3DHIC

Crystal structure of reduced toluene 4-monoxygenase hydroxylase complexed with effector protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of effector protein complex formation in a diiron hydroxylase.
pubmed doi rcsb
molecule keywords toluene 4-monooxygenase hydroxylase alpha subunit
molecule tags Oxidoreductase
source organism Pseudomonas mendocina
total genus 26
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3dhiC00
3GE8C 3Q3NC 2INDC 3N1YC 3Q14C 1T0QC 3DHIC 4P1CC 3RMKC 3RNBC 3RNFC 3N1XC 3DHGC 2RDBC 3RNCC 3I5JC 3N1ZC 3I63C 2INCC 3DHHC 3RI7C 3RNAC 3RNGC 3RN9C 3N20C 3Q3OC 4P1BC 1T0RC 3GE3C 3Q2AC 3RNEC 3Q3MC 1T0SC
chains in the Genus database with same CATH superfamily
1HZ5A 1GC6A 2KNBA 2ZVOA 1FXAA 1I4XA 3VQIA 3L08A 3EA6A 1YNTE 1F2RI 2V3SA 3AE2B 2IY1B 3H7PA 2WXJA 1WH3A 3NVWA 1Y56A 1HXYD 1CMXB 3VR8B 1Q1OA 2LZ6A 1HE8A 2ON8A 4W9HA 2ZNVC 2GRIA 1JWSD 5IKCM 2GB1A 1MVKA 1M94A 1WXQA 2PMVA 4HPMB 2L05A 3WIMA 1Y8RC 3AEBB 1KTKA 2J0KA 2LGSA 2DZJA 1YN3A 4RCOA 1H4RA 2BGFA 4G0NB 3W9CB 1EF1A 2D2QA 2RPQA 2O2VB 4DXGA 4BBNC 1YN5A 3QARA 3H1UA 1BXTA 4C7YA 2RDGA 4WQMA 1YQBA 1P3QU 2MH7A 4IW0A 4ZHPA 1QQRA 1KLUD 2E6XA 4ANWA 4A8XC 2O6VA 5FK9C 3UGBB 1WXAA 4II2B 1AW7A 4AUQC 1PGXA 2MEKA 4MSQB 4F7ZA 3X23A 4W9KA 3VRAB 5JZEB 2ZCCA 2K1FA 4XE0A 2N9EB 3P4QB 4P16A 2ZPNA 1KLGD 2AL6A 4TKNA 5BMGA 1UNSA 1D6EC 4HVBA 3EFUA 3RFZB 1E8ZA 5D94A 4OZBA 2JRHA 4M0WB 2QMTA 4WWMA 3VTUA 2WXIA 3JW0X 2A5UA 1MG4A 4AP4C 3RNCC 5LXHA 1TS5A 1I4GA 2PEAA 5L83A 2ONQA 5HI1A 5E6JA 3MC9A 4GDKB 1TIFA 3BWUD 2ZPYA 3DDCB 2LUEA 3ZDMC 4KZCA 1GAQB 3CWIA 3EFCA 2EELA 4LDTB 2WS3B 1ZPSA 2D10A 2JZ3B 2LGIA 3Q3NC 3BIID 1A5RA 2LI5A 2JUOA 3R3MA 3GP7A 3VH4B 4KGRA 4NPNA 4EZLA 5J18A 1XO3A 1AWDA 1UUPA 5C3JB 1OQRA 3GB1A 5BYQA 3OLMD 4OVVA 1J7BA 2WXRA 3MP9A 4I6NB 3DVNV 5D2MB 1L6UA 4NAWA 1WXSA 5DPWA 2XBBC 1GB1A 2DYBA 5E6NA 3IVFA 1JRPA 5FKAC 1U4AA 4A3OA 2D3GA 1V86A 3VVWB 3VHTC 2MJ3A 4J6IA 1R4MI 1FCCC 3HRDD 4GOCA 2KFKB 2MCNB 3W5VB 4HJKA 2NTSA 4M01A 4GIVA 2DX5B 2RD0A 1JWAD 2Y5CA 1PDXA 3QX1A 3N3KB 3DVGY 4E3CA 2D5GA 2BB6A 2INNE 3SR6A 4W9EA 2KQ4X 2PIAA 2J4XA 2C60A 1E9MA 3T3NA 5IN7A 1FIQA 1E7UA 4BOZB 1ROEA 3ZUNA 1L6VA 2L32A 3TJPA 4PK1A 1K51A 2V3NA 3RI7C 2Q5WD 3Q3OC 4WJOA 2N9PC 4EUTA 2SEBD 3WA0A 1GB4A 4UDUC 1YX6B 2KDMA 4FULA 2EKEC 1HTQA 2MBOA 3ZVVA 3JSVA 3L4PA 4DHZB 1V6EA 1T0QC 2YLMA 3VUXA 3MJWA 1KJTA 2PE9A 3M62B 3Q3JA 1MPEA 2KDBA 3CF6E 3TUOA 4BFRA 1YN4A 2KJHB 3PSEB 2KTFA 5AZGA 3NZSA 3U52E 3OG5A 1VJKA 2D3CA 2KQ7A 3WCQA 2CU1A 2KMAA 4ICVA 4EOYA 4NNJB 3R7QA 3RUIB 2VRRB 3AEFB 4CQNA 4C7ZA 1M4VA 3TEZA 3BINA 1R4MB 3I57A 4MDKE 1GOZA 4KDLB 1E5WA 4DBGA 5EE1A 4LDTD 3DBLI 3ZO5B 1RWSA 3AEDB 3OWEB 1IBXA 2ZW0A 2MJDA 2JX5A 2IJ0A 4EEWA 2D3BA 4B6WA 4KIKB 2NBUA 4YL8A 1FRRA 3CSFA 4C80A 4M8MA 4YSZB 2JYTA 2LGYA 4HCPB 2M1MA 1JWMD 4IDIA 2KLCA 1E7PB 3M63B 2D07B 3QK0A 3UINB 3HM6X 3AE6B 2JWZA 3MFGA 3IBEA 3ZIMA 3DHIC 2CHXA 3P63A 4W9LA 2KVRA 3U2SC 2UU7A 2LD9A 1UGJA 2K8BA 3PPAA 5IOIA 2LXAA 1I4PA 1ZUD2 4KZ0A 2NBVB 2W54A 3KUCB 3AN1A 1WMHB 2J53A 4GN1A 3A9JB 3I9V1 3ONSA 4FJVB 5D3DA 1Z2MA 4K7UA 1I35A 4XX5A 3RN9C 4W9JA 3RD2A 2KAJA 2J7QB 3NZUA 1PFDA 3A9KB 4MM3B 2LASA 1V9JA 3AE8B 3ZQ4A 2MP2A 3DBLB 1STEA 3QAQA 1XT9B 4WURA 2HTHA 5AZHA 1NDDA 1P0RA 3N20C 2V0GA 1RAXA 1V1PA 3PRPB 1IPGA 1RFKA 3KW5B 2XK5A 2EKIA 2KC2A 3ZXRA 3BY4B 1C76A 2KANA 1YJ1A 3DBHI 2MJEA 3T8MA 4JX1C 2CJNA 4WAAA 4MH8A 1TGZB 2KWDA 2W9NA 2QSDA 4IWOA 4PS3A 3SU8X 5CHFA 3RNEC 5G2NA 2WXNA 1AARA 1WJ6A 3E56A 3PZDA 4NJCA 3ZRFA 1GC7A 2QDFA 1ESFA 2CU3A 2K5PA 4B0MA 1PUTA 1GG3A 4JGHB 3B2GA 4LNIA 3CSTA 2RR9A 1P98A 3UF8A 3HK0A 2WXHA 2QCZA 1BT0A 3NVZA 2UYZB 1QZEA 2LXCA 3WAPA 5L95C 