1I4RA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.5
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4rA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4rA02
1JWSD 1LTID 1SE3A 2RDGA 3CHBD 3BVMA 1HA5A 2ICIA 4RGOS 5ELDA 1L0XB 5ELCA 3EFXD 1SBBB 3BYYB 1QILA 1FD7D 3BYTB 5I4DA 4RHRA 1I4GA 1ET9A 4RGNA 1EU3A 1HTLD 2R61A 1UNSA 1LT5D 1JWMD 1PZJD 1LTTD 4UDUC 1S5CD 4NZLB 1RCVD 2XRSD 1CK1A 2RDHA 4RCOA 1TY0A 1FGBD 1SXTA 1FNUA 1PTOC 2NTTA 1F77A 1ENFA 1L0YB 1PRTF 2Z8LA 1YN3A 1CT1D 1I4HA 1JCKB 1TS4A 1S5FD 3SEBA 1LTRD 4RH6A 3DWAA 1STEA 1KLGD 1I4RA 1HQRD 1V1OA 3O13A 3URYA 1BCPF 3MC0B 1PTOD 1S5BD 3V05A 1MD2D 1CQVA 1G8ZD 1LO5D 1V1PA 1AW7A 1PYWD 2IPKD 3R8BA 1LT4D 4RGMA 3GP7A 1TS5A 1PZID 1PRTB 1XXGA 1FNVA 1LT6D 1LTBD 2AQ1B 3EA6A 1RF2D 1LT3D 5FKAC 4ZYSA 4DXGA 4RHSA 4BWGB 2QILA 2SEBD 1BCPB 1BXTA 4RFBA 1B44D 1UUPA 1I4PA 3BVZA 1SE2A 5ELFA 1FNWA 1ESFA 1D5XC 1KLUD 2TSSA 2XN9C 1EU4A 3KLSX 4TSSA 5D3DA 1AN8A 1TS3A 5FK9C 2G9HD 1V1PB 3OWEB 1GOZA 1I4QA 5TSSA 5ELBA 1JQYD 1JWUD 3DWQA 1EEID 5D3IB 4L63B 4Z9CB 3DWPA 5ELEA 1DJRD 1TY2A 4OHJA 1YN4A 1JR0D 3TSSA 1B1ZA 4K6LA 2NTSA 1CHQD 1EFID 3R2IA 1I4XA 2AQ3B 1DYQA 1RD9D 2XNAC 1BCPC 3MFGA 3W2DA 2XRQD 1PTOF 4DXFA 1EWCA 1SEBD 1PRTD 1SE4A 1TS2A 3BZDB 2CHBD 4RGTA 1CHPD 2J4XA 1SJHD 1D5MC 1M4VA 1LTSD 1XTCD 2AQ2B 4L6TB 4C56C 1D6EC 3BVGA 1HXYD 1PTOH 1BCPD 1S5ED 2O2LD 3R2TA 1LTAD 1T5XD 1KTKA 1ET6A 2WV6D 4O1NA 1LLRD 1RDPD 1EEFD 1LTGD 1PTOB 1SJED 2QEJC 1S5DD 2IJ0A 1D5ZC 1PRTC 1YN5A 1PZKD
chains in the Genus database with same CATH superfamily
4AOFA 1IP9A 2ZVNA 1YNTE 4HXDA 3RZWC 2A4ZA 5H1SE 1K0SA 1WXAA 2LGIA 2DAFA 3FPUB 3V2TA 5EE1A 2V0GA 1PDQA 1IBMQ 1KRTA 2W54A 4E6IA 5IT9L 1R4NI 5GAGC 4IG7B 4R4QA 2J0MA 1QLBB 4EX5A 1A5RA 3S1RB 1I35A 3HKZB 4LFBL 2RMMA 3GV6A 4PS7A 1SYCA 5AJ3Q 2NYZD 1UE1A 3ZDMC 3ND8A 1KM7A 3P4QB 1OXUA 4NZLB 1RCVD 5BMIA 2LY7A 5HKHA 2QDLA 3FRPB 2KWUB 3CC7A 4AYBE 4RF0A 1SYBA 1W6KA 5I6YA 3U58A 3HVDA 2L5TA 3TP5A 5IOCA 2EY5A 2MX2A 2PW9A 2JXMB 2KTRA 4L23A 1LM0A 4A93H 5JPMC 4WJPA 1KQSA 2R93B 3AEEB 3HHMA 1WJNA 1LXDA 3E9IA 2J0KA 1X56A 4NJ6A 1H9JA 4A3KB 1WI5A 3UGBB 2JRIB 4KKJA 4B0EA 4BY1G 3VA7A 3TJPA 1GB1A 1D3ZA 1JT8A 3PRZA 1WR1A 3KUZA 3KWLA 3H7SA 1LT6D 2KQ4X 4US9A 5AUIA 2EQSA 3GZNI 1QOFA 2Q2TA 2EYPA 2E76C 3UIPB 2Y0SB 5FO7B 3IKJA 3X23A 2SEBD 2MQJA 4AIMA 3TBIB 5IKCM 3C1EA 2HTME 1PHJA 4G57A 1K8OA 1A2TA 3E3XA 2TSSA 3DXJC 3AE1B 2O5IC 2W82A 4ITKA 3G6EA 1Y1WB 4Y52H 2WXIA 4LNNA 4W9JA 4IZ8A 4KD3A 3Q69A 2B2WC 4B9XA 4A4IA 1TIFA 4I6PA 3L7ZC 4XE0A 4DWFA 4WORA 2Y3AA 4C3JH 1N63A 3ALBA 2BH8A 4C7ZA 5CTRC 3ZKJC 1DJRD 4A3JB 1I3QB 5EDSA 3VTVA 2L11A 2FBWB 1JB7A 2IGGA 3HM6X 2EYJA 1GUNA 1NYRA 1B1ZA 3GTOH 1BBXC 1G6ZA 5DM73 4M02A 3OHXC 5IYCH 1CHQD 1L0VB 1MHXA 2ZVOA 3GTPH 1EIHA 3N1YC 4ALPA 2MHJA 1DONA 3ZUNA 4ANVA 4EOYA 4A3FB 2NPTA 5HY6A 1WH3A 4FF4A 1BCPC 3S1QH 1NBFC 5EBCA 2PMVA 2PIAA 1SIFA 4GS3A 1PRTD 4LFCL 4A3GG 4K0KQ 2MJDA 1UE5A 2BS3B 3AYHB 3ZJTA 2BPSA 3QWNA 2Z0DB 2LJIA 4A3EG 1SJHD 4LF9L 2ZTEA 1XO3A 1E8YA 3LJ3A 1MI2A 2EKEC 5M5XH 2RHQB 3I70A 4JI0Q 2YV5A 3GTQB 1IBKQ 1UWVA 1E6EB 4JQWC 1LLRD 3H0GB 1VDZA 1PTOB 3OTOL 1GUAB 2KTFA 5LL6S 2K50A 2SDFA 3DLLA 2F03A 1RRBA 4HSVA 3GE8C 4IOIE 3Q8DA 1D2BA 3SR6A 5DPSA 1SE3A 1Q46A 1IW7C 1N6ZA 4KV6A 2NZOA 4ZUIA 2B2YA 1E10A 4PV1C 1O80A 5I9PA 5IIFA 2WX0A 4BKSD 4EEWA 1K83H 3RN5A 5I4DA 4DV5Q 1G51A 1CJEA 4J1MA 2LXCA 4RGNA 2DBYA 5JOBA 4JWSC 2CWPA 4RMFA 2Z6BA 4KI0A 4H0LC 4K2KA 1JE4A 2KOLA 1XPUA 4BXXH 1RYJA 1E8XA 5M3FG 2DJFC 4RKBA 2WDRB 3IFWB 3P42A 4FLHA 5BN4A 2JXXA 1V5OA 2BE5C 1E0BA 3VR3A 3FC4A 4XTCS 4DR3L 3I91A 2WWZA 4A9AA 1GAQB 2JK8A 3HEJA 3PS6A 3IFDA 3NS8A 5BO4B 4XT3B 2XVSA 2YLMA 1WJ4A 3KYCD 1I5FA 4A3OA 4ARCA 5AUKA 3SEBA 1RTOA 2PZUA 4HRSA 2XK5B 1ZXHA 2IT1A 4DK1A 1FXTB 4IW0A 1I4RA 1HQRD 2MWSB 1EUJA 2GBRA 1CQVA 1RIPA 1V1PA 4KMUC 1OQYA 2PKOA 2REXA 1O7YA 3TMPB 1WOCA 3J9CA 1LT4D 1PH3A 3IAS1 3KQ4A 4ZYNA 2K01A 3ZTCA 4HAEA 3FKIG 1OXTA 3V62A 1CM9A 1GXDC 3CCVA 1AARA 1E1TA 5C0XJ 4HJ7A 1TKEA 4BKSA 2K5QA 4IJLA 3HOWG 3T8MA 2K14A 3MC8A 1CSQA 4BWGB 2YU9B 3PVLA 2WAQG 2OF1A 1J5EL 2A6HC 2G4DB 2KAJA 2EY1A 2ZJQA 5ISRA 4HDOA 1B3AA 2GN5A 2MBQA 4IUNA 2VQEL 2R7ZG 5FK9C 1TS3A 1P3QU 1KDCA 4Q0FA 4RNAA 1EWYC 3A5ZB 1JMLA 2DX5B 3OJ3A 1H9RA 2B8FA 2M4NA 4QUCA 3NELA 3KWVA 1DXMA 3M95A 1EQQA 1EO6A 1YNNC 2EXZA 2MHVA 5FLMG 4CDCC 1RLFA 4BKTA 2PQAA 4DU9A 1S3OA 3S2DB 1N33Q 2HT1A 4IUPA 2L0TA 1YN4A 2NCNA 2BA0A 4ZAIA 3FKYA 3NZ3A 1BBUA 1QVGA 4REZA 4RM9A 2DNCA 1GC7A 3S16B 2HQLA 5D2MB 5ELNA 3KUPA 3NK9A 4FVMA 4GOCA 2VRRB 2INPE 4QUFA 4HJ5A 4HMJA 2Q5WD 3I9V1 3ZXRA 5AZHA 3ETRA 3BDCA 2NVTH 3RLFA 4WAAA 3K7AB 1ONLA 3M4YA 2JA9A 4RGTA 1CHPD 5E4WC 2R92B 1QVCA 5G55A 5C44B 2PYKA 3OG5A 2IZVB 2AMCB 4L6TB 2DN8A 3SE0A 1HFNA 2A73B 1N61A 3V61A 3NQTA 3G6JB 2WHIA 4JI8L 4LUVA 3GD7A 2L55A 4JI6Q 2UXCQ 4TUUA 1FRRA 4WAFA 3HOZG 3S24A 1HA6A 3W5UB 4KKTA 4DQOC 3LDZE 4EUTA 1VQMA 1HZ6A 3VUXA 1YNJD 1VQIA 2OJWA 1Y8RC 4OO1G 4DR5Q 3HOUH 2D11A 2JUOA 3AE2B 2K6QA 4UY8C 5K36H 2WB1E 2WXMA 2MW5A 3WAPA 4B0MA 2F0UA 4OWTB 1T5EA 1W3SA 2CQOA 1A8VA 2KHJA 4DAPA 