1I4RA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.5
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4rA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4rA02
2CHBD 3V05A 4DXGA 1BCPF 2IJ0A 1PRTF 1V1PA 1LLRD 1RF2D 3BVGA 1SJED 3W2DA 1JWSD 3DWAA 1EFID 3EFXD 4BWGB 1HTLD 1UNSA 2J4XA 1B44D 3CHBD 4RGTA 1B1ZA 2WV6D 1T5XD 2QEJC 1I4PA 1TS2A 1S5FD 2AQ2B 1BCPD 1JCKB 4RHSA 1LTBD 1F77A 1JR0D 1LT3D 2AQ3B 4Z9CB 3R2IA 1LTSD 5ELFA 1PTOC 1EEFD 1PRTC 2QILA 1UUPA 1LTGD 4RH6A 5ELBA 3TSSA 1D6EC 5ELEA 1LT4D 1PTOD 5FKAC 1XXGA 1HQRD 3R8BA 1KLUD 1KTKA 1FGBD 1PYWD 4RGMA 1KLGD 5FK9C 3SEBA 4RHRA 1RDPD 1QILA 3BVZA 2G9HD 4RGOS 1S5CD 1EWCA 1JWUD 1BXTA 1ESFA 2RDHA 1RCVD 1CQVA 2SEBD 1YN4A 1M4VA 1TY2A 4K6LA 1EU3A 1LT6D 4DXFA 1I4XA 1AN8A 3O13A 1ENFA 1PZID 3GP7A 1JQYD 1FNWA 1DJRD 3OWEB 1SEBD 3KLSX 2R61A 2Z8LA 1ET9A 1CHQD 4L63B 2NTSA 1S5BD 4L6TB 4O1NA 3MC0B 1TS5A 2TSSA 1D5MC 3MFGA 4TSSA 1BCPB 3BYYB 4C56C 5D3IB 5D3DA 1CHPD 2O2LD 1SE4A 1SE3A 2XN9C 1EU4A 1SBBB 1HA5A 1AW7A 1PRTD 2XRQD 1LTAD 1SJHD 4UDUC 1SXTA 4NZLB 1CK1A 1SE2A 1LTRD 1PTOF 1MD2D 1TY0A 1L0YB 1GOZA 1PRTB 3BZDB 3URYA 1BCPC 1I4QA 1V1OA 4RGNA 1S5ED 1YN3A 2ICIA 1I4RA 3BYTB 1I4HA 1CT1D 1LTTD 4OHJA 1G8ZD 3BVMA 1EEID 1PZJD 2XRSD 3EA6A 1FD7D 1JWMD 1TS4A 4RFBA 2RDGA 1L0XB 1PTOH 1LTID 2AQ1B 3DWQA 1DYQA 5TSSA 1LT5D 5ELDA 1D5ZC 3DWPA 1RD9D 1S5DD 1I4GA 1PZKD 1D5XC 1ET6A 1STEA 1HXYD 2NTTA 5I4DA 5ELCA 1LO5D 1FNVA 2XNAC 1PTOB 1FNUA 1XTCD 4ZYSA 1YN5A 3R2TA 2IPKD 4RCOA 1V1PB 1TS3A
chains in the Genus database with same CATH superfamily
4A3DB 1BO0A 1NR4A 2B2UC 4YL8A 4ME3A 2YTVA 3I4MG 4B9KA 2ZM6L 2GBMA 1FIQA 2HCIA 4IM2A 3UF8A 1T3QA 4ANUA 1J19A 3OHXC 1H9SA 3MXPA 5IGEA 3TMPB 3W2DA 2UUBQ 1X9NA 3ZJYC 1EYAA 2FIDA 2HE7A 1SSOA 3MZ5A 4JLCA 1T5XD 2QEJC 3BZCA 3A4RA 4A9AA 1ASZA 4A3CH 2PNHA 1S5FD 4HPPA 1J0GA 3IFTA 4AS1A 2F0SA 3MXNB 1HR0L 3SXHA 1FPYA 2OOBB 3Q8FA 1E2WA 4B08A 2IBIB 4ZK9B 4A93G 1RYJA 2PZWA 4KLKA 4RNAA 4KX6B 1U4RA 4RG1A 2JQOA 1KRSA 1PGXA 1N33Q 3DDCB 1H9SB 4FHKA 1PUTA 3N1ZC 2KENA 1TKGA 2WXGA 4DR3L 2FBWB 3I7FA 1MI0A 3K58A 2KDBA 1D1KA 4LLGM 4ZQ3A 3EJIA 5FLXE 2DNFA 2AX5A 1BOSA 1ZYRC 2BS4B 2IGGA 3X3MA 4M0WA 2G9HD 3A54A 2VRRB 3MA2B 4G11A 3A1QB 4IUTA 1SNCA 3C0RB 3KYHC 2SNMA 4B0EA 1BF4A 1VZ6A 4RCNA 3WWVA 2PI2A 3LWUA 4K81A 4BFRA 2RHQB 1EY5A 2BA0A 2BYTA 1STGA 2RSNA 2JYTA 2XVSA 2WXIA 3AEEB 2RR9A 5CV6A 4L5TA 3WANA 1QVFA 1E8XA 1VLBA 2VZKD 4FADA 2XIWA 1Q1EA 4NY0A 1WWTA 2QDLA 3I90A 3HOXG 1IHZA 3HIZA 1X65A 2DZMA 1IBMQ 5BR8Q 1S5BD 3BU2A 3CRLC 3TEHB 3MEFA 3I4MB 1CM9A 3S2DH 1JJGA 2MBBB 4HPMB 4OZAA 2CJNA 3DBRI 2O5JC 3V60A 4I6PA 4MGKE 3STBC 1KIXA 3VHTC 4MSQB 2TMPA 1GM5A 1WZ0A 2A69C 3P75A 4DUYQ 1CHPD 1K52A 4CBVA 4NAWA 1AARA 5CTRC 2Z59B 2OQKA 3DHQA 4LF8L 2I1JA 1IKMA 1G6PA 2K22A 4KZ0A 4BKSA 3PUZA 2VB3X 3K57A 3FVQA 1J9OA 3J81i 4ID6A 1WSPA 3DHIC 5C4JH 4A3IB 1FFVA 3E3XA 4OXPA 3TJPA 4GZYC 1HNXQ 1WE6A 1RWSA 3ZGZA 3A8KE 5M3FG 1RRBA 3AEBB 4OHJA 1Q8KA 5LNK1 4IUMB 2A1AA 2M17A 3QARA 4C7YA 1HZ9A 4DNIA 5EKKA 4NMZA 3KBGA 1BUVT 1ILPA 1WMHA 5J39A 2OTJA 1EQTA 2PI2E 4HAEA 2ZVNA 4NB3A 1LUZA 2PZTA 3K9OB 4FULA 4W9HA 4GKJQ 1LT5D 4DR7L 4KKJA 3GTGH 1WM3A 1IPGA 4ZHPA 5EDSA 1GKHA 1D5XC 4R1JA 4X3TA 1E90A 2K1FA 3LB8C 3NUHB 2FMMA 3QA8A 3KYDD 3PGEA 5C1ZA 5EKLA 2KEDA 4DR2Q 2R7ZH 3F2BA 4IUNA 1WIAA 2KANA 4X64L 1N9WA 5GROA 3GD7A 1ZKOA 3PIPA 1A6XA 1X3PA 2Z0EB 3LYYA 1TU2B 4CGYB 5BYQA 1F9SA 2EMTA 3V3XA 1JOKA 4QJFA 1QKZA 2IHFA 1Y14B 4I65A 5E3FA 3BJUA 2K25A 2ZW1A 1STAA 2DZKA 2D11A 2NS5A 1B3QA 2N9EB 3T3NA 2WINB 2W82A 4ZRJA 5AZHA 4GXBA 3V96A 2B29A 5CGKA 2WXPA 1R4PB 1TS2A 1BBXC 2XEWA 4F88A 2IX1A 3LDZE 1XNRQ 4OVVA 4RKLA 4QF4A 4J6HA 4UP8A 2WXJA 2DJGC 2R92B 4L8JA 3S1MB 3FKIH 1I50H 4GIVA 4ZUIA 2V9HA 3W1YA 3ZKJC 2N7DA 2FCQA 3NENA 1WYDA 2NVQH 4EVOA 2B2VC 3HM6X 4F1SA 3TSSA 4AJYB 1I94Q 3CCJA 3OOCA 1IYJB 4LW1A 1HQRD 1HTPA 1DOKA 1PQSA 1KTKA 4BY7H 1Y1VG 3P7JA 1KOTA 4RM9A 1FMAD 2E2IH 3PUYA 1V5TA 3OMCA 4BY7B 3TMEA 4A20A 2WFWA 3W5UB 4US9A 2RDFA 4A3BH 4GOCA 4DR1L 1I6HH 5E7NA 4X62Q 2LGXA 3PO3H 3H3VH 1TGZB 2MP2B 2V4DA 4JBJA 4F87A 4QAYA 2I07B 1VQOA 1GHKA 3GV6A 2K5PA 3SR1A 3RLOA 2K5NA 3OAWA 3AE5B 4HIOA 2L4NA 1S3SG 2IY1B 5ELOA 1F2RI 2RDBC 3K5NA 4PZ8A 2BVCA 3GS2A 2ZPNA 2JN4A 1WFQA 3DCGA 1TS5A 2K1BA 1UBIA 1E0BA 1X3QA 3I70A 2GVAA 4AH6A 2KX3A 1Y1WH 2QSDA 4MIUA 4BBRB 2PQAA 4DK0A 2YVCA 3VQIA 2JZZA 5M5XB 1WZ3A 3LWEA 5G55A 2EVBA 1K28A 3NVYA 1STNA 1R7SA 3BS1A 1QT9A 3H9DA 2XRQD 1BT0A 2OWOA 4OZBA 1WGGA 2O6VA 5L83A 3D0FA 4IWOA 4QY7A 4JI6L 1E24A 4A3DG 3VRAB 3FC4A 2MBEA 1L6VA 1OEYA 2LEKA 2MA9B 1XEEA 5IYCG 3KDFA 1OXVA 1VQ8A 1LTTD 2PTLA 4ZHOA 3HGBA 2Y5CA 4OIKA 5A2QL 2Q5WD 2DHZA 3EN2A 1JW9D 3OJ4B 2LS01 2H89B 4W9CA 4EZLA 1B9MA 4JI6Q 1MPEA 2INNE 5K5PA 5J22A 4LFAQ 4B3TQ 4GDKB 1VQMA 2HDLA 1VQDA 1EWHA 2L8JA 4HLEA 4IURA 1J6QA 3W1BA 4JI7L 1I4GA 3P1HA 3IVFA 4UAIA 2IX3A 2PNRC 2C7NB 4IM3A 3OJ3A 5KYIA 4LJZC 2NVYH 3UGBB 3SE0A 3PO3G 4MSMB 3ZTDA 1E22A 3BDOA 2EY2A 1FXIA 2NVYB 3MEHA 1DGSA 2XBBC 4R9WA 4HPLB 4YSXB 1SROA 3J7ZC 2IPKD 4R4IA 3VUYA 5GAGC 2JXXA 2LFIA 2IL8A 4MGYE 4BAXA 1H9KA 