1RAXA

Ra-domain of ral guanosine-nucleotide dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
QQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RA-DOMAIN OF RAL GUANOSINE DISSOCIATION STIMULATOR)
publication title High-Resolution Structure of the Ra-Domain of Human Ralgds and a Dynamics Study of its Binding Loop to Ras
rcsb
source organism Homo sapiens
molecule tags Ras-binding domain
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1999-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1raxA00
2MCNB 3ZKJC 2IBIB 2IO0B 3ZLZA 4EKUA 4DDID 2C9WB 4DHZB 1R4MI 2OJRA 1WGHA 4BBNF 3UQAA 4MGYE 1WZ0A 4JLCA 4NAWB 4ANVA 3A1QA 1BT0A 2DYOA 2K39A 2LRWA 4DBGA 2K8HA 1TTNA 3D32A 3L08A 1LXDA 3PHWB 3S2AA 4K7WA 1NI2A 3L0WB 4M0WB 4W9HA 2NPTB 5J2RA 2K1FA 3IG3A 3LJ3A 2Z0DB 4N9F4 4IWPA 1H4RA 4HDOA 4HLEA 3L54A 1P9DU 1WRDB 2J0JA 4MSQB 3QWZB 4BKSD 3ZNZB 4DDGD 2KO3A 1IYFA 3ZDTA 2D11A 1TGZB 2LGXA 3TBLD 1PQSA 4W9CA 1MG8A 2KNBA 3V61A 2IY1B 4AJYB 2FUHB 2K6QA 1T0YA 4KIKA 2O6VA 2NBUA 2NPTA 3U7DA 1EO6A 3M3JA 3C0RB 2ZZPB 4HCNB 1ISNA 3P2BA 2KMCA 1Z5SB 5CTRC 3ZNHB 2KTRB 1E8ZA 2KK8A 4I6LB 4WQOB 2Z59B 3VHTC 1C1YB 2GBRA 2ZCBA 3JSVA 4EOYA 3DBLI 5DCNA 1GG3A 1YX6B 2FIFA 3H1UA 2C60A 2M17A 4ZYNA 3W1SA 1WR1A 2YVCA 3VFKA 4WJQA 3PGEA 2LWPA 3ZNGC 2J0MA 2A4ZA 2DZKA 3DCGA 3AI5A 2BYFA 5GMVA 5BO4B 4W9DA 2G45B 2JZZA 3BY4B 2KN5A 2MWSB 2A5UA 2KC1A 4BVUC 2KD0A 1IPGA 2L76A 2JY6A 4A20A 2HD5B 2XK5A 3HM3A 4OVVA 1LFDA 2ZNVB 4FHKA 3VH3B 2DAFA 2BWES 1C3TA 4GOCA 2JF5A 1F9JA 3ZRFA 2KQ7A 2XEWA 3OAWA 1EF5A 4NJ6A 1LQBA 3DDCB 4HWIB 2K8BA 3ML8A 4DHJB 3VXWA 3KYCD 2UYZB 3UGBB 4A3PA 3NZSA 3VTVA 1V49A 3NZUA 2PJHA 5TR5A 4FHJA 1WX7A 4FJYA 2GOWA 2LVQA 4HXDA 1S1QB 4NY0A 3VUYA 2LGYA 4PYZA 3QC8B 2JRIB 1UELA 2KX0A 5E6OA 3UF8A 4K81A 2MSED 3WANA 2KWUB 2D07B 3A9KB 4G3XB 4TQ0A 2WYQA 2ZVOA 2LASA 3QAQA 4HCPB 4TKNA 4TUUA 5AZGA 3Q3FA 2LZ6A 3K9OB 4HVBA 2AYOB 2O6VD 2V3SA 5E6PA 1V6EA 2AL3A 1KM7A 2KDEB 3QA8A 4ZDVA 4K7SA 4KDIC 3IHPC 1XQQA 1D3ZA 3OJ3A 3IFWB 1KLVA 4A3OA 1Y8RC 2KDBA 1WJUA 2ZJDA 3DBHI 5FR6A 4MH0E 2L3ZA 4LJOB 2JXXA 2AWTA 2N4FA 4W9FA 4AP4C 1OQYA 2K8CA 1E90A 5DPTA 3VTUA 1WMHA 1E7VA 1WY8A 4AJWA 2LUEA 3TL5A 5D7GA 3PRPB 3M62B 4GXBA 3B0AA 3HIZA 2M0XA 3PLUA 3PZDA 2JVCA 4AUQC 3A9JB 2NBWB 4W9JA 2KC2A 1VD2A 5J17A 4URKA 1RRBA 3PVLA 1V5OA 3JYUA 4PS7A 2KWCA 2LVOA 4GGQA 4BBNC 2L05A 4B6WA 2ZCCA 4M8MA 3R7QA 1P98A 2IO3B 1CMXB 4M8NA 2MP2B 2LD9A 2G4SA 2KX3A 4WAAA 5CHVC 1AARA 1TBEA 4IG7B 2N9EB 4KVGB 4HDQA 2NR2A 3TJPA 4WWPA 5G55A 1ZGUB 2AEHA 3N3KB 3ZTCA 1V2YA 2IZVB 5C23A 1WE6A 1WM2A 4JL9A 2WX1A 5CHFA 5AZHA 5KHOA 3R3MA 4MDKE 2D3GA 2M4NA 2RSUA 1U4AA 1TZ1A 2BYEA 2JWZA 2KVRA 2NBVB 2DYBA 3PRZA 3QQ8B 2QHOA 4GSWA 3ZDMC 5JHBA 3MTNB 4NJ7A 4MJSB 4NAWA 3ML9A 2N1WA 3SDLC 3QJZA 3PS6A 1RAXA 2KKCA 2GBMA 4LDTD 3AU5A 1M94A 2N7DA 2K6DB 1G6JA 2NCNA 2Z0EB 1WI0A 3APDA 2CU1A 2IYDB 3RD2A 1J0GA 2KQSA 2MA9B 1V5TA 2MBOA 2KOXA 2IO1B 3KVFB 4K7UA 4ZRIA 1KOTA 2MW5A 3ZO5B 1E7UA 3R66C 4W9LA 2LXAA 5C1ZA 4MGZE 4X57B 2MBHA 4G11A 2OOBB 3NOBA 4RM9A 4FA6A 3AXCA 4GN1A 2FIDA 4PYUA 3CSTA 3L10B 3NHEB 1WIAA 2BKFA 4IM3A 1I35A 3A4RA 1OGWA 4IUMB 4G50A 3ZVVA 4P7IA 4W9KA 1E8XA 2BYVE 2KTRA 4PS3A 3BINA 3ENEA 1V9JA 2BKRB 1X1MA 2KDFB 2ZNVC 4XZ4A 4DHZE 1P3QU 2JT4B 3DVNV 4IW0A 2CKHB 4GDLB 3H9DA 1WM3A 3N32A 2L0TA 3PHXB 2JZ3B 1WGYA 1UD7A 5AZFA 3VTWA 4BFRA 3IVFA 2GBKA 2N9XA 3L16A 3KUCB 1SIFA 3GZNI 3WALA 2DZJA 3UQBA 4FJZA 3V6EB 1NBFC 1RLFA 1YJ1A 1RFAA 3CSFA 2Y5BB 2D2QA 2NS5A 4EZLA 2N1VA 3M95A 1WYWB 4G0NB 3KUZA 2HTHA 3JVZX 3T9LA 2B3AA 4NQKE 4E3CA 4E74A 5JZEB 3A4SC 2I1KA 2RR9A 4OVUA 4CYEA 2J0KA 2MQJA 2I1JA 4GMVA 3QX1A 4KZCA 4PS8A 4RM8A 4WWNA 5AEKB 1I42A 2C7NB 2RGFA 5IAAC 3DVNU 2KXJA 2KJRA 4FADA 1QZEA 4IM2A 3WAPA 1WF9A 1WXVA 2GBJA 4W9GA 1K8RB 2DENB 3LDZE 3A9KA 1UBIA 1ZW7A 4YL8A 4EZKA 1GNUA 3T8MA 1J19A 1LM8B 4NNJB 1SE9A 2JUOA 2MX2A 3QCAA 1Q0WB 3EHVA 4IWOA 5JHAA 3TMPB 1UZXB 3RZWC 2BF8B 2LJ5A 3B08A 3DQVA 4EEWA 1VCBA 5JH5C 5DPRA 1WE7A 3N30A 4WJPA 1YIWA 2CHWA 4EZJA 2RPQA 3NS8A 3UIPB 3EECA 4GDKB 2FCMA 2XBBC 2MLBA 4BOZB 1OTRB 2FNJB 2MBEA 3H7PB 4IWQA 2N7EA 3RYTA 1WFYA 3DPDA 3VUWA 2C5LC 3PT2B 1GC7A 5DPWA 5KHQA 4KZ0A 4F7ZA 1A5RA 3JW0X 3PPAA 3X23A 4FLHA 4DK5A 2L8JA 3EFUA 3WAMA 1EF1A 5D6JB 1OEYJ 2V1YA 2GBNA 1WX9A 2O2VB 4B95A 2LI5A 4I6PA 3RT3B 2HJ8A 3H6NA 1UH6A 2LGDA 2LXCA 3A9JA 3A1QB 3QARA 2BGFA 2FCSA 2ZEQA 1L2NA 4MEMA 4DHJD 3O65B 2KFJA 3L17A 4HK2A 5J18A 2WWZA 4W9EA 3AULA 3RULA 3MHSD 4E71A 4GIVA 5LXHA 2BWFA 4KSKC 2CR5A 3I3TB 3ZTDA 2PPHA 3SD5A 4ZRJA 3DVGY 2MP2A 3OJ4B 2O2VA 3PREA 1GC6A 4HPMB 1WH3A 1IP9A 5L83A 4AOFA 3W1YA 3CF6E 4CO7A 4J6IA 4ANXA 2REXA 2CS4A 2KANA 2KJ6A 5CX3A 2IY0B 2WDTB 4RMAA 2ZPYA 3L13A 4KIKB 2ASQA 3R7RA 4FBJB 2O6VB 3CMMB 3RZFA 3ECIA 4DWFA 4I6NB 2KZRA 3VH4B 1WXMA 1WGDA 2K25A 5EDSA 4XC2A 4XX5A 1EUVB 3V60A 2EMTA 4MGIE 4MJSA 3JSVB 2M8SA 3APCA 3B1LX 2R2QA 2PE9A 4WJOA 3KW5B 4MELA 2LRUA 4JGHB 3TCAA 2FCQA 1JRUA 3A33B 3VVWB 1Q1OA 3W1SC 1Z2MA 1WJNA 3RUIB 1HE8A 2BPSA 3K9PB 2JPHA 2MBBB 5L95C 3DBRI 5LLIA 4HPLB 1Q5WB 4ANWA 2GMIC 2C7HA 2DX5B 2YLMA 5G2NA 3X0WA 3HHMA 2R2OA 3MJWA 1V80A 2DAJA 2NVUI 2D10A 1ZKHA 2XK5B 1L7YA 1NDDA 1SGHA 1YQBA 1P0RA 4K1RB 4ZRKA 1P1AA 4NPNA 3WAOA 2L0FA 4JIOU 2C7MB 4BOSC 3DOWA 4IM0A 4W9IA 1UBQA 1S3SG 3KYDD 2KFKB 3ONSA 4II3B 3EC8A 1YX5B 4FULA 1GJZA 1H8CA 4TV3A 3APFA 4GU2A 4GB9A 4KSLC 3VDZA 1WXSA 1V86A 2G4DB 4TQ1A 4CHKA 2M1MA 3SHQA 2MBQA 4MGKE 3V6CB 2VRRB 4WWOA 4ICUA 4HJKA 2EMSA 4BKTA 2DHZA 1WGRA 5IA7A 2PE6B 2KDIA 4B9KA 2KJHB 1V81A 2DZIA 4GDLA 3AU4A 3ALBA 5DPSA 1E8WA 2KFKA 3ZRCA 3ZW3A 2AL6A 3HM6X 3PLVA 3ZUNA 2WX0A 1WX8A 3Q3JA 4JQWC 4KV2A 4DXAB 2PEAA 4F1SA 3UIOB 2KLGA 3PRMB 2JRHA 1WXAA 2KTFA 2LVPA 3GOEA 3RCZA 3U8ZA 3WA0A 5HKHA 2G3QB 1KJTA 2DZMA 3VUXA 1E5WA 2RD0A 1J8CA 3QIJA 3VQIA 4BKGA 4MSMB 3OLMD 4LDTB 4FN2A 3WIMA 1GUAB 3QK0A 4FJVB 3NY5A 4EUTA 5LXIB 1WMHB 4MM3A 2L00B 1XT9B 3ZIMA 2ZPNA 3KH0A 5D2MB 4NQLB 4BKSA 2CHZA 1UGMA 4LJPB 2HE7A 4LCDE 5E6NA 2UWQA 3V62A 3HK0A 1YD8U 2ZVNA 2DYMA 2EKEC 3IBEA 4ICVA 3PTFC 3U30A 3M63B 3SU8X 4EFOA 5CHWA 2V4LA 4ASWC 2FAZA 1OEYA 3PSEB 3PV1A 4WJNA 3UINB 2N9PC 4IC7B 2IO2B 2KWVB 3H7SA 4ANUA 1WR6E 2CHXA 1R4NI 1WJ6A 1WJ4A 2FCNA 4GDKA 2W9NA 3DVGX 3H7PA 4AWJA 2KHWB 5D94A 4KDLB 2KMAA 3TIXA 1WZ3A 2MRPA 3VAWA 1E8YA 4F8CB 1WGGA 4II2B 1FXTB 2L7RA 3DBSA 1XD3B 3KUDB 3ZNID 2KLCA 3QHTA 2J7QB
chains in the Genus database with same CATH superfamily
