1I4RA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.5
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4rA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4rA02
2QEJC 2IPKD 2XRSD 1TY0A 4RGNA 1LT3D 1EFID 4Z9CB 1I4QA 1KLGD 4L6TB 4C56C 2SEBD 1DJRD 1KLUD 1JR0D 1PTOF 3W2DA 1G8ZD 4TSSA 1V1PB 1BXTA 4RFBA 1LO5D 1PRTC 1RCVD 1S5CD 5ELCA 1SEBD 1D5MC 4ZYSA 1LTID 1TY2A 3BZDB 1BCPF 2J4XA 2CHBD 4DXFA 2Z8LA 3EA6A 1PZKD 4UDUC 1CHQD 1I4GA 1SXTA 1CT1D 1LTRD 1ET6A 2WV6D 1PRTD 5I4DA 1S5ED 2XNAC 1PTOC 4RGOS 4RGMA 1FNVA 4RH6A 3DWAA 1ENFA 1CQVA 4OHJA 2R61A 1PTOH 1JQYD 3R2IA 1HA5A 5FKAC 1AN8A 1S5DD 2RDGA 3BYTB 3DWPA 1B1ZA 1S5FD 4DXGA 3MFGA 3BVMA 1I4PA 1PTOD 2IJ0A 3GP7A 1CHPD 1QILA 1JWUD 1I4XA 3SEBA 4RGTA 1I4RA 1EEFD 1RD9D 1KTKA 3BYYB 1EU4A 1GOZA 1B44D 1LT4D 2AQ3B 1PTOB 1BCPD 2NTTA 1D5ZC 2QILA 1YN4A 3R2TA 1CK1A 1UUPA 1F77A 1ET9A 5D3IB 1SE3A 1DYQA 4BWGB 5ELDA 1HQRD 1RF2D 1YN3A 1V1PA 3V05A 1PRTB 1BCPC 1MD2D 1ESFA 1HXYD 1YN5A 1D5XC 1TS4A 1FGBD 4NZLB 1LTSD 5ELEA 1LTBD 2G9HD 1LLRD 3BVGA 1FNUA 1PYWD 3BVZA 3MC0B 2XRQD 1EU3A 5D3DA 1LTTD 1AW7A 1SJHD 1T5XD 3OWEB 5TSSA 5FK9C 4RHSA 1SE4A 1LT6D 5ELBA 3EFXD 4O1NA 3CHBD 4K6LA 1PZJD 5ELFA 1STEA 1EEID 1LTAD 1EWCA 1PZID 1UNSA 1XXGA 2ICIA 1RDPD 2XN9C 1LT5D 2AQ1B 1FD7D 1XTCD 1LTGD 1BCPB 1SE2A 1S5BD 1TS5A 2TSSA 1SBBB 1TS2A 1PRTF 2RDHA 3O13A 1SJED 4RHRA 2O2LD 3URYA 1L0XB 1L0YB 3DWQA 1D6EC 1V1OA 3KLSX 1JWMD 2AQ2B 2NTSA 4RCOA 3R8BA 1M4VA 1JCKB 1FNWA 1HTLD 3TSSA 1TS3A 1JWSD 1I4HA 4L63B
chains in the Genus database with same CATH superfamily
3S1QB 1WJ4A 3MHBA 1I6HB 1DOYA 4GXBA 2K39A 4MM3B 5M5WB 5LMUQ 5M5YH 2WDQB 1WGYA 4LNKA 3HOUH 4FULA 1SYGA 1EQQA 2F0UA 4WJ4A 1FJGQ 4A76A 3ULJA 2NS5A 1GJZA 4U673 2GI9A 4C4VB 3RNGC 4B3RL 1BKBA 4IW0A 4CJ2C 2M00A 3ZXVA 3E5SA 2H88B 3O65B 4LF8Q 4C3HB 3AU7A 3H9DA 1N36L 1I7HA 2RKSA 4KHZA 4DAPA 2ZJDA 2Z8LA 5BN3A 1QKZA 1T0SC 2DHZA 1HUMA 2AL6A 3I56A 5C0XH 4KKJA 3JC66 4RKLA 3Q6SA 1VR9A 3BDCA 2E2JH 4WWMA 4PMCA 4OW0A 4L5QA 2JSOA 3D3RA 3VR6A 1QUQB 2L52A 1KM7A 2NWGA 4B3ML 2K25A 4Y7NB 2X6GA 3R2IA 1SMYD 1S5DD 1OQQA 4A3EG 3BYTB 1IW7D 5IGDA 3K7AH 3HOZB 1P7EA 1NEKB 2L05A 2JA9A 4KK7A 1Y14B 3KH0A 5AZHA 2MBQA 2IGHA 1UD7A 1NMFA 2A73B 4KY5A 1QOFA 1JWUD 2KD0A 1F2RI 2KJ6A 5C4HA 1WGRA 3N3KB 4B0MA 5HY6A 3BYYB 1JT8A 3UIOB 5FLMH 3RNFC 2LMCB 2WXOA 3ML8A 2ZXRA 4HXDA 3VYRA 4POFA 1VQCA 3J80L 4PMWA 3Q22A 1GUOA 4W9FA 4YTMB 4EQ5A 2L5TA 1KHIA 2K01A 3PF4A 1RHPA 1XMQL 1Z5SB 2KDMA 5LMNQ 1ZYRC 2F0QA 2PNRC 2HHHQ 2B63H 1VJKA 2OJWA 3AE5B 1QCBD 3MJ5A 2BKRB 3ZGZA 3APCA 2PI2A 4LDTD 3QQ8B 4DV2Q 2MFIA 4GNXC 2WXRA 4PMBA 4F8MA 1TS4A 1YJJA 3IHPC 2D2QA 1TR5A 4JI8L 5COYA 3EFCA 2F3VA 1IYJB 4G50A 2LXAA 1EU3A 2MP1A 3CRKC 5EE0A 1D1KA 3QIJA 5JEAJ 2DZIA 1NVID 1OGWA 4EZJA 5EPJA 3U9SA 4IFDJ 4FHJA 1XO3A 4WWNA 1IBKL 1GNUA 1GUNA 3OMGA 1STEA 1J7CA 2KA7A 1EWCA 3HGBA 3QJYA 4DR1L 1N34L 4A75A 2DAFA 2BB6A 1V49A 1N33Q 2J0TD 2VB3X 1YX5B 3IXSA 4EZKA 2DY8A 1LQBA 1XTCD 1YNXA 2PIAA 1BMLC 3VAWA 2D3BA 4H0LC 1J5EQ 2IO0B 2KFJA 4GOCA 1CKOA 2JPHA 2KVRA 3S2DB 5KHQA 3P1HA 1TKYA 2NTSA 3DBHI 2K28A 2VQFQ 4MSMB 4DN4M 3GTGB 5IYDH 4DFAA 1QOAA 2AEHA 4IM3A 1CTMA 3TREA 1OFFA 1IYFA 4BY7H 4GN4B 1DOXA 1GPXA 1IL8A 1FEHA 5IGFA 3ND8A 4K0KQ 3K5LA 1F9QA 4GOPB 4LF6L 4HPMB 4DR2L 4O0AA 4BY1H 4ANWA 2HIVA 4MGZE 4HJGE 4A4IA 3U30A 3PIO3 3I4MB 1ILPA 3JAME 5ELCA 4X62L 1VZ6A 3TEZA 3ZRFA 2RDBC 3H0GH 1E9MA 1K51A 1D2BA 3PIP3 4NKLA 1FD6A 2F1MA 4DR5Q 2G1EA 1UEAB 3ALBA 2IY0B 1JQ4A 1Z9FA 2ZPNA 3WAPA 4R4TA 4A93G 4APVA 3RUZA 3WOEA 3S16H 4NP5A 3UQBA 5I9OA 5FLXE 2B8GA 4CDFC 1MG4A 4HKZE 5C2TB 3ML9A 1VMCA 2I38A 2D0OA 2DGYA 4ZRJA 4PQXA 4HK2A 2MBBB 2JP1A 4ABNA 4HPLB 3A8JE 4J1MA 3AU5A 3U4ZA 1I3QB 5EE3A 4AIMA 4JI3Q 3B08A 4LUZA 3P4PB 3AMUA 4OX9Q 2KECA 2KENA 2C9WB 1I4XA 3I73A 3F2DA 5BYSA 4AQ7A 1B8AA 1PVOA 3A4SC 2O5IC 2R92B 5KEEA 5KNCA 3UDFA 3HOXB 1QG7A 2MQHA 1OQYA 4JPSA 1GUGA 3OG5A 4JI1Q 3PHXB 3PO3G 4F7ZA 1S3SG 5AZFA 4G7HC 5HKHA 1CK1A 2J0KA 1DYQA 1Q12A 1CJEA 4ME5A 5ELDA 1UE6A 1N60A 4FXCA 2PQAA 3TBLD 3M95A 4DUYL 2EYOA 4DV5L 1HXYD 4BXXH 4FF1A 2R7ZB 1UELA 3Q69A 3PRMB 5JHAA 1FO4A 5EBCA 3JW0X 2MJDA 1YJ9A 4W9LA 1WY8A 4MJSA 1PFNA 2R7ZH 3QA8A 3OHXC 4W9KA 2L11A 1E22A 3Q24A 5JHBA 2MP2B 1OEYA 1IBML 2YVCA 4G11A 1VZ7A 3I70A 5JVG3 3CC7A 2O4XA 1PFMA 2FCMA 4JWSC 2JXMB 2OCEA 3HRDD 2K5HA 4QQBX 3PV0A 2K5QA 4IALA 4V0BA 1ZPSA 4MH0E 4MTKA 1L2FA 3DEPA 2N4FA 5C44H 2N9KA 3E9IA 1HNWL 2J53A 5M3MG 2PCFB 1B50A 1Y8NB 1L0XB 1D6EC 3FVQA 4DAYA 4K81A 4NJ7A 3RYTA 1K8GA 4ANXA 3KWLA 4KY7A 2JA7G 3AEEB 2XIWA 4XIGS 1WTWA 4RAUC 1E2VA 2KK8A 5CV4A 1SYDA 2D11A 5C23A 4BOZB 1TT2A 4C00A 2LGDA 4LDTB 1AARA 1AWDA 2K1BA 5E6JA 5G5GA 3UGBB 1FRRA 4FF2A 1PXUA 2F0SA 3IFWB 1XQQA 1MI2A 2KHWB 2K7VA 3RD4A 4TSSA 3ZQ4A 3M4YA 3MXGA 5FOBB 1HR0Q 2BTEA 2Z6KA 3LGJA 1RCVD 4HN7A 3T3OA 1TWCB 3BDLA 1E5WA 4WJPA 1HTPA 5IKCM 2ZTDA 1E6EB 1PGAA 3B1LX 1XCTL 1BF4A 3GTLH 1J7AA 1VQOA 3FPPA 2O5JC 2CCZA 3NQTA 4WFN3 1WE6A 2D3AA 3DOWA 4OO1G 3Q3MC 5IT9c 3R93A 3A9JA 5JJIA 5M3FH 3AM9A 5T1GA 3MWYW 5JVH3 2L83A 3RZOB 4NJCA 1Y56A 2KHSA 3ZTDA 4GMVA 1IBXB 3BIID 