1L6VA

Structure of reduced bovine adrenodoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
106
structure length
106
Chain Sequence
DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenodoxin 1
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 9
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6vA00
1QF6A 5EE0A 3NVYA 5EE3A 2DWQA 2L52A 1N62A 1N61A 1NYRA 1PUTA 3AE6B 1YJJA 2KMMA 3AE8B 1TKGA 1A70A 3AEEB 3AE3B 1L6UA 3NVVA 2K5PA 3CWIA 3LB8C 1OQRA 4YTNB 5H92C 2LEKA 3B9JA 1E0ZA 1QOFA 2K9XA 2M56B 3AE9B 1PFDA 3HRDD 3AEFB 3SFEB 3VR8B 3VRBB 3NVZA 3NRZA 3PO0A 3P1MA 5C3JB 2EKIA 2B76B 2HTME 3AEBB 1QOBA 2CJNA 4YSYB 1TYGB 2BT6A 5G5GA 4US8A 1FMAD 4A9AA 2BS3B 3P63A 1XLPA 2Y5CA 1WWTA 3DWGC 1TKYA 3WCQA 2WQYB 4C7ZA 1F0ZA 2MH7A 4ZHOA 3B2FA 1N5XA 1JRPA 1YJIA 3P4PB 3AN1A 2L83A 1E7PB 4N6EB 4C7YA 4C80A 5GXGB 2Q5WD 5AUKA 2MJ3A 2MJDA 3AV8A 1T3QA 4USAA 1E10A 2W55A 3KWLA 3B2GA 2E3TA 4YXDB 1JWAD 2ACZB 4LTUA 3VR9B 2PVOD 1J7CA 2WP9B 1ROEA 3AE7B 5H8YE 1QLBB 3ZYYX 4YSZB 1J7AA 1DOIA 1EWYC 2CU3A 2OHFA 2WDQB 2PVGC 2H89B 4N59A 3LXFA 1JWBD 3AEAB 1WXQA 2WU5B 3VRAB 1AYFA 1QT9A 3AE5B 1L5PA 3BIID 4YTPB 2WDVB 1DOYA 2QIEB 5C2TB 3P4QB 3HVZA 1WGKA 1GPXA 2MJEA 4YT0B 1SB3C 1FO4A 1QOGA 1PDXA 1FM0D 1CJEA 4WQMA 1NEKB 1WYGA 1ZUD2 3HUIA 2WU2B 2WLBA 1AWDA 1XLQA 2K22A 4KX6B 1N60A 4ZHPA 1ZP0B 1TKEA 2WS3B 5EE9A 2BS2B 3FC4A 3AE2B 2KAJA 3AB5A 1JQ4A 2BS4B 2W54A 3AM9A 1JALA 1JW9D 1R7SA 1XLOA 2AX5A 1XO3A 1FIQA 2JX5A 4P6VF 1TJEA 1YQ4B 1NVID 2JQRB 2W3SA 1RFKA 2QJLA 1E6EB 1RYJA 1FFUA 4FXCA 1NI3A 2G1EA 1FRDA 1ZOYB 2FBWB 2WDRB 5EE1A 5AUIA 3W9CB 1IUEA 1WRIA 1ZXIA 4ZOHC 4YTMB 1B9RA 1OFFA 3SFDB 1E9MA 3AECB 4HROA 2M19A 4YSXB 1L6VA 1OQQA 1KRHA 1SIJA 3AMZA 3L4PA 2DBYA 1SF0A 1FFVA 1N63A 3P4SB 1FXIA 1RM6C 2PIAA 3AE1B 4ITKA 1QOAA 1FXAA 1KF6B 1N5WA 1RWSA 3ETRA 4JWSC 1JROA 1GAQB 2PKOA 1V97A 4IDIA 4N58A 1YQ3B 1DGJA 1NENB 1VJKA 1KFYB 4HRSA 1DOXA 1V8CA 2CJOA 2H88B 3AE4B 3ABVB 3CIRB 3RPFC 1L0VB 4JX1C 1I7HA 3DWMA 3W5UB 5MPOA 3P4RB 4US9A 1FRRA 3EUB2 3NS1A 1VLBA 5G5HA 2N0SB 1CZPA 4WWMA 1NYQA 3SR6A 3NVWA 1UWMA 1VDVA 3AEGB 3FAHA 2W3RA 1J7BA 4JWUC 3W5VB 3AH7A 3AEDB 1XLNA
chains in the Genus database with same CATH superfamily
3SU8X 1Y56A 2BB6A 3I5JC 2A4ZA 1TKGA 2DYOA 2M56B 2QILA 3N9YC 3NVZA 3B0AA 2B76B 4WJQA 1I4RA 2FUG1 2OEDA 2KDIA 1GC7A 2XNAC 2PMVA 3GP7A 2WXKA 2L8JA 5EDSA 1GC6A 5JZEB 3WAPA 2FUHB 4IWOA 1WYWB 5BO4B 4JE3B 2WXMA 3OJ3A 3N1XC 5TR5A 3DBLI 4ICVA 3ZRCA 3IBEA 1P7FA 1UUPA 1EU4A 4OHJA 1YNTE 1JRUA 2DYBA 3A4RA 5AZGA 1WX9A 1H8CA 4B6WA 1F2RI 1D3ZA 5JHBA 4KIKA 3IXSA 2KJ6A 4NPNA 3IT6B 4IKGA 3W1YA 1DYQA 2J7QB 4WQMA 1ZUD2 5GMVA 3TBLD 2LWPA 1V80A 2WXJA 1WXSA 1FFUA 1XCQL 1ZOYB 1I4QA 2LJ5A 3TMPB 1E9MA 2XN9C 3TL5A 3UINB 2D5GA 3L4PA 2DBYA 1FFVA 3AE1B 2ZZPB 1SJHD 1P9DU 3N30A 1YQ3B 3KYCD 1MVKA 1DOXA 4KGRA 3VVWB 1C79A 2NCNA 5HKHA 1UWMA 3FAHA 3W5VB 4IOIE 3PS6A 3Q6BA 1NYRA 2QCZA 1D6EC 3CMMB 2K5PA 3APFA 3AE9B 2WXPA 2INPE 2PW9A 1QOBA 1OEYJ 4EZLA 2LD9A 3IAM1 2KQSA 4W9DA 2JY6A 3QHTA 2I38A 3M62B 2KN5A 4JQWC 4N6EB 2JF5A 4KZ0A 2KKCA 4YXDB 2KYWA 4TUUA 4M8MA 1I4PA 4BAXA 2KN4A 4DDGD 1ROEA 2AQ1B 2HE7A 3DBLB 2LGDA 3LXFA 2RDHA 1QT9A 5C2TB 2KWUB 2BYEA 4BKSA 4AJYB 1WYGA 1V5OA 2K6QA 3AU4A 2O6VD 1M94A 4DK5A 2N9LA 4GIVA 3T3OA 3C8YA 3PZ7A 4GN1A 1XLOA 5D3DA 5D6JB 3ZIMA 2JZ3B 1HZ6A 2WWZA 2W3SA 3MHZA 4TMAB 3SHQA 2KVRA 2BYTA 4G50A 3IAS1 3R7RA 5C1ZA 2BWES 1ET6A 4JGHB 3AU5A 4X57B 1HTQA 2DZKA 4ANVA 2JWZA 1KFYB 1J19A 3BVMA 4II3B 3T8MA 2M17A 1I7HA 3W5UB 4S0RA 3ALBA 1FRRA 3ZDMC 4WWMA 2M8SA 1T0QC 5EE0A 3HM3A 2N7DA 2LGSA 1A5RA 1PGXA 3ZNZB 3Q14C 4S17A 1UBIA 4C4VA 2KT7A 1WM3A 3P1MA 1WE7A 3AI5A 1CK1A 5BMGA 1I42A 1OTRB 2AL6A 1YMHE 2MBBB 5J2RA 2LRWA 3BK1A 1N5XA 2C7HA 1LFDA 2DNFA 2GRIA 3QAQA 2DLBA 4PYUA 4M8NA 2KWCA 3ZJVA 3TEZA 4KSKC 1GOZA 3DHGC 3PHWB 4IC7B 3M63B 1Q10A 5JXVA 2TSSA 4YSZB 1UELA 3HM6X 1LGRA 3R8BA 3QA8A 2A5UA 2DZJA 3P4QB 1WXMA 2NBUA 2ZW1A 1GNUA 1TS2A 2WLBA 3Q8BA 3PPAA 3ZTCA 5LXHA 3IT4B 5G2NA 2JRIB 3RZFA 4OW0A 3ZO5B 2OJRA 1V5TA 1RYJA 4FXCA 4LNIA 2BYFA 2RPVA 4IM0A 3ZVVA 3UF8A 1WJ6A 3QX1A 3D32A 3ETRA 3PTFC 3ENEA 3BVZA 4B95A 1DGJA 1NENB 2H88B 2MRPA 3HHMA 3KH0A 2AQ3B 2LUEA 1E8WA 2JUOA 4FBJB 2ONQA 1VDVA 2W3RA 5DPWA 5E6OA 5KHOA 5HI1A 4KGTA 2N7EA 4CHKA 2KMMA 5E6JA 1E7VA 3IG3A 5DCNA 2LRUA 4D2KA 4XC2A 3HRDD 2N1VA 1WXVA 2BB5A 4HVBA 3RYTA 2CJNA 5G5GA 2LXCA 1WXAA 5BMIA 3AULA 4C7ZA 4ICUA 1KOTA 1WX8A 1HZ5A 2WXIA 3KUZA 3V05A 2D11A 2L7RA 4USAA 2NTTA 3DBHB 4OZCA 4CQNA 2O6VA 2MCNB 1WR6E 3PLVA 5I4DA 4A3PA 1JMLA 5IAAC 1D5XC 4LLGM 3B08A 1XT9B 3L13A 2WU5B 3I9V1 4K7UA 4MSMB 2ZEQA 3VH3B 2MJEA 3JW0X 1Q0WB 2Z59B 4P7IA 1C78A 1GB1A 2K6DB 3TCAA 2AX5A 2LHEA 3FKYA 5BYRA 4C56C 2I1KA 4TQ0A 1FRDA 5J18A 4ZOHC 2VZKB 1C77A 3ML8A 4II2B 2MEKA 2KC2A 3BWUD 2JRHA 3EC8A 4MSQB 4LNFA 1ZPSA 1JCKB 2MLBA 3BINA 4XX5A 2G4SA 2YLMA 3QIJA 4ANXA 2DYMA 3R2TA 3CIRB 3AE4B 3ABVB 1L0VB 4LK0M 4EEWA 3DVNU 3CSFA 3ZNGC 3EUB2 4DQOC 3VTUA 3Q69A 3SR6A 3C19A 2YEPF 3AEDB 3PZ8A 1EWCA 3L17A 1D5MC 1N62A 1FNVA 3ZQ4A 2RDGA 2HJ8A 4YTNB 3SFEB 2XBBC 3PRMB 5HFYA 1SJED 4G3XB 2WXOA 4C4VB 3RNCC 4I6LB 4AP4C 4MGZE 4H2AA 3A33B 1GG3A 2ZPYA 3Q3NC 3B2FA 4BKTA 1JRPA 4KGSA 3CF6E 2WXQA 4A3OA 3NZ3A 2E3TA 2REXA 1FCCC 4DXFA 1E5WA 4RF1A 3X23A 3PREA 3R66C 1SE3A 1VD2A 4EUTA 1AYFA 3BIID 5CTRC 1SE4A 4FN2A 4RGTA 1ZE3D 3K9PB 1VZ7A 4KSLC 1I4GA 4E3CA 4UDUC 4TQ1A 1NEKB 4KX6B 3Q2AC 2KMCA 3AE2B 4QAYA 3QARA 4RM8A 2J0JA 2KVZA 4F7ZA 1FIQA 2PLPA 4HCPB 3MHSD 1WZ0A 3L16A 4YTMB 2INNE 2KACA 1WJUA 4RGNA 2M19A 4YSXB 2L1AA 1TBEA 4ITKA 4O1NA 3TIXA 1TS5A 2MX2A 4JWSC 1ZDVA 2GBMA 3IFWB 3APDA 4W9IA 1V8CA 2W9NA 5IA7A 