4DFAA 4CJ1B 3S14B 3DM3A 4C3HB 4IWOA 4KV2A 2RHSB 2C60A 1CQFA 4P6VF 2VL6A 4IURA 2N7JA 2X8XX 4DHZE 1JWMD 4ZK9B 3TEWA 4KDIC 1EIGA 2E75C 2HHHL 1C48A 1BF4A 2CH4W 1JJGA 2LUMA 1HTOA 2DZJA 1CK1A 4YWLA 1JALA 1WX7A 4FHKA 4LJPB 2D5GA 4JPSA 4HLEA 1EY4A 1PTOC 3TP7A 5L83A 3H09A 1L0YB 4IO9A 1PRTF 2J42A 5C4JB 2WINB 4MGKE 3PZ7A 4RAUC 3D31A 1Q90A 3IT6B 2LZ6A 1EWHA 3URYA 4MTNA 1WTHA 3SGIA 4LJZC 1WJUA 4USAA 4PMBA 1NEKB 1VCBA 1FD6A 3VAWA 5EE0A 4NKLA 3OJ4B 1NY4A 1Q3LA 4F7ZA 1TS5A 2XTIA 2BT6A 3PLUA 4G50A 1TTNA 5DCNA 2MP2A 3ZVVA 2MP1A 2QC8A 2K0PA 1RF2D 3ONSA 2L4NA 1GUGA 1EY9A 4K2LA 2GBNA 4DHJD 3MJ5A 1ICFB 1K8AC 1XCTL 2DYBA 2WXPA 2GVAA 1OQRA 1WZ0A 4J8QA 3DVGX 2I5LX 1RM6C 3E0JA 1JROA 1FGUA 1Y1WH 2JT4B 4PS3A 1WXMA 1ESFA 1TT2A 3UDGA 2AWOA 1I6HB 1K28A 2BS4B 3F1ZA 3CCLA 1M94A 1GO3E 4A3MG 2UUAL 2H4OA 2WGSA 4HIKA 2I2YA 3KLRA 4A3JH 1I3QH 1F2RC 1NMFA 1WTVA 2MRPA 4JI4Q 2QKIC 4DV6L 5JJLA 1MG8A 4HWIB 1QUQA 2AUJD 2EJGC 4HCSA 3CPWA 4WJ3M 3Q8BA 2CHZA 4OEMB 1B4OA 2D2CC 2DENB 3W3AA 4DK3C 4A3FH 4KTAA 1HNZQ 2RPVA 3TN2A 2ZXPA 1VF5C 3GE3C 2K52A 2MFIA 4NDXA 1OXSC 3J7AV 1TWCH 1YITA 4DDID 1H4RA 2KQ7A 2JRHA 2L76A 3KUDB 2A68D 1B53A 4LF8Q 2KDBA 3CU7A 3CIRB 5H8YE 1CMXB 2NWGA 4KY7A 3B2FA 3CCUA 3Q24A 3GTQH 5IP4D 3DVNU 3H0GH 3P7JA 4RWSC 1PTOH 1BO0A 1HR0Q 1E8ZA 2LXKA 3NTIA 2BYVE 4K5WA 4TQ0A 1V8QA 1ASZA 2MGSA 1ZOYB 4OVUA 2QEJC 1DOXA 2IO2B 2KMAA 4C3JG 4LF5Q 1YN5A 4P1CC 4E71A 3G48A 4PNYA 4EQ5A 4HJGE 1CFMA 4AWJA 1J0GA 1KC8C 4LW1A 2GOWA 1HTPA 1L0XB 2ALYB 1OTRB 1VQJA 3CCEA 2M9VA 1IYFA 4RHRA 4XX5A 5LMUL 1ASYA 3FILB 3VUWA 4P71A 2WU5B 1Y56A 1PYBA 2WXRA 2D3AA 1FR3A 4JOIC 4FBJB 1MGSA 1PH9A 3RNCC 5C1ZA 1IYUA 4DF7A 2DZKA 3KFUA 1I94L 4WWPA 3J81i 1WSPA 3ZJUA 1SLJA 2ZJPA 2UXDQ 1DOYA 1BNZA 1KXLA 1E5WA 4C4VB 2XGTA 2GBMA 4GDKB 1STAA 2KENA 2KCNA 1JORA 3VR8B 4LUOA 4JG2A 1VZ6A 1FIQA 2CFMA 2I07B 3MXUA 3NQIA 3GTJH 2JA5G 4GN1A 4K8IA 4M0WA 1EF5A 4FXGC 1KLGD 2F0TA 1V1OA 3D4DA 3O13A 4B3MQ 2I1JA 3AFQA 4HJ9A 3APCA 1C76A 2KFKB 2WXJA 3Q8EA 2HQEA 2RR9A 2KN4A 3NENA 5GROA 2A69C 5DNFA 1U4RA 1JOQA 1Z9FA 1L4ZB 3J81c 3RULA 1N33L 4DNTB 1GC6A 2HUGA 1SE9A 4JK1C 4KN7C 3GTKH 1VRAB 3E6ZX 3L10B 1KHIA 4QMGA 4YWMA 1H95A 4DXGA 1U4LA 5CV4A 4H2AA 3VTUA 5M5YH 2PCFB 2L9HA 2HTHA 4RFBA 2KTRB 5NUCA 1PUTA 1I4PA 2ASQA 2WP9B 3AE7B 1X55A 2K6AA 5C3WA 1K50A 3I3TB 3MXPA 4JX1C 4P16A 4YWKA 1FPYA 4H13C 1MI0A 4DK0A 3KJOA 3CRKC 2H88B 3LB8C 3OMCA 1J9OA 2F0HA 1PH6A 3S2DH 2DZMA 4BS9A 1FCCC 5ELBA 1JQYD 3KLSA 1OXVA 1Q81C 2DY8A 4G7HC 3TBLD 1SNPA 2B63G 1QNKA 3S16H 4A93B 3TS2A 4L63B 1VR9A 3GDEA 4N9PA 2A8VA 4LFBQ 4EZJA 4LMQD 2Q8TA 3L3OC 3LXFA 2UXCL 4OVZA 1QKZA 3QC8B 3VH4B 2FMMA 5IE8A 5T8IA 1N9WA 2L1BA 1MFWA 1XMQL 4NQLB 5AEKB 1EFID 2IX0A 3BZKA 1L2NA 1F9SA 1UEAB 4X3KA 1WY8A 1B3QA 3K7AH 1I4XA 3OW2A 1TKGA 4XC2A 3A7AB 3RMKC 4DNRB 4XDXA 4BBNC 4K1RB 3GTMH 4DR6Q 3GB1A 4YWGG 4XQNA 2L1AA 1L1OA 1S72A 1VQKA 3AULA 4DR5L 4C3IB 2M0XA 4I6LB 1VLBA 2AL3A 2P5ZX 2MBOA 1M4VA 5DLQE 1L5PA 3FHWA 4Q5VA 1I6VC 3DBLB 4C56C 3P4SB 2QMTA 2OCEA 3F2CA 1WRDB 3BK1A 1E3PA 3MTSA 3H3VC 4X65L 3QG1A 3A1QA 1II3A 3NBHA 3MEFA 1RDPD 3HK0A 2L83A 4A3DH 2IJ0A 2NPTB 3JAME 1EIFA 4OL7A 5T1GA 4N8X1 1YMHE 3UQBA 2N9KA 5IN7A 2ZPNA 3EUB2 3N3KB 2IL8A 1GD7A 3H91A 1VCIA 2EELA 2FE8A 1L6UA 5EGTA 2F0PA 4H02A 4C3HH 3EFXD 4MGIE 4JE3B 1FD7D 2JQOA 5CBAE 3S1NH 5MPOA 1BBWA 4FNFA 3S1QB 3GV3A 2AKWB 2FUG1 4FO2A 2R61A 1BDOA 2I38A 2MUYA 3RUZA 1B2TA 1TVXA 1FMAD 1UWMA 1PZJD 5HG2A 1BOSA 1PFDA 4KHVA 1NR4A 4QQBX 2BDNA 4IOCA 4JI2Q 1WI0A 2FCNA 2O2VA 3FMCA 4ZRIA 1XPOA 3X0WA 4GN5A 1QOHA 4RCOA 2BS2B 4G0NB 2X6GA 2KHIA 4MIUA 1VQLA 2LMCB 1K52A 1T3QA 2J0JA 2V1CC 3RPFC 3CSFA 3CC4A 1Q10A 3K0YA 4B6WA 4B9KA 2OXPA 4RH6A 2A5HA 4LFCQ 2Z6KA 4A3CH 1ZYRD 4ILWA 5EKLA 3I56A 4LF9Q 3RT3B 4IUQA 2N9EB 4NQKE 5J39A 3ZGZA 3PGEA 3R8BA 1PMRA 3C3LA 3ZDTA 1K83B 1NR2A 2BWFA 3HKZG 1PRTB 1K3BC 2EXDA 3K6OA 4XWTA 1TBEA 4I65A 3Q14C 3JAML 4FXCA 1CKMA 5G3LD 1CA5A 3QQ8B 1VQGA 4IPHA 3OTOQ 2NBFA 3K5NA 2QILA 4QB4A 4M8NA 1SSOA 3H3VI 1RKNA 1TXYA 3ML9A 4NP5A 2BBCA 2RCFA 4MGZE 4DAMA 2F0KA 2PNRC 1CKOA 3PHWB 4MH8A 3ZRCA 2XN9C 3C8YA 1EFWA 2C5CA 2NZHA 3H3VH 1V1PB 3L16A 4LF8L 5FOBB 1PH2A 2HDMA 5FR6A 2F52A 3HKZE 1TZOA 4NW2A 2L0FA 2R93G 3CMEA 4IC7B 2MBBB 5COYA 1L7YA 1PQSA 4IWPA 1K8MA 3AECB 1NI2A 4A3KG 1D1KA 5K5PA 3S2AA 1TY2A 1Z47A 3STBD 1HR0L 3U7DA 2V3PA 4C00A 3KYDD 4KKUA 1WF9A 4KGTA 3AE4B 2VB2X 5JHAA 4KK7A 2G1EA 4AUQC 5JXVA 1KAAA 5J2RA 3IRBA 1F0ZA 4HIDA 3C19A 2Y0SG 1QWYA 1U4PA 1VQFA 3H15A 4DR3Q 3S17H 4LDTD 5DPTA 3T3OA 4LCDE 1Z5SB 2GLSA 2X6LA 2FNJB 3S1MH 1P7FA 2D07B 5BN5A 1P0RA 5LMNQ 3A4SC 1O7LA 1ENCA 2CHBD 3BS1A 1Y1WG 1AZQA 1P98A 1UGJA 3MFYA 3AE5B 4D2KA 2PQAB 3S9WA 5DPRA 1K8RB 3K81C 4K8JA 1Q1EA 4HROA 2AX5A 4POGA 1M8AA 1VJKA 4ZOHC 3I7FA 1LYLA 1K0RA 5CORA 2N9PC 2K5WA 3U8ZA 2BOSA 5CV6A 2EE1A 3B6YA 3SR1A 2A19A 3CCJA 4K81A 1WTQA 1J5EQ 4NAMA 1UEBA 3M7NA 1Q0WB 1KRSA 5GAHC 4A3FG 2Y5BB 2VQEQ 3H6NA 1U4MA 3L4PA 2J52A 2FUHB 2W9NA 2F0DA 1WXQA 1EYGA 1RHPA 4NXMQ 3HOXB 3OAWA 4KGRA 1PXUA 2F0LA 4B3ML 2K25A 3AU4A 2KXJA 3WIMA 1N62A 4KIKB 1EU3A 3E5SA 1VZ7A 2XIWA 1V1QA 4ANXA 