5C2TB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 64
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 5c2tB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5c2tB01
1YJJA 2ACZB 1QOBA 4USAA 3AE5B 3AE6B 3AE7B 3ABVB 1FFVA 1IUEA 4YSZB 1FXIA 1YQ4B 3AE4B 3P4QB 1FFUA 1OQQA 2WS3B 1PDXA 2FBWB 3AEEB 1RFKA 1NENB 1FXAA 2AX5A 2WDQB 2WLBA 3KWLA 2W54A 5G5HA 1H7XA 1J7BA 2MJEA 4YTMB 4JWSC 3W5VB 2B76B 4US9A 3HUIA 4KX6B 3B2FA 1DOIA 2N0SB 3WCQA 1V8CA 1RYJA 2MJ3A 3P63A 1ZUD2 3NRZA 3W9CB 3AMZA 2BS3B 2BS2B 3FC4A 1JWAD 1UWMA 4N6EB 2M56B 1FIQA 1T3QA 4WWMA 1DOXA 4ZHPA 1PFDA 3CWIA 3AE1B 1JROA 2BT6A 2MJDA 2PVGC 4IDIA 1WRIA 4ZHOA 3DWGC 2KMMA 1TKEA 1XLPA 4C80A 3AV8A 2CJOA 2CU3A 1ZP0B 3NVYA 1FRRA 1E6EB 3P4SB 1CJEA 1GAQB 1L6VA 1I7HA 2CJNA 3CIRB 3SR6A 1WXQA 4WQMA 3VR9B 1RWSA 1GT8A 2K22A 1OQRA 3BIID 4HRSA 2PVOD 5EE9A 1J7CA 1GTEA 3AM9A 1R7SA 3ETRA 3NVZA 1GTHA 4JX1C 1NYRA 4A9AA 5MPOA 1B9RA 1YJIA 1AYFA 1XO3A 1WYGA 2QJLA 5AUIA 1DOYA 1NEKB 1QF6A 1KF6B 3DWMA 1FRDA 2EKIA 3AB5A 3P1MA 4US8A 3VR8B 5EE0A 1XLQA 2WP9B 5H92C 2HTME 1J7AA 1N61A 3AH7A 1N5WA 2E3TA 3FAHA 4ZOHC 3AE9B 2WU2B 1CZPA 1NYQA 1SIJA 2PKOA 5AUKA 2KAJA 3L4PA 2JQRB 2PIAA 3B9JA 3AEAB 1XLOA 4N59A 4YSYB 1ROEA 1SF0A 1E10A 1FO4A 4YSXB 1TYGB 2JX5A 1FM0D 2M19A 1TJEA 1VJKA 2OHFA 4P6VF 4JWUC 1VDVA 1VLBA 3NS1A 3P4PB 1YQ3B 5C3JB 2H89B 2WQYB 2DBYA 2L83A 1QT9A 3LB8C 1F0ZA 1DGJA 5GXGB 1RM6C 1JALA 4YXDB 1KRHA 1TKGA 1N62A 2G1EA 4N58A 3AEGB 5EE3A 4C7YA 1E0ZA 1L0VB 3AEDB 1QOGA 5G5GA 3PO0A 3NVVA 1JQ4A 3AECB 1JWBD 3AE3B 2LEKA 1E7PB 1JRPA 1L6UA 2DWQA 5C2TB 4ITKA 2H88B 1SB3C 3VRBB 3NVWA 3AEBB 1ZOYB 1PUTA 1JW9D 1FMAD 4FXCA 3P4RB 1H7WA 2W55A 3EUB2 2WDRB 2WU5B 1NVID 3LXFA 4LTUA 3SFDB 2W3SA 5EE1A 3ZYYX 2MH7A 3AE8B 4HROA 4YTNB 1E9MA 3AN1A 2K9XA 2Y5CA 4YT0B 3AE2B 2W3RA 1L5PA 1QOFA 3W5UB 3CF4A 1QOAA 1N60A 1NI3A 1V97A 1QLBB 1EWYC 4C7ZA 1N5XA 2Q5WD 3B2GA 3HRDD 2BS4B 1AWDA 1A70A 1XLNA 1OFFA 1N63A 1WGKA 2WDVB 1ZXIA 3VRAB 1TKYA 1KFYB 1WWTA 3AEFB 1GPXA 5H8YE 3HVZA 2L52A 2QIEB 4YTPB 3SFEB 2K5PA 3RPFC
chains in the Genus database with same CATH superfamily
1QOBA 3H7PA 2M8SA 2L3ZA 5IP4D 3BZDB 2NTSA 2WLBA 1WSPA 1L2NA 1Z2MA 4KKIA 2Z0DB 1E7VA 2BVCA 2C60A 2RSUA 2MJ3A 1J8CA 4KSLC 4DDID 4K7WA 1V6EA 1TY2A 4XDCA 2RDHA 3PLUA 3V62A 4FA6A 1WZ3A 2M0XA 1OQRA 4NQKE 3DVGX 5EDSA 1NYRA 2QC8A 3DBLB 3NZUA 3KW5B 2INPE 2LZ6A 3KWVA 5BMIA 2AWTA 3VR8B 2IYDB 2MBBB 1VRAB 4G11A 5G55A 1J7AA 3EFUA 1V2YA 2KAJA 3HM3A 2V3NA 3QX1A 4GMVA 2EMSA 1KTKA 4N59A 1E5WA 2DYOA 2KVZA 5AZHA 1FO4A 1VJKA 3A4SC 1VLBA 2G45B 1P3QU 2DBYA 2KTFA 1RM6C 1E0ZA 3SDLC 1L0YB 2MHJA 3U7DA 2O6VA 4A6QA 4ZRQA 1LO5D 4M02A 4RGNA 1V49A 3BWUD 2IY0B 2LUMA 4KGTA 2WU5B 5BMGA 2MCNB 1SJHD 3AE8B 1PGAA 2K9XA 3VDZA 4F1SA 4HDOA 3ZGZA 3VVWB 2RR9A 2X38A 3X23A 2FCSA 1JMLA 2ZW0A 1V80A 4JE3B 1VD2A 1D5ZC 4DHJD 5J2RA 4M8MA 2DYBA 3AE4B 1I4XA 3BINA 2MJEA 1EO6A 1HEZE 4PYZA 1V8CA 4NQLB 3OG5A 1ZUD2 2BS3B 2LI5A 1FIQA 1VZ6A 2M56B 2RPVA 1EWCA 4XGAB 3AV8A 1MG4A 1XCQL 3U7ZA 2JPHA 3KUZA 1EF5A 3I5JC 1ZW7A 2RDGA 1GTEA 4XX5A 3SEBA 2FUHB 3QQ8B 1B9RA 1ZPSA 1XO3A 1WYGA 3DVNU 3DWMA 2JSVX 2CHXA 2W82A 1ACCA 1F52A 2G4SA 3MTNB 4MSQB 1N5WA 2LHEA 3I9V1 4W9IA 4WAAA 1LXDA 2JU6X 1SJED 3V6EB 1FM0D 1TJEA 4OZAA 1WI0A 3ML9A 2HD5B 3K9PB 4YXDB 2YVCA 2MBOA 1V5OA 1UH6A 4KKJA 1KJTA 2LXCA 3AECB 4RNAA 4K3BA 1SB3C 2H88B 3APCA 3R8BA 2BKFA 2D2QA 3SFDB 3UIOB 5EE1A 2MH7A 4C00A 1I4RA 2RGFA 3AI5A 2KT7A 2FCQA 1QOFA 4L1BA 3WALA 4MM3A 3BK2A 3IFWB 5AZFA 3ZNGC 3VXWA 1TKYA 2LD9A 4EZKA 2MQJA 4A8XC 4IM0A 3VAWA 1FD6A 3ZRFA 3RFZB 2QHOA 3ALBA 4LK0M 5LLIA 4N9F4 1XF5L 1JWMD 3RNAC 3B0AA 1C4CA 3NZ3A 1KLUD 5AEKB 1RRBA 3UF8A 2KWUB 2M1MA 1WRIA 3A1QB 1GB4A 2PE9A 5CHWA 1GAQB 3BVZA 3UQBA 4AJYB 3CIRB 3IBEA 4FLHA 2WYQA 3BIID 5EE9A 4EUTA 3PVLA 3VTVA 5MPOA 1D3ZA 4PS3A 2JUOA 2DENB 2DNFA 1WXVA 4G3XB 3E9SA 4S17A 1N61A 2INNE 1CZPA 3EHVA 1AN8A 3EC8A 3LDZE 4DDGD 3WA0A 3RD2A 3TSSA 4JGHB 1SBBB 2V3PA 3P4PB 4ZYSA 2L83A 1DGJA 3PHWB 1JALA 4F7ZA 4N58A 2XN9C 4LCDE 3AEGB 1L0VB 2IO2B 5IA7A 1JQ4A 2I1KA 2N7EA 4CQNA 3AE3B 2M17A 2BWES 2GBJA 1RAXA 4HROA 2IJ0A 4JQWC 2GMIC 4RM9A 2D3CA 1WGYA 1V97A 3GOEA 3GE8C 1ZKHA 3LJ3A 2BTEA 1ESFA 2IGGA 1WWTA 1SGHA 1EM7A 1HQRD 3VH4B 2PW9A 1V1PA 5AZGA 2JXTA 2K3UA 3MC9A 1H4RA 4BKTA 1FFUA 2KX3A 4W9KA 3DOWA 3HUIA 3SU8X 2N0SB 1TS2A 3SD5A 1V1OA 4WWOA 5TR5A 3AE1B 2PE6B 2ICIA 3PRZA 3DBHB 2CJOA 5JHBA 4ANXA 1FRRA 2INCC 1M4VA 2KQSA 1KLVA 3C8YA 3RZFA 2IBIB 3K9OB 1UBIA 2IY1B 3MHZA 4A9AA 4HJGE 3O13A 3SHQA 2AQ1B 4LDTB 3Q8FA 2N4FA 2JZPA 3ZW3A 5G2NA 4WWNA 5LXIB 2E6XA 4XYCA 2FAZA 3W1SC 3QJZA 1HTOA 4AP4C 2PLPA 1OEYA 4AJWA 3LYYA 3LB8C 4DWFA 1QT9A 3Q8CA 4G0NB 4EFOA 3HM6X 1TKGA 3KUDB 4C7YA 4WH4A 3Q3MC 4C4VA 4FJYA 1L6UA 2G3QB 4WWPA 5D7GA 1LQBA 1XQQA 1C78A 1H7WA 2W55A 2KJHB 1UD7A 4AS1A 3ZUNA 4ANVA 2NBVB 1S3SG 1M94A 3U4EG 2JYEA 4BKGA 4WJNA 4C7ZA 5HKHA 3ZTCA 5DPWA 4E3CA 4K3CA 3RYTA 4YTPB 4B0MA 3DBRB 1YIWA 3PSEB 4HCPB 4K7UA 3AE5B 1Q5WB 4OZCA 1RFKA 1MPEA 1PDXA 5G5HA 3ZNZB 3RCZA 3B2FA 3KLSX 1DOIA 1VZ7A 1RYJA 3L17A 3N32A 3Q69A 2BYFA 1FXTB 1YX5B 2C7NB 2DHZA 2GOWA 2YLMA 2KDFB 3JSVB 1TKEA 1XT9B 2XEWA 3T8MA 2VZKD 2C7MB 3PGEA 4TUUA 2JRHA 1YN4A 3OAWA 3P4SB 1P0RA 2MX2A 3RNCC 4WQMA 1JWSD 1SE3A 4P16A 1I35A 1J7CA 3ONSA 4II2B 5BMHA 3E56A 5IKCM 3VHTC 3A9JB 4M0WB 1CMXB 2QJLA 1T0YA 1XXGA 1QF6A 2KDIA 3PZ8A 2BYVE 3UIPB 1V81A 1K51A 4MGYE 1E8ZA 4ZYNA 3FAHA 1FNVA 4P1BC 3WANA 3TEXA 4LNIA 1E10A 3T3NA 1F2RI 4DXAB 2M19A 4DHZE 2ZCCA 1UGJA 2PPHA 3NS1A 3V05A 4ARCA 2K8BA 1V5TA 1QOGA 3S2AA 2LRUA 2VRRB 1YD8U 1KLGD 3AEBB 4CO7A 2HDEA 3Q8EA 2TSSA 2JY6A 2KFJA 2D11A 5FR6A 4HJKA 1EWYC 1G6JA 2BS4B 1AWDA 1OTRB 