1I4RA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.5
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4rA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4rA02
3URYA 1V1PB 1B1ZA 2SEBD 3BVGA 2TSSA 1PRTD 3EFXD 1EU3A 1S5FD 5ELCA 1PZID 2XN9C 1S5CD 1LLRD 1BCPD 4RFBA 4NZLB 3O13A 1QILA 3BVMA 1KLGD 1RDPD 3MFGA 2XNAC 1I4RA 1SE4A 1JCKB 2G9HD 1I4QA 1I4HA 4DXGA 2Z8LA 2AQ3B 1BCPF 1CK1A 1I4PA 5D3DA 2AQ1B 1UNSA 1LTRD 1DJRD 1XTCD 4DXFA 3BYYB 5I4DA 1M4VA 1ENFA 1G8ZD 1HTLD 1F77A 1PZJD 5TSSA 1STEA 2ICIA 1LTBD 1YN3A 5FK9C 4RGMA 3TSSA 3EA6A 1LTSD 3R8BA 3DWAA 5ELEA 3W2DA 2WV6D 1LTGD 1JWUD 1LT5D 2J4XA 3R2TA 1RF2D 1DYQA 1YN5A 1D6EC 1S5DD 2R61A 3BZDB 2XRSD 1JQYD 1PTOD 2QILA 3CHBD 1JWSD 1HXYD 1RCVD 4Z9CB 1RD9D 1PTOH 4RGNA 2QEJC 4L63B 4TSSA 1ET9A 1KLUD 4O1NA 1LO5D 1PTOB 1HA5A 2XRQD 1YN4A 1D5XC 1EFID 1KTKA 1PRTB 1CHQD 1PRTC 1D5MC 1FGBD 1SE3A 1TS5A 1V1OA 4K6LA 1EU4A 3GP7A 1I4XA 4RGTA 2NTSA 5ELFA 1I4GA 1CT1D 1FNVA 1ET6A 1SJHD 1JR0D 1SE2A 4L6TB 3DWPA 1LTID 2O2LD 1PYWD 1BCPC 2AQ2B 2RDGA 5FKAC 1V1PA 1BCPB 1SJED 1CHPD 1EWCA 4ZYSA 1FNUA 4C56C 1LTTD 3KLSX 1AN8A 1CQVA 1SEBD 1LT3D 1PTOC 1D5ZC 1GOZA 1L0XB 1TY0A 1PTOF 1BXTA 2IJ0A 3DWQA 4RCOA 1ESFA 5ELBA 1EEID 1LTAD 1L0YB 3R2IA 1SBBB 1JWMD 1FNWA 2NTTA 2RDHA 3BVZA 4RHSA 1TS3A 1UUPA 3V05A 1AW7A 1S5ED 1S5BD 1TY2A 3SEBA 3MC0B 1HQRD 1MD2D 1TS4A 3OWEB 1LT6D 5ELDA 1EEFD 1LT4D 1TS2A 4RGOS 1B44D 1SXTA 4RHRA 4RH6A 4UDUC 1XXGA 1PRTF 2IPKD 5D3IB 4OHJA 3BYTB 1PZKD 1T5XD 2CHBD 4BWGB 1FD7D
chains in the Genus database with same CATH superfamily
1V43A 4IURA 2VQEQ 3P1HA 4HJKA 4MJSA 3QWNA 3HKZG 3BVGA 4B3TL 2DZIA 1K83H 1SFOB 4OZBA 3C46A 4Q5VA 3LGJA 1OO9B 1B7YB 1B9MA 2E2JH 5KNCA 4RNAA 2JQRB 1L0VB 3FKIG 1EY7A 2I0QA 1VQ6A 3NVVA 1XX8A 3NJTA 4S0RA 1LV9A 1Y8RC 1JT8A 3TEHB 2IX1A 2CQOA 1N33L 1VQOA 4B3TQ 2LHDA 4D2KA 4DR3L 1S4ZA 3HOUH 4I7AA 5IYDH 4KIKA 3I55A 2E2DC 4EQOA 2HDMA 2KVMA 3ZJTA 1I3QB 1WM3A 4QMGA 3DHIC 1QF6A 3D4DA 2CJOA 2BYVE 1X1MA 3HOYG 4IFDG 4HJ8A 3L13A 1U4LA 1VCIA 5AJ3Q 2EQSA 4BA1I 2KCCA 2LI5A 3T9LA 2BB5A 3TSSA 1RWSA 3EIVA 1S1QB 2J7QB 3QWZB 2PI2E 4KZCA 2NWGA 1SYFA 5ELEA 4G7ZC 2AWTA 1DOMA 1UE6A 4N8FA 3WAPA 4XYOA 5LXHA 3ML9A 1ZXTA 2ON8A 1PFBA 2ATWA 1Q7YC 1AH9A 1WCMG 2MGSA 5IYBH 2M1MA 3ABVB 3GTKB 1NDDA 4MT5A 2EY1A 4HVBA 1WCMH 3W5OA 3BJUA 3S15B 1A70A 3IFWB 4RGNA 1IYFA 1PDXA 1K3BC 3UDGA 3JAMc 1YN4A 1XMOL 4IUTA 4LUOA 2IDYA 1D5XC 1EFID 3IAM1 4LMQD 3X3MA 2IO2B 3PLUA 1R9TB 2Y5BB 4BBNF 2RCFA 3G6JB 1WJUA 1XPRA 4UY8C 2NMQA 4ZHPA 4NW2A 4A3LH 4LF6Q 1KRTA 4WORA 2EZVA 3WDNA 5IGBA 3PO2B 1XMOQ 1ZYRC 4JI1L 2KQSA 2GVAA 1KAWA 2KN5A 5KYIA 2WQYB 1OGWA 2O2LD 2ONQA 2P5ZX 4C2MH 2HDLA 2M0XA 3Q14C 1FNUA 3EJIA 2PW5A 1XLPA 2LFIA 1MIUA 1U4RA 1PTOC 2EJMA 5LMUL 1K52A 3PSIA 1BBUA 4MN3A 4NDXA 3VYUA 3KK7A 4EZKA 3DWQA 2PW9A 4R4OA 1WMHA 3M4PA 2X6LA 4DAYB 2LVQA 1F2ZA 4RHSA 4DNIA 1Z6HA 2WIIB 1DONA 3IAYA 3TP6A 1ZW7A 2N4FA 3AI5A 4IM0A 1TS4A 2XVSA 2D3CA 2Z0DB 1S3SG 2K5DA 3AM9A 4JWSC 1G6PA 3RNEC 2L05A 4DDID 4KGTA 3E9IA 2JSVX 2KQ4X 4MGZE 4BKTA 2JA6G 3JAMi 2UUAL 1X3GA 4KD3A 4LFCL 3B08A 1WXVA 1KL9A 3STBC 1A62A 1KD1C 2QHOA 4K2KA 3Q8AA 2XWBB 2C7MB 2V1CC 1O7LA 2JYOA 1V6EA 1B1ZA 4W9IA 3TZUA 3PTFC 3EFXD 2GVBA 4YWLA 4FYDA 1FD6A 2PZWA 2A8VA 3QIJA 3IFDA 4ICVA 2C9WB 1GPXA 3PHXB 2K52A 2MUYA 2WU5B 4IALA 5FLMG 4NNJB 1MHHE 3HVZA 3NSWA 3TJPA 3T1YQ 1WTQA 2F1MA 4TMAB 3T16A 2OOBB 3FMCA 4IUPA 3PVLA 1I4PA 2ZZPB 1W3SA 1UZXB 2JPHA 2M17A 2OJWA 2JK8A 1OQQA 1E9MA 1HFGA 4JI6Q 2FNJB 2I5LX 4V190 2UXDL 4PV1C 5LMNL 1WTVA 3V3XA 1E1TA 3T53B 1L6VA 3CMAA 3H3VI 2WXLA 3EFCA 1LTBD 4A3KG 1TWAB 3VDYA 3EA6A 3U9SA 3X3NA 3PO2H 1TKYA 4GDKA 5C4XG 1IYUA 1IPGA 3PHWB 3NEMA 1H9SB 5EBDA 1I50H 3H3VH 5JJKA 3IVFA 1GB4A 1B3QA 1UWMA 2BF8B 4DV2Q 4X6AH 2JY6A 5BN3A 1DGJA 3K57A 3AU5A 1G91A 2R61A 2ZTDA 4CHKA 1WJJA 3L7ZC 2QILA 3A7AB 1HXYD 1N32Q 5G3LF 1VQ7A 4BXXH 2KJHB 3GTOH 2MWSB 1BO0A 4BY7G 2KAJA 3HFZB 3LYYA 4O1NA 1KF6B 4MTKA 1WCMB 1YIWA 3TRZA 3OYYA 5DM63 4KY7A 2MJEA 4JOIC 5E6OA 1N5WA 3UDXA 4YSZB 2BA0A 3ZRFA 1KFYB 2JZ3B 4H0LC 2EY2A 1HPCA 4HAEA 5H1SE 1F9SA 3VXWA 4LTUA 2DLBA 2E2HH 2N1WA 4URKA 2QDLA 2X69A 3I3CA 4NPSA 1QNKA 5AJ3L 4GS3A 3PO3B 1YBYA 2JN4A 2NVXB 1QVGA 1NSNS 2LXJA 2RDGA 4NAWA 4XQJA 4KK7A 2FHTA 1J19A 2JX5A 3I4NB 1I3QH 3C8YA 3I4NH 2WB1B 2K5HA 1CQVA 3OHXC 5IOCA 4N8X1 2RHQB 5IE8A 1Y56A 3HOUB 1XMQL 2EMTA 1WTWA 1E5WA 2NN6H 1MI2A 4GU2A 3L54A 1H9KA 2AL3A 2KWDA 2KO3A 4CKBA 2MFIA 4GOPB 2WDTB 4YT0B 1WGKA 5AZGA 1JWMD 3DBRI 5D65A 2J42A 2CHXA 4PK1A 5DPWA 4O0AA 4FJVB 1DOXA 1WSPA 1HTPA 4PZ7A 4MM3A 2YVCA 3WOEA 2GBJA 3H09A 3CCVA 3CCJA 3KDFB 1IGDA 3M4QA 2UU7A 3A1QA 1SMYD 2RQXA 3P20A 1C48A 3VA5A 1A0IA 5BR8Q 2ASQA 5D7GA 1YQ3B 4ZDVA 1JRPA 1N61A 3GTOB 1O80A 2YYZA 4ZQ3A 4A3FG 1E90A 1ILPA 2J53A 2NUCA 2M2LA 2D3GA 2LRWA 4HTHA 4IZ8A 3QOJA 1U4AA 3F1ZA 1WX7A 2KTRA 3TQYA 3G71A 4BY1B 2RGFA 2UUBQ 3K80C 3NTIA 4K2LA 1I50B 3PREA 3OOCA 3W9CB 5IP4D 1BUVT 4YWMA 2D3AA 1LLRD 5KEEA 5C4XB 3GDEA 3PUVA 5JEAJ 4JI4Q 4OO1G 4WH4A 4FADA 3K5NA 3GTGH 3T4AC 3SK4A 2HE7A 1P3QU 1KDCA 2R7ZG 1CJEA 1FGUA 4HSPA 3KDFA 1JCKB 4USAA 