5HFYA

Backbone modifications in the protein gb1 helix: beta-2-ala24, beta-3-lys28, beta-3-lys31, beta-3-asn35
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Immunoglobulin G-binding protein G
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
total genus 12
structure length 52
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hfyA00
4HJGE 1MVKA 2N9KA 2KN4A 5HI1A 4IKGA 1PGXA 2LGIA 1F2RC 1GB1A 2PW9A 2QMTA 2LHDA 1IGCA 1K52A 4KGSA 1K51A 5BMIA 2IGDA 2GI9A 4OZBA 2JZPA 4KGTA 2K0PA 5HG2A 2EELA 1KH0A 1D4BA 1YMHE 1PGAA 2N7JA 2NMQA 1MHHE 2PLPA 2IGHA 2PTLA 1IBXB 1XF5L 2ON8A 2GB1A 1IBXA 1JMLA 4WH4A 2ZW0A 4OZAA 1MHXA 1P7FA 2RPVA 1FCCC 4OZCA 2OEDA 3UI3A 1YNTE 2KACA 3FILA 2QSDA 1K53A 4GLSC 1HZ6A 5HHDG 1Q10A 4IOIE 5BMHA 1PGBA 2KWDA 1P7EA 5HFYA 1EM7A 2RMMA 2N9LA 2IGGA 1K50A 3MP9A 1MPEA 2ONQA 2ZW1A 1MI0A 4D2KA 2I2YA 1GB4A 3FILB 1XCQL 2KQ4X 2JXTA 4MACA 2JU6X 1HEZE 1IGDA 1HZ5A 1C9FA 1XCTL 2J53A 2JSVX 1FD6A 5JXVA 3GB1A 2JWUA 4HKZE 4KGRA 1FCLA 1F2RI 2LHEA 1UWXA 2LUMA 1ZXHA 2J52A 2KDMA 3V3XA 1QKZA 2I38A 5BMGA
chains in the Genus database with same CATH superfamily
4I6PA 2FAZA 4HJGE 1UELA 4KKIA 1K8RB 3PTFC 3AM9A 2AL3A 2KWCA 4IKGA 4RFBA 4LK0M 4IWOA 3I5JC 2KDIA 5J17A 3EGRA 4FJVB 2WS3B 3W5UB 4RM9A 2KKCA 1N60A 1V81A 4QAYA 1ET6A 2QEJC 3QQ8B 4RM8A 3UIPB 1WGGA 3QC8B 1DYQA 3FC4A 1PGAA 2PVGC 2INCC 3SU8X 5CHWA 2KFKB 2NVUI 4M00A 2V0GA 3IVFA 4HROA 2GB1A 3T3NA 4N59A 4MH8A 3VTUA 3KVFB 1IBXA 2A5UA 4HLEA 1EUVB 1KOTA 2GBJA 4E71A 1Q5WB 1ZGUB 3ENEA 5BYQA 2WXKA 3BVMA 3KH0A 4GDLA 1SE2A 1C1YB 4W9EA 3B2GA 2Y5PA 1WFYA 1FRDA 2IY1B 4IWQA 2DZJA 4HXDA 3ZTDA 4OVZA 1G6JA 1VJKA 3VH4B 1EU4A 3ZRFA 4WWNA 4KIKB 4EKUA 2N9PC 1M94A 1TT5B 2V4LA 4LNIA 4NPNA 1CJEA 4MSQB 3WAOA 1OQYA 5C3JB 1C79A 3W1SA 1QILA 2GLSA 2EKIA 3R7RA 2HTME 3N3KB 1E7VA 2D3CA 2KYWA 4RCOA 3MTNB 2KJRA 4C56C 3WAPA 1HEZE 1C9FA 2JX5A 2J53A 2G4DB 1ZW7A 3U52E 1CK1A 2ZPNA 1EWYC 3E56A 2HTHA 4JGHB 4RGMA 3SDLC 4S0RA 1C76A 1MFWA 2BYVE 4K81A 2DWQA 1C4CA 1TS4A 5L83A 4LNOA 4AQ7A 2L05A 4X57B 2DX5B 3PPAA 4MJSA 1ENFA 4HKQA 4DBGA 2MP2B 1PGXA 2CU1A 4RF0A 3AE6B 5D3DA 1WGHA 3AE5B 2K6DB 2V4IB 4KGSA 2W9NA 4F8CB 4OHJA 1GC6A 4JIOU 3OG5A 2C9WB 3VR8B 4US8A 1B9RA 2WXOA 3DWGC 4PYUA 3RNGC 1WM2A 3APFA 3BVZA 2PLPA 5G2NA 1FFUA 2AQ1B 4ICVA 3JSVA 3W1SC 1WX8A 1HTQA 3VQIA 2AX5A 3B08A 3A1QB 3ZNID 1XXGA 3AH7A 3A4SC 4MGIE 3VVWB 1YJIA 1XLQA 1AN8A 1HZ6A 3AEGB 4M01A 2JY6A 4DHJB 1WGYA 2WDTB 2JT4B 3SFEB 5TSSA 1WJ4A 2PEAA 3ETRA 3QAQA 2V3PA 2BKFA 2ONQA 4K7SA 1NVID 4D2KA 1XEEA 4W9GA 1J8CA 2M8SA 3Q3MC 1V8CA 1X1MA 2XK5A 3AB5A 2N4FA 5FK9C 2GBMA 2LEKA 5JXVA 1FFVA 2KVZA 2ZCCA 2NBUA 2WHIA 3NY5A 3PRPB 3AE8B 1C4PA 4FXCA 4MH0E 2MBHA 2LZ6A 4JQWC 3AULA 4AJWA 1ZOYB 4RGNA 2HD5B 4TQ1A 4JE3B 1ZP0B 4FULA 5IP4D 5BYRA 3ZXRA 3AEEB 2BWES 3VTWA 4E3CA 2K9XA 4WJPA 2DYOA 2MSED 3B1LX 1L2NA 2Z8LA 3DVNV 4KKJA 4IG7B 3T8MA 4CQNA 1WYGA 3AXCA 1AYFA 1FXAA 3AMZA 4EUTA 1D5MC 1T0SC 2QILA 5HG2A 3BWUD 4WJNA 4ANUA 2NMQA 1PQSA 3VHTC 5E6NA 1L4ZB 1XQQA 4HK2A 4DHZB 3VTVA 3AE3B 1R4MB 3L16A 2KK8A 4A3OA 1YX6B 1IPGA 4XYCA 1WMHB 1WE6A 4BBNF 1TS5A 4IW0A 1YN5A 1EM7A 3U2SC 5GMVA 1FRRA 4ACFA 3NOBA 1YN4A 2MX2A 2C7HA 2ZW1A 2G45B 3A33B 1EU3A 3I3TB 1L6VA 1V49A 2AQ3B 4ANXA 4XDCA 1E9MA 4YT0B 4NNJB 2VRRB 1Q0WB 3QK0A 4JWUC 1QZEA 4W9KA 2KMMA 2BB6A 2J42A 3V60A 2XBBC 1L5PA 1WE7A 2I38A 3AECB 2WX1A 2GBNA 4MGKE 3P63A 1JWBD 4GDKA 1F1HA 2A4ZA 1KRHA 3ZTCA 3VRAB 3ZYYX 1JCKB 3U4EG 2MJEA 1WM3A 1QT9A 3CSTA 3KWVA 4KZCA 3SR6A 4TUUA 2ZNVC 2JYEA 3AV8A 1V6EA 2DBYA 2KNBA 1L6UA 2QJLA 2L32A 4FJZA 3AE2B 4TV3A 3TEYA 1YX5B 1WX7A 4II2B 4DDGD 3RPFC 1WZ0A 1TZ1A 2IO1B 1XF5L 3ABVB 4RNAA 3FKYA 2YLMA 3EUB2 2VH2A 1FEHA 3HHMA 1V1PB 4MDKE 2EKEC 3DVGX 3ZO5B 1P98A 2KDBA 1WXAA 3BZDB 1QOGA 5HHDG 2Y5CA 2KC2A 2KXJA 2L52A 4ZDVA 4DK5A 4EZJA 5JHAA 1MPEA 2JQRB 4W9LA 4HDQA 3EFCA 3RUIB 3FILB 4MM3A 4O1NA 4RMAA 4KZ0A 5JZEB 3NVYA 2C7MB 3HVDA 4YSYB 3QX1A 1KTKA 1FXIA 3IXSA 5CX3A 2XNAC 3OJ3A 2PPHA 3PRZA 1MG4A 2WXRA 3EC8A 2Q5WD 4DDID 3AE7B 1UBIA 1N5WA 3N1YC 1KFYB 3L13A 2NS5A 2GOWA 2KFKA 3ZNGC 4MSMB 2D11A 3UQBA 2QDFA 1TIFA 3TL5A 1V1OA 1SE9A 2ICIA 3ZIMA 3ZQ4A 5D6JB 2QC8A 2LRUA 1DOXA 4OZBA 4TQ0A 4G0NB 2O2VA 1FO4A 1ZKHA 1I42A 3U7ZA 2UWQA 1YMHE 3QARA 4GN1A 5LXIB 3P4QB 4LJPB 2PTLA 3RZWC 1D6EC 4KIKA 2RSUA 1C4AA 1JMLA 5EE1A 2IO3B 4OZCA 4W9CA 4W9IA 2OOBB 5EDSA 2N1WA 4J6IA 1D3ZA 4RGTA 2WX0A 4A90A 1C78A 2QSDA 2L0TA 1QF6A 4GLSC 1JQ4A 3TBLD 3RNAC 1Q10A 2JRHA 1NBFC 2FNJB 3KWLA 1VZ6A 3DHIC 2X38A 1GJZA 3DDCB 1C77A 2JVCA 3PGEA 2PE6B 4ZRPA 3VFKA 4GOCA 4C00A 1GC7A 1VR9A 3N30A 2WXHA 1P0RA 2INNE 4G11A 5D94A 3ZGZA 2MP2A 4DWFA 3TEXA 3VDZA 1R4MI 2MBBB 1PDXA 3PV1A 3V3XA 4LNKA 1WGDA 2D3AA 4KVGB 2ZJDA 1MVKA 2IZVB 4H2AA 5AUKA 3QIJA 3PLVA 3W1YA 4HPLB 3A9JB 2J0JA 1YOVB 4WIPA 1TGZB 4K7WA 4JWSC 1TKEA 3NS8A 3VUWA 4R3DA 3OWEB 4ARCA 3NS1A 3RCZA 5T8IA 4EZKA 1GNUA 3SHQA 5HKHA 4B6WA 2L8JA 3ALBA 3A1QA 1SSNA 2QHOA 4WQOB 3DHHC 1Z2MA 2BYTA 1JRUA 1XT9B 3OLMD 4K7UA 1HE8A 4M8MA 4WURA 4M02A 1E8ZA 2RPVA 3CF6E 1FCCC 2JUOA 3IBEA 3QCAA 2YVCA 4HCNB 4C4VB 2HJ1A 3R66C 3UI3A 1GPXA 1V80A 3BINA 1LO5D 3MHZA 3OAWA 3RYTA 2KANA 2V9HA 2WXJA 1ROEA 2B76B 2KWUB 1BUIC 3NVVA 3MC8A 4P16A 1ZDVA 4IOIE 5BMHA 1V2YA 4GU2A 3ZKJC 2Z0DB 2RR9A 3WIMA 2LVPA 2IY0B 4YTPB 1SGHA 3Q69A 2WXIA 