2DZMA

Solution structure of the ubiquitin-like domain in human fas-associated factor 1 (hfaf1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
100
structure length
100
Chain Sequence
GSSGSSGRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics unknown function
molecule keywords FAS-associated factor 1
publication title Solution Structure of the Ubiquitin-like Domain in Human FAS-associated factor 1 (hFAF1)
rcsb
source organism Homo sapiens
total genus 9
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dzmA01
3QA8A 1KM7A 1Y8RC 4A3OA 4G0NB 3VTVA 4TQ1A 3WAOA 4DDGD 1HE8A 4JIOU 1S1QB 3QQ8B 3DPDA 1C1YB 1UZXB 2EMSA 4KDLB 3SDLC 4FN2A 4IM0A 2NPTB 3ZNHB 4WJNA 2UWQA 3DVNU 4HXDA 5D94A 2NBUA 4TV3A 2J7QB 2M17A 4M0WB 4CHKA 3NS8A 2XBBC 3ML8A 4DWFA 3L16A 3A1QA 1M94A 3PGEA 4ZYNA 1WZ0A 3QWZB 2NS5A 1GG3A 1T0YA 3NY5A 5EDSA 5LXIB 3HHMA 4MJSB 2KDIA 3N3KB 4IC7B 1WX7A 2L7RA 3GZNI 2O6VA 5CHFA 4ZRJA 4HPMB 5CX3A 4TUUA 2AWTA 2LASA 1V49A 3PREA 3UQAA 3SU8X 3W1SA 3H1UA 3TBLD 3JYUA 1RRBA 4XC2A 1WI0A 3K9OB 3UGBB 2HE7A 2IO1B 4FJYA 2K8CA 2FCNA 1WR6E 4BVUC 1WIAA 4TKNA 2KMAA 3C0RB 3TCAA 3Q3FA 4KVGB 3VTUA 1V80A 2K8HA 3ZW3A 4WJPA 3DCGA 2N9XA 2JXXA 3ZTCA 2C9WB 4ANXA 3H7PA 3UF8A 1WXMA 2IO2B 3QK0A 3PT2B 4K81A 4NAWA 1P0RA 2M1MA 2ZJDA 3OJ4B 1WGYA 1ZKHA 4G50A 2LGDA 2D10A 2N9EB 2RD0A 3M62B 3M95A 3S2AA 2KC1A 5KHOA 5DPSA 1V86A 1ZGUB 5G55A 5AZGA 3NZUA 2NVUI 3MJWA 4IW0A 2MA9B 4MGKE 2LVOA 5D7GA 3R7QA 2MLBA 4LJPB 4K7SA 1WXAA 5E6PA 4FBJB 2N4FA 4IWOA 4A20A 4MGZE 5L83A 2GBKA 2ZEQA 3P2BA 1WJNA 3PTFC 2WDTB 3OLMD 2HTHA 4NQLB 5JHBA 2G4SA 2CHWA 1XD3B 3JVZX 2C7MB 2LXCA 4LJOB 1UBIA 2KDBA 1IPGA 3AI5A 1WM3A 3UIPB 3DBRI 3WAPA 3L13A 2B3AA 2FCMA 4KZCA 4BKSA 2ZNVB 3PHWB 3A1QB 3KUDB 4XX5A 1EF5A 3U30A 2MRPA 4CO7A 3PHXB 1KLVA 4XZ4A 2N1VA 2C7NB 2PE9A 2LWPA 4PYZA 2O6VB 3A33B 5DPTA 3ZNGC 2L76A 2KDEB 4GDLA 3TL5A 1X1MA 4NJ7A 2ZVNA 3PLVA 1OQYA 2LXAA 2NBWB 2I1JA 4BKSD 2LRWA 1UBQA 3VUYA 4AJYB 2N1WA 4BBNF 3PRPB 4BOZB 2K8BA 2KQ7A 2KWVB 3T8MA 2HJ8A 2IZVB 2KC2A 5HKHA 2MQJA 2DZMA 2W9NA 3ECIA 2O2VA 3DBHI 3KUCB 2DAFA 3RZFA 4KSLC 3A4SC 3B1LX 3H7PB 1WF9A 2LI5A 4W9KA 1UGMA 3B0AA 2ASQA 3RULA 3DQVA 3QJZA 1WZ3A 2AYOB 4NAWB 3ZO5B 3NHEB 4KSKC 2KJRA 1EF1A 2CHZA 2LGXA 5G2NA 1D3ZA 1RAXA 2L00B 2MBBB 4J6IA 2V1YA 2VRRB 1I42A 1JRUA 3CSFA 3OAWA 2Z59B 1WGRA 2MBHA 5AZFA 4HPLB 4II3B 2GBMA 3ZRCA 2MCNB 2KTRA 3ONSA 1E8XA 3ZNZB 2GBJA 2BYVE 1BT0A 1OGWA 3CSTA 3WIMA 4G11A 2KWCA 4ICUA 3HK0A 3R3MA 4F7ZA 2A5UA 5GMVA 4RM9A 5KHQA 2HD5B 4MEMA 4WWOA 1WX9A 2M8SA 1U4AA 2L3ZA 3V62A 4CYEA 3AXCA 1SGHA 2V4LA 3QIJA 2FUHB 2BPSA 4DDID 1GC6A 4BBNC 2KTFA 2RSUA 3AU4A 4EZKA 3ALBA 1J19A 1E7VA 2IY1B 4GDLB 2JY6A 4MGIE 4FLHA 1WE6A 2LZ6A 3PLUA 2KWUB 2MBEA 2MWSB 2WX0A 1WJ6A 1TBEA 3HM3A 3PV1A 1UD7A 3JSVA 4LCDE 1IP9A 1Q5WB 3RYTA 3L17A 4PS8A 3ZDTA 3PS6A 4W9JA 1TZ1A 3X0WA 1KJTA 1WFYA 2G45B 4GU2A 2MX2A 4HVBA 1WXVA 1EO6A 2GBRA 4II2B 4JQWC 4W9EA 4MM3A 2PJHA 4KIKA 4M8NA 1P9DU 3TIXA 1E90A 2C7HA 3CF6E 2Y5BB 2O2VB 1YX5B 3BY4B 1V81A 4GMVA 4DHJD 1RFAA 2RGFA 2IYDB 3PVLA 4GB9A 3DOWA 4WAAA 4ZRIA 4KZ0A 4B6WA 1WYWB 2DHZA 4ICVA 3L54A 3PPAA 3UQBA 2BGFA 3I3TB 1XQQA 1P98A 2LJ5A 3VUWA 2D07B 2ZCCA 2ZVOA 2UYZB 3WANA 4JL9A 3H9DA 3ENEA 4IUMB 2LD9A 3U8ZA 4B95A 3A4RA 2KTRB 3N32A 4RM8A 3QCAA 2DAJA 2NCNA 4WJOA 1E8YA 1WGGA 2BWES 2N7DA 1WJ4A 4W9HA 2LVPA 4FHJA 3VTWA 1NDDA 1V5OA 4EOYA 1WX8A 1SIFA 3LDZE 2CS4A 2FIFA 2PE6B 4F1SA 4W9DA 1Q1OA 4GN1A 4E3CA 4A3PA 1A5RA 1FXTB 4MSQB 2K1FA 4EFOA 5J18A 1YIWA 1WMHA 1OEYA 3QC8B 2V3SA 2KLGA 3VXWA 4TQ0A 2MP2A 1V2YA 3KW5B 1LM8B 3PRMB 4I6NB 2RR9A 1K8RB 2IBIB 2BKRB 3IFWB 4OVUA 4YL8A 2KDFB 3OJ3A 3IVFA 4ZDVA 3A9JA 2KO3A 5CHVC 2M4NA 4FJZA 1WGHA 3JSVB 2L8JA 2GBNA 2FCQA 1V9JA 4N9F4 3ZLZA 3L0WB 4DHJB 1C3TA 4FHKA 5IAAC 2CR5A 2JZZA 2IY0B 2KJHB 2KXJA 1E7UA 3L10B 4HLEA 4BKGA 2DZIA 3V6EB 2BF8B 3QX1A 4WWNA 1V6EA 2N7EA 4EZJA 3D32A 1QZEA 4KIKB 1WRDB 3SHQA 4AJWA 2ZNVC 4DHZE 1NBFC 4PS3A 3QHTA 2KKCA 2KD0A 2YLMA 4BKTA 5AEKB 5IA7A 3KYDD 3W1SC 3GOEA 3WALA 1WH3A 3X23A 4W9FA 4B9KA 4EUTA 2JF5A 5J17A 2ZCBA 3IG3A 2BKFA 3MTNB 3VUXA 1LXDA 2LRUA 4ZRKA 5BO4B 2KVRA 4GOCA 1ZW7A 1ISNA 3B08A 1GUAB 2KN5A 2FIDA 3KUZA 4HDQA 3VH4B 2BYEA 4MELA 3A9KA 3M3JA 2MW5A 4X57B 4W9GA 3RD2A 2JUOA 1WXSA 4IM3A 4KV2A 2KNBA 5DCNA 2QHOA 3RZWC 2ZPYA 1WM2A 1YX6B 2G4DB 3EECA 3SD5A 3U7DA 3ZNID 2DYMA 4WWPA 1VCBA 1GNUA 4WQOB 4AUQC 3KH0A 3PRZA 2JPHA 1P3QU 1NI2A 2K6DB 2KOXA 2D2QA 3EHVA 5CHWA 1H4RA 1WMHB 2JVCA 4IG7B 4K7UA 1E5WA 4MGYE 4AP4C 1J8CA 2MP2B 3VH3B 4IWPA 4LDTD 4GDKA 2JWZA 3A9JB 1H8CA 4AWJA 2L0FA 4FULA 3WAMA 2KFKA 2JRHA 1CMXB 5LLIA 3AU5A 3UINB 4PYUA 4FJVB 3VVWB 2IO0B 5CTRC 1WR1A 3IBEA 2YVCA 5AZHA 3ZVVA 4FADA 5E6NA 1J0GA 4F8CB 3MHSD 3M63B 4EKUA 2LVQA 1GJZA 3HIZA 1GC7A 3O65B 4K1RB 1L7YA 1G6JA 3W1YA 2KJ6A 2K6QA 4NPNA 1YQBA 2L0TA 2KZRA 3L08A 4I6LB 1MG8A 2XK5A 2KFJA 4W9IA 3RCZA 3HM6X 2NR2A 1SE9A 4MDKE 2WX1A 4OVVA 1UELA 3R66C 4RMAA 2N9PC 3QARA 1IYFA 2J0JA 1WJUA 5JZEB 2REXA 2M0XA 4ANUA 4DXAB 2IO3B 1P1AA 3NOBA 3Q3JA 1AARA 5E6OA 4ANVA 3A9KB 4EZLA 2O6VD 1LQBA 1R4MI 4HJKA 3DVGY 3KVFB 4GIVA 4GSWA 2OOBB 2BWFA 4URKA 2KK8A 1WGDA 3ML9A 5D2MB 3VQIA 2CHXA 2KANA 3AULA 4GXBA 3RUIB 2KQSA 2C5LC 4LDTB 1WE7A 2EMTA 1V5TA 3PZDA 5D6JB 3UIOB 4ANWA 2AL3A 1EUVB 1RLFA 2MBOA 2RPQA 3H7SA 4E74A 4NJ6A 5JHAA 2R2OA 4DK5A 1Z2MA 2J0MA 3DDCB 1I35A 3JW0X 3ZTDA 2D11A 2I1KA 1PQSA 2AEHA 1TTNA 4IM2A 4P7IA 5C23A 2JT4B 2DYBA 1L2NA 3KYCD 4GDKB 2LGYA 2WYQA 2GMIC 4IWQA 1Z5SB 4DHZB 4AOFA 1S3SG 2ZZPB 3VAWA 2EKEC 2FCSA 2AL6A 4FA6A 2KFKB 2KMCA 4WJQA 4HK2A 5LXHA 2CU1A 5FR6A 1E8ZA 3ZKJC 3EFUA 2KLCA 1OTRB 4EEWA 2JZ3B 2NPTA 2DX5B 4DBGA 3APDA 2OJRA 2KHWB 1WY8A 2D3GA 3TJPA 1Q0WB 4ASWC 4HCNB 3RT3B 1VD2A 1E8WA 2Z0DB 3PSEB 3ZUNA 2BYFA 2PPHA 3BINA 5C1ZA 1YD8U 2C60A 3QAQA 2MSED 4G3XB 2WWZA 2DYOA 3CMMB 3EC8A 3DBLI 1TGZB 2JRIB 4HWIB 4MJSA 1F9JA 2XK5B 3R7RA 3T9LA 2PEAA 4W9CA 3VHTC 4W9LA 2ZPNA 2GOWA 1LFDA 4HCPB 4GGQA 3V60A 4E71A 2K39A 3N30A 2K25A 2L05A 4PS7A 2J0KA 4K7WA 2G3QB 2XEWA 2A4ZA 4M8MA 3VFKA 2FNJB 4BFRA 5TR5A 1XT9B 5JH5C 3K9PB 2KX3A 3IHPC 2R2QA 2LUEA 2CKHB 3NZSA 4I6PA 3TMPB 1YJ1A 4NY0A 3APFA 4JGHB 4JLCA 2KX0A 5L95C 3APCA 3WA0A 3DVGX 2Z0EB 3V61A 3LJ3A 4NQKE 4NNJB 3V6CB 2DZKA 3ZRFA 2DENB 3DVNV 4KDIC 1UH6A 3ZIMA 2DZJA 1R4NI 4HDOA 4MSMB 4MH0E 5DPWA 3H6NA 5DPRA 2FAZA 3DBSA 4BOSC 3VDZA 2MBQA 1KOTA 3ZDMC 2NBVB 5J2RA 1OEYJ
chains in the Genus database with same CATH superfamily