3VTUA 2EMTA 2D5GA 2IO3B 1F2RC 2FCMA 2OOBB 2CR5A 2DZKA 2QSDA 3N1XC 4KIKB 1GC7A 2VZKB 3AE6B 1FXIA 4HRSA 1MHHE 2UWQA 3DBSA 1C4AA 5D3IB 1STEA 2B76B 2N7JA 3HK0A 2DX5B 4W9LA 3AMZA 4BBNC 1A5RA 3N30A 3NOBA 4W9GA 1XLPA 2M4NA 1FNWA 3URYA 1EU4A 2DAJA 4ZRKA 3Q3OC 5I4DA 2ONQA 1I4PA 1GT8A 2WXKA 4HDQA 3NVZA 1KM7A 4JX1C 2WNMA 2KWDA 3NHEB 1KF6B 1WM2A 3JYUA 4OVVA 4NPNA 2BYEA 2N9KA 1E8XA 1SIJA 2PKOA 4MJSA 2Z0EB 4MGZE 2JQRB 1Q0WB 2J42A 3N9YC 4YSYB 2JWZA 2JX5A 1C77A 1AW7A 3TUOA 4A3OA 2G1EA 2RD0A 3W1YA 1WGDA 1T0RC 3NVVA 4PK1A 2N9PC 2LEKA 1E7PB 5C2TB 2Y3AA 1S1QB 2LGXA 4KZCA 2ON8A 3A9KA 5CX3A 3ZVVA 4DXGA 3DCGA 3AN1A 5FKAC 1WR1A 3AE2B 2WWZA 4LJOB 5CHFA 1QOAA 4BKSA 5KHOA 3B2GA 3CF6E 1E8YA 1WGKA 2WXPA 2DZJA 2AQ2B 2WXFA 2ZJDA 2QIEB 3RPFC 3TEZA 1TS5A 3ABVB 4K7SA 3AU5A 4RGOS 1ISNA 4W9CA 2WXJA 3QC8B 1R4MB 2KOXA 3W5VB 2N1WA 4MT5A 3TMPB 2MWSB 2N7DA 2BPSA 1X1MA 1F9JA 4MACA 3CWIA 2QMTA 3H9DA 2BT6A 2N9XA 4GU2A 3ZNHB 1Z5SB 2IDYA 4J6IA 2ASQA 2CU3A 3H6NA 1SE4A 4FJVB 1L6VA 5JHAA 2SEBD 2MSED 4IUMB 3ZDMC 1BT0A 1FCCC 1F77A 2NMQA 2KTRA 2REXA 2R2OA 1FRDA 2EKIA 2KZRA 3ZDTA 2GLSA 4A55A 3EFCA 2JF5A 3PREA 2NVUI 4A90A 2K8CA 1SEBD 5C23A 2L00B 2L0FA 4CYEA 3KH0A 4YSXB 4JWUC 3B1LX 2J0MA 3RMKC 1F0ZA 2PEAA 3R7QA 2ZEQA 3DHGC 1AARA 1V9JA 4XDDA 3RT3B 4IWPA 1WGRA 3OWEB 3DBLI 2AQ3B 3NVWA 2XNAC 4MSMB 2BYTA 4J3OD 1OEYJ 5D6JB 2KK8A 3PV1A 4X57B 4WURA 4B6WA 1UF0A 3FILA 4AWJA 2DYMA 3DDCB 3HRDD 5C1ZA 1BXTA 4ZRIA 2OEDA 1KFYB 1V86A 3L16A 3MJ5A 1C79A 3W1SA 3ZJVA 1R4MI 3U2SC 4BZAA 1F1HA 2UYZB 2ACZB 3P2BA 4I6NB 4YSZB 3APDA 3A9JA 1K8RB 1D5MC 2W54A 1WRDB 1K50A 3PZDA 2LWPA 1MVKA 2FE8A 3NRZA 2NPTB 3ZRCA 3FC4A 1PFDA 2EKEC 2MJDA 4L23A 1UUPA 5DPTA 3SR6A 1EF1A 2IO0B 3MP9A 3RNGC 2GB1A 2LASA 2K6DB 2LJIA 2G4DB 3WAOA 1E90A 1MFWA 1XLQA 4A3PA 1TIFA 4WJPA 1WIAA 1WM3A 3ZTDA 3RN9C 4W9DA 5J18A 3TL5A 2OHFA 2WQYB 3MHSD 2KJ6A 4II3B 1U4AA 2O2VB 3HIZA 1TT5B 4DQOC 3AEDB 1R4NB 4GLSC 1JWBD 1LGRA 2DWQA 1FPYA 3ZJTA 3QA8A 3M62B 2O6VD 1ZOYB 2I38A 4FXCA 5HG2A 4ARIA 2Y5CA 3N1YC 1SE2A 2KQ4X 2RMMA 2K8HA 2WXRA 4IC7B 3QHTA 5E6OA 3A33B 1XLNA 2VH1A 2WDVB 3DQVA 4OHJA 1UNSA 2KNBA 2MBHA 2A5UA 2L52A 2K0PA 4I6LB 3X0WA 1YJJA 2JXXA 4NAWB 1GNUA 4TMAB 4K81A 4OVZA 2QCZA 1WJUA 1JWUD 1GC6A 3R3MA 2JVCA 1BUIC 1JWAD 1VZ8A 4WWMA 1WGHA 4MH8A 5DCNA 1JROA 2KDEB 3DWGC 1PYWD 3DVGY 4ZRPA 3OJ3A 4NAWA 4M8NA 4RGMA 1GTHA 5GMVA 2GI9A 2YEPF 2A4ZA 2WXQA 2ZPYA 5D3DA 4IWQA 3RULA 3AB5A 1UGMA 3Q8AA 2KDBA 1GG3A 1MJDA 4M00A 3OLMD 4ZRJA 2PIAA 2LUEA 3PTFC 3ZLZA 3NY5A 4TQ1A 4HLEA 2L0TA 2SAKA 2FNJB 4IWOA 4PS7A 4GXBA 5HI1A 4NJCA 5C3JB 2IPKD 4JLCA 1GB1A 2RPQA 4EOYA 1WR6E 1IYFA 3NUHB 4KZ0A 1WE6A 4B0EA 2WXGA 1Y56A 1PGBA 1YN3A 4A20A 2GBRA 4IW0A 3PT2B 2NPTA 1FMAD 2BWFA 2WXOA 3Q3NC 1GOZA 3QK0A 3ML8A 3N20C 3M63B 4YTNB 3A4RA 5LNK1 2C9WB 3T3OA 2MP2A 4XZ4A 4RFBA 4LDTD 1N5XA 1K52A 3WIMA 4S0RA 3VRAB 2ZZPB 4GOCA 4W9EA 1GPXA 4IG7B 5DPSA 2KDMA 1UELA 2ZNVC 2WGSA 2LXAA 1HZ5A 4GDLB 2J52A 4XWTA 1OQQA 4E71A 1FXAA 2BGFA 2LVQA 1H7XA 4FHJA 4MH0E 3Q3JA 2QDFA 1C9FA 4REZA 2HE7A 1UWMA 4N6EB 2ZVNA 2MW5A 2WXHA 1K53A 1IGDA 3TBLD 2PVGC 5T8IA 3GZNB 2HJ1A 2MA9B 1WX7A 1XCTL 3UQAA 5BYQA 3ETRA 2IGDA 3QIJA 4KGSA 3L08A 2K1FA 1SSNA 4HXDA 3PRMB 2XK5A 3GE3C 1RFAA 1YNTE 2LVPA 3O65B 1IBXA 3KUCB 4FADA 2LVOA 4HKZE 4ZOHC 2WU2B 3GZNI 1WXAA 1YX6B 3R2TA 4IKGA 3PLVA 1TYGB 2MEKA 3L0WB 2OJRA 3UGBB 1HE8A 5L83A 1WZ0A 2LRWA 4ACFA 2G9HD 4ITKA 1ZDXA 2AL3A 3T9LA 4KGRA 1FNUA 4K1RB 4DHJB 1C3TA 2WDRB 1NVID 1N6ZA 3VUYA 4KV2A 1NDDA 2NBWB 4LJPB 1E9MA 2J7QB 1L5PA 2GBNA 4O1NA 1CQVA 4PT5A 1WXSA 1L4ZB 2KO3A 4RGTA 2KACA 5JZEB 4M0WA 2D3AA 3D32A 1WF9A 3JW0X 2EELA 2K5PA 1SIFA 1WJ6A 2N9LA 2VH2A 2HTME 3KQ4A 4H2AA 2INDC 2FBWB 4IM2A 3EGRA 3VQIA 4TSSA 1I4GA 3GP7A 4PYUA 1JCKB 2L76A 1VCBA 4RCOA 5CTRC 2R2QA 4XE0A 2LFIA 4NNJB 2K6QA 2I1JA 1R7SA 1FEHA 1D5XC 1DOYA 2L1AA 3EECA 2XBBC 3MFGA 1HZ6A 4DXFA 3DHHC 3AH7A 2KX0A 3PHXB 1NYQA 3TCAA 3V3XA 4MEMA 2LMCA 3PRPB 2WXIA 3VUWA 1BMLC 2NR2A 3KVFB 4P6VF 3H7SA 1T0SC 1E7UA 5GXGB 3V6CB 4NJ6A 3MC0B 2L7RA 4EZJA 1QKZA 3VTWA 4LLGM 1JRPA 1WX8A 2WXNA 2QEJC 4B9KA 2D10A 1D4BA 1ET6A 5IO9A 4YT0B 2KC2A 2KJRA 2YEPB 1N60A 2HJ8A 2L8JA 3RNBC 1TZOA 2J0JA 1P1AA 4KSKC 2KLGA 1OFFA 3CSTA 1ZXIA 2Y5PA 4I6PA 2HTHA 5H8YE 5E6PA 1YN5A 1MG8A 2Z8LA 2XK5B 2RDBC 4E74A 4GIVA 3AE7B 4BOSC 3KWLA 2AL6A 3PS6A 5BO4B 4JWSC 4KX6B 1YQBA 5J17A 3W9CB 4LNOA 2BS2B 3I57A 4TV3A 1T6BX 3IVFA 4WJQA 4EEWA 3BYTB 3CSFA 4C80A 1WE7A 4LNFA 4URKA 3NVYA 2MBEA 1OGWA 3KYDD 2NTTA 3WAPA 3FILB 2JZZA 1AYFA 2DZMA 4P1CC 1NEKB 2O6VB 4XC2A 2I2YA 3MC8A 1GUAB 4GN1A 1B1ZA 4OZBA 2KWVB 3BY4B 2D3GA 2KKCA 3BYYB 1GJZA 1Q10A 1XLOA 4MDKE 2JT4B 2BB5A 2JYTA 2DLBA 2KXJA 1WMHB 2LGIA 2KN5A 4HVBA 5G5GA 4DHZB 5FK9C 2KTRB 3VUXA 2LGSA 3B08A 2AYOB 3IG3A 3P4RB 1D6EC 4AOFA 4LTUA 5E6JA 4HPMB 2IZVB 2CHWA 4GB9A 3W5UB 3Q2AC 1NI3A 3HHMA 2Q5WD 1A70A 3CMMB 3P42A 4MJSB 2WXLA 4XWWA 3TIXA 1RLFA 2JRIB 3TEYA 4YL8A 3DVNV 4HKQA 4GSWA 4Q2JA 1WXQA 2Y5BB 4ICVA 4USAA 1FFVA 1IUEA 1YQ4B 2WS3B 3AEEB 1J0GA 4YWGG 3MJWA 4DBGA 3BVMA 3QWZB 4IM3A 1P7EA 3JSVA 1YJ1A 4US9A 3TJPA 1LM8B 5JH5C 3WCQA 2W9NA 4GDLA 4BFRA 1T3QA 1UWXA 2IGHA 4HEA1 1UZXB 4NY0A 4W9JA 2M0AA 2K22A 4ZDVA 2J0KA 2QILA 2KANA 3J9CA 5AUIA 2KHWB 3NZSA 3M95A 2KC1A 2E3TA 2PJHA 5D94A 1MHXA 2N1VA 3QAQA 4G50A 3PPAA 1SXTA 3ZQ4A 1WXMA 1PQSA 3N1ZC 3RUIB 4C56C 4NZLB 5D2MB 1TBEA 1HA5A 2Z59B 2WHIA 4WJOA 3PO0A 4FJZA 1T0QC 4ASWC 3WAMA 4GDKB 3Q6BA 1KOTA 1L7YA 3IXSA 4BOZB 3LXFA 1J19A 3ZYYX 2PMVA 2C5LC 2L32A 3PZ7A 2LGDA 4QAYA 1P9DU 4HPPA 3VH3B 4WQOB 3L54A 1FCLA 2V0GA 1N63A 3AULA 1WY8A 3APFA 3R66C 1V1PB 4DK5A 4FULA 1C4PA 1IP9A 1JRUA 4HK2A 3ZO5B 2AX5A 5HFYA 3P4QB 4HCNB 4OW0A 