5HFYA

Backbone modifications in the protein gb1 helix: beta-2-ala24, beta-3-lys28, beta-3-lys31, beta-3-asn35
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Comparison of design strategies for alpha-helix backbone modification in a protein tertiary fold.
pubmed doi rcsb
molecule tags De novo protein
total genus 12
structure length 52
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5hfyA00
2QMTA 2I38A 2N7JA 4GLSC 1YNTE 1F2RI 2N9KA 4MACA 3GB1A 3FILA 4HKZE 1XF5L 2PW9A 2JWUA 2K0PA 1P7EA 2IGDA 1K50A 2KN4A 2RMMA 1D4BA 4IKGA 1MVKA 2JSVX 1PGBA 1XCTL 4OZAA 4HJGE 5BMHA 4OZCA 1FCLA 2J53A 1HZ6A 2J52A 5BMGA 1MHXA 1P7FA 5HI1A 1PGAA 1K51A 1YMHE 2JXTA 2OEDA 1FD6A 1KH0A 2NMQA 2RPVA 2LGIA 2I2YA 1K52A 4D2KA 1F2RC 2KDMA 2N9LA 2JZPA 4KGSA 5JXVA 1FCCC 4OZBA 2PLPA 2ZW0A 3UI3A 2ON8A 1QKZA 2PTLA 1GB1A 4WH4A 2LHDA 1PGXA 5HHDG 1MHHE 1IGCA 1K53A 5HG2A 2QSDA 4KGRA 5HFYA 3MP9A 1HZ5A 1IBXA 1HEZE 1GB4A 2GB1A 3V3XA 1UWXA 2ONQA 1EM7A 2IGHA 2KQ4X 1ZXHA 5BMIA 1JMLA 4KGTA 2IGGA 2LHEA 4IOIE 1IBXB 1C9FA 2ZW1A 2EELA 1Q10A 2JU6X 3FILB 1IGDA 2LUMA 2KACA 2GI9A 1MI0A 2KWDA 1MPEA 1XCQL
chains in the Genus database with same CATH superfamily
1EO6A 5JH5C 3ETRA 1C76A 1UUPA 2DHZA 4NAMA 4XC2A 4KSLC 2C7NB 3MFGA 3ONSA 3OG5A 3RUIB 2PW9A 3PZDA 2CU3A 4ZHOA 2WXJA 1J0GA 4NZLB 1H4RA 4XWTA 1D4BA 1WGRA 4PK1A 1RLFA 1MG4A 3NZUA 3BYYB 1UELA 4TV3A 4XYCA 1YJIA 1FRRA 1QT9A 3MJWA 1WXQA 2HJ1A 5AZGA 1WJ6A 1J19A 5D94A 1PGAA 3K9PB 4N59A 1GOZA 4RFBA 4DHJB 2LVOA 4IUMB 2M1MA 2LGIA 3ML8A 1NEKB 4OVZA 3GOEA 3Q3JA 4M8MA 4D2KA 5L95C 1I4XA 1H8CA 4G50A 4GIVA 1WIAA 2L7RA 3AMZA 4E74A 3E9SA 4BKSA 1VD2A 4DK5A 3ZNID 4B95A 1NVID 1AW7A 2QJLA 2D10A 3HVZA 4BFRA 1SEBD 1YX5B 2L52A 3AH7A 2DYBA 2Y5CA 5HG2A 3QIJA 1FM0D 2HDEA 3MP9A 2L0FA 1JWBD 2LUEA 3AU5A 1TKEA 2KMMA 2D3GA 2GRIA 5JHBA 4KGTA 4CHKA 5EE9A 1ZXIA 2IBIB 4LCDE 3V6EB 2ZNVC 2ASQA 5EE0A 1BXTA 4ZYNA 3NJTA 1ACCA 1C1YB 3H9DA 5TR5A 3N9YC 5KHOA 3RI7C 5LLIA 2UU7A 4M02A 5CHWA 5AUIA 3DHHC 2LRUA 1WJUA 1L6VA 1R4MI 3N1YC 4DWFA 1RWSA 3KQ4A 1RFAA 1B9RA 2BPSA 2JRIB 3V05A 4E71A 2JSVX 3EUB2 1HA5A 4KZCA 2NBVB 2H88B 4N58A 4JE3B 2KJHB 3HM3A 2FE8A 2MP2A 3JSVB 4NJ7A 2KFKB 2WS3B 5HI1A 4DXFA 2BS2B 4ITKA 3NOBA 4ZRPA 3PREA 1FXAA 3AULA 2BQQA 1GPXA 2JXXA 2IO0B 4S0RA 1PQSA 1VZ6A 1D3ZA 2FIFA 5DPSA 4MGYE 2M8SA 1F1HA 2KDMA 2WLBA 2JYEA 3V6CB 3W5VB 2CJNA 1Y56A 3AB5A 1WGYA 4FBJB 4W9DA 4J3OD 2XK5A 1E8WA 4AJYB 2KVRA 4R3DA 3MC9A 1MHHE 1K53A 1QOFA 1EU4A 2PKOA 2KJ6A 1YQ4B 3BINA 2K1FA 4W9EA 3K9OB 4REZA 3AI5A 1SIJA 5E6NA 5C2TB 4J6IA 2WNMA 4M00A 2Z0EB 3W9CB 1DOYA 1HTQA 2CR5A 2REXA 3DPDA 2K3UA 1MI0A 3ZO5B 1E7VA 3WAPA 2KTRB 1TS3A 1CQVA 4L1BA 4GLSC 3W1YA 1E10A 2WXNA 2ZCCA 4HKZE 2NVUI 3H6NA 2ZNVB 2YEPF 3CSFA 5LNK1 2ZPNA 2MA9B 1I4RA 1JROA 4HLEA 3ML9A 4C7YA 1GNUA 1Q1OA 4HDOA 3BZDB 1WX7A 2MW5A 1I35A 5MPOA 2H89B 1WWTA 3L16A 1YMHE 2JXTA 3QARA 2JY6A 1WGKA 4FADA 1PUTA 1XD3B 3VHTC 3ZJUA 2WQYB 1WY8A 4C56C 1GAQB 3RZWC 2WXKA 4WJQA 2LASA 3ZNZB 5EDSA 5G55A 3UIOB 2IDYA 4XGAB 1V86A 1WMHA 2WXGA 5E6OA 2BF8B 4EKUA 2Y5BB 4F8CB 1T5XD 2PTLA 4E3CA 4MJSB 1UBIA 1WJ4A 3PRMB 4LDTB 3TEXA 3RZFA 3O13A 2KX0A 2YLMA 1J7BA 2JPHA 3PSEB 3FC4A 5D3IB 2X38A 5KHQA 2WDVB 3TEZA 4EZLA 3IAM1 3H7SA 2IGHA 4RGOS 4ZYSA 4N9F4 2L83A 4YTMB 1FFVA 2GOWA 4WAFA 3IT4B 2O2VB 2WX1A 3RNBC 3MC8A 2ICIA 2ZW1A 2PEAA 3URYA 1SXTA 1N5WA 2KACA 3V61A 1WI0A 3TBLD 2MWSB 2BS4B 2KK8A 3OJ4B 2JQRB 3R7QA 3HVDA 2CHXA 5D6JB 2M0XA 4MT5A 4PT5A 3A4SC 2KN4A 4XDDA 5BYSA 4O1NA 3U7ZA 2ACZB 3B08A 1LGRA 4N6EB 3AE3B 4NQKE 4HJGE 2ZCBA 3LJ3A 2VZKD 4YSZB 4P6VF 1E5WA 3ZXRA 4RF1A 4OZCA 3NZSA 4JGHB 3R7RA 4W9KA 4IM2A 2FCQA 2KD0A 3ZJTA 3A4RA 3VRBB 2RPVA 4WWOA 4AQ7A 1GC6A 1XXGA 1TBEA 3P4QB 5DPWA 2TSSA 3ENEA 2C5LC 3T9LA 2V1YA 1N60A 4IW0A 2LXAA 2CS4A 5HHDG 3AEAB 2FUHB 5HKHA 1IGCA 1C4PA 1XLNA 4WWMA 3BK1A 3CSTA 1UGJA 4DDID 1ISNA 3NS1A 1D5XC 1IUEA 1ZE3D 2INCC 2AQ2B 5E6JA 1T0QC 1YQ3B 2LD9A 2DZMA 3ZW3A 4WAAA 3RNEC 3J9CA 2RGFA 1SB3C 1XLQA 3VUYA 3N1ZC 4BKTA 1ZW7A 4ZHPA 3N20C 2VH2A 2MBHA 2DZIA 4NJ6A 4K81A 4C4VA 2WX0A 4GSWA 5FKAC 3AE6B 3TMPB 1WFYA 1ET9A 1TTNA 1F77A 3SHQA 5BMHA 2BKRB 2LVQA 3NVVA 5BMGA 5IO9A 3M63B 5TSSA 1K51A 1FMAD 1FNUA 4P1CC 3P4RB 2CKHB 2BYEA 3SFEB 2QEJC 3A9JA 5IOIA 3RD2A 2K6QA 2AL3A 2N7EA 4FHKA 3OLMD 2KJRA 2LGYA 3W1SA 1P9DU 1BT0A 2PLPA 2INPE 3RULA 3WALA 3NY5A 1TT5B 4JIOU 4W9HA 4IDIA 3AV8A 5CTRC 1JALA 1S1QB 3H7PA 4A9AA 3DCGA 1QILA 4JQWC 2V3SA 4BVUC 2NCNA 4GDLB 3X0WA 4A55A 1WGGA 1STEA 1EUVB 1ZXHA 3MHSD 3R3MA 2PJHA 2BS3B 5GMVA 1VZ8A 2BTEA 3L4PA 1IBXB 3RNFC 1ZUD2 2EMSA 4NAWA 2EELA 2JU6X 2V9HA 5D2MB 3GZNB 3TIXA 3VR9B 4B0MA 2GI9A 3TCAA 1AARA 1MPEA 4TSSA 5H8YE 4JL9A 3AEFB 1XCQL 3A33B 3ZRFA 4JLCA 4LK0M 2J0KA 3C19A 4WWPA 4RGTA 2J42A 2JWUA 4K7SA 1JQ4A 1K50A 2LI5A 1ROEA 4NJCA 1C79A 1CK1A 4GMVA 1WR6E 4WQOB 3PS6A 1C4AA 3LDZE 3L08A 4OZAA 1YOVB 2MJ3A 1OEYA 3VTUA 2GBNA 3Q8CA 1FO4A 5D7GA 1Q5WB 2OEDA 3NVZA 1I4GA 3HIZA 1QLBB 2MRPA 2NMQA 4G11A 2A5UA 1SE9A 2I2YA 2QILA 2ZEQA 2WXFA 2G9HD 1WXSA 2MBOA 3DWGC 1J8CA 3MJ5A 4W9FA 2O6VB 5J2RA 4HPLB 5LXIB 2LGDA 1QKZA 2MSED 3ZNHB 1M94A 4HPMB 2O6VA 1NBFC 3BVZA 2MEKA 1DOXA 3AE5B 3I3TB 2FCNA 2GB1A 1KM7A 1TJEA 4WJNA 1N62A 2INDC 2JZ3B 4RGMA 1WJNA 1ZPSA 3EECA 1I4PA 1P1AA 1FPYA 2Z8LA 3P2BA 1JRUA 3VXWA 1C9FA 1EWCA 3M95A 3KW5B 