1RAXA

Ra-domain of ral guanosine-nucleotide dissociation stimulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
QQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ras-binding domain
molecule keywords PROTEIN (RA-DOMAIN OF RAL GUANOSINE DISSOCIATION STIMULATOR)
publication title High-Resolution Structure of the Ra-Domain of Human Ralgds and a Dynamics Study of its Binding Loop to Ras
rcsb
source organism Homo sapiens
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1999-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1raxA00
2JF5A 1ZKHA 3HIZA 3MJWA 5JZEB 2HJ8A 5DPTA 1V2YA 2DAFA 1P98A 5G55A 4LJPB 2ZPNA 2ZCCA 3L16A 3LDZE 3S2AA 3V60A 1L7YA 3ZDTA 3JYUA 5E6NA 2KDBA 4W9CA 1V80A 4IWPA 5D6JB 4MGIE 5BO4B 2FUHB 4BBNF 1WMHB 2FIDA 2KWVB 1MG8A 2PEAA 3AI5A 4P7IA 3BINA 4XX5A 1JRUA 3W1SC 2GBRA 2AL6A 3KH0A 2BYEA 2KMCA 2LVPA 2NVUI 2K39A 4GU2A 1BT0A 4I6NB 1WJ6A 3IHPC 1WY8A 5KHOA 2LRWA 4MSQB 1NBFC 1WJNA 2LRUA 2IO2B 1TZ1A 3PPAA 4FHJA 2WX1A 2CS4A 4W9KA 2JZ3B 3IVFA 2BGFA 2MCNB 3PGEA 2A5UA 4GN1A 4NAWB 3CSTA 2D11A 1E7VA 2DYBA 2LZ6A 4AWJA 2IY0B 2N1VA 5LXHA 3VDZA 1XD3B 2KZRA 2LD9A 2MA9B 1Z2MA 3DBHI 3DVGY 2PPHA 5CHVC 4EOYA 4HJKA 1P9DU 1WXSA 1AARA 1NI2A 2BWES 5D2MB 2DYOA 2ZNVC 2KMAA 1T0YA 3ZO5B 5IAAC 2GOWA 1WXAA 4ICVA 4KDIC 3VTUA 3T8MA 2KNBA 2KD0A 3W1YA 2CR5A 2R2OA 4IG7B 3NOBA 2C7NB 2K6QA 1V81A 1XQQA 3K9OB 4WAAA 5AEKB 1YQBA 1E5WA 4GMVA 3D32A 3RCZA 1KJTA 4HVBA 3QK0A 1V86A 2BF8B 3PZDA 2O6VD 3AULA 5E6PA 2OJRA 1EF1A 4TV3A 3ZW3A 2MP2B 1WIAA 1RAXA 3VUWA 5C1ZA 2ZCBA 4W9IA 5LLIA 3SU8X 3MHSD 4F8CB 2K8HA 2GBJA 2KTFA 3OJ3A 4A3OA 1KM7A 1U4AA 1PQSA 3I3TB 4KSKC 4G50A 3ZVVA 4NQLB 4PS7A 2MRPA 2LXAA 4IM3A 1E7UA 4G0NB 2EMSA 5LXIB 2O6VB 2XK5A 2FCQA 3M62B 4IW0A 2C7MB 4M0WB 1H4RA 1WI0A 2YVCA 4DDGD 4EEWA 4MJSB 2PE6B 3RYTA 3OJ4B 2MBBB 2K25A 5IA7A 1M94A 3PLVA 4AOFA 2NCNA 2C9WB 1P1AA 2JVCA 2L05A 2KQSA 4ANVA 5AZGA 3PTFC 2AYOB 3JSVB 2XBBC 3KUDB 1S1QB 2I1JA 4IWQA 2KANA 5G2NA 3UQBA 4IM2A 1R4NI 4BBNC 4MGKE 3PSEB 4W9EA 4HPLB 5FR6A 3R7QA 2AEHA 3HHMA 4JL9A 1WFYA 1ZW7A 3DBLI 3QWZB 4KV2A 4URKA 4HCPB 1WR1A 1WE6A 3RZFA 3VTVA 3ENEA 3QAQA 4WJPA 4DHZE 1WYWB 2FCNA 3A9JA 3QJZA 2MLBA 4FHKA 3ZDMC 5L83A 3QX1A 2D10A 3A33B 2KX0A 4FN2A 2IYDB 2KFKA 4MGZE 2IO1B 3ZNHB 1R4MI 2YLMA 3PRZA 4CO7A 4DWFA 3A1QA 4IM0A 3PREA 1WF9A 2J0MA 3VHTC 2MSED 3UIPB 3ML8A 4RMAA 5CHFA 4LCDE 5JH5C 5C23A 2ZVOA 4GDLB 1LM8B 4BKSA 4TQ1A 3PHXB 1WRDB 3KYDD 3OAWA 3LJ3A 1H8CA 4DXAB 2B3AA 2IY1B 3ZNID 1WM2A 3RZWC 5D94A 1WMHA 4ZRKA 4ZYNA 3ZNGC 1E8XA 2C60A 4FJVB 2HE7A 2V4LA 3M3JA 1OEYJ 2KTRA 3WAOA 1GUAB 4JLCA 2NBVB 2KTRB 4KZ0A 3QQ8B 4YL8A 5JHBA 3KUZA 2NS5A 2ZNVB 3DDCB 1P0RA 2RGFA 4JGHB 1WGYA 2D3GA 3AU5A 4EZJA 3DCGA 5D7GA 4ICUA 5KHQA 4WJOA 1WM3A 4MELA 4GXBA 4NAWA 4GSWA 2G4DB 2FCMA 2IBIB 4GIVA 3R7RA 4NQKE 4J6IA 2CHWA 4DHJB 1EF5A 2GBMA 3WIMA 2K8BA 3L13A 4N9F4 4BVUC 3UF8A 3GOEA 3NZSA 2IZVB 4ANUA 2REXA 1Q1OA 2KO3A 2KK8A 2PJHA 4PYUA 3VQIA 3AXCA 3ONSA 4WWNA 1A5RA 4FBJB 2KXJA 3QCAA 2KOXA 4AJYB 1ISNA 1IP9A 2KN5A 4NJ7A 3TCAA 2N7EA 4I6PA 3KUCB 2JUOA 4HCNB 4WJNA 2JWZA 3VAWA 1Z5SB 2W9NA 2L00B 3VTWA 4AP4C 2KHWB 3TIXA 2MBHA 5DCNA 2LGXA 3ZRFA 3VXWA 3B1LX 3EC8A 5CX3A 2ZZPB 4W9HA 3NS8A 4MSMB 3EECA 4PS8A 3QC8B 2M4NA 1YX5B 2LASA 2MP2A 3DOWA 4W9LA 2KDFB 3A9KB 1WX8A 3UGBB 4AJWA 1SE9A 1UGMA 1UZXB 5DPRA 4WJQA 1YJ1A 2FNJB 4MH0E 4X57B 4FLHA 1E8YA 3O65B 4BKTA 1S3SG 3IG3A 2L3ZA 4IWOA 4CYEA 4FJYA 3NY5A 2MBQA 3OLMD 5TR5A 3ZUNA 2O6VA 3KVFB 4KIKB 2N7DA 1RLFA 1XT9B 4RM9A 4MJSA 4W9GA 4ASWC 2ASQA 2NR2A 5J2RA 2N9XA 4M8MA 2O2VB 2FAZA 3M95A 4EKUA 3PV1A 4HPMB 4W9FA 2JY6A 3B08A 2DZMA 3CSFA 2K1FA 2UWQA 1WR6E 2MQJA 3EHVA 2Y5BB 4KSLC 1WGRA 4IUMB 3JSVA 3ZLZA 2LUEA 4M8NA 1WE7A 2D07B 2UYZB 3PT2B 4IC7B 5AZFA 2QHOA 2JRHA 4ZRJA 3VUYA 3T9LA 3ZIMA 2N9PC 3SDLC 1GJZA 1WGGA 1X1MA 2DZKA 2ZEQA 2KWCA 4F7ZA 4G11A 4GDKB 4XZ4A 4FA6A 2D2QA 2BYFA 3TJPA 4KDLB 2PE9A 1K8RB 4MM3A 2MWSB 3L10B 3TMPB 2L0FA 4FJZA 4HXDA 2K6DB 3C0RB 3W1SA 3ZTCA 3A4SC 2DZIA 2KX3A 3R66C 4E74A 2GBKA 1OTRB 3DVNV 1P3QU 3H7PB 4FADA 1C3TA 3KYCD 2BPSA 2LVQA 3N30A 4WQOB 3ZTDA 2LXCA 2N4FA 4B9KA 4ZDVA 4NJ6A 4GGQA 2MBOA 1OQYA 1UELA 1VD2A 2DX5B 4HWIB 4NY0A 3QA8A 1KLVA 1L2NA 4G3XB 2AL3A 3U8ZA 2L7RA 2BKRB 4GDLA 1GNUA 1WJ4A 1Y8RC 2KQ7A 3IFWB 3PLUA 3UIOB 3ML9A 1RFAA 1Q0WB 2KJRA 4DDID 4TQ0A 5J18A 4NNJB 2C5LC 1G6JA 1WX9A 2LGYA 2V3SA 3WAPA 3U30A 2JT4B 2CHZA 2KWUB 3IBEA 2GBNA 2A4ZA 4DHJD 1J19A 2M0XA 2WYQA 3VH4B 1YX6B 4KZCA 4BOZB 3N3KB 1V5TA 4DBGA 4KVGB 4CHKA 4GOCA 2NPTB 2KDIA 2KLCA 2ZJDA 3CMMB 2BWFA 3H6NA 3DBRI 3SHQA 3TBLD 5EDSA 4F1SA 1F9JA 3PRPB 4K7WA 3L17A 1SGHA 2JZZA 4EZLA 4DK5A 2L76A 4DHZB 3H7SA 1V49A 4NPNA 3VUXA 1KOTA 1GC6A 3V61A 2CKHB 1IPGA 1D3ZA 2DENB 2GMIC 2KVRA 1V5OA 2FCSA 5DPWA 2DAJA 3PS6A 3CF6E 3P2BA 2NBUA 2M1MA 3BY4B 2DHZA 3UQAA 3GZNI 4I6LB 2M8SA 2J0KA 4W9DA 3H9DA 4MEMA 2N9EB 3U7DA 3X23A 1LFDA 1FXTB 2G3QB 3QARA 1GC7A 1WGDA 1E8ZA 3Q3FA 4B95A 2G45B 4RM8A 1VCBA 4K1RB 3PHWB 2J7QB 4BFRA 2N1WA 1UBQA 1YIWA 3DVNU 3R3MA 3RT3B 5DPSA 1J8CA 3HK0A 1TTNA 3A4RA 2KLGA 1LQBA 2ZPYA 3V6EB 2KJHB 5GMVA 1E90A 4EFOA 2KC1A 4WWPA 2LWPA 3A9KA 2LGDA 3X0WA 3PVLA 4OVVA 1TBEA 3ZNZB 3HM3A 3AU4A 1WGHA 5HKHA 2RPQA 3HM6X 4EZKA 2KC2A 2BKFA 3APDA 5CHWA 4OVUA 3V62A 4LJOB 1QZEA 5E6OA 2MBEA 4II3B 3H1UA 1IYFA 3ZRCA 4W9JA 1UD7A 3SD5A 4KIKA 1EUVB 4A20A 5L95C 2G4SA 1OGWA 2OOBB 1HE8A 3Q3JA 4HK2A 4K7UA 4MDKE 1WX7A 3L08A 4E71A 3NHEB 3K9PB 2CU1A 3DBSA 3QIJA 3VFKA 2KFJA 2O2VA 3DVGX 2I1KA 1NDDA 1V6EA 3APCA 2M17A 2MX2A 1YD8U 3APFA 1V9JA 2KJ6A 3KW5B 2DZJA 3VH3B 3DQVA 1C1YB 3NZUA 3V6CB 4HLEA 5JHAA 3JVZX 1WJUA 4ANWA 3EFUA 4K81A 1CMXB 2JXXA 1SIFA 2IO0B 2JPHA 4ZRIA 1E8WA 4E3CA 4TKNA 2JRIB 3PRMB 2LVOA 1WXMA 2FIFA 3ECIA 1OEYA 2XK5B 2RD0A 3ALBA 3N32A 1J0GA 3WALA 4WWOA 3WAMA 3JW0X 4GDKA 2VRRB 3RD2A 4AUQC 4ANXA 2DYMA 4K7SA 1UH6A 2ZVNA 3DPDA 2HTHA 3MTNB 4FULA 4JQWC 2C7HA 4MGYE 4PYZA 4II2B 3TL5A 2MW5A 2WX0A 2L0TA 2Z0EB 2EMTA 2LJ5A 2NBWB 2Z59B 3H7PA 4HDOA 1GG3A 2Z0DB 2AWTA 2KKCA 3ZKJC 2LI5A 2IO3B 2KDEB 3B0AA 1I42A 4LDTD 1LXDA 1TGZB 4JIOU 5CTRC 3VVWB 3UINB 1ZGUB 1RRBA 4XC2A 1WXVA 2WWZA 2L8JA 5J17A 3M63B 2WDTB 2RSUA 4BKGA 2XEWA 4PS3A 2EKEC 2K8CA 2BYVE 3WANA 2R2QA 4HDQA 3WA0A 4GB9A 1I35A 1Q5WB 2RR9A 3A9JB 4BKSD 4BOSC 4LDTB 4TUUA 3QHTA 3RULA 4EUTA 1WZ0A 1WH3A 2KFKB 2CHXA 1UBIA 2V1YA 5AZHA 3RUIB 3L54A 3L0WB 4B6WA 3A1QB 1EO6A 2J0JA 4A3PA 1WZ3A 2HD5B 2NPTA
chains in the Genus database with same CATH superfamily
