2KMCA

Solution structure of the n-terminal domain of kindlin-1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GIDPFTMLSSGDLTSASWELVVRVDHANGEQQTEITLRVSGDLHIGGVMLKLVEQMNIAQDWSDYALWWEQKRCWLLKTHWTLDKCGVQADANLLFTPQHKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the N-Terminus of Kindlin-1: A Domain Important for alphaIIbbeta3 Integrin Activation
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Fermitin family homolog 1
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18124 Kindlin_2_N Kindlin-2 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmcA00
2KWCA 4ICVA 1WFYA 1MG8A 2XK5A 4W9CA 3W1YA 5DPWA 4K7UA 2ZPNA 4I6NB 3N30A 1LXDA 2JT4B 3W1SC 4FJYA 1KJTA 1RAXA 1EO6A 2M17A 2XBBC 3B08A 2QHOA 3HM6X 3R3MA 2MCNB 2NPTB 3VVWB 2L3ZA 2MW5A 3KUCB 4KV2A 3ZNZB 1J0GA 2FNJB 5C23A 4ZDVA 4M8NA 4W9EA 1V6EA 4G3XB 2JZ3B 5KHQA 4DHZB 1R4MI 4EZJA 2D3GA 2KD0A 4G11A 2NVUI 4EOYA 2D10A 4E71A 3PGEA 2JRIB 4J6IA 3JYUA 3PHXB 4TUUA 2JPHA 3UIPB 2C60A 4MGYE 2KWUB 5JHAA 3V6EB 1P9DU 2ASQA 3U8ZA 2IO0B 2V3SA 4MELA 1TBEA 2C7NB 2DZIA 3L10B 5J18A 4KSKC 3M95A 1C3TA 1OGWA 2BGFA 4URKA 3ZRCA 2RD0A 2LRWA 1YJ1A 3LDZE 3QQ8B 2CU1A 3ALBA 4WJPA 4AWJA 2BKRB 3DVNU 4BKTA 3CF6E 3K9PB 2EMSA 1VD2A 2L0TA 3A4RA 3VDZA 4KDIC 5KHOA 2K8BA 3QWZB 1WM2A 2KLGA 4FADA 2W9NA 3A9JB 1E8XA 3BINA 4GDKA 4P7IA 5AZHA 1WJUA 1UBIA 1YIWA 2DZJA 1AARA 2JY6A 3ZO5B 2N4FA 2ZZPB 2CS4A 2K8CA 3MHSD 2IO2B 4K81A 2ZEQA 1OQYA 3IG3A 1X1MA 3JW0X 1UGMA 2NBWB 4WWNA 4HCNB 3WAPA 3ZNGC 2ZVNA 1T0YA 4BOSC 2A4ZA 3VAWA 1WZ0A 2DENB 4NY0A 3NHEB 3PTFC 4XX5A 1NDDA 4IWPA 4FBJB 3ENEA 2REXA 3DDCB 3ML8A 2FUHB 3P2BA 1HE8A 2GBRA 2KC1A 1VCBA 4NQKE 3RZFA 4BOZB 2MBEA 4W9FA 1LM8B 2L0FA 5J2RA 4GDKB 3B0AA 3DCGA 3TCAA 3JSVA 4NJ7A 4HWIB 3R7RA 2GBKA 3U30A 4WQOB 4FA6A 2MQJA 2DYOA 3H7PA 4KIKA 4G50A 3IFWB 2BWES 2IZVB 3KH0A 3VQIA 2L05A 2IY0B 3M3JA 3NZUA 4E3CA 4RM9A 1WGYA 4PS8A 1TTNA 2ZNVB 5JH5C 1Y8RC 1PQSA 1CMXB 4X57B 2RGFA 2LZ6A 3KYDD 2KX0A 2XEWA 3APFA 3B1LX 3RD2A 4LDTD 2NBVB 1K8RB 4MSMB 4BKSA 2JXXA 4N9F4 5D94A 4HPMB 4IW0A 4WJOA 4MGZE 1WGHA 3AULA 4FJZA 3AU5A 3PRPB 4IWOA 3L0WB 2CHZA 2I1KA 1F9JA 4F8CB 2KVRA 4MJSB 3K9OB 1UZXB 3SHQA 3TMPB 2Y5BB 1LFDA 2GMIC 3Q3FA 4I6LB 2PEAA 4RMAA 2N1VA 3OJ3A 4KDLB 2C5LC 2LWPA 3SU8X 1E8ZA 3WA0A 4WAAA 3ZNHB 3VFKA 1L7YA 3WAOA 3PPAA 2YVCA 3L16A 2D11A 2GBNA 3CSTA 4TQ1A 4BVUC 4E74A 2KC2A 3DBLI 2DAFA 2OOBB 2AL3A 1V86A 4OVUA 2BKFA 2NS5A 1V2YA 1OTRB 4BBNC 3R66C 2IYDB 1TZ1A 2I1JA 2LRUA 4HJKA 2BYVE 3Q3JA 5DCNA 1GJZA 5CX3A 1ZKHA 2N9EB 1GUAB 2O2VA 3QCAA 5JZEB 3GOEA 2C7MB 3MJWA 3ZVVA 2MRPA 1WMHA 3VHTC 1WXSA 1P3QU 4DHJD 4IC7B 4MJSA 4B9KA 1WM3A 2FCQA 4DDGD 1J19A 1WI0A 3H9DA 1WR1A 3JSVB 1H4RA 3O65B 3V61A 2DYMA 3QA8A 2LJ5A 2L76A 1SGHA 4AJWA 2BWFA 1WGDA 2IO3B 4F7ZA 4IM3A 3WAMA 4LJOB 3EC8A 4G0NB 5HKHA 2JWZA 1ZW7A 5CHVC 5DPTA 4GDLA 1WGGA 2HTHA 3TIXA 3SDLC 2KJ6A 1IYFA 4DBGA 3L17A 3HIZA 4HCPB 3GZNI 1D3ZA 2G45B 1LQBA 1WGRA 2KMAA 1E7VA 2FCSA 2VRRB 4W9LA 4MH0E 5L95C 2PPHA 3KUZA 2BYFA 1P1AA 4ZRJA 2M0XA 1YD8U 3RULA 2BF8B 2L8JA 2MX2A 3A9JA 4GGQA 3DVNV 4NJ6A 1UH6A 3DPDA 1UBQA 1XQQA 2K8HA 1Q0WB 2NR2A 3QJZA 1BT0A 2JZZA 2MWSB 3H6NA 2RSUA 4OVVA 2KLCA 3PV1A 4HPLB 3PRMB 4NAWA 3QHTA 3TL5A 1A5RA 1WJ4A 4IM2A 2MBOA 4AP4C 5IA7A 4W9IA 3RYTA 4LJPB 4IM0A 1EUVB 1XD3B 4MSQB 1WXAA 3M62B 2KX3A 2LGYA 3T8MA 1V81A 3WIMA 1EF5A 1I35A 2MBBB 2LXCA 3QC8B 2WX1A 2HE7A 1WIAA 3I3TB 1H8CA 3A33B 3NOBA 2KDBA 5DPSA 2PE6B 1E5WA 3KVFB 5CTRC 5EDSA 2CR5A 2AWTA 4WWPA 5E6OA 3DVGY 2K6DB 4TV3A 2N9PC 2EMTA 3ML9A 3EFUA 2KQSA 3AI5A 5FR6A 2KTRA 2K39A 5BO4B 2DHZA 2LXAA 4KSLC 2AL6A 2LVOA 2MSED 4JL9A 4NAWB 3ZRFA 1YX6B 1S3SG 5E6PA 2V4LA 2KJRA 2KO3A 4CYEA 2FIDA 2HJ8A 3S2AA 1UELA 1S1QB 4FLHA 1ISNA 2O2VB 2ZPYA 4LCDE 3ONSA 2GBJA 3QK0A 2FCMA 2KJHB 3RZWC 1SE9A 1WH3A 2MP2B 3M63B 3ZLZA 1WMHB 3PSEB 2KKCA 4WJNA 4F1SA 4FN2A 3ZNID 2PE9A 3NZSA 5J17A 3C0RB 4XC2A 2DZMA 1P98A 2NCNA 2UYZB 3QX1A 3U7DA 4GMVA 3PLUA 3N32A 4GIVA 4IG7B 3VXWA 3PLVA 3ZW3A 5D6JB 2BYEA 1QZEA 3DVGX 2EKEC 2KTRB 4DXAB 1E8WA 2N7EA 1YQBA 2LUEA 2Z0EB 4ANXA 2A5UA 1OEYJ 2M1MA 4GU2A 3X23A 4JQWC 2LD9A 4GDLB 4ZRKA 3ECIA 3VH4B 4KZ0A 5CHFA 3KYCD 2LASA 1GG3A 2FIFA 3PVLA 4A3PA 3ZIMA 4EEWA 2O6VB 2R2OA 1U4AA 3OJ4B 4TQ0A 2D07B 2PJHA 2ZCBA 4K1RB 1V80A 5GMVA 4ANUA 4DHJB 2HD5B 2LVPA 1Q5WB 1RRBA 3WALA 2KFJA 4M0WB 3A1QA 3IVFA 2ZNVC 4HXDA 4ASWC 2Z0DB 1GC6A 4EFOA 3MTNB 3VTWA 2AYOB 1YX5B 2G4DB 2GBMA 2O6VD 2G3QB 4AJYB 2KTFA 2KMCA 4MDKE 1GNUA 4JLCA 1R4NI 2J7QB 4W9DA 4HK2A 1WXVA 2IBIB 2J0JA 2YLMA 1JRUA 3LJ3A 2WX0A 3UGBB 3QIJA 2M4NA 2CHWA 3PRZA 4ICUA 2C7HA 3SD5A 4WWOA 5AZGA 2V1YA 1NBFC 4YL8A 4JIOU 2ZJDA 3BY4B 4ANWA 5LXHA 3D32A 1E7UA 3PZDA 3X0WA 4DK5A 3L08A 2IO1B 2DAJA 3V62A 4II3B 4W9GA 3RT3B 4B6WA 4DWFA 4HLEA 5TR5A 1WJ6A 4FHKA 1WE6A 5AZFA 2MBHA 2CKHB 3UQAA 2OJRA 3A9KB 5DPRA 1WZ3A 1GC7A 1KM7A 1P0RA 1E90A 2MLBA 4B95A 4EZLA 5C1ZA 3VH3B 2ZVOA 3UIOB 1WE7A 1Z2MA 3DBSA 4EZKA 4W9KA 2KXJA 2RPQA 1TGZB 1M94A 2LGXA 4KVGB 3H1UA 3EHVA 2B3AA 3N3KB 5D2MB 3DOWA 5L83A 2KNBA 4AOFA 1V5OA 2WDTB 3KUDB 4PS7A 3VUWA 2AEHA 5D7GA 4BBNF 4EUTA 1FXTB 4PYUA 1SIFA 5LXIB 1NI2A 1WYWB 2J0MA 4IUMB 1J8CA 2O6VA 3ZTCA 4LDTB 2MP2A 3AU4A 3PT2B 2CHXA 2FAZA 2KQ7A 4A20A 1V9JA 1XT9B 3VTUA 2Z59B 4TKNA 2XK5B 3A1QB 3PHWB 4I6PA 3NS8A 2J0KA 4NPNA 1IP9A 1L2NA 2KHWB 4BKGA 2KANA 3L13A 3VTVA 3VUXA 4EKUA 2MA9B 1KLVA 3ZDTA 3JVZX 1IPGA 2RR9A 3QAQA 4HDOA 3WANA 2R2QA 3IBEA 3APDA 1WF9A 4IWQA 4GXBA 3CSFA 2KZRA 5G55A 2JRHA 3UINB 1E8YA 1V5TA 4GOCA 2DYBA 2IY1B 3R7QA 2KWVB 1V49A 2D2QA 4MEMA 4M8MA 4MGKE 3DBRI 4NNJB 5G2NA 1WX8A 1OEYA 2KFKA 4AUQC 3VUYA 3QARA 4A3OA 4W9HA 1WJNA 4FJVB 1WX9A 2C9WB 3PS6A 4CHKA 2N7DA 2JVCA 4HDQA 4NQLB 2FCNA 4CO7A 2JUOA 3TBLD 2L00B 2KDEB 1WXMA 4XZ4A 3V60A 2G4SA 3DBHI 2L7RA 2LI5A 2NPTA 3AXCA 3RCZA 3OLMD 1WR6E 2NBUA 4PYZA 1EF1A 3ZTDA 5AEKB 3NY5A 1C1YB 4FULA 4ZYNA 2LGDA 5LLIA 4KIKB 4PS3A 4MGIE 1WRDB 2KK8A 4FHJA 3L54A 2M8SA 1RLFA 3PREA 2UWQA 2KOXA 5CHWA 3HK0A 2K1FA 1RFAA 1KOTA 4K7WA 2LVQA 3TJPA 2KDIA 4K7SA 4II2B 3V6CB 5IAAC 3DQVA 3A9KA 4DHZE 2MBQA 2KN5A 4BKSD 2N1WA 4MM3A 3ZDMC 4W9JA 2N9XA 4ZRIA 1I42A 5JHBA 4KZCA 4GSWA 3OAWA 2K6QA 1Q1OA 4GN1A 4WJQA 2GOWA 4HVBA 3ZKJC 3ZUNA 3UQBA 2WYQA 3T9LA 3HM3A 2DZKA 4BFRA 5E6NA 4DDID 2WWZA 4RM8A 2JF5A 3RUIB 3H7PB 1WX7A 3APCA 3UF8A 2DX5B 3IHPC 4JGHB 3HHMA 1UD7A 2K25A 2KDFB 3H7SA 4ANVA 1WY8A 3A4SC 3CMMB 3EECA 3KW5B 2ZCCA 3W1SA 1Z5SB 2BPSA 2KFKB 4GB9A 1G6JA 1ZGUB
chains in the Genus database with same CATH superfamily