1Y8RC 1SIJA 4US8A 3WAOA 2W3SA 4IM0A 4WJNA 4N6EB 1L0XB 4M0WB 1MHXA 2XBBC 3ZGZA 1PFDA 3Q3MC 4ZYNA 1M94A 3BZDB 3PGEA 3QWZB 1GG3A 1T0YA 1TZOA 3N3KB 1AW7A 1JROA 3PREA 4YSXB 3JYUA 1PGBA 3K9OB 3RNEC 3UGBB 3VR8B 2IO1B 4P6VF 1GB1A 2K8CA 1WR6E 1N60A 1VZ8A 2E3TA 3ZW3A 4WJPA 2WXGA 1FPYA 3H7PA 3UF8A 4WWMA 2IO2B 4HKQA 4NAWA 3OJ4B 1WGYA 4G50A 4YTNB 4A9AA 2N7JA 2N9EB 3S2AA 1V86A 1ZGUB 5G55A 3ZQ4A 3NZUA 2NVUI 1XXGA 2MA9B 3HVDA 3LB8C 1B9RA 3DHHC 4K3BA 4DXFA 2G1EA 5E6PA 4YSYB 1V97A 2XN9C 1MG4A 4MGZE 2GBKA 2ZEQA 3P2BA 3PTFC 3OLMD 4B0MA 1XD3B 4LJOB 1WM3A 2M56B 1MHHE 1L0VB 1T0QC 4A90A 4N58A 3U30A 4DXGA 2JZPA 4RGTA 2SAKA 4HROA 5EE1A 1I4HA 4LNOA 3PLVA 1FNVA 4KX6B 4BOZB 2K8BA 3NVVA 2KC2A 4PK1A 5HKHA 4HJGE 2WXNA 4KKIA 2W9NA 1YOVB 3TEZA 2PIAA 4IKGA 3A4SC 2DLBA 3GB1A 3H7PB 2LI5A 1UGMA 3B0AA 2PKOA 4NAWB 2AYOB 2D3AA 3NHEB 1EF1A 3AEEB 1FRRA 2V1YA 2VRRB 2Z59B 1WGRA 3P63A 4HPLB 2JSVX 3P42A 2EELA 1ZXIA 3V3XA 5IP4D 2GBJA 2J4XA 4ICUA 3NVWA 4M01A 1KH0A 5GMVA 1QLBB 2M8SA 3V62A 4CYEA 2BQQA 2KTFA 1J19A 2IY1B 4C00A 1V1OA 2WX0A 1WJ6A 1UD7A 1IP9A 1GAQB 2QC8A 3X0WA 1KJTA 4HVBA 1Q10A 1EO6A 4KIKA 4M8NA 3TIXA 1E90A 3AE5B 2Y5BB 1LO5D 1R7SA 1V81A 4GMVA 3DHGC 3DOWA 4ZRIA 3BK2A 2MEKA 1P98A 2BS3B 1YN3A 1NVID 2D07B 2BB5A 2ZVOA 2UYZB 5T8IA 3AE2B 3U8ZA 1CJEA 3N32A 2NCNA 2N7DA 2LVPA 2CJNA 4EOYA 1SIFA 2PE6B 4JX1C 4GN1A 4MH8A 2K1FA 1QF6A 1JWMD 1WMHA 2WNMA 1TT5B 3Q8AA 2KLGA 3VXWA 4H2AA 3W9CB 4OVUA 3PRMB 1K8RB 2IBIB 3IFWB 4AQ7A 2INCC 4FJZA 1QT9A 3L0WB 4FHKA 2JYEA 1E7UA 3L10B 3MHZA 2BF8B 5AUIA 4NZLB 2N7EA 1QZEA 4KIKB 2KKCA 1ZOYB 3GOEA 2OHFA 3KQ4A 4EUTA 2J52A 3IG3A 2PMVA 2BKFA 3VUXA 4RCOA 1ISNA 3RNBC 2FIDA 3A9KA 3N1XC 2JUOA 2IGGA 1WRIA 3SD5A 3ZNID 3I5JC 1VCBA 3KH0A 2VZKD 1SSNA 1WMHB 4MGYE 1JW9D 3Q14C 1D4BA 1WGKA 1C9FA 2WXKA 1CMXB 3AU5A 4FJVB 5CTRC 2INNE 3IBEA 2YVCA 2K0PA 5AZHA 3MHSD 2N9LA 3M63B 1N63A 1GC7A 1G6JA 4USAA 2JQRB 1T5XD 2K6QA 1YQBA 1B1ZA 2WU5B 2PW9A 4W9IA 3RCZA 3HM6X 2NR2A 3L4PA 4OVVA 1I4PA 1WWTA 2J0JA 5JZEB 2BS4B 5E6JA 2M0XA 4D2KA 1P1AA 1IGDA 2VZKB 3A9KB 4LTUA 4IOIE 1V8CA 4HJKA 3DVGY 3NUHB 5IN7A 3EFCA 2MJEA 5D2MB 5FKAC 3W5UB 2WXRA 2KANA 1BUIC 1V5TA 2MBOA 3H7SA 5JHAA 2R2OA 2L83A 1I35A 4JWSC 1KLUD 3VRBB 2D11A 1PQSA 5C23A 1TTNA 3HUIA 2JT4B 3RPFC 1L2NA 2LGYA 1Z5SB 3AB5A 1QOFA 5LXHA 4WQMA 2CU1A 3ZKJC 2KLCA 4EEWA 2NPTA 2DX5B 3U52E 2OJRA 1RYJA 1VD2A 2MJ3A 1YD8U 4RH6A 4G3XB 2DYOA 1HZ5A 3EC8A 3BVZA 3C8YA 2JRIB 4MJSA 3R7RA 3T9LA 2PEAA 2NMQA 2Y3AA 2GOWA 3AM9A 3BVGA 3N30A 2J0KA 3N9YC 2QILA 1ESFA 2RDBC 1XLPA 1ZPSA 2LUEA 3NZSA 2D3CA 3DWGC 3APCA 3V61A 3LJ3A 4NQKE 2WP9B 1TS2A 2DENB 3PO0A 4KDIC 2WXPA 3ZIMA 1SJHD 5DPWA 5DPRA 1SB3C 3DBSA 4BOSC 1OFFA 2MBQA 2W82A 3ZDMC 1YN5A 3P4QB 3R2TA 5EE0A 2WLBA 4KDLB 4YXDB 1K52A 2NPTB 2UWQA 3ZXVA 5D94A 3U7ZA 4TV3A 4CHKA 1WZ0A 1T0SC 1YMHE 4MJSB 2L7RA 1XCTL 5CHFA 1VDVA 4TUUA 3GE8C 3H1UA 3AE4B 3MJ5A 4XC2A 2HE7A 2W3RA 4ACFA 4FJYA 3Q3OC 1FO4A 4BVUC 1WIAA 4Q2JA 3R8BA 3Q3FA 2K8HA 1EU4A 1R4MB 2JXXA 3ZTCA 1SXTA 3AN1A 2ZJDA 2LGDA 3VR9B 4C80A 2D10A 2RD0A 3M62B 2KC1A 5KHOA 1F1HA 4MGKE 2N0SB 3NG0A 3R2IA 4A55A 4IWOA 5L83A 4NQLB 2G4SA 2WXHA 2LXCA 2WS3B 3DBRI 3WAPA 4KZCA 2B3AA 2KT7A 2ZNVB 3KUDB 4XX5A 1EF5A 4WH4A 3Q6BA 4HKZE 2LWPA 5DPTA 3ZNGC 2KDEB 4M02A 1ZE3D 1OQYA 4C56C 2LXAA 2NBWB 3NVYA 4S17A 2E6XA 3KLSX 4AJYB 4BBNF 3IXSA 1JQ4A 3T8MA 3AEBB 4YT0B 1D5ZC 1WYGA 2IZVB 2MH7A 2DZMA 3ECIA 3KUCB 1GPXA 1J7CA 1WF9A 3IAS1 3RULA 3QJZA 4KSKC 2KJRA 1HEZE 5G2NA 1D3ZA 1RAXA 3SR6A 1NEKB 3OAWA 4YSZB 2MBHA 2IGDA 2MCNB 1ZUD2 2B76B 4RGMA 1XLNA 2LEKA 3ZNZB 1FFUA 4REZA 1OGWA 4KGTA 4RF0A 1YQ3B 2KWCA 2QSDA 1SEBD 5KHQA 1HQRD 4MEMA 1UF0A 2D3BA 1SGHA 2V4LA 1GC6A 3AU4A 4EZKA 1E7VA 1WE6A 2LZ6A 3JSVA 1Q5WB 3RYTA 5AUKA 3L17A 1FXIA 4PS8A 3ZDTA 4TMAB 4RGOS 4W9JA 1TZ1A 2LHDA 2MX2A 3I57A 4US9A 1WXVA 1JMLA 4MM3A 3ZJTA 3DHIC 3GS2A 4KKJA 2IDYA 1KTKA 1RFAA 2RGFA 3PVLA 4OHJA 4O1NA 2DHZA 3P4PB 1YQ4B 4ICVA 3PPAA 1XQQA 2INDC 2ZCCA 3AE8B 1UWXA 3WANA 4IUMB 2LD9A 1F52A 1I4RA 2BT6A 4RM8A 3QCAA 2BWES 1WGGA 4W9HA 1WJ4A 4RFBA 4YWGG 3LDZE 5HHDG 2FIFA 4W9DA 1A5RA 4MSQB 1YN4A 4EFOA 2KQ4X 3QC8B 2V3SA 2L32A 4RGNA 2MP2A 3KW5B 1LM8B 1I42A 3FILA 2KDFB 4ZDVA 3Q69A 3A9JA 1NYQA 1MJDA 2KO3A 4XDCA 2PVOD 3JSVB 1XEEA 4IDIA 4ARCA 4RNAA 4BKGA 4EE2A 4WWNA 3MC0B 4MM3B 4L1BA 3D32A 1WRDB 4DHZE 2WGSA 3QHTA 2KD0A 2YLMA 3B9JA 1WH3A 3X23A 4B9KA 1MVKA 2JYTA 5J17A 5G5HA 1LXDA 3B08A 4ZRQA 1SJED 2KN5A 4W9GA 2AQ1B 3RZWC 2KNBA 5DCNA 2QHOA 4A8XC 2G4DB 2DYMA 4WWPA 2AQ3B 1P3QU 2KOXA 2D2QA 3EHVA 2JVCA 1C4AA 4K7UA 4MACA 4AP4C 3PZ8A 2MP2B 2ACZB 3VH3B 1OQRA 3OG5A 3FILB 4GDKA 4LK0M 3A9JB 1TS5A 3MC8A 5C3JB 4ZYSA 2JRHA 1JALA 1P7EA 3EA6A 1WR1A 2WQYB 4F8CB 2LVQA 3HIZA 3Q8FA 2KJ6A 1MPEA 1SF0A 4NPNA 3L08A 4I6LB 2XK5A 5TSSA 5JHBA 2WX1A 5EE3A 2N9PC 3QARA 1WJUA 2HDEA 2REXA 3LXFA 4C7YA 1NENB 1AN8A 3NOBA 3Q3JA 1AARA 2O6VD 2HJ1A 4GLSC 3MC9A 4WIPA 2BWFA 4URKA 2KK8A 1OQQA 4BZAA 3P4RB 2X8XX 1WE7A 3I63C 3UIOB 4ANWA 2AL3A 1TKYA 4WURA 1RLFA 4E74A 1Z2MA 3ZTDA 2ZW1A 2I1KA 4GDKB 2WYQA 2R61A 1TKGA 2ZZPB 2XNAC 2AL6A 4FA6A 1N61A 3EFUA 4ASWC 2PTLA 2ONQA 2BYFA 1Y56A 1L0YB 4HWIB 1F9JA 2LGSA 2XK5B 3KWVA 2GI9A 3VHTC 3MFGA 3DBHB 4GGQA 2K39A 3BK1A 2K25A 2KYWA 4N59A 3VFKA 4M8MA 3RNCC 4ZRPA 4BFRA 1RM6C 1AWDA 5JH5C 3IHPC 2R2QA 4A6QA 2CKHB 3TMPB 1YJ1A 3I9V1 4JGHB 1FCCC 3ABVB 3WA0A 3B2FA 4K3CA 1K50A 1TIFA 3AEAB 2DZJA 4MH0E 1L4ZB 3BYTB 3NZ3A 3HHMA 1ZP0B 5J2RA 3QA8A 4XYCA 1FNUA 4DDGD 1HE8A 5I4DA 4JIOU 1S1QB 3QQ8B 3DPDA 1C1YB 3RN9C 4FN2A 2V0GA 1PGAA 2LMCA 3DVNU 2J7QB 2M17A 1K53A 3NS8A 2Y5CA 3AMZA 1HTOA 3ML8A 2WXFA 3W1SA 3Q8CA 2JWUA 2KDIA 4ZRJA 4HPMB 1V49A 4XE0A 3SU8X 3FC4A 3TBLD 2WXLA 4LLGM 1VRAB 4TKNA 3C0RB 3CWIA 2OJWA 3KWLA 4FXCA 3VTUA 2N9XA 4NJCA 2C9WB 5HFYA 4K81A 1ZKHA 4ZHOA 3M95A 1FD6A 2WXOA 2NTSA 3DWMA 1F77A 3R7QA 4ZHPA 2MLBA 1SE3A 3V05A 4FBJB 1TS4A 4P1BC 4A20A 1WJNA 2IJ0A 1GOZA 3JVZX 1T6BX 1UBIA 1IPGA 3AI5A 3AV8A 2M0AA 4P1CC 4BKSA 1F2RI 2FCMA 3ETRA 2MRPA 4PYZA 2PE9A 3A33B 4GDLA 1E0ZA 1E7PB 2ZVNA 2LJIA 2I1JA 4BKSD 1UBQA 1T3QA 3VUYA 2N1WA 3PRPB 2KQ7A 1JWAD 2KWVB 1JWSD 4OZCA 3GE3C 3ZXRA 3DBHI 2DAFA 1FFVA 3RZFA 3B1LX 4W9KA 3DQVA 3ZJVA 1I7HA 1DOYA 1VJKA 2K3UA 2CHZA 1ZXHA 2L00B 4J6IA 3EUB2 3O13A 1JRUA 3CSFA 3IT6B 3BVMA 5AZFA 1IBXA 2KTRA 3RNGC 1ENFA 3ONSA 1E8XA 4JWUC 1BT0A 4G11A 4F7ZA 2A5UA 4RM9A 4LNNA 1C79A 2HD5B 4WWOA 1WX9A 1U4AA 1ET6A 1CK1A 3U2SC 2BPSA 4DDID 4BBNC 2RSUA 4LNIA 4GDLB 2JY6A 4BAXA 4FLHA 3PLUA 2MBEA 3AE6B 1MI0A 3PV1A 4LCDE 3CIRB 1C77A 1WFYA 2PVGC 2G45B 4GU2A 2GBRA 5BYQA 1MFWA 2VH2A 2AQ2B 3BY4B 4DHJD 3AEDB 4KZ0A 1WYWB 1TJEA 2GLSA 4OVZA 3L54A 3UQBA 2BGFA 3RI7C 4L2YA 3VUWA 2G9HD 3ENEA 1IBXB 4B95A 2KTRB 2MHJA 3BIID 1GB4A 1M4VA 4FHJA 1NDDA 1V5OA 2BW2A 4F1SA 2K5PA 3SEBA 4A3PA 4E3CA 1FXTB 2QEJC 1OEYA 1V2YA 5AEKB 1UGJA 2RR9A 3IVFA 3Q3NC 5IKCM 4OZBA 2WXQA 2M4NA 3DBLB 2GBNA 2L8JA 2FCQA 1V9JA 4P16A 4DHJB 5IAAC 2KXJA 3TEXA 1QKZA 4HLEA 2BVCA 2DZIA 1D6EC 3QX1A 1N6ZA 4AJWA 1QOGA 2ZNVC 1EWCA 4BKTA 5IA7A 3KYDD 2KN4A 1DOIA 2WXJA 4W9FA 5BYSA 2JF5A 2ZCBA 2LRUA 4ZRKA 3W2DA 5BO4B 1J7BA 4GOCA 1ZW7A 1VZ7A 3UI3A 1GUAB 3W5VB 1PGXA 3KUZA 4HDQA 3VH4B 2BYEA 3M3JA 2MW5A 1WXSA 4IM3A 2ZPYA 1YX6B 4B0EA 1IUEA 4WQOB 3ZJUA 1P7FA 2W54A 3PRZA 1DYQA 5CHWA 1H4RA 2FBWB 1L5PA 1J8CA 4IWPA 4DQOC 1C4PA 2CJOA 1H8CA 4AWJA 2L0FA 4FULA 2KFKA 5HI1A 3RNFC 3GZNB 3VVWB 3ZVVA 3LYYA 1J0GA 2QDFA 3O65B 4K1RB 4YTMB 3T3OA 1VZ6A 3U4EG 1MG8A 1YJJA 1FEHA 5H92C 2V3PA 4MDKE 1SE9A 2WDVB 1UELA 3R66C 4M00A 1FM0D 5GXGB 4ANUA 2H88B 2KACA 3AE9B 2IO3B 5E6OA 4ANVA 1JWUD 2JU6X 4EZLA 2ICIA 1R4MI 4ITKA 4GSWA 5G5GA 3ML9A 3VQIA 2CHXA 3RUIB 4GXBA 1EU3A 4YTPB 2KQSA 5D6JB 3PZDA 1C4CA 1XLOA 1EUVB 1SBBB 2J53A 4NJ6A 4DK5A 2DNFA 2J0MA 1N62A 3T3NA 2KWDA 4P7IA 1I4GA 2GMIC 4IWQA 4DHZB 4AOFA 1S3SG 3VAWA 5LNK1 2EKEC 2FCSA 2KFKB 4WJQA 5FR6A 2J42A 1OTRB 4DBGA 3APDA 4J3OD 2KHWB 1WY8A 3TJPA 1J7AA 1FCLA 3SFEB 2PPHA 4MT5A 3BINA 4R3DA 2C60A 2MSED 5BYRA 3CMMB 3H8HA 3DBLI 5BMGA 3Q8BA 3AH7A 1N5XA 1KF6B 4W9CA 1ROEA 4W9LA 1LFDA 3V60A 4E71A 1JRPA 2L05A 3ZYYX 1L4DB 2G3QB 4XGAB 2V9HA 1XT9B 