3DHIC

Crystal structure of reduced toluene 4-monoxygenase hydroxylase complexed with effector protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords toluene 4-monooxygenase hydroxylase alpha subunit
publication title Structural consequences of effector protein complex formation in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 26
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3dhiC00
3I5JC 3I63C 3DHGC 3N1XC 3RNFC 3N20C 3Q3OC 3RMKC 3Q3MC 4P1BC 2INCC 3RNEC 3Q2AC 3GE8C 3RI7C 4P1CC 3DHIC 2INDC 3Q14C 3N1ZC 3RNBC 3RNCC 3RNGC 1T0SC 3Q3NC 1T0QC 3DHHC 3RNAC 3RN9C 1T0RC 3N1YC 2RDBC 3GE3C
chains in the Genus database with same CATH superfamily
2JZZA 2PE6B 2RDHA 4NQLB 3DVNU 3Q3FA 4RGMA 3SDLC 2O2VA 4IW0A 3UI3A 2LD9A 3VRBB 2JQRB 1WJ4A 5MPOA 3AN1A 1TS3A 2ZJDA 4LNKA 2TSSA 4FBJB 2DZKA 4KVGB 1IGCA 1N5WA 2M56B 4BOSC 5HHDG 4E3CA 1N61A 2NBWB 4A3OA 1F1HA 1FNUA 3TEWA 4OHJA 5AZGA 4GU2A 4N59A 3Q8BA 2KMCA 1P9DU 1KFYB 2WXQA 3AEEB 5DPSA 2WDQB 2ZEQA 4MELA 1E8XA 4F8CB 3BK2A 1S3SG 1MJDA 2MQJA 3M62B 1SBBB 3H7SA 5D3IB 1E7UA 1BMLC 1TBEA 4AUQC 2DENB 4CYEA 4YSXB 2V0GA 1H4RA 4L1BA 3AXCA 5EE0A 4TQ1A 1AWDA 2K5PA 5E6JA 1RFKA 3ZO5B 3TEXA 3WALA 4BBNF 1ZW7A 3N1YC 2IY1B 3ML8A 4HWIB 3PV1A 1ESFA 3MJ5A 3NS8A 1TY2A 1FEHA 3AU4A 2G4DB 2JSVX 3Q8AA 2RDGA 5JHBA 1N62A 2NVUI 3RT3B 2AEHA 3Q14C 1JROA 4RFBA 1TS5A 5KHOA 2KJRA 5CX3A 2K1FA 2WP9B 1JRUA 1PYWD 2DHZA 2QMTA 3WAMA 4W9FA 3KYDD 2DZIA 2BQQA 2JWUA 2KC1A 2KVRA 1AW7A 1J19A 4ZRKA 2JRIB 1IUEA 4WQMA 5IOIA 4NJ7A 3VAWA 3MFGA 1NENB 3Q2AC 3QWZB 4WIPA 2M0AA 2WX1A 4C7ZA 2HJ1A 4GDLB 3NUHB 2LVQA 1UGMA 2NTTA 2NPTB 1NYQA 3U8ZA 1SIJA 4W9KA 2W3RA 1DOYA 2J42A 2LHEA 3GZNB 1NYRA 1WGRA 3SFDB 2VRRB 4M00A 5L83A 1UNSA 3ABVB 4CQNA 4KGRA 2K25A 4C4VA 2PKOA 2I38A 3KUDB 2LGYA 2PPHA 3NY5A 4EZLA 4GDKB 3QA8A 3ZYYX 4KIKA 2MJDA 1WGYA 5G2NA 2J0JA 1GOZA 4NAMA 3RI7C 4ASWC 2DZJA 1QOBA 2KFJA 3U7ZA 1VZ7A 4DHJD 4HEA1 1GG3A 1XLNA 1L6UA 4RGNA 4IM2A 3N30A 3ZXVA 3R7RA 4A55A 2ZVNA 3QX1A 1WX9A 1GAQB 1EM7A 4OZBA 4W9GA 2N7EA 1FXIA 4P16A 2BPSA 2INCC 3R7QA 1WJNA 1VRAB 2K8BA 3U4EG 1D5XC 3R3MA 5AZFA 2NS5A 2CHZA 4WH4A 4A3PA 3S2AA 2LXAA 2ZZPB 1WXMA 2O6VD 3IXSA 3NJTA 4US9A 3W1SC 2QSDA 5IO9A 4AJYB 2HTHA 2LZ6A 2LJ5A 1WGDA 3OWEB 2BKRB 4E71A 2UYZB 1KLVA 4K7SA 1CMXB 1JWAD 1D6EC 2QEJC 4B6WA 3IAM1 3PSEB 3I5JC 3EHVA 2DZMA 5AZHA 2WWZA 5AUKA 1TS2A 4LCDE 4C80A 4OZAA 2WQYB 1LGRA 3B1LX 3EC8A 3PRMB 4LNOA 2YLMA 3A33B 2M1MA 4YSZB 2RSUA 3SEBA 2MJEA 2RR9A 3OAWA 1K52A 2X38A 4IWPA 5C23A 1M94A 2Z0EB 5C1ZA 1J8CA 3KWLA 5LLIA 2KDBA 4IM0A 5GXGB 1WH3A 4TQ0A 4OVZA 1R4NI 3RNBC 1T0SC 3PPAA 1VD2A 4W9IA 5E6OA 4C00A 1F9JA 1GB4A 2KQSA 2NCNA 2FUHB 2RDBC 4A90A 5BYQA 2FIFA 2XEWA 1YQ4B 4XDCA 4C7YA 5E6NA 3NRZA 4AJWA 1K53A 4NZLB 4M0WA 1XF5L 3TEZA 4ZRJA 3N3KB 1UUPA 4AP4C 1YIWA 5EE9A 1WGHA 4KKIA 3BIID 3VTWA 4KDLB 1YQ3B 4DXFA 2WS3B 2K6QA 2ACZB 2MJ3A 1UWMA 3N9YC 1YX5B 1QLBB 3VR8B 1L4ZB 3R2TA 3M95A 2N9XA 1XLQA 3J9CA 4KX6B 3VQIA 2G3QB 5C2TB 1WZ0A 4ARCA 1WF9A 4EFOA 4DHZE 4ICVA 4ZHOA 2HTME 2V3NA 2WLBA 1L2NA 1E6EB 4GXBA 1WJUA 1PGXA 4RF1A 3GE3C 3BK1A 1R4NB 1Q1OA 3VDZA 1R4MB 1A70A 1YNTE 1NI3A 5CHWA 2XN9C 1L4DB 2KDFB 3L17A 1UELA 1TGZB 2GOWA 5D3DA 3RUIB 3T3OA 2WYQA 5LXHA 1D5MC 3N1ZC 4HK2A 4BKSD 1T0YA 2XK5A 1JMLA 2L52A 2A4ZA 2FNJB 3P4PB 2K6DB 1A5RA 2ZNVB 5GMVA 1UD7A 2NBVB 1P0RA 2NTSA 1F52A 1YMHE 3A9JA 3RNCC 4B0EA 5HG2A 1L7YA 3B08A 5L95C 3AM9A 1ZGUB 2G4SA 3DBLI 3HVZA 3UF8A 4WJNA 1EUVB 2Y5CA 4BAXA 1F0ZA 3QHTA 4GN1A 2C7NB 3TEYA 2D11A 1ZXHA 2KX0A 1PGAA 2JY6A 3QK0A 1RRBA 1MHXA 3AE7B 1FO4A 2IO1B 3NOBA 1MHHE 3B9JA 2BYEA 3K9PB 1HE8A 1FD6A 1VR9A 3H8HA 2RPVA 4JL9A 2MLBA 1D3ZA 3ZNID 1E8ZA 2WXHA 2Y5PA 1I4XA 4XWWA 1WXQA 1VZ6A 3HIZA 4URKA 1QF6A 