3RNEC 2K22A 4W9CA 2CU3A 2M19A 2N9KA 4P7IA 4XX5A 3O13A 1KF6B 2AL6A 4I6NB 2NVUI 2D3AA 1WY8A 5KHOA 2KVZA 1EU3A 4MSQB 1NBFC 2INNE 2ONQA 3NUHB 2A5UA 3CSTA 2KT7A 2JYEA 1P7EA 4EOYA 1P9DU 1NI2A 2BWES 2ZNVC 1T0YA 2GOWA 4ICVA 3VTUA 2KNBA 1CJEA 1V81A 4HVBA 1VJKA 3EGRA 3AMZA 2BF8B 1I4QA 3AE2B 4A9AA 4TV3A 3AE5B 2MP2B 1RWSA 5FR3A 2CJOA 2FE8A 2ZCBA 3BVZA 3Q3MC 4F8CB 2KTFA 4A3OA 1HA5A 4K3BA 2INPE 4ACFA 1PQSA 4KSKC 4NQLB 1GB1A 1E7UA 3TEZA 2EMSA 3R8BA 2O6VB 2XK5A 4RGNA 2YVCA 2M0AA 3OJ4B 2K25A 5JXVA 2JVCA 5T8IA 1SXTA 2AYOB 3U4EG 3JSVB 2GI9A 2V3NA 2WDQB 5G2NA 3TUOA 1GB4A 4IM2A 1TJEA 4MGKE 3PSEB 4W9EA 1J7BA 2FBWB 3AN1A 1WFYA 3RZFA 1WE6A 3ENEA 4WJPA 2FCNA 4MM3B 3ZDMC 1UWXA 1JROA 4MGZE 1R4MI 3A1QA 4IM0A 1WF9A 1YN5A 2MSED 4RMAA 1QF6A 5C23A 4GDLB 4HRSA 3LJ3A 1H8CA 1IBXB 3ZNID 3RNAC 3J9CA 5D94A 1WMHA 2QSDA 2OHFA 3IT4B 4BZAA 1K51A 1FXIA 3KUZA 2RGFA 5HHDG 1ZP0B 4ICUA 3N1XC 4NAWA 2JU6X 2IBIB 4BVUC 3WIMA 5AUIA 2PJHA 3DWGC 2KXJA 3QCAA 2KOXA 1ISNA 4DXFA 1YNTE 4I6PA 4HCNB 2JWZA 2QDFA 1I4GA 2H89B 1T0SC 3DHHC 4NJCA 2LEKA 5CX3A 4L2YA 1XLQA 2M4NA 3DOWA 4W9LA 2KDFB 1WX8A 5DPRA 2FNJB 1E8YA 2WXHA 3RNCC 5D3DA 2L3ZA 3NY5A 2YEPF 3AE6B 1XT9B 4M0WA 3BYYB 4RM9A 5HFYA 2ASQA 3Q14C 3KWLA 3PV1A 3ZQ4A 4A55A 1XLNA 1WR6E 2Y5BB 1WGRA 2WXGA 2D07B 1T5XD 2JRHA 4ZRJA 3VUYA 3SDLC 4TSSA 3C19A 4FA6A 2BQQA 2L0FA 2K6DB 3W1SA 3ZTCA 2WXMA 2DZIA 1UF0A 1OTRB 3N30A 1K53A 3ZTDA 4B9KA 1L2NA 4HWIB 3QA8A 2DBYA 5IOIA 1B1ZA 1K52A 1TIFA 2V0GA 4XYCA 4M01A 3UIOB 3AM9A 1Q0WB 4DDID 2C5LC 1WX9A 2PVGC 2J4XA 3U30A 2AQ3B 2KWUB 3W2DA 1MI0A 1TKGA 1YX6B 5HI1A 2KAJA 3I5JC 1SE3A 1XXGA 4RNAA 2ZJDA 1LGRA 4D2KA 2BWFA 2Q5WD 3H6NA 3L17A 1SGHA 4EZLA 1PGBA 3MC0B 1B9RA 1V97A 1GC6A 3GE3C 1IPGA 2L32A 2GMIC 4N6EB 2KVRA 2FCSA 5DPWA 1SF0A 3CF6E 1IGCA 1SIJA 2DHZA 3UQAA 3GZNI 2WLBA 4MEMA 1A70A 1LFDA 1FO4A 3QARA 4REZA 4B95A 1VCBA 4K1RB 3PHWB 2BS4B 2SEBD 2DNFA 2N1WA 1YIWA 3DVNU 1JWSD 3A4RA 2ZPYA 3BWUD 3RPFC 2KJHB 4EFOA 1IGDA 4WWPA 2LWPA 2OEDA 1KRHA 4YXDB 1QT9A 3AU4A 2RPQA 3HM6X 4EZKA 1N61A 2KC2A 4DXGA 1WSPA 4II3B 3ZRCA 4M00A 4OZCA 1JWUD 4M02A 1EUVB 2HJ1A 2G4SA 2OOBB 3PO0A 1K50A 2LHEA 1WX7A 4HEA1 3NHEB 3K9PB 2RDGA 3VFKA 3B2FA 2O2VA 1ZDVA 1E9MA 1KFYB 3W9CB 2CJNA 3APFA 2KJ6A 1F77A 2V9HA 3EFUA 2JXXA 2JPHA 1E8WA 4TKNA 3ETRA 2FIFA 2XK5B 2RD0A 3ALBA 3RD2A 2GRIA 4K7SA 3DPDA 2HTHA 2PMVA 2WU5B 3TL5A 2MW5A 2Z0EB 2L0TA 2LJ5A 2Z59B 1GG3A 2KKCA 3B0AA 3Q3OC 1I42A 5BYSA 1LXDA 1L6UA 4FXCA 4JIOU 3I57A 3VRAB 3DBLB 1OFFA 1WXVA 2N0SB 4BKGA 1HXYD 1FMAD 2BYVE 2R2QA 1TY0A 2JZPA 1T6BX 1SE2A 4UDUC 5AZHA 4YTMB 3A1QB 3E56A 1L0YB 2J0JA 1YQBA 1FD6A 5JZEB 1L6VA 1ZKHA 3HRDD 2FUG1 2ZPNA 3LDZE 5BYRA 1C78A 3BIID 2WDVB 2RDHA 1XF5L 3AE3B 5D6JB 4MGIE 3MC8A 2FUHB 3PZ7A 1WMHB 2KWVB 2PEAA 3AI5A 3BINA 1JRUA 1BT0A 1N6ZA 2JYTA 2LRWA 2LRUA 2IO2B 5LNK1 2WX1A 2MHJA 4NAWB 2D11A 1E7VA 2DYBA 4RGTA 2LZ6A 2IY0B 1QILA 1XCQL 2N1VA 4H2AA 1XD3B 2MA9B 1Z2MA 3N9YC 1SB3C 5CHVC 4HJKA 4OHJA 5H92C 5C3JB 5D2MB 2DYOA 2KMAA 3FC4A 5IAAC 3T8MA 4P6VF 2R2OA 3VR8B 4IG7B 3NOBA 2C7NB 2K6QA 1HQRD 3L4PA 3ZJTA 1E5WA 3D32A 1KJTA 4XE0A 1V86A 2N9LA 3PZDA 1VLBA 4L1BA 2K5PA 2QMTA 1MFWA 1EF1A 4KX6B 5AUKA 3ZW3A 1WIAA 1RAXA 2WHIA 5C1ZA 2D3CA 5LLIA 2K8HA 1KM7A 1Q10A 1U4AA 1N63A 3ZVVA 4G50A 1EWYC 1D5MC 1VRAB 2FCQA 4M0WB 1H4RA 4EEWA 1V1PA 1C79A 2NTSA 2PE6B 2KWDA 2MBBB 5D3IB 1M94A 2R61A 1D6EC 4XGAB 4AOFA 2I2YA 2JSVX 2NCNA 3HVZA 3PTFC 3ZJVA 1D4BA 2UU7A 1S1QB 4IWQA 2KANA 3NVZA 4B0MA 3R7QA 1M4VA 4JL9A 1ZW7A 3DBLI 4C4VB 3VTVA 3QAQA 1JCKB 1E0ZA 4DHZE 1WYWB 3EFCA 1AW7A 4FHKA 2AQ2B 1R4MB 5L83A 2QIEB 3A33B 2KX0A 4DWFA 2IO1B 2YLMA 3PRZA 2QILA 2J42A 2BBCA 5C2TB 2J0MA 1T0RC 3N1YC 3Q6BA 1SBBB 5JH5C 2ZVOA 2WXLA 3LB8C 4TQ1A 3KYDD 4XWWA 1N5WA 4ZRKA 1D5ZC 4FJVB 3GS2A 2V4LA 3M3JA 2KTRA 1GUAB 3QQ8B 2NS5A 1I4PA 4JGHB 1F2RI 1WGYA 5D7GA 2BT6A 4WJOA 4GSWA 4NQKE 2PIAA 4DHJB 1EF5A 3L13A 2KACA 3UF8A 3GOEA 1DOXA 3NZ3A 4USAA 5TSSA 1QOFA 2KO3A 3VQIA 4AJYB 2J53A 1EU4A 2AX5A 3KLSX 5E6JA 2JUOA 3VAWA 1Z5SB 2W9NA 2L00B 4A6QA 1QOAA 3TIXA 2MBHA 2L83A 3VXWA 4XDDA 3EC8A 2ZZPB 2QCZA 2WS3B 3EECA 1YX5B 4AJWA 1GOZA 3UGBB 1UZXB 5EE9A 4FJYA 5H8YE 1RLFA 4BAXA 3P1MA 4NZLB 3BVGA 5I4DA 2LHDA 5G5GA 2NR2A 3NS1A 1BXTA 2N9XA 2O2VB 2JWUA 2FAZA 3M95A 4EE2A 4HPMB 4W9FA 2JY6A 5J2RA 2DZMA 3CSFA 2MQJA 4KSLC 2LUEA 3PT2B 1ZXIA 2NTTA 3ZIMA 2RPVA 1GJZA 2ZEQA 2DZKA 2KWCA 3MFGA 4F7ZA 1K8RB 1WRIA 3TMPB 1C4PA 2LMCA 3C0RB 3R66C 2PKOA 2GBKA 3KYCD 4PK1A 4WQOB 4NJ6A 1FNWA 1UELA 2DX5B 4NY0A 4RH6A 3ZJUA 2L7RA 1J7CA 1SJED 3P63A 2JX5A 2LGYA 2KQ4X 1C4CA 2JT4B 2CHZA 2WXNA 4DHJD 2Y3AA 4KVGB 4CHKA 2KDIA 4ARIA 3CMMB 4F1SA 1F9JA 3PRPB 4K7WA 2JZZA 4DK5A 3H7SA 1KOTA 3V61A 1GAQB 4RCOA 1D3ZA 1I4RA 2DENB 1V5OA 3GZNB 4A8XC 2NBUA 3BY4B 2Y5PA 2PVOD 4RGMA 2N9EB 3U7DA 1FXTB 1ROEA 1GC7A 1WGDA 4AS1A 1AYFA 4XWTA 1UBQA 5DPSA 3HK0A 2KLGA 3RN9C 2VH2A 2WNMA 1FNVA 1F2RC 4JWUC 3A9KA 2LGDA 3URYA 4OVVA 3ZNZB 1UGJA 4WQMA 1WGHA 3TEYA 2BKFA 5CHWA 1YMHE 1IYFA 3H1UA 1PYWD 1UD7A 4W9JA 2ICIA 5BYQA 4LNFA 1HE8A 1ZDXA 4HK2A 1T3QA 3L08A 1XEEA 1V6EA 3APCA 2M17A 4YSYB 4AQ7A 3VH3B 1C1YB 3VRBB 3U7ZA 3KWVA 4ZRIA 2VZKD 1OEYA 1J0GA 3N32A 2BB5A 3WALA 1XLOA 1V1PB 4AUQC 2ZVNA 1BMLC 4RGOS 3EA6A 1C77A 1STEA 2W55A 2W3SA 3TSSA 4PYZA 4MGYE 3WCQA 2NBWB 2KDEB 4LDTD 3UINB 2WXOA 1NVID 1RRBA 2WWZA 1FCLA 4DQOC 2RSUA 4PS3A 4R3DA 2ACZB 1WYGA 3AEEB 3Q8EA 2XN9C 4TUUA 2WP9B 2V1YA 2CHXA 3L0WB 4B6WA 3HIZA 3AE4B 3AB5A 2HJ8A 5DPTA 1BUIC 4LNNA 5G55A 2H88B 4C56C 2PTLA 2ZCCA 1QKZA 3S2AA 3V60A 3ZDTA 3JYUA 5E6NA 2KDBA 4J3OD 2ZW1A 5BO4B 1ENFA 3W1SC 4LK0M 1P7FA 1JW9D 2K39A 2BS3B 3IHPC 2BTEA 1WJNA 1DOYA 4OZBA 1D5XC 4YSZB 3AEAB 1SEBD 3IVFA 3PGEA 3B9JA 1AN8A 4GN1A 4P1CC 3RNFC 4JE3B 2Y5CA 5HG2A 4AWJA 3RMKC 5LXHA 3VDZA 2LD9A 3DVGY 2PPHA 1DYQA 3CIRB 3Q8AA 2IDYA 3ZO5B 2HDEA 1TKYA 1UUPA 2CR5A 1QLBB 2GLSA 2KDMA 1XQQA 3K9OB 3RCZA 4C7YA 3LYYA 1QOBA 1WGKA 4YTPB 5E6PA 2OJRA 1FRDA 3NVVA 3AH7A 2D5GA 4CQNA 4W9IA 3SU8X 2BS2B 2GBJA 1CK1A 1I4XA 3I3TB 2MRPA 4XDCA 4IM3A 4G0NB 2N7JA 3ZGZA 1N60A 2C7MB 4ZRQA 1I7HA 4ITKA 1NYRA 2L05A 4ANVA 4WWMA 5AZGA 1C76A 4GLSC 1R4NI 3ZYYX 4BBNC 5FR6A 1L5PA 4L23A 1JWAD 1ET6A 3QX1A 3BZDB 2D10A 3ZXVA 3R2IA 4FN2A 2IYDB 2KFKA 3P42A 1JRPA 4CO7A 1V8CA 3SFEB 3PREA 1CZPA 3VHTC 1TS5A 1PGAA 3UIPB 5CHFA 3AEFB 4LCDE 1LM8B 3PHXB 1WRDB 3OAWA 2QC8A 4WAFA 4DXAB 2B3AA 2IY1B 3C8YA 3FILA 2LGIA 3OG5A 3RZWC 4ZYNA 4C80A 2C60A 4KGRA 3TEXA 1TZOA 4JLCA 4YWGG 4YL8A 3AE7B 5JHBA 1P0RA 3DBRB 4EZJA 5KHQA 1XLPA 3IT6B 4MELA 4GXBA 3P4QB 1KLUD 2G4DB 3Q69A 4J6IA 2GBMA 2MJ3A 4N9F4 4NAMA 2IZVB 1VZ7A 1KTKA 3AXCA 3ONSA 4WWNA 4IKGA 4NJ7A 2MEKA 3KUCB 5G5HA 4WJNA 1E7PB 4Q2JA 4AP4C 5DCNA 4RFBA 2LGXA 2KN4A 1DGJA 4W9HA 4MSMB 2ZW0A 2LASA 3A9KB 1SE9A 2SAKA 4IDIA 3SEBA 4MH0E 4X57B 4FLHA 2X8XX 1S3SG 3IG3A 4ZHPA 4IWOA 1ZE3D 3ZUNA 4ZYSA 4O1NA 2AQ1B 4WIPA 4MJSA 4ASWC 2WXFA 2QJLA 2K9XA 2Z8LA 4EKUA 3B08A 3PZ8A 4M8NA 1FFUA 1WE7A 1C9FA 4JPSA 5FK9C 2EKIA 3MHZA 1YQ3B 2E3TA 2D3BA 2D2QA 2BYFA 3TJPA 2MWSB 4HXDA 3DHGC 1HEZE 1P3QU 3RNGC 2BPSA 5GXGB 2LXCA 4ZDVA 4GGQA 5IKCM 1VD2A 1KLVA 4G3XB 3U8ZA 3V05A 2BKRB 3BYTB 5BMGA 5EE3A 1GNUA 3IFWB 3BK1A 2BB6A 3ML9A 1MPEA 2KJRA 1YN3A 3Q8BA 5J18A 1TS4A 4NNJB 1G6JA 2LUMA 1RM6C 4YTNB 2A4ZA 1J19A 3VH4B 4KZCA 4BOZB 3N3KB 1FEHA 1V5TA 4N59A 4DBGA 1HTQA 2DWQA 1LO5D 2KLCA 2V3PA 3DBRI 3SHQA 3TBLD 5EDSA 4DHZB 1YN4A 2W54A 1MJDA 2IGGA 3P2BA 2M1MA 1AWDA 4MT5A 3H9DA 4KGSA 3I9V1 2G3QB 1E8ZA 1Y56A 4RM8A 2J7QB 4BFRA 1JWBD 3DBHB 1MHXA 1EM7A 3RFZB 1TTNA 3AV8A 2V4IB 3GB1A 2KC1A 3IAM1 1YJIA 3LXFA 3PVLA 1FFVA 2W3RA 1TBEA 1ESFA 3HM3A 1TY2A 5HKHA 2WDRB 3APDA 3V62A 1FXAA 1QZEA 2IGDA 4B0EA 3SD5A 4KIKA 4A20A 5L95C 2X38A 2L52A 3Q3JA 4MDKE 4K7UA 4E71A 4OVZA 3QIJA 1YQ4B 1NDDA 3HVDA 2MX2A 1V9JA 3KW5B 2DZJA 3NZUA 4HLEA 3JVZX 4K81A 1CMXB 2IO0B 2JRIB 3PRMB 2LVOA 1WXMA 4WWOA 3WAMA 3CWIA 4GDKA 4ANXA 2DYMA 1UWMA 3UI3A 1KH0A 4P16A 1KLGD 3MP9A 4II2B 2WX0A 4HDOA 3H7PA 4WURA 3ZKJC 2AWTA 3P4RB 2LI5A 2VZKB 1TGZB 5CTRC 5J17A 2WDTB 2XEWA 2K8CA 2WU2B 3WANA 4TMAB 4HDQA 1I35A 2WXQA 3FKYA 1L0VB 4BKSD 4LDTB 