1L6VA

Structure of reduced bovine adrenodoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
106
structure length
106
Chain Sequence
DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenodoxin 1
publication title A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 9
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l6vA00
1GAQB 4HRSA 2M19A 1XO3A 2WDRB 1E7PB 2H88B 2WP9B 1WYGA 2W55A 1NYQA 3AE4B 3VR8B 3DWMA 4US8A 2PVOD 3AE3B 3NVWA 4A9AA 2PIAA 1QOGA 1L5PA 1T3QA 3P4SB 1F0ZA 1RM6C 2L83A 2W3RA 4ZOHC 1CJEA 1A70A 3NRZA 1TYGB 1YJJA 3NVYA 2B76B 2HTME 4N6EB 2G1EA 2MJEA 4US9A 1L6UA 1GPXA 3AEDB 3FC4A 1FXAA 1TJEA 3AE7B 1ZXIA 5MPOA 1NYRA 3W5VB 2OHFA 1ZOYB 1N60A 1OQRA 1EWYC 2WQYB 4YT0B 3AE1B 1R7SA 2BT6A 1IUEA 2JQRB 1FFUA 5EE0A 1DOYA 1DOXA 1PFDA 3FAHA 3VRAB 1J7BA 1AYFA 1J7AA 4USAA 1L0VB 2WDVB 1UWMA 2BS2B 2Q5WD 3B2FA 3BIID 3AN1A 3SR6A 4YSXB 1SIJA 5C3JB 1FFVA 1JALA 1KRHA 2KMMA 1PUTA 5GXGB 3CWIA 1I7HA 1JRPA 1QOBA 2JX5A 5EE3A 2MH7A 1NEKB 1VJKA 1FIQA 2KAJA 2PVGC 2BS3B 3VR9B 2QIEB 2AX5A 4ZHOA 1V97A 3P4PB 3RPFC 2K9XA 1QF6A 1QOAA 3LXFA 1L6VA 3NS1A 1JQ4A 5EE1A 1AWDA 2EKIA 1WRIA 1OFFA 3AM9A 3HUIA 3AB5A 5AUKA 1SB3C 1YQ3B 3ABVB 1XLQA 1E10A 1E9MA 1CZPA 2PKOA 3AV8A 3AEEB 4YSYB 5EE9A 1B9RA 3AE9B 3AE2B 3AE8B 3P1MA 1N63A 4IDIA 4N59A 2N0SB 3SFDB 1V8CA 1QT9A 1VLBA 3WCQA 4HROA 2K5PA 2CU3A 1FRRA 1ROEA 1N62A 2K22A 1DGJA 1XLPA 2WU2B 4JWSC 2WDQB 1J7CA 1NVID 3P4QB 4WWMA 4C7ZA 4C80A 3AH7A 3CIRB 1FO4A 3VRBB 2DWQA 3NVVA 1JW9D 3AEGB 4ITKA 3W9CB 5C2TB 3AEFB 4N58A 4YXDB 2CJNA 3DWGC 2BS4B 2MJ3A 2WLBA 1N5XA 1VDVA 2WU5B 3KWLA 3P63A 5H8YE 1JWBD 4WQMA 3W5UB 1E0ZA 2DBYA 1KFYB 3ETRA 1KF6B 5AUIA 3AMZA 4KX6B 4P6VF 4YTNB 4YTPB 1E6EB 2M56B 1SF0A 2L52A 1ZUD2 3SFEB 1WGKA 2CJOA 2H89B 3B9JA 3AEAB 2ACZB 3AECB 4YSZB 1WWTA 4FXCA 3EUB2 2FBWB 4C7YA 2W3SA 2LEKA 1TKGA 1FXIA 2QJLA 2W54A 1QLBB 3LB8C 4JWUC 2MJDA 1XLNA 1WXQA 5G5HA 1DOIA 3AE5B 1FRDA 4JX1C 5G5GA 1N61A 1RFKA 1YJIA 2E3TA 1YQ4B 1RWSA 1QOFA 1OQQA 1TKYA 3HRDD 3NVZA 1FMAD 1JROA 3ZYYX 3B2GA 1TKEA 5H92C 4ZHPA 1FM0D 3L4PA 1PDXA 3HVZA 1ZP0B 2WS3B 2Y5CA 1RYJA 4LTUA 3AEBB 4YTMB 1NENB 1JWAD 1NI3A 3PO0A 3AE6B 3P4RB 1XLOA 1N5WA
chains in the Genus database with same CATH superfamily
2HDEA 1STEA 2KACA 1RM6C 4I6NB 5FR6A 3AXCA 3IG3A 1MJDA 4KZCA 5CTRC 1TJEA 3ZNGC 4OVZA 4E74A 2E6XA 4YT0B 1ZE3D 2FNJB 1IUEA 2C60A 3NZ3A 1GC6A 4FLHA 2BYVE 1SIJA 3OJ3A 1JALA 1FFVA 4DHZB 3QIJA 1PUTA 2K8BA 1NEKB 2L76A 2JYEA 2M1MA 1SB3C 4KV2A 2R61A 2KLGA 1HTQA 3RT3B 2JRIB 3PTFC 1FCCC 3AE8B 4MM3B 1Y8RC 2KJHB 1DGJA 1V80A 1NVID 3AH7A 2RGFA 1R4MB 4M0WA 4IG7B 1WE6A 2NBUA 2O2VB 3P63A 4M01A 4LNOA 2IO1B 1ESFA 3H7PB 4JIOU 4ZRJA 1VZ8A 4GGQA 3DCGA 3PPAA 3SD5A 3KYDD 3PHWB 2FBWB 4DDGD 4S0RA 1EU3A 3GE8C 2GBRA 4JE3B 2MBQA 4W9FA 4AWJA 2AL3A 2DAJA 3Q8BA 1YQ4B 4GDKA 4Q2JA 3EC8A 2PLPA 1TIFA 4BFRA 4BKTA 1HXYD 2LASA 1HEZE 1YN4A 5DPSA 3TUOA 1WMHA 2Y5CA 2WDTB 2XK5A 1CMXB 1GB4A 1JWMD 3NJTA 4K3CA 2LFIA 2LVQA 2R2OA 1H8CA 3CSTA 3IFWB 2JZPA 1ISNA 1UUPA 4RM8A 2HTME 4US9A 4XX5A 2IGHA 3A4SC 2QHOA 2IO2B 1IP9A 4CO7A 5EE0A 1SXTA 2JRHA 4DHJD 3CWIA 1QOBA 3RNCC 3BK2A 4C4VB 1T5XD 4PYZA 2IO3B 5AUKA 4AS1A 2KFJA 2SEBD 1I4HA 2WXQA 1K8RB 3WALA 3AV8A 5EE9A 1WX8A 2NBWB 4HROA 2CU3A 4L1BA 2QILA 4EEWA 1EO6A 3I63C 3GOEA 3TEZA 2DZIA 4DQOC 2DWQA 1JW9D 2LUMA 3VUWA 1JWBD 4LK0M 1KF6B 1WGHA 3ZJTA 1E6EB 2ZCCA 3B9JA 2W3SA 1ZPSA 1FXIA 1QLBB 1FEHA 4JWUC 2MJDA 4IKGA 2ZEQA 1ZKHA 1RFKA 3BYTB 1HQRD 3RNGC 2KHWB 1V86A 2LGYA 2RDGA 2KTFA 5H92C 2LGXA 4EOYA 3A1QB 4TV3A 4YTMB 3IHPC 1R4MI 5HKHA 4C80A 3SDLC 4LNKA 2M19A 1WYGA 3IAM1 1PQSA 4RGMA 1D5ZC 4MM3A 3LDZE 1F77A 3NRZA 4W9KA 1TYGB 4ZRPA 2MJEA 4RGOS 1FXAA 1ZXIA 2IZVB 4HXDA 3VXWA 2O2VA 1RRBA 4F1SA 1IPGA 2PW9A 3H7PA 3N9YC 1HE8A 2PPHA 3B0AA 4HLEA 1AYFA 1FPYA 2GLSA 4LNFA 5D94A 3TL5A 2M17A 1Y56A 3KUZA 2HJ1A 2MHJA 3PT2B 4IM3A 1WIAA 3ZLZA 1Z2MA 4J3OD 1JWSD 2MP2B 3M63B 3LXFA 2WXMA 1XT9B 3AM9A 5D7GA 3NY5A 4HDQA 3L54A 3PS6A 1I4GA 4EKUA 1V8CA 4BKGA 3TIXA 3QK0A 4TQ0A 3A9JB 1AW7A 4HDOA 5DCNA 1XLPA 1PYWD 1TS5A 4HKQA 4OHJA 2FUG1 2OOBB 1D6EC 3T3NA 2K8HA 1XD3B 4JGHB 2WXNA 1J19A 3AMZA 2V0GA 1SF0A 4LLGM 5E6PA 3EUB2 3Q3OC 4JPSA 4FN2A 1OQYA 1WF9A 3BYYB 2FUHB 2K6QA 1K53A 1WXQA 5LNK1 5G5HA 2BKRB 2I1KA 1MI0A 2DNFA 4W9DA 3ECIA 5IA7A 4K7UA 4DHZE 3NVZA 3ZTDA 3M3JA 1WX9A 1TT5B 1ACCA 2UU7A 1IGDA 2XBBC 4C4VA 1WZ0A 3AE6B 1SE4A 3AEGB 4HRSA 2JYTA 4L23A 1C4AA 1D4BA 1WFYA 2NS5A 3FKYA 4RF1A 2MX2A 2GBNA 1I4XA 4DHJB 4X57B 3KUCB 2EMTA 3JSVB 2KX0A 1KLVA 3HHMA 3AE7B 2MEKA 1GC7A 2J4XA 1OQRA 3JVZX 1IGCA 5DPTA 1WSPA 2DAFA 3L10B 3FAHA 1I4QA 2FAZA 3JW0X 1U4AA 4B0EA 3RNEC 2QSDA 4ZYNA 4RGNA 2Z59B 3PV1A 4WURA 2PVGC 1KLGD 5AZHA 4ICVA 3NS1A 1C4CA 1XXGA 1XF5L 3EGRA 3ZKJC 1YX6B 4GOCA 4HKZE 4N9F4 4OZCA 3A1QA 3U7DA 3V62A 3CIRB 1XCQL 2RD0A 2I2YA 2BVCA 3DWGC 2BS4B 2FCSA 1KFYB 2BTEA 2D11A 4PS3A 3ML8A 3X0WA 1E8YA 3ALBA 4PS7A 2VZKD 3QWZB 5FKAC 2QCZA 1K51A 3NHEB 1YN3A 2BB5A 2ZVNA 3C8YA 4IWOA 3UF8A 2Y3AA 1HZ5A 1YJIA 3VHTC 4WJPA 4GLSC 3ZYYX 2AL6A 2G4DB 2XN9C 4HJGE 1NENB 2MP2A 4JQWC 5LXHA 2JXXA 3RMKC 3SU8X 2GBJA 2MRPA 1E7PB 2WP9B 2D3AA 1PGXA 4UDUC 3O13A 3AE3B 3FILB 4KZ0A 3L0WB 3A9JA 4XE0A 4ZRQA 5E6JA 4EE2A 2LGSA 4EUTA 3NVYA 3M62B 4N6EB 1C76A 2EKEC 3V05A 2K1FA 3MC9A 2CHWA 4GN1A 4XGAB 4AUQC 1UH6A 4RF0A 2M8SA 1L2NA 1X1MA 3K9PB 5E6OA 3U8ZA 4B9KA 1JRPA 5EE3A 3R7QA 1I35A 4MGIE 2A5UA 1T0YA 4GSWA 4MT5A 4NZLB 1JRUA 1WRIA 1OFFA 3H8HA 1P9DU 5TSSA 4NQLB 1CZPA 4N59A 3SFDB 1VLBA 3APDA 1ROEA 3MP9A 4P16A 4G3XB 3ZDTA 1FO4A 2IJ0A 5I4DA 3DVGX 3AEFB 4P6VF 4I6PA 2WU5B 1C78A 2FCMA 2B3AA 4GIVA 3IT4B 4MSQB 4FHKA 3JSVA 3WANA 1CQVA 2LVOA 