3DWMA

Crystal structure of mycobacterium tuberculosis cyso, an antigen
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
NVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 9.5 kDa culture filtrate antigen cfp10A
publication title Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 25
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3dwmA00
3P63A 3AE2B 1FXIA 3P1MA 1YQ3B 2FBWB 2HTME 4N59A 1N63A 1NI3A 1DOYA 1ZXIA 3NVVA 4LTUA 1FIQA 1N61A 1OFFA 1WWTA 3AE3B 2BT6A 1NEKB 3AECB 3AEFB 5H8YE 1TYGB 1XO3A 3RPFC 1NENB 3DWGC 4JWSC 4YTNB 3ABVB 1XLNA 2BS4B 1WYGA 1QOFA 2W55A 1NYRA 3PO0A 1GPXA 4C7YA 1J7CA 1A70A 1PDXA 1ZOYB 2B76B 4JX1C 2JX5A 5EE1A 3W5VB 1GAQB 2WLBA 3AEGB 1TKYA 5G5GA 1PFDA 1IUEA 1KFYB 1FMAD 2M56B 2W3SA 3NVYA 3AE9B 3HUIA 4KX6B 2WDVB 1ZUD2 2G1EA 1TJEA 1T3QA 1L5PA 2K22A 5AUKA 2MJEA 1DGJA 1E6EB 3B2GA 3VR9B 2PVGC 1NYQA 1E10A 2KAJA 2AX5A 5AUIA 1E9MA 1OQRA 1QF6A 1R7SA 2EKIA 1UWMA 2H89B 3BIID 4YTPB 4YSXB 1FRDA 2WP9B 3AM9A 1TKGA 3AB5A 3L4PA 3SR6A 1WGKA 3B2FA 3VRAB 1FM0D 2H88B 2MJDA 1YJJA 3AE7B 4YSYB 3DWMA 3NVZA 1N60A 1VLBA 2WS3B 2K5PA 3EUB2 1XLQA 3AE5B 1V97A 3P4QB 1VJKA 1JRPA 2M19A 3AEDB 1XLOA 4P6VF 1JW9D 3NVWA 4ZOHC 3SFDB 3VRBB 1RYJA 1WRIA 3KWLA 3P4PB 3ZYYX 5EE0A 1F0ZA 1E0ZA 3AEBB 4ITKA 5EE9A 3W5UB 1PUTA 1V8CA 2ACZB 4JWUC 1FO4A 1CJEA 4IDIA 1SIJA 3CWIA 1AYFA 1QOGA 1YJIA 2WQYB 5H92C 3B9JA 2BS2B 1RM6C 2Q5WD 3LB8C 1B9RA 1KF6B 1JALA 1CZPA 2MJ3A 4US9A 4ZHOA 1SF0A 2LEKA 5C2TB 1L0VB 1VDVA 1TKEA 1E7PB 1JWAD 1EWYC 1QLBB 3AE6B 4N6EB 3W9CB 3NRZA 1JROA 1YQ4B 1FFVA 1KRHA 3AE1B 5GXGB 1JQ4A 1ROEA 4A9AA 1AWDA 3AH7A 1J7AA 4ZHPA 4US8A 2MH7A 3AE8B 2L83A 4YSZB 1QOBA 4C7ZA 2L52A 3AMZA 4N58A 2W3RA 2WDRB 1I7HA 2CJOA 1JWBD 3AEAB 2E3TA 1XLPA 1ZP0B 4USAA 2PVOD 1QT9A 3AEEB 3LXFA 2WU2B 2OHFA 4YT0B 4YTMB 2Y5CA 1FFUA 1N5XA 5C3JB 1FRRA 1FXAA 2PIAA 1L6VA 1WXQA 5MPOA 1RWSA 2QIEB 2PKOA 4HRSA 4FXCA 3ETRA 3AV8A 3HRDD 5G5HA 2DWQA 3AE4B 4C80A 1DOXA 2K9XA 1OQQA 1N62A 4WQMA 2CU3A 1SB3C 2QJLA 3CIRB 3FC4A 1NVID 2JQRB 3P4SB 2N0SB 4HROA 4WWMA 3FAHA 2WDQB 1L6UA 3VR8B 1J7BA 1N5WA 4YXDB 2WU5B 5EE3A 2W54A 2DBYA 1RFKA 3SFEB 1QOAA 1DOIA 2CJNA 3NS1A 2BS3B 2KMMA 3HVZA 3WCQA 3AN1A 3P4RB
chains in the Genus database with same CATH superfamily
4RM9A 4HXDA 4MDKE 1U4AA 3DCGA 4OVUA 4GSWA 4EEWA 3ZNGC 2OJRA 4DHJD 5HHDG 3PO0A 2CHZA 3DHGC 3QX1A 2XK5A 1Z2MA 4FJVB 3U8ZA 1YX6B 2EELA 2QCZA 3UGBB 5BMIA 1E5WA 2OJWA 3U7ZA 3ENEA 3ZJVA 1FXTB 3HUIA 3OJ3A 1TJEA 2RGFA 1K52A 1E10A 2ZPNA 1R4NI 3CSTA 2O6VA 2O2VB 1TGZB 3CF6E 3BVMA 3IT6B 2LWPA 1H8CA 2H88B 4FLHA 2K5PA 2BKFA 1E8XA 1VJKA 1JRPA 2M19A 3TSSA 3NVWA 3RNEC 1E0ZA 4LNIA 2WX0A 2ACZB 4BKSA 2JRIB 1GNUA 5HI1A 3MC0B 3E9SA 2KFJA 2IPKD 3IXSA 1E7PB 3PVLA 2DLBA 3PREA 1ZE3D 5DCNA 1F1HA 2LASA 4ZHPA 2EMSA 2FCNA 3Q8AA 2BW2A 4LNKA 3PZDA 3VTUA 1UGMA 2RDGA 1HQRD 1XF5L 2INCC 1FRRA 3W2DA 1P0RA 4KDLB 5IKCM 1RWSA 5BYQA 3RI7C 2KTFA 4KZ0A 1CQVA 4C80A 3AE4B 3PHWB 2K9XA 2VH2A 2Z59B 2ZPYA 5CHWA 1NVID 2IGGA 1YMHE 1C4CA 4BOZB 1WXVA 2WXOA 3O13A 3WCQA 2KMMA 3R2IA 3WAOA 2PW9A 3A4RA 2JXXA 3P4RB 1V80A 1TIFA 3VQIA 2OEDA 1WFYA 3KUZA 3JSVB 3UQAA 2MW5A 3AI5A 5D94A 4JWSC 3W1SC 3GZNB 2W55A 1SGHA 1NYRA 1J7CA 4CYEA 2WHIA 2JX5A 3ZKJC 3HIZA 3SDLC 3AEGB 2QC8A 2LVPA 2CHWA 1WXMA 4NQKE 5HKHA 2NMQA 3QWZB 4IOIE 3L08A 4MT5A 5IAAC 2BKRB 4F7ZA 5IN7A 4YSXB 2LVQA 2L1AA 1L0XB 4FHJA 2DX5B 1Q10A 4RM8A 1RYJA 4NJCA 4ZDVA 1IBXA 1HZ6A 2DAFA 1QOGA 5H92C 3EHVA 1T0YA 1KF6B 4ZHOA 1T6BX 3W9CB 4CO7A 4MH0E 5GXGB 4EZLA 3T9LA 3NUHB 1HTQA 4WJNA 2KDBA 3W1YA 1QOBA 4ICVA 2L52A 3AMZA 4KGTA 2PVOD 4DXFA 2IY1B 2BB6A 3HVDA 3MHZA 2L8JA 3RNGC 3ZRFA 5J2RA 1FEHA 2NPTA 3R2TA 1C3TA 2QIEB 3U4EG 1XCQL 3AV8A 3A33B 4NJ7A 4RF1A 4B9KA 2PPHA 1SB3C 2WXFA 2RPQA 4AP4C 4HEA1 2WXPA 2L76A 3BYTB 2INNE 3VTVA 3HVZA 3PRMB 1YQ3B 1N63A 1YOVB 4RF0A 4X57B 2JXTA 2V4LA 5AZGA 2DAJA 3BZDB 4WURA 4IKGA 2BQQA 2NTSA 3ZGZA 3C19A 1R4NB 3L13A 1KFYB 2W3SA 2KTRB 4BVUC 4ZRJA 2IDYA 3MTNB 3R66C 4N9F4 1WM2A 3HM3A 4K7SA 2CKHB 1I4RA 1QF6A 2ZEQA 2GBRA 2L05A 2HE7A 1WGRA 4QAYA 3RN9C 3ZTDA 5KHOA 3ZLZA 4JGHB 4ZRQA 1H4RA 1UF0A 5EE9A 2ZW1A 3H1UA 1WMHA 4C4VA 3H7SA 4BZAA 2G4DB 1SF0A 2M0XA 1EWYC 4Q2JA 4II2B 1TTNA 4GDKA 2W3RA 4K7UA 1I7HA 2LZ6A 1E7VA 1L0YB 2IGDA 2DZIA 3V05A 4YTMB 2J7QB 2V1YA 3TEWA 1V1OA 4ARIA 3WA0A 1EWCA 4KGRA 1WSPA 2LUMA 3L10B 3M63B 3NZ3A 1V1PA 2KWUB 3QC8B 1I4GA 3NJTA 2LGIA 1GOZA 1DOIA 1MI0A 4KIKA 3TL5A 3QQ8B 1C78A 4IM2A 4MSMB 4B6WA 2DYMA 3SHQA 4A8XC 1HEZE 1TYGB 3DWGC 4BKTA 3Q2AC 2B3AA 1LFDA 3B08A 1A70A 2KC2A 2KDFB 2BVCA 4A90A 3VHTC 4K3BA 1IUEA 2LGYA 5AUKA 3LDZE 2MBEA 3UI3A 4L23A 1UWMA 2H89B 2CR5A 3ZDTA 2WX1A 1Q0WB 1WGKA 2D07B 2MX2A 3ML9A 1VLBA 1MHXA 3P4QB 4P6VF 1YN3A 5BMHA 1Y8RC 1XQQA 2L32A 1I35A 1QZEA 1SE2A 2KO3A 3B9JA 1RM6C 1WX7A 3C0RB 2DYBA 2WXHA 3WALA 3ONSA 1L7YA 3AE1B 2LXAA 4RGNA 2AWTA 1J0GA 1Q1OA 3V6CB 2IY0B 1V9JA 1WXSA 2FCMA 1OEYJ 4G0NB 1WGYA 5AZHA 1JWMD 2Y5CA 2FCQA 3VDZA 3D32A 3MC8A 3M3JA 2VZKB 1WE6A 1V5OA 1TS3A 2DENB 3DBSA 4E3CA 2GBMA 2YLMA 3MFGA 5D3IB 4HK2A 3RNFC 5IOIA 2R61A 3BVGA 3MJ5A 5IO9A 4R3DA 4MGKE 2IJ0A 2IO3B 3B1LX 3NVVA 3AE3B 3EECA 3OJ4B 1XLNA 2BYVE 2NVUI 2OOBB 1PGBA 5CX3A 4AOFA 3QIJA 2KX0A 2IZVB 5FR3A 2BPSA 1FMAD 4LDTD 2SEBD 3A4SC 4MACA 3JVZX 2KD0A 2KJRA 2NS5A 3U30A 3I57A 4LJPB 2KN5A 1AARA 3P2BA 1ZDVA 3DVNU 2MJDA 1KM7A 4LNOA 3DOWA 4MGYE 3VH3B 2RPVA 3TEZA 1C79A 1SIJA 2IO0B 3MHSD 2FAZA 1GG3A 1JROA 2JRHA 3TEYA 3KYDD 4NNJB 4KV2A 3RULA 1RRBA 1JWBD 1XLPA 2D3GA 4OVVA 2PIAA 4OHJA 1GUAB 2LVOA 4W9DA 2KKCA 1J19A 1SJED 3ZRCA 4HKQA 2KFKB 2KLCA 3N1XC 4XGAB 5DPWA 1E8WA 1KH0A 1WH3A 3P42A 2C5LC 3H8HA 1EM7A 4KSKC 4OVZA 3GB1A 