5DPRA 1N5WA 4A6QA 3N1XC 2W55A 3LXFA 2NS5A 5EDSA 1ZXHA 3MC8A 1TKEA 2DAJA 2N1WA 3PZ8A 4FHKA 3PS6A 1WGKA 1V5OA 4RFBA 3RNFC 4GB9A 4NQKE 4BKTA 2MRPA 3DBHB 2WXKA 2LVPA 4X57B 2OOBB 3L10B 4W9GA 5AEKB 2FUHB 1PGBA 3X0WA 4XDDA 3VTWA 2V3PA 2IGDA 2NPTB 2BTEA 1C3TA 2NBWB 3PHXB 2ICIA 2W82A 2L83A 3D32A 3H8HA 3OAWA 3AE3B 4REZA 2KJ6A 2DENB 1RYJA 2V1YA 4E71A 3NUHB 3VAWA 2L52A 2IYDB 1YMHE 2ZEQA 2BYTA 1ET9A 1XCTL 2QJLA 1T3QA 1SB3C 1UWXA 1UGMA 2IO0B 1L0VB 2N7EA 3QIJA 1Z5SB 2LJ5A 4K3BA 2YEPB 1TTNA 4DDGD 3BVMA 1WM2A 3BZDB 4IG7B 2W3RA 1D5ZC 2ZVNA 4WJPA 4HRSA 4RGOS 5LXIB 2RDHA 3NY5A 3FILB 3K9PB 5CHVC 5CX3A 3AI5A 1RFAA 3KYCD 4XZ4A 1WM3A 4FJYA 1FFUA 1L0YB 3W2DA 5C23A 3V3XA 5HFYA 4BOSC 3EGRA 3IHPC 4QAYA 3Q69A 1RM6C 1E10A 1J7CA 3TMPB 3RNGC 5BMHA 4A55A 3BYYB 4J3OD 1FCLA 1L5PA 2GBMA 2PVOD 2KTRB 1YJIA 3H6NA 1ZW7A 2L0FA 1H8CA 2LUMA 3SFDB 3ABVB 4GDLB 2JQRB 3A4RA 4L23A 1J19A 2KHWB 4MT5A 1B1ZA 1NVID 1XEEA 3DWGC 3VUWA 2MBEA 1UBIA 2PE6B 3P2BA 1QOFA 2C5LC 1TJEA 4P7IA 2IO3B 3LB8C 1YX5B 2K9XA 1BUIC 2KFJA 4DXAB 1KH0A 2WQYB 1VDVA 1C4PA 3I3TB 2E3TA 2QIEB 1KF6B 2FIFA 1NI3A 3KUZA 4HJGE 1JWUD 2RDBC 4GGQA 3DBRI 4ZDVA 1NBFC 1LQBA 1ENFA 2MBQA 3P42A 2ZJDA 2UWQA 3P4RB 3N30A 4DDID 4LNOA 2EMSA 2KACA 1XD3B 2PVGC 2IO1B 2K3UA 4FXCA 4A90A 4W9DA 2LWPA 2KX3A 2ZCBA 3QWZB 2KMCA 1ZP0B 4ICUA 4IWQA 4EE2A 3IFWB 4IM2A 2VH2A 1EU3A 1SF0A 4EZJA 3PLVA 4KX6B 3UQAA 1YD8U 1UWMA 1E7VA 1TY2A 3APCA 3FKYA 1GUAB 3APDA 1B9RA 3NOBA 3P1MA 2FAZA 2KYWA 2ASQA 1VCBA 2J0JA 3ZJTA 3V6CB 4YSYB 2WU2B 1X1MA 3AH7A 4NQLB 5FR6A 5FR3A 1G6JA 3ZLZA 1C77A 1FM0D 3VR9B 3V61A 1WX8A 2IY0B 3BK2A 1OFFA 3URYA 2OJRA 4RGTA 1SIFA 2WX1A 4KVGB 2CHZA 4KSLC 3DBRB 1CJEA 4JWUC 2B3AA 3R2TA 2JYEA 4ZOHC 1EU4A 4BKSD 1XCQL 4FADA 5BO4B 1WYGA 1DOIA 2WXGA 4HDQA 4LJPB 1YJJA 4RMAA 3L17A 3GZNI 1VLBA 2NR2A 3ML8A 3U8ZA 4ZRQA 1E8XA 3H7PB 4L1BA 3ML9A 3M3JA 4ARCA 4HDOA 2FNJB 3ZNGC 4YSXB 3NS8A 1UBQA 1F9JA 3DWMA 2ZNVB 1MJDA 5EE3A 2XN9C 1P7FA 3QA8A 4M8NA 2DBYA 2CKHB 2PKOA 3GS2A 4PT5A 3PLUA 2KC1A 1AYFA 1WWTA 4F1SA 2OJWA 3RCZA 4BVUC 2BBCA 3TCAA 4YTNB 2K25A 1UH6A 1E8YA 4B9KA 3TEXA 2KXJA 1Q10A 2VH1A 2J0MA 1LXDA 2R2OA 2PW9A 1YQ3B 3ZNID 4A3PA 3L54A 4HK2A 5AZFA 3AMZA 1PQSA 3FC4A 2JU6X 3N1YC 3U7DA 1SEBD 3RULA 3NVYA 4FA6A 2NVUI 3ALBA 3S2AA 4NJ6A 1N5XA 4C4VA 2PJHA 1QOGA 3W5UB 2KDEB 2BYVE 4RNAA 4URKA 4MGYE 1TT5B 2JWUA 2K6DB 2O6VB 2I2YA 1RRBA 4YTMB 3ZW3A 1WJUA 3GZNB 5IP4D 1TY0A 2I1KA 3I5JC 1BMLC 2K8CA 2C7MB 2WDVB 4I6PA 4MSMB 4AOFA 4FN2A 1MI0A 1WZ3A 3P4SB 3DPDA 4JQWC 2BS4B 3A1QA 4BKGA 2KKCA 3UIPB 4KSKC 3ZTCA 4HPPA 2LVQA 2C7HA 3H9DA 3VTVA 4WWNA 2LHDA 1LM8B 4N6EB 1SJED 5HKHA 2WYQA 1C9FA 3J9CA 3SD5A 4FJZA 2J52A 2V4IB 4ANVA 5T8IA 1HEZE 1JWBD 2G4SA 3HUIA 3NHEB 5CTRC 2BWES 3L0WB 4AJWA 1SGHA 4CHKA 4GSWA 1WR6E 2KT7A 2L7RA 2BW2A 2DYOA 1SE2A 3IAS1 2Z59B 4DXFA 1F1HA 2NPTA 3V6EB 1SXTA 1QF6A 2MQJA 3TEWA 1YIWA 3PHWB 1VZ7A 1WF9A 1V97A 1WY8A 2DZMA 1ZXIA 4B95A 1OEYJ 4NAWB 2DYMA 3NJTA 4HPLB 3PREA 1TS4A 4ACFA 4DK5A 1P1AA 1XQQA 3R7RA 1WRIA 2BYEA 2AX5A 5C2TB 4KDIC 1OQYA 2Y3AA 4LCDE 4AS1A 1PYWD 2Z8LA 2BS3B 3FAHA 3Q14C 4OW0A 4PYUA 1NYRA 4DWFA 1J8CA 2GOWA 1E8WA 3QHTA 3ZGZA 2MSED 2L76A 2INCC 1WFYA 2JVCA 4XC2A 1FMAD 1WE7A 4LK0M 3WAMA 3DCGA 1FNUA 4FHJA 4ZYNA 1V5TA 1VD2A 3W1YA 4BKSA 1V1OA 4N59A 1SE3A 2L8JA 3PRMB 3Q8EA 3AEAB 2KD0A 1PGAA 1DOYA 2GMIC 4ARIA 4JE3B 1WJ4A 2DZIA 3AEGB 4EKUA 3N9YC 2KTRA 2O6VD 4M00A 2L1AA 3ZTDA 1V49A 4MEMA 3ZJVA 2HTME 1VR9A 1NENB 4W9FA 4WQOB 2O2VA 3QQ8B 3JSVB 4MGKE 1JCKB 2GBJA 2MBBB 4MH0E 2WU5B 3B08A 1TS3A 4MACA 1EUVB 1N63A 4HKZE 3Q8BA 3DOWA 1NI2A 2M0AA 1SBBB 4R3DA 4DHZE 3VH3B 4ASWC 3Q2AC 1T0SC 3AU5A 2QILA 4IKGA 1ZKHA 2HE7A 4OVZA 2Y5PA 5TR5A 3SEBA 2M56B 1V2YA 