3V61A 2OOBB 4ZRKA 5D2MB 2WHIA 3NY5A 4WWPA 3UI3A 1MHHE 4P1CC 1OEYA 3Q8FA 1F52A 3TSSA 1WH3A 2IO0B 1UF0A 4NQKE 1FCLA 1LM8B 2Z0EB 1FNWA 3RNFC 2NBWB 3EFUA 2XEWA 1QOFA 2C9WB 3GZNB 1E8ZA 2G4DB 2VZKD 2HTME 2L05A 4OVVA 2KJHB 1Y8RC 2FCMA 1S3SG 2AQ2B 4WJOA 4W9HA 3O65B 1TZ1A 1WFYA 1YOVB 4W9CA 1WGGA 3ZJTA 3ZXVA 2RR9A 3ZGZA 4NY0A 4B0MA 3MJWA 2J4XA 4FJVB 3B2GA 3ZLZA 3NHEB 2IPKD 2ZCBA 1IPGA 1ET9A 1V9JA 2Y5PA 2WP9B 3H7SA 2O6VB 4MGYE 4C00A 3KWVA 3BYTB 2INDC 1WGKA 3EA6A 1MJDA 1CJEA 3U2SC 1AWDA 2KO3A 2K22A 1UZXB 4DHZE 2FIFA 2KFJA 4I6NB 4PS8A 1C76A 4HPMB 4MGIE 1F9JA 1V81A 1YQ4B 5AZHA 2FBWB 3N1YC 4HROA 4XZ4A 2N9KA 4PS3A 4WJNA 4BBNC 4RMAA 1KRHA 3N32A 4A6QA 2IYDB 1WMHA 2KNBA 2Z0DB 4HRSA 1C4PA 3L0WB 2UWQA 1LQBA 2V3NA 2LUMA 1VLBA 2G45B 5D94A 2K8CA 4L2YA 3AEGB 2V1YA 2BQQA 3BY4B 1WZ3A 2RDBC 1Q5WB 2JU6X 1WRDB 1F1HA 3AEEB 1T5XD 2C7NB 1K52A 1ZGUB 4MJSA 1PFDA 1ZXHA 5C23A 2HJ1A 5C3JB 4IUMB 2CHXA 3ZXRA 3WAOA 2ZCCA 2NVUI 3ZKJC 4PT5A 2CS4A 2BS3B 2WX0A 1XLPA 3Q8CA 2KOXA 4K3CA 2DHZA 4IM3A 5CHWA 1WM2A 3P42A 3GS2A 4L1BA 4GLSC 4HLEA 2J0MA 2DZIA 1YD8U 1J7AA 3T9LA 2BPSA 3A9JA 1WY8A 1JWBD 4RH6A 1PGBA 4RFBA 4MM3A 1I4XA 1HXYD 1XCTL 4XDCA 2WU2B 3P2BA 3MC9A 1L4DB 3B1LX 5DPTA 2JYEA 2KANA 1H4RA 3ZRFA 1BT0A 2G1EA 1T0SC 3W9CB 2QEJC 1OFFA 2KDBA 3DBSA 1CMXB 1SF0A 2DZMA 3VUWA 1HQRD 4LNKA 3I57A 1GAQB 1FPYA 1V97A 2JSVX 4JLCA 2N1WA 2WXLA 1IYFA 5T8IA 4HPPA 3UIOB 2KLGA 2DAJA 3DVGX 2QC8A 4HXDA 4M00A 1WI0A 1AN8A 3JYUA 2LASA 4W9EA 1QF6A 4MH0E 1KTKA 3ZNID 1N61A 4LNNA 1TIFA 1E0ZA 3AEFB 2J0KA 2PE9A 1TYGB 1AW7A 2QMTA 1FMAD 5J17A 1ZKHA 2LGYA 2FNJB 1CQVA 4A8XC 1C3TA 1WWTA 3KUDB 3WAMA 4FJZA 4JL9A 2MH7A 3RI7C 2L83A 1E7PB 2D3AA 1V6EA 1K8RB 3HIZA 4KDIC 5AUKA 4DHJB 2MJDA 3RNEC 4F8CB 1SEBD 2G9HD 2R2OA 1ZDXA 4PYZA 4HDOA 5DPSA 4W9KA 5H8YE 4EOYA 4IW0A 2J53A 4BKGA 3A1QB 4YTPB 3Q8AA 1ACCA 3HVZA 3DBHI 3RN9C 4FLHA 4W9FA 3LDZE 4ZRQA 1V1PA 2D2QA 3N3KB 3PHXB 2WXFA 3GB1A 4LDTD 2PTLA 4WWNA 5EE9A 4K7WA 3GE3C 2KAJA 3PSEB 1JQ4A 3AM9A 2JYTA 5IKCM 3O13A 4MDKE 2RSUA 4K3BA 2D07B 3VQIA 1IUEA 4ASWC 2ICIA 2L0TA 1SIJA 2LVOA 3QK0A 1IP9A 2ZNVB 4GDKB 1PYWD 2M0XA 1QOAA 1FXAA 4DBGA 2KWDA 4N58A 4EE2A 1UH6A 2HD5B 1WMHB 3A9KA 5IO9A 2OJWA 2AYOB 2KTRB 2K1FA 3P4RB 4XWTA 2MA9B 3NVWA 2D3CA 1QQRA 3ONSA 4WQOB 1UD7A 1PUTA 1A70A 2NTSA 2N9EB 1OQRA 3U4EG 4HKQA 2LXAA 2ZVOA 2IDYA 3PV1A 4MJSB 3JSVA 4YSYB 2PPHA 3OJ4B 4A9AA 1FEHA 1T0RC 2KK8A 4AWJA 4XDDA 2L3ZA 4MELA 3K9OB 1QILA 1JWSD 2L76A 1IBXB 1D4BA 4RCOA 4C7YA 4C80A 3AV8A 1I4HA 1T3QA 2W55A 2L0FA 5TSSA 3AXCA 1RLFA 2LGIA 3NZSA 2NPTB 2JWUA 3DCGA 3ZYYX 5CHFA 1DOIA 1EWYC 2OHFA 2WDQB 4GB9A 4J3OD 3UGBB 1IGDA 1L5PA 1SSNA 1K50A 2LJIA 1MHXA 2BKRB 2QIEB 3A9JB 1FO4A 5CX3A 4I6PA 1WR1A 4MM3B 4K7SA 4HK2A 3FC4A 3AB5A 1L4ZB 2ZVNA 4EFOA 4P6VF 3ZDTA 2VH1A 3RULA 1RFKA 3KVFB 4NAWB 1NI3A 4A20A 3PZDA 4DHJD 2V9HA 4ACFA 1ESFA 3WANA 2KMAA 5LXIB 1R4NI 4NZLB 2KHWB 4IDIA 2ZNVC 4KVGB 1YX5B 4KDLB 5JH5C 2RPQA 5MPOA 2X8XX 1IGCA 3QWZB 1TGZB 1NYQA 3KUCB 4NAMA 3GOEA 4IG7B 3WALA 5EE3A 3NVVA 2WNMA 2KQ4X 3PVLA 1PQSA 2K9XA 3VR8B 2JT4B 3VTWA 1ENFA 3V6EB 1YX6B 2IO2B 1EF1A 1KH0A 5E6NA 1UGMA 2C5LC 1TKYA 3HK0A 1C4AA 2NBVB 3L08A 3GZNI 5AZFA 2FIDA 5GXGB 2AEHA 2GBKA 3EECA 4GXBA 1C9FA 3EFCA 2CR5A 2YVCA 1JWAD 4MT5A 1D5ZC 1E90A 2K3UA 4GDLB 2J42A 1BUIC 3SDLC 1ISNA 1E8XA 2E6XA 3ML9A 4ARCA 4E71A 3AEAB 3H9DA 1SXTA 4B0EA 3RNGC 1SB3C 4HJGE 2LZ6A 4WAFA 3TEXA 3MC8A 1Z2MA 2RMMA 1J8CA 1KLGD 3MTNB 1V1PB 1P98A 1YQBA 3EGRA 3Q3FA 4WURA 3ZTDA 3VAWA 2O2VA 4RM9A 1YJ1A 1XO3A 2KJRA 3NOBA 2ZPNA 1E6EB 4HCNB 5KHQA 3OAWA 4HEA1 3LYYA 4R3DA 3AMZA 2GMIC 2IJ0A 3DHHC 3P4SB 1R4MI 2KXJA 2UU7A 3Q3MC 1V49A 1JWMD 2MBEA 5FR3A 1F77A 2IY0B 1T0YA 1R4NB 4ZYSA 4JIOU 3DWMA 4HPLB 1G6JA 3A9KB 2MSED 1MFWA 5DPRA 4FHJA 3UQBA 5LNK1 4NJCA 3AE3B 3PRZA 3U8ZA 3N1ZC 1B1ZA 3PO0A 4EZKA 2I2YA 3A4SC 5D3IB 2D3GA 1BMLC 2AWTA 3URYA 3JSVB 4FHKA 2UYZB 3DVNV 3E56A 3R2IA 1WGYA 1KLUD 3RNAC 2KX0A 3DPDA 3JVZX 2PEAA 2WQYB 1F0ZA 3V6CB 4ZHOA 1TY0A 2Q5WD 2MJ3A 4ZRIA 2LHDA 2GB1A 3H8HA 1I35A 4AS1A 1V86A 2R2QA 3DOWA 3PRPB 4Q2JA 3QC8B 2K39A 4AQ7A 1C1YB 4P16A 4YT0B 1QOGA 3T3NA 3X0WA 4F1SA 1N60A 2KFKA 2BGFA 2EELA 2KX3A 4NJ6A 2WXNA 1JALA 1JW9D 1BXTA 2C60A 2JQRB 3A1QA 2FCSA 2V3PA 1WRIA 1KM7A 3AECB 1NBFC 3RUIB 2MW5A 2CKHB 3VUXA 4LNOA 1UWXA 2Z8LA 1WJ4A 2JXTA 3IVFA 1EO6A 1R4MB 1XF5L 4GOCA 1TY2A 3NS1A 1CZPA 4BOZB 1LXDA 1TS4A 3H7PA 3V62A 4JWUC 2INCC 4GDKA 3WA0A 2KDMA 2K0PA 2MWSB 4WAAA 3TJPA 3KLSX 2BW2A 2BVCA 2KDEB 4MGKE 2L32A 2ON8A 4B9KA 2KTRA 4AOFA 4KKJA 1WE6A 5BYSA 4HKZE 2IO3B 2PJHA 2AL3A 3WCQA 1VR9A 1GB4A 3TUOA 2MP2A 3NS8A 4KV2A 1VCBA 4YL8A 3VFKA 2PVOD 5HG2A 2MBQA 3UIPB 4RGOS 2V4IB 2EKEC 2CHWA 4ZDVA 4LDTB 4BZAA 1WXQA 4ANUA 3AE5B 2LFIA 1IBXA 3ECIA 1GPXA 1OGWA 1L7YA 4G0NB 1XD3B 5IN7A 4PK1A 4K81A 1EUVB 3DVGY 2WS3B 3MFGA 2BS2B 3PGEA 3Q3OC 2NPTA 2J52A 1TJEA 4RGMA 2O2VB 4FJYA 1U4AA 4NQLB 4L23A 3VHTC 3J9CA 4NJ7A 2C7MB 1J0GA 2KDFB 2IGDA 1KF6B 5E6PA 3Q3JA 2KD0A 3ZUNA 2LVPA 1VJKA 1MG4A 1V2YA 2JXXA 5IOIA 3V3XA 2CJOA 1K53A 4NAWA 3KYDD 4US9A 1RRBA 2M1MA 2V4LA 2IGGA 3VXWA 1QZEA 2LMCA 2N7JA 3NVYA 3DBRI 2L52A 2IO1B 3LB8C 3R7QA 3VUYA 3PLUA 2K8BA 5H92C 1K51A 2D10A 1WF9A 4KZCA 1NI2A 1P7EA 4US8A 3L54A 3V60A 2LGXA 5BMHA 2SEBD 3OG5A 1P0RA 1SE2A 2DAFA 3DWGC 1EF5A 5D7GA 1XXGA 4REZA 4XYCA 4TV3A 1E10A 2CU1A 4MH8A 3FILA 2LVQA 4LTUA 2IGHA 3DDCB 4BVUC 4TKNA 4CYEA 2CU3A 3EHVA 4M0WA 4K1RB 3ZJUA 4M01A 3RD2A 2WDVB 2ZJDA 3ZW3A 3VH4B 2ZW0A 1RFAA 1UBQA 2M0AA 3RMKC 1YIWA 2QSDA 1ZP0B 4GDLA 2WYQA 2KFKB 4E74A 2IBIB 2MHJA 1NVID 2Y5BB 5LLIA 3W2DA 2JPHA 3U52E 2PIAA 1GUAB 3C0RB 2FCQA 2GLSA 2WXRA 3U30A 1P3QU 1TTNA 1VZ8A 1RAXA 2R61A 