3ZVVA 3AE2B 3KLSX 2NBWB 3A9JB 4AQ7A 2HTME 1UWXA 2KQSA 1DOYA 1UD7A 2WNMA 2N7EA 3RNCC 1XO3A 4XDCA 3VH4B 3ZUNA 3V61A 4ZRKA 1E90A 1ZKHA 2N7JA 3APCA 4NAMA 1E8YA 1L4DB 1ISNA 3NOBA 3RNBC 1MJDA 2WDVB 2GRIA 2JY6A 4ANWA 3V60A 4EE2A 5L95C 4KZCA 3A1QB 1NYQA 3R7QA 4GB9A 4YTPB 1S1QB 3L4PA 1VCBA 4W9IA 1TS5A 1P98A 3KYCD 2KMAA 1V97A 4M8NA 1YNTE 5JHAA 5T8IA 2KXJA 4DDGD 2BS2B 1R4MI 4EZJA 1JALA 1Q5WB 4US9A 4GOCA 5C2TB 1JWAD 2DNFA 2ZVNA 4N6EB 1VD2A 4NAWB 1JQ4A 4GXBA 3ML8A 2Z0DB 3N1ZC 2WXNA 3I63C 5I4DA 2CJOA 4DHJB 2NR2A 5IA7A 3EGRA 1WF9A 3ZTCA 3AEEB 3IBEA 1WXAA 1XT9B 3JSVA 3N30A 1V6EA 5C3JB 1SEBD 1LO5D 1K53A 2MRPA 4HRSA 3N20C 1TS4A 2BWES 3IHPC 2Y3AA 3RZFA 4P7IA 3KWVA 2HTHA 3GE3C 1J7BA 2N9XA 2D3AA 2A5UA 4ACFA 3BYYB 4WH4A 1MPEA 2LHEA 2NBUA 4MM3A 2MEKA 1WI0A 1K8RB 3H9DA 3SD5A 2BYFA 3P63A 2I1KA 2J0MA 1ACCA 2O6VD 2LUEA 3BY4B 4ZYSA 1N61A 1NEKB 2G45B 1TT5B 1V5TA 2D3CA 4RCOA 1WJ6A 5D3DA 2B76B 2K1FA 1D4BA 3U2SC 1XEEA 3T3NA 4BKSD 1DGJA 2K25A 3AXCA 3FKYA 3OG5A 1ZW7A 4GU2A 4WJQA 1R7SA 4TUUA 4AJYB 2KWDA 3Q14C 1FRDA 1TKGA 3SR6A 1F77A 1YX5B 3QHTA 1XLQA 4WQOB 1WJNA 1FNVA 3QA8A 1PUTA 1V8CA 2W82A 2L0TA 4AS1A 2WXJA 2JU6X 2JPHA 3QCAA 4OW0A 3AULA 1TKEA 4B0MA 1I4PA 3T8MA 4MELA 3UIPB 2J53A 1FNUA 2KT7A 3K9OB 3PV1A 3BINA 1WX8A 4RGTA 2JZZA 1XD3B 3N1YC 4HJGE 4C7ZA 4FBJB 2HJ1A 5LNK1 1I4XA 1ENFA 1QT9A 4C00A 3HK0A 1OQYA 2DZJA 4A6QA 1CMXB 3ETRA 3RFZB 3KUDB 1IGCA 4WWPA 4CHKA 2QMTA 3P4SB 4IM3A 3OWEB 1WM3A 2KVZA 4M8MA 1HZ5A 4PS7A 4DXGA 2KTRA 1V49A 2K39A 3WAPA 4G11A 2A4ZA 2CHXA 2GLSA 3Q3FA 4NY0A 4K7WA 2N9EB 4GN1A 2M0AA 2C60A 3JYUA 2BT6A 1T0QC 3EA6A 5BYRA 1OGWA 2K8HA 1F2RC 3OAWA 2HDEA 2LXCA 1UBIA 2N9LA 1V81A 1GAQB 4F8CB 2M56B 4S17A 4KKIA 3U7DA 2AL6A 2KAJA 2KWCA 2GMIC 1TBEA 4XZ4A 3AM9A 2GI9A 4PS3A 1N60A 1MHHE 2N1WA 5E6NA 3ZIMA 3KW5B 5EDSA 2XBBC 2BYTA 1BUIC 3B0AA 3URYA 4HPMB 4IWPA 2WQYB 2NCNA 4K81A 4FJZA 2I38A 1CZPA 4E71A 1L0VB 1VDVA 4A20A 4XYCA 4HCPB 2MP2B 2N9PC 2AQ3B 3PLUA 4PYZA 3A9KB 4B95A 3Q3OC 4KGSA 4ANVA 2LJIA 3I5JC 1WIAA 2KQ4X 3IAS1 2V9HA 2LI5A 2LRUA 2KACA 1UH6A 2ZNVC 3HRDD 2NPTB 3E56A 4HWIB 2HJ8A 2MBBB 3PTFC 2C7NB 3ZO5B 4AUQC 5EE3A 3WAMA 4GDLA 2FIDA 4LK0M 4G50A 1TZOA 3P1MA 2D2QA 2FBWB 2V4IB 4ARCA 3AEFB 1WYGA 2MBHA 3PT2B 5KHQA 4JX1C 1C77A 1NDDA 2X8XX 2BYEA 1YN5A 2YVCA 2Z8LA 1L5PA 1T3QA 2PVGC 3NZSA 2AX5A 1IYFA 2DHZA 4TMAB 3UINB 4WAAA 1YJJA 2LJ5A 4JLCA 4M0WA 4E74A 4HDQA 3RCZA 1SE4A 2KMCA 4RMAA 4FN2A 2PEAA 2GB1A 4MH8A 1SBBB 1NI2A 3P4PB 4IW0A 1UUPA 3APDA 4ITKA 5E6PA 2AYOB 1CJEA 4IDIA 2DZKA 5JH5C 2ZCCA 2LEKA 4TKNA 5HG2A 4PS8A 1QLBB 1UELA 1ZGUB 3AE6B 4DXAB 1MFWA 1LM8B 1FFVA 1YJ1A 4KDIC 1J7AA 3R7RA 3DDCB 3AEAB 4W9EA 4FA6A 4MJSB 1YD8U 3TUOA 3ZJUA 1F52A 4XX5A 1WR1A 5GMVA 4A3OA 2RSUA 1KTKA 3CIRB 3KQ4A 3R3MA 4OZAA 1LQBA 2WDQB 3VXWA 4YXDB 4WJOA 2JF5A 2W54A 5D7GA 2BB5A 1KOTA 4BOSC 3ZW3A 2V3NA 3NS1A 5DPTA 3V6EB 3ZNHB 4DK5A 3IT4B 1VRAB 2R2OA 1F2RI 4KIKB 4ZRIA 5FR6A 1YQBA 1FIQA 5H8YE 3RD2A 3RPFC 4HCNB 1UNSA 2WWZA 4G3XB 2BTEA 4WWNA 4W9CA 1P1AA 1WYWB 2NBVB 5BO4B 1C76A 3W5VB 4J6IA 2MBQA 5G5GA 4ZYNA 1JCKB 4K3CA 1ZUD2 2G1EA 4EOYA 1HXYD 1E6EB 3VR9B 1BMLC 1WX9A 2UYZB 3AB5A 4ANXA 1WR6E 3AE7B 2KANA 2KK8A 5BMGA 3AE5B 4YWGG 3L16A 1F0ZA 1FO4A 1T0RC 2V3PA 3N32A 4MSQB 2AQ2B 3PZ7A 2JUOA 3RUIB 2KFKA 3Q8BA 4JL9A 1ZXHA 1IPGA 1J8CA 4A9AA 2LMCA 4N58A 2C7MB 4MGZE 1P3QU 1KJTA 4I6NB 2OHFA 2D5GA 2JWZA 1WRDB 1FFUA 2CS4A 2JT4B 4KVGB 4LDTB 5BYSA 1WGGA 2AL3A 4EUTA 2J0KA 2QJLA 2K6QA 4TV3A 1N5WA 4FJYA 1RFKA 3A1QA 1QOAA 2PE9A 2V3SA 2BS3B 1P9DU 4DWFA 2ASQA 3HM6X 3BWUD 3WANA 2Z0EB 3IFWB 3ZQ4A 4LTUA 3X0WA 3AECB 4REZA 3GS2A 4W9KA 2KDEB 1FNWA 1SXTA 1QOFA 3CMMB 1GB1A 5D6JB 1FCCC 4M01A 3UIOB 5D2MB 3VUYA 2FUHB 1JWUD 2TSSA 3NVYA 3ZXRA 2O2VA 1EUVB 1EF5A 2PMVA 4ANUA 1E9MA 2YEPB 5LXHA 3VUXA 2WP9B 3RYTA 5DPSA 1M94A 2KJHB 2L7RA 4LJOB 5JHBA 3DVNV 4KSLC 1WZ3A 1SE3A 4DBGA 1I4HA 3AEBB 2J52A 4PT5A 1S3SG 3W5UB 4J3OD 4K1RB 2E6XA 3ZNID 1MG8A 2RDHA 2UU7A 2BBCA 1EU4A 2C7HA 3PZ8A 2N4FA 2QHOA 1TY0A 3AE8B 4YSZB 2D11A 2KYWA 1Z5SB 4XDDA 1PQSA 3H7PB 4YT0B 2N1VA 2LHDA 4W9LA 4NQLB 2J4XA 3RNAC 2D3BA 5IP4D 2KX3A 1JWSD 4IWOA 3QJZA 3L0WB 2QDFA 2FUG1 4HJKA 3NS8A 3ZNZB 5TR5A 2MLBA 3LJ3A 2WXKA 2N9KA 1DYQA 4OZCA 2XNAC 1IP9A 4CQNA 1WZ0A 1L4ZB 3PHXB 2KHWB 3U52E 4EZKA 3KUCB 1NI3A 1OFFA 2ZVOA 4MGIE 2INPE 3APFA 1IGDA 2K8CA 5CHVC 5G55A 1GPXA 1QQRA 3M95A 3DBRI 2EKEC 3FILB 4W9HA 5CTRC 4NZLB 1HE8A 1M4VA 3PRZA 3VVWB 4EFOA 3B2GA 5L83A 1K50A 4F1SA 4PYUA 2ZZPB 4IC7B 3TBLD 1E7UA 2RMMA 1WY8A 2G4SA 1HTOA 3BIID 3JW0X 3VRAB 2XN9C 3Q8FA 2M8SA 2REXA 1GC7A 2WXMA 3S2AA 3Q6BA 4ZOHC 3SFDB 4O1NA 5J18A 1ET6A 2XK5B 5E6OA 4M02A 2I1JA 4LCDE 5FK9C 5DPRA 1AN8A 1KLVA 3T3OA 3L17A 2O6VB 1B1ZA 1KRHA 3GOEA 1LXDA 2ZNVB 4IWQA 2MHJA 3DHHC 1X1MA 3C8YA 1LGRA 2WU2B 4XWWA 3ZJTA 3MP9A 1UBQA 3BK2A 2JSVX 1FD6A 3ECIA 2V0GA 2KNBA 2KLGA 1N62A 2WXLA 4WQMA 5JXVA 3O65B 2INDC 2WGSA 3NY5A 3DPDA 4YL8A 2AQ1B 4RGOS 5AZFA 4FADA 1Y56A 4MM3B 2RR9A 1SE9A 2WYQA 4AJWA 2DYOA 1JMLA 2WXQA 4KKJA 2FNJB 2PJHA 2BS4B 4NJ6A 5G2NA 1KLUD 5EE1A 1VZ7A 1FCLA 3V3XA 2XEWA 3AE9B 5LXIB 3SU8X 4HKZE 4WAFA 2K3UA 2MP2A 3MC9A 3TMPB 3PS6A 3V62A 3N3KB 4UDUC 1FM0D 2VH1A 1TS2A 4WWOA 2WS3B 1TY2A 3EUB2 1ESFA 2MSED 2ZW0A 3A9KA 1JW9D 4LNNA 3VRBB 3N9YC 4JE3B 1WE7A 1T5XD 2MWSB 4JWUC 1AYFA 1YJIA 3Q3NC 2K0PA 2Q5WD 2MCNB 1SJHD 3L54A 4P1CC 3DBHI 2LGSA 4FULA 3NRZA 2BF8B 2L3ZA 2QEJC 2JZPA 1ROEA 4IG7B 2MH7A 2EMTA 1KLGD 3VUWA 3LXFA 1R4MB 2G3QB 1G6JA 4II3B 1SIFA 1IBXB 1L6VA 1WXQA 4W9FA 2LGDA 2KJ6A 1I4QA 3NZUA 2JYTA 2CU1A 3IVFA 2JQRB 2N0SB 4HROA 1WGDA 1I42A 2WU5B 3DQVA 2DBYA 1EF1A 1GC6A 2IGHA 5E6JA 2KN4A 2ZCBA 3GP7A 3ALBA 3M62B 1FXIA 2JYEA 