1ZOYB 1UZXB 3B0AA 4Q2JA 1K8RB 2YVCA 2K6QA 3QCAA 2EMTA 3DVNU 3U4EG 3L13A 2WX0A 3NG0A 4OZCA 1K52A 4ITKA 3TIXA 1GJZA 5CHWA 1IBXB 1F2RC 3KYDD 1UD7A 1D3ZA 1WXMA 2JXTA 3V05A 5TSSA 3RZFA 2WDRB 1Q5WB 5AUKA 3RPFC 3WALA 4AJYB 1L7YA 3C19A 3KQ4A 4M0WA 1I4RA 2KWVB 2PTLA 1XXGA 3RYTA 5EE0A 3NRZA 4WJQA 4TQ1A 2JRIB 2FIDA 1YOVB 4S0RA 4XWWA 5LLIA 3L16A 4MGZE 1MFWA 1QOAA 1V8CA 3ENEA 2KN5A 2VZKB 4GDKA 2M17A 3NZ3A 3ECIA 3VXWA 4MJSB 2Y5BB 2IZVB 4LNNA 2JZPA 1SE9A 1MG8A 2D3AA 2QHOA 2KWCA 5JHAA 3O13A 2WNMA 4IC7B 5G55A 2LGXA 1L2NA 1XLNA 1OQQA 4TUUA 1QOBA 1I4QA 4JLCA 1TBEA 2HD5B 4RM8A 2G1EA 2LJIA 1K50A 2KX0A 3MC0B 4A9AA 3UI3A 4W9IA 2AQ1B 3LDZE 3MHSD 2GI9A 4BZAA 1VZ6A 1R4NI 1EWCA 1CK1A 2IPKD 4TQ0A 2JSVX 2MP2B 5BMIA 2X8XX 1A70A 1IGCA 2KJRA 3JVZX 4II3B 1I4HA 1V1PB 4DHJB 2KFKA 4YTPB 2XK5B 1FRDA 3R8BA 1C4CA 3MHZA 3DBSA 1EWYC 2N7DA 1F52A 4XDCA 4US9A 2NCNA 1TS2A 4XYCA 2ACZB 2G45B 4WWOA 4CYEA 4NZLB 3VFKA 2M8SA 2REXA 2ZW1A 3ETRA 3OJ3A 2BQQA 2FCMA 1D5MC 4JIOU 2J42A 2MHJA 2PPHA 3RNBC 2H89B 2W3SA 4B0EA 2GLSA 4GMVA 3Q8CA 4HLEA 3KLSX 3AV8A 1J7AA 2JF5A 1WX7A 2LFIA 2KN4A 2NTTA 3GE3C 2N9LA 3ZJUA 3HIZA 4XWTA 2ZZPB 4FLHA 1JALA 1SSNA 2WGSA 4NAMA 2MW5A 2N1VA 1QT9A 2V9HA 3DQVA 5D6JB 3UQBA 1CQVA 3U7ZA 1JW9D 4NY0A 3I63C 3Q8AA 1D5XC 2G4DB 4K1RB 2B76B 1FO4A 4JL9A 3APFA 2NMQA 1R4NB 2JT4B 2A4ZA 5D7GA 5C1ZA 4JWSC 3SFEB 1XLPA 1EF5A 1TKYA 5LNK1 4NJ7A 5H92C 1V81A 4ANUA 3IT6B 4TMAB 3SDLC 2VZKD 1MHHE 4IUMB 1N60A 4HKQA 5DPSA 4RH6A 2DLBA 2LRUA 5GXGB 3PT2B 2FCNA 5H8YE 1T0YA 5KHOA 2V4LA 1IUEA 4P6VF 2N9XA 1R7SA 4RF0A 2KVZA 2AQ2B 4KIKA 2WP9B 1DYQA 4I6LB 4FBJB 2BVCA 3ZYYX 2WDTB 1N61A 2KDIA 3TSSA 4GXBA 3KH0A 1FEHA 3AXCA 3C8YA 1YQ4B 1WGHA 2GBNA 3W1SA 5EE9A 5HHDG 2AL3A 4EZKA 3NS1A 3EECA 3W1SC 1Q0WB 4KKJA 3E9SA 3K9OB 3TBLD 1D4BA 3AULA 1IGDA 1FD6A 4MGIE 1WGYA 3ZXVA 1SIJA 2JZZA 1HA5A 3IT4B 1SE4A 3ZKJC 3ZRCA 4PYZA 4OVUA 1WMHA 4DHJD 3QJZA 3ZNHB 3A9JA 1OEYA 4AWJA 5IO9A 3ZNZB 3C0RB 3BYTB 2DNFA 3R2IA 4WIPA 3WANA 1ACCA 5JHBA 3AE5B 4LNKA 4P1BC 2BT6A 3AM9A 3A9KA 3BK1A 4EFOA 3AECB 3HHMA 4MM3A 2FCQA 3UIOB 2BF8B 4G11A 1DOXA 1JMLA 2WLBA 5HG2A 2L0TA 2KDFB 1OGWA 2D11A 2INPE 2BKRB 5GMVA 2PLPA 2BKFA 2FUG1 4YT0B 4K7WA 2C7NB 4KGTA 4N58A 4RGMA 1QLBB 2RSUA 3PVLA 4WAFA 2HJ8A 1SJHD 4IM3A 1J0GA 1WZ0A 3RMKC 4HWIB 3HVZA 2KWUB 3MJ5A 4KV2A 4K81A 2SAKA 3JYUA 1ISNA 2QC8A 3M95A 3IAM1 1P7EA 5DPTA 3KVFB 5G5GA 2L00B 1JQ4A 3PV1A 2HDEA 1JRUA 3GE8C 4WH4A 4HEA1 5IA7A 2C9WB 1WXVA 3N32A 1WGGA 4ZYSA 1I42A 1ZDXA 2XNAC 3PZ7A 3EHVA 1UELA 1XLOA 2MA9B 4WJNA 3AE4B 1IYFA 1WGDA 4AQ7A 5AUIA 3GOEA 2OEDA 2AQ3B 4ZRJA 4PS8A 5IAAC 1AN8A 4YXDB 3P4PB 3VRBB 3EC8A 1FPYA 1NEKB 4IM0A 3VUYA 5J17A 2IBIB 2YEPF 1HQRD 2AEHA 3T3OA 4KKIA 2BPSA 4DQOC 1T5XD 1NYQA 2MX2A 3O65B 1FXTB 1FNVA 2WXPA 3PTFC 2MLBA 3RZWC 3Q3MC 2N9KA 5BYSA 3AE1B 2N0SB 4P1CC 5DCNA 4M02A 4C00A 5JH5C 2KOXA 2LRWA 4TV3A 2AYOB 2Z0EB 3TEYA 2DWQA 5JXVA 4LLGM 2BS2B 3CMMB 2JY6A 1MHXA 1KM7A 3B2FA 2LVOA 1F0ZA 3A4SC 3U30A 1FFVA 2X38A 4O1NA 2WXOA 2LGDA 2R2QA 4IOIE 2WDQB 4GLSC 4MJSA 3LJ3A 2IO2B 1QILA 3KWVA 4HCNB 2L3ZA 2K0PA 1OTRB 2MWSB 4USAA 4H2AA 5MPOA 2G9HD 2TSSA 2JXXA 4N9F4 1E90A 1LGRA 1LO5D 3QC8B 4L2YA 1E6EB 4ZRIA 4K3CA 3WAOA 2WXLA 5D3IB 2CR5A 4F8CB 3FILA 4TSSA 2CJOA 2WXFA 2AWTA 2DZKA 1C79A 2WXMA 4ZRKA 2M4NA 3Q3FA 4MELA 2KLGA 4LTUA 2I38A 1I7HA 1T6BX 4GU2A 1WRDB 1WX9A 2K8HA 1C4AA 4ANXA 2LMCA 5J2RA 4JPSA 4S17A 3DVGX 1TYGB 1FXIA 1HZ6A 3N1ZC 5E6PA 1WIAA 4US8A 2K22A 5BYRA 1DGJA 1VZ8A 2GBRA 1T0RC 5E6OA 4C56C 2OHFA 4RF1A 2IGHA 1LFDA 2LEKA 2KMMA 4CO7A 3PRZA 3LYYA 2DAFA 3NVVA 4HROA 4OZAA 4G3XB 1ZDVA 1L4DB 4GDLA 4D2KA 3H7SA 1ZGUB 4LJOB 4RGNA 4YWGG 1KRHA 2R61A 2RGFA 1TZ1A 3AE7B 3B1LX 3DHHC 1RLFA 1V80A 1XF5L 