1RAXA

Ra-domain of ral guanosine-nucleotide dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
b'QQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RA-DOMAIN OF RAL GUANOSINE DISSOCIATION STIMULATOR)
publication title High-Resolution Structure of the Ra-Domain of Human Ralgds and a Dynamics Study of its Binding Loop to Ras
rcsb
source organism Homo sapiens
molecule tags Ras-binding domain
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1999-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1raxA00
3P2BA 2KTFA 3SDLC 1UZXB 3ZNGC 4KV2A 3JVZX 1WGDA 2DZKA 3V60A 4ZDVA 2NR2A 1YD8U 2FIFA 3M3JA 4W9LA 5E6PA 5LLIA 3NS8A 2L8JA 5LXHA 2IO3B 5EDSA 1ZKHA 2KZRA 4FLHA 1WGRA 2GBKA 2MBHA 3TMPB 2CU1A 1EF1A 3B1LX 3QC8B 2C5LC 5D6JB 3VVWB 2KNBA 2BKRB 3M62B 4PS8A 1PQSA 2LVQA 3AU4A 3OAWA 4NAWB 3QAQA 2BYFA 3ML8A 3BINA 3K9PB 4K7SA 2N9XA 4WJNA 5JZEB 2FCSA 1P9DU 3VXWA 3APCA 4BKTA 1WI0A 2KWUB 5DPSA 1GNUA 2LGXA 3DDCB 1P98A 1WGYA 1UH6A 3WIMA 4HCPB 4GGQA 2M1MA 4MDKE 4IW0A 4II3B 4W9GA 2LASA 2FUHB 1E5WA 3U30A 5TR5A 4AWJA 1EF5A 3BY4B 1OTRB 4HCNB 1WM2A 4PS7A 2NCNA 4RMAA 3PLUA 4EEWA 3R7QA 4NAWA 2WWZA 3RZFA 3VAWA 4F7ZA 4F8CB 4I6LB 1G6JA 4XX5A 3PRMB 3T9LA 2MQJA 2JZ3B 4BKSD 3L08A 2DZIA 3KUZA 1RLFA 1CMXB 3NZUA 5LXIB 2D3GA 2ZPNA 2R2OA 5DPWA 2V4LA 2GBMA 2MP2A 3OJ4B 5D7GA 1WJ4A 5KHOA 2JVCA 3PTFC 1WXVA 1P3QU 3L10B 1GC7A 1WJUA 4MGYE 2ZJDA 3CMMB 5C1ZA 1SGHA 2FAZA 4MGZE 3DBRI 3Q3FA 4CHKA 4EOYA 1TGZB 2REXA 2Y5BB 4GN1A 4GU2A 1K8RB 2UYZB 4IC7B 1JRUA 3VDZA 4HLEA 2FNJB 2N9EB 4W9CA 5E6OA 2BKFA 3IFWB 1I42A 3LDZE 3EHVA 3AULA 3ZTDA 2KDBA 4HPMB 1WR6E 2N4FA 3PVLA 4K7UA 2BYVE 1KM7A 4GDKB 2EKEC 3PREA 4KIKB 1GG3A 2L0FA 4GDLA 5CHWA 5J2RA 3DBLI 3B0AA 4MSMB 4RM9A 3ZRCA 4W9HA 3WALA 2C60A 2IO2B 5L83A 2L00B 2D11A 1WX7A 4MJSA 4E71A 5HKHA 1HE8A 3DBSA 2PEAA 2JZZA 4LDTD 2KHWB 1IPGA 4II2B 4DHZE 2RSUA 1NI2A 4BBNF 2M4NA 2CHWA 1WE7A 1LFDA 3H9DA 4JIOU 3QWZB 4MH0E 2L7RA 3OLMD 4X57B 2OOBB 3VTWA 1S1QB 1A5RA 2ZNVB 4ASWC 2KXJA 3L16A 2JRIB 2EMSA 3CSFA 3HHMA 2KC2A 2GBRA 4NNJB 4TUUA 3WAMA 2IYDB 1LXDA 2FCNA 1WJNA 3TL5A 2IO0B 2ZCBA 4NY0A 3ZNID 3PRPB 2OJRA 4BKGA 2MBBB 2YVCA 4K1RB 1KLVA 1U4AA 1WXAA 1OQYA 4IM3A 4GOCA 2BWES 4PYUA 1E7VA 2QHOA 3NY5A 4IWPA 3AXCA 3MHSD 2CHXA 2NBUA 3RYTA 4B6WA 4FA6A 4HK2A 2LRUA 3PHWB 2J0JA 2ZVOA 3UIPB 1V49A 2N1WA 3DVGY 4BKSA 2KKCA 1AARA 2IY1B 1V5OA 4KDLB 3ZDMC 2O2VA 4JQWC 3DPDA 4HDQA 5AZHA 2DYMA 2MRPA 4PS3A 3ZRFA 5FR6A 2JT4B 3AI5A 2XBBC 2NPTB 4IG7B 1H4RA 1J19A 3DVNV 4IM0A 2O6VD 4LDTB 5CHVC 2AEHA 1WR1A 2MWSB 3A33B 4AUQC 2MW5A 2LRWA 2WYQA 3HIZA 3DQVA 2RGFA 4KDIC 1UD7A 3SD5A 3VHTC 1TTNA 2XEWA 3EFUA 2D2QA 4JLCA 4IWQA 2YLMA 2LJ5A 2DAJA 2W9NA 3IBEA 2AL3A 2MCNB 5JHAA 4JGHB 2V1YA 3QX1A 4ZYNA 3KUCB 2JY6A 1L2NA 3N3KB 3KYCD 3ZUNA 1LM8B 2KC1A 1UBQA 2EMTA 1QZEA 2DHZA 5DPRA 1C1YB 2KJ6A 1Q5WB 4W9IA 4FJYA 5D2MB 1E8YA 2NPTA 2C7HA 1BT0A 4JL9A 1NDDA 4B95A 2MP2B 1WH3A 2LI5A 5C23A 2PPHA 4E3CA 2KMCA 1E8WA 3M63B 4M8NA 4GSWA 2G4DB 2ZCCA 1GJZA 3D32A 4BOSC 2KLGA 2MBEA 5L95C 1VCBA 2LZ6A 4NQKE 4WWOA 3SU8X 3VQIA 2LXCA 3IG3A 1V80A 1WF9A 2B3AA 4LCDE 2Z0DB 3W1SC 2RD0A 4ZRJA 2FCMA 5E6NA 5AEKB 2O6VB 1RAXA 3U7DA 2DZJA 4IUMB 1YJ1A 2L3ZA 2I1KA 3WA0A 1LQBA 3UINB 4AP4C 4GDLB 2J0MA 2KQSA 4A20A 2K6QA 2BGFA 4ANWA 4AJYB 1EUVB 1WY8A 2G3QB 2KQ7A 2KK8A 4HXDA 1WGHA 3A1QA 4MJSB 3S2AA 4FJZA 4ICVA 2K6DB 2ZNVC 3A9KB 2M8SA 3IHPC 3MJWA 4MM3A 4ZRKA 1RRBA 2KJRA 3L0WB 3PV1A 3RULA 5G55A 2I1JA 4B9KA 2DX5B 1Q0WB 4HJKA 3CSTA 3N30A 1FXTB 2NS5A 3NZSA 2CKHB 3T8MA 2O6VA 3IVFA 3RZWC 2KD0A 3DBHI 2CR5A 3RT3B 1WX9A 4W9DA 5IA7A 3KVFB 2LXAA 3QHTA 2GBNA 3C0RB 1J8CA 3CF6E 2WX0A 4TKNA 2IBIB 3VUXA 5AZGA 2K8CA 4AJWA 2DZMA 2LWPA 2K8BA 2LUEA 3DVGX 4NQLB 3V61A 3RUIB 1V2YA 4G3XB 5KHQA 2J7QB 3A9KA 3X23A 1WXMA 1WMHB 1I35A 2KTRB 4EZLA 3DVNU 4IWOA 3K9OB 5GMVA 3NHEB 3LJ3A 3ZTCA 3R7RA 1V86A 1J0GA 1TBEA 2LGYA 1V6EA 3PGEA 4IM2A 1YX5B 2KN5A 4A3PA 3ZW3A 3ZNHB 4HVBA 1S3SG 4YL8A 2O2VB 2IY0B 5J18A 1IYFA 2BYEA 3O65B 4XC2A 1P0RA 2LVOA 5DPTA 2WX1A 4PYZA 1ZW7A 3VTUA 1YIWA 1WYWB 4TV3A 2DYOA 4KZ0A 3TCAA 1TZ1A 3QQ8B 2Z0EB 5G2NA 1MG8A 3NOBA 3JYUA 4FN2A 1E8XA 4WJOA 4GIVA 4FJVB 4DHJD 4ICUA 1P1AA 4W9EA 2JPHA 2KLCA 1WMHA 2KTRA 2JWZA 1GC6A 2MSED 1YQBA 4FBJB 3M95A 1UBIA 1RFAA 2FCQA 4WJPA 3A9JB 3U8ZA 3V6EB 2LGDA 2UWQA 4DK5A 3QIJA 4LJOB 4GMVA 2ASQA 3Q3JA 3UQAA 3W1SA 2C7NB 3SHQA 1OEYJ 1WZ0A 2GMIC 4I6PA 4DBGA 2AWTA 1KOTA 4NJ7A 1WGGA 3PPAA 4P7IA 4TQ0A 4LJPB 3JSVA 2A4ZA 3VUYA 3ENEA 2NBVB 2K25A 4OVVA 3ZLZA 2AYOB 4G0NB 3PSEB 3H7SA 3N32A 1F9JA 3DOWA 2MA9B 4FULA 3WAPA 1SE9A 3A9JA 3DCGA 1XT9B 2V3SA 4N9F4 3W1YA 1D3ZA 2KX0A 1R4MI 2GOWA 2JUOA 1YX6B 4OVUA 3ZO5B 1UELA 4NJ6A 4EFOA 5JHBA 3GOEA 3I3TB 1OEYA 4GXBA 2LD9A 2G4SA 4DHJB 4EKUA 1ISNA 4DWFA 4NPNA 4KVGB 3PZDA 4A3OA 1ZGUB 2ZZPB 1H8CA 1WJ6A 2G45B 3A4SC 3A1QB 4FHKA 3RD2A 4K81A 4W9FA 2NBWB 4KZCA 3ZVVA 1XD3B 3WAOA 1OGWA 2XK5B 4DXAB 3EECA 2J0KA 3QK0A 4MGIE 3B08A 3R3MA 1WE6A 5BO4B 3VFKA 4WQOB 3TIXA 2DYBA 1NBFC 4MELA 3X0WA 1V9JA 4EZJA 3VUWA 4M0WB 4GB9A 3APDA 4E74A 1XQQA 4CYEA 2IO1B 2KDEB 3KUDB 4W9JA 3PS6A 4EUTA 3H7PB 2BWFA 4WWPA 2JF5A 3MTNB 4URKA 5JH5C 2BF8B 2R2QA 3TJPA 1E8ZA 2HJ8A 1Y8RC 2K39A 3ML9A 2M0XA 5IAAC 2HTHA 2KWVB 3HM3A 3ZNZB 1WIAA 2KX3A 5CTRC 2MLBA 1Q1OA 2L0TA 4HDOA 3GZNI 2HE7A 5CHFA 2KVRA 2M17A 2XK5A 3UGBB 3PRZA 5J17A 2MBQA 2K1FA 4ANUA 2K8HA 1WM3A 3UIOB 3EC8A 2Z59B 2L05A 3R66C 3L13A 3APFA 2D07B 3ONSA 2A5UA 4DHZB 4FHJA 4F1SA 3UQBA 3ZDTA 1Z2MA 1VD2A 4AOFA 3AU5A 3VH3B 3WANA 2HD5B 3KYDD 1GUAB 2GBJA 2MX2A 3V62A 2MBOA 3H7PA 2DENB 3HM6X 4DDID 4DDGD 1X1MA 2RR9A 2IZVB 2NVUI 2KJHB 5AZFA 2PE9A 2ZEQA 2KFKB 3OJ3A 3QJZA 1V81A 3ZIMA 2D10A 2N9PC 2KDFB 1WFYA 3QARA 3VTVA 4ZRIA 2LVPA 3HK0A 2BPSA 2N7EA 4ANXA 3QCAA 4XZ4A 1WZ3A 4I6NB 2VRRB 2KMAA 2CHZA 5DCNA 1R4NI 2PE6B 1T0YA 2KFJA 2N7DA 3L17A 2N1VA 1Z5SB 4CO7A 4M8MA 2CS4A 2KDIA 2KO3A 2JRHA 4G11A 3TBLD 3JSVB 4J6IA 2JXXA 1V5TA 2ZPYA 4HPLB 2FIDA 4KSLC 4WJQA 4WAAA 2KFKA 3ECIA 2KOXA 4MEMA 1SIFA 2PJHA 3L54A 5CX3A 2KANA 3ALBA 1WX8A 3KH0A 1IP9A 2WDTB 3ZKJC 1WRDB 1E7UA 4EZKA 3RCZA 4ANVA 4KSKC 2L76A 3A4RA 4GDKA 1WXSA 4KIKA 3V6CB 3PT2B 4TQ1A 2ZVNA 4BFRA 4BVUC 1M94A 4W9KA 3JW0X 3QA8A 4K7WA 3UF8A 3VH4B 4FADA 2C9WB 1UGMA 3H1UA 4HWIB 3PHXB 4WWNA 4MGKE 1EO6A 2RPQA 1KJTA 2C7MB 4BOZB 1C3TA 3KW5B 2DAFA 3H6NA 1L7YA 2KWCA 4BBNC 4G50A 4RM8A 1E90A 5D94A 4MSQB 2AL6A 3PLVA
chains in the Genus database with same CATH superfamily