2F0EA 1BKBA 2KHSA 3GOEA 1WX8A 4ACFA 1EWIA 3A8KE 2J0TD 3D6WA 1S5CD 4GOPA 2WDTB 3P20A 1V49A 1QF6A 4RG1A 2NS5A 3FAHA 4L5SA 1F2LA 1VQ6A 2EY6A 2JA6B 2F4IA 2KJXA 3M3JA 2NTTA 1VMPA 2M00A 3M85A 3PV1A 4II3B 2RKSA 4HMIA 5IGDA 1I4HA 3PLVA 1JCKB 4KHZA 4EQOA 5KHOA 5C4XH 2EKIA 1U4AA 2ZPYA 3W5VB 3ND9A 1T9HA 2O4XA 1KF6B 2KDEB 2RGFA 4RF1A 2EY2A 4L1BA 5CYUA 1L2FA 4C7YA 1HZBA 3HOUB 1PYWD 3SU8X 1V43A 4XDDA 2J7QB 5JH5C 1DM0B 3TQYA 2KOXA 4JI8Q 1QJOA 1E8WA 3NSWA 1F52A 2N0SB 3Q3MC 4WJQA 1CUKA 3PUZA 1PH4A 4MEMA 1R4MI 2CVRA 1HHVA 3ULLA 2N1WA 5BMHA 5JEAJ 4KGSA 4IM0A 3DHGC 1N5XA 1ROEA 2WDVB 1IYJB 1KNAA 3BVZA 1XJVA 1MJEA 2QIEB 3U4EG 4DR6L 2K28A 5GAEC 2X69A 3S2HH 3DVNV 3N1XC 3PO3H 5D3DA 5AZGA 2E2IB 5D7GA 2LGSA 2QCPX 4JYAL 3PSEB 4JV5L 3VYTA 3PREA 2ENBA 5TSSA 5C4ZA 1J7BA 4PZ8A 1YJJA 2J53A 3V96A 1STGA 2CJNA 3QIJA 5D6JB 2JF5A 1LFDA 2WXHA 4JL9A 4ZDVA 3BWUD 4A3LH 4PZ6A 4JCVE 1OQQA 2IBIB 2HHHQ 3TL5A 4XGAB 4GNXA 2AWTA 4QIWB 4HCNB 3VXWA 1DOKA 1WR6E 4PYZA 2I1KA 2M17A 1BUVT 4NPNA 1V80A 4I7ZC 3R2IA 2C7HA 3KW5B 4OZBA 4C3IH 5LNK1 3DBLI 4IUUA 1ZUD2 2LWPA 4L5TA 3PO0A 4K7WA 3EFUA 1STHA 1DYQA 2EJMA 2LVOA 1HEZE 2ZTDA 3W2DA 1ZW7A 2K5NA 2XRQD 2ZZPB 3MZ5A 2CQAA 4JWUC 3TIXA 2IY5B 3M63B 3VA5A 3J7AF 4ME3A 3NTKA 3E56A 1X32A 4OIKA 1D5MC 1G2SA 3EC8A 1QUQB 5IGFA 2K7VA 1D6EC 2B39A 4QAYA 4OZCA 2B2VC 4KHPQ 2UUCL 2O2LD 5G3LF 1J8IA 2XWBB 4IFDI 1AEXA 3VR5A 1K3RA 5ELOA 3WOEA 4JI2L 1GB4A 2L7RA 4CO7A 4CQNA 1S5DD 1FEHA 1XEEA 3R7RA 4IFDH 3IAM1 2WACA 3EGRA 1TWGB 3I72A 3SDZA 1HA5A 2BCOA 2ICIA 3A56A 4HR7B 5IYDH 1HPCA 4LF7Q 2NVQH 1KH0A 1U5KA 5J3BA 2LFNA 1A63A 3OWFA 5HGQA 2UUAQ 2JA8H 5EPJA 1TWCB 2R92G 4KKIA 1ET9A 3ENEA 3D3RA 2N4FA 2KEDA 5C44G 3VR9B 3E0EA 2M2LA 1WGDA 2N8NA 2PMZB 4DV6Q 4A20A 4GGQA 2YEPF 3ZW3A 3TZDA 2CR5A 2IO3B 3K0XA 1TWFB 4XT1B 2IGDA 1F9PA 2RBMA 3AEVA 1EQTA 5CBEE 3Q22A 2A6EC 1VQ8A 3L0WB 1GJZA 2OQ0A 3H1UA 1DOMA 1JJCB 2CHWA 3M4OB 2JN4A 2B2UA 4NJCA 1NE3A 3D6CA 2VH2A 2D3BA 5C2TB 4X66L 3PSIA 5E3FA 1YIWA 1WTPA 5IP7H 3W1SA 1R7SA 1PH8A 2RF4A 2LRUA 1O7IA 5J18A 3MC0B 1H9SB 3V05A 5GMVA 4B08A 2K8CA 2ID0A 1TIID 4C3HG 1VQNA 2FMCA 4JI5L 1T0QC 1BVSA 2RVLA 4NB3A 2EMTA 3EA6A 4ZCKA 2KECA 3HVZA 2XSCA 4JBJA 4TQUS 1TWAH 5EPKA 5CX3A 4X3TA 3AB9A 2O6VD 2Q2IA 3DWMA 1KL9A 2D62A 4IQZA 3VVWB 3UDIA 1YJ9A 3DMUA 5ELFA 4M0WB 4AYBB 3G4SA 2JWZA 3AB5A 3Q8CA 1GUOA 1WE6A 2Z0SA 1Y1VH 1PA6A 5CC4A 4IUVA 2LRWA 5LMNL 2PLPA 2W3SA 3U7ZA 5LMUQ 1N32L 4JPBW 1IGCA 3CCRA 3H94A 3I8ZA 3GTJB 1NCVA 4IPCA 4H7BA 4HIMA 1EYCA 1VQ9A 2F0GA 3QJZA 2FAZA 1SAPA 1XNQL 1NSNS 4A3CG 1GHKA 3DOWA 1G291 1ICWA 4XQJA 3AEFB 4DXAB 4ZKCB 3F2BA 1I94Q 2GI9A 5AFWA 1LTLA 2CKHB 3NHEB 3K8AA 4ZRJA 3MHSD 4HJKA 2OTJA 1MG4A 2K9XA 2QW7A 1WCMH 4PMWA 1SMYC 3GTKB 2UXBL 3KVFB 2ICEC 3QA8A 1RD9D 1F9JA 3M3YH 1J19A 4NY0A 3AQQA 3MTNB 5M5YB 1JWBD 4OVVA 5M9OA 2INCC 4EKUA 3MXGA 3TS0A 3VHTC 4NXML 4CHKA 5LXHA 2HCCA 3JSVB 5G2NA 1C3TA 4YT0B 2CKZB 2UUBL 4ZKBB 1AFPA 1V5TA 3DCGA 2O6VA 2F0JA 3I4OA 2HDLA 2FINB 2E2HH 4HPMB 2MQHA 1ILQA 3TMEA 4QL5A 2DGYA 2WAQE 3TP8A 1YX6B 1D4BA 2NN6G 4N59A 1CZWA 1IKLA 5JJKA 1T6BX 4ULLA 1ZE3D 2IO1B 2KJ6A 1D5ZC 4L8JA 1FVIA 1PYSB 2YYZA 5EJWA 2LHEA 3CXCA 3NJTA 4HKQA 3K5OA 1SR3A 2RSOA 4DV1L 5C3EH 3DQVA 3HOXH 3CSTA 2LHDA 4MZ9A 1C78A 1DOIA 1CZGA 1MPEA 2WFWA 1XX8A 4BBSG 2BE5D 1SBBB 5DM63 5EE3A 1JW9D 3I4NG 3HFZB 1SB3C 4MTKA 3GTMB 2EJFC 1PFSA 3TEXA 4F7XA 1IZ6A 3NBHB 4DV7L 2AL6A 3MC9A 4J6HA 2EYFA 2N78A 2R3ZA 4UDUC 5C6AA 1YQ3B 2JA6H 1XMQQ 4B3RQ 1SXTA 2C35B 4PS8A 2JZPA 1SNCA 3CCMA 2UU9L 1S40A 1B9RA 1F77A 2M56B 2D3GA 2WXOA 1FO4A 3L08A 4GMVA 2AHOB 4A3DB 4YTPB 1UELA 1F2MA 2BDOA 2ZW0A 1H9MA 3Q6BA 4WWNA 3DWAA 1XT9B 4ASWC 1UBIA 4LF4Q 3VDZA 4II2B 4NAWA 3A0JA 3T13A 2A6HD 3UI2A 2JY6A 2QDFA 1MD2D 2M1MA 2HIXA 3RNFC 2KJRA 2O2VB 4GDLA 4A3IG 4JVZA 1C79A 4X65Q 3PO2H 3S1NB 2CW0D 4YIJA 2RPQA 4K3BA 1LT3D 1RAXA 4I7AA 1SYFA 2LASA 4P74A 5FKAC 2VUMH 2WQYB 4OWWB 3NE5B 5C0XH 3EVQA 1A3UA 3J81E 3HOVH 2GVBA 4PG3A 2E2IH 3RZDB 4P7IA 2VQFQ 3A9JB 2Q8IB 4X3UA 2E5LQ 2JQRB 3TUOA 3JW0X 3BDOA 3C1FA 2V9HA 2FIDA 2D2QA 3UE1A 2M0AA 1GOZA 4MACA 1Y8OB 2BYEA 3EJIA 3I63C 4GLAC 1QZHA 1YX5B 1TGZB 1JWUD 3I4MH 5KGUA 2VS1A 1KIXA 2HD5B 3MEHA 4KHPL 5M3FB 5CR3A 4YCUA 2YTYA 1JQ4A 4QY7A 2KVMA 4CJ0B 1TJEA 3CF6E 3Q0AA 2L05A 1JR0D 3RLOA 3IBEA 4FHJA 2A68C 4BA1I 4K6LA 2KVRA 1GVPA 3NHHA 3KK7A 5EPLA 3H6MA 4DAYA 1NJIC 2KT7A 2PO4A 3EHVA 2BKFA 5IWAL 2ZJRA 4AQ7A 2RDFA 4DV2Q 4LF7L 3T53B 1EWCA 1WGRA 2O5JC 4W9CA 4BVUC 1F1HA 4RA8A 3BZDB 3C2PA 3W1BA 2IHEA 1DCZA 1X3QA 2KJHB 4WJ4A 1JB3A 1F2YA 2AQ2B 1H8CA 3VR6A 1V97A 1S5ED 4GZYC 2I46A 2C9WB 2OOBB 4A93G 2W55A 1IXRA 3M4PA 1NVID 1IBXB 4O1NA 1YJWA 3MHZA 1TWGH 3J81L 1D1IA 4N9TA 5JVH3 1UF0A 1P7EA 4CKEA 3AMZA 4HCPB 4IPDA 1WXVA 4A3LG 3FDTA 4FF2A 3QK0A 4BBRH 1UE7A 4FDBA 1VQHA 1A3VA 1JWSD 1IL8A 1VQCA 1TWHH 4ZLTF 2R7ZB 1FFVA 1WIAA 4RGOS 4AH6A 2BH2A 2WNMA 3AXCA 3DDCB 1O7ZA 3N1ZC 1VS0A 1L4DB 4W9KA 3BYYB 3BYTB 2NBWB 1LABA 3S17B 4KSKC 4C3IG 1BT0A 1QZEA 1WMHB 2ZCCA 1KOTA 1XMOL 2VZKB 3S1MB 1KAWA 1BMLC 3LYYA 4QJFA 1TWFH 3A9KB 5E6NA 2MJ3A 1YEZA 1EM7A 1V86A 3ZQ4A 1B8AA 3IAYA 