2IBIB 2IO0B 3ZLZA 4EKUA 3E56A 2C9WB 2WXQA 1FNWA 3UQAA 4MGYE 2WHIA 3NS1A 2EKIA 4A9AA 1L0YB 2LRWA 5GXGB 2K8HA 2N0SB 4K7WA 2G1EA 3L0WB 4W9HA 5J2RA 1XF5L 4L1BA 2WLBA 1ET9A 5EE9A 1P9DU 4DDGD 1VJKA 2VZKB 1IYFA 3ZDTA 1TGZB 4ZYSA 1QOGA 4W9CA 4C4VB 2KNBA 4AJYB 2FUHB 1TS2A 1OFFA 3FKYA 2NBUA 3M3JA 4HCNB 3AE8B 5CTRC 3VHTC 2GBRA 3DBLI 1YX6B 3W1SA 2M17A 1WR1A 2J0MA 5BO4B 2DZKA 2PIAA 3AI5A 1YJIA 2A5UA 4LNIA 3AEBB 2KD0A 1TKGA 2L76A 2JY6A 4C7ZA 4OVVA 4KKIA 2JF5A 1F9JA 3ZRFA 2KQ7A 2M56B 4NJ6A 1LQBA 3NZSA 4HRSA 2LGYA 5E6OA 3C19A 4K81A 1K50A 2MSED 3HUIA 2D07B 2KWDA 4TQ0A 2WYQA 5AZGA 3Q3FA 2LZ6A 2WP9B 3MJ5A 2HDEA 1V6EA 2AL3A 2WDVB 2BVCA 4KDIC 3OJ3A 3RNBC 1KLVA 5IO9A 2JXXA 3ZQ4A 2N4FA 1B9RA 3LB8C 5AUKA 1BXTA 1K52A 3VTUA 1E7VA 2LUEA 3M62B 3U4EG 2M0XA 4M01A 2Q5WD 1KH0A 3A9JB 3KLSX 2NBWB 2KC2A 3Q8FA 3HVZA 1E0ZA 2N9KA 3JYUA 2WXJA 2D3CA 4BBNC 4B6WA 2QJLA 3B2GA 2WXNA 2L32A 2RDHA 3GS2A 2WXGA 2LD9A 2N9LA 1TBEA 5D3DA 4YT0B 1TS4A 2MHJA 2N9EB 4KGRA 4KVGB 1WE6A 4MDKE 3BK2A 1YN5A 2RSUA 2JWZA 4JX1C 1BUIC 4C7YA 4US9A 1T5XD 3MTNB 4MJSB 3ML9A 2N1WA 1NENB 3PS6A 3NVWA 2GBMA 2LFIA 1M94A 1ZPSA 2N7DA 5TSSA 1G6JA 2NCNA 2KQSA 1V5TA 2IO1B 4K7UA 3VRAB 2MW5A 3HVDA 2INNE 2LXAA 4OZAA 4MGZE 1C9FA 2MBHA 4C4VA 3BYYB 4RM9A 5JXVA 1WIAA 3RPFC 1OGWA 4IUMB 2BYVE 4PS3A 4RCOA 1TS5A 1SJED 4WIPA 4GLSC 3SFDB 2L0TA 4US8A 4BFRA 3KUCB 1SIFA 1I4PA 1YJ1A 3Q3NC 2X8XX 1IBXB 3AMZA 2BB6A 3EA6A 3T9LA 2B3AA 4BAXA 3A4SC 4OVUA 2RR9A 4KZCA 1I42A 4WWNA 1EU3A 2BT6A 4KKJA 1QZEA 4IM2A 3AN1A 2DENB 2D3AA 2JUOA 3FILB 2GLSA 3TMPB 1UZXB 3RZWC 3B08A 1ROEA 1YIWA 3NS8A 4LK0M 2WXFA 2XBBC 3IXSA 4IWQA 3DPDA 3VUWA 5HFYA 1A5RA 3JW0X 4XDDA 4N6EB 2L8JA 1L6UA 2INDC 4L23A 1EF1A 3IT6B 5D6JB 1OEYJ 3ZGZA 3RNAC 1V97A 2INCC 2KT7A 2HJ8A 1UH6A 2LGDA 3A9JA 3A1QB 3QARA 2BGFA 2ZEQA 3BK1A 3L17A 4HK2A 4YTPB 3RNCC 4W9EA 3AULA 5LXHA 1YOVB 4S17A 4RFBA 3ZTDA 3RN9C 2O2VA 4AOFA 3N1YC 2REXA 3NVZA 3LYYA 1JWAD 2KANA 3W9CB 2IY0B 2L1AA 2WDTB 4UDUC 4RMAA 1FCLA 3CMMB 4DQOC 4DWFA 2K25A 4XC2A 3V60A 2EMTA 4MGIE 4MJSA 2JYTA 3APCA 3KW5B 2LRUA 3P4SB 4JGHB 2FCQA 3A33B 1QLBB 3DBRB 1WJNA 1HE8A 3URYA 1Q5WB 4ANWA 2DX5B 5G2NA 3HHMA 2NVUI 2D10A 2XK5B 5FK9C 4ZRKA 5IN7A 1YQBA 4WURA 4NPNA 2L0FA 1IGDA 1VLBA 2C7MB 2ONQA 4W9IA 3L4PA 2KFKB 4O1NA 4II3B 1YX5B 1GJZA 4KSLC 1TS3A 4TQ1A 4CHKA 1FFUA 1SF0A 3V6CB 1JCKB 4BKTA 2DHZA 4H2AA 4XWTA 5IA7A 2DZIA 2ICIA 1ZDXA 3HM6X 1E10A 1WX8A 1N62A 4RGMA 2MH7A 4YSZB 2KLGA 3PRMB 2KTFA 2LVPA 2RPVA 1TKYA 1J8CA 1IBXA 1ZP0B 2GI9A 2PVGC 1FRRA 1P7EA 4FN2A 2BYTA 3Q8AA 3P42A 5LXIB 3P63A 1WMHB 2L00B 4YSXB 1TKEA 3Q69A 5D2MB 2CHZA 4LJPB 4LCDE 4LNKA 5FR3A 2DYMA 3AE9B 3U30A 3M63B 5CHWA 3FILA 4ASWC 1WSPA 5H92C 3PV1A 5HG2A 4IC7B 4ANUA 1WJ4A 3DVGX 2VH2A 2L52A 3TIXA 2M0AA 1E8YA 4II2B 1FXTB 4AJWA 2J7QB 2AQ2B 2RDBC 1YQ3B 4DHZB 2YEPF 1WGHA 4NAWB 3BYTB 4ANVA 3RNGC 1EM7A 3A1QA 1KRHA 2DYOA 3D32A 3AEGB 2V9HA 3I9V1 1LXDA 1DYQA 2K5PA 4M0WB 4ZHOA 3ZJVA 2HJ1A 2Z0DB 4IWPA 1KF6B 2J0JA 4MSQB 4BKSD 3IAM1 3AECB 1SIJA 1PQSA 3V61A 2IJ0A 2ACZB 1B1ZA 4P16A 1T0YA 2ZW0A 4LLGM 2EELA 3C0RB 2KVZA 2ZZPB 1ISNA 3P2BA 2KMCA 3ZNHB 2W82A 2KK8A 4WQOB 2Z59B 4EOYA 3P4RB 4ZYNA 2C60A 2SAKA 1T0QC 4WJQA 2LWPA 3ZNGC 2A4ZA 2BYFA 4W9DA 1HQRD 2G45B 2JZZA 3BY4B 1JW9D 2MWSB 2KC1A 4BVUC 3B2FA 3V3XA 2HD5B 2XK5A 5MPOA 1C3TA 3NRZA 3OAWA 1EF5A 1NEKB 4HWIB 1V49A 2PJHA 4LNOA 1RFKA 4XWWA 2I38A 4FJYA 2LVQA 4NY0A 1TJEA 4PYZA 3QC8B 3WANA 1P7FA 4HCPB 1HTQA 1PGAA 2MJEA 2O6VD 3U52E 2QDFA 4K7SA 2K9XA 1CZPA 3IHPC 1D3ZA 1YN4A 3IFWB 1SSNA 1Y8RC 2KDBA 2ZJDA 3DBHI 4YTNB 4RGNA 4MH0E 3OWEB 1SB3C 2W3RA 1ENFA 2V3NA 2QEJC 3N9YC 1C77A 1E90A 5DPTA 1WMHA 1ET6A 5D7GA 3Q14C 1CK1A 2R61A 1KLGD 2FUG1 4AUQC 1UWXA 5J17A 4URKA 2KMMA 1WGKA 2JYEA 1OQRA 4GGQA 2IO3B 4ZHPA 4XYCA 1CMXB 1JWUD 1AARA 4OVZA 1Q10A 4HDQA 2NR2A 2BQQA 3DHIC 3TJPA 5G55A 1ZGUB 2H88B 2LJIA 4OHJA 5CHFA 3R3MA 2D3GA 1I4HA 3QQ8B 3ZDMC 2QHOA 1FRDA 4NAWA 1Y56A 4XE0A 3SDLC 2G9HD 3AU5A 1SJHD 2K6DB 4M0WA 1WI0A 2CU1A 2IYDB 3Q6BA 2MBOA 3KVFB 1E7UA 3NJTA 5C1ZA 2VH1A 4X57B 1YMHE 4G11A 3UI3A 4YXDB 4GN1A 2TSSA 2IGDA 4PYUA 3L10B 4S0RA 4A6QA 3ZVVA 4P7IA 4W9KA 1QOAA 3Q8EA 3BINA 1V9JA 2ZNVC 1D5MC 1NI3A 1L4ZB 4IW0A 4WQMA 3N32A 3PHXB 2JZ3B 2WXIA 3VTWA 3R2TA 1VZ7A 3IVFA 1N5XA 3AV8A 3GZNI 2DZJA 4JPSA 1NBFC 1RLFA 2Y5BB 4EZLA 2N1VA 4G0NB 1D4BA 1GB4A 4NQKE 4E74A 4CYEA 3NZ3A 2J0KA 2SEBD 5AEKB 4RM8A 3ZJUA 2LEKA 3Q2AC 4DXGA 2H89B 4FADA 1HTOA 4JWUC 3BVZA 3WAPA 3PO0A 1C79A 1WXVA 4W9GA 1ZW7A 4BZAA 3T8MA 1NYQA 1PGXA 2J42A 1L0VB 3QCAA 3EHVA 1RWSA 2LJ5A 1J7BA 1VCBA 2NMQA 1MI0A 5DPRA 4WJPA 2K22A 2MBEA 3H7PB 3GE3C 2N7EA 2J52A 2W3SA 3RYTA 2V0GA 3CIRB 4KZ0A 4FLHA 4DK5A 3P1MA 4L2YA 1A70A 2BB5A 2AX5A 4REZA 2Y3AA 3AH7A 3IT4B 2QILA 2O2VB 1AN8A 4B95A 5E6JA 3H6NA 2LXCA 1EWCA 4DHJD 4HEA1 4JWSC 2WWZA 3RULA 4GIVA 3T3NA 1KLUD 1ZE3D 2LGSA 3SD5A 1QOBA 1E6EB 3T3OA 1R7SA 1JQ4A 2MJDA 4HPMB 1WH3A 5L83A 1SXTA 1F2RC 3CF6E 3EFCA 1XLNA 4LTUA 5CX3A 2ZPYA 2DLBA 1JWSD 1HZ5A 3RZFA 3ECIA 4I6NB 2KZRA 3VH4B 1LGRA 5AUIA 1MG4A 1WGDA 5LNK1 2M8SA 5IOIA 1FEHA 3TCAA 3AB5A 3W1SC 3RUIB 2JPHA 4WAFA 4CQNA 5L95C 3DBRI 5LLIA 2GMIC 2YLMA 1BMLC 3Q8CA 3MJWA 2R2OA 1V80A 3DBLB 4K1RB 1V1OA 1P1AA 4WWMA 3WAOA 3DOWA 1S3SG 5EE1A 1CJEA 3ONSA 4N59A 5IKCM 3APFA 4GU2A 4GB9A 3VDZA 1V86A 2G4DB 3O13A 1SBBB 2M1MA 1SE4A 2KACA 2MBQA 4MGKE 4ICUA 2EMSA 5HI1A 2PE6B 5G5HA 1I4XA 2XNAC 1TIFA 1V81A 3ALBA 5DPSA 3ZRCA 3ZW3A 2WX0A 3Q3JA 1QOFA 2BW2A 4JQWC 4DXAB 2PEAA 2QCZA 3BVMA 5BMGA 5HKHA 1WXAA 3GOEA 3RCZA 3U8ZA 1KJTA 3VUXA 1LO5D 4HPPA 2OJWA 3OLMD 2BTEA 3WIMA 1KTKA 1GUAB 1M4VA 4FJVB 3PZ7A 2CJOA 1UGMA 2HE7A 3HK0A 4OZBA 2E3TA 3PTFC 1J7CA 3SU8X 2FAZA 4P6VF 3PSEB 3I5JC 4RGTA 3ZJTA 2IO2B 4OZCA 1R4NI 2FCNA 2W9NA 2PVOD 3TEZA 3H7PA 4KDLB 3FAHA 1WZ3A 2MRPA 2Y5PA 3VAWA 4F8CB 1WRIA 2JX5A 3DBSA 3KUDB 1NYRA 2KLCA 3QHTA 1R4MB 2OJRA 2Y5CA 4BBNF 2E6XA 3P4PB 4JLCA 4JE3B 1BT0A 1F2RI 2K39A 4DBGA 5G5GA 1TTNA 3L08A 3GE8C 4MT5A 2K1FA 3IG3A 1QILA 4N9F4 1H4RA 4P1BC 4HLEA 3QWZB 2KO3A 2D11A 2LGXA 3TBLD 3AEFB 3TEWA 3WCQA 2GRIA 2IY1B 3I57A 5BYQA 2NPTA 3U7DA 1EO6A 1FXAA 4ARIA 3NUHB 2KTRB 2X38A 1HEZE 1T6BX 2I2YA 5DCNA 1GG3A 1CQVA 2YVCA 5GMVA 3DCGA 5EE0A 2BS2B 3HM3A 1LFDA 2ZNVB 4FHKA 3VH3B 2BWES 4GOCA 1AYFA 1TY0A 1TY2A 3DDCB 4C00A 3IAS1 3VXWA 3KYCD 2UYZB 4A3PA 3VTVA 3NZUA 2AQ1B 4FHJA 3W5VB 1S1QB 1STEA 3VUYA 4ZRQA 4HKQA 2JRIB 2KX0A 1WWTA 2WDRB 3UF8A 1T0SC 1DOYA 4G3XB 1JRPA 2ON8A 2LASA 4TUUA 2DNFA 4HVBA 2AYOB 4RF1A 1T0RC 4ZDVA 1XQQA 4A3OA 2PLPA 1N5WA 1FMAD 1N6ZA 2L3ZA 1C4PA 3RFZB 3VR9B 3TUOA 1OQYA 4OW0A 1WY8A 1PDXA 4FXCA 4GXBA 1F52A 3B0AA 3NVVA 3PZDA 2JVCA 3OG5A 1FO4A 1F0ZA 1D5ZC 4W9JA 1VD2A 2OEDA 5BMHA 3AE2B 1V5OA 4PS7A 2L05A 2ZCCA 1P98A 4M8NA 4WAAA 5CHVC 1C4AA 4WWPA 3ZXRA 2AEHA 3N3KB 3ZTCA 1V2YA 2IZVB 5C23A 1MPEA 5KHOA 2IPKD 2M4NA 5H8YE 1TZ1A 3PRZA 1PUTA 2DYBA 1DGJA 5JHBA 4NJ7A 3QJZA 4M02A 1RAXA 2KKCA 4HROA 4LDTD 4NAMA 4A55A 2MJ3A 1XLPA 1TT5B 2Z0EB 1ESFA 3U7ZA 1YJJA 5IP4D 1J0GA 2KOXA 4ZRIA 2K0PA 4W9LA 2RDGA 2OOBB 3AXCA 2FIDA 3CSTA 1TZOA 2BKFA 4K3BA 4G50A 3DWGC 1E8XA 2KTRA 2WXLA 5EE3A 1X1MA 2KDFB 3KWVA 3AEDB 4DHZE 3RNEC 2JT4B 3DVNV 4GDLB 3H9DA 3Q3OC 1QT9A 1UD7A 1WGYA 2GBKA 3L16A 1XEEA 3UQBA 1L0XB 4FJZA 3V6EB 3CSFA 1HZ6A 2D2QA 3M95A 1I4QA 4E3CA 2MEKA 2MQJA 3QX1A 2C7NB 4MM3B 2KJRA 2VZKD 3AE7B 2GBJA 2KN4A 3LDZE 4YL8A 1GNUA 1FD6A 2MX2A 4IWOA 5JHAA 4HJGE 4P1CC 4AQ7A 3DQVA 4EEWA 1L5PA 2JZPA 4BOZB 1OTRB 3C8YA 1WFYA 3BIID 2C5LC 5KHQA 4F7ZA 3X23A 3MFGA 1YQ4B 4TSSA 4KGSA 2W55A 3TSSA 1WX9A 1T3QA 2LI5A 3RT3B 4HKZE 3TEYA 1L2NA 3P4QB 3BZDB 2KFJA 3MHSD 2BWFA 5I4DA 4KSKC 4NJCA 2PMVA 5C3JB 3I3TB 2PPHA 4ZRJA 1FNVA 5BYSA 3PREA 1XCQL 2V3PA 4ANXA 1RM6C 2QMTA 3AM9A 4KIKB 2ASQA 1SEBD 2D3BA 2O6VB 5EDSA 4RH6A 1EUVB 4IDIA 3MC9A 3JSVB 3KQ4A 4MELA 1JRUA 4PT5A 1Z2MA 2BPSA 5FKAC 2MBBB 1K53A 1MVKA 3EGRA 2DAJA 1L7YA 1NDDA 1SGHA 3VR8B 4PK1A 4BOSC 2AQ3B 3KYDD 2QSDA 3EC8A 3MP9A 4TV3A 4LNNA 2N7JA 2WXKA 1JROA 4M00A 3Q3MC 1ZXIA 4HJKA 1WGRA 2XN9C 1E9MA 2KDIA 4B9KA 2KJHB 4IOIE 4GDLA 3AU4A 1E8WA 2AL6A 1JWMD 3PLVA 3ZUNA 4KV2A 5BMIA 1XXGA 4ACFA 3WA0A 