2DWQA 3RPFC 2BWFA 4XYCA 4FJVB 3DBLB 3AE6B 2BBCA 2ZW0A 3OJ3A 3RZFA 4KGTA 2N7DA 1WR1A 4JGHB 2ZCBA 1NBFC 2KTRA 2K22A 3RN9C 1CJEA 5FR6A 4C4VB 4W9HA 3CWIA 2OJRA 1IBXA 2K9XA 5DPWA 2C7MB 2GBMA 3RYTA 4II2B 3H6NA 4P1BC 2NBUA 1CK1A 3AE3B 4KIKB 1WRDB 4RGOS 5TR5A 4ZOHC 2PMVA 2PIAA 2GMIC 2WXJA 2D10A 4A8XC 3ZGZA 3LJ3A 3UGBB 2MWSB 2MSED 2J4XA 2MBEA 5HFYA 4NPNA 1KRHA 4E74A 3KYCD 1KF6B 2LI5A 1I4HA 2D5GA 2M8SA 3TCAA 1PUTA 1TYGB 4RM9A 3U7DA 1JW9D 2GB1A 3BYYB 5EE1A 3OG5A 2V1YA 4LNIA 4X57B 1SB3C 3I3TB 2LFIA 1KH0A 3IHPC 4LNFA 2KVZA 2Z0DB 3V05A 4K7WA 1EO6A 2KX3A 3C8YA 1YOVB 1AYFA 4MSMB 3CSTA 3I57A 3NVVA 1WI0A 4ICUA 2KQ4X 1FCLA 1Z2MA 1WE7A 3EFUA 2MCNB 1YX6B 4M8NA 1FFVA 1B1ZA 4RNAA 4ITKA 2QILA 1WM2A 2JU6X 2LVPA 4N9F4 2JUOA 5D6JB 5AUIA 3P2BA 2I1JA 5J17A 2DYOA 2CS4A 2IJ0A 1FNVA 1VCBA 2VH2A 4B0MA 3DBHB 3ONSA 2SEBD 4DQOC 1ZPSA 4XZ4A 3DWGC 3E9SA 1EWYC 3DCGA 3NZSA 1AARA 4C56C 1YJJA 2PW9A 2V3SA 1OQRA 3RNEC 2PVGC 2WXFA 2BT6A 1RM6C 2C7HA 4MH8A 1WYWB 3VUXA 2KXJA 2MP2A 3ZJUA 2ZCCA 1IYFA 2B76B 2WGSA 1ZXIA 3AE5B 1C4PA 2KWCA 4HJKA 1YJIA 2KD0A 3L4PA 1FIQA 2Z8LA 2ICIA 4IOIE 2N7JA 5C3JB 4HPMB 3W1SA 1K8RB 1MFWA 1C9FA 1L6VA 4LK0M 3GZNI 3DBRB 2JVCA 3GOEA 3NVZA 2PVOD 1F2RI 4LDTB 2D3AA 4JX1C 3SR6A 1D5ZC 1JWUD 2EMTA 3VTUA 2DYBA 3VR9B 2BS2B 3Q8FA 4JIOU 3RD2A 2QDFA 1JWSD 5BO4B 4MGIE 2CKHB 2G1EA 2CJOA 3AV8A 2I1KA 4DWFA 4KSLC 2MA9B 2JYTA 3N20C 5E6PA 4WJQA 2WX0A 4WWOA 2FAZA 3SD5A 4XX5A 1ZKHA 3JSVA 4FHJA 5DPTA 4EE2A 4EEWA 3KQ4A 3A9KA 1UBQA 1FMAD 1C78A 2WXOA 4YL8A 2LWPA 3TSSA 3MTNB 1LXDA 5JH5C 3H7PA 4XDDA 2BWES 4K3CA 3ZW3A 2L7RA 2CHWA 2XK5B 1X1MA 4YWGG 2H89B 2K8HA 4JLCA 3N32A 5T8IA 1IGDA 3AEGB 4S0RA 2AQ2B 3WCQA 1L0YB 4PYZA 3NZUA 2LGIA 4M8MA 2JPHA 1Y56A 2KK8A 3U52E 3FILA 1UF0A 4M02A 3DVGX 2A5UA 4FJZA 1SGHA 3A9JB 3U30A 1WGGA 2OOBB 4B9KA 4MEMA 4OW0A 1JQ4A 5BMGA 4USAA 2LGDA 4JE3B 3SHQA 3DVGY 3DOWA 2D3BA 3L08A 4KZCA 4FN2A 1HZ5A 3V3XA 2XNAC 2MEKA 1EWCA 4ZDVA 1HA5A 3AI5A 1FCCC 2WDTB 3CF6E 3TL5A 3GP7A 4MSQB 2DX5B 2WXIA 4FA6A 4MM3A 3W2DA 3N1XC 1TIFA 1SIFA 3W1YA 4EOYA 1OEYJ 3DPDA 2IY0B 1TJEA 3R8BA 3DWMA 1P7FA 2WDVB 3MC0B 4ZRPA 3PZ7A 1V9JA 1SE2A 1YN4A 3OJ4B 1YN5A 2L8JA 2KFKA 1PFDA 2O6VA 1ZUD2 1VZ8A 3MHZA 1HXYD 1K50A 3CSFA 1BT0A 1S1QB 3BWUD 3O13A 2ZNVC 4HKZE 4MJSB 4ZHPA 1ACCA 4GIVA 4P7IA 1XCTL 4HJGE 2N1VA 3IFWB 2L00B 3RFZB 1VLBA 3B0AA 1OEYA 4A6QA 4IUMB 2MBOA 2AL3A 2KTRB 5DPRA 3T3NA 2V9HA 4FJYA 3ECIA 2GBJA 2NMQA 4HVBA 4BZAA 3CMMB 4LJOB 4ANXA 1GJZA 3HVDA 3NS1A 1HZ6A 1KTKA 4TSSA 3WA0A 3SU8X 4ANVA 2RMMA 3IAS1 2C60A 3VRAB 5CTRC 2IGHA 1J7AA 1WJ6A 3P4QB 2CJNA 4BKGA 3ETRA 1MG8A 2WU2B 1SE9A 1V80A 3P63A 5DCNA 2D3CA 2J0KA 4A20A 3NVYA 4GB9A 2WXKA 1Y8RC 1TKEA 1R4MI 1V1PA 1FFUA 3A1QB 2JZ3B 3H9DA 1QOFA 4FLHA 5D7GA 3P1MA 2M19A 3GB1A 1VJKA 2FIDA 4MH0E 3VVWB 1JRPA 3UINB 1N63A 2LEKA 4RH6A 1KLGD 2M4NA 3AMZA 4HXDA 3ZIMA 2O2VB 2R2QA 3EUB2 2FCQA 2CU1A 4HKQA 3UQBA 2GRIA 4UDUC 2N9PC 3PO0A 2HJ8A 2MBQA 3VUYA 1F77A 2JT4B 1PDXA 2BF8B 4Q2JA 3ZJVA 2IGDA 3PREA 2CHXA 2VH1A 1NVID 3QQ8B 2R2OA 1C1YB 2GBRA 4IWQA 2BTEA 1OTRB 4RMAA 4AQ7A 2E6XA 2KANA 2BYVE 3ML9A 2B3AA 1SJED 1G6JA 3RCZA 4AWJA 1JALA 1QZEA 3ALBA 3C0RB 2OEDA 2MBBB 1WXSA 5IAAC 1RFAA 4BKSA 2DBYA 2K3UA 1T0QC 4AS1A 1I7HA 4ANUA 4HCPB 4GDLA 1SE3A 1ZP0B 3I63C 1D4BA 2MP2B 4YTPB 4YTNB 4JQWC 3DQVA 2KNBA 2KLCA 1V8CA 4K7UA 3ZNGC 3IBEA 1KOTA 2ZW1A 5IKCM 2NR2A 3HHMA 3JVZX 4RM8A 3FAHA 2KHWB 3AE8B 4ZRQA 4EZKA 2WXNA 2KWDA 1FRRA 1HTOA 1FPYA 4HRSA 4TKNA 2HDEA 1U4AA 3L10B 4G50A 1E10A 4CO7A 4WQOB 1WRIA 2LGSA 3K9OB 4I6NB 5KHQA 1AN8A 4D2KA 1CQVA 4EUTA 1RLFA 1WX7A 2KDEB 2ZVOA 5JHAA 3T9LA 2AQ1B 1WIAA 4HCNB 3RNFC 4J6IA 1GB1A 2KJ6A 2FCNA 2UU7A 2LJIA 2PE9A 1JWBD 4G3XB 4S17A 2QIEB 4YSYB 2WDRB 3JSVB 4ZYNA 