1L6VA

Structure of reduced bovine adrenodoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
106
structure length
106
Chain Sequence
b'DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenodoxin 1
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 9
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6vA00
2PVGC 1UWMA 3AMZA 2DBYA 4US8A 1SIJA 2WQYB 5MPOA 2MH7A 1QLBB 2H89B 2WDQB 2PKOA 4YXDB 2N0SB 1AYFA 1RM6C 1CJEA 2AX5A 1J7CA 1TYGB 3AV8A 2MJ3A 4IDIA 4YTNB 2Y5CA 1FO4A 1WYGA 3FAHA 3P4RB 2K9XA 1GPXA 2G1EA 1ZP0B 1WWTA 3CIRB 2L83A 2B76B 4KX6B 3VRAB 2WDRB 2FBWB 1FXIA 2QIEB 2W3RA 4YT0B 1JWAD 1R7SA 3NRZA 1FFVA 3VRBB 1DOXA 2MJEA 3AE3B 3AE7B 2W3SA 1VLBA 1TKGA 2BS2B 3AE8B 4ZOHC 4C80A 1XO3A 1TKYA 3FC4A 2W55A 5H92C 1E9MA 1YQ4B 4YSXB 1PDXA 3AE2B 1PUTA 1J7AA 1WRIA 1FRRA 1N61A 4HROA 1ZXIA 1XLNA 1SF0A 4C7ZA 3VR8B 1V8CA 1E7PB 3W5UB 1JALA 1FM0D 1RFKA 4ZHOA 4ITKA 2KAJA 1NVID 1XLQA 2K22A 3P4SB 1OQRA 3AEDB 3SFDB 1QOGA 1QOFA 1XLPA 2PIAA 1FIQA 1ROEA 1VJKA 1N60A 5C2TB 2M19A 2JX5A 2W54A 3AEEB 3W5VB 1NYQA 1QF6A 1VDVA 3NS1A 1OFFA 3B2FA 2HTME 1E10A 1F0ZA 1N5XA 5EE1A 4ZHPA 2QJLA 1FFUA 5GXGB 1B9RA 2CJNA 1ZOYB 3P4PB 1T3QA 1XLOA 1YJIA 1N5WA 3VR9B 1NYRA 4N59A 4JWUC 1PFDA 1FXAA 2WP9B 1JW9D 2WDVB 5AUIA 1AWDA 4N6EB 1JWBD 3NVYA 1QT9A 3B9JA 1JRPA 2L52A 2LEKA 3AN1A 3HRDD 1TJEA 1DGJA 3HVZA 1WXQA 1KFYB 1V97A 4YTPB 4US9A 4WWMA 2ACZB 3NVWA 1E0ZA 1L6VA 3ZYYX 2E3TA 2KMMA 3HUIA 3ETRA 5C3JB 2EKIA 1A70A 3LXFA 1N63A 2K5PA 2WS3B 3AB5A 1CZPA 3AE9B 1WGKA 5AUKA 4N58A 5EE0A 2BT6A 5G5GA 3AE1B 1FMAD 1JQ4A 4FXCA 3AEBB 4C7YA 3AECB 4USAA 1N62A 1ZUD2 3AEGB 2JQRB 3DWGC 5EE3A 4JX1C 5G5HA 1I7HA 3DWMA 2BS3B 3P1MA 4WQMA 5H8YE 1JROA 3SR6A 3L4PA 1RWSA 4HRSA 1L6UA 3BIID 3CWIA 3NVVA 3RPFC 4YSZB 1NI3A 1L5PA 1KRHA 4P6VF 3LB8C 1YJJA 3AEAB 3EUB2 2Q5WD 1NENB 1KF6B 1SB3C 1E6EB 2M56B 1IUEA 1NEKB 2PVOD 3P63A 5EE9A 2CJOA 1L0VB 2WU5B 3B2GA 3PO0A 1RYJA 1OQQA 3AE6B 3KWLA 2WLBA 1J7BA 2CU3A 3ABVB 3AE4B 3P4QB 2OHFA 2DWQA 3WCQA 1DOIA 3NVZA 4LTUA 1EWYC 3AE5B 2BS4B 4YSYB 4YTMB 2H88B 4A9AA 2MJDA 1FRDA 1YQ3B 3SFEB 3AH7A 4JWSC 3W9CB 1GAQB 3AEFB 1QOBA 3AM9A 1DOYA 1TKEA 2WU2B 1QOAA
chains in the Genus database with same CATH superfamily
3L08A 1F77A 5MPOA 2WQYB 4L1BA 3KUZA 3QARA 2NVUI 2LXCA 2AX5A 4ARIA 2PJHA 2KTRA 2Y5CA 4RGOS 4KSLC 3TCAA 1E7UA 2FBWB 3IT4B 4QAYA 2A5UA 2N7EA 4A20A 2PPHA 1CMXB 2D10A 4BBNF 4NJ7A 1F9JA 1VCBA 2O6VD 4JIOU 1WR1A 1QQRA 2E6XA 2NMQA 4WJNA 3V3XA 3QC8B 4ZDVA 3VUXA 4ICUA 2J52A 4BAXA 2ZPNA 3B2FA 3VQIA 1N5XA 2J7QB 4B9KA 4DBGA 4FULA 2WXLA 4MJSB 1I42A 5AZFA 2L52A 2XK5A 4TQ0A 1R4MI 4RH6A 4W9JA 1AARA 3SU8X 4N58A 2KNBA 1OQYA 3ZJTA 1FMAD 5JHBA 3W1SC 2JZPA 1WR6E 2SAKA 3O13A 3BWUD 2BYVE 3L4PA 1FNVA 2KJHB 2LASA 5GMVA 3DPDA 4P6VF 3OJ4B 1HTOA 1KF6B 2UU7A 2KWDA 2NR2A 4FHKA 2LMCA 4H2AA 3PRZA 1SE2A 5BYRA 4RF0A 2IJ0A 4RGTA 4AWJA 4B0EA 4JWSC 4OVUA 2FUG1 3JYUA 1C9FA 1RM6C 2KQ4X 1UH6A 3H8HA 1WWTA 3DHHC 3DVNV 3VXWA 1TTNA 1D5MC 2ZW1A 5DPSA 2MBBB 2N7DA 3JSVB 1XCTL 4RM9A 4B95A 1BMLC 5CHWA 2DYBA 3ZNZB 3IT6B 1UZXB 3NUHB 4HROA 4MACA 2NBUA 2WXKA 3UQAA 5IP4D 3H9DA 1RFKA 1SSNA 4ZHOA 2K22A 2OEDA 3BY4B 1C1YB 4M8MA 3R2IA 4NJ6A 4JLCA 1WXAA 3KLSX 2QJLA 1K50A 2LGXA 2KVZA 1YJIA 3L13A 4BZAA 4JWUC 4K3CA 3R7QA 2FCQA 2BF8B 2KX0A 3DBHI 2DZIA 2MBEA 3Q8CA 2ZJDA 2JRIB 3NVWA 3ETRA 3WALA 2O2VB 3NJTA 4ZYSA 5AUKA 5HI1A 5BO4B 2PW9A 1GNUA 1JWMD 2K8CA 4URKA 4F1SA 2K39A 3NVVA 2KC2A 1XXGA 4AQ7A 1WGGA 4K7SA 1KRHA 3TEXA 3AEAB 3RNFC 1E6EB 3BK2A 5DPRA 2CJOA 3ZLZA 1IP9A 1K52A 4A3PA 2DWQA 4OZCA 2G4SA 2C5LC 3ZNID 4DHZB 3AH7A 1VZ8A 4KIKA 2PVGC 3AMZA 3ONSA 3NZSA 2ZNVC 2MSED 1TYGB 3WAOA 3M62B 1PYWD 4P1BC 1WMHA 2ON8A 4BFRA 3PLVA 3NZ3A 2QEJC 2KFKB 5HFYA 2IO2B 2KMAA 2MJEA 3V62A 4ZOHC 1XO3A 1IBXB 1IYFA 4HXDA 4RGNA 2G45B 3PREA 2MP2B 2CKHB 1WM3A 1MG8A 5C23A 2BW2A 2N9LA 3PZ8A 1OQRA 3AEDB 4ICVA 2ZCCA 2KN4A 1GC7A 4OVZA 3AULA 2WGSA 3HM6X 3KW5B 1I4GA 2D5GA 2C7MB 3RNEC 2RGFA 1XLOA 3HM3A 4NJCA 4BKSD 3DHIC 4JGHB 3K9OB 1YIWA 1WM2A 2KT7A 1V1PB 1Q5WB 3Q3MC 3ZDTA 4E71A 4JQWC 3A9JB 4MM3B 1N63A 3PLUA 2QILA 5BMGA 3I57A 3UQBA 3AEGB 5H8YE 3T3NA 1KLUD 4HRSA 3BIID 1C76A 2N1VA 2I1KA 2JRHA 2LRUA 3MC0B 2DHZA 2WDTB 5EE9A 3IG3A 3BVGA 3A4SC 2W9NA 2FIFA 2HJ8A 3QA8A 3TJPA 2D11A 1LXDA 3D32A 4KGSA 1CK1A 4US8A 4XX5A 1T0RC 4LDTD 4ANUA 3J9CA 2ONQA 3VHTC 2N0SB 4FN2A 1QKZA 5IA7A 4HDQA 2JZZA 4KV2A 2L0FA 3R2TA 2BBCA 2QIEB 2AQ2B 2VZKB 2BS2B 1SEBD 3RNAC 1WE6A 3NHEB 3Q3JA 2MA9B 1HZ5A 4ZRIA 1ZXIA 4A90A 2JF5A 1V8CA 1NVID 4RFBA 3MC8A 1E8YA 2JY6A 3SHQA 4RGMA 3A33B 3ZXVA 4IM3A 2M19A 2W54A 5BYSA 2WXPA 2KLGA 3Q69A 1C78A 2IO0B 3UF8A 3WIMA 3NS1A 3ZKJC 1I4HA 2HTME 3IBEA 4D2KA 2J0KA 2V9HA 2XBBC 3DVGX 3RI7C 3C8YA 3EECA 2WP9B 4GDKA 2A4ZA 3HVDA 1SIFA 3E56A 1DGJA 2OJWA 1TT5B 4F8CB 4WJOA 3TMPB 3LXFA 1CZPA 4LCDE 1WIAA 2WXGA 1JQ4A 4M02A 3I3TB 4USAA 1YD8U 3ZRCA 3A1QA 1V1OA 1JROA 2BKRB 2L8JA 1GOZA 1ZXHA 4ANVA 1L5PA 1HA5A 2DYOA 4IM0A 2Y5BB 4C4VA 5DCNA 3GE3C 3KWVA 2RSUA 1WYWB 2IZVB 3Q8EA 2OHFA 3C0RB 1DOIA 4YSYB 1DYQA 4KZ0A 4DQOC 1WX9A 4XYCA 1TY2A 3ALBA 2WU2B 4HLEA 4NQKE 1YJ1A 5HKHA 2H89B 3PPAA 3UIOB 1AYFA 4WAFA 4HWIB 3ZJVA 5L83A 2GLSA 2JVCA 3H7SA 2L32A 4HJGE 2VH2A 2GI9A 4E74A 1WGYA 4XWTA 3Q8FA 2R2OA 3VRBB 1DOXA 3ECIA 2BVCA 1KLVA 4NNJB 1VR9A 1XEEA 4KDLB 3ML9A 3K9PB 1QILA 4ANXA 3ZJUA 2KXJA 3P42A 2AL3A 2MWSB 1D6EC 4NPNA 1OFFA 2BB5A 3MHSD 4ZHPA 3Q2AC 2D3CA 1FFUA 2M17A 3VUYA 1MHXA 1EO6A 1F2RI 2GMIC 1I4XA 1QT9A 2ZEQA 3RMKC 4DXGA 1EUVB 5C1ZA 1YX6B 5LXIB 4CHKA 1ZDVA 2YEPB 2MHJA 1H8CA 2K5PA 3AE9B 1M4VA 3AE1B 5D3DA 2AYOB 4CQNA 4EOYA 2WXNA 3H1UA 4EZJA 2Z0EB 2QDFA 4ASWC 3U7DA 1V6EA 2B3AA 2KYWA 