2KX3A 4I6PA 2LGIA 3MP9A 3APFA 4JLCA 2KX0A 5L95C 3DVGX 3V6CB 2DZKA 2FE8A 2FAZA 2Y5PA 3AEFB 3VDZA 2SEBD 1KOTA 4RF1A 2DBYA 3PZ7A 3WIMA 1OEYJ 2KAJA 1KM7A 4A3OA 4G0NB 3VTVA 4TQ1A 1L6VA 1UZXB 2EMSA 3ZNHB 3SDLC 4TSSA 2W55A 4HXDA 2NBUA 3FKYA 4XDDA 2BBCA 4OW0A 4DWFA 3L16A 2INPE 2H89B 3A1QA 1TS3A 2LUMA 2Q5WD 2NS5A 4S0RA 3NY5A 5EDSA 5LXIB 1XF5L 4IC7B 1WX7A 3GZNI 2O6VA 1D5XC 3Q2AC 5CX3A 2AWTA 2LASA 2QJLA 3UQAA 1WXQA 2WHIA 1RRBA 1WI0A 2KVZA 1BMLC 4ZOHC 1HTQA 2FCNA 3AEGB 4HRSA 2KMAA 3TCAA 2LHEA 1EWYC 4KGSA 4KVGB 1BXTA 1V80A 2FUG1 3DCGA 4L23A 1DGJA 4ANXA 1FMAD 3TEWA 2L1AA 1WXMA 3QK0A 3PT2B 1P0RA 2M1MA 1FIQA 4LNFA 2K9XA 5DPSA 1QQRA 1NI3A 5MPOA 4WAFA 1D5MC 5AZGA 4OZAA 3MJWA 4IW0A 4HEA1 2LVOA 5D7GA 3E56A 1SE2A 1FRDA 4LJPB 1XCQL 3NS1A 4K7SA 1WXAA 3URYA 1JWBD 2N4FA 4QAYA 2WDTB 2HTHA 2TSSA 2ZW0A 2CHWA 2C7MB 3NRZA 2KDBA 3UIPB 1UUPA 1KRHA 2EKIA 3L13A 3PHWB 3A1QB 3TSSA 2D5GA 3PHXB 4CO7A 2RDHA 4XZ4A 2N1VA 2C7NB 1KLVA 2O6VB 1F2RC 2L76A 3HVZA 1UNSA 3TL5A 1X1MA 4NJ7A 4NAMA 3FAHA 2HTME 1PUTA 3AE1B 3GP7A 2LRWA 1A70A 1STEA 1CQVA 2WXMA 2HJ8A 3N1ZC 2MQJA 3P1MA 2O2VA 4KSLC 2RMMA 2ASQA 1WZ3A 3ZO5B 2BYTA 4XWTA 2LGXA 4ARIA 2MBBB 5IO9A 4KGRA 5EE9A 4II3B 1FXAA 2GBMA 3NVZA 3ZRCA 1IGCA 5HG2A 3NJTA 2BYVE 3CSTA 2QIEB 3HK0A 1YJIA 3R3MA 2ON8A 1DOXA 2L3ZA 1PDXA 1TY0A 3AXCA 3QIJA 2FUHB 2WDRB 3ALBA 4MGIE 2KWUB 2MWSB 1KLGD 1TBEA 3HM3A 1PYWD 2N9KA 2V4IB 3PS6A 2UU7A 1V1PA 5FK9C 4C7ZA 4II2B 4JQWC 1JCKB 4W9EA 4LNKA 2PJHA 3B2GA 1P9DU 2C7HA 3CF6E 2O2VB 2JX5A 1YX5B 1C78A 2IYDB 4GB9A 1ZDXA 4WAAA 4B6WA 3Q8EA 3I3TB 5C2TB 1HA5A 3N20C 2LJ5A 3AECB 2VH1A 4JL9A 3H9DA 3E9SA 3TUOA 3A4RA 3SFDB 2WU2B 2DAJA 4WJOA 1E8YA 2M19A 3VTWA 1WX8A 1YNTE 4AS1A 2CS4A 1Q1OA 2X38A 5IOIA 5J18A 1TY2A 1YIWA 1SE4A 4TQ0A 4C4VA 1ZDVA 3DBRB 4I6NB 4YL8A 2BKRB 3OJ3A 5BMIA 1VR9A 5CHVC 1NYRA 1L6UA 1WGHA 1VLBA 4CQNA 4N9F4 3ZLZA 2YEPB 1C3TA 1K51A 2CR5A 1RWSA 2IY0B 2JZZA 2KJHB 1V1PB 3V6EB 1V6EA 4HPPA 1AYFA 4EZJA 3SHQA 1NBFC 1XO3A 4PS3A 2WDQB 3W1SC 3WALA 1ET9A 3MTNB 2CU3A 4PT5A 5FR3A 2KVRA 5D3DA 1ACCA 4MELA 4X57B 1R4NB 3RD2A 4KV2A 1WM2A 2K22A 3EECA 3U7DA 1I4QA 1GNUA 3BWUD 4AUQC 2AX5A 1HZ6A 2JPHA 1NI2A 2K6DB 2I2YA 2QMTA 4IG7B 1E5WA 4C4VB 5JXVA 4LDTD 3HRDD 2JWZA 3WCQA 3N1YC 3WAMA 1XLQA 3UINB 5LLIA 4PYUA 1T0RC 2IO0B 3RFZB 4XWWA 1E9MA 4FADA 4JE3B 2OEDA 5E6NA 5H8YE 1E6EB 4EKUA 1GJZA 1L7YA 2RDGA 3W1YA 2L0TA 2KZRA 3RMKC 2GRIA 2KFJA 1I4XA 1EM7A 4RMAA 1IYFA 2QCZA 4JPSA 4DXAB 3AE7B 1QILA 1LQBA 3KVFB 4GIVA 2L52A 2OOBB 2MJDA 1WGDA 2YEPF 3AULA 2KDMA 2C5LC 2I38A 2EMTA 4LDTB 2PLPA 2RPVA 5D3IB 2BTEA 2RPQA 5BMHA 2KMMA 3DDCB 1C76A 3JW0X 2V3NA 2AEHA 4IM2A 2DYBA 3KYCD 3AE3B 3IT4B 3P4SB 1E10A 2KMCA 1TYGB 4HK2A 1E8ZA 2JZ3B 1LGRA 2D3GA 1Q0WB 4HCNB 3RT3B 1QOAA 1E8WA 2Z0DB 3PSEB 4M0WA 3ZUNA 5C1ZA 3QAQA 1RFKA 3VRAB 3C19A 2WWZA 1QOBA 1TGZB 1WSPA 1FNWA 3EGRA 2ZPNA 4HCPB 2JXTA 4PS7A 4K7WA 2NTTA 2XEWA 2A4ZA 2FNJB 2Z8LA 2BB6A 5TR5A 3J9CA 3OWEB 1CZPA 4UDUC 3RNAC 3K9PB 3BYYB 2GB1A 4NY0A 2Z0EB 2IPKD 4NNJB 2LFIA 2IGHA 3ZRFA 3TEYA 3DVNV 2BS2B 1UH6A 1R4NI 4HDOA 4MSMB 2WXIA 3H6NA 1UWMA 1TKEA 1F0ZA 1HXYD 1N5WA 1KFYB 3IAM1 2NBVB 2DWQA
chains in the Genus database with same CATH topology
3QA8A 1KM7A 1Y8RC 4A3OA 4G0NB 3VTVA 4TQ1A 3WAOA 4DDGD 1HE8A 4JIOU 1S1QB 3QQ8B 3DPDA 1C1YB 1UZXB 2EMSA 4KDLB 3SDLC 4FN2A 4IM0A 2NPTB 3ZNHB 4WJNA 2UWQA 3DVNU 4HXDA 5D94A 2NBUA 4TV3A 2J7QB 2M17A 4M0WB 4CHKA 3NS8A 2XBBC 3ML8A 4DWFA 3L16A 3A1QA 1M94A 3PGEA 4ZYNA 1WZ0A 3QWZB 2NS5A 1GG3A 1T0YA 3NY5A 5EDSA 5LXIB 3HHMA 4MJSB 2KDIA 3N3KB 4IC7B 1WX7A 2L7RA 3GZNI 2O6VA 5CHFA 4ZRJA 4HPMB 5CX3A 4TUUA 2AWTA 2LASA 1V49A 3PREA 3UQAA 3SU8X 3W1SA 3H1UA 3TBLD 3JYUA 1RRBA 4XC2A 1WI0A 3K9OB 3UGBB 2HE7A 2IO1B 4FJYA 2K8CA 2FCNA 1WR6E 4BVUC 1WIAA 4TKNA 2KMAA 3C0RB 3TCAA 3Q3FA 4KVGB 3VTUA 1V80A 2K8HA 3ZW3A 4WJPA 3DCGA 2N9XA 2JXXA 3ZTCA 2C9WB 4ANXA 3H7PA 3UF8A 1WXMA 2IO2B 3QK0A 3PT2B 4K81A 4NAWA 1P0RA 2M1MA 2ZJDA 3OJ4B 1WGYA 1ZKHA 4G50A 2LGDA 2D10A 2N9EB 2RD0A 3M62B 3M95A 3S2AA 2KC1A 5KHOA 5DPSA 1V86A 1ZGUB 5G55A 5AZGA 3NZUA 2NVUI 3MJWA 4IW0A 2MA9B 4MGKE 2LVOA 5D7GA 3R7QA 2MLBA 4LJPB 4K7SA 1WXAA 5E6PA 4FBJB 2N4FA 4IWOA 4A20A 4MGZE 5L83A 2GBKA 2ZEQA 3P2BA 1WJNA 3PTFC 2WDTB 3OLMD 2HTHA 4NQLB 5JHBA 2G4SA 2CHWA 1XD3B 3JVZX 2C7MB 2LXCA 4LJOB 1UBIA 2KDBA 1IPGA 3AI5A 1WM3A 3UIPB 3DBRI 3WAPA 3L13A 2B3AA 2FCMA 4KZCA 4BKSA 2ZNVB 3PHWB 3A1QB 3KUDB 4XX5A 1EF5A 3U30A 2MRPA 4CO7A 3PHXB 1KLVA 4XZ4A 2N1VA 2C7NB 2PE9A 2LWPA 4PYZA 2O6VB 3A33B 5DPTA 3ZNGC 2L76A 2KDEB 4GDLA 3TL5A 1X1MA 4NJ7A 2ZVNA 3PLVA 1OQYA 2LXAA 2NBWB 2I1JA 4BKSD 2LRWA 1UBQA 3VUYA 4AJYB 2N1WA 4BBNF 3PRPB 4BOZB 2K8BA 2KQ7A 2KWVB 3T8MA 2HJ8A 2IZVB 2KC2A 5HKHA 2MQJA 2DZMA 2W9NA 3ECIA 2O2VA 3DBHI 3KUCB 2DAFA 3RZFA 4KSLC 3A4SC 3B1LX 3H7PB 1WF9A 2LI5A 4W9KA 1UGMA 3B0AA 2ASQA 3RULA 3DQVA 3QJZA 1WZ3A 2AYOB 4NAWB 3ZO5B 3NHEB 4KSKC 2KJRA 1EF1A 2CHZA 2LGXA 5G2NA 1D3ZA 1RAXA 2L00B 2MBBB 4J6IA 2V1YA 2VRRB 1I42A 1JRUA 3CSFA 3OAWA 2Z59B 1WGRA 2MBHA 5AZFA 4HPLB 4II3B 2GBMA 3ZRCA 2MCNB 2KTRA 3ONSA 1E8XA 3ZNZB 2GBJA 2BYVE 1BT0A 1OGWA 3CSTA 3WIMA 4G11A 2KWCA 4ICUA 3HK0A 3R3MA 4F7ZA 2A5UA 5GMVA 4RM9A 5KHQA 2HD5B 4MEMA 4WWOA 1WX9A 2M8SA 1U4AA 2L3ZA 3V62A 4CYEA 3AXCA 1SGHA 2V4LA 3QIJA 2FUHB 2BPSA 4DDID 1GC6A 4BBNC 2KTFA 2RSUA 3AU4A 4EZKA 3ALBA 1J19A 1E7VA 2IY1B 4GDLB 2JY6A 4MGIE 4FLHA 1WE6A 2LZ6A 3PLUA 2KWUB 2MBEA 2MWSB 2WX0A 1WJ6A 1TBEA 3HM3A 3PV1A 1UD7A 3JSVA 4LCDE 1IP9A 1Q5WB 3RYTA 3L17A 4PS8A 3ZDTA 3PS6A 4W9JA 1TZ1A 3X0WA 1KJTA 1WFYA 2G45B 4GU2A 2MX2A 4HVBA 1WXVA 1EO6A 2GBRA 4II2B 4JQWC 4W9EA 4MM3A 2PJHA 4KIKA 4M8NA 1P9DU 3TIXA 1E90A 2C7HA 3CF6E 2Y5BB 2O2VB 1YX5B 3BY4B 1V81A 4GMVA 4DHJD 1RFAA 2RGFA 2IYDB 3PVLA 4GB9A 3DOWA 4WAAA 4ZRIA 4KZ0A 4B6WA 1WYWB 2DHZA 4ICVA 3L54A 3PPAA 3UQBA 2BGFA 3I3TB 1XQQA 1P98A 2LJ5A 3VUWA 2D07B 2ZCCA 2ZVOA 2UYZB 3WANA 4JL9A 3H9DA 3ENEA 4IUMB 2LD9A 3U8ZA 4B95A 3A4RA 2KTRB 3N32A 4RM8A 3QCAA 2DAJA 2NCNA 4WJOA 1E8YA 1WGGA 2BWES 2N7DA 1WJ4A 4W9HA 2LVPA 4FHJA 3VTWA 1NDDA 1V5OA 4EOYA 1WX8A 1SIFA 3LDZE 2CS4A 2FIFA 2PE6B 4F1SA 4W9DA 1Q1OA 4GN1A 4E3CA 4A3PA 1A5RA 1FXTB 4MSQB 2K1FA 4EFOA 5J18A 1YIWA 1WMHA 1OEYA 3QC8B 2V3SA 2KLGA 3VXWA 4TQ0A 2MP2A 1V2YA 3KW5B 1LM8B 3PRMB 4I6NB 2RR9A 1K8RB 2IBIB 2BKRB 3IFWB 4OVUA 4YL8A 2KDFB 3OJ3A 3IVFA 4ZDVA 3A9JA 2KO3A 5CHVC 2M4NA 4FJZA 1WGHA 3JSVB 2L8JA 2GBNA 2FCQA 1V9JA 4N9F4 3ZLZA 3L0WB 4DHJB 1C3TA 4FHKA 5IAAC 2CR5A 2JZZA 2IY0B 2KJHB 2KXJA 1E7UA 3L10B 4HLEA 4BKGA 2DZIA 3V6EB 2BF8B 3QX1A 4WWNA 1V6EA 2N7EA 4EZJA 3D32A 1QZEA 4KIKB 1WRDB 3SHQA 4AJWA 2ZNVC 4DHZE 1NBFC 4PS3A 3QHTA 2KKCA 2KD0A 2YLMA 4BKTA 5AEKB 5IA7A 3KYDD 3W1SC 3GOEA 3WALA 1WH3A 3X23A 4W9FA 4B9KA 4EUTA 2JF5A 5J17A 2ZCBA 3IG3A 2BKFA 3MTNB 3VUXA 1LXDA 2LRUA 4ZRKA 5BO4B 2KVRA 4GOCA 1ZW7A 1ISNA 3B08A 1GUAB 2KN5A 2FIDA 3KUZA 4HDQA 3VH4B 2BYEA 4MELA 3A9KA 3M3JA 2MW5A 4X57B 4W9GA 3RD2A 2JUOA 1WXSA 4IM3A 4KV2A 2KNBA 5DCNA 2QHOA 3RZWC 2ZPYA 1WM2A 1YX6B 2G4DB 3EECA 3SD5A 3U7DA 3ZNID 2DYMA 4WWPA 1VCBA 1GNUA 4WQOB 4AUQC 3KH0A 3PRZA 2JPHA 1P3QU 1NI2A 2K6DB 2KOXA 2D2QA 3EHVA 5CHWA 1H4RA 1WMHB 2JVCA 4IG7B 4K7UA 1E5WA 4MGYE 4AP4C 1J8CA 2MP2B 3VH3B 4IWPA 4LDTD 4GDKA 2JWZA 3A9JB 1H8CA 4AWJA 2L0FA 4FULA 3WAMA 2KFKA 2JRHA 1CMXB 5LLIA 