4EOYA 4OVUA 4CO7A 3P4PB 1G6JA 3GE3C 4ZRJA 3AE7B 1FNWA 2WWZA 3EA6A 4MH8A 5G2NA 2VH1A 2I38A 1ESFA 1V49A 4FJVB 3R8BA 1NI3A 1N63A 1GUAB 4PS3A 2SAKA 3R2IA 2L00B 4WJOA 3S2AA 1F52A 4FA6A 2NBUA 1KLGD 1QQRA 3KVFB 1JWSD 3DVGY 1MVKA 4KDIC 1V1OA 4ARCA 2KTFA 2MX2A 3ABVB 3SR6A 2MLBA 3L54A 2BBCA 2J52A 2UYZB 4FLHA 2NTTA 2BB6A 4ZRQA 1WXMA 2D3CA 2MP2B 1YD8U 2V4IB 3TJPA 4LNNA 3VFKA 1ET6A 2XN9C 3NG0A 3U8ZA 3FKYA 3ECIA 4BAXA 2WU2B 2N9XA 4W9CA 3U52E 3VR8B 4CQNA 4G0NB 3APDA 2ON8A 2HTHA 4DHZE 1KRHA 3Q3FA 4RF0A 5AUKA 2AYOB 3B2FA 1YQBA 2DNFA 3DOWA 4BKGA 3UF8A 1AWDA 1WM3A 3CIRB 2HD5B 1S3SG 2XK5B 1LQBA 4DHJD 3APCA 3OAWA 2WXIA 3NUHB 2IZVB 1PDXA 4MH0E 3Q8BA 4YXDB 4A6QA 2KN5A 3AU4A 4AUQC 2C60A 1KTKA 2K8CA 2X8XX 2JYTA 2YEPB 2AQ3B 2JVCA 4ANXA 1TY2A 4IM3A 2RDHA 1U4AA 4KKIA 2LWPA 3MC0B 1NYRA 3O65B 1ZDXA 4EE2A 1P7EA 4FULA 4IWOA 2RMMA 1BMLC 4IKGA 5BO4B 4HRSA 3KUDB 2I1KA 1CJEA 1V9JA 2L1AA 2PE9A 2WXMA 1FCLA 2K22A 4HXDA 4KX6B 1M4VA 2INNE 4DXGA 2N7DA 4KKJA 1FD6A 1KH0A 2K5PA 4MM3A 1RM6C 3DVGX 5C3JB 1E8XA 3ZNGC 2IYDB 3B0AA 2LJIA 2L0TA 2DENB 2KDEB 3RNCC 3VDZA 4AJWA 4XDCA 1FCCC 3IAS1 1N5XA 4ZDVA 2QDFA 4KIKB 3H8HA 4II2B 4I6PA 4IWQA 1QZEA 3T3OA 1NDDA 3OWEB 2WHIA 2AQ1B 3PRPB 1WMHB 2W82A 3VAWA 2D2QA 4GGQA 4OHJA 1JWMD 4LTUA 4KIKA 1KOTA 2PVGC 3BIID 3VUXA 4KGRA 1NENB 1HZ5A 3V60A 1OQQA 1XT9B 1EM7A 2MJEA 4FHJA 2KFJA 3RCZA 5BMIA 3UGBB 3ZDMC 2WDTB 1PFDA 3ZDTA 1V6EA 1QOAA 4JWSC 1C78A 3FILB 4KDLB 3QA8A 2HE7A 2SEBD 3RYTA 3W5UB 2NPTB 3ZYYX 2L05A 2EKEC 3U7DA 3IG3A 2A4ZA 2DZJA 2VRRB 4GDKA 3A1QA 1WH3A 3FILA 3TSSA 2IO3B 4NY0A 5FR6A 4H2AA 4M8NA 2NPTA 2GBJA 2LFIA 3JW0X 1I42A 1YJJA 3AE2B 3Q8FA 3PO0A 2V3NA 2WDRB 1OEYJ 1OQYA 3NZ3A 1WGHA 2MJDA 3X23A 2KDIA 1KFYB 3TEWA 4HROA 2LZ6A 1MHXA 4MGIE 1C3TA 3KUZA 3KH0A 5LXHA 2K8HA 2RR9A 1VRAB 4WJPA 2KZRA 3W1SC 2PIAA 1IPGA 2MBQA 4HJKA 3WANA 3DHGC 1ZDVA 3LB8C 2DAFA 2PMVA 3GZNI 2N9LA 1WE6A 1JWAD 3SEBA 1T0SC 3DVNV 4QAYA 1PGXA 1E7UA 4M0WA 2LJ5A 1R4NB 1T0YA 1TZ1A 2MH7A 1D5ZC 4GOCA 4LJPB 1AN8A 2KLGA 1T0RC 1HQRD 2C7HA 1EF1A 4YT0B 4S17A 3VUWA 5JHAA 1P98A 3I63C 1L6UA 2K9XA 4UDUC 2V0GA 3I9V1 1J7AA 2DYOA 1YJ1A 2EKIA 2OHFA 1OFFA 5IP4D 3N3KB 1V1PA 3W2DA 4DDGD 4EEWA 1XQQA 2N0SB 1V81A 2KC2A 3DBRB 2LRWA 3TL5A 1ZKHA 1E7PB 1SBBB 4LDTD 5I4DA 3AM9A 4MACA 1KF6B 5BYQA 3GB1A 3MTNB 4KVGB 2Y3AA 4LNIA 3HRDD 3KUCB 3KYDD 3PZ8A 4YTPB 4MGZE 3ZXVA 1XCTL 3U4EG 4C4VB 3BVMA 2M0AA 2Z0DB 3SDLC 1VCBA 2DBYA 4RCOA 2BKFA 3I57A 2AL6A 3PTFC 3ZTCA 2KMCA 1UF0A 1X1MA 4K7WA 1HTOA 3KWLA 2K39A 1V8CA 2KXJA 2OJRA 1I4QA 2JZPA 4TQ0A 4IWPA 2BWFA 2RD0A 3A9JB 1D5MC 3UI3A 2D5GA 3QX1A 3DHIC 3PV1A 4HVBA 4CYEA 2IO2B 2KKCA 3ZLZA 2L76A 1D6EC 4II3B 2N4FA 1HEZE 2GMIC 2KWUB 3PHWB 4B0EA 4P1BC 3H7PB 3QQ8B 4RH6A 3CMMB 4A20A 1FNVA 1UNSA 3CWIA 5T8IA 2KT7A 2FCSA 2KANA 1V2YA 2KX3A 4EZJA 3N1XC 2HTME 2LEKA 4B6WA 3DBLB 4NAWB 4RM9A 3RT3B 1F2RI 2J4XA 2JUOA 2DWQA 3IFWB 5JZEB 4BOSC 4NNJB 1UH6A 1TKGA 1L4ZB 2QC8A 4K3BA 3TEYA 1EU3A 3DWMA 1V5TA 3FAHA 1UBQA 4W9GA 2JX5A 2L32A 3PPAA 2KC1A 2LGSA 3ZJVA 4NPNA 3QCAA 5C1ZA 1YN5A 4DXAB 3N32A 3A9KA 3VRAB 2MHJA 3WAOA 3ZRCA 4LLGM 3M62B 3ZUNA 2LVPA 3GS2A 2KDFB 2NS5A 1UGMA 2NTSA 4FJYA 5G5HA 5IAAC 4ANUA 2IY0B 1K8RB 5JXVA 3BVGA 2ZVOA 4ZOHC 2N9EB 4AS1A 4I6LB 3RMKC 2LHDA 1UWMA 2Y5PA 3ALBA 3Q8AA 4W9LA 2BT6A 2DAJA 5IA7A 5BYRA 1HE8A 3WIMA 2WDQB 1XLOA 5CX3A 5HFYA 2KNBA 3DDCB 5D3DA 2WXRA 1E90A 1VJKA 4BZAA 2V4LA 2LMCA 2KQ4X 2ZVNA 2K25A 2XNAC 2BYFA 1LFDA 1XLPA 1L2NA 4KV2A 2JF5A 3ZKJC 2JWZA 3HUIA 5DPRA 2WP9B 2G1EA 5E6PA 1WX8A 4DBGA 1FIQA 5H92C 2K8BA 1WSPA 4P7IA 2FIDA 3L10B 4YL8A 3Q14C 1L0VB 4FXCA 2IO1B 2W3SA 1E0ZA 3MHZA 3LYYA 1MFWA 1RFKA 2L3ZA 2BYTA 1WRIA 1JWUD 4HPPA 4RGNA 1V97A 2J7QB 4AP4C 1PGBA 2C7MB 3VTVA 3NS8A 1YN3A 4HEA1 4KSKC 2V3PA 4TKNA 3VH4B 4EUTA 3R66C 3T3NA 2ZZPB 2EMTA 3NHEB 3PLVA 1KLUD 3U30A 4X57B 3UQAA 3RN9C 1EF5A 4US9A 4AWJA 2D11A 2CHZA 1C77A 4KGSA 1UD7A 2L8JA 5CHFA 4LJOB 4HCPB 2PPHA 1EWYC 2BB5A 3B9JA 1ZP0B 2WXQA 1TKYA 2W9NA 4F1SA 2KAJA 4PS7A 1CZPA 2MBEA 4FJZA 2WU5B 1OTRB 2NR2A 1WYGA 3QK0A 1RYJA 1C4CA 3AEGB 3Q3MC 3IVFA 1QOBA 3ZGZA 4WURA 2O6VD 3KYCD 4C00A 4JX1C 1N61A 1Z5SB 2BYVE 5AZFA 2R61A 4AOFA 4WQMA 1MG8A 1SIFA 4HK2A 3DBHB 2B76B 2FBWB 3AECB 1WF9A 4TUUA 4BKSD 4Q2JA 2G4SA 2N9KA 5EE1A 1SGHA 4B9KA 1A5RA 1F0ZA 4K7UA 2GLSA 3P63A 2IGDA 2KVZA 1F9JA 4GXBA 3Q3OC 1WXAA 1A70A 4A3OA 3JSVA 4BBNF 4A8XC 1FFUA 2R2OA 3AEEB 1TZOA 2KFKA 3M3JA 2FNJB 4L23A 3SFDB 2W3RA 1R4NI 2WYQA 4PYZA 2XEWA 2QHOA 3PT2B 2AEHA 2BGFA 1WM2A 2DX5B 1SE4A 2JRHA 1ZGUB 5EE3A 2M4NA 3C0RB 3H1UA 2UWQA 3IXSA 3D32A 1DYQA 1L5PA 1NYQA 2M17A 2HJ8A 1K52A 2IY1B 2N9PC 1QF6A 2GBRA 3NRZA 2LXCA 2DZKA 4ZRIA 4MM3B 4URKA 1E8YA 1I7HA 4EZKA 1L4DB 1WX9A 3DBRI 4GB9A 2KOXA 4BOZB 2RDGA 2WXOA 3EFUA 3OJ3A 1WXVA 4DHZB 1IP9A 3WCQA 2N1WA 2R2QA 3AXCA 2CJOA 2D3AA 2QSDA 3VH3B 3QC8B 3RPFC 2Q5WD 4HDQA 3V3XA 1Q0WB 4USAA 1YX6B 1WZ0A 1JMLA 4FN2A 2IGGA 2LHEA 1UZXB 2KTRA 2WXLA 4KZ0A 3KLSX 2VZKB 3AE9B 4GN1A 1KJTA 3AEDB 5CHVC 2PE6B 1L0XB 1JW9D 4IC7B 1YNTE 1KLVA 3GP7A 2AWTA 3B1LX 3U2SC 4GDKB 3A1QB 3WAMA 1XEEA 4XE0A 1VLBA 5IN7A 1WRDB 2E6XA 3BWUD 4TMAB 3SD5A 3P1MA 2IJ0A 3HHMA 2BVCA 2RPQA 1HZ6A 4ASWC 1WYWB 2KDBA 1XO3A 1TIFA 5IKCM 3QHTA 1GJZA 2KQSA 3NVYA 2M56B 1SF0A 3Q8EA 1V80A 4XX5A 3HK0A 4DQOC 4XWWA 4LNKA 2MQJA 4A90A 1R4MB 4M01A 4MJSA 