4M00A 1WF9A 1YN4A 1S1QB 2KQSA 4DWFA 1IUEA 2WU5B 3UI3A 3AE6B 3ABVB 3AE4B 1EWYC 4K7UA 3BVMA 4G0NB 4UDUC 2LVQA 1PGBA 2CR5A 3LJ3A 3U2SC 4HPMB 2WNMA 1J7CA 3QX1A 2MJ3A 2IBIB 1JWSD 1ENFA 1ZP0B 2KZRA 4YL8A 3FILA 2QHOA 1FXIA 4EFOA 1V1PA 3ZGZA 4S17A 2WHIA 1WJ6A 2DNFA 2PTLA 1T0YA 1B1ZA 3WANA 4GXBA 4AP4C 1SXTA 1FM0D 3LDZE 4ITKA 3IXSA 3SFDB 4L2YA 2PEAA 1NYQA 1SGHA 1VDVA 2MW5A 4M0WB 4WIPA 3VR9B 5EDSA 2CS4A 1OEYJ 1V86A 2LRWA 4N6EB 4OW0A 3B9JA 3CSTA 2LI5A 4GMVA 3HVZA 4BKSA 4W9GA 4ARCA 5KHOA 4WJQA 1XT9B 1WGKA 2UYZB 3M63B 3R8BA 4MSQB 1UGMA 2KDIA 1I7HA 3DWMA 4JE3B 2KD0A 3A9KB 4ZRPA 1L6UA 4I6PA 2LXAA 1FNWA 3SDLC 3Q14C 3LB8C 1ZE3D 4MGYE 2WXHA 1VZ6A 1FCLA 3DBRB 1NEKB 1TY0A 3T8MA 5AZGA 2BKFA 4LTUA 3AE5B 3URYA 1YQ3B 4W9HA 2KWUB 3OG5A 4PT5A 1F52A 2WDQB 2DENB 4MGIE 2IYDB 1JRUA 1UBQA 3RN9C 1WXSA 1C4CA 1C79A 2AL6A 3AE3B 4C80A 3BYTB 1IGDA 2W55A 2X8XX 3NG0A 4KVGB 4BOZB 2DZMA 2KDFB 5BMIA 2KQ7A 2LGDA 3UIPB 1GG3A 3B0AA 2L3ZA 4HJKA 1YX5B 2LGIA 4WAAA 2MRPA 2JYEA 3ML8A 4C56C 4W9FA 4GDLB 1F0ZA 2KFJA 4PYZA 2HE7A 1ZOYB 4HKZE 2MQJA 5J2RA 2L1AA 4N59A 2LJ5A 4DHJB 2RDGA 2WDVB 1AWDA 2XEWA 4K7WA 5TR5A 4WWOA 5G55A 4AJWA 1WGRA 2AEHA 3V6EB 2BT6A 1GC6A 3MC9A 4L23A 3NS8A 1TZ1A 5CHFA 5EE3A 1E90A 1NI2A 4KGTA 2BTEA 1RWSA 2KDEB 2WWZA 3CWIA 3TEWA 4DHZE 1YN3A 1NDDA 1TZOA 2MX2A 2KX3A 3AI5A 3EUB2 1NENB 2GBRA 3ZNHB 3P4QB 1SJED 2LFIA 1JMLA 2KWVB 3AEFB 3BZDB 1N6ZA 2RR9A 3HIZA 2LZ6A 2M8SA 1HXYD 4A55A 2MH7A 3OJ3A 2K3UA 3MTNB 3V6CB 3PZDA 2L0TA 1E8ZA 1IGCA 4G11A 4P16A 3DHGC 1ET9A 2MEKA 1T0QC 3WAPA 3N32A 3PHWB 3M95A 2NPTA 2V1YA 5BMHA 1YQ4B 3N3KB 2KK8A 5FR3A 1R4MB 3AE2B 2FCMA 4DDGD 4IWOA 1SE4A 3E9SA 1N61A 5G2NA 3GB1A 1KM7A 1E7PB 3N9YC 1WJNA 4BKGA 4W9IA 1FIQA 1SE3A 1VJKA 2PE9A 2DAFA 3ZVVA 3FKYA 4DDID 3U7ZA 4MH0E 2WXOA 4AOFA 2JXXA 1T3QA 2JU6X 4XGAB 4GGQA 2LHDA 4XE0A 2FE8A 2INPE 2KVRA 1PFDA 3TL5A 2WXMA 3QQ8B 2LEKA 3AN1A 1ET6A 1H4RA 2C7HA 2HJ1A 4M01A 4MGZE 3WAMA 1D5ZC 1Z5SB 3EFUA 3U4EG 1E0ZA 1ZGUB 4MT5A 2ASQA 3L54A 2K1FA 3ZW3A 4FJVB 4EKUA 1PGXA 3H7PA 4NAWB 4W9LA 1BXTA 4YWGG 4A3OA 2M0XA 2RPQA 3W2DA 1WH3A 4KGRA 1T6BX 2BYEA 4P7IA 1SB3C 2KO3A 3P63A 3KUCB 3ZIMA 3IVFA 3VTWA 2KJRA 2LVPA 1VZ7A 1FD6A 4IC7B 1TKEA 3PZ7A 3UGBB 1Z2MA 2M1MA 1MHHE 5FR6A 4OZAA 5HG2A 5LLIA 1CJEA 1WJ4A 1WYGA 2YEPF 4I6LB 2G1EA 1JCKB 1T0SC 5D7GA 2K6DB 4AJYB 2I2YA 1JWAD 3DBLI 2ZNVB 3NRZA 1RAXA 3DCGA 4LK0M 3DBHB 3AE8B 5H92C 3TBLD 2KTRB 2RDBC 2CHWA 2V4LA 3TEZA 1I4RA 3EC8A 4C7ZA 3W5UB 2KAJA 2GBNA 1E8WA 1V81A 4X57B 4MELA 4MJSA 2JX5A 4KKJA 1P7FA 1TS2A 3W5VB 1PQSA 2D2QA 1E10A 4W9DA 2GOWA 5AZHA 1VRAB 1NYRA 1R4NI 1M94A 4MEMA 2N1WA 4PS8A 4AUQC 3RNGC 3KUDB 1P9DU 5D2MB 2EKIA 4K3BA 4LLGM 3BINA 1TIFA 3IAM1 5J17A 2XK5B 1UGJA 2RMMA 1U4AA 4KDIC 1UNSA 2IPKD 1TS5A 3I5JC 2LD9A 3B1LX 2KDMA 1WE7A 5E6OA 5TSSA 3RNBC 3ZYYX 4B0MA 3TUOA 2OOBB 1FEHA 2BWFA 1E5WA 2CU3A 2BGFA 1KH0A 1MVKA 3SEBA 2NBWB 3C19A 2LVOA 2NTTA 2GBKA 3AU5A 2DYMA 4RMAA 2XN9C 1P98A 3U52E 2DBYA 2IDYA 3APFA 3JSVA 1UF0A 5D3IB 2B76B 2C60A 3Q6BA 2ZVNA 4K1RB 1R7SA 2FIDA 1UBIA 1VLBA 4HKQA 1TKYA 4R3DA 2GRIA 3I63C 1PDXA 3RFZB 2J4XA 2FUHB 2K8HA 4JPSA 4HDOA 1XLNA 1SF0A 3QJZA 1JALA 2V3SA 1FCCC 2BB6A 4TSSA 1UD7A 1EU4A 1L7YA 1N60A 3N1ZC 1LFDA 3AEEB 3V61A 2FAZA 2FCSA 4NQLB 3L0WB 4LJOB 2NBVB 5GXGB 3IFWB 1L4ZB 1V2YA 4OHJA 2IGDA 1WGHA 2O2VA 1GB1A 3HHMA 1KFYB 2J42A 1WJUA 2WXRA 3HUIA 1MPEA 2N9EB 1QZEA 3AB5A 2M0AA 1LQBA 1N62A 4J6IA 5G5HA 3P1MA 3SR6A 2J0MA 4DK5A 3PGEA 5I4DA 4DXFA 1MJDA 4CO7A 1P7EA 1YJJA 4IG7B 3KYDD 4I6NB 2IY0B 2WX1A 3B2GA 1C4PA 1UELA 1RYJA 3PHXB 5IKCM 2IGHA 4W9CA 2WXFA 3SFEB 1FRDA 3V05A 2LGYA 1AW7A 2BS3B 2J53A 4GB9A 4J3OD 2KLCA 2KFKA 2V0GA 1IPGA 4YXDB 3NZUA 1IBXA 4IW0A 1FO4A 1YN5A 2CU1A 3OWEB 2IO1B 2DZKA 2BPSA 4ACFA 2MP2A 3AU4A 3I9V1 3OLMD 4KIKB 4N9F4 2IY1B 1FFVA 4S0RA 3FC4A 2FCNA 1PUTA 1WMHB 4RNAA 2MLBA 4GN1A 4EUTA 1HE8A 4GOCA 3P4SB 3PT2B 1SE9A 2X38A 3MHZA 3KYCD 3L17A 2C9WB 4BKTA 1STEA 1V5OA 2CHZA 3MFGA 1OEYA 5IOIA 3ZUNA 1N5WA 2KANA 3A9JA 4MM3A 1JW9D 5AUIA 3M3JA 3TEYA 4HVBA 4WH4A 2V3NA 5JH5C 1F1HA 3VTUA 2RPVA 1C77A 1BT0A 2LWPA 4OZBA 3ENEA 3AEBB 3KVFB 2NTSA 2LUEA 4TMAB 3SD5A 1P0RA 4KSKC 1HQRD 2Z0DB 4LNFA 1HTQA 3ZQ4A 5FKAC 1ZW7A 3GE8C 4AS1A 4HPLB 3WCQA 2JSVX 2BS4B 5DPTA 3X0WA 3R66C 1QOBA 4EZLA 3VR8B 2L7RA 3R3MA 4FJZA 1QLBB 5D94A 4TV3A 4P1CC 3AV8A 4PK1A 5L95C 3P4RB 3CIRB 4MSMB 5DPWA 5KHQA 2D3BA 5J18A 2N9XA 2W3RA 2TSSA 2AWTA 1I35A 1WX7A 2LHEA 3APDA 4WURA 1WRIA 2JT4B 3KH0A 2PE6B 3ZO5B 4DHJD 4E3CA 3H6NA 1LO5D 1L4DB 1XQQA 2N4FA 2IO3B 3DOWA 1RLFA 3V60A 4C00A 3IAS1 3GS2A 5EE1A 2REXA 4NY0A 2KWCA 4IWQA 4IM2A 4EEWA 2VRRB 4PS3A 2O6VB 1K53A 3GP7A 4FBJB 3N1XC 1I4QA 4YTPB 3QHTA 3QAQA 4PS7A 2KMMA 4HCNB 1A70A 1JWUD 4XDCA 2QCZA 1J0GA 2EMSA 5G5GA 4IUMB 2QC8A 1Q10A 4FXCA 4GDKB 3Q3FA 4Q2JA 3VH4B 3NY5A 2MCNB 4WQMA 3L16A 2LJIA 1LM8B 2INDC 3RUIB 1ISNA 4MGKE 3MP9A 4FADA 4YSZB 2NS5A 4HCPB 3ZTCA 1ZDXA 3GOEA 3RYTA 2K8BA 4BVUC 1J7BA 1EWCA 2LUMA 3A1QB 3WA0A 3CMMB 2SEBD 3EGRA 4BBNC 2V4IB 1QOAA 1RFAA 4C4VB 1I4PA 4YTNB 1V80A 3QIJA 2HD5B 3DQVA 1J8CA 1TBEA 1FPYA 4KX6B 4TQ1A 5CTRC 1OGWA 3OAWA 4WJPA 2JZ3B 2L00B 1LGRA 2Y5PA 4HK2A 3A4RA 3O65B 2RDHA 1D5XC 1XD3B 4IWPA 4PYUA 3DVNU 3ZDMC 4ANWA 1SBBB 1QOGA 1ROEA 3MJWA 1E8XA 4LJPB 1WY8A 1NBFC 1QF6A 2G9HD 3X23A 2CJNA 1YQBA 3QK0A 1Q1OA 2NCNA 1FXAA 2R2QA 3NVYA 4REZA 1JRPA 2WXQA 3NOBA 5IO9A 1V97A 2K6QA 2Y3AA 1SJHD 4MH8A 4A8XC 3ZNGC 5LNK1 1MI0A 4TUUA 4MDKE 3T3OA 2M4NA 2I38A 3B08A 2YVCA 4WQOB 2EMTA 2JQRB 2K0PA 3RZWC 1BUIC 1KLGD 1P1AA 2YLMA 4JL9A 2WYQA 2I1JA 2N9PC 3DVGY 4ZRKA 1GB4A 2PVOD 1WZ0A 2MBOA 1A5RA 2H88B 3S2AA 4RM8A 1UWMA 3Q3OC 3N30A 1SIJA 4IOIE 3GZNI 