4BBNC 3X0WA 5G5HA 3L54A 2JZPA 4HLEA 3MHSD 2JF5A 4W9DA 4PS3A 3PHWB 1OGWA 4BFRA 3ZTDA 1UH6A 1C79A 3VUWA 1C3TA 3AEBB 2D07B 2J7QB 5HKHA 1B9RA 2JXTA 2LUEA 1V5OA 2YVCA 3BVMA 3EECA 4I6LB 2KZRA 4HDQA 1OQYA 5CHVC 2DYMA 3ZLZA 2JXXA 1SEBD 2KYWA 3TBLD 4F1SA 3DHIC 2D2QA 3DDCB 1WM3A 4GGQA 1WE6A 3PRZA 1E8WA 2KDMA 4BOZB 4XWTA 3HUIA 5FK9C 4DHJB 3W9CB 5BMIA 2BS3B 1XD3B 2MX2A 3ZJTA 2D3GA 3DBHI 2AYOB 3Q3OC 1WSPA 1LM8B 3A4SC 1ENFA 3PVLA 4W9EA 5TSSA 3QJZA 3V60A 3PLVA 4MM3B 2IBIB 1TZ1A 2IYDB 1T5XD 1GC6A 2EKEC 1WX8A 3LXFA 4GMVA 2LXCA 1QILA 4WJPA 2JYEA 4M01A 2Y5BB 2BKFA 2OJWA 2EKIA 2KFKB 2O6VB 1E7VA 1SJHD 3ZTCA 1QQRA 1HQRD 1F2RC 1NI2A 1WMHA 2RD0A 2E3TA 2MH7A 1LFDA 4NQKE 5H8YE 1PGBA 1C77A 1SSNA 2ON8A 1XXGA 3MC9A 2AWTA 2WXRA 1QOGA 2KTFA 4RCOA 5LXIB 2BYFA 4B95A 4YXDB 5LNK1 1JWMD 2QCZA 2KC2A 4H2AA 2BVCA 3E56A 3DBRI 3KH0A 4L2YA 3B2FA 3OLMD 4PYUA 2LHDA 4NJ6A 3HRDD 1J7CA 3JYUA 2BB6A 1WFYA 1LO5D 1EF1A 1YQBA 1FRDA 3EA6A 1DYQA 1IPGA 3DHGC 1P98A 4PS8A 4WAFA 3QIJA 2MW5A 1ISNA 2KACA 5D94A 5BMHA 1RWSA 3P42A 4RGTA 2DNFA 3MP9A 3Q8EA 2AL6A 3AE4B 1QOAA 2BS4B 4DDID 2FUG1 4LJPB 1V1PB 3PZ8A 1I4QA 5G55A 3LDZE 4EKUA 3WAPA 1YJ1A 3L0WB 2N4FA 3LB8C 4XE0A 2W55A 5D2MB 5J2RA 4NAWA 1TTNA 1UZXB 1GUAB 4M0WB 3VH3B 3RULA 2BB5A 3AE2B 3ZRFA 3UIPB 4NNJB 4DHZB 1UGJA 3ZDMC 3AECB 3ZXRA 2FE8A 3H1UA 1M4VA 2REXA 1Z5SB 4KZ0A 4N58A 3ZQ4A 1TS4A 1DOXA 2LGXA 4YT0B 2WXLA 1TZOA 3A4RA 1MG4A 3V62A 4G11A 5G5GA 2R61A 3PT2B 3AB5A 2JRHA 1K51A 4HROA 2L32A 1TY0A 4DK5A 4QAYA 3LYYA 4W9LA 1XQQA 5FKAC 4MGZE 3WANA 2J0MA 2L0TA 1V81A 1HEZE 1EU3A 4JWUC 3PZDA 2IO2B 4KV2A 2X8XX 1WY8A 1WWTA 3Q3MC 2QHOA 3IT6B 3W5UB 1J7BA 4IG7B 3HM3A 4MGYE 3ZNZB 2BGFA 1Q5WB 3WAOA 1I4GA 3U2SC 3ZNHB 2V4LA 2N9KA 2KT7A 1WYGA 2HE7A 4A9AA 1XT9B 4K3BA 3QARA 1PQSA 4W9JA 4CHKA 1IP9A 2KDIA 3BINA 3D32A 4PS7A 3VXWA 2DAFA 2L1AA 3KLSX 2J53A 1V5TA 4MDKE 1EF5A 4N6EB 1E7PB 4WJOA 4O1NA 4ZRIA 1XLPA 4PT5A 2MBHA 2J52A 3IT4B 2ASQA 3KUZA 1ZE3D 3UQAA 2I2YA 2ONQA 5I4DA 1P7EA 2FCMA 3I9V1 1UWXA 2KMAA 4LTUA 2RPQA 3KWVA 3PTFC 1BXTA 1RYJA 2AQ3B 2CR5A 2V3PA 2KQ7A 4KKJA 3GS2A 2BW2A 4RF0A 2GBKA 3DBSA 1XEEA 2EELA 4WWMA 4JPSA 1WR6E 5EE3A 4IC7B 2N9EB 1XLOA 1V49A 3ZVVA 2KN5A 4EZJA 2LUMA 2UWQA 1QKZA 2ZPNA 2EMSA 2LMCA 4G0NB 2IO3B 1ET9A 2LRWA 1J0GA 3P4RB 2H88B 1MI0A 1HTQA 5IA7A 3TUOA 3VTVA 1I4PA 2VZKB 1IBXB 2KAJA 2INDC 1XO3A 2Y3AA 4K81A 3Q8CA 1E8YA 3RNGC 3SFEB 2L0FA 3Q6BA 3MJWA 1V2YA 2RGFA 4TUUA 3V6EB 4GSWA 2W3SA 3ZUNA 2KO3A 2LRUA 3JW0X 1MPEA 3BVZA 3RMKC 3TIXA 1V6EA 3AU5A 3BZDB 1NDDA 4GLSC 3APFA 3BYTB 4HPPA 3R66C 2SAKA 2QJLA 4W9CA 3WIMA 1QT9A 4LLGM 2K39A 2L76A 2KWVB 4FULA 3PS6A 4ARIA 1FXTB 2LASA 2BYTA 4DXGA 5IP4D 4KGSA 3AEDB 3NG0A 4IM3A 3VH4B 1CZPA 2N9LA 3GE8C 2W9NA 3CIRB 4II3B 3MC8A 3IVFA 4DXAB 2N0SB 3Q3NC 1NEKB 3M3JA 3VHTC 3O65B 2KWUB 1Q0WB 1WMHB 2M0XA 3BVGA 1DGJA 2PEAA 3QCAA 2K8CA 3PRPB 1KLUD 1E90A 4LNNA 1DOIA 1FM0D 4DDGD 2KKCA 1L5PA 2XBBC 1P1AA 2LVOA 1GPXA 3APCA 3B2GA 4NJCA 1SF0A 3QAQA 5CHFA 2W54A 2C5LC 4LDTD 3L13A 1TT5B 4WWNA 4K1RB 2WXGA 4AOFA 2G9HD 1STEA 3URYA 3AEAB 3T8MA 1N6ZA 4FXCA 4WURA 5JXVA 5FR3A 4IKGA 1SE4A 5HI1A 4REZA 1WXVA 2KN4A 2YEPB 2YEPF 1SXTA 2JWZA 2L83A 2L3ZA 2M17A 1C4AA 4MACA 3PHXB 1GNUA 1ROEA 2CU3A 3Q3JA 4MT5A 4NY0A 5BYSA 5JZEB 4WWPA 4P6VF 3AULA 4FADA 1C4CA 2WXPA 1N60A 2PTLA 3UIOB 3Q69A 1P3QU 1R7SA 4JWSC 4OVUA 5H92C 2NPTA 1ZDVA 4HPLB 3HM6X 3KUCB 3NVWA 3AE9B 3IG3A 1H8CA 4WAAA 2FCSA 2INPE 2V4IB 3BY4B 1TKGA 4IWOA 1YD8U 4GOCA 3FKYA 4BVUC 2G45B 4F7ZA 2HD5B 3L16A 4NAWB 3FC4A 2Z59B 5AEKB 1GC7A 5BYRA 1KJTA 4GDKA 2IPKD 4ANWA 3M63B 3AE1B 1E5WA 2JX5A 2K0PA 2IGGA 2GBNA 3W5VB 3TJPA 4PK1A 3AEFB 3HK0A 2WNMA 3P4SB 5IN7A 3X23A 1I35A 1V86A 2IZVB 3QC8B 1XCQL 3TMPB 2GLSA 3VFKA 2KLGA 3ZRCA 