3SEBA 5G5HA 4DXGA 2N0SB 4DXAB 2GBNA 4XWWA 3KWLA 3AH7A 4DDID 2B3AA 4MACA 2DWQA 2MBHA 3H7PB 3CWIA 2NR2A 3WIMA 3QQ8B 4OZBA 2G3QB 1Z5SB 3DBRB 4JPSA 2XK5A 4W9GA 3NRZA 2LI5A 2RGFA 1AARA 2BT6A 2Y3AA 4WWOA 2DX5B 2WXHA 3BK2A 4ZRJA 4CO7A 3DHIC 1N6ZA 3N20C 4EKUA 4ZYNA 4KIKB 1UNSA 1YJIA 3P4PB 3CSTA 1UGJA 1KLVA 1PGAA 3GE8C 1YN5A 4KKIA 1WGRA 2JZZA 1HA5A 2MP2B 1F2RC 4BFRA 1J7CA 1XEEA 3U7DA 3AE7B 2ASQA 5L95C 2FCNA 5JHAA 2BTEA 3U7ZA 1E8YA 1T6BX 2JVCA 3ZNHB 1JWUD 2EMTA 3PT2B 1MI0A 3E9SA 3RFZB 1VZ6A 1NDDA 4FA6A 1FNUA 3KQ4A 2KLCA 2KZRA 4IWPA 2JX5A 3I3TB 3MC0B 5EE1A 5AUIA 4J6IA 1B9RA 4A90A 1QKZA 4IM2A 4MEMA 2GBRA 3W1SC 1N5WA 1Q1OA 2VH2A 4WH4A 3I63C 2PKOA 3RPFC 4BOSC 4ZRPA 2KC1A 1FD6A 1WX7A 4LJPB 5FR6A 1FXTB 1MG8A 1EU3A 3R3MA 1YJJA 4XE0A 4WIPA 2BYVE 4ANWA 2LEKA 4M02A 1L0XB 3VRBB 4HJKA 1WGHA 4GU2A 1XQQA 4LCDE 2EKIA 3AEBB 2HTHA 3OLMD 1YN4A 3Q8EA 3P63A 2QHOA 2Y5CA 3BYYB 2GI9A 3KW5B 4N9F4 2D3BA 3AN1A 3QCAA 4OVZA 2K8HA 2WDTB 1TZOA 2EMSA 4GGQA 2HDEA 3VR9B 2N4FA 4YWGG 1SIFA 1QLBB 2DENB 3FILB 3VTVA 4N59A 3VRAB 2BWFA 2L00B 4NNJB 4M0WB 3S2AA 3RT3B 3TEWA 4EZJA 2NS5A 1PDXA 4FADA 2K25A 3HUIA 2FE8A 1WIAA 4RNAA 2MQJA 2QJLA 2WGSA 2WDRB 3M95A 3VDZA 1HTOA 4A55A 3HVDA 3H6NA 2V0GA 3BZDB 4G11A 4DHZB 1TS3A 4GMVA 1N63A 1RM6C 4GSWA 1JROA 5L83A 2YEPB 2JZPA 4ARIA 3LJ3A 5FKAC 2VRRB 1HEZE 3NUHB 5CHVC 2WXGA 1WSPA 4OVUA 1LO5D 1J7BA 4JX1C 4PS7A 2SAKA 2MBOA 3AE6B 3AE8B 1MPEA 1L6UA 3SD5A 2GBJA 2NMQA 1GJZA 3B9JA 4BBNF 2I1JA 2CHZA 2N9PC 4URKA 1OQYA 2BBCA 2XK5B 2RD0A 2W82A 5FK9C 3QJZA 3MJ5A 4TSSA 1KJTA 3MP9A 3IHPC 1P1AA 4DWFA 1EM7A 2FAZA 1S1QB 1SE9A 1VRAB 3OWEB 1X1MA 3APCA 4W9JA 2ACZB 2KQ7A 4XGAB 2IY1B 1SGHA 3UQAA 2BF8B 2PVGC 2H89B 1TT5B 3RNBC 2M4NA 1E7UA 1HE8A 3NG0A 2N9XA 5G55A 3NZUA 1SBBB 2BKFA 2GOWA 5IP4D 3DQVA 4RF0A 1FM0D 2PE6B 4ZHPA 1ZW7A 1XLQA 1TKEA 3M3JA 4HDQA 3L10B 3RZWC 2BS4B 2W54A 3H1UA 4LJOB 1R7SA 4W9LA 2KTFA 5HHDG 2KWVB 1DOYA 1YN3A 1V1OA 1ZXIA 5BYQA 3SFDB 4BKSD 1L6VA 1OQQA 3BVGA 4IWQA 1M4VA 2X38A 2QDFA 4AJWA 1FXIA 4WJPA 2WX1A 1RWSA 1WGDA 3RCZA 3TEYA 2V3SA 1STEA 4P1BC 4HWIB 1L0YB 3W1SA 1C4CA 2IZVB 1WJNA 4AUQC 3NJTA 4OZAA 4FULA 1L2NA 5AEKB 1XLNA
chains in the Genus database with same CATH topology
2N7JA 3PZ8A 1Y56A 3NVYA 1QQRA 1EWCA 2BB6A 2L52A 1D5MC 1N62A 1FNVA 1PUTA 3LB8C 2RDGA 3ZQ4A 1TKGA 1A70A 2DYOA 2NTSA 5H92C 4YTNB 1OQRA 3U4EG 1K51A 2M56B 2QILA 3SFEB 4HKQA 3N9YC 3NVZA 1SJED 2IDYA 5HFYA 2WXOA 2B76B 1I4RA 1P7EA 2FUG1 4YSYB 4US8A 2OEDA 4A9AA 1FEHA 4H2AA 4XDDA 2XNAC 5BMHA 2SEBD 2PMVA 3GP7A 1QILA 2WXKA 1SE2A 3DWGC 1JWSD 1IBXB 1D4BA 3B2FA 5D7GA 1JRPA 4RCOA 1XXGA 4C7YA 4JE3B 4C80A 4REZA 2WXMA 4KGSA 3AV8A 1I4HA 1T3QA 1E10A 2WXQA 2W55A 5TSSA 3NZ3A 2E3TA 1FCCC 4DXFA 4MH8A 3FILA 1P7FA 2LGIA 1UUPA 1EU4A 4LTUA 2IGHA 4OHJA 1YNTE 2JWUA 4RF1A 3ZYYX 1DOIA 1EWYC 2CU3A 4M0WA 2OHFA 1SE3A 2WDQB 4J3OD 3ZJUA 1AYFA 1IGDA 1F2RI 1L5PA 1SSNA 3BIID 1K50A 2LJIA 1MHXA 1SE4A 2QIEB 2WDVB 3IXSA 4RGTA 1ZE3D 3IT6B 4IKGA 1VZ7A 2ZW0A 1I4GA 1FO4A 4UDUC 4TQ1A 1DYQA 4WQMA 2M0AA 1NEKB 4MM3B 1ZUD2 4KX6B 2QSDA 1ZP0B 3FC4A 3AE2B 3AB5A 1L4ZB 1FIQA 2PLPA 4P6VF 1NVID 2WXJA 1RFKA 1FFUA 4NAWB 1NI3A 1XCQL 1ZOYB 3W2DA 1I4QA 4YTMB 2INNE 2KACA 4RGNA 1E9MA 1ESFA 2XN9C 2M19A 4YSXB 2D5GA 3L4PA 2DBYA 1FFVA 3U52E 2L1AA 2PIAA 3AE1B 4ITKA 4O1NA 1SJHD 1TS5A 4JWSC 1ZDVA 2WXRA 4NZLB 4IDIA 1YQ3B 1MVKA 1DOXA 1V8CA 4KGRA 1VZ8A 5MPOA 2R61A 3SEBA 5G5HA 3UI3A 1IGCA 4DXGA 1C79A 1MHHE 2N0SB 1NYQA 1UWMA 3Q8FA 4XWWA 3FAHA 3TSSA 3KWLA 3W5VB 4NAMA 3AH7A 4MACA 5EE3A 2DWQA 4IOIE 1FCLA 1NYRA 1D6EC 1FNWA 3NVVA 2K5PA 2KQ4X 2WNMA 3CWIA 4OZBA 1QOFA 2K9XA 3AE9B 2WXPA 3VR8B 4JPSA 3NRZA 1ENFA 2INPE 2HTME 2PW9A 2VZKD 1QOBA 2BT6A 2Y3AA 2WXHA 2AQ2B 3BK2A 3IAM1 1KH0A 4GDLB 1TKYA 2I38A 1C4AA 3ZJTA 1UNSA 1YJIA 3P4PB 4N6EB 1UGJA 5GXGB 3ZGZA 1PGAA 1YN5A 4KKIA 4B0MA 2J4XA 1C9FA 3B2GA 1HA5A 4YXDB 1F2RC 2IPKD 1JWAD 4MT5A 1D5ZC 1I4PA 2K3UA 2J42A 1BUIC 2KN4A 1ET9A 1J7CA 1XEEA 2WP9B 1ROEA 2AQ1B 2Y5PA 3AE7B 2E6XA 3KWVA 4ARCA 3LXFA 3AEAB 2RDHA 3BYTB 1QT9A 2BTEA 3U7ZA 1SXTA 4B0EA 1T6BX 5C2TB 1JWUD 1MI0A 1WGKA 3EA6A 3E9SA 3RFZB 1SB3C 4HJGE 1VZ6A 1CJEA 4WAFA 1FNUA 3U2SC 1WYGA 3TEXA 1AWDA 2K22A 3KQ4A 2RMMA 2N9LA 1KLGD 1V1PB 1C76A 3T3OA 3C8YA 3EGRA 4WURA 3PZ7A 1XLOA 1XO3A 2JX5A 5D3DA 3MC0B 1YQ4B 1HZ6A 3MHZA 2W3SA 4TMAB 1E6EB 5EE1A 2FBWB 4HEA1 5AUIA 1B9RA 3LYYA 2BYTA 4R3DA 4A90A 4HROA 2N9KA 1QKZA 3IAS1 3AMZA 1KRHA 2IJ0A 3P4SB 1ET6A 4A6QA 1N5WA 4WH4A 2PKOA 1JWMD 5FR3A 4HRSA 1KFYB 1C4PA 1F77A 3BVMA 3RPFC 4ZRPA 4ZYSA 1I7HA 2V3NA 3DWMA 2LUMA 3W5UB 1FD6A 1FRRA 1VLBA 4WWMA 4L2YA 3AEGB 1EU3A 5EE0A 5LNK1 2JU6X 4NJCA 1YJJA 3AEEB 1PGXA 4XE0A 3AE3B 4WIPA 1T5XD 2LEKA 1K52A 1L0XB 3VRBB 1PFDA 1ZXHA 1B1ZA 3PO0A 2I2YA 3P1MA 5C3JB 2EKIA 3AEBB 5D3IB 4PT5A 1BMLC 1YN4A 3Q8EA 1CK1A 2BS3B 5BMGA 3URYA 3P63A 3E56A 3R2IA 1XLPA 1KLUD 2Y5CA 3BYYB 1YMHE 2GI9A 3Q8CA 2WQYB 1F0ZA 4ZHOA 3BK1A 1N5XA 3AN1A 1TY0A 2Q5WD 2GRIA 2MJ3A 2DLBA 2LHDA 4OVZA 3P42A 3ZJVA 2GB1A 3H8HA 3TEZA 4AS1A 3GS2A 1GOZA 1TZOA 4L1BA 1Q10A 4GLSC 2HDEA 3VR9B 4YWGG 5JXVA 2TSSA 1QLBB 4YSZB 1J7AA 3FILB 4N59A 3R8BA 4Q2JA 1JWBD 3VRAB 4RH6A 1PGBA 4RFBA 4AQ7A 3P4QB 3TEWA 4P16A 4YT0B 1I4XA 1QOGA 1PDXA 3T3NA 1HXYD 1XCTL 2ZW1A 1TS2A 3HUIA 2WU2B 2WLBA 4XDCA 2FE8A 1N60A 3Q8BA 1L4DB 2EELA 2WXNA 2JYEA 3IT4B 4RNAA 1JALA 1JW9D 1BXTA 4OW0A 2JQRB 2QJLA 1RYJA 4FXCA 2G1EA 2V3PA 2WDRB 3W9CB 1WRIA 4A55A 2QEJC 1OFFA 2RPVA 3AECB 3HVDA 2V0GA 3BZDB 1TS3A 1SF0A 1N63A 1RM6C 1UWXA 2Z8LA 1HQRD 3ETRA 1JROA 2JXTA 3I57A 1GAQB 3BVZA 2JSVX 1V97A 2YEPB 2JZPA 2WXLA 1DGJA 1NENB 5T8IA 4ARIA 5FKAC 2H88B 1XF5L 1HEZE 3NUHB 1TY2A 2AQ3B 