1C76A 2KYWA 2BS4B 1E5WA 2PTLA 2RD0A 2WXHA 4ARCA 1C78A 4C56C 4BKGA 2QIEB 1ZOYB 2HTME 3QK0A 1IGCA 3NY5A 2ZW1A 4RGOS 1DOXA 4MM3A 1TYGB 1HA5A 1XCTL 3DBHB 4BKSA 5E6NA 1YD8U 4EFOA 2V4LA 4B0MA 3LXFA 2FBWB 1JALA 3UINB 4YWGG 1VZ8A 2KWVB 1WR6E 2CHXA 1WJ6A 1D5XC 4AWJA 5T8IA 1XLQA 4IKGA 5D94A 2KMAA 1HXYD 1WGGA 3ZNID 1XD3B 3ABVB 2MCNB 3ZKJC 4DDID 1R4MI 2RMMA 3GP7A 1WZ0A 2JU6X 2WDQB 2WS3B 1XLOA 1GAQB 3SEBA 2JSVX 4ZRPA 1N63A 2WU2B 3MHZA 1WYGA 3PHWB 3S2AA 1NI2A 2NPTB 3LJ3A 4HDOA 3L54A 1WRDB 3RMKC 3ZNZB 1MG8A 2K6QA 4KIKA 2O6VA 1QQRA 1QF6A 4KX6B 2K3UA 1Z5SB 4N58A 1E8ZA 3N20C 1AW7A 4I6LB 3CWIA 2LMCA 1C1YB 3JSVA 2ZCBA 1K51A 3SR6A 1ZXHA 4TMAB 2FIFA 3H1UA 1UGJA 4ZOHC 2LHEA 3VFKA 1GB1A 3PGEA 2GB1A 2INPE 3N1XC 2KN5A 1F1HA 3BVGA 1IPGA 5C2TB 4A20A 2M19A 2DAFA 3NVYA 4A90A 2XEWA 1UUPA 4J3OD 1VZ6A 2K8BA 3ML8A 4DHJB 3UGBB 5TR5A 3GZNB 3NG0A 1WX7A 4HXDA 2GOWA 1MJDA 2KQ4X 4KGTA 2KDMA 3AEEB 1UELA 2BBCA 4DXFA 2KWUB 3A9KB 4TKNA 2ZVOA 3QAQA 4EE2A 1MHXA 2WU5B 3K9OB 5E6PA 2V3SA 3W2DA 1KM7A 1PFDA 3DHHC 2KDEB 3QA8A 4RNAA 1EU4A 3AEAB 4YTMB 1ZUD2 1WJUA 5FR6A 4MH8A 4LJOB 2AWTA 4XDCA 2JXTA 4W9FA 4AP4C 2K8CA 1WXQA 2WXOA 1RYJA 2NTTA 2D5GA 3TL5A 2J53A 3PRPB 3HIZA 3PLUA 2WQYB 1FFVA 1PYWD 2V4IB 3FC4A 1RRBA 3PVLA 1IUEA 2KWCA 4Q2JA 2LVOA 3AE5B 1YNTE 4M8MA 3R7QA 1FM0D 1VR9A 2MP2B 2G4SA 2KX3A 1VDVA 4IG7B 3V05A 2WGSA 3MC8A 3ZYYX 4LNFA 3VRBB 1WM2A 4JL9A 2WX1A 5AZHA 2OHFA 1U4AA 1I7HA 2BYEA 2KVRA 2NBVB 4GSWA 2JQRB 2QC8A 3APDA 3B9JA 3RD2A 1OQQA 2JWUA 2MA9B 1KOTA 2PKOA 3ZO5B 3R66C 1ACCA 3AE3B 3R2IA 3NOBA 4FA6A 1FIQA 3NHEB 4IM3A 3A4RA 1SE3A 2CJNA 3ENEA 2BKRB 4XZ4A 1P3QU 2WXMA 1N61A 2CKHB 1WM3A 5AZFA 2W54A 2IGGA 3H8HA 2N9XA 1UF0A 3WALA 3KWLA 2FE8A 1RFAA 4USAA 2NS5A 4XGAB 2IGHA 1WYWB 1MHHE 1C4CA 3KUZA 2HTHA 3JVZX 1FXIA 5JZEB 4WH4A 1N60A 2I1KA 1I35A 3BWUD 4PS8A 2I1JA 4GMVA 3RNFC 2RGFA 5IAAC 3DVNU 4QAYA 2KXJA 2DWQA 1UWMA 1WF9A 1V1PB 1K8RB 3A9KA 1UBIA 4EZKA 2UU7A 1J19A 1LM8B 2KAJA 5D3IB 4NNJB 1SE9A 1Q0WB 2B76B 2LGIA 2BF8B 1KFYB 1QKZA 1NVID 5JH5C 1WE7A 3N30A 2CHWA 4EZJA 2RPQA 3UIPB 3EECA 4GDKB 2FCMA 2MLBA 4ITKA 2FNJB 4RF0A 1I4RA 3PT2B 1GC7A 4C80A 5DPWA 3PPAA 3R8BA 3EFUA 3WAMA 2LUMA 1R4NB 2LHDA 2V1YA 2GBNA 3N1ZC 3MC0B 4I6PA 2FCSA 4MEMA 3O65B 4D2KA 5J18A 1SE2A 4E71A 2CR5A 1L4DB 3DVGY 1UNSA 2MP2A 3OJ4B 1IP9A 1GC6A 3W1YA 4CO7A 4J6IA 1D6EC 2CS4A 3AE1B 2KJ6A 3L13A 3R7RA 4FBJB 3TEXA 3EUB2 1WXMA 1JMLA 4XX5A 4R3DA 3B1LX 2R2QA 2PE9A 4WJOA 2NTSA 2WXRA 3HRDD 3SFEB 3VVWB 1GPXA 1Q1OA 1PGBA 1I4GA 3K9PB 2WXPA 3ZXVA 1EWYC 3DWMA 4HPLB 2Z8LA 2C7HA 4MACA 4K3CA 4B0EA 1FPYA 3X0WA 3PZ8A 1ZKHA 1P0RA 3ETRA 2J4XA 1XO3A 4JIOU 4IM0A 1UBQA 2CU3A 4FULA 2L83A 1H8CA 3I63C 1WXSA 1YN3A 1F77A 3SHQA 2VRRB 4WWOA 3RI7C 2DBYA 1GOZA 2KFKA 3DHGC 2IDYA 4YSYB 3E9SA 2BS3B 4F1SA 3UIOB 2JRHA 5BYRA 2G3QB 4NZLB 2DZMA 1J7AA 3W5UB 3QIJA 3VQIA 3AE6B 4MSMB 4LDTB 1JWBD 4EUTA 3ZIMA 1XT9B 4AS1A 2ZPNA 3KH0A 1V8CA 1E7PB 4NQLB 1DOIA 1L6VA 1V1PA 3V62A 2UWQA 1FNUA 2ZVNA 4A8XC 2EKEC 3IBEA 4ICVA 1AWDA 3AE4B 5HHDG 3Q8BA 2WNMA 3J9CA 1OEYA 4WJNA 2PW9A 2N9PC 1VRAB 3H7SA 4GDKA 3GB1A 1FCCC 2KHWB 1MFWA 3U2SC 1ZDVA 2YEPB 2L7RA
chains in the Genus database with same CATH topology
2MCNB 3ZKJC 2IBIB 2IO0B 3ZLZA 4EKUA 4DDID 2C9WB 4DHZB 1R4MI 2OJRA 1WGHA 4BBNF 3UQAA 4MGYE 1WZ0A 4JLCA 4NAWB 4ANVA 3A1QA 1BT0A 2DYOA 2K39A 2LRWA 4DBGA 2K8HA 1TTNA 3D32A 3L08A 1LXDA 3PHWB 3S2AA 4K7WA 1NI2A 3L0WB 4M0WB 4W9HA 2NPTB 5J2RA 2K1FA 3IG3A 3LJ3A 2Z0DB 4N9F4 4IWPA 1H4RA 4HDOA 4HLEA 3L54A 1P9DU 1WRDB 2J0JA 4MSQB 3QWZB 4BKSD 3ZNZB 4DDGD 2KO3A 1IYFA 3ZDTA 2D11A 1TGZB 2LGXA 3TBLD 1PQSA 4W9CA 1MG8A 2KNBA 3V61A 2IY1B 4AJYB 2FUHB 2K6QA 1T0YA 4KIKA 2O6VA 2NBUA 2NPTA 3U7DA 1EO6A 3M3JA 3C0RB 2ZZPB 4HCNB 1ISNA 3P2BA 2KMCA 1Z5SB 5CTRC 3ZNHB 2KTRB 1E8ZA 2KK8A 4I6LB 4WQOB 2Z59B 3VHTC 1C1YB 2GBRA 2ZCBA 3JSVA 4EOYA 3DBLI 5DCNA 1GG3A 1YX6B 2FIFA 3H1UA 2C60A 2M17A 4ZYNA 3W1SA 1WR1A 2YVCA 3VFKA 4WJQA 3PGEA 2LWPA 3ZNGC 2J0MA 2A4ZA 2DZKA 3DCGA 3AI5A 2BYFA 5GMVA 5BO4B 4W9DA 2G45B 2JZZA 3BY4B 2KN5A 2MWSB 2A5UA 2KC1A 4BVUC 2KD0A 1IPGA 2L76A 2JY6A 4A20A 2HD5B 2XK5A 3HM3A 4OVVA 1LFDA 2ZNVB 4FHKA 3VH3B 2DAFA 2BWES 1C3TA 4GOCA 2JF5A 1F9JA 3ZRFA 2KQ7A 2XEWA 3OAWA 1EF5A 4NJ6A 1LQBA 3DDCB 4HWIB 2K8BA 3ML8A 4DHJB 3VXWA 3KYCD 2UYZB 3UGBB 4A3PA 3NZSA 3VTVA 1V49A 3NZUA 2PJHA 5TR5A 4FHJA 1WX7A 4FJYA 2GOWA 2LVQA 4HXDA 1S1QB 4NY0A 3VUYA 2LGYA 4PYZA 3QC8B 2JRIB 1UELA 2KX0A 5E6OA 3UF8A 4K81A 2MSED 3WANA 2KWUB 2D07B 3A9KB 4G3XB 4TQ0A 2WYQA 2ZVOA 2LASA 3QAQA 4HCPB 4TKNA 4TUUA 5AZGA 3Q3FA 2LZ6A 3K9OB 4HVBA 2AYOB 2O6VD 2V3SA 5E6PA 1V6EA 2AL3A 1KM7A 2KDEB 3QA8A 4ZDVA 4K7SA 4KDIC 3IHPC 1XQQA 1D3ZA 3OJ3A 3IFWB 1KLVA 4A3OA 1Y8RC 2KDBA 1WJUA 2ZJDA 3DBHI 5FR6A 4MH0E 2L3ZA 4LJOB 2JXXA 2AWTA 2N4FA 4W9FA 4AP4C 1OQYA 2K8CA 1E90A 5DPTA 3VTUA 1WMHA 1E7VA 1WY8A 4AJWA 2LUEA 3TL5A 5D7GA 3PRPB 3M62B 4GXBA 3B0AA 3HIZA 2M0XA 3PLUA 3PZDA 2JVCA 4AUQC 3A9JB 2NBWB 4W9JA 2KC2A 1VD2A 5J17A 4URKA 1RRBA 3PVLA 1V5OA 3JYUA 4PS7A 2KWCA 2LVOA 4GGQA 4BBNC 2L05A 4B6WA 2ZCCA 4M8MA 3R7QA 1P98A 2IO3B 1CMXB 4M8NA 2MP2B 2LD9A 2G4SA 2KX3A 4WAAA 5CHVC 1AARA 1TBEA 4IG7B 2N9EB 4KVGB 4HDQA 2NR2A 3TJPA 4WWPA 5G55A 1ZGUB 2AEHA 3N3KB 3ZTCA 1V2YA 2IZVB 5C23A 1WE6A 1WM2A 4JL9A 2WX1A 5CHFA 5AZHA 5KHOA 3R3MA 4MDKE 2D3GA 2M4NA 2RSUA 1U4AA 1TZ1A 2BYEA 2JWZA 2KVRA 2NBVB 2DYBA 3PRZA 3QQ8B 2QHOA 4GSWA 3ZDMC 5JHBA 3MTNB 4NJ7A 4MJSB 4NAWA 3ML9A 2N1WA 3SDLC 3QJZA 3PS6A 1RAXA 2KKCA 2GBMA 4LDTD 3AU5A 1M94A 2N7DA 2K6DB 1G6JA 2NCNA 2Z0EB 1WI0A 3APDA 2CU1A 2IYDB 3RD2A 1J0GA 2KQSA 2MA9B 1V5TA 2MBOA 2KOXA 2IO1B 3KVFB 4K7UA 4ZRIA 1KOTA 2MW5A 3ZO5B 1E7UA 3R66C 4W9LA 2LXAA 5C1ZA 4MGZE 4X57B 2MBHA 4G11A 2OOBB 3NOBA 4RM9A 4FA6A 3AXCA 4GN1A 2FIDA 4PYUA 3CSTA 3L10B 3NHEB 1WIAA 2BKFA 4IM3A 1I35A 3A4RA 1OGWA 4IUMB 4G50A 3ZVVA 4P7IA 4W9KA 1E8XA 2BYVE 2KTRA 4PS3A 3BINA 3ENEA 1V9JA 2BKRB 1X1MA 2KDFB 2ZNVC 4XZ4A 4DHZE 1P3QU 2JT4B 3DVNV 4IW0A 2CKHB 4GDLB 3H9DA 1WM3A 3N32A 2L0TA 3PHXB 2JZ3B 1WGYA 1UD7A 5AZFA 3VTWA 4BFRA 3IVFA 2GBKA 2N9XA 3L16A 3KUCB 1SIFA 3GZNI 3WALA 2DZJA 3UQBA 4FJZA 3V6EB 1NBFC 1RLFA 1YJ1A 1RFAA 3CSFA 2Y5BB 2D2QA 2NS5A 4EZLA 2N1VA 3M95A 1WYWB 4G0NB 3KUZA 2HTHA 3JVZX 3T9LA 2B3AA 4NQKE 4E3CA 4E74A 5JZEB 3A4SC 2I1KA 2RR9A 4OVUA 4CYEA 2J0KA 2MQJA 2I1JA 4GMVA 3QX1A 4KZCA 4PS8A 4RM8A 4WWNA 5AEKB 1I42A 2C7NB 2RGFA 5IAAC 3DVNU 2KXJA 2KJRA 4FADA 1QZEA 4IM2A 3WAPA 1WF9A 1WXVA 2GBJA 4W9GA 1K8RB 2DENB 3LDZE 3A9KA 1UBIA 1ZW7A 4YL8A 4EZKA 1GNUA 3T8MA 1J19A 1LM8B 4NNJB 1SE9A 2JUOA 2MX2A 3QCAA 1Q0WB 3EHVA 4IWOA 5JHAA 3TMPB 1UZXB 3RZWC 2BF8B 2LJ5A 3B08A 3DQVA 4EEWA 1VCBA 5JH5C 5DPRA 1WE7A 3N30A 4WJPA 1YIWA 2CHWA 4EZJA 2RPQA 3NS8A 3UIPB 3EECA 4GDKB 2FCMA 2XBBC 2MLBA 4BOZB 1OTRB 2FNJB 2MBEA 3H7PB 4IWQA 2N7EA 3RYTA 1WFYA 3DPDA 3VUWA 2C5LC 3PT2B 1GC7A 5DPWA 5KHQA 4KZ0A 4F7ZA 1A5RA 3JW0X 3PPAA 3X23A 4FLHA 4DK5A 2L8JA 3EFUA 3WAMA 1EF1A 5D6JB 1OEYJ 2V1YA 2GBNA 1WX9A 2O2VB 4B95A 2LI5A 4I6PA 3RT3B 2HJ8A 3H6NA 1UH6A 2LGDA 2LXCA 3A9JA 3A1QB 3QARA 2BGFA 2FCSA 2ZEQA 1L2NA 4MEMA 4DHJD 3O65B 2KFJA 3L17A 4HK2A 5J18A 2WWZA 4W9EA 3AULA 3RULA 3MHSD 4E71A 4GIVA 5LXHA 2BWFA 4KSKC 2CR5A 3I3TB 3ZTDA 2PPHA 3SD5A 4ZRJA 3DVGY 2MP2A 3OJ4B 2O2VA 3PREA 1GC6A 4HPMB 1WH3A 1IP9A 