4NPNA 1T0YA 3A7AB 1HH2P 3RZOH 2INDC 5G3LD 2RDGA 4BKTA 2JSVX 2JA6G 1K8MA 3IAM1 2HCCA 4DXGA 1YHQA 3SDLC 1QOBA 2R6GA 4XYCA 2DWQA 1X6OA 4PZ6A 3LYYA 3ERQA 3QARA 3TEYA 5C5LA 3PUYA 1RLFA 2CR5A 1UZXB 2KDEB 2IX1A 5JJKA 4TV3A 3LWUA 2WHIA 4LF4L 2BT6A 2JA8G 1WWTA 1B44D 1C77A 2HJ8A 2L12A 2BYFA 4R4IA 2K5WA 2RSUA 2VQEQ 2EZVA 1F2RC 1EYCA 2KCNA 4A3MG 3VYSA 1IXRA 1FCCC 1LV9A 3VXWA 1WXSA 2FIFA 2K1FA 3A74A 4CKBA 3P1MA 3WAOA 2NVYH 3IVFA 4A3EB 4F7XA 2KOXA 3AE7B 1I35A 4IUPA 4CJ1B 4S17A 3V61A 1WM2A 2A69C 2IY1B 2SAKA 1RKNA 2RCNA 2J52A 1FGBD 4LF7L 2WB1E 4JQWC 4KSKC 1E0BA 2I07B 5HURA 5BMIA 3ZNHB 1VQ4A 4FADA 1TXYA 1SR3A 4CKCA 4HDQA 2F0IA 3IAYA 3VH4B 5JJZA 2HIXA 5BR8Q 1H9JA 1NBWA 4XQNA 2ZJPA 4DV3Q 2DY7A 3AE2B 3FMCA 3S14B 1FFVA 4IG7B 2LWPA 4I6NB 2DZJA 2QHOA 2JT4B 1E7VA 3P4QB 4GDKB 5NUCA 1VQAA 3I57A 2FXQA 2LZ6A 2K5NA 1I50B 2RDFA 3D0FA 1Q82C 3GTJH 3HKZE 2R93G 1BBXC 2ZZPB 4J15A 2KQ7A 1SNOA 2L00B 4KD4A 1VQGA 4LJZC 1C79A 1P1AA 2OHFA 3CIRB 5D7GA 1FVIA 2Z0SA 3DWQA 1YHAA 3GTOH 2QKIC 2E76C 4A3KG 5GROA 2ZNVC 4M8NA 1KQSA 2DZMA 1WTPA 4NB3A 3WOFA 3U7ZA 3HOUG 3KBXA 5AJ3Q 4AJYB 3P4SB 3DHIC 4Z9CB 1GVPA 4CDDC 4KKSA 1PA6A 4CDEC 2QEXA 2KFKA 2HD5B 2LVQA 1Z47A 3RN5A 3GTKB 3SVMA 3GO5A 1N62A 3VR8B 2WXNA 4OGQC 4DV4Q 2SDFA 2JZPA 1C9FA 4N8X1 1CA6A 3GZNI 4DQOC 2K52A 3GTKH 2H5XA 5C0XG 1WSPA 3K58A 1L2NA 4DV7Q 4IUTA 1MPEA 2F0MA 1UE5A 3AE8B 2D5DA 1SE8A 5DPTA 1STBA 5J39A 5EE1A 1IYVA 2KANA 2KHJA 1HJPA 5D94A 3TMEA 1WX9A 3BY4B 3V3XA 3VTWA 1M90C 2PPHA 3L54A 1HUNA 4IKGA 1O7YA 2NVXB 1C1YB 1X32A 3HM6X 1Y8PB 3JAMi 2PZTA 1Q1OA 4C7YA 4II3B 1NI3A 4KHPQ 1TT5B 3FC4A 1XF5L 5HGTA 1XCQL 4LUVA 2BDOA 2A6HD 1K0RA 2ASBA 2QSDA 2FUHB 3H91A 1T0RC 3VUXA 4I65A 1PMRA 4IPHA 3T51B 5FLMG 4GNXA 1N63A 4KX6B 2WAQE 1ENAA 1QILA 3VYTA 2K4KA 1QOGA 4GSWA 1QF6A 3RI7C 3ZNZB 1C48A 3S15H 1WYGA 2JRHA 1IL2A 3SU8X 2I0QA 3R7QA 4A93B 2UXBL 2FIDA 1PTOB 4G57A 1M94A 2B63G 1SROA 2OQKA 4A55A 4JI2L 5IP4D 3MHSD 3ER0A 1OXXK 4DK5A 3SK4A 1K0SA 2QDFA 2F0EA 1H95A 2GVAA 2E75C 2INCC 2DLBA 5CHFA 1HCZA 5JH5C 4WAAA 3A8KE 5GQOA 1P3QU 1WD1A 1PH3A 2FCQA 1PFSA 3H7PB 4NNJB 2F0WA 4R3DA 2AMCB 2N7EA 2DZKA 1O7IA 2EMTA 4IJHA 1D3ZA 1ZW7A 1ZXTA 1GAQB 4LFCL 3CCRA 5EQ0A 3GE8C 3HVZA 2MGSA 2V3SA 2G4DB 3N1ZC 2VY3A 1K28A 3EQLC 4DR7L 4ZYNA 4TUUA 3GDEA 1VCBA 2JXXA 1SJHD 3LWEA 4II2B 5IWAL 2UUCQ 5C4XB 1QLBB 1CQFA 4FBJB 2XK5A 3EROA 3Q14C 4HSVA 3TJPA 1SNPA 1QOHA 3B0AA 2LASA 2WQYB 2ZEQA 1WGKA 2WXLA 3QG1A 5C4XH 3S1RH 1PH7A 1X3EA 3PO3B 2UXDL 2OXPA 1E10A 3NBHA 3W5VB 1G2SA 3T56B 3TP5A 2BA1A 1WJNA 2Z9HA 4KN4C 2LHEA 3K9OB 1KOTA 1SNQA 1SE2A 1KDAA 5KRUA 1V97A 4LNNA 4DHJD 2EJGC 4QAYA 2F3IA 3GV6A 2D62A 1MG8A 1PH6A 2OQ0A 1R9TH 1G6ZA 1XMOQ 4BY7G 2R3ZA 4EE2A 3DVGY 2KBNA 3J7ZC 1NNXA 2XWBB 5LHY1 3RLFA 3L0OA 1NE3A 3OTOQ 2B76B 2QJLA 3T1HL 4GLAC 2C5CA 4BY1G 3VDYA 2IPKD 2IGDA 4NJ6A 4XZ4A 1O78A 1ICWA 2PW7A 3AFPA 4YHHQ 2MSED 4QMGA 2PW9A 3B9JA 1JALA 4P71A 5CV8A 5DCNA 5E6PA 2LUEA 3JAMc 4RF0A 3H0GG 2QCPX 1PH8A 1XWEA 2JA5H 3P75A 4GLSC 1UWVA 1BBWA 1SMXA 2WKCA 2K8BA 1DGJA 2Z4HA 1T6BX 3P2BA 2R7DA 4IFDI 3OIQA 3CSTA 1EQTA 3WCQA 3TBIB 1CSQA 4E71A 4B3TQ 4DXFA 3EA6A 5M3MB 2E2IH 2NCNA 3PVLA 2MNAA 1HNZL 1YD8U 2BE5D 4XTCS 5E3FA 1XLNA 2D3CA 3S2HH 2B39A 3D6CA 2F0PA 2V1YA 5FLXc 4J3OD 3E3XA 3S1MB 1FNVA 1ZXHA 4NQKE 1T3QA 5I2XA 1VF7A 3PMFA 3RLNA 3PRZA 1VRAB 4XYQA 4C3IB 1D7QA 3DBRB 4MELA 1FFUA 4WWPA 3CF5A 5L83A 1QNKA 2KWCA 3MXNA 4N9PA 2ZT9C 5DPWA 2UU9L 2WYQA 5EJWA 2UUAQ 2WGSA 4EOYA 4AYBG 4OVZA 4US8A 2WXHA 2RQXA 3R7RA 1CHPD 5F2DA 5L37A 2NPTA 1A8VA 3OMCA 4PS3A 1K3RA 4U68A 2R92G 2QCZA 3CCUA 1ENCA 2VZAA 4W9EA 1BCPD 4M00A 2KDFB 5IT9E 1B3QA 4GKJQ 2L0FA 1EOVA 4PK1A 2BYEA 4XDCA 3SDZA 2WINB 1UUPA 1MHWC 1ET9A 3PF5A 1CUKA 4NXML 1N61A 2PE9A 4BA2I 1V1PA 2JVCA 2M9VA 4FYDA 4LCDE 2R7ZG 1A63A 1QT9A 2JA6B 1N5XA 1YX6B 2LI5A 1QWYA 2FINB 2CJOA 1FXTB 1ZKHA 4JCVE 2IO3B 4HCNB 2ONQA 3J7AV 4LUOA 1K3BC 4WORA 1YBYA 2WP9B 3PZ7A 1VQDA 4RKBA 3QX1A 4GIVA 3HRZC 5D3DA 5H8YE 3U4EG 3CCLA 1H9KA 1TKWB 5CHVC 1SNCA 2INPE 5FJ8H 2N3SA 3HOVH 4FJVB 1F2MA 4O1NA 1FMAD 2N8NA 4X64Q 4USAA 1EY5A 1EF5A 1SYBA 4DUZL 1W3SA 2HDMA 5C44G 2J0JA 4A3MB 1C9OA 3UDIA 4DPGA 4DV1L 3Q8EA 1V43A 4C3JB 2UUBL 1JC7A 1JB3A 1JOOA 1TWFH 1IBKQ 3M4PA 4A3IH 4DA2A 4CJ0B 3CD6A 3CF6E 4FLHA 4IOAA 2WU5B 2BB5A 3NTIA 4RMFA 3F1ZA 1X3PA 4WJ3M 2QDLA 2DJGC 2LXJA 2FMMA 2K03A 3AULA 4LJPB 2EE1A 2O6VD 1ASZA 3TN2A 4KLKA 4A6QA 4CHKA 3V62A 1WGGA 4G4KA 4RGNA 3PO2B 1YZ6A 3DLLA 1FCLA 1I4QA 4XXEA 4ILWA 2NVTB 4DBGA 2B2UC 3W3AA 4JGHB 2E2HB 4XYOA 3JVZX 2EXZA 1G8ZD 3DUZA 2PMZE 4JI6L 4HEDA 4I6PA 3G71A 1EUJA 1L0WA 4E6IA 1EFWA 1NJIC 3DDCB 3L9AX 2K33A 3V6EB 1NR2A 2R93B 3SHLA 3TP8A 2UXCL 3GTQB 2NVQB 1SMYC 1MHHE 1N6ZA 2BBCA 1HTOA 1II3A 1IZ6A 5GXGB 3SK6A 4PT5A 1I4GA 3B2FA 2N9PC 1FM0D 1GXDC 2CFMA 3NHEB 5CV9A 5M5YB 4DHJB 5FO9B 5JOBA 3HOUB 1GHKA 3RT3B 1Z7TA 2LFNA 1WZ3A 1R4NI 2WXMA 1SYEA 4JLCA 2YLMA 5FR6A 4BBNF 2CHZA 1XPUA 2ZW1A 3HS0C 1E1OA 3H3VI 2F0HA 1A70A 2HUGA 1HZAA 1E2WA 3PRPB 4ZUJA 3BJUA 3AN1A 4YSZB 5BYQA 1SSNA 3UIPB 3VRBB 5GAHC 3ERSX 1E1TA 1VQ9A 1ZXIA 2EKEC 3I4NH 2E2JB 3SGIA 2H89B 2O2VA 