3AU5A 3UINB 4PYUA 4FJVB 3VVWB 2IO0B 5CTRC 1WR1A 3IBEA 2YVCA 5AZHA 3ZVVA 4FADA 5E6NA 1J0GA 4F8CB 3MHSD 3M63B 4EKUA 2LVQA 1GJZA 3HIZA 1GC7A 3O65B 4K1RB 1L7YA 1G6JA 3W1YA 2KJ6A 2K6QA 4NPNA 1YQBA 2L0TA 2KZRA 3L08A 4I6LB 1MG8A 2XK5A 2KFJA 4W9IA 3RCZA 3HM6X 2NR2A 1SE9A 4MDKE 2WX1A 4OVVA 1UELA 3R66C 4RMAA 2N9PC 3QARA 1IYFA 2J0JA 1WJUA 5JZEB 2REXA 2M0XA 4ANUA 4DXAB 2IO3B 1P1AA 3NOBA 3Q3JA 1AARA 5E6OA 4ANVA 3A9KB 4EZLA 2O6VD 1LQBA 1R4MI 4HJKA 3DVGY 3KVFB 4GIVA 4GSWA 2OOBB 2BWFA 4URKA 2KK8A 1WGDA 3ML9A 5D2MB 3VQIA 2CHXA 2KANA 3AULA 4GXBA 3RUIB 2KQSA 2C5LC 4LDTB 1WE7A 2EMTA 1V5TA 3PZDA 5D6JB 3UIOB 4ANWA 2AL3A 1EUVB 1RLFA 2MBOA 2RPQA 3H7SA 4E74A 4NJ6A 5JHAA 2R2OA 4DK5A 1Z2MA 2J0MA 3DDCB 1I35A 3JW0X 3ZTDA 2D11A 2I1KA 1PQSA 2AEHA 1TTNA 4IM2A 4P7IA 5C23A 2JT4B 2DYBA 1L2NA 3KYCD 4GDKB 2LGYA 2WYQA 2GMIC 4IWQA 1Z5SB 4DHZB 4AOFA 1S3SG 2ZZPB 3VAWA 2EKEC 2FCSA 2AL6A 4FA6A 2KFKB 2KMCA 4WJQA 4HK2A 5LXHA 2CU1A 5FR6A 1E8ZA 3ZKJC 3EFUA 2KLCA 1OTRB 4EEWA 2JZ3B 2NPTA 2DX5B 4DBGA 3APDA 2OJRA 2KHWB 1WY8A 2D3GA 3TJPA 1Q0WB 4ASWC 4HCNB 3RT3B 1VD2A 1E8WA 2Z0DB 3PSEB 3ZUNA 2BYFA 2PPHA 3BINA 5C1ZA 1YD8U 2C60A 3QAQA 2MSED 4G3XB 2WWZA 2DYOA 3CMMB 3EC8A 3DBLI 1TGZB 2JRIB 4HWIB 4MJSA 1F9JA 2XK5B 3R7RA 3T9LA 2PEAA 4W9CA 3VHTC 4W9LA 2ZPNA 2GOWA 1LFDA 4HCPB 4GGQA 3V60A 4E71A 2K39A 3N30A 2K25A 2L05A 4PS7A 2J0KA 4K7WA 2G3QB 2XEWA 2A4ZA 4M8MA 3VFKA 2FNJB 4BFRA 5TR5A 1XT9B 5JH5C 3K9PB 2KX3A 3IHPC 2R2QA 2LUEA 2CKHB 3NZSA 4I6PA 3TMPB 1YJ1A 4NY0A 3APFA 4JGHB 4JLCA 2KX0A 5L95C 3APCA 3WA0A 3DVGX 2Z0EB 3V61A 3LJ3A 4NQKE 4NNJB 3V6CB 2DZKA 3ZRFA 2DENB 3DVNV 4KDIC 1UH6A 3ZIMA 2DZJA 1R4NI 4HDOA 4MSMB 4MH0E 5DPWA 3H6NA 5DPRA 2FAZA 3DBSA 4BOSC 3VDZA 2MBQA 1KOTA 3ZDMC 2NBVB 5J2RA 1OEYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QA8 A;  1KM7 A;  1Y8R C;  4A3O A;  4G0N B;  3VTV A;  4TQ1 A;  3WAO A;  4DDG D;  1HE8 A;  4JIO U;  1S1Q B;  3QQ8 B;  3DPD A;  1C1Y B;  1UZX B;  2EMS A;  4KDL B;  3SDL C;  4FN2 A;  4IM0 A;  2NPT B;  3ZNH B;  4WJN A;  2UWQ A;  3DVN U;  4HXD A;  5D94 A;  2NBU A;  4TV3 A;  2J7Q B;  2M17 A;  4M0W B;  4CHK A;  3NS8 A;  2XBB C;  3ML8 A;  4DWF A;  3L16 A;  3A1Q A;  1M94 A;  3PGE A;  4ZYN A;  1WZ0 A;  3QWZ B;  2NS5 A;  1GG3 A;  1T0Y A;  3NY5 A;  5EDS A;  5LXI B;  3HHM A;  4MJS B;  2KDI A;  3N3K B;  4IC7 B;  1WX7 A;  2L7R A;  3GZN I;  2O6V A;  5CHF A;  4ZRJ A;  4HPM B;  5CX3 A;  4TUU A;  2AWT A;  2LAS A;  1V49 A;  3PRE A;  3UQA A;  3SU8 X;  3W1S A;  3H1U A;  3TBL D;  3JYU A;  1RRB A;  4XC2 A;  1WI0 A;  3K9O B;  3UGB B;  2HE7 A;  2IO1 B;  4FJY A;  2K8C A;  2FCN A;  1WR6 E;  4BVU C;  1WIA A;  4TKN A;  2KMA A;  3C0R B;  3TCA A;  3Q3F A;  4KVG B;  3VTU A;  1V80 A;  2K8H A;  3ZW3 A;  4WJP A;  3DCG A;  2N9X A;  2JXX A;  3ZTC A;  2C9W B;  4ANX A;  3H7P A;  3UF8 A;  1WXM A;  2IO2 B;  3QK0 A;  3PT2 B;  4K81 A;  4NAW A;  1P0R A;  2M1M A;  2ZJD A;  3OJ4 B;  1WGY A;  1ZKH A;  4G50 A;  2LGD A;  2D10 A;  2N9E B;  2RD0 A;  3M62 B;  3M95 A;  3S2A A;  2KC1 A;  5KHO A;  5DPS A;  1V86 A;  1ZGU B;  5G55 A;  5AZG A;  3NZU A;  2NVU I;  3MJW A;  4IW0 A;  2MA9 B;  4MGK E;  2LVO A;  5D7G A;  3R7Q A;  2MLB A;  4LJP B;  4K7S A;  1WXA A;  5E6P A;  4FBJ B;  2N4F A;  4IWO A;  4A20 A;  4MGZ E;  5L83 A;  2GBK A;  2ZEQ A;  3P2B A;  1WJN A;  3PTF C;  2WDT B;  3OLM D;  2HTH A;  4NQL B;  5JHB A;  2G4S A;  2CHW A;  1XD3 B;  3JVZ X;  2C7M B;  2LXC A;  4LJO B;  1UBI A;  2KDB A;  1IPG A;  3AI5 A;  1WM3 A;  3UIP B;  3DBR I;  3WAP A;  3L13 A;  2B3A A;  2FCM A;  4KZC A;  4BKS A;  2ZNV B;  3PHW B;  3A1Q B;  3KUD B;  4XX5 A;  1EF5 A;  3U30 A;  2MRP A;  4CO7 A;  3PHX B;  1KLV A;  4XZ4 A;  2N1V A;  2C7N B;  2PE9 A;  2LWP A;  4PYZ A;  2O6V B;  3A33 B;  5DPT A;  3ZNG C;  2L76 A;  2KDE B;  4GDL A;  3TL5 A;  1X1M A;  4NJ7 A;  2ZVN A;  3PLV A;  1OQY A;  2LXA A;  2NBW B;  2I1J A;  4BKS D;  2LRW A;  1UBQ A;  3VUY A;  4AJY B;  2N1W A;  4BBN F;  3PRP B;  4BOZ B;  2K8B A;  2KQ7 A;  2KWV B;  3T8M A;  2HJ8 A;  2IZV B;  2KC2 A;  5HKH A;  2MQJ A;  2DZM A;  2W9N A;  3ECI A;  2O2V A;  3DBH I;  3KUC B;  2DAF A;  3RZF A;  4KSL C;  3A4S C;  3B1L X;  3H7P B;  1WF9 A;  2LI5 A;  4W9K A;  1UGM A;  3B0A A;  2ASQ A;  3RUL A;  3DQV A;  3QJZ A;  1WZ3 A;  2AYO B;  4NAW B;  3ZO5 B;  3NHE B;  4KSK C;  2KJR A;  1EF1 A;  2CHZ A;  2LGX A;  5G2N A;  1D3Z A;  1RAX A;  2L00 B;  2MBB B;  4J6I A;  2V1Y A;  2VRR B;  1I42 A;  1JRU A;  3CSF A;  3OAW A;  2Z59 B;  1WGR A;  2MBH A;  5AZF A;  4HPL B;  4II3 B;  2GBM A;  3ZRC A;  2MCN B;  2KTR A;  3ONS A;  1E8X A;  3ZNZ B;  2GBJ A;  2BYV E;  1BT0 A;  1OGW A;  3CST A;  3WIM A;  4G11 A;  2KWC A;  4ICU A;  3HK0 A;  3R3M A;  4F7Z A;  2A5U A;  5GMV A;  4RM9 A;  5KHQ A;  2HD5 B;  4MEM A;  4WWO A;  1WX9 A;  2M8S A;  1U4A A;  2L3Z A;  3V62 A;  4CYE A;  3AXC A;  1SGH A;  2V4L A;  3QIJ A;  2FUH B;  2BPS A;  4DDI D;  1GC6 A;  4BBN C;  2KTF A;  2RSU A;  3AU4 A;  4EZK A;  3ALB A;  1J19 A;  1E7V A;  2IY1 B;  4GDL B;  2JY6 A;  4MGI E;  4FLH A;  1WE6 A;  2LZ6 A;  3PLU A;  2KWU B;  2MBE A;  2MWS B;  2WX0 A;  1WJ6 A;  1TBE A;  3HM3 A;  3PV1 A;  1UD7 A;  3JSV A;  4LCD E;  1IP9 A;  1Q5W B;  3RYT A;  3L17 A;  4PS8 A;  3ZDT A;  3PS6 A;  4W9J A;  1TZ1 A;  3X0W A;  1KJT A;  1WFY A;  2G45 B;  4GU2 A;  2MX2 A;  4HVB A;  1WXV A;  1EO6 A;  2GBR A;  4II2 B;  4JQW C;  4W9E A;  4MM3 A;  2PJH A;  4KIK A;  4M8N A;  1P9D U;  3TIX A;  1E90 A;  2C7H A;  3CF6 E;  2Y5B B;  2O2V B;  1YX5 B;  3BY4 B;  1V81 A;  4GMV A;  4DHJ D;  1RFA A;  2RGF A;  2IYD B;  3PVL A;  4GB9 A;  3DOW A;  4WAA A;  4ZRI A;  4KZ0 A;  4B6W A;  1WYW B;  2DHZ A;  4ICV A;  3L54 A;  3PPA A;  3UQB A;  2BGF A;  3I3T B;  1XQQ A;  1P98 A;  2LJ5 A;  3VUW A;  2D07 B;  2ZCC A;  2ZVO A;  2UYZ B;  3WAN A;  4JL9 A;  3H9D A;  3ENE A;  4IUM B;  2LD9 A;  3U8Z A;  4B95 A;  3A4R A;  2KTR B;  3N32 A;  4RM8 A;  3QCA A;  2DAJ A;  2NCN A;  4WJO A;  1E8Y A;  1WGG A;  2BWE S;  2N7D A;  1WJ4 A;  4W9H A;  2LVP A;  4FHJ A;  3VTW A;  1NDD A;  1V5O A;  4EOY A;  1WX8 A;  1SIF A;  3LDZ E;  2CS4 A;  2FIF A;  2PE6 B;  4F1S A;  4W9D A;  1Q1O A;  4GN1 A;  4E3C A;  4A3P A;  1A5R A;  1FXT B;  4MSQ B;  2K1F A;  4EFO A;  5J18 A;  1YIW A;  1WMH A;  1OEY A;  3QC8 B;  2V3S A;  2KLG A;  3VXW A;  4TQ0 A;  2MP2 A;  1V2Y A;  3KW5 B;  1LM8 B;  3PRM B;  4I6N B;  2RR9 A;  1K8R B;  2IBI B;  2BKR B;  3IFW B;  4OVU A;  4YL8 A;  2KDF B;  3OJ3 A;  3IVF A;  4ZDV A;  3A9J A;  2KO3 A;  5CHV C;  2M4N A;  4FJZ A;  1WGH A;  3JSV B;  2L8J A;  2GBN A;  2FCQ A;  1V9J A;  4N9F 4;  3ZLZ A;  3L0W B;  4DHJ B;  1C3T A;  4FHK A;  5IAA C;  2CR5 A;  2JZZ A;  2IY0 B;  2KJH B;  2KXJ A;  1E7U A;  3L10 B;  4HLE A;  4BKG A;  2DZI A;  3V6E B;  2BF8 B;  3QX1 A;  4WWN A;  1V6E A;  2N7E A;  4EZJ A;  3D32 A;  1QZE A;  4KIK B;  1WRD B;  3SHQ A;  4AJW A;  2ZNV C;  4DHZ E;  1NBF C;  4PS3 A;  3QHT A;  2KKC A;  2KD0 A;  2YLM A;  4BKT A;  5AEK B;  5IA7 A;  3KYD D;  3W1S C;  3GOE A;  3WAL A;  1WH3 A;  3X23 A;  4W9F A;  4B9K A;  4EUT A;  2JF5 A;  5J17 A;  2ZCB A;  3IG3 A;  2BKF A;  3MTN B;  3VUX A;  1LXD A;  2LRU A;  4ZRK A;  5BO4 B;  2KVR A;  4GOC A;  1ZW7 A;  1ISN A;  3B08 A;  1GUA B;  2KN5 A;  2FID A;  3KUZ A;  4HDQ A;  3VH4 B;  2BYE A;  4MEL A;  3A9K A;  3M3J A;  2MW5 A;  4X57 B;  4W9G A;  3RD2 A;  2JUO A;  1WXS A;  4IM3 A;  4KV2 A;  2KNB A;  5DCN A;  2QHO A;  3RZW C;  2ZPY A;  1WM2 A;  1YX6 B;  2G4D B;  3EEC A;  3SD5 A;  3U7D A;  3ZNI D;  2DYM A;  4WWP A;  1VCB A;  1GNU A;  4WQO B;  4AUQ C;  3KH0 A;  3PRZ A;  2JPH A;  1P3Q U;  1NI2 A;  2K6D B;  2KOX A;  2D2Q A;  3EHV A;  5CHW A;  1H4R A;  1WMH B;  2JVC A;  4IG7 B;  4K7U A;  1E5W A;  4MGY E;  4AP4 C;  1J8C A;  2MP2 B;  3VH3 B;  4IWP A;  4LDT D;  4GDK A;  2JWZ A;  3A9J B;  1H8C A;  4AWJ A;  2L0F A;  4FUL A;  3WAM A;  2KFK A;  2JRH A;  1CMX B;  5LLI A;  3AU5 A;  3UIN B;  4PYU A;  4FJV B;  3VVW B;  2IO0 B;  5CTR C;  1WR1 A;  3IBE A;  2YVC A;  5AZH A;  3ZVV A;  4FAD A;  5E6N A;  1J0G A;  4F8C B;  3MHS D;  3M63 B;  4EKU A;  2LVQ A;  1GJZ A;  3HIZ A;  1GC7 A;  3O65 B;  4K1R B;  1L7Y A;  1G6J A;  3W1Y A;  2KJ6 A;  2K6Q A;  4NPN A;  1YQB A;  2L0T A;  2KZR A;  3L08 A;  4I6L B;  1MG8 A;  2XK5 A;  2KFJ A;  4W9I A;  3RCZ A;  3HM6 X;  2NR2 A;  1SE9 A;  4MDK E;  2WX1 A;  4OVV A;  1UEL A;  3R66 C;  4RMA A;  2N9P C;  3QAR A;  1IYF A;  2J0J A;  1WJU A;  5JZE B;  2REX A;  2M0X A;  4ANU A;  4DXA B;  2IO3 B;  1P1A A;  3NOB A;  3Q3J A;  1AAR A;  5E6O A;  4ANV A;  3A9K B;  4EZL A;  2O6V D;  1LQB A;  1R4M I;  4HJK A;  3DVG Y;  3KVF B;  4GIV A;  4GSW A;  2OOB B;  2BWF A;  4URK A;  2KK8 A;  1WGD A;  3ML9 A;  5D2M B;  3VQI A;  2CHX A;  2KAN A;  3AUL A;  4GXB A;  3RUI B;  2KQS A;  2C5L C;  4LDT B;  1WE7 A;  2EMT A;  1V5T A;  3PZD A;  5D6J B;  3UIO B;  4ANW A;  2AL3 A;  1EUV B;  1RLF A;  2MBO A;  2RPQ A;  3H7S A;  4E74 A;  4NJ6 A;  5JHA A;  2R2O A;  4DK5 A;  1Z2M A;  2J0M A;  3DDC B;  1I35 A;  3JW0 X;  3ZTD A;  2D11 A;  2I1K A;  1PQS A;  2AEH A;  1TTN A;  4IM2 A;  4P7I A;  5C23 A;  2JT4 B;  2DYB A;  1L2N A;  3KYC D;  4GDK B;  2LGY A;  2WYQ A;  2GMI C;  4IWQ A;  1Z5S B;  4DHZ B;  4AOF A;  1S3S G;  2ZZP B;  3VAW A;  2EKE C;  2FCS A;  2AL6 A;  4FA6 A;  2KFK B;  2KMC A;  4WJQ A;  4HK2 A;  5LXH A;  2CU1 A;  5FR6 A;  1E8Z A;  3ZKJ C;  3EFU A;  2KLC A;  1OTR B;  4EEW A;  2JZ3 B;  2NPT A;  2DX5 B;  4DBG A;  3APD A;  2OJR A;  2KHW B;  1WY8 A;  2D3G A;  3TJP A;  1Q0W B;  4ASW C;  4HCN B;  3RT3 B;  1VD2 A;  1E8W A;  2Z0D B;  3PSE B;  3ZUN A;  2BYF A;  2PPH A;  3BIN A;  5C1Z A;  1YD8 U;  2C60 A;  3QAQ A;  2MSE D;  4G3X B;  2WWZ A;  2DYO A;  3CMM B;  3EC8 A;  3DBL I;  1TGZ B;  2JRI B;  4HWI B;  4MJS A;  1F9J A;  2XK5 B;  3R7R A;  3T9L A;  2PEA A;  4W9C A;  3VHT C;  4W9L A;  2ZPN A;  2GOW A;  1LFD A;  4HCP B;  4GGQ A;  3V60 A;  4E71 A;  2K39 A;  3N30 A;  2K25 A;  2L05 A;  4PS7 A;  2J0K A;  4K7W A;  2G3Q B;  2XEW A;  2A4Z A;  4M8M A;  3VFK A;  2FNJ B;  4BFR A;  5TR5 A;  1XT9 B;  5JH5 C;  3K9P B;  2KX3 A;  3IHP C;  2R2Q A;  2LUE A;  2CKH B;  3NZS A;  4I6P A;  3TMP B;  1YJ1 A;  4NY0 A;  3APF A;  4JGH B;  4JLC A;  2KX0 A;  5L95 C;  3APC A;  3WA0 A;  3DVG X;  2Z0E B;  3V61 A;  3LJ3 A;  4NQK E;  4NNJ B;  3V6C B;  2DZK A;  3ZRF A;  2DEN B;  3DVN V;  4KDI C;  1UH6 A;  3ZIM A;  2DZJ A;  1R4N I;  4HDO A;  4MSM B;  4MH0 E;  5DPW A;  3H6N A;  5DPR A;  2FAZ A;  3DBS A;  4BOS C;  3VDZ A;  2MBQ A;  1KOT A;  3ZDM C;  2NBV B;  5J2R A;  1OEY J; 
#chains in the Genus database with same CATH topology
 1Y8R C;  1SIJ A;  4US8 A;  3WAO A;  2W3S A;  4IM0 A;  4WJN A;  4N6E B;  1L0X B;  4M0W B;  1MHX A;  2XBB C;  3ZGZ A;  1PFD A;  3Q3M C;  4ZYN A;  1M94 A;  3BZD B;  3PGE A;  3QWZ B;  1GG3 A;  1T0Y A;  1TZO A;  3N3K B;  1AW7 A;  1JRO A;  3PRE A;  4YSX B;  3JYU A;  1PGB A;  3K9O B;  3RNE C;  3UGB B;  3VR8 B;  2IO1 B;  4P6V F;  1GB1 A;  2K8C A;  1WR6 E;  1N60 A;  1VZ8 A;  2E3T A;  3ZW3 A;  4WJP A;  2WXG A;  1FPY A;  3H7P A;  3UF8 A;  4WWM A;  2IO2 B;  4HKQ A;  4NAW A;  3OJ4 B;  1WGY A;  4G50 A;  4YTN B;  4A9A A;  2N7J A;  2N9E B;  3S2A A;  1V86 A;  1ZGU B;  5G55 A;  3ZQ4 A;  3NZU A;  2NVU I;  1XXG A;  2MA9 B;  3HVD A;  3LB8 C;  1B9R A;  3DHH C;  4K3B A;  4DXF A;  2G1E A;  5E6P A;  4YSY B;  1V97 A;  2XN9 C;  1MG4 A;  4MGZ E;  2GBK A;  2ZEQ A;  3P2B A;  3PTF C;  3OLM D;  4B0M A;  1XD3 B;  4LJO B;  1WM3 A;  2M56 B;  1MHH E;  1L0V B;  1T0Q C;  4A90 A;  4N58 A;  3U30 A;  4DXG A;  2JZP A;  4RGT A;  2SAK A;  4HRO A;  5EE1 A;  1I4H A;  4LNO A;  3PLV A;  1FNV A;  4KX6 B;  4BOZ B;  2K8B A;  3NVV A;  2KC2 A;  4PK1 A;  5HKH A;  4HJG E;  2WXN A;  4KKI A;  2W9N A;  1YOV B;  3TEZ A;  2PIA A;  4IKG A;  3A4S C;  2DLB A;  3GB1 A;  3H7P B;  2LI5 A;  1UGM A;  3B0A A;  2PKO A;  4NAW B;  2AYO B;  2D3A A;  3NHE B;  1EF1 A;  3AEE B;  1FRR A;  2V1Y A;  2VRR B;  2Z59 B;  1WGR A;  3P63 A;  4HPL B;  2JSV X;  3P42 A;  2EEL A;  1ZXI A;  3V3X A;  5IP4 D;  2GBJ A;  2J4X A;  4ICU A;  3NVW A;  4M01 A;  1KH0 A;  5GMV A;  1QLB B;  2M8S A;  3V62 A;  4CYE A;  2BQQ A;  2KTF A;  1J19 A;  2IY1 B;  4C00 A;  1V1O A;  2WX0 A;  1WJ6 A;  1UD7 A;  1IP9 A;  1GAQ B;  2QC8 A;  3X0W A;  1KJT A;  4HVB A;  1Q10 A;  1EO6 A;  4KIK A;  4M8N A;  3TIX A;  1E90 A;  3AE5 B;  2Y5B B;  1LO5 D;  1R7S A;  1V81 A;  4GMV A;  3DHG C;  3DOW A;  4ZRI A;  3BK2 A;  2MEK A;  1P98 A;  2BS3 B;  1YN3 A;  1NVI D;  2D07 B;  2BB5 A;  2ZVO A;  2UYZ B;  5T8I A;  3AE2 B;  3U8Z A;  1CJE A;  3N32 A;  2NCN A;  2N7D A;  2LVP A;  2CJN A;  4EOY A;  1SIF A;  2PE6 B;  4JX1 C;  4GN1 A;  4MH8 A;  2K1F A;  1QF6 A;  1JWM D;  1WMH A;  2WNM A;  1TT5 B;  3Q8A A;  2KLG A;  3VXW A;  4H2A A;  3W9C B;  4OVU A;  3PRM B;  1K8R B;  2IBI B;  3IFW B;  4AQ7 A;  2INC C;  4FJZ A;  1QT9 A;  3L0W B;  4FHK A;  2JYE A;  1E7U A;  3L10 B;  3MHZ A;  2BF8 B;  5AUI A;  4NZL B;  2N7E A;  1QZE A;  4KIK B;  2KKC A;  1ZOY B;  3GOE A;  2OHF A;  3KQ4 A;  4EUT A;  2J52 A;  3IG3 A;  2PMV A;  2BKF A;  3VUX A;  4RCO A;  1ISN A;  3RNB C;  2FID A;  3A9K A;  3N1X C;  2JUO A;  2IGG A;  1WRI A;  3SD5 A;  3ZNI D;  3I5J C;  1VCB A;  3KH0 A;  2VZK D;  1SSN A;  1WMH B;  4MGY E;  1JW9 D;  3Q14 C;  1D4B A;  1WGK A;  1C9F A;  2WXK A;  1CMX B;  3AU5 A;  4FJV B;  5CTR C;  2INN E;  3IBE A;  2YVC A;  2K0P A;  5AZH A;  3MHS D;  2N9L A;  3M63 B;  1N63 A;  1GC7 A;  1G6J A;  4USA A;  2JQR B;  1T5X D;  2K6Q A;  1YQB A;  1B1Z A;  2WU5 B;  2PW9 A;  4W9I A;  3RCZ A;  3HM6 X;  2NR2 A;  3L4P A;  4OVV A;  1I4P A;  1WWT A;  2J0J A;  5JZE B;  2BS4 B;  5E6J A;  2M0X A;  4D2K A;  1P1A A;  1IGD A;  2VZK B;  3A9K B;  4LTU A;  4IOI E;  1V8C A;  4HJK A;  3DVG Y;  3NUH B;  5IN7 A;  3EFC A;  2MJE A;  5D2M B;  5FKA C;  3W5U B;  2WXR A;  2KAN A;  1BUI C;  1V5T A;  2MBO A;  3H7S A;  5JHA A;  2R2O A;  2L83 A;  1I35 A;  4JWS C;  1KLU D;  3VRB B;  2D11 A;  1PQS A;  5C23 A;  1TTN A;  3HUI A;  2JT4 B;  3RPF C;  1L2N A;  2LGY A;  1Z5S B;  3AB5 A;  1QOF A;  5LXH A;  4WQM A;  2CU1 A;  3ZKJ C;  2KLC A;  4EEW A;  2NPT A;  2DX5 B;  3U52 E;  2OJR A;  1RYJ A;  1VD2 A;  2MJ3 A;  1YD8 U;  4RH6 A;  4G3X B;  2DYO A;  1HZ5 A;  3EC8 A;  3BVZ A;  3C8Y A;  2JRI B;  4MJS A;  3R7R A;  3T9L A;  2PEA A;  2NMQ A;  2Y3A A;  2GOW A;  3AM9 A;  3BVG A;  3N30 A;  2J0K A;  3N9Y C;  2QIL A;  1ESF A;  2RDB C;  1XLP A;  1ZPS A;  2LUE A;  3NZS A;  2D3C A;  3DWG C;  3APC A;  3V61 A;  3LJ3 A;  4NQK