2KMCA

Solution structure of the n-terminal domain of kindlin-1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GIDPFTMLSSGDLTSASWELVVRVDHANGEQQTEITLRVSGDLHIGGVMLKLVEQMNIAQDWSDYALWWEQKRCWLLKTHWTLDKCGVQADANLLFTPQHKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fermitin family homolog 1
publication title The Structure of the N-Terminus of Kindlin-1: A Domain Important for alphaIIbbeta3 Integrin Activation
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18124 Kindlin_2_N Kindlin-2 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kmcA00
5IAAC 1V5OA 3NY5A 4B6WA 1WR6E 2L8JA 2DHZA 1UELA 1S1QB 2LUEA 2KNBA 4MJSB 5CTRC 1E8YA 2KOXA 3ZTCA 4ANVA 1NI2A 2WX1A 3ZVVA 2PPHA 3ZTDA 2C5LC 5EDSA 1IP9A 2Z0DB 2V1YA 3UQBA 2M8SA 1P0RA 4IWPA 4P7IA 3IVFA 2LWPA 3IFWB 3ALBA 1WH3A 4G50A 1WX8A 2FNJB 1WXSA 3V62A 2K1FA 4F1SA 2C7HA 4M0WB 2MP2A 2B3AA 5KHOA 1WGDA 5TR5A 3WANA 3TJPA 4HDQA 4W9FA 2JXXA 3IBEA 2RD0A 3N3KB 3HM3A 4HK2A 4N9F4 1KJTA 3ML9A 1UH6A 3VQIA 2GBRA 2KO3A 1GG3A 2I1KA 3KW5B 3ML8A 2R2QA 4NAWB 3HM6X 1Q0WB 2GBJA 4FULA 1UBQA 2D3GA 2DZMA 1WE7A 4FADA 3APDA 1YX6B 3OLMD 2K25A 2N1WA 2L05A 2KDFB 4MGYE 3RZWC 3UINB 2KFKB 4ZRIA 2ZPYA 5J17A 2MWSB 2L0FA 3EFUA 5J18A 2IO2B 2KD0A 5LXIB 4FJZA 2BF8B 2PE6B 1OQYA 4ZDVA 4E74A 2AL6A 2AL3A 3M62B 4MJSA 4AOFA 2NPTB 3PS6A 2FCMA 4W9CA 4KSKC 4BFRA 4GDKB 3W1SA 1IYFA 1GC6A 4EEWA 4JIOU 3Q3JA 4IWOA 3TIXA 2M4NA 1WM2A 2CS4A 1M94A 3AU4A 4EZJA 3TBLD 2L7RA 3GOEA 4K7SA 2JF5A 3QHTA 1RLFA 2NBUA 3V61A 1ZW7A 2N1VA 4WWOA 1E8WA 3UGBB 4MGZE 4JL9A 4BBNF 4IM3A 3Q3FA 2BWES 1WZ0A 3LDZE 2IY1B 3JYUA 3PTFC 4OVVA 5AZHA 1ISNA 2JUOA 4NNJB 5DCNA 4XC2A 1KOTA 3RD2A 1L2NA 3ECIA 2DZIA 2FIDA 2KANA 3WAOA 3M95A 4NAWA 4B95A 4ZYNA 1Y8RC 3DCGA 4W9KA 1X1MA 4WJOA 2WYQA 2C9WB 1GC7A 2KQ7A 2ZEQA 2KC1A 4AP4C 2JY6A 3OAWA 2Y5BB 3PRMB 2O6VA 3ZW3A 2MW5A 2CHZA 3K9PB 3QAQA 1Z5SB 4KDLB 3P2BA 3SDLC 2MBQA 3VHTC 2KFKA 4GDLB 2YLMA 3DDCB 2D07B 2KQSA 4K1RB 4GOCA 3H9DA 3KYDD 5J2RA 4A20A 2LGYA 1WGGA 3QA8A 2RR9A 4M8MA 1KLVA 1RRBA 3EECA 4ICUA 3R3MA 2NBVB 3H7PA 4GDKA 3VDZA 2N4FA 3CSFA 2KTRB 4LJOB 1SIFA 3DQVA 4FLHA 2AYOB 1WX9A 3MHSD 1MG8A 3ZNID 2GBMA 4MEMA 3RULA 2KKCA 3KUCB 2DX5B 3VUWA 1NBFC 1V5TA 5JHBA 3MTNB 3NOBA 4GGQA 4URKA 3B1LX 2KJ6A 1WM3A 2IYDB 3AI5A 4GIVA 4WWNA 2ZVOA 3V6CB 3ZIMA 3DVNV 2FCNA 4HCPB 3QC8B 2REXA 3QCAA 1V86A 4KIKB 2DAJA 1WY8A 3A33B 2JWZA 1E90A 1RFAA 1V9JA 1WFYA 3L10B 4F7ZA 4WJPA 2R2OA 3A4RA 4PYZA 2DYOA 3W1YA 4GDLA 1F9JA 3BY4B 2BKFA 3U8ZA 2OJRA 4PYUA 5BO4B 3ZDMC 2WWZA 3MJWA 1J19A 3VAWA 3DBLI 1E8ZA 4MGKE 3UIOB 2ZCBA 2LGDA 3R66C 2IO1B 4IM2A 4NQKE 5DPTA 2N7EA 4ANXA 4CO7A 3APFA 3APCA 3EC8A 5D7GA 1LFDA 1WJNA 4MSQB 3A9KB 3OJ4B 1WYWB 5CHWA 1J8CA 3QWZB 2KTRA 1V6EA 2L3ZA 4MM3A 3VTWA 3VH3B 4AUQC 3QX1A 2KVRA 2MA9B 4K7UA 1LM8B 3GZNI 3VH4B 3D32A 5D2MB 2XEWA 1YQBA 1E8XA 2LRWA 3ENEA 2ASQA 2ZPNA 2N9XA 4II2B 4DBGA 3PLVA 2CR5A 4MH0E 2C60A 2BPSA 2UWQA 3DPDA 3PPAA 2LZ6A 4EFOA 5E6NA 2PEAA 2RSUA 2JRIB 2EKEC 1XT9B 1G6JA 3RUIB 1EF5A 2JT4B 3C0RB 1T0YA 2NVUI 3R7RA 3AULA 3N32A 4KVGB 5D94A 1SE9A 5G55A 3JSVB 3DVGX 4LJPB 3PZDA 5AZGA 1YX5B 4X57B 4AWJA 3DBRI 1OEYJ 4TQ0A 3CF6E 4CYEA 1GJZA 1WI0A 2LASA 5FR6A 2JZZA 2KJRA 4AJYB 1YD8U 4TUUA 2NCNA 4I6LB 1UZXB 1WXVA 4K81A 1FXTB 3ZNZB 2DZKA 4I6PA 4EZLA 1D3ZA 4FN2A 3PVLA 2KMAA 3ZDTA 2BWFA 3SU8X 3PHXB 2L0TA 4W9LA 1WF9A 4FHJA 3WALA 5LXHA 4FJYA 3K9OB 1R4MI 4DHJD 5DPSA 4HCNB 1R4NI 1Q5WB 4BKTA 4CHKA 2BYEA 4KV2A 2MCNB 3DOWA 2KTFA 1ZKHA 4K7WA 4KSLC 1WR1A 1LXDA 1KM7A 2EMSA 2LI5A 2O2VB 2Z59B 1WJ4A 3B0AA 3M3JA 2FCSA 2ZVNA 4DXAB 4HLEA 2IO0B 4IM0A 1WGRA 5CX3A 2NS5A 4NQLB 1OTRB 2KWCA 2ZCCA 2MX2A 2KX3A 4RMAA 4FHKA 3T9LA 4RM8A 2IY0B 2BKRB 2KHWB 4HWIB 3X0WA 1JRUA 4EOYA 3IG3A 5CHFA 4DDGD 4E71A 3VXWA 4JGHB 2JRHA 5HKHA 3JSVA 2NPTA 1IPGA 2VRRB 2QHOA 2WX0A 4BVUC 3L08A 4RM9A 2J0JA 5DPWA 2LVQA 4DHJB 2LVOA 1WMHB 2K6DB 2KWUB 2DYBA 2KJHB 2D2QA 2DYMA 2LXCA 2W9NA 2G4DB 2MBOA 2KN5A 1XQQA 3UQAA 3WAPA 1WGHA 1GNUA 5GMVA 1VCBA 3VUXA 4XZ4A 1H4RA 3PSEB 4KZ0A 2ZNVC 3A1QB 2M0XA 5DPRA 1GUAB 2HTHA 2ZJDA 1UD7A 3OJ3A 4G3XB 2DZJA 2A5UA 5C23A 1Z2MA 2KLGA 1WZ3A 3QJZA 1WJ6A 4JQWC 2DENB 4I6NB 4W9IA 4FA6A 3A9JB 4PS3A 1TTNA 3QARA 2LVPA 3UF8A 3WAMA 2KDIA 4GB9A 3X23A 3ZUNA 1XD3B 1E7VA 3TL5A 2M17A 2WDTB 2FAZA 2GBNA 5L95C 2O2VA 4BBNC 2MBHA 4LDTD 3L54A 3UIPB 2AWTA 3NHEB 1WGYA 1OEYA 1J0GA 1S3SG 2KDEB 3VUYA 2KDBA 3ONSA 2LGXA 2ZZPB 1EF1A 2V3SA 3QIJA 2LXAA 2MSED 5G2NA 3AU5A 3PV1A 3PREA 2K8HA 2BYVE 2LD9A 3L13A 4NJ6A 3ZRCA 3PT2B 3V6EB 1V81A 2KC2A 5E6PA 4HVBA 1YIWA 2G3QB 2O6VD 3NS8A 4JLCA 4FJVB 2DAFA 3DBSA 2KZRA 1ZGUB 3N30A 5L83A 2KWVB 2AEHA 4WWPA 2MBEA 3VTUA 3ZRFA 4HDOA 4II3B 4BOSC 1WMHA 2LRUA 4OVUA 2MBBB 2GOWA 4IG7B 3RYTA 3HK0A 1VD2A 3QQ8B 4BKSD 3H1UA 4HPMB 3L17A 3W1SC 3RZFA 3HIZA 1K8RB 2PE9A 3A1QA 4LDTB 5LLIA 4IC7B 2XK5B 3KUZA 4G0NB 3PHWB 2K8CA 4HPLB 1TBEA 4MSMB 1C1YB 2D11A 2FIFA 4W9GA 5D6JB 1L7YA 2UYZB 4GN1A 1I42A 3VTVA 1WE6A 2HJ8A 1YJ1A 2V4LA 3A9JA 3B08A 1SGHA 1WXMA 3L16A 5JHAA 3KYCD 3PLUA 1TGZB 4TV3A 3RT3B 2RPQA 2KX0A 2MQJA 3BINA 1QZEA 3CMMB 4KIKA 5E6OA 4WJNA 4ANWA 5C1ZA 2CHWA 4DWFA 1HE8A 1P1AA 3LJ3A 4HXDA 2JZ3B 2O6VB 4M8NA 3T8MA 4AJWA 1E5WA 2MRPA 4KZCA 4F8CB 4A3PA 5AEKB 3ZLZA 4DHZB 4DHZE 3DVGY 5IA7A 2KXJA 1OGWA 1UGMA 4W9DA 4XX5A 2KLCA 4DK5A 4NY0A 1LQBA 3PRZA 3HHMA 4GMVA 2GBKA 4DDID 5JH5C 1I35A 2N7DA 5KHQA 2BGFA 1H8CA 3VFKA 4IWQA 1AARA 1P3QU 1WRDB 4HJKA 2IBIB 1RAXA 4TQ1A 2PJHA 4NPNA 3KUDB 3DVNU 2HE7A 3V60A 4ASWC 3H7PB 2K6QA 2Z0EB 4PS7A 3KVFB 2CU1A 2HD5B 2J7QB 1WX7A 3A9KA 4YL8A 1C3TA 4BKGA 4NJ7A 3S2AA 3TMPB 3O65B 3ZKJC 2RGFA 4GU2A 3M63B 4W9HA 4ZRKA 2OOBB 3U7DA 3TCAA 4GXBA 2IO3B 1NDDA 5AZFA 4BOZB 4MELA 4LCDE 4MDKE 4EZKA 4WJQA 1TZ1A 3NZUA 3RCZA 3WIMA 3I3TB 1CMXB 2XK5A 1EUVB 2GMIC 1P98A 2LJ5A 2N9PC 4GSWA 2M1MA 1P9DU 3U30A 2C7MB 3AXCA 2JVCA 1UBIA 3PGEA 2KK8A 4ANUA 4IUMB 1E7UA 2EMTA 2J0KA 4MGIE 2L00B 5JZEB 3KH0A 2K39A 3CSTA 4ICVA 4PS8A 1U4AA 3JW0X 4W9EA 4FBJB 2ZNVB 1EO6A 3L0WB 2C7NB 2MLBA 1V2YA 2KMCA 2I1JA 2NR2A 2BYFA 1WIAA 3WA0A 4A3OA 2D10A 2NBWB 3VVWB 3ZNHB 3QK0A 2J0MA 2KFJA 4BKSA 2A4ZA 3DBHI 2MP2B 2N9EB 4W9JA 2FUHB 3JVZX 2L76A 1A5RA 3EHVA 4KDIC 1WJUA 4B9KA 4TKNA 4WQOB 4EKUA 3H7SA 4G11A 3NZSA 4ZRJA 4J6IA 4WAAA 2K8BA 2G45B 2CHXA 3ZNGC 1PQSA 3A4SC 3H6NA 1Q1OA 3R7QA 3SHQA 2IZVB 3ZO5B 4IW0A 4EUTA 2JPHA 2FCQA 1BT0A 1V49A 3IHPC 2YVCA 5CHVC 2G4SA 4E3CA 2CKHB 3SD5A 1V80A 1WXAA 3PRPB 2XBBC
chains in the Genus database with same CATH superfamily