3KLSX 4K81A 4XYCA 2KD0A 2ZW1A 1LFDA 2K25A 5G2NA 1V1PB 4WH4A 3UQAA 2KNBA 5AZGA 1EF1A 3VH3B 5HHDG 2N9LA 4W9EA 3PO0A 2IGDA 1LM8B 4MACA 3TEYA 3VR8B 1V2YA 2KYWA 4PK1A 2J53A 1L6UA 2ZNVC 2NTTA 1QZEA 3QJZA 2K6DB 4II3B 2JZZA 3VTUA 3RFZB 1R7SA 2WXFA 1PFDA 2INNE 2D10A 2N7JA 1LQBA 2AYOB 1F52A 2IGGA 3SHQA 4KGRA 2CR5A 4QAYA 4TSSA 4K7SA 5FR3A 4ZHOA 3GE3C 5JXVA 3J9CA 1GNUA 4FBJB 1L6VA 1FCLA 2KTRB 1YQ3B 3ABVB 2L0FA 2L8JA 2J7QB 2VZKB 1N63A 2NBVB 3URYA 3D32A 3TSSA 2K22A 3PZDA 2DYBA 2N4FA 3Q3NC 2OJRA 2PEAA 2BYTA 4W9IA 1C3TA 3P2BA 3PLVA 3H1UA 3FILA 3EFUA 1UGJA 4MSMB 4MEMA 3DHIC 2IY1B 2KVZA 4OW0A 3Q8CA 5J17A 4DXAB 4GB9A 5KHOA 1FNWA 3AI5A 3RD2A 3U2SC 1H4RA 2INPE 2KDBA 2LGIA 2WWZA 2IDYA 3DBHB 3MFGA 4MELA 3T9LA 4KSLC 4P7IA 1PDXA 2RPQA 5HG2A 4RMAA 1T0SC 5DPWA 1UZXB 1IYFA 1V5TA 2LHDA 3Q3MC 4GXBA 1TY0A 2KXJA 4US8A 2G4SA 3DWMA 2MBBB 2JY6A 3N1YC 1SJED 2KN5A 4KDLB 4FJZA 2PJHA 3DVNU 3TJPA 5AZFA 3FC4A 3MJWA 3PRZA 4DWFA 1SGHA 2N9EB 2MBOA 1VR9A 4REZA 1YOVB 2REXA 1JCKB 1E8XA 2GB1A 2JU6X 2O6VD 3Q14C 4BVUC 3QC8B 3U7ZA 2KMMA 3V61A 2JX5A 3QA8A 3SEBA 3KUDB 4BBNF 2G9HD 2ZJDA 2MLBA 1V1PA 1ET9A 1XLQA 4LNNA 1GG3A 4XC2A 2YEPB 1B9RA 5JH5C 4G0NB 1Q5WB 5J18A 4KKIA 1J7CA 1KM7A 3ZIMA 3HM6X 1WM3A 2QDFA 5C2TB 4RCOA 4YXDB 5EDSA 1QKZA 2KX3A 2CS4A 4EZKA 3ETRA 4IWPA 3ZUNA 2AQ2B 2OJWA 5J2RA 3QQ8B 2L52A 4JL9A 3AEAB 2RR9A 4YSZB 2XEWA 2D07B 2V4LA 1D5XC 2C9WB 2KDFB 4A3PA 3W1SC 1WGRA 2N7DA 4EFOA 4A3OA 2PTLA 1TKYA 3UGBB 2FCNA 1JROA 3B2GA 2WYQA 4XDDA 3PVLA 4M02A 1WH3A 3AEBB 1YJ1A 1JWAD 3HVDA 1XLOA 1G6JA 1UF0A 2KTRA 3W1YA 1ET6A 2PVOD 3DBLB 4FA6A 1P0RA 1DYQA 2J52A 2BB6A 5DPRA 3RI7C 1I4RA 1EU4A 2B76B 3RYTA 4A55A 2BGFA 1NYRA 1ZOYB 3IXSA 4RGTA 1FXTB 4GDLB 1ZDVA 1EWYC 2KVRA 3Q2AC 1YX5B 1XCTL 2BT6A 2Y5BB 1WXAA 4USAA 3DBHI 3AN1A 1KRHA 3WA0A 1WX7A 3AU5A 3R8BA 4DK5A 1F2RI 1T6BX 1C77A 4HCNB 2L32A 2AX5A 1WXVA 2VH2A 1WGYA 2DHZA 2JPHA 2YLMA 2KJ6A 3AE2B 4NPNA 3PLUA 3LYYA 3BVGA 2K5PA 4AJWA 2WXKA 2LXCA 2WDQB 2N1WA 1E8WA 3VRBB 3W9CB 3APFA 4HPPA 3IBEA 3RNAC 4PS8A 3W2DA 2FIFA 4URKA 2UWQA 3H6NA 1YD8U 2H89B 2ACZB 2LEKA 2WGSA 4MH0E 1GB1A 1YMHE 3U4EG 2WXPA 2ON8A 1TZ1A 5IAAC 3DVNV 4IWQA 4BOSC 3RNBC 3HRDD 3MC8A 4NJ6A 4MGYE 1K50A 1E7UA 2N9PC 5C23A 4A20A 4ZRKA 1ZP0B 3DBRB 2FIDA 1WR1A 4CQNA 1TBEA 1NI3A 1MG4A 3ZRCA 1LO5D 2GRIA 2WDRB 4TKNA 3OLMD 2ZPYA 2L1AA 2LRUA 2O6VB 3NVWA 2LJ5A 4ZDVA 3RNFC 1TGZB 2L83A 2BKFA 2N9XA 4BZAA 5AEKB 4G11A 3A9KB 4RH6A 1TY2A 1BUIC 1WGDA 5LLIA 4II2B 3ZVVA 4A90A 3VH4B 4WWOA 2NPTB 5CHWA 1IBXB 2KLCA 4YSXB 3BK1A 1F9JA 1KTKA 2K0PA 1VJKA 1C4PA 2X38A 2QIEB 3DPDA 3KQ4A 3P4PB 2G3QB 2KC1A 3EECA 1UBIA 3GP7A 3OWEB 1HTOA 3Q69A 2EKIA 4PYUA 2LHEA 1BMLC 3DBLI 2PKOA 3UQBA 3N1XC 3LJ3A 1WI0A 4KDIC 1FRRA 3ZJUA 3I57A 1E90A 2WXHA 3MHZA 2LWPA 3EFCA 1TZOA 3MTNB 1WGGA 5FK9C 3Q3FA 1ZUD2 4EZLA 2VRRB 2MCNB 5TR5A 1YIWA 2MBHA 2LVPA 4L2YA 1WXSA 2G45B 4GDLA 1SE2A 5D6JB 3S2AA 2BW2A 1FRDA 1FMAD 1TKEA 3L16A 1RAXA 2X8XX 3VVWB 3E56A 2RMMA 3PGEA 2K39A 4ANVA 2MQJA 3ENEA 4H2AA 2JVCA 5CHVC 2C7MB 1ENFA 4K1RB 5IO9A 3DHHC 5BO4B 4ZOHC 2Y5PA 4BBNC 2M0XA 2KFKB 4WQOB 2D2QA 2RDHA 2DZJA 1F2RC 2I1JA 2KZRA 2Z0DB 2K3UA 4W9CA 1FFUA 1V81A 2KDIA 2YVCA 3QX1A 5GXGB 2FE8A 2KDEB 3C0RB 3DBRI 3VR9B 4D2KA 1A5RA 2D3GA 1P1AA 1C9FA 1Q0WB 3OAWA 3R66C 4LCDE 2DYOA 4YSYB 3RZFA 4IDIA 3DDCB 3TCAA 4RNAA 2ZCBA 2ZW0A 4WIPA 2NVUI 3RULA 2PMVA 3CSFA 1MFWA 4S17A 2WLBA 2KJRA 5JZEB 5H8YE 3Q6BA 2BWES 3N32A 2O6VA 2LGDA 2JWUA 4AQ7A 3PRPB 1NI2A 2MA9B 3A9KA 3AECB 1V9JA 1YNTE 2KWUB 5HFYA 2J0KA 3DOWA 4ACFA 1NBFC 3VQIA 3LB8C 4WWNA 1L0XB 1CK1A 1OGWA 5GMVA 1N61A 2NPTA 1IBXA 3N1ZC 1QOFA 1YN5A 3TMPB 3RCZA 4CYEA 1VCBA 2WX1A 4M00A 4LJPB 4NQKE 2JXTA 4M8NA 1N5WA 3GB1A 2L7RA 1WJNA 4OVUA 1NYQA 2V9HA 1I4PA 1A70A 2BBCA 2QEJC 4ZYSA 4WJOA 2TSSA 2EELA 2WQYB 4NJ7A 3MHSD 3AE1B 4A6QA 2LD9A 4DDID 3P42A 1GOZA 4GMVA 2GBKA 3OJ4B 3QCAA 1E8ZA 1V5OA 3PRMB 1FIQA 2KAJA 4AJYB 3NG0A 2PE9A 1Z5SB 1SE3A 4HJKA 2K9XA 1QOAA 2MW5A 4OVVA 2RSUA 1R4NB 2IO0B 2WXLA 5BYSA 3L13A 2SAKA 4KGTA 3DBSA 2N0SB 1J0GA 1RLFA 3WAPA 3EA6A 1SIFA 1WXMA 2V1YA 2WU2B 3ZJVA 3TEXA 4YL8A 1TS4A 4ITKA 1V49A 1MVKA 4EZJA 2C5LC 3MJ5A 4HPMB 4MH8A 3NUHB 2KQSA 2CKHB 4ANUA 4MGZE 5LXIB 3CMMB 4YTNB 2L05A 3N20C 1FNUA 2CJOA 2KFKA 1JMLA 4FXCA 1NDDA 1TKGA 4P1BC 1WRDB 1WZ3A 4HEA1 1TS2A 1KOTA 2AQ1B 1RWSA 5HI1A 3NZUA 4FJYA 2HTHA 2D3CA 1V6EA 3HVZA 2QC8A 3ZNZB 3JYUA 2IBIB 4MDKE 2LXAA 3RN9C 4IW0A 3WAOA 1QOGA 3N30A 2KWVB 3QARA 5JHBA 2W3RA 1EF5A 1UWXA 3I3TB 4RM9A 3HM3A 2GMIC 1PGAA 2RDBC 2KWDA 1RFAA 2ZZPB 4PT5A 1J7BA 1J7AA 2DENB 2L0TA 4FULA 1UWMA 2CU1A 4W9JA 2NCNA 1I7HA 4XDCA 3UIOB 1Q1OA 3BVMA 1V97A 3UINB 2BWFA 2EMSA 4WAAA 4KGSA 4IM0A 1XQQA 5BYRA 3V60A 4FHJA 4WWMA 4LDTD 2OEDA 4XWTA 1WJUA 2INDC 1E5WA 2MBEA 4C00A 3KWLA 4W9LA 3W5UB 3H9DA 1TS3A 2KC2A 2HJ8A 3WAMA 2BPSA 4OZAA 4KX6B 4YTPB 3HIZA 1VD2A 3KWVA 1E7VA 3TBLD 4ICUA 4YWGG 1WGKA 3ZNHB 1SEBD 3A33B 4FADA 4NAWB 1WWTA 4C7YA 4IOIE 2CHXA 1ZDXA 5KHQA 2GI9A 1R4NI 3AE5B 4JX1C 3T8MA 1OEYJ 5CHFA 1L4DB 1L4ZB 5BMIA 3ZRFA 2JSVX 3R2TA 4A8XC 1D5MC 4LTUA 4WAFA 3B08A 2LRWA 1F1HA 2H88B 4B6WA 2KT7A 4ARCA 4BKSA 1F0ZA 5IP4D 5MPOA 3BWUD 2LJIA 1SSNA 2JQRB 4HPLB 2CHZA 2YEPF 4K3BA 3ZXVA 1LXDA 1L0VB 2Q5WD 3B2FA 3SR6A 3KVFB 4G50A 2WX0A 2DZMA 4B95A 5L83A 2MH7A 2DLBA 2BS3B 1OEYA 1PGBA 1QF6A 1XEEA 2ASQA 1UELA 3AB5A 3NS8A 3R3MA 2V3NA 3M95A 2W9NA 4JWSC 3V6EB 1AARA 4K7WA 3NVVA 4NNJB 2BF8B 1UGMA 3U52E 2KMCA 2WXJA 2N7EA 4IUMB 1N5XA 1VDVA 2HD5B 3BZDB 2ZNVB 3VTVA 3DVGY 2NTSA 4BAXA 4ASWC 3ZNID 3ZQ4A 1M4VA 4BOZB 1FNVA 4O1NA 3K9OB 1D3ZA 2GOWA 3N3KB 3QAQA 1N6ZA 1TTNA 3UIPB 2V3SA 1QILA 4ZHPA 1FM0D 3L4PA 3I9V1 3Q8EA 3TEWA 2WS3B 