1LM8B 4AWJA 2WU2B 1ZE3D 4ZRJA 2MJ3A 4BZAA 1TJEA 1OQQA 1WJUA 3IAS1 1WZ3A 2FIFA 3LDZE 1SXTA 2NTTA 1J7BA 2QIEB 1OEYA 2M0XA 1SB3C 5IA7A 2LGXA 1KM7A 1UD7A 3ZJUA 5EE3A 3IT4B 3AU5A 2D3BA 1PUTA 1YJ1A 2DZKA 2IO2B 2CJNA 4NQKE 4L1BA 1RWSA 2LXCA 1OTRB 4LJOB 4EFOA 3L0WB 3W2DA 1ESFA 4IUMB 5J2RA 1V5OA 4DXAB 4M0WB 1YQBA 2WXGA 1E10A 1FMAD 4GMVA 2TSSA 5D2MB 1WRIA 1YJJA 2MBQA 4HDOA 4A9AA 2K25A 1WMHA 2D10A 2WDQB 3QHTA 4TSSA 2D2QA 3BYYB 3JW0X 1U4AA 4YTMB 4ZYSA 1I4PA 3RZFA 4K3BA 1AARA 5TR5A 3V05A 4BVUC 1N63A 1YNTE 2KTRA 3Q3OC 5IO9A 4BAXA 2KT7A 2MBEA 2EMSA 3Q8FA 2KWDA 1JWSD 3DBLI 1S1QB 2J4XA 2WDVB 3KW5B 2LI5A 1R4NB 1STEA 1V9JA 2LGYA 2CJOA 2H89B 3UGBB 4C80A 3A9KA 4FHJA 3C19A 4AUQC 4C7ZA 1I7HA 4HPPA 1SIJA 3TUOA 3ZJVA 1SE3A 4W9DA 1DOYA 3GB1A 1TY0A 3NVZA 1ISNA 1UGJA 3MFGA 5CHFA 1SE4A 3L08A 1YIWA 4S17A 1KLVA 1VDVA 2BT6A 1OGWA 4N6EB 2JYTA 3H9DA 2NPTA 4FBJB 4DXGA 1SJHD 2LMCA 4F7ZA 1OEYJ 2LHDA 4JX1C 4P1CC 2L83A 3I9V1 3T3OA 4KSLC 2O6VD 1I4RA 1ZDXA 3K9PB 2EELA 4LLGM 3TIXA 1D4BA 3CIRB 1L0VB 4BKSD 2WXLA 2J0KA 1IBXB 4BKGA 4NJ6A 4M8NA 1SIFA 1OQRA 5JHBA 2M19A 1T0YA 2LJIA 3Q8AA 2K8HA 2N7DA 3S2AA 2YEPB 3FILA 2R2QA 2FBWB 3V6EB 3RT3B 2N1VA 3M95A 2KHWB 1J19A 2BB5A 2MH7A 1UNSA 1E8YA 3KQ4A 1QOBA 1P1AA 2I2YA 3TCAA 4XX5A 2MQJA 4XWTA 3TSSA 1P9DU 2KQ4X 2JXTA 3RNEC 3Q3NC 2L3ZA 2CKHB 1HZ5A 2FIDA 4ZRKA 2QCZA 3RMKC 2AL6A 2PKOA 3CSFA 1F2RI 2WWZA 3APCA 2LGDA 4E74A 3KUCB 2J52A 2KDMA 2HDEA 4RH6A 3E9SA 3WA0A 3M63B 3IHPC 2I1JA 2ZPYA 3JVZX 2I1KA 2LGIA 2LUEA 2DYBA 5JH5C 3VR9B 1F0ZA 4AOFA 1K51A 4P1BC 4NAWA 2PJHA 3DOWA 3UINB 1KH0A 4PT5A 3PZ8A 2MA9B 3KUZA 5C1ZA 2L1AA 4WQMA 4YSZB 1SEBD 2IGHA 1WXMA 1RRBA 3JSVB 5G55A 2FCSA 2R61A 5IAAC 1AW7A 3Q8CA 1P7FA 1QQRA 3I57A 4JPSA 2OEDA 3PSEB 4WWOA 3N32A 4ZHOA 3LYYA 3HVZA 2RGFA 3ZW3A 2RDHA 4IM0A 4CO7A 2G3QB 3N1ZC 2LASA 4NQLB 4IDIA 5AUIA 3UQAA 1TZOA 1ET9A 2W3RA 4DXFA 2RMMA 3AE1B 4FHKA 4RGOS 1E0ZA 2AEHA 3PT2B 3B2FA 4GXBA 2PVOD 4L2YA 4P7IA 3NVWA 2IJ0A 2KMAA 1IGDA 3U30A 1TY2A 4MELA 3A9JA 2KN5A 2ZVOA 4AJYB 1N6ZA 3PREA 2C60A 3Q8BA 3DQVA 1JW9D 2LHEA 4WJOA 2LVQA 5AZFA 4FLHA 1UWMA 2KLCA 3OJ4B 1JWMD 3W9CB 1SJED 1KLUD 3GS2A 3AU4A 3BVGA 4ZRQA 1E7UA 5DPWA 3BK1A 3MJ5A 2WQYB 2FCQA 2XEWA 1WJ6A 2PW9A 2H88B 4YXDB 1K52A 2DAJA 1Z5SB 5CTRC 1ZXIA 2IGDA 4GIVA 1CMXB 2K8BA 1DOIA 1R4NI 5DPRA 1KJTA 3PHWB 2N9EB 1QOAA 4F1SA 2MWSB 4P6VF 1WYWB 3J9CA 1WSPA 3SEBA 3DVGY 3QA8A 4I6NB 1I35A 1JRPA 1RYJA 2BW2A 4BBNC 4HPMB 3BYTB 4A55A 2ZNVB 3JYUA 4MGYE 4URKA 2WDRB 1EF5A 1EWCA 1I4XA 2PMVA 3KUDB 2OHFA 2BPSA 1FNUA 2JZ3B 1HQRD 1N62A 2E6XA 2BKRB 3ZRCA 2BVCA 1N61A 1AWDA 4WAAA 5D3IB 2KDFB 2KOXA 3R8BA 5HFYA 3QJZA 3W5VB 1T3QA 1HXYD 2PIAA 3DBRB 2O6VB 1YQ3B 2CHWA 3ZNHB 2C7NB 4MACA 1XLNA 3H7PB 4HVBA 2K8CA 4B95A 4B0EA 2DHZA 2KVRA 3RFZB 4JLCA 4KGRA 3N20C 1FCLA 1VD2A 4NZLB 1TS2A 1ZPSA 4IWPA 2EMTA 5KHOA 3L10B 5G5HA 2W82A 3EA6A 1D5XC 2MW5A 2JXXA 5LLIA 2GBRA 4DHZE 4GDKB 3DBSA 3R3MA 3NZSA 5HI1A 4YSXB 3NUHB 1GUAB 4A3PA 1NDDA 4FN2A 2KJHB 3WANA 4PK1A 1L0YB 2IBIB 3AN1A 3TMPB 4BOZB 2DLBA 3LJ3A 5BMIA 2BTEA 3P42A 2L7RA 1WIAA 3NRZA 1DGJA 1E90A 3H7SA 2N7EA 3L17A 2JZPA 1YN3A 3AE9B 3CWIA 1I4HA 4EEWA 1C3TA 3R2IA 2KZRA 3PVLA 2WP9B 4FA6A 2ACZB 2SAKA 3EFUA 1RM6C 5IKCM 3VXWA 2Z0EB 3I63C 1A5RA 3IG3A 1UGMA 5DPTA 3ZDMC 2M56B 4II3B 1D5ZC 2FCNA 3A4RA 3AI5A 3SFDB 2LJ5A 2KO3A 5J18A 2M4NA 4MM3B 5E6PA 3RI7C 1MI0A 3NG0A 4K3CA 1XCQL 4IM2A 3ONSA 1R7SA 2BQQA 1V86A 4EOYA 1XCTL 3V61A 3AEBB 1HA5A 1XLPA 4UDUC 3NZUA 4MGZE 2KQ7A 2RPQA 2KC1A 2G9HD 4XC2A 2LUMA 2VZKD 4LTUA 4KX6B 3V62A 4FADA 2DAFA 4C7YA 4BOSC 5IOIA 3MHSD 3H8HA 1JWAD 2JF5A 2WXFA 1WXQA 4KSKC 4YTNB 1IGCA 2IDYA 3B0AA 2CU3A 2N9XA 1SBBB 1UBQA 2KD0A 1LFDA 3P4PB 2DYMA 3N9YC 2AYOB 3L54A 1A70A 2GI9A 2O2VB 3PS6A 3VH3B 4G50A 1FPYA 4ANVA 1KF6B 1B1ZA 4WWMA 4ZOHC 4HRSA 4IC7B 3ZLZA 2WGSA 3Q3JA 1TYGB 2JWZA 3NZ3A 3LB8C 1MHXA 3PO0A 2KLGA 1JWUD 3TEZA 3BK2A 2NR2A 4K1RB 3WCQA 2KACA 4AP4C 1RFAA 1K53A 2NBWB 3M3JA 3VRBB 3K9OB 4W9FA 2E3TA 1P7EA 1T0RC 4ITKA 2N9LA 2BS3B 3R7QA 1WY8A 1WXVA 2Y3AA 2M1MA 2INDC 2GMIC 4KDLB 1GB4A 3GZNB 1ZUD2 2CHZA 2ZEQA 2KWVB 4AS1A 3VUYA 2DZMA 3O65B 1FD6A 5EE0A 4LDTD 2HE7A 3IFWB 4HKZE 1WRDB 4XGAB 1J0GA 3X0WA 3B9JA 1MG8A 3VUXA 4CHKA 2DNFA 4EE2A 3MC0B 1QKZA 3T9LA 4ASWC 5BO4B 2UYZB 4A8XC 3GOEA 5DPSA 1YQ4B 2PE9A 3TJPA 3DVNU 3RN9C 1P3QU 3U8ZA 5H92C 1GB1A 4WJQA 1IYFA 4B9KA 2ZVNA 3WALA 5EE9A 4L23A 1UF0A 3DBRI 2DENB 1F52A 3ZJTA 5I4DA 2K0PA 4PS7A 3BY4B 2JPHA 1FM0D 2ASQA 2K22A 2WXQA 3RNFC 4LNFA 2ZCBA 4DQOC 2W54A 2KJ6A 2BWFA 1V1PA 2LXAA 4XZ4A 1VZ8A 3DBHB 3DWMA 2G1EA 1E5WA 5E6JA 3RD2A 2MLBA 2L76A 2Y5BB 3PHXB 3ZUNA 1CZPA 3LXFA 4LCDE 1PGBA 1F77A 1NYRA 2GRIA 3APDA 1QOFA 3Q14C 2NTSA 2R2OA 5D7GA 2IGGA 2KMCA 3GE3C 3BIID 1FIQA 3DHGC 3Q6BA 3MJWA 4GDLB 1VCBA 1J7AA 1I4GA 2KAJA 2MRPA 1SF0A 1UUPA 3ML9A 2HJ8A 4FJYA 1NI3A 2JSVX 2W55A 1H8CA 2GBKA 2LD9A 3IT6B 2REXA 1HTOA 2M0AA 1UWXA 4XWWA 2MCNB 1WGKA 5BMGA 3ZNZB 1WX9A 3Q3FA 4A6QA 4XDDA 3PLUA 4B0MA 3KYDD 4XE0A 3P1MA 3CMMB 1WI0A 2KFJA 1XO3A 2L0FA 2BF8B 4NY0A 1EO6A 2Z59B 4HCPB 5E6OA 2DZIA 2G4SA 2LWPA 3L4PA 4MJSB 3TEWA 3RNCC 2N7JA 3HRDD 2ON8A 2M17A 1EF1A 2ZW0A 4GGQA 4NAMA 1WJNA 3P4RB 2VZKB 2VH1A 1TKGA 1NEKB 2J0MA 4ZHPA 3P4SB 2KTRB 2O6VA 3MC9A 2WNMA 3ML8A 1FNVA 1RAXA 1F9JA 4PS8A 1WF9A 2K6QA 3DPDA 4US9A 3RULA 