2KMCA

Solution structure of the n-terminal domain of kindlin-1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GIDPFTMLSSGDLTSASWELVVRVDHANGEQQTEITLRVSGDLHIGGVMLKLVEQMNIAQDWSDYALWWEQKRCWLLKTHWTLDKCGVQADANLLFTPQHKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Fermitin family homolog 1
publication title The Structure of the N-Terminus of Kindlin-1: A Domain Important for alphaIIbbeta3 Integrin Activation
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18124 Kindlin_2_N Kindlin-2 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmcA00
4M8MA 1C3TA 2KFKA 4W9FA 4MJSB 1IYFA 3ZDMC 2QHOA 1WGDA 3MJWA 4FA6A 2LVOA 3AU4A 1E8XA 2GBJA 4CHKA 3PHWB 4AJWA 2FUHB 1WR6E 1WXAA 3X0WA 1UD7A 3H7PB 3L0WB 1WE7A 1KJTA 3NY5A 2G4DB 1V81A 4B95A 3VUWA 2LXCA 2C7NB 2KFKB 2AEHA 5LXHA 4TQ1A 4I6NB 2KDEB 1OEYJ 1Q5WB 5JHBA 2NCNA 1R4MI 2BWFA 3KH0A 2GBRA 2O6VD 4NQKE 3ZKJC 1GC7A 1TZ1A 4BKTA 2KX0A 2L0FA 4NPNA 4AWJA 1LFDA 2YLMA 4JQWC 2KWCA 4EKUA 1V9JA 3T9LA 3VVWB 4TQ0A 4F1SA 2O2VA 2L00B 2PE9A 4K81A 5AZFA 2KZRA 4BKSA 3IVFA 1RAXA 3QWZB 4URKA 3HM6X 2D2QA 3V61A 2N9EB 2KTRA 1WY8A 4EFOA 1WR1A 4HCNB 4GGQA 3IFWB 1VD2A 1PQSA 2NBVB 4K7WA 1SE9A 4KDLB 5IA7A 3WA0A 2RGFA 3EECA 2DENB 2O2VB 3ZNHB 4B9KA 3DCGA 4W9JA 4WJPA 4E3CA 2EMTA 3DPDA 2DZIA 4KIKA 3PV1A 1S3SG 2J0KA 3ML9A 1ISNA 5IAAC 3V60A 1NBFC 1NI2A 1X1MA 5D6JB 2FAZA 3ZUNA 2MQJA 4FADA 2IZVB 3KUCB 4IWPA 3WAPA 2V3SA 4I6PA 3MTNB 2WX1A 3D32A 3ONSA 4GMVA 1P3QU 2IO1B 2NR2A 4W9CA 3IG3A 4G11A 4X57B 3VXWA 1GUAB 5G2NA 1YX6B 2GMIC 3PT2B 3ZTCA 4IWQA 2KDIA 3IBEA 1L7YA 3PLVA 1ZGUB 4ICUA 4BOSC 4DBGA 1WIAA 4AOFA 2JT4B 3GOEA 2EMSA 2LWPA 4WWPA 5G55A 3RCZA 5DPSA 4MGYE 2I1KA 4AUQC 1WGHA 2K25A 3DVNV 4FHKA 3QHTA 4BVUC 1WZ0A 3HM3A 4ZRJA 4MEMA 1WJUA 2A5UA 4MSQB 2BPSA 2CR5A 4FN2A 1MG8A 3A9JB 2KWUB 2C5LC 4EZJA 1C1YB 2KXJA 1UGMA 2ZEQA 4GN1A 1A5RA 4YL8A 4IM2A 4DDGD 3GZNI 4M8NA 4OVUA 3U30A 1LM8B 4G50A 3PS6A 1EUVB 2GBNA 1R4NI 4W9GA 1YJ1A 2G4SA 1LQBA 2KN5A 2XEWA 4J6IA 2XK5B 2KQSA 2CU1A 4WAAA 3M3JA 2FNJB 3DBSA 2KKCA 3DVGY 4LDTD 3QARA 3WIMA 1I42A 3PSEB 3B0AA 4GB9A 3TJPA 3V62A 3M62B 5TR5A 2MWSB 3DVNU 3TIXA 3V6EB 1HE8A 2ZCCA 3SU8X 3Q3FA 5GMVA 3ZRCA 2KJHB 2CHWA 2L76A 2G45B 1P0RA 5E6PA 3PTFC 1SIFA 4NAWB 3UGBB 3A4SC 4AJYB 1Q1OA 2LVQA 1J8CA 4WJQA 3MHSD 3I3TB 1WXSA 3VTWA 2K6QA 2LGXA 2AWTA 4EUTA 2N1WA 4FBJB 1WMHA 2DZMA 2IO2B 1H8CA 2LXAA 2MCNB 2KWVB 4W9IA 2BKFA 2UWQA 3L10B 1WGYA 3CF6E 2NBWB 3QX1A 5CHWA 3W1YA 4GXBA 3PZDA 1TBEA 2FCSA 2LVPA 2CKHB 2RD0A 3QCAA 3QC8B 2BYFA 4JGHB 2KC1A 3A1QA 2ZJDA 3H9DA 4WWNA 3TL5A 3WANA 3ZTDA 3DBHI 1WMHB 5J17A 2NS5A 5D94A 2ZVOA 2W9NA 4HWIB 4HJKA 4HCPB 2BYEA 1Q0WB 4BBNC 3JW0X 4HDOA 1WXMA 3OJ3A 1KM7A 1WI0A 1FXTB 1WRDB 3KYDD 2IO3B 3VTVA 4FHJA 3O65B 2KNBA 4LJOB 2MX2A 2Y5BB 1V80A 3A1QB 2FCNA 2IO0B 2KJ6A 2L05A 2M0XA 4KDIC 2JPHA 3UQAA 2KTFA 2J7QB 2ZNVC 4GOCA 4MH0E 4DWFA 3CMMB 4WQOB 4NQLB 2CHZA 4PYUA 2L8JA 2LI5A 1IPGA 2FCQA 2MP2B 4IUMB 4M0WB 4FULA 4ZRKA 5AZHA 5LLIA 4LJPB 3K9PB 5BO4B 2V1YA 1RLFA 3NZUA 2N7DA 2GBKA 3VDZA 3EHVA 1Z5SB 1M94A 1E8ZA 1U4AA 2GOWA 2KK8A 5CHFA 2Z0DB 3DOWA 3NS8A 1I35A 2BYVE 3ZNGC 3U7DA 2R2OA 2N1VA 3PRMB 4IC7B 1E7UA 1WE6A 3DVGX 2MLBA 2NBUA 5DPRA 2DZJA 1E90A 2IYDB 3AI5A 5JHAA 1P9DU 2A4ZA 1UH6A 3PPAA 2KMCA 4RM8A 2FIFA 4MDKE 2MBBB 4LCDE 3VUXA 1V6EA 4NJ6A 2K8BA 3H7SA 5L83A 1E8WA 3R7QA 3C0RB 5AZGA 3ZDTA 3T8MA 3ZO5B 2JWZA 4F7ZA 2XBBC 3VAWA 4CO7A 4BKSD 3UQBA 2KLCA 3VUYA 3L54A 3NZSA 4KSKC 3LJ3A 3PHXB 4TUUA 2J0JA 3APCA 1CMXB 3LDZE 3L16A 4EZLA 2C9WB 2PEAA 2DZKA 4DDID 2DAJA 2KDBA 1WFYA 3A9JA 4MGKE 1WJ6A 1WX8A 1WM2A 4ZRIA 3L17A 2L7RA 1GC6A 2LD9A 4W9KA 3ZRFA 4G0NB 2JUOA 3QIJA 2EKEC 4ANWA 3RUIB 3V6CB 5C23A 2KO3A 2XK5A 2ZPYA 3U8ZA 2K8HA 2LGYA 3KW5B 1F9JA 4FJYA 4EZKA 3W1SA 5LXIB 1WGRA 4WJOA 3KUDB 2REXA 3ENEA 3DQVA 3KVFB 2LRUA 3ZIMA 3WALA 4CYEA 5EDSA 3M63B 3N3KB 4HVBA 5J2RA 2MBOA 1UZXB 4NAWA 2D3GA 3BINA 4GDKA 3ZVVA 2Z59B 4IWOA 2NVUI 3ZNID 1E8YA 2C7HA 4RM9A 4ZDVA 2KQ7A 4JL9A 2UYZB 2N7EA 4HPLB 4TV3A 2C7MB 2WYQA 3APFA 3HIZA 4EEWA 4F8CB 4HLEA 2HJ8A 2OJRA 4GDKB 4K7SA 3S2AA 1G6JA 1V5TA 3L13A 1SGHA 1E7VA 2JRIB 4DHJD 4JIOU 1WJ4A 2KFJA 2BGFA 2LGDA 3A4RA 2JZZA 4ZYNA 2MSED 2MBQA 5D2MB 4DXAB 2DYMA 2C60A 2M1MA 2MBEA 3ZW3A 4W9EA 1YIWA 4W9LA 4ANUA 4ANXA 3PREA 3WAMA 3IHPC 2KVRA 1Z2MA 4N9F4 3UIOB 1V86A 4WWOA 3ECIA 2ZNVB 4W9HA 1V2YA 1P1AA 5E6OA 3CSFA 2MRPA 2IBIB 1UBQA 2WDTB 2LASA 2MP2A 1K8RB 1T0YA 3TBLD 3K9OB 2LRWA 2D10A 2GBMA 2YVCA 2ASQA 2PE6B 4BBNF 1IP9A 3RULA 4ICVA 2CS4A 4FJVB 4W9DA 3JYUA 2KC2A 2WX0A 4MSMB 1WXVA 2RR9A 2ZCBA 3R66C 2O6VB 3UINB 1YQBA 3SDLC 1L2NA 1XQQA 4FLHA 2BKRB 2N4FA 4XZ4A 2DYOA 2Z0EB 4BKGA 4DHZE 4II2B 3SHQA 1TGZB 2WWZA 3JSVB 2HTHA 1WM3A 2FCMA 4G3XB 4HPMB 1JRUA 5AEKB 1WF9A 4A3PA 2I1JA 4HK2A 3QAQA 3DBLI 1WYWB 2N9XA 5FR6A 3RD2A 3B1LX 4E71A 3RZFA 5DPWA 4DK5A 3PLUA 1H4RA 3HK0A 4HDQA 4B6WA 1GJZA 2KX3A 3L08A 3RYTA 3VQIA 1WJNA 3UIPB 2DAFA 3BY4B 3QA8A 1WZ3A 5CX3A 4MELA 4GIVA 2JRHA 3QQ8B 2ZZPB 3VH4B 2MBHA 5C1ZA 4XX5A 3ZNZB 3PRZA 3TCAA 2KJRA 2NPTA 1J0GA 4PS3A 2MA9B 3AXCA 3VFKA 2FIDA 1OGWA 1YD8U 4II3B 3X23A 4IG7B 4GSWA 2MW5A 1WGGA 1EO6A 2ZPNA 3AU5A 2VRRB 3PRPB 3R3MA 4K1RB 3TMPB 4RMAA 5DCNA 1EF5A 2KD0A 3ALBA 2NPTB 1XT9B 2ZVNA 4E74A 3DDCB 4ASWC 2KTRB 4NJ7A 1KOTA 1D3ZA 5KHOA 4FJZA 3RT3B 4IM3A 3ZLZA 4EOYA 1GNUA 3NHEB 3RZWC 1TTNA 2M17A 2PJHA 5L95C 2KLGA 2BWES 3QJZA 2BF8B 5CTRC 1QZEA 2K8CA 1WX9A 4KVGB 4KIKB 3QK0A 4HXDA 3VHTC 2M8SA 1WH3A 3EC8A 1UELA 2LUEA 3ML8A 1LXDA 1V5OA 3A9KA 2CHXA 4GDLA 2AL6A 4PS7A 3H1UA 3VH3B 3HHMA 3H6NA 3OAWA 4AP4C 5JZEB 3N32A 2JZ3B 2KANA 1P98A 3A33B 4ANVA 2PPHA 3P2BA 1ZKHA 3CSTA 1XD3B 4BFRA 4KSLC 2DYBA 3A9KB 4MM3A 3Q3JA 2KOXA 2D11A 4IW0A 2IY0B 4LDTB 2KDFB 4K7UA 4MGZE 4GDLB 3VTUA 5JH5C 2DX5B 3DBRI 3M95A 2J0MA 4PYZA 3APDA 2B3AA 2OOBB 3OJ4B 4KZCA 2HE7A 1GG3A 2RSUA 1BT0A 3JVZX 2L3ZA 3EFUA 3N30A 3B08A 4IM0A 3KUZA 1S1QB 5DPTA 4BOZB 1J19A 5KHQA 2JF5A 3AULA 2JXXA 2V4LA 3PVLA 1OQYA 1V49A 4KZ0A 1YX5B 4P7IA 1UBIA 1OEYA 4OVVA 3UF8A 2AL3A 2DHZA 4XC2A 1NDDA 4MGIE 4NNJB 1Y8RC 2K6DB 1KLVA 4DHJB 1OTRB 5E6NA 4WJNA 3NOBA 4JLCA 1RRBA 3R7RA 4TKNA 1EF1A 2RPQA 4A20A 4I6LB 3SD5A 2K39A 2HD5B 4A3OA 2KHWB 5D7GA 3WAOA 2M4NA 3W1SC 2KMAA 2G3QB 3KYCD 4DHZB 4NY0A 2K1FA 4GU2A 2LJ5A 3PGEA 2R2QA 2LZ6A 1ZW7A 1AARA 2L0TA 2O6VA 1WX7A 2JY6A 4MJSA 5J18A 5HKHA 2N9PC 4PS8A 1VCBA 2D07B 3JSVA 2JVCA 4KV2A 3OLMD 3H7PA 2AYOB 5CHVC 1E5WA 1RFAA 2IY1B
chains in the Genus database with same CATH superfamily