E;  2WP9 B;  1TS2 A;  2DEN B;  3PO0 A;  4KDI C;  2WXP A;  3ZIM A;  1SJH D;  5DPW A;  5DPR A;  1SB3 C;  3DBS A;  4BOS C;  1OFF A;  2MBQ A;  2W82 A;  3ZDM C;  1YN5 A;  3P4Q B;  3R2T A;  5EE0 A;  2WLB A;  4KDL B;  4YXD B;  1K52 A;  2NPT B;  2UWQ A;  3ZXV A;  5D94 A;  3U7Z A;  4TV3 A;  4CHK A;  1WZ0 A;  1T0S C;  1YMH E;  4MJS B;  2L7R A;  1XCT L;  5CHF A;  1VDV A;  4TUU A;  3GE8 C;  3H1U A;  3AE4 B;  3MJ5 A;  4XC2 A;  2HE7 A;  2W3R A;  4ACF A;  4FJY A;  3Q3O C;  1FO4 A;  4BVU C;  1WIA A;  4Q2J A;  3R8B A;  3Q3F A;  2K8H A;  1EU4 A;  1R4M B;  2JXX A;  3ZTC A;  1SXT A;  3AN1 A;  2ZJD A;  2LGD A;  3VR9 B;  4C80 A;  2D10 A;  2RD0 A;  3M62 B;  2KC1 A;  5KHO A;  1F1H A;  4MGK E;  2N0S B;  3NG0 A;  3R2I A;  4A55 A;  4IWO A;  5L83 A;  4NQL B;  2G4S A;  2WXH A;  2LXC A;  2WS3 B;  3DBR I;  3WAP A;  4KZC A;  2B3A A;  2KT7 A;  2ZNV B;  3KUD B;  4XX5 A;  1EF5 A;  4WH4 A;  3Q6B A;  4HKZ E;  2LWP A;  5DPT A;  3ZNG C;  2KDE B;  4M02 A;  1ZE3 D;  1OQY A;  4C56 C;  2LXA A;  2NBW B;  3NVY A;  4S17 A;  2E6X A;  3KLS X;  4AJY B;  4BBN F;  3IXS A;  1JQ4 A;  3T8M A;  3AEB B;  4YT0 B;  1D5Z C;  1WYG A;  2IZV B;  2MH7 A;  2DZM A;  3ECI A;  3KUC B;  1GPX A;  1J7C A;  1WF9 A;  3IAS 1;  3RUL A;  3QJZ A;  4KSK C;  2KJR A;  1HEZ E;  5G2N A;  1D3Z A;  1RAX A;  3SR6 A;  1NEK B;  3OAW A;  4YSZ B;  2MBH A;  2IGD A;  2MCN B;  1ZUD 2;  2B76 B;  4RGM A;  1XLN A;  2LEK A;  3ZNZ B;  1FFU A;  4REZ A;  1OGW A;  4KGT A;  4RF0 A;  1YQ3 B;  2KWC A;  2QSD A;  1SEB D;  5KHQ A;  1HQR D;  4MEM A;  1UF0 A;  2D3B A;  1SGH A;  2V4L A;  1GC6 A;  3AU4 A;  4EZK A;  1E7V A;  1WE6 A;  2LZ6 A;  3JSV A;  1Q5W B;  3RYT A;  5AUK A;  3L17 A;  1FXI A;  4PS8 A;  3ZDT A;  4TMA B;  4RGO S;  4W9J A;  1TZ1 A;  2LHD A;  2MX2 A;  3I57 A;  4US9 A;  1WXV A;  1JML A;  4MM3 A;  3ZJT A;  3DHI C;  3GS2 A;  4KKJ A;  2IDY A;  1KTK A;  1RFA A;  2RGF A;  3PVL A;  4OHJ A;  4O1N A;  2DHZ A;  3P4P B;  1YQ4 B;  4ICV A;  3PPA A;  1XQQ A;  2IND C;  2ZCC A;  3AE8 B;  1UWX A;  3WAN A;  4IUM B;  2LD9 A;  1F52 A;  1I4R A;  2BT6 A;  4RM8 A;  3QCA A;  2BWE S;  1WGG A;  4W9H A;  1WJ4 A;  4RFB A;  4YWG G;  3LDZ E;  5HHD G;  2FIF A;  4W9D A;  1A5R A;  4MSQ B;  1YN4 A;  4EFO A;  2KQ4 X;  3QC8 B;  2V3S A;  2L32 A;  4RGN A;  2MP2 A;  3KW5 B;  1LM8 B;  1I42 A;  3FIL A;  2KDF B;  4ZDV A;  3Q69 A;  3A9J A;  1NYQ A;  1MJD A;  2KO3 A;  4XDC A;  2PVO D;  3JSV B;  1XEE A;  4IDI A;  4ARC A;  4RNA A;  4BKG A;  4EE2 A;  4WWN A;  3MC0 B;  4MM3 B;  4L1B A;  3D32 A;  1WRD B;  4DHZ E;  2WGS A;  3QHT A;  2KD0 A;  2YLM A;  3B9J A;  1WH3 A;  3X23 A;  4B9K A;  1MVK A;  2JYT A;  5J17 A;  5G5H A;  1LXD A;  3B08 A;  4ZRQ A;  1SJE D;  2KN5 A;  4W9G A;  2AQ1 B;  3RZW C;  2KNB A;  5DCN A;  2QHO A;  4A8X C;  2G4D B;  2DYM A;  4WWP A;  2AQ3 B;  1P3Q U;  2KOX A;  2D2Q A;  3EHV A;  2JVC A;  1C4A A;  4K7U A;  4MAC A;  4AP4 C;  3PZ8 A;  2MP2 B;  2ACZ B;  3VH3 B;  1OQR A;  3OG5 A;  3FIL B;  4GDK A;  4LK0 M;  3A9J B;  1TS5 A;  3MC8 A;  5C3J B;  4ZYS A;  2JRH A;  1JAL A;  1P7E A;  3EA6 A;  1WR1 A;  2WQY B;  4F8C B;  2LVQ A;  3HIZ A;  3Q8F A;  2KJ6 A;  1MPE A;  1SF0 A;  4NPN A;  3L08 A;  4I6L B;  2XK5 A;  5TSS A;  5JHB A;  2WX1 A;  5EE3 A;  2N9P C;  3QAR A;  1WJU A;  2HDE A;  2REX A;  3LXF A;  4C7Y A;  1NEN B;  1AN8 A;  3NOB A;  3Q3J A;  1AAR A;  2O6V D;  2HJ1 A;  4GLS C;  3MC9 A;  4WIP A;  2BWF A;  4URK A;  2KK8 A;  1OQQ A;  4BZA A;  3P4R B;  2X8X X;  1WE7 A;  3I63 C;  3UIO B;  4ANW A;  2AL3 A;  1TKY A;  4WUR A;  1RLF A;  4E74 A;  1Z2M A;  3ZTD A;  2ZW1 A;  2I1K A;  4GDK B;  2WYQ A;  2R61 A;  1TKG A;  2ZZP B;  2XNA C;  2AL6 A;  4FA6 A;  1N61 A;  3EFU A;  4ASW C;  2PTL A;  2ONQ A;  2BYF A;  1Y56 A;  1L0Y B;  4HWI B;  1F9J A;  2LGS A;  2XK5 B;  3KWV A;  2GI9 A;  3VHT C;  3MFG A;  3DBH B;  4GGQ A;  2K39 A;  3BK1 A;  2K25 A;  2KYW A;  4N59 A;  3VFK A;  4M8M A;  3RNC C;  4ZRP A;  4BFR A;  1RM6 C;  1AWD A;  5JH5 C;  3IHP C;  2R2Q A;  4A6Q A;  2CKH B;  3TMP B;  1YJ1 A;  3I9V 1;  4JGH B;  1FCC C;  3ABV B;  3WA0 A;  3B2F A;  4K3C A;  1K50 A;  1TIF A;  3AEA B;  2DZJ A;  4MH0 E;  1L4Z B;  3BYT B;  3NZ3 A;  3HHM A;  1ZP0 B;  5J2R A;  3QA8 A;  4XYC A;  1FNU A;  4DDG D;  1HE8 A;  5I4D A;  4JIO U;  1S1Q B;  3QQ8 B;  3DPD A;  1C1Y B;  3RN9 C;  4FN2 A;  2V0G A;  1PGA A;  2LMC A;  3DVN U;  2J7Q B;  2M17 A;  1K53 A;  3NS8 A;  2Y5C A;  3AMZ A;  1HTO A;  3ML8 A;  2WXF A;  3W1S A;  3Q8C A;  2JWU A;  2KDI A;  4ZRJ A;  4HPM B;  1V49 A;  4XE0 A;  3SU8 X;  3FC4 A;  3TBL D;  2WXL A;  4LLG M;  1VRA B;  4TKN A;  3C0R B;  3CWI A;  2OJW A;  3KWL A;  4FXC A;  3VTU A;  2N9X A;  4NJC A;  2C9W B;  5HFY A;  4K81 A;  1ZKH A;  4ZHO A;  3M95 A;  1FD6 A;  2WXO A;  2NTS A;  3DWM A;  1F77 A;  3R7Q A;  4ZHP A;  2MLB A;  1SE3 A;  3V05 A;  4FBJ B;  1TS4 A;  4P1B C;  4A20 A;  1WJN A;  2IJ0 A;  1GOZ A;  3JVZ X;  1T6B X;  1UBI A;  1IPG A;  3AI5 A;  3AV8 A;  2M0A A;  4P1C C;  4BKS A;  1F2R I;  2FCM A;  3ETR A;  2MRP A;  4PYZ A;  2PE9 A;  3A33 B;  4GDL A;  1E0Z A;  1E7P B;  2ZVN A;  2LJI A;  2I1J A;  4BKS D;  1UBQ A;  1T3Q A;  3VUY A;  2N1W A;  3PRP B;  2KQ7 A;  1JWA D;  2KWV B;  1JWS D;  4OZC A;  3GE3 C;  3ZXR A;  3DBH I;  2DAF A;  1FFV A;  3RZF A;  3B1L X;  4W9K A;  3DQV A;  3ZJV A;  1I7H A;  1DOY A;  1VJK A;  2K3U A;  2CHZ A;  1ZXH A;  2L00 B;  4J6I A;  3EUB 2;  3O13 A;  1JRU A;  3CSF A;  3IT6 B;  3BVM A;  5AZF A;  1IBX A;  2KTR A;  3RNG C;  1ENF A;  3ONS A;  1E8X A;  4JWU C;  1BT0 A;  4G11 A;  4F7Z A;  2A5U A;  4RM9 A;  4LNN A;  1C79 A;  2HD5 B;  4WWO A;  1WX9 A;  1U4A A;  1ET6 A;  1CK1 A;  3U2S C;  2BPS A;  4DDI D;  4BBN C;  2RSU A;  4LNI A;  4GDL B;  2JY6 A;  4BAX A;  4FLH A;  3PLU A;  2MBE A;  3AE6 B;  1MI0 A;  3PV1 A;  4LCD E;  3CIR B;  1C77 A;  1WFY A;  2PVG C;  2G45 B;  4GU2 A;  2GBR A;  5BYQ A;  1MFW A;  2VH2 A;  2AQ2 B;  3BY4 B;  4DHJ D;  3AED B;  4KZ0 A;  1WYW B;  1TJE A;  2GLS A;  4OVZ A;  3L54 A;  3UQB A;  2BGF A;  3RI7 C;  4L2Y A;  3VUW A;  2G9H D;  3ENE A;  1IBX B;  4B95 A;  2KTR B;  2MHJ A;  3BII D;  1GB4 A;  1M4V A;  4FHJ A;  1NDD A;  1V5O A;  2BW2 A;  4F1S A;  2K5P A;  3SEB A;  4A3P A;  4E3C A;  1FXT B;  2QEJ C;  1OEY A;  1V2Y A;  5AEK B;  1UGJ A;  2RR9 A;  3IVF A;  3Q3N C;  5IKC M;  4OZB A;  2WXQ A;  2M4N A;  3DBL B;  2GBN A;  2L8J A;  2FCQ A;  1V9J A;  4P16 A;  4DHJ B;  5IAA C;  2KXJ A;  3TEX A;  1QKZ A;  4HLE A;  2BVC A;  2DZI A;  1D6E C;  3QX1 A;  1N6Z A;  4AJW A;  1QOG A;  2ZNV C;  1EWC A;  4BKT A;  5IA7 A;  3KYD D;  2KN4 A;  1DOI A;  2WXJ A;  4W9F A;  5BYS A;  2JF5 A;  2ZCB A;  2LRU A;  4ZRK A;  3W2D A;  5BO4 B;  1J7B A;  4GOC A;  1ZW7 A;  1VZ7 A;  3UI3 A;  1GUA B;  3W5V B;  1PGX A;  3KUZ A;  4HDQ A;  3VH4 B;  2BYE A;  3M3J A;  2MW5 A;  1WXS A;  4IM3 A;  2ZPY A;  1YX6 B;  4B0E A;  1IUE A;  4WQO B;  3ZJU A;  1P7F A;  2W54 A;  3PRZ A;  1DYQ A;  5CHW A;  1H4R A;  2FBW B;  1L5P A;  1J8C A;  4IWP A;  4DQO C;  1C4P A;  2CJO A;  1H8C A;  4AWJ A;  2L0F A;  4FUL A;  2KFK A;  5HI1 A;  3RNF C;  3GZN B;  3VVW B;  3ZVV A;  3LYY A;  1J0G A;  2QDF A;  3O65 B;  4K1R B;  4YTM B;  3T3O A;  1VZ6 A;  3U4E G;  1MG8 A;  1YJJ A;  1FEH A;  5H92 C;  2V3P A;  