5GMVA

Lc3b-fundc1 complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
KTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural insights into the recognition of phosphorylated FUNDC1 by LC3B in mitophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 41
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5gmvA00
3IHPC 5CHVC 2KN5A 3UQAA 3IFWB 1OEYA 1YX6B 2WDTB 3H9DA 3TMPB 3DVNU 2C7HA 2KX3A 2L05A 4GXBA 4A3PA 5HKHA 2C60A 2O2VA 1C3TA 2PEAA 4M0WB 1V6EA 4DHJB 5IA7A 1AARA 3ENEA 4TQ0A 1UZXB 1Z5SB 3B1LX 2M1MA 3ZNHB 3ALBA 3AULA 3SDLC 2O2VB 2MBBB 1RLFA 2DENB 1WX8A 1WZ3A 2KJHB 3IG3A 4G3XB 4OVVA 3OJ3A 3H6NA 2NVUI 1WM3A 4AWJA 1TGZB 4IG7B 1QZEA 1XQQA 1WE6A 3SHQA 4PYZA 2NPTA 3DBRI 3Q3FA 5E6PA 2GOWA 4HCNB 1UBIA 4E71A 4AJYB 3RT3B 1A5RA 4FADA 2FUHB 4EZLA 2N7DA 1WI0A 2NPTB 1GC7A 3QWZB 2M4NA 4TUUA 4II2B 5CHWA 3HM6X 4HVBA 3A1QA 2R2QA 2JY6A 4BOZB 4F7ZA 2KQSA 2HJ8A 2ZEQA 4MELA 4WWPA 3T9LA 4BKTA 1GJZA 3QJZA 2D3GA 4MSMB 2RD0A 3DVGY 2CS4A 2N7EA 2LJ5A 4DHZB 3C0RB 1WXMA 3LDZE 5BO4B 4BKSD 3A1QB 5C1ZA 2ZCCA 3RD2A 3GOEA 4NPNA 1IP9A 4HPLB 3ML8A 3QCAA 3HK0A 4A3OA 2JF5A 4BBNC 2IY1B 2DYMA 1WRDB 2V1YA 2KWVB 3ZNID 4DHZE 2UYZB 3KH0A 1E8WA 3ZKJC 3L13A 2KJ6A 1WF9A 1SGHA 2O6VA 2NBUA 5GMVA 3PHXB 1L7YA 1GNUA 2ZNVC 4I6LB 5J17A 2IY0B 1WYWB 1YQBA 1WXAA 2BWES 2L8JA 4IM0A 2JT4B 1I35A 4ICUA 1J8CA 2O6VB 1RRBA 2G45B 4HCPB 2MBOA 2RGFA 2LVOA 1CMXB 2G3QB 4GSWA 2WWZA 2N9XA 3PS6A 3UIOB 4FULA 1J0GA 3JSVA 3QIJA 4DK5A 4CYEA 3W1SC 1Q0WB 1WR1A 2LD9A 2MBQA 4XX5A 3VTVA 2N9PC 3PZDA 4GU2A 2XK5A 2J0KA 4ZRIA 4B6WA 4DHJD 1UD7A 2KDFB 3L0WB 4FJVB 2GBJA 3PHWB 4GIVA 2LRUA 2KZRA 3JSVB 2KLGA 4K7UA 3PVLA 4JQWC 3NHEB 3PTFC 4PYUA 2XK5B 5CX3A 3U7DA 1IYFA 3S2AA 1SIFA 3TL5A 1V2YA 2K1FA 3DVNV 5AZGA 5CHFA 2KFJA 2NR2A 4W9GA 3WIMA 4NJ7A 2MCNB 3R7RA 1LQBA 2DZIA 2FIDA 3CMMB 4RM8A 4WJNA 1YX5B 1P0RA 2ZZPB 4AP4C 2WX1A 3HHMA 1PQSA 3AXCA 3KUDB 4NQKE 2ZVNA 3PRPB 2K6QA 5TR5A 4ZDVA 3DDCB 1ZKHA 1WJUA 1WJ4A 1F9JA 2Z0EB 3VTWA 1P98A 2MBHA 1UH6A 3DPDA 3PPAA 4ZRKA 3T8MA 2YLMA 4G50A 2LGXA 5L83A 4EOYA 2ZPNA 4PS3A 4G0NB 2RSUA 4P7IA 1WGRA 2AL3A 2UWQA 3W1SA 4TKNA 2KJRA 1WX9A 3NZSA 2K8BA 3ZIMA 4ANXA 4WAAA 3QA8A 2J0MA 2CKHB 1V49A 1GC6A 4K1RB 3VH3B 3WALA 4FHKA 2FCQA 3KUZA 2MA9B 4E3CA 1C1YB 3ZVVA 4W9CA 3RULA 1NI2A 3A9JA 2GBNA 5L95C 4GGQA 4N9F4 3DBHI 4HJKA 3D32A 1WXVA 2KANA 1E7VA 4HLEA 4W9JA 4W9LA 1WGDA 4WQOB 2LVQA 1LXDA 2W9NA 3L08A 1Y8RC 2BKRB 1WH3A 2PJHA 3A9JB 1WZ0A 2MW5A 1TZ1A 2KTRA 3AU5A 3UQBA 1VD2A 3PLVA 1P1AA 4A20A 1S3SG 3L54A 3W1YA 2O6VD 3PREA 4FN2A 2I1KA 3R7QA 1P9DU 4YL8A 4MGIE 3U8ZA 1V5TA 2KTRB 2LGYA 4MEMA 4URKA 2EMTA 2KMAA 3KYDD 2KDEB 4GDKA 2MX2A 2G4SA 3QK0A 5JHAA 4KV2A 5G55A 4BOSC 2LGDA 3APDA 4KDLB 2XEWA 2Y5BB 2JVCA 3EECA 4G11A 4GDKB 3SU8X 1L2NA 3RCZA 3ZTCA 3JYUA 4EUTA 2L7RA 1OQYA 2KFKA 2Z59B 4MGKE 2DHZA 2K6DB 2FCNA 3EC8A 3OJ4B 3R66C 4GB9A 2MWSB 3VVWB 4ASWC 4WJPA 2Z0DB 3PSEB 4HDQA 2HD5B 2PE9A 2WYQA 2KNBA 2LZ6A 4F1SA 4HPMB 2L0FA 2KFKB 3QHTA 1V5OA 1E7UA 4NJ6A 4FA6A 2KC1A 4TV3A 1U4AA 4LJPB 1GG3A 3NS8A 1SE9A 5FR6A 5EDSA 5LXIB 3VDZA 3CF6E 5D6JB 2NBVB 4GDLA 3ZLZA 3QX1A 4EKUA 2YVCA 1KM7A 1BT0A 4KIKA 4MDKE 4K7SA 2PE6B 4AJWA 1S1QB 3HIZA 4J6IA 3H7PA 2KOXA 2IYDB 3U30A 3A33B 3UIPB 3I3TB 3V6EB 4ZRJA 2C9WB 3M95A 2LXAA 4FJYA 4GDLB 4OVUA 4F8CB 2BYFA 3DOWA 3VQIA 2FCSA 2DZJA 4KIKB 4KDIC 4EZJA 4I6PA 2KK8A 3ZNGC 2MLBA 2V3SA 3V61A 4IM2A 1HE8A 4EFOA 4LCDE 1X1MA 5J18A 3PT2B 4PS8A 1WR6E 2D2QA 3BINA 3KVFB 3BY4B 3JVZX 2KX0A 3QAQA 2KHWB 3V62A 2K8CA 5IAAC 1P3QU 2D07B 1V9JA 5AZFA 3Q3JA 5LXHA 4HDOA 3O65B 2A5UA 3TCAA 1ZW7A 5DPRA 2KDIA 4IC7B 1K8RB 4CO7A 4MSQB 4I6NB 3KUCB 3DVGX 4WWOA 1T0YA 5D7GA 5E6OA 2AEHA 5KHOA 2JXXA 2BYVE 5D94A 5JZEB 3DBLI 4HK2A 3PRMB 2BPSA 3VUYA 2MQJA 4WJQA 1JRUA 4NQLB 4DWFA 3ZO5B 1IPGA 4IWQA 5LLIA 1E90A 2L0TA 4XC2A 2AWTA 2IO2B 4KVGB 4GN1A 4E74A 3UINB 2CU1A 3EFUA 3ONSA 1WFYA 3X23A 3RZWC 3A4RA 2C7NB 3TBLD 3PV1A 2NBWB 2ZVOA 1WJ6A 3ZTDA 1YIWA 4HXDA 2ZNVB 4NY0A 4ANVA 2EKEC 3ZRFA 1V80A 1V86A 3WAOA 4W9IA 4DBGA 5AEKB 3VH4B 1KLVA 2GBMA 1LM8B 3MHSD 2KQ7A 2IZVB 4LJOB 2LWPA 4MH0E 2HE7A 4BBNF 2CHZA 2XBBC 4JLCA 4MGZE 1WM2A 3V60A 3L16A 1RAXA 2A4ZA 4ANUA 3QC8B 4JL9A 1GUAB 4RM9A 3B0AA 1R4NI 2VRRB 2MRPA 4KSLC 2FCMA 3APCA 2DYOA 4FLHA 1UELA 2JRIB 3N32A 3NY5A 2KLCA 3OAWA 2N1WA 3PLUA 3WANA 4GMVA 4PS7A 2BKFA 1ISNA 2L76A 2OJRA 4LDTB 3JW0X 2GBKA 2HTHA 2C5LC 4MGYE 1EUVB 2N9EB 1YD8U 2LXCA 4B95A 1TBEA 5D2MB 2L00B 2BF8B 2DYBA 3SD5A 4BVUC 4K81A 3VAWA 2BYEA 2DZMA 2RR9A 3UGBB 1EF1A 2ZPYA 1UGMA 1WXSA 3ML9A 2JWZA 4ZYNA 3GZNI 1EO6A 4W9EA 1LFDA 4MJSA 3PGEA 1RFAA 3RYTA 2JUOA 4IW0A 3N3KB 2KTFA 1OGWA 4BFRA 2GBRA 3NZUA 2G4DB 3ZDTA 4RMAA 1V81A 4MJSB 3K9PB 1ZGUB 2MP2A 2JPHA 4NAWA 5DCNA 1UBQA 4KZ0A 3KYCD 3VTUA 2FIFA 4IUMB 1TTNA 1MG8A 1WE7A 3DBSA 2DAFA 1R4MI 2MP2B 1WX7A 4NAWB 2LUEA 3EHVA 2DX5B 2J7QB 1VCBA 2KVRA 3AI5A 2PPHA 3PRZA 3A9KA 1Q5WB 2IBIB 1OEYJ 4KZCA 4DXAB 2K25A 4W9FA 5KHQA 1EF5A 4AUQC 4K7WA 2FNJB 2M0XA 1KJTA 3VHTC 5DPSA 4EEWA 3RUIB 1E8ZA 1KOTA 2K39A 2I1JA 3M63B 4BKGA 1WGHA 3DQVA 3RZFA 2KC2A 3A9KB 4IWPA 4JIOU 2LRWA 4M8NA 2AL6A 1NBFC 2M17A 1FXTB 1XD3B 3IVFA 3ZW3A 3V6CB 1E8XA 2IO3B 3H7SA 2NS5A 3M62B 3VXWA 2JZ3B 1E5WA 2LASA 2ZJDA 3H7PB 3R3MA 1J19A 3MTNB 4DDGD 3VFKA 4M8MA 2JZZA 3VUWA 3VUXA 5JH5C 1WMHA 4JGHB 4WJOA 3UF8A 2JRHA 2KWUB 2V4LA 3ZUNA 4FBJB 3WAMA 1WJNA 3ECIA 3OLMD 2B3AA 2J0JA 1WGYA 3NOBA 4EZKA 1WMHB 4ANWA 2RPQA 3AU4A 4LDTD 5J2RA 5DPWA 1WY8A 4CHKA 2C7MB 2KKCA 2KO3A 2EMSA 2WX0A 3N30A 2BGFA 2ASQA 4W9HA 2LI5A 5CTRC 2KWCA 3WA0A 3DCGA 2ZCBA 4FJZA 2OOBB 2GMIC 3LJ3A 3KW5B 4X57B 4WWNA 1H4RA 4BKSA 2DAJA 2K8HA 5G2NA 4W9DA 3ZNZB 4DDID 1WGGA 2M8SA 4XZ4A 3TJPA 1WIAA 3L17A 2CR5A 2D10A 2KDBA 3A4SC 4FHJA 2QHOA 3WAPA 1XT9B 2KD0A 2L3ZA 4B9KA 1H8CA 3HM3A 5E6NA 1YJ1A 3QQ8B 1G6JA 5JHBA 3TIXA 4MM3A 3K9OB 3QARA 2REXA 2NCNA 2IO0B 3MJWA 2N1VA 2BWFA 3CSFA 2IO1B 2KMCA 3IBEA 4W9KA 3L10B 2MBEA 2CHXA 1OTRB 4NNJB 3B08A 2KXJA 2R2OA 1E8YA 4GOCA 1M94A 4II3B 3P2BA 1Q1OA 4KSKC 4TQ1A 1D3ZA 1NDDA 5C23A 4AOFA 2AYOB 3CSTA 3X0WA 3ZRCA 4IM3A 2D11A 1I42A 1Z2MA 3ZDMC 3H1UA 5DPTA 3M3JA 4HWIB 2MSED 3APFA 2FAZA 4IWOA 2LVPA 2CHWA 2N4FA 2DZKA 5AZHA 4ICVA
chains in the Genus database with same CATH superfamily
