;  5E6P A;  3MC0 B;  4A9A A;  2RPQ A;  3I9V 1;  1IGC A;  2Q5W D;  3IG3 A;  5TSS A;  3AE9 B;  2QMT A;  2BVC A;  4BZA A;  1FD6 A;  1V6E A;  1F52 A;  3HUI A;  3DVG Y;  3A1Q A;  4M01 A;  3WAL A;  3AEE B;  3R8B A;  4OHJ A;  3L4P A;  1LXD A;  1YN5 A;  2L8J A;  2KX0 A;  3EEC A;  1J7C A;  3EA6 A;  3L10 B;  3LB8 C;  3TBL D;  1D5X C;  3KUZ A;  1KTK A;  2NTS A;  5CHW A;  1V5O A;  3AEC B;  3ZNI D;  1MPE A;  2MBO A;  2K0P A;  3DHH C;  2LXA A;  2GBJ A;  2KLG A;  4A3O A;  1WI0 A;  4N9F 4;  1QQR A;  4XZ4 A;  4PYZ A;  1ZPS A;  1NEK B;  1RFA A;  3NVZ A;  3ZXR A;  2O2V B;  2WXF A;  5G5H A;  1EM7 A;  3U30 A;  3IHP C;  1L0V B;  1E6E B;  1U4A A;  1QZE A;  4GDK A;  1HA5 A;  1ZDX A;  3KW5 B;  4HDQ A;  2KDE B;  3CF4 A;  3BYT B;  2KO3 A;  4PK1 A;  3H7P A;  1J7B A;  2KFK B;  3SHQ A;  3QQ8 B;  4EZJ A;  2VH2 A;  1KF6 B;  2N9L A;  1SIF A;  2MQJ A;  1E90 A;  2JXX A;  2PPH A;  2WYQ A;  4JL9 A;  1N5W A;  2BT6 A;  1JCK B;  4II2 B;  3ML9 A;  1F1H A;  1MVK A;  1AW7 A;  1V49 A;  1E7P B;  3U7D A;  2DAF A;  2KTF A;  4REZ A;  3ONS A;  4BBN F;  1WY8 A;  2WXI A;  5E6J A;  1L7Y A;  4RGM A;  4L2Y A;  2MCN B;  3L13 A;  4A3P A;  2LD9 A;  3MFG A;  2ZW0 A;  4MDK E;  4ANW A;  2RSU A;  4DXA B;  1GC7 A;  4FAD A;  3QIJ A;  4RH6 A;  2JPH A;  1J19 A;  3DVN U;  2QIL A;  1EUV B;  1LM8 B;  2JU6 X;  1VLB A;  2FUH B;  4ZRQ A;  3BK2 A;  5HKH A;  4IDI A;  4A6Q A;  2KZR A;  3P4Q B;  3AM9 A;  3VRA B;  3Q3F A;  2I1K A;  2LVQ A;  1S1Q B;  4KZ0 A;  4TV3 A;  1QOB A;  3BY4 B;  3NG0 A;  2KFJ A;  3AEB B;  4WIP A;  2WDV B;  1T5X D;  1D5M C;  2C7H A;  1L6V A;  3U52 E;  3HM6 X;  2ZVO A;  4A90 A;  4O1N A;  4XX5 A;  3HK0 A;  2B76 B;  2RGF A;  1OFF A;  1WWT A;  1GTE A;  1N61 A;  3ZTD A;  2DYM A;  1P3Q U;  3LYY A;  4DWF A;  3W9C B;  1XD3 B;  4LCD E;  4XC2 A;  2WXQ A;  2WXR A;  2D2Q A;  1GC6 A;  2BW2 A;  4MGK E;  3DBH B;  2KNB A;  2KQ4 X;  1GAQ B;  1WJ4 A;  3V3X A;  3W5U B;  1VDV A;  4MJS B;  3HIZ A;  2HDE A;  1NBF C;  2V3N A;  1P7F A;  1K51 A;  1Q1O A;  4NJ6 A;  5IAA C;  2KLC A;  4RFB A;  4A8X C;  2KOX A;  4AS1 A;  4C56 C;  1F2R I;  