4HR7B 2NCNA 2YEPB 5LL6X 3CW2C 4H44C 2L11A 1FFUA 2WXQA 3VTWA 2A5UA 2ID0A 3T1YL 1V1PA 1IP9A 1WM2A 2CR5A 2A68C 4JI8Q 1YNTE 2JA8H 5IOCA 5F2DA 3GQBA 1EFID 1C79A 1WXQA 1GXDC 2B2WC 2F0QA 1MG4A 4CHKA 4HJ5A 2PKOA 1ZXIA 1BQQT 2GLSA 4JI1Q 4KSKC 1ZYRD 1K9MC 1JCKB 3S1NH 3SR6A 1J7AA 3NELA 3PQIA 4DDID 1LT3D 3K0XA 4IPGA 3S1NB 4FBJB 3T51B 3PO2B 3R2IA 2CHXA 3CKIB 3IHPC 1A5RA 1HNWQ 1CKOA 1SDFA 2B2YA 4YT0B 3HKZG 2LSSA 3J81L 2K5HA 1DONA 2KACA 2KQ7A 2L32A 4DHZB 4TQ0A 1IBLQ 1FGBD 5H92C 1ZGUB 2F0UA 2GBRA 2IDYA 3M7NA 4KIKA 1STYA 4HDOA 5EBDA 4LF7L 2Z6KA 4JCVE 1HZ6A 2JRHA 4NQLB 1Q46A 2MBHA 3DWGC 5DPWA 2E76C 1CKNB 2RDHA 4C2MH 1T0YA 4BKSD 2F0HA 4GKKQ 4LUOA 4K7WA 1BBWA 3W1GA 4PS8A 2BE5C 2K4KA 5KGUA 1LT6D 5AFWA 2K01A 1L1OA 1K0RA 2HCCA 3KK7A 4GOPA 5IP7G 2HHHL 2Y5PA 2B2TA 2JWUA 3P4PB 1U0LA 2J7QB 5EE0A 2LUEA 3RNEC 3EGRA 3PLUA 2GN5A 2F0GA 5CHFA 3TEYA 1VQAA 1TQOA 3QJZA 1QVGA 3GTPB 3D8GA 4W9EA 2WQYB 3Q8CA 4L5RC 3MC0B 2UXBL 4WAAA 4JC0A 4XTCS 4JI3Q 5EKIA 1XT9B 2BDOA 2TSSA 1WTOA 2E2HH 1NNXA 1DZ1A 3CQZB 2LWPA 1CKMA 1GD7A 3DM3A 4JPBW 5T1IA 5D3DA 2ATWA 4XE0A 3SHLA 1EU4A 1X54A 2KCNA 3WALA 3NQIA 5JEAH 3AE3B 4XC2A 1AW7A 2NN6I 1UE5A 2F03A 1N34Q 4BY7G 2M2LA 1KM7A 1TT5B 2F4VL 4UPAA 5CMDA 4UDUC 1T6BX 3B0AA 1Q0WB 1NBWA 3H3VC 2K32A 5IIFA 5C4XB 1MJCA 5AZGA 4II3B 5M9OA 4U673 1I3QB 1BKBA 4DV1Q 1V5OA 4M8AA 2WXFA 2B2YC 2F0FA 3U50C 5KIXA 2BF8B 3NHEB 2F0LA 1K50A 1EZ6A 3HS0C 4EZJA 5EE9A 3H6MA 2RDGA 5FLMH 4IG7B 3WOFA 3J80L 5M5XH 4KK7A 3ZXRA 2CU1A 4MN3A 1JWAD 4KKTA 4ITKA 4F8CB 4KY7A 4JI0L 3RNUA 1KAAA 3OIPA 3S16H 1HRJA 3HOUB 2CKHB 1VF5C 3R7QA 2GBJA 2IZVB 3HHMA 4KKUA 3KUZA 1HPCA 2F0OA 3CCRA 4K7SA 4DDGD 4HIKA 3FDTA 1C0AA 3PTFC 2D3GA 3QCAA 4MGIE 1RAXA 4DK3C 3HUIA 5C0XH 2IGHA 4A55A 1DOIA 2BYEA 3S14H 1V1PB 4IDIA 2I2YA 4PS3A 3AU7A 3V05A 2ZJPA 1FD6A 4I7AA 4OW0A 3T4AC 4GLAC 4JGHB 2KVZA 5G5GA 4G57A 4R4CA 3SK5A 3I4NG 3I73A 1K8MA 2G4SA 2WXOA 3WIMA 3A9JA 1E9MA 2Z1CA 5JVG3 2JP1A 4ALPA 2KDMA 3AE8B 4FJZA 4JPSA 3ZNHB 5JPNC 5JZEB 4RGTA 4A3DH 1MSHA 3GZNI 1EQQA 2EKEC 1QNUA 3IKJA 1R9TH 2HT1A 1AZPA 3TS2A 1KLVA 5C23A 2D9UA 1R4NI 5FR6A 3IAS1 3U8ZA 2W9NA 4NJCA 4FN2A 1EIYB 3SVMA 1Y8RC 4BA1I 2F3WA 3JAME 2FE8A 3U9OA 5E1FA 3UE1A 1WCMG 1Z9FA 1SLJA 5FO9B 1YJ1A 3BK2A 5C3JB 2IT1A 2W55A 1RDPD 1EM7A 3Q2AC 1X55A 4LTUA 2B2UA 4AQ7A 3OTOQ 1LQBA 5EE1A 3WCQA 4WWMA 3V6CB 1V49A 1RCVD 3KFUA 2FJ2A 3DQVA 3KYCD 1HZ5A 4G0NB 3V62A 1QB5D 5IYDH 2Q8RE 4K6LA 1QQRA 2JEBI 2FHTA 4FVMA 1UELA 3A0JA 2QA4A 3VDYA 1MKHA 1SR3A 1QCBD 1KNEA 1MI2A 2R93B 2Y5BB 3VH4B 3IRBA 3GDEA 4C3IH 2FFKB 2NVUI 5DCNA 4KY6A 2WXRA 1P7FA 3H3VI 1M8AA 2UXDL 3F1ZA 1OO9B 1ICWA 3RN2A 2L83A 3RPFC 1SB3C 3ND8A 2RPQA 1EYDA 1D5MC 3MFGA 1P98A 1WOCA 3ZRCA 3DWMA 3C19A 1K0SA 4HMJA 1JOOA 5BN3A 4M8MA 2AL6A 2NYZD 2VB2X 4B3TL 2Z6KC 3A5ZB 2KTFA 1OXSC 4HSVA 5A35A 4PMCA 4DAMA 1H9MA 2OTLA 3MWYW 4BY1H 3I9V1 3I4LA 1Q5WB 3M4YA 1WX7A 4NW2A 1I4QA 2EYHA 3H09A 4H0LC 5IT9L 2WP9B 3UDFA 2J0JA 4J1MA 3V61A 1QNKA 2L1AA 1EUJA 1IYUA 2V1CC 5J2RA 4CDFC 4B6WA 4N8FA 1E1TA 1JWMD 3GTLH 2FUHB 2RA4A 2M9VA 3ZNGC 5T1GA 1M94A 2PMZB 4LNIA 2C7HA 3SDLC 2KYWA 2MW5A 1WX8A 4ACFA 1KRTA 3DEPA 5C0XG 1LTID 4DR5Q 1H8CA 2WAQE 3BZKA 1SE9A 1S5DD 5IP7H 1FJGQ 2BB6A 1G6JA 3DXJC 2KVMA 4BBRG 1STEA 2D3CA 3LX0A 2W54A 3C1FA 4DHZE 2AKWB 5I4DA 1NSNS 2IY0B 3NJTA 5IWAQ 3X0WA 1S72A 3PUVA 5T8IA 1TT2A 2KHIA 5HY6A 1YQ3B 3NS8A 3RZDB 4EKUA 1AYFA 5M3MB 4JVZA 4IOAA 1KF6B 1EQRA 1NI2A 1WYGA 2QEXA 3CCMA 2F4VQ 1FRRA 1YQ4B 2KTRA 3M62B 3Q8AA 3ZDTA 3I5JC 5LHY1 1LLRD 5IGFA 2WXLA 1C8CA 2A6HD 1SJED 1SN8A 2DN8A 3J80i 1AZQA 3CC4A 1I5FA 1SYFA 4A3EH 2UXCQ 4AJWA 4XYQA 3CHBD 2WNMA 3H91A 4ODGA 5IKCM 4KI0A 4V0BA 1XO3A 1DD2A 1LTBD 3J7YW 3AEFB 3IAM1 1XWEA 2AQ3B 1E3PA 5D14A 4A3FG 2UYZB 1PTOC 1TKWB 1SNMA 4ULLA 2MP1A 2RHSB 2HJ1A 1LTGD 2ONQA 1QOGA 1HH2P 1F9PA 1SAPA 4AIMA 1WR1A 1VF7A 1SFOH 1N36L 2JQRB 4O0AA 1HFNA 1V80A 1KLGD 4JBMA 2IGDA 4HIDA 1WD0A 1F9QA 4K2LA 3ZQ4A 4GLXA 1PMRA 2EY1A 2K04A 3M4QA 2KECA 1JWUD 4FO2A 1Q81C 3A9KA 3HVZA 1PGBA 3QAQA 5G3LF 1N36Q 1YN4A 3EFCA 1R9TB 2O5IC 5HHDG 4EQ5A 3ERQA 1J5EL 4RF0A 1JMCA 3DOWA 1TWHB 4KD4A 1LV9A 1A15A 1YNXA 2PVOD 2K33A 4B95A 1WRIA 2ASQA 3AEAB 4ZUJA 1JMLA 2MBQA 2Z0DB 3DVNU 1J8CA 1XPUA 3IAYA 3J81c 1I6HB 2LHEA 3P2BA 1EFWA 3AMZA 2LKVA 2H4OA 1N8RC 4YCVA 4LK1C 1ONLA 1VQ9A 1II3A 3H6NA 1EOTA 5GXGB 3ZTCA 1V1QA 1EIGA 4PV1C 1HFGA 2E75C 1RTOA 2IX0A 4LUZA 2ZEQA 4YIJA 2HUGA 2HQEA 3T1YQ 1DGJA 2V3NA 2PW5A 3GTKB 4NZLB 3JW0X 4C4VB 1PRTB 3I72A 1YN3A 2JWZA 3HOVB 2HTME 4A3KG 4J3OD 2KFKA 3S1RB 2K8CA 1ML0D 1STHA 3PV1A 2DAJA 1AEXA 1O7YA 4AQYL 2XRSD 1Y8OB 4CHTB 4X3KA 1VQGA 3DLLA 1N32Q 2DLBA 5J17A 5ISRA 5IN7A 5C0XJ 2PMVA 2WXKA 4IN3A 5H1SE 1U4AA 2DBYA 5G5HA 4IJLA 3DM1A 4PYUA 1D3ZA 3VTUA 4M02A 4DAYB 2M19A 1AH9A 1QJOA 2JA5H 3DHGC 2M00A 3PIP3 1ET6A 1SNOA 4FP5D 3DBLI 5BR8L 2LASA 1HHVA 2WHIA 4C3IG 4AYBE 4K6DA 2BB5A 1PH1A 1TJEA 1SRUA 2FNJB 3G48A 3HOWG 1V6EA 4O42A 4ZKCB 2KWDA 2B2TC 2LVQA 2LHDA 3BG3A 3ZO5B 5CC4A 1KDBA 5C4JB 3PO3B 1HTOA 4A3IH 3NBIA 1XNRL 1UGMA 2K28A 1MJDA 1RF2D 2WXMA 1C9FA 2GMIC 3I91A 3RUZA 3DBHI 1ILQA 2BE5D 2P5ZX 2PW9A 