4MDK E;  1SE9 A;  2WDV B;  1UEL A;  3R66 C;  4M00 A;  1FM0 D;  5GXG B;  4ANU A;  2H88 B;  2KAC A;  3AE9 B;  2IO3 B;  5E6O A;  4ANV A;  1JWU D;  2JU6 X;  4EZL A;  2ICI A;  1R4M I;  4ITK A;  4GSW A;  5G5G A;  3ML9 A;  3VQI A;  2CHX A;  3RUI B;  4GXB A;  1EU3 A;  4YTP B;  2KQS A;  5D6J B;  3PZD A;  1C4C A;  1XLO A;  1EUV B;  1SBB B;  2J53 A;  4NJ6 A;  4DK5 A;  2DNF A;  2J0M A;  1N62 A;  3T3N A;  2KWD A;  4P7I A;  1I4G A;  2GMI C;  4IWQ A;  4DHZ B;  4AOF A;  1S3S G;  3VAW A;  5LNK 1;  2EKE C;  2FCS A;  2KFK B;  4WJQ A;  5FR6 A;  2J42 A;  1OTR B;  4DBG A;  3APD A;  4J3O D;  2KHW B;  1WY8 A;  3TJP A;  1J7A A;  1FCL A;  3SFE B;  2PPH A;  4MT5 A;  3BIN A;  4R3D A;  2C60 A;  2MSE D;  5BYR A;  3CMM B;  3H8H A;  3DBL I;  5BMG A;  3Q8B A;  3AH7 A;  1N5X A;  1KF6 B;  4W9C A;  1ROE A;  4W9L A;  1LFD A;  3V60 A;  4E71 A;  1JRP A;  2L05 A;  3ZYY X;  1L4D B;  2G3Q B;  4XGA B;  2V9H A;  1XT9 B;  2KX3 A;  4I6P A;  2LGI A;  3MP9 A;  3APF A;  4JLC A;  2KX0 A;  5L95 C;  3DVG X;  3V6C B;  2DZK A;  2FE8 A;  2FAZ A;  2Y5P A;  3AEF B;  3VDZ A;  2SEB D;  1KOT A;  4RF1 A;  2DBY A;  3PZ7 A;  3WIM A;  1OEY J;  2KAJ A;  1KM7 A;  4A3O A;  4G0N B;  3VTV A;  4TQ1 A;  1L6V A;  1UZX B;  2EMS A;  3ZNH B;  3SDL C;  4TSS A;  2W55 A;  4HXD A;  2NBU A;  3FKY A;  4XDD A;  2BBC A;  4OW0 A;  4DWF A;  3L16 A;  2INP E;  2H89 B;  3A1Q A;  1TS3 A;  2LUM A;  2Q5W D;  2NS5 A;  4S0R A;  3NY5 A;  5EDS A;  5LXI B;  1XF5 L;  4IC7 B;  1WX7 A;  3GZN I;  2O6V A;  1D5X C;  3Q2A C;  5CX3 A;  2AWT A;  2LAS A;  2QJL A;  3UQA A;  1WXQ A;  2WHI A;  1RRB A;  1WI0 A;  2KVZ A;  1BML C;  4ZOH C;  1HTQ A;  2FCN A;  3AEG B;  4HRS A;  2KMA A;  3TCA A;  2LHE A;  1EWY C;  4KGS A;  4KVG B;  1BXT A;  1V80 A;  2FUG 1;  3DCG A;  4L23 A;  1DGJ A;  4ANX A;  1FMA D;  3TEW A;  2L1A A;  1WXM A;  3QK0 A;  3PT2 B;  1P0R A;  2M1M A;  1FIQ A;  4LNF A;  2K9X A;  5DPS A;  1QQR A;  1NI3 A;  5MPO A;  4WAF A;  1D5M C;  5AZG A;  4OZA A;  3MJW A;  4IW0 A;  4HEA 1;  2LVO A;  5D7G A;  3E56 A;  1SE2 A;  1FRD A;  4LJP B;  1XCQ L;  3NS1 A;  4K7S A;  1WXA A;  3URY A;  1JWB D;  2N4F A;  4QAY A;  2WDT B;  2HTH A;  2TSS A;  2ZW0 A;  2CHW A;  2C7M B;  3NRZ A;  2KDB A;  3UIP B;  1UUP A;  1KRH A;  2EKI A;  3L13 A;  3PHW B;  3A1Q B;  3TSS A;  2D5G A;  3PHX B;  4CO7 A;  2RDH A;  4XZ4 A;  2N1V A;  2C7N B;  1KLV A;  2O6V B;  1F2R C;  2L76 A;  3HVZ A;  1UNS A;  3TL5 A;  1X1M A;  4NJ7 A;  4NAM A;  3FAH A;  2HTM E;  1PUT A;  3AE1 B;  3GP7 A;  2LRW A;  1A70 A;  1STE A;  1CQV A;  2WXM A;  2HJ8 A;  3N1Z C;  2MQJ A;  3P1M A;  2O2V A;  4KSL C;  2RMM A;  2ASQ A;  1WZ3 A;  3ZO5 B;  2BYT A;  4XWT A;  2LGX A;  4ARI A;  2MBB B;  5IO9 A;  4KGR A;  5EE9 A;  4II3 B;  1FXA A;  2GBM A;  3NVZ A;  3ZRC A;  1IGC A;  5HG2 A;  3NJT A;  2BYV E;  3CST A;  2QIE B;  3HK0 A;  1YJI A;  3R3M A;  2ON8 A;  1DOX A;  2L3Z A;  1PDX A;  1TY0 A;  3AXC A;  3QIJ A;  2FUH B;  2WDR B;  3ALB A;  4MGI E;  2KWU B;  2MWS B;  1KLG D;  1TBE A;  3HM3 A;  1PYW D;  2N9K A;  2V4I B;  3PS6 A;  2UU7 A;  1V1P A;  5FK9 C;  4C7Z A;  4II2 B;  4JQW C;  1JCK B;  4W9E A;  4LNK A;  2PJH A;  3B2G A;  1P9D U;  2C7H A;  3CF6 E;  2O2V B;  2JX5 A;  1YX5 B;  1C78 A;  2IYD B;  4GB9 A;  1ZDX A;  4WAA A;  4B6W A;  3Q8E A;  3I3T B;  5C2T B;  1HA5 A;  3N20 C;  2LJ5 A;  3AEC B;  2VH1 A;  4JL9 A;  3H9D A;  3E9S A;  3TUO A;  3A4R A;  3SFD B;  2WU2 B;  2DAJ A;  4WJO A;  1E8Y A;  2M19 A;  3VTW A;  1WX8 A;  1YNT E;  4AS1 A;  2CS4 A;  1Q1O A;  2X38 A;  5IOI A;  5J18 A;  1TY2 A;  1YIW A;  1SE4 A;  4TQ0 A;  4C4V A;  1ZDV A;  3DBR B;  4I6N B;  4YL8 A;  2BKR B;  3OJ3 A;  5BMI A;  1VR9 A;  5CHV C;  1NYR A;  1L6U A;  1WGH A;  1VLB A;  4CQN A;  4N9F 4;  3ZLZ A;  2YEP B;  1C3T A;  1K51 A;  2CR5 A;  1RWS A;  2IY0 B;  2JZZ A;  2KJH B;  1V1P B;  3V6E B;  1V6E A;  4HPP A;  1AYF A;  4EZJ A;  3SHQ A;  1NBF C;  1XO3 A;  4PS3 A;  2WDQ B;  3W1S C;  3WAL A;  1ET9 A;  3MTN B;  2CU3 A;  4PT5 A;  5FR3 A;  2KVR A;  5D3D A;  1ACC A;  4MEL A;  4X57 B;  1R4N B;  3RD2 A;  4KV2 A;  1WM2 A;  2K22 A;  3EEC A;  3U7D A;  1I4Q A;  1GNU A;  3BWU D;  4AUQ C;  2AX5 A;  1HZ6 A;  2JPH A;  1NI2 A;  2K6D B;  2I2Y A;  2QMT A;  4IG7 B;  1E5W A;  4C4V B;  5JXV A;  4LDT D;  3HRD D;  2JWZ A;  3WCQ A;  3N1Y C;  3WAM A;  1XLQ A;  3UIN B;  5LLI A;  4PYU A;  1T0R C;  2IO0 B;  3RFZ B;  4XWW A;  1E9M A;  4FAD A;  4JE3 B;  2OED A;  5E6N A;  5H8Y E;  1E6E B;  4EKU A;  1GJZ A;  1L7Y A;  2RDG A;  3W1Y A;  2L0T A;  2KZR A;  3RMK C;  2GRI A;  2KFJ A;  1I4X A;  1EM7 A;  4RMA A;  1IYF A;  2QCZ A;  4JPS A;  4DXA B;  3AE7 B;  1QIL A;  1LQB A;  3KVF B;  4GIV A;  2L52 A;  2OOB B;  2MJD A;  1WGD A;  2YEP F;  3AUL A;  2KDM A;  2C5L C;  2I38 A;  2EMT A;  4LDT B;  2PLP A;  2RPV A;  5D3I B;  2BTE A;  2RPQ A;  5BMH A;  2KMM A;  3DDC B;  1C76 A;  3JW0 X;  2V3N A;  2AEH A;  4IM2 A;  2DYB A;  3KYC D;  3AE3 B;  3IT4 B;  3P4S B;  1E10 A;  2KMC A;  1TYG B;  4HK2 A;  1E8Z A;  2JZ3 B;  1LGR A;  2D3G A;  1Q0W B;  4HCN B;  3RT3 B;  1QOA A;  1E8W A;  2Z0D B;  3PSE B;  4M0W A;  3ZUN A;  5C1Z A;  3QAQ A;  1RFK A;  3VRA B;  3C19 A;  2WWZ A;  1QOB A;  1TGZ B;  1WSP A;  1FNW A;  3EGR A;  2ZPN A;  4HCP B;  2JXT A;  4PS7 A;  4K7W A;  2NTT A;  2XEW A;  2A4Z A;  2FNJ B;  2Z8L A;  2BB6 A;  5TR5 A;  3J9C A;  3OWE B;  1CZP A;  4UDU C;  3RNA C;  3K9P B;  3BYY B;  2GB1 A;  4NY0 A;  2Z0E B;  2IPK D;  4NNJ B;  2LFI A;  2IGH A;  3ZRF A;  3TEY A;  3DVN V;  2BS2 B;  1UH6 A;  1R4N I;  4HDO A;  4MSM B;  2WXI A;  3H6N A;  1UWM A;  1TKE A;  1F0Z A;  1HXY D;  1N5W A;  1KFY B;  3IAM 1;  2NBV B;  2DWQ A; 
#chains in the Genus database with same CATH homology
 3QA8 A;  1KM7 A;  1Y8R C;  4A3O A;  4G0N B;  3VTV A;  4TQ1 A;  3WAO A;  4DDG D;  1HE8 A;  4JIO U;  1S1Q B;  3QQ8 B;  3DPD A;  1C1Y B;  1UZX B;  2EMS A;  4KDL B;  3SDL C;  4FN2 A;  4IM0 A;  2NPT B;  3ZNH B;  4WJN A;  2UWQ A;  3DVN U;  4HXD A;  5D94 A;  2NBU A;  4TV3 A;  2J7Q B;  2M17 A;  4M0W B;  4CHK A;  3NS8 A;  2XBB C;  3ML8 A;  4DWF A;  3L16 A;  3A1Q A;  1M94 A;  3PGE A;  4ZYN A;  1WZ0 A;  3QWZ B;  2NS5 A;  1GG3 A;  1T0Y A;  3NY5 A;  5EDS A;  5LXI B;  3HHM A;  4MJS B;  2KDI A;  3N3K B;  4IC7 B;  1WX7 A;  2L7R A;  3GZN I;  2O6V A;  5CHF A;  4ZRJ A;  4HPM B;  5CX3 A;  4TUU A;  2AWT A;  2LAS A;  1V49 A;  3PRE A;  3UQA A;  3SU8 X;  3W1S A;  3H1U A;  3TBL D;  3JYU A;  1RRB A;  4XC2 A;  1WI0 A;  3K9O B;  3UGB B;  2HE7 A;  2IO1 B;  4FJY A;  2K8C A;  2FCN A;  1WR6 E;  4BVU C;  1WIA A;  4TKN A;  2KMA A;  3C0R B;  3TCA A;  3Q3F A;  4KVG B;  3VTU A;  1V80 A;  2K8H A;  3ZW3 A;  4WJP A;  3DCG A;  2N9X A;  2JXX A;  3ZTC A;  2C9W B;  4ANX A;  3H7P A;  3UF8 A;  1WXM A;  2IO2 B;  3QK0 A;  3PT2 B;  4K81 A;  4NAW A;  1P0R A;  2M1M A;  2ZJD A;  3OJ4 B;  1WGY A;  1ZKH A;  4G50 A;  2LGD A;  2D10 A;  2N9E B;  2RD0 A;  3M62 B;  3M95 A;  3S2A A;  2KC1 A;  5KHO A;  5DPS A;  1V86 A;  1ZGU B;  5G55 A;  5AZG A;  3NZU A;  2NVU I;  3MJW A;  4IW0 A;  2MA9 B;  4MGK E;  2LVO A;  5D7G A;  3R7Q A;  2MLB A;  4LJP B;  4K7S A;  1WXA A;  5E6P A;  4FBJ B;  2N4F A;  4IWO A;  4A20 A;  4MGZ E;  5L83 A;  2GBK A;  2ZEQ A;  3P2B A;  1WJN A;  3PTF C;  2WDT