5L83A 4AOFA 3W1YA 3CF6E 4CO7A 4J6IA 4ANXA 2REXA 2CS4A 2KANA 2KJ6A 5CX3A 2IY0B 2WDTB 4RMAA 2ZPYA 3L13A 4KIKB 2ASQA 3R7RA 4FBJB 2O6VB 3CMMB 3RZFA 3ECIA 4DWFA 4I6NB 2KZRA 3VH4B 1WXMA 1WGDA 2K25A 5EDSA 4XC2A 4XX5A 1EUVB 3V60A 2EMTA 4MGIE 4MJSA 3JSVB 2M8SA 3APCA 3B1LX 2R2QA 2PE9A 4WJOA 3KW5B 4MELA 2LRUA 4JGHB 3TCAA 2FCQA 1JRUA 3A33B 3VVWB 1Q1OA 3W1SC 1Z2MA 1WJNA 3RUIB 1HE8A 2BPSA 3K9PB 2JPHA 2MBBB 5L95C 3DBRI 5LLIA 4HPLB 1Q5WB 4ANWA 2GMIC 2C7HA 2DX5B 2YLMA 5G2NA 3X0WA 3HHMA 2R2OA 3MJWA 1V80A 2DAJA 2NVUI 2D10A 1ZKHA 2XK5B 1L7YA 1NDDA 1SGHA 1YQBA 1P0RA 4K1RB 4ZRKA 1P1AA 4NPNA 3WAOA 2L0FA 4JIOU 2C7MB 4BOSC 3DOWA 4IM0A 4W9IA 1UBQA 1S3SG 3KYDD 2KFKB 3ONSA 4II3B 3EC8A 1YX5B 4FULA 1GJZA 1H8CA 4TV3A 3APFA 4GU2A 4GB9A 4KSLC 3VDZA 1WXSA 1V86A 2G4DB 4TQ1A 4CHKA 2M1MA 3SHQA 2MBQA 4MGKE 3V6CB 2VRRB 4WWOA 4ICUA 4HJKA 2EMSA 4BKTA 2DHZA 1WGRA 5IA7A 2PE6B 2KDIA 4B9KA 2KJHB 1V81A 2DZIA 4GDLA 3AU4A 3ALBA 5DPSA 1E8WA 2KFKA 3ZRCA 3ZW3A 2AL6A 3HM6X 3PLVA 3ZUNA 2WX0A 1WX8A 3Q3JA 4JQWC 4KV2A 4DXAB 2PEAA 4F1SA 3UIOB 2KLGA 3PRMB 2JRHA 1WXAA 2KTFA 2LVPA 3GOEA 3RCZA 3U8ZA 3WA0A 5HKHA 2G3QB 1KJTA 2DZMA 3VUXA 1E5WA 2RD0A 1J8CA 3QIJA 3VQIA 4BKGA 4MSMB 3OLMD 4LDTB 4FN2A 3WIMA 1GUAB 3QK0A 4FJVB 3NY5A 4EUTA 5LXIB 1WMHB 4MM3A 2L00B 1XT9B 3ZIMA 2ZPNA 3KH0A 5D2MB 4NQLB 4BKSA 2CHZA 1UGMA 4LJPB 2HE7A 4LCDE 5E6NA 2UWQA 3V62A 3HK0A 1YD8U 2ZVNA 2DYMA 2EKEC 3IBEA 4ICVA 3PTFC 3U30A 3M63B 3SU8X 4EFOA 5CHWA 2V4LA 4ASWC 2FAZA 1OEYA 3PSEB 3PV1A 4WJNA 3UINB 2N9PC 4IC7B 2IO2B 2KWVB 3H7SA 4ANUA 1WR6E 2CHXA 1R4NI 1WJ6A 1WJ4A 2FCNA 4GDKA 2W9NA 3DVGX 3H7PA 4AWJA 2KHWB 5D94A 4KDLB 2KMAA 3TIXA 1WZ3A 2MRPA 3VAWA 1E8YA 4F8CB 1WGGA 4II2B 1FXTB 2L7RA 3DBSA 1XD3B 3KUDB 3ZNID 2KLCA 3QHTA 2J7QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MCN B;  3ZKJ C;  2IBI B;  2IO0 B;  3ZLZ A;  4EKU A;  4DDI D;  2C9W B;  4DHZ B;  1R4M I;  2OJR A;  1WGH A;  4BBN F;  3UQA A;  4MGY E;  1WZ0 A;  4JLC A;  4NAW B;  4ANV A;  3A1Q A;  1BT0 A;  2DYO A;  2K39 A;  2LRW A;  4DBG A;  2K8H A;  1TTN A;  3D32 A;  3L08 A;  1LXD A;  3PHW B;  3S2A A;  4K7W A;  1NI2 A;  3L0W B;  4M0W B;  4W9H A;  2NPT B;  5J2R A;  2K1F A;  3IG3 A;  3LJ3 A;  2Z0D B;  4N9F 4;  4IWP A;  1H4R A;  4HDO A;  4HLE A;  3L54 A;  1P9D U;  1WRD B;  2J0J A;  4MSQ B;  3QWZ B;  4BKS D;  3ZNZ B;  4DDG D;  2KO3 A;  1IYF A;  3ZDT A;  2D11 A;  1TGZ B;  2LGX A;  3TBL D;  1PQS A;  4W9C A;  1MG8 A;  2KNB A;  3V61 A;  2IY1 B;  4AJY B;  2FUH B;  2K6Q A;  1T0Y A;  4KIK A;  2O6V A;  2NBU A;  2NPT A;  3U7D A;  1EO6 A;  3M3J A;  3C0R B;  2ZZP B;  4HCN B;  1ISN A;  3P2B A;  2KMC A;  1Z5S B;  5CTR C;  3ZNH B;  2KTR B;  1E8Z A;  2KK8 A;  4I6L B;  4WQO B;  2Z59 B;  3VHT C;  1C1Y B;  2GBR A;  2ZCB A;  3JSV A;  4EOY A;  3DBL I;  5DCN A;  1GG3 A;  1YX6 B;  2FIF A;  3H1U A;  2C60 A;  2M17 A;  4ZYN A;  3W1S A;  1WR1 A;  2YVC A;  3VFK A;  4WJQ A;  3PGE A;  2LWP A;  3ZNG C;  2J0M A;  2A4Z A;  2DZK A;  3DCG A;  3AI5 A;  2BYF A;  5GMV A;  5BO4 B;  4W9D A;  2G45 B;  2JZZ A;  3BY4 B;  2KN5 A;  2MWS B;  2A5U A;  2KC1 A;  4BVU C;  2KD0 A;  1IPG A;  2L76 A;  2JY6 A;  4A20 A;  2HD5 B;  2XK5 A;  3HM3 A;  4OVV A;  1LFD A;  2ZNV B;  4FHK A;  3VH3 B;  2DAF A;  2BWE S;  1C3T A;  4GOC A;  2JF5 A;  1F9J A;  3ZRF A;  2KQ7 A;  2XEW A;  3OAW A;  1EF5 A;  4NJ6 A;  1LQB A;  3DDC B;  4HWI B;  2K8B A;  3ML8 A;  4DHJ B;  3VXW A;  3KYC D;  2UYZ B;  3UGB B;  4A3P A;  3NZS A;  3VTV A;  1V49 A;  3NZU A;  2PJH A;  5TR5 A;  4FHJ A;  1WX7 A;  4FJY A;  2GOW A;  2LVQ A;  4HXD A;  1S1Q B;  4NY0 A;  3VUY A;  2LGY A;  4PYZ A;  3QC8 B;  2JRI B;  1UEL A;  2KX0 A;  5E6O A;  3UF8 A;  4K81 A;  2MSE D;  3WAN A;  2KWU B;  2D07 B;  3A9K B;  4G3X B;  4TQ0 A;  2WYQ A;  2ZVO A;  2LAS A;  3QAQ A;  4HCP B;  4TKN A;  4TUU A;  5AZG A;  3Q3F A;  2LZ6 A;  3K9O B;  4HVB A;  2AYO B;  2O6V D;  2V3S A;  5E6P A;  1V6E A;  2AL3 A;  1KM7 A;  2KDE B;  3QA8 A;  4ZDV A;  4K7S A;  4KDI C;  3IHP C;  1XQQ A;  1D3Z A;  3OJ3 A;  3IFW B;  1KLV A;  4A3O A;  1Y8R C;  2KDB A;  1WJU A;  2ZJD A;  3DBH I;  5FR6 A;  4MH0 E;  2L3Z A;  4LJO B;  2JXX A;  2AWT A;  2N4F A;  4W9F A;  4AP4 C;  1OQY A;  2K8C A;  1E90 A;  5DPT A;  3VTU A;  1WMH A;  1E7V A;  1WY8 A;  4AJW A;  2LUE A;  3TL5 A;  5D7G A;  3PRP B;  3M62 B;  4GXB A;  3B0A A;  3HIZ A;  2M0X A;  3PLU A;  3PZD A;  2JVC A;  4AUQ C;  3A9J B;  2NBW B;  4W9J A;  2KC2 A;  1VD2 A;  5J17 A;  4URK A;  1RRB A;  3PVL A;  1V5O A;  3JYU A;  4PS7 A;  2KWC A;  2LVO A;  4GGQ A;  4BBN C;  2L05 A;  4B6W A;  2ZCC A;  4M8M A;  3R7Q A;  1P98 A;  2IO3 B;  1CMX B;  4M8N A;  2MP2 B;  2LD9 A;  2G4S A;  2KX3 A;  4WAA A;  5CHV C;  1AAR A;  1TBE A;  4IG7 B;  2N9E B;  4KVG B;  4HDQ A;  2NR2 A;  3TJP A;  4WWP A;  5G55 A;  1ZGU B;  2AEH A;  3N3K B;  3ZTC A;  1V2Y A;  2IZV B;  5C23 A;  1WE6 A;  1WM2 A;  4JL9 A;  2WX1 A;  5CHF A;  5AZH A;  5KHO A;  3R3M A;  4MDK E;  2D3G A;  2M4N A;  2RSU A;  1U4A A;  1TZ1 A;  2BYE A;  2JWZ A;  2KVR A;  2NBV B;  2DYB A;  3PRZ A;  3QQ8 B;  2QHO A;  4GSW A;  3ZDM C;  5JHB A;  3MTN B;  4NJ7 A;  4MJS B;  4NAW A;  3ML9 A;  2N1W A;  3SDL C;  3QJZ A;  3PS6 A;  1RAX A;  2KKC A;  2GBM A;  4LDT D;  3AU5 A;  1M94 A;  2N7D A;  2K6D B;  1G6J A;  2NCN A;  2Z0E B;  1WI0 A;  3APD A;  2CU1 A;  2IYD B;  3RD2 A;  1J0G A;  2KQS A;  2MA9 B;  1V5T A;  2MBO A;  2KOX A;  2IO1 B;  3KVF B;  4K7U A;  4ZRI A;  1KOT A;  2MW5 A;  3ZO5 B;  1E7U A;  3R66 C;  4W9L A;  2LXA A;  5C1Z A;  4MGZ E;  4X57 B;  2MBH A;  4G11 A;  2OOB B;  3NOB A;  4RM9 A;  4FA6 A;  3AXC A;  4GN1 A;  2FID A;  4PYU A;  3CST A;  3L10 B;  3NHE B;  1WIA A;  2BKF A;  4IM3 A;  1I35 A;  3A4R A;  1OGW A;  4IUM B;  4G50 A;  3ZVV A;  4P7I A;  4W9K A;  1E8X A;  2BYV E;  2KTR A;  4PS3 A;  3BIN A;  3ENE A;  1V9J A;  2BKR B;  1X1M A;  2KDF B;  2ZNV C;  4XZ4 A;  4DHZ E;  1P3Q U;  2JT4 B;  3DVN V;  4IW0 A;  2CKH B;  4GDL B;  3H9D A;  1WM3 A;  3N32 A;  2L0T A;  3PHX B;  2JZ3 B;  1WGY A;  1UD7 A;  5AZF A;  3VTW A;  4BFR A;  3IVF A;  2GBK A;  2N9X A;  3L16 A;  3KUC B;  1SIF A;  3GZN I;  3WAL A;  2DZJ A;  3UQB A;  4FJZ A;  3V6E B;  1NBF C;  1RLF A;  1YJ1 A;  1RFA A;  3CSF A;  2Y5B B;  2D2Q A;  2NS5 A;  4EZL A;  2N1V A;  3M95 A;  1WYW B;  4G0N B;  3KUZ A;  2HTH A;  3JVZ X;  3T9L A;  2B3A A;  4NQK E;  4E3C A;  4E74 A;  5JZE B;  3A4S C;  2I1K A;  2RR9 A;  4OVU A;  4CYE A;  2J0K A;  2MQJ A;  2I1J A;  4GMV A;  3QX1 A;  4KZC A;  4PS8 A;  4RM8 A;  4WWN A;  5AEK B;  1I42 A;  2C7N B;  2RGF A;  5IAA C;  3DVN U;  2KXJ A;  2KJR A;  4FAD A;  1QZE A;  4IM2 A;  3WAP A;  1WF9 A;  1WXV A;  2GBJ A;  4W9G A;  1K8R B;  2DEN B;  3LDZ E;  3A9K A;  1UBI A;  1ZW7 A;  4YL8 A;  4EZK A;  1GNU A;  3T8M A;  1J19 A;  1LM8 B;  4NNJ B;  1SE9 A;  2JUO A;  2MX2 A;  3QCA A;  1Q0W B;  3EHV A;  4IWO A;  5JHA A;  3TMP B;  1UZX B;  3RZW C;  2BF8 B;  2LJ5 A;  3B08 A;  3DQV A;  4EEW A;  1VCB A;  5JH5 C;  5DPR A;  1WE7 A;  3N30 A;  4WJP A;  1YIW A;  2CHW A;  4EZJ A;  2RPQ A;  3NS8 A;  3UIP B;  3EEC A;  4GDK B;  2FCM A;  2XBB C;  2MLB A;  4BOZ B;  1OTR B;  2FNJ B;  2MBE A;  3H7P B;  4IWQ A;  2N7E A;  3RYT A;  1WFY A;  3DPD A;  3VUW A;  2C5L C;  3PT2 B;  1GC7 A;  5DPW A;  