2W82A 3RULA 4EUTA 1WZ0A 4P1BC 2KFKB 1UBIA 2EELA 2YEPB 1VZ8A 1WZ3A 2NPTA 4NPNA 2JF5A 3MJWA 1V2YA 2DAFA 1P98A 2JQRB 4LJPB 3L16A 3NG0A 3OWEB 1L7YA 4OZAA 3AEGB 5IN7A 4MH8A 1V80A 4IWPA 2HTME 3FILB 4BBNF 2FIDA 1MG8A 4WH4A 2GBRA 4GU2A 3KH0A 2BYEA 2KMCA 2LVPA 1QQRA 1WJ6A 4RF0A 1TZ1A 3PPAA 1PDXA 2RMMA 4FHJA 2LFIA 1TYGB 2CS4A 4W9KA 2JZ3B 2BGFA 3HUIA 3H8HA 2MCNB 4HKZE 3ABVB 4S17A 1OQRA 2KZRA 3DBHI 1WXSA 1AARA 2M56B 4HPPA 2WXPA 3U52E 3W5UB 1WXAA 3AECB 4KDIC 3MJ5A 2KD0A 3W1YA 3P4PB 3NVWA 2PLPA 4WAAA 5AEKB 4KKJA 2J52A 2IGHA 3NVYA 4GMVA 2WXIA 3QK0A 2DLBA 2L1AA 1F1HA 2O6VD 4ZHOA 3AULA 1TT5B 3VUWA 1UNSA 4LNOA 3MHSD 3OJ3A 1NI3A 3AEBB 1JWMD 3ZXRA 2WXRA 3NRZA 2NMQA 4PS7A 2LXAA 2QEJC 5LXIB 3IAS1 3SR6A 3M62B 4IW0A 5IO9A 1WI0A 4DDGD 3TEWA 4MJSB 3RYTA 1F52A 5IA7A 3PLVA 1PUTA 1L4DB 3SFDB 2C9WB 1P1AA 1NENB 2KQSA 2WXJA 2IJ0A 3KUDB 1R4NB 3AEDB 1C4AA 2I1JA 3UQBA 2LJIA 1HZ5A 1J8CA 3DHIC 4HPLB 2AEHA 3HHMA 3QWZB 2G1EA 1TS2A 4KV2A 4HCPB 1WR1A 4C4VA 4URKA 1NEKB 3QJZA 3A9JA 2MLBA 1ZUD2 4LNIA 1WXQA 4JX1C 3ZNHB 1ZXHA 1EWCA 3ML8A 4BKSA 1L0XB 5IP4D 4RF1A 1QOGA 1WM2A 4JWSC 3ZNGC 1E8XA 4C00A 1N62A 2HE7A 4ZRPA 1OEYJ 3V3XA 3WAOA 2NBVB 4IOIE 2KTRB 4KZ0A 2ZNVB 3DDCB 3NJTA 2D3GA 3AU5A 3DCGA 1ET9A 2IPKD 1XCTL 1WM3A 2WQYB 2G9HD 3B2GA 2FCMA 4GIVA 3R7RA 1SJHD 2CHWA 2K8BA 3NZSA 4ANUA 2REXA 1Q1OA 4ARCA 2KK8A 4PYUA 1A5RA 4FBJB 3E9SA 1WWTA 1IP9A 2KN5A 3TCAA 1E10A 2N7EA 5EE1A 4N58A 3VTWA 2KHWB 3Q2AC 1VR9A 3ZRFA 3B1LX 3NS8A 4YSXB 4PS8A 4YT0B 3QC8B 2MP2A 1UGMA 1GPXA 4WJQA 1YJ1A 5MPOA 3O65B 4BKTA 5EE0A 4CYEA 2MBQA 2GB1A 3OLMD 5TR5A 4PT5A 2O6VA 1ZOYB 3KVFB 4KIKB 2N7DA 3BK2A 1FM0D 4W9GA 4M8MA 1F0ZA 2K1FA 2UWQA 3EHVA 4HROA 4IUMB 3JSVA 3ZLZA 1FCCC 2MJEA 2UYZB 4IC7B 5AZFA 3KQ4A 2QHOA 1CQVA 3T9LA 2N9PC 1WGGA 1X1MA 4G11A 4GDKB 4XZ4A 4KDLB 2PE9A 3I63C 4MM3A 3L10B 4FJZA 3DWMA 4LNKA 4E74A 3A4SC 2KX3A 4FADA 3DVNV 3H7PB 3N20C 2VH1A 1C3TA 2BW2A 2LVQA 2N4FA 2MBOA 1OQYA 3U2SC 3W5VB 1ACCA 1VZ6A 2AL3A 4HKQA 1OQQA 5BMHA 4GDLA 1WJ4A 3Q8FA 1Y8RC 1SE4A 2KQ7A 3PLUA 3FAHA 1NYQA 4LTUA 1RFAA 3BVMA 1IBXA 2RDBC 4TQ0A 1I4HA 2V3SA 3WAPA 1E6EB 1RFKA 3IBEA 2GBNA 1JMLA 2M0XA 2WYQA 2PW9A 1L4ZB 1TS3A 2K0PA 4GOCA 2NPTB 2KYWA 2E6XA 4US8A 3Q3NC 1HZ6A 2L76A 4K3CA 1V49A 3VUXA 1MG4A 2CKHB 2KMMA 4QAYA 5BMIA 2DAJA 3R2TA 3PS6A 1MHHE 2JXTA 1N5XA 4I6LB 2M8SA 2J0KA 4W9DA 3X23A 4A90A 1ZPSA 3T3OA 4C7ZA 3Q3FA 2G45B 2WGSA 4LLGM 2LGSA 4S0RA 3R3MA 3RT3B 1LQBA 1XO3A 3GE8C 3V6EB 5GMVA 1E90A 2INDC 1HTOA 3X0WA 4US9A 3P4SB 1DOIA 3EUB2 1FIQA 1PGXA 4OVUA 4LJOB 5E6OA 2MBEA 3GP7A 1RYJA 2INCC 3RI7C 1FPYA 1VDVA 1OGWA 4MACA 2XNAC 1J7AA 2CU1A 3DBSA 2KFJA 1JALA 2I1KA 3DVGX 1YD8U 2WXKA 1FNUA 2ON8A 3DQVA 3V6CB 5JHAA 1WJUA 4ANWA 1SIFA 4E3CA 3IXSA 4OW0A 1TKEA 3ECIA 1JQ4A 4KGTA 3JW0X 2OJWA 1PFDA 2VRRB 4ZOHC 1UH6A 3MTNB 4FULA 3MC9A 2TSSA 2C7HA 3AE8B 4JQWC 1MVKA 2EMTA 4HJGE 2Z0DB 2IO3B 3VVWB 3VR9B 1ZGUB 3AE9B 4XC2A 3AE1B 3N1ZC 2L8JA 3M63B 2B76B 3T3NA 2EKEC 1V1OA 1YOVB 1SSNA 2BVCA 3WA0A 1IUEA 4GB9A 2MH7A 1Q5WB 2RR9A 1YJJA 3A9JB 3Q8CA 2I38A 5FKAC 1FRRA 3RNBC 2MJDA 4BOSC 3QHTA 1WH3A 3RUIB 2BYTA 3L54A 1R7SA 1T0QC 2K3UA 1EO6A 4A3PA 2HD5B 4KKIA 2XBBC
chains in the Genus database with same CATH topology
2JF5A 1ZKHA 3HIZA 3MJWA 5JZEB 2HJ8A 5DPTA 1V2YA 2DAFA 1P98A 5G55A 4LJPB 2ZPNA 2ZCCA 3L16A 3LDZE 3S2AA 3V60A 1L7YA 3ZDTA 3JYUA 5E6NA 2KDBA 4W9CA 1V80A 4IWPA 5D6JB 4MGIE 5BO4B 2FUHB 4BBNF 1WMHB 2FIDA 2KWVB 1MG8A 2PEAA 3AI5A 4P7IA 3BINA 4XX5A 1JRUA 3W1SC 2GBRA 2AL6A 3KH0A 2BYEA 2KMCA 2LVPA 2NVUI 2K39A 4GU2A 1BT0A 4I6NB 1WJ6A 3IHPC 1WY8A 5KHOA 2LRWA 4MSQB 1NBFC 1WJNA 2LRUA 2IO2B 1TZ1A 3PPAA 4FHJA 2WX1A 2CS4A 4W9KA 2JZ3B 3IVFA 2BGFA 2MCNB 3PGEA 2A5UA 4GN1A 4NAWB 3CSTA 2D11A 1E7VA 2DYBA 2LZ6A 4AWJA 2IY0B 2N1VA 5LXHA 3VDZA 1XD3B 2KZRA 2LD9A 2MA9B 1Z2MA 3DBHI 3DVGY 2PPHA 5CHVC 4EOYA 4HJKA 1P9DU 1WXSA 1AARA 1NI2A 2BWES 5D2MB 2DYOA 2ZNVC 2KMAA 1T0YA 3ZO5B 5IAAC 2GOWA 1WXAA 4ICVA 4KDIC 3VTUA 3T8MA 2KNBA 2KD0A 3W1YA 2CR5A 2R2OA 4IG7B 3NOBA 2C7NB 2K6QA 1V81A 1XQQA 3K9OB 4WAAA 5AEKB 1YQBA 1E5WA 4GMVA 3D32A 3RCZA 1KJTA 4HVBA 3QK0A 1V86A 2BF8B 3PZDA 2O6VD 3AULA 5E6PA 2OJRA 1EF1A 4TV3A 3ZW3A 2MP2B 1WIAA 1RAXA 3VUWA 5C1ZA 2ZCBA 4W9IA 5LLIA 3SU8X 3MHSD 4F8CB 2K8HA 2GBJA 2KTFA 3OJ3A 4A3OA 1KM7A 1U4AA 1PQSA 3I3TB 4KSKC 4G50A 3ZVVA 4NQLB 4PS7A 2MRPA 2LXAA 4IM3A 1E7UA 4G0NB 2EMSA 5LXIB 2O6VB 2XK5A 2FCQA 3M62B 4IW0A 2C7MB 4M0WB 1H4RA 1WI0A 2YVCA 4DDGD 4EEWA 4MJSB 2PE6B 3RYTA 3OJ4B 2MBBB 2K25A 5IA7A 1M94A 3PLVA 4AOFA 2NCNA 2C9WB 1P1AA 2JVCA 2L05A 2KQSA 4ANVA 5AZGA 3PTFC 2AYOB 3JSVB 2XBBC 3KUDB 1S1QB 2I1JA 4IWQA 2KANA 5G2NA 3UQBA 4IM2A 1R4NI 4BBNC 4MGKE 3PSEB 4W9EA 4HPLB 5FR6A 3R7QA 2AEHA 3HHMA 4JL9A 1WFYA 1ZW7A 3DBLI 3QWZB 4KV2A 4URKA 4HCPB 1WR1A 1WE6A 3RZFA 3VTVA 3ENEA 3QAQA 4WJPA 4DHZE 1WYWB 2FCNA 3A9JA 3QJZA 2MLBA 4FHKA 3ZDMC 5L83A 3QX1A 2D10A 3A33B 2KX0A 4FN2A 2IYDB 2KFKA 4MGZE 2IO1B 3ZNHB 1R4MI 2YLMA 3PRZA 4CO7A 4DWFA 3A1QA 4IM0A 3PREA 1WF9A 2J0MA 3VHTC 2MSED 3UIPB 3ML8A 4RMAA 5CHFA 4LCDE 5JH5C 5C23A 2ZVOA 4GDLB 1LM8B 4BKSA 4TQ1A 3PHXB 1WRDB 3KYDD 3OAWA 3LJ3A 1H8CA 4DXAB 2B3AA 2IY1B 3ZNID 1WM2A 3RZWC 5D94A 1WMHA 4ZRKA 4ZYNA 3ZNGC 1E8XA 2C60A 4FJVB 2HE7A 2V4LA 3M3JA 1OEYJ 2KTRA 3WAOA 1GUAB 4JLCA 2NBVB 2KTRB 4KZ0A 3QQ8B 4YL8A 5JHBA 3KUZA 2NS5A 2ZNVB 3DDCB 1P0RA 2RGFA 4JGHB 1WGYA 2D3GA 3AU5A 4EZJA 3DCGA 5D7GA 4ICUA 5KHQA 4WJOA 1WM3A 4MELA 4GXBA 4NAWA 4GSWA 2G4DB 2FCMA 2IBIB 4GIVA 3R7RA 4NQKE 4J6IA 2CHWA 4DHJB 1EF5A 2GBMA 3WIMA 2K8BA 3L13A 4N9F4 4BVUC 3UF8A 3GOEA 3NZSA 2IZVB 4ANUA 2REXA 1Q1OA 2KO3A 2KK8A 2PJHA 4PYUA 3VQIA 3AXCA 3ONSA 4WWNA 1A5RA 4FBJB 2KXJA 3QCAA 2KOXA 4AJYB 1ISNA 1IP9A 2KN5A 4NJ7A 3TCAA 2N7EA 4I6PA 3KUCB 2JUOA 4HCNB 4WJNA 2JWZA 3VAWA 1Z5SB 2W9NA 2L00B 3VTWA 4AP4C 2KHWB 3TIXA 2MBHA 5DCNA 2LGXA 3ZRFA 3VXWA 3B1LX 3EC8A 5CX3A 2ZZPB 4W9HA 3NS8A 4MSMB 3EECA 4PS8A 3QC8B 2M4NA 1YX5B 2LASA 2MP2A 3DOWA 4W9LA 2KDFB 3A9KB 1WX8A 3UGBB 4AJWA 1SE9A 1UGMA 1UZXB 5DPRA 4WJQA 1YJ1A 2FNJB 4MH0E 4X57B 4FLHA 1E8YA 3O65B 4BKTA 1S3SG 3IG3A 2L3ZA 4IWOA 4CYEA 4FJYA 3NY5A 2MBQA 3OLMD 5TR5A 3ZUNA 2O6VA 3KVFB 4KIKB 2N7DA 1RLFA 1XT9B 4RM9A 4MJSA 4W9GA 4ASWC 2ASQA 2NR2A 5J2RA 2N9XA 4M8MA 2O2VB 2FAZA 3M95A 4EKUA 3PV1A 4HPMB 4W9FA 2JY6A 3B08A 2DZMA 3CSFA 2K1FA 2UWQA 1WR6E 2MQJA 3EHVA 2Y5BB 4KSLC 1WGRA 4IUMB 3JSVA 3ZLZA 2LUEA 4M8NA 1WE7A 2D07B 2UYZB 3PT2B 4IC7B 5AZFA 2QHOA 2JRHA 4ZRJA 3VUYA 3T9LA 3ZIMA 2N9PC 3SDLC 1GJZA 1WGGA 1X1MA 2DZKA 2ZEQA 2KWCA 4F7ZA 4G11A 4GDKB 4XZ4A 4FA6A 2D2QA 2BYFA 3TJPA 4KDLB 2PE9A 1K8RB 4MM3A 2MWSB 3L10B 3TMPB 2L0FA 4FJZA 4HXDA 2K6DB 3C0RB 3W1SA 3ZTCA 3A4SC 2DZIA 2KX3A 3R66C 4E74A 2GBKA 1OTRB 3DVNV 1P3QU 3H7PB 4FADA 1C3TA 3KYCD 2BPSA 2LVQA 3N30A 4WQOB 3ZTDA 2LXCA 2N4FA 4B9KA 4ZDVA 4NJ6A 4GGQA 2MBOA 1OQYA 1UELA 1VD2A 2DX5B 4HWIB 4NY0A 3QA8A 1KLVA 1L2NA 4G3XB 2AL3A 3U8ZA 2L7RA 2BKRB 4GDLA 1GNUA 1WJ4A 1Y8RC 2KQ7A 3IFWB 3PLUA 3UIOB 3ML9A 1RFAA 1Q0WB 2KJRA 4DDID 4TQ0A 5J18A 4NNJB 2C5LC 1G6JA 1WX9A 2LGYA 2V3SA 3WAPA 3U30A 2JT4B 2CHZA 2KWUB 3IBEA 2GBNA 2A4ZA 4DHJD 1J19A 2M0XA 2WYQA 3VH4B 1YX6B 4KZCA 4BOZB 3N3KB 1V5TA 4DBGA 4KVGB 4CHKA 4GOCA 2NPTB 2KDIA 2KLCA 2ZJDA 3CMMB 2BWFA 3H6NA 3DBRI 3SHQA 3TBLD 5EDSA 4F1SA 1F9JA 3PRPB 4K7WA 3L17A 