4OIKA 1XEEA 1EZ6A 4JI2L 4C3JH 4M8NA 3MEFA 2KD0A 3VUWA 4IKGA 4IPDA 3S9WA 1LABA 1BKBA 3CQZB 3TP5A 4HK2A 3DOWA 4HPLB 1PFDA 1EUJA 4MEMA 1B2TA 2KTFA 4GMVA 2JA6B 4LNQA 2ICIA 3RD2A 2VUMG 4LF8Q 5FK9C 2E75C 2YEPB 4XYQA 1DXMA 1UBQA 2WGSA 1X3FA 2XWJB 2JA5B 2RD0A 4P72A 3B2FA 1U5KA 4KV2A 2PZUA 4FHJA 5DCNA 5AUKA 5AZHA 1EYCA 2L9HA 2UXDQ 4A3KB 4A3MG 4OO1H 3AE2B 4LF7Q 4MH8A 5K36H 4YY3L 3HHMA 2R2OA 1V86A 1Y8OB 2HHHQ 1ENAA 3BK1A 3HOXG 3QJZA 4JVZA 5EPKA 1RLFA 1NI3A 1IKLA 1JWSD 1HHVA 1SMXA 4O42A 4P71A 3QARA 5J18A 2RCNA 2MRPA 4DPGA 5JEAH 3ND8A 4M8MA 5IP7G 1KLUD 3ZIMA 5LNK1 4A3DB 1HNXQ 5JHBA 4XWTA 1YNJD 4RA8A 1G6ZA 1L4DB 5C4JH 3AMZA 1KABA 3I4MB 2ZXRA 4A3BG 2K04A 3GTPB 1YQBA 1T0SC 2Q2HA 2VUMH 4CQNA 1XLNA 2UYZB 1N5XA 5FLXE 1W6JA 2B8FA 3DXJC 4KY6A 3S1NB 4NQLB 2F0TA 4IUVA 2RA4A 1IUEA 1ZKOA 4L6TB 3JAME 1L1OA 4TKOB 2KMAA 4XXEA 2A69C 1IL2A 1C4PA 4K7SA 1C4QA 1HUMA 1T5EA 1X3EA 4X3SA 1WZ3A 3RZWC 4L8JA 5C0XG 3EC8A 3L17A 3VFKA 1GB1A 1RODA 3M3YH 2EKIA 1R4PB 3S1QB 2BT6A 1E8XA 3L0OA 2V1YA 2RSNA 4C2MB 5IA7A 2B2TC 4GDKB 4A3PA 1WR1A 3RNGC 3VQIA 1VQDA 1SYBA 3S1RB 3I8ZA 5C5LA 4ITKA 1E7UA 2W54A 4QCLA 4NB3A 1S5BD 2VB3X 1X3PA 3W1SC 3U50C 2GOWA 1JE4A 1BF4A 4OZAA 3RLNA 1A5RA 2QC8A 1WVLA 3S2HH 4KHVA 4EE2A 4XWWA 1LT4D 4A55A 3CIRB 1KDBA 3L10B 1HR0L 1UE7A 2R2QA 3NUHB 1TKWB 4P1CC 2Z6BA 4HCSA 5HG2A 2BDNA 4MZ9A 2FINB 2ZCCA 4LAAA 3S15H 3KYHC 3SHQA 1KAAA 2XGTA 2ZXPA 2CHBD 4BZAA 1HNXL 1WD1A 1FD7D 3WWVA 1DZ1A 3UIPB 2JYEA 2FJ2A 1TZ1A 1IBLL 1UWXA 1WXQA 1V1PB 2R93G 1J8CA 4WWNA 2V9HA 4DV5L 4IOAA 2XEWA 5HFYA 5GXGB 1PMRA 3HOVH 5G5GA 3L16A 1S5CD 3J7A5 2EYPA 2R3ZA 1J7BA 4PS7A 3ZXRA 4A9AA 1HZBA 2OCEA 4RFBA 3I72A 3PV0A 4LDTD 3IBEA 4QJFA 4XE0A 2NYZD 5EE0A 1RDPD 3KF6A 3OTOL 3QR8A 2R6GA 4EX5A 4XDCA 3AU4A 4L1BA 2F0EA 3OWFA 2IYDB 2N9KA 1SNCA 3OLMD 1MPEA 4CO7A 5D3DA 2IY1B 2BQQA 3CP0A 4C3HH 1UWVA 4P1BC 5IY0A 2F03A 4DV4Q 2R92B 2RKSA 3N1ZC 2Q8RE 2WXHA 5M5WB 4A3BB 3C1FA 4PMWA 4HJAA 4GKKL 2ZEQA 3FKYA 1I94Q 4P74A 1HZAA 4DR5L 3CF6E 3L08A 1CQFA 1P8LA 3SXHA 3FVQA 2LASA 2E2JB 2E5LQ 5JXVA 3HOVG 4K8JA 4OVVA 2Z4IA 4K8IA 1LT5D 3RT3B 3ZJVA 1D8LA 1DYQA 4CBVA 3LXFA 1S5DD 2I1JA 5AZFA 2NZHA 3S14H 3VYSA 3MHBA 4KD4A 5M3MH 1IBXB 3AE6B 3QC8B 1EM7A 5DPRA 4JQWC 1SMYC 1PGXA 2WXQA 2K39A 1I6VC 3LJ3A 2XRQD 1SDFA 4R4CA 4FHKA 1TT5B 2VL6A 2K8CA 3I63C 4C1NI 4JI2Q 3W5UB 4BY1H 1K51A 3KW5B 4OONA 1PH8A 3VYTA 3J7ZC 5I6WA 3PSEB 2MJ3A 3KLSA 2HJ8A 3ONSA 1KQSA 3RNAC 2K5NA 3VRAB 1YEZA 1W2BA 1WGYA 3L0WB 4LDTB 1O7IA 1LM0A 4A3LG 4W9DA 4QGUA 1U4PA 4B08A 1NYQA 1K8MA 1BBWA 5E4XA 4HXDA 3DWPA 4HCNB 1LTID 5FKAC 4HRSA 3GOEA 2CHWA 1J9OA 3DDCB 1OXVA 2DBYA 3VH4B 1LTTD 4REZA 4RAUC 4OWWB 1PH3A 1YNXA 2RVLA 5HURA 1G2TA 3CCEA 2AKWB 1T0YA 1JOQA 4NJCA 3HRZC 2DWQA 1EWIA 1PYSB 1EQRA 1VQFA 3FEWX 1FNWA 2WKCA 1VCBA 4ZRPA 3ZNHB 4IFDI 3HM3A 4XQQA 2IGDA 3NBIA 2K03A 2MPMA 5JJLA 1TY2A 3OWEB 5IKCM 1IW7C 2ID0A 3WAMA 2PE9A 1HA6A 2MQHA 2DAJA 2QMTA 4ID6A 1L6UA 2RBMA 3FHWA 1B44D 4POFA 3ITPA 1SB3C 2A6ED 5D6JB 3L4PA 1IBML 1G291 3AE8B 2QJLA 3MAQA 3KQ4A 4AYBG 3BY4B 4CGYB 2L1AA 1GUGA 2RPVA 3DWMA 1M8AA 3ZNZB 5C3XA 3AEFB 4LFAL 4ZUJA 3GTPH 3URYA 1NENB 5C2TB 5C4HA 4Y7NB 3I4MH 2J7ZA 2SEBD 4H44C 4TQUS 3H8HA 1QT9A 3NVZA 1EIYB 3SR1A 3TDQA 4M0WA 1VQBA 1E6EB 2LXKA 3H3VC 1JOOA 4JBJA 5ISRA 2KOLA 4TRDA 2DAFA 1WI5A 2WP9B 1ZYRD 2QKIC 4XGAB 3H0GH 4B3ML 1EWYC 2OT2A 1O7ZA 1E1OA 2UUAQ 1EY0A 5G2NA 4II3B 2KLCA 1EZ8A 4DU9A 4WJQA 5H92C 1TWGH 2G3QB 5M5XB 5CBEE 2AL6A 2Z59B 1B4OA 3HIZA 3GS2A 1H9MA 3ERQA 5I2XA 4WJPA 3W1YA 4DA2A 4ZRQA 1EY8A 2AEHA 1G6JA 3GZNB 5NUCA 4DHJB 1CUKA 3S2DB 4FJZA 2KDEB 2UUBL 2IZVB 3F8TA 1LTGD 2FCNA 3J7YW 3I4OA 2WU2B 3QAQA 3I2ZA 3A8IE 1B8AA 3D0FA 1SR3A 1YN5A 1D6EC 4ZKCB 2JA7B 2JXXA 4RF0A 2I07B 5FLXL 2B2WA 3ETRA 3VVWB 5BMHA 2EVBA 2CCZA 1RCVD 3GTJB 3TL5A 2KFKB 3LNNA 2H1EA 3DWGC 1PV4A 3NZ3A 1XQQA 3EECA 1TWFH 1N63A 2Y5CA 4JI1Q 2ZW1A 2NVTB 3VYRA 2K5PA 3IRBA 3B1LX 2DNEA 3HEJA 4PZ6A 1T0RC 4F8CB 4RGTA 3KF8B 2E2IH 5CX3A 2EYFA 2DN8A 3E0EA 3QQ8B 1Q8IA 3P7JA 4CDFC 4JBWA 4IOCA 2L12A 2DZMA 4OWXB 4DXAB 5EE1A 2PW7A 3VH3B 5CR3A 4YCUA 3C0RB 3NVWA 4IDIA 1QOBA 3CW2C 2BYEA 4CYEA 5LLIA 3Q6SA 1V1PA 4A75A 1FCCC 1SJED 3WIMA 2F4VL 5E7NA 2F0QA 4A3FH 2PMZE 3R7RA 2HHHL 1J8IA 4KY5A 4GOCA 5I2YA 4KMUC 2EE1A 4A3JB 2L55A 3LWEA 4KJNA 5GMVA 4I65A 1BXTA 1IBKQ 4ME5A 2XIWA 4K5XA 3A33B 3P4QB 1GXDC 2HD5B 3R2IA 2G1EA 4C4VB 2NTTA 2LSSA 1YJJA 4DUYQ 3Q3MC 2HCIA 2KKCA 3S16B 5FO7B 4GLAC 4O2DA 2B3AA 1L1OB 2W82A 5JEAG 3H1UA 4N9TA 1IHZA 1Z2MA 1W6KA 4RF1A 3TBLD 5CV4A 3R7QA 1FFUA 2K50A 3G4SA 2JEAI 4RH6A 1XD3B 4RHRA 3P4RB 2N7DA 3PO3H 3E0JA 4RKBA 4DR6L 4A3GH 2F0HA 1R4MI 3NG0A 1VQJA 1QOFA 2L8JA 2YTXA 3J9CA 3GE3C 4ME3A 1PRTF 1CMXB 1PYBA 3BYTB 4A3IG 2A74C 1HR0Q 1NBFC 4BWGB 1C9FA 4QUCA 5IT9E 5D94A 4JL9A 2KEEA 2TSSA 2IL8A 2B76B 1IBMQ 4DUYL 2JA8H 2B63B 2BKRB 2Y5PA 3T3OA 2QCPX 4FDBA 1R4MB 2QDBA 3OG5A 2N49A 1WYDA 5FJ8G 2C5LC 4HEA1 3Q6BA 3E5SA 1GAQB 4XQNA 1MFWA 2BB6A 2WB1E 4LFAQ 1PHJA 1NBWA 2NBFA 2IX0A 4JI5Q 5EPJA 5LMNW 2AWNA 2UXBL 1GC7A 4PYZA 2R7ZH 1QWYA 1QNUA 1KH0A 3RZDH 2DY8A 3APFA 2RDBC 5JJIA 3E56A 2ZVNA 3GO5A 