2QDFA 2WXFA 1HA5A 3ZDMC 4XYCA 1F2RI 4S17A 1WXQA 2D5GA 1WR6E 3X0WA 3AEGB 1ZXHA 3H7PB 3NZ3A 2G4DB 4IDIA 2LXCA 2C7NB 2AEHA 2INPE 4TQ1A 2KDEB 1HTOA 4PT5A 2NCNA 1R4MI 4L23A 2O6VD 4NQKE 2WGSA 2PVGC 1JWUD 2KX0A 3MJ5A 2KDMA 1ACCA 1LFDA 4ARCA 3DWGC 3VVWB 4C4VA 2O2VA 1NYQA 4K81A 2QJLA 4BKSA 3IVFA 1RAXA 3QWZB 1WY8A 4HCNB 1TKGA 3IFWB 1PQSA 4K7WA 5IA7A 2DENB 2O2VB 3Q8EA 2WDRB 2AQ3B 1T0QC 3DBHB 4WJPA 1PFDA 4M01A 1S3SG 5IAAC 1EWYC 2MQJA 3KUCB 1B9RA 3IT6B 4A9AA 2V3SA 2YEPB 4I6PA 3ZYYX 1YNTE 1JWMD 1CZPA 3VXWA 1GUAB 1YX6B 2KDIA 1L7YA 3PLVA 2JT4B 5G55A 2ACZB 2LHEA 1WGHA 3QHTA 3I5JC 3HM3A 5EE9A 4MEMA 1FRRA 2RMMA 2A5UA 2BPSA 2CR5A 3GB1A 1E9MA 2ZEQA 4WWMA 2L83A 3IAS1 1EUVB 1YJ1A 2Y5CA 3DBSA 3WIMA 3B0AA 3TJPA 3V62A 3M62B 5TR5A 3ETRA 1XLPA 3V6EB 1IGCA 3ZRCA 1VRAB 2L32A 3HUIA 1P0RA 1SIFA 4AJYB 4RGNA 2INCC 2GRIA 1WXSA 1IUEA 2LGXA 1WYGA 2N1WA 2IPKD 2M0AA 1WGYA 3QX1A 1RM6C 4LNKA 1HEZE 3PZDA 2PIAA 2LVPA 2CKHB 2WDVB 3QCAA 3QC8B 3ZTDA 1L5PA 3RPFC 3ZJVA 4HCPB 2BYEA 3FC4A 5BMHA 3Q14C 2SEBD 1WRDB 4LJOB 3AH7A 2N9KA 3AE3B 4GOCA 4DWFA 1P7EA 3U52E 4IUMB 2LI5A 1IPGA 4ITKA 2HJ1A 3K9PB 2N7DA 1MHXA 3VDZA 4B0MA 2GI9A 1M94A 1E8ZA 2GLSA 2GOWA 3DOWA 2WXJA 2MHJA 3NS8A 3CIRB 2KACA 2BYVE 1LO5D 3U7DA 2N1VA 3PRMB 4IC7B 4XWTA 3LYYA 2W54A 2KMCA 3I57A 1HZ6A 1V6EA 4NJ6A 1OFFA 2X8XX 5T8IA 4KGRA 3R7QA 3ZO5B 1NEKB 4BKSD 2K9XA 3BYTB 4RNAA 3L16A 1FRDA 4EZLA 1MVKA 2C9WB 2PEAA 2DZKA 1SSNA 2LD9A 3RUIB 3NVVA 2XK5A 2K8HA 2LMCA 4Q2JA 1F2RC 1D5MC 1F9JA 2KN4A 4FJYA 3U7ZA 1WGRA 3ENEA 3DQVA 3ZIMA 2IGDA 4HVBA 1I7HA 2MJDA 3AEAB 3BINA 2JXTA 2Z59B 4IWOA 1WGKA 4RM9A 2C7HA 5FK9C 1RFKA 4HPLB 4TV3A 4F8CB 4EEWA 2N9LA 3EA6A 2OJRA 1L6UA 3S2AA 1V5TA 3AE4B 1SGHA 3RNGC 1TS2A 2LGDA 5H8YE 1IGDA 3E56A 5D2MB 4DXAB 2M1MA 1KRHA 4W9EA 1D5XC 3L4PA 4ANXA 5IP4D 3ABVB 3AEEB 1V86A 2IGGA 1JQ4A 5MPOA 4W9HA 1P1AA 2LASA 3OG5A 1K8RB 5IOIA 2AQ2B 4M0WA 3TBLD 3K9OB 2L52A 2ASQA 1TS3A 2CS4A 3EFCA 3N1YC 3NVYA 1E6EB 3UINB 1L2NA 1XQQA 2N4FA 4XZ4A 3GZNB 3SHQA 2WWZA 1WM3A 3DHGC 4HPMB 4HK2A 1AW7A 5AUIA 5FKAC 3QAQA 2FUG1 3DBLI 1WYWB 5FR6A 3AN1A 3SEBA 4DK5A 4HDQA 2W3RA 3L08A 1BMLC 2WXIA 2BYTA 3QA8A 4RF1A 4MELA 4RH6A 2ZZPB 3VH4B 4USAA 3PRZA 5C2TB 3PZ7A 4S0RA 2MA9B 2FIDA 2WXRA 1YD8U 3X23A 4IG7B 3FILA 2MW5A 1EO6A 3AU5A 2VRRB 5DCNA 2LEKA 1XT9B 1F52A 1D3ZA 4FJZA 3RT3B 4IM3A 2H88B 1ENFA 2M17A 2PJHA 4US8A 3AE1B 2K8CA 4J3OD 4KVGB 3QK0A 1R4MB 4WH4A 2LUEA 1LXDA 2GB1A 3KWVA 5IO9A 4GDLA 2AL6A 2R61A 3CSTA 3Q69A 2D11A 4LDTB 4C00A 4K7UA 4GDLB 5JH5C 4ARIA 1MFWA 2B3AA 4KZCA 5G5GA 1S1QB 2NTSA 2JF5A 3PVLA 3MC9A 1UBIA 1FFUA 2AL3A 2DHZA 3N1XC 1SJED 1KLVA 1PYWD 3VRAB 4JLCA 3R7RA 4TKNA 4CQNA 4YXDB 4JE3B 4A3OA 3Q8BA 2K22A 2X38A 4QAYA 2JYTA 2R2QA 2RDHA 3FAHA 2LZ6A 4RCOA 2O6VA 4N6EB 1EU3A 3BIID 2Z8LA 2JVCA 4KV2A 3OLMD 3SR6A 1E5WA 1VZ6A 1UWXA 4M8MA 2KFKA 3RNFC 1UF0A 1WGDA 3P42A 2JX5A 1EU4A 3AU4A 3TEZA 4CHKA 1C77A 2OJWA 1V81A 3VUWA 2KFKB 4I6NB 1TZ1A 2WU5B 1V9JA 3Q3OC 2L00B 3AE5B 2KZRA 3AE7B 4EFOA 1WR1A 4N59A 5GXGB 3Q8AA 4C80A 2W82A 5HFYA 3ZNHB 2KWDA 2BB6A 3Q6BA 4TSSA 3MFGA 4KIKA 1L0YB 3PV1A 2J0KA 3AM9A 1VDVA 3ML9A 1C4CA 5D6JB 2IZVB 3N1ZC 3N9YC 2CU3A 4GMVA 1P3QU 1LGRA 2WP9B 5JXVA 2WS3B 4DXGA 2NMQA 4BOSC 2EMSA 4WWPA 3J9CA 5DPSA 2LGSA 2I1KA 1F0ZA 4BVUC 4OVZA 3P4SB 2G1EA 1DOXA 1J7CA 1WJUA 1TZOA 4FN2A 4EZJA 1C1YB 2KXJA 5HHDG 1A5RA 4YL8A 1FCLA 3GZNI 4M8NA 1LM8B 2GBNA 2G4SA 2KQSA 2N7JA 4WAAA 2KKCA 4LDTD 1I42A 2MWSB 3TIXA 2ZCCA 3SU8X 2KJHB 1YMHE 4A90A 5E6PA 3PTFC 4NAWB 1Q1OA 4ZYSA 1XEEA 2W55A 4YSYB 4FBJB 2IO2B 2VH2A 2LXAA 2BKFA 2UWQA 1SE3A 2NBWB 2G9HD 4REZA 3W1YA 4GXBA 4AS1A 4WWNA 3H9DA 2W9NA 1Q0WB 4BBNC 3BVMA 1WXMA 1FXTB 3KYDD 1QOAA 4FHJA 2FCNA 4RGOS 3TUOA 2INNE 2JPHA 2J7QB 2ZNVC 1K52A 2JSVX 3CMMB 5LLIA 2FCQA 3RNEC 4LJPB 1N6ZA 3HVDA 1QF6A 1Z5SB 3R2IA 1PGXA 5TSSA 5CHFA 1EWCA 1IBXB 4BAXA 2MJ3A 2MLBA 2IYDB 1P9DU 3TEYA 1ZXIA 5BYSA 3PPAA 4RM8A 2MBBB 4LCDE 3VUXA 2IGHA 2K8BA 1I4RA 3C0RB 4F7ZA 4CO7A 2V3NA 2KLCA 2LGIA 1JWBD 4TUUA 1CMXB 4MACA 3W2DA 4NZLB 2J4XA 1WX8A 2WNMA 4ZRIA 3L17A 1GC6A 4W9KA 4ANWA 1TIFA 1D4BA 5C23A 2H89B 2OHFA 1D6EC 2B76B 1PUTA 2IJ0A 3DBLB 3W1SA 3IAM1 3P4RB 4WJOA 4LK0M 1L4DB 2Q5WD 2REXA 3KVFB 2HTME 3N3KB 3RMKC 2MBOA 4GDKA 4ZOHC 3AECB 1AYFA 4FXCA 1GAQB 1N5WA 4GDKB 3UI3A 1CK1A 3NVWA 1GPXA 2DNFA 2PKOA 4DHJD 1FCCC 1PGBA 2K0PA 3A4RA 2MSED 2MBQA 4OW0A 1VZ8A 2W3SA 4L1BA 3CWIA 4ANUA 3IHPC 1QT9A 1Z2MA 3AEFB 4WWOA 1ZPSA 3ECIA 2ZNVB 5E6OA 2WDTB 2IBIB 1XCQL 5BYRA 2YVCA 3RULA 2D3CA 5BMGA 2I38A 4MSMB 2BW2A 2RR9A 1SF0A 3OWEB 1TYGB 1UUPA 3JSVB 1R4NB 1TS5A 1WF9A 1J7AA 5FR3A 1FD6A 3RD2A 3MP9A 1CJEA 4E71A 3RZFA 5DPWA 4B6WA 1H4RA 2KX3A 1KLUD 3RYTA 4B0EA 3QQ8B 3ZNZB 4YSXB 3TCAA 1ZDVA 4II3B 1Y56A 3PRPB 1WGGA 4K1RB 4YSZB 1EF5A 1FNVA 3T3OA 1K50A 2KTRB 2PTLA 5KHOA 3ZLZA 1GNUA 3P4PB 2HDEA 4DQOC 3RZWC 4K3BA 5L95C 2V4IB 4XWWA 1WH3A 3ML8A 1V5OA 2INDC 4P6VF 5EE1A 1ZOYB 1L4ZB 3H1UA 4HEA1 3H6NA 4AP4C 4BZAA 5JZEB 4UDUC 1P98A 2PPHA 1ZKHA 2KT7A 2BQQA 4BFRA 4MM3A 4C56C 1MJDA 4MGZE 3VTUA 3DBRI 2J0MA 4LLGM 1WRIA 4HKQA 2HE7A 4ZRQA 3NVZA 3JVZX 2L3ZA 2RPVA 2WXQA 5DPTA 1J19A 4MM3B 1VLBA 3AULA 1FFVA 4OVVA 4KZ0A 1YX5B 1OEYA 3UF8A 1PGAA 2M19A 4MGIE 5E6NA 2QSDA 1I4XA 1DYQA 4A20A 1E7PB 2BT6A 2K39A 2HD5B 5D7GA 1FXIA 2M4NA 1HQRD 2KMAA 1HZ5A 4GU2A 3NJTA 4MT5A 4MJSA 5HKHA 3V3XA 4PS8A 1VCBA 2D07B 2IY1B 1C3TA 5BMIA 4MJSB 1TY0A 1IYFA 2LVOA 1E8XA 2GBJA 3PHWB 1E0ZA 1SXTA 4HPPA 1ZDXA 1WE7A 1KJTA 3NY5A 4B95A 1YN3A 1OEYJ 1Q5WB 5JHBA 4A8XC 3Q3NC 1GC7A 1N61A 4BKTA 2L0FA 2JU6X 4AWJA 4KGTA 4RGTA 4TQ0A 1T6BX 2PE9A 3TEXA 4URKA 3HM6X 3V61A 1AN8A 2N9EB 4PK1A 2RDBC 1VD2A 2NBVB 1QQRA 1SE9A 4O1NA 3R2TA 3O13A 2RGFA 3EECA 4B9KA 1FMAD 3DCGA 4W9JA 1ET6A 3AE8B 1KLGD 2DZIA 2KYWA 1NBFC 3ZXVA 3NS1A 3ZUNA 5IKCM 3EGRA 4IWPA 3WAPA 3MTNB 4YTPB 1TT5B 1AWDA 4IOIE 3P63A 2NR2A 4W9CA 3IG3A 4X57B 4ACFA 2GMIC 4IWQA 4DBGA 1WIAA 1FPYA 3GOEA 2LWPA 3RCZA 1MHHE 3W9CB 5I4DA 4AUQC 4AQ7A 4RFBA 3DVNV 1FIQA 2YEPF 1ET9A 1WZ0A 2D3BA 4XDDA 1MG8A 3A9JB 1UGMA 4GN1A 4DDGD 3KQ4A 1L0VB 4OVUA 1R4NI 1N63A 1LQBA 2KN5A 2XEWA 4J6IA 3ZJUA 2CU1A 3M3JA 4YWGG 3DVNU 4DXFA 1HE8A 5GMVA 2L76A 3VR8B 1YN5A 3N20C 3NUHB 3UGBB 1XXGA 3A4SC 1V1OA 1V97A 4WJQA 3MHSD 4M02A 3VTWA 4EUTA 2AWTA 2DZMA 1FM0D 2MCNB 2Y3AA 2KWVB 4W9IA 4ZHOA 1UGJA 4US9A 2D3AA 4EE2A 2BYFA 2KC1A 1J8CA 2J52A 3AE6B 2NS5A 5D94A 2ZVOA 4HWIB 1TJEA 3OJ3A 1KM7A 1WI0A 3DHHC 2LUMA 1Q10A 2KNBA 2MX2A 2Y5BB 1V80A 3DHIC 4HROA 3C19A 4KDIC 4L2YA 1OQRA 2KTFA 4KGSA 4MH0E 4WQOB 4NQLB 2N0SB 1ROEA 2MP2B 5AZHA 4FULA 5BO4B 2V1YA 1RLFA 3BVZA 3EHVA 1JRPA 2KK8A 2Z0DB 2WHIA 3B9JA 3P1MA 2KMMA 3ZNGC 2R2OA 3Q3MC 1WE6A 1VZ7A 3GP7A 4LTUA 2NBUA 1NYRA 2DZJA 1E90A 4NJCA 5JHAA 4RF0A 2A4ZA 1UH6A 2PMVA 1T0SC 4OZAA 4RGMA 4KKJA 3H7SA 2AX5A 1T5XD 2XBBC 2VH1A 3L54A 3LJ3A 4JPSA 3PHXB 2J0JA 2KAJA 1KTKA 2ON8A 4DDID 2KDBA 1WFYA 1TY2A 1WJ6A 1WM2A 4G0NB 5E6JA 3ZGZA 2KO3A 3AE2B 2ZPYA 2LGYA 3KW5B 4EZKA 2BBCA 1D5ZC 3KUDB 3BK2A 3NRZA 2LRUA 4CYEA 3I63C 2XN9C 3M63B 4GLSC 3BZDB 1UZXB 4NAWA 2BTEA 3ZVVA 1JROA 1E8YA 5LNK1 1T0RC 2L1AA 4JL9A 2UYZB 3APFA 1C4AA 3HIZA 1I4QA 2HJ8A 3MHZA 1C9FA 4K7SA 1XLQA 3AEDB 3L13A 4OHJA 1RYJA 1JMLA 2JRIB 3RN9C 2BGFA 2WLBA 3LB8C 2JZZA 4ZYNA 1V8CA 5IN7A 2DBYA 3ZW3A 3AMZA 1R7SA 4W9LA 2LHDA 3PREA 3WAMA 5G5HA 4N9F4 3UIOB 1JWSD 4KX6B 3CSFA 1UBQA 2WDQB 4MH8A 2GBMA 2UU7A 1QILA 4FJVB 1VJKA 2IDYA 4W9DA 3GE8C 3JYUA 1MG4A 2WX0A 1OQQA 3DBRB 1WXVA 1V1PB 1IBXA 1YQBA 3SDLC 4FLHA 1FNUA 4DHZE 2CJNA 2DYOA 1MI0A 1M4VA 2QCZA 2BVCA 2HTHA 1RWSA 2FCMA 4G3XB 3SFDB 5AEKB 4KKIA 4A3PA 2I1JA 2BS2B 2BS3B 2BB5A 2N9XA 3B1LX 1HTQA 1C4PA 3UIPB 4XDCA 3BY4B 3GS2A 1UWMA 1WZ3A 5CX3A 2JRHA 1TKEA 5C1ZA 4XX5A 2NTTA 3R8BA 1J0GA 4PS3A 3AXCA 1OGWA 2LJIA 3R3MA 2ZPNA 1C78A 4C4VB 4RMAA 5C3JB 2KD0A 4P1CC 2M56B 3ALBA 4E74A 4ASWC 4NJ7A 3Q8FA 2QIEB 3AEBB 4EOYA 3NHEB 2RDGA 1XF5L 2BWES 3QJZA 2ONQA 5CTRC 1QZEA 1YJIA 4LNFA 4HXDA 2M8SA 1CQVA 3EC8A 3A9KA 2EKIA 1YQ4B 2V9HA 1I4GA 4WQMA 3N32A 2JZ3B 1YQ3B 4OZCA 1FNWA 4ANVA 1XD3B 4KSLC 3A9KB 3Q3JA 2IY0B 2KDFB 2DX5B 3Q8CA 5EE3A 3APDA 