3ZVVA 2J0JA 4OW0A 4OZBA 4WWNA 2KO3A 2YVCA 1SE2A 3AE4B 3DBLI 4YTNB 4MGKE 3APFA 3UQBA 2PVOD 4LNOA 1PYWD 5G5GA 4K3CA 3TUOA 1SJHD 1HXYD 2CHWA 1JCKB 2ZJDA 2NBWB 2DYMA 1YN4A 4MEMA 5AZHA 4M0WB 2E3TA 2O2VA 4LNFA 2JZZA 4C7ZA 1Y8RC 3ZIMA 5FK9C 5L83A 3WA0A 3IT6B 1T3QA 1OGWA 4HWIB 2D3BA 3B2GA 3Q3NC 4GU2A 5FR3A 1DGJA 3N30A 3Q69A 2KWVB 3UIPB 4EFOA 1CMXB 1RRBA 1GC7A 3Q2AC 2LUMA 4YSXB 2LGXA 1BUIC 1LXDA 2QMTA 3PLUA 3BY4B 1GG3A 1V1PB 3PVLA 3RNGC 2KHWB 4PS8A 3CF6E 4ANWA 3E56A 3C8YA 1TS2A 3IBEA 2D07B 3Q6BA 1RAXA 2WGSA 4C80A 3PZ7A 2I1JA 1LM8B 2QCZA 2J0MA 2M19A 3RFZB 2G3QB 1SSNA 2BW2A 3L17A 1IYFA 2KMAA 1P0RA 1SJED 4ACFA 3UINB 1TY0A 3JVZX 4P16A 4HCNB 1OQRA 2J53A 1DOIA 4L2YA 2FUG1 3DVNU 2KQ7A 4RNAA 4HKQA 2B3AA 3NVWA 1FXTB 5DCNA 3KWVA 1AYFA 3T8MA 4ANVA 3QWZB 3IHPC 2W55A 2FCMA 4I6NB 2RSUA 2BWES 1FRDA 3RNAC 2WXPA 3R2TA 3P42A 3JYUA 2DLBA 4MELA 3AE8B 2ZPYA 3DBSA 3VQIA 3EGRA 5AEKB 5GXGB 4YSYB 4W9IA 1Z2MA 2GBKA 1L0YB 1FXIA 1WE7A 2IPKD 2XBBC 1TGZB 1NI2A 4PYUA 1P3QU 5C23A 1T6BX 1WR1A 3BYTB 4MSQB 1N6ZA 2RDBC 1B1ZA 1E8ZA 4JPSA 1QOGA 5DPTA 3V62A 1MJDA 3PHXB 4ICVA 2CU1A 1WGDA 1Q10A 2K6DB 1IGDA 1WZ3A 3VTWA 4IG7B 2C9WB 3AEBB 2N7JA 4MDKE 1TS5A 4XZ4A 1VR9A 5J17A 1XF5L 4TQ1A 3BK2A 2K0PA 1YIWA 3SU8X 1FEHA 3L13A 2Z59B 4G3XB 1R7SA 2N1VA 3I5JC 1VDVA 3EFCA 2WXHA 1TS4A 2GBMA 3PGEA 1P7FA 4W9JA 1I4HA 2KLCA 2OJWA 1E6EB 1SE3A 4MSMB 5J18A 3GE8C 1LO5D 2QIEB 4K1RB 1VZ7A 3L0WB 4A3PA 3A9KB 4JWUC 1ENFA 2FAZA 2G45B 3ZTDA 1J7CA 3DBHI 3DQVA 3AN1A 3P4SB 2ZW0A 4WIPA 2G4DB 1V5OA 2OOBB 1GB1A 4WH4A 3ZQ4A 4F7ZA 3VVWB 4IM0A 1TYGB 3PRZA 4GDLA 3LXFA 4ZRKA 4ARIA 4RMAA 4BBNC 1IBXA 1GB4A 1L7YA 2MBBB 2KWCA 4RM8A 1UWXA 1ZOYB 2ONQA 3EHVA 1JRPA 3QJZA 4IOIE 4OVVA 2AX5A 4ICUA 4YWGG 2MCNB 2KYWA 2W54A 4NQLB 1E9MA 3HM6X 4US8A 3QAQA 2KWDA 2JT4B 3EC8A 3AE1B 1F2RC
chains in the Genus database with same CATH topology
4ZHPA 2B76B 2FBWB 3ETRA 3AECB 1C76A 1UUPA 4NAMA 4Q2JA 5EE1A 2N9KA 3MFGA 3FILA 3TSSA 2PW9A 1F0ZA 2CU3A 3P63A 4ZHOA 2IGDA 2WXJA 4H2AA 4NZLB 4XWTA 2LFIA 5FKAC 1D4BA 3AE6B 1A70A 1YJJA 3AE2B 3BYYB 3Q8FA 4A8XC 1FFUA 3AEEB 1TZOA 3PO0A 4L23A 3SFDB 2V3NA 2W3RA 2WDRB 1ET9A 1YJIA 1F77A 3NZ3A 5BMHA 1FRRA 2MJDA 1QT9A 1WXQA 3NVVA 1KFYB 1SE4A 3TEWA 5BMGA 4HROA 1MHXA 5TSSA 1PGAA 1K51A 5EE3A 1FMAD 1FNUA 4N59A 1GOZA 4RFBA 3IXSA 1DYQA 1L5PA 1VRAB 1NYQA 2LGIA 3P4RB 1NEKB 2PIAA 4OVZA 1K52A 3SFEB 2QEJC 1QF6A 4D2KA 1ZDVA 1I4XA 3NRZA 3LB8C 2PMVA 4MM3B 3W1SA 1I7HA 2N9LA 3AMZA 1L4DB 3E9SA 2PLPA 2INPE 1JWAD 2RDGA 3SEBA 1NVID 1AW7A 2QJLA 3HVZA 2WXOA 1PGXA 4M0WA 1SEBD 4IDIA 2L52A 2MH7A 1D5ZC 3AH7A 3WCQA 3AV8A 1JALA 1AN8A 2Y5CA 5HG2A 1FM0D 1HQRD 2CJOA 4YT0B 2QSDA 2HDEA 3MP9A 4A9AA 1QILA 3RPFC 1JWBD 2Q5WD 3V3XA 4GDLB 4A55A 1TKEA 1L6UA 2KMMA 4USAA 1STEA 2GRIA 2K9XA 4UDUC 1ZXHA 2V0GA 3I9V1 1JMLA 1J7AA 4KGTA 2IGGA 2BS3B 2LHEA 1VZ8A 2DYOA 2EKIA 2OHFA 2BTEA 3L4PA 1IBXB 1OFFA 2WXLA 5EE9A 1ZUD2 1V1PA 1ZXIA 3W2DA 3KLSX 2EELA 2VZKB 2JU6X 3AE9B 5EE0A 2N0SB 4B0MA 3VR9B 1BXTA 2GI9A 1ACCA 1MPEA 4TSSA 5H8YE 3AEDB 3AEFB 3N9YC 1XCQL 1L0XB 1E7PB 1JW9D 1SBBB 4LK0M 5I4DA 5AUIA 1YNTE 3AM9A 4MACA 1KF6B 5BYQA 3GB1A 4RGTA 1L6VA 2J42A 2Y3AA 2JWUA 3HRDD 3GP7A 1RWSA 3KQ4A 3U2SC 1K50A 1JQ4A 4GDKB 1B9RA 1ROEA 4NJCA 3PZ8A 1C79A 3V05A 4YTPB 1CK1A 2JSVX 1XEEA 1HA5A 1VLBA 3EUB2 4XE0A 2E6XA 3BWUD 1C4AA 4TMAB 3P1MA 2H88B 1XCTL 4OZAA 2IJ0A 3U4EG 3BVMA 2MJ3A 2M0AA 4N58A 2DBYA 4JE3B 1HZ6A 2FE8A 4RCOA 2WS3B 3I57A 5HI1A 4DXFA 2BS2B 1XO3A 3Q8CA 4ITKA 1FO4A 5D7GA 3NVZA 2OEDA 4ZRPA 1I4GA 1QLBB 1FXAA 1GPXA 2NMQA 3NVYA 2M56B 1SF0A 1VZ6A 2I2YA 2QILA 3Q8EA 2WXFA 3KWLA 2G9HD 1V8CA 3DWGC 2KDMA 3MJ5A 2WLBA 2JYEA 4DQOC 4XWWA 1I4QA 3W5VB 2CJNA 4A90A 2JZPA 4TQ0A 1Y56A 3AB5A 4OW0A 4OZBA 1SE2A 1D5MC 3UI3A 2D5GA 3AE4B 1QKZA 4YTNB 4J3OD 2PVOD 1PYWD 4R3DA 5G5GA 1MHHE 3TUOA 1SJHD 1HXYD 1K53A 3BVZA 1QOFA 1EU4A 2PKOA 1JCKB 1D6EC 2MEKA 3AE5B 1DOXA 2DYMA 1YN4A 1HEZE 2GB1A 1YQ4B 2E3TA 4B0EA 1TJEA 4C7ZA 1N62A 5FK9C 4RGMA 4REZA 1SIJA 5C2TB 3IT6B 4RH6A 1T3QA 2WNMA 1ZPSA 1I4PA 1FNVA 3B2GA 2Z8LA 1UNSA 5FR3A 1DGJA 1C9FA 1EWCA 3W9CB 3Q69A 3CWIA 5T8IA 1DOYA 2LUMA 3P4PB 4YSXB 2K3UA 1MI0A 3AE7B 1BUIC 1FNWA 2HTME 1TS3A 3EA6A 2LEKA 4MH8A 2QMTA 2I38A 1ESFA 1CQVA 1V1PB 4NAWB 4L1BA 4GLSC 3R8BA 1NI3A 1F2RI 1N63A 2J4XA 1E10A 2DWQA 2WXNA 3E56A 4HKZE 2SAKA 3C8YA 1TS2A 3R2IA 4C80A 3PZ7A 1KLGD 1QQRA 2M19A 3RFZB 1JWSD 1MVKA 1SSNA 2BW2A 1TKGA 2YEPF 5LNK1 1L4ZB 1V1OA 3TEYA 1EU3A 1SJED 3DWMA 3FAHA 1I4RA 4ARCA 1TY0A 1JROA 3ABVB 2JX5A 4P16A 3SR6A 4C7YA 2L32A 1OQRA 2J53A 3ZJVA 1DOIA 4L2YA 3BZDB 2FUG1 2BBCA 4RNAA 2J52A 2H89B 5MPOA 4HKQA 1WWTA 3NVWA 3KWVA 1AYFA 2NTTA 1YMHE 2BB6A 1YN5A 2JXTA 1WGKA 4ZRQA 3VRAB 4LLGM 1PUTA 2V4IB 3GS2A 3ZJUA 2W55A 2WQYB 4C56C 1GAQB 1ET6A 2WXKA 2XN9C 1FRDA 2NTSA 5G5HA 2WXPA 3R2TA 3P42A 2WU2B 2IDYA 5JXVA 3U52E 3VR8B 2DLBA 2WXGA 3BVGA 3AE8B 4CQNA 4ZOHC 3VQIA 3EGRA 2ON8A 1KRHA 1T5XD 2PTLA 5GXGB 4AS1A 4YSYB 4RF0A 5AUKA 2LHDA 1L0YB 1UWMA 2Y5PA 3B2FA 3Q8AA 1FXIA 2IPKD 3TEXA 1AWDA 2BT6A 3CIRB 3O13A 5BYRA 1J7BA 3FC4A 2WDQB 5D3IB 1XLOA 5HFYA 1T6BX 2X38A 2WDVB 5D3DA 3TEZA 2WXIA 2WXRA 3BYTB 3IAM1 3NUHB 1VJKA 2IGHA 1PDXA 4RGOS 4ZYSA 2LMCA 2KQ4X 2XNAC 3Q8BA 1B1ZA 2L83A 4YXDB 4YTMB 4JPSA 1FFVA 1XLPA 4A6QA 1QOGA 4WAFA 3HUIA 3IT4B 1KTKA 2ICIA 2G1EA 2WP9B 2ZW1A 