3DBSA 2RQXA 2XBBC 4NXNQ 3APFA 1NBWA 3M4OH 2B2TC 1SNMA 1QB5D 2C9OA 4CDEC 3UI3A 3KF6B 1FGBD 1HQMC 4HEA1 2CH4A 2E3TA 1EY6A 1J8CA 2IX1A 2EDGA 2PW7A 1NAPA 5KNCA 5JAVA 2K04A 1QOGA 3Q3FA 3X3NA 4JI3Q 4IFDG 2YTXA 5IYCG 5D65A 1T0SC 2RD0A 2YEPB 3NRZA 4N58A 3V6EB 2JXTA 1HZ9A 3A4RA 5HURA 1HFGA 2PQEA 3ZNZB 4MHEA 1S5BD 2WB1B 1LO5D 3AEGB 1WTXA 2WYQA 1N36L 3L17A 2AYOB 4EE2A 1SYDA 3VYSA 2H1EA 3RR5A 3CCSA 4DHZB 3CMAA 1JRPA 1Y8PB 2ZCBA 4WWOA 4XDCA 1PH7A 3ZO5B 1WGKA 2DYMA 2YVCA 2Y5PA 4OELB 3LWEA 1E2WA 1UUPA 1V9PA 1LUZA 1E22A 2JEAI 1XCQL 5DAUA 5KYIA 3J80E 2JA7B 2KQSA 2F0FA 1KABA 3AE9B 1Z6HA 1UE6A 2K75A 1IL2A 1I50H 4MT5A 2KMMA 1P9DU 4M1UB 5C4XB 3DWPA 5IP7G 5EAYA 1YI2A 2N7DA 4A6QA 1OO9B 3F8TA 2LS01 1K53A 4FJYA 1K9MC 2NB0A 2BKRB 2MSED 1PH5A 3SHQA 3AEBB 3DEOA 2BYTA 3ERQA 4YSZB 4BXXG 1EY7A 2UYZB 2NVUI 1WTOA 4L2YA 4BY1H 3PRMB 1JMCA 2PEAA 2WXFA 1SE4A 3BU2A 3EQLC 3A8JE 1IBLL 4ANUA 1C4QA 3TEYA 1JWAD 4MNOA 2F1MA 4NMZA 1E2VA 1E90A 2XK5A 1WRIA 3NWTA 1TQOA 3S2HB 2K8HA 1Q82C 3PO3B 3P2BA 3QOLA 3RNBC 3O65B 5M3MB 3ZJYC 4GNXB 4AQYQ 2KACA 3R2TA 1WWTA 1SMXA 3KF8A 3VRAB 1KTKA 2G4SA 2FCSA 1ZKOA 4HVBA 1ESRA 4XXEA 2DHZA 5TR5A 2FXQA 5BR8L 1B7YB 1RODA 1VQOA 4B3RL 2KK8A 5DEHA 2MJEA 3H7PA 4CDDC 1WTRA 1YNXA 2JWUA 2LEKA 2W3RA 2N9XA 3ZRFA 3PIOA 4DR7Q 3J80L 1VQBA 5ELCA 4A3MB 1SIJA 1G6PA 3UDFA 2R2QA 3NVWA 2L8JA 4R8NA 3S15B 3CQZB 3I4LA 4JYAQ 4LF4L 4JV5Q 2CHXA 2EYHA 1Y69U 3IVFA 2RSUA 1JE5A 3VYRA 1QOBA 2F0NA 4GKKL 4TKOB 1UNSA 3A8IE 4IM2A 2IHFA 3HUIA 3SFDB 1LTTD 4W9GA 4GN4B 5E6PA 1OFFA 4X64L 2RSNA 1ZGUB 3BIID 1E0ZA 2F3VA 2LKVA 4ZHPA 1GKHA 2C7MB 1YHBA 1HUMA 1MKHA 4A3GH 4UP7A 5JHBA 1ZYRC 1STYA 3MXNA 2K1BA 3DHQA 4A3EH 1AYFA 1WZ3A 3AEAB 2VQFL 3T4AC 1IYVA 3GTLH 2L12A 4ANWA 4DGZA 2E5LL 2D3CA 2KDMA 4CKBA 1STEA 1ZXIA 4ZRQA 4DV4L 1TZ1A 4LFAL 4KY6A 4HEDA 1X65A 3HOXG 1MJCA 3QARA 4JOIA 2NVQB 4IALA 2KLCA 2OT2A 2UUCQ 2JA8B 3A74A 4FJZA 1TT5B 2DZIA 2K6DB 1BR9A 4GKJL 1K73C 4HDQA 3KBXA 3RZDH 2EMSA 5CHVC 1O78A 4ZHOA 3NWSA 4RM8A 2VXWA 3WA0A 4B95A 1HH2P 1BXTA 2KUMA 1KJTA 4CJ2C 1YHQA 3CAMA 4G7OC 5CV5A 2CS4A 1XYIA 1FCLA 3PUWA 4ZRPA 4OWXB 1HRJA 1AN8A 5CV7A 2Q2HA 3STBC 2RDBC 4DV2L 3T51B 5J22A 3PIP3 4C1NK 5M3FH 3HRZC 4IDIA 1I4QA 4R4CA 2JP1A 5EKIA 1K51A 2IY0B 2KA7A 4TV3A 3HKSA 3HOUG 2N49A 4OGQC 1SGHA 1A62A 2J7ZA 4A3BB 3F2UA 3DBHB 3FEWX 5K36G 4P1BC 4B9WA 4LNFA 3RNEC 3TSSA 4DR4L 3KJPA 5J1ZA 1MVKA 3Q6SA 3NEMA 2F0WA 4DUYL 4F87A 4PMCA 4X3SA 2ASBA 4PT5A 3A33B 3AV8A 2MPMA 1TWAB 3NG0A 4K7UA 3C46A 3AI5A 4OXPA 4X66Q 4LF6L 3FKIH 1TS2A 1QZGA 2I5MX 1YJ1A 1AP0A 2QCZA 4C2MB 3AFPA 1QQRA 1E24A 1EY8A 1SNDA 1Y1VB 2K03A 3BVGA 4J15A 5CHFA 4WJOA 2OJRA 4JI5Q 1LTAD 1N34L 4DK5A 1TKWB 1S3SG 2KLGA 2E74C 4IJHA 2R7ZH 4XYQA 1VZ8A 5JPNC 4NXNL 1K8GA 2VNUD 3CW2C 1C8CA 4W9DA 3K57A 3SDLC 3NVVA 3PZDA 2MBEA 2CWAA 2QJLA 5L37A 5FLMH 1HE8A 3NTHA 1X3PA 2NVYB 3CWIA 2D10A 4JI3L 1WCMB 2KX0A 1QCBD 3Q3JA 5IA7A 4C80A 1N32Q 2PTLA 3D8GA 3M3YB 1WGGA 3FP9A 1LT5D 1MHWC 1LACA 1Q8IA 1XNQQ 1C0AA 2QEXA 2V3NA 4TQ1A 1B50A 4GNXC 4LNQA 2Y0SE 1ACCA 4A3JG 4PYUA 2R2OA 5IYBH 1Q5WB 2EYMA 1RTNA 1QVFA 3KYHC 1V81A 2E2HB 1FNUA 3DVGY 3TEZA 4S3SA 1N60A 3EN2A 4A75A 2UXBQ 2KC2A 1C1YB 2Z8LA 3ZIMA 3EECA 1KLVA 3L54A 1YZ6A 1MBYA 3A5UA 3QR8A 4FADA 5C3EB 3K5LA 2VY3A 1C4PA 2NR2A 3AH7A 4XWWA 1LQBA 3HOZH 3Q3OC 3CPFA 5FO9B 4V190 2UUBQ 2KMCA 4IOAA 1ZXTA 4OO1I 3QX1A 2F4VQ 3N30A 2KYWA 3A7LA 4HCEA 4YSXB 1XXGA 3T9LA 4UAIA 2EVBA 4YHHL 2A1AA 3AU5A 4OO1H 2MJ8A 4E3CA 2G3QB 1EZ6A 3CC2A 3H0GG 1CTMA 2MLBA 3C0RB 1NI3A 4OW0A 4TKNA 3HG9A 1WTWA 2WP8J 4F8MA 4A76A 1YHAA 2JYOA 2LUEA 1N8RC 2JA7H 4YY3L 5E7NA 4DV1Q 2E2JB 2WX1A 4C1NI 4LUZA 5GXGB 4BY7B 1QNUA 4LNIA 1D5XC 3KLSX 4TSSA 5D14A 2L52A 4HK2A 4NAWB 5G5HA 2F3IA 3T1HL 3K5MA 1UD7A 1ZPSA 4R8IA 4GDLB 2KCMA 4AJWA 4EQPA 5FLXc 3E9SA 2XEWA 3VYUA 4DV7Q 5D3IB 3JAMc 4AQYL 4K7SA 1WM2A 5E6JA 4JI7L 4JLCA 3NUCA 2PW5A 4IFDJ 2V1YA 3ZLZA 2K1FA 1QT9A 2ZJDA 1J7CA 3VDYA 1L6VA 3PO2B 4RKLA 3RMHA 1GUSA 2UU9Q 4N6EB 4C4VA 2B2UC 4M01A 4YCWA 3B2GA 1TYGB 4GDKA 3M7GA 1VMCA 2VUMB 2B2YC 4DR7L 4AYBG 2IGHA 4J3OD 4A8XC 2LFIA 3HOVB 2IX3A 3W1SC 4ZUJA 5M3MH 4DR1L 5FR3A 3NS1A 3PMFA 3HM3A 4G3XB 2NMQA 4S0RA 5M5WH 1P1AA 4LJOB 4US8A 3I5JC 4KLKA 3W9CB 2MP2B 2KFKA 4MM3A 2K8BA 3LNNA 1L0WA 3F2DA 2XWJB 2QGQA 2KC1A 2JVCA 1C77A 3OSOA 1G2TA 3I4MB 4DAYB 5CMDA 4DV0L 2KBNA 3GTGH 1LGRA 2LVPA 3HIZA 1PRTC 1VQPA 1A70A 5IODA 4A3MH 3U30A 1DOLA 2ZM6Q 3BJUA 5G5GA 3S15H 3BVMA 3CQZH 5A35A 3RZOH 3VQIA 1QE6A 5LXIB 3RFZB 2ATWA 3X3MA 1HJPA 1DD2A 1ZDXA 2VZAA 1SROA 2BB5A 4JGHB 4BBNF 1TU2B 1QILA 4FF1A 1I4GA 2E8GA 2MNAA 3SK8A 1WFYA 3MAQA 1PGBA 1EUVB 2Y5CA 3PPAA 5IP9H 3T1YL 2DY7A 3WOFA 3WCQA 1UGMA 3MVVA 3IG3A 1JRUA 1NNXA 3U4VA 1M1KC 1WXSA 1Q7YC 3HOYB 4CGYB 3H9DA 1YVCA 4WQOB 1AZPA 5H92C 3U9OA 3SFEB 3K59A 3B1LX 4U673 1TKYA 4X62L 1ENFA 4JBWA 3SD5A 3ZJVA 2HCIA 5IOIA 3UF8A 5IWAQ 3ZNHB 1EZ8A 4L5QA 1S5FD 3MA2B 2WXLA 2I0QA 2JE6I 4TRDA 1WYWB 3QJYA 4BBRB 4DHJB 2R7FA 2CU3A 1TWHB 1GG3A 4MELA 5FJ8H 4ME5A 4B3TL 2JZ3B 2V3SA 5I2YA 2WXQA 3K9PB 2F0QA 2Q2UA 4K14A 3KDFA 1PGXA 4KN4C 1H9KA 2WKDA 1ZKHA 1YOVB 2G5DA 