3P2BA 3AE8B 2Y3AA 3KWLA 1TJEA 4L1BA 1SF0A 5EDSA 3TEZA 4C4VA 2BB5A 2CU1A 5D6JB 4NJCA 2BKRB 1I4XA 2HJ1A 3BK1A 2BYFA 3K9PB 4K7SA 2N9XA 2PKOA 3APCA 1WI0A 1MVKA 1YOVB 2LGXA 1P98A 1WGYA 1FNWA 2M1MA 4II3B 4US9A 4W9GA 3U30A 1EF5A 4PS7A 1D5ZC 4EEWA 2JYEA 4NAWA 2IGGA 4YTNB 4F8CB 2MQJA 1NYQA 4YTPB 2KVZA 4P16A 1NEKB 2R2OA 2V4LA 3OJ4B 5EE1A 4DQOC 1WXVA 3HVDA 3L10B 4C56C 3W9CB 3AE1B 2UYZB 3PZ7A 4W9CA 3IFWB 4NZLB 2W54A 3AULA 3ZTDA 1L6VA 2KDBA 3PVLA 1YQ3B 2BYVE 1ZPSA 3NZ3A 4KIKB 1ZXHA 5CHWA 2LHEA 4HJGE 4RM9A 5G5GA 4W9HA 3WALA 2C60A 2D3AA 2WNMA 2JZZA 3N1YC 1IPGA 1NI2A 3QWZB 2L7RA 1FNVA 3OLMD 1RFKA 2BW2A 1S1QB 2ZNVB 4ASWC 3L16A 4O1NA 4NNJB 3CSFA 4TUUA 2GBRA 2JX5A 2IYDB 1QILA 4B0MA 2ZCBA 4BKGA 4GOCA 3R8BA 3NY5A 4IWPA 2WDVB 2XNAC 4DXGA 2ZVOA 1V49A 2N1WA 3DVGY 4BKSA 3PZ8A 4HDQA 1HZ5A 3ZRFA 3AI5A 2XBBC 2NPTB 2VZKD 2O6VD 4AUQC 2MWSB 2LRWA 2RPVA 2WXIA 4KDIC 1TTNA 3EFUA 1QF6A 2DAJA 2INCC 1C77A 5D3IB 3ZUNA 1LM8B 2KC1A 1JALA 1AW7A 2DHZA 1C1YB 1ZE3D 1E8YA 1BT0A 4H2AA 4B95A 2MP2B 2KMCA 4BOSC 2KLGA 3RNBC 3SU8X 3VQIA 4LCDE 2Z0DB 1DGJA 3ZJVA 3EUB2 2JWUA 5AEKB 2QCZA 5EE3A 1JCKB 1RAXA 3KWVA 3AEBB 1LQBA 2J53A 1SE2A 1DOXA 4YT0B 4GDLB 2J0MA 3NRZA 1VZ7A 2BGFA 4ANWA 1WY8A 2G3QB 4L2YA 4JE3B 1WGHA 3A1QA 5IOIA 4MJSB 2K6DB 3A9KB 4MM3A 1WRIA 4ZRKA 2KJRA 1JWBD 1ZDVA 3MP9A 4HJKA 1FXTB 2NS5A 3NZSA 3CWIA 2K5PA 3VR8B 1V97A 1WX9A 3FAHA 1ENFA 2GBNA 3C0RB 3CF6E 2WX0A 1L0YB 2CJNA 2K8BA 3RUIB 1V2YA 2W3SA 3HRDD 1SB3C 1I35A 1K52A 2KTRB 2BS4B 4IWOA 5GMVA 3NVWA 5HHDG 3LJ3A 1SJED 3PGEA 1KTKA 1GAQB 1YX5B 1S3SG 3J9CA 2KQ4X 2JXTA 1ZW7A 1YIWA 1I7HA 1WYWB 4TV3A 1XO3A 4KZ0A 3P4SB 1E8XA 4GIVA 3T3OA 2WQYB 4JPSA 1VDVA 2KLCA 5HG2A 1N5XA 1F1HA 3M95A 1FD6A 1SIJA 4WJPA 4AS1A 4YSYB 3W1SA 2C7NB 3SHQA 1WZ0A 4I6PA 1JROA 1EWCA 4LJPB 3VUYA 1MJDA 1WYGA 3ENEA 2NBVB 2K25A 5H8YE 1JMLA 3ZLZA 4G0NB 1F9JA 2MA9B 5C2TB 3A9JA 3DCGA 4N9F4 1FCCC 1UWMA 2GOWA 2JUOA 2GLSA 3P63A 3ZO5B 1QOGA 3I3TB 4GXBA 2FUG1 3P1MA 2V4IB 1ISNA 1LGRA 1QOFA 3EGRA 1ZGUB 2ZZPB 1TZOA 3ZXVA 2NBWB 1XD3B 4RGTA 2CJOA 2XK5B 4PT5A 4RGNA 3T3NA 1XXGA 5AUIA 1WE6A 3VFKA 2TSSA 1NBFC 3X0WA 3Q2AC 1V9JA 4XE0A 4GB9A 3APDA 4E74A 3KUDB 2KDEB 3PS6A 1C79A 2BF8B 2HJ8A 1Y8RC 4TMAB 1T0SC 1JWUD 1NVID 1Q1OA 1CZPA 2KVRA 2M17A 3AE6B 3C19A 1ET6A 3RNGC 4K3CA 5D3DA 2D07B 3W2DA 1PFDA 4DHZB 4FHJA 1VD2A 4AOFA 3AU5A 3WANA 3KYDD 3V62A 3ZGZA 3H7PA 2DENB 3HM6X 2RR9A 2WXGA 2ZEQA 4ZRQA 4LLGM 1L0VB 2D10A 2QEJC 1JWMD 3AEEB 2JZPA 3VTVA 1JRPA 2N7EA 4XZ4A 2MHJA 1QKZA 2KMAA 1WSPA 4GLSC 3UI3A 1T0YA 2K0PA 3DWMA 1QQRA 5EE0A 3TBLD 4J6IA 2JXXA 2PJHA 3BVMA 1IP9A 2WDTB 1WRDB 2RMMA 1EU4A 5C3JB 4KIKA 3PT2B 4BFRA 1WGKA 3QA8A 3UF8A 1UWXA 3H1UA 4HWIB 4LK0M 2RPQA 2C7MB 4BOZB 3KW5B 2WXQA 3H6NA 1NYRA 1TY0A 4BBNC 4G50A 1K51A 3PLVA 2KTFA 3JVZX 1VZ6A 2DLBA 4RGMA 3RNFC 4EE2A 3M3JA 4W9LA 5E6PA 5LLIA 3NUHB 2L8JA 2BVCA 3B1LX 2C5LC 3BIID 3M62B 3AU4A 3OAWA 3U7ZA 4NAMA 3BINA 2KMMA 5JZEB 1P9DU 3SEBA 4BKTA 3BWUD 1GNUA 3WIMA 4GGQA 1VLBA 2FE8A 1QLBB 2LEKA 4RCOA 2FUHB 2MJ3A 5TR5A 4AWJA 4HCNB 1IUEA 2NCNA 1TKEA 3PLUA 2WXJA 4WURA 1XCQL 3R7QA 2WWZA 3VAWA 4I6LB 3MJ5A 4N59A 1SE4A 4BKSD 2JZ3B 3L08A 3KUZA 5LXIB 1XF5L 2ZPNA 3IT4B 1XLOA 2MP2A 3TEYA 2JVCA 3PTFC 1P3QU 4MGYE 5C1ZA 2FAZA 1E9MA 1RWSA 3Q3FA 2IPKD 4CHKA 2REXA 4GN1A 4GU2A 4P6VF 4HLEA 1FPYA 4D2KA 2BKFA 1SXTA 1ET9A 3LDZE 5BMGA 2DWQA 4K7UA 1WR6E 2N4FA 1N6ZA 2OEDA 3O13A 3N20C 4GDKB 4KKIA 4GDLA 3ZXRA 4MSMB 3DBRB 3RNCC 5L83A 2D11A 1WX7A 4MJSA 4E71A 5HKHA 4II2B 2RSUA 2M4NA 4LNKA 4JIOU 3EA6A 4MH0E 1HTQA 1PGAA 2KXJA 2KC2A 2MH7A 1LXDA 1WJNA 2IO0B 2ON8A 5BMIA 1TT5B 2YVCA 1IGCA 1KLVA 4IM3A 2BWES 1ROEA 3OWEB 2LJIA 4HROA 4PYUA 2QHOA 4B6WA 4ARIA 4FA6A 1YJIA 3PHWB 3MC8A 1YNTE 4US8A 1V5OA 1PDXA 3L4PA 4JQWC 2DYMA 2MRPA 1FRRA 3A33B 2MW5A 1E10A 3HIZA 2WXHA 3SD5A 2D2QA 4S17A 1HXYD 4OVZA 3Q3NC 1YMHE 2AL3A 5JHAA 2W3RA 4JGHB 2V1YA 3IXSA 1L2NA 3KYCD 2EMTA 1QZEA 5DPRA 3N1ZC 3FC4A 4W9IA 3GE3C 4FJYA 2C7HA 3HUIA 1NDDA 1YN3A 2KT7A 1WH3A 5C23A 2QJLA 3M63B 2ONQA 4Q2JA 4USAA 3D32A 4P1BC 5L95C 4NQKE 2OJWA 2LXCA 1WF9A 1MHHE 2B3AA 1T0RC 2RD0A 4ZRJA 2VZKB 1Q10A 2ACZB 2BQQA 2O6VB 2WXFA 1VRAB 2L3ZA 2KQSA 1EUVB 1BMLC 2KQ7A 2KWDA 4HXDA 3S2AA 3V3XA 4ICVA 2ZNVC 3MJWA 3TEWA 3RULA 1Q0WB 3NG0A 1VR9A 3T8MA 1IGDA 4HRSA 3DHGC 3E9SA 2KD0A 2CR5A 4W9DA 3Q8BA 4B0EA 1L0XB 1WXQA 3TSSA 2DZMA 5GXGB 4NQLB 1N60A 4ZRPA 4YTMB 3BZDB 3Q8EA 3ZTCA 3R7RA 1V86A 3TEXA 3GE8C 4A3PA 1V6EA 4IM2A 4HVBA 3ZW3A 3VRAB 5J18A 2BYEA 2QDFA 1VJKA 2WXOA 1TIFA 5DPTA 1GOZA 3VTUA 2DYOA 1TZ1A 5G2NA 4UDUC 3JYUA 4WJOA 5IKCM 4ICUA 1P1AA 1WMHA 2JWZA 2D5GA 2MSED 1KFYB 3V6EB 3Q69A 2UWQA 4DK5A 4LJOB 2ASQA 4C7YA 1OEYJ 2GMIC 4DBGA 2AWTA 4TQ0A 2DNFA 1GB4A 4OVVA 1MI0A 3DOWA 1D6EC 4FULA 1NENB 2H88B 1XT9B 1D3ZA 2KX0A 1R4MI 4RF0A 1UELA 3AM9A 4NJ6A 2KDMA 4YWGG 2YEPF 4WIPA 3GOEA 2G4SA 4BZAA 4DWFA 2IJ0A 3PZDA 1H8CA 1WJ6A 4A6QA 3AE4B 1IBXA 3RD2A 4RNAA 4W9FA 1ZP0B 3WAOA 2INPE 2MEKA 1FMAD 2N9KA 1I4QA 5BO4B 4MACA 4WQOB 3MFGA 2Z8LA 4IOIE 4EZJA 3VUWA 4M0WB 4WH4A 4CYEA 2IO1B 4W9JA 1HA5A 4WWPA 2BWFA 4URKA 3MTNB 2Y5PA 5JH5C 2WHIA 2HTHA 1WIAA 2KX3A 2MLBA 2B76B 4HDOA 3GZNI 1E6EB 5J17A 2MBQA 2K8HA 1T5XD 2Z59B 3APFA 2IGDA 2A5UA 4AQ7A 1AN8A 4RGOS 1D5MC 2MBOA 3CIRB 4DDID 4DDGD 1X1MA 2IZVB 5EE9A 2PE9A 2KFKB 5IP4D 3BYYB 3ZIMA 3MC0B 4ZRIA 2LVPA 2BPSA 2PIAA 4I6NB 2WU5B 1XLPA 2VRRB 2CHZA 5DCNA 1R4NI 2PE6B 2QC8A 2RDGA 3L17A 2N1VA 3RNAC 1Z5SB 4CO7A 4IDIA 2KDIA 2JRHA 2WLBA 1FNUA 4WAAA 3ECIA 4ZHPA 2KOXA 1SIFA 4OW0A 3L54A 1P7EA 2YEPB 1A70A 2BYTA 1E7UA 3P4QB 1R7SA 3A4RA 4GDKA 1WXSA 3BK2A 4IKGA 1D4BA 4K7WA 4KGRA 4FADA 3LYYA 1UGMA 1EO6A 1KJTA 4JWUC 1CJEA 1ZUD2 1CQVA 1L7YA 2AL6A 3FILB 3SDLC 1BUIC 1UZXB 3AB5A 3ZNGC 2CU3A 4KV2A 1C78A 1OFFA 2QMTA 1WGDA 2DZKA 4CQNA 1YD8U 3N9YC 4YSZB 5LXHA 1C9FA 1ZKHA 2KZRA 4FLHA 1WGRA 2GBKA 2JQRB 2MBHA 3VVWB 2KNBA 4NAWB 1V1PB 2VH1A 3QAQA 3BYTB 3ML8A 2FCSA 3VXWA 2V0GA 2QILA 2KWUB 3DDCB 3KQ4A 3U2SC 3C8YA 1UH6A 2DBYA 2VH2A 1F52A 2LASA 2JYTA 2WXRA 1OTRB 1WM2A 4L23A 2K22A 3RZFA 4F7ZA 2INNE 3T9LA 2OHFA 1RLFA 1CMXB 3NZUA 1M4VA 1N5WA 5HFYA 4KX6B 1WJ4A 4M02A 5BYSA 3GP7A 2ZJDA 3CMMB 1SGHA 1NI3A 4ZOHC 1B1ZA 3Q8CA 1K8RB 3VDZA 1XCTL 2N9EB 4A8XC 2Y5CA 3EHVA 3Q8FA 4HPMB 1SJHD 1KH0A 1T6BX 3PREA 1GG3A 5J2RA 3B2GA 3ZRCA 2IO2B 1PYWD 2L00B 1XLQA 3WCQA 1GPXA 2PEAA 4LDTD 1FM0D 3MC9A 2N7JA 5FKAC 4DHZE 2WGSA 4BBNF 2CHWA 2LFIA 4OZCA 2LGIA 2LHDA 4EZKA 3HHMA 2WDRB 3GB1A 3TL5A 1KRHA 4NY0A 3ZNID 2OJRA 4RFBA 2MBBB 4K1RB 1U4AA 1WXAA 1OQYA 1L4DB 1UUPA 1E7VA 3AXCA 2CHXA 1FEHA 4WAFA 2LRUA 4C80A 2J0JA 1AARA 3AMZA 1TKYA 3ZDMC 2J52A 3DPDA 1XEEA 4PS3A 2JT4B 1H4RA 5CHVC 1QOAA 2D3BA 2AEHA 4A9AA 2K9XA 1UD7A 3VHTC 2XEWA 2E6XA 2YLMA 1HTOA 2LJ5A 3ZQ4A 2PVOD 3R2IA 3IBEA 3QX1A 2JY6A 1ZDXA 4JX1C 1UBQA 5LNK1 2QSDA 1Q5WB 2NPTA 4JL9A 1EM7A 2LUMA 2PPHA 4E3CA 1I4GA 2M19A 1F2RC 1I4HA 2ZCCA 4MM3B 1GJZA 2WXKA 2LZ6A 2RDHA 3IG3A 1V80A 1TS3A 3W1SC 4WQMA 2HDEA 4LNIA 1MG4A 4IUMB 3RN9C 2WS3B 2AX5A 3WA0A 3UINB 1LO5D 2K6QA 2KAJA 4AJYB 1YN4A 4S0RA 1QT9A 2KK8A 2BBCA 2LMCA 4FJZA 2RDBC 3L0WB 2SEBD 5G55A 1KLUD 2CKHB 2AQ1B 3IVFA 3RZWC 4M0WA 3DBHI 2WXLA 1YN5A 5IA7A 2LXAA 1UNSA 1J8CA 3I63C 2IBIB 1N62A 3VUXA 3GZNB 5AZGA 1F0ZA 3RNEC 4HKZE 3VR9B 5FK9C 3DVGX 5KHQA 4G3XB 2J7QB 3A9KA 1WXMA 3SFEB 3DVNU 3W5VB 4RF1A 2PLPA 5IN7A 3TUOA 1TBEA 2LGYA 1EWYC 4C7ZA 2GRIA 3ZNHB 2O2VB 4LTUA 4OZAA 2PW9A 3Q8AA 1JQ4A 3O65B 4XC2A 1P0RA 1FXIA 2KACA 4PYZA 1UGJA 2BTEA 1C4PA 1MG8A 1J7BA 3ZJTA 2SAKA 4FJVB 3AH7A 4DHJD 1DYQA 2JPHA 4LNFA 2KTRA 3H8HA 1GC6A 1YQBA 3VRBB 2FCQA 3A9JB 1GB1A 2PMVA 4LNOA 5MPOA 2LGDA 2ZW0A 2WXNA 3QIJA 4GMVA 3Q3JA 3OG5A 4NJ7A 2M56B 1PUTA 3AEDB 2A4ZA 5BYQA 3AE5B 2KYWA 3H7SA 3N32A 1ESFA 3WAPA 2V3SA 3W1YA 4EFOA 3Q3MC 1C4AA 1OEYA 3BVGA 2LD9A 4EKUA 2ICIA 3B9JA 2G45B 2Q5WD 2M0AA 4KZCA 3I9V1 3ZVVA 1E0ZA 1N63A 2L83A 2J0KA 3NJTA 3QK0A 3B08A 3TIXA 2DYBA 2V3PA 4MELA 3FILA 1BXTA 1XQQA 4EUTA 3H7PB 2JF5A 1E8ZA 3ML9A 5IAAC 3AEFB 2L52A 5IO9A 3IAM1 2L0TA 2XK5A 3UGBB 1V1PA 4BAXA 2L05A 4KKJA 3SR6A 3URYA 3UQBA 1B9RA 2BB6A 3ABVB 3ZDTA 1TYGB 2PTLA 1L4ZB 5T8IA 3RFZB 2KJHB 