1SGHA 2JZZA 4EZLA 4DK5A 2L76A 4DHZB 3H7SA 1V49A 4NPNA 3VUXA 1KOTA 1GC6A 3V61A 2CKHB 1IPGA 1D3ZA 2DENB 2GMIC 2KVRA 1V5OA 2FCSA 5DPWA 2DAJA 3PS6A 3CF6E 3P2BA 2NBUA 2M1MA 3BY4B 2DHZA 3UQAA 3GZNI 4I6LB 2M8SA 2J0KA 4W9DA 3H9DA 4MEMA 2N9EB 3U7DA 3X23A 1LFDA 1FXTB 2G3QB 3QARA 1GC7A 1WGDA 1E8ZA 3Q3FA 4B95A 2G45B 4RM8A 1VCBA 4K1RB 3PHWB 2J7QB 4BFRA 2N1WA 1UBQA 1YIWA 3DVNU 3R3MA 3RT3B 5DPSA 1J8CA 3HK0A 1TTNA 3A4RA 2KLGA 1LQBA 2ZPYA 3V6EB 2KJHB 5GMVA 1E90A 4EFOA 2KC1A 4WWPA 2LWPA 3A9KA 2LGDA 3X0WA 3PVLA 4OVVA 1TBEA 3ZNZB 3HM3A 3AU4A 1WGHA 5HKHA 2RPQA 3HM6X 4EZKA 2KC2A 2BKFA 3APDA 5CHWA 4OVUA 3V62A 4LJOB 1QZEA 5E6OA 2MBEA 4II3B 3H1UA 1IYFA 3ZRCA 4W9JA 1UD7A 3SD5A 4KIKA 1EUVB 4A20A 5L95C 2G4SA 1OGWA 2OOBB 1HE8A 3Q3JA 4HK2A 4K7UA 4MDKE 1WX7A 3L08A 4E71A 3NHEB 3K9PB 2CU1A 3DBSA 3QIJA 3VFKA 2KFJA 2O2VA 3DVGX 2I1KA 1NDDA 1V6EA 3APCA 2M17A 2MX2A 1YD8U 3APFA 1V9JA 2KJ6A 3KW5B 2DZJA 3VH3B 3DQVA 1C1YB 3NZUA 3V6CB 4HLEA 5JHAA 3JVZX 1WJUA 4ANWA 3EFUA 4K81A 1CMXB 2JXXA 1SIFA 2IO0B 2JPHA 4ZRIA 1E8WA 4E3CA 4TKNA 2JRIB 3PRMB 2LVOA 1WXMA 2FIFA 3ECIA 1OEYA 2XK5B 2RD0A 3ALBA 3N32A 1J0GA 3WALA 4WWOA 3WAMA 3JW0X 4GDKA 2VRRB 3RD2A 4AUQC 4ANXA 2DYMA 4K7SA 1UH6A 2ZVNA 3DPDA 2HTHA 3MTNB 4FULA 4JQWC 2C7HA 4MGYE 4PYZA 4II2B 3TL5A 2MW5A 2WX0A 2L0TA 2Z0EB 2EMTA 2LJ5A 2NBWB 2Z59B 3H7PA 4HDOA 1GG3A 2Z0DB 2AWTA 2KKCA 3ZKJC 2LI5A 2IO3B 2KDEB 3B0AA 1I42A 4LDTD 1LXDA 1TGZB 4JIOU 5CTRC 3VVWB 3UINB 1ZGUB 1RRBA 4XC2A 1WXVA 2WWZA 2L8JA 5J17A 3M63B 2WDTB 2RSUA 4BKGA 2XEWA 4PS3A 2EKEC 2K8CA 2BYVE 3WANA 2R2QA 4HDQA 3WA0A 4GB9A 1I35A 1Q5WB 2RR9A 3A9JB 4BKSD 4BOSC 4LDTB 4TUUA 3QHTA 3RULA 4EUTA 1WZ0A 1WH3A 2KFKB 2CHXA 1UBIA 2V1YA 5AZHA 3RUIB 3L54A 3L0WB 4B6WA 3A1QB 1EO6A 2J0JA 4A3PA 1WZ3A 2HD5B 2NPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JF5 A;  1ZKH A;  3HIZ A;  3MJW A;  5JZE B;  2HJ8 A;  5DPT A;  1V2Y A;  2DAF A;  1P98 A;  5G55 A;  4LJP B;  2ZPN A;  2ZCC A;  3L16 A;  3LDZ E;  3S2A A;  3V60 A;  1L7Y A;  3ZDT A;  3JYU A;  5E6N A;  2KDB A;  4W9C A;  1V80 A;  4IWP A;  5D6J B;  4MGI E;  5BO4 B;  2FUH B;  4BBN F;  1WMH B;  2FID A;  2KWV B;  1MG8 A;  2PEA A;  3AI5 A;  4P7I A;  3BIN A;  4XX5 A;  1JRU A;  3W1S C;  2GBR A;  2AL6 A;  3KH0 A;  2BYE A;  2KMC A;  2LVP A;  2NVU I;  2K39 A;  4GU2 A;  1BT0 A;  4I6N B;  1WJ6 A;  3IHP C;  1WY8 A;  5KHO A;  2LRW A;  4MSQ B;  1NBF C;  1WJN A;  2LRU A;  2IO2 B;  1TZ1 A;  3PPA A;  4FHJ A;  2WX1 A;  2CS4 A;  4W9K A;  2JZ3 B;  3IVF A;  2BGF A;  2MCN B;  3PGE A;  2A5U A;  4GN1 A;  4NAW B;  3CST A;  2D11 A;  1E7V A;  2DYB A;  2LZ6 A;  4AWJ A;  2IY0 B;  2N1V A;  5LXH A;  3VDZ A;  1XD3 B;  2KZR A;  2LD9 A;  2MA9 B;  1Z2M A;  3DBH I;  3DVG Y;  2PPH A;  5CHV C;  4EOY A;  4HJK A;  1P9D U;  1WXS A;  1AAR A;  1NI2 A;  2BWE S;  5D2M B;  2DYO A;  2ZNV C;  2KMA A;  1T0Y A;  3ZO5 B;  5IAA C;  2GOW A;  1WXA A;  4ICV A;  4KDI C;  3VTU A;  3T8M A;  2KNB A;  2KD0 A;  3W1Y A;  2CR5 A;  2R2O A;  4IG7 B;  3NOB A;  2C7N B;  2K6Q A;  1V81 A;  1XQQ A;  3K9O B;  4WAA A;  5AEK B;  1YQB A;  1E5W A;  4GMV A;  3D32 A;  3RCZ A;  1KJT A;  4HVB A;  3QK0 A;  1V86 A;  2BF8 B;  3PZD A;  2O6V D;  3AUL A;  5E6P A;  2OJR A;  1EF1 A;  4TV3 A;  3ZW3 A;  2MP2 B;  1WIA A;  1RAX A;  3VUW A;  5C1Z A;  2ZCB A;  4W9I A;  5LLI A;  3SU8 X;  3MHS D;  4F8C B;  2K8H A;  2GBJ A;  2KTF A;  3OJ3 A;  4A3O A;  1KM7 A;  1U4A A;  1PQS A;  3I3T B;  4KSK C;  4G50 A;  3ZVV A;  4NQL B;  4PS7 A;  2MRP A;  2LXA A;  4IM3 A;  1E7U A;  4G0N B;  2EMS A;  5LXI B;  2O6V B;  2XK5 A;  2FCQ A;  3M62 B;  4IW0 A;  2C7M B;  4M0W B;  1H4R A;  1WI0 A;  2YVC A;  4DDG D;  4EEW A;  4MJS B;  2PE6 B;  3RYT A;  3OJ4 B;  2MBB B;  2K25 A;  5IA7 A;  1M94 A;  3PLV A;  4AOF A;  2NCN A;  2C9W B;  1P1A A;  2JVC A;  2L05 A;  2KQS A;  4ANV A;  5AZG A;  3PTF C;  2AYO B;  3JSV B;  2XBB C;  3KUD B;  1S1Q B;  2I1J A;  4IWQ A;  2KAN A;  5G2N A;  3UQB A;  4IM2 A;  1R4N I;  4BBN C;  4MGK E;  3PSE B;  4W9E A;  4HPL B;  5FR6 A;  3R7Q A;  2AEH A;  3HHM A;  4JL9 A;  1WFY A;  1ZW7 A;  3DBL I;  3QWZ B;  4KV2 A;  4URK A;  4HCP B;  1WR1 A;  1WE6 A;  3RZF A;  3VTV A;  3ENE A;  3QAQ A;  4WJP A;  4DHZ E;  1WYW B;  2FCN A;  3A9J A;  3QJZ A;  2MLB A;  4FHK A;  3ZDM C;  5L83 A;  3QX1 A;  2D10 A;  3A33 B;  2KX0 A;  4FN2 A;  2IYD B;  2KFK A;  4MGZ E;  2IO1 B;  3ZNH B;  1R4M I;  2YLM A;  3PRZ A;  4CO7 A;  4DWF A;  3A1Q A;  4IM0 A;  3PRE A;  1WF9 A;  2J0M A;  3VHT C;  2MSE D;  3UIP B;  3ML8 A;  4RMA A;  5CHF A;  4LCD E;  5JH5 C;  5C23 A;  2ZVO A;  4GDL B;  1LM8 B;  4BKS A;  4TQ1 A;  3PHX B;  1WRD B;  3KYD D;  3OAW A;  3LJ3 A;  1H8C A;  4DXA B;  2B3A A;  2IY1 B;  3ZNI D;  1WM2 A;  3RZW C;  5D94 A;  1WMH A;  4ZRK A;  4ZYN A;  3ZNG C;  1E8X A;  2C60 A;  4FJV B;  2HE7 A;  2V4L A;  3M3J A;  1OEY J;  2KTR A;  3WAO A;  1GUA B;  4JLC A;  2NBV B;  2KTR B;  4KZ0 A;  3QQ8 B;  4YL8 A;  5JHB A;  3KUZ A;  2NS5 A;  2ZNV B;  3DDC B;  1P0R A;  2RGF A;  4JGH B;  1WGY A;  2D3G A;  3AU5 A;  4EZJ A;  3DCG A;  5D7G A;  4ICU A;  5KHQ A;  4WJO A;  1WM3 A;  4MEL A;  4GXB A;  4NAW A;  4GSW A;  2G4D B;  2FCM A;  2IBI B;  4GIV A;  3R7R A;  4NQK E;  4J6I A;  2CHW A;  4DHJ B;  1EF5 A;  2GBM A;  3WIM A;  2K8B A;  3L13 A;  4N9F 4;  4BVU C;  3UF8 A;  3GOE A;  3NZS A;  2IZV B;  4ANU A;  2REX A;  1Q1O A;  2KO3 A;  2KK8 A;  2PJH A;  4PYU A;  3VQI A;  3AXC A;  3ONS A;  4WWN A;  1A5R A;  4FBJ B;  2KXJ A;  3QCA A;  2KOX A;  4AJY B;  1ISN A;  1IP9 A;  2KN5 A;  4NJ7 A;  3TCA A;  2N7E A;  4I6P A;  3KUC B;  2JUO A;  4HCN B;  4WJN A;  2JWZ A;  3VAW A;  1Z5S B;  2W9N A;  2L00 B;  3VTW A;  4AP4 C;  2KHW B;  3TIX A;  2MBH A;  5DCN A;  2LGX A;  3ZRF A;  3VXW A;  3B1L X;  3EC8 A;  5CX3 A;  2ZZP B;  4W9H A;  3NS8 A;  4MSM B;  3EEC A;  4PS8 A;  3QC8 B;  2M4N A;  1YX5 B;  2LAS A;  2MP2 A;  3DOW A;  4W9L A;  2KDF B;  3A9K B;  1WX8 A;  3UGB B;  4AJW A;  1SE9 A;  1UGM A;  1UZX B;  5DPR A;  4WJQ A;  1YJ1 A;  2FNJ B;  4MH0 E;  4X57 B;  4FLH A;  1E8Y A;  3O65 B;  4BKT A;  1S3S G;  3IG3 A;  2L3Z A;  4IWO A;  4CYE A;  4FJY A;  3NY5 A;  2MBQ A;  3OLM D;  5TR5 A;  3ZUN A;  2O6V A;  3KVF B;  4KIK B;  2N7D A;  1RLF A;  1XT9 B;  4RM9 A;  4MJS A;  4W9G A;  4ASW C;  2ASQ A;  2NR2 A;  5J2R A;  2N9X A;  4M8M A;  2O2V B;  2FAZ A;  3M95 A;  4EKU A;  3PV1 A;  4HPM B;  4W9F A;  2JY6 A;  3B08 A;  2DZM A;  3CSF A;  2K1F A;  2UWQ A;  1WR6 E;  2MQJ A;  3EHV A;  2Y5B B;  4KSL C;  1WGR A;  4IUM B;  3JSV A;  3ZLZ A;  2LUE A;  4M8N A;  1WE7 A;  2D07 B;  2UYZ B;  3PT2 B;  4IC7 B;  5AZF A;  2QHO A;  2JRH A;  4ZRJ A;  3VUY A;  3T9L A;  3ZIM A;  2N9P C;  3SDL C;  1GJZ A;  1WGG A;  1X1M A;  2DZK A;  2ZEQ A;  2KWC A;  4F7Z A;  4G11 A;  4GDK B;  4XZ4 A;  4FA6 A;  2D2Q A;  2BYF A;  3TJP A;  4KDL B;  2PE9 A;  1K8R B;  4MM3 A;  2MWS B;  3L10 B;  3TMP B;  2L0F A;  4FJZ A;  4HXD A;  2K6D B;  3C0R B;  3W1S A;  3ZTC A;  3A4S C;  2DZI A;  2KX3 A;  3R66 C;  4E74 A;  2GBK A;  1OTR B;  3DVN V;  1P3Q U;  3H7P B;  4FAD A;  1C3T A;  3KYC D;  2BPS A;  2LVQ A;  3N30 A;  4WQO B;  3ZTD A;  2LXC A;  2N4F A;  4B9K A;  4ZDV A;  4NJ6 A;  4GGQ A;  2MBO A;  1OQY A;  1UEL A;  1VD2 A;  2DX5 B;  4HWI B;  4NY0 A;  3QA8 A;  