1NENB 2X8XX 4FN2A 1I42A 2C7HA 3NS8A 2CKHB 4F8CB 4RMAA 4TKNA 1ZDVA 4ZHPA 4B95A 4IDIA 2ZCBA 2KMMA 4M01A 2ZNVB 4BBNF 1ZP0B 5CHVC 2PTLA 3NJTA 4CHKA 2KVRA 1RWSA 3GS2A 3RNEC 3NG0A 2FIDA 4LNNA 1IBXB 4FBJB 4JIOU 4PS8A 4ANWA 3M3JA 3I3TB 2WX0A 1L0XB 2WDTB 5EE0A 3ZXRA 1NBFC 1QZEA 2KFKB 2KMCA 5JXVA 2J4XA 3DBRI 4NAMA 3AEAB 5FR3A 3BK1A 1SE9A 2OJWA 1VDVA 2FCNA 4EZLA 3IAM1 1YQ3B 2ZW1A 1KRHA 2CS4A 1WH3A 1WYWB 3UI3A 4ANUA 5LXHA 2JWUA 3GB1A 4HPLB 2KFKA 3DBHI 4C4VB 1JW9D 1WGGA 2JZ3B 1WFYA 1P98A 2ZPNA 3CF4A 5IAAC 2MLBA 5IOIA 1Y8RC 3Q8BA 3IAS1 2KN4A 2GBKA 2WXMA 3AEFB 2O2VA 3C19A 3V60A 3HVZA 3A1QA 2LHDA 1XEEA 3OJ4B 3SFEB 3H8HA 3W2DA 4KVGB 5E6NA 1HTQA 3N3KB 2DZIA 1KH0A 1QILA 4EE2A 4KDIC 5DPRA 5TSSA 2BBCA 1R4NI 4GGQA 1ENFA 1E8WA 4FHKA 2MP2B 1P7FA 3P63A 2FIFA 2NCNA 4ZHOA 2BQQA 4ICUA 1CJEA 2CJNA 4AUQC 5KHQA 3RZWC 2D07B 3VR9B 4NJ7A 2KYWA 1WMHA 1TS4A 1WJNA 2V1YA 2NBUA 4US8A 4MGIE 1YOVB 1YMHE 2MRPA 3QARA 3VFKA 3AE9B 3IT6B 3B9JA 3Q3FA 4IOIE 1ROEA 1SF0A 3R7RA 2CHZA 1EU3A 3ZXVA 2AEHA 1TGZB 4W9FA 2V3SA 4R3DA 1N62A 4MELA 4EKUA 3HVDA 2KD0A 2GRIA 3ECIA 3ZNID 1OQYA 4TQ0A 3EUB2 4BKSD 2LJ5A 4GDKA 1TZ1A 1QQRA 2KQ7A 1C1YB 1UBQA 2KMAA 2UU7A 2R61A 2D3BA 3FKYA 1LFDA 2V9HA 4UDUC 1Q1OA 1I4QA 5L95C 4JPSA 2LGYA 4KIKA 2BB6A 1NI2A 2GBMA 1DYQA 4WAFA 2WDQB 3AXCA 1J7BA 1WX9A 4YTMB 1ZGUB 3KYCD 4MGKE 3U8ZA 4D2KA 2FUG1 1DOXA 3DHIC 1H8CA 4P7IA 3U52E 1IGCA 1E6EB 2K25A 1I7HA 3U30A 1T5XD 2PVOD 1ET9A 2ZVOA 3AM9A 3BVGA 5IN7A 1YJIA 1ZE3D 1TTNA 4BAXA 3P1MA 2KWCA 3AU4A 2WP9B 4RF0A 2MBQA 5H92C 3L10B 3RNFC 3TEWA 2K39A 4JL9A 5AUKA 2L05A 3L4PA 3I63C 4OVUA 2CU1A 4RH6A 4HWIB 4MM3B 4WIPA 3C0RB 1TY0A 1CK1A 4RM8A 1IPGA 3IT4B 2H89B 2V4IB 3H1UA 3JVZX 4LNKA 3QCAA 3ZIMA 3ZJUA 2BF8B 5BYSA 5EE3A 2DAFA 1EUVB 3ENEA 3V61A 1VR9A 2BW2A 3A9KB 3Q14C 3VRBB 1PUTA 2WX1A 3DPDA 2N9EB 2W3SA 4L2YA 1WJ4A 4W9HA 2B3AA 4BVUC 3RI7C 1L4DB 4AQ7A 3IHPC 1XD3B 2W3RA 4KDLB 1I4HA 1PGXA 5HHDG 2NS5A 1ZXHA 2V4LA 3ZKJC 2IO1B 3EA6A 1QLBB 1MI0A 4RF1A 3L13A 1HXYD 3H7PB 3UINB 2J53A 2BKRB 1C76A 3R2IA 1TS3A 2KLCA 5BYRA
chains in the Genus database with same CATH topology
1YJJA 1QOBA 4USAA 3AE5B 1FFVA 4NAWB 1IUEA 3BZDB 4OZCA 1YQ4B 1RFKA 1MPEA 4TMAB 2WS3B 1PDXA 3AEEB 4YWGG 2NTSA 2WLBA 3BVMA 4OVZA 5G5HA 1P7EA 1WSPA 1JWUD 4KKIA 4US9A 3B2FA 3KLSX 1DOIA 1VZ7A 1BUIC 3WCQA 1RYJA 2MJ3A 3Q69A 1JWAD 1VZ8A 1T3QA 4WWMA 1UWXA 1TY2A 4MH8A 4XDCA 1JROA 2RDHA 3DWGC 2IGHA 1TKEA 4HEA1 1PYWD 2VZKD 1YN4A 4ZRPA 3P4SB 4WQMA 1JWSD 1SE3A 2K22A 1OQRA 2M0AA 4P16A 1J7CA 4RGMA 2QILA 3J9CA 1GTHA 3E56A 5BMHA 1NYRA 2QJLA 5AUIA 2INPE 2GI9A 2YEPF 1XXGA 1QF6A 2WXQA 3KWVA 5D3DA 3PZ8A 5BMIA 3AB5A 3VR8B 1K51A 1VRAB 3Q8AA 1J7AA 2E3TA 3FAHA 1FNVA 2KAJA 2V3NA 2PIAA 1MHXA 1KTKA 4N59A 2DYOA 4TQ1A 3TEXA 2SAKA 1E10A 3T3NA 1F2RI 1FO4A 2M19A 1UGJA 1SXTA 1VJKA 3ZQ4A 1VLBA 3NS1A 5HI1A 4NJCA 3V05A 5C3JB 2DBYA 4C56C 4ARCA 2IPKD 4NZLB 1GB1A 1RM6C 1HA5A 1E0ZA 1L0YB 3NUHB 1QOGA 3PO0A 4B0EA 2WXGA 4A6QA 4ZRQA 1LO5D 1Y56A 1KLGD 1PGBA 1YN3A 4GDKB 3AEBB 2HDEA 4RGNA 3BWUD 1FMAD 2LUMA 3IXSA 3Q8EA 2WXOA 4KGTA 2WU5B 1GOZA 3LXFA 5BMGA 3ZYYX 1SJHD 3AE8B 1PGAA 4YTNB 2PMVA 3PZ7A 2L32A 2K9XA 5LNK1 2TSSA 3ZGZA 3T3OA 4RFBA 2X38A 1JMLA 1EWYC 1N5XA 1K52A 2BS4B 1AWDA 1FCLA 2V0GA 1N63A 2ZW0A 3VRAB 1V1PB 2D5GA 1F2RC 4JE3B 1GPXA 1D5ZC 1C4PA 2KDMA 2QSDA 2VZKB 3AE6B 1HZ5A 4GDLB 1FXIA 2AX5A 2J52A 4HRSA 5HFYA 3AE4B 3P4QB 1OQQA 1MHHE 4XWTA 1C4AA 1NENB 1FXAA 4OW0A 5D3IB 1I4XA 1H7XA 2MJEA 1STEA 2B76B 1HEZE 2N7JA 1V8CA 1ZUD2 1C9FA 3AMZA 2BS3B 4REZA 1UWMA 4N6EB 1ZDVA 1FIQA 1VZ6A 2M56B 2WXHA 4ZHPA 1K53A 1IGDA 2RPVA 4IDIA 2PVGC 1EWCA 2KMMA 1XLPA 3AV8A 1ZP0B 5T8IA 1XCQL 1FNWA 3URYA 1EU4A 2PTLA 3U7ZA 5I4DA 2ONQA 1I4PA 1RWSA 1GT8A 2RDGA 3GS2A 1XCTL 2WXKA 1GTEA 5BYQA 3SEBA 3ETRA 3NVZA 1IBXB 4JX1C 2IGDA 4KGSA 2WNMA 1B9RA 1ZPSA 1XO3A 1WYGA 2KWDA 1SSNA 1KF6B 3DWMA 2JSVX 1L0XB 5EE0A 2W82A 1ACCA 1YNTE 2N9KA 1IBXA 1N5WA 4HKZE 2LHEA 3I9V1 2WU2B 1SIJA 2PKOA 4ZOHC 5JXVA 2J4XA 2JQRB 4NAMA 2J42A 3AEAB 2JU6X 1SJED 3N9YC 4YSYB 3R2TA 3BK1A 4IKGA 5FR3A 1TYGB 2JX5A 1C77A 1FM0D 1TJEA 4OZAA 1VDVA 1AW7A 3IAM1 1YQ3B 2MEKA 3TUOA 2ZW1A 4YXDB 1KRHA 2G1EA 3UI3A 4KKJA 2JWUA 3GB1A 3NVVA 3AECB 4RNAA 2G9HD 2LEKA 1E7PB 1ZDXA 4ITKA 5C2TB 2Y3AA 2H88B 1SB3C 4KGRA 1FNUA 1JW9D 2WDRB 1NVID 2ON8A 3R8BA 3SFDB 5EE1A 2MH7A 1I4RA 1E9MA 3AN1A 4DXGA 5FKAC 3AE2B 1L5PA 1QOFA 4O1NA 4L1BA 3CF4A 1CQVA 1QOAA 4PT5A 1L4ZB 3B2GA 3BK2A 4RGTA 1WGKA 3Q8BA 3IAS1 2WXPA 2AQ2B 2KACA 1TKYA 2WXFA 4M0WA 2KN4A 2WXMA 3AEFB 3HVZA 2LHDA 1XEEA 2EELA 2QIEB 3SFEB 2K5PA 3H8HA 4A8XC 3RPFC 3W2DA 3TEZA 1TS5A 2N9LA 2HTME 3ABVB 3KQ4A 4H2AA 4RGOS 1KH0A 2FBWB 1QILA 1FD6A 2WXJA 4EE2A 3RFZB 5TSSA 2BBCA 4LK0M 3W5VB 1ENFA 3EGRA 4MT5A 3VQIA 1XF5L 1JWMD 4TSSA 1P7FA 3P63A 1I4GA 3GP7A 4MACA 1C4CA 3NZ3A 1KLUD 1JCKB 3CWIA 2QMTA 2BT6A 4ZHOA 1WRIA 2IDYA 1GB4A 4RCOA 2CU3A 1SE4A 1L6VA 1CJEA 1GAQB 2CJNA 3BVZA 3CIRB 4XE0A 2SEBD 2LFIA 3VR9B 3BIID 5EE9A 1R7SA 1FCCC 1F77A 1TS4A 1FEHA 5MPOA 1D5XC 2NMQA 1DOYA 1FRDA 2EKIA 2L1AA 4US8A 3MFGA 3E9SA 1HZ6A 4A55A 4DXFA 1YMHE 1N61A 3AH7A 2INNE 4A90A 3AE9B 1CZPA 1NYQA 3IT6B 3V3XA 1AN8A 1SEBD 2LMCA 3B9JA 4IOIE 2WXIA 1ROEA 1SF0A 1EU3A 1BMLC 3TSSA 4YSXB 4P6VF 4JWUC 1SBBB 2V3PA 3P4PB 4ZYSA 2L83A 1F0ZA 1DGJA 5GXGB 4R3DA 1JALA 4N58A 2XN9C 1N62A 4XDDA 3AEGB 1L0VB 3MC0B 3OWEB 3HVDA 1JQ4A 2GRIA 4CQNA 1QKZA 3AE3B 4LLGM 1JRPA 2AQ3B 2WXNA 3NVWA 2QEJC 2XNAC 2BYTA 4TQ0A 4J3OD 3EUB2 1D4BA 1QQRA 1ET6A 4HROA 2IJ0A 4Q2JA 4YT0B 2R61A 4WURA 3FILA 2YEPB 1N60A 2DYMA 1V97A 1TZOA 3HRDD 4UDUC 1BXTA 1I4QA 1OFFA 1ZXIA 2Y5PA 2OEDA 2BTEA 1ESFA 1KFYB 2IGGA 1WWTA 4JPSA 3MJ5A 1EM7A 1HQRD 1C79A 