2VH2A 5CHVC 3IFWB 2WDTB 2WNMA 3TMPB 3DVNU 2KX3A 4RGNA 2L05A 2O2VA 4YWGG 4DHJB 5IA7A 2BB6A 2EELA 2JZPA 1UZXB 3ZNHB 1RM6C 3AULA 1WYGA 1C76A 3IG3A 1OQQA 4AWJA 1HZ5A 4PYZA 3DBRI 1MPEA 1UBIA 2LHDA 2ICIA 4E71A 3RT3B 4ARCA 1WI0A 1B9RA 2M4NA 2BYTA 5CHWA 3HM6X 2KQSA 2ZEQA 3SEBA 4BKTA 3QJZA 2RD0A 2WXJA 3OWEB 2CS4A 2N7EA 1XEEA 2H88B 2LJ5A 3C0RB 1FFUA 3DHHC 1ZP0B 4NPNA 3ML8A 4A3OA 2JF5A 4BBNC 3SR6A 2DYMA 1L0XB 2KWVB 5FKAC 1E8WA 3L13A 4UDUC 4OHJA 1SGHA 1PGBA 1UWXA 2PMVA 3MFGA 5J17A 1YQBA 2BWES 2JT4B 4ZOHC 4ICUA 2O6VB 2NMQA 2G45B 2LVOA 2WWZA 4WAFA 3UIOB 1J0GA 2KQ4X 3NVVA 1R4NB 4CYEA 2WU2B 3PZDA 2XK5A 1SJHD 2HJ1A 2KDFB 3PHWB 3JSVB 2HDEA 3SFEB 2WXMA 2IPKD 3RN9C 2J52A 3P4PB 4JE3B 2VZKB 2K1FA 4XWWA 2ONQA 5CHFA 3U4EG 4W9GA 3EA6A 4RFBA 1P7EA 2DZIA 3CMMB 1P0RA 4NQKE 1HTQA 2K6QA 4ZDVA 4REZA 1E9MA 1F9JA 3VTWA 5AUKA 4N58A 2MBHA 4OZCA 4EOYA 4PS3A 4S0RA 4P7IA 1WGRA 2AL3A 1F2RI 1UWMA 2K8BA 3ZIMA 4ANXA 3U7ZA 1XLQA 1PUTA 2CKHB 3SFDB 4FHKA 2FCQA 1HTOA 1C1YB 3RNBC 4W9CA 2GBNA 4RGTA 4WQOB 1XF5L 2LVQA 2W9NA 2BKRB 2PJHA 1WWTA 1S3SG 1DYQA 3RI7C 2I1KA 3R7QA 1A70A 4KGRA 1AW7A 4LNIA 2KMAA 2UU7A 2MX2A 2WXFA 2ZW0A 1D4BA 1RYJA 3V3XA 2Y5BB 4G11A 3P42A 5IP4D 1VJKA 1V8CA 4MGKE 2DHZA 4GB9A 2Z0DB 4HDQA 4KX6B 4ZRPA 2KN4A 4F1SA 2SEBD 3MC9A 3QHTA 5FR6A 5EDSA 1UNSA 2KMMA 2NBVB 1BT0A 4KIKA 1S1QB 4J6IA 2HTME 3N9YC 1KTKA 3A33B 4XYCA 4QAYA 2OEDA 1SBBB 3RPFC 2BYFA 3VQIA 3R2IA 4EZJA 2KK8A 2V3SA 4M01A 3V61A 4IM2A 3Q3NC 1F0ZA 4PS8A 3BINA 3Q8EA 3AMZA 1GB4A 1V9JA 1FEHA 4K3BA 4HJGE 1J7AA 3TCAA 2KACA 2R61A 2J53A 5E6OA 5D7GA 2JXXA 2MEKA 3PRMB 1GPXA 2BPSA 1JRUA 4NQLB 1TKYA 2GRIA 1IPGA 4XC2A 3T3OA 2B76B 1MG4A 3B2FA 5HG2A 3Q6BA 3UINB 3EFUA 3A4RA 3TBLD 4ANVA 1GOZA 1V80A 2AQ2B 4W9IA 5AEKB 1KLVA 3ETRA 1YNTE 1D6EC 2LWPA 4MH0E 2WXRA 5MPOA 3L16A 1RAXA 3QC8B 4JL9A 4RM9A 2D3CA 3BYYB 2VRRB 2JYEA 2DYOA 3AEGB 1ISNA 2L76A 1TS3A 2GBKA 2C5LC 4WQMA 1YD8U 3EGRA 2KVZA 1C4PA 4B0EA 4H2AA 2DYBA 1YJJA 2ON8A 3VAWA 2BYEA 2RR9A 1TYGB 1MHXA 3Q14C 1DOXA 3NVZA 1WGKA 2ZPYA 4JWSC 1EO6A 4MJSA 1ROEA 4YTMB 1JWBD 3N3KB 3BZDB 2KTFA 1OGWA 4BFRA 3AB5A 4RMAA 1V81A 2JPHA 4NAWA 4HPPA 3KYCD 1TTNA 1V1PA 1WE7A 2KYWA 2XNAC 3UI3A 2KVRA 3ZXRA 3P4SB 3R2TA 4K7WA 2FNJB 5DPSA 4EEWA 3RUIB 1E8ZA 2K39A 4K3CA 2I1JA 1WGHA 3DQVA 1I4RA 1STEA 4IWPA 2LRWA 4JIOU 1XD3B 3IVFA 3ZW3A 3TSSA 3N1XC 4FXCA 1E5WA 2LASA 4DDGD 2LMCA 1FXIA 2ZW1A 1WSPA 3J9CA 4JGHB 2QC8A 1DOYA 2V0GA 3ZUNA 2PIAA 3WAMA 1WGYA 3NOBA 4EZKA 2W3SA 1YJIA 4ANWA 1C77A 3IT6B 2KKCA 2N7JA 2KO3A 3N30A 5CTRC 1L6UA 1TZOA 1E7PB 2DAJA 5G2NA 4DDID 1WGGA 4XZ4A 3L17A 2D10A 4FHJA 3WAPA 4B9KA 1H8CA 5G5GA 2AX5A 3AEEB 3MP9A 5JHBA 3QARA 4YSXB 1XXGA 1TJEA 1B1ZA 1E10A 2KMCA 2MBEA 2MHJA 4MM3B 1E8YA 2CJOA 4II3B 3P2BA 1XCQL 4JWUC 1NDDA 5C23A 2AYOB 3CSTA 3X0WA 3ZRCA 2D11A 4HWIB 1N63A 2FAZA 2N4FA 3BVZA 3IHPC 1OEYA 1I7HA 3H9DA 2C7HA 1JWUD 1XLNA 2C60A 2PEAA 3TUOA 3ENEA 2DLBA 1Z5SB 3B1LX 2L1AA 2DENB 1WX8A 2KJHB 4G3XB 4HROA 3OJ3A 3H6NA 1T0QC 1TGZB 1QZEA 2WP9B 4N6EB 3SHQA 1L0YB 5JXVA 2I38A 2GOWA 2QCZA 5BYRA 1A5RA 4FADA 3AE3B 2N7DA 2WDRB 2NPTB 4II2B 1XLOA 1I4QA 2JY6A 1GJZA 3BVMA 4XWTA 3PO0A 3ZYYX 4DHZB 2NTTA 1L6VA 3AM9A 4OZAA 4BKSD 5C1ZA 2ZCCA 1T3QA 1TS5A 4HPLB 3QCAA 2IY1B 2I2YA 4C80A 1ET6A 3ZKJC 2KJ6A 2O6VA 3E56A 2NBUA 2GI9A 2JX5A 5GMVA 3PHXB 1ZDXA 4BZAA 2AQ3B 1ZXHA 4RGOS 1WRIA 4XGAB 4IM0A 1WXAA 1NEKB 2MBOA 1CMXB 2WXQA 3AE5B 1JQ4A 3JSVA 2MBQA 3VTVA 1IGDA 4ZRIA 4B6WA 3N20C 3L0WB 1MVKA 2LUMA 2LRUA 3NHEB 1FNVA 1FXAA 1N60A 1V2YA 2LHEA 1CZPA 2KFJA 3KWVA 4A9AA 1BMLC 3R7RA 1LQBA 4RM8A 4XE0A 4WWMA 2ZZPB 2WXLA 1XO3A 3KUDB 4HEA1 3NS1A 3PRPB 1BUIC 3DDCB 1YN3A 2BVCA 3TEWA 4DXFA 2IGGA 1FIQA 1UH6A 5HHDG 4G50A 2LGXA 4G0NB 2BS3B 2INNE 1D5ZC 3NZSA 2NTSA 4P1CC 2INCC 3KUZA 2MA9B 3ZVVA 3RULA 1NI2A 5L95C 2N0SB 2PVGC 2Q5WD 1WXVA 5BMHA 1QOGA 4HLEA 1D5XC 1WH3A 3A9JB 3MHZA 1VD2A 5I4DA 3PLVA 3ZQ4A 2MJDA 5BMGA 3W1YA 3PREA 4FN2A 2GB1A 3I5JC 4MEMA 4L23A 4LTUA 4O1NA 2EMTA 2G4SA 4KV2A 3BIID 4GDKB 3ZXVA 1IBXB 2JXTA 1LGRA 1OQYA 1PYWD 2FCNA 3OJ4B 4ASWC 3PSEB 1VZ7A 4OVZA 2LZ6A 2W55A 1FRDA 2QMTA 1OQRA 3Q8FA 1NI3A 2H89B 1U4AA 2WU5B 3AE9B 1SE9A 1PGAA 4HKZE 5LXIB 3VDZA 4C56C 3PZ7A 4EKUA 2YVCA 4NJCA 4MDKE 4LNNA 3HIZA 2KOXA 2OHFA 3UIPB 3V6EB 1HQRD 3M95A 4FJYA 1KFYB 2LXAA 2FCSA 2DZJA 1JROA 2JSVX 4IOIE 1HEZE 3VR9B 3AEFB 1K52A 2OJWA 2IGHA 4LCDE 2WXNA 3ZJVA 1WR6E 2D5GA 2KHWB 4C7ZA 2D07B 3AV8A 1QF6A 4IC7B 1K8RB 4CO7A 3KUCB 1T0YA 4L1BA 2LGIA 1AWDA 5JZEB 3DBLI 1V97A 2PKOA 1AYFA 3O13A 4DWFA 5HFYA 3GZNB 4BAXA 4IWQA 1T0SC 3I57A 2M0AA 4E74A 2INDC 2CU1A 1WFYA 2V4IB 4C00A 3PV1A 2ZVOA 2WS3B 1C4CA 3DBRB 2MJ3A 3OG5A 3ZRFA 3RNGC 3VH4B 2GBMA 1LM8B 3AE8B 4LJOB 3U2SC 1ZE3D 3AE1B 1R4MB 4JLCA 1HXYD 2A4ZA 1FCCC 3B0AA 3HVDA 4S17A 4KSLC 5EE0A 3APCA 3GE3C 1UELA 2JRIB 2KLCA 3DHIC 3PLUA 1SSNA 3AEDB 4LDTB 2E6XA 1QOAA 2CJNA 2N9EB 4B95A 1SJED 1TBEA 5D2MB 2L00B 2KAJA 1TT5B 1UGMA 1NENB 1SE4A 1WXSA 3ZJUA 2JWZA 4ZYNA 3IAS1 1LFDA 2JUOA 4IW0A 1RWSA 1F2RC 1J7CA 3ZDTA 1ZGUB 2FIFA 1QOFA 3MC0B 1MG8A 1DGJA 3FC4A 2BT6A 4ZYSA 2AQ1B 3AI5A 2PPHA 1I4HA 2IBIB 1OEYJ 1QILA 4DXAB 2K25A 4W9FA 2WDVB 1CJEA 4MT5A 2M0XA 1KJTA 1GAQB 3VHTC 3NJTA 3M63B 2TSSA 4XDCA 3RZFA 3A9KB 3AE4B 4M8NA 2AL6A 3AEBB 1FXTB 1I4GA 3H7SA 3VXWA 1JRPA 2JZ3B 2ZJDA 1L0VB 3NRZA 3MTNB 3VFKA 4M8MA 1ACCA 3VUWA 1YOVB 2GLSA 5G5HA 4FBJB 1FNWA 1WJNA 3OLMD 2J0JA 4MACA 1YQ3B 1WMHB 3AU4A 5J2RA 2EMSA 2LI5A 2KWCA 4YTNB 2OOBB 1UF0A 2N9KA 4X57B 3GE8C 4W9DA 2M8SA 2INPE 3A4SC 3BK2A 2QHOA 1N6ZA 2KD0A 4A8XC 1E0ZA 1ZDVA 1YJ1A 3QQ8B 3KQ4A 4MM3A 3K9OB 2REXA 3MJWA 2BWFA 4Q2JA 4P6VF 2IO1B 3IBEA 4US8A 4W9KA 2CHXA 1OTRB 4NNJB 1IGCA 2R2OA 3I9V1 2M19A 1M94A 2LGSA 1ET9A 1Q1OA 4KSKC 1TIFA 1Z2MA 3DWMA 3H1UA 2MSED 3APFA 5IOIA 2DZKA 3UQAA 3NG0A 4D2KA 1V1OA 3Q3OC 3FAHA 1FFVA 4GXBA 1JWMD 1TS4A 5HKHA 3LXFA 1C3TA 4M0WB 1V6EA 4TQ0A 4YSZB 3ALBA 3SDLC 4IKGA 2MBBB 1RLFA 1WZ3A 1PFDA 4OVVA 1XCTL 1L4ZB 2NVUI 1YMHE 4IG7B 1WE6A 1JW9D 2NPTA 3Q3FA 4KKJA 5E6PA 2MJEA 4AJYB 2FUHB 4EZLA 3CWIA 1DOIA 4HVBA 2R2QA 2DWQA 4BOZB 4F7ZA 4MELA 3T9LA 3Q3MC 4MSMB 1F77A 1WXMA 5BO4B 2CU3A 3A1QB 2W82A 3GOEA 2WQYB 3GS2A 3HK0A 1KRHA 1WRDB 1VLBA 2PLPA 2UYZB 2Y5PA 3KH0A 2QJLA 4A55A 3ZJTA 4LNOA 1L7YA 1YN4A 4WH4A 2FUG1 1GNUA 2ZNVC 1TKGA 4I6LB 2IY0B 2L8JA 1EWCA 4HCPB 2G3QB 3P4QB 1VR9A 2N9XA 3PS6A 4FULA 1VZ6A 3QIJA 4DK5A 3W1SC 4XX5A 2LD9A 4GU2A 2J0KA 3DBHB 4DHJD 5BYQA 2JU6X 4GIVA 3MC8A 2WXOA 3PVLA 4JQWC 4ZHOA 1KF6B 4PYUA 5IO9A 1P7FA 3U7DA 2YEPB 3S2AA 4CQNA 3TL5A 1SIJA 2WXIA 3DVNV 5AZGA 3WIMA 2NR2A 1Q10A 2FIDA 4WJNA 1YX5B 1XLPA 2WX1A 1PQSA 2ZVNA 1OFFA 1WJUA 2BTEA 1L5PA 2WLBA 1MI0A 4ZRQA 4TSSA 1N5XA 3DPDA 3PPAA 4ZRKA 3T8MA 2ZPNA 2WDQB 2RSUA 2M56B 3BK1A 2J42A 4WAAA 3QA8A 2J0MA 4ZHPA 1V49A 1GC6A 2KDMA 3RNEC 4K1RB 3V05A 4E3CA 2JWUA 3A9JA 3RNCC 5LNK1 3BVGA 2RPVA 3P1MA 1E7VA 4W9LA 1FO4A 4RCOA 1WGDA 3L08A 5FR3A 2WGSA 1WZ0A 3AU5A 3UQBA 1P1AA 4A20A 1EU3A 2O6VD 1QOBA 1P9DU 4MGIE 3U8ZA 1V5TA 2KTRB 3TEXA 4DQOC 1FPYA 2KDEB 3KYDD 4GDKA 1IBXA 3IAM1 3FKYA 4NZLB 3APDA 2XEWA 3EECA 4RF1A 1SEBD 4RF0A 1L2NA 3RCZA 4EUTA 2L7RA 2Z59B 3VVWB 1K53A 2VZKD 2PE9A 5AUIA 2KNBA 2L0FA 2KFKB 1V5OA 4YXDB 1E7UA 4NJ6A 4FA6A 3HUIA 4LJPB 1GG3A 3NS8A 3NUHB 1LO5D 4OZBA 3CF6E 2RDGA 2PVOD 3DHGC 2W3RA 1GB1A 2PE6B 4AJWA 3URYA 3H7PA 4P16A 2IYDB 3U30A 1WXQA 2Y5CA 4GDLB 3DOWA 2BBCA 4RNAA 1AN8A 4I6PA 3ZNGC 2MLBA 3C8YA 4EFOA 1X1MA 4B0MA 1SB3C 3JVZX 2KX0A 3QAQA 3AEAB 2FBWB 5LXHA 3O65B 2XN9C 1ZW7A 5DPRA 2KDIA 2AEHA 5KHOA 2BYVE 5D94A 1QKZA 1TS2A 4HK2A 5BYSA 2MQJA 4WJQA 5LLIA 1E90A 2IO2B 1VRAB 2EKIA 3DWGC 4RH6A 3P63A 3X23A 3RZWC 2C7NB 2NBWB 3U52E 3ZTDA 4NY0A 2G1EA 2EKEC 1V86A 2WXGA 5IN7A 4DBGA 2HE7A 2CHZA 2XBBC 1WM2A 1GUAB 1R4NI 4KGSA 2K22A 2FCMA 2QSDA 3B2GA 3OAWA 3WANA 4GMVA 2OJRA 4KGTA 3JW0X 5EE3A 2HTHA 2LXCA 2RDHA 4YT0B 1CK1A 4C4VB 3UGBB 1EF1A 1M4VA 3ML9A 4J3OD 1QQRA 3GZNI 1SF0A 4W9EA 2PW9A 2LFIA 3PGEA 1ZOYB 2GBRA 1MHHE 3NZUA 2G4DB 5T8IA 3RMKC 3K9PB 1UBQA 4KZ0A 1C9FA 2IGDA 4IUMB 3DBSA 4JX1C 1R4MI 2MP2B 2J7QB 3BWUD 1VCBA 3VRAB 3PRZA 3A9KA 5KHQA 3W9CB 3WCQA 1EF5A 4AUQC 4C7YA 1SXTA 1EM7A 2JYTA 3Q8AA 2KC2A 3NVYA 1NBFC 1PGXA 3V6CB 2IO3B 3N1ZC 2NS5A 3H7PB 1YQ4B 3ABVB 5JH5C 4L2YA 1FNUA 1WMHA 3UF8A 2V4LA 1ZXIA 1TKEA 1D5MC 