1KLV A;  1L2N A;  4G3X B;  2AL3 A;  3U8Z A;  2L7R A;  2BKR B;  4GDL A;  1GNU A;  1WJ4 A;  1Y8R C;  2KQ7 A;  3IFW B;  3PLU A;  3UIO B;  3ML9 A;  1RFA A;  1Q0W B;  2KJR A;  4DDI D;  4TQ0 A;  5J18 A;  4NNJ B;  2C5L C;  1G6J A;  1WX9 A;  2LGY A;  2V3S A;  3WAP A;  3U30 A;  2JT4 B;  2CHZ A;  2KWU B;  3IBE A;  2GBN A;  2A4Z A;  4DHJ D;  1J19 A;  2M0X A;  2WYQ A;  3VH4 B;  1YX6 B;  4KZC A;  4BOZ B;  3N3K B;  1V5T A;  4DBG A;  4KVG B;  4CHK A;  4GOC A;  2NPT B;  2KDI A;  2KLC A;  2ZJD A;  3CMM B;  2BWF A;  3H6N A;  3DBR I;  3SHQ A;  3TBL D;  5EDS A;  4F1S A;  1F9J A;  3PRP B;  4K7W A;  3L17 A;  1SGH A;  2JZZ A;  4EZL A;  4DK5 A;  2L76 A;  4DHZ B;  3H7S A;  1V49 A;  4NPN A;  3VUX A;  1KOT A;  1GC6 A;  3V61 A;  2CKH B;  1IPG A;  1D3Z A;  2DEN B;  2GMI C;  2KVR A;  1V5O A;  2FCS A;  5DPW A;  2DAJ A;  3PS6 A;  3CF6 E;  3P2B A;  2NBU A;  2M1M A;  3BY4 B;  2DHZ A;  3UQA A;  3GZN I;  4I6L B;  2M8S A;  2J0K A;  4W9D A;  3H9D A;  4MEM A;  2N9E B;  3U7D A;  3X23 A;  1LFD A;  1FXT B;  2G3Q B;  3QAR A;  1GC7 A;  1WGD A;  1E8Z A;  3Q3F A;  4B95 A;  2G45 B;  4RM8 A;  1VCB A;  4K1R B;  3PHW B;  2J7Q B;  4BFR A;  2N1W A;  1UBQ A;  1YIW A;  3DVN U;  3R3M A;  3RT3 B;  5DPS A;  1J8C A;  3HK0 A;  1TTN A;  3A4R A;  2KLG A;  1LQB A;  2ZPY A;  3V6E B;  2KJH B;  5GMV A;  1E90 A;  4EFO A;  2KC1 A;  4WWP A;  2LWP A;  3A9K A;  2LGD A;  3X0W A;  3PVL A;  4OVV A;  1TBE A;  3ZNZ B;  3HM3 A;  3AU4 A;  1WGH A;  5HKH A;  2RPQ A;  3HM6 X;  4EZK A;  2KC2 A;  2BKF A;  3APD A;  5CHW A;  4OVU A;  3V62 A;  4LJO B;  1QZE A;  5E6O A;  2MBE A;  4II3 B;  3H1U A;  1IYF A;  3ZRC A;  4W9J A;  1UD7 A;  3SD5 A;  4KIK A;  1EUV B;  4A20 A;  5L95 C;  2G4S A;  1OGW A;  2OOB B;  1HE8 A;  3Q3J A;  4HK2 A;  4K7U A;  4MDK E;  1WX7 A;  3L08 A;  4E71 A;  3NHE B;  3K9P B;  2CU1 A;  3DBS A;  3QIJ A;  3VFK A;  2KFJ A;  2O2V A;  3DVG X;  2I1K A;  1NDD A;  1V6E A;  3APC A;  2M17 A;  2MX2 A;  1YD8 U;  3APF A;  1V9J A;  2KJ6 A;  3KW5 B;  2DZJ A;  3VH3 B;  3DQV A;  1C1Y B;  3NZU A;  3V6C B;  4HLE A;  5JHA A;  3JVZ X;  1WJU A;  4ANW A;  3EFU A;  4K81 A;  1CMX B;  2JXX A;  1SIF A;  2IO0 B;  2JPH A;  4ZRI A;  1E8W A;  4E3C A;  4TKN A;  2JRI B;  3PRM B;  2LVO A;  1WXM A;  2FIF A;  3ECI A;  1OEY A;  2XK5 B;  2RD0 A;  3ALB A;  3N32 A;  1J0G A;  3WAL A;  4WWO A;  3WAM A;  3JW0 X;  4GDK A;  2VRR B;  3RD2 A;  4AUQ C;  4ANX A;  2DYM A;  4K7S A;  1UH6 A;  2ZVN A;  3DPD A;  2HTH A;  3MTN B;  4FUL A;  4JQW C;  2C7H A;  4MGY E;  4PYZ A;  4II2 B;  3TL5 A;  2MW5 A;  2WX0 A;  2L0T A;  2Z0E B;  2EMT A;  2LJ5 A;  2NBW B;  2Z59 B;  3H7P A;  4HDO A;  1GG3 A;  2Z0D B;  2AWT A;  2KKC A;  3ZKJ C;  2LI5 A;  2IO3 B;  2KDE B;  3B0A A;  1I42 A;  4LDT D;  1LXD A;  1TGZ B;  4JIO U;  5CTR C;  3VVW B;  3UIN B;  1ZGU B;  1RRB A;  4XC2 A;  1WXV A;  2WWZ A;  2L8J A;  5J17 A;  3M63 B;  2WDT B;  2RSU A;  4BKG A;  2XEW A;  4PS3 A;  2EKE C;  2K8C A;  2BYV E;  3WAN A;  2R2Q A;  4HDQ A;  3WA0 A;  4GB9 A;  1I35 A;  1Q5W B;  2RR9 A;  3A9J B;  4BKS D;  4BOS C;  4LDT B;  4TUU A;  3QHT A;  3RUL A;  4EUT A;  1WZ0 A;  1WH3 A;  2KFK B;  2CHX A;  1UBI A;  2V1Y A;  5AZH A;  3RUI B;  3L54 A;  3L0W B;  4B6W A;  3A1Q B;  1EO6 A;  2J0J A;  4A3P A;  1WZ3 A;  2HD5 B;  2NPT A; 
#chains in the Genus database with same CATH topology
 3RNE C;  2K22 A;  4W9C A;  2CU3 A;  2M19 A;  2N9K A;  4P7I A;  4XX5 A;  3O13 A;  1KF6 B;  2AL6 A;  4I6N B;  2NVU I;  2D3A A;  1WY8 A;  5KHO A;  2KVZ A;  1EU3 A;  4MSQ B;  1NBF C;  2INN E;  2ONQ A;  3NUH B;  2A5U A;  3CST A;  2KT7 A;  2JYE A;  1P7E A;  4EOY A;  1P9D U;  1NI2 A;  2BWE S;  2ZNV C;  1T0Y A;  2GOW A;  4ICV A;  3VTU A;  2KNB A;  1CJE A;  1V81 A;  4HVB A;  1VJK A;  3EGR A;  3AMZ A;  2BF8 B;  1I4Q A;  3AE2 B;  4A9A A;  4TV3 A;  3AE5 B;  2MP2 B;  1RWS A;  5FR3 A;  2CJO A;  2FE8 A;  2ZCB A;  3BVZ A;  3Q3M C;  4F8C B;  2KTF A;  4A3O A;  1HA5 A;  4K3B A;  2INP E;  4ACF A;  1PQS A;  4KSK C;  4NQL B;  1GB1 A;  1E7U A;  3TEZ A;  2EMS A;  3R8B A;  2O6V B;  2XK5 A;  4RGN A;  2YVC A;  2M0A A;  3OJ4 B;  2K25 A;  5JXV A;  2JVC A;  5T8I A;  1SXT A;  2AYO B;  3U4E G;  3JSV B;  2GI9 A;  2V3N A;  2WDQ B;  5G2N A;  3TUO A;  1GB4 A;  4IM2 A;  1TJE A;  4MGK E;  3PSE B;  4W9E A;  1J7B A;  2FBW B;  3AN1 A;  1WFY A;  3RZF A;  1WE6 A;  3ENE A;  4WJP A;  2FCN A;  4MM3 B;  3ZDM C;  1UWX A;  1JRO A;  4MGZ E;  1R4M I;  3A1Q A;  4IM0 A;  1WF9 A;  1YN5 A;  2MSE D;  4RMA A;  1QF6 A;  5C23 A;  4GDL B;  4HRS A;  3LJ3 A;  1H8C A;  1IBX B;  3ZNI D;  3RNA C;  3J9C A;  5D94 A;  1WMH A;  2QSD A;  2OHF A;  3IT4 B;  4BZA A;  1K51 A;  1FXI A;  3KUZ A;  2RGF A;  5HHD G;  1ZP0 B;  4ICU A;  3N1X C;  4NAW A;  2JU6 X;  2IBI B;  4BVU C;  3WIM A;  5AUI A;  2PJH A;  3DWG C;  2KXJ A;  3QCA A;  2KOX A;  1ISN A;  4DXF A;  1YNT E;  4I6P A;  4HCN B;  2JWZ A;  2QDF A;  1I4G A;  2H89 B;  1T0S C;  3DHH C;  4NJC A;  2LEK A;  5CX3 A;  4L2Y A;  1XLQ A;  2M4N A;  3DOW A;  4W9L A;  2KDF B;  1WX8 A;  5DPR A;  2FNJ B;  1E8Y A;  2WXH A;  3RNC C;  5D3D A;  2L3Z A;  3NY5 A;  2YEP F;  3AE6 B;  1XT9 B;  4M0W A;  3BYY B;  4RM9 A;  5HFY A;  2ASQ A;  3Q14 C;  3KWL A;  3PV1 A;  3ZQ4 A;  4A55 A;  1XLN A;  1WR6 E;  2Y5B B;  1WGR A;  2WXG A;  2D07 B;  1T5X D;  2JRH A;  4ZRJ A;  3VUY A;  3SDL C;  4TSS A;  3C19 A;  4FA6 A;  2BQQ A;  2L0F A;  2K6D B;  3W1S A;  3ZTC A;  2WXM A;  2DZI A;  1UF0 A;  1OTR B;  3N30 A;  1K53 A;  3ZTD A;  4B9K A;  1L2N A;  4HWI B;  3QA8 A;  2DBY A;  5IOI A;  1B1Z A;  1K52 A;  1TIF A;  2V0G A;  4XYC A;  4M01 A;  3UIO B;  3AM9 A;  1Q0W B;  4DDI D;  2C5L C;  1WX9 A;  2PVG C;  2J4X A;  3U30 A;  2AQ3 B;  2KWU B;  3W2D A;  1MI0 A;  1TKG A;  1YX6 B;  5HI1 A;  2KAJ A;  3I5J C;  1SE3 A;  1XXG A;  4RNA A;  2ZJD A;  1LGR A;  4D2K A;  2BWF A;  2Q5W D;  3H6N A;  3L17 A;  1SGH A;  4EZL A;  1PGB A;  3MC0 B;  1B9R A;  1V97 A;  1GC6 A;  3GE3 C;  1IPG A;  2L32 A;  2GMI C;  4N6E B;  2KVR A;  2FCS A;  5DPW A;  1SF0 A;  3CF6 E;  1IGC A;  1SIJ A;  2DHZ A;  3UQA A;  3GZN I;  2WLB A;  4MEM A;  1A70 A;  1LFD A;  1FO4 A;  3QAR A;  4REZ A;  4B95 A;  1VCB A;  4K1R B;  3PHW B;  2BS4 B;  2SEB D;  2DNF A;  2N1W A;  1YIW A;  3DVN U;  1JWS D;  3A4R A;  2ZPY A;  3BWU D;  3RPF C;  2KJH B;  4EFO A;  1IGD A;  4WWP A;  2LWP A;  2OED A;  1KRH A;  4YXD B;  1QT9 A;  3AU4 A;  2RPQ A;  3HM6 X;  4EZK A;  1N61 A;  2KC2 A;  4DXG A;  1WSP A;  4II3 B;  3ZRC A;  4M00 A;  4OZC A;  1JWU D;  4M02 A;  1EUV B;  2HJ1 A;  2G4S A;  2OOB B;  3PO0 A;  1K50 A;  2LHE A;  1WX7 A;  4HEA 1;  3NHE B;  3K9P B;  2RDG A;  3VFK A;  3B2F A;  2O2V A;  1ZDV A;  1E9M A;  1KFY B;  3W9C B;  2CJN A;  3APF A;  2KJ6 A;  1F77 A;  2V9H A;  3EFU A;  2JXX A;  2JPH A;  1E8W A;  4TKN A;  3ETR A;  2FIF A;  2XK5 B;  2RD0 A;  3ALB A;  3RD2 A;  2GRI A;  4K7S A;  3DPD A;  2HTH A;  2PMV A;  2WU5 B;  3TL5 A;  2MW5 A;  2Z0E B;  2L0T A;  2LJ5 A;  2Z59 B;  1GG3 A;  2KKC A;  3B0A A;  3Q3O C;  1I42 A;  5BYS A;  1LXD A;  1L6U A;  4FXC A;  4JIO U;  3I57 A;  3VRA B;  3DBL B;  1OFF A;  1WXV A;  2N0S B;  4BKG A;  1HXY D;  1FMA D;  2BYV E;  2R2Q A;  1TY0 A;  2JZP A;  1T6B X;  1SE2 A;  4UDU C;  5AZH A;  4YTM B;  3A1Q B;  3E56 A;  