5GMVA

Lc3b-fundc1 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
b'KTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural insights into the recognition of phosphorylated FUNDC1 by LC3B in mitophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 41
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5gmvA00
3EHVA 3KUZA 1RAXA 1GC6A 4W9DA 4EKUA 2KX0A 3ZNID 2KJRA 3ZTDA 5AZGA 1G6JA 4DXAB 2ASQA 3CSTA 2R2QA 5D2MB 3ML8A 3QAQA 2LVQA 4OVVA 3HIZA 2CHXA 3PRPB 3VDZA 2K25A 3R7RA 2VRRB 2N7DA 3WAPA 2YVCA 3DBHI 1VD2A 1EUVB 4DHZE 4GIVA 3UQAA 4XZ4A 2NVUI 4GXBA 2ZNVB 1CMXB 3QARA 4F8CB 2D2QA 2UYZB 2KN5A 1TGZB 3M62B 2J7QB 3RULA 2WX1A 2AL3A 3HK0A 1E8ZA 4MEMA 1I42A 4HK2A 4M8MA 2GBNA 2K8BA 3VTWA 3Q3FA 3KVFB 5DPTA 1E8XA 4IM0A 2J0MA 4WJNA 1WRDB 1YJ1A 2MBBB 3H1UA 4BOSC 1VCBA 4GB9A 3PT2B 2XBBC 5JZEB 4GN1A 4ICUA 1J8CA 3N3KB 3OJ4B 1NBFC 1T0YA 2NBUA 3RZWC 2MW5A 4B9KA 3AU5A 1WR6E 4W9CA 2QHOA 4DHZB 1JRUA 1EF5A 1P0RA 4G11A 5FR6A 1WX8A 4FBJB 3TJPA 3QWZB 3N32A 3ZIMA 4II2B 1LXDA 5E6OA 2NR2A 4DHJB 2IO0B 4KDIC 1UD7A 3W1YA 1FXTB 1TBEA 4N9F4 2DAFA 1WR1A 3SU8X 3JW0X 3PLVA 3U8ZA 2KMAA 1Z2MA 4LDTD 3EC8A 3PV1A 1UGMA 1YD8U 4JIOU 1IPGA 4AP4C 3A4RA 1WJ6A 1XT9B 2LD9A 1UBQA 2IO3B 4IC7B 3VTVA 4ICVA 3WAOA 4DK5A 3UQBA 4IM3A 2DZIA 3UIPB 2KVRA 2DZKA 2KC2A 2WDTB 2IY1B 4W9HA 3APDA 3HM6X 4WJQA 3RZFA 2KKCA 1UELA 2DYBA 3ECIA 2KLGA 2K39A 3CF6E 1WYWB 1ISNA 5KHQA 1IYFA 5CHFA 4LJPB 4JQWC 1WJ4A 3JVZX 3HHMA 2KXJA 4W9IA 2DHZA 5C1ZA 4KSLC 1XD3B 3UINB 3TMPB 2N9EB 4BBNF 3DVGX 3ZNHB 2V1YA 2MP2A 2MP2B 2YLMA 3UIOB 1WXSA 3A4SC 3A9KA 3A9KB 3W1SC 2PJHA 4MDKE 4GGQA 1C1YB 1WI0A 3AULA 2M8SA 3K9PB 3N30A 2JZ3B 2FCNA 4WJPA 4F7ZA 1WMHA 1WMHB 3VUXA 3VXWA 2LGXA 3ZUNA 3QQ8B 4DWFA 4FHKA 1WY8A 2MWSB 2JZZA 2GBKA 3RD2A 4WQOB 4HDQA 4HCNB 4HDOA 3VH3B 3V60A 2CS4A 1EO6A 4TKNA 4MGIE 2M17A 3CMMB 2LI5A 2L76A 4G50A 3VH4B 3X0WA 2FNJB 2C7NB 3CSFA 2BWES 2MBQA 3L54A 4W9EA 1ZW7A 2KJ6A 3RUIB 5CHVC 1RFAA 4AWJA 3TIXA 2KDEB 5LXHA 3ENEA 2KMCA 4RM9A 5J17A 2L0FA 1GG3A 3V62A 4E3CA 1WGHA 4EUTA 3KH0A 2A4ZA 2JY6A 1WX7A 5BO4B 2JPHA 3D32A 3PLUA 4IUMB 3RYTA 3C0RB 5KHOA 2AYOB 5J18A 3NZUA 4JGHB 2GBJA 4BKSA 2WX0A 3ZDMC 3IBEA 2JXXA 2B3AA 4IG7B 1TTNA 2LXAA 4I6NB 4KV2A 3R7QA 3RCZA 2JF5A 2C7HA 1ZKHA 1YX6B 2K8HA 4FJVB 4NNJB 5JH5C 2MLBA 1SIFA 3QCAA 4I6LB 2M1MA 3KUDB 4JLCA 2NCNA 2RD0A 1E8WA 1SE9A 2KX3A 2XK5A 2XK5B 3ZTCA 1WXMA 2NPTA 2NPTB 1OGWA 4TQ1A 4E74A 2GBRA 4A20A 3QA8A 5JHBA 1V86A 2IYDB 2MRPA 2FIFA 3LDZE 4MH0E 4BKTA 3MTNB 2Z0DB 2D07B 4I6PA 2KC1A 4HXDA 1SGHA 4ZRIA 2JRIB 2NBWB 3H7PA 2CKHB 3H7PB 3L17A 2MQJA 3R66C 4NQLB 3PSEB 5D6JB 4BKGA 4FA6A 2WWZA 2O6VA 2O6VB 4EFOA 4ZRKA 3AI5A 4RMAA 5JHAA 2KZRA 3PHXB 3PVLA 4K7WA 2OOBB 3PTFC 3KW5B 2CHZA 1WJNA 4AUQC 2Z59B 1LM8B 2FCMA 2HD5B 2J0JA 3P2BA 4ANWA 1J0GA 2DYMA 2KANA 3DPDA 3VUWA 3V61A 2L00B 3OAWA 3VQIA 1WX9A 2L7RA 2ZEQA 2LJ5A 3WA0A 1WGGA 3PGEA 5D94A 3TL5A 1Z5SB 2BKFA 1OTRB 2KTFA 2K1FA 5G2NA 3IVFA 1OEYJ 4KIKA 4KIKB 2FUHB 4II3B 5DCNA 4KZ0A 5G55A 2ZCBA 3ZDTA 1LQBA 1A5RA 3ML9A 3QK0A 4ZDVA 2C7MB 2KWCA 3NS8A 3DDCB 2LUEA 2M0XA 2N9XA 4IW0A 4HLEA 2L3ZA 2ZVNA 2RPQA 2J0KA 5CX3A 4EZKA 2IO2B 1HE8A 2BYVE 3HM3A 1GNUA 5AZHA 4IWPA 3V6EB 2CR5A 2MSED 3O65B 4K7UA 5AEKB 2BKRB 1E7VA 1WM3A 1WGRA 4KVGB 3KYCD 3NZSA 4M8NA 4WJOA 5L95C 4NQKE 4DDGD 1L2NA 4ZYNA 3M3JA 3GZNI 4BKSD 3ZLZA 2LASA 2KDIA 3VTUA 2LXCA 1H8CA 3NY5A 4MGZE 4B95A 3T8MA 4ANVA 1GJZA 4XC2A 1D3ZA 2UWQA 2REXA 1YQBA 2HTHA 3SD5A 3VHTC 1WIAA 2KDFB 3ALBA 1KOTA 2I1JA 3Q3JA 4K7SA 2GMIC 2PE9A 2ZJDA 2N4FA 1WXVA 1KJTA 2Y5BB 1Q1OA 4GU2A 3TBLD 5IA7A 2G4SA 2PEAA 1OQYA 4DDID 2AL6A 1H4RA 3A33B 2ZNVC 4ZRJA 4KDLB 1E5WA 1V6EA 2I1KA 2KWUB 5DPRA 4AJWA 2A5UA 3ZNZB 4EZJA 2PPHA 4TQ0A 2BWFA 2O2VA 2O2VB 5IAAC 2KTRA 2KTRB 3WAMA 1GC7A 5CHWA 2O6VD 3DOWA 5EDSA 2N1WA 3ZRCA 1V49A 3U30A 3H6NA 4K1RB 4LCDE 2LWPA 4E71A 2DZMA 5CTRC 4GDKB 4GDKA 3QHTA 3KUCB 2BYFA 3L16A 1BT0A 1E8YA 2FAZA 2JVCA 2K6QA 2L05A 1WGYA 2FCQA 3UGBB 4IM2A 4AOFA 2Z0EB 3IFWB 2MBEA 1ZGUB 2FIDA 1WZ3A 3L10B 3IG3A 4DHJD 2JWZA 4MJSB 1WFYA 3JYUA 2LGYA 2D11A 2W9NA 4MJSA 2HE7A 3WANA 2KFKB 2KFKA 2DX5B 4A3PA 3VUYA 3MHSD 1V81A 2C9WB 3A9JB 3A9JA 2KD0A 2KNBA 3BINA 3JSVA 3JSVB 4RM8A 2KDBA 4HCPB 3BY4B 1P98A 1S3SG 3DCGA 2DAJA 4ANUA 3PS6A 4HPMB 4NPNA 1V9JA 4ANXA 3H9DA 4GDLA 4GDLB 4MSQB 4G0NB 2LGDA 2L8JA 2DYOA 2V4LA 3A1QA 3A1QB 2KK8A 3B0AA 3RT3B 4XX5A 2N9PC 4EOYA 3DVNU 3ZKJC 2BGFA 2OJRA 1EF1A 1P9DU 3ZNGC 2ZVOA 5J2RA 1E7UA 2KO3A 1NI2A 2EMSA 4F1SA 2R2OA 3H7SA 3IHPC 1V80A 2G45B 3SHQA 2KFJA 4PS3A 4W9JA 4X57B 1J19A 3W1SA 2D3GA 4BVUC 3VFKA 1UH6A 2K8CA 4FADA 2EMTA 1XQQA 2RSUA 4HWIB 1WM2A 3QJZA 4KSKC 1I35A 3V6CB 4MELA 4HJKA 2BYEA 2WYQA 3PHWB 3VVWB 3DBSA 2KQSA 4CHKA 4GSWA 1P3QU 3M95A 1V5OA 2V3SA 1GUAB 2M4NA 4G3XB 3ZRFA 2KOXA 2N7EA 2JUOA 4K81A 3L13A 1U4AA 2C60A 3EFUA 3L0WB 1KLVA 4NJ7A 1LFDA 3UF8A 4FJZA 3L08A 3B1LX 5GMVA 1S1QB 2GOWA 2NBVB 4MM3A 3NOBA 1WGDA 2CHWA 1TZ1A 1YX5B 3MJWA 2JRHA 4PS7A 5HKHA 3AU4A 4WAAA 4FJYA 3WIMA 2KWVB 4TV3A 2JT4B 4W9LA 3TCAA 4A3OA 2G4DB 1RRBA 2MBHA 1OEYA 4FULA 4NY0A 4EZLA 4FLHA 3DBRI 5AZFA 3PRMB 3VAWA 2HJ8A 2LVOA 1L7YA 4J6IA 3X23A 3EECA 3U7DA 1UZXB 1WE6A 4LJOB 2PE6B 4OVUA 2LZ6A 2LRWA 4KZCA 3R3MA 1WJUA 1RLFA 2D10A 3I3TB 1IP9A 2RGFA 2G3QB 1YIWA 2DZJA 4DBGA 1PQSA 4IWOA 3DVGY 3APFA 3QC8B 3DBLI 3PZDA 2NS5A 2C5LC 3PRZA 4W9FA 4WWPA 4B6WA 4WWNA 1X1MA 4PYUA 2KJHB 2ZPYA 4JL9A 4IWQA 3APCA 3PPAA 3DQVA 3WALA 1P1AA 4WWOA 5C23A 2FCSA 2AEHA 2MBOA 2ZPNA 5E6NA 1WH3A 4HVBA 2BPSA 1Q5WB 2ZZPB 4URKA 1WXAA 2KLCA 2L0TA 3PREA 1R4NI 4YL8A 4BBNC 4NAWA 4NAWB 5L83A 2IY0B 2IO1B 2KHWB 2BF8B 2K6DB 3M63B 4HPLB 2DENB 4M0WB 1E90A 3QIJA 1Q0WB 4NJ6A 1F9JA 3B08A 5LLIA 4BFRA 5LXIB 3OJ3A 5DPSA 1AARA 3QX1A 3NHEB 2EKEC 1Y8RC 4PS8A 1KM7A 4BOZB 4LDTB 3T9LA 2MCNB 3OLMD 3S2AA 2GBMA 2CU1A 4P7IA 3SDLC 5D7GA 1QZEA 4GMVA 2KQ7A 3AXCA 3DVNV 4MSMB 2MA9B 2ZCCA 3ZO5B 2RR9A 4FHJA 3LJ3A 2LVPA 4MGYE 5DPWA 4GOCA 3ZW3A 1V2YA 3ZVVA 2AWTA 1NDDA 1M94A 2LRUA 2XEWA 3KYDD 4FN2A 1V5TA 5TR5A 4CYEA 4ASWC 1C3TA 1MG8A 1R4MI 3ONSA 4MGKE 4CO7A 1WE7A 3GOEA 4W9KA 4W9GA 1WZ0A 1K8RB 4PYZA 4EEWA 4AJYB 1WF9A 2N1VA 2IBIB 2IZVB 2MX2A 1UBIA 4TUUA 3K9OB 5E6PA
chains in the Genus database with same CATH superfamily