4ICVA 3W1YA 2DLBA 2KT7A 2ZPNA 2QSDA 3W1SC 3B08A 3HM6X 2M56B 2QHOA 1BXTA 1NYRA 1V6EA 4RF0A 4N58A 3FAHA 4DHZB 1R4MI 3TEZA 2W3SA 4EOYA 3R8BA 2AQ2B 4J6IA 3PHXB 2JPHA 4MGYE 3DWMA 5JHAA 3V6EB 2IO0B 2DZIA 5BMIA 1OGWA 4OZAA 2CU1A 3ALBA 4WJPA 4AWJA 3DVNU 3ZYYX 2L0TA 2WXGA 3Q14C 1YQ4B 3AE9B 2KLGA 4GDKA 3AEGB 5AZHA 2WXIA 1UBIA 1XXGA 3AEDB 3ZO5B 2JY6A 5T8IA 2D3AA 2NTTA 4M00A 3MHSD 4K81A 1X1MA 2NBWB 4WWNA 2K3UA 4HCNB 3WAPA 3ZNGC 2WXNA 1EM7A 1D4BA 2DENB 3DBLB 1C4AA 1XLOA 3ENEA 2GBRA 2J53A 3U7ZA 2LGSA 3RZFA 1FO4A 5J2RA 4GDKB 1MHHE 3B0AA 4WURA 4NJ7A 2MJ3A 3R7RA 4C7ZA 3U30A 1FFUA 1I4PA 2MQJA 1JWUD 2WXRA 3H7PA 1PDXA 3IFWB 3M3JA 5JH5C 4X57B 1D5ZC 4JPSA 1YN4A 2RDBC 2XEWA 1ZXHA 3APFA 3B1LX 3RD2A 2L1AA 5D3DA 4BKSA 4N9F4 2BB5A 2BS4B 2INNE 4IW0A 4WJOA 4Q2JA 4LK0M 4IWOA 3L0WB 3GE3C 2I1KA 3Q6BA 2VZKD 4F8CB 1XLQA 3K9OB 2KAJA 2GMIC 3OG5A 2PEAA 2MH7A 1E8ZA 3BVMA 3ZNHB 1FEHA 3PPAA 1Q10A 4XDDA 2D11A 4E74A 3MFGA 2KC2A 4YSYB 2DAFA 2OOBB 1V86A 4OVUA 1OTRB 1E6EB 2LRUA 3BVGA 5DCNA 3NUHB 3VR9B 3BIID 4IKGA 3NS1A 3VHTC 1WXSA 4MJSA 1WM3A 2JU6X 1ZUD2 2JSVX 3H9DA 3DHGC 3RMKC 3B9JA 3MC9A 2BWFA 4IM3A 3Q69A 3WAMA 4LJOB 5FR3A 3HVZA 1ZW7A 5DPTA 1GOZA 1WGGA 3TIXA 4DXGA 4DBGA 3L17A 1D3ZA 2J42A 3NVVA 3KUZA 4RCOA 3P4PB 1CK1A 1IGDA 2BF8B 3AE5B 4NJ6A 1QKZA 3AE4B 3QJZA 2MWSB 2KLCA 5IO9A 3PV1A 3PRMB 4NAWA 1FNVA 4OZBA 5IA7A 4W9IA 3AMZA 4LJPB 1EUVB 4MSQB 1TT5B 2IPKD 4GLSC 3WIMA 1EF5A 1EWCA 4JE3B 1I35A 2LXCA 3I57A 3NOBA 3P4QB 2AQ1B 5EDSA 3DVGY 2EMTA 2LMCA 3EFUA 3ML9A 2WQYB 5FR6A 5BYRA 4IDIA 2BTEA 2K39A 3ZRFA 4KSLC 4JL9A 3NG0A 2AX5A 4CYEA 2K0PA 2ZPYA 2GBJA 4LTUA 2KJHB 1SE9A 3M63B 1T0QC 3L4PA 3PSEB 2KKCA 3AM9A 3RPFC 2PE9A 3QX1A 1VRAB 3U7DA 2XN9C 3N32A 4IG7B 5D6JB 3IT6B 3DVGX 3E56A 4DXAB 2D3BA 2A5UA 2M1MA 4GU2A 3X23A 2LD9A 4GDLB 1QOFA 3VH4B 1PGXA 3KYCD 5FK9C 2O6VB 3OJ4B 1U4AA 3LB8C 4K1RB 1D5MC 1RYJA 2LVPA 1Q5WB 1RRBA 3A1QA 1CZPA 3W9CB 4HXDA 1HZ6A 3AB5A 5MPOA 3LYYA 2GBMA 4MDKE 3BYYB 1SB3C 2KDMA 1FIQA 3KLSX 2ZW1A 1TS5A 1EU3A 2YLMA 3R2IA 2WXOA 1I4HA 3SD5A 2C7HA 4WWOA 4JIOU 3D32A 1JRPA 2JZPA 3L08A 2DAJA 4L1BA 4W9GA 3RT3B 5TR5A 4FHKA 2MBHA 2CKHB 3UQAA 3Q8EA 3VH3B 3BVZA 2HJ1A 3AE1B 1MG4A 1F2RC 2LGXA 3EHVA 3HUIA 3N3KB 5D2MB 2KNBA 3FILB 1TKEA 3PZ7A 4PS7A 3KUDB 2AEHA 1F2RI 4UDUC 3U52E 1ACCA 5HHDG 2J0MA 1DGJA 4LNOA 2KMMA 3PHWB 3NS8A 1VZ8A 2KANA 4EKUA 2MA9B 3ZDTA 3JVZX 4HDOA 3RNEC 3APDA 1I4RA 1WF9A 5BMHA 4GXBA 1QLBB 2KZRA 5G55A 2JRHA 1V49A 4MGKE 1HTOA 1K51A 2KQ4X 2KFKA 1CQVA 1WJNA 3ZXRA 4CHKA 2N7DA 4HDQA 4CO7A 2FCNA 2L00B 3RNAC 2G4SA 3DBHI 3N1YC 3AXCA 2BYTA 3OLMD 1EF1A 2QILA 4JWUC 1CJEA 5LLIA 4PS3A 4YWGG 4MGIE 3AE3B 4WAFA 1MHXA 3PREA 2KOXA 1L6UA 1KOTA 1FCCC 2QCZA 2Z8LA 4XGAB 2KN5A 2N1WA 2PLPA 2IGDA 2N9XA 4C00A 5JHBA 2W55A 1C4PA 3Q2AC 2K6QA 1Q1OA 1F52A 4HVBA 3ZKJC 3MP9A 3UQBA 1YQ3B 3HM3A 1JQ4A 4BFRA 4DQOC 5E6NA 1DOIA 2ON8A 2WWZA 3AE8B 4JGHB 1J7AA 5D3IB 2NMQA 3H7SA 1WY8A 1K52A 2MHJA 4XWTA 1Z5SB 2BPSA 1UGJA 4KGTA 1P1AA 4W9CA 2FUG1 1LXDA 2JT4B 1RAXA 1EO6A 1TS2A 3VVWB 2MCNB 1J0GA 5C23A 4KGRA 4G3XB 1YNTE 2N0SB 2D3GA 4G11A 1RWSA 3PGEA 4PT5A 2JRIB 3JYUA 4N6EB 2KWUB 4MELA 1TBEA 5J18A 4KSKC 4XE0A 4MH8A 3ZRCA 1BMLC 1N5WA 3GP7A 3AV8A 2RD0A 3N9YC 1YJ1A 4YSZB 3GZNB 2R61A 5HFYA 2EMSA 4OHJA 3VDZA 5KHOA 3QWZB 4FADA 2W9NA 3A9JB 1E8XA 4RFBA 1WJUA 1FNUA 2INCC 1YIWA 1VR9A 2DZJA 1AARA 2ZZPB 2CS4A 2K8CA 1C76A 1L0XB 2ZEQA 3DHIC 1OQYA 1UGMA 4O1NA 2ZVNA 4J3OD 1T0YA 1MJDA 4BOSC 1WZ0A 4YTPB 4NY0A 3PTFC 4IWPA 1MPEA 1TY0A 2BBCA 2WDRB 3DDCB 3ML8A 1HA5A 2KC1A 1SXTA 2MBEA 1LM8B 4ZRQA 4HWIB 4IOIE 4FA6A 2DYOA 4KIKA 2IZVB 5C3JB 1P7FA 3N1XC 1V97A 4ZOHC 4E3CA 1WGYA 1TTNA 2JXTA 1J7CA 1Y8RC 1PQSA 2RGFA 3KYDD 2LFIA 3IXSA 1N6ZA 4MSMB 2NBVB 1FFVA 4HPMB 1L5PA 1WSPA 1WXQA 4MGZE 4FJZA 3PRPB 2KVRA 4MJSB 3SHQA 2KACA 3Q3FA 1R4NB 1C4CA 2N1VA 4RMAA 2C5LC 2XNAC 4WAAA 1FRRA 1L7YA 3TEWA 3E9SA 2YVCA 2BQQA 4TQ1A 2QJLA 2FBWB 3W5UB 1FXIA 2AL3A 3AEEB 3R66C 3BZDB 1TZ1A 3NVWA 5CX3A 1ZKHA 2O2VA 1GUAB 2C7MB 2MRPA 2BVCA 4DHJD 5GXGB 3C19A 1ZE3D 4DDGD 1J19A 1WI0A 3JSVB 3O65B 3V61A 1N61A 3QA8A 2OJWA 3DBRB 4G0NB 5HKHA 2JWZA 3ETRA 4KKIA 2I38A 1GPXA 4P6VF 1JW9D 4HCPB 2KMAA 3NZ3A 1VZ6A 1ZP0B 2Q5WD 3Q8AA 2BYFA 4ZRJA 2Y3AA 4GGQA 2L8JA 3A9JA 3DVNV 1UH6A 1XQQA 1ROEA 4DXFA 3RNFC 4OVVA 2WS3B 3QHTA 3TL5A 1A5RA 2VH1A 3AE2B 5AUKA 2LGYA 3T8MA 2QEJC 2MBBB 3QC8B 2WX1A 1WIAA 3I3TB 2GI9A 3A33B 2KDBA 2N9LA 1JCKB 2CR5A 4WWPA 5G5HA 2WXJA 3ZGZA 1V1PB 1S3SG 2V4LA 1XLNA 1STEA 2VH2A 2HJ8A 3S2AA 4LCDE 5FKAC 3ONSA 3RZWC 2MP2B 1V8CA 4FN2A 1PGAA 3NZSA 4XC2A 2DZMA 5I4DA 2K5PA 1N63A 4GMVA 4N59A 2K22A 2BYEA 1QZEA 3H8HA 3FILA 2Z0EB 1OEYJ 2H89B 3C8YA 1AW7A 4TQ0A 2R2OA 2D07B 2PJHA 2ZCBA 2WXQA 1KLGD 2Z0DB 1FPYA 2G4DB 3V3XA 4AJYB 1GNUA 1KH0A 1YMHE 1BUIC 2WP9B 4W9DA 1WXVA 2IBIB 2J4XA 4A90A 2BS2B 3UGBB 3QIJA 2EKIA 2V1YA 1NBFC 4YL8A 3BY4B 2DWQA 1E7UA 3PZDA 1UNSA 4DK5A 3U2SC 3V62A 4II3B 2ONQA 2PW9A 2KYWA 1JALA 2OJRA 1P0RA 2MLBA 2WXHA 5C1ZA 4P1CC 1WE7A 1HQRD 1WWTA 1Z2MA 3AEBB 2N9KA 1TGZB 1JWAD 1I7HA 3DOWA 1V5OA 1ZXIA 4K3CA 1VZ7A 1SBBB 3GE8C 3GB1A 1L4ZB 5LXIB 1WYWB 3AU4A 1V9JA 1UF0A 3VTUA 2Z59B 4TKNA 1AYFA 2XK5B 4I6PA 3KQ4A 2J0KA 4YT0B 4US9A 1IP9A 1L2NA 2KHWB 3VUXA 4RNAA 5HI1A 3IBEA 4IWQA 1K50A 2WXKA 3VFKA 3R7QA 4ACFA 4MEMA 4M8MA 4NNJB 4AUQC 1PUTA 4W9HA 1C77A 1JWSD 2LI5A 1FD6A 3RCZA 2G1EA 2NBUA 5AEKB 3NY5A 3AEFB 1C1YB 2WU2B 2CU3A 4KIKB 4ZHPA 2SEBD 4FHJA 2WGSA 3L54A 2FE8A 1XCQL 1F1HA 4C4VA 3MJ5A 5CHWA 3HK0A 2K1FA 1RFAA 3TJPA 1ET9A 5H92C 4II2B 3V6CB 1SEBD 4DHZE 3VR8B 1FM0D 1TZOA 1I42A 1NEKB 1T0SC 3OAWA 4GN1A 4RGOS 1AN8A 2WYQA 2DZKA 1L0VB 3CIRB 4DDID 2JF5A 2WXPA 3RUIB 2OEDA 3APCA 3V05A 1QOAA 1ZDXA 3CMMB 1JWBD 1XEEA 3A4SC 1OQRA 5G5GA 2JWUA 2KWCA 1WFYA 2XK5A 2GB1A 5DPWA 4K7UA 4I6NB 1E0ZA 4FJYA 1KJTA 2M17A 2XBBC 3ZNZB 2NPTB 3R2TA 2L3ZA 4KV2A 2CJNA 2FNJB 4ZDVA 4W9EA 4XDCA 3OWEB 4HROA 2NVUI 1DYQA 4E71A 2W54A 4LLGM 4TUUA 2C60A 1P9DU 4LNFA 2V3SA 3M95A 1C3TA 2BGFA 4URKA 1E9MA 2LRWA 3QQ8B 1I4GA 2BKRB 1L6VA 2WDQB 1VD2A 3HVDA 1ZDVA 4KDIC 4K3BA 2K8BA 1SE3A 3AE7B 2N4FA 1I4XA 1QQRA 3ZJTA 2L83A 3EGRA 3MC0B 2G9HD 2QDFA 3N1ZC 1ZPSA 2A4ZA 1WYGA 3NHEB 4XX5A 4FBJB 1NDDA 3BWUD 1HE8A 4REZA 4W9FA 3SR6A 3TCAA 4XYCA 1KTKA 2LEKA 2GBKA 3T3NA 1XLPA 2MJEA 3J9CA 4RGMA 1B1ZA 4G50A 2BWES 2IY0B 1T6BX 3NZUA 4RM9A 4PS8A 1SIJA 4HJGE 5EE1A 1CMXB 3EFCA 4WWMA 2VZKB 2LZ6A 3GS2A 1P7EA 4ARIA 4LDTD 4M01A 2JXXA 4KGSA 3AULA 3AU5A 5EE3A 1F9JA 1UZXB 3TMPB 5IKCM 1LFDA 4I6LB 4KDLB 3EA6A 3IAM1 3LXFA 5IOIA 3SU8X 3WAOA 2GBNA 4BVUC 1Y56A 1D5XC 2OHFA 4BBNC 2NS5A 2IYDB 2I1JA 4HJKA 2BYVE 3Q3JA 1GJZA 5JZEB 3QCAA 3GOEA 3MJWA 1WMHA 4IC7B 3I63C 1T0RC 1OQQA 2FCQA 2IGGA 1H4RA 1UWMA 2DYMA 2LJ5A 2L76A 2KN4A 1SGHA 4AJWA 1WGDA 3EC8A 4ZHOA 4LNNA 5CHVC 2EELA 1LQBA 1WGRA 1E7VA 3RN9C 4AS1A 2VRRB 4MH0E 5L95C 4HPPA 1TYGB 1DOYA 2M0XA 1RM6C 4TSSA 2MX2A 1YN5A 4ITKA 3DPDA 1YJJA 2K8HA 1Q0WB 2WLBA 1BT0A 3H6NA 1TKYA 4HPLB 3Q8BA 2LHDA 2MBOA 1V1PA 4AP4C 3Q3MC 3UI3A 3RYTA 4IM0A 2JX5A 1WXAA 3M62B 1V81A 3DHHC 2QIEB 3T3OA 2L52A 1E5WA 5CTRC 2AWTA 4YSXB 2K6DB 4TV3A 2N9PC 2KQSA 3AI5A 3BK1A 4JX1C 2DHZA 5BO4B 2LVOA 2MSED 2KO3A 3ABVB 1LO5D 2FIDA 1F0ZA 1UELA 1NENB 4FLHA 1ISNA 2O2VB 3QK0A 2FCMA 1WH3A 3ZLZA 4M0WA 4WJNA 3IT4B 4F1SA 3DBHB 4L2YA 1N5XA 5J17A 3C0RB 2NCNA 4C56C 3PLVA 1MFWA 2WXFA 3AE6B 4L23A 1SJED 3ZQ4A 2EKEC 2N7JA 2E3TA 5IN7A 1NVID 1LGRA 2V3NA 4JQWC 4ZRKA 3ECIA 5CHFA 2LASA 3PVLA 4EEWA 3ZIMA 1TIFA 4DHJB 4ANUA 1V80A 4JWSC 2HD5B 3CWIA 3WALA 1DOXA 1PYWD 4M0WB 3IVFA 2ZNVC 1GC6A 4P1BC 4A55A 2PVOD 2JYEA 3AH7A 2O6VD 2KTFA 2KMCA 2LHEA 1YJIA 2J7QB 1WGKA 4HK2A 1JROA 4A9AA 2BW2A 3RFZB 2WX0A 2M4NA 2CHWA 3Q3NC 4ICUA 1T3QA 5AZGA 1SJHD 2ZJDA 2RPVA 4ANWA 5LXHA 3KWVA 2IGHA 1VDVA 5TSSA 4HLEA 1WJ6A 5AZFA 3A9KB 5DPRA 4RGNA 1WZ3A 1KM7A 1E90A 4B95A 3UIOB 3DBSA 4EZKA 4W9KA 1M94A 2B3AA 2WDTB 4BBNF 1FXTB 2B76B 4NZLB 4IUMB 3ZTCA 4LDTB 1HXYD 2MP2A 3PT2B 2CHXA 4XWWA 2KQ7A 4A20A 3SFDB 3AN1A 3A1QB 3VTVA 1KLVA 2CJOA 4KKJA 1ESFA 3FKYA 4C80A 3CSFA 1NYQA 4PK1A 2AQ3B 1L0YB 3UINB 1E8YA 2DYBA 