4R3DA 1ZGUB 3C19A 1GAQB 1EUVB 4M8MA 1XO3A 1OTRB 2W55A 1VRAB 2BQQA 2AWTA 2KMAA 3AE4B 4CHKA 3X23A 4WJNA 4ANXA 2DZKA 1AN8A 3BINA 1B1ZA 1S3SG 3Q8FA 2G1EA 3BY4B 3AEDB 3Q8AA 1C79A 2Z0EB 2KDMA 3VFKA 1HA5A 4JLCA 1DOXA 4ANWA 3VRAB 2AEHA 2BS2B 2LUEA 3KYCD 4W9HA 4NAWA 1T0RC 3VDZA 4LDTB 4E3CA 2WHIA 1P7FA 2R2QA 4KIKB 3AULA 2KOXA 5IOIA 2NMQA 5EE1A 1JQ4A 3RZWC 2GBMA 3V6CB 1J8CA 1E9MA 1WY8A 3IT6B 1WE7A 4XWWA 3A4RA 1UD7A 3V3XA 2Z8LA 1MPEA 4AP4C 3R7RA 1MG8A 2MSED 4WWPA 4WQMA 2M0AA 3ZO5B 2DBYA 2JF5A 4I6LB 4J6IA 3L08A 3SFEB 3H7SA 4OZBA 2QJLA 2W54A 2ZPNA 1P98A 1GUAB 1DOIA 4TUUA 2J42A 5D2MB 2XNAC 4ARIA 2JZ3B 2IYDB 1OQQA 2C7NB 3CF6E 1RYJA 2C7HA 3HK0A 4BKSD 1Q10A 1EWCA 1ZW7A 2MWSB 2N9KA 4AOFA 2PE6B 4NAMA 3NZSA 2J0MA 1L5PA 1T3QA 3P4SB 3BVZA 3GZNB 4KVGB 1WR6E 4LJOB 4GU2A 1T0QC 3KW5B 3APCA 5CX3A 3W5VB 1MHXA 2OHFA 3OG5A 1N60A 4MJSB 5BYQA 1P7EA 2JUOA 3VUXA 2KO3A 4NY0A 1DOYA 5D3IB 3BIID 5C3JB 2LMCA 2QMTA 2BYEA 2LZ6A 1P3QU 2K8CA 5C1ZA 4P1CC 3WIMA 1AWDA 4IC7B 5D3DA 2KK8A 2KKCA 2UYZB 2NR2A 3P1MA 4C56C 1QT9A 1WJ6A 1N62A 1UBQA 4FJVB 4C7ZA 2A4ZA 1MHHE 1M94A 2J0JA 3ML9A 4HCPB 2MJ3A 5L95C 3I5JC 2D3BA 2M56B 1SBBB 3ZDMC 2WNMA 1VZ7A 1C1YB 2KANA 2WXOA 1KJTA 2IPKD 3GS2A 1XLNA 5E6NA 4MGKE 3VAWA 1QQRA 5G5GA 2DYMA 2E3TA 3EHVA 5IN7A 1L7YA 1BXTA 3UI3A 3IVFA 1V1OA 3PHXB 4KIKA 1UNSA 2M4NA 5T8IA 2JWZA 2L3ZA 4M0WB 4F7ZA 4HK2A 1HZ6A 2AQ3B 2N1VA 3QHTA 4WJQA 3ZW3A 3B1LX 1FD6A 4A9AA 2PIAA 5BMGA 1CJEA 2LI5A 4F8CB 1K52A 1YJJA 3Q3JA 3DQVA 2RPVA 1GPXA 4E71A 1I42A 1GJZA 4XZ4A 1KH0A 2V4IB 4RFBA 4KKJA 3VTWA 2I38A 3O65B 2WXIA 1WM2A 2VH1A 3T3OA 3L17A 2JT4B 2WDVB 2WXGA 1EM7A 4GDKB 3E9SA 3U30A 4ZRIA 1WJ4A 3PSEB 5IKCM 1WMHB 3RPFC 1WYWB 2XK5B 4W9GA 3ZGZA 5JHAA 2DX5B 2KN4A 4HVBA 3HUIA 4IM2A 3DHGC 2KWCA 3ZXRA 2L00B 4DBGA 2KQ4X 4NJCA 1E10A 3AEEB 2FCQA 3AE9B 4TQ1A 3WCQA 2ZVOA 3GZNI 3R2IA 2KQ7A 3P4QB 2IY0B 5BMHA 3AU4A 1BT0A 3KH0A 4N58A 2CJNA 1E0ZA 4KSKC 4B0MA 3ZTCA 5AUIA 3IAS1 3ONSA 2ONQA 4DXGA 1S1QB 3NOBA 2INCC 4DXFA 2BYFA 1ZXHA 3PREA 4MJSA 1LGRA 1KLUD 1VZ6A 2W82A 1JWUD 2WXRA 3MC0B 4LNIA 3VUYA 2D5GA 2V3PA 1YQBA 3PZ8A 3RUIB 1L0YB 3W1SA 1SE9A 2ICIA 4HWIB 5G55A 3PZ7A 2HE7A 4TMAB 1SJHD 3P4RB
chains in the Genus database with same CATH topology
1LO5D 2GRIA 2HDEA 1E7PB 2H88B 2WDRB 2WP9B 4ARCA 1PGXA 4UDUC 2L1AA 1STEA 3O13A 3AE3B 3NVWA 3FILB 2KACA 1F0ZA 4XE0A 1RM6C 2L83A 4ZRQA 5E6JA 4EE2A 3NVYA 4N6EB 1C76A 3V05A 4RH6A 1TJEA 1TY2A 1BUIC 3BWUD 5MPOA 4OVZA 2E6XA 2LJIA 4YT0B 1ZE3D 1SSNA 4A90A 2JQRB 1IUEA 3NZ3A 2YEPF 4RF0A 1IBXB 1L0VB 2Q5WD 3B2FA 3SR6A 4YSXB 1SIJA 1JALA 1FFVA 3BK1A 1PUTA 1JRPA 1KTKA 5EE3A 2K0PA 2MH7A 1NEKB 1VJKA 2DLBA 1C4PA 2X38A 2BS3B 2QIEB 3KQ4A 3P4PB 1PGBA 2JYEA 1QF6A 1XEEA 3GP7A 3Q69A 3OWEB 4MT5A 4NZLB 2EKIA 1WRIA 1OFFA 3H8HA 5TSSA 3AB5A 1SB3C 2R61A 2LHEA 1BMLC 1CZPA 2PKOA 1FCCC 3AE8B 4N59A 3SFDB 1VLBA 2V3NA 4MM3B 1FRRA 1ROEA 1DGJA 3ZJUA 4JWSC 1NVID 3AH7A 3I57A 3MP9A 4P16A 1FO4A 2IJ0A 3NVVA 5I4DA 4M0WA 2WXHA 3U52E 3AEFB 2WXJA 3MHZA 4P6VF 3P63A 1N5XA 1VDVA 2WU5B 1TZOA 3BZDB 1C78A 1ESFA 5FK9C 2NTSA 3IT4B 1VZ8A 1ZUD2 3ZQ4A 4L2YA 2FBWB 1CQVA 1M4VA 3KLSX 1EU3A 1FNVA 4JE3B 2ZW1A 1SE2A 2BW2A 1FRDA 4O1NA 1V1PB 4WH4A 3Q8BA 1YQ4B 4Q2JA 2PLPA 1FMAD 1HXYD 1TKEA 1QILA 4ZHPA 1FM0D 3L4PA 1HEZE 3I9V1 3Q8EA 1YN4A 5HHDG 3E56A 2WS3B 3TUOA 3TEWA 2N9LA 2Y5CA 2RMMA 4R3DA 3PO0A 3P4RB 1GB4A 1JWMD 1GAQB 1XO3A 2LFIA 4H2AA 2W55A 4MACA 3TEYA 1VRAB 3AE4B 3VR8B 1ENFA 2JZPA 1AN8A 4ZOHC 2Y5PA 1UUPA 2J53A 1B1ZA 3Q8FA 2HTME 4US9A 2G1EA 1L6UA 3AEDB 2IGHA 2NTTA 3Q8AA 2RDHA 1F2RC 1C79A 2K3UA 3RFZB 1R7SA 2KDMA 5EE0A 2WXFA 1FFUA 1HA5A 1DOXA 1PFDA 2INNE 3VRAB 2N7JA 2BS2B 1SXTA 2IGGA 5GXGB 3CWIA 1QOBA 4KGRA 3BK2A 4TSSA 1P7FA 2FE8A 3VR9B 5FR3A 4D2KA 4ZHOA 1T5XD 5JXVA 3J9CA 1L6VA 2NMQA 5EE1A 1JQ4A 1C9FA 5AUKA 4AS1A 1FCLA 1YQ3B 2SEBD 1I4HA 2WXQA 3ABVB 2DYOA 1E9MA 4YSYB 3AV8A 5EE9A 4IDIA 2VZKB 1N63A 4RNAA 3IT6B 4HROA 3URYA 2CU3A 3TSSA 4L1BA 2QILA 2K22A 4XWWA 2ZW0A 4WIPA 3TEZA 4DQOC 3V3XA 2DWQA 1JW9D 2Z8LA 1MPEA 2PMVA 2BYTA 2LUMA 2WLBA 5H8YE 1JWBD 2M0AA 4WQMA 2DBYA 4LK0M 3FILA 1UGJA 2JWUA 1KF6B 3ZJTA 4AQ7A 1E6EB 3SFEB 3B9JA 4OW0A 3Q8CA 3AECB 4OZBA 2W3SA 1YNTE 1ZPSA 5HFYA 1FXIA 2QJLA 2W54A 1FNWA 1QLBB 3VQIA 3LB8C 1FEHA 1L0XB 3U2SC 4JWUC 1CK1A 2MJDA 4IKGA 1DOIA 2INPE 2LGIA 2J42A 1N61A 1RFKA 1HQRD 2XNAC 3BYTB 1IBXA 4ARIA 2IDYA 3MFGA 1QOFA 1OQQA 1YN5A 2RDGA 5H92C 1PDXA 5HG2A 1RYJA 4YTMB 2JXTA 1N5WA 4C80A 1Q10A 1EWCA 2M19A 3GB1A 2LHDA 1WYGA 2N9KA 1TY0A 1NYQA 4US8A 3DWMA 4NAMA 3IAM1 1SJED 4RGMA 1L5PA 1D5ZC 1I4PA 1T3QA 3P4SB 3BVZA 1A70A 1F77A 3NRZA 1TYGB 2BBCA 4ZRPA 2MJEA 4RGOS 3FC4A 1FXAA 2QEJC 4ZYSA 1ZXIA 3W5VB 1MHXA 2OHFA 2TSSA 2EELA 1N60A 2WQYB 5BYQA 1P7EA 3AE1B 1VR9A 4REZA 4A6QA 2PW9A 3N9YC 1DOYA 5D3IB 1JCKB 3P42A 1AYFA 1GOZA 2GB1A 2JU6X 3BIID 5C3JB 3U7ZA 2LMCA 2KMMA 2QMTA 2JX5A 1Y56A 3SEBA 1FIQA 2KAJA 1SE3A 2K9XA 2G9HD 4J3OD 1QOAA 1JWSD 3LXFA 2WXMA 1AWDA 1V1PA 3AM9A 5D3DA 2WXLA 1ET9A 5D7GA 5BYSA 2SAKA 1XLQA 2YEPB 1B9RA 1I4GA 4KGTA 3P1MA 2N0SB 4C56C 1V8CA 1QT9A 4TQ0A 1AW7A 3EA6A 1N62A 1XLPA 2WU2B 1PYWD 1TS5A 1J7CA 4KKIA 3TEXA 4C7ZA 3ZJVA 4HKQA 1TS4A 1MHHE 4OHJA 2FUG1 4ITKA 1MVKA 3MJ5A 5C2TB 4MH8A 4RCOA 4YXDB 3NUHB 2MJ3A 1D6EC 1QKZA 3T3NA 3ETRA 2AQ2B 2WXNA 3AMZA 4YTNB 2V0GA 2M56B 1SF0A 2L52A 4LLGM 1SBBB 1FNUA 2CJOA 2WNMA 1VZ7A 3AEAB 4YSZB 1JMLA 4FXCA 3EUB2 4JPSA 1TKGA 2WXOA 3BYYB 2IPKD 1K53A 3GS2A 4HEA1 1XLNA 1TS2A 1D5XC 1WXQA 5LNK1 5G5HA 2AQ1B 1MI0A 1QQRA 5G5GA 2DYMA 2E3TA 1RWSA 2PTLA 1TKYA 5HI1A 3NVZA 1BXTA 1JROA 3UI3A 3B2GA 4XDDA 1ACCA 3HVZA 1IGDA 1V1OA 1UNSA 3AEBB 1JWAD 3HVDA 3AE6B 5T8IA 1XLOA 1SE4A 