1BUIC 2INNE 1L0VB 2GI9A 2IO0B 4R3DA 3EFCA 1OFFA 3KVFB 4XGAB 4YTMB 3ZDTA 1T6BX 4XC2A 3KW5B 1KM7A 4OVVA 3DHHC 2KJHB 3PLUA 3NZ3A 1N5XA 1T0RC 4US8A 1YN3A 3A9KB 1VDVA 1ZOYB 1E0ZA 1WGKA 4MGKE 1JCKB 1L0XB 4KDIC 1WZ3A 2Q5WD 2DLBA 3H7PB 4ACFA 2PJHA 1FNWA 2QC8A 2AX5A 1EU4A 2WHIA 2KMMA 4MJSA 3EGRA 3V61A 2WXMA 3FILB 4L23A 3ENEA 4J3OD 1V97A 2PLPA 2OHFA 4OZCA 4I6PA 4TMAB 1RAXA 3R2IA 3NHEB 1TKYA 4BKTA 4DBGA 3RNAC 2N1WA 2C9WB 2WU5B 2VZKD 1E9MA 1WXAA 4IDIA 1V1OA 1MVKA 2FBWB 2DAJA 1OQQA 1ZDXA 2KOXA 1T3QA 3PGEA 2ZPYA 4HDOA 3V6CB 5EDSA 4KSKC 2L05A 1FXAA 1Q10A 3AH7A 1I4RA 2MHJA 3RZWC 3APDA 4ZYSA 5J18A 4P1CC 3A1QA 4TV3A 3DVNV 2MRPA 1LQBA 1I42A 1UBIA 3C19A 2IDYA 1ET6A 4FHKA 3ZKJC 2W82A 1C76A
chains in the Genus database with same CATH topology
3I5JC 3I63C 3DHGC 3N1XC 3RNFC 3N20C 3Q3OC 3RMKC 3Q3MC 4P1BC 2INCC 3RNEC 3Q2AC 3GE8C 3RI7C 4P1CC 3DHIC 2INDC 3Q14C 3N1ZC 3RNBC 3RNCC 3RNGC 1T0SC 3Q3NC 1T0QC 3DHHC 3RNAC 3RN9C 1T0RC 3N1YC 2RDBC 3GE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5J C;  3I63 C;  3DHG C;  3N1X C;  3RNF C;  3N20 C;  3Q3O C;  3RMK C;  3Q3M C;  4P1B C;  2INC C;  3RNE C;  3Q2A C;  3GE8 C;  3RI7 C;  4P1C C;  3DHI C;  2IND C;  3Q14 C;  3N1Z C;  3RNB C;  3RNC C;  3RNG C;  1T0S C;  3Q3N C;  1T0Q C;  3DHH C;  3RNA C;  3RN9 C;  1T0R C;  3N1Y C;  2RDB C;  3GE3 C; 
#chains in the Genus database with same CATH topology
 2JZZ A;  2PE6 B;  2RDH A;  4NQL B;  3DVN U;  3Q3F A;  4RGM A;  3SDL C;  2O2V A;  4IW0 A;  3UI3 A;  2LD9 A;  3VRB B;  2JQR B;  1WJ4 A;  5MPO A;  3AN1 A;  1TS3 A;  2ZJD A;  4LNK A;  2TSS A;  4FBJ B;  2DZK A;  4KVG B;  1IGC A;  1N5W A;  2M56 B;  4BOS C;  5HHD G;  4E3C A;  1N61 A;  2NBW B;  4A3O A;  1F1H A;  1FNU A;  3TEW A;  4OHJ A;  5AZG A;  4GU2 A;  4N59 A;  3Q8B A;  2KMC A;  1P9D U;  1KFY B;  2WXQ A;  3AEE B;  5DPS A;  2WDQ B;  2ZEQ A;  4MEL A;  1E8X A;  4F8C B;  3BK2 A;  1S3S G;  1MJD A;  2MQJ A;  3M62 B;  1SBB B;  3H7S A;  5D3I B;  1E7U A;  1BML C;  1TBE A;  4AUQ C;  2DEN B;  4CYE A;  4YSX B;  2V0G A;  1H4R A;  4L1B A;  3AXC A;  5EE0 A;  4TQ1 A;  1AWD A;  2K5P A;  5E6J A;  1RFK A;  3ZO5 B;  3TEX A;  3WAL A;  4BBN F;  1ZW7 A;  3N1Y C;  2IY1 B;  3ML8 A;  4HWI B;  3PV1 A;  1ESF A;  3MJ5 A;  3NS8 A;  1TY2 A;  1FEH A;  3AU4 A;  2G4D B;  2JSV X;  3Q8A A;  2RDG A;  5JHB A;  1N62 A;  2NVU I;  3RT3 B;  2AEH A;  3Q14 C;  1JRO A;  4RFB A;  1TS5 A;  5KHO A;  2KJR A;  5CX3 A;  2K1F A;  2WP9 B;  1JRU A;  1PYW D;  2DHZ A;  2QMT A;  3WAM A;  4W9F A;  3KYD D;  2DZI A;  2BQQ A;  2JWU A;  2KC1 A;  2KVR A;  1AW7 A;  1J19 A;  4ZRK A;  2JRI B;  1IUE A;  4WQM A;  5IOI A;  4NJ7 A;  3VAW A;  3MFG A;  1NEN B;  3Q2A C;  3QWZ B;  4WIP A;  2M0A A;  2WX1 A;  4C7Z A;  2HJ1 A;  4GDL B;  3NUH B;  2LVQ A;  1UGM A;  2NTT A;  2NPT B;  1NYQ A;  3U8Z A;  1SIJ A;  4W9K A;  2W3R A;  1DOY A;  2J42 A;  2LHE A;  3GZN B;  1NYR A;  1WGR A;  3SFD B;  2VRR B;  4M00 A;  5L83 A;  1UNS A;  3ABV B;  4CQN A;  4KGR A;  2K25 A;  4C4V A;  2PKO A;  2I38 A;  3KUD B;  2LGY A;  2PPH A;  3NY5 A;  4EZL A;  4GDK B;  3QA8 A;  3ZYY X;  4KIK A;  2MJD A;  1WGY A;  5G2N A;  2J0J A;  1GOZ A;  4NAM A;  3RI7 C;  4ASW C;  2DZJ A;  1QOB A;  2KFJ A;  3U7Z A;  1VZ7 A;  4DHJ D;  4HEA 1;  1GG3 A;  1XLN A;  1L6U A;  4RGN A;  4IM2 A;  3N30 A;  3ZXV A;  3R7R A;  4A55 A;  2ZVN A;  3QX1 A;  1WX9 A;  1GAQ B;  1EM7 A;  4OZB A;  4W9G A;  2N7E A;  1FXI A;  4P16 A;  2BPS A;  2INC C;  3R7Q A;  1WJN A;  1VRA B;  2K8B A;  3U4E G;  1D5X C;  3R3M A;  5AZF A;  2NS5 A;  2CHZ A;  4WH4 A;  4A3P A;  3S2A A;  2LXA A;  2ZZP B;  1WXM A;  2O6V D;  3IXS A;  3NJT A;  4US9 A;  3W1S C;  2QSD A;  5IO9 A;  4AJY B;  2HTH A;  2LZ6 A;  2LJ5 