2IY1B 2KWVB 4C4VB 2HDEA 4A8XC 1EWYC 1OEYA 3VUYA 4A3OA 2X38A 1WX9A 2C9WB 4C7YA 2JVCA 4NQLB 4RGTA 3P4SB 2KDEB 1WXMA 4XZ4A 1A70A 1WR6E 4PYZA 1D6EC 1E10A 3ZTDA 4FULA 2LGDA 2PTLA 2IJ0A 3P42A 2WXLA 1RLFA 2UWQA 1SSNA 3FC4A 3NJTA 2DBYA 4K7WA 2KDIA 4LNKA 2JYTA 3DQVA 2MBQA 3ZDMC 4W9JA 1QOBA 4P16A 4ZRIA 2D5GA 4GSWA 1UUPA 4WJQA 3EUB2 3ZUNA 3T9LA 4KX6B 3O13A 4CQNA 2MJDA 4WH4A 1WRIA 3H7PB 1IUEA 1HTQA 2E6XA 2DX5B 3IHPC 3U4EG 1UD7A 2K25A 3W1SA 2ZCCA 1GAQB 3NVZA 4R3DA 2KFKB 2RDHA 1NI3A 1MG8A 3N30A 3R3MA 3KUCB 2MW5A 4YXDB 1HZ5A 4M8NA 2JZ3B 5KHQA 4MACA 3BK2A 1SF0A 4EZJA 2KD0A 3I5JC 1QT9A 2D10A 1PGBA 2TSSA 3UIPB 1HEZE 3PZ8A 2M0AA 3U8ZA 2ASQA 2C7NB 3L10B 1GB4A 2ZW0A 3LDZE 4BKTA 3CF6E 3K9PB 3A4RA 1C9FA 1WM2A 4MM3B 3BINA 4P7IA 1RFKA 3P63A 2IO2B 3SFEB 1QF6A 3IG3A 4OZCA 3JW0X 2ICIA 3W5VB 3MC8A 3VAWA 2REXA 2FUHB 3P2BA 3IAS1 3N20C 1VCBA 4NQKE 2BB6A 4BOZB 4US8A 2L0FA 4B0MA 3DCGA 3JSVA 4WQMA 2MEKA 4WQOB 1L4DB 2M19A 2WXMA 3KH0A 3VQIA 2L05A 3W2DA 2ZNVB 4A6QA 1KRHA 2KX0A 3TEXA 1K8RB 4USAA 5D94A 2V9HA 1WGHA 2CHZA 3RNGC 4EE2A 1IBXA 2Y5BB 4HRSA 1IGCA 2H88B 1MVKA 3OJ3A 2LWPA 1KLUD 3WA0A 3WCQA 2PMVA 2NTSA 3B2FA 5BYSA 1YOVB 3AECB 3L16A 3CSTA 3DBLI 4AQ7A 2BKFA 1V2YA 3AEAB 1FXAA 2N9EB 3I9V1 3TEYA 3ZVVA 1J7BA 2INPE 1P3QU 3URYA 4B9KA 1E7PB 2X8XX 1WR1A 4ZYSA 1XO3A 2WNMA 2WDVB 1ZOYB 4QAYA 2IO3B 4F7ZA 1EU4A 1B9RA 3BYTB 4GDLA 2HTME 5BYQA 2HTHA 3KWLA 4OW0A 1SE4A 3SDLC 2KJ6A 1IYFA 4S0RA 3HIZA 4RH6A 3GZNI 2LUMA 1V1OA 2G45B 2FCSA 2YEPF 4W9LA 2PPHA 2IDYA 1TS3A 1YD8U 4BAXA 3RULA 5BMGA 4OVZA 1UBQA 2NR2A 3TUOA 3ZJUA 2JZZA 2RSUA 2K9XA 1WJ4A 4IM2A 2D3CA 5H8YE 3Q8FA 1XD3B 4BZAA 2KX3A 1F77A 5IP4D 1C78A 2HE7A 1IBXB 3RNBC 1H8CA 5DPSA 2PE6B 3KVFB 3P1MA 5E6OA 3VRBB 4YTNB 1QILA 2KTRA 2DNFA 2LXAA 4NAWB 2AL6A 1YX6B 4HKZE 2JQRB 5E6PA 2KJRA 1I4QA 1KF6B 1S1QB 1WMHB 1FRDA 3ZNID 1VJKA 2KVZA 2GLSA 1P98A 2UYZB 3PLUA 3VXWA 4GIVA 3ZW3A 2KWDA 1ET6A 1R7SA 4M02A 2KTRB 1E8WA 2N7EA 1YQBA 2LUEA 4ANXA 3B2GA 2LGIA 1KFYB 1FCLA 1XCTL 4KZ0A 1GG3A 2FIFA 4A3PA 1TY2A 5JXVA 5GMVA 3NRZA 2KFJA 4WIPA 4TMAB 1JWMD 4NAMA 4LNIA 4ASWC 4EFOA 5EE9A 1AWDA 3MTNB 3VTWA 4S17A 2AYOB 1YX5B 2G3QB 4JLCA 1R4NI 2L32A 1N60A 3RNCC 2J0JA 1R4MB 2WU5B 1JRUA 3LJ3A 3PRZA 4ZRPA 2INDC 2V0GA 3X0WA 2IO1B 4B6WA 4DWFA 1WE6A 1FNWA 1GC7A 2W82A 4EZLA 2ZVOA 1VLBA 2SAKA 2KXJA 2RPQA 2Y5PA 3RI7C 4KVGB 3H1UA 2LJIA 3Q8CA 5L83A 2BT6A 4AOFA 3VUWA 2I2YA 2J52A 1N62A 5D7GA 4EUTA 3PO0A 4PYUA 1SIFA 5C2TB 1NI2A 1J8CA 2O6VA 2FAZA 1XT9B 2WHIA 4D2KA 1K53A 3SEBA 5LNK1 4NPNA 3DWGC 4BKGA 3L13A 5E6JA 1IPGA 2RR9A 1FMAD 3QAQA 5AUIA 3WANA 5EE0A 2R2QA 3NVYA 2ACZB 2V3PA 2QMTA 1QOGA 1SE2A 4NJCA 1V5TA 4GOCA 3VRAB 1PFDA 2D2QA 2BS3B 3DBRI 5G2NA 1WX8A 3QARA 4FJVB 3Q3OC 3TSSA 4B0EA 3PS6A 4YTMB 2JUOA 3TBLD 2Y5CA 4FXCA 3V60A 2QC8A 2L7RA 2NPTA 4ZYNA 2PVGC 2GRIA 2PIAA 3HRDD 4H2AA 1WRDB 2KK8A 4ARCA 1M4VA 1ENFA 5HG2A 2M8SA 3MHZA 4MT5A 1XF5L 4HKQA 1T5XD 1TKGA 3ZJVA 2LVQA 4K7SA 1C79A 5IAAC 2W3RA 3A9KA 2V4IB 1YN3A 4RF1A 4BKSD 4MM3A 1TJEA 1UWXA 2YEPB 4KZCA 3P4RB 1MI0A 2GOWA 3ZXVA 4RM8A 1JMLA 1WX7A 2UU7A 3UF8A 2PKOA 3HHMA 4ANVA 2KDFB 4HEA1 3EECA 1OFFA 3KW5B 2RMMA 1GB1A 2RDGA 1G6JA 4GB9A 1ZGUB 1TS4A
chains in the Genus database with same CATH topology
2KWCA 4ICVA 1WFYA 1MG8A 2XK5A 4W9CA 3W1YA 5DPWA 4K7UA 2ZPNA 4I6NB 3N30A 1LXDA 2JT4B 3W1SC 4FJYA 1KJTA 1RAXA 1EO6A 2M17A 2XBBC 3B08A 2QHOA 3HM6X 3R3MA 2MCNB 2NPTB 3VVWB 2L3ZA 2MW5A 3KUCB 4KV2A 3ZNZB 1J0GA 2FNJB 5C23A 4ZDVA 4M8NA 4W9EA 1V6EA 4G3XB 2JZ3B 5KHQA 4DHZB 1R4MI 4EZJA 2D3GA 2KD0A 4G11A 2NVUI 4EOYA 2D10A 4E71A 3PGEA 2JRIB 4J6IA 3JYUA 3PHXB 4TUUA 2JPHA 3UIPB 2C60A 4MGYE 2KWUB 5JHAA 3V6EB 1P9DU 2ASQA 3U8ZA 2IO0B 2V3SA 4MELA 1TBEA 2C7NB 2DZIA 3L10B 5J18A 4KSKC 3M95A 1C3TA 1OGWA 2BGFA 4URKA 3ZRCA 2RD0A 2LRWA 1YJ1A 3LDZE 3QQ8B 2CU1A 3ALBA 4WJPA 4AWJA 2BKRB 3DVNU 4BKTA 3CF6E 3K9PB 2EMSA 1VD2A 2L0TA 3A4RA 3VDZA 4KDIC 5KHOA 2K8BA 3QWZB 1WM2A 2KLGA 4FADA 2W9NA 3A9JB 1E8XA 3BINA 4GDKA 4P7IA 5AZHA 1WJUA 1UBIA 1YIWA 2DZJA 1AARA 2JY6A 3ZO5B 2N4FA 2ZZPB 2CS4A 2K8CA 3MHSD 2IO2B 4K81A 2ZEQA 1OQYA 3IG3A 1X1MA 3JW0X 1UGMA 2NBWB 4WWNA 4HCNB 3WAPA 3ZNGC 2ZVNA 1T0YA 4BOSC 2A4ZA 3VAWA 1WZ0A 2DENB 4NY0A 3NHEB 3PTFC 4XX5A 1NDDA 4IWPA 4FBJB 3ENEA 2REXA 3DDCB 3ML8A 2FUHB 3P2BA 1HE8A 2GBRA 2KC1A 1VCBA 4NQKE 3RZFA 4BOZB 2MBEA 4W9FA 1LM8B 2L0FA 5J2RA 4GDKB 3B0AA 3DCGA 3TCAA 3JSVA 4NJ7A 4HWIB 3R7RA 2GBKA 3U30A 4WQOB 4FA6A 2MQJA 2DYOA 3H7PA 4KIKA 4G50A 3IFWB 2BWES 2IZVB 3KH0A 3VQIA 2L05A 2IY0B 3M3JA 3NZUA 4E3CA 4RM9A 1WGYA 4PS8A 1TTNA 2ZNVB 5JH5C 1Y8RC 1PQSA 1CMXB 4X57B 2RGFA 2LZ6A 3KYDD 2KX0A 2XEWA 3APFA 3B1LX 3RD2A 4LDTD 2NBVB 1K8RB 4MSMB 4BKSA 2JXXA 4N9F4 5D94A 4HPMB 4IW0A 4WJOA 4MGZE 1WGHA 3AULA 4FJZA 3AU5A 3PRPB 4IWOA 3L0WB 2CHZA 2I1KA 1F9JA 4F8CB 2KVRA 4MJSB 3K9OB 1UZXB 3SHQA 3TMPB 2Y5BB 1LFDA 2GMIC 3Q3FA 4I6LB 2PEAA 4RMAA 2N1VA 3OJ3A 4KDLB 2C5LC 2LWPA 3SU8X 1E8ZA 3WA0A 4WAAA 3ZNHB 3VFKA 1L7YA 3WAOA 3PPAA 2YVCA 3L16A 2D11A 2GBNA 3CSTA 4TQ1A 4BVUC 4E74A 2KC2A 3DBLI 2DAFA 2OOBB 2AL3A 1V86A 4OVUA 2BKFA 2NS5A 1V2YA 1OTRB 4BBNC 3R66C 2IYDB 1TZ1A 2I1JA 2LRUA 4HJKA 2BYVE 3Q3JA 5DCNA 1GJZA 5CX3A 1ZKHA 2N9EB 1GUAB 2O2VA 3QCAA 5JZEB 3GOEA 2C7MB 3MJWA 3ZVVA 2MRPA 1WMHA 3VHTC 1WXSA 1P3QU 4DHJD 4IC7B 4MJSA 4B9KA 1WM3A 2FCQA 4DDGD 1J19A 1WI0A 3H9DA 1WR1A 3JSVB 1H4RA 3O65B 3V61A 2DYMA 3QA8A 2LJ5A 2L76A 1SGHA 4AJWA 2BWFA 1WGDA 2IO3B 4F7ZA 4IM3A 3WAMA 4LJOB 3EC8A 4G0NB 5HKHA 2JWZA 1ZW7A 5CHVC 5DPTA 4GDLA 1WGGA 2HTHA 3TIXA 3SDLC 2KJ6A 1IYFA 4DBGA 3L17A 3HIZA 4HCPB 3GZNI 1D3ZA 2G45B 1LQBA 1WGRA 2KMAA 1E7VA 2FCSA 2VRRB 4W9LA 4MH0E 5L95C 2PPHA 3KUZA 2BYFA 1P1AA 4ZRJA 2M0XA 1YD8U 3RULA 2BF8B 2L8JA 2MX2A 3A9JA 4GGQA 3DVNV 4NJ6A 1UH6A 3DPDA 1UBQA 1XQQA 2K8HA 1Q0WB 2NR2A 3QJZA 1BT0A 2JZZA 2MWSB 3H6NA 2RSUA 4OVVA 2KLCA 3PV1A 4HPLB 3PRMB 4NAWA 3QHTA 3TL5A 1A5RA 1WJ4A 4IM2A 2MBOA 4AP4C 5IA7A 4W9IA 3RYTA 4LJPB 4IM0A 1EUVB 1XD3B 4MSQB 1WXAA 3M62B 2KX3A 2LGYA 3T8MA 1V81A 3WIMA 1EF5A 1I35A 2MBBB 2LXCA 3QC8B 2WX1A 2HE7A 1WIAA 3I3TB 1H8CA 3A33B 3NOBA 2KDBA 5DPSA 2PE6B 1E5WA 3KVFB 5CTRC 5EDSA 2CR5A 2AWTA 4WWPA 5E6OA 3DVGY 2K6DB 4TV3A 2N9PC 2EMTA 3ML9A 3EFUA 2KQSA 3AI5A 5FR6A 2KTRA 2K39A 5BO4B 2DHZA 2LXAA 4KSLC 2AL6A 2LVOA 2MSED 4JL9A 4NAWB 3ZRFA 1YX6B 1S3SG 5E6PA 2V4LA 2KJRA 2KO3A 4CYEA 2FIDA 2HJ8A 3S2AA 1UELA 1S1QB 4FLHA 1ISNA 2O2VB 2ZPYA 4LCDE 3ONSA 2GBJA 3QK0A 2FCMA 2KJHB 3RZWC 1SE9A 1WH3A 2MP2B 3M63B 3ZLZA 1WMHB 3PSEB 2KKCA 4WJNA 4F1SA 4FN2A 3ZNID 2PE9A 3NZSA 5J17A 3C0RB 4XC2A 2DZMA 1P98A 2NCNA 2UYZB 3QX1A 3U7DA 4GMVA 3PLUA 3N32A 4GIVA 4IG7B 3VXWA 3PLVA 3ZW3A 5D6JB 2BYEA 1QZEA 3DVGX 2EKEC 2KTRB 4DXAB 1E8WA 2N7EA 1YQBA 2LUEA 2Z0EB 4ANXA 2A5UA 1OEYJ 2M1MA 4GU2A 3X23A 4JQWC 2LD9A 4GDLB 4ZRKA 3ECIA 3VH4B 4KZ0A 5CHFA 3KYCD 2LASA 1GG3A 2FIFA 3PVLA 4A3PA 3ZIMA 4EEWA 2O6VB 2R2OA 1U4AA 3OJ4B 4TQ0A 2D07B 2PJHA 2ZCBA 4K1RB 1V80A 5GMVA 4ANUA 4DHJB 2HD5B 2LVPA 1Q5WB 1RRBA 3WALA 2KFJA 4M0WB 3A1QA 3IVFA 2ZNVC 4HXDA 4ASWC 2Z0DB 1GC6A 4EFOA 3MTNB 3VTWA 2AYOB 1YX5B 2G4DB 2GBMA 2O6VD 2G3QB 4AJYB 2KTFA 2KMCA 4MDKE 1GNUA 4JLCA 1R4NI 2J7QB 4W9DA 4HK2A 1WXVA 2IBIB 2J0JA 2YLMA 1JRUA 3LJ3A 2WX0A 3UGBB 3QIJA 2M4NA 2CHWA 3PRZA 4ICUA 2C7HA 3SD5A 4WWOA 5AZGA 2V1YA 1NBFC 4YL8A 