1P1A A;  2LGI A;  3ZLZ A;  3AE3 B;  2EEL A;  2C9W B;  2KC1 A;  2OHF A;  2L83 A;  1TKY A;  1VRA B;  4MGY E;  4OW0 A;  2R2Q A;  2N7E A;  1EO6 A;  4TMA B;  1JWA D;  2QCZ A;  3HVZ A;  4GDK B;  2JQR B;  3QC8 B;  3E9S A;  2CHX A;  3N30 A;  2AEH A;  2KQS A;  2FIF A;  1EF1 A;  3APD A;  1WXS A;  2N7J A;  3RUL A;  2WLB A;  1KOT A;  4WQM A;  4MT5 A;  5C2T B;  2KN4 A;  1QOG A;  2Z0E B;  2LHD A;  1WX9 A;  1GB4 A;  2ZZP B;  5HI1 A;  3QX1 A;  3BII D;  2MBE A;  1WIA A;  1KLV A;  4HPP A;  4E71 A;  2W3R A;  1MHH E;  1HXY D;  2KTR A;  1OQY A;  2D5G A;  2PE6 B;  4K3C A;  4W9D A;  1EF5 A;  3BVM A;  4W9J A;  4XGA B;  4RM8 A;  2BYV E;  2WNM A;  3BZD B;  1V86 A;  1FNV A;  3APF A;  2CHZ A;  1MI0 A;  4G11 A;  1TKE A;  2WHI A;  1AN8 A;  1PGB A;  4W9I A;  4AOF A;  3X23 A;  4ZHO A;  2YEP F;  4NNJ B;  1PUT A;  4EOY A;  1MFW A;  3PT2 B;  5J2R A;  1SIJ A;  3N1Z C;  1WRD B;  1C4A A;  3MC8 A;  1FXT B;  2DYB A;  2W55 A;  3I5J C;  3URY A;  3I57 A;  1WJ6 A;  3RCZ A;  2LUM A;  5JZE B;  1E10 A;  1F77 A;  2XNA C;  2ASQ A;  2NBU A;  2BYT A;  1FM0 D;  4C00 A;  1XF5 L;  2QHO A;  4BOS C;  3PV1 A;  4HEA 1;  5J17 A;  3JSV B;  4DK5 A;  5D7G A;  2GRI A;  2ZJD A;  4LLG M;  3CMM B;  1PYW D;  4LNO A;  4CHK A;  4OZC A;  2NTT A;  4KVG B;  3QK0 A;  2GBM A;  2LI5 A;  2M19 A;  1IGD A;  4FJV B;  2RDG A;  1OQR A;  1YNT E;  4NQK E;  1ZOY B;  5D6J B;  1XCT L;  4LDT D;  1KJT A;  1IBX B;  3ALB A;  1T0Y A;  3SEB A;  5J18 A;  3FIL A;  1YIW A;  4ZRK A;  2MSE D;  4JWS C;  4RNA A;  4RF0 A;  4GLS C;  4YSX B;  4XWT A;  4USA A;  2N7D A;  1V1O A;  1T0Q C;  2G9H D;  1EU4 A;  1GOZ A;  1WXM A;  2N4F A;  1ISN A;  4N6E B;  1NYQ A;  2JZZ A;  1D5Z C;  1ZKH A;  1YOV B;  4II3 B;  3SFD B;  4NAW A;  5I4D A;  3APC A;  3V6C B;  1STE A;  4TSS A;  3DBH I;  3CIR B;  2J42 A;  2BWF A;  3A4S C;  2LWP A;  1JWU D;  1K52 A;  3GP7 A;  1WJU A;  3N20 C;  2LVP A;  2KDI A;  4WJO A;  1ZGU B;  3KUC B;  2VZK B;  2KAJ A;  3ML8 A;  1E8X A;  1VJK A;  1ZUD 2;  1LGR A;  5FKA C;  2KTR B;  4KKI A;  3U8Z A;  4RF1 A;  1L4D B;  4HPL B;  1WXV A;  2H89 B;  3GB1 A;  3LXF