2OOBB 1I4PA 3N30A 3EFUA 4IM0A 3B08A 4BOZB 5AUKA 4P16A 2JXXA 1OQYA 1V49A 3TEWA 2PVOD 1NDDA 4NNJB 1TS4A 1Y8RC 2K6DB 2WXHA 4WJNA 4H2AA 4C7YA 1QLBB 1EF1A 5BYQA 2KHWB 3WAOA 1YOVB 2G3QB 3KYCD 4DHZB 4NY0A 1C76A 1FO4A 1ZW7A 1AARA 1WX7A 2JY6A 3FKYA 4K3CA 2N9PC 4WIPA 3RNAC 2E3TA 1N62A 3JSVA 2AYOB 1RFAA 1BUIC 4W9FA 1GOZA 1XLOA 2QHOA 3MJWA 4ZRPA 4C7ZA 4FA6A 2J42A 1YN4A 2I2YA 4AJWA 2FUHB 1WXAA 1UD7A 3L0WB 3BYYB 2V0GA 5LXHA 2VZKB 2BWFA 3KH0A 2GBRA 3ZKJC 2QMTA 4NPNA 2YLMA 4JQWC 2KWCA 4D2KA 4EKUA 3T9LA 4F1SA 5AZFA 4JWUC 2D2QA 2WXGA 4OZBA 2KTRA 4GGQA 3PO0A 4KDLB 4JWSC 3WA0A 3ZJTA 4E3CA 2EMTA 3DPDA 1ISNA 1FXAA 3V60A 1NI2A 1X1MA 2FAZA 1VR9A 4FADA 1SJHD 2EELA 3BWUD 1TKYA 2DLBA 2WX1A 3D32A 4HKZE 3ONSA 2IO1B 4G11A 3ZXRA 2BS4B 1WWTA 5G2NA 3PT2B 3ZTCA 3IBEA 4ICUA 2WXOA 1ZGUB 2MJEA 1HXYD 1K53A 4MGYE 4FHKA 2K25A 1BXTA 1WSPA 4ZRJA 1A70A 4MSQB 2ICIA 2KWUB 2C5LC 1DGJA 4IM2A 3U30A 4G50A 3PS6A 4W9GA 2QEJC 2XK5B 2FNJB 3DVGY 3QARA 3PSEB 4GB9A 3I9V1 2WXPA 3Q3FA 5HI1A 2CHWA 2G45B 3WCQA 2LVQA 3I3TB 1P7FA 3C8YA 1KH0A 2TSSA 2K6QA 1WMHA 1STEA 4NAMA 1H8CA 3L10B 3CF6E 5H92C 2WXLA 5CHWA 4N58A 3RI7C 1TBEA 2FCSA 2RD0A 3WANA 4JGHB 1IP9A 3A1QA 2ZJDA 5J17A 3TL5A 1MPEA 3DBHI 1WMHB 3EUB2 1XCTL 3BVGA 4HJKA 3JW0X 4HDOA 4M00A 3VTVA 2IO3B 1QOFA 3O65B 3GE3C 3A1QB 1SBBB 2IO0B 1L6VA 3AV8A 2KJ6A 3Q2AC 2L05A 2M0XA 3T3NA 3BK1A 3UQAA 2DWQA 1JALA 2CHZA 4PYUA 2L8JA 4ZRKA 1SEBD 4M0WB 4YT0B 3VR9B 3NZUA 1E10A 3NG0A 2GBKA 2FBWB 1C79A 2VZKD 4A55A 1U4AA 2ZW1A 3IT4B 2QC8A 1I35A 4ZHPA 1E7UA 3DVGX 1DOYA 4YTMB 5DPRA 3MC8A 3AI5A 3KLSX 4HJGE 2FIFA 4MDKE 1JWAD 5L83A 1E8WA 1KFYB 2XNAC 3ZDTA 5AZGA 3T8MA 2JWZA 3VAWA 4IKGA 3UQBA 3MC0B 3VUYA 3NZSA 4KSKC 3V05A 3APCA 3LDZE 4WURA 2DAJA 2MEKA 3A9JA 4MGKE 2SAKA 2PW9A 3FILB 2L7RA 3ZRFA 2E6XA 2JUOA 2EKEC 3QIJA 1SB3C 3V6CB 3W5UB 1JW9D 3U8ZA 1NENB 4A6QA 3LXFA 5LXIB 1EM7A 3WALA 5EDSA 4P1BC 5J2RA 2K5PA 1QKZA 2D3GA 1F77A 3B2FA 2NVUI 2WU2B 3ZNID 4ZDVA 1XLNA 2KQ7A 2N7EA 3KWLA 2C7MB 2WYQA 1N5XA 4HLEA 2J53A 4LNOA 1G6JA 2ZW0A 3IXSA 4XE0A 1E7VA 4JIOU 1WJ4A 1SE4A 2KFJA 3U2SC 2JQRB 2Y5PA 4YTNB 2DYMA 2C60A 2MBEA 1YIWA 3TSSA 2KVRA 2KQ4X 2KVZA 2FE8A 3AB5A 3RFZB 1V2YA 2MRPA 2MP2A 1K51A 1T0YA 2MH7A 2QILA 1KF6B 2LRWA 2D10A 2PE6B 4BBNF 4ICVA 2KC2A 1DOIA 4LNNA 1J7BA 1QOBA 5D3IB 1NI3A 2ZCBA 3R66C 3E9SA 2O6VB 2BKRB 2Z0EB 4BKGA 4II2B 1TGZB 1NVID 5HG2A 1JRUA 3PLUA 3HK0A 1GJZA 3VQIA 3PZ8A 1WJNA 2DAFA 3W5VB 1GB4A 1QOGA 2V3PA 4GIVA 2MBHA 3SFEB 4HRSA 2KJRA 2NPTA 2JWUA 3ZQ4A 3VFKA 2LFIA 1ESFA 1JCKB 1L0XB 1GB1A 4GSWA 4AOFA 2JYEA 3TMPB 5EE0A 3HVZA 3H8HA 2AQ1B 2NPTB 2WQYB 2ZVNA 3DDCB 2CJOA 1T3QA 1KOTA 4R3DA 4XGAB 1TTNA 2JZPA 2KLGA 1PDXA 1N60A 2BF8B 3DWMA 1WX9A 4KIKB 3VHTC 3URYA 1UELA 2CHXA 2WXKA 4PS7A 3VRBB 3VH3B 3HHMA 3OAWA 3HRDD 2KANA 3A33B 3P2BA 2OEDA 2DYBA 1UNSA 2KOXA 4IW0A 3P4QB 3U4EG 3M95A 3RNBC 4PYZA 3OJ4B 1GG3A 2RSUA 1BT0A 3KUZA 4JX1C 5KHQA 2WXMA 2V4LA 1B1ZA 4P7IA 4XC2A 4DHJB 1OTRB 1XO3A 3NOBA 3AE9B 1RRBA 2RPQA 1ZUD2 4I6LB 5D3DA 1SE2A 3SD5A 4LNIA 3W1SC 1F1HA 4TMAB 2K1FA 2LJ5A 2WXNA 3PGEA 1YJJA 3RNCC 1ZE3D 2PLPA 2L0TA 5J18A 1V1PA 1ZP0B 1FEHA 2K3UA 4WAFA 1SIJA 3B2GA 1I4HA 3H7PA 5CHVC
chains in the Genus database with same CATH topology
4M8MA 1C3TA 2KFKA 4W9FA 4MJSB 1IYFA 3ZDMC 2QHOA 1WGDA 3MJWA 4FA6A 2LVOA 3AU4A 1E8XA 2GBJA 4CHKA 3PHWB 4AJWA 2FUHB 1WR6E 1WXAA 3X0WA 1UD7A 3H7PB 3L0WB 1WE7A 1KJTA 3NY5A 2G4DB 1V81A 4B95A 3VUWA 2LXCA 2C7NB 2KFKB 2AEHA 5LXHA 4TQ1A 4I6NB 2KDEB 1OEYJ 1Q5WB 5JHBA 2NCNA 1R4MI 2BWFA 3KH0A 2GBRA 2O6VD 4NQKE 3ZKJC 1GC7A 1TZ1A 4BKTA 2KX0A 2L0FA 4NPNA 4AWJA 1LFDA 2YLMA 4JQWC 2KWCA 4EKUA 1V9JA 3T9LA 3VVWB 4TQ0A 4F1SA 2O2VA 2L00B 2PE9A 4K81A 5AZFA 2KZRA 4BKSA 3IVFA 1RAXA 3QWZB 4URKA 3HM6X 2D2QA 3V61A 2N9EB 2KTRA 1WY8A 4EFOA 1WR1A 4HCNB 4GGQA 3IFWB 1VD2A 1PQSA 2NBVB 4K7WA 1SE9A 4KDLB 5IA7A 3WA0A 2RGFA 3EECA 2DENB 2O2VB 3ZNHB 4B9KA 3DCGA 4W9JA 4WJPA 4E3CA 2EMTA 3DPDA 2DZIA 4KIKA 3PV1A 1S3SG 2J0KA 3ML9A 1ISNA 5IAAC 3V60A 1NBFC 1NI2A 1X1MA 5D6JB 2FAZA 3ZUNA 2MQJA 4FADA 2IZVB 3KUCB 4IWPA 3WAPA 2V3SA 4I6PA 3MTNB 2WX1A 3D32A 3ONSA 4GMVA 1P3QU 2IO1B 2NR2A 4W9CA 3IG3A 4G11A 4X57B 3VXWA 1GUAB 5G2NA 1YX6B 2GMIC 3PT2B 3ZTCA 4IWQA 2KDIA 3IBEA 1L7YA 3PLVA 1ZGUB 4ICUA 4BOSC 4DBGA 1WIAA 4AOFA 2JT4B 3GOEA 2EMSA 2LWPA 4WWPA 5G55A 3RCZA 5DPSA 4MGYE 2I1KA 4AUQC 1WGHA 2K25A 3DVNV 4FHKA 3QHTA 4BVUC 1WZ0A 3HM3A 4ZRJA 4MEMA 1WJUA 2A5UA 4MSQB 2BPSA 2CR5A 4FN2A 1MG8A 3A9JB 2KWUB 2C5LC 4EZJA 1C1YB 2KXJA 1UGMA 2ZEQA 4GN1A 1A5RA 4YL8A 4IM2A 4DDGD 3GZNI 4M8NA 4OVUA 3U30A 1LM8B 4G50A 3PS6A 1EUVB 2GBNA 1R4NI 4W9GA 1YJ1A 2G4SA 1LQBA 2KN5A 2XEWA 4J6IA 2XK5B 2KQSA 2CU1A 4WAAA 3M3JA 2FNJB 3DBSA 2KKCA 3DVGY 4LDTD 3QARA 3WIMA 1I42A 3PSEB 3B0AA 4GB9A 3TJPA 3V62A 3M62B 5TR5A 2MWSB 3DVNU 3TIXA 3V6EB 1HE8A 2ZCCA 3SU8X 3Q3FA 5GMVA 3ZRCA 2KJHB 2CHWA 2L76A 2G45B 1P0RA 5E6PA 3PTFC 1SIFA 4NAWB 3UGBB 3A4SC 4AJYB 1Q1OA 2LVQA 1J8CA 4WJQA 3MHSD 3I3TB 1WXSA 3VTWA 2K6QA 2LGXA 2AWTA 4EUTA 2N1WA 4FBJB 1WMHA 2DZMA 2IO2B 1H8CA 2LXAA 2MCNB 2KWVB 4W9IA 2BKFA 2UWQA 3L10B 1WGYA 3CF6E 2NBWB 3QX1A 5CHWA 3W1YA 4GXBA 3PZDA 1TBEA 2FCSA 2LVPA 2CKHB 2RD0A 3QCAA 3QC8B 2BYFA 4JGHB 2KC1A 3A1QA 2ZJDA 3H9DA 4WWNA 3TL5A 3WANA 3ZTDA 3DBHI 1WMHB 5J17A 2NS5A 5D94A 2ZVOA 2W9NA 4HWIB 4HJKA 4HCPB 2BYEA 1Q0WB 4BBNC 3JW0X 4HDOA 1WXMA 3OJ3A 1KM7A 1WI0A 1FXTB 1WRDB 3KYDD 2IO3B 3VTVA 4FHJA 3O65B 2KNBA 4LJOB 2MX2A 2Y5BB 1V80A 3A1QB 2FCNA 2IO0B 2KJ6A 2L05A 2M0XA 4KDIC 2JPHA 3UQAA 2KTFA 2J7QB 2ZNVC 4GOCA 4MH0E 4DWFA 3CMMB 4WQOB 4NQLB 2CHZA 4PYUA 2L8JA 2LI5A 1IPGA 2FCQA 2MP2B 4IUMB 4M0WB 4FULA 4ZRKA 5AZHA 5LLIA 4LJPB 3K9PB 5BO4B 2V1YA 1RLFA 3NZUA 2N7DA 2GBKA 3VDZA 3EHVA 1Z5SB 1M94A 1E8ZA 1U4AA 2GOWA 2KK8A 5CHFA 2Z0DB 3DOWA 3NS8A 1I35A 2BYVE 3ZNGC 3U7DA 2R2OA 2N1VA 3PRMB 4IC7B 1E7UA 1WE6A 3DVGX 2MLBA 2NBUA 5DPRA 2DZJA 1E90A 2IYDB 3AI5A 5JHAA 1P9DU 2A4ZA 1UH6A 3PPAA 2KMCA 4RM8A 2FIFA 4MDKE 2MBBB 4LCDE 3VUXA 1V6EA 4NJ6A 2K8BA 3H7SA 5L83A 1E8WA 3R7QA 3C0RB 5AZGA 3ZDTA 3T8MA 3ZO5B 2JWZA 4F7ZA 2XBBC 3VAWA 4CO7A 4BKSD 3UQBA 2KLCA 3VUYA 3L54A 3NZSA 4KSKC 3LJ3A 3PHXB 4TUUA 2J0JA 3APCA 1CMXB 3LDZE 3L16A 4EZLA 2C9WB 2PEAA 2DZKA 4DDID 2DAJA 2KDBA 1WFYA 3A9JA 4MGKE 1WJ6A 1WX8A 1WM2A 4ZRIA 3L17A 2L7RA 1GC6A 2LD9A 4W9KA 3ZRFA 4G0NB 2JUOA 3QIJA 2EKEC 4ANWA 3RUIB 3V6CB 5C23A 2KO3A 2XK5A 2ZPYA 3U8ZA 2K8HA 2LGYA 3KW5B 1F9JA 4FJYA 4EZKA 3W1SA 5LXIB 1WGRA 4WJOA 3KUDB 2REXA 3ENEA 3DQVA 3KVFB 2LRUA 3ZIMA 3WALA 4CYEA 5EDSA 3M63B 3N3KB 4HVBA 5J2RA 2MBOA 1UZXB 4NAWA 2D3GA 3BINA 4GDKA 3ZVVA 2Z59B 4IWOA 2NVUI 3ZNID 1E8YA 2C7HA 4RM9A 4ZDVA 2KQ7A 4JL9A 2UYZB 2N7EA 4HPLB 4TV3A 2C7MB 2WYQA 3APFA 3HIZA 4EEWA 4F8CB 4HLEA 2HJ8A 2OJRA 4GDKB 4K7SA 3S2AA 1G6JA 1V5TA 3L13A 1SGHA 1E7VA 2JRIB 4DHJD 4JIOU 1WJ4A 2KFJA 2BGFA 2LGDA 3A4RA 2JZZA 4ZYNA 2MSED 2MBQA 5D2MB 4DXAB 2DYMA 2C60A 2M1MA 2MBEA 3ZW3A 4W9EA 1YIWA 4W9LA 4ANUA 4ANXA 3PREA 3WAMA 3IHPC 2KVRA 1Z2MA 4N9F4 3UIOB 1V86A 4WWOA 3ECIA 2ZNVB 4W9HA 1V2YA 1P1AA 5E6OA 3CSFA 2MRPA 2IBIB 1UBQA 2WDTB 2LASA 2MP2A 1K8RB 1T0YA 3TBLD 3K9OB 2LRWA 2D10A 2GBMA 2YVCA 2ASQA 2PE6B 4BBNF 1IP9A 3RULA 4ICVA 2CS4A 4FJVB 4W9DA 3JYUA 2KC2A 2WX0A 4MSMB 1WXVA 2RR9A 2ZCBA 3R66C 2O6VB 3UINB 1YQBA 3SDLC 1L2NA 1XQQA 4FLHA 2BKRB 