3AEGB 1ET6A 4HRSA 1HZ6A 2JYTA 2AQ3B 4L23A 2PVOD 1C4AA 1FD6A 1DYQA 2J52A 1D4BA 4RF1A 2PIAA 4A9AA 1QOGA 2BB6A 5BMGA 1I4XA 2W3RA 1CJEA 1UWXA 1K52A 1YJJA 1I4RA 1EU4A 2RPVA 2B76B 1GPXA 4A55A 3AE7B 2MEKA 1NYRA 1ZOYB 3IXSA 4RGTA 2J4XA 1ZDVA 1OQRA 1EWYC 4GDLB 1KH0A 1PGAA 1IGCA 2V4IB 4KKJA 1XCTL 2I38A 4RFBA 1WSPA 2BT6A 2KWDA 3FAHA 1I4QA 2WXIA 4PT5A 3T3OA 1J7BA 1J7AA 4USAA 2WDVB 1UWMA 2WXGA 1EM7A 3AN1A 4GDKB 4B0EA 1KRHA 3E9SA 1I7HA 2QSDA 4XDCA 4RGNA 3R8BA 1F2RI 3BVMA 4WURA 1T6BX 2PVGC 1C77A 1KLGD 2AX5A 2L32A 1V97A 3RPFC 3ZGZA 2KN4A 3NS1A 1C4CA 4KGSA 3HUIA 1XXGA 1XF5L 3EGRA 2KQ4X 4NJCA 1E10A 3AEEB 3AE9B 3AE2B 4TQ1A 4HKZE 3WCQA 3LYYA 3BVGA 2K5PA 3R2IA 2WXKA 5BYRA 4OZCA 2WDQB 3P4QB 4WWMA 5BMHA 3CIRB 1XCQL 2OEDA 3VRBB 4XWTA 3W9CB 2I2YA 4N58A 2CJNA 3DWGC 2BS4B 3KWLA 3W5UB 1E0ZA 1KFYB 1TS3A 2BTEA 4B0MA 3W2DA 4OZAA 5AUIA 4KX6B 4YTPB 3IAS1 2VZKD 3KWVA 5FKAC 2ONQA 4YWGG 1WGKA 1SEBD 2H89B 2ACZB 4DXGA 4NAWB 1WWTA 1K51A 4C7YA 4DXFA 2LEKA 1YN3A 2BB5A 4IOIE 1GB1A 1ZXHA 1YMHE 3U4EG 1ZDXA 2GI9A 2WXPA 2ON8A 3C8YA 1KLUD 1VZ6A 2W82A 1JWUD 2WXRA 3AE5B 4JX1C 2Y3AA 3MC0B 1HZ5A 1YJIA 2D5GA 3HRDD 2V3PA 1L4DB 3PZ8A 4GLSC 3ZYYX 1L4ZB 1K50A 5BMIA 1L0YB 3W1SA 2ICIA 2JSVX 3R2TA 3PZ7A 1ZP0B 4A8XC 1D5MC 4CQNA 4LTUA 2XN9C 4HJGE 1NENB 1NI3A 4WAFA 4TMAB 1SJHD 2IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAQ B;  4HRS A;  2M19 A;  1XO3 A;  2WDR B;  1E7P B;  2H88 B;  2WP9 B;  1WYG A;  2W55 A;  1NYQ A;  3AE4 B;  3VR8 B;  3DWM A;  4US8 A;  2PVO D;  3AE3 B;  3NVW A;  4A9A A;  2PIA A;  1QOG A;  1L5P A;  1T3Q A;  3P4S B;  1F0Z A;  1RM6 C;  2L83 A;  2W3R A;  4ZOH C;  1CJE A;  1A70 A;  3NRZ A;  1TYG B;  1YJJ A;  3NVY A;  2B76 B;  2HTM E;  4N6E B;  2G1E A;  2MJE A;  4US9 A;  1L6U A;  1GPX A;  3AED B;  3FC4 A;  1FXA A;  1TJE A;  3AE7 B;  1ZXI A;  5MPO A;  1NYR A;  3W5V B;  2OHF A;  1ZOY B;  1N60 A;  1OQR A;  1EWY C;  2WQY B;  4YT0 B;  3AE1 B;  1R7S A;  2BT6 A;  1IUE A;  2JQR B;  1FFU A;  5EE0 A;  1DOY A;  1DOX A;  1PFD A;  3FAH A;  3VRA B;  1J7B A;  1AYF A;  1J7A A;  4USA A;  1L0V B;  2WDV B;  1UWM A;  2BS2 B;  2Q5W D;  3B2F A;  3BII D;  3AN1 A;  3SR6 A;  4YSX B;  1SIJ A;  5C3J B;  1FFV A;  1JAL A;  1KRH A;  2KMM A;  1PUT A;  5GXG B;  3CWI A;  1I7H A;  1JRP A;  1QOB A;  2JX5 A;  5EE3 A;  2MH7 A;  1NEK B;  1VJK A;  1FIQ A;  2KAJ A;  2PVG C;  2BS3 B;  3VR9 B;  2QIE B;  2AX5 A;  4ZHO A;  1V97 A;  3P4P B;  3RPF C;  2K9X A;  1QF6 A;  1QOA A;  3LXF A;  1L6V A;  3NS1 A;  1JQ4 A;  5EE1 A;  1AWD A;  2EKI A;  1WRI A;  1OFF A;  3AM9 A;  3HUI A;  3AB5 A;  5AUK A;  1SB3 C;  1YQ3 B;  3ABV B;  1XLQ A;  1E10 A;  1E9M A;  1CZP A;  2PKO A;  3AV8 A;  3AEE B;  4YSY B;  5EE9 A;  1B9R A;  3AE9 B;  3AE2 B;  3AE8 B;  3P1M A;  1N63 A;  4IDI A;  4N59 A;  2N0S B;  3SFD B;  1V8C A;  1QT9 A;  1VLB A;  3WCQ A;  4HRO A;  2K5P A;  2CU3 A;  1FRR A;  1ROE A;  1N62 A;  2K22 A;  1DGJ A;  1XLP A;  2WU2 B;  4JWS C;  2WDQ B;  1J7C A;  1NVI D;  3P4Q B;  4WWM A;  4C7Z A;  4C80 A;  3AH7 A;  3CIR B;  1FO4 A;  3VRB B;  2DWQ A;  3NVV A;  1JW9 D;  3AEG B;  4ITK A;  3W9C B;  5C2T B;  3AEF B;  4N58 A;  4YXD B;  2CJN A;  3DWG C;  2BS4 B;  2MJ3 A;  2WLB A;  1N5X A;  1VDV A;  2WU5 B;  3KWL A;  3P63 A;  5H8Y E;  1JWB D;  4WQM A;  3W5U B;  1E0Z A;  2DBY A;  1KFY B;  3ETR A;  1KF6 B;  5AUI A;  3AMZ A;  4KX6 B;  4P6V F;  4YTN B;  4YTP B;  1E6E B;  2M56 B;  1SF0 A;  2L52 A;  1ZUD 2;  3SFE B;  1WGK A;  2CJO A;  2H89 B;  3B9J A;  3AEA B;  2ACZ B;  3AEC B;  4YSZ B;  1WWT A;  4FXC A;  3EUB 2;  2FBW B;  4C7Y A;  2W3S A;  2LEK A;  1TKG A;  1FXI A;  2QJL A;  2W54 A;  1QLB B;  3LB8 C;  4JWU C;  2MJD A;  1XLN A;  1WXQ A;  5G5H A;  1DOI A;  3AE5 B;  1FRD A;  4JX1 C;  5G5G A;  1N61 A;  1RFK A;  1YJI A;  2E3T A;  1YQ4 B;  1RWS A;  1QOF A;  1OQQ A;  1TKY A;  3HRD D;  3NVZ A;  1FMA D;  1JRO A;  3ZYY X;  3B2G A;  1TKE A;  5H92 C;  4ZHP A;  1FM0 D;  3L4P A;  1PDX A;  3HVZ A;  1ZP0 B;  2WS3 B;  2Y5C A;  1RYJ A;  4LTU A;  3AEB B;  4YTM B;  1NEN B;  1JWA D;  1NI3 A;  3PO0 A;  3AE6 B;  3P4R B;  1XLO A;  1N5W A; 
#chains in the Genus database with same CATH topology
 2HDE A;  1STE A;  2KAC A;  1RM6 C;  4I6N B;  5FR6 A;  3AXC A;  3IG3 A;  1MJD A;  4KZC A;  5CTR C;  1TJE A;  3ZNG C;  4OVZ A;  4E74 A;  2E6X A;  4YT0 B;  1ZE3 D;  2FNJ B;  1IUE A;  2C60 A;  3NZ3 A;  1GC6 A;  4FLH A;  2BYV E;  1SIJ A;  3OJ3 A;  1JAL A;  1FFV A;  4DHZ B;  3QIJ A;  1PUT A;  2K8B A;  1NEK B;  2L76 A;  2JYE A;  2M1M A;  1SB3 C;  4KV2 A;  2R61 A;  2KLG A;  1HTQ A;  3RT3 B;  2JRI B;  3PTF C;  1FCC C;  3AE8 B;  4MM3 B;  1Y8R C;  2KJH B;  1DGJ A;  1V80 A;  1NVI D;  3AH7 A;  2RGF A;  1R4M B;  4M0W A;  4IG7 B;  1WE6 A;  2NBU A;  2O2V B;  3P63 A;  4M01 A;  4LNO A;  2IO1 B;  1ESF A;  3H7P B;  4JIO U;  4ZRJ A;  1VZ8 A;  4GGQ A;  3DCG A;  3PPA A;  3SD5 A;  3KYD D;  3PHW B;  2FBW B;  4DDG D;  4S0R A;  1EU3 A;  3GE8 C;  2GBR A;  4JE3 B;  2MBQ A;  4W9F A;  4AWJ A;  2AL3 A;  2DAJ A;  3Q8B A;  1YQ4 B;  4GDK A;  4Q2J A;  3EC8 A;  2PLP A;  1TIF A;  4BFR A;  4BKT A;  1HXY D;  2LAS A;  1HEZ E;  1YN4 A;  5DPS A;  3TUO A;  1WMH A;  2Y5C A;  2WDT B;  2XK5 A;  1CMX B;  1GB4 A;  1JWM D;  3NJT A;  4K3C A;  2LFI A;  2LVQ A;  2R2O A;  1H8C A;  3CST A;  3IFW B;  2JZP A;  1ISN A;  1UUP A;  4RM8 A;  2HTM E;  4US9 A;  4XX5 A;  2IGH A;  3A4S C;  2QHO A;  2IO2 B;  1IP9 A;  4CO7 A;  5EE0 A;  1SXT A;  2JRH A;  4DHJ D;  3CWI A;  1QOB A;  3RNC C;  3BK2 A;  4C4V B;  1T5X D;  4PYZ A;  2IO3 B;  5AUK A;  4AS1 A;  2KFJ A;  2SEB D;  1I4H A;  2WXQ A;  1K8R B;  3WAL A;  3AV8 A;  5EE9 