1UUPA 2B3AA 2RPQA 5DPWA 1WY8A 4CHKA 2C7MB 3RNAC 2WX0A 4W9HA 2BGFA 5H92C 1SE3A 3MJ5A 2ZCBA 4FJZA 2GMIC 3KW5B 3KWLA 4EE2A 5EE1A 2K8HA 2K5PA 1WIAA 2V3NA 2LEKA 2KDBA 2RDBC 1XT9B 1JWAD 3IT4B 3N1YC 2QEJC 1N62A 3HRDD 2QDFA 3L10B 4LNKA 2N9LA 4GOCA 1D3ZA 4TQ1A 4AOFA 1C78A 1I42A 4IM3A 2YEPF 3M3JA 2Y3AA 4ICVA 1C4AA 3FILB 2KN5A 1YX6B 4M0WA 4NAMA 4A3PA 2DNFA 1ZPSA 1AARA 2E3TA 2M1MA 4PK1A 2O2VB 4RGMA 1I4PA 5D3IB 1BXTA 5E6JA 1WM3A 1XQQA 4PT5A 3RNFC 4HCNB 3W5VB 1N5WA 4WIPA 1GC7A 3QWZB 4TUUA 2QIEB 2IJ0A 3A1QA 2K0PA 3Q8CA 4WWPA 2HJ8A 1NYRA 2D3GA 3DVGY 1YN5A 3L4PA 1FRRA 3LDZE 1MFWA 2KT7A 3RD2A 3RFZB 2FE8A 3DBLB 1IP9A 1E6EB 2V1YA 1FD6A 3ZNID 4DHZE 5HI1A 4LK0M 1WF9A 4KKIA 4US9A 1WYWB 1I35A 2G9HD 2D3BA 1KH0A 3Q2AC 1J8CA 1RRBA 1T6BX 2RGFA 4GSWA 4R3DA 4MH8A 2WHIA 1Q0WB 1WR1A 3VRBB 2N9PC 1UD7A 4FJVB 2GBJA 2KZRA 2KLGA 4IDIA 2WXPA 4K7UA 4M02A 3GP7A 3PTFC 2XK5B 5CX3A 5D3DA 1IYFA 3NZ3A 1KLUD 1SIFA 1N61A 3E9SA 3W5UB 4NJ7A 2MCNB 4AP4C 2K9XA 3HHMA 1K51A 3AXCA 5TR5A 3Q69A 1ZKHA 1WJ4A 2Z0EB 1P98A 1I4XA 3AE6B 1R7SA 3I63C 2YLMA 3LB8C 5L83A 5C2TB 2UWQA 3W1SA 4TKNA 2KJRA 1WX9A 2Z8LA 3VH3B 3WALA 4A90A 1IUEA 4GGQA 4ITKA 4N9F4 3DBHI 4HJKA 3D32A 2KANA 4W9JA 3TEYA 1LXDA 1Y8RC 2DBYA 2MW5A 1TZ1A 2KTRA 1JALA 3AE7B 4HKQA 3L54A 4YL8A 2PTLA 2LGYA 3BYTB 4GLSC 4URKA 3AE2B 3QK0A 5JHAA 4BOSC 5G55A 3KLSX 2L32A 2LGDA 4KDLB 2JVCA 3SU8X 2WXHA 3ZTCA 3JYUA 2KFKA 2BW2A 2K6DB 3EC8A 3R66C 1EU4A 2MWSB 4WJPA 2HD5B 2WYQA 4HPMB 2L83A 2KC1A 4TV3A 2X8XX 3IXSA 5D6JB 4GDLA 3ZLZA 3QX1A 1KM7A 4K7SA 2W54A 3I3TB 4ZRJA 2C9WB 4OVUA 3R8BA 4F8CB 2X38A 4KIKB 4KDIC 1L4DB 2KWDA 1HE8A 3T3NA 2LJIA 5J18A 3PT2B 1JMLA 2D2QA 3KVFB 3BY4B 4AS1A 2V9HA 3V62A 4LNFA 2K8CA 5IAAC 1P3QU 1QLBB 5AZFA 3Q3JA 5C3JB 4HDOA 2A5UA 2BQQA 4MSQB 5FK9C 4I6NB 4WWOA 3DVGX 1T5XD 4LLGM 5H8YE 3VUYA 4AQ7A 3AH7A 3PZ8A 1FMAD 3ZO5B 2L0TA 1NVID 2AWTA 3ZGZA 4GN1A 3W2DA 1ESFA 3ONSA 3AECB 2D3AA 1F1HA 1WJ6A 1YIWA 4HXDA 2ZNVB 3WAOA 2JQRB 1HA5A 1KLGD 3MHSD 2KQ7A 2IZVB 4BBNF 4A6QA 4WURA 4MGZE 3V60A 4ANUA 4OW0A 2MRPA 1NYQA 1HZ6A 4FLHA 3N32A 3NY5A 2N1WA 4PS7A 2BKFA 3C19A 1CQVA 3Q8BA 2RMMA 2K3UA 4C4VA 1JWSD 4MGYE 1EUVB 4HRSA 1F52A 4TMAB 2BF8B 3SD5A 2L52A 4BVUC 4K81A 3NVWA 2DZMA 1TY0A 1ENFA 1JCKB 1RFAA 3RYTA 5GXGB 2MH7A 4MJSB 2MP2A 5DCNA 4DXGA 3VTUA 1J7BA 1Y56A 2DAFA 4ACFA 1WX7A 3EUB2 4NAWB 3TEZA 2LUEA 3EHVA 2DX5B 4N59A 1FCLA 1Q5WB 4KZCA 1V1PB 3CIRB 1KOTA 4BKGA 2M17A 1E8XA 3M62B 3R3MA 1UGJA 1FM0D 1J19A 1RFKA 3LYYA 1ZUD2 2JZZA 4YTPB 3VUXA 5IKCM 1PDXA 4WJOA 2JRHA 2KWUB 5BMIA 2BS2B 1TY2A 3ECIA 2WXKA 4LDTD 1T0RC 2ASQA 3WA0A 3DCGA 1C79A 3EFCA 3LJ3A 4P1BC 4WWNA 4BKSA 1H4RA 3ZNZB 1MJDA 3B9JA 1SE2A 3TJPA 5TSSA 2CR5A 1K50A 2ACZB 2L3ZA 1VDVA 3HM3A 5E6NA 1G6JA 2SAKA 3TIXA 4USAA 5EE9A 2NCNA 2IO0B 2N1VA 2V3PA 2J4XA 3CSFA 4XDDA 3AN1A 1VZ8A 3H8HA 4YSYB 2QILA 3B08A 2KXJA 3P4RB 2BS4B 4JPSA 3GB1A 1QT9A 4M00A 3FILA 3VR8B 4ARIA 2BB5A 2IDYA 3ZDMC 5DPTA 3HVZA 1EWYC 2VH1A 4IWOA 2LVPA 2CHWA 5AZHA 4KVGB
chains in the Genus database with same CATH topology
3IHPC 5CHVC 2KN5A 3UQAA 3IFWB 1OEYA 1YX6B 2WDTB 3H9DA 3TMPB 3DVNU 2C7HA 2KX3A 2L05A 4GXBA 4A3PA 5HKHA 2C60A 2O2VA 1C3TA 2PEAA 4M0WB 1V6EA 4DHJB 5IA7A 1AARA 3ENEA 4TQ0A 1UZXB 1Z5SB 3B1LX 2M1MA 3ZNHB 3ALBA 3AULA 3SDLC 2O2VB 2MBBB 1RLFA 2DENB 1WX8A 1WZ3A 2KJHB 3IG3A 4G3XB 4OVVA 3OJ3A 3H6NA 2NVUI 1WM3A 4AWJA 1TGZB 4IG7B 1QZEA 1XQQA 1WE6A 3SHQA 4PYZA 2NPTA 3DBRI 3Q3FA 5E6PA 2GOWA 4HCNB 1UBIA 4E71A 4AJYB 3RT3B 1A5RA 4FADA 2FUHB 4EZLA 2N7DA 1WI0A 2NPTB 1GC7A 3QWZB 2M4NA 4TUUA 4II2B 5CHWA 3HM6X 4HVBA 3A1QA 2R2QA 2JY6A 4BOZB 4F7ZA 2KQSA 2HJ8A 2ZEQA 4MELA 4WWPA 3T9LA 4BKTA 1GJZA 3QJZA 2D3GA 4MSMB 2RD0A 3DVGY 2CS4A 2N7EA 2LJ5A 4DHZB 3C0RB 1WXMA 3LDZE 5BO4B 4BKSD 3A1QB 5C1ZA 2ZCCA 3RD2A 3GOEA 4NPNA 1IP9A 4HPLB 3ML8A 3QCAA 3HK0A 4A3OA 2JF5A 4BBNC 2IY1B 2DYMA 1WRDB 2V1YA 2KWVB 3ZNID 4DHZE 2UYZB 3KH0A 1E8WA 3ZKJC 3L13A 2KJ6A 1WF9A 1SGHA 2O6VA 2NBUA 5GMVA 3PHXB 1L7YA 1GNUA 2ZNVC 4I6LB 5J17A 2IY0B 1WYWB 1YQBA 1WXAA 2BWES 2L8JA 4IM0A 2JT4B 1I35A 4ICUA 1J8CA 2O6VB 1RRBA 2G45B 4HCPB 2MBOA 2RGFA 2LVOA 1CMXB 2G3QB 4GSWA 2WWZA 2N9XA 3PS6A 3UIOB 4FULA 1J0GA 3JSVA 3QIJA 4DK5A 4CYEA 3W1SC 1Q0WB 1WR1A 2LD9A 2MBQA 4XX5A 3VTVA 2N9PC 3PZDA 4GU2A 2XK5A 2J0KA 4ZRIA 4B6WA 4DHJD 1UD7A 2KDFB 3L0WB 4FJVB 2GBJA 3PHWB 4GIVA 2LRUA 2KZRA 3JSVB 2KLGA 4K7UA 3PVLA 4JQWC 3NHEB 3PTFC 4PYUA 2XK5B 5CX3A 3U7DA 1IYFA 3S2AA 1SIFA 3TL5A 1V2YA 2K1FA 3DVNV 5AZGA 5CHFA 2KFJA 2NR2A 4W9GA 3WIMA 4NJ7A 2MCNB 3R7RA 1LQBA 2DZIA 2FIDA 3CMMB 4RM8A 4WJNA 1YX5B 1P0RA 2ZZPB 4AP4C 2WX1A 3HHMA 1PQSA 3AXCA 3KUDB 4NQKE 2ZVNA 3PRPB 2K6QA 5TR5A 4ZDVA 3DDCB 1ZKHA 1WJUA 1WJ4A 1F9JA 2Z0EB 3VTWA 1P98A 2MBHA 1UH6A 3DPDA 3PPAA 4ZRKA 3T8MA 2YLMA 4G50A 2LGXA 5L83A 4EOYA 2ZPNA 4PS3A 4G0NB 2RSUA 4P7IA 1WGRA 2AL3A 2UWQA 3W1SA 4TKNA 2KJRA 1WX9A 3NZSA 2K8BA 3ZIMA 4ANXA 4WAAA 3QA8A 2J0MA 2CKHB 1V49A 1GC6A 4K1RB 3VH3B 3WALA 4FHKA 2FCQA 3KUZA 2MA9B 4E3CA 1C1YB 3ZVVA 4W9CA 3RULA 1NI2A 3A9JA 2GBNA 5L95C 4GGQA 4N9F4 3DBHI 4HJKA 3D32A 1WXVA 2KANA 1E7VA 4HLEA 4W9JA 4W9LA 1WGDA 4WQOB 2LVQA 1LXDA 2W9NA 3L08A 1Y8RC 2BKRB 1WH3A 2PJHA 3A9JB 1WZ0A 2MW5A 1TZ1A 2KTRA 3AU5A 3UQBA 1VD2A 3PLVA 1P1AA 4A20A 1S3SG 3L54A 3W1YA 2O6VD 3PREA 4FN2A 2I1KA 3R7QA 1P9DU 4YL8A 4MGIE 3U8ZA 1V5TA 2KTRB 2LGYA 4MEMA 4URKA 2EMTA 2KMAA 3KYDD 2KDEB 4GDKA 2MX2A 2G4SA 3QK0A 5JHAA 4KV2A 5G55A 4BOSC 2LGDA 3APDA 4KDLB 2XEWA 2Y5BB 2JVCA 3EECA 4G11A 4GDKB 3SU8X 1L2NA 3RCZA 3ZTCA 3JYUA 4EUTA 2L7RA 1OQYA 2KFKA 2Z59B 4MGKE 2DHZA 2K6DB 2FCNA 3EC8A 3OJ4B 3R66C 4GB9A 2MWSB 3VVWB 4ASWC 4WJPA 2Z0DB 3PSEB 4HDQA 2HD5B 2PE9A 2WYQA 2KNBA 2LZ6A 4F1SA 4HPMB 2L0FA 2KFKB 3QHTA 1V5OA 1E7UA 4NJ6A 4FA6A 2KC1A 4TV3A 1U4AA 4LJPB 1GG3A 3NS8A 1SE9A 5FR6A 5EDSA 5LXIB 3VDZA 3CF6E 5D6JB 2NBVB 4GDLA 3ZLZA 3QX1A 4EKUA 2YVCA 1KM7A 1BT0A 4KIKA 4MDKE 4K7SA 2PE6B 4AJWA 1S1QB 3HIZA 4J6IA 3H7PA 2KOXA 2IYDB 3U30A 3A33B 3UIPB 3I3TB 3V6EB 4ZRJA 2C9WB 3M95A 2LXAA 4FJYA 4GDLB 4OVUA 4F8CB 2BYFA 3DOWA 3VQIA 2FCSA 2DZJA 4KIKB 4KDIC 4EZJA 4I6PA 2KK8A 3ZNGC 2MLBA 2V3SA 3V61A 4IM2A 1HE8A 4EFOA 4LCDE 1X1MA 5J18A 3PT2B 4PS8A 1WR6E 2D2QA 3BINA 3KVFB 3BY4B 3JVZX 2KX0A 3QAQA 2KHWB 3V62A 2K8CA 5IAAC 1P3QU 2D07B 1V9JA 5AZFA 3Q3JA 5LXHA 4HDOA 3O65B 2A5UA 3TCAA 1ZW7A 5DPRA 2KDIA 4IC7B 1K8RB 4CO7A 4MSQB 4I6NB 3KUCB 3DVGX 4WWOA 1T0YA 5D7GA 5E6OA 2AEHA 5KHOA 2JXXA 2BYVE 5D94A 5JZEB 3DBLI 4HK2A 3PRMB 2BPSA 3VUYA 2MQJA 4WJQA 1JRUA 4NQLB 4DWFA 3ZO5B 1IPGA 4IWQA 5LLIA 1E90A 2L0TA 4XC2A 2AWTA 2IO2B 4KVGB 4GN1A 4E74A 3UINB 2CU1A 3EFUA 3ONSA 1WFYA 3X23A 3RZWC 3A4RA 2C7NB 3TBLD 3PV1A 2NBWB 2ZVOA 1WJ6A 3ZTDA 1YIWA 4HXDA 2ZNVB 4NY0A 4ANVA 2EKEC 3ZRFA 1V80A 1V86A 3WAOA 4W9IA 4DBGA 5AEKB 3VH4B 1KLVA 2GBMA 1LM8B 3MHSD 2KQ7A 2IZVB 4LJOB 2LWPA 4MH0E 2HE7A 4BBNF 2CHZA 2XBBC 4JLCA 4MGZE 1WM2A 3V60A 3L16A 1RAXA 2A4ZA 4ANUA 3QC8B 4JL9A 1GUAB 4RM9A 3B0AA 1R4NI 2VRRB 2MRPA 4KSLC 2FCMA 3APCA 2DYOA 4FLHA 1UELA 2JRIB 3N32A 3NY5A 2KLCA 3OAWA 2N1WA 3PLUA 3WANA 4GMVA 4PS7A 2BKFA 1ISNA 2L76A 2OJRA 4LDTB 3JW0X 2GBKA 2HTHA 2C5LC 4MGYE 1EUVB 2N9EB 1YD8U 2LXCA 4B95A 1TBEA 5D2MB 2L00B 2BF8B 2DYBA 3SD5A 4BVUC 4K81A 3VAWA 2BYEA 2DZMA 2RR9A 3UGBB 1EF1A 2ZPYA 1UGMA 1WXSA 