2N4FA 4XZ4A 2DYOA 2Z0EB 4BKGA 4DHZE 4II2B 3SHQA 1TGZB 2WWZA 3JSVB 2HTHA 1WM3A 2FCMA 4G3XB 4HPMB 1JRUA 5AEKB 1WF9A 4A3PA 2I1JA 4HK2A 3QAQA 3DBLI 1WYWB 2N9XA 5FR6A 3RD2A 3B1LX 4E71A 3RZFA 5DPWA 4DK5A 3PLUA 1H4RA 3HK0A 4HDQA 4B6WA 1GJZA 2KX3A 3L08A 3RYTA 3VQIA 1WJNA 3UIPB 2DAFA 3BY4B 3QA8A 1WZ3A 5CX3A 4MELA 4GIVA 2JRHA 3QQ8B 2ZZPB 3VH4B 2MBHA 5C1ZA 4XX5A 3ZNZB 3PRZA 3TCAA 2KJRA 2NPTA 1J0GA 4PS3A 2MA9B 3AXCA 3VFKA 2FIDA 1OGWA 1YD8U 4II3B 3X23A 4IG7B 4GSWA 2MW5A 1WGGA 1EO6A 2ZPNA 3AU5A 2VRRB 3PRPB 3R3MA 4K1RB 3TMPB 4RMAA 5DCNA 1EF5A 2KD0A 3ALBA 2NPTB 1XT9B 2ZVNA 4E74A 3DDCB 4ASWC 2KTRB 4NJ7A 1KOTA 1D3ZA 5KHOA 4FJZA 3RT3B 4IM3A 3ZLZA 4EOYA 1GNUA 3NHEB 3RZWC 1TTNA 2M17A 2PJHA 5L95C 2KLGA 2BWES 3QJZA 2BF8B 5CTRC 1QZEA 2K8CA 1WX9A 4KVGB 4KIKB 3QK0A 4HXDA 3VHTC 2M8SA 1WH3A 3EC8A 1UELA 2LUEA 3ML8A 1LXDA 1V5OA 3A9KA 2CHXA 4GDLA 2AL6A 4PS7A 3H1UA 3VH3B 3HHMA 3H6NA 3OAWA 4AP4C 5JZEB 3N32A 2JZ3B 2KANA 1P98A 3A33B 4ANVA 2PPHA 3P2BA 1ZKHA 3CSTA 1XD3B 4BFRA 4KSLC 2DYBA 3A9KB 4MM3A 3Q3JA 2KOXA 2D11A 4IW0A 2IY0B 4LDTB 2KDFB 4K7UA 4MGZE 4GDLB 3VTUA 5JH5C 2DX5B 3DBRI 3M95A 2J0MA 4PYZA 3APDA 2B3AA 2OOBB 3OJ4B 4KZCA 2HE7A 1GG3A 2RSUA 1BT0A 3JVZX 2L3ZA 3EFUA 3N30A 3B08A 4IM0A 3KUZA 1S1QB 5DPTA 4BOZB 1J19A 5KHQA 2JF5A 3AULA 2JXXA 2V4LA 3PVLA 1OQYA 1V49A 4KZ0A 1YX5B 4P7IA 1UBIA 1OEYA 4OVVA 3UF8A 2AL3A 2DHZA 4XC2A 1NDDA 4MGIE 4NNJB 1Y8RC 2K6DB 1KLVA 4DHJB 1OTRB 5E6NA 4WJNA 3NOBA 4JLCA 1RRBA 3R7RA 4TKNA 1EF1A 2RPQA 4A20A 4I6LB 3SD5A 2K39A 2HD5B 4A3OA 2KHWB 5D7GA 3WAOA 2M4NA 3W1SC 2KMAA 2G3QB 3KYCD 4DHZB 4NY0A 2K1FA 4GU2A 2LJ5A 3PGEA 2R2QA 2LZ6A 1ZW7A 1AARA 2L0TA 2O6VA 1WX7A 2JY6A 4MJSA 5J18A 5HKHA 2N9PC 4PS8A 1VCBA 2D07B 3JSVA 2JVCA 4KV2A 3OLMD 3H7PA 2AYOB 5CHVC 1E5WA 1RFAA 2IY1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M8M A;  1C3T A;  2KFK A;  4W9F A;  4MJS B;  1IYF A;  3ZDM C;  2QHO A;  1WGD A;  3MJW A;  4FA6 A;  2LVO A;  3AU4 A;  1E8X A;  2GBJ A;  4CHK A;  3PHW B;  4AJW A;  2FUH B;  1WR6 E;  1WXA A;  3X0W A;  1UD7 A;  3H7P B;  3L0W B;  1WE7 A;  1KJT A;  3NY5 A;  2G4D B;  1V81 A;  4B95 A;  3VUW A;  2LXC A;  2C7N B;  2KFK B;  2AEH A;  5LXH A;  4TQ1 A;  4I6N B;  2KDE B;  1OEY J;  1Q5W B;  5JHB A;  2NCN A;  1R4M I;  2BWF A;  3KH0 A;  2GBR A;  2O6V D;  4NQK E;  3ZKJ C;  1GC7 A;  1TZ1 A;  4BKT A;  2KX0 A;  2L0F A;  4NPN A;  4AWJ A;  1LFD A;  2YLM A;  4JQW C;  2KWC A;  4EKU A;  1V9J A;  3T9L A;  3VVW B;  4TQ0 A;  4F1S A;  2O2V A;  2L00 B;  2PE9 A;  4K81 A;  5AZF A;  2KZR A;  4BKS A;  3IVF A;  1RAX A;  3QWZ B;  4URK A;  3HM6 X;  2D2Q A;  3V61 A;  2N9E B;  2KTR A;  1WY8 A;  4EFO A;  1WR1 A;  4HCN B;  4GGQ A;  3IFW B;  1VD2 A;  1PQS A;  2NBV B;  4K7W A;  1SE9 A;  4KDL B;  5IA7 A;  3WA0 A;  2RGF A;  3EEC A;  2DEN B;  2O2V B;  3ZNH B;  4B9K A;  3DCG A;  4W9J A;  4WJP A;  4E3C A;  2EMT A;  3DPD A;  2DZI A;  4KIK A;  3PV1 A;  1S3S G;  2J0K A;  3ML9 A;  1ISN A;  5IAA C;  3V60 A;  1NBF C;  1NI2 A;  1X1M A;  5D6J B;  2FAZ A;  3ZUN A;  2MQJ A;  4FAD A;  2IZV B;  3KUC B;  4IWP A;  3WAP A;  2V3S A;  4I6P A;  3MTN B;  2WX1 A;  3D32 A;  3ONS A;  4GMV A;  1P3Q U;  2IO1 B;  2NR2 A;  4W9C A;  3IG3 A;  4G11 A;  4X57 B;  3VXW A;  1GUA B;  5G2N A;  1YX6 B;  2GMI C;  3PT2 B;  3ZTC A;  4IWQ A;  2KDI A;  3IBE A;  1L7Y A;  3PLV A;  1ZGU B;  4ICU A;  4BOS C;  4DBG A;  1WIA A;  4AOF A;  2JT4 B;  3GOE A;  2EMS A;  2LWP A;  4WWP A;  5G55 A;  3RCZ A;  5DPS A;  4MGY E;  2I1K A;  4AUQ C;  1WGH A;  2K25 A;  3DVN V;  4FHK A;  3QHT A;  4BVU C;  1WZ0 A;  3HM3 A;  4ZRJ A;  4MEM A;  1WJU A;  2A5U A;  4MSQ B;  2BPS A;  2CR5 A;  4FN2 A;  1MG8 A;  3A9J B;  2KWU B;  2C5L C;  4EZJ A;  1C1Y B;  2KXJ A;  1UGM A;  2ZEQ A;  4GN1 A;  1A5R A;  4YL8 A;  4IM2 A;  4DDG D;  3GZN I;  4M8N A;  4OVU A;  3U30 A;  1LM8 B;  4G50 A;  3PS6 A;  1EUV B;  2GBN A;  1R4N I;  4W9G A;  1YJ1 A;  2G4S A;  1LQB A;  2KN5 A;  2XEW A;  4J6I A;  2XK5 B;  2KQS A;  2CU1 A;  4WAA A;  3M3J A;  2FNJ B;  3DBS A;  2KKC A;  3DVG Y;  4LDT D;  3QAR A;  3WIM A;  1I42 A;  3PSE B;  3B0A A;  4GB9 A;  3TJP A;  3V62 A;  3M62 B;  5TR5 A;  2MWS B;  3DVN U;  3TIX A;  3V6E B;  1HE8 A;  2ZCC A;  3SU8 X;  3Q3F A;  5GMV A;  3ZRC A;  2KJH B;  2CHW A;  2L76 A;  2G45 B;  1P0R A;  5E6P A;  3PTF C;  1SIF A;  4NAW B;  3UGB B;  3A4S C;  4AJY B;  1Q1O A;  2LVQ A;  1J8C A;  4WJQ A;  3MHS D;  3I3T B;  1WXS A;  3VTW A;  2K6Q A;  2LGX A;  2AWT A;  4EUT A;  2N1W A;  4FBJ B;  1WMH A;  2DZM A;  2IO2 B;  1H8C A;  2LXA A;  2MCN B;  2KWV B;  4W9I A;  2BKF A;  2UWQ A;  3L10 B;  1WGY A;  3CF6 E;  2NBW B;  3QX1 A;  5CHW A;  3W1Y A;  4GXB A;  3PZD A;  1TBE A;  2FCS A;  2LVP A;  2CKH B;  2RD0 A;  3QCA A;  3QC8 B;  2BYF A;  4JGH B;  2KC1 A;  3A1Q A;  2ZJD A;  3H9D A;  4WWN A;  3TL5 A;  3WAN A;  3ZTD A;  3DBH I;  1WMH B;  5J17 A;  2NS5 A;  5D94 A;  2ZVO A;  2W9N A;  4HWI B;  4HJK A;  4HCP B;  2BYE A;  1Q0W B;  4BBN C;  3JW0 X;  4HDO A;  1WXM A;  3OJ3 A;  1KM7 A;  1WI0 A;  1FXT B;  1WRD B;  3KYD D;  2IO3 B;  3VTV A;  4FHJ A;  3O65 B;  2KNB A;  4LJO B;  2MX2 A;  2Y5B B;  1V80 A;  3A1Q B;  2FCN A;  2IO0 B;  2KJ6 A;  2L05 A;  2M0X A;  4KDI C;  2JPH A;  3UQA A;  2KTF A;  2J7Q B;  2ZNV C;  4GOC A;  4MH0 E;  4DWF A;  3CMM B;  4WQO B;  4NQL B;  2CHZ A;  4PYU A;  2L8J A;  2LI5 A;  1IPG A;  2FCQ A;  2MP2 B;  4IUM B;  4M0W B;  4FUL A;  4ZRK A;  5AZH A;  5LLI A;  4LJP B;  3K9P B;  5BO4 B;  2V1Y A;  1RLF A;  3NZU A;  2N7D A;  2GBK A;  3VDZ A;  3EHV A;  1Z5S B;  1M94 A;  1E8Z A;  1U4A A;  2GOW A;  2KK8 A;  5CHF A;  2Z0D B;  3DOW A;  3NS8 A;  1I35 A;  2BYV E;  3ZNG C;  3U7D A;  2R2O A;  2N1V A;  3PRM B;  4IC7 B;  1E7U A;  1WE6 A;  3DVG X;  2MLB A;  2NBU A;  5DPR A;  2DZJ A;  1E90 A;  2IYD B;  3AI5 A;  5JHA A;  1P9D U;  2A4Z A;  1UH6 A;  3PPA A;  2KMC A;  4RM8 A;  2FIF A;  4MDK E;  2MBB B;  4LCD E;  3VUX A;  1V6E A;  4NJ6 A;  2K8B A;  3H7S A;  5L83 A;  1E8W A;  3R7Q A;  3C0R B;  5AZG A;  3ZDT A;  3T8M A;  3ZO5 B;  2JWZ A;  4F7Z A;  2XBB C;  3VAW A;  4CO7 A;  4BKS D;  3UQB A;  2KLC A;  3VUY A;  3L54 A;  3NZS A;  4KSK C;  3LJ3 A;  3PHX B;  4TUU A;  2J0J A;  3APC A;  1CMX B;  3LDZ E;  3L16 A;  4EZL A;  2C9W B;  2PEA A;  2DZK A;  4DDI D;  2DAJ A;  2KDB A;  1WFY A;  3A9J A;  4MGK E;  1WJ6 A;  1WX8 A;  1WM2 A;  4ZRI A;  3L17 A;  2L7R A;  1GC6 A;  2LD9 A;  4W9K A;  3ZRF A;  4G0N B;  2JUO A;  3QIJ A;  2EKE C;  4ANW A;  3RUI B;  3V6C B;  5C23 A;  2KO3 A;  2XK5 A;  2ZPY A;  3U8Z A;  2K8H A;  2LGY A;  3KW5 B;  1F9J A;  4FJY A;  4EZK A;  3W1S A;  5LXI B;  1WGR A;  4WJO A;  3KUD B;  2REX A;  3ENE A;  3DQV A;  3KVF B;  2LRU A;  3ZIM A;  3WAL A;  4CYE A;  5EDS A;  3M63 B;  3N3K B;  4HVB A;  5J2R A;  2MBO A;  1UZX B;  4NAW A;  2D3G A;  3BIN A;  4GDK A;  3ZVV A;  2Z59 B;  4IWO A;  2NVU I;  3ZNI D;  1E8Y A;  2C7H A;  4RM9 A;  4ZDV A;  2KQ7 A;  4JL9 A;  2UYZ B;  2N7E A;  4HPL B;  4TV3 A;  2C7M B;  2WYQ A;  3APF A;  3HIZ A;  4EEW A;  4F8C B;  4HLE A;  2HJ8 A;  2OJR A;  4GDK B;  4K7S A;  3S2A A;  1G6J A;  1V5T A;  3L13 A;  1SGH A;  1E7V A;  2JRI B;  4DHJ D;  4JIO U;  1WJ4 A;  2KFJ A;  2BGF A;  2LGD A;  3A4R A;  2JZZ A;  4ZYN A;  2MSE D;  2MBQ A;  5D2M B;  4DXA B;  