A;  1WX8 A;  2NBW B;  4HRO A;  2CU3 A;  4L1B A;  2QIL A;  4EEW A;  1EO6 A;  3I63 C;  3GOE A;  3TEZ A;  2DZI A;  4DQO C;  2DWQ A;  1JW9 D;  2LUM A;  3VUW A;  1JWB D;  4LK0 M;  1KF6 B;  1WGH A;  3ZJT A;  1E6E B;  2ZCC A;  3B9J A;  2W3S A;  1ZPS A;  1FXI A;  1QLB B;  1FEH A;  4JWU C;  2MJD A;  4IKG A;  2ZEQ A;  1ZKH A;  1RFK A;  3BYT B;  1HQR D;  3RNG C;  2KHW B;  1V86 A;  2LGY A;  2RDG A;  2KTF A;  5H92 C;  2LGX A;  4EOY A;  3A1Q B;  4TV3 A;  4YTM B;  3IHP C;  1R4M I;  5HKH A;  4C80 A;  3SDL C;  4LNK A;  2M19 A;  1WYG A;  3IAM 1;  1PQS A;  4RGM A;  1D5Z C;  4MM3 A;  3LDZ E;  1F77 A;  3NRZ A;  4W9K A;  1TYG B;  4ZRP A;  2MJE A;  4RGO S;  1FXA A;  1ZXI A;  2IZV B;  4HXD A;  3VXW A;  2O2V A;  1RRB A;  4F1S A;  1IPG A;  2PW9 A;  3H7P A;  3N9Y C;  1HE8 A;  2PPH A;  3B0A A;  4HLE A;  1AYF A;  1FPY A;  2GLS A;  4LNF A;  5D94 A;  3TL5 A;  2M17 A;  1Y56 A;  3KUZ A;  2HJ1 A;  2MHJ A;  3PT2 B;  4IM3 A;  1WIA A;  3ZLZ A;  1Z2M A;  4J3O D;  1JWS D;  2MP2 B;  3M63 B;  3LXF A;  2WXM A;  1XT9 B;  3AM9 A;  5D7G A;  3NY5 A;  4HDQ A;  3L54 A;  3PS6 A;  1I4G A;  4EKU A;  1V8C A;  4BKG A;  3TIX A;  3QK0 A;  4TQ0 A;  3A9J B;  1AW7 A;  4HDO A;  5DCN A;  1XLP A;  1PYW D;  1TS5 A;  4HKQ A;  4OHJ A;  2FUG 1;  2OOB B;  1D6E C;  3T3N A;  2K8H A;  1XD3 B;  4JGH B;  2WXN A;  1J19 A;  3AMZ A;  2V0G A;  1SF0 A;  4LLG M;  5E6P A;  3EUB 2;  3Q3O C;  4JPS A;  4FN2 A;  1OQY A;  1WF9 A;  3BYY B;  2FUH B;  2K6Q A;  1K53 A;  1WXQ A;  5LNK 1;  5G5H A;  2BKR B;  2I1K A;  1MI0 A;  2DNF A;  4W9D A;  3ECI A;  5IA7 A;  4K7U A;  4DHZ E;  3NVZ A;  3ZTD A;  3M3J A;  1WX9 A;  1TT5 B;  1ACC A;  2UU7 A;  1IGD A;  2XBB C;  4C4V A;  1WZ0 A;  3AE6 B;  1SE4 A;  3AEG B;  4HRS A;  2JYT A;  4L23 A;  1C4A A;  1D4B A;  1WFY A;  2NS5 A;  3FKY A;  4RF1 A;  2MX2 A;  2GBN A;  1I4X A;  4DHJ B;  4X57 B;  3KUC B;  2EMT A;  3JSV B;  2KX0 A;  1KLV A;  3HHM A;  3AE7 B;  2MEK A;  1GC7 A;  2J4X A;  1OQR A;  3JVZ X;  1IGC A;  5DPT A;  1WSP A;  2DAF A;  3L10 B;  3FAH A;  1I4Q A;  2FAZ A;  3JW0 X;  1U4A A;  4B0E A;  3RNE C;  2QSD A;  4ZYN A;  4RGN A;  2Z59 B;  3PV1 A;  4WUR A;  2PVG C;  1KLG D;  5AZH A;  4ICV A;  3NS1 A;  1C4C A;  1XXG A;  1XF5 L;  3EGR A;  3ZKJ C;  1YX6 B;  4GOC A;  4HKZ E;  4N9F 4;  4OZC A;  3A1Q A;  3U7D A;  3V62 A;  3CIR B;  1XCQ L;  2RD0 A;  2I2Y A;  2BVC A;  3DWG C;  2BS4 B;  2FCS A;  1KFY B;  2BTE A;  2D11 A;  4PS3 A;  3ML8 A;  3X0W A;  1E8Y A;  3ALB A;  4PS7 A;  2VZK D;  3QWZ B;  5FKA C;  2QCZ A;  1K51 A;  3NHE B;  1YN3 A;  2BB5 A;  2ZVN A;  3C8Y A;  4IWO A;  3UF8 A;  2Y3A A;  1HZ5 A;  1YJI A;  3VHT C;  4WJP A;  4GLS C;  3ZYY X;  2AL6 A;  2G4D B;  2XN9 C;  4HJG E;  1NEN B;  2MP2 A;  4JQW C;  5LXH A;  2JXX A;  3RMK C;  3SU8 X;  2GBJ A;  2MRP A;  1E7P B;  2WP9 B;  2D3A A;  1PGX A;  4UDU C;  3O13 A;  3AE3 B;  3FIL B;  4KZ0 A;  3L0W B;  3A9J A;  4XE0 A;  4ZRQ A;  5E6J A;  4EE2 A;  2LGS A;  4EUT A;  3NVY A;  3M62 B;  4N6E B;  1C76 A;  2EKE C;  3V05 A;  2K1F A;  3MC9 A;  2CHW A;  4GN1 A;  4XGA B;  4AUQ C;  1UH6 A;  4RF0 A;  2M8S A;  1L2N A;  1X1M A;  3K9P B;  5E6O A;  3U8Z A;  4B9K A;  1JRP A;  5EE3 A;  3R7Q A;  1I35 A;  4MGI E;  2A5U A;  1T0Y A;  4GSW A;  4MT5 A;  4NZL B;  1JRU A;  1WRI A;  1OFF A;  3H8H A;  1P9D U;  5TSS A;  4NQL B;  1CZP A;  4N59 A;  3SFD B;  1VLB A;  3APD A;  1ROE A;  3MP9 A;  4P16 A;  4G3X B;  3ZDT A;  1FO4 A;  2IJ0 A;  5I4D A;  3DVG X;  3AEF B;  4P6V F;  4I6P A;  2WU5 B;  1C78 A;  2FCM A;  2B3A A;  4GIV A;  3IT4 B;  4MSQ B;  4FHK A;  3JSV A;  3WAN A;  1CQV A;  2LVO A;  3KLS X;  4K81 A;  4XYC A;  2KD0 A;  2ZW1 A;  1LFD A;  2K25 A;  5G2N A;  1V1P B;  4WH4 A;  3UQA A;  2KNB A;  5AZG A;  1EF1 A;  3VH3 B;  5HHD G;  2N9L A;  4W9E A;  3PO0 A;  2IGD A;  1LM8 B;  4MAC A;  3TEY A;  3VR8 B;  1V2Y A;  2KYW A;  4PK1 A;  2J53 A;  1L6U A;  2ZNV C;  2NTT A;  1QZE A;  3QJZ A;  2K6D B;  4II3 B;  2JZZ A;  3VTU A;  3RFZ B;  1R7S A;  2WXF A;  1PFD A;  2INN E;  2D10 A;  2N7J A;  1LQB A;  2AYO B;  1F52 A;  2IGG A;  3SHQ A;  4KGR A;  2CR5 A;  4QAY A;  4TSS A;  4K7S A;  5FR3 A;  4ZHO A;  3GE3 C;  5JXV A;  3J9C A;  1GNU A;  4FBJ B;  1L6V A;  1FCL A;  2KTR B;  1YQ3 B;  3ABV B;  2L0F A;  2L8J A;  2J7Q B;  2VZK B;  1N63 A;  2NBV B;  3URY A;  3D32 A;  3TSS A;  2K22 A;  3PZD A;  2DYB A;  2N4F A;  3Q3N C;  2OJR A;  2PEA A;  2BYT A;  4W9I A;  1C3T A;  3P2B A;  3PLV A;  3H1U A;  3FIL A;  3EFU A;  1UGJ A;  4MSM B;  4MEM A;  3DHI C;  2IY1 B;  2KVZ A;  4OW0 A;  3Q8C A;  5J17 A;  4DXA B;  4GB9 A;  5KHO A;  1FNW A;  3AI5 A;  3RD2 A;  3U2S C;  1H4R A;  2INP E;  2KDB A;  2LGI A;  2WWZ A;  2IDY A;  3DBH B;  3MFG A;  4MEL A;  3T9L A;  4KSL C;  4P7I A;  1PDX A;  2RPQ A;  5HG2 A;  4RMA A;  1T0S C;  5DPW A;  1UZX B;  1IYF A;  1V5T A;  2LHD A;  3Q3M C;  4GXB A;  1TY0 A;  2KXJ A;  4US8 A;  2G4S A;  3DWM A;  2MBB B;  2JY6 A;  3N1Y C;  1SJE D;  2KN5 A;  4KDL B;  4FJZ A;  2PJH A;  3DVN U;  3TJP A;  5AZF A;  3FC4 A;  3MJW A;  3PRZ A;  4DWF A;  1SGH A;  2N9E B;  2MBO A;  1VR9 A;  4REZ A;  1YOV B;  2REX A;  1JCK B;  1E8X A;  2GB1 A;  2JU6 X;  2O6V D;  3Q14 C;  4BVU C;  3QC8 B;  3U7Z A;  2KMM A;  3V61 A;  2JX5 A;  3QA8 A;  3SEB A;  3KUD B;  4BBN F;  2G9H D;  2ZJD A;  2MLB A;  1V1P A;  1ET9 A;  1XLQ A;  4LNN A;  1GG3 A;  4XC2 A;  2YEP B;  1B9R A;  5JH5 C;  4G0N B;  1Q5W B;  5J18 A;  4KKI A;  1J7C A;  1KM7 A;  3ZIM A;  3HM6 X;  1WM3 A;  2QDF A;  5C2T B;  4RCO A;  4YXD B;  5EDS A;  1QKZ A;  2KX3 A;  2CS4 A;  4EZK A;  3ETR A;  4IWP A;  3ZUN A;  2AQ2 B;  2OJW A;  5J2R A;  3QQ8 B;  