1WXVA 2K25A 5FK9C 2DZJA 2PMVA 2DLBA 1OTRB 1GPXA 4WWPA 2L83A 5E6JA 3PRMB 3VRAB 4BOSC 1KTKA 2D3GA 2GB1A 1ACCA 4YT0B 2IGGA 1G6JA 2GBJA 3N1YC 1TKGA 2N7JA 3PVLA 2VZKD 1HZ6A 4YSXB 4M0WA 1FRRA 2HDEA 3FILB 4F7ZA 2INCC 2QMTA 2LGSA 3RT3B 1QOFA 4ZRJA 2MBHA 3PTFC 5C2TB 1VD2A 4II3B 4GU2A 1Y56A 3N20C 2INNE 2OJRA 3RNCC 1J19A 3P4PB 3QCAA 4B6WA 4RCOA 1V49A 2Z59B 4W9KA 3Q3NC 4EZKA 1YNTE 2MBQA 1JWBD 2VH1A 3HRDD 2JWUA 5JZEB 2JYTA 1WXQA 1UWXA 4K81A 3A9KA 1AN8A 2XNAC 3BK1A 4LNIA 2JWZA 1D4BA 5E6PA 4HPPA 3JW0X 5BYQA 3Q8BA 1CQVA 4HEA1 3DWGC 1EF5A 5IN7A 1GUAB 4XDDA 2V3PA 3MJ5A 1ZKHA 1S3SG 2G4DB 4TKNA 2KDBA 4RF1A 4W9EA 1YMHE 3RPFC 5CHVC 2AQ3B 2W82A 2ZW0A 4LNNA 5JXVA 1ZPSA 3JVZX 1EM7A 1V9JA 3EHVA 2WLBA 4WWNA 2JPHA 4YTMB 1E7VA 3W9CB 3AM9A 4LNKA 5E6NA 3PS6A 3CSFA 3DDCB 3KQ4A 2CHXA 3Q8AA 4G3XB 2BQQA 2DX5B 2O6VA 2WDRB 4ZYNA 2ZZPB 3IHPC 3AE7B 2W3SA 1HEZE 4IKGA 1L0XB 5D6JB 1E9MA 4GDLA 2QSDA 3LYYA 2ICIA 1MG4A 1FXTB 3RCZA 4LDTB 3VAWA 1K8RB 1J7AA 2WXJA 3TSSA 2L76A 1XLQA 4ZRQA 1EU3A 4XZ4A 2KJ6A 3VTVA 3GZNB 3BYYB 2WXIA 3ZRFA 4FLHA 5HHDG 3UINB 2Z8LA 3AXCA 2AQ1B 2J0JA 3PRPB 1ESFA 1B9RA 3DBSA 3VUWA 3APCA 3VDZA 2UWQA 4A6QA 2BWES 4NZLB 2JXTA 3P2BA 4LNOA 4KKIA 4FHJA 4M8NA 4GLSC 3W1YA 4WWMA 3U30A 2ACZB 2E3TA 5C3JB 1TGZB 2EELA 3R7RA 3W1SA 1TS4A 3RULA 1T5XD 1FNUA 2WX0A 2KN5A 1RRBA 3RZFA 3RD2A 4II2B 3DBLB 1NI3A 2Q5WD 2PLPA 3PO0A 2KOXA 3NVZA 4EE2A 1GAQB 3T9LA 5IAAC 1WI0A 1TS3A 2KMCA 2PKOA 2RD0A 1X1MA 4IDIA 3FAHA 2K9XA 1K51A 2L05A 2G3QB 4NAMA 4XWWA 1Q0WB 1R4NB 2KACA 5T8IA 2R61A 3VFKA 2GBMA 3DBRI 3L10B 1PGAA 1WX8A 3U8ZA 4G50A 3VVWB 1UUPA 4KZCA 1XF5L 2KC1A 1WRDB 1XLPA 2BYFA 2NPTB 2PIAA 2DAJA 1L2NA 1L0YB 4GIVA 3TIXA 1XCQL 2JUOA 2D3AA 3ZTDA 1WXMA 4GSWA 2KHWB 3CF6E 5LXHA 2HTHA 1KJTA 3EFCA 2ZVOA 1TJEA 4NAWA 3QWZB 4US9A 1Y8RC 4FJYA 2EKEC 1L6VA 5AEKB 3VH3B 3PSEB 2KKCA 2WS3B 2C7NB 5EE0A 1WZ3A 1P3QU 1MFWA 3AECB 4C7YA 4O1NA 1C3TA 1ZUD2 1WGDA 2FNJB 3ZXRA 4OVVA 4JX1C 1KOTA 3PV1A 1F2RC 1GJZA 2BYTA 2ZCBA 3BVZA 5JHAA 2KTFA 2M56B 1YOVB 1L0VB 4FA6A 3KWLA 3H7PB 1OQQA 1V5TA 3HK0A 1C4AA 4XC2A 2N9KA 5CX3A 4A9AA 2MJDA 4CYEA 1WFYA 3EA6A 1WSPA 1D3ZA 1EF1A 2D07B 1DOYA 4DXAB 2ZPYA
chains in the Genus database with same CATH topology
1F77A 5MPOA 2WQYB 1MHHE 4L1BA 2H89B 4OZAA 5HG2A 1I4PA 1AYFA 4WAFA 1CJEA 2AX5A 4ARIA 3ZJVA 4YTNB 2Y5CA 1WYGA 2YEPF 4RGOS 2G1EA 1JCKB 2L32A 4HJGE 2GI9A 4KX6B 4XWTA 4TQ1A 2FBWB 5D7GA 3Q8FA 2I2YA 1JWAD 3IT4B 3VRBB 3NRZA 1DOXA 4LK0M 3AE8B 2Y5PA 5H92C 2RDHA 1D5XC 3TEZA 1I4RA 1VR9A 1XEEA 4C7ZA 3W5UB 2KAJA 1SBBB 1QOGA 1ROEA 1QILA 1QQRA 2E6XA 2NMQA 3V3XA 2JX5A 4KKJA 1P7FA 1TS2A 3ZJUA 3P42A 3W5VB 1D6EC 1QF6A 2J52A 1OFFA 2BB5A 2G9HD 3B2FA 1E10A 3VQIA 1N5XA 4ZHPA 1FFUA 2CJNA 1VRAB 1MHXA 1NYRA 2WXLA 1FXAA 1F2RI 3NVYA 1I4XA 1QT9A 4REZA 1JRPA 2L52A 4DXGA 2WXQA 4TQ0A 1V97A 2Y3AA 1SJHD 4MH8A 4A8XC 4RH6A 5LNK1 1MI0A 1ZDVA 2YEPB 3T3OA 2EKIA 4LLGM 2K5PA 3AE9B 1M4VA 4N58A 3ZJTA 2I38A 1FMAD 3AE1B 5D3DA 4CQNA 3IAM1 2WXNA 2JZPA 1UGJA 2JQRB 2K0PA 2RMMA 2SAKA 3O13A 1BUIC 1KLGD 3BWUD 3L4PA 1UNSA 1FNVA 1TS5A 2IPKD 2KDMA 5TSSA 4P6VF 1GB4A 1YN4A 1KF6B 2KWDA 4H2AA 3ZYYX 1IUEA 2LMCA 2PVOD 4B0MA 2WU5B 3TUOA 1FEHA 3UI3A 3AE6B 1SE2A 3ABVB 2CU3A 3AE4B 1KH0A 1MVKA 5BYRA 4RF0A 3SEBA 1EWYC 2IJ0A 3BVMA 2H88B 2NTTA 4UDUC 4RGTA 2DYMA 4B0EA 4JWSC 2XN9C 1PGBA 3U52E 1UWMA 2DBYA 2IDYA 2FUG1 1SIJA 4IOIE 3U2SC 1C9FA 5FK9C 1RM6C 2WNMA 1J7CA 2MJ3A 2PMVA 1JWSD 2DLBA 1ENFA 2KQ4X 3H8HA 1GPXA 1ZP0B 1WWTA 5D3IB 2L83A 2B76B 5E6JA 3VRAB 1KTKA 3FILA 1FXIA 2GB1A 1D5MC 2ZW1A 1ACCA 4YT0B 2IGGA 1R7SA 1V1PA 3ZGZA 1VLBA 1TKGA 4HKQA 2N7JA 1TKYA 2VZKD 1XCTL 1HZ6A 4R3DA 1BMLC 2GRIA 4YSXB 1PDXA 2PTLA 4M0WA 3RFZB 2J4XA 1FRRA 1B1ZA 3IT6B 4JPSA 3NUHB 2HDEA 4HROA 1XLNA 1SF0A 2WXKA 3FILB 4MACA 2QMTA 1JALA 1FM0D 1SXTA 1RFKA 1SSNA 1FCCC 4ZHOA 4ITKA 2BB6A 3IXSA 2K22A 4TSSA 3SFDB 1QOFA 1EU4A 2OEDA 1N60A 5C2TB 4L2YA 3AEEB 1NYQA 1VDVA 3R2IA 1Y56A 2INNE 3KLSX 2QJLA 1K50A 4WIPA 5GXGB 1L4ZB 3P4PB 4OHJA 1YJIA 2IGDA 4RCOA 3VR9B 1GB1A 4JWUC 1YNTE 4N6EB 1JWBD 4OW0A 3B9JA 3HRDD 2JWUA 3Q8CA 2JYTA 3HVZA 1WXQA 1KFYB 1UWXA 2J42A 2WXRA 3NVWA 4ARCA 1AN8A 2XNAC 3HUIA 3BK1A 3ETRA 1MPEA 1D4BA 3AB5A 4ZYSA 1WGKA 5AUKA 5BYQA 2M0AA 3PZ7A 3R8BA 3Q8BA 5HI1A 1CQVA 2PW9A 4HEA1 1N62A 3DWGC 1JWMD 4XDDA 2V3PA 3MJ5A 1I7HA 3DWMA 3P1MA 4JE3B 5G5HA 3SR6A 4ZRPA 1L6UA 5I4DA 3NVVA 4RF1A 4DXFA 1YMHE 1XXGA 3RPFC 4AQ7A 1FNWA 1P7EA 2AQ3B 2W82A 1KRHA 2ZW0A 3TEXA 3LB8C 5JXVA 1ZPSA 1YJJA 1ZE3D 3AEAB 2WXHA 1VZ6A 1FCLA 1E6EB 3BK2A 1EM7A 1NEKB 1TY0A 2CJOA 3B2GA 1C4PA 1K52A 1RYJA 2WLBA 2DWQA 2IGHA 4LTUA 4YTMB 4OZCA 3AE5B 3URYA 2WXFA 3SFEB 1FRDA 1YQ3B 3V05A 3AH7A 3W9CB 3AM9A 1AW7A 1VZ8A 2BS3B 2PVGC 3AMZA 4PT5A 2J53A 4J3OD 2V0GA 2WDQB 4YXDB 3KQ4A 1TYGB 1IBXA 1FO4A 1YN5A 3OWEB 1PYWD 3Q8AA 2ON8A 2WDRB 3I9V1 3NZ3A 1C4CA 1C79A 2QEJC 5HFYA 1FFVA 2MJEA 3AE3B 3AE7B 2W3SA 1HEZE 4IKGA 4C80A 4ZOHC 1L0XB 1XO3A 3BYTB 1IGDA 3FC4A 2W55A 1E9MA 1IBXB 2QSDA 3LYYA 2ICIA 4RGNA 1PUTA 1J7AA 4RNAA 2BW2A 2N9LA 5BMIA 3PZ8A 2WXJA 3TSSA 1XLQA 3P4SB 4ZRQA 1EU3A 1OQRA 3AEDB 2LGIA 2X38A 2JYEA 3MHZA 4C56C 4GDLB 2KN4A 3BYYB 4OVZA 2WXIA 1STEA 5HHDG 1F0ZA 3MFGA 2Z8LA 1I4GA 2D5GA 2AQ1B 1ESFA 1B9RA 1ZOYB 1XLOA 1N5WA 4HKZE 4NJCA 2L1AA 4A6QA 4N59A 4NZLB 2JXTA 1JW9D 2RDGA 2WDVB 1AWDA 5AUIA 3TEYA 4WH4A 4KKIA 2V3NA 1V1PB 4GLSC 4WWMA 2ACZB 2E3TA 2RPVA 4MM3B 1C77A 5C3JB 1N63A 2EELA 2QILA 4OZBA 3W1SA 2BT6A 1TS4A 5BMGA 1T5XD 3I57A 1FNUA 3AEBB 4L23A 2NTSA 3AEGB 4TMAB 5EE3A 5H8YE 3T3NA 1KLUD 4KGTA 2BTEA 1RWSA 4HRSA 3BIID 3CWIA 1C76A 3TEWA 1HQRD 1YN3A 1TZOA 1NI3A 3ZQ4A 5FKAC 3MC0B 3EUB2 2Q5WD 1NENB 5EE9A 4AS1A 