1JWSD 3HOZG 4FHJA 3GTQH 2G3QB 4I7ZC 1WYWB 2KHJA 2L5TA 3GTQB 2KUMA 3L7ZC 2E74C 3PIO3 1WTHA 2Z4IA 5BN5A 3AE6B 1P0RA 4GN5A 2EYLA 2INCC 3OW7A 2L76A 2WU2B 4MEMA 4PNYA 1SYGA 5EPJA 3NP8A 4Z9CB 1HNXL 4NDXA 4G3XB 1N63A 4LJPB 1XX8A 2C5CA 2EYFA 1BBUA 2YTYA 3KJOA 3PVLA 2LVOA 4JW0A 4A75A 4BY1G 2GVBA 2JJQA 3E9HA 1YIWA 1O7ZA 2BS2B 3STBD 1SIFA 2L05A 2LGYA 3C1EA 4J8QA 3HK0A 3H94A 1QILA 4K2KA 1UF0A 2AEHA 1EQVA 2L12A 4A3EB 1BXTA 3OSOA 1JOQA 2NMQA 3PHXB 1EY6A 3I3TB 2B8GA 1QWYA 1EU3A 4DXFA 5COYA 4X3UA 2IY5B 2FIFA 1MJEA 1AN8A 4ICVA 3CD6A 4USAA 3F2CA 1PGAA 4IFDI 3GP7A 3ITPA 2VXWA 2N1VA 1N60A 4C2MB 4KMUC 2Z8LA 3SK8A 1VD2A 4XGAB 4DBGA 3PREA 4MM3A 2R92H 2UU9L 4NQKE 2CQAA 3QOJA 2KKCA 4WRDA 4TQUS 3EUB2 4C56C 5M3FH 4H13C 3NK9A 1UGJA 1ICFB 2E6XA 4HJAA 2OHFA 3KF6A 1SE3A 4K8IA 5DNFA 5KNBA 1EYCA 3Q24A 2MHJA 3UE0A 3NUCA 5AJ3L 1VMPA 4G7ZC 2Q2TA 2RPVA 5D94A 3ZNID 4A3MB 2E2HB 1SE2A 2MQHA 3EVQA 3FILA 3NZSA 2PJHA 3JAMc 4NNJB 4JI5Q 1XJVA 5IP9G 1K83H 3NTKA 4FF2A 2DYBA 4R4QA 2DNCA 1A8VA 2HIXA 4DR2L 3GTGB 4OWXB 5FJ8G 2JA6G 1GC7A 3DHHC 3IXSA 4W9JA 3Q8EA 4ZAIA 1K3RA 2KA7A 1PH8A 1LFDA 4R4TA 3AE1B 4GN3B 2DNEA 5HGTA 4LF9L 1VZ8A 2LI5A 3IT6B 2EPBA 4NXMQ 4EOYA 1EY9A 2JPHA 5IE8A 3DWPA 1TZOA 2EYMA 4F8MA 1RL2A 4G7HC 2G9DA 3VVWB 2MSED 1B50A 2B63B 1C78A 3DEOA 4N8X1 4GDLB 4DR4Q 4IC7B 5FO7B 2K6QA 3ND9A 5TR5A 1QZEA 1CKNA 5A2QE 4AOFA 1OTRB 1VQIA 2AL3A 1WFYA 4K5WA 2WGSA 1RIPA 4M00A 3NEMA 4ZDVA 4DK6C 4KV2A 1QLBB 4LNFA 5AUIA 2SOBA 1NBFC 3FHWA 4GNXA 2DX5B 2UUCQ 3T53B 2MHVA 2EXZA 1K73C 1N62A 5M3MG 3L3OC 1KRHA 1V43A 5E6JA 3QG1A 1TWAB 3N30A 4GSWA 4WJQA 2L15A 4QCLA 2N78A 3M3YH 2UXBQ 5CX3A 1XTDA 3M3YB 4DGZA 1BCPD 2WDRB 3C2PA 3IFWB 4RHSA 3HOXB 3TUOA 4ZCKA 3ZJUA 4HKZE 4EFOA 5EBCA 5LMNL 2EMSA 3VR8B 2CWPA 1EEFD 2JXMB 3U2SC 4ARIA 1PTOD 2KXJA 4KGSA 4DV3Q 5FKAC 1GB4A 2CKZB 1ZKHA 4GKKL 2NBWB 2WWZA 2IO1B 3F8TA 5NUCA 1NY4A 4MJSB 2SDFA 1T0SC 2OJRA 4C3JH 2GI9A 2D3AA 3TP7A 1GUWA 4DNTB 3KWLA 5KRUA 4LK0M 4A3IG 2K05A 3ZRFA 1CQVA 2MNAA 3UI3A 4A3JG 3SFEB 2NR2A 4NKLA 4A6QA 3B08A 3K5LA 4KJOA 1W6KA 4DPGA 3O13A 2JE6I 5IT9c 1HNWL 3HOWH 1WH3A 1DOLA 3UDGA 1BMLC 1N33L 2EZVA 3J7AV 3HRDD 4L5SA 2KWVB 5GAEC 2MLBA 3D32A 3CF6E 2QW7A 1T9HA 2FINB 3VH3B 4FA6A 2NTSA 1VQJA 3D31A 1WXSA 1D2BA 3HOUH 2LRUA 1RM6C 5CV5A 2PO4A 1BCPB 3PZ7A 2RF4A 3DUZA 2KNBA 4YY3L 4B3SQ 3TN2A 5IYCH 4JQWC 4KHZA 3SFDB 3MHSD 1W6JA 2O2LD 3IFDA 2PPHA 2EDGA 4N58A 2G5DA 1HA5A 4WORA 1IBKQ 4POFA 5JVH3 3MHZA 3Q3MC 2BT6A 3AB9A 4YTMB 4LF4L 1NDDA 2A4ZA 2ZCBA 4DAYA 1WI0A 1RKNA 2YYZA 3M4OH 1H95A 3FAHA 1QOFA 1TY0A 2F4IA 3URYA 2KMMA 3DMUA 4NXNQ 2V4LA 5IGGA 3PF5A 1PYBA 1SNDA 2IO3B 4PT5A 3I56A 2YU9H 1DCZA 1Y1WG 1Y1VH 2NZ1D 3BDLA 4EQPA 4LUVA 2R3ZA 2CW0C 3A9JB 2RQXA 2F3IA 3T13A 3S9WA 5BMHA 1WTQA 4EEWA 1TS4A 1WGKA 3KOJA 3T3OA 5E6NA 1YI2A 4LF4Q 1L7YA 3OLMD 1CSQA 2RSUA 2F0DA 3UDIA 3BIID 4HWIB 2QKIC 3RCZA 2R7ZG 2UUAQ 1WE7A 1L2FA 2EYOA 1IZ6A 1U4LA 2A69D 3GTLB 3WAMA 1HUNA 4NAWB 2EJGC 3GTJB 3W5VB 3MVVA 4ZRZA 4A4IA 1A2UA 3OMGA 2NPTA 1WRDB 2JA8B 3CCQA 2N88A 1C4QA 2JF5A 1TWGH 1X3GA 1GUAB 2QDBA 1MFWA 4TVAB 1VQFA 4IOCA 2ZTDA 4MDKE 3HZXA 1PDXA 1MHHE 1SSNA 2JZ3B 3HVDA 5C5MA 1FM0D 2F0VA 3N3KB 3I55A 1HE8A 2LGDA 4IUVA 4JOIC 5CV7A 1WTXA 1IGDA 1SYEA 2VS1A 4B3RQ 2EYJA 1HCZA 1LGRA 3T8MA 1A62A 2ENBA 4A3FH 1XNQQ 5C5LA 1JQ4A 1TWCH 4YTPB 1WMHB 1WR6E 2PZUA 1TTNA 1Z2MA 1YMHE 3VR5A 5I6WA 3KBXA 1BDOA 3TP6A 2D0OA 5FOBB 2O2VA 1PYWD 1Q90A 1YX6B 2R2OA 2JA6B 2BOSA 2KWCA 1ZDXA 4DWFA 4K8JA 2MO1A 4URKA 5JHAA 1B9NA 2ZTCA 1AE2A 3K8AA 3AE7B 1EUVB 4HCPB 4Y7NH 2EXDA 2MH7A 1WF9A 1GUTA 1HZCA 2KCTA 4DV6Q 4LF6L 4NPNA 3K80C 2UUCL 2SNSA 1R4MB 2C9WB 3VA7A 3ALBA 1ASYA 4HROA 1B4OA 5CHVC 4DF7A 3D4WA 4AQYQ 1NYRA 4IWQA 2WAQG 2R7DA 1L0WA 4Y52H 1SEBD 3ZJTA 1YJWA 5IAAC 4OL7A 2ZJRA 4IQZA 2AUKA 5LMUQ 2NVXB 1ET9A 4BOZB 4L6TB 3S1QB 4KIKB 4GMVA 2N7EA 1CSPA 4ARCA 3Q3FA 4PMBA 2I1KA 2R2QA 3M4PA 4W9IA 1WGRA 5D3IB 4DN4M 4QGUA 5GMVA 2WAQB 3OG5A 3RZWC 2WKDA 1P7EA 3NBHA 4DU9A 5CV4A 5J18A 1C3TA 4P72A 2JVCA 5E6PA 2NBFA 2UU7A 4ILWA 2NVTH 3UI2A 1HEZE 1MD2D 2JSVX 2IYDB 1LABA 1XCQL 2WACA 4KJNA 2NVTB 3DVNV 4WH4A 4A8XC 4RMFA 3RZFA 4WJOA 1GPXA 1S5ED 3AV8A 1WJNA 4C1NK 4E71A 5E4XA 2NN6G 2RGFA 5IA7A 1G8ZD 2KQ3A 4WJWA 3H1UA 4KZCA 4JL9A 3GTKH 3DBSA 4ZRKA 3DBLB 1VCIA 2FUG1 4YWKA 5LXHA 3IT4B 1UEBA 2AUJD 4GKJL 2KCCA 2JA7B 3Q14C 4GNXB 2KOXA 1S1QB 2JA8G 2AQ1B 1Z7TA 4GOPC 2JXTA 2ALYB 2ZM6Q 3S2HB 3SGIA 2SAKA 3E5SA 3J80E 3LXFA 2K5WA 4NJ6A 4YCWA 1HJPA 3J81E 1VQ6A 2BBCA 1N61A 1PZKD 1E8YA 2JX5A 4MELA 1H4RA 2CU3A 1IYFA 4C1NI 2KEEA 2UU9Q 1XNQL 2XNAC 1XMQL 4GDLA 2PPBC 1W3SA 3J81j 1CQFA 2EELA 2QIEB 3VR3A 1FEHA 1L5PA 4LNOA 5L37A 3VAWA 1Y1VB 4WAFA 2OF1A 4NAMA 3KQ4A 3L4PA 1GUSA 2ZJDA 5JH5C 2A73B 2IJ0A 4KTAA 4HJ8A 4GDKA 2BKFA 1UWXA 1QUQB 2C60A 3NTIA 3TL5A 3U4ZA 4HJ9A 4BXXG 1L1OB 3PUXA 3HFZB 1G2TA 1E7VA 2OT2A 3X3NA 2ZZPB 3NE5B 2A8VA 1TWHH 1VR9A 2KN5A 3KF8B 4LDTD 3ZNZB 3A55A 4BWGB 4US8A 1FL0A 1JB7A 4M8NA 4ZYNA 3DBRB 3V6EB 3CCEA 5CV8A 4UY8C 5JEAJ 3HKSA 4UP7A 5I2XA 1WVLA 1A2TA 2GRIA 3CSTA 4KGTA 3VDZA 2M0AA 2KJHB 4X64Q 4KDLB 2PE6B 3TQYA 3Q3OC 