3EHVA 3I9V1 3KUZA 4EKUA 2KX0A 2KJRA 2ASQA 1FXAA 2CHXA 1L4ZB 3AE7B 1VD2A 4DHZE 2JX5A 2VH1A 2K3UA 2LEKA 2NTSA 2KN5A 3M62B 1BMLC 2KDMA 3KVFB 2LJIA 1DGJA 2LGSA 4BOSC 5JZEB 4GN1A 1DOXA 1NBFC 5H8YE 1WR6E 1LO5D 4FBJB 1P0RA 4G11A 5IKCM 3TJPA 2PKOA 1TY2A 5E6OA 1YN3A 2NR2A 2QIEB 5C2TB 1PFDA 1TBEA 2DAFA 3U8ZA 2X38A 1FPYA 1XT9B 2LD9A 1UBQA 2WXIA 3BWUD 2K22A 4DK5A 3UIPB 2KVRA 1MVKA 2WDTB 1UELA 1HZ5A 1FCCC 2FE8A 2J4XA 3RNCC 3ZJVA 1WJ4A 3HHMA 2KXJA 2DHZA 2IPKD 2SEBD 4KSLC 3DVGX 3LXFA 4TMAB 2BYTA 1TYGB 3W5UB 1C1YB 1ZOYB 2M8SA 3N30A 4WJPA 1L6VA 1FRRA 2LGXA 5E6JA 1WY8A 4DXFA 2MWSB 2QILA 3EA6A 2XNAC 3VH3B 1XCQL 1E0ZA 2L76A 4G50A 2FNJB 2CJNA 2BWES 3T3NA 5LXHA 2KMCA 1P7EA 5J17A 5H92C 3VRBB 2A4ZA 2JY6A 2JPHA 3D32A 3PLUA 4IUMB 3NZUA 4JGHB 2GBJA 3ZDMC 4WWMA 3R7QA 2JF5A 1R7SA 2C7HA 4P16A 1KLGD 3SEBA 2M1MA 3ZTCA 1WXMA 3TEZA 1V86A 2IYDB 3LDZE 3DHIC 2D3BA 3MTNB 3AB5A 4I6PA 2KC1A 1ZDXA 4ZRIA 2JRIB 1JWSD 2JSVX 1BUIC 3PSEB 4BKGA 2O6VA 2O6VB 3AI5A 5JHAA 3PHXB 3KWVA 2LFIA 3NZ3A 2KANA 3VUWA 2ZW1A 2L7RA 2ZEQA 4C80A 4KGRA 2YEPB 1Z5SB 2L32A 3AE5B 1IGCA 2WXGA 4ACFA 3MC0B 1OEYJ 4KIKA 4KIKB 5DCNA 2HJ1A 3ZDTA 4BAXA 1A5RA 3QK0A 3NS8A 1IUEA 2LUEA 5EE1A 1DOYA 2JQRB 2KYWA 3DWMA 3P4SB 2RPQA 2J0KA 5CX3A 2IO2B 3AM9A 1GNUA 1TY0A 1C76A 4IWPA 4K7UA 1TT5B 1WM3A 4KVGB 2AX5A 1JMLA 4BKSD 4ZHOA 1H8CA 2QDFA 4MGZE 3ETRA 1D3ZA 2JXTA 2UWQA 1YQBA 5TSSA 1KOTA 3ALBA 1E6EB 3RMKC 4ZRQA 4YTNB 4GU2A 3TBLD 2KN4A 4LNOA 4DDID 3Q8AA 3A33B 2ZNVC 5BMIA 4KDLB 2E6XA 2J42A 1V6EA 2PPHA 4N6EB 1PDXA 3OG5A 2KTRA 2KTRB 3WAMA 3SR6A 4A8XC 3AV8A 2N1WA 3ZRCA 3H6NA 4K1RB 2LWPA 2JU6X 1KF6B 3QHTA 2FAZA 1WGYA 2FCQA 3ZJTA 1RYJA 1SEBD 1JQ4A 1CQVA 1FXIA 4MJSB 4MJSA 2LGYA 3N9YC 1I7HA 4A3PA 3VUYA 3A9JB 3A9JA 3ZXRA 3JSVA 3JSVB 4RM8A 1VR9A 2J52A 5AUIA 4HPMB 2L52A 4NPNA 4ANXA 3H9DA 4GDLA 4GDLB 2LGDA 3RNBC 2DYOA 4XX5A 1UUPA 2DBYA 3NRZA 2BGFA 2OJRA 1A70A 1JW9D 1MFWA 3NJTA 1E7UA 1NI2A 2R2OA 2G45B 4PS3A 3W1SA 3HRDD 2K8CA 3SFDB 2RSUA 1FM0D 2NMQA 4WIPA 3HVDA 3MHZA 4LNIA 3Q8CA 2WU2B 4HJKA 1I4QA 3PHWB 2WYQA 3DBSA 2KQSA 4CHKA 5FK9C 2V3SA 1YOVB 3ZRFA 2N7EA 1AN8A 2MJ3A 1KLVA 1TIFA 4NJ7A 4AS1A 1PGBA 4K3BA 1UF0A 3B2GA 4WAFA 2GOWA 3O13A 4NJCA 2DLBA 2JRHA 3IAS1 4TV3A 2JT4B 3TCAA 4A3OA 1RRBA 4NY0A 1JWBD 3AN1A 2PW9A 1ZXIA 2LVOA 1I4GA 1L7YA 3Q3OC 3X23A 3EECA 1WE6A 4LJOB 1MHHE 1WJUA 1IP9A 3P4PB 3UI3A 2RGFA 2DZJA 1PQSA 2WNMA 3APFA 3PZDA 2NS5A 2C5LC 4XWWA 4B6WA 1KH0A 2KQ4X 2KWDA 4S0RA 4HVBA 1XEEA 2ZZPB 3PREA 2YEPF 5L83A 1I4HA 2QC8A 2KHWB 2K6DB 2QJLA 3QIJA 1AARA 5C3JB 1FRDA 2EKEC 2TSSA 1XLPA 1T5XD 1HZ6A 4LDTB 3T9LA 3S2AA 2GBMA 3PO0A 4GMVA 4XGAB 3R2TA 2RR9A 2LVPA 4C56C 3ZW3A 3ZVVA 1M94A 4CYEA 1TS5A 3ONSA 4MGKE 2H89B 1ZP0B 4EEWA 4AJYB 1WF9A 2N1VA 2IBIB 1LGRA 1RAXA 1GC6A 2WXPA 1VZ6A 3AEFB 3ZNID 3TSSA 5AZGA 4DXAB 3CSTA 2LVQA 3LYYA 3PRPB 2K25A 1MPEA 2VRRB 2N7DA 3WAPA 1YQ4B 4ZOHC 3ZGZA 4GIVA 3RPFC 3UQAA 1RFKA 2NVUI 3QARA 2PVGC 1TGZB 2J7QB 2WX1A 1AW7A 2IGGA 2FBWB 4HK2A 4M8MA 2GBNA 4A55A 1F52A 3VTWA 4UDUC 3Q3FA 2JYTA 4JE3B 4IM0A 4IKGA 5HI1A 1WRDB 3H1UA 1VCBA 1GB4A 2K0PA 4GB9A 4ICUA 1J8CA 1T0YA 3AE6B 2QHOA 4QAYA 4YWGG 1EF5A 5FR6A 1WX8A 2WXQA 3N32A 1F0ZA 1LXDA 1WR1A 3SU8X 1XCTL 3PV1A 4JIOU 1UGMA 1YD8U 2IGDA 3A4RA 3N1XC 2IO3B 4ICVA 4ZHPA 2DZKA 2QMTA 4W9HA 2IY1B 2DYBA 3ECIA 2KLGA 1QOGA 1WYWB 1SXTA 4US8A 1IYFA 4LJPB 4RF1A 3MC9A 5C1ZA 3TMPB 4BBNF 4Q2JA 1MG4A 3A9KA 3A9KB 4GGQA 2L83A 1WI0A 1STEA 3ABVB 3OWEB 1VJKA 3R8BA 4C4VB 4C4VA 2M0AA 1Q10A 4F7ZA 1WMHA 1WMHB 3P4RB 4DWFA 3U2SC 4FHKA 3RD2A 4HCNB 4HDOA 4MGIE 1DYQA 1N5XA 1SBBB 4YSXB 2C7NB 3AECB 4W9EA 2KJ6A 5CHVC 4RM9A 2L0FA 3V62A 4EUTA 3KH0A 5BO4B 4HRSA 3C0RB 1FEHA 3P42A 2XN9C 2BQQA 2B3AA 1TTNA 4KV2A 1UNSA 3Q14C 1ZKHA 4NNJB 1MI0A 2INCC 3BYTB 2MLBA 2WDRB 2NCNA 4OHJA 2NPTA 2NPTB 4C7ZA 5HHDG 2GBRA 3BK2A 3ZJUA 2Z0DB 4HXDA 1TZOA 5D6JB 5IP4D 3TUOA 5HG2A 3Q8BA 1QQRA 3PVLA 2OOBB 2ZW0A 3KW5B 1WJNA 4AUQC 2Z59B 2J0JA 4YTMB 2ON8A 2L00B 1N61A 2V4IB 2D5GA 2LJ5A 3PGEA 5D94A 4US9A 1OTRB 2KTFA 1EWCA 2K1FA 5G2NA 3BYYB 1SE2A 3VR9B 2ZCBA 4ZDVA 2M0XA 2N9XA 1CJEA 4HLEA 2OEDA 1EU4A 2WXNA 2ZVNA 1HE8A 2WXJA 5AZHA 3O65B 2BKRB 1WGRA 5AUKA 1P7FA 3KYCD 5L95C 4NQKE 2PIAA 2KDIA 4R3DA 3VTUA 3NY5A 4ANVA 1GJZA 2REXA 2HTHA 3SD5A 3VHTC 1WIAA 1IBXA 1IBXB 2GMIC 2W54A 2N9LA 3Q3NC 3C19A 1CZPA 2G4SA 2PEAA 3RNEC 1H4RA 3NVWA 3P63A 1V8CA 3RFZB 3VR8B 2BWFA 1NYRA 2RPVA 1TS3A 3R2IA 3DOWA 4WQMA 1V49A 3U30A 4E71A 4GDKB 4GDKA 2VZKD 3KUCB 2BYFA 1Y56A 1BT0A 2JVCA 2L05A 3AE8B 1SIJA 3UGBB 4IM2A 3Q6BA 2Z0EB 2MBEA 2FIDA 4KKIA 4DHJD 3TEWA 2HE7A 3WANA 1ACCA 1QT9A 1V9JA 2K5PA 4G0NB 2CU3A 3A1QA 3A1QB 2KK8A 3RT3B 2N9PC 3DVNU 3NG0A 1P9DU 3ZNGC 2ZVOA 4HKQA 2RDHA 4XE0A 3IHPC 3SHQA 2PVOD 2KFJA 4X57B 4BVUC 4FADA 4KSKC 3V6CB 4BZAA 3VVWB 1KRHA 1P3QU 3M95A 1V5OA 1IGDA 2MEKA 4JPSA 3DHHC 4IOIE 2PLPA 5BMHA 1GUAB 2W82A 2M4NA 2KOXA 3L13A 1ET6A 3PZ8A 1VZ7A 2H88B 1S1QB 2W3SA 1WGDA 2CHWA 4NAMA 3MJWA 3GP7A 5LNK1 3AU4A 4WAAA 1VLBA 2MBHA 4KGTA 3KWLA 2BS4B 4ZRPA 3GB1A 4OVUA 2LZ6A 3R3MA 1RLFA 2D10A 3J9CA 1YIWA 4C7YA 3QC8B 3PRZA 1ZPSA 1GAQB 2CJOA 5IN7A 2MBOA 5E6NA 3IAM1 1D5ZC 4URKA 1HA5A 1WXAA 4LNNA 4YL8A 4BBNC 4NAWA 4NAWB 3RNGC 1R4MB 4PK1A 1Q0WB 1RM6C 4NJ6A 1OQQA 1F9JA 1YN4A 4BFRA 1KFYB 2ICIA 3QX1A 1FCLA 4WURA 3BZDB 4RGNA 1QZEA 3AXCA 2ZCCA 4A90A 1XLNA 4FHJA 2AWTA 2XEWA 3FKYA 3KYDD 5TR5A 1V5TA 1K51A 1K8RB 2WU5B 4TUUA 3K9OB 3NUHB 5E6PA 3AE2B 1HTQA 3KQ4A 4W9DA 3ZTDA 1G6JA 2WLBA 5D3IB 2R2QA 3N1YC 3U4EG 2LHDA 3N1ZC 3R7RA 3W5VB 3DBHI 1EUVB 1VRAB 2ZNVB 1CMXB 4F8CB 4OZCA 1QLBB 2AL3A 3HK0A 1E8ZA 1I42A 2E3TA 5DPTA 3RN9C 1FO4A 2J0MA 4WJNA 2MBBB 3PT2B 2XBBC 4M00A 1J7CA 5T8IA 1TKYA 3N3KB 2GB1A 3E56A 2MW5A 4B9KA 1L0YB 3AU5A 4W9CA 4DHZB 3V3XA 3QWZB 2RDBC 2ACZB 4DHJB 2IO0B 1UD7A 1FXTB 3PLVA 2KMAA 4USAA 5BMGA 3RI7C 1WJ6A 4IC7B 3VTVA 1NVID 4IM3A 2DZIA 1ESFA 2KC2A 3RZFA 3APDA 3HM6X 1XLQA 2LHEA 2IJ0A 2PTLA 4A6QA 1ISNA 2AQ1B 4JQWC 3WCQA 1J7AA 3UINB 2N9EB 1D5MC 2V1YA 2MP2A 2DWQA 2MP2B 2WXLA 2YLMA 3UIOB 1WXSA 2MHJA 3A4SC 1SE4A 4RGMA 1PGAA 1QILA 2JZ3B 1SJED 3IXSA 3VXWA 2GBKA 4WQOB 4HDQA 2INPE 5FKAC 2CS4A 1EO6A 4TKNA 2M17A 3CMMB 3VH4B 3CSFA 4D2KA 3DBHB 3L54A 3GE8C 1MHXA 4AWJA 1V97A 1V1OA 2KDEB 3TIXA 3ENEA 1B1ZA 1SSNA 1WX7A 3RYTA 1C4CA 5KHOA 4N58A 4BKSA 2WX0A 4HJGE 1E10A 3IBEA 2JXXA 1K52A 4RGTA 1FNVA 4H2AA 2V3PA 3RCZA 3EUB2 4L2YA 1BXTA 1YX6B 2AQ3B 4FJVB 2Q5WD 1SIFA 1SJHD 2RD0A 2XK5A 1SE9A 2XK5B 1GOZA 3AEDB 3W9CB 1HXYD 2WDVB 4DQOC 1FD6A 1QOAA 1OGWA 3Q3MC 3V05A 1FIQA 1N63A 4A20A 1PGXA 2DNFA 4MH0E 4BKTA 3URYA 2OHFA 3L17A 2CKHB 4FA6A 4NQLB 2MQJA 4FXCA 1JROA 1D4BA 4EFOA 1TKEA 1NYQA 4RMAA 4RH6A 2KZRA 4OVZA 3PTFC 2CHZA 1F2RI 2HD5B 3P2BA 4YTPB 1NEKB 2AQ2B 2DYMA 3DPDA 3V61A 4LNFA 1WX9A 3IT6B 4M01A 3WA0A 1WGGA 1AWDA 5D3DA 2FUHB 4II3B 4KZ0A 1LQBA 5FR3A 2IGHA 2C7MB 2J53A 4IW0A 2EKIA 2MSED 1E7VA 1EM7A 3NZSA 3P1MA 4M8NA 4WJOA 1L2NA 4DDGD 3M3JA 3ZLZA 2LASA 1TJEA 2LXCA 1TS2A 4B95A 2V0GA 2OJWA 3Q3JA 4K7SA 2PE9A 2ZJDA 1KJTA 2NTTA 2QCZA 1Q1OA 5IA7A 5HFYA 1QOBA 1ZDVA 1EU3A 4ZRJA 1E5WA 5DPRA 3ZNZB 1UWXA 4EZJA 2O2VA 2O2VB 3CWIA 5CHWA 2O6VD 5EDSA 4LCDE 1C79A 1I4PA 3L16A 2K6QA 4AOFA 1FNUA 3IFWB 1ZGUB 1L0XB 1OFFA 1T0SC 1WZ3A 2WXMA 5EE3A 2JWZA 4RGOS 1WFYA 2KFKB 1T6BX 2KFKA 2DX5B 1V81A 2GI9A 2KNBA 3BINA 1I4RA 1P98A 1JWMD 1S3SG 4ANUA 1YMHE 3MFGA 2BB5A 2I2YA 1EWYC 2L8JA 4MT5A 3I63C 3AE1B 1N60A 4N59A 1V80A 4YSYB 4LNKA 1FNWA 3RNFC 1J19A 3VFKA 1UH6A 2BW2A 2EMTA 1XQQA 2KVZA 1WM2A 5I4DA 4WH4A 1I35A 2BYEA 1NENB 4GSWA 3DBRB 4GLSC 1PYWD 1XO3A 2JUOA 4K81A 1U4AA 3AE9B 3EFUA 1QF6A 1HEZE 1UWMA 2G1EA 4O1NA 3LB8C 3L08A 3B1LX 5GMVA 2NBVB 4MM3A 4MM3B 3NOBA 1L6UA 2WDQB 1TZ1A 3U7ZA 1YX5B 3I5JC 4PS7A 1C4PA 1FFUA 4FJYA 3WIMA 2JZPA 4RNAA 3AMZA 1OEYA 4EZLA 4FLHA 1XXGA 2WQYB 3VAWA 1SF0A 1R4NB 4J6IA 3NVVA 3U7DA 2B76B 1GPXA 2M56B 2HDEA 1HQRD 1RWSA 4HEA1 2G3QB 2KT7A 4IDIA 3DVGY 4A9AA 1I4XA 3DBLI 4W9FA 4WWPA 1X1MA 4PYUA 3FILA 3FILB 3BVZA 3APCA 3PPAA 1WYGA 3DQVA 1P1AA 4WWOA 5C23A 2AEHA 3AH7A 3BK1A 2W55A 3B9JA 2BPSA 1K50A 1Q5WB 2WXRA 1WRIA 2L0TA 3C8YA 3L4PA 2K9XA 4P1CC 4L1BA 2IY0B 2IO1B 3M63B 2DENB 4M0WA 4M0WB 1E90A 5LLIA 5LXIB 1SE3A 4XWTA 4PS8A 1KM7A 3GS2A 3B2FA 2CU1A 4P7IA 3SDLC 5D7GA 4MSMB 1C9FA 2KQ7A 3DVNV 2W3RA 2QSDA 