2PLPA 3BVGA 3PO0A 3P4QB 1SJED 2LFIA 3WCQA 3NVZA 1JMLA 2JSVX 2BS4B 4EE2A 1GAQB 3AEFB 1QOBA 3BZDB 4KGSA 3VR8B 1CK1A 4US8A 1HXYD 1TS3A 4A55A 2MH7A 1QLBB 2K3UA 3J9CA 2ONQA 2PKOA 2N0SB 1QKZA 3AV8A 4IDIA 3FAHA 3P4RB 2K9XA 1K51A 1IGCA 3CIRB 3R2TA 4P16A 4NAMA 4XWWA 1ET9A 2BBCA 2MEKA 2KACA 2QIEB 2W3RA 2AQ2B 5T8IA 2R61A 2VZKB 2BS2B 1SEBD 5BMHA 2TSSA 1YQ4B 5FR3A 2LHEA 3AE2B 4WURA 1HZ5A 1WRIA 1PGAA 1SE4A 3E9SA 1N61A 1ZXIA 3GB1A 4A90A 1V8CA 1E7PB 1UUPA 3N9YC 1XF5L 1NVID 4RFBA 1XLPA 1LO5D 2PIAA 4RGMA 1FIQA 1SE3A 1VJKA 1L4DB 2M19A 2W54A 5BYSA 2WXPA 3Q69A 1L0YB 1C78A 3IAS1 3GS2A 3NS1A 1I4HA 2HTME 1XCQL 4D2KA 5EE1A 3U7ZA 2WXOA 1T3QA 2JU6X 2LHDA 4XE0A 2FE8A 2INPE 3C8YA 1PFDA 2WP9B 2WXMA 3HVDA 2LEKA 3AN1A 3E56A 1K53A 3GP7A 1TJEA 1DGJA 1ET6A 1I4QA 4YTPB 1D5ZC 4US9A 3U4EG 1E0ZA 1L6VA 2KMMA 3LXFA 1A70A 1JWUD 4MT5A 4XDCA 2WS3B 1CZPA 5EE0A 5G5GA 2WXGA 1JQ4A 1Q10A 4FXCA 4GDKB 4C7YA 3AECB 4Q2JA 1PGXA 4O1NA 4USAA 1ZUD2 4NAWB 4JX1C 1BXTA 1V1OA 4WQMA 1JROA 4YWGG 2LJIA 1F2RC 1GOZA 2BYTA 1ZXHA 3MP9A 4YSZB 1L5PA 3BVZA 3W2DA 1HA5A 1ZDXA 4KGRA 2DYOA 1T6BX 1SB3C 2M56B 3P63A 1L0VB 3KWVA 1OQQA 3KWLA 1J7BA 1EWCA 2LUMA 1C4AA 3Q8EA 2OHFA 1DOIA 2N9KA 4YSYB 1DYQA 4DQOC 4A9AA 2MJDA 2SEBD 3EA6A 1WSPA 3EGRA 1DOYA 1TY2A 1VZ7A 1FD6A 1TKEA 2V4IB 2WU2B 1QOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVG C;  1UWM A;  3AMZ A;  2DBY A;  4US8 A;  1SIJ A;  2WQY B;  5MPO A;  2MH7 A;  1QLB B;  2H89 B;  2WDQ B;  2PKO A;  4YXD B;  2N0S B;  1AYF A;  1RM6 C;  1CJE A;  2AX5 A;  1J7C A;  1TYG B;  3AV8 A;  2MJ3 A;  4IDI A;  4YTN B;  2Y5C A;  1FO4 A;  1WYG A;  3FAH A;  3P4R B;  2K9X A;  1GPX A;  2G1E A;  1ZP0 B;  1WWT A;  3CIR B;  2L83 A;  2B76 B;  4KX6 B;  3VRA B;  2WDR B;  2FBW B;  1FXI A;  2QIE B;  2W3R A;  4YT0 B;  1JWA D;  1R7S A;  3NRZ A;  1FFV A;  3VRB B;  1DOX A;  2MJE A;  3AE3 B;  3AE7 B;  2W3S A;  1VLB A;  1TKG A;  2BS2 B;  3AE8 B;  4ZOH C;  4C80 A;  1XO3 A;  1TKY A;  3FC4 A;  2W55 A;  5H92 C;  1E9M A;  1YQ4 B;  4YSX B;  1PDX A;  3AE2 B;  1PUT A;  1J7A A;  1WRI A;  1FRR A;  1N61 A;  4HRO A;  1ZXI A;  1XLN A;  1SF0 A;  4C7Z A;  3VR8 B;  1V8C A;  1E7P B;  3W5U B;  1JAL A;  1FM0 D;  1RFK A;  4ZHO A;  4ITK A;  2KAJ A;  1NVI D;  1XLQ A;  2K22 A;  3P4S B;  1OQR A;  3AED B;  3SFD B;  1QOG A;  1QOF A;  1XLP A;  2PIA A;  1FIQ A;  1ROE A;  1VJK A;  1N60 A;  5C2T B;  2M19 A;  2JX5 A;  2W54 A;  3AEE B;  3W5V B;  1NYQ A;  1QF6 A;  1VDV A;  3NS1 A;  1OFF A;  3B2F A;  2HTM E;  1E10 A;  1F0Z A;  1N5X A;  5EE1 A;  4ZHP A;  2QJL A;  1FFU A;  5GXG B;  1B9R A;  2CJN A;  1ZOY B;  3P4P B;  1T3Q A;  1XLO A;  1YJI A;  1N5W A;  3VR9 B;  1NYR A;  4N59 A;  4JWU C;  1PFD A;  1FXA A;  2WP9 B;  1JW9 D;  2WDV B;  5AUI A;  1AWD A;  4N6E B;  1JWB D;  3NVY A;  1QT9 A;  3B9J A;  1JRP A;  2L52 A;  2LEK A;  3AN1 A;  3HRD D;  1TJE A;  1DGJ A;  3HVZ A;  1WXQ A;  1KFY B;  1V97 A;  4YTP B;  4US9 A;  4WWM A;  2ACZ B;  3NVW A;  1E0Z A;  1L6V A;  3ZYY X;  2E3T A;  2KMM A;  3HUI A;  3ETR A;  5C3J B;  2EKI A;  1A70 A;  3LXF A;  1N63 A;  2K5P A;  2WS3 B;  3AB5 A;  1CZP A;  3AE9 B;  1WGK A;  5AUK A;  4N58 A;  5EE0 A;  2BT6 A;  5G5G A;  3AE1 B;  1FMA D;  1JQ4 A;  4FXC A;  3AEB B;  4C7Y A;  3AEC B;  4USA A;  1N62 A;  1ZUD 2;  3AEG B;  2JQR B;  3DWG C;  5EE3 A;  4JX1 C;  5G5H A;  1I7H A;  3DWM A;  2BS3 B;  3P1M A;  4WQM A;  5H8Y E;  1JRO A;  3SR6 A;  3L4P A;  1RWS A;  4HRS A;  1L6U A;  3BII D;  3CWI A;  3NVV A;  3RPF C;  4YSZ B;  1NI3 A;  1L5P A;  1KRH A;  4P6V F;  3LB8 C;  1YJJ A;  3AEA B;  3EUB 2;  2Q5W D;  1NEN B;  1KF6 B;  1SB3 C;  1E6E B;  2M56 B;  1IUE A;  1NEK B;  2PVO D;  3P63 A;  5EE9 A;  2CJO A;  1L0V B;  2WU5 B;  3B2G A;  3PO0 A;  1RYJ A;  1OQQ A;  3AE6 B;  3KWL A;  2WLB A;  1J7B A;  2CU3 A;  3ABV B;  3AE4 B;  3P4Q B;  2OHF A;  2DWQ A;  3WCQ A;  1DOI A;  3NVZ A;  4LTU A;  1EWY C;  3AE5 B;  2BS4 B;  4YSY B;  4YTM B;  2H88 B;  4A9A A;  2MJD A;  1FRD A;  1YQ3 B;  3SFE B;  3AH7 A;  4JWS C;  3W9C B;  1GAQ B;  3AEF B;  1QOB A;  3AM9 A;  1DOY A;  1TKE A;  2WU2 B;  1QOA A; 
#chains in the Genus database with same CATH topology
 3L08 A;  1F77 A;  5MPO A;  2WQY B;  4L1B A;  3KUZ A;  3QAR A;  2NVU I;  2LXC A;  2AX5 A;  4ARI A;  2PJH A;  2KTR A;  2Y5C A;  4RGO S;  4KSL C;  3TCA A;  1E7U A;  2FBW B;  3IT4 B;  4QAY A;  2A5U A;  2N7E A;  4A20 A;  2PPH A;  1CMX B;  2D10 A;  4BBN F;  4NJ7 A;  1F9J A;  1VCB A;  2O6V D;  4JIO U;  1WR1 A;  1QQR A;  2E6X A;  2NMQ A;  4WJN A;  3V3X A;  3QC8 B;  4ZDV A;  3VUX A;  4ICU A;  2J52 A;  4BAX A;  2ZPN A;  3B2F A;  3VQI A;  1N5X A;  2J7Q B;  4B9K A;  4DBG A;  4FUL A;  2WXL A;  4MJS B;  1I42 A;  5AZF A;  2L52 A;  2XK5 A;  4TQ0 A;  1R4M I;  4RH6 A;  4W9J A;  1AAR A;  3SU8 X;  4N58 A;  2KNB A;  1OQY A;  3ZJT A;  1FMA D;  5JHB A;  3W1S C;  2JZP A;  1WR6 E;  2SAK A;  3O13 A;  3BWU D;  2BYV E;  3L4P A;  1FNV A;  2KJH B;  2LAS A;  5GMV A;  3DPD A;  4P6V F;  3OJ4 B;  1HTO A;  1KF6 B;  2UU7 A;  2KWD A;  2NR2 A;  4FHK A;  2LMC A;  4H2A A;  3PRZ A;  1SE2 A;  5BYR A;  4RF0 A;  2IJ0 A;  4RGT A;  4AWJ A;  4B0E A;  4JWS C;  4OVU A;  2FUG 1;  3JYU A;  1C9F A;  1RM6 C;  2KQ4 X;  1UH6 A;  3H8H A;  1WWT A;  3DHH C;  3DVN V;  3VXW A;  1TTN A;  1D5M C;  2ZW1 A;  5DPS A;  2MBB B;  2N7D A;  3JSV B;  1XCT L;  4RM9 A;  4B95 A;  1BML C;  5CHW A;  2DYB A;  3ZNZ B;  3IT6 B;  1UZX B;  3NUH B;  4HRO A;  4MAC A;  2NBU A;  2WXK A;  3UQA A;  5IP4 D;  3H9D A;  1RFK A;  1SSN A;  4ZHO A;  2K22 A;  2OED A;  3BY4 B;  1C1Y B;  4M8M A;  3R2I A;  4NJ6 A;  4JLC A;  1WXA A;  3KLS X;  2QJL A;  1K50 A;  2LGX A;  2KVZ A;  1YJI A;  3L13 A;  4BZA A;  4JWU C;  4K3C A;  3R7Q A;  2FCQ A;  2BF8 B;  2KX0 A;  3DBH I;  2DZI A;  2MBE A;  3Q8C A;  2ZJD A;  2JRI B;  3NVW A;  3ETR A;  3WAL A;  2O2V B;  3NJT A;  4ZYS A;  5AUK A;  5HI1 A;  5BO4 B;  2PW9 A;  1GNU A;  1JWM D;  2K8C A;  4URK A;  4F1S A;  2K39 A;  3NVV A;  2KC2 A;  1XXG A;  4AQ7 A;  1WGG A;  4K7S A;  1KRH A;  3TEX A;  3AEA B;  3RNF C;  1E6E B;  3BK2 A;  5DPR A;  2CJO A;  3ZLZ A;  1IP9 A;  1K52 A;  4A3P A;  2DWQ A;  4OZC A;  2G4S A;  2C5L C;  3ZNI D;  4DHZ B;  3AH7 A;  1VZ8 A;  4KIK A;  2PVG C;  3AMZ A;  3ONS A;  3NZS A;  2ZNV C;  2MSE D;  1TYG B;  3WAO A;  3M62 B;  1PYW D;  4P1B C;  1WMH A;  2ON8 A;  4BFR A;  3PLV A;  3NZ3 A;  2QEJ C;  2KFK B;  5HFY A;  2IO2 B;  2KMA A;  2MJE A;  3V62 A;  4ZOH C;  1XO3 A;  1IBX B;  1IYF A;  4HXD A;  4RGN A;  2G45 B;  3PRE A;  2MP2 B;  2CKH B;  1WM3 A;  1MG8 A;  5C23 A;  2BW2 A;  2N9L A;  3PZ8 A;  1OQR A;  3AED B;  4ICV A;  2ZCC A;  2KN4 A;  1GC7 A;  4OVZ A;  3AUL A;  2WGS A;  3HM6 X;  3KW5 B;  1I4G A;  2D5G A;  2C7M B;  3RNE C;  2RGF A;  1XLO A;  3HM3 A;  4NJC A;  4BKS D;  3DHI C;  4JGH B;  3K9O B;  1YIW A;  1WM2 A;  2KT7 A;  1V1P B;  1Q5W B;  3Q3M C;  3ZDT A;  4E71 A;  4JQW C;  3A9J B;  4MM3 B;  1N63 A;  3PLU A;  2QIL A;  5BMG A;  3I57 A;  3UQB A;  3AEG B;  5H8Y E;  3T3N A;  1KLU D;  4HRS A;  3BII D;  1C76 A;  2N1V A;  2I1K A;  2JRH A;  2LRU A;  3MC0 B;  2DHZ A;  2WDT B;  5EE9 A;  3IG3 A;  3BVG A;  3A4S C;  2W9N A;  2FIF A;  2HJ8 A;  3QA8 A;  3TJP A;  2D11 A;  1LXD A;  3D32 A;  4KGS A;  1CK1 A;  4US8 A;  4XX5 A;  1T0R C;  4LDT D;  4ANU A;  3J9C A;  2ONQ A;  3VHT C;  2N0S B;  4FN2 A;  1QKZ A;  5IA7 A;  4HDQ A;  2JZZ A;  4KV2 A;  2L0F A;  3R2T A;  2BBC A;  2QIE B;  2AQ2 B;  2VZK B;  2BS2 B;  1SEB D;  3RNA C;  1WE6 A;  3NHE B;  3Q3J A;  2MA9 B;  1HZ5 A;  4ZRI A;  1ZXI A;  4A90 A;  2JF5 A;  1V8C A;  1NVI D;  4RFB A;  3MC8 A;  1E8Y A;  2JY6 A;  3SHQ A;  4RGM A;  3A33 B;  3ZXV A;  4IM3 A;  2M19 A;  2W54 A;  5BYS A;  2WXP A;  2KLG A;  3Q69 A;  1C78 A;  2IO0 B;  3UF8 A;  3WIM A;  3NS1 A;  3ZKJ C;  1I4H A;  2HTM E;  3IBE A;  4D2K A;  2J0K A;  2V9H A;  2XBB C;  3DVG X;  3RI7 C;  3C8Y A;  3EEC A;  2WP9 B;  4GDK A;  2A4Z A;  3HVD A;  1SIF A;  3E56 A;  1DGJ A;  2OJW A;  1TT5 B;  4F8C B;  4WJO A;  3TMP B;  3LXF A;  1CZP A;  4LCD E;  1WIA A;  2WXG A;  1JQ4 A;  4M02 A;  3I3T B;  4USA A;  1YD8 U;  3ZRC A;  3A1Q A;  1V1O A;  1JRO A;  2BKR B;  2L8J A;  1GOZ A;  1ZXH A;  4ANV A;  1L5P A;  1HA5 A;  2DYO A;  4IM0 A;  2Y5B B;  4C4V A;  5DCN A;  3GE3 C;  3KWV A;  2RSU A;  1WYW B;  2IZV B;  3Q8E A;  2OHF A;  3C0R B;  1DOI A;  4YSY B;  1DYQ A;  4KZ0 A;  4DQO C;  1WX9 A;  4XYC A;  1TY2 A;  3ALB A;  2WU2 B;  4HLE A;  4NQK E;  1YJ1 A;  5HKH A;  2H89 B;  3PPA A;  3UIO B;  1AYF A;  4WAF A;  4HWI B;  3ZJV A;  5L83 A;  2GLS A;  2JVC A;  3H7S A;  2L32 A;  4HJG E;  2VH2 A;  2GI9 A;  4E74 A;  1WGY A;  4XWT A;  3Q8F A;  2R2O A;  3VRB B;  1DOX A;  3ECI A;  2BVC A;  1KLV A;  4NNJ B;  1VR9 A;  1XEE A;  4KDL B;  3ML9 A;  3K9P B;  1QIL A;  4ANX A;  3ZJU A;  2KXJ A;  3P42 A;  2AL3 A;  2MWS B;  1D6E C;  4NPN A;  1OFF A;  2BB5 A;  3MHS D;  4ZHP A;  3Q2A C;  2D3C A;  1FFU A;  2M17 A;  3VUY A;  1MHX A;  1EO6 A;  1F2R I;  2GMI C;  1I4X A;  1QT9 A;  2ZEQ A;  3RMK C;  4DXG A;  1EUV B;  5C1Z A;  1YX6 B;  5LXI B;  4CHK A;  1ZDV A;  2YEP B;  2MHJ A;  1H8C A;  2K5P A;  3AE9 B;  1M4V A;  3AE1 B;  5D3D A;  2AYO B;  4CQN A;  4EOY A;  2WXN A;  3H1U A;  4EZJ A;  2Z0E B;  2QDF A;  4ASW C;  3U7D A;  1V6E A;  2B3A A;  2KYW A;  4M00 A;  1WF9 A;  1YN4 A;  1S1Q B;  2KQS A;  4DWF A;  1IUE A;  2WU5 B;  3UI3 A;  3AE6 B;  3ABV B;  3AE4 B;  1EWY C;  4K7U A;  3BVM A;  4G0N B;  4UDU C;  2LVQ A;  1PGB A;  2CR5 A;  3LJ3 A;  3U2S C;  4HPM B;  2WNM A;  1J7C A;  3QX1 A;  2MJ3 A;  2IBI B;  1JWS D;  1ENF A;  1ZP0 B;  2KZR A;  4YL8 A;  3FIL A;  2QHO A;  1FXI A;  4EFO A;  1V1P A;  3ZGZ A;  4S17 A;  2WHI A;  1WJ6 A;  2DNF A;  2PTL A;  1T0Y A;  1B1Z A;  3WAN A;  4GXB A;  4AP4 C;  1SXT A;  1FM0 D;  3LDZ E;  4ITK A;  3IXS A;  3SFD B;  4L2Y A;  2PEA A;  1NYQ A;  1SGH A;  1VDV A;  2MW5 A;  4M0W B;  4WIP A;  3VR9 B;  5EDS A;  2CS4 A;  1OEY J;  1V86 A;  2LRW A;  4N6E B;  4OW0 A;  3B9J A;  3CST A;  2LI5 A;  4GMV A;  3HVZ A;  4BKS A;  4W9G A;  4ARC A;  5KHO A;  4WJQ A;  1XT9 B;  1WGK A;  2UYZ B;  3M63 B;  3R8B A;  4MSQ B;  1UGM A;  2KDI A;  1I7H A;  3DWM A;  4JE3 B;  2KD0 A;  3A9K B;  4ZRP A;  1L6U A;  4I6P A;  2LXA A;  1FNW A;  3SDL C;  3Q14 C;  3LB8 C;  1ZE3 D;  4MGY E;  2WXH A;  1VZ6 A;  1FCL A;  3DBR B;  1NEK B;  1TY0 A;  3T8M A;  5AZG A;  2BKF A;  4LTU A;  3AE5 B;  3URY A;  1YQ3 B;  4W9H A;  2KWU B;  3OG5 A;  4PT5 A;  1F52 A;  2WDQ B;  2DEN B;  4MGI E;  2IYD B;  1JRU A;  1UBQ A;  3RN9 C;  1WXS A;  1C4C A;  1C79 A;  2AL6 A;  3AE3 B;  4C80 A;  3BYT B;  1IGD A;  2W55 A;  2X8X X;  3NG0 A;  4KVG B;  4BOZ B;  2DZM A;  2KDF B;  5BMI A;  2KQ7 A;  2LGD A;  3UIP B;  1GG3 A;  3B0A A;  2L3Z A;  4HJK A;  1YX5 B;  2LGI A;  4WAA A;  2MRP A;  2JYE A;  3ML8 A;  4C56 C;  4W9F A;  4GDL B;  1F0Z A;  2KFJ A;  4PYZ A;  2HE7 A;  1ZOY B;  4HKZ E;  2MQJ A;  5J2R A;  2L1A A;  4N59 A;  2LJ5 A;  4DHJ B;  2RDG A;  2WDV B;  1AWD A;  2XEW A;  4K7W A;  5TR5 A;  4WWO A;  5G55 A;  4AJW A;  1WGR A;  2AEH A;  3V6E B;  2BT6 A;  1GC6 A;  3MC9 A;  4L23 A;  3NS8 A;  1TZ1 A;  5CHF A;  5EE3 A;  1E90 A;  1NI2 A;  4KGT A;  2BTE A;  1RWS A;  2KDE B;  2WWZ A;  3CWI A;  3TEW A;  4DHZ E;  1YN3 A;  1NDD A;  1TZO A;  2MX2 A;  2KX3 A;  