2DYM A;  2C60 A;  2M1M A;  2MBE A;  3ZW3 A;  4W9E A;  1YIW A;  4W9L A;  4ANU A;  4ANX A;  3PRE A;  3WAM A;  3IHP C;  2KVR A;  1Z2M A;  4N9F 4;  3UIO B;  1V86 A;  4WWO A;  3ECI A;  2ZNV B;  4W9H A;  1V2Y A;  1P1A A;  5E6O A;  3CSF A;  2MRP A;  2IBI B;  1UBQ A;  2WDT B;  2LAS A;  2MP2 A;  1K8R B;  1T0Y A;  3TBL D;  3K9O B;  2LRW A;  2D10 A;  2GBM A;  2YVC A;  2ASQ A;  2PE6 B;  4BBN F;  1IP9 A;  3RUL A;  4ICV A;  2CS4 A;  4FJV B;  4W9D A;  3JYU A;  2KC2 A;  2WX0 A;  4MSM B;  1WXV A;  2RR9 A;  2ZCB A;  3R66 C;  2O6V B;  3UIN B;  1YQB A;  3SDL C;  1L2N A;  1XQQ A;  4FLH A;  2BKR B;  2N4F A;  4XZ4 A;  2DYO A;  2Z0E B;  4BKG A;  4DHZ E;  4II2 B;  3SHQ A;  1TGZ B;  2WWZ A;  3JSV B;  2HTH A;  1WM3 A;  2FCM A;  4G3X B;  4HPM B;  1JRU A;  5AEK B;  1WF9 A;  4A3P A;  2I1J A;  4HK2 A;  3QAQ A;  3DBL I;  1WYW B;  2N9X A;  5FR6 A;  3RD2 A;  3B1L X;  4E71 A;  3RZF A;  5DPW A;  4DK5 A;  3PLU A;  1H4R A;  3HK0 A;  4HDQ A;  4B6W A;  1GJZ A;  2KX3 A;  3L08 A;  3RYT A;  3VQI A;  1WJN A;  3UIP B;  2DAF A;  3BY4 B;  3QA8 A;  1WZ3 A;  5CX3 A;  4MEL A;  4GIV A;  2JRH A;  3QQ8 B;  2ZZP B;  3VH4 B;  2MBH A;  5C1Z A;  4XX5 A;  3ZNZ B;  3PRZ A;  3TCA A;  2KJR A;  2NPT A;  1J0G A;  4PS3 A;  2MA9 B;  3AXC A;  3VFK A;  2FID A;  1OGW A;  1YD8 U;  4II3 B;  3X23 A;  4IG7 B;  4GSW A;  2MW5 A;  1WGG A;  1EO6 A;  2ZPN A;  3AU5 A;  2VRR B;  3PRP B;  3R3M A;  4K1R B;  3TMP B;  4RMA A;  5DCN A;  1EF5 A;  2KD0 A;  3ALB A;  2NPT B;  1XT9 B;  2ZVN A;  4E74 A;  3DDC B;  4ASW C;  2KTR B;  4NJ7 A;  1KOT A;  1D3Z A;  5KHO A;  4FJZ A;  3RT3 B;  4IM3 A;  3ZLZ A;  4EOY A;  1GNU A;  3NHE B;  3RZW C;  1TTN A;  2M17 A;  2PJH A;  5L95 C;  2KLG A;  2BWE S;  3QJZ A;  2BF8 B;  5CTR C;  1QZE A;  2K8C A;  1WX9 A;  4KVG B;  4KIK B;  3QK0 A;  4HXD A;  3VHT C;  2M8S A;  1WH3 A;  3EC8 A;  1UEL A;  2LUE A;  3ML8 A;  1LXD A;  1V5O A;  3A9K A;  2CHX A;  4GDL A;  2AL6 A;  4PS7 A;  3H1U A;  3VH3 B;  3HHM A;  3H6N A;  3OAW A;  4AP4 C;  5JZE B;  3N32 A;  2JZ3 B;  2KAN A;  1P98 A;  3A33 B;  4ANV A;  2PPH A;  3P2B A;  1ZKH A;  3CST A;  1XD3 B;  4BFR A;  4KSL C;  2DYB A;  3A9K B;  4MM3 A;  3Q3J A;  2KOX A;  2D11 A;  4IW0 A;  2IY0 B;  4LDT B;  2KDF B;  4K7U A;  4MGZ E;  4GDL B;  3VTU A;  5JH5 C;  2DX5 B;  3DBR I;  3M95 A;  2J0M A;  4PYZ A;  3APD A;  2B3A A;  2OOB B;  3OJ4 B;  4KZC A;  2HE7 A;  1GG3 A;  2RSU A;  1BT0 A;  3JVZ X;  2L3Z A;  3EFU A;  3N30 A;  3B08 A;  4IM0 A;  3KUZ A;  1S1Q B;  5DPT A;  4BOZ B;  1J19 A;  5KHQ A;  2JF5 A;  3AUL A;  2JXX A;  2V4L A;  3PVL A;  1OQY A;  1V49 A;  4KZ0 A;  1YX5 B;  4P7I A;  1UBI A;  1OEY A;  4OVV A;  3UF8 A;  2AL3 A;  2DHZ A;  4XC2 A;  1NDD A;  4MGI E;  4NNJ B;  1Y8R C;  2K6D B;  1KLV A;  4DHJ B;  1OTR B;  5E6N A;  4WJN A;  3NOB A;  4JLC A;  1RRB A;  3R7R A;  4TKN A;  1EF1 A;  2RPQ A;  4A20 A;  4I6L B;  3SD5 A;  2K39 A;  2HD5 B;  4A3O A;  2KHW B;  5D7G A;  3WAO A;  2M4N A;  3W1S C;  2KMA A;  2G3Q B;  3KYC D;  4DHZ B;  4NY0 A;  2K1F A;  4GU2 A;  2LJ5 A;  3PGE A;  2R2Q A;  2LZ6 A;  1ZW7 A;  1AAR A;  2L0T A;  2O6V A;  1WX7 A;  2JY6 A;  4MJS A;  5J18 A;  5HKH A;  2N9P C;  4PS8 A;  1VCB A;  2D07 B;  3JSV A;  2JVC A;  4KV2 A;  3OLM D;  3H7P A;  2AYO B;  5CHV C;  1E5W A;  1RFA A;  2IY1 B; 
#chains in the Genus database with same CATH topology
 2QDF A;  2WXF A;  1HA5 A;  3ZDM C;  4XYC A;  1F2R I;  4S17 A;  1WXQ A;  2D5G A;  1WR6 E;  3X0W A;  3AEG B;  1ZXH A;  3H7P B;  3NZ3 A;  2G4D B;  4IDI A;  2LXC A;  2C7N B;  2AEH A;  2INP E;  4TQ1 A;  2KDE B;  1HTO A;  4PT5 A;  2NCN A;  1R4M I;  4L23 A;  2O6V D;  4NQK E;  2WGS A;  2PVG C;  1JWU D;  2KX0 A;  3MJ5 A;  2KDM A;  1ACC A;  1LFD A;  4ARC A;  3DWG C;  3VVW B;  4C4V A;  2O2V A;  1NYQ A;  4K81 A;  2QJL A;  4BKS A;  3IVF A;  1RAX A;  3QWZ B;  1WY8 A;  4HCN B;  1TKG A;  3IFW B;  1PQS A;  4K7W A;  5IA7 A;  2DEN B;  2O2V B;  3Q8E A;  2WDR B;  2AQ3 B;  1T0Q C;  3DBH B;  4WJP A;  1PFD A;  4M01 A;  1S3S G;  5IAA C;  1EWY C;  2MQJ A;  3KUC B;  1B9R A;  3IT6 B;  4A9A A;  2V3S A;  2YEP B;  4I6P A;  3ZYY X;  1YNT E;  1JWM D;  1CZP A;  3VXW A;  1GUA B;  1YX6 B;  2KDI A;  1L7Y A;  3PLV A;  2JT4 B;  5G55 A;  2ACZ B;  2LHE A;  1WGH A;  3QHT A;  3I5J C;  3HM3 A;  5EE9 A;  4MEM A;  1FRR A;  2RMM A;  2A5U A;  2BPS A;  2CR5 A;  3GB1 A;  1E9M A;  2ZEQ A;  4WWM A;  2L83 A;  3IAS 1;  1EUV B;  1YJ1 A;  2Y5C A;  3DBS A;  3WIM A;  3B0A A;  3TJP A;  3V62 A;  3M62 B;  5TR5 A;  3ETR A;  1XLP A;  3V6E B;  1IGC A;  3ZRC A;  1VRA B;  2L32 A;  3HUI A;  1P0R A;  1SIF A;  4AJY B;  4RGN A;  2INC C;  2GRI A;  1WXS A;  1IUE A;  2LGX A;  1WYG A;  2N1W A;  2IPK D;  2M0A A;  1WGY A;  3QX1 A;  1RM6 C;  4LNK A;  1HEZ E;  3PZD A;  2PIA A;  2LVP A;  2CKH B;  2WDV B;  3QCA A;  3QC8 B;  3ZTD A;  1L5P A;  3RPF C;  3ZJV A;  4HCP B;  2BYE A;  3FC4 A;  5BMH A;  3Q14 C;  2SEB D;  1WRD B;  4LJO B;  3AH7 A;  2N9K A;  3AE3 B;  4GOC A;  4DWF A;  1P7E A;  3U52 E;  4IUM B;  2LI5 A;  1IPG A;  4ITK A;  2HJ1 A;  3K9P B;  2N7D A;  1MHX A;  3VDZ A;  4B0M A;  2GI9 A;  1M94 A;  1E8Z A;  2GLS A;  2GOW A;  3DOW A;  2WXJ A;  2MHJ A;  3NS8 A;  3CIR B;  2KAC A;  2BYV E;  1LO5 D;  3U7D A;  2N1V A;  3PRM B;  4IC7 B;  4XWT A;  3LYY A;  2W54 A;  2KMC A;  3I57 A;  1HZ6 A;  1V6E A;  4NJ6 A;  1OFF A;  2X8X X;  5T8I A;  4KGR A;  3R7Q A;  3ZO5 B;  1NEK B;  4BKS D;  2K9X A;  3BYT B;  4RNA A;  3L16 A;  1FRD A;  4EZL A;  1MVK A;  2C9W B;  2PEA A;  2DZK A;  1SSN A;  2LD9 A;  3RUI B;  3NVV A;  2XK5 A;  2K8H A;  2LMC A;  4Q2J A;  1F2R C;  1D5M C;  1F9J A;  2KN4 A;  4FJY A;  3U7Z A;  1WGR A;  3ENE A;  3DQV A;  3ZIM A;  2IGD A;  4HVB A;  1I7H A;  2MJD A;  3AEA B;  3BIN A;  2JXT A;  2Z59 B;  4IWO A;  1WGK A;  4RM9 A;  2C7H A;  5FK9 C;  1RFK A;  4HPL B;  4TV3 A;  4F8C B;  4EEW A;  2N9L A;  3EA6 A;  2OJR A;  1L6U A;  3S2A A;  1V5T A;  3AE4 B;  1SGH A;  3RNG C;  1TS2 A;  2LGD A;  5H8Y E;  1IGD A;  3E56 A;  5D2M B;  4DXA B;  2M1M A;  1KRH A;  4W9E A;  1D5X C;  3L4P A;  4ANX A;  5IP4 D;  3ABV B;  3AEE B;  1V86 A;  2IGG A;  1JQ4 A;  5MPO A;  4W9H A;  1P1A A;  2LAS A;  3OG5 A;  1K8R B;  5IOI A;  2AQ2 B;  4M0W A;  3TBL D;  3K9O B;  2L52 A;  2ASQ A;  1TS3 A;  2CS4 A;  3EFC A;  3N1Y C;  3NVY A;  1E6E B;  3UIN B;  1L2N A;  1XQQ A;  2N4F A;  4XZ4 A;  3GZN B;  3SHQ A;  2WWZ A;  1WM3 A;  3DHG C;  4HPM B;  4HK2 A;  1AW7 A;  5AUI A;  5FKA C;  3QAQ A;  2FUG 1;  3DBL I;  1WYW B;  5FR6 A;  3AN1 A;  3SEB A;  4DK5 A;  4HDQ A;  2W3R A;  3L08 A;  1BML C;  2WXI A;  2BYT A;  3QA8 A;  4RF1 A;  4MEL A;  4RH6 A;  2ZZP B;  3VH4 B;  4USA A;  3PRZ A;  5C2T B;  3PZ7 A;  4S0R A;  2MA9 B;  2FID A;  2WXR A;  1YD8 U;  3X23 A;  4IG7 B;  3FIL A;  2MW5 A;  1EO6 A;  3AU5 A;  2VRR B;  5DCN A;  2LEK A;  1XT9 B;  1F52 A;  1D3Z A;  4FJZ A;  3RT3 B;  4IM3 A;  2H88 B;  1ENF A;  2M17 A;  2PJH A;  4US8 A;  3AE1 B;  2K8C A;  4J3O D;  4KVG B;  3QK0 A;  1R4M B;  4WH4 A;  2LUE A;  1LXD A;  2GB1 A;  3KWV A;  5IO9 A;  4GDL A;  2AL6 A;  2R61 A;  3CST A;  3Q69 A;  2D11 A;  4LDT B;  4C00 A;  4K7U A;  4GDL B;  5JH5 C;  4ARI A;  1MFW A;  2B3A A;  4KZC A;  5G5G A;  1S1Q B;  2NTS A;  2JF5 A;  3PVL A;  3MC9 A;  1UBI A;  1FFU