1L0Y B;  2J0J A;  1YQB A;  1FD6 A;  5JZE B;  1L6V A;  1ZKH A;  3HRD D;  2FUG 1;  2ZPN A;  3LDZ E;  5BYR A;  1C78 A;  3BII D;  2WDV B;  2RDH A;  1XF5 L;  3AE3 B;  5D6J B;  4MGI E;  3MC8 A;  2FUH B;  3PZ7 A;  1WMH B;  2KWV B;  2PEA A;  3AI5 A;  3BIN A;  1JRU A;  1BT0 A;  1N6Z A;  2JYT A;  2LRW A;  2LRU A;  2IO2 B;  5LNK 1;  2WX1 A;  2MHJ A;  4NAW B;  2D11 A;  1E7V A;  2DYB A;  4RGT A;  2LZ6 A;  2IY0 B;  1QIL A;  1XCQ L;  2N1V A;  4H2A A;  1XD3 B;  2MA9 B;  1Z2M A;  3N9Y C;  1SB3 C;  5CHV C;  4HJK A;  4OHJ A;  5H92 C;  5C3J B;  5D2M B;  2DYO A;  2KMA A;  3FC4 A;  5IAA C;  3T8M A;  4P6V F;  2R2O A;  3VR8 B;  4IG7 B;  3NOB A;  2C7N B;  2K6Q A;  1HQR D;  3L4P A;  3ZJT A;  1E5W A;  3D32 A;  1KJT A;  4XE0 A;  1V86 A;  2N9L A;  3PZD A;  1VLB A;  4L1B A;  2K5P A;  2QMT A;  1MFW A;  1EF1 A;  4KX6 B;  5AUK A;  3ZW3 A;  1WIA A;  1RAX A;  2WHI A;  5C1Z A;  2D3C A;  5LLI A;  2K8H A;  1KM7 A;  1Q10 A;  1U4A A;  1N63 A;  3ZVV A;  4G50 A;  1EWY C;  1D5M C;  1VRA B;  2FCQ A;  4M0W B;  1H4R A;  4EEW A;  1V1P A;  1C79 A;  2NTS A;  2PE6 B;  2KWD A;  2MBB B;  5D3I B;  1M94 A;  2R61 A;  1D6E C;  4XGA B;  4AOF A;  2I2Y A;  2JSV X;  2NCN A;  3HVZ A;  3PTF C;  3ZJV A;  1D4B A;  2UU7 A;  1S1Q B;  4IWQ A;  2KAN A;  3NVZ A;  4B0M A;  3R7Q A;  1M4V A;  4JL9 A;  1ZW7 A;  3DBL I;  4C4V B;  3VTV A;  3QAQ A;  1JCK B;  1E0Z A;  4DHZ E;  1WYW B;  3EFC A;  1AW7 A;  4FHK A;  2AQ2 B;  1R4M B;  5L83 A;  2QIE B;  3A33 B;  2KX0 A;  4DWF A;  2IO1 B;  2YLM A;  3PRZ A;  2QIL A;  2J42 A;  2BBC A;  5C2T B;  2J0M A;  1T0R C;  3N1Y C;  3Q6B A;  1SBB B;  5JH5 C;  2ZVO A;  2WXL A;  3LB8 C;  4TQ1 A;  3KYD D;  4XWW A;  1N5W A;  4ZRK A;  1D5Z C;  4FJV B;  3GS2 A;  2V4L A;  3M3J A;  2KTR A;  1GUA B;  3QQ8 B;  2NS5 A;  1I4P A;  4JGH B;  1F2R I;  1WGY A;  5D7G A;  2BT6 A;  4WJO A;  4GSW A;  4NQK E;  2PIA A;  4DHJ B;  1EF5 A;  3L13 A;  2KAC A;  3UF8 A;  3GOE A;  1DOX A;  3NZ3 A;  4USA A;  5TSS A;  1QOF A;  2KO3 A;  3VQI A;  4AJY B;  2J53 A;  1EU4 A;  2AX5 A;  3KLS X;  5E6J A;  2JUO A;  3VAW A;  1Z5S B;  2W9N A;  2L00 B;  4A6Q A;  1QOA A;  3TIX A;  2MBH A;  2L83 A;  3VXW A;  4XDD A;  3EC8 A;  2ZZP B;  2QCZ A;  2WS3 B;  3EEC A;  1YX5 B;  4AJW A;  1GOZ A;  3UGB B;  1UZX B;  5EE9 A;  4FJY A;  5H8Y E;  1RLF A;  4BAX A;  3P1M A;  4NZL B;  3BVG A;  5I4D A;  2LHD A;  5G5G A;  2NR2 A;  3NS1 A;  1BXT A;  2N9X A;  2O2V B;  2JWU A;  2FAZ A;  3M95 A;  4EE2 A;  4HPM B;  4W9F A;  2JY6 A;  5J2R A;  2DZM A;  3CSF A;  2MQJ A;  4KSL C;  2LUE A;  3PT2 B;  1ZXI A;  2NTT A;  3ZIM A;  2RPV A;  1GJZ A;  2ZEQ A;  2DZK A;  2KWC A;  3MFG A;  4F7Z A;  1K8R B;  1WRI A;  3TMP B;  1C4P A;  2LMC A;  3C0R B;  3R66 C;  2PKO A;  2GBK A;  3KYC D;  4PK1 A;  4WQO B;  4NJ6 A;  1FNW A;  1UEL A;  2DX5 B;  4NY0 A;  4RH6 A;  3ZJU A;  2L7R A;  1J7C A;  1SJE D;  3P63 A;  2JX5 A;  2LGY A;  2KQ4 X;  1C4C A;  2JT4 B;  2CHZ A;  2WXN A;  4DHJ D;  2Y3A A;  4KVG B;  4CHK A;  2KDI A;  4ARI A;  3CMM B;  4F1S A;  1F9J A;  3PRP B;  4K7W A;  2JZZ A;  4DK5 A;  3H7S A;  1KOT A;  3V61 A;  1GAQ B;  4RCO A;  1D3Z A;  1I4R A;  2DEN B;  1V5O A;  3GZN B;  4A8X C;  2NBU A;  3BY4 B;  2Y5P A;  2PVO D;  4RGM A;  2N9E B;  3U7D A;  1FXT B;  1ROE A;  1GC7 A;  1WGD A;  4AS1 A;  1AYF A;  4XWT A;  1UBQ A;  5DPS A;  3HK0 A;  2KLG A;  3RN9 C;  2VH2 A;  2WNM A;  1FNV A;  1F2R C;  4JWU C;  3A9K A;  2LGD A;  3URY A;  4OVV A;  3ZNZ B;  1UGJ A;  4WQM A;  1WGH A;  3TEY A;  2BKF A;  5CHW A;  1YMH E;  1IYF A;  3H1U A;  1PYW D;  1UD7 A;  4W9J A;  2ICI A;  5BYQ A;  4LNF A;  1HE8 A;  1ZDX A;  4HK2 A;  1T3Q A;  3L08 A;  1XEE A;  1V6E A;  3APC A;  2M17 A;  4YSY B;  4AQ7 A;  3VH3 B;  1C1Y B;  3VRB B;  3U7Z A;  3KWV A;  4ZRI A;  2VZK D;  1OEY A;  1J0G A;  3N32 A;  2BB5 A;  3WAL A;  1XLO A;  1V1P B;  4AUQ C;  2ZVN A;  1BML C;  4RGO S;  3EA6 A;  1C77 A;  1STE A;  2W55 A;  2W3S A;  3TSS A;  4PYZ A;  4MGY E;  3WCQ A;  2NBW B;  2KDE B;  4LDT D;  3UIN B;  2WXO A;  1NVI D;  1RRB A;  2WWZ A;  1FCL A;  4DQO C;  2RSU A;  4PS3 A;  4R3D A;  2ACZ B;  1WYG A;  3AEE B;  3Q8E A;  2XN9 C;  4TUU A;  2WP9 B;  2V1Y A;  2CHX A;  3L0W B;  4B6W A;  3HIZ A;  3AE4 B;  3AB5 A;  2HJ8 A;  5DPT A;  1BUI C;  4LNN A;  5G55 A;  2H88 B;  4C56 C;  2PTL A;  2ZCC A;  1QKZ A;  3S2A A;  3V60 A;  3ZDT A;  3JYU A;  5E6N A;  2KDB A;  4J3O D;  2ZW1 A;  5BO4 B;  1ENF A;  3W1S C;  4LK0 M;  1P7F A;  1JW9 D;  2K39 A;  2BS3 B;  3IHP C;  2BTE A;  1WJN A;  1DOY A;  4OZB A;  1D5X C;  4YSZ B;  3AEA B;  1SEB D;  3IVF A;  3PGE A;  3B9J A;  1AN8 A;  4GN1 A;  4P1C C;  3RNF C;  4JE3 B;  2Y5C A;  5HG2 A;  4AWJ A;  3RMK C;  5LXH A;  3VDZ A;  2LD9 A;  3DVG Y;  2PPH A;  1DYQ A;  3CIR B;  3Q8A A;  2IDY A;  3ZO5 B;  2HDE A;  1TKY A;  1UUP A;  2CR5 A;  1QLB B;  2GLS A;  2KDM A;  1XQQ A;  3K9O B;  3RCZ A;  4C7Y A;  3LYY A;  1QOB A;  1WGK A;  4YTP B;  5E6P A;  2OJR A;  1FRD A;  3NVV A;  3AH7 A;  2D5G A;  4CQN A;  4W9I A;  3SU8 X;  2BS2 B;  2GBJ A;  1CK1 A;  1I4X A;  3I3T B;  2MRP A;  4XDC A;  4IM3 A;  4G0N B;  2N7J A;  3ZGZ A;  1N60 A;  2C7M B;  4ZRQ A;  1I7H A;  4ITK A;  1NYR A;  2L05 A;  4ANV A;  4WWM A;  5AZG A;  1C76 A;  4GLS C;  1R4N I;  3ZYY X;  4BBN C;  5FR6 A;  1L5P A;  4L23 A;  1JWA D;  1ET6 A;  3QX1 A;  3BZD B;  2D10 A;  3ZXV A;  3R2I A;  4FN2 A;  2IYD B;  2KFK A;  3P42 A;  1JRP A;  4CO7 A;  1V8C A;  3SFE B;  3PRE A;  1CZP A;  3VHT C;  1TS5 A;  1PGA A;  3UIP B;  5CHF A;  3AEF B;  4LCD E;  1LM8 B;  3PHX B;  1WRD B;  3OAW A;  2QC8 A;  4WAF A;  4DXA B;  2B3A A;  2IY1 B;  3C8Y A;  3FIL A;  2LGI A;  3OG5 A;  3RZW C;  4ZYN A;  4C80 A;  2C60 A;  4KGR A;  3TEX A;  1TZO A;  4JLC A;  4YWG G;  4YL8 A;  3AE7 B;  5JHB A;  1P0R A;  3DBR B;  4EZJ A;  5KHQ A;  1XLP A;  3IT6 B;  4MEL A;  4GXB A;  3P4Q B;  1KLU D;  2G4D B;  3Q69 A;  4J6I A;  2GBM A;  2MJ3 A;  4N9F 4;  4NAM A;  2IZV B;  1VZ7 A;  1KTK A;  3AXC A;  3ONS A;  4WWN A;  4IKG A;  4NJ7 A;  2MEK A;  3KUC B;  5G5H A;  4WJN A;  1E7P B;  4Q2J A;  4AP4 C;  5DCN A;  4RFB A;  2LGX A;  2KN4 A;  1DGJ A;  4W9H A;  4MSM B;  2ZW0 A;  2LAS A;  3A9K B;  1SE9 A;  2SAK A;  4IDI A;  3SEB A;  4MH0 E;  4X57 B;  4FLH A;  2X8X X;  1S3S G;  3IG3 A;  4ZHP A;  4IWO A;  1ZE3 D;  3ZUN A;  4ZYS A;  4O1N A;  2AQ1 B;  4WIP A;  4MJS A;  4ASW C;  2WXF A;  2QJL A;  2K9X A;  2Z8L A;  4EKU A;  3B08 A;  3PZ8 A;  4M8N A;  1FFU A;  1WE7 A;  1C9F A;  4JPS A;  5FK9 C;  2EKI A;  3MHZ A;  1YQ3 B;  2E3T A;  2D3B A;  2D2Q A;  2BYF A;  3TJP A;  2MWS B;  4HXD A;  3DHG C;  1HEZ E;  1P3Q U;  3RNG C;  2BPS A;  5GXG B;  2LXC A;  4ZDV A;  4GGQ A;  5IKC M;  1VD2 A;  1KLV A;  4G3X B;  3U8Z A;  3V05 A;  2BKR B;  3BYT B;  5BMG A;  5EE3 A;  1GNU A;  3IFW B;  3BK1 A;  2BB6 A;  3ML9 A;  1MPE A;  2KJR A;  1YN3 A;  3Q8B A;  5J18 A;  1TS4 A;  4NNJ B;  1G6J A;  2LUM A;  1RM6 C;  4YTN B;  2A4Z A;  1J19 A;  3VH4 B;  4KZC A;  4BOZ B;  3N3K B;  1FEH A;  1V5T A;  4N59 A;  4DBG A;  1HTQ A;  2DWQ A;  1LO5 D;  2KLC A;  2V3P A;  3DBR I;  3SHQ A;  3TBL D;  5EDS A;  4DHZ B;  1YN4 A;  2W54 A;  1MJD A;  2IGG A;  3P2B A;  2M1M A;  1AWD A;  4MT5 A;  3H9D A;  4KGS A;  3I9V 1;  2G3Q B;  1E8Z A;  1Y56 A;  4RM8 A;  2J7Q