4N59A 5FKAC 4RGMA 4DQOC 1ZXIA 3DBRB 1WWTA 4YTNB 3ABVB 1C4PA 3DHIC 3VTWA 3RT3B 2MQJA 4L2YA 4XC2A 2BWFA 5CHFA 2G9HD 3RZWC 2IBIB 2WLBA 4OZBA 4DDID 1TKYA 4RH6A 1PFDA 2QILA 1D5XC 5HFYA 4KX6B 3Q8EA 3Q69A 3GE8C 2K22A 1ZPSA 2GBJA 1VZ6A 1K51A 2MA9B 3AU5A 2KDIA 3KH0A 3DVGX 2PTLA 1RAXA 1EO6A 4WIPA 4YSYB 3VAWA 3DWMA 2WXGA 4IM0A 1WJUA 4MJSA 1WGHA 2ZJDA 3DBLI 1P7FA 1XCTL 1JRUA 2ICIA 4RFBA 5EE0A 4JIOU 3BVZA 2KDMA 2C9WB 1GJZA 1C4AA 2ONQA 2L00B 2RD0A 3IAM1 2R2QA 2MJ3A 5TSSA 3TJPA 1E8ZA 1CK1A 1YQ4B 2GBNA 2KZRA 4GIVA 4RNAA 2N7DA 3PLVA 4US8A 3UQBA 2K8BA 2VRRB 1PGAA 2E3TA 1ZP0B 1GB4A 4A3PA 1YIWA 1VR9A 4MEMA 4JQWC 1MVKA 4BFRA 5MPOA 1SSNA 1WMHB 4HPLB 4C4VB 2JVCA 1T0SC 1TZ1A 3FC4A 4B0EA 1D3ZA 1V86A 4GDKB 2KWVB 4FHKA 3AN1A 4GDLB 1MG4A 2LFIA 4JPSA 3NG0A 1AW7A 3BK1A 5AEKB 4TQ0A 2WXRA 2FIFA 1XXGA 1BXTA 2UWQA 3PSEB 4GGQA 1UGJA 1FPYA 1ZOYB 4H2AA 2JZ3B 1V1PB 1V2YA 3H6NA 2JWUA 3QAQA 4C56C 2MJEA 4PK1A 4TQ1A 2LRWA 2BGFA 1D6EC 4ASWC 2J0JA 2SAKA 2EKIA 2VZKD 4S0RA 3B2FA 2I2YA 2IYDB 5LLIA 3PRPB 2J42A 3EFUA 4P1BC 4I6LB 3AEDB 4M0WB 3I9V1 2IO2B 1WRIA 4BBNF 1OEYA 4HDOA 1A5RA 3Q3JA 3DBHB 1VZ8A 2QSDA 1QILA 3Q3MC 3WIMA 3CSFA 2LD9A 2IO1B 4AWJA 2K6DB 2M4NA 4I6PA 1UZXB 1AWDA 2MBOA 2L83A 2Y5PA 1ET9A 3HHMA 4IUMB 5JZEB 3TEXA 1RLFA 1PYWD 2GOWA 5C1ZA 1N5XA 1FXAA 3OLMD 4M00A 3KVFB 3SEBA 2KOXA 2DWQA 2GBKA 3IG3A 2CU3A 2PE6B 1QKZA 3W1SA 4WWMA 5C23A 3FAHA 1L6UA 3VR8B 1ZDXA 3ZDMC 4EKUA 3K9PB 3QARA 2KVRA 4L1BA 3PGEA 3A9JA 4DHZE 4GMVA 4ZRPA 2M17A 3J9CA 4A55A 3LYYA 5J17A 2X38A 2W9NA 1NENB 4XE0A 3ZXVA 4DHZB 4C7YA 1N6ZA 2HD5B 1PDXA 3TCAA 3R8BA 3EC8A 2WDTB 3NHEB 3GZNI 3TIXA 2M1MA 1F9JA 4LLGM 3MJWA 1HA5A 5AUIA 1OQRA 3I3TB 2NTTA 1RFAA 2KC1A 4W9JA 3RMKC 3X23A 3DBLB 3NVZA 4BAXA 3H7PA 1XLOA 3PPAA 4HVBA 3KWLA 3ZYYX 1L2NA 2FCSA 1D5MC 2DZMA 4HPPA 3AU4A 3CWIA 4TSSA 1EU3A 3LB8C 1B9RA 1WJ4A 4NAWA 3Q8CA 3VFKA 1YN4A 4W9GA 4HLEA 1PGXA 2L0FA 3AH7A 1C1YB 1C9FA 4XWTA 4LNFA 3QK0A 4BKGA 1BT0A 2WDRB 2RDBC 1P7EA 4USAA 1NBFC 4P16A 2Y5BB 4D2KA 1D5ZC 2KQ7A 4NPNA 2LGXA 2FE8A 2WXIA 4ICUA 2PKOA 4FXCA 1STEA 5G5HA 1OTRB 1DOXA 2YEPF 3FILA 4BBNC 1OQQA 2PLPA 2AEHA 2ON8A 3UF8A 3DVGY 3EFCA 2D10A 3SFEB 4WJPA 2CJNA 4URKA 4GLSC
chains in the Genus database with same CATH topology
1Y56A 4R3DA 4MM3B 3P1MA 2IJ0A 2FBWB 2V4IB 3NVVA 4ARCA 2DYOA 1JMLA 3AE3B 3AEFB 2WXQA 4KKJA 3BVGA 1XLNA 2BS4B 1WYGA 5HHDG 3PO0A 1PGBA 1KLUD 2EELA 4JX1C 5BMIA 5EE1A 3U7ZA 1C77A 5FR3A 1VZ7A 1FCLA 3V3XA 1FMAD 1YN5A 3ZJVA 3AE9B 3HUIA 2SEBD 2Z8LA 4MACA 1TJEA 1L5PA 1T3QA 1K52A 1E10A 2PVGC 4HKZE 4WAFA 2AX5A 2K3UA 3I57A 3BVMA 4TMAB 3IT6B 4UDUC 1ZDVA 1FM0D 2H88B 2MJDA 1YJJA 1TS2A 4M0WA 2WS3B 1TY2A 2K5PA 3EUB2 1SE4A 1VJKA 1JRPA 1ESFA 2GB1A 2M19A 2ZW0A 1SBBB 4MH8A 1JW9D 3TSSA 3NVWA 3VRBB 3N9YC 3P4PB 4JE3B 2RPVA 3TEZA 1UUPA 1E0ZA 1T5XD 4ITKA 4JWUC 2ACZB 1C79A 1CJEA 4IDIA 1SIJA 1AYFA 1YJIA 2K0PA 5HI1A 3MC0B 3E9SA 2Q5WD 1SJHD 2IPKD 2LEKA 3IXSA 5HG2A 1E7PB 1QLBB 3AE6B 2DLBA 3NRZA 1JROA 1FFVA 1ZE3D 2QEJC 3TEYA 2JZPA 1ROEA 1J7AA 4ZHPA 2MH7A 3Q8AA 2BW2A 1KLGD 1JWBD 3AEAB 2RDGA 1XLPA 3LXFA 1HQRD 1XF5L 3TUOA 3ZJUA 1FRRA 2PIAA 3W2DA 1IBXB 4OHJA 1L6VA 1WXQA 1RWSA 5BYQA 1I4QA 4EE2A 1CQVA 4C80A 3AE4B 2JYTA 2K9XA 1SJED 4HKQA 1KTKA 3CIRB 3KQ4A 1NVID 2JQRB 4OZAA 2N0SB 4HROA 2WDQB 2IGGA 1YMHE 4YXDB 2WU5B 1KH0A 2W54A 2DBYA 5D7GA 3P42A 2BB5A 3H8HA 1C4CA 1EM7A 2WXOA 4OVZA 3O13A 2V3NA 3NS1A 3WCQA 2KMMA 2IGHA 3R2IA 5E6JA 2PW9A 3GB1A 2KN4A 3GP7A 3IT4B 3P4RB 1VRAB 3AE2B 3KLSX 1F2RI 3VQIA 1FXIA 2JYEA 2OEDA 4AQ7A 2HTME 4N59A 5FKAC 1UWXA 4RGMA 1DOYA 4DQOC 1ZXIA 1FIQA 1WWTA 2WNMA 5H8YE 1XO3A 4XDCA 3RPFC 4YTNB 4JWSC 3ABVB 1UNSA 2W55A 1NYRA 1C4PA 2BTEA 1J7CA 4L2YA 2N7JA 2JX5A 2G9HD 1C76A 3W5VB 2WLBA 3AEGB 4NAMA 1TKYA 1L4DB 1JCKB 1PFDA 4OZBA 4RH6A 5G5GA 2QILA 1D5XC 5HFYA 4KX6B 2WDVB 1ZUD2 2G1EA 2GRIA 3Q69A 3Q8EA 2K22A 1HXYD 1ZPSA 2NMQA 1E6EB 4IOIE 3VR9B 4MT5A 1BMLC 1NYQA 1K51A 1VZ6A 4YSXB 4YTPB 2PTLA 2L1AA 3AB5A 3L4PA 4WIPA 1L0XB 3AE7B 4YSYB 1TS5A 3DWMA 2WXGA 5BMGA 3AE5B 1V97A 4YWGG 1Q10A 1P7FA 1XCTL 1RYJA 2ICIA 1YNTE 4NJCA 4RFBA 5EE0A 1HZ6A 1F0ZA 1IBXA 3BVZA 2KDMA 5T8IA 1FO4A 1QOGA 5H92C 2V3PA 2AQ2B 1C4AA 2ONQA 3PZ7A 3IAM1 2BS2B 1KF6B 1JALA 2MJ3A 4US9A 4ZHOA 5C2TB 5TSSA 1T6BX 3Q8BA 1JWAD 1ZXHA 4N6EB 3W9CB 1CK1A 4NAWB 1JQ4A 1YQ4B 5GXGB 4A9AA 3NUHB 4RNAA 4US8A 2LMCA 2WXNA 1QOBA 4KGTA 2L52A 3AMZA 4N58A 5I4DA 2CJOA 1PGAA 3EGRA 2E3TA 1ZP0B 2PVOD 3AEEB 4DXFA 2OHFA 2BB6A 2D5GA 3HVDA 3MHZA 1GB4A 1FFUA 5C3JB 1SEBD 1VR9A 1FEHA 5MPOA 1LO5D 1MVKA 3R2TA 1K53A 2QIEB 1SSNA 4HRSA 5BYSA 3U4EG 1TS4A 1XCQL 3AV8A 2Y3AA 4RF1A 1SB3C 2QJLA 2WXFA 3FC4A 3KWVA 4B0EA 1J7BA 1N5WA 4HEA1 2WXPA 1RFKA 3BYYB 4GDKB 1QOAA 4WH4A 3BYTB 1MPEA 2INNE 2LHEA 2BS3B 2MEKA 3HVZA 3AN1A 4GDLB 3BWUD 3P63A 2LFIA 4JPSA 1AW7A 1ACCA 1YQ3B 3BK1A 1N63A 3ZQ4A 4TQ0A 4ZYSA 2WXRA 4RF0A 4LTUA 1N61A 1XXGA 1BXTA 1NEKB 3AECB 3GS2A 4REZA 2JXTA 1FNWA 1SXTA 1QOFA 1UGJA 1GB1A 3BZDB 1FCCC 4RCOA 4WURA 4IKGA 5D3DA 2B76B 1ZOYB 4H2AA 1V1PB 2NTSA 3ZGZA 1JWUD 2JWUA 1D4BA 1KFYB 2W3SA 3U2SC 1XEEA 3T3NA 2TSSA 3NVYA 4C56C 2IDYA 1DGJA 2MJEA 2PMVA 4TQ1A 1D6EC 1E9MA 1I4RA 2SAKA 2YEPB 1R7SA 2EKIA 1QF6A 2VZKD 2KWDA 1FRDA 2WP9B 1TKGA 3SR6A 3B2FA 2I2YA 2J42A 1F77A 1XLQA 3AEDB 1SE3A 3I9V1 4ZRQA 1FNVA 1I4HA 1WRIA 3AEBB 2J52A 4PT5A 5EE9A 3W5UB 1PUTA 1V8CA 2W82A 2ZW1A 4J3OD 1VZ8A 2QSDA 1QILA 4AS1A 2WXJA 2JU6X 2E6XA 4OW0A 2RDHA 1SF0A 1TKEA 2BBCA 1EWYC 1EU4A 1I4PA 4B0MA 2J53A 1FNUA 4Q2JA 3PZ8A 1AWDA 1TY0A 4RGTA 3AE8B 2L83A 2Y5PA 4YSZB 4HJGE 1ET9A 4C7ZA 2W3RA 1I7HA 5LNK1 1I4XA 4XDDA 1ENFA 1QT9A 1L0YB 2IGDA 3TEXA 4YT0B 4YTMB 3V05A 1PYWD 2LHDA 2J4XA 