A;  2NR2 A;  2DBY A;  3V6E B;  1YJI A;  3OLM D;  1FO4 A;  4NAM A;  2IZV B;  3Q14 C;  3SD5 A;  2KMC A;  4JQW C;  2RDH A;  2I2Y A;  2M0A A;  2JSV X;  1QIL A;  5IN7 A;  1UGJ A;  3AU4 A;  3A9K B;  3NUH B;  2JWU A;  4TQ1 A;  3GZN I;  4HLE A;  1ZXI A;  1S3S G;  3QWZ B;  3PSE B;  1I4P A;  3OG5 A;  3WAP A;  5EE9 A;  1JRP A;  3CSF A;  3ZJT A;  3MHZ A;  2N1V A;  1E7U A;  2V1Y A;  2AWT A;  3LDZ E;  4LK0 M;  4DBG A;  5G55 A;  4DHJ D;  2IGH A;  2HJ1 A;  5AEK B;  1MHX A;  3ZNG C;  4YSZ B;  2KFK A;  4ICU A;  4HPM B;  2M56 B;  1DGJ A;  4NY0 A;  2KX3 A;  3P4P B;  3AE1 B;  4GMV A;  2WXK A;  4EZK A;  4ZYN A;  1R4M I;  1V1P A;  4FJZ A;  2N0S B;  3T8M A;  1UF0 A;  4X57 B;  3PHX B;  1JRO A;  1NVI D;  3ZW3 A;  1MG4 A;  1R4N I;  3Q3N C;  1VZ7 A;  3PPA A;  5D3I B;  3H8H A;  1WZ0 A;  4HCP B;  2G4D B;  3J9C A;  3VTW A;  1NYR A;  1M94 A;  3I63 C;  5IO9 A;  1E5W A;  3KH0 A;  5JHB A;  4LJO B;  1XEE A;  3T9L A;  1X1M A;  3NZS A;  2LXC A;  3RNE C;  2WDQ B;  3L17 A;  5EDS A;  1WGY A;  4ANX A;  2Y5P A;  3W2D A;  3K9O B;  3ZNH B;  4NAW B;  2BWE S;  2LFI A;  1C78 A;  3JVZ X;  3ZUN A;  1Y56 A;  1FIQ A;  4FJY A;  3DQV A;  1YJ1 A;  4L23 A;  3PO0 A;  4F1S A;  3EGR A;  4EEW A;  2K6D B;  3V62 A;  3UQA A;  3RPF C;  4ZRP A;  1TS2 A;  2BB6 A;  1QLB B;  3VTV A;  3EC8 A;  1C77 A;  3ECI A;  1HZ6 A;  2JYE A;  2AL3 A;  1L6U A;  2O6V D;  1B9R A;  1WGR A;  3JYU A;  2DEN B;  1A70 A;  1GUA B;  2K3U A;  2L00 B;  2JZ3 B;  4KIK A;  4EFO A;  4KGR A;  3R7Q A;  2Y3A A;  1P0R A;  2DX5 B;  3TSS A;  5T8I A;  2BS3 B;  3N1Y C;  4UDU C;  1YX5 B;  2D3A A;  2KVR A;  4KGS A;  1WE7 A;  2PEA A;  4MJS A;  1C9F A;  5BO4 B;  5LNK 1;  2INP E;  3Q8F A;  2GMI C;  1H7W A;  1XQQ A;  1JRU A;  4EE2 A;  3TCA A;  3EHV A;  4YXD B;  1YN3 A;  1UBQ A;  3U7Z A;  1K8R B;  1I7H A;  4FBJ B;  2L32 A;  3NOB A;  4KDL B;  3DHG C;  3ZJV A;  1B1Z A;  4LDT B;  3W1S C;  3N1X C;  3KWL A;  1WR6 E;  3U4E G;  1QT9 A;  1I35 A;  1WMH B;  2WXJ A;  3AED B;  2KVZ A;  2WXH A;  1Q5W B;  3VH3 B;  1QF6 A;  2KXJ A;  1CJE A;  4WUR A;  3T3O A;  4ICV A;  2KDM A;  5LXH A;  2GBN