5C2TB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 64
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 5c2tB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5c2tB01
3AEEB 2E3TA 3B9JA 4HROA 3NVWA 1JWBD 1WYGA 1ZOYB 1NYRA 2WQYB 1V97A 2PVOD 1FO4A 1YJIA 5H92C 5G5HA 3VR9B 1QT9A 1TYGB 1N5WA 3FAHA 1QOFA 1N63A 4JWUC 1E10A 2JX5A 3W5UB 2WDQB 1H7XA 4FXCA 3CF4A 3P4PB 3AH7A 1JW9D 1TKEA 1JQ4A 1NENB 1UWMA 2L83A 2PIAA 1SB3C 1FXIA 2BS2B 1FFUA 3VR8B 3ETRA 1E0ZA 1CJEA 4C7ZA 1QLBB 1FM0D 1NVID 2HTME 2B76B 3AN1A 3ABVB 3AEGB 3CIRB 5C2TB 2KMMA 2DBYA 3P4SB 1TKYA 2CJNA 1SIJA 2QIEB 1JWAD 1L6VA 1AWDA 3AM9A 4KX6B 2MJ3A 3EUB2 3HVZA 4IDIA 4US9A 5EE0A 4USAA 3AEFB 4YTPB 1L5PA 2OHFA 5GXGB 3AE9B 4C7YA 1RYJA 1QOAA 2MJEA 2M56B 4LTUA 2WU2B 3AE3B 1RFKA 1VDVA 3RPFC 1PDXA 4N6EB 2H88B 3B2GA 3NS1A 1EWYC 3AMZA 2BS3B 1YQ3B 1OFFA 3AE1B 1ZUD2 3AE6B 3AECB 1NEKB 1I7HA 2AX5A 4US8A 1H7WA 1PUTA 4YSYB 1XO3A 2K9XA 1AYFA 2PKOA 2PVGC 4JWSC 4YTMB 1TJEA 3DWGC 3HUIA 1A70A 1TKGA 2M19A 3P1MA 3SFEB 1ROEA 4ZHOA 2WDRB 5EE9A 2WLBA 4P6VF 1QF6A 2QJLA 2BT6A 1J7BA 1E9MA 3L4PA 2MJDA 2K22A 1XLOA 1GTHA 1KRHA 1VJKA 1GPXA 1DOYA 1FRRA 3AE7B 1CZPA 3SFDB 1ZXIA 1E7PB 2W55A 3DWMA 3HRDD 1WRIA 4WQMA 3CWIA 2CU3A 2DWQA 1FIQA 3SR6A 2Y5CA 1N60A 2W3SA 4A9AA 4C80A 3P4RB 5AUKA 2WU5B 3BIID 1XLQA 1XLPA 2JQRB 2H89B 3NVVA 4JX1C 3AE2B 2BS4B 1J7AA 2G1EA 4ZHPA 3W9CB 1WWTA 2ACZB 1YQ4B 1FRDA 2N0SB 3NVYA 3LB8C 1GAQB 1FFVA 1DOIA 4ZOHC 3WCQA 1V8CA 4YSZB 4WWMA 2WP9B 3AV8A 3B2FA 2K5PA 1GT8A 2MH7A 5H8YE 1QOBA 4YT0B 1QOGA 1GTEA 1WGKA 1XLNA 4ITKA 1SF0A 1KFYB 3AEDB 3W5VB 3NRZA 3VRAB 1JRPA 1N62A 5EE3A 3AE4B 4YSXB 4N59A 1FMAD 1NI3A 5EE1A 5AUIA 3AE8B 3KWLA 1RM6C 4N58A 4YXDB 2CJOA 2W54A 1DOXA 1PFDA 4HRSA 1N61A 2EKIA 3VRBB 5C3JB 2Q5WD 3FC4A 3AE5B 3ZYYX 1FXAA 1F0ZA 1YJJA 3P4QB 3P63A 1VLBA 5G5GA 1R7SA 1L6UA 1OQRA 1E6EB 1KF6B 2WDVB 1OQQA 2KAJA 2LEKA 5MPOA 3NVZA 3AEBB 3PO0A 1IUEA 1B9RA 2L52A 1NYQA 1T3QA 1ZP0B 4YTNB 2FBWB 1J7CA 1JALA 1JROA 1RWSA 2WS3B 1L0VB 1N5XA 2W3RA 3AB5A 3LXFA 1WXQA 3AEAB 1DGJA
chains in the Genus database with same CATH superfamily
3PRMB 4HROA 2BYTA 1V1PB 3X0WA 4XWWA 5G5HA 2WXIA 5CX3A 1P3QU 2FAZA 3GE3C 2V3SA 5AEKB 1TKEA 2L83A 4G3XB 1E0ZA 1HEZE 3UI3A 1FM0D 3AN1A 3CIRB 3CF6E 2CJNA 4IDIA 5GXGB 4L1BA 1VDVA 4IC7B 2ZNVC 3B2GA 2PE6B 2MBEA 2C5LC 4LJOB 4X57B 4DHZB 4GGQA 4HJKA 4XDDA 2BF8B 2WDRB 3BK1A 4WH4A 2IYDB 1C78A 5L83A 5CHFA 4NJ7A 3PGEA 3RNGC 4E74A 2XBBC 1FNVA 2CHWA 3C0RB 2BKRB 3KVFB 2NVUI 4A9AA 3BIID 2JT4B 3NVVA 1J7AA 2WHIA 3S2AA 1L0XB 1NI2A 3BVZA 4ARIA 2M4NA 4ICUA 2INPE 2PE9A 1IP9A 3IBEA 4JL9A 3T9LA 1WGHA 2IY0B 5AZGA 4N58A 2ONQA 2CJOA 1QKZA 1YIWA 2Q5WD 1K50A 3PZDA 2FIFA 4KZ0A 1WSPA 1OQRA 3L17A 1SE3A 1TS4A 2L0FA 2BWES 1FNUA 3R2TA 1JALA 5TSSA 3W1YA 2R61A 3A9JA 1L4DB 4FJZA 1C4AA 3X23A 4NPNA 4AP4C 2INCC 4LDTB 5KHOA 1D5XC 1FXIA 1UBIA 2BKFA 3ZRFA 4R3DA 3Q3MC 4HKQA 3QA8A 1L6VA 3UIPB 1AWDA 3DBLB 3AE9B 2JVCA 4DDGD 1TY2A 3OAWA 2I2YA 2IY1B 1E8YA 2MP2A 3NS1A 1XCQL 3GS2A 1LXDA 1OFFA 2DZMA 2INNE 1LGRA 3PRZA 3V3XA 4PS3A 1PUTA 1ZKHA 1C3TA 4ZHOA 2CHXA 1XLOA 1KRHA 3SFDB 4RCOA 3APFA 4WQMA 1JCKB 4A55A 2K8HA 4WJPA 3VUYA 4RMAA 2LRWA 4S0RA 3I63C 1J19A 3DBRI 1IPGA 2LWPA 2WXPA 1SBBB 3ZNZB 3RFZB 4HXDA 2JY6A 2QEJC 4ZOHC 2G9HD 3ZO5B 2SEBD 1ZPSA 2I1JA 3N30A 3ZDTA 2CHZA 3Q8AA 2PLPA 1QZEA 4XYCA 1RFAA 4MGYE 2N9LA 1WJUA 1WE6A 1RRBA 1PFDA 3DHHC 2LGIA 2CR5A 2JPHA 3AE5B 2N9XA 3AU4A 4LDTD 3OLMD 2N4FA 1WMHA 3TIXA 5JHAA 3NVZA 3E9SA 2ZEQA 5E6NA 1DOXA 1JROA 5D7GA 3AB5A 2WXMA 1F2RI 4PS7A 2NPTA 2GBMA 1QT9A 3N32A 1GUAB 1WX7A 1QOFA 3DVNU 1RLFA 2UU7A 3P42A 1E10A 2KANA 4RH6A 2YEPF 2ZPNA 3MC8A 4MGKE 1JQ4A 1NENB 1SIFA 2ICIA 3H8HA 3KUZA 4MSQB 4RM8A 2HTME 1MI0A 1SJHD 1I4XA 1WJNA 2AWTA 4RM9A 2Z0EB 1WXVA 5HKHA 3A1QB 2H88B 2MWSB 1E5WA 3HM6X 4IM3A 4DK5A 3ZNID 1IGDA 2BTEA 1ACCA 1R4NI 3WANA 1YJ1A 4W9JA 4BOZB 1S1QB 4C56C 2XK5B 3L4PA 1MG8A 3TL5A 2PTLA 2AEHA 4EOYA 1V49A 1JWMD 4A3OA 1FRRA 3V61A 4C4VA 2DLBA 3VXWA 3ZJVA 4GSWA 4BKGA 4B0EA 3NHEB 4WAFA 2WGSA 5BYRA 3TEWA 4GB9A 2BYFA 1TY0A 1WGGA 1GAQB 1SJED 5BO4B 5DPTA 2Z0DB 2QILA 1HXYD 1FXTB 1GTEA 3RNAC 4KGRA 1L0YB 4F7ZA 1PQSA 4YSXB 1VZ8A 4N59A 1NI3A 2FUHB 3DBHB 4PS8A 1MHHE 2LJ5A 4C00A 1B1ZA 4HRSA 4K81A 2K6QA 3H7PA 3N3KB 5JXVA 1KM7A 2WYQA 2K3UA 4LLGM 5G2NA 4GMVA 3L54A 4HJGE 2LEKA 1KF6B 4J6IA 4A6QA 5G5GA 1Q10A 1RWSA 2W3RA 4AOFA 5BMHA 3PHXB 3Q8FA 4HEA1 3NVWA 4KZCA 2KVRA 4MH0E 1Y8RC 1QILA 2O2VA 4AQ7A 2RDGA 2TSSA 2LXAA 3DHGC 1VD2A 2XN9C 2MW5A 4IM0A 2B76B 2J4XA 4W9KA 4AJWA 3W1SA 4YTPB 1WZ0A 3DBSA 2L00B 1ET9A 4BBNC 1I4HA 3U30A 4HPLB 3E56A 1GB1A 3VTUA 4BOSC 1E90A 3DVNV 3AE1B 1HE8A 1I7HA 4KGSA 2JXXA 4EZLA 2LVOA 2PMVA 5JH5C 1JRUA 1E9MA 4ZYSA 2KDEB 4HVBA 2ZW1A 2C7MB 3DWMA 1E7PB 1WRIA 2KZRA 4BAXA 1WM3A 3SR6A 2IO0B 4OW0A 4WJNA 3EECA 2JRHA 2EMTA 1S3SG 4GIVA 4ACFA 1XLQA 3V6CB 4IM2A 2YVCA 4NAMA 2KOXA 2M8SA 3B2FA 3ZW3A 4ITKA 3NS8A 1YD8U 5AUIA 3KWLA 3A9KB 2PPHA 3DBLI 2MSED 3U8ZA 2W54A 2EKIA 3BVMA 2BPSA 2E6XA 3AI5A 1FCLA 3DVGX 4RGNA 2C7NB 3PO0A 1B9RA 3GB1A 4M02A 4LK0M 4MSMB 1HTOA 3DHIC 2PVOD 2BYVE 2D5GA 1N63A 2AL3A 2DAJA 4B95A 3P4PB 1JW9D 2RR9A 4WJOA 4LNNA 3N1YC 4Q2JA 5AUKA 2MRPA 4NAWA 3SHQA 3AM9A 1GJZA 3U7ZA 4QAYA 3Q3FA 4BKTA 1RYJA 2KDIA 1I4QA 4OZAA 2WU2B 2AL6A 2HTHA 2EKEC 1XO3A 1AN8A 3BK2A 1QF6A 5FR6A 2ZW0A 1OGWA 3C19A 1GTHA 1XD3B 2FIDA 3JSVB 2KN5A 4XGAB 2L8JA 3EGRA 4HWIB 3L13A 3GOEA 4M0WA 4M00A 5IAAC 2WU5B 5E6OA 3RMKC 2ACZB 2VH1A 4IWQA 3VTVA 1KLGD 4AJYB 2IPKD 4PYZA 1WX8A 3V62A 1V1PA 1T0SC 1QOGA 1WFYA 5EE3A 1TS3A 4ICVA 5FKAC 4GLSC 3DQVA 1FNWA 1N61A 1FPYA 3FC4A 5DPWA 3ZTCA 2NMQA 1UH6A 2Z8LA 3A4SC 2ZCBA 3UGBB 2KYWA 