4KD3A 4J15A 4YWLA 4OO1I 1ZDVA 3M95A 4IUPA 1VJKA 3NWSA 2QILA 2E2DC 5M5YB 3P63A 1D6EC 5ELEA 4KV6A 2H1EA 4B9WA 1I42A 1E7UA 4CJ0B 2I46A 2K7VA 2GBNA 1PFBA 5FK9C 2KFKB 5E6OA 1Y1WB 1OFFA 4RHRA 3GE3C 1V86A 1QVCA 5CHWA 2R93H 3T16A 1BVSA 2RKSA 4RAUC 5DM63 3TEXA 4DK5A 3H7PB 2F0MA 1EF1A 3VYUA 1J7BA 3S1RH 1XF5L 1JE5A 2WIIB 1TY2A 1TKYA 3KH0A 3HEJA 2I38A 5C2TB 4ME5A 4KN7C 5I2YA 2H5XA 3EQLC 1JQYD 4CKBA 4HJ7A 1F52A 4CDEC 3NG0A 2DY8A 2Q8IB 4DV4L 3FRPB 3T1HQ 4LF6Q 2ZXRA 3NPPA 2OCEA 5G3LD 2MEKA 3QC8B 1T5EA 1V97A 2J0KA 4R8NA 3MTNB 2N7JA 3GTMB 4K7UA 2UUAL 4AYBB 2E3TA 1GNUA 2JRIB 2K8BA 3R93A 1UAPA 1OTCA 4W9LA 3UQBA 2NBVB 4QUCA 3RUIB 1IBML 2L0FA 2L3ZA 3QIJA 3RD2A 1X6OA 3WOEA 2JEAI 3KUCB 3KUPA 5AUKA 4QUFA 4WFN3 4DUZQ 2Y0SG 2JA5G 1SXTA 1CJEA 1CK1A 2KC1A 2XK5A 1PTOF 1VQEA 5DAUA 3AMUA 1N32L 3M9BA 2ZVOA 3NZ3A 1K51A 4I6LB 1PH2A 3N32A 4ANVA 5C0XI 2CW0D 3BYTB 3MXGA 2ASBA 4KHVA 1E7ZA 2Q2IA 4IFDH 1SYCA 3PRZA 1DM0B 5C4XG 3E0JA 1QZHA 1JRUA 5CR3A 3C46A 1WXVA 4A3LG 3P4RB 3EROA 3QR8A 5DM73 2LD9A 3WDNA 4JI2Q 1JALA 2X38A 2KLGA 1K83B 2BYVE 4DR5L 4P71A 1D5ZC 4B3SL 2KLCA 2BA1A 4DV3L 3RZDH 1NI3A 3L16A 2WXHA 1CTMA 3GZNB 3ECIA 1SMYC 2EE1A 2R7ZB 4IOIE 3ZJVA 1PTOB 3G71A 3CPWA 5JHBA 1E5WA 3JSVA 2WP8J 2XWBB 1E8ZA 1XD3B 4EE2A 1LACA 4II2B 2KDFB 4LNKA 4KGRA 5HKHA 2K6AA 1KC8C 2LZ6A 2ZNVB 2B63H 4O2DA 2PCFB 2VH1A 3A56A 1TIID 2KDEB 3HKZE 3SK6A 5FJ8H 1EOVA 4DR6L 2LMCA 3MP9A 3U7ZA 2VQEQ 4M1UB 1I35A 4IUQA 1F2RC 2JYOA 4AYBG 5JJIA 1VCBA 5D65A 1Y8PB 2QGQA 1PLFA 4DV2L 2PMZE 3TREA 1SFOB 2N49A 3QOLA 4Q0FA 3B9JA 1UEAB 3H8HA 2ZXOA 3O65B 1F1HA 3VA5A 3TDQA 1JR0D 2NVQB 4P6VF 2EY6A 4I6NB 3K7AB 1X56A 5BYSA 3FKIB 1I50B 5M3FB 5ELBA 4KVGB 2KC2A 3GTPH 4TQ1A 2J7ZA 4IW0A 2KJXA 3H0GB 4DHJD 1F9JA 1SIJA 3DVGX 2RVLA 2PQAB 4OWWB 2DGYA 2E2IB 4HEA1 3CRKC 3G7LA 3PV0A 1IBKL 3NRZA 5KYLA 1EY0A 4IPCA 4LF9Q 4JX1C 2VY3A 2JYEA 1SE8A 4KN4C 3Q6BA 3RT3B 2CH4A 4UHVA 1OGWA 3JVZX 2UWQA 3QIAA 4WQOB 3T9LA 1WTPA 3RNGC 3NBHB 5J3BA 4JI5L 1NVID 2PIAA 3FMCA 3PUWA 3RN9C 2H88B 5IP4D 4RA8A 4K5XA 5M5YH 1KDCA 1KHIA 4L1BA 3PGZA 2W3SA 3JSVB 2MO0A 3PZDA 4BBRH 1Q82C 1PH7A 4GS3A 4EX5A 1X3EA 2R6GA 3Q8DA 3ML8A 2Q8TA 3MXUA 4P75A 4CDDC 2A19A 4ANXA 4GOPB 5BO4B 1XMOL 4JYAL 2A5HA 4X65L 4ZKBB 2QC8A 2BWES 4E3CA 3NWTA 2HD5B 1O80A 1P1AA 2JT4B 2KD0A 3PLVA 3PSEB 1PH5A 2D2CC 3EFUA 2L9HA 1ZXHA 1JJCB 5C3XA 2ZJQA 1EWYC 5EGTA 3UINB 2L7RA 1PZJD 4XQJA 1H9RA 2CHZA 4QB4A 3I4MH 3VR4A 1FXTB 3OIQA 2KJRA 5IT9E 4YWGG 4JYAQ 1OQYA 2O6VB 4FJYA 1DYQA 2B3AA 1NMFA 3J7A5 1GAQB 4K0KQ 3AU4A 4A3GB 2D07B 3BINA 1WJUA 4XX5A 5ELCA 4PZ7A 3LJ3A 1I7HA 1W2BA 4LFBL 1XPOA 4WURA 3F2UA 1C7YA 4DV1L 1GO3E 2K52A 3PF4A 1EWIA 1XYIA 3W9CB 2RMMA 4N59A 3ENEA 4YCUA 4XDDA 2YTXA 1ZW7A 3CIRB 1YIJA 1GUNA 4Q5VA 3ONSA 2MP2A 1EY7A 3I8ZA 1DOXA 2RD0A 3J9CA 1AWDA 1HNZL 4A3LH 4KKIA 1GC6A 2WDVB 3HRZC 2WB1B 2CJOA 1JWBD 1VQCA 4E74A 2WU5B 3B2GA 4XYCA 2ES2A 2G45B 4DV5Q 1YZ6A 2KDIA 2M4NA 1F77A 3CCSA 3WA0A 4WWOA 2DYMA 3I63C 3DBHB 2XSCA 1GJZA 1WJ6A 3N20C 4MNOA 4B3ML 4LF5Q 3B1LX 3ML9A 4X66Q 4KSLC 3CMEA 1FO4A 5I9PA 1JC7A 4FXCA 4YSYB 5JJZA 1VQNA 4KHPQ 1TR5A 5C3EG 2OQ0A 1CA6A 4P7IA 3W1SC 3AE4B 4PZ6A 3VYTA 2YEPF 4OZCA 3AQQA 4R8IA 3WAPA 1EL0A 2B2WA 3I4OA 2EOTA 2VW9A 3I4NH 1D1IA 3CU7A 2NZHA 2QJLA 2F0TA 3A4SC 4FXGC 2VQEL 3KF8A 4DV0Q 2YU9B 3AU5A 1E7PB 1TWFH 1GB1A 1I4XA 3C8YA 1ENFA 2N3SA 3PS6A 1V8CA 2G4DB 3MC9A 3PRPB 5D2MB 1J7CA 3MTSA 1YJNA 1ZPSA 3P4QB 2C9OA 5J1ZA 3ZLZA 3AFQA 2V1YA 4N9PA 1EO6A 4DK1A 4HJGE 5D7GA 2I5MX 3RNBC 1PDQA 1ZP0B 5JOBA 2ON8A 3QB3A 2E2JH 1YHBA 2JSOA 3NZUA 1A63A 3W1SA 3GTJH 3MFYA 4TKOB 3E9IA 4APVA 2ZXPA 2QF7A 5FLMG 1SBBB 1Z5SB 3FILB 4P73A 3VYSA 2MCNB 1PRTD 4BA2I 4JI4L 1XLOA 1OXTA 1EF5A 4FDBA 5C4XH 1MG8A 5FLXc 4JWUC 1MSGA 4W9KA 3MAQA 1VQBA 4GN4B 3CC7A 3ER0A 2MBOA 4EQNA 3L0WB 2ICIA 3PPAA 1N6ZA 4JOIA 5C3EH 4XXEA 3MC8A 3BVMA 2BS3B 4HRSA 1IBXA 1EEID 3FP9A 1WJ4A 3ZXVA 2E8GA 1FJGL 3VR6A 2KBNA 1VQ7A 3ZYYX 3JYUA 5CBAE 5KNDA 5EQ0A 3PIOA 2VQFQ 2LXAA 2K5VA 3K59A 4JIOU 2BYFA 1TWCB 2JK8A 4HTHA 2PEAA 4GB9A 2LUMA 3EECA 3A74A 3OYYA 4A3EG 4TRDA 3AH7A 1PVOA 4AP4C 3L0OA 2N9XA 1O7IA 5KEEA 1YN5A 3TBIB 2K14A 1RHPA 3AFPA 2F0EA 3UIOB 1J5EQ 2DYOA 1XQQA 2X6LA 4IZ8A 1SNQA 2WB1G 4DNRB 1C1YB 3JAMi 3HOYG 2EQSA 3AXCA 2EIFA 1V81A 3R3MA 4A3KB 3HOXH 2KHWB 1PFNA 1QOAA 4HK2A 3BVGA 1SYDA 4A3KH 2PE9A 3KVFB 3BY4B 4TUUA 1R4QB 1IBXB 4XWTA 3TRZA 3PHWB 1HTLD 4IALA 3RNCC 4LF7Q 5DPTA 1UWVA 2DZIA 3NOBA 3BWUD 3AEGB 2M0XA 2OXPA 1IBLL 3W5OA 4DAPA 1K8OA 2BKRB 2MQJA 2N8NA 3S1QH 3AM9A 1E2ZA 4GLVB 3U30A 4MGZE 4X6AH 4BBNC 1LTSD 1Z6HA 4HSPA 4OWTB 4XQQA 1J8IA 4BKGA 1PRTC 4JBKA 3ETRA 1VZ7A 4RH6A 5ELNA 2I5HA 4C3HH 1MVKA 4DV5L 2F0JA 5FLXL 1WXAA 4ZRQA 4C3HB 3CMAA 1KFYB 3GOEA 3VUWA 3TEZA 4RGMA 2L00B 1OQRA 1JT8A 2MGSA 2CFMA 1A3TA 4HDQA 1LYLA 3HOZH 2CS4A 3PZ8A 1S5CD 3PCOB 4OGQC 4K1RB 4IO9A 2VQFL 2FAZA 5LL6S 1YX5B 3HP3A 3ZVVA 4G7OC 1KAWA 1SGHA 1KL9A 3HOUG 1M4VA 2B76B 2J42A 5CBEE 5I6YA 3AN1A 3CMMB 4BBNF 2F52A 5M5WH 5KNCA 1C77A 4A3BG 1PZID 3CPFA 5M5WB 5LXIB 3PO2H 4LNQA 3ICEA 4CDCC 2JA7H 5I9OA 4A90A 2LVPA 2R61A 4OO1H 5EJWA 3S2HH 5IWAL 