3HIZA 1Y8RC 4BKSA 3H7PA 2FE8A 3P2BA 4PYZA 2KX0A 1H4RA 2FUG1 1N5XA 3DCGA 2BBCA 2RDBC 3GP7A 1T6BX 1QLBB 3MP9A 5AZHA 3A9KB 2WU5B 4J3OD 2LVOA 2K3UA 4KDIC 4GB9A 4YWGG 1JROA 1UH6A 4TMAB 2MBOA 4Q2JA 3GE8C 1E8WA 2BS2B 1E8XA 1CQVA 4BFRA 2RD0A 1Y56A 5IN7A 3WAMA 1MJDA 1J7CA 3SD5A 2W3SA 4OVUA 2NPTB 4JL9A 4RF1A 1BT0A 4OVVA 4REZA 1WXSA 1XLOA 2XK5B 2SEBD 4EZLA 4N58A 2N9KA 2KN4A 1GAQB 5LNK1 5C23A 3AEDB 1GOZA 3ZXVA 4HWIB 1RFKA 4OW0A 2BS4B 2J7QB 4ICUA 3FAHA 2D3GA 3M62B 2B3AA 1ACCA 1JALA 2V3SA 1L7YA 1YD8U 3GZNI 2C5LC 4HEA1 2FCMA 3HUIA 2ZZPB 4LDTB 1MHHE 1IP9A 3C0RB 1NENB 3AE4B 1GG3A 2CHXA 4WH4A 2INPE 3Q2AC 3PZ7A 1LQBA 1RLFA 1WR6E 5MPOA 2K39A 3UIOB 4C4VA 3C8YA 1LGRA 1TBEA 1WR1A 2KX3A 5GXGB 4TKNA 2JRIB 1I4QA 4CYEA 5H8YE 4IM3A 1TTNA 1T0QC 1K50A 3EECA 2CR5A 2MEKA 5BYSA 3KLSX 4A20A 3N1XC 2WXPA 2JU6X 1TKYA 4WAFA 1BXTA 2UU7A 3H6NA 3ECIA 1FNWA 2WXNA 3DBLB 2JWUA 2LGSA 5FR6A 1IUEA 1WGRA 2AQ2B 1PYWD 4BKTA 1VZ7A 1E6EB 1BMLC 3RNBC 2BYFA 2WYQA 2L00B 3DBHI 3UF8A 3NJTA 3D32A 3PZDA 2WLBA 1S3SG 4ZYNA 1UZXB 4MEMA 1LXDA 4MT5A 4DHJD 1F2RC 2QMTA 3EHVA 4G3XB 2IPKD 4ARIA 5KHQA 4NAWB 3IAM1 5LXHA 3URYA 3NHEB 4PS3A 4M0WA 1NYQA 1L4DB 4I6LB 4KGTA 3HK0A 1V97A 3PRMB 3HM6X 1E7PB 2IYDB 2LFIA 1PFDA 1OFFA 2AWTA 3X23A 2D5GA 3KYCD 3V6CB 1Q1OA 2FUHB 2RDGA 1T5XD 1VRAB 4W9HA 3Q8EA 4OZAA 4USAA 1WH3A 2JZZA 2IO0B 1FXTB 1XD3B 4W9JA 1KLGD 2V1YA 4ZRIA 4YL8A 3VAWA 2NBVB 5L95C 2K5PA 2MHJA 4WWPA 5DCNA 2XN9C 5C2TB 1M4VA 2NCNA 1NI2A 3R2TA 3HM3A 3QWZB 2LRWA 1VLBA 2K1FA 5FKAC 2V3NA 1L0XB 2CS4A 2KTFA 2YEPF 4GSWA 2OJRA 4LNNA 2D07B 3AEFB 2WXMA 2MJDA 5AEKB 5CHVC 2X8XX 2KDEB 2OJWA 5G5GA 3O13A 3ZVVA 4ANWA 4NJCA 5FR3A 1TS3A 3U7DA 4HJKA 2KQSA 1WWTA 2BYEA 3AEAB 4KV2A 4NJ7A 5AZGA 3H1UA 4N9F4 2N0SB 1ZXHA 3ZDTA 2BGFA 1V5TA
chains in the Genus database with same CATH topology
4A8XC 1N5WA 4HJGE 4KKIA 3AM9A 1KFYB 1YQ4B 4IKGA 2LGIA 4LK0M 4RFBA 5H92C 1GB1A 3EGRA 3VR9B 2WS3B 3W5UB 1F0ZA 1K51A 1N60A 1V1OA 5EE9A 2ICIA 4L23A 3ZQ4A 1DOXA 1ET6A 2QEJC 3ZJTA 4OZBA 4TQ0A 5I4DA 2K0PA 1FO4A 1KH0A 3U7ZA 1FM0D 4PT5A 1DYQA 1YMHE 3FC4A 1PGAA 3PZ8A 2K22A 3P4QB 2PVGC 2L1AA 4WQMA 4YSZB 1SEBD 2WXQA 2IGHA 2PTLA 2V0GA 4HROA 2GB1A 3T3NA 4N59A 4MH8A 1D6EC 1IBXA 5EE1A 1C4AA 1JMLA 2R61A 1AW7A 3Q8CA 4OZCA 1P7FA 1QQRA 3I57A 4DQOC 2W54A 4JPSA 2OEDA 1V1PA 4ZHOA 1VZ8A 3LYYA 5BYQA 2WXKA 3BVMA 3HVZA 4RGTA 1SE2A 2RDHA 3DWMA 3B2GA 4A90A 1C78A 2QSDA 2Y5PA 1FRDA 1QF6A 2G1EA 5E6JA 4GLSC 1JQ4A 4IDIA 5AUIA 1CZPA 3LXFA 1TZOA 1Q10A 4OVZA 1VJKA 1PGBA 1F77A 1EU4A 1ET9A 1NYRA 1QOFA 2GRIA 2W3RA 3KWLA 2NTSA 1VZ6A 4DXFA 2X38A 2RMMA 3AE1B 5D7GA 1C77A 2IGGA 4RGOS 1E0ZA 1CJEA 4ZRPA 5C3JB 1C79A 1FIQA 3B2FA 1QILA 3BIID 3W1SA 1VR9A 2PVOD 2EKIA 4L2YA 2HTME 4GDLB 2WXHA 3NVWA 1J7AA 1I4GA 4RCOA 2KAJA 2INNE 2IJ0A 4C56C 1SF0A 1UUPA 1HEZE 1IGDA 1C9FA 2JX5A 1NI3A 1TY2A 2J53A 2JSVX 2W55A 3ZGZA 3IT6B 3TEXA 3U52E 1CK1A 3Q8BA 1JW9D 1EWYC 2LHEA 2M0AA 1UWXA 3E56A 1UWMA 4RGMA 1PDXA 4XWWA 1C76A 1JWMD 3W9CB 1SJED 1C4CA 1TS4A 1KLUD 2DWQA 3V3XA 3GS2A 1WGKA 4AQ7A 3BVGA 5BMGA 4ZRQA 1ENFA 1MVKA 4A6QA 4H2AA 4XDDA 5AUKA 4HKQA 4B0MA 1PGXA 4RF0A 3BK1A 3AE6B 3MJ5A 4WIPA 2WQYB 4JWSC 5D3DA 4XE0A 3P1MA 1TKEA 3AE5B 2PW9A 2H88B 4YXDB 1K52A 2V4IB 4R3DA 4KGSA 3OWEB 4ARCA 4OHJA 3NS1A 1ZXIA 2IGDA 1XO3A 5T8IA 1DOIA 3VR8B 3L4PA 4US8A 1QOAA 1SSNA 1B9RA 2WXOA 3TEWA 3DWGC 4P6VF 2BYTA 3J9CA 2N7JA 3HRDD 1WSPA 3SEBA 3BVZA 2PLPA 1JRPA 2ON8A 1RYJA 2BW2A 1FFUA 2AQ1B 4WURA 2ZW0A 2RPVA 3BYTB 1FCCC 4NAMA 3P4RB 4A55A 2VZKB 3VQIA 1TKGA 1NEKB 2AX5A 4ZHPA 3P4SB 3UI3A 1GPXA 2WDRB 1EWCA 1I4XA 2PMVA 3MHZA 1LO5D 1XXGA 2OHFA 1FNVA 2WNMA 1FNUA 3AH7A 2WXJA 1ROEA 1HQRD 4US9A 2B76B 1YJIA 1XLQA 1AN8A 1BUIC 1HZ6A 1N62A 2E6XA 3NVVA 3AEGB 4P16A 1N61A 1ZDVA 2FE8A 1AWDA 4IOIE 5BMHA 5D3IB 3SFEB 3R8BA 5HFYA 5TSSA 3ETRA 3W5VB 2FUG1 1T3QA 1N5XA 2V3PA 2BBCA 3GP7A 1HXYD 4YTPB 2PIAA 1T6BX 1QLBB 3MP9A 3Q69A 2WXIA 2ONQA 1NVID 2WU2B 1ZE3D 1YQ3B 2WU5B 4D2KA 1XEEA 2MJ3A 1TJEA 4J3OD 1V8CA 4MACA 1OQQA 2K3UA 3AB5A 1XLNA 3IAS1 4YWGG 5FK9C 1JROA 2LEKA 5JXVA 1SXTA 1FFVA 4TMAB 2NTTA 1J7BA 2QIEB 4Q2JA 4B0EA 3RFZB 1SB3C 4KGRA 1FCLA 2BS2B 1CQVA 4NZLB 1Y56A 1TS2A 1ZPSA 3AE8B 1C4PA 4FXCA 5G5HA 1J7CA 3ZJUA 5EE3A 2W3SA 3IT4B 2W82A 1ZOYB 4RGNA 3EA6A 1D5XC 4RF1A 4REZA 4GDKB 4TQ1A 1PUTA 1XLOA 2SEBD 4JE3B 2CJNA 4N58A 1ZP0B 2N9KA 2KN4A 1GAQB 5HI1A 5LNK1 4YSXB 3NUHB 4L1BA 5BYRA 3AEDB 1RWSA 3AEEB 2K9XA 1GOZA 1L0YB 2DYOA 3AN1A 3W2DA 1ESFA 2DLBA 2Z8LA 4KKJA 1RFKA 4OW0A 2BS4B 4CQNA 1WYGA 5BMIA 2BTEA 3P42A 1AYFA 2WXGA 3NRZA 1DGJA 3FAHA 1FXAA 1E10A 1FMAD 2JZPA 1YN3A 1ACCA 1JALA 1WRIA 1D5MC 1YJJA 2TSSA 3AE9B 3CWIA 3AMZA 2QILA 5HG2A 1I4HA 3BWUD 4HEA1 4A9AA 3R2IA 3HUIA 2WDQB 2NMQA 1MHHE 2WP9B 4TSSA 1NENB 3BYYB 3AE4B 2ACZB 2SAKA 1L4ZB 1RM6C 4ZYSA 4YTMB 1I4PA 4WH4A 3AE3B 2INPE 3PZ7A 5MPOA 3V05A 3C8YA 1N63A 1YNTE 2M56B 1D5ZC 5GXGB 3Q8FA 3SFDB 2KWDA 1TS5A 1JWSD 1YN5A 1EM7A 3U2SC 2J4XA 1I4QA 2WDVB 5H8YE 1FRRA 1K50A 1STEA 1YN4A 2CJOA 4MM3B 2H89B 1MI0A 2MEKA 2ZW1A 5BYSA 1EU3A 4C80A 1L6VA 1XCQL 3KLSX 2WXPA 2AQ3B 1R7SA 2JU6X 4C7ZA 1I7HA 1TKYA 1SIJA 1XCTL 4WAFA 3TUOA 4XDCA 3ZJVA 1SE3A 1E9MA 1BXTA 1DOYA 4YT0B 1FNWA 2WXNA 3GB1A 1TY0A 2JWUA 3AEBB 3NVZA 1IUEA 1UGJA 1HA5A 1XLPA 4UDUC 4JWUC 3MFGA 2AQ2B 1SE4A 2KMMA 2BB6A 2G9HD 1PYWD 2LUMA 