1I4RA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.5
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4rA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4rA02
3BYTB 4UDUC 1SXTA 1S5BD 2QEJC 1L0YB 1F77A 4TSSA 1EEFD 2NTSA 1AW7A 3GP7A 3W2DA 5ELDA 1GOZA 1G8ZD 3MC0B 1LTRD 4RGMA 1M4VA 1I4QA 1EU3A 1UUPA 1YN4A 1D5MC 1JWUD 1V1OA 1TS5A 1MD2D 1LTAD 1PTOH 2G9HD 4RHSA 4RGOS 2ICIA 1D5XC 1LT6D 1PRTF 1T5XD 1EU4A 1YN3A 2IPKD 2SEBD 2QILA 2NTTA 3DWPA 4RH6A 4NZLB 1PRTC 1EEID 3BVGA 3MFGA 1ET9A 3DWQA 1LTGD 1PRTB 1V1PB 5D3IB 1LTSD 3EA6A 4RGTA 1LLRD 5FKAC 1B1ZA 1JR0D 1BCPF 1DJRD 4C56C 1PRTD 1SE2A 1SJHD 1TY0A 3BYYB 1SJED 4DXFA 1LO5D 4RGNA 2J4XA 1XTCD 1BCPC 1PZKD 5ELEA 2R61A 3OWEB 1BCPB 3V05A 4BWGB 1DYQA 1LT4D 3O13A 3URYA 3CHBD 4RHRA 1SE3A 1HQRD 1YN5A 3SEBA 1AN8A 1BCPD 1KLUD 5ELFA 4RCOA 4OHJA 1LTID 1FGBD 1PZID 1STEA 1I4PA 1EFID 5FK9C 1LT5D 1D6EC 4Z9CB 1CK1A 3BVZA 3DWAA 1JWSD 5ELBA 1CHQD 1JCKB 1CT1D 1PTOF 2WV6D 1JWMD 1FNVA 1ESFA 1LTTD 1CHPD 4O1NA 1B44D 4DXGA 1HXYD 2AQ1B 1TS4A 2RDHA 1FD7D 1S5FD 1D5ZC 5I4DA 1PTOB 2AQ2B 1UNSA 4L63B 2XRSD 1HTLD 1PTOD 1RF2D 1I4RA 1KLGD 3BZDB 5D3DA 1EWCA 1RDPD 4RFBA 1LTBD 1RD9D 1TS3A 3KLSX 1BXTA 1KTKA 1V1PA 3R2IA 3R2TA 4K6LA 3BVMA 3TSSA 1ENFA 1TY2A 2IJ0A 5ELCA 1I4XA 4L6TB 1I4HA 1XXGA 1S5DD 2TSSA 2XNAC 3EFXD 1RCVD 5TSSA 2AQ3B 2RDGA 1FNUA 1SE4A 1JQYD 2XRQD 2O2LD 1HA5A 1PYWD 1ET6A 1S5CD 1QILA 2CHBD 1L0XB 1TS2A 1FNWA 1PTOC 1S5ED 1SBBB 1I4GA 3R8BA 4ZYSA 1LT3D 1PZJD 2XN9C 1CQVA 1SEBD 2Z8LA
chains in the Genus database with same CATH superfamily
4IN3A 4L5TA 2BB5A 2JZPA 3DVGX 5IO9A 4C7YA 2F4VQ 2HE7A 2DBYA 4M8NA 3RUZA 4KMUC 4ZDVA 4A9AA 4JI0L 2JQOA 4DV7L 3D6WA 3KJPA 4DR2Q 3K9PB 3DVNV 2Q2TA 1Q1BA 2D2QA 3PIP3 1TS5A 1JOOA 1MD2D 3L9AX 1HHVA 2UU9Q 1Y69U 1HNXQ 4JI6L 2E2IB 1Y1WH 3FILB 2JA5G 3IAM1 2KHIA 1YNNC 2NTTA 5EE9A 3MC9A 4PS3A 2DGYA 2B63B 1RRBA 2WXFA 2ZPYA 2NUCA 1R4PB 1EEID 2R93G 1MSHA 1WTWA 5C0XJ 3RLOA 2RDBC 4QB4A 2WAQB 1LTSD 3WWVA 3A9JA 2O5JC 4USAA 2NVYB 2K28A 3U8ZA 4CJ0B 4C56C 3VUXA 5GQOA 5JHBA 1TY0A 4BBRG 3H8HA 2IWHA 3OAWA 2K1BA 1SJED 1Q86C 3HRDD 1U0LA 4A20A 1BBWA 4O42A 5I6WA 2BDNA 4JI2L 1MVKA 1P1AA 3KQ4A 3RNEC 3OWEB 2LXKA 4A3KB 2JWUA 4JPSA 1K52A 3J7AF 2EVBA 1A0IA 3AEDB 4LUZA 2FFKB 3Q3OC 4A3DB 3HOXB 3OIPA 1XMQQ 3CF6E 4GS3A 3OMGA 2EZVA 4C3JB 3J81j 1T6BX 3Q0AA 3K80C 1S1QB 3Q8EA 1CK1A 1GB4A 4XE0A 1L6UA 3EROA 4FF1A 1WM2A 2Z6BA 3FHWA 2DYBA 1FMAD 4X3KA 2ASBA 3L0WB 2E2IH 4R4QA 2XVSA 5H1SE 4FF3A 4F87A 1SNPA 4DR6L 5BMGA 4HKQA 2A6EC 2OEOA 1PH6A 2MWSB 4IW0A 2V1CC 4BBNC 4OWWB 2BOSA 1YJJA 2K5NA 2BA0A 4LMQD 2KWDA 4LDTD 1PDXA 3H7SA 2MUYA 5C4JH 3CCEA 1W3SA 4GSWA 4K6DA 2XRSD 3NTHA 4HJAA 1PFDA 2WHIA 3T3OA 2K8BA 4MH0E 5LMUQ 3P4RB 1R9TH 4GKJL 4J6IA 5L83A 4DR1L 1F2RC 3SXHA 3PO2B 1BUVT 3BVMA 4LF5L 4HCEA 1E8ZA 2HJ1A 2PQAB 4XDCA 2EYHA 2EJMA 4IOIE 4JBMA 3E56A 3HS0C 4A3KH 5FLXE 2DLBA 1V5OA 3VAWA 1GAQB 2LMCB 4NB3A 1WVLA 2YEPB 1XCTL 1G6PA 1LTLA 5IA7A 3DWGC 1CSQA 4I7ZC 1FNWA 4KN7C 5FO8B 3QIJA 1FL0A 2B2VA 5LMNQ 1RTNA 4C3JH 2JA8B 3S16B 1IYFA 2VW9A 2WLBA 1B3AA 1U9RA 3D32A 2MJ8A 3KYCD 1CQVA 2Q8RE 3HKZB 4KY5A 1KJTA 1YNND 3CCMA 2L1BA 1VQ7A 1L4DB 1TIFA 2ZPNA 1F77A 2K32A 3NSWA 3M4PA 2VUMB 1RIPA 1IP9A 3BDOA 1LUZA 2QA4A 2KN4A 1T5EA 1GC7A 4DV3Q 1VQIA 4A3FG 1WTQA 2MSED 1E1OA 2WXKA 3N1XC 1B3QA 1MFWA 1R4QB 3HGBA 4MM3A 1XO3A 2JY6A 2KOXA 2K50A 4A55A 3ENEA 4X64L 2DY8A 2FJ2A 5AJ3Q 5IP4D 1LTAD 4A3GB 2O6VB 3ZJVA 2OQKA 4OO1I 2WAQE 3CRLC 4LF7Q 2BBCA 1IBLL 3C2PA 3K5MA 4WQMA 3ZDMC 5J2RA 4KDLB 1T0YA 2ZJQA 2R7DA 5IYCG 2UXBL 2C5CA 4MHEA 1E7PB 2FCNA 4HVBA 2KJXA 1EIYB 3W1YA 1PRTC 3RLFA 3FP9A 5C4XH 4CKBA 3CCVA 3GTJB 3OPOA 5C5MA 2L55A 4GOPC 1JT8A 4IFDH 1YIWA 4OVUA 5FKAC 1N33Q 4HWIB 3J9CA 4ZRKA 1BO0A 3JVZX 1DGSA 4DK5A 2Z6KC 3UDXA 1HNZQ 1QZEA 3IRBA 1H9JA 1KRHA 4IM2A 2KX0A 3WOEA 1WCMG 2BYEA 3AEFB 2M0XA 3A4SC 1PZKD 2B2VC 1YJNA 1X3FA 4RA8A 2Z0DB 4PZ8A 4K0KL 2K33A 3VYUA 2NVXB 1KOTA 3A74A 5IT9L 2A6ED 2IX0A 4KHZA 2CHZA 1ZUD2 3MAQA 2BH8A 3PGZA 1ISNA 4FLHA 2ZW1A 4M00A 1WWTA 1K3RA 3T4AC 1B70B 1HZCA 5I9PA 4OEMB 2VUMH 4A93G 3OJ4B 5AUIA 3DWMA 1GB1A 2F0EA 1D6EC 4K8JA 5CMDA 3CCSA 2L8JA 1WZ0A 3H09A 4EQPA 3C3LA 5ELBA 3T53B 1VQ5A 4N9PA 3MWYW 3DPDA 2WV6D 2OXPA 3JSVA 1P9DU 2LUEA 1EY9A 3HHMA 1KF6B 2NPTB 4I6LB 1HXYD 1PMRA 2LVPA 5JJZA 3L0OA 5M5XH 4RCNA 2WU2B 4Q2JA 4U673 2F3WA 1BR9A 3CKIB 1EF5A 4YSZB 3PGEA 2F1MA 3AE7B 1XJVA 5M3MH 3SD5A 3GTJH 1I3QB 1VQ6A 3NS8A 1DOLA 1I50H 2KMMA 2IO3B 1F2RI 2KUMA 1D3ZA 2NBWB 5D7GA 4B9WA 3VYSA 2P5ZX 1RYJA 1X56A 1I4RA 4F88A 3QG1A 1S3SG 2F0DA 2YU9B 4JOIA 2FUG1 2LWPA 3R2IA 1WI5A 2PZTA 2ZM6L 1HR0W 2XWJB 4X3TA 1PFNA 5EBCA 4WH4A 4DFAA 4B3RL 4KKJA 2JJQA 4DR7Q 1WYDA 1VZ8A 2G45B 4MGYE 2NVXH 3HKZE 4A3MB 5K36G 2DAFA 5C23A 5C0XG 1X3EA 4NXMQ 3ZJTA 4DN4M 4B0MA 4L5QA 1VDVA 3EIVA 3UINB 2JYOA 3W5VB 5CX3A 1K0RA 3C1FA 1SXTA 1C76A 4HK2A 4WJNA 3S1NH 1VQKA 1P7FA 3HZXA 2KQ7A 2JX5A 5GROA 1AW7A 3D4DA 3W1BA 4GN1A 3H91A 4C4VB 4DNRB 2M4NA 2F4VL 4N6EB 5IN7A 2KACA 3KF8A 1XTDA 2IW3A 3OSOA 1HZ9A 2B3GA 4BY7B 4DV5Q 2NS5A 2B29A 1EY6A 4RGOS 4QQBX 2G9HD 4DR2L 4XGAB 