3LJ3A 1FMAD 1TKGA 4OZBA 4MGYE 3ZXVA 1V2YA 1NDDA 1MJDA 4ASWC 1N62A 1R4MI 4CO7A 2V9HA 1WE7A 4W9KA 4W9GA 1WZ0A 2IZVB 2MX2A 2KACA 3CIRB 2BVCA 5D2MB 3ML8A 3QAQA 4OVVA 3HIZA 3VDZA 2N9KA 4XYCA 2LMCA 1N6ZA 4KKJA 2YVCA 3AE4B 2WXOA 4XZ4A 4GXBA 2D2QA 2UYZB 3RULA 4MEMA 2WS3B 2VH2A 2K8BA 2WXKA 1JWAD 1E8XA 1HTOA 1YJ1A 2KMMA 2I38A 1M4VA 3PZ7A 2KAJA 3RZWC 3OJ4B 2NBUA 3AE3B 4LLGM 3DBLB 1C4AA 1JRUA 2BTEA 1OQRA 3ZIMA 4II2B 4KDIC 3W1YA 4N9F4 1QOFA 3JW0X 1Z2MA 3DWGC 4LDTD 3EC8A 1IPGA 4AP4C 1ZUD2 3WAOA 1T0QC 3UQBA 4WJQA 2KKCA 2K39A 3CF6E 5KHQA 5CHFA 4XDCA 3JVZX 4W9IA 1XD3B 2FUG1 4K3CA 3ZNHB 2BS2B 3RNAC 2HTME 3W1SC 2PJHA 4MDKE 1WWTA 5GXGB 1K53A 3AULA 2RDGA 3K9PB 2FCNA 1T0RC 3VUXA 1T3QA 3ZUNA 3QQ8B 3GE3C 2JZZA 1SB3C 2Z8LA 4KX6B 2EELA 3V60A 2INNE 2LI5A 4NZLB 4XDDA 3X0WA 2G9HD 5IOIA 4MACA 2MBQA 1ZW7A 3EGRA 3RUIB 1RFAA 4OZAA 2SAKA 4JWUC 4E3CA 1GG3A 1WGHA 2UU7A 1E9MA 2L1AA 5BYRA 2AYOB 2M19A 5J18A 3Q8FA 3ZQ4A 1C77A 1ET9A 4IG7B 2LXAA 4I6NB 2INDC 2ONQA 4AQ7A 2K8HA 5JXVA 3U52E 5JH5C 3QCAA 4I6LB 4JLCA 3KUDB 1E8WA 2KX3A 3BIID 4TQ1A 4E74A 3QA8A 5JHBA 2MRPA 2FIFA 2D07B 1SGHA 2NBWB 1L4DB 2BBCA 3H7PA 3H7PB 3R66C 2WWZA 3HUIA 3P4QB 4ZRKA 4K7WA 1J7BA 2VZKB 3W2DA 1LM8B 2FCMA 4EE2A 4ANWA 1J0GA 1F1HA 3OAWA 3VQIA 3NVYA 1JALA 3TL5A 2BKFA 4P6VF 1JWUD 3I57A 2V3NA 1JCKB 1WGKA 3IVFA 2D3CA 5G55A 3ML9A 2KWCA 3DDCB 2WGSA 3N20C 3Q8EA 2L3ZA 4KGSA 1C78A 4EZKA 1YJIA 2BYVE 3HM3A 3MC8A 3FC4A 3V6EB 2CR5A 5AEKB 3H8HA 1D6EC 2JYEA 3AEGB 4ZYNA 3GZNI 4B0MA 4LK0M 1UGJA 1GB1A 3T8MA 4XC2A 3ZYYX 4P1BC 2KDFB 2I1JA 1JRPA 4JWSC 2N4FA 1WXVA 2PMVA 2BB6A 1XF5L 4CQNA 2Y5BB 4OW0A 4YT0B 1OQYA 2AL6A 2KWUB 2I1KA 1F77A 4AJWA 2A5UA 2MJEA 4TQ0A 2WXHA 5IAAC 2JWUA 2LGIA 4TSSA 1GC7A 2MH7A 4S17A 3SFEB 2BS3B 1V1PA 1V1PB 1WSPA 2DZMA 5CTRC 4PT5A 1CK1A 1E8YA 3L10B 4RF0A 3IG3A 1N5WA 3MP9A 5EE9A 3JYUA 2D11A 2W9NA 3DHGC 1L0VB 3MHSD 2C9WB 2KD0A 2KDBA 4HCPB 5G5GA 3BY4B 3DCGA 2DAJA 2R61A 3PS6A 1VZ8A 4MSQB 2V4LA 3AEBB 1ZE3D 3BVGA 3EFCA 1YQ3B 3B0AA 2Y5CA 4EOYA 3ZKJC 2RMMA 1YJJA 1EF1A 5J2RA 5BYSA 4RCOA 2KO3A 4ZYSA 2EMSA 4F1SA 2X8XX 3H7SA 3AEAB 2LUMA 4W9JA 2D3GA 4YSZB 4HWIB 4REZA 5MPOA 3QJZA 4M02A 4MELA 5G5HA 3GZNB 4C00A 1ZXHA 3T3OA 4HPPA 1YNTE 4G3XB 4RFBA 2Y5PA 1L5PA 2C60A 1TS4A 3L0WB 2IDYA 1YN5A 3E9SA 1LFDA 1WXQA 3UF8A 1KLUD 3Q69A 3HVZA 4FJZA 2GRIA 3VRAB 2N0SB 1ROEA 1AYFA 5HKHA 5IO9A 2KWVB 4W9LA 3NS1A 2G4DB 1E7PB 4FULA 4DXGA 3DBRI 5AZFA 3PRMB 2WXFA 4LTUA 4MH8A 4ARIA 2HJ8A 1B9RA 1F2RC 1UZXB 3NVZA 2PE6B 3TEXA 2LRWA 4KZCA 3I3TB 3BVMA 2N7JA 4HKZE 4IWOA 4DBGA 4B0EA 3FAHA 1XLOA 4ITKA 4WWNA 2KJHB 2ZPYA 4JL9A 2WHIA 4IWQA 2GLSA 3WALA 2FCSA 1FFVA 3Q2AC 2ZPNA 1WH3A 4L23A 5BYQA 2KLCA 3MJ5A 4ARCA 1R4NI 3KLSX 2BF8B 4HPLB 1ENFA 3B08A 3OJ3A 5DPSA 5EE0A 2BT6A 2QEJC 1VDVA 3NHEB 1Y8RC 1KTKA 4BOZB 2MCNB 3OLMD 4JX1C 1QKZA 2MA9B 4HROA 2MJDA 3ZO5B 3AEEB 2WP9B 1PUTA 1D5XC 4GOCA 1NI3A 5DPWA 4YXDB 3TEYA 4FN2A 2LRUA 1C3TA 1MG8A 3IT4B 4J3OD 3GOEA 1DOIA 2Y3AA 4PYZA 2D3AA 1UBIA
chains in the Genus database with same CATH topology
3EHVA 3KUZA 1RAXA 1GC6A 4W9DA 4EKUA 2KX0A 3ZNID 2KJRA 3ZTDA 5AZGA 1G6JA 4DXAB 2ASQA 3CSTA 2R2QA 5D2MB 3ML8A 3QAQA 2LVQA 4OVVA 3HIZA 2CHXA 3PRPB 3VDZA 2K25A 3R7RA 2VRRB 2N7DA 3WAPA 2YVCA 3DBHI 1VD2A 1EUVB 4DHZE 4GIVA 3UQAA 4XZ4A 2NVUI 4GXBA 2ZNVB 1CMXB 3QARA 4F8CB 2D2QA 2UYZB 2KN5A 1TGZB 3M62B 2J7QB 3RULA 2WX1A 2AL3A 3HK0A 1E8ZA 4MEMA 1I42A 4HK2A 4M8MA 2GBNA 2K8BA 3VTWA 3Q3FA 3KVFB 5DPTA 1E8XA 4IM0A 2J0MA 4WJNA 1WRDB 1YJ1A 2MBBB 3H1UA 4BOSC 1VCBA 4GB9A 3PT2B 2XBBC 5JZEB 4GN1A 4ICUA 1J8CA 3N3KB 3OJ4B 1NBFC 1T0YA 2NBUA 3RZWC 2MW5A 4B9KA 3AU5A 1WR6E 4W9CA 2QHOA 4DHZB 1JRUA 1EF5A 1P0RA 4G11A 5FR6A 1WX8A 4FBJB 3TJPA 3QWZB 3N32A 3ZIMA 4II2B 1LXDA 5E6OA 2NR2A 4DHJB 2IO0B 4KDIC 1UD7A 3W1YA 1FXTB 1TBEA 4N9F4 2DAFA 1WR1A 3SU8X 3JW0X 3PLVA 3U8ZA 2KMAA 1Z2MA 4LDTD 3EC8A 3PV1A 1UGMA 1YD8U 4JIOU 1IPGA 4AP4C 3A4RA 1WJ6A 1XT9B 2LD9A 1UBQA 2IO3B 4IC7B 3VTVA 4ICVA 3WAOA 4DK5A 3UQBA 4IM3A 2DZIA 3UIPB 2KVRA 2DZKA 2KC2A 2WDTB 2IY1B 4W9HA 3APDA 3HM6X 4WJQA 3RZFA 2KKCA 1UELA 2DYBA 3ECIA 2KLGA 2K39A 3CF6E 1WYWB 1ISNA 5KHQA 1IYFA 5CHFA 4LJPB 4JQWC 1WJ4A 3JVZX 3HHMA 2KXJA 4W9IA 2DHZA 5C1ZA 4KSLC 1XD3B 3UINB 3TMPB 2N9EB 4BBNF 3DVGX 3ZNHB 2V1YA 2MP2A 2MP2B 2YLMA 3UIOB 1WXSA 3A4SC 3A9KA 3A9KB 3W1SC 2PJHA 4MDKE 4GGQA 1C1YB 1WI0A 3AULA 2M8SA 3K9PB 3N30A 2JZ3B 2FCNA 4WJPA 4F7ZA 1WMHA 1WMHB 3VUXA 3VXWA 2LGXA 3ZUNA 3QQ8B 4DWFA 4FHKA 1WY8A 2MWSB 2JZZA 2GBKA 3RD2A 4WQOB 4HDQA 4HCNB 4HDOA 3VH3B 3V60A 2CS4A 1EO6A 4TKNA 4MGIE 2M17A 3CMMB 2LI5A 2L76A 4G50A 3VH4B 3X0WA 2FNJB 2C7NB 3CSFA 2BWES 2MBQA 3L54A 4W9EA 1ZW7A 2KJ6A 3RUIB 5CHVC 1RFAA 4AWJA 3TIXA 2KDEB 5LXHA 3ENEA 2KMCA 4RM9A 5J17A 2L0FA 1GG3A 3V62A 4E3CA 1WGHA 4EUTA 3KH0A 2A4ZA 2JY6A 1WX7A 5BO4B 2JPHA 3D32A 3PLUA 4IUMB 3RYTA 3C0RB 5KHOA 2AYOB 5J18A 3NZUA 4JGHB 2GBJA 4BKSA 2WX0A 3ZDMC 3IBEA 2JXXA 2B3AA 4IG7B 1TTNA 2LXAA 4I6NB 4KV2A 3R7QA 3RCZA 2JF5A 2C7HA 1ZKHA 1YX6B 2K8HA 4FJVB 4NNJB 5JH5C 2MLBA 1SIFA 3QCAA 4I6LB 2M1MA 3KUDB 4JLCA 2NCNA 2RD0A 1E8WA 1SE9A 2KX3A 2XK5A 2XK5B 3ZTCA 1WXMA 2NPTA 2NPTB 1OGWA 4TQ1A 4E74A 2GBRA 4A20A 3QA8A 5JHBA 1V86A 2IYDB 2MRPA 2FIFA 3LDZE 4MH0E 4BKTA 3MTNB 2Z0DB 2D07B 4I6PA 2KC1A 4HXDA 1SGHA 4ZRIA 2JRIB 2NBWB 3H7PA 2CKHB 3H7PB 3L17A 2MQJA 3R66C 4NQLB 3PSEB 5D6JB 4BKGA 4FA6A 2WWZA 2O6VA 2O6VB 4EFOA 4ZRKA 3AI5A 4RMAA 5JHAA 2KZRA 3PHXB 3PVLA 4K7WA 2OOBB 3PTFC 3KW5B 2CHZA 1WJNA 4AUQC 2Z59B 1LM8B 2FCMA 2HD5B 2J0JA 3P2BA 4ANWA 1J0GA 2DYMA 2KANA 3DPDA 3VUWA 3V61A 2L00B 3OAWA 3VQIA 1WX9A 2L7RA 2ZEQA 2LJ5A 3WA0A 1WGGA 3PGEA 5D94A 3TL5A 1Z5SB 2BKFA 1OTRB 2KTFA 2K1FA 5G2NA 3IVFA 1OEYJ 4KIKA 4KIKB 2FUHB 4II3B 5DCNA 4KZ0A 5G55A 2ZCBA 3ZDTA 1LQBA 1A5RA 3ML9A 3QK0A 4ZDVA 2C7MB 2KWCA 3NS8A 3DDCB 2LUEA 2M0XA 2N9XA 4IW0A 4HLEA 2L3ZA 2ZVNA 2RPQA 2J0KA 5CX3A 4EZKA 2IO2B 1HE8A 2BYVE 3HM3A 1GNUA 5AZHA 4IWPA 3V6EB 2CR5A 2MSED 3O65B 4K7UA 5AEKB 2BKRB 1E7VA 1WM3A 1WGRA 4KVGB 3KYCD 3NZSA 4M8NA 4WJOA 5L95C 4NQKE 4DDGD 1L2NA 4ZYNA 3M3JA 3GZNI 4BKSD 3ZLZA 2LASA 2KDIA 3VTUA 2LXCA 1H8CA 3NY5A 4MGZE 4B95A 3T8MA 4ANVA 1GJZA 4XC2A 1D3ZA 2UWQA 2REXA 1YQBA 2HTHA 3SD5A 3VHTC 1WIAA 2KDFB 3ALBA 1KOTA 2I1JA 3Q3JA 4K7SA 2GMIC 2PE9A 2ZJDA 2N4FA 1WXVA 1KJTA 2Y5BB 1Q1OA 4GU2A 3TBLD 5IA7A 2G4SA 2PEAA 1OQYA 4DDID 2AL6A 1H4RA 3A33B 2ZNVC 4ZRJA 4KDLB 1E5WA 1V6EA 2I1KA 2KWUB 5DPRA 4AJWA 2A5UA 3ZNZB 4EZJA 2PPHA 4TQ0A 2BWFA 2O2VA 2O2VB 5IAAC 2KTRA 2KTRB 3WAMA 1GC7A 5CHWA 2O6VD 3DOWA 5EDSA 2N1WA 3ZRCA 1V49A 3U30A 3H6NA 4K1RB 4LCDE 2LWPA 4E71A 2DZMA 5CTRC 4GDKB 4GDKA 3QHTA 3KUCB 2BYFA 3L16A 1BT0A 1E8YA 2FAZA 2JVCA 2K6QA 2L05A 1WGYA 2FCQA 3UGBB 4IM2A 4AOFA 2Z0EB 3IFWB 2MBEA 1ZGUB 2FIDA 1WZ3A 3L10B 3IG3A 4DHJD 2JWZA 4MJSB 1WFYA 3JYUA 2LGYA 2D11A 2W9NA 4MJSA 2HE7A 3WANA 2KFKB 2KFKA 2DX5B 4A3PA 3VUYA 3MHSD 1V81A 2C9WB 3A9JB 3A9JA 2KD0A 2KNBA 3BINA 3JSVA 3JSVB 4RM8A 2KDBA 4HCPB 3BY4B 1P98A 1S3SG 3DCGA 2DAJA 4ANUA 3PS6A 4HPMB 4NPNA 1V9JA 4ANXA 3H9DA 4GDLA 4GDLB 4MSQB 4G0NB 2LGDA 2L8JA 2DYOA 2V4LA 3A1QA 3A1QB 2KK8A 3B0AA 3RT3B 4XX5A 2N9PC 4EOYA 3DVNU 3ZKJC 2BGFA 2OJRA 1EF1A 1P9DU 3ZNGC 2ZVOA 5J2RA 1E7UA 2KO3A 1NI2A 2EMSA 4F1SA 2R2OA 3H7SA 3IHPC 1V80A 2G45B 3SHQA 2KFJA 