5IAAC 3NY5A 3T3OA 4C4VB 5IN7A 4JX1C 2AQ1B 1UGJA 5TSSA 2M0AA 2PPHA 2WU5B 1IP9A 3PZ7A 2V1YA 3P4QB 3UQBA 2M8SA 1P0RA 4IWPA 4OZBA 4P7IA 3IT6B 4R3DA 5G5GA 3RN9C 3ALBA 1FFUA 2VH2A 1WXSA 2C7HA 2WXLA 2KQ4X 3WANA 3RNFC 1T3QA 2JXXA 2WGSA 3N3KB 4USAA 1JWBD 2MH7A 2N9LA 2KO3A 4NAWB 1Q0WB 2GBJA 2E3TA 1WSPA 5T8IA 2WP9B 2JXTA 1JWSD 4KGTA 1FPYA 4MGYE 2ON8A 1HXYD 3RZWC 4ZRIA 2ZPYA 3EFUA 2WXPA 2PE6B 1OQYA 2AL6A 2AL3A 3U4EG 1IBXA 2FCMA 1SJHD 4GDKB 1GC6A 3GE8C 4EZJA 3AU4A 4BZAA 3VR9B 3GOEA 2JZPA 5H8YE 1ZW7A 2N1VA 1YMHE 4MGZE 1JWUD 4IM3A 5BYRA 1KLUD 4OVVA 3LDZE 2BB6A 2NTTA 3RD2A 1ET9A 3WAOA 4B95A 3BK1A 1ACCA 3DCGA 4W9KA 1F52A 4LNNA 3PRMB 4OZAA 4KDLB 3SDLC 3VHTC 4GDLB 3AE4B 3HVDA 4A20A 1UUPA 2N9KA 2JX5A 1N62A 1RRBA 2NBVB 3AEGB 3H7PA 4OHJA 1FD6A 3MC0B 2W55A 4LJOB 4MM3B 3DQVA 3MHSD 4MEMA 3RULA 3W5UB 2GLSA 1P7FA 2AQ3B 3AN1A 3NOBA 3B1LX 3ZIMA 2ZVOA 1NYRA 5AUKA 2REXA 3QCAA 2QIEB 1SE4A 1WRIA 4KIKB 1SSNA 4A8XC 3MJ5A 1TKGA 1E90A 1XLOA 3L10B 1T0SC 3A4RA 4PYZA 4RFBA 5BO4B 3BIID 3R2IA 2V9HA 4NQKE 2N7EA 5D7GA 3RNAC 1CK1A 1V1PA 1WYWB 1XLQA 3DBHB 2KTRA 3VTWA 1CZPA 3VH3B 1LM8B 3GZNI 1E8XA 1RWSA 1JALA 3ENEA 2ASQA 4C00A 2ZW0A 3C8YA 3AB5A 2BPSA 2UWQA 3DPDA 2LZ6A 4YT0B 2PEAA 2RSUA 3KLSX 1XT9B 2NVUI 4M01A 3KWVA 3N32A 5D94A 5LNK1 1SE9A 1ET6A 3DVGX 4ZYSA 4X57B 3J9CA 3DBRI 1OEYJ 2TSSA 1TY2A 2INDC 1FXAA 3NUHB 1MHXA 1WXVA 1FXTB 2K9XA 1FNVA 3EFCA 3SU8X 5LXHA 3AEFB 3NJTA 4RGTA 1ZE3D 4BKTA 1C79A 4KV2A 2MCNB 1ZKHA 4KSLC 4YSXB 1LXDA 1VJKA 2EMSA 1WJ4A 2WXJA 3IXSA 5CX3A 1OTRB 2ZCCA 4RMAA 2KX3A 4J3OD 2IY0B 4HWIB 2Y3AA 4DDGD 2BYTA 1IPGA 1STEA 2BVCA 3L08A 5DPWA 3WCQA 2DYBA 2KJHB 2V4IB 2G4DB 2MBOA 2KN5A 3UQAA 3WAPA 1B1ZA 3VUXA 1H4RA 3ZJUA 3A1QB 1K53A 2WXMA 1UD7A 2DZJA 2A5UA 5C23A 3DWGC 1WJ6A 4LNFA 4I6NB 1DGJA 4AQ7A 4W9IA 4PS3A 1TTNA 3QARA 3X23A 1XD3B 2RDGA 3TL5A 2WDTB 2JWUA 2K3UA 3B9JA 4ZRPA 1L4DB 5HHDG 1J0GA 2LGXA 2MSED 3AU5A 3L13A 2BYVE 3ZRCA 2KC2A 4GLSC 4HVBA 2GRIA 2G3QB 2IGDA 4FJVB 2KZRA 3N30A 1HTOA 4II3B 4BOSC 1WMHA 4OVUA 4YWGG 3RYTA 3HK0A 2YEPF 3H1UA 3L17A 3W1SC 1EU3A 2PE9A 4LDTB 1DYQA 4FXCA 5LLIA 4HPLB 2NTSA 4UDUC 1C1YB 2M56B 4W9GA 5FR3A 5D6JB 3ZJTA 3A9JA 2V4LA 3B08A 1XCTL 1TGZB 4RGMA 1PYWD 3BINA 2GI9A 1A70A 4YSZB 4WJNA 4ANWA 1C78A 4HXDA 2O6VB 4AJWA 1E5WA 1OQQA 3VRBB 3Q8CA 4A3PA 3ZLZA 4DHZB 1E6EB 2KLCA 4NY0A 1LQBA 3HHMA 4GMVA 2GBKA 4DDID 1H8CA 1P3QU 2IBIB 1RAXA 2HE7A 2QDFA 4ASWC 5C3JB 2CU1A 3AECB 1WX7A 2XNAC 3O65B 1ZP0B 4W9HA 1VLBA 3TCAA 2IO3B 1NDDA 4BOZB 4MELA 3U2SC 1E9MA 2QSDA 5H92C 4JPSA 1TS3A 1EUVB 1GPXA 2M1MA 2ZW1A 3GZNB 1UBIA 2WXKA 2Z8LA 2IDYA 4WQMA 5BMGA 1I4XA 1NEKB 2J0KA 5FKAC 4C80A 2L00B 4JE3B 3AMZA 4WIPA 1WXQA 2KMCA 4P16A 2NR2A 3WA0A 1WIAA 1YQ4B 1F1HA 5G5HA 1CJEA 4B0MA 2A4ZA 3ZYYX 3BK2A 1D5ZC 1FMAD 2L76A 3DBRB 3EHVA 3BYTB 1WJUA 4TKNA 2BS3B 1I4QA 1E0ZA 4J6IA 1TY0A 4S17A 2INPE 2CHXA 1PQSA 1Q1OA 3SHQA 1FFVA 2IZVB 4XDCA 4EUTA 1BT0A 3IAM1 1QQRA 4RGOS 1WXAA 3PRPB 4ITKA 3AEEB 2KNBA 4MJSB 2KOXA 2PVGC 2WX1A 2C5LC 3EA6A 3RNEC 3IFWB 2LGIA 4C56C 1WX8A 3Q8AA 4F1SA 2H89B 4M0WB 3NVVA 2B3AA 3L4PA 4LK0M 4W9FA 1GB1A 3HM3A 4N9F4 1KJTA 3FC4A 3AE1B 1GG3A 2R2QA 4XWTA 2D3GA 1WE7A 2K25A 5GXGB 3UINB 3RI7C 5J17A 2RPVA 4C4VA 2BF8B 4E74A 2IPKD 3M62B 2NPTB 1F77A 3NS1A 4HKZE 4BFRA 1IYFA 2X8XX 2DNFA 4IWOA 3TIXA 2M4NA 1WM2A 2CS4A 2L7RA 4K7SA 2JF5A 3RFZB 2RDHA 1E8WA 4JL9A 3NRZA 1SE2A 4JWUC 2BWES 1WZ0A 2IY1B 3JYUA 1MFWA 3Q3NC 5AZHA 1ISNA 1KOTA 2G1EA 2FIDA 1Q10A 4NAWA 1X1MA 4BAXA 4ZHPA 1JQ4A 2C9WB 2ZEQA 3OAWA 4D2KA 2MW5A 2KAJA 2MJEA 1M4VA 3W9CB 2ONQA 3DDCB 3KYDD 1WGGA 1AWDA 2RR9A 4LLGM 4XE0A 3R3MA 4GDKA 2N4FA 5E6JA 1VDVA 1TJEA 2HTME 3SEBA 2AYOB 1WX9A 2Y5PA 3VUWA 4B0EA 1V5TA 1KLGD 2WDVB 2KJ6A 1B9RA 3QC8B 3KQ4A 1UWXA 2HDEA 2JWZA 3Q3OC 4F7ZA 4WJPA 3W1YA 2DYOA 3C19A 4GDLA 2BKFA 2K5PA 4PYUA 1C4CA 3MJWA 3VAWA 3DBLI 3BWUD 4MGKE 4YTNB 1TZOA 2IO1B 5DPTA 1GOZA 4ANXA 3EC8A 2L3ZA 4MM3A 4AUQC 1MHHE 3QX1A 1MPEA 1J7BA 1QKZA 5D2MB 5MPOA 1FM0D 1T5XD 2BW2A 3PO0A 3P4SB 2ZPNA 3EUB2 4DBGA 1I7HA 2C60A 4MH0E 2BT6A 2JRIB 2QJLA 1G6JA 2JT4B 1T0YA 1BMLC 4S0RA 4YSYB 5G55A 3JSVB 1R7SA 2B76B 3PZDA 2RMMA 1N6ZA 2FBWB 4AWJA 2W54A 4TQ0A 4CYEA 1WI0A 5FR6A 2KJRA 1KH0A 2J42A 4TUUA 4K81A 2DZKA 4FN2A 2KMAA 3ZDTA 1I4GA 2YEPB 1L0XB 4FHJA 4FJYA 2DLBA 1R4MI 4DHJD 5DPSA 1R4NI 3NVZA 2V0GA 3AV8A 4NZLB 1YNTE 1MJDA 2KTFA 1WR1A 2O2VB 1C9FA 2ZVNA 4HLEA 3OWEB 3URYA 2XN9C 5IKCM 3Q3MC 1WGRA 2KWCA 1JRUA 4KX6B 3TEWA 3FKYA 4E71A 3VXWA 4JGHB 3HVZA 3GB1A 1JROA 3PZ8A 1WWTA 2QHOA 5C2TB 2VH1A 2K6DB 2LXCA 2DYMA 1FEHA 1VCBA 1N5WA 4AS1A 2PIAA 5DPRA 1GUAB 2HTHA 2JYTA 2LJIA 2KLGA 2DENB 1FRRA 2WXIA 2MEKA 2OHFA 2R61A 4US9A 2WU2B 2LVPA 3ZUNA 2M17A 3MC8A 1DOYA 2GBNA 1OQRA 2E6XA 3UIPB 2AWTA 1V8CA 3NHEB 4N59A 1OEYA 1CQVA 1FNWA 3VUYA 1EF1A 2V3SA 2V3PA 5G2NA 1F0ZA 1KFYB 1SJED 3FAHA 1YIWA 2PW9A 3TEXA 3VTUA 4HDOA 2LRUA 2MBBB 4IG7B 2QILA 3Q6BA 2WXFA 1K8RB 3A1QA 4IC7B 4G0NB 2L32A 2KWDA 1HTQA 1MG4A 2UYZB 1WE6A 5JHAA 3KYCD 3PLUA 2CJOA 2VZKD 1N61A 1L6UA 1L5PA 4A6QA 3ZJVA 4DWFA 4N58A 1HE8A 3LJ3A 1UF0A 3FILB 2JZ3B 4RCOA 3Q8BA 2MRPA 4KZCA 1JMLA 4LNIA 3DVGY 5IA7A 2CJNA 4XX5A 4MACA 2WXHA 2OJWA 1HEZE 1SIJA 2BGFA 4IWQA 4HJKA 3N1YC 1V1OA 5IO9A 4NPNA 3KUDB 3DVNU 3V60A 3H7PB 3KVFB 2LHDA 2BQQA 2J7QB 3A9KA 3DBLB 1K50A 3TMPB 3ZKJC 2RGFA 3M63B 2OOBB 3P63A 4GXBA 2MHJA 2WS3B 1HQRD 4M02A 3WIMA 3I3TB 2IJ0A 1I4HA 3N20C 2GMIC 4GSWA 4HROA 2K0PA 3AXCA 2JVCA 1XO3A 2KMMA 1L0YB 1E7UA 4MGIE 3CSTA 3V3XA 1U4AA 4W9EA 2UU7A 4FBJB 4C7ZA 2MLBA 2BYFA 2WDRB 3U7ZA 2D10A 4L1BA 3AE8B 3QK0A 4BKSA 2MP2B 2FUHB 4EKUA 3H7SA 4G11A 4ZRJA 4WAAA 1QLBB 3AE5B 2LEKA 2G45B 3I9V1 3H6NA 3R7QA 1R4MB 4IW0A 4TSSA 1R4NB 5CHVC 2G4SA 2CKHB 1HA5A 1K51A 4A55A 5AUIA 1V5OA 4OW0A 2J4XA 1ZUD2 4LNKA 2JU6X 2LUEA 2I38A 3ZTCA 1NI2A 3ZVVA 5EDSA 1YN4A 1YJIA 4WURA 2FNJB 1TS4A 3V62A 5KHOA 1WGDA 3TJPA 4HDQA 1AW7A 3IBEA 2RD0A 2L1AA 4HK2A 4Q2JA 2K22A 1PGBA 3ML9A 3VQIA 2D3BA 1EWCA 1PDXA 3KW5B 3ML8A 3OLMD 1UNSA 1L4ZB 2N1WA 2KDFB 2QCZA 2H88B 2KFKB 2IGHA 2MWSB 5LXIB 2IO2B 4HKQA 1SB3C 4MJSA 4CQNA 3W1SA 3AEBB 4JWSC 4EEWA 2PVOD 2W3SA 3QHTA 2NBUA 3MC9A 2WLBA 4M0WA 3UGBB 4BBNF 3PTFC 4NAMA 2JUOA 4NNJB 5BYSA 2LFIA 3ECIA 2DZIA 3SR6A 1D5MC 4WJOA 1GC7A 2KQ7A 4AP4C 2KC1A 2JY6A 2Y5BB 1PGXA 3K9PB 3QAQA 1ZXIA 3P2BA 1Y56A 2MBQA 4LNOA 3SFDB 2BS4B 5BMHA 2D07B 2KQSA 4K1RB 4GOCA 3H9DA 3O13A 4M8MA 1KLVA 3N1XC 3EECA 4ICUA 2PTLA 4US8A 2LMCA 3CSFA 3LXFA 2SAKA 1J7AA 4FLHA 1YQ3B 1MG8A 2GBMA 3KUCB 2DX5B 1T0RC 4RF1A 5JHBA 4GGQA 4URKA 3NZ3A 4HEA1 1WM3A 3AI5A 3V6CB 5D3DA 2FCNA 3DHIC 1V86A 2DAJA 1WY8A 3A33B 2DWQA 1RFAA 1V9JA 2JSVX 1IUEA 4IOIE 3ZXVA 1MI0A 3TUOA 4K3CA 4KGSA 1J19A 3R66C 4ARIA 1QILA 3W5VB 3OG5A 4CO7A 1LFDA 1WJNA 3OJ4B 1ZOYB 3QWZB 1V6EA 1JW9D 3VH4B 1FO4A 3D32A 3B2FA 1YN3A 3LYYA 4II2B 2INNE 3PPAA 3R8BA 2EKEC 1D5XC 3C0RB 3GS2A 1XLNA 4KVGB 2BTEA 4LJPB 5AZGA 1I4RA 4OZCA 4P1BC 3CF6E 2LASA 4HRSA 1VZ7A 2NCNA 4I6LB 3ZNZB 3GE3C 4EZLA 1J7CA 1D3ZA 1SXTA 2CU3A 3KWLA 3PHXB 2L0TA 4W9LA 1WF9A 3WALA 4YTPB 1Q5WB 4QAYA 2KYWA 2LI5A 2Z59B 3M3JA 2FCSA 2KT7A 4IM0A 2Y5CA 2NS5A 4NQLB 3MFGA 4FHKA 3T9LA 4RM8A 2BKRB 5CHFA 2JRHA 3LB8C 5EE9A 5HKHA 3JSVA 1DOXA 4BVUC 2WXOA 2J0JA 2LVQA 4DHJB 2LVOA 4TMAB 2D2QA 1TYGB 1WGHA 1GNUA 5GMVA 1KRHA 4PK1A 1N60A 1FRDA 4KZ0A 1SBBB 3NVWA 1TT5B 2ZJDA 3OJ3A 4G3XB 4FA6A 4M00A 3UF8A 4GB9A 2FAZA 3B2GA 3BYYB 5L95C 2O2VA 4BBNC 2MBHA 2KACA 3L54A 1S3SG 1XF5L 1SF0A 2KDBA 3ONSA 3ETRA 2KN4A 5FK9C 5EE1A 3PV1A 3PREA 3PT2B 5E6PA 2WXNA 1FCLA 3NS8A 1QOBA 5L83A 1QT9A 1ZGUB 5HFYA 2SEBD 2AEHA 4WWPA 2MBEA 1PGAA 1TKYA 1YOVB 4ACFA 3HIZA 1ENFA 2D5GA 2XK5B 1D6EC 1FXIA 2D11A 2FIFA 3CWIA 4ZRQA 1L7YA 4YTMB 3CIRB 4GN1A 3VTVA 3L16A 1MVKA 4TV3A 3RT3B 2RPQA 2MQJA 3CMMB 4KIKA 4DXFA 5C1ZA 2CHWA 2QC8A 4F8CB 1XLPA 5I4DA 1OGWA 1UGMA 4W9DA 2EKIA 4DK5A 3I63C 3PRZA 1I35A 2N7DA 3IT4B 1AARA 1WRDB 4TQ1A 2PJHA 1QOGA 4BKGA 4ZRKA 2VZKB 5D3IB 4LCDE 4WJQA 3RCZA 4WWMA 1CMXB 1P98A 2LJ5A 1OFFA 2MJ3A 1JWMD 1GAQB 3PGEA 2KK8A 2EMTA 3N9YC 3NG0A 4RF0A 5JZEB 3KH0A 2K39A 4ICVA 3FILA 1N5XA 3L0WB 2C7NB 2I1JA 