1N5XA 1FXAA 4A6QA 3TEWA 1JWSD 1V1OA 4ARIA 3ETRA 3RFZB 1EWCA 3SEBA 4KGRA 1IGCA 2DWQA 1WSPA 2LUMA 3NZ3A 1V1PA 2FUG1 2QMTA 2CU3A 3P4SB 1QKZA 3W1SA 3OWEB 4WWMA 2WXKA 3FAHA 1I4GA 1L6UA 3VR8B 1HZ5A 1ZDXA 4DXGA 2N9KA 1DYQA 4OZCA 2XNAC 2LGIA 4CQNA 1GOZA 1L4ZB 1DOIA 1MI0A 4L1BA 1C78A 4ZRPA 3J9CA 3U52E 4A55A 3LYYA 2DYMA 1NI3A 4A8XC 2M0AA 1OFFA 2X38A 2BT6A 3EA6A 1HEZE 1TYGB 2INPE 3MJ5A 1NENB 3DWGC 5BYRA 1IGDA 4XE0A 1F2RC 1GPXA 1QQRA 4C7YA 3FILB 1A70A 1PDXA 3R8BA 4NZLB 2HDEA 4A90A 1M4VA 2N9LA 1GAQB 2M56B 1IUEA 4KKIA 4LLGM 5AUKA 1HA5A 3B2GA 1K50A 2KAJA 5AUIA 1OQRA 3UI3A 2NTTA 2RMMA 4L23A 1UWMA 2H89B 3BIID 3AM9A 1WGKA 3VRAB 2GI9A 2XN9C 3NVZA 3Q8FA 1N60A 1VLBA 1MHXA 2WXMA 3P4QB 1XLOA 4P6VF 1MHHE 1YN3A 4ZOHC 3SFDB 4O1NA 3KWLA 3ZYYX 5BMHA 1ET6A 2BYTA 1BUIC 1D5MC 2L32A 3URYA 3CWIA 2WQYB 1SE2A 3B9JA 4TSSA 1EU3A 1RM6C 2I38A 3LB8C 1B9RA 1CZPA 3Q8CA 5FK9C 1AN8A 1YN4A 1L0VB 1VDVA 3T3OA 2WXHA 1PGXA 1B1ZA 1KRHA 3AE1B 3AH7A 4RGNA 1C9FA 4XWTA 2AQ3B 2WDRB 1P7EA 4USAA 4P16A 3C8YA 2WU2B 4D2KA 4XWWA 1D5ZC 3ZJTA 3MP9A 1JWMD 3BK2A 2JSVX 2Y5CA 4KGSA 1FD6A 2FE8A 2LJIA 2WXIA 2V0GA 2KQ4X 3IAS1 2PKOA 4FXCA 2KACA 1STEA 3HRDD 5G5HA 1DOXA 2YEPF 3FILA 3E56A 1OQQA 1N62A 2PLPA 2WXLA 2VZKB 4WQMA 5JXVA 2ON8A 1TS3A 5EE3A 3MFGA 2AQ1B 3SFEB 4RGOS 5D3IB 2CJNA 4LK0M 2R61A 1TZOA 4GLSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P63 A;  3AE2 B;  1FXI A;  3P1M A;  1YQ3 B;  2FBW B;  2HTM E;  4N59 A;  1N63 A;  1NI3 A;  1DOY A;  1ZXI A;  3NVV A;  4LTU A;  1FIQ A;  1N61 A;  1OFF A;  1WWT A;  3AE3 B;  2BT6 A;  1NEK B;  3AEC B;  3AEF B;  5H8Y E;  1TYG B;  1XO3 A;  3RPF C;  1NEN B;  3DWG C;  4JWS C;  4YTN B;  3ABV B;  1XLN A;  2BS4 B;  1WYG A;  1QOF A;  2W55 A;  1NYR A;  3PO0 A;  1GPX A;  4C7Y A;  1J7C A;  1A70 A;  1PDX A;  1ZOY B;  2B76 B;  4JX1 C;  2JX5 A;  5EE1 A;  3W5V B;  1GAQ B;  2WLB A;  3AEG B;  1TKY A;  5G5G A;  1PFD A;  1IUE A;  1KFY B;  1FMA D;  2M56 B;  2W3S A;  3NVY A;  3AE9 B;  3HUI A;  4KX6 B;  2WDV B;  1ZUD 2;  2G1E A;  1TJE A;  1T3Q A;  1L5P A;  2K22 A;  5AUK A;  2MJE A;  1DGJ A;  1E6E B;  3B2G A;  3VR9 B;  2PVG C;  1NYQ A;  1E10 A;  2KAJ A;  2AX5 A;  5AUI A;  1E9M A;  1OQR A;  1QF6 A;  1R7S A;  2EKI A;  1UWM A;  2H89 B;  3BII D;  4YTP B;  4YSX B;  1FRD A;  2WP9 B;  3AM9 A;  1TKG A;  3AB5 A;  3L4P A;  3SR6 A;  1WGK A;  3B2F A;  3VRA B;  1FM0 D;  2H88 B;  2MJD A;  1YJJ A;  3AE7 B;  4YSY B;  3DWM A;  3NVZ A;  1N60 A;  1VLB A;  2WS3 B;  2K5P A;  3EUB 2;  1XLQ A;  3AE5 B;  1V97 A;  3P4Q B;  1VJK A;  1JRP A;  2M19 A;  3AED B;  1XLO A;  4P6V F;  1JW9 D;  3NVW A;  4ZOH C;  3SFD B;  3VRB B;  1RYJ A;  1WRI A;  3KWL A;  3P4P B;  3ZYY X;  5EE0 A;  1F0Z A;  1E0Z A;  3AEB B;  4ITK A;  5EE9 A;  3W5U B;  1PUT A;  1V8C A;  2ACZ B;  4JWU C;  1FO4 A;  1CJE A;  4IDI A;  1SIJ A;  3CWI A;  1AYF A;  1QOG A;  1YJI A;  2WQY B;  5H92 C;  3B9J A;  2BS2 B;  1RM6 C;  2Q5W D;  3LB8 C;  1B9R A;  1KF6 B;  1JAL A;  1CZP A;  2MJ3 A;  4US9 A;  4ZHO A;  1SF0 A;  2LEK A;  5C2T B;  1L0V B;  1VDV A;  1TKE A;  1E7P B;  1JWA D;  1EWY C;  1QLB B;  3AE6 B;  4N6E B;  3W9C B;  3NRZ A;  1JRO A;  1YQ4 B;  1FFV A;  1KRH A;  3AE1 B;  5GXG B;  1JQ4 A;  1ROE A;  4A9A A;  1AWD A;  3AH7 A;  1J7A A;  4ZHP A;  4US8 A;  2MH7 A;  3AE8 B;  2L83 A;  4YSZ B;  1QOB A;  4C7Z A;  2L52 A;  3AMZ A;  4N58 A;  2W3R A;  2WDR B;  1I7H A;  2CJO A;  1JWB D;  3AEA B;  2E3T A;  1XLP A;  1ZP0 B;  4USA A;  2PVO D;  1QT9 A;  3AEE B;  3LXF A;  2WU2 B;  2OHF A;  4YT0 B;  4YTM B;  2Y5C A;  1FFU A;  1N5X A;  5C3J B;  1FRR A;  1FXA A;  2PIA A;  1L6V A;  1WXQ A;  5MPO A;  1RWS A;  2QIE B;  2PKO A;  4HRS A;  4FXC A;  3ETR A;  3AV8 A;  3HRD D;  5G5H A;  2DWQ A;  3AE4 B;  4C80 A;  1DOX A;  2K9X A;  1OQQ A;  1N62 A;  4WQM A;  2CU3 A;  1SB3 C;  2QJL A;  3CIR B;  3FC4 A;  1NVI D;  2JQR B;  3P4S B;  2N0S B;  4HRO A;  4WWM A;  3FAH A;  2WDQ B;  1L6U A;  3VR8 B;  1J7B A;  1N5W A;  4YXD B;  2WU5 B;  5EE3 A;  2W54 A;  2DBY A;  1RFK A;  3SFE B;  1QOA A;  1DOI A;  2CJN A;  3NS1 A;  2BS3 B;  2KMM A;  3HVZ A;  3WCQ A;  3AN1 A;  3P4R B; 
#chains in the Genus database with same CATH topology
 4RM9 A;  4HXD A;  4MDK E;  1U4A A;  3DCG A;  4OVU A;  4GSW A;  4EEW A;  3ZNG C;  2OJR A;  4DHJ D;  5HHD G;  3PO0 A;  2CHZ A;  3DHG C;  3QX1 A;  2XK5 A;  1Z2M A;  4FJV B;  3U8Z A;  1YX6 B;  2EEL A;  2QCZ A;  3UGB B;  5BMI A;  1E5W A;  2OJW A;  3U7Z A;  3ENE A;  3ZJV A;  1FXT B;  3HUI A;  3OJ3 A;  1TJE A;  2RGF A;  1K52 A;  1E10 A;  2ZPN A;  1R4N I;  3CST A;  2O6V A;  2O2V B;  1TGZ B;  3CF6 E;  3BVM A;  3IT6 B;  2LWP A;  1H8C A;  2H88 B;  4FLH A;  2K5P A;  2BKF A;  1E8X A;  1VJK A;  1JRP A;  2M19 A;  3TSS A;  3NVW A;  3RNE C;  1E0Z A;  4LNI A;  2WX0 A;  2ACZ B;  4BKS A;  2JRI B;  1GNU A;  5HI1 A;  3MC0 B;  3E9S A;  2KFJ A;  2IPK D;  3IXS A;  1E7P B;  3PVL A;  2DLB A;  3PRE A;  1ZE3 D;  5DCN A;  1F1H A;  2LAS A;  4ZHP A;  2EMS A;  2FCN A;  3Q8A A;  2BW2 A;  4LNK A;  3PZD A;  3VTU A;  1UGM A;  2RDG A;  1HQR D;  1XF5 L;  2INC C;  1FRR A;  3W2D A;  1P0R A;  4KDL B;  5IKC M;  1RWS A;  5BYQ A;  3RI7 C;  2KTF A;  4KZ0 A;  1CQV A;  4C80 A;  3AE4 B;  3PHW B;  2K9X A;  2VH2 A;  2Z59 B;  2ZPY A;  5CHW A;  1NVI D;  2IGG A;  1YMH E;  1C4C A;  4BOZ B;  1WXV A;  2WXO A;  3O13 A;  3WCQ A;  2KMM A;  3R2I A;  3WAO A;  2PW9 A;  3A4R A;  2JXX A;  3P4R B;  1V80 A;  1TIF A;  3VQI A;  2OED A;  1WFY A;  3KUZ A;  3JSV B;  3UQA A;  2MW5 A;  3AI5 A;  5D94 A;  4JWS C;  3W1S C;  3GZN B;  2W55 A;  1SGH A;  1NYR A;  1J7C A;  4CYE A;  2WHI A;  2JX5 A;  3ZKJ C;  3HIZ A;  