3ML9A 2JWZA 4ZYNA 3GZNI 1EO6A 4W9EA 1LFDA 4MJSA 3PGEA 1RFAA 3RYTA 2JUOA 4IW0A 3N3KB 2KTFA 1OGWA 4BFRA 2GBRA 3NZUA 2G4DB 3ZDTA 4RMAA 1V81A 4MJSB 3K9PB 1ZGUB 2MP2A 2JPHA 4NAWA 5DCNA 1UBQA 4KZ0A 3KYCD 3VTUA 2FIFA 4IUMB 1TTNA 1MG8A 1WE7A 3DBSA 2DAFA 1R4MI 2MP2B 1WX7A 4NAWB 2LUEA 3EHVA 2DX5B 2J7QB 1VCBA 2KVRA 3AI5A 2PPHA 3PRZA 3A9KA 1Q5WB 2IBIB 1OEYJ 4KZCA 4DXAB 2K25A 4W9FA 5KHQA 1EF5A 4AUQC 4K7WA 2FNJB 2M0XA 1KJTA 3VHTC 5DPSA 4EEWA 3RUIB 1E8ZA 1KOTA 2K39A 2I1JA 3M63B 4BKGA 1WGHA 3DQVA 3RZFA 2KC2A 3A9KB 4IWPA 4JIOU 2LRWA 4M8NA 2AL6A 1NBFC 2M17A 1FXTB 1XD3B 3IVFA 3ZW3A 3V6CB 1E8XA 2IO3B 3H7SA 2NS5A 3M62B 3VXWA 2JZ3B 1E5WA 2LASA 2ZJDA 3H7PB 3R3MA 1J19A 3MTNB 4DDGD 3VFKA 4M8MA 2JZZA 3VUWA 3VUXA 5JH5C 1WMHA 4JGHB 4WJOA 3UF8A 2JRHA 2KWUB 2V4LA 3ZUNA 4FBJB 3WAMA 1WJNA 3ECIA 3OLMD 2B3AA 2J0JA 1WGYA 3NOBA 4EZKA 1WMHB 4ANWA 2RPQA 3AU4A 4LDTD 5J2RA 5DPWA 1WY8A 4CHKA 2C7MB 2KKCA 2KO3A 2EMSA 2WX0A 3N30A 2BGFA 2ASQA 4W9HA 2LI5A 5CTRC 2KWCA 3WA0A 3DCGA 2ZCBA 4FJZA 2OOBB 2GMIC 3LJ3A 3KW5B 4X57B 4WWNA 1H4RA 4BKSA 2DAJA 2K8HA 5G2NA 4W9DA 3ZNZB 4DDID 1WGGA 2M8SA 4XZ4A 3TJPA 1WIAA 3L17A 2CR5A 2D10A 2KDBA 3A4SC 4FHJA 2QHOA 3WAPA 1XT9B 2KD0A 2L3ZA 4B9KA 1H8CA 3HM3A 5E6NA 1YJ1A 3QQ8B 1G6JA 5JHBA 3TIXA 4MM3A 3K9OB 3QARA 2REXA 2NCNA 2IO0B 3MJWA 2N1VA 2BWFA 3CSFA 2IO1B 2KMCA 3IBEA 4W9KA 3L10B 2MBEA 2CHXA 1OTRB 4NNJB 3B08A 2KXJA 2R2OA 1E8YA 4GOCA 1M94A 4II3B 3P2BA 1Q1OA 4KSKC 4TQ1A 1D3ZA 1NDDA 5C23A 4AOFA 2AYOB 3CSTA 3X0WA 3ZRCA 4IM3A 2D11A 1I42A 1Z2MA 3ZDMC 3H1UA 5DPTA 3M3JA 4HWIB 2MSED 3APFA 2FAZA 4IWOA 2LVPA 2CHWA 2N4FA 2DZKA 5AZHA 4ICVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP C;  5CHV C;  2KN5 A;  3UQA A;  3IFW B;  1OEY A;  1YX6 B;  2WDT B;  3H9D A;  3TMP B;  3DVN U;  2C7H A;  2KX3 A;  2L05 A;  4GXB A;  4A3P A;  5HKH A;  2C60 A;  2O2V A;  1C3T A;  2PEA A;  4M0W B;  1V6E A;  4DHJ B;  5IA7 A;  1AAR A;  3ENE A;  4TQ0 A;  1UZX B;  1Z5S B;  3B1L X;  2M1M A;  3ZNH B;  3ALB A;  3AUL A;  3SDL C;  2O2V B;  2MBB B;  1RLF A;  2DEN B;  1WX8 A;  1WZ3 A;  2KJH B;  3IG3 A;  4G3X B;  4OVV A;  3OJ3 A;  3H6N A;  2NVU I;  1WM3 A;  4AWJ A;  1TGZ B;  4IG7 B;  1QZE A;  1XQQ A;  1WE6 A;  3SHQ A;  4PYZ A;  2NPT A;  3DBR I;  3Q3F A;  5E6P A;  2GOW A;  4HCN B;  1UBI A;  4E71 A;  4AJY B;  3RT3 B;  1A5R A;  4FAD A;  2FUH B;  4EZL A;  2N7D A;  1WI0 A;  2NPT B;  1GC7 A;  3QWZ B;  2M4N A;  4TUU A;  4II2 B;  5CHW A;  3HM6 X;  4HVB A;  3A1Q A;  2R2Q A;  2JY6 A;  4BOZ B;  4F7Z A;  2KQS A;  2HJ8 A;  2ZEQ A;  4MEL A;  4WWP A;  3T9L A;  4BKT A;  1GJZ A;  3QJZ A;  2D3G A;  4MSM B;  2RD0 A;  3DVG Y;  2CS4 A;  2N7E A;  2LJ5 A;  4DHZ B;  3C0R B;  1WXM A;  3LDZ E;  5BO4 B;  4BKS D;  3A1Q B;  5C1Z A;  2ZCC A;  3RD2 A;  3GOE A;  4NPN A;  1IP9 A;  4HPL B;  3ML8 A;  3QCA A;  3HK0 A;  4A3O A;  2JF5 A;  4BBN C;  2IY1 B;  2DYM A;  1WRD B;  2V1Y A;  2KWV B;  3ZNI D;  4DHZ E;  2UYZ B;  3KH0 A;  1E8W A;  3ZKJ C;  3L13 A;  2KJ6 A;  1WF9 A;  1SGH A;  2O6V A;  2NBU A;  5GMV A;  3PHX B;  1L7Y A;  1GNU A;  2ZNV C;  4I6L B;  5J17 A;  2IY0 B;  1WYW B;  1YQB A;  1WXA A;  2BWE S;  2L8J A;  4IM0 A;  2JT4 B;  1I35 A;  4ICU A;  1J8C A;  2O6V B;  1RRB A;  2G45 B;  4HCP B;  2MBO A;  2RGF A;  2LVO A;  1CMX B;  2G3Q B;  4GSW A;  2WWZ A;  2N9X A;  3PS6 A;  3UIO B;  4FUL A;  1J0G A;  3JSV A;  3QIJ A;  4DK5 A;  4CYE A;  3W1S C;  1Q0W B;  1WR1 A;  2LD9 A;  2MBQ A;  4XX5 A;  3VTV A;  2N9P C;  3PZD A;  4GU2 A;  2XK5 A;  2J0K A;  4ZRI A;  4B6W A;  4DHJ D;  1UD7 A;  2KDF B;  3L0W B;  4FJV B;  2GBJ A;  3PHW B;  4GIV A;  2LRU A;  2KZR A;  3JSV B;  2KLG A;  4K7U A;  3PVL A;  4JQW C;  3NHE B;  3PTF C;  4PYU A;  2XK5 B;  5CX3 A;  3U7D A;  1IYF A;  3S2A A;  1SIF A;  3TL5 A;  1V2Y A;  2K1F A;  3DVN V;  5AZG A;  5CHF A;  2KFJ A;  2NR2 A;  4W9G A;  3WIM A;  4NJ7 A;  2MCN B;  3R7R A;  1LQB A;  2DZI A;  2FID A;  3CMM B;  4RM8 A;  4WJN A;  1YX5 B;  1P0R A;  2ZZP B;  4AP4 C;  2WX1 A;  3HHM A;  1PQS A;  3AXC A;  3KUD B;  4NQK E;  2ZVN A;  3PRP B;  2K6Q A;  5TR5 A;  4ZDV A;  3DDC B;  1ZKH A;  1WJU A;  1WJ4 A;  1F9J A;  2Z0E B;  3VTW A;  1P98 A;  2MBH A;  1UH6 A;  3DPD A;  3PPA A;  4ZRK A;  3T8M A;  2YLM A;  4G50 A;  2LGX A;  5L83 A;  4EOY A;  2ZPN A;  4PS3 A;  4G0N B;  2RSU A;  4P7I A;  1WGR A;  2AL3 A;  2UWQ A;  3W1S A;  4TKN A;  2KJR A;  1WX9 A;  3NZS A;  2K8B A;  3ZIM A;  4ANX A;  4WAA A;  3QA8 A;  2J0M A;  2CKH B;  1V49 A;  1GC6 A;  4K1R B;  3VH3 B;  3WAL A;  4FHK A;  2FCQ A;  3KUZ A;  2MA9 B;  4E3C A;  1C1Y B;  3ZVV A;  4W9C A;  3RUL A;  1NI2 A;  3A9J A;  2GBN A;  5L95 C;  4GGQ A;  4N9F 4;  3DBH I;  4HJK A;  3D32 A;  1WXV A;  2KAN A;  1E7V A;  4HLE A;  4W9J A;  4W9L A;  1WGD A;  4WQO B;  2LVQ A;  1LXD A;  2W9N A;  3L08 A;  1Y8R C;  2BKR B;  1WH3 A;  2PJH A;  3A9J B;  1WZ0 A;  2MW5 A;  1TZ1 A;  2KTR A;  3AU5 A;  3UQB A;  1VD2 A;  3PLV A;  1P1A A;  4A20 A;  1S3S G;  3L54 A;  3W1Y A;  2O6V D;  3PRE A;  4FN2 A;  2I1K A;  3R7Q A;  1P9D U;  4YL8 A;  4MGI E;  3U8Z A;  1V5T A;  2KTR B;  2LGY A;  4MEM A;  4URK A;  2EMT A;  2KMA A;  3KYD D;  2KDE B;  4GDK A;  2MX2 A;  2G4S A;  3QK0 A;  5JHA A;  4KV2 A;  5G55 A;  4BOS C;  2LGD A;  3APD A;  4KDL B;  2XEW A;  2Y5B B;  2JVC A;  3EEC A;  4G11 A;  4GDK B;  3SU8 X;  1L2N A;  3RCZ A;  3ZTC A;  3JYU A;  4EUT A;  2L7R A;  1OQY A;  2KFK A;  2Z59 B;  4MGK E;  2DHZ A;  2K6D B;  2FCN A;  3EC8 A;  3OJ4 B;  3R66 C;  4GB9 A;  2MWS B;  3VVW B;  4ASW C;  4WJP A;  2Z0D B;  3PSE B;  4HDQ A;  2HD5 B;  2PE9 A;  2WYQ A;  2KNB A;  2LZ6 A;  4F1S A;  4HPM B;  2L0F A;  2KFK B;  3QHT A;  1V5O A;  1E7U A;  4NJ6 A;  4FA6 A;  2KC1 A;  4TV3 A;  1U4A A;  4LJP B;  1GG3 A;  3NS8 A;  1SE9 A;  5FR6 A;  5EDS A;  5LXI B;  3VDZ A;  3CF6 E;  5D6J B;  2NBV B;  4GDL A;  3ZLZ A;  3QX1 A;  4EKU A;  2YVC A;  1KM7 A;  1BT0 A;  4KIK A;  4MDK E;  4K7S A;  2PE6 B;  4AJW A;  1S1Q B;  3HIZ A;  4J6I A;  3H7P A;  2KOX A;  2IYD B;  3U30 A;  3A33 B;  3UIP B;  3I3T B;  3V6E B;  4ZRJ A;  2C9W B;  3M95 A;  2LXA A;  4FJY A;  4GDL B;  4OVU A;  4F8C B;  2BYF A;  3DOW A;  3VQI A;  2FCS A;  2DZJ A;  4KIK B;  4KDI C;  4EZJ A;  4I6P A;  2KK8 A;  3ZNG C;  2MLB A;  2V3S A;  3V61 A;  4IM2 A;  1HE8 A;  4EFO A;  4LCD E;  1X1M A;  5J18 A;  3PT2 B;  4PS8 A;  1WR6 E;  2D2Q A;  3BIN A;  3KVF B;  3BY4 B;  3JVZ X;  2KX0 A;  3QAQ A;  2KHW B;  3V62 A;  2K8C A;  5IAA C;  1P3Q U;  2D07 B;  1V9J A;  5AZF A;  3Q3J A;  5LXH A;  4HDO A;  3O65 B;  2A5U A;  3TCA A;  1ZW7 A;  5DPR A;  2KDI A;  4IC7 B;  1K8R B;  4CO7 A;  4MSQ B;  4I6N B;  3KUC B;  3DVG X;  4WWO A;  1T0Y A;  5D7G A;  5E6O A;  2AEH A;  5KHO A;  2JXX A;  2BYV E;  5D94 A;  5JZE B;  3DBL I;  4HK2 A;  3PRM B;  2BPS A;  3VUY A;  2MQJ A;  4WJQ A;  1JRU A;  4NQL B;  4DWF A;  3ZO5 B;  1IPG A;  4IWQ A;  5LLI A;  1E90 A;  2L0T A;  4XC2 A;  2AWT A;  2IO2 B;  4KVG B;  4GN1 A;  4E74 A;  3UIN B;  2CU1 A;  3EFU A;  3ONS A;  1WFY A;  3X23 A;  3RZW C;  3A4R A;  2C7N B;  3TBL D;  3PV1 A;  2NBW B;  2ZVO A;  1WJ6 A;  3ZTD A;  1YIW A;  4HXD A;  2ZNV B;  4NY0 A;  4ANV A;  2EKE C;  3ZRF A;  1V80 A;  1V86 A;  3WAO A;  4W9I A;  4DBG A;  5AEK B;  3VH4 B;  1KLV