2VZKD 2J42A 1VZ7A 4KX6B 4LTUA 1E6EB 1VDVA 2BT6A 1L5PA 1BMLC 2I38A 3AECB 4C7YA 4N6EB 2JYTA 2WLBA 3P63A 3H8HA 1JWBD 1JWAD 4MT5A 2WXFA 1KRHA 1WXQA 4DXGA 1SJHD 3VRAB 2LMCA 3ZYYX 4YTNB 1JCKB 3U4EG 1F2RC 2MJEA 2QMTA 2LHDA 1IGCA 1QT9A 2IDYA 2IPKD 3KWVA 2CU3A 1SBBB 4JX1C 3SR6A 4ARIA 2JYEA 3P4PB 4NAWB 3IAM1 3URYA 2DYMA 3AV8A 3N9YC 4M0WA 1A70A 2GI9A 2L83A 1NYQA 1L4DB 2DBYA 3I9V1 3T3OA 4KGTA 1L6UA 1V97A 2QJLA 1E7PB 2L32A 3AE2B 1I4RA 1PFDA 1OFFA 1ZDXA 2LFIA 2EELA 3TEYA 1KF6B 4LLGM 1B1ZA 1D4BA 3CIRB 1L0VB 4WWMA 2D5GA 2WXLA 4ZOHC 3RPFC 4HRSA 1IBXB 1XF5L 1TYGB 3ABVB 2RDGA 3NZ3A 4RNAA 1T5XD 1VRAB 3EUB2 1OQRA 1FEHA 3LB8C 2M19A 1MHXA 3Q8EA 4OZAA 1V1PB 4USAA 3PO0A 2LJIA 1JWUD 3TEZA 3Q8AA 3BK2A 1KLGD 3WCQA 2YEPB 2KACA 3FILA 1K53A 2K5PA 3VRBB 2FBWB 2XN9C 3BZDB 5C2TB 1M4VA 1QOGA 5HHDG 2Y5CA 2E3TA 3R2TA 2L52A 1P7EA 4ITKA 2BB5A 1VLBA 2N9LA 2BS3B 5FKAC 2MH7A 2V3NA 1UNSA 1L0XB 2YEPF 2Y3AA 1MPEA 3AEFB 3KQ4A 2JQRB 1QOBA 2WXMA 2MJDA 2I2YA 4XWTA 1GB4A 3FILB 4O1NA 1ZUD2 3TSSA 2KQ4X 2JXTA 5G5GA 3O13A 4AS1A 3NVYA 4NJCA 1HZ5A 5FR3A 1TS3A 3HVDA 1FD6A 5EE0A 4YSYB 1KTKA 1FXIA 1WWTA 4HKZE 3AEAB 2PKOA 3IXSA 1F2RI 3B9JA 2XNAC 2N0SB 1ZXHA 2J52A 2KDMA 4EE2A 2HDEA 2WXRA 4RH6A 3MC0B 1QKZA 3E9SA 2Q5WD 3AE7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJG E;  1MVK A;  2N9K A;  2KN4 A;  5HI1 A;  4IKG A;  1PGX A;  2LGI A;  1F2R C;  1GB1 A;  2PW9 A;  2QMT A;  2LHD A;  1IGC A;  1K52 A;  4KGS A;  1K51 A;  5BMI A;  2IGD A;  2GI9 A;  4OZB A;  2JZP A;  4KGT A;  2K0P A;  5HG2 A;  2EEL A;  1KH0 A;  1D4B A;  1YMH E;  1PGA A;  2N7J A;  2NMQ A;  1MHH E;  2PLP A;  2IGH A;  2PTL A;  1IBX B;  1XF5 L;  2ON8 A;  2GB1 A;  1IBX A;  1JML A;  4WH4 A;  2ZW0 A;  4OZA A;  1MHX A;  1P7F A;  2RPV A;  1FCC C;  4OZC A;  2OED A;  3UI3 A;  1YNT E;  2KAC A;  3FIL A;  2QSD A;  1K53 A;  4GLS C;  1HZ6 A;  5HHD G;  1Q10 A;  4IOI E;  5BMH A;  1PGB A;  2KWD A;  1P7E A;  5HFY A;  1EM7 A;  2RMM A;  2N9L A;  2IGG A;  1K50 A;  3MP9 A;  1MPE A;  2ONQ A;  2ZW1 A;  1MI0 A;  4D2K A;  2I2Y A;  1GB4 A;  3FIL B;  1XCQ L;  2KQ4 X;  2JXT A;  4MAC A;  2JU6 X;  1HEZ E;  1IGD A;  1HZ5 A;  1C9F A;  1XCT L;  2J53 A;  2JSV X;  1FD6 A;  5JXV A;  3GB1 A;  2JWU A;  4HKZ E;  4KGR A;  1FCL A;  1F2R I;  2LHE A;  1UWX A;  2LUM A;  1ZXH A;  2J52 A;  2KDM A;  3V3X A;  1QKZ A;  2I38 A;  5BMG A; 
#chains in the Genus database with same CATH topology
 4I6P A;  2FAZ A;  4HJG E;  1UEL A;  4KKI A;  1K8R B;  3PTF C;  3AM9 A;  2AL3 A;  2KWC A;  4IKG A;  4RFB A;  4LK0 M;  4IWO A;  3I5J C;  2KDI A;  5J17 A;  3EGR A;  4FJV B;  2WS3 B;  3W5U B;  4RM9 A;  2KKC A;  1N60 A;  1V81 A;  4QAY A;  1ET6 A;  2QEJ C;  3QQ8 B;  4RM8 A;  3UIP B;  1WGG A;  3QC8 B;  1DYQ A;  3FC4 A;  1PGA A;  2PVG C;  2INC C;  3SU8 X;  5CHW A;  2KFK B;  2NVU I;  4M00 A;  2V0G A;  3IVF A;  4HRO A;  2GB1 A;  3T3N A;  4N59 A;  4MH8 A;  3VTU A;  3KVF B;  1IBX A;  2A5U A;  4HLE A;  1EUV B;  1KOT A;  2GBJ A;  4E71 A;  1Q5W B;  1ZGU B;  3ENE A;  5BYQ A;  2WXK A;  3BVM A;  3KH0 A;  4GDL A;  1SE2 A;  1C1Y B;  4W9E A;  3B2G A;  2Y5P A;  1WFY A;  1FRD A;  2IY1 B;  4IWQ A;  2DZJ A;  4HXD A;  3ZTD A;  4OVZ A;  1G6J A;  1VJK A;  3VH4 B;  1EU4 A;  3ZRF A;  4WWN A;  4KIK B;  4EKU A;  2N9P C;  1M94 A;  1TT5 B;  2V4L A;  4LNI A;  4NPN A;  1CJE A;  4MSQ B;  3WAO A;  1OQY A;  5C3J B;  1C79 A;  3W1S A;  1QIL A;  2GLS A;  2EKI A;  3R7R A;  2HTM E;  3N3K B;  1E7V A;  2D3C A;  2KYW A;  4RCO A;  3MTN B;  2KJR A;  4C56 C;  3WAP A;  1HEZ E;  1C9F A;  2JX5 A;  2J53 A;  2G4D B;  1ZW7 A;  3U52 E;  1CK1 A;  2ZPN A;  1EWY C;  3E56 A;  2HTH A;  4JGH B;  4RGM A;  3SDL C;  4S0R A;  1C76 A;  1MFW A;  2BYV E;  4K81 A;  2DWQ A;  1C4C A;  1TS4 A;  5L83 A;  4LNO A;  4AQ7 A;  2L05 A;  4X57 B;  2DX5 B;  3PPA A;  4MJS A;  1ENF A;  4HKQ A;  4DBG A;  2MP2 B;  1PGX A;  2CU1 A;  4RF0 A;  3AE6 B;  5D3D A;  1WGH A;  3AE5 B;  2K6D B;  2V4I B;  4KGS A;  2W9N A;  4F8C B;  4OHJ A;  1GC6 A;  4JIO U;  3OG5 A;  2C9W B;  3VR8 B;  4US8 A;  1B9R A;  2WXO A;  3DWG C;  4PYU A;  3RNG C;  1WM2 A;  3APF A;  3BVZ A;  2PLP A;  5G2N A;  1FFU A;  2AQ1 B;  4ICV A;  3JSV A;  3W1S C;  1WX8 A;  1HTQ A;  3VQI A;  2AX5 A;  3B08 A;  3A1Q B;  3ZNI D;  1XXG A;  3AH7 A;  3A4S C;  4MGI E;  3VVW B;  1YJI A;  1XLQ A;  1AN8 A;  1HZ6 A;  3AEG B;  4M01 A;  2JY6 A;  4DHJ B;  1WGY A;  2WDT B;  2JT4 B;  3SFE B;  5TSS A;  1WJ4 A;  2PEA A;  3ETR A;  3QAQ A;  2V3P A;  2BKF A;  2ONQ A;  4K7S A;  1NVI D;  4D2K A;  1XEE A;  4W9G A;  1J8C A;  2M8S A;  3Q3M C;  1V8C A;  1X1M A;  2XK5 A;  3AB5 A;  2N4F A;  5FK9 C;  2GBM A;  2LEK A;  5JXV A;  1FFV A;  2KVZ A;  2ZCC A;  2NBU A;  2WHI A;  3NY5 A;  3PRP B;  3AE8 B;  1C4P A;  4FXC A;  4MH0 E;  2MBH A;  2LZ6 A;  4JQW C;  3AUL A;  4AJW A;  1ZOY B;  4RGN A;  2HD5 B;  4TQ1 A;  4JE3 B;  1ZP0 B;  4FUL A;  5IP4 D;  5BYR A;  3ZXR A;  3AEE B;  2BWE S;  3VTW A;  4E3C A;  2K9X A;  4WJP A;  2DYO A;  2MSE D;  3B1L X;  1L2N A;  2Z8L A;  3DVN V;  4KKJ A;  4IG7 B;  3T8M A;  4CQN A;  1WYG A;  3AXC A;  1AYF A;  1FXA A;  3AMZ A;  4EUT A;  1D5M C;  1T0S C;  2QIL A;  5HG2 A;  3BWU D;  4WJN A;  4ANU A;  2NMQ A;  1PQS A;  3VHT C;  5E6N A;  1L4Z B;  1XQQ A;  4HK2 A;  4DHZ B;  3VTV A;  3AE3 