3SDL C;  3AEG B;  2QC8 A;  2LVP A;  2CHW A;  1WXM A;  4NQK E;  5HKH A;  2NMQ A;  3QWZ B;  4IOI E;  3L08 A;  4MT5 A;  5IAA C;  2BKR B;  4F7Z A;  5IN7 A;  4YSX B;  2LVQ A;  2L1A A;  1L0X B;  4FHJ A;  2DX5 B;  1Q10 A;  4RM8 A;  1RYJ A;  4NJC A;  4ZDV A;  1IBX A;  1HZ6 A;  2DAF A;  1QOG A;  5H92 C;  3EHV A;  1T0Y A;  1KF6 B;  4ZHO A;  1T6B X;  3W9C B;  4CO7 A;  4MH0 E;  5GXG B;  4EZL A;  3T9L A;  3NUH B;  1HTQ A;  4WJN A;  2KDB A;  3W1Y A;  1QOB A;  4ICV A;  2L52 A;  3AMZ A;  4KGT A;  2PVO D;  4DXF A;  2IY1 B;  2BB6 A;  3HVD A;  3MHZ A;  2L8J A;  3RNG C;  3ZRF A;  5J2R A;  1FEH A;  2NPT A;  3R2T A;  1C3T A;  2QIE B;  3U4E G;  1XCQ L;  3AV8 A;  3A33 B;  4NJ7 A;  4RF1 A;  4B9K A;  2PPH A;  1SB3 C;  2WXF A;  2RPQ A;  4AP4 C;  4HEA 1;  2WXP A;  2L76 A;  3BYT B;  2INN E;  3VTV A;  3HVZ A;  3PRM B;  1YQ3 B;  1N63 A;  1YOV B;  4RF0 A;  4X57 B;  2JXT A;  2V4L A;  5AZG A;  2DAJ A;  3BZD B;  4WUR A;  4IKG A;  2BQQ A;  2NTS A;  3ZGZ A;  3C19 A;  1R4N B;  3L13 A;  1KFY B;  2W3S A;  2KTR B;  4BVU C;  4ZRJ A;  2IDY A;  3MTN B;  3R66 C;  4N9F 4;  1WM2 A;  3HM3 A;  4K7S A;  2CKH B;  1I4R A;  1QF6 A;  2ZEQ A;  2GBR A;  2L05 A;  2HE7 A;  1WGR A;  4QAY A;  3RN9 C;  3ZTD A;  5KHO A;  3ZLZ A;  4JGH B;  4ZRQ A;  1H4R A;  1UF0 A;  5EE9 A;  2ZW1 A;  3H1U A;  1WMH A;  4C4V A;  3H7S A;  4BZA A;  2G4D B;  1SF0 A;  2M0X A;  1EWY C;  4Q2J A;  4II2 B;  1TTN A;  4GDK A;  2W3R A;  4K7U A;  1I7H A;  2LZ6 A;  1E7V A;  1L0Y B;  2IGD A;  2DZI A;  3V05 A;  4YTM B;  2J7Q B;  2V1Y A;  3TEW A;  1V1O A;  4ARI A;  3WA0 A;  1EWC A;  4KGR A;  1WSP A;  2LUM A;  3L10 B;  3M63 B;  3NZ3 A;  1V1P A;  2KWU B;  3QC8 B;  1I4G A;  3NJT A;  2LGI A;  1GOZ A;  1DOI A;  1MI0 A;  4KIK A;  3TL5 A;  3QQ8 B;  1C78 A;  4IM2 A;  4MSM B;  4B6W A;  2DYM A;  3SHQ A;  4A8X C;  1HEZ E;  1TYG B;  3DWG C;  4BKT A;  3Q2A C;  2B3A A;  1LFD A;  3B08 A;  1A70 A;  2KC2 A;  2KDF B;  2BVC A;  4A90 A;  3VHT C;  4K3B A;  1IUE A;  2LGY A;  5AUK A;  3LDZ E;  2MBE A;  3UI3 A;  4L23 A;  1UWM A;  2H89 B;  2CR5 A;  3ZDT A;  2WX1 A;  1Q0W B;  1WGK A;  2D07 B;  2MX2 A;  3ML9 A;  1VLB A;  1MHX A;  3P4Q B;  4P6V F;  1YN3 A;  5BMH A;  1Y8R C;  1XQQ A;  2L32 A;  1I35 A;  1QZE A;  1SE2 A;  2KO3 A;  3B9J A;  1RM6 C;  1WX7 A;  3C0R B;  2DYB A;  2WXH A;  3WAL A;  3ONS A;  1L7Y A;  3AE1 B;  2LXA A;  4RGN A;  2AWT A;  1J0G A;  1Q1O A;  3V6C B;  2IY0 B;  1V9J A;  1WXS A;  2FCM A;  1OEY J;  4G0N B;  1WGY A;  5AZH A;  1JWM D;  2Y5C A;  2FCQ A;  3VDZ A;  3D32 A;  3MC8 A;  3M3J A;  2VZK B;  1WE6 A;  1V5O A;  1TS3 A;  2DEN B;  3DBS A;  4E3C A;  2GBM A;  2YLM A;  3MFG A;  5D3I B;  4HK2 A;  3RNF C;  5IOI A;  2R61 A;  3BVG A;  3MJ5 A;  5IO9 A;  4R3D A;  4MGK E;  2IJ0 A;  2IO3 B;  3B1L X;  3NVV A;  3AE3 B;  3EEC A;  3OJ4 B;  1XLN A;  2BYV E;  2NVU I;  2OOB B;  1PGB A;  5CX3 A;  4AOF A;  3QIJ A;  2KX0 A;  2IZV B;  5FR3 A;  2BPS A;  1FMA D;  4LDT D;  2SEB D;  3A4S C;  4MAC A;  3JVZ X;  2KD0 A;  2KJR A;  2NS5 A;  3U30 A;  3I57 A;  4LJP B;  2KN5 A;  1AAR A;  3P2B A;  1ZDV A;  3DVN U;  2MJD A;  1KM7 A;  4LNO A;  3DOW A;  4MGY E;  3VH3 B;  2RPV A;  3TEZ A;  1C79 A;  1SIJ A;  2IO0 B;  3MHS D;  2FAZ A;  1GG3 A;  1JRO A;  2JRH A;  3TEY A;  3KYD D;  4NNJ B;  4KV2 A;  3RUL A;  1RRB A;  1JWB D;  1XLP A;  2D3G A;  4OVV A;  2PIA A;  4OHJ A;  1GUA B;  2LVO A;  4W9D A;  2KKC A;  1J19 A;  1SJE D;  3ZRC A;  4HKQ A;  2KFK B;  2KLC A;  3N1X C;  4XGA B;  5DPW A;  1E8W A;  1KH0 A;  1WH3 A;  3P42 A;  2C5L C;  3H8H A;  1EM7 A;  4KSK C;  4OVZ A;  3GB1 A;  3ZVV A;  3AE2 B;  3KLS X;  2NBW B;  3A9J B;  4AQ7 A;  2HTM E;  1UWX A;  2KQS A;  1DOY A;  1UD7 A;  2WNM A;  2N7E A;  3RNC C;  1XO3 A;  4XDC A;  3VH4 B;  3ZUN A;  3V61 A;  4ZRK A;  1E90 A;  1ZKH A;  2N7J A;  3APC A;  4NAM A;  1E8Y A;  1L4D B;  1ISN A;  3NOB A;  3RNB C;  1MJD A;  2WDV B;  2GRI A;  2JY6 A;  4ANW A;  3V60 A;  4EE2 A;  5L95 C;  4KZC A;  3A1Q B;  1NYQ A;  3R7Q A;  4GB9 A;  4YTP B;  1S1Q B;  3L4P A;  1VCB A;  4W9I A;  1TS5 A;  1P98 A;  3KYC D;  2KMA A;  1V97 A;  4M8N A;  1YNT E;  5JHA A;  5T8I A;  2KXJ A;  4DDG D;  2BS2 B;  1R4M I;  4EZJ A;  1JAL A;  1Q5W B;  4US9 A;  4GOC A;  5C2T B;  1JWA D;  2DNF A;  2ZVN A;  4N6E B;  1VD2 A;  4NAW B;  1JQ4 A;  4GXB A;  3ML8 A;  2Z0D B;  3N1Z C;  2WXN A;  3I63 C;  5I4D A;  2CJO A;  4DHJ B;  2NR2 A;  5IA7 A;  3EGR A;  1WF9 A;  3ZTC A;  3AEE B;  3IBE A;  1WXA A;  1XT9 B;  3JSV A;  3N30 A;  1V6E A;  5C3J B;  1SEB D;  1LO5 D;  1K53 A;  2MRP A;  4HRS A;  3N20 C;  1TS4 A;  2BWE S;  3IHP C;  2Y3A A;  3RZF A;  4P7I A;  3KWV A;  2HTH A;  3GE3 C;  1J7B A;  2N9X A;  2D3A A;  2A5U A;  4ACF A;  3BYY B;  4WH4 A;  1MPE A;  2LHE A;  2NBU A;  4MM3 A;  2MEK A;  1WI0 A;  1K8R B;  3H9D A;  3SD5 A;  2BYF A;  3P63 A;  2I1K A;  2J0M A;  1ACC A;  2O6V D;  2LUE A;  3BY4 B;  4ZYS A;  1N61 A;  1NEK B;  2G45 B;  1TT5 B;  1V5T A;  2D3C A;  4RCO A;  1WJ6 A;  5D3D A;  2B76 B;  2K1F A;  1D4B A;  3U2S C;  1XEE A;  3T3N A;  4BKS D;  1DGJ A;  2K25 A;  3AXC A;  3FKY A;  3OG5 A;  1ZW7 A;  4GU2 A;  4WJQ A;  1R7S A;  4TUU A;  4AJY B;  2KWD A;  3Q14 C;  1FRD A;  1TKG A;  3SR6 A;  1F77 A;  1YX5 B;  3QHT A;  1XLQ A;  4WQO B;  1WJN A;  1FNV A;  3QA8 A;  1PUT A;  1V8C A;  2W82 A;  2L0T A;  4AS1 A;  2WXJ A;  2JU6 X;  2JPH A;  3QCA A;  4OW0 A;  3AUL A;  1TKE A;  4B0M A;  1I4P A;  3T8M A;  4MEL A;  3UIP B;  2J53 A;  1FNU A;  2KT7 A;  3K9O B;  3PV1 A;  3BIN A;  1WX8 A;  4RGT A;  2JZZ A;  1XD3 B;  3N1Y C;  4HJG E;  4C7Z A;  4FBJ B;  2HJ1 A;  5LNK 1;  1I4X A;  1ENF A;  1QT9 A;  4C00 