A;  2GBM A;  1LM8 B;  3MHS D;  2KQ7 A;  2IZV B;  4LJO B;  2LWP A;  4MH0 E;  2HE7 A;  4BBN F;  2CHZ A;  2XBB C;  4JLC A;  4MGZ E;  1WM2 A;  3V60 A;  3L16 A;  1RAX A;  2A4Z A;  4ANU A;  3QC8 B;  4JL9 A;  1GUA B;  4RM9 A;  3B0A A;  1R4N I;  2VRR B;  2MRP A;  4KSL C;  2FCM A;  3APC A;  2DYO A;  4FLH A;  1UEL A;  2JRI B;  3N32 A;  3NY5 A;  2KLC A;  3OAW A;  2N1W A;  3PLU A;  3WAN A;  4GMV A;  4PS7 A;  2BKF A;  1ISN A;  2L76 A;  2OJR A;  4LDT B;  3JW0 X;  2GBK A;  2HTH A;  2C5L C;  4MGY E;  1EUV B;  2N9E B;  1YD8 U;  2LXC A;  4B95 A;  1TBE A;  5D2M B;  2L00 B;  2BF8 B;  2DYB A;  3SD5 A;  4BVU C;  4K81 A;  3VAW A;  2BYE A;  2DZM A;  2RR9 A;  3UGB B;  1EF1 A;  2ZPY A;  1UGM A;  1WXS A;  3ML9 A;  2JWZ A;  4ZYN A;  3GZN I;  1EO6 A;  4W9E A;  1LFD A;  4MJS A;  3PGE A;  1RFA A;  3RYT A;  2JUO A;  4IW0 A;  3N3K B;  2KTF A;  1OGW A;  4BFR A;  2GBR A;  3NZU A;  2G4D B;  3ZDT A;  4RMA A;  1V81 A;  4MJS B;  3K9P B;  1ZGU B;  2MP2 A;  2JPH A;  4NAW A;  5DCN A;  1UBQ A;  4KZ0 A;  3KYC D;  3VTU A;  2FIF A;  4IUM B;  1TTN A;  1MG8 A;  1WE7 A;  3DBS A;  2DAF A;  1R4M I;  2MP2 B;  1WX7 A;  4NAW B;  2LUE A;  3EHV A;  2DX5 B;  2J7Q B;  1VCB A;  2KVR A;  3AI5 A;  2PPH A;  3PRZ A;  3A9K A;  1Q5W B;  2IBI B;  1OEY J;  4KZC A;  4DXA B;  2K25 A;  4W9F A;  5KHQ A;  1EF5 A;  4AUQ C;  4K7W A;  2FNJ B;  2M0X A;  1KJT A;  3VHT C;  5DPS A;  4EEW A;  3RUI B;  1E8Z A;  1KOT A;  2K39 A;  2I1J A;  3M63 B;  4BKG A;  1WGH A;  3DQV A;  3RZF A;  2KC2 A;  3A9K B;  4IWP A;  4JIO U;  2LRW A;  4M8N A;  2AL6 A;  1NBF C;  2M17 A;  1FXT B;  1XD3 B;  3IVF A;  3ZW3 A;  3V6C B;  1E8X A;  2IO3 B;  3H7S A;  2NS5 A;  3M62 B;  3VXW A;  2JZ3 B;  1E5W A;  2LAS A;  2ZJD A;  3H7P B;  3R3M A;  1J19 A;  3MTN B;  4DDG D;  3VFK A;  4M8M A;  2JZZ A;  3VUW A;  3VUX A;  5JH5 C;  1WMH A;  4JGH B;  4WJO A;  3UF8 A;  2JRH A;  2KWU B;  2V4L A;  3ZUN A;  4FBJ B;  3WAM A;  1WJN A;  3ECI A;  3OLM D;  2B3A A;  2J0J A;  1WGY A;  3NOB A;  4EZK A;  1WMH B;  4ANW A;  2RPQ A;  3AU4 A;  4LDT D;  5J2R A;  5DPW A;  1WY8 A;  4CHK A;  2C7M B;  2KKC A;  2KO3 A;  2EMS A;  2WX0 A;  3N30 A;  2BGF A;  2ASQ A;  4W9H A;  2LI5 A;  5CTR C;  2KWC A;  3WA0 A;  3DCG A;  2ZCB A;  4FJZ A;  2OOB B;  2GMI C;  3LJ3 A;  3KW5 B;  4X57 B;  4WWN A;  1H4R A;  4BKS A;  2DAJ A;  2K8H A;  5G2N A;  4W9D A;  3ZNZ B;  4DDI D;  1WGG A;  2M8S A;  4XZ4 A;  3TJP A;  1WIA A;  3L17 A;  2CR5 A;  2D10 A;  2KDB A;  3A4S C;  4FHJ A;  2QHO A;  3WAP A;  1XT9 B;  2KD0 A;  2L3Z A;  4B9K A;  1H8C A;  3HM3 A;  5E6N A;  1YJ1 A;  3QQ8 B;  1G6J A;  5JHB A;  3TIX A;  4MM3 A;  3K9O B;  3QAR A;  2REX A;  2NCN A;  2IO0 B;  3MJW A;  2N1V A;  2BWF A;  3CSF A;  2IO1 B;  2KMC A;  3IBE A;  4W9K A;  3L10 B;  2MBE A;  2CHX A;  1OTR B;  4NNJ B;  3B08 A;  2KXJ A;  2R2O A;  1E8Y A;  4GOC A;  1M94 A;  4II3 B;  3P2B A;  1Q1O A;  4KSK C;  4TQ1 A;  1D3Z A;  1NDD A;  5C23 A;  4AOF A;  2AYO B;  3CST A;  3X0W A;  3ZRC A;  4IM3 A;  2D11 A;  1I42 A;  1Z2M A;  3ZDM C;  3H1U A;  5DPT A;  3M3J A;  4HWI B;  2MSE D;  3APF A;  2FAZ A;  4IWO A;  2LVP A;  2CHW A;  2N4F A;  2DZK A;  5AZH A;  4ICV A; 
#chains in the Genus database with same CATH topology
 2VH2 A;  5CHV C;  3IFW B;  2WDT B;  2WNM A;  3TMP B;  3DVN U;  2KX3 A;  4RGN A;  2L05 A;  2O2V A;  4YWG G;  4DHJ B;  5IA7 A;  2BB6 A;  2EEL A;  2JZP A;  1UZX B;  3ZNH B;  1RM6 C;  3AUL A;  1WYG A;  1C76 A;  3IG3 A;  1OQQ A;  4AWJ A;  1HZ5 A;  4PYZ A;  3DBR I;  1MPE A;  1UBI A;  2LHD A;  2ICI A;  4E71 A;  3RT3 B;  4ARC A;  1WI0 A;  1B9R A;  2M4N A;  2BYT A;  5CHW A;  3HM6 X;  2KQS A;  2ZEQ A;  3SEB A;  4BKT A;  3QJZ A;  2RD0 A;  2WXJ A;  3OWE B;  2CS4 A;  2N7E A;  1XEE A;  2H88 B;  2LJ5 A;  3C0R B;  1FFU A;  3DHH C;  1ZP0 B;  4NPN A;  3ML8 A;  4A3O A;  2JF5 A;  4BBN C;  3SR6 A;  2DYM A;  1L0X B;  2KWV B;  5FKA C;  1E8W A;  3L13 A;  4UDU C;  4OHJ A;  1SGH A;  1PGB A;  1UWX A;  2PMV A;  3MFG A;  5J17 A;  1YQB A;  2BWE S;  2JT4 B;  4ZOH C;  4ICU A;  2O6V B;  2NMQ A;  2G45 B;  2LVO A;  2WWZ A;  4WAF A;  3UIO B;  1J0G A;  2KQ4 X;  3NVV A;  1R4N B;  4CYE A;  2WU2 B;  3PZD A;  2XK5 A;  1SJH D;  2HJ1 A;  2KDF B;  3PHW B;  3JSV B;  2HDE A;  3SFE B;  2WXM A;  2IPK D;  3RN9 C;  2J52 A;  3P4P B;  4JE3 B;  2VZK B;  2K1F A;  4XWW A;  2ONQ A;  5CHF A;  3U4E G;  4W9G A;  3EA6 A;  4RFB A;  1P7E A;  2DZI A;  3CMM B;  1P0R A;  4NQK E;  1HTQ A;  2K6Q A;  4ZDV A;  4REZ A;  1E9M A;  1F9J A;  3VTW A;  5AUK A;  4N58 A;  2MBH A;  4OZC A;  4EOY A;  4PS3 A;  4S0R A;  4P7I A;  1WGR A;  2AL3 A;  1F2R I;  1UWM A;  2K8B A;  3ZIM A;  4ANX A;  3U7Z A;  1XLQ A;  1PUT A;  2CKH B;  3SFD B;  4FHK A;  2FCQ A;  1HTO A;  1C1Y B;  3RNB C;  4W9C A;  2GBN A;  4RGT A;  4WQO B;  1XF5 L;  2LVQ A;  2W9N A;  2BKR B;  2PJH A;  1WWT A;  1S3S G;  1DYQ A;  3RI7 C;  2I1K A;  3R7Q A;  1A70 A;  4KGR A;  1AW7 A;  4LNI A;  2KMA A;  2UU7 A;  2MX2 A;  2WXF A;  2ZW0 A;  1D4B A;  1RYJ A;  3V3X A;  2Y5B B;  4G11 A;  3P42 A;  5IP4 D;  1VJK A;  1V8C A;  4MGK E;  2DHZ A;  4GB9 A;  2Z0D B;  4HDQ A;  4KX6 B;  4ZRP A;  2KN4 A;  4F1S A;  2SEB D;  3MC9 A;  3QHT A;  5FR6 A;  5EDS A;  1UNS A;  2KMM A;  2NBV B;  1BT0 A;  4KIK A;  1S1Q B;  4J6I A;  2HTM E;  3N9Y C;  1KTK A;  3A33 B;  4XYC A;  4QAY A;  2OED A;  1SBB B;  3RPF C;  2BYF A;  3VQI A;  3R2I A;  4EZJ A;  2KK8 A;  2V3S A;  4M01 A;  3V61 A;  4IM2 A;  3Q3N C;  1F0Z A;  4PS8 A;  3BIN A;  3Q8E A;  3AMZ A;  1GB4 A;  1V9J A;  1FEH A;  4K3B A;  4HJG E;  1J7A A;  3TCA A;  2KAC A;  2R61 A;  2J53 A;  5E6O A;  5D7G A;  2JXX A;  2MEK A;  3PRM B;  1GPX A;  2BPS A;  1JRU A;  4NQL B;  1TKY A;  2GRI A;  1IPG A;  4XC2 A;  3T3O A;  2B76 B;  1MG4 A;  3B2F A;  5HG2 A;  3Q6B A;  3UIN B;  3EFU A;  3A4R A;  3TBL D;  4ANV A;  1GOZ A;  1V80 A;  2AQ2 B;  4W9I A;  5AEK B;  1KLV A;  3ETR A;  1YNT E;  1D6E C;  2LWP A;  4MH0 E;  2WXR A;  5MPO A;  3L16 A;  1RAX A;  3QC8 B;  4JL9 A;  4RM9 A;  2D3C A;  3BYY B;  2VRR B;  2JYE A;  2DYO A;  3AEG B;  1ISN A;  2L76 A;  1TS3 A;  2GBK A;  2C5L C;  4WQM A;  1YD8 U;  3EGR A;  2KVZ A;  1C4P A;  4B0E A;  4H2A A;  2DYB A;  1YJJ A;  2ON8 A;  3VAW A;  2BYE A;  2RR9 A;  1TYG B;  1MHX A;  3Q14 C;  1DOX A;  3NVZ A;  1WGK A;  2ZPY A;  4JWS C;  1EO6 A;  4MJS A;  1ROE A;  4YTM B;  1JWB D;  3N3K B;  3BZD B;  2KTF A;  1OGW A;  4BFR A;  3AB5 A;  4RMA A;  1V81 A;  2JPH A;  4NAW A;  4HPP A;  3KYC D;  1TTN A;  1V1P A;  1WE7 A;  2KYW A;  2XNA C;  3UI3 A;  2KVR A;  3ZXR A;  3P4S B;  3R2T A;  4K7W A;  2FNJ B;  5DPS A;  4EEW A;  3RUI B;  1E8Z A;  2K39 A;  4K3C A;  2I1J A;  1WGH A;  3DQV A;  1I4R A;  1STE A;  4IWP A;  2LRW A;  4JIO U;  1XD3 B;  3IVF A;  3ZW3 A;  3TSS A;  3N1X C;  4FXC A;  1E5W A;  2LAS A;  4DDG D;  2LMC A;  1FXI A;  2ZW1 A;  1WSP A;  3J9C A;  4JGH B;  2QC8 A;  1DOY A;  2V0G A;  3ZUN A;  2PIA A;  3WAM A;  1WGY A;  3NOB A;  4EZK A;  2W3S A;  1YJI A;  4ANW A;  1C77 A;  3IT6 B;  2KKC A;  2N7J A;  2KO3 A;  3N30 A;  5CTR C;  1L6U A;  1TZO A;  1E7P B;  2DAJ A;  5G2N A;  4DDI D;  1WGG A;  4XZ4 A;  3L17 A;  2D10 A;  4FHJ A;  3WAP A;  4B9K A;  1H8C A;  5G5G A;  2AX5 A;  3AEE B;  3MP9 A;  