1L6VA

Structure of reduced bovine adrenodoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
106
structure length
106
Chain Sequence
DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Adrenodoxin 1
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
total genus 9
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6vA00
3FAHA 1OFFA 5C3JB 1XLOA 2JX5A 2PIAA 1PDXA 1QOAA 2L52A 3AB5A 3AEBB 3HVZA 4ZOHC 3L4PA 1FO4A 2KMMA 4HROA 1YQ3B 2BT6A 1TJEA 3AE6B 1L6VA 2H88B 2WP9B 3NS1A 3P4QB 1PUTA 4US9A 3CWIA 3EUB2 1QT9A 1RYJA 2JQRB 1TKYA 1N5WA 2Y5CA 2LEKA 1KFYB 4US8A 4FXCA 1E10A 2L83A 2MH7A 4ZHOA 4YXDB 4WWMA 3VR9B 5MPOA 4YSXB 4C7ZA 1QLBB 4ITKA 3HRDD 1NYQA 3AE1B 1I7HA 1L6UA 1JWBD 1FIQA 1ZP0B 2DWQA 3B2GA 4YT0B 3AE8B 3SR6A 3AH7A 1JWAD 1IUEA 1ZOYB 1R7SA 1V8CA 3AEDB 1GPXA 1FRDA 1KF6B 2G1EA 3PO0A 3HUIA 1JQ4A 1L5PA 2AX5A 3P4SB 3DWMA 2K9XA 1ROEA 1QOFA 1OQQA 1FMAD 1VDVA 2MJ3A 2E3TA 1N62A 1FFVA 2W55A 3AEFB 4A9AA 3AEGB 4YSZB 2HTME 3B2FA 1N63A 1QOGA 2WU5B 5EE9A 5EE3A 1DOIA 2Q5WD 3P4PB 4IDIA 4N6EB 1DGJA 2K22A 1WRIA 3NVVA 3CIRB 1DOXA 1VLBA 1RM6C 2OHFA 3LB8C 1TKEA 1ZXIA 2EKIA 2PKOA 1XLPA 3NVYA 1FFUA 2B76B 1ZUD2 2PVOD 4USAA 5AUIA 3P4RB 2QIEB 1A70A 5AUKA 1E0ZA 1WWTA 1NENB 3B9JA 5H92C 2WDRB 3AE2B 4YTNB 5GXGB 2PVGC 3KWLA 2WDQB 1E9MA 4N58A 1FXIA 3SFEB 1KRHA 3AEEB 3W5VB 5G5HA 1NYRA 1YQ4B 1AWDA 2QJLA 3P1MA 4KX6B 3W9CB 3VRAB 3ETRA 3NRZA 3SFDB 1JROA 1N60A 1RWSA 2KAJA 4YSYB 5C2TB 1NVID 1NEKB 4YTMB 1JALA 2CU3A 1XLNA 1WYGA 1N61A 3AMZA 2BS2B 1JW9D 1GAQB 5G5GA 3W5UB 1V97A 4YTPB 3AE4B 3AECB 1YJJA 1QOBA 1CZPA 4LTUA 4P6VF 4ZHPA 1FXAA 1FM0D 3RPFC 2M56B 4HRSA 2FBWB 2MJDA 1WGKA 2CJOA 3VR8B 1F0ZA 3BIID 3FC4A 1SB3C 3AEAB 3AM9A 3P63A 1CJEA 4C7YA 1SF0A 1OQRA 2W3RA 2WQYB 1E6EB 1TYGB 1SIJA 1XO3A 2WDVB 4JX1C 5EE1A 4WQMA 1EWYC 2WU2B 5H8YE 1QF6A 4JWUC 3ZYYX 2WS3B 3AE5B 2ACZB 1E7PB 1RFKA 1XLQA 2CJNA 3AE3B 3AN1A 3NVWA 1AYFA 1NI3A 2W54A 3WCQA 3AV8A 2MJEA 1JRPA 2DBYA 1WXQA 4N59A 4C80A 1FRRA 2BS4B 4JWSC 1J7BA 3AE7B 3LXFA 1J7AA 1UWMA 1N5XA 3DWGC 1B9RA 2N0SB 1TKGA 2H89B 2BS3B 3ABVB 1J7CA 1L0VB 2K5PA 2M19A 2W3SA 2WLBA 1YJIA 3NVZA 5EE0A 3VRBB 1T3QA 1DOYA 1VJKA 3AE9B 1PFDA
chains in the Genus database with same CATH superfamily
2BWES 2L52A 2QC8A 2KTRA 3V62A 4WJNA 2FUG1 3KQ4A 3AU5A 4EUTA 1LO5D 4TKNA 3VH4B 1E10A 4ZHOA 1I4QA 2M1MA 3ZNHB 3NS8A 1FXTB 4YSXB 5LXIB 4KGSA 5AEKB 1J0GA 3PO0A 1G6JA 3HUIA 1JQ4A 1L5PA 3AXCA 2DYBA 2KNBA 4ASWC 2KC1A 3VUYA 1IP9A 2ZNVC 5LLIA 2QCZA 1UUPA 1YN3A 4DWFA 2KX0A 3QA8A 2D3AA 1WRIA 1WGHA 4GDKB 1Y8RC 2PKOA 2PE9A 4HWIB 3TUOA 1E5WA 2MBHA 3HIZA 1WWTA 2UU7A 1P7FA 5JZEB 1I35A 3RYTA 4MH8A 1BUIC 3AEEB 2NTSA 2AL6A 4KX6B 1JCKB 3QARA 5C2TB 1NVID 2INPE 1T0YA 1XLNA 1TS3A 3RUIB 4NY0A 1GB4A 1V5TA 4XDDA 5G5GA 3U7DA 2WXMA 4MEMA 4ACFA 3L17A 4MT5A 3GZNB 1F0ZA 3AEAB 3H7PB 3AULA 2RPQA 1XQQA 2MHJA 3TEYA 4WURA 3WIMA 1RFKA 1XLQA 2KD0A 2DZIA 3KW5B 4M00A 1WMHB 2N1WA 1PGBA 4A90A 4LDTB 1VZ8A 5D7GA 4MELA 2LMCA 4XGAB 1FPYA 4AP4C 1GB1A 3ZNID 2M0AA 1HA5A 5C3JB 2LHDA 2N9PC 2D5GA 2PIAA 3M63B 4YL8A 2KJHB 3RT3B 4HPMB 2DAFA 2INCC 2BYTA 2EMSA 4IG7B 4PK1A 3P4QB 1RRBA 4TMAB 2JQRB 4HLEA 4MM3A 2N7DA 4RCOA 2JT4B 3JW0X 2IO2B 1VR9A 1F2RI 2RDGA 4FULA 2Z59B 1SJHD 4A3PA 1KLUD 2YLMA 4K7SA 3VQIA 1WGDA 1FCCC 4C56C 4EFOA 1E8WA 4NAWB 5IAAC 2ONQA 2UYZB 3SD5A 5JHBA 2IPKD 1EO6A 2INDC 2JXXA 3HK0A 3ZXRA 1C4PA 1JRUA 1L4DB 4ZRIA 2EKIA 4KZ0A 1UGMA 1I4HA 4HCPB 3Q3JA 1LXDA 2PLPA 1P9DU 2REXA 2GMIC 2DYOA 2AL3A 1SE3A 3W5VB 4ZRPA 2FCQA 1P98A 1PGXA 1J8CA 2D3CA 3AMZA 2XK5B 2WXKA 4BZAA 2DNFA 1UF0A 1CZPA 2IYDB 3ZNGC 2R2OA 4PT5A 3L16A 3AM9A 4N9F4 3VFKA 2I1KA 1EWYC 4AS1A 2WXOA 1YD8U 4PS7A 4BKGA 2WX0A 3AV8A 2MJEA 2GBJA 5KHQA 2NTTA 3LXFA 1UWMA 2KDFB 2N0SB 4FJVB 3R8BA 4IOIE 2W3SA 1YJIA 4A8XC 3U7ZA 4BOSC 3CSTA 5CX3A 3MHZA 3AEBB 1BT0A 1YQ3B 4NZLB 1J19A 5JHAA 4LLGM 4GSWA 3BY4B 2VH2A 4FADA 2CR5A 1RYJA 2MEKA 1TKYA 2GOWA 2Y5CA 4WH4A 4K81A 2K8BA 2VH1A 5BMGA 2KK8A 2NBVB 2NMQA 3UINB 1WX8A 3Q3OC 2RMMA 3BYTB 1VCBA 1MI0A 2MP2B 1WM2A 3VVWB 2C7NB 1TS5A 1WGYA 1T6BX 4Q2JA 3QWZB 2N9XA 1ET9A 5DPWA 5E6PA 2AYOB 1T0SC 2M17A 1GC7A 4RNAA 2XEWA 1E9MA 3N1XC 5AZHA 2IGHA 1WM3A 3OJ3A 3ZXVA 1JROA 2MQJA 4ZRKA 3N1YC 3DHGC 4GOCA 5BO4B 4LTUA 4ZHPA 4IUMB 2FBWB 3DVGX 2V3NA 3A1QA 3W1SA 1D5MC 1F2RC 2BKFA 1OQRA 4MGKE 2WDVB 4KKJA 3WALA 2BWFA 1L0XB 3Q3MC 2W82A 2WNMA 4HKQA 2WS3B 1YN5A 2WXJA 3NVWA 5IP4D 4OZBA 3DOWA 4FJZA 2J4XA 1WXQA 2J53A 3A9KA 2BGFA 2GRIA 2KWUB 1OGWA 3VTUA 2M19A 3NVZA 3GP7A 3R2IA 3QJZA 5E6JA 1DOYA 3AE9B 4OVZA 4KIKA 3PREA 3AB5A 4HROA 5HKHA 3W1SC 4HEA1 2CKHB 2KDIA 2WP9B 1WE6A 2ZJDA 1IBXA 2EELA 2KTRB 5DPRA 1T0RC 2PE6B 5MPOA 2DZMA 2DAJA 4MJSA 2WXLA 4XDCA 3RMKC 4S17A 4MH0E 1KF6B 1I42A 2PJHA 2LGYA 3HM6X 2K8CA 1QOFA 5BYRA 2W55A 3AI5A 3AEGB 2WXRA 2JSVX 3O13A 1DOIA 4IDIA 1UGJA 4ZRJA 2ZVNA 4NNJB 2KMAA 1TT5B 2M4NA 4WAFA 3V05A 1E7UA 5C23A 5I4DA 3B9JA 1XXGA 3AE2B 2VRRB 1I4RA 2WXQA 2LUEA 2RD0A 2CHXA 3A33B 4A20A 3RULA 2MA9B 3P2BA 1EF1A 3VRAB 2V3PA 1JALA 4LCDE 3C8YA 2N1VA 2M56B 1F1HA 3APCA 3IT4B 4QAYA 4R3DA 2WQYB 1D5XC 2ZW1A 3U2SC 5TSSA 3BVGA 4GN1A 1V1OA 1ZKHA 3L10B 4AWJA 3H6NA 4C80A 1T5XD 1C3TA 2LRUA 2L00B 2Z0EB 4IM0A 1PDXA 4ZOHC 3K9PB 2IO1B 3QQ8B 2YVCA 2LXAA 1AW7A 5G55A 2LGXA 1R4MB 4M0WB 4US8A 2AEHA 1YX5B 3H1UA 1V81A 1R4NB 1HZ5A 1TBEA 3M3JA 4MM3B 1FIQA 2KT7A 3AEDB 3ZRFA 1FRDA 2K25A 2RSUA 2KWCA 1KLGD 5DPTA 1C9FA 1TGZB 5IOIA 3AEFB 1CMXB 2YEPB 5EE3A 4IWPA 4RM8A 2K22A 3DVNU 2EKEC 2D3GA 1ZUD2 5AUIA 1MJDA 2QIEB 3RD2A 3ZDTA 2NPTB 4YTNB 3RNGC 2WDQB 3BK2A 4JIOU 4BVUC 3KUZA 2IGGA 1YQ4B 5TR5A 2WHIA 1K52A 3ZIMA 3QC8B 3NUHB 3R66C 4PYZA 4FA6A 3OJ4B 1GAQB 