A;  1WGD A;  3OWE B;  2BKR B;  4E71 A;  2UYZ B;  1KLV A;  4K7S A;  1CMX B;  1JWA D;  1D6E C;  2QEJ C;  4B6W A;  3IAM 1;  3PSE B;  3I5J C;  3EHV A;  2DZM A;  5AZH A;  2WWZ A;  5AUK A;  1TS2 A;  4LCD E;  4C80 A;  4OZA A;  2WQY B;  1LGR A;  3B1L X;  3EC8 A;  3PRM B;  4LNO A;  2YLM A;  3A33 B;  2M1M A;  4YSZ B;  2RSU A;  3SEB A;  2MJE A;  2RR9 A;  3OAW A;  1K52 A;  2X38 A;  4IWP A;  5C23 A;  1M94 A;  2Z0E B;  5C1Z A;  1J8C A;  3KWL A;  5LLI A;  2KDB A;  4IM0 A;  5GXG B;  1WH3 A;  4TQ0 A;  4OVZ A;  1R4N I;  3RNB C;  1T0S C;  3PPA A;  1VD2 A;  4W9I A;  5E6O A;  4C00 A;  1F9J A;  1GB4 A;  2KQS A;  2NCN A;  2FUH B;  2RDB C;  4A90 A;  5BYQ A;  2FIF A;  2XEW A;  1YQ4 B;  4XDC A;  4C7Y A;  5E6N A;  3NRZ A;  4AJW A;  1K53 A;  4NZL B;  4M0W A;  1XF5 L;  3TEZ A;  4ZRJ A;  3N3K B;  1UUP A;  4AP4 C;  1YIW A;  5EE9 A;  1WGH A;  4KKI A;  3BII D;  3VTW A;  4KDL B;  1YQ3 B;  4DXF A;  2WS3 B;  2K6Q A;  2ACZ B;  2MJ3 A;  1UWM A;  3N9Y C;  1YX5 B;  1QLB B;  3VR8 B;  1L4Z B;  3R2T A;  3M95 A;  2N9X A;  1XLQ A;  3J9C A;  4KX6 B;  3VQI A;  2G3Q B;  5C2T B;  1WZ0 A;  4ARC A;  1WF9 A;  4EFO A;  4DHZ E;  4ICV A;  4ZHO A;  2HTM E;  2V3N A;  2WLB A;  1L2N A;  1E6E B;  4GXB A;  1WJU A;  1PGX A;  4RF1 A;  3GE3 C;  3BK1 A;  1R4N B;  1Q1O A;  3VDZ A;  1R4M B;  1A70 A;  1YNT E;  1NI3 A;  5CHW A;  2XN9 C;  1L4D B;  2KDF B;  3L17 A;  1UEL A;  1TGZ B;  2GOW A;  5D3D A;  3RUI B;  3T3O A;  2WYQ A;  5LXH A;  1D5M C;  3N1Z C;  4HK2 A;  4BKS D;  1T0Y A;  2XK5 A;  1JML A;  2L52 A;  2A4Z A;  2FNJ B;  3P4P B;  2K6D B;  1A5R A;  2ZNV B;  5GMV A;  1UD7 A;  2NBV B;  1P0R A;  2NTS A;  1F52 A;  1YMH E;  3A9J A;  3RNC C;  4B0E A;  5HG2 A;  1L7Y A;  3B08 A;  5L95 C;  3AM9 A;  1ZGU B;  2G4S A;  3DBL I;  3HVZ A;  3UF8 A;  4WJN A;  1EUV B;  2Y5C A;  4BAX A;  1F0Z A;  3QHT A;  4GN1 A;  2C7N B;  3TEY A;  2D11 A;  1ZXH A;  2KX0 A;  1PGA A;  2JY6 A;  3QK0 A;  1RRB A;  1MHX A;  3AE7 B;  1FO4 A;  2IO1 B;  3NOB A;  1MHH E;  3B9J A;  2BYE A;  3K9P B;  1HE8 A;  1FD6 A;  1VR9 A;  3H8H A;  2RPV A;  4JL9 A;  2MLB A;  1D3Z A;  3ZNI D;  1E8Z A;  2WXH A;  2Y5P A;  1I4X A;  4XWW A;  1WXQ A;  1VZ6 A;  3HIZ A;  4URK A;  1QF6 A;  2DWQ A;  3RPF C;  2BWF A;  4XYC A;  4FJV B;  3DBL B;  3AE6 B;  2BBC A;  2ZW0 A;  3OJ3 A;  3RZF A;  4KGT A;  2N7D A;  1WR1 A;  4JGH B;  2ZCB A;  1NBF C;  2KTR A;  2K22 A;  3RN9 C;  1CJE A;  5FR6 A;  4C4V B;  4W9H A;  3CWI A;  2OJR A;  1IBX A;  2K9X A;  5DPW A;  2C7M B;  2GBM A;  3RYT A;  4II2 B;  3H6N A;  4P1B C;  2NBU A;  1CK1 A;  3AE3 B;  4KIK B;  1WRD B;  4RGO S;  5TR5 A;  4ZOH C;  2PMV A;  2PIA A;  2GMI C;  2WXJ A;  2D10 A;  4A8X C;  3ZGZ A;  3LJ3 A;  3UGB B;  2MWS B;  2MSE D;  2J4X A;  2MBE A;  5HFY A;  4NPN A;  1KRH A;  4E74 A;  3KYC D;  1KF6 B;  2LI5 A;  1I4H A;  2D5G A;  2M8S A;  3TCA A;  1PUT A;  1TYG B;  4RM9 A;  3U7D A;  1JW9 D;  2GB1 A;  3BYY B;  5EE1 A;  3OG5 A;  2V1Y A;  4LNI A;  4X57 B;  1SB3 C;  3I3T B;  2LFI A;  1KH0 A;  3IHP C;  4LNF A;  2KVZ A;  2Z0D B;  3V05 A;  4K7W A;  1EO6 A;  2KX3 A;  3C8Y A;  1YOV B;  1AYF A;  4MSM B;  3CST A;  3I57 A;  3NVV A;  1WI0 A;  4ICU A;  2KQ4 X;  1FCL A;  1Z2M A;  1WE7 A;  3EFU A;  2MCN B;  1YX6 B;  4M8N A;  1FFV A;  1B1Z A;  4RNA A;  4ITK A;  2QIL A;  1WM2 A;  2JU6 X;  2LVP A;  4N9F 4;  2JUO A;  5D6J B;  5AUI A;  3P2B A;  2I1J A;  5J17 A;  2DYO A;  2CS4 A;  2IJ0 A;  1FNV A;  1VCB A;  2VH2 A;  4B0M A;  3DBH B;  3ONS A;  2SEB D;  4DQO C;  1ZPS A;  4XZ4 A;  3DWG C;  3E9S A;  1EWY C;  3DCG A;  3NZS A;  1AAR A;  4C56 C;  1YJJ A;  2PW9 A;  2V3S A;  1OQR A;  3RNE C;  2PVG C;  2WXF A;  2BT6 A;  1RM6 C;  2C7H A;  4MH8 A;  1WYW B;  3VUX A;  2KXJ A;  