1HTQA 1PYSB 4G4KA 5C44G 1IKLA 2HDMA 2BH2A 4O1NA 1FXAA 5L95C 3OW2A 4TSSA 2V3PA 2B8FA 1E1OA 4K0KL 5IY0A 4L5QA 4LAAA 3CSFA 1ROEA 5CV9A 2ZCCA 1Z47A 1ZEQX 4KHPL 1R4NB 3L2PA 2UXDQ 4C4VA 2PLPA 3AULA 1C76A 1V9PA 1LTAD 3Q23A 1WCMH 4XWWA 3RNAC 3K81C 1NMGA 4IPDA 1NUCA 2C35B 3D4DA 3V2TA 3Q6SA 3T56B 4B3MQ 2JA6H 1QF6A 1L0YB 1GOZA 2AMCB 3KLRA 4BY1B 3A1QA 3BZDB 4TMAB 1V1OA 2LGSA 2M8SA 1TKEA 1FVIA 3QJYA 4F7XA 1EY8A 1F2LA 2K9XA 3NVWA 1RLFA 4H2AA 4ZOHC 1IXRA 4P16A 4QIWB 5IYBH 2O6VD 2FMCA 4C3HG 1JRPA 2BH8A 2A68D 3FEWX 3LNNA 3RLFA 1TVXA 1VQPA 3EC8A 3CQZH 1Y8NB 1EIFA 3I2ZA 1UE7A 3P20A 1PH3A 3BDCA 3OPOA 4BXXH 5ELDA 3U52E 4K3BA 2YV5A 4FJVB 5JAVA 2Q2UA 3GB1A 2R92G 1GVPA 4BS9A 3JAML 3RD4A 2CWAA 3HOYH 3K0YA 3CCLA 1HXYD 1XLNA 4DA2A 2WDQB 3S17B 3HOYB 1NEKB 3DVGY 2BW2A 1EIHA 2Z9HA 4X66L 1P8LA 4LF5L 1L4ZB 1XTCD 2QCPX 4ZYSA 4OVZA 2LRWA 4GNXC 5M3MH 1Q3LA 3RYTA 3S2AA 5C3EB 5IGCA 2LJ5A 3VFKA 2MFIA 5DLQE 1G91A 4WJ4A 2AWTA 4MTNA 1D7QA 1ACCA 4DXGA 1N34L 2QDFA 2NUCA 4A3JH 1M1KC 4JI4Q 3TBLD 4NXML 1WTRA 5K36G 4A3JB 2E5LQ 4X62L 4R3DA 4A3FB 4C3JG 4DUYL 2VNUD 3NHHA 3EFXD 4DQOC 1FRDA 3CCVA 2V3SA 1LTLA 1JJ2A 1TZ1A 3E56A 1I4PA 1AP0A 3P42A 2Y3AA 3KJPA 3MJWA 3JC66 4PYZA 1DOMA 2IO0B 2A74C 3S2DB 3MHBA 1MHWC 2O4XA 4KKSA 1YJ9A 2KHSA 3S15B 2K0PA 4YSZB 3Q22A 2KCMA 5C4ZA 3GE8C 1QG7A 3GTMH 3A5UA 2HHHQ 2FXQA 4OVUA 1A3UA 1UUPA 2HD3A 3PSIA 3IBEA 5KHOA 3Q3JA 1GHJA 1UE6A 1XXGA 1IGCA 3CAMA 1N5XA 4HCEA 3U58A 2J52A 2KMAA 1JICA 2BTEA 3HKZB 3SEBA 2K8HA 2IO2B 1AE3A 2G1EA 2CH4W 4RGOS 1CMXB 1HR0W 1VDZA 2CQOA 1GJXA 1L0VB 1EWCA 3M7GA 5BMGA 3A7LA 1PHJA 4BZAA 1JB3A 2N9LA 1WD1A 1B7YB 4C00A 3TCAA 1V9JA 5HFYA 2N1WA 1K8AC 1KD1C 1WI5A 3AYHB 1BNZA 2DY7A 1DJRD 3KLSX 3L9AX 4KY5A 1TBEA 3IG3A 1K8RB 1YEZA 4XIGS 1CHQD 1B8AA 2D0PA 4CJ1B 3RZOH 3PMFA 5C44H 2J0TD 2D2QA 4HKQA 1CUKA 1WX9A 2REXA 3D6CA 1NR2A 3FPUB 4N9TA 4JI0Q 2NWGA 2CHWA 1CZWA 2E5LL 2ZT9C 3HOZB 3P4SB 5FR3A 1G51A 2LXJA 3R3OA 3CWIA 1GG3A 1C9OA 2L0CA 3AECB 1ZOYB 4HJKA 3E9SA 3C3LA 2K03A 1FR3A 2F0PA 3ZW3A 1E10A 4A93B 2N9KA 1BCPC 2NB0A 4RKBA 4OX9L 2WDTB 1LM0A 3F2DA 4CO7A 4A93H 2KJ6A 1A70A 4V190 5IGBA 1UD7A 1JORA 3J80c 5FO8B 1VMCA 2DJFC 4BOSC 3KDFB 3M3JA 1PFSA 4X3SA 4JI7Q 4N9F4 3APFA 5DPRA 3B6YA 3RLNA 2BGFA 4HMIA 2M1MA 5JXVA 4L23A 3BK1A 1L0XB 3RULA 3DWQA 5TSSA 4DR6Q 1OXUA 1U4PA 1M90C 4YTNB 2ZTEA 4LCDE 4QL5A 2Y0SB 2JA5B 4GU2A 3WAOA 1LO5D 3QWNA 3H7PA 4OO1G 2MJ8A 1FNVA 4ABNA 3A9KB 3NVVA 2PVGC 3W3AA 1SMYD 4BVUC 4D2KA 1LXDA 3HOVG 3R2TA 4WJ3M 4ZRIA 1VS0A 4JE3B 1TS3A 2HQLA 1QUQA 2SEBD 2JU6X 5AZFA 1WTVA 1H9JA 4A3BB 1WXMA 4KDIC 2DWQA 1P9DU 1ENCA 3QK0A 3ABVB 5JJLA 4CKEA 1D4BA 5EPKA 2EYPA 1YBYA 4HCSA 1E2VA 4ANWA 3UQAA 4JBWA 1RJTA 4QIWE 2J4XA 2V0GA 1B44D 2MX2A 4MT5A 2F0WA 2ZPYA 1F2YA 2WXNA 1YD8U 2DENB 4OELB 4A3CG 1C4CA 2MJEA 2MRPA 1NAPA 3G6JB 4QQBX 1HA6A 5JEAG 3KWVA 1X32A 2INPE 4IFDJ 5ELFA 5MPOA 4P1CC 1LM8B 1KNAA 2RCFA 5KHQA 1BR9A 4QMGA 1KQSA 2AWNA 4REZA 4NJ7A 4S0RA 2LGIA 2L1BA 4IWPA 2F0IA 3BVZA 4MM3B 1CZPA 1FGUA 1BUIC 2ACZB 5HG2A 4WJNA 4MTKA 4JI8L 4EGVA 3KLSA 1YJIA 3VXWA 3NTHA 1Q1BA 5H8YE 2B63G 4C80A 4P2CB 2XWJB 2I5LX 2D3BA 1DOYA 2A6ED 1AFPA 1E0ZA 3G6EA 3TEWA 2A6EC 4XQNA 2MWSB 4FF3A 3OWEB 3ZUNA 1V8QA 1XLPA 3ZDMC 3I4NB 4TKNA 1YITA 5GAHC 4L63B 4RWSC 4B9XA 2WX1A 1F9RA 4AUQC 5DEHA 1T0RC 5DPSA 4FNFA 4A3GH 4DV2Q 3S1MH 5E4WC 4DUZL 2KOLA 2K3UA 1PH9A 3R66C 2FCNA 4LFCL 3VYRA 4PQXA 1B3AA 2C5LC 2LJIA 4IPHA 4XT1B 2N9PC 3L13A 4PMWA 4PG3A 4LNNA 3H0GH 4W9FA 4OEMB 2Z0SA 2KK8A 5HGQA 2B2VA 4W9DA 3M85A 1VQKA 4LFAL 2MJ3A 3G4SA 3Q0AA 1SJHD 3E0EA 2MUYA 5IGDA 2Z6BA 1LTRD 1SF0A 1FYCA 2XGTA 1X1MA 4A3MH 1K53A 3B2FA 4GLSC 4MACA 5BN4A 3NSWA 2BWFA 4A3PA 2JA9A 2LXKA 1I4RA 5C6AA 1CT1D 3FKIG 4HIMA 3AEDB 4E6IA 4JI1L 1WTWA 2VZKB 1FD7D 1XLQA 4FF1A 3NVZA 4H02A 1RODA 2WB1E 2NBUA 1B70B 1RFKA 3SU8X 4MHEA 5AJ3Q 5IP9H 1PTOH 4WQMA 2HIVA 2KWUB 2BQQA 2X6GA 1L2NA 3AB5A 2BPSA 3NS1A 2EJMA 1S40A 3D6WA 4FXDA 2K75A 1FCCC 3FPPA 2BDNA 2NTTA 2XTIA 1OQQA 4WWPA 4ZRPA 3ERSX 1WGDA 1TYGB 4TV3A 2HJ8A 5GADC 1N5WA 3ULPA 3X23A 3U4EG 2CHBD 4K5VA 3H15A 2RBMA 2O2VB 1A0IA 4IUUA 2EY5A 2VH2A 1B53A 1Q1OA 4DV7Q 3QHTA 5GQOA 1TWFB 1WJJA 1UWMA 2ZW0A 3N1YC 1TIFA 4MH8A 1YHQA 2W3RA 3K5OA 3QO2A 3D4RA 1UNSA 1KXLA 3HM3A 1TWAH 2K6DB 3QWZB 1B1ZA 2WV6D 3RR5A 4YXDB 2WS3B 2INDC 5IODA 2AQ2B 1VQHA 2RCNA 4DV7L 1Y56A 2WX0A 3N1XC 3UIPB 3RMHA 4P74A 1HQMC 3D3RA 3RN5A 1V2YA 4IFDG 4XYOA 4J6IA 5EPLA 1X3FA 4DV4Q 3T1HL 2E2JB 4FF4A 2KMCA 4BBSH 2JY6A 4MZ9A 3S24A 3Q3NC 3EIVA 1Q86C 1XMQQ 2OEOA 4DV0L 1U9RA 2GOWA 3L54A 1KDAA 1VQLA 3N9YC 5LMNW 2F1MA 1NENB 4Q2JA 4LJOB 3VRBB 5EE3A 2KFJA 3MXNA 2L0TA 3PO0A 1WGHA 1YOVB 3AE2B 1CZGA 3PO2G 3KW5B 4BKTA 2L52A 3U4VA 2NPTB 1ESFA 3RNFC 1B9RA 3SHQA 1U4MA 4A3GG 2EJFC 3TP5A 2VL6A 2J53A 1KABA 4PS7A 4HEDA 4NP5A 5LMUL 1JROA 3UDXA 2QCZA 4NPSA 2PW7A 4R4OA 3EBEA 4B0MA 5BMIA 2LY7A 4K3CA 2K50A 3ULJA 1B2TA 1U5KA 2KZRA 2BCOA 4G50A 4HXDA 1HR0Q 3AEVA 1YQBA 2L55A 2GA4B 2Z4HA 1F2ZA 1QZGA 1S3OA 1SMXA 1HNZQ 1YNND 4A3OA 2F0NA 4DR1Q 3OTOL 3CXCA 2NN6H 4LMQD 5LLIA 3P1MA 4S3SA 3N52A 1HZAA 5JPMC 2R93G 2WKCA 1C4PA 1UH6A 