4JIOU 2ZJDA 3BY4B 4ANWA 5LXHA 3D32A 1E7UA 3PZDA 3X0WA 4DK5A 3L08A 2IO1B 2DAJA 3V62A 4II3B 4W9GA 3RT3B 4B6WA 4DWFA 4HLEA 5TR5A 1WJ6A 4FHKA 1WE6A 5AZFA 2MBHA 2CKHB 3UQAA 2OJRA 3A9KB 5DPRA 1WZ3A 1GC7A 1KM7A 1P0RA 1E90A 2MLBA 4B95A 4EZLA 5C1ZA 3VH3B 2ZVOA 3UIOB 1WE7A 1Z2MA 3DBSA 4EZKA 4W9KA 2KXJA 2RPQA 1TGZB 1M94A 2LGXA 4KVGB 3H1UA 3EHVA 2B3AA 3N3KB 5D2MB 3DOWA 5L83A 2KNBA 4AOFA 1V5OA 2WDTB 3KUDB 4PS7A 3VUWA 2AEHA 5D7GA 4BBNF 4EUTA 1FXTB 4PYUA 1SIFA 5LXIB 1NI2A 1WYWB 2J0MA 4IUMB 1J8CA 2O6VA 3ZTCA 4LDTB 2MP2A 3AU4A 3PT2B 2CHXA 2FAZA 2KQ7A 4A20A 1V9JA 1XT9B 3VTUA 2Z59B 4TKNA 2XK5B 3A1QB 3PHWB 4I6PA 3NS8A 2J0KA 4NPNA 1IP9A 1L2NA 2KHWB 4BKGA 2KANA 3L13A 3VTVA 3VUXA 4EKUA 2MA9B 1KLVA 3ZDTA 3JVZX 1IPGA 2RR9A 3QAQA 4HDOA 3WANA 2R2QA 3IBEA 3APDA 1WF9A 4IWQA 4GXBA 3CSFA 2KZRA 5G55A 2JRHA 3UINB 1E8YA 1V5TA 4GOCA 2DYBA 2IY1B 3R7QA 2KWVB 1V49A 2D2QA 4MEMA 4M8MA 4MGKE 3DBRI 4NNJB 5G2NA 1WX8A 1OEYA 2KFKA 4AUQC 3VUYA 3QARA 4A3OA 4W9HA 1WJNA 4FJVB 1WX9A 2C9WB 3PS6A 4CHKA 2N7DA 2JVCA 4HDQA 4NQLB 2FCNA 4CO7A 2JUOA 3TBLD 2L00B 2KDEB 1WXMA 4XZ4A 3V60A 2G4SA 3DBHI 2L7RA 2LI5A 2NPTA 3AXCA 3RCZA 3OLMD 1WR6E 2NBUA 4PYZA 1EF1A 3ZTDA 5AEKB 3NY5A 1C1YB 4FULA 4ZYNA 2LGDA 5LLIA 4KIKB 4PS3A 4MGIE 1WRDB 2KK8A 4FHJA 3L54A 2M8SA 1RLFA 3PREA 2UWQA 2KOXA 5CHWA 3HK0A 2K1FA 1RFAA 1KOTA 4K7WA 2LVQA 3TJPA 2KDIA 4K7SA 4II2B 3V6CB 5IAAC 3DQVA 3A9KA 4DHZE 2MBQA 2KN5A 4BKSD 2N1WA 4MM3A 3ZDMC 4W9JA 2N9XA 4ZRIA 1I42A 5JHBA 4KZCA 4GSWA 3OAWA 2K6QA 1Q1OA 4GN1A 4WJQA 2GOWA 4HVBA 3ZKJC 3ZUNA 3UQBA 2WYQA 3T9LA 3HM3A 2DZKA 4BFRA 5E6NA 4DDID 2WWZA 4RM8A 2JF5A 3RUIB 3H7PB 1WX7A 3APCA 3UF8A 2DX5B 3IHPC 4JGHB 3HHMA 1UD7A 2K25A 2KDFB 3H7SA 4ANVA 1WY8A 3A4SC 3CMMB 3EECA 3KW5B 2ZCCA 3W1SA 1Z5SB 2BPSA 2KFKB 4GB9A 1G6JA 1ZGUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWC A;  4ICV A;  1WFY A;  1MG8 A;  2XK5 A;  4W9C A;  3W1Y A;  5DPW A;  4K7U A;  2ZPN A;  4I6N B;  3N30 A;  1LXD A;  2JT4 B;  3W1S C;  4FJY A;  1KJT A;  1RAX A;  1EO6 A;  2M17 A;  2XBB C;  3B08 A;  2QHO A;  3HM6 X;  3R3M A;  2MCN B;  2NPT B;  3VVW B;  2L3Z A;  2MW5 A;  3KUC B;  4KV2 A;  3ZNZ B;  1J0G A;  2FNJ B;  5C23 A;  4ZDV A;  4M8N A;  4W9E A;  1V6E A;  4G3X B;  2JZ3 B;  5KHQ A;  4DHZ B;  1R4M I;  4EZJ A;  2D3G A;  2KD0 A;  4G11 A;  2NVU I;  4EOY A;  2D10 A;  4E71 A;  3PGE A;  2JRI B;  4J6I A;  3JYU A;  3PHX B;  4TUU A;  2JPH A;  3UIP B;  2C60 A;  4MGY E;  2KWU B;  5JHA A;  3V6E B;  1P9D U;  2ASQ A;  3U8Z A;  2IO0 B;  2V3S A;  4MEL A;  1TBE A;  2C7N B;  2DZI A;  3L10 B;  5J18 A;  4KSK C;  3M95 A;  1C3T A;  1OGW A;  2BGF A;  4URK A;  3ZRC A;  2RD0 A;  2LRW A;  1YJ1 A;  3LDZ E;  3QQ8 B;  2CU1 A;  3ALB A;  4WJP A;  4AWJ A;  2BKR B;  3DVN U;  4BKT A;  3CF6 E;  3K9P B;  2EMS A;  1VD2 A;  2L0T A;  3A4R A;  3VDZ A;  4KDI C;  5KHO A;  2K8B A;  3QWZ B;  1WM2 A;  2KLG A;  4FAD A;  2W9N A;  3A9J B;  1E8X A;  3BIN A;  4GDK A;  4P7I A;  5AZH A;  1WJU A;  1UBI A;  1YIW A;  2DZJ A;  1AAR A;  2JY6 A;  3ZO5 B;  2N4F A;  2ZZP B;  2CS4 A;  2K8C A;  3MHS D;  2IO2 B;  4K81 A;  2ZEQ A;  1OQY A;  3IG3 A;  1X1M A;  3JW0 X;  1UGM A;  2NBW B;  4WWN A;  4HCN B;  3WAP A;  3ZNG C;  2ZVN A;  1T0Y A;  4BOS C;  2A4Z A;  3VAW A;  1WZ0 A;  2DEN B;  4NY0 A;  3NHE B;  3PTF C;  4XX5 A;  1NDD A;  4IWP A;  4FBJ B;  3ENE A;  2REX A;  3DDC B;  3ML8 A;  2FUH B;  3P2B A;  1HE8 A;  2GBR A;  2KC1 A;  1VCB A;  4NQK E;  3RZF A;  4BOZ B;  2MBE A;  4W9F A;  1LM8 B;  2L0F A;  5J2R A;  4GDK B;  3B0A A;  3DCG A;  3TCA A;  3JSV A;  4NJ7 A;  4HWI B;  3R7R A;  2GBK A;  3U30 A;  4WQO B;  4FA6 A;  2MQJ A;  2DYO A;  3H7P A;  4KIK A;  4G50 A;  3IFW B;  2BWE S;  2IZV B;  3KH0 A;  3VQI A;  2L05 A;  2IY0 B;  3M3J A;  3NZU A;  4E3C A;  4RM9 A;  1WGY A;  4PS8 A;  1TTN A;  2ZNV B;  5JH5 C;  1Y8R C;  1PQS A;  1CMX B;  4X57 B;  2RGF A;  2LZ6 A;  3KYD D;  2KX0 A;  2XEW A;  3APF A;  3B1L X;  3RD2 A;  4LDT D;  2NBV B;  1K8R B;  4MSM B;  4BKS A;  2JXX A;  4N9F 4;  5D94 A;  4HPM B;  4IW0 A;  4WJO A;  4MGZ E;  1WGH A;  3AUL A;  4FJZ A;  3AU5 A;  3PRP B;  4IWO A;  3L0W B;  2CHZ A;  2I1K A;  1F9J A;  4F8C B;  2KVR A;  4MJS B;  3K9O B;  1UZX B;  3SHQ A;  3TMP B;  2Y5B B;  1LFD A;  2GMI C;  3Q3F A;  4I6L B;  2PEA A;  4RMA A;  2N1V A;  3OJ3 A;  4KDL B;  2C5L C;  2LWP A;  3SU8 X;  1E8Z A;  3WA0 A;  4WAA A;  3ZNH B;  3VFK A;  1L7Y A;  3WAO A;  3PPA A;  2YVC A;  3L16 A;  2D11 A;  2GBN A;  3CST A;  4TQ1 A;  4BVU C;  4E74 A;  2KC2 A;  3DBL I;  2DAF A;  2OOB B;  2AL3 A;  1V86 A;  4OVU A;  2BKF A;  2NS5 A;  1V2Y A;  1OTR B;  4BBN C;  3R66 C;  2IYD B;  1TZ1 A;  2I1J A;  2LRU A;  4HJK A;  2BYV E;  3Q3J A;  5DCN A;  1GJZ A;  5CX3 A;  1ZKH A;  2N9E B;  1GUA B;  2O2V A;  3QCA A;  5JZE B;  3GOE A;  2C7M B;  3MJW A;  3ZVV A;  2MRP A;  1WMH A;  3VHT C;  1WXS A;  1P3Q U;  4DHJ D;  4IC7 B;  4MJS A;  4B9K A;  1WM3 A;  2FCQ A;  4DDG D;  1J19 A;  1WI0 A;  3H9D A;  1WR1 A;  3JSV B;  1H4R A;  3O65 B;  3V61 A;  2DYM A;  3QA8 A;  2LJ5 A;  2L76 A;  1SGH A;  4AJW A;  2BWF A;  1WGD A;  2IO3 B;  4F7Z A;  4IM3 A;  3WAM A;  4LJO B;  3EC8 A;  4G0N B;  5HKH A;  2JWZ A;  1ZW7 A;  5CHV C;  5DPT A;  4GDL A;  1WGG A;  2HTH A;  3TIX A;  3SDL C;  2KJ6 A;  1IYF A;  4DBG A;  3L17 A;  3HIZ A;  4HCP B;  3GZN I;  1D3Z A;  2G45 B;  1LQB A;  1WGR A;  2KMA A;  1E7V A;  2FCS A;  2VRR B;  4W9L A;  4MH0 E;  5L95 C;  2PPH A;  3KUZ A;  2BYF A;  1P1A A;  4ZRJ A;  2M0X A;  1YD8 U;  3RUL A;  2BF8 B;  2L8J A;  2MX2 A;  3A9J A;  4GGQ A;  3DVN V;  4NJ6 A;  1UH6 A;  3DPD A;  1UBQ A;  1XQQ A;  2K8H A;  1Q0W B;  2NR2 A;  3QJZ A;  1BT0 A;  2JZZ A;  2MWS B;  3H6N A;  2RSU A;  4OVV A;  2KLC A;  3PV1 A;  4HPL B;  3PRM B;  4NAW A;  3QHT A;  3TL5 A;  1A5R A;  1WJ4 A;  4IM2 A;  2MBO A;  4AP4 C;  5IA7 A;  4W9I A;  3RYT A;  4LJP B;  4IM0 A;  1EUV B;  1XD3 B;  4MSQ B;  1WXA A;  3M62 B;  2KX3 A;  2LGY A;  3T8M A;  1V81 A;  3WIM A;  1EF5 A;  1I35 A;  2MBB B;  2LXC A;  3QC8 B;  2WX1 A;  2HE7 A;  1WIA A;  3I3T B;  1H8C A;  3A33 B;  3NOB A;  2KDB A;  5DPS A;  2PE6 B;  1E5W A;  3KVF B;  5CTR C;  5EDS A;  2CR5 A;  2AWT A;  4WWP A;  5E6O A;  3DVG Y;  2K6D B;  4TV3 A;  2N9P C;  2EMT A;  3ML9 A;  3EFU A;  2KQS A;  3AI5 A;  5FR6 A;  2KTR A;  2K39 A;  5BO4 B;  2DHZ A;  2LXA A;  4KSL C;  2AL6 A;  2LVO A;  2MSE D;  4JL9 A;  4NAW B;  3ZRF A;  1YX6 B;  1S3S G;  5E6P A;  2V4L A;  2KJR A;  2KO3 A;  4CYE A;  2FID A;  2HJ8 A;  3S2A A;  1UEL A;  1S1Q B;  4FLH A;  1ISN A;  2O2V B;  2ZPY A;  4LCD E;  3ONS A;  2GBJ A;  3QK0 A;  2FCM A;  2KJH B;  3RZW C;  1SE9 A;  1WH3 A;  2MP2 B;  3M63 B;  3ZLZ A;  1WMH B;  3PSE B;  2KKC A;  4WJN A;  4F1S A;  4FN2 A;  3ZNI D;  2PE9 A;  3NZS A;  5J17 A;  3C0R B;  4XC2 A;  2DZM A;  1P98 A;  2NCN A;  2UYZ B;  3QX1 A;  3U7D A;  4GMV A;  3PLU A;  3N32 A;  4GIV A;  4IG7 B;  3VXW A;  3PLV A;  3ZW3 A;  5D6J B;  2BYE A;  1QZE A;  3DVG X;  2EKE C;  2KTR B;  4DXA B;  1E8W A;  2N7E A;  1YQB A;  2LUE A;  2Z0E B;  4ANX A;  2A5U A;  1OEY J;  2M1M A;  4GU2 A;  3X23 A;  4JQW C;  2LD9 A;  4GDL B;  4ZRK A;  3ECI A;  3VH4 B;  4KZ0 A;  5CHF A;  3KYC D;  2LAS A;  1GG3 A;  2FIF A;  3PVL A;  4A3P A;  3ZIM A;  4EEW A;  2O6V B;  2R2O A;  