B;  4BFR A;  1JWB D;  3DBH B;  1MHX A;  1EM7 A;  3RFZ B;  1TTN A;  3AV8 A;  2V4I B;  3GB1 A;  2KC1 A;  3IAM 1;  1YJI A;  3LXF A;  3PVL A;  1FFV A;  2W3R A;  1TBE A;  1ESF A;  3HM3 A;  1TY2 A;  5HKH A;  2WDR B;  3APD A;  3V62 A;  1FXA A;  1QZE A;  2IGD A;  4B0E A;  3SD5 A;  4KIK A;  4A20 A;  5L95 C;  2X38 A;  2L52 A;  3Q3J A;  4MDK E;  4K7U A;  4E71 A;  4OVZ A;  3QIJ A;  1YQ4 B;  1NDD A;  3HVD A;  2MX2 A;  1V9J A;  3KW5 B;  2DZJ A;  3NZU A;  4HLE A;  3JVZ X;  4K81 A;  1CMX B;  2IO0 B;  2JRI B;  3PRM B;  2LVO A;  1WXM A;  4WWO A;  3WAM A;  3CWI A;  4GDK A;  4ANX A;  2DYM A;  1UWM A;  3UI3 A;  1KH0 A;  4P16 A;  1KLG D;  3MP9 A;  4II2 B;  2WX0 A;  4HDO A;  3H7P A;  4WUR A;  3ZKJ C;  2AWT A;  3P4R B;  2LI5 A;  2VZK B;  1TGZ B;  5CTR C;  5J17 A;  2WDT B;  2XEW A;  2K8C A;  2WU2 B;  3WAN A;  4TMA B;  4HDQ A;  1I35 A;  2WXQ A;  3FKY A;  1L0V B;  4BKS D;  4LDT B;  2W82 A;  3RUL A;  4EUT A;  1WZ0 A;  4P1B C;  2KFK B;  1UBI A;  2EEL A;  2YEP B;  1VZ8 A;  1WZ3 A;  2NPT A;  4NPN A;  2JF5 A;  3MJW A;  1V2Y A;  2DAF A;  1P98 A;  2JQR B;  4LJP B;  3L16 A;  3NG0 A;  3OWE B;  1L7Y A;  4OZA A;  3AEG B;  5IN7 A;  4MH8 A;  1V80 A;  4IWP A;  2HTM E;  3FIL B;  4BBN F;  2FID A;  1MG8 A;  4WH4 A;  2GBR A;  4GU2 A;  3KH0 A;  2BYE A;  2KMC A;  2LVP A;  1QQR A;  1WJ6 A;  4RF0 A;  1TZ1 A;  3PPA A;  1PDX A;  2RMM A;  4FHJ A;  2LFI A;  1TYG B;  2CS4 A;  4W9K A;  2JZ3 B;  2BGF A;  3HUI A;  3H8H A;  2MCN B;  4HKZ E;  3ABV B;  4S17 A;  1OQR A;  2KZR A;  3DBH I;  1WXS A;  1AAR A;  2M56 B;  4HPP A;  2WXP A;  3U52 E;  3W5U B;  1WXA A;  3AEC B;  4KDI C;  3MJ5 A;  2KD0 A;  3W1Y A;  3P4P B;  3NVW A;  2PLP A;  4WAA A;  5AEK B;  4KKJ A;  2J52 A;  2IGH A;  3NVY A;  4GMV A;  2WXI A;  3QK0 A;  2DLB A;  2L1A A;  1F1H A;  2O6V D;  4ZHO A;  3AUL A;  1TT5 B;  3VUW A;  1UNS A;  4LNO A;  3MHS D;  3OJ3 A;  1NI3 A;  3AEB B;  1JWM D;  3ZXR A;  2WXR A;  3NRZ A;  2NMQ A;  4PS7 A;  2LXA A;  2QEJ C;  5LXI B;  3IAS 1;  3SR6 A;  3M62 B;  4IW0 A;  5IO9 A;  1WI0 A;  4DDG D;  3TEW A;  4MJS B;  3RYT A;  1F52 A;  5IA7 A;  3PLV A;  1PUT A;  1L4D B;  3SFD B;  2C9W B;  1P1A A;  1NEN B;  2KQS A;  2WXJ A;  2IJ0 A;  3KUD B;  1R4N B;  3AED B;  1C4A A;  2I1J A;  3UQB A;  2LJI A;  1HZ5 A;  1J8C A;  3DHI C;  4HPL B;  2AEH A;  3HHM A;  3QWZ B;  2G1E A;  1TS2 A;  4KV2 A;  4HCP B;  1WR1 A;  4C4V A;  4URK A;  1NEK B;  3QJZ A;  3A9J A;  2MLB A;  1ZUD 2;  4LNI A;  1WXQ A;  4JX1 C;  3ZNH B;  1ZXH A;  1EWC A;  3ML8 A;  4BKS A;  1L0X B;  5IP4 D;  4RF1 A;  1QOG A;  1WM2 A;  4JWS C;  3ZNG C;  1E8X A;  4C00 A;  1N62 A;  2HE7 A;  4ZRP A;  1OEY J;  3V3X A;  3WAO A;  2NBV B;  4IOI E;  2KTR B;  4KZ0 A;  2ZNV B;  3DDC B;  3NJT A;  2D3G A;  3AU5 A;  3DCG A;  1ET9 A;  2IPK D;  1XCT L;  1WM3 A;  2WQY B;  2G9H D;  3B2G A;  2FCM A;  4GIV A;  3R7R A;  1SJH D;  2CHW A;  2K8B A;  3NZS A;  4ANU A;  2REX A;  1Q1O A;  4ARC A;  2KK8 A;  4PYU A;  1A5R A;  4FBJ B;  3E9S A;  1WWT A;  1IP9 A;  2KN5 A;  3TCA A;  1E10 A;  2N7E A;  5EE1 A;  4N58 A;  3VTW A;  2KHW B;  3Q2A C;  1VR9 A;  3ZRF A;  3B1L X;  3NS8 A;  4YSX B;  4PS8 A;  4YT0 B;  3QC8 B;  2MP2 A;  1UGM A;  1GPX A;  4WJQ A;  1YJ1 A;  5MPO A;  3O65 B;  4BKT A;  5EE0 A;  4CYE A;  2MBQ A;  2GB1 A;  3OLM D;  5TR5 A;  4PT5 A;  2O6V A;  1ZOY B;  3KVF B;  4KIK B;  2N7D A;  3BK2 A;  1FM0 D;  4W9G A;  4M8M A;  1F0Z A;  2K1F A;  2UWQ A;  3EHV A;  4HRO A;  4IUM B;  3JSV A;  3ZLZ A;  1FCC C;  2MJE A;  2UYZ B;  4IC7 B;  5AZF A;  3KQ4 A;  2QHO A;  1CQV A;  3T9L A;  2N9P C;  1WGG A;  1X1M A;  4G11 A;  4GDK B;  4XZ4 A;  4KDL B;  2PE9 A;  3I63 C;  4MM3 A;  3L10 B;  4FJZ A;  3DWM A;  4LNK A;  4E74 A;  3A4S C;  2KX3 A;  4FAD A;  3DVN V;  3H7P B;  3N20 C;  2VH1 A;  1C3T A;  2BW2 A;  2LVQ A;  2N4F A;  2MBO A;  1OQY A;  3U2S C;  3W5V B;  1ACC A;  1VZ6 A;  2AL3 A;  4HKQ A;  1OQQ A;  5BMH A;  4GDL A;  1WJ4 A;  3Q8F A;  1Y8R C;  1SE4 A;  2KQ7 A;  3PLU A;  3FAH A;  1NYQ A;  4LTU A;  1RFA A;  3BVM A;  1IBX A;  2RDB C;  4TQ0 A;  1I4H A;  2V3S A;  3WAP A;  1E6E B;  1RFK A;  3IBE A;  2GBN A;  1JML A;  2M0X A;  2WYQ A;  2PW9 A;  1L4Z B;  1TS3 A;  2K0P A;  4GOC A;  2NPT B;  2KYW A;  2E6X A;  4US8 A;  3Q3N C;  1HZ6 A;  2L76 A;  4K3C A;  1V49 A;  3VUX A;  1MG4 A;  2CKH B;  2KMM A;  4QAY A;  5BMI A;  2DAJ A;  3R2T A;  3PS6 A;  1MHH E;  2JXT A;  1N5X A;  4I6L B;  2M8S A;  2J0K A;  4W9D A;  3X23 A;  4A90 A;  1ZPS A;  3T3O A;  4C7Z A;  3Q3F A;  2G45 B;  2WGS A;  4LLG M;  2LGS A;  4S0R A;  3R3M A;  3RT3 B;  1LQB A;  1XO3 A;  3GE8 C;  3V6E B;  5GMV A;  1E90 A;  2IND C;  1HTO A;  3X0W A;  4US9 A;  3P4S B;  1DOI A;  3EUB 2;  1FIQ A;  1PGX A;  4OVU A;  4LJO B;  5E6O A;  2MBE A;  3GP7 A;  1RYJ A;  2INC C;  3RI7 C;  1FPY A;  1VDV A;  1OGW A;  4MAC A;  2XNA C;  1J7A A;  2CU1 A;  3DBS A;  2KFJ A;  1JAL A;  2I1K A;  3DVG X;  1YD8 U;  2WXK A;  1FNU A;  2ON8 A;  3DQV A;  3V6C B;  5JHA A;  1WJU A;  4ANW A;  1SIF A;  4E3C A;  3IXS A;  4OW0 A;  1TKE A;  3ECI A;  1JQ4 A;  4KGT A;  3JW0 X;  2OJW A;  1PFD A;  2VRR B;  4ZOH C;  1UH6 A;  3MTN B;  4FUL A;  3MC9 A;  2TSS A;  2C7H A;  3AE8 B;  4JQW C;  1MVK A;  2EMT A;  4HJG E;  2Z0D B;  2IO3 B;  3VVW B;  3VR9 B;  1ZGU B;  3AE9 B;  4XC2 A;  3AE1 B;  3N1Z C;  2L8J A;  3M63 B;  2B76 B;  3T3N A;  2EKE C;  1V1O A;  1YOV B;  1SSN A;  2BVC A;  3WA0 A;  1IUE A;  4GB9 A;  2MH7 A;  1Q5W B;  2RR9 A;  1YJJ A;  3A9J B;  3Q8C A;  2I38 A;  5FKA C;  1FRR A;  3RNB C;  2MJD A;  4BOS C;  3QHT A;  1WH3 A;  3RUI B;  2BYT A;  3L54 A;  1R7S A;  1T0Q C;  2K3U A;  1EO6 A;  4A3P A;  2HD5 B;  4KKI A;  2XBB C; 
#chains in the Genus database with same CATH homology
 2JF5 A;  1ZKH A;  3HIZ A;  3MJW A;  5JZE B;  2HJ8 A;  5DPT A;  1V2Y A;  2DAF A;  1P98 A;  5G55 A;  4LJP B;  2ZPN A;  2ZCC A;  3L16 A;  3LDZ E;  3S2A A;  3V60 A;  1L7Y A;  3ZDT A;  3JYU A;  5E6N A;  2KDB A;  4W9C A;  1V80 A;  4IWP A;  5D6J B;  4MGI E;  5BO4 B;  2FUH B;  4BBN F;  1WMH B;  2FID A;  2KWV B;  1MG8 A;  2PEA A;  3AI5 A;  4P7I A;  3BIN A;  4XX5 A;  1JRU A;  3W1S C;  2GBR A;  2AL6 A;  3KH0 A;  2BYE A;  2KMC A;  2LVP A;  2NVU I;  2K39 A;  4GU2 A;  1BT0 A;  4I6N B;  1WJ6 A;  3IHP C;  1WY8 A;  5KHO A;  2LRW A;  4MSQ B;  1NBF C;  1WJN A;  2LRU A;  2IO2 B;  1TZ1 A;  3PPA A;  4FHJ A;  2WX1 A;  2CS4 A;  4W9K A;  2JZ3 B;  3IVF A;  2BGF A;  2MCN B;  3PGE A;  2A5U A;  4GN1 A;  4NAW B;  3CST A;  2D11 A;  1E7V A;  2DYB A;  2LZ6 A;  4AWJ A;  2IY0 B;  2N1V A;  5LXH A;  3VDZ A;  1XD3 B;  2KZR A;  2LD9 A;  2MA9 B;  1Z2M A;  3DBH I;  3DVG Y;  2PPH A;  5CHV C;  4EOY A;  4HJK A;  1P9D U;  1WXS A;  1AAR A;  1NI2 A;  2BWE S;  5D2M B;  2DYO A;  2ZNV C;  2KMA A;  1T0Y A;  3ZO5 B;  5IAA C;  2GOW A;  1WXA A;  4ICV A;  4KDI C;  3VTU A;  3T8M A;  2KNB A;  2KD0 A;  3W1Y A;  2CR5 A;  2R2O A;  4IG7 B;  3NOB A;  2C7N B;  2K6Q A;  1V81 A;  1XQQ A;  3K9O B;  4WAA A;  5AEK B;  1YQB A;  1E5W A;  4GMV A;  3D32 A;  3RCZ A;  1KJT A;  4HVB A;  3QK0 A;  1V86 A;  2BF8 B;  3PZD A;  2O6V D;  3AUL A;  5E6P A;  2OJR A;  1EF1 A;  4TV3 A;  3ZW3 A;  2MP2 B;  1WIA A;  1RAX A;  3VUW A;  5C1Z A;  2ZCB A;  4W9I A;  5LLI A;  3SU8 X;  3MHS D;  4F8C B;  