4DQOC 3VVWB 3ZNHB 2KFJA 1IGCA 4W9JA 3JVZX 4KDIC 2BB5A 3NZSA 3TEZA 1VZ6A 3AM9A 2K8BA 1JWAD 3AE3B 2OEDA 2I2YA 2PLPA 1RFKA 2JPHA 4HPPA 3IHPC 4E3CA 3Q69A 4B6WA 3ZQ4A 1WR6E 2L8JA 2DHZA 2X38A 1UELA 1S1QB 1TS5A 2DBYA 5CTRC 3RMKC 1IBXB 1E8YA 4ANVA 1AN8A 3ZTDA 2Z0DB 1UWMA 3IVFA 2LWPA 2G9HD 1WH3A 4G50A 2K1FA 3DWMA 2MP2A 5TR5A 2LGSA 1LO5D 2MJDA 1PUTA 1SE3A 1UH6A 1KTKA 3RNBC 2GBRA 2I1KA 3HM6X 1F2RI 4FULA 1UBQA 2DZMA 1FNUA 4KKIA 2LUMA 4FADA 4REZA 3APDA 1YX6B 4MT5A 2L05A 2QEJC 2WXGA 2GB1A 3AE7B 5HI1A 3NVYA 3Q2AC 5J18A 2L0FA 2KD0A 4FJZA 4ZDVA 3AE2B 2FUG1 2KVZA 4AOFA 1E7PB 3PS6A 4LTUA 1HZ5A 4KSKC 4W9CA 1K52A 2V3NA 1JRPA 4EE2A 3GP7A 4JIOU 2IGGA 3Q3JA 3UI3A 1M94A 3TBLD 1RLFA 3V61A 2NMQA 4WWOA 2Q5WD 3HRDD 4KKJA 3Q3FA 5DCNA 2QMTA 4XC2A 2WXRA 1L2NA 2KANA 5IOIA 3M95A 4XWWA 1AYFA 2INCC 4ZYNA 1Y8RC 4P1CC 1C76A 1N63A 2WYQA 2WNMA 3BVGA 4ZOHC 1ESFA 2O6VA 3ZW3A 2CHZA 1Z5SB 1D4BA 2KFKA 2YLMA 1GB4A 5J2RA 2LGYA 3QA8A 3P4RB 1F2RC 2WXQA 4L23A 3VDZA 1V1PB 3R2TA 1I4PA 2KTRB 1SIFA 2HJ1A 3ZNID 2ACZB 2KKCA 1NYQA 1ZDXA 1NBFC 3MTNB 2IYDB 4GIVA 4WWNA 2D3AA 3DVNV 4HCPB 1E10A 2RDBC 2JQRB 1WFYA 3I57A 2R2OA 1F9JA 3BY4B 4K3BA 3U8ZA 2OJRA 3ZDMC 2WWZA 1E8ZA 3UIOB 2ZCBA 2LGDA 4IM2A 3APFA 1NENB 3APCA 1BUIC 3Q8EA 4MSQB 3A9KB 4WH4A 5CHWA 1J8CA 3MP9A 2KVRA 2MA9B 4K7UA 4XDDA 2XEWA 1YQBA 2LRWA 2N9XA 4HJGE 3PLVA 2CR5A 4EFOA 5E6NA 2N7JA 3RUIB 1EF5A 2LHEA 2PMVA 3R7RA 3AULA 2N0SB 1VRAB 2BS2B 3BVMA 1YX5B 3AEDB 1GJZA 2JZZA 4AJYB 5HG2A 1YD8U 2JYEA 1UZXB 3P4PB 1QOAA 4I6PA 1DOIA 3H8HA 3PVLA 1YJJA 3ABVB 2BWFA 3HUIA 4P6VF 3AEAB 3K9OB 4HCNB 2FE8A 4CHKA 2BYEA 2AX5A 3DOWA 4K7WA 1WYGA 1KF6B 1KM7A 3P42A 4N6EB 3B0AA 4DXAB 4A90A 3Q14C 2BBCA 2IO0B 3MHZA 2D3CA 1V97A 3V05A 2MX2A 4XYCA 2EELA 1HZ6A 2KHWB 4YXDB 3X0WA 1EM7A 4EOYA 3IG3A 3E9SA 3EGRA 1EWYC 4WAFA 2NPTA 1FCCC 2VRRB 2KDMA 2WX0A 3Q8FA 4RM9A 5EE3A 1WMHB 1L0VB 2KWUB 2W9NA 3W2DA 1C77A 1XQQA 4XZ4A 3PSEB 2ZNVC 2M0XA 1Z2MA 3N1ZC 1WZ3A 3QJZA 4JQWC 1XXGA 3A9JB 3WAMA 1ZPSA 2W82A 2KDIA 5EE0A 5BMIA 1E7VA 3AE6B 3TEYA 1C4AA 1JCKB 4LDTD 3U52E 2PKOA 4O1NA 1WGYA 3RPFC 5IP4D 2KDEB 1RM6C 2ZZPB 3QIJA 2LXAA 3I5JC 2WDQB 1FIQA 2K8HA 2LD9A 4NJ6A 3IAS1 4H2AA 3V6EB 1V81A 2O6VD 4JLCA 2DAFA 1NVID 3DBSA 1C4PA 2KWVB 3ZRFA 2GOWA 3BVZA 1VD2A 3QQ8B 4BKSD 1BXTA 3BZDB 4HPMB 3RZFA 3KUZA 3PHWB 2K8CA 1TBEA 2W3RA 4MSMB 3RNCC 1I42A 2HJ8A 1YJ1A 1SGHA 1WXMA 1P7EA 2KX0A 5E6OA 1QZEA 4RH6A 1P1AA 3E56A 5JXVA 3T8MA 4M8NA 5AEKB 1ROEA 4DHZE 2KXJA 4XGAB 1TKEA 3VR8B 1T0QC 3T3NA 2L83A 1IGDA 5JH5C 4NJCA 4A9AA 5KHQA 1LGRA 3VFKA 1QF6A 4KGRA 3P1MA 1NI3A 1RYJA 2K6QA 2Z0EB 4PS7A 3TSSA 2HD5B 4YL8A 1C3TA 1PFDA 4MH8A 4NJ7A 1ZDVA 3S2AA 4GU2A 1YN5A 3RNGC 3DHGC 3U7DA 2L52A 4ARCA 5AZFA 4OVZA 3VRAB 4MDKE 4EZKA 1TZ1A 3DHHC 3NZUA 3AE9B 2XK5A 1XCQL 2N9PC 1P9DU 3U30A 2C7MB 1SEBD 2ICIA 4ZHOA 4ANUA 1L6VA 2J53A 4IKGA 1TIFA 4IUMB 1VR9A 4PS8A 3JW0X 3AH7A 4L2YA 2ZNVB 4RGNA 1EO6A 1WGKA 1V2YA 4A3OA 2WQYB 4C7YA 2NBWB 2J0MA 3DBHI 2N9EB 1A5RA 4B9KA 1ZXHA 4WQOB 5BYQA 1XEEA 2AQ2B 4IDIA 4DXGA 3ZNGC 1EU4A 2J52A 2WHIA 1TS2A 3A4SC 3ZGZA 3ZXRA 2M19A 1T6BX 4PT5A 3ZO5B 4RNAA 2FCQA 1V49A 1QOFA 1VZ8A 2YVCA 3SFEB 3SD5A 1V80A 2XBBC
chains in the Genus database with same CATH topology
5IAAC 1V5OA 3NY5A 4B6WA 1WR6E 2L8JA 2DHZA 1UELA 1S1QB 2LUEA 2KNBA 4MJSB 5CTRC 1E8YA 2KOXA 3ZTCA 4ANVA 1NI2A 2WX1A 3ZVVA 2PPHA 3ZTDA 2C5LC 5EDSA 1IP9A 2Z0DB 2V1YA 3UQBA 2M8SA 1P0RA 4IWPA 4P7IA 3IVFA 2LWPA 3IFWB 3ALBA 1WH3A 4G50A 1WX8A 2FNJB 1WXSA 3V62A 2K1FA 4F1SA 2C7HA 4M0WB 2MP2A 2B3AA 5KHOA 1WGDA 5TR5A 3WANA 3TJPA 4HDQA 4W9FA 2JXXA 3IBEA 2RD0A 3N3KB 3HM3A 4HK2A 4N9F4 1KJTA 3ML9A 1UH6A 3VQIA 2GBRA 2KO3A 1GG3A 2I1KA 3KW5B 3ML8A 2R2QA 4NAWB 3HM6X 1Q0WB 2GBJA 4FULA 1UBQA 2D3GA 2DZMA 1WE7A 4FADA 3APDA 1YX6B 3OLMD 2K25A 2N1WA 2L05A 2KDFB 4MGYE 3RZWC 3UINB 2KFKB 4ZRIA 2ZPYA 5J17A 2MWSB 2L0FA 3EFUA 5J18A 2IO2B 2KD0A 5LXIB 4FJZA 2BF8B 2PE6B 1OQYA 4ZDVA 4E74A 2AL6A 2AL3A 3M62B 4MJSA 4AOFA 2NPTB 3PS6A 2FCMA 4W9CA 4KSKC 4BFRA 4GDKB 3W1SA 1IYFA 1GC6A 4EEWA 4JIOU 3Q3JA 4IWOA 3TIXA 2M4NA 1WM2A 2CS4A 1M94A 3AU4A 4EZJA 3TBLD 2L7RA 3GOEA 4K7SA 2JF5A 3QHTA 1RLFA 2NBUA 3V61A 1ZW7A 2N1VA 4WWOA 1E8WA 3UGBB 4MGZE 4JL9A 4BBNF 4IM3A 3Q3FA 2BWES 1WZ0A 3LDZE 2IY1B 3JYUA 3PTFC 4OVVA 5AZHA 1ISNA 2JUOA 4NNJB 5DCNA 4XC2A 1KOTA 3RD2A 1L2NA 3ECIA 2DZIA 2FIDA 2KANA 3WAOA 3M95A 4NAWA 4B95A 4ZYNA 1Y8RC 3DCGA 4W9KA 1X1MA 4WJOA 2WYQA 2C9WB 1GC7A 2KQ7A 2ZEQA 2KC1A 4AP4C 2JY6A 3OAWA 2Y5BB 3PRMB 2O6VA 3ZW3A 2MW5A 2CHZA 3K9PB 3QAQA 1Z5SB 4KDLB 3P2BA 3SDLC 2MBQA 3VHTC 2KFKA 4GDLB 2YLMA 3DDCB 2D07B 2KQSA 4K1RB 4GOCA 3H9DA 3KYDD 5J2RA 4A20A 2LGYA 1WGGA 3QA8A 2RR9A 4M8MA 1KLVA 1RRBA 3EECA 4ICUA 3R3MA 2NBVB 3H7PA 4GDKA 3VDZA 2N4FA 3CSFA 2KTRB 4LJOB 1SIFA 3DQVA 4FLHA 2AYOB 1WX9A 3MHSD 1MG8A 3ZNID 2GBMA 4MEMA 3RULA 2KKCA 3KUCB 2DX5B 3VUWA 1NBFC 1V5TA 5JHBA 3MTNB 3NOBA 4GGQA 4URKA 3B1LX 2KJ6A 1WM3A 2IYDB 3AI5A 4GIVA 4WWNA 2ZVOA 3V6CB 3ZIMA 3DVNV 2FCNA 4HCPB 3QC8B 2REXA 3QCAA 1V86A 4KIKB 2DAJA 1WY8A 3A33B 2JWZA 1E90A 1RFAA 1V9JA 1WFYA 3L10B 4F7ZA 4WJPA 2R2OA 3A4RA 4PYZA 2DYOA 3W1YA 4GDLA 1F9JA 3BY4B 2BKFA 3U8ZA 2OJRA 4PYUA 5BO4B 3ZDMC 2WWZA 3MJWA 1J19A 3VAWA 3DBLI 1E8ZA 4MGKE 3UIOB 2ZCBA 2LGDA 3R66C 2IO1B 4IM2A 4NQKE 5DPTA 2N7EA 4ANXA 4CO7A 3APFA 3APCA 3EC8A 5D7GA 1LFDA 1WJNA 4MSQB 3A9KB 3OJ4B 1WYWB 5CHWA 1J8CA 3QWZB 2KTRA 1V6EA 2L3ZA 4MM3A 3VTWA 3VH3B 4AUQC 3QX1A 2KVRA 2MA9B 4K7UA 1LM8B 3GZNI 3VH4B 3D32A 5D2MB 2XEWA 1YQBA 1E8XA 2LRWA 3ENEA 2ASQA 2ZPNA 2N9XA 4II2B 4DBGA 3PLVA 2CR5A 4MH0E 2C60A 2BPSA 2UWQA 3DPDA 3PPAA 2LZ6A 4EFOA 5E6NA 2PEAA 2RSUA 2JRIB 2EKEC 1XT9B 1G6JA 3RUIB 1EF5A 2JT4B 3C0RB 1T0YA 2NVUI 3R7RA 3AULA 3N32A 4KVGB 5D94A 1SE9A 5G55A 3JSVB 3DVGX 4LJPB 3PZDA 5AZGA 1YX5B 4X57B 4AWJA 3DBRI 1OEYJ 4TQ0A 3CF6E 4CYEA 1GJZA 1WI0A 2LASA 5FR6A 2JZZA 2KJRA 4AJYB 1YD8U 4TUUA 2NCNA 4I6LB 1UZXB 1WXVA 4K81A 1FXTB 3ZNZB 2DZKA 4I6PA 4EZLA 1D3ZA 4FN2A 3PVLA 2KMAA 3ZDTA 2BWFA 3SU8X 3PHXB 2L0TA 4W9LA 1WF9A 4FHJA 3WALA 5LXHA 4FJYA 3K9OB 1R4MI 4DHJD 5DPSA 4HCNB 1R4NI 1Q5WB 4BKTA 4CHKA 2BYEA 4KV2A 2MCNB 3DOWA 2KTFA 1ZKHA 4K7WA 4KSLC 1WR1A 1LXDA 1KM7A 2EMSA 2LI5A 2O2VB 2Z59B 1WJ4A 3B0AA 3M3JA 2FCSA 2ZVNA 4DXAB 4HLEA 2IO0B 4IM0A 1WGRA 5CX3A 2NS5A 4NQLB 1OTRB 2KWCA 2ZCCA 2MX2A 2KX3A 4RMAA 4FHKA 3T9LA 4RM8A 2IY0B 2BKRB 2KHWB 4HWIB 3X0WA 1JRUA 4EOYA 3IG3A 5CHFA 4DDGD 4E71A 3VXWA 4JGHB 2JRHA 5HKHA 3JSVA 2NPTA 1IPGA 2VRRB 2QHOA 2WX0A 4BVUC 3L08A 4RM9A 2J0JA 5DPWA 2LVQA 4DHJB 2LVOA 1WMHB 2K6DB 2KWUB 2DYBA 2KJHB 2D2QA 2DYMA 2LXCA 2W9NA 2G4DB 2MBOA 2KN5A 1XQQA 3UQAA 3WAPA 1WGHA 1GNUA 5GMVA 1VCBA 3VUXA 4XZ4A 1H4RA 3PSEB 4KZ0A 2ZNVC 3A1QB 2M0XA 5DPRA 1GUAB 2HTHA 2ZJDA 1UD7A 3OJ3A 4G3XB 2DZJA 2A5UA 5C23A 1Z2MA 2KLGA 1WZ3A 3QJZA 1WJ6A 4JQWC 2DENB 4I6NB 4W9IA 4FA6A 3A9JB 4PS3A 1TTNA 3QARA 2LVPA 3UF8A 3WAMA 2KDIA 4GB9A 3X23A 3ZUNA 1XD3B 1E7VA 3TL5A 2M17A 2WDTB 2FAZA 2GBNA 5L95C 2O2VA 4BBNC 2MBHA 4LDTD 3L54A 3UIPB 2AWTA 3NHEB 1WGYA 1OEYA 1J0GA 1S3SG 2KDEB 3VUYA 2KDBA 3ONSA 2LGXA 2ZZPB 1EF1A 2V3SA 3QIJA 2LXAA 2MSED 5G2NA 3AU5A 3PV1A 3PREA 2K8HA 2BYVE 2LD9A 3L13A 4NJ6A 3ZRCA 3PT2B 3V6EB 1V81A 2KC2A 5E6PA 4HVBA 1YIWA 2G3QB 2O6VD 3NS8A 4JLCA 4FJVB 2DAFA 3DBSA 2KZRA 1ZGUB 3N30A 5L83A 2KWVB 