5KHQ A;  4KZ0 A;  4F7Z A;  1A5R A;  3JW0 X;  3PPA A;  3X23 A;  4FLH A;  4DK5 A;  2L8J A;  3EFU A;  3WAM A;  1EF1 A;  5D6J B;  1OEY J;  2V1Y A;  2GBN A;  1WX9 A;  2O2V B;  4B95 A;  2LI5 A;  4I6P A;  3RT3 B;  2HJ8 A;  3H6N A;  1UH6 A;  2LGD A;  2LXC A;  3A9J A;  3A1Q B;  3QAR A;  2BGF A;  2FCS A;  2ZEQ A;  1L2N A;  4MEM A;  4DHJ D;  3O65 B;  2KFJ A;  3L17 A;  4HK2 A;  5J18 A;  2WWZ A;  4W9E A;  3AUL A;  3RUL A;  3MHS D;  4E71 A;  4GIV A;  5LXH A;  2BWF A;  4KSK C;  2CR5 A;  3I3T B;  3ZTD A;  2PPH A;  3SD5 A;  4ZRJ A;  3DVG Y;  2MP2 A;  3OJ4 B;  2O2V A;  3PRE A;  1GC6 A;  4HPM B;  1WH3 A;  1IP9 A;  5L83 A;  4AOF A;  3W1Y A;  3CF6 E;  4CO7 A;  4J6I A;  4ANX A;  2REX A;  2CS4 A;  2KAN A;  2KJ6 A;  5CX3 A;  2IY0 B;  2WDT B;  4RMA A;  2ZPY A;  3L13 A;  4KIK B;  2ASQ A;  3R7R A;  4FBJ B;  2O6V B;  3CMM B;  3RZF A;  3ECI A;  4DWF A;  4I6N B;  2KZR A;  3VH4 B;  1WXM A;  1WGD A;  2K25 A;  5EDS A;  4XC2 A;  4XX5 A;  1EUV B;  3V60 A;  2EMT A;  4MGI E;  4MJS A;  3JSV B;  2M8S A;  3APC A;  3B1L X;  2R2Q A;  2PE9 A;  4WJO A;  3KW5 B;  4MEL A;  2LRU A;  4JGH B;  3TCA A;  2FCQ A;  1JRU A;  3A33 B;  3VVW B;  1Q1O A;  3W1S C;  1Z2M A;  1WJN A;  3RUI B;  1HE8 A;  2BPS A;  3K9P B;  2JPH A;  2MBB B;  5L95 C;  3DBR I;  5LLI A;  4HPL B;  1Q5W B;  4ANW A;  2GMI C;  2C7H A;  2DX5 B;  2YLM A;  5G2N A;  3X0W A;  3HHM A;  2R2O A;  3MJW A;  1V80 A;  2DAJ A;  2NVU I;  2D10 A;  1ZKH A;  2XK5 B;  1L7Y A;  1NDD A;  1SGH A;  1YQB A;  1P0R A;  4K1R B;  4ZRK A;  1P1A A;  4NPN A;  3WAO A;  2L0F A;  4JIO U;  2C7M B;  4BOS C;  3DOW A;  4IM0 A;  4W9I A;  1UBQ A;  1S3S G;  3KYD D;  2KFK B;  3ONS A;  4II3 B;  3EC8 A;  1YX5 B;  4FUL A;  1GJZ A;  1H8C A;  4TV3 A;  3APF A;  4GU2 A;  4GB9 A;  4KSL C;  3VDZ A;  1WXS A;  1V86 A;  2G4D B;  4TQ1 A;  4CHK A;  2M1M A;  3SHQ A;  2MBQ A;  4MGK E;  3V6C B;  2VRR B;  4WWO A;  4ICU A;  4HJK A;  2EMS A;  4BKT A;  2DHZ A;  1WGR A;  5IA7 A;  2PE6 B;  2KDI A;  4B9K A;  2KJH B;  1V81 A;  2DZI A;  4GDL A;  3AU4 A;  3ALB A;  5DPS A;  1E8W A;  2KFK A;  3ZRC A;  3ZW3 A;  2AL6 A;  3HM6 X;  3PLV A;  3ZUN A;  2WX0 A;  1WX8 A;  3Q3J A;  4JQW C;  4KV2 A;  4DXA B;  2PEA A;  4F1S A;  3UIO B;  2KLG A;  3PRM B;  2JRH A;  1WXA A;  2KTF A;  2LVP A;  3GOE A;  3RCZ A;  3U8Z A;  3WA0 A;  5HKH A;  2G3Q B;  1KJT A;  2DZM A;  3VUX A;  1E5W A;  2RD0 A;  1J8C A;  3QIJ A;  3VQI A;  4BKG A;  4MSM B;  3OLM D;  4LDT B;  4FN2 A;  3WIM A;  1GUA B;  3QK0 A;  4FJV B;  3NY5 A;  4EUT A;  5LXI B;  1WMH B;  4MM3 A;  2L00 B;  1XT9 B;  3ZIM A;  2ZPN A;  3KH0 A;  5D2M B;  4NQL B;  4BKS A;  2CHZ A;  1UGM A;  4LJP B;  2HE7 A;  4LCD E;  5E6N A;  2UWQ A;  3V62 A;  3HK0 A;  1YD8 U;  2ZVN A;  2DYM A;  2EKE C;  3IBE A;  4ICV A;  3PTF C;  3U30 A;  3M63 B;  3SU8 X;  4EFO A;  5CHW A;  2V4L A;  4ASW C;  2FAZ A;  1OEY A;  3PSE B;  3PV1 A;  4WJN A;  3UIN B;  2N9P C;  4IC7 B;  2IO2 B;  2KWV B;  3H7S A;  4ANU A;  1WR6 E;  2CHX A;  1R4N I;  1WJ6 A;  1WJ4 A;  2FCN A;  4GDK A;  2W9N A;  3DVG X;  3H7P A;  4AWJ A;  2KHW B;  5D94 A;  4KDL B;  2KMA A;  3TIX A;  1WZ3 A;  2MRP A;  3VAW A;  1E8Y A;  4F8C B;  1WGG A;  4II2 B;  1FXT B;  2L7R A;  3DBS A;  1XD3 B;  3KUD B;  3ZNI D;  2KLC A;  3QHT A;  2J7Q B; 
#chains in the Genus database with same CATH topology
 2IBI B;  2IO0 B;  3ZLZ A;  4EKU A;  3E56 A;  2C9W B;  2WXQ A;  1FNW A;  3UQA A;  4MGY E;  2WHI A;  3NS1 A;  2EKI A;  4A9A A;  1L0Y B;  2LRW A;  5GXG B;  2K8H A;  2N0S B;  4K7W A;  2G1E A;  3L0W B;  4W9H A;  5J2R A;  1XF5 L;  4L1B A;  2WLB A;  1ET9 A;  5EE9 A;  1P9D U;  4DDG D;  1VJK A;  2VZK B;  1IYF A;  3ZDT A;  1TGZ B;  4ZYS A;  1QOG A;  4W9C A;  4C4V B;  2KNB A;  4AJY B;  2FUH B;  1TS2 A;  1OFF A;  3FKY A;  2NBU A;  3M3J A;  4HCN B;  3AE8 B;  5CTR C;  3VHT C;  2GBR A;  3DBL I;  1YX6 B;  3W1S A;  2M17 A;  1WR1 A;  2J0M A;  5BO4 B;  2DZK A;  2PIA A;  3AI5 A;  1YJI A;  2A5U A;  4LNI A;  3AEB B;  2KD0 A;  1TKG A;  2L76 A;  2JY6 A;  4C7Z A;  4OVV A;  4KKI A;  2JF5 A;  1F9J A;  3ZRF A;  2KQ7 A;  2M56 B;  4NJ6 A;  1LQB A;  3NZS A;  4HRS A;  2LGY A;  5E6O A;  3C19 A;  4K81 A;  1K50 A;  2MSE D;  3HUI A;  2D07 B;  2KWD A;  4TQ0 A;  2WYQ A;  5AZG A;  3Q3F A;  2LZ6 A;  2WP9 B;  3MJ5 A;  2HDE A;  1V6E A;  2AL3 A;  2WDV B;  2BVC A;  4KDI C;  3OJ3 A;  3RNB C;  1KLV A;  5IO9 A;  2JXX A;  3ZQ4 A;  2N4F A;  1B9R A;  3LB8 C;  5AUK A;  1BXT A;  1K52 A;  3VTU A;  1E7V A;  2LUE A;  3M62 B;  3U4E G;  2M0X A;  4M01 A;  2Q5W D;  1KH0 A;  3A9J B;  3KLS X;  2NBW B;  2KC2 A;  3Q8F A;  3HVZ A;  1E0Z A;  2N9K A;  3JYU A;  2WXJ A;  2D3C A;  4BBN C;  4B6W A;  2QJL A;  3B2G A;  2WXN A;  2L32 A;  2RDH A;  3GS2 A;  2WXG A;  2LD9 A;  2N9L A;  1TBE A;  5D3D A;  4YT0 B;  1TS4 A;  2MHJ A;  2N9E B;  4KGR A;  4KVG B;  1WE6 A;  4MDK E;  3BK2 A;  1YN5 A;  2RSU A;  2JWZ A;  4JX1 C;  1BUI C;  4C7Y A;  4US9 A;  1T5X D;  3MTN B;  4MJS B;  3ML9 A;  2N1W A;  1NEN B;  3PS6 A;  3NVW A;  2GBM A;  2LFI A;  1M94 A;  1ZPS A;  2N7D A;  5TSS A;  1G6J A;  2NCN A;  2KQS A;  1V5T A;  2IO1 B;  4K7U A;  3VRA B;  2MW5 A;  3HVD A;  2INN E;  2LXA A;  4OZA A;  4MGZ E;  1C9F A;  2MBH A;  4C4V A;  3BYY B;  4RM9 A;  5JXV A;  1WIA A;  3RPF C;  1OGW A;  4IUM B;  2BYV E;  4PS3 A;  4RCO A;  1TS5 A;  1SJE D;  4WIP A;  4GLS C;  3SFD B;  2L0T A;  4US8 A;  4BFR A;  3KUC B;  1SIF A;  1I4P A;  1YJ1 A;  3Q3N C;  2X8X X;  1IBX B;  3AMZ A;  2BB6 A;  3EA6 A;  3T9L A;  2B3A A;  4BAX A;  3A4S C;  4OVU A;  2RR9 A;  4KZC A;  1I42 A;  4WWN A;  1EU3 A;  2BT6 A;  4KKJ A;  1QZE A;  4IM2 A;  3AN1 A;  2DEN B;  2D3A A;  2JUO A;  3FIL B;  2GLS A;  3TMP B;  1UZX B;  3RZW C;  3B08 A;  1ROE A;  1YIW A;  3NS8 A;  4LK0 M;  2WXF A;  2XBB C;  3IXS A;  4IWQ A;  3DPD A;  3VUW A;  5HFY A;  1A5R A;  3JW0 X;  4XDD A;  4N6E B;  2L8J A;  1L6U A;  2IND C;  4L23 A;  1EF1 A;  3IT6 B;  5D6J B;  1OEY J;  3ZGZ A;  3RNA C;  1V97 A;  2INC C;  2KT7 A;  2HJ8 A;  1UH6 A;  2LGD A;  3A9J A;  3A1Q B;  3QAR A;  2BGF A;  2ZEQ A;  3BK1 A;  3L17 A;  4HK2 A;  4YTP B;  3RNC C;  4W9E A;  3AUL A;  5LXH A;  1YOV B;  4S17 A;  4RFB A;  3ZTD A;  3RN9 C;  2O2V A;  4AOF A;  3N1Y C;  2REX A;  3NVZ A;  3LYY A;  1JWA D;  2KAN A;  3W9C B;  2IY0 B;  2L1A A;  2WDT B;  4UDU C;  4RMA A;  1FCL A;  3CMM B;  4DQO C;  4DWF A;  2K25 A;  4XC2 A;  3V60 A;  2EMT A;  4MGI E;  4MJS A;  2JYT A;  3APC A;  3KW5 B;  2LRU A;  3P4S B;  4JGH B;  2FCQ A;  3A33 B;  1QLB B;  3DBR B;  1WJN A;  1HE8 A;  3URY A;  1Q5W B;  4ANW A;  2DX5 B;  5G2N A;  3HHM A;  2NVU I;  2D10 A;  2XK5 B;  5FK9 C;  4ZRK A;  5IN7 A;  1YQB A;  4WUR A;  4NPN A;  2L0F A;  1IGD A;  1VLB A;  2C7M B;  2ONQ A;  4W9I A;  3L4P A;  2KFK B;  4O1N A;  4II3 B;  1YX5 B;  1GJZ A;  4KSL C;  1TS3 A;  4TQ1 A;  4CHK A;  1FFU A;  1SF0 A;  3V6C B;  1JCK B;  4BKT A;  2DHZ A;  4H2A A;  4XWT A;  5IA7 A;  2DZI A;  2ICI A;  1ZDX A;  3HM6 X;  1E10 A;  1WX8 A;  1N62 A;  4RGM A;  2MH7 A;  4YSZ B;  2KLG A;  3PRM B;  2KTF A;  2LVP A;  2RPV A;  1TKY A;  1J8C A;  1IBX A;  1ZP0 B;  2GI9 A;  2PVG C;  1FRR A;  1P7E A;  4FN2 A;  2BYT A;  3Q8A A;  3P42 A;  5LXI B;  3P63 A;  1WMH B;  2L00 B;  4YSX B;  1TKE A;  3Q69 A;  