4PS3A 4W9JA 4X57B 1J19A 3W1SA 2D3GA 4BVUC 3VFKA 1UH6A 2K8CA 4FADA 2EMTA 1XQQA 2RSUA 4HWIB 1WM2A 3QJZA 4KSKC 1I35A 3V6CB 4MELA 4HJKA 2BYEA 2WYQA 3PHWB 3VVWB 3DBSA 2KQSA 4CHKA 4GSWA 1P3QU 3M95A 1V5OA 2V3SA 1GUAB 2M4NA 4G3XB 3ZRFA 2KOXA 2N7EA 2JUOA 4K81A 3L13A 1U4AA 2C60A 3EFUA 3L0WB 1KLVA 4NJ7A 1LFDA 3UF8A 4FJZA 3L08A 3B1LX 5GMVA 1S1QB 2GOWA 2NBVB 4MM3A 3NOBA 1WGDA 2CHWA 1TZ1A 1YX5B 3MJWA 2JRHA 4PS7A 5HKHA 3AU4A 4WAAA 4FJYA 3WIMA 2KWVB 4TV3A 2JT4B 4W9LA 3TCAA 4A3OA 2G4DB 1RRBA 2MBHA 1OEYA 4FULA 4NY0A 4EZLA 4FLHA 3DBRI 5AZFA 3PRMB 3VAWA 2HJ8A 2LVOA 1L7YA 4J6IA 3X23A 3EECA 3U7DA 1UZXB 1WE6A 4LJOB 2PE6B 4OVUA 2LZ6A 2LRWA 4KZCA 3R3MA 1WJUA 1RLFA 2D10A 3I3TB 1IP9A 2RGFA 2G3QB 1YIWA 2DZJA 4DBGA 1PQSA 4IWOA 3DVGY 3APFA 3QC8B 3DBLI 3PZDA 2NS5A 2C5LC 3PRZA 4W9FA 4WWPA 4B6WA 4WWNA 1X1MA 4PYUA 2KJHB 2ZPYA 4JL9A 4IWQA 3APCA 3PPAA 3DQVA 3WALA 1P1AA 4WWOA 5C23A 2FCSA 2AEHA 2MBOA 2ZPNA 5E6NA 1WH3A 4HVBA 2BPSA 1Q5WB 2ZZPB 4URKA 1WXAA 2KLCA 2L0TA 3PREA 1R4NI 4YL8A 4BBNC 4NAWA 4NAWB 5L83A 2IY0B 2IO1B 2KHWB 2BF8B 2K6DB 3M63B 4HPLB 2DENB 4M0WB 1E90A 3QIJA 1Q0WB 4NJ6A 1F9JA 3B08A 5LLIA 4BFRA 5LXIB 3OJ3A 5DPSA 1AARA 3QX1A 3NHEB 2EKEC 1Y8RC 4PS8A 1KM7A 4BOZB 4LDTB 3T9LA 2MCNB 3OLMD 3S2AA 2GBMA 2CU1A 4P7IA 3SDLC 5D7GA 1QZEA 4GMVA 2KQ7A 3AXCA 3DVNV 4MSMB 2MA9B 2ZCCA 3ZO5B 2RR9A 4FHJA 3LJ3A 2LVPA 4MGYE 5DPWA 4GOCA 3ZW3A 1V2YA 3ZVVA 2AWTA 1NDDA 1M94A 2LRUA 2XEWA 3KYDD 4FN2A 1V5TA 5TR5A 4CYEA 4ASWC 1C3TA 1MG8A 1R4MI 3ONSA 4MGKE 4CO7A 1WE7A 3GOEA 4W9KA 4W9GA 1WZ0A 1K8RB 4PYZA 4EEWA 4AJYB 1WF9A 2N1VA 2IBIB 2IZVB 2MX2A 1UBIA 4TUUA 3K9OB 5E6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHV A;  3KUZ A;  1RAX A;  1GC6 A;  4W9D A;  4EKU A;  2KX0 A;  3ZNI D;  2KJR A;  3ZTD A;  5AZG A;  1G6J A;  4DXA B;  2ASQ A;  3CST A;  2R2Q A;  5D2M B;  3ML8 A;  3QAQ A;  2LVQ A;  4OVV A;  3HIZ A;  2CHX A;  3PRP B;  3VDZ A;  2K25 A;  3R7R A;  2VRR B;  2N7D A;  3WAP A;  2YVC A;  3DBH I;  1VD2 A;  1EUV B;  4DHZ E;  4GIV A;  3UQA A;  4XZ4 A;  2NVU I;  4GXB A;  2ZNV B;  1CMX B;  3QAR A;  4F8C B;  2D2Q A;  2UYZ B;  2KN5 A;  1TGZ B;  3M62 B;  2J7Q B;  3RUL A;  2WX1 A;  2AL3 A;  3HK0 A;  1E8Z A;  4MEM A;  1I42 A;  4HK2 A;  4M8M A;  2GBN A;  2K8B A;  3VTW A;  3Q3F A;  3KVF B;  5DPT A;  1E8X A;  4IM0 A;  2J0M A;  4WJN A;  1WRD B;  1YJ1 A;  2MBB B;  3H1U A;  4BOS C;  1VCB A;  4GB9 A;  3PT2 B;  2XBB C;  5JZE B;  4GN1 A;  4ICU A;  1J8C A;  3N3K B;  3OJ4 B;  1NBF C;  1T0Y A;  2NBU A;  3RZW C;  2MW5 A;  4B9K A;  3AU5 A;  1WR6 E;  4W9C A;  2QHO A;  4DHZ B;  1JRU A;  1EF5 A;  1P0R A;  4G11 A;  5FR6 A;  1WX8 A;  4FBJ B;  3TJP A;  3QWZ B;  3N32 A;  3ZIM A;  4II2 B;  1LXD A;  5E6O A;  2NR2 A;  4DHJ B;  2IO0 B;  4KDI C;  1UD7 A;  3W1Y A;  1FXT B;  1TBE A;  4N9F 4;  2DAF A;  1WR1 A;  3SU8 X;  3JW0 X;  3PLV A;  3U8Z A;  2KMA A;  1Z2M A;  4LDT D;  3EC8 A;  3PV1 A;  1UGM A;  1YD8 U;  4JIO U;  1IPG A;  4AP4 C;  3A4R A;  1WJ6 A;  1XT9 B;  2LD9 A;  1UBQ A;  2IO3 B;  4IC7 B;  3VTV A;  4ICV A;  3WAO A;  4DK5 A;  3UQB A;  4IM3 A;  2DZI A;  3UIP B;  2KVR A;  2DZK A;  2KC2 A;  2WDT B;  2IY1 B;  4W9H A;  3APD A;  3HM6 X;  4WJQ A;  3RZF A;  2KKC A;  1UEL A;  2DYB A;  3ECI A;  2KLG A;  2K39 A;  3CF6 E;  1WYW B;  1ISN A;  5KHQ A;  1IYF A;  5CHF A;  4LJP B;  4JQW C;  1WJ4 A;  3JVZ X;  3HHM A;  2KXJ A;  4W9I A;  2DHZ A;  5C1Z A;  4KSL C;  1XD3 B;  3UIN B;  3TMP B;  2N9E B;  4BBN F;  3DVG X;  3ZNH B;  2V1Y A;  2MP2 A;  2MP2 B;  2YLM A;  3UIO B;  1WXS A;  3A4S C;  3A9K A;  3A9K B;  3W1S C;  2PJH A;  4MDK E;  4GGQ A;  1C1Y B;  1WI0 A;  3AUL A;  2M8S A;  3K9P B;  3N30 A;  2JZ3 B;  2FCN A;  4WJP A;  4F7Z A;  1WMH A;  1WMH B;  3VUX A;  3VXW A;  2LGX A;  3ZUN A;  3QQ8 B;  4DWF A;  4FHK A;  1WY8 A;  2MWS B;  2JZZ A;  2GBK A;  3RD2 A;  4WQO B;  4HDQ A;  4HCN B;  4HDO A;  3VH3 B;  3V60 A;  2CS4 A;  1EO6 A;  4TKN A;  4MGI E;  2M17 A;  3CMM B;  2LI5 A;  2L76 A;  4G50 A;  3VH4 B;  3X0W A;  2FNJ B;  2C7N B;  3CSF A;  2BWE S;  2MBQ A;  3L54 A;  4W9E A;  1ZW7 A;  2KJ6 A;  3RUI B;  5CHV C;  1RFA A;  4AWJ A;  3TIX A;  2KDE B;  5LXH A;  3ENE A;  2KMC A;  4RM9 A;  5J17 A;  2L0F A;  1GG3 A;  3V62 A;  4E3C A;  1WGH A;  4EUT A;  3KH0 A;  2A4Z A;  2JY6 A;  1WX7 A;  5BO4 B;  2JPH A;  3D32 A;  3PLU A;  4IUM B;  3RYT A;  3C0R B;  5KHO A;  2AYO B;  5J18 A;  3NZU A;  4JGH B;  2GBJ A;  4BKS A;  2WX0 A;  3ZDM C;  3IBE A;  2JXX A;  2B3A A;  4IG7 B;  1TTN A;  2LXA A;  4I6N B;  4KV2 A;  3R7Q A;  3RCZ A;  2JF5 A;  2C7H A;  1ZKH A;  1YX6 B;  2K8H A;  4FJV B;  4NNJ B;  5JH5 C;  2MLB A;  1SIF A;  3QCA A;  4I6L B;  2M1M A;  3KUD B;  4JLC A;  2NCN A;  2RD0 A;  1E8W A;  1SE9 A;  2KX3 A;  2XK5 A;  2XK5 B;  3ZTC A;  1WXM A;  2NPT A;  2NPT B;  1OGW A;  4TQ1 A;  4E74 A;  2GBR A;  4A20 A;  3QA8 A;  5JHB A;  1V86 A;  2IYD B;  2MRP A;  2FIF A;  3LDZ E;  4MH0 E;  4BKT A;  3MTN B;  2Z0D B;  2D07 B;  4I6P A;  2KC1 A;  4HXD A;  1SGH A;  4ZRI A;  2JRI B;  2NBW B;  3H7P A;  2CKH B;  3H7P B;  3L17 A;  2MQJ A;  3R66 C;  4NQL B;  3PSE B;  5D6J B;  4BKG A;  4FA6 A;  2WWZ A;  2O6V A;  2O6V B;  4EFO A;  4ZRK A;  3AI5 A;  4RMA A;  5JHA A;  2KZR A;  3PHX B;  3PVL A;  4K7W A;  2OOB B;  3PTF C;  3KW5 B;  2CHZ A;  1WJN A;  4AUQ C;  2Z59 B;  1LM8 B;  2FCM A;  2HD5 B;  2J0J A;  3P2B A;  4ANW A;  1J0G A;  2DYM A;  2KAN A;  3DPD A;  3VUW A;  3V61 A;  2L00 B;  3OAW A;  3VQI A;  1WX9 A;  2L7R A;  2ZEQ A;  2LJ5 A;  3WA0 A;  1WGG A;  3PGE A;  5D94 A;  3TL5 A;  1Z5S B;  2BKF A;  1OTR B;  2KTF A;  2K1F A;  5G2N A;  3IVF A;  1OEY J;  4KIK A;  4KIK B;  2FUH B;  4II3 B;  5DCN A;  4KZ0 A;  5G55 A;  2ZCB A;  3ZDT A;  1LQB A;  1A5R A;  3ML9 A;  3QK0 A;  4ZDV A;  2C7M B;  2KWC A;  3NS8 A;  3DDC B;  2LUE A;  2M0X A;  2N9X A;  4IW0 A;  4HLE A;  2L3Z A;  2ZVN A;  2RPQ A;  2J0K A;  5CX3 A;  4EZK A;  2IO2 B;  1HE8 A;  2BYV E;  3HM3 A;  1GNU A;  5AZH A;  4IWP A;  3V6E B;  2CR5 A;  2MSE D;  3O65 B;  4K7U A;  5AEK B;  2BKR B;  1E7V A;  1WM3 A;  1WGR A;  4KVG B;  3KYC D;  3NZS A;  4M8N A;  4WJO A;  5L95 C;  4NQK E;  4DDG D;  1L2N A;  4ZYN A;  3M3J A;  3GZN I;  4BKS D;  3ZLZ A;  2LAS A;  2KDI A;  3VTU A;  2LXC A;  1H8C A;  3NY5 A;  4MGZ E;  4B95 A;  3T8M A;  4ANV A;  1GJZ A;  4XC2 A;  1D3Z A;  2UWQ A;  2REX A;  1YQB A;  2HTH A;  3SD5 A;  3VHT C;  1WIA A;  2KDF B;  3ALB A;  1KOT A;  2I1J A;  3Q3J A;  4K7S A;  2GMI C;  2PE9 A;  2ZJD A;  2N4F A;  1WXV A;  1KJT A;  2Y5B B;  1Q1O A;  4GU2 A;  3TBL D;  5IA7 A;  2G4S A;  2PEA A;  1OQY A;  4DDI D;  2AL6 A;  1H4R A;  3A33 B;  2ZNV C;  4ZRJ A;  4KDL B;  1E5W A;  1V6E A;  2I1K A;  2KWU B;  5DPR A;  4AJW A;  2A5U A;  3ZNZ B;  4EZJ A;  2PPH A;  4TQ0 A;  2BWF A;  2O2V A;  2O2V B;  5IAA C;  2KTR A;  2KTR B;  3WAM A;  1GC7 A;  5CHW A;  2O6V D;  3DOW A;  5EDS A;  2N1W A;  3ZRC A;  1V49 A;  3U30 A;  3H6N A;  4K1R B;  4LCD E;  2LWP A;  4E71 A;  2DZM A;  5CTR C;  4GDK B;  4GDK A;  3QHT A;  3KUC B;  2BYF A;  3L16 A;  1BT0 A;  1E8Y A;  2FAZ A;  2JVC A;  2K6Q A;  2L05 A;  1WGY A;  2FCQ A;  3UGB B;  4IM2 A;  4AOF A;  2Z0E B;  3IFW B;  2MBE A;  1ZGU B;  2FID A;  1WZ3 A;  3L10 B;  3IG3 A;  4DHJ D;  2JWZ A;  4MJS B;  1WFY A;  3JYU A;  2LGY A;  2D11 A;  2W9N A;  4MJS A;  2HE7 A;  3WAN A;  2KFK B;  2KFK A;  2DX5 B;  4A3P A;  3VUY A;  3MHS D;  1V81 A;  2C9W B;  3A9J B;  3A9J A;  2KD0 A;  2KNB A;  3BIN A;  3JSV A;  3JSV B;  4RM8 A;  2KDB A;  4HCP B;  3BY4 B;  1P98 A;  1S3S G;  3DCG A;  2DAJ A;  4ANU A;  3PS6 A;  4HPM B;  4NPN A;  1V9J A;  4ANX A;  3H9D A;  4GDL A;  4GDL B;  4MSQ B;  4G0N B;  2LGD A;  2L8J A;  2DYO A;  2V4L A;  3A1Q A;  3A1Q B;  2KK8 A;  3B0A A;  3RT3 B;  4XX5 A;  2N9P C;  4EOY A;  3DVN U;  3ZKJ C;  2BGF A;  2OJR A;  1EF1 A;  1P9D U;  3ZNG C;  2ZVO A;  5J2R A;  1E7U A;  2KO3 A;  1NI2 A;  2EMS A;  4F1S A;  2R2O A;  3H7S A;  3IHP C;  1V80 A;  2G45 B;  3SHQ A;  2KFJ A;  4PS3 A;  4W9J A;  4X57 B;  1J19 A;  3W1S A;  2D3G A;  4BVU C;  3VFK A;  1UH6 A;  2K8C A;  4FAD A;  2EMT A;  1XQQ A;  2RSU A;  4HWI B;  1WM2 A;  3QJZ A;  4KSK C;  1I35 A;  3V6C B;  4MEL A;  4HJK A;  2BYE A;  2WYQ A;  3PHW B;  3VVW B;  3DBS A;  2KQS A;  4CHK A;  4GSW A;  1P3Q U;  3M95 A;  1V5O A;  2V3S A;  1GUA B;  2M4N A;  4G3X B;  3ZRF A;  2KOX A;  2N7E A;  2JUO A;  4K81 A;  3L13 A;  1U4A A;  2C60 A;  3EFU A;  3L0W B;  1KLV A;  4NJ7 A;  1LFD A;  3UF8 A;  4FJZ A;  3L08 A;  3B1L X;  5GMV A;  1S1Q B;  2GOW A;  2NBV B;  4MM3 A;  3NOB A;  1WGD A;  2CHW A;  1TZ1 A;  1YX5 B;  3MJW A;  2JRH A;  4PS7 A;  5HKH A;  3AU4 A;  4WAA A;  4FJY A;  3WIM A;  2KWV B;  4TV3 A;  2JT4 B;  4W9L A;  3TCA A;  4A3O A;  2G4D B;  1RRB A;  2MBH A;  1OEY A;  4FUL A;  4NY0 A;  4EZL A;  4FLH A;  3DBR I;  5AZF A;  3PRM B;  3VAW A;  2HJ8 A;  2LVO A;  1L7Y A;  4J6I A;  3X23 A;  3EEC A;  3U7D A;  1UZX B;  1WE6 A;  4LJO B;  2PE6 B;  4OVU A;  2LZ6 A;  2LRW A;  4KZC A;  3R3M A;  1WJU A;  1RLF A;  2D10 A;  3I3T B;  1IP9 A;  2RGF A;  2G3Q B;  1YIW A;  2DZJ A;  4DBG A;  1PQS A;  4IWO A;  3DVG Y;  3APF A;  3QC8 B;  3DBL I;  3PZD A;  2NS5 A;  2C5L C;  3PRZ A;  4W9F A;  4WWP A;  4B6W A;  4WWN A;  1X1M A;  4PYU A;  2KJH B;  2ZPY A;  4JL9 A;  4IWQ A;  3APC A;  3PPA A;  3DQV A;  3WAL A;  1P1A A;  4WWO A;  5C23 A;  2FCS A;  2AEH A;  2MBO A;  2ZPN A;  5E6N A;  1WH3 A;  4HVB A;  2BPS A;  1Q5W B;  2ZZP B;  4URK A;  1WXA A;  2KLC A;  2L0T A;  3PRE A;  1R4N I;  4YL8 A;  4BBN C;  4NAW A;  4NAW B;  5L83 A;  2IY0 B;  2IO1 B;  2KHW B;  2BF8 B;  2K6D B;  3M63 B;  4HPL B;  2DEN B;  4M0W B;  1E90 A;  3QIJ A;  1Q0W B;  4NJ6 A;  1F9J A;  3B08 A;  5LLI A;  4BFR A;  5LXI B;  3OJ3 A;  5DPS A;  1AAR A;  3QX1 A;  3NHE B;  2EKE C;  1Y8R C;  4PS8 A;  1KM7 A;  4BOZ B;  4LDT B;  3T9L A;  2MCN B;  3OLM D;  3S2A A;  2GBM A;  2CU1 A;  4P7I A;  3SDL C;  5D7G A;  1QZE A;  4GMV A;  2KQ7 A;  3AXC A;  3DVN V;  4MSM B;  2MA9 B;  2ZCC A;  3ZO5 B;  2RR9 A;  4FHJ A;  3LJ3 A;  2LVP A;  4MGY E;  5DPW A;  4GOC A;  3ZW3 A;  1V2Y A;  3ZVV A;  2AWT A;  1NDD A;  1M94 A;  2LRU A;  2XEW A;  3KYD D;  4FN2 A;  1V5T A;  5TR5 A;  4CYE A;  4ASW C;  1C3T A;  1MG8 A;  1R4M I;  3ONS A;  4MGK E;  4CO7 A;  1WE7 A;  3GOE A;  4W9K A;  4W9G A;  1WZ0 A;  1K8R B;  4PYZ A;  4EEW A;  4AJY B;  1WF9 A;  2N1V A;  2IBI B;  2IZV B;  2MX2 A;  1UBI A;  4TUU A;  3K9O B;  5E6P A; 
#chains in the Genus database with same CATH topology
 3EHV A;  3I9V 1;  3KUZ A;  4EKU A;  2KX0 A;  2KJR A;  2ASQ A;  1FXA A;  2CHX A;  1L4Z B;  3AE7 B;  1VD2 A;  4DHZ E;  2JX5 A;  2VH1 A;  2K3U A;  2LEK A;  2NTS A;  2KN5 A;  3M62 B;  1BML C;  2KDM A;  3KVF B;  2LJI A;  1DGJ A;  2LGS A;  4BOS C;  5JZE B;  4GN1 A;  1DOX A;  1NBF C;  5H8Y E;  1WR6 E;  1LO5 D;  4FBJ B;  1P0R A;  4G11 A;  5IKC M;  3TJP A;  2PKO A;  1TY2 A;  5E6O A;  1YN3 A;  2NR2 A;  2QIE B;  5C2T B;  1PFD A;  1TBE A;  2DAF A;  3U8Z A;  2X38 A;  1FPY A;  1XT9 B;  2LD9 A;  1UBQ A;  2WXI A;  3BWU D;  2K22 A;  4DK5 A;  3UIP B;  2KVR A;  1MVK A;  2WDT B;  1UEL A;  1HZ5 A;  1FCC C;  2FE8 A;  2J4X A;  3RNC C;  3ZJV A;  1WJ4 A;  3HHM A;  2KXJ A;  2DHZ A;  2IPK D;  2SEB D;  4KSL C;  3DVG X;  3LXF A;  4TMA B;  2BYT A;  1TYG B;  3W5U B;  1C1Y B;  1ZOY B;  2M8S A;  3N30 A;  4WJP A;  1L6V A;  1FRR A;  2LGX A;  5E6J A;  1WY8 A;  4DXF A;  2MWS B;  2QIL A;  3EA6 A;  2XNA C;  3VH3 B;  1XCQ L;  1E0Z A;  2L76 A;  4G50 A;  2FNJ B;  2CJN A;  2BWE S;  3T3N A;  5LXH A;  2KMC A;  1P7E A;  5J17 A;  5H92 C;  3VRB B;  2A4Z A;  2JY6 A;  2JPH A;  3D32 A;  3PLU A;  4IUM B;  3NZU A;  4JGH B;  2GBJ A;  3ZDM C;  4WWM A;  3R7Q A;  2JF5 A;  1R7S A;  2C7H A;  4P16 A;  1KLG D;  3SEB A;  2M1M A;  3ZTC A;  1WXM A;  3TEZ A;  1V86 A;  2IYD B;  3LDZ E;  3DHI C;  2D3B A;  3MTN B;  3AB5 A;  4I6P A;  2KC1 A;  1ZDX A;  4ZRI A;  2JRI B;  1JWS D;  2JSV X;  1BUI C;  3PSE B;  4BKG A;  2O6V A;  2O6V B;  3AI5 A;  5JHA A;  3PHX B;  3KWV A;  2LFI A;  3NZ3 A;  2KAN A;  3VUW A;  2ZW1 A;  2L7R A;  2ZEQ A;  4C80 A;  4KGR A;  2YEP B;  1Z5S B;  2L32 A;  3AE5 B;  1IGC A;  2WXG A;  4ACF A;  3MC0 B;  1OEY J;  4KIK A;  4KIK B;  5DCN A;  2HJ1 A;  3ZDT A;  4BAX A;  1A5R A;  3QK0 A;  3NS8 A;  1IUE A;  2LUE A;  5EE1 A;  1DOY A;  2JQR B;  2KYW A;  3DWM A;  3P4S B;  2RPQ A;  2J0K A;  5CX3 A;  2IO2 B;  3AM9 A;  1GNU A;  1TY0 A;  1C76 A;  4IWP A;  4K7U A;  1TT5 B;  1WM3 A;  4KVG B;  2AX5 A;  1JML A;  4BKS D;  4ZHO A;  1H8C A;  2QDF A;  4MGZ E;  3ETR A;  1D3Z A;  2JXT A;  2UWQ A;  1YQB A;  5TSS A;  1KOT A;  3ALB A;  1E6E B;  3RMK C;  4ZRQ A;  4YTN B;  4GU2 A;  3TBL D;  2KN4 A;  4LNO A;  4DDI D;  3Q8A A;  3A33 B;  2ZNV C;  5BMI A;  4KDL B;  2E6X A;  2J42 A;  1V6E A;  2PPH A;  4N6E B;  1PDX A;  3OG5 A;  2KTR A;  2KTR B;  3WAM A;  3SR6 A;  4A8X C;  3AV8 A;  2N1W A;  3ZRC A;  3H6N A;  4K1R B;  2LWP A;  2JU6 X;  1KF6 B;  3QHT A;  2FAZ A;  1WGY A;  2FCQ A;  3ZJT A;  1RYJ A;  1SEB D;  1JQ4 A;  1CQV A;  1FXI A;  4MJS B;  4MJS A;  2LGY A;  3N9Y C;  1I7H A;  4A3P A;  3VUY A;  3A9J B;  3A9J A;  3ZXR A;  3JSV A;  3JSV B;  4RM8 A;  1VR9 A;  2J52 A;  5AUI A;  4HPM B;  2L52 A;  4NPN A;  4ANX A;  3H9D A;  4GDL A;  4GDL B;  2LGD A;  3RNB C;  2DYO A;  4XX5 A;  1UUP A;  2DBY A;  3NRZ A;  2BGF A;  2OJR A;  1A70 A;  1JW9 D;  1MFW A;  3NJT A;  1E7U A;  1NI2 A;  2R2O A;  2G45 B;  4PS3 A;  3W1S A;  3HRD D;  2K8C A;  3SFD B;  2RSU A;  1FM0 D;  2NMQ A;  4WIP A;  3HVD A;  3MHZ A;  4LNI A;  3Q8C A;  2WU2 B;  4HJK A;  1I4Q A;  3PHW B;  2WYQ A;  3DBS A;  2KQS A;  4CHK A;  5FK9 C;  2V3S A;  1YOV B;  3ZRF A;  2N7E A;  1AN8 A;  2MJ3 A;  1KLV A;  1TIF A;  4NJ7 A;  4AS1 A;  1PGB A;  4K3B A;  1UF0 A;  3B2G A;  4WAF A;  2GOW A;  3O13 A;  4NJC A;  2DLB A;  2JRH A;  3IAS 1;  4TV3 A;  2JT4 B;  3TCA A;  4A3O A;  1RRB A;  4NY0 A;  1JWB D;  3AN1 A;  2PW9 A;  1ZXI A;  2LVO A;  1I4G A;  1L7Y A;  3Q3O C;  3X23 A;  3EEC A;  1WE6 A;  4LJO B;  1MHH E;  1WJU A;  1IP9 A;  3P4P B;  3UI3 A;  2RGF A;  2DZJ A;  1PQS A;  2WNM A;  3APF A;  3PZD A;  2NS5 A;  2C5L C;  4XWW A;  4B6W A;  1KH0 A;  2KQ4 X;  2KWD A;  4S0R A;  4HVB A;  1XEE A;  2ZZP B;  3PRE A;  2YEP F;  5L83 A;  1I4H A;  2QC8 A;  2KHW B;  2K6D B;  2QJL A;  3QIJ A;  1AAR A;  5C3J B;  1FRD A;  2EKE C;  2TSS A;  1XLP A;  1T5X D;  1HZ6 A;  4LDT B;  3T9L A;  3S2A A;  2GBM A;  3PO0 A;  4GMV A;  4XGA B;  3R2T A;  2RR9 A;  2LVP A;  