1Q10A 3URYA 1IGDA 1N5WA 1SXTA 1FIQA 2JYTA 2KACA 2YEPB 5H92C 2AQ3B 1WSPA 2BS4B 3AEBB 1TY2A 2N7JA 1TS5A 2RDHA 2JQRB 1L0VB 4KKIA 1VR9A 3HVDA 4FXCA 3MC0B 2W3SA 1NYRA 1XF5L 4MT5A 1ZDXA 4TQ1A 3BK2A 2K0PA 3MHZA 4EE2A 3LYYA 4PT5A 1E0ZA 1P7EA 1FEHA 1RFKA 2BYTA 2KN4A 1WRIA 2RMMA 4XDDA 5BYSA 1JWUD 1BMLC 4O1NA 3U7ZA 2ACZB 4IKGA 4RGNA 1V97A 4HRSA 1R7SA 1PGBA 4N6EB 3AE3B 1VDVA 1CJEA 2L1AA 2WXHA 4HJGE 1TS4A 2VZKD 1YN3A 2WXMA 4P6VF 4YSZB 4HEA1 4OZCA 2V3PA 4RF1A 1FCLA 2K22A 4KX6B 1M4VA 2INNE 1P7FA 4DXGA 4KKJA 3T3NA 1I4HA 3ZJTA 3VRBB 1FD6A 1KH0A 1KLUD 2K5PA 2RPVA 1E6EB 1RM6C 1SE3A 5C3JB 4AQ7A 1LO5D 2QIEB 2LJIA 1VZ7A 1XXGA 3P4QB 4US9A 4JWUC 1ENFA 1C77A 4XDCA 4KGSA 1FCCC 2TSSA 3IAS1 1N5XA 1J7CA 3AN1A 3H8HA 3P4SB 2ZW0A 4WIPA 1N60A 3T3OA 1EWYC 1GB1A 4WH4A 2BB5A 3OWEB 3ZQ4A 3B9JA 1ZP0B 2WXQA 2AQ1B 1TKYA 2W82A 5HHDG 3AEAB 1TYGB 1IGCA 2KAJA 1CZPA 1C4PA 4OHJA 3LXFA 1JWMD 4LTUA 1XLNA 4WWMA 2WU5B 2PVGC 3BIID 3BK1A 4KGRA 1NENB 4ARIA 1HZ5A 1IBXA 1GB4A 1WYGA 1OQQA 1UWXA 1UGJA 1ZOYB 2ONQA 1EM7A 2MJEA 1RYJA 1C4CA 3AEGB 3NS1A 1D5XC 1JRPA 1IUEA 1QOBA 5BMIA 3ZGZA 1ZE3D 4WURA 4IOIE 2AQ2B 2AX5A 5E6JA 1PFDA 4YWGG 1YQ3B 1QOAA 4JWSC 1C78A 4JX1C 3FILB 1N61A 2W54A 3J9CA 1SB3C 2R61A 2SEBD 1E9MA 1XLQA 4WQMA 4US8A 2KWDA 3W5UB 3AE1B 3ZYYX 1F2RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMT A;  2I38 A;  2N7J A;  4GLS C;  1YNT E;  1F2R I;  2N9K A;  4MAC A;  3GB1 A;  3FIL A;  4HKZ E;  1XF5 L;  2PW9 A;  2JWU A;  2K0P A;  1P7E A;  2IGD A;  1K50 A;  2KN4 A;  2RMM A;  1D4B A;  4IKG A;  1MVK A;  2JSV X;  1PGB A;  1XCT L;  4OZA A;  4HJG E;  5BMH A;  4OZC A;  1FCL A;  2J53 A;  1HZ6 A;  2J52 A;  5BMG A;  1MHX A;  1P7F A;  5HI1 A;  1PGA A;  1K51 A;  1YMH E;  2JXT A;  2OED A;  1FD6 A;  1KH0 A;  2NMQ A;  2RPV A;  2LGI A;  2I2Y A;  1K52 A;  4D2K A;  1F2R C;  2KDM A;  2N9L A;  2JZP A;  4KGS A;  5JXV A;  1FCC C;  4OZB A;  2PLP A;  2ZW0 A;  3UI3 A;  2ON8 A;  1QKZ A;  2PTL A;  1GB1 A;  4WH4 A;  2LHD A;  1PGX A;  5HHD G;  1MHH E;  1IGC A;  1K53 A;  5HG2 A;  2QSD A;  4KGR A;  5HFY A;  3MP9 A;  1HZ5 A;  1IBX A;  1HEZ E;  1GB4 A;  2GB1 A;  3V3X A;  1UWX A;  2ONQ A;  1EM7 A;  2IGH A;  2KQ4 X;  1ZXH A;  5BMI A;  1JML A;  4KGT A;  2IGG A;  2LHE A;  4IOI E;  1IBX B;  1C9F A;  2ZW1 A;  2EEL A;  1Q10 A;  2JU6 X;  3FIL B;  1IGD A;  2LUM A;  2KAC A;  2GI9 A;  1MI0 A;  2KWD A;  1MPE A;  1XCQ L; 
#chains in the Genus database with same CATH topology
 1EO6 A;  5JH5 C;  3ETR A;  1C76 A;  1UUP A;  2DHZ A;  4NAM A;  4XC2 A;  4KSL C;  2C7N B;  3MFG A;  3ONS A;  3OG5 A;  3RUI B;  2PW9 A;  3PZD A;  2CU3 A;  4ZHO A;  2WXJ A;  1J0G A;  4NZL B;  1H4R A;  4XWT A;  1D4B A;  1WGR A;  4PK1 A;  1RLF A;  1MG4 A;  3NZU A;  3BYY B;  1UEL A;  4TV3 A;  4XYC A;  1YJI A;  1FRR A;  1QT9 A;  3MJW A;  1WXQ A;  2HJ1 A;  5AZG A;  1WJ6 A;  1J19 A;  5D94 A;  1PGA A;  3K9P B;  4N59 A;  1GOZ A;  4RFB A;  4DHJ B;  2LVO A;  4IUM B;  2M1M A;  2LGI A;  3ML8 A;  1NEK B;  4OVZ A;  3GOE A;  3Q3J A;  4M8M A;  4D2K A;  5L95 C;  1I4X A;  1H8C A;  4G50 A;  4GIV A;  1WIA A;  2L7R A;  3AMZ A;  4E74 A;  3E9S A;  4BKS A;  1VD2 A;  4DK5 A;  3ZNI D;  4B95 A;  1NVI D;  1AW7 A;  2QJL A;  2D10 A;  3HVZ A;  4BFR A;  1SEB D;  1YX5 B;  2L52 A;  3AH7 A;  2DYB A;  2Y5C A;  5HG2 A;  3QIJ A;  1FM0 D;  2HDE A;  3MP9 A;  2L0F A;  1JWB D;  2LUE A;  3AU5 A;  1TKE A;  2KMM A;  2D3G A;  2GRI A;  5JHB A;  4KGT A;  4CHK A;  5EE9 A;  1ZXI A;  2IBI B;  4LCD E;  3V6E B;  2ZNV C;  2ASQ A;  5EE0 A;  1BXT A;  4ZYN A;  3NJT A;  1ACC A;  1C1Y B;  3H9D A;  5TR5 A;  3N9Y C;  5KHO A;  3RI7 C;  5LLI A;  2UU7 A;  4M02 A;  5CHW A;  5AUI A;  3DHH C;  2LRU A;  1WJU A;  1L6V A;  1R4M I;  3N1Y C;  4DWF A;  1RWS A;  3KQ4 A;  1RFA A;  1B9R A;  2BPS A;  2JRI B;  3V05 A;  4E71 A;  2JSV X;  3EUB 2;  1HA5 A;  4KZC A;  2NBV B;  2H88 B;  4N58 A;  4JE3 B;  2KJH B;  3HM3 A;  2FE8 A;  2MP2 A;  3JSV B;  4NJ7 A;  2KFK B;  2WS3 B;  5HI1 A;  4DXF A;  2BS2 B;  4ITK A;  3NOB A;  4ZRP A;  3PRE A;  1FXA A;  3AUL A;  2BQQ A;  1GPX A;  2JXX A;  2IO0 B;  4S0R A;  1PQS A;  1VZ6 A;  1D3Z A;  2FIF A;  5DPS A;  4MGY E;  2M8S A;  1F1H A;  2KDM A;  2WLB A;  2JYE A;  3V6C B;  3W5V B;  2CJN A;  1Y56 A;  3AB5 A;  1WGY A;  4FBJ B;  4W9D A;  4J3O D;  2XK5 A;  1E8W A;  4AJY B;  2KVR A;  4R3D A;  3MC9 A;  1MHH E;  1K53 A;  1QOF A;  1EU4 A;  2PKO A;  2KJ6 A;  1YQ4 B;  3BIN A;  2K1F A;  4W9E A;  3K9O B;  4REZ A;  3AI5 A;  1SIJ A;  5E6N A;  5C2T B;  4J6I A;  2WNM A;  4M00 A;  2Z0E B;  3W9C B;  1DOY A;  1HTQ A;  2CR5 A;  2REX A;  3DPD A;  2K3U A;  1MI0 A;  3ZO5 B;  1E7V A;  3WAP A;  2KTR B;  1TS3 A;  1CQV A;  4L1B A;  4GLS C;  3W1Y A;  1E10 A;  2WXN A;  2ZCC A;  4HKZ E;  2NVU I;  3H6N A;  2ZNV B;  2YEP F;  3CSF A;  5LNK 1;  2ZPN A;  2MA9 B;  1I4R A;  1JRO A;  4HLE A;  3ML9 A;  4C7Y A;  1GNU A;  1Q1O A;  4HDO A;  3BZD B;  1WX7 A;  2MW5 A;  1I35 A;  5MPO A;  2H89 B;  1WWT A;  3L16 A;  1YMH E;  2JXT A;  3QAR A;  2JY6 A;  1WGK A;  4FAD A;  1PUT A;  1XD3 B;  3VHT C;  3ZJU A;  2WQY B;  1WY8 A;  4C56 C;  1GAQ B;  3RZW C;  2WXK A;  4WJQ A;  2LAS A;  3ZNZ B;  5EDS A;  5G55 A;  3UIO B;  2IDY A;  4XGA B;  1V86 A;  1WMH A;  2WXG A;  5E6O A;  2BF8 B;  4EKU A;  2Y5B B;  4F8C B;  1T5X