2WXGA 3NS1A 1CZPA 2ONQA 1WSPA 1VDVA 1AN8A 1TS4A 1LO5D 1J7BA 2W3RA 4JX1C 4JWUC 1QF6A 2SAKA 4KGTA 5HI1A 1KTKA 2KDMA 2K0PA 1N61A 3AE6B 3AE8B 2KMMA 5E6JA 1MPEA 1L6UA 3KLSX 2BW2A 2NMQA 4D2KA 3B9JA 1E0ZA 3HRDD 3AEFB 2L32A 2ON8A 2BB5A 2CJNA 1TYGB 2BBCA 5G5GA 1AW7A 2QMTA 1FMAD 2W82A 4KKJA 5BYSA 4HKZE 5BMIA 5FK9C 1CQVA 3MJ5A 4A8XC 4TSSA 1WWTA 3MP9A 3WCQA 1VR9A 4C7ZA 2MH7A 1HZ5A 2WXIA 1EM7A 1E7PB 2L83A 3V05A 1VRAB 1GB4A 5AUKA 3OWEB 3TUOA 2MJDA 4USAA 1SEBD 2G9HD 2NTTA 1ZDXA 4OZCA 2ACZB 4CQNA 2PVOD 5I4DA 5H8YE 5HG2A 4RGOS 2V4IB 1JMLA 2PVGC 1D5XC 2H89B 4LLGM 1WXQA 2J53A 2WU5B 3AE5B 3I9V1 4YTPB 2LFIA 1IBXA 3Q8AA 1ACCA 3HVZA 1SBBB 1GPXA 2MJEA 4RF0A 1FM0D 4ZRQA 1V1PA 4ZHPA 2WXFA 1XLQA 3GB1A 1TKEA 1C78A 2PTLA 2WS3B 3MFGA 2BS2B 5EE9A 1GB1A 2KAJA 2J52A 1JQ4A 2BS4B 2W54A 3AM9A 2AX5A 1R7SA 2JYTA 2LHEA 5HHDG 5BYRA 3O13A 4C56C 1TJEA 4RGMA 4TQ0A 1FRDA 1YN3A 4L23A 1DOYA 1V1OA 3VQIA 1IUEA 4ZOHC 1ZXIA 5BYQA 2VZKB 3SFDB 2ICIA 3J9CA 1C77A 1L6VA 1OQQA 1SIJA 3BVGA 1M4VA 2X38A 2MEKA 1FXIA 3BWUD 4GDKB 1PYWD 1QOAA 1ZPSA 1FXAA 1KF6B 1JCKB 1RWSA 2IGDA 2KWDA 4N58A 4EE2A 1VJKA 2DYMA 3R2TA 3V3XA 2CJOA 3CIRB 1STEA 3ABVB 3AE4B 3TEYA 1L0VB 4LK0M 1K53A 3P4RB 4US9A 4XWTA 1L0YB 3EUB2 3W1SA 4DQOC 1C4CA 2IGGA 3Q69A 4OZAA 3SR6A 3NVWA 2LMCA 2YEPF 3AEDB 1XLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QF6 A;  5EE0 A;  3NVY A;  5EE3 A;  2DWQ A;  2L52 A;  1N62 A;  1N61 A;  1NYR A;  1PUT A;  3AE6 B;  1YJJ A;  2KMM A;  3AE8 B;  1TKG A;  1A70 A;  3AEE B;  3AE3 B;  1L6U A;  3NVV A;  2K5P A;  3CWI A;  3LB8 C;  1OQR A;  4YTN B;  5H92 C;  2LEK A;  3B9J A;  1E0Z A;  1QOF A;  2K9X A;  2M56 B;  3AE9 B;  1PFD A;  3HRD D;  3AEF B;  3SFE B;  3VR8 B;  3VRB B;  3NVZ A;  3NRZ A;  3PO0 A;  3P1M A;  5C3J B;  2EKI A;  2B76 B;  2HTM E;  3AEB B;  1QOB A;  2CJN A;  4YSY B;  1TYG B;  2BT6 A;  5G5G A;  4US8 A;  1FMA D;  4A9A A;  2BS3 B;  3P63 A;  1XLP A;  2Y5C A;  1WWT A;  3DWG C;  1TKY A;  3WCQ A;  2WQY B;  4C7Z A;  1F0Z A;  2MH7 A;  4ZHO A;  3B2F A;  1N5X A;  1JRP A;  1YJI A;  3P4P B;  3AN1 A;  2L83 A;  1E7P B;  4N6E B;  4C7Y A;  4C80 A;  5GXG B;  2Q5W D;  5AUK A;  2MJ3 A;  2MJD A;  3AV8 A;  1T3Q A;  4USA A;  1E10 A;  2W55 A;  3KWL A;  3B2G A;  2E3T A;  4YXD B;  1JWA D;  2ACZ B;  4LTU A;  3VR9 B;  2PVO D;  1J7C A;  2WP9 B;  1ROE A;  3AE7 B;  5H8Y E;  1QLB B;  3ZYY X;  4YSZ B;  1J7A A;  1DOI A;  1EWY C;  2CU3 A;  2OHF A;  2WDQ B;  2PVG C;  2H89 B;  4N59 A;  3LXF A;  1JWB D;  3AEA B;  1WXQ A;  2WU5 B;  3VRA B;  1AYF A;  1QT9 A;  3AE5 B;  1L5P A;  3BII D;  4YTP B;  2WDV B;  1DOY A;  2QIE B;  5C2T B;  3P4Q B;  3HVZ A;  1WGK A;  1GPX A;  2MJE A;  4YT0 B;  1SB3 C;  1FO4 A;  1QOG A;  1PDX A;  1FM0 D;  1CJE A;  4WQM A;  1NEK B;  1WYG A;  1ZUD 2;  3HUI A;  2WU2 B;  2WLB A;  1AWD A;  1XLQ A;  2K22 A;  4KX6 B;  1N60 A;  4ZHP A;  1ZP0 B;  1TKE A;  2WS3 B;  5EE9 A;  2BS2 B;  3FC4 A;  3AE2 B;  2KAJ A;  3AB5 A;  1JQ4 A;  2BS4 B;  2W54 A;  3AM9 A;  1JAL A;  1JW9 D;  1R7S A;  1XLO A;  2AX5 A;  1XO3 A;  1FIQ A;  2JX5 A;  4P6V F;  1TJE A;  1YQ4 B;  1NVI D;  2JQR B;  2W3S A;  1RFK A;  2QJL A;  1E6E B;  1RYJ A;  1FFU A;  4FXC A;  1NI3 A;  2G1E A;  1FRD A;  1ZOY B;  2FBW B;  2WDR B;  5EE1 A;  5AUI A;  3W9C B;  1IUE A;  1WRI A;  1ZXI A;  4ZOH C;  4YTM B;  1B9R A;  1OFF A;  3SFD B;  1E9M A;  3AEC B;  4HRO A;  2M19 A;  4YSX B;  1L6V A;  1OQQ A;  1KRH A;  1SIJ A;  3AMZ A;  3L4P A;  2DBY A;  1SF0 A;  1FFV A;  1N63 A;  3P4S B;  1FXI A;  1RM6 C;  2PIA A;  3AE1 B;  4ITK A;  1QOA A;  1FXA A;  1KF6 B;  1N5W A;  1RWS A;  3ETR A;  4JWS C;  1JRO A;  1GAQ B;  2PKO A;  1V97 A;  4IDI A;  4N58 A;  1YQ3 B;  1DGJ A;  1NEN B;  1VJK A;  1KFY B;  4HRS A;  1DOX A;  1V8C A;  2CJO A;  2H88 B;  3AE4 B;  3ABV B;  3CIR B;  3RPF C;  1L0V B;  4JX1 C;  1I7H A;  3DWM A;  3W5U B;  5MPO A;  3P4R B;  4US9 A;  1FRR A;  3EUB 2;  3NS1 A;  1VLB A;  5G5H A;  2N0S B;  1CZP A;  4WWM A;  1NYQ A;  3SR6 A;  3NVW A;  1UWM A;  1VDV A;  3AEG B;  3FAH A;  2W3R A;  1J7B A;  4JWU C;  3W5V B;  3AH7 A;  3AED B;  1XLN A; 
#chains in the Genus database with same CATH topology
 3SU8 X;  1Y56 A;  2BB6 A;  3I5J C;  2A4Z A;  1TKG A;  2DYO A;  2M56 B;  2QIL A;  3N9Y C;  3NVZ A;  3B0A A;  2B76 B;  4WJQ A;  1I4R A;  2FUG 1;  2OED A;  2KDI A;  1GC7 A;  2XNA C;  2PMV A;  3GP7 A;  2WXK A;  2L8J A;  5EDS A;  1GC6 A;  5JZE B;  3WAP A;  2FUH B;  4IWO A;  1WYW B;  5BO4 B;  4JE3 B;  2WXM A;  3OJ3 A;  3N1X C;  5TR5 A;  3DBL I;  4ICV A;  3ZRC A;  3IBE A;  1P7F A;  1UUP A;  1EU4 A;  4OHJ A;  1YNT E;  1JRU A;  2DYB A;  3A4R A;  5AZG A;  1WX9 A;  1H8C A;  4B6W A;  1F2R I;  1D3Z A;  5JHB A;  4KIK A;  3IXS A;  2KJ6 A;  4NPN A;  3IT6 B;  4IKG A;  3W1Y A;  1DYQ A;  2J7Q B;  4WQM A;  1ZUD 2;  5GMV A;  3TBL D;  2LWP A;  1V80 A;  2WXJ A;  1WXS A;  1FFU A;  1XCQ L;  1ZOY B;  1I4Q A;  2LJ5 A;  3TMP B;  1E9M A;  2XN9 C;  3TL5 A;  3UIN B;  2D5G A;  3L4P A;  2DBY A;  1FFV A;  3AE1 B;  2ZZP B;  1SJH D;  1P9D U;  3N30 A;  1YQ3 B;  3KYC D;  1MVK A;  1DOX A;  4KGR A;  3VVW B;  1C79 A;  2NCN A;  5HKH A;  1UWM A;  3FAH A;  3W5V B;  4IOI E;  3PS6 A;  3Q6B A;  1NYR A;  2QCZ A;  1D6E C;  3CMM B;  2K5P A;  3APF A;  3AE9 B;  2WXP A;  2INP E;  2PW9 A;  1QOB A;  1OEY J;  4EZL A;  2LD9 A;  3IAM 1;  2KQS A;  4W9D A;  2JY6 A;  3QHT A;  2I38 A;  3M62 B;  2KN5 A;  4JQW C;  4N6E B;  2JF5 A;  4KZ0 A;  2KKC A;  4YXD B;  2KYW A;  4TUU A;  4M8M A;  1I4P A;  4BAX A;  2KN4 A;  4DDG D;  1ROE A;  2AQ1 B;  2HE7 A;  3DBL B;  2LGD A;  3LXF A;  2RDH A;  1QT9 A;  5C2T B;  2KWU B;  2BYE A;  4BKS