B;  3OLM D;  2HTH A;  4NQL B;  5JHB A;  2G4S A;  2CHW A;  1XD3 B;  3JVZ X;  2C7M B;  2LXC A;  4LJO B;  1UBI A;  2KDB A;  1IPG A;  3AI5 A;  1WM3 A;  3UIP B;  3DBR I;  3WAP A;  3L13 A;  2B3A A;  2FCM A;  4KZC A;  4BKS A;  2ZNV B;  3PHW B;  3A1Q B;  3KUD B;  4XX5 A;  1EF5 A;  3U30 A;  2MRP A;  4CO7 A;  3PHX B;  1KLV A;  4XZ4 A;  2N1V A;  2C7N B;  2PE9 A;  2LWP A;  4PYZ A;  2O6V B;  3A33 B;  5DPT A;  3ZNG C;  2L76 A;  2KDE B;  4GDL A;  3TL5 A;  1X1M A;  4NJ7 A;  2ZVN A;  3PLV A;  1OQY A;  2LXA A;  2NBW B;  2I1J A;  4BKS D;  2LRW A;  1UBQ A;  3VUY A;  4AJY B;  2N1W A;  4BBN F;  3PRP B;  4BOZ B;  2K8B A;  2KQ7 A;  2KWV B;  3T8M A;  2HJ8 A;  2IZV B;  2KC2 A;  5HKH A;  2MQJ A;  2DZM A;  2W9N A;  3ECI A;  2O2V A;  3DBH I;  3KUC B;  2DAF A;  3RZF A;  4KSL C;  3A4S C;  3B1L X;  3H7P B;  1WF9 A;  2LI5 A;  4W9K A;  1UGM A;  3B0A A;  2ASQ A;  3RUL A;  3DQV A;  3QJZ A;  1WZ3 A;  2AYO B;  4NAW B;  3ZO5 B;  3NHE B;  4KSK C;  2KJR A;  1EF1 A;  2CHZ A;  2LGX A;  5G2N A;  1D3Z A;  1RAX A;  2L00 B;  2MBB B;  4J6I A;  2V1Y A;  2VRR B;  1I42 A;  1JRU A;  3CSF A;  3OAW A;  2Z59 B;  1WGR A;  2MBH A;  5AZF A;  4HPL B;  4II3 B;  2GBM A;  3ZRC A;  2MCN B;  2KTR A;  3ONS A;  1E8X A;  3ZNZ B;  2GBJ A;  2BYV E;  1BT0 A;  1OGW A;  3CST A;  3WIM A;  4G11 A;  2KWC A;  4ICU A;  3HK0 A;  3R3M A;  4F7Z A;  2A5U A;  5GMV A;  4RM9 A;  5KHQ A;  2HD5 B;  4MEM A;  4WWO A;  1WX9 A;  2M8S A;  1U4A A;  2L3Z A;  3V62 A;  4CYE A;  3AXC A;  1SGH A;  2V4L A;  3QIJ A;  2FUH B;  2BPS A;  4DDI D;  1GC6 A;  4BBN C;  2KTF A;  2RSU A;  3AU4 A;  4EZK A;  3ALB A;  1J19 A;  1E7V A;  2IY1 B;  4GDL B;  2JY6 A;  4MGI E;  4FLH A;  1WE6 A;  2LZ6 A;  3PLU A;  2KWU B;  2MBE A;  2MWS B;  2WX0 A;  1WJ6 A;  1TBE A;  3HM3 A;  3PV1 A;  1UD7 A;  3JSV A;  4LCD E;  1IP9 A;  1Q5W B;  3RYT A;  3L17 A;  4PS8 A;  3ZDT A;  3PS6 A;  4W9J A;  1TZ1 A;  3X0W A;  1KJT A;  1WFY A;  2G45 B;  4GU2 A;  2MX2 A;  4HVB A;  1WXV A;  1EO6 A;  2GBR A;  4II2 B;  4JQW C;  4W9E A;  4MM3 A;  2PJH A;  4KIK A;  4M8N A;  1P9D U;  3TIX A;  1E90 A;  2C7H A;  3CF6 E;  2Y5B B;  2O2V B;  1YX5 B;  3BY4 B;  1V81 A;  4GMV A;  4DHJ D;  1RFA A;  2RGF A;  2IYD B;  3PVL A;  4GB9 A;  3DOW A;  4WAA A;  4ZRI A;  4KZ0 A;  4B6W A;  1WYW B;  2DHZ A;  4ICV A;  3L54 A;  3PPA A;  3UQB A;  2BGF A;  3I3T B;  1XQQ A;  1P98 A;  2LJ5 A;  3VUW A;  2D07 B;  2ZCC A;  2ZVO A;  2UYZ B;  3WAN A;  4JL9 A;  3H9D A;  3ENE A;  4IUM B;  2LD9 A;  3U8Z A;  4B95 A;  3A4R A;  2KTR B;  3N32 A;  4RM8 A;  3QCA A;  2DAJ A;  2NCN A;  4WJO A;  1E8Y A;  1WGG A;  2BWE S;  2N7D A;  1WJ4 A;  4W9H A;  2LVP A;  4FHJ A;  3VTW A;  1NDD A;  1V5O A;  4EOY A;  1WX8 A;  1SIF A;  3LDZ E;  2CS4 A;  2FIF A;  2PE6 B;  4F1S A;  4W9D A;  1Q1O A;  4GN1 A;  4E3C A;  4A3P A;  1A5R A;  1FXT B;  4MSQ B;  2K1F A;  4EFO A;  5J18 A;  1YIW A;  1WMH A;  1OEY A;  3QC8 B;  2V3S A;  2KLG A;  3VXW A;  4TQ0 A;  2MP2 A;  1V2Y A;  3KW5 B;  1LM8 B;  3PRM B;  4I6N B;  2RR9 A;  1K8R B;  2IBI B;  2BKR B;  3IFW B;  4OVU A;  4YL8 A;  2KDF B;  3OJ3 A;  3IVF A;  4ZDV A;  3A9J A;  2KO3 A;  5CHV C;  2M4N A;  4FJZ A;  1WGH A;  3JSV B;  2L8J A;  2GBN A;  2FCQ A;  1V9J A;  4N9F 4;  3ZLZ A;  3L0W B;  4DHJ B;  1C3T A;  4FHK A;  5IAA C;  2CR5 A;  2JZZ A;  2IY0 B;  2KJH B;  2KXJ A;  1E7U A;  3L10 B;  4HLE A;  4BKG A;  2DZI A;  3V6E B;  2BF8 B;  3QX1 A;  4WWN A;  1V6E A;  2N7E A;  4EZJ A;  3D32 A;  1QZE A;  4KIK B;  1WRD B;  3SHQ A;  4AJW A;  2ZNV C;  4DHZ E;  1NBF C;  4PS3 A;  3QHT A;  2KKC A;  2KD0 A;  2YLM A;  4BKT A;  5AEK B;  5IA7 A;  3KYD D;  3W1S C;  3GOE A;  3WAL A;  1WH3 A;  3X23 A;  4W9F A;  4B9K A;  4EUT A;  2JF5 A;  5J17 A;  2ZCB A;  3IG3 A;  2BKF A;  3MTN B;  3VUX A;  1LXD A;  2LRU A;  4ZRK A;  5BO4 B;  2KVR A;  4GOC A;  1ZW7 A;  1ISN A;  3B08 A;  1GUA B;  2KN5 A;  2FID A;  3KUZ A;  4HDQ A;  3VH4 B;  2BYE A;  4MEL A;  3A9K A;  3M3J A;  2MW5 A;  4X57 B;  4W9G A;  3RD2 A;  2JUO A;  1WXS A;  4IM3 A;  4KV2 A;  2KNB A;  5DCN A;  2QHO A;  3RZW C;  2ZPY A;  1WM2 A;  1YX6 B;  2G4D B;  3EEC A;  3SD5 A;  3U7D A;  3ZNI D;  2DYM A;  4WWP A;  1VCB A;  1GNU A;  4WQO B;  4AUQ C;  3KH0 A;  3PRZ A;  2JPH A;  1P3Q U;  1NI2 A;  2K6D B;  2KOX A;  2D2Q A;  3EHV A;  5CHW A;  1H4R A;  1WMH B;  2JVC A;  4IG7 B;  4K7U A;  1E5W A;  4MGY E;  4AP4 C;  1J8C A;  2MP2 B;  3VH3 B;  4IWP A;  4LDT D;  4GDK A;  2JWZ A;  3A9J B;  1H8C A;  4AWJ A;  2L0F A;  4FUL A;  3WAM A;  2KFK A;  2JRH A;  1CMX B;  5LLI A;  3AU5 A;  3UIN B;  4PYU A;  4FJV B;  3VVW B;  2IO0 B;  5CTR C;  1WR1 A;  3IBE A;  2YVC A;  5AZH A;  3ZVV A;  4FAD A;  5E6N A;  1J0G A;  4F8C B;  3MHS D;  3M63 B;  4EKU A;  2LVQ A;  1GJZ A;  3HIZ A;  1GC7 A;  3O65 B;  4K1R B;  1L7Y A;  1G6J A;  3W1Y A;  2KJ6 A;  2K6Q A;  4NPN A;  1YQB A;  2L0T A;  2KZR A;  3L08 A;  4I6L B;  1MG8 A;  2XK5 A;  2KFJ A;  4W9I A;  3RCZ A;  3HM6 X;  2NR2 A;  1SE9 A;  4MDK E;  2WX1 A;  4OVV A;  1UEL A;  3R66 C;  4RMA A;  2N9P C;  3QAR A;  1IYF A;  2J0J A;  1WJU A;  5JZE B;  2REX A;  2M0X A;  4ANU A;  4DXA B;  2IO3 B;  1P1A A;  3NOB A;  3Q3J A;  1AAR A;  5E6O A;  4ANV A;  3A9K B;  4EZL A;  2O6V D;  1LQB A;  1R4M I;  4HJK A;  3DVG Y;  3KVF B;  4GIV A;  4GSW A;  2OOB B;  2BWF A;  4URK A;  2KK8 A;  1WGD A;  3ML9 A;  5D2M B;  3VQI A;  2CHX A;  2KAN A;  3AUL A;  4GXB A;  3RUI B;  2KQS A;  2C5L C;  4LDT B;  1WE7 A;  2EMT A;  1V5T A;  3PZD A;  5D6J B;  3UIO B;  4ANW A;  2AL3 A;  1EUV B;  1RLF A;  2MBO A;  2RPQ A;  3H7S A;  4E74 A;  4NJ6 A;  5JHA A;  2R2O A;  4DK5 A;  1Z2M A;  2J0M A;  3DDC B;  1I35 A;  3JW0 X;  3ZTD A;  2D11 A;  2I1K A;  1PQS A;  2AEH A;  1TTN A;  4IM2 A;  4P7I A;  5C23 A;  2JT4 B;  2DYB A;  1L2N A;  3KYC D;  4GDK B;  2LGY A;  2WYQ A;  2GMI C;  4IWQ A;  1Z5S B;  4DHZ B;  4AOF A;  1S3S G;  2ZZP B;  3VAW A;  2EKE C;  2FCS A;  2AL6 A;  4FA6 A;  2KFK B;  2KMC A;  4WJQ A;  4HK2 A;  5LXH A;  2CU1 A;  5FR6 A;  1E8Z A;  3ZKJ C;  3EFU A;  2KLC A;  1OTR B;  4EEW A;  2JZ3 B;  2NPT A;  2DX5 B;  4DBG A;  3APD A;  2OJR A;  2KHW B;  1WY8 A;  2D3G A;  3TJP A;  1Q0W B;  4ASW C;  4HCN B;  3RT3 B;  1VD2 A;  1E8W A;  2Z0D B;  3PSE B;  3ZUN A;  2BYF A;  2PPH A;  3BIN A;  5C1Z A;  1YD8 U;  2C60 A;  3QAQ A;  2MSE D;  4G3X B;  2WWZ A;  2DYO A;  3CMM B;  3EC8 A;  3DBL I;  1TGZ B;  2JRI B;  4HWI B;  4MJS A;  1F9J A;  2XK5 B;  3R7R A;  3T9L A;  2PEA A;  4W9C A;  3VHT C;  4W9L A;  2ZPN A;  2GOW A;  1LFD A;  4HCP B;  4GGQ A;  3V60 A;  4E71 A;  2K39 A;  3N30 A;  2K25 A;  2L05 A;  4PS7 A;  2J0K A;  4K7W A;  2G3Q B;  2XEW A;  2A4Z A;  4M8M A;  3VFK A;  2FNJ B;  4BFR A;  5TR5 A;  1XT9 B;  5JH5 C;  3K9P B;  2KX3 A;  3IHP C;  2R2Q A;  2LUE A;  2CKH B;  3NZS A;  4I6P A;  3TMP B;  1YJ1 A;  4NY0 A;  3APF A;  4JGH B;  4JLC A;  2KX0 A;  5L95 C;  3APC A;  3WA0 A;  3DVG X;  2Z0E B;  3V61 A;  3LJ3 A;  4NQK E;  4NNJ B;  3V6C B;  2DZK A;  3ZRF A;  2DEN B;  3DVN V;  4KDI C;  1UH6 A;  3ZIM A;  2DZJ A;  1R4N I;  4HDO A;  4MSM B;  4MH0 E;  5DPW A;  3H6N A;  5DPR A;  2FAZ A;  3DBS A;  4BOS C;  3VDZ A;  2MBQ A;  1KOT A;  3ZDM C;  2NBV B;  5J2R A;  1OEY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...