1AP0A 3NTHA 2I1KA 2ZJDA 1TWAH 2C9OA 2O2VB 5DAUA 1VF7A 2K28A 2N9PC 4DV1Q 1RJTA 3H0GG 4QB4A 1V5OA 2BWES 3A54A 4FXCA 4B3MQ 1SN8A 1PGBA 3VUXA 1KOTA 2AX5A 2F4IA 3UDIA 3N3KB 4IWOA 4JPBW 4NPNA 3U58A 1VDVA 3AB9A 1JB7A 1RM6C 1KRHA 5C23A 1MHWC 2JVCA 2KJ6A 3TBIB 3TN2A 1XTDA 2MBQA 2XK5A 4BKSD 4XZ4A 1LUZA 4POGA 2CH4A 1F2MA 4BKSA 4C00A 1Q5WB 5LMNQ 1CA5A 1VLBA 1EOVA 1K50A 3HVDA 4MH0E 1J0GA 3BZDB 3OW7A 3ZTCA 1C77A 3IL8A 1D4BA 3I3TB 5CV9A 5IYCG 1UBIA 3APDA 2QEJC 3KLWA 4CJ1B 4ARIA 1A15A 1PTOB 1GD7A 2DUDA 1UH6A 3AFQA 1OTCA 3D32A 4NJ6A 2K25A 1SE3A 1TS5A 2MHVA 1Q1OA 2WX1A 4GN3B 4J3OD 1KDAA 3ZJUA 3A1QB 3AFPA 2B2YA 1V97A 4MSQB 2HCCA 2NTSA 1WWTA 2D07B 2RDFA 4QAYA 5EAYA 2B2YC 1SYDA 3NWSA 1TIID 1TXYA 4FO2A 3KWLA 1EQTA 1S3OA 2VS1A 4K14A 2GBNA 3PZ7A 2LMCB 3QA8A 1WXAA 1DGSA 2WACA 4H02A 2FCQA 2E5LL 4BBSH 5KYLA 5JOBA 2KUMA 2INDC 2BYFA 1FRRA 4ABNA 1XCTL 5EQ0A 1E7PB 1EWCA 2KX0A 3H94A 1K0RA 4JI8Q 4A3IB 4JPSA 2KDBA 2C60A 3KLSX 1SEBD 2PZTA 2MBHA 2PPHA 4JYAQ 2V4IB 1F2RC 2IJ0A 4ZRIA 2BBCA 3KBGA 1NR2A 3U4VA 1EEID 2GI9A 2M56B 2Z1CA 5IO9A 1L0YB 3CRKC 1N34Q 1SBBB 3FPUB 1OEYJ 1RFKA 3IT6B 4AWJA 5CORA 1TU2B 5EDSA 4ZLTF 3I4NG 1VDZA 4NXNL 2LGXA 4ULLA 2YU9B 2KHJA 1WTRA 1S40A 5IAAC 2B2VA 2SNMA 5HGTA 3VR9B 4K7UA 2NN6G 3A56A 4QIWB 5JZEB 3O65B 1S72A 1CM9A 1SXTA 4OXPA 2MBOA 3A4SC 2AHOB 3EVQA 4GLSC 3RZDB 1EQQA 2VW9A 1TWGB 2F0GA 1TWHB 1B50A 3ZVVA 4ZKBB 3MC9A 1EY5A 4QY7A 1HTOA 1R9TH 3TMPB 2F0WA 1E8ZA 3H0GB 1WXSA 5AUIA 3U30A 1PH9A 3N6RA 1EU3A 3K9OB 2VH2A 1H4RA 5J1ZA 1SSNA 4ILWA 1P7FA 1AEXA 1HE8A 3ERSX 2EKEC 2N88A 2FMMA 1EUVB 1JW9D 2O6VA 3CD6A 4US8A 4DV2L 1EIFA 4RG1A 4AYBE 1QILA 3BVMA 5BMGA 5TR5A 2G9HD 4DXGA 2Z8LA 1V9PA 3E6ZX 4X3KA 2AQ3B 2KVRA 4WAAA 3QG1A 1LQBA 1QVFA 1J7CA 4EUTA 4DGZA 2A6EC 2NVUI 3AEEB 4OELB 1SYCA 3X23A 1FO4A 4RM9A 3NY5A 3SDZA 1AFPA 3Q0AA 3N1XC 1HQMC 1PZJD 5M5YB 2EYMA 1VQNA 3M4OH 4IUUA 3DLLA 2A6HC 1AE2A 2EYLA 3K58A 1L5PA 3UDFA 2K1FA 1LTSD 3HK0A 2K5QA 1CKOA 2KQ3A 4C7YA 1EO6A 3H6NA 2X6GA 2CQAA 1E0ZA 1Z47A 4HROA 1C0AA 3NZUA 3CAMA 3RD4A 5C0XJ 1YJ9A 3PPAA 3DBLI 1JQYD 1TWCH 3D4WA 3R93A 2E8GA 5C3EG 2V4LA 3PF4A 2Z6KC 5CYUA 1EY9A 2IHFA 3W1BA 4LK0M 2JA5G 3UF8A 4L63B 1U4MA 4TSSA 3RLOA 1ET9A 2J52A 1ICFB 3VR2A 1HR0W 1GG3A 3SDLC 1U0LA 1SFOH 3PRMB 3TZDA 1J5EL 2DYBA 2CU1A 3P4PB 3FDTA 4MGIE 4CDEC 3EQLC 2OQKA 4DR7L 3NWTA 1YIJA 5MPOA 2CHZA 1SJHD 5IGFA 3HOWB 1DOKA 1EY6A 3NQIA 3MXUA 1C9OA 2KFKA 3NUCA 2AQ2B 1BCPB 5LXIB 5EE3A 1JOKA 4DR1Q 2O5JC 1ACCA 2EDGA 5E6NA 2HQLA 4DK5A 2PLPA 3NK9A 5KHQA 1LT3D 3GTJH 4OVZA 4WQOB 4Q2JA 1R7SA 1WX9A 2K8HA 3F2CA 1LTAD 5C0XH 3GV6A 4MGYE 4RKLA 1N36L 2MJDA 3P42A 1OEYA 2FUHB 1TS3A 2DY7A 2WFWA 4Q0FA 4DR4Q 2I5MX 2J0TD 4DK0A 5L37A 2IY5B 1WTPA 1H95A 2KJRA 1G2SA 3BDCA 2GBMA 4KKTA 4FXGC 4JI4L 1F9QA 5JPNC 1YVCA 3CC4A 3A74A 4NY0A 2RF4A 2JA9A 1RIPA 2MSED 3PZDA 2R92H 3V6CB 1KRSA 5E6PA 1PH2A 1STYA 3MHZA 3I4LA 2UUCL 1SE4A 5IWAQ 3DVNV 4BOSC 1X55A 1Z9FA 1NE3A 4A4IA 2Q8TA 2CJNA 4LF9Q 2OQ0A 4JI7L 1I6HB 3P4SB 2LVOA 3MP9A 4ZCKA 2NVQH 2VQFQ 3VR4A 3F2BA 5ELCA 1EL0A 3JVZX 3BG3A 2WDQB 3NTKA 1QZEA 4A93G 4KKSA 2F0VA 4YWGG 1V81A 3U2SC 1KLGD 1YNND 1AYFA 4NXNQ 3HOXB 4LF8L 2PE6B 3MXPA 4K5VA 1JJCB 3CWIA 4GOPA 1FJGQ 1BCPF 1ZPSA 4LFBL 1XLOA 4AYBB 2CWPA 2UXBQ 2AQ1B 4W9CA 2UXCQ 1K8OA 4APVA 2XBBC 4B0MA 1STNA 2AYOB 2ZCBA 5D2MB 2K33A 4DHJD 5I4DA 5KIXA 2FAZA 1T0QC 2KYWA 2PVOD 4E74A 5EKIA 3G7LA 1VQGA 1MG4A 4A3GG 4HCPB 3ZNGC 1FVIA 4HIDA 2NS5A 4RGMA 1WOCA 2VQFL 1PH7A 1JALA 3IAS1 4KZ0A 2V4DA 1PFSA 3KYDD 4NKLA 3DVNU 4N9F4 2JSOA 2Z0SA 4MGKE 5BMIA 3PIO3 2WHIA 2J4XA 2B63G 4NXML 1VQ4A 1WTOA 2PTLA 1WRIA 5HHDG 4KLKA 2L15A 1Z7TA 3I73A 4CKEA 2WNMA 1UD7A 2KBNA 3S17B 3RULA 2OXPA 1JQ4A 3RYTA 3AE7B 2JA8G 1PVOA 2IY0B 3KVFB 3WANA 3UE1A 1CA6A 4KGRA 1PXUA 3OIPA 3ZKJC 4WJWA 4ZRKA 1JB3A 3S1QH 4WFN3 2MJ8A 2UXCL 4R4QA 1VR9A 1Y1VG 2MHJA 3CC7A 2NVYH 1RTNA 3PGEA 1GJXA 1R4NB 3A5ZB 1P1AA 4AUQC 1VQKA 4K6LA 1TVXA 1M90C 3NS1A 2KHSA 1Z5SB 5CBAE 2KNBA 4IW0A 2O4XA 3G48A 3QJYA 5IGEA 2KWCA 1TJEA 1CSPA 1UAPA 3VUYA 2CH4W 1PH1A 4ZAIA 3BS1A 1DOLA 2UU9L 4PS8A 3WAOA 1ROEA 2K05A 1QVCA 2KCMA 3TP8A 1EIHA 2KACA 1HRJA 1B70B 3L9AX 4DR3Q 3ZTDA 2KC2A 3QK0A 3TEYA 3AV8A 5CV7A 5K5PA 2D0OA 2VZKD 1NUCA 3NBHB 3DEOA 4B9XA 1CZPA 4DAVA 2CWAA 4G57A 1Y1VH 1VJKA 2KX3A 1YX6B 2N7JA 1MHXA 1NR4A 3OMCA 1WGDA 2RSUA 1UUPA 2K6DB 4C4VA 4ICUA 3N9YC 1E8YA 4LJZC 3OPOA 1YITA 1YJ1A 3B0AA 3U8ZA 4YXDB 2WDRB 1ZKHA 4ANUA 5ELDA 3AEDB 1XLQA 2W55A 1G51A 3K5OA 4FVMA 2LUMA 3Q69A 1F9RA 2PEAA 3M9BA 2JA6H 2LXCA 3AULA 4RGOS 5M5WH 1KLVA 1JWAD 3U9OA 1CTMA 4WWMA 3K5LA 2G5DA 4C3HB 3PO3G 3N52A 2EMSA 1XXGA 4N9PA 2C7NB 2VRRB 3DBHI 5HKHA 1WI0A 1X65A 4PQXA 2GA4B 4GGQA 4W9GA 2HT1A 2KWUB 4X57B 2EYOA 1P7EA 4DUZL 4HWIB 3DBSA 3QCAA 1JJ2A 1I5FA 1O78A 3UI3A 2WKDA 2R92G 4U68A 1YNNC 5IYBG 4DR6Q 1PZID 3D4RA 4X62Q 2LGIA 1RL2A 2HQEA 2JQOA 4PG3A 3F2DA 3IHPC 3K6OA 1RHPA 3A9JA 3SGIA 5C0XI 3I7FA 3PUYA 1X9NA 3OIQA 1C4CA 2B3GA 2JWUA 2A68C 4DR4L 4IOIE 4E6IA 1E3PA 3P2BA 3MXNA 1MJEA 4A3DG 2LGDA 4HLEA 1WMHB 3UQBA 2Q5WD 3HS0C 1OXTA 4BKGA 4C3IB 3RUZA 3CU7A 1CZWA 1FYCA 4KN7C 4DNTB 