A;  4AJY B;  1WYG A;  1V5O A;  2K6Q A;  3AU4 A;  2O6V D;  1M94 A;  4DK5 A;  2N9L A;  4GIV A;  3T3O A;  3C8Y A;  3PZ7 A;  4GN1 A;  1XLO A;  5D3D A;  5D6J B;  3ZIM A;  2JZ3 B;  1HZ6 A;  2WWZ A;  2W3S A;  3MHZ A;  4TMA B;  3SHQ A;  2KVR A;  2BYT A;  4G50 A;  3IAS 1;  3R7R A;  5C1Z A;  2BWE S;  1ET6 A;  4JGH B;  3AU5 A;  4X57 B;  1HTQ A;  2DZK A;  4ANV A;  2JWZ A;  1KFY B;  1J19 A;  3BVM A;  4II3 B;  3T8M A;  2M17 A;  1I7H A;  3W5U B;  4S0R A;  3ALB A;  1FRR A;  3ZDM C;  4WWM A;  2M8S A;  1T0Q C;  5EE0 A;  3HM3 A;  2N7D A;  2LGS A;  1A5R A;  1PGX A;  3ZNZ B;  3Q14 C;  4S17 A;  1UBI A;  4C4V A;  2KT7 A;  1WM3 A;  3P1M A;  1WE7 A;  3AI5 A;  1CK1 A;  5BMG A;  1I42 A;  1OTR B;  2AL6 A;  1YMH E;  2MBB B;  5J2R A;  2LRW A;  3BK1 A;  1N5X A;  2C7H A;  1LFD A;  2DNF A;  2GRI A;  3QAQ A;  2DLB A;  4PYU A;  4M8N A;  2KWC A;  3ZJV A;  3TEZ A;  4KSK C;  1GOZ A;  3DHG C;  3PHW B;  4IC7 B;  3M63 B;  1Q10 A;  5JXV A;  2TSS A;  4YSZ B;  1UEL A;  3HM6 X;  1LGR A;  3R8B A;  3QA8 A;  2A5U A;  2DZJ A;  3P4Q B;  1WXM A;  2NBU A;  2ZW1 A;  1GNU A;  1TS2 A;  2WLB A;  3Q8B A;  3PPA A;  3ZTC A;  5LXH A;  3IT4 B;  5G2N A;  2JRI B;  3RZF A;  4OW0 A;  3ZO5 B;  2OJR A;  1V5T A;  1RYJ A;  4FXC A;  4LNI A;  2BYF A;  2RPV A;  4IM0 A;  3ZVV A;  3UF8 A;  1WJ6 A;  3QX1 A;  3D32 A;  3ETR A;  3PTF C;  3ENE A;  3BVZ A;  4B95 A;  1DGJ A;  1NEN B;  2H88 B;  2MRP A;  3HHM A;  3KH0 A;  2AQ3 B;  2LUE A;  1E8W A;  2JUO A;  4FBJ B;  2ONQ A;  1VDV A;  2W3R A;  5DPW A;  5E6O A;  5KHO A;  5HI1 A;  4KGT A;  2N7E A;  4CHK A;  2KMM A;  5E6J A;  1E7V A;  3IG3 A;  5DCN A;  2LRU A;  4D2K A;  4XC2 A;  3HRD D;  2N1V A;  1WXV A;  2BB5 A;  4HVB A;  3RYT A;  2CJN A;  5G5G A;  2LXC A;  1WXA A;  5BMI A;  3AUL A;  4C7Z A;  4ICU A;  1KOT A;  1WX8 A;  1HZ5 A;  2WXI A;  3KUZ A;  3V05 A;  2D11 A;  2L7R A;  4USA A;  2NTT A;  3DBH B;  4OZC A;  4CQN A;  2O6V A;  2MCN B;  1WR6 E;  3PLV A;  5I4D A;  4A3P A;  1JML A;  5IAA C;  1D5X C;  4LLG M;  3B08 A;  1XT9 B;  3L13 A;  2WU5 B;  3I9V 1;  4K7U A;  4MSM B;  2ZEQ A;  3VH3 B;  2MJE A;  3JW0 X;  1Q0W B;  2Z59 B;  4P7I A;  1C78 A;  1GB1 A;  2K6D B;  3TCA A;  2AX5 A;  2LHE A;  3FKY A;  5BYR A;  4C56 C;  2I1K A;  4TQ0 A;  1FRD A;  5J18 A;  4ZOH C;  2VZK B;  1C77 A;  3ML8 A;  4II2 B;  2MEK A;  2KC2 A;  3BWU D;  2JRH A;  3EC8 A;  4MSQ B;  4LNF A;  1ZPS A;  1JCK B;  2MLB A;  3BIN A;  4XX5 A;  2G4S A;  2YLM A;  3QIJ A;  4ANX A;  2DYM A;  3R2T A;  3CIR B;  3AE4 B;  3ABV B;  1L0V B;  4LK0 M;  4EEW A;  3DVN U;  3CSF A;  3ZNG C;  3EUB 2;  4DQO C;  3VTU A;  3Q69 A;  3SR6 A;  3C19 A;  2YEP F;  3AED B;  3PZ8 A;  1EWC A;  3L17 A;  1D5M C;  1N62 A;  1FNV A;  3ZQ4 A;  2RDG A;  2HJ8 A;  4YTN B;  3SFE B;  2XBB C;  3PRM B;  5HFY A;  1SJE D;  4G3X B;  2WXO A;  4C4V B;  3RNC C;  4I6L B;  4AP4 C;  4MGZ E;  4H2A A;  3A33 B;  1GG3 A;  2ZPY A;  3Q3N C;  3B2F A;  4BKT A;  1JRP A;  4KGS A;  3CF6 E;  2WXQ A;  4A3O A;  3NZ3 A;  2E3T A;  2REX A;  1FCC C;  4DXF A;  1E5W A;  4RF1 A;  3X23 A;  3PRE A;  3R66 C;  1SE3 A;  1VD2 A;  4EUT A;  1AYF A;  3BII D;  5CTR C;  1SE4 A;  4FN2 A;  4RGT A;  1ZE3 D;  3K9P B;  1VZ7 A;  4KSL C;  1I4G A;  4E3C A;  4UDU C;  4TQ1 A;  1NEK B;  4KX6 B;  3Q2A C;  2KMC A;  3AE2 B;  4QAY A;  3QAR A;  4RM8 A;  2J0J A;  2KVZ A;  4F7Z A;  1FIQ A;  2PLP A;  4HCP B;  3MHS D;  1WZ0 A;  3L16 A;  4YTM B;  2INN E;  2KAC A;  1WJU A;  4RGN A;  2M19 A;  4YSX B;  2L1A A;  1TBE A;  4ITK A;  4O1N A;  3TIX A;  1TS5 A;  2MX2 A;  4JWS C;  1ZDV A;  2GBM A;  3IFW B;  3APD A;  4W9I A;  1V8C A;  2W9N A;  5IA7 A;  3V61 A;  2OOB B;  4ZRK A;  5D2M B;  2WHI A;  3NY5 A;  4WWP A;  3UI3 A;  1MHH E;  4P1C C;  1OEY A;  3Q8F A;  1F52 A;  3TSS A;  1WH3 A;  2IO0 B;  1UF0 A;  4NQK E;  1FCL A;  1LM8 B;  2Z0E B;  1FNW A;  3RNF C;  2NBW B;  3EFU A;  2XEW A;  1QOF A;  2C9W B;  3GZN B;  1E8Z A;  2G4D B;  2VZK D;  2HTM E;  2L05 A;  4OVV A;  2KJH B;  1Y8R C;  2FCM A;  1S3S G;  2AQ2 B;  4WJO A;  4W9H A;  3O65 B;  1TZ1 A;  1WFY A;  1YOV B;  4W9C A;  1WGG A;  3ZJT A;  3ZXV A;  2RR9 A;  3ZGZ A;  4NY0 A;  4B0M A;  3MJW A;  2J4X A;  4FJV B;  3B2G A;  3ZLZ A;  3NHE B;  2IPK D;  2ZCB A;  1IPG A;  1ET9 A;  1V9J A;  2Y5P A;  2WP9 B;  3H7S A;  2O6V B;  4MGY E;  4C00 A;  3KWV A;  3BYT B;  2IND C;  1WGK A;  3EA6 A;  1MJD A;  1CJE A;  3U2S C;  1AWD A;  2KO3 A;  2K22 A;  1UZX B;  4DHZ E;  2FIF A;  2KFJ A;  4I6N B;  4PS8 A;  1C76 A;  4HPM B;  4MGI E;  1F9J A;  1V81 A;  1YQ4 B;  5AZH A;  2FBW B;  3N1Y C;  4HRO A;  4XZ4 A;  2N9K A;  4PS3 A;  4WJN A;  4BBN C;  4RMA A;  1KRH A;  3N32 A;  4A6Q A;  2IYD B;  1WMH A;  2KNB A;  2Z0D B;  4HRS A;  1C4P A;  3L0W B;  2UWQ A;  1LQB A;  2V3N A;  2LUM A;  1VLB A;  2G45 B;  5D94 A;  2K8C A;  4L2Y A;  3AEG B;  2V1Y A;  2BQQ A;  3BY4 B;  1WZ3 A;  2RDB C;  1Q5W B;  2JU6 X;  1WRD B;  1F1H A;  3AEE B;  1T5X D;  2C7N B;  1K52 A;  1ZGU B;  4MJS A;  1PFD A;  1ZXH A;  5C23 A;  2HJ1 A;  5C3J B;  4IUM B;  2CHX A;  3ZXR A;  3WAO A;  2ZCC A;  2NVU I;  3ZKJ C;  4PT5 A;  2CS4 A;  2BS3 B;  2WX0 A;  1XLP A;  3Q8C A;  2KOX A;  4K3C A;  2DHZ A;  4IM3 A;  5CHW A;  1WM2 A;  3P42 A;  3GS2 A;  4L1B A;  4GLS C;  4HLE A;  2J0M A;  2DZI A;  1YD8 U;  1J7A A;  3T9L A;  2BPS A;  3A9J A;  1WY8 A;  1JWB D;  4RH6 A;  1PGB A;  4RFB A;  4MM3 A;  1I4X A;  1HXY D;  1XCT L;  4XDC A;  2WU2 B;  3P2B A;  3MC9 A;  1L4D B;  3B1L X;  5DPT A;  2JYE A;  2KAN A;  1H4R A;  3ZRF A;  1BT0 A;  2G1E A;  1T0S C;  3W9C B;  2QEJ C;  1OFF A;  2KDB A;  3DBS A;  1CMX B;  1SF0 A;  2DZM A;  3VUW A;  1HQR D;  