5C2TB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 64
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 5c2tB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5c2tB01
1GPXA 4ITKA 1J7CA 4US9A 2CU3A 2WS3B 1YQ4B 2WU2B 1FXAA 3ZYYX 1JW9D 2W55A 1GT8A 3SFDB 1QOGA 2W3SA 1A70A 1RYJA 3FAHA 1FFVA 3P63A 1IUEA 2WDVB 1JWAD 1E6EB 1PFDA 1TKGA 1WWTA 1XLOA 2L83A 1E7PB 5H92C 1JQ4A 3NRZA 2BS4B 3AECB 1ZP0B 1WGKA 2KMMA 3HRDD 3AE6B 1SB3C 5EE3A 4US8A 1V97A 1AYFA 3DWGC 1UWMA 1FRRA 3VR9B 4YTPB 5EE0A 1N5XA 1JROA 3HVZA 3W5UB 1NVID 1F0ZA 1XO3A 3AEDB 1AWDA 1DOYA 2M56B 2WLBA 1J7BA 2G1EA 1QOFA 1DOIA 1NYQA 3LXFA 4A9AA 1YQ3B 2KAJA 4N58A 3AEGB 1NEKB 1L6UA 1I7HA 2AX5A 1QLBB 4YTMB 1ZOYB 3AE4B 1WYGA 1FM0D 3P4RB 1XLNA 4N6EB 1PUTA 2M19A 4ZOHC 1N63A 1RM6C 1FFUA 3CF4A 4YXDB 2K5PA 2L52A 1TJEA 1FIQA 1TKEA 3LB8C 5H8YE 1QF6A 3SFEB 4WQMA 1TKYA 4P6VF 1H7XA 1EWYC 4N59A 1CZPA 1OQQA 1OFFA 3AE3B 1NYRA 1ZXIA 1FXIA 2EKIA 2CJOA 2H89B 3B2FA 1XLQA 2PIAA 1QT9A 1GAQB 3B9JA 3NVZA 1E10A 3NVVA 3VRAB 1N62A 4HROA 3W5VB 1V8CA 4YT0B 1B9RA 1GTHA 3KWLA 2BS2B 3AMZA 4JWUC 1XLPA 4C80A 1R7SA 2DWQA 2MJEA 3RPFC 2B76B 2H88B 1J7AA 1FMAD 2HTME 1VJKA 2BT6A 3B2GA 2WDRB 3AEFB 1QOAA 3HUIA 2WQYB 3AE2B 4LTUA 3BIID 3W9CB 3AEBB 1VLBA 2Q5WD 2W3RA 5G5GA 2WU5B 3CIRB 1DOXA 1GTEA 3VR8B 4YSZB 1TYGB 5C2TB 5GXGB 1JRPA 2LEKA 3P4PB 1T3QA 3WCQA 5G5HA 3SR6A 4ZHPA 4ZHOA 3P4SB 2DBYA 2W54A 1WRIA 3AE5B 5AUIA 4IDIA 4YSYB 1NI3A 3ETRA 4JWSC 1PDXA 2QIEB 4JX1C 1YJJA 5AUKA 1E0ZA 2PKOA 3VRBB 1ROEA 1JALA 1SIJA 2JX5A 3EUB2 3P4QB 2WP9B 1QOBA 4YTNB 2OHFA 3AB5A 3AE1B 1L6VA 2FBWB 3PO0A 3L4PA 2MJ3A 3DWMA 3AM9A 1YJIA 3NVYA 1NENB 3NVWA 3P1MA 4FXCA 4C7ZA 4HRSA 5MPOA 2BS3B 1N61A 3AEAB 2MH7A 4YSXB 2K22A 1N5WA 2E3TA 2Y5CA 1FO4A 1L0VB 2ACZB 2MJDA 2CJNA 2PVGC 3CWIA 1RWSA 1OQRA 3ABVB 1VDVA 3AN1A 5EE1A 5C3JB 3FC4A 1JWBD 3AE7B 3AV8A 1WXQA 1L5PA 2QJLA 3NS1A 2JQRB 3AEEB 1CJEA 3AH7A 1H7WA 2K9XA 1RFKA 2WDQB 2N0SB 1FRDA 2PVOD 5EE9A 4USAA 1KF6B 3AE9B 3AE8B 1SF0A 1ZUD2 1KFYB 4KX6B 1E9MA 4C7YA 1DGJA 4WWMA 1KRHA 1N60A
chains in the Genus database with same CATH superfamily
4XDCA 2DLBA 3ZYYX 4LNNA 4ICUA 2K39A 4DDID 1TS5A 4FHKA 5IA7A 4A6QA 2WXMA 3AECB 5L95C 1WGKA 4AJWA 4J3OD 1EWCA 4II2B 4OVUA 3GP7A 1QOFA 4G11A 4A3OA 3JYUA 4ARCA 1C3TA 2AX5A 2AWTA 2KHWB 5FKAC 1TBEA 2IPKD 2L52A 3C0RB 4ANWA 3KW5B 2H89B 2MHJA 2RGFA 3R2IA 4M8NA 4KKIA 2HJ8A 1F2RI 3DBLI 1FMAD 4B6WA 1D5MC 4FN2A 2KDBA 2LUEA 3NG0A 1V2YA 4FJZA 4L1BA 3WALA 4YSZB 1UH6A 3URYA 1JWUD 2QC8A 1CK1A 1V1OA 3VUWA 1QZEA 4JWSC 1PDXA 1DYQA 4WAFA 4HKQA 2LVPA 1TTNA 2JX5A 2M4NA 3IBEA 3KYCD 2OHFA 2JZZA 2A5UA 4W9GA 1F77A 2KDFB 1V9JA 1N61A 2L8JA 5AZHA 2PVGC 4EZLA 1ET9A 2VZKD 1L5PA 4MJSA 2LVQA 3ZLZA 2L7RA 2N0SB 3KH0A 4K1RB 2JF5A 5E6NA 2IDYA 3BVZA 3RNBC 2QCZA 4NQLB 4MGKE 2EMTA 4O1NA 2XBBC 3U4EG 3V05A 2KDIA 1FFVA 1E8WA 5FR6A 3Q2AC 1C77A 1JWAD 3MHSD 1P98A 1YOVB 4KDLB 2V4LA 4YTPB 2K1FA 1JROA 3W5UB 1UBQA 3MJ5A 4GOCA 1I4RA 4DBGA 4L2YA 3LDZE 2CS4A 3W1SC 1V6EA 3DVGX 1UELA 2ONQA 2JYEA 2K8CA 3VH4B 1ENFA 2LXAA 3KWVA 2LHDA 1LXDA 2PW9A 1JRUA 3C8YA 1XLQA 1QQRA 4I6NB 4FBJB 5BMHA 1Q10A 2PLPA 2MW5A 2B76B 2BYVE 2PE9A 1GJZA 2W9NA 1WMHA 3PS6A 3VQIA 4HJGE 3KVFB 2MBQA 2DZKA 4BKTA 1MG4A 2JXXA 2LZ6A 4RH6A 3DBHI 4IDIA 4I6LB 5AUKA 1YJJA 2D3AA 3SDLC 2KC2A 1HTQA 1F1HA 4WJQA 4UDUC 2MA9B 2KWCA 3Q14C 3NVYA 4GDLA 4MGIE 3ZNHB 2BWFA 3PRMB 4FJVB 4DDGD 2KMAA 3CF6E 3QK0A 1RWSA 4CO7A 3AN1A 5FK9C 4ACFA 2WGSA 2QJLA 1C4AA 1R4NB 2XNAC 2DAFA 1BXTA 1AARA 3B08A 3PLUA 1YQ4B 2KKCA 4AS1A 1GT8A 3SFDB 1I4GA 1YQBA 1VZ7A 5HHDG 4HPPA 4B9KA 2JYTA 1I4PA 2KVZA 4P7IA 1IYFA 2JWUA 5T8IA 1NVID 4IC7B 2MSED 2KFJA 4WWPA 3GE3C 4XC2A 1L4ZB 1NEKB 4WURA 2KYWA 1IGDA 3T9LA 4URKA 3QAQA 4RM8A 5JHAA 1PUTA 1U4AA 4CYEA 4K81A 1WSPA 2MX2A 1TKEA 3PZ8A 1OFFA 4LNFA 1QT9A 3SHQA 5LNK1 4IM2A 3OWEB 1WGYA 4F8CB 2BS2B 3Q69A 1J7AA 2WWZA 4JE3B 1C9FA 3EFUA 2DYMA 3KYDD 4MT5A 4HVBA 2W3RA 3CIRB 1TIFA 4TV3A 2ZNVC 3N20C 3VR8B 3U7ZA 3A1QB 4BBNC 4EZJA 1L0XB 2D3BA 3EUB2 1GC6A 5FR3A 4KV2A 1HXYD 3IT6B 3NVWA 4E3CA 3IXSA 4K7UA 3A4SC 4JL9A 2WXKA 1JMLA 4WWOA 5D94A 4JQWC 1SXTA 4K7WA 1ZDVA 2KN5A 1QILA 1WJUA 2WDQB 2PVOD 2G9HD 2VH2A 2Y5PA 3ML8A 2IGGA 1SJED 1TS3A 2JXTA 1JQ4A 1PFDA 3E9SA 3OAWA 2AYOB 4NQKE 1AYFA 1TGZB 1D6EC 2WXPA 1MPEA 3UF8A 3A4RA 1P7EA 4LJPB 2J4XA 3IFWB 3ZRFA 1YD8U 2N9XA 1HE8A 1TY2A 2LGYA 3B2FA 3L54A 1Z2MA 1ET6A 3NVZA 1E10A 3NVVA 1LO5D 3A9KB 3RPFC 2BVCA 4W9IA 2WYQA 1WX7A 2V3SA 3H8HA 4P1CC 2LASA 3O65B 4LK0M 3PRPB 4OZAA 4ARIA 1ZW7A 1RRBA 2BTEA 5C2TB 3MFGA 4R3DA 4W9FA 2FUHB 2QMTA 2FUG1 2ZW1A 1ZDXA 2MWSB 2V0GA 3MC8A 1J8CA 3PZ7A 5CHWA 1IBXB 3UQAA 2DAJA 1NENB 2G3QB 4LLGM 1VCBA 4LDTB 3AEAB 1WM2A 4YWGG 2DZIA 4FA6A 3GOEA 4AWJA 3R66C 2J7QB 3AEEB 3L08A 1IBXA 4OVZA 5EE9A 1N6ZA 2D11A 2L32A 2K6DB 4OZBA 3KUDB 1UD7A 3CSFA 4DQOC 3QQ8B 3BK1A 3RFZB 1FXAA 1GG3A 3QC8B 1RYJA 2L0TA 1E6EB 3AXCA 4YL8A 2KMMA 3EA6A 1FNUA 3DWGC 4MM3B 3UGBB 2MP2B 2M0AA 1J7BA 4MEMA 3ZTCA 3T3NA 3AEGB 1L6UA 2WXGA 1WI0A 2O6VA 2OJWA 2KWDA 5IO9A 4PYUA 3TJPA 3GZNI 1P0RA 4REZA 1RM6C 4ANXA 2RMMA 1AN8A 3WAPA 1FIQA 1D4BA 5CHVC 3Q3NC 1FXIA 5CTRC 1V8CA 1C1YB 1XLPA 2DWQA 2FE8A 3EC8A 2HTME 3AEFB 2WXRA 3I5JC 3AE2B 2ICIA 4EZKA 2KFKB 1IP9A 2GBNA 2LI5A 3ZNZB 2AQ3B 3V6EB 5BYQA 1K52A 4G0NB 2Z0DB 1C4CA 1GUAB 4OW0A 3N9YC 1FNWA 2QIEB 2DYOA 2KO3A 4FLHA 4IM0A 3HIZA 3PHXB 1ACCA 2O2VB 1P7FA 2NBUA 2DENB 4WWMA 2VRRB 2ZZPB 1HA5A 2MH7A 4E74A 4LCDE 2KFKA 1SGHA 3CWIA 2UWQA 3MC9A 1CJEA 3MC0B 2JWZA 3APFA 3ZXRA 3N3KB 1XQQA 1ZUD2 1WYWB 3S2AA 2KWVB 4US9A 2WU2B 3VTUA 2Y3AA 1QOGA 3ZW3A 4W9EA 3DDCB 4M0WA 3HM3A 1YJ1A 3UQBA 5H92C 2LFIA 3HRDD 2C7NB 4MM3A 4BOZB 3UI3A 