4L5SA 2DZJA 4OO1H 2DZKA 1AH9A 2YU9H 3ALBA 2F0FA 1HNXL 4PT5A 4JOIC 3H94A 5LXHA 1MG4A 2RHQB 2ATWA 3BVGA 1VQ8A 3CC2A 3ONAB 3IXSA 1WF9A 1E0BA 1E9MA 1IKLA 2DJGC 3QOLA 2L0FA 5HFYA 1TZ1A 2UUBQ 2WYQA 4G0NB 4A3PA 4OZCA 5FO7B 1N32Q 1IZ6A 1XLOA 3TMEA 1HE8A 1Q0WB 1STGA 2KFKB 1VJKA 4A3MH 3BYYB 4KK7A 1MPEA 4S3SA 1JROA 2CWPA 1LGRA 3QA8A 1E2ZA 5J22A 5C3EB 4ARCA 3OTOQ 4BOZB 1TU2B 4H02A 4P75A 1J8IA 4ZUJA 1EY8A 2J53A 3OW7A 5ELEA 3U4ZA 2LRWA 1WD1A 1WTRA 3URYA 1SNOA 3TREA 1CZPA 2CKHB 1HQRD 5IODA 3ML9A 3ZDTA 3I70A 4KKUA 4MZ9A 4A76A 4A90A 2M00A 4RCOA 2N7EA 1TKEA 2MA9B 1FGBD 2WACA 1HZ6A 2K01A 4R1JA 1NJIC 2BT6A 2ZW0A 3P2BA 4IC7B 3RNBC 4WAAA 3A9KB 1KDCA 1VS0A 4CBVA 2KCMA 2I1KA 2JXTA 4K7WA 1FCCC 2JA7G 1PGBA 1WZ3A 1GUOA 2DZMA 4M0WA 2JA6B 1XMQL 3DBHB 3VHTC 2K6AA 1G91A 1V86A 1EOTA 2PW7A 1ZDVA 3DDCB 3QX1A 2KWCA 5G2NA 4PQXA 1S72A 3HVZA 4EGVA 3NTKA 3BY4B 3DQVA 1GNUA 2K5WA 4RF0A 1YITA 1FJGQ 4MT5A 4K1RB 3G6JB 4LUOA 2JPHA 1TS4A 2XK5B 2BH2A 3W1SA 3ZUNA 1JMLA 3RNGC 5C44G 2BS3B 2N0SB 2QSDA 2V3SA 2IGDA 1J8CA 2KVZA 1Z47A 5A2QE 4RM8A 3KLWA 3S17H 5AZHA 3ZVVA 3ZJUA 3RNAC 1OXTA 2CH4A 1N5XA 3CCUA 3H3VI 1RD9D 1SNCA 1V1PA 4C2MB 4ZQ3A 5D65A 2NVQB 5LMUL 5D2MB 3IBEA 3PVLA 3HM3A 3EFCA 3RYTA 1SAPA 3CSTA 1RCVD 4NPNA 1RKNA 4JCVE 3ZGZA 1SE4A 1WGDA 3A4RA 5BYRA 2CHBD 5DEHA 2LGDA 2UUCQ 3NTIA 4DNIA 3DM1A 2FAZA 4I6NB 1Q8KA 5DAUA 2WU5B 1GPXA 1TKWB 1I4GA 3R8BA 1YQBA 4C3IH 3T1YQ 5IP9G 1PZJD 1SEBD 5EJWA 2K04A 4WAFA 2JA6H 1LXDA 1NYRA 1Y56A 2CJOA 2WNMA 5LMNL 3NJTA 2F3IA 4JIOU 2J52A 2CQOA 4XZ4A 4HEDA 4N59A 2RQXA 3KBXA 3CD6A 4P16A 5DM73 1L0VB 3DBSA 2Z9HA 5JOBA 2W54A 2F0MA 1IL2A 4YTNB 3VR2A 1NI3A 1SIJA 3W1SC 3JC66 2KMAA 1ZE3D 4A8XC 1ICFB 1JWUD 4H13C 3CAMA 2EY5A 4DV3L 5JJKA 3PZ8A 3E6ZX 3P20A 1T5XD 2NVTB 1EU4A 3EQLC 3PUVA 2JSOA 5C3WA 5KYIA 1YI2A 2KVMA 1XLNA 2FCSA 2QCZA 2L4NA 3P4QB 1XNQQ 4MSQB 1IGCA 3K5LA 3I2ZA 1C3TA 1EOVA 5I6YA 2MBHA 3Q3FA 3MXNA 3NWTA 2IO2B 5EPKA 4LF7L 3RNUA 4C2MH 1VMPA 4A75A 2JWZA 3ETRA 3PSIA 2NVQH 4A3CG 1C8CA 2WGSA 1FD6A 1SLJA 2GB1A 2AX5A 2LJIA 4P1BC 2GOWA 2J0TD 2BKFA 4ZOHC 2EIFA 1EY0A 2CH4W 2KNBA 4N8FA 1HUMA 2IO1B 3TEWA 3HG9A 1N33L 3VR3A 3S1MB 1WFYA 1HQMC 3K5NA 2LRUA 3QJZA 4KIKA 4GKKQ 3HOUG 3T16A 4ZLTF 1BCPC 1OXVA 1B50A 4HMIA 1HNZL 2EE1A 4RHRA 4MSMB 4HJ9A 2ZTEA 1YN5A 4BKSD 3DVNU 1AN8A 1D7QA 1QNUA 2GBMA 2C7MB 2XGTA 1RHPA 2F0UA 3GTPH 4REZA 1FXIA 2KBNA 2JEBI 1EFID 4B3TL 1QNKA 1IBKQ 4PV1C 5G55A 2ZXOA 3T51B 1XLPA 4Z9CB 4RMAA 1XYIA 4LK1C 2WP8J 3A54A 4JGHB 4BY1B 1SB3C 2CS4A 1YJ9A 1YIJA 3K7AB 3D6CA 3NP8A 4G3XB 3NENA 4PNYA 3QB3A 2V3NA 4L8JA 3WIMA 3CW2C 2BCOA 3TBIB 2IX3A 2HD3A 2CU1A 1UEAB 5E1FA 2A68D 3JYUA 3FILA 1U4AA 1B9RA 5IWAQ 1JORA 3KLRA 2Y5PA 3GTLH 1KLGD 2BE5C 4AIMA 1EY5A 2QEXA 2KENA 3VH3B 2G4DB 2F0TA 3H3VH 5CV8A 5IYDG 2PEAA 3S1MH 3AEGB 5EE3A 2LJ5A 1ENFA 3GTOB 3SK6A 4DR6Q 5GMVA 4HJ8A 4JI5Q 3WAOA 1QOFA 1J5EL 3P75A 4B3SQ 2IO0B 1JQYD 1TJEA 3Q23A 4DR7L 2O2LD 2JZZA 4FP5D 2PMVA 3SK4A 4HJ7A 3RZOB 1B8AA 2A73B 2CKZB 1S5ED 1SBBB 1C78A 4FXGC 1L4ZB 2DNCA 4ZYSA 1Y8OB 2G5DA 1FXAA 2D11A 4W9EA 4F1SA 2NR2A 1DOXA 4GKJQ 4CHTB 4PMWA 4NXML 1OEYJ 4EX5A 3J80c 3BYTB 2UUAQ 3F1ZA 2NZHA 1QCBD 3VTUA 2K0PA 4ILWA 1STYA 4MJSB 1MBYA 3P4PB 4A3JG 3LYYA 4NJCA 3AE8B 1Y1VH 1PFSA 1EQVA 1D5MC 4JW0A 3UDGA 1WFQA 3IFDA 3J81E 4DAVA 2G4SA 1TBEA 2Y5BB 4HPPA 1GUAB 2ICIA 2JF5A 4KY7A 1MHWC 1TWCB 5M5WB 1DONA 2M0AA 3L08A 1Q10A 4LNKA 5G5HA 2BS2B 3MHSD 3PS6A 2QIEB 3R66C 4DV5L 3B1LX 3RLNA 4BBSH 4XXEA 2INCC 3HOVG 4X62Q 4TQ1A 1GJXA 2RMMA 1HCZA 4TV3A 3CPWA 4I6PA 1BQQT 1XNRL 1LQBA 4ZHPA 1VQJA 1ET9A 1ZYRD 4A3LG 3JAME 3SFDB 2CU3A 3EA6A 4HCNB 4OGQC 4FF2A 3AEEB 3GTKH 2R7ZG 5T1GA 2VL6A 4I65A 2X6GA 3I4MH 1Q82C 3HRZC 3FRPB 3MJWA 1WYWB 2VY3A 2ZZPB 4HEA1 3S24A 2UUBL 4FJYA 3ULLA 2JEAI 4IPGA 1C9OA 1VMCA 1N32L 4W9IA 2WDTB 1MG8A 1XTCD 1G6JA 1IHZA 4B3MQ 2V4LA 3SDLC 3HOYG 3NQIA 2K5DA 3PT2B 2LMCA 3OTOL 3NBHB 4CDFC 1DOYA 1NMFA 1VQFA 3S15B 2E8GA 2N9PC 3VXWA 2ZJRA 3ZRFA 3L7ZC 1C79A 4YWGG 4IUMB 5BN4A 1HUNA 4NDXA 3VDZA 5D14A 3OLMD 4RMFA 2N78A 4ZYNA 1ZXTA 3FKIB 2BE5D 3DWAA 4HIKA 2PYKA 1C9FA 1QVFA 3PV1A 1NSNS 2R3ZA 1IW7C 1WR6E 3WAMA 1HPCA 5M5WH 2ONQA 4PK1A 4DK3C 1HZ5A 1IBXB 3VR5A 1K28A 4DPGA 1VCBA 3U30A 1VQBA 2J0MA 2O6VA 2RPQA 2UU7A 1NE3A 1TWAB 2E75C 4GDLB 1ZGUB 4ZCKA 1FJGL 3FPUB 2JYEA 2D9UA 1X54A 4A3EB 1XX8A 1Z7TA 1DD2A 3S14B 4IOCA 1E10A 5JEAG 1EY7A 2OOBB 3BZDB 2NYZD 2B8FA 3DCGA 2J0JA 1XMOL 4OVVA 5HGQA 5JVH3 1TQOA 2J7QB 3M9BA 4EE2A 3AE2B 3GTMH 4L23A 5KNCA 3ZQ4A 3DLLA 1I4XA 2K14A 4L6TB 2KHWB 1XXGA 3QR8A 3PF4A 2LVOA 4ICVA 2A4ZA 2BPSA 3TUOA 2OF1A 4QMGA 3UIOB 2V4IB 1N36Q 3S15H 2Q5WD 3VR9B 3TQYA 2E5LL 3Q8AA 1HA5A 3Q8CA 4XX5A 2I2YA 5M3FB 1VR9A 2MQHA 2EYPA 4J15A 5CBEE 4FNFA 1XF5L 1VQLA 4OW0A 4EUTA 2KC2A 1H95A 3N9YC 1I7HA 4PYZA 1KNEA 3SR1A 2KDMA 4JI4Q 2WFWA 1EYCA 1WTVA 2XN9C 4HSVA 3OMCA 1V1OA 3KF6B 2UUCL 1WJUA 2LI5A 2YTXA 3FKIH 3MP9A 3I91A 3WA0A 5LL6X 4YWKA 1V9PA 1Z9FA 5J1ZA 4B3RQ 3LB8C 3T1YL 4C3HG 1GJZA 2EJFC 4R4CA 2K1FA 1EZ8A 4BKGA 1HTQA 4RGMA 2REXA 2KDIA 1FEHA 1FYCA 4IG7B 5CV9A 1YN4A 1N6ZA 3M62B 4B95A 3KJOA 4LWCA 2AL3A 2EXDA 2Q8TA 