B;  1R4M B;  3L16 A;  2KK8 A;  4A3O A;  1YX6 B;  1IPG A;  4XYC A;  1WMH B;  1WE6 A;  4BBN F;  1TS5 A;  4IW0 A;  1YN5 A;  1EM7 A;  3U2S C;  5GMV A;  1FRR A;  4ACF A;  3NOB A;  1YN4 A;  2MX2 A;  2C7H A;  2ZW1 A;  2G45 B;  3A33 B;  1EU3 A;  3I3T B;  1L6V A;  1V49 A;  2AQ3 B;  4ANX A;  4XDC A;  1E9M A;  4YT0 B;  4NNJ B;  2VRR B;  1Q0W B;  3QK0 A;  4JWU C;  1QZE A;  4W9K A;  2KMM A;  2BB6 A;  2J42 A;  3V60 A;  2XBB C;  1L5P A;  1WE7 A;  2I38 A;  3AEC B;  2WX1 A;  2GBN A;  4MGK E;  3P63 A;  1JWB D;  4GDK A;  1F1H A;  2A4Z A;  1KRH A;  3ZTC A;  3VRA B;  3ZYY X;  1JCK B;  3U4E G;  2MJE A;  1WM3 A;  1QT9 A;  3CST A;  3KWV A;  4KZC A;  3SR6 A;  4TUU A;  2ZNV C;  2JYE A;  3AV8 A;  1V6E A;  2DBY A;  2KNB A;  1L6U A;  2QJL A;  2L32 A;  4FJZ A;  3AE2 B;  4TV3 A;  3TEY A;  1YX5 B;  1WX7 A;  4II2 B;  4DDG D;  3RPF C;  1WZ0 A;  1TZ1 A;  2IO1 B;  1XF5 L;  3ABV B;  4RNA A;  3FKY A;  2YLM A;  3EUB 2;  2VH2 A;  1FEH A;  3HHM A;  1V1P B;  4MDK E;  2EKE C;  3DVG X;  3ZO5 B;  1P98 A;  2KDB A;  1WXA A;  3BZD B;  1QOG A;  5HHD G;  2Y5C A;  2KC2 A;  2KXJ A;  2L52 A;  4ZDV A;  4DK5 A;  4EZJ A;  5JHA A;  1MPE A;  2JQR B;  4W9L A;  4HDQ A;  3EFC A;  3RUI B;  3FIL B;  4MM3 A;  4O1N A;  4RMA A;  4KZ0 A;  5JZE B;  3NVY A;  2C7M B;  3HVD A;  4YSY B;  3QX1 A;  1KTK A;  1FXI A;  3IXS A;  5CX3 A;  2XNA C;  3OJ3 A;  2PPH A;  3PRZ A;  1MG4 A;  2WXR A;  3EC8 A;  2Q5W D;  4DDI D;  3AE7 B;  1UBI A;  1N5W A;  3N1Y C;  1KFY B;  3L13 A;  2NS5 A;  2GOW A;  2KFK A;  3ZNG C;  4MSM B;  2D11 A;  3UQB A;  2QDF A;  1TIF A;  3TL5 A;  1V1O A;  1SE9 A;  2ICI A;  3ZIM A;  3ZQ4 A;  5D6J B;  2QC8 A;  2LRU A;  1DOX A;  4OZB A;  4TQ0 A;  4G0N B;  2O2V A;  1FO4 A;  1ZKH A;  1I42 A;  3U7Z A;  2UWQ A;  1YMH E;  3QAR A;  4GN1 A;  5LXI B;  3P4Q B;  4LJP B;  2PTL A;  3RZW C;  1D6E C;  4KIK A;  2RSU A;  1C4A A;  1JML A;  5EE1 A;  2IO3 B;  4OZC A;  4W9C A;  4W9I A;  2OOB B;  5EDS A;  2N1W A;  4J6I A;  1D3Z A;  4RGT A;  2WX0 A;  4A90 A;  1C78 A;  2QSD A;  2L0T A;  1QF6 A;  4GLS C;  1JQ4 A;  3TBL D;  3RNA C;  1Q10 A;  2JRH A;  1NBF C;  2FNJ B;  3KWL A;  1VZ6 A;  3DHI C;  2X38 A;  1GJZ A;  3DDC B;  1C77 A;  2JVC A;  3PGE A;  2PE6 B;  4ZRP A;  3VFK A;  4GOC A;  4C00 A;  1GC7 A;  1VR9 A;  3N30 A;  2WXH A;  1P0R A;  2INN E;  4G11 A;  5D94 A;  3ZGZ A;  2MP2 A;  4DWF A;  3TEX A;  3VDZ A;  1R4M I;  2MBB B;  1PDX A;  3PV1 A;  3V3X A;  4LNK A;  1WGD A;  2D3A A;  4KVG B;  2ZJD A;  1MVK A;  2IZV B;  4H2A A;  5AUK A;  3QIJ A;  3PLV A;  3W1Y A;  4HPL B;  3A9J B;  2J0J A;  1YOV B;  4WIP A;  1TGZ B;  4K7W A;  4JWS C;  1TKE A;  3NS8 A;  3VUW A;  4R3D A;  3OWE B;  4ARC A;  3NS1 A;  3RCZ A;  5T8I A;  4EZK A;  1GNU A;  3SHQ A;  5HKH A;  4B6W A;  2L8J A;  3ALB A;  3A1Q A;  1SSN A;  2QHO A;  4WQO B;  3DHH C;  1Z2M A;  2BYT A;  1JRU A;  1XT9 B;  3OLM D;  4K7U A;  1HE8 A;  4M8M A;  4WUR A;  4M02 A;  1E8Z A;  2RPV A;  3CF6 E;  1FCC C;  2JUO A;  3IBE A;  3QCA A;  2YVC A;  4HCN B;  4C4V B;  2HJ1 A;  3R66 C;  3UI3 A;  1GPX A;  1V80 A;  3BIN A;  1LO5 D;  3MHZ A;  3OAW A;  3RYT A;  2KAN A;  2V9H A;  2WXJ A;  1ROE A;  2B76 B;  2KWU B;  1BUI C;  3NVV A;  3MC8 A;  4P16 A;  1ZDV A;  4IOI E;  5BMH A;  1V2Y A;  4GU2 A;  3ZKJ C;  2Z0D B;  2RR9 A;  3WIM A;  2LVP A;  2IY0 B;  4YTP B;  1SGH A;  3Q69 A;  2WXI A;  1LM8 B;  4AWJ A;  2WU2 B;  1ZE3 D;  4ZRJ A;  2MJ3 A;  4BZA A;  1TJE A;  1OQQ A;  1WJU A;  3IAS 1;  1WZ3 A;  2FIF A;  3LDZ E;  1SXT A;  2NTT A;  1J7B A;  2QIE B;  1OEY A;  2M0X A;  1SB3 C;  5IA7 A;  2LGX A;  1KM7 A;  1UD7 A;  3ZJU A;  5EE3 A;  3IT4 B;  3AU5 A;  2D3B A;  1PUT A;  1YJ1 A;  2DZK A;  2IO2 B;  2CJN A;  4NQK E;  4L1B A;  1RWS A;  2LXC A;  1OTR B;  4LJO B;  4EFO A;  3L0W B;  3W2D A;  1ESF A;  4IUM B;  5J2R A;  1V5O A;  4DXA B;  4M0W B;  1YQB A;  2WXG A;  1E10 A;  1FMA D;  4GMV A;  2TSS A;  5D2M B;  1WRI A;  1YJJ A;  2MBQ A;  4HDO A;  4A9A A;  2K25 A;  1WMH A;  2D10 A;  2WDQ B;  3QHT A;  4TSS A;  2D2Q A;  3BYY B;  3JW0 X;  1U4A A;  4YTM B;  4ZYS A;  1I4P A;  3RZF A;  4K3B A;  1AAR A;  5TR5 A;  3V05 A;  4BVU C;  1N63 A;  1YNT E;  2KTR A;  3Q3O C;  5IO9 A;  4BAX A;  2KT7 A;  2MBE A;  2EMS A;  3Q8F A;  2KWD A;  1JWS D;  3DBL I;  1S1Q B;  2J4X A;  2WDV B;  3KW5 B;  2LI5 A;  1R4N B;  1STE A;  1V9J A;  2LGY A;  2CJO A;  2H89 B;  3UGB B;  4C80 A;  3A9K A;  4FHJ A;  3C19 A;  4AUQ C;  4C7Z A;  1I7H A;  4HPP A;  1SIJ A;  3TUO A;  3ZJV A;  1SE3 A;  4W9D A;  1DOY A;  3GB1 A;  1TY0 A;  3NVZ A;  1ISN A;  1UGJ A;  3MFG A;  5CHF A;  1SE4 A;  3L08 A;  1YIW A;  4S17 A;  1KLV A;  1VDV A;  2BT6 A;  1OGW A;  4N6E B;  2JYT A;  3H9D A;  2NPT A;  4FBJ B;  4DXG A;  1SJH D;  2LMC A;  4F7Z A;  1OEY J;  2LHD A;  4JX1 C;  4P1C C;  2L83 A;  3I9V 1;  3T3O A;  4KSL C;  2O6V D;  1I4R A;  1ZDX A;  3K9P B;  2EEL A;  4LLG M;  3TIX A;  1D4B A;  3CIR B;  1L0V B;  4BKS D;  2WXL A;  2J0K A;  1IBX B;  4BKG A;  4NJ6 A;  4M8N A;  1SIF A;  1OQR A;  5JHB A;  2M19 A;  1T0Y A;  2LJI A;  3Q8A A;  2K8H A;  2N7D A;  3S2A A;  2YEP B;  3FIL A;  2R2Q A;  2FBW B;  3V6E B;  3RT3 B;  2N1V A;  3M95 A;  2KHW B;  1J19 A;  2BB5 A;  2MH7 A;  1UNS A;  1E8Y A;  3KQ4 A;  1QOB A;  1P1A A;  2I2Y A;  3TCA A;  4XX5 A;  2MQJ A;  