5IP4D 2JVCA 2N1VA 4XWWA 1K51A 2JT4B 4A8XC 1WXAA 2IBIB 3H6NA 2KC1A 5DPTA 2JSVX 1S3SG 4DHJD 1LFDA 2FCNA 3BK2A 1XLNA 4NAWA 4PS8A 2K5PA 3TCAA 4MSQB 3SFEB 2WXHA 2ZVOA 3R2TA 5AZFA 1P1AA 2LGSA 2CKHB 4DWFA 3AU4A 4YT0B 1NBFC 1SEBD 4FHJA 3DBRB 3W9CB 5JXVA 3RD2A 2YEPB 3L0WB 4HPMB 3KUZA 3P4SB 4ZRJA 4X57B 3R3MA 3DVGY 1HZ5A 2N7JA 3KUCB 2ZW0A 2BKRB 3JSVA 3RMKC 2KTRA 1ROEA 1C4PA 2N1WA 1HZ6A 4ZRKA 1C78A 3A33B 3VXWA 3PVLA 2D10A 1ZPSA 4KZ0A 2R2QA 5G2NA 2IO1B 3ONSA 2CHXA 1YX5B 2KMCA 2BYFA 3NY5A 3AE9B 4A20A 3IAM1 2CU3A 1EO6A 4BAXA 3DBHB 3BINA 4A3PA 2FIFA 3JW0X 3Q8FA 3NRZA 2GLSA 5EE3A 2NBWB 2V9HA 3WAMA 2C7HA 1HEZE 1E5WA 3U7DA 5CX3A 2G1EA 4XYCA 1WGHA 1EU4A 4YTMB 1STEA 2KWUB 2LMCA 1E8ZA 2K6QA 3RNEC 3VUYA 1TJEA 4WJPA 1YX6B 4XE0A 1H7XA 2WX1A 1ZKHA 5I4DA 1D3ZA 4B0MA 4NY0A 4HROA 4NJCA 3W5VB 3DQVA 3RZFA 1B9RA 2GI9A 4II3B 3QJZA 4NPNA 1ESFA 2BT6A 2FNJB 1B1ZA 2KQSA 3TBLD 3CSTA 1FXTB 4LTUA 1WGGA 4GDKB 2FIDA 2HDEA 4ZDVA 3RNFC 2LEKA 3TEWA 2W54A 4TQ0A 1F52A 3ETRA 2E6XA 3R8BA 2PKOA 4KKJA 2KJRA 4IWQA 4GIVA 3L17A 1I4QA 5CHFA 4HRSA 4GLSC 4GDKA 2BF8B 1L0VB 3M62B 4NAMA 2ZCBA 4XWTA 3ABVB 2HJ1A 3O13A 2K9XA 1RFKA 2K3UA 3N1ZC 4KX6B 5BMIA 2UYZB 4IOIE 4ANVA 4EOYA 4KGTA 1WIAA 1A70A 4LNKA 1WY8A 3P63A 1TZ1A 2WDTB 3RT3B 4ZHOA 4K3CA 2BB5A 2L83A 4IM3A 1LGRA 1A5RA 1SB3C 3ZQ4A 3Q6BA 3HVZA 1SE9A 3RNAC 3WANA 1UGMA 1NYQA 2LUMA 4N58A 3FKYA 1QLBB 1OGWA 4TUUA 4IW0A 1FM0D 1V86A 4ASWC 4MSMB 5H8YE 3A9JA 2B3AA 4JIOU 4P6VF 2ON8A 4MGYE 5HFYA 1J0GA 3RYTA 1GAQB 3MJWA 2L76A 2EMSA 4PS7A 4BFRA 4C00A 3AMZA 2JZPA 4QAYA 1R7SA 1BT0A 3NS8A 4J6IA 2LJIA 1FD6A 2WXNA 1CMXB 2AL6A 3VTWA 4F1SA 3APDA 3D32A 5D3IB 2MBEA 1T3QA 1UZXB 3RZWC 4BBNF 1I42A 1WE7A 3AE5B 1R4MB 4YSYB 1L7YA 4P1BC 4RGOS 4M0WB 3VRBB 2GBKA 3FILB 3NZUA 1LQBA 1EF5A 4AP4C 2KJ6A 3KQ4A 3TEYA 2MRPA 1J19A 1VZ8A 3TEXA 2J52A 2MBBB 1FO4A 2LRWA 2ACZB 2BB6A 4W9DA 3IG3A 3JSVB 2N7DA 3DHHC 1Q5WB 1KM7A 1TS2A 3K9PB 2M17A 2NCNA 1FPYA 1WH3A 3AU5A 1EF1A 2AL3A 4NAWB 2WS3B 5TR5A 1SE2A 1M94A 3U30A 1F2RC 5DCNA 5JH5C 1UNSA 2ZCCA 3ZIMA 1YN4A 2MEKA 4K3BA 2RPVA 4C4VB 3RUIB 2R2OA 1F0ZA 1DOYA 2WXFA 1OQYA 4RGNA 1MG8A 2RDHA 4HEA1 2GBJA 3M63B 3PGEA 1PGAA 3Q8EA 3AE4B 3P4RB 1SE4A 2KDMA 2M0XA 5IAAC 2K0PA 1FFUA 3EHVA 4HWIB 4KGRA 2AQ2B 1Q1OA 2BKFA 1QF6A 1TKYA 2CHZA 4W9HA 4K7SA 1C79A 2BW2A 3BZDB 3ECIA 2HE7A 5DPSA 1VLBA 2KQ4X 1FCLA 2BYEA 3ZKJC 2PMVA 3ZXVA 2NBVB 3TUOA 2WXIA 1WGRA 1D5ZC 2OOBB 3UIOB 1WXMA 5G55A 2KNBA 4G3XB 1P9DU 3M3JA 4KZCA 1JALA 3APCA 1WR6E 1EU3A 1KH0A 2FBWB 3L4PA 3DWMA 4ZRQA 4FADA 1KLVA 2G4SA 2N9LA 2D3CA 1RAXA 1V5TA 2WHIA 3DOWA 1VDVA 5C3JB 1JWBD 3NS1A 3VUXA 2UU7A 5IKCM 2MCNB 1H7WA 4W9LA 3PT2B 5C23A 5IOIA 4EKUA 3QX1A 5J17A 3VFKA 3VHTC 2KZRA 2ZNVB 2KTRB 4RFBA 5D2MB 4WJNA 1E7PB 1JCKB 1MVKA 1FEHA 3V6CB 4D2KA 4S0RA 1XCTL 3AEDB 4BOSC 3DHIC 4MH0E 2IO2B 3LYYA 3LXFA 4A9AA 3A9KA 5JHBA 2BBCA 4TKNA 2EKEC 4GGQA 1T6BX 4N6EB 4ICVA 3N1YC 4ZRPA 3TIXA 4ANUA 2PTLA 3LB8C 1V1PB 3DHGC 2ASQA 2YEPF 2YLMA 3R7RA 3AE3B 1NI2A 3U2SC 2ZPYA 2GBRA 4FULA 3L13A 2R61A 2ZVNA 4JPSA 4BKSA 4LNOA 1TS4A 4W9CA 2N4FA 1SJHD 2CU1A 1YN3A 1SSNA 5G5HA 2KDEB 3SR6A 4EFOA 1WJ6A 5AUIA 4MACA 1WXVA 3B0AA 1RFAA 2KACA 2EELA 3IAS1 1G6JA 4C7ZA 5J18A 3I9V1 3H1UA 3MTNB 2KQ7A 4P16A 2YVCA 5LXIB 2JQRB 1T0QC 2LHEA 2HD5B 3PV1A 1KRHA 5DPWA 1GPXA 1XD3B 1JWSD 1WX8A 2GB1A 4Q2JA 3FAHA 3KLSX 4MH8A 2WDVB 2D2QA 4RNAA 2KJHB 2D5GA 4OVVA 3LJ3A 2IY1B 1L2NA 4HKZE 4DXGA 3V60A 3U8ZA 3X0WA 1XO3A 4C56C 2WLBA 2KX0A 4GN1A 1WM3A 4KSKC 1WYGA 3DVNU 2M19A 1UUPA 3ZTDA 3CMMB 4IG7B 1IPGA 5JZEB 1WGDA 2INNE 4NNJB 2EKIA 2FAZA 2QILA 4S17A 1E7UA 1BUIC 3VVWB 2G4DB 4DXAB 2REXA 1GTHA 3ZDTA 4C80A 3GB1A 2DX5B 5TSSA 2WNMA 3B2GA 4BKSD 3V3XA 4HK2A 3VTVA 4HLEA 4PK1A 3GE8C 2ZEQA 1H8CA 2BYTA 4B0EA 2XK5B 1MHHE 1YN5A 2KOXA 1R4NI 4NZLB 1KLUD 1GB4A 3K9OB 2D07B 3AE1B 3HK0A 3AM9A 4BKGA 2GMIC 3HM6X 4BVUC 2KLCA 3ZJUA 2O6VB 5KHOA 3UIPB 5EE1A 3AE7B 2XK5A 3H9DA 3UINB 1V5OA 1SIFA 1GOZA 1KFYB 2NVUI 1DGJA 3PHWB 4KDIC 2L3ZA 3NZ3A 2N7EA 1LM8B 3JVZX 4DHZE 3SEBA 3ZVVA 4CHKA 3DPDA 1Y8RC 1XT9B 5BYRA 1V81A 3QHTA 4G50A 3VR9B 2LJ5A 5HKHA 2OEDA 3PREA 2C7MB 2FCMA 4DXFA 1DOIA 3X23A 2V1YA 1WMHB 1K53A 1I7HA 3HVDA 4IWPA 5AZGA 1I35A 4OHJA 4I6PA 4AJYB 2JRHA 2K25A 1MI0A 5E6JA 4PS3A 1EUVB 4WQMA 2C60A 1CZPA 4EEWA 4JLCA 1H4RA 3ZO5B 4KGSA 4HCNB 1VZ6A 2CHWA 2N9EB 1F9JA 5E6PA 1KJTA 3ENEA 3ZNGC 3HHMA 4AUQC 3T3OA 2WQYB 3DBSA 5LLIA 4BZAA 3AEBB 4ZRIA 3W2DA 1GTEA 4PT5A 1JRPA 3B1LX 2DBYA 2QSDA 2IY0B 3W1SA 1ZE3D 4NJ6A 4XDDA 4H2AA 3NZSA 2WP9B 4EE2A 3BYYB 1RLFA 1WX9A 5MPOA 2BS3B 2Y5CA 5GMVA 2QDFA 3L10B 1T0YA 2INDC 2WXOA 4DK5A 3BVGA 3H7PB 2CJNA 3PSEB 4M8MA 1OQRA 3IHPC 2W82A 3AV8A 3QWZB 2PEAA 2RDBC 4HDQA 4C4VA 3U52E 3AE8B 3WIMA 4C7YA 4RF1A 1X1MA 4KIKA 4GMVA 3EGRA 2LXCA 3ZDMC 1ZGUB 2INPE 3NJTA 4CQNA 1ZP0B 4US8A 2IO0B 1AW7A 1V97A 3J9CA 1UWMA 1FRRA 3VAWA 5J2RA 2O6VD 1JWMD 1N5XA 3R7QA 4OZCA 1AWDA 4W9JA 3OJ4B 1V80A 4WJOA 1YQ3B 1T0RC 2X8XX 1MHXA 1YNTE 3BYTB 3TL5A 4M00A 2IYDB 3IT4B 2MQJA 4YXDB 4TQ1A 2LVOA 3ZNID 1EWYC 1V49A 2LGIA 4TSSA 1OQQA 3Q3FA 1T5XD 3TSSA 4RF0A 1WJ4A 4HCPB 1EM7A 2WXQA 4GB9A 5EDSA 3Q8BA 2A4ZA 1KOTA 1BMLC 4N9F4 2JU6X 1D5XC 5L83A 2VZKB 3SD5A 2LRUA 2I2YA 1TYGB 3P4PB 2SAKA 2MBOA 4JGHB 1WRIA 2HTHA 3MP9A 2JPHA 2AEHA 1E0ZA 2NMQA 2J0JA 4AQ7A 4KVGB 2RPQA 2KD0A 3AB5A 4HXDA 1NDDA 2V3NA 3N1XC 5LXHA 2MJ3A 2M8SA 1E8XA 4WQOB 1N5WA 3H7PA 4WWNA 2Z8LA 1XXGA 3QIJA 4EUTA 1CQVA 5HG2A 1E8YA 1WR1A 1UF0A 1E9MA 2J0MA 4FJYA 1KTKA 1N60A 1MJDA 2IO3B 2V3PA 1J7CA 3ALBA 2W55A 1GNUA 2XN9C 1XCQL 4W9KA 3RNGC 1WWTA 2ZJDA 2BS4B 1PYWD 2RD0A 1TY0A 3QA8A 2AQ1B 4WH4A 3Q8CA 2PJHA 4HJKA 4XGAB 3DBLB 2KN4A 2IJ0A 1VR9A 2J0KA 3TEZA 3QCAA 