3H7SA 4ARCA 4B9KA 1J7CA 4ZDVA 3OJ4B 4MELA 1JWBD 3KYCD 4M8MA 2V1YA 5BYQA 1HTQA 1ZDXA 4D2KA 2MA9B 4J3OD 5IO9A 2MX2A 2JX5A 5BYSA 3IAM1 3WA0A 1BMLC 4IKGA 5KHQA 1DYQA 2WXOA 2BS2B 2KACA 4CQNA 4CYEA 5J2RA 3ABVB 4W9LA 3EUB2 1F1HA 4JIOU 2KC2A 2LVPA 3PHWB 5EE0A 4GN1A 2R2OA 1SXTA 3KUCB 2C7HA 3AE6B 2K25A 2K9XA 3A33B 1L4ZB 2CS4A 4JWSC 3AXCA 3L10B 3DBHI 1T0RC 1STEA 4W9HA 3MJ5A 3KW5B 5DCNA 3TEXA 3FILB 3HRDD 1C9FA 2JUOA 2DWQA 2MBOA 1XEEA 1E7VA 2JYTA 1NDDA 3IXSA 1OEYJ 2NR2A 3N1ZC 1WZ3A 3BVGA 1P1AA 2Y5BB 3LB8C 3Q2AC 3I57A 3NZSA 2OJRA 2BB6A 5D6JB 4OZCA 2D07B 1QOBA 1V6EA 4E71A 3UQBA 1JRPA 4XX5A 2N9KA 4LNFA 3VRBB 1YJJA 3BWUD 2WXKA 2IO2B 1V5TA 2R2QA 2KX3A 2ZNVB 1WYWB 2WX0A 2KTRB 4HDQA 1V9JA 1UD7A 4DXFA 1L0VB 3LJ3A 2QCZA 4ZHPA 2AQ3B 4K7WA 2KWUB 2E3TA 5I4DA 2DHZA 3RUIB 1NYRA 3V60A 4DWFA 3B0AA 4HDOA 2KWCA 4H2AA 4WJQA 1WI0A 3SU8X 2DNFA 3HM3A 1JMLA 3U7DA 2LASA 3MTNB 2QMTA 3ZXVA 4PYUA 1X1MA 3EFUA 2MEKA 1YX6B 2HD5B 2BYEA 3MP9A 4NQLB 2L0TA 3M3JA 4M01A 4HKZE 1LFDA 3AMZA 2BS3B 1N6ZA 1NEKB 2JWZA 4GU2A 4EUTA 2KNBA 2PVGC 2IO3B 2KTFA 3P1MA 2ZCCA 2I38A 5EE9A 1D3ZA 5D3IB 1J7BA 3B08A 4OVVA 4L23A 1GB4A 1K51A 4GOCA 3QIJA 3QQ8B 4BFRA 1CZPA 4FHJA 2LJIA 3GZNI 4FADA 2GBJA 1TTNA 3IAS1 2GBRA 5IP4D 2LGSA 1T6BX 3PPAA 2QDFA 2VZKB 2BS4B 1KTKA 2N0SB 1V2YA 1P9DU 2KX0A 4B0MA 4XE0A 4YWGG 4TKNA 3VHTC 3PREA 3W2DA 3Q8CA 3ZQ4A 3HK0A 1E8XA 2WXRA 4TV3A 3TCAA 5IN7A 3H6NA 3ZYYX 1UZXB 2VRRB 3P4QB 1F52A 3GP7A 1T5XD 2L52A 3BZDB 2FBWB 2NBVB 1EM7A 3WAPA 3VH3B 4AUQC 4NNJB 3A1QA 1E8ZA 1WH3A 2L3ZA 2M0AA 3PRPB 3W5UB 1H7XA 3B1LX 3U52E 1BT0A 4I6PA 2XK5A 3ETRA 2LD9A 5HI1A 2BB5A 1U4AA 2O6VB 2JZPA 3P4SB 2LGYA 1SIJA 4US9A 3FKYA 1G6JA 1RAXA 2N7EA 3CSFA 2DYBA 2LXCA 4P1BC 1YOVB 2RSUA 4HPMB 4WQOB 5BMGA 1KLVA 3RI7C 2VZKD 3O13A 4LCDE 3KQ4A 3QCAA 2ASQA 2XNAC 2K22A 4JLCA 1WXSA 1GPXA 1ZXIA 2W55A 4MEMA 2CU3A 3N9YC 1MG4A 5HG2A 4TQ0A 2WXJA 2PW9A 3VUXA 4NQKE 2REXA 2BWFA 3PVLA 5AZFA 5FR3A 2JQRB 2G1EA 3WIMA 2NBWB 3DOWA 4EZJA 5IKCM 2LUEA 4DXGA 2K5PA 5H8YE 5LLIA 2GLSA 4KDLB 4YL8A 4CO7A 3ZJTA 1EWCA 2J7QB 2LI5A 1R4MB 4K3CA 5D2MB 1YX5B 2LVQA 2C60A 2KJ6A 3GE8C 3RD2A 1PYWD 2M0XA 3PTFC 2O6VD 2N1WA 2AQ2B 1ZW7A 3EHVA 3AEAB 1DGJA 4ANWA 2JYEA 3B9JA 2D3BA 1MVKA 3Q8EA 1FO4A 1YJIA 3VR9B 4GDKB 1LO5D 2WDQB 4A90A 4TQ1A 2OOBB 2DZKA 3NJTA 1GC7A 3ALBA 2JRIB 2NTSA 1K52A 1FFUA 1CJEA 1NVID 4K1RB 4WWOA 1VCBA 3TBLD 4ANUA 4P1CC 3Q3OC 3HVZA 5LXHA 3AEFB 3R66C 1WE7A 2LFIA 1QOAA 3M62B 1RFKA 1WGRA 1TZ1A 3VTWA 1ET6A 1C4CA 2X8XX 1AW7A 3AECB 1ZDVA 3RULA 2MBQA 2WXNA 2RGFA 4YSYB 2V9HA 1AYFA 3R7QA 2YLMA 2KJRA 2NTTA 2RDBC 4II2B 1V80A 1L2NA 2K8BA 3QARA 3KWVA 4ZRPA 1HA5A 4MGZE 3LDZE 3A9KA 2CU1A 1UF0A 4HK2A 2KXJA 4WURA 2V0GA 1K53A 2JF5A 3AE2B 2LZ6A 4DHJB 4DBGA 1YQ4B 2N7DA 3RNEC 2KT7A 4MJSB 3DDCB 2K6DB 1DOIA 1WJ6A 1OTRB 2QHOA 1WF9A 2L7RA 4WWPA 1F77A 4NJCA 3ZKJC 5G55A 3NRZA 4JE3B 4RF0A 1WRDB 4FN2A 5C3JB 4A8XC 1KH0A 4FBJB 1C77A 4MM3B 2KJHB 3P63A 4AWJA 4MACA 4RF1A 3W1SC 1UWXA 1E6EB 2WDVB 3RNCC 3RZFA 2KDMA 1M4VA 2XEWA 4O1NA 1D5MC 4BKSD 1T0YA 2IBIB 1VZ7A 4S17A 4RGTA 2LMCA 3R7RA 1TYGB 1OQYA 2RPQA 3FAHA 2O2VB 3QJZA 2FE8A 1FCCC 1VRAB 1WXMA 1UWMA 3ZXRA 1T0QC 1M94A 5IOIA 3GZNB 1CK1A 2EELA 3JSVA 3C8YA 4KKJA 3Q14C 4EZKA 4M8NA 2KFKB 4MDKE 2GOWA 1PDXA 2W9NA 3R2IA 5CHWA 2KFJA 5FK9C 1I4RA 3RNFC 1E7UA 2JWUA 4HLEA 3H9DA 4FLHA 3HUIA 4DHJD 1TKGA 3SFEB 2LGXA 2KQ7A 1UGMA 3APDA 4JQWC 1PGBA 2Y5PA 1DOYA 3PZ8A 1VR9A 2PJHA 2KLGA 3TEYA 2V4IB 1EUVB 3W9CB 4KDIC 1QQRA 2MH7A 1ZGUB 1V81A 1KFYB 3AEDB 1F2RC 3SD5A 3AE8B 5C1ZA 1NBFC 1VLBA 2I1KA 1OQQA 4EFOA 5MPOA 3RNBC 2K8CA 3K9OB 3JW0X 4YTNB 1MHXA 2WS3B 3QK0A 5IA7A 4WWNA 4OHJA 3ECIA 1V86A 3OG5A 2JSVX 2J53A 1SGHA 4LNKA 2VH2A 2HJ8A 2FCQA 4JGHB 3MHZA 3TSSA 1MPEA 2MLBA 3FILA 4KIKB 2MJ3A 4W9DA 1AARA 1KOTA 2N9PC 4DXAB 1GOZA 4N9F4 1YQ3B 1D4BA 1UELA 3M95A 2AX5A 4RGMA 2J52A 3U4EG 1TJEA 4WIPA 1J0GA 1H8CA 1R4MI 1Y56A 2G4SA 4OVUA 1KJTA 2GB1A 1UBQA 1C1YB 3AE7B 5AZHA 4XWTA 4ASWC 1P7FA 1D6EC 4ZRJA 2MHJA 4BZAA 2LUMA 2W3SA 1XXGA 4FHKA 1CQVA 3SDLC 2WXGA 2N1VA 1FRDA 2G4DB 3ZJUA 3NVYA 1SEBD 3T3NA 3P2BA 3U2SC 4IW0A 1EF5A 1FFVA 3ENEA 4K7SA 1JWSD 3UQAA 2KD0A 5DPSA 1XLNA 2KC1A 2DZJA 3VRAB 2D3GA 1Q1OA 2L32A 5TR5A 1RM6C 2ZVOA 3MC0B 1F0ZA 2KMAA 3HHMA 1L6UA 3AEBB 4NJ6A 4ZRIA 1NYQA 4II3B 2M1MA 1A5RA 1P0RA 3ONSA 3IT6B 1K8RB 3AEEB 1MFWA 2IO1B 4RNAA 2RDHA 2IGGA 1IBXB 2NCNA 1N5WA 3R3MA 4GDLB 2IGDA 1GNUA 3JYUA 3CF4A 3AH7A 2D11A 3VR8B 2WXFA 2KMMA 2GRIA 1SE2A 4KX6B 3RZWC 1MJDA 3SEBA 3EA6A 2KQSA 4N6EB 2HDEA 4RFBA 5J17A 1Z5SB 1ENFA 3PZ7A 2KDBA 4LJPB 1SE9A 5L95C 2HJ1A 4A3PA 3Q6BA 2BW2A 3N1XC 4IG7B 5BMIA 3MHSD 2PKOA 1C4PA 4F8CB 3APCA 1ROEA 2HE7A 2LHDA 2QJLA 1TIFA 2MJDA 1BXTA 2X38A 3ZTDA 1JWUD 4BBNF 4KVGB 2MBHA 4JPSA 1WGYA 2L1AA 5GMVA 3NG0A 3BYTB 3N20C 3T3OA 2KWDA 1ESFA 2JZ3B 3PT2B 3T8MA 4DQOC 1WWTA 3TJPA 1H4RA 2MBBB 2RPVA 3M63B 3UF8A 2WP9B 5LNK1 4YT0B 2G3QB 3I9V1 1SF0A 2JZZA 4DHZE 3BINA 4G0NB 3AE4B 3O65B 1TGZB 3I5JC 4REZA 1XF5L 1HQRD 3ZLZA 2GBNA 2O6VA 2WX1A 3VVWB 4ZRQA 1CMXB 3PLVA 3K9PB 4P7IA 2WQYB 2UYZB 1V97A 4IOIE 4JWUC 1TZOA 2KK8A 2D3AA 1V1OA 2DYMA 2WWZA 4C7ZA 1QLBB 2QIEB 2RMMA 5J18A 1XT9B 1LM8B 1LQBA 4FJYA 3Q3JA 2OHFA 3NZUA 1EO6A 2M56B 3RPFC 3OWEB 3A9JB 1KLUD 3IT4B 3EC8A 3A4RA 1TT5B 3ZVVA 5CHVC 4YTMB 3DWGC 1YN3A 2M19A 1BUIC 2WLBA 2IGHA 3AU5A 3UINB 4EE2A 1VJKA 1FIQA 3J9CA 1N60A 4XDCA 4KKIA 2MP2B 2IJ0A 3ZIMA 4XC2A 4URKA 4JX1C 1VZ6A 3RN9C 2JU6X 1WXAA 1EU3A 1GG3A 1IGCA 1L7YA 2C9WB 1YN5A 2AQ1B 2ZJDA 2RD0A 4WWMA 1I35A 1GT8A 2KLCA 1WGKA 4GDKA 4KSKC 4NZLB 1N62A 1FMAD 2BVCA 5E6JA 4YXDB 2NS5A 2JXTA 2WXLA 4UDUC 2LGDA 2V3NA 2SAKA 4OVZA 1N5XA 2DZIA 4BKSA 1UNSA 4FA6A 3HVDA 2KWVB 