5JHB A;  3QAR A;  4YSX B;  1XXG A;  1TJE A;  1B1Z A;  1E10 A;  2KMC A;  2MBE A;  2MHJ A;  4MM3 B;  1E8Y A;  2CJO A;  4II3 B;  3P2B A;  1XCQ L;  4JWU C;  1NDD A;  5C23 A;  2AYO B;  3CST A;  3X0W A;  3ZRC A;  2D11 A;  4HWI B;  1N63 A;  2FAZ A;  2N4F A;  3BVZ A;  3IHP C;  1OEY A;  1I7H A;  3H9D A;  2C7H A;  1JWU D;  1XLN A;  2C60 A;  2PEA A;  3TUO A;  3ENE A;  2DLB A;  1Z5S B;  3B1L X;  2L1A A;  2DEN B;  1WX8 A;  2KJH B;  4G3X B;  4HRO A;  3OJ3 A;  3H6N A;  1T0Q C;  1TGZ B;  1QZE A;  2WP9 B;  4N6E B;  3SHQ A;  1L0Y B;  5JXV A;  2I38 A;  2GOW A;  2QCZ A;  5BYR A;  1A5R A;  4FAD A;  3AE3 B;  2N7D A;  2WDR B;  2NPT B;  4II2 B;  1XLO A;  1I4Q A;  2JY6 A;  1GJZ A;  3BVM A;  4XWT A;  3PO0 A;  3ZYY X;  4DHZ B;  2NTT A;  1L6V A;  3AM9 A;  4OZA A;  4BKS D;  5C1Z A;  2ZCC A;  1T3Q A;  1TS5 A;  4HPL B;  3QCA A;  2IY1 B;  2I2Y A;  4C80 A;  1ET6 A;  3ZKJ C;  2KJ6 A;  2O6V A;  3E56 A;  2NBU A;  2GI9 A;  2JX5 A;  5GMV A;  3PHX B;  1ZDX A;  4BZA A;  2AQ3 B;  1ZXH A;  4RGO S;  1WRI A;  4XGA B;  4IM0 A;  1WXA A;  1NEK B;  2MBO A;  1CMX B;  2WXQ A;  3AE5 B;  1JQ4 A;  3JSV A;  2MBQ A;  3VTV A;  1IGD A;  4ZRI A;  4B6W A;  3N20 C;  3L0W B;  1MVK A;  2LUM A;  2LRU A;  3NHE B;  1FNV A;  1FXA A;  1N60 A;  1V2Y A;  2LHE A;  1CZP A;  2KFJ A;  3KWV A;  4A9A A;  1BML C;  3R7R A;  1LQB A;  4RM8 A;  4XE0 A;  4WWM A;  2ZZP B;  2WXL A;  1XO3 A;  3KUD B;  4HEA 1;  3NS1 A;  3PRP B;  1BUI C;  3DDC B;  1YN3 A;  2BVC A;  3TEW A;  4DXF A;  2IGG A;  1FIQ A;  1UH6 A;  5HHD G;  4G50 A;  2LGX A;  4G0N B;  2BS3 B;  2INN E;  1D5Z C;  3NZS A;  2NTS A;  4P1C C;  2INC C;  3KUZ A;  2MA9 B;  3ZVV A;  3RUL A;  1NI2 A;  5L95 C;  2N0S B;  2PVG C;  2Q5W D;  1WXV A;  5BMH A;  1QOG A;  4HLE A;  1D5X C;  1WH3 A;  3A9J B;  3MHZ A;  1VD2 A;  5I4D A;  3PLV A;  3ZQ4 A;  2MJD A;  5BMG A;  3W1Y A;  3PRE A;  4FN2 A;  2GB1 A;  3I5J C;  4MEM A;  4L23 A;  4LTU A;  4O1N A;  2EMT A;  2G4S A;  4KV2 A;  3BII D;  4GDK B;  3ZXV A;  1IBX B;  2JXT A;  1LGR A;  1OQY A;  1PYW D;  2FCN A;  3OJ4 B;  4ASW C;  3PSE B;  1VZ7 A;  4OVZ A;  2LZ6 A;  2W55 A;  1FRD A;  2QMT A;  1OQR A;  3Q8F A;  1NI3 A;  2H89 B;  1U4A A;  2WU5 B;  3AE9 B;  1SE9 A;  1PGA A;  4HKZ E;  5LXI B;  3VDZ A;  4C56 C;  3PZ7 A;  4EKU A;  2YVC A;  4NJC A;  4MDK E;  4LNN A;  3HIZ A;  2KOX A;  2OHF A;  3UIP B;  3V6E B;  1HQR D;  3M95 A;  4FJY A;  1KFY B;  2LXA A;  2FCS A;  2DZJ A;  1JRO A;  2JSV X;  4IOI E;  1HEZ E;  3VR9 B;  3AEF B;  1K52 A;  2OJW A;  2IGH A;  4LCD E;  2WXN A;  3ZJV A;  1WR6 E;  2D5G A;  2KHW B;  4C7Z A;  2D07 B;  3AV8 A;  1QF6 A;  4IC7 B;  1K8R B;  4CO7 A;  3KUC B;  1T0Y A;  4L1B A;  2LGI A;  1AWD A;  5JZE B;  3DBL I;  1V97 A;  2PKO A;  1AYF A;  3O13 A;  4DWF A;  5HFY A;  3GZN B;  4BAX A;  4IWQ A;  1T0S C;  3I57 A;  2M0A A;  4E74 A;  2IND C;  2CU1 A;  1WFY A;  2V4I B;  4C00 A;  3PV1 A;  2ZVO A;  2WS3 B;  1C4C A;  3DBR B;  2MJ3 A;  3OG5 A;  3ZRF A;  3RNG C;  3VH4 B;  2GBM A;  1LM8 B;  3AE8 B;  4LJO B;  3U2S C;  1ZE3 D;  3AE1 B;  1R4M B;  4JLC A;  1HXY D;  2A4Z A;  1FCC C;  3B0A A;  3HVD A;  4S17 A;  4KSL C;  5EE0 A;  3APC A;  3GE3 C;  1UEL A;  2JRI B;  2KLC A;  3DHI C;  3PLU A;  1SSN A;  3AED B;  4LDT B;  2E6X A;  1QOA A;  2CJN A;  2N9E B;  4B95 A;  1SJE D;  1TBE A;  5D2M B;  2L00 B;  2KAJ A;  1TT5 B;  1UGM A;  1NEN B;  1SE4 A;  1WXS A;  3ZJU A;  2JWZ A;  4ZYN A;  3IAS 1;  1LFD A;  2JUO A;  4IW0 A;  1RWS A;  1F2R C;  1J7C A;  3ZDT A;  1ZGU B;  2FIF A;  1QOF A;  3MC0 B;  1MG8 A;  1DGJ A;  3FC4 A;  2BT6 A;  4ZYS A;  2AQ1 B;  3AI5 A;  2PPH A;  1I4H A;  2IBI B;  1OEY J;  1QIL A;  4DXA B;  2K25 A;  4W9F A;  2WDV B;  1CJE A;  4MT5 A;  2M0X A;  1KJT A;  1GAQ B;  3VHT C;  3NJT A;  3M63 B;  2TSS A;  4XDC A;  3RZF A;  3A9K B;  3AE4 B;  4M8N A;  2AL6 A;  3AEB B;  1FXT B;  1I4G A;  3H7S A;  3VXW A;  1JRP A;  2JZ3 B;  2ZJD A;  1L0V B;  3NRZ A;  3MTN B;  3VFK A;  4M8M A;  1ACC A;  3VUW A;  1YOV B;  2GLS A;  5G5H A;  4FBJ B;  1FNW A;  1WJN A;  3OLM D;  2J0J A;  4MAC A;  1YQ3 B;  1WMH B;  3AU4 A;  5J2R A;  2EMS A;  2LI5 A;  2KWC A;  4YTN B;  2OOB B;  1UF0 A;  2N9K A;  4X57 B;  3GE8 C;  4W9D A;  2M8S A;  2INP E;  3A4S C;  3BK2 A;  2QHO A;  1N6Z A;  2KD0 A;  4A8X C;  1E0Z A;  1ZDV A;  1YJ1 A;  3QQ8 B;  3KQ4 A;  4MM3 A;  3K9O B;  2REX A;  3MJW A;  2BWF A;  4Q2J A;  4P6V F;  2IO1 B;  3IBE A;  4US8 A;  4W9K A;  2CHX A;  1OTR B;  4NNJ B;  1IGC A;  2R2O A;  3I9V 1;  2M19 A;  1M94 A;  2LGS A;  1ET9 A;  1Q1O A;  4KSK C;  1TIF A;  1Z2M A;  3DWM A;  3H1U A;  2MSE D;  3APF A;  5IOI A;  2DZK A;  3UQA A;  3NG0 A;  4D2K A;  1V1O A;  3Q3O C;  3FAH A;  1FFV A;  4GXB A;  1JWM D;  1TS4 A;  5HKH A;  3LXF A;  1C3T A;  4M0W B;  1V6E A;  4TQ0 A;  4YSZ B;  3ALB A;  3SDL C;  4IKG A;  2MBB B;  1RLF A;  1WZ3 A;  1PFD A;  4OVV A;  1XCT L;  1L4Z B;  2NVU I;  1YMH E;  4IG7 B;  1WE6 A;  1JW9 D;  2NPT A;  3Q3F A;  4KKJ A;  5E6P A;  2MJE A;  4AJY B;  2FUH B;  4EZL A;  3CWI A;  1DOI A;  4HVB A;  2R2Q A;  2DWQ A;  4BOZ B;  4F7Z A;  4MEL A;  3T9L A;  3Q3M C;  4MSM B;  1F77 A;  1WXM A;  5BO4 B;  2CU3 A;  3A1Q B;  2W82 A;  3GOE A;  2WQY B;  3GS2 A;  3HK0 A;  1KRH A;  1WRD B;  1VLB A;  2PLP A;  2UYZ B;  2Y5P A;  3KH0 A;  2QJL A;  4A55 A;  3ZJT A;  4LNO A;  1L7Y A;  1YN4 A;  4WH4 A;  2FUG 1;  1GNU A;  2ZNV C;  1TKG A;  4I6L B;  2IY0 B;  2L8J A;  1EWC A;  4HCP B;  2G3Q B;  3P4Q B;  1VR9 A;  2N9X A;  3PS6 A;  4FUL A;  1VZ6 A;  3QIJ A;  4DK5 A;  3W1S C;  4XX5 A;  2LD9 A;  4GU2 A;  2J0K A;  3DBH B;  4DHJ D;  5BYQ A;  2JU6 X;  4GIV A;  3MC8 A;  2WXO A;  3PVL A;  4JQW C;  4ZHO A;  1KF6 B;  4PYU A;  5IO9 A;  1P7F A;  3U7D A;  2YEP B;  3S2A A;  4CQN A;  3TL5 A;  1SIJ A;  2WXI A;  3DVN V;  5AZG A;  3WIM A;  2NR2 A;  1Q10 A;  2FID A;  4WJN A;  1YX5 B;  1XLP A;  2WX1 A;  1PQS A;  2ZVN A;  1OFF A;  1WJU A;  2BTE A;  1L5P A;  2WLB A;  1MI0 A;  4ZRQ A;  4TSS A;  1N5X A;  3DPD A;  3PPA A;  4ZRK A;  3T8M A;  2ZPN A;  2WDQ B;  2RSU A;  2M56 B;  3BK1 A;  2J42 A;  4WAA A;  3QA8 A;  2J0M A;  4ZHP A;  1V49 A;  1GC6 A;  2KDM A;  3RNE C;  4K1R B;  3V05 A;  4E3C A;  2JWU A;  3A9J A;  3RNC C;  5LNK 1;  3BVG A;  2RPV A;  3P1M A;  1E7V A;  4W9L A;  1FO4 A;  4RCO A;  1WGD A;  3L08 A;  5FR3 A;  2WGS A;  1WZ0 A;  3AU5 A;  3UQB A;  1P1A A;  4A20 A;  1EU3 A;  2O6V D;  1QOB A;  1P9D U;  4MGI E;  3U8Z A;  1V5T A;  2KTR B;  3TEX A;  4DQO C;  1FPY A;  2KDE B;  3KYD D;  4GDK A;  1IBX A;  3IAM 1;  3FKY A;  4NZL B;  3APD A;  2XEW A;  3EEC A;  4RF1 A;  1SEB D;  4RF0 A;  1L2N A;  3RCZ A;  4EUT A;  2L7R A;  2Z59 B;  3VVW B;  1K53 A;  2VZK D;  2PE9 A;  5AUI A;  2KNB A;  2L0F A;  2KFK B;  1V5O A;  4YXD B;  1E7U A;  4NJ6 A;  4FA6 A;  3HUI A;  4LJP B;  1GG3 A;  3NS8 A;  3NUH B;  1LO5 D;  4OZB A;  3CF6 E;  2RDG A;  2PVO D;  3DHG C;  2W3R A;  1GB1 A;  2PE6 B;  4AJW A;  3URY A;  3H7P A;  4P16 A;  2IYD B;  3U30 A;  1WXQ A;  2Y5C A;  4GDL B;  3DOW A;  2BBC A;  4RNA A;  1AN8 A;  4I6P A;  3ZNG C;  2MLB A;  3C8Y A;  4EFO A;  1X1M A;  4B0M A;  1SB3 C;  3JVZ X;  2KX0 A;  3QAQ A;  3AEA B;  2FBW B;  5LXH A;  3O65 B;  2XN9 C;  1ZW7 A;  5DPR A;  2KDI A;  2AEH A;  5KHO