1U4A A;  3OJ4 B;  4TQ0 A;  2D07 B;  2PJH A;  2ZCB A;  4K1R B;  1V80 A;  5GMV A;  4ANU A;  4DHJ B;  2HD5 B;  2LVP A;  1Q5W B;  1RRB A;  3WAL A;  2KFJ A;  4M0W B;  3A1Q A;  3IVF A;  2ZNV C;  4HXD A;  4ASW C;  2Z0D B;  1GC6 A;  4EFO A;  3MTN B;  3VTW A;  2AYO B;  1YX5 B;  2G4D B;  2GBM A;  2O6V D;  2G3Q B;  4AJY B;  2KTF A;  2KMC A;  4MDK E;  1GNU A;  4JLC A;  1R4N I;  2J7Q B;  4W9D A;  4HK2 A;  1WXV A;  2IBI B;  2J0J A;  2YLM A;  1JRU A;  3LJ3 A;  2WX0 A;  3UGB B;  3QIJ A;  2M4N A;  2CHW A;  3PRZ A;  4ICU A;  2C7H A;  3SD5 A;  4WWO A;  5AZG A;  2V1Y A;  1NBF C;  4YL8 A;  4JIO U;  2ZJD A;  3BY4 B;  4ANW A;  5LXH A;  3D32 A;  1E7U A;  3PZD A;  3X0W A;  4DK5 A;  3L08 A;  2IO1 B;  2DAJ A;  3V62 A;  4II3 B;  4W9G A;  3RT3 B;  4B6W A;  4DWF A;  4HLE A;  5TR5 A;  1WJ6 A;  4FHK A;  1WE6 A;  5AZF A;  2MBH A;  2CKH B;  3UQA A;  2OJR A;  3A9K B;  5DPR A;  1WZ3 A;  1GC7 A;  1KM7 A;  1P0R A;  1E90 A;  2MLB A;  4B95 A;  4EZL A;  5C1Z A;  3VH3 B;  2ZVO A;  3UIO B;  1WE7 A;  1Z2M A;  3DBS A;  4EZK A;  4W9K A;  2KXJ A;  2RPQ A;  1TGZ B;  1M94 A;  2LGX A;  4KVG B;  3H1U A;  3EHV A;  2B3A A;  3N3K B;  5D2M B;  3DOW A;  5L83 A;  2KNB A;  4AOF A;  1V5O A;  2WDT B;  3KUD B;  4PS7 A;  3VUW A;  2AEH A;  5D7G A;  4BBN F;  4EUT A;  1FXT B;  4PYU A;  1SIF A;  5LXI B;  1NI2 A;  1WYW B;  2J0M A;  4IUM B;  1J8C A;  2O6V A;  3ZTC A;  4LDT B;  2MP2 A;  3AU4 A;  3PT2 B;  2CHX A;  2FAZ A;  2KQ7 A;  4A20 A;  1V9J A;  1XT9 B;  3VTU A;  2Z59 B;  4TKN A;  2XK5 B;  3A1Q B;  3PHW B;  4I6P A;  3NS8 A;  2J0K A;  4NPN A;  1IP9 A;  1L2N A;  2KHW B;  4BKG A;  2KAN A;  3L13 A;  3VTV A;  3VUX A;  4EKU A;  2MA9 B;  1KLV A;  3ZDT A;  3JVZ X;  1IPG A;  2RR9 A;  3QAQ A;  4HDO A;  3WAN A;  2R2Q A;  3IBE A;  3APD A;  1WF9 A;  4IWQ A;  4GXB A;  3CSF A;  2KZR A;  5G55 A;  2JRH A;  3UIN B;  1E8Y A;  1V5T A;  4GOC A;  2DYB A;  2IY1 B;  3R7Q A;  2KWV B;  1V49 A;  2D2Q A;  4MEM A;  4M8M A;  4MGK E;  3DBR I;  4NNJ B;  5G2N A;  1WX8 A;  1OEY A;  2KFK A;  4AUQ C;  3VUY A;  3QAR A;  4A3O A;  4W9H A;  1WJN A;  4FJV B;  1WX9 A;  2C9W B;  3PS6 A;  4CHK A;  2N7D A;  2JVC A;  4HDQ A;  4NQL B;  2FCN A;  4CO7 A;  2JUO A;  3TBL D;  2L00 B;  2KDE B;  1WXM A;  4XZ4 A;  3V60 A;  2G4S A;  3DBH I;  2L7R A;  2LI5 A;  2NPT A;  3AXC A;  3RCZ A;  3OLM D;  1WR6 E;  2NBU A;  4PYZ A;  1EF1 A;  3ZTD A;  5AEK B;  3NY5 A;  1C1Y B;  4FUL A;  4ZYN A;  2LGD A;  5LLI A;  4KIK B;  4PS3 A;  4MGI E;  1WRD B;  2KK8 A;  4FHJ A;  3L54 A;  2M8S A;  1RLF A;  3PRE A;  2UWQ A;  2KOX A;  5CHW A;  3HK0 A;  2K1F A;  1RFA A;  1KOT A;  4K7W A;  2LVQ A;  3TJP A;  2KDI A;  4K7S A;  4II2 B;  3V6C B;  5IAA C;  3DQV A;  3A9K A;  4DHZ E;  2MBQ A;  2KN5 A;  4BKS D;  2N1W A;  4MM3 A;  3ZDM C;  4W9J A;  2N9X A;  4ZRI A;  1I42 A;  5JHB A;  4KZC A;  4GSW A;  3OAW A;  2K6Q A;  1Q1O A;  4GN1 A;  4WJQ A;  2GOW A;  4HVB A;  3ZKJ C;  3ZUN A;  3UQB A;  2WYQ A;  3T9L A;  3HM3 A;  2DZK A;  4BFR A;  5E6N A;  4DDI D;  2WWZ A;  4RM8 A;  2JF5 A;  3RUI B;  3H7P B;  1WX7 A;  3APC A;  3UF8 A;  2DX5 B;  3IHP C;  4JGH B;  3HHM A;  1UD7 A;  2K25 A;  2KDF B;  3H7S A;  4ANV A;  1WY8 A;  3A4S C;  3CMM B;  3EEC A;  3KW5 B;  2ZCC A;  3W1S A;  1Z5S B;  2BPS A;  2KFK B;  4GB9 A;  1G6J A;  1ZGU B; 
#chains in the Genus database with same CATH topology
 4ICV A;  3W1Y A;  2DLB A;  2KT7 A;  2ZPN A;  2QSD A;  3W1S C;  3B08 A;  3HM6 X;  2M56 B;  2QHO A;  1BXT A;  1NYR A;  1V6E A;  4RF0 A;  4N58 A;  3FAH A;  4DHZ B;  1R4M I;  3TEZ A;  2W3S A;  4EOY A;  3R8B A;  2AQ2 B;  4J6I A;  3PHX B;  2JPH A;  4MGY E;  3DWM A;  5JHA A;  3V6E B;  2IO0 B;  2DZI A;  5BMI A;  1OGW A;  4OZA A;  2CU1 A;  3ALB A;  4WJP A;  4AWJ A;  3DVN U;  3ZYY X;  2L0T A;  2WXG A;  3Q14 C;  1YQ4 B;  3AE9 B;  2KLG A;  4GDK A;  3AEG B;  5AZH A;  2WXI A;  1UBI A;  1XXG A;  3AED B;  3ZO5 B;  2JY6 A;  5T8I A;  2D3A A;  2NTT A;  4M00 A;  3MHS D;  4K81 A;  1X1M A;  2NBW B;  4WWN A;  2K3U A;  4HCN B;  3WAP A;  3ZNG C;  2WXN A;  1EM7 A;  1D4B A;  2DEN B;  3DBL B;  1C4A A;  1XLO A;  3ENE A;  2GBR A;  2J53 A;  3U7Z A;  2LGS A;  3RZF A;  1FO4 A;  5J2R A;  4GDK B;  1MHH E;  3B0A A;  4WUR A;  4NJ7 A;  2MJ3 A;  3R7R A;  4C7Z A;  3U30 A;  1FFU A;  1I4P A;  2MQJ A;  1JWU D;  2WXR A;  3H7P A;  1PDX A;  3IFW B;  3M3J A;  5JH5 C;  4X57 B;  1D5Z C;  4JPS A;  1YN4 A;  2RDB C;  2XEW A;  1ZXH A;  3APF A;  3B1L X;  3RD2 A;  2L1A A;  5D3D A;  4BKS A;  4N9F 4;  2BB5 A;  2BS4 B;  2INN E;  4IW0 A;  4WJO A;  4Q2J A;  4LK0 M;  4IWO A;  3L0W B;  3GE3 C;  2I1K A;  3Q6B A;  2VZK D;  4F8C B;  1XLQ A;  3K9O B;  2KAJ A;  2GMI C;  3OG5 A;  2PEA A;  2MH7 A;  1E8Z A;  3BVM A;  3ZNH B;  1FEH A;  3PPA A;  1Q10 A;  4XDD A;  2D11 A;  4E74 A;  3MFG A;  2KC2 A;  4YSY B;  2DAF A;  2OOB B;  1V86 A;  4OVU A;  1OTR B;  1E6E B;  2LRU A;  3BVG A;  5DCN A;  3NUH B;  3VR9 B;  3BII D;  4IKG A;  3NS1 A;  3VHT C;  1WXS A;  4MJS A;  1WM3 A;  2JU6 X;  1ZUD 2;  2JSV X;  3H9D A;  3DHG C;  3RMK C;  3B9J A;  3MC9 A;  2BWF A;  4IM3 A;  3Q69 A;  3WAM A;  4LJO B;  5FR3 A;  3HVZ A;  1ZW7 A;  5DPT A;  1GOZ A;  1WGG A;  3TIX A;  4DXG A;  4DBG A;  3L17 A;  1D3Z A;  2J42 A;  3NVV A;  3KUZ A;  4RCO A;  3P4P B;  1CK1 A;  1IGD A;  2BF8 B;  3AE5 B;  4NJ6 A;  1QKZ A;  3AE4 B;  3QJZ A;  2MWS B;  2KLC A;  5IO9 A;  3PV1 A;  3PRM B;  4NAW A;  1FNV A;  4OZB A;  5IA7 A;  4W9I A;  3AMZ A;  4LJP B;  1EUV B;  4MSQ B;  1TT5 B;  2IPK D;  4GLS C;  3WIM A;  1EF5 A;  1EWC A;  4JE3 B;  1I35 A;  2LXC A;  3I57 A;  3NOB A;  3P4Q B;  2AQ1 B;  5EDS A;  3DVG Y;  2EMT A;  2LMC A;  3EFU A;  3ML9 A;  2WQY B;  5FR6 A;  5BYR A;  4IDI A;  2BTE A;  2K39 A;  3ZRF A;  4KSL C;  4JL9 A;  3NG0 A;  2AX5 A;  4CYE A;  2K0P A;  2ZPY A;  2GBJ A;  4LTU A;  2KJH B;  1SE9 A;  3M63 B;  1T0Q C;  3L4P A;  3PSE B;  2KKC A;  3AM9 A;  3RPF C;  2PE9 A;  3QX1 A;  1VRA B;  3U7D A;  2XN9 C;  3N32 A;  4IG7 B;  5D6J B;  3IT6 B;  3DVG X;  3E56 A;  4DXA B;  2D3B A;  2A5U A;  2M1M A;  4GU2 A;  3X23 A;  2LD9 A;  4GDL B;  1QOF A;  3VH4 B;  1PGX A;  3KYC D;  5FK9 C;  2O6V B;  3OJ4 B;  1U4A A;  3LB8 C;  4K1R B;  1D5M C;  1RYJ A;  2LVP A;  1Q5W B;  1RRB A;  3A1Q A;  1CZP A;  3W9C B;  4HXD A;  1HZ6 A;  3AB5 A;  5MPO A;  3LYY A;  2GBM A;  4MDK E;  3BYY B;  1SB3 C;  2KDM A;  1FIQ A;  3KLS X;  2ZW1 A;  1TS5 A;  1EU3 A;  2YLM A;  3R2I A;  2WXO A;  1I4H A;  3SD5 A;  2C7H A;  4WWO A;  4JIO U;  3D32 A;  1JRP A;  2JZP A;  3L08 A;  2DAJ A;  4L1B A;  4W9G A;  3RT3 B;  5TR5 A;  4FHK A;  2MBH A;  2CKH B;  3UQA A;  3Q8E A;  3VH3 B;  3BVZ A;  2HJ1 A;  3AE1 B;  1MG4 A;  1F2R C;  2LGX A;  3EHV A;  3HUI A;  3N3K B;  5D2M B;  2KNB A;  3FIL B;  1TKE A;  3PZ7 A;  4PS7 A;  3KUD B;  2AEH A;  1F2R I;  4UDU C;  3U52 E;  1ACC A;  5HHD G;  2J0M A;  1DGJ A;  4LNO A;  2KMM A;  3PHW B;  3NS8 A;  1VZ8 A;  2KAN A;  4EKU A;  2MA9 B;  3ZDT A;  3JVZ X;  4HDO A;  3RNE C;  3APD A;  1I4R A;  1WF9 A;  5BMH A;  4GXB A;  1QLB B;  2KZR A;  5G55 A;  2JRH A;  1V49 A;  4MGK E;  1HTO A;  1K51 A;  2KQ4 X;  2KFK A;  1CQV A;  1WJN A;  3ZXR A;  4CHK A;  2N7D A;  4HDQ A;  4CO7 A;  2FCN A;  2L00 B;  3RNA C;  2G4S A;  3DBH I;  3N1Y C;  3AXC A;  2BYT