5H8YE 3W1SA 3ZJVA 1YN5A 2PW9A 1V1PA 2BB6A 2Z8LA 3U2SC 2ACZB 2JXTA 2K3UA 3AE7B 1DYQA 4WAFA 4YSZB 1FFUA 3KWLA 1D5MC 2WDQB 2W54A 1J7BA 4YTMB 4JWSC 1K50A 3HUIA 4KX6B 2N0SB 1MVKA 1TS2A 2FE8A 1V1OA 3NRZA 3W9CB 2BS2B 3FC4A 4D2KA 2FUG1 1DOXA 3I57A 1PFDA 1T6BX 3AE1B 2MJDA 3BYTB 2ICIA 4L23A 4C80A 1UUPA 2CJOA 3NVYA 3U52E 1FRRA 1IGCA 1E6EB 1I7HA 3SR6A 1M4VA 2NTTA 3C8YA 1T5XD 2PVOD 1ET9A 3AM9A 3MP9A 3BVGA 3MHZA 3FILB 4A9AA 2GB1A 4HJGE 1YJIA 1AYFA 1ZE3D 3O13A 1NEKB 2AQ1B 2LJIA 2I2YA 3P1MA 3Q8FA 1XLQA 1B1ZA 2WP9B 4RF0A 5H92C 4OZBA 2JZPA 3TEWA 3BYYB 5AUKA 3L4PA 2E6XA 1Q10A 1XLOA 4RH6A 4MM3B 4WIPA 1TY0A 1CK1A 2PLPA 2BB5A 2JYTA 2DLBA 2OHFA 3IT4B 2H89B 2WQYB 2V4IB 3LB8C 1QT9A 3LYYA 3Q8CA 3ZJUA 2LGIA 5BYSA 1TKGA 5EE3A 4C7YA 4WH4A 4DQOC 3AEDB 5G5GA 5FK9C 1JWBD 4GLSC 1VR9A 1L6UA 2BW2A 2DWQA 3VRBB 3ZJTA 5D7GA 1ZOYB 1PUTA 2I38A 4FXCA 3P4RB 1C78A 1H7WA 2W55A 1D6EC 5HG2A 4AS1A 4LTUA 2W3SA 4L2YA 5E6JA 1L4DB 4ARIA 4AQ7A 2Y5CA 3U4EG 2W3RA 1I4HA 1PGXA 1SE2A 5HHDG 3W5UB 2JYEA 1ZXHA 1NI3A 3EA6A 2KQ4X 1QLBB 2RMMA 4C7ZA 1MI0A 4RF1A 2Q5WD 2WXRA 1HXYD 1A70A 1XLNA 2J53A 3P42A 2WDVB 1C76A 2WXLA 4OHJA 3R2IA 4XWWA 1UNSA 3TEYA 1TS3A 2L52A 4HKQA 2K0PA 5BYRA 4YTPB 1WXQA 4B0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJJ A;  2ACZ B;  1QOB A;  4USA A;  3AE5 B;  3AE6 B;  3AE7 B;  3ABV B;  1FFV A;  1IUE A;  4YSZ B;  1FXI A;  1YQ4 B;  3AE4 B;  3P4Q B;  1FFU A;  1OQQ A;  2WS3 B;  1PDX A;  2FBW B;  3AEE B;  1RFK A;  1NEN B;  1FXA A;  2AX5 A;  2WDQ B;  2WLB A;  3KWL A;  2W54 A;  5G5H A;  1H7X A;  1J7B A;  2MJE A;  4YTM B;  4JWS C;  3W5V B;  2B76 B;  4US9 A;  3HUI A;  4KX6 B;  3B2F A;  1DOI A;  2N0S B;  3WCQ A;  1V8C A;  1RYJ A;  2MJ3 A;  3P63 A;  1ZUD 2;  3NRZ A;  3W9C B;  3AMZ A;  2BS3 B;  2BS2 B;  3FC4 A;  1JWA D;  1UWM A;  4N6E B;  2M56 B;  1FIQ A;  1T3Q A;  4WWM A;  1DOX A;  4ZHP A;  1PFD A;  3CWI A;  3AE1 B;  1JRO A;  2BT6 A;  2MJD A;  2PVG C;  4IDI A;  1WRI A;  4ZHO A;  3DWG C;  2KMM A;  1TKE A;  1XLP A;  4C80 A;  3AV8 A;  2CJO A;  2CU3 A;  1ZP0 B;  3NVY A;  1FRR A;  1E6E B;  3P4S B;  1CJE A;  1GAQ B;  1L6V A;  1I7H A;  2CJN A;  3CIR B;  3SR6 A;  1WXQ A;  4WQM A;  3VR9 B;  1RWS A;  1GT8 A;  2K22 A;  1OQR A;  3BII D;  4HRS A;  2PVO D;  5EE9 A;  1J7C A;  1GTE A;  3AM9 A;  1R7S A;  3ETR A;  3NVZ A;  1GTH A;  4JX1 C;  1NYR A;  4A9A A;  5MPO A;  1B9R A;  1YJI A;  1AYF A;  1XO3 A;  1WYG A;  2QJL A;  5AUI A;  1DOY A;  1NEK B;  1QF6 A;  1KF6 B;  3DWM A;  1FRD A;  2EKI A;  3AB5 A;  3P1M A;  4US8 A;  3VR8 B;  5EE0 A;  1XLQ A;  2WP9 B;  5H92 C;  2HTM E;  1J7A A;  1N61 A;  3AH7 A;  1N5W A;  2E3T A;  3FAH A;  4ZOH C;  3AE9 B;  2WU2 B;  1CZP A;  1NYQ A;  1SIJ A;  2PKO A;  5AUK A;  2KAJ A;  3L4P A;  2JQR B;  2PIA A;  3B9J A;  3AEA B;  1XLO A;  4N59 A;  4YSY B;  1ROE A;  1SF0 A;  1E10 A;  1FO4 A;  4YSX B;  1TYG B;  2JX5 A;  1FM0 D;  2M19 A;  1TJE A;  1VJK A;  2OHF A;  4P6V F;  4JWU C;  1VDV A;  1VLB A;  3NS1 A;  3P4P B;  1YQ3 B;  5C3J B;  2H89 B;  2WQY B;  2DBY A;  2L83 A;  1QT9 A;  3LB8 C;  1F0Z A;  1DGJ A;  5GXG B;  1RM6 C;  1JAL A;  4YXD B;  1KRH A;  1TKG A;  1N62 A;  2G1E A;  4N58 A;  3AEG B;  5EE3 A;  4C7Y A;  1E0Z A;  1L0V B;  3AED B;  1QOG A;  5G5G A;  3PO0 A;  3NVV A;  1JQ4 A;  3AEC B;  1JWB D;  3AE3 B;  2LEK A;  1E7P B;  1JRP A;  1L6U A;  2DWQ A;  5C2T B;  4ITK A;  2H88 B;  1SB3 C;  3VRB B;  3NVW A;  3AEB B;  1ZOY B;  1PUT A;  1JW9 D;  1FMA D;  4FXC A;  3P4R B;  1H7W A;  2W55 A;  3EUB 2;  2WDR B;  2WU5 B;  1NVI D;  3LXF A;  4LTU A;  3SFD B;  2W3S A;  5EE1 A;  3ZYY X;  2MH7 A;  3AE8 B;  4HRO A;  4YTN B;  1E9M A;  3AN1 A;  2K9X A;  2Y5C A;  4YT0 B;  3AE2 B;  2W3R A;  1L5P A;  1QOF A;  3W5U B;  3CF4 A;  1QOA A;  1N60 A;  1NI3 A;  1V97 A;  1QLB B;  1EWY C;  4C7Z A;  1N5X A;  2Q5W D;  3B2G A;  3HRD D;  2BS4 B;  1AWD A;  1A70 A;  1XLN A;  1OFF A;  1N63 A;  1WGK A;  2WDV B;  1ZXI A;  3VRA B;  1TKY A;  1KFY B;  1WWT A;  3AEF B;  1GPX A;  5H8Y E;  3HVZ A;  2L52 A;  2QIE B;  4YTP B;  3SFE B;  2K5P A;  3RPF C; 
#chains in the Genus database with same CATH topology
 1QOB A;  3H7P A;  2M8S A;  2L3Z A;  5IP4 D;  3BZD B;  2NTS A;  2WLB A;  1WSP A;  1L2N A;  1Z2M A;  4KKI A;  2Z0D B;  1E7V A;  2BVC A;  2C60 A;  2RSU A;  2MJ3 A;  1J8C A;  4KSL C;  4DDI D;  4K7W A;  1V6E A;  1TY2 A;  4XDC A;  2RDH A;  3PLU A;  3V62 A;  4FA6 A;  1WZ3 A;  2M0X A;  1OQR A;  4NQK E;  3DVG X;  5EDS A;  1NYR A;  2QC8 A;  3DBL B;  3NZU A;  3KW5 B;  2INP E;  2LZ6 A;  3KWV A;  5BMI A;  2AWT A;  3VR8 B;  2IYD B;  2MBB B;  1VRA B;  4G11 A;  5G55 A;  1J7A A;  3EFU A;  1V2Y A;  2KAJ A;  3HM3 A;  2V3N A;  3QX1 A;  4GMV A;  2EMS A;  1KTK A;  4N59 A;  1E5W A;  2DYO A;  2KVZ A;  5AZH A;  1FO4 A;  1VJK A;  3A4S C;  1VLB A;  2G45 B;  1P3Q U;  2DBY A;  2KTF A;  1RM6 C;  1E0Z A;  3SDL C;  1L0Y B;  2MHJ A;  3U7D A;  2O6V A;  4A6Q A;  4ZRQ A;  1LO5 D;  4M02 A;  4RGN A;  1V49 A;  3BWU D;  2IY0 B;  2LUM A;  4KGT A;  2WU5 B;  5BMG A;  2MCN B;  1SJH D;  3AE8 B;  1PGA A;  2K9X A;  3VDZ A;  4F1S A;  4HDO A;  3ZGZ A;  3VVW B;  2RR9 A;  2X38 A;  3X23 A;  2FCS A;  1JML A;  2ZW0 A;  1V80 A;  4JE3 B;  1VD2 A;  1D5Z C;  4DHJ D;  5J2R A;  4M8M A;  2DYB A;  3AE4 B;  1I4X A;  3BIN A;  2MJE A;  1EO6 A;  1HEZ E;  4PYZ A;  1V8C A;  4NQL B;  3OG5 A;  1ZUD 2;  2BS3 B;  2LI5 A;  1FIQ A;  1VZ6 A;  2M56 B;  2RPV A;  1EWC A;  4XGA B;  3AV8 A;  1MG4 A;  1XCQ L;  3U7Z A;  2JPH A;  3KUZ A;  1EF5 A;  3I5J C;  1ZW7 A;  2RDG A;  1GTE A;  4XX5 A;  3SEB A;  2FUH B;  3QQ8 B;  1B9R A;  1ZPS A;  1XO3 A;  1WYG A;  3DVN U;  3DWM A;  2JSV X;  2CHX A;  2W82 A;  1ACC A;  1F52 A;  2G4S A;  3MTN B;  4MSQ B;  1N5W A;  2LHE A;  3I9V 1;  4W9I A;  4WAA A;  1LXD A;  2JU6 X;  1SJE D;  3V6E B;  1FM0 D;  1TJE A;  4OZA A;  1WI0 A;  3ML9 A;  2HD5 B;  3K9P B;  4YXD B;  2YVC A;  2MBO A;  1V5O A;  1UH6 A;  4KKJ A;  1KJT A;  2LXC A;  3AEC B;  4RNA A;  4K3B A;  1SB3 C;  2H88 B;  3APC A;  3R8B A;  2BKF A;  2D2Q A;  3SFD B;  3UIO B;  5EE1 A;  2MH7 A;  4C00 A;  1I4R A;  2RGF A;  3AI5 A;  2KT7 A;  2FCQ A;  1QOF A;  4L1B A;  3WAL A;  4MM3 A;  3BK2 A;  3IFW B;  5AZF A;  3ZNG C;  3VXW A;  1TKY A;  2LD9 A;  4EZK A;  2MQJ A;  4A8X C;  4IM0 A;  3VAW A;  1FD6 A;  3ZRF A;  3RFZ B;  2QHO A;  3ALB A;  4LK0 M;  5LLI A;  4N9F 4;  1XF5 L;  1JWM D;  3RNA C;  3B0A A;  1C4C A;  3NZ3 A;  1KLU D;  5AEK B;  1RRB A;  3UF8 A;  2KWU B;  2M1M A;  1WRI A;  3A1Q B;  1GB4 A;  2PE9 A;  5CHW A;  1GAQ B;  3BVZ A;  3UQB A;  4AJY B;  3CIR B;  3IBE A;  4FLH A;  2WYQ A;  3BII D;  5EE9 A;  4EUT A;  3PVL A;  3VTV A;  5MPO A;  1D3Z A;  4PS3 A;  2JUO A;  2DEN B;  2DNF A;  1WXV A;  4G3X B;  3E9S A;  4S17 A;  1N61 A;  2INN E;  1CZP A;  3EHV A;  1AN8 A;  3EC8 A;  3LDZ E;  4DDG D;  3WA0 A;  3RD2 A;  3TSS A;  4JGH B;  1SBB B;  2V3P A;  3P4P B;  4ZYS A;  2L83 A;  1DGJ A;  3PHW B;  1JAL A;  4F7Z A;  4N58 A;  2XN9 C;  4LCD E;  3AEG B;  1L0V B;  2IO2 B;  5IA7 A;  1JQ4 A;  2I1K A;  2N7E A;  4CQN A;  3AE3 B;  2M17 A;  2BWE S;  2GBJ A;  1RAX A;  4HRO A;  2IJ0 A;  4JQW C;  2GMI C;  4RM9 A;  2D3C A;  1WGY A;  1V97 A;  3GOE A;  3GE8 C;  1ZKH A;  3LJ3 A;  2BTE A;  1ESF A;  2IGG A;  1WWT A;  1SGH A;  1EM7 A;  1HQR D;  3VH4 B;  2PW9 A;  1V1P A;  5AZG A;  2JXT A;  2K3U A;  3MC9 A;  1H4R A;  4BKT A;  1FFU A;  2KX3 A;  4W9K A;  3DOW A;  3HUI A;  3SU8 X;  2N0S B;  1TS2 A;  3SD5 A;  1V1O A;  4WWO A;  5TR5 A;  3AE1 B;  2PE6 B;  2ICI A;  3PRZ A;  3DBH B;  2CJO A;  5JHB A;  4ANX A;  1FRR A;  2INC C;  1M4V A;  2KQS A;  1KLV A;  3C8Y A;  3RZF A;  2IBI B;  3K9O B;  1UBI A;  2IY1 B;  3MHZ A;  4A9A A;  4HJG E;  3O13 A;  3SHQ A;  2AQ1 B;  4LDT B;  3Q8F A;  2N4F A;  2JZP A;  3ZW3 A;  5G2N A;  4WWN A;  5LXI B;  2E6X A;  4XYC A;  2FAZ A;  3W1S C;  3QJZ A;  1HTO A;  4AP4 C;  2PLP A;  1OEY A;  4AJW A;  3LYY A;  3LB8 C;  4DWF A;  1QT9 A;  3Q8C A;  4G0N B;  4EFO A;  3HM6 X;  1TKG A;  3KUD B;  4C7Y A;  4WH4 A;  3Q3M C;  4C4V A;  4FJY A;  1L6U A;  2G3Q B;  4WWP A;  5D7G A;  1LQB A;  1XQQ A;  1C78 A;  1H7W A;  2W55 A;  2KJH B;  1UD7 A;  4AS1 A;  3ZUN A;  4ANV A;  2NBV B;  1S3S G;  1M94 A;  3U4E G;  2JYE A;  4BKG A;  4WJN A;  4C7Z A;  5HKH A;  3ZTC A;  5DPW A;  4E3C A;  4K3C A;  3RYT A;  4YTP B;  4B0M A;  3DBR B;  1YIW A;  3PSE B;  4HCP B;  4K7U A;  3AE5 B;  1Q5W B;  4OZC A;  1RFK A;  1MPE A;  1PDX A;  5G5H A;  3ZNZ B;  3RCZ A;  3B2F A;  3KLS X;  1DOI A;  1VZ7 A;  1RYJ A;  3L17 A;  3N32 A;  3Q69 A;  2BYF A;  1FXT B;  1YX5 B;  2C7N B;  2DHZ A;  2GOW A;  2YLM A;  2KDF B;  3JSV B;  1TKE A;  1XT9 B;  2XEW A;  3T8M A;  2VZK D;  2C7M B;  3PGE A;  4TUU A;  2JRH A;  1YN4 A;  3OAW A;  3P4S B;  1P0R A;  2MX2 A;  3RNC C;  4WQM A;  1JWS D;  1SE3 A;  4P16 A;  1I35 A;  1J7C A;  3ONS A;  4II2 B;  5BMH A;  3E56 A;  5IKC M;  3VHT C;  3A9J B;  4M0W B;  1CMX B;  2QJL A;  1T0Y A;  1XXG A;  1QF6 A;  2KDI A;  3PZ8 A;  2BYV E;  3UIP B;  1V81 A;  1K51 A;  4MGY E;  1E8Z A;  4ZYN A;  3FAH A;  1FNV A;  4P1B C;  3WAN A;  3TEX A;  4LNI A;  1E10 A;  3T3N A;  1F2R I;  4DXA B;  2M19 A;  4DHZ E;  2ZCC A;  1UGJ A;  2PPH A;  3NS1 A;  3V05 A;  4ARC A;  2K8B A;  1V5T A;  1QOG A;  3S2A A;  2LRU A;  2VRR B;  1YD8 U;  1KLG D;  3AEB B;  4CO7 A;  2HDE A;  3Q8E A;  2TSS A;  2JY6 A;  2KFJ A;  2D11 A;  5FR6 A;  4HJK A;  1EWY C;  1G6J A;  2BS4 B;  1AWD A;  1OTR B;  3VTU A;  2EMT A;  2D5G A;  2IO3 B;  1F2R C;  2FCM A;  2OOB B;  2CR5 A;  2DZK A;  2QSD A;  3N1X C;  4KIK B;  1GC7 A;  2VZK B;  3AE6 B;  1FXI A;  4HRS A;  1MHH E;  2UWQ A;  3DBS A;  1C4A A;  5D3I B;  1STE A;  2B76 B;  2N7J A;  3HK0 A;  2DX5 B;  4W9L A;  3AMZ A;  4BBN C;  1A5R A;  3N30 A;  3NOB A;  4W9G A;  1XLP A;  2M4N A;  1FNW A;  3URY A;  1EU4 A;  2DAJ A;  4ZRK A;  3Q3O C;  5I4D A;  2ONQ A;  1I4P A;  1GT8 A;  2WXK A;  4HDQ A;  3NVZ A;  1KM7 A;  4JX1 C;  2WNM A;  2KWD A;  3NHE B;  1KF6 B;  1WM2 A;  3JYU A;  4OVV A;  4NPN A;  2BYE A;  2N9K A;  1E8X A;  1SIJ A;  2PKO A;  4MJS A;  2Z0E B;  4MGZ E;  2JQR B;  1Q0W B;  2J42 A;  3N9Y C;  4YSY B;  2JWZ A;  2JX5 A;  1C77 A;  1AW7 A;  3TUO A;  4A3O A;  2G1E A;  2RD0 A;  3W1Y A;  1WGD A;  1T0R C;  3NVV A;  4PK1 A;  2N9P C;  2LEK A;  1E7P B;  5C2T B;  2Y3A A;  1S1Q B;  2LGX A;  4KZC A;  2ON8 A;  3A9K A;  5CX3 A;  3ZVV A;  4DXG A;  3DCG A;  3AN1 A;  5FKA C;  1WR1 A;  3AE2 B;  2WWZ A;  4LJO B;  5CHF A;  1QOA A;  4BKS A;  5KHO A;  3B2G A;  3CF6 E;  1E8Y A;  1WGK A;  2WXP A;  2DZJ A;  2AQ2 B;  2WXF A;  2ZJD A;  2QIE B;  3RPF C;  3TEZ A;  1TS5 A;  3ABV B;  4K7S A;  3AU5 A;  4RGO S;  1ISN A;  4W9C A;  2WXJ A;  3QC8 B;  1R4M B;  2KOX A;  3W5V B;  2N1W A;  4MT5 A;  3TMP B;  2MWS B;  2N7D A;  2BPS A;  1X1M A;  1F9J A;  4MAC A;  3CWI A;  2QMT A;  3H9D A;  2BT6 A;  2N9X A;  4GU2 A;  3ZNH B;  1Z5S B;  2IDY A;  4J6I A;  2ASQ A;  2CU3 A;  3H6N A;  1SE4 A;  4FJV B;  1L6V A;  5JHA A;  2SEB D;  2MSE D;  4IUM B;  3ZDM C;  1BT0 A;  1FCC C;  1F77 A;  2NMQ A;  2KTR A;  2REX A;  2R2O A;  1FRD A;  2EKI A;  2KZR A;  3ZDT A;  2GLS A;  4A55 A;  3EFC A;  2JF5 A;  3PRE A;  2NVU I;  4A90 A;  2K8C A;  1SEB D;  5C23 A;  2L00 B;  2L0F A;  4CYE A;  3KH0 A;  4YSX B;  4JWU C;  3B1L X;  2J0M A;  3RMK C;  1F0Z A;  2PEA A;  3R7Q