A;  2AL3 A;  2DHZ A;  3N1X C;  1SJE D;  1KLV A;  1PYW D;  3VRA B;  4JLC A;  3R7R A;  4TKN A;  4CQN A;  4YXD B;  4JE3 B;  4A3O A;  3Q8B A;  2K22 A;  2X38 A;  4QAY A;  2JYT A;  2R2Q A;  2RDH A;  3FAH A;  2LZ6 A;  4RCO A;  2O6V A;  4N6E B;  1EU3 A;  3BII D;  2Z8L A;  2JVC A;  4KV2 A;  3OLM D;  3SR6 A;  1E5W A;  1VZ6 A;  1UWX A;  4M8M A;  2KFK A;  3RNF C;  1UF0 A;  1WGD A;  3P42 A;  2JX5 A;  1EU4 A;  3AU4 A;  3TEZ A;  4CHK A;  1C77 A;  2OJW A;  1V81 A;  3VUW A;  2KFK B;  4I6N B;  1TZ1 A;  2WU5 B;  1V9J A;  3Q3O C;  2L00 B;  3AE5 B;  2KZR A;  3AE7 B;  4EFO A;  1WR1 A;  4N59 A;  5GXG B;  3Q8A A;  4C80 A;  2W82 A;  5HFY A;  3ZNH B;  2KWD A;  2BB6 A;  3Q6B A;  4TSS A;  3MFG A;  4KIK A;  1L0Y B;  3PV1 A;  2J0K A;  3AM9 A;  1VDV A;  3ML9 A;  1C4C A;  5D6J B;  2IZV B;  3N1Z C;  3N9Y C;  2CU3 A;  4GMV A;  1P3Q U;  1LGR A;  2WP9 B;  5JXV A;  2WS3 B;  4DXG A;  2NMQ A;  4BOS C;  2EMS A;  4WWP A;  3J9C A;  5DPS A;  2LGS A;  2I1K A;  1F0Z A;  4BVU C;  4OVZ A;  3P4S B;  2G1E A;  1DOX A;  1J7C A;  1WJU A;  1TZO A;  4FN2 A;  4EZJ A;  1C1Y B;  2KXJ A;  5HHD G;  1A5R A;  4YL8 A;  1FCL A;  3GZN I;  4M8N A;  1LM8 B;  2GBN A;  2G4S A;  2KQS A;  2N7J A;  4WAA A;  2KKC A;  4LDT D;  1I42 A;  2MWS B;  3TIX A;  2ZCC A;  3SU8 X;  2KJH B;  1YMH E;  4A90 A;  5E6P A;  3PTF C;  4NAW B;  1Q1O A;  4ZYS A;  1XEE A;  2W55 A;  4YSY B;  4FBJ B;  2IO2 B;  2VH2 A;  2LXA A;  2BKF A;  2UWQ A;  1SE3 A;  2NBW B;  2G9H D;  4REZ A;  3W1Y A;  4GXB A;  4AS1 A;  4WWN A;  3H9D A;  2W9N A;  1Q0W B;  4BBN C;  3BVM A;  1WXM A;  1FXT B;  3KYD D;  1QOA A;  4FHJ A;  2FCN A;  4RGO S;  3TUO A;  2INN E;  2JPH A;  2J7Q B;  2ZNV C;  1K52 A;  2JSV X;  3CMM B;  5LLI A;  2FCQ A;  3RNE C;  4LJP B;  1N6Z A;  3HVD A;  1QF6 A;  1Z5S B;  3R2I A;  1PGX A;  5TSS A;  5CHF A;  1EWC A;  1IBX B;  4BAX A;  2MJ3 A;  2MLB A;  2IYD B;  1P9D U;  3TEY A;  1ZXI A;  5BYS A;  3PPA A;  4RM8 A;  2MBB B;  4LCD E;  3VUX A;  2IGH A;  2K8B A;  1I4R A;  3C0R B;  4F7Z A;  4CO7 A;  2V3N A;  2KLC A;  2LGI A;  1JWB D;  4TUU A;  1CMX B;  4MAC A;  3W2D A;  4NZL B;  2J4X A;  1WX8 A;  2WNM A;  4ZRI A;  3L17 A;  1GC6 A;  4W9K A;  4ANW A;  1TIF A;  1D4B A;  5C23 A;  2H89 B;  2OHF A;  1D6E C;  2B76 B;  1PUT A;  2IJ0 A;  3DBL B;  3W1S A;  3IAM 1;  3P4R B;  4WJO A;  4LK0 M;  1L4D B;  2Q5W D;  2REX A;  3KVF B;  2HTM E;  3N3K B;  3RMK C;  2MBO A;  4GDK A;  4ZOH C;  3AEC B;  1AYF A;  4FXC A;  1GAQ B;  1N5W A;  4GDK B;  3UI3 A;  1CK1 A;  3NVW A;  1GPX A;  2DNF A;  2PKO A;  4DHJ D;  1FCC C;  1PGB A;  2K0P A;  3A4R A;  2MSE D;  2MBQ A;  4OW0 A;  1VZ8 A;  2W3S A;  4L1B A;  3CWI A;  4ANU A;  3IHP C;  1QT9 A;  1Z2M A;  3AEF B;  4WWO A;  1ZPS A;  3ECI A;  2ZNV B;  5E6O A;  2WDT B;  2IBI B;  1XCQ L;  5BYR A;  2YVC A;  3RUL A;  2D3C A;  5BMG A;  2I38 A;  4MSM B;  2BW2 A;  2RR9 A;  1SF0 A;  3OWE B;  1TYG B;  1UUP A;  3JSV B;  1R4N B;  1TS5 A;  1WF9 A;  1J7A A;  5FR3 A;  1FD6 A;  3RD2 A;  3MP9 A;  1CJE A;  4E71 A;  3RZF A;  5DPW A;  4B6W A;  1H4R A;  2KX3 A;  1KLU D;  3RYT A;  4B0E A;  3QQ8 B;  3ZNZ B;  4YSX B;  3TCA A;  1ZDV A;  4II3 B;  1Y56 A;  3PRP B;  1WGG A;  4K1R B;  4YSZ B;  1EF5 A;  1FNV A;  3T3O A;  1K50 A;  2KTR B;  2PTL A;  5KHO A;  3ZLZ A;  1GNU A;  3P4P B;  2HDE A;  4DQO C;  3RZW C;  4K3B A;  5L95 C;  2V4I B;  4XWW A;  1WH3 A;  3ML8 A;  1V5O A;  2IND C;  4P6V F;  5EE1 A;  1ZOY B;  1L4Z B;  3H1U A;  4HEA 1;  3H6N A;  4AP4 C;  4BZA A;  5JZE B;  4UDU C;  1P98 A;  2PPH A;  1ZKH A;  2KT7 A;  2BQQ A;  4BFR A;  4MM3 A;  4C56 C;  1MJD A;  4MGZ E;  3VTU A;  3DBR I;  2J0M A;  4LLG M;  1WRI A;  4HKQ A;  2HE7 A;  4ZRQ A;  3NVZ A;  3JVZ X;  2L3Z A;  2RPV A;  2WXQ A;  5DPT A;  1J19 A;  4MM3 B;  1VLB A;  3AUL A;  1FFV A;  4OVV A;  4KZ0 A;  1YX5 B;  1OEY A;  3UF8 A;  1PGA A;  2M19 A;  4MGI E;  5E6N A;  2QSD A;  1I4X A;  1DYQ A;  4A20 A;  1E7P B;  2BT6 A;  2K39 A;  2HD5 B;  5D7G A;  1FXI A;  2M4N A;  1HQR D;  2KMA A;  1HZ5 A;  4GU2 A;  3NJT A;  4MT5 A;  4MJS A;  5HKH A;  3V3X A;  4PS8 A;  1VCB A;  2D07 B;  2IY1 B;  1C3T A;  5BMI A;  4MJS B;  1TY0 A;  1IYF A;  2LVO A;  1E8X A;  2GBJ A;  3PHW B;  1E0Z A;  1SXT A;  4HPP A;  1ZDX A;  1WE7 A;  1KJT A;  3NY5 A;  4B95 A;  1YN3 A;  1OEY J;  1Q5W B;  5JHB A;  4A8X C;  3Q3N C;  1GC7 A;  1N61 A;  4BKT A;  2L0F A;  2JU6 X;  4AWJ A;  4KGT A;  4RGT A;  4TQ0 A;  1T6B X;  2PE9 A;  3TEX A;  4URK A;  3HM6 X;  3V61 A;  1AN8 A;  2N9E B;  4PK1 A;  2RDB C;  1VD2 A;  2NBV B;  1QQR A;  1SE9 A;  4O1N A;  3R2T A;  3O13 A;  2RGF A;  3EEC A;  4B9K A;  1FMA D;  3DCG A;  4W9J A;  1ET6 A;  3AE8 B;  1KLG D;  2DZI A;  2KYW A;  1NBF C;  3ZXV A;  3NS1 A;  3ZUN A;  5IKC M;  3EGR A;  4IWP A;  3WAP A;  3MTN B;  4YTP B;  1TT5 B;  1AWD A;  4IOI E;  3P63 A;  2NR2 A;  4W9C A;  3IG3 A;  4X57 B;  4ACF A;  2GMI C;  4IWQ A;  4DBG A;  1WIA A;  1FPY A;  3GOE A;  2LWP A;  3RCZ A;  1MHH E;  3W9C B;  5I4D A;  4AUQ C;  4AQ7 A;  4RFB A;  3DVN V;  1FIQ A;  2YEP F;  1ET9 A;  1WZ0 A;  2D3B A;  4XDD A;  1MG8 A;  3A9J B;  1UGM A;  4GN1 A;  4DDG D;  3KQ4 A;  1L0V B;  4OVU A;  1R4N I;  1N63 A;  1LQB A;  2KN5 A;  2XEW A;  4J6I A;  3ZJU A;  2CU1 A;  3M3J A;  4YWG G;  3DVN U;  4DXF A;  1HE8 A;  5GMV A;  2L76 A;  3VR8 B;  1YN5 A;  3N20 C;  3NUH B;  3UGB B;  1XXG A;  3A4S C;  1V1O A;  1V97 A;  4WJQ A;  3MHS D;  4M02 A;  3VTW A;  4EUT A;  2AWT A;  2DZM A;  1FM0 D;  2MCN B;  2Y3A A;  2KWV B;  4W9I A;  4ZHO A;  1UGJ A;  4US9 A;  2D3A A;  4EE2 A;  2BYF A;  2KC1 A;  1J8C A;  2J52 A;  3AE6 B;  2NS5 A;  5D94 A;  2ZVO A;  4HWI B;  1TJE A;  3OJ3 A;  1KM7 A;  1WI0 A;  3DHH C;  2LUM A;  1Q10 A;  2KNB A;  2MX2 A;  2Y5B B;  1V80 A;  3DHI C;  4HRO A;  3C19 A;  4KDI C;  4L2Y A;  1OQR A;  2KTF A;  4KGS A;  4MH0 E;  4WQO B;  4NQL B;  2N0S B;  1ROE A;  2MP2 B;  5AZH A;  4FUL A;  5BO4 B;  2V1Y A;  1RLF A;  3BVZ A;  3EHV A;  1JRP A;  2KK8 A;  2Z0D B;  2WHI A;  3B9J A;  3P1M A;  2KMM A;  3ZNG C;  2R2O A;  3Q3M C;  1WE6 A;  1VZ7 A;  3GP7 A;  4LTU A;  2NBU A;  1NYR A;  2DZJ A;  1E90 A;  4NJC A;  5JHA A;  4RF0 A;  2A4Z A;  1UH6 A;  2PMV A;  1T0S C;  4OZA A;  4RGM A;  4KKJ A;  3H7S A;  2AX5 A;  1T5X D;  2XBB C;  2VH1 A;  3L54 A;  3LJ3 A;  4JPS A;  3PHX B;  2J0J A;  2KAJ A;  1KTK A;  2ON8 A;  4DDI D;  2KDB A;  1WFY A;  1TY2 A;  1WJ6 A;  1WM2 A;  4G0N B;  5E6J A;  3ZGZ A;  2KO3 A;  3AE2 B;  2ZPY A;  2LGY A;  3KW5 B;  4EZK A;  2BBC A;  1D5Z C;  3KUD B;  3BK2 A;  3NRZ A;  2LRU A;  4CYE A;  3I63 C;  2XN9 C;  3M63 B;  4GLS C;  3BZD B;  1UZX B;  4NAW A;  2BTE A;  3ZVV A;  1JRO A;  1E8Y A;  5LNK 1;  1T0R C;  2L1A A;  4JL9 A;  2UYZ B;  3APF A;  1C4A A;  3HIZ A;  1I4Q A;  2HJ8 A;  3MHZ A;  1C9F A;  4K7S A;  1XLQ A;  3AED B;  3L13 A;  4OHJ A;  1RYJ A;  1JML A;  2JRI B;  3RN9 C;  2BGF A;  2WLB A;  3LB8 C;  2JZZ A;  4ZYN A;  1V8C A;  5IN7 A;  2DBY A;  3ZW3 A;  3AMZ A;  1R7S A;  4W9L A;  2LHD A;  3PRE A;  3WAM A;  5G5H A;  4N9F 4;  3UIO B;  1JWS D;  4KX6 B;  3CSF A;  1UBQ A;  2WDQ B;  4MH8 A;  2GBM A;  2UU7 A;  1QIL A;  4FJV B;  1VJK A;  2IDY A;  4W9D A;  3GE8 C;  3JYU A;  1MG4 A;  2WX0 A;  1OQQ A;  3DBR B;  1WXV A;  1V1P B;  1IBX A;  1YQB A;  3SDL C;  