2AHOB 3SEBA 2ATWA 4NQLB 4HJ9A 2MEKA 1XLOA 1JW9D 1NYQA 1ZOYB 2FHTA 2QILA 1HNXQ 1IBLQ 4K5WA 1JMLA 5HI1A 3LNNA 3RLOA 3MAQA 2CKZB 2I5HA 2B8FA 2Q2IA 2RHQB 3K7AB 4S3SA 3S17H 3A1QB 5LNK1 1OTCA 1STGA 3T1YQ 1GUSA 1PH2A 1TKEA 4HCPB 1HFNA 2LY7A 1HRJA 1ESFA 5C3XA 2FBWB 3NS1A 3OW7A 5IGEA 1P16A 1SRUA 3T16A 3D4RA 4JI5L 3FKIH 3M63B 2DAJA 3S2AA 1BO0A 5EBDA 5M5XH 4QCLA 4NW2A 4A3PA 1EWHA 3P63A 3IFTA 5J17A 1L6UA 2ZM6L 1ZP0B 2W55A 1AW7A 3NS8A 2LHDA 1R4MB 4DK0A 1JROA 2HTME 2IY5B 1U9RA 3NVVA 1VQ8A 2B63B 2EYLA 5IGCA 1V5TA 4K1RB 1PZID 3AEAB 2KCTA 4LNFA 1RDPD 2IO2B 1EIGA 2BH8A 1YQBA 1ZUD2 2EELA 4IUNA 4O2DA 2E5LL 2IBIB 3AE3B 3VR9B 3TIXA 1BCPB 4M8AA 3STBC 4X65Q 1S5BD 2ES2A 3L4PA 3CPWA 4YY3Q 1MGSA 2KQSA 2B2YC 3PGZA 5ELFA 3DBSA 5IN7A 2CWAA 1H9SA 3MP9A 4DXAB 4K8JA 4L5SA 1XYIA 3RNAC 2L9HA 1UF0A 4HIKA 3I3CA 4L63B 1ISNA 4C1NK 1WR6E 5ELOA 4DF7A 1GB4A 2Q2HA 4JC0A 4Q5VA 3U58A 4JIOU 2KHIA 4C56C 4DR4Q 3Q3JA 3K6OA 5MPOA 3HOYH 2LRWA 3D31A 2WXQA 4B08A 3C46A 2PQAB 3NHHA 2WXPA 1NSNS 2B2WC 5G5HA 2E8GA 4LFBL 3ZXRA 3NUCA 4N9TA 1WR1A 4LW1A 1QVGA 2GBKA 2RR9A 3KLSA 3G6EA 1VQNA 2PJHA 2RD0A 4MJSB 1VQKA 2NN6I 5G2NA 2KACA 2Z4IA 1PDXA 2FE8A 3CW2C 4GN1A 1U0LA 2HE7A 1RTNA 3WAMA 1Q46A 3UDGA 2I2YA 4BY7B 2WXIA 4UDUC 1WMHA 5K36H 1EYAA 1STAA 4KIKA 4EQPA 1UWMA 3Q3FA 4RH6A 2NZ1D 4ZOHC 3DWAA 2JWZA 4BY1B 3MC8A 3RMHA 3AXCA 3EGRA 3GE3C 1D1IA 4JI7Q 3UI3A 4W9DA 3D8GA 4MH8A 5CORA 5BYRA 4B3SL 4PZ8A 3ZJTA 1JJCB 4YCWA 2O6VB 3J81L 2ZPYA 2E2DC 3H0GB 2SOBA 3I5JC 3OJ4B 3X3MA 3U4VA 3Q8BA 3DBLI 4XDDA 2KN4A 1A3TA 1P0RA 1WI0A 1WRDB 2K6AA 4DAYB 2EYPA 4DGZA 3ZDTA 5BO4B 4JI0L 1M8AA 3PLVA 1I4RA 5LL6X 3K57A 1ZYRD 3S16B 2BGFA 4JV5Q 1EO6A 2IHFA 3F2UA 3X3NA 3F2BA 2N9EB 4EX5A 4N58A 2ZXOA 2CJNA 1DD2A 1J8CA 1WI5A 4LF4Q 1WGHA 2M56B 3Q6BA 4XQJA 2EVBA 3PQIA 4GN3B 2Q8TA 3HOWH 2CHWA 2GOWA 1F77A 3VDZA 1EY6A 1HZ6A 5JAVA 3AEDB 4ASWC 2KX3A 1K83H 3I72A 1E0ZA 1PH4A 1MD2D 3M7GA 3S1NH 3PUWA 2GVBA 5GAGC 3M85A 2Q8IB 3VR4A 3I7FA 4JE3B 4NZLB 1WXAA 1LTSD 3WWVA 5L95C 4WJOA 4AYBB 1FXAA 1VQ5A 5LMUL 4HVBA 2FMCA 3R3OA 4GZYC 4MN3A 4W9CA 5C4XG 3J80i 1MI0A 2YEPB 1FJGL 1OTRB 4ARCA 4NDXA 3OWEB 3I91A 5I9PA 1MVKA 1RIPA 4K2LA 3EFXD 2LMCA 3N20C 3RULA 4YSXB 2ALYB 2P5ZX 3HVDA 1LTAD 1X3FA 5E4WC 2G9DA 4LF8L 1WE7A 5A35A 2IO1B 3MHZA 3NY5A 3KUZA 4G0NB 4H2AA 5AUIA 2F0TA 1QZEA 1XNRQ 2KDIA 5C4JH 4H02A 2WFWA 2NUCA 3AH7A 2OWOA 3L0WB 2BVCA 1FYCA 3RD2A 1PQSA 4QIWB 2JUOA 2D07B 1SJED 3GB1A 5E7NA 2KEEA 3QOJA 4KMUC 4M01A 5C1ZA 4DK1A 4X66Q 4LF5Q 3K0YA 1X56A 1FXIA 1K73C 1VQIA 2MA9B 3HM3A 3ZO5B 4ZK9B 1F0ZA 1TY0A 3TS2A 2KTRA 2MLBA 2JA5G 1GC7A 2K5DA 3VR3A 3ABVB 1WH3A 5IP7H 4B95A 3U52E 5EKKA 5KIXA 5KHOA 1G291 2OEOA 4H7BA 2PVOD 5C44B 4URKA 1G2TA 3MTNB 3VR5A 1DOMA 2N49A 1JOKA 4K3BA 1WCMH 3SE0A 1CZWA 1Y1WH 1TKGA 1RODA 4OXPA 4C2MH 2WXGA 3P4RB 5LXIB 2JK8A 1HEZE 4WAFA 4CYEA 3QR8A 4HMJA 4D2KA 3F2CA 2N55A 2FCNA 3RZWC 3JSVB 1S4ZA 2GN5A 3CCJA 1SXTA 5D65A 1CT1D 4BAXA 4NMZA 2ID0A 3BINA 5LMNL 1ET6A 3QK0A 4A3JH 2HHHL 3X23A 1EF1A 4JWUC 3A55A 3K0XA 5IGGA 1T5EA 1CQVA 2W82A 3APDA 3EECA 1R4PB 2QA4A 4C3IG 4K7UA 3FKYA 1Y8RC 1HA5A 2MRPA 1SB3C 4AJWA 4WJQA 2KC1A 2KYWA 1B1ZA 3Q23A 4JVZA 2AL3A 5AUKA 2PLPA 3NVYA 3GTLB 2D10A 3BVMA 2WXKA 1I4PA 1PTOD 2K75A 1KABA 3BG3A 3G7LA 3GP7A 3PCOB 5CV7A 4CDCC 1SNDA 4FF3A 2DENB 2G45B 2W3RA 2BYTA 4OEMB 3AECB 3H3VC 1QZGA 4AS1A 2XEWA 4XGAB 5M3FB 1KTKA 1N8RC 2CVRA 4DR3Q 3J80c 4M8MA 1N33L 2AQ3B 2KFKB 2ZJQA 3TZDA 2CU3A 2GB1A 4LNIA 5M9OA 4JPBW 4GDLA 1J5EL 2GBNA 3JYUA 4TMAB 3RCZA 4KD3A 2FUG1 5HGQA 2MQJA 3PREA 4K14A 3WANA 1VDZA 2BA0A 5EGTA 1W6KA 2ZTCA 4IPGA 5CBAE 2BWFA 2D2CC 2BF8B 4EZLA 2VQFL 1CZGA 2DYBA 3E6ZX 1HA6A 2FFKB 1K53A 3H09A 3H6NA 2WS3B 3A0JA 3TEXA 2XVSA 4ZRPA 1VQ6A 5FJ8G 3HOVG 3SR1A 2WDVB 4K0KL 2E74C 1E90A 2AUJD 4YT0B 3KLRA 3M4OH 1PYSB 2KUMA 3OPOA 3GTPH 2EIFA 4HIMA 1TYGB 3NELA 5TSSA 2YTVA 5FK9C 3OWFA 2EQSA 4BKSD 1B70B 4K6LA 1WTXA 5CV6A 4ZRZA 1K8RB 2MBOA 4N59A 1Q0WB 5IWAQ 4US9A 2ICIA 3WIMA 5IOCA 2NVYB 5ELNA 3OAWA 2XN9C 2B2UA 4HROA 1G6PA 2CH4W 4C3JG 3DPDA 1FD7D 2L4NA 4UP9A 4DR5L 3NZUA 4LJOB 4JI4Q 4IQZA 2IYDB 1Q90A 4NXNQ 2UXDQ 3L17A 4GNXB 3O13A 1PHJA 3NVWA 2RDHA 4FXGC 3VR2A 4TQ1A 2J0MA 2O2LD 2M0XA 1VMPA 2A68D 3R8BA 4DDID 2I1KA 3N1YC 1GB1A 3P20A 5CHWA 1J0GA 1EWIA 1JCKB 1BNZA 2LGYA 1B9NA 3K8AA 1SFOH 1HZBA 2N9XA 4AQYQ 4X6AH 1YMHE 5CYUA 1ONLA 4RNAA 2ZTEA 4QUCA 5FLXL 3PO2G 3W5OA 2FCSA 1C4PA 2VNUD 3NEMA 3CMMB 3A9KB 4DHZB 3Q2AC 1LACA 2JZ3B 3Q3NC 2QDBA 4LF9Q 3GTJB 4IM2A 4C1NI 4JI3L 2RGFA 3KJOA 2BKFA 4RFBA 4WJNA 1KNAA 4CO7A 4OX9L 4L5TA 2Q2TA 3VHTC 3UQAA 3HUIA 5EKIA 1WOCA 4CBVA 3AE4B 3VTUA 3GTOB 2V9HA 4ZYSA 1V6EA 2F0OA 3BZDB 5GADC 4ODGA 1NTGA 3TP7A 1GUTA 2XBBC 3QCAA 2A74C 5IIFA 4NAWA 4JI1L 3KF6A 3ZYYX 5C3EH 4EKUA 4H13C 2CQAA 2K8CA 2XK5B 3NBIA 3ZJVA 2A6HC 5JEAH 1WYDA 3ZDMC 1PRTD 2WU2B 1S5ED 3EIVA 1PDQA 3WDNA 1NUCA 4IFDH 3C19A 1NCVA 2M2LA 4QUFA 2Z1CA 3KDFB 3KF8A 3NBHB 3CCVA 4M02A 2TMPA 2HCIA 4BS9A 3I8ZA 2ZCCA 1L4DB 3BDOA 3PIPA 4GGQA 5GMVA 3PS6A 3A4RA 2WLBA 3I4NG 1KRTA 1YJIA 5E6NA 2EY1A 3FPUB 1GO3E 4JYAQ 4IWQA 3DM3A 3U9OA 5C3WA 1SNMA 3KJPA 