2L52 A;  4JL9 A;  3AEA B;  2RR9 A;  4YSZ B;  2XEW A;  2D07 B;  2V4L A;  1D5X C;  2C9W B;  2KDF B;  4A3P A;  3W1S C;  1WGR A;  2N7D A;  4EFO A;  4A3O A;  2PTL A;  1TKY A;  3UGB B;  2FCN A;  1JRO A;  3B2G A;  2WYQ A;  4XDD A;  3PVL A;  4M02 A;  1WH3 A;  3AEB B;  1YJ1 A;  1JWA D;  3HVD A;  1XLO A;  1G6J A;  1UF0 A;  2KTR A;  3W1Y A;  1ET6 A;  2PVO D;  3DBL B;  4FA6 A;  1P0R A;  1DYQ A;  2J52 A;  2BB6 A;  5DPR A;  3RI7 C;  1I4R A;  1EU4 A;  2B76 B;  3RYT A;  4A55 A;  2BGF A;  1NYR A;  1ZOY B;  3IXS A;  4RGT A;  1FXT B;  4GDL B;  1ZDV A;  1EWY C;  2KVR A;  3Q2A C;  1YX5 B;  1XCT L;  2BT6 A;  2Y5B B;  1WXA A;  4USA A;  3DBH I;  3AN1 A;  1KRH A;  3WA0 A;  1WX7 A;  3AU5 A;  3R8B A;  4DK5 A;  1F2R I;  1T6B X;  1C77 A;  4HCN B;  2L32 A;  2AX5 A;  1WXV A;  2VH2 A;  1WGY A;  2DHZ A;  2JPH A;  2YLM A;  2KJ6 A;  3AE2 B;  4NPN A;  3PLU A;  3LYY A;  3BVG A;  2K5P A;  4AJW A;  2WXK A;  2LXC A;  2WDQ B;  2N1W A;  1E8W A;  3VRB B;  3W9C B;  3APF A;  4HPP A;  3IBE A;  3RNA C;  4PS8 A;  3W2D A;  2FIF A;  4URK A;  2UWQ A;  3H6N A;  1YD8 U;  2H89 B;  2ACZ B;  2LEK A;  2WGS A;  4MH0 E;  1GB1 A;  1YMH E;  3U4E G;  2WXP A;  2ON8 A;  1TZ1 A;  5IAA C;  3DVN V;  4IWQ A;  4BOS C;  3RNB C;  3HRD D;  3MC8 A;  4NJ6 A;  4MGY E;  1K50 A;  1E7U A;  2N9P C;  5C23 A;  4A20 A;  4ZRK A;  1ZP0 B;  3DBR B;  2FID A;  1WR1 A;  4CQN A;  1TBE A;  1NI3 A;  1MG4 A;  3ZRC A;  1LO5 D;  2GRI A;  2WDR B;  4TKN A;  3OLM D;  2ZPY A;  2L1A A;  2LRU A;  2O6V B;  3NVW A;  2LJ5 A;  4ZDV A;  3RNF C;  1TGZ B;  2L83 A;  2BKF A;  2N9X A;  4BZA A;  5AEK B;  4G11 A;  3A9K B;  4RH6 A;  1TY2 A;  1BUI C;  1WGD A;  5LLI A;  4II2 B;  3ZVV A;  4A90 A;  3VH4 B;  4WWO A;  2NPT B;  5CHW A;  1IBX B;  2KLC A;  4YSX B;  3BK1 A;  1F9J A;  1KTK A;  2K0P A;  1VJK A;  1C4P A;  2X38 A;  2QIE B;  3DPD A;  3KQ4 A;  3P4P B;  2G3Q B;  2KC1 A;  3EEC A;  1UBI A;  3GP7 A;  3OWE B;  1HTO A;  3Q69 A;  2EKI A;  4PYU A;  2LHE A;  1BML C;  3DBL I;  2PKO A;  3UQB A;  3N1X C;  3LJ3 A;  1WI0 A;  4KDI C;  1FRR A;  3ZJU A;  3I57 A;  1E90 A;  2WXH A;  3MHZ A;  2LWP A;  3EFC A;  1TZO A;  3MTN B;  1WGG A;  5FK9 C;  3Q3F A;  1ZUD 2;  4EZL A;  2VRR B;  2MCN B;  5TR5 A;  1YIW A;  2MBH A;  2LVP A;  4L2Y A;  1WXS A;  2G45 B;  4GDL A;  1SE2 A;  5D6J B;  3S2A A;  2BW2 A;  1FRD A;  1FMA D;  1TKE A;  3L16 A;  1RAX A;  2X8X X;  3VVW B;  3E56 A;  2RMM A;  3PGE A;  2K39 A;  4ANV A;  2MQJ A;  3ENE A;  4H2A A;  2JVC A;  5CHV C;  2C7M B;  1ENF A;  4K1R B;  5IO9 A;  3DHH C;  5BO4 B;  4ZOH C;  2Y5P A;  4BBN C;  2M0X A;  2KFK B;  4WQO B;  2D2Q A;  2RDH A;  2DZJ A;  1F2R C;  2I1J A;  2KZR A;  2Z0D B;  2K3U A;  4W9C A;  1FFU A;  1V81 A;  2KDI A;  2YVC A;  3QX1 A;  5GXG B;  2FE8 A;  2KDE B;  3C0R B;  3DBR I;  3VR9 B;  4D2K A;  1A5R A;  2D3G A;  1P1A A;  1C9F A;  1Q0W B;  3OAW A;  3R66 C;  4LCD E;  2DYO A;  4YSY B;  3RZF A;  4IDI A;  3DDC B;  3TCA A;  4RNA A;  2ZCB A;  2ZW0 A;  4WIP A;  2NVU I;  3RUL A;  2PMV A;  3CSF A;  1MFW A;  4S17 A;  2WLB A;  2KJR A;  5JZE B;  5H8Y E;  3Q6B A;  2BWE S;  3N32 A;  2O6V A;  2LGD A;  2JWU A;  4AQ7 A;  3PRP B;  1NI2 A;  2MA9 B;  3A9K A;  3AEC B;  1V9J A;  1YNT E;  2KWU B;  5HFY A;  2J0K A;  3DOW A;  4ACF A;  1NBF C;  3VQI A;  3LB8 C;  4WWN A;  1L0X B;  1CK1 A;  1OGW A;  5GMV A;  1N61 A;  2NPT A;  1IBX A;  3N1Z C;  1QOF A;  1YN5 A;  3TMP B;  3RCZ A;  4CYE A;  1VCB A;  2WX1 A;  4M00 A;  4LJP B;  4NQK E;  2JXT A;  4M8N A;  1N5W A;  3GB1 A;  2L7R A;  1WJN A;  4OVU A;  1NYQ A;  2V9H A;  1I4P A;  1A70 A;  2BBC A;  2QEJ C;  4ZYS A;  4WJO A;  2TSS A;  2EEL A;  2WQY B;  4NJ7 A;  3MHS D;  3AE1 B;  4A6Q A;  2LD9 A;  4DDI D;  3P42 A;  1GOZ A;  4GMV A;  2GBK A;  3OJ4 B;  3QCA A;  1E8Z A;  1V5O A;  3PRM B;  1FIQ A;  2KAJ A;  4AJY B;  3NG0 A;  2PE9 A;  1Z5S B;  1SE3 A;  4HJK A;  2K9X A;  1QOA A;  2MW5 A;  4OVV A;  2RSU A;  1R4N B;  2IO0 B;  2WXL A;  5BYS A;  3L13 A;  2SAK A;  4KGT A;  3DBS A;  2N0S B;  1J0G A;  1RLF A;  3WAP A;  3EA6 A;  1SIF A;  1WXM A;  2V1Y A;  2WU2 B;  3ZJV A;  3TEX A;  4YL8 A;  1TS4 A;  4ITK A;  1V49 A;  1MVK A;  4EZJ A;  2C5L C;  3MJ5 A;  4HPM B;  4MH8 A;  3NUH B;  2KQS A;  2CKH B;  4ANU A;  4MGZ E;  5LXI B;  3CMM B;  4YTN B;  2L05 A;  3N20 C;  1FNU A;  2CJO A;  2KFK A;  1JML A;  4FXC A;  1NDD A;  1TKG A;  4P1B C;  1WRD B;  1WZ3 A;  4HEA 1;  1TS2 A;  1KOT A;  2AQ1 B;  1RWS A;  5HI1 A;  3NZU A;  4FJY A;  2HTH A;  2D3C A;  1V6E A;  3HVZ A;  2QC8 A;  3ZNZ B;  3JYU A;  2IBI B;  4MDK E;  2LXA A;  3RN9 C;  4IW0 A;  3WAO A;  1QOG A;  3N30 A;  2KWV B;  3QAR A;  5JHB A;  2W3R A;  1EF5 A;  1UWX A;  3I3T B;  4RM9 A;  3HM3 A;  2GMI C;  1PGA A;  2RDB C;  2KWD A;  1RFA A;  2ZZP B;  4PT5 A;  1J7B A;  1J7A A;  2DEN B;  2L0T A;  4FUL A;  1UWM A;  2CU1 A;  4W9J A;  2NCN A;  1I7H A;  4XDC A;  3UIO B;  1Q1O A;  3BVM A;  1V97 A;  3UIN B;  2BWF A;  2EMS A;  4WAA A;  4KGS A;  4IM0 A;  1XQQ A;  5BYR A;  3V60 A;  4FHJ A;  4WWM A;  4LDT D;  2OED A;  4XWT A;  1WJU A;  2IND C;  1E5W A;  2MBE A;  4C00 A;  3KWL A;  4W9L A;  3W5U B;  3H9D A;  1TS3 A;  2KC2 A;  2HJ8 A;  3WAM A;  2BPS A;  4OZA A;  4KX6 B;  4YTP B;  3HIZ A;  1VD2 A;  3KWV A;  1E7V A;  3TBL D;  4ICU A;  4YWG G;  1WGK A;  3ZNH B;  1SEB D;  3A33 B;  4FAD A;  4NAW B;  1WWT A;  4C7Y A;  4IOI E;  2CHX A;  1ZDX A;  5KHQ A;  2GI9 A;  1R4N I;  3AE5 B;  4JX1 C;  3T8M A;  1OEY J;  5CHF A;  1L4D B;  1L4Z B;  5BMI A;  3ZRF A;  2JSV X;  3R2T A;  4A8X C;  1D5M C;  4LTU A;  4WAF A;  3B08 A;  2LRW A;  1F1H A;  2H88 B;  4B6W A;  2KT7 A;  4ARC A;  4BKS A;  