4LK1C 1I7HA 1KM7A 2EYHA 4S3SA 1QQRA 5LMUQ 3BYYB 2NPTA 2X38A 3MTSA 3DM3A 1G8ZD 4I6LB 1N60A 1HTQA 1XJVA 1EYDA 1STEA 3MZ5A 1WGRA 1KJTA 1HH2P 3DPDA 4BFRA 5J2RA 3HOWG 2INCC 2LJ5A 3DHGC 4IPHA 2KCTA 4X62L 2JRHA 4LF7L 4XTCS 1PFMA 3R8BA 2WB1G 3JC66 2MBBB 3V6EB 3T8MA 1FMAD 3S17H 4XC2A 3IKJA 4LJOB 1J6QA 4BBSG 1RF2D 2V3NA 5J17A 3TEZA 1QOHA 4RMFA 1WE7A 2XRSD 1F2YA 4X66L 1PTOD 4HMIA 1QUQB 1QZHA 2DYOA 4AJWA 4LNOA 2K75A 4Z9CB 2KHWB 3SD5A 1RFAA 2EY5A 1BUIC 2PIAA 1HNZQ 3M3YB 4A93B 2BE5C 3R3OA 5CC4A 5C3WA 4GKJQ 3VAWA 2M00A 3M4OB 1YI2A 4UP7A 1Q46A 1V5TA 3AE1B 4MDKE 4B3SQ 1Y1WB 2XK5B 4KSLC 1FGBD 3NENA 2N1VA 2BVCA 4RM8A 3NP8A 3BINA 3QHTA 1JWBD 2D5GA 5AEKB 3PZ8A 2NZ1D 2PQAB 3ALBA 3ECIA 2HTME 4GKJL 4P7IA 2K3UA 4YCWA 1VQ8A 1BQQT 2H89B 1PYWD 1JC7A 3A8JE 1N9WA 1C7YA 1TR5A 1WM2A 1GJZA 2WS3B 3PO0A 4HR7B 4ZHOA 4K3BA 4FF3A 2D2CC 2MW5A 4R4IA 5C5MA 4CDCC 1WD0A 3AECB 2M9VA 4BY7B 3PRZA 3RNBC 3TEXA 2ACZB 4FULA 3HKZE 1PTOF 5M3FH 1VZ8A 2J0MA 3CPFA 3WALA 4A20A 5KRUA 3K9PB 5I9PA 2RHSB 5M3MG 4A3CG 1MBYA 3STBD 2A4ZA 1KNAA 3J7AF 2BTEA 2EXDA 4HIKA 3J80i 1C76A 4CDDC 1QUQA 1YQ4B 2Y0SB 1SIFA 4LF5L 4L5RC 2KT7A 3M7GA 4LNIA 1EEFD 1TIFA 2G4DB 2IO1B 3OAWA 3SK6A 1TS2A 4GNXA 1ONLA 5CMDA 4BA2I 3GTLB 3CQZH 1HFNA 2KDMA 3GE8C 3P1MA 4NP5A 2ENBA 2CW0D 2Q8IB 5IYDG 3HOUG 1P16A 4A3EG 1A6XA 4FJYA 3TS0A 3AEVA 4JE3B 1N32L 2UWQA 1MKHA 4C3JB 4R9WA 2JEBI 3DVGX 1T5XD 1STHA 4KHPQ 4JI6L 1ASZA 1CI3M 4K0KQ 2PO4A 1CSQA 1ML0D 3UIOB 3T13A 1NYRA 4WURA 3ZDTA 4BVUC 4W9EA 3Q8DA 5JH5C 3MEHA 3A55A 2OEDA 2JWZA 2LWPA 4P16A 4FF2A 1WXMA 4ANXA 4DHZE 4QUFA 4KKJA 2A1AA 4DUZQ 2AUKA 1Q0WB 3Q3FA 1BR9A 1E7ZA 3K8AA 4BBSB 3IG3A 1XPUA 4LUVA 3RMKC 2GN5A 4GB9A 1IP9A 3WCQA 2C7HA 1I4QA 3FPPA 2F4VQ 1K53A 3M95A 5FJ8H 3T3NA 1UF0A 3SE0A 1Q82C 1J5EQ 1GNUA 1WJ6A 5IN7A 2OJRA 2SDFA 1VRAB 1DJRD 2WYQA 3MXGA 4BY1G 4V0BA 1TZOA 1NMFA 2BE5D 2YTVA 4DBGA 1WRDB 2TMPA 4B9WA 1NEKB 5CV6A 2WXGA 3H9DA 4OIJA 2DZJA 2BW2A 2CS4A 5CV8A 4JI7Q 4KV6A 4HKQA 3DM1A 3FAHA 2WV6D 2EJGC 1TWCB 3R2TA 4DFAA 3SVMA 4GN4B 1IKMA 2N0SB 1UEAB 1NI2A 1NMGA 2B2WC 3RR5A 1BNZA 3NZSA 1ZE3D 2K1BA 4K5WA 2VNUD 1FXAA 3QB3A 1A63A 1HZ5A 5A2QE 2BS2B 3FC4A 4ASWC 4EOYA 1A3UA 2C5CA 3D31A 4LFCQ 3ZW3A 2WXOA 1RD9D 3J81i 1KNEA 1K0SA 4EQNA 1C1YB 3RLFA 1MGSA 4HIMA 5M5YH 2JP1A 5IODA 3CCLA 1MJDA 3ZO5B 2GB1A 1CKMA 4HDQA 4PZ8A 5FOBB 3V61A 1D1IA 3GP7A 4DV3L 2A69D 3HG9A 4JV5L 3JSVB 2K6AA 1A3VA 4UHVA 1ZXHA 2EPBA 3KFUA 5ELFA 4QQBX 1WTXA 4DK6C 3AE3B 4KDLB 4DV7Q 5T1IA 4CJ0B 4YL8A 5GAEC 3I56A 4US9A 3UINB 4AOFA 2J0JA 3FP9A 1ZDXA 4BBRH 3I5JC 4ZYSA 4AP4C 3GTQB 2OF1A 3TEWA 3GTQH 3DMUA 3A0JA 1AN8A 4C3IH 4BBRB 3KLRA 2K9XA 4DAMA 1H9SA 2SOBA 4H7BA 4YIJA 3Q22A 1WR6E 2KZRA 5E3FA 4S17A 1HJPA 3APCA 3RCZA 1VMCA 3UQAA 4KI0A 4W9HA 2Y3AA 3A4RA 1FM0D 4X65Q 3NRZA 3OTOQ 1YJWA 2GMIC 5FLMH 4R1JA 2E74C 2N3SA 2F3IA 3T56B 2LXAA 4CJ2C 2ZJPA 2F0LA 4F8MA 1SIJA 1WJ4A 3J81c 3L3OC 4OGQC 2SNSA 3H15A 2Q2TA 4I6NB 4PS3A 3HRDD 3RNCC 5C3JB 5IP9G 1N36Q 4EEWA 4DAPA 2Y0SG 1K9MC 2QF7A 1JMLA 4WWPA 4KTAA 1QJOA 2MLBA 3S16H 4IM2A 5I9OA 1XMQQ 2EOTA 2OTLA 2W9NA 3AE5B 1GUAB 4DHZB 3Q24A 3E9SA 2OTJA 5C6AA 4TKNA 1IXRA 2N8NA 4HPMB 4BS9A 1AE3A 2BDOA 4DK1A 4A3EH 3PO2G 1PDQA 4JV5Q 2L7RA 2A5UA 2K22A 4F1SA 1XNQL 4LNFA 3CCQA 3H6MA 4P73A 5DPSA 2A5HA 2K5WA 2KDIA 2LFNA 4NJ7A 5HY6A 4B95A 1VF5C 2JJQA 4HEDA 1OTRB 3ZUNA 4DR5Q 3CPWA 1QKZA 1SYEA 3V96A 2LJIA 3SR6A 3AMUA 4X3TA 1WYWB 3K81C 4OWTB 3RZOH 4FF1A 1UNSA 1E2VA 1LTRD 3FRPB 5A35A 1VQ5A 2M0AA 4L23A 2IHEA 3KYCD 1XTCD 4L5SA 4IC7B 4W9LA 1QOAA 1SAPA 1HTLD 2EY6A 5LL6S 4EQ5A 4EZLA 3HUIA 2GBKA 2H88B 5IGDA 2PNRC 4IN3A 1ESRA 4F88A 3JW0X 4ZYNA 1YD8U 3GB1A 4DV1L 4F7ZA 3U7ZA 1SE9A 1FXTB 3K59A 3W2DA 2KTRB 1H8CA 3LX0A 4HJ7A 1ZP0B 2K14A 4K3CA 1NNXA 3P75A 4GLVB 2FCMA 2LS01 1SSOA 3D6WA 3GV3A 3DEPA 2ZW0A 4IG7B 1K28A 3NELA 1IBXA 3A9JB 5GADC 3M62B 2DNCA 1N33Q 2YTYA 3S2DH 3CMMB 2M8SA 1R4NI 5AFWA 4DV0Q 1EF1A 1HA5A 4JYAL 2QDFA 1D7QA 4JGHB 4ZOHC 4DKAC 2REXA 4K81A 2LRUA 2F0IA 4MNOA 1HUNA 1PRTC 1T3QA 1QOGA 1UGJA 3TS2A 3VTVA 1YHAA 4AQ7A 2KVZA 2VZAA 2JXMB 2DJGC 1WY8A 2KXJA 3KF8A 3IT4B 5FR3A 3ICEA 2BYTA 3J81j 3QIAA 2PPBC 2N9EB 3A7LA 4DV0L 1TGZB 3EFUA 3M3JA 3HKZB 1QZGA 4DV6L 2D0PA 1XT9B 1BCPC 4HJ9A 2VZKB 2FUG1 2L4NA 2ALYB 3EBEA 2HUGA 2MH7A 3F2UA 4LFBQ 1PA6A 1RTOA 4NAWB 2VQEL 2O6VD 2FXQA 1UEBA 2N78A 3KF6B 4X66Q 3J80L 1V80A 4II2B 3GTKH 4G11A 1GOZA 4JI0L 1E7VA 3NVYA 2HIXA 2PVGC 1EY4A 3Q2AC 4AIMA 2VY3A 4JX1C 2HD3A 3CCRA 5E1FA 3J80c 1XPOA 5KHOA 1C79A 2MNAA 4ALPA 4KHZA 1S5ED 5ELOA 1E24A 1T9HA 3RMHA 1BMLC 1M94A 2L3ZA 1SNPA 4EQPA 1N34L 2VB2X 4C3HG 3U4EG 4IQZA 4DNRB 5C44G 3Q23A 2CU3A 1BOSA 2MEKA 2NCNA 4KX6B 2CFMA 5DLQE 3A9KA 4KDIC 3AH7A 3ZGZA 3SFEB 3IFTA 3OJ3A 4JLCA 3K0YA 3DBLB 2IPKD 3RN5A 2CKHB 1PFNA 2WAQE 3J7AV 1VZ6A 1VQ9A 4KVGB 3HGBA 1FRDA 1GUTA 1SGHA 1BVSA 1Q8KA 1L4ZB 3Q8CA 2FCSA 1XWEA 4A3JH 1E2ZA 4R4TA 4A90A 2QEXA 2BKFA 1GVPA 5LHY1 4A3JG 5DM73 1FFVA 4JI5L 5C4ZA 1H9RA 1ASYA 5IOIA 4M0WB 1BCPD 2L0TA 4E3CA 3MHSD 3PIPA 2N55A 4WQMA 1EF5A 3QO2A 5L83A 3VR5A 1L0WA 3MFGA 2XNAC 4GNXB 3UI2A 1I4HA 2KN4A 2IO3B 2MO1A 3Q3NC 