A;  2ZEQ A;  3DHG C;  1AAR A;  1V9J A;  4XDD A;  3RT3 B;  4IWP A;  1WGR A;  3OWE B;  3DBL I;  2AQ3 B;  3NVW A;  2XNA C;  4MSM B;  2BYT A;  4J3O D;  1OEY J;  5D6J B;  2KK8 A;  3PV1 A;  4X57 B;  4WUR A;  4B6W A;  1UF0 A;  3FIL A;  4AWJ A;  2DYM A;  3DDC B;  3HRD D;  5C1Z A;  1BXT A;  4ZRI A;  2OED A;  1KFY B;  1V86 A;  3L16 A;  3MJ5 A;  1C79 A;  3W1S A;  3ZJV A;  1R4M I;  3U2S C;  4BZA A;  1F1H A;  2UYZ B;  2ACZ B;  3P2B A;  4I6N B;  4YSZ B;  3APD A;  3A9J A;  1K8R B;  1D5M C;  2W54 A;  1WRD B;  1K50 A;  3PZD A;  2LWP A;  1MVK A;  2FE8 A;  3NRZ A;  2NPT B;  3ZRC A;  3FC4 A;  1PFD A;  2EKE C;  2MJD A;  4L23 A;  1UUP A;  5DPT A;  3SR6 A;  1EF1 A;  2IO0 B;  3MP9 A;  3RNG C;  2GB1 A;  2LAS A;  2K6D B;  2LJI A;  2G4D B;  3WAO A;  1E90 A;  1MFW A;  1XLQ A;  4A3P A;  1TIF A;  4WJP A;  1WIA A;  1WM3 A;  3ZTD A;  3RN9 C;  4W9D A;  5J18 A;  3TL5 A;  2OHF A;  2WQY B;  3MHS D;  2KJ6 A;  4II3 B;  1U4A A;  2O2V B;  3HIZ A;  1TT5 B;  4DQO C;  3AED B;  1R4N B;  4GLS C;  1JWB D;  1LGR A;  2DWQ A;  1FPY A;  3ZJT A;  3QA8 A;  3M62 B;  2O6V D;  1ZOY B;  2I38 A;  4FXC A;  5HG2 A;  4ARI A;  2Y5C A;  3N1Y C;  1SE2 A;  2KQ4 X;  2RMM A;  2K8H A;  2WXR A;  4IC7 B;  3QHT A;  5E6O A;  3A33 B;  1XLN A;  2VH1 A;  2WDV B;  3DQV A;  4OHJ A;  1UNS A;  2KNB A;  2MBH A;  2A5U A;  2L52 A;  2K0P A;  4I6L B;  3X0W A;  1YJJ A;  2JXX A;  4NAW B;  1GNU A;  4TMA B;  4K81 A;  4OVZ A;  2QCZ A;  1WJU A;  1JWU D;  1GC6 A;  3R3M A;  2JVC A;  1BUI C;  1JWA D;  1VZ8 A;  4WWM A;  1WGH A;  4MH8 A;  5DCN A;  1JRO A;  2KDE B;  3DWG C;  1PYW D;  3DVG Y;  4ZRP A;  3OJ3 A;  4NAW A;  4M8N A;  4RGM A;  1GTH A;  5GMV A;  2GI9 A;  2YEP F;  2A4Z A;  2WXQ A;  2ZPY A;  5D3D A;  4IWQ A;  3RUL A;  3AB5 A;  1UGM A;  3Q8A A;  2KDB A;  1GG3 A;  1MJD A;  4M00 A;  3OLM D;  4ZRJ A;  2PIA A;  2LUE A;  3PTF C;  3ZLZ A;  3NY5 A;  4TQ1 A;  4HLE A;  2L0T A;  2SAK A;  2FNJ B;  4IWO A;  4PS7 A;  4GXB A;  5HI1 A;  4NJC A;  5C3J B;  2IPK D;  4JLC A;  1GB1 A;  2RPQ A;  4EOY A;  1WR6 E;  1IYF A;  3NUH B;  4KZ0 A;  1WE6 A;  4B0E A;  2WXG A;  1Y56 A;  1PGB A;  1YN3 A;  4A20 A;  2GBR A;  4IW0 A;  3PT2 B;  2NPT A;  1FMA D;  2BWF A;  2WXO A;  3Q3N C;  1GOZ A;  3QK0 A;  3ML8 A;  3N20 C;  3M63 B;  4YTN B;  3A4R A;  5LNK 1;  2C9W B;  3T3O A;  2MP2 A;  4XZ4 A;  4RFB A;  4LDT D;  1N5X A;  1K52 A;  3WIM A;  4S0R A;  3VRA B;  2ZZP B;  4GOC A;  4W9E A;  1GPX A;  4IG7 B;  5DPS A;  2KDM A;  1UEL A;  2ZNV C;  2WGS A;  2LXA A;  1HZ5 A;  4GDL B;  2J52 A;  4XWT A;  1OQQ A;  4E71 A;  1FXA A;  2BGF A;  2LVQ A;  1H7X A;  4FHJ A;  4MH0 E;  3Q3J A;  2QDF A;  1C9F A;  4REZ A;  2HE7 A;  1UWM A;  4N6E B;  2ZVN A;  2MW5 A;  2WXH A;  1K53 A;  1IGD A;  3TBL D;  2PVG C;  5T8I A;  3GZN B;  2HJ1 A;  2MA9 B;  1WX7 A;  1XCT L;  3UQA A;  5BYQ A;  3ETR A;  2IGD A;  3QIJ A;  4KGS A;  3L08 A;  2K1F A;  1SSN A;  4HXD A;  3PRM B;  2XK5 A;  3GE3 C;  1RFA A;  1YNT E;  2LVP A;  3O65 B;  1IBX A;  3KUC B;  4FAD A;  2LVO A;  4HKZ E;  4ZOH C;  2WU2 B;  3GZN I;  1WXA A;  1YX6 B;  3R2T A;  4IKG A;  3PLV A;  1TYG B;  2MEK A;  3L0W B;  2OJR A;  3UGB B;  1HE8 A;  5L83 A;  1WZ0 A;  2LRW A;  4ACF A;  2G9H D;  4ITK A;  1ZDX A;  2AL3 A;  3T9L A;  4KGR A;  1FNU A;  4K1R B;  4DHJ B;  1C3T A;  2WDR B;  1NVI D;  1N6Z A;  3VUY A;  4KV2 A;  1NDD A;  2NBW B;  4LJP B;  1E9M A;  2J7Q B;  1L5P A;  2GBN A;  4O1N A;  1CQV A;  4PT5 A;  1WXS A;  1L4Z B;  2KO3 A;  4RGT A;  2KAC A;  5JZE B;  4M0W A;  2D3A A;  3D32 A;  1WF9 A;  3JW0 X;  2EEL A;  2K5P A;  1SIF A;  1WJ6 A;  2N9L A;  2VH2 A;  2HTM E;  3KQ4 A;  4H2A A;  2IND C;  2FBW B;  4IM2 A;  3EGR A;  3VQI A;  4TSS A;  1I4G A;  3GP7 A;  4PYU A;  1JCK B;  2L76 A;  1VCB A;  4RCO A;  5CTR C;  2R2Q A;  4XE0 A;  2LFI A;  4NNJ B;  2K6Q A;  2I1J A;  1R7S A;  1FEH A;  1D5X C;  1DOY A;  2L1A A;  3EEC A;  2XBB C;  3MFG A;  1HZ6 A;  4DXF A;  3DHH C;  3AH7 A;  2KX0 A;  3PHX B;  1NYQ A;  3TCA A;  3V3X A;  4MEM A;  2LMC A;  3PRP B;  2WXI A;  3VUW A;  1BML C;  2NR2 A;  3KVF B;  4P6V F;  3H7S A;  1T0S C;  1E7U A;  5GXG B;  3V6C B;  4NJ6 A;  3MC0 B;  2L7R A;  4EZJ A;  1QKZ A;  3VTW A;  4LLG M;  1JRP A;  1WX8 A;  2WXN A;  2QEJ C;  4B9K A;  2D10 A;  1D4B A;  1ET6 A;  5IO9 A;  4YT0 B;  2KC2 A;  2KJR A;  2YEP B;  1N60 A;  2HJ8 A;  2L8J A;  3RNB C;  1TZO A;  2J0J A;  1P1A A;  4KSK C;  2KLG A;  1OFF A;  3CST A;  1ZXI A;  2Y5P A;  4I6P A;  2HTH A;  5H8Y E;  5E6P A;  1YN5 A;  1MG8 A;  2Z8L A;  2XK5 B;  2RDB C;  4E74 A;  4GIV A;  3AE7 B;  4BOS C;  3KWL A;  2AL6 A;  3PS6 A;  5BO4 B;  4JWS C;  4KX6 B;  1YQB A;  5J17 A;  3W9C B;  4LNO A;  2BS2 B;  3I57 A;  4TV3 A;  1T6B X;  3IVF A;  4WJQ A;  4EEW A;  3BYT B;  3CSF A;  4C80 A;  1WE7 A;  4LNF A;  4URK A;  3NVY A;  2MBE A;  1OGW A;  3KYD D;  2NTT A;  3WAP A;  3FIL B;  2JZZ A;  1AYF A;  2DZM A;  4P1C C;  1NEK B;  2O6V B;  4XC2 A;  2I2Y A;  3MC8 A;  1GUA B;  4GN1 A;  1B1Z A;  4OZB A;  2KWV B;  3BY4 B;  2D3G A;  2KKC A;  3BYY B;  1GJZ A;  1Q10 A;  1XLO A;  4MDK E;  2JT4 B;  2BB5 A;  2JYT A;  2DLB A;  2KXJ A;  1WMH B;  2LGI A;  2KN5 A;  4HVB A;  5G5G A;  4DHZ B;  5FK9 C;  2KTR B;  3VUX A;  2LGS A;  3B08 A;  2AYO B;  3IG3 A;  3P4R B;  1D6E C;  4AOF A;  4LTU A;  5E6J A;  4HPM B;  2IZV B;  2CHW A;  4GB9 A;  3W5U B;  3Q2A C;  1NI3 A;  3HHM A;  2Q5W D;  1A70 A;  3CMM B;  3P42 A;  4MJS B;  2WXL A;  4XWW A;  3TIX A;  1RLF A;  2JRI B;  3TEY A;  4YL8 A;  3DVN V;  4HKQ A;  4GSW A;  4Q2J A;  1WXQ A;  2Y5B B;  4ICV A;  4USA A;  1FFV A;  1IUE A;  1YQ4 B;  2WS3 B;  3AEE B;  1J0G A;  4YWG G;  3MJW A;  4DBG A;  