1I42A 4IWPA 1ZOYB 2ZVNA 4HCPB 4FJVB 3VFKA 2MQJA 4PT5A 3KYDD 3Q69A 2A5UA 1SB3C 3AULA 4US8A 2DAFA 1WMHB 4RGOS 3L0WB 2DBYA 1JWAD 4USAA 4MT5A 3ML8A 4TSSA 3ZUNA 5CTRC 3EFCA 2NPTB 2ZZPB 2J0JA 1EWYC 3L08A 1YQBA 1ZUD2 2KQ4X 1H7WA 4KV2A 2L05A 2A4ZA 4MJSA 3TEZA 2BGFA 3ML9A 1GC6A 3CSTA 3PV1A 2IZVB 1WX9A 3ZRCA 4I6LB 1YN4A 3PSEB 3DPDA 3QX1A 2Y5CA 3WALA 3URYA 4NY0A 1WGDA 4LNOA 4C80A 1TS2A 2WXHA 1FEHA 4MM3A 5JZEB 3VQIA 2H89B 3RYTA 5HFYA 1C76A 2FCSA 2D3CA 3QC8B 3WAMA 1UUPA 1XCTL 3MFGA 2GBKA 4YSZB 2K1FA 3KLSX 4K7UA 4OZBA 1C79A 4G50A 4IWOA 4C4VB 5HHDG 2QC8A 4ZYNA 2KN4A 2IDYA 2K39A 2KAJA 3Q8BA 3RCZA 2J42A 3VAWA 1T3QA 2KFKA 4DDID 4AS1A 3IHPC 4F1SA 4TMAB 1WIAA 1WYGA 2V3PA 3TUOA 3BYYB 5H92C 3VUWA 4EEWA 1WM2A 2WDTB 4L2YA 4W9FA 3H7PB 1ISNA 4XZ4A 1XQQA 2NBUA 1HZ6A 3AEGB 5C2TB 1TKYA 2KKCA 4W9EA 4E3CA 1J8CA 1L5PA 2WNMA 5E6PA 2MJEA 3NOBA 2BBCA 5JHBA 3IFWB 4KGTA 1D5ZC 1FD6A 2DYOA 1A70A 5D3DA 1F9JA 2D10A 3CWIA 5T8IA 1IYFA 2DX5B 2J0MA 3NZ3A 2ON8A 3L16A 3P4RB 2AYOB 1XLPA 3DCGA 1YMHE 2WXQA 1OEYA 4HCNB 3I3TB 5LXIB 4W9GA 3KH0A 3VH4B 2G45B 3WCQA 1WY8A 1V8CA 2W82A 2KMCA 3V6EB 3KUDB 1Z2MA 2N9EB 3PS6A 3W5VB 1V5OA 2CKHB 3ZDMC 3TMPB 1PGAA 2Y3AA 4B6WA 1E8WA 1R7SA 2EMSA 3H1UA 3OJ3A 3DVGY 3NUHB 1IUEA 4KIKA 1ZP0B 4C7YA 2FNJB 2FCMA 2B3AA 3ZGZA 5D94A 2D2QA 3DBRB 4K3BA 1EF1A 3RT3B 4IUMB 1HZ5A 2KO3A 4ZRKA 4CHKA 4G11A 3NY5A 4FXCA 2N7JA 1I4GA 1ZXHA 4ANXA 2PIAA 3WAOA 4I6NB 1SSNA 2PEAA 1TS5A 2V4LA 3PLUA 2BQQA 1SE4A 3R8BA 2LRUA 3ZNHB 2MCNB 4WAAA 4TUUA 1WJ4A 2OEDA 4LTUA 3AE3B 1P7EA 2GMIC 1Q5WB 3BY4B 3V05A 5EDSA 4W9CA 2DENB 1P98A 4PK1A 2KVZA 4LNIA 3IG3A 3IVFA 1YNTE 2Z59B 2J0KA 2OJWA 4GXBA 4KSLC 4P16A 1ZE3D 4P6VF 1PGXA 1UGJA 2BT6A 2KDFB 2L76A 2GI9A 1TBEA 2INDC 3Q3NC 4NAWB 4EKUA 2YEPB 1Q0WB 2K0PA 5DPRA 2QSDA 3QHTA 3D32A 4BVUC 1WR6E 3LYYA 3QAQA 4MGIE 4W9IA 4ANVA 4HPPA 3VDZA 2FCNA 3MC9A 2FUG1 3AV8A 2KHWB 1IBXA 3JVZX 4MH8A 1R4NB 2ZPYA 4A20A 4GDLA 5EE1A 3CMMB 4M0WB 3ZNGC 1FXAA 1I4PA 3MJWA 4FULA 2KTRA 2UWQA 3UIOB 3QWZB 1EU4A 1WR1A 3HIZA 2M17A 3LXFA 1WXQA 5C23A 2LHEA
chains in the Genus database with same CATH topology
2JYEA 3B9JA 4HROA 2BYTA 1V1PB 2WQYB 4XWWA 1MVKA 1V97A 2PVOD 3Q8EA 1FO4A 1YJIA 5G5HA 3VR9B 4GDKB 2D5GA 1LO5D 4IOIE 1N63A 2WXIA 4JWUC 2WDQB 1TZOA 4A90A 4TQ1A 3P4PB 1JW9D 1TKEA 1V1OA 2NTSA 2L83A 1K52A 2DYMA 1FFUA 4Q2JA 1E0ZA 1CJEA 1HEZE 3UI3A 4C7ZA 1QLBB 1FM0D 1NVID 3AN1A 5AUKA 3CIRB 2QIEB 2RMMA 2CJNA 3AM9A 3HVZA 3U7ZA 4IDIA 3AEFB 2OHFA 5GXGB 4L1BA 1RYJA 2LFIA 1I4QA 1QOAA 2M56B 4OZAA 2WU2B 1RFKA 1VDVA 3RPFC 3OWEB 3B2GA 1KLUD 1ET6A 1C4CA 3IT4B 1AW7A 3AECB 1ZDVA 2WXNA 4YSYB 1XO3A 1AYFA 1AN8A 4YTMB 3BK2A 3DWGC 1YN3A 2M19A 1BUIC 4XDDA 1QF6A 2WDRB 3BK1A 2WLBA 4WH4A 2IGHA 2ZW0A 2NTTA 4EE2A 1GTHA 1C78A 1VJKA 3KWVA 4ZRPA 3EGRA 1HA5A 1FIQA 4M0WA 3J9CA 1N60A 1FNVA 4XDCA 4KKIA 4A9AA 2IJ0A 4WURA 2V0GA 1K53A 2WU5B 3BIID 3NVVA 4JX1C 3AE2B 1J7AA 1VZ6A 2ACZB 2JU6X 1YQ4B 1EU3A 1IGCA 1L0XB 1YN5A 2AQ1B 1KLGD 1DOIA 3BVZA 2IPKD 4WWMA 4ARIA 1GT8A 1V1PA 2INPE 1F77A 4NJCA 1QOGA 1WGKA 3NRZA 4NZLB 1N62A 5EE3A 1TS3A 4JE3B 1FMAD 4RF0A 5FKAC 4N58A 2ONQA 4GLSC 5E6JA 4YXDB 2CJOA 2JXTA 1QKZA 2WXLA 1FNWA 1N61A 5C3JB 3FC4A 2Q5WD 4UDUC 4A8XC 1KH0A 1C77A 1K50A 4MM3B 3P63A 4MACA 4RF1A 1WSPA 2NMQA 1UWXA 1OQRA 1E6EB 2WDVB 2V3NA 2Z8LA 1SE3A 1TS4A 2KDMA 2SAKA 1FNUA 4OVZA 4ARCA 1M4VA 1J7CA 3R2TA 1JALA 1N5XA 5TSSA 1UNSA 3HVDA 2R61A 4O1NA 1D5MC 1JWBD 1ZOYB 1VZ7A 4RGTA 2LMCA 5BYQA 1L4DB 1ZDXA 4D2KA 1TYGB 4J3OD 1C4AA 3FAHA 4PT5A 2FE8A 2JX5A 3Q69A 5BYSA 3IAM1 1FCCC 1BMLC 4IKGA 1VRAB 1UWMA 1DYQA 1SB3C 1D5XC 1FXIA 2WXOA 2BS2B 2KACA 4CQNA 4US8A 4R3DA 1CK1A 2EELA 3ABVB 4RGOS 3C8YA 4KKJA 2DBYA 4HKQA 3EUB2 1JWAD 1L6VA 1AWDA 5EE0A 4USAA 4MT5A 3AE9B 4TSSA 1TY2A 2I2YA 1PDXA 3NS1A 1XCQL 3GS2A 1EWYC 3R2IA 5FK9C 1SXTA 1I4RA 1OFFA 1ZUD2 2INNE 3AE6B 2JWUA 2KQ4X 3V3XA 1H7WA 1PUTA 2K9XA 1L4ZB 4JWSC 4ZHOA 3HUIA 1TKGA 3SFEB 1STEA 3TEZA 3MJ5A 1XLOA 3TEXA 1PGBA 1KRHA 2Y5PA 1DOYA 3FILB 3SFDB 3HRDD 4RCOA 4WQMA 1C9FA 1JCKB 2DWQA 1YN4A 3PZ8A 4A55A 1VR9A 1XEEA 2JYTA 2Y5CA 3IXSA 3URYA 4C80A 1TS2A 2WXHA 1FEHA 3TEYA 3VQIA 2H89B 2V4IB 1C76A 5HFYA 3BVGA 3W9CB 2WXPA 1UUPA 1SBBB 3LB8C 1XCTL 3RFZB 3I57A 3MFGA 2QEJC 4ZOHC 2BB6A 2G9HD 4YSZB 1QQRA 3KLSX 4OZCA 2SEBD 1ZPSA 2MH7A 4OZBA 1QOBA 1C79A 1KFYB 3AEDB 2PLPA 3Q8AA 1F2RC 1JRPA 2N9LA 5HHDG 2N9KA 3AE8B 1PFDA 3VRBB 2LGIA 3AE5B 2KN4A 1YJJA 2IDYA 3BWUD 2WXKA 1VLBA 2KAJA 1OQQA 5MPOA 3Q8BA 3NVZA 4DXFA 2J42A 3E9SA 1T3QA 1DOXA 4YTNB 1JROA 1MHXA 2WS3B 1L0VB 5D7GA 3AB5A 4AS1A 2WXMA 2LHEA 4TMAB 4ZHPA 2AQ3B 1F2RI 2E3TA 5I4DA 4OHJA 1WYGA 2V3PA 1NYRA 3TUOA 3BYYB 2JSVX 2J53A 5H92C 1QT9A 1QOFA 1E10A 3P42A 4L2YA 4RH6A 2YEPF 3MHZA 4H2AA 1NENB 2ICIA 3TSSA 1JQ4A 3H8HA 1MPEA 1JMLA 1HZ6A 2HTME 3AEGB 5C2TB 2QMTA 3FILA 1TKYA 2MEKA 2MJ3A 1MI0A 1SJHD 1I4XA 1L5PA 2WNMA 2MJEA 3MP9A 2BBCA 1GOZA 2H88B 4HKZE 3AMZA 2BS3B 1YQ3B 1D4BA 1NEKB 2AX5A 4KGTA 4RGMA 1IGDA 2J52A 2BTEA 1ACCA 1D5ZC 2PVGC 3U4EG 1TJEA 4WIPA 1FD6A 2DYOA 1A70A 5D3DA 3P1MA 2I38A 5EE9A 5D3IB 1J7BA 1Y56A 4C56C 3L4PA 4L23A 1GB4A 1K51A 2PTLA 2GB1A 1JWMD 1FRRA 3AE7B 1CZPA 3CWIA 4XWTA 5T8IA 1P7FA 1D6EC 2LJIA 2DLBA 3IAS1 2LUMA 2ON8A 3NZ3A 2W3SA 3ZJVA 4B0EA 3P4RB 4WAFA 1T6BX 1XXGA 1CQVA 1XLPA 5BYRA 3TEWA 2VZKB 2WXGA 2BS4B 1YMHE 1KTKA 1FRDA 2WXQA 1TY0A 2N0SB 3ZJUA 3NVYA 1SEBD 3T3NA 1GAQB 3U2SC 1SJED 1FFVA 3WCQA 1V8CA 2W82A 1JWSD 4B0MA 2QILA 1HXYD 1GTEA 1XLNA 4KGRA 4XE0A 4YWGG 1L0YB 3W5VB 3VRAB 3W2DA 4YSXB 1VZ8A 3Q8CA 4N59A 1NI3A 2L32A 3ZQ4A 1MHHE 1RM6C 1B1ZA 3MC0B 2WXRA 4HRSA 1F0ZA 5JXVA 3ZYYX 1PGAA 3P4QB 2K3UA 2Y3AA 4LLGM 1R7SA 4HJGE 1L6UA 2LEKA 1KF6B 3GP7A 