3AI5 A;  3EUB 2;  1NEN B;  2GBR A;  3ZNH B;  3P4Q B;  1SJE D;  2LFI A;  1JML A;  2KWV B;  3AEF B;  3BZD B;  1N6Z A;  2RR9 A;  3HIZ A;  2LZ6 A;  2M8S A;  1HXY D;  4A55 A;  2MH7 A;  3OJ3 A;  2K3U A;  3MTN B;  3V6C B;  3PZD A;  2L0T A;  1E8Z A;  1IGC A;  4G11 A;  4P16 A;  3DHG C;  1ET9 A;  2MEK A;  1T0Q C;  3WAP A;  3N32 A;  3PHW B;  3M95 A;  2NPT A;  2V1Y A;  5BMH A;  1YQ4 B;  3N3K B;  2KK8 A;  5FR3 A;  1R4M B;  3AE2 B;  2FCM A;  4DDG D;  4IWO A;  1SE4 A;  3E9S A;  1N61 A;  5G2N A;  3GB1 A;  1KM7 A;  1E7P B;  3N9Y C;  1WJN A;  4BKG A;  4W9I A;  1FIQ A;  1SE3 A;  1VJK A;  2PE9 A;  2DAF A;  3ZVV A;  3FKY A;  4DDI D;  3U7Z A;  4MH0 E;  2WXO A;  4AOF A;  2JXX A;  1T3Q A;  2JU6 X;  4XGA B;  4GGQ A;  2LHD A;  4XE0 A;  2FE8 A;  2INP E;  2KVR A;  1PFD A;  3TL5 A;  2WXM A;  3QQ8 B;  2LEK A;  3AN1 A;  1ET6 A;  1H4R A;  2C7H A;  2HJ1 A;  4M01 A;  4MGZ E;  3WAM A;  1D5Z C;  1Z5S B;  3EFU A;  3U4E G;  1E0Z A;  1ZGU B;  4MT5 A;  2ASQ A;  3L54 A;  2K1F A;  3ZW3 A;  4FJV B;  4EKU A;  1PGX A;  3H7P A;  4NAW B;  4W9L A;  1BXT A;  4YWG G;  4A3O A;  2M0X A;  2RPQ A;  3W2D A;  1WH3 A;  4KGR A;  1T6B X;  2BYE A;  4P7I A;  1SB3 C;  2KO3 A;  3P63 A;  3KUC B;  3ZIM A;  3IVF A;  3VTW A;  2KJR A;  2LVP A;  1VZ7 A;  1FD6 A;  4IC7 B;  1TKE A;  3PZ7 A;  3UGB B;  1Z2M A;  2M1M A;  1MHH E;  5FR6 A;  4OZA A;  5HG2 A;  5LLI A;  1CJE A;  1WJ4 A;  1WYG A;  2YEP F;  4I6L B;  2G1E A;  1JCK B;  1T0S C;  5D7G A;  2K6D B;  4AJY B;  2I2Y A;  1JWA D;  3DBL I;  2ZNV B;  3NRZ A;  1RAX A;  3DCG A;  4LK0 M;  3DBH B;  3AE8 B;  5H92 C;  3TBL D;  2KTR B;  2RDB C;  2CHW A;  2V4L A;  3TEZ A;  1I4R A;  3EC8 A;  4C7Z A;  3W5U B;  2KAJ A;  2GBN A;  1E8W A;  1V81 A;  4X57 B;  4MEL A;  4MJS A;  2JX5 A;  4KKJ A;  1P7F A;  1TS2 A;  3W5V B;  1PQS A;  2D2Q A;  1E10 A;  4W9D A;  2GOW A;  5AZH A;  1VRA B;  1NYR A;  1R4N I;  1M94 A;  4MEM A;  2N1W A;  4PS8 A;  4AUQ C;  3RNG C;  3KUD B;  1P9D U;  5D2M B;  2EKI A;  4K3B A;  4LLG M;  3BIN A;  1TIF A;  3IAM 1;  5J17 A;  2XK5 B;  1UGJ A;  2RMM A;  1U4A A;  4KDI C;  1UNS A;  2IPK D;  1TS5 A;  3I5J C;  2LD9 A;  3B1L X;  2KDM A;  1WE7 A;  5E6O A;  5TSS A;  3RNB C;  3ZYY X;  4B0M A;  3TUO A;  2OOB B;  1FEH A;  2BWF A;  1E5W A;  2CU3 A;  2BGF A;  1KH0 A;  1MVK A;  3SEB A;  2NBW B;  3C19 A;  2LVO A;  2NTT A;  2GBK A;  3AU5 A;  2DYM A;  4RMA A;  2XN9 C;  1P98 A;  3U52 E;  2DBY A;  2IDY A;  3APF A;  3JSV A;  1UF0 A;  5D3I B;  2B76 B;  2C60 A;  3Q6B A;  2ZVN A;  4K1R B;  1R7S A;  2FID A;  1UBI A;  1VLB A;  4HKQ A;  1TKY A;  4R3D A;  2GRI A;  3I63 C;  1PDX A;  3RFZ B;  2J4X A;  2FUH B;  2K8H A;  4JPS A;  4HDO A;  1XLN A;  1SF0 A;  3QJZ A;  1JAL A;  2V3S A;  1FCC C;  2BB6 A;  4TSS A;  1UD7 A;  1EU4 A;  1L7Y A;  1N60 A;  3N1Z C;  1LFD A;  3AEE B;  3V61 A;  2FAZ A;  2FCS A;  4NQL B;  3L0W B;  4LJO B;  2NBV B;  5GXG B;  3IFW B;  1L4Z B;  1V2Y A;  4OHJ A;  2IGD A;  1WGH A;  2O2V A;  1GB1 A;  3HHM A;  1KFY B;  2J42 A;  1WJU A;  2WXR A;  3HUI A;  1MPE A;  2N9E B;  1QZE A;  3AB5 A;  2M0A A;  1LQB A;  1N62 A;  4J6I A;  5G5H A;  3P1M A;  3SR6 A;  2J0M A;  4DK5 A;  3PGE A;  5I4D A;  4DXF A;  1MJD A;  4CO7 A;  1P7E A;  1YJJ A;  4IG7 B;  3KYD D;  4I6N B;  2IY0 B;  2WX1 A;  3B2G A;  1C4P A;  1UEL A;  1RYJ A;  3PHX B;  5IKC M;  2IGH A;  4W9C A;  2WXF A;  3SFE B;  1FRD A;  3V05 A;  2LGY A;  1AW7 A;  2BS3 B;  2J53 A;  4GB9 A;  4J3O D;  2KLC A;  2KFK A;  2V0G A;  1IPG A;  4YXD B;  3NZU A;  1IBX A;  4IW0 A;  1FO4 A;  1YN5 A;  2CU1 A;  3OWE B;  2IO1 B;  2DZK A;  2BPS A;  4ACF A;  2MP2 A;  3AU4 A;  3I9V 1;  3OLM D;  4KIK B;  4N9F 4;  2IY1 B;  1FFV A;  4S0R A;  3FC4 A;  2FCN A;  1PUT A;  1WMH B;  4RNA A;  2MLB A;  4GN1 A;  4EUT A;  1HE8 A;  4GOC A;  3P4S B;  3PT2 B;  1SE9 A;  2X38 A;  3MHZ A;  3KYC D;  3L17 A;  2C9W B;  4BKT A;  1STE A;  1V5O A;  2CHZ A;  3MFG A;  1OEY A;  5IOI A;  3ZUN A;  1N5W A;  2KAN A;  3A9J A;  4MM3 A;  1JW9 D;  5AUI A;  3M3J A;  3TEY A;  4HVB A;  4WH4 A;  2V3N A;  5JH5 C;  1F1H A;  3VTU A;  2RPV A;  1C77 A;  1BT0 A;  2LWP A;  4OZB A;  3ENE A;  3AEB B;  3KVF B;  2NTS A;  2LUE A;  4TMA B;  3SD5 A;  1P0R A;  4KSK C;  1HQR D;  2Z0D B;  4LNF A;  1HTQ A;  3ZQ4 A;  5FKA C;  1ZW7 A;  3GE8 C;  4AS1 A;  4HPL B;  3WCQ A;  2JSV X;  2BS4 B;  5DPT A;  3X0W A;  3R66 C;  1QOB A;  4EZL A;  3VR8 B;  2L7R A;  3R3M A;  4FJZ A;  1QLB B;  5D94 A;  4TV3 A;  4P1C C;  3AV8 A;  4PK1 A;  5L95 C;  3P4R B;  3CIR B;  4MSM B;  5DPW A;  5KHQ A;  2D3B A;  5J18 A;  2N9X A;  2W3R A;  2TSS A;  2AWT A;  1I35 A;  1WX7 A;  2LHE A;  3APD A;  4WUR A;  1WRI A;  2JT4 B;  3KH0 A;  2PE6 B;  3ZO5 B;  4DHJ D;  4E3C A;  3H6N A;  1LO5 D;  1L4D B;  1XQQ A;  2N4F A;  2IO3 B;  3DOW A;  1RLF A;  3V60 A;  4C00 A;  3IAS 1;  3GS2 A;  5EE1 A;  2REX A;  4NY0 A;  2KWC A;  4IWQ A;  4IM2 A;  4EEW A;  2VRR B;  4PS3 A;  2O6V B;  1K53 A;  3GP7 A;  4FBJ B;  3N1X C;  1I4Q A;  4YTP B;  3QHT A;  3QAQ A;  4PS7 A;  2KMM A;  4HCN B;  1A70 A;  1JWU D;  4XDC A;  2QCZ A;  1J0G A;  2EMS A;  5G5G A;  4IUM B;  2QC8 A;  1Q10 A;  4FXC A;  4GDK B;  3Q3F A;  4Q2J A;  3VH4 B;  3NY5 A;  2MCN B;  4WQM A;  3L16 A;  2LJI A;  1LM8 B;  2IND C;  3RUI B;  1ISN A;  4MGK E;  3MP9 A;  4FAD A;  4YSZ B;  2NS5 A;  4HCP B;  3ZTC A;  1ZDX A;  3GOE A;  3RYT A;  2K8B A;  4BVU C;  1J7B A;  1EWC A;  2LUM A;  3A1Q B;  3WA0 A;  3CMM B;  2SEB D;  3EGR A;  4BBN C;  2V4I B;  1QOA A;  1RFA A;  4C4V B;  1I4P A;  4YTN B;  1V80 A;  3QIJ A;  2HD5 B;  3DQV A;  1J8C A;  1TBE A;  1FPY A;  4KX6 B;  4TQ1 A;  5CTR C;  1OGW A;  3OAW