D;  2PTL A;  4E3C A;  4MJS B;  1UBI A;  1WJ4 A;  3PRM B;  4LDT B;  3TEX A;  3RZF A;  3O13 A;  2KX0 A;  2YLM A;  1J7B A;  2JPH A;  3PSE B;  3FC4 A;  5D3I B;  2X38 A;  5KHQ A;  2WDV B;  3TEZ A;  4EZL A;  3IAM 1;  3H7S A;  2IGH A;  4RGO S;  4ZYS A;  4N9F 4;  2L83 A;  4YTM B;  1FFV A;  2GOW A;  4WAF A;  3IT4 B;  2O2V B;  2WX1 A;  3RNB C;  3MC8 A;  2ICI A;  2ZW1 A;  2PEA A;  3URY A;  1SXT A;  1N5W A;  2KAC A;  3V61 A;  1WI0 A;  3TBL D;  2MWS B;  2BS4 B;  2KK8 A;  3OJ4 B;  2JQR B;  3R7Q A;  3HVD A;  2CHX A;  5D6J B;  2M0X A;  4MT5 A;  4PT5 A;  3A4S C;  2KN4 A;  4XDD A;  5BYS A;  4O1N A;  3U7Z A;  2ACZ B;  3B08 A;  1LGR A;  4N6E B;  3AE3 B;  4NQK E;  4HJG E;  2ZCB A;  3LJ3 A;  2VZK D;  4YSZ B;  4P6V F;  1E5W A;  3ZXR A;  4RF1 A;  4OZC A;  3NZS A;  4JGH B;  3R7R A;  4W9K A;  4IM2 A;  2FCQ A;  2KD0 A;  3ZJT A;  3A4R A;  3VRB B;  2RPV A;  4WWO A;  4AQ7 A;  1GC6 A;  1XXG A;  1TBE A;  3P4Q B;  5DPW A;  2TSS A;  3ENE A;  2C5L C;  3T9L A;  2V1Y A;  1N60 A;  4IW0 A;  2LXA A;  2CS4 A;  5HHD G;  3AEA B;  2FUH B;  5HKH A;  1IGC A;  1C4P A;  1XLN A;  4WWM A;  3BK1 A;  3CST A;  1UGJ A;  4DDI D;  1ISN A;  3NS1 A;  1D5X C;  1IUE A;  1ZE3 D;  2INC C;  2AQ2 B;  5E6J A;  1T0Q C;  1YQ3 B;  2LD9 A;  2DZM A;  3ZW3 A;  4WAA A;  3RNE C;  3J9C A;  2RGF A;  1SB3 C;  1XLQ A;  3VUY A;  3N1Z C;  4BKT A;  1ZW7 A;  4ZHP A;  3N20 C;  2VH2 A;  2MBH A;  2DZI A;  4NJ6 A;  4K81 A;  4C4V A;  2WX0 A;  4GSW A;  5FKA C;  3AE6 B;  3TMP B;  1WFY A;  1ET9 A;  1TTN A;  1F77 A;  3SHQ A;  5BMH A;  2BKR B;  2LVQ A;  3NVV A;  5BMG A;  5IO9 A;  3M63 B;  5TSS A;  1K51 A;  1FMA D;  1FNU A;  4P1C C;  3P4R B;  2CKH B;  2BYE A;  3SFE B;  2QEJ C;  3A9J A;  5IOI A;  3RD2 A;  2K6Q A;  2AL3 A;  2N7E A;  4FHK A;  3OLM D;  2KJR A;  2LGY A;  3W1S A;  1P9D U;  1BT0 A;  2PLP A;  2INP E;  3RUL A;  3WAL A;  3NY5 A;  1TT5 B;  4JIO U;  4W9H A;  4IDI A;  3AV8 A;  5CTR C;  1JAL A;  1S1Q B;  3H7P A;  4A9A A;  3DCG A;  1QIL A;  4JQW C;  2V3S A;  4BVU C;  2NCN A;  4GDL B;  3X0W A;  4A55 A;  1WGG A;  1STE A;  1EUV B;  1ZXH A;  3MHS D;  3R3M A;  2PJH A;  2BS3 B;  5GMV A;  1VZ8 A;  2BTE A;  3L4P A;  1IBX B;  3RNF C;  1ZUD 2;  2EMS A;  4NAW A;  2EEL A;  2JU6 X;  2V9H A;  5D2M B;  3GZN B;  3TIX A;  3VR9 B;  4B0M A;  2GI9 A;  3TCA A;  1AAR A;  1MPE A;  4TSS A;  5H8Y E;  4JL9 A;  3AEF B;  1XCQ L;  3A33 B;  3ZRF A;  4JLC A;  4LK0 M;  2J0K A;  3C19 A;  4WWP A;  4RGT A;  2J42 A;  2JWU A;  4K7S A;  1JQ4 A;  1K50 A;  2LI5 A;  1ROE A;  4NJC A;  1C79 A;  1CK1 A;  4GMV A;  1WR6 E;  4WQO B;  3PS6 A;  1C4A A;  3LDZ E;  3L08 A;  4OZA A;  1YOV B;  2MJ3 A;  1OEY A;  3VTU A;  2GBN A;  3Q8C A;  1FO4 A;  5D7G A;  1Q5W B;  2OED A;  3NVZ A;  1I4G A;  3HIZ A;  1QLB B;  2MRP A;  2NMQ A;  4G11 A;  2A5U A;  1SE9 A;  2I2Y A;  2QIL A;  2ZEQ A;  2WXF A;  2G9H D;  1WXS A;  2MBO A;  3DWG C;  1J8C A;  3MJ5 A;  4W9F A;  2O6V B;  5J2R A;  4HPL B;  5LXI B;  2LGD A;  1QKZ A;  2MSE D;  3ZNH B;  1M94 A;  4HPM B;  2O6V A;  1NBF C;  3BVZ A;  2MEK A;  1DOX A;  3AE5 B;  3I3T B;  2FCN A;  2GB1 A;  1KM7 A;  1TJE A;  4WJN A;  1N62 A;  2IND C;  2JZ3 B;  4RGM A;  1WJN A;  1ZPS A;  3EEC A;  1I4P A;  1P1A A;  1FPY A;  2Z8L A;  3P2B A;  1JRU A;  3VXW A;  1C9F A;  1EWC A;  3M95 A;  3KW5 B;  4EOY A;  4OVU A;  4CO7 A;  3P4P B;  1G6J A;  3GE3 C;  4ZRJ A;  3AE7 B;  1FNW A;  2WWZ A;  3EA6 A;  4MH8 A;  5G2N A;  2VH1 A;  2I38 A;  1ESF A;  1V49 A;  4FJV B;  3R8B A;  1NI3 A;  1N63 A;  1GUA B;  4PS3 A;  2SAK A;  3R2I A;  2L00 B;  4WJO A;  3S2A A;  1F52 A;  4FA6 A;  2NBU A;  1KLG D;  1QQR A;  3KVF B;  1JWS D;  3DVG Y;  1MVK A;  4KDI C;  1V1O A;  4ARC A;  2KTF A;  2MX2 A;  3ABV B;  3SR6 A;  2MLB A;  3L54 A;  2BBC A;  2J52 A;  2UYZ B;  4FLH A;  2NTT A;  2BB6 A;  4ZRQ A;  1WXM A;  2D3C A;  2MP2 B;  1YD8 U;  2V4I B;  3TJP A;  4LNN A;  3VFK A;  1ET6 A;  2XN9 C;  3NG0 A;  3U8Z A;  3FKY A;  3ECI A;  4BAX A;  2WU2 B;  2N9X A;  4W9C A;  3U52 E;  3VR8 B;  4CQN A;  4G0N B;  3APD A;  2ON8 A;  2HTH A;  4DHZ E;  1KRH A;  3Q3F A;  4RF0 A;  5AUK A;  2AYO B;  3B2F A;  1YQB A;  2DNF A;  3DOW A;  4BKG A;  3UF8 A;  1AWD A;  1WM3 A;  3CIR B;  2HD5 B;  1S3S G;  2XK5 B;  1LQB A;  4DHJ D;  3APC A;  3OAW A;  2WXI A;  3NUH B;  2IZV B;  1PDX A;  4MH0 E;  3Q8B A;  4YXD B;  4A6Q A;  2KN5 A;  3AU4 A;  4AUQ C;  2C60 A;  1KTK A;  2K8C A;  2X8X X;  2JYT A;  2YEP B;  2AQ3 B;  2JVC A;  4ANX A;  1TY2 A;  4IM3 A;  2RDH A;  1U4A A;  4KKI A;  2LWP A;  3MC0 B;  1NYR A;  3O65 B;  1ZDX A;  4EE2 A;  1P7E A;  4FUL A;  4IWO A;  2RMM A;  1BML C;  4IKG A;  5BO4 B;  4HRS A;  3KUD B;  2I1K A;  1CJE A;  1V9J A;  2L1A A;  2PE9 A;  2WXM A;  1FCL A;  2K22 A;  4HXD A;  4KX6 B;  1M4V A;  2INN E;  4DXG A;  2N7D A;  4KKJ A;  1FD6 A;  1KH0 A;  2K5P A;  4MM3 A;  1RM6 C;  3DVG X;  5C3J B;  1E8X A;  3ZNG C;  2IYD B;  3B0A A;  2LJI A;  2L0T A;  2DEN B;  2KDE B;  3RNC C;  3VDZ A;  4AJW A;  4XDC A;  1FCC C;  3IAS 1;  1N5X A;  4ZDV A;  2QDF A;  4KIK B;  3H8H A;  4II2 B;  4I6P A;  4IWQ A;  1QZE A;  3T3O A;  1NDD A;  3OWE B;  2WHI A;  2AQ1 B;  3PRP B;  1WMH B;  2W82 A;  3VAW A;  2D2Q A;  4GGQ A;  4OHJ A;  1JWM D;  4LTU A;  4KIK A;  1KOT A;  2PVG C;  3BII D;  3VUX A;  4KGR A;  1NEN