2D0OA 2L0CA 5BMGA 2ZW1A 4DK6C 5JEAH 1B44D 4DKAC 3OPOA 2Z0EB 2K5VA 4KZ0A 5EE9A 4A90A 2OTLA 3DBHI 1ILPA 1EU4A 2JEBI 3VR2A 4A3DG 4ICUA 2DNEA 5IT9c 1XPRA 1YJIA 4IWQA 2OHFA 4A3BH 1STNA 4R4OA 3P63A 2IWHA 1XMOQ 4W9LA 3B9JA 3J7ZC 2DJGC 2JYEA 2ZTCA 3R7QA 4MN3A 4XZ4A 3BDLA 2K22A 1MJDA 2N9LA 1KFYB 2K3UA 4FN2A 4N8FA 2B8GA 2D9UA 3ONAB 4XIGS 4CBVA 4P2CB 2JA5H 3TEHB 2VB3X 1CZPA 3AU7A 4UP8A 4CYEA 3CF5A 2C7NB 4O42A 2PPBC 4LK0M 3WWVA 2LMCA 1CSPA 4C2MH 2GBJA 4YXDB 3K58A 5E6OA 1WYDA 1F9QA 2KO3A 1SFOH 1SEBD 2MA9B 2JX5A 3KH0A 2G9DA 2WXNA 4KY5A 1NUCA 1JJ2A 2D0PA 3FPPA 3CD6A 2BVCA 2Z59B 3VUYA 1X54A 1GNUA 3CMMB 3J7A5 3I57A 1EQRA 1N36Q 1Q8KA 3NBIA 4P75A 1RWSA 5CHWA 1BCPD 1T5XD 2K4KA 3MWYW 5IY0A 3PIPA 3B08A 4GN3B 2Z1CA 3KLWA 1EEFD 4K5VA 1I50B 1KD1C 5EQ0A 3PIO3 1P8LA 4EZKA 1HR0W 1XNRL 3LX0A 2NVYH 1PZKD 1E7VA 2SAKA 2E6XA 2KDIA 4IM3A 3WAMA 1EQVA 1R9TB 2GA4B 1NYQA 3CHBD 3ULJA 4I6NB 3L0OA 3EROA 3TP6A 4R3DA 2EIFA 4WJNA 2B63H 2QSDA 5IAAC 2A6ED 3AN1A 3M62B 2B2WA 2F0OA 3KF8B 1JOKA 4APVA 1IW7D 4BY1B 2B2VA 4DNIA 3AEDB 3E9HA 1QG7A 1Y8NB 4Y7NH 2Z9HA 2F4VL 3T16A 1YNJC 2G45B 1SSNA 3H7PB 2B29A 3CCQA 3EBEA 4DV3L 4WIPA 2XRSD 2PZWA 2RDHA 2EOTA 4A55A 3J81j 2PE6B 2IW3A 2LXAA 3PGZA 3PUYA 1L1OB 4DR2Q 3QAQA 1SNQA 2N88A 2JZZA 2DWQA 3TDQA 2Q8RE 1IUEA 4QCLA 3IT4B 4YCVA 2Z4IA 4GLXA 4E74A 1IBLQ 1JOOA 2CW0C 3DPDA 5AZFA 2BWES 1CKNA 3R3OA 1G8ZD 4TMAB 5HHDG 2K5HA 2K05A 1WYGA 2PI2E 2VW9A 3A1QB 4GLSC 3ABVB 1PZID 2FHTA 1WJ6A 2HJ8A 1IPGA 1LTBD 4ABNA 2X38A 4F1SA 4DUZL 1NTGA 4LNOA 1Z2MA 2E2JH 3MXNB 5BR8Q 4ZYSA 5BN3A 4BY7H 1DGSA 1Q1OA 2KWCA 1E7PB 4MJSA 1KDAA 4QGUA 1YJNA 2GMIC 4GB9A 5LHY1 2IO0B 1SE2A 2N55A 2NVXB 1FNWA 4BOSC 5IYBG 2N7EA 5CV8A 4A3GB 5I6WA 1EL0A 3KUCB 1MIUA 2UWQA 1YQ4B 1IBML 3DBRB 4A3EB 3OLMD 2F3WA 1ISNA 1SYEA 1SMYD 1WX9A 1B9MA 3GTLB 2GB1A 2OEDA 4LTUA 1C9FA 3PRPB 4JBKA 1EEID 2WB1G 3PV0A 3K80C 4GKKQ 3I55A 3HRDD 4KIKA 4Z9CB 1R4PB 5CGKA 4KZCA 2KX3A 4FA6A 3N9YC 3W1GA 5C0XI 1SYGA 4X64Q 5AJ3L 1XQQA 1XLPA 1GM5A 5HGTA 2CJOA 5GADC 1YNND 2BF8B 3BZCA 4WFN3 3SK5A 2ZM6L 1S4ZA 4UHVA 4EVOA 2INNE 1P16A 3DUZA 3MFGA 1FJGQ 4DXFA 3S1RH 1EOTA 3JVZX 3A55A 4DV4Q 2CU1A 4LFAQ 2JA7G 3UDXA 2BQQA 3ULPA 1T0YA 3WDNA 2NBVB 5IGGA 2KCTA 1XTCD 3LGJA 4W9EA 1M90C 1FYCA 3I73A 4NPSA 3QB3A 2WIIB 2K32A 4AP4C 1E7ZA 5C4XG 2QF7A 1E2ZA 1E1OA 4EFOA 3MP9A 2AWNA 4GKJQ 4PZ7A 1F9RA 4HTHA 3DWGC 3D4WA 2L3ZA 1Z7TA 2LGYA 5C3JB 3PT2B 5BYSA 2FJ2A 3GQBA 5KYLA 4MGYE 5GQOA 2LXJA 2RDGA 3TREA 2R93H 1GJXA 5J17A 2KFJA 3UQAA 4A3KH 2JU6X 1VQ5A 3AM9A 2LSSA 2FCQA 3ZXVA 2BB6A 4DN4M 3CRLC 3HOYH 4MDKE 1PGAA 2M8SA 3PTFC 4DPGA 1EY0A 3PO3G 3FKIB 1HNXQ 4TVAB 1S1QB 4RMAA 5M3MG 1WD1A 2H89B 3RNAC 1CA6A 1W6JA 3M9BA 3HOWB 4DR4Q 4FYDA 4MSMB 2NBUA 2WAQB 2ONQA 4W9IA 1X3EA 1WE7A 4URKA 2OWOA 3R93A 1BQQT 4DUYQ 1GUWA 4UP9A 1YN3A 2ZXOA 4B3SQ 5HFYA 2K39A 4F88A 3Q8FA 3U52E 2FCMA 2EYLA 1TS4A 1XF5L 1FM0D 4LF6Q 4K0KL 3VH3B 4LLGM 4K6DA 3RLNA 2A5UA 3B0AA 1MHHE 1HZCA 4WQMA 1BCPF 2PPHA 1PTOD 4XYOA 1PH1A 4JBMA 3OW7A 4RGMA 4R9WA 3GP7A 4CHTB 4JI0L 1N34Q 2N1VA 2FIFA 1IBKL 4WH4A 1HNWQ 1VD2A 1V2YA 1X3GA 3I2ZA 1KDBA 5IP9G 3RNUA 4AS1A 4RHSA 1A3TA 1C4CA 2ZEQA 2KWDA 4KVGB 1IGDA 1ENAA 4A3PA 1YBYA 5F2DA 3NP8A 4BBSB 2MH7A 3I4NB 1L1OC 2WKCA 1ML0D 1EYDA 2WDQB 4N9F4 5LLIA 4DV5L 4M8MA 4HN7A 3UINB 2L15A 4IPGA 2F0MA 4V0BA 1W2BA 4HJ8A 5E1FA 3NVYA 1SE8A 5E4XA 5C3XA 3EFCA 4LDTB 5IYDG 2V4LA 3PF5A 5C5LA 1X3FA 4HPLB 4U68A 4GOPB 1D7QA 2BW2A 5ELEA 3OYYA 1NDDA 2QHOA 3P4PB 2MBHA 2JA8G 1E9MA 5L95C 3P1MA 3HOZB 3WANA 1FXIA 5FJ8G 1ZDVA 1A6XA 2NTSA 3QIAA 2C5LC 3J7YW 3EIVA 3T56B 1OEYJ 4GU2A 2F0VA 5KRUA 4MH0E 1EOVA 2B76B 3JYUA 2B3GA 4DAVA 3DM1A 2EZVA 4FXDA 1XD3B 3AE8B 2HJ1A 2XNAC 1XLNA 2DUDA 3PCOB 3IFTA 4GIVA 2INDC 3K9OB 4UPAA 3NUHB 1J6QA 5JEAG 2IYDB 1ZEQX 4LWCA 4DA2A 1LTSD 4HJAA 1VF7A 4A3IB 5A2QE 3R66C 1FL0A 5IGCA 5LMNW 2ES2A 1H9SA 2L32A 1HXYD 2PZTA 1GPXA 3HS0C 1ET6A 1GHJA 5KEEA 4A3BG 3RN9C 5LL6X 2KKCA 1F2RI 4YHHQ 1R9TH 1G91A 4O2DA 3M4QA 4BOZB 1SJED 1LTGD 2HE7A 5BYRA 2RCNA 2V4DA 2OQKA 4OX9Q 4YL8A 4KD4A 1MSGA 4FF3A 1LTID 1WJJA 4DR2L 4YY3Q 4YTNB 3NZUA 4GXBA 4BZAA 1C9OA 2IY1B 4DBGA 3T1HQ 2EYOA 4KJNA 2H5XA 2Z6KC 4MM3B 2V4IB 3RUIB 4S17A 2CCZA 3VRBB 4JI1Q 2KCCA 1WVLA 1UBQA 2BTEA 1IHZA 5FO8B 1FXAA 3BINA 1JC7A 1Y1VG 4IUTA 2YU9H 2LD9A 4ZRKA 2KQ3A 3SK6A 1UH6A 4JI7Q 2FFKB 3P75A 4KSLC 2ZXRA 2BA1A 5M5WB 4MSQB 3HZXA 1B70B 4QF4A 3RI7C 4KKSA 3DEPA 1R4NB 1TY0A 2KHWB 3SHLA 2JSOA 4JW0A 4BA2I 3QCAA 1RFAA 3RD4A 2WU2B 3RCZA 4AJYB 3UIOB 1CI3M 1CT1D 3G71A 1EIYB 3GTGB 1AE2A 1OTCA 3VR4A 3P4RB 2PVGC 1LTRD 3PUVA 4OONA 3ZYYX 3PQIA 3L9AX 5EBDA 1R4MB 2R7DA 4DR1Q 5A2QL 1PV4A 3RZOB 1WCMG 3V6CB 4ODGA 3FVQA 3ICEA 4BAXA 3TZUA 2IPKD 3CKIB 1AW7A 4IN3A 3PZ8A 1C4AA 2WLBA 1Y14B 2K5DA 3JSVA 1X9NA 5HI1A 2M19A 2DYOA 3OIPA 3GS2A 3NXWA 5D94A 2AQ1B 4JI6L 3ER0A 2IDYA 1N5WA 5T1IA 4ZQ3A 2B2TA 2ZNVB 4NJ7A 3DBRI 4DV0Q 1UAPA 2NVXH 3OMGA 5IGEA 4LAAA 4CKCA 4FP5D 3SVMA 2A69D 2WXKA 4YSYB 2SNSA 2YTVA 4O0AA 1VQ7A 2R92H 3CP0A 3I90A 5C44H 2LVQA 4FJVB 3ZTDA 4POFA 2PNHA 5CV9A 1FJGL 3GZNB 4HPPA 2LGXA 5I9OA 1TR5A 4L5RC 3SXHA 2JSVX 