4ASWC 1SE4A 2XN9C 2CCZA 4C3IB 3Q69A 4MH0E 1Q7YC 1UBQA 1VDVA 3RI7C 3S14B 5JJKA 1IL2A 2Y0SE 1Q10A 4RMAA 5IYBG 1YHAA 4GN1A 1I94L 4N6EB 3QQ8B 3M4OB 3VR2A 4JWSC 2KQ4X 1ZXTA 1OXXK 2IHEA 1PXUA 1I4HA 4LFBQ 3I3CA 3ULLA 4POGA 3PRMB 1MIUA 4B3RL 3EA6A 2CVRA 4JK1C 4EQOA 1WCMB 1MHXA 5AEKB 2A6HC 1SYBA 5HURA 4CQNA 1F0ZA 4LDTB 3L10B 4RFBA 1L1OC 1GUOA 3SDZA 3TP8A 1IUEA 2KTRB 2K5DA 2PQEA 2AHOB 3KUDB 1RTNA 1RD9D 3N6RA 1T0QC 4DR3Q 2FCSA 2DUDA 2KN4A 1GUGA 2KAJA 3RMKC 3U7DA 3QX1A 1E8WA 1P16A 3SD5A 1ZUD2 1P3QU 2VUMG 4H7BA 1VQ4A 2JA7G 1YJJA 5C4HA 3A33B 1FNUA 1ISNA 1XPRA 3MJ5A 1E6EB 1UZXB 4XT3B 2LMCB 5CYUA 3KLWA 2F0KA 4RCOA 1G2SA 4ZLTF 1NJIC 2X8XX 3NXWA 4MJSA 4IKGA 1TWGB 2AWOA 1UE1A 1R4MI 2VZAA 2MJDA 1TXYA 4XDCA 1BCPF 4X65Q 1PRTF 5IYDG 1G6ZA 4HVBA 5CORA 1XMOQ 2YLMA 1WY8A 1ESRA 1VRAB 2LFNA 4JI2L 4DR7Q 2M56B 4CKCA 5BYRA 1PA6A 1PH4A 1I3QH 3U9SA 2QHOA 3DWAA 3H7SA 3L17A 1EY4A 1ENAA 1NYQA 2KQSA 3M63B 4WWNA 4W9GA 4S17A 1CI3M 2ICEC 1CFMA 4X57B 2JUOA 2ZNVC 1FCLA 1QOHA 1CA5A 2QMTA 1EZ8A 1O78A 3ONAB 2IW3A 3A8IE 2B3GA 4HN7A 1KJTA 3APDA 1PFMA 4RF1A 3H0GG 2EKIA 4GGQA 2IWHA 3J7AF 2LXCA 2N55A 1Q8IA 4BBSG 2GB1A 3S16B 4M01A 3TZUA 1WGYA 3A8JE 4OONA 4DKAC 3CF5A 2FCMA 1JE4A 1LT4D 3CCUA 3R8BA 1KLUD 4DV6L 2KT7A 4PK1A 1IYVA 5HI1A 4LF8Q 2AYOB 4XZ4A 1Q12A 2N4FA 2HDEA 4ICUA 1YNNC 4LWCA 2D5GA 4AWJA 4YY3Q 1STBA 4JI3L 2UXCL 3VR9B 2UUBL 1A3VA 2X69A 5K36H 3TS0A 2XK5B 4WIPA 1QE6A 3AE9B 3R7RA 2OEDA 4Y7NB 1KH0A 1NTGA 1K3BC 3K7UC 3KF6B 2HTHA 2VUMB 3LGJA 1FNWA 4DFAA 4BBSB 3Q8BA 4YHHL 2NVXH 2D5DA 2VUMH 3K6OA 4DAVA 1VQ5A 4NXNL 1HUMA 1OEYJ 1F2MA 3PT2B 1C48A 1ZE3D 3K9PB 1K8GA 1SNPA 4A76A 1IW7D 4OIJA 4FYDA 3L08A 2D10A 3RFZB 1MBYA 1YNJC 3S17H 3BYYB 2J0MA 2C7MB 4WJPA 4C3JB 3NY5A 4XDXA 3A7AB 4A3MG 4CYEA 2OJWA 1MGSA 3CP0A 4FXKC 3ZIMA 2D62A 1QOBA 3RZOB 3E6ZX 4U68A 2R7FA 5C44B 3VTVA 4EZKA 4JV5L 4JG2A 2MPMA 4YHHQ 2K39A 1NCVA 2PYKA 4RM8A 2F3VA 3K5MA 4EUTA 3HOWB 1L4DB 1I6VC 2NZOA 3AI5A 4RGNA 4IJHA 3OWFA 2K5QA 1Y69U 4HCNB 4DXAB 2DZJA 4CJ2C 1NE3A 1PV4A 1S4ZA 2KVRA 1RFAA 2GBKA 1IL8A 1EYGA 2KX0A 4YWMA 4JV5Q 3TZDA 2JZPA 5G2NA 4C7ZA 4F7ZA 3GTOH 3HG9A 4K14A 1L6UA 5C3WA 2B39A 3GTOB 1C4AA 1PFDA 3HOVH 3S15H 3GO5A 2WLBA 3FKYA 3APCA 1G291 3NQTA 1HZBA 2Q2HA 2N0SB 3IL8A 4LFCQ 3I57A 2WYQA 3CC2A 2DAFA 1D8LA 3SK4A 1YNJD 1YVCA 4P1BC 1DXMA 5D6JB 4L2YA 1XCTL 3TIXA 5EAYA 2V4IB 1O7LA 4FLHA 3GV3A 4IM0A 5IO9A 3EHVA 1IW7C 2I0QA 2RSOA 3VUXA 5IOIA 3K7AH 4DHJB 1PH6A 4OX9Q 4UP9A 3DPDA 4M0WB 5LMNQ 2KO3A 4DR4L
chains in the Genus database with same CATH topology
4A3DB 1BO0A 1NR4A 2B2UC 1FIQA 2HCIA 1T3QA 3OHXC 1H9SA 3MXPA 5IGEA 3W2DA 1EYAA 1SSOA 3MZ5A 4A9AA 1T5XD 2QEJC 1S5FD 3IFTA 4AS1A 2F0SA 3Q8FA 3SXHA 1E2WA 4B08A 4ZK9B 1RYJA 2PZWA 4RNAA 4KX6B 1U4RA 1PGXA 1H9SB 1PUTA 1TKGA 2WXGA 2FBWB 1MI0A 3K58A 4LLGM 1D1KA 4ZQ3A 3EJIA 5FLXE 2AX5A 1BOSA 1ZYRC 2BS4B 2IGGA 3X3MA 4M0WA 2G9HD 3A54A 3MA2B 1SNCA 4IUTA 2SNMA 4B0EA 1BF4A 1VZ6A 4RCNA 3LWUA 1EY5A 2BA0A 2BYTA 1STGA 2RSNA 2JYTA 2XVSA 2WXIA 3AEEB 5CV6A 1VLBA 2VZKD 2XIWA 1Q1EA 1WWTA 3I90A 1IHZA 1S5BD 3CRLC 3I4MB 1CM9A 4OZAA 2CJNA 2O5JC 2TMPA 2A69C 3P75A 1CHPD 1K52A 4CBVA 3DHQA 2K22A 1IKMA 3PUZA 2VB3X 3K57A 3FVQA 1J9OA 4ID6A 1WSPA 4A3IB 1FFVA 4GZYC 1RWSA 3ZGZA 3A8KE 3AEBB 4OHJA 5LNK1 4C7YA 5EKKA 4NMZA 3KBGA 1BUVT 1ILPA 5J39A 1EQTA 4HAEA 2PZTA 1LT5D 4KKJA 4ZHPA 1D5XC 4X3TA 3LB8C 3NUHB 2FMMA 5EKLA 2KEDA 4IUNA 3GD7A 1ZKOA 1A6XA 1X3PA 3LYYA 1TU2B 4CGYB 5BYQA 1F9SA 3V3XA 1JOKA 1QKZA 4I65A 5E3FA 2ZW1A 1STAA 3T3NA 2WINB 2W82A 3V96A 5CGKA 2WXPA 1R4PB 1TS2A 1BBXC 4F88A 2IX1A 4RKLA 4QF4A 4J6HA 2WXJA 2R92B 4L8JA 3S1MB 4ZUIA 4EVOA 2B2VC 3TSSA 3OOCA 1HQRD 1HTPA 1DOKA 1KTKA 3P7JA 1FMAD 3PUYA 3OMCA 4BY7B 3TMEA 3W5UB 4US9A 2RDFA 2V4DA 4F87A 2I07B 1GHKA 3GV6A 2K5PA 3SR1A 3AE5B 2L4NA 1F2RI 3K5NA 3GS2A 1TS5A 2K1BA 1E0BA 1X3QA 3I70A 2QSDA 3VQIA 4MIUA 4BBRB 4DK0A 5M5XB 3LWEA 2EVBA 3NVYA 1STNA 1R7SA 3BS1A 1QT9A 2XRQD 4OZBA 3VRAB 3FC4A 1L6VA 2LEKA 1XEEA 1OXVA 1LTTD 2PTLA 4ZHOA 3HGBA 2Y5CA 4OIKA 5A2QL 2Q5WD 1JW9D 2LS01 2H89B 1B9MA 1MPEA 2INNE 5K5PA 5J22A 4GDKB 2HDLA 1EWHA 4IURA 1I4GA 3P1HA 4UAIA 2IX3A 2PNRC 5KYIA 4LJZC 3SE0A 3BDOA 2EY2A 1FXIA 2NVYB 3MEHA 4R9WA 4YSXB 2IPKD 2LFIA 2IL8A 1H9KA 4HR7B 2YEPB 5LL6X 1FFUA 4H44C 2L11A 2WXQA 2ID0A 1V1PA 2A68C 1YNTE 5IOCA 5F2DA 3GQBA 1EFID 1C79A 1WXQA 1GXDC 2B2WC 2F0QA 2PKOA 1ZXIA 1BQQT 3SR6A 1ZYRD 1JCKB 1J7AA 1LT3D 3S1NB 3T51B 3PO2B 3R2IA 3CKIB 1SDFA 2B2YA 4TQ0A 3J81L 2KACA 1DONA 2L32A 1FGBD 5H92C 2F0UA 2IDYA 3M7NA 1STYA 5EBDA 1HZ6A 3DWGC 2E76C 2RDHA 2F0HA 2BE5C 5KGUA 1LT6D 5AFWA 2K01A 3KK7A 2HCCA 2Y5PA 3P4PB 2B2TA 2JWUA 5EE0A 3EGRA 2F0GA 3TEYA 1TQOA 3GTPB 3D8GA 2WQYB 3Q8CA 3MC0B 4XTCS 5EKIA 2BDOA 2TSSA 1WTOA 1DZ1A 3CQZB 5T1IA 5D3DA 4XE0A 3SHLA 1EU4A 2KCNA 3NQIA 5JEAH 3AE3B 1AW7A 2NN6I 2F03A 2M2LA 5CMDA 4UDUC 1T6BX 3H3VC 2K32A 5IIFA 5C4XB 5M9OA 4U673 1I3QB 4M8AA 2WXFA 2B2YC 2F0FA 5KIXA 2F0LA 1K50A 1EZ6A 3HS0C 5EE9A 3H6MA 2RDGA 3WOFA 3J80L 4KK7A 4MN3A 1JWAD 4KKTA 4ITKA 4KY7A 1KAAA 3OIPA 1HRJA 3HOUB 1VF5C 4KKUA 1HPCA 2F0OA 3FDTA 3HUIA 5C0XH 