2FCSA 3AE9B 3IG3A 1TZOA 2Z0DB 3HM3A 4C4VB 1TKGA 2LHEA 3VDZA 1UF0A 2MBHA 2IDYA 4WWPA 4HXDA 3ZDTA 2WXQA 1XLQA 1QKZA 4RM9A 4IWPA 3KWLA 1ZE3D 4A20A 2N4FA 4PS7A 2HJ1A 1WJNA 3OJ4B 1VRAB 3Q8FA 1KOTA 3CIRB 3AU4A 1L4ZB 1C78A 1S1QB 3RNAC 2RPVA 3RT3B 1E0ZA 2WWZA 3AB5A 2BYFA 4OHJA 3B9JA 1WYWB 2GBKA 1EM7A 1WR1A 3R66C 1WSPA 2INDC 2KK8A 1N62A 3A1QB 1ET6A 2DHZA 2CHWA 4E74A 1GPXA 2JPHA 5G5HA 2H88B 2WHIA 4XGAB 1S3SG 1WI0A 4ZHOA 3BVZA 2G3QB 1P9DU 1HTOA 2BWFA 2XEWA 4K7SA 3KUDB 2FE8A 4BAXA 3BVGA 3PGEA 1C1YB 4LNFA 3TL5A 3V62A 2N7JA 2RMMA 1WE6A 3SHQA 4KGSA 2KQSA 3DHGC 3AEEB 3A33B 2FBWB 1FNWA 1KFYB 3Q6BA 2CS4A 1L0XB 2QEJC 2BB5A 4G50A 2I1JA 5I4DA 1EO6A 1F77A 3PO0A 2K39A 2KO3A 2KZRA 3V60A 1JROA 2IGGA 3T9LA 2M0XA 1K53A 1N6ZA 3EUB2 3HVDA 4ZRPA 4W9CA 3IXSA 5KHQA 4BBNF 1IP9A 1WGRA 1CZPA 3MTNB 2M19A 1KLVA 1GNUA
chains in the Genus database with same CATH topology
3GE8C 3Q3NC 2INDC 3N1YC 3Q14C 1T0QC 3DHIC 4P1CC 3RMKC 3RNBC 3RNFC 3N1XC 3DHGC 2RDBC 3RNCC 3I5JC 3N1ZC 3I63C 2INCC 3DHHC 3RI7C 3RNAC 3RNGC 3RN9C 3N20C 3Q3OC 4P1BC 1T0RC 3GE3C 3Q2AC 3RNEC 3Q3MC 1T0SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE8 C;  3Q3N C;  2IND C;  3N1Y C;  3Q14 C;  1T0Q C;  3DHI C;  4P1C C;  3RMK C;  3RNB C;  3RNF C;  3N1X C;  3DHG C;  2RDB C;  3RNC C;  3I5J C;  3N1Z C;  3I63 C;  2INC C;  3DHH C;  3RI7 C;  3RNA C;  3RNG C;  3RN9 C;  3N20 C;  3Q3O C;  4P1B C;  1T0R C;  3GE3 C;  3Q2A C;  3RNE C;  3Q3M C;  1T0S C; 
#chains in the Genus database with same CATH topology
 1HZ5 A;  1GC6 A;  2KNB A;  2ZVO A;  1FXA A;  1I4X A;  3VQI A;  3L08 A;  3EA6 A;  1YNT E;  1F2R I;  2V3S A;  3AE2 B;  2IY1 B;  3H7P A;  2WXJ A;  1WH3 A;  3NVW A;  1Y56 A;  1HXY D;  1CMX B;  3VR8 B;  1Q1O A;  2LZ6 A;  1HE8 A;  2ON8 A;  4W9H A;  2ZNV C;  2GRI A;  1JWS D;  5IKC M;  2GB1 A;  1MVK A;  1M94 A;  1WXQ A;  2PMV A;  4HPM B;  2L05 A;  3WIM A;  1Y8R C;  3AEB B;  1KTK A;  2J0K A;  2LGS A;  2DZJ A;  1YN3 A;  4RCO A;  1H4R A;  2BGF A;  4G0N B;  3W9C B;  1EF1 A;  2D2Q A;  2RPQ A;  2O2V B;  4DXG A;  4BBN C;  1YN5 A;  3QAR A;  3H1U A;  1BXT A;  4C7Y A;  2RDG A;  4WQM A;  1YQB A;  1P3Q U;  2MH7 A;  4IW0 A;  4ZHP A;  1QQR A;  1KLU D;  2E6X A;  4ANW A;  4A8X C;  2O6V A;  5FK9 C;  3UGB B;  1WXA A;  4II2 B;  1AW7 A;  4AUQ C;  1PGX A;  2MEK A;  4MSQ B;  4F7Z A;  3X23 A;  4W9K A;  3VRA B;  5JZE B;  2ZCC A;  2K1F A;  4XE0 A;  2N9E B;  3P4Q B;  4P16 A;  2ZPN A;  1KLG D;  2AL6 A;  4TKN A;  5BMG A;  1UNS A;  1D6E C;  4HVB A;  3EFU A;  3RFZ B;  1E8Z A;  5D94 A;  4OZB A;  2JRH A;  4M0W B;  2QMT A;  4WWM A;  3VTU A;  2WXI A;  3JW0 X;  2A5U A;  1MG4 A;  4AP4 C;  3RNC C;  5LXH A;  1TS5 A;  1I4G A;  2PEA A;  5L83 A;  2ONQ A;  5HI1 A;  5E6J A;  3MC9 A;  4GDK B;  1TIF A;  3BWU D;  2ZPY A;  3DDC B;  2LUE A;  3ZDM C;  4KZC A;  1GAQ B;  3CWI A;  3EFC A;  2EEL A;  4LDT B;  2WS3 B;  1ZPS A;  2D10 A;  2JZ3 B;  2LGI A;  3Q3N C;  3BII D;  1A5R A;  2LI5 A;  2JUO A;  3R3M A;  3GP7 A;  3VH4 B;  4KGR A;  4NPN A;  4EZL A;  5J18 A;  1XO3 A;  1AWD A;  1UUP A;  5C3J B;  1OQR A;  3GB1 A;  5BYQ A;  3OLM D;  4OVV A;  1J7B A;  2WXR A;  3MP9 A;  4I6N B;  3DVN V;  5D2M B;  1L6U A;  4NAW A;  1WXS A;  5DPW A;  2XBB C;  1GB1 A;  2DYB A;  5E6N A;  3IVF A;  1JRP A;  5FKA C;  1U4A A;  4A3O A;  2D3G A;  1V86 A;  3VVW B;  3VHT C;  2MJ3 A;  4J6I A;  1R4M I;  1FCC C;  3HRD D;  4GOC A;  2KFK B;  2MCN B;  3W5V B;  4HJK A;  2NTS A;  4M01 A;  4GIV A;  2DX5 B;  2RD0 A;  1JWA D;  2Y5C A;  1PDX A;  3QX1 A;  3N3K B;  3DVG Y;  4E3C A;  2D5G A;  2BB6 A;  2INN E;  3SR6 A;  4W9E A;  2KQ4 X;  2PIA A;  2J4X A;  2C60 A;  1E9M A;  3T3N A;  5IN7 A;  1FIQ A;  1E7U