1T5XD 4A6QA 3AEBB 3NUHB 1IUEA 2L52A 1NYQA 1ZP0B 3BZDB 2FBWB 1Q10A 1RWSA 2W3RA 5G5GA 4C7YA 1EM7A 3IT6B 5BMHA 3ZGZA 3Q8FA 4HEA1 3AEEB 4RNAA 3NVWA 2RDHA 2IGGA 1IBXB 2M0AA 1QILA 1HZ5A 1N5WA 4AQ7A 2RDGA 2TSSA 4GDLB 3W5UB 2IGDA 1H7XA 2XN9C 3CF4A 4FXCA 3AH7A 2N7JA 3U52E 1I4GA 1ZXHA 2PIAA 3VR8B 3ETRA 5HI1A 1SSNA 1TS5A 2WXFA 2BB5A 2B76B 2JZPA 2KMMA 1SE4A 2GRIA 3P4SB 1SE2A 2J4XA 1SIJA 3R8BA 4US9A 4KX6B 3W1SA 4YTPB 3SEBA 2OEDA 3EA6A 1ET9A 1I4HA 4LTUA 3AE3B 1P7EA 3E56A 1GB1A 4N6EB 2HDEA 4RFBA 3V05A 1ENFA 3PZ7A 3AE1B 5BMGA 1I7HA 1YNTE 4KGSA 2BW2A 5BMIA 2PKOA 2VZKD 1C4PA 3O13A 3KQ4A 2PMVA 1ROEA 1ZE3D 2LHDA 4P16A 4P6VF 1PGXA 2QJLA 1UGJA 2BT6A 2XNAC 1E9MA 2MJDA 1BXTA 2K22A 2X38A 1JWUD 4ZYSA 1GPXA 2GI9A 1ZXIA 2ZW1A 2W55A 3DWMA 1E7PB 4NAWB 1WRIA 2CU3A 2YEPB 4JPSA 3N9YC 5HG2A 4TQ0A 3SR6A 2WXJA 2PW9A 2K0PA 2L1AA 4OW0A 2QSDA 3BYTB 3T3OA 2KWDA 1ESFA 5FR3A 1XLQA 2JQRB 3LYYA 2G1EA 4DQOC 1WWTA 4NAMA 2RPVA 2WP9B 2FUG1 5LNK1 3AV8A 3B2FA 2K5PA 4DXGA 5H8YE 4YT0B 1IBXA 3I9V1 4ITKA 1SF0A 4MH8A 3ZJTA 3AE4B 1EWCA 5EE1A 5AUIA 3KWLA 2W54A 4REZA 2EKIA 3BVMA 1FXAA 1XF5L 1I4PA 2E6XA 1HQRD 1EU4A 1FCLA 1PYWD 4ZRQA 4RGNA 3PO0A 1B9RA 3GB1A 4LK0M 2AQ2B 3LXFA 1WXQA 3AEAB 1DGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEE B;  2E3T A;  3B9J A;  4HRO A;  3NVW A;  1JWB D;  1WYG A;  1ZOY B;  1NYR A;  2WQY B;  1V97 A;  2PVO D;  1FO4 A;  1YJI A;  5H92 C;  5G5H A;  3VR9 B;  1QT9 A;  1TYG B;  1N5W A;  3FAH A;  1QOF A;  1N63 A;  4JWU C;  1E10 A;  2JX5 A;  3W5U B;  2WDQ B;  1H7X A;  4FXC A;  3CF4 A;  3P4P B;  3AH7 A;  1JW9 D;  1TKE A;  1JQ4 A;  1NEN B;  1UWM A;  2L83 A;  2PIA A;  1SB3 C;  1FXI A;  2BS2 B;  1FFU A;  3VR8 B;  3ETR A;  1E0Z A;  1CJE A;  4C7Z A;  1QLB B;  1FM0 D;  1NVI D;  2HTM E;  2B76 B;  3AN1 A;  3ABV B;  3AEG B;  3CIR B;  5C2T B;  2KMM A;  2DBY A;  3P4S B;  1TKY A;  2CJN A;  1SIJ A;  2QIE B;  1JWA D;  1L6V A;  1AWD A;  3AM9 A;  4KX6 B;  2MJ3 A;  3EUB 2;  3HVZ A;  4IDI A;  4US9 A;  5EE0 A;  4USA A;  3AEF B;  4YTP B;  1L5P A;  2OHF A;  5GXG B;  3AE9 B;  4C7Y A;  1RYJ A;  1QOA A;  2MJE A;  2M56 B;  4LTU A;  2WU2 B;  3AE3 B;  1RFK A;  1VDV A;  3RPF C;  1PDX A;  4N6E B;  2H88 B;  3B2G A;  3NS1 A;  1EWY C;  3AMZ A;  2BS3 B;  1YQ3 B;  1OFF A;  3AE1 B;  1ZUD 2;  3AE6 B;  3AEC B;  1NEK B;  1I7H A;  2AX5 A;  4US8 A;  1H7W A;  1PUT A;  4YSY B;  1XO3 A;  2K9X A;  1AYF A;  2PKO A;  2PVG C;  4JWS C;  4YTM B;  1TJE A;  3DWG C;  3HUI A;  1A70 A;  1TKG A;  2M19 A;  3P1M A;  3SFE B;  1ROE A;  4ZHO A;  2WDR B;  5EE9 A;  2WLB A;  4P6V F;  1QF6 A;  2QJL A;  2BT6 A;  1J7B A;  1E9M A;  3L4P A;  2MJD A;  2K22 A;  1XLO A;  1GTH A;  1KRH A;  1VJK A;  1GPX A;  1DOY A;  1FRR A;  3AE7 B;  1CZP A;  3SFD B;  1ZXI A;  1E7P B;  2W55 A;  3DWM A;  3HRD D;  1WRI A;  4WQM A;  3CWI A;  2CU3 A;  2DWQ A;  1FIQ A;  3SR6 A;  2Y5C A;  1N60 A;  2W3S A;  4A9A A;  4C80 A;  3P4R B;  5AUK A;  2WU5 B;  3BII D;  1XLQ A;  1XLP A;  2JQR B;  2H89 B;  3NVV A;  4JX1 C;  3AE2 B;  2BS4 B;  1J7A A;  2G1E A;  4ZHP A;  3W9C B;  1WWT A;  2ACZ B;  1YQ4 B;  1FRD A;  2N0S B;  3NVY A;  3LB8 C;  1GAQ B;  1FFV A;  1DOI A;  4ZOH C;  3WCQ A;  1V8C A;  4YSZ B;  4WWM A;  2WP9 B;  3AV8 A;  3B2F A;  2K5P A;  1GT8 A;  2MH7 A;  5H8Y E;  1QOB A;  4YT0 B;  1QOG A;  1GTE A;  1WGK A;  1XLN A;  4ITK A;  1SF0 A;  1KFY B;  3AED B;  3W5V B;  3NRZ A;  3VRA B;  1JRP A;  1N62 A;  5EE3 A;  3AE4 B;  4YSX B;  4N59 A;  1FMA D;  1NI3 A;  5EE1 A;  5AUI A;  3AE8 B;  3KWL A;  1RM6 C;  4N58 A;  4YXD B;  2CJO A;  2W54 A;  1DOX A;  1PFD A;  4HRS A;  1N61 A;  2EKI A;  3VRB B;  5C3J B;  2Q5W D;  3FC4 A;  3AE5 B;  3ZYY X;  1FXA A;  1F0Z A;  1YJJ A;  3P4Q B;  3P63 A;  1VLB A;  5G5G A;  1R7S A;  1L6U A;  1OQR A;  1E6E B;  1KF6 B;  2WDV B;  1OQQ A;  2KAJ A;  2LEK A;  5MPO A;  3NVZ A;  3AEB B;  3PO0 A;  1IUE A;  1B9R A;  2L52 A;  1NYQ A;  1T3Q A;  1ZP0 B;  4YTN B;  2FBW B;  1J7C A;  1JAL A;  1JRO A;  1RWS A;  2WS3 B;  1L0V B;  1N5X A;  2W3R A;  3AB5 A;  3LXF A;  1WXQ A;  3AEA B;  1DGJ A; 
#chains in the Genus database with same CATH topology
 3PRM B;  4HRO A;  2BYT A;  1V1P B;  3X0W A;  4XWW A;  5G5H A;  2WXI A;  5CX3 A;  1P3Q U;  2FAZ A;  3GE3 C;  2V3S A;  5AEK B;  1TKE A;  2L83 A;  4G3X B;  1E0Z A;  1HEZ E;  3UI3 A;  1FM0 D;  3AN1 A;  3CIR B;  3CF6 E;  2CJN A;  4IDI A;  5GXG B;  4L1B A;  1VDV A;  4IC7 B;  2ZNV C;  3B2G A;  2PE6 B;  2MBE A;  2C5L C;  4LJO B;  4X57 B;  4DHZ B;  4GGQ A;  4HJK A;  4XDD A;  2BF8 B;  2WDR B;  3BK1 A;  4WH4 A;  2IYD B;  1C78 A;  5L83 A;  5CHF A;  4NJ7 A;  3PGE A;  3RNG C;  4E74 A;  2XBB C;  1FNV A;  2CHW A;  3C0R B;  2BKR B;  3KVF B;  2NVU I;  4A9A A;  3BII D;  2JT4 B;  3NVV A;  1J7A A;  2WHI A;  3S2A A;  1L0X B;  1NI2 A;  3BVZ A;  4ARI A;  2M4N A;  4ICU A;  2INP E;  2PE9 A;  1IP9 A;  3IBE A;  4JL9 A;  3T9L A;  1WGH A;  2IY0 B;  5AZG A;  4N58 A;  2ONQ A;  2CJO A;  1QKZ A;  1YIW A;  2Q5W D;  1K50 A;  3PZD A;  2FIF A;  4KZ0 A;  1WSP A;  1OQR A;  3L17 A;  1SE3 A;  1TS4 A;  2L0F A;  2BWE S;  1FNU A;  3R2T A;  1JAL A;  5TSS A;  3W1Y A;  2R61 A;  3A9J A;  1L4D B;  4FJZ A;  1C4A A;  3X23 A;  4NPN A;  4AP4 C;  2INC C;  4LDT B;  5KHO A;  1D5X C;  1FXI A;  1UBI A;  2BKF A;  3ZRF A;  4R3D A;  3Q3M C;  4HKQ A;  3QA8 A;  1L6V A;  3UIP B;  1AWD A;  3DBL B;  3AE9 B;  2JVC A;  4DDG D;  1TY2 A;  3OAW A;  2I2Y A;  2IY1 B;  1E8Y A;  2MP2 A;  3NS1 A;  1XCQ L;  3GS2 A;  1LXD A;  1OFF A;  2DZM A;  2INN E;  1LGR A;  3PRZ A;  3V3X A;  4PS3 A;  1PUT A;  1ZKH A;  1C3T A;  4ZHO A;  2CHX A;  1XLO A;  1KRH A;  3SFD B;  4RCO A;  3APF A;  