A;  4WJP A;  2JZ3 B;  2L00 B;  1LGR A;  2Y5P A;  4HK2 A;  3A4R A;  3O65 B;  2RDH A;  1D5X C;  1XD3 B;  4IWP A;  4PYU A;  3DVN U;  3ZDM C;  4ANW A;  1SBB B;  1QOG A;  1ROE A;  3MJW A;  1E8X A;  4LJP B;  1WY8 A;  1NBF C;  1QF6 A;  2G9H D;  3X23 A;  2CJN A;  1YQB A;  3QK0 A;  1Q1O A;  2NCN A;  1FXA A;  2R2Q A;  3NVY A;  4REZ A;  1JRP A;  2WXQ A;  3NOB A;  5IO9 A;  1V97 A;  2K6Q A;  2Y3A A;  1SJH D;  4MH8 A;  4A8X C;  3ZNG C;  5LNK 1;  1MI0 A;  4TUU A;  4MDK E;  3T3O A;  2M4N A;  2I38 A;  3B08 A;  2YVC A;  4WQO B;  2EMT A;  2JQR B;  2K0P A;  3RZW C;  1BUI C;  1KLG D;  1P1A A;  2YLM A;  4JL9 A;  2WYQ A;  2I1J A;  2N9P C;  3DVG Y;  4ZRK A;  1GB4 A;  2PVO D;  1WZ0 A;  2MBO A;  1A5R A;  2H88 B;  3S2A A;  4RM8 A;  1UWM A;  3Q3O C;  3N30 A;  1SIJ A;  4IOI E;  3GZN I;  1WXV A;  2K25 A;  5FK9 C;  2DZJ A;  2PMV A;  2DLB A;  1OTR B;  1GPX A;  4WWP A;  2L83 A;  5E6J A;  3PRM B;  3VRA B;  4BOS C;  1KTK A;  2D3G A;  2GB1 A;  1ACC A;  4YT0 B;  2IGG A;  1G6J A;  2GBJ A;  3N1Y C;  1TKG A;  2N7J A;  3PVL A;  2VZK D;  1HZ6 A;  4YSX B;  4M0W A;  1FRR A;  2HDE A;  3FIL B;  4F7Z A;  2INC C;  2QMT A;  2LGS A;  3RT3 B;  1QOF A;  4ZRJ A;  2MBH A;  3PTF C;  5C2T B;  1VD2 A;  4II3 B;  4GU2 A;  1Y56 A;  3N20 C;  2INN E;  2OJR A;  3RNC C;  1J19 A;  3P4P B;  3QCA A;  4B6W A;  4RCO A;  1V49 A;  2Z59 B;  4W9K A;  3Q3N C;  4EZK A;  1YNT E;  2MBQ A;  1JWB D;  2VH1 A;  3HRD D;  2JWU A;  5JZE B;  2JYT A;  1WXQ A;  1UWX A;  4K81 A;  3A9K A;  1AN8 A;  2XNA C;  3BK1 A;  4LNI A;  2JWZ A;  1D4B A;  5E6P A;  4HPP A;  3JW0 X;  5BYQ A;  3Q8B A;  1CQV A;  4HEA 1;  3DWG C;  1EF5 A;  5IN7 A;  1GUA B;  4XDD A;  2V3P A;  3MJ5 A;  1ZKH A;  1S3S G;  2G4D B;  4TKN A;  2KDB A;  4RF1 A;  4W9E A;  1YMH E;  3RPF C;  5CHV C;  2AQ3 B;  2W82 A;  2ZW0 A;  4LNN A;  5JXV A;  1ZPS A;  3JVZ X;  1EM7 A;  1V9J A;  3EHV A;  2WLB A;  4WWN A;  2JPH A;  4YTM B;  1E7V A;  3W9C B;  3AM9 A;  4LNK A;  5E6N A;  3PS6 A;  3CSF A;  3DDC B;  3KQ4 A;  2CHX A;  3Q8A A;  4G3X B;  2BQQ A;  2DX5 B;  2O6V A;  2WDR B;  4ZYN A;  2ZZP B;  3IHP C;  3AE7 B;  2W3S A;  1HEZ E;  4IKG A;  1L0X B;  5D6J B;  1E9M A;  4GDL A;  2QSD A;  3LYY A;  2ICI A;  1MG4 A;  1FXT B;  3RCZ A;  4LDT B;  3VAW A;  1K8R B;  1J7A A;  2WXJ A;  3TSS A;  2L76 A;  1XLQ A;  4ZRQ A;  1EU3 A;  4XZ4 A;  2KJ6 A;  3VTV A;  3GZN B;  3BYY B;  2WXI A;  3ZRF A;  4FLH A;  5HHD G;  3UIN B;  2Z8L A;  3AXC A;  2AQ1 B;  2J0J A;  3PRP B;  1ESF A;  1B9R A;  3DBS A;  3VUW A;  3APC A;  3VDZ A;  2UWQ A;  4A6Q A;  2BWE S;  4NZL B;  2JXT A;  3P2B A;  4LNO A;  4KKI A;  4FHJ A;  4M8N A;  4GLS C;  3W1Y A;  4WWM A;  3U30 A;  2ACZ B;  2E3T A;  5C3J B;  1TGZ B;  2EEL A;  3R7R A;  3W1S A;  1TS4 A;  3RUL A;  1T5X D;  1FNU A;  2WX0 A;  2KN5 A;  1RRB A;  3RZF A;  3RD2 A;  4II2 B;  3DBL B;  1NI3 A;  2Q5W D;  2PLP A;  3PO0 A;  2KOX A;  3NVZ A;  4EE2 A;  1GAQ B;  3T9L A;  5IAA C;  1WI0 A;  1TS3 A;  2KMC A;  2PKO A;  2RD0 A;  1X1M A;  4IDI A;  3FAH A;  2K9X A;  1K51 A;  2L05 A;  2G3Q B;  4NAM A;  4XWW A;  1Q0W B;  1R4N B;  2KAC A;  5T8I A;  2R61 A;  3VFK A;  2GBM A;  3DBR I;  3L10 B;  1PGA A;  1WX8 A;  3U8Z A;  4G50 A;  3VVW B;  1UUP A;  4KZC A;  1XF5 L;  2KC1 A;  1WRD B;  1XLP A;  2BYF A;  2NPT B;  2PIA A;  2DAJ A;  1L2N A;  1L0Y B;  4GIV A;  3TIX A;  1XCQ L;  2JUO A;  2D3A A;  3ZTD A;  1WXM A;  4GSW A;  2KHW B;  3CF6 E;  5LXH A;  2HTH A;  1KJT A;  3EFC A;  2ZVO A;  1TJE A;  4NAW A;  3QWZ B;  4US9 A;  1Y8R C;  4FJY A;  2EKE C;  1L6V A;  5AEK B;  3VH3 B;  3PSE B;  2KKC A;  2WS3 B;  2C7N B;  5EE0 A;  1WZ3 A;  1P3Q U;  1MFW A;  3AEC B;  4C7Y A;  4O1N A;  1C3T A;  1ZUD 2;  1WGD A;  2FNJ B;  3ZXR A;  4OVV A;  4JX1 C;  1KOT A;  3PV1 A;  1F2R C;  1GJZ A;  2BYT A;  2ZCB A;  3BVZ A;  5JHA A;  2KTF A;  2M56 B;  1YOV B;  1L0V B;  4FA6 A;  3KWL A;  3H7P B;  1OQQ A;  1V5T A;  3HK0 A;  1C4A A;  4XC2 A;  2N9K A;  5CX3 A;  4A9A A;  2MJD A;  4CYE A;  1WFY A;  3EA6 A;  1WSP A;  1D3Z A;  1EF1 A;  2D07 B;  1DOY A;  4DXA B;  2ZPY A; 
#chains in the Genus database with same CATH homology
 1F77 A;  5MPO A;  2WQY B;  1MHH E;  4L1B A;  2H89 B;  4OZA A;  5HG2 A;  1I4P A;  1AYF A;  4WAF A;  1CJE A;  2AX5 A;  4ARI A;  3ZJV A;  4YTN B;  2Y5C A;  1WYG A;  2YEP F;  4RGO S;  2G1E A;  1JCK B;  2L32 A;  4HJG E;  2GI9 A;  4KX6 B;  4XWT A;  4TQ1 A;  2FBW B;  5D7G A;  3Q8F A;  2I2Y A;  1JWA D;  3IT4 B;  3VRB B;  3NRZ A;  1DOX A;  4LK0 M;  3AE8 B;  2Y5P A;  5H92 C;  2RDH A;  1D5X C;  3TEZ A;  1I4R A;  1VR9 A;  1XEE A;  4C7Z A;  3W5U B;  2KAJ A;  1SBB B;  1QOG A;  1ROE A;  1QIL A;  1QQR A;  2E6X A;  2NMQ A;  3V3X A;  2JX5 A;  4KKJ A;  1P7F A;  1TS2 A;  3ZJU A;  3P42 A;  3W5V B;  1D6E C;  1QF6 A;  2J52 A;  1OFF A;  2BB5 A;  2G9H D;  3B2F A;  1E10 A;  3VQI A;  1N5X A;  4ZHP A;  1FFU A;  2CJN A;  1VRA B;  1MHX A;  1NYR A;  2WXL A;  1FXA A;  1F2R I;  3NVY A;  1I4X A;  1QT9 A;  4REZ A;  1JRP A;  2L52 A;  4DXG A;  2WXQ A;  4TQ0 A;  1V97 A;  2Y3A A;  1SJH D;  4MH8 A;  4A8X C;  4RH6 A;  5LNK 1;  1MI0 A;  1ZDV A;  2YEP B;  3T3O A;  2EKI A;  4LLG M;  2K5P A;  3AE9 B;  1M4V A;  4N58 A;  3ZJT A;  2I38 A;  1FMA D;  3AE1 B;  5D3D A;  4CQN A;  3IAM 1;  2WXN A;  2JZP A;  1UGJ A;  2JQR B;  2K0P A;  2RMM A;  2SAK A;  3O13 A;  1BUI C;  1KLG D;  3BWU D;  3L4P A;  1UNS A;  1FNV A;  1TS5 A;  2IPK D;  2KDM A;  5TSS A;  4P6V F;  1GB4 A;  1YN4 A;  1KF6 B;  2KWD A;  4H2A A;  3ZYY X;  1IUE A;  2LMC A;  2PVO D;  4B0M A;  2WU5 B;  3TUO A;  1FEH A;  3UI3 A;  3AE6 B;  1SE2 A;  3ABV B;  2CU3 A;  3AE4 B;  1KH0 A;  