4A90A 1ZOYB 2I1KA 2FCSA 3M95A 2WXJA 1N63A 4ZYSA 2QEJC 2V4IB 4N59A 1ZXIA 1XEEA 2IGHA 3OG5A 4GU2A 3RNCC 2Z0EB 5KHQA 3V61A 3KWLA 3W1YA 4JWUC 3RCZA 5BMGA 2H88B 4M01A 4M02A 1VJKA 2WDRB 1P3QU 3Q8AA 4RMAA 4A55A 3HUIA 3FILA 4RM9A 5G5GA 2DYBA 3MHZA 2M1MA 5BO4B 2WU5B 3Q3OC 1K50A 1SBBB 3WAOA 5AEKB 3WCQA 1OEYJ 1WFYA 4LDTD 2K8BA 4JX1C 2OJRA 4LNIA 3PZDA 1SIJA 1XF5L 2BQQA 3V62A 1GC7A 3TMPB 2C9WB 4MELA 2LGDA 4FXCA 2L0FA 1OTRB 2D3GA 3ZRCA 3E56A 2K22A 1S1QB 4RGTA 1PGXA 3OJ3A 2KX3A 1PQSA 3FC4A 1WXQA 2XEWA 1UBIA 3DVNV 2LWPA 2QHOA 1FRDA 2KANA 3PRZA 5D3DA 1GB1A 1KF6B 2K8HA 4RGMA 4B95A 2G45B 4ITKA 4WIPA 1JW9D 3A1QA 5HI1A 3ZJTA 1TZOA 2GBMA 1M4VA 2SEBD 1TKGA 2MJDA 4KSLC 1XLOA 3EFCA 3EECA 3ZJVA 4MDKE 3H7SA 2BPSA 2DNFA 1WF9A 1YMHE 3L16A 4KIKB 2MLBA 3Q3JA 3RI7C 1SE3A 2VH1A 2KAJA 2DZJA 2MBHA 2KT7A 4HPLB 1Q0WB 1YIWA 2INCC 3ML9A 2KXJA 3A9JB 3CF4A 2LD9A 1E90A 1C76A 1Y56A 2BGFA 3DBRI 1NYRA 1QKZA 2CJOA 3QARA 1UGJA 2PIAA 3GS2A 3NHEB 2JZ3B 3VRAB 3P42A 2J53A 1WE6A 3I57A 2NTTA 2NPTB 5IN7A 2KTFA 3BIID 1DOXA 1WZ0A 2CR5A 4XX5A 5GXGB 2GOWA 3DCGA 4ZHPA 1L0YB 1OEYA 2I38A 1MFWA 3ZGZA 5BYSA 4NJ7A 1R4MI 1V1PA 1QOBA 4YTNB 4MJSB 1L6VA 2NPTA 3PO0A 3T8MA 1YJIA 5D7GA 4PYZA 1FCCC 2ZPNA 1E7VA 1T0SC 2NTSA 1HQRD 2X38A 2WX0A 2N9PC 4USAA 1SF0A 4WAAA 3OLMD 3VDZA 3PLVA 2JRIB 2W3SA 3N30A 4LJOB 2KLGA 2RSUA 1IUEA 4DHZB 4DHJB 1WRDB 3AE6B 3NUHB 2NS5A 4GXBA 1HTOA 3PTFC 5EE0A 4L23A 1L4DB 3AULA 3ZUNA 2JUOA 2M56B 2DHZA 2RR9A 3I3TB 2PPHA 5E6OA 5D6JB 1I4HA 2L1AA 4ZOHC 1FNVA 1Z5SB 2L05A 3VH3B 3BY4B 2KVRA 2O2VA 1ISNA 3N32A 1VD2A 2FCQA 3B9JA 2DZMA 4XZ4A 1N62A 4F7ZA 4IUMB 3WA0A 2MJEA 4IKGA 1IGCA 4AOFA 1WXSA 2PE6B 1WJNA 1ZXHA 1QOAA 2J42A 3C19A 1K8RB 2IGDA 2N9KA 2Q5WD 3GZNB 4E71A 4HDOA 2MP2A 3PPAA 2GRIA 4GDLB 1UWXA 1VRAB 2NR2A 3BVMA 4MGZE 2RDGA 1NI3A 2KK8A 1WZ3A 1TT5B 3P4QB 4ZYNA 5C1ZA 3P1MA 3AI5A 2Z59B 2I1JA 4YSXB 2BWES 2E3TA 3IVFA 3RULA 5DPRA 2IZVB 1I4XA 2L00B 4GSWA 3SU8X 2C5LC 3NOBA 3I63C 2Y5BB 3BWUD 2TSSA 3RN9C 3AH7A 3P2BA 4TMAB 2WXLA 4RCOA 3Q3MC 1PGBA 2LGXA 1KLGD 2JY6A 4IWOA
chains in the Genus database with same CATH topology
4DQOC 4XDCA 2DLBA 3BK1A 2WS3B 3RFZB 1FXAA 3ZYYX 1SE2A 1F2RC 3EGRA 1RYJA 1TS5A 1UNSA 2INPE 1YN4A 1E6EB 2MEKA 4A6QA 2WXMA 3AECB 4CQNA 2RPVA 1ZP0B 1WGKA 2KMMA 4US8A 1AW7A 3EA6A 1FNUA 1V97A 3DWGC 3J9CA 1UWMA 4J3OD 1FRRA 4MM3B 1JWMD 1N5XA 4OZCA 1EWCA 1F0ZA 2M0AA 3GP7A 1AWDA 1DOYA 2WXFA 1J7BA 1QOFA 4ARCA 4RGNA 1YQ3B 2RDHA 4HEA1 3T3NA 3AEGB 1L6UA 2WXGA 2AX5A 2KWDA 1PGAA 3Q8EA 3AE4B 1MHXA 3P4RB 1SE4A 1YNTE 3BYTB 2KDMA 5FKAC 4REZA 1RM6C 2K0PA 3IT4B 2RMMA 1FFUA 1AN8A 4YXDB 2IPKD 2AQ2B 2L52A 1FIQA 4KGRA 4TQ1A 1QF6A 1D4BA 1TKYA 1EWYC 2LGIA 4TSSA 1OQQA 1FXIA 2H89B 1T5XD 3R2IA 3TSSA 4RF0A 4KKIA 1V8CA 1F2RI 1XLPA 1C79A 2DWQA 2FE8A 1EM7A 2WXQA 1FMAD 2BW2A 2HTME 3BZDB 3Q8BA 3AEFB 1BMLC 1D5MC 2WXRA 2JU6X 3AE2B 1D5XC 2ICIA 1VLBA 2KQ4X 2VZKB 1FCLA 2PMVA 4L1BA 2AQ3B 2I2YA 4YSZB 1TYGB 3P4PB 3TUOA 5BYQA 3URYA 2WXIA 1K52A 1D5ZC 2SAKA 1JWUD 1C4CA 1WRIA 1CK1A 1V1OA 4OW0A 3MP9A 3N9YC 4JWSC 1FNWA 1PDXA 2DYOA 2QIEB 1DYQA 4WAFA 2NMQA 4HKQA 1E0ZA 2JX5A 1JALA 4AQ7A 1ACCA 1EU3A 1P7FA 2OHFA 1KH0A 3AB5A 2V3NA 4WWMA 2FBWB 1F77A 2MJ3A 3DWMA 3L4PA 4ZRQA 1HA5A 1N61A 2MH7A 1N5WA 2N9LA 2PVGC 2Z8LA 3CWIA 1ET9A 1XXGA 1VDVA 5C3JB 2VZKD 1JWBD 3NS1A 1L5PA 1CJEA 3MC0B 1H7WA 1CQVA 2N0SB 5HG2A 1ZUD2 1E9MA 1KTKA 2IDYA 1N60A 3BVZA 2V3PA 1J7CA 4O1NA 4US9A 2WU2B 3U4EG 3V05A 2W55A 1QOGA 2Y3AA 4M0WA 2XN9C 4RFBA 1FFVA 1XCQL 1C77A 1JWAD 1WWTA 5H92C 1E7PB 1JCKB 1MVKA 2BS4B 1FEHA 1PYWD 2LFIA 3HRDD 3UI3A 1TY0A 4D2KA 2AQ1B 4WH4A 4YTPB 1XCTL 1K51A 3Q8CA 4XWWA 1JROA 3W5UB 4A8XC 3MJ5A 3AEDB 1I4RA 2KN4A 2IJ0A 1VR9A 3TEZA 3LYYA 2JSVX 3LXFA 4A9AA 4L2YA 2BBCA 4A90A 1ZOYB 3BK2A 1T6BX 1XLNA 2ONQA 4N6EB 2WXJA 4ZRPA 1N63A 2JYEA 2PTLA 1ENFA 3KWVA 2LHDA 2QEJC 2K5PA 4ZYSA 3LB8C 1V1PB 2PW9A 3SFEB 2V4IB 2YEPF 4N59A 2WXHA 3C8YA 1ZXIA 3AE3B 3R2TA 1XLQA 1XEEA 2IGHA 1QQRA 3U2SC 5BMHA 4YT0B 1Q10A 3KWLA 1SEBD 2PLPA 4JWUC 5BMGA 2B76B 2H88B 2R61A 1VJKA 2WDRB 4JPSA 3Q8AA 3VQIA 4A55A 3HUIA 3FILA 3W9CB 1TS4A 4HJGE 5G5GA 3MHZA 5JXVA 2WU5B 1K50A 2YEPB 1SBBB 1SJHD 1YN3A 1SSNA 3WCQA 5G5HA 3SR6A 3P4SB 4RH6A 5AUIA 4IDIA 4MACA 1HZ5A 2N7JA 5AUKA 4JX1C 1YJJA 2ZW0A 1ROEA 1C4PA 1SIJA 1XF5L 2KACA 1HZ6A 2EELA 4UDUC 3IAS1 1C78A 4FXCA 3NVYA 1ZPSA 4C7ZA 3E56A 2K22A 4RGTA 3I9V1 1PGXA 1RWSA 3AN1A 4P16A 5FK9C 3FC4A 1WXQA 2QJLA 1C4AA 2JQRB 2XNAC 2LHEA 1BXTA 1FRDA 5D3DA 1GB1A 1KF6B 3AE9B 3IAM1 1KRHA 4RGMA 1GPXA 4ITKA 2CU3A 1JWSD 1YQ4B 4WIPA 4AS1A 1JW9D 1GT8A 3SFDB 1I4GA 2GB1A 5HI1A 4Q2JA 3FAHA 3KLSX 3ZJTA 1TZOA 1M4VA 4MH8A 2SEBD 1TKGA 2WDVB 1VZ7A 1XLOA 2MJDA 5HHDG 3Q8FA 3NRZA 5EE3A 4RNAA 2JYTA 1I4PA 3ZJVA 2D5GA 2JWUA 1HEZE 4HKZE 5T8IA 1YMHE 4DXGA 1NVID 1XO3A 4C56C 1SE3A 2WLBA 2G1EA 1EU4A 2KAJA 1L4ZB 1NEKB 4WURA 4YTMB 1IGDA 1STEA 2LMCA 1WYGA 1PUTA 2M19A 1UUPA 1WSPA 3CF4A 1TJEA 1C76A 1TKEA 1Y56A 4XE0A 1H7XA 3PZ8A 2INNE 2EKIA 1OFFA 2QILA 1NYRA 1QKZA 2CJOA 1BUIC 1UGJA 2PIAA 1QT9A 3GS2A 5I4DA 4B0MA 5LNK1 3VRAB 3P42A 3OWEB 4HROA 4NJCA 2J53A 3W5VB 1B9RA 1GTHA 2BS2B 2GI9A 4C80A 3GB1A 5TSSA 3I57A 1ESFA 3Q69A 1J7AA 2NTTA 2WNMA 2BT6A 4JE3B 3B2GA 1C9FA 3V3XA 1B1ZA 2DYMA 4LTUA 4MT5A 3BIID 4GDKB 2HDEA 2W3RA 3CIRB 1DOXA 3VR8B 3U7ZA 5GXGB 2LEKA 2BYTA 4ZHPA 1L0YB 3TEWA 4B0EA 2W54A 1MHHE 1YN5A 4TQ0A 3ETRA 2E6XA 4NZLB 1KLUD 2I38A 1L0XB 3R8BA 2PKOA 3ZGZA 1GB4A 4KKJA 3EUB2 5BYSA 1V1PA 1QOBA 4YTNB 5FR3A 3AE1B 1L6VA 3PO0A 3AM9A 1YJIA 1HXYD 3IT6B 1I4QA 3NVWA 4HRSA 3IXSA 4GLSC 3ZJUA 5D7GA 1L0VB 2WXKA 1JMLA 4NAMA 1FCCC 4XWTA 1SXTA 3ABVB 5EE1A 3O13A 3AE7B 1ZDVA 1QILA 2NTSA 2K9XA 1RFKA 