2AEHA 4WWPA 2MBEA 3VTUA 3ZRFA 4HDOA 4II3B 4BOSC 1WMHA 2LRUA 4OVUA 2MBBB 2GOWA 4IG7B 3RYTA 3HK0A 1VD2A 3QQ8B 4BKSD 3H1UA 4HPMB 3L17A 3W1SC 3RZFA 3HIZA 1K8RB 2PE9A 3A1QA 4LDTB 5LLIA 4IC7B 2XK5B 3KUZA 4G0NB 3PHWB 2K8CA 4HPLB 1TBEA 4MSMB 1C1YB 2D11A 2FIFA 4W9GA 5D6JB 1L7YA 2UYZB 4GN1A 1I42A 3VTVA 1WE6A 2HJ8A 1YJ1A 2V4LA 3A9JA 3B08A 1SGHA 1WXMA 3L16A 5JHAA 3KYCD 3PLUA 1TGZB 4TV3A 3RT3B 2RPQA 2KX0A 2MQJA 3BINA 1QZEA 3CMMB 4KIKA 5E6OA 4WJNA 4ANWA 5C1ZA 2CHWA 4DWFA 1HE8A 1P1AA 3LJ3A 4HXDA 2JZ3B 2O6VB 4M8NA 3T8MA 4AJWA 1E5WA 2MRPA 4KZCA 4F8CB 4A3PA 5AEKB 3ZLZA 4DHZB 4DHZE 3DVGY 5IA7A 2KXJA 1OGWA 1UGMA 4W9DA 4XX5A 2KLCA 4DK5A 4NY0A 1LQBA 3PRZA 3HHMA 4GMVA 2GBKA 4DDID 5JH5C 1I35A 2N7DA 5KHQA 2BGFA 1H8CA 3VFKA 4IWQA 1AARA 1P3QU 1WRDB 4HJKA 2IBIB 1RAXA 4TQ1A 2PJHA 4NPNA 3KUDB 3DVNU 2HE7A 3V60A 4ASWC 3H7PB 2K6QA 2Z0EB 4PS7A 3KVFB 2CU1A 2HD5B 2J7QB 1WX7A 3A9KA 4YL8A 1C3TA 4BKGA 4NJ7A 3S2AA 3TMPB 3O65B 3ZKJC 2RGFA 4GU2A 3M63B 4W9HA 4ZRKA 2OOBB 3U7DA 3TCAA 4GXBA 2IO3B 1NDDA 5AZFA 4BOZB 4MELA 4LCDE 4MDKE 4EZKA 4WJQA 1TZ1A 3NZUA 3RCZA 3WIMA 3I3TB 1CMXB 2XK5A 1EUVB 2GMIC 1P98A 2LJ5A 2N9PC 4GSWA 2M1MA 1P9DU 3U30A 2C7MB 3AXCA 2JVCA 1UBIA 3PGEA 2KK8A 4ANUA 4IUMB 1E7UA 2EMTA 2J0KA 4MGIE 2L00B 5JZEB 3KH0A 2K39A 3CSTA 4ICVA 4PS8A 1U4AA 3JW0X 4W9EA 4FBJB 2ZNVB 1EO6A 3L0WB 2C7NB 2MLBA 1V2YA 2KMCA 2I1JA 2NR2A 2BYFA 1WIAA 3WA0A 4A3OA 2D10A 2NBWB 3VVWB 3ZNHB 3QK0A 2J0MA 2KFJA 4BKSA 2A4ZA 3DBHI 2MP2B 2N9EB 4W9JA 2FUHB 3JVZX 2L76A 1A5RA 3EHVA 4KDIC 1WJUA 4B9KA 4TKNA 4WQOB 4EKUA 3H7SA 4G11A 3NZSA 4ZRJA 4J6IA 4WAAA 2K8BA 2G45B 2CHXA 3ZNGC 1PQSA 3A4SC 3H6NA 1Q1OA 3R7QA 3SHQA 2IZVB 3ZO5B 4IW0A 4EUTA 2JPHA 2FCQA 1BT0A 1V49A 3IHPC 2YVCA 5CHVC 2G4SA 4E3CA 2CKHB 3SD5A 1V80A 1WXAA 3PRPB 2XBBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IAA C;  1V5O A;  3NY5 A;  4B6W A;  1WR6 E;  2L8J A;  2DHZ A;  1UEL A;  1S1Q B;  2LUE A;  2KNB A;  4MJS B;  5CTR C;  1E8Y A;  2KOX A;  3ZTC A;  4ANV A;  1NI2 A;  2WX1 A;  3ZVV A;  2PPH A;  3ZTD A;  2C5L C;  5EDS A;  1IP9 A;  2Z0D B;  2V1Y A;  3UQB A;  2M8S A;  1P0R A;  4IWP A;  4P7I A;  3IVF A;  2LWP A;  3IFW B;  3ALB A;  1WH3 A;  4G50 A;  1WX8 A;  2FNJ B;  1WXS A;  3V62 A;  2K1F A;  4F1S A;  2C7H A;  4M0W B;  2MP2 A;  2B3A A;  5KHO A;  1WGD A;  5TR5 A;  3WAN A;  3TJP A;  4HDQ A;  4W9F A;  2JXX A;  3IBE A;  2RD0 A;  3N3K B;  3HM3 A;  4HK2 A;  4N9F 4;  1KJT A;  3ML9 A;  1UH6 A;  3VQI A;  2GBR A;  2KO3 A;  1GG3 A;  2I1K A;  3KW5 B;  3ML8 A;  2R2Q A;  4NAW B;  3HM6 X;  1Q0W B;  2GBJ A;  4FUL A;  1UBQ A;  2D3G A;  2DZM A;  1WE7 A;  4FAD A;  3APD A;  1YX6 B;  3OLM D;  2K25 A;  2N1W A;  2L05 A;  2KDF B;  4MGY E;  3RZW C;  3UIN B;  2KFK B;  4ZRI A;  2ZPY A;  5J17 A;  2MWS B;  2L0F A;  3EFU A;  5J18 A;  2IO2 B;  2KD0 A;  5LXI B;  4FJZ A;  2BF8 B;  2PE6 B;  1OQY A;  4ZDV A;  4E74 A;  2AL6 A;  2AL3 A;  3M62 B;  4MJS A;  4AOF A;  2NPT B;  3PS6 A;  2FCM A;  4W9C A;  4KSK C;  4BFR A;  4GDK B;  3W1S A;  1IYF A;  1GC6 A;  4EEW A;  4JIO U;  3Q3J A;  4IWO A;  3TIX A;  2M4N A;  1WM2 A;  2CS4 A;  1M94 A;  3AU4 A;  4EZJ A;  3TBL D;  2L7R A;  3GOE A;  4K7S A;  2JF5 A;  3QHT A;  1RLF A;  2NBU A;  3V61 A;  1ZW7 A;  2N1V A;  4WWO A;  1E8W A;  3UGB B;  4MGZ E;  4JL9 A;  4BBN F;  4IM3 A;  3Q3F A;  2BWE S;  1WZ0 A;  3LDZ E;  2IY1 B;  3JYU A;  3PTF C;  4OVV A;  5AZH A;  1ISN A;  2JUO A;  4NNJ B;  5DCN A;  4XC2 A;  1KOT A;  3RD2 A;  1L2N A;  3ECI A;  2DZI A;  2FID A;  2KAN A;  3WAO A;  3M95 A;  4NAW A;  4B95 A;  4ZYN A;  1Y8R C;  3DCG A;  4W9K A;  1X1M A;  4WJO A;  2WYQ A;  2C9W B;  1GC7 A;  2KQ7 A;  2ZEQ A;  2KC1 A;  4AP4 C;  2JY6 A;  3OAW A;  2Y5B B;  3PRM B;  2O6V A;  3ZW3 A;  2MW5 A;  2CHZ A;  3K9P B;  3QAQ A;  1Z5S B;  4KDL B;  3P2B A;  3SDL C;  2MBQ A;  3VHT C;  2KFK A;  4GDL B;  2YLM A;  3DDC B;  2D07 B;  2KQS A;  4K1R B;  4GOC A;  3H9D A;  3KYD D;  5J2R A;  4A20 A;  2LGY A;  1WGG A;  3QA8 A;  2RR9 A;  4M8M A;  1KLV A;  1RRB A;  3EEC A;  4ICU A;  3R3M A;  2NBV B;  3H7P A;  4GDK A;  3VDZ A;  2N4F A;  3CSF A;  2KTR B;  4LJO B;  1SIF A;  3DQV A;  4FLH A;  2AYO B;  1WX9 A;  3MHS D;  1MG8 A;  3ZNI D;  2GBM A;  4MEM A;  3RUL A;  2KKC A;  3KUC B;  2DX5 B;  3VUW A;  1NBF C;  1V5T A;  5JHB A;  3MTN B;  3NOB A;  4GGQ A;  4URK A;  3B1L X;  2KJ6 A;  1WM3 A;  2IYD B;  3AI5 A;  4GIV A;  4WWN A;  2ZVO A;  3V6C B;  3ZIM A;  3DVN V;  2FCN A;  4HCP B;  3QC8 B;  2REX A;  3QCA A;  1V86 A;  4KIK B;  2DAJ A;  1WY8 A;  3A33 B;  2JWZ A;  1E90 A;  1RFA A;  1V9J A;  1WFY A;  3L10 B;  4F7Z A;  4WJP A;  2R2O A;  3A4R A;  4PYZ A;  2DYO A;  3W1Y A;  4GDL A;  1F9J A;  3BY4 B;  2BKF A;  3U8Z A;  2OJR A;  4PYU A;  5BO4 B;  3ZDM C;  2WWZ A;  3MJW A;  1J19 A;  3VAW A;  3DBL I;  1E8Z A;  4MGK E;  3UIO B;  2ZCB A;  2LGD A;  3R66 C;  2IO1 B;  4IM2 A;  4NQK E;  5DPT A;  2N7E A;  4ANX A;  4CO7 A;  3APF A;  3APC A;  3EC8 A;  5D7G A;  1LFD A;  1WJN A;  4MSQ B;  3A9K B;  3OJ4 B;  1WYW B;  5CHW A;  1J8C A;  3QWZ B;  2KTR A;  1V6E A;  2L3Z A;  4MM3 A;  3VTW A;  3VH3 B;  4AUQ C;  3QX1 A;  2KVR A;  2MA9 B;  4K7U A;  1LM8 B;  3GZN I;  3VH4 B;  3D32 A;  5D2M B;  2XEW A;  1YQB A;  1E8X A;  2LRW A;  3ENE A;  2ASQ A;  2ZPN A;  2N9X A;  4II2 B;  4DBG A;  3PLV A;  2CR5 A;  4MH0 E;  2C60 A;  2BPS A;  2UWQ A;  3DPD A;  3PPA A;  2LZ6 A;  4EFO A;  5E6N A;  2PEA A;  2RSU A;  2JRI B;  2EKE C;  1XT9 B;  1G6J A;  3RUI B;  1EF5 A;  2JT4 B;  3C0R B;  1T0Y A;  2NVU I;  3R7R A;  3AUL A;  3N32 A;  4KVG B;  5D94 A;  1SE9 A;  5G55 A;  3JSV B;  3DVG X;  4LJP B;  3PZD A;  5AZG A;  1YX5 B;  4X57 B;  4AWJ A;  3DBR I;  1OEY J;  4TQ0 A;  3CF6 E;  4CYE A;  1GJZ A;  1WI0 A;  2LAS A;  5FR6 A;  2JZZ A;  2KJR A;  4AJY B;  1YD8 U;  4TUU A;  2NCN A;  4I6L B;  1UZX B;  1WXV A;  4K81 A;  1FXT B;  3ZNZ B;  2DZK A;  4I6P A;  4EZL A;  1D3Z A;  4FN2 A;  3PVL A;  2KMA A;  3ZDT A;  2BWF A;  3SU8 X;  3PHX B;  2L0T A;  4W9L A;  1WF9 A;  4FHJ A;  3WAL A;  5LXH A;  4FJY A;  3K9O B;  1R4M I;  4DHJ D;  5DPS A;  4HCN B;  1R4N I;  1Q5W B;  4BKT A;  4CHK A;  2BYE A;  4KV2 A;  2MCN B;  3DOW A;  2KTF A;  1ZKH A;  4K7W A;  4KSL C;  1WR1 A;  1LXD A;  1KM7 A;  2EMS A;  2LI5 A;  2O2V B;  2Z59 B;  1WJ4 A;  3B0A A;  3M3J A;  2FCS A;  2ZVN A;  4DXA B;  4HLE A;  2IO0 B;  4IM0 A;  1WGR A;  5CX3 A;  2NS5 A;  4NQL B;  1OTR B;  2KWC A;  2ZCC A;  2MX2 A;  2KX3 A;  4RMA A;  4FHK A;  3T9L A;  4RM8 A;  2IY0 B;  2BKR B;  2KHW B;  4HWI B;  3X0W A;  1JRU A;  4EOY A;  3IG3 A;  5CHF A;  4DDG D;  4E71 A;  3VXW A;  4JGH B;  2JRH A;  5HKH A;  3JSV A;  2NPT A;  1IPG A;  2VRR B;  2QHO A;  2WX0 A;  4BVU C;  3L08 A;  4RM9 A;  2J0J A;  5DPW A;  2LVQ A;  4DHJ B;  2LVO A;  1WMH B;  2K6D B;  2KWU B;  2DYB A;  2KJH B;  2D2Q A;  2DYM A;  2LXC A;  2W9N A;  2G4D B;  2MBO A;  2KN5 A;  1XQQ A;  3UQA A;  3WAP A;  1WGH A;  1GNU A;  5GMV A;  1VCB A;  3VUX A;  4XZ4 A;  1H4R A;  3PSE B;  4KZ0 A;  2ZNV C;  3A1Q B;  2M0X A;  5DPR A;  1GUA B;  2HTH A;  2ZJD A;  1UD7 A;  3OJ3 A;  4G3X B;  2DZJ A;  2A5U A;  5C23 A;  1Z2M A;  2KLG A;  1WZ3 A;  3QJZ A;  1WJ6 A;  4JQW C;  2DEN B;  4I6N B;  4W9I A;  4FA6 A;  3A9J B;  4PS3 A;  1TTN A;  3QAR A;  2LVP A;  3UF8 A;  3WAM A;  2KDI A;  4GB9 A;  3X23 A;  3ZUN A;  1XD3 B;  1E7V A;  3TL5 A;  2M17 A;  2WDT B;  2FAZ A;  2GBN A;  5L95 C;  2O2V A;  4BBN C;  2MBH A;  4LDT D;  3L54 A;  3UIP B;  2AWT A;  3NHE B;  1WGY A;  1OEY A;  1J0G A;  1S3S G;  2KDE B;  3VUY A;  2KDB A;  3ONS A;  2LGX A;  2ZZP B;  1EF1 A;  2V3S A;  3QIJ A;  2LXA A;  2MSE D;  5G2N A;  3AU5 A;  3PV1 A;  3PRE A;  2K8H A;  2BYV E;  2LD9 A;  3L13 A;  4NJ6 A;  3ZRC A;  3PT2 B;  3V6E B;  1V81 A;  2KC2 A;  5E6P A;  4HVB A;  1YIW A;  2G3Q B;  2O6V D;  3NS8 A;  4JLC A;  4FJV B;  2DAF A;  3DBS A;  2KZR A;  1ZGU B;  3N30 A;  5L83 A;  2KWV B;  2AEH A;  4WWP A;  2MBE A;  3VTU A;  3ZRF A;  4HDO A;  4II3 B;  4BOS C;  1WMH A;  2LRU A;  4OVU A;  2MBB B;  2GOW A;  4IG7 B;  3RYT A;  3HK0 A;  1VD2 A;  3QQ8 B;  4BKS D;  3H1U A;  4HPM B;  3L17 A;  3W1S C;  3RZF A;  3HIZ A;  1K8R B;  2PE9 A;  3A1Q A;  4LDT B;  5LLI A;  4IC7 B;  2XK5 B;  3KUZ A;  4G0N B;  3PHW B;  2K8C A;  4HPL B;  1TBE A;  4MSM B;  1C1Y B;  2D11 A;  2FIF A;  4W9G A;  5D6J B;  1L7Y A;  2UYZ B;  4GN1 A;  1I42 A;  3VTV A;  1WE6 A;  2HJ8 A;  1YJ1 A;  2V4L A;  3A9J A;  3B08 A;  1SGH A;  1WXM A;  3L16 A;  5JHA A;  3KYC D;  3PLU A;  1TGZ B;  4TV3 A;  3RT3 B;  2RPQ A;  2KX0 A;  2MQJ A;  3BIN A;  1QZE A;  3CMM B;  4KIK A;  5E6O A;  4WJN A;  4ANW A;  5C1Z A;  2CHW A;  4DWF A;  1HE8 A;  1P1A A;  3LJ3 A;  4HXD A;  2JZ3 B;  2O6V B;  4M8N A;  3T8M A;  4AJW A;  1E5W A;  2MRP A;  4KZC A;  4F8C B;  4A3P A;  5AEK B;  3ZLZ A;  4DHZ B;  4DHZ E;  3DVG Y;  5IA7 A;  2KXJ A;  1OGW A;  1UGM A;  4W9D A;  4XX5 A;  2KLC A;  4DK5 A;  4NY0 A;  1LQB A;  3PRZ A;  3HHM A;  4GMV A;  2GBK A;  4DDI D;  5JH5 C;  1I35 A;  2N7D A;  5KHQ A;  2BGF A;  1H8C A;  3VFK A;  4IWQ A;  1AAR A;  1P3Q U;  1WRD B;  4HJK A;  2IBI B;  1RAX A;  4TQ1 A;  2PJH A;  4NPN A;  3KUD B;  3DVN U;  2HE7 A;  3V60 A;  4ASW C;  3H7P B;  2K6Q A;  2Z0E B;  4PS7 A;  3KVF B;  2CU1 A;  2HD5 B;  2J7Q B;  1WX7 A;  3A9K A;  4YL8 A;  1C3T A;  4BKG A;  4NJ7 A;  3S2A A;  3TMP B;  3O65 B;  3ZKJ C;  2RGF A;  4GU2 A;  3M63 B;  4W9H A;  4ZRK A;  2OOB B;  3U7D A;  3TCA A;  4GXB A;  2IO3 B;  1NDD A;  5AZF A;  4BOZ B;  4MEL A;  4LCD E;  4MDK E;  4EZK A;  4WJQ A;  1TZ1 A;  3NZU A;  3RCZ A;  3WIM A;  3I3T B;  1CMX B;  2XK5 A;  1EUV B;  2GMI C;  1P98 A;  2LJ5 A;  2N9P C;  4GSW A;  2M1M A;  1P9D U;  3U30 A;  2C7M B;  3AXC A;  2JVC A;  1UBI A;  3PGE A;  2KK8 A;  4ANU A;  4IUM B;  1E7U A;  2EMT A;  2J0K A;  4MGI E;  2L00 B;  5JZE B;  3KH0 A;  2K39 A;  3CST A;  4ICV A;  4PS8 A;  1U4A A;  3JW0 X;  4W9E A;  4FBJ B;  2ZNV B;  1EO6 A;  3L0W B;  2C7N B;  2MLB A;  1V2Y A;  2KMC A;  2I1J A;  2NR2 A;  2BYF A;  1WIA A;  3WA0 A;  4A3O A;  2D10 A;  2NBW B;  3VVW B;  3ZNH B;  3QK0 A;  2J0M A;  2KFJ A;  4BKS A;  2A4Z A;  3DBH I;  2MP2 B;  2N9E B;  4W9J A;  2FUH B;  3JVZ X;  2L76 A;  1A5R A;  3EHV A;  4KDI C;  1WJU A;  4B9K A;  4TKN A;  4WQO B;  4EKU A;  3H7S A;  4G11 A;  3NZS A;  4ZRJ A;  4J6I A;  4WAA A;  2K8B A;  2G45 B;  2CHX A;  3ZNG C;  1PQS A;  3A4S C;  3H6N A;  1Q1O A;  3R7Q A;  3SHQ A;  2IZV B;  3ZO5 B;  4IW0 A;  4EUT A;  2JPH A;  2FCQ A;  1BT0 A;  1V49 A;  3IHP C;  2YVC A;  5CHV C;  2G4S A;  4E3C A;  2CKH B;  3SD5 A;  1V80 A;  1WXA A;  3PRP B;  2XBB C; 
#chains in the Genus database with same CATH topology
 5IAA C;  3NY5 A;  3T3O A;  4C4V B;  5IN7 A;  4JX1 C;  2AQ1 B;  1UGJ A;  5TSS A;  2M0A A;  2PPH A;  2WU5 B;  1IP9 A;  3PZ7 A;  2V1Y A;  3P4Q B;  3UQB A;  2M8S A;  1P0R A;  4IWP A;  4OZB A;  4P7I A;  3IT6 B;  4R3D A;  5G5G A;  3RN9 C;  3ALB A;  1FFU A;  2VH2 A;  1WXS A;  2C7H A;  2WXL A;  2KQ4 X;  3WAN A;  3RNF C;  1T3Q A;  2JXX A;  2WGS A;  3N3K B;  4USA A;  1JWB D;  2MH7 A;  2N9L A;  2KO3 A;  4NAW B;  1Q0W B;  2GBJ A;  2E3T A;  1WSP A;  5T8I A;  2WP9 B;  2JXT A;  1JWS D;  4KGT A;  1FPY A;  4MGY E;  2ON8 A;  1HXY D;  3RZW C;  4ZRI A;  2ZPY A;  3EFU A;  2WXP A;  2PE6 B;  1OQY A;  2AL6 A;  2AL3 A;  3U4E G;  1IBX A;  2FCM A;  1SJH D;  4GDK B;  1GC6 A;  3GE8 C;  4EZJ A;  3AU4 A;  4BZA A;  3VR9 B;  3GOE A;  2JZP A;  5H8Y E;  1ZW7 A;  2N1V A;  1YMH E;  4MGZ E;  1JWU D;  4IM3 A;  5BYR A;  1KLU D;  4OVV A;  3LDZ E;  2BB6 A;  2NTT A;  3RD2 A;  1ET9 A;  3WAO A;  4B95 A;  3BK1 A;  1ACC A;  3DCG A;  4W9K A;  1F52 A;  4LNN A;  3PRM B;  4OZA A;  4KDL B;  3SDL C;  3VHT C;  4GDL B;  3AE4 B;  3HVD A;  4A20 A;  1UUP A;  2N9K A;  2JX5 A;  1N62 A;  1RRB A;  2NBV B;  3AEG B;  3H7P A;  4OHJ A;  1FD6 A;  3MC0 B;  2W55 A;  4LJO B;  4MM3 B;  3DQV A;  3MHS D;  4MEM A;  3RUL A;  3W5U B;  2GLS A;  1P7F A;  2AQ3 B;  3AN1 A;  3NOB A;  3B1L X;  3ZIM A;  2ZVO A;  1NYR A;  5AUK A;  2REX A;  3QCA A;  2QIE B;  1SE4 A;  1WRI A;  4KIK B;  1SSN A;  4A8X C;  3MJ5 A;  1TKG A;  1E90 A;  1XLO A;  3L10 B;  1T0S C;  3A4R A;  4PYZ A;  4RFB A;  5BO4 B;  3BII D;  3R2I A;  2V9H A;  4NQK E;  2N7E A;  5D7G A;  3RNA C;  1CK1 A;  1V1P A;  1WYW B;  1XLQ A;  3DBH B;  2KTR A;  3VTW A;  1CZP A;  3VH3 B;  1LM8 B;  3GZN I;  1E8X A;  1RWS A;  1JAL A;  3ENE A;  2ASQ A;  4C00 A;  2ZW0 A;  3C8Y A;  3AB5 A;  2BPS A;  2UWQ A;  3DPD A;  2LZ6 A;  4YT0 B;  2PEA A;  2RSU A;  3KLS X;  1XT9 B;  2NVU I;  4M01 A;  3KWV A;  3N32 A;  5D94 A;  5LNK 1;  1SE9 A;  1ET6 A;  3DVG X;  4ZYS A;  4X57 B;  3J9C A;  3DBR I;  1OEY J;  2TSS A;  1TY2 A;  2IND C;  1FXA A;  3NUH B;  1MHX A;  1WXV A;  1FXT B;  2K9X A;  1FNV A;  3EFC A;  3SU8 X;  5LXH A;  3AEF B;  3NJT A;  4RGT A;  1ZE3 D;  4BKT A;  1C79 A;  4KV2 A;  2MCN B;  1ZKH A;  4KSL C;  4YSX B;  1LXD A;  1VJK A;  2EMS A;  1WJ4 A;  2WXJ A;  3IXS A;  5CX3 A;  1OTR B;  2ZCC A;  4RMA A;  2KX3 A;  4J3O D;  2IY0 B;  4HWI B;  2Y3A A;  4DDG D;  2BYT A;  1IPG A;  1STE A;  2BVC A;  3L08 A;  5DPW A;  3WCQ A;  2DYB A;  2KJH B;  2V4I B;  2G4D B;  2MBO A;  2KN5 A;  3UQA A;  3WAP A;  1B1Z A;  3VUX A;  1H4R A;  3ZJU A;  3A1Q B;  1K53 A;  2WXM A;  1UD7 A;  2DZJ A;  2A5U A;  5C23 A;  3DWG C;  1WJ6 A;  4LNF A;  4I6N B;  1DGJ A;  4AQ7 A;  4W9I A;  4PS3 A;  1TTN A;  3QAR A;  3X23 A;  1XD3 B;  2RDG A;  3TL5 A;  2WDT B;  2JWU A;  2K3U A;  3B9J A;  4ZRP A;  1L4D B;  5HHD G;  1J0G A;  2LGX A;  2MSE D;  3AU5 A;  3L13 A;  2BYV E;  3ZRC A;  2KC2 A;  4GLS C;  4HVB A;  2GRI A;  2G3Q B;  2IGD A;  4FJV B;  2KZR A;  3N30 A;  1HTO A;  4II3 B;  4BOS C;  1WMH A;  4OVU A;  4YWG G;  3RYT A;  3HK0 A;  2YEP F;  3H1U A;  3L17 A;  3W1S C;  1EU3 A;  2PE9 A;  4LDT B;  1DYQ A;  4FXC A;  5LLI A;  4HPL B;  2NTS A;  4UDU C;  1C1Y B;  2M56 B;  4W9G A;  5FR3 A;  5D6J B;  3ZJT A;  3A9J A;  2V4L A;  3B08 A;  1XCT L;  1TGZ B;  4RGM A;  1PYW D;  3BIN A;  2GI9 A;  1A70 A;  4YSZ B;  4WJN A;  4ANW A;  1C78 A;  4HXD A;  2O6V B;  4AJW A;  1E5W A;  1OQQ A;  3VRB B;  3Q8C A;  4A3P A;  3ZLZ A;  4DHZ B;  1E6E B;  2KLC A;  4NY0 A;  1LQB A;  3HHM A;  4GMV A;  2GBK A;  4DDI D;  1H8C A;  1P3Q U;  2IBI B;  1RAX A;  2HE7 A;  2QDF A;  4ASW C;  5C3J B;  2CU1 A;  3AEC B;  1WX7 A;  2XNA C;  3O65 B;  1ZP0 B;  4W9H A;  1VLB A;  3TCA A;  2IO3 B;  1NDD A;  4BOZ B;  4MEL A;  3U2S C;  1E9M A;  2QSD A;  5H92 C;  4JPS A;  1TS3 A;  1EUV B;  1GPX A;  2M1M A;  2ZW1 A;  3GZN B;  1UBI A;  2WXK A;  2Z8L