4C56 C;  3ZW3 A;  3ZVV A;  1M94 A;  4CYE A;  1TS5 A;  3ONS A;  4MGK E;  2H89 B;  1ZP0 B;  4EEW A;  4AJY B;  1WF9 A;  2N1V A;  2IBI B;  1LGR A;  1RAX A;  1GC6 A;  2WXP A;  1VZ6 A;  3AEF B;  3ZNI D;  3TSS A;  5AZG A;  4DXA B;  3CST A;  2LVQ A;  3LYY A;  3PRP B;  2K25 A;  1MPE A;  2VRR B;  2N7D A;  3WAP A;  1YQ4 B;  4ZOH C;  3ZGZ A;  4GIV A;  3RPF C;  3UQA A;  1RFK A;  2NVU I;  3QAR A;  2PVG C;  1TGZ B;  2J7Q B;  2WX1 A;  1AW7 A;  2IGG A;  2FBW B;  4HK2 A;  4M8M A;  2GBN A;  4A55 A;  1F52 A;  3VTW A;  4UDU C;  3Q3F A;  2JYT A;  4JE3 B;  4IM0 A;  4IKG A;  5HI1 A;  1WRD B;  3H1U A;  1VCB A;  1GB4 A;  2K0P A;  4GB9 A;  4ICU A;  1J8C A;  1T0Y A;  3AE6 B;  2QHO A;  4QAY A;  4YWG G;  1EF5 A;  5FR6 A;  1WX8 A;  2WXQ A;  3N32 A;  1F0Z A;  1LXD A;  1WR1 A;  3SU8 X;  1XCT L;  3PV1 A;  4JIO U;  1UGM A;  1YD8 U;  2IGD A;  3A4R A;  3N1X C;  2IO3 B;  4ICV A;  4ZHP A;  2DZK A;  2QMT A;  4W9H A;  2IY1 B;  2DYB A;  3ECI A;  2KLG A;  1QOG A;  1WYW B;  1SXT A;  4US8 A;  1IYF A;  4LJP B;  4RF1 A;  3MC9 A;  5C1Z A;  3TMP B;  4BBN F;  4Q2J A;  1MG4 A;  3A9K A;  3A9K B;  4GGQ A;  2L83 A;  1WI0 A;  1STE A;  3ABV B;  3OWE B;  1VJK A;  3R8B A;  4C4V B;  4C4V A;  2M0A A;  1Q10 A;  4F7Z A;  1WMH A;  1WMH B;  3P4R B;  4DWF A;  3U2S C;  4FHK A;  3RD2 A;  4HCN B;  4HDO A;  4MGI E;  1DYQ A;  1N5X A;  1SBB B;  4YSX B;  2C7N B;  3AEC B;  4W9E A;  2KJ6 A;  5CHV C;  4RM9 A;  2L0F A;  3V62 A;  4EUT A;  3KH0 A;  5BO4 B;  4HRS A;  3C0R B;  1FEH A;  3P42 A;  2XN9 C;  2BQQ A;  2B3A A;  1TTN A;  4KV2 A;  1UNS A;  3Q14 C;  1ZKH A;  4NNJ B;  1MI0 A;  2INC C;  3BYT B;  2MLB A;  2WDR B;  2NCN A;  4OHJ A;  2NPT A;  2NPT B;  4C7Z A;  5HHD G;  2GBR A;  3BK2 A;  3ZJU A;  2Z0D B;  4HXD A;  1TZO A;  5D6J B;  5IP4 D;  3TUO A;  5HG2 A;  3Q8B A;  1QQR A;  3PVL A;  2OOB B;  2ZW0 A;  3KW5 B;  1WJN A;  4AUQ C;  2Z59 B;  2J0J A;  4YTM B;  2ON8 A;  2L00 B;  1N61 A;  2V4I B;  2D5G A;  2LJ5 A;  3PGE A;  5D94 A;  4US9 A;  1OTR B;  2KTF A;  1EWC A;  2K1F A;  5G2N A;  3BYY B;  1SE2 A;  3VR9 B;  2ZCB A;  4ZDV A;  2M0X A;  2N9X A;  1CJE A;  4HLE A;  2OED A;  1EU4 A;  2WXN A;  2ZVN A;  1HE8 A;  2WXJ A;  5AZH A;  3O65 B;  2BKR B;  1WGR A;  5AUK A;  1P7F A;  3KYC D;  5L95 C;  4NQK E;  2PIA A;  2KDI A;  4R3D A;  3VTU A;  3NY5 A;  4ANV A;  1GJZ A;  2REX A;  2HTH A;  3SD5 A;  3VHT C;  1WIA A;  1IBX A;  1IBX B;  2GMI C;  2W54 A;  2N9L A;  3Q3N C;  3C19 A;  1CZP A;  2G4S A;  2PEA A;  3RNE C;  1H4R A;  3NVW A;  3P63 A;  1V8C A;  3RFZ B;  3VR8 B;  2BWF A;  1NYR A;  2RPV A;  1TS3 A;  3R2I A;  3DOW A;  4WQM A;  1V49 A;  3U30 A;  4E71 A;  4GDK B;  4GDK A;  2VZK D;  3KUC B;  2BYF A;  1Y56 A;  1BT0 A;  2JVC A;  2L05 A;  3AE8 B;  1SIJ A;  3UGB B;  4IM2 A;  3Q6B A;  2Z0E B;  2MBE A;  2FID A;  4KKI A;  4DHJ D;  3TEW A;  2HE7 A;  3WAN A;  1ACC A;  1QT9 A;  1V9J A;  2K5P A;  4G0N B;  2CU3 A;  3A1Q A;  3A1Q B;  2KK8 A;  3RT3 B;  2N9P C;  3DVN U;  3NG0 A;  1P9D U;  3ZNG C;  2ZVO A;  4HKQ A;  2RDH A;  4XE0 A;  3IHP C;  3SHQ A;  2PVO D;  2KFJ A;  4X57 B;  4BVU C;  4FAD A;  4KSK C;  3V6C B;  4BZA A;  3VVW B;  1KRH A;  1P3Q U;  3M95 A;  1V5O A;  1IGD A;  2MEK A;  4JPS A;  3DHH C;  4IOI E;  2PLP A;  5BMH A;  1GUA B;  2W82 A;  2M4N A;  2KOX A;  3L13 A;  1ET6 A;  3PZ8 A;  1VZ7 A;  2H88 B;  1S1Q B;  2W3S A;  1WGD A;  2CHW A;  4NAM A;  3MJW A;  3GP7 A;  5LNK 1;  3AU4 A;  4WAA A;  1VLB A;  2MBH A;  4KGT A;  3KWL A;  2BS4 B;  4ZRP A;  3GB1 A;  4OVU A;  2LZ6 A;  3R3M A;  1RLF A;  2D10 A;  3J9C A;  1YIW A;  4C7Y A;  3QC8 B;  3PRZ A;  1ZPS A;  1GAQ B;  2CJO A;  5IN7 A;  2MBO A;  5E6N A;  3IAM 1;  1D5Z C;  4URK A;  1HA5 A;  1WXA A;  4LNN A;  4YL8 A;  4BBN C;  4NAW A;  4NAW B;  3RNG C;  1R4M B;  4PK1 A;  1Q0W B;  1RM6 C;  4NJ6 A;  1OQQ A;  1F9J A;  1YN4 A;  4BFR A;  1KFY B;  2ICI A;  3QX1 A;  1FCL A;  4WUR A;  3BZD B;  4RGN A;  1QZE A;  3AXC A;  2ZCC A;  4A90 A;  1XLN A;  4FHJ A;  2AWT A;  2XEW A;  3FKY A;  3KYD D;  5TR5 A;  1V5T A;  1K51 A;  1K8R B;  2WU5 B;  4TUU A;  3K9O B;  3NUH B;  5E6P A;  3AE2 B;  1HTQ A;  3KQ4 A;  4W9D A;  3ZTD A;  1G6J A;  2WLB A;  5D3I B;  2R2Q A;  3N1Y C;  3U4E G;  2LHD A;  3N1Z C;  3R7R A;  3W5V B;  3DBH I;  1EUV B;  1VRA B;  2ZNV B;  1CMX B;  4F8C B;  4OZC A;  1QLB B;  2AL3 A;  3HK0 A;  1E8Z A;  1I42 A;  2E3T A;  5DPT A;  3RN9 C;  1FO4 A;  2J0M A;  4WJN A;  2MBB B;  3PT2 B;  2XBB C;  4M00 A;  1J7C A;  5T8I A;  1TKY A;  3N3K B;  2GB1 A;  3E56 A;  2MW5 A;  4B9K A;  1L0Y B;  3AU5 A;  4W9C A;  4DHZ B;  3V3X A;  3QWZ B;  2RDB C;  2ACZ B;  4DHJ B;  2IO0 B;  1UD7 A;  1FXT B;  3PLV A;  2KMA A;  4USA A;  5BMG A;  3RI7 C;  1WJ6 A;  4IC7 B;  3VTV A;  1NVI D;  4IM3 A;  2DZI A;  1ESF A;  2KC2 A;  3RZF A;  3APD A;  3HM6 X;  1XLQ A;  2LHE A;  2IJ0 A;  2PTL A;  4A6Q A;  1ISN A;  2AQ1 B;  4JQW C;  3WCQ A;  1J7A A;  3UIN B;  2N9E B;  1D5M C;  2V1Y A;  2MP2 A;  2DWQ A;  2MP2 B;  2WXL A;  2YLM A;  3UIO B;  1WXS A;  2MHJ A;  3A4S C;  1SE4 A;  4RGM A;  1PGA A;  1QIL A;  2JZ3 B;  1SJE D;  3IXS A;  3VXW A;  2GBK A;  4WQO B;  4HDQ A;  2INP E;  5FKA C;  2CS4 A;  1EO6 A;  4TKN A;  2M17 A;  3CMM B;  3VH4 B;  3CSF A;  4D2K A;  3DBH B;  3L54 A;  3GE8 C;  1MHX A;  4AWJ A;  1V97 A;  1V1O A;  2KDE B;  3TIX A;  3ENE A;  1B1Z A;  1SSN A;  1WX7 A;  3RYT A;  1C4C A;  5KHO A;  4N58 A;  4BKS A;  2WX0 A;  4HJG E;  1E10 A;  3IBE A;  2JXX A;  1K52 A;  4RGT A;  1FNV A;  4H2A A;  2V3P A;  3RCZ A;  3EUB 2;  4L2Y A;  1BXT A;  1YX6 B;  2AQ3 B;  4FJV B;  2Q5W D;  1SIF A;  1SJH D;  2RD0 A;  2XK5 A;  1SE9 A;  2XK5 B;  1GOZ A;  3AED B;  3W9C B;  1HXY D;  2WDV B;  4DQO C;  1FD6 A;  1QOA A;  1OGW A;  3Q3M C;  3V05 A;  1FIQ A;  1N63 A;  4A20 A;  1PGX A;  2DNF A;  4MH0 E;  4BKT A;  3URY A;  2OHF A;  3L17 A;  2CKH B;  4FA6 A;  4NQL B;  2MQJ A;  4FXC A;  1JRO A;  1D4B A;  4EFO A;  1TKE A;  1NYQ A;  4RMA A;  4RH6 A;  2KZR A;  4OVZ A;  3PTF C;  2CHZ A;  1F2R I;  2HD5 B;  3P2B A;  4YTP B;  1NEK B;  2AQ2 B;  2DYM A;  3DPD A;  3V61 A;  4LNF A;  1WX9 A;  3IT6 B;  4M01 A;  3WA0 A;  1WGG A;  1AWD A;  5D3D A;  2FUH B;  4II3 B;  4KZ0 A;  1LQB A;  5FR3 A;  2IGH A;  2C7M B;  2J53 A;  4IW0 A;  2EKI A;  2MSE D;  1E7V A;  1EM7 A;  3NZS A;  3P1M A;  4M8N A;  4WJO A;  1L2N A;  4DDG D;  3M3J A;  3ZLZ A;  2LAS A;  1TJE A;  2LXC A;  1TS2 A;  4B95 A;  2V0G A;  2OJW A;  3Q3J A;  4K7S A;  2PE9 A;  2ZJD A;  1KJT A;  2NTT A;  2QCZ A;  1Q1O A;  5IA7 A;  5HFY A;  1QOB A;  1ZDV A;  1EU3 A;  4ZRJ A;  1E5W A;  5DPR A;  3ZNZ B;  1UWX A;  4EZJ A;  2O2V A;  2O2V B;  3CWI A;  5CHW A;  2O6V D;  5EDS A;  4LCD E;  1C79 A;  1I4P A;  3L16 A;  2K6Q A;  4AOF A;  1FNU A;  3IFW B;  1ZGU B;  1L0X B;  1OFF A;  1T0S C;  1WZ3 A;  2WXM A;  5EE3 A;  2JWZ A;  4RGO S;  1WFY A;  2KFK B;  1T6B X;  2KFK A;  2DX5 B;  1V81 A;  2GI9 A;  2KNB A;  3BIN A;  1I4R A;  1P98 A;  1JWM D;  1S3S G;  4ANU A;  1YMH E;  3MFG A;  2BB5 A;  2I2Y A;  1EWY C;  2L8J A;  4MT5 A;  3I63 C;  3AE1 B;  1N60 A;  4N59 A;  1V80 A;  4YSY B;  4LNK A;  1FNW A;  3RNF C;  1J19 A;  3VFK A;  1UH6 A;  2BW2 A;  2EMT A;  1XQQ A;  2KVZ A;  1WM2 A;  5I4D A;  4WH4 A;  1I35 A;  2BYE