2K3UA 1HQRD 2WDQB 2X38A 2PVOD 1GOZA 4USAA 1SF0A 1KFYB 4KX6B 5BMIA 1DGJA 3NZ3A 2G9HD 4IOIE 4KGTA 2W3SA 1A70A 2Y5PA 2IGGA 1SJED 1TS3A 3P63A 2JXTA 3SEBA 1IUEA 4ZHOA 1JQ4A 1PFDA 2BB5A 2L83A 3E9SA 3AE6B 1SB3C 1AYFA 3NUHB 5BYRA 3VR9B 5EE0A 4L23A 1D6EC 1L4DB 2WXPA 3HVZA 3ZQ4A 2OEDA 1MPEA 2M56B 4DXFA 1DOIA 1NYQA 2LUMA 4N58A 1K53A 1P7EA 1I7HA 1QLBB 3HVDA 4OHJA 1FM0D 1I4HA 2J4XA 2L1AA 4ZOHC 1MI0A 5E6JA 1FNVA 5H8YE 4WQMA 4P6VF 2ON8A 1TY2A 5HFYA 1CZPA 3B2FA 4KGSA 1GAQB 1ET6A 3B9JA 3NVZA 1E10A 1VZ6A 3NVVA 1N62A 1LO5D 3AMZA 2JZPA 1R7SA 2MJEA 4IKGA 3RPFC 1IGCA 2LJIA 1FD6A 2WXNA 1ZXHA 1QOAA 3T3OA 2J42A 3H8HA 2WQYB 4LK0M 2IGDA 4OZAA 2N9KA 3AEBB 2Q5WD 4ARIA 3W2DA 1GTEA 2BTEA 2GRIA 4GDLB 5C2TB 4PT5A 5D3IB 1UWXA 3MFGA 1JRPA 1T3QA 4R3DA 1VRAB 3BVMA 2DBYA 2QSDA 2QMTA 2FUG1 3AE5B 2ZW1A 3W1SA 1ZE3D 2RDGA 1ZDXA 4YSYB 1NI3A 4RGOS 2V0GA 3VRBB 4XDDA 4H2AA 3PZ7A 3FILB 1IBXB 3P4QB 2WP9B 3P1MA 3KQ4A 4EE2A 1NENB 3BYYB 3TEYA 4LLGM 5MPOA 1VZ8A 2BS3B 2J52A 3AEAB 3TEXA 4YSXB 4YWGG 2Y5CA 2E3TA 1FO4A 2WXOA 2ACZB 3BVGA 2BB6A 2CJNA 1I4XA 1OQRA 2W82A 1TS2A 3AV8A 3BWUD 2TSSA 3AEEB 3AH7A 4TMAB 2WXLA 1IBXA 4RCOA 4OVZA 5EE9A 3U52E 3AE8B 4NAWB 4C7YA 2L32A 1PGBA 1KLGD 4OZBA 4RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPX A;  4ITK A;  1J7C A;  4US9 A;  2CU3 A;  2WS3 B;  1YQ4 B;  2WU2 B;  1FXA A;  3ZYY X;  1JW9 D;  2W55 A;  1GT8 A;  3SFD B;  1QOG A;  2W3S A;  1A70 A;  1RYJ A;  3FAH A;  1FFV A;  3P63 A;  1IUE A;  2WDV B;  1JWA D;  1E6E B;  1PFD A;  1TKG A;  1WWT A;  1XLO A;  2L83 A;  1E7P B;  5H92 C;  1JQ4 A;  3NRZ A;  2BS4 B;  3AEC B;  1ZP0 B;  1WGK A;  2KMM A;  3HRD D;  3AE6 B;  1SB3 C;  5EE3 A;  4US8 A;  1V97 A;  1AYF A;  3DWG C;  1UWM A;  1FRR A;  3VR9 B;  4YTP B;  5EE0 A;  1N5X A;  1JRO A;  3HVZ A;  3W5U B;  1NVI D;  1F0Z A;  1XO3 A;  3AED B;  1AWD A;  1DOY A;  2M56 B;  2WLB A;  1J7B A;  2G1E A;  1QOF A;  1DOI A;  1NYQ A;  3LXF A;  4A9A A;  1YQ3 B;  2KAJ A;  4N58 A;  3AEG B;  1NEK B;  1L6U A;  1I7H A;  2AX5 A;  1QLB B;  4YTM B;  1ZOY B;  3AE4 B;  1WYG A;  1FM0 D;  3P4R B;  1XLN A;  4N6E B;  1PUT A;  2M19 A;  4ZOH C;  1N63 A;  1RM6 C;  1FFU A;  3CF4 A;  4YXD B;  2K5P A;  2L52 A;  1TJE A;  1FIQ A;  1TKE A;  3LB8 C;  5H8Y E;  1QF6 A;  3SFE B;  4WQM A;  1TKY A;  4P6V F;  1H7X A;  1EWY C;  4N59 A;  1CZP A;  1OQQ A;  1OFF A;  3AE3 B;  1NYR A;  1ZXI A;  1FXI A;  2EKI A;  2CJO A;  2H89 B;  3B2F A;  1XLQ A;  2PIA A;  1QT9 A;  1GAQ B;  3B9J A;  3NVZ A;  1E10 A;  3NVV A;  3VRA B;  1N62 A;  4HRO A;  3W5V B;  1V8C A;  4YT0 B;  1B9R A;  1GTH A;  3KWL A;  2BS2 B;  3AMZ A;  4JWU C;  1XLP A;  4C80 A;  1R7S A;  2DWQ A;  2MJE A;  3RPF C;  2B76 B;  2H88 B;  1J7A A;  1FMA D;  2HTM E;  1VJK A;  2BT6 A;  3B2G A;  2WDR B;  3AEF B;  1QOA A;  3HUI A;  2WQY B;  3AE2 B;  4LTU A;  3BII D;  3W9C B;  3AEB B;  1VLB A;  2Q5W D;  2W3R A;  5G5G A;  2WU5 B;  3CIR B;  1DOX A;  1GTE A;  3VR8 B;  4YSZ B;  1TYG B;  5C2T B;  5GXG B;  1JRP A;  2LEK A;  3P4P B;  1T3Q A;  3WCQ A;  5G5H A;  3SR6 A;  4ZHP A;  4ZHO A;  3P4S B;  2DBY A;  2W54 A;  1WRI A;  3AE5 B;  5AUI A;  4IDI A;  4YSY B;  1NI3 A;  3ETR A;  4JWS C;  1PDX A;  2QIE B;  4JX1 C;  1YJJ A;  5AUK A;  1E0Z A;  2PKO A;  3VRB B;  1ROE A;  1JAL A;  1SIJ A;  2JX5 A;  3EUB 2;  3P4Q B;  2WP9 B;  1QOB A;  4YTN B;  2OHF A;  3AB5 A;  3AE1 B;  1L6V A;  2FBW B;  3PO0 A;  3L4P A;  2MJ3 A;  3DWM A;  3AM9 A;  1YJI A;  3NVY A;  1NEN B;  3NVW A;  3P1M A;  4FXC A;  4C7Z A;  4HRS A;  5MPO A;  2BS3 B;  1N61 A;  3AEA B;  2MH7 A;  4YSX B;  2K22 A;  1N5W A;  2E3T A;  2Y5C A;  1FO4 A;  1L0V B;  2ACZ B;  2MJD A;  2CJN A;  2PVG C;  3CWI A;  1RWS A;  1OQR A;  3ABV B;  1VDV A;  3AN1 A;  5EE1 A;  5C3J B;  3FC4 A;  1JWB D;  3AE7 B;  3AV8 A;  1WXQ A;  1L5P A;  2QJL A;  3NS1 A;  2JQR B;  3AEE B;  1CJE A;  3AH7 A;  1H7W A;  2K9X A;  1RFK A;  2WDQ B;  2N0S B;  1FRD A;  2PVO D;  5EE9 A;  4USA A;  1KF6 B;  3AE9 B;  3AE8 B;  1SF0 A;  1ZUD 2;  1KFY B;  4KX6 B;  1E9M A;  4C7Y A;  1DGJ A;  4WWM A;  1KRH A;  1N60 A; 
#chains in the Genus database with same CATH topology
 4XDC A;  2DLB A;  3ZYY X;  4LNN A;  4ICU A;  2K39 A;  4DDI D;  1TS5 A;  4FHK A;  5IA7 A;  4A6Q A;  2WXM A;  3AEC B;  5L95 C;  1WGK A;  4AJW A;  4J3O D;  1EWC A;  4II2 B;  4OVU A;  3GP7 A;  1QOF A;  4G11 A;  4A3O A;  3JYU A;  4ARC A;  1C3T A;  2AX5 A;  2AWT A;  2KHW B;  5FKA C;  1TBE A;  2IPK D;  2L52 A;  3C0R B;  4ANW A;  3KW5 B;  2H89 B;  2MHJ A;  2RGF A;  3R2I A;  4M8N A;  4KKI A;  2HJ8 A;  1F2R I;  3DBL I;  1FMA D;  4B6W A;  1D5M C;  4FN2 A;  2KDB A;  2LUE A;  3NG0 A;  1V2Y A;  4FJZ A;  4L1B A;  3WAL A;  4YSZ B;  1UH6 A;  3URY A;  1JWU D;  2QC8 A;  1CK1 A;  1V1O A;  3VUW A;  1QZE A;  4JWS C;  1PDX A;  1DYQ A;  4WAF A;  4HKQ A;  2LVP A;  1TTN A;  2JX5 A;  2M4N A;  3IBE A;  3KYC D;  2OHF A;  2JZZ A;  2A5U A;  4W9G A;  1F77 A;  2KDF B;  1V9J A;  1N61 A;  2L8J A;  5AZH A;  2PVG C;  4EZL A;  1ET9 A;  2VZK D;  1L5P A;  4MJS A;  2LVQ A;  3ZLZ A;  2L7R A;  2N0S B;  3KH0 A;  4K1R B;  2JF5 A;  5E6N A;  2IDY A;  3BVZ A;  3RNB C;  2QCZ A;  4NQL B;  4MGK E;  2EMT A;  4O1N A;  2XBB C;  3U4E G;  3V05 A;  2KDI A;  1FFV A;  1E8W A;  5FR6 A;  3Q2A C;  1C77 A;  1JWA D;  3MHS D;  1P98 A;  1YOV B;  4KDL B;  2V4L A;  4YTP B;  2K1F A;  1JRO A;  3W5U B;  1UBQ A;  3MJ5 A;  4GOC A;  1I4R A;  4DBG A;  4L2Y A;  3LDZ E;  2CS4 A;  3W1S C;  1V6E A;  3DVG X;  1UEL A;  2ONQ A;  2JYE A;  2K8C A;  3VH4 B;  1ENF A;  2LXA A;  3KWV A;  2LHD A;  1LXD A;  2PW9 A;  1JRU A;  3C8Y A;  1XLQ A;  1QQR A;  4I6N B;  4FBJ B;  5BMH A;  1Q10 A;  