4LNK A;  3I57 A;  1GAQ B;  1FPY A;  1V97 A;  2JSV X;  4JLC A;  2N1W A;  2WXL A;  1IYF A;  5T8I A;  4HPP A;  3UIO B;  2KLG A;  2DAJ A;  3DVG X;  2QC8 A;  4HXD A;  4M00 A;  1WI0 A;  1AN8 A;  3JYU A;  2LAS A;  4W9E A;  1QF6 A;  4MH0 E;  1KTK A;  3ZNI D;  1N61 A;  4LNN A;  1TIF A;  1E0Z A;  3AEF B;  2J0K A;  2PE9 A;  1TYG B;  1AW7 A;  2QMT A;  1FMA D;  5J17 A;  1ZKH A;  2LGY A;  2FNJ B;  1CQV A;  4A8X C;  1C3T A;  1WWT A;  3KUD B;  3WAM A;  4FJZ A;  4JL9 A;  2MH7 A;  3RI7 C;  2L83 A;  1E7P B;  2D3A A;  1V6E A;  1K8R B;  3HIZ A;  4KDI C;  5AUK A;  4DHJ B;  2MJD A;  3RNE C;  4F8C B;  1SEB D;  2G9H D;  2R2O A;  1ZDX A;  4PYZ A;  4HDO A;  5DPS A;  4W9K A;  5H8Y E;  4EOY A;  4IW0 A;  2J53 A;  4BKG A;  3A1Q B;  4YTP B;  3Q8A A;  1ACC A;  3HVZ A;  3DBH I;  3RN9 C;  4FLH A;  4W9F A;  3LDZ E;  4ZRQ A;  1V1P A;  2D2Q A;  3N3K B;  3PHX B;  2WXF A;  3GB1 A;  4LDT D;  2PTL A;  4WWN A;  5EE9 A;  4K7W A;  3GE3 C;  2KAJ A;  3PSE B;  1JQ4 A;  3AM9 A;  2JYT A;  5IKC M;  3O13 A;  4MDK E;  2RSU A;  4K3B A;  2D07 B;  3VQI A;  1IUE A;  4ASW C;  2ICI A;  2L0T A;  1SIJ A;  2LVO A;  3QK0 A;  1IP9 A;  2ZNV B;  4GDK B;  1PYW D;  2M0X A;  1QOA A;  1FXA A;  4DBG A;  2KWD A;  4N58 A;  4EE2 A;  1UH6 A;  2HD5 B;  1WMH B;  3A9K A;  5IO9 A;  2OJW A;  2AYO B;  2KTR B;  2K1F A;  3P4R B;  4XWT A;  2MA9 B;  3NVW A;  2D3C A;  1QQR A;  3ONS A;  4WQO B;  1UD7 A;  1PUT A;  1A70 A;  2NTS A;  2N9E B;  1OQR A;  3U4E G;  4HKQ A;  2LXA A;  2ZVO A;  2IDY A;  3PV1 A;  4MJS B;  3JSV A;  4YSY B;  2PPH A;  3OJ4 B;  4A9A A;  1FEH A;  1T0R C;  2KK8 A;  4AWJ A;  4XDD A;  2L3Z A;  4MEL A;  3K9O B;  1QIL A;  1JWS D;  2L76 A;  1IBX B;  1D4B A;  4RCO A;  4C7Y A;  4C80 A;  3AV8 A;  1I4H A;  1T3Q A;  2W55 A;  2L0F A;  5TSS A;  3AXC A;  1RLF A;  2LGI A;  3NZS A;  2NPT B;  2JWU A;  3DCG A;  3ZYY X;  5CHF A;  1DOI A;  1EWY C;  2OHF A;  2WDQ B;  4GB9 A;  4J3O D;  3UGB B;  1IGD A;  1L5P A;  1SSN A;  1K50 A;  2LJI A;  1MHX A;  2BKR B;  2QIE B;  3A9J B;  1FO4 A;  5CX3 A;  4I6P A;  1WR1 A;  4MM3 B;  4K7S A;  4HK2 A;  3FC4 A;  3AB5 A;  1L4Z B;  2ZVN A;  4EFO A;  4P6V F;  3ZDT A;  2VH1 A;  3RUL A;  1RFK A;  3KVF B;  4NAW B;  1NI3 A;  4A20 A;  3PZD A;  4DHJ D;  2V9H A;  4ACF A;  1ESF A;  3WAN A;  2KMA A;  5LXI B;  1R4N I;  4NZL B;  2KHW B;  4IDI A;  2ZNV C;  4KVG B;  1YX5 B;  4KDL B;  5JH5 C;  2RPQ A;  5MPO A;  2X8X X;  1IGC A;  3QWZ B;  1TGZ B;  1NYQ A;  3KUC B;  4NAM A;  3GOE A;  4IG7 B;  3WAL A;  5EE3 A;  3NVV A;  2WNM A;  2KQ4 X;  3PVL A;  1PQS A;  2K9X A;  3VR8 B;  2JT4 B;  3VTW A;  1ENF A;  3V6E B;  1YX6 B;  2IO2 B;  1EF1 A;  1KH0 A;  5E6N A;  1UGM A;  2C5L C;  1TKY A;  3HK0 A;  1C4A A;  2NBV B;  3L08 A;  3GZN I;  5AZF A;  2FID A;  5GXG B;  2AEH A;  2GBK A;  3EEC A;  4GXB A;  1C9F A;  3EFC A;  2CR5 A;  2YVC A;  1JWA D;  4MT5 A;  1D5Z C;  1E90 A;  2K3U A;  4GDL B;  2J42 A;  1BUI C;  3SDL C;  1ISN A;  1E8X A;  2E6X A;  3ML9 A;  4ARC A;  4E71 A;  3AEA B;  3H9D A;  1SXT A;  4B0E A;  3RNG C;  1SB3 C;  4HJG E;  2LZ6 A;  4WAF A;  3TEX A;  3MC8 A;  1Z2M A;  2RMM A;  1J8C A;  1KLG D;  3MTN B;  1V1P B;  1P98 A;  1YQB A;  3EGR A;  3Q3F A;  4WUR A;  3ZTD A;  3VAW A;  2O2V A;  4RM9 A;  1YJ1 A;  1XO3 A;  2KJR A;  3NOB A;  2ZPN A;  1E6E B;  4HCN B;  5KHQ A;  3OAW A;  4HEA 1;  3LYY A;  4R3D A;  3AMZ A;  2GMI C;  2IJ0 A;  3DHH C;  3P4S B;  1R4M I;  2KXJ A;  2UU7 A;  3Q3M C;  1V49 A;  1JWM D;  2MBE A;  5FR3 A;  1F77 A;  2IY0 B;  1T0Y A;  1R4N B;  4ZYS A;  4JIO U;  3DWM A;  4HPL B;  1G6J A;  3A9K B;  2MSE D;  1MFW A;  5DPR A;  4FHJ A;  3UQB A;  5LNK 1;  4NJC A;  3AE3 B;  3PRZ A;  3U8Z A;  3N1Z C;  1B1Z A;  3PO0 A;  4EZK A;  2I2Y A;  3A4S C;  5D3I B;  2D3G A;  1BML C;  2AWT A;  3URY A;  3JSV B;  4FHK A;  2UYZ B;  3DVN V;  3E56 A;  3R2I A;  1WGY A;  1KLU D;  3RNA C;  2KX0 A;  3DPD A;  3JVZ X;  2PEA A;  2WQY B;  1F0Z A;  3V6C B;  4ZHO A;  1TY0 A;  2Q5W D;  2MJ3 A;  4ZRI A;  2LHD A;  2GB1 A;  3H8H A;  1I35 A;  4AS1 A;  1V86 A;  2R2Q A;  3DOW A;  3PRP B;  4Q2J A;  3QC8 B;  2K39 A;  4AQ7 A;  1C1Y B;  4P16 A;  4YT0 B;  1QOG A;  3T3N A;  3X0W A;  4F1S A;  1N60 A;  2KFK A;  2BGF A;  2EEL A;  2KX3 A;  4NJ6 A;  2WXN A;  1JAL A;  1JW9 D;  1BXT A;  2C60 A;  2JQR B;  3A1Q A;  2FCS A;  2V3P A;  1WRI A;  1KM7 A;  3AEC B;  1NBF C;  3RUI B;  2MW5 A;  2CKH B;  3VUX A;  4LNO A;  1UWX A;  2Z8L A;  1WJ4 A;  2JXT A;  3IVF A;  1EO6 A;  1R4M B;  1XF5 L;  4GOC A;  1TY2 A;  3NS1 A;  1CZP A;  4BOZ B;  1LXD A;  1TS4 A;  3H7P A;  3V62 A;  4JWU C;  2INC C;  4GDK A;  3WA0 A;  2KDM A;  2K0P A;  2MWS B;  4WAA A;  3TJP A;  3KLS X;  2BW2 A;  2BVC A;  2KDE B;  4MGK E;  2L32 A;  2ON8 A;  4B9K A;  2KTR A;  4AOF A;  4KKJ A;  1WE6 A;  5BYS A;  4HKZ E;  2IO3 B;  2PJH A;  2AL3 A;  3WCQ A;  1VR9 A;  1GB4 A;  3TUO A;  2MP2 A;  3NS8 A;  4KV2 A;  1VCB A;  4YL8 A;  3VFK A;  2PVO D;  5HG2 A;  2MBQ A;  3UIP B;  4RGO S;  2V4I B;  2EKE C;  2CHW A;  4ZDV A;  4LDT B;  4BZA A;  1WXQ A;  4ANU A;  3AE5 B;  2LFI A;  1IBX A;  3ECI A;  1GPX A;  1OGW A;  1L7Y A;  4G0N B;  1XD3 B;  5IN7 A;  4PK1 A;  4K81 A;  1EUV B;  3DVG Y;  2WS3 B;  3MFG A;  2BS2 B;  3PGE A;  3Q3O C;  2NPT A;  2J52 A;  1TJE A;  4RGM A;  2O2V B;  4FJY A;  1U4A A;  4NQL B;  4L23 A;  3VHT C;  3J9C A;  4NJ7 A;  2C7M B;  1J0G A;  2KDF B;  2IGD A;  1KF6 B;  5E6P A;  3Q3J A;  2KD0 A;  3ZUN A;  2LVP A;  1VJK A;  1MG4 A;  1V2Y A;  2JXX A;  5IOI A;  3V3X A;  2CJO A;  1K53 A;  4NAW A;  3KYD D;  4US9 A;  1RRB A;  2M1M A;  2V4L A;  2IGG A;  3VXW A;  1QZE A;  2LMC A;  2N7J A;  3NVY