A;  4BOZ B;  1ROE A;  3ZUN A;  1L6V A;  2L32 A;  3TJP A;  4PK1 A;  1K51 A;  2V3N A;  3RI7 C;  2Q5W D;  3Q3O C;  4WJO A;  2N9P C;  4EUT A;  2SEB D;  3WA0 A;  1GB4 A;  4UDU C;  1YX6 B;  2KDM A;  4FUL A;  2EKE C;  1HTQ A;  2MBO A;  3ZVV A;  3JSV A;  3L4P A;  4DHZ B;  1V6E A;  1T0Q C;  2YLM A;  3VUX A;  3MJW A;  1KJT A;  2PE9 A;  3M62 B;  3Q3J A;  1MPE A;  2KDB A;  3CF6 E;  3TUO A;  4BFR A;  1YN4 A;  2KJH B;  3PSE B;  2KTF A;  5AZG A;  3NZS A;  3U52 E;  3OG5 A;  1VJK A;  2D3C A;  2KQ7 A;  3WCQ A;  2CU1 A;  2KMA A;  4ICV A;  4EOY A;  4NNJ B;  3R7Q A;  3RUI B;  2VRR B;  3AEF B;  4CQN A;  4C7Z A;  1M4V A;  3TEZ A;  3BIN A;  1R4M B;  3I57 A;  4MDK E;  1GOZ A;  4KDL B;  1E5W A;  4DBG A;  5EE1 A;  4LDT D;  3DBL I;  3ZO5 B;  1RWS A;  3AED B;  3OWE B;  1IBX A;  2ZW0 A;  2MJD A;  2JX5 A;  2IJ0 A;  4EEW A;  2D3B A;  4B6W A;  4KIK B;  2NBU A;  4YL8 A;  1FRR A;  3CSF A;  4C80 A;  4M8M A;  4YSZ B;  2JYT A;  2LGY A;  4HCP B;  2M1M A;  1JWM D;  4IDI A;  2KLC A;  1E7P B;  3M63 B;  2D07 B;  3QK0 A;  3UIN B;  3HM6 X;  3AE6 B;  2JWZ A;  3MFG A;  3IBE A;  3ZIM A;  3DHI C;  2CHX A;  3P63 A;  4W9L A;  2KVR A;  3U2S C;  2UU7 A;  2LD9 A;  1UGJ A;  2K8B A;  3PPA A;  5IOI A;  2LXA A;  1I4P A;  1ZUD 2;  4KZ0 A;  2NBV B;  2W54 A;  3KUC B;  3AN1 A;  1WMH B;  2J53 A;  4GN1 A;  3A9J B;  3I9V 1;  3ONS A;  4FJV B;  5D3D A;  1Z2M A;  4K7U A;  1I35 A;  4XX5 A;  3RN9 C;  4W9J A;  3RD2 A;  2KAJ A;  2J7Q B;  3NZU A;  1PFD A;  3A9K B;  4MM3 B;  2LAS A;  1V9J A;  3AE8 B;  3ZQ4 A;  2MP2 A;  3DBL B;  1STE A;  3QAQ A;  1XT9 B;  4WUR A;  2HTH A;  5AZH A;  1NDD A;  1P0R A;  3N20 C;  2V0G A;  1RAX A;  1V1P A;  3PRP B;  1IPG A;  1RFK A;  3KW5 B;  2XK5 A;  2EKI A;  2KC2 A;  3ZXR A;  3BY4 B;  1C76 A;  2KAN A;  1YJ1 A;  3DBH I;  2MJE A;  3T8M A;  4JX1 C;  2CJN A;  4WAA A;  4MH8 A;  1TGZ B;  2KWD A;  2W9N A;  2QSD A;  4IWO A;  4PS3 A;  3SU8 X;  5CHF A;  3RNE C;  5G2N A;  2WXN A;  1AAR A;  1WJ6 A;  3E56 A;  3PZD A;  4NJC A;  3ZRF A;  1GC7 A;  2QDF A;  1ESF A;  2CU3 A;  2K5P A;  4B0M A;  1PUT A;  1GG3 A;  4JGH B;  3B2G A;  4LNI A;  3CST A;  2RR9 A;  1P98 A;  3UF8 A;  3HK0 A;  2WXH A;  2QCZ A;  1BT0 A;  3NVZ A;  2UYZ B;  1QZE A;  2LXC A;  3WAP A;  5L95 C;  5DPR A;  1N5W A;  4A6Q A;  3N1X C;  2W55 A;  3LXF A;  2NS5 A;  5EDS A;  1ZXH A;  3MC8 A;  1TKE A;  2DAJ A;  2N1W A;  3PZ8 A;  4FHK A;  3PS6 A;  1WGK A;  1V5O A;  4RFB A;  3RNF C;  4GB9 A;  4NQK E;  4BKT A;  2MRP A;  3DBH B;  2WXK A;  2LVP A;  4X57 B;  2OOB B;  3L10 B;  4W9G A;  5AEK B;  2FUH B;  1PGB A;  3X0W A;  4XDD A;  3VTW A;  2V3P A;  2IGD A;  2NPT B;  2BTE A;  1C3T A;  2NBW B;  3PHX B;  2ICI A;  2W82 A;  2L83 A;  3D32 A;  3H8H A;  3OAW A;  3AE3 B;  4REZ A;  2KJ6 A;  2DEN B;  1RYJ A;  2V1Y A;  4E71 A;  3NUH B;  3VAW A;  2L52 A;  2IYD B;  1YMH E;  2ZEQ A;  2BYT A;  1ET9 A;  1XCT L;  2QJL A;  1T3Q A;  1SB3 C;  1UWX A;  1UGM A;  2IO0 B;  1L0V B;  2N7E A;  3QIJ A;  1Z5S B;  2LJ5 A;  4K3B A;  2YEP B;  1TTN A;  4DDG D;  3BVM A;  1WM2 A;  3BZD B;  4IG7 B;  2W3R A;  1D5Z C;  2ZVN A;  4WJP A;  4HRS A;  4RGO S;  5LXI B;  2RDH A;  3NY5 A;  3FIL B;  3K9P B;  5CHV C;  5CX3 A;  3AI5 A;  1RFA A;  3KYC D;  4XZ4 A;  1WM3 A;  4FJY A;  1FFU A;  1L0Y B;  3W2D A;  5C23 A;  3V3X A;  5HFY A;  4BOS C;  3EGR A;  3IHP C;  4QAY A;  3Q69 A;  1RM6 C;  1E10 A;  1J7C A;  3TMP B;  3RNG C;  5BMH A;  4A55 A;  3BYY B;  4J3O D;  1FCL A;  1L5P A;  2GBM A;  2PVO D;  2KTR B;  1YJI A;  3H6N A;  1ZW7 A;  2L0F A;  1H8C A;  2LUM A;  3SFD B;  3ABV B;  4GDL B;  2JQR B;  3A4R A;  4L23 A;  1J19 A;  2KHW B;  4MT5 A;  1B1Z A;  1NVI D;  1XEE A;  3DWG C;  3VUW