2PLP A;  2MW5 A;  2B76 B;  2BYV E;  2PE9 A;  1GJZ A;  2W9N A;  1WMH A;  3PS6 A;  3VQI A;  4HJG E;  3KVF B;  2MBQ A;  2DZK A;  4BKT A;  1MG4 A;  2JXX A;  2LZ6 A;  4RH6 A;  3DBH I;  4IDI A;  4I6L B;  5AUK A;  1YJJ A;  2D3A A;  3SDL C;  2KC2 A;  1HTQ A;  1F1H A;  4WJQ A;  4UDU C;  2MA9 B;  2KWC A;  3Q14 C;  3NVY A;  4GDL A;  4MGI E;  3ZNH B;  2BWF A;  3PRM B;  4FJV B;  4DDG D;  2KMA A;  3CF6 E;  3QK0 A;  1RWS A;  4CO7 A;  3AN1 A;  5FK9 C;  4ACF A;  2WGS A;  2QJL A;  1C4A A;  1R4N B;  2XNA C;  2DAF A;  1BXT A;  1AAR A;  3B08 A;  3PLU A;  1YQ4 B;  2KKC A;  4AS1 A;  1GT8 A;  3SFD B;  1I4G A;  1YQB A;  1VZ7 A;  5HHD G;  4HPP A;  4B9K A;  2JYT A;  1I4P A;  2KVZ A;  4P7I A;  1IYF A;  2JWU A;  5T8I A;  1NVI D;  4IC7 B;  2MSE D;  2KFJ A;  4WWP A;  3GE3 C;  4XC2 A;  1L4Z B;  1NEK B;  4WUR A;  2KYW A;  1IGD A;  3T9L A;  4URK A;  3QAQ A;  4RM8 A;  5JHA A;  1PUT A;  1U4A A;  4CYE A;  4K81 A;  1WSP A;  2MX2 A;  1TKE A;  3PZ8 A;  1OFF A;  4LNF A;  1QT9 A;  3SHQ A;  5LNK 1;  4IM2 A;  3OWE B;  1WGY A;  4F8C B;  2BS2 B;  3Q69 A;  1J7A A;  2WWZ A;  4JE3 B;  1C9F A;  3EFU A;  2DYM A;  3KYD D;  4MT5 A;  4HVB A;  2W3R A;  3CIR B;  1TIF A;  4TV3 A;  2ZNV C;  3N20 C;  3VR8 B;  3U7Z A;  3A1Q B;  4BBN C;  4EZJ A;  1L0X B;  2D3B A;  3EUB 2;  1GC6 A;  5FR3 A;  4KV2 A;  1HXY D;  3IT6 B;  3NVW A;  4E3C A;  3IXS A;  4K7U A;  3A4S C;  4JL9 A;  2WXK A;  1JML A;  4WWO A;  5D94 A;  4JQW C;  1SXT A;  4K7W A;  1ZDV A;  2KN5 A;  1QIL A;  1WJU A;  2WDQ B;  2PVO D;  2G9H D;  2VH2 A;  2Y5P A;  3ML8 A;  2IGG A;  1SJE D;  1TS3 A;  2JXT A;  1JQ4 A;  1PFD A;  3E9S A;  3OAW A;  2AYO B;  4NQK E;  1AYF A;  1TGZ B;  1D6E C;  2WXP A;  1MPE A;  3UF8 A;  3A4R A;  1P7E A;  4LJP B;  2J4X A;  3IFW B;  3ZRF A;  1YD8 U;  2N9X A;  1HE8 A;  1TY2 A;  2LGY A;  3B2F A;  3L54 A;  1Z2M A;  1ET6 A;  3NVZ A;  1E10 A;  3NVV A;  1LO5 D;  3A9K B;  3RPF C;  2BVC A;  4W9I A;  2WYQ A;  1WX7 A;  2V3S A;  3H8H A;  4P1C C;  2LAS A;  3O65 B;  4LK0 M;  3PRP B;  4OZA A;  4ARI A;  1ZW7 A;  1RRB A;  2BTE A;  5C2T B;  3MFG A;  4R3D A;  4W9F A;  2FUH B;  2QMT A;  2FUG 1;  2ZW1 A;  1ZDX A;  2MWS B;  2V0G A;  3MC8 A;  1J8C A;  3PZ7 A;  5CHW A;  1IBX B;  3UQA A;  2DAJ A;  1NEN B;  2G3Q B;  4LLG M;  1VCB A;  4LDT B;  3AEA B;  1WM2 A;  4YWG G;  2DZI A;  4FA6 A;  3GOE A;  4AWJ A;  3R66 C;  2J7Q B;  3AEE B;  3L08 A;  1IBX A;  4OVZ A;  5EE9 A;  1N6Z A;  2D11 A;  2L32 A;  2K6D B;  4OZB A;  3KUD B;  1UD7 A;  3CSF A;  4DQO C;  3QQ8 B;  3BK1 A;  3RFZ B;  1FXA A;  1GG3 A;  3QC8 B;  1RYJ A;  2L0T A;  1E6E B;  3AXC A;  4YL8 A;  2KMM A;  3EA6 A;  1FNU A;  3DWG C;  4MM3 B;  3UGB B;  2MP2 B;  2M0A A;  1J7B A;  4MEM A;  3ZTC A;  3T3N A;  3AEG B;  1L6U A;  2WXG A;  1WI0 A;  2O6V A;  2OJW A;  2KWD A;  5IO9 A;  4PYU A;  3TJP A;  3GZN I;  1P0R A;  4REZ A;  1RM6 C;  4ANX A;  2RMM A;  1AN8 A;  3WAP A;  1FIQ A;  1D4B A;  5CHV C;  3Q3N C;  1FXI A;  5CTR C;  1V8C A;  1C1Y B;  1XLP A;  2DWQ A;  2FE8 A;  3EC8 A;  2HTM E;  3AEF B;  2WXR A;  3I5J C;  3AE2 B;  2ICI A;  4EZK A;  2KFK B;  1IP9 A;  2GBN A;  2LI5 A;  3ZNZ B;  2AQ3 B;  3V6E B;  5BYQ A;  1K52 A;  4G0N B;  2Z0D B;  1C4C A;  1GUA B;  4OW0 A;  3N9Y C;  1FNW A;  2QIE B;  2DYO A;  2KO3 A;  4FLH A;  4IM0 A;  3HIZ A;  3PHX B;  1ACC A;  2O2V B;  1P7F A;  2NBU A;  2DEN B;  4WWM A;  2VRR B;  2ZZP B;  1HA5 A;  2MH7 A;  4E74 A;  4LCD E;  2KFK A;  1SGH A;  3CWI A;  2UWQ A;  3MC9 A;  1CJE A;  3MC0 B;  2JWZ A;  3APF A;  3ZXR A;  3N3K B;  1XQQ A;  1ZUD 2;  1WYW B;  3S2A A;  2KWV B;  4US9 A;  2WU2 B;  3VTU A;  2Y3A A;  1QOG A;  3ZW3 A;  4W9E A;  3DDC B;  4M0W A;  3HM3 A;  1YJ1 A;  3UQB A;  5H92 C;  2LFI A;  3HRD D;  2C7N B;  4MM3 A;  4BOZ B;  3UI3 A;  5IP4 D;  2JVC A;  2N1V A;  4XWW A;  1K51 A;  2JT4 B;  4A8X C;  1WXA A;  2IBI B;  3H6N A;  2KC1 A;  5DPT A;  2JSV X;  1S3S G;  4DHJ D;  1LFD A;  2FCN A;  3BK2 A;  1XLN A;  4NAW A;  4PS8 A;  2K5P A;  3TCA A;  4MSQ B;  3SFE B;  2WXH A;  2ZVO A;  3R2T A;  5AZF A;  1P1A A;  2LGS A;  2CKH B;  4DWF A;  3AU4 A;  4YT0 B;  1NBF C;  1SEB D;  4FHJ A;  3DBR B;  3W9C B;  5JXV A;  3RD2 A;  2YEP B;  3L0W B;  4HPM B;  3KUZ A;  3P4S B;  4ZRJ A;  4X57 B;  3R3M A;  3DVG Y;  1HZ5 A;  2N7J A;  3KUC B;  2ZW0 A;  2BKR B;  3JSV A;  3RMK C;  2KTR A;  1ROE A;  1C4P A;  2N1W A;  1HZ6 A;  4ZRK A;  1C78 A;  3A33 B;  3VXW A;  3PVL A;  2D10 A;  1ZPS A;  4KZ0 A;  2R2Q A;  5G2N A;  2IO1 B;  3ONS A;  2CHX A;  1YX5 B;  2KMC A;  2BYF A;  3NY5 A;  3AE9 B;  4A20 A;  3IAM 1;  2CU3 A;  1EO6 A;  4BAX A;  3DBH B;  3BIN A;  4A3P A;  2FIF A;  3JW0 X;  3Q8F A;  3NRZ A;  2GLS A;  5EE3 A;  2NBW B;  2V9H A;  3WAM A;  2C7H A;  1HEZ E;  1E5W A;  3U7D A;  5CX3 A;  2G1E A;  4XYC A;  1WGH A;  1EU4 A;  4YTM B;  1STE A;  2KWU B;  2LMC A;  1E8Z A;  2K6Q A;  3RNE C;  3VUY A;  1TJE A;  4WJP A;  1YX6 B;  4XE0 A;  1H7X A;  2WX1 A;  1ZKH A;  5I4D A;  1D3Z A;  4B0M A;  4NY0 A;  4HRO A;  4NJC A;  3W5V B;  3DQV A;  3RZF A;  1B9R A;  2GI9 A;  4II3 B;  3QJZ A;  4NPN A;  1ESF A;  2BT6 A;  2FNJ B;  1B1Z A;  2KQS A;  3TBL D;  3CST A;  1FXT B;  4LTU A;  1WGG A;  4GDK B;  2FID A;  2HDE A;  4ZDV A;  3RNF C;  2LEK A;  3TEW A;  2W54 A;  4TQ0 A;  1F52 A;  3ETR A;  2E6X A;  3R8B A;  2PKO A;  4KKJ A;  2KJR A;  4IWQ A;  4GIV A;  3L17 A;  1I4Q A;  5CHF A;  4HRS A;  4GLS C;  4GDK A;  2BF8 B;  1L0V B;  3M62 B;  4NAM A;  2ZCB A;  4XWT A;  3ABV B;  2HJ1 A;  3O13 A;  2K9X A;  1RFK A;  2K3U A;  3N1Z C;  4KX6 B;  5BMI A;  2UYZ B;  4IOI E;  4ANV A;  4EOY A;  4KGT A;  1WIA A;  1A70 A;  4LNK A;  1WY8 A;  3P63 A;  1TZ1 