1MVK A;  5BYR A;  4RF0 A;  3SEB A;  1EWY C;  2IJ0 A;  3BVM A;  2H88 B;  2NTT A;  4UDU C;  4RGT A;  2DYM A;  4B0E A;  4JWS C;  2XN9 C;  1PGB A;  3U52 E;  1UWM A;  2DBY A;  2IDY A;  2FUG 1;  1SIJ A;  4IOI E;  3U2S C;  1C9F A;  5FK9 C;  1RM6 C;  2WNM A;  1J7C A;  2MJ3 A;  2PMV A;  1JWS D;  2DLB A;  1ENF A;  2KQ4 X;  3H8H A;  1GPX A;  1ZP0 B;  1WWT A;  5D3I B;  2L83 A;  2B76 B;  5E6J A;  3VRA B;  1KTK A;  3FIL A;  1FXI A;  2GB1 A;  1D5M C;  2ZW1 A;  1ACC A;  4YT0 B;  2IGG A;  1R7S A;  1V1P A;  3ZGZ A;  1VLB A;  1TKG A;  4HKQ A;  2N7J A;  1TKY A;  2VZK D;  1XCT L;  1HZ6 A;  4R3D A;  1BML C;  2GRI A;  4YSX B;  1PDX A;  2PTL A;  4M0W A;  3RFZ B;  2J4X A;  1FRR A;  1B1Z A;  3IT6 B;  4JPS A;  3NUH B;  2HDE A;  4HRO A;  1XLN A;  1SF0 A;  2WXK A;  3FIL B;  4MAC A;  2QMT A;  1JAL A;  1FM0 D;  1SXT A;  1RFK A;  1SSN A;  1FCC C;  4ZHO A;  4ITK A;  2BB6 A;  3IXS A;  2K22 A;  4TSS A;  3SFD B;  1QOF A;  1EU4 A;  2OED A;  1N60 A;  5C2T B;  4L2Y A;  3AEE B;  1NYQ A;  1VDV A;  3R2I A;  1Y56 A;  2INN E;  3KLS X;  2QJL A;  1K50 A;  4WIP A;  5GXG B;  1L4Z B;  3P4P B;  4OHJ A;  1YJI A;  2IGD A;  4RCO A;  3VR9 B;  1GB1 A;  4JWU C;  1YNT E;  4N6E B;  1JWB D;  4OW0 A;  3B9J A;  3HRD D;  2JWU A;  3Q8C A;  2JYT A;  3HVZ A;  1WXQ A;  1KFY B;  1UWX A;  2J42 A;  2WXR A;  3NVW A;  4ARC A;  1AN8 A;  2XNA C;  3HUI A;  3BK1 A;  3ETR A;  1MPE A;  1D4B A;  3AB5 A;  4ZYS A;  1WGK A;  5AUK A;  5BYQ A;  2M0A A;  3PZ7 A;  3R8B A;  3Q8B A;  5HI1 A;  1CQV A;  2PW9 A;  4HEA 1;  1N62 A;  3DWG C;  1JWM D;  4XDD A;  2V3P A;  3MJ5 A;  1I7H A;  3DWM A;  3P1M A;  4JE3 B;  5G5H A;  3SR6 A;  4ZRP A;  1L6U A;  5I4D A;  3NVV A;  4RF1 A;  4DXF A;  1YMH E;  1XXG A;  3RPF C;  4AQ7 A;  1FNW A;  1P7E A;  2AQ3 B;  2W82 A;  1KRH A;  2ZW0 A;  3TEX A;  3LB8 C;  5JXV A;  1ZPS A;  1YJJ A;  1ZE3 D;  3AEA B;  2WXH A;  1VZ6 A;  1FCL A;  1E6E B;  3BK2 A;  1EM7 A;  1NEK B;  1TY0 A;  2CJO A;  3B2G A;  1C4P A;  1K52 A;  1RYJ A;  2WLB A;  2DWQ A;  2IGH A;  4LTU A;  4YTM B;  4OZC A;  3AE5 B;  3URY A;  2WXF A;  3SFE B;  1FRD A;  1YQ3 B;  3V05 A;  3AH7 A;  3W9C B;  3AM9 A;  1AW7 A;  1VZ8 A;  2BS3 B;  2PVG C;  3AMZ A;  4PT5 A;  2J53 A;  4J3O D;  2V0G A;  2WDQ B;  4YXD B;  3KQ4 A;  1TYG B;  1IBX A;  1FO4 A;  1YN5 A;  3OWE B;  1PYW D;  3Q8A A;  2ON8 A;  2WDR B;  3I9V 1;  3NZ3 A;  1C4C A;  1C79 A;  2QEJ C;  5HFY A;  1FFV A;  2MJE A;  3AE3 B;  3AE7 B;  2W3S A;  1HEZ E;  4IKG A;  4C80 A;  4ZOH C;  1L0X B;  1XO3 A;  3BYT B;  1IGD A;  3FC4 A;  2W55 A;  1E9M A;  1IBX B;  2QSD A;  3LYY A;  2ICI A;  4RGN A;  1PUT A;  1J7A A;  4RNA A;  2BW2 A;  2N9L A;  5BMI A;  3PZ8 A;  2WXJ A;  3TSS A;  1XLQ A;  3P4S B;  4ZRQ A;  1EU3 A;  1OQR A;  3AED B;  2LGI A;  2X38 A;  2JYE A;  3MHZ A;  4C56 C;  4GDL B;  2KN4 A;  3BYY B;  4OVZ A;  2WXI A;  1STE A;  5HHD G;  1F0Z A;  3MFG A;  2Z8L A;  1I4G A;  2D5G A;  2AQ1 B;  1ESF A;  1B9R A;  1ZOY B;  1XLO A;  1N5W A;  4HKZ E;  4NJC A;  2L1A A;  4A6Q A;  4N59 A;  4NZL B;  2JXT A;  1JW9 D;  2RDG A;  2WDV B;  1AWD A;  5AUI A;  3TEY A;  4WH4 A;  4KKI A;  2V3N A;  1V1P B;  4GLS C;  4WWM A;  2ACZ B;  2E3T A;  2RPV A;  4MM3 B;  1C77 A;  5C3J B;  1N63 A;  2EEL A;  2QIL A;  4OZB A;  3W1S A;  2BT6 A;  1TS4 A;  5BMG A;  1T5X D;  3I57 A;  1FNU A;  3AEB B;  4L23 A;  2NTS A;  3AEG B;  4TMA B;  5EE3 A;  5H8Y E;  3T3N A;  1KLU D;  4KGT A;  2BTE A;  1RWS A;  4HRS A;  3BII D;  3CWI A;  1C76 A;  3TEW A;  1HQR D;  1YN3 A;  1TZO A;  1NI3 A;  3ZQ4 A;  5FKA C;  3MC0 B;  3EUB 2;  2Q5W D;  1NEN B;  5EE9 A;  4AS1 A;  2PLP A;  3BVG A;  3PO0 A;  3P4Q B;  1SJE D;  2LFI A;  3WCQ A;  3NVZ A;  1JML A;  2JSV X;  2BS4 B;  4EE2 A;  1GAQ B;  3AEF B;  1QOB A;  3BZD B;  4KGS A;  3VR8 B;  1CK1 A;  4US8 A;  1HXY D;  1TS3 A;  4A55 A;  2MH7 A;  1QLB B;  2K3U A;  3J9C A;  2ONQ A;  2PKO A;  2N0S B;  1QKZ A;  3AV8 A;  4IDI A;  3FAH A;  3P4R B;  2K9X A;  1K51 A;  1IGC A;  3CIR B;  3R2T A;  4P16 A;  4NAM A;  4XWW A;  1ET9 A;  2BBC A;  2MEK A;  2KAC A;  2QIE B;  2W3R A;  2AQ2 B;  5T8I A;  2R61 A;  2VZK B;  2BS2 B;  1SEB D;  5BMH A;  2TSS A;  1YQ4 B;  5FR3 A;  2LHE A;  3AE2 B;  4WUR A;  1HZ5 A;  1WRI A;  1PGA A;  1SE4 A;  3E9S A;  1N61 A;  1ZXI A;  3GB1 A;  4A90 A;  1V8C A;  1E7P B;  1UUP A;  3N9Y C;  1XF5 L;  1NVI D;  4RFB A;  1XLP A;  1LO5 D;  2PIA A;  4RGM A;  1FIQ A;  1SE3 A;  1VJK A;  1L4D B;  2M19 A;  2W54 A;  5BYS A;  2WXP A;  3Q69 A;  1L0Y B;  1C78 A;  3IAS 1;  3GS2 A;  3NS1 A;  1I4H A;  2HTM E;  1XCQ L;  4D2K A;  5EE1 A;  3U7Z A;  2WXO A;  1T3Q A;  2JU6 X;  2LHD A;  4XE0 A;  2FE8 A;  2INP E;  3C8Y A;  1PFD A;  2WP9 B;  2WXM A;  3HVD A;  2LEK A;  3AN1 A;  3E56 A;  1K53 A;  3GP7 A;  1TJE A;  1DGJ A;  1ET6 A;  1I4Q A;  4YTP B;  1D5Z C;  4US9 A;  3U4E G;  1E0Z A;  1L6V A;  2KMM A;  3LXF A;  1A70 A;  1JWU D;  4MT5 A;  4XDC A;  2WS3 B;  1CZP A;  5EE0 A;  5G5G A;  2WXG A;  1JQ4 A;  1Q10 A;  4FXC A;  4GDK B;  4C7Y A;  3AEC B;  4Q2J A;  1PGX A;  4O1N A;  4USA A;  1ZUD 2;  4NAW B;  4JX1 C;  1BXT A;  1V1O A;  4WQM A;  1JRO A;  4YWG G;  2LJI A;  1F2R C;  1GOZ A;  2BYT A;  1ZXH A;  3MP9 A;  4YSZ B;  1L5P A;  3BVZ A;  3W2D A;  1HA5 A;  1ZDX A;  4KGR A;  2DYO A;  1T6B X;  1SB3 C;  2M56 B;  3P63 A;  1L0V B;  3KWV A;  1OQQ A;  3KWL A;  1J7B A;  1EWC A;  2LUM A;  1C4A A;  3Q8E A;  2OHF A;  1DOI A;  2N9K A;  4YSY B;  1DYQ A;  4DQO C;  4A9A A;  2MJD A;  2SEB D;  3EA6 A;  1WSP A;  3EGR A;  1DOY A;  1TY2 A;  1VZ7 A;  1FD6 A;  1TKE A;  2V4I B;  2WU2 B;  1QOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...