A;  2IDY A;  4WQM A;  5BMG A;  1I4X A;  1NEK B;  2J0K A;  5FKA C;  4C80 A;  2L00 B;  4JE3 B;  3AMZ A;  4WIP A;  1WXQ A;  2KMC A;  4P16 A;  2NR2 A;  3WA0 A;  1WIA A;  1YQ4 B;  1F1H A;  5G5H A;  1CJE A;  4B0M A;  2A4Z A;  3ZYY X;  3BK2 A;  1D5Z C;  1FMA D;  2L76 A;  3DBR B;  3EHV A;  3BYT B;  1WJU A;  4TKN A;  2BS3 B;  1I4Q A;  1E0Z A;  4J6I A;  1TY0 A;  4S17 A;  2INP E;  2CHX A;  1PQS A;  1Q1O A;  3SHQ A;  1FFV A;  2IZV B;  4XDC A;  4EUT A;  1BT0 A;  3IAM 1;  1QQR A;  4RGO S;  1WXA A;  3PRP B;  4ITK A;  3AEE B;  2KNB A;  4MJS B;  2KOX A;  2PVG C;  2WX1 A;  2C5L C;  3EA6 A;  3RNE C;  3IFW B;  2LGI A;  4C56 C;  1WX8 A;  3Q8A A;  4F1S A;  2H89 B;  4M0W B;  3NVV A;  2B3A A;  3L4P A;  4LK0 M;  4W9F A;  1GB1 A;  3HM3 A;  4N9F 4;  1KJT A;  3FC4 A;  3AE1 B;  1GG3 A;  2R2Q A;  4XWT A;  2D3G A;  1WE7 A;  2K25 A;  5GXG B;  3UIN B;  3RI7 C;  5J17 A;  2RPV A;  4C4V A;  2BF8 B;  4E74 A;  2IPK D;  3M62 B;  2NPT B;  1F77 A;  3NS1 A;  4HKZ E;  4BFR A;  1IYF A;  2X8X X;  2DNF A;  4IWO A;  3TIX A;  2M4N A;  1WM2 A;  2CS4 A;  2L7R A;  4K7S A;  2JF5 A;  3RFZ B;  2RDH A;  1E8W A;  4JL9 A;  3NRZ A;  1SE2 A;  4JWU C;  2BWE S;  1WZ0 A;  2IY1 B;  3JYU A;  1MFW A;  3Q3N C;  5AZH A;  1ISN A;  1KOT A;  2G1E A;  2FID A;  1Q10 A;  4NAW A;  1X1M A;  4BAX A;  4ZHP A;  1JQ4 A;  2C9W B;  2ZEQ A;  3OAW A;  4D2K A;  2MW5 A;  2KAJ A;  2MJE A;  1M4V A;  3W9C B;  2ONQ A;  3DDC B;  3KYD D;  1WGG A;  1AWD A;  2RR9 A;  4LLG M;  4XE0 A;  3R3M A;  4GDK A;  2N4F A;  5E6J A;  1VDV A;  1TJE A;  2HTM E;  3SEB A;  2AYO B;  1WX9 A;  2Y5P A;  3VUW A;  4B0E A;  1V5T A;  1KLG D;  2WDV B;  2KJ6 A;  1B9R A;  3QC8 B;  3KQ4 A;  1UWX A;  2HDE A;  2JWZ A;  3Q3O C;  4F7Z A;  4WJP A;  3W1Y A;  2DYO A;  3C19 A;  4GDL A;  2BKF A;  2K5P A;  4PYU A;  1C4C A;  3MJW A;  3VAW A;  3DBL I;  3BWU D;  4MGK E;  4YTN B;  1TZO A;  2IO1 B;  5DPT A;  1GOZ A;  4ANX A;  3EC8 A;  2L3Z A;  4MM3 A;  4AUQ C;  1MHH E;  3QX1 A;  1MPE A;  1J7B A;  1QKZ A;  5D2M B;  5MPO A;  1FM0 D;  1T5X D;  2BW2 A;  3PO0 A;  3P4S B;  2ZPN A;  3EUB 2;  4DBG A;  1I7H A;  2C60 A;  4MH0 E;  2BT6 A;  2JRI B;  2QJL A;  1G6J A;  2JT4 B;  1T0Y A;  1BML C;  4S0R A;  4YSY B;  5G55 A;  3JSV B;  1R7S A;  2B76 B;  3PZD A;  2RMM A;  1N6Z A;  2FBW B;  4AWJ A;  2W54 A;  4TQ0 A;  4CYE A;  1WI0 A;  5FR6 A;  2KJR A;  1KH0 A;  2J42 A;  4TUU A;  4K81 A;  2DZK A;  4FN2 A;  2KMA A;  3ZDT A;  1I4G A;  2YEP B;  1L0X B;  4FHJ A;  4FJY A;  2DLB A;  1R4M I;  4DHJ D;  5DPS A;  1R4N I;  3NVZ A;  2V0G A;  3AV8 A;  4NZL B;  1YNT E;  1MJD A;  2KTF A;  1WR1 A;  2O2V B;  1C9F A;  2ZVN A;  4HLE A;  3OWE B;  3URY A;  2XN9 C;  5IKC M;  3Q3M C;  1WGR A;  2KWC A;  1JRU A;  4KX6 B;  3TEW A;  3FKY A;  4E71 A;  3VXW A;  4JGH B;  3HVZ A;  3GB1 A;  1JRO A;  3PZ8 A;  1WWT A;  2QHO A;  5C2T B;  2VH1 A;  2K6D B;  2LXC A;  2DYM A;  1FEH A;  1VCB A;  1N5W A;  4AS1 A;  2PIA A;  5DPR A;  1GUA B;  2HTH A;  2JYT A;  2LJI A;  2KLG A;  2DEN B;  1FRR A;  2WXI A;  2MEK A;  2OHF A;  2R61 A;  4US9 A;  2WU2 B;  2LVP A;  3ZUN A;  2M17 A;  3MC8 A;  1DOY A;  2GBN A;  1OQR A;  2E6X A;  3UIP B;  2AWT A;  1V8C A;  3NHE B;  4N59 A;  1OEY A;  1CQV A;  1FNW A;  3VUY A;  1EF1 A;  2V3S A;  2V3P A;  5G2N A;  1F0Z A;  1KFY B;  1SJE D;  3FAH A;  1YIW A;  2PW9 A;  3TEX A;  3VTU A;  4HDO A;  2LRU A;  2MBB B;  4IG7 B;  2QIL A;  3Q6B A;  2WXF A;  1K8R B;  3A1Q A;  4IC7 B;  4G0N B;  2L32 A;  2KWD A;  1HTQ A;  1MG4 A;  2UYZ B;  1WE6 A;  5JHA A;  3KYC D;  3PLU A;  2CJO A;  2VZK D;  1N61 A;  1L6U A;  1L5P A;  4A6Q A;  3ZJV A;  4DWF A;  4N58 A;  1HE8 A;  3LJ3 A;  1UF0 A;  3FIL B;  2JZ3 B;  4RCO A;  3Q8B A;  2MRP A;  4KZC A;  1JML A;  4LNI A;  3DVG Y;  5IA7 A;  2CJN A;  4XX5 A;  4MAC A;  2WXH A;  2OJW A;  1HEZ E;  1SIJ A;  2BGF A;  4IWQ A;  4HJK A;  3N1Y C;  1V1O A;  5IO9 A;  4NPN A;  3KUD B;  3DVN U;  3V60 A;  3H7P B;  3KVF B;  2LHD A;  2BQQ A;  2J7Q B;  3A9K A;  3DBL B;  1K50 A;  3TMP B;  3ZKJ C;  2RGF A;  3M63 B;  2OOB B;  3P63 A;  4GXB A;  2MHJ A;  2WS3 B;  1HQR D;  4M02 A;  3WIM A;  3I3T B;  2IJ0 A;  1I4H A;  3N20 C;  2GMI C;  4GSW A;  4HRO A;  2K0P A;  3AXC A;  2JVC A;  1XO3 A;  2KMM A;  1L0Y B;  1E7U A;  4MGI E;  3CST A;  3V3X A;  1U4A A;  4W9E A;  2UU7 A;  4FBJ B;  4C7Z A;  2MLB A;  2BYF A;  2WDR B;  3U7Z A;  2D10 A;  4L1B A;  3AE8 B;  3QK0 A;  4BKS A;  2MP2 B;  2FUH B;  4EKU A;  3H7S A;  4G11 A;  4ZRJ A;  4WAA A;  1QLB B;  3AE5 B;  2LEK A;  2G45 B;  3I9V 1;  3H6N A;  3R7Q A;  1R4M B;  4IW0 A;  4TSS A;  1R4N B;  5CHV C;  2G4S A;  2CKH B;  1HA5 A;  1K51 A;  4A55 A;  5AUI A;  1V5O A;  4OW0 A;  2J4X A;  1ZUD 2;  4LNK A;  2JU6 X;  2LUE A;  2I38 A;  3ZTC A;  1NI2 A;  3ZVV A;  5EDS A;  1YN4 A;  1YJI A;  4WUR A;  2FNJ B;  1TS4 A;  3V62 A;  5KHO A;  1WGD A;  3TJP A;  4HDQ A;  1AW7 A;  3IBE A;  2RD0 A;  2L1A A;  4HK2 A;  4Q2J A;  2K22 A;  1PGB A;  3ML9 A;  3VQI A;  2D3B A;  1EWC A;  1PDX A;  3KW5 B;  3ML8 A;  3OLM D;  1UNS A;  1L4Z B;  2N1W A;  2KDF B;  2QCZ A;  2H88 B;  2KFK B;  2IGH A;  2MWS B;  5LXI B;  2IO2 B;  4HKQ A;  1SB3 C;  4MJS A;  4CQN A;  3W1S A;  3AEB B;  4JWS C;  4EEW A;  2PVO D;  2W3S A;  3QHT A;  2NBU A;  3MC9 A;  2WLB A;  4M0W A;  3UGB B;  4BBN F;  3PTF C;  4NAM A;  2JUO A;  4NNJ B;  5BYS A;  2LFI A;  3ECI A;  2DZI A;  3SR6 A;  1D5M C;  4WJO A;  1GC7 A;  2KQ7 A;  4AP4 C;  2KC1 A;  2JY6 A;  2Y5B B;  1PGX A;  3K9P B;  3QAQ A;  1ZXI A;  3P2B A;  1Y56 A;  2MBQ A;  4LNO A;  3SFD B;  2BS4 B;  5BMH A;  2D07 B;  2KQS A;  4K1R B;  4GOC A;  3H9D A;  3O13 A;  4M8M A;  1KLV A;  3N1X C;  3EEC A;  4ICU A;  2PTL A;  4US8 A;  2LMC A;  3CSF A;  3LXF A;  2SAK A;  1J7A A;  4FLH A;  1YQ3 B;  1MG8 A;  2GBM A;  3KUC B;  2DX5 B;  1T0R C;  4RF1 A;  5JHB A;  4GGQ A;  4URK A;  3NZ3 A;  4HEA 1;  1WM3 A;  3AI5 A;  3V6C B;  5D3D A;  2FCN A;  3DHI C;  1V86 A;  2DAJ A;  1WY8 A;  3A33 B;  2DWQ A;  1RFA A;  1V9J A;  2JSV X;  1IUE A;  4IOI E;  3ZXV A;  1MI0 A;  3TUO A;  4K3C A;  4KGS A;  1J19 A;  3R66 C;  4ARI A;  1QIL A;  3W5V B;  3OG5 A;  4CO7 A;  1LFD A;  1WJN A;  3OJ4 B;  1ZOY B;  3QWZ B;  1V6E A;  1JW9 D;  3VH4 B;  1FO4 A;  3D32 A;  3B2F A;  1YN3 A;  3LYY A;  4II2 B;  2INN E;  3PPA A;  3R8B A;  2EKE C;  1D5X C;  3C0R B;  3GS2 A;  1XLN A;  4KVG B;  2BTE A;  4LJP B;  5AZG A;  1I4R A;  4OZC A;  4P1B C;  3CF6 E;  2LAS A;  4HRS A;  1VZ7 A;  2NCN A;  4I6L B;  3ZNZ B;  3GE3 C;  4EZL A;  1J7C A;  1D3Z A;  1SXT A;  2CU3 A;  3KWL A;  3PHX B;  2L0T A;  4W9L A;  1WF9 A;  3WAL A;  4YTP B;  1Q5W B;  4QAY A;  2KYW A;  2LI5 A;  2Z59 B;  3M3J A;  2FCS A;  2KT7 A;  4IM0 A;  2Y5C A;  2NS5 A;  4NQL B;  3MFG A;  4FHK A;  3T9L A;  4RM8 A;  2BKR B;  5CHF A;  2JRH A;  3LB8 C;  5EE9 A;  5HKH A;  3JSV A;  1DOX A;  4BVU C;  2WXO A;  2J0J A;  2LVQ A;  4DHJ B;  2LVO A;  4TMA B;  2D2Q A;  1TYG B;  1WGH A;  1GNU A;  5GMV A;  1KRH A;  4PK1 A;  1N60 A;  1FRD A;  4KZ0 A;  1SBB B;  3NVW A;  1TT5 B;  2ZJD A;  3OJ3 A;  4G3X B;  4FA6 A;  4M00 A;  3UF8 A;  4GB9 A;  2FAZ A;  3B2G A;  3BYY B;  5L95 C;  2O2V A;  4BBN C;  2MBH A;  2KAC A;  3L54 A;  1S3S G;  1XF5 L;  1SF0 A;  2KDB A;  3ONS A;  3ETR A;  2KN4 A;  5FK9 C;  