4X6AH 1I42A 3SK4A 5C3EG 1PFNA 3LWUA 1OEYA 3ML8A 3T1YQ 1Q1BA 3KDFB 3BY4B 3V3XA 1Q12A 2KANA 4LK1C 3IXSA 2JYTA 4WWMA 5FLXE 2BYFA 3IHPC 3NZSA 4X57B 4IKGA 4WURA 5BYQA 2D5DA 4C3JB 3G7LA 2B3AA 3MJWA 2HIVA 1FFUA 2LJ5A 3APDA 1RFKA 4JIOU 1SNOA 1I7HA 3NOBA 4X62Q 2AQ3B 2KN5A 3GTOB 3TRZA 3S14H 2JA6G 2MCNB 4G7ZC 2Z4HA 3UE0A 4BY7G 1A15A 1G6JA 1PTOF 3GTPB 3AMUA 4M8AA 1QOAA 3NPPA 4R1JA 4K3CA 2I5HA 3Q23A 3MHBA 1WGHA 1YIJA 3NVZA 2J4XA 1V9JA 2N3SA 3RYTA 3L2PA 1DZ1A 4B3TQ 2KVZA 1WFQA 3L13A 1HNXL 2KEEA 3PF4A 1SRUA 3IL8A 3RD2A 1HTQA 1EY5A 1UWXA 2PJHA 2HD3A 3QWZB 4GOPC 5M5XB 5C4JH 2NZ1D 1LM8B 2LGDA 3V60A 3DHHC 4HSPA 1MSHA 1RL2A 1IKMA 1RJTA 4LNKA 5KNBA 1YD8U 2EPBA 4G4KA 1ZP0B 1T0RC 1SDFA 1WGYA 1AE3A 3J80i 1STBA 3PO2G 3WALA 1WD0A 5ELDA 4B3SL 3U9SA 1PVOA 2JA5B 2K5PA 3A9JA 3VFKA 5DPWA 2VUMG 2DAJA 4Q2JA 3T3NA 5C0XG 3BK2A 1DGJA 3HOVG 3AE3B 4PQXA 3NY5A 3N52A 2OEOA 2UU7A 4ZRZA 4OZAA 1HTLD 2HDEA 5IO9A 5C5MA 1SFOB 4JI4L 5FLXL 1U0LA 3HOWH 4W9FA 3RZFA 2R6GA 2RA4A 4OIJA 2PVOD 3U2SC 1NMGA 4RCNA 1GUTA 1KRHA 4BFRA 2SOBA 2F0IA 5JJZA 5C4HA 1HNWL 1VDVA 1PDXA 2VH1A 1XTDA 3R3MA 1I6HH 1HNZL 1WM3A 3I4MG 2DLBA 1UZXB 2F0SA 4G11A 4GSWA 4ARIA 4K5XA 3J80c 2ON8A 1FRDA 2VZKD 3ITPA 3P1HA 3DHIC 3ERSX 2KD0A 1KNEA 4XQQA 1Q86C 2NN6I 3OOCA 1SF0A 4J6IA 2AEHA 2ZT9C 2PE9A 2NUCA 2NN6H 4F8CB 4P73A 1PFBA 4JC0A 3D0FA 1B9NA 5I2XA 2O6VB 2DNFA 1A0IA 2B63B 1U9RA 3QO2A 3HP3A 2WXGA 2JJQA 1X6OA 1XWEA 4EQNA 4QIWE 2BGFA 4KDLB 1FNVA 3ZNGC 2MEKA 4PK1A 3JC66 2WS3B 1V8CA 5JJIA 4HKZE 1X1MA 1NENB 3HOYG 1IBXA 3Q2AC 4ICVA 1VQDA 4BBSH 1A2UA 2K33A 4H44C 4LF5L 1XNRQ 4Y7NB 3I4NH 2PI2A 1J7AA 1HZ5A 4KX6B 4WJWA 1BCPB 2ACZB 4W9HA 3I3CA 1OXXK 1VQAA 2TMPA 4R4IA 2AUKA 3W5OA 1E7UA 1KLUD 2KWVB 3W1YA 3ZNID 1CKNB 4WRDA 2G9HD 3K7UC 3PHXB 3TCAA 2MO0A 3OWEB 1LV9A 5JVG3 4BBRG 4P72A 2KDFB 1C7YA 4GLVB 1WMHA 3AE6B 4M00A 3DWQA 3RN2A 1V6EA 5IT9E 4EGVA 4ID6A 1XLQA 4IUMB 4OHJA 3A9KA 2KZRA 3ECIA 3A54A 3H8HA 2A74C 4MJSB 3JAMi 3RNGC 3OIQA 2L00B 3QHTA 2UXDL 1XLOA 4DV3Q 1D8LA 1HUNA 1PLFA 2GBKA 4OX9L 5JZEB 2ZNVC 3U4ZA 1JICA 2QA4A 3KF6A 4YTMB 5KNDA 3HGBA 1F2ZA 3Q3NC 3GO5A 5KHQA 4A3IH 2GRIA 1AH9A 5IGBA 1PFMA 1SN8A 1VQEA 3KOJA 4KJOA 2JPHA 2KNBA 2LI5A 4NNJB 5C23A 3WAOA 4HIOA 2PMZE 1R4QB 2NVTB 3N6RA 4JI1L 4EZLA 3VTWA 1AWDA 3FILA 3N32A 2SNMA 5KIXA 1EF1A 1EYAA 1HCZA 1BUIC 4FULA 2MO1A 2WV6D 1YQBA 3BG3A 3QOJA 1OGWA 5EKKA 4DUZQ 3D32A 4DDGD 3D4RA 3U50C 4FXKC 2E2DC 3N20C 4BKGA 1HZAA 4XYCA 1VQ4A 3Q8AA 3KBGA 2QDBA 3PUXA 4CDFC 4R4TA
chains in the Genus database with same CATH topology
1YNTE 2LGIA 3FPUB 3V2TA 5EE1A 2V0GA 1PDQA 2W54A 4E6IA 5IT9L 1QLBB 3S1RB 3HKZB 2RMMA 3GV6A 1SYCA 2NYZD 3ND8A 3P4QB 1OXUA 4NZLB 1RCVD 5BMIA 2LY7A 3FRPB 4RF0A 1SYBA 1W6KA 5I6YA 3HVDA 2L5TA 3TP5A 5IOCA 2EY5A 2PW9A 2JXMB 4L23A 5JPMC 2R93B 3AEEB 1H9JA 4A3KB 4B0EA 4KKJA 3VA7A 1GB1A 3KWLA 1LT6D 2KQ4X 4US9A 5AUIA 1QOFA 2EYPA 2E76C 2Y0SB 5FO7B 3IKJA 2SEBD 3TBIB 3C1EA 2HTME 4G57A 1K8OA 1A2TA 3DXJC 2TSSA 3AE1B 2O5IC 2W82A 4ITKA 1Y1WB 2WXIA 4IZ8A 4KD3A 3Q69A 2B2WC 4B9XA 3L7ZC 4XE0A 4WORA 2Y3AA 1N63A 4C7ZA 1DJRD 4A3JB 1I3QB 2L11A 2FBWB 2IGGA 2EYJA 1GUNA 1NYRA 1B1ZA 1BBXC 1G6ZA 5DM73 3OHXC 1L0VB 1CHQD 1MHXA 1EIHA 1DONA 4A3FB 4FF4A 1BCPC 5EBCA 2PMVA 2PIAA 1PRTD 2MJDA 2BS3B 3ZJTA 3QWNA 2LJIA 1SJHD 1XO3A 1MI2A 3I70A 3GTQB 1E6EB 1LLRD 3H0GB 1VDZA 1PTOB 5LL6S 2SDFA 2F03A 4HSVA 4IOIE 1D2BA 3SR6A 1SE3A 1IW7C 4KV6A 4ZUIA 2B2YA 1E10A 4PV1C 1O80A 5I9PA 5IIFA 5I4DA 1CJEA 4J1MA 4RGNA 2DBYA 5JOBA 4JWSC 4KI0A 4H0LC 4K2KA 1JE4A 2KOLA 1RYJA 4RKBA 3P42A 2WDRB 5BN4A 2BE5C 1E0BA 3VR3A 3FC4A 4XTCS 3I91A 4A9AA 1GAQB 3HEJA 3IFDA 4XT3B 2XVSA 4ARCA 5AUKA 3SEBA 1RTOA 2PZUA 4HRSA 1ZXHA 2IT1A 4DK1A 1I4RA 1HQRD 3NS1A 1CQVA 4KMUC 1V1PA 2PKOA 1O7YA 3J9CA 3KQ4A 1LT4D 3IAS1 2K01A 4HAEA 1OXTA 1CM9A 1GXDC 5C0XJ 1TKEA 2K5QA 4BWGB 2YU9B 2OF1A 2A6HC 2KAJA 2EY1A 5ISRA 1B3AA 4IUNA 5FK9C 1TS3A 1KDCA 4Q0FA 4RNAA 1EWYC 1JMLA 1H9RA 2B8FA 4QUCA 3KWVA 1DXMA 1YNNC 2EXZA 2MHVA 4DU9A 3S2DB 4IUPA 1YN4A 2BA0A 4ZAIA 3NZ3A 4REZA 2DNCA 3S16B 3KUPA 3NK9A 4FVMA 2INPE 4QUFA 2Q5WD 4HMJA 3I9V1 3ETRA 3BDCA 3RLFA 3K7AB 1ONLA 3M4YA 4RGTA 2R92B 1CHPD 5E4WC 5C44B 2PYKA 4L6TB 2DN8A 3SE0A 1HFNA 2A73B 1N61A 3NQTA 3G6JB 3GD7A 2L55A 1FRRA 4WAFA 1HA6A 3W5UB 4KKTA 4DQOC 1HZ6A 1YNJD 4OO1G 3AE2B 5K36H 2WXMA 4B0MA 2F0UA 1T5EA 4DAPA 3S14B 4DFAA 4CJ1B 4C3HB 1CQFA 4P6VF 4IURA 2N7JA 3TEWA 1JWMD 4ZK9B 1EIGA 2E75C 1C48A 1BF4A 2LUMA 1CK1A 1JALA 2D5GA 4JPSA 1EY4A 1PTOC 3TP7A 3H09A 1L0YB 1PRTF 2J42A 5C4JB 2WINB 3PZ7A 4RAUC 3D31A 1Q90A 3IT6B 1EWHA 3URYA 4USAA 4LJZC 4PMBA 1NEKB 1FD6A 5EE0A 4NKLA 1Q3LA 1TS5A 2BT6A 2MP1A 2K0PA 1RF2D 2L4NA 1GUGA 1EY9A 4K2LA 3MJ5A 1XCTL 2WXPA 1OQRA 4J8QA 1RM6C 3E0JA 1JROA 1ESFA 1TT2A 1I6HB 2AWOA 2BS4B 2H4OA 2I2YA 3KLRA 1F2RC 1WTVA 2QKIC 2AUJD 2EJGC 4HCSA 3Q8BA 1B4OA 2D2CC 3W3AA 4KTAA 2RPVA 3TN2A 2ZXPA 1VF5C 4NDXA 1OXSC 3J7AV 2A68D 1B53A 3CIRB 5H8YE 3CU7A 2NWGA 4KY7A 3B2FA 3Q24A 3P7JA 4RWSC 1PTOH 1BO0A 3NTIA 4K5WA 4TQ0A 1V8QA 2MGSA 1ZOYB 2QEJC 1DOXA 4C3JG 1YN5A 4PNYA 4HJGE 1CFMA 1HTPA 1L0XB 2M9VA 4RHRA 