3BVM A;  3QWZ B;  4IM3 A;  1P7E A;  3JSV A;  1YJ1 A;  4US9 A;  3TJP A;  1LM8 B;  5JH5 C;  3WCQ A;  2W9N A;  4GDL A;  4BFR A;  1T3Q A;  1UWX A;  2IGH A;  4HEA 1;  1UZX B;  4NY0 A;  4W9J A;  2M0A A;  2K22 A;  4ZDV A;  2J0K A;  2QIL A;  2KAN A;  3J9C A;  5AUI A;  2KHW B;  3NZS A;  3M95 A;  2KC1 A;  2E3T A;  2PJH A;  5D94 A;  1MHX A;  2N1V A;  3QAQ A;  4G50 A;  3PPA A;  1SXT A;  3ZQ4 A;  1WXM A;  1PQS A;  3N1Z C;  3RUI B;  4C56 C;  4NZL B;  5D2M B;  1TBE A;  1HA5 A;  2Z59 B;  2WHI A;  4WJO A;  3PO0 A;  4FJZ A;  1T0Q C;  4ASW C;  3WAM A;  4GDK B;  3Q6B A;  1KOT A;  1L7Y A;  3IXS A;  4BOZ B;  3LXF A;  1J19 A;  3ZYY X;  2PMV A;  2C5L C;  2L32 A;  3PZ7 A;  2LGD A;  4QAY A;  1P9D U;  4HPP A;  3VH3 B;  4WQO B;  3L54 A;  1FCL A;  2V0G A;  1N63 A;  3AUL A;  1WY8 A;  3APF A;  3R66 C;  1V1P B;  4DK5 A;  4FUL A;  1C4P A;  1IP9 A;  1JRU A;  4HK2 A;  3ZO5 B;  2AX5 A;  5HFY A;  3P4Q B;  4HCN B;  4OW0 A;  1NEN B;  2X8X X;  4FN2 A;  1I42 A;  2C7H A;  3NS8 A;  2CKH B;  4F8C B;  4RMA A;  4TKN A;  1ZDV A;  4ZHP A;  4B95 A;  4IDI A;  2ZCB A;  2KMM A;  4M01 A;  2ZNV B;  4BBN F;  1ZP0 B;  5CHV C;  2PTL A;  3NJT A;  4CHK A;  2KVR A;  1RWS A;  3GS2 A;  3RNE C;  3NG0 A;  2FID A;  4LNN A;  1IBX B;  4FBJ B;  4JIO U;  4PS8 A;  4ANW A;  3M3J A;  3I3T B;  2WX0 A;  1L0X B;  2WDT B;  5EE0 A;  3ZXR A;  1NBF C;  1QZE A;  2KFK B;  2KMC A;  5JXV A;  2J4X A;  3DBR I;  4NAM A;  3AEA B;  5FR3 A;  3BK1 A;  1SE9 A;  2OJW A;  1VDV A;  2FCN A;  4EZL A;  3IAM 1;  1YQ3 B;  2ZW1 A;  1KRH A;  2CS4 A;  1WH3 A;  1WYW B;  3UI3 A;  4ANU A;  5LXH A;  2JWU A;  3GB1 A;  4HPL B;  2KFK A;  3DBH I;  4C4V B;  1JW9 D;  1WGG A;  2JZ3 B;  1WFY A;  1P98 A;  2ZPN A;  3CF4 A;  5IAA C;  2MLB A;  5IOI A;  1Y8R C;  3Q8B A;  3IAS 1;  2KN4 A;  2GBK A;  2WXM A;  3AEF B;  2O2V A;  3C19 A;  3V60 A;  3HVZ A;  3A1Q A;  2LHD A;  1XEE A;  3OJ4 B;  3SFE B;  3H8H A;  3W2D A;  4KVG B;  5E6N A;  1HTQ A;  3N3K B;  2DZI A;  1KH0 A;  1QIL A;  4EE2 A;  4KDI C;  5DPR A;  5TSS A;  2BBC A;  1R4N I;  4GGQ A;  1ENF A;  1E8W A;  4FHK A;  2MP2 B;  1P7F A;  3P63 A;  2FIF A;  2NCN A;  4ZHO A;  2BQQ A;  4ICU A;  1CJE A;  2CJN A;  4AUQ C;  5KHQ A;  3RZW C;  2D07 B;  3VR9 B;  4NJ7 A;  2KYW A;  1WMH A;  1TS4 A;  1WJN A;  2V1Y A;  2NBU A;  4US8 A;  4MGI E;  1YOV B;  1YMH E;  2MRP A;  3QAR A;  3VFK A;  3AE9 B;  3IT6 B;  3B9J A;  3Q3F A;  4IOI E;  1ROE A;  1SF0 A;  3R7R A;  2CHZ A;  1EU3 A;  3ZXV A;  2AEH A;  1TGZ B;  4W9F A;  2V3S A;  4R3D A;  1N62 A;  4MEL A;  4EKU A;  3HVD A;  2KD0 A;  2GRI A;  3ECI A;  3ZNI D;  1OQY A;  4TQ0 A;  3EUB 2;  4BKS D;  2LJ5 A;  4GDK A;  1TZ1 A;  1QQR A;  2KQ7 A;  1C1Y B;  1UBQ A;  2KMA A;  2UU7 A;  2R61 A;  2D3B A;  3FKY A;  1LFD A;  2V9H A;  4UDU C;  1Q1O A;  1I4Q A;  5L95 C;  4JPS A;  2LGY A;  4KIK A;  2BB6 A;  1NI2 A;  2GBM A;  1DYQ A;  4WAF A;  2WDQ B;  3AXC A;  1J7B A;  1WX9 A;  4YTM B;  1ZGU B;  3KYC D;  4MGK E;  3U8Z A;  4D2K A;  2FUG 1;  1DOX A;  3DHI C;  1H8C A;  4P7I A;  3U52 E;  1IGC A;  1E6E B;  2K25 A;  1I7H A;  3U30 A;  1T5X D;  2PVO D;  1ET9 A;  2ZVO A;  3AM9 A;  3BVG A;  5IN7 A;  1YJI A;  1ZE3 D;  1TTN A;  4BAX A;  3P1M A;  2KWC A;  3AU4 A;  2WP9 B;  4RF0 A;  2MBQ A;  5H92 C;  3L10 B;  3RNF C;  3TEW A;  2K39 A;  4JL9 A;  5AUK A;  2L05 A;  3L4P A;  3I63 C;  4OVU A;  2CU1 A;  4RH6 A;  4HWI B;  4MM3 B;  4WIP A;  3C0R B;  1TY0 A;  1CK1 A;  4RM8 A;  1IPG A;  3IT4 B;  2H89 B;  2V4I B;  3H1U A;  3JVZ X;  4LNK A;  3QCA A;  3ZIM A;  3ZJU A;  2BF8 B;  5BYS A;  5EE3 A;  2DAF A;  1EUV B;  3ENE A;  3V61 A;  1VR9 A;  2BW2 A;  3A9K B;  3Q14 C;  3VRB B;  1PUT A;  2WX1 A;  3DPD A;  2N9E B;  2W3S A;  4L2Y A;  1WJ4 A;  4W9H A;  2B3A A;  4BVU C;  3RI7 C;  1L4D B;  4AQ7 A;  3IHP C;  1XD3 B;  2W3R A;  4KDL B;  1I4H A;  1PGX A;  5HHD G;  2NS5 A;  1ZXH A;  2V4L A;  3ZKJ C;  2IO1 B;  3EA6 A;  1QLB B;  1MI0 A;  4RF1 A;  3L13 A;  1HXY D;  3H7P B;  3UIN B;  2J53 A;  2BKR B;  1C76 A;  3R2I A;  1TS3 A;  2KLC A;  5BYR A; 
#chains in the Genus database with same CATH homology
 1YJJ A;  1QOB A;  4USA A;  3AE5 B;  1FFV A;  4NAW B;  1IUE A;  3BZD B;  4OZC A;  1YQ4 B;  1RFK A;  1MPE A;  4TMA B;  2WS3 B;  1PDX A;  3AEE B;  4YWG G;  2NTS A;  2WLB A;  3BVM A;  4OVZ A;  5G5H A;  1P7E A;  1WSP A;  1JWU D;  4KKI A;  4US9 A;  3B2F A;  3KLS X;  1DOI A;  1VZ7 A;  1BUI C;  3WCQ A;  1RYJ A;  2MJ3 A;  3Q69 A;  1JWA D;  1VZ8 A;  1T3Q A;  4WWM A;  1UWX A;  1TY2 A;  4MH8 A;  4XDC A;  1JRO A;  2RDH A;  3DWG C;  2IGH A;  1TKE A;  4HEA 1;  1PYW D;  2VZK D;  1YN4 A;  4ZRP A;  3P4S B;  4WQM A;  1JWS D;  1SE3 A;  2K22 A;  1OQR A;  2M0A A;  4P16 A;  1J7C A;  4RGM A;  2QIL A;  3J9C A;  1GTH A;  3E56 A;  5BMH A;  1NYR A;  2QJL A;  5AUI A;  2INP E;  2GI9 A;  2YEP F;  1XXG A;  1QF6 A;  2WXQ A;  3KWV A;  5D3D A;  3PZ8 A;  5BMI A;  3AB5 A;  3VR8 B;  1K51 A;  1VRA B;  3Q8A A;  1J7A A;  2E3T A;  3FAH A;  1FNV A;  2KAJ A;  2V3N A;  2PIA A;  1MHX A;  1KTK A;  4N59 A;  2DYO A;  4TQ1 A;  3TEX A;  2SAK A;  1E10 A;  3T3N A;  1F2R I;  1FO4 A;  2M19 A;  1UGJ A;  1SXT A;  1VJK A;  3ZQ4 A;  1VLB A;  3NS1 A;  5HI1 A;  4NJC A;  3V05 A;  5C3J B;  2DBY A;  4C56 C;  4ARC A;  2IPK D;  4NZL B;  1GB1 A;  1RM6 C;  1HA5 A;  1E0Z A;  1L0Y B;  3NUH B;  1QOG A;  3PO0 A;  4B0E A;  2WXG A;  4A6Q A;  4ZRQ A;  1LO5 D;  1Y56 A;  1KLG D;  1PGB A;  1YN3 A;  4GDK B;  3AEB B;  2HDE A;  4RGN A;  3BWU D;  1FMA D;  2LUM A;  3IXS A;  3Q8E A;  2WXO A;  4KGT A;  2WU5 B;  1GOZ A;  3LXF A;  5BMG A;  3ZYY X;  1SJH D;  3AE8 B;  1PGA A;  4YTN B;  2PMV A;  3PZ7 A;  