A;  3DBR I;  2L52 A;  2IO1 B;  3LB8 C;  3R7Q A;  3VUY A;  3PLU A;  2K8B A;  5H92 C;  1K51 A;  2D10 A;  1WF9 A;  4KZC A;  1NI2 A;  1P7E A;  4US8 A;  3L54 A;  3V60 A;  2LGX A;  5BMH A;  2SEB D;  3OG5 A;  1P0R A;  1SE2 A;  2DAF A;  3DWG C;  1EF5 A;  5D7G A;  1XXG A;  4REZ A;  4XYC A;  4TV3 A;  1E10 A;  2CU1 A;  4MH8 A;  3FIL A;  2LVQ A;  4LTU A;  2IGH A;  3DDC B;  4BVU C;  4TKN A;  4CYE A;  2CU3 A;  3EHV A;  4M0W A;  4K1R B;  3ZJU A;  4M01 A;  3RD2 A;  2WDV B;  2ZJD A;  3ZW3 A;  3VH4 B;  2ZW0 A;  1RFA A;  1UBQ A;  2M0A A;  3RMK C;  1YIW A;  2QSD A;  1ZP0 B;  4GDL A;  2WYQ A;  2KFK B;  4E74 A;  2IBI B;  2MHJ A;  1NVI D;  2Y5B B;  5LLI A;  3W2D A;  2JPH A;  3U52 E;  2PIA A;  1GUA B;  3C0R B;  2FCQ A;  2GLS A;  2WXR A;  3U30 A;  1P3Q U;  1TTN A;  1VZ8 A;  1RAX A;  2R61 A;  3SEB A;  5G5H A;  4DXG A;  2N0S B;  4DXA B;  2GBN A;  4XWW A;  3KWL A;  3AH7 A;  4DDI D;  2B3A A;  4MAC A;  2DWQ A;  2MBH A;  3H7P B;  3CWI A;  2NR2 A;  3WIM A;  3QQ8 B;  4OZB A;  2G3Q B;  1Z5S B;  3DBR B;  4JPS A;  2XK5 A;  4W9G A;  3NRZ A;  2LI5 A;  2RGF A;  1AAR A;  2BT6 A;  2Y3A A;  4WWO A;  2DX5 B;  2WXH A;  3BK2 A;  4ZRJ A;  4CO7 A;  3DHI C;  1N6Z A;  3N20 C;  4EKU A;  4ZYN A;  4KIK B;  1UNS A;  1YJI A;  3P4P B;  3CST A;  1UGJ A;  1KLV A;  1PGA A;  3GE8 C;  1YN5 A;  4KKI A;  1WGR A;  2JZZ A;  1HA5 A;  2MP2 B;  1F2R C;  4BFR A;  1J7C A;  1XEE A;  3U7D A;  3AE7 B;  2ASQ A;  5L95 C;  2FCN A;  5JHA A;  2BTE A;  3U7Z A;  1E8Y A;  1T6B X;  2JVC A;  3ZNH B;  1JWU D;  2EMT A;  3PT2 B;  1MI0 A;  3E9S A;  3RFZ B;  1VZ6 A;  1NDD A;  4FA6 A;  1FNU A;  3KQ4 A;  2KLC A;  2KZR A;  4IWP A;  2JX5 A;  3I3T B;  3MC0 B;  5EE1 A;  5AUI A;  4J6I A;  1B9R A;  4A90 A;  1QKZ A;  4IM2 A;  4MEM A;  2GBR A;  3W1S C;  1N5W A;  1Q1O A;  2VH2 A;  4WH4 A;  3I63 C;  2PKO A;  3RPF C;  4BOS C;  4ZRP A;  2KC1 A;  1FD6 A;  1WX7 A;  4LJP B;  5FR6 A;  1FXT B;  1MG8 A;  1EU3 A;  3R3M A;  1YJJ A;  4XE0 A;  4WIP A;  2BYV E;  4ANW A;  2LEK A;  4M02 A;  1L0X B;  3VRB B;  4HJK A;  1WGH A;  4GU2 A;  1XQQ A;  4LCD E;  2EKI A;  3AEB B;  2HTH A;  3OLM D;  1YN4 A;  3Q8E A;  3P63 A;  2QHO A;  2Y5C A;  3BYY B;  2GI9 A;  3KW5 B;  4N9F 4;  2D3B A;  3AN1 A;  3QCA A;  4OVZ A;  2K8H A;  2WDT B;  1TZO A;  2EMS A;  4GGQ A;  2HDE A;  3VR9 B;  2N4F A;  4YWG G;  1SIF A;  1QLB B;  2DEN B;  3FIL B;  3VTV A;  4N59 A;  3VRA B;  2BWF A;  2L00 B;  4NNJ B;  4M0W B;  3S2A A;  3RT3 B;  3TEW A;  4EZJ A;  2NS5 A;  1PDX A;  4FAD A;  2K25 A;  3HUI A;  2FE8 A;  1WIA A;  4RNA A;  2MQJ A;  2QJL A;  2WGS A;  2WDR B;  3M95 A;  3VDZ A;  1HTO A;  4A55 A;  3HVD A;  3H6N A;  2V0G A;  3BZD B;  4G11 A;  4DHZ B;  1TS3 A;  4GMV A;  1N63 A;  1RM6 C;  4GSW A;  1JRO A;  5L83 A;  2YEP B;  2JZP A;  4ARI A;  3LJ3 A;  5FKA C;  2VRR B;  1HEZ E;  3NUH B;  5CHV C;  2WXG A;  1WSP A;  4OVU A;  1LO5 D;  1J7B A;  4JX1 C;  4PS7 A;  2SAK A;  2MBO A;  3AE6 B;  3AE8 B;  1MPE A;  1L6U A;  3SD5 A;  2GBJ A;  2NMQ A;  1GJZ A;  3B9J A;  4BBN F;  2I1J A;  2CHZ A;  2N9P C;  4URK A;  1OQY A;  2BBC A;  2XK5 B;  2RD0 A;  2W82 A;  5FK9 C;  3QJZ A;  3MJ5 A;  4TSS A;  1KJT A;  3MP9 A;  3IHP C;  1P1A A;  4DWF A;  1EM7 A;  2FAZ A;  1S1Q B;  1SE9 A;  1VRA B;  3OWE B;  1X1M A;  3APC A;  4W9J A;  2ACZ B;  2KQ7 A;  4XGA B;  2IY1 B;  1SGH A;  3UQA A;  2BF8 B;  2PVG C;  2H89 B;  1TT5 B;  3RNB C;  2M4N A;  1E7U A;  1HE8 A;  3NG0 A;  2N9X A;  5G55 A;  3NZU A;  1SBB B;  2BKF A;  2GOW A;  5IP4 D;  3DQV A;  4RF0 A;  1FM0 D;  2PE6 B;  4ZHP A;  1ZW7 A;  1XLQ A;  1TKE A;  3M3J A;  4HDQ A;  3L10 B;  3RZW C;  2BS4 B;  2W54 A;  3H1U A;  4LJO B;  1R7S A;  4W9L A;  2KTF A;  5HHD G;  2KWV B;  1DOY A;  1YN3 A;  1V1O A;  1ZXI A;  5BYQ A;  3SFD B;  4BKS D;  1L6V A;  1OQQ A;  3BVG A;  4IWQ A;  1M4V A;  2X38 A;  2QDF A;  4AJW A;  1FXI A;  4WJP A;  2WX1 A;  1RWS A;  1WGD A;  3RCZ A;  3TEY A;  2V3S A;  1STE A;  4P1B C;  4HWI B;  1L0Y B;  3W1S A;  1C4C A;  2IZV B;  1WJN A;  4AUQ C;  3NJT A;  4OZA A;  4FUL A;  1L2N A;  5AEK B;  1XLN A; 
#chains in the Genus database with same CATH homology
 2N7J A;  3PZ8 A;  1Y56 A;  3NVY A;  1QQR A;  1EWC A;  2BB6 A;  2L52 A;  1D5M C;  1N62 A;  1FNV A;  1PUT A;  3LB8 C;  2RDG A;  3ZQ4 A;  1TKG A;  1A70 A;  2DYO A;  2NTS A;  5H92 C;  4YTN B;  1OQR A;  3U4E G;  1K51 A;  2M56 B;  2QIL A;  3SFE B;  4HKQ A;  3N9Y C;  3NVZ A;  1SJE D;  2IDY A;  5HFY A;  2WXO A;  2B76 B;  1I4R A;  1P7E A;  2FUG 1;  4YSY B;  4US8 A;  2OED A;  4A9A A;  1FEH A;  4H2A A;  4XDD A;  2XNA C;  5BMH A;  2SEB D;  2PMV A;  3GP7 A;  1QIL A;  2WXK A;  1SE2 A;  3DWG C;  1JWS D;  1IBX B;  1D4B A;  3B2F A;  5D7G A;  1JRP A;  4RCO A;  1XXG A;  4C7Y A;  4JE3 B;  4C80 A;  4REZ A;  2WXM A;  4KGS A;  3AV8 A;  1I4H A;  1T3Q A;  1E10 A;  2WXQ A;  2W55 A;  5TSS A;  3NZ3 A;  2E3T A;  1FCC C;  4DXF A;  4MH8 A;  3FIL A;  1P7F A;  2LGI A;  1UUP A;  1EU4 A;  4LTU A;  2IGH A;  4OHJ A;  1YNT E;  2JWU A;  4RF1 A;  3ZYY X;  1DOI A;  1EWY C;  2CU3 A;  4M0W A;  2OHF A;  1SE3 A;  2WDQ B;  4J3O D;  3ZJU A;  1AYF A;  1IGD A;  1F2R I;  1L5P A;  1SSN A;  3BII D;  1K50 A;  2LJI A;  1MHX A;  1SE4 A;  2QIE B;  2WDV B;  3IXS A;  4RGT A;  1ZE3 D;  3IT6 B;  4IKG A;  1VZ7 A;  2ZW0 A;  1I4G A;  1FO4 A;  4UDU C;  4TQ1 A;  1DYQ A;  4WQM A;  2M0A A;  1NEK B;  4MM3 B;  1ZUD 2;  4KX6 B;  2QSD A;  1ZP0 B;  3FC4 A;  3AE2 B;  3AB5 A;  1L4Z B;  1FIQ A;  2PLP A;  4P6V F;  1NVI D;  2WXJ A;  1RFK A;  1FFU A;  4NAW B;  1NI3 A;  1XCQ L;  1ZOY B;  3W2D A;  1I4Q A;  4YTM B;  2INN E;  2KAC A;  4RGN A;  1E9M A;  1ESF A;  