A;  2WDT B;  3RT3 B;  4ZHO A;  4K3C A;  2BB5 A;  2L83 A;  4IM3 A;  1LGR A;  1A5R A;  1SB3 C;  3ZQ4 A;  3Q6B A;  3HVZ A;  1SE9 A;  3RNA C;  3WAN A;  1UGM A;  1NYQ A;  2LUM A;  4N58 A;  3FKY A;  1QLB B;  1OGW A;  4TUU A;  4IW0 A;  1FM0 D;  1V86 A;  4ASW C;  4MSM B;  5H8Y E;  3A9J A;  2B3A A;  4JIO U;  4P6V F;  2ON8 A;  4MGY E;  5HFY A;  1J0G A;  3RYT A;  1GAQ B;  3MJW A;  2L76 A;  2EMS A;  4PS7 A;  4BFR A;  4C00 A;  3AMZ A;  2JZP A;  4QAY A;  1R7S A;  1BT0 A;  3NS8 A;  4J6I A;  2LJI A;  1FD6 A;  2WXN A;  1CMX B;  2AL6 A;  3VTW A;  4F1S A;  3APD A;  3D32 A;  5D3I B;  2MBE A;  1T3Q A;  1UZX B;  3RZW C;  4BBN F;  1I42 A;  1WE7 A;  3AE5 B;  1R4M B;  4YSY B;  1L7Y A;  4P1B C;  4RGO S;  4M0W B;  3VRB B;  2GBK A;  3FIL B;  3NZU A;  1LQB A;  1EF5 A;  4AP4 C;  2KJ6 A;  3KQ4 A;  3TEY A;  2MRP A;  1J19 A;  1VZ8 A;  3TEX A;  2J52 A;  2MBB B;  1FO4 A;  2LRW A;  2ACZ B;  2BB6 A;  4W9D A;  3IG3 A;  3JSV B;  2N7D A;  3DHH C;  1Q5W B;  1KM7 A;  1TS2 A;  3K9P B;  2M17 A;  2NCN A;  1FPY A;  1WH3 A;  3AU5 A;  1EF1 A;  2AL3 A;  4NAW B;  2WS3 B;  5TR5 A;  1SE2 A;  1M94 A;  3U30 A;  1F2R C;  5DCN A;  5JH5 C;  1UNS A;  2ZCC A;  3ZIM A;  1YN4 A;  2MEK A;  4K3B A;  2RPV A;  4C4V B;  3RUI B;  2R2O A;  1F0Z A;  1DOY A;  2WXF A;  1OQY A;  4RGN A;  1MG8 A;  2RDH A;  4HEA 1;  2GBJ A;  3M63 B;  3PGE A;  1PGA A;  3Q8E A;  3AE4 B;  3P4R B;  1SE4 A;  2KDM A;  2M0X A;  5IAA C;  2K0P A;  1FFU A;  3EHV A;  4HWI B;  4KGR A;  2AQ2 B;  1Q1O A;  2BKF A;  1QF6 A;  1TKY A;  2CHZ A;  4W9H A;  4K7S A;  1C79 A;  2BW2 A;  3BZD B;  3ECI A;  2HE7 A;  5DPS A;  1VLB A;  2KQ4 X;  1FCL A;  2BYE A;  3ZKJ C;  2PMV A;  3ZXV A;  2NBV B;  3TUO A;  2WXI A;  1WGR A;  1D5Z C;  2OOB B;  3UIO B;  1WXM A;  5G55 A;  2KNB A;  4G3X B;  1P9D U;  3M3J A;  4KZC A;  1JAL A;  3APC A;  1WR6 E;  1EU3 A;  1KH0 A;  2FBW B;  3L4P A;  3DWM A;  4ZRQ A;  4FAD A;  1KLV A;  2G4S A;  2N9L A;  2D3C A;  1RAX A;  1V5T A;  2WHI A;  3DOW A;  1VDV A;  5C3J B;  1JWB D;  3NS1 A;  3VUX A;  2UU7 A;  5IKC M;  2MCN B;  1H7W A;  4W9L A;  3PT2 B;  5C23 A;  5IOI A;  4EKU A;  3QX1 A;  5J17 A;  3VFK A;  3VHT C;  2KZR A;  2ZNV B;  2KTR B;  4RFB A;  5D2M B;  4WJN A;  1E7P B;  1JCK B;  1MVK A;  1FEH A;  3V6C B;  4D2K A;  4S0R A;  1XCT L;  3AED B;  4BOS C;  3DHI C;  4MH0 E;  2IO2 B;  3LYY A;  3LXF A;  4A9A A;  3A9K A;  5JHB A;  2BBC A;  4TKN A;  2EKE C;  4GGQ A;  1T6B X;  4N6E B;  4ICV A;  3N1Y C;  4ZRP A;  3TIX A;  4ANU A;  2PTL A;  3LB8 C;  1V1P B;  3DHG C;  2ASQ A;  2YEP F;  2YLM A;  3R7R A;  3AE3 B;  1NI2 A;  3U2S C;  2ZPY A;  2GBR A;  4FUL A;  3L13 A;  2R61 A;  2ZVN A;  4JPS A;  4BKS A;  4LNO A;  1TS4 A;  4W9C A;  2N4F A;  1SJH D;  2CU1 A;  1YN3 A;  1SSN A;  5G5H A;  2KDE B;  3SR6 A;  4EFO A;  1WJ6 A;  5AUI A;  4MAC A;  1WXV A;  3B0A A;  1RFA A;  2KAC A;  2EEL A;  3IAS 1;  1G6J A;  4C7Z A;  5J18 A;  3I9V 1;  3H1U A;  3MTN B;  2KQ7 A;  4P16 A;  2YVC A;  5LXI B;  2JQR B;  1T0Q C;  2LHE A;  2HD5 B;  3PV1 A;  1KRH A;  5DPW A;  1GPX A;  1XD3 B;  1JWS D;  1WX8 A;  2GB1 A;  4Q2J A;  3FAH A;  3KLS X;  4MH8 A;  2WDV B;  2D2Q A;  4RNA A;  2KJH B;  2D5G A;  4OVV A;  3LJ3 A;  2IY1 B;  1L2N A;  4HKZ E;  4DXG A;  3V60 A;  3U8Z A;  3X0W A;  1XO3 A;  4C56 C;  2WLB A;  2KX0 A;  4GN1 A;  1WM3 A;  4KSK C;  1WYG A;  3DVN U;  2M19 A;  1UUP A;  3ZTD A;  3CMM B;  4IG7 B;  1IPG A;  5JZE B;  1WGD A;  2INN E;  4NNJ B;  2EKI A;  2FAZ A;  2QIL A;  4S17 A;  1E7U A;  1BUI C;  3VVW B;  2G4D B;  4DXA B;  2REX A;  1GTH A;  3ZDT A;  4C80 A;  3GB1 A;  2DX5 B;  5TSS A;  2WNM A;  3B2G A;  4BKS D;  3V3X A;  4HK2 A;  3VTV A;  4HLE A;  4PK1 A;  3GE8 C;  2ZEQ A;  1H8C A;  2BYT A;  4B0E A;  2XK5 B;  1MHH E;  1YN5 A;  2KOX A;  1R4N I;  4NZL B;  1KLU D;  1GB4 A;  3K9O B;  2D07 B;  3AE1 B;  3HK0 A;  3AM9 A;  4BKG A;  2GMI C;  3HM6 X;  4BVU C;  2KLC A;  3ZJU A;  2O6V B;  5KHO A;  3UIP B;  5EE1 A;  3AE7 B;  2XK5 A;  3H9D A;  3UIN B;  1V5O A;  1SIF A;  1GOZ A;  1KFY B;  2NVU I;  1DGJ A;  3PHW B;  4KDI C;  2L3Z A;  3NZ3 A;  2N7E A;  1LM8 B;  3JVZ X;  4DHZ E;  3SEB A;  3ZVV A;  4CHK A;  3DPD A;  1Y8R C;  1XT9 B;  5BYR A;  1V81 A;  3QHT A;  4G50 A;  3VR9 B;  2LJ5 A;  5HKH A;  2OED A;  3PRE A;  2C7M B;  2FCM A;  4DXF A;  1DOI A;  3X23 A;  2V1Y A;  1WMH B;  1K53 A;  1I7H A;  3HVD A;  4IWP A;  5AZG A;  1I35 A;  4OHJ A;  4I6P A;  4AJY B;  2JRH A;  2K25 A;  1MI0 A;  5E6J A;  4PS3 A;  1EUV B;  4WQM A;  2C60 A;  1CZP A;  4EEW A;  4JLC A;  1H4R A;  3ZO5 B;  4KGS A;  4HCN B;  1VZ6 A;  2CHW A;  2N9E B;  1F9J A;  5E6P A;  1KJT A;  3ENE A;  3ZNG C;  3HHM A;  4AUQ C;  3T3O A;  2WQY B;  3DBS A;  5LLI A;  4BZA A;  3AEB B;  4ZRI A;  3W2D A;  1GTE A;  4PT5 A;  1JRP A;  3B1L X;  2DBY A;  2QSD A;  2IY0 B;  3W1S A;  1ZE3 D;  4NJ6 A;  4XDD A;  4H2A A;  3NZS A;  2WP9 B;  4EE2 A;  3BYY B;  1RLF A;  1WX9 A;  5MPO A;  2BS3 B;  2Y5C A;  5GMV A;  2QDF A;  3L10 B;  1T0Y A;  2IND C;  2WXO A;  4DK5 A;  3BVG A;  3H7P B;  2CJN A;  3PSE B;  4M8M A;  1OQR A;  3IHP C;  2W82 A;  3AV8 A;  3QWZ B;  2PEA A;  2RDB C;  4HDQ A;  4C4V A;  3U52 E;  3AE8 B;  3WIM A;  4C7Y A;  4RF1 A;  1X1M A;  4KIK A;  4GMV A;  3EGR A;  2LXC A;  3ZDM C;  1ZGU B;  2INP E;  3NJT A;  4CQN A;  1ZP0 B;  4US8 A;  2IO0 B;  1AW7 A;  1V97 A;  3J9C A;  1UWM A;  1FRR A;  3VAW A;  5J2R A;  2O6V D;  1JWM D;  1N5X A;  3R7Q A;  4OZC A;  1AWD A;  4W9J A;  3OJ4 B;  1V80 A;  4WJO A;  1YQ3 B;  1T0R C;  2X8X X;  1MHX A;  1YNT E;  3BYT B;  3TL5 A;  4M00 A;  2IYD B;  3IT4 B;  2MQJ A;  4YXD B;  4TQ1 A;  2LVO A;  3ZNI D;  1EWY C;  1V49 