A;  3HK0 A;  1OQY A;  2DZJ A;  4A6Q A;  1CMX B;  3ETR A;  3RFZ B;  3KUD B;  1IGC A;  4WWP A;  4CHK A;  2QMT A;  3P4S B;  4IM3 A;  3OWE B;  1WM3 A;  2KVZ A;  4M8M A;  1HZ5 A;  4PS7 A;  4DXG A;  2KTR A;  1V49 A;  2K39 A;  3WAP A;  4G11 A;  2A4Z A;  2CHX A;  2GLS A;  3Q3F A;  4NY0 A;  4K7W A;  2N9E B;  4GN1 A;  2M0A A;  2C60 A;  3JYU A;  2BT6 A;  1T0Q C;  3EA6 A;  5BYR A;  1OGW A;  2K8H A;  1F2R C;  3OAW A;  2HDE A;  2LXC A;  1UBI A;  2N9L A;  1V81 A;  1GAQ B;  4F8C B;  2M56 B;  4S17 A;  4KKI A;  3U7D A;  2AL6 A;  2KAJ A;  2KWC A;  2GMI C;  1TBE A;  4XZ4 A;  3AM9 A;  2GI9 A;  4PS3 A;  1N60 A;  1MHH E;  2N1W A;  5E6N A;  3ZIM A;  3KW5 B;  5EDS A;  2XBB C;  2BYT A;  1BUI C;  3B0A A;  3URY A;  4HPM B;  4IWP A;  2WQY B;  2NCN A;  4K81 A;  4FJZ A;  2I38 A;  1CZP A;  4E71 A;  1L0V B;  1VDV A;  4A20 A;  4XYC A;  4HCP B;  2MP2 B;  2N9P C;  2AQ3 B;  3PLU A;  4PYZ A;  3A9K B;  4B95 A;  3Q3O C;  4KGS A;  4ANV A;  2LJI A;  3I5J C;  1WIA A;  2KQ4 X;  3IAS 1;  2V9H A;  2LI5 A;  2LRU A;  2KAC A;  1UH6 A;  2ZNV C;  3HRD D;  2NPT B;  3E56 A;  4HWI B;  2HJ8 A;  2MBB B;  3PTF C;  2C7N B;  3ZO5 B;  4AUQ C;  5EE3 A;  3WAM A;  4GDL A;  2FID A;  4LK0 M;  4G50 A;  1TZO A;  3P1M A;  2D2Q A;  2FBW B;  2V4I B;  4ARC A;  3AEF B;  1WYG A;  2MBH A;  3PT2 B;  5KHQ A;  4JX1 C;  1C77 A;  1NDD A;  2X8X X;  2BYE A;  1YN5 A;  2YVC A;  2Z8L A;  1L5P A;  1T3Q A;  2PVG C;  3NZS A;  2AX5 A;  1IYF A;  2DHZ A;  4TMA B;  3UIN B;  4WAA A;  1YJJ A;  2LJ5 A;  4JLC A;  4M0W A;  4E74 A;  4HDQ A;  3RCZ A;  1SE4 A;  2KMC A;  4RMA A;  4FN2 A;  2PEA A;  2GB1 A;  4MH8 A;  1SBB B;  1NI2 A;  3P4P B;  4IW0 A;  1UUP A;  3APD A;  4ITK A;  5E6P A;  2AYO B;  1CJE A;  4IDI A;  2DZK A;  5JH5 C;  2ZCC A;  2LEK A;  4TKN A;  5HG2 A;  4PS8 A;  1QLB B;  1UEL A;  1ZGU B;  3AE6 B;  4DXA B;  1MFW A;  1LM8 B;  1FFV A;  1YJ1 A;  4KDI C;  1J7A A;  3R7R A;  3DDC B;  3AEA B;  4W9E A;  4FA6 A;  4MJS B;  1YD8 U;  3TUO A;  3ZJU A;  1F52 A;  4XX5 A;  1WR1 A;  5GMV A;  4A3O A;  2RSU A;  1KTK A;  3CIR B;  3KQ4 A;  3R3M A;  4OZA A;  1LQB A;  2WDQ B;  3VXW A;  4YXD B;  4WJO A;  2JF5 A;  2W54 A;  5D7G A;  2BB5 A;  1KOT A;  4BOS C;  3ZW3 A;  2V3N A;  3NS1 A;  5DPT A;  3V6E B;  3ZNH B;  4DK5 A;  3IT4 B;  1VRA B;  2R2O A;  1F2R I;  4KIK B;  4ZRI A;  5FR6 A;  1YQB A;  1FIQ A;  5H8Y E;  3RD2 A;  3RPF C;  4HCN B;  1UNS A;  2WWZ A;  4G3X B;  2BTE A;  4WWN A;  4W9C A;  1P1A A;  1WYW B;  2NBV B;  5BO4 B;  1C76 A;  3W5V B;  4J6I A;  2MBQ A;  5G5G A;  4ZYN A;  1JCK B;  4K3C A;  1ZUD 2;  2G1E A;  4EOY A;  1HXY D;  1E6E B;  3VR9 B;  1BML C;  1WX9 A;  2UYZ B;  3AB5 A;  4ANX A;  1WR6 E;  3AE7 B;  2KAN A;  2KK8 A;  5BMG A;  3AE5 B;  4YWG G;  3L16 A;  1F0Z A;  1FO4 A;  1T0R C;  2V3P A;  3N32 A;  4MSQ B;  2AQ2 B;  3PZ7 A;  2JUO A;  3RUI B;  2KFK A;  3Q8B A;  4JL9 A;  1ZXH A;  1IPG A;  1J8C A;  4A9A A;  2LMC A;  4N58 A;  2C7M B;  4MGZ E;  1P3Q U;  1KJT A;  4I6N B;  2OHF A;  2D5G A;  2JWZ A;  1WRD B;  1FFU A;  2CS4 A;  2JT4 B;  4KVG B;  4LDT B;  5BYS A;  1WGG A;  2AL3 A;  4EUT A;  2J0K A;  2QJL A;  2K6Q A;  4TV3 A;  1N5W A;  4FJY A;  1RFK A;  3A1Q A;  1QOA A;  2PE9 A;  2V3S A;  2BS3 B;  1P9D U;  4DWF A;  2ASQ A;  3HM6 X;  3BWU D;  3WAN A;  2Z0E B;  3IFW B;  3ZQ4 A;  4LTU A;  3X0W A;  3AEC B;  4REZ A;  3GS2 A;  4W9K A;  2KDE B;  1FNW A;  1SXT A;  1QOF A;  3CMM B;  1GB1 A;  5D6J B;  1FCC C;  4M01 A;  3UIO B;  5D2M B;  3VUY A;  2FUH B;  1JWU D;  2TSS A;  3NVY A;  3ZXR A;  2O2V A;  1EUV B;  1EF5 A;  2PMV A;  4ANU A;  1E9M A;  2YEP B;  5LXH A;  3VUX A;  2WP9 B;  3RYT A;  5DPS A;  1M94 A;  2KJH B;  2L7R A;  4LJO B;  5JHB A;  3DVN V;  4KSL C;  1WZ3 A;  1SE3 A;  4DBG A;  1I4H A;  3AEB B;  2J52 A;  4PT5 A;  1S3S G;  3W5U B;  4J3O D;  4K1R B;  2E6X A;  3ZNI D;  1MG8 A;  2RDH A;  2UU7 A;  2BBC A;  1EU4 A;  2C7H A;  3PZ8 A;  2N4F A;  2QHO A;  1TY0 A;  3AE8 B;  4YSZ B;  2D11 A;  2KYW A;  1Z5S B;  4XDD A;  1PQS A;  3H7P B;  4YT0 B;  2N1V A;  2LHD A;  4W9L A;  4NQL B;  2J4X A;  3RNA C;  2D3B A;  5IP4 D;  2KX3 A;  1JWS D;  4IWO A;  3QJZ A;  3L0W B;  2QDF A;  2FUG 1;  4HJK A;  3NS8 A;  3ZNZ B;  5TR5 A;  2MLB A;  3LJ3 A;  2WXK A;  2N9K A;  1DYQ A;  4OZC A;  2XNA C;  1IP9 A;  4CQN A;  1WZ0 A;  1L4Z B;  3PHX B;  2KHW B;  3U52 E;  4EZK A;  3KUC B;  1NI3 A;  1OFF A;  2ZVO A;  4MGI E;  2INP E;  3APF A;  1IGD A;  2K8C A;  5CHV C;  5G55 A;  1GPX A;  1QQR A;  3M95 A;  3DBR I;  2EKE C;  3FIL B;  4W9H A;  5CTR C;  4NZL B;  1HE8 A;  1M4V A;  3PRZ A;  3VVW B;  4EFO A;  3B2G A;  5L83 A;  1K50 A;  4F1S A;  4PYU A;  2ZZP B;  4IC7 B;  3TBL D;  1E7U A;  2RMM A;  1WY8 A;  2G4S A;  1HTO A;  3BII D;  3JW0 X;  3VRA B;  2XN9 C;  3Q8F A;  2M8S A;  2REX A;  1GC7 A;  2WXM A;  3S2A A;  3Q6B A;  4ZOH C;  3SFD B;  4O1N A;  5J18 A;  1ET6 A;  2XK5 B;  5E6O A;  4M02 A;  2I1J A;  4LCD E;  5FK9 C;  5DPR A;  1AN8 A;  1KLV A;  3T3O A;  3L17 A;  2O6V B;  1B1Z A;  1KRH A;  3GOE A;  1LXD A;  2ZNV B;  4IWQ A;  2MHJ A;  3DHH C;  1X1M A;  3C8Y A;  1LGR A;  2WU2 B;  4XWW A;  3ZJT A;  3MP9 A;  1UBQ A;  3BK2 A;  2JSV X;  1FD6 A;  3ECI A;  2V0G A;  2KNB A;  2KLG A;  1N62 A;  2WXL A;  4WQM A;  5JXV A;  3O65 B;  2IND C;  2WGS A;  3NY5 A;  3DPD A;  4YL8 A;  2AQ1 B;  4RGO S;  5AZF A;  4FAD A;  1Y56 A;  4MM3 B;  2RR9 A;  1SE9 A;  2WYQ A;  4AJW A;  2DYO A;  1JML A;  2WXQ A;  4KKJ A;  2FNJ B;  2PJH A;  2BS4 B;  4NJ6 A;  5G2N A;  1KLU D;  5EE1 A;  1VZ7 A;  1FCL A;  3V3X A;  2XEW A;  3AE9 B;  5LXI B;  3SU8 X;  4HKZ E;  4WAF A;  2K3U A;  2MP2 A;  3MC9 A;  3TMP B;  3PS6 