4XWT A;  3TSS A;  1P9D U;  2KQ4 X;  2JXT A;  3RNE C;  3Q3N C;  2L3Z A;  2CKH B;  1HZ5 A;  2FID A;  4ZRK A;  2QCZ A;  3RMK C;  2AL6 A;  2PKO A;  3CSF A;  1F2R I;  2WWZ A;  3APC A;  2LGD A;  4E74 A;  3KUC B;  2J52 A;  2KDM A;  2HDE A;  4RH6 A;  3E9S A;  3WA0 A;  3M63 B;  3IHP C;  2I1J A;  2ZPY A;  3JVZ X;  2I1K A;  2LGI A;  2LUE A;  2DYB A;  5JH5 C;  3VR9 B;  1F0Z A;  4AOF A;  1K51 A;  4P1B C;  4NAW A;  2PJH A;  3DOW A;  3UIN B;  1KH0 A;  4PT5 A;  3PZ8 A;  2MA9 B;  3KUZ A;  5C1Z A;  2L1A A;  4WQM A;  4YSZ B;  1SEB D;  2IGH A;  1WXM A;  1RRB A;  3JSV B;  5G55 A;  2FCS A;  2R61 A;  5IAA C;  1AW7 A;  3Q8C A;  1P7F A;  1QQR A;  3I57 A;  4JPS A;  2OED A;  3PSE B;  4WWO A;  3N32 A;  4ZHO A;  3LYY A;  3HVZ A;  2RGF A;  3ZW3 A;  2RDH A;  4IM0 A;  4CO7 A;  2G3Q B;  3N1Z C;  2LAS A;  4NQL B;  4IDI A;  5AUI A;  3UQA A;  1TZO A;  1ET9 A;  2W3R A;  4DXF A;  2RMM A;  3AE1 B;  4FHK A;  4RGO S;  1E0Z A;  2AEH A;  3PT2 B;  3B2F A;  4GXB A;  2PVO D;  4L2Y A;  4P7I A;  3NVW A;  2IJ0 A;  2KMA A;  1IGD A;  3U30 A;  1TY2 A;  4MEL A;  3A9J A;  2KN5 A;  2ZVO A;  4AJY B;  1N6Z A;  3PRE A;  2C60 A;  3Q8B A;  3DQV A;  1JW9 D;  2LHE A;  4WJO A;  2LVQ A;  5AZF A;  4FLH A;  1UWM A;  2KLC A;  3OJ4 B;  1JWM D;  3W9C B;  1SJE D;  1KLU D;  3GS2 A;  3AU4 A;  3BVG A;  4ZRQ A;  1E7U A;  5DPW A;  3BK1 A;  3MJ5 A;  2WQY B;  2FCQ A;  2XEW A;  1WJ6 A;  2PW9 A;  2H88 B;  4YXD B;  1K52 A;  2DAJ A;  1Z5S B;  5CTR C;  1ZXI A;  2IGD A;  4GIV A;  1CMX B;  2K8B A;  1DOI A;  1R4N I;  5DPR A;  1KJT A;  3PHW B;  2N9E B;  1QOA A;  4F1S A;  2MWS B;  4P6V F;  1WYW B;  3J9C A;  1WSP A;  3SEB A;  3DVG Y;  3QA8 A;  4I6N B;  1I35 A;  1JRP A;  1RYJ A;  2BW2 A;  4BBN C;  4HPM B;  3BYT B;  4A55 A;  2ZNV B;  3JYU A;  4MGY E;  4URK A;  2WDR B;  1EF5 A;  1EWC A;  1I4X A;  2PMV A;  3KUD B;  2OHF A;  2BPS A;  1FNU A;  2JZ3 B;  1HQR D;  1N62 A;  2E6X A;  2BKR B;  3ZRC A;  2BVC A;  1N61 A;  1AWD A;  4WAA A;  5D3I B;  2KDF B;  2KOX A;  3R8B A;  5HFY A;  3QJZ A;  3W5V B;  1T3Q A;  1HXY D;  2PIA A;  3DBR B;  2O6V B;  1YQ3 B;  2CHW A;  3ZNH B;  2C7N B;  4MAC A;  1XLN A;  3H7P B;  4HVB A;  2K8C A;  4B95 A;  4B0E A;  2DHZ A;  2KVR A;  3RFZ B;  4JLC A;  4KGR A;  3N20 C;  1FCL A;  1VD2 A;  4NZL B;  1TS2 A;  1ZPS A;  4IWP A;  2EMT A;  5KHO A;  3L10 B;  5G5H A;  2W82 A;  3EA6 A;  1D5X C;  2MW5 A;  2JXX A;  5LLI A;  2GBR A;  4DHZ E;  4GDK B;  3DBS A;  3R3M A;  3NZS A;  5HI1 A;  4YSX B;  3NUH B;  1GUA B;  4A3P A;  1NDD A;  4FN2 A;  2KJH B;  3WAN A;  4PK1 A;  1L0Y B;  2IBI B;  3AN1 A;  3TMP B;  4BOZ B;  2DLB A;  3LJ3 A;  5BMI A;  2BTE A;  3P42 A;  2L7R A;  1WIA A;  3NRZ A;  1DGJ A;  1E90 A;  3H7S A;  2N7E A;  3L17 A;  2JZP A;  1YN3 A;  3AE9 B;  3CWI A;  1I4H A;  4EEW A;  1C3T A;  3R2I A;  2KZR A;  3PVL A;  2WP9 B;  4FA6 A;  2ACZ B;  2SAK A;  3EFU A;  1RM6 C;  5IKC M;  3VXW A;  2Z0E B;  3I63 C;  1A5R A;  3IG3 A;  1UGM A;  5DPT A;  3ZDM C;  2M56 B;  4II3 B;  1D5Z C;  2FCN A;  3A4R A;  3AI5 A;  3SFD B;  2LJ5 A;  2KO3 A;  5J18 A;  2M4N A;  4MM3 B;  5E6P A;  3RI7 C;  1MI0 A;  3NG0 A;  4K3C A;  1XCQ L;  4IM2 A;  3ONS A;  1R7S A;  2BQQ A;  1V86 A;  4EOY A;  1XCT L;  3V61 A;  3AEB B;  1HA5 A;  1XLP A;  4UDU C;  3NZU A;  4MGZ E;  2KQ7 A;  2RPQ A;  2KC1 A;  2G9H D;  4XC2 A;  2LUM A;  2VZK D;  4LTU A;  4KX6 B;  3V62 A;  4FAD A;  2DAF A;  4C7Y A;  4BOS C;  5IOI A;  3MHS D;  3H8H A;  1JWA D;  2JF5 A;  2WXF A;  1WXQ A;  4KSK C;  4YTN B;  1IGC A;  2IDY A;  3B0A A;  2CU3 A;  2N9X A;  1SBB B;  1UBQ A;  2KD0 A;  1LFD A;  3P4P B;  2DYM A;  3N9Y C;  2AYO B;  3L54 A;  1A70 A;  2GI9 A;  2O2V B;  3PS6 A;  3VH3 B;  4G50 A;  1FPY A;  4ANV A;  1KF6 B;  1B1Z A;  4WWM A;  4ZOH C;  4HRS A;  4IC7 B;  3ZLZ A;  2WGS A;  3Q3J A;  1TYG B;  2JWZ A;  3NZ3 A;  3LB8 C;  1MHX A;  3PO0 A;  2KLG A;  1JWU D;  3TEZ A;  3BK2 A;  2NR2 A;  4K1R B;  3WCQ A;  2KAC A;  4AP4 C;  1RFA A;  1K53 A;  2NBW B;  3M3J A;  3VRB B;  3K9O B;  4W9F A;  2E3T A;  1P7E A;  1T0R C;  4ITK A;  2N9L A;  2BS3 B;  3R7Q A;  1WY8 A;  1WXV A;  2Y3A A;  2M1M A;  2IND C;  2GMI C;  4KDL B;  1GB4 A;  3GZN B;  1ZUD 2;  2CHZ A;  2ZEQ A;  2KWV B;  4AS1 A;  3VUY A;  2DZM A;  3O65 B;  1FD6 A;  5EE0 A;  4LDT D;  2HE7 A;  3IFW B;  4HKZ E;  1WRD B;  4XGA B;  1J0G A;  3X0W A;  3B9J A;  1MG8 A;  3VUX A;  4CHK A;  2DNF A;  4EE2 A;  3MC0 B;  1QKZ A;  3T9L A;  4ASW C;  5BO4 B;  2UYZ B;  4A8X C;  3GOE A;  5DPS A;  1YQ4 B;  2PE9 A;  3TJP A;  3DVN U;  3RN9 C;  1P3Q U;  3U8Z A;  5H92 C;  1GB1 A;  4WJQ A;  1IYF A;  4B9K A;  2ZVN A;  3WAL A;  5EE9 A;  4L23 A;  1UF0 A;  3DBR I;  2DEN B;  1F52 A;  3ZJT A;  5I4D A;  2K0P A;  4PS7 A;  3BY4 B;  2JPH A;  1FM0 D;  2ASQ A;  2K22 A;  2WXQ A;  3RNF C;  4LNF A;  2ZCB A;  4DQO C;  2W54 A;  2KJ6 A;  2BWF A;  1V1P A;  2LXA A;  4XZ4 A;  1VZ8 A;  3DBH B;  3DWM A;  2G1E A;  1E5W A;  5E6J A;  3RD2 A;  2MLB A;  2L76 A;  2Y5B B;  3PHX B;  3ZUN A;  1CZP A;  3LXF A;  4LCD E;  1PGB A;  1F77 A;  1NYR A;  2GRI A;  3APD A;  1QOF A;  3Q14 C;  2NTS A;  2R2O A;  5D7G A;  2IGG A;  2KMC A;  3GE3 C;  3BII D;  1FIQ A;  3DHG C;  3Q6B A;  3MJW A;  4GDL B;  1VCB A;  1J7A A;  1I4G A;  2KAJ A;  2MRP A;  1SF0 A;  1UUP A;  3ML9 A;  2HJ8 