3FILB 2WU5B 1Y56A 2WXRA 1FR3A 1MGSA 1IYUA 4DF7A 1WSPA 3ZJUA 1DOYA 1BNZA 4GDKB 1STAA 3VR8B 2KCNA 1JORA 1VZ6A 1FIQA 2I07B 3MXUA 3NQIA 4K8IA 4M0WA 4FXGC 1KLGD 2F0TA 1V1OA 3D4DA 3O13A 3Q8EA 1C76A 2WXJA 2HQEA 2KN4A 2A69C 5DNFA 1U4RA 1JOQA 1L4ZB 4DNTB 2HUGA 4JK1C 4KN7C 1VRAB 3E6ZX 4QMGA 4DXGA 1U4LA 5CV4A 4H2AA 2PCFB 2L9HA 4RFBA 5NUCA 1PUTA 1I4PA 2WP9B 3AE7B 4JX1C 2K6AA 5C3WA 1K50A 4P16A 3MXPA 4H13C 1MI0A 4DK0A 3CRKC 2H88B 3LB8C 3OMCA 1J9OA 2F0HA 4BS9A 1FCCC 5ELBA 1JQYD 3KLSA 1OXVA 2DY8A 4G7HC 1SNPA 1QNKA 4A93B 4L63B 1VR9A 4N9PA 4LMQD 2Q8TA 3L3OC 3LXFA 4OVZA 1QKZA 2FMMA 5T8IA 2L1BA 1EFID 2IX0A 1F9SA 1UEAB 4X3KA 1I4XA 1TKGA 3A7AB 4DNRB 4XDXA 4YWGG 3GB1A 4XQNA 2L1AA 4C3IB 1VLBA 1M4VA 1L5PA 4Q5VA 1I6VC 4C56C 3P4SB 2QMTA 3BK1A 3MTSA 3H3VC 3QG1A 1II3A 3NBHA 1RDPD 2L83A 2IJ0A 3JAME 4OL7A 5T1GA 1YMHE 2N9KA 3EUB2 2IL8A 3H91A 1VCIA 2EELA 2FE8A 1L6UA 5EGTA 2F0PA 3EFXD 4JE3B 1FD7D 5CBAE 5MPOA 4FNFA 3S1QB 3GV3A 2FUG1 4FO2A 2R61A 1BDOA 2I38A 2MUYA 3RUZA 1B2TA 1TVXA 1FMAD 1UWMA 1PZJD 5HG2A 1BOSA 1PFDA 4KHVA 1NR4A 2BDNA 3FMCA 1QOHA 4RCOA 2BS2B 2X6GA 1K52A 4MIUA 1T3QA 2LMCB 3RPFC 1Q10A 3K0YA 2OXPA 4RH6A 2A5HA 1ZYRD 4ILWA 5EKLA 4IUQA 3ZGZA 5J39A 3R8BA 1PMRA 3C3LA 1K83B 1NR2A 1PRTB 3K6OA 4XWTA 4I65A 3JAML 4FXCA 5G3LD 1CA5A 2NBFA 3K5NA 2QILA 4QB4A 1SSOA 1RKNA 4NP5A 2BBCA 2F0KA 2PNRC 4MH8A 2XN9C 3C8YA 2C5CA 1V1PB 5FOBB 2HDMA 1TZOA 4NW2A 5COYA 1K8MA 3AECB 1D1KA 5K5PA 1TY2A 1Z47A 2V3PA 4KKUA 4KGTA 3AE4B 2VB2X 4KK7A 2G1EA 5JXVA 1KAAA 1F0ZA 1QWYA 1U4PA 3T3OA 2X6LA 1P7FA 5BN5A 1O7LA 1ENCA 2CHBD 3BS1A 1AZQA 1UGJA 3AE5B 3MFYA 4D2KA 3S9WA 4K8JA 1Q1EA 4HROA 2AX5A 1M8AA 1VJKA 4ZOHC 5CORA 2K5WA 2BOSA 5CV6A 2EE1A 3SR1A 1WTQA 4NAMA 3M7NA 1U4MA 3L4PA 2J52A 2F0DA 1WXQA 1RHPA 3HOXB 4KGRA 1PXUA 2F0LA 1N62A 1EU3A 3E5SA 1VZ7A 2XIWA 2F0EA 2KHSA 3A8KE 2J0TD 3D6WA 1S5CD 3P20A 1QF6A 3FAHA 1F2LA 2EY6A 2JA6B 2F4IA 2KJXA 2NTTA 1VMPA 2M00A 3M85A 2RKSA 4HMIA 5IGDA 1I4HA 1JCKB 4KHZA 4EQOA 2EKIA 3W5VB 3ND9A 2O4XA 1KF6B 4RF1A 2EY2A 4L1BA 5CYUA 4C7YA 3HOUB 1PYWD 1V43A 4XDDA 1DM0B 1QJOA 3NSWA 2N0SB 3PUZA 2CVRA 1HHVA 5BMHA 5JEAJ 4KGSA 1N5XA 1ROEA 2WDVB 1KNAA 3BVZA 3U4EG 2QIEB 2K28A 2X69A 5D3DA 2E2IB 5D7GA 2QCPX 3VYTA 2ENBA 5TSSA 5C4ZA 1J7BA 1YJJA 2J53A 3V96A 1STGA 2CJNA 2WXHA 3BWUD 1OQQA 4QIWB 1DOKA 1BUVT 4I7ZC 3R2IA 4OZBA 5LNK1 4IUUA 1ZUD2 3PO0A 1STHA 1DYQA 2EJMA 1HEZE 3W2DA 2XRQD 3MZ5A 2CQAA 4JWUC 3VA5A 3J7AF 3E56A 3NTKA 1X32A 4OIKA 1D5MC 1G2SA 5IGFA 1D6EC 2B39A 2K7VA 4OZCA 2B2VC 2O2LD 5G3LF 1J8IA 2XWBB 4IFDI 1AEXA 3VR5A 3WOEA 1GB4A 4CQNA 1S5DD 1FEHA 1XEEA 4IFDH 3IAM1 2WACA 3EGRA 1TWGB 3I72A 3SDZA 1HA5A 2BCOA 2ICIA 3A56A 4HR7B 1HPCA 1KH0A 2LFNA 3OWFA 5EPJA 1TWCB 1ET9A 3D3RA 3VR9B 2KEDA 2M2LA 2PMZB 2YEPF 3TZDA 1TWFB 4XT1B 2IGDA 1F9PA 2RBMA 1EQTA 5CBEE 3Q22A 2A6EC 1DOMA 3M4OB 2B2UA 4NJCA 3D6CA 5C2TB 5E3FA 1WTPA 3W1SA 1R7SA 3MC0B 1H9SB 3V05A 4B08A 2ID0A 1TIID 4C3HG 2FMCA 2RVLA 3EA6A 2KECA 3HVZA 2XSCA 4TQUS 5EPKA 4X3TA 3AB9A 3DWMA 2D62A 4IQZA 3DMUA 5ELFA 4AYBB 3AB5A 3Q8CA 1GUOA 5CC4A 4IUVA 2PLPA 2W3SA 3U7ZA 1IGCA 3H94A 3I8ZA 3GTJB 1NCVA 4H7BA 1EYCA 2F0GA 1SAPA 1NSNS 1GHKA 1G291 1ICWA 4XQJA 3AEFB 4ZKCB 2GI9A 5AFWA 2K9XA 4PMWA 1SMYC 3GTKB 2ICEC 1RD9D 5M5YB 1JWBD 5M9OA 3MXGA 2HCCA 4YT0B 4ZKBB 1AFPA 2F0JA 2HDLA 2FINB 3TMEA 1ILQA 3TP8A 1D4BA 2NN6G 4N59A 1CZWA 1IKLA 1ZE3D 1T6BX 4ULLA 2LHEA 1D5ZC 4L8JA 5EJWA 2YYZA 4HKQA 3K5OA 2RSOA 2LHDA 1C78A 1DOIA 1CZGA 1MPEA 1XX8A 2BE5D 1SBBB 5DM63 5EE3A 1JW9D 1SB3C 3GTMB 2EJFC 3TEXA 4F7XA 4J6HA 2EYFA 2R3ZA 4UDUC 5C6AA 1YQ3B 1SXTA 2JZPA 1SNCA 1B9RA 1F77A 2M56B 2WXOA 1FO4A 4A3DB 4YTPB 1F2MA 2BDOA 2ZW0A 1H9MA 3DWAA 3T13A 2A6HD 3UI2A 1MD2D 1C79A 3S1NB 2CW0D 4YIJA 1LT3D 1SYFA 5FKAC 2WQYB 3NE5B 5C0XH 3EVQA 1A3UA 3J81E 3RZDB 2Q8IB 4X3UA 2JQRB 3TUOA 3BDOA 3C1FA 2M0AA 1GOZA 4MACA 1Y8OB 3EJIA 1JWUD 5KGUA 3MEHA 5M3FB 5CR3A 1JQ4A 2KVMA 4CJ0B 1TJEA 3Q0AA 1JR0D 2A68C 4BA1I 4K6LA 3NHHA 3KK7A 5EPLA 3H6MA 4DAYA 2PO4A 4AQ7A 2RDFA 3T53B 1EWCA 2O5JC 4RA8A 3BZDB 3C2PA 1DCZA 1X3QA 1JB3A 1F2YA 2AQ2B 3VR6A 1V97A 1S5ED 4GZYC 2I46A 2W55A 1IBXB 1NVID 4O1NA 3MHZA 3J81L 1D1IA 4N9TA 5JVH3 1P7EA 4CKEA 3AMZA 3FDTA 4FF2A 4ZLTF 1FFVA 1A3VA 1JWSD 1IL8A 2R7ZB 4RGOS 2WNMA 1O7ZA 1L4DB 3BYYB 3BYTB 1LABA 3S17B 4C3IG 2VZKB 3S1MB 1BMLC 3LYYA 2MJ3A 1EM7A 3ZQ4A 3IAYA 2RQXA 2B2TC 1SNMA 1QB5D 2C9OA 3UI3A 1FGBD 1HQMC 4HEA1 2E3TA 1EY6A 2IX1A 2EDGA 2PW7A 1NAPA 5KNCA 5JAVA 2K04A 1QOGA 3X3NA 4IFDG 3NRZA 4N58A 5D65A 2YEPB 2JXTA 5HURA 1HFGA 2PQEA 4MHEA 1S5BD 2WB1B 1LO5D 3AEGB 1WTXA 4EE2A 1SYDA 3VYSA 2H1EA 1JRPA 1Y8PB 4XDCA 1WGKA 2DYMA 2Y5PA 3LWEA 1E2WA 1UUPA 2JEAI 1XCQL 5DAUA 5KYIA 3J80E 2JA7B 2F0FA 1KABA 3AE9B 1Z6HA 4MT5A 2KMMA 4M1UB 5C4XB 3DWPA 4A6QA 1OO9B 2LS01 1K53A 2NB0A 3AEBB 3DEOA 2BYTA 3ERQA 4YSZB 1EY7A 1WTOA 4L2YA 2WXFA 1SE4A 3EQLC 3A8JE 1C4QA 3TEYA 1JWAD 2F1MA 4NMZA 1E2VA 1WRIA 3NWTA 1TQOA 3S2HB 3PO3B 3QOLA 5M3MB 2KACA 3R2TA 1WWTA 3KF8A 3VRAB 1KTKA 1ZKOA 1ESRA 4XXEA 1RODA 2MJEA 5DEHA 1WTRA 2JWUA 2LEKA 2W3RA 3J80L 5ELCA 4A3MB 1SIJA 4KKIA 3NVWA 4R8NA 3S15B 3CQZB 3I4LA 