2MP2 A;  3ZJU A;  2ZCC A;  1IYF A;  2B76 B;  2WGS A;  1ZXI A;  3AE5 B;  1C4P A;  2KWC A;  4HJK A;  1YJI A;  2KD0 A;  3L4P A;  1FIQ A;  2Z8L A;  2ICI A;  4IOI E;  2N7J A;  5C3J B;  4HPM B;  3W1S A;  1K8R B;  1MFW A;  1C9F A;  1L6V A;  4LK0 M;  3GZN I;  3DBR B;  2JVC A;  3GOE A;  3NVZ A;  2PVO D;  1F2R I;  4LDT B;  2D3A A;  4JX1 C;  3SR6 A;  1D5Z C;  1JWU D;  2EMT A;  3VTU A;  2DYB A;  3VR9 B;  2BS2 B;  3Q8F A;  4JIO U;  3RD2 A;  2QDF A;  1JWS D;  5BO4 B;  4MGI E;  2CKH B;  2G1E A;  2CJO A;  3AV8 A;  2I1K A;  4DWF A;  4KSL C;  2MA9 B;  2JYT A;  3N20 C;  5E6P A;  4WJQ A;  2WX0 A;  4WWO A;  2FAZ A;  3SD5 A;  4XX5 A;  1ZKH A;  3JSV A;  4FHJ A;  5DPT A;  4EE2 A;  4EEW A;  3KQ4 A;  3A9K A;  1UBQ A;  1FMA D;  1C78 A;  2WXO A;  4YL8 A;  2LWP A;  3TSS A;  3MTN B;  1LXD A;  5JH5 C;  3H7P A;  4XDD A;  2BWE S;  4K3C A;  3ZW3 A;  2L7R A;  2CHW A;  2XK5 B;  1X1M A;  4YWG G;  2H89 B;  2K8H A;  4JLC A;  3N32 A;  5T8I A;  1IGD A;  3AEG B;  4S0R A;  2AQ2 B;  3WCQ A;  1L0Y B;  4PYZ A;  3NZU A;  2LGI A;  4M8M A;  2JPH A;  1Y56 A;  2KK8 A;  3U52 E;  3FIL A;  1UF0 A;  4M02 A;  3DVG X;  2A5U A;  4FJZ A;  1SGH A;  3A9J B;  3U30 A;  1WGG A;  2OOB B;  4B9K A;  4MEM A;  4OW0 A;  1JQ4 A;  5BMG A;  4USA A;  2LGD A;  4JE3 B;  3SHQ A;  3DVG Y;  3DOW A;  2D3B A;  3L08 A;  4KZC A;  4FN2 A;  1HZ5 A;  3V3X A;  2XNA C;  2MEK A;  1EWC A;  4ZDV A;  1HA5 A;  3AI5 A;  1FCC C;  2WDT B;  3CF6 E;  3TL5 A;  3GP7 A;  4MSQ B;  2DX5 B;  2WXI A;  4FA6 A;  4MM3 A;  3W2D A;  3N1X C;  1TIF A;  1SIF A;  3W1Y A;  4EOY A;  1OEY J;  3DPD A;  2IY0 B;  1TJE A;  3R8B A;  3DWM A;  1P7F A;  2WDV B;  3MC0 B;  4ZRP A;  3PZ7 A;  1V9J A;  1SE2 A;  1YN4 A;  3OJ4 B;  1YN5 A;  2L8J A;  2KFK A;  1PFD A;  2O6V A;  1ZUD 2;  1VZ8 A;  3MHZ A;  1HXY D;  1K50 A;  3CSF A;  1BT0 A;  1S1Q B;  3BWU D;  3O13 A;  2ZNV C;  4HKZ E;  4MJS B;  4ZHP A;  1ACC A;  4GIV A;  4P7I A;  1XCT L;  4HJG E;  2N1V A;  3IFW B;  2L00 B;  3RFZ B;  1VLB A;  3B0A A;  1OEY A;  4A6Q A;  4IUM B;  2MBO A;  2AL3 A;  2KTR B;  5DPR A;  3T3N A;  2V9H A;  4FJY A;  3ECI A;  2GBJ A;  2NMQ A;  4HVB A;  4BZA A;  3CMM B;  4LJO B;  4ANX A;  1GJZ A;  3HVD A;  3NS1 A;  1HZ6 A;  1KTK A;  4TSS A;  3WA0 A;  3SU8 X;  4ANV A;  2RMM A;  3IAS 1;  2C60 A;  3VRA B;  5CTR C;  2IGH A;  1J7A A;  1WJ6 A;  3P4Q B;  2CJN A;  4BKG A;  3ETR A;  1MG8 A;  2WU2 B;  1SE9 A;  1V80 A;  3P63 A;  5DCN A;  2D3C A;  2J0K A;  4A20 A;  3NVY A;  4GB9 A;  2WXK A;  1Y8R C;  1TKE A;  1R4M I;  1V1P A;  1FFU A;  3A1Q B;  2JZ3 B;  3H9D A;  1QOF A;  4FLH A;  5D7G A;  3P1M A;  2M19 A;  3GB1 A;  1VJK A;  2FID A;  4MH0 E;  3VVW B;  1JRP A;  3UIN B;  1N63 A;  2LEK A;  4RH6 A;  1KLG D;  2M4N A;  3AMZ A;  4HXD A;  3ZIM A;  2O2V B;  2R2Q A;  3EUB 2;  2FCQ A;  2CU1 A;  4HKQ A;  3UQB A;  2GRI A;  4UDU C;  2N9P C;  3PO0 A;  2HJ8 A;  2MBQ A;  3VUY A;  1F77 A;  2JT4 B;  1PDX A;  2BF8 B;  4Q2J A;  3ZJV A;  2IGD A;  3PRE A;  2CHX A;  2VH1 A;  1NVI D;  3QQ8 B;  2R2O A;  1C1Y B;  2GBR A;  4IWQ A;  2BTE A;  1OTR B;  4RMA A;  4AQ7 A;  2E6X A;  2KAN A;  2BYV E;  3ML9 A;  2B3A A;  1SJE D;  1G6J A;  3RCZ A;  4AWJ A;  1JAL A;  1QZE A;  3ALB A;  3C0R B;  2OED A;  2MBB B;  1WXS A;  5IAA C;  1RFA A;  4BKS A;  2DBY A;  2K3U A;  1T0Q C;  4AS1 A;  1I7H A;  4ANU A;  4HCP B;  4GDL A;  1SE3 A;  1ZP0 B;  3I63 C;  1D4B A;  2MP2 B;  4YTP B;  4YTN B;  4JQW C;  3DQV A;  2KNB A;  2KLC A;  1V8C A;  4K7U A;  3ZNG C;  3IBE A;  1KOT A;  2ZW1 A;  5IKC M;  2NR2 A;  3HHM A;  3JVZ X;  4RM8 A;  3FAH A;  2KHW B;  3AE8 B;  4ZRQ A;  4EZK A;  2WXN A;  2KWD A;  1FRR A;  1HTO A;  1FPY A;  4HRS A;  4TKN A;  2HDE A;  1U4A A;  3L10 B;  4G50 A;  