2WDRB 3T13A 2C9OA 3AE5B 4A3EH 1JMCA 2WWZA 3LX0A 2EOTA 3MA2B 3RN2A 3ZRCA 3S14H 2BTEA 2JXXA 4JI8Q 1YN3A 5BYSA 1DOIA 3MXPA 2R93H 1EWYC 2GMIC 4A3BG 3H0GG 4PMBA 4CQNA 4RH6A 3HOWG 4KZCA 1STNA 4F8CB 1PA6A 1XNQL 4TQ0A 2D62A 1J9OA 3MVVA 4FXCA 4BBRH 4B6WA 2LXAA 1FFUA 1JR0D 2I1JA 2R92G 4KVGB 2OEDA 3P4SB 1WSPA 3HKSA 3SE0A 5FR6A 4K5VA 3CCQA 4H44C 1CKNB 5M3FH 3TEYA 2B2TA 3DBRI 3GE3C 1J7BA 2K8HA 1VZ7A 4JLCA 4II2B 1QF6A 2NVUI 2C5LC 3QARA 4IFDJ 4BFRA 1J6QA 1V8QA 3CHBD 4ALPA 2D3BA 4GKKL 2VB2X 1YD8U 2W3RA 3NZUA 4WJQA 5ELFA 2RSOA 4OHJA 3F2DA 1STEA 2HHHL 1EM7A 3ZXRA 1MJDA 3NG0A 2WDVB 5CGKA 3CIRB 1ILQA 1EY4A 5C4JB 4HCPB 4QAYA 2H88B 1YMHE 4M8MA 2QC8A 3KLSA 1L5PA 5KHOA 4K2KA 1IBKL 1GD7A 2I46A 1R9TB 1ESFA 1A2TA 1CHPD 2IDYA 2IT1A 1O78A 1I42A 2ID0A 1ZDXA 3U4VA 4FADA 4LF6Q 3MHZA 3LNNA 2PJHA 2K5PA 3DUZA 2A8VA 4NAMA 1R7SA 1CI3M 2RKSA 3IFTA 2DX5B 5C3XA 2HTHA 3TEXA 2ACZB 4EZKA 4XIGS 1HFGA 5EDSA 5JZEB 4CGYB 2B2UA 2WXLA 1HTLD 1I5FA 1RF2D 1JE5A 2CQAA 2WB1G 4CJ1B 1PH9A 1BVSA 1U4MA 1N62A 4AYBB 5JVG3 2AKWB 3CQZB 2A19A 4JQWC 4FHKA 5IWAL 1SYDA 3R2TA 2Q8IB 3I63C 4DR4Q 1AEXA 1UE6A 1DOMA 2IL8A 3GV6A 4K6LA 2MEKA 3KUZA 4ZK9B 3ZTDA 5EQ0A 3ND9A 2B2TC 4KD3A 4QUCA 3FEWX 4XQQA 1EQQA 1OTCA 2KFKA 1E90A 3DOWA 3KH0A 5C0XI 1EUVB 3B9JA 1MIUA 2B3AA 4AUQC 5GAHC 1FNUA 4V0BA 2XRQD 2ZVNA 3S2HH 2V0GA 1EIFA 2KECA 1T0QC 3CCJA 4QUFA 4JI5L 5GAEC 2MRPA 1PTOC 2F0SA 1JB7A 4HJGE 4B3SL 1Y1WG 1FRRA 3RMKC 1SDFA 3M4OH 5DCNA 2WXGA 2JQRB 2G1EA 1MSGA 4YY3L 3AEBB 2WKCA 2ALYB 4XT1B 3VA7A 1L2FA 2ZCCA 2ES2A 1QOHA 4A3FH 3A9KA 5E3FA 2O4XA 3UE1A 4OZBA 4MDKE 3I4OA 2A74C 4NMZA 2UUAL 3S1RB 5C4XB 3I3TB 4ZRIA 3TIXA 3ZXVA 3MZ5A 1JOQA 4KKIA 2JZ3B 3I72A 3T8MA 4K7SA 3F2CA 4CHKA 1RTOA 5E4WC 2N4FA 5LHY1 1RODA 2PMZB 3C19A 3OIQA 5IYCH 2XK5A 2B2UC 1KHIA 3AI5A 3RNFC 2FHTA 1GUSA 4UP9A 4EZJA 3CQZH 1UAPA 2LZ6A 1VRAB 1PH5A 4P6VF 3U7ZA 4DBGA 1Q46A 1CZGA 3MFGA 3PO0A 2V1YA 1PFMA 1LTGD 1SNDA 3A0JA 1IBML 2PE6B 1IXRA 4KV2A 1AE2A 2QF7A 3AU7A 4DK0A 4X62L 3CMEA 5BYQA 3KOJA 4ZRQA 1SF0A 1M94A 4IPDA 1F1HA 2RHSB 2LVQA 1UGMA 3PHWB 4XYOA 1QVGA 4IQZA 4XQNA 1C4PA 1WX9A 3I9V1 3PPAA 2MW5A 4RG1A 1J7AA 4LNFA 1SE8A 5JPMC 4YSYB 3AXCA 2D3AA 4W9JA 1V6EA 4L5RC 1TGZB 1TTNA 3DEPA 5M5XB 4AOFA 2B63G 4OWTB 1NR4A 1K83H 3RD4A 2F0IA 4EQOA 1PH3A 1FVIA 4FO2A 4B3ML 1XQQA 1YX6B 3KWVA 5J17A 3D3RA 2KVRA 5EAYA 2HQLA 5AZFA 2Y0SB 2RA4A 2WAQG 5M3MB 3S1RH 4RKLA 1F2ZA 1I50B 4R4TA 2JXMB 4BA1I 2KFJA 2E2HB 1WJNA 2WXNA 4F7XA 3BZCA 2FE8A 1A2UA 1E7ZA 3Q14C 4G11A 2B8GA 5C6AA 3AE4B 3MEFA 4WJWA 3NK9A 2BF8B 3L3OC 3J7ZC 4LDTB 5DNFA 4AYBE 4A3KG 3W5UB 1NMGA 1FRDA 3AU4A 3E9IA 2ASQA 4LK0M 3BDCA 1NR2A 4YWMA 3PIO3 3B6YA 4A3DG 3HOXG 4B3TQ 2BA1A 2I07B 1SRUA 3UQBA 3EECA 4P71A 1PTOD 4JBKA 3NXWA 3WCQA 1QZGA 3ZNID 3A8KE 2RPVA 5AZGA 3TEZA 2CFMA 1TWHH 4WJOA 2MGSA 3M7NA 2K3UA 1YVCA 4LW1A 3M4QA 3KFUA 1KQSA 5ELCA 1P8LA 2ZJPA 3S1NB 1A3VA 2EY1A 3Q24A 2NBFA 3RZFA 3EN2A 2ZXPA 3AN1A 4PZ7A 5C0XH 1HNWQ 1BBUA 1DXMA 3P42A 2N1VA 3D4WA 4KTAA 1WIAA 1IYVA 4ARIA 4HCSA 1I94Q 4LUVA 1L0XB 4YIJA 1TS2A 1F2LA 3F2UA 2OCEA 2SDFA 1SFOB 1N36L 1UELA 3A1QB 4JWSC 3KWLA 5IT9E 3L16A 1SYFA 1HR0Q 5DPRA 4ZRJA 3Q3MC 1PH8A 3S1QH 4JV5Q 2E2HH 2IGHA 4LF8Q 4ACFA 2KCTA 5EE0A 4JBWA 3PO2G 4JI4L 2PMZE 3V3XA 4EKUA 1GOZA 4IFDG 2GBJA 4GN3B 1J5EQ 1M4VA 1CJEA 1WJJA 1N9WA 1WGYA 2AEHA 2LGYA 3HVDA 4YXDB 4P72A 3U9SA 3M95A 4LAAA 2KOLA 4MH8A 1IL8A 2B2YA 3TP7A 3SK8A 3CWIA 2VQFL 1LT6D 4BA2I 4AQYQ 1VD2A 4YHHQ 2JA8G 4YTPB 1EFWA 2LEKA 5IGEA 5CV7A 4XQJA 2PNRC 3D0FA 4QL5A 5TR5A 3HKZG 3GTQH 5JPNC 3PTFC 4K3BA 4H2AA 4JI8L 4W9DA 2EKEC 1NBFC 3ABVB 3ECIA 1L7YA 3KDFA 3IHPC 1X6OA 1LLRD 2VUMG 1K8AC 2QJLA 1KM7A 1CSPA 1DJRD 1PRTD 1NTGA 2K6DB 1C0AA 3NHHA 1CA5A 4ABNA 3Q3NC 4RAUC 4M8AA 2KMCA 2LY7A 2DUDA 2RCFA 4LF9Q 3Q2AC 3IL8A 2J0KA 3ZNGC 2YV5A 4A3GG 4ANUA 3R3MA 3BJUA 2AWNA 1T9HA 2N9LA 2Y0SE 4LJZC 1SFOH 2ZNVB 2L11A 3EC8A 3K6OA 4B08A 2BDOA 3SEBA 1XNRQ 1KABA 3ZYYX 3RNCC 1JJ2A 1WXAA 1YQ4B 3ZO5B 2JVCA 3N1ZC 1STAA 4CKEA 5LLIA 1OXSC 4NW2A 3L54A 2A6HC 4QCLA 4ICUA 1JICA 3UI3A 4PMCA 3S17B 4IO9A 1KD1C 4C1NK 4BXXG 1ZXHA 3RR5A 3T1HQ 1UD7A 2AL6A 5J39A 1JWSD 2B76B 2INNE 3ML8A 4NPSA 2CR5A 5IIFA 4MJSA 3ZIMA 3PQIA 1CT1D 2B2YC 2MJ3A 2DY7A 4KHVA 4DQOC 4UP7A 2CCZA 5C44H 2FCMA 1G291 4DHJD 1TIID 1QG7A 5FLXc 1EQTA 1FD7D 3H15A 1II3A 4YL8A 4YCVA 3J80L 3Q69A 3DM3A 4WFN3 3ND8A 1ASZA 4LF6L 2GBKA 2W9NA 2X8XX 5C3JB 1F9SA 2PCFB 5LNK1 1UNSA 4NJ7A 1Q8IA 5ISRA 2NBVB 1HZAA 1RDPD 4DUZQ 1SGHA 2BYFA 2EMSA 2KTFA 4FHJA 3OYYA 4E6IA 4C3IB 1KTKA 3QO2A 4NKLA 1UH6A 3ZLZA 3BWUD 1HA6A 3LXFA 4KSLC 2MPMA 4H0LC 5IGFA 2MBBB 2ICEC 5DPSA 2ZT9C 1JRPA 1PH4A 5C4HA 4B0EA 2PPBC 1AWDA 2MP2B 4DR4L 3OJ3A 2J7ZA 3HK0A 3H6NA 4QGUA 1X3PA 3KBGA 3B08A 3C0RB 1F2MA 2OTLA 3PMFA 4MN3A 5KEEA 1S5CD 1WJ4A 5JJIA 3SK5A 5E6NA 3AYHB 1U4LA 4HMJA 5I2XA 5G3LD 2EXZA 3NBHA 4IJHA 4WIPA 1XMOQ 2KEDA 2N55A 1XD3B 2WP9B 3MFYA 4RKBA 4XWWA 4TKNA 1DOKA 4Y7NB 1UF0A 1F52A 3GO5A 4KI0A 2LXJA 4MTNA 5FO9B 1PYSB 4GOPB 4DV0Q 3PV0A 1WJ6A 3SDZA 1G8ZD 1STHA 1ZEQX 4MTKA 1WI0A 3NHEB 4LJOB 1SSNA 1E2VA 2E5LQ 4A3MG 2MO1A 3CRKC 3WANA 1D5XC 