2XN9 C;  2M19 A;  4YSX B;  2D5G A;  3L4P A;  2DBY A;  1FFV A;  3U52 E;  2L1A A;  2PIA A;  3AE1 B;  4ITK A;  4O1N A;  1SJH D;  1TS5 A;  4JWS C;  1ZDV A;  2WXR A;  4NZL B;  4IDI A;  1YQ3 B;  1MVK A;  1DOX A;  1V8C A;  4KGR A;  1VZ8 A;  5MPO A;  2R61 A;  3SEB A;  5G5H A;  3UI3 A;  1IGC A;  4DXG A;  1C79 A;  1MHH E;  2N0S B;  1NYQ A;  1UWM A;  3Q8F A;  4XWW A;  3FAH A;  3TSS A;  3KWL A;  3W5V B;  4NAM A;  3AH7 A;  4MAC A;  5EE3 A;  2DWQ A;  4IOI E;  1FCL A;  1NYR A;  1D6E C;  1FNW A;  3NVV A;  2K5P A;  2KQ4 X;  2WNM A;  3CWI A;  4OZB A;  1QOF A;  2K9X A;  3AE9 B;  2WXP A;  3VR8 B;  4JPS A;  3NRZ A;  1ENF A;  2INP E;  2HTM E;  2PW9 A;  2VZK D;  1QOB A;  2BT6 A;  2Y3A A;  2WXH A;  2AQ2 B;  3BK2 A;  3IAM 1;  1KH0 A;  4GDL B;  1TKY A;  2I38 A;  1C4A A;  3ZJT A;  1UNS A;  1YJI A;  3P4P B;  4N6E B;  1UGJ A;  5GXG B;  3ZGZ A;  1PGA A;  1YN5 A;  4KKI A;  4B0M A;  2J4X A;  1C9F A;  3B2G A;  1HA5 A;  4YXD B;  1F2R C;  2IPK D;  1JWA D;  4MT5 A;  1D5Z C;  1I4P A;  2K3U A;  2J42 A;  1BUI C;  2KN4 A;  1ET9 A;  1J7C A;  1XEE A;  2WP9 B;  1ROE A;  2AQ1 B;  2Y5P A;  3AE7 B;  2E6X A;  3KWV A;  4ARC A;  3LXF A;  3AEA B;  2RDH A;  3BYT B;  1QT9 A;  2BTE A;  3U7Z A;  1SXT A;  4B0E A;  1T6B X;  5C2T B;  1JWU D;  1MI0 A;  1WGK A;  3EA6 A;  3E9S A;  3RFZ B;  1SB3 C;  4HJG E;  1VZ6 A;  1CJE A;  4WAF A;  1FNU A;  3U2S C;  1WYG A;  3TEX A;  1AWD A;  2K22 A;  3KQ4 A;  2RMM A;  2N9L A;  1KLG D;  1V1P B;  1C76 A;  3T3O A;  3C8Y A;  3EGR A;  4WUR A;  3PZ7 A;  1XLO A;  1XO3 A;  2JX5 A;  5D3D A;  3MC0 B;  1YQ4 B;  1HZ6 A;  3MHZ A;  2W3S A;  4TMA B;  1E6E B;  5EE1 A;  2FBW B;  4HEA 1;  5AUI A;  1B9R A;  3LYY A;  2BYT A;  4R3D A;  4A90 A;  4HRO A;  2N9K A;  1QKZ A;  3IAS 1;  3AMZ A;  1KRH A;  2IJ0 A;  3P4S B;  1ET6 A;  4A6Q A;  1N5W A;  4WH4 A;  2PKO A;  1JWM D;  5FR3 A;  4HRS A;  1KFY B;  1C4P A;  1F77 A;  3BVM A;  3RPF C;  4ZRP A;  4ZYS A;  1I7H A;  2V3N A;  3DWM A;  2LUM A;  3W5U B;  1FD6 A;  1FRR A;  1VLB A;  4WWM A;  4L2Y A;  3AEG B;  1EU3 A;  5EE0 A;  5LNK 1;  2JU6 X;  4NJC A;  1YJJ A;  3AEE B;  1PGX A;  4XE0 A;  3AE3 B;  4WIP A;  1T5X D;  2LEK A;  1K52 A;  1L0X B;  3VRB B;  1PFD A;  1ZXH A;  1B1Z A;  3PO0 A;  2I2Y A;  3P1M A;  5C3J B;  2EKI A;  3AEB B;  5D3I B;  4PT5 A;  1BML C;  1YN4 A;  3Q8E A;  1CK1 A;  2BS3 B;  5BMG A;  3URY A;  3P63 A;  3E56 A;  3R2I A;  1XLP A;  1KLU D;  2Y5C A;  3BYY B;  1YMH E;  2GI9 A;  3Q8C A;  2WQY B;  1F0Z A;  4ZHO A;  3BK1 A;  1N5X A;  3AN1 A;  1TY0 A;  2Q5W D;  2GRI A;  2MJ3 A;  2DLB A;  2LHD A;  4OVZ A;  3P42 A;  3ZJV A;  2GB1 A;  3H8H A;  3TEZ A;  4AS1 A;  3GS2 A;  1GOZ A;  1TZO A;  4L1B A;  1Q10 A;  4GLS C;  2HDE A;  3VR9 B;  4YWG G;  5JXV A;  2TSS A;  1QLB B;  4YSZ B;  1J7A A;  3FIL B;  4N59 A;  3R8B A;  4Q2J A;  1JWB D;  3VRA B;  4RH6 A;  1PGB A;  4RFB A;  4AQ7 A;  3P4Q B;  3TEW A;  4P16 A;  4YT0 B;  1I4X A;  1QOG A;  1PDX A;  3T3N A;  1HXY D;  1XCT L;  2ZW1 A;  1TS2 A;  3HUI A;  2WU2 B;  2WLB A;  4XDC A;  2FE8 A;  1N60 A;  3Q8B A;  1L4D B;  2EEL A;  2WXN A;  2JYE A;  3IT4 B;  4RNA A;  1JAL A;  1JW9 D;  1BXT A;  4OW0 A;  2JQR B;  2QJL A;  1RYJ A;  4FXC A;  2G1E A;  2V3P A;  2WDR B;  3W9C B;  1WRI A;  4A55 A;  2QEJ C;  1OFF A;  2RPV A;  3AEC B;  3HVD A;  2V0G A;  3BZD B;  1TS3 A;  1SF0 A;  1N63 A;  1RM6 C;  1UWX A;  2Z8L A;  1HQR D;  3ETR A;  1JRO A;  2JXT A;  3I57 A;  1GAQ B;  3BVZ A;  2JSV X;  1V97 A;  2YEP B;  2JZP A;  2WXL A;  1DGJ A;  1NEN B;  5T8I A;  4ARI A;  5FKA C;  2H88 B;  1XF5 L;  1HEZ E;  3NUH B;  1TY2 A;  2AQ3 B;  2WXG A;  3NS1 A;  1CZP A;  2ONQ A;  1WSP A;  1VDV A;  1AN8 A;  1TS4 A;  1LO5 D;  1J7B A;  2W3R A;  4JX1 C;  4JWU C;  1QF6 A;  2SAK A;  4KGT A;  5HI1 A;  1KTK A;  2KDM A;  2K0P A;  1N61 A;  3AE6 B;  3AE8 B;  2KMM A;  5E6J A;  1MPE A;  1L6U A;  3KLS X;  2BW2 A;  2NMQ A;  4D2K A;  3B9J A;  1E0Z A;  3HRD D;  3AEF B;  2L32 A;  2ON8 A;  2BB5 A;  2CJN A;  1TYG B;  2BBC A;  5G5G A;  1AW7 A;  2QMT A;  1FMA D;  2W82 A;  4KKJ A;  5BYS A;  4HKZ E;  5BMI A;  5FK9 C;  1CQV A;  3MJ5 A;  4A8X C;  4TSS A;  1WWT A;  3MP9 A;  3WCQ A;  1VR9 A;  4C7Z A;  2MH7 A;  1HZ5 A;  2WXI A;  1EM7 A;  1E7P B;  2L83 A;  3V05 A;  1VRA B;  1GB4 A;  5AUK A;  3OWE B;  3TUO A;  2MJD A;  4USA A;  1SEB D;  2G9H D;  2NTT A;  1ZDX A;  4OZC A;  2ACZ B;  4CQN A;  2PVO D;  5I4D A;  5H8Y E;  5HG2 A;  4RGO S;  2V4I B;  1JML A;  2PVG C;  1D5X C;  2H89 B;  4LLG M;  1WXQ A;  2J53 A;  2WU5 B;  3AE5 B;  3I9V 1;  4YTP B;  2LFI A;  1IBX A;  3Q8A A;  1ACC A;  3HVZ A;  1SBB B;  1GPX A;  2MJE A;  4RF0 A;  1FM0 D;  4ZRQ A;  1V1P A;  4ZHP A;  2WXF A;  1XLQ A;  3GB1 A;  1TKE A;  1C78 A;  2PTL A;  2WS3 B;  3MFG A;  2BS2 B;  5EE9 A;  1GB1 A;  2KAJ A;  2J52 A;  1JQ4 A;  2BS4 B;  2W54 A;  3AM9 A;  2AX5 A;  1R7S A;  2JYT A;  2LHE A;  5HHD G;  5BYR A;  3O13 A;  4C56 C;  1TJE A;  4RGM A;  4TQ0 A;  1FRD A;  1YN3 A;  4L23 A;  1DOY A;  1V1O A;  3VQI A;  1IUE A;  4ZOH C;  1ZXI A;  5BYQ A;  2VZK B;  3SFD B;  2ICI A;  3J9C A;  1C77 A;  1L6V A;  1OQQ A;  1SIJ A;  3BVG A;  1M4V A;  2X38 A;  2MEK A;  1FXI A;  3BWU D;  4GDK B;  1PYW D;  1QOA A;  1ZPS A;  1FXA A;  1KF6 B;  1JCK B;  1RWS A;  2IGD A;  2KWD A;  4N58 A;  4EE2 A;  1VJK A;  2DYM A;  3R2T A;  3V3X A;  2CJO A;  3CIR B;  1STE A;  3ABV B;  3AE4 B;  3TEY A;  1L0V B;  4LK0 M;  1K53 A;  3P4R B;  4US9 A;  4XWT A;  1L0Y B;  3EUB 2;  3W1S A;  4DQO C;  1C4C A;  2IGG A;  3Q69 A;  4OZA A;  3SR6 A;  3NVW A;  2LMC A;  2YEP F;  3AED B;  1XLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...