B;  1HZ5 A;  3V60 A;  1OQQ A;  1XT9 B;  1EM7 A;  2MJE A;  4FHJ A;  2KFJ A;  3RCZ A;  5BMI A;  3UGB B;  3ZDM C;  2WDT B;  1PFD A;  3ZDT A;  1V6E A;  1QOA A;  4JWS C;  1C78 A;  3FIL B;  4KDL B;  3QA8 A;  2HE7 A;  2SEB D;  3RYT A;  3W5U B;  2NPT B;  3ZYY X;  2L05 A;  2EKE C;  3U7D A;  3IG3 A;  2A4Z A;  2DZJ A;  2VRR B;  4GDK A;  3A1Q A;  1WH3 A;  3FIL A;  3TSS A;  2IO3 B;  4NY0 A;  5FR6 A;  4H2A A;  4M8N A;  2NPT A;  2GBJ A;  2LFI A;  3JW0 X;  1I42 A;  1YJJ A;  3AE2 B;  3Q8F A;  3PO0 A;  2V3N A;  2WDR B;  1OEY J;  1OQY A;  3NZ3 A;  1WGH A;  2MJD A;  3X23 A;  2KDI A;  1KFY B;  3TEW A;  4HRO A;  2LZ6 A;  1MHX A;  4MGI E;  1C3T A;  3KUZ A;  3KH0 A;  5LXH A;  2K8H A;  2RR9 A;  1VRA B;  4WJP A;  2KZR A;  3W1S C;  2PIA A;  1IPG A;  2MBQ A;  4HJK A;  3WAN A;  3DHG C;  1ZDV A;  3LB8 C;  2DAF A;  2PMV A;  3GZN I;  2N9L A;  1WE6 A;  1JWA D;  3SEB A;  1T0S C;  3DVN V;  4QAY A;  1PGX A;  1E7U A;  4M0W A;  2LJ5 A;  1R4N B;  1T0Y A;  1TZ1 A;  2MH7 A;  1D5Z C;  4GOC A;  4LJP B;  1AN8 A;  2KLG A;  1T0R C;  1HQR D;  2C7H A;  1EF1 A;  4YT0 B;  4S17 A;  3VUW A;  5JHA A;  1P98 A;  3I63 C;  1L6U A;  2K9X A;  4UDU C;  2V0G A;  3I9V 1;  1J7A A;  2DYO A;  1YJ1 A;  2EKI A;  2OHF A;  1OFF A;  5IP4 D;  3N3K B;  1V1P A;  3W2D A;  4DDG D;  4EEW A;  1XQQ A;  2N0S B;  1V81 A;  2KC2 A;  3DBR B;  2LRW A;  3TL5 A;  1ZKH A;  1E7P B;  1SBB B;  4LDT D;  5I4D A;  3AM9 A;  4MAC A;  1KF6 B;  5BYQ A;  3GB1 A;  3MTN B;  4KVG B;  2Y3A A;  4LNI A;  3HRD D;  3KUC B;  3KYD D;  3PZ8 A;  4YTP B;  4MGZ E;  3ZXV A;  1XCT L;  3U4E G;  4C4V B;  3BVM A;  2M0A A;  2Z0D B;  3SDL C;  1VCB A;  2DBY A;  4RCO A;  2BKF A;  3I57 A;  2AL6 A;  3PTF C;  3ZTC A;  2KMC A;  1UF0 A;  1X1M A;  4K7W A;  1HTO A;  3KWL A;  2K39 A;  1V8C A;  2KXJ A;  2OJR A;  1I4Q A;  2JZP A;  4TQ0 A;  4IWP A;  2BWF A;  2RD0 A;  3A9J B;  1D5M C;  3UI3 A;  2D5G A;  3QX1 A;  3DHI C;  3PV1 A;  4HVB A;  4CYE A;  2IO2 B;  2KKC A;  3ZLZ A;  2L76 A;  1D6E C;  4II3 B;  2N4F A;  1HEZ E;  2GMI C;  2KWU B;  3PHW B;  4B0E A;  4P1B C;  3H7P B;  3QQ8 B;  4RH6 A;  3CMM B;  4A20 A;  1FNV A;  1UNS A;  3CWI A;  5T8I A;  2KT7 A;  2FCS A;  2KAN A;  1V2Y A;  2KX3 A;  4EZJ A;  3N1X C;  2HTM E;  2LEK A;  4B6W A;  3DBL B;  4NAW B;  4RM9 A;  3RT3 B;  1F2R I;  2J4X A;  2JUO A;  2DWQ A;  3IFW B;  5JZE B;  4BOS C;  4NNJ B;  1UH6 A;  1TKG A;  1L4Z B;  2QC8 A;  4K3B A;  3TEY A;  1EU3 A;  3DWM A;  1V5T A;  3FAH A;  1UBQ A;  4W9G A;  2JX5 A;  2L32 A;  3PPA A;  2KC1 A;  2LGS A;  3ZJV A;  4NPN A;  3QCA A;  5C1Z A;  1YN5 A;  4DXA B;  3N32 A;  3A9K A;  3VRA B;  2MHJ A;  3WAO A;  3ZRC A;  4LLG M;  3M62 B;  3ZUN A;  2LVP A;  3GS2 A;  2KDF B;  2NS5 A;  1UGM A;  2NTS A;  4FJY A;  5G5H A;  5IAA C;  4ANU A;  2IY0 B;  1K8R B;  5JXV A;  3BVG A;  2ZVO A;  4ZOH C;  2N9E B;  4AS1 A;  4I6L B;  3RMK C;  2LHD A;  1UWM A;  2Y5P A;  3ALB A;  3Q8A A;  4W9L A;  2BT6 A;  2DAJ A;  5IA7 A;  5BYR A;  1HE8 A;  3WIM A;  2WDQ B;  1XLO A;  5CX3 A;  5HFY A;  2KNB A;  3DDC B;  5D3D A;  2WXR A;  1E90 A;  1VJK A;  4BZA A;  2V4L A;  2LMC A;  2KQ4 X;  2ZVN A;  2K25 A;  2XNA C;  2BYF A;  1LFD A;  1XLP A;  1L2N A;  4KV2 A;  2JF5 A;  3ZKJ C;  2JWZ A;  3HUI A;  5DPR A;  2WP9 B;  2G1E A;  5E6P A;  1WX8 A;  4DBG A;  1FIQ A;  5H92 C;  2K8B A;  1WSP A;  4P7I A;  2FID A;  3L10 B;  4YL8 A;  3Q14 C;  1L0V B;  4FXC A;  2IO1 B;  2W3S A;  1E0Z A;  3MHZ A;  3LYY A;  1MFW A;  1RFK A;  2L3Z A;  2BYT A;  1WRI A;  1JWU D;  4HPP A;  4RGN A;  1V97 A;  2J7Q B;  4AP4 C;  1PGB A;  2C7M B;  3VTV A;  3NS8 A;  1YN3 A;  4HEA 1;  4KSK C;  2V3P A;  4TKN A;  3VH4 B;  4EUT A;  3R66 C;  3T3N A;  2ZZP B;  2EMT A;  3NHE B;  3PLV A;  1KLU D;  3U30 A;  4X57 B;  3UQA A;  3RN9 C;  1EF5 A;  4US9 A;  4AWJ A;  2D11 A;  2CHZ A;  1C77 A;  4KGS A;  1UD7 A;  2L8J A;  5CHF A;  4LJO B;  4HCP B;  2PPH A;  1EWY C;  2BB5 A;  3B9J A;  1ZP0 B;  2WXQ A;  1TKY A;  2W9N A;  4F1S A;  2KAJ A;  4PS7 A;  1CZP A;  2MBE A;  4FJZ A;  2WU5 B;  1OTR B;  2NR2 A;  1WYG A;  3QK0 A;  1RYJ A;  1C4C A;  3AEG B;  3Q3M C;  3IVF A;  1QOB A;  3ZGZ A;  4WUR A;  2O6V D;  3KYC D;  4C00 A;  4JX1 C;  1N61 A;  1Z5S B;  2BYV E;  5AZF A;  2R61 A;  4AOF A;  4WQM A;  1MG8 A;  1SIF A;  4HK2 A;  3DBH B;  2B76 B;  2FBW B;  3AEC B;  1WF9 A;  4TUU A;  4BKS D;  4Q2J A;  2G4S A;  2N9K A;  5EE1 A;  1SGH A;  4B9K A;  1A5R A;  1F0Z A;  4K7U A;  2GLS A;  3P63 A;  2IGD A;  2KVZ A;  1F9J A;  4GXB A;  3Q3O C;  1WXA A;  1A70 A;  4A3O A;  3JSV A;  4BBN F;  4A8X C;  1FFU A;  2R2O A;  3AEE B;  1TZO A;  2KFK A;  3M3J A;  2FNJ B;  4L23 A;  3SFD B;  2W3R A;  1R4N I;  2WYQ A;  4PYZ A;  2XEW A;  2QHO A;  3PT2 B;  2AEH A;  2BGF A;  1WM2 A;  2DX5 B;  1SE4 A;  2JRH A;  1ZGU B;  5EE3 A;  2M4N A;  3C0R B;  3H1U A;  2UWQ A;  3IXS A;  3D32 A;  1DYQ A;  1L5P A;  1NYQ A;  2M17 A;  2HJ8 A;  1K52 A;  2IY1 B;  2N9P C;  1QF6 A;  2GBR A;  3NRZ A;  2LXC A;  2DZK A;  4ZRI A;  4MM3 B;  4URK A;  1E8Y A;  1I7H A;  4EZK A;  1L4D B;  1WX9 A;  3DBR I;  4GB9 A;  2KOX A;  4BOZ B;  2RDG A;  2WXO A;  3EFU A;  3OJ3 A;  1WXV A;  4DHZ B;  1IP9 A;  3WCQ A;  2N1W A;  2R2Q A;  3AXC A;  2CJO A;  2D3A A;  2QSD A;  3VH3 B;  3QC8 B;  3RPF C;  2Q5W D;  4HDQ A;  3V3X A;  1Q0W B;  