3ONSA 1IBXA 3TJPA 1JALA 3RPFC 1AP0A 2GLSA 4DDGD 2QKIC 3MXUA 5LXIB 4CJ2C 1A15A 2YTYA 2OHFA 3HIZA 1OEYA 4II3B 1SMXA 4GDLA 4A3CH 2MFIA 3DWPA 1M8AA 2FIDA 1XPRA 2F0QA 1ICWA 3N6RA 5IGDA 5JH5C 5HURA 4KV6A 4IDIA 2AMCB 1UWVA 4NQKE 4KY6A 4WWPA 1H9SB 4GLAC 3Q22A 1CMXB 4P1CC 3SHLA 3EGRA 1S3OA 3GTPB 2V4DA 2QHOA 3DHQA 3QAQA 1SE2A 2A6HD 4OVZA 3RZWC 1QOBA 1YHQA 4XWTA 4BY7G 1VZ6A 4F8MA 1JJCB 1ZOYB 1K8MA 2XIWA 2IZVB 4DAYB 3DBLI 2IY5B 4ULLA 3I5JC 4X66Q 1D1KA 1LT4D 4GDKA 3HOZB 2KCCA 3U58A 4CDEC 1KIXA 4IWQA 4Y7NH 2LASA 2HT1A 1ZP0B 3GZNI 2WXOA 4EVOA 1I4PA 3PCOB 3S9WA 1SSOA 3V2TA 1GG3A 4HXDA 5FJ8G 1N63A 5C4ZA 3M4YA 1PVOA 3KF6A 3TS0A 1GHJA 1H9RA 3K0YA 3MTSA 3W3AA 4DV6Q 1QZHA 3J80i 4MELA 4YT0B 3K81C 5BMIA 3GTLB 4OIJA 2BWES 2HIVA 5C3EG 1VF5C 4M01A 1B4OA 1LTTD 2D2CC 1F9RA 2K4KA 4O1NA 1JC7A 4GNXB 2NCNA 3TBLD 1KDBA 1D1IA 1Q81C 3VH4B 2KT7A 2OQ0A 1I6VC 4URKA 2HHHQ 2KWVB 3AE9B 1R4NI 3AE6B 1ROEA 2Q2UA 4KD4A 4L63B 1E5WA 1MJCA 3VVWB 5IYDH 1O7YA 1A70A 1FM0D 1D2BA 5KNDA 3KYHC 2VXWA 3GQBA 1XPUA 4W9GA 2FUHB 4CDDC 2N8NA 3RN5A 5CORA 1SNMA 2KDEB 2O2VB 3E0JA 3HP3A 1WMHB 1WXSA 4IALA 2FNJB 2KC1A 3HM6X 2CWAA 3HOZH 2SNMA 2AQ3B 1WYGA 1CKNA 4J6HA 3Q3JA 1UWXA 3QWNA 1Y1VB 4KKSA 3ERSX 3DHGC 2UXDQ 1HNWL 3P63A 2F3VA 3PUZA 1L0WA 3I55A 1I6HB 2INPE 4GIVA 4XC2A 3LWEA 4YSXB 3H7PB 2EJGC 3DBLB 4M1UB 1NEKB 1EYAA 2IHEA 1I94L 1KAWA 3OOCA 3HUIA 3N30A 1WTXA 1WRDB 4A3JH 1LYLA 2JU6X 4BBSB 2WS3B 3UQAA 1B2TA 4TSSA 1V49A 1CZWA 4K8IA 2L1AA 4Q0FA 2F0KA 1XWEA 3K57A 2VZAA 5K5PA 1HR0L 3LJ3A 4EOYA 4JV5L 2XBBC 3VQIA 5EPLA 2K03A 3TZUA 3VA5A 4LF8L 4ID6A 2M17A 1EIHA 3MHBA 3GTKB 4HAEA 1VQ4A 2IYDB 3EUB2 3I4MB 3HOVH 2KHSA 3OW2A 1ZW7A 2DZIA 4KZ0A 3CCRA 4DAMA 3PHXB 2E2DC 4YY3Q 2KEEA 3GV3A 4A3LH 2PQEA 3NBIA 1QUQB 1NENB 1RWSA 3UF8A 4AQYL 1V97A 1NY4A 5IGBA 4YHHL 4FVMA 2AHOB 4JBJA 1A8VA 1K8GA 5D3IB 2FCQA 3WALA 2Z0SA 5G5GA 2BB6A 3BK1A 3AMUA 4TQUS 3OG5A 3M3YH 1YEZA 2YVCA 4OX9L 5CHFA 4ASWC 2KDFB 5KHQA 4U68A 1OXUA 4QIWE 4IM0A 3U4EG 4LFCQ 1OFFA 2KK8A 2ZVOA 1I6HH 2F0LA 1TWFH 2N9KA 4ZKBB 1PHJA 3A5ZB 3P1HA 4HSPA 3BS1A 4LF9L 1QT9A 4KLKA 3AFQA 4IPCA 1GHKA 4PS7A 4G4KA 4NAWB 1BCPD 1IBMQ 1A63A 3AE1B 4X3UA 2LFIA 4MGZE 3X23A 1PDQA 2MQJA 4IUQA 5CC4A 1JW9D 3L4PA 3GB1A 4R3DA 1K53A 4ZRPA 1DCZA 4GLVB 2KLCA 1Q12A 4MACA 4KX6B 2WXPA 2D0PA 3D31A 5ELNA 2GA4B 2KCNA 3G6EA 4GGQA 5H92C 3VTVA 4FXDA 3QHTA 2MLBA 3T1HL 2D5GA 5JJLA 3I73A 1H9MA 2L0CA 2PQAA 3PO3G 1WOCA 5BN3A 4XDDA 3GTMB 1IGDA 1TWGB 1QLBB 1WX7A 4DUYQ 5CHWA 4HRSA 2D3GA 3NOBA 5EPJA 1V8CA 1UWMA 3LWUA 3I4NB 2G9DA 5JEAH 5COYA 1LM8B 4HIMA 2L32A 2DYMA 2WX0A 1BNZA 3IVFA 2B2WA 2LUMA 5D3DA 4AWJA 2QGQA 1WE7A 4RFBA 5BMHA 5IP7H 3X3NA 4L2YA 1TS3A 1BXTA 4R4IA 4A3IG 1PUTA 3R7RA 2HQEA 1O7IA 4BY1G 3F8TA 4DAPA 1WGHA 1IPGA 4ME5A 4DUZL 3K0XA 3N1YC 2D10A 4G7HC 2VQEQ 3KVFB 1UGJA 4JWUC 1WRIA 2WXRA 1B7YB 2K39A 4K81A 2FBWB 3BDLA 1QVCA 3CCLA 4FULA 2D0OA 1YNJC 2LS01 4C1NI 1ZXIA 1SYCA 1H9KA 2JA5B 2NWGA 1LFDA 3G71A 2VZKD 4W9HA 2HUGA 1RFAA 1O80A 3NVZA 2MX2A 2KQ3A 4C3HH 2VRRB 4LF4Q 1JWBD 3PRMB 2R93B 1U4RA 2C60A 2KWUB 3Q6BA 2MCNB 4A3OA 3QCAA 2BYTA 5HHDG 1D4BA 2BQQA 4AJYB 3QWZB 1OQQA 3ERQA 1FIQA 1TWGH 4BBRB 5GADC 4DV0L 3LGJA 2QDBA 2UXCQ 1J19A 2XWBB 3I4NH 1S40A 2EYLA 3RCZA 3KUPA 2O5IC 1NBWA 2W55A 1P3QU 5C5LA 4A3BH 3H0GH 3U9OA 5FLMH 1WXVA 3HOWH 1ZKOA 2YLMA 2B2WC 3N32A 2SEBD 4P73A 1WGKA 2DYOA 3S2AA 1KLVA 2W82A 4GMVA 2WB1B 4DF7A 2EKIA 2R92H 2BW2A 2KJHB 1XCQL 4IJLA 3TN2A 2K5VA 4N8X1 4DNTB 2JYTA 3IT4B 2BWFA 4CO7A 3TCAA 1ENAA 3RN9C 2F0WA 2VQFQ 1B9MA 2QCPX 1VQPA 1ZPSA 4RGNA 1LABA 2Z4IA 1SMYC 3NRZA 4MGIE 4X6AH 2F0PA 3V6CB 2JA5H 2NPTA 2R61A 3V05A 4BWGB 4W9CA 3FC4A 5CTRC 1F2YA 3MXNB 4HJKA 3Q6SA 1YHBA 2VB3X 1PH1A 2NN6G 1G2SA 4X66L 1N61A 1OXXK 3BIID 2EMTA 3A1QA 4IUVA 2I38A 1CUKA 1IYJB 2EYOA 1LT5D 1EYGA 3NE5B 3E0EA 4IURA 3QIAA 1BOSA 2KQ4X 2KJRA 1GUGA 4NP5A 1DGJA 4P2CB 4OONA 2MP1A 3GS2A 1FNVA 3G7LA 3NEMA 2WQYB 4DV6L 2PI2E 1EWIA 4POGA 1RJTA 5L37A 5M5YB 4FJVB 2LGXA 4DDID 1PQSA 1HTPA 1IW7D 2H89B 3AU5A 3A8IE 4IPHA 4XYQA 1D5ZC 5NUCA 4CKCA 5I4DA 4DK6C 1RM6C 1FR3A 3PRPB 3S2HB 2M9VA 2JP1A 4JK1C 4LLGM 2KYWA 4E71A 5GAGC 1C1YB 4TVAB 4TRDA 2KJ6A 2KTRB 3K8AA 1LACA 4WJ3M 2KAJA 1DM0B 3FKIG 5M9OA 2Z4HA 3RZDH 2MBOA 3M4OB 3SU8X 1WY8A 3BG3A 4LFAQ 4PZ6A 2XSCA 4GN4B 2KHJA 3TSSA 4Y52H 1QOAA 2L0TA 3PZDA 1TY2A 2L5TA 1SYBA 2MJDA 2MH7A 4A3FB 4C4VA 4KHPQ 1TXYA 2A5HA 2XNAC 4JG2A 5IYBG 4BAXA 2JUOA 2H4OA 4A4IA 3E9HA 3M3JA 3J81c 2EYJA 4GU2A 1JWAD 4A3EG 1NDDA 3E9SA 1OQYA 2R2QA 4LNNA 1P98A 3ZTCA 2RBMA 2ZTDA 2Z8LA 3CP0A 4IFDI 4IUTA 2UXDL 3S2DB 1CTMA 3I7FA 2PVGC 1V43A 4E3CA 2QEJC 1L0YB 2DAJA 2C9WB 1YOVB 4OIKA 4S17A 1EEFD 2MHVA 2OT2A 3BU2A 3JAMc 2RGFA 1GC6A 3AV8A 4NQLB 4JVZA 1L1OB 1NI2A 1A3UA 2JK8A 2L76A 3AM9A 4HN7A 4MIUA 5M5YH 1WGRA 3VUWA 2NZOA 4ZUIA 3K58A 2GVAA 1MHHE 1ZKHA 5L95C 3MJ5A 3VR6A 1NAPA 2WB1E 1PH7A 4JI3Q 5C2TB 4RHSA 2EY2A 1WCMB 5M3FG 4H7BA 1QOGA 3AECB 4X65Q 3GE8C 3FAHA 3CC7A 1M90C 1JRUA 1SMYD 2FIFA 2LKVA 2O6VD 2N3SA 1EYDA 3VDYA 4AS1A 4M02A 2EQSA 4GZYC 3DBRB 2OJRA 1UE5A 2WX1A 3I56A 2WKDA 1GO3E 4W9FA 1JOKA 4BVUC 2PIAA 