4LFAQ 4X3TA 4HWIB 4OWXB 5H1SE 4W9IA 2A6EC 1L1OB 1FL0A 2K22A 5IE8A 4IDIA 2MCNB 4I7ZC 2UWQA 1SF0A 2A69D 2B3GA 2F0GA 1EIHA 3CCMA 1N32L 4J6IA 1IBXA 5D3IB 3RNUA 3CCQA 1ACCA 2INNE 1PLFA 3AU4A 3J9CA 2X6LA 1C4QA 2F0JA 4YWMA 4X3UA 3RMKC 4A8XC 4ZLTF 5JZEB 1D4BA 5EKLA 1D5XC 4RM8A 4JG2A 4DWFA 5BMGA 2EXDA 4O42A 2AUKA 2LJ5A 3N52A 2YU9H 3S15B 1QQRA 4YXDB 3QHTA 4KGSA 1PYWD 2B2YA 5C0XJ 3E9SA 1QZHA 2RMMA 3Q8AA 3AI5A 1PYBA 3KYHC 4REZA 1YEZA 2V1CC 1T5XD 4JW0A 3AMZA 2CQOA 1HR0L 1VQ7A 1JRUA 4GKKQ 1U4AA 2KDBA 4K5XA 4W9GA 4DR6Q 1JICA 2IGGA 1K52A 1LFDA 3C8YA 1Q1EA 2RPQA 1I94Q 2BOSA 2CWPA 4BA1I 3P42A 2A8VA 2F4VQ 4YWGG 2XTIA 1QVFA 4KKIA 1P98A 2V3PA 2B2WA 4TKOB 2VRRB 4QGUA 1RRBA 3L13A 1SBBB 4DV1Q 5EE9A 3OIPA 4ZKBB 5K5PA 2ASQA 3D4DA 2NPTB 1TWGH 4HR7B 3NUHB 4GS3A 3J7A5 2LGXA 1HPCA 5LXHA 4RCOA 2NB0A 4XDXA 4YL8A 2DN8A 3A5UA 4LWCA 3HKSA 3LDZE 5J1ZA 3TSSA 1TS3A 3HOYG 1N9WA 1JWSD 1WD0A 3M3YH 5BMHA 4RF1A 2VB2X 1TWAH 4GLXA 3S1RB 1F9JA 4MEMA 1LT3D 1EYDA 3TQYA 1JOQA 2SEBD 1DJRD 3I55A 2RF4A 2EKIA 3C0RB 4X3SA 2BE5C 4KDLB 4IZ8A 3CQZH 1ESRA 4TVAB 1V1PB 3EVQA 3NG0A 1EY8A 2BDNA 3I4LA 2PO4A 4IUQA 3CKIB 1VQLA 5CX3A 2V4IB 1ILQA 2BS2B 2IHEA 4OONA 1WTVA 4JX1C 2BW2A 1R9TB 3AYHB 2IX3A 2LKVA 5IYDG 5K36G 2CKHB 1BCPF 1NR4A 2HDLA 3DVNV 4OVUA 2F0LA 2Y3AA 3LXFA 1HTQA 1V1QA 2VQEL 4Q2JA 1QVCA 4ICVA 1BQQT 1A15A 1XNQQ 2UXCQ 1PUTA 2B2VC 1U4RA 2FAZA 1LTRD 2IL8A 2MJ3A 4IWPA 5JXVA 1C7YA 3U7DA 1LXDA 1TWHH 4A20A 4M0WA 3KBGA 2JA5B 2MPMA 1KAWA 2N0SB 3QO2A 2DNFA 1XJVA 1BDOA 1XX8A 3DWMA 1AEXA 2WX0A 5HG2A 2NBVB 5E6OA 5LLIA 1S5FD 1KNEA 1EY4A 1SAPA 2PYKA 5KNDA 5FO8B 1KJTA 2E2IB 2K8HA 3VFKA 3MFGA 3AQQA 2EYJA 4QF4A 3BK2A 2YTYA 2JEBI 4KKTA 1AE3A 4MACA 4XE0A 5BR8L 4DV3L 3S2HB 3ITPA 2BPSA 4B3RQ 1LYLA 3BU2A 2F03A 1K9MC 1N36Q 1CA5A 3H3VH 3DHHC 1D8LA 2Z6BA 4DNTB 2Y0SB 5A2QL 3PSIA 5DPRA 3BK1A 4DAVA 1RYJA 4IURA 2KN5A 4QY7A 4LMQD 3J81j 2RA4A 1E8YA 1GC6A 3LJ3A 1YNJC 5FR3A 1W2BA 1WJ6A 2KMMA 1MSGA 3RZDH 4CQNA 1J8IA 1YVCA 1YNND 5DEHA 1XD3B 1PRTB 3J7YW 2ZW0A 3APFA 3QAQA 3UINB 4B3MQ 5LL6S 4JBMA 4A3LH 3CRLC 5AZGA 5IYCH 4A3DH 4JBJA 1YJ1A 4GU2A 4DV0L 4S0RA 5AJ3L 2X69A 1IP9A 1C4AA 2ZVOA 2LXKA 2OJRA 2BQQA 2V0GA 2CW0C 4A3GH 3BVZA 3HK0A 5HHDG 1BUVT 1C8CA 3T8MA 1E2ZA 4IUVA 5CGKA 3CC4A 3S9WA 1V8CA 3L10B 2IX0A 2KLGA 2JA7H 3QJZA 4OZBA 2YV5A 4WURA 5ELBA 1OQRA 3N6RA 2JYOA 3OYYA 4K6DA 3J80E 1EEID 4GOPC 1YOVB 2LD9A 5IAAC 2Y5CA 4DV7L 2DJFC 1EUVB 4BXXG 2KLCA 2AQ1B 2MBHA 4ICUA 4P1CC 1YQ4B 4J8QA 1Q86C 1ROEA 4BBSH 2F0DA 2KVZA 3ONSA 1XMQQ 2O2VB 2F3WA 1GHJA 1STYA 1V1OA 1RFAA 1JWMD 1AP0A 2ICEC 1M4VA 1HTLD 3HOVB 1E24A 1U5KA 2MHJA 2Y5BB 2OF1A 3GTMH 4YCUA 2LVOA 1YHBA 4DK6C 5CV5A 4KHPL 4B0EA 3AFQA 4HJAA 4JI8Q 3KOJA 3ONAB 4A3FH 3AEVA 2VUMH 2WXJA 2Z0EB 3CWIA 1Y1WG 4HKQA 2IW3A 4UP7A 2K0PA 2EY6A 3W2DA 4A3CH 1TWFB 3NOBA 4A3IB 4K7SA 1WJUA 2JYTA 1CMXB 1JE5A 3IL8A 1OXSC 4OWWB 2KXJA 4P75A 2N88A 3M9BA 4DR1Q 1N34Q 1RJTA 3MC9A 1T9HA 1WIAA 1YJWA 3MFYA 2AKWB 3DEOA 1Y1VH 1A5RA 1F9SA 4A3JG 2CU1A 2L0CA 2NMQA 2ZNVB 4HPPA 1IHZA 1CHQD 1E3PA 2DYMA 1EY7A 5ISRA 1IPGA 4DK3C 1O7ZA 1VQJA 2WV6D 5I4DA 5IYBH 3EBEA 1KRSA 1ASYA 2R2OA 4RGMA 3KW5B 1XPOA 1TBEA 2JA8H 1KXLA 3ZJYC 1Q10A 1PH9A 3DBHB 1K8OA 1WTHA 2NN6H 1AFPA 2X8XX 3KUDB 1U4PA 3ZJUA 2LEKA 3E0JA 1Q81C 4XQQA 3DWPA 4N6EB 3QB3A 4FN2A 5JPMC 3AB9A 3J81E 3DMUA 1WZ0A 2D3GA 2M8SA 3KFUA 4B6WA 3EJIA 4RG1A 4LF6Q 4TQ0A 4DR2Q 2UUCL 1DCZA 4HLEA 1H9SB 1TGZB 4R9WA 1X3QA 1VQMA 1L7YA 3I3TB 1JMCA 4XT1B 3HKZG 2C7NB 3UE1A 5M3FG 3KYCD 4X62Q 1RD9D 1IW7C 3H94A 1HR0W 3HHMA 4KVGB 1EU4A 4HJ5A 4GB9A 4ZHOA 5J2RA 2NTTA 2PQEA 4EQOA 2B3AA 2K3UA 2W3SA 4FXKC 4KN7C 4AH6A 1R4QB 3ULPA 1WXVA 1WJJA 2VS1A 3CCEA 1MBYA 1B2TA 3A7LA 1H9RA 3UDXA 5CC4A 1NENB 2C5LC 3KUCB 1XMOL 5J22A 1WFYA 4CGYB 2ACZB 4H44C 1KRHA 4E74A 5EAYA 3Q3OC 4L8JA 4HJ7A 3I4NB 3L08A 3Q8FA 5JJLA 5CTRC 1S40A 1F52A 5ELEA 1ICFB 2JYEA 1CI3M 2VL6A 1LTBD 4YHHL 3HG9A 5JPNC 1Y8OB 3NJTA 2XWJB 2K6DB 2EPBA 1PGBA 2K14A 2RPVA 4A3BH 2JE6I 4BVUC 5KGUA 1C0AA 4A3KH 1L4ZB 4LTUA 1IUEA 1L5PA 4KHVA 1P9DU 3IT6B 4X57B 3CHBD 3S17B 1F9PA 1FPYA 4TKNA 4RA8A 3TCAA 1R7SA 1PZJD 3S1QH 4BBNC 1I6HH 4KKUA 4PG3A 1ZEQX 5M5WH 1HZ9A 3ZNID 4Y52H 1LT5D 4B3TL 1MFWA 3X0WA 4FJYA 3L16A 3FKIB 3ZW3A 4WQMA 5M5XB 3TEHB 3AEBB 4RHRA 1NYRA 3VH3B 5EDSA 3VYUA 2AQ2B 3AE9B 4C3HH 2JY6A 5KYLA 1FNWA 5DAUA 2IDYA 4DUYQ 4DV5Q 4ZCKA 2F0KA 2GBJA 3D32A 3DBRI 3A56A 4JL9A 4RMAA 3PLUA 1CM9A 2J42A 2QEJC 3RNCC 3KLWA 3ICEA 2WAQG 3QIAA 1BT0A 2FJ2A 4HEA1 4L6TB 2KJXA 2ENBA 5BN5A 1NBFC 1PGXA 2E3TA 1DOKA 2PZWA 4KV6A 2UUAL 2NYZD 1S1QB 2F0NA 2LGIA 1W6JA 4DNRB 1IBMQ 4P6VF 1CKNA 4QB4A 4Y7NH 4P74A 2C7HA 1XEEA 4KTAA 3CAMA 1GD7A 1MKHA 1H8CA 5C3EG 3K5NA 3HOZH 3J7AF 4OO1I 4ME3A 5JEAG 1HZCA 3TEWA 3AEFB 2KEDA 2L55A 3M4QA 2AX5A 4GKJL 3I4OA 4IFDG 2PI2E 2JN4A 4W9JA 1HNWQ 2L76A 5D2MB 3RR5A 2N78A 2N1VA 3HOYB 1RTOA 2KOLA 5IT9L 3RNBC 1U4MA 4JOIC 4YTPB 3MJWA 2L15A 1ENFA 4OHJA 4ALPA 5IA7A 4M1UB 1H9MA 4WRDA 2J7ZA 2PEAA 1QB5D 3ETRA 3ZTCA 3Q8DA 4FNFA 1MIUA 2KAJA 4EGVA 2EYMA 1SYCA 1DGSA 3PGEA 5E4XA 3OW2A 3HIZA 4I6LB 1EZ6A 2Y5PA 4ZKCB 4EUTA 1STHA 1B4OA 