4USA A;  1YX6 B;  1WZ0 A;  1JML A;  4FN2 A;  2IGG A;  2LHE A;  1UZX B;  2KTR A;  2WXL A;  4KZ0 A;  3KLS X;  2VZK B;  3AE9 B;  4GN1 A;  1KJT A;  3AED B;  5CHV C;  2PE6 B;  1L0X B;  1JW9 D;  4IC7 B;  1YNT E;  1KLV A;  3GP7 A;  2AWT A;  3B1L X;  3U2S C;  4GDK B;  3A1Q B;  3WAM A;  1XEE A;  4XE0 A;  1VLB A;  5IN7 A;  1WRD B;  2E6X A;  3BWU D;  4TMA B;  3SD5 A;  3P1M A;  2IJ0 A;  3HHM A;  2BVC A;  2RPQ A;  1HZ6 A;  4ASW C;  1WYW B;  2KDB A;  1XO3 A;  1TIF A;  5IKC M;  3QHT A;  1GJZ A;  2KQS A;  3NVY A;  2M56 B;  1SF0 A;  3Q8E A;  1V80 A;  4XX5 A;  3HK0 A;  4DQO C;  4XWW A;  4LNK A;  2MQJ A;  4A90 A;  1R4M B;  4M01 A;  4MJS A;  3ZVV A;  2J0J A;  4OW0 A;  4OZB A;  4WWN A;  2KO3 A;  2YVC A;  1SE2 A;  3AE4 B;  3DBL I;  4YTN B;  4MGK E;  3APF A;  3UQB A;  2PVO D;  4LNO A;  1PYW D;  5G5G A;  4K3C A;  3TUO A;  1SJH D;  1HXY D;  2CHW A;  1JCK B;  2ZJD A;  2NBW B;  2DYM A;  1YN4 A;  4MEM A;  5AZH A;  4M0W B;  2E3T A;  2O2V A;  4LNF A;  2JZZ A;  4C7Z A;  1Y8R C;  3ZIM A;  5FK9 C;  5L83 A;  3WA0 A;  3IT6 B;  1T3Q A;  1OGW A;  4HWI B;  2D3B A;  3B2G A;  3Q3N C;  4GU2 A;  5FR3 A;  1DGJ A;  3N30 A;  3Q69 A;  2KWV B;  3UIP B;  4EFO A;  1CMX B;  1RRB A;  1GC7 A;  3Q2A C;  2LUM A;  4YSX B;  2LGX A;  1BUI C;  1LXD A;  2QMT A;  3PLU A;  3BY4 B;  1GG3 A;  1V1P B;  3PVL A;  3RNG C;  2KHW B;  4PS8 A;  3CF6 E;  4ANW A;  3E56 A;  3C8Y A;  1TS2 A;  3IBE A;  2D07 B;  3Q6B A;  1RAX A;  2WGS A;  4C80 A;  3PZ7 A;  2I1J A;  1LM8 B;  2QCZ A;  2J0M A;  2M19 A;  3RFZ B;  2G3Q B;  1SSN A;  2BW2 A;  3L17 A;  1IYF A;  2KMA A;  1P0R A;  1SJE D;  4ACF A;  3UIN B;  1TY0 A;  3JVZ X;  4P16 A;  4HCN B;  1OQR A;  2J53 A;  1DOI A;  4L2Y A;  2FUG 1;  3DVN U;  2KQ7 A;  4RNA A;  4HKQ A;  2B3A A;  3NVW A;  1FXT B;  5DCN A;  3KWV A;  1AYF A;  3T8M A;  4ANV A;  3QWZ B;  3IHP C;  2W55 A;  2FCM A;  4I6N B;  2RSU A;  2BWE S;  1FRD A;  3RNA C;  2WXP A;  3R2T A;  3P42 A;  3JYU A;  2DLB A;  4MEL A;  3AE8 B;  2ZPY A;  3DBS A;  3VQI A;  3EGR A;  5AEK B;  5GXG B;  4YSY B;  4W9I A;  1Z2M A;  2GBK A;  1L0Y B;  1FXI A;  1WE7 A;  2IPK D;  2XBB C;  1TGZ B;  1NI2 A;  4PYU A;  1P3Q U;  5C23 A;  1T6B X;  1WR1 A;  3BYT B;  4MSQ B;  1N6Z A;  2RDB C;  1B1Z A;  1E8Z A;  4JPS A;  1QOG A;  5DPT A;  3V62 A;  1MJD A;  3PHX B;  4ICV A;  2CU1 A;  1WGD A;  1Q10 A;  2K6D B;  1IGD A;  1WZ3 A;  3VTW A;  4IG7 B;  2C9W B;  3AEB B;  2N7J A;  4MDK E;  1TS5 A;  4XZ4 A;  1VR9 A;  5J17 A;  1XF5 L;  4TQ1 A;  3BK2 A;  2K0P A;  1YIW A;  3SU8 X;  1FEH A;  3L13 A;  2Z59 B;  4G3X B;  1R7S A;  2N1V A;  3I5J C;  1VDV A;  3EFC A;  2WXH A;  1TS4 A;  2GBM A;  3PGE A;  1P7F A;  4W9J A;  1I4H A;  2KLC A;  2OJW A;  1E6E B;  1SE3 A;  4MSM B;  5J18 A;  3GE8 C;  1LO5 D;  2QIE B;  4K1R B;  1VZ7 A;  3L0W B;  4A3P A;  3A9K B;  4JWU C;  1ENF A;  2FAZ A;  2G45 B;  3ZTD A;  1J7C A;  3DBH I;  3DQV A;  3AN1 A;  3P4S B;  2ZW0 A;  4WIP A;  2G4D B;  1V5O A;  2OOB B;  1GB1 A;  4WH4 A;  3ZQ4 A;  4F7Z A;  3VVW B;  4IM0 A;  1TYG B;  3PRZ A;  4GDL A;  3LXF A;  4ZRK A;  4ARI A;  4RMA A;  4BBN C;  1IBX A;  1GB4 A;  1L7Y A;  2MBB B;  2KWC A;  4RM8 A;  1UWX A;  1ZOY B;  2ONQ A;  3EHV A;  1JRP A;  3QJZ A;  4IOI E;  4OVV A;  2AX5 A;  4ICU A;  4YWG G;  2MCN B;  2KYW A;  2W54 A;  4NQL B;  1E9M A;  3HM6 X;  4US8 A;  3QAQ A;  2KWD A;  2JT4 B;  3EC8 A;  3AE1 B;  1F2R C; 
#chains in the Genus database with same CATH homology
 4ZHP A;  2B76 B;  2FBW B;  3ETR A;  3AEC B;  1C76 A;  1UUP A;  4NAM A;  4Q2J A;  5EE1 A;  2N9K A;  3MFG A;  3FIL A;  3TSS A;  2PW9 A;  1F0Z A;  2CU3 A;  3P63 A;  4ZHO A;  2IGD A;  2WXJ A;  4H2A A;  4NZL B;  4XWT A;  2LFI A;  5FKA C;  1D4B A;  3AE6 B;  1A70 A;  1YJJ A;  3AE2 B;  3BYY B;  3Q8F A;  4A8X C;  1FFU A;  3AEE B;  1TZO A;  3PO0 A;  4L23 A;  3SFD B;  2V3N A;  2W3R A;  2WDR B;  1ET9 A;  1YJI A;  1F77 A;  3NZ3 A;  5BMH A;  1FRR A;  2MJD A;  1QT9 A;  1WXQ A;  3NVV A;  1KFY B;  1SE4 A;  3TEW A;  5BMG A;  4HRO A;  1MHX A;  5TSS A;  1PGA A;  1K51 A;  5EE3 A;  1FMA D;  1FNU A;  4N59 A;  1GOZ A;  4RFB A;  3IXS A;  1DYQ A;  1L5P A;  1VRA B;  1NYQ A;  2LGI A;  3P4R B;  1NEK B;  2PIA A;  4OVZ A;  1K52 A;  3SFE B;  2QEJ C;  1QF6 A;  4D2K A;  1ZDV A;  1I4X A;  3NRZ A;  3LB8 C;  2PMV A;  4MM3 B;  3W1S A;  1I7H A;  2N9L A;  3AMZ A;  1L4D B;  3E9S A;  2PLP A;  2INP E;  1JWA D;  2RDG A;  3SEB A;  1NVI D;  1AW7 A;  2QJL A;  3HVZ A;  2WXO A;  1PGX A;  4M0W A;  1SEB D;  4IDI A;  2L52 A;  2MH7 A;  1D5Z C;  3AH7 A;  3WCQ A;  3AV8 A;  1JAL A;  1AN8 A;  2Y5C A;  5HG2 A;  1FM0 D;  1HQR D;  2CJO A;  4YT0 B;  2QSD A;  2HDE A;  3MP9 A;  4A9A A;  1QIL A;  3RPF C;  1JWB D;  2Q5W D;  3V3X A;  4GDL B;  4A55 A;  1TKE A;  1L6U A;  2KMM A;  4USA A;  1STE A;  2GRI A;  2K9X A;  4UDU C;  1ZXH A;  2V0G A;  3I9V 1;  1JML A;  1J7A A;  4KGT A;  2IGG A;  2BS3 B;  2LHE A;  1VZ8 A;  2DYO A;  2EKI A;  2OHF A;  2BTE A;  3L4P A;  1IBX B;  1OFF A;  2WXL A;  5EE9 A;  1ZUD 2;  1V1P A;  1ZXI A;  3W2D A;  3KLS X;  2EEL A;  2VZK B;  2JU6 X;  3AE9 B;  5EE0 A;  2N0S B;  4B0M A;  3VR9 B;  1BXT A;  2GI9 A;  1ACC A;  1MPE A;  4TSS A;  5H8Y E;  3AED B;  3AEF B;  3N9Y C;  1XCQ L;  1L0X B;  1E7P B;  1JW9 D;  1SBB B;  4LK0 M;  5I4D A;  5AUI A;  1YNT