3OJ3A 3DWGC 3NVZA 1V81A 1C4CA 2R61A 1TKGA 5JXVA 1WFYA 1PGBA 3HK0A 3QCAA 3R2TA 4MH8A 2ZW1A 2IGHA 3E56A 2KFJA 4XYCA 1UF0A 3AN1A 2NTTA 4M8MA 1ZOYB 2CS4A 3AE2B 1SEBD 3JSVB 1V5TA 4KSLC 4WJQA 5CX3A 1SE3A 1TS2A 1WX8A 3ZKJC 1J7CA 1C76A 3ETRA 4KSKC 3NS1A 4TQ1A 1M94A 3JW0X 1CK1A 2C9WB 1F77A 3P4PB 4WWNA 4XWWA 4KGTA 3P4RB 4RM8A 5D94A 4MSQB 3DHHC 3V60A 4ZDVA 1Y56A 2NR2A 1YJJA 2FIFA 2I38A 3NS8A 2IO3B 2WP9B 3AV8A 3TMPB 1EF1A 3QC8B 4PS8A 1AYFA 1PQSA 2LVQA 2N9LA 3PO0A 4WJNA 5G5HA 2JSVX 4ACFA 1MHXA 5DPSA 4DXFA 1SSNA 3Q6BA 4HCPB 4MDKE 4IW0A 5BYRA 1E5WA 3AE9B 3BY4B 1T3QA 2AQ2B 4RMAA 3ZYYX 3MHZA 1FRDA 3U4EG 1STEA 1WWTA 4XX5A 1G6JA 3PRMB 2H89B 2WXPA 2DZIA 2D3GA 1HQRD 1F2RI 2W55A 5DPWA 2GBMA 5D7GA 5KHOA 1L5PA 2XN9C 1GC7A 1WJUA 4MGZE 3DBRI 2E3TA 4EOYA 1TGZB 2Y5BB 4IC7B 1JRUA 4OHJA 2FNJB 3BVZA 3AECB 5E6OA 1I42A 1P7FA 1KM7A 2EKEC 2LGSA 2L0FA 2J42A 3DBLI 3B0AA 1HE8A 3DBSA 2KHWB 1FCLA 1WE7A 3DBHB 1LFDA 3H9DA 2FBWB 4X57B 2OOBB 1FFVA 3ZJUA 3VTWA 1A5RA 3NVVA 1EU3A 2I2YA 2JRIB 2EMSA 3WAMA 4XGAB 1J7AA 3AE7B 1MPEA 2X38A 2FCNA 4J3OD 4HKQA 1K50A 3NVYA 3PRPB 4KGSA 3I57A 4C00A 3MHSD 3RYTA 2NBUA 4C4VB 3AEAB 4HK2A 3UIPB 2KKCA 4P1CC 1JW9D 2IY1B 4XDCA 4KDLB 2O2VA 5AZHA 5FR6A 4IG7B 3DVNV 1J19A 4IM0A 4LDTB 4MT5A 1WR1A 2BS3B 2NTSA 2WYQA 4M01A 3DQVA 2L1AA 2RGFA 3LXFA 4JLCA 4IWQA 2W9NA 2MCNB 4ZYNA 3KUCB 3SFDB 3N3KB 3Q3OC 2KJ6A 5D2MB 3Q14C 2LI5A 1OQQA 1E8WA 4M8NA 4GSWA 2PVGC 2G4DB 2MBEA 1VCBA 4WWOA 1L6UA 1I4RA 1JWAD 2FCMA 5E6NA 1N61A 3U7DA 2DZJA 1YJ1A 1MFWA 1FO4A 2I1KA 4YXDB 2G1EA 4AP4C 4A20A 1T0QC 1RYJA 1KF6B 1FXAA 3IHPC 2M8SA 1RRBA 3PV1A 2I1JA 4B9KA 2D3CA 2DX5B 3CSTA 3N30A 2O6VA 2MJDA 2WU2B 4QAYA 3V05A 3RT3B 4PK1A 1DOYA 3KVFB 3QHTA 4TKNA 2K8CA 4AJWA 1FFUA 2LWPA 2LUEA 5AUKA 3V61A 3X23A 1WMHB 4EZLA 3K9OB 3NHEB 5E6JA 5HI1A 1ACCA 1D5XC 1QOBA 2V9HA 1J0GA 1VZ8A 2KN5A 4YL8A 2IY0B 2MJEA 1IYFA 2LVOA 2WX1A 4R3DA 3TCAA 3EFCA 3QQ8B 4XDDA 5TSSA 2Z0EB 1YQ4B 4FN2A 3NOBA 3LB8C 4W9EA 4FXCA 3GS2A 4HEA1 4K3BA 4FBJB 5I4DA 1UBIA 2AQ3B 1RFAA 3U8ZA 2UU7A 3P42A 2EELA 3UQAA 1K53A 2V3NA 4ZHOA 1JWSD 3AEGB 1KOTA 4ITKA 1WGGA 3PPAA 4RH6A 4P7IA 3JSVA 1TS5A 4LNNA 1IBXB 2EKIA 2WXMA 2AYOB 3PSEB 3DHIC 1SE9A 1XLNA 4YSXB 4JWSC 1YX6B 2BT6A 3AE3B 4OZBA 4OVUA 4M00A 5JHBA 3HVZA 2GI9A 1FIQA 1ZXIA 4DHJB 3IT6B 2L32A 4NPNA 4KVGB 4A3OA 3A4SC 3A1QB 4FHKA 4K81A 3I5JC 4WWMA 1OGWA 1R4MB 5FR3A 1V8CA 3FKYA 4DXAB 3KLSX 3EECA 5H92C 4MGIE 1TY2A 3R3MA 3RPFC 2K3UA 1PGXA 5BMHA 3TJPA 2R2QA 1TS4A 2INDC 2K39A 2M0XA 2NMQA 2KWVB 3HM3A 3ZNZB 5CTRC 1HZ6A 3U52E 2HE7A 5CHFA 3B2FA 3PRZA 2K1FA 4ANUA 3UIOB 1WM3A 3EC8A 1V1OA 3R66C 3L13A 2QIEB 1HEZE 1I4PA 3ONSA 4F1SA 1Z2MA 3VH3B 2HD5B 1GUAB 2GBJA 2MX2A 4N58A 1DOIA 2NVUI 5AZFA 1KLGD 4A90A 3QJZA 2BS2B 1OQRA 2N9PC 2KDFB 3QARA 2G9HD 2X8XX 4ANXA 2J4XA 4N6EB 1WZ3A 2W82A 1E7PB 2N7DA 2KN4A 4TSSA 4ARCA 4A55A 2KO3A 3N1XC 4G11A 2JU6X 1SBBB 4REZA 2ZPYA 4HPLB 2FIDA 2KFKA 4MEMA 2WDQB 3RI7C 2KANA 1R4NB 3ALBA 3KH0A 2N0SB 3DBLB 3RCZA 4ANVA 2L76A 2HTME 3V6CB 2IDYA 2ZVNA 4BVUC 4W9KA 3VH4B 3RMKC 2GB1A 3PHXB 1AWDA 4MGKE 4HPPA 1C3TA 4XWTA 3IAS1 3W5UB 1RM6C 2DAFA 2KWCA 1E90A 4ZYSA
chains in the Genus database with same CATH topology
3P2BA 2KTFA 3SDLC 1UZXB 3ZNGC 4KV2A 3JVZX 1WGDA 2DZKA 3V60A 4ZDVA 2NR2A 1YD8U 2FIFA 3M3JA 4W9LA 5E6PA 5LLIA 3NS8A 2L8JA 5LXHA 2IO3B 5EDSA 1ZKHA 2KZRA 4FLHA 1WGRA 2GBKA 2MBHA 3TMPB 2CU1A 1EF1A 3B1LX 3QC8B 2C5LC 5D6JB 3VVWB 2KNBA 2BKRB 3M62B 4PS8A 1PQSA 2LVQA 3AU4A 3OAWA 4NAWB 3QAQA 2BYFA 3ML8A 3BINA 3K9PB 4K7SA 2N9XA 4WJNA 5JZEB 2FCSA 1P9DU 3VXWA 3APCA 4BKTA 1WI0A 2KWUB 5DPSA 1GNUA 2LGXA 3DDCB 1P98A 1WGYA 1UH6A 3WIMA 4HCPB 4GGQA 2M1MA 4MDKE 4IW0A 4II3B 4W9GA 2LASA 2FUHB 1E5WA 3U30A 5TR5A 4AWJA 1EF5A 3BY4B 1OTRB 4HCNB 1WM2A 4PS7A 2NCNA 4RMAA 3PLUA 4EEWA 3R7QA 4NAWA 2WWZA 3RZFA 3VAWA 4F7ZA 4F8CB 4I6LB 1G6JA 4XX5A 3PRMB 3T9LA 2MQJA 2JZ3B 4BKSD 3L08A 2DZIA 3KUZA 1RLFA 1CMXB 3NZUA 5LXIB 2D3GA 2ZPNA 2R2OA 5DPWA 2V4LA 2GBMA 2MP2A 3OJ4B 5D7GA 1WJ4A 5KHOA 2JVCA 3PTFC 1WXVA 1P3QU 3L10B 1GC7A 1WJUA 4MGYE 2ZJDA 3CMMB 5C1ZA 1SGHA 2FAZA 4MGZE 3DBRI 3Q3FA 4CHKA 4EOYA 1TGZB 2REXA 2Y5BB 4GN1A 4GU2A 1K8RB 2UYZB 4IC7B 1JRUA 3VDZA 4HLEA 2FNJB 2N9EB 4W9CA 5E6OA 2BKFA 3IFWB 1I42A 3LDZE 3EHVA 3AULA 3ZTDA 2KDBA 4HPMB 1WR6E 2N4FA 3PVLA 4K7UA 2BYVE 1KM7A 4GDKB 2EKEC 3PREA 4KIKB 1GG3A 2L0FA 4GDLA 5CHWA 5J2RA 3DBLI 3B0AA 4MSMB 4RM9A 3ZRCA 4W9HA 3WALA 2C60A 2IO2B 5L83A 2L00B 2D11A 1WX7A 4MJSA 4E71A 5HKHA 1HE8A 3DBSA 2PEAA 2JZZA 4LDTD 2KHWB 1IPGA 4II2B 4DHZE 2RSUA 1NI2A 4BBNF 2M4NA 2CHWA 1WE7A 1LFDA 3H9DA 4JIOU 3QWZB 4MH0E 2L7RA 3OLMD 4X57B 2OOBB 3VTWA 1S1QB 1A5RA 2ZNVB 4ASWC 2KXJA 3L16A 2JRIB 2EMSA 3CSFA 3HHMA 2KC2A 2GBRA 4NNJB 4TUUA 3WAMA 2IYDB 1LXDA 2FCNA 1WJNA 3TL5A 2IO0B 2ZCBA 4NY0A 3ZNID 3PRPB 2OJRA 4BKGA 2MBBB 2YVCA 4K1RB 1KLVA 1U4AA 1WXAA 1OQYA 4IM3A 4GOCA 2BWES 4PYUA 1E7VA 2QHOA 3NY5A 4IWPA 3AXCA 3MHSD 2CHXA 2NBUA 3RYTA 4B6WA 4FA6A 4HK2A 2LRUA 3PHWB 2J0JA 2ZVOA 3UIPB 1V49A 2N1WA 3DVGY 4BKSA 2KKCA 1AARA 2IY1B 1V5OA 4KDLB 3ZDMC 2O2VA 4JQWC 3DPDA 4HDQA 5AZHA 2DYMA 2MRPA 4PS3A 3ZRFA 5FR6A 2JT4B 3AI5A 2XBBC 2NPTB 4IG7B 1H4RA 1J19A 3DVNV 4IM0A 2O6VD 4LDTB 5CHVC 2AEHA 1WR1A 2MWSB 3A33B 4AUQC 2MW5A 2LRWA 2WYQA 3HIZA 3DQVA 2RGFA 4KDIC 1UD7A 3SD5A 3VHTC 1TTNA 2XEWA 3EFUA 2D2QA 4JLCA 4IWQA 2YLMA 2LJ5A 2DAJA 2W9NA 3IBEA 2AL3A 2MCNB 5JHAA 4JGHB 2V1YA 3QX1A 4ZYNA 3KUCB 2JY6A 1L2NA 3N3KB 3KYCD 3ZUNA 1LM8B 2KC1A 1UBQA 2EMTA 1QZEA 2DHZA 5DPRA 1C1YB 2KJ6A 1Q5WB 4W9IA 4FJYA 5D2MB 1E8YA 2NPTA 2C7HA 1BT0A 4JL9A 1NDDA 4B95A 2MP2B 1WH3A 2LI5A 5C23A 2PPHA 4E3CA 2KMCA 1E8WA 3M63B 4M8NA 4GSWA 2G4DB 2ZCCA 1GJZA 3D32A 4BOSC 2KLGA 2MBEA 5L95C 1VCBA 2LZ6A 4NQKE 4WWOA 3SU8X 3VQIA 2LXCA 3IG3A 1V80A 1WF9A 2B3AA 4LCDE 2Z0DB 3W1SC 2RD0A 4ZRJA 2FCMA 5E6NA 5AEKB 2O6VB 1RAXA 3U7DA 2DZJA 4IUMB 1YJ1A 2L3ZA 2I1KA 3WA0A 1LQBA 3UINB 4AP4C 4GDLB 2J0MA 2KQSA 4A20A 2K6QA 2BGFA 4ANWA 4AJYB 1EUVB 1WY8A 2G3QB 2KQ7A 2KK8A 4HXDA 1WGHA 3A1QA 4MJSB 3S2AA 4FJZA 4ICVA 2K6DB 2ZNVC 3A9KB 2M8SA 3IHPC 3MJWA 4MM3A 4ZRKA 1RRBA 2KJRA 3L0WB 3PV1A 3RULA 5G55A 2I1JA 4B9KA 2DX5B 1Q0WB 4HJKA 3CSTA 3N30A 1FXTB 2NS5A 3NZSA 2CKHB 3T8MA 2O6VA 3IVFA 3RZWC 2KD0A 3DBHI 2CR5A 3RT3B 1WX9A 4W9DA 5IA7A 3KVFB 2LXAA 3QHTA 2GBNA 3C0RB 1J8CA 3CF6E 2WX0A 4TKNA 2IBIB 3VUXA 5AZGA 2K8CA 4AJWA 2DZMA 2LWPA 2K8BA 2LUEA 3DVGX 4NQLB 3V61A 3RUIB 1V2YA 4G3XB 5KHQA 2J7QB 3A9KA 3X23A 1WXMA 1WMHB 1I35A 2KTRB 4EZLA 3DVNU 4IWOA 3K9OB 5GMVA 3NHEB 3LJ3A 3ZTCA 3R7RA 1V86A 1J0GA 1TBEA 2LGYA 1V6EA 3PGEA 4IM2A 1YX5B 2KN5A 4A3PA 3ZW3A 3ZNHB 4HVBA 1S3SG 4YL8A 2O2VB 2IY0B 5J18A 1IYFA 2BYEA 3O65B 4XC2A 1P0RA 2LVOA 5DPTA 2WX1A 4PYZA 1ZW7A 3VTUA 1YIWA 1WYWB 4TV3A 2DYOA 4KZ0A 3TCAA 1TZ1A 3QQ8B 2Z0EB 5G2NA 1MG8A 3NOBA 3JYUA 4FN2A 1E8XA 4WJOA 4GIVA 4FJVB 4DHJD 4ICUA 1P1AA 4W9EA 2JPHA 2KLCA 1WMHA 2KTRA 2JWZA 1GC6A 2MSED 1YQBA 4FBJB 3M95A 1UBIA 1RFAA 2FCQA 4WJPA 3A9JB 3U8ZA 3V6EB 2LGDA 2UWQA 4DK5A 3QIJA 4LJOB 4GMVA 2ASQA 3Q3JA 3UQAA 3W1SA 2C7NB 3SHQA 1OEYJ 1WZ0A 2GMIC 4I6PA 4DBGA 2AWTA 1KOTA 4NJ7A 1WGGA 3PPAA 4P7IA 4TQ0A 4LJPB 3JSVA 2A4ZA 3VUYA 3ENEA 2NBVB 2K25A 4OVVA 3ZLZA 2AYOB 4G0NB 3PSEB 3H7SA 3N32A 1F9JA 3DOWA 2MA9B 4FULA 3WAPA 1SE9A 3A9JA 3DCGA 1XT9B 2V3SA 4N9F4 