3CMMB 2CJOA 2IDYA 3P63A 2W3RA 3FKYA 1TYGB 4B9KA 2KANA 4OVVA 1E7PB 3WANA 1T0QC 1UH6A 2CJNA 4NQKE 4N59A 3UI3A 4HVBA 1V86A 1OQYA 1MVKA 1C78A 1TKGA 3JYUA 2WLBA 3KWVA 3MC9A 3TJPA 4GU2A 1C77A 5BMHA 3DBLB 3ZTDA 3B0AA 3RZWC 4DHJD 1KTKA 3NZ3A 4AQ7A 4W9DA 2A4ZA 3RNCC 2H88B 2LZ6A 4XE0A 2QHOA 1UNSA 1WX9A 1SGHA 2IZVB 2KQ4X 3EUB2 4HXDA 2GBKA 2PW9A 3TL5A 1Z5SB 3VHTC 3EFCA 2LVQA 5FR3A 3KVFB 1WH3A 2G9HD 4ITKA 1NYQA 3Q8CA 4G0NB 3QHTA 1ZDXA 2G1EA 3VUWA 3WAMA 3DWMA 2K8HA 4EZLA 3C19A 3PT2B 3KYCD 4II3B 3ZNZB 2KYWA 1TS2A 4C4VA 1Z2MA 3R7QA 1K53A 2O6VA 2OHFA 3NVYA 4GDLA 5HG2A 4MSQB 1BMLC 3Q6BA 1E0ZA 3PLUA 1EU4A 1NENB 2PMVA 4BKSD 2WDRB 3ZDMC 1SE9A 2MBBB 4E3CA 1SSNA 2QDFA 5DPSA 1P0RA 1RWSA 2OEDA 1EU3A 2CU3A 4GMVA 3I5JC 2GLSA 3ZO5B 2DZKA 3U52E 4DHZB 2LWPA 4OZCA 1B1ZA 4C00A 4IW0A 1LM8B 2J0JA 5D94A 4B6WA 2BF8B 3DCGA 5D2MB 2G4DB 3VDZA 4ANVA 2GBRA 4A3OA 2KTFA 4PYUA 2BS3B 3LDZE 1J7CA 3V61A 3APDA 4TUUA 2V1YA 4G3XB 4ICVA 4RMAA 1VJKA 1E7VA 3VUXA 4H2AA 2A5UA 2NVUI 2KFKA 1TJEA 2K1FA 3DBHB 1S1QB 3IT6B 1QZEA 2KZRA 3ZW3A 1ENFA 2KDMA 3PVLA 4F7ZA 4XYCA 4E71A 2G4SA 1HZ6A 2FUHB 2LJIA 2KLCA 1Q10A 2R61A 2BTEA 4WIPA 1F77A 2L8JA 1VRAB 1ZP0B 1JWAD 3IBEA 1Y56A 2MBOA 3BYYB 1VZ6A 1ROEA 1D6EC 2GB1A 1N62A 1MHXA 1HQRD 3Q8FA 1OEYJ 4REZA 4PS8A 1WI0A 2KN4A 5EE9A 3P4PB 1VLBA 2WYQA 2B76B 2Y5BB 3EECA 4MSMB 2LGIA 2V9HA 4M02A 2PVGC 2LD9A 4RF1A 2LI5A 4FHJA 2V3SA 1FD6A 1V1PB 1H4RA 3RNEC 2BYEA 2HD5B 1YJJA 1UZXB 4W9KA 1FM0D 3X23A 3N1ZC 2ZCBA 2L7RA 5HHDG 3BWUD 5EE1A 4S0RA 2LVOA 4JWUC 3ZYYX 3Q8EA 4AOFA 1WX7A 2IBIB 1C79A 2WGSA 2BVCA 2KQ7A 1XD3B 3NOBA 4IC7B 1IGCA 3IVFA 1HEZE 1F9JA 1C4CA 2IY0B 4KGTA 3VAWA 3ZQ4A 1L0VB 1L2NA 2CHZA 1LFDA 2KDEB 2Y5PA 2Y3AA 4EOYA 1P7EA 4DK5A 4EZKA 2IO0B 2KJRA 2KO3A 2L3ZA 3QX1A 2HE7A 5BYSA 1KJTA 4PS3A 1EM7A 4WWMA 1IYFA 2D10A 4C7ZA 2V0GA 4YT0B 1IUEA 2ZEQA 3FILA 3ML9A 4W9HA 3IAM1 3P4SB 3NG0A 2FNJB 1M4VA 3EFUA 2RDBC 1OQQA 1VDVA 4YSZB 4W9IA 4K3BA 1DGJA 4J6IA 1OEYA 4HK2A 1ZXIA 3A4RA 3DVGY 4DHZE 3MHSD 2KHWB 4MGYE 5D6JB 4XWTA 4ZYSA 3ZJUA 1E8XA 1WXSA 1A5RA 4O1NA 2SAKA 1ZXHA 1U4AA 1A70A 3EA6A 1XF5L 3VTVA 2MLBA 1KRHA 3PRPB 2OOBB 1SE4A 1C76A 2ZPNA 3N3KB 3JSVB 2ZW0A 4DXAB 2O2VB 4TQ1A 1HTOA 3IAS1 4YWGG 4IM2A 4K7UA 4LNFA 4DHJB 4J3OD 3W5UB 1QKZA 4C7YA 1SIJA 4K7WA 4MGIE 2WU2B 2INNE 2N9KA 3H9DA 2ACZB 4KZCA 3QAQA 2W54A 2J42A 1UD7A 1J7BA 3CSFA 2FCNA 1N5XA 4RF0A 1TTNA 4LNNA 3TCAA 3ENEA 2KACA 2I1JA 1SIFA 2WX1A 4RGTA 1ISNA 2JX5A 3APFA 3NJTA 1YX6B 2KWDA 2OJWA 3VH3B 2AQ2B 2ON8A 3B08A 1PUTA 3PSEB 3I57A 1YOVB 3SDLC 2RPVA 3L0WB 1QLBB 3ONSA 3ECIA 4BBNC 2JUOA 4IWOA 4FLHA 3R7RA 4F1SA 1JWMD 3A9JB 4M8MA 1C4AA 1HTQA 4KSKC 2FIFA 4B0MA 2FCSA 4HJGE 1XCTL 3WA0A 1N63A 2DENB 3H7PA 2ZNVB 3J9CA 1LQBA 4USAA 2WXNA 5AUKA 2JYTA 5J18A 2O6VB 1JMLA 2E6XA 3DBRI 4GDLB 1WIAA 3GE3C 4D2KA 3GS2A 3OAWA 4RH6A 4UDUC 2DX5B 3DHIC 2N7JA 3SFDB 3TBLD 2KAJA 3MFGA 4JE3B 3M95A 3GOEA 1N61A 3CF6E 4L2YA 3RZFA 3AE4B 3DPDA 2JPHA 4GXBA 3ZVVA 3NZUA 1SB3C 4IWQA 1AARA 1IPGA 4F8CB 4WQOB 5CHWA 3VXWA 3DVNV 4HCNB 1FRRA 2SEBD 1V49A 4W9GA 2C9WB 5D3IB 2H89B 3N9YC 3T8MA 4WJOA 2QSDA 1PFDA 2BB6A 2LXCA 3MJ5A 1GNUA 3QIJA 2BBCA 2LGSA 2WXFA 3V6CB 2JVCA 2LEKA 4FXCA 2JRHA 2L83A 2KFKB 3DDCB 3PS6A 4DBGA 3VR9B 3L08A 3N32A 1E90A 4BOZB 4OZAA 1GJZA 3AE1B 5DCNA 2AQ3B 2JZPA 3PGEA 4JLCA 3UIPB 4KSLC 2WXIA 4A9AA 2C60A 2MSED 2NBWB 1V6EA 4G11A 4EE2A 4DXGA 4FBJB 1WGRA 4KDLB 3QCAA 2CHWA 3GE8C 3A4SC 1TS4A 1SE2A 1FEHA 2MW5A 4TQ0A 1UWXA 2BQQA 3VTWA 3PRMB 2K0PA 2YEPF 3P1MA 2NS5A 3ETRA 3WAOA 1N60A 3Q3FA 1FNVA 3ZGZA 3WAPA 4OVUA 3NY5A 3TEXA 3UQAA 3KH0A 1IGDA 4AJWA 1V97A 4NQLB 3GB1A 3ZLZA 4URKA 4HRSA 1STEA 1FNUA 5IN7A 2KN5A 1CJEA 2EMTA 1WJ4A 3RI7C 5H8YE 1X1MA 3AE3B 1DYQA 1H8CA 2X8XX 1ZE3D 2UWQA 2MP2A 2KVRA 1XCQL 4TSSA 2I2YA 3OWEB 2BB5A 2DHZA 2KDBA 1PGAA 1YNTE 2BT6A 1WXAA 5CHVC 1QILA 1RAXA 1N5WA 1MG8A 3Q2AC 1WR6E 1PYWD 3R2TA 1P3QU 3Q8AA 1JWBD 1E8YA 1ZOYB 1MHHE 3PZ7A 3SU8X 3KUCB 2MBQA 4B0EA 1M94A 2JWZA 3KUDB 1K50A 3FILB 3B2FA 4RFBA 5E6NA 4N6EB 3NVVA 4ZYNA 1DOXA 3CIRB 1WJUA 1RM6C 2RR9A 3BVMA 5GMVA 3P4RB 2HDEA 4GGQA 4YSYB 1Q1OA 3ZUNA 4HKZE 5E6OA 1KOTA 5JXVA 2MJDA 1D3ZA 1RFAA 5CTRC 4BBNF 1E6EB 4JX1C 4P1CC 3DQVA 3WCQA 4JL9A 2NCNA 2DBYA 3T3NA 2HTHA 4JWSC 1K51A 4FJYA 3ZKJC 1S3SG 5FR6A 3R3MA 2KKCA 1T3QA 5HI1A 4OHJA 1HE8A 2QEJC 2WWZA 2KMMA 3LYYA 2C7MB 2KWVB 4DDGD 3A1QB 3EHVA 5IO9A 2BW2A 2RDHA 2ZPYA 2O6VD 3W2DA 3UF8A 1BXTA 1ZW7A 2WXHA 2OJRA 3E9SA 3A9KB 2KOXA 3B2GA 2K3UA 2J0KA 2AX5A 4OW0A 2WDTB 2D07B 2KMCA 1FMAD 2N4FA 2VZKD 4HDOA 4LNOA 4AUQC 1VZ7A 4KIKB 1QOGA 1V5OA 3W1YA 3DBLI 2RGFA 4AJYB 3PRZA 1V9JA 3IG3A 3O65B 4W9JA 4TV3A 4EEWA 1IBXB 4RGOS 4KKIA 1WGGA 4XX5A 5H92C 4XC2A 2LVPA 1FXIA 3SFEB 4M01A 4MJSB 5T8IA 2JRIB 1VD2A 3ALBA 2L0TA 2G3QB 2L76A 3RNFC 2JY6A 2BS2B 4KDIC 2BKRB 1FXAA 2KQSA 3UQBA 1EF5A 2ZVOA 2G45B 4M0WA 3U30A 4WQMA 3K9OB 4DQOC 2JF5A 4BFRA 4RM9A 1WJ6A 3AN1A 2KX3A 1XT9B 3RCZA 2PPHA 3BZDB 3L13A 4NJ6A 4DXFA 5IKCM 4WJPA 4JPSA 1KM7A 4I6LB 4E74A 1L0YB 3NZSA 3PPAA 4RGNA 3L4PA 2K6QA 4EZJA 1WRDB 1L6VA 1N6ZA 3S2AA 1OTRB 4ANWA 4WWOA 1MFWA 2J7QB 3HM3A 2NPTA 3H8HA 3PZDA 3JVZX 4ZRQA 3Q8BA 3ZJVA 1UBIA 5JH5C 3PV1A 5G2NA 3BK1A 4FHKA 3PLVA 1HXYD 1FFVA 3T3OA 2L1AA 2HTME 2IGDA 3GZNI 1KLVA 2K39A 3ZJTA 5KHOA 2HJ1A 3RNAC 3I3TB 2ICIA 2I38A 4X57B 3N20C 4ARIA 5BYQA 3HHMA 3DBHI 1QQRA 5J17A 2ZZPB 2FIDA 3I63C 5AZFA 1WY8A 2LASA 1ESFA 2V4IB 3D32A 4HDQA 1WXMA 3N30A 3MP9A 3V3XA 2J52A 1NEKB 1V80A 1NI2A 3SHQA 1UELA 1LGRA 2N9LA 2CU1A 1QOBA 2BPSA 3IFWB 4CQNA 3VR8B 3MTNB 1TZOA 3EGRA 3Q14C 1SJED 1WZ3A 1WE7A 1SBBB 4DDID 1NBFC 1QF6A 1WR1A 2LHEA 1C1YB 1AYFA 3PHWB 2MBEA 3DBRB 3B1LX 3AU4A 1J7AA 