A;  3OLM D;  1EF1 A;  2QIL A;  4JWU C;  1CJE A;  5LLI A;  4PS3 A;  4YWG G;  4MGI E;  3AE3 B;  4WAF A;  1MHX A;  3PRE A;  2KOX A;  1L6U A;  1KOT A;  1FCC C;  2QCZ A;  2Z8L A;  4XGA B;  2KN5 A;  2N1W A;  2PLP A;  2IGD A;  2N9X A;  4C00 A;  5JHB A;  2W55 A;  1C4P A;  3Q2A C;  2K6Q A;  1Q1O A;  1F52 A;  4HVB A;  3ZKJ C;  3MP9 A;  3UQB A;  1YQ3 B;  3HM3 A;  1JQ4 A;  4BFR A;  4DQO C;  5E6N A;  1DOI A;  2ON8 A;  2WWZ A;  3AE8 B;  4JGH B;  1J7A A;  5D3I B;  2NMQ A;  3H7S A;  1WY8 A;  1K52 A;  2MHJ A;  4XWT A;  1Z5S B;  2BPS A;  1UGJ A;  4KGT A;  1P1A A;  4W9C A;  2FUG 1;  1LXD A;  2JT4 B;  1RAX A;  1EO6 A;  1TS2 A;  3VVW B;  2MCN B;  1J0G A;  5C23 A;  4KGR A;  4G3X B;  1YNT E;  2N0S B;  2D3G A;  4G11 A;  1RWS A;  3PGE A;  4PT5 A;  2JRI B;  3JYU A;  4N6E B;  2KWU B;  4MEL A;  1TBE A;  5J18 A;  4KSK C;  4XE0 A;  4MH8 A;  3ZRC A;  1BML C;  1N5W A;  3GP7 A;  3AV8 A;  2RD0 A;  3N9Y C;  1YJ1 A;  4YSZ B;  3GZN B;  2R61 A;  5HFY A;  2EMS A;  4OHJ A;  3VDZ A;  5KHO A;  3QWZ B;  4FAD A;  2W9N A;  3A9J B;  1E8X A;  4RFB A;  1WJU A;  1FNU A;  2INC C;  1YIW A;  1VR9 A;  2DZJ A;  1AAR A;  2ZZP B;  2CS4 A;  2K8C A;  1C76 A;  1L0X B;  2ZEQ A;  3DHI C;  1OQY A;  1UGM A;  4O1N A;  2ZVN A;  4J3O D;  1T0Y A;  1MJD A;  4BOS C;  1WZ0 A;  4YTP B;  4NY0 A;  3PTF C;  4IWP A;  1MPE A;  1TY0 A;  2BBC A;  2WDR B;  3DDC B;  3ML8 A;  1HA5 A;  2KC1 A;  1SXT A;  2MBE A;  1LM8 B;  4ZRQ A;  4HWI B;  4IOI E;  4FA6 A;  2DYO A;  4KIK A;  2IZV B;  5C3J B;  1P7F A;  3N1X C;  1V97 A;  4ZOH C;  4E3C A;  1WGY A;  1TTN A;  2JXT A;  1J7C A;  1Y8R C;  1PQS A;  2RGF A;  3KYD D;  2LFI A;  3IXS A;  1N6Z A;  4MSM B;  2NBV B;  1FFV A;  4HPM B;  1L5P A;  1WSP A;  1WXQ A;  4MGZ E;  4FJZ A;  3PRP B;  2KVR A;  4MJS B;  3SHQ A;  2KAC A;  3Q3F A;  1R4N B;  1C4C A;  2N1V A;  4RMA A;  2C5L C;  2XNA C;  4WAA A;  1FRR A;  1L7Y A;  3TEW A;  3E9S A;  2YVC A;  2BQQ A;  4TQ1 A;  2QJL A;  2FBW B;  3W5U B;  1FXI A;  2AL3 A;  3AEE B;  3R66 C;  3BZD B;  1TZ1 A;  3NVW A;  5CX3 A;  1ZKH A;  2O2V A;  1GUA B;  2C7M B;  2MRP A;  2BVC A;  4DHJ D;  5GXG B;  3C19 A;  1ZE3 D;  4DDG D;  1J19 A;  1WI0 A;  3JSV B;  3O65 B;  3V61 A;  1N61 A;  3QA8 A;  2OJW A;  3DBR B;  4G0N B;  5HKH A;  2JWZ A;  3ETR A;  4KKI A;  2I38 A;  1GPX A;  4P6V F;  1JW9 D;  4HCP B;  2KMA A;  3NZ3 A;  1VZ6 A;  1ZP0 B;  2Q5W D;  3Q8A A;  2BYF A;  4ZRJ A;  2Y3A A;  4GGQ A;  2L8J A;  3A9J A;  3DVN V;  1UH6 A;  1XQQ A;  1ROE A;  4DXF A;  3RNF C;  4OVV A;  2WS3 B;  3QHT A;  3TL5 A;  1A5R A;  2VH1 A;  3AE2 B;  5AUK A;  2LGY A;  3T8M A;  2QEJ C;  2MBB B;  3QC8 B;  2WX1 A;  1WIA A;  3I3T B;  2GI9 A;  3A33 B;  2KDB A;  2N9L A;  1JCK B;  2CR5 A;  4WWP A;  5G5H A;  2WXJ A;  3ZGZ A;  1V1P B;  1S3S G;  2V4L A;  1XLN A;  1STE A;  2VH2 A;  2HJ8 A;  3S2A A;  4LCD E;  5FKA C;  3ONS A;  3RZW C;  2MP2 B;  1V8C A;  4FN2 A;  1PGA A;  3NZS A;  4XC2 A;  2DZM A;  5I4D A;  2K5P A;  1N63 A;  4GMV A;  4N59 A;  2K22 A;  2BYE A;  1QZE A;  3H8H A;  3FIL A;  2Z0E B;  1OEY J;  2H89 B;  3C8Y A;  1AW7 A;  4TQ0 A;  2R2O A;  2D07 B;  2PJH A;  2ZCB A;  2WXQ A;  1KLG D;  2Z0D B;  1FPY A;  2G4D B;  3V3X A;  4AJY B;  1GNU A;  1KH0 A;  1YMH E;  1BUI C;  2WP9 B;  4W9D A;  1WXV A;  2IBI B;  2J4X A;  4A90 A;  2BS2 B;  3UGB B;  3QIJ A;  2EKI A;  2V1Y A;  1NBF C;  4YL8 A;  3BY4 B;  2DWQ A;  1E7U A;  3PZD A;  1UNS A;  4DK5 A;  3U2S C;  3V62 A;  4II3 B;  2ONQ A;  2PW9 A;  2KYW A;  1JAL A;  2OJR A;  1P0R A;  2MLB A;  2WXH A;  5C1Z A;  4P1C C;  1WE7 A;  1HQR D;  1WWT A;  1Z2M A;  3AEB B;  2N9K A;  1TGZ B;  1JWA D;  1I7H A;  3DOW A;  1V5O A;  1ZXI A;  4K3C A;  1VZ7 A;  1SBB B;  3GE8 C;  3GB1 A;  1L4Z B;  5LXI B;  1WYW B;  3AU4 A;  1V9J A;  1UF0 A;  3VTU A;  2Z59 B;  4TKN A;  1AYF A;  2XK5 B;  4I6P A;  3KQ4 A;  2J0K A;  4YT0 B;  4US9 A;  1IP9 A;  1L2N A;  2KHW B;  3VUX A;  4RNA A;  5HI1 A;  3IBE A;  4IWQ A;  1K50 A;  2WXK A;  3VFK A;  3R7Q A;  4ACF A;  4MEM A;  4M8M A;  4NNJ B;  4AUQ C;  1PUT A;  4W9H A;  1C77 A;  1JWS D;  2LI5 A;  1FD6 A;  3RCZ A;  2G1E A;  2NBU A;  5AEK B;  3NY5 A;  3AEF B;  1C1Y B;  2WU2 B;  2CU3 A;  4KIK B;  4ZHP A;  2SEB D;  4FHJ A;  2WGS A;  3L54 A;  2FE8 A;  1XCQ L;  1F1H A;  4C4V A;  3MJ5 A;  5CHW A;  3HK0 A;  2K1F A;  1RFA A;  3TJP A;  1ET9 A;  5H92 C;  4II2 B;  3V6C B;  1SEB D;  4DHZ E;  3VR8 B;  1FM0 D;  1TZO A;  1I42 A;  1NEK B;  1T0S C;  3OAW A;  4GN1 A;  4RGO S;  1AN8 A;  2WYQ A;  2DZK A;  1L0V B;  3CIR B;  4DDI D;  2JF5 A;  2WXP A;  3RUI B;  2OED A;  3APC A;  3V05 A;  1QOA A;  1ZDX A;  3CMM B;  1JWB D;  1XEE A;  3A4S C;  1OQR A;  5G5G A;  2JWU A;  2KWC A;  1WFY A;  2XK5 A;  2GB1 A;  5DPW A;  4K7U A;  4I6N B;  1E0Z A;  4FJY A;  1KJT A;  2M17 A;  2XBB C;  3ZNZ B;  2NPT B;  3R2T A;  2L3Z A;  4KV2 A;  2CJN A;  2FNJ B;  4ZDV A;  4W9E A;  4XDC A;  3OWE B;  4HRO A;  2NVU I;  1DYQ A;  4E71 A;  2W54 A;  4LLG M;  4TUU A;  2C60 A;  1P9D U;  4LNF A;  2V3S A;  3M95 A;  1C3T A;  2BGF A;  4URK A;  1E9M A;  2LRW A;  3QQ8 B;  1I4G A;  2BKR B;  1L6V A;  2WDQ B;  1VD2 A;  3HVD A;  1ZDV A;  4KDI C;  4K3B A;  2K8B A;  1SE3 A;  3AE7 B;  2N4F A;  1I4X A;  1QQR A;  3ZJT A;  2L83 A;  3EGR A;  3MC0 B;  2G9H D;  2QDF A;  3N1Z C;  1ZPS A;  2A4Z A;  1WYG A;  3NHE B;  4XX5 A;  4FBJ B;  1NDD A;  3BWU D;  1HE8 A;  4REZ A;  4W9F A;  3SR6 A;  3TCA A;  4XYC A;  1KTK A;  2LEK A;  2GBK A;  3T3N A;  1XLP A;  2MJE A;  3J9C A;  4RGM A;  1B1Z A;  4G50 A;  2BWE S;  2IY0 B;  1T6B X;  3NZU A;  4RM9 A;  4PS8 A;  1SIJ A;  4HJG E;  5EE1 A;  1CMX B;  3EFC A;  4WWM A;  2VZK B;  2LZ6 A;  3GS2 A;  1P7E A;  4ARI A;  4LDT D;  4M01 A;  2JXX A;  4KGS A;  3AUL A;  3AU5 A;  5EE3 A;  1F9J A;  1UZX B;  3TMP B;  5IKC M;  1LFD A;  4I6L B;  4KDL B;  3EA6 A;  3IAM 1;  3LXF A;  5IOI A;  3SU8 X;  3WAO A;  2GBN A;  4BVU C;  1Y56 A;  1D5X C;  2OHF A;  4BBN C;  2NS5 A;  2IYD B;  2I1J A;  4HJK A;  2BYV E;  3Q3J A;  1GJZ A;  5JZE B;  3QCA A;  3GOE A;  3MJW A;  1WMH A;  4IC7 B;  3I63 C;  1T0R C;  1OQQ A;  2FCQ A;  2IGG A;  1H4R A;  1UWM A;  2DYM A;  2LJ5 A;  2L76 A;  2KN4 A;  1SGH A;  4AJW A;  1WGD A;  3EC8 A;  4ZHO A;  4LNN A;  5CHV C;  2EEL A;  1LQB A;  1WGR A;  1E7V A;  3RN9 C;  4AS1 A;  2VRR B;  4MH0 E;  5L95 C;  4HPP A;  1TYG B;  1DOY A;  2M0X A;  1RM6 C;  4TSS A;  2MX2 A;  1YN5 A;  4ITK A;  3DPD A;  1YJJ A;  2K8H A;  1Q0W B;  2WLB A;  1BT0 A;  3H6N A;  1TKY A;  4HPL B;  3Q8B A;  2LHD A;  2MBO A;  1V1P A;  4AP4 C;  3Q3M C;  3UI3 A;  3RYT A;  4IM0 A;  2JX5 A;  1WXA A;  3M62 B;  1V81 A;  3DHH C;  2QIE B;  3T3O A;  2L52 A;  1E5W A;  5CTR C;  2AWT A;  4YSX B;  2K6D B;  4TV3 A;  2N9P C;  2KQS A;  3AI5 A;  3BK1 A;  4JX1 C;  2DHZ A;  5BO4 B;  2LVO A;  2MSE D;  2KO3 A;  3ABV B;  1LO5 D;  2FID A;  1F0Z A;  1UEL A;  1NEN B;  4FLH A;  1ISN A;  2O2V B;  3QK0 A;  2FCM A;  1WH3 A;  3ZLZ A;  4M0W A;  4WJN A;  3IT4 B;  4F1S A;  3DBH B;  4L2Y A;  1N5X A;  5J17 A;  3C0R B;  2NCN A;  4C56 C;  3PLV A;  1MFW A;  2WXF A;  3AE6 B;  4L23 A;  1SJE D;  3ZQ4 A;  2EKE C;  2N7J A;  2E3T A;  5IN7 A;  1NVI D;  1LGR A;  2V3N A;  4JQW C;  4ZRK A;  3ECI A;  5CHF A;  2LAS A;  3PVL A;  4EEW A;  3ZIM A;  1TIF A;  4DHJ B;  4ANU A;  1V80 A;  4JWS C;  2HD5 B;  3CWI A;  3WAL A;  1DOX A;  1PYW D;  4M0W B;  3IVF A;  2ZNV C;  1GC6 A;  4P1B C;  4A55 A;  2PVO D;  2JYE A;  3AH7 A;  2O6V D;  2KTF A;  2KMC A;  2LHE A;  1YJI A;  2J7Q B;  1WGK A;  4HK2 A;  1JRO A;  4A9A A;  2BW2 A;  3RFZ B;  2WX0 A;  2M4N A;  2CHW A;  3Q3N C;  4ICU A;  1T3Q A;  5AZG A;  1SJH D;  2ZJD A;  2RPV A;  4ANW A;  5LXH A;  3KWV A;  2IGH A;  1VDV A;  5TSS A;  4HLE A;  1WJ6 A;  5AZF A;  3A9K B;  5DPR A;  4RGN A;  1WZ3 A;  1KM7 A;  1E90 A;  4B95 A;  3UIO B;  3DBS A;  4EZK A;  4W9K A;  1M94 A;  2B3A A;  2WDT B;  4BBN F;  1FXT B;  2B76 B;  4NZL B;  4IUM B;  3ZTC A;  4LDT B;  1HXY D;  2MP2 A;  3PT2 B;  2CHX A;  4XWW A;  2KQ7 A;  4A20 A;  3SFD B;  3AN1 A;  3A1Q B;  3VTV A;  1KLV A;  2CJO A;  4KKJ A;  1ESF A;  3FKY A;  4C80 A;  3CSF A;  1NYQ A;  4PK1 A;  2AQ3 B;  1L0Y B;  3UIN B;  1E8Y A;  2DYB A;  2IY1 B;  2KWV B;  4C4V B;  2HDE A;  4A8X C;  1EWY C;  1OEY A;  3VUY A;  4A3O A;  2X38 A;  1WX9 A;  2C9W B;  4C7Y A;  2JVC A;  4NQL B;  4RGT A;  3P4S B;  2KDE B;  1WXM A;  4XZ4 A;  1A70 A;  1WR6 E;  4PYZ A;  1D6E C;  1E10 A;  3ZTD A;  4FUL A;  2LGD A;  2PTL A;  2IJ0 A;  3P42 A;  2WXL A;  1RLF A;  2UWQ A;  1SSN A;  3FC4 A;  3NJT A;  2DBY A;  4K7W A;  2KDI A;  4LNK A;  2JYT A;  3DQV A;  2MBQ A;  3ZDM C;  4W9J A;  1QOB A;  4P16 A;  4ZRI A;  2D5G A;  4GSW A;  1UUP A;  4WJQ A;  3EUB 2;  3ZUN A;  3T9L A;  4KX6 B;  3O13 A;  4CQN A;  2MJD A;  4WH4 A;  1WRI A;  3H7P B;  1IUE A;  1HTQ A;  2E6X A;  2DX5 B;  3IHP C;  3U4E G;  1UD7 A;  2K25 A;  3W1S A;  2ZCC A;  1GAQ B;  3NVZ A;  4R3D A;  2KFK B;  2RDH A;  1NI3 A;  1MG8 A;  3N30 A;  3R3M A;  3KUC B;  2MW5 A;  4YXD B;  1HZ5 A;  4M8N A;  2JZ3 B;  5KHQ A;  4MAC A;  3BK2 A;  1SF0 A;  4EZJ A;  2KD0 A;  3I5J C;  1QT9 A;  2D10 A;  1PGB A;  2TSS A;  3UIP B;  1HEZ E;  3PZ8 A;  2M0A A;  3U8Z A;  2ASQ A;  2C7N B;  3L10 B;  1GB4 A;  2ZW0 A;  3LDZ E;  4BKT A;  3CF6 E;  3K9P B;  3A4R A;  1C9F A;  1WM2 A;  4MM3 B;  3BIN A;  4P7I A;  1RFK A;  3P63 A;  2IO2 B;  3SFE B;  1QF6 A;  3IG3 A;  4OZC A;  3JW0 X;  2ICI A;  3W5V B;  3MC8 A;  3VAW A;  2REX A;  2FUH B;  3P2B A;  3IAS 1;  3N20 C;  1VCB A;  4NQK E;  2BB6 A;  4BOZ B;  4US8 A;  2L0F A;  4B0M A;  3DCG A;  3JSV A;  4WQM A;  2MEK A;  4WQO B;  1L4D B;  2M19 A;  2WXM A;  3KH0 A;  3VQI A;  2L05 A;  3W2D A;  2ZNV B;  4A6Q A;  1KRH A;  2KX0 A;  3TEX A;  1K8R B;  4USA A;  5D94 A;  2V9H A;  1WGH A;  2CHZ A;  3RNG C;  4EE2 A;  1IBX A;  2Y5B B;  4HRS A;  1IGC A;  2H88 B;  1MVK A;  3OJ3 A;  2LWP A;  1KLU D;  3WA0 A;  3WCQ A;  2PMV A;  2NTS A;  3B2F A;  5BYS A;  1YOV B;  3AEC B;  3L16 A;  3CST A;  3DBL I;  4AQ7 A;  2BKF A;  1V2Y A;  3AEA B;  1FXA A;  2N9E B;  3I9V 1;  3TEY A;  3ZVV A;  1J7B A;  2INP E;  1P3Q U;  3URY A;  4B9K A;  1E7P B;  2X8X X;  1WR1 A;  4ZYS A;  1XO3 A;  2WNM A;  2WDV B;  1ZOY B;  4QAY A;  2IO3 B;  4F7Z A;  1EU4 A;  1B9R A;  3BYT B;  4GDL A;  2HTM E;  5BYQ A;  2HTH A;  3KWL A;  4OW0 A;  1SE4 A;  3SDL C;  2KJ6 A;  1IYF A;  4S0R A;  3HIZ A;  4RH6 A;  3GZN I;  2LUM A;  1V1O A;  2G45 B;  2FCS A;  2YEP F;  4W9L A;  2PPH A;  2IDY A;  1TS3 A;  1YD8 U;  4BAX A;  3RUL A;  5BMG A;  4OVZ A;  1UBQ A;  2NR2 A;  3TUO A;  3ZJU A;  2JZZ A;  2RSU A;  2K9X A;  1WJ4 A;  4IM2 A;  2D3C A;  5H8Y E;  3Q8F A;  1XD3 B;  4BZA A;  2KX3 A;  1F77 A;  5IP4 D;  1C78 A;  2HE7 A;  1IBX B;  3RNB C;  1H8C A;  5DPS A;  2PE6 B;  3KVF B;  3P1M A;  5E6O A;  3VRB B;  4YTN B;  1QIL A;  2KTR A;  2DNF A;  2LXA A;  4NAW B;  2AL6 A;  1YX6 B;  4HKZ E;  2JQR B;  5E6P A;  2KJR A;  1I4Q A;  1KF6 B;  1S1Q B;  1WMH B;  1FRD A;  3ZNI D;  1VJK A;  2KVZ A;  2GLS A;  1P98 A;  2UYZ B;  3PLU A;  3VXW A;  4GIV A;  3ZW3 A;  2KWD A;  1ET6 A;  1R7S A;  4M02 A;  2KTR B;  1E8W A;  2N7E A;  1YQB A;  2LUE A;  4ANX A;  3B2G A;  2LGI A;  1KFY B;  1FCL A;  1XCT L;  4KZ0 A;  1GG3 A;  2FIF A;  4A3P A;  1TY2 A;  5JXV A;  5GMV A;  3NRZ A;  2KFJ A;  4WIP A;  4TMA B;  1JWM D;  4NAM A;  4LNI A;  4ASW C;  4EFO A;  5EE9 A;  1AWD A;  3MTN B;  3VTW A;  4S17 A;  2AYO B;  1YX5 B;  2G3Q B;  4JLC A;  1R4N I;  2L32 A;  1N60 A;  3RNC C;  2J0J A;  1R4M B;  2WU5 B;  1JRU A;  3LJ3 A;  3PRZ A;  4ZRP A;  2IND C;  2V0G A;  3X0W A;  2IO1 B;  4B6W A;  4DWF A;  1WE6 A;  1FNW A;  1GC7 A;  2W82 A;  4EZL A;  2ZVO A;  1VLB A;  2SAK A;  2KXJ A;  2RPQ A;  2Y5P A;  3RI7 C;  4KVG B;  3H1U A;  2LJI A;  3Q8C A;  5L83 A;  2BT6 A;  4AOF A;  3VUW A;  2I2Y A;  2J52 A;  1N62 A;  5D7G A;  4EUT A;  3PO0 A;  4PYU A;  1SIF A;  5C2T B;  1NI2 A;  1J8C A;  2O6V A;  2FAZ A;  1XT9 B;  2WHI A;  4D2K A;  1K53 A;  3SEB A;  5LNK 1;  4NPN A;  3DWG C;  4BKG A;  3L13 A;  5E6J A;  1IPG A;  2RR9 A;  1FMA D;  3QAQ A;  5AUI A;  3WAN A;  5EE0 A;  2R2Q A;  3NVY A;  2ACZ B;  2V3P A;  2QMT A;  1QOG A;  1SE2 A;  4NJC A;  1V5T A;  4GOC A;  3VRA B;  1PFD A;  2D2Q A;  2BS3 B;  3DBR I;  5G2N A;  1WX8 A;  3QAR A;  4FJV B;  3Q3O C;  3TSS A;  4B0E A;  3PS6 A;  4YTM B;  2JUO A;  3TBL D;  2Y5C A;  4FXC A;  3V60 A;  2QC8 A;  2L7R A;  2NPT A;  4ZYN A;  2PVG C;  2GRI A;  2PIA A;  3HRD D;  4H2A A;  1WRD B;  2KK8 A;  4ARC A;  1M4V A;  1ENF A;  5HG2 A;  2M8S A;  3MHZ A;  4MT5 A;  1XF5 L;  4HKQ A;  1T5X D;  1TKG A;  3ZJV A;  2LVQ A;  4K7S A;  1C79 A;  5IAA C;  2W3R A;  3A9K A;  2V4I B;  1YN3 A;  4RF1 A;  4BKS D;  4MM3 A;  1TJE A;  1UWX A;  2YEP B;  4KZC A;  3P4R B;  1MI0 A;  2GOW A;  3ZXV A;  4RM8 A;  1JML A;  1WX7 A;  2UU7 A;  3UF8 A;  2PKO A;  3HHM A;  4ANV A;  2KDF B;  4HEA 1;  3EEC A;  1OFF A;  3KW5 B;  2RMM A;  1GB1 A;  2RDG A;  1G6J A;  4GB9 A;  1ZGU B;  1TS4 A; 
#chains in the Genus database with same CATH homology
 2KWC A;  4ICV A;  1WFY A;  1MG8 A;  2XK5 A;  4W9C A;  3W1Y A;  5DPW A;  4K7U A;  2ZPN A;  4I6N B;  3N30 A;  1LXD A;  2JT4 B;  3W1S C;  4FJY A;  1KJT A;  1RAX A;  1EO6 A;  2M17 A;  2XBB C;  3B08 A;  2QHO A;  3HM6 X;  3R3M A;  2MCN B;  2NPT B;  3VVW B;  2L3Z A;  2MW5 A;  3KUC B;  4KV2 A;  3ZNZ B;  1J0G A;  2FNJ B;  5C23 A;  4ZDV A;  4M8N A;  4W9E A;  1V6E A;  4G3X B;  2JZ3 B;  5KHQ A;  4DHZ B;  1R4M I;  4EZJ A;  2D3G A;  2KD0 A;  4G11 A;  2NVU I;  4EOY A;  2D10 A;  4E71 A;  3PGE A;  2JRI B;  4J6I A;  3JYU A;  3PHX B;  4TUU A;  2JPH A;  3UIP B;  2C60 A;  4MGY E;  2KWU B;  5JHA A;  3V6E B;  1P9D U;  2ASQ A;  3U8Z A;  2IO0 B;  2V3S A;  4MEL A;  1TBE A;  2C7N B;  2DZI A;  3L10 B;  5J18 A;  4KSK C;  3M95 A;  1C3T A;  1OGW A;  2BGF A;  4URK A;  3ZRC A;  2RD0 A;  2LRW A;  1YJ1 A;  3LDZ E;  3QQ8 B;  2CU1 A;  3ALB A;  4WJP A;  4AWJ A;  2BKR B;  3DVN U;  4BKT A;  3CF6 E;  3K9P B;  2EMS A;  1VD2 A;  2L0T A;  3A4R A;  3VDZ A;  4KDI C;  5KHO A;  2K8B A;  3QWZ B;  1WM2 A;  2KLG A;  4FAD A;  2W9N A;  3A9J B;  1E8X A;  3BIN A;  4GDK A;  4P7I A;  5AZH A;  1WJU A;  1UBI A;  1YIW A;  2DZJ A;  1AAR A;  2JY6 A;  3ZO5 B;  2N4F A;  2ZZP B;  2CS4 A;  2K8C A;  3MHS D;  2IO2 B;  4K81 A;  2ZEQ A;  1OQY A;  3IG3 A;  1X1M A;  3JW0 X;  1UGM A;  2NBW B;  4WWN A;  4HCN B;  3WAP A;  3ZNG C;  2ZVN A;  1T0Y A;  4BOS C;  2A4Z A;  3VAW A;  1WZ0 A;  2DEN B;  4NY0 A;  3NHE B;  3PTF C;  4XX5 A;  1NDD A;  4IWP A;  4FBJ B;  3ENE A;  2REX A;  3DDC