A;  3V62 A;  3N3K B;  4UDU C;  1FM0 D;  2VH1 A;  1TS2 A;  4WWO A;  2WS3 B;  1TY2 A;  3EUB 2;  1ESF A;  2MSE D;  2ZW0 A;  3A9K A;  1JW9 D;  4LNN A;  3VRB B;  3N9Y C;  4JE3 B;  1WE7 A;  1T5X D;  2MWS B;  4JWU C;  1AYF A;  1YJI A;  3Q3N C;  2K0P A;  2Q5W D;  2MCN B;  1SJH D;  3L54 A;  4P1C C;  3DBH I;  2LGS A;  4FUL A;  3NRZ A;  2BF8 B;  2L3Z A;  2QEJ C;  2JZP A;  1ROE A;  4IG7 B;  2MH7 A;  2EMT A;  1KLG D;  3VUW A;  3LXF A;  1R4M B;  2G3Q B;  1G6J A;  4II3 B;  1SIF A;  1IBX B;  1L6V A;  1WXQ A;  4W9F A;  2LGD A;  2KJ6 A;  1I4Q A;  3NZU A;  2JYT A;  2CU1 A;  3IVF A;  2JQR B;  2N0S B;  4HRO A;  1WGD A;  1I42 A;  2WU5 B;  3DQV A;  2DBY A;  1EF1 A;  1GC6 A;  2IGH A;  5E6J A;  2KN4 A;  2ZCB A;  3GP7 A;  3ALB A;  3M62 B;  1FXI A;  2JYE A;  4N59 A;  5FKA C;  4RGM A;  4DQO C;  1ZXI A;  3DBR B;  1WWT A;  4YTN B;  3ABV B;  1C4P A;  3DHI C;  3VTW A;  3RT3 B;  2MQJ A;  4L2Y A;  4XC2 A;  2BWF A;  5CHF A;  2G9H D;  3RZW C;  2IBI B;  2WLB A;  4OZB A;  4DDI D;  1TKY A;  4RH6 A;  1PFD A;  2QIL A;  1D5X C;  5HFY A;  4KX6 B;  3Q8E A;  3Q69 A;  3GE8 C;  2K22 A;  1ZPS A;  2GBJ A;  1VZ6 A;  1K51 A;  2MA9 B;  3AU5 A;  2KDI A;  3KH0 A;  3DVG X;  2PTL A;  1RAX A;  1EO6 A;  4WIP A;  4YSY B;  3VAW A;  3DWM A;  2WXG A;  4IM0 A;  1WJU A;  4MJS A;  1WGH A;  2ZJD A;  3DBL I;  1P7F A;  1XCT L;  1JRU A;  2ICI A;  4RFB A;  5EE0 A;  4JIO U;  3BVZ A;  2KDM A;  2C9W B;  1GJZ A;  1C4A A;  2ONQ A;  2L00 B;  2RD0 A;  3IAM 1;  2R2Q A;  2MJ3 A;  5TSS A;  3TJP A;  1E8Z A;  1CK1 A;  1YQ4 B;  2GBN A;  2KZR A;  4GIV A;  4RNA A;  2N7D A;  3PLV A;  4US8 A;  3UQB A;  2K8B A;  2VRR B;  1PGA A;  2E3T A;  1ZP0 B;  1GB4 A;  4A3P A;  1YIW A;  1VR9 A;  4MEM A;  4JQW C;  1MVK A;  4BFR A;  5MPO A;  1SSN A;  1WMH B;  4HPL B;  4C4V B;  2JVC A;  1T0S C;  1TZ1 A;  3FC4 A;  4B0E A;  1D3Z A;  1V86 A;  4GDK B;  2KWV B;  4FHK A;  3AN1 A;  4GDL B;  1MG4 A;  2LFI A;  4JPS A;  3NG0 A;  1AW7 A;  3BK1 A;  5AEK B;  4TQ0 A;  2WXR A;  2FIF A;  1XXG A;  1BXT A;  2UWQ A;  3PSE B;  4GGQ A;  1UGJ A;  1FPY A;  1ZOY B;  4H2A A;  2JZ3 B;  1V1P B;  1V2Y A;  3H6N A;  2JWU A;  3QAQ A;  4C56 C;  2MJE A;  4PK1 A;  4TQ1 A;  2LRW A;  2BGF A;  1D6E C;  4ASW C;  2J0J A;  2SAK A;  2EKI A;  2VZK D;  4S0R A;  3B2F A;  2I2Y A;  2IYD B;  5LLI A;  3PRP B;  2J42 A;  3EFU A;  4P1B C;  4I6L B;  3AED B;  4M0W B;  3I9V 1;  2IO2 B;  1WRI A;  4BBN F;  1OEY A;  4HDO A;  1A5R A;  3Q3J A;  3DBH B;  1VZ8 A;  2QSD A;  1QIL A;  3Q3M C;  3WIM A;  3CSF A;  2LD9 A;  2IO1 B;  4AWJ A;  2K6D B;  2M4N A;  4I6P A;  1UZX B;  1AWD A;  2MBO A;  2L83 A;  2Y5P A;  1ET9 A;  3HHM A;  4IUM B;  5JZE B;  3TEX A;  1RLF A;  1PYW D;  2GOW A;  5C1Z A;  1N5X A;  1FXA A;  3OLM D;  4M00 A;  3KVF B;  3SEB A;  2KOX A;  2DWQ A;  2GBK A;  3IG3 A;  2CU3 A;  2PE6 B;  1QKZ A;  3W1S A;  4WWM A;  5C23 A;  3FAH A;  1L6U A;  3VR8 B;  1ZDX A;  3ZDM C;  4EKU A;  3K9P B;  3QAR A;  2KVR A;  4L1B A;  3PGE A;  3A9J A;  4DHZ E;  4GMV A;  4ZRP A;  2M17 A;  3J9C A;  4A55 A;  3LYY A;  5J17 A;  2X38 A;  2W9N A;  1NEN B;  4XE0 A;  3ZXV A;  4DHZ B;  4C7Y A;  1N6Z A;  2HD5 B;  1PDX A;  3TCA A;  3R8B A;  3EC8 A;  2WDT B;  3NHE B;  3GZN I;  3TIX A;  2M1M A;  1F9J A;  4LLG M;  3MJW A;  1HA5 A;  5AUI A;  1OQR A;  3I3T B;  2NTT A;  1RFA A;  2KC1 A;  4W9J A;  3RMK C;  3X23 A;  3DBL B;  3NVZ A;  4BAX A;  3H7P A;  1XLO A;  3PPA A;  4HVB A;  3KWL A;  3ZYY X;  1L2N A;  2FCS A;  1D5M C;  2DZM A;  4HPP A;  3AU4 A;  3CWI A;  4TSS A;  1EU3 A;  3LB8 C;  1B9R A;  1WJ4 A;  4NAW A;  3Q8C A;  3VFK A;  1YN4 A;  4W9G A;  4HLE A;  1PGX A;  2L0F A;  3AH7 A;  1C1Y B;  1C9F A;  4XWT A;  4LNF A;  3QK0 A;  4BKG A;  1BT0 A;  2WDR B;  2RDB C;  1P7E A;  4USA A;  1NBF C;  4P16 A;  2Y5B B;  4D2K A;  1D5Z C;  2KQ7 A;  4NPN A;  2LGX A;  2FE8 A;  2WXI A;  4ICU A;  2PKO A;  4FXC A;  1STE A;  5G5H A;  1OTR B;  1DOX A;  2YEP F;  3FIL A;  4BBN C;  1OQQ A;  2PLP A;  2AEH A;  2ON8 A;  3UF8 A;  3DVG Y;  3EFC A;  2D10 A;  3SFE B;  4WJP A;  2CJN A;  4URK A;  4GLS C; 
#chains in the Genus database with same CATH homology
 1Y56 A;  4R3D A;  4MM3 B;  3P1M A;  2IJ0 A;  2FBW B;  2V4I B;  3NVV A;  4ARC A;  2DYO A;  1JML A;  3AE3 B;  3AEF B;  2WXQ A;  4KKJ A;  3BVG A;  1XLN A;  2BS4 B;  1WYG A;  5HHD G;  3PO0 A;  1PGB A;  1KLU D;  2EEL A;  4JX1 C;  5BMI A;  5EE1 A;  3U7Z A;  1C77 A;  5FR3 A;  1VZ7 A;  1FCL A;  3V3X A;  1FMA D;  1YN5 A;  3ZJV A;  3AE9 B;  3HUI A;  2SEB D;  2Z8L A;  4MAC A;  1TJE A;  1L5P A;  1T3Q A;  1K52 A;  1E10 A;  2PVG C;  4HKZ E;  4WAF A;  2AX5 A;  2K3U A;  3I57 A;  3BVM A;  4TMA B;  3IT6 B;  4UDU C;  1ZDV A;  1FM0 D;  2H88 B;  2MJD A;  1YJJ A;  1TS2 A;  4M0W A;  2WS3 B;  1TY2 A;  2K5P A;  3EUB 2;  1SE4 A;  1VJK A;  1JRP A;  1ESF A;  2GB1 A;  2M19 A;  2ZW0 A;  1SBB B;  4MH8 A;  1JW9 D;  3TSS A;  3NVW A;  3VRB B;  3N9Y C;  3P4P B;  4JE3 B;  2RPV A;  3TEZ A;  1UUP A;  1E0Z A;  1T5X D;  4ITK A;  4JWU C;  2ACZ B;  1C79 A;  1CJE A;  4IDI A;  1SIJ A;  1AYF A;  1YJI A;  2K0P A;  5HI1 A;  3MC0 B;  3E9S A;  2Q5W D;  1SJH D;  2IPK D;  2LEK A;  3IXS A;  5HG2 A;  1E7P B;  1QLB B;  3AE6 B;  2DLB A;  3NRZ A;  1JRO A;  1FFV A;  1ZE3 D;  2QEJ C;  3TEY A;  2JZP A;  1ROE A;  1J7A A;  4ZHP A;  2MH7 A;  3Q8A A;  2BW2 A;  1KLG D;  1JWB D;  3AEA B;  2RDG A;  1XLP A;  3LXF A;  1HQR D;  1XF5 L;  3TUO A;  3ZJU A;  1FRR A;  2PIA A;  3W2D A;  1IBX B;  4OHJ A;  1L6V A;  1WXQ A;  1RWS A;  5BYQ A;  1I4Q A;  4EE2 A;  1CQV A;  4C80 A;  3AE4 B;  2JYT A;  2K9X A;  1SJE D;  4HKQ A;  1KTK A;  3CIR B;  3KQ4 A;  1NVI