5DM73 4X64L 1KH0A 2PKOA 4LNQA 2GA4B 3FILA 4DV6L 2KWDA 2WDTB 2KTRB 3R3MA 4BKGA 2NBWB 4A9AA 2EYFA 4FO2A 2WDRB 4IUUA 2JQRB 3PTFC 2DUDA 4E3CA 4N8FA 1UWXA 3NE5B 3T53B 4MM3A 1SE3A 2V4LA 3SFDB 1HQRD 1YN3A 2PVGC 1VLBA 5T8IA 4OWTB 3KUPA 1IKMA 1YN5A 3K5MA 3QOLA 3BS1A 3NTHA 1EZ8A 4HJ8A 4QJFA 2ZVNA 3PSEB 4LNOA 1J19A 4C4VA 4BFRA 1C78A 3L2PA 3CSFA 1V9PA 4P2CB 3BVGA 1IGDA 4UPAA 1FNUA 1F9RA 3MC0B 3S2DH 3MA2B 1SIJA 3OJ3A 3K9PB 3L3OC 2R7FA 4PS8A 1LTTD 1LABA 4HMIA 3T13A 1QE6A 1MJEA 4PV1C 3A54A 3GTGH 3HOWB 3NRZA 4C80A 3W1SC 1OXTA 2NZOA 3STBD 4ZAIA 2IZVB 3RZFA 3B2GA 3LX0A 2VH1A 3NZ3A 2QW7A 1GJXA 1QUQA 4WJWA 2LJIA 3TUOA 4K3CA 1GG3A 2WACA 1K83B 2AYOB 2L0TA 5BN4A 2UYZB 1YIWA 3S1NB 3A1QA 4RWSC 2PNHA 5D6JB 1WFQA 1YNTE 1A0IA 3UE0A 2VXWA 2TSSA 4AUQC 1L0VB 2MX2A 3I4MH 5C4ZA 3PT2B 2UU7A 4MDKE 3ENEA 2IT1A 4XC2A 3HP3A 3U2SC 4MGYE 1GUAB 1L1OC 2SNSA 3A9JB 1I4HA 2PZUA 4LF7Q 1XLPA 2C35B 3H8HA 2B2VA 3U8ZA 4GDLB 1PV4A 4BBRB 5CMDA 1NMGA 1KLGD 2ZJRA 2OT2A 4KV2A 1PTOF 4HTHA 5C4JB 2B2TC 5C0XI 3HZXA 4BBRH 1E7ZA 1B9MA 4HSPA 1LO5D 2KQ3A 1L6VA 4MTNA 4ANUA 3WALA 4BZAA 3ZLZA 3I90A 3OOCA 5C5MA 1LTID 4IWOA 4XWTA 3MZ5A 1SSOA 2EDGA 3NENA 1BUIC 1XT9B 1I3QH 2AWTA 1HNXL 1IBLL 3D4WA 4UHVA 3MXUA 3NTKA 5C6AA 5I6YA 4MSQB 4ZHPA 1UE1A 2D0PA 2WIIB 4G7ZC 1ZDXA 4EQNA 2GRIA 3DCGA 4RGOS 5G3LF 1PTOC 1LTLA 1P7FA 3T1YL 1G91A 3EUB2 1X3GA 4HIOA 1K50A 3IT4B 3OLMD 2R92H 3HOXH 3TP6A 1HFGA 2I5LX 2R61A 1I5FA 3PUVA 2NBUA 1WCMB 4ULLA 1A2TA 1Y1WB 4MGKE 2L1AA 4C2MB 3EFUA 5C3JB 3RUIB 1OO9B 2EJMA 1E8WA 4DDGD 1XTDA 2AWNA 1EL0A 2EJFC 4NPSA 1MSHA 1R4MI 4OIKA 1GM5A 4F8CB 1DOLA 5I2YA 2IJ0A 2G4SA 3C1FA 1PFDA 3E0EA 3T3NA 3HEJA 3GOEA 1Q8KA 4RGTA 4A3JB 3GZNB 1EEFD 3CXCA 1EY0A 4DKAC 3PHWB 4FJZA 3FDTA 1GOZA 2HQLA 2SNMA 4XX5A 4K2KA 1P8LA 1LT4D 2KTFA 2Y0SG 1D5ZC 3GV3A 1WYWB 4WH4A 2WB1B 4MZ9A 4KGTA 2LS01 4X65L 5H92C 3J81i 3SK5A 4DV2L 4A3LG 2BS4B 4YY3L 2LFIA 4HDOA 3DHQA 1UE7A 5IYCG 4GOPA 4A3DG 1UBIA 1JJ2A 3CP0A 5GAEC 2PMVA 2O6VA 1N32Q 3B6YA 1PH5A 4A3GG 2CHXA 3N32A 1VQBA 4NAWB 5G55A 2YYZA 2K05A 4KGRA 4P73A 3KF6B 2EY5A 3PUXA 1TU2B 4R4QA 1RL2A 1Q3LA 1M1KC 4DR4L 2OTJA 4V190 3HKZB 2WP8J 4ARIA 5IP9H 1WTRA 2A5UA 3DVGX 3A33B 2DNCA 3KF8B 4RHSA 4B9XA 1LT6D 2JJQA 2F52A 2RVLA 2A68C 3G48A 1EWYC 2VZKD 1DZ1A 4EFOA 1AZQA 3GS2A 4P1BC 3DM1A 3SHQA 1UNSA 4J6HA 5J3BA 4BBSG 1EQVA 2MWSB 4AYBE 3V6CB 2GLSA 4C7ZA 1S3OA 1CZPA 2UXBQ 2MH7A 1FGUA 1OXUA 3BZKA 3FHWA 3NVZA 2K9XA 3MEFA 4JI2Q 2OEDA 2A1AA 2BH2A 4HRSA 2K6QA 3W1YA 2D9UA 1TS5A 1PRTF 3MVVA 1J7BA 4JBKA 3PO0A 2GBMA 1TWCH 1TZOA 1QNUA 4RM9A 3M4OB 4LAAA 1B3AA 5AFWA 3GTPB 3ZNGC 4ZRQA 3I9V1 5E1FA 2VUMG 3AE1B 4A3FG 2Q8RE 3WA0A 1SDFA 4JI7L 1V80A 2A4ZA 3T4AC 2KVMA 4A3CG 4KDIC 4LFCQ 3IBEA 4L2YA 4FA6A 4QIWE 2KNBA 2G3QB 4W9HA 4FDBA 4DR7Q 1KLUD 4FXDA 1JR0D 1S72A 3W9CB 4R4CA 4A3IG 3K7UC 4TRDA 1TQOA 1RWSA 4YCVA 1KL9A 4F87A 2N1WA 1EIFA 1PH1A 1PRTC 1Y1VG 1S5CD 3JAML 1XPRA 4IUMB 2KMAA 1KIXA 2NVUI 2QGQA 4JV5L 4NAMA 4POGA 4P7IA 1N5WA 1EYGA 2Q2UA 1V9JA 2K5PA 2QF7A 2CHBD 1SFOB 2EYHA 5IYBG 4OVVA 2KJHB 2H1EA 5CBEE 4I7AA 3M62B 4K7WA 4HCSA 2NN6G 1JB7A 3VTVA 1E8XA 2ZXPA 1E8ZA 2W54A 1YIJA 1A3VA 2XNAC 1TIFA 2MP2A 1ZKOA 3ZVVA 1DM0B 4LLGM 2KCCA 4IC7B 2WAQB 1B9RA 1WTQA 5EPKA 1Q1BA 3J81c 1JE4A 4FVMA 3T1HQ 1EM7A 3L7ZC 4ZDVA 1TIID 2A5HA 2K50A 1X54A 1Q5WB 3V2TA 3LB8C 1F2ZA 3A5ZB 2RBMA 4A3EH 5C3EB 1O7LA 2KWUB 2PPBC 1HQMC 1FRDA 2L32A 2WWZA 3MTSA 1A3UA 2LSSA 4CHTB 3GQBA 3K80C 4JK1C 4HAEA 1WX8A 3JSVA 2KO3A 3ZRCA 1NI2A 4UAIA 2BYVE 2F0VA 1UH6A 3QC8B 1XNRL 3DHGC 1A6XA 5A2QE 3KYDD 1HNZQ 1HE8A 2EY2A 5EPLA 4YIJA 2K04A 2H4OA 3PIOA 2ZCBA 3AEGB 4A3OA 3S14H 1B53A 3KQ4A 3SXHA 3CU7A 3Q0AA 3GD7A 1KD1C 1WX7A 3TZUA 1Y69U 1C76A 2YTXA 4X66L 1IKLA 3ULLA 4LF5L 1I50H 2JX5A 2HJ1A 1LM0A 1WXMA 4A3BG 1ML0D 2OTLA 3KVFB 1VCIA 1TTNA 4FF4A 4PS7A 2OOBB 1FR3A 4ID6A 1LLRD 4N9F4 2Q5WD 2N7DA 3VUWA 2XRQD 4UY8C 2UU9Q 4IJLA 4R8NA 4YWLA 4DV0Q 2JXTA 1YITA 1X9NA 2HDEA 5DPSA 1VD2A 1SE4A 4M0WB 3NWSA 3RPFC 1MJCA 1KF6B 3T9LA 5J18A 1XXGA 2M17A 3IKJA 4R8IA 4F1SA 4EVOA 1WGDA 4P16A 3VUYA 1UBQA 3V60A 4IN3A 3FKIG 2JU6X 4C3HG 1V8QA 2BWES 2YU9B 1RFKA 2L8JA 2R2QA 3AB5A 4KJOA 4NXMQ 3ZKJC 1WRIA 3EHVA 2HQEA 2F4IA 3C3LA 1ZGUB 1GKHA 3KWVA 4L1BA 2I1JA 3C2PA 2XSCA 1EIYB 1VZ8A 1RAXA 3V96A 4AP4C 4OZAA 4B9WA 2M1MA 2HD3A 4PNYA 3N30A 1DXMA 2MJ8A 2XRSD 4FHKA 2L7RA 1EFID 3N1XC 2N9LA 3HFZB 2WNMA 3SFEB 2K5VA 1EOTA 4JOIA 1AE2A 4LK1C 2JF5A 4AWJA 3K81C 3HOZG 4PYUA 5IGBA 3C1EA 2WKDA 3MXNB 3NQIA 4CKEA 2NVXH 2DX5B 4K5VA 1TWGB 3NP8A 4DUZQ 2L1BA 1KDBA 4RCNA 2VZKB 1D5MC 3TDQA 2NZHA 4JBWA 4DR3L 1JORA 4DHZE 2EMSA 3CPFA 4XWWA 1T0QC 3SR6A 2UUBQ 3M3YB 1PZKD 5DM63 2QIEB 3PZ8A 1TWAB 4QL5A 1CSPA 5LMNW 2REXA 2JEAI 5KNBA 1JWBD 4LK0M 4ZRKA 2I5MX 3W5UB 3CQZB 5IO9A 2KCMA 3A9KA 1SLJA 4ZQ3A 4A93H 1PTOH 1JQYD 2KX0A 4OL7A 5FKAC 2J7QB 3IRBA 1AN8A 2PE6B 2LVPA 3H7SA 5AEKB 1AYFA 3VRAB 2LGSA 4GDKA 4KSLC 2A6ED 3I2ZA 2RCFA 4JI6Q 1EY9A 2KC2A 3ZIMA 3BWUD 1F1HA 3UF8A 2NBFA 4R1JA 1VF5C 4HJKA 1YNNC 1SN8A 2MO1A 4ACFA 5IY0A 1KLVA 1HHVA 5TR5A 4XT3B 4OELB 4MNOA 1TWHB 3CMEA 2A19A 4FP5D 1BR9A 3PPAA 4YTNB 