3W1YA 1D3ZA 2KX0A 1R4MI 2GOWA 2JUOA 1YX6B 4OVUA 3ZO5B 1UELA 4NJ6A 4EFOA 5JHBA 3GOEA 3I3TB 1OEYA 4GXBA 2LD9A 2G4SA 4DHJB 4EKUA 1ISNA 4DWFA 4NPNA 4KVGB 3PZDA 4A3OA 1ZGUB 2ZZPB 1H8CA 1WJ6A 2G45B 3A4SC 3A1QB 4FHKA 3RD2A 4K81A 4W9FA 2NBWB 4KZCA 3ZVVA 1XD3B 3WAOA 1OGWA 2XK5B 4DXAB 3EECA 2J0KA 3QK0A 4MGIE 3B08A 3R3MA 1WE6A 5BO4B 3VFKA 4WQOB 3TIXA 2DYBA 1NBFC 4MELA 3X0WA 1V9JA 4EZJA 3VUWA 4M0WB 4GB9A 3APDA 4E74A 1XQQA 4CYEA 2IO1B 2KDEB 3KUDB 4W9JA 3PS6A 4EUTA 3H7PB 2BWFA 4WWPA 2JF5A 3MTNB 4URKA 5JH5C 2BF8B 2R2QA 3TJPA 1E8ZA 2HJ8A 1Y8RC 2K39A 3ML9A 2M0XA 5IAAC 2HTHA 2KWVB 3HM3A 3ZNZB 1WIAA 2KX3A 5CTRC 2MLBA 1Q1OA 2L0TA 4HDOA 3GZNI 2HE7A 5CHFA 2KVRA 2M17A 2XK5A 3UGBB 3PRZA 5J17A 2MBQA 2K1FA 4ANUA 2K8HA 1WM3A 3UIOB 3EC8A 2Z59B 2L05A 3R66C 3L13A 3APFA 2D07B 3ONSA 2A5UA 4DHZB 4FHJA 4F1SA 3UQBA 3ZDTA 1Z2MA 1VD2A 4AOFA 3AU5A 3VH3B 3WANA 2HD5B 3KYDD 1GUAB 2GBJA 2MX2A 3V62A 2MBOA 3H7PA 2DENB 3HM6X 4DDID 4DDGD 1X1MA 2RR9A 2IZVB 2NVUI 2KJHB 5AZFA 2PE9A 2ZEQA 2KFKB 3OJ3A 3QJZA 1V81A 3ZIMA 2D10A 2N9PC 2KDFB 1WFYA 3QARA 3VTVA 4ZRIA 2LVPA 3HK0A 2BPSA 2N7EA 4ANXA 3QCAA 4XZ4A 1WZ3A 4I6NB 2VRRB 2KMAA 2CHZA 5DCNA 1R4NI 2PE6B 1T0YA 2KFJA 2N7DA 3L17A 2N1VA 1Z5SB 4CO7A 4M8MA 2CS4A 2KDIA 2KO3A 2JRHA 4G11A 3TBLD 3JSVB 4J6IA 2JXXA 1V5TA 2ZPYA 4HPLB 2FIDA 4KSLC 4WJQA 4WAAA 2KFKA 3ECIA 2KOXA 4MEMA 1SIFA 2PJHA 3L54A 5CX3A 2KANA 3ALBA 1WX8A 3KH0A 1IP9A 2WDTB 3ZKJC 1WRDB 1E7UA 4EZKA 3RCZA 4ANVA 4KSKC 2L76A 3A4RA 4GDKA 1WXSA 4KIKA 3V6CB 3PT2B 4TQ1A 2ZVNA 4BFRA 4BVUC 1M94A 4W9KA 3JW0X 3QA8A 4K7WA 3UF8A 3VH4B 4FADA 2C9WB 1UGMA 3H1UA 4HWIB 3PHXB 4WWNA 4MGKE 1EO6A 2RPQA 1KJTA 2C7MB 4BOZB 1C3TA 3KW5B 2DAFA 3H6NA 1L7YA 2KWCA 4BBNC 4G50A 4RM8A 1E90A 5D94A 4MSQB 2AL6A 3PLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P2B A;  2KTF A;  3SDL C;  1UZX B;  3ZNG C;  4KV2 A;  3JVZ X;  1WGD A;  2DZK A;  3V60 A;  4ZDV A;  2NR2 A;  1YD8 U;  2FIF A;  3M3J A;  4W9L A;  5E6P A;  5LLI A;  3NS8 A;  2L8J A;  5LXH A;  2IO3 B;  5EDS A;  1ZKH A;  2KZR A;  4FLH A;  1WGR A;  2GBK A;  2MBH A;  3TMP B;  2CU1 A;  1EF1 A;  3B1L X;  3QC8 B;  2C5L C;  5D6J B;  3VVW B;  2KNB A;  2BKR B;  3M62 B;  4PS8 A;  1PQS A;  2LVQ A;  3AU4 A;  3OAW A;  4NAW B;  3QAQ A;  2BYF A;  3ML8 A;  3BIN A;  3K9P B;  4K7S A;  2N9X A;  4WJN A;  5JZE B;  2FCS A;  1P9D U;  3VXW A;  3APC A;  4BKT A;  1WI0 A;  2KWU B;  5DPS A;  1GNU A;  2LGX A;  3DDC B;  1P98 A;  1WGY A;  1UH6 A;  3WIM A;  4HCP B;  4GGQ A;  2M1M A;  4MDK E;  4IW0 A;  4II3 B;  4W9G A;  2LAS A;  2FUH B;  1E5W A;  3U30 A;  5TR5 A;  4AWJ A;  1EF5 A;  3BY4 B;  1OTR B;  4HCN B;  1WM2 A;  4PS7 A;  2NCN A;  4RMA A;  3PLU A;  4EEW A;  3R7Q A;  4NAW A;  2WWZ A;  3RZF A;  3VAW A;  4F7Z A;  4F8C B;  4I6L B;  1G6J A;  4XX5 A;  3PRM B;  3T9L A;  2MQJ A;  2JZ3 B;  4BKS D;  3L08 A;  2DZI A;  3KUZ A;  1RLF A;  1CMX B;  3NZU A;  5LXI B;  2D3G A;  2ZPN A;  2R2O A;  5DPW A;  2V4L A;  2GBM A;  2MP2 A;  3OJ4 B;  5D7G A;  1WJ4 A;  5KHO A;  2JVC A;  3PTF C;  1WXV A;  1P3Q U;  3L10 B;  1GC7 A;  1WJU A;  4MGY E;  2ZJD A;  3CMM B;  5C1Z A;  1SGH A;  2FAZ A;  4MGZ E;  3DBR I;  3Q3F A;  4CHK A;  4EOY A;  1TGZ B;  2REX A;  2Y5B B;  4GN1 A;  4GU2 A;  1K8R B;  2UYZ B;  4IC7 B;  1JRU A;  3VDZ A;  4HLE A;  2FNJ B;  2N9E B;  4W9C A;  5E6O A;  2BKF A;  3IFW B;  1I42 A;  3LDZ E;  3EHV A;  3AUL A;  3ZTD A;  2KDB A;  4HPM B;  1WR6 E;  2N4F A;  3PVL A;  4K7U A;  2BYV E;  1KM7 A;  4GDK B;  2EKE C;  3PRE A;  4KIK B;  1GG3 A;  2L0F A;  4GDL A;  5CHW A;  5J2R A;  3DBL I;  3B0A A;  4MSM B;  4RM9 A;  3ZRC A;  4W9H A;  3WAL A;  2C60 A;  2IO2 B;  5L83 A;  2L00 B;  2D11 A;  1WX7 A;  4MJS A;  4E71 A;  5HKH A;  1HE8 A;  3DBS A;  2PEA A;  2JZZ A;  4LDT D;  2KHW B;  1IPG A;  4II2 B;  4DHZ E;  2RSU A;  1NI2 A;  4BBN F;  2M4N A;  2CHW A;  1WE7 A;  1LFD A;  3H9D A;  4JIO U;  3QWZ B;  4MH0 E;  2L7R A;  3OLM D;  4X57 B;  2OOB B;  3VTW A;  1S1Q B;  1A5R A;  2ZNV B;  4ASW C;  2KXJ A;  3L16 A;  2JRI B;  2EMS A;  3CSF A;  3HHM A;  2KC2 A;  2GBR A;  4NNJ B;  4TUU A;  3WAM A;  2IYD B;  1LXD A;  2FCN A;  1WJN A;  3TL5 A;  2IO0 B;  2ZCB A;  4NY0 A;  3ZNI D;  3PRP B;  2OJR A;  4BKG A;  2MBB B;  2YVC A;  4K1R B;  1KLV A;  1U4A A;  1WXA A;  1OQY A;  4IM3 A;  4GOC A;  2BWE S;  4PYU A;  1E7V A;  2QHO A;  3NY5 A;  4IWP A;  3AXC A;  3MHS D;  2CHX A;  2NBU A;  3RYT A;  4B6W A;  4FA6 A;  4HK2 A;  2LRU A;  3PHW B;  2J0J A;  2ZVO A;  3UIP B;  1V49 A;  2N1W A;  3DVG Y;  4BKS A;  2KKC A;  1AAR A;  2IY1 B;  1V5O A;  4KDL B;  3ZDM C;  2O2V A;  4JQW C;  3DPD A;  4HDQ A;  5AZH A;  2DYM A;  2MRP A;  4PS3 A;  3ZRF A;  5FR6 A;  2JT4 B;  3AI5 A;  2XBB C;  2NPT B;  4IG7 B;  1H4R A;  1J19 A;  3DVN V;  4IM0 A;  2O6V D;  4LDT B;  5CHV C;  2AEH A;  1WR1 A;  2MWS B;  3A33 B;  4AUQ C;  2MW5 A;  2LRW A;  2WYQ A;  3HIZ A;  3DQV A;  2RGF A;  4KDI C;  1UD7 A;  3SD5 A;  3VHT C;  1TTN A;  2XEW A;  3EFU A;  2D2Q A;  4JLC A;  4IWQ A;  2YLM A;  2LJ5 A;  2DAJ A;  2W9N A;  3IBE A;  2AL3 A;  2MCN B;  5JHA A;  4JGH B;  2V1Y A;  3QX1 A;  4ZYN A;  3KUC B;  2JY6 A;  1L2N A;  3N3K B;  3KYC D;  3ZUN A;  1LM8 B;  2KC1 A;  1UBQ A;  2EMT A;  1QZE A;  2DHZ A;  5DPR A;  1C1Y B;  2KJ6 A;  1Q5W B;  4W9I A;  4FJY A;  5D2M B;  1E8Y A;  2NPT A;  2C7H A;  1BT0 A;  4JL9 A;  1NDD A;  4B95 A;  2MP2 B;  1WH3 A;  2LI5 A;  5C23 A;  2PPH A;  4E3C A;  2KMC A;  1E8W A;  3M63 B;  4M8N A;  4GSW A;  2G4D B;  2ZCC A;  1GJZ A;  3D32 A;  4BOS C;  2KLG A;  2MBE A;  5L95 C;  1VCB A;  2LZ6 A;  4NQK E;  4WWO A;  3SU8 X;  3VQI A;  2LXC A;  3IG3 A;  1V80 A;  1WF9 A;  2B3A A;  4LCD E;  2Z0D B;  3W1S C;  2RD0 A;  4ZRJ A;  2FCM A;  5E6N A;  5AEK B;  2O6V B;  1RAX A;  3U7D A;  2DZJ A;  4IUM B;  1YJ1 A;  2L3Z A;  2I1K A;  3WA0 A;  1LQB A;  3UIN B;  4AP4 C;  4GDL B;  2J0M A;  2KQS A;  4A20 A;  2K6Q A;  2BGF A;  4ANW A;  4AJY B;  1EUV B;  1WY8 A;  2G3Q B;  2KQ7 A;  2KK8 A;  4HXD A;  1WGH A;  3A1Q A;  4MJS B;  3S2A A;  4FJZ A;  4ICV A;  2K6D B;  2ZNV C;  3A9K B;  2M8S A;  3IHP C;  3MJW A;  4MM3 A;  4ZRK A;  1RRB A;  2KJR A;  3L0W B;  3PV1 A;  3RUL A;  5G55 A;  2I1J A;  4B9K A;  2DX5 B;  1Q0W B;  4HJK A;  3CST A;  3N30 A;  1FXT B;  2NS5 A;  3NZS A;  2CKH B;  3T8M A;  2O6V A;  3IVF A;  3RZW C;  2KD0 A;  3DBH I;  2CR5 A;  3RT3 B;  1WX9 A;  4W9D A;  5IA7 A;  3KVF B;  2LXA A;  3QHT A;  2GBN A;  3C0R B;  1J8C A;  3CF6 E;  2WX0 A;  4TKN A;  2IBI B;  3VUX A;  5AZG A;  2K8C A;  4AJW A;  2DZM A;  2LWP A;  2K8B A;  2LUE A;  3DVG X;  4NQL B;  3V61 A;  3RUI B;  1V2Y A;  4G3X B;  5KHQ A;  2J7Q B;  3A9K A;  3X23 A;  1WXM A;  1WMH B;  1I35 A;  2KTR B;  4EZL A;  3DVN U;  4IWO A;  3K9O B;  5GMV A;  3NHE B;  3LJ3 A;  3ZTC A;  3R7R A;  1V86 A;  1J0G A;  1TBE A;  2LGY A;  1V6E A;  3PGE A;  4IM2 A;  1YX5 B;  2KN5 A;  4A3P A;  3ZW3 A;  3ZNH B;  4HVB A;  1S3S G;  4YL8 A;  2O2V B;  2IY0 B;  5J18 A;  1IYF A;  2BYE A;  3O65 B;  4XC2 A;  1P0R A;  2LVO A;  5DPT A;  2WX1 A;  4PYZ A;  1ZW7 A;  3VTU A;  1YIW A;  1WYW B;  4TV3 A;  2DYO A;  4KZ0 A;  3TCA A;  1TZ1 A;  3QQ8 B;  2Z0E B;  5G2N A;  1MG8 A;  3NOB A;  3JYU A;  4FN2 A;  1E8X A;  4WJO A;  4GIV A;  4FJV B;  4DHJ D;  4ICU A;  1P1A A;  4W9E A;  2JPH A;  2KLC A;  1WMH A;  2KTR A;  2JWZ A;  1GC6 A;  2MSE D;  1YQB A;  4FBJ B;  3M95 A;  1UBI A;  1RFA A;  2FCQ A;  4WJP A;  3A9J B;  3U8Z A;  3V6E B;  2LGD A;  2UWQ A;  4DK5 A;  3QIJ A;  4LJO B;  4GMV A;  2ASQ A;  3Q3J A;  3UQA A;  3W1S A;  2C7N B;  3SHQ A;  1OEY J;  1WZ0 A;  2GMI C;  4I6P A;  4DBG A;  2AWT A;  1KOT A;  4NJ7 A;  1WGG A;  3PPA A;  4P7I A;  4TQ0 A;  4LJP B;  3JSV A;  2A4Z A;  3VUY A;  3ENE A;  2NBV B;  2K25 A;  4OVV A;  3ZLZ A;  2AYO B;  4G0N B;  3PSE B;  3H7S A;  3N32 A;  1F9J A;  3DOW A;  2MA9 B;  4FUL A;  3WAP A;  1SE9 A;  3A9J A;  3DCG A;  1XT9 B;  2V3S A;  4N9F 4;  3W1Y A;  1D3Z A;  2KX0 A;  1R4M I;  2GOW A;  2JUO A;  1YX6 B;  4OVU A;  3ZO5 B;  1UEL A;  4NJ6 A;  4EFO A;  5JHB A;  3GOE A;  3I3T B;  1OEY A;  4GXB A;  2LD9 A;  2G4S A;  4DHJ B;  4EKU A;  1ISN A;  4DWF A;  4NPN A;  4KVG B;  3PZD A;  4A3O A;  1ZGU B;  2ZZP B;  1H8C A;  1WJ6 A;  2G45 B;  3A4S C;  3A1Q B;  4FHK A;  3RD2 A;  4K81 A;  4W9F A;  2NBW B;  4KZC A;  3ZVV A;  1XD3 B;  3WAO A;  1OGW A;  2XK5 B;  4DXA B;  3EEC A;  2J0K A;  3QK0 A;  4MGI E;  3B08 A;  3R3M A;  1WE6 A;  5BO4 B;  3VFK A;  4WQO B;  3TIX A;  2DYB A;  1NBF C;  4MEL A;  3X0W A;  1V9J A;  4EZJ A;  3VUW A;  4M0W B;  4GB9 A;  3APD A;  4E74 A;  1XQQ A;  4CYE A;  2IO1 B;  2KDE B;  3KUD B;  4W9J A;  3PS6 A;  4EUT A;  3H7P B;  2BWF A;  4WWP A;  2JF5 A;  3MTN B;  4URK A;  5JH5 C;  2BF8 B;  2R2Q A;  3TJP A;  1E8Z A;  2HJ8 A;  1Y8R C;  2K39 A;  3ML9 A;  2M0X A;  5IAA C;  2HTH A;  2KWV B;  3HM3 A;  3ZNZ B;  1WIA A;  2KX3 A;  5CTR C;  2MLB A;  1Q1O A;  2L0T A;  4HDO A;  3GZN I;  2HE7 A;  5CHF A;  2KVR A;  2M17 A;  2XK5 A;  3UGB B;  3PRZ A;  5J17 A;  2MBQ A;  2K1F A;  4ANU A;  2K8H A;  1WM3 A;  3UIO B;  3EC8 A;  2Z59 B;  2L05 A;  3R66 C;  3L13 A;  3APF A;  2D07 B;  3ONS A;  2A5U A;  4DHZ B;  4FHJ A;  4F1S A;  3UQB A;  3ZDT A;  1Z2M A;  1VD2 A;  4AOF A;  3AU5 A;  3VH3 B;  3WAN A;  2HD5 B;  3KYD D;  1GUA B;  2GBJ A;  2MX2 A;  3V62 A;  2MBO A;  3H7P A;  2DEN B;  3HM6 X;  4DDI D;  4DDG D;  1X1M A;  2RR9 A;  2IZV B;  2NVU I;  2KJH B;  5AZF A;  2PE9 A;  2ZEQ A;  2KFK B;  3OJ3 A;  3QJZ A;  1V81 A;  3ZIM A;  2D10 A;  2N9P C;  2KDF B;  1WFY A;  3QAR A;  3VTV A;  4ZRI A;  2LVP A;  3HK0 A;  2BPS A;  2N7E A;  4ANX A;  3QCA A;  4XZ4 A;  1WZ3 A;  4I6N B;  2VRR B;  2KMA A;  2CHZ A;  5DCN A;  1R4N I;  2PE6 B;  1T0Y A;  2KFJ A;  2N7D A;  3L17 A;  2N1V A;  1Z5S B;  4CO7 A;  4M8M A;  2CS4 A;  2KDI A;  2KO3 A;  2JRH A;  4G11 A;  3TBL D;  3JSV B;  4J6I A;  2JXX A;  1V5T A;  2ZPY A;  4HPL B;  2FID A;  4KSL C;  4WJQ A;  4WAA A;  2KFK A;  3ECI A;  2KOX A;  4MEM A;  1SIF A;  2PJH A;  3L54 A;  5CX3 A;  2KAN A;  3ALB A;  1WX8 A;  3KH0 A;  1IP9 A;  2WDT B;  3ZKJ C;  1WRD B;  1E7U A;  4EZK A;  3RCZ A;  4ANV A;  4KSK C;  2L76 A;  3A4R A;  4GDK A;  1WXS A;  4KIK A;  3V6C B;  3PT2 B;  4TQ1 A;  2ZVN A;  4BFR A;  4BVU C;  1M94 A;  4W9K A;  3JW0 X;  3QA8 A;  4K7W A;  3UF8 A;  3VH4 B;  4FAD A;  2C9W B;  1UGM A;  3H1U A;  4HWI B;  3PHX B;  4WWN A;  4MGK E;  1EO6 A;  2RPQ A;  1KJT A;  2C7M B;  4BOZ B;  1C3T A;  3KW5 B;  2DAF A;  3H6N A;  1L7Y A;  2KWC A;  4BBN C;  4G50 A;  4RM8 A;  1E90 A;  5D94 A;  4MSQ B;  2AL6 A;  3PLV A; 
#chains in the Genus database with same CATH topology
 3P2B A;  3AE8 B;  2Y3A A;  3KWL A;  1TJE A;  4L1B A;  1SF0 A;  5EDS A;  3TEZ A;  4C4V A;  2BB5 A;  2CU1 A;  5D6J B;  4NJC A;  2BKR B;  1I4X A;  2HJ1 A;  3BK1 A;  2BYF A;  3K9P B;  4K7S A;  2N9X A;  2PKO A;  3APC A;  1WI0 A;  1MVK A;  1YOV B;  2LGX A;  1P98 A;  1WGY A;  1FNW A;  2M1M A;  4II3 B;  4US9 A;  4W9G A;  3U30 A;  1EF5 A;  4PS7 A;  1D5Z C;  4EEW A;  2JYE A;  4NAW A;  2IGG A;  4YTN B;  4F8C B;  2MQJ A;  1NYQ A;  4YTP B;  2KVZ A;  4P16 A;  1NEK B;  2R2O A;  2V4L A;  3OJ4 B;  5EE1 A;  4DQO C;  1WXV A;  3HVD A;  3L10 B;  4C56 C;  3W9C B;  3AE1 B;  2UYZ B;  3PZ7 A;  4W9C A;  3IFW B;  4NZL B;  2W54 A;  3AUL A;  3ZTD A;  1L6V A;  2KDB A;  3PVL A;  1YQ3 B;  2BYV E;  1ZPS A;  3NZ3 A;  4KIK B;  1ZXH A;  5CHW A;  2LHE A;  4HJG E;  4RM9 A;  5G5G A;  4W9H A;  3WAL A;  2C60 A;  2D3A A;  2WNM A;  2JZZ A;  3N1Y C;  1IPG A;  1NI2 A;  3QWZ B;  2L7R A;  1FNV A;  3OLM D;  1RFK A;  2BW2 A;  1S1Q B;  2ZNV B;  4ASW C;  3L16 A;  4O1N A;  4NNJ B;  3CSF A;  4TUU A;  2GBR A;  2JX5 A;  2IYD B;  1QIL A;  4B0M A;  2ZCB A;  4BKG A;  4GOC A;  3R8B A;  3NY5 A;  4IWP A;  2WDV B;  2XNA C;  4DXG A;  2ZVO A;  1V49 A;  2N1W A;  3DVG Y;  4BKS A;  3PZ8 A;  4HDQ A;  1HZ5 A;  3ZRF A;  3AI5 A;  2XBB C;  2NPT B;  2VZK D;  2O6V D;  4AUQ C;  2MWS B;  2LRW A;  2RPV A;  2WXI A;  4KDI C;  1TTN A;  3EFU A;  1QF6 A;  2DAJ A;  2INC C;  1C77 A;  5D3I B;  3ZUN A;  1LM8 B;  2KC1 A;  1JAL A;  1AW7 A;  2DHZ A;  1C1Y B;  1ZE3 D;  1E8Y A;  1BT0 A;  4H2A A;  4B95 A;  2MP2 B;  2KMC A;  4BOS C;  2KLG A;  3RNB C;  3SU8 X;  3VQI A;  4LCD E;  2Z0D B;  1DGJ A;  3ZJV A;  3EUB 2;  2JWU A;  5AEK B;  2QCZ A;  5EE3 A;  1JCK B;  1RAX A;  3KWV A;  3AEB B;  1LQB A;  2J53 A;  1SE2 A;  1DOX A;  4YT0 B;  4GDL B;  2J0M A;  3NRZ A;  1VZ7 A;  2BGF A;  4ANW A;  1WY8 A;  2G3Q B;  4L2Y A;  4JE3 B;  1WGH A;  3A1Q A;  5IOI A;  4MJS B;  2K6D B;  3A9K B;  4MM3 A;  1WRI A;  4ZRK A;  2KJR A;  1JWB D;  1ZDV A;  3MP9 A;  4HJK A;  1FXT B;  2NS5 A;  3NZS A;  3CWI A;  2K5P A;  3VR8 B;  1V97 A;  1WX9 A;  3FAH A;  1ENF A;  2GBN A;  3C0R B;  3CF6 E;  2WX0 A;  1L0Y B;  2CJN A;  2K8B A;  3RUI B;  1V2Y A;  2W3S A;  3HRD D;  1SB3 C;  1I35 A;  1K52 A;  2KTR B;  2BS4 B;  4IWO A;  5GMV A;  3NVW A;  5HHD G;  3LJ3 A;  1SJE D;  3PGE A;  1KTK A;  1GAQ B;  1YX5 B;  1S3S G;  3J9C A;  2KQ4 X;  2JXT A;  1ZW7 A;  1YIW A;  1I7H A;  1WYW B;  4TV3 A;  1XO3 A;  4KZ0 A;  3P4S B;  1E8X A;  4GIV A;  3T3O A;  2WQY B;  4JPS A;  1VDV A;  2KLC A;  5HG2 A;  1N5X A;  1F1H A;  3M95 A;  1FD6 A;  1SIJ A;  4WJP A;  4AS1 A;  4YSY B;  3W1S A;  2C7N B;  3SHQ A;  1WZ0 A;  4I6P A;  1JRO A;  1EWC A;  4LJP B;  3VUY A;  1MJD A;  1WYG A;  3ENE A;  2NBV B;  2K25 A;  5H8Y E;  1JML A;  3ZLZ A;  4G0N B;  1F9J A;  2MA9 B;  5C2T B;  3A9J A;  3DCG A;  4N9F 4;  1FCC C;  1UWM A;  2GOW A;  2JUO A;  2GLS A;  3P63 A;  3ZO5 B;  1QOG A;  3I3T B;  4GXB A;  2FUG 1;  3P1M A;  2V4I B;  1ISN A;  1LGR A;  1QOF A;  3EGR A;  1ZGU B;  2ZZP B;  1TZO A;  3ZXV A;  2NBW B;  1XD3 B;  4RGT A;  2CJO A;  2XK5 B;  4PT5 A;  4RGN A;  3T3N A;  1XXG A;  5AUI A;  1WE6 A;  3VFK A;  2TSS A;  1NBF C;  3X0W A;  3Q2A C;  1V9J A;  4XE0 A;  4GB9 A;  3APD A;  4E74 A;  3KUD B;  2KDE B;  3PS6 A;  1C79 A;  2BF8 B;  2HJ8 A;  1Y8R C;  4TMA B;  1T0S C;  1JWU D;  1NVI D;  1Q1O A;  1CZP A;  2KVR A;  2M17 A;  3AE6 B;  3C19 A;  1ET6 A;  3RNG C;  4K3C A;  5D3D A;  2D07 B;  3W2D A;  1PFD A;  4DHZ B;  4FHJ A;  1VD2 A;  4AOF A;  3AU5 A;  3WAN A;  3KYD D;  3V62 A;  3ZGZ A;  3H7P A;  2DEN B;  3HM6 X;  2RR9 A;  2WXG A;  2ZEQ A;  4ZRQ A;  4LLG M;  1L0V B;  2D10 A;  2QEJ C;  1JWM D;  3AEE B;  2JZP A;  3VTV A;  1JRP A;  2N7E A;  4XZ4 A;  2MHJ A;  1QKZ A;  2KMA A;  1WSP A;  4GLS C;  3UI3 A;  1T0Y A;  2K0P A;  3DWM A;  1QQR A;  5EE0 A;  3TBL D;  4J6I A;  2JXX A;  2PJH A;  3BVM A;  1IP9 A;  