A;  1SGH A;  1BT0 A;  2L76 A;  1UZX B;  3QHT A;  3L08 A;  1V81 A;  3ZJU A;  1V1P B;  1YQ4 B;  1ESF A;  1ZW7 A;  1ACC A;  3DVG X;  2YLM A;  2JUO A;  2K6Q A;  2J53 A;  2BS2 B;  4W9G A;  2N9E B;  3EFU A;  1WGG A;  3N32 A;  5AZG A;  3Q69 A;  3P2B A;  4MGZ E;  3NS8 A;  1XCQ L;  2DYO A;  2IO3 B;  1RRB A;  1K50 A;  1VZ6 A;  3RI7 C;  2O6V A;  2MX2 A;  4ARI A;  4RM9 A;  2M1M A;  2JT4 B;  4GOC A;  1TKG A;  2W9N A;  2D3G A;  1JWB D;  1XXG A;  4IOI E;  3KYC D;  3M95 A;  1J7A A;  4BKG A;  2N9K A;  1KLG D;  2L05 A;  3AB5 A;  1ET9 A;  3AN1 A;  4TQ0 A;  2K5P A;  3LJ3 A;  2GBR A;  2JRI B;  4HRO A;  4N59 A;  1C76 A;  2XN9 C;  2VZK D;  5BYQ A;  2MJE A;  1C79 A;  1FFV A;  3ZNZ B;  2NBV B;  5AUI A;  3WAN A;  1UWX A;  1ZDV A;  4GSW A;  1N62 A;  2Z8L A;  3V60 A;  2DZM A;  2WXG A;  4JIO U;  1FNU A;  4WAF A;  2KD0 A;  4LNN A;  4DQO C;  2QIE B;  4HKZ E;  1QKZ A;  3JSV A;  4KIK B;  1FFU A;  2RPV A;  2E6X A;  3KVF B;  1Q0W B;  2B3A A;  1BML C;  2YVC A;  4JLC A;  2M8S A;  5EE0 A;  3PS6 A;  4DHJ B;  2HTH A;  1RYJ A;  2V0G A;  2LGY A;  1LFD A;  5EE3 A;  2MJD A;  3VRB B;  3MJ5 A;  1HTO A;  2MLB A;  1NDD A;  1J8C A;  3PZD A;  1EU3 A;  2FNJ B;  3NZU A;  2V9H A;  2MHJ A;  3ZYY X;  2EKI A; 
#chains in the Genus database with same CATH homology
 1IGD A;  1I4Q A;  1AWD A;  2RMM A;  1IBX A;  1JWS D;  4RGO S;  2K22 A;  2RDG A;  2IGG A;  3TEW A;  1OQR A;  1YNT E;  3VQI A;  1ZOY B;  2WXP A;  1EWY C;  2ONQ A;  2INN E;  2AQ2 B;  1XCT L;  1JW9 D;  1WYG A;  3BVG A;  4C7Y A;  1IBX B;  2NMQ A;  3AE4 B;  3SEB A;  3WCQ A;  3FIL A;  1Q10 A;  1SE4 A;  2WXN A;  4JWS C;  3B2G A;  4HJG E;  2PIA A;  4LTU A;  4RNA A;  4RF0 A;  2PTL A;  4GLS C;  4YSX B;  1TS4 A;  4XDC A;  4USA A;  4XWT A;  1WGK A;  3ZGZ A;  3AV8 A;  3V05 A;  3Q8C A;  1LO5 D;  4CQN A;  1V1O A;  1YJJ A;  2G9H D;  2WP9 B;  4US9 A;  1EU4 A;  2QEJ C;  3RFZ B;  3P63 A;  4ZYS A;  1C4P A;  2WDR B;  4YTP B;  4OZB A;  1GOZ A;  3FIL B;  4N6E B;  1ET6 A;  3R2T A;  4US8 A;  1NYQ A;  4P6V F;  2WU5 B;  4OVZ A;  1D5Z C;  1XLQ A;  2PKO A;  3SFD B;  2MH7 A;  1KH0 