5D2M B;  2CHZ A;  4LJP B;  4LCD E;  4LNK A;  5FR3 A;  2DYM A;  3AE9 B;  3U30 A;  3M63 B;  5CHW A;  3FIL A;  4ASW C;  1WSP A;  5H92 C;  3PV1 A;  5HG2 A;  4IC7 B;  4ANU A;  1WJ4 A;  3DVG X;  2VH2 A;  2L52 A;  3TIX A;  2M0A A;  1E8Y A;  4II2 B;  1FXT B;  4AJW A;  2J7Q B;  2AQ2 B;  2RDB C;  1YQ3 B;  4DHZ B;  2YEP F;  1WGH A;  4NAW B;  3BYT B;  4ANV A;  3RNG C;  1EM7 A;  3A1Q A;  1KRH A;  2DYO A;  3D32 A;  3AEG B;  2V9H A;  3I9V 1;  1LXD A;  1DYQ A;  2K5P A;  4M0W B;  4ZHO A;  3ZJV A;  2HJ1 A;  2Z0D B;  4IWP A;  1KF6 B;  2J0J A;  4MSQ B;  4BKS D;  3IAM 1;  3AEC B;  1SIJ A;  1PQS A;  3V61 A;  2IJ0 A;  2ACZ B;  1B1Z A;  4P16 A;  1T0Y A;  2ZW0 A;  4LLG M;  2EEL A;  3C0R B;  2KVZ A;  2ZZP B;  1ISN A;  3P2B A;  2KMC A;  3ZNH B;  2W82 A;  2KK8 A;  4WQO B;  2Z59 B;  4EOY A;  3P4R B;  4ZYN A;  2C60 A;  2SAK A;  1T0Q C;  4WJQ A;  2LWP A;  3ZNG C;  2A4Z A;  2BYF A;  4W9D A;  1HQR D;  2G45 B;  2JZZ A;  3BY4 B;  1JW9 D;  2MWS B;  2KC1 A;  4BVU C;  3B2F A;  3V3X A;  2HD5 B;  2XK5 A;  5MPO A;  1C3T A;  3NRZ A;  3OAW A;  1EF5 A;  1NEK B;  4HWI B;  1V49 A;  2PJH A;  4LNO A;  1RFK A;  4XWW A;  2I38 A;  4FJY A;  2LVQ A;  4NY0 A;  1TJE A;  4PYZ A;  3QC8 B;  3WAN A;  1P7F A;  4HCP B;  1HTQ A;  1PGA A;  2MJE A;  2O6V D;  3U52 E;  2QDF A;  4K7S A;  2K9X A;  1CZP A;  3IHP C;  1D3Z A;  1YN4 A;  3IFW B;  1SSN A;  1Y8R C;  2KDB A;  2ZJD A;  3DBH I;  4YTN B;  4RGN A;  4MH0 E;  3OWE B;  1SB3 C;  2W3R A;  1ENF A;  2V3N A;  2QEJ C;  3N9Y C;  1C77 A;  1E90 A;  5DPT A;  1WMH A;  1ET6 A;  5D7G A;  3Q14 C;  1CK1 A;  2R61 A;  1KLG D;  2FUG 1;  4AUQ C;  1UWX A;  5J17 A;  4URK A;  2KMM A;  1WGK A;  2JYE A;  1OQR A;  4GGQ A;  2IO3 B;  4ZHP A;  4XYC A;  1CMX B;  1JWU D;  1AAR A;  4OVZ A;  1Q10 A;  4HDQ A;  2NR2 A;  2BQQ A;  3DHI C;  3TJP A;  5G55 A;  1ZGU B;  2H88 B;  2LJI A;  4OHJ A;  5CHF A;  3R3M A;  2D3G A;  1I4H A;  3QQ8 B;  3ZDM C;  2QHO A;  1FRD A;  4NAW A;  1Y56 A;  4XE0 A;  3SDL C;  2G9H D;  3AU5 A;  1SJH D;  2K6D B;  4M0W A;  1WI0 A;  2CU1 A;  2IYD B;  3Q6B A;  2MBO A;  3KVF B;  1E7U A;  3NJT A;  5C1Z A;  2VH1 A;  4X57 B;  1YMH E;  4G11 A;  3UI3 A;  4YXD B;  4GN1 A;  2TSS A;  2IGD A;  4PYU A;  3L10 B;  4S0R A;  4A6Q A;  3ZVV A;  4P7I A;  4W9K A;  1QOA A;  3Q8E A;  3BIN A;  1V9J A;  2ZNV C;  1D5M C;  1NI3 A;  1L4Z B;  4IW0 A;  4WQM A;  3N32 A;  3PHX B;  2JZ3 B;  2WXI A;  3VTW A;  3R2T A;  1VZ7 A;  3IVF A;  1N5X A;  3AV8 A;  3GZN I;  2DZJ A;  4JPS A;  1NBF C;  1RLF A;  2Y5B B;  4EZL A;  2N1V A;  4G0N B;  1D4B A;  1GB4 A;  4NQK E;  4E74 A;  4CYE A;  3NZ3 A;  2J0K A;  2SEB D;  5AEK B;  4RM8 A;  3ZJU A;  2LEK A;  3Q2A C;  4DXG A;  2H89 B;  4FAD A;  1HTO A;  4JWU C;  3BVZ A;  3WAP A;  3PO0 A;  1C79 A;  1WXV A;  4W9G A;  1ZW7 A;  4BZA A;  3T8M A;  1NYQ A;  1PGX A;  2J42 A;  1L0V B;  3QCA A;  3EHV A;  1RWS A;  2LJ5 A;  1J7B A;  1VCB A;  2NMQ A;  1MI0 A;  5DPR A;  4WJP A;  2K22 A;  2MBE A;  3H7P B;  3GE3 C;  2N7E A;  2J52 A;  2W3S A;  3RYT A;  2V0G A;  3CIR B;  4KZ0 A;  4FLH A;  4DK5 A;  3P1M A;  4L2Y A;  1A70 A;  2BB5 A;  2AX5 A;  4REZ A;  2Y3A A;  3AH7 A;  3IT4 B;  2QIL A;  2O2V B;  1AN8 A;  4B95 A;  5E6J A;  3H6N A;  2LXC A;  1EWC A;  4DHJ D;  4HEA 1;  4JWS C;  2WWZ A;  3RUL A;  4GIV A;  3T3N A;  1KLU D;  1ZE3 D;  2LGS A;  3SD5 A;  1QOB A;  1E6E B;  3T3O A;  1R7S A;  1JQ4 A;  2MJD A;  4HPM B;  1WH3 A;  5L83 A;  1SXT A;  1F2R C;  3CF6 E;  3EFC A;  1XLN A;  4LTU A;  5CX3 A;  2ZPY A;  2DLB A;  1JWS D;  1HZ5 A;  3RZF A;  3ECI A;  4I6N B;  2KZR A;  3VH4 B;  1LGR A;  5AUI A;  1MG4 A;  1WGD A;  5LNK 1;  2M8S A;  5IOI A;  1FEH A;  3TCA A;  3AB5 A;  3W1S C;  3RUI B;  2JPH A;  4WAF A;  4CQN A;  5L95 C;  3DBR I;  5LLI A;  2GMI C;  2YLM A;  1BML C;  3Q8C A;  3MJW A;  2R2O A;  1V80 A;  3DBL B;  4K1R B;  1V1O A;  1P1A A;  4WWM A;  3WAO A;  3DOW A;  1S3S G;  5EE1 A;  1CJE A;  3ONS A;  4N59 A;  5IKC M;  3APF A;  4GU2 A;  4GB9 A;  3VDZ A;  1V86 A;  2G4D B;  3O13 A;  1SBB B;  2M1M A;  1SE4 A;  2KAC A;  2MBQ A;  4MGK E;  4ICU A;  2EMS A;  5HI1 A;  2PE6 B;  5G5H A;  1I4X A;  2XNA C;  1TIF A;  1V81 A;  3ALB A;  5DPS A;  3ZRC A;  3ZW3 A;  2WX0 A;  3Q3J A;  1QOF A;  2BW2 A;  4JQW C;  4DXA B;  2PEA A;  2QCZ A;  3BVM A;  5BMG A;  5HKH A;  1WXA A;  3GOE A;  3RCZ A;  3U8Z A;  1KJT A;  3VUX A;  1LO5 D;  4HPP A;  2OJW A;  3OLM D;  2BTE A;  3WIM A;  1KTK A;  1GUA B;  1M4V A;  4FJV B;  3PZ7 A;  2CJO A;  1UGM A;  2HE7 A;  3HK0 A;  4OZB A;  2E3T A;  3PTF C;  1J7C A;  3SU8 X;  2FAZ A;  4P6V F;  3PSE B;  3I5J C;  4RGT A;  3ZJT A;  2IO2 B;  4OZC A;  1R4N I;  2FCN A;  2W9N A;  2PVO D;  3TEZ A;  3H7P A;  4KDL B;  3FAH A;  1WZ3 A;  2MRP A;  2Y5P A;  3VAW A;  4F8C B;  1WRI A;  2JX5 A;  3DBS A;  3KUD B;  1NYR A;  2KLC A;  3QHT A;  1R4M B;  2OJR A;  2Y5C A;  4BBN F;  2E6X A;  3P4P B;  4JLC A;  4JE3 B;  1BT0 A;  1F2R I;  2K39 A;  4DBG A;  5G5G A;  1TTN A;  3L08 A;  3GE8 C;  4MT5 A;  2K1F A;  3IG3 A;  1QIL A;  4N9F 4;  1H4R A;  4P1B C;  4HLE A;  3QWZ B;  2KO3 A;  2D11 A;  2LGX A;  3TBL D;  3AEF B;  3TEW A;  3WCQ A;  2GRI A;  2IY1 B;  3I57 A;  5BYQ A;  2NPT A;  3U7D A;  1EO6 A;  1FXA A;  4ARI A;  3NUH B;  2KTR B;  2X38 A;  1HEZ E;  1T6B X;  2I2Y A;  5DCN A;  1GG3 A;  1CQV A;  2YVC A;  5GMV A;  3DCG A;  5EE0 A;  2BS2 B;  3HM3 A;  1LFD A;  2ZNV B;  4FHK A;  3VH3 B;  2BWE S;  4GOC A;  1AYF A;  1TY0 A;  1TY2 A;  3DDC B;  4C00 A;  3IAS 1;  3VXW A;  3KYC D;  2UYZ B;  4A3P A;  3VTV A;  3NZU A;  2AQ1 B;  4FHJ A;  3W5V B;  1S1Q B;  1STE A;  3VUY A;  4ZRQ A;  4HKQ A;  2JRI B;  2KX0 A;  1WWT A;  2WDR B;  3UF8 A;  1T0S C;  1DOY A;  4G3X B;  1JRP A;  2ON8 A;  2LAS A;  4TUU A;  2DNF A;  4HVB A;  2AYO B;  4RF1 A;  1T0R C;  4ZDV A;  1XQQ A;  4A3O A;  2PLP A;  1N5W A;  1FMA D;  1N6Z A;  2L3Z A;  1C4P A;  3RFZ B;  3VR9 B;  3TUO A;  1OQY A;  4OW0 A;  1WY8 A;  1PDX A;  4FXC A;  4GXB A;  1F52 A;  3B0A A;  3NVV A;  3PZD A;  2JVC A;  3OG5 A;  1FO4 A;  1F0Z A;  1D5Z C;  4W9J A;  1VD2 A;  2OED A;  5BMH A;  3AE2 B;  1V5O A;  4PS7 A;  2L05 A;  2ZCC A;  1P98 A;  4M8N A;  4WAA A;  5CHV C;  1C4A A;  4WWP A;  3ZXR A;  2AEH A;  3N3K B;  3ZTC A;  1V2Y A;  2IZV B;  5C23 A;  1MPE A;  5KHO A;  2IPK D;  2M4N A;  5H8Y E;  1TZ1 A;  3PRZ A;  1PUT A;  2DYB A;  1DGJ A;  5JHB A;  4NJ7 A;  3QJZ A;  4M02 A;  1RAX A;  2KKC A;  4HRO A;  4LDT D;  4NAM A;  4A55 A;  2MJ3 A;  1XLP A;  1TT5 B;  2Z0E B;  1ESF A;  3U7Z A;  1YJJ A;  5IP4 D;  1J0G A;  2KOX A;  4ZRI A;  2K0P A;  4W9L A;  2RDG A;  2OOB B;  3AXC A;  2FID A;  3CST A;  1TZO A;  2BKF A;  4K3B A;  4G50 A;  3DWG C;  1E8X A;  2KTR A;  2WXL A;  5EE3 A;  1X1M A;  2KDF B;  3KWV A;  3AED B;  4DHZ E;  3RNE C;  2JT4 B;  3DVN V;  4GDL B;  3H9D A;  3Q3O C;  1QT9 A;  1UD7 A;  1WGY A;  2GBK A;  3L16 A;  1XEE A;  3UQB A;  1L0X B;  4FJZ A;  3V6E B;  3CSF A;  1HZ6 A;  2D2Q A;  3M95 A;  1I4Q A;  4E3C A;  2MEK A;  2MQJ A;  3QX1 A;  2C7N B;  4MM3 B;  2KJR A;  2VZK D;  3AE7 B;  2GBJ A;  2KN4 A;  3LDZ E;  4YL8 A;  1GNU A;  1FD6 A;  2MX2 A;  4IWO A;  5JHA A;  4HJG E;  4P1C C;  4AQ7 A;  3DQV A;  4EEW A;  1L5P A;  2JZP A;  4BOZ B;  1OTR B;  3C8Y A;  1WFY A;  3BII D;  2C5L C;  