2WDT B;  1WRD B;  2RMM A;  1EU4 A;  5C3J B;  4KIK A;  3PT2 B;  4BFR A;  1WGK A;  3QA8 A;  3UF8 A;  1UWX A;  3H1U A;  4HWI B;  4LK0 M;  2RPQ A;  2C7M B;  4BOZ B;  3KW5 B;  2WXQ A;  3H6N A;  1NYR A;  1TY0 A;  4BBN C;  4G50 A;  1K51 A;  3PLV A;  2KTF A;  3JVZ X;  1VZ6 A;  2DLB A;  4RGM A;  3RNF C;  4EE2 A;  3M3J A;  4W9L A;  5E6P A;  5LLI A;  3NUH B;  2L8J A;  2BVC A;  3B1L X;  2C5L C;  3BII D;  3M62 B;  3AU4 A;  3OAW A;  3U7Z A;  4NAM A;  3BIN A;  2KMM A;  5JZE B;  1P9D U;  3SEB A;  4BKT A;  3BWU D;  1GNU A;  3WIM A;  4GGQ A;  1VLB A;  2FE8 A;  1QLB B;  2LEK A;  4RCO A;  2FUH B;  2MJ3 A;  5TR5 A;  4AWJ A;  4HCN B;  1IUE A;  2NCN A;  1TKE A;  3PLU A;  2WXJ A;  4WUR A;  1XCQ L;  3R7Q A;  2WWZ A;  3VAW A;  4I6L B;  3MJ5 A;  4N59 A;  1SE4 A;  4BKS D;  2JZ3 B;  3L08 A;  3KUZ A;  5LXI B;  1XF5 L;  2ZPN A;  3IT4 B;  1XLO A;  2MP2 A;  3TEY A;  2JVC A;  3PTF C;  1P3Q U;  4MGY E;  5C1Z A;  2FAZ A;  1E9M A;  1RWS A;  3Q3F A;  2IPK D;  4CHK A;  2REX A;  4GN1 A;  4GU2 A;  4P6V F;  4HLE A;  1FPY A;  4D2K A;  2BKF A;  1SXT A;  1ET9 A;  3LDZ E;  5BMG A;  2DWQ A;  4K7U A;  1WR6 E;  2N4F A;  1N6Z A;  2OED A;  3O13 A;  3N20 C;  4GDK B;  4KKI A;  4GDL A;  3ZXR A;  4MSM B;  3DBR B;  3RNC C;  5L83 A;  2D11 A;  1WX7 A;  4MJS A;  4E71 A;  5HKH A;  4II2 B;  2RSU A;  2M4N A;  4LNK A;  4JIO U;  3EA6 A;  4MH0 E;  1HTQ A;  1PGA A;  2KXJ A;  2KC2 A;  2MH7 A;  1LXD A;  1WJN A;  2IO0 B;  2ON8 A;  5BMI A;  1TT5 B;  2YVC A;  1IGC A;  1KLV A;  4IM3 A;  2BWE S;  1ROE A;  3OWE B;  2LJI A;  4HRO A;  4PYU A;  2QHO A;  4B6W A;  4ARI A;  4FA6 A;  1YJI A;  3PHW B;  3MC8 A;  1YNT E;  4US8 A;  1V5O A;  1PDX A;  3L4P A;  4JQW C;  2DYM A;  2MRP A;  1FRR A;  3A33 B;  2MW5 A;  1E10 A;  3HIZ A;  2WXH A;  3SD5 A;  2D2Q A;  4S17 A;  1HXY D;  4OVZ A;  3Q3N C;  1YMH E;  2AL3 A;  5JHA A;  2W3R A;  4JGH B;  2V1Y A;  3IXS A;  1L2N A;  3KYC D;  2EMT A;  1QZE A;  5DPR A;  3N1Z C;  3FC4 A;  4W9I A;  3GE3 C;  4FJY A;  2C7H A;  3HUI A;  1NDD A;  1YN3 A;  2KT7 A;  1WH3 A;  5C23 A;  2QJL A;  3M63 B;  2ONQ A;  4Q2J A;  4USA A;  3D32 A;  4P1B C;  5L95 C;  4NQK E;  2OJW A;  2LXC A;  1WF9 A;  1MHH E;  2B3A A;  1T0R C;  2RD0 A;  4ZRJ A;  2VZK B;  1Q10 A;  2ACZ B;  2BQQ A;  2O6V B;  2WXF A;  1VRA B;  2L3Z A;  2KQS A;  1EUV B;  1BML C;  2KQ7 A;  2KWD A;  4HXD A;  3S2A A;  3V3X A;  4ICV A;  2ZNV C;  3MJW A;  3TEW A;  3RUL A;  1Q0W B;  3NG0 A;  1VR9 A;  3T8M A;  1IGD A;  4HRS A;  3DHG C;  3E9S A;  2KD0 A;  2CR5 A;  4W9D A;  3Q8B A;  4B0E A;  1L0X B;  1WXQ A;  3TSS A;  2DZM A;  5GXG B;  4NQL B;  1N60 A;  4ZRP A;  4YTM B;  3BZD B;  3Q8E A;  3ZTC A;  3R7R A;  1V86 A;  3TEX A;  3GE8 C;  4A3P A;  1V6E A;  4IM2 A;  4HVB A;  3ZW3 A;  3VRA B;  5J18 A;  2BYE A;  2QDF A;  1VJK A;  2WXO A;  1TIF A;  5DPT A;  1GOZ A;  3VTU A;  2DYO A;  1TZ1 A;  5G2N A;  4UDU C;  3JYU A;  4WJO A;  5IKC M;  4ICU A;  1P1A A;  1WMH A;  2JWZ A;  2D5G A;  2MSE D;  1KFY B;  3V6E B;  3Q69 A;  2UWQ A;  4DK5 A;  4LJO B;  2ASQ A;  4C7Y A;  1OEY J;  2GMI C;  4DBG A;  2AWT A;  4TQ0 A;  2DNF A;  1GB4 A;  4OVV A;  1MI0 A;  3DOW A;  1D6E C;  4FUL A;  1NEN B;  2H88 B;  1XT9 B;  1D3Z A;  2KX0 A;  1R4M I;  4RF0 A;  1UEL A;  3AM9 A;  4NJ6 A;  2KDM A;  4YWG G;  2YEP F;  4WIP A;  3GOE A;  2G4S A;  4BZA A;  4DWF A;  2IJ0 A;  3PZD A;  1H8C A;  1WJ6 A;  4A6Q A;  3AE4 B;  1IBX A;  3RD2 A;  4RNA A;  4W9F A;  1ZP0 B;  3WAO A;  2INP E;  2MEK A;  1FMA D;  2N9K A;  1I4Q A;  5BO4 B;  4MAC A;  4WQO B;  3MFG A;  2Z8L A;  4IOI E;  4EZJ A;  3VUW A;  4M0W B;  4WH4 A;  4CYE A;  2IO1 B;  4W9J A;  1HA5 A;  4WWP A;  2BWF A;  4URK A;  3MTN B;  2Y5P A;  5JH5 C;  2WHI A;  2HTH A;  1WIA A;  2KX3 A;  2MLB A;  2B76 B;  4HDO A;  3GZN I;  1E6E B;  5J17 A;  2MBQ A;  2K8H A;  1T5X D;  2Z59 B;  3APF A;  2IGD A;  2A5U A;  4AQ7 A;  1AN8 A;  4RGO S;  1D5M C;  2MBO A;  3CIR B;  4DDI D;  4DDG D;  1X1M A;  2IZV B;  5EE9 A;  2PE9 A;  2KFK B;  5IP4 D;  3BYY B;  3ZIM A;  3MC0 B;  4ZRI A;  2LVP A;  2BPS A;  2PIA A;  4I6N B;  2WU5 B;  1XLP A;  2VRR B;  2CHZ A;  5DCN A;  1R4N I;  2PE6 B;  2QC8 A;  2RDG A;  3L17 A;  2N1V A;  3RNA C;  1Z5S B;  4CO7 A;  4IDI A;  2KDI A;  2JRH A;  2WLB A;  1FNU A;  4WAA A;  3ECI A;  4ZHP A;  2KOX A;  1SIF A;  4OW0 A;  3L54 A;  1P7E A;  2YEP B;  1A70 A;  2BYT A;  1E7U A;  3P4Q B;  1R7S A;  3A4R A;  4GDK A;  1WXS A;  3BK2 A;  4IKG A;  1D4B A;  4K7W A;  4KGR A;  4FAD A;  3LYY A;  1UGM A;  1EO6 A;  1KJT A;  4JWU C;  1CJE A;  1ZUD 2;  1CQV A;  1L7Y A;  2AL6 A;  3FIL B;  3SDL C;  1BUI C;  1UZX B;  3AB5 A;  3ZNG C;  2CU3 A;  4KV2 A;  1C78 A;  1OFF A;  2QMT A;  1WGD A;  2DZK A;  4CQN A;  1YD8 U;  3N9Y C;  4YSZ B;  5LXH A;  1C9F A;  1ZKH A;  2KZR A;  4FLH A;  1WGR A;  2GBK A;  2JQR B;  2MBH A;  3VVW B;  2KNB A;  4NAW B;  1V1P B;  2VH1 A;  3QAQ A;  3BYT B;  3ML8 A;  2FCS A;  3VXW A;  2V0G A;  2QIL A;  2KWU B;  3DDC B;  3KQ4 A;  3U2S C;  3C8Y A;  1UH6 A;  2DBY A;  2VH2 A;  1F52 A;  2LAS A;  2JYT A;  2WXR A;  1OTR B;  1WM2 A;  4L23 A;  2K22 A;  3RZF A;  4F7Z A;  2INN E;  3T9L A;  2OHF A;  1RLF A;  1CMX B;  3NZU A;  1M4V A;  1N5W A;  5HFY A;  4KX6 B;  1WJ4 A;  4M02 A;  5BYS A;  3GP7 A;  2ZJD A;  3CMM B;  1SGH A;  1NI3 A;  4ZOH C;  1B1Z A;  3Q8C A;  1K8R B;  3VDZ A;  1XCT L;  2N9E B;  4A8X C;  2Y5C A;  3EHV A;  3Q8F A;  4HPM B;  1SJH D;  1KH0 A;  1T6B X;  3PRE A;  1GG3 A;  5J2R A;  3B2G A;  3ZRC A;  2IO2 B;  1PYW D;  2L00 B;  1XLQ A;  3WCQ A;  1GPX A;  2PEA A;  4LDT D;  1FM0 D;  3MC9 A;  2N7J A;  5FKA C;  4DHZ E;  2WGS A;  4BBN F;  2CHW A;  2LFI A;  4OZC A;  2LGI A;  2LHD A;  4EZK A;  3HHM A;  2WDR B;  3GB1 A;  3TL5 A;  1KRH A;  4NY0 A;  3ZNI D;  2OJR A;  4RFB A;  2MBB B;  4K1R B;  1U4A A;  1WXA A;  1OQY A;  1L4D B;  1UUP A;  1E7V A;  3AXC A;  2CHX A;  1FEH A;  4WAF A;  2LRU A;  4C80 A;  2J0J A;  1AAR A;  3AMZ A;  1TKY A;  3ZDM C;  2J52 A;  3DPD A;  1XEE A;  4PS3 A;  2JT4 B;  1H4R A;  5CHV C;  1QOA A;  2D3B A;  2AEH A;  4A9A A;  2K9X A;  1UD7 A;  3VHT C;  2XEW A;  2E6X A;  2YLM A;  1HTO A;  2LJ5 A;  3ZQ4 A;  2PVO D;  3R2I A;  3IBE A;  3QX1 A;  2JY6 A;  1ZDX A;  4JX1 C;  1UBQ A;  5LNK 1;  2QSD A;  1Q5W B;  2NPT A;  4JL9 A;  1EM7 A;  2LUM A;  2PPH A;  4E3C A;  1I4G A;  2M19 A;  1F2R C;  1I4H A;  2ZCC A;  4MM3 B;  1GJZ A;  2WXK A;  2LZ6 A;  2RDH A;  3IG3 A;  1V80 A;  1TS3 A;  3W1S C;  4WQM A;  2HDE A;  4LNI A;  1MG4 A;  4IUM B;  3RN9 C;  2WS3 B;  2AX5 A;  3WA0 A;  3UIN B;  1LO5 D;  2K6Q A;  2KAJ A;  4AJY B;  1YN4 A;  4S0R A;  1QT9 A;  2KK8 A;  2BBC A;  2LMC A;  4FJZ A;  2RDB C;  3L0W B;  2SEB D;  5G55 A;  1KLU D;  2CKH B;  2AQ1 B;  3IVF A;  3RZW C;  4M0W A;  3DBH I;  2WXL A;  1YN5 A;  5IA7 A;  2LXA A;  1UNS A;  1J8C A;  3I63 C;  2IBI B;  1N62 A;  3VUX A;  3GZN B;  5AZG A;  1F0Z A;  3RNE C;  4HKZ E;  3VR9 B;  5FK9 C;  3DVG X;  5KHQ A;  4G3X B;  2J7Q B;  3A9K A;  1WXM A;  3SFE B;  3DVN U;  3W5V B;  4RF1 A;  2PLP A;  5IN7 A;  3TUO A;  1TBE A;  2LGY A;  1EWY C;  4C7Z A;  2GRI A;  3ZNH B;  2O2V B;  4LTU A;  4OZA A;  2PW9 A;  3Q8A A;  1JQ4 A;  3O65 B;  4XC2 A;  1P0R A;  1FXI A;  2KAC A;  4PYZ A;  1UGJ A;  2BTE A;  1C4P A;  1MG8 A;  