4FLH A;  1FNU A;  4DHZ E;  2CJN A;  2DYO A;  1MI0 A;  1M4V A;  2QCZ A;  2BVC A;  2HTH A;  1RWS A;  2FCM A;  4G3X B;  3SFD B;  5AEK B;  4KKI A;  4A3P A;  2I1J A;  2BS2 B;  2BS3 B;  2BB5 A;  2N9X A;  3B1L X;  1HTQ A;  1C4P A;  3UIP B;  4XDC A;  3BY4 B;  3GS2 A;  1UWM A;  1WZ3 A;  5CX3 A;  2JRH A;  1TKE A;  5C1Z A;  4XX5 A;  2NTT A;  3R8B A;  1J0G A;  4PS3 A;  3AXC A;  1OGW A;  2LJI A;  3R3M A;  2ZPN A;  1C78 A;  4C4V B;  4RMA A;  5C3J B;  2KD0 A;  4P1C C;  2M56 B;  3ALB A;  4E74 A;  4ASW C;  4NJ7 A;  3Q8F A;  2QIE B;  3AEB B;  4EOY A;  3NHE B;  2RDG A;  1XF5 L;  2BWE S;  3QJZ A;  2ONQ A;  5CTR C;  1QZE A;  1YJI A;  4LNF A;  4HXD A;  2M8S A;  1CQV A;  3EC8 A;  3A9K A;  2EKI A;  1YQ4 B;  2V9H A;  1I4G A;  4WQM A;  3N32 A;  2JZ3 B;  1YQ3 B;  4OZC A;  1FNW A;  4ANV A;  1XD3 B;  4KSL C;  3A9K B;  3Q3J A;  2IY0 B;  2KDF B;  2DX5 B;  3Q8C A;  5EE3 A;  3APD A;  2OOB B;  1I4P A;  3N30 A;  3EFU A;  4IM0 A;  3B08 A;  4BOZ B;  5AUK A;  4P16 A;  2JXX A;  1OQY A;  1V49 A;  3TEW A;  2PVO D;  1NDD A;  4NNJ B;  1TS4 A;  1Y8R C;  2K6D B;  2WXH A;  4WJN A;  4H2A A;  4C7Y A;  1QLB B;  1EF1 A;  5BYQ A;  2KHW B;  3WAO A;  1YOV B;  2G3Q B;  3KYC D;  4DHZ B;  4NY0 A;  1C76 A;  1FO4 A;  1ZW7 A;  1AAR A;  1WX7 A;  2JY6 A;  3FKY A;  4K3C A;  2N9P C;  4WIP A;  3RNA C;  2E3T A;  1N62 A;  3JSV A;  2AYO B;  1RFA A;  1BUI C;  4W9F A;  1GOZ A;  1XLO A;  2QHO A;  3MJW A;  4ZRP A;  4C7Z A;  4FA6 A;  2J42 A;  1YN4 A;  2I2Y A;  4AJW A;  2FUH B;  1WXA A;  1UD7 A;  3L0W B;  3BYY B;  2V0G A;  5LXH A;  2VZK B;  2BWF A;  3KH0 A;  2GBR A;  3ZKJ C;  2QMT A;  4NPN A;  2YLM A;  4JQW C;  2KWC A;  4D2K A;  4EKU A;  3T9L A;  4F1S A;  5AZF A;  4JWU C;  2D2Q A;  2WXG A;  4OZB A;  2KTR A;  4GGQ A;  3PO0 A;  4KDL B;  4JWS C;  3WA0 A;  3ZJT A;  4E3C A;  2EMT A;  3DPD A;  1ISN A;  1FXA A;  3V60 A;  1NI2 A;  1X1M A;  2FAZ A;  1VR9 A;  4FAD A;  1SJH D;  2EEL A;  3BWU D;  1TKY A;  2DLB A;  2WX1 A;  3D32 A;  4HKZ E;  3ONS A;  2IO1 B;  4G11 A;  3ZXR A;  2BS4 B;  1WWT A;  5G2N A;  3PT2 B;  3ZTC A;  3IBE A;  4ICU A;  2WXO A;  1ZGU B;  2MJE A;  1HXY D;  1K53 A;  4MGY E;  4FHK A;  2K25 A;  1BXT A;  1WSP A;  4ZRJ A;  1A70 A;  4MSQ B;  2ICI A;  2KWU B;  2C5L C;  1DGJ A;  4IM2 A;  3U30 A;  4G50 A;  3PS6 A;  4W9G A;  2QEJ C;  2XK5 B;  2FNJ B;  3DVG Y;  3QAR A;  3PSE B;  4GB9 A;  3I9V 1;  2WXP A;  3Q3F A;  5HI1 A;  2CHW A;  2G45 B;  3WCQ A;  2LVQ A;  3I3T B;  1P7F A;  3C8Y A;  1KH0 A;  2TSS A;  2K6Q A;  1WMH A;  1STE A;  4NAM A;  1H8C A;  3L10 B;  3CF6 E;  5H92 C;  2WXL A;  5CHW A;  4N58 A;  3RI7 C;  1TBE A;  2FCS A;  2RD0 A;  3WAN A;  4JGH B;  1IP9 A;  3A1Q A;  2ZJD A;  5J17 A;  3TL5 A;  1MPE A;  3DBH I;  1WMH B;  3EUB 2;  1XCT L;  3BVG A;  4HJK A;  3JW0 X;  4HDO A;  4M00 A;  3VTV A;  2IO3 B;  1QOF A;  3O65 B;  3GE3 C;  3A1Q B;  1SBB B;  2IO0 B;  1L6V A;  3AV8 A;  2KJ6 A;  3Q2A C;  2L05 A;  2M0X A;  3T3N A;  3BK1 A;  3UQA A;  2DWQ A;  1JAL A;  2CHZ A;  4PYU A;  2L8J A;  4ZRK A;  1SEB D;  4M0W B;  4YT0 B;  3VR9 B;  3NZU A;  1E10 A;  3NG0 A;  2GBK A;  2FBW B;  1C79 A;  2VZK D;  4A55 A;  1U4A A;  2ZW1 A;  3IT4 B;  2QC8 A;  1I35 A;  4ZHP A;  1E7U A;  3DVG X;  1DOY A;  4YTM B;  5DPR A;  3MC8 A;  3AI5 A;  3KLS X;  4HJG E;  2FIF A;  4MDK E;  1JWA D;  5L83 A;  1E8W A;  1KFY B;  2XNA C;  3ZDT A;  5AZG A;  3T8M A;  2JWZ A;  3VAW A;  4IKG A;  3UQB A;  3MC0 B;  3VUY A;  3NZS A;  4KSK C;  3V05 A;  3APC A;  3LDZ E;  4WUR A;  2DAJ A;  2MEK A;  3A9J A;  4MGK E;  2SAK A;  2PW9 A;  3FIL B;  2L7R A;  3ZRF A;  2E6X A;  2JUO A;  2EKE C;  3QIJ A;  1SB3 C;  3V6C B;  3W5U B;  1JW9 D;  3U8Z A;  1NEN B;  4A6Q A;  3LXF A;  5LXI B;  1EM7 A;  3WAL A;  5EDS A;  4P1B C;  5J2R A;  2K5P A;  1QKZ A;  2D3G A;  1F77 A;  3B2F A;  2NVU I;  2WU2 B;  3ZNI D;  4ZDV A;  1XLN A;  2KQ7 A;  2N7E A;  3KWL A;  2C7M B;  2WYQ A;  1N5X A;  4HLE A;  2J53 A;  4LNO A;  1G6J A;  2ZW0 A;  3IXS A;  4XE0 A;  1E7V A;  4JIO U;  1WJ4 A;  1SE4 A;  2KFJ A;  3U2S C;  2JQR B;  2Y5P A;  4YTN B;  2DYM A;  2C60 A;  2MBE A;  1YIW A;  3TSS A;  2KVR A;  2KQ4 X;  2KVZ A;  2FE8 A;  3AB5 A;  3RFZ B;  1V2Y A;  2MRP A;  2MP2 A;  1K51 A;  1T0Y A;  2MH7 A;  2QIL A;  1KF6 B;  2LRW A;  2D10 A;  2PE6 B;  4BBN F;  4ICV A;  2KC2 A;  1DOI A;  4LNN A;  1J7B A;  1QOB A;  5D3I B;  1NI3 A;  2ZCB A;  3R66 C;  3E9S A;  2O6V B;  2BKR B;  2Z0E B;  4BKG A;  4II2 B;  1TGZ B;  1NVI D;  5HG2 A;  1JRU A;  3PLU A;  3HK0 A;  1GJZ A;  3VQI A;  3PZ8 A;  1WJN A;  2DAF A;  3W5V B;  1GB4 A;  1QOG A;  2V3P A;  4GIV A;  2MBH A;  3SFE B;  4HRS A;  2KJR A;  2NPT A;  2JWU A;  3ZQ4 A;  3VFK A;  2LFI A;  1ESF A;  1JCK B;  1L0X B;  1GB1 A;  4GSW A;  4AOF A;  2JYE A;  3TMP B;  5EE0 A;  3HVZ A;  3H8H A;  2AQ1 B;  2NPT B;  2WQY B;  2ZVN A;  3DDC B;  2CJO A;  1T3Q A;  1KOT A;  4R3D A;  4XGA B;  1TTN A;  2JZP A;  2KLG A;  1PDX A;  1N60 A;  2BF8 B;  3DWM A;  1WX9 A;  4KIK B;  3VHT C;  3URY A;  1UEL A;  2CHX A;  2WXK A;  4PS7 A;  3VRB B;  3VH3 B;  3HHM A;  3OAW A;  3HRD D;  2KAN A;  3A33 B;  3P2B A;  2OED A;  2DYB A;  1UNS A;  2KOX A;  4IW0 A;  3P4Q B;  3U4E G;  3M95 A;  3RNB C;  4PYZ A;  3OJ4 B;  1GG3 A;  2RSU A;  1BT0 A;  3KUZ A;  4JX1 C;  5KHQ A;  2WXM A;  2V4L A;  1B1Z A;  4P7I A;  4XC2 A;  4DHJ B;  1OTR B;  1XO3 A;  3NOB A;  3AE9 B;  1RRB A;  2RPQ A;  1ZUD 2;  4I6L B;  5D3D A;  1SE2 A;  3SD5 A;  4LNI A;  3W1S C;  1F1H A;  4TMA B;  2K1F A;  2LJ5 A;  2WXN A;  3PGE A;  1YJJ A;  3RNC C;  1ZE3 D;  2PLP A;  2L0T A;  5J18 A;  1V1P A;  1ZP0 B;  1FEH A;  2K3U A;  4WAF A;  1SIJ A;  3B2G A;  1I4H A;  3H7P A;  5CHV C; 
#chains in the Genus database with same CATH homology
 4M8M A;  1C3T A;  2KFK A;  4W9F A;  4MJS B;  1IYF A;  3ZDM C;  2QHO A;  1WGD A;  3MJW A;  4FA6 A;  2LVO A;  3AU4 A;  1E8X A;  2GBJ A;  4CHK A;  3PHW B;  4AJW A;  2FUH B;  1WR6 E;  1WXA A;  3X0W A;  1UD7 A;  3H7P B;  3L0W B;  1WE7 A;  1KJT A;  3NY5 A;  2G4D B;  1V81 A;  4B95 A;  3VUW A;  2LXC A;  2C7N B;  2KFK B;  2AEH A;  5LXH A;  4TQ1 A;  4I6N B;  2KDE B;  1OEY J;  1Q5W B;  5JHB A;  2NCN A;  1R4M I;  2BWF A;  3KH0 A;  2GBR A;  2O6V D;  4NQK E;  3ZKJ C;  1GC7 A;  1TZ1 A;  4BKT A;  2KX0 A;  2L0F A;  4NPN A;  4AWJ A;  1LFD A;  2YLM A;  4JQW C;  2KWC A;  4EKU A;  1V9J A;  3T9L A;  3VVW B;  4TQ0 A;  4F1S A;  2O2V A;  2L00 B;  2PE9 A;  4K81 A;  5AZF A;  2KZR A;  4BKS A;  3IVF A;  1RAX A;  3QWZ B;  4URK A;  3HM6 X;  2D2Q A;  3V61 A;  2N9E B;  2KTR A;  1WY8 A;  4EFO A;  1WR1 A;  4HCN B;  4GGQ A;  3IFW B;  1VD2 A;  1PQS A;  2NBV B;  4K7W A;  1SE9 A;  4KDL B;  5IA7 A;  3WA0 A;  2RGF A;  3EEC A;  2DEN B;  2O2V B;  3ZNH B;  4B9K A;  3DCG A;  4W9J A;  4WJP A;  4E3C A;  2EMT A;  3DPD A;  2DZI A;  4KIK A;  3PV1 A;  1S3S G;  2J0K A;  3ML9 A;  1ISN A;  5IAA C;  3V60 A;  1NBF C;  1NI2 A;  1X1M A;  5D6J B;  2FAZ A;  3ZUN A;  2MQJ A;  4FAD A;  2IZV B;  3KUC B;  4IWP A;  3WAP A;  2V3S A;  4I6P A;  3MTN B;  2WX1 A;  3D32 A;  3ONS A;  4GMV A;  1P3Q U;  2IO1 B;  2NR2 A;  4W9C A;  3IG3 A;  4G11 A;  4X57 B;  3VXW A;  1GUA B;  5G2N A;  1YX6 B;  2GMI C;  3PT2 B;  3ZTC A;  4IWQ A;  2KDI A;  3IBE A;  1L7Y A;  3PLV A;  1ZGU B;  4ICU A;  