B;  3ML8 A;  2FUH B;  3P2B A;  1HE8 A;  2GBR A;  2KC1 A;  1VCB A;  4NQK E;  3RZF A;  4BOZ B;  2MBE A;  4W9F A;  1LM8 B;  2L0F A;  5J2R A;  4GDK B;  3B0A A;  3DCG A;  3TCA A;  3JSV A;  4NJ7 A;  4HWI B;  3R7R A;  2GBK A;  3U30 A;  4WQO B;  4FA6 A;  2MQJ A;  2DYO A;  3H7P A;  4KIK A;  4G50 A;  3IFW B;  2BWE S;  2IZV B;  3KH0 A;  3VQI A;  2L05 A;  2IY0 B;  3M3J A;  3NZU A;  4E3C A;  4RM9 A;  1WGY A;  4PS8 A;  1TTN A;  2ZNV B;  5JH5 C;  1Y8R C;  1PQS A;  1CMX B;  4X57 B;  2RGF A;  2LZ6 A;  3KYD D;  2KX0 A;  2XEW A;  3APF A;  3B1L X;  3RD2 A;  4LDT D;  2NBV B;  1K8R B;  4MSM B;  4BKS A;  2JXX A;  4N9F 4;  5D94 A;  4HPM B;  4IW0 A;  4WJO A;  4MGZ E;  1WGH A;  3AUL A;  4FJZ A;  3AU5 A;  3PRP B;  4IWO A;  3L0W B;  2CHZ A;  2I1K A;  1F9J A;  4F8C B;  2KVR A;  4MJS B;  3K9O B;  1UZX B;  3SHQ A;  3TMP B;  2Y5B B;  1LFD A;  2GMI C;  3Q3F A;  4I6L B;  2PEA A;  4RMA A;  2N1V A;  3OJ3 A;  4KDL B;  2C5L C;  2LWP A;  3SU8 X;  1E8Z A;  3WA0 A;  4WAA A;  3ZNH B;  3VFK A;  1L7Y A;  3WAO A;  3PPA A;  2YVC A;  3L16 A;  2D11 A;  2GBN A;  3CST A;  4TQ1 A;  4BVU C;  4E74 A;  2KC2 A;  3DBL I;  2DAF A;  2OOB B;  2AL3 A;  1V86 A;  4OVU A;  2BKF A;  2NS5 A;  1V2Y A;  1OTR B;  4BBN C;  3R66 C;  2IYD B;  1TZ1 A;  2I1J A;  2LRU A;  4HJK A;  2BYV E;  3Q3J A;  5DCN A;  1GJZ A;  5CX3 A;  1ZKH A;  2N9E B;  1GUA B;  2O2V A;  3QCA A;  5JZE B;  3GOE A;  2C7M B;  3MJW A;  3ZVV A;  2MRP A;  1WMH A;  3VHT C;  1WXS A;  1P3Q U;  4DHJ D;  4IC7 B;  4MJS A;  4B9K A;  1WM3 A;  2FCQ A;  4DDG D;  1J19 A;  1WI0 A;  3H9D A;  1WR1 A;  3JSV B;  1H4R A;  3O65 B;  3V61 A;  2DYM A;  3QA8 A;  2LJ5 A;  2L76 A;  1SGH A;  4AJW A;  2BWF A;  1WGD A;  2IO3 B;  4F7Z A;  4IM3 A;  3WAM A;  4LJO B;  3EC8 A;  4G0N B;  5HKH A;  2JWZ A;  1ZW7 A;  5CHV C;  5DPT A;  4GDL A;  1WGG A;  2HTH A;  3TIX A;  3SDL C;  2KJ6 A;  1IYF A;  4DBG A;  3L17 A;  3HIZ A;  4HCP B;  3GZN I;  1D3Z A;  2G45 B;  1LQB A;  1WGR A;  2KMA A;  1E7V A;  2FCS A;  2VRR B;  4W9L A;  4MH0 E;  5L95 C;  2PPH A;  3KUZ A;  2BYF A;  1P1A A;  4ZRJ A;  2M0X A;  1YD8 U;  3RUL A;  2BF8 B;  2L8J A;  2MX2 A;  3A9J A;  4GGQ A;  3DVN V;  4NJ6 A;  1UH6 A;  3DPD A;  1UBQ A;  1XQQ A;  2K8H A;  1Q0W B;  2NR2 A;  3QJZ A;  1BT0 A;  2JZZ A;  2MWS B;  3H6N A;  2RSU A;  4OVV A;  2KLC A;  3PV1 A;  4HPL B;  3PRM B;  4NAW A;  3QHT A;  3TL5 A;  1A5R A;  1WJ4 A;  4IM2 A;  2MBO A;  4AP4 C;  5IA7 A;  4W9I A;  3RYT A;  4LJP B;  4IM0 A;  1EUV B;  1XD3 B;  4MSQ B;  1WXA A;  3M62 B;  2KX3 A;  2LGY A;  3T8M A;  1V81 A;  3WIM A;  1EF5 A;  1I35 A;  2MBB B;  2LXC A;  3QC8 B;  2WX1 A;  2HE7 A;  1WIA A;  3I3T B;  1H8C A;  3A33 B;  3NOB A;  2KDB A;  5DPS A;  2PE6 B;  1E5W A;  3KVF B;  5CTR C;  5EDS A;  2CR5 A;  2AWT A;  4WWP A;  5E6O A;  3DVG Y;  2K6D B;  4TV3 A;  2N9P C;  2EMT A;  3ML9 A;  3EFU A;  2KQS A;  3AI5 A;  5FR6 A;  2KTR A;  2K39 A;  5BO4 B;  2DHZ A;  2LXA A;  4KSL C;  2AL6 A;  2LVO A;  2MSE D;  4JL9 A;  4NAW B;  3ZRF A;  1YX6 B;  1S3S G;  5E6P A;  2V4L A;  2KJR A;  2KO3 A;  4CYE A;  2FID A;  2HJ8 A;  3S2A A;  1UEL A;  1S1Q B;  4FLH A;  1ISN A;  2O2V B;  2ZPY A;  4LCD E;  3ONS A;  2GBJ A;  3QK0 A;  2FCM A;  2KJH B;  3RZW C;  1SE9 A;  1WH3 A;  2MP2 B;  3M63 B;  3ZLZ A;  1WMH B;  3PSE B;  2KKC A;  4WJN A;  4F1S A;  4FN2 A;  3ZNI D;  2PE9 A;  3NZS A;  5J17 A;  3C0R B;  4XC2 A;  2DZM A;  1P98 A;  2NCN A;  2UYZ B;  3QX1 A;  3U7D A;  4GMV A;  3PLU A;  3N32 A;  4GIV A;  4IG7 B;  3VXW A;  3PLV A;  3ZW3 A;  5D6J B;  2BYE A;  1QZE A;  3DVG X;  2EKE C;  2KTR B;  4DXA B;  1E8W A;  2N7E A;  1YQB A;  2LUE A;  2Z0E B;  4ANX A;  2A5U A;  1OEY J;  2M1M A;  4GU2 A;  3X23 A;  4JQW C;  2LD9 A;  4GDL B;  4ZRK A;  3ECI A;  3VH4 B;  4KZ0 A;  5CHF A;  3KYC D;  2LAS A;  1GG3 A;  2FIF A;  3PVL A;  4A3P A;  3ZIM A;  4EEW A;  2O6V B;  2R2O A;  1U4A A;  3OJ4 B;  4TQ0 A;  2D07 B;  2PJH A;  2ZCB A;  4K1R B;  1V80 A;  5GMV A;  4ANU A;  4DHJ B;  2HD5 B;  2LVP A;  1Q5W B;  1RRB A;  3WAL A;  2KFJ A;  4M0W B;  3A1Q A;  3IVF A;  2ZNV C;  4HXD A;  4ASW C;  2Z0D B;  1GC6 A;  4EFO A;  3MTN B;  3VTW A;  2AYO B;  1YX5 B;  2G4D B;  2GBM A;  2O6V D;  2G3Q B;  4AJY B;  2KTF A;  2KMC A;  4MDK E;  1GNU A;  4JLC A;  1R4N I;  2J7Q B;  4W9D A;  4HK2 A;  1WXV A;  2IBI B;  2J0J A;  2YLM A;  1JRU A;  3LJ3 A;  2WX0 A;  3UGB B;  3QIJ A;  2M4N A;  2CHW A;  3PRZ A;  4ICU A;  2C7H A;  3SD5 A;  4WWO A;  5AZG A;  2V1Y A;  1NBF C;  4YL8 A;  4JIO U;  2ZJD A;  3BY4 B;  4ANW A;  5LXH A;  3D32 A;  1E7U A;  3PZD A;  3X0W A;  4DK5 A;  3L08 A;  2IO1 B;  2DAJ A;  3V62 A;  4II3 B;  4W9G A;  3RT3 B;  4B6W A;  4DWF A;  4HLE A;  5TR5 A;  1WJ6 A;  4FHK A;  1WE6 A;  5AZF A;  2MBH A;  2CKH B;  3UQA A;  2OJR A;  3A9K B;  5DPR A;  1WZ3 A;  1GC7 A;  1KM7 A;  1P0R A;  1E90 A;  2MLB A;  4B95 A;  4EZL A;  5C1Z A;  3VH3 B;  2ZVO A;  3UIO B;  1WE7 A;  1Z2M A;  3DBS A;  4EZK A;  4W9K A;  2KXJ A;  2RPQ A;  1TGZ B;  1M94 A;  2LGX A;  4KVG B;  3H1U A;  3EHV A;  2B3A A;  3N3K B;  5D2M B;  3DOW A;  5L83 A;  2KNB A;  4AOF A;  1V5O A;  2WDT B;  3KUD B;  4PS7 A;  3VUW A;  2AEH A;  5D7G A;  4BBN F;  4EUT A;  1FXT B;  4PYU A;  1SIF A;  5LXI B;  1NI2 A;  1WYW B;  2J0M A;  4IUM B;  1J8C A;  2O6V A;  3ZTC A;  4LDT B;  2MP2 A;  3AU4 A;  3PT2 B;  2CHX A;  2FAZ A;  2KQ7 A;  4A20 A;  1V9J A;  1XT9 B;  3VTU A;  2Z59 B;  4TKN A;  2XK5 B;  3A1Q B;  3PHW B;  4I6P A;  3NS8 A;  2J0K A;  4NPN A;  1IP9 A;  1L2N A;  2KHW B;  4BKG A;  2KAN A;  3L13 A;  3VTV A;  3VUX A;  4EKU A;  2MA9 B;  1KLV A;  3ZDT A;  3JVZ X;  1IPG A;  2RR9 A;  3QAQ A;  4HDO A;  3WAN A;  2R2Q A;  3IBE A;  3APD A;  1WF9 A;  4IWQ A;  4GXB A;  3CSF A;  2KZR A;  5G55 A;  2JRH A;  3UIN B;  1E8Y A;  1V5T A;  4GOC A;  2DYB A;  2IY1 B;  3R7Q A;  2KWV B;  1V49 A;  2D2Q A;  4MEM A;  4M8M A;  4MGK E;  3DBR I;  4NNJ B;  5G2N A;  1WX8 A;  1OEY A;  2KFK A;  4AUQ C;  3VUY A;  3QAR A;  4A3O A;  4W9H A;  1WJN A;  4FJV B;  1WX9 A;  2C9W B;  3PS6 A;  4CHK A;  2N7D A;  2JVC A;  4HDQ A;  4NQL B;  2FCN A;  4CO7 A;  2JUO A;  3TBL D;  2L00 B;  2KDE B;  1WXM A;  4XZ4 A;  3V60 A;  2G4S A;  3DBH I;  2L7R A;  2LI5 A;  2NPT A;  3AXC A;  3RCZ A;  3OLM D;  1WR6 E;  2NBU A;  4PYZ A;  1EF1 A;  3ZTD A;  5AEK B;  3NY5 A;  1C1Y B;  4FUL A;  4ZYN A;  2LGD A;  5LLI A;  4KIK B;  4PS3 A;  4MGI E;  1WRD B;  2KK8 A;  4FHJ A;  3L54 A;  2M8S A;  1RLF A;  3PRE A;  2UWQ A;  2KOX A;  5CHW A;  3HK0 A;  2K1F A;  1RFA A;  1KOT A;  4K7W A;  2LVQ A;  3TJP A;  2KDI A;  4K7S A;  4II2 B;  3V6C B;  5IAA C;  3DQV A;  3A9K A;  4DHZ E;  2MBQ A;  2KN5 A;  4BKS D;  2N1W A;  4MM3 A;  3ZDM C;  4W9J A;  2N9X A;  4ZRI A;  1I42 A;  5JHB A;  4KZC A;  4GSW A;  3OAW A;  2K6Q A;  1Q1O A;  4GN1 A;  4WJQ A;  2GOW A;  4HVB A;  3ZKJ C;  3ZUN A;  3UQB A;  2WYQ A;  3T9L A;  3HM3 A;  2DZK A;  4BFR A;  5E6N A;  4DDI D;  2WWZ A;  4RM8 A;  2JF5 A;  3RUI B;  3H7P B;  1WX7 A;  3APC A;  3UF8 A;  2DX5 B;  3IHP C;  4JGH B;  3HHM A;  1UD7 A;  2K25 A;  2KDF B;  3H7S A;  4ANV A;  1WY8 A;  3A4S C;  3CMM B;  3EEC A;  3KW5 B;  2ZCC A;  3W1S A;  1Z5S B;  2BPS A;  2KFK B;  4GB9 A;  1G6J A;  1ZGU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...