1E10 A;  4CO7 A;  4WQO B;  1WRI A;  2LGS A;  3K9O B;  4I6N B;  5KHQ A;  1AN8 A;  4D2K A;  1CQV A;  4EUT A;  1RLF A;  1WX7 A;  2KDE B;  2ZVO A;  5JHA A;  3T9L A;  2AQ1 B;  1WIA A;  4HCN B;  3RNF C;  4J6I A;  1GB1 A;  2KJ6 A;  2FCN A;  2UU7 A;  2LJI A;  2PE9 A;  1JWB D;  4G3X B;  4S17 A;  2QIE B;  4YSY B;  2WDR B;  3JSV B;  4ZYN A;  4BBN C;  3X0W A;  5G5H A;  3L54 A;  2JZP A;  4HLE A;  3MHS D;  2JF5 A;  4W9D A;  4PS3 A;  3PHW B;  1OGW A;  4BFR A;  3ZTD A;  1UH6 A;  1C79 A;  3VUW A;  1C3T A;  3AEB B;  2D07 B;  2J7Q B;  5HKH A;  1B9R A;  2JXT A;  2LUE A;  1V5O A;  2YVC A;  3BVM A;  3EEC A;  4I6L B;  2KZR A;  4HDQ A;  1OQY A;  5CHV C;  2DYM A;  3ZLZ A;  2JXX A;  1SEB D;  2KYW A;  3TBL D;  4F1S A;  3DHI C;  2D2Q A;  3DDC B;  1WM3 A;  4GGQ A;  1WE6 A;  3PRZ A;  1E8W A;  2KDM A;  4BOZ B;  4XWT A;  3HUI A;  5FK9 C;  4DHJ B;  3W9C B;  5BMI A;  2BS3 B;  1XD3 B;  2MX2 A;  3ZJT A;  2D3G A;  3DBH I;  2AYO B;  3Q3O C;  1WSP A;  1LM8 B;  3A4S C;  1ENF A;  3PVL A;  4W9E A;  5TSS A;  3QJZ A;  3V60 A;  3PLV A;  4MM3 B;  2IBI B;  1TZ1 A;  2IYD B;  1T5X D;  1GC6 A;  2EKE C;  1WX8 A;  3LXF A;  4GMV A;  2LXC A;  1QIL A;  4WJP A;  2JYE A;  4M01 A;  2Y5B B;  2BKF A;  2OJW A;  2EKI A;  2KFK B;  2O6V B;  1E7V A;  1SJH D;  3ZTC A;  1QQR A;  1HQR D;  1F2R C;  1NI2 A;  1WMH A;  2RD0 A;  2E3T A;  2MH7 A;  1LFD A;  4NQK E;  5H8Y E;  1PGB A;  1C77 A;  1SSN A;  2ON8 A;  1XXG A;  3MC9 A;  2AWT A;  2WXR A;  1QOG A;  2KTF A;  4RCO A;  5LXI B;  2BYF A;  4B95 A;  4YXD B;  5LNK 1;  1JWM D;  2QCZ A;  2KC2 A;  4H2A A;  2BVC A;  3E56 A;  3DBR I;  3KH0 A;  4L2Y A;  3B2F A;  3OLM D;  4PYU A;  2LHD A;  4NJ6 A;  3HRD D;  1J7C A;  3JYU A;  2BB6 A;  1WFY A;  1LO5 D;  1EF1 A;  1YQB A;  1FRD A;  3EA6 A;  1DYQ A;  1IPG A;  3DHG C;  1P98 A;  4PS8 A;  4WAF A;  3QIJ A;  2MW5 A;  1ISN A;  2KAC A;  5D94 A;  5BMH A;  1RWS A;  3P42 A;  4RGT A;  2DNF A;  3MP9 A;  3Q8E A;  2AL6 A;  3AE4 B;  1QOA A;  2BS4 B;  4DDI D;  2FUG 1;  4LJP B;  1V1P B;  3PZ8 A;  1I4Q A;  5G55 A;  3LDZ E;  4EKU A;  3WAP A;  1YJ1 A;  3L0W B;  2N4F A;  3LB8 C;  4XE0 A;  2W55 A;  5D2M B;  5J2R A;  4NAW A;  1TTN A;  1UZX B;  1GUA B;  4M0W B;  3VH3 B;  3RUL A;  2BB5 A;  3AE2 B;  3ZRF A;  3UIP B;  4NNJ B;  4DHZ B;  1UGJ A;  3ZDM C;  3AEC B;  3ZXR A;  2FE8 A;  3H1U A;  1M4V A;  2REX A;  1Z5S B;  4KZ0 A;  4N58 A;  3ZQ4 A;  1TS4 A;  1DOX A;  2LGX A;  4YT0 B;  2WXL A;  1TZO A;  3A4R A;  1MG4 A;  3V62 A;  4G11 A;  5G5G A;  2R61 A;  3PT2 B;  3AB5 A;  2JRH A;  1K51 A;  4HRO A;  2L32 A;  1TY0 A;  4DK5 A;  4QAY A;  3LYY A;  4W9L A;  1XQQ A;  5FKA C;  4MGZ E;  3WAN A;  2J0M A;  2L0T A;  1V81 A;  1HEZ E;  1EU3 A;  4JWU C;  3PZD A;  2IO2 B;  4KV2 A;  2X8X X;  1WY8 A;  1WWT A;  3Q3M C;  2QHO A;  3IT6 B;  3W5U B;  1J7B A;  4IG7 B;  3HM3 A;  4MGY E;  3ZNZ B;  2BGF A;  1Q5W B;  3WAO A;  1I4G A;  3U2S C;  3ZNH B;  2V4L A;  2N9K A;  2KT7 A;  1WYG A;  2HE7 A;  4A9A A;  1XT9 B;  4K3B A;  3QAR A;  1PQS A;  4W9J A;  4CHK A;  1IP9 A;  2KDI A;  3BIN A;  3D32 A;  4PS7 A;  3VXW A;  2DAF A;  2L1A A;  3KLS X;  2J53 A;  1V5T A;  4MDK E;  1EF5 A;  4N6E B;  1E7P B;  4WJO A;  4O1N A;  4ZRI A;  1XLP A;  4PT5 A;  2MBH A;  2J52 A;  3IT4 B;  2ASQ A;  3KUZ A;  1ZE3 D;  3UQA A;  2I2Y A;  2ONQ A;  5I4D A;  1P7E A;  2FCM A;  3I9V 1;  1UWX A;  2KMA A;  4LTU A;  2RPQ A;  3KWV A;  3PTF C;  1BXT A;  1RYJ A;  2AQ3 B;  2CR5 A;  2V3P A;  2KQ7 A;  4KKJ A;  3GS2 A;  2BW2 A;  4RF0 A;  2GBK A;  3DBS A;  1XEE A;  2EEL A;  4WWM A;  4JPS A;  1WR6 E;  5EE3 A;  4IC7 B;  2N9E B;  1XLO A;  1V49 A;  3ZVV A;  2KN5 A;  4EZJ A;  2LUM A;  2UWQ A;  1QKZ A;  2ZPN A;  2EMS A;  2LMC A;  4G0N B;  2IO3 