A;  2LGI A;  4TSS A;  1OQQ A;  3Q3F A;  1T5X D;  3TSS A;  4RF0 A;  1WJ4 A;  4HCP B;  1EM7 A;  2WXQ A;  4GB9 A;  5EDS A;  3Q8B A;  2A4Z A;  1KOT A;  1BML C;  4N9F 4;  2JU6 X;  1D5X C;  5L83 A;  2VZK B;  3SD5 A;  2LRU A;  2I2Y A;  1TYG B;  3P4P B;  2SAK A;  2MBO A;  4JGH B;  1WRI A;  2HTH A;  3MP9 A;  2JPH A;  2AEH A;  1E0Z A;  2NMQ A;  2J0J A;  4AQ7 A;  4KVG B;  2RPQ A;  2KD0 A;  3AB5 A;  4HXD A;  1NDD A;  2V3N A;  3N1X C;  5LXH A;  2MJ3 A;  2M8S A;  1E8X A;  4WQO B;  1N5W A;  3H7P A;  4WWN A;  2Z8L A;  1XXG A;  3QIJ A;  4EUT A;  1CQV A;  5HG2 A;  1E8Y A;  1WR1 A;  1UF0 A;  1E9M A;  2J0M A;  4FJY A;  1KTK A;  1N60 A;  1MJD A;  2IO3 B;  2V3P A;  1J7C A;  3ALB A;  2W55 A;  1GNU A;  2XN9 C;  1XCQ L;  4W9K A;  3RNG C;  1WWT A;  2ZJD A;  2BS4 B;  1PYW D;  2RD0 A;  1TY0 A;  3QA8 A;  2AQ1 B;  4WH4 A;  3Q8C A;  2PJH A;  4HJK A;  4XGA B;  3DBL B;  2KN4 A;  2IJ0 A;  1VR9 A;  2J0K A;  3TEZ A;  3QCA A;  4A90 A;  1ZOY B;  2I1K A;  2FCS A;  3M95 A;  2WXJ A;  1N63 A;  4ZYS A;  2QEJ C;  2V4I B;  4N59 A;  1ZXI A;  1XEE A;  2IGH A;  3OG5 A;  4GU2 A;  3RNC C;  2Z0E B;  5KHQ A;  3V61 A;  3KWL A;  3W1Y A;  4JWU C;  3RCZ A;  5BMG A;  2H88 B;  4M01 A;  4M02 A;  1VJK A;  2WDR B;  1P3Q U;  3Q8A A;  4RMA A;  4A55 A;  3HUI A;  3FIL A;  4RM9 A;  5G5G A;  2DYB A;  3MHZ A;  2M1M A;  5BO4 B;  2WU5 B;  3Q3O C;  1K50 A;  1SBB B;  3WAO A;  5AEK B;  3WCQ A;  1OEY J;  1WFY A;  4LDT D;  2K8B A;  4JX1 C;  2OJR A;  4LNI A;  3PZD A;  1SIJ A;  1XF5 L;  2BQQ A;  3V62 A;  1GC7 A;  3TMP B;  2C9W B;  4MEL A;  2LGD A;  4FXC A;  2L0F A;  1OTR B;  2D3G A;  3ZRC A;  3E56 A;  2K22 A;  1S1Q B;  4RGT A;  1PGX A;  3OJ3 A;  2KX3 A;  1PQS A;  3FC4 A;  1WXQ A;  2XEW A;  1UBI A;  3DVN V;  2LWP A;  2QHO A;  1FRD A;  2KAN A;  3PRZ A;  5D3D A;  1GB1 A;  1KF6 B;  2K8H A;  4RGM A;  4B95 A;  2G45 B;  4ITK A;  4WIP A;  1JW9 D;  3A1Q A;  5HI1 A;  3ZJT A;  1TZO A;  2GBM A;  1M4V A;  2SEB D;  1TKG A;  2MJD A;  4KSL C;  1XLO A;  3EFC A;  3EEC A;  3ZJV A;  4MDK E;  3H7S A;  2BPS A;  2DNF A;  1WF9 A;  1YMH E;  3L16 A;  4KIK B;  2MLB A;  3Q3J A;  3RI7 C;  1SE3 A;  2VH1 A;  2KAJ A;  2DZJ A;  2MBH A;  2KT7 A;  4HPL B;  1Q0W B;  1YIW A;  2INC C;  3ML9 A;  2KXJ A;  3A9J B;  3CF4 A;  2LD9 A;  1E90 A;  1C76 A;  1Y56 A;  2BGF A;  3DBR I;  1NYR A;  1QKZ A;  2CJO A;  3QAR A;  1UGJ A;  2PIA A;  3GS2 A;  3NHE B;  2JZ3 B;  3VRA B;  3P42 A;  2J53 A;  1WE6 A;  3I57 A;  2NTT A;  2NPT B;  5IN7 A;  2KTF A;  3BII D;  1DOX A;  1WZ0 A;  2CR5 A;  4XX5 A;  5GXG B;  2GOW A;  3DCG A;  4ZHP A;  1L0Y B;  1OEY A;  2I38 A;  1MFW A;  3ZGZ A;  5BYS A;  4NJ7 A;  1R4M I;  1V1P A;  1QOB A;  4YTN B;  4MJS B;  1L6V A;  2NPT A;  3PO0 A;  3T8M A;  1YJI A;  5D7G A;  4PYZ A;  1FCC C;  2ZPN A;  1E7V A;  1T0S C;  2NTS A;  1HQR D;  2X38 A;  2WX0 A;  2N9P C;  4USA A;  1SF0 A;  4WAA A;  3OLM D;  3VDZ A;  3PLV A;  2JRI B;  2W3S A;  3N30 A;  4LJO B;  2KLG A;  2RSU A;  1IUE A;  4DHZ B;  4DHJ B;  1WRD B;  3AE6 B;  3NUH B;  2NS5 A;  4GXB A;  1HTO A;  3PTF C;  5EE0 A;  4L23 A;  1L4D B;  3AUL A;  3ZUN A;  2JUO A;  2M56 B;  2DHZ A;  2RR9 A;  3I3T B;  2PPH A;  5E6O A;  5D6J B;  1I4H A;  2L1A A;  4ZOH C;  1FNV A;  1Z5S B;  2L05 A;  3VH3 B;  3BY4 B;  2KVR A;  2O2V A;  1ISN A;  3N32 A;  1VD2 A;  2FCQ A;  3B9J A;  2DZM A;  4XZ4 A;  1N62 A;  4F7Z A;  4IUM B;  3WA0 A;  2MJE A;  4IKG A;  1IGC A;  4AOF A;  1WXS A;  2PE6 B;  1WJN A;  1ZXH A;  1QOA A;  2J42 A;  3C19 A;  1K8R B;  2IGD A;  2N9K A;  2Q5W D;  3GZN B;  4E71 A;  4HDO A;  2MP2 A;  3PPA A;  2GRI A;  4GDL B;  1UWX A;  1VRA B;  2NR2 A;  3BVM A;  4MGZ E;  2RDG A;  1NI3 A;  2KK8 A;  1WZ3 A;  1TT5 B;  3P4Q B;  4ZYN A;  5C1Z A;  3P1M A;  3AI5 A;  2Z59 B;  2I1J A;  4YSX B;  2BWE S;  2E3T A;  3IVF A;  3RUL A;  5DPR A;  2IZV B;  1I4X A;  2L00 B;  4GSW A;  3SU8 X;  2C5L C;  3NOB A;  3I63 C;  2Y5B B;  3BWU D;  2TSS A;  3RN9 C;  3AH7 A;  3P2B A;  4TMA B;  2WXL A;  4RCO A;  3Q3M C;  1PGB A;  2LGX A;  1KLG D;  2JY6 A;  4IWO A; 
#chains in the Genus database with same CATH homology
 4DQO C;  4XDC A;  2DLB A;  3BK1 A;  2WS3 B;  3RFZ B;  1FXA A;  3ZYY X;  1SE2 A;  1F2R C;  3EGR A;  1RYJ A;  1TS5 A;  1UNS A;  2INP E;  1YN4 A;  1E6E B;  2MEK A;  4A6Q A;  2WXM A;  3AEC B;  4CQN A;  2RPV A;  1ZP0 B;  1WGK A;  2KMM A;  4US8 A;  1AW7 A;  3EA6 A;  1FNU A;  1V97 A;  3DWG C;  3J9C A;  1UWM A;  4J3O D;  1FRR A;  4MM3 B;  1JWM D;  1N5X A;  4OZC A;  1EWC A;  1F0Z A;  2M0A A;  3GP7 A;  1AWD A;  1DOY A;  2WXF A;  1J7B A;  1QOF A;  4ARC A;  4RGN A;  1YQ3 B;  2RDH A;  4HEA 1;  3T3N A;  3AEG B;  1L6U A;  2WXG A;  2AX5 A;  2KWD A;  1PGA A;  3Q8E A;  3AE4 B;  1MHX A;  3P4R B;  1SE4 A;  1YNT E;  3BYT B;  2KDM A;  5FKA C;  4REZ A;  1RM6 C;  2K0P A;  3IT4 B;  2RMM A;  1FFU A;  1AN8 A;  4YXD B;  2IPK D;  2AQ2 B;  2L52 A;  1FIQ A;  4KGR A;  4TQ1 A;  1QF6 A;  1D4B A;  1TKY A;  1EWY C;  2LGI A;  4TSS A;  1OQQ A;  1FXI A;  2H89 B;  1T5X D;  3R2I A;  3TSS A;  4RF0 A;  4KKI A;  1V8C A;  1F2R I;  1XLP A;  1C79 A;  2DWQ A;  2FE8 A;  1EM7 A;  2WXQ A;  1FMA D;  2BW2 A;  2HTM E;  3BZD B;  3Q8B A;  3AEF B;  1BML C;  1D5M C;  2WXR A;  2JU6 X;  3AE2 B;  1D5X C;  2ICI A;  1VLB A;  2KQ4 X;  2VZK B;  1FCL A;  2PMV A;  4L1B A;  2AQ3 B;  2I2Y A;  4YSZ B;  1TYG B;  3P4P B;  3TUO A;  5BYQ A;  3URY A;  2WXI A;  1K52 A;  1D5Z C;  2SAK A;  1JWU D;  1C4C A;  1WRI A;  1CK1 A;  1V1O A;  4OW0 A;  3MP9 A;  3N9Y C;  4JWS C;  1FNW A;  1PDX A;  2DYO A;  2QIE B;  1DYQ A;  4WAF A;  2NMQ A;  4HKQ A;  1E0Z A;  2JX5 A;  1JAL A;  4AQ7 A;  1ACC A;  1EU3 A;  