1V1QA 1D8LA 1I35A 1WH3A 4K3CA 5AFWA 4GLSC 4A93B 4XTCS 1K83B 3PUWA 4DU9A 4DR3L 3V60A 4KJOA 3IFWB 1JJGA 3L10B 5E6OA 1SYEA 2LXCA 5FLXL 3T9LA 4C7ZA 5HGTA 2KDBA 2BVCA 2VH2A 1FCLA 2ZNVC 2MP2A 3AEAB 3QC8B 1K0SA 3LDZE 1EF1A 2B63H 4MNOA 2MHJA 1NNXA 4DV1Q 4LFCL 4OXPA 1GUNA 4US8A 3S2DH 2PZUA 1YNTE 4WJ4A 4GXBA 4DV2Q 2OWOA 3TP5A 2K52A 1WTHA 2NVYH 4XT3B 1N60A 1V9JA 2K6QA 3I3CA 1TR5A 4DWFA 1OTRB 5FK9C 2GI9A 3UGBB 2FXQA 2FMCA 2CJNA 4ME3A 4DV4L 2Z59B 4GOPA 3UDFA 4HLEA 1PTOF 2UWQA 4BBNF 1JWMD 1WCMH 1WM3A 4NXNQ 4CYEA 2LGIA 1TWHB 1X3GA 2Z6KA 3KUCB 1VLBA 2RDHA 5J3BA 2M8SA 3E3XA 4A3DH 1S5FD 3K9OB 3HOXH 4IOAA 2R6GA 3PIPA 3UIPB 4KDIC 2L05A 3EVQA 4R8NA 4FDBA 1N34Q 4D2KA 5E6JA 3NQTA 4DUYL 4IZ8A 5LMNW 1MI2A 1AFPA 1VCIA 1QQRA 2OTJA 1V2YA 3TS2A 2RR9A 3VFKA 2CW0C 1C4CA 3E5SA 3IAYA 3TZDA 1H9SA 2ZEQA 3NY5A 2F52A 4P74A 2VNUD 3S1QB 1G6ZA 2FMMA 3NPPA 2K8CA 3BINA 3C46A 2RDFA 4NJ6A 4JYAQ 1K8OA 1Y8NB 4AQ7A 1X32A 2WDQB 3EFXD 1VDZA 1V80A 2L15A 1GKHA 2M2LA 1E8XA 5J18A 4R4OA 3BZKA 2VQEL 4DAYA 4G7OC 4IUNA 2TMPA 4LFBQ 2PPHA 4GOCA 3QJYA 3AFPA 1WXMA 1VQHA 1Y8RC 5H8YE 3B2FA 4EZLA 1AE3A 3PO2H 3MEHA 4GB9A 4QJFA 4AYBG 3FVQA 4UDUC 5CV4A 4C3JG 3TDQA 4IUUA 1F9JA 2DWQA 4GLXA 3AH7A 1YJIA 5IOIA 3L17A 1BT0A 3GTQB 2LHDA 1R4MI 4HDQA 2XEWA 2SNSA 4LF4L 1TT2A 1FO4A 1I4QA 4AH6A 1L6VA 2N9EB 4EEWA 2LGSA 2I5MX 1CFMA 5K36H 4G7ZC 2F0NA 2NZ1D 3U2SC 4HDOA 1JQ4A 3L2PA 2JA8H 3S16H 2JE6I 1GUWA 1G51A 1PRTF 4EQ5A 3K5OA 4DGZA 4GNXA 3PSEB 5EGTA 3W5OA 5D94A 2UXCL 3U50C 1M1KC 3IKJA 4MGKE 2IPKD 3J7YW 1BUIC 4WURA 4NY0A 4C00A 5EKKA 2A69C 1HZBA 2XTIA 2JA9A 2KXJA 2IX1A 1VQ9A 2F0OA 3DWQA 3W9CB 2B39A 3VRBB 1J7CA 5KIXA 4JC0A 2G3QB 2AUJD 4RGTA 1E6EB 2QDFA 2K7VA 4J3OD 5C4XG 2JA7B 3Q8DA 2N1WA 3A7AB 1MI0A 2PO4A 1WR1A 2K5HA 2N7JA 2WXIA 4JPBW 1Y8PB 4A3GH 3V6EB 2HD5B 1LO5D 3J7A5 2O2VA 1O7ZA 1WMHA 2ZXRA 2J4XA 3D8GA 3SGIA 3AB5A 3EFUA 2RF4A 5ELOA 4AP4C 1EWHA 1EL0A 2A1AA 5C44B 1IKMA 4JI7Q 1BKBA 1E8WA 2K22A 1UEBA 5AEKB 1L2NA 5IGGA 3NVYA 3PZ7A 1LTID 4AJWA 4UP8A 5BN5A 3H7PA 4BXXH 3TP6A 3PUYA 3PREA 1N8RC 2N7DA 4QY7A 2KZRA 4OX9Q 3GTGB 1F9QA 1VQGA 4B9XA 1YQ3B 1JE4A 4YCUA 2KX3A 1S4ZA 3KUDB 5GXGB 2M56B 2IBIB 1GM5A 3H3VC 2CW0D 2GRIA 1P16A 2QW7A 4GNXC 1SIFA 3AMZA 3NWSA 3I90A 3TP8A 2Q2HA 5IGCA 4S0RA 5BO4B 1R4MB 3HEJA 3CMMB 1FXTB 3PF5A 3D4RA 5HI1A 4WORA 3MTNB 2L9HA 5MPOA 5E4XA 5E7NA 3CF5A 3CSFA 1ESRA 1UBIA 1PTOB 1QJOA 4JL9A 3V62A 2PW9A 2R2OA 3VYTA 3DBHI 3ULPA 4W9LA 4YTMB 2E3TA 1F9PA 2Y0SG 2JA7H 1QUQA 5M3MG 2GVBA 3Q8BA 2INDC 3A9JB 1E1TA 2F0VA 3T3NA 1UBQA 1WGGA 1VF7A 5G3LF 4BS9A 3IT6B 2UYZB 3NVVA 2H5XA 2HDEA 2F0GA 1EUJA 3I4LA 1X9NA 2KQSA 2KN5A 1S5DD 3L13A 2WXMA 4LFAL 3PLVA 2RDGA 3NELA 3V96A 2PLPA 1I3QH 2CVRA 1K9MC 4G50A 4PS8A 5D6JB 2YYZA 2Y3AA 4TKOB 4DA2A 1FGUA 1QILA 4KHPL 3ZKJC 4BKSA 2CHXA 2LHEA 5C1ZA 3FPPA 4BKTA 2UU9L 1STBA 4DR5Q 2D5DA 1LT3D 1CKOA 2F4IA 3AEVA 3GTGH 3BK2A 2F0HA 4NAWA 2RVLA 3PIOA 2X69A 1Q1OA 2SOBA 4RM9A 2RSUA 1RL2A 2A69D 4LTUA 4C80A 1SE9A 4RF1A 3GP7A 3CMAA 4TUUA 2L7RA 1NCVA 4DHZB 5IKCM 2H1EA 2BS4B 2HCIA 2JRHA 1LV9A 3QK0A 2KO3A 4UHVA 1T0SC 4LCDE 1KNAA 4ODGA 4CDCC 1ILPA 4WWMA 3G4SA 1PLFA 2L52A 1GUTA 1PTOH 4HIOA 3UDIA 5BR8Q 1SROA 3HOUB 2VS1A 3WAPA 3PRZA 3M7GA 1Q5WB 4FN2A 4KGTA 4PYUA 5A2QL 3AQQA 2RD0A 1KL9A 5IP9H 1AARA 1TKGA 2QILA 1C48A 4JI3L 3APFA 3M85A 3J80E 1BBXC 4X65L 4OO1G 1PV4A 4LNOA 1YBYA 5CR3A 4N9F4 4NZLB 4FF4A 4DKAC 4GN5A 2PI2A 1PRTB 4UPAA 1CQFA 1WXQA 2KKCA 1PGAA 1B1ZA 1HEZE 4BY7H 1F0ZA 3DHHC 1V81A 1KXLA 1Q90A 2WXJA 3OWFA 5CHVC 1AZPA 5EE1A 2WINB 2NMQA 2ZCBA 4DXFA 4KSKC 1VQMA 4BZAA 2BGFA 3N3KB 1LM0A 4HJ5A 4K5WA 1A6XA 3RI7C 2Z0EB 3R7QA 5HG2A 4FYDA 2ZTCA 1EQRA 3H6MA 1K73C 1V5TA 2AYOB 1SE3A 3DVGY 1WX8A 1K3BC 4UY8C 5FJ8H 1KLUD 2I0QA 2VH1A 2WIIB 5LL6S 1SR3A 4DV1L 4KGRA 5FOBB 5T8IA 3AULA 2FINB 4NNJB 1XLQA 5JAVA 4DV2L 4N58A 4TMAB 4BOSC 5C3EH 5IAAC 2K25A 2QMTA 5I9OA 1NUCA 2AUKA 4FJZA 4MM3B 3SHQA 1U5KA 2N88A 3OHXC 4DHJB 3R3OA 2A68C 3HOUH 4HPLB 2HCCA 1RFKA 3X3MA 1E24A 2AQ1B 2M1MA 4NXNL 3KYDD 3P1MA 2HDMA 1XPOA 3ZNZB 1K50A 2ENBA 4JI1Q 3ICEA 4V190 3ER0A 3WOFA 1B53A 1TZOA 2IY0B 4QIWB 4WWOA 1J0GA 5IT9c 1FPYA 3U7DA 5KRUA 1N5WA 1N34L 1RLFA 3KLSX 3IG3A 1ML0D 4K2LA 1YJ1A 4IUPA 1ENCA 5JEAJ 1HFNA 5KYLA 4A3JB 1RAXA 1E2WA 1PXUA 2BYVE 4X57B 1W6JA 3NS1A 1G2TA 3ZW3A 4DXAB 5TSSA 3SVMA 4ZKCB 3ZNHB 1VQEA 1E7VA 4ZHOA 1NYQA 3A33B 5IOCA 2N9XA 2N49A 3A55A 1H4RA 1PYWD 4JYAL 1HTOA 3VYRA 2NB0A 3A5UA 3U52E 1E0ZA 5AJ3L 4DHZE 1JB3A 3VRAB 2D3CA 3JW0X 2DNEA 5KNBA 1X55A 1Z2MA 3F2BA 1TKYA 3HOVB 3W1GA 1KRTA 4LFBL 1YJWA 4JI0Q 4C3IG 4DV7Q 4K5XA 2ZJDA 4A93H 2QDLA 1TVXA 2DN8A 1AYFA 2NTSA 2HIXA 2JA6G 3JSVB 1E7UA 4UAIA 2R7ZB 1U4PA 2E76C 2LFNA 2MJEA 2L00B 2DNFA 2MNAA 1UUPA 5EKLA 2K5QA 4JI6Q 2PZWA 4ANXA 1UE1A 3M3YB 3PO3B 1E22A 1MGSA 2KA7A 3QOJA 3PLUA 2GN5A 3HOYB 1ZYRC 1WTPA 3NZSA 4ANVA 3TRZA 3MC8A 4OELB 3ZJYC 1K8RB 1TWFB 1T0RC 2R7FA 3HFZB 2M19A 1C4QA 3A8JE 1C77A 2JRIB 3UI2A 1OO9B 4WRDA 4FXKC 3IAS1 1ONLA 3H1UA 2KTRA 2A5UA 3TL5A 1BCPF 4A3IB 3KK7A 3GZNB 3NZ3A 1SJHD 4JI2Q 1QB5D 2NVTH 3DXJC 2GBRA 1QE6A 3C8YA 4OL7A 2NN6I 2MO0A 1PFBA 