4MDKE 1I4XA 4GIVA 1L4ZB 2K6DB 2M0XA 5EE0A 1Q5WB 1SXTA 2D2QA 4CYEA 3OLMD 3RN9C 3AE6B 4ZDVA 4NJCA 4HPPA 1YJ1A 1ZPSA 3LJ3A 2X38A 1D4BA 3RNBC 5L95C 4YXDB 2KC2A 3HRDD 1I7HA 2DWQA 5AZGA 1GPXA 2JXTA 2MRPA 2J0MA 3MC0B 4GDKA 2E3TA 4W9CA 4ICUA 3Q3NC 1MG4A 2XNAC 3DBSA 1TKEA 1XLPA 3TMPB 1TZ1A 5IA7A 1FFUA 5LNK1 4W9FA 5D3DA 1WZ0A 2LJ5A 3NHEB 2FAZA 2KFJA 5EDSA 5G5HA 1NYRA 1AWDA 4W9EA 3NRZA 2FCMA 2GBNA 1P1AA 4WWPA 4BAXA 4LJPB 1FNWA 1WJNA 4G50A 1GUAB 1GOZA 1JWUD 1JW9D 2ZCCA 4XWWA 1ZDVA 4ANXA 2MX2A 1WSPA 3TSSA 1K8RB 4KGRA 1YN4A 3RPFC 5CHFA 1JWSD 3MC8A 4C4VB 1WXVA 1CK1A 1SF0A 2N7EA 1WMHA 1XO3A 3BINA 4HPLB 4MACA 2XBBC 4LJOB 4WJQA 5FK9C 2BS4B 3ZTCA 5BMIA 1B9RA 2JU6X 2JZZA 2K5PA 2D11A 1E8ZA 2VZKB 3QK0A 3FAHA 1OFFA 4WAAA 2Z0DB 3C0RB 3SEBA 3HVZA 5FKAC 2JZ3B 2KJ6A 4CO7A 2PEAA 3NS1A 3CWIA 1QT9A 1PQSA 4WWNA 1D5ZC 3HVDA 4EKUA 1KFYB 1F52A 2MH7A 2MCNB 3UIOB 2AWTA 1UBQA 4IM3A 4I6PA 4KVGB 4NAWA 3SR6A 4LDTD 3AE8B 3L54A 1V1PA 1V2YA 3V6EB 1TY2A 4MGZE 4ANUA 2BYVE 2MJ3A 1YMHE 2L05A 2L0FA 4KV2A 3IHPC 1XEEA 4NJ7A 3P42A 3LB8C 4II2B 4L23A 1EWCA 2AQ1B 2IO3B 2D3BA 2HJ8A 3I9V1 2JYEA 4LNIA 4XZ4A 2GI9A 3Q69A 4N58A 3U8ZA 1WF9A 2XK5A 3OG5A 2QJLA 3UGBB 2KVZA 1Q0WB 2FE8A 3TEWA 4I6NB 4YTMB 4LK0M 1RLFA 4LNKA 5L83A 3PTFC 1YQBA 4YTPB 4P6VF 4GB9A 2MWSB 3EC8A 1WGKA 1KH0A 3BIID 3FC4A 2JWUA 2C5LC 5LXHA 3AE5B 3ZRCA 1WYWB 2KXJA 2XN9C 3PHXB 1L7YA 1NI3A 2WXGA 2NR2A 1JRPA 2TSSA 4L1BA 2LUMA 3AE7B 4JGHB 3ABVB 3RFZB 2QILA 4M8NA 3VRBB 3M62B 4HJKA 1CQVA 4NPNA 4BKTA 3TEZA 1XLOA 4P16A 1QOAA 4K3CA 1FO4A 4CHKA 4FN2A 4ARCA 2N9EB 1I4GA 2W9NA 4US9A 2M8SA 1SEBD 2CS4A 2DLBA 3IXSA 2WXPA 3KLSX 2Z8LA 1TIFA 1L6UA 1GC6A 3JSVA 4GLSC 1I4PA 3AH7A 1R7SA 1V8CA 2O2VA 1WFYA 3H7SA 2K9XA 2KLGA 5HFYA 1TY0A 4IKGA 2PTLA 3U4EG 3T9LA 2WU5B 2Q5WD 2V4LA 2B3AA 3TIXA 1AN8A 2LFIA 2PVOD 2C7HA 3MJWA 2DZJA 4JQWC 2QMTA 4A6QA 2DYMA 5GXGB 4P1BC 3KWLA 1FCLA 1ET6A 3W9CB 1ACCA 2ASQA 3X0WA 2IJ0A 4P7IA 3PZ8A 4NAMA 1WYGA 4B95A 3ML8A 1MPEA 3AECB 4RGMA 3DHHC 3KYDD 1EUVB 3E56A 2GBMA 4A55A 3URYA 1R4MI 5C1ZA 4W9LA 1ZGUB 4BKSA 2LRWA 5J2RA 2IY1B 1R4NI 2L32A 2LGDA 3DWGC 2BYFA 3A9JA 3BVZA 2R2QA 4K1RB 3V60A 1YIWA 1GG3A 1NDDA 2NBUA
chains in the Genus database with same CATH topology
4RGTA 1L0YB 4RGNA 2JX5A 1PDXA 4ZOHC 2L52A 3L4PA 2KWDA 2AQ2B 2FUG1 1L6VA 3KQ4A 2ON8A 1AW7A 1PUTA 1LO5D 3I57A 4US8A 1E10A 4ZHOA 1I4QA 3H8HA 2RPVA 1QLBB 1HZ5A 4ZRQA 3Q8BA 3ZJVA 4MM3B 4YSXB 1FIQA 4KGSA 3AEDB 1FRDA 3PO0A 3HUIA 1JQ4A 1JWMD 1KLGD 1L5PA 1C4AA 3BK1A 1C9FA 4B0MA 4HJGE 1HXYD 1FFVA 3AEFB 3T3OA 1UUPA 1XCTL 2HTME 2L1AA 1YN3A 2IGDA 1N63A 2YEPB 5EE3A 3ZJTA 2K22A 1WRIA 3J9CA 4GDKB 2ICIA 2I38A 2PKOA 3TUOA 4ARIA 1ZUD2 4USAA 5BYQA 5AUIA 1QQRA 2QIEB 2WXNA 5AUKA 2JYTA 1WWTA 1P7FA 1JMLA 2E6XA 4GDLB 4YTNB 2WDQB 4MH8A 3BK2A 4D2KA 1BUIC 2IGGA 1ESFA 2V4IB 3AEEB 2NTSA 3GS2A 4RH6A 4UDUC 1YQ4B 1K52A 4KX6B 1JCKB 2N7JA 3NUHB 3SFDB 3MP9A 2KAJA 3MFGA 4JE3B 5C2TB 1NVID 3V3XA 2INPE 2J52A 1NEKB 1XLNA 1TS3A 1GB4A 1N61A 1GAQB 4XDDA 5G5GA 4L2YA 3AE4B 2N9LA 2WXMA 1QOBA 4MT5A 4CQNA 3VR8B 2CJOA 1TZOA 3EGRA 2IDYA 1F0ZA 1SB3C 1SJED 3AEAB 3P63A 2W3RA 1TYGB 1SBBB 1QF6A 3TEYA 2LHEA 1E7PB 4WURA 1RFKA 1XLQA 2CJNA 1AYFA 4N59A 1FRRA 2SEBD 3UI3A 1PGBA 4A90A 1J7AA 1MVKA 1VZ8A 5D7GA 1C78A 1TKGA 1I4XA 5D3IB 2H89B 3N9YC 2LMCA 1L4ZB 2WLBA 3KWVA 5EE0A 1C77A 2QSDA 5BMHA 1GB1A 2M0AA 1PFDA 2BB6A 1HA5A 5C3JB 1SXTA 2LHDA 2D5GA 3MJ5A 2PIAA 1KTKA 3NZ3A 4AQ7A 3AE6B 2BYTA 4NJCA 2BBCA 2H88B 4XE0A 1UNSA 1ZPSA 3P4QB 2X38A 2KQ4X 1D4BA 3EUB2 4TMAB 2JQRB 2WXFA 2LEKA 2PW9A 4FXCA 4RCOA 2L83A 4YXDB 1VR9A 3VR9B 5FR3A 1F2RI 2G9HD 4ITKA 3HRDD 1NYQA 2RDGA 3Q8CA 4OZAA 3AE1B 1I7HA 2AQ3B 2DWQA 2JZPA 1SJHD 1GPXA 2JXTA 1KLUD 1ZDXA 2G1EA 3VQIA 3DWMA 1FCCC 4C56C 3MC0B 4NAWB 2WXIA 2E3TA 4A9AA 1TS2A 2ONQA 2IPKD 1C4PA 1K53A 4EE2A 4DXGA 2XNAC 2OHFA 1L4DB 1TKEA 2EKIA 3NVYA 1XLPA 5HG2A 1FFUA 1I4HA 5LNK1 5D3DA 1BMLC 2PLPA 1TS4A 1SE2A 1FEHA 1E0ZA 1EU4A 1NENB 2PMVA 2WDRB 4TQ0A 1UWXA 2DYOA 1SE3A 3W5VB 1SSNA 5G5HA 1NYRA 1AWDA 2K0PA 2YEPF 3P1MA 3ETRA 3NRZA 1N60A 1RWSA 4ZRPA 1FNVA 2OEDA 1PGXA 1EU3A 3ZGZA 1FNWA 2CU3A 3TEXA 1GOZA 1JWUD 1IGDA 3AMZA 2WXKA 1JW9D 4XWWA 1ZDVA 1V97A 1WSPA 3TSSA 1CZPA 4KGRA 3GB1A 3U52E 1YN4A 3RPFC 4PT5A 4HRSA 4OZCA 1JWSD 1B1ZA 1STEA 1FNUA 3AM9A 1CK1A 1CJEA 1SF0A 1XO3A 1EWYC 4AS1A 2WXOA 5H8YE 4MACA 3AE3B 1DYQA 3AV8A 2MJEA 5FK9C 2BS4B 1ZE3D 2NTTA 3LXFA 5BMIA 1UWMA 1B9RA 2N0SB 2JU6X 2BS3B 3R8BA 4IOIE 1J7CA 2K5PA 2W3SA 1XCQL 1YJIA 4A8XC 4TSSA 2I2YA 3U7ZA 2VZKB 1VJKA 3OWEB 2BB5A 3FAHA 1OFFA 3MHZA 4H2AA 3AEBB 3SEBA 3HVZA 1PGAA 1YNTE 1YQ3B 2BT6A 5FKAC 4NZLB 1TJEA 4LLGM 1QILA 3NS1A 3IT6B 3CWIA 1QT9A 1ENFA 1RYJA 1TKYA 1D5ZC 1N5WA 2MEKA 2Y5CA 3HVDA 1KFYB 2KDMA 4WH4A 2MH7A 1HZ6A 1PYWD 5BMGA 2LJIA 3R2TA 1Q10A 2NMQA 2R61A 2BTEA 4WIPA 1F77A 3Q8AA 1JWBD 1VRAB 1ZP0B 2RMMA 3SR6A 3AE8B 3BYTB 1ZOYB 1JWAD 1V1PA 1MI0A 1MHHE 1Y56A 1TY2A 3BYYB 1VZ6A 3PZ7A 1ROEA 1D6EC 2MJ3A 4B0EA 1YMHE 2GB1A 1N62A 1TS5A 1K50A 1MHXA 1HQRD 3Q8FA 3FILB 3B2FA 1T6BX 4REZA 4RFBA 4Q2JA 2KN4A 5EE9A 3P4PB 4N6EB 3NVVA 1ET9A 1DOXA 3CIRB 1XEEA 1VLBA 1RM6C 3P42A 3LB8C 4L23A 1EWCA 3BVMA 2B76B 2AQ1B 3P4RB 2LGIA 3I9V1 4RNAA 2HDEA 2JYEA 2PVGC 2GI9A 3Q69A 1E9MA 4N58A 2IGHA 4RF1A 2QJLA 1JROA 4YSYB 2FE8A 1FD6A 1V1PB 3TEWA 4YTMB 4LK0M 4YTPB 4LTUA 4P6VF 1YJJA 4ZHPA 4HKZE 1FM0D 5JXVA 2FBWB 2MJDA 2V3NA 1WGKA 1KH0A 3BIID 3FC4A 3W1SA 1D5MC 1F2RC 2JWUA 1OQRA 5HHDG 3BWUD 1E6EB 2WDVB 4KKJA 4JX1C 5EE1A 1L0XB 2W82A 2WNMA 4JWUC 3ZYYX 2WS3B 3AE5B 4HKQA 2XN9C 1YN5A 2WXJA 3NVWA 3Q8EA 1NI3A 2WXGA 3WCQA 1C79A 4OZBA 1JRPA 2J4XA 2DBYA 1WXQA 2J53A 3T3NA 2TSSA 4L1BA 