4DR1L 4FNFA 5JHAA 4HMJA 3TCAA 2E3TA 2ZTCA 3FILA 3OJ4B 3KUDB 4OZCA 1AARA 2XSCA 2B29A 4HCEA 4JCVE 1I42A 4GZYC 1ENFA 2NVTH 1FXIA 4FBJB 3I4MG 2GBRA 3K7AB 1GC6A 3HOWH 3J81L 2ZM6L 1SNDA 1STGA 3DWAA 3PF5A 4C80A 4FXKC 3SK8A 1LACA 2VH1A 1JWUD 1VQAA 5JVH3 1XO3A 1VQIA 3TREA 3D3RA 5CHWA 2R93H 2JA7H 2GRIA 2F0NA 5HGQA 4PMCA 4QF4A 5IGGA 2ZNVC 4JI8L 3JYUA 2KMMA 5G55A 2BCOA 4JG2A 4BXXG 3Q3JA 2AUJD 1PH5A 1E0BA 2W3SA 3ZQ4A 3LWUA 1PH4A 4JK1C 4PYUA 4AS1A 2ZVOA 1GUNA 3AEGB 1LO5D 3SU8X 3S1MB 1EIGA 1KTKA 1E22A 4A3EB 3T1HL 4WJ3M 2Y0SE 1STBA 1XF5L 1CKNA 4JW0A 4L5TA 5I6YA 1BBXC 3C2PA 1WGHA 1NJIC 2YEPF 2I46A 4IWQA 4DAYA 1V49A 4HJ5A 1AZPA 4IM3A 4DWFA 3AE4B 3RPFC 3CSTA 3HOYH 4IFDH 3ULPA 1YHQA 2KECA 1K8AC 2LGYA 2KJXA 1N62A 2JA7G 1TQOA 2LMCA 1D3ZA 4P75A 4YTNB 2KQ7A 4NAMA 1SF0A 5BN5A 1WGGA 3EGRA 4L2YA 3HOZG 2DENB 2L52A 2QIEB 4AQYL 1D5ZC 2OEOA 1L0XB 2BWFA 4JWUC 4QL5A 4WAFA 1H9JA 2CKZB 3AN1A 4WIPA 5G5HA 4Y52H 5JPMC 2C35B 2WXKA 4MELA 3D8GA 2A19A 2RDHA 3C1EA 2YV5A 3PIOA 1E2WA 1Q90A 1VS0A 2L83A 5C1ZA 4GDLB 3GQBA 5BYRA 2HIVA 3ZDMC 2V0GA 2WAQB 2ZPYA 4IUNA 3M4YA 3MXNB 4U673 2B2UA 1Q81C 2EIFA 1Q12A 3E3XA 4KKUA 2N9XA 1FJGL 1RAXA 1OQRA 2KMCA 5E6JA 4OHJA 2IX3A 1ZDVA 3MA2B 1P9DU 3AE9B 4KN4C 1Q10A 4IFDJ 1Y8PB 1FEHA 2IGGA 3CSFA 4M00A 3QOLA 3J81E 3V60A 3GTMH 4BBRG 4J6HA 1C3TA 2CR5A 2JT4B 2DGYA 1X3QA 1HCZA 1A2UA 4IWPA 1X6OA 3UGBB 2YU9H 3NS8A 2YLMA 1BT0A 3N30A 4A76A 5C3EB 4HKZE 4MACA 3PCOB 4KHPL 4YTMB 3O13A 1IBLQ 4K0KL 1VQLA 2H4OA 2Z4HA 2NB0A 1EYAA 2FBWB 4W9FA 1F52A 1JMCA 2MX2A 5JJZA 4KIKB 5KNBA 5KNDA 2KANA 3I57A 4N58A 3W3AA 1TT2A 4BAXA 1V2YA 4WRDA 5GROA 4NXMQ 4JIOU 3DVGY 1M4VA 1OXXK 2D62A 5C4JB 4LF4L 4A3OA 1V8QA 1HZ9A 1LM8B 1YN3A 3ZRCA 3BU2A 1DM0B 1EQVA 2F0UA 1L7YA 2K4KA 4DV6Q 3TMEA 4IJLA 1DOYA 2BOSA 4DN4M 4WJ4A 1VQPA 1WZ0A 1V1QA 4YWKA 5IT9L 4DV4L 3S14B 1DOIA 2JU6X 2ZJRA 3MC8A 4M01A 3RUIB 2I5HA 3I9V1 1C4AA 4A3KH 3MVVA 2IW3A 1R4QB 3H91A 1MSHA 2FE8A 4BOZB 1PTOH 5IP7H 2G45B 4G0NB 3DBHB 1A3TA 2ZTEA 4JBMA 4A3BH 3ML8A 1Q1BA 1D5MC 1IL8A 2KA7A 4UAIA 3BIID 1FL0A 2W3RA 4LJPB 4WJOA 1EU4A 3PS6A 1I4XA 2R7FA 3RN2A 3A9KB 5C44B 3CCMA 5EGTA 4TV3A 4IPGA 3GZNI 1QB5D 5DNFA 3VR3A 1B9RA 1FNVA 3ENEA 3NHEB 4MSMB 1SNOA 1U9RA 1ET6A 4EVOA 2QA4A 3J80E 3DBRB 1A2TA 4B3RL 1CFMA 2A6HD 3G6EA 1Y14B 1WE6A 1RYJA 4HN7A 4P2CB 1XNRL 2O6VB 1GUSA 5C4XH 2MQJA 3KOJA 4P6VF 4ANWA 3HOVB 3OSOA 2F0SA 1PH6A 3C19A 1F1HA 1M1KC 4G3XB 4HJGE 4LF5Q 4ODGA 3VTWA 1TY0A 5EKLA 4X64Q 2AWOA 1K8GA 1BDOA 2R7ZB 5JAVA 1JRUA 2XTIA 2WXNA 4IJHA 1F9JA 2BS4B 3MTNB 5M3FB 4CHTB 3V05A 3PIP3 4LUZA 1F2LA 2KFJA 3H7SA 1II3A 3HOZH 2KEDA 1HQRD 4BY7H 4C3JG 1FIQA 1F0ZA 3T1HQ 1YJIA 3I70A 3SFDB 3M7NA 4B9KA 2JUOA 4GDLA 4K1RB 1AWDA 3WA0A 1PGAA 3CF5A 3S2HB 4XT1B 4RMAA 3FKIB 3GD7A 4N6EB 5H8YE 1JROA 1O7YA 2IO0B 2R7DA 1PZKD 1HNWL 1FCLA 1IZ6A 4TUUA 4ACFA 2OWOA 1YX5B 1T6BX 4J6IA 1EYGA 1XNQQ 2F0FA 1Y1WH 3VDZA 2I38A 2LY7A 5T1GA 4JC0A 3AEAB 4IO9A 3W1GA 2XN9C 4LW1A 2KLGA 1KXLA 3KBXA 2F0OA 4J15A 3KJOA 5E4WC 4NZLB 3CKIB 4YSYB 4HPPA 3QX1A 4GLXA 2NVXH 2RMMA 2PQEA 1YOVB 1I4RA 3A5UA 4OW0A 3K7UC 1CK1A 4G7HC 3EHVA 1CKNB 1OXUA 3B2GA 1LFDA 4XIGS 2MBEA 4ZK9B 4DXFA 3Q8EA 1PLFA 5D14A 4FP5D 4EKUA 5T8IA 2B2VC 3P63A 4MM3B 4X65L 2NBVB 4K6DA 2V3SA 3EUB2 2F0MA 3DHHC 2EXZA 1D2BA 4YY3Q 1I94L 4DV5Q 3B6YA 4LNKA 4WJNA 4ARCA 2E2IB 4M02A 4J8QA 4DDGD 4R8NA 1WYGA 3RI7C 3PUXA 4KGSA 1NY4A 1UE5A 1YHBA 4DV3Q 1TWHH 1YZ6A 1LXDA 2LGSA 2JA5H 2ASBA 4DF7A 1IBKL 2PJHA 1TWFB 4GXBA 2BGFA 2H5XA 1ZXIA 3Q3OC 2MA9B 2NR2A 2PCFB 2DNFA 3OW2A 1ZEQX 4EGVA 5K36G 1J7AA 1LGRA 3PUWA 1IW7D 2O2VA 1QG7A 2PMZB 1MI0A 3S2AA 5HI1A 2K5VA 4RWSC 3HM6X 4JOIA 1ZOYB 2KOXA 1ILQA 2PQAA 3DHQA 1GKHA 3CCSA 1I4GA 2Z9HA 1L2FA 2AMCB 3U4ZA 5C44H 1GHJA 1GUOA 4DR2L 1SE2A 2IT1A 3AXCA 2DYMA 2B39A 2ZM6Q 3GTLH 1SLJA 1B3AA 4KJOA 2UUCQ 1HNWQ 1VZ7A 1EFWA 1PUTA 1LYLA 2PYKA 4ZUIA 4MJSB 3KUZA 1UE1A 3TUOA 2K6QA 1VD2A 4A3IH 3PQIA 4C56C 2LEKA 4R8IA 4FLHA 4NMZA 2F3VA 2LVPA 1HEZE 3TP7A 3Q8FA 4FA6A 5M5XH 1NCVA 2IBIB 4LLGM 3R3MA 1F9PA 2QCZA 2Q2UA 2NBWB 3KUCB 4DQOC 3ZJYC 4W9JA 4A6QA 1Y69U 3PLVA 1ISNA 1NVID 3SHLA 1Y1VB 5BR8L 2MCNB 2G9DA 5IYCH 1B53A 1WF9A 1AW7A 1WFQA 4E71A 4TQ0A 3SEBA 2B8GA 4ZRJA 2MP2B 2J0KA 2F52A 2KHIA 2LZ6A 3U7DA 2EELA 1EOTA 3R66C 4NQKE 4WWOA 1AZQA 4ZRZA 4EFOA 3JSVA 3ULJA 4Y7NH 2HDEA 5LL6X 2M19A 1X56A 3VRBB 5BYSA 4IPCA 4LF4Q 2JYTA 5BYQA 2NN6I 2RR9A 2UU9Q 3AEBB 3S24A 1SROA 4J1MA 3VR8B 1LTLA 1KIXA 1I35A 2JF5A 3T1YL 2X8XX 1WJNA 3CMEA 1XNRQ 5GQOA 4F7XA 3PT2B 1PRTD 2BPSA 3NHHA 5COYA 2L76A 1CZGA 3CCUA 4MIUA 1S5FD 5C3EH 2DJFC 2QW7A 4A93H 3PRPB 2HTHA 3A8KE 4DK3C 4FN2A 1RRBA 5BO4B 3X0WA 4DR2Q 3K0XA 3NE5B 5GAHC 1Y8NB 5EKKA 5J22A 1TTNA 3BZKA 2N7EA 3GTMB 1X54A 4X3UA 2DZKA 3Q8BA 1HNZL 3SK5A 2K0PA 2WDVB 2DHZA 2WAQG 4M8AA 3N20C 5EPLA 1QCBD 2E2HB 2WXMA 4GKKQ 3CC2A 3BDLA 3HZXA 4JI0Q 3FKIH 5IT9c 4G4KA 4RCNA 1HZ6A 5J3BA 3PGZA 3CXCA 1V9JA 1JJGA 1TKGA 4A8XC 4JI3L 3KH0A 3ULLA 4OEMB 1Q1EA 1VQHA 3DUZA 4PMBA 5IIFA 1E10A 2N9LA 4B3RQ 1V8CA 2F0KA 3HOZB 5CHVC 2B63H 2JA8B 1WTHA 3EN2A 4G7OC 1WH3A 1WX8A 2D11A 5EBCA 2GLSA 1OQYA 1QLBB 3ONAB 