1F0Z A;  5IP4 D;  5MPO A;  3BWU D;  2LJI A;  1SSN A;  2JQR B;  4HPL B;  2CHZ A;  2YEP F;  4K3B A;  3ZXV A;  1LXD A;  1L0V B;  2Q5W D;  3B2F A;  3SR6 A;  3KVF B;  4G50 A;  2WX0 A;  2DZM A;  4B95 A;  5L83 A;  2MH7 A;  2DLB A;  2BS3 B;  1OEY A;  1PGB A;  1QF6 A;  1XEE A;  2ASQ A;  1UEL A;  3AB5 A;  3NS8 A;  3R3M A;  2V3N A;  3M95 A;  2W9N A;  4JWS C;  3V6E B;  1AAR A;  4K7W A;  3NVV A;  4NNJ B;  2BF8 B;  1UGM A;  3U52 E;  2KMC A;  2WXJ A;  2N7E A;  4IUM B;  1N5X A;  1VDV A;  2HD5 B;  3BZD B;  2ZNV B;  3VTV A;  3DVG Y;  2NTS A;  4BAX A;  4ASW C;  3ZNI D;  3ZQ4 A;  1M4V A;  4BOZ B;  1FNV A;  4O1N A;  3K9O B;  1D3Z A;  2GOW A;  3N3K B;  3QAQ A;  1N6Z A;  1TTN A;  3UIP B;  2V3S A;  1QIL A;  4ZHP A;  1FM0 D;  3L4P A;  3I9V 1;  3Q8E A;  3TEW A;  2WS3 B;  4R3D A;  1ZGU B;  3C19 A;  1GAQ B;  1EUV B;  4M8M A;  1XO3 A;  1OTR B;  2W55 A;  1VRA B;  2BQQ A;  2AWT A;  2KMA A;  3AE4 B;  4CHK A;  3X23 A;  4WJN A;  4ANX A;  2DZK A;  1AN8 A;  3BIN A;  1B1Z A;  1S3S G;  3Q8F A;  2G1E A;  3BY4 B;  3AED B;  3Q8A A;  1C79 A;  2Z0E B;  2KDM A;  3VFK A;  1HA5 A;  4JLC A;  1DOX A;  4ANW A;  3VRA B;  2AEH A;  2BS2 B;  2LUE A;  3KYC D;  4W9H A;  4NAW A;  1T0R C;  3VDZ A;  4LDT B;  4E3C A;  2WHI A;  1P7F A;  2R2Q A;  4KIK B;  3AUL A;  2KOX A;  5IOI A;  2NMQ A;  5EE1 A;  1JQ4 A;  3RZW C;  2GBM A;  3V6C B;  1J8C A;  1E9M A;  1WY8 A;  3IT6 B;  1WE7 A;  4XWW A;  3A4R A;  1UD7 A;  3V3X A;  2Z8L A;  1MPE A;  4AP4 C;  3R7R A;  1MG8 A;  2MSE D;  4WWP A;  4WQM A;  2M0A A;  3ZO5 B;  2DBY A;  2JF5 A;  4I6L B;  4J6I A;  3L08 A;  3SFE B;  3H7S A;  4OZB A;  2QJL A;  2W54 A;  2ZPN A;  1P98 A;  1GUA B;  1DOI A;  4TUU A;  2J42 A;  5D2M B;  2XNA C;  4ARI A;  2JZ3 B;  2IYD B;  1OQQ A;  2C7N B;  3CF6 E;  1RYJ A;  2C7H A;  3HK0 A;  4BKS D;  1Q10 A;  1EWC A;  1ZW7 A;  2MWS B;  2N9K A;  4AOF A;  2PE6 B;  4NAM A;  3NZS A;  2J0M A;  1L5P A;  1T3Q A;  3P4S B;  3BVZ A;  3GZN B;  4KVG B;  1WR6 E;  4LJO B;  4GU2 A;  1T0Q C;  3KW5 B;  3APC A;  5CX3 A;  3W5V B;  1MHX A;  2OHF A;  3OG5 A;  1N60 A;  4MJS B;  5BYQ A;  1P7E A;  2JUO A;  3VUX A;  2KO3 A;  4NY0 A;  1DOY A;  5D3I B;  3BII D;  5C3J B;  2LMC A;  2QMT A;  2BYE A;  2LZ6 A;  1P3Q U;  2K8C A;  5C1Z A;  4P1C C;  3WIM A;  1AWD A;  4IC7 B;  5D3D A;  2KK8 A;  2KKC A;  2UYZ B;  2NR2 A;  3P1M A;  4C56 C;  1QT9 A;  1WJ6 A;  1N62 A;  1UBQ A;  4FJV B;  4C7Z A;  2A4Z A;  1MHH E;  1M94 A;  2J0J A;  3ML9 A;  4HCP B;  2MJ3 A;  5L95 C;  3I5J C;  2D3B A;  2M56 B;  1SBB B;  3ZDM C;  2WNM A;  1VZ7 A;  1C1Y B;  2KAN A;  2WXO A;  1KJT A;  2IPK D;  3GS2 A;  1XLN A;  5E6N A;  4MGK E;  3VAW A;  1QQR A;  5G5G A;  2DYM A;  2E3T A;  3EHV A;  5IN7 A;  1L7Y A;  1BXT A;  3UI3 A;  3IVF A;  1V1O A;  3PHX B;  4KIK A;  1UNS A;  2M4N A;  5T8I A;  2JWZ A;  2L3Z A;  4M0W B;  4F7Z A;  4HK2 A;  1HZ6 A;  2AQ3 B;  2N1V A;  3QHT A;  4WJQ A;  3ZW3 A;  3B1L X;  1FD6 A;  4A9A A;  2PIA A;  5BMG A;  1CJE A;  2LI5 A;  4F8C B;  1K52 A;  1YJJ A;  3Q3J A;  3DQV A;  2RPV A;  1GPX A;  4E71 A;  1I42 A;  1GJZ A;  4XZ4 A;  1KH0 A;  2V4I B;  4RFB A;  4KKJ A;  3VTW A;  2I38 A;  3O65 B;  2WXI A;  1WM2 A;  2VH1 A;  3T3O A;  3L17 A;  2JT4 B;  2WDV B;  2WXG A;  1EM7 A;  4GDK B;  3E9S A;  3U30 A;  4ZRI A;  1WJ4 A;  3PSE B;  5IKC M;  1WMH B;  3RPF C;  1WYW B;  2XK5 B;  4W9G A;  3ZGZ A;  5JHA A;  2DX5 B;  2KN4 A;  4HVB A;  3HUI A;  4IM2 A;  3DHG C;  2KWC A;  3ZXR A;  2L00 B;  4DBG A;  2KQ4 X;  4NJC A;  1E10 A;  3AEE B;  2FCQ A;  3AE9 B;  4TQ1 A;  3WCQ A;  2ZVO A;  3GZN I;  3R2I A;  2KQ7 A;  3P4Q B;  2IY0 B;  5BMH A;  3AU4 A;  1BT0 A;  3KH0 A;  4N58 A;  2CJN A;  1E0Z A;  4KSK C;  4B0M A;  3ZTC A;  5AUI A;  3IAS 1;  3ONS A;  2ONQ A;  4DXG A;  1S1Q B;  3NOB A;  2INC C;  4DXF A;  2BYF A;  1ZXH A;  3PRE A;  4MJS A;  1LGR A;  1KLU D;  1VZ6 A;  2W82 A;  1JWU D;  2WXR A;  3MC0 B;  4LNI A;  3VUY A;  2D5G A;  2V3P A;  1YQB A;  3PZ8 A;  3RUI B;  1L0Y B;  3W1S A;  1SE9 A;  2ICI A;  4HWI B;  5G55 A;  3PZ7 A;  2HE7 A;  4TMA B;  1SJH D;  3P4R B; 
#chains in the Genus database with same CATH homology
 1LO5 D;  2GRI A;  2HDE A;  1E7P B;  2H88 B;  2WDR B;  2WP9 B;  4ARC A;  1PGX A;  4UDU C;  2L1A A;  1STE A;  3O13 A;  3AE3 B;  3NVW A;  3FIL B;  2KAC A;  1F0Z A;  4XE0 A;  1RM6 C;  2L83 A;  4ZRQ A;  5E6J A;  4EE2 A;  3NVY A;  4N6E B;  1C76 A;  3V05 A;  4RH6 A;  1TJE A;  1TY2 A;  1BUI C;  3BWU D;  5MPO A;  4OVZ A;  2E6X A;  2LJI A;  4YT0 B;  1ZE3 D;  1SSN A;  4A90 A;  2JQR B;  1IUE A;  3NZ3 A;  2YEP F;  4RF0 A;  1IBX B;  1L0V B;  2Q5W D;  3B2F A;  3SR6 A;  4YSX B;  1SIJ A;  1JAL A;  1FFV A;  3BK1 A;  1PUT A;  1JRP A;  1KTK A;  5EE3 A;  2K0P A;  2MH7 A;  1NEK B;  1VJK A;  2DLB A;  1C4P A;  2X38 A;  2BS3 B;  2QIE B;  3KQ4 A;  3P4P B;  1PGB A;  2JYE A;  1QF6 A;  1XEE A;  3GP7 A;  3Q69 A;  3OWE B;  4MT5 A;  4NZL B;  2EKI A;  1WRI A;  1OFF A;  3H8H A;  5TSS A;  3AB5 A;  1SB3 C;  2R61 A;  2LHE A;  1BML C;  1CZP A;  2PKO A;  1FCC C;  3AE8 B;  4N59 A;  3SFD B;  1VLB A;  2V3N A;  4MM3 B;  1FRR A;  1ROE A;  1DGJ A;  3ZJU A;  4JWS C;  1NVI D;  3AH7 A;  3I57 A;  3MP9 A;  4P16 A;  1FO4 A;  2IJ0 A;  3NVV A;  5I4D A;  4M0W A;  2WXH A;  3U52 E;  3AEF B;  2WXJ A;  3MHZ A;  4P6V F;  3P63 A;  1N5X A;  1VDV A;  2WU5 B;  1TZO A;  3BZD B;  1C78 A;  1ESF A;  5FK9 C;  2NTS A;  3IT4 B;  1VZ8 A;  1ZUD 2;  3ZQ4 A;  4L2Y A;  2FBW B;  1CQV A;  1M4V A;  3KLS X;  1EU3 A;  1FNV A;  4JE3 B;  2ZW1 A;  1SE2 A;  2BW2 A;  1FRD A;  4O1N A;  1V1P B;  4WH4 A;  3Q8B A;  1YQ4 B;  4Q2J A;  2PLP A;  1FMA D;  1HXY D;  1TKE