4WQM A;  1JCK B;  4A55 A;  2K8H A;  4WJP A;  3VUY A;  4RMA A;  2LRW A;  4S0R A;  3I63 C;  1J19 A;  3DBR I;  1IPG A;  2LWP A;  2WXP A;  1SBB B;  3ZNZ B;  3RFZ B;  4HXD A;  2JY6 A;  2QEJ C;  4ZOH C;  2G9H D;  3ZO5 B;  2SEB D;  1ZPS A;  2I1J A;  3N30 A;  3ZDT A;  2CHZ A;  3Q8A A;  2PLP A;  1QZE A;  4XYC A;  1RFA A;  4MGY E;  2N9L A;  1WJU A;  1WE6 A;  1RRB A;  1PFD A;  3DHH C;  2LGI A;  2CR5 A;  2JPH A;  3AE5 B;  2N9X A;  3AU4 A;  4LDT D;  3OLM D;  2N4F A;  1WMH A;  3TIX A;  5JHA A;  3NVZ A;  3E9S A;  2ZEQ A;  5E6N A;  1DOX A;  1JRO A;  5D7G A;  3AB5 A;  2WXM A;  1F2R I;  4PS7 A;  2NPT A;  2GBM A;  1QT9 A;  3N32 A;  1GUA B;  1WX7 A;  1QOF A;  3DVN U;  1RLF A;  2UU7 A;  3P42 A;  1E10 A;  2KAN A;  4RH6 A;  2YEP F;  2ZPN A;  3MC8 A;  4MGK E;  1JQ4 A;  1NEN B;  1SIF A;  2ICI A;  3H8H A;  3KUZ A;  4MSQ B;  4RM8 A;  2HTM E;  1MI0 A;  1SJH D;  1I4X A;  1WJN A;  2AWT A;  4RM9 A;  2Z0E B;  1WXV A;  5HKH A;  3A1Q B;  2H88 B;  2MWS B;  1E5W A;  3HM6 X;  4IM3 A;  4DK5 A;  3ZNI D;  1IGD A;  2BTE A;  1ACC A;  1R4N I;  3WAN A;  1YJ1 A;  4W9J A;  4BOZ B;  1S1Q B;  4C56 C;  2XK5 B;  3L4P A;  1MG8 A;  3TL5 A;  2PTL A;  2AEH A;  4EOY A;  1V49 A;  1JWM D;  4A3O A;  1FRR A;  3V61 A;  4C4V A;  2DLB A;  3VXW A;  3ZJV A;  4GSW A;  4BKG A;  4B0E A;  3NHE B;  4WAF A;  2WGS A;  5BYR A;  3TEW A;  4GB9 A;  2BYF A;  1TY0 A;  1WGG A;  1GAQ B;  1SJE D;  5BO4 B;  5DPT A;  2Z0D B;  2QIL A;  1HXY D;  1FXT B;  1GTE A;  3RNA C;  4KGR A;  1L0Y B;  4F7Z A;  1PQS A;  4YSX B;  1VZ8 A;  4N59 A;  1NI3 A;  2FUH B;  3DBH B;  4PS8 A;  1MHH E;  2LJ5 A;  4C00 A;  1B1Z A;  4HRS A;  4K81 A;  2K6Q A;  3H7P A;  3N3K B;  5JXV A;  1KM7 A;  2WYQ A;  2K3U A;  4LLG M;  5G2N A;  4GMV A;  3L54 A;  4HJG E;  2LEK A;  1KF6 B;  4J6I A;  4A6Q A;  5G5G A;  1Q10 A;  1RWS A;  2W3R A;  4AOF A;  5BMH A;  3PHX B;  3Q8F A;  4HEA 1;  3NVW A;  4KZC A;  2KVR A;  4MH0 E;  1Y8R C;  1QIL A;  2O2V A;  4AQ7 A;  2RDG A;  2TSS A;  2LXA A;  3DHG C;  1VD2 A;  2XN9 C;  2MW5 A;  4IM0 A;  2B76 B;  2J4X A;  4W9K A;  4AJW A;  3W1S A;  4YTP B;  1WZ0 A;  3DBS A;  2L00 B;  1ET9 A;  4BBN C;  1I4H A;  3U30 A;  4HPL B;  3E56 A;  1GB1 A;  3VTU A;  4BOS C;  1E90 A;  3DVN V;  3AE1 B;  1HE8 A;  1I7H A;  4KGS A;  2JXX A;  4EZL A;  2LVO A;  2PMV A;  5JH5 C;  1JRU A;  1E9M A;  4ZYS A;  2KDE B;  4HVB A;  2ZW1 A;  2C7M B;  3DWM A;  1E7P B;  1WRI A;  2KZR A;  4BAX A;  1WM3 A;  3SR6 A;  2IO0 B;  4OW0 A;  4WJN A;  3EEC A;  2JRH A;  2EMT A;  1S3S G;  4GIV A;  4ACF A;  1XLQ A;  3V6C B;  4IM2 A;  2YVC A;  4NAM A;  2KOX A;  2M8S A;  3B2F A;  3ZW3 A;  4ITK A;  3NS8 A;  1YD8 U;  5AUI A;  3KWL A;  3A9K B;  2PPH A;  3DBL I;  2MSE D;  3U8Z A;  2W54 A;  2EKI A;  3BVM A;  2BPS A;  2E6X A;  3AI5 A;  1FCL A;  3DVG X;  4RGN A;  2C7N B;  3PO0 A;  1B9R A;  3GB1 A;  4M02 A;  4LK0 M;  4MSM B;  1HTO A;  3DHI C;  2PVO D;  2BYV E;  2D5G A;  1N63 A;  2AL3 A;  2DAJ A;  4B95 A;  3P4P B;  1JW9 D;  2RR9 A;  4WJO A;  4LNN A;  3N1Y C;  4Q2J A;  5AUK A;  2MRP A;  4NAW A;  3SHQ A;  3AM9 A;  1GJZ A;  3U7Z A;  4QAY A;  3Q3F A;  4BKT A;  1RYJ A;  2KDI A;  1I4Q A;  4OZA A;  2WU2 B;  2AL6 A;  2HTH A;  2EKE C;  1XO3 A;  1AN8 A;  3BK2 A;  1QF6 A;  5FR6 A;  2ZW0 A;  1OGW A;  3C19 A;  1GTH A;  1XD3 B;  2FID A;  3JSV B;  2KN5 A;  4XGA B;  2L8J A;  3EGR A;  4HWI B;  3L13 A;  3GOE A;  4M0W A;  4M00 A;  5IAA C;  2WU5 B;  5E6O A;  3RMK C;  2ACZ B;  2VH1 A;  4IWQ A;  3VTV A;  1KLG D;  4AJY B;  2IPK D;  4PYZ A;  1WX8 A;  3V62 A;  1V1P A;  1T0S C;  1QOG A;  1WFY A;  5EE3 A;  1TS3 A;  4ICV A;  5FKA C;  4GLS C;  3DQV A;  1FNW A;  1N61 A;  1FPY A;  3FC4 A;  5DPW A;  3ZTC A;  2NMQ A;  1UH6 A;  2Z8L A;  3A4S C;  2ZCB A;  3UGB B;  2KYW A;  3H7S A;  4ARC A;  4B9K A;  1J7C A;  4ZDV A;  3OJ4 B;  4MEL A;  1JWB D;  3KYC D;  4M8M A;  2V1Y A;  5BYQ A;  1HTQ A;  1ZDX A;  4D2K A;  2MA9 B;  4J3O D;  5IO9 A;  2MX2 A;  2JX5 A;  5BYS A;  3IAM 1;  3WA0 A;  1BML C;  4IKG A;  5KHQ A;  1DYQ A;  2WXO A;  2BS2 B;  2KAC A;  4CQN A;  4CYE A;  5J2R A;  3ABV B;  4W9L A;  3EUB 2;  1F1H A;  4JIO U;  2KC2 A;  2LVP A;  3PHW B;  5EE0 A;  4GN1 A;  2R2O A;  1SXT A;  3KUC B;  2C7H A;  3AE6 B;  2K25 A;  2K9X A;  3A33 B;  1L4Z B;  2CS4 A;  4JWS C;  3AXC A;  3L10 B;  3DBH I;  1T0R C;  1STE A;  4W9H A;  3MJ5 A;  3KW5 B;  5DCN A;  3TEX A;  3FIL B;  3HRD D;  1C9F A;  2JUO A;  2DWQ A;  2MBO A;  1XEE A;  1E7V A;  2JYT A;  1NDD A;  3IXS A;  1OEY J;  2NR2 A;  3N1Z C;  1WZ3 A;  3BVG A;  1P1A A;  2Y5B B;  3LB8 C;  3Q2A C;  3I57 A;  3NZS A;  2OJR A;  2BB6 A;  5D6J B;  4OZC A;  2D07 B;  1QOB A;  1V6E A;  4E71 A;  3UQB A;  1JRP A;  4XX5 A;  2N9K A;  4LNF A;  3VRB B;  1YJJ A;  3BWU D;  2WXK A;  2IO2 B;  1V5T A;  2R2Q A;  2KX3 A;  2ZNV B;  1WYW B;  2WX0 A;  2KTR B;  4HDQ A;  1V9J A;  1UD7 A;  4DXF A;  1L0V B;  3LJ3 A;  2QCZ A;  4ZHP A;  2AQ3 B;  4K7W A;  2KWU B;  2E3T A;  5I4D A;  2DHZ A;  3RUI B;  1NYR A;  3V60 A;  4DWF A;  3B0A A;  4HDO A;  2KWC A;  4H2A A;  4WJQ A;  1WI0 A;  3SU8 X;  2DNF A;  3HM3 A;  1JML A;  3U7D A;  2LAS A;  3MTN B;  2QMT A;  3ZXV A;  4PYU A;  1X1M A;  3EFU A;  2MEK A;  1YX6 B;  2HD5 B;  2BYE A;  3MP9 A;  4NQL B;  2L0T A;  3M3J A;  4M01 A;  4HKZ E;  1LFD A;  3AMZ A;  2BS3 B;  1N6Z A;  1NEK B;  2JWZ A;  4GU2 A;  4EUT A;  2KNB A;  2PVG C;  2IO3 B;  2KTF A;  3P1M A;  2ZCC A;  2I38 A;  5EE9 A;  1D3Z A;  5D3I B;  1J7B A;  3B08 A;  4OVV A;  4L23 A;  1GB4 A;  1K51 A;  4GOC A;  3QIJ A;  3QQ8 B;  4BFR A;  1CZP A;  4FHJ A;  2LJI A;  3GZN I;  4FAD A;  2GBJ A;  1TTN A;  3IAS 1;  2GBR A;  5IP4 D;  2LGS