2I46A 4JI4L 3PV1A 3H15A 3W1SA 4NXNL 3KDFA 2LRUA 3R2TA 1AZPA 2VH2A 1NY4A 4WIPA 4MIUA 1LUZA 1X1MA 3Q8CA 2F0FA 3P7JA 4WWOA 4DAMA 4YWKA 1VS0A 3AE6B 3PO3H 2C9OA 3V05A 4MGIE 3KK7A 1BCPC 4IM0A 3ECIA 3RFZB 1HZ5A 4AQYL 1R4NB 1K8AC 1EQRA 3PUZA 1UGMA 2CS4A 2BS3B 1UGJA 2DNEA 1KAAA 3FRPB 4ZRIA 3NSWA 3A8IE 1V2YA 2KT7A 3F8TA 5D14A 4LF9L 2AWOA 3MEHA 3D6WA 3TS0A 1ZE3D 1KC8C 2HTHA 1UEBA 3IAS1 4G3XB 4NY0A 3HOWG 4R4OA 1I6VC 1OEYJ 3K5OA 1L1OA 1SE9A 3VVWB 4ZUIA 2GMIC 3RZDB 2L3ZA 1UAPA 3RNEC 3TMPB 3ZUNA 1H4RA 4YSYB 1E7UA 3EC8A 3I4MG 3VA5A 1F2LA 3PZDA 2B2TA 3NXWA 2PTLA 4HCEA 4A3DB 2XGTA 3DXJC 1LTGD 1B7YB 4EEWA 2KJRA 4A3GB 1MHXA 1U4LA 3URYA 3G4SA 4KJNA 4BWGB 1NDDA 2D5GA 1IGCA 2PMZB 3NWTA 1V81A 3DWGC 2JA7B 1JJGA 3DVNU 3IFDA 5M3MH 4KZ0A 3NZSA 1C4CA 4IOIE 1XLQA 4JI5Q 3H6MA 2RHSB 5DNFA 1A62A 1BVSA 4L5RC 4BBRG 1KDCA 3CMAA 4DV4L 3W1GA 1OXVA 2V3NA 5T1IA 2C7MB 2Z0DB 1GUWA 2ZM6Q 3S1MH 4JYAL 1JRPA 4F88A 2FNJB 1BXTA 4BBSB 4GN5A 2M19A 3FP9A 1AH9A 2MJEA 3ND9A 4DNIA 4LFAL 1Z2MA 4C3IH 4OIJA 1SEBD 3QWZB 1WTOA 3CCSA 3IG3A 4WQOB 4KI0A 1TVXA 3H1UA 3H7PA 4IOCA 1TY2A 2JRIB 1E7PB 2J4XA 1FIQA 1SIFA 2JZZA 2E5LQ 2EOTA 4GLVB 3GTMB 1IYUA 3G6JB 4DU9A 2LXCA 4TQUS 3HOXG 2KMCA 2MBEA 2DBYA 2VUMB 4A3FB 3NPPA 3VQIA 3W1BA 5IP7G 2M4NA 2QC8A 2MUYA 1BOSA 5FO7B 1VQPA 1G6JA 3BZCA 4IPDA 2YEPF 3R66C 1LM8B 1QJOA 3K59A 4OO1H 1WCMG 2V4DA 2Z6KC 1O80A 4IPCA 2MHVA 1G51A 3TRZA 1LGRA 5IOIA 1BBUA 1ZDVA 2IWHA 3SD5A 1PFBA 1Z6HA 5HFYA 1Y1VB 2B29A 2G5DA 1JWAD 2KQ4X 2MW5A 3EN2A 1CKMA 2RSOA 1STNA 4K8IA 3U50C 1WVLA 4BKSA 1WF9A 3DQVA 4GKKL 2JA6H 1V86A 4LFBQ 1X55A 4DR6L 1A2UA 1RM6C 1YNJD 4IO9A 2KKCA 1Q7YC 1MJDA 1I94L 2JA8B 5I6WA 4P72A 2PW5A 2F4VL 2DYOA 1SYFA 2HT1A 2MO0A 2CH4A 2WB1G 2JWUA 1DONA 1YI2A 4BOSC 1V5OA 4PZ7A 4DV6Q 1YN4A 1CKNB 5DLQE 4KZCA 2BCOA 2CW0D 2E6XA 2C60A 1C3TA 1RF2D 2K32A 1YQ3B 3RN2A 1NAPA 4Q0FA 4A3MH 2KWVB 2X38A 2RSNA 5IODA 2VW9A 4ANVA 3AV8A 3NK9A 3TL5A 3E56A 4C3JH 2Y0SE 1F2YA 5IP9G 3MXPA 4B3SQ 1TZ1A 1WM3A 3VA7A 2LUMA 2W9NA 4ITKA 3QWNA 2G9HD 1SGHA 3UI2A 3N9YC 3CC2A 1DOIA 3DBLB 4MHEA 1CFMA 3M7NA 4AOFA 1VQHA 1TJEA 5KYIA 4A90A 1YJNA 2Z59B 2N7JA 5CR3A 1KFYB 3FEWX 1WXQA 1Q8IA 4JI0Q 4MT5A 2M0AA 4PYZA 1VQFA 3PO2H 2WX1A 1I42A 2NVTH 4UP8A 2WXFA 1X65A 3SK8A 2E2HH 4OZCA 3M3JA 4B9KA 4HIDA 3FAHA 1XNQL 3S24A 1VQEA 1VDVA 2NR2A 1J6QA 1TS2A 3RN9C 2ON8A 4L23A 3OTOL 1L0YB 2R93H 3KLSX 4A3BB 2KZRA 4KY6A 2QMTA 3FILB 4A3KB 1WMHB 2GBRA 3OSOA 3GTQH 1J9OA 4X3KA 3E9HA 2NVQH 4G7OC 4KIKB 2JQOA 3I63C
chains in the Genus database with same CATH topology
3S1QB 3MHBA 1I6HB 1DOYA 4MM3B 5M5WB 2WDQB 1SYGA 2F0UA 4U673 2GI9A 4CJ2C 2M00A 3E5SA 2H88B 4C3HB 3AU7A 1I7HA 2RKSA 4KHZA 4DAPA 2Z8LA 5BN3A 1QKZA 1HUMA 5C0XH 4KKJA 4RKLA 3Q6SA 1VR9A 3BDCA 4WWMA 4PMCA 4OW0A 2JSOA 3D3RA 3VR6A 2L52A 2NWGA 4Y7NB 2X6GA 3R2IA 1SMYD 1S5DD 1OQQA 3BYTB 1IW7D 5IGDA 3HOZB 1P7EA 1NEKB 4KK7A 2IGHA 4KY5A 2A73B 1QOFA 1JWUD 1F2RI 5C4HA 4B0MA 3BYYB 2LMCB 2WXOA 2ZXRA 3VYRA 3J80L 4PMWA 3Q22A 1GUOA 4YTMB 2L5TA 2K01A 1RHPA 2KDMA 1ZYRC 2F0QA 2PNRC 1VJKA 3MJ5A 3AE5B 1QCBD 3ZGZA 2WXRA 4PMBA 4F8MA 1TS4A 1YJJA 1TR5A 5COYA 2F3VA 1EU3A 2MP1A 3CRKC 1D1KA 5JEAJ 1NVID 5EPJA 3U9SA 4IFDJ 1XO3A 1GUNA 3OMGA 1STEA 1J7CA 2KA7A 1EWCA 3HGBA 3QJYA 2BB6A 2J0TD 2VB3X 3IXSA 2DY8A 1XTCD 2PIAA 1BMLC 4H0LC 3S2DB 3P1HA 1TKYA 2NTSA 2K28A 4DN4M 3GTGB 4DFAA 1QOAA 1CTMA 1OFFA 1DOXA 1GPXA 1IL8A 1FEHA 5IGFA 3ND8A 3K5LA 1F9QA 4HJGE 3PIO3 3I4MB 1ILPA 3JAME 5ELCA 1VZ6A 3TEZA 1E9MA 1K51A 1D2BA 3PIP3 4NKLA 1FD6A 2F1MA 2G1EA 1UEAB 1JQ4A 3RUZA 3WOEA 4NP5A 5I9OA 5FLXE 2B8GA 4HKZE 5C2TB 1VMCA 2I38A 4PQXA 2JP1A 4ABNA 3A8JE 4J1MA 1I3QB 5EE3A 3P4PB 3AMUA 2KECA 1I4XA 3I73A 5BYSA 4AQ7A 2O5IC 2R92B 5KEEA 5KNCA 3HOXB 1QG7A 4JPSA 1GUGA 4G7HC 1CK1A 1DYQA 1Q12A 1CJEA 4ME5A 5ELDA 1N60A 4FXCA 5EE0A 2EYOA 1HXYD 2R7ZB 4FF1A 3Q69A 1FO4A 5EBCA 2MJDA 1PFNA 3OHXC 2L11A 3Q24A 1VZ7A 3I70A 5JVG3 2O4XA 1PFMA 4JWSC 2JXMB 3HRDD 3PV0A 2K5QA 4IALA 4V0BA 1ZPSA 3DEPA 2N9KA 2J53A 2PCFB 1B50A 1Y8NB 1L0XB 1D6EC 3FVQA 4DAYA 3KWLA 4KY7A 3AEEB 2XIWA 4XIGS 1WTWA 4RAUC 1E2VA 5CV4A 1SYDA 1TT2A 5E6JA 1AWDA 2K1BA 5G5GA 1FRRA 4FF2A 1PXUA 2F0SA 1MI2A 2K7VA 3RD4A 4TSSA 3ZQ4A 3M4YA 3MXGA 5FOBB 2BTEA 1RCVD 4HN7A 3T3OA 1TWCB 3BDLA 1HTPA 1E6EB 1PGAA 1XCTL 1BF4A 1J7AA 3FPPA 2O5JC 3NQTA 4WFN3 4OO1G 3R93A 3AM9A 5T1GA 3MWYW 5JVH3 2L83A 3RZOB 4NJCA 1Y56A 2KHSA 1IBXB 3BIID 3A7AB 5G3LD 2RDGA 2JSVX 1K8MA 3IAM1 2HCCA 4DXGA 1QOBA 2R6GA 2DWQA 3LYYA 3ERQA 3TEYA 5C5LA 3PUYA 2IX1A 3LWUA 2BT6A 1WWTA 1B44D 1C77A 2L12A 2K5WA 2EZVA 1F2RC 1EYCA 2KCNA 3VYSA 1FCCC 1LV9A 4CKBA 3P1MA 4A3EB 4F7XA 3AE7B 4IUPA 4CJ1B 2A69C 2SAKA 1RKNA 2J52A 1FGBD 1E0BA 2I07B 5HURA 5BMIA 4CKCA 2F0IA 3IAYA 5JJZA 1H9JA 4XQNA 3AE2B 2DY7A 3FMCA 3S14B 1FFVA 3P4QB 4GDKB 5NUCA 3I57A 1I50B 2RDFA 1BBXC 1SNOA 4KD4A 4LJZC 1C79A 3CIRB 2OHFA 5D7GA 3DWQA 2QKIC 2E76C 1WTPA 3WOFA 3U7ZA 3KBXA 3P4SB 4Z9CB 4KKSA 1Z47A 3GTKB 3SVMA 3GO5A 1N62A 3VR8B 2WXNA 4OGQC 2SDFA 2JZPA 1C9FA 1CA6A 4DQOC 5C0XG 1WSPA 3K58A 4IUTA 1MPEA 2F0MA 3AE8B 2D5DA 1STBA 5J39A 5EE1A 1IYVA 3TMEA 3V3XA 