5KHQ A;  4F7Z A;  3X23 A;  3MFG A;  1YQ4 B;  4TSS A;  4KGS A;  2W55 A;  3TSS A;  1WX9 A;  1T3Q A;  2LI5 A;  3RT3 B;  4HKZ E;  3TEY A;  1L2N A;  3P4Q B;  3BZD B;  2KFJ A;  3MHS D;  2BWF A;  5I4D A;  4KSK C;  4NJC A;  2PMV A;  5C3J B;  3I3T B;  2PPH A;  4ZRJ A;  1FNV A;  5BYS A;  3PRE A;  1XCQ L;  2V3P A;  4ANX A;  1RM6 C;  2QMT A;  3AM9 A;  4KIK B;  2ASQ A;  1SEB D;  2D3B A;  2O6V B;  5EDS A;  4RH6 A;  1EUV B;  4IDI A;  3MC9 A;  3JSV B;  3KQ4 A;  4MEL A;  1JRU A;  4PT5 A;  1Z2M A;  2BPS A;  5FKA C;  2MBB B;  1K53 A;  1MVK A;  3EGR A;  2DAJ A;  1L7Y A;  1NDD A;  1SGH A;  3VR8 B;  4PK1 A;  4BOS C;  2AQ3 B;  3KYD D;  2QSD A;  3EC8 A;  3MP9 A;  4TV3 A;  4LNN A;  2N7J A;  2WXK A;  1JRO A;  4M00 A;  3Q3M C;  1ZXI A;  4HJK A;  1WGR A;  2XN9 C;  1E9M A;  2KDI A;  4B9K A;  2KJH B;  4IOI E;  4GDL A;  3AU4 A;  1E8W A;  2AL6 A;  1JWM D;  3PLV A;  3ZUN A;  4KV2 A;  5BMI A;  1XXG A;  4ACF A;  3WA0 A;  1C76 A;  2KYW A;  2BS4 B;  1E5W A;  2PTL A;  2RD0 A;  2WXH A;  4ARC A;  1C78 A;  4C56 C;  4BKG A;  2QIE B;  1ZOY B;  2HTM E;  3QK0 A;  1IGC A;  3NY5 A;  2ZW1 A;  4RGO S;  1DOX A;  4MM3 A;  1TYG B;  1HA5 A;  1XCT L;  3DBH B;  4BKS A;  5E6N A;  1YD8 U;  4EFO A;  2V4L A;  4B0M A;  3LXF A;  2FBW B;  1JAL A;  3UIN B;  4YWG G;  1VZ8 A;  2KWV B;  1WR6 E;  2CHX A;  1WJ6 A;  1D5X C;  4AWJ A;  5T8I A;  1XLQ A;  4IKG A;  5D94 A;  2KMA A;  1HXY D;  1WGG A;  3ZNI D;  1XD3 B;  3ABV B;  2MCN B;  3ZKJ C;  4DDI D;  1R4M I;  2RMM A;  3GP7 A;  1WZ0 A;  2JU6 X;  2WDQ B;  2WS3 B;  1XLO A;  1GAQ B;  3SEB A;  2JSV X;  4ZRP A;  1N63 A;  2WU2 B;  3MHZ A;  1WYG A;  3PHW B;  3S2A A;  1NI2 A;  2NPT B;  3LJ3 A;  4HDO A;  3L54 A;  1WRD B;  3RMK C;  3ZNZ B;  1MG8 A;  2K6Q A;  4KIK A;  2O6V A;  1QQR A;  1QF6 A;  4KX6 B;  2K3U A;  1Z5S B;  4N58 A;  1E8Z A;  3N20 C;  1AW7 A;  4I6L B;  3CWI A;  2LMC A;  1C1Y B;  3JSV A;  2ZCB A;  1K51 A;  3SR6 A;  1ZXH A;  4TMA B;  2FIF A;  3H1U A;  1UGJ A;  4ZOH C;  2LHE A;  3VFK A;  1GB1 A;  3PGE A;  2GB1 A;  2INP E;  3N1X C;  2KN5 A;  1F1H A;  3BVG A;  1IPG A;  5C2T B;  4A20 A;  2M19 A;  2DAF A;  3NVY A;  4A90 A;  2XEW A;  1UUP A;  4J3O D;  1VZ6 A;  2K8B A;  3ML8 A;  4DHJ B;  3UGB B;  5TR5 A;  3GZN B;  3NG0 A;  1WX7 A;  4HXD A;  2GOW A;  1MJD A;  2KQ4 X;  4KGT A;  2KDM A;  3AEE B;  1UEL A;  2BBC A;  4DXF A;  2KWU B;  3A9K B;  4TKN A;  2ZVO A;  3QAQ A;  4EE2 A;  1MHX A;  2WU5 B;  3K9O B;  5E6P A;  2V3S A;  3W2D A;  1KM7 A;  1PFD A;  3DHH C;  2KDE B;  3QA8 A;  4RNA A;  1EU4 A;  3AEA B;  4YTM B;  1ZUD 2;  1WJU A;  5FR6 A;  4MH8 A;  4LJO B;  2AWT A;  4XDC A;  2JXT A;  4W9F A;  4AP4 C;  2K8C A;  1WXQ A;  2WXO A;  1RYJ A;  2NTT A;  2D5G A;  3TL5 A;  2J53 A;  3PRP B;  3HIZ A;  3PLU A;  2WQY B;  1FFV A;  1PYW D;  2V4I B;  3FC4 A;  1RRB A;  3PVL A;  1IUE A;  2KWC A;  4Q2J A;  2LVO A;  3AE5 B;  1YNT E;  4M8M A;  3R7Q A;  1FM0 D;  1VR9 A;  2MP2 B;  2G4S A;  2KX3 A;  1VDV A;  4IG7 B;  3V05 A;  2WGS A;  3MC8 A;  3ZYY X;  4LNF A;  3VRB B;  1WM2 A;  4JL9 A;  2WX1 A;  5AZH A;  2OHF A;  1U4A A;  1I7H A;  2BYE A;  2KVR A;  2NBV B;  4GSW A;  2JQR B;  2QC8 A;  3APD A;  3B9J A;  3RD2 A;  1OQQ A;  2JWU A;  2MA9 B;  1KOT A;  2PKO A;  3ZO5 B;  3R66 C;  1ACC A;  3AE3 B;  3R2I A;  3NOB A;  4FA6 A;  1FIQ A;  3NHE B;  4IM3 A;  3A4R A;  1SE3 A;  2CJN A;  3ENE A;  2BKR B;  4XZ4 A;  1P3Q U;  2WXM A;  1N61 A;  2CKH B;  1WM3 A;  5AZF A;  2W54 A;  2IGG A;  3H8H A;  2N9X A;  1UF0 A;  3WAL A;  3KWL A;  2FE8 A;  1RFA A;  4USA A;  2NS5 A;  4XGA B;  2IGH A;  1WYW B;  1MHH E;  1C4C A;  3KUZ A;  2HTH A;  3JVZ X;  1FXI A;  5JZE B;  4WH4 A;  1N60 A;  2I1K A;  1I35 A;  3BWU D;  4PS8 A;  2I1J A;  4GMV A;  3RNF C;  2RGF A;  5IAA C;  3DVN U;  4QAY A;  2KXJ A;  2DWQ A;  1UWM A;  1WF9 A;  1V1P B;  1K8R B;  3A9K A;  1UBI A;  4EZK A;  2UU7 A;  1J19 A;  1LM8 B;  2KAJ A;  5D3I B;  4NNJ B;  1SE9 A;  1Q0W B;  2B76 B;  2LGI A;  2BF8 B;  1KFY B;  1QKZ A;  1NVI D;  5JH5 C;  1WE7 A;  3N30 A;  2CHW A;  4EZJ A;  2RPQ A;  3UIP B;  3EEC A;  4GDK B;  2FCM A;  2MLB A;  4ITK A;  2FNJ B;  4RF0 A;  1I4R A;  3PT2 B;  1GC7 A;  4C80 A;  5DPW A;  3PPA A;  3R8B A;  3EFU A;  3WAM A;  2LUM A;  1R4N B;  2LHD A;  2V1Y A;  2GBN A;  3N1Z C;  3MC0 B;  4I6P A;  2FCS A;  4MEM A;  3O65 B;  4D2K A;  5J18 A;  1SE2 A;  4E71 A;  2CR5 A;  1L4D B;  3DVG Y;  1UNS A;  2MP2 A;  3OJ4 B;  1IP9 A;  1GC6 A;  3W1Y A;  4CO7 A;  4J6I A;  1D6E C;  2CS4 A;  3AE1 B;  2KJ6 A;  3L13 A;  3R7R A;  4FBJ B;  3TEX A;  3EUB 2;  1WXM A;  1JML A;  4XX5 A;  4R3D A;  3B1L X;  2R2Q A;  2PE9 A;  4WJO A;  2NTS A;  2WXR A;  3HRD D;  3SFE B;  3VVW B;  1GPX A;  1Q1O A;  1PGB A;  1I4G A;  3K9P B;  2WXP A;  3ZXV A;  1EWY C;  3DWM A;  4HPL B;  2Z8L A;  2C7H A;  4MAC A;  4K3C A;  4B0E A;  1FPY A;  3X0W A;  3PZ8 A;  1ZKH A;  1P0R A;  3ETR A;  2J4X A;  1XO3 A;  4JIO U;  4IM0 A;  1UBQ A;  2CU3 A;  4FUL A;  2L83 A;  1H8C A;  3I63 C;  1WXS A;  1YN3 A;  1F77 A;  3SHQ A;  2VRR B;  4WWO A;  3RI7 C;  2DBY A;  1GOZ A;  2KFK A;  3DHG C;  2IDY A;  4YSY B;  3E9S A;  2BS3 B;  4F1S A;  3UIO B;  2JRH A;  5BYR A;  2G3Q B;  4NZL B;  2DZM A;  1J7A A;  3W5U B;  3QIJ A;  3VQI A;  3AE6 B;  4MSM B;  4LDT B;  1JWB D;  4EUT A;  3ZIM A;  1XT9 B;  4AS1 A;  2ZPN A;  3KH0 A;  1V8C A;  1E7P B;  4NQL B;  1DOI A;  1L6V A;  1V1P A;  3V62 A;  2UWQ A;  1FNU A;  2ZVN A;  4A8X C;  2EKE C;  3IBE A;  4ICV A;  1AWD A;  3AE4 B;  5HHD G;  3Q8B A;  2WNM A;  3J9C A;  1OEY A;  4WJN A;  2PW9 A;  2N9P C;  1VRA B;  3H7S A;  4GDK A;  3GB1 A;  1FCC C;  2KHW B;  1MFW A;  3U2S C;  1ZDV A;  2YEP B;  2L7R A; 
#chains in the Genus database with same CATH homology
 2MCN B;  3ZKJ C;  2IBI B;  2IO0 B;  3ZLZ A;  4EKU A;  4DDI D;  2C9W B;  4DHZ B;  1R4M I;  2OJR A;  1WGH A;  4BBN F;  3UQA A;  4MGY E;  1WZ0 A;  4JLC A;  4NAW B;  4ANV A;  3A1Q A;  1BT0 A;  2DYO A;  2K39 A;  2LRW A;  4DBG A;  2K8H A;  1TTN A;  3D32 A;  3L08 A;  1LXD A;  3PHW B;  3S2A A;  4K7W A;  1NI2 A;  3L0W B;  4M0W B;  4W9H A;  2NPT B;  5J2R A;  2K1F A;  3IG3 A;  3LJ3 A;  2Z0D B;  4N9F 4;  4IWP A;  1H4R A;  4HDO A;  4HLE A;  3L54 A;  1P9D U;  1WRD B;  2J0J A;  4MSQ B;  3QWZ B;  4BKS D;  3ZNZ B;  4DDG D;  2KO3 A;  1IYF A;  3ZDT A;  2D11 A;  1TGZ B;  2LGX A;  3TBL D;  1PQS A;  4W9C A;  1MG8 A;  2KNB A;  3V61 A;  2IY1 B;  4AJY B;  2FUH B;  2K6Q A;  1T0Y A;  4KIK A;  2O6V A;  2NBU A;  2NPT A;  3U7D A;  1EO6 A;  3M3J A;  3C0R B;  2ZZP B;  4HCN B;  1ISN A;  3P2B A;  2KMC A;  1Z5S B;  5CTR C;  3ZNH B;  2KTR B;  1E8Z A;  2KK8 A;  4I6L B;  4WQO B;  2Z59 B;  3VHT C;  1C1Y B;  2GBR A;  2ZCB A;  3JSV A;  4EOY A;  3DBL I;  5DCN A;  1GG3 A;  1YX6 B;  2FIF A;  3H1U A;  2C60 A;  2M17 A;  4ZYN A;  3W1S A;  1WR1 A;  2YVC A;  3VFK A;  4WJQ A;  3PGE A;  2LWP A;  3ZNG C;  2J0M A;  2A4Z A;  2DZK A;  3DCG A;  3AI5 A;  2BYF A;  5GMV A;  5BO4 B;  4W9D A;  2G45 B;  2JZZ A;  3BY4 B;  2KN5 A;  2MWS B;  2A5U A;  2KC1 A;  4BVU C;  2KD0 A;  1IPG A;  2L76 A;  2JY6 A;  4A20 A;  2HD5 B;  2XK5 A;  3HM3 A;  4OVV A;  1LFD A;  2ZNV B;  4FHK A;  3VH3 B;  2DAF A;  2BWE S;  1C3T A;  4GOC A;  2JF5 A;  1F9J A;  3ZRF A;  2KQ7 A;  2XEW A;  3OAW A;  1EF5 