A;  1T6B X;  3PPA A;  2QDF A;  2VZK B;  2BS4 B;  1KTK A;  2N0S B;  1V2Y A;  1P9D U;  2KX0 A;  4B0M A;  4XE0 A;  4YWG G;  4TKN A;  3VHT C;  3PRE A;  3W2D A;  3Q8C A;  3ZQ4 A;  3HK0 A;  1E8X A;  2WXR A;  4TV3 A;  3TCA A;  5IN7 A;  3H6N A;  3ZYY X;  1UZX B;  2VRR B;  3P4Q B;  1F52 A;  3GP7 A;  1T5X D;  2L52 A;  3BZD B;  2FBW B;  2NBV B;  1EM7 A;  3WAP A;  3VH3 B;  4AUQ C;  4NNJ B;  3A1Q A;  1E8Z A;  1WH3 A;  2L3Z A;  2M0A A;  3PRP B;  3W5U B;  1H7X A;  3B1L X;  3U52 E;  1BT0 A;  4I6P A;  2XK5 A;  3ETR A;  2LD9 A;  5HI1 A;  2BB5 A;  1U4A A;  2O6V B;  2JZP A;  3P4S B;  2LGY A;  1SIJ A;  4US9 A;  3FKY A;  1G6J A;  1RAX A;  2N7E A;  3CSF A;  2DYB A;  2LXC A;  4P1B C;  1YOV B;  2RSU A;  4HPM B;  4WQO B;  5BMG A;  1KLV A;  3RI7 C;  2VZK D;  3O13 A;  4LCD E;  3KQ4 A;  3QCA A;  2ASQ A;  2XNA C;  2K22 A;  4JLC A;  1WXS A;  1GPX A;  1ZXI A;  2W55 A;  4MEM A;  2CU3 A;  3N9Y C;  1MG4 A;  5HG2 A;  4TQ0 A;  2WXJ A;  2PW9 A;  3VUX A;  4NQK E;  2REX A;  2BWF A;  3PVL A;  5AZF A;  5FR3 A;  2JQR B;  2G1E A;  3WIM A;  2NBW B;  3DOW A;  4EZJ A;  5IKC M;  2LUE A;  4DXG A;  2K5P A;  5H8Y E;  5LLI A;  2GLS A;  4KDL B;  4YL8 A;  4CO7 A;  3ZJT A;  1EWC A;  2J7Q B;  2LI5 A;  1R4M B;  4K3C A;  5D2M B;  1YX5 B;  2LVQ A;  2C60 A;  2KJ6 A;  3GE8 C;  3RD2 A;  1PYW D;  2M0X A;  3PTF C;  2O6V D;  2N1W A;  2AQ2 B;  1ZW7 A;  3EHV A;  3AEA B;  1DGJ A;  4ANW A;  2JYE A;  3B9J A;  2D3B A;  1MVK A;  3Q8E A;  1FO4 A;  1YJI A;  3VR9 B;  4GDK B;  1LO5 D;  2WDQ B;  4A90 A;  4TQ1 A;  2OOB B;  2DZK A;  3NJT A;  1GC7 A;  3ALB A;  2JRI B;  2NTS A;  1K52 A;  1FFU A;  1CJE A;  1NVI D;  4K1R B;  4WWO A;  1VCB A;  3TBL D;  4ANU A;  4P1C C;  3Q3O C;  3HVZ A;  5LXH A;  3AEF B;  3R66 C;  1WE7 A;  2LFI A;  1QOA A;  3M62 B;  1RFK A;  1WGR A;  1TZ1 A;  3VTW A;  1ET6 A;  1C4C A;  2X8X X;  1AW7 A;  3AEC B;  1ZDV A;  3RUL A;  2MBQ A;  2WXN A;  2RGF A;  4YSY B;  2V9H A;  1AYF A;  3R7Q A;  2YLM A;  2KJR A;  2NTT A;  2RDB C;  4II2 B;  1V80 A;  1L2N A;  2K8B A;  3QAR A;  3KWV A;  4ZRP A;  1HA5 A;  4MGZ E;  3LDZ E;  3A9K A;  2CU1 A;  1UF0 A;  4HK2 A;  2KXJ A;  4WUR A;  2V0G A;  1K53 A;  2JF5 A;  3AE2 B;  2LZ6 A;  4DHJ B;  4DBG A;  1YQ4 B;  2N7D A;  3RNE C;  2KT7 A;  4MJS B;  3DDC B;  2K6D B;  1DOI A;  1WJ6 A;  1OTR B;  2QHO A;  1WF9 A;  2L7R A;  4WWP A;  1F77 A;  4NJC A;  3ZKJ C;  5G55 A;  3NRZ A;  4JE3 B;  4RF0 A;  1WRD B;  4FN2 A;  5C3J B;  4A8X C;  1KH0 A;  4FBJ B;  1C77 A;  4MM3 B;  2KJH B;  3P63 A;  4AWJ A;  4MAC A;  4RF1 A;  3W1S C;  1UWX A;  1E6E B;  2WDV B;  3RNC C;  3RZF A;  2KDM A;  1M4V A;  2XEW A;  4O1N A;  1D5M C;  4BKS D;  1T0Y A;  2IBI B;  1VZ7 A;  4S17 A;  4RGT A;  2LMC A;  3R7R A;  1TYG B;  1OQY A;  2RPQ A;  3FAH A;  2O2V B;  3QJZ A;  2FE8 A;  1FCC C;  1VRA B;  1WXM A;  1UWM A;  3ZXR A;  1T0Q C;  1M94 A;  5IOI A;  3GZN B;  1CK1 A;  2EEL A;  3JSV A;  3C8Y A;  4KKJ A;  3Q14 C;  4EZK A;  4M8N A;  2KFK B;  4MDK E;  2GOW A;  1PDX A;  2W9N A;  3R2I A;  5CHW A;  2KFJ A;  5FK9 C;  1I4R A;  3RNF C;  1E7U A;  2JWU A;  4HLE A;  3H9D A;  4FLH A;  3HUI A;  4DHJ D;  1TKG A;  3SFE B;  2LGX A;  2KQ7 A;  1UGM A;  3APD A;  4JQW C;  1PGB A;  2Y5P A;  1DOY A;  3PZ8 A;  1VR9 A;  2PJH A;  2KLG A;  3TEY A;  2V4I B;  1EUV B;  3W9C B;  4KDI C;  1QQR A;  2MH7 A;  1ZGU B;  1V81 A;  1KFY B;  3AED B;  1F2R C;  3SD5 A;  3AE8 B;  5C1Z A;  1NBF C;  1VLB A;  2I1K A;  1OQQ A;  4EFO A;  5MPO A;  3RNB C;  2K8C A;  3K9O B;  3JW0 X;  4YTN B;  1MHX A;  2WS3 B;  3QK0 A;  5IA7 A;  4WWN A;  4OHJ A;  3ECI A;  1V86 A;  3OG5 A;  2JSV X;  2J53 A;  1SGH A;  4LNK A;  2VH2 A;  2HJ8 A;  2FCQ A;  4JGH B;  3MHZ A;  3TSS A;  1MPE A;  2MLB A;  3FIL A;  4KIK B;  2MJ3 A;  4W9D A;  1AAR A;  1KOT A;  2N9P C;  4DXA B;  1GOZ A;  4N9F 4;  1YQ3 B;  1D4B A;  1UEL A;  3M95 A;  2AX5 A;  4RGM A;  2J52 A;  3U4E G;  1TJE A;  4WIP A;  1J0G A;  1H8C A;  1R4M I;  1Y56 A;  2G4S A;  4OVU A;  1KJT A;  2GB1 A;  1UBQ A;  1C1Y B;  3AE7 B;  5AZH A;  4XWT A;  4ASW C;  1P7F A;  1D6E C;  4ZRJ A;  2MHJ A;  4BZA A;  2LUM A;  2W3S A;  1XXG A;  4FHK A;  1CQV A;  3SDL C;  2WXG A;  2N1V A;  1FRD A;  2G4D B;  3ZJU A;  3NVY A;  1SEB D;  3T3N A;  3P2B A;  3U2S C;  4IW0 A;  1EF5 A;  1FFV A;  3ENE A;  4K7S A;  1JWS D;  3UQA A;  2KD0 A;  5DPS A;  1XLN A;  2KC1 A;  2DZJ A;  3VRA B;  2D3G A;  1Q1O A;  2L32 A;  5TR5 A;  1RM6 C;  2ZVO A;  3MC0 B;  1F0Z A;  2KMA A;  3HHM A;  1L6U A;  3AEB B;  4NJ6 A;  4ZRI A;  1NYQ A;  4II3 B;  2M1M A;  1A5R A;  1P0R A;  3ONS A;  3IT6 B;  1K8R B;  3AEE B;  1MFW A;  2IO1 B;  4RNA A;  2RDH A;  2IGG A;  1IBX B;  2NCN A;  1N5W A;  3R3M A;  4GDL B;  2IGD A;  1GNU A;  3JYU A;  3CF4 A;  3AH7 A;  2D11 A;  3VR8 B;  2WXF A;  2KMM A;  2GRI A;  1SE2 A;  4KX6 B;  3RZW C;  1MJD A;  3SEB A;  3EA6 A;  2KQS A;  4N6E B;  2HDE A;  4RFB A;  5J17 A;  1Z5S B;  1ENF A;  3PZ7 A;  2KDB A;  4LJP B;  1SE9 A;  5L95 C;  2HJ1 A;  4A3P A;  3Q6B A;  2BW2 A;  3N1X C;  4IG7 B;  5BMI A;  3MHS D;  2PKO A;  1C4P A;  4F8C B;  3APC A;  1ROE A;  2HE7 A;  2LHD A;  2QJL A;  1TIF A;  2MJD A;  1BXT A;  2X38 A;  3ZTD A;  1JWU D;  4BBN F;  4KVG B;  2MBH A;  4JPS A;  1WGY A;  2L1A A;  5GMV A;  3NG0 A;  3BYT B;  3N20 C;  3T3O A;  2KWD A;  1ESF A;  2JZ3 B;  3PT2 B;  3T8M A;  4DQO C;  1WWT A;  3TJP A;  1H4R A;  2MBB B;  2RPV A;  3M63 B;  3UF8 A;  2WP9 B;  5LNK 1;  4YT0 B;  2G3Q B;  3I9V 1;  1SF0 A;  2JZZ A;  4DHZ E;  3BIN A;  4G0N B;  3AE4 B;  3O65 B;  1TGZ B;  3I5J C;  4REZ A;  1XF5 L;  1HQR D;  3ZLZ A;  2GBN A;  2O6V A;  2WX1 A;  3VVW B;  4ZRQ A;  1CMX B;  3PLV A;  