1BMLC 3RUIB 5DM63 3O13A 2IGGA 5CYUA 4F7ZA 4WJPA 3K7UC 4LNIA 3KDFB 4DR3Q 3UE0A 3VTWA 3G48A 2R7ZH 1X1MA 4JI7L 3FKYA 2KD0A 3AE3B 3O65B 3RD2A 4K14A 1C7YA 1R4NB 4IM3A 2AWTA 1E8YA 1YHAA 2DENB 2YTVA 3DHIC 3BVZA 2PTLA 1EO6A 4JX1C 1JCKB 3KF8B 3RT3B 2PKOA 3N20C 3PO3H 1AZQA 1L1OA 1IUEA 1XEEA 3J81L 3B0AA 4KGSA 2CHWA 3K59A 3HOYH 4APVA 2C35B 4RNAA 3HOZG 2J42A 1KC8C 2PE9A 1HH2P 5CV6A 1WE6A 3TMPB 4ITKA 1EIGA 2EYMA 3B2GA 1XT9B 5CV5A 4DR1Q 3JAML 2K05A 2Q2IA 4YCWA 4DV4Q 4A3IH 4LF5Q 2KANA 2ON8A 4IKGA 3WDNA 4BY1H 3X0WA 4HIDA 1KDAA 4A6QA 3K7AH 1VQAA 4C3HB 1MHXA 2SAKA 3RMHA 3CC4A 1X3QA 1YNXA 4B9KA 4LJPB 3R93A 4KKTA 1Y14B 2EY6A 1IYUA 4N9TA 1CA6A 5EKIA 5CBAE 1I4HA 3EBEA 5F2DA 1WTOA 2TSSA 4LNQA 5IY0A 1UZXB 2E6XA 3APCA 1TYGB 1GXDC 2KLGA 1ET6A 3GD7A 4J8QA 4X3SA 4QF4A 1SN8A 2HTME 1Q7YC 3STBC 4JE3B 2RCNA 2W3SA 5DPWA 3V61A 1PGXA 3FDTA 3N52A 2IY1B 1P0RA 1VQCA 2K9XA 2MBEA 5A35A 4A3BB 2HJ8A 3H0GB 3QQ8B 1BDOA 3APDA 1ASYA 3HOWB 3GTOH 3RULA 4O0AA 1S5BD 2HDLA 1MJEA 5T1IA 4M0WB 4DR5L 1VQDA 2WXQA 3NVWA 2LD9A 1L1OC 3W2DA 3RFZB 4XDXA 1YZ6A 5ELDA 4X64Q 3GOEA 3M63B 4XYCA 3MC0B 1H8CA 1LTRD 4FA6A 3TEHB 2R92B 2GBNA 3Q8FA 3RZOH 1EU3A 4ZAIA 2AWOA 1O7LA 5KGUA 1IBLQ 3C1EA 5IE8A 1Y1VG 4HKZE 2Z1CA 4YWLA 2UXBQ 1C4AA 3J7AV 4ANWA 1MKHA 3CXCA 3A7LA 1WD0A 1PH2A 1W6KA 5HKHA 1PYBA 2JSVX 2I5HA 1E3PA 5I2YA 1KH0A 3A56A 5BR8L 4ZRZA 3PUXA 4MEMA 3CPFA 2V9HA 1QWYA 4BBSG 4FBJB 1V1PB 2PNHA 4R9WA 2F0JA 4I7AA 3I8ZA 1OQRA 1A3TA 1Q3LA 4J1MA 3FMCA 4HROA 2EPBA 1TWCH 4K0KQ 1A5RA 3KW5B 2IHFA 1ACCA 3I4MG 2JT4B 5HY6A 1HRJA 3H9DA 5FR3A 2E2JB 1EZ6A 1KAAA 1UE7A 4E74A 2NN6H 3VUYA 5JXVA 1BCPB 1DYQA 3DEOA 4IWOA 1DZ1A 1QKZA 4P7IA 2BKRB 4R8IA 4O2DA 4RWSC 4WWNA 3MXGA 4HTHA 3J81i 2F03A 4OZAA 1PZID 1SNQA 1K51A 4IWPA 1VQNA 2L83A 3T56B 3NUCA 4US9A 2EELA 4POFA 1OGWA 2WXHA 5IP7G 1CHQD 1HJPA 4L1BA 2DJFC 2L12A 3JAMi 3RZDB 2EYFA 2V3PA 2I5LX 2X6LA 1A62A 1B44D 4DXGA 3GDEA 1KFYB 3NUHB 4GDKB 4HPMB 5JHAA 3SR6A 3P7JA 2X38A 1NVID 4DK1A 2NBUA 3EHVA 4EQNA 1B9NA 4G57A 4HR7B 1P7EA 1Q1EA 1X65A 2D07B 3AB9A 5EBDA 3ULJA 2AQ2B 2ZM6Q 5DPTA 1Y1WB 3CU7A 4Q5VA 1KRSA 2LSSA 3STBD 1BF4A 2K75A 1VQOA 1FFVA 1EWCA 2MBQA 2JN4A 1CKMA 2RSNA 1Z5SB 1LTBD 2YEPF 4JI1L 1SYGA 4KN4C 1TT5B 2E74C 5DLQE 3EJIA 2EDGA 2C7HA 4PG3A 5IYBH 1YX5B 2PVOD 2E2JH 4KIKB 3VR8B 2IJ0A 3VR4A 3I57A 3SFEB 4OWXB 1TWAH 5AUKA 2PW5A 1W2BA 2OJWA 2Y5CA 1CM9A 1T3QA 4EFOA 4WQOB 3ITPA 3I4NG 1Z6HA 2VZKB 4W9KA 1GVPA 2C7NB 3DMUA 5FLMG 2DHZA 2L3ZA 5E6PA 4KJNA 1YNJD 4K7UA
chains in the Genus database with same CATH topology
4IN3A 2BB5A 2JZPA 4C7YA 2DBYA 3RUZA 4KMUC 4A9AA 3D6WA 1Q1BA 3PIP3 1TS5A 1JOOA 1MD2D 3L9AX 1HHVA 1Y69U 3FILB 2E2IB 3IAM1 1YNNC 2NTTA 5EE9A 2B63B 2WXFA 2NUCA 1R4PB 1EEID 1MSHA 1WTWA 5C0XJ 4QB4A 2WAQB 1LTSD 4USAA 2O5JC 2NVYB 2K28A 4CJ0B 4C56C 1TY0A 3H8HA 2IWHA 2K1BA 1SJED 3HRDD 4O42A 5I6WA 2BDNA 1MVKA 3KQ4A 3OWEB 4A3KB 2JWUA 4JPSA 1K52A 3J7AF 2EVBA 3AEDB 2FFKB 4A3DB 3HOXB 3OIPA 2EZVA 3OMGA 4C3JB 1T6BX 3Q0AA 3Q8EA 1CK1A 1GB4A 4XE0A 1L6UA 3EROA 4FF1A 1FMAD 4X3KA 2XVSA 4FF3A 4F87A 1SNPA 5BMGA 4HKQA 2A6EC 2OEOA 2BOSA 1YJJA 2BA0A 4LMQD 2KWDA 1PDXA 2MUYA 4K6DA 2XRSD 3NTHA 3T3OA 1PFDA 3P4RB 1F2RC 3SXHA 3PO2B 1BUVT 3BVMA 4HCEA 4XDCA 2EYHA 2EJMA 4IOIE 3E56A 3HS0C 5FLXE 2DLBA 1GAQB 2LMCB 1WVLA 2YEPB 1XCTL 3DWGC 4I7ZC 1FNWA 4KN7C 5FO8B 2B2VA 1RTNA 2JA8B 3S16B 2WLBA 1B3AA 1U9RA 2MJ8A 1CQVA 2Q8RE 3HKZB 4KY5A 1YNND 2L1BA 1L4DB 1F77A 2K32A 3NSWA 2VUMB 3BDOA 2KN4A 1T5EA 2WXKA 1WTQA 1R4QB 3HGBA 1XO3A 4A55A 2DY8A 2FJ2A 1LTAD 4A3GB 3ZJVA 4OO1I 3CRLC 2BBCA 3C2PA 3K5MA 4WQMA 4YSXB 1E7PB 2C5CA 4MHEA 2KJXA 1PRTC 3RLFA 4CKBA 3GTJB 3OPOA 5C5MA 2L55A 4IFDH 5FKAC 3J9CA 1BO0A 1H9JA 1KRHA 3WOEA 3AEFB 1PZKD 2B2VC 4RA8A 2K33A 3VYUA 2NVXB 5IT9L 2A6ED 2IX0A 4KHZA 1ZUD2 3MAQA 2ZW1A 1WWTA 3T4AC 5AUIA 5I9PA 3DWMA 1GB1A 2F0EA 1D6EC 4K8JA 5CMDA 3H09A 4EQPA 3C3LA 5ELBA 3T53B 4N9PA 3MWYW 2WV6D 2OXPA 1EY9A 1KF6B 1HXYD 1PMRA 5JJZA 4RCNA 2WU2B 4Q2JA 4U673 2F3WA 1BR9A 3CKIB 4YSZB 2F1MA 3AE7B 1I3QB 1DOLA 2KMMA 1F2RI 2KUMA 5D7GA 4B9WA 3VYSA 1RYJA 1I4RA 4F88A 3QG1A 2F0DA 2YU9B 2FUG1 3R2IA 2PZTA 2XWJB 4X3TA 1PFNA 5EBCA 4WH4A 4DFAA 4KKJA 1VZ8A 4A3MB 5K36G 5C0XG 3ZJTA 4DN4M 4B0MA 1VDVA 2JYOA 3W5VB 3C1FA 1SXTA 1C76A 1P7FA 3HZXA 2JX5A 1AW7A 3D4DA 3H91A 4DNRB 4N6EB 2KACA 3KF8A 3OSOA 2IW3A 4BY7B 1EY6A 4RGOS 2G9HD 4OO1H 4PT5A 2F0FA 3H94A 3BVGA 3ONAB 3IXSA 1E0BA 1E9MA 1IKLA 3QOLA 5HFYA 4OZCA 5FO7B 1XLOA 3TMEA 1STGA 1VJKA 3BYYB 4KK7A 1MPEA 4S3SA 1JROA 1E2ZA 5J22A 5C3EB 4ARCA 1TU2B 1J8IA 4ZUJA 1EY8A 2J53A 3OW7A 5ELEA 1WD1A 1WTRA 3URYA 1SNOA 1CZPA 1HQRD 5IODA 3I70A 4KKUA 4A90A 2M00A 4RCOA 1TKEA 2ZW0A 1FGBD 2WACA 1HZ6A 2K01A 2BT6A 1KDCA 4CBVA 2JXTA 1FCCC 1PGBA 1GUOA 4M0WA 2JA6B 2K6AA 1G91A 1EOTA 2PW7A 1ZDVA 4PQXA 3HVZA 4EGVA 3NTKA 2K5WA 4RF0A 4MT5A 3G6JB 3W1SA 1TS4A 1JMLA 2N0SB 2BS3B 2QSDA 2IGDA 1Z47A 5A2QE 3ZJUA 1OXTA 1N5XA 1RD9D 1SNCA 1V1PA 4C2MB 4ZQ3A 5D65A 2NVQB 1SAPA 1RCVD 1RKNA 3ZGZA 1SE4A 5BYRA 5DEHA 2CHBD 3NTIA 3DM1A 5DAUA 2WU5B 1GPXA 1TKWB 1I4GA 3R8BA 1PZJD 1SEBD 5EJWA 2K04A 4WAFA 2CJOA 