A;  4FJY A;  1NI3 A;  2JSV X;  2W55 A;  1H8C A;  2GBK A;  2LD9 A;  3IT6 B;  2REX A;  1HTO A;  2M0A A;  1UWX A;  4XWW A;  2MCN B;  1WGK A;  5BMG A;  3ZNZ B;  1WX9 A;  3Q3F A;  4A6Q A;  4XDD A;  3PLU A;  4B0M A;  3KYD D;  4XE0 A;  3P1M A;  3CMM B;  1WI0 A;  2KFJ A;  1XO3 A;  2L0F A;  2BF8 B;  4NY0 A;  1EO6 A;  2Z59 B;  4HCP B;  5E6O A;  2DZI A;  2G4S A;  2LWP A;  3L4P A;  4MJS B;  3TEW A;  3RNC C;  2N7J A;  3HRD D;  2ON8 A;  2M17 A;  1EF1 A;  2ZW0 A;  4GGQ A;  4NAM A;  1WJN A;  3P4R B;  2VZK B;  2VH1 A;  1TKG A;  1NEK B;  2J0M A;  4ZHP A;  3P4S B;  2KTR B;  2O6V A;  3MC9 A;  2WNM A;  3ML8 A;  1FNV A;  1RAX A;  1F9J A;  4PS8 A;  1WF9 A;  2K6Q A;  3DPD A;  4US9 A;  3RUL A;  3HIZ A;  1Y8R C;  4BKS A;  3H7P A;  2FE8 A;  3P2B A;  4PYZ A;  2KX0 A;  1H4R A;  2FUG 1;  1N5X A;  3DCG A;  2BBC A;  2RDB C;  3GP7 A;  1T6B X;  1QLB B;  3MP9 A;  5AZH A;  3A9K B;  2WU5 B;  4J3O D;  2LVO A;  2K3U A;  4KDI C;  4GB9 A;  4YWG G;  1JRO A;  1UH6 A;  4TMA B;  2MBO A;  4Q2J A;  3GE8 C;  1E8W A;  2BS2 B;  1E8X A;  1CQV A;  4BFR A;  2RD0 A;  1Y56 A;  5IN7 A;  3WAM A;  1MJD A;  1J7C A;  3SD5 A;  2W3S A;  4OVU A;  2NPT B;  4JL9 A;  4RF1 A;  1BT0 A;  4OVV A;  4REZ A;  1WXS A;  1XLO A;  2XK5 B;  2SEB D;  4EZL A;  4N58 A;  2N9K A;  2KN4 A;  1GAQ B;  5LNK 1;  5C23 A;  3AED B;  1GOZ A;  3ZXV A;  4HWI B;  1RFK A;  4OW0 A;  2BS4 B;  2J7Q B;  4ICU A;  3FAH A;  2D3G A;  3M62 B;  2B3A A;  1ACC A;  1JAL A;  2V3S A;  1L7Y A;  1YD8 U;  3GZN I;  2C5L C;  4HEA 1;  2FCM A;  3HUI A;  2ZZP B;  4LDT B;  1MHH E;  1IP9 A;  3C0R B;  1NEN B;  3AE4 B;  1GG3 A;  2CHX A;  4WH4 A;  2INP E;  3Q2A C;  3PZ7 A;  1LQB A;  1RLF A;  1WR6 E;  5MPO A;  2K39 A;  3UIO B;  4C4V A;  3C8Y A;  1LGR A;  1TBE A;  1WR1 A;  2KX3 A;  5GXG B;  4TKN A;  2JRI B;  1I4Q A;  4CYE A;  5H8Y E;  4IM3 A;  1TTN A;  1T0Q C;  1K50 A;  3EEC A;  2CR5 A;  2MEK A;  5BYS A;  3KLS X;  4A20 A;  3N1X C;  2WXP A;  2JU6 X;  1TKY A;  4WAF A;  1BXT A;  2UU7 A;  3H6N A;  3ECI A;  1FNW A;  2WXN A;  3DBL B;  2JWU A;  2LGS A;  5FR6 A;  1IUE A;  1WGR A;  2AQ2 B;  1PYW D;  4BKT A;  1VZ7 A;  1E6E B;  1BML C;  3RNB C;  2BYF A;  2WYQ A;  2L00 B;  3DBH I;  3UF8 A;  3NJT A;  3D32 A;  3PZD A;  2WLB A;  1S3S G;  4ZYN A;  1UZX B;  4MEM A;  1LXD A;  4MT5 A;  4DHJ D;  1F2R C;  2QMT A;  3EHV A;  4G3X B;  2IPK D;  4ARI A;  5KHQ A;  4NAW B;  3IAM 1;  5LXH A;  3URY A;  3NHE B;  4PS3 A;  4M0W A;  1NYQ A;  1L4D B;  4I6L B;  4KGT A;  3HK0 A;  1V97 A;  3PRM B;  3HM6 X;  1E7P B;  2IYD B;  2LFI A;  1PFD A;  1OFF A;  2AWT A;  3X23 A;  2D5G A;  3KYC D;  3V6C B;  1Q1O A;  2FUH B;  2RDG A;  1T5X D;  1VRA B;  4W9H A;  3Q8E A;  4OZA A;  4USA A;  1WH3 A;  2JZZ A;  2IO0 B;  1FXT B;  1XD3 B;  4W9J A;  1KLG D;  2V1Y A;  4ZRI A;  4YL8 A;  3VAW A;  2NBV B;  5L95 C;  2K5P A;  2MHJ A;  4WWP A;  5DCN A;  2XN9 C;  5C2T B;  1M4V A;  2NCN A;  1NI2 A;  3R2T A;  3HM3 A;  3QWZ B;  2LRW A;  1VLB A;  2K1F A;  5FKA C;  2V3N A;  1L0X B;  2CS4 A;  2KTF A;  2YEP F;  4GSW A;  2OJR A;  4LNN A;  2D07 B;  3AEF B;  2WXM A;  2MJD A;  5AEK B;  5CHV C;  2X8X X;  2KDE B;  2OJW A;  5G5G A;  3O13 A;  3ZVV A;  4ANW A;  4NJC A;  5FR3 A;  1TS3 A;  3U7D A;  4HJK A;  2KQS A;  1WWT A;  2BYE A;  3AEA B;  4KV2 A;  4NJ7 A;  5AZG A;  3H1U A;  4N9F 4;  2N0S B;  1ZXH A;  3ZDT A;  2BGF A;  1V5T A; 
#chains in the Genus database with same CATH homology
 4A8X C;  1N5W A;  4HJG E;  4KKI A;  3AM9 A;  1KFY B;  1YQ4 B;  4IKG A;  2LGI A;  4LK0 M;  4RFB A;  5H92 C;  1GB1 A;  3EGR A;  3VR9 B;  2WS3 B;  3W5U B;  1F0Z A;  1K51 A;  1N60 A;  1V1O A;  5EE9 A;  2ICI A;  4L23 A;  3ZQ4 A;  1DOX A;  1ET6 A;  2QEJ C;  3ZJT A;  4OZB A;  4TQ0 A;  5I4D A;  2K0P A;  1FO4 A;  1KH0 A;  3U7Z A;  1FM0 D;  4PT5 A;  1DYQ A;  1YMH E;  3FC4 A;  1PGA A;  3PZ8 A;  2K22 A;  3P4Q B;  2PVG C;  2L1A A;  4WQM A;  4YSZ B;  1SEB D;  2WXQ A;  2IGH A;  2PTL A;  2V0G A;  4HRO A;  2GB1 A;  3T3N A;  4N59 A;  4MH8 A;  1D6E C;  1IBX A;  5EE1 A;  1C4A A;  1JML A;  2R61 A;  1AW7 A;  3Q8C A;  4OZC A;  1P7F A;  1QQR A;  3I57 A;  4DQO C;  2W54 A;  4JPS A;  2OED A;  1V1P A;  4ZHO A;  1VZ8 A;  3LYY A;  5BYQ A;  2WXK A;  3BVM A;  3HVZ A;  4RGT A;  1SE2 A;  2RDH A;  3DWM A;  3B2G A;  4A90 A;  1C78 A;  2QSD A;  2Y5P A;  1FRD A;  1QF6 A;  2G1E A;  5E6J A;  4GLS C;  1JQ4 A;  4IDI A;  5AUI A;  1CZP A;  3LXF A;  1TZO A;  1Q10 A;  4OVZ A;  1VJK A;  1PGB A;  1F77 A;  1EU4 A;  1ET9 A;  1NYR A;  1QOF A;  2GRI A;  2W3R A;  3KWL A;  2NTS A;  1VZ6 A;  4DXF A;  2X38 A;  2RMM A;  3AE1 B;  5D7G A;  1C77 A;  2IGG A;  4RGO S;  1E0Z A;  1CJE A;  4ZRP A;  5C3J B;  1C79 A;  1FIQ A;  3B2F A;  1QIL A;  3BII D;  3W1S A;  1VR9 A;  2PVO D;  2EKI A;  4L2Y A;  2HTM E;  4GDL B;  2WXH A;  3NVW A;  1J7A A;  1I4G A;  4RCO A;  2KAJ A;  2INN E;  2IJ0 A;  4C56 C;  1SF0 A;  1UUP A;  1HEZ E;  1IGD A;  1C9F A;  2JX5 A;  1NI3 A;  1TY2 A;  2J53 A;  2JSV X;  2W55 A;  3ZGZ A;  3IT6 B;  3TEX A;  3U52 E;  1CK1 A;  3Q8B A;  1JW9 D;  1EWY C;  2LHE A;  2M0A A;  1UWX A;  3E56 A;  1UWM A;  4RGM A;  1PDX A;  4XWW A;  1C76 A;  1JWM D;  3W9C B;  1SJE D;  1C4C A;  1TS4 A;  1KLU D;  2DWQ A;  3V3X A;  3GS2 A;  1WGK A;  4AQ7 A;  3BVG A;  5BMG A;  4ZRQ A;  