A;  1NEN B;  4GSW A;  3DBR B;  4GLS C;  1PYW D;  1XO3 A;  2JUO A;  4K81 A;  1U4A A;  3AE9 B;  3EFU A;  1QF6 A;  1HEZ E;  1UWM A;  2G1E A;  4O1N A;  3LB8 C;  3L08 A;  3B1L X;  5GMV A;  2NBV B;  4MM3 A;  4MM3 B;  3NOB A;  1L6U A;  2WDQ B;  1TZ1 A;  3U7Z A;  1YX5 B;  3I5J C;  4PS7 A;  1C4P A;  1FFU A;  4FJY A;  3WIM A;  2JZP A;  4RNA A;  3AMZ A;  1OEY A;  4EZL A;  4FLH A;  1XXG A;  2WQY B;  3VAW A;  1SF0 A;  1R4N B;  4J6I A;  3NVV A;  3U7D A;  2B76 B;  1GPX A;  2M56 B;  2HDE A;  1HQR D;  1RWS A;  4HEA 1;  2G3Q B;  2KT7 A;  4IDI A;  3DVG Y;  4A9A A;  1I4X A;  3DBL I;  4W9F A;  4WWP A;  1X1M A;  4PYU A;  3FIL A;  3FIL B;  3BVZ A;  3APC A;  3PPA A;  1WYG A;  3DQV A;  1P1A A;  4WWO A;  5C23 A;  2AEH A;  3AH7 A;  3BK1 A;  2W55 A;  3B9J A;  2BPS A;  1K50 A;  1Q5W B;  2WXR A;  1WRI A;  2L0T A;  3C8Y A;  3L4P A;  2K9X A;  4P1C C;  4L1B A;  2IY0 B;  2IO1 B;  3M63 B;  2DEN B;  4M0W A;  4M0W B;  1E90 A;  5LLI A;  5LXI B;  1SE3 A;  4XWT A;  4PS8 A;  1KM7 A;  3GS2 A;  3B2F A;  2CU1 A;  4P7I A;  3SDL C;  5D7G A;  4MSM B;  1C9F A;  2KQ7 A;  3DVN V;  2W3R A;  2QSD A;  3LJ3 A;  1FMA D;  1TKG A;  4OZB A;  4MGY E;  3ZXV A;  1V2Y A;  1NDD A;  1MJD A;  4ASW C;  1N62 A;  1R4M I;  4CO7 A;  2V9H A;  1WE7 A;  4W9K A;  4W9G A;  1WZ0 A;  2IZV B;  2MX2 A;  2KAC A;  3CIR B;  2BVC A;  5D2M B;  3ML8 A;  3QAQ A;  4OVV A;  3HIZ A;  3VDZ A;  2N9K A;  4XYC A;  2LMC A;  1N6Z A;  4KKJ A;  2YVC A;  3AE4 B;  2WXO A;  4XZ4 A;  4GXB A;  2D2Q A;  2UYZ B;  3RUL A;  4MEM A;  2WS3 B;  2VH2 A;  2K8B A;  2WXK A;  1JWA D;  1E8X A;  1HTO A;  1YJ1 A;  2KMM A;  2I38 A;  1M4V A;  3PZ7 A;  2KAJ A;  3RZW C;  3OJ4 B;  2NBU A;  3AE3 B;  4LLG M;  3DBL B;  1C4A A;  1JRU A;  2BTE A;  1OQR A;  3ZIM A;  4II2 B;  4KDI C;  3W1Y A;  4N9F 4;  1QOF A;  3JW0 X;  1Z2M A;  3DWG C;  4LDT D;  3EC8 A;  1IPG A;  4AP4 C;  1ZUD 2;  3WAO A;  1T0Q C;  3UQB A;  4WJQ A;  2KKC A;  2K39 A;  3CF6 E;  5KHQ A;  5CHF A;  4XDC A;  3JVZ X;  4W9I A;  1XD3 B;  2FUG 1;  4K3C A;  3ZNH B;  2BS2 B;  3RNA C;  2HTM E;  3W1S C;  2PJH A;  4MDK E;  1WWT A;  5GXG B;  1K53 A;  3AUL A;  2RDG A;  3K9P B;  2FCN A;  1T0R C;  3VUX A;  1T3Q A;  3ZUN A;  3QQ8 B;  3GE3 C;  2JZZ A;  1SB3 C;  2Z8L A;  4KX6 B;  2EEL A;  3V60 A;  2INN E;  2LI5 A;  4NZL B;  4XDD A;  3X0W A;  2G9H D;  5IOI A;  4MAC A;  2MBQ A;  1ZW7 A;  3EGR A;  3RUI B;  1RFA A;  4OZA A;  2SAK A;  4JWU C;  4E3C A;  1GG3 A;  1WGH A;  2UU7 A;  1E9M A;  2L1A A;  5BYR A;  2AYO B;  2M19 A;  5J18 A;  3Q8F A;  3ZQ4 A;  1C77 A;  1ET9 A;  4IG7 B;  2LXA A;  4I6N B;  2IND C;  2ONQ A;  4AQ7 A;  2K8H A;  5JXV A;  3U52 E;  5JH5 C;  3QCA A;  4I6L B;  4JLC A;  3KUD B;  1E8W A;  2KX3 A;  3BII D;  4TQ1 A;  4E74 A;  3QA8 A;  5JHB A;  2MRP A;  2FIF A;  2D07 B;  1SGH A;  2NBW B;  1L4D B;  2BBC A;  3H7P A;  3H7P B;  3R66 C;  2WWZ A;  3HUI A;  3P4Q B;  4ZRK A;  4K7W A;  1J7B A;  2VZK B;  3W2D A;  1LM8 B;  2FCM A;  4EE2 A;  4ANW A;  1J0G A;  1F1H A;  3OAW A;  3VQI A;  3NVY A;  1JAL A;  3TL5 A;  2BKF A;  4P6V F;  1JWU D;  3I57 A;  2V3N A;  1JCK B;  1WGK A;  3IVF A;  2D3C A;  5G55 A;  3ML9 A;  2KWC A;  3DDC B;  2WGS A;  3N20 C;  3Q8E A;  2L3Z A;  4KGS A;  1C78 A;  4EZK A;  1YJI A;  2BYV E;  3HM3 A;  3MC8 A;  3FC4 A;  3V6E B;  2CR5 A;  5AEK B;  3H8H A;  1D6E C;  2JYE A;  3AEG B;  4ZYN A;  3GZN I;  4B0M A;  4LK0 M;  1UGJ A;  1GB1 A;  3T8M A;  4XC2 A;  3ZYY X;  4P1B C;  2KDF B;  2I1J A;  1JRP A;  4JWS C;  2N4F A;  1WXV A;  2PMV A;  2BB6 A;  1XF5 L;  4CQN A;  2Y5B B;  4OW0 A;  4YT0 B;  1OQY A;  2AL6 A;  2KWU B;  2I1K A;  1F77 A;  4AJW A;  2A5U A;  2MJE A;  4TQ0 A;  2WXH A;  5IAA C;  2JWU A;  2LGI A;  4TSS A;  1GC7 A;  2MH7 A;  4S17 A;  3SFE B;  2BS3 B;  1V1P A;  1V1P B;  1WSP A;  2DZM A;  5CTR C;  4PT5 A;  1CK1 A;  1E8Y A;  3L10 B;  4RF0 A;  3IG3 A;  1N5W A;  3MP9 A;  5EE9 A;  3JYU A;  2D11 A;  2W9N A;  3DHG C;  1L0V B;  3MHS D;  2C9W B;  2KD0 A;  2KDB A;  4HCP B;  5G5G A;  3BY4 B;  3DCG A;  2DAJ A;  2R61 A;  3PS6 A;  1VZ8 A;  4MSQ B;  2V4L A;  3AEB B;  1ZE3 D;  3BVG A;  3EFC A;  1YQ3 B;  3B0A A;  2Y5C A;  4EOY A;  3ZKJ C;  2RMM A;  1YJJ A;  1EF1 A;  5J2R A;  5BYS A;  4RCO A;  2KO3 A;  4ZYS A;  2EMS A;  4F1S A;  2X8X X;  3H7S A;  3AEA B;  2LUM A;  4W9J A;  2D3G A;  4YSZ B;  4HWI B;  4REZ A;  5MPO A;  3QJZ A;  4M02 A;  4MEL A;  5G5H A;  3GZN B;  4C00 A;  1ZXH A;  3T3O A;  4HPP A;  1YNT E;  4G3X B;  4RFB A;  2Y5P A;  1L5P A;  2C60 A;  1TS4 A;  3L0W B;  2IDY A;  1YN5 A;  3E9S A;  1LFD A;  1WXQ A;  3UF8 A;  1KLU D;  3Q69 A;  3HVZ A;  4FJZ A;  2GRI A;  3VRA B;  2N0S B;  1ROE A;  1AYF A;  5HKH A;  5IO9 A;  2KWV B;  4W9L A;  3NS1 A;  2G4D B;  1E7P B;  4FUL A;  4DXG A;  3DBR I;  5AZF A;  3PRM B;  2WXF A;  4LTU A;  4MH8 A;  4ARI A;  2HJ8 A;  1B9R A;  1F2R C;  1UZX B;  3NVZ A;  2PE6 B;  3TEX A;  2LRW A;  4KZC A;  3I3T B;  3BVM A;  2N7J A;  4HKZ E;  4IWO A;  4DBG A;  4B0E A;  3FAH A;  1XLO A;  4ITK A;  4WWN A;  2KJH B;  2ZPY A;  4JL9 A;  2WHI A;  4IWQ A;  2GLS A;  3WAL A;  2FCS A;  1FFV A;  3Q2A C;  2ZPN A;  1WH3 A;  4L23 A;  5BYQ A;  2KLC A;  3MJ5 A;  4ARC A;  1R4N I;  3KLS X;  2BF8 B;  4HPL B;  1ENF A;  3B08 A;  3OJ3 A;  5DPS A;  5EE0 A;  2BT6 A;  2QEJ C;  1VDV A;  3NHE B;  1Y8R C;  1KTK A;  4BOZ B;  2MCN B;  3OLM D;  4JX1 C;  1QKZ A;  2MA9 B;  4HRO A;  2MJD A;  3ZO5 B;  3AEE B;  2WP9 B;  1PUT A;  1D5X C;  4GOC A;  1NI3 A;  5DPW A;  4YXD B;  3TEY A;  4FN2 A;  2LRU A;  1C3T A;  1MG8 A;  3IT4 B;  4J3O D;  3GOE A;  1DOI A;  2Y3A A;  4PYZ A;  2D3A A;  1UBI A; 
#chains in the Genus database with same CATH homology
 3EHV A;  3KUZ A;  1RAX A;  1GC6 A;  4W9D A;  4EKU A;  2KX0 A;  3ZNI D;  2KJR A;  3ZTD A;  5AZG A;  1G6J A;  4DXA B;  2ASQ A;  3CST A;  2R2Q A;  5D2M B;  3ML8 A;  3QAQ A;  2LVQ A;  4OVV A;  3HIZ A;  2CHX A;  3PRP B;  3VDZ A;  2K25 A;  3R7R A;  2VRR B;  2N7D A;  3WAP A;  2YVC A;  3DBH I;  1VD2 A;  1EUV B;  4DHZ E;  4GIV A;  3UQA A;  4XZ4 A;  2NVU I;  4GXB A;  2ZNV B;  1CMX B;  3QAR A;  4F8C B;  2D2Q A;  2UYZ B;  2KN5 A;  1TGZ B;  3M62 B;  2J7Q B;  3RUL A;  2WX1 A;  2AL3 A;  3HK0 A;  1E8Z A;  4MEM A;  1I42 A;  4HK2 A;  4M8M A;  2GBN A;  2K8B A;  3VTW A;  3Q3F A;  3KVF B;  5DPT A;  1E8X A;  4IM0 A;  2J0M A;  4WJN A;  1WRD B;  1YJ1 A;  2MBB B;  3H1U A;  4BOS C;  1VCB A;  4GB9 A;  3PT2 B;  2XBB C;  5JZE B;  4GN1 A;  4ICU A;  1J8C A;  3N3K B;  3OJ4 B;  1NBF C;  1T0Y A;  2NBU A;  3RZW C;  2MW5 A;  4B9K A;  3AU5 A;  1WR6 E;  4W9C A;  2QHO A;  4DHZ B;  1JRU A;  1EF5 A;  1P0R A;  4G11 A;  5FR6 A;  1WX8 A;  4FBJ B;  3TJP A;  3QWZ B;  3N32 A;  3ZIM A;  4II2 B;  1LXD A;  5E6O A;  2NR2 A;  4DHJ B;  2IO0 B;  4KDI C;  1UD7 A;  3W1Y A;  1FXT B;  1TBE A;  4N9F 4;  2DAF A;  1WR1 A;  3SU8 X;  3JW0 X;  3PLV A;  3U8Z A;  2KMA A;  1Z2M A;  4LDT D;  3EC8 A;  3PV1 A;  1UGM A;  1YD8 U;  4JIO U;  1IPG A;  4AP4 C;  3A4R A;  1WJ6 A;  1XT9 B;  2LD9 A;  1UBQ A;  2IO3 B;  4IC7 B;  3VTV A;  4ICV A;  3WAO A;  4DK5 A;  3UQB A;  4IM3 A;  2DZI A;  3UIP B;  2KVR A;  2DZK A;  2KC2 A;  2WDT B;  2IY1 B;  4W9H A;  3APD A;  3HM6 X;  4WJQ A;  3RZF A;  2KKC A;  1UEL A;  2DYB A;  