1J7B A;  3ZJT A;  2SAK A;  4FJV B;  3AH7 A;  4DHJ D;  1DYQ A;  2JPH A;  4LNF A;  2KTR A;  3H8H A;  1GC6 A;  1YQB A;  3VRB B;  2FCQ A;  3A9J B;  1GB1 A;  2PMV A;  4LNO A;  5MPO A;  2LGD A;  2ZW0 A;  2WXN A;  3QIJ A;  4GMV A;  3Q3J A;  3OG5 A;  4NJ7 A;  2M56 B;  1PUT A;  3AED B;  2A4Z A;  5BYQ A;  3AE5 B;  2KYW A;  3H7S A;  3N32 A;  1ESF A;  3WAP A;  2V3S A;  3W1Y A;  4EFO A;  3Q3M C;  1C4A A;  1OEY A;  3BVG A;  2LD9 A;  4EKU A;  2ICI A;  3B9J A;  2G45 B;  2Q5W D;  2M0A A;  4KZC A;  3I9V 1;  3ZVV A;  1E0Z A;  1N63 A;  2L83 A;  2J0K A;  3NJT A;  3QK0 A;  3B08 A;  3TIX A;  2DYB A;  2V3P A;  4MEL A;  3FIL A;  1BXT A;  1XQQ A;  4EUT A;  3H7P B;  2JF5 A;  1E8Z A;  3ML9 A;  5IAA C;  3AEF B;  2L52 A;  5IO9 A;  3IAM 1;  2L0T A;  2XK5 A;  3UGB B;  1V1P A;  4BAX A;  2L05 A;  4KKJ A;  3SR6 A;  3URY A;  3UQB A;  1B9R A;  2BB6 A;  3ABV B;  3ZDT A;  1TYG B;  2PTL A;  1L4Z B;  5T8I A;  3RFZ B;  2KJH B;  3OJ3 A;  3DWG C;  3NVZ A;  1V81 A;  1C4C A;  2R61 A;  1TKG A;  5JXV A;  1WFY A;  1PGB A;  3HK0 A;  3QCA A;  3R2T A;  4MH8 A;  2ZW1 A;  2IGH A;  3E56 A;  2KFJ A;  4XYC A;  1UF0 A;  3AN1 A;  2NTT A;  4M8M A;  1ZOY B;  2CS4 A;  3AE2 B;  1SEB D;  3JSV B;  1V5T A;  4KSL C;  4WJQ A;  5CX3 A;  1SE3 A;  1TS2 A;  1WX8 A;  3ZKJ C;  1J7C A;  1C76 A;  3ETR A;  4KSK C;  3NS1 A;  4TQ1 A;  1M94 A;  3JW0 X;  1CK1 A;  2C9W B;  1F77 A;  3P4P B;  4WWN A;  4XWW A;  4KGT A;  3P4R B;  4RM8 A;  5D94 A;  4MSQ B;  3DHH C;  3V60 A;  4ZDV A;  1Y56 A;  2NR2 A;  1YJJ A;  2FIF A;  2I38 A;  3NS8 A;  2IO3 B;  2WP9 B;  3AV8 A;  3TMP B;  1EF1 A;  3QC8 B;  4PS8 A;  1AYF A;  1PQS A;  2LVQ A;  2N9L A;  3PO0 A;  4WJN A;  5G5H A;  2JSV X;  4ACF A;  1MHX A;  5DPS A;  4DXF A;  1SSN A;  3Q6B A;  4HCP B;  4MDK E;  4IW0 A;  5BYR A;  1E5W A;  3AE9 B;  3BY4 B;  1T3Q A;  2AQ2 B;  4RMA A;  3ZYY X;  3MHZ A;  1FRD A;  3U4E G;  1STE A;  1WWT A;  4XX5 A;  1G6J A;  3PRM B;  2H89 B;  2WXP A;  2DZI A;  2D3G A;  1HQR D;  1F2R I;  2W55 A;  5DPW A;  2GBM A;  5D7G A;  5KHO A;  1L5P A;  2XN9 C;  1GC7 A;  1WJU A;  4MGZ E;  3DBR I;  2E3T A;  4EOY A;  1TGZ B;  2Y5B B;  4IC7 B;  1JRU A;  4OHJ A;  2FNJ B;  3BVZ A;  3AEC B;  5E6O A;  1I42 A;  1P7F A;  1KM7 A;  2EKE C;  2LGS A;  2L0F A;  2J42 A;  3DBL I;  3B0A A;  1HE8 A;  3DBS A;  2KHW B;  1FCL A;  1WE7 A;  3DBH B;  1LFD A;  3H9D A;  2FBW B;  4X57 B;  2OOB B;  1FFV A;  3ZJU A;  3VTW A;  1A5R A;  3NVV A;  1EU3 A;  2I2Y A;  2JRI B;  2EMS A;  3WAM A;  4XGA B;  1J7A A;  3AE7 B;  1MPE A;  2X38 A;  2FCN A;  4J3O D;  4HKQ A;  1K50 A;  3NVY A;  3PRP B;  4KGS A;  3I57 A;  4C00 A;  3MHS D;  3RYT A;  2NBU A;  4C4V B;  3AEA B;  4HK2 A;  3UIP B;  2KKC A;  4P1C C;  1JW9 D;  2IY1 B;  4XDC A;  4KDL B;  2O2V A;  5AZH A;  5FR6 A;  4IG7 B;  3DVN V;  1J19 A;  4IM0 A;  4LDT B;  4MT5 A;  1WR1 A;  2BS3 B;  2NTS A;  2WYQ A;  4M01 A;  3DQV A;  2L1A A;  2RGF A;  3LXF A;  4JLC A;  4IWQ A;  2W9N A;  2MCN B;  4ZYN A;  3KUC B;  3SFD B;  3N3K B;  3Q3O C;  2KJ6 A;  5D2M B;  3Q14 C;  2LI5 A;  1OQQ A;  1E8W A;  4M8N A;  4GSW A;  2PVG C;  2G4D B;  2MBE A;  1VCB A;  4WWO A;  1L6U A;  1I4R A;  1JWA D;  2FCM A;  5E6N A;  1N61 A;  3U7D A;  2DZJ A;  1YJ1 A;  1MFW A;  1FO4 A;  2I1K A;  4YXD B;  2G1E A;  4AP4 C;  4A20 A;  1T0Q C;  1RYJ A;  1KF6 B;  1FXA A;  3IHP C;  2M8S A;  1RRB A;  3PV1 A;  2I1J A;  4B9K A;  2D3C A;  2DX5 B;  3CST A;  3N30 A;  2O6V A;  2MJD A;  2WU2 B;  4QAY A;  3V05 A;  3RT3 B;  4PK1 A;  1DOY A;  3KVF B;  3QHT A;  4TKN A;  2K8C A;  4AJW A;  1FFU A;  2LWP A;  2LUE A;  5AUK A;  3V61 A;  3X23 A;  1WMH B;  4EZL A;  3K9O B;  3NHE B;  5E6J A;  5HI1 A;  1ACC A;  1D5X C;  1QOB A;  2V9H A;  1J0G A;  1VZ8 A;  2KN5 A;  4YL8 A;  2IY0 B;  2MJE A;  1IYF A;  2LVO A;  2WX1 A;  4R3D A;  3TCA A;  3EFC A;  3QQ8 B;  4XDD A;  5TSS A;  2Z0E B;  1YQ4 B;  4FN2 A;  3NOB A;  3LB8 C;  4W9E A;  4FXC A;  3GS2 A;  4HEA 1;  4K3B A;  4FBJ B;  5I4D A;  1UBI A;  2AQ3 B;  1RFA A;  3U8Z A;  2UU7 A;  3P42 A;  2EEL A;  3UQA A;  1K53 A;  2V3N A;  4ZHO A;  1JWS D;  3AEG B;  1KOT A;  4ITK A;  1WGG A;  3PPA A;  4RH6 A;  4P7I A;  3JSV A;  1TS5 A;  4LNN A;  1IBX B;  2EKI A;  2WXM A;  2AYO B;  3PSE B;  3DHI C;  1SE9 A;  1XLN A;  4YSX B;  4JWS C;  1YX6 B;  2BT6 A;  3AE3 B;  4OZB A;  4OVU A;  4M00 A;  5JHB A;  3HVZ A;  2GI9 A;  1FIQ A;  1ZXI A;  4DHJ B;  3IT6 B;  2L32 A;  4NPN A;  4KVG B;  4A3O A;  3A4S C;  3A1Q B;  4FHK A;  4K81 A;  3I5J C;  4WWM A;  1OGW A;  1R4M B;  5FR3 A;  1V8C A;  3FKY A;  4DXA B;  3KLS X;  3EEC A;  5H92 C;  4MGI E;  1TY2 A;  3R3M A;  3RPF C;  2K3U A;  1PGX A;  5BMH A;  3TJP A;  2R2Q A;  1TS4 A;  2IND C;  2K39 A;  2M0X A;  2NMQ A;  2KWV B;  3HM3 A;  3ZNZ B;  5CTR C;  1HZ6 A;  3U52 E;  2HE7 A;  5CHF A;  3B2F A;  3PRZ A;  2K1F A;  4ANU A;  3UIO B;  1WM3 A;  3EC8 A;  1V1O A;  3R66 C;  3L13 A;  2QIE B;  1HEZ E;  1I4P A;  3ONS A;  4F1S A;  1Z2M A;  3VH3 B;  2HD5 B;  1GUA B;  2GBJ A;  2MX2 A;  4N58 A;  1DOI A;  2NVU I;  5AZF A;  1KLG D;  4A90 A;  3QJZ A;  2BS2 B;  1OQR A;  2N9P C;  2KDF B;  3QAR A;  2G9H D;  2X8X X;  4ANX A;  2J4X A;  4N6E B;  1WZ3 A;  2W82 A;  1E7P B;  2N7D A;  2KN4 A;  4TSS A;  4ARC A;  4A55 A;  2KO3 A;  3N1X C;  4G11 A;  2JU6 X;  1SBB B;  4REZ A;  2ZPY A;  4HPL B;  2FID A;  2KFK A;  4MEM A;  2WDQ B;  3RI7 C;  2KAN A;  1R4N B;  3ALB A;  3KH0 A;  2N0S B;  3DBL B;  3RCZ A;  4ANV A;  2L76 A;  2HTM E;  3V6C B;  2IDY A;  2ZVN A;  4BVU C;  4W9K A;  3VH4 B;  3RMK C;  2GB1 A;  3PHX B;  1AWD A;  4MGK E;  4HPP A;  1C3T A;  4XWT A;  3IAS 1;  3W5U B;  1RM6 C;  2DAF A;  2KWC A;  1E90 A;  4ZYS A; 
#chains in the Genus database with same CATH homology
 3P2B A;  2KTF A;  3SDL C;  1UZX B;  3ZNG C;  4KV2 A;  3JVZ X;  1WGD A;  2DZK A;  3V60 A;  4ZDV A;  2NR2 A;  1YD8 U;  2FIF A;  3M3J A;  4W9L A;  5E6P A;  5LLI A;  3NS8 A;  2L8J A;  5LXH A;  2IO3 B;  5EDS A;  1ZKH A;  2KZR A;  4FLH A;  1WGR A;  2GBK A;  2MBH A;  3TMP B;  2CU1 A;  1EF1 A;  3B1L X;  3QC8 B;  2C5L C;  5D6J B;  3VVW B;  2KNB A;  2BKR B;  3M62 B;  4PS8 A;  1PQS A;  2LVQ A;  3AU4 A;  3OAW A;  4NAW B;  3QAQ A;  2BYF A;  3ML8 A;  3BIN A;  3K9P B;  4K7S A;  2N9X A;  4WJN A;  5JZE B;  2FCS A;  1P9D U;  3VXW A;  3APC A;  4BKT A;  1WI0 A;  2KWU B;  5DPS A;  1GNU A;  2LGX A;  3DDC B;  1P98 A;  1WGY A;  1UH6 A;  3WIM A;  4HCP B;  4GGQ A;  2M1M A;  4MDK E;  4IW0 A;  4II3 B;  4W9G A;  2LAS A;  2FUH B;  1E5W A;  3U30 A;  5TR5 A;  4AWJ A;  1EF5 A;  3BY4 B;  1OTR B;  4HCN B;  1WM2 A;  4PS7 A;  2NCN A;  4RMA A;  3PLU A;  4EEW A;  3R7Q A;  4NAW A;  2WWZ A;  3RZF A;  3VAW A;  4F7Z A;  4F8C B;  4I6L B;  1G6J A;  4XX5 A;  3PRM B;  3T9L A;  2MQJ A;  2JZ3 B;  4BKS D;  3L08 A;  2DZI A;  3KUZ A;  1RLF A;  1CMX B;  3NZU A;  5LXI B;  2D3G A;  2ZPN A;  2R2O A;  5DPW A;  2V4L A;  2GBM A;  2MP2 A;  3OJ4 B;  5D7G A;  1WJ4 A;  5KHO A;  2JVC A;  3PTF C;  1WXV A;  1P3Q U;  3L10 B;  1GC7 A;  1WJU A;  4MGY E;  2ZJD A;  3CMM B;  5C1Z A;  1SGH A;  2FAZ A;  4MGZ E;  3DBR I;  3Q3F A;  4CHK A;  4EOY A;  1TGZ B;  2REX A;  2Y5B B;  4GN1 A;  4GU2 A;  1K8R B;  2UYZ B;  4IC7 B;  1JRU A;  3VDZ A;  4HLE A;  2FNJ B;  2N9E B;  4W9C A;  5E6O A;  2BKF