1ENF A;  1MVK A;  4A6Q A;  4H2A A;  4XDD A;  5AUK A;  4HKQ A;  4B0M A;  1PGX A;  4RF0 A;  3BK1 A;  3AE6 B;  3MJ5 A;  4WIP A;  2WQY B;  4JWS C;  5D3D A;  4XE0 A;  3P1M A;  1TKE A;  3AE5 B;  2PW9 A;  2H88 B;  4YXD B;  1K52 A;  2V4I B;  4R3D A;  4KGS A;  3OWE B;  4ARC A;  4OHJ A;  3NS1 A;  1ZXI A;  2IGD A;  1XO3 A;  5T8I A;  1DOI A;  3VR8 B;  3L4P A;  4US8 A;  1QOA A;  1SSN A;  1B9R A;  2WXO A;  3TEW A;  3DWG C;  4P6V F;  2BYT A;  3J9C A;  2N7J A;  3HRD D;  1WSP A;  3SEB A;  3BVZ A;  2PLP A;  1JRP A;  2ON8 A;  1RYJ A;  2BW2 A;  1FFU A;  2AQ1 B;  4WUR A;  2ZW0 A;  2RPV A;  3BYT B;  1FCC C;  4NAM A;  3P4R B;  4A55 A;  2VZK B;  3VQI A;  1TKG A;  1NEK B;  2AX5 A;  4ZHP A;  3P4S B;  3UI3 A;  1GPX A;  2WDR B;  1EWC A;  1I4X A;  2PMV A;  3MHZ A;  1LO5 D;  1XXG A;  2OHF A;  1FNV A;  2WNM A;  1FNU A;  3AH7 A;  2WXJ A;  1ROE A;  1HQR D;  4US9 A;  2B76 B;  1YJI A;  1XLQ A;  1AN8 A;  1BUI C;  1HZ6 A;  1N62 A;  2E6X A;  3NVV A;  3AEG B;  4P16 A;  1N61 A;  1ZDV A;  2FE8 A;  1AWD A;  4IOI E;  5BMH A;  5D3I B;  3SFE B;  3R8B A;  5HFY A;  5TSS A;  3ETR A;  3W5V B;  2FUG 1;  1T3Q A;  1N5X A;  2V3P A;  2BBC A;  3GP7 A;  1HXY D;  4YTP B;  2PIA A;  1T6B X;  1QLB B;  3MP9 A;  3Q69 A;  2WXI A;  2ONQ A;  1NVI D;  2WU2 B;  1ZE3 D;  1YQ3 B;  2WU5 B;  4D2K A;  1XEE A;  2MJ3 A;  1TJE A;  4J3O D;  1V8C A;  4MAC A;  1OQQ A;  2K3U A;  3AB5 A;  1XLN A;  3IAS 1;  4YWG G;  5FK9 C;  1JRO A;  2LEK A;  5JXV A;  1SXT A;  1FFV A;  4TMA B;  2NTT A;  1J7B A;  2QIE B;  4Q2J A;  4B0E A;  3RFZ B;  1SB3 C;  4KGR A;  1FCL A;  2BS2 B;  1CQV A;  4NZL B;  1Y56 A;  1TS2 A;  1ZPS A;  3AE8 B;  1C4P A;  4FXC A;  5G5H A;  1J7C A;  3ZJU A;  5EE3 A;  2W3S A;  3IT4 B;  2W82 A;  1ZOY B;  4RGN A;  3EA6 A;  1D5X C;  4RF1 A;  4REZ A;  4GDK B;  4TQ1 A;  1PUT A;  1XLO A;  2SEB D;  4JE3 B;  2CJN A;  4N58 A;  1ZP0 B;  2N9K A;  2KN4 A;  1GAQ B;  5HI1 A;  5LNK 1;  4YSX B;  3NUH B;  4L1B A;  5BYR A;  3AED B;  1RWS A;  3AEE B;  2K9X A;  1GOZ A;  1L0Y B;  2DYO A;  3AN1 A;  3W2D A;  1ESF A;  2DLB A;  2Z8L A;  4KKJ A;  1RFK A;  4OW0 A;  2BS4 B;  4CQN A;  1WYG A;  5BMI A;  2BTE A;  3P42 A;  1AYF A;  2WXG A;  3NRZ A;  1DGJ A;  3FAH A;  1FXA A;  1E10 A;  1FMA D;  2JZP A;  1YN3 A;  1ACC A;  1JAL A;  1WRI A;  1D5M C;  1YJJ A;  2TSS A;  3AE9 B;  3CWI A;  3AMZ A;  2QIL A;  5HG2 A;  1I4H A;  3BWU D;  4HEA 1;  4A9A A;  3R2I A;  3HUI A;  2WDQ B;  2NMQ A;  1MHH E;  2WP9 B;  4TSS A;  1NEN B;  3BYY B;  3AE4 B;  2ACZ B;  2SAK A;  1L4Z B;  1RM6 C;  4ZYS A;  4YTM B;  1I4P A;  4WH4 A;  3AE3 B;  2INP E;  3PZ7 A;  5MPO A;  3V05 A;  3C8Y A;  1N63 A;  1YNT E;  2M56 B;  1D5Z C;  5GXG B;  3Q8F A;  3SFD B;  2KWD A;  1TS5 A;  1JWS D;  1YN5 A;  1EM7 A;  3U2S C;  2J4X A;  1I4Q A;  2WDV B;  5H8Y E;  1FRR A;  1K50 A;  1STE A;  1YN4 A;  2CJO A;  4MM3 B;  2H89 B;  1MI0 A;  2MEK A;  2ZW1 A;  5BYS A;  1EU3 A;  4C80 A;  1L6V A;  1XCQ L;  3KLS X;  2WXP A;  2AQ3 B;  1R7S A;  2JU6 X;  4C7Z A;  1I7H A;  1TKY A;  1SIJ A;  1XCT L;  4WAF A;  3TUO A;  4XDC A;  3ZJV A;  1SE3 A;  1E9M A;  1BXT A;  1DOY A;  4YT0 B;  1FNW A;  2WXN A;  3GB1 A;  1TY0 A;  2JWU A;  3AEB B;  3NVZ A;  1IUE A;  1UGJ A;  1HA5 A;  1XLP A;  4UDU C;  4JWU C;  3MFG A;  2AQ2 B;  1SE4 A;  2KMM A;  2BB6 A;  2G9H D;  1PYW D;  2LUM A;  2VZK D;  2J42 A;  1VZ7 A;  4KX6 B;  4LTU A;  1E6E B;  1VDV A;  2BT6 A;  1L5P A;  1BML C;  2I38 A;  3AEC B;  4C7Y A;  4N6E B;  2JYT A;  2WLB A;  3P63 A;  3H8H A;  1JWB D;  1JWA D;  4MT5 A;  2WXF A;  1KRH A;  1WXQ A;  4DXG A;  1SJH D;  3VRA B;  2LMC A;  3ZYY X;  4YTN B;  1JCK B;  3U4E G;  1F2R C;  2MJE A;  2QMT A;  2LHD A;  1IGC A;  1QT9 A;  2IDY A;  2IPK D;  3KWV A;  2CU3 A;  1SBB B;  4JX1 C;  3SR6 A;  4ARI A;  2JYE A;  3P4P B;  4NAW B;  3IAM 1;  3URY A;  2DYM A;  3AV8 A;  3N9Y C;  4M0W A;  1A70 A;  2GI9 A;  2L83 A;  1NYQ A;  1L4D B;  2DBY A;  3I9V 1;  3T3O A;  4KGT A;  1L6U A;  1V97 A;  2QJL A;  1E7P B;  2L32 A;  3AE2 B;  1I4R A;  1PFD A;  1OFF A;  1ZDX A;  2LFI A;  2EEL A;  3TEY A;  1KF6 B;  4LLG M;  1B1Z A;  1D4B A;  3CIR B;  1L0V B;  4WWM A;  2D5G A;  2WXL A;  4ZOH C;  3RPF C;  4HRS A;  1IBX B;  1XF5 L;  1TYG B;  3ABV B;  2RDG A;  3NZ3 A;  4RNA A;  1T5X D;  1VRA B;  3EUB 2;  1OQR A;  1FEH A;  3LB8 C;  2M19 A;  1MHX A;  3Q8E A;  4OZA A;  1V1P B;  4USA A;  3PO0 A;  2LJI A;  1JWU D;  3TEZ A;  3Q8A A;  3BK2 A;  1KLG D;  3WCQ A;  2YEP B;  2KAC A;  3FIL A;  1K53 A;  2K5P A;  3VRB B;  2FBW B;  2XN9 C;  3BZD B;  5C2T B;  1M4V A;  1QOG A;  5HHD G;  2Y5C A;  2E3T A;  3R2T A;  2L52 A;  1P7E A;  4ITK A;  2BB5 A;  1VLB A;  2N9L A;  2BS3 B;  5FKA C;  2MH7 A;  2V3N A;  1UNS A;  1L0X B;  2YEP F;  2Y3A A;  1MPE A;  3AEF B;  3KQ4 A;  2JQR B;  1QOB A;  2WXM A;  2MJD A;  2I2Y A;  4XWT A;  1GB4 A;  3FIL B;  4O1N A;  1ZUD 2;  3TSS A;  2KQ4 X;  2JXT A;  5G5G A;  3O13 A;  4AS1 A;  3NVY A;  4NJC A;  1HZ5 A;  5FR3 A;  1TS3 A;  3HVD A;  1FD6 A;  5EE0 A;  4YSY B;  1KTK A;  1FXI A;  1WWT A;  4HKZ E;  3AEA B;  2PKO A;  3IXS A;  1F2R I;  3B9J A;  2XNA C;  2N0S B;  1ZXH A;  2J52 A;  2KDM A;  4EE2 A;  2HDE A;  2WXR A;  4RH6 A;  3MC0 B;  1QKZ A;  3E9S A;  2Q5W D;  3AE7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...