2IGHA 4A55A 1DOIA 1V1PB 4IDIA 2I2YA 3AU7A 3V05A 1FD6A 4OW0A 3T4AC 5G5GA 4G57A 3SK5A 3I73A 1K8MA 2WXOA 1E9MA 2Z1CA 5JVG3 2JP1A 2KDMA 3AE8B 4JPSA 5JPNC 4RGTA 1MSHA 1QNUA 3IKJA 1AZPA 2D9UA 3IAS1 4NJCA 3SVMA 4BA1I 2F3WA 3JAME 2FE8A 3U9OA 5E1FA 5C3JB 5FO9B 3BK2A 2IT1A 2W55A 1RDPD 1EM7A 4LTUA 2B2UA 4AQ7A 5EE1A 3WCQA 4WWMA 1RCVD 2FJ2A 1HZ5A 1QB5D 2Q8RE 4K6LA 1QQRA 2JEBI 2FHTA 4FVMA 1QCBD 1KNEA 1MI2A 2R93B 2FFKB 4KY6A 2WXRA 1P7FA 1M8AA 1OO9B 1ICWA 2L83A 3RPFC 1SB3C 3ND8A 1EYDA 1D5MC 3MFGA 3DWMA 4HMJA 1JOOA 5BN3A 2NYZD 2VB2X 1OXSC 4HSVA 5A35A 4PMCA 1H9MA 3MWYW 3I9V1 3I4LA 3M4YA 4NW2A 1I4QA 2EYHA 3H09A 4H0LC 5IT9L 2WP9B 4J1MA 1QNKA 2L1AA 1IYUA 1JWMD 2RA4A 2M9VA 5T1GA 2PMZB 3DEPA 5C0XG 1LTID 1S5DD 2BB6A 3DXJC 2KVMA 1STEA 2W54A 3LX0A 3C1FA 5I4DA 1NSNS 3PUVA 5T8IA 1TT2A 1YQ3B 3RZDB 1AYFA 5M3MB 1KF6B 3Q8AA 1WYGA 1FRRA 1YQ4B 5LHY1 1LLRD 5IGFA 2WXLA 1C8CA 2A6HD 1SJED 2DN8A 1AZQA 1SYFA 4XYQA 3CHBD 2WNMA 3H91A 4ODGA 4KI0A 4V0BA 1XO3A 1DD2A 1LTBD 3J7YW 3AEFB 3IAM1 1XWEA 2AQ3B 5D14A 1PTOC 1TKWB 1SNMA 4ULLA 2MP1A 2ONQA 1LTGD 1QOGA 1F9PA 1SAPA 1VF7A 2JQRB 1HFNA 1KLGD 2IGDA 1WD0A 1F9QA 4K2LA 3ZQ4A 1PMRA 2EY1A 2K04A 2KECA 1JWUD 4FO2A 3HVZA 1PGBA 5G3LF 1YN4A 1R9TB 2O5IC 5HHDG 3ERQA 4RF0A 1TWHB 4KD4A 1LV9A 1A15A 2PVOD 2K33A 1WRIA 3AEAB 4ZUJA 1JMLA 3IAYA 1I6HB 2LHEA 3AMZA 2LKVA 2H4OA 4LK1C 1ONLA 1II3A 5GXGB 1EOTA 1EIGA 4PV1C 1HFGA 2E75C 1RTOA 2IX0A 4YIJA 2HUGA 2HQEA 1DGJA 2V3NA 2PW5A 3GTKB 4NZLB 1PRTB 3I72A 1YN3A 3HOVB 2HTME 4J3OD 3S1RB 1ML0D 1STHA 1AEXA 1O7YA 2XRSD 1Y8OB 4CHTB 4X3KA 2DLBA 5ISRA 5C0XJ 2PMVA 2WXKA 4IN3A 2DBYA 5G5HA 3DM1A 2M19A 1QJOA 2M00A 3PIP3 1ET6A 1SNOA 4FP5D 1HHVA 4C3IG 4K6DA 2BB5A 1TJEA 4O42A 4ZKCB 2KWDA 2B2TC 2LHDA 3BG3A 5CC4A 1KDBA 5C4JB 3PO3B 3NBIA 2K28A 1RF2D 2WXMA 1C9FA 3I91A 3RUZA 1ILQA 2BE5D 2PW9A 1JWSD 4I7ZC 2L5TA 3GTQB 3PIO3 2E74C 2KUMA 3L7ZC 2Z4IA 3AE6B 5BN5A 2EYLA 2WU2B 3OW7A 4PNYA 1SYGA 5EPJA 3NP8A 4Z9CB 4NDXA 1N63A 1XX8A 2C5CA 2EYFA 1O7ZA 2BS2B 3C1EA 4J8QA 3H94A 1QILA 4K2KA 1EQVA 2L12A 4A3EB 1BXTA 3OSOA 1JOQA 2NMQA 1EY6A 2B8GA 1QWYA 1EU3A 4DXFA 5COYA 4X3UA 1AN8A 4USAA 1PGAA 4IFDI 3GP7A 3ITPA 2VXWA 1N60A 4C2MB 4KMUC 2Z8LA 3SK8A 2CQAA 3QOJA 4WRDA 4TQUS 3EUB2 4C56C 4H13C 3NK9A 1UGJA 2E6XA 2OHFA 5DNFA 1SE3A 4K8IA 5KNBA 1EYCA 3Q24A 3NUCA 1VMPA 4G7ZC 2RPVA 4A3MB 2E2HB 1SE2A 3EVQA 3FILA 3NTKA 4FF2A 2DNCA 3GTGB 3IXSA 3Q8EA 4ZAIA 2KA7A 3AE1B 2DNEA 5HGTA 1VZ8A 3IT6B 2EPBA 1EY9A 3DWPA 1TZOA 2EYMA 4F8MA 4G7HC 2G9DA 1B50A 2B63B 1C78A 3DEOA 4GDLB 5FO7B 3ND9A 5A2QE 4K5WA 1QLBB 5AUIA 2SOBA 3T53B 2MHVA 2EXZA 1N62A 3L3OC 1KRHA 1V43A 5E6JA 3QG1A 1TWAB 4QCLA 3M3YB 4DGZA 1BCPD 2WDRB 3C2PA 4RHSA 3HOXB 3TUOA 3ZJUA 4HKZE 5EBCA 3VR8B 1EEFD 2JXMB 3U2SC 4ARIA 1PTOD 4KGSA 5FKAC 1GB4A 5NUCA 2SDFA 2GI9A 3KWLA 3TP7A 1GUWA 4DNTB 5KRUA 4LK0M 2K05A 1CQVA 3UI3A 3SFEB 4A6QA 4NKLA 3K5LA 4KJOA 1W6KA 3O13A 2JE6I 1DOLA 1BMLC 2EZVA 3J7AV 3HRDD 2FINB 2NTSA 3D31A 1D2BA 1RM6C 5CV5A 2PO4A 1BCPB 3PZ7A 3DUZA 3TN2A 3SFDB 4KHZA 1W6JA 2O2LD 3IFDA 2EDGA 4N58A 1HA5A 4WORA 3MHZA 5JVH3 2BT6A 3AB9A 4YTMB 4DAYA 1RKNA 2YYZA 3FAHA 1QOFA 1TY0A 2F4IA 3URYA 2KMMA 3DMUA 5IGGA 1SNDA 4PT5A 1DCZA 2NZ1D 3BDLA 4EQPA 2R3ZA 2CW0C 2RQXA 3T13A 3S9WA 5BMHA 1WTQA 1TS4A 1WGKA 3T3OA 2F0DA 3BIID 2QKIC 2EYOA 1U4LA 2A69D 3GTLB 1HUNA 4NAWB 2EJGC 3GTJB 3W5VB 3MVVA 4ZRZA 1A2UA 3OMGA 2JA8B 2N88A 1C4QA 2QDBA 3HZXA 1PDXA 1MHHE 1SSNA 3HVDA 5C5MA 1FM0D 2F0VA 4IUVA 5CV7A 1WTXA 1IGDA 1SYEA 2EYJA 1HCZA 2ENBA 5C5LA 1JQ4A 4YTPB 2PZUA 1YMHE 3VR5A 5I6WA 3KBXA 1BDOA 3TP6A 5FOBB 1PYWD 1Q90A 2JA6B 2BOSA 1ZDXA 4K8JA 1B9NA 3AE7B 2MH7A 1GUTA 2SNSA 4HROA 3VA7A 1B4OA 4DF7A 3D4WA 1NYRA 1SEBD 3ZJTA 4OL7A 4IQZA 2AUKA 2NVXB 1ET9A 4L6TB 3S1QB 4ARCA 4PMBA 5D3IB 4DN4M 2WAQB 2WKDA 1P7EA 3NBHA 4DU9A 5CV4A 2NBFA 4ILWA 3UI2A 1HEZE 1MD2D 2JSVX 1LABA 1XCQL 2WACA 4KJNA 2NVTB 4WH4A 4A8XC 1GPXA 1S5ED 3AV8A 4C1NK 5E4XA 2NN6G 1G8ZD 2KQ3A 4WJWA 1VCIA 2FUG1 3IT4B 2AUJD 2KCCA 2JA7B 2AQ1B 1Z7TA 2JXTA 2SAKA 3S2HB 3E5SA 3J80E 3LXFA 2K5WA 2JX5A 3J81E 2BBCA 1N61A 1PZKD 2CU3A 4C1NI 2KEEA 2XNAC 2PPBC 1CQFA 2EELA 2QIEB 3VR3A 1FEHA 1L5PA 1Y1VB 4WAFA 2OF1A 4NAMA 3KQ4A 3L4PA 1GUSA 2A73B 2IJ0A 4KTAA 1UWXA 3NTIA 1G2TA 3PUXA 2OT2A 3X3NA 3NE5B 1VR9A 3A55A 4BWGB 4US8A 5CV8A 5JEAJ 5I2XA 2GRIA 1WVLA 1A2TA 4KGTA 2M0AA 4KD3A 4OO1I 1ZDVA 4IUPA 1VJKA 3NWSA 2QILA 2E2DC 5M5YB 3P63A 1D6EC 5ELEA 4KV6A 2H1EA 4B9WA 4CJ0B 2I46A 2K7VA 1PFBA 5FK9C 1Y1WB 1OFFA 4RHRA 3T16A 2RKSA 4RAUC 3TEXA 5DM63 2F0MA 3VYUA 1J7BA 1XF5L 2WIIB 1TY2A 1TKYA 3HEJA 2I38A 5C2TB 4ME5A 4KN7C 5I2YA 4CKBA 3EQLC 1JQYD 2DY8A 2Q8IB 3FRPB 2ZXRA 3NPPA 5G3LD 2MEKA 1T5EA 1V97A 4R8NA 2N7JA 3GTMB 4AYBB 2E3TA 3R93A 1UAPA 4QUCA 3WOEA 2JEAI 5AUKA 3KUPA 4QUFA 4WFN3 1SXTA 1CJEA 1CK1A 4YXDB 1PTOF 5DAUA 3AMUA 3NZ3A 1K51A 5C0XI 2CW0D 3BYTB 3MXGA 4KHVA 4IFDH 1SYCA 1DM0B 3E0JA 5CR3A 3C46A 3P4RB 3EROA 5DM73 3WDNA 1JALA 2X38A 1K83B 1D5ZC 2BA1A 1NI3A 2WXHA 1CTMA 1SMYC 2EE1A 2R7ZB 4IOIE 3ZJVA 1PTOB 2WP8J 2XWBB 4EE2A 1LACA 4KGRA 2K6AA 2PCFB 3A56A 1TIID 3SK6A 3MP9A 3U7ZA 2LMCA 4M1UB 4IUQA 