1NYRA 1Y56A 2WNMA 2J52A 4HEDA 4N59A 2RQXA 3KBXA 4P16A 5DM73 1L0VB 5JOBA 2W54A 2F0MA 4YTNB 3VR2A 1NI3A 1SIJA 1ZE3D 4A8XC 1JWUD 4H13C 2EY5A 3PZ8A 3E6ZX 3P20A 1T5XD 2NVTB 1EU4A 3EQLC 3PUVA 2JSOA 5C3WA 5KYIA 1XLNA 2KVMA 3P4QB 2L4NA 1IGCA 3K5LA 5I6YA 3MXNA 3NWTA 5EPKA 1VMPA 3ETRA 1C8CA 1FD6A 2GB1A 2AX5A 2LJIA 2J0TD 4ZOHC 1EY0A 1HUMA 3TEWA 3HG9A 3S1MB 3VR3A 1HQMC 3K5NA 3T16A 4ZLTF 1BCPC 1OXVA 1B50A 4HMIA 2EE1A 4RHRA 1YN5A 1AN8A 1QNUA 1RHPA 2F0UA 4REZA 1FXIA 2JEBI 1EFID 1QNKA 4PV1C 2ZXOA 3T51B 1XLPA 4Z9CB 1XYIA 4LK1C 2WP8J 3A54A 4BY1B 1SB3C 3K7AB 3D6CA 3NP8A 4PNYA 3QB3A 2V3NA 4L8JA 2BCOA 3TBIB 2IX3A 1UEAB 5E1FA 2A68D 3FILA 1B9RA 1JORA 3KLRA 2Y5PA 1KLGD 2BE5C 1EY5A 2F0TA 5CV8A 3AEGB 5EE3A 1ENFA 3GTOB 3SK6A 1QOFA 3P75A 1JQYD 1TJEA 3Q23A 2O2LD 4FP5D 2PMVA 3SK4A 3RZOB 2A73B 1S5ED 1SBBB 1C78A 4FXGC 1L4ZB 2DNCA 4ZYSA 1Y8OB 1FXAA 1DOXA 4CHTB 4PMWA 3BYTB 1QCBD 2K0PA 4ILWA 1STYA 1MBYA 3P4PB 3LYYA 4NJCA 3AE8B 1EQVA 1D5MC 3IFDA 3J81E 4DAVA 4B0EA 2ICIA 4KY7A 5M5WB 1TWCB 2M0AA 1DONA 5G5HA 1Q10A 2BS2B 2QIEB 4XXEA 1GJXA 2RMMA 1HCZA 1BQQT 4ZHPA 1ET9A 1ZYRD 3JAME 3SFDB 2CU3A 3EA6A 4OGQC 4FF2A 3AEEB 5T1GA 4I65A 2X6GA 3HRZC 3FRPB 4HEA1 2JEAI 1VMCA 1XTCD 1IHZA 3NQIA 2K5DA 2LMCA 1DOYA 3S15B 3L7ZC 1C79A 4YWGG 5BN4A 1HUNA 4NDXA 5D14A 1ZXTA 3FKIB 2BE5D 3DWAA 2PYKA 1C9FA 1NSNS 2R3ZA 1IW7C 1HPCA 2ONQA 1HZ5A 1IBXB 3VR5A 1TWAB 2E75C 4GDLB 3FPUB 2JYEA 2D9UA 4A3EB 1XX8A 1Z7TA 1DD2A 3S14B 1E10A 5JEAG 1EY7A 3BZDB 2NYZD 2B8FA 5JVH3 1TQOA 4EE2A 3AE2B 4L23A 5KNCA 3ZQ4A 1I4XA 4L6TB 1XXGA 3TUOA 2OF1A 4QMGA 2V4IB 3VR9B 2Q5WD 2I2YA 3Q8AA 1HA5A 3Q8CA 5M3FB 1VR9A 1XF5L 2EYPA 4OW0A 5CBEE 4FNFA 3N9YC 1I7HA 1KNEA 3SR1A 2KDMA 1EYCA 1WTVA 2XN9C 4HSVA 1V1OA 3OMCA 3MP9A 3I91A 5LL6X 3LB8C 5J1ZA 4C3HG 2EJFC 1EZ8A 4RGMA 1FEHA 1FYCA 5CV9A 1YN4A 2WDRB 2Q8TA 3T13A 2C9OA 3AE5B 3LX0A 2EOTA 3MA2B 2BTEA 1YN3A 5BYSA 1DOIA 3MXPA 1EWYC 4PMBA 4CQNA 4RH6A 1STNA 4TQ0A 2D62A 1J9OA 3MVVA 4FXCA 1FFUA 1JR0D 2OEDA 3P4SB 1WSPA 3SE0A 4K5VA 4H44C 3TEYA 2B2TA 1J7BA 1QF6A 1VZ7A 4IFDJ 1V8QA 3CHBD 2VB2X 2W3RA 5ELFA 2RSOA 4OHJA 1STEA 1EM7A 2WDVB 5CGKA 3CIRB 1ILQA 1EY4A 5C4JB 2H88B 1YMHE 3KLSA 1L5PA 4K2KA 2I46A 1R9TB 1ESFA 1A2TA 1CHPD 2IDYA 2IT1A 1O78A 2ID0A 1ZDXA 3MHZA 3LNNA 2K5PA 3DUZA 4NAMA 1R7SA 1CI3M 2RKSA 3IFTA 5C3XA 3TEXA 2ACZB 4XIGS 1HFGA 4CGYB 2B2UA 2WXLA 1HTLD 2CQAA 1RF2D 4CJ1B 1N62A 1U4MA 4AYBB 5JVG3 3CQZB 1SYDA 3R2TA 2Q8IB 1AEXA 1DOMA 2IL8A 3GV6A 4K6LA 2MEKA 4ZK9B 5EQ0A 3ND9A 2B2TC 4KD3A 4QUCA 3FEWX 4XQQA 5C0XI 3B9JA 1FNUA 4V0BA 2XRQD 2V0GA 2KECA 4QUFA 1PTOC 2F0SA 4HJGE 1FRRA 1SDFA 2WXGA 2JQRB 2G1EA 1MSGA 3AEBB 2WKCA 4XT1B 3VA7A 1QOHA 5E3FA 2O4XA 4OZBA 2A74C 4NMZA 5C4XB 3S1RB 3MZ5A 1JOQA 4KKIA 3I72A 1RTOA 5E4WC 5LHY1 1RODA 2PMZB 3OIQA 2B2UC 2FHTA 1GUSA 1UAPA 1VRAB 4P6VF 3U7ZA 1CZGA 3MFGA 3PO0A 1PFMA 1LTGD 1SNDA 5BYQA 2QF7A 3AU7A 4DK0A 4ZRQA 1SF0A 4XYOA 1C4PA 4IQZA 4XQNA 3I9V1 1J7AA 5JPMC 4YSYB 3DEPA 5M5XB 4EQOA 1NR4A 3RD4A 3KWVA 2F0IA 4FO2A 3D3RA 2Y0SB 2RA4A 5M3MB 4RKLA 1F2ZA 1I50B 2JXMB 4BA1I 2E2HB 2WXNA 4F7XA 2FE8A 1A2UA 2B8GA 5C6AA 3AE4B 4WJWA 3NK9A 3W5UB 3L3OC 5DNFA 1FRDA 4LK0M 3BDCA 1NR2A 3PIO3 2BA1A 2I07B 1PTOD 3NXWA 3WCQA 3A8KE 2RPVA 3TEZA 2MGSA 3M7NA 2K3UA 5ELCA 3S1NB 1A3VA 2EY1A 3Q24A 2NBFA 2ZXPA 3AN1A 5C0XH 1DXMA 3P42A 3D4WA 4KTAA 1IYVA 4ARIA 4HCSA 1L0XB 4YIJA 1TS2A 1F2LA 3F2UA 2SDFA 1SFOB 4JWSC 3KWLA 5IT9E 1SYFA 2IGHA 5EE0A 4JBWA 3V3XA 1GOZA 4IFDG 1M4VA 1CJEA 3HVDA 4YXDB 3U9SA 4LAAA 2KOLA 4MH8A 1IL8A 2B2YA 3TP7A 3SK8A 3CWIA 1LT6D 4BA2I 4YTPB 2LEKA 5IGEA 5CV7A 4XQJA 2PNRC 5JPNC 4H2AA 3ABVB 1LLRD 2QJLA 1DJRD 1PRTD 3NHHA 1CA5A 4ABNA 4RAUC 4M8AA 2LY7A 3IL8A 2AWNA 2N9LA 4LJZC 2L11A 3K6OA 4B08A 2BDOA 3SEBA 1KABA 3ZYYX 1YQ4B 1STAA 4CKEA 1OXSC 4NW2A 2A6HC 4QCLA 1JICA 3UI3A 4PMCA 3S17B 3BK2A 4C1NK 1ZXHA 2INNE 5J39A 1JWSD 2B76B 5IIFA 1CT1D 2B2YC 2MJ3A 2DY7A 4KHVA 4DQOC 1G291 1TIID 1QG7A 1EQTA 1FD7D 1II3A 3J80L 3Q69A 4WFN3 3ND8A 5C3JB 1F9SA 2PCFB 5LNK1 1UNSA 1Q8IA 5ISRA 1RDPD 4E6IA 4C3IB 1KTKA 3QO2A 4NKLA 3BWUD 1HA6A 3LXFA 2MPMA 5IGFA 4H0LC 2ICEC 2ZT9C 1JRPA 5C4HA 2PPBC 1AWDA 2J7ZA 1X3PA 3KBGA 1F2MA 3PMFA 4MN3A 5KEEA 1S5CD 3SK5A 1U4LA 4HMJA 5I2XA 5G3LD 2EXZA 3NBHA 4WIPA 2KEDA 2N55A 2WP9B 3MFYA 4RKBA 4XWWA 1DOKA 4Y7NB 3GO5A 4KI0A 5FO9B 3PV0A 3SDZA 1G8ZD 1STHA 1ZEQX 1SSNA 1E2VA 3CRKC 1D5XC 1IBXA 1JALA 3RPFC 1AP0A 2QKIC 3MXUA 4CJ2C 1A15A 2OHFA 3DWPA 1M8AA 2F0QA 1ICWA 3N6RA 5IGDA 5HURA 4KV6A 4IDIA 4KY6A 1H9SB 3Q22A 3SHLA 3EGRA 3GTPB 2V4DA 3DHQA 1SE2A 2A6HD 4OVZA 1QOBA 4XWTA 1VZ6A 4F8MA 1ZOYB 1K8MA 2XIWA 4ULLA 1D1KA 1LT4D 3HOZB 2KCCA 1ZP0B 2WXOA 4EVOA 1I4PA 3S9WA 1SSOA 3V2TA 1N63A 5C4ZA 3M4YA 1GHJA 1H9RA 3K0YA 3MTSA 3W3AA 4YT0B 5BMIA 3GTLB 4OIJA 1VF5C 1B4OA 1LTTD 2D2CC 1F9RA 4O1NA 1JC7A 1KDBA 1D1IA 1I6VC 3AE9B 3AE6B 1ROEA 4KD4A 4L63B 1O7YA 1A70A 1FM0D 1D2BA 5KNDA 2VXWA 3GQBA 5CORA 1SNMA 3E0JA 3HP3A 4IALA 1WYGA 2SNMA 2AQ3B 4J6HA 1UWXA 3QWNA 1Y1VB 4KKSA 3P63A 2F3VA 3PUZA 2INPE 1I6HB 3LWEA 2EJGC 3HUIA 4M1UB 1NEKB 1EYAA 3OOCA 1WTXA 2JU6X 4BBSB 2WS3B 1B2TA 4TSSA 2L1AA 1CZWA 