3ECI A;  2KLG A;  2K39 A;  3CF6 E;  1WYW B;  1ISN A;  5KHQ A;  1IYF A;  5CHF A;  4LJP B;  4JQW C;  1WJ4 A;  3JVZ X;  3HHM A;  2KXJ A;  4W9I A;  2DHZ A;  5C1Z A;  4KSL C;  1XD3 B;  3UIN B;  3TMP B;  2N9E B;  4BBN F;  3DVG X;  3ZNH B;  2V1Y A;  2MP2 A;  2MP2 B;  2YLM A;  3UIO B;  1WXS A;  3A4S C;  3A9K A;  3A9K B;  3W1S C;  2PJH A;  4MDK E;  4GGQ A;  1C1Y B;  1WI0 A;  3AUL A;  2M8S A;  3K9P B;  3N30 A;  2JZ3 B;  2FCN A;  4WJP A;  4F7Z A;  1WMH A;  1WMH B;  3VUX A;  3VXW A;  2LGX A;  3ZUN A;  3QQ8 B;  4DWF A;  4FHK A;  1WY8 A;  2MWS B;  2JZZ A;  2GBK A;  3RD2 A;  4WQO B;  4HDQ A;  4HCN B;  4HDO A;  3VH3 B;  3V60 A;  2CS4 A;  1EO6 A;  4TKN A;  4MGI E;  2M17 A;  3CMM B;  2LI5 A;  2L76 A;  4G50 A;  3VH4 B;  3X0W A;  2FNJ B;  2C7N B;  3CSF A;  2BWE S;  2MBQ A;  3L54 A;  4W9E A;  1ZW7 A;  2KJ6 A;  3RUI B;  5CHV C;  1RFA A;  4AWJ A;  3TIX A;  2KDE B;  5LXH A;  3ENE A;  2KMC A;  4RM9 A;  5J17 A;  2L0F A;  1GG3 A;  3V62 A;  4E3C A;  1WGH A;  4EUT A;  3KH0 A;  2A4Z A;  2JY6 A;  1WX7 A;  5BO4 B;  2JPH A;  3D32 A;  3PLU A;  4IUM B;  3RYT A;  3C0R B;  5KHO A;  2AYO B;  5J18 A;  3NZU A;  4JGH B;  2GBJ A;  4BKS A;  2WX0 A;  3ZDM C;  3IBE A;  2JXX A;  2B3A A;  4IG7 B;  1TTN A;  2LXA A;  4I6N B;  4KV2 A;  3R7Q A;  3RCZ A;  2JF5 A;  2C7H A;  1ZKH A;  1YX6 B;  2K8H A;  4FJV B;  4NNJ B;  5JH5 C;  2MLB A;  1SIF A;  3QCA A;  4I6L B;  2M1M A;  3KUD B;  4JLC A;  2NCN A;  2RD0 A;  1E8W A;  1SE9 A;  2KX3 A;  2XK5 A;  2XK5 B;  3ZTC A;  1WXM A;  2NPT A;  2NPT B;  1OGW A;  4TQ1 A;  4E74 A;  2GBR A;  4A20 A;  3QA8 A;  5JHB A;  1V86 A;  2IYD B;  2MRP A;  2FIF A;  3LDZ E;  4MH0 E;  4BKT A;  3MTN B;  2Z0D B;  2D07 B;  4I6P A;  2KC1 A;  4HXD A;  1SGH A;  4ZRI A;  2JRI B;  2NBW B;  3H7P A;  2CKH B;  3H7P B;  3L17 A;  2MQJ A;  3R66 C;  4NQL B;  3PSE B;  5D6J B;  4BKG A;  4FA6 A;  2WWZ A;  2O6V A;  2O6V B;  4EFO A;  4ZRK A;  3AI5 A;  4RMA A;  5JHA A;  2KZR A;  3PHX B;  3PVL A;  4K7W A;  2OOB B;  3PTF C;  3KW5 B;  2CHZ A;  1WJN A;  4AUQ C;  2Z59 B;  1LM8 B;  2FCM A;  2HD5 B;  2J0J A;  3P2B A;  4ANW A;  1J0G A;  2DYM A;  2KAN A;  3DPD A;  3VUW A;  3V61 A;  2L00 B;  3OAW A;  3VQI A;  1WX9 A;  2L7R A;  2ZEQ A;  2LJ5 A;  3WA0 A;  1WGG A;  3PGE A;  5D94 A;  3TL5 A;  1Z5S B;  2BKF A;  1OTR B;  2KTF A;  2K1F A;  5G2N A;  3IVF A;  1OEY J;  4KIK A;  4KIK B;  2FUH B;  4II3 B;  5DCN A;  4KZ0 A;  5G55 A;  2ZCB A;  3ZDT A;  1LQB A;  1A5R A;  3ML9 A;  3QK0 A;  4ZDV A;  2C7M B;  2KWC A;  3NS8 A;  3DDC B;  2LUE A;  2M0X A;  2N9X A;  4IW0 A;  4HLE A;  2L3Z A;  2ZVN A;  2RPQ A;  2J0K A;  5CX3 A;  4EZK A;  2IO2 B;  1HE8 A;  2BYV E;  3HM3 A;  1GNU A;  5AZH A;  4IWP A;  3V6E B;  2CR5 A;  2MSE D;  3O65 B;  4K7U A;  5AEK B;  2BKR B;  1E7V A;  1WM3 A;  1WGR A;  4KVG B;  3KYC D;  3NZS A;  4M8N A;  4WJO A;  5L95 C;  4NQK E;  4DDG D;  1L2N A;  4ZYN A;  3M3J A;  3GZN I;  4BKS D;  3ZLZ A;  2LAS A;  2KDI A;  3VTU A;  2LXC A;  1H8C A;  3NY5 A;  4MGZ E;  4B95 A;  3T8M A;  4ANV A;  1GJZ A;  4XC2 A;  1D3Z A;  2UWQ A;  2REX A;  1YQB A;  2HTH A;  3SD5 A;  3VHT C;  1WIA A;  2KDF B;  3ALB A;  1KOT A;  2I1J A;  3Q3J A;  4K7S A;  2GMI C;  2PE9 A;  2ZJD A;  2N4F A;  1WXV A;  1KJT A;  2Y5B B;  1Q1O A;  4GU2 A;  3TBL D;  5IA7 A;  2G4S A;  2PEA A;  1OQY A;  4DDI D;  2AL6 A;  1H4R A;  3A33 B;  2ZNV C;  4ZRJ A;  4KDL B;  1E5W A;  1V6E A;  2I1K A;  2KWU B;  5DPR A;  4AJW A;  2A5U A;  3ZNZ B;  4EZJ A;  2PPH A;  4TQ0 A;  2BWF A;  2O2V A;  2O2V B;  5IAA C;  2KTR A;  2KTR B;  3WAM A;  1GC7 A;  5CHW A;  2O6V D;  3DOW A;  5EDS A;  2N1W A;  3ZRC A;  1V49 A;  3U30 A;  3H6N A;  4K1R B;  4LCD E;  2LWP A;  4E71 A;  2DZM A;  5CTR C;  4GDK B;  4GDK A;  3QHT A;  3KUC B;  2BYF A;  3L16 A;  1BT0 A;  1E8Y A;  2FAZ A;  2JVC A;  2K6Q A;  2L05 A;  1WGY A;  2FCQ A;  3UGB B;  4IM2 A;  4AOF A;  2Z0E B;  3IFW B;  2MBE A;  1ZGU B;  2FID A;  1WZ3 A;  3L10 B;  3IG3 A;  4DHJ D;  2JWZ A;  4MJS B;  1WFY A;  3JYU A;  2LGY A;  2D11 A;  2W9N A;  4MJS A;  2HE7 A;  3WAN A;  2KFK B;  2KFK A;  2DX5 B;  4A3P A;  3VUY A;  3MHS D;  1V81 A;  2C9W B;  3A9J B;  3A9J A;  2KD0 A;  2KNB A;  3BIN A;  3JSV A;  3JSV B;  4RM8 A;  2KDB A;  4HCP B;  3BY4 B;  1P98 A;  1S3S G;  3DCG A;  2DAJ A;  4ANU A;  3PS6 A;  4HPM B;  4NPN A;  1V9J A;  4ANX A;  3H9D A;  4GDL A;  4GDL B;  4MSQ B;  4G0N B;  2LGD A;  2L8J A;  2DYO A;  2V4L A;  3A1Q A;  3A1Q B;  2KK8 A;  3B0A A;  3RT3 B;  4XX5 A;  2N9P C;  4EOY A;  3DVN U;  3ZKJ C;  2BGF A;  2OJR A;  1EF1 A;  1P9D U;  3ZNG C;  2ZVO A;  5J2R A;  1E7U A;  2KO3 A;  1NI2 A;  2EMS A;  4F1S A;  2R2O A;  3H7S A;  3IHP C;  1V80 A;  2G45 B;  3SHQ A;  2KFJ A;  4PS3 A;  4W9J A;  4X57 B;  1J19 A;  3W1S A;  2D3G A;  4BVU C;  3VFK A;  1UH6 A;  2K8C A;  4FAD A;  2EMT A;  1XQQ A;  2RSU A;  4HWI B;  1WM2 A;  3QJZ A;  4KSK C;  1I35 A;  3V6C B;  4MEL A;  4HJK A;  2BYE A;  2WYQ A;  3PHW B;  3VVW B;  3DBS A;  2KQS A;  4CHK A;  4GSW A;  1P3Q U;  3M95 A;  1V5O A;  2V3S A;  1GUA B;  2M4N A;  4G3X B;  3ZRF A;  2KOX A;  2N7E A;  2JUO A;  4K81 A;  3L13 A;  1U4A A;  2C60 A;  3EFU A;  3L0W B;  1KLV A;  4NJ7 A;  1LFD A;  3UF8 A;  4FJZ A;  3L08 A;  3B1L X;  5GMV A;  1S1Q B;  2GOW A;  2NBV B;  4MM3 A;  3NOB A;  1WGD A;  2CHW A;  1TZ1 A;  1YX5 B;  3MJW A;  2JRH A;  4PS7 A;  5HKH A;  3AU4 A;  4WAA A;  4FJY A;  3WIM A;  2KWV B;  4TV3 A;  2JT4 B;  4W9L A;  3TCA A;  4A3O A;  2G4D B;  1RRB A;  2MBH A;  1OEY A;  4FUL A;  4NY0 A;  4EZL A;  4FLH A;  3DBR I;  5AZF A;  3PRM B;  3VAW A;  2HJ8 A;  2LVO A;  1L7Y A;  4J6I A;  3X23 A;  3EEC A;  3U7D A;  1UZX B;  1WE6 A;  4LJO B;  2PE6 B;  4OVU A;  2LZ6 A;  2LRW A;  4KZC A;  3R3M A;  1WJU A;  1RLF A;  2D10 A;  3I3T B;  1IP9 A;  2RGF A;  2G3Q B;  1YIW A;  2DZJ A;  4DBG A;  1PQS A;  4IWO A;  3DVG Y;  3APF A;  3QC8 B;  3DBL I;  3PZD A;  2NS5 A;  2C5L C;  3PRZ A;  4W9F A;  4WWP A;  4B6W A;  4WWN A;  1X1M A;  4PYU A;  2KJH B;  2ZPY A;  4JL9 A;  4IWQ A;  3APC A;  3PPA A;  3DQV A;  3WAL A;  1P1A A;  4WWO A;  5C23 A;  2FCS A;  2AEH A;  2MBO A;  2ZPN A;  5E6N A;  1WH3 A;  4HVB A;  2BPS A;  1Q5W B;  2ZZP B;  4URK A;  1WXA A;  2KLC A;  2L0T A;  3PRE A;  1R4N I;  4YL8 A;  4BBN C;  4NAW A;  4NAW B;  5L83 A;  2IY0 B;  2IO1 B;  2KHW B;  2BF8 B;  2K6D B;  3M63 B;  4HPL B;  2DEN B;  4M0W B;  1E90 A;  3QIJ A;  1Q0W B;  4NJ6 A;  1F9J A;  3B08 A;  5LLI A;  4BFR A;  5LXI B;  3OJ3 A;  5DPS A;  1AAR A;  3QX1 A;  3NHE B;  2EKE C;  1Y8R C;  4PS8 A;  1KM7 A;  4BOZ B;  4LDT B;  3T9L A;  2MCN B;  3OLM D;  3S2A A;  2GBM A;  2CU1 A;  4P7I A;  3SDL C;  5D7G A;  1QZE A;  4GMV A;  2KQ7 A;  3AXC A;  3DVN V;  4MSM B;  2MA9 B;  2ZCC A;  3ZO5 B;  2RR9 A;  4FHJ A;  3LJ3 A;  2LVP A;  4MGY E;  5DPW A;  4GOC A;  3ZW3 A;  1V2Y A;  3ZVV A;  2AWT A;  1NDD A;  1M94 A;  2LRU A;  2XEW A;  3KYD D;  4FN2 A;  1V5T A;  5TR5 A;  4CYE A;  4ASW C;  1C3T A;  1MG8 A;  1R4M I;  3ONS A;  4MGK E;  4CO7 A;  1WE7 A;  3GOE A;  4W9K A;  4W9G A;  1WZ0 A;  1K8R B;  4PYZ A;  4EEW A;  4AJY B;  1WF9 A;  2N1V A;  2IBI B;  2IZV B;  2MX2 A;  1UBI A;  4TUU A;  3K9O B;  5E6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...