4JWSC 1IGCA 1K51A 2LUMA 3AE7B 1HEZE 2GRIA 1C4CA 4KGTA 3ABVB 3RFZB 2QILA 3ZQ4A 1L0VB 2M19A 3NVZA 3GP7A 3R2IA 3VRBB 5E6JA 1T3QA 5HI1A 1DOYA 3AE9B 1CQVA 4OHJA 4OVZA 2QEJC 2Y5PA 3TEZA 1XLOA 4P16A 3AB5A 1QOAA 2Y3AA 1FO4A 4ARCA 2KMMA 4HROA 3LYYA 4HEA1 1P7EA 1I4GA 2WP9B 1IBXA 2BW2A 4US9A 2EELA 1SEBD 2RDHA 2DLBA 5BYSA 3W2DA 1EM7A 4WWMA 1BXTA 5MPOA 3IXSA 4C7ZA 2WXPA 2V0GA 2WXHA 3E9SA 2WXLA 2Z8LA 3KLSX 4XDCA 1L6UA 4YT0B 3B2GA 4GLSC 1I4PA 3AH7A 1IUEA 1R7SA 1V8CA 1KF6B 3FILA 2K3UA 2AX5A 3IAM1 3P4SB 4OW0A 2K9XA 1M4VA 5HFYA 1QOFA 1OQQA 1FMAD 1VDVA 2VZKD 5BYRA 2W55A 1TY0A 4IKGA 2PTLA 3AEGB 4YSZB 3U4EG 1VZ7A 2WXRA 1QOGA 2JSVX 2WU5B 3O13A 1DOIA 2Q5WD 4IDIA 1DGJA 1UGJA 1AN8A 1ZXIA 2LFIA 2PVOD 1IBXB 4RGOS 4XWTA 4ZYSA 3ZJUA 4WAFA 3V05A 2QMTA 4KKIA 4O1NA 2SAKA 1ZXHA 4A6QA 1A70A 3EA6A 5I4DA 2DYMA 3B9JA 1XXGA 5H92C 3AE2B 5GXGB 1XF5L 1I4RA 2WXQA 3KWLA 1FCLA 1FXIA 3SFEB 1ET6A 1KRHA 1SE4A 1ACCA 1C76A 3W9CB 3VRAB 5T8IA 2IJ0A 2ZW0A 4TQ1A 3IAS1 2V3PA 3PZ8A 1JALA 4YWGG 4NAMA 1WYGA 2BS2B 1MPEA 4J3OD 3W5UB 3C8YA 3AECB 4RGMA 1FXAA 1QKZA 2M56B 3IT4B 4C7YA 4R3DA 3E56A 2WQYB 1D5XC 1SIJA 4M0WA 2ZW1A 4WQMA 4A55A 2WU2B 3URYA 4DQOC 2INNE 2N9KA 2ACZB 3U2SC 3AN1A 5TSSA 3BVGA 1V1OA 2W54A 2J42A 4C80A 2L32A 1T5XD 1J7BA 3DWGC 1N5XA 4RF0A 3BZDB 4DXFA 3BVZA 4JPSA 2KACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAH A;  1OFF A;  5C3J B;  1XLO A;  2JX5 A;  2PIA A;  1PDX A;  1QOA A;  2L52 A;  3AB5 A;  3AEB B;  3HVZ A;  4ZOH C;  3L4P A;  1FO4 A;  2KMM A;  4HRO A;  1YQ3 B;  2BT6 A;  1TJE A;  3AE6 B;  1L6V A;  2H88 B;  2WP9 B;  3NS1 A;  3P4Q B;  1PUT A;  4US9 A;  3CWI A;  3EUB 2;  1QT9 A;  1RYJ A;  2JQR B;  1TKY A;  1N5W A;  2Y5C A;  2LEK A;  1KFY B;  4US8 A;  4FXC A;  1E10 A;  2L83 A;  2MH7 A;  4ZHO A;  4YXD B;  4WWM A;  3VR9 B;  5MPO A;  4YSX B;  4C7Z A;  1QLB B;  4ITK A;  3HRD D;  1NYQ A;  3AE1 B;  1I7H A;  1L6U A;  1JWB D;  1FIQ A;  1ZP0 B;  2DWQ A;  3B2G A;  4YT0 B;  3AE8 B;  3SR6 A;  3AH7 A;  1JWA D;  1IUE A;  1ZOY B;  1R7S A;  1V8C A;  3AED B;  1GPX A;  1FRD A;  1KF6 B;  2G1E A;  3PO0 A;  3HUI A;  1JQ4 A;  1L5P A;  2AX5 A;  3P4S B;  3DWM A;  2K9X A;  1ROE A;  1QOF A;  1OQQ A;  1FMA D;  1VDV A;  2MJ3 A;  2E3T A;  1N62 A;  1FFV A;  2W55 A;  3AEF B;  4A9A A;  3AEG B;  4YSZ B;  2HTM E;  3B2F A;  1N63 A;  1QOG A;  2WU5 B;  5EE9 A;  5EE3 A;  1DOI A;  2Q5W D;  3P4P B;  4IDI A;  4N6E B;  1DGJ A;  2K22 A;  1WRI A;  3NVV A;  3CIR B;  1DOX A;  1VLB A;  1RM6 C;  2OHF A;  3LB8 C;  1TKE A;  1ZXI A;  2EKI A;  2PKO A;  1XLP A;  3NVY A;  1FFU A;  2B76 B;  1ZUD 2;  2PVO D;  4USA A;  5AUI A;  3P4R B;  2QIE B;  1A70 A;  5AUK A;  1E0Z A;  1WWT A;  1NEN B;  3B9J A;  5H92 C;  2WDR B;  3AE2 B;  4YTN B;  5GXG B;  2PVG C;  3KWL A;  2WDQ B;  1E9M A;  4N58 A;  1FXI A;  3SFE B;  1KRH A;  3AEE B;  3W5V B;  5G5H A;  1NYR A;  1YQ4 B;  1AWD A;  2QJL A;  3P1M A;  4KX6 B;  3W9C B;  3VRA B;  3ETR A;  3NRZ A;  3SFD B;  1JRO A;  1N60 A;  1RWS A;  2KAJ A;  4YSY B;  5C2T B;  1NVI D;  1NEK B;  4YTM B;  1JAL A;  2CU3 A;  1XLN A;  1WYG A;  1N61 A;  3AMZ A;  2BS2 B;  1JW9 D;  1GAQ B;  5G5G A;  3W5U B;  1V97 A;  4YTP B;  3AE4 B;  3AEC B;  1YJJ A;  1QOB A;  1CZP A;  4LTU A;  4P6V F;  4ZHP A;  1FXA A;  1FM0 D;  3RPF C;  2M56 B;  4HRS A;  2FBW B;  2MJD A;  1WGK A;  2CJO A;  3VR8 B;  1F0Z A;  3BII D;  3FC4 A;  1SB3 C;  3AEA B;  3AM9 A;  3P63 A;  1CJE A;  4C7Y A;  1SF0 A;  1OQR A;  2W3R A;  2WQY B;  1E6E B;  1TYG B;  1SIJ A;  1XO3 A;  2WDV B;  4JX1 C;  5EE1 A;  4WQM A;  1EWY C;  2WU2 B;  5H8Y E;  1QF6 A;  4JWU C;  3ZYY X;  2WS3 B;  3AE5 B;  2ACZ B;  1E7P B;  1RFK A;  1XLQ A;  2CJN A;  3AE3 B;  3AN1 A;  3NVW A;  1AYF A;  1NI3 A;  2W54 A;  3WCQ A;  3AV8 A;  2MJE A;  1JRP A;  2DBY A;  1WXQ A;  4N59 A;  4C80 A;  1FRR A;  2BS4 B;  4JWS C;  1J7B A;  3AE7 B;  3LXF A;  1J7A A;  1UWM A;  1N5X A;  3DWG C;  1B9R A;  2N0S B;  1TKG A;  2H89 B;  2BS3 B;  3ABV B;  1J7C A;  1L0V B;  2K5P A;  2M19 A;  2W3S A;  2WLB A;  1YJI A;  3NVZ A;  5EE0 A;  3VRB B;  1T3Q A;  1DOY A;  1VJK A;  3AE9 B;  1PFD A; 
#chains in the Genus database with same CATH topology
 2BWE S;  2L52 A;  2QC8 A;  2KTR A;  3V62 A;  4WJN A;  2FUG 1;  3KQ4 A;  3AU5 A;  4EUT A;  1LO5 D;  4TKN A;  3VH4 B;  1E10 A;  4ZHO A;  1I4Q A;  2M1M A;  3ZNH B;  3NS8 A;  1FXT B;  4YSX B;  5LXI B;  4KGS A;  5AEK B;  1J0G A;  3PO0 A;  1G6J A;  3HUI A;  1JQ4 A;  1L5P A;  3AXC A;  2DYB A;  2KNB A;  4ASW C;  2KC1 A;  3VUY A;  1IP9 A;  2ZNV C;  5LLI A;  2QCZ A;  1UUP A;  1YN3 A;  4DWF A;  2KX0 A;  3QA8 A;  2D3A A;  1WRI A;  1WGH A;  4GDK B;  1Y8R C;  2PKO A;  2PE9 A;  4HWI B;  3TUO A;  1E5W A;  2MBH A;  3HIZ A;  1WWT A;  2UU7 A;  1P7F A;  5JZE B;  1I35 A;  3RYT A;  4MH8 A;  1BUI C;  3AEE B;  2NTS A;  2AL6 A;  4KX6 B;  1JCK B;  3QAR A;  5C2T B;  1NVI D;  2INP E;  1T0Y A;  1XLN A;  1TS3 A;  3RUI B;  4NY0 A;  1GB4 A;  1V5T A;  4XDD A;  5G5G A;  3U7D A;  2WXM A;  4MEM A;  4ACF A;  3L17 A;  4MT5 A;  3GZN B;  1F0Z A;  3AEA B;  3H7P B;  3AUL A;  2RPQ A;  1XQQ A;  2MHJ A;  3TEY A;  4WUR A;  3WIM A;  1RFK A;  1XLQ A;  2KD0 A;  2DZI A;  3KW5 B;  4M00 A;  1WMH B;  2N1W A;  1PGB A;  4A90 A;  4LDT B;  1VZ8 A;  5D7G A;  4MEL A;  2LMC A;  4XGA B;  1FPY A;  4AP4 C;  1GB1 A;  3ZNI D;  2M0A A;  1HA5 A;  5C3J B;  2LHD A;  2N9P C;  2D5G A;  2PIA A;  3M63 B;  4YL8 A;  2KJH B;  3RT3 B;  4HPM B;  2DAF A;  2INC C;  2BYT A;  2EMS A;  4IG7 B;  4PK1 A;  3P4Q B;  1RRB A;  4TMA B;  2JQR B;  4HLE A;  4MM3 A;  2N7D A;  4RCO A;  2JT4 B;  3JW0 X;  2IO2 B;  1VR9 A;  1F2R I;  2RDG A;  4FUL