1P7F A;  2OHF A;  1KH0 A;  3AB5 A;  2V3N A;  4WWM A;  2FBW B;  1F77 A;  2MJ3 A;  3DWM A;  3L4P A;  4ZRQ A;  1HA5 A;  1N61 A;  2MH7 A;  1N5W A;  2N9L A;  2PVG C;  2Z8L A;  3CWI A;  1ET9 A;  1XXG A;  1VDV A;  5C3J B;  2VZK D;  1JWB D;  3NS1 A;  1L5P A;  1CJE A;  3MC0 B;  1H7W A;  1CQV A;  2N0S B;  5HG2 A;  1ZUD 2;  1E9M A;  1KTK A;  2IDY A;  1N60 A;  3BVZ A;  2V3P A;  1J7C A;  4O1N A;  4US9 A;  2WU2 B;  3U4E G;  3V05 A;  2W55 A;  1QOG A;  2Y3A A;  4M0W A;  2XN9 C;  4RFB A;  1FFV A;  1XCQ L;  1C77 A;  1JWA D;  1WWT A;  5H92 C;  1E7P B;  1JCK B;  1MVK A;  2BS4 B;  1FEH A;  1PYW D;  2LFI A;  3HRD D;  3UI3 A;  1TY0 A;  4D2K A;  2AQ1 B;  4WH4 A;  4YTP B;  1XCT L;  1K51 A;  3Q8C A;  4XWW A;  1JRO A;  3W5U B;  4A8X C;  3MJ5 A;  3AED B;  1I4R A;  2KN4 A;  2IJ0 A;  1VR9 A;  3TEZ A;  3LYY A;  2JSV X;  3LXF A;  4A9A A;  4L2Y A;  2BBC A;  4A90 A;  1ZOY B;  3BK2 A;  1T6B X;  1XLN A;  2ONQ A;  4N6E B;  2WXJ A;  4ZRP A;  1N63 A;  2JYE A;  2PTL A;  1ENF A;  3KWV A;  2LHD A;  2QEJ C;  2K5P A;  4ZYS A;  3LB8 C;  1V1P B;  2PW9 A;  3SFE B;  2V4I B;  2YEP F;  4N59 A;  2WXH A;  3C8Y A;  1ZXI A;  3AE3 B;  3R2T A;  1XLQ A;  1XEE A;  2IGH A;  1QQR A;  3U2S C;  5BMH A;  4YT0 B;  1Q10 A;  3KWL A;  1SEB D;  2PLP A;  4JWU C;  5BMG A;  2B76 B;  2H88 B;  2R61 A;  1VJK A;  2WDR B;  4JPS A;  3Q8A A;  3VQI A;  4A55 A;  3HUI A;  3FIL A;  3W9C B;  1TS4 A;  4HJG E;  5G5G A;  3MHZ A;  5JXV A;  2WU5 B;  1K50 A;  2YEP B;  1SBB B;  1SJH D;  1YN3 A;  1SSN A;  3WCQ A;  5G5H A;  3SR6 A;  3P4S B;  4RH6 A;  5AUI A;  4IDI A;  4MAC A;  1HZ5 A;  2N7J A;  5AUK A;  4JX1 C;  1YJJ A;  2ZW0 A;  1ROE A;  1C4P A;  1SIJ A;  1XF5 L;  2KAC A;  1HZ6 A;  2EEL A;  4UDU C;  3IAS 1;  1C78 A;  4FXC A;  3NVY A;  1ZPS A;  4C7Z A;  3E56 A;  2K22 A;  4RGT A;  3I9V 1;  1PGX A;  1RWS A;  3AN1 A;  4P16 A;  5FK9 C;  3FC4 A;  1WXQ A;  2QJL A;  1C4A A;  2JQR B;  2XNA C;  2LHE A;  1BXT A;  1FRD A;  5D3D A;  1GB1 A;  1KF6 B;  3AE9 B;  3IAM 1;  1KRH A;  4RGM A;  1GPX A;  4ITK A;  2CU3 A;  1JWS D;  1YQ4 B;  4WIP A;  4AS1 A;  1JW9 D;  1GT8 A;  3SFD B;  1I4G A;  2GB1 A;  5HI1 A;  4Q2J A;  3FAH A;  3KLS X;  3ZJT A;  1TZO A;  1M4V A;  4MH8 A;  2SEB D;  1TKG A;  2WDV B;  1VZ7 A;  1XLO A;  2MJD A;  5HHD G;  3Q8F A;  3NRZ A;  5EE3 A;  4RNA A;  2JYT A;  1I4P A;  3ZJV A;  2D5G A;  2JWU A;  1HEZ E;  4HKZ E;  5T8I A;  1YMH E;  4DXG A;  1NVI D;  1XO3 A;  4C56 C;  1SE3 A;  2WLB A;  2G1E A;  1EU4 A;  2KAJ A;  1L4Z B;  1NEK B;  4WUR A;  4YTM B;  1IGD A;  1STE A;  2LMC A;  1WYG A;  1PUT A;  2M19 A;  1UUP A;  1WSP A;  3CF4 A;  1TJE A;  1C76 A;  1TKE A;  1Y56 A;  4XE0 A;  1H7X A;  3PZ8 A;  2INN E;  2EKI A;  1OFF A;  2QIL A;  1NYR A;  1QKZ A;  2CJO A;  1BUI C;  1UGJ A;  2PIA A;  1QT9 A;  3GS2 A;  5I4D A;  4B0M A;  5LNK 1;  3VRA B;  3P42 A;  3OWE B;  4HRO A;  4NJC A;  2J53 A;  3W5V B;  1B9R A;  1GTH A;  2BS2 B;  2GI9 A;  4C80 A;  3GB1 A;  5TSS A;  3I57 A;  1ESF A;  3Q69 A;  1J7A A;  2NTT A;  2WNM A;  2BT6 A;  4JE3 B;  3B2G A;  1C9F A;  3V3X A;  1B1Z A;  2DYM A;  4LTU A;  4MT5 A;  3BII D;  4GDK B;  2HDE A;  2W3R A;  3CIR B;  1DOX A;  3VR8 B;  3U7Z A;  5GXG B;  2LEK A;  2BYT A;  4ZHP A;  1L0Y B;  3TEW A;  4B0E A;  2W54 A;  1MHH E;  1YN5 A;  4TQ0 A;  3ETR A;  2E6X A;  4NZL B;  1KLU D;  2I38 A;  1L0X B;  3R8B A;  2PKO A;  3ZGZ A;  1GB4 A;  4KKJ A;  3EUB 2;  5BYS A;  1V1P A;  1QOB A;  4YTN B;  5FR3 A;  3AE1 B;  1L6V A;  3PO0 A;  3AM9 A;  1YJI A;  1HXY D;  3IT6 B;  1I4Q A;  3NVW A;  4HRS A;  3IXS A;  4GLS C;  3ZJU A;  5D7G A;  1L0V B;  2WXK A;  1JML A;  4NAM A;  1FCC C;  4XWT A;  1SXT A;  3ABV B;  5EE1 A;  3O13 A;  3AE7 B;  1ZDV A;  1QIL A;  2NTS A;  2K9X A;  1RFK A;  2K3U A;  1HQR D;  2WDQ B;  2X38 A;  2PVO D;  1GOZ A;  4USA A;  1SF0 A;  1KFY B;  4KX6 B;  5BMI A;  1DGJ A;  3NZ3 A;  2G9H D;  4IOI E;  4KGT A;  2W3S A;  1A70 A;  2Y5P A;  2IGG A;  1SJE D;  1TS3 A;  3P63 A;  2JXT A;  3SEB A;  1IUE A;  4ZHO A;  1JQ4 A;  1PFD A;  2BB5 A;  2L83 A;  3E9S A;  3AE6 B;  1SB3 C;  1AYF A;  3NUH B;  5BYR A;  3VR9 B;  5EE0 A;  4L23 A;  1D6E C;  1L4D B;  2WXP A;  3HVZ A;  3ZQ4 A;  2OED A;  1MPE A;  2M56 B;  4DXF A;  1DOI A;  1NYQ A;  2LUM A;  4N58 A;  1K53 A;  1P7E A;  1I7H A;  1QLB B;  3HVD A;  4OHJ A;  1FM0 D;  1I4H A;  2J4X A;  2L1A A;  4ZOH C;  1MI0 A;  5E6J A;  1FNV A;  5H8Y E;  4WQM A;  4P6V F;  2ON8 A;  1TY2 A;  5HFY A;  1CZP A;  3B2F A;  4KGS A;  1GAQ B;  1ET6 A;  3B9J A;  3NVZ A;  1E10 A;  1VZ6 A;  3NVV A;  1N62 A;  1LO5 D;  3AMZ A;  2JZP A;  1R7S A;  2MJE A;  4IKG A;  3RPF C;  1IGC A;  2LJI A;  1FD6 A;  2WXN A;  1ZXH A;  1QOA A;  3T3O A;  2J42 A;  3H8H A;  2WQY B;  4LK0 M;  2IGD A;  4OZA A;  2N9K A;  3AEB B;  2Q5W D;  4ARI A;  3W2D A;  1GTE A;  2BTE A;  2GRI A;  4GDL B;  5C2T B;  4PT5 A;  5D3I B;  1UWX A;  3MFG A;  1JRP A;  1T3Q A;  4R3D A;  1VRA B;  3BVM A;  2DBY A;  2QSD A;  2QMT A;  2FUG 1;  3AE5 B;  2ZW1 A;  3W1S A;  1ZE3 D;  2RDG A;  1ZDX A;  4YSY B;  1NI3 A;  4RGO S;  2V0G A;  3VRB B;  4XDD A;  4H2A A;  3PZ7 A;  3FIL B;  1IBX B;  3P4Q B;  2WP9 B;  3P1M A;  3KQ4 A;  4EE2 A;  1NEN B;  3BYY B;  3TEY A;  4LLG M;  5MPO A;  1VZ8 A;  2BS3 B;  2J52 A;  3AEA B;  3TEX A;  4YSX B;  4YWG G;  2Y5C A;  2E3T A;  1FO4 A;  2WXO A;  2ACZ B;  3BVG A;  2BB6 A;  2CJN A;  1I4X A;  1OQR A;  2W82 A;  1TS2 A;  3AV8 A;  3BWU D;  2TSS A;  3AEE B;  3AH7 A;  4TMA B;  2WXL A;  1IBX A;  4RCO A;  4OVZ A;  5EE9 A;  3U52 E;  3AE8 B;  4NAW B;  4C7Y A;  2L32 A;  1PGB A;  1KLG D;  4OZB A;  4RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...