B;  1ET9 A;  2LRW A;  1J0G A;  3P4R B;  2H88 B;  1MI0 A;  1HTQ A;  5IA7 A;  3TUO A;  3VTV A;  1I4P A;  2VZK B;  1IBX B;  2KAJ A;  2IND C;  1XO3 A;  2Y3A A;  4K81 A;  3Q8C A;  1E8Y A;  3RNG C;  3SFE B;  2L0F A;  3Q6B A;  3MJW A;  1V2Y A;  2RGF A;  4TUU A;  3V6E B;  4GSW A;  2W3S A;  3ZUN A;  2KO3 A;  2LRU A;  3JW0 X;  1MPE A;  3BVZ A;  3RMK C;  3TIX A;  1V6E A;  3AU5 A;  3BZD B;  1NDD A;  4GLS C;  3APF A;  3BYT B;  4HPP A;  3R66 C;  2SAK A;  2QJL A;  4W9C A;  3WIM A;  1QT9 A;  4LLG M;  2K39 A;  2L76 A;  2KWV B;  4FUL A;  3PS6 A;  4ARI A;  1FXT B;  2LAS A;  2BYT A;  4DXG A;  5IP4 D;  4KGS A;  3AED B;  3NG0 A;  4IM3 A;  3VH4 B;  1CZP A;  2N9L A;  3GE8 C;  2W9N A;  3CIR B;  4II3 B;  3MC8 A;  3IVF A;  4DXA B;  2N0S B;  3Q3N C;  1NEK B;  3M3J A;  3VHT C;  3O65 B;  2KWU B;  1Q0W B;  1WMH B;  2M0X A;  3BVG A;  1DGJ A;  2PEA A;  3QCA A;  2K8C A;  3PRP B;  1KLU D;  1E90 A;  4LNN A;  1DOI A;  1FM0 D;  4DDG D;  2KKC A;  1L5P A;  2XBB C;  1P1A A;  2LVO A;  1GPX A;  3APC A;  3B2G A;  4NJC A;  1SF0 A;  3QAQ A;  5CHF A;  2W54 A;  2C5L C;  4LDT D;  3L13 A;  1TT5 B;  4WWN A;  4K1R B;  2WXG A;  4AOF A;  2G9H D;  1STE A;  3URY A;  3AEA B;  3T8M A;  1N6Z A;  4FXC A;  4WUR A;  5JXV A;  5FR3 A;  4IKG A;  1SE4 A;  5HI1 A;  4REZ A;  1WXV A;  2KN4 A;  2YEP B;  2YEP F;  1SXT A;  2JWZ A;  2L83 A;  2L3Z A;  2M17 A;  1C4A A;  4MAC A;  3PHX B;  1GNU A;  1ROE A;  2CU3 A;  3Q3J A;  4MT5 A;  4NY0 A;  5BYS A;  5JZE B;  4WWP A;  4P6V F;  3AUL A;  4FAD A;  1C4C A;  2WXP A;  1N60 A;  2PTL A;  3UIO B;  3Q69 A;  1P3Q U;  1R7S A;  4JWS C;  4OVU A;  5H92 C;  2NPT A;  1ZDV A;  4HPL B;  3HM6 X;  3KUC B;  3NVW A;  3AE9 B;  3IG3 A;  1H8C A;  4WAA A;  2FCS A;  2INP E;  2V4I B;  3BY4 B;  1TKG A;  4IWO A;  1YD8 U;  4GOC A;  3FKY A;  4BVU C;  2G45 B;  4F7Z A;  2HD5 B;  3L16 A;  4NAW B;  3FC4 A;  2Z59 B;  5AEK B;  1GC7 A;  5BYR A;  1KJT A;  4GDK A;  2IPK D;  4ANW A;  3M63 B;  3AE1 B;  1E5W A;  2JX5 A;  2K0P A;  2IGG A;  2GBN A;  3W5V B;  3TJP A;  4PK1 A;  3AEF B;  3HK0 A;  2WNM A;  3P4S B;  5IN7 A;  3X23 A;  1I35 A;  1V86 A;  2IZV B;  3QC8 B;  1XCQ L;  3TMP B;  2GLS A;  3VFK A;  2KLG A;  3ZRC A;  1BUI C;  2INN E;  1L0V B;  2GI9 A;  2IO0 B;  4R3D A;  3EFC A;  1OFF A;  3KVF B;  4XGA B;  4YTM B;  3ZDT A;  1T6B X;  4XC2 A;  3KW5 B;  1KM7 A;  4OVV A;  3DHH C;  2KJH B;  3PLU A;  3NZ3 A;  1N5X A;  1T0R C;  4US8 A;  1YN3 A;  3A9K B;  1VDV A;  1ZOY B;  1E0Z A;  1WGK A;  4MGK E;  1JCK B;  1L0X B;  4KDI C;  1WZ3 A;  2Q5W D;  2DLB A;  3H7P B;  4ACF A;  2PJH A;  1FNW A;  2QC8 A;  2AX5 A;  1EU4 A;  2WHI A;  2KMM A;  4MJS A;  3EGR A;  3V61 A;  2WXM A;  3FIL B;  4L23 A;  3ENE A;  4J3O D;  1V97 A;  2PLP A;  2OHF A;  4OZC A;  4I6P A;  4TMA B;  1RAX A;  3R2I A;  3NHE B;  1TKY A;  4BKT A;  4DBG A;  3RNA C;  2N1W A;  2C9W B;  2WU5 B;  2VZK D;  1E9M A;  1WXA A;  4IDI A;  1V1O A;  1MVK A;  2FBW B;  2DAJ A;  1OQQ A;  1ZDX A;  2KOX A;  1T3Q A;  3PGE A;  2ZPY A;  4HDO A;  3V6C B;  5EDS A;  4KSK C;  2L05 A;  1FXA A;  1Q10 A;  3AH7 A;  1I4R A;  2MHJ A;  3RZW C;  3APD A;  4ZYS A;  5J18 A;  4P1C C;  3A1Q A;  4TV3 A;  3DVN V;  2MRP A;  1LQB A;  1I42 A;  1UBI A;  3C19 A;  2IDY A;  1ET6 A;  4FHK A;  3ZKJ C;  2W82 A;  1C76 A; 
#chains in the Genus database with same CATH homology
 3I5J C;  3I63 C;  3DHG C;  3N1X C;  3RNF C;  3N20 C;  3Q3O C;  3RMK C;  3Q3M C;  4P1B C;  2INC C;  3RNE C;  3Q2A C;  3GE8 C;  3RI7 C;  4P1C C;  3DHI C;  2IND C;  3Q14 C;  3N1Z C;  3RNB C;  3RNC C;  3RNG C;  1T0S C;  3Q3N C;  1T0Q C;  3DHH C;  3RNA C;  3RN9 C;  1T0R C;  3N1Y C;  2RDB C;  3GE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...