A;  2MBE A;  1UBI A;  2PE6 B;  3P2B A;  1QOF A;  2C5L C;  1TJE A;  4P7I A;  2IO3 B;  3LB8 C;  1YX5 B;  2K9X A;  1BUI C;  2KFJ A;  4DXA B;  1KH0 A;  2WQY B;  1VDV A;  1C4P A;  3I3T B;  2E3T A;  2QIE B;  1KF6 B;  2FIF A;  1NI3 A;  3KUZ A;  4HJG E;  1JWU D;  2RDB C;  4GGQ A;  3DBR I;  4ZDV A;  1NBF C;  1LQB A;  1ENF A;  2MBQ A;  3P42 A;  2ZJD A;  2UWQ A;  3P4R B;  3N30 A;  4DDI D;  4LNO A;  2EMS A;  2KAC A;  1XD3 B;  2PVG C;  2IO1 B;  2K3U A;  4FXC A;  4A90 A;  4W9D A;  2LWP A;  2KX3 A;  2ZCB A;  3QWZ B;  2KMC A;  1ZP0 B;  4ICU A;  4IWQ A;  4EE2 A;  3IFW B;  4IM2 A;  2VH2 A;  1EU3 A;  1SF0 A;  4EZJ A;  3PLV A;  4KX6 B;  3UQA A;  1YD8 U;  1UWM A;  1E7V A;  1TY2 A;  3APC A;  3FKY A;  1GUA B;  3APD A;  1B9R A;  3NOB A;  3P1M A;  2FAZ A;  2KYW A;  2ASQ A;  1VCB A;  2J0J A;  3ZJT A;  3V6C B;  4YSY B;  2WU2 B;  1X1M A;  3AH7 A;  4NQL B;  5FR6 A;  5FR3 A;  1G6J A;  3ZLZ A;  1C77 A;  1FM0 D;  3VR9 B;  3V61 A;  1WX8 A;  2IY0 B;  3BK2 A;  1OFF A;  3URY A;  2OJR A;  4RGT A;  1SIF A;  2WX1 A;  4KVG B;  2CHZ A;  4KSL C;  3DBR B;  1CJE A;  4JWU C;  2B3A A;  3R2T A;  2JYE A;  4ZOH C;  1EU4 A;  4BKS D;  1XCQ L;  4FAD A;  5BO4 B;  1WYG A;  1DOI A;  2WXG A;  4HDQ A;  4LJP B;  1YJJ A;  4RMA A;  3L17 A;  3GZN I;  1VLB A;  2NR2 A;  3ML8 A;  3U8Z A;  4ZRQ A;  1E8X A;  3H7P B;  4L1B A;  3ML9 A;  3M3J A;  4ARC A;  4HDO A;  2FNJ B;  3ZNG C;  4YSX B;  3NS8 A;  1UBQ A;  1F9J A;  3DWM A;  2ZNV B;  1MJD A;  5EE3 A;  2XN9 C;  1P7F A;  3QA8 A;  4M8N A;  2DBY A;  2CKH B;  2PKO A;  3GS2 A;  4PT5 A;  3PLU A;  2KC1 A;  1AYF A;  1WWT A;  4F1S A;  2OJW A;  3RCZ A;  4BVU C;  2BBC A;  3TCA A;  4YTN B;  2K25 A;  1UH6 A;  1E8Y A;  4B9K A;  3TEX A;  2KXJ A;  1Q10 A;  2VH1 A;  2J0M A;  1LXD A;  2R2O A;  2PW9 A;  1YQ3 B;  3ZNI D;  4A3P A;  3L54 A;  4HK2 A;  5AZF A;  3AMZ A;  1PQS A;  3FC4 A;  2JU6 X;  3N1Y C;  3U7D A;  1SEB D;  3RUL A;  3NVY A;  4FA6 A;  2NVU I;  3ALB A;  3S2A A;  4NJ6 A;  1N5X A;  4C4V A;  2PJH A;  1QOG A;  3W5U B;  2KDE B;  2BYV E;  4RNA A;  4URK A;  4MGY E;  1TT5 B;  2JWU A;  2K6D B;  2O6V B;  2I2Y A;  1RRB A;  4YTM B;  3ZW3 A;  1WJU A;  3GZN B;  5IP4 D;  1TY0 A;  2I1K A;  3I5J C;  1BML C;  2K8C A;  2C7M B;  2WDV B;  4I6P A;  4MSM B;  4AOF A;  4FN2 A;  1MI0 A;  1WZ3 A;  3P4S B;  3DPD A;  4JQW C;  2BS4 B;  3A1Q A;  4BKG A;  2KKC A;  3UIP B;  4KSK C;  3ZTC A;  4HPP A;  2LVQ A;  2C7H A;  3H9D A;  3VTV A;  4WWN A;  2LHD A;  1LM8 B;  4N6E B;  1SJE D;  5HKH A;  2WYQ A;  1C9F A;  3J9C A;  3SD5 A;  4FJZ A;  2J52 A;  2V4I B;  4ANV A;  5T8I A;  1HEZ E;  1JWB D;  2G4S A;  3HUI A;  3NHE B;  5CTR C;  2BWE S;  3L0W B;  4AJW A;  1SGH A;  4CHK A;  4GSW A;  1WR6 E;  2KT7 A;  2L7R A;  2BW2 A;  2DYO A;  1SE2 A;  3IAS 1;  2Z59 B;  4DXF A;  1F1H A;  2NPT A;  3V6E B;  1SXT A;  1QF6 A;  2MQJ A;  3TEW A;  1YIW A;  3PHW B;  1VZ7 A;  1WF9 A;  1V97 A;  1WY8 A;  2DZM A;  1ZXI A;  4B95 A;  1OEY J;  4NAW B;  2DYM A;  3NJT A;  4HPL B;  3PRE A;  1TS4 A;  4ACF A;  4DK5 A;  1P1A A;  1XQQ A;  3R7R A;  1WRI A;  2BYE A;  2AX5 A;  5C2T B;  4KDI C;  1OQY A;  2Y3A A;  4LCD E;  4AS1 A;  1PYW D;  2Z8L A;  2BS3 B;  3FAH A;  3Q14 C;  4OW0 A;  4PYU A;  1NYR A;  4DWF A;  1J8C A;  2GOW A;  1E8W A;  3QHT A;  3ZGZ A;  2MSE D;  2L76 A;  2INC C;  1WFY A;  2JVC A;  4XC2 A;  1FMA D;  1WE7 A;  4LK0 M;  3WAM A;  3DCG A;  1FNU A;  4FHJ A;  4ZYN A;  1V5T A;  1VD2 A;  3W1Y A;  4BKS A;  1V1O A;  4N59 A;  1SE3 A;  2L8J A;  3PRM B;  3Q8E A;  3AEA B;  2KD0 A;  1PGA A;  1DOY A;  2GMI C;  4ARI A;  4JE3 B;  1WJ4 A;  2DZI A;  3AEG B;  4EKU A;  3N9Y C;  2KTR A;  2O6V D;  4M00 A;  2L1A A;  3ZTD A;  1V49 A;  