2EYHA 1Y69U 3VYRA 1QOBA 2F0NA 4TKOB 1UNSA 3A8IE 3HUIA 3SFDB 1LTTD 1OFFA 2RSNA 1E0ZA 3BIID 2F3VA 2LKVA 4ZHPA 1HUMA 1ZYRC 1STYA 3MXNA 2K1BA 3DHQA 1AYFA 3AEAB 3T4AC 1IYVA 2L12A 4DGZA 2KDMA 4CKBA 1STEA 1ZXIA 4ZRQA 4KY6A 4HEDA 2NVQB 4IALA 2OT2A 2JA8B 1BR9A 3KBXA 1O78A 4ZHOA 3NWSA 2VXWA 1BXTA 2KUMA 4CJ2C 4G7OC 5CV5A 1XYIA 1FCLA 3PUWA 4ZRPA 1HRJA 1AN8A 5CV7A 3T51B 5J22A 3PIP3 4C1NK 3HRZC 4IDIA 1I4QA 1K51A 2JP1A 5EKIA 2KA7A 4OGQC 2J7ZA 4A3BB 3F2UA 3FEWX 5K36G 4B9WA 3TSSA 5J1ZA 1MVKA 3Q6SA 2F0WA 4F87A 4PMCA 4X3SA 4PT5A 3AV8A 2MPMA 1TWAB 3C46A 1TS2A 1AP0A 4C2MB 1QQRA 1EY8A 1SNDA 1Y1VB 2K03A 3BVGA 1LTAD 1TKWB 2E74C 1VZ8A 4XYQA 5JPNC 2VNUD 1C8CA 3K57A 3NVVA 2QJLA 3NTHA 1X3PA 2NVYB 3CWIA 1WCMB 1QCBD 4C80A 2PTLA 3D8GA 3M3YB 1LT5D 1LACA 1Q8IA 2V3NA 4TQ1A 1B50A 1ACCA 2EYMA 1RTNA 2E2HB 1FNUA 3TEZA 4S3SA 1N60A 2Z8LA 1MBYA 5C3EB 3K5LA 1C4PA 3AH7A 4XWWA 5FO9B 4V190 1ZXTA 4OO1I 3A7LA 4HCEA 4YSXB 1XXGA 4UAIA 2EVBA 4OO1H 2MJ8A 1EZ6A 1CTMA 1NI3A 4OW0A 3HG9A 1WTWA 2WP8J 4F8MA 2JYOA 2E2JB 4C1NI 5GXGB 4BY7B 1QNUA 5G5HA 1D5XC 3KLSX 4TSSA 5D14A 2L52A 4NAWB 3K5MA 1ZPSA 4R8IA 4GDLB 4EQPA 3E9SA 3VYUA 5D3IB 5E6JA 3NUCA 2PW5A 4IFDJ 1QT9A 1J7CA 1L6VA 3PO2B 4RKLA 3RMHA 1GUSA 4N6EB 2B2UC 3B2GA 1TYGB 3M7GA 1VMCA 2VUMB 2B2YC 2IGHA 4J3OD 4A8XC 2LFIA 3HOVB 2IX3A 4ZUJA 5FR3A 3PMFA 2NMQA 4US8A 3W9CB 3LNNA 2XWJB 1C77A 3OSOA 1G2TA 3I4MB 5CMDA 1PRTC 1A70A 5IODA 1DOLA 5G5GA 3BVMA 5A35A 3VQIA 1QE6A 3RFZB 3X3MA 1DD2A 1ZDXA 2BB5A 1TU2B 1QILA 4FF1A 1I4GA 3SK8A 3MAQA 1PGBA 2Y5CA 2DY7A 3WOFA 3WCQA 3MVVA 3HOYB 4CGYB 5H92C 1AZPA 3U9OA 3SFEB 3K59A 4U673 1TKYA 1ENFA 4JBWA 3ZJVA 2HCIA 1EZ8A 1S5FD 3MA2B 2WXLA 2JE6I 4TRDA 3QJYA 4BBRB 2CU3A 1TWHB 4ME5A 5I2YA 2WXQA 2F0QA 4K14A 1PGXA 4KN4C 1H9KA 2WKDA 2L0CA 5BMGA 2ZW1A 5JEAH 1B44D 3OPOA 5EE9A 4A90A 1ILPA 1EU4A 2JEBI 3VR2A 2DNEA 1YJIA 2OHFA 1STNA 3P63A 2IWHA 3B9JA 2JYEA 4MN3A 3BDLA 2K22A 2N9LA 1KFYB 2K3UA 2B8GA 2D9UA 3ONAB 4XIGS 4CBVA 4P2CB 2VB3X 1CZPA 3AU7A 4O42A 2PPBC 4LK0M 2LMCA 4YXDB 3K58A 1F9QA 1SEBD 2JX5A 2G9DA 2WXNA 4KY5A 1NUCA 3FPPA 3I57A 3NBIA 1RWSA 1BCPD 1T5XD 3MWYW 2Z1CA 1EEFD 4K5VA 1I50B 5EQ0A 3PIO3 3LX0A 1PZKD 2SAKA 2E6XA 1EQVA 1R9TB 2GA4B 1NYQA 3CHBD 3EROA 3TP6A 4R3DA 2QSDA 2A6ED 3AN1A 2B2WA 2F0OA 1JOKA 4BY1B 1IW7D 2B2VA 3AEDB 1QG7A 1Y8NB 3T16A 1YNJC 1SSNA 4WIPA 2XRSD 2PZWA 2RDHA 2EOTA 4A55A 2IW3A 3PUYA 1SNQA 2N88A 2DWQA 3TDQA 2Q8RE 1IUEA 4QCLA 3IT4B 2Z4IA 1JOOA 2CW0C 3R3OA 1G8ZD 4TMAB 5HHDG 2K05A 1WYGA 4GLSC 3ABVB 1PZID 2FHTA 1LTBD 4ABNA 2X38A 5BN3A 4ZYSA 1E7PB 1KDAA 5LHY1 1SE2A 2N55A 2NVXB 1FNWA 5CV8A 4A3GB 5I6WA 1EL0A 1YQ4B 4A3EB 2F3WA 1SYEA 1SMYD 1C9FA 1B9MA 3GTLB 2GB1A 2OEDA 4LTUA 1EEID 3PV0A 3HRDD 4Z9CB 1R4PB 5CGKA 3N9YC 5C0XI 1SYGA 1XLPA 5HGTA 2CJOA 1YNND 4WFN3 3SK5A 1S4ZA 4EVOA 2INNE 3DUZA 3MFGA 4DXFA 1EOTA 3A55A 3WDNA 5IGGA 1XTCD 1FYCA 3I73A 3QB3A 2WIIB 2K32A 2QF7A 1E2ZA 3MP9A 2AWNA 1F9RA 4HTHA 3DWGC 3D4WA 1Z7TA 5C3JB 5BYSA 2FJ2A 3GQBA 5KYLA 2RDGA 1GJXA 2JU6X 3AM9A 2BB6A 4DN4M 3CRLC 1PGAA 1EY0A 3FKIB 1WD1A 2H89B 1CA6A 1W6JA 3HOWB 4FYDA 2WAQB 2ONQA 3R93A 1BQQT 1GUWA 1YN3A 2ZXOA 5HFYA 3U52E 4F88A 3Q8FA 2EYLA 1TS4A 1XF5L 1FM0D 4LLGM 4K6DA 4WQMA 1MHHE 1BCPF 1PTOD 4XYOA 3OW7A 4RGMA 4R9WA 3GP7A 4CHTB 4WH4A 1KDBA 4AS1A 4RHSA 1A3TA 1C4CA 2KWDA 1IGDA 1ENAA 5F2DA 3NP8A 4BBSB 2MH7A 3I4NB 2WKCA 1ML0D 1EYDA 2WDQB 4HN7A 4V0BA 2F0MA 3NVYA 5E1FA 5E4XA 5C3XA 5C5LA 4U68A 2BW2A 5ELEA 3P4PB 1E9MA 3P1MA 3HOZB 1FXIA 1ZDVA 1A6XA 2NTSA 3QIAA 3J7YW 3T56B 2F0VA 5KRUA 2B76B 4DAVA 3DM1A 2EZVA 4FXDA 3AE8B 2XNAC 1XLNA 3IFTA 3NUHB 5JEAG 1ZEQX 4DA2A 1LTSD 4A3IB 1VF7A 5A2QE 2L32A 5IGCA 1H9SA 1HXYD 2PZTA 1GPXA 3HS0C 1ET6A 1GHJA 5KEEA 5LL6X 1F2RI 1G91A 1SJED 1LTGD 5BYRA 2V4DA 4KD4A 1MSGA 4FF3A 1LTID 4YTNB 2EYOA 4KJNA 4MM3B 2V4IB 3VRBB 2KCCA 1WVLA 2BTEA 1IHZA 5FO8B 1FXAA 1JC7A 4IUTA 2KQ3A 3SK6A 2FFKB 3P75A 2ZXRA 2BA1A 5M5WB 3HZXA 4QF4A 4KKSA 3DEPA 1TY0A 3SHLA 2JSOA 4BA2I 3RD4A 2WU2B 1CI3M 1CT1D 3GTGB 3P4RB 3VR4A 2PVGC 1LTRD 3PUVA 3ZYYX 3L9AX 5EBDA 5A2QL 3RZOB 4ODGA 3FVQA 3TZUA 2IPKD 3CKIB 1AW7A 4IN3A 3PZ8A 1C4AA 2WLBA 2K5DA 5HI1A 2M19A 2DYOA 3OIPA 3GS2A 3NXWA 2AQ1B 2IDYA 1N5WA 5T1IA 4ZQ3A 2B2TA 1UAPA 5IGEA 3OMGA 4LAAA 4CKCA 4FP5D 3SVMA 2A69D 2WXKA 4YSYB 2SNSA 3I90A 5CV9A 5I9OA 1TR5A 3SXHA 2JSVX 3SK4A 1PFNA 3LWUA 1Q1BA 3V3XA 1Q12A 3IXSA 4LK1C 4WWMA 2JYTA 5FLXE 4IKGA 4WURA 5BYQA 2D5DA 4C3JB 3G7LA 1FFUA 1RFKA 1SNOA 1I7HA 2AQ3B 3GTOB 4G7ZC 2Z4HA 1A15A 1PTOF 3GTPB 3AMUA 4M8AA 1QOAA 3NPPA 3Q23A 3MHBA 3NVZA 2J4XA 1DZ1A 2KEEA 3IL8A 1EY5A 1UWXA 5M5XB 2NZ1D 4HSPA 1MSHA 1IKMA 1RJTA 5KNBA 1ZP0B 2EPBA 4G4KA 1SDFA 1STBA 1WD0A 5ELDA 2JA5B 3U9SA 2K5PA 4Q2JA 3T3NA 5C0XG 3BK2A 1DGJA 3AE3B 4PQXA 3N52A 2OEOA 4ZRZA 4OZAA 1HTLD 2HDEA 5C5MA 1SFOB 5FLXL 2R6GA 2RA4A 4OIJA 2PVOD 3U2SC 4RCNA 1GUTA 1KRHA 2SOBA 2F0IA 5JJZA 5C4HA 1VDVA 1PDXA 2DLBA 2F0SA 4ARIA 4K5XA 2ON8A 1FRDA 2VZKD 3ITPA 3P1HA 1KNEA 4XQQA 2NN6I 3OOCA 1SF0A 2ZT9C 2NUCA 2NN6H 1PFBA 1B9NA 5I2XA 2B63B 1U9RA 3QO2A 3HP3A 2WXGA 1XWEA 4EQNA 1FNVA 2MEKA 2WS3B 1V8CA 4HKZE 1NENB 1IBXA