4K8IA 4Q0FA 2F0KA 1XWEA 3K57A 5K5PA 3VQIA 5EPLA 2K03A 3TZUA 3VA5A 4ID6A 1EIHA 3MHBA 3GTKB 4HAEA 3EUB2 3I4MB 2KHSA 2E2DC 2KEEA 3GV3A 2PQEA 3NBIA 1NENB 1RWSA 1V97A 5IGBA 4FVMA 5D3IB 5G5GA 2BB6A 3BK1A 3AMUA 4TQUS 4U68A 1OXUA 3U4EG 1OFFA 2F0LA 2N9KA 4ZKBB 4HSPA 3P1HA 3BS1A 1QT9A 1GHKA 4G4KA 4NAWB 1BCPD 3AE1B 4X3UA 2LFIA 1PDQA 4IUQA 5CC4A 1JW9D 3L4PA 3GB1A 4R3DA 1K53A 4ZRPA 1DCZA 1Q12A 4MACA 4KX6B 2WXPA 3D31A 2GA4B 2KCNA 5H92C 4FXDA 2D5GA 3I73A 1H9MA 2L0CA 5BN3A 4XDDA 3GTMB 1IGDA 1TWGB 1QLBB 4HRSA 5EPJA 1V8CA 1UWMA 3LWUA 3I4NB 2G9DA 5JEAH 5COYA 2L32A 2DYMA 1BNZA 2B2WA 2LUMA 5D3DA 4RFBA 5BMHA 3X3NA 4L2YA 1TS3A 1BXTA 1PUTA 2HQEA 4DAPA 4ME5A 4G7HC 1UGJA 4JWUC 1WRIA 2WXRA 2FBWB 3BDLA 1YNJC 2LS01 4C1NI 1ZXIA 1SYCA 1H9KA 2JA5B 2NWGA 2VZKD 2HUGA 1O80A 3NVZA 2KQ3A 1JWBD 2R93B 1U4RA 2BYTA 5HHDG 1D4BA 1OQQA 3ERQA 1FIQA 4BBRB 2QDBA 2XWBB 2EYLA 3KUPA 2O5IC 2W55A 5C5LA 3U9OA 1ZKOA 2B2WC 2SEBD 1WGKA 2DYOA 2W82A 2WB1B 4DF7A 2EKIA 2BW2A 1XCQL 3TN2A 4DNTB 2JYTA 3IT4B 1ENAA 2F0WA 1B9MA 2QCPX 1ZPSA 4RGNA 1LABA 2Z4IA 1SMYC 3NRZA 2F0PA 2R61A 3V05A 4BWGB 3FC4A 1F2YA 3Q6SA 2VB3X 2NN6G 1G2SA 1N61A 1OXXK 3BIID 4IUVA 2I38A 2EYOA 1LT5D 3NE5B 4IURA 3QIAA 1BOSA 2KQ4X 1GUGA 4NP5A 1DGJA 4P2CB 2MP1A 3GS2A 1FNVA 3G7LA 2WQYB 1RJTA 5M5YB 1HTPA 1IW7D 2H89B 3A8IE 4XYQA 1D5ZC 5NUCA 4CKCA 5I4DA 1RM6C 1FR3A 3S2HB 2M9VA 2JP1A 4JK1C 4LLGM 4TRDA 1LACA 2KAJA 1DM0B 5M9OA 2Z4HA 3M4OB 3BG3A 2XSCA 3TSSA 1QOAA 1TY2A 2L5TA 1SYBA 2MJDA 2MH7A 4A3FB 2A5HA 2XNAC 2H4OA 2EYJA 1JWAD 3E9SA 2RBMA 2Z8LA 4IFDI 4IUTA 2PVGC 3S2DB 1CTMA 1V43A 2QEJC 1L0YB 4OIKA 1EEFD 2MHVA 2OT2A 3AV8A 1A3UA 3AM9A 4HN7A 4MIUA 4ZUIA 3K58A 1MHHE 3MJ5A 3VR6A 1NAPA 5C2TB 3RFZB 4RHSA 2EY2A 1WCMB 4H7BA 1QOGA 3AECB 3FAHA 1SMYD 2LKVA 1EYDA 4AS1A 4GZYC 2WKDA 1JOKA 2PIAA 5AFWA 4GLSC 4A93B 4XTCS 1K83B 3PUWA 4DU9A 4KJOA 1SYEA 5FLXL 4C7ZA 5HGTA 1FCLA 3AEAB 1GUNA 4US8A 2PZUA 1YNTE 3TP5A 4XT3B 1N60A 3I3CA 1TR5A 5FK9C 2GI9A 2FMCA 2CJNA 1PTOF 1JWMD 2LGIA 1TWHB 1VLBA 2RDHA 1S5FD 2R6GA 3EVQA 4R8NA 4D2KA 5E6JA 3NQTA 4IZ8A 1MI2A 1AFPA 1VCIA 1QQRA 2CW0C 1C4CA 3E5SA 3IAYA 3TZDA 1H9SA 2VNUD 3S1QB 1G6ZA 2FMMA 3NPPA 3C46A 2RDFA 1K8OA 1Y8NB 4AQ7A 1X32A 2WDQB 3EFXD 1VDZA 2M2LA 4DAYA 4G7OC 4IUNA 2TMPA 3QJYA 5H8YE 3B2FA 3MEHA 3FVQA 4UDUC 5CV4A 4C3JG 3TDQA 4IUUA 2DWQA 3AH7A 1YJIA 3GTQB 2LHDA 2SNSA 1TT2A 1FO4A 1I4QA 1L6VA 1CFMA 5K36H 4G7ZC 2F0NA 2NZ1D 3U2SC 1JQ4A 2JE6I 1GUWA 1PRTF 3K5OA 4DGZA 5EGTA 3IKJA 2IPKD 3J7YW 1BUIC 4WURA 5EKKA 2A69C 2IX1A 2F0OA 3DWQA 3W9CB 2B39A 3VRBB 1J7CA 5KIXA 2AUJD 4RGTA 1E6EB 2K7VA 4J3OD 2JA7B 3A7AB 1MI0A 2PO4A 2N7JA 2WXIA 1Y8PB 1LO5D 1O7ZA 2ZXRA 2J4XA 3D8GA 3AB5A 1EWHA 1EL0A 5C44B 1IKMA 2K22A 5IGGA 3NVYA 3PZ7A 1LTID 5BN5A 3TP6A 3PUYA 3GTGB 1F9QA 4B9XA 1YQ3B 1JE4A 1S4ZA 5GXGB 2M56B 3H3VC 2CW0D 2GRIA 3AMZA 5IGCA 3NWSA 3I90A 3TP8A 3HEJA 3D4RA 5HI1A 4WORA 5MPOA 2L9HA 5E4XA 1ESRA 1PTOB 1QJOA 2PW9A 3VYTA 4YTMB 2E3TA 1F9PA 3Q8BA 2F0VA 3T3NA 1VF7A 5G3LF 4BS9A 3IT6B 3NVVA 2HDEA 2F0GA 3I4LA 1S5DD 2WXMA 2RDGA 3V96A 2PLPA 2CVRA 2YYZA 2Y3AA 4TKOB 4DA2A 1QILA 2LHEA 3FPPA 1STBA 2D5DA 1LT3D 2F4IA 2F0HA 2RVLA 2X69A 2SOBA 2A69D 4LTUA 4C80A 4RF1A 3GP7A 1NCVA 2H1EA 2BS4B 2HCIA 1LV9A 1KNAA 4ODGA 4WWMA 1ILPA 1PLFA 2L52A 1GUTA 1PTOH 3HOUB 3M7GA 4KGTA 5A2QL 1TKGA 2QILA 1C48A 3M85A 3J80E 1BBXC 4OO1G 5CR3A 4NZLB 4FF4A 1PRTB 1CQFA 1WXQA 1PGAA 1B1ZA 1HEZE 1F0ZA 2WXJA 1Q90A 3OWFA 1AZPA 5EE1A 2WINB 2NMQA 4DXFA 4K5WA 1A6XA 5HG2A 4FYDA 3H6MA 1SE3A 1KLUD 2WIIB 5LL6S 4KGRA 5FOBB 5T8IA 2FINB 1XLQA 5JAVA 4TMAB 4N58A 2QMTA 5I9OA 1NUCA 2AUKA 4MM3B 2N88A 3OHXC 3R3OA 2A68C 2HCCA 1RFKA 3X3MA 2AQ1B 3P1MA 2HDMA 1K50A 2ENBA 1TZOA 4V190 3WOFA 1B53A 4QIWB 5KRUA 1N5WA 3KLSX 1ML0D 4K2LA 4IUPA 1ENCA 5JEAJ 1HFNA 5KYLA 4A3JB 1E2WA 1PXUA 1W6JA 3NS1A 1G2TA 5TSSA 3SVMA 4ZKCB 4ZHOA 1NYQA 5IOCA 3A55A 1PYWD 3VYRA 2NB0A 3U52E 1E0ZA 1JB3A 3VRAB 2DNEA 5KNBA 1TKYA 3HOVB 4C3IG 4K5XA 1AYFA 1TVXA 2DN8A 2NTSA 4UAIA 2R7ZB 1U4PA 2E76C 2LFNA 2MJEA 1UUPA 5EKLA 2K5QA 2PZWA 3M3YB 3PO3B 3QOJA 1MGSA 2KA7A 3HOYB 1ZYRC 1WTPA 1TWFB 2M19A 1C4QA 3A8JE 1C77A 3UI2A 1OO9B 4WRDA 4FXKC 3IAS1 1ONLA 1BCPF 4A3IB 3KK7A 3NZ3A 1SJHD 1QB5D 3DXJC 1QE6A 3C8YA 4OL7A 2NN6I 1PFBA 1BMLC 5DM63 3O13A 2IGGA 5CYUA 3AE3B 4K14A 3BVZA 2PTLA 4JX1C 1JCKB 2PKOA 1AZQA 1IUEA 1XEEA 3J81L 4KGSA 3K59A 4RNAA 2J42A 5CV6A 4ITKA 1EIGA 2EYMA 3B2GA 5CV5A 3JAML 2K05A 2ON8A 4TQ1A 4IKGA 3WDNA 1KDAA 4A6QA 4C3HB 1MHXA 2SAKA 3RMHA 1X3QA 3R93A 4KKTA 2EY6A 1IYUA 4N9TA 1CA6A 5CBAE 5EKIA 1I4HA 5F2DA 1WTOA 2TSSA 2E6XA 1TYGB 1GXDC 1ET6A 3GD7A 4J8QA 4X3SA 4QF4A 2HTME 4JE3B 2W3SA 1PGXA 3FDTA 3N52A 2K9XA 5A35A 4A3BB 3H0GB 1BDOA 3HOWB 1S5BD 2HDLA 5T1IA 2WXQA 3NVWA 3W2DA 4XDXA 5ELDA 3MC0B 1LTRD 2R92B 3Q8FA 1EU3A 4ZAIA 2AWOA 1O7LA 5KGUA 3C1EA 4HKZE 2Z1CA 1C4AA 3J7AV 3A7LA 1WD0A 1W6KA 2JSVX 5I2YA 1KH0A 3A56A 4ZRZA 3PUXA 1QWYA 1V1PB 4R9WA 2F0JA 3I8ZA 1OQRA 1A3TA 1Q3LA 4J1MA 3FMCA 4HROA 2EPBA 1ACCA 1HRJA 5FR3A 2E2JB 1EZ6A 1KAAA 2NN6H 5JXVA 1BCPB 1DYQA 3DEOA 1DZ1A 1QKZA 4R8IA 4RWSC 3MXGA 4HTHA 2F03A 4OZAA 1PZID