A;  5I4D A;  5D3D A;  4ZOH C;  5HG2 A;  3W1S A;  1STE A;  4TSS A;  2LJI A;  3U2S C;  2ON8 A;  3R2I A;  3CIR B;  2AX5 A;  2J42 A;  3UI3 A;  1FEH A;  3KWV A;  1JWU D;  1WSP A;  1K52 A;  1E9M A;  3CWI A;  1SJE D;  1AYF A;  3GP7 A;  3ETR A;  1K53 A;  1E0Z A;  2IGD A;  1TY0 A;  1VZ8 A;  2VZK B;  1NI3 A;  1WRI A;  4AQ7 A;  4P16 A;  2KAJ A;  2KWD A;  4OZA A;  1VJK A;  1ZUD 2;  5FKA C;  4KKI A;  2IDY A;  4C80 A;  4RF1 A;  2JYT A;  1L4D B;  2BS4 B;  3IT4 B;  1YMH E;  2H89 B;  1V97 A;  3GB1 A;  3LXF A;  5EE1 A;  1FCC C;  3AH7 A;  2DBY A;  4MAC A;  1YJI A;  2SAK A;  4DXF A;  1FO4 A;  4NAM A;  2W54 A;  3MC0 B;  4A9A A;  1I4G A;  2QSD A;  2RDH A;  3I9V 1;  1IGC A;  2Q5W D;  2I2Y A;  5TSS A;  3AE9 B;  1HEZ E;  1KFY B;  2QMT A;  2M0A A;  4JE3 B;  3BK1 A;  2PVG C;  2JSV X;  1FD6 A;  1QIL A;  3AEA B;  4L1B A;  1UGJ A;  5MPO A;  2FUG 1;  3HUI A;  2FBW B;  3ZQ4 A;  3NUH B;  2JWU A;  5BYR A;  1XLP A;  4TQ1 A;  2MJ3 A;  1ZXI A;  4NJC A;  3AEE B;  3R8B A;  4OHJ A;  1PFD A;  1I4P A;  1CK1 A;  4DXG A;  3L4P A;  3NRZ A;  5EE9 A;  1JRP A;  1N60 A;  2H88 B;  1YN5 A;  1UNS A;  3ZJT A;  3MHZ A;  1GT8 A;  3O13 A;  1I4R A;  1L5P A;  1RWS A;  1JQ4 A;  1J7C A;  3EA6 A;  3LB8 C;  2WU2 B;  4ITK A;  1HZ5 A;  1D5X C;  2IJ0 A;  1UUP A;  3B2F A;  1KTK A;  1QOF A;  2NTS A;  1FRD A;  4LK0 M;  3AEC B;  1RM6 C;  1CQV A;  1MPE A;  4IKG A;  2K0P A;  4XDD A;  1YN4 A;  3IXS A;  1V8C A;  2V3P A;  1VR9 A;  2IGH A;  1C4C A;  2J4X A;  2IPK D;  1QQR A;  1MHX A;  4YSZ B;  1SE2 A;  1PGX A;  1ZPS A;  1NEK B;  3NVZ A;  2SEB D;  5G5H A;  2WXF A;  3AE2 B;  1T3Q A;  1DGJ A;  1EM7 A;  1F2R C;  2M56 B;  5H8Y E;  3HRD D;  1L0V B;  1E6E B;  2JX5 A;  3P4P B;  3AE1 B;  2GB1 A;  4GDL B;  3NVY A;  1HA5 A;  2WXK A;  1V1P A;  1ZDX A;  1SXT A;  2N0S B;  2PMV A;  3TUO A;  3CF4 A;  3BYT B;  3FC4 A;  3P4S B;  1YQ3 B;  1ZE3 D;  1JRO A;  1J7B A;  3N9Y C;  1NVI D;  1KF6 B;  2N9L A;  3GS2 A;  2LMC A;  1PDX A;  4HKQ A;  1VZ7 A;  4M0W A;  2PVO D;  3H8H A;  5D3I B;  1XO3 A;  1N5W A;  1JWM D;  2BT6 A;  1JCK B;  3J9C A;  1NYR A;  3ABV B;  3BVZ A;  1NEN B;  3IT6 B;  4YT0 B;  1D4B A;  1MVK A;  1AW7 A;  1E7P B;  3KQ4 A;  4REZ A;  2DWQ A;  1XEE A;  1TY2 A;  2G1E A;  2WXI A;  3PZ7 A;  4RGN A;  2WDQ B;  5E6J A;  1QOA A;  2CJN A;  4RGM A;  4L2Y A;  2V4I B;  1ROE A;  3E56 A;  3MFG A;  2ZW0 A;  1H7X A;  2Y5P A;  1IUE A;  3W2D A;  4NAW B;  2LEK A;  2LFI A;  1C78 A;  1JAL A;  2ZW1 A;  1Y56 A;  1FIQ A;  2JXT A;  4JX1 C;  4RH6 A;  4L23 A;  2WXO A;  3PO0 A;  4YTM B;  2YEP B;  2QIL A;  3EGR A;  1N5X A;  1T6B X;  3AMZ A;  2JU6 X;  1SEB D;  1VLB A;  2OED A;  1BUI C;  1XLN A;  3RPF C;  1GTH A;  4ZRP A;  1TS2 A;  2BB6 A;  2L52 A;  1F0Z A;  1QLB B;  4ZRQ A;  2HTM E;  3BK2 A;  2GI9 A;  2L1A A;  4IDI A;  4A6Q A;  3P4Q B;  2DLB A;  1C77 A;  3VRA B;  3AM9 A;  3DWM A;  5GXG B;  2Y5C A;  1HZ6 A;  2JYE A;  1L6U A;  2CU3 A;  1L0Y B;  1QOB A;  1B9R A;  1A70 A;  2W82 A;  1GB1 A;  1D6E C;  3NZ3 A;  2K3U A;  5C3J B;  5JXV A;  1ENF A;  2FE8 A;  2PW9 A;  3AEB B;  2KMM A;  4KGR A;  4WIP A;  1L4Z B;  2WDV B;  1SF0 A;  1T5X D;  4WWM A;  1D5M C;  2Y3A A;  3TSS A;  1L6V A;  4NZL B;  5T8I A;  3U52 E;  3SR6 A;  2BS3 B;  4YWG G;  1L0X B;  4UDU C;  3AE7 B;  1BXT A;  4A90 A;  4O1N A;  2B76 B;  3DWG C;  4KGS A;  1OFF A;  1WWT A;  1GTE A;  1N61 A;  1C9F A;  2DYM A;  1FXI A;  3LYY A;  5LNK 1;  2INP E;  3NS1 A;  3NVV A;  3Q8F A;  3Q8B A;  3W9C B;  3AEG B;  2BB5 A;  3SFE B;  2WXQ A;  1H7W A;  3P4R B;  2WXR A;  4EE2 A;  2BW2 A;  4XE0 A;  4YXD B;  1DOY A;  1OQQ A;  2KQ4 X;  1GAQ B;  1YN3 A;  3IAS 1;  4MH8 A;  3V3X A;  3W5U B;  4Q2J A;  3U7Z A;  3BWU D;  1VDV A;  2JZP A;  2AQ1 B;  2HDE A;  4MM3 B;  2V3N A;  1I7H A;  1P7F A;  1K51 A;  2L32 A;  1DYQ A;  2AQ3 B;  3ZJV A;  1B1Z A;  1SE3 A;  2KAC A;  1FCL A;  4RFB A;  4A8X C;  3KWL A;  3U4E G;  4B0E A;  1QT9 A;  4AS1 A;  4C56 C;  1JML A;  1F2R I;  2WXJ A;  2LGI A;  1CZP A;  3AE3 B;  2EEL A;  3AED B;  2WXH A;  3Q8E A;  1QF6 A;  2OHF A;  3KLS X;  1CJE A;  2L83 A;  1SJH D;  1TKY A;  1VRA B;  4WUR A;  3T3O A;  1N63 A;  3IAM 1;  2KDM A;  3EUB 2;  4OW0 A;  3FAH A;  4JWU C;  2X38 A;  1DOI A;  2BTE A;  4TMA B;  