5EE1 A;  3PV1 A;  3PRE A;  3PT2 B;  5E6P A;  2WXN A;  1FCL A;  3NS8 A;  1QOB A;  5L83 A;  1QT9 A;  1ZGU B;  5HFY A;  2SEB D;  2AEH A;  4WWP A;  2MBE A;  1PGA A;  1TKY A;  1YOV B;  4ACF A;  3HIZ A;  1ENF A;  2D5G A;  2XK5 B;  1D6E C;  1FXI A;  2D11 A;  2FIF A;  3CWI A;  4ZRQ A;  1L7Y A;  4YTM B;  3CIR B;  4GN1 A;  3VTV A;  3L16 A;  1MVK A;  4TV3 A;  3RT3 B;  2RPQ A;  2MQJ A;  3CMM B;  4KIK A;  4DXF A;  5C1Z A;  2CHW A;  2QC8 A;  4F8C B;  1XLP A;  5I4D A;  1OGW A;  1UGM A;  4W9D A;  2EKI A;  4DK5 A;  3I63 C;  3PRZ A;  1I35 A;  2N7D A;  3IT4 B;  1AAR A;  1WRD B;  4TQ1 A;  2PJH A;  1QOG A;  4BKG A;  4ZRK A;  2VZK B;  5D3I B;  4LCD E;  4WJQ A;  3RCZ A;  4WWM A;  1CMX B;  1P98 A;  2LJ5 A;  1OFF A;  2MJ3 A;  1JWM D;  1GAQ B;  3PGE A;  2KK8 A;  2EMT A;  3N9Y C;  3NG0 A;  4RF0 A;  5JZE B;  3KH0 A;  2K39 A;  4ICV A;  3FIL A;  1N5X A;  3L0W B;  2C7N B;  2I1J A;  4DQO C;  3VVW B;  3ZNH B;  2KFJ A;  1IGC A;  4W9J A;  3JVZ X;  4KDI C;  2BB5 A;  3NZS A;  3TEZ A;  1VZ6 A;  3AM9 A;  2K8B A;  1JWA D;  3AE3 B;  2OED A;  2I2Y A;  2PLP A;  1RFK A;  2JPH A;  4HPP A;  3IHP C;  4E3C A;  3Q69 A;  4B6W A;  3ZQ4 A;  1WR6 E;  2L8J A;  2DHZ A;  2X38 A;  1UEL A;  1S1Q B;  1TS5 A;  2DBY A;  5CTR C;  3RMK C;  1IBX B;  1E8Y A;  4ANV A;  1AN8 A;  3ZTD A;  2Z0D B;  1UWM A;  3IVF A;  2LWP A;  2G9H D;  1WH3 A;  4G50 A;  2K1F A;  3DWM A;  2MP2 A;  5TR5 A;  2LGS A;  1LO5 D;  2MJD A;  1PUT A;  1SE3 A;  1UH6 A;  1KTK A;  3RNB C;  2GBR A;  2I1K A;  3HM6 X;  1F2R I;  4FUL A;  1UBQ A;  2DZM A;  1FNU A;  4KKI A;  2LUM A;  4FAD A;  4REZ A;  3APD A;  1YX6 B;  4MT5 A;  2L05 A;  2QEJ C;  2WXG A;  2GB1 A;  3AE7 B;  5HI1 A;  3NVY A;  3Q2A C;  5J18 A;  2L0F A;  2KD0 A;  4FJZ A;  4ZDV A;  3AE2 B;  2FUG 1;  2KVZ A;  4AOF A;  1E7P B;  3PS6 A;  4LTU A;  1HZ5 A;  4KSK C;  4W9C A;  1K52 A;  2V3N A;  1JRP A;  4EE2 A;  3GP7 A;  4JIO U;  2IGG A;  3Q3J A;  3UI3 A;  1M94 A;  3TBL D;  1RLF A;  3V61 A;  2NMQ A;  4WWO A;  2Q5W D;  3HRD D;  4KKJ A;  3Q3F A;  5DCN A;  2QMT A;  4XC2 A;  2WXR A;  1L2N A;  2KAN A;  5IOI A;  3M95 A;  4XWW A;  1AYF A;  2INC C;  4ZYN A;  1Y8R C;  4P1C C;  1C76 A;  1N63 A;  2WYQ A;  2WNM A;  3BVG A;  4ZOH C;  1ESF A;  2O6V A;  3ZW3 A;  2CHZ A;  1Z5S B;  1D4B A;  2KFK A;  2YLM A;  1GB4 A;  5J2R A;  2LGY A;  3QA8 A;  3P4R B;  1F2R C;  2WXQ A;  4L23 A;  3VDZ A;  1V1P B;  3R2T A;  1I4P A;  2KTR B;  1SIF A;  2HJ1 A;  3ZNI D;  2ACZ B;  2KKC A;  1NYQ A;  1ZDX A;  1NBF C;  3MTN B;  2IYD B;  4GIV A;  4WWN A;  2D3A A;  3DVN V;  4HCP B;  1E10 A;  2RDB C;  2JQR B;  1WFY A;  3I57 A;  2R2O A;  1F9J A;  3BY4 B;  4K3B A;  3U8Z A;  2OJR A;  3ZDM C;  2WWZ A;  1E8Z A;  3UIO B;  2ZCB A;  2LGD A;  4IM2 A;  3APF A;  1NEN B;  3APC A;  1BUI C;  3Q8E A;  4MSQ B;  3A9K B;  4WH4 A;  5CHW A;  1J8C A;  3MP9 A;  2KVR A;  2MA9 B;  4K7U A;  4XDD A;  2XEW A;  1YQB A;  2LRW A;  2N9X A;  4HJG E;  3PLV A;  2CR5 A;  4EFO A;  5E6N A;  2N7J A;  3RUI B;  1EF5 A;  2LHE A;  2PMV A;  3R7R A;  3AUL A;  2N0S B;  1VRA B;  2BS2 B;  3BVM A;  1YX5 B;  3AED B;  1GJZ A;  2JZZ A;  4AJY B;  5HG2 A;  1YD8 U;  2JYE A;  1UZX B;  3P4P B;  1QOA A;  4I6P A;  1DOI A;  3H8H A;  3PVL A;  1YJJ A;  3ABV B;  2BWF A;  3HUI A;  4P6V F;  3AEA B;  3K9O B;  4HCN B;  2FE8 A;  4CHK A;  2BYE A;  2AX5 A;  3DOW A;  4K7W A;  1WYG A;  1KF6 B;  1KM7 A;  3P42 A;  4N6E B;  3B0A A;  4DXA B;  4A90 A;  3Q14 C;  2BBC A;  2IO0 B;  3MHZ A;  2D3C A;  1V97 A;  3V05 A;  2MX2 A;  4XYC A;  2EEL A;  1HZ6 A;  2KHW B;  4YXD B;  3X0W A;  1EM7 A;  4EOY A;  3IG3 A;  3E9S A;  3EGR A;  1EWY C;  4WAF A;  2NPT A;  1FCC C;  2VRR B;  2KDM A;  2WX0 A;  3Q8F A;  4RM9 A;  5EE3 A;  1WMH B;  1L0V B;  2KWU B;  2W9N A;  3W2D A;  1C77 A;  1XQQ A;  4XZ4 A;  3PSE B;  2ZNV C;  2M0X A;  1Z2M A;  3N1Z C;  1WZ3 A;  3QJZ A;  4JQW C;  1XXG A;  3A9J B;  3WAM A;  1ZPS A;  2W82 A;  2KDI A;  5EE0 A;  5BMI A;  1E7V A;  3AE6 B;  3TEY A;  1C4A A;  1JCK B;  4LDT D;  3U52 E;  2PKO A;  4O1N A;  1WGY A;  3RPF C;  5IP4 D;  2KDE B;  1RM6 C;  2ZZP B;  3QIJ A;  2LXA A;  3I5J C;  2WDQ B;  1FIQ A;  2K8H A;  2LD9 A;  4NJ6 A;  3IAS 1;  4H2A A;  3V6E B;  1V81 A;  2O6V D;  4JLC A;  2DAF A;  1NVI D;  3DBS A;  1C4P A;  2KWV B;  3ZRF A;  2GOW A;  3BVZ A;  1VD2 A;  3QQ8 B;  4BKS D;  1BXT A;  3BZD B;  4HPM B;  3RZF A;  3KUZ A;  3PHW B;  2K8C A;  1TBE A;  2W3R A;  4MSM B;  3RNC C;  1I42 A;  2HJ8 A;  1YJ1 A;  1SGH A;  1WXM A;  1P7E A;  2KX0 A;  5E6O A;  1QZE A;  4RH6 A;  1P1A A;  3E56 A;  5JXV A;  3T8M A;  4M8N A;  5AEK B;  1ROE A;  4DHZ E;  2KXJ A;  4XGA B;  1TKE A;  3VR8 B;  1T0Q C;  3T3N A;  2L83 A;  1IGD A;  5JH5 C;  4NJC A;  4A9A A;  5KHQ A;  1LGR A;  3VFK A;  1QF6 A;  4KGR A;  3P1M A;  1NI3 A;  1RYJ A;  2K6Q A;  2Z0E B;  4PS7 A;  3TSS A;  2HD5 B;  4YL8 A;  1C3T A;  1PFD A;  4MH8 A;  4NJ7 A;  1ZDV A;  3S2A A;  4GU2 A;  1YN5 A;  3RNG C;  3DHG C;  3U7D A;  2L52 A;  4ARC A;  5AZF A;  4OVZ A;  3VRA B;  4MDK E;  4EZK A;  1TZ1 A;  3DHH C;  3NZU A;  3AE9 B;  2XK5 A;  1XCQ L;  2N9P C;  1P9D U;  3U30 A;  2C7M B;  1SEB D;  2ICI A;  4ZHO A;  4ANU A;  1L6V A;  2J53 A;  4IKG A;  1TIF A;  4IUM B;  1VR9 A;  4PS8 A;  3JW0 X;  3AH7 A;  4L2Y A;  2ZNV B;  4RGN A;  1EO6 A;  1WGK A;  1V2Y A;  4A3O A;  2WQY B;  4C7Y A;  2NBW B;  2J0M A;  3DBH I;  2N9E B;  1A5R A;  4B9K A;  1ZXH A;  4WQO B;  5BYQ A;  1XEE A;  2AQ2 B;  4IDI A;  4DXG A;  3ZNG C;  1EU4 A;  2J52 A;  2WHI A;  1TS2 A;  3A4S C;  3ZGZ A;  3ZXR A;  2M19 A;  1T6B X;  4PT5 A;  3ZO5 B;  4RNA A;  2FCQ A;  1V49 A;  1QOF A;  1VZ8 A;  2YVC A;  3SFE B;  3SD5 A;  1V80 A;  2XBB C; 
#chains in the Genus database with same CATH homology
 5IAA C;  1V5O A;  3NY5 A;  4B6W A;  1WR6 E;  2L8J A;  2DHZ A;  1UEL A;  1S1Q B;  2LUE A;  2KNB A;  4MJS B;  5CTR C;  1E8Y A;  2KOX A;  3ZTC A;  4ANV A;  1NI2 A;  2WX1 A;  3ZVV A;  2PPH A;  3ZTD A;  2C5L C;  5EDS A;  1IP9 A;  2Z0D B;  2V1Y A;  3UQB A;  2M8S A;  1P0R A;  4IWP A;  4P7I A;  3IVF A;  2LWP A;  3IFW B;  3ALB A;  1WH3 A;  4G50 A;  1WX8 A;  2FNJ B;  1WXS A;  3V62 A;  2K1F A;  4F1S A;  2C7H A;  4M0W B;  2MP2 A;  2B3A A;  5KHO A;  1WGD A;  5TR5 A;  3WAN A;  3TJP A;  4HDQ A;  4W9F A;  2JXX A;  3IBE A;  2RD0 A;  3N3K B;  3HM3 A;  4HK2 A;  4N9F 4;  1KJT A;  3ML9 A;  1UH6 A;  3VQI A;  2GBR A;  2KO3 A;  1GG3 A;  2I1K A;  3KW5 B;  3ML8 A;  2R2Q A;  4NAW B;  3HM6 X;  1Q0W B;  2GBJ A;  4FUL A;  1UBQ A;  2D3G A;  2DZM A;  1WE7 A;  4FAD A;  3APD A;  1YX6 B;  3OLM D;  2K25 A;  2N1W A;  2L05 A;  2KDF B;  4MGY E;  3RZW C;  3UIN B;  2KFK B;  4ZRI A;  2ZPY A;  5J17 A;  2MWS B;  2L0F A;  3EFU A;  5J18 A;  2IO2 B;  2KD0 A;  5LXI B;  4FJZ A;  2BF8 B;  2PE6 B;  1OQY A;  4ZDV A;  4E74 A;  2AL6 A;  2AL3 A;  3M62 B;  4MJS A;  4AOF A;  2NPT B;  3PS6 A;  2FCM A;  4W9C A;  4KSK C;  4BFR A;  4GDK B;  3W1S A;  1IYF A;  1GC6 A;  4EEW A;  4JIO U;  3Q3J A;  4IWO A;  3TIX A;  2M4N A;  1WM2 A;  2CS4 A;  1M94 A;  3AU4 A;  4EZJ A;  3TBL D;  2L7R A;  3GOE A;  4K7S A;  2JF5 A;  3QHT A;  1RLF A;  2NBU A;  3V61 A;  1ZW7 A;  2N1V A;  4WWO A;  1E8W A;  3UGB B;  4MGZ E;  4JL9 A;  4BBN F;  4IM3 A;  3Q3F A;  2BWE S;  1WZ0 A;  3LDZ E;  2IY1 B;  