E;  3AM9 A;  4MAC A;  1KF6 B;  5BYQ A;  3GB1 A;  4RGT A;  1L6V A;  2J42 A;  2Y3A A;  2JWU A;  3HRD D;  3GP7 A;  1RWS A;  3KQ4 A;  3U2S C;  1K50 A;  1JQ4 A;  4GDK B;  1B9R A;  1ROE A;  4NJC A;  3PZ8 A;  1C79 A;  3V05 A;  4YTP B;  1CK1 A;  2JSV X;  1XEE A;  1HA5 A;  1VLB A;  3EUB 2;  4XE0 A;  2E6X A;  3BWU D;  1C4A A;  4TMA B;  3P1M A;  2H88 B;  1XCT L;  4OZA A;  2IJ0 A;  3U4E G;  3BVM A;  2MJ3 A;  2M0A A;  4N58 A;  2DBY A;  4JE3 B;  1HZ6 A;  2FE8 A;  4RCO A;  2WS3 B;  3I57 A;  5HI1 A;  4DXF A;  2BS2 B;  1XO3 A;  3Q8C A;  4ITK A;  1FO4 A;  5D7G A;  3NVZ A;  2OED A;  4ZRP A;  1I4G A;  1QLB B;  1FXA A;  1GPX A;  2NMQ A;  3NVY A;  2M56 B;  1SF0 A;  1VZ6 A;  2I2Y A;  2QIL A;  3Q8E A;  2WXF A;  3KWL A;  2G9H D;  1V8C A;  3DWG C;  2KDM A;  3MJ5 A;  2WLB A;  2JYE A;  4DQO C;  4XWW A;  1I4Q A;  3W5V B;  2CJN A;  4A90 A;  2JZP A;  4TQ0 A;  1Y56 A;  3AB5 A;  4OW0 A;  4OZB A;  1SE2 A;  1D5M C;  3UI3 A;  2D5G A;  3AE4 B;  1QKZ A;  4YTN B;  4J3O D;  2PVO D;  1PYW D;  4R3D A;  5G5G A;  1MHH E;  3TUO A;  1SJH D;  1HXY D;  1K53 A;  3BVZ A;  1QOF A;  1EU4 A;  2PKO A;  1JCK B;  1D6E C;  2MEK A;  3AE5 B;  1DOX A;  2DYM A;  1YN4 A;  1HEZ E;  2GB1 A;  1YQ4 B;  2E3T A;  4B0E A;  1TJE A;  4C7Z A;  1N62 A;  5FK9 C;  4RGM A;  4REZ A;  1SIJ A;  5C2T B;  3IT6 B;  4RH6 A;  1T3Q A;  2WNM A;  1ZPS A;  1I4P A;  1FNV A;  3B2G A;  2Z8L A;  1UNS A;  5FR3 A;  1DGJ A;  1C9F A;  1EWC A;  3W9C B;  3Q69 A;  3CWI A;  5T8I A;  1DOY A;  2LUM A;  3P4P B;  4YSX B;  2K3U A;  1MI0 A;  3AE7 B;  1BUI C;  1FNW A;  2HTM E;  1TS3 A;  3EA6 A;  2LEK A;  4MH8 A;  2QMT A;  2I38 A;  1ESF A;  1CQV A;  1V1P B;  4NAW B;  4L1B A;  4GLS C;  3R8B A;  1NI3 A;  1F2R I;  1N63 A;  2J4X A;  1E10 A;  2DWQ A;  2WXN A;  3E56 A;  4HKZ E;  2SAK A;  3C8Y A;  1TS2 A;  3R2I A;  4C80 A;  3PZ7 A;  1KLG D;  1QQR A;  2M19 A;  3RFZ B;  1JWS D;  1MVK A;  1SSN A;  2BW2 A;  1TKG A;  2YEP F;  5LNK 1;  1L4Z B;  1V1O A;  3TEY A;  1EU3 A;  1SJE D;  3DWM A;  3FAH A;  1I4R A;  4ARC A;  1TY0 A;  1JRO A;  3ABV B;  2JX5 A;  4P16 A;  3SR6 A;  4C7Y A;  2L32 A;  1OQR A;  2J53 A;  3ZJV A;  1DOI A;  4L2Y A;  3BZD B;  2FUG 1;  2BBC A;  4RNA A;  2J52 A;  2H89 B;  5MPO A;  4HKQ A;  1WWT A;  3NVW A;  3KWV A;  1AYF A;  2NTT A;  1YMH E;  2BB6 A;  1YN5 A;  2JXT A;  1WGK A;  4ZRQ A;  3VRA B;  4LLG M;  1PUT A;  2V4I B;  3GS2 A;  3ZJU A;  2W55 A;  2WQY B;  4C56 C;  1GAQ B;  1ET6 A;  2WXK A;  2XN9 C;  1FRD A;  2NTS A;  5G5H A;  2WXP A;  3R2T A;  3P42 A;  2WU2 B;  2IDY A;  5JXV A;  3U52 E;  3VR8 B;  2DLB A;  2WXG A;  3BVG A;  3AE8 B;  4CQN A;  4ZOH C;  3VQI A;  3EGR A;  2ON8 A;  1KRH A;  1T5X D;  2PTL A;  5GXG B;  4AS1 A;  4YSY B;  4RF0 A;  5AUK A;  2LHD A;  1L0Y B;  1UWM A;  2Y5P A;  3B2F A;  3Q8A A;  1FXI A;  2IPK D;  3TEX A;  1AWD A;  2BT6 A;  3CIR B;  3O13 A;  5BYR A;  1J7B A;  3FC4 A;  2WDQ B;  5D3I B;  1XLO A;  5HFY A;  1T6B X;  2X38 A;  2WDV B;  5D3D A;  3TEZ A;  2WXI A;  2WXR A;  3BYT B;  3IAM 1;  3NUH B;  1VJK A;  2IGH A;  1PDX A;  4RGO S;  4ZYS A;  2LMC A;  2KQ4 X;  2XNA C;  3Q8B A;  1B1Z A;  2L83 A;  4YXD B;  4YTM B;  4JPS A;  1FFV A;  1XLP A;  4A6Q A;  1QOG A;  4WAF A;  3HUI A;  3IT4 B;  1KTK A;  2ICI A;  2G1E A;  2WP9 B;  2ZW1 A;  1Q10 A;  3URY A;  1IGD A;  1N5W A;  1SXT A;  1FIQ A;  2JYT A;  2KAC A;  2YEP B;  5H92 C;  2AQ3 B;  1WSP A;  2BS4 B;  3AEB B;  1TY2 A;  2N7J A;  1TS5 A;  2RDH A;  2JQR B;  1L0V B;  4KKI A;  1VR9 A;  3HVD A;  4FXC A;  3MC0 B;  2W3S A;  1NYR A;  1XF5 L;  4MT5 A;  1ZDX A;  4TQ1 A;  3BK2 A;  2K0P A;  3MHZ A;  4EE2 A;  3LYY A;  4PT5 A;  1E0Z A;  1P7E A;  1FEH A;  1RFK A;  2BYT A;  2KN4 A;  1WRI A;  2RMM A;  4XDD A;  5BYS A;  1JWU D;  1BML C;  4O1N A;  3U7Z A;  2ACZ B;  4IKG A;  4RGN A;  1V97 A;  4HRS A;  1R7S A;  1PGB A;  4N6E B;  3AE3 B;  1VDV A;  1CJE A;  2L1A A;  2WXH A;  4HJG E;  1TS4 A;  2VZK D;  1YN3 A;  2WXM A;  4P6V F;  4YSZ B;  4HEA 1;  4OZC A;  2V3P A;  4RF1 A;  1FCL A;  2K22 A;  4KX6 B;  1M4V A;  2INN E;  1P7F A;  4DXG A;  4KKJ A;  3T3N A;  1I4H A;  3ZJT A;  3VRB B;  1FD6 A;  1KH0 A;  1KLU D;  2K5P A;  2RPV A;  1E6E B;  1RM6 C;  1SE3 A;  5C3J B;  4AQ7 A;  1LO5 D;  2QIE B;  2LJI A;  1VZ7 A;  1XXG A;  3P4Q B;  4US9 A;  4JWU C;  1ENF A;  1C77 A;  4XDC A;  4KGS A;  1FCC C;  2TSS A;  3IAS 1;  1N5X A;  1J7C A;  3AN1 A;  3H8H A;  3P4S B;  2ZW0 A;  4WIP A;  1N60 A;  3T3O A;  1EWY C;  1GB1 A;  4WH4 A;  2BB5 A;  3OWE B;  3ZQ4 A;  3B9J A;  1ZP0 B;  2WXQ A;  2AQ1 B;  1TKY A;  2W82 A;  5HHD G;  3AEA B;  1TYG B;  1IGC A;  2KAJ A;  1CZP A;  1C4P A;  4OHJ A;  3LXF A;  1JWM D;  4LTU A;  1XLN A;  4WWM A;  2WU5 B;  2PVG C;  3BII D;  3BK1 A;  4KGR A;  1NEN B;  4ARI A;  1HZ5 A;  1IBX A;  1GB4 A;  1WYG A;  1OQQ A;  1UWX A;  1UGJ A;  1ZOY B;  2ONQ A;  1EM7 A;  2MJE A;  1RYJ A;  1C4C A;  3AEG B;  3NS1 A;  1D5X C;  1JRP A;  1IUE A;  1QOB A;  5BMI A;  3ZGZ A;  1ZE3 D;  4WUR A;  4IOI E;  2AQ2 B;  2AX5 A;  5E6J A;  1PFD A;  4YWG G;  1YQ3 B;  1QOA A;  4JWS C;  1C78 A;  4JX1 C;  3FIL B;  1N61 A;  2W54 A;  3J9C A;  1SB3 C;  2R61 A;  2SEB D;  1E9M A;  1XLQ A;  4WQM A;  4US8 A;  2KWD A;  3W5U B;  3AE1 B;  3ZYY X;  1F2R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...