4MEM A;  3ZJV A;  2HTM E;  1VR9 A;  1NEN B;  4W9F A;  4WQO B;  2O2V A;  3QQ8 B;  3JSV B;  4MGK E;  1JCK B;  2GBJ A;  2MBB B;  4MH0 E;  2WU5 B;  3B08 A;  1TS3 A;  4MAC A;  1EUV B;  1N63 A;  4HKZ E;  3Q8B A;  3DOW A;  1NI2 A;  2M0A A;  1SBB B;  4R3D A;  4DHZ E;  3VH3 B;  4ASW C;  3Q2A C;  1T0S C;  3AU5 A;  2QIL A;  4IKG A;  1ZKH A;  2HE7 A;  4OVZ A;  2Y5P A;  5TR5 A;  3SEB A;  2M56 B;  1V2Y A;  1ZOY B;  1UZX B;  3B0A A;  4Q2J A;  1K8R B;  2YVC A;  2K6Q A;  3QCA A;  2EMT A;  3DVN U;  3U4E G;  3L13 A;  2WX0 A;  3NG0 A;  4OZC A;  1K52 A;  4ITK A;  3TIX A;  1GJZ A;  5CHW A;  1IBX B;  1F2R C;  3KYD D;  1UD7 A;  1D3Z A;  1WXM A;  2JXT A;  3V05 A;  5TSS A;  3RZF A;  2WDR B;  1Q5W B;  5AUK A;  3RPF C;  3WAL A;  4AJY B;  1L7Y A;  3C19 A;  3KQ4 A;  4M0W A;  1I4R A;  2KWV B;  2PTL A;  1XXG A;  3RYT A;  5EE0 A;  3NRZ A;  4WJQ A;  4TQ1 A;  2JRI B;  2FID A;  1YOV B;  4S0R A;  4XWW A;  5LLI A;  3L16 A;  4MGZ E;  1MFW A;  1QOA A;  1V8C A;  3ENE A;  2KN5 A;  2VZK B;  4GDK A;  2M17 A;  3NZ3 A;  3ECI A;  3VXW A;  4MJS B;  2Y5B B;  2IZV B;  4LNN A;  2JZP A;  1SE9 A;  1MG8 A;  2D3A A;  2QHO A;  2KWC A;  5JHA A;  3O13 A;  2WNM A;  4IC7 B;  5G55 A;  2LGX A;  1L2N A;  1XLN A;  1OQQ A;  4TUU A;  1QOB A;  1I4Q A;  4JLC A;  1TBE A;  2HD5 B;  4RM8 A;  2G1E A;  2LJI A;  1K50 A;  2KX0 A;  3MC0 B;  4A9A A;  3UI3 A;  4W9I A;  2AQ1 B;  3LDZ E;  3MHS D;  2GI9 A;  4BZA A;  1VZ6 A;  1R4N I;  1EWC A;  1CK1 A;  2IPK D;  4TQ0 A;  2JSV X;  2MP2 B;  5BMI A;  2X8X X;  1A70 A;  1IGC A;  2KJR A;  3JVZ X;  4II3 B;  1I4H A;  1V1P B;  4DHJ B;  2KFK A;  4YTP B;  2XK5 B;  1FRD A;  3R8B A;  1C4C A;  3MHZ A;  3DBS A;  1EWY C;  2N7D A;  1F52 A;  4XDC A;  4US9 A;  2NCN A;  1TS2 A;  4XYC A;  2ACZ B;  2G45 B;  4WWO A;  4CYE A;  4NZL B;  3VFK A;  2M8S A;  2REX A;  2ZW1 A;  3ETR A;  3OJ3 A;  2BQQ A;  2FCM A;  1D5M C;  4JIO U;  2J42 A;  2MHJ A;  2PPH A;  3RNB C;  2H89 B;  2W3S A;  4B0E A;  2GLS A;  4GMV A;  3Q8C A;  4HLE A;  3KLS X;  3AV8 A;  1J7A A;  2JF5 A;  1WX7 A;  2LFI A;  2KN4 A;  2NTT A;  3GE3 C;  2N9L A;  3ZJU A;  3HIZ A;  4XWT A;  2ZZP B;  4FLH A;  1JAL A;  1SSN A;  2WGS A;  4NAM A;  2MW5 A;  2N1V A;  1QT9 A;  2V9H A;  3DQV A;  5D6J B;  3UQB A;  1CQV A;  3U7Z A;  1JW9 D;  4NY0 A;  3I63 C;  3Q8A A;  1D5X C;  2G4D B;  4K1R B;  2B76 B;  1FO4 A;  4JL9 A;  3APF A;  2NMQ A;  1R4N B;  2JT4 B;  2A4Z A;  5D7G A;  5C1Z A;  4JWS C;  3SFE B;  1XLP A;  1EF5 A;  1TKY A;  5LNK 1;  4NJ7 A;  5H92 C;  1V81 A;  4ANU A;  3IT6 B;  4TMA B;  3SDL C;  2VZK D;  1MHH E;  4IUM B;  1N60 A;  4HKQ A;  5DPS A;  4RH6 A;  2DLB A;  2LRU A;  5GXG B;  3PT2 B;  2FCN A;  5H8Y E;  1T0Y A;  5KHO A;  2V4L A;  1IUE A;  4P6V F;  2N9X A;  1R7S A;  4RF0 A;  2KVZ A;  2AQ2 B;  4KIK A;  2WP9 B;  1DYQ A;  4I6L B;  4FBJ B;  2BVC A;  3ZYY X;  2WDT B;  1N61 A;  2KDI A;  3TSS A;  4GXB A;  3KH0 A;  1FEH A;  3AXC A;  3C8Y A;  1YQ4 B;  1WGH A;  2GBN A;  3W1S A;  5EE9 A;  5HHD G;  2AL3 A;  4EZK A;  3NS1 A;  3EEC A;  3W1S C;  1Q0W B;  4KKJ A;  3E9S A;  3K9O B;  3TBL D;  1D4B A;  3AUL A;  1IGD A;  1FD6 A;  4MGI E;  1WGY A;  3ZXV A;  1SIJ A;  2JZZ A;  1HA5 A;  3IT4 B;  1SE4 A;  3ZKJ C;  3ZRC A;  4PYZ A;  4OVU A;  1WMH A;  4DHJ D;  3QJZ A;  3ZNH B;  3A9J A;  1OEY A;  4AWJ A;  5IO9 A;  3ZNZ B;  3C0R B;  3BYT B;  2DNF A;  3R2I A;  4WIP A;  3WAN A;  1ACC A;  5JHB A;  3AE5 B;  4LNK A;  4P1B C;  2BT6 A;  3AM9 A;  3A9K A;  3BK1 A;  4EFO A;  3AEC B;  3HHM A;  4MM3 A;  2FCQ A;  3UIO B;  2BF8 B;  4G11 A;  1DOX A;  1JML A;  2WLB A;  5HG2 A;  2L0T A;  2KDF B;  1OGW A;  2D11 A;  2INP E;  2BKR B;  5GMV A;  2PLP A;  2BKF A;  2FUG 1;  