A;  2Z59 B;  1SJH D;  4A3P A;  1KLU D;  2YLM A;  4K7S A;  3VQI A;  1WGD A;  1FCC C;  4C56 C;  4EFO A;  1E8W A;  4NAW B;  5IAA C;  2ONQ A;  2UYZ B;  3SD5 A;  5JHB A;  2IPK D;  1EO6 A;  2IND C;  2JXX A;  3HK0 A;  3ZXR A;  1C4P A;  1JRU A;  1L4D B;  4ZRI A;  2EKI A;  4KZ0 A;  1UGM A;  1I4H A;  4HCP B;  3Q3J A;  1LXD A;  2PLP A;  1P9D U;  2REX A;  2GMI C;  2DYO A;  2AL3 A;  1SE3 A;  3W5V B;  4ZRP A;  2FCQ A;  1P98 A;  1PGX A;  1J8C A;  2D3C A;  3AMZ A;  2XK5 B;  2WXK A;  4BZA A;  2DNF A;  1UF0 A;  1CZP A;  2IYD B;  3ZNG C;  2R2O A;  4PT5 A;  3L16 A;  3AM9 A;  4N9F 4;  3VFK A;  2I1K A;  1EWY C;  4AS1 A;  2WXO A;  1YD8 U;  4PS7 A;  4BKG A;  2WX0 A;  3AV8 A;  2MJE A;  2GBJ A;  5KHQ A;  2NTT A;  3LXF A;  1UWM A;  2KDF B;  2N0S B;  4FJV B;  3R8B A;  4IOI E;  2W3S A;  1YJI A;  4A8X C;  3U7Z A;  4BOS C;  3CST A;  5CX3 A;  3MHZ A;  3AEB B;  1BT0 A;  1YQ3 B;  4NZL B;  1J19 A;  5JHA A;  4LLG M;  4GSW A;  3BY4 B;  2VH2 A;  4FAD A;  2CR5 A;  1RYJ A;  2MEK A;  1TKY A;  2GOW A;  2Y5C A;  4WH4 A;  4K81 A;  2K8B A;  2VH1 A;  5BMG A;  2KK8 A;  2NBV B;  2NMQ A;  3UIN B;  1WX8 A;  3Q3O C;  2RMM A;  3BYT B;  1VCB A;  1MI0 A;  2MP2 B;  1WM2 A;  3VVW B;  2C7N B;  1TS5 A;  1WGY A;  1T6B X;  4Q2J A;  3QWZ B;  2N9X A;  1ET9 A;  5DPW A;  5E6P A;  2AYO B;  1T0S C;  2M17 A;  1GC7 A;  4RNA A;  2XEW A;  1E9M A;  3N1X C;  5AZH A;  2IGH A;  1WM3 A;  3OJ3 A;  3ZXV A;  1JRO A;  2MQJ A;  4ZRK A;  3N1Y C;  3DHG C;  4GOC A;  5BO4 B;  4LTU A;  4ZHP A;  4IUM B;  2FBW B;  3DVG X;  2V3N A;  3A1Q A;  3W1S A;  1D5M C;  1F2R C;  2BKF A;  1OQR A;  4MGK E;  2WDV B;  4KKJ A;  3WAL A;  2BWF A;  1L0X B;  3Q3M C;  2W82 A;  2WNM A;  4HKQ A;  2WS3 B;  1YN5 A;  2WXJ A;  3NVW A;  5IP4 D;  4OZB A;  3DOW A;  4FJZ A;  2J4X A;  1WXQ A;  2J53 A;  3A9K A;  2BGF A;  2GRI A;  2KWU B;  1OGW A;  3VTU A;  2M19 A;  3NVZ A;  3GP7 A;  3R2I A;  3QJZ A;  5E6J A;  1DOY A;  3AE9 B;  4OVZ A;  4KIK A;  3PRE A;  3AB5 A;  4HRO A;  5HKH A;  3W1S C;  4HEA 1;  2CKH B;  2KDI A;  2WP9 B;  1WE6 A;  2ZJD A;  1IBX A;  2EEL A;  2KTR B;  5DPR A;  1T0R C;  2PE6 B;  5MPO A;  2DZM A;  2DAJ A;  4MJS A;  2WXL A;  4XDC A;  3RMK C;  4S17 A;  4MH0 E;  1KF6 B;  1I42 A;  2PJH A;  2LGY A;  3HM6 X;  2K8C A;  1QOF A;  5BYR A;  2W55 A;  3AI5 A;  3AEG B;  2WXR A;  2JSV X;  3O13 A;  1DOI A;  4IDI A;  1UGJ A;  4ZRJ A;  2ZVN A;  4NNJ B;  2KMA A;  1TT5 B;  2M4N A;  4WAF A;  3V05 A;  1E7U A;  5C23 A;  5I4D A;  3B9J A;  1XXG A;  3AE2 B;  2VRR B;  1I4R A;  2WXQ A;  2LUE A;  2RD0 A;  2CHX A;  3A33 B;  4A20 A;  3RUL A;  2MA9 B;  3P2B A;  1EF1 A;  3VRA B;  2V3P A;  1JAL A;  4LCD E;  3C8Y A;  2N1V A;  2M56 B;  1F1H A;  3APC A;  3IT4 B;  4QAY A;  4R3D A;  2WQY B;  1D5X C;  2ZW1 A;  3U2S C;  5TSS A;  3BVG A;  4GN1 A;  1V1O A;  1ZKH A;  3L10 B;  4AWJ A;  3H6N A;  4C80 A;  1T5X D;  1C3T A;  2LRU A;  2L00 B;  2Z0E B;  4IM0 A;  1PDX A;  4ZOH C;  3K9P B;  2IO1 B;  3QQ8 B;  2YVC A;  2LXA A;  1AW7 A;  5G55 A;  2LGX A;  1R4M B;  4M0W B;  4US8 A;  2AEH A;  1YX5 B;  3H1U A;  1V81 A;  1R4N B;  1HZ5 A;  1TBE A;  3M3J A;  4MM3 B;  1FIQ A;  2KT7 A;  3AED B;  3ZRF A;  1FRD A;  2K25 A;  2RSU A;  2KWC A;  1KLG D;  5DPT A;  1C9F A;  1TGZ B;  5IOI A;  3AEF B;  1CMX B;  2YEP B;  5EE3 A;  4IWP A;  4RM8 A;  2K22 A;  3DVN U;  2EKE C;  2D3G A;  1ZUD 2;  5AUI A;  1MJD A;  2QIE B;  3RD2 A;  3ZDT A;  2NPT B;  4YTN B;  3RNG C;  2WDQ B;  3BK2 A;  4JIO U;  4BVU C;  3KUZ A;  2IGG A;  1YQ4 B;  5TR5 A;  2WHI A;  1K52 A;  3ZIM A;  3QC8 B;  3NUH B;  3R66 C;  4PYZ A;  4FA6 A;  3OJ4 B;  1GAQ B;  3CMM B;  2CJO A;  2IDY A;  3P63 A;  2W3R A;  3FKY A;  1TYG B;  4B9K A;  2KAN A;  4OVV A;  1E7P B;  3WAN A;  1T0Q C;  1UH6 A;  2CJN A;  4NQK E;  4N59 A;  3UI3 A;  4HVB A;  1V86 A;  1OQY A;  1MVK A;  1C78 A;  1TKG A;  3JYU A;  2WLB A;  3KWV A;  3MC9 A;  3TJP A;  4GU2 A;  1C77 A;  5BMH A;  3DBL B;  3ZTD A;  3B0A A;  3RZW C;  4DHJ D;  1KTK A;  3NZ3 A;  4AQ7 A;  4W9D A;  2A4Z A;  3RNC C;  2H88 B;  2LZ6 A;  4XE0 A;  2QHO A;  1UNS A;  1WX9 A;  1SGH A;  2IZV B;  2KQ4 X;  3EUB 2;  4HXD A;  2GBK A;  2PW9 A;  3TL5 A;  1Z5S B;  3VHT C;  3EFC A;  2LVQ A;  5FR3 A;  3KVF B;  1WH3 A;  2G9H D;  4ITK A;  1NYQ A;  3Q8C A;  4G0N B;  3QHT A;  1ZDX A;  2G1E A;  3VUW A;  3WAM A;  3DWM A;  2K8H A;  4EZL A;  3C19 A;  3PT2 B;  3KYC D;  4II3 B;  3ZNZ B;  2KYW A;  1TS2 A;  4C4V A;  1Z2M A;  3R7Q A;  1K53 A;  2O6V A;  2OHF A;  3NVY A;  4GDL A;  5HG2 A;  4MSQ B;  1BML C;  3Q6B A;  1E0Z A;  3PLU A;  1EU4 A;  1NEN B;  2PMV A;  4BKS D;  2WDR B;  3ZDM C;  1SE9 A;  2MBB B;  4E3C A;  1SSN A;  2QDF A;  5DPS A;  1P0R A;  1RWS A;  2OED A;  1EU3 A;  2CU3 A;  4GMV A;  3I5J C;  2GLS A;  3ZO5 B;  2DZK A;  3U52 E;  4DHZ B;  2LWP A;  4OZC A;  1B1Z A;  4C00 A;  4IW0 A;  1LM8 B;  2J0J A;  5D94 A;  4B6W A;  2BF8 B;  3DCG A;  5D2M B;  2G4D B;  3VDZ A;  4ANV A;  2GBR A;  4A3O A;  2KTF A;  4PYU A;  2BS3 B;  3LDZ E;  1J7C A;  3V61 A;  3APD A;  4TUU A;  2V1Y A;  4G3X B;  4ICV A;  4RMA A;  1VJK A;  1E7V A;  3VUX A;  4H2A A;  2A5U A;  2NVU I;  2KFK A;  1TJE A;  2K1F A;  3DBH B;  1S1Q B;  3IT6 B;  1QZE A;  2KZR A;  3ZW3 A;  1ENF A;  2KDM A;  3PVL A;  4F7Z A;  4XYC A;  4E71 A;  2G4S A;  1HZ6 A;  2FUH B;  2LJI A;  2KLC A;  1Q10 A;  2R61 A;  2BTE A;  4WIP A;  1F77 A;  2L8J A;  1VRA B;  1ZP0 B;  1JWA D;  3IBE A;  1Y56 A;  2MBO A;  3BYY B;  1VZ6 A;  1ROE A;  1D6E C;  2GB1 A;  1N62 A;  1MHX A;  1HQR D;  3Q8F A;  1OEY J;  4REZ A;  4PS8 A;  1WI0 A;  2KN4 A;  5EE9 A;  3P4P B;  1VLB A;  2WYQ A;  2B76 B;  2Y5B B;  3EEC