4G50A 1L2NA 3I91A 2WXRA 3LB8C 1SNQA 1SNMA 4LWCA 2IGHA 2BA1A 1IYJB 1K73C 2INPE 3NXWA 2ES2A 2WP8J 4FXDA 4PNYA 1ZUD2 1ICWA 4HDOA 4A3GB 2PMVA 2LUEA 5CTRC 1NAPA 2F0DA 3V62A 1PRTB 4QIWE 1CHQD 5CV5A 4A3CH 5M9OA 4LF6L 1E8WA 3VR6A 2RPQA 3PUZA 2WXIA 5IP9H 3ZXVA 3LDZE 5A2QL 4M1UB 3E9HA 1CT1D 2EJFC 2L0CA 5CGKA 4XDDA 2A73B 2BH2A 3M85A 1DD2A 2M4NA 3N1YC 1MG8A 2E76C 1KHIA 1K8RB 4H2AA 4TQ1A 1HZCA 2OHFA 1VQCA 2JE6I 1CHPD 3S1MH 3TIXA 3T51B 3PMFA 2ZPNA 4A3FB 2JRIB 3H7PB 1ZGUB 3IXSA 5IWAL 4OL7A 4F87A 1DCZA 3VA7A 3MJWA 4RCOA 4N59A 1STAA 3CRLC 2D2QA 2K7VA 4ANVA 1N8RC 4AJYB 5FO9B 2WXPA 3AYHB 3MFYA 2KCNA 5EJWA 4IUMB 1LT6D 1X32A 2K01A 4GSWA 3MJ5A 4YHHQ 2NZOA 2F0PA 2FIDA 2WXFA 4K7WA 1FR3A 1SYGA 3ER0A 4I6PA 2FFKB 2INNE 5FR6A 3DCGA 4W9KA 5EE9A 4AH6A 1EWHA 4KKIA 1D1KA 5D3IB 2F0JA 2FMCA 1UGMA 2LKVA 4AQYQ 4I7ZC 5IGCA 2MO0A 4GIVA 3HP3A 3NQTA 3EROA 2K8BA 4YTPB 3BZCA 1XCQL 5F2DA 3FILB 5KGUA 4JBKA 3L2PA 3KUPA 2SAKA 4DR7Q 2NVYB 3BWUD 2A68D 1KC8C 1YMHE 1B9NA 2KENA 2I2YA 3RFZB 2MP1A 5G3LD 4EZJA 4OX9Q 1JORA 5FO8B 4UP9A 4XT3B 4A3MB 4UPAA 3KWVA 3H7PA 2EYJA 1F2RI 3RN9C 3S1RH 4LF9L 1TKEA 4UP8A 3UE0A 1GHKA 2WXJA 5GAGC 3W5VB 2KK8A 1MSGA 5J39A 1P98A 3NPPA 1YNTE 4PT5A 3PV1A 2CVRA 5JVG3 1QE6A 2D9UA 3B9JA 1YNJC 4C1NK 4OX9L 4IUQA 2BS3B 2IWHA 1JICA 3OMGA 2L5TA 2WWZA 1F77A 1Q86C 2KDFB 2L1BA 5TSSA 3V2TA 3N32A 2L11A 2ZJQA 1PQSA 4YCVA 4BBNC 2B2TA 3U52E 2LD9A 4R3DA 4C7ZA 3VTUA 2PKOA 1VQEA 4FF4A 3S1NH 1IGCA 3JAML 4YHHL 2VUMB 4TVAB 2ZNVB 4CKCA 2JXTA 3HOXH 3WOFA 2E6XA 2Z6KA 3CHBD 3RZFA 2NPTB 4HIOA 1GO3E 1WFYA 1ENCA 4A3DH 4C3IG 4X64L 1NTGA 3ZNID 4MTNA 3DQVA 2QSDA 2ICEC 2NVQB 2KWVB 1I6HH 5CHFA 4LCDE 1N6ZA 1OFFA 1Q3LA 2WINB 4B0EA 2WX0A 3HOYB 1JE5A 2ZXOA 4DV7L 1WIAA 1V1OA 2L0FA 2JZZA 2KC1A 5BN4A 4OO1I 2Z0EB 3ZYYX 2LHEA 3K5MA 1FPYA 3MWYW 4L5QA 1GM5A 2JZPA 1L1OC 2L32A 1P0RA 4JI3Q 1C78A 3NOBA 2K32A 3KJPA 1JR0D 1RKNA 2NBUA 2Q2IA 4A3MH 1GUWA 2V3PA 5DPTA 1SRUA 3D6CA 4XX5A 1OXSC 4B6WA 3ND9A 4YSXB 2PI2A 3M63B 3BDOA 1TBEA 5M3FG 1K83B 2O5IC 3BK2A 1C8CA 3VHTC 3RNUA 1Y1WG 1ESFA 5ELBA 4H13C 4GOPC 1MVKA 2QGQA 1TYGB 2VXWA 2R93B 4GN1A 3RNFC 4XYCA 4LNNA 3C3LA 3W1SA 3BVZA 2ZT9C 3AQQA 5ELNA 2D5DA 2PNHA 5FLXc 3GTGB 1VQMA 2MP2A 4OVUA 3MC0B 5L95C 1MD2D 4B3SL 1YJNA 2D3BA 2CW0C 3ZLZA 3HKSA 1VMPA 3K7AH 4HSVA 2D10A 5DEHA 1A8VA 1K3RA 1IYVA 1SE8A 3AB5A 2G4SA 4KSKC 2DX5B 2FIFA 3I90A 2L00B 4UDUC 4GNXC 2BH8A 1XYIA 4XDXA 2HJ1A 3NBHA 2B2UC 2WLBA 2RSOA 2F3WA 4MHEA 3RZOB 3AU7A 5M3MB 4GN5A 1UELA 1MJCA
chains in the Genus database with same CATH topology
1V43A 4IURA 3P1HA 3QWNA 3BVGA 1SFOB 4OZBA 3C46A 4Q5VA 1OO9B 1B9MA 5KNCA 4RNAA 2JQRB 1L0VB 1EY7A 3NVVA 1XX8A 1LV9A 2IX1A 2LHDA 4D2KA 1S4ZA 2E2DC 4EQOA 2HDMA 2KVMA 3ZJTA 1I3QB 1QF6A 4QMGA 3D4DA 2CJOA 4IFDG 1U4LA 1VCIA 4BA1I 2KCCA 2BB5A 3TSSA 1RWSA 2NWGA 1SYFA 5ELEA 4G7ZC 1DOMA 4XYOA 1ZXTA 2ON8A 1PFBA 2MGSA 3ABVB 4MT5A 3GTKB 2EY1A 3S15B 1A70A 4RGNA 1PDXA 1YN4A 4IUTA 2IDYA 1D5XC 1EFID 3IAM1 4LMQD 3X3MA 1R9TB 3G6JB 2NMQA 4ZHPA 4NW2A 4WORA 2EZVA 3WDNA 5IGBA 3PO2B 1ZYRC 2WQYB 5KYIA 2O2LD 2ONQA 2HDLA 1FNUA 3EJIA 2PW5A 1XLPA 2LFIA 1U4RA 1PTOC 2EJMA 1K52A 4MN3A 4NDXA 3VYUA 3KK7A 3DWQA 2PW9A 2X6LA 1F2ZA 4RHSA 1DONA 1Z6HA 2WIIB 3IAYA 3TP6A 1TS4A 2XVSA 2K5DA 3AM9A 4JWSC 4KGTA 2JSVX 2KQ4X 4KD3A 3Q8AA 4K2KA 2XWBB 1O7LA 2JYOA 1B1ZA 3TZUA 3EFXD 4FYDA 1FD6A 2PZWA 3IFDA 1GPXA 2MUYA 2WU5B 4IALA 1MHHE 3HVZA 3NSWA 1WTQA 2F1MA 4TMAB 3T16A 3FMCA 4IUPA 1I4PA 1OQQA 1E9MA 1HFGA 4V190 4PV1C 1WTVA 3V3XA 3T53B 1L6VA 2WXLA 1LTBD 1TWAB 3EA6A 3U9SA 3X3NA 1TKYA 1IYUA 5EBDA 1H9SB 1GB4A 1UWMA 5BN3A 1DGJA 3K57A 1G91A 2R61A 3L7ZC 2QILA 3A7AB 1HXYD 5G3LF 1BO0A 2KAJA 3LYYA 4O1NA 1KF6B 1WCMB 5DM63 4KY7A 2MJEA 1N5WA 4YSZB 2BA0A 1KFYB 4H0LC 2EY2A 1HPCA 4HAEA 1F9SA 4LTUA 2DLBA 2X69A 3I3CA 1QNKA 3PO3B 2NVXB 1NSNS 2RDGA 4XQJA 4KK7A 2FHTA 2JX5A 3I4NB 3C8YA 2WB1B 1CQVA 3OHXC 5IOCA 1Y56A 3HOUB 1WTWA 2NN6H 1MI2A 1H9KA 2KWDA 4CKBA 4YT0B 1WGKA 1JWMD 5D65A 2J42A 1DOXA 1WSPA 1HTPA 3WOEA 3H09A 1IGDA 1SMYD 2RQXA 3P20A 1C48A 3VA5A 5D7GA 1YQ3B 1JRPA 1N61A 3GTOB 1O80A 2YYZA 4ZQ3A 1ILPA 2J53A 2NUCA 2M2LA 4HTHA 4IZ8A 3QOJA 4BY1B 3NTIA 4K2LA 1I50B 3OOCA 3W9CB 1BUVT 4WH4A 1LLRD 5KEEA 5C4XB 3PUVA 5JEAJ 4OO1G 3K5NA 3T4AC 3SK4A 1KDCA 1CJEA 4HSPA 1JCKB 4USAA 4OIKA 1XEEA 1EZ6A 4IKGA 3S9WA 1LABA 3CQZB 3TP5A 1PFDA 1B2TA 2JA6B 2ICIA 5FK9C 2E75C 2YEPB 4XYQA 1DXMA 2XWJB 2JA5B 3B2FA 2PZUA 5AUKA 1EYCA 2L9HA 4A3KB 4OO1H 3AE2B 4MH8A 5K36H 1Y8OB 1ENAA 3BK1A 5EPKA 1NI3A 1IKLA 1JWSD 1HHVA 4O42A 5JEAH 3ND8A 1KLUD 5LNK1 4A3DB 4XWTA 1YNJD 4RA8A 1G6ZA 1L4DB 3AMZA 1KABA 3I4MB 2ZXRA 2K04A 3GTPB 4CQNA 1XLNA 1N5XA 5FLXE 1W6JA 2B8FA 3DXJC 4KY6A 3S1NB 2F0TA 4IUVA 2RA4A 1IUEA 1ZKOA 4L6TB 3JAME 4TKOB 4XXEA 2A69C 1C4PA 1C4QA 1HUMA 1T5EA 4X3SA 1GB1A 4L8JA 5C0XG 1RODA 2EKIA 1R4PB 3S1QB 2BT6A 2RSNA 4C2MB 2B2TC 4GDKB 3VQIA 1SYBA 3S1RB 3I8ZA 5C5LA 4ITKA 2W54A 4QCLA 1S5BD 2VB3X 1X3PA 1JE4A 1BF4A 4OZAA 1WVLA 4KHVA 4EE2A 4XWWA 1LT4D 4A55A 3CIRB 1KDBA 3NUHB 1TKWB 4HCSA 5HG2A 2BDNA 2FINB 4LAAA 1KAAA 2ZXPA 2CHBD 1WD1A 1FD7D 1DZ1A 2JYEA 