D;  2JQR B;  4OZA A;  2N0S B;  4HRO A;  2WDQ B;  2IGG A;  1YMH E;  4YXD B;  2WU5 B;  1KH0 A;  2W54 A;  2DBY A;  5D7G A;  3P42 A;  2BB5 A;  3H8H A;  1C4C A;  1EM7 A;  2WXO A;  4OVZ A;  3O13 A;  2V3N A;  3NS1 A;  3WCQ A;  2KMM A;  2IGH A;  3R2I A;  5E6J A;  2PW9 A;  3GB1 A;  2KN4 A;  3GP7 A;  3IT4 B;  3P4R B;  1VRA B;  3AE2 B;  3KLS X;  1F2R I;  3VQI A;  1FXI A;  2JYE A;  2OED A;  4AQ7 A;  2HTM E;  4N59 A;  5FKA C;  1UWX A;  4RGM A;  1DOY A;  4DQO C;  1ZXI A;  1FIQ A;  1WWT A;  2WNM A;  5H8Y E;  1XO3 A;  4XDC A;  3RPF C;  4YTN B;  4JWS C;  3ABV B;  1UNS A;  2W55 A;  1NYR A;  1C4P A;  2BTE A;  1J7C A;  4L2Y A;  2N7J A;  2JX5 A;  2G9H D;  1C76 A;  3W5V B;  2WLB A;  3AEG B;  4NAM A;  1TKY A;  1L4D B;  1JCK B;  1PFD A;  4OZB A;  4RH6 A;  5G5G A;  2QIL A;  1D5X C;  5HFY A;  4KX6 B;  2WDV B;  1ZUD 2;  2G1E A;  2GRI A;  3Q69 A;  3Q8E A;  2K22 A;  1HXY D;  1ZPS A;  2NMQ A;  1E6E B;  4IOI E;  3VR9 B;  4MT5 A;  1BML C;  1NYQ A;  1K51 A;  1VZ6 A;  4YSX B;  4YTP B;  2PTL A;  2L1A A;  3AB5 A;  3L4P A;  4WIP A;  1L0X B;  3AE7 B;  4YSY B;  1TS5 A;  3DWM A;  2WXG A;  5BMG A;  3AE5 B;  1V97 A;  4YWG G;  1Q10 A;  1P7F A;  1XCT L;  1RYJ A;  2ICI A;  1YNT E;  4NJC A;  4RFB A;  5EE0 A;  1HZ6 A;  1F0Z A;  1IBX A;  3BVZ A;  2KDM A;  5T8I A;  1FO4 A;  1QOG A;  5H92 C;  2V3P A;  2AQ2 B;  1C4A A;  2ONQ A;  3PZ7 A;  3IAM 1;  2BS2 B;  1KF6 B;  1JAL A;  2MJ3 A;  4US9 A;  4ZHO A;  5C2T B;  5TSS A;  1T6B X;  3Q8B A;  1JWA D;  1ZXH A;  4N6E B;  3W9C B;  1CK1 A;  4NAW B;  1JQ4 A;  1YQ4 B;  5GXG B;  4A9A A;  3NUH B;  4RNA A;  4US8 A;  2LMC A;  2WXN A;  1QOB A;  4KGT A;  2L52 A;  3AMZ A;  4N58 A;  5I4D A;  2CJO A;  1PGA A;  3EGR A;  2E3T A;  1ZP0 B;  2PVO D;  3AEE B;  4DXF A;  2OHF A;  2BB6 A;  2D5G A;  3HVD A;  3MHZ A;  1GB4 A;  1FFU A;  5C3J B;  1SEB D;  1VR9 A;  1FEH A;  5MPO A;  1LO5 D;  1MVK A;  3R2T A;  1K53 A;  2QIE B;  1SSN A;  4HRS A;  5BYS A;  3U4E G;  1TS4 A;  1XCQ L;  3AV8 A;  2Y3A A;  4RF1 A;  1SB3 C;  2QJL A;  2WXF A;  3FC4 A;  3KWV A;  4B0E A;  1J7B A;  1N5W A;  4HEA 1;  2WXP A;  1RFK A;  3BYY B;  4GDK B;  1QOA A;  4WH4 A;  3BYT B;  1MPE A;  2INN E;  2LHE A;  2BS3 B;  2MEK A;  3HVZ A;  3AN1 A;  4GDL B;  3BWU D;  3P63 A;  2LFI A;  4JPS A;  1AW7 A;  1ACC A;  1YQ3 B;  3BK1 A;  1N63 A;  3ZQ4 A;  4TQ0 A;  4ZYS A;  2WXR A;  4RF0 A;  4LTU A;  1N61 A;  1XXG A;  1BXT A;  1NEK B;  3AEC B;  3GS2 A;  4REZ A;  2JXT A;  1FNW A;  1SXT A;  1QOF A;  1UGJ A;  1GB1 A;  3BZD B;  1FCC C;  4RCO A;  4WUR A;  4IKG A;  5D3D A;  2B76 B;  1ZOY B;  4H2A A;  1V1P B;  2NTS A;  3ZGZ A;  1JWU D;  2JWU A;  1D4B A;  1KFY B;  2W3S A;  3U2S C;  1XEE A;  3T3N A;  2TSS A;  3NVY A;  4C56 C;  2IDY A;  1DGJ A;  2MJE A;  2PMV A;  4TQ1 A;  1D6E C;  1E9M A;  1I4R A;  2SAK A;  2YEP B;  1R7S A;  2EKI A;  1QF6 A;  2VZK D;  2KWD A;  1FRD A;  2WP9 B;  1TKG A;  3SR6 A;  3B2F A;  2I2Y A;  2J42 A;  1F77 A;  1XLQ A;  3AED B;  1SE3 A;  3I9V 1;  4ZRQ A;  1FNV A;  1I4H A;  1WRI A;  3AEB B;  2J52 A;  4PT5 A;  5EE9 A;  3W5U B;  1PUT A;  1V8C A;  2W82 A;  2ZW1 A;  4J3O D;  1VZ8 A;  2QSD A;  1QIL A;  4AS1 A;  2WXJ A;  2JU6 X;  2E6X A;  4OW0 A;  2RDH A;  1SF0 A;  1TKE A;  2BBC A;  1EWY C;  1EU4 A;  1I4P A;  4B0M A;  2J53 A;  1FNU A;  4Q2J A;  3PZ8 A;  1AWD A;  1TY0 A;  4RGT A;  3AE8 B;  2L83 A;  2Y5P A;  4YSZ B;  4HJG E;  1ET9 A;  4C7Z A;  2W3R A;  1I7H A;  5LNK 1;  1I4X A;  4XDD A;  1ENF A;  1QT9 A;  1L0Y B;  2IGD A;  3TEX A;  4YT0 B;  4YTM B;  3V05 A;  1PYW D;  2LHD A;  2J4X A;  1N5X A;  1FXA A;  4A6Q A;  3TEW A;  1JWS D;  1V1O A;  4ARI A;  3ETR A;  3RFZ B;  1EWC A;  3SEB A;  4KGR A;  1IGC A;  2DWQ A;  1WSP A;  2LUM A;  3NZ3 A;  1V1P A;  2FUG 1;  2QMT A;  2CU3 A;  3P4S B;  1QKZ A;  3W1S A;  3OWE B;  4WWM A;  2WXK A;  3FAH A;  1I4G A;  1L6U A;  3VR8 B;  1HZ5 A;  1ZDX A;  4DXG A;  2N9K A;  1DYQ A;  4OZC A;  2XNA C;  2LGI A;  4CQN A;  1GOZ A;  1L4Z B;  1DOI A;  1MI0 A;  4L1B A;  1C78 A;  4ZRP A;  3J9C A;  3U52 E;  4A55 A;  3LYY A;  2DYM A;  1NI3 A;  4A8X C;  2M0A A;  1OFF A;  2X38 A;  2BT6 A;  3EA6 A;  1HEZ E;  1TYG B;  2INP E;  3MJ5 A;  1NEN B;  3DWG C;  5BYR A;  1IGD A;  4XE0 A;  1F2R C;  1GPX A;  1QQR A;  4C7Y A;  3FIL B;  1A70 A;  1PDX A;  3R8B A;  4NZL B;  2HDE A;  4A90 A;  1M4V A;  2N9L A;  1GAQ B;  2M56 B;  1IUE A;  4KKI A;  4LLG M;  5AUK A;  1HA5 A;  3B2G A;  1K50 A;  2KAJ A;  5AUI A;  1OQR A;  3UI3 A;  2NTT A;  2RMM A;  4L23 A;  1UWM A;  2H89 B;  3BII D;  3AM9 A;  1WGK A;  3VRA B;  2GI9 A;  2XN9 C;  3NVZ A;  3Q8F A;  1N60 A;  1VLB A;  1MHX A;  2WXM A;  3P4Q B;  1XLO A;  4P6V F;  1MHH E;  1YN3 A;  4ZOH C;  3SFD B;  4O1N A;  3KWL A;  3ZYY X;  5BMH A;  1ET6 A;  2BYT A;  1BUI C;  1D5M C;  2L32 A;  3URY A;  3CWI A;  2WQY B;  1SE2 A;  3B9J A;  4TSS A;  1EU3 A;  1RM6 C;  2I38 A;  3LB8 C;  1B9R A;  1CZP A;  3Q8C A;  5FK9 C;  1AN8 A;  1YN4 A;  1L0V B;  1VDV A;  3T3O A;  2WXH A;  1PGX A;  1B1Z A;  1KRH A;  3AE1 B;  3AH7 A;  4RGN A;  1C9F A;  4XWT A;  2AQ3 B;  2WDR B;  1P7E A;  4USA A;  4P16 A;  3C8Y A;  2WU2 B;  4D2K A;  4XWW A;  1D5Z C;  3ZJT A;  3MP9 A;  1JWM D;  3BK2 A;  2JSV X;  2Y5C A;  4KGS A;  1FD6 A;  2FE8 A;  2LJI A;  2WXI A;  2V0G A;  2KQ4 X;  3IAS 1;  2PKO A;  4FXC A;  2KAC A;  1STE A;  3HRD D;  5G5H A;  1DOX A;  2YEP F;  3FIL A;  3E56 A;  1OQQ A;  1N62 A;  2PLP A;  2WXL A;  2VZK B;  4WQM A;  5JXV A;  2ON8 A;  1TS3 A;  5EE3 A;  3MFG A;  2AQ1 B;  3SFE B;  4RGO S;  5D3I B;  2CJN A;  4LK0 M;  2R61 A;  1TZO A;  4GLS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...