1F2RC 2JYOA 5D65A 1Y8PB 1PLFA 1SFOB 3QOLA 4Q0FA 3B9JA 1UEAB 3H8HA 2ZXOA 3VA5A 3TDQA 1JR0D 2NVQB 4P6VF 2EY6A 3K7AB 5BYSA 3FKIB 1I50B 5M3FB 5ELBA 4TQ1A 2J7ZA 2KJXA 3H0GB 1SIJA 2RVLA 2E2IB 4HEA1 3CRKC 3G7LA 3PV0A 3NRZA 5KYLA 1EY0A 4JX1C 2JYEA 4KN4C 3QIAA 1WTPA 1NVID 2PIAA 3FMCA 3PUWA 2H88B 4RA8A 4K5XA 1KDCA 4L1BA 2W3SA 2R6GA 2Q8TA 3MXUA 2A5HA 4ZKBB 3NWTA 1O80A 2D2CC 2L9HA 1ZXHA 5C3XA 1EWYC 5EGTA 1PZJD 4XQJA 1H9RA 4QB4A 3VR4A 3OIQA 5IT9E 4YWGG 1DYQA 1GAQB 4A3GB 5ELCA 1I7HA 4WURA 3F2UA 1XYIA 3W9CB 2RMMA 4N59A 4XDDA 3CIRB 1GUNA 4Q5VA 1DOXA 1EY7A 3I8ZA 3J9CA 1AWDA 4KKIA 2WDVB 3HRZC 2WB1B 2CJOA 1JWBD 2WU5B 3B2GA 1F77A 2DYMA 2XSCA 1FO4A 5I9PA 1JC7A 4FXCA 4YSYB 5JJZA 1TR5A 1CA6A 3AE4B 3VYTA 2YEPF 4OZCA 4R8IA 1EL0A 2B2WA 2EOTA 1D1IA 3CU7A 2QJLA 2F0TA 4FXGC 2YU9B 3KF8A 1E7PB 1GB1A 1I4XA 3C8YA 1ENFA 1V8CA 1J7CA 3MTSA 3P4QB 1ZPSA 2C9OA 5J1ZA 4N9PA 4HJGE 4DK1A 5D7GA 1PDQA 1ZP0B 5JOBA 2ON8A 3QB3A 2JSOA 3W1SA 3MFYA 4TKOB 2ZXPA 2QF7A 1SBBB 3FILB 3VYSA 1PRTD 4BA2I 1XLOA 1OXTA 4JWUC 1MSGA 3MAQA 4EQNA 2ICIA 4XXEA 4HRSA 3BVMA 2BS3B 1IBXA 1EEID 3VR6A 3ZYYX 5CBAE 5KNDA 5EQ0A 3K59A 1TWCB 4HTHA 2LUMA 4TRDA 3AH7A 5KEEA 1YN5A 3TBIB 1RHPA 2F0EA 2DYOA 2X6LA 4IZ8A 1SNQA 4DNRB 4A3KB 1PFNA 1QOAA 3BVGA 1SYDA 1R4QB 1IBXB 4XWTA 1HTLD 4IALA 3BWUD 3AEGB 2OXPA 4DAPA 1K8OA 3AM9A 1E2ZA 1LTSD 1Z6HA 4HSPA 4XQQA 1J8IA 1PRTC 3ETRA 1VZ7A 4RH6A 1MVKA 2F0JA 5FLXL 4ZRQA 4C3HB 1KFYB 3TEZA 4RGMA 1OQRA 2MGSA 1A3TA 3PZ8A 1S5CD 4OGQC 5LL6S 3HP3A 4G7OC 1M4VA 2B76B 2J42A 5CBEE 5I6YA 3AN1A 5KNCA 1C77A 1PZID 5M5WB 5I9OA 4A90A 2R61A 4OO1H 5EJWA 4G4KA 1IKLA 2HDMA 1FXAA 4O1NA 4TSSA 2V3PA 2B8FA 4LAAA 1ROEA 5CV9A 1Z47A 1ZEQX 2PLPA 1C76A 3Q23A 1LTAD 4XWWA 1NUCA 3D4DA 3V2TA 3Q6SA 3T56B 1QF6A 1L0YB 1GOZA 3KLRA 4BY1B 4TMAB 3BZDB 1V1OA 1TKEA 3QJYA 4F7XA 1EY8A 1F2LA 2K9XA 3NVWA 4H2AA 4ZOHC 4P16A 4QIWB 2FMCA 4C3HG 1JRPA 2A68D 3FEWX 3LNNA 3RLFA 1TVXA 1Y8NB 3P20A 3BDCA 3OPOA 5ELDA 3U52E 4YT0B 5JAVA 3GB1A 4BS9A 3JAML 3RD4A 3K0YA 1HXYD 1XLNA 4DA2A 2WDQB 3S17B 3HOYB 1NEKB 2BW2A 1EIHA 1L4ZB 1XTCD 2QCPX 4ZYSA 4OVZA 1Q3LA 5C3EB 5IGCA 1G91A 1ACCA 4DXGA 2NUCA 1WTRA 5K36G 4A3JB 4R3DA 4A3FB 4C3JG 2VNUD 3NHHA 3EFXD 4DQOC 1FRDA 3E56A 1I4PA 1AP0A 3P42A 2Y3AA 1DOMA 2A74C 3S2DB 3MHBA 3S15B 2O4XA 4KKSA 4YSZB 2KHSA 2K0PA 3Q22A 5C4ZA 1QG7A 1A3UA 1UUPA 1GHJA 1XXGA 1IGCA 1N5XA 4HCEA 2J52A 2BTEA 1JICA 3HKZB 3SEBA 2G1EA 4RGOS 1VDZA 1GJXA 1L0VB 5BMGA 1EWCA 3M7GA 3A7LA 1JB3A 2N9LA 1WD1A 5HFYA 1BNZA 2DY7A 1DJRD 3KLSX 3L9AX 4KY5A 4XIGS 1CHQD 4CJ1B 3PMFA 2J0TD 4HKQA 3D6CA 1NR2A 3FPUB 4N9TA 2NWGA 1CZWA 2ZT9C 3HOZB 3P4SB 5FR3A 3R3OA 3CWIA 2L0CA 3AECB 1ZOYB 3E9SA 3C3LA 2K03A 1FR3A 2F0PA 1E10A 4A93B 2N9KA 1BCPC 2NB0A 4RKBA 1A70A 4V190 5IGBA 1JORA 5FO8B 1VMCA 4X3SA 4HMIA 5JXVA 4L23A 3BK1A 1L0XB 3DWQA 5TSSA 1OXUA 1U4PA 4YTNB 2Y0SB 2JA5B 1LO5D 3QWNA 4OO1G 2MJ8A 1FNVA 4ABNA 3NVVA 2PVGC 3W3AA 1SMYD 4D2KA 3R2TA 4JE3B 1TS3A 2SEBD 2JU6X 1WTVA 1H9JA 4A3BB 2DWQA 1ENCA 3ABVB 4CKEA 1D4BA 5EPKA 2EYPA 4HCSA 1E2VA 4JBWA 1RJTA 2J4XA 2V0GA 1B44D 4MT5A 2F0WA 1F2YA 2WXNA 1C4CA 2MJEA 1NAPA 3G6JB 1HA6A 5JEAG 3KWVA 1X32A 2INPE 4IFDJ 5ELFA 5MPOA 1KNAA 1BR9A 4QMGA 2AWNA 4REZA 2LGIA 2L1BA 2F0IA 3BVZA 4MM3B 1CZPA 2ACZB 1BUIC 5HG2A 4EGVA 3KLSA 1YJIA 3NTHA 1Q1BA 5H8YE 4C80A 4P2CB 2XWJB 1DOYA 2A6ED 1AFPA 1E0ZA 3TEWA 2A6EC 4XQNA 4FF3A 3OWEB 1V8QA 1XLPA 3I4NB 4L63B 4RWSC 4B9XA 1F9RA 5DEHA 4FNFA 5E4WC 2K3UA 2KOLA 3VYRA 4PQXA 1B3AA 2LJIA 4XT1B 4PMWA 2B2VA 3M85A 2MJ3A 3Q0AA 1SJHD 2MUYA 5IGDA 1LTRD 1SF0A 1FYCA 1K53A 3B2FA 4GLSC 4MACA 5BN4A 3NSWA 1I4RA 5C6AA 1CT1D 3AEDB 4E6IA 1WTWA 2VZKB 1FD7D 1XLQA 4FF1A 3NVZA 1RODA 1RFKA 4MHEA 1PTOH 4WQMA 2X6GA 3AB5A 3NS1A 2EJMA 4FXDA 3D6WA 1FCCC 3FPPA 2BDNA 2NTTA 1OQQA 4ZRPA 1TYGB 1N5WA 3U4EG 2CHBD 4K5VA 2RBMA 4IUUA 2EY5A 1B53A 1TWFB 1UWMA 2ZW0A 4MH8A 2W3RA 3K5OA 3QO2A 3D4RA 1UNSA 1B1ZA 2WV6D 2WS3B 5IODA 2AQ2B 1Y56A 3RMHA 1HQMC 3D3RA 4IFDG 4XYOA 5EPLA 2E2JB 4FF4A 2OEOA 1U9RA 1KDAA 3N9YC 2F1MA 1NENB 4Q2JA 3VRBB 5EE3A 3MXNA 3PO0A 3AE2B 1CZGA 2L52A 1ESFA 1B9RA 1U4MA 2EJFC 3TP5A 2J53A 1KABA 4HEDA 4NP5A 1JROA 2PW7A 4B0MA 5BMIA 2LY7A 1B2TA 2BCOA 2L55A 2GA4B 2Z4HA 1F2ZA 1YNND 2F0NA 2NN6H 4LMQD 3P1MA 4S3SA 3N52A 5JPMC 1C4PA 2WKCA 1SE4A 2XN9C 4C3IB 3Q69A 1VDVA 3S14B 1Q10A 4N6EB 3M4OB 3VR2A 4JWSC 2KQ4X 1ZXTA 1OXXK 1PXUA 1I4HA 3I3CA 3EA6A 2CVRA 4JK1C 4EQOA 1WCMB 1MHXA 2A6HC 1SYBA 5HURA 4CQNA 1F0ZA 4RFBA 3SDZA 1GUOA 3TP8A 1IUEA 2K5DA 2PQEA 1RTNA 1RD9D 3N6RA 2KN4A 1GUGA 2KAJA 1ZUD2 4H7BA 3MJ5A 1YJJA 5C4HA 1FNUA 1E6EB 4XT3B 2LMCB 5CYUA 2F0KA 4RCOA 1G2SA 4ZLTF 3NXWA 4XDCA 4IKGA 1TWGB 2AWOA 2MJDA 1BCPF 1G6ZA 1PRTF 5CORA 1ESRA 1VRAB 2LFNA 2M56B 4CKCA 5BYRA 3U9SA 3DWAA 1EY4A 1ENAA 1NYQA 1CI3M 2ICEC 1CFMA 1FCLA 1QOHA 1CA5A 2QMTA 1EZ8A 1O78A 3ONAB 2IW3A 3A8IE 4HN7A 1PFMA 4RF1A 2EKIA 2IWHA 3J7AF 2N55A 1Q8IA 2GB1A 3S16B 3TZUA 3A8JE 1JE4A 1LT4D 3R8BA 1KLUD 1IYVA 5HI1A 1Q12A 2HDEA 1YNNC 2D5GA 1STBA 3VR9B 1A3VA 2X69A 5K36H 4WIPA 1QE6A 3AE9B 2OEDA 4Y7NB 1KH0A 2VUMB 1FNWA 4DFAA 4BBSB 3Q8BA 2D5DA 3K6OA 4DAVA 1HUMA