2FJ2A 1UWXA 1WXQA 1V1PB 5HFYA 5GXGB 1PMRA 5G5GA 1S5CD 2EYPA 2R3ZA 1J7BA 4A9AA 4RFBA 3I72A 3PV0A 4XE0A 2NYZD 5EE0A 1RDPD 2R6GA 4XDCA 4L1BA 2F0EA 3OWFA 2N9KA 1SNCA 1MPEA 5D3DA 2F03A 2R92B 2RKSA 2Q8RE 2WXHA 5M5WB 4A3BB 3C1FA 4PMWA 1CQFA 3SXHA 3FVQA 2E2JB 5JXVA 4K8JA 2Z4IA 4K8IA 1LT5D 3ZJVA 1DYQA 4CBVA 3LXFA 1S5DD 3VYSA 3MHBA 4KD4A 1IBXB 3AE6B 1EM7A 1SMYC 1PGXA 2WXQA 1I6VC 2XRQD 1SDFA 4C1NI 3W5UB 1K51A 3VYTA 5I6WA 2MJ3A 3KLSA 3VRAB 1U4PA 4B08A 1NYQA 1K8MA 5E4XA 3DWPA 1LTID 5FKAC 4HRSA 1J9OA 1OXVA 2DBYA 1LTTD 4REZA 4RAUC 2RVLA 5HURA 1G2TA 1JOQA 4NJCA 3HRZC 2DWQA 2WKCA 3FEWX 1FNWA 4ZRPA 4IFDI 4XQQA 2IGDA 3NBIA 2K03A 2MPMA 1TY2A 3OWEB 1IW7C 2ID0A 1HA6A 2QMTA 4ID6A 1L6UA 2RBMA 1B44D 3ITPA 1SB3C 2A6ED 3L4PA 1G291 3AE8B 2QJLA 3MAQA 3KQ4A 4CGYB 2L1AA 1GUGA 2RPVA 3DWMA 1M8AA 5C3XA 3AEFB 5C2TB 4ZUJA 3URYA 1NENB 5C4HA 4Y7NB 2J7ZA 2SEBD 4H44C 4TQUS 3H8HA 1QT9A 3NVZA 3SR1A 3TDQA 4M0WA 1E6EB 3H3VC 1JOOA 5ISRA 2KOLA 4TRDA 2WP9B 1ZYRD 2QKIC 1EWYC 2OT2A 1O7ZA 1EY0A 1EZ8A 4DU9A 5H92C 5M5XB 5CBEE 1B4OA 3GS2A 1H9MA 3ERQA 5I2XA 4DA2A 4ZRQA 1EY8A 5NUCA 3S2DB 1LTGD 3J7YW 2WU2B 3A8IE 1YN5A 1D6EC 4ZKCB 2JA7B 4RF0A 2I07B 5FLXL 2B2WA 3ETRA 2EVBA 1RCVD 3GTJB 3LNNA 2H1EA 3DWGC 3NZ3A 1N63A 2Y5CA 2ZW1A 2NVTB 3VYRA 2K5PA 2DNEA 3HEJA 4RGTA 2EYFA 2DN8A 1Q8IA 3P7JA 4JBWA 2L12A 5EE1A 2PW7A 5CR3A 3NVWA 4IDIA 1QOBA 3Q6SA 1V1PA 1FCCC 1SJED 2F0QA 1J8IA 4KY5A 5I2YA 4KMUC 2EE1A 4A3JB 2L55A 3LWEA 4KJNA 4I65A 1BXTA 4ME5A 2XIWA 4K5XA 3P4QB 1GXDC 3R2IA 2G1EA 2NTTA 1YJJA 2HCIA 3S16B 5FO7B 2W82A 5JEAG 4N9TA 1IHZA 1W6KA 4RF1A 5CV4A 1FFUA 2JEAI 4RH6A 4RHRA 3P4RB 3E0JA 4RKBA 2F0HA 1QOFA 3J9CA 1PRTF 3BYTB 1C9FA 2A74C 4BWGB 4QUCA 5IT9E 2KEEA 2TSSA 2IL8A 2B76B 2Y5PA 2B63B 3T3OA 2QCPX 2QDBA 4HEA1 3E5SA 1GAQB 4XQNA 2BB6A 2NBFA 2IX0A 5EPJA 2AWNA 1QWYA 1QNUA 1KH0A 2DY8A 3E56A 3GO5A 1AP0A 3NTHA 2C9OA 5DAUA 1VF7A 2K28A 1RJTA 4FXCA 4QB4A 3A54A 1PGBA 2AX5A 2F4IA 1VDVA 3AB9A 1RM6C 1KRHA 3TBIB 3TN2A 1F2MA 1VLBA 3HVDA 1CA5A 1K50A 3BZDB 3OW7A 1C77A 3IL8A 1D4BA 5CV9A 2QEJC 4CJ1B 4ARIA 1A15A 1PTOB 1SE3A 1TS5A 2MHVA 3ZJUA 4J3OD 1KDAA 2B2YA 1V97A 2HCCA 2NTSA 1WWTA 2RDFA 2B2YC 1SYDA 3NWSA 1TIID 4FO2A 3KWLA 1EQTA 4K14A 3PZ7A 2LMCB 2WACA 5KYLA 5JOBA 2KUMA 1FRRA 4ABNA 1XCTL 5EQ0A 1E7PB 1EWCA 3H94A 4A3IB 4JPSA 3KLSX 1SEBD 2PZTA 2V4IB 1F2RC 2IJ0A 2BBCA 3KBGA 1NR2A 1EEID 2GI9A 2M56B 2Z1CA 1L0YB 3CRKC 1RFKA 1SBBB 3FPUB 3IT6B 5CORA 1TU2B 4ZLTF 1VDZA 4ULLA 2YU9B 1WTRA 3VR9B 2B2VA 2SNMA 5HGTA 2NN6G 3A56A 4QIWB 1CM9A 1SXTA 3EVQA 4GLSC 3RZDB 1TWGB 2F0GA 1TWHB 1B50A 4ZKBB 1EY5A 2F0WA 5AUIA 3H0GB 3N6RA 1EU3A 1SSNA 5J1ZA 4ILWA 1P7FA 1AEXA 2N88A 2FMMA 1JW9D 4US8A 1QILA 3BVMA 5BMGA 2G9HD 4DXGA 2Z8LA 3E6ZX 4X3KA 2AQ3B 3QG1A 1J7CA 4DGZA 2A6EC 3AEEB 1FO4A 1SYCA 3SDZA 1AFPA 3Q0AA 1HQMC 1PZJD 5M5YB 2EYMA 4IUUA 2A6HC 2EYLA 3K58A 1L5PA 1LTSD 2K5QA 2KQ3A 4C7YA 2X6GA 2CQAA 1E0ZA 1Z47A 4HROA 5C0XJ 3RD4A 1JQYD 3D4WA 3R93A 5CYUA 1EY9A 4LK0M 4L63B 1U4MA 4TSSA 2J52A 1ET9A 3VR2A 3TZDA 3P4PB 3FDTA 3EQLC 3NWTA 5MPOA 3HOWB 1SJHD 5IGFA 1DOKA 1EY6A 3NQIA 3MXUA 3NUCA 2AQ2B 1BCPB 5EE3A 1JOKA 2O5JC 1ACCA 2EDGA 2PLPA 3NK9A 1LT3D 4OVZA 4Q2JA 1R7SA 1LTAD 5C0XH 3GV6A 4RKLA 2MJDA 3P42A 1TS3A 2DY7A 4Q0FA 4DK0A 2J0TD 1WTPA 1G2SA 3BDCA 4KKTA 4FXGC 1F9QA 5JPNC 1STYA 3MHZA 3I4LA 1SE4A 2Q8TA 2CJNA 3P4SB 1I6HB 3MP9A 3VR4A 1EL0A 5ELCA 3BG3A 2WDQB 3NTKA 4KKSA 2F0VA 4YWGG 3U2SC 1KLGD 1YNND 1AYFA 3HOXB 3MXPA 4K5VA 3CWIA 1BCPF 1ZPSA 1XLOA 4AYBB 2AQ1B 1K8OA 4B0MA 1STNA 2K33A 5I4DA 5KIXA 2PVOD 5EKIA 3G7LA 3IAS1 4RGMA 1JALA 2V4DA 4NKLA 2JSOA 5BMIA 3PIO3 2J4XA 2PTLA 1WTOA 1WRIA 5HHDG 1Z7TA 3I73A 4CKEA 2WNMA 3S17B 1JQ4A 2OXPA 3AE7B 1CA6A 4KGRA 1PXUA 3OIPA 4WJWA 1JB3A 4WFN3 2MJ8A 1VR9A 1RTNA 1GJXA 4K6LA 1TVXA 3NS1A 2KHSA 5CBAE 2O4XA 3QJYA 5IGEA 1TJEA 1UAPA 4ZAIA 3BS1A 1DOLA 1ROEA 2K05A 3TP8A 2KACA 1EIHA 1HRJA 3L9AX 3TEYA 3AV8A 5CV7A 5K5PA 2VZKD 1NUCA 3DEOA 4B9XA 1CZPA 4DAVA 4G57A 1VJKA 2N7JA 1MHXA 1NR4A 3OMCA 1UUPA 3N9YC 4LJZC 3OPOA 4YXDB 2WDRB 5ELDA 3AEDB 1XLQA 2W55A 3K5OA 2LUMA 4FVMA 3Q69A 1F9RA 4RGOS 1JWAD 3U9OA 1CTMA 4WWMA 3K5LA 4C3HB 3N52A 1XXGA 4N9PA 4PQXA 2GA4B 2EYOA 1P7EA 1O78A 3UI3A 2WKDA 4U68A 1YNNC 1PZID 3D4RA 2LGIA 2HQEA 3K6OA 1RHPA 5C0XI 4IOIE 3PUYA 1C4CA 3OIQA 2JWUA 2A68C 4E6IA 3MXNA 2Q5WD 3HS0C 1OXTA 4C3IB 3RUZA 3CU7A 1CZWA 1FYCA 4KN7C 4DNTB 4LK1C 1I7HA 2EYHA 4S3SA 1QQRA 3BYYB 2X38A 3MTSA 1G8ZD 1N60A 1EYDA 1STEA 3MZ5A 4XTCS 1PFMA 3R8BA 1FMAD 3IKJA 3TEZA 2V3NA 1RF2D 1QOHA 2XRSD 1F2YA 1PTOD 4HMIA 2DYOA 4Z9CB 2EY5A 1BUIC 2PIAA 4A93B 3M3YB 2BE5C 3R3OA 5CC4A 5C3WA 2M00A 3M4OB 3AE1B 1Y1WB 1FGBD 3NP8A 1JWBD 2D5GA 3PZ8A 2NZ1D 2HTME 2K3UA 1BQQT 2H89B 1PYWD 1JC7A 3A8JE 1TR5A 2WS3B 3PO0A 4HR7B 4ZHOA 4FF3A 2D2CC 5C5MA 1WD0A 3AECB 2M9VA 4BY7B 3TEXA 2ACZB 1PTOF 1VZ8A 5KRUA 5I9PA 1MBYA 1KNAA 3J7AF 2BTEA 1C76A 1YQ4B 2Y0SB 3M7GA 1EEFD 3SK6A 1TS2A 1ONLA 5CMDA 4BA2I 3GTLB 1HFNA 2KDMA 3P1MA 4NP5A 2ENBA 2CW0D 2Q8IB 5BMHA 4JE3B 1A6XA 4C3JB 4R9WA 2JEBI 1T5XD 1STHA 1CI3M 2PO4A 1ML0D 3T13A 1NYRA 4WURA 3MEHA 3A55A 2OEDA 4P16A 4FF2A 4QUFA 