A;  4MSM B;  2LGI A;  2V9H A;  4M02 A;  2PVG C;  2LD9 A;  4RF1 A;  2LI5 A;  4FHJ A;  2V3S A;  1FD6 A;  1V1P B;  1H4R A;  3RNE C;  2BYE A;  2HD5 B;  1YJJ A;  1UZX B;  4W9K A;  1FM0 D;  3X23 A;  3N1Z C;  2ZCB A;  2L7R A;  5HHD G;  3BWU D;  5EE1 A;  4S0R A;  2LVO A;  4JWU C;  3ZYY X;  3Q8E A;  4AOF A;  1WX7 A;  2IBI B;  1C79 A;  2WGS A;  2BVC A;  2KQ7 A;  1XD3 B;  3NOB A;  4IC7 B;  1IGC A;  3IVF A;  1HEZ E;  1F9J A;  1C4C A;  2IY0 B;  4KGT A;  3VAW A;  3ZQ4 A;  1L0V B;  1L2N A;  2CHZ A;  1LFD A;  2KDE B;  2Y5P A;  2Y3A A;  4EOY A;  1P7E A;  4DK5 A;  4EZK A;  2IO0 B;  2KJR A;  2KO3 A;  2L3Z A;  3QX1 A;  2HE7 A;  5BYS A;  1KJT A;  4PS3 A;  1EM7 A;  4WWM A;  1IYF A;  2D10 A;  4C7Z A;  2V0G A;  4YT0 B;  1IUE A;  2ZEQ A;  3FIL A;  3ML9 A;  4W9H A;  3IAM 1;  3P4S B;  3NG0 A;  2FNJ B;  1M4V A;  3EFU A;  2RDB C;  1OQQ A;  1VDV A;  4YSZ B;  4W9I A;  4K3B A;  1DGJ A;  4J6I A;  1OEY A;  4HK2 A;  1ZXI A;  3A4R A;  3DVG Y;  4DHZ E;  3MHS D;  2KHW B;  4MGY E;  5D6J B;  4XWT A;  4ZYS A;  3ZJU A;  1E8X A;  1WXS A;  1A5R A;  4O1N A;  2SAK A;  1ZXH A;  1U4A A;  1A70 A;  3EA6 A;  1XF5 L;  3VTV A;  2MLB A;  1KRH A;  3PRP B;  2OOB B;  1SE4 A;  1C76 A;  2ZPN A;  3N3K B;  3JSV B;  2ZW0 A;  4DXA B;  2O2V B;  4TQ1 A;  1HTO A;  3IAS 1;  4YWG G;  4IM2 A;  4K7U A;  4LNF A;  4DHJ B;  4J3O D;  3W5U B;  1QKZ A;  4C7Y A;  1SIJ A;  4K7W A;  4MGI E;  2WU2 B;  2INN E;  2N9K A;  3H9D A;  2ACZ B;  4KZC A;  3QAQ A;  2W54 A;  2J42 A;  1UD7 A;  1J7B A;  3CSF A;  2FCN A;  1N5X A;  4RF0 A;  1TTN A;  4LNN A;  3TCA A;  3ENE A;  2KAC A;  2I1J A;  1SIF A;  2WX1 A;  4RGT A;  1ISN A;  2JX5 A;  3APF A;  3NJT A;  1YX6 B;  2KWD A;  2OJW A;  3VH3 B;  2AQ2 B;  2ON8 A;  3B08 A;  1PUT A;  3PSE B;  3I57 A;  1YOV B;  3SDL C;  2RPV A;  3L0W B;  1QLB B;  3ONS A;  3ECI A;  4BBN C;  2JUO A;  4IWO A;  4FLH A;  3R7R A;  4F1S A;  1JWM D;  3A9J B;  4M8M A;  1C4A A;  1HTQ A;  4KSK C;  2FIF A;  4B0M A;  2FCS A;  4HJG E;  1XCT L;  3WA0 A;  1N63 A;  2DEN B;  3H7P A;  2ZNV B;  3J9C A;  1LQB A;  4USA A;  2WXN A;  5AUK A;  2JYT A;  5J18 A;  2O6V B;  1JML A;  2E6X A;  3DBR I;  4GDL B;  1WIA A;  3GE3 C;  4D2K A;  3GS2 A;  3OAW A;  4RH6 A;  4UDU C;  2DX5 B;  3DHI C;  2N7J A;  3SFD B;  3TBL D;  2KAJ A;  3MFG A;  4JE3 B;  3M95 A;  3GOE A;  1N61 A;  3CF6 E;  4L2Y A;  3RZF A;  3AE4 B;  3DPD A;  2JPH A;  4GXB A;  3ZVV A;  3NZU A;  1SB3 C;  4IWQ A;  1AAR A;  1IPG A;  4F8C B;  4WQO B;  5CHW A;  3VXW A;  3DVN V;  4HCN B;  1FRR A;  2SEB D;  1V49 A;  4W9G A;  2C9W B;  5D3I B;  2H89 B;  3N9Y C;  3T8M A;  4WJO A;  2QSD A;  1PFD A;  2BB6 A;  2LXC A;  3MJ5 A;  1GNU A;  3QIJ A;  2BBC A;  2LGS A;  2WXF A;  3V6C B;  2JVC A;  2LEK A;  4FXC A;  2JRH A;  2L83 A;  2KFK B;  3DDC B;  3PS6 A;  4DBG A;  3VR9 B;  3L08 A;  3N32 A;  1E90 A;  4BOZ B;  4OZA A;  1GJZ A;  3AE1 B;  5DCN A;  2AQ3 B;  2JZP A;  3PGE A;  4JLC A;  3UIP B;  4KSL C;  2WXI A;  4A9A A;  2C60 A;  2MSE D;  2NBW B;  1V6E A;  4G11 A;  4EE2 A;  4DXG A;  4FBJ B;  1WGR A;  4KDL B;  3QCA A;  2CHW A;  3GE8 C;  3A4S C;  1TS4 A;  1SE2 A;  1FEH A;  2MW5 A;  4TQ0 A;  1UWX A;  2BQQ A;  3VTW A;  3PRM B;  2K0P A;  2YEP F;  3P1M A;  2NS5 A;  3ETR A;  3WAO A;  1N60 A;  3Q3F A;  1FNV A;  3ZGZ A;  3WAP A;  4OVU A;  3NY5 A;  3TEX A;  3UQA A;  3KH0 A;  1IGD A;  4AJW A;  1V97 A;  4NQL B;  3GB1 A;  3ZLZ A;  4URK A;  4HRS A;  1STE A;  1FNU A;  5IN7 A;  2KN5 A;  1CJE A;  2EMT A;  1WJ4 A;  3RI7 C;  5H8Y E;  1X1M A;  3AE3 B;  1DYQ A;  1H8C A;  2X8X X;  1ZE3 D;  2UWQ A;  2MP2 A;  2KVR A;  1XCQ L;  4TSS A;  2I2Y A;  3OWE B;  2BB5 A;  2DHZ A;  2KDB A;  1PGA A;  1YNT E;  2BT6 A;  1WXA A;  5CHV C;  1QIL A;  1RAX A;  1N5W A;  1MG8 A;  3Q2A C;  1WR6 E;  1PYW D;  3R2T A;  1P3Q U;  3Q8A A;  1JWB D;  1E8Y A;  1ZOY B;  1MHH E;  3PZ7 A;  3SU8 X;  3KUC B;  2MBQ A;  4B0E A;  1M94 A;  2JWZ A;  3KUD B;  1K50 A;  3FIL B;  3B2F A;  4RFB A;  5E6N A;  4N6E B;  3NVV A;  4ZYN A;  1DOX A;  3CIR B;  1WJU A;  1RM6 C;  2RR9 A;  3BVM A;  5GMV A;  3P4R B;  2HDE A;  4GGQ A;  4YSY B;  1Q1O A;  3ZUN A;  4HKZ E;  5E6O A;  1KOT A;  5JXV A;  2MJD A;  1D3Z A;  1RFA A;  5CTR C;  4BBN F;  1E6E B;  4JX1 C;  4P1C C;  3DQV A;  3WCQ A;  4JL9 A;  2NCN A;  2DBY A;  3T3N A;  2HTH A;  4JWS C;  1K51 A;  4FJY A;  3ZKJ C;  1S3S G;  5FR6 A;  3R3M A;  2KKC A;  1T3Q A;  5HI1 A;  4OHJ A;  1HE8 A;  2QEJ C;  2WWZ A;  2KMM A;  3LYY A;  2C7M B;  2KWV B;  4DDG D;  3A1Q B;  3EHV A;  5IO9 A;  2BW2 A;  2RDH A;  2ZPY A;  2O6V D;  3W2D A;  3UF8 A;  1BXT A;  1ZW7 A;  2WXH A;  2OJR A;  3E9S A;  3A9K B;  2KOX A;  3B2G A;  2K3U A;  2J0K A;  2AX5 A;  4OW0 A;  2WDT B;  2D07 B;  2KMC A;  1FMA D;  2N4F A;  2VZK D;  4HDO A;  4LNO A;  4AUQ C;  1VZ7 A;  4KIK B;  1QOG A;  1V5O A;  3W1Y A;  3DBL I;  2RGF A;  4AJY B;  3PRZ A;  1V9J A;  3IG3 A;  3O65 B;  4W9J A;  4TV3 A;  4EEW A;  1IBX B;  4RGO S;  4KKI A;  1WGG A;  4XX5 A;  5H92 C;  4XC2 A;  2LVP A;  1FXI A;  3SFE B;  4M01 A;  4MJS B;  5T8I A;  2JRI B;  1VD2 A;  3ALB A;  2L0T A;  2G3Q B;  2L76 A;  3RNF C;  2JY6 A;  2BS2 B;  4KDI C;  2BKR B;  1FXA A;  2KQS A;  3UQB A;  1EF5 A;  2ZVO A;  2G45 B;  4M0W A;  3U30 A;  4WQM A;  3K9O B;  4DQO C;  2JF5 A;  4BFR A;  4RM9 A;  1WJ6 A;  3AN1 A;  2KX3 A;  1XT9 B;  3RCZ A;  2PPH A;  3BZD B;  3L13 A;  4NJ6 A;  4DXF A;  5IKC M;  4WJP A;  4JPS A;  1KM7 A;  4I6L B;  4E74 A;  1L0Y B;  3NZS A;  3PPA A;  4RGN A;  3L4P A;  2K6Q A;  4EZJ A;  1WRD B;  1L6V A;  1N6Z A;  3S2A A;  1OTR B;  4ANW A;  4WWO A;  1MFW A;  2J7Q B;  3HM3 A;  2NPT A;  3H8H A;  