1FRR A;  1JWA D;  1SSN A;  1SBB B;  3AE6 B;  2WXL A;  3HVZ A;  3HVD A;  4GDK B;  4KKJ A;  5BMH A;  1I4H A;  1M4V A;  2JQR B;  3ZJU A;  1TS5 A;  1YQ4 B;  1ESF A;  1V1P B;  3E9S A;  1ACC A;  1EWC A;  2J53 A;  2BS2 B;  3AE5 B;  1I4X A;  1FMA D;  4YTN B;  5BMI A;  3Q69 A;  2N7J A;  2WLB A;  3B9J A;  4KX6 B;  4WQM A;  4MT5 A;  3TEY A;  5C2T B;  2KN4 A;  1QOG A;  2I38 A;  1XCQ L;  2DYO A;  2LHD A;  2MEK A;  1TJE A;  1R7S A;  4R3D A;  1K50 A;  3NVW A;  1GB4 A;  1VZ6 A;  3C8Y A;  5HI1 A;  4N58 A;  3TEZ A;  3BII D;  4FXC A;  3TEX A;  4ARI A;  4H2A A;  1GPX A;  4ARC A;  4WH4 A;  1TKG A;  1JWB D;  1XXG A;  2W3R A;  1MHH E;  1HXY D;  4IOI E;  5BMG A;  3MP9 A;  2D5G A;  1DOX A;  1J7A A;  4KGT A;  2N9K A;  2E3T A;  1UWM A;  3BVM A;  1KLG D;  1HQR D;  5FK9 C;  1XLO A;  2WNM A;  3BZD B;  1P7E A;  3AB5 A;  3VR8 B;  1ET9 A;  3AN1 A;  4B0M A;  1FNV A;  4TQ0 A;  1ZXH A;  2K5P A;  1KLU D;  4PT5 A;  2TSS A;  1TZO A;  4HRO A;  4C7Z A;  4N59 A;  1MI0 A;  1TKE A;  1C76 A;  1KRH A;  2VZK D;  2XN9 C;  5BYQ A;  2MJE A;  1AN8 A;  3W5V B;  4RCO A;  1PGB A;  1C79 A;  1FFV A;  4ZHO A;  2YEP F;  5AUI A;  5HHD G;  1UWX A;  1PUT A;  2WS3 B;  1TS3 A;  1ZDV A;  4RGT A;  1N62 A;  2Z8L A;  3T3N A;  1SIJ A;  2PLP A;  2WXG A;  2BBC A;  1C4A A;  3PZ8 A;  5H92 C;  3VR9 B;  4YSY B;  1FNU A;  4WAF A;  4ZHP A;  4JPS A;  4A55 A;  2W55 A;  4DQO C;  2QIE B;  4HKZ E;  1FXA A;  1QKZ A;  3AEF B;  3URY A;  5BYS A;  3I57 A;  1FFU A;  1PGA A;  1SB3 C;  2RPV A;  2E6X A;  5HFY A;  2WQY B;  2LUM A;  1TYG B;  1BML C;  1E10 A;  1F77 A;  2XNA C;  4XWW A;  2BYT A;  2CJO A;  5FR3 A;  5EE0 A;  5G5G A;  2K9X A;  2W3S A;  1RYJ A;  1FM0 D;  4J3O D;  1XF5 L;  3P42 A;  2V0G A;  3OWE B;  4HEA 1;  4HRS A;  1ZP0 B;  3P1M A;  2ACZ B;  2QJL A;  5EE3 A;  2LHE A;  2MJD A;  2J52 A;  2WXM A;  3VRB B;  1WXQ A;  3MJ5 A;  5D7G A;  3BYY B;  2GRI A;  3AE8 B;  4LLG M;  1FNW A;  2ICI A;  1EU3 A;  4D2K A;  1PYW D;  1RFK A;  3Q8A A;  2R61 A;  4OZC A;  2NTT A;  2M19 A;  5AUK A;  3ZYY X;  2EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...