4KKJA 2AUKA 1BR9A 4BBSB 3WCQA 1I4QA 3FPPA 1K53A 3T3NA 3SE0A 2SDFA 1VRAB 1DJRD 3MXGA 4V0BA 1TZOA 2BE5D 2TMPA 4B9WA 1NEKB 5CV6A 2WXGA 4OIJA 2BW2A 5CV8A 4HKQA 4KV6A 3DM1A 3FAHA 2WV6D 2EJGC 1TWCB 3R2TA 4DFAA 3SVMA 1IKMA 2N0SB 1UEAB 2B2WC 1BNZA 1ZE3D 2K1BA 4K5WA 2VNUD 1FXAA 3QB3A 1HZ5A 2BS2B 5A2QE 3FC4A 1A3UA 2C5CA 3D31A 2WXOA 1RD9D 1KNEA 4EQNA 3RLFA 1MGSA 2JP1A 5IODA 2GB1A 5FOBB 1D1IA 3GP7A 2A69D 3HG9A 2K6AA 1A3VA 1ZXHA 3AE3B 2EPBA 5ELFA 1WTXA 5T1IA 4CJ0B 4US9A 1ZDXA 4ZYSA 3GTQB 2OF1A 3TEWA 3DMUA 1AN8A 4BBRB 3KLRA 2K9XA 1H9SA 3Q22A 2SOBA 4H7BA 4YIJA 5E3FA 1VMCA 4KI0A 2Y3AA 1FM0D 3NRZA 2E74C 3T56B 4CJ2C 2F0LA 4F8MA 1SIJA 3L3OC 4OGQC 2SNSA 3HRDD 5C3JB 4DAPA 1JMLA 2QF7A 4KTAA 1QJOA 5I9OA 2EOTA 3AE5B 3Q24A 3E9SA 5C6AA 4BS9A 2BDOA 4DK1A 1PDQA 2K22A 3H6MA 2A5HA 2K5WA 2LFNA 1VF5C 4HEDA 1QKZA 3V96A 1SYEA 2LJIA 3SR6A 3AMUA 4X3TA 4FF1A 1UNSA 1E2VA 1LTRD 3FRPB 5A35A 4L23A 2M0AA 1XTCD 1QOAA 1SAPA 1HTLD 2EY6A 5LL6S 3HUIA 2H88B 5IGDA 2PNRC 4IN3A 1ESRA 4F88A 3GB1A 3U7ZA 3K59A 3W2DA 3LX0A 1ZP0B 3P75A 2LS01 1SSOA 3D6WA 3GV3A 3DEPA 2ZW0A 1IBXA 2DNCA 5AFWA 4ZOHC 1HA5A 2F0IA 1HUNA 1PRTC 1T3QA 1QOGA 1UGJA 4AQ7A 2JXMB 3IT4B 3KF8A 5FR3A 2BYTA 2PPBC 3QIAA 3A7LA 3HKZB 2VZKB 1BCPC 2FUG1 2L4NA 2HUGA 2MH7A 3F2UA 1RTOA 4NAWB 3J80L 1GOZA 3NVYA 2PVGC 1EY4A 4JX1C 5E1FA 1C79A 4KHZA 1S5ED 3RMHA 1BMLC 1SNPA 4EQPA 2VB2X 4C3HG 3U4EG 4IQZA 4DNRB 2CU3A 3Q23A 2MEKA 1BOSA 4KX6B 3AH7A 3ZGZA 3SFEB 3IFTA 3K0YA 2IPKD 1PFNA 3J7AV 1VZ6A 3HGBA 1FRDA 1GUTA 1L4ZB 3Q8CA 1XWEA 1E2ZA 4A90A 5LHY1 5DM73 1FFVA 5C4ZA 1H9RA 1BCPD 2N55A 4WQMA 3QO2A 3VR5A 3MFGA 2XNAC 3UI2A 1I4HA 2KN4A 4FNFA 4HMJA 2E3TA 3FILA 4OZCA 2XSCA 4HCEA 4GZYC 1ENFA 1FXIA 3K7AB 3J81L 1SNDA 1STGA 3DWAA 4C80A 4FXKC 3SK8A 1LACA 1JWUD 5JVH3 1XO3A 3D3RA 2GRIA 2F0NA 4PMCA 4QF4A 5IGGA 2KMMA 2BCOA 2AUJD 1E0BA 3ZQ4A 3LWUA 4AS1A 4JK1C 1GUNA 3AEGB 1LO5D 3S1MB 1EIGA 1KTKA 4A3EB 1STBA 1XF5L 1BBXC 3C2PA 5I6YA 2YEPF 2I46A 4DAYA 1AZPA 3AE4B 3RPFC 4IFDH 2KECA 2LMCA 2KJXA 1N62A 1TQOA 4YTNB 4NAMA 1SF0A 5BN5A 3EGRA 4L2YA 2L52A 2QIEB 1D5ZC 2OEOA 1L0XB 4JWUC 4WAFA 1H9JA 3AN1A 4WIPA 5G5HA 5JPMC 2WXKA 3D8GA 2RDHA 3C1EA 1E2WA 1Q90A 2L83A 4GDLB 3GQBA 5BYRA 2V0GA 2WAQB 4IUNA 3M4YA 4U673 2B2UA 1Q12A 4KKUA 1OQRA 5E6JA 4OHJA 2IX3A 1ZDVA 3MA2B 3AE9B 4KN4C 1Q10A 4IFDJ 1Y8PB 1FEHA 2IGGA 3QOLA 3J81E 4J6HA 1X3QA 1HCZA 1A2UA 4MACA 4HKZE 5C3EB 4YTMB 3O13A 2H4OA 2Z4HA 2NB0A 1EYAA 2FBWB 5JJZA 5KNBA 5KNDA 3I57A 4N58A 3W3AA 1TT2A 4WRDA 1M4VA 1OXXK 2D62A 5C4JB 1V8QA 1YN3A 1DM0B 1EQVA 2F0UA 3TMEA 1DOYA 2BOSA 4DN4M 5IT9L 3S14B 1DOIA 2JU6X 3I9V1 1C4AA 3MVVA 2IW3A 1R4QB 3H91A 1MSHA 2FE8A 1PTOH 1A3TA 1Q1BA 1D5MC 1IL8A 2KA7A 4UAIA 3BIID 2W3RA 1EU4A 1I4XA 5C44B 5EGTA 1QB5D 5DNFA 3VR3A 1B9RA 1FNVA 1SNOA 1U9RA 1ET6A 4EVOA 3J80E 1A2TA 1CFMA 2A6HD 1RYJA 4HN7A 4P2CB 4P6VF 1GUSA 3HOVB 3OSOA 2F0SA 4HJGE 4ODGA 1TY0A 5EKLA 2AWOA 1BDOA 2R7ZB 5JAVA 2WXNA 2BS4B 5M3FB 4CHTB 3V05A 3PIP3 1F2LA 1II3A 2KEDA 1HQRD 1FIQA 4C3JG 1F0ZA 1YJIA 3I70A 3SFDB 3M7NA 1AWDA 1PGAA 3S2HB 4XT1B 3FKIB 3GD7A 4N6EB 5H8YE 1JROA 1O7YA 1PZKD 1FCLA 1T6BX 2F0FA 2I38A 2LY7A 5T1GA 3AEAB 2XN9C 3KBXA 2F0OA 5E4WC 4NZLB 3CKIB 4YSYB 2RMMA 2PQEA 1I4RA 4OW0A 1CK1A 4G7HC 1OXUA 3B2GA 4XIGS 4ZK9B 4DXFA 3Q8EA 1PLFA 5D14A 4FP5D 5T8IA 2B2VC 3P63A 4MM3B 4K6DA 3EUB2 2F0MA 2EXZA 1D2BA 4ARCA 2E2IB 4J8QA 4R8NA 1WYGA 3PUXA 4KGSA 4DF7A 1TWFB 1ZXIA 2PCFB 1ZEQX 4EGVA 5K36G 1J7AA 3PUWA 1IW7D 1QG7A 2PMZB 1MI0A 5HI1A 4RWSC 1ZOYB 1ILQA 3DHQA 1I4GA 1GHJA 1GUOA 1SE2A 2IT1A 2DYMA 2B39A 1B3AA 4KJOA 1VZ7A 1PUTA 2PYKA 4ZUIA 3TUOA 4C56C 2LEKA 4R8IA 4NMZA 2F3VA 1HEZE 3TP7A 3Q8FA 1NCVA 4LLGM 1F9PA 4DQOC 4A6QA 1Y69U 1NVID 3SHLA 1Y1VB 2G9DA 1B53A 1AW7A 4TQ0A 3SEBA 2B8GA 2EELA 1EOTA 1AZQA 4ZRZA 2HDEA 5LL6X 2M19A 3VRBB 5BYSA 5BYQA 2JYTA 2NN6I 3AEBB 4J1MA 3VR8B 4F7XA 1PRTD 3NHHA 5COYA 1CZGA 4MIUA 1S5FD 3A8KE 3NE5B 1Y8NB 5EKKA 5J22A 3GTMB 4X3UA 3Q8BA 3SK5A 2K0PA 2WDVB 4M8AA 5EPLA 1QCBD 2E2HB 2WXMA 3BDLA 3HZXA 4G4KA 4RCNA 1HZ6A 1TKGA 4A8XC 1Q1EA 3DUZA 5IIFA 4PMBA 1E10A 2N9LA 1V8CA 2F0KA 3HOZB 2JA8B 4G7OC 5EBCA 1QLBB 3ONAB 3I91A 2WXRA 3LB8C 1SNQA 1SNMA 2IGHA 2BA1A 2INPE 3NXWA 2WP8J 4FXDA 4PNYA 1ZUD2 1ICWA 4A3GB 2PMVA 1NAPA 2F0DA 1PRTB 1CHQD 5CV5A 5M9OA 3VR6A 3PUZA 2WXIA 5A2QL 4M1UB 1CT1D 2EJFC 2L0CA 5CGKA 4XDDA 2A73B 3M85A 1DD2A 2E76C 4H2AA 4TQ1A 2OHFA 2JE6I 1CHPD 3T51B 3PMFA 4A3FB 3IXSA 4OL7A 4F87A 1DCZA 3VA7A 4N59A 4RCOA 1STAA 3CRLC 2K7VA 5FO9B 2WXPA 3MFYA 2KCNA 5EJWA 1LT6D 1X32A 2K01A 3MJ5A 2F0PA 2WXFA 1FR3A 1SYGA 2FFKB 2INNE 5EE9A 1EWHA 4KKIA 1D1KA 5D3IB 2F0JA 2FMCA 2LKVA 4I7ZC 5IGCA 3HP3A 3NQTA 3EROA 4YTPB 1XCQL 5F2DA 3FILB 5KGUA 3KUPA 2SAKA 2NVYB 3BWUD 2A68D 1YMHE 1B9NA 2I2YA 3RFZB 2MP1A 5G3LD 1JORA 5FO8B 4XT3B 4A3MB 3KWVA 2EYJA 1F2RI 1TKEA 1GHKA 2WXJA 3W5VB 1MSGA 5J39A 1YNTE 3NPPA 4PT5A 2CVRA 5JVG3 1QE6A 2D9UA 3B9JA 1YNJC 4C1NK 4IUQA 2BS3B 2IWHA 1JICA 3OMGA 2L5TA 1F77A 2L1BA 5TSSA 3V2TA 2L11A 2B2TA 3U52E 4R3DA 4C7ZA 2PKOA 4FF4A 1IGCA 3JAML 2VUMB 4CKCA 2JXTA 2E6XA 3WOFA 3CHBD 1ENCA 4C3IG 2QSDA 2ICEC 2NVQB