A;  4NJ6 A;  1LQB A;  3DDC B;  4HWI B;  2K8B A;  3ML8 A;  4DHJ B;  3VXW A;  3KYC D;  2UYZ B;  3UGB B;  4A3P A;  3NZS A;  3VTV A;  1V49 A;  3NZU A;  2PJH A;  5TR5 A;  4FHJ A;  1WX7 A;  4FJY A;  2GOW A;  2LVQ A;  4HXD A;  1S1Q B;  4NY0 A;  3VUY A;  2LGY A;  4PYZ A;  3QC8 B;  2JRI B;  1UEL A;  2KX0 A;  5E6O A;  3UF8 A;  4K81 A;  2MSE D;  3WAN A;  2KWU B;  2D07 B;  3A9K B;  4G3X B;  4TQ0 A;  2WYQ A;  2ZVO A;  2LAS A;  3QAQ A;  4HCP B;  4TKN A;  4TUU A;  5AZG A;  3Q3F A;  2LZ6 A;  3K9O B;  4HVB A;  2AYO B;  2O6V D;  2V3S A;  5E6P A;  1V6E A;  2AL3 A;  1KM7 A;  2KDE B;  3QA8 A;  4ZDV A;  4K7S A;  4KDI C;  3IHP C;  1XQQ A;  1D3Z A;  3OJ3 A;  3IFW B;  1KLV A;  4A3O A;  1Y8R C;  2KDB A;  1WJU A;  2ZJD A;  3DBH I;  5FR6 A;  4MH0 E;  2L3Z A;  4LJO B;  2JXX A;  2AWT A;  2N4F A;  4W9F A;  4AP4 C;  1OQY A;  2K8C A;  1E90 A;  5DPT A;  3VTU A;  1WMH A;  1E7V A;  1WY8 A;  4AJW A;  2LUE A;  3TL5 A;  5D7G A;  3PRP B;  3M62 B;  4GXB A;  3B0A A;  3HIZ A;  2M0X A;  3PLU A;  3PZD A;  2JVC A;  4AUQ C;  3A9J B;  2NBW B;  4W9J A;  2KC2 A;  1VD2 A;  5J17 A;  4URK A;  1RRB A;  3PVL A;  1V5O A;  3JYU A;  4PS7 A;  2KWC A;  2LVO A;  4GGQ A;  4BBN C;  2L05 A;  4B6W A;  2ZCC A;  4M8M A;  3R7Q A;  1P98 A;  2IO3 B;  1CMX B;  4M8N A;  2MP2 B;  2LD9 A;  2G4S A;  2KX3 A;  4WAA A;  5CHV C;  1AAR A;  1TBE A;  4IG7 B;  2N9E B;  4KVG B;  4HDQ A;  2NR2 A;  3TJP A;  4WWP A;  5G55 A;  1ZGU B;  2AEH A;  3N3K B;  3ZTC A;  1V2Y A;  2IZV B;  5C23 A;  1WE6 A;  1WM2 A;  4JL9 A;  2WX1 A;  5CHF A;  5AZH A;  5KHO A;  3R3M A;  4MDK E;  2D3G A;  2M4N A;  2RSU A;  1U4A A;  1TZ1 A;  2BYE A;  2JWZ A;  2KVR A;  2NBV B;  2DYB A;  3PRZ A;  3QQ8 B;  2QHO A;  4GSW A;  3ZDM C;  5JHB A;  3MTN B;  4NJ7 A;  4MJS B;  4NAW A;  3ML9 A;  2N1W A;  3SDL C;  3QJZ A;  3PS6 A;  1RAX A;  2KKC A;  2GBM A;  4LDT D;  3AU5 A;  1M94 A;  2N7D A;  2K6D B;  1G6J A;  2NCN A;  2Z0E B;  1WI0 A;  3APD A;  2CU1 A;  2IYD B;  3RD2 A;  1J0G A;  2KQS A;  2MA9 B;  1V5T A;  2MBO A;  2KOX A;  2IO1 B;  3KVF B;  4K7U A;  4ZRI A;  1KOT A;  2MW5 A;  3ZO5 B;  1E7U A;  3R66 C;  4W9L A;  2LXA A;  5C1Z A;  4MGZ E;  4X57 B;  2MBH A;  4G11 A;  2OOB B;  3NOB A;  4RM9 A;  4FA6 A;  3AXC A;  4GN1 A;  2FID A;  4PYU A;  3CST A;  3L10 B;  3NHE B;  1WIA A;  2BKF A;  4IM3 A;  1I35 A;  3A4R A;  1OGW A;  4IUM B;  4G50 A;  3ZVV A;  4P7I A;  4W9K A;  1E8X A;  2BYV E;  2KTR A;  4PS3 A;  3BIN A;  3ENE A;  1V9J A;  2BKR B;  1X1M A;  2KDF B;  2ZNV C;  4XZ4 A;  4DHZ E;  1P3Q U;  2JT4 B;  3DVN V;  4IW0 A;  2CKH B;  4GDL B;  3H9D A;  1WM3 A;  3N32 A;  2L0T A;  3PHX B;  2JZ3 B;  1WGY A;  1UD7 A;  5AZF A;  3VTW A;  4BFR A;  3IVF A;  2GBK A;  2N9X A;  3L16 A;  3KUC B;  1SIF A;  3GZN I;  3WAL A;  2DZJ A;  3UQB A;  4FJZ A;  3V6E B;  1NBF C;  1RLF A;  1YJ1 A;  1RFA A;  3CSF A;  2Y5B B;  2D2Q A;  2NS5 A;  4EZL A;  2N1V A;  3M95 A;  1WYW B;  4G0N B;  3KUZ A;  2HTH A;  3JVZ X;  3T9L A;  2B3A A;  4NQK E;  4E3C A;  4E74 A;  5JZE B;  3A4S C;  2I1K A;  2RR9 A;  4OVU A;  4CYE A;  2J0K A;  2MQJ A;  2I1J A;  4GMV A;  3QX1 A;  4KZC A;  4PS8 A;  4RM8 A;  4WWN A;  5AEK B;  1I42 A;  2C7N B;  2RGF A;  5IAA C;  3DVN U;  2KXJ A;  2KJR A;  4FAD A;  1QZE A;  4IM2 A;  3WAP A;  1WF9 A;  1WXV A;  2GBJ A;  4W9G A;  1K8R B;  2DEN B;  3LDZ E;  3A9K A;  1UBI A;  1ZW7 A;  4YL8 A;  4EZK A;  1GNU A;  3T8M A;  1J19 A;  1LM8 B;  4NNJ B;  1SE9 A;  2JUO A;  2MX2 A;  3QCA A;  1Q0W B;  3EHV A;  4IWO A;  5JHA A;  3TMP B;  1UZX B;  3RZW C;  2BF8 B;  2LJ5 A;  3B08 A;  3DQV A;  4EEW A;  1VCB A;  5JH5 C;  5DPR A;  1WE7 A;  3N30 A;  4WJP A;  1YIW A;  2CHW A;  4EZJ A;  2RPQ A;  3NS8 A;  3UIP B;  3EEC A;  4GDK B;  2FCM A;  2XBB C;  2MLB A;  4BOZ B;  1OTR B;  2FNJ B;  2MBE A;  3H7P B;  4IWQ A;  2N7E A;  3RYT A;  1WFY A;  3DPD A;  3VUW A;  2C5L C;  3PT2 B;  1GC7 A;  5DPW A;  5KHQ A;  4KZ0 A;  4F7Z A;  1A5R A;  3JW0 X;  3PPA A;  3X23 A;  4FLH A;  4DK5 A;  2L8J A;  3EFU A;  3WAM A;  1EF1 A;  5D6J B;  1OEY J;  2V1Y A;  2GBN A;  1WX9 A;  2O2V B;  4B95 A;  2LI5 A;  4I6P A;  3RT3 B;  2HJ8 A;  3H6N A;  1UH6 A;  2LGD A;  2LXC A;  3A9J A;  3A1Q B;  3QAR A;  2BGF A;  2FCS A;  2ZEQ A;  1L2N A;  4MEM A;  4DHJ D;  3O65 B;  2KFJ A;  3L17 A;  4HK2 A;  5J18 A;  2WWZ A;  4W9E A;  3AUL A;  3RUL A;  3MHS D;  4E71 A;  4GIV A;  5LXH A;  2BWF A;  4KSK C;  2CR5 A;  3I3T B;  3ZTD A;  2PPH A;  3SD5 A;  4ZRJ A;  3DVG Y;  2MP2 A;  3OJ4 B;  2O2V A;  3PRE A;  1GC6 A;  4HPM B;  1WH3 A;  1IP9 A;  5L83 A;  4AOF A;  3W1Y A;  3CF6 E;  4CO7 A;  4J6I A;  4ANX A;  2REX A;  2CS4 A;  2KAN A;  2KJ6 A;  5CX3 A;  2IY0 B;  2WDT B;  4RMA A;  2ZPY A;  3L13 A;  4KIK B;  2ASQ A;  3R7R A;  4FBJ B;  2O6V B;  3CMM B;  3RZF A;  3ECI A;  4DWF A;  4I6N B;  2KZR A;  3VH4 B;  1WXM A;  1WGD A;  2K25 A;  5EDS A;  4XC2 A;  4XX5 A;  1EUV B;  3V60 A;  2EMT A;  4MGI E;  4MJS A;  3JSV B;  2M8S A;  3APC A;  3B1L X;  2R2Q A;  2PE9 A;  4WJO A;  3KW5 B;  4MEL A;  2LRU A;  4JGH B;  3TCA A;  2FCQ A;  1JRU A;  3A33 B;  3VVW B;  1Q1O A;  3W1S C;  1Z2M A;  1WJN A;  3RUI B;  1HE8 A;  2BPS A;  3K9P B;  2JPH A;  2MBB B;  5L95 C;  3DBR I;  5LLI A;  4HPL B;  1Q5W B;  4ANW A;  2GMI C;  2C7H A;  2DX5 B;  2YLM A;  5G2N A;  3X0W A;  3HHM A;  2R2O A;  3MJW A;  1V80 A;  2DAJ A;  2NVU I;  2D10 A;  1ZKH A;  2XK5 B;  1L7Y A;  1NDD A;  1SGH A;  1YQB A;  1P0R A;  4K1R B;  4ZRK A;  1P1A A;  4NPN A;  3WAO A;  2L0F A;  4JIO U;  2C7M B;  4BOS C;  3DOW A;  4IM0 A;  4W9I A;  1UBQ A;  1S3S G;  3KYD D;  2KFK B;  3ONS A;  4II3 B;  3EC8 A;  1YX5 B;  4FUL A;  1GJZ A;  1H8C A;  4TV3 A;  3APF A;  4GU2 A;  4GB9 A;  4KSL C;  3VDZ A;  1WXS A;  1V86 A;  2G4D B;  4TQ1 A;  4CHK A;  2M1M A;  3SHQ A;  2MBQ A;  4MGK E;  3V6C B;  2VRR B;  4WWO A;  4ICU A;  4HJK A;  2EMS A;  4BKT A;  2DHZ A;  1WGR A;  5IA7 A;  2PE6 B;  2KDI A;  4B9K A;  2KJH B;  1V81 A;  2DZI A;  4GDL A;  3AU4 A;  3ALB A;  5DPS A;  1E8W A;  2KFK A;  3ZRC A;  3ZW3 A;  2AL6 A;  3HM6 X;  3PLV A;  3ZUN A;  2WX0 A;  1WX8 A;  3Q3J A;  4JQW C;  4KV2 A;  4DXA B;  2PEA A;  4F1S A;  3UIO B;  2KLG A;  3PRM B;  2JRH A;  1WXA A;  2KTF A;  2LVP A;  3GOE A;  3RCZ A;  3U8Z A;  3WA0 A;  5HKH A;  2G3Q B;  1KJT A;  2DZM A;  3VUX A;  1E5W A;  2RD0 A;  1J8C A;  3QIJ A;  3VQI A;  4BKG A;  4MSM B;  3OLM D;  4LDT B;  4FN2 A;  3WIM A;  1GUA B;  3QK0 A;  4FJV B;  3NY5 A;  4EUT A;  5LXI B;  1WMH B;  4MM3 A;  2L00 B;  1XT9 B;  3ZIM A;  2ZPN A;  3KH0 A;  5D2M B;  4NQL B;  4BKS A;  2CHZ A;  1UGM A;  4LJP B;  2HE7 A;  4LCD E;  5E6N A;  2UWQ A;  3V62 A;  3HK0 A;  1YD8 U;  2ZVN A;  2DYM A;  2EKE C;  3IBE A;  4ICV A;  3PTF C;  3U30 A;  3M63 B;  3SU8 X;  4EFO A;  5CHW A;  2V4L A;  4ASW C;  2FAZ A;  1OEY A;  3PSE B;  3PV1 A;  4WJN A;  3UIN B;  2N9P C;  4IC7 B;  2IO2 B;  2KWV B;  3H7S A;  4ANU A;  1WR6 E;  2CHX A;  1R4N I;  1WJ6 A;  1WJ4 A;  2FCN A;  4GDK A;  2W9N A;  3DVG X;  3H7P A;  4AWJ A;  2KHW B;  5D94 A;  4KDL B;  2KMA A;  3TIX A;  1WZ3 A;  2MRP A;  3VAW A;  1E8Y A;  4F8C B;  1WGG A;  4II2 B;  1FXT B;  2L7R A;  3DBS A;  1XD3 B;  3KUD B;  3ZNI D;  2KLC A;  3QHT A;  2J7Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...