3PZD A;  3JVZ X;  4ZRQ A;  3Q8B A;  3ZJV A;  1UBI A;  5JH5 C;  3PV1 A;  5G2N A;  3BK1 A;  4FHK A;  3PLV A;  1HXY D;  1FFV A;  3T3O A;  2L1A A;  2HTM E;  2IGD A;  3GZN I;  1KLV A;  2K39 A;  3ZJT A;  5KHO A;  2HJ1 A;  3RNA C;  3I3T B;  2ICI A;  2I38 A;  4X57 B;  3N20 C;  4ARI A;  5BYQ A;  3HHM A;  3DBH I;  1QQR A;  5J17 A;  2ZZP B;  2FID A;  3I63 C;  5AZF A;  1WY8 A;  2LAS A;  1ESF A;  2V4I B;  3D32 A;  4HDQ A;  1WXM A;  3N30 A;  3MP9 A;  3V3X A;  2J52 A;  1NEK B;  1V80 A;  1NI2 A;  3SHQ A;  1UEL A;  1LGR A;  2N9L A;  2CU1 A;  1QOB A;  2BPS A;  3IFW B;  4CQN A;  3VR8 B;  3MTN B;  1TZO A;  3EGR A;  3Q14 C;  1SJE D;  1WZ3 A;  1WE7 A;  1SBB B;  4DDI D;  1NBF C;  1QF6 A;  1WR1 A;  2LHE A;  1C1Y B;  1AYF A;  3PHW B;  2MBE A;  3DBR B;  3B1L X;  3AU4 A;  1J7A A;  4MDK E;  1I4X A;  4GIV A;  1L4Z B;  2K6D B;  2M0X A;  5EE0 A;  1Q5W B;  1SXT A;  2D2Q A;  4CYE A;  3OLM D;  3RN9 C;  3AE6 B;  4ZDV A;  4NJC A;  4HPP A;  1YJ1 A;  1ZPS A;  3LJ3 A;  2X38 A;  1D4B A;  3RNB C;  5L95 C;  4YXD B;  2KC2 A;  3HRD D;  1I7H A;  2DWQ A;  5AZG A;  1GPX A;  2JXT A;  2MRP A;  2J0M A;  3MC0 B;  4GDK A;  2E3T A;  4W9C A;  4ICU A;  3Q3N C;  1MG4 A;  2XNA C;  3DBS A;  1TKE A;  1XLP A;  3TMP B;  1TZ1 A;  5IA7 A;  1FFU A;  5LNK 1;  4W9F A;  5D3D A;  1WZ0 A;  2LJ5 A;  3NHE B;  2FAZ A;  2KFJ A;  5EDS A;  5G5H A;  1NYR A;  1AWD A;  4W9E A;  3NRZ A;  2FCM A;  2GBN A;  1P1A A;  4WWP A;  4BAX A;  4LJP B;  1FNW A;  1WJN A;  4G50 A;  1GUA B;  1GOZ A;  1JWU D;  1JW9 D;  2ZCC A;  4XWW A;  1ZDV A;  4ANX A;  2MX2 A;  1WSP A;  3TSS A;  1K8R B;  4KGR A;  1YN4 A;  3RPF C;  5CHF A;  1JWS D;  3MC8 A;  4C4V B;  1WXV A;  1CK1 A;  1SF0 A;  2N7E A;  1WMH A;  1XO3 A;  3BIN A;  4HPL B;  4MAC A;  2XBB C;  4LJO B;  4WJQ A;  5FK9 C;  2BS4 B;  3ZTC A;  5BMI A;  1B9R A;  2JU6 X;  2JZZ A;  2K5P A;  2D11 A;  1E8Z A;  2VZK B;  3QK0 A;  3FAH A;  1OFF A;  4WAA A;  2Z0D B;  3C0R B;  3SEB A;  3HVZ A;  5FKA C;  2JZ3 B;  2KJ6 A;  4CO7 A;  2PEA A;  3NS1 A;  3CWI A;  1QT9 A;  1PQS A;  4WWN A;  1D5Z C;  3HVD A;  4EKU A;  1KFY B;  1F52 A;  2MH7 A;  2MCN B;  3UIO B;  2AWT A;  1UBQ A;  4IM3 A;  4I6P A;  4KVG B;  4NAW A;  3SR6 A;  4LDT D;  3AE8 B;  3L54 A;  1V1P A;  1V2Y A;  3V6E B;  1TY2 A;  4MGZ E;  4ANU A;  2BYV E;  2MJ3 A;  1YMH E;  2L05 A;  2L0F A;  4KV2 A;  3IHP C;  1XEE A;  4NJ7 A;  3P42 A;  3LB8 C;  4II2 B;  4L23 A;  1EWC A;  2AQ1 B;  2IO3 B;  2D3B A;  2HJ8 A;  3I9V 1;  2JYE A;  4LNI A;  4XZ4 A;  2GI9 A;  3Q69 A;  4N58 A;  3U8Z A;  1WF9 A;  2XK5 A;  3OG5 A;  2QJL A;  3UGB B;  2KVZ A;  1Q0W B;  2FE8 A;  3TEW A;  4I6N B;  4YTM B;  4LK0 M;  1RLF A;  4LNK A;  5L83 A;  3PTF C;  1YQB A;  4YTP B;  4P6V F;  4GB9 A;  2MWS B;  3EC8 A;  1WGK A;  1KH0 A;  3BII D;  3FC4 A;  2JWU A;  2C5L C;  5LXH A;  3AE5 B;  3ZRC A;  1WYW B;  2KXJ A;  2XN9 C;  3PHX B;  1L7Y A;  1NI3 A;  2WXG A;  2NR2 A;  1JRP A;  2TSS A;  4L1B A;  2LUM A;  3AE7 B;  4JGH B;  3ABV B;  3RFZ B;  2QIL A;  4M8N A;  3VRB B;  3M62 B;  4HJK A;  1CQV A;  4NPN A;  4BKT A;  3TEZ A;  1XLO A;  4P16 A;  1QOA A;  4K3C A;  1FO4 A;  4CHK A;  4FN2 A;  4ARC A;  2N9E B;  1I4G A;  2W9N A;  4US9 A;  2M8S A;  1SEB D;  2CS4 A;  2DLB A;  3IXS A;  2WXP A;  3KLS X;  2Z8L A;  1TIF A;  1L6U A;  1GC6 A;  3JSV A;  4GLS C;  1I4P A;  3AH7 A;  1R7S A;  1V8C A;  2O2V A;  1WFY A;  3H7S A;  2K9X A;  2KLG A;  5HFY A;  1TY0 A;  4IKG A;  2PTL A;  3U4E G;  3T9L A;  2WU5 B;  2Q5W D;  2V4L A;  2B3A A;  3TIX A;  1AN8 A;  2LFI A;  2PVO D;  2C7H A;  3MJW A;  2DZJ A;  4JQW C;  2QMT A;  4A6Q A;  2DYM A;  5GXG B;  4P1B C;  3KWL A;  1FCL A;  1ET6 A;  3W9C B;  1ACC A;  2ASQ A;  3X0W A;  2IJ0 A;  4P7I A;  3PZ8 A;  4NAM A;  1WYG A;  4B95 A;  3ML8 A;  1MPE A;  3AEC B;  4RGM A;  3DHH C;  3KYD D;  1EUV B;  3E56 A;  2GBM A;  4A55 A;  3URY A;  1R4M I;  5C1Z A;  4W9L A;  1ZGU B;  4BKS A;  2LRW A;  5J2R A;  2IY1 B;  1R4N I;  2L32 A;  2LGD A;  3DWG C;  2BYF A;  3A9J A;  3BVZ A;  2R2Q A;  4K1R B;  3V60 A;  1YIW A;  1GG3 A;  1NDD A;  2NBU A; 
#chains in the Genus database with same CATH homology
 4RGT A;  1L0Y B;  4RGN A;  2JX5 A;  1PDX A;  4ZOH C;  2L52 A;  3L4P A;  2KWD A;  2AQ2 B;  2FUG 1;  1L6V A;  3KQ4 A;  2ON8 A;  1AW7 A;  1PUT A;  1LO5 D;  3I57 A;  4US8 A;  1E10 A;  4ZHO A;  1I4Q A;  3H8H A;  2RPV A;  1QLB B;  1HZ5 A;  4ZRQ A;  3Q8B A;  3ZJV A;  4MM3 B;  4YSX B;  1FIQ A;  4KGS A;  3AED B;  1FRD A;  3PO0 A;  3HUI A;  1JQ4 A;  1JWM D;  1KLG D;  1L5P A;  1C4A A;  3BK1 A;  1C9F A;  4B0M A;  4HJG E;  1HXY D;  1FFV A;  3AEF B;  3T3O A;  1UUP A;  1XCT L;  2HTM E;  2L1A A;  1YN3 A;  2IGD A;  1N63 A;  2YEP B;  5EE3 A;  3ZJT A;  2K22 A;  1WRI A;  3J9C A;  4GDK B;  2ICI A;  2I38 A;  2PKO A;  3TUO A;  4ARI A;  1ZUD 2;  4USA A;  5BYQ A;  5AUI A;  1QQR A;  2QIE B;  2WXN A;  5AUK A;  2JYT A;  1WWT A;  1P7F A;  1JML A;  2E6X A;  4GDL B;  4YTN B;  2WDQ B;  4MH8 A;  3BK2 A;  4D2K A;  1BUI C;  2IGG A;  1ESF A;  2V4I B;  3AEE B;  2NTS A;  3GS2 A;  4RH6 A;  4UDU C;  1YQ4 B;  1K52 A;  4KX6 B;  1JCK B;  2N7J A;  3NUH B;  3SFD B;  3MP9 A;  2KAJ A;  3MFG A;  4JE3 B;  5C2T B;  1NVI D;  3V3X A;  2INP E;  2J52 A;  1NEK B;  1XLN A;  1TS3 A;  1GB4 A;  1N61 A;  1GAQ B;  4XDD A;  5G5G A;  4L2Y A;  3AE4 B;  2N9L A;  2WXM A;  1QOB A;  4MT5 A;  4CQN A;  3VR8 B;  2CJO A;  1TZO A;  3EGR A;  2IDY A;  1F0Z A;  1SB3 C;  1SJE D;  3AEA B;  3P63 A;  2W3R A;  1TYG B;  1SBB B;  1QF6 A;  3TEY A;  2LHE A;  1E7P B;  4WUR A;  1RFK A;  1XLQ A;  2CJN A;  1AYF A;  4N59 A;  1FRR A;  2SEB D;  3UI3 A;  1PGB A;  4A90 