3JYU A;  3PTF C;  4OVV A;  5AZH A;  1ISN A;  2JUO A;  4NNJ B;  5DCN A;  4XC2 A;  1KOT A;  3RD2 A;  1L2N A;  3ECI A;  2DZI A;  2FID A;  2KAN A;  3WAO A;  3M95 A;  4NAW A;  4B95 A;  4ZYN A;  1Y8R C;  3DCG A;  4W9K A;  1X1M A;  4WJO A;  2WYQ A;  2C9W B;  1GC7 A;  2KQ7 A;  2ZEQ A;  2KC1 A;  4AP4 C;  2JY6 A;  3OAW A;  2Y5B B;  3PRM B;  2O6V A;  3ZW3 A;  2MW5 A;  2CHZ A;  3K9P B;  3QAQ A;  1Z5S B;  4KDL B;  3P2B A;  3SDL C;  2MBQ A;  3VHT C;  2KFK A;  4GDL B;  2YLM A;  3DDC B;  2D07 B;  2KQS A;  4K1R B;  4GOC A;  3H9D A;  3KYD D;  5J2R A;  4A20 A;  2LGY A;  1WGG A;  3QA8 A;  2RR9 A;  4M8M A;  1KLV A;  1RRB A;  3EEC A;  4ICU A;  3R3M A;  2NBV B;  3H7P A;  4GDK A;  3VDZ A;  2N4F A;  3CSF A;  2KTR B;  4LJO B;  1SIF A;  3DQV A;  4FLH A;  2AYO B;  1WX9 A;  3MHS D;  1MG8 A;  3ZNI D;  2GBM A;  4MEM A;  3RUL A;  2KKC A;  3KUC B;  2DX5 B;  3VUW A;  1NBF C;  1V5T A;  5JHB A;  3MTN B;  3NOB A;  4GGQ A;  4URK A;  3B1L X;  2KJ6 A;  1WM3 A;  2IYD B;  3AI5 A;  4GIV A;  4WWN A;  2ZVO A;  3V6C B;  3ZIM A;  3DVN V;  2FCN A;  4HCP B;  3QC8 B;  2REX A;  3QCA A;  1V86 A;  4KIK B;  2DAJ A;  1WY8 A;  3A33 B;  2JWZ A;  1E90 A;  1RFA A;  1V9J A;  1WFY A;  3L10 B;  4F7Z A;  4WJP A;  2R2O A;  3A4R A;  4PYZ A;  2DYO A;  3W1Y A;  4GDL A;  1F9J A;  3BY4 B;  2BKF A;  3U8Z A;  2OJR A;  4PYU A;  5BO4 B;  3ZDM C;  2WWZ A;  3MJW A;  1J19 A;  3VAW A;  3DBL I;  1E8Z A;  4MGK E;  3UIO B;  2ZCB A;  2LGD A;  3R66 C;  2IO1 B;  4IM2 A;  4NQK E;  5DPT A;  2N7E A;  4ANX A;  4CO7 A;  3APF A;  3APC A;  3EC8 A;  5D7G A;  1LFD A;  1WJN A;  4MSQ B;  3A9K B;  3OJ4 B;  1WYW B;  5CHW A;  1J8C A;  3QWZ B;  2KTR A;  1V6E A;  2L3Z A;  4MM3 A;  3VTW A;  3VH3 B;  4AUQ C;  3QX1 A;  2KVR A;  2MA9 B;  4K7U A;  1LM8 B;  3GZN I;  3VH4 B;  3D32 A;  5D2M B;  2XEW A;  1YQB A;  1E8X A;  2LRW A;  3ENE A;  2ASQ A;  2ZPN A;  2N9X A;  4II2 B;  4DBG A;  3PLV A;  2CR5 A;  4MH0 E;  2C60 A;  2BPS A;  2UWQ A;  3DPD A;  3PPA A;  2LZ6 A;  4EFO A;  5E6N A;  2PEA A;  2RSU A;  2JRI B;  2EKE C;  1XT9 B;  1G6J A;  3RUI B;  1EF5 A;  2JT4 B;  3C0R B;  1T0Y A;  2NVU I;  3R7R A;  3AUL A;  3N32 A;  4KVG B;  5D94 A;  1SE9 A;  5G55 A;  3JSV B;  3DVG X;  4LJP B;  3PZD A;  5AZG A;  1YX5 B;  4X57 B;  4AWJ A;  3DBR I;  1OEY J;  4TQ0 A;  3CF6 E;  4CYE A;  1GJZ A;  1WI0 A;  2LAS A;  5FR6 A;  2JZZ A;  2KJR A;  4AJY B;  1YD8 U;  4TUU A;  2NCN A;  4I6L B;  1UZX B;  1WXV A;  4K81 A;  1FXT B;  3ZNZ B;  2DZK A;  4I6P A;  4EZL A;  1D3Z A;  4FN2 A;  3PVL A;  2KMA A;  3ZDT A;  2BWF A;  3SU8 X;  3PHX B;  2L0T A;  4W9L A;  1WF9 A;  4FHJ A;  3WAL A;  5LXH A;  4FJY A;  3K9O B;  1R4M I;  4DHJ D;  5DPS A;  4HCN B;  1R4N I;  1Q5W B;  4BKT A;  4CHK A;  2BYE A;  4KV2 A;  2MCN B;  3DOW A;  2KTF A;  1ZKH A;  4K7W A;  4KSL C;  1WR1 A;  1LXD A;  1KM7 A;  2EMS A;  2LI5 A;  2O2V B;  2Z59 B;  1WJ4 A;  3B0A A;  3M3J A;  2FCS A;  2ZVN A;  4DXA B;  4HLE A;  2IO0 B;  4IM0 A;  1WGR A;  5CX3 A;  2NS5 A;  4NQL B;  1OTR B;  2KWC A;  2ZCC A;  2MX2 A;  2KX3 A;  4RMA A;  4FHK A;  3T9L A;  4RM8 A;  2IY0 B;  2BKR B;  2KHW B;  4HWI B;  3X0W A;  1JRU A;  4EOY A;  3IG3 A;  5CHF A;  4DDG D;  4E71 A;  3VXW A;  4JGH B;  2JRH A;  5HKH A;  3JSV A;  2NPT A;  1IPG A;  2VRR B;  2QHO A;  2WX0 A;  4BVU C;  3L08 A;  4RM9 A;  2J0J A;  5DPW A;  2LVQ A;  4DHJ B;  2LVO A;  1WMH B;  2K6D B;  2KWU B;  2DYB A;  2KJH B;  2D2Q A;  2DYM A;  2LXC A;  2W9N A;  2G4D B;  2MBO A;  2KN5 A;  1XQQ A;  3UQA A;  3WAP A;  1WGH A;  1GNU A;  5GMV A;  1VCB A;  3VUX A;  4XZ4 A;  1H4R A;  3PSE B;  4KZ0 A;  2ZNV C;  3A1Q B;  2M0X A;  5DPR A;  1GUA B;  2HTH A;  2ZJD A;  1UD7 A;  3OJ3 A;  4G3X B;  2DZJ A;  2A5U A;  5C23 A;  1Z2M A;  2KLG A;  1WZ3 A;  3QJZ A;  1WJ6 A;  4JQW C;  2DEN B;  4I6N B;  4W9I A;  4FA6 A;  3A9J B;  4PS3 A;  1TTN A;  3QAR A;  2LVP A;  3UF8 A;  3WAM A;  2KDI A;  4GB9 A;  3X23 A;  3ZUN A;  1XD3 B;  1E7V A;  3TL5 A;  2M17 A;  2WDT B;  2FAZ A;  2GBN A;  5L95 C;  2O2V A;  4BBN C;  2MBH A;  4LDT D;  3L54 A;  3UIP B;  2AWT A;  3NHE B;  1WGY A;  1OEY A;  1J0G A;  1S3S G;  2KDE B;  3VUY A;  2KDB A;  3ONS A;  2LGX A;  2ZZP B;  1EF1 A;  2V3S A;  3QIJ A;  2LXA A;  2MSE D;  5G2N A;  3AU5 A;  3PV1 A;  3PRE A;  2K8H A;  2BYV E;  2LD9 A;  3L13 A;  4NJ6 A;  3ZRC A;  3PT2 B;  3V6E B;  1V81 A;  2KC2 A;  5E6P A;  4HVB A;  1YIW A;  2G3Q B;  2O6V D;  3NS8 A;  4JLC A;  4FJV B;  2DAF A;  3DBS A;  2KZR A;  1ZGU B;  3N30 A;  5L83 A;  2KWV B;  2AEH A;  4WWP A;  2MBE A;  3VTU A;  3ZRF A;  4HDO A;  4II3 B;  4BOS C;  1WMH A;  2LRU A;  4OVU A;  2MBB B;  2GOW A;  4IG7 B;  3RYT A;  3HK0 A;  1VD2 A;  3QQ8 B;  4BKS D;  3H1U A;  4HPM B;  3L17 A;  3W1S C;  3RZF A;  3HIZ A;  1K8R B;  2PE9 A;  3A1Q A;  4LDT B;  5LLI A;  4IC7 B;  2XK5 B;  3KUZ A;  4G0N B;  3PHW B;  2K8C A;  4HPL B;  1TBE A;  4MSM B;  1C1Y B;  2D11 A;  2FIF A;  4W9G A;  5D6J B;  1L7Y A;  2UYZ B;  4GN1 A;  1I42 A;  3VTV A;  1WE6 A;  2HJ8 A;  1YJ1 A;  2V4L A;  3A9J A;  3B08 A;  1SGH A;  1WXM A;  3L16 A;  5JHA A;  3KYC D;  3PLU A;  1TGZ B;  4TV3 A;  3RT3 B;  2RPQ A;  2KX0 A;  2MQJ A;  3BIN A;  1QZE A;  3CMM B;  4KIK A;  5E6O A;  4WJN A;  4ANW A;  5C1Z A;  2CHW A;  4DWF A;  1HE8 A;  1P1A A;  3LJ3 A;  4HXD A;  2JZ3 B;  2O6V B;  4M8N A;  3T8M A;  4AJW A;  1E5W A;  2MRP A;  4KZC A;  4F8C B;  4A3P A;  5AEK B;  3ZLZ A;  4DHZ B;  4DHZ E;  3DVG Y;  5IA7 A;  2KXJ A;  1OGW A;  1UGM A;  4W9D A;  4XX5 A;  2KLC A;  4DK5 A;  4NY0 A;  1LQB A;  3PRZ A;  3HHM A;  4GMV A;  2GBK A;  4DDI D;  5JH5 C;  1I35 A;  2N7D A;  5KHQ A;  2BGF A;  1H8C A;  3VFK A;  4IWQ A;  1AAR A;  1P3Q U;  1WRD B;  4HJK A;  2IBI B;  1RAX A;  4TQ1 A;  2PJH A;  4NPN A;  3KUD B;  3DVN U;  2HE7 A;  3V60 A;  4ASW C;  3H7P B;  2K6Q A;  2Z0E B;  4PS7 A;  3KVF B;  2CU1 A;  2HD5 B;  2J7Q B;  1WX7 A;  3A9K A;  4YL8 A;  1C3T A;  4BKG A;  4NJ7 A;  3S2A A;  3TMP B;  3O65 B;  3ZKJ C;  2RGF A;  4GU2 A;  3M63 B;  4W9H A;  4ZRK A;  2OOB B;  3U7D A;  3TCA A;  4GXB A;  2IO3 B;  1NDD A;  5AZF A;  4BOZ B;  4MEL A;  4LCD E;  4MDK E;  4EZK A;  4WJQ A;  1TZ1 A;  3NZU A;  3RCZ A;  3WIM A;  3I3T B;  1CMX B;  2XK5 A;  1EUV B;  2GMI C;  1P98 A;  2LJ5 A;  2N9P C;  4GSW A;  2M1M A;  1P9D U;  3U30 A;  2C7M B;  3AXC A;  2JVC A;  1UBI A;  3PGE A;  2KK8 A;  4ANU A;  4IUM B;  1E7U A;  2EMT A;  2J0K A;  4MGI E;  2L00 B;  5JZE B;  3KH0 A;  2K39 A;  3CST A;  4ICV A;  4PS8 A;  1U4A A;  3JW0 X;  4W9E A;  4FBJ B;  2ZNV B;  1EO6 A;  3L0W B;  2C7N B;  2MLB A;  1V2Y A;  2KMC A;  2I1J A;  2NR2 A;  2BYF A;  1WIA A;  3WA0 A;  4A3O A;  2D10 A;  2NBW B;  3VVW B;  3ZNH B;  3QK0 A;  2J0M A;  2KFJ A;  4BKS A;  2A4Z A;  3DBH I;  2MP2 B;  2N9E B;  4W9J A;  2FUH B;  3JVZ X;  2L76 A;  1A5R A;  3EHV A;  4KDI C;  1WJU A;  4B9K A;  4TKN A;  4WQO B;  4EKU A;  3H7S A;  4G11 A;  3NZS A;  4ZRJ A;  4J6I A;  4WAA A;  2K8B A;  2G45 B;  2CHX A;  3ZNG C;  1PQS A;  3A4S C;  3H6N A;  1Q1O A;  3R7Q A;  3SHQ A;  2IZV B;  3ZO5 B;  4IW0 A;  4EUT A;  2JPH A;  2FCQ A;  1BT0 A;  1V49 A;  3IHP C;  2YVC A;  5CHV C;  2G4S A;  4E3C A;  2CKH B;  3SD5 A;  1V80 A;  1WXA A;  3PRP B;  2XBB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...