4BOS C;  4DBG A;  1WIA A;  4AOF A;  2JT4 B;  3GOE A;  2EMS A;  2LWP A;  4WWP A;  5G55 A;  3RCZ A;  5DPS A;  4MGY E;  2I1K A;  4AUQ C;  1WGH A;  2K25 A;  3DVN V;  4FHK A;  3QHT A;  4BVU C;  1WZ0 A;  3HM3 A;  4ZRJ A;  4MEM A;  1WJU A;  2A5U A;  4MSQ B;  2BPS A;  2CR5 A;  4FN2 A;  1MG8 A;  3A9J B;  2KWU B;  2C5L C;  4EZJ A;  1C1Y B;  2KXJ A;  1UGM A;  2ZEQ A;  4GN1 A;  1A5R A;  4YL8 A;  4IM2 A;  4DDG D;  3GZN I;  4M8N A;  4OVU A;  3U30 A;  1LM8 B;  4G50 A;  3PS6 A;  1EUV B;  2GBN A;  1R4N I;  4W9G A;  1YJ1 A;  2G4S A;  1LQB A;  2KN5 A;  2XEW A;  4J6I A;  2XK5 B;  2KQS A;  2CU1 A;  4WAA A;  3M3J A;  2FNJ B;  3DBS A;  2KKC A;  3DVG Y;  4LDT D;  3QAR A;  3WIM A;  1I42 A;  3PSE B;  3B0A A;  4GB9 A;  3TJP A;  3V62 A;  3M62 B;  5TR5 A;  2MWS B;  3DVN U;  3TIX A;  3V6E B;  1HE8 A;  2ZCC A;  3SU8 X;  3Q3F A;  5GMV A;  3ZRC A;  2KJH B;  2CHW A;  2L76 A;  2G45 B;  1P0R A;  5E6P A;  3PTF C;  1SIF A;  4NAW B;  3UGB B;  3A4S C;  4AJY B;  1Q1O A;  2LVQ A;  1J8C A;  4WJQ A;  3MHS D;  3I3T B;  1WXS A;  3VTW A;  2K6Q A;  2LGX A;  2AWT A;  4EUT A;  2N1W A;  4FBJ B;  1WMH A;  2DZM A;  2IO2 B;  1H8C A;  2LXA A;  2MCN B;  2KWV B;  4W9I A;  2BKF A;  2UWQ A;  3L10 B;  1WGY A;  3CF6 E;  2NBW B;  3QX1 A;  5CHW A;  3W1Y A;  4GXB A;  3PZD A;  1TBE A;  2FCS A;  2LVP A;  2CKH B;  2RD0 A;  3QCA A;  3QC8 B;  2BYF A;  4JGH B;  2KC1 A;  3A1Q A;  2ZJD A;  3H9D A;  4WWN A;  3TL5 A;  3WAN A;  3ZTD A;  3DBH I;  1WMH B;  5J17 A;  2NS5 A;  5D94 A;  2ZVO A;  2W9N A;  4HWI B;  4HJK A;  4HCP B;  2BYE A;  1Q0W B;  4BBN C;  3JW0 X;  4HDO A;  1WXM A;  3OJ3 A;  1KM7 A;  1WI0 A;  1FXT B;  1WRD B;  3KYD D;  2IO3 B;  3VTV A;  4FHJ A;  3O65 B;  2KNB A;  4LJO B;  2MX2 A;  2Y5B B;  1V80 A;  3A1Q B;  2FCN A;  2IO0 B;  2KJ6 A;  2L05 A;  2M0X A;  4KDI C;  2JPH A;  3UQA A;  2KTF A;  2J7Q B;  2ZNV C;  4GOC A;  4MH0 E;  4DWF A;  3CMM B;  4WQO B;  4NQL B;  2CHZ A;  4PYU A;  2L8J A;  2LI5 A;  1IPG A;  2FCQ A;  2MP2 B;  4IUM B;  4M0W B;  4FUL A;  4ZRK A;  5AZH A;  5LLI A;  4LJP B;  3K9P B;  5BO4 B;  2V1Y A;  1RLF A;  3NZU A;  2N7D A;  2GBK A;  3VDZ A;  3EHV A;  1Z5S B;  1M94 A;  1E8Z A;  1U4A A;  2GOW A;  2KK8 A;  5CHF A;  2Z0D B;  3DOW A;  3NS8 A;  1I35 A;  2BYV E;  3ZNG C;  3U7D A;  2R2O A;  2N1V A;  3PRM B;  4IC7 B;  1E7U A;  1WE6 A;  3DVG X;  2MLB A;  2NBU A;  5DPR A;  2DZJ A;  1E90 A;  2IYD B;  3AI5 A;  5JHA A;  1P9D U;  2A4Z A;  1UH6 A;  3PPA A;  2KMC A;  4RM8 A;  2FIF A;  4MDK E;  2MBB B;  4LCD E;  3VUX A;  1V6E A;  4NJ6 A;  2K8B A;  3H7S A;  5L83 A;  1E8W A;  3R7Q A;  3C0R B;  5AZG A;  3ZDT A;  3T8M A;  3ZO5 B;  2JWZ A;  4F7Z A;  2XBB C;  3VAW A;  4CO7 A;  4BKS D;  3UQB A;  2KLC A;  3VUY A;  3L54 A;  3NZS A;  4KSK C;  3LJ3 A;  3PHX B;  4TUU A;  2J0J A;  3APC A;  1CMX B;  3LDZ E;  3L16 A;  4EZL A;  2C9W B;  2PEA A;  2DZK A;  4DDI D;  2DAJ A;  2KDB A;  1WFY A;  3A9J A;  4MGK E;  1WJ6 A;  1WX8 A;  1WM2 A;  4ZRI A;  3L17 A;  2L7R A;  1GC6 A;  2LD9 A;  4W9K A;  3ZRF A;  4G0N B;  2JUO A;  3QIJ A;  2EKE C;  4ANW A;  3RUI B;  3V6C B;  5C23 A;  2KO3 A;  2XK5 A;  2ZPY A;  3U8Z A;  2K8H A;  2LGY A;  3KW5 B;  1F9J A;  4FJY A;  4EZK A;  3W1S A;  5LXI B;  1WGR A;  4WJO A;  3KUD B;  2REX A;  3ENE A;  3DQV A;  3KVF B;  2LRU A;  3ZIM A;  3WAL A;  4CYE A;  5EDS A;  3M63 B;  3N3K B;  4HVB A;  5J2R A;  2MBO A;  1UZX B;  4NAW A;  2D3G A;  3BIN A;  4GDK A;  3ZVV A;  2Z59 B;  4IWO A;  2NVU I;  3ZNI D;  1E8Y A;  2C7H A;  4RM9 A;  4ZDV A;  2KQ7 A;  4JL9 A;  2UYZ B;  2N7E A;  4HPL B;  4TV3 A;  2C7M B;  2WYQ A;  3APF A;  3HIZ A;  4EEW A;  4F8C B;  4HLE A;  2HJ8 A;  2OJR A;  4GDK B;  4K7S A;  3S2A A;  1G6J A;  1V5T A;  3L13 A;  1SGH A;  1E7V A;  2JRI B;  4DHJ D;  4JIO U;  1WJ4 A;  2KFJ A;  2BGF A;  2LGD A;  3A4R A;  2JZZ A;  4ZYN A;  2MSE D;  2MBQ A;  5D2M B;  4DXA B;  2DYM A;  2C60 A;  2M1M A;  2MBE A;  3ZW3 A;  4W9E A;  1YIW A;  4W9L A;  4ANU A;  4ANX A;  3PRE A;  3WAM A;  3IHP C;  2KVR A;  1Z2M A;  4N9F 4;  3UIO B;  1V86 A;  4WWO A;  3ECI A;  2ZNV B;  4W9H A;  1V2Y A;  1P1A A;  5E6O A;  3CSF A;  2MRP A;  2IBI B;  1UBQ A;  2WDT B;  2LAS A;  2MP2 A;  1K8R B;  1T0Y A;  3TBL D;  3K9O B;  2LRW A;  2D10 A;  2GBM A;  2YVC A;  2ASQ A;  2PE6 B;  4BBN F;  1IP9 A;  3RUL A;  4ICV A;  2CS4 A;  4FJV B;  4W9D A;  3JYU A;  2KC2 A;  2WX0 A;  4MSM B;  1WXV A;  2RR9 A;  2ZCB A;  3R66 C;  2O6V B;  3UIN B;  1YQB A;  3SDL C;  1L2N A;  1XQQ A;  4FLH A;  2BKR B;  2N4F A;  4XZ4 A;  2DYO A;  2Z0E B;  4BKG A;  4DHZ E;  4II2 B;  3SHQ A;  1TGZ B;  2WWZ A;  3JSV B;  2HTH A;  1WM3 A;  2FCM A;  4G3X B;  4HPM B;  1JRU A;  5AEK B;  1WF9 A;  4A3P A;  2I1J A;  4HK2 A;  3QAQ A;  3DBL I;  1WYW B;  2N9X A;  5FR6 A;  3RD2 A;  3B1L X;  4E71 A;  3RZF A;  5DPW A;  4DK5 A;  3PLU A;  1H4R A;  3HK0 A;  4HDQ A;  4B6W A;  1GJZ A;  2KX3 A;  3L08 A;  3RYT A;  3VQI A;  1WJN A;  3UIP B;  2DAF A;  3BY4 B;  3QA8 A;  1WZ3 A;  5CX3 A;  4MEL A;  4GIV A;  2JRH A;  3QQ8 B;  2ZZP B;  3VH4 B;  2MBH A;  5C1Z A;  4XX5 A;  3ZNZ B;  3PRZ A;  3TCA A;  2KJR A;  2NPT A;  1J0G A;  4PS3 A;  2MA9 B;  3AXC A;  3VFK A;  2FID A;  1OGW A;  1YD8 U;  4II3 B;  3X23 A;  4IG7 B;  4GSW A;  2MW5 A;  1WGG A;  1EO6 A;  2ZPN A;  3AU5 A;  2VRR B;  3PRP B;  3R3M A;  4K1R B;  3TMP B;  4RMA A;  5DCN A;  1EF5 A;  2KD0 A;  3ALB A;  2NPT B;  1XT9 B;  2ZVN A;  4E74 A;  3DDC B;  4ASW C;  2KTR B;  4NJ7 A;  1KOT A;  1D3Z A;  5KHO A;  4FJZ A;  3RT3 B;  4IM3 A;  3ZLZ A;  4EOY A;  1GNU A;  3NHE B;  3RZW C;  1TTN A;  2M17 A;  2PJH A;  5L95 C;  2KLG A;  2BWE S;  3QJZ A;  2BF8 B;  5CTR C;  1QZE A;  2K8C A;  1WX9 A;  4KVG B;  4KIK B;  3QK0 A;  4HXD A;  3VHT C;  2M8S A;  1WH3 A;  3EC8 A;  1UEL A;  2LUE A;  3ML8 A;  1LXD A;  1V5O A;  3A9K A;  2CHX A;  4GDL A;  2AL6 A;  4PS7 A;  3H1U A;  3VH3 B;  3HHM A;  3H6N A;  3OAW A;  4AP4 C;  5JZE B;  3N32 A;  2JZ3 B;  2KAN A;  1P98 A;  3A33 B;  4ANV A;  2PPH A;  3P2B A;  1ZKH A;  3CST A;  1XD3 B;  4BFR A;  4KSL C;  2DYB A;  3A9K B;  4MM3 A;  3Q3J A;  2KOX A;  2D11 A;  4IW0 A;  2IY0 B;  4LDT B;  2KDF B;  4K7U A;  4MGZ E;  4GDL B;  3VTU A;  5JH5 C;  2DX5 B;  3DBR I;  3M95 A;  2J0M A;  4PYZ A;  3APD A;  2B3A A;  2OOB B;  3OJ4 B;  4KZC A;  2HE7 A;  1GG3 A;  2RSU A;  1BT0 A;  3JVZ X;  2L3Z A;  3EFU A;  3N30 A;  3B08 A;  4IM0 A;  3KUZ A;  1S1Q B;  5DPT A;  4BOZ B;  1J19 A;  5KHQ A;  2JF5 A;  3AUL A;  2JXX A;  2V4L A;  3PVL A;  1OQY A;  1V49 A;  4KZ0 A;  1YX5 B;  4P7I A;  1UBI A;  1OEY A;  4OVV A;  3UF8 A;  2AL3 A;  2DHZ A;  4XC2 A;  1NDD A;  4MGI E;  4NNJ B;  1Y8R C;  2K6D B;  1KLV A;  4DHJ B;  1OTR B;  5E6N A;  4WJN A;  3NOB A;  4JLC A;  1RRB A;  3R7R A;  4TKN A;  1EF1 A;  2RPQ A;  4A20 A;  4I6L B;  3SD5 A;  2K39 A;  2HD5 B;  4A3O A;  2KHW B;  5D7G A;  3WAO A;  2M4N A;  3W1S C;  2KMA A;  2G3Q B;  3KYC D;  4DHZ B;  4NY0 A;  2K1F A;  4GU2 A;  2LJ5 A;  3PGE A;  2R2Q A;  2LZ6 A;  1ZW7 A;  1AAR A;  2L0T A;  2O6V A;  1WX7 A;  2JY6 A;  4MJS A;  5J18 A;  5HKH A;  2N9P C;  4PS8 A;  1VCB A;  2D07 B;  3JSV A;  2JVC A;  4KV2 A;  3OLM D;  3H7P A;  2AYO B;  5CHV C;  1E5W A;  1RFA A;  2IY1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...