2K8H A;  2GBJ A;  2KTF A;  3OJ3 A;  4A3O A;  1KM7 A;  1U4A A;  1PQS A;  3I3T B;  4KSK C;  4G50 A;  3ZVV A;  4NQL B;  4PS7 A;  2MRP A;  2LXA A;  4IM3 A;  1E7U A;  4G0N B;  2EMS A;  5LXI B;  2O6V B;  2XK5 A;  2FCQ A;  3M62 B;  4IW0 A;  2C7M B;  4M0W B;  1H4R A;  1WI0 A;  2YVC A;  4DDG D;  4EEW A;  4MJS B;  2PE6 B;  3RYT A;  3OJ4 B;  2MBB B;  2K25 A;  5IA7 A;  1M94 A;  3PLV A;  4AOF A;  2NCN A;  2C9W B;  1P1A A;  2JVC A;  2L05 A;  2KQS A;  4ANV A;  5AZG A;  3PTF C;  2AYO B;  3JSV B;  2XBB C;  3KUD B;  1S1Q B;  2I1J A;  4IWQ A;  2KAN A;  5G2N A;  3UQB A;  4IM2 A;  1R4N I;  4BBN C;  4MGK E;  3PSE B;  4W9E A;  4HPL B;  5FR6 A;  3R7Q A;  2AEH A;  3HHM A;  4JL9 A;  1WFY A;  1ZW7 A;  3DBL I;  3QWZ B;  4KV2 A;  4URK A;  4HCP B;  1WR1 A;  1WE6 A;  3RZF A;  3VTV A;  3ENE A;  3QAQ A;  4WJP A;  4DHZ E;  1WYW B;  2FCN A;  3A9J A;  3QJZ A;  2MLB A;  4FHK A;  3ZDM C;  5L83 A;  3QX1 A;  2D10 A;  3A33 B;  2KX0 A;  4FN2 A;  2IYD B;  2KFK A;  4MGZ E;  2IO1 B;  3ZNH B;  1R4M I;  2YLM A;  3PRZ A;  4CO7 A;  4DWF A;  3A1Q A;  4IM0 A;  3PRE A;  1WF9 A;  2J0M A;  3VHT C;  2MSE D;  3UIP B;  3ML8 A;  4RMA A;  5CHF A;  4LCD E;  5JH5 C;  5C23 A;  2ZVO A;  4GDL B;  1LM8 B;  4BKS A;  4TQ1 A;  3PHX B;  1WRD B;  3KYD D;  3OAW A;  3LJ3 A;  1H8C A;  4DXA B;  2B3A A;  2IY1 B;  3ZNI D;  1WM2 A;  3RZW C;  5D94 A;  1WMH A;  4ZRK A;  4ZYN A;  3ZNG C;  1E8X A;  2C60 A;  4FJV B;  2HE7 A;  2V4L A;  3M3J A;  1OEY J;  2KTR A;  3WAO A;  1GUA B;  4JLC A;  2NBV B;  2KTR B;  4KZ0 A;  3QQ8 B;  4YL8 A;  5JHB A;  3KUZ A;  2NS5 A;  2ZNV B;  3DDC B;  1P0R A;  2RGF A;  4JGH B;  1WGY A;  2D3G A;  3AU5 A;  4EZJ A;  3DCG A;  5D7G A;  4ICU A;  5KHQ A;  4WJO A;  1WM3 A;  4MEL A;  4GXB A;  4NAW A;  4GSW A;  2G4D B;  2FCM A;  2IBI B;  4GIV A;  3R7R A;  4NQK E;  4J6I A;  2CHW A;  4DHJ B;  1EF5 A;  2GBM A;  3WIM A;  2K8B A;  3L13 A;  4N9F 4;  4BVU C;  3UF8 A;  3GOE A;  3NZS A;  2IZV B;  4ANU A;  2REX A;  1Q1O A;  2KO3 A;  2KK8 A;  2PJH A;  4PYU A;  3VQI A;  3AXC A;  3ONS A;  4WWN A;  1A5R A;  4FBJ B;  2KXJ A;  3QCA A;  2KOX A;  4AJY B;  1ISN A;  1IP9 A;  2KN5 A;  4NJ7 A;  3TCA A;  2N7E A;  4I6P A;  3KUC B;  2JUO A;  4HCN B;  4WJN A;  2JWZ A;  3VAW A;  1Z5S B;  2W9N A;  2L00 B;  3VTW A;  4AP4 C;  2KHW B;  3TIX A;  2MBH A;  5DCN A;  2LGX A;  3ZRF A;  3VXW A;  3B1L X;  3EC8 A;  5CX3 A;  2ZZP B;  4W9H A;  3NS8 A;  4MSM B;  3EEC A;  4PS8 A;  3QC8 B;  2M4N A;  1YX5 B;  2LAS A;  2MP2 A;  3DOW A;  4W9L A;  2KDF B;  3A9K B;  1WX8 A;  3UGB B;  4AJW A;  1SE9 A;  1UGM A;  1UZX B;  5DPR A;  4WJQ A;  1YJ1 A;  2FNJ B;  4MH0 E;  4X57 B;  4FLH A;  1E8Y A;  3O65 B;  4BKT A;  1S3S G;  3IG3 A;  2L3Z A;  4IWO A;  4CYE A;  4FJY A;  3NY5 A;  2MBQ A;  3OLM D;  5TR5 A;  3ZUN A;  2O6V A;  3KVF B;  4KIK B;  2N7D A;  1RLF A;  1XT9 B;  4RM9 A;  4MJS A;  4W9G A;  4ASW C;  2ASQ A;  2NR2 A;  5J2R A;  2N9X A;  4M8M A;  2O2V B;  2FAZ A;  3M95 A;  4EKU A;  3PV1 A;  4HPM B;  4W9F A;  2JY6 A;  3B08 A;  2DZM A;  3CSF A;  2K1F A;  2UWQ A;  1WR6 E;  2MQJ A;  3EHV A;  2Y5B B;  4KSL C;  1WGR A;  4IUM B;  3JSV A;  3ZLZ A;  2LUE A;  4M8N A;  1WE7 A;  2D07 B;  2UYZ B;  3PT2 B;  4IC7 B;  5AZF A;  2QHO A;  2JRH A;  4ZRJ A;  3VUY A;  3T9L A;  3ZIM A;  2N9P C;  3SDL C;  1GJZ A;  1WGG A;  1X1M A;  2DZK A;  2ZEQ A;  2KWC A;  4F7Z A;  4G11 A;  4GDK B;  4XZ4 A;  4FA6 A;  2D2Q A;  2BYF A;  3TJP A;  4KDL B;  2PE9 A;  1K8R B;  4MM3 A;  2MWS B;  3L10 B;  3TMP B;  2L0F A;  4FJZ A;  4HXD A;  2K6D B;  3C0R B;  3W1S A;  3ZTC A;  3A4S C;  2DZI A;  2KX3 A;  3R66 C;  4E74 A;  2GBK A;  1OTR B;  3DVN V;  1P3Q U;  3H7P B;  4FAD A;  1C3T A;  3KYC D;  2BPS A;  2LVQ A;  3N30 A;  4WQO B;  3ZTD A;  2LXC A;  2N4F A;  4B9K A;  4ZDV A;  4NJ6 A;  4GGQ A;  2MBO A;  1OQY A;  1UEL A;  1VD2 A;  2DX5 B;  4HWI B;  4NY0 A;  3QA8 A;  1KLV A;  1L2N A;  4G3X B;  2AL3 A;  3U8Z A;  2L7R A;  2BKR B;  4GDL A;  1GNU A;  1WJ4 A;  1Y8R C;  2KQ7 A;  3IFW B;  3PLU A;  3UIO B;  3ML9 A;  1RFA A;  1Q0W B;  2KJR A;  4DDI D;  4TQ0 A;  5J18 A;  4NNJ B;  2C5L C;  1G6J A;  1WX9 A;  2LGY A;  2V3S A;  3WAP A;  3U30 A;  2JT4 B;  2CHZ A;  2KWU B;  3IBE A;  2GBN A;  2A4Z A;  4DHJ D;  1J19 A;  2M0X A;  2WYQ A;  3VH4 B;  1YX6 B;  4KZC A;  4BOZ B;  3N3K B;  1V5T A;  4DBG A;  4KVG B;  4CHK A;  4GOC A;  2NPT B;  2KDI A;  2KLC A;  2ZJD A;  3CMM B;  2BWF A;  3H6N A;  3DBR I;  3SHQ A;  3TBL D;  5EDS A;  4F1S A;  1F9J A;  3PRP B;  4K7W A;  3L17 A;  1SGH A;  2JZZ A;  4EZL A;  4DK5 A;  2L76 A;  4DHZ B;  3H7S A;  1V49 A;  4NPN A;  3VUX A;  1KOT A;  1GC6 A;  3V61 A;  2CKH B;  1IPG A;  1D3Z A;  2DEN B;  2GMI C;  2KVR A;  1V5O A;  2FCS A;  5DPW A;  2DAJ A;  3PS6 A;  3CF6 E;  3P2B A;  2NBU A;  2M1M A;  3BY4 B;  2DHZ A;  3UQA A;  3GZN I;  4I6L B;  2M8S A;  2J0K A;  4W9D A;  3H9D A;  4MEM A;  2N9E B;  3U7D A;  3X23 A;  1LFD A;  1FXT B;  2G3Q B;  3QAR A;  1GC7 A;  1WGD A;  1E8Z A;  3Q3F A;  4B95 A;  2G45 B;  4RM8 A;  1VCB A;  4K1R B;  3PHW B;  2J7Q B;  4BFR A;  2N1W A;  1UBQ A;  1YIW A;  3DVN U;  3R3M A;  3RT3 B;  5DPS A;  1J8C A;  3HK0 A;  1TTN A;  3A4R A;  2KLG A;  1LQB A;  2ZPY A;  3V6E B;  2KJH B;  5GMV A;  1E90 A;  4EFO A;  2KC1 A;  4WWP A;  2LWP A;  3A9K A;  2LGD A;  3X0W A;  3PVL A;  4OVV A;  1TBE A;  3ZNZ B;  3HM3 A;  3AU4 A;  1WGH A;  5HKH A;  2RPQ A;  3HM6 X;  4EZK A;  2KC2 A;  2BKF A;  3APD A;  5CHW A;  4OVU A;  3V62 A;  4LJO B;  1QZE A;  5E6O A;  2MBE A;  4II3 B;  3H1U A;  1IYF A;  3ZRC A;  4W9J A;  1UD7 A;  3SD5 A;  4KIK A;  1EUV B;  4A20 A;  5L95 C;  2G4S A;  1OGW A;  2OOB B;  1HE8 A;  3Q3J A;  4HK2 A;  4K7U A;  4MDK E;  1WX7 A;  3L08 A;  4E71 A;  3NHE B;  3K9P B;  2CU1 A;  3DBS A;  3QIJ A;  3VFK A;  2KFJ A;  2O2V A;  3DVG X;  2I1K A;  1NDD A;  1V6E A;  3APC A;  2M17 A;  2MX2 A;  1YD8 U;  3APF A;  1V9J A;  2KJ6 A;  3KW5 B;  2DZJ A;  3VH3 B;  3DQV A;  1C1Y B;  3NZU A;  3V6C B;  4HLE A;  5JHA A;  3JVZ X;  1WJU A;  4ANW A;  3EFU A;  4K81 A;  1CMX B;  2JXX A;  1SIF A;  2IO0 B;  2JPH A;  4ZRI A;  1E8W A;  4E3C A;  4TKN A;  2JRI B;  3PRM B;  2LVO A;  1WXM A;  2FIF A;  3ECI A;  1OEY A;  2XK5 B;  2RD0 A;  3ALB A;  3N32 A;  1J0G A;  3WAL A;  4WWO A;  3WAM A;  3JW0 X;  4GDK A;  2VRR B;  3RD2 A;  4AUQ C;  4ANX A;  2DYM A;  4K7S A;  1UH6 A;  2ZVN A;  3DPD A;  2HTH A;  3MTN B;  4FUL A;  4JQW C;  2C7H A;  4MGY E;  4PYZ A;  4II2 B;  3TL5 A;  2MW5 A;  2WX0 A;  2L0T A;  2Z0E B;  2EMT A;  2LJ5 A;  2NBW B;  2Z59 B;  3H7P A;  4HDO A;  1GG3 A;  2Z0D B;  2AWT A;  2KKC A;  3ZKJ C;  2LI5 A;  2IO3 B;  2KDE B;  3B0A A;  1I42 A;  4LDT D;  1LXD A;  1TGZ B;  4JIO U;  5CTR C;  3VVW B;  3UIN B;  1ZGU B;  1RRB A;  4XC2 A;  1WXV A;  2WWZ A;  2L8J A;  5J17 A;  3M63 B;  2WDT B;  2RSU A;  4BKG A;  2XEW A;  4PS3 A;  2EKE C;  2K8C A;  2BYV E;  3WAN A;  2R2Q A;  4HDQ A;  3WA0 A;  4GB9 A;  1I35 A;  1Q5W B;  2RR9 A;  3A9J B;  4BKS D;  4BOS C;  4LDT B;  4TUU A;  3QHT A;  3RUL A;  4EUT A;  1WZ0 A;  1WH3 A;  2KFK B;  2CHX A;  1UBI A;  2V1Y A;  5AZH A;  3RUI B;  3L54 A;  3L0W B;  4B6W A;  3A1Q B;  1EO6 A;  2J0J A;  4A3P A;  1WZ3 A;  2HD5 B;  2NPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...