A;  2BYV E;  5D94 A;  1QKZ A;  1TS2 A;  4HK2 A;  5BYS A;  2MQJ A;  4WJQ A;  5LLI A;  1E90 A;  2IO2 B;  1VRA B;  2EKI A;  3DWG C;  4RH6 A;  3P63 A;  3X23 A;  3RZW C;  2C7N B;  2NBW B;  3U52 E;  3ZTD A;  4NY0 A;  2G1E A;  2EKE C;  1V86 A;  2WXG A;  5IN7 A;  4DBG A;  2HE7 A;  2CHZ A;  2XBB C;  1WM2 A;  1GUA B;  1R4N I;  4KGS A;  2K22 A;  2FCM A;  2QSD A;  3B2G A;  3OAW A;  3WAN A;  4GMV A;  2OJR A;  4KGT A;  3JW0 X;  5EE3 A;  2HTH A;  2LXC A;  2RDH A;  4YT0 B;  1CK1 A;  4C4V B;  3UGB B;  1EF1 A;  1M4V A;  3ML9 A;  4J3O D;  1QQR A;  3GZN I;  1SF0 A;  4W9E A;  2PW9 A;  2LFI A;  3PGE A;  1ZOY B;  2GBR A;  1MHH E;  3NZU A;  2G4D B;  5T8I A;  3RMK C;  3K9P B;  1UBQ A;  4KZ0 A;  1C9F A;  2IGD A;  4IUM B;  3DBS A;  4JX1 C;  1R4M I;  2MP2 B;  2J7Q B;  3BWU D;  1VCB A;  3VRA B;  3PRZ A;  3A9K A;  5KHQ A;  3W9C B;  3WCQ A;  1EF5 A;  4AUQ C;  4C7Y A;  1SXT A;  1EM7 A;  2JYT A;  3Q8A A;  2KC2 A;  3NVY A;  1NBF C;  1PGX A;  3V6C B;  2IO3 B;  3N1Z C;  2NS5 A;  3H7P B;  1YQ4 B;  3ABV B;  5JH5 C;  4L2Y A;  1FNU A;  1WMH A;  3UF8 A;  2V4L A;  1ZXI A;  1TKE A;  1D5M C;  1UUP A;  2B3A A;  2RPQ A;  5DPW A;  1WY8 A;  4CHK A;  2C7M B;  3RNA C;  2WX0 A;  4W9H A;  2BGF A;  5H92 C;  1SE3 A;  3MJ5 A;  2ZCB A;  4FJZ A;  2GMI C;  3KW5 B;  3KWL A;  4EE2 A;  5EE1 A;  2K8H A;  2K5P A;  1WIA A;  2V3N A;  2LEK A;  2KDB A;  2RDB C;  1XT9 B;  1JWA D;  3IT4 B;  3N1Y C;  2QEJ C;  1N62 A;  3HRD D;  2QDF A;  3L10 B;  4LNK A;  2N9L A;  4GOC A;  1D3Z A;  4TQ1 A;  4AOF A;  1C78 A;  1I42 A;  4IM3 A;  2YEP F;  3M3J A;  2Y3A A;  4ICV A;  1C4A A;  3FIL B;  2KN5 A;  1YX6 B;  4M0W A;  4NAM A;  4A3P A;  2DNF A;  1ZPS A;  1AAR A;  2E3T A;  2M1M A;  4PK1 A;  2O2V B;  4RGM A;  1I4P A;  5D3I B;  1BXT A;  5E6J A;  1WM3 A;  1XQQ A;  4PT5 A;  3RNF C;  4HCN B;  3W5V B;  1N5W A;  4WIP A;  1GC7 A;  3QWZ B;  4TUU A;  2QIE B;  2IJ0 A;  3A1Q A;  2K0P A;  3Q8C A;  4WWP A;  2HJ8 A;  1NYR A;  2D3G A;  3DVG Y;  1YN5 A;  3L4P A;  1FRR A;  3LDZ E;  1MFW A;  2KT7 A;  3RD2 A;  3RFZ B;  2FE8 A;  3DBL B;  1IP9 A;  1E6E B;  2V1Y A;  1FD6 A;  3ZNI D;  4DHZ E;  5HI1 A;  4LK0 M;  1WF9 A;  4KKI A;  4US9 A;  1WYW B;  1I35 A;  2G9H D;  2D3B A;  1KH0 A;  3Q2A C;  1J8C A;  1RRB A;  1T6B X;  2RGF A;  4GSW A;  4R3D A;  4MH8 A;  2WHI A;  1Q0W B;  1WR1 A;  3VRB B;  2N9P C;  1UD7 A;  4FJV B;  2GBJ A;  2KZR A;  2KLG A;  4IDI A;  2WXP A;  4K7U A;  4M02 A;  3GP7 A;  3PTF C;  2XK5 B;  5CX3 A;  5D3D A;  1IYF A;  3NZ3 A;  1KLU D;  1SIF A;  1N61 A;  3E9S A;  3W5U B;  4NJ7 A;  2MCN B;  4AP4 C;  2K9X A;  3HHM A;  1K51 A;  3AXC A;  5TR5 A;  3Q69 A;  1ZKH A;  1WJ4 A;  2Z0E B;  1P98 A;  1I4X A;  3AE6 B;  1R7S A;  3I63 C;  2YLM A;  3LB8 C;  5L83 A;  5C2T B;  2UWQ A;  3W1S A;  4TKN A;  2KJR A;  1WX9 A;  2Z8L A;  3VH3 B;  3WAL A;  4A90 A;  1IUE A;  4GGQ A;  4ITK A;  4N9F 4;  3DBH I;  4HJK A;  3D32 A;  2KAN A;  4W9J A;  3TEY A;  1LXD A;  1Y8R C;  2DBY A;  2MW5 A;  1TZ1 A;  2KTR A;  1JAL A;  3AE7 B;  4HKQ A;  3L54 A;  4YL8 A;  2PTL A;  2LGY A;  3BYT B;  4GLS C;  4URK A;  3AE2 B;  3QK0 A;  5JHA A;  4BOS C;  5G55 A;  3KLS X;  2L32 A;  2LGD A;  4KDL B;  2JVC A;  3SU8 X;  2WXH A;  3ZTC A;  3JYU A;  2KFK A;  2BW2 A;  2K6D B;  3EC8 A;  3R66 C;  1EU4 A;  2MWS B;  4WJP A;  2HD5 B;  2WYQ A;  4HPM B;  2L83 A;  2KC1 A;  4TV3 A;  2X8X X;  3IXS A;  5D6J B;  4GDL A;  3ZLZ A;  3QX1 A;  1KM7 A;  4K7S A;  2W54 A;  3I3T B;  4ZRJ A;  2C9W B;  4OVU A;  3R8B A;  4F8C B;  2X38 A;  4KIK B;  4KDI C;  1L4D B;  2KWD A;  1HE8 A;  3T3N A;  2LJI A;  5J18 A;  3PT2 B;  1JML A;  2D2Q A;  3KVF B;  3BY4 B;  4AS1 A;  2V9H A;  3V62 A;  4LNF A;  2K8C A;  5IAA C;  1P3Q U;  1QLB B;  5AZF A;  3Q3J A;  5C3J B;  4HDO A;  2A5U A;  2BQQ A;  4MSQ B;  5FK9 C;  4I6N B;  4WWO A;  3DVG X;  1T5X D;  4LLG M;  5H8Y E;  3VUY A;  4AQ7 A;  3AH7 A;  3PZ8 A;  1FMA D;  3ZO5 B;  2L0T A;  1NVI D;  2AWT A;  3ZGZ A;  4GN1 A;  3W2D A;  1ESF A;  3ONS A;  3AEC B;  2D3A A;  1F1H A;  1WJ6 A;  1YIW A;  4HXD A;  2ZNV B;  3WAO A;  2JQR B;  1HA5 A;  1KLG D;  3MHS D;  2KQ7 A;  2IZV B;  4BBN F;  4A6Q A;  4WUR A;  4MGZ E;  3V60 A;  4ANU A;  4OW0 A;  2MRP A;  1NYQ A;  1HZ6 A;  4FLH A;  3N32 A;  3NY5 A;  2N1W A;  4PS7 A;  2BKF A;  3C19 A;  1CQV A;  3Q8B A;  2RMM A;  2K3U A;  4C4V A;  1JWS D;  4MGY E;  1EUV B;  4HRS A;  1F52 A;  4TMA B;  2BF8 B;  3SD5 A;  2L52 A;  4BVU C;  4K81 A;  3NVW A;  2DZM A;  1TY0 A;  1ENF A;  1JCK B;  1RFA A;  3RYT A;  5GXG B;  2MH7 A;  4MJS B;  2MP2 A;  5DCN A;  4DXG A;  3VTU A;  1J7B A;  1Y56 A;  2DAF A;  4ACF A;  1WX7 A;  3EUB 2;  4NAW B;  3TEZ A;  2LUE A;  3EHV A;  2DX5 B;  4N59 A;  1FCL A;  1Q5W B;  4KZC A;  1V1P B;  3CIR B;  1KOT A;  4BKG A;  2M17 A;  1E8X A;  3M62 B;  3R3M A;  1UGJ A;  1FM0 D;  1J19 A;  1RFK A;  3LYY A;  1ZUD 2;  2JZZ A;  4YTP B;  3VUX A;  5IKC M;  1PDX A;  4WJO A;  2JRH A;  2KWU B;  5BMI A;  2BS2 B;  1TY2 A;  3ECI A;  2WXK A;  4LDT D;  1T0R C;  2ASQ A;  3WA0 A;  3DCG A;  1C79 A;  3EFC A;  3LJ3 A;  4P1B C;  4WWN A;  4BKS A;  1H4R A;  3ZNZ B;  1MJD A;  3B9J A;  1SE2 A;  3TJP A;  5TSS A;  2CR5 A;  1K50 A;  2ACZ B;  2L3Z A;  1VDV A;  3HM3 A;  5E6N A;  1G6J A;  2SAK A;  3TIX A;  4USA A;  5EE9 A;  2NCN A;  2IO0 B;  2N1V A;  2V3P A;  2J4X A;  3CSF A;  4XDD A;  3AN1 A;  1VZ8 A;  3H8H A;  4YSY B;  2QIL A;  3B08 A;  2KXJ A;  3P4R B;  2BS4 B;  4JPS A;  3GB1 A;  1QT9 A;  4M00 A;  3FIL A;  3VR8 B;  4ARI A;  2BB5 A;  2IDY A;  3ZDM C;  5DPT A;  3HVZ A;  1EWY C;  2VH1 A;  4IWO A;  2LVP A;  2CHW A;  5AZH A;  4KVG B; 
#chains in the Genus database with same CATH homology
 3IHP C;  5CHV C;  2KN5 A;  3UQA A;  3IFW B;  1OEY A;  1YX6 B;  2WDT B;  3H9D A;  3TMP B;  3DVN U;  2C7H A;  2KX3 A;  2L05 A;  4GXB A;  4A3P A;  5HKH A;  2C60 A;  2O2V A;  1C3T A;  2PEA A;  4M0W B;  1V6E A;  4DHJ B;  5IA7 A;  1AAR A;  3ENE A;  4TQ0 A;  1UZX B;  1Z5S B;  3B1L X;  2M1M A;  3ZNH B;  3ALB A;  3AUL A;  3SDL C;  2O2V B;  2MBB B;  1RLF A;  2DEN B;  1WX8 A;  1WZ3 A;  2KJH B;  3IG3 A;  4G3X B;  4OVV A;  3OJ3 A;  3H6N A;  2NVU I;  1WM3 A;  4AWJ A;  1TGZ B;  4IG7 B;  1QZE A;  1XQQ A;  1WE6 A;  3SHQ A;  4PYZ A;  2NPT A;  3DBR I;  3Q3F A;  5E6P A;  2GOW A;  4HCN B;  1UBI A;  4E71 A;  4AJY B;  3RT3 B;  1A5R A;  4FAD A;  2FUH B;  4EZL A;  2N7D A;  1WI0 A;  2NPT B;  1GC7 A;  3QWZ B;  2M4N A;  4TUU A;  4II2 B;  5CHW A;  3HM6 X;  4HVB A;  3A1Q A;  2R2Q A;  2JY6 A;  4BOZ B;  4F7Z A;  2KQS A;  2HJ8 A;  2ZEQ A;  4MEL A;  4WWP A;  3T9L A;  4BKT A;  1GJZ A;  3QJZ A;  2D3G A;  4MSM B;  2RD0 A;  3DVG Y;  2CS4 A;  2N7E A;  2LJ5 A;  4DHZ B;  3C0R B;  1WXM A;  3LDZ E;  5BO4 B;  4BKS D;  3A1Q B;  5C1Z A;  2ZCC A;  3RD2 A;  3GOE A;  4NPN A;  1IP9 A;  4HPL B;  3ML8 A;  3QCA A;  3HK0 A;  4A3O A;  2JF5 A;  4BBN C;  2IY1 B;  2DYM A;  1WRD B;  2V1Y A;  2KWV B;  3ZNI D;  4DHZ E;  2UYZ B;  3KH0 A;  1E8W A;  3ZKJ C;  3L13 A;  2KJ6 A;  1WF9 A;  1SGH A;  2O6V A;  2NBU A;  5GMV A;  3PHX B;  1L7Y A;  1GNU A;  2ZNV C;  4I6L B;  5J17 A;  2IY0 B;  1WYW B;  1YQB A;  1WXA A;  2BWE S;  2L8J A;  4IM0 A;  2JT4 B;  1I35 A;  4ICU A;  1J8C A;  2O6V B;  1RRB A;  2G45 B;  