3K9P B;  4P7I A;  2WQY B;  2UYZ B;  1V97 A;  4IOI E;  4JWU C;  1TZO A;  2KK8 A;  2D3A A;  1V1O A;  2DYM A;  2WWZ A;  4C7Z A;  1QLB B;  2QIE B;  2RMM A;  5J18 A;  1XT9 B;  1LM8 B;  1LQB A;  4FJY A;  3Q3J A;  2OHF A;  3NZU A;  1EO6 A;  2M56 B;  3RPF C;  3OWE B;  3A9J B;  1KLU D;  3IT4 B;  3EC8 A;  3A4R A;  1TT5 B;  3ZVV A;  5CHV C;  4YTM B;  3DWG C;  1YN3 A;  2M19 A;  1BUI C;  2WLB A;  2IGH A;  3AU5 A;  3UIN B;  4EE2 A;  1VJK A;  1FIQ A;  3J9C A;  1N60 A;  4XDC A;  4KKI A;  2MP2 B;  2IJ0 A;  3ZIM A;  4XC2 A;  4URK A;  4JX1 C;  1VZ6 A;  3RN9 C;  2JU6 X;  1WXA A;  1EU3 A;  1GG3 A;  1IGC A;  1L7Y A;  2C9W B;  1YN5 A;  2AQ1 B;  2ZJD A;  2RD0 A;  4WWM A;  1I35 A;  1GT8 A;  2KLC A;  1WGK A;  4GDK A;  4KSK C;  4NZL B;  1N62 A;  1FMA D;  2BVC A;  5E6J A;  4YXD B;  2NS5 A;  2JXT A;  2WXL A;  4UDU C;  2LGD A;  2V3N A;  2SAK A;  4OVZ A;  1N5X A;  2DZI A;  4BKS A;  1UNS A;  4FA6 A;  3HVD A;  2KWV B;  1I42 A;  4IWP A;  1ZOY B;  2ZVN A;  4HCP B;  4FJV B;  3VFK A;  2MQJ A;  4PT5 A;  3KYD D;  3Q69 A;  2A5U A;  1SB3 C;  3AUL A;  4US8 A;  2DAF A;  1WMH B;  4RGO S;  3L0W B;  2DBY A;  1JWA D;  4USA A;  4MT5 A;  3ML8 A;  4TSS A;  3ZUN A;  5CTR C;  3EFC A;  2NPT B;  2ZZP B;  2J0J A;  1EWY C;  3L08 A;  1YQB A;  1ZUD 2;  2KQ4 X;  1H7W A;  4KV2 A;  2L05 A;  2A4Z A;  4MJS A;  3TEZ A;  2BGF A;  3ML9 A;  1GC6 A;  3CST A;  3PV1 A;  2IZV B;  1WX9 A;  3ZRC A;  4I6L B;  1YN4 A;  3PSE B;  3DPD A;  3QX1 A;  2Y5C A;  3WAL A;  3URY A;  4NY0 A;  1WGD A;  4LNO A;  4C80 A;  1TS2 A;  2WXH A;  1FEH A;  4MM3 A;  5JZE B;  3VQI A;  2H89 B;  3RYT A;  5HFY A;  1C76 A;  2FCS A;  2D3C A;  3QC8 B;  3WAM A;  1UUP A;  1XCT L;  3MFG A;  2GBK A;  4YSZ B;  2K1F A;  3KLS X;  4K7U A;  4OZB A;  1C79 A;  4G50 A;  4IWO A;  4C4V B;  5HHD G;  2QC8 A;  4ZYN A;  2KN4 A;  2IDY A;  2K39 A;  2KAJ A;  3Q8B A;  3RCZ A;  2J42 A;  3VAW A;  1T3Q A;  2KFK A;  4DDI D;  4AS1 A;  3IHP C;  4F1S A;  4TMA B;  1WIA A;  1WYG A;  2V3P A;  3TUO A;  3BYY B;  5H92 C;  3VUW A;  4EEW A;  1WM2 A;  2WDT B;  4L2Y A;  4W9F A;  3H7P B;  1ISN A;  4XZ4 A;  1XQQ A;  2NBU A;  1HZ6 A;  3AEG B;  5C2T B;  1TKY A;  2KKC A;  4W9E A;  4E3C A;  1J8C A;  1L5P A;  2WNM A;  5E6P A;  2MJE A;  3NOB A;  2BBC A;  5JHB A;  3IFW B;  4KGT A;  1D5Z C;  1FD6 A;  2DYO A;  1A70 A;  5D3D A;  1F9J A;  2D10 A;  3CWI A;  5T8I A;  1IYF A;  2DX5 B;  2J0M A;  3NZ3 A;  2ON8 A;  3L16 A;  3P4R B;  2AYO B;  1XLP A;  3DCG A;  1YMH E;  2WXQ A;  1OEY A;  4HCN B;  3I3T B;  5LXI B;  4W9G A;  3KH0 A;  3VH4 B;  2G45 B;  3WCQ A;  1WY8 A;  1V8C A;  2W82 A;  2KMC A;  3V6E B;  3KUD B;  1Z2M A;  2N9E B;  3PS6 A;  3W5V B;  1V5O A;  2CKH B;  3ZDM C;  3TMP B;  1PGA A;  2Y3A A;  4B6W A;  1E8W A;  1R7S A;  2EMS A;  3H1U A;  3OJ3 A;  3DVG Y;  3NUH B;  1IUE A;  4KIK A;  1ZP0 B;  4C7Y A;  2FNJ B;  2FCM A;  2B3A A;  3ZGZ A;  5D94 A;  2D2Q A;  3DBR B;  4K3B A;  1EF1 A;  3RT3 B;  4IUM B;  1HZ5 A;  2KO3 A;  4ZRK A;  4CHK A;  4G11 A;  3NY5 A;  4FXC A;  2N7J A;  1I4G A;  1ZXH A;  4ANX A;  2PIA A;  3WAO A;  4I6N B;  1SSN A;  2PEA A;  1TS5 A;  2V4L A;  3PLU A;  2BQQ A;  1SE4 A;  3R8B A;  2LRU A;  3ZNH B;  2MCN B;  4WAA A;  4TUU A;  1WJ4 A;  2OED A;  4LTU A;  3AE3 B;  1P7E A;  2GMI C;  1Q5W B;  3BY4 B;  3V05 A;  5EDS A;  4W9C A;  2DEN B;  1P98 A;  4PK1 A;  2KVZ A;  4LNI A;  3IG3 A;  3IVF A;  1YNT E;  2Z59 B;  2J0K A;  2OJW A;  4GXB A;  4KSL C;  4P16 A;  1ZE3 D;  4P6V F;  1PGX A;  1UGJ A;  2BT6 A;  2KDF B;  2L76 A;  2GI9 A;  1TBE A;  2IND C;  3Q3N C;  4NAW B;  4EKU A;  2YEP B;  1Q0W B;  2K0P A;  5DPR A;  2QSD A;  3QHT A;  3D32 A;  4BVU C;  1WR6 E;  3LYY A;  3QAQ A;  4MGI E;  4W9I A;  4ANV A;  4HPP A;  3VDZ A;  2FCN A;  3MC9 A;  2FUG 1;  3AV8 A;  2KHW B;  1IBX A;  3JVZ X;  4MH8 A;  1R4N B;  2ZPY A;  4A20 A;  4GDL A;  5EE1 A;  3CMM B;  4M0W B;  3ZNG C;  1FXA A;  1I4P A;  3MJW A;  4FUL A;  2KTR A;  2UWQ A;  3UIO B;  3QWZ B;  1EU4 A;  1WR1 A;  3HIZ A;  2M17 A;  3LXF A;  1WXQ A;  5C23 A;  2LHE A; 
#chains in the Genus database with same CATH homology
 2JYE A;  3B9J A;  4HRO A;  2BYT A;  1V1P B;  2WQY B;  4XWW A;  1MVK A;  1V97 A;  2PVO D;  3Q8E A;  1FO4 A;  1YJI A;  5G5H A;  3VR9 B;  4GDK B;  2D5G A;  1LO5 D;  4IOI E;  1N63 A;  2WXI A;  4JWU C;  2WDQ B;  1TZO A;  4A90 A;  4TQ1 A;  3P4P B;  1JW9 D;  1TKE A;  1V1O A;  2NTS A;  2L83 A;  1K52 A;  2DYM A;  1FFU A;  4Q2J A;  1E0Z A;  1CJE A;  1HEZ E;  3UI3 A;  4C7Z A;  1QLB B;  1FM0 D;  1NVI D;  3AN1 A;  5AUK A;  3CIR B;  2QIE B;  2RMM A;  2CJN A;  3AM9 A;  3HVZ A;  3U7Z A;  4IDI A;  3AEF B;  2OHF A;  5GXG B;  4L1B A;  1RYJ A;  2LFI A;  1I4Q A;  1QOA A;  2M56 B;  4OZA A;  2WU2 B;  1RFK A;  1VDV A;  3RPF C;  3OWE B;  3B2G A;  1KLU D;  1ET6 A;  1C4C A;  3IT4 B;  1AW7 A;  3AEC B;  1ZDV A;  2WXN A;  4YSY B;  1XO3 A;  1AYF A;  1AN8 A;  4YTM B;  3BK2 A;  3DWG C;  1YN3 A;  2M19 A;  1BUI C;  4XDD A;  1QF6 A;  2WDR B;  3BK1 A;  2WLB A;  4WH4 A;  2IGH A;  2ZW0 A;  2NTT A;  4EE2 A;  1GTH A;  1C78 A;  1VJK A;  3KWV A;  4ZRP A;  3EGR A;  1HA5 A;  1FIQ A;  4M0W A;  3J9C A;  1N60 A;  1FNV A;  4XDC A;  4KKI A;  4A9A A;  2IJ0 A;  4WUR A;  2V0G A;  1K53 A;  2WU5 B;  3BII D;  3NVV A;  4JX1 C;  3AE2 B;  1J7A A;  1VZ6 A;  2ACZ B;  2JU6 X;  1YQ4 B;  1EU3 A;  1IGC A;  1L0X B;  1YN5 A;  2AQ1 B;  1KLG D;  1DOI A;  3BVZ A;  2IPK D;  4WWM A;  4ARI A;  1GT8 A;  1V1P A;  2INP E;  1F77 A;  4NJC A;  1QOG A;  1WGK A;  3NRZ A;  4NZL B;  1N62 A;  5EE3 A;  1TS3 A;  4JE3 B;  1FMA D;  4RF0 A;  5FKA C;  4N58 A;  2ONQ A;  4GLS C;  5E6J A;  4YXD B;  2CJO A;  