1HUNA 4IKGA 1O7YA 2NVXB 1X32A 1Y8PB 4C7YA 2PZTA 1NI3A 3FC4A 1XF5L 5HGTA 1XCQL 2BDOA 2A6HD 2QSDA 3H91A 4I65A 1PMRA 3T51B 1N63A 4KX6B 1ENAA 1QILA 3VYTA 1QOGA 1QF6A 1C48A 1WYGA 4A93B 1PTOB 4G57A 4A55A 1OXXK 3SK4A 2F0EA 2E75C 2DLBA 1HCZA 3A8KE 1WD1A 2F0WA 4R3DA 1ZXTA 1GAQB 5EQ0A 3HVZA 2MGSA 3EQLC 1SJHD 3LWEA 5C4XB 1QLBB 1CQFA 3EROA 4HSVA 1SNPA 1QOHA 2WQYB 1WGKA 2WXLA 3QG1A 3PO3B 2OXPA 1E10A 3NBHA 3W5VB 1G2SA 3T56B 3TP5A 2BA1A 4KN4C 2LHEA 1SNQA 1SE2A 1KDAA 5KRUA 1V97A 2EJGC 3GV6A 2D62A 4EE2A 1G6ZA 2R3ZA 2XWBB 5LHY1 3RLFA 2B76B 2QJLA 2C5CA 2IPKD 2IGDA 1O78A 1ICWA 2PW7A 4QMGA 2PW9A 3B9JA 1JALA 5CV8A 4RF0A 2QCPX 1XWEA 3P75A 4GLSC 2WKCA 1DGJA 2Z4HA 1T6BX 4IFDI 3OIQA 1EQTA 3WCQA 3TBIB 4DXFA 3EA6A 5M3MB 2BE5D 4XTCS 5E3FA 1XLNA 2B39A 3D6CA 2F0PA 4J3OD 3S1MB 1FNVA 1ZXHA 1T3QA 5I2XA 1VF7A 3PMFA 1VRAB 4XYQA 4C3IB 1FFUA 1QNKA 3MXNA 4N9PA 2ZT9C 5EJWA 4OVZA 4US8A 2WXHA 2RQXA 1CHPD 5F2DA 3OMCA 4U68A 1ENCA 1BCPD 5IT9E 4XDCA 3SDZA 2WINB 1UUPA 1ET9A 1N61A 4BA2I 1V1PA 2M9VA 4FYDA 1QT9A 1N5XA 2JA6B 1QWYA 2FINB 2CJOA 2ONQA 3J7AV 4WORA 3PZ7A 2WP9B 4RKBA 3HRZC 5D3DA 5H8YE 3U4EG 1H9KA 1TKWB 1SNCA 2INPE 1F2MA 4O1NA 1FMAD 4USAA 1EY5A 1SYBA 2HDMA 4A3MB 3Q8EA 1V43A 4C3JB 1JC7A 1JB3A 1JOOA 4DA2A 4CJ0B 2WU5B 2BB5A 3NTIA 2FMMA 2K03A 2EE1A 3TN2A 4A6QA 4G4KA 4RGNA 3PO2B 1FCLA 1I4QA 4XXEA 4ILWA 2NVTB 2B2UC 3W3AA 2E2HB 4XYOA 2EXZA 1G8ZD 3DUZA 4HEDA 4E6IA 3L9AX 2K33A 1NR2A 2R93B 3SHLA 3TP8A 3GTQB 2NVQB 1SMYC 1MHHE 2BBCA 1II3A 5GXGB 3SK6A 4PT5A 1I4GA 3B2FA 1FM0D 1GXDC 5CV9A 5M5YB 5FO9B 5JOBA 3HOUB 1GHKA 1Z7TA 2LFNA 2WXMA 1SYEA 2ZW1A 3HS0C 2F0HA 1A70A 2HUGA 1E2WA 4ZUJA 3AN1A 4YSZB 5BYQA 1SSNA 3VRBB 1ZXIA 2E2JB 2H89B 3SEBA 2MEKA 1XLOA 1JW9D 1NYQA 1ZOYB 2FHTA 2QILA 4K5WA 1JMLA 5HI1A 3LNNA 3MAQA 2B8FA 3K7AB 4S3SA 5LNK1 1STGA 1TKEA 1GUSA 1HFNA 2LY7A 1HRJA 1ESFA 5C3XA 2FBWB 3NS1A 3OW7A 5IGEA 3T16A 3D4RA 1BO0A 5EBDA 4QCLA 4NW2A 1EWHA 3P63A 3IFTA 1L6UA 1ZP0B 2W55A 1AW7A 2LHDA 4DK0A 1JROA 2HTME 1U9RA 3NVVA 2B63B 2EYLA 5IGCA 1PZID 3AEAB 1RDPD 1EIGA 1ZUD2 2EELA 4IUNA 3AE3B 3VR9B 1BCPB 4M8AA 1S5BD 3L4PA 1MGSA 2B2YC 5ELFA 1H9SA 3MP9A 4K8JA 1XYIA 2L9HA 3I3CA 4L63B 4C1NK 4DF7A 1GB4A 4Q5VA 4C56C 3K6OA 5MPOA 3D31A 2WXQA 4B08A 3C46A 3NHHA 2WXPA 1NSNS 2B2WC 5G5HA 3NUCA 4N9TA 3KLSA 2NN6I 2KACA 2Z4IA 1PDXA 2FE8A 1RTNA 2I2YA 4BY7B 2WXIA 4UDUC 5K36H 1EYAA 1STAA 4EQPA 1UWMA 4RH6A 2NZ1D 4ZOHC 3DWAA 4BY1B 3RMHA 3EGRA 1D1IA 3UI3A 3D8GA 4MH8A 5CORA 5BYRA 3ZJTA 3J81L 2E2DC 3H0GB 2SOBA 3Q8BA 3X3MA 4XDDA 2KN4A 1A3TA 2K6AA 2EYPA 4DGZA 1M8AA 1I4RA 5LL6X 3K57A 1ZYRD 3S16B 3F2UA 3X3NA 4N58A 2ZXOA 2CJNA 1DD2A 2M56B 4XQJA 2EVBA 2Q8TA 1F77A 1EY6A 1HZ6A 5JAVA 3AEDB 3I72A 1E0ZA 1MD2D 3M7GA 3PUWA 3M85A 2Q8IB 3VR4A 4JE3B 4NZLB 1LTSD 4AYBB 1FXAA 2FMCA 3R3OA 4GZYC 4MN3A 4ARCA 2YEPB 1MI0A 4NDXA 3OWEB 3I91A 5I9PA 1MVKA 4K2LA 3EFXD 2LMCA 4YSXB 3HVDA 1LTAD 5E4WC 2G9DA 3MHZA 5A35A 4H2AA 5AUIA 2F0TA 3AH7A 2NUCA 1FYCA 4QIWB 1SJED 3GB1A 2KEEA 3QOJA 4KMUC 4DK1A 3K0YA 1FXIA 4ZK9B 1F0ZA 1TY0A 2K5DA 3VR3A 3ABVB 3U52E 5KIXA 5EKKA 1G291 2OEOA 4H7BA 2PVOD 5C44B 1G2TA 3VR5A 1DOMA 1JOKA 3SE0A 1CZWA 1TKGA 1RODA 2WXGA 3P4RB 1HEZE 4WAFA 4HMJA 4D2KA 2N55A 1S4ZA 1SXTA 5D65A 1CT1D 4NMZA 2ID0A 1ET6A 4JWUC 3A55A 5IGGA 1T5EA 1CQVA 2W82A 1R4PB 4C3IG 1HA5A 1SB3C 1B1ZA 3Q23A 5AUKA 2PLPA 3NVYA 3GTLB 3BVMA 2WXKA 1I4PA 1PTOD 3BG3A 1KABA 3G7LA 1K52A 3GP7A 5CV7A 2W3RA 1SNDA 4FF3A 2BYTA 3AECB 3H3VC 4AS1A 5M3FB 1KTKA 2CVRA 2AQ3B 3TZDA 2CU3A 2GB1A 5M9OA 4TMAB 4KD3A 2FUG1 4K14A 1VDZA 2BA0A 5EGTA 1W6KA 5CBAE 2D2CC 1CZGA 3E6ZX 1HA6A 2FFKB 1K53A 3H09A 2WS3B 3TEXA 2XVSA 4ZRPA 3SR1A 2WDVB 2E74C 2AUJD 4YT0B 3KLRA 2KUMA 3OPOA 1TYGB 5TSSA 5FK9C 3OWFA 4K6LA 1WTXA 5CV6A 4ZRZA 4N59A 4US9A 2ICIA 5IOCA 2NVYB 4HROA 2XN9C 2B2UA 4C3JG 1FD7D 2L4NA 4IQZA 1Q90A 3O13A 3NVWA 4TQ1A 2RDHA 4FXGC 3VR2A 2O2LD 1VMPA 2A68D 3R8BA 1GB1A 3P20A 1JCKB 1BNZA 1B9NA 1YMHE 5CYUA 1ONLA 4RNAA 4QUCA 5FLXL 1C4PA 2VNUD 1LACA 2QDBA 3GTJB 4C1NI 4RFBA 1KNAA 3HUIA 5EKIA 4CBVA 3AE4B 3GTOB 4ZYSA 2F0OA 3BZDB 4ODGA 3TP7A 1GUTA 2A74C 5IIFA 3ZYYX 4H13C 2CQAA 3ZJVA 3NBIA 2A6HC 5JEAH 1PRTD 2WU2B 1S5ED 1PDQA 3WDNA 1NUCA 4IFDH 1NCVA 2M2LA 4QUFA 2Z1CA 3KF8A 2TMPA 2HCIA 4BS9A 3I8ZA 1L4DB 3BDOA 2WLBA 1YJIA 2EY1A 3FPUB 3U9OA 5C3WA 1SNMA 4X3TA 2A6EC 2K22A 4IDIA 4I7ZC 1SF0A 2A69D 2F0GA 1EIHA 1IBXA 5D3IB 1ACCA 2INNE 1PLFA 3J9CA 2X6LA 1C4QA 2F0JA 4X3UA 4A8XC 4ZLTF 1D4BA 5EKLA 1D5XC 5BMGA 4O42A 2AUKA 3N52A 3S15B 1QQRA 4YXDB 4KGSA 1PYWD 2B2YA 5C0XJ 3E9SA 2RMMA 3Q8AA 4REZA 1T5XD 3AMZA 4K5XA 1JICA 2IGGA 3C8YA 1Q1EA 2BOSA 4BA1I 3P42A 4YWGG 4KKIA 2V3PA 2B2WA 4TKOB 1SBBB 5EE9A 3OIPA 4ZKBB 5K5PA 3NUHB 3D4DA 4HR7B 1HPCA 4RCOA 2NB0A 4XDXA 2DN8A 5J1ZA 3TSSA 1TS3A 1WD0A 1JWSD 5BMHA 4RF1A 2VB2X 3S1RB 1LT3D 1EYDA 1JOQA 2EKIA 2SEBD 1DJRD 4X3SA 2BE5C 4IZ8A 1ESRA 1V1PB 3EVQA 1EY8A 2BDNA 3I4LA 2PO4A 4IUQA 3CKIB 2V4IB 1ILQA 2BS2B 1WTVA 4JX1C 2BW2A 1R9TB 2IX3A 2LKVA 5K36G 1BCPF 1NR4A 2HDLA 2F0LA 2Y3AA 3LXFA 4Q2JA 1BQQT 1A15A 1PUTA 2B2VC 1U4RA 1LTRD 2IL8A 2MJ3A 5JXVA 4M0WA 3KBGA 2JA5B 2MPMA 2N0SB 