2L32 A;  2K9X A;  5LNK 1;  2TSS A;  3ZGZ A;  3T3O A;  4RFB A;  2X38 A;  1JML A;  1EWY C;  1N5X A;  1K52 A;  2BS4 B;  1AWD A;  1FCL A;  2V0G A;  1N63 A;  2ZW0 A;  3VRA B;  1V1P B;  2D5G A;  1F2R C;  4JE3 B;  1GPX A;  1D5Z C;  1C4P A;  2KDM A;  2QSD A;  2VZK B;  3AE6 B;  1HZ5 A;  4GDL B;  1FXI A;  2AX5 A;  2J52 A;  4HRS A;  5HFY A;  3AE4 B;  3P4Q B;  1OQQ A;  1MHH E;  4XWT A;  1C4A A;  1NEN B;  1FXA A;  4OW0 A;  5D3I B;  1I4X A;  1H7X A;  2MJE A;  1STE A;  2B76 B;  1HEZ E;  2N7J A;  1V8C A;  1ZUD 2;  1C9F A;  3AMZ A;  2BS3 B;  4REZ A;  1UWM A;  4N6E B;  1ZDV A;  1FIQ A;  1VZ6 A;  2M56 B;  2WXH A;  4ZHP A;  1K53 A;  1IGD A;  2RPV A;  4IDI A;  2PVG C;  1EWC A;  2KMM A;  1XLP A;  3AV8 A;  1ZP0 B;  5T8I A;  1XCQ L;  1FNW A;  3URY A;  1EU4 A;  2PTL A;  3U7Z A;  5I4D A;  2ONQ A;  1I4P A;  1RWS A;  1GT8 A;  2RDG A;  3GS2 A;  1XCT L;  2WXK A;  1GTE A;  5BYQ A;  3SEB A;  3ETR A;  3NVZ A;  1IBX B;  4JX1 C;  2IGD A;  4KGS A;  2WNM A;  1B9R A;  1ZPS A;  1XO3 A;  1WYG A;  2KWD A;  1SSN A;  1KF6 B;  3DWM A;  2JSV X;  1L0X B;  5EE0 A;  2W82 A;  1ACC A;  1YNT E;  2N9K A;  1IBX A;  1N5W A;  4HKZ E;  2LHE A;  3I9V 1;  2WU2 B;  1SIJ A;  2PKO A;  4ZOH C;  5JXV A;  2J4X A;  2JQR B;  4NAM A;  2J42 A;  3AEA B;  2JU6 X;  1SJE D;  3N9Y C;  4YSY B;  3R2T A;  3BK1 A;  4IKG A;  5FR3 A;  1TYG B;  2JX5 A;  1C77 A;  1FM0 D;  1TJE A;  4OZA A;  1VDV A;  1AW7 A;  3IAM 1;  1YQ3 B;  2MEK A;  3TUO A;  2ZW1 A;  4YXD B;  1KRH A;  2G1E A;  3UI3 A;  4KKJ A;  2JWU A;  3GB1 A;  3NVV A;  3AEC B;  4RNA A;  2G9H D;  2LEK A;  1E7P B;  1ZDX A;  4ITK A;  5C2T B;  2Y3A A;  2H88 B;  1SB3 C;  4KGR A;  1FNU A;  1JW9 D;  2WDR B;  1NVI D;  2ON8 A;  3R8B A;  3SFD B;  5EE1 A;  2MH7 A;  1I4R A;  1E9M A;  3AN1 A;  4DXG A;  5FKA C;  3AE2 B;  1L5P A;  1QOF A;  4O1N A;  4L1B A;  3CF4 A;  1CQV A;  1QOA A;  4PT5 A;  1L4Z B;  3B2G A;  3BK2 A;  4RGT A;  1WGK A;  3Q8B A;  3IAS 1;  2WXP A;  2AQ2 B;  2KAC A;  1TKY A;  2WXF A;  4M0W A;  2KN4 A;  2WXM A;  3AEF B;  3HVZ A;  2LHD A;  1XEE A;  2EEL A;  2QIE B;  3SFE B;  2K5P A;  3H8H A;  4A8X C;  3RPF C;  3W2D A;  3TEZ A;  1TS5 A;  2N9L A;  2HTM E;  3ABV B;  3KQ4 A;  4H2A A;  4RGO S;  1KH0 A;  2FBW B;  1QIL A;  1FD6 A;  2WXJ A;  4EE2 A;  3RFZ B;  5TSS A;  2BBC A;  4LK0 M;  3W5V B;  1ENF A;  3EGR A;  4MT5 A;  3VQI A;  1XF5 L;  1JWM D;  4TSS A;  1P7F A;  3P63 A;  1I4G A;  3GP7 A;  4MAC A;  1C4C A;  3NZ3 A;  1KLU D;  1JCK B;  3CWI A;  2QMT A;  2BT6 A;  4ZHO A;  1WRI A;  2IDY A;  1GB4 A;  4RCO A;  2CU3 A;  1SE4 A;  1L6V A;  1CJE A;  1GAQ B;  2CJN A;  3BVZ A;  3CIR B;  4XE0 A;  2SEB D;  2LFI A;  3VR9 B;  3BII D;  5EE9 A;  1R7S A;  1FCC C;  1F77 A;  1TS4 A;  1FEH A;  5MPO A;  1D5X C;  2NMQ A;  1DOY A;  1FRD A;  2EKI A;  2L1A A;  4US8 A;  3MFG A;  3E9S A;  1HZ6 A;  4A55 A;  4DXF A;  1YMH E;  1N61 A;  3AH7 A;  2INN E;  4A90 A;  3AE9 B;  1CZP A;  1NYQ A;  3IT6 B;  3V3X A;  1AN8 A;  1SEB D;  2LMC A;  3B9J A;  4IOI E;  2WXI A;  1ROE A;  1SF0 A;  1EU3 A;  1BML C;  3TSS A;  4YSX B;  4P6V F;  4JWU C;  1SBB B;  2V3P A;  3P4P B;  4ZYS A;  2L83 A;  1F0Z A;  1DGJ A;  5GXG B;  4R3D A;  1JAL A;  4N58 A;  2XN9 C;  1N62 A;  4XDD A;  3AEG B;  1L0V B;  3MC0 B;  3OWE B;  3HVD A;  1JQ4 A;  2GRI A;  4CQN A;  1QKZ A;  3AE3 B;  4LLG M;  1JRP A;  2AQ3 B;  2WXN A;  3NVW A;  2QEJ C;  2XNA C;  2BYT A;  4TQ0 A;  4J3O D;  3EUB 2;  1D4B A;  1QQR A;  1ET6 A;  4HRO A;  2IJ0 A;  4Q2J A;  4YT0 B;  2R61 A;  4WUR A;  3FIL A;  2YEP B;  1N60 A;  2DYM A;  1V97 A;  1TZO A;  3HRD D;  4UDU C;  1BXT A;  1I4Q A;  1OFF A;  1ZXI A;  2Y5P A;  2OED A;  2BTE A;  1ESF A;  1KFY B;  2IGG A;  1WWT A;  4JPS A;  3MJ5 A;  1EM7 A;  1HQR D;  1C79 A;  5H8Y E;  3W1S A;  3ZJV A;  1YN5 A;  2PW9 A;  1V1P A;  2BB6 A;  2Z8L A;  3U2S C;  2ACZ B;  2JXT A;  2K3U A;  3AE7 B;  1DYQ A;  4WAF A;  4YSZ B;  1FFU A;  3KWL A;  1D5M C;  2WDQ B;  2W54 A;  1J7B A;  4YTM B;  4JWS C;  1K50 A;  3HUI A;  4KX6 B;  2N0S B;  1MVK A;  1TS2 A;  2FE8 A;  1V1O A;  3NRZ A;  3W9C B;  2BS2 B;  3FC4 A;  4D2K A;  2FUG 1;  1DOX A;  3I57 A;  1PFD A;  1T6B X;  3AE1 B;  2MJD A;  3BYT B;  2ICI A;  4L23 A;  4C80 A;  1UUP A;  2CJO A;  3NVY A;  3U52 E;  1FRR A;  1IGC A;  1E6E B;  1I7H A;  3SR6 A;  1M4V A;  2NTT A;  3C8Y A;  1T5X D;  2PVO D;  1ET9 A;  3AM9 A;  3MP9 A;  3BVG A;  3MHZ A;  3FIL B;  4A9A A;  2GB1 A;  4HJG E;  1YJI A;  1AYF A;  1ZE3 D;  3O13 A;  1NEK B;  2AQ1 B;  2LJI A;  2I2Y A;  3P1M A;  3Q8F A;  1XLQ A;  1B1Z A;  2WP9 B;  4RF0 A;  5H92 C;  4OZB A;  2JZP A;  3TEW A;  3BYY B;  5AUK A;  3L4P A;  2E6X A;  1Q10 A;  1XLO A;  4RH6 A;  4MM3 B;  4WIP A;  1TY0 A;  1CK1 A;  2PLP A;  2BB5 A;  2JYT A;  2DLB A;  2OHF A;  3IT4 B;  2H89 B;  2WQY B;  2V4I B;  3LB8 C;  1QT9 A;  3LYY A;  3Q8C A;  3ZJU A;  2LGI A;  5BYS A;  1TKG A;  5EE3 A;  4C7Y A;  4WH4 A;  4DQO C;  3AED B;  5G5G A;  5FK9 C;  1JWB D;  4GLS C;  1VR9 A;  1L6U A;  2BW2 A;  2DWQ A;  3VRB B;  3ZJT A;  5D7G A;  1ZOY B;  1PUT A;  2I38 A;  4FXC A;  3P4R B;  1C78 A;  1H7W A;  2W55 A;  1D6E C;  5HG2 A;  4AS1 A;  4LTU A;  2W3S A;  4L2Y A;  5E6J A;  1L4D B;  4ARI A;  4AQ7 A;  2Y5C A;  3U4E G;  2W3R A;  1I4H A;  1PGX A;  1SE2 A;  5HHD G;  3W5U B;  2JYE A;  1ZXH A;  1NI3 A;  3EA6 A;  2KQ4 X;  1QLB B;  2RMM A;  4C7Z A;  1MI0 A;  4RF1 A;  2Q5W D;  2WXR A;  1HXY D;  1A70 A;  1XLN A;  2J53 A;  3P42 A;  2WDV B;  1C76 A;  2WXL A;  4OHJ A;  3R2I A;  4XWW A;  1UNS A;  3TEY A;  1TS3 A;  2L52 A;  4HKQ A;  2K0P A;  5BYR A;  4YTP B;  1WXQ A;  4B0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...