2JXT A;  1QKZ A;  2WXL A;  1FNW A;  1N61 A;  5C3J B;  3FC4 A;  2Q5W D;  4UDU C;  4A8X C;  1KH0 A;  1C77 A;  1K50 A;  4MM3 B;  3P63 A;  4MAC A;  4RF1 A;  1WSP A;  2NMQ A;  1UWX A;  1OQR A;  1E6E B;  2WDV B;  2V3N A;  2Z8L A;  1SE3 A;  1TS4 A;  2KDM A;  2SAK A;  1FNU A;  4OVZ A;  4ARC A;  1M4V A;  1J7C A;  3R2T A;  1JAL A;  1N5X A;  5TSS A;  1UNS A;  3HVD A;  2R61 A;  4O1N A;  1D5M C;  1JWB D;  1ZOY B;  1VZ7 A;  4RGT A;  2LMC A;  5BYQ A;  1L4D B;  1ZDX A;  4D2K A;  1TYG B;  4J3O D;  1C4A A;  3FAH A;  4PT5 A;  2FE8 A;  2JX5 A;  3Q69 A;  5BYS A;  3IAM 1;  1FCC C;  1BML C;  4IKG A;  1VRA B;  1UWM A;  1DYQ A;  1SB3 C;  1D5X C;  1FXI A;  2WXO A;  2BS2 B;  2KAC A;  4CQN A;  4US8 A;  4R3D A;  1CK1 A;  2EEL A;  3ABV B;  4RGO S;  3C8Y A;  4KKJ A;  2DBY A;  4HKQ A;  3EUB 2;  1JWA D;  1L6V A;  1AWD A;  5EE0 A;  4USA A;  4MT5 A;  3AE9 B;  4TSS A;  1TY2 A;  2I2Y A;  1PDX A;  3NS1 A;  1XCQ L;  3GS2 A;  1EWY C;  3R2I A;  5FK9 C;  1SXT A;  1I4R A;  1OFF A;  1ZUD 2;  2INN E;  3AE6 B;  2JWU A;  2KQ4 X;  3V3X A;  1H7W A;  1PUT A;  2K9X A;  1L4Z B;  4JWS C;  4ZHO A;  3HUI A;  1TKG A;  3SFE B;  1STE A;  3TEZ A;  3MJ5 A;  1XLO A;  3TEX A;  1PGB A;  1KRH A;  2Y5P A;  1DOY A;  3FIL B;  3SFD B;  3HRD D;  4RCO A;  4WQM A;  1C9F A;  1JCK B;  2DWQ A;  1YN4 A;  3PZ8 A;  4A55 A;  1VR9 A;  1XEE A;  2JYT A;  2Y5C A;  3IXS A;  3URY A;  4C80 A;  1TS2 A;  2WXH A;  1FEH A;  3TEY A;  3VQI A;  2H89 B;  2V4I B;  1C76 A;  5HFY A;  3BVG A;  3W9C B;  2WXP A;  1UUP A;  1SBB B;  3LB8 C;  1XCT L;  3RFZ B;  3I57 A;  3MFG A;  2QEJ C;  4ZOH C;  2BB6 A;  2G9H D;  4YSZ B;  1QQR A;  3KLS X;  4OZC A;  2SEB D;  1ZPS A;  2MH7 A;  4OZB A;  1QOB A;  1C79 A;  1KFY B;  3AED B;  2PLP A;  3Q8A A;  1F2R C;  1JRP A;  2N9L A;  5HHD G;  2N9K A;  3AE8 B;  1PFD A;  3VRB B;  2LGI A;  3AE5 B;  2KN4 A;  1YJJ A;  2IDY A;  3BWU D;  2WXK A;  1VLB A;  2KAJ A;  1OQQ A;  5MPO A;  3Q8B A;  3NVZ A;  4DXF A;  2J42 A;  3E9S A;  1T3Q A;  1DOX A;  4YTN B;  1JRO A;  1MHX A;  2WS3 B;  1L0V B;  5D7G A;  3AB5 A;  4AS1 A;  2WXM A;  2LHE A;  4TMA B;  4ZHP A;  2AQ3 B;  1F2R I;  2E3T A;  5I4D A;  4OHJ A;  1WYG A;  2V3P A;  1NYR A;  3TUO A;  3BYY B;  2JSV X;  2J53 A;  5H92 C;  1QT9 A;  1QOF A;  1E10 A;  3P42 A;  4L2Y A;  4RH6 A;  2YEP F;  3MHZ A;  4H2A A;  1NEN B;  2ICI A;  3TSS A;  1JQ4 A;  3H8H A;  1MPE A;  1JML A;  1HZ6 A;  2HTM E;  3AEG B;  5C2T B;  2QMT A;  3FIL A;  1TKY A;  2MEK A;  2MJ3 A;  1MI0 A;  1SJH D;  1I4X A;  1L5P A;  2WNM A;  2MJE A;  3MP9 A;  2BBC A;  1GOZ A;  2H88 B;  4HKZ E;  3AMZ A;  2BS3 B;  1YQ3 B;  1D4B A;  1NEK B;  2AX5 A;  4KGT A;  4RGM A;  1IGD A;  2J52 A;  2BTE A;  1ACC A;  1D5Z C;  2PVG C;  3U4E G;  1TJE A;  4WIP A;  1FD6 A;  2DYO A;  1A70 A;  5D3D A;  3P1M A;  2I38 A;  5EE9 A;  5D3I B;  1J7B A;  1Y56 A;  4C56 C;  3L4P A;  4L23 A;  1GB4 A;  1K51 A;  2PTL A;  2GB1 A;  1JWM D;  1FRR A;  3AE7 B;  1CZP A;  3CWI A;  4XWT A;  5T8I A;  1P7F A;  1D6E C;  2LJI A;  2DLB A;  3IAS 1;  2LUM A;  2ON8 A;  3NZ3 A;  2W3S A;  3ZJV A;  4B0E A;  3P4R B;  4WAF A;  1T6B X;  1XXG A;  1CQV A;  1XLP A;  5BYR A;  3TEW A;  2VZK B;  2WXG A;  2BS4 B;  1YMH E;  1KTK A;  1FRD A;  2WXQ A;  1TY0 A;  2N0S B;  3ZJU A;  3NVY A;  1SEB D;  3T3N A;  1GAQ B;  3U2S C;  1SJE D;  1FFV A;  3WCQ A;  1V8C A;  2W82 A;  1JWS D;  4B0M A;  2QIL A;  1HXY D;  1GTE A;  1XLN A;  4KGR A;  4XE0 A;  4YWG G;  1L0Y B;  3W5V B;  3VRA B;  3W2D A;  4YSX B;  1VZ8 A;  3Q8C A;  4N59 A;  1NI3 A;  2L32 A;  3ZQ4 A;  1MHH E;  1RM6 C;  1B1Z A;  3MC0 B;  2WXR A;  4HRS A;  1F0Z A;  5JXV A;  3ZYY X;  1PGA A;  3P4Q B;  2K3U A;  2Y3A A;  4LLG M;  1R7S A;  4HJG E;  1L6U A;  2LEK A;  1KF6 B;  3GP7 A;  1T5X D;  4A6Q A;  3AEB B;  3NUH B;  1IUE A;  2L52 A;  1NYQ A;  1ZP0 B;  3BZD B;  2FBW B;  1Q10 A;  1RWS A;  2W3R A;  5G5G A;  4C7Y A;  1EM7 A;  3IT6 B;  5BMH A;  3ZGZ A;  3Q8F A;  4HEA 1;  3AEE B;  4RNA A;  3NVW A;  2RDH A;  2IGG A;  1IBX B;  2M0A A;  1QIL A;  1HZ5 A;  1N5W A;  4AQ7 A;  2RDG A;  2TSS A;  4GDL B;  3W5U B;  2IGD A;  1H7X A;  2XN9 C;  3CF4 A;  4FXC A;  3AH7 A;  2N7J A;  3U52 E;  1I4G A;  1ZXH A;  2PIA A;  3VR8 B;  3ETR A;  5HI1 A;  1SSN A;  1TS5 A;  2WXF A;  2BB5 A;  2B76 B;  2JZP A;  2KMM A;  1SE4 A;  2GRI A;  3P4S B;  1SE2 A;  2J4X A;  1SIJ A;  3R8B A;  4US9 A;  4KX6 B;  3W1S A;  4YTP B;  3SEB A;  2OED A;  3EA6 A;  1ET9 A;  1I4H A;  4LTU A;  3AE3 B;  1P7E A;  3E56 A;  1GB1 A;  4N6E B;  2HDE A;  4RFB A;  3V05 A;  1ENF A;  3PZ7 A;  3AE1 B;  5BMG A;  1I7H A;  1YNT E;  4KGS A;  2BW2 A;  5BMI A;  2PKO A;  2VZK D;  1C4P A;  3O13 A;  3KQ4 A;  2PMV A;  1ROE A;  1ZE3 D;  2LHD A;  4P16 A;  4P6V F;  1PGX A;  2QJL A;  1UGJ A;  2BT6 A;  2XNA C;  1E9M A;  2MJD A;  1BXT A;  2K22 A;  2X38 A;  1JWU D;  4ZYS A;  1GPX A;  2GI9 A;  1ZXI A;  2ZW1 A;  2W55 A;  3DWM A;  1E7P B;  4NAW B;  1WRI A;  2CU3 A;  2YEP B;  4JPS A;  3N9Y C;  5HG2 A;  4TQ0 A;  3SR6 A;  2WXJ A;  2PW9 A;  2K0P A;  2L1A A;  4OW0 A;  2QSD A;  3BYT B;  3T3O A;  2KWD A;  1ESF A;  5FR3 A;  1XLQ A;  2JQR B;  3LYY A;  2G1E A;  4DQO C;  1WWT A;  4NAM A;  2RPV A;  2WP9 B;  2FUG 1;  5LNK 1;  3AV8 A;  3B2F A;  2K5P A;  4DXG A;  5H8Y E;  4YT0 B;  1IBX A;  3I9V 1;  4ITK A;  1SF0 A;  4MH8 A;  3ZJT A;  3AE4 B;  1EWC A;  5EE1 A;  5AUI A;  3KWL A;  2W54 A;  4REZ A;  2EKI A;  3BVM A;  1FXA A;  1XF5 L;  1I4P A;  2E6X A;  1HQR D;  1EU4 A;  1FCL A;  1PYW D;  4ZRQ A;  4RGN A;  3PO0 A;  1B9R A;  3GB1 A;  4LK0 M;  2AQ2 B;  3LXF A;  1WXQ A;  3AEA B;  1DGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...