4HCP B;  2MBO A;  2RGF A;  2LVO A;  1CMX B;  2G3Q B;  4GSW A;  2WWZ A;  2N9X A;  3PS6 A;  3UIO B;  4FUL A;  1J0G A;  3JSV A;  3QIJ A;  4DK5 A;  4CYE A;  3W1S C;  1Q0W B;  1WR1 A;  2LD9 A;  2MBQ A;  4XX5 A;  3VTV A;  2N9P C;  3PZD A;  4GU2 A;  2XK5 A;  2J0K A;  4ZRI A;  4B6W A;  4DHJ D;  1UD7 A;  2KDF B;  3L0W B;  4FJV B;  2GBJ A;  3PHW B;  4GIV A;  2LRU A;  2KZR A;  3JSV B;  2KLG A;  4K7U A;  3PVL A;  4JQW C;  3NHE B;  3PTF C;  4PYU A;  2XK5 B;  5CX3 A;  3U7D A;  1IYF A;  3S2A A;  1SIF A;  3TL5 A;  1V2Y A;  2K1F A;  3DVN V;  5AZG A;  5CHF A;  2KFJ A;  2NR2 A;  4W9G A;  3WIM A;  4NJ7 A;  2MCN B;  3R7R A;  1LQB A;  2DZI A;  2FID A;  3CMM B;  4RM8 A;  4WJN A;  1YX5 B;  1P0R A;  2ZZP B;  4AP4 C;  2WX1 A;  3HHM A;  1PQS A;  3AXC A;  3KUD B;  4NQK E;  2ZVN A;  3PRP B;  2K6Q A;  5TR5 A;  4ZDV A;  3DDC B;  1ZKH A;  1WJU A;  1WJ4 A;  1F9J A;  2Z0E B;  3VTW A;  1P98 A;  2MBH A;  1UH6 A;  3DPD A;  3PPA A;  4ZRK A;  3T8M A;  2YLM A;  4G50 A;  2LGX A;  5L83 A;  4EOY A;  2ZPN A;  4PS3 A;  4G0N B;  2RSU A;  4P7I A;  1WGR A;  2AL3 A;  2UWQ A;  3W1S A;  4TKN A;  2KJR A;  1WX9 A;  3NZS A;  2K8B A;  3ZIM A;  4ANX A;  4WAA A;  3QA8 A;  2J0M A;  2CKH B;  1V49 A;  1GC6 A;  4K1R B;  3VH3 B;  3WAL A;  4FHK A;  2FCQ A;  3KUZ A;  2MA9 B;  4E3C A;  1C1Y B;  3ZVV A;  4W9C A;  3RUL A;  1NI2 A;  3A9J A;  2GBN A;  5L95 C;  4GGQ A;  4N9F 4;  3DBH I;  4HJK A;  3D32 A;  1WXV A;  2KAN A;  1E7V A;  4HLE A;  4W9J A;  4W9L A;  1WGD A;  4WQO B;  2LVQ A;  1LXD A;  2W9N A;  3L08 A;  1Y8R C;  2BKR B;  1WH3 A;  2PJH A;  3A9J B;  1WZ0 A;  2MW5 A;  1TZ1 A;  2KTR A;  3AU5 A;  3UQB A;  1VD2 A;  3PLV A;  1P1A A;  4A20 A;  1S3S G;  3L54 A;  3W1Y A;  2O6V D;  3PRE A;  4FN2 A;  2I1K A;  3R7Q A;  1P9D U;  4YL8 A;  4MGI E;  3U8Z A;  1V5T A;  2KTR B;  2LGY A;  4MEM A;  4URK A;  2EMT A;  2KMA A;  3KYD D;  2KDE B;  4GDK A;  2MX2 A;  2G4S A;  3QK0 A;  5JHA A;  4KV2 A;  5G55 A;  4BOS C;  2LGD A;  3APD A;  4KDL B;  2XEW A;  2Y5B B;  2JVC A;  3EEC A;  4G11 A;  4GDK B;  3SU8 X;  1L2N A;  3RCZ A;  3ZTC A;  3JYU A;  4EUT A;  2L7R A;  1OQY A;  2KFK A;  2Z59 B;  4MGK E;  2DHZ A;  2K6D B;  2FCN A;  3EC8 A;  3OJ4 B;  3R66 C;  4GB9 A;  2MWS B;  3VVW B;  4ASW C;  4WJP A;  2Z0D B;  3PSE B;  4HDQ A;  2HD5 B;  2PE9 A;  2WYQ A;  2KNB A;  2LZ6 A;  4F1S A;  4HPM B;  2L0F A;  2KFK B;  3QHT A;  1V5O A;  1E7U A;  4NJ6 A;  4FA6 A;  2KC1 A;  4TV3 A;  1U4A A;  4LJP B;  1GG3 A;  3NS8 A;  1SE9 A;  5FR6 A;  5EDS A;  5LXI B;  3VDZ A;  3CF6 E;  5D6J B;  2NBV B;  4GDL A;  3ZLZ A;  3QX1 A;  4EKU A;  2YVC A;  1KM7 A;  1BT0 A;  4KIK A;  4MDK E;  4K7S A;  2PE6 B;  4AJW A;  1S1Q B;  3HIZ A;  4J6I A;  3H7P A;  2KOX A;  2IYD B;  3U30 A;  3A33 B;  3UIP B;  3I3T B;  3V6E B;  4ZRJ A;  2C9W B;  3M95 A;  2LXA A;  4FJY A;  4GDL B;  4OVU A;  4F8C B;  2BYF A;  3DOW A;  3VQI A;  2FCS A;  2DZJ A;  4KIK B;  4KDI C;  4EZJ A;  4I6P A;  2KK8 A;  3ZNG C;  2MLB A;  2V3S A;  3V61 A;  4IM2 A;  1HE8 A;  4EFO A;  4LCD E;  1X1M A;  5J18 A;  3PT2 B;  4PS8 A;  1WR6 E;  2D2Q A;  3BIN A;  3KVF B;  3BY4 B;  3JVZ X;  2KX0 A;  3QAQ A;  2KHW B;  3V62 A;  2K8C A;  5IAA C;  1P3Q U;  2D07 B;  1V9J A;  5AZF A;  3Q3J A;  5LXH A;  4HDO A;  3O65 B;  2A5U A;  3TCA A;  1ZW7 A;  5DPR A;  2KDI A;  4IC7 B;  1K8R B;  4CO7 A;  4MSQ B;  4I6N B;  3KUC B;  3DVG X;  4WWO A;  1T0Y A;  5D7G A;  5E6O A;  2AEH A;  5KHO A;  2JXX A;  2BYV E;  5D94 A;  5JZE B;  3DBL I;  4HK2 A;  3PRM B;  2BPS A;  3VUY A;  2MQJ A;  4WJQ A;  1JRU A;  4NQL B;  4DWF A;  3ZO5 B;  1IPG A;  4IWQ A;  5LLI A;  1E90 A;  2L0T A;  4XC2 A;  2AWT A;  2IO2 B;  4KVG B;  4GN1 A;  4E74 A;  3UIN B;  2CU1 A;  3EFU A;  3ONS A;  1WFY A;  3X23 A;  3RZW C;  3A4R A;  2C7N B;  3TBL D;  3PV1 A;  2NBW B;  2ZVO A;  1WJ6 A;  3ZTD A;  1YIW A;  4HXD A;  2ZNV B;  4NY0 A;  4ANV A;  2EKE C;  3ZRF A;  1V80 A;  1V86 A;  3WAO A;  4W9I A;  4DBG A;  5AEK B;  3VH4 B;  1KLV A;  2GBM A;  1LM8 B;  3MHS D;  2KQ7 A;  2IZV B;  4LJO B;  2LWP A;  4MH0 E;  2HE7 A;  4BBN F;  2CHZ A;  2XBB C;  4JLC A;  4MGZ E;  1WM2 A;  3V60 A;  3L16 A;  1RAX A;  2A4Z A;  4ANU A;  3QC8 B;  4JL9 A;  1GUA B;  4RM9 A;  3B0A A;  1R4N I;  2VRR B;  2MRP A;  4KSL C;  2FCM A;  3APC A;  2DYO A;  4FLH A;  1UEL A;  2JRI B;  3N32 A;  3NY5 A;  2KLC A;  3OAW A;  2N1W A;  3PLU A;  3WAN A;  4GMV A;  4PS7 A;  2BKF A;  1ISN A;  2L76 A;  2OJR A;  4LDT B;  3JW0 X;  2GBK A;  2HTH A;  2C5L C;  4MGY E;  1EUV B;  2N9E B;  1YD8 U;  2LXC A;  4B95 A;  1TBE A;  5D2M B;  2L00 B;  2BF8 B;  2DYB A;  3SD5 A;  4BVU C;  4K81 A;  3VAW A;  2BYE A;  2DZM A;  2RR9 A;  3UGB B;  1EF1 A;  2ZPY A;  1UGM A;  1WXS A;  3ML9 A;  2JWZ A;  4ZYN A;  3GZN I;  1EO6 A;  4W9E A;  1LFD A;  4MJS A;  3PGE A;  1RFA A;  3RYT A;  2JUO A;  4IW0 A;  3N3K B;  2KTF A;  1OGW A;  4BFR A;  2GBR A;  3NZU A;  2G4D B;  3ZDT A;  4RMA A;  1V81 A;  4MJS B;  3K9P B;  1ZGU B;  2MP2 A;  2JPH A;  4NAW A;  5DCN A;  1UBQ A;  4KZ0 A;  3KYC D;  3VTU A;  2FIF A;  4IUM B;  1TTN A;  1MG8 A;  1WE7 A;  3DBS A;  2DAF A;  1R4M I;  2MP2 B;  1WX7 A;  4NAW B;  2LUE A;  3EHV A;  2DX5 B;  2J7Q B;  1VCB A;  2KVR A;  3AI5 A;  2PPH A;  3PRZ A;  3A9K A;  1Q5W B;  2IBI B;  1OEY J;  4KZC A;  4DXA B;  2K25 A;  4W9F A;  5KHQ A;  1EF5 A;  4AUQ C;  4K7W A;  2FNJ B;  2M0X A;  1KJT A;  3VHT C;  5DPS A;  4EEW A;  3RUI B;  1E8Z A;  1KOT A;  2K39 A;  2I1J A;  3M63 B;  4BKG A;  1WGH A;  3DQV A;  3RZF A;  2KC2 A;  3A9K B;  4IWP A;  4JIO U;  2LRW A;  4M8N A;  2AL6 A;  1NBF C;  2M17 A;  1FXT B;  1XD3 B;  3IVF A;  3ZW3 A;  3V6C B;  1E8X A;  2IO3 B;  3H7S A;  2NS5 A;  3M62 B;  3VXW A;  2JZ3 B;  1E5W A;  2LAS A;  2ZJD A;  3H7P B;  3R3M A;  1J19 A;  3MTN B;  4DDG D;  3VFK A;  4M8M A;  2JZZ A;  3VUW A;  3VUX A;  5JH5 C;  1WMH A;  4JGH B;  4WJO A;  3UF8 A;  2JRH A;  2KWU B;  2V4L A;  3ZUN A;  4FBJ B;  3WAM A;  1WJN A;  3ECI A;  3OLM D;  2B3A A;  2J0J A;  1WGY A;  3NOB A;  4EZK A;  1WMH B;  4ANW A;  2RPQ A;  3AU4 A;  4LDT D;  5J2R A;  5DPW A;  1WY8 A;  4CHK A;  2C7M B;  2KKC A;  2KO3 A;  2EMS A;  2WX0 A;  3N30 A;  2BGF A;  2ASQ A;  4W9H A;  2LI5 A;  5CTR C;  2KWC A;  3WA0 A;  3DCG A;  2ZCB A;  4FJZ A;  2OOB B;  2GMI C;  3LJ3 A;  3KW5 B;  4X57 B;  4WWN A;  1H4R A;  4BKS A;  2DAJ A;  2K8H A;  5G2N A;  4W9D A;  3ZNZ B;  4DDI D;  1WGG A;  2M8S A;  4XZ4 A;  3TJP A;  1WIA A;  3L17 A;  2CR5 A;  2D10 A;  2KDB A;  3A4S C;  4FHJ A;  2QHO A;  3WAP A;  1XT9 B;  2KD0 A;  2L3Z A;  4B9K A;  1H8C A;  3HM3 A;  5E6N A;  1YJ1 A;  3QQ8 B;  1G6J A;  5JHB A;  3TIX A;  4MM3 A;  3K9O B;  3QAR A;  2REX A;  2NCN A;  2IO0 B;  3MJW A;  2N1V A;  2BWF A;  3CSF A;  2IO1 B;  2KMC A;  3IBE A;  4W9K A;  3L10 B;  2MBE A;  2CHX A;  1OTR B;  4NNJ B;  3B08 A;  2KXJ A;  2R2O A;  1E8Y A;  4GOC A;  1M94 A;  4II3 B;  3P2B A;  1Q1O A;  4KSK C;  4TQ1 A;  1D3Z A;  1NDD A;  5C23 A;  4AOF A;  2AYO B;  3CST A;  3X0W A;  3ZRC A;  4IM3 A;  2D11 A;  1I42 A;  1Z2M A;  3ZDM C;  3H1U A;  5DPT A;  3M3J A;  4HWI B;  2MSE D;  3APF A;  2FAZ A;  4IWO A;  2LVP A;  2CHW A;  2N4F A;  2DZK A;  5AZH A;  4ICV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...