A;  1QIL A;  4ZHP A;  1FM0 D;  3L4P A;  1HEZ E;  3I9V 1;  3Q8E A;  1YN4 A;  5HHD G;  3E56 A;  2WS3 B;  3TUO A;  3TEW A;  2N9L A;  2Y5C A;  2RMM A;  4R3D A;  3PO0 A;  3P4R B;  1GB4 A;  1JWM D;  1GAQ B;  1XO3 A;  2LFI A;  4H2A A;  2W55 A;  4MAC A;  3TEY A;  1VRA B;  3AE4 B;  3VR8 B;  1ENF A;  2JZP A;  1AN8 A;  4ZOH C;  2Y5P A;  1UUP A;  2J53 A;  1B1Z A;  3Q8F A;  2HTM E;  4US9 A;  2G1E A;  1L6U A;  3AED B;  2IGH A;  2NTT A;  3Q8A A;  2RDH A;  1F2R C;  1C79 A;  2K3U A;  3RFZ B;  1R7S A;  2KDM A;  5EE0 A;  2WXF A;  1FFU A;  1HA5 A;  1DOX A;  1PFD A;  2INN E;  3VRA B;  2N7J A;  2BS2 B;  1SXT A;  2IGG A;  5GXG B;  3CWI A;  1QOB A;  4KGR A;  3BK2 A;  4TSS A;  1P7F A;  2FE8 A;  3VR9 B;  5FR3 A;  4D2K A;  4ZHO A;  1T5X D;  5JXV A;  3J9C A;  1L6V A;  2NMQ A;  5EE1 A;  1JQ4 A;  1C9F A;  5AUK A;  4AS1 A;  1FCL A;  1YQ3 B;  2SEB D;  1I4H A;  2WXQ A;  3ABV B;  2DYO A;  1E9M A;  4YSY B;  3AV8 A;  5EE9 A;  4IDI A;  2VZK B;  1N63 A;  4RNA A;  3IT6 B;  4HRO A;  3URY A;  2CU3 A;  3TSS A;  4L1B A;  2QIL A;  2K22 A;  4XWW A;  2ZW0 A;  4WIP A;  3TEZ A;  4DQO C;  3V3X A;  2DWQ A;  1JW9 D;  2Z8L A;  1MPE A;  2PMV A;  2BYT A;  2LUM A;  2WLB A;  5H8Y E;  1JWB D;  2M0A A;  4WQM A;  2DBY A;  4LK0 M;  3FIL A;  1UGJ A;  2JWU A;  1KF6 B;  3ZJT A;  4AQ7 A;  1E6E B;  3SFE B;  3B9J A;  4OW0 A;  3Q8C A;  3AEC B;  4OZB A;  2W3S A;  1YNT E;  1ZPS A;  5HFY A;  1FXI A;  2QJL A;  2W54 A;  1FNW A;  1QLB B;  3VQI A;  3LB8 C;  1FEH A;  1L0X B;  3U2S C;  4JWU C;  1CK1 A;  2MJD A;  4IKG A;  1DOI A;  2INP E;  2LGI A;  2J42 A;  1N61 A;  1RFK A;  1HQR D;  2XNA C;  3BYT B;  1IBX A;  4ARI A;  2IDY A;  3MFG A;  1QOF A;  1OQQ A;  1YN5 A;  2RDG A;  5H92 C;  1PDX A;  5HG2 A;  1RYJ A;  4YTM B;  2JXT A;  1N5W A;  4C80 A;  1Q10 A;  1EWC A;  2M19 A;  3GB1 A;  2LHD A;  1WYG A;  2N9K A;  1TY0 A;  1NYQ A;  4US8 A;  3DWM A;  4NAM A;  3IAM 1;  1SJE D;  4RGM A;  1L5P A;  1D5Z C;  1I4P A;  1T3Q A;  3P4S B;  3BVZ A;  1A70 A;  1F77 A;  3NRZ A;  1TYG B;  2BBC A;  4ZRP A;  2MJE A;  4RGO S;  3FC4 A;  1FXA A;  2QEJ C;  4ZYS A;  1ZXI A;  3W5V B;  1MHX A;  2OHF A;  2TSS A;  2EEL A;  1N60 A;  2WQY B;  5BYQ A;  1P7E A;  3AE1 B;  1VR9 A;  4REZ A;  4A6Q A;  2PW9 A;  3N9Y C;  1DOY A;  5D3I B;  1JCK B;  3P42 A;  1AYF A;  1GOZ A;  2GB1 A;  2JU6 X;  3BII D;  5C3J B;  3U7Z A;  2LMC A;  2KMM A;  2QMT A;  2JX5 A;  1Y56 A;  3SEB A;  1FIQ A;  2KAJ A;  1SE3 A;  2K9X A;  2G9H D;  4J3O D;  1QOA A;  1JWS D;  3LXF A;  2WXM A;  1AWD A;  1V1P A;  3AM9 A;  5D3D A;  2WXL A;  1ET9 A;  5D7G A;  5BYS A;  2SAK A;  1XLQ A;  2YEP B;  1B9R A;  1I4G A;  4KGT A;  3P1M A;  2N0S B;  4C56 C;  1V8C A;  1QT9 A;  4TQ0 A;  1AW7 A;  3EA6 A;  1N62 A;  1XLP A;  2WU2 B;  1PYW D;  1TS5 A;  1J7C A;  4KKI A;  3TEX A;  4C7Z A;  3ZJV A;  4HKQ A;  1TS4 A;  1MHH E;  4OHJ A;  2FUG 1;  4ITK A;  1MVK A;  3MJ5 A;  5C2T B;  4MH8 A;  4RCO A;  4YXD B;  3NUH B;  2MJ3 A;  1D6E C;  1QKZ A;  3T3N A;  3ETR A;  2AQ2 B;  2WXN A;  3AMZ A;  4YTN B;  2V0G A;  2M56 B;  1SF0 A;  2L52 A;  4LLG M;  1SBB B;  1FNU A;  2CJO A;  2WNM A;  1VZ7 A;  3AEA B;  4YSZ B;  1JML A;  4FXC A;  3EUB 2;  4JPS A;  1TKG A;  2WXO A;  3BYY B;  2IPK D;  1K53 A;  3GS2 A;  4HEA 1;  1XLN A;  1TS2 A;  1D5X C;  1WXQ A;  5LNK 1;  5G5H A;  2AQ1 B;  1MI0 A;  1QQR A;  5G5G A;  2DYM A;  2E3T A;  1RWS A;  2PTL A;  1TKY A;  5HI1 A;  3NVZ A;  1BXT A;  1JRO A;  3UI3 A;  3B2G A;  4XDD A;  1ACC A;  3HVZ A;  1IGD A;  1V1O A;  1UNS A;  3AEB B;  1JWA D;  3HVD A;  3AE6 B;  5T8I A;  1XLO A;  1SE4 A;  3AEG B;  1ET6 A;  4HRS A;  1HZ6 A;  2JYT A;  2AQ3 B;  4L23 A;  2PVO D;  1C4A A;  1FD6 A;  1DYQ A;  2J52 A;  1D4B A;  4RF1 A;  2PIA A;  4A9A A;  1QOG A;  2BB6 A;  5BMG A;  1I4X A;  2W3R A;  1CJE A;  1UWX A;  1K52 A;  1YJJ A;  1I4R A;  1EU4 A;  2RPV A;  2B76 B;  1GPX A;  4A55 A;  3AE7 B;  2MEK A;  1NYR A;  1ZOY B;  3IXS A;  4RGT A;  2J4X A;  1ZDV A;  1OQR A;  1EWY C;  4GDL B;  1KH0 A;  1PGA A;  1IGC A;  2V4I B;  4KKJ A;  1XCT L;  2I38 A;  4RFB A;  1WSP A;  2BT6 A;  2KWD A;  3FAH A;  1I4Q A;  2WXI A;  4PT5 A;  3T3O A;  1J7B A;  1J7A A;  4USA A;  2WDV B;  1UWM A;  2WXG A;  1EM7 A;  3AN1 A;  4GDK B;  4B0E A;  1KRH A;  3E9S A;  1I7H A;  2QSD A;  4XDC A;  4RGN A;  3R8B A;  1F2R I;  3BVM A;  4WUR A;  1T6B X;  2PVG C;  1C77 A;  1KLG D;  2AX5 A;  2L32 A;  1V97 A;  3RPF C;  3ZGZ A;  2KN4 A;  3NS1 A;  1C4C A;  4KGS A;  3HUI A;  1XXG A;  1XF5 L;  3EGR A;  2KQ4 X;  4NJC A;  1E10 A;  3AEE B;  3AE9 B;  3AE2 B;  4TQ1 A;  4HKZ E;  3WCQ A;  3LYY A;  3BVG A;  2K5P A;  3R2I A;  2WXK A;  5BYR A;  4OZC A;  2WDQ B;  3P4Q B;  4WWM A;  5BMH A;  3CIR B;  1XCQ L;  2OED A;  3VRB B;  4XWT A;  3W9C B;  2I2Y A;  4N58 A;  2CJN A;  3DWG C;  2BS4 B;  3KWL A;  3W5U B;  1E0Z A;  1KFY B;  1TS3 A;  2BTE A;  4B0M A;  3W2D A;  4OZA A;  5AUI A;  4KX6 B;  4YTP B;  3IAS 1;  2VZK D;  3KWV A;  5FKA C;  2ONQ A;  4YWG G;  1WGK A;  1SEB D;  2H89 B;  2ACZ B;  4DXG A;  4NAW B;  1WWT A;  1K51 A;  4C7Y A;  4DXF A;  2LEK A;  1YN3 A;  2BB5 A;  4IOI E;  1GB1 A;  1ZXH A;  1YMH E;  3U4E G;  1ZDX A;  2GI9 A;  2WXP A;  2ON8 A;  3C8Y A;  1KLU D;  1VZ6 A;  2W82 A;  1JWU D;  2WXR A;  3AE5 B;  4JX1 C;  2Y3A A;  3MC0 B;  1HZ5 A;  1YJI A;  2D5G A;  3HRD D;  2V3P A;  1L4D B;  3PZ8 A;  4GLS C;  3ZYY X;  1L4Z B;  1K50 A;  5BMI A;  1L0Y B;  3W1S A;  2ICI A;  2JSV X;  3R2T A;  3PZ7 A;  1ZP0 B;  4A8X C;  1D5M C;  4CQN A;  4LTU A;  2XN9 C;  4HJG E;  1NEN B;  1NI3 A;  4WAF A;  4TMA B;  1SJH D;  2IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...