A;  1J7A A;  1MVK A;  1VZ8 A;  5D7G A;  1C78 A;  1TKG A;  1I4X A;  5D3I B;  2H89 B;  3N9Y C;  2LMC A;  1L4Z B;  2WLB A;  3KWV A;  5EE0 A;  1C77 A;  2QSD A;  5BMH A;  1GB1 A;  2M0A A;  1PFD A;  2BB6 A;  1HA5 A;  5C3J B;  1SXT A;  2LHD A;  2D5G A;  3MJ5 A;  2PIA A;  1KTK A;  3NZ3 A;  4AQ7 A;  3AE6 B;  2BYT A;  4NJC A;  2BBC A;  2H88 B;  4XE0 A;  1UNS A;  1ZPS A;  3P4Q B;  2X38 A;  2KQ4 X;  1D4B A;  3EUB 2;  4TMA B;  2JQR B;  2WXF A;  2LEK A;  2PW9 A;  4FXC A;  4RCO A;  2L83 A;  4YXD B;  1VR9 A;  3VR9 B;  5FR3 A;  1F2R I;  2G9H D;  4ITK A;  3HRD D;  1NYQ A;  2RDG A;  3Q8C A;  4OZA A;  3AE1 B;  1I7H A;  2AQ3 B;  2DWQ A;  2JZP A;  1SJH D;  1GPX A;  2JXT A;  1KLU D;  1ZDX A;  2G1E A;  3VQI A;  3DWM A;  1FCC C;  4C56 C;  3MC0 B;  4NAW B;  2WXI A;  2E3T A;  4A9A A;  1TS2 A;  2ONQ A;  2IPK D;  1C4P A;  1K53 A;  4EE2 A;  4DXG A;  2XNA C;  2OHF A;  1L4D B;  1TKE A;  2EKI A;  3NVY A;  1XLP A;  5HG2 A;  1FFU A;  1I4H A;  5LNK 1;  5D3D A;  1BML C;  2PLP A;  1TS4 A;  1SE2 A;  1FEH A;  1E0Z A;  1EU4 A;  1NEN B;  2PMV A;  2WDR B;  4TQ0 A;  1UWX A;  2DYO A;  1SE3 A;  3W5V B;  1SSN A;  5G5H A;  1NYR A;  1AWD A;  2K0P A;  2YEP F;  3P1M A;  3ETR A;  3NRZ A;  1N60 A;  1RWS A;  4ZRP A;  1FNV A;  2OED A;  1PGX A;  1EU3 A;  3ZGZ A;  1FNW A;  2CU3 A;  3TEX A;  1GOZ A;  1JWU D;  1IGD A;  3AMZ A;  2WXK A;  1JW9 D;  4XWW A;  1ZDV A;  1V97 A;  1WSP A;  3TSS A;  1CZP A;  4KGR A;  3GB1 A;  3U52 E;  1YN4 A;  3RPF C;  4PT5 A;  4HRS A;  4OZC A;  1JWS D;  1B1Z A;  1STE A;  1FNU A;  3AM9 A;  1CK1 A;  1CJE A;  1SF0 A;  1XO3 A;  1EWY C;  4AS1 A;  2WXO A;  5H8Y E;  4MAC A;  3AE3 B;  1DYQ A;  3AV8 A;  2MJE A;  5FK9 C;  2BS4 B;  1ZE3 D;  2NTT A;  3LXF A;  5BMI A;  1UWM A;  1B9R A;  2N0S B;  2JU6 X;  2BS3 B;  3R8B A;  4IOI E;  1J7C A;  2K5P A;  2W3S A;  1XCQ L;  1YJI A;  4A8X C;  4TSS A;  2I2Y A;  3U7Z A;  2VZK B;  1VJK A;  3OWE B;  2BB5 A;  3FAH A;  1OFF A;  3MHZ A;  4H2A A;  3AEB B;  3SEB A;  3HVZ A;  1PGA A;  1YNT E;  1YQ3 B;  2BT6 A;  5FKA C;  4NZL B;  1TJE A;  4LLG M;  1QIL A;  3NS1 A;  3IT6 B;  3CWI A;  1QT9 A;  1ENF A;  1RYJ A;  1TKY A;  1D5Z C;  1N5W A;  2MEK A;  2Y5C A;  3HVD A;  1KFY B;  2KDM A;  4WH4 A;  2MH7 A;  1HZ6 A;  1PYW D;  5BMG A;  2LJI A;  3R2T A;  1Q10 A;  2NMQ A;  2R61 A;  2BTE A;  4WIP A;  1F77 A;  3Q8A A;  1JWB D;  1VRA B;  1ZP0 B;  2RMM A;  3SR6 A;  3AE8 B;  3BYT B;  1ZOY B;  1JWA D;  1V1P A;  1MI0 A;  1MHH E;  1Y56 A;  1TY2 A;  3BYY B;  1VZ6 A;  3PZ7 A;  1ROE A;  1D6E C;  2MJ3 A;  4B0E A;  1YMH E;  2GB1 A;  1N62 A;  1TS5 A;  1K50 A;  1MHX A;  1HQR D;  3Q8F A;  3FIL B;  3B2F A;  1T6B X;  4REZ A;  4RFB A;  4Q2J A;  2KN4 A;  5EE9 A;  3P4P B;  4N6E B;  3NVV A;  1ET9 A;  1DOX A;  3CIR B;  1XEE A;  1VLB A;  1RM6 C;  3P42 A;  3LB8 C;  4L23 A;  1EWC A;  3BVM A;  2B76 B;  2AQ1 B;  3P4R B;  2LGI A;  3I9V 1;  4RNA A;  2HDE A;  2JYE A;  2PVG C;  2GI9 A;  3Q69 A;  1E9M A;  4N58 A;  2IGH A;  4RF1 A;  2QJL A;  1JRO A;  4YSY B;  2FE8 A;  1FD6 A;  1V1P B;  3TEW A;  4YTM B;  4LK0 M;  4YTP B;  4LTU A;  4P6V F;  1YJJ A;  4ZHP A;  4HKZ E;  1FM0 D;  5JXV A;  2FBW B;  2MJD A;  2V3N A;  1WGK A;  1KH0 A;  3BII D;  3FC4 A;  3W1S A;  1D5M C;  1F2R C;  2JWU A;  1OQR A;  5HHD G;  3BWU D;  1E6E B;  2WDV B;  4KKJ A;  4JX1 C;  5EE1 A;  1L0X B;  2W82 A;  2WNM A;  4JWU C;  3ZYY X;  2WS3 B;  3AE5 B;  4HKQ A;  2XN9 C;  1YN5 A;  2WXJ A;  3NVW A;  3Q8E A;  1NI3 A;  2WXG A;  3WCQ A;  1C79 A;  4OZB A;  1JRP A;  2J4X A;  2DBY A;  1WXQ A;  2J53 A;  3T3N A;  2TSS A;  4L1B A;  4JWS C;  1IGC A;  1K51 A;  2LUM A;  3AE7 B;  1HEZ E;  2GRI A;  1C4C A;  4KGT A;  3ABV B;  3RFZ B;  2QIL A;  3ZQ4 A;  1L0V B;  2M19 A;  3NVZ A;  3GP7 A;  3R2I A;  3VRB B;  5E6J A;  1T3Q A;  5HI1 A;  1DOY A;  3AE9 B;  1CQV A;  4OHJ A;  4OVZ A;  2QEJ C;  2Y5P A;  3TEZ A;  1XLO A;  4P16 A;  3AB5 A;  1QOA A;  2Y3A A;  1FO4 A;  4ARC A;  2KMM A;  4HRO A;  3LYY A;  4HEA 1;  1P7E A;  1I4G A;  2WP9 B;  1IBX A;  2BW2 A;  4US9 A;  2EEL A;  1SEB D;  2RDH A;  2DLB A;  5BYS A;  3W2D A;  1EM7 A;  4WWM A;  1BXT A;  5MPO A;  3IXS A;  4C7Z A;  2WXP A;  2V0G A;  2WXH A;  3E9S A;  2WXL A;  2Z8L A;  3KLS X;  4XDC A;  1L6U A;  4YT0 B;  3B2G A;  4GLS C;  1I4P A;  3AH7 A;  1IUE A;  1R7S A;  1V8C A;  1KF6 B;  3FIL A;  2K3U A;  2AX5 A;  3IAM 1;  3P4S B;  4OW0 A;  2K9X A;  1M4V A;  5HFY A;  1QOF A;  1OQQ A;  1FMA D;  1VDV A;  2VZK D;  5BYR A;  2W55 A;  1TY0 A;  4IKG A;  2PTL A;  3AEG B;  4YSZ B;  3U4E G;  1VZ7 A;  2WXR A;  1QOG A;  2JSV X;  2WU5 B;  3O13 A;  1DOI A;  2Q5W D;  4IDI A;  1DGJ A;  1UGJ A;  1AN8 A;  1ZXI A;  2LFI A;  2PVO D;  1IBX B;  4RGO S;  4XWT A;  4ZYS A;  3ZJU A;  4WAF A;  3V05 A;  2QMT A;  4KKI A;  4O1N A;  2SAK A;  1ZXH A;  4A6Q A;  1A70 A;  3EA6 A;  5I4D A;  2DYM A;  3B9J A;  1XXG A;  5H92 C;  3AE2 B;  5GXG B;  1XF5 L;  1I4R A;  2WXQ A;  3KWL A;  1FCL A;  1FXI A;  3SFE B;  1ET6 A;  1KRH A;  1SE4 A;  1ACC A;  1C76 A;  3W9C B;  3VRA B;  5T8I A;  2IJ0 A;  2ZW0 A;  4TQ1 A;  3IAS 1;  2V3P A;  3PZ8 A;  1JAL A;  4YWG G;  4NAM A;  1WYG A;  2BS2 B;  1MPE A;  4J3O D;  3W5U B;  3C8Y A;  3AEC B;  4RGM A;  1FXA A;  1QKZ A;  2M56 B;  3IT4 B;  4C7Y A;  4R3D A;  3E56 A;  2WQY B;  1D5X C;  1SIJ A;  4M0W A;  2ZW1 A;  4WQM A;  4A55 A;  2WU2 B;  3URY A;  4DQO C;  2INN E;  2N9K A;  2ACZ B;  3U2S C;  3AN1 A;  5TSS A;  3BVG A;  1V1O A;  2W54 A;  2J42 A;  4C80 A;  2L32 A;  1T5X D;  1J7B A;  3DWG C;  1N5X A;  4RF0 A;  3BZD B;  4DXF A;  3BVZ A;  4JPS A;  2KAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...