A;  3IFW B;  1I42 A;  3LDZ E;  3EHV A;  3AUL A;  3ZTD A;  2KDB A;  4HPM B;  1WR6 E;  2N4F A;  3PVL A;  4K7U A;  2BYV E;  1KM7 A;  4GDK B;  2EKE C;  3PRE A;  4KIK B;  1GG3 A;  2L0F A;  4GDL A;  5CHW A;  5J2R A;  3DBL I;  3B0A A;  4MSM B;  4RM9 A;  3ZRC A;  4W9H A;  3WAL A;  2C60 A;  2IO2 B;  5L83 A;  2L00 B;  2D11 A;  1WX7 A;  4MJS A;  4E71 A;  5HKH A;  1HE8 A;  3DBS A;  2PEA A;  2JZZ A;  4LDT D;  2KHW B;  1IPG A;  4II2 B;  4DHZ E;  2RSU A;  1NI2 A;  4BBN F;  2M4N A;  2CHW A;  1WE7 A;  1LFD A;  3H9D A;  4JIO U;  3QWZ B;  4MH0 E;  2L7R A;  3OLM D;  4X57 B;  2OOB B;  3VTW A;  1S1Q B;  1A5R A;  2ZNV B;  4ASW C;  2KXJ A;  3L16 A;  2JRI B;  2EMS A;  3CSF A;  3HHM A;  2KC2 A;  2GBR A;  4NNJ B;  4TUU A;  3WAM A;  2IYD B;  1LXD A;  2FCN A;  1WJN A;  3TL5 A;  2IO0 B;  2ZCB A;  4NY0 A;  3ZNI D;  3PRP B;  2OJR A;  4BKG A;  2MBB B;  2YVC A;  4K1R B;  1KLV A;  1U4A A;  1WXA A;  1OQY A;  4IM3 A;  4GOC A;  2BWE S;  4PYU A;  1E7V A;  2QHO A;  3NY5 A;  4IWP A;  3AXC A;  3MHS D;  2CHX A;  2NBU A;  3RYT A;  4B6W A;  4FA6 A;  4HK2 A;  2LRU A;  3PHW B;  2J0J A;  2ZVO A;  3UIP B;  1V49 A;  2N1W A;  3DVG Y;  4BKS A;  2KKC A;  1AAR A;  2IY1 B;  1V5O A;  4KDL B;  3ZDM C;  2O2V A;  4JQW C;  3DPD A;  4HDQ A;  5AZH A;  2DYM A;  2MRP A;  4PS3 A;  3ZRF A;  5FR6 A;  2JT4 B;  3AI5 A;  2XBB C;  2NPT B;  4IG7 B;  1H4R A;  1J19 A;  3DVN V;  4IM0 A;  2O6V D;  4LDT B;  5CHV C;  2AEH A;  1WR1 A;  2MWS B;  3A33 B;  4AUQ C;  2MW5 A;  2LRW A;  2WYQ A;  3HIZ A;  3DQV A;  2RGF A;  4KDI C;  1UD7 A;  3SD5 A;  3VHT C;  1TTN A;  2XEW A;  3EFU A;  2D2Q A;  4JLC A;  4IWQ A;  2YLM A;  2LJ5 A;  2DAJ A;  2W9N A;  3IBE A;  2AL3 A;  2MCN B;  5JHA A;  4JGH B;  2V1Y A;  3QX1 A;  4ZYN A;  3KUC B;  2JY6 A;  1L2N A;  3N3K B;  3KYC D;  3ZUN A;  1LM8 B;  2KC1 A;  1UBQ A;  2EMT A;  1QZE A;  2DHZ A;  5DPR A;  1C1Y B;  2KJ6 A;  1Q5W B;  4W9I A;  4FJY A;  5D2M B;  1E8Y A;  2NPT A;  2C7H A;  1BT0 A;  4JL9 A;  1NDD A;  4B95 A;  2MP2 B;  1WH3 A;  2LI5 A;  5C23 A;  2PPH A;  4E3C A;  2KMC A;  1E8W A;  3M63 B;  4M8N A;  4GSW A;  2G4D B;  2ZCC A;  1GJZ A;  3D32 A;  4BOS C;  2KLG A;  2MBE A;  5L95 C;  1VCB A;  2LZ6 A;  4NQK E;  4WWO A;  3SU8 X;  3VQI A;  2LXC A;  3IG3 A;  1V80 A;  1WF9 A;  2B3A A;  4LCD E;  2Z0D B;  3W1S C;  2RD0 A;  4ZRJ A;  2FCM A;  5E6N A;  5AEK B;  2O6V B;  1RAX A;  3U7D A;  2DZJ A;  4IUM B;  1YJ1 A;  2L3Z A;  2I1K A;  3WA0 A;  1LQB A;  3UIN B;  4AP4 C;  4GDL B;  2J0M A;  2KQS A;  4A20 A;  2K6Q A;  2BGF A;  4ANW A;  4AJY B;  1EUV B;  1WY8 A;  2G3Q B;  2KQ7 A;  2KK8 A;  4HXD A;  1WGH A;  3A1Q A;  4MJS B;  3S2A A;  4FJZ A;  4ICV A;  2K6D B;  2ZNV C;  3A9K B;  2M8S A;  3IHP C;  3MJW A;  4MM3 A;  4ZRK A;  1RRB A;  2KJR A;  3L0W B;  3PV1 A;  3RUL A;  5G55 A;  2I1J A;  4B9K A;  2DX5 B;  1Q0W B;  4HJK A;  3CST A;  3N30 A;  1FXT B;  2NS5 A;  3NZS A;  2CKH B;  3T8M A;  2O6V A;  3IVF A;  3RZW C;  2KD0 A;  3DBH I;  2CR5 A;  3RT3 B;  1WX9 A;  4W9D A;  5IA7 A;  3KVF B;  2LXA A;  3QHT A;  2GBN A;  3C0R B;  1J8C A;  3CF6 E;  2WX0 A;  4TKN A;  2IBI B;  3VUX A;  5AZG A;  2K8C A;  4AJW A;  2DZM A;  2LWP A;  2K8B A;  2LUE A;  3DVG X;  4NQL B;  3V61 A;  3RUI B;  1V2Y A;  4G3X B;  5KHQ A;  2J7Q B;  3A9K A;  3X23 A;  1WXM A;  1WMH B;  1I35 A;  2KTR B;  4EZL A;  3DVN U;  4IWO A;  3K9O B;  5GMV A;  3NHE B;  3LJ3 A;  3ZTC A;  3R7R A;  1V86 A;  1J0G A;  1TBE A;  2LGY A;  1V6E A;  3PGE A;  4IM2 A;  1YX5 B;  2KN5 A;  4A3P A;  3ZW3 A;  3ZNH B;  4HVB A;  1S3S G;  4YL8 A;  2O2V B;  2IY0 B;  5J18 A;  1IYF A;  2BYE A;  3O65 B;  4XC2 A;  1P0R A;  2LVO A;  5DPT A;  2WX1 A;  4PYZ A;  1ZW7 A;  3VTU A;  1YIW A;  1WYW B;  4TV3 A;  2DYO A;  4KZ0 A;  3TCA A;  1TZ1 A;  3QQ8 B;  2Z0E B;  5G2N A;  1MG8 A;  3NOB A;  3JYU A;  4FN2 A;  1E8X A;  4WJO A;  4GIV A;  4FJV B;  4DHJ D;  4ICU A;  1P1A A;  4W9E A;  2JPH A;  2KLC A;  1WMH A;  2KTR A;  2JWZ A;  1GC6 A;  2MSE D;  1YQB A;  4FBJ B;  3M95 A;  1UBI A;  1RFA A;  2FCQ A;  4WJP A;  3A9J B;  3U8Z A;  3V6E B;  2LGD A;  2UWQ A;  4DK5 A;  3QIJ A;  4LJO B;  4GMV A;  2ASQ A;  3Q3J A;  3UQA A;  3W1S A;  2C7N B;  3SHQ A;  1OEY J;  1WZ0 A;  2GMI C;  4I6P A;  4DBG A;  2AWT A;  1KOT A;  4NJ7 A;  1WGG A;  3PPA A;  4P7I A;  4TQ0 A;  4LJP B;  3JSV A;  2A4Z A;  3VUY A;  3ENE A;  2NBV B;  2K25 A;  4OVV A;  3ZLZ A;  2AYO B;  4G0N B;  3PSE B;  3H7S A;  3N32 A;  1F9J A;  3DOW A;  2MA9 B;  4FUL A;  3WAP A;  1SE9 A;  3A9J A;  3DCG A;  1XT9 B;  2V3S A;  4N9F 4;  3W1Y A;  1D3Z A;  2KX0 A;  1R4M I;  2GOW A;  2JUO A;  1YX6 B;  4OVU A;  3ZO5 B;  1UEL A;  4NJ6 A;  4EFO A;  5JHB A;  3GOE A;  3I3T B;  1OEY A;  4GXB A;  2LD9 A;  2G4S A;  4DHJ B;  4EKU A;  1ISN A;  4DWF A;  4NPN A;  4KVG B;  3PZD A;  4A3O A;  1ZGU B;  2ZZP B;  1H8C A;  1WJ6 A;  2G45 B;  3A4S C;  3A1Q B;  4FHK A;  3RD2 A;  4K81 A;  4W9F A;  2NBW B;  4KZC A;  3ZVV A;  1XD3 B;  3WAO A;  1OGW A;  2XK5 B;  4DXA B;  3EEC A;  2J0K A;  3QK0 A;  4MGI E;  3B08 A;  3R3M A;  1WE6 A;  5BO4 B;  3VFK A;  4WQO B;  3TIX A;  2DYB A;  1NBF C;  4MEL A;  3X0W A;  1V9J A;  4EZJ A;  3VUW A;  4M0W B;  4GB9 A;  3APD A;  4E74 A;  1XQQ A;  4CYE A;  2IO1 B;  2KDE B;  3KUD B;  4W9J A;  3PS6 A;  4EUT A;  3H7P B;  2BWF A;  4WWP A;  2JF5 A;  3MTN B;  4URK A;  5JH5 C;  2BF8 B;  2R2Q A;  3TJP A;  1E8Z A;  2HJ8 A;  1Y8R C;  2K39 A;  3ML9 A;  2M0X A;  5IAA C;  2HTH A;  2KWV B;  3HM3 A;  3ZNZ B;  1WIA A;  2KX3 A;  5CTR C;  2MLB A;  1Q1O A;  2L0T A;  4HDO A;  3GZN I;  2HE7 A;  5CHF A;  2KVR A;  2M17 A;  2XK5 A;  3UGB B;  3PRZ A;  5J17 A;  2MBQ A;  2K1F A;  4ANU A;  2K8H A;  1WM3 A;  3UIO B;  3EC8 A;  2Z59 B;  2L05 A;  3R66 C;  3L13 A;  3APF A;  2D07 B;  3ONS A;  2A5U A;  4DHZ B;  4FHJ A;  4F1S A;  3UQB A;  3ZDT A;  1Z2M A;  1VD2 A;  4AOF A;  3AU5 A;  3VH3 B;  3WAN A;  2HD5 B;  3KYD D;  1GUA B;  2GBJ A;  2MX2 A;  3V62 A;  2MBO A;  3H7P A;  2DEN B;  3HM6 X;  4DDI D;  4DDG D;  1X1M A;  2RR9 A;  2IZV B;  2NVU I;  2KJH B;  5AZF A;  2PE9 A;  2ZEQ A;  2KFK B;  3OJ3 A;  3QJZ A;  1V81 A;  3ZIM A;  2D10 A;  2N9P C;  2KDF B;  1WFY A;  3QAR A;  3VTV A;  4ZRI A;  2LVP A;  3HK0 A;  2BPS A;  2N7E A;  4ANX A;  3QCA A;  4XZ4 A;  1WZ3 A;  4I6N B;  2VRR B;  2KMA A;  2CHZ A;  5DCN A;  1R4N I;  2PE6 B;  1T0Y A;  2KFJ A;  2N7D A;  3L17 A;  2N1V A;  1Z5S B;  4CO7 A;  4M8M A;  2CS4 A;  2KDI A;  2KO3 A;  2JRH A;  4G11 A;  3TBL D;  3JSV B;  4J6I A;  2JXX A;  1V5T A;  2ZPY A;  4HPL B;  2FID A;  4KSL C;  4WJQ A;  4WAA A;  2KFK A;  3ECI A;  2KOX A;  4MEM A;  1SIF A;  2PJH A;  3L54 A;  5CX3 A;  2KAN A;  3ALB A;  1WX8 A;  3KH0 A;  1IP9 A;  2WDT B;  3ZKJ C;  1WRD B;  1E7U A;  4EZK A;  3RCZ A;  4ANV A;  4KSK C;  2L76 A;  3A4R A;  4GDK A;  1WXS A;  4KIK A;  3V6C B;  3PT2 B;  4TQ1 A;  2ZVN A;  4BFR A;  4BVU C;  1M94 A;  4W9K A;  3JW0 X;  3QA8 A;  4K7W A;  3UF8 A;  3VH4 B;  4FAD A;  2C9W B;  1UGM A;  3H1U A;  4HWI B;  3PHX B;  4WWN A;  4MGK E;  1EO6 A;  2RPQ A;  1KJT A;  2C7M B;  4BOZ B;  1C3T A;  3KW5 B;  2DAF A;  3H6N A;  1L7Y A;  2KWC A;  4BBN C;  4G50 A;  4RM8 A;  1E90 A;  5D94 A;  4MSQ B;  2AL6 A;  3PLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...