3QO2A 1BDOA 1XX8A 3DWMA 1AEXA 5HG2A 1S5FD 1KNEA 1EY4A 1SAPA 2PYKA 5KNDA 5FO8B 2E2IB 3MFGA 2EYJA 4QF4A 3BK2A 2JEBI 4KKTA 4MACA 4XE0A 3S2HB 3ITPA 2F03A 1CA5A 4DNTB 2Y0SB 5A2QL 3BK1A 4DAVA 1RYJA 4IURA 4LMQD 2RA4A 5FR3A 1YNJC 4CQNA 2KMMA 1MSGA 1J8IA 1YNND 5DEHA 1PRTB 3J7YW 2ZW0A 5LL6S 3CRLC 2X69A 1C4AA 2V0GA 2CW0C 3BVZA 5HHDG 1BUVT 1C8CA 1E2ZA 4IUVA 5CGKA 1V8CA 3S9WA 2IX0A 4WURA 4OZBA 5ELBA 1OQRA 3N6RA 2JYOA 4K6DA 3J80E 1EEID 2Y5CA 2AQ1B 1YQ4B 4J8QA 1ROEA 2F0DA 2F3WA 1GHJA 1STYA 1V1OA 1JWMD 1AP0A 2ICEC 1M4VA 1HTLD 3HOVB 2OF1A 5CV5A 4B0EA 3CWIA 3ONAB 2WXJA 4HKQA 2IW3A 2K0PA 2EY6A 3W2DA 1TWFB 4A3IB 2JYTA 3IL8A 1OXSC 2N88A 1RJTA 3MFYA 3DEOA 1F9SA 2NMQA 2L0CA 1IHZA 1CHQD 2DYMA 1EY7A 5ISRA 1O7ZA 2WV6D 5I4DA 4RGMA 1Q10A 1K8OA 2NN6H 1AFPA 3ZJUA 1U4PA 2LEKA 3E0JA 4XQQA 3DWPA 4N6EB 3QB3A 5JPMC 3AB9A 3J81E 3DMUA 3EJIA 4TQ0A 1DCZA 1H9SB 4R9WA 1X3QA 4XT1B 1RD9D 1IW7C 3H94A 1EU4A 4ZHOA 2NTTA 2PQEA 4EQOA 2K3UA 2W3SA 4FXKC 4KN7C 1R4QB 1MBYA 1B2TA 3A7LA 1H9RA 5CC4A 1NENB 5J22A 4CGYB 2ACZB 4H44C 1KRHA 4L8JA 3I4NB 3Q8FA 5ELEA 2JYEA 1CI3M 1LTBD 3HG9A 5JPNC 1Y8OB 2XWJB 2EPBA 1PGBA 2RPVA 2JE6I 5KGUA 1L4ZB 4LTUA 1IUEA 1L5PA 4KHVA 3IT6B 3CHBD 3S17B 1F9PA 4RA8A 1R7SA 1PZJD 4KKUA 1ZEQX 1LT5D 3FKIB 4WQMA 5M5XB 3AEBB 4RHRA 1NYRA 3VYUA 2AQ2B 3AE9B 5KYLA 1FNWA 5DAUA 2IDYA 2F0KA 3A56A 1CM9A 2J42A 2QEJC 3QIAA 4HEA1 2FJ2A 4L6TB 2KJXA 2ENBA 5BN5A 1PGXA 2E3TA 1DOKA 2PZWA 4KV6A 2NYZD 2F0NA 2LGIA 1W6JA 4DNRB 4P6VF 4QB4A 1XEEA 4KTAA 3K5NA 3J7AF 4OO1I 5JEAG 3TEWA 3AEFB 2KEDA 2L55A 2AX5A 4IFDG 3HOYB 1RTOA 2KOLA 5IT9L 1U4MA 4YTPB 1ENFA 4OHJA 4M1UB 1H9MA 4WRDA 2J7ZA 1QB5D 3ETRA 4FNFA 2KAJA 4EGVA 2EYMA 1SYCA 5E4XA 1EZ6A 2Y5PA 4ZKCB 1STHA 1B4OA 5DM73 1KH0A 2PKOA 2GA4B 3FILA 2KWDA 4A9AA 2EYFA 4FO2A 2WDRB 4IUUA 2JQRB 1UWXA 3NE5B 3T53B 1SE3A 3SFDB 1HQRD 1YN3A 2PVGC 1VLBA 5T8IA 3KUPA 1IKMA 1YN5A 3K5MA 3QOLA 3BS1A 3NTHA 1EZ8A 1C78A 4P2CB 3BVGA 1IGDA 1FNUA 1F9RA 3MC0B 1SIJA 3MA2B 3L3OC 1LTTD 1LABA 4HMIA 3T13A 1QE6A 4PV1C 3A54A 4C80A 3HOWB 3NRZA 1OXTA 4ZAIA 3B2GA 3LX0A 3NZ3A 1GJXA 4WJWA 2LJIA 3TUOA 2WACA 1K83B 5BN4A 3S1NB 4RWSC 1YNTE 2VXWA 2TSSA 1L0VB 5C4ZA 2IT1A 3HP3A 3U2SC 2SNSA 1I4HA 2PZUA 1XLPA 3H8HA 2B2VA 4GDLB 4BBRB 5CMDA 1KLGD 2OT2A 1PTOF 4HTHA 5C4JB 2B2TC 5C0XI 3HZXA 4HSPA 1B9MA 1LO5D 2KQ3A 1L6VA 3I90A 3OOCA 5C5MA 1LTID 4XWTA 3MZ5A 1SSOA 2EDGA 1BUIC 3D4WA 5C6AA 3MXUA 3NTKA 5I6YA 4ZHPA 2WIIB 4G7ZC 1ZDXA 4EQNA 2GRIA 4RGOS 5G3LF 1PTOC 1P7FA 1G91A 3EUB2 1K50A 3IT4B 3TP6A 1HFGA 2R61A 3PUVA 1WCMB 4ULLA 1A2TA 1Y1WB 2L1AA 4C2MB 5C3JB 1OO9B 2EJMA 2AWNA 1EL0A 2EJFC 1MSHA 4OIKA 1DOLA 5I2YA 2IJ0A 3C1FA 1PFDA 3T3NA 3HEJA 4RGTA 4A3JB 1EEFD 1EY0A 3FDTA 1GOZA 2SNMA 4K2KA 1LT4D 1D5ZC 3GV3A 4WH4A 2WB1B 4KGTA 2LS01 5H92C 3SK5A 2BS4B 2LFIA 3DHQA 2PMVA 4NAWB 2YYZA 2K05A 4KGRA 2EY5A 3PUXA 1TU2B 1Q3LA 4V190 3HKZB 2WP8J 4ARIA 1WTRA 2DNCA 4RHSA 4B9XA 1LT6D 2RVLA 1EWYC 2VZKD 2A68C 1DZ1A 1AZQA 3GS2A 3DM1A 1UNSA 4J6HA 1EQVA 4C7ZA 1CZPA 2MH7A 1OXUA 3NVZA 2K9XA 2OEDA 4HRSA 2D9UA 1TS5A 1PRTF 3MVVA 1J7BA 3PO0A 1TZOA 1QNUA 3M4OB 4LAAA 1B3AA 5AFWA 3GTPB 4ZRQA 3I9V1 5E1FA 3AE1B 2Q8RE 1SDFA 3T4AC 2KVMA 4L2YA 1KLUD 4FXDA 1JR0D 3W9CB 4TRDA 1TQOA 1RWSA 4F87A 1PRTC 1S5CD 3JAML 4NAMA 1N5WA 2K5PA 2QF7A 2CHBD 1SFOB 2EYHA 2H1EA 5CBEE 4HCSA 2NN6G 2W54A 2ZXPA 1A3VA 2XNAC 1ZKOA 1DM0B 4LLGM 2KCCA 2WAQB 1B9RA 1WTQA 5EPKA 1Q1BA 1EM7A 1JE4A 4FVMA 3L7ZC 1TIID 2A5HA 3V2TA 3LB8C 1F2ZA 2RBMA 5C3EB 1O7LA 2PPBC 1HQMC 1FRDA 2L32A 3MTSA 1A3UA 4CHTB 3GQBA 4JK1C 4HAEA 4UAIA 2F0VA 1A6XA 5A2QE 2EY2A 5EPLA 4YIJA 2K04A 2H4OA 3AEGB 1B53A 3KQ4A 3SXHA 3CU7A 3Q0AA 3GD7A 3TZUA 1Y69U 1C76A 1IKLA 2JX5A 1ML0D 1VCIA 4FF4A 1FR3A 4ID6A 1LLRD 2Q5WD 2XRQD 4R8NA 2JXTA 2HDEA 1SE4A 3NWSA 3RPFC 1KF6B 1XXGA 3IKJA 4R8IA 4EVOA 4P16A 4IN3A 2JU6X 4C3HG 1V8QA 2YU9B 1RFKA 3AB5A 4KJOA 1WRIA 2HQEA 2F4IA 3C3LA 3KWVA 4L1BA 3C2PA 2XSCA 1VZ8A 3V96A 4OZAA 4B9WA 4PNYA 1DXMA 2MJ8A 2XRSD 1EFID 2N9LA 2WNMA 3SFEB 1EOTA 4LK1C 5IGBA 3C1EA 2WKDA 3NQIA 4CKEA 4K5VA 1TWGB 3NP8A 2L1BA 1KDBA 4RCNA 2VZKB 1D5MC 3TDQA 4JBWA 1JORA 4XWWA 3SR6A 3M3YB 1PZKD 5DM63 2QIEB 3PZ8A 1TWAB 2JEAI 5KNBA 1JWBD 4LK0M 3W5UB 3CQZB 4ZQ3A 1PTOH 1JQYD 4OL7A 5FKAC 1AN8A 1AYFA 3VRAB 2A6ED 1EY9A 3BWUD 2NBFA 1VF5C 1YNNC 1HHVA 4XT3B 1TWHB 4FP5D 1BR9A 4YTNB 2I46A 3W1SA 3R2TA 1AZPA 4WIPA 4MIUA 3Q8CA 2F0FA 3P7JA 3AE6B 2C9OA 3V05A 3KK7A 1BCPC 3RFZB 1HZ5A 3PUZA 2BS3B 1UGJA 2DNEA 1KAAA 3FRPB 3NSWA 3A8IE 5D14A 2AWOA 3MEHA 3D6WA 1ZE3D 3IAS1 1I6VC 3K5OA 4ZUIA 3RZDB 1UAPA 4YSYB 3VA5A 1F2LA 2B2TA 3NXWA 2PTLA 4HCEA 4A3DB 3DXJC 1LTGD 4A3GB 1MHXA 1U4LA 3URYA 2D5GA 4KJNA 4BWGB 1IGCA 2PMZB 3NWTA 3DWGC 2JA7B 3IFDA 1C4CA 4IOIE 1XLQA 3H6MA 5DNFA 1KDCA 1OXVA 2V3NA 5T1IA 1GUWA 1JRPA 4F88A 1BXTA 4BBSB 2M19A 2MJEA 3ND9A 4OIJA 1SEBD 1WTOA 4KI0A 1TVXA 1TY2A 1E7PB 2J4XA 1FIQA 2EOTA 3GTMB 1IYUA 3G6JB 4DU9A 4TQUS 2DBYA 2VUMB 4A3FB 3NPPA 3VQIA 2MUYA 1BOSA 5FO7B 2YEPF 1QJOA 3K59A 4OO1H 2V4DA 1O80A 2MHVA 1ZDVA 2IWHA 1PFBA 1Z6HA 5HFYA 1Y1VB 1JWAD 2KQ4X 2RSOA 4K8IA 1STNA 1WVLA 1A2UA 1RM6C 1YNJD 2JA8B