4YT0 B;  4K7W A;  2C7N B;  4KGT A;  4N58 A;  4RGM A;  1QLB B;  2RSU A;  3PVL A;  4WAF A;  2HJ8 A;  1SJH D;  4IM3 A;  1J0G A;  1WZ0 A;  3RMK C;  4HWI B;  3HVZ A;  2KWU B;  3MJ5 A;  4KV2 A;  4K81 A;  2SAK A;  3JYU A;  1ISN A;  2QC8 A;  3M95 A;  3IAM 1;  1P7E A;  5DPT A;  3KVF B;  5G5G A;  2L00 B;  1JQ4 A;  3PV1 A;  2HDE A;  1JRU A;  3GE8 C;  4WH4 A;  4HEA 1;  5IA7 A;  2C9W B;  1WXV A;  3N32 A;  1WGG A;  4ZYS A;  1I42 A;  1ZDX A;  2XNA C;  3PZ7 A;  3EHV A;  1UEL A;  1XLO A;  2MA9 B;  4WJN A;  3AE4 B;  1IYF A;  1WGD A;  4AQ7 A;  5AUI A;  3GOE A;  2OED A;  2AQ3 B;  4ZRJ A;  4PS8 A;  5IAA C;  1AN8 A;  4YXD B;  3P4P B;  3VRB B;  3EC8 A;  1FPY A;  1NEK B;  4IM0 A;  3VUY A;  5J17 A;  2IBI B;  2YEP F;  1HQR D;  2AEH A;  3T3O A;  4KKI A;  2BPS A;  4DQO C;  1T5X D;  1NYQ A;  2MX2 A;  3O65 B;  1FXT B;  1FNV A;  2WXP A;  3PTF C;  2MLB A;  3RZW C;  3Q3M C;  2N9K A;  5BYS A;  3AE1 B;  2N0S B;  4P1C C;  5DCN A;  4M02 A;  4C00 A;  5JH5 C;  2KOX A;  2LRW A;  4TV3 A;  2AYO B;  2Z0E B;  3TEY A;  2DWQ A;  5JXV A;  4LLG M;  2BS2 B;  3CMM B;  2JY6 A;  1MHX A;  1KM7 A;  3B2F A;  2LVO A;  1F0Z A;  3A4S C;  3U30 A;  1FFV A;  2X38 A;  4O1N A;  2WXO A;  2LGD A;  2R2Q A;  4IOI E;  2WDQ B;  4GLS C;  4MJS A;  3LJ3 A;  2IO2 B;  1QIL A;  3KWV A;  4HCN B;  2L3Z A;  2K0P A;  1OTR B;  2MWS B;  4USA A;  4H2A A;  5MPO A;  2G9H D;  2TSS A;  2JXX A;  4N9F 4;  1E90 A;  1LGR A;  1LO5 D;  3QC8 B;  4L2Y A;  1E6E B;  4ZRI A;  4K3C A;  3WAO A;  2WXL A;  5D3I B;  2CR5 A;  4F8C B;  3FIL A;  4TSS A;  2CJO A;  2WXF A;  2AWT A;  2DZK A;  1C79 A;  2WXM A;  4ZRK A;  2M4N A;  3Q3F A;  4MEL A;  2KLG A;  4LTU A;  2I38 A;  1I7H A;  1T6B X;  4GU2 A;  1WRD B;  1WX9 A;  2K8H A;  1C4A A;  4ANX A;  2LMC A;  5J2R A;  4JPS A;  4S17 A;  3DVG X;  1TYG B;  1FXI A;  1HZ6 A;  3N1Z C;  5E6P A;  1WIA A;  4US8 A;  2K22 A;  5BYR A;  1DGJ A;  1VZ8 A;  2GBR A;  1T0R C;  5E6O A;  4C56 C;  2OHF A;  4RF1 A;  2IGH A;  1LFD A;  2LEK A;  2KMM A;  4CO7 A;  3PRZ A;  3LYY A;  2DAF A;  3NVV A;  4HRO A;  4OZA A;  4G3X B;  1ZDV A;  1L4D B;  4GDL A;  4D2K A;  3H7S A;  1ZGU B;  4LJO B;  4RGN A;  4YWG G;  1KRH A;  2R61 A;  2RGF A;  1TZ1 A;  3AE7 B;  3B1L X;  3DHH C;  1RLF A;  1V80 A;  1XF5 L;  2FCS A;  3AE9 B;  3IG3 A;  1TZO A;  2Z0D B;  3HM3 A;  4C4V B;  1TKG A;  2LHE A;  3VDZ A;  1UF0 A;  2MBH A;  2IDY A;  4WWP A;  4HXD A;  3ZDT A;  2WXQ A;  1XLQ A;  1QKZ A;  4RM9 A;  4IWP A;  3KWL A;  1ZE3 D;  4A20 A;  2N4F A;  4PS7 A;  2HJ1 A;  1WJN A;  3OJ4 B;  1VRA B;  3Q8F A;  1KOT A;  3CIR B;  3AU4 A;  1L4Z B;  1C78 A;  1S1Q B;  3RNA C;  2RPV A;  3RT3 B;  1E0Z A;  2WWZ A;  3AB5 A;  2BYF A;  4OHJ A;  3B9J A;  1WYW B;  2GBK A;  1EM7 A;  1WR1 A;  3R66 C;  1WSP A;  2IND C;  2KK8 A;  1N62 A;  3A1Q B;  1ET6 A;  2DHZ A;  2CHW A;  4E74 A;  1GPX A;  2JPH A;  5G5H A;  2H88 B;  2WHI A;  4XGA B;  1S3S G;  1WI0 A;  4ZHO A;  3BVZ A;  2G3Q B;  1P9D U;  1HTO A;  2BWF A;  2XEW A;  4K7S A;  3KUD B;  2FE8 A;  4BAX A;  3BVG A;  3PGE A;  1C1Y B;  4LNF A;  3TL5 A;  3V62 A;  2N7J A;  2RMM A;  1WE6 A;  3SHQ A;  4KGS A;  2KQS A;  3DHG C;  3AEE B;  3A33 B;  2FBW B;  1FNW A;  1KFY B;  3Q6B A;  2CS4 A;  1L0X B;  2QEJ C;  2BB5 A;  4G50 A;  2I1J A;  5I4D A;  1EO6 A;  1F77 A;  3PO0 A;  2K39 A;  2KO3 A;  2KZR A;  3V60 A;  1JRO A;  2IGG A;  3T9L A;  2M0X A;  1K53 A;  1N6Z A;  3EUB 2;  3HVD A;  4ZRP A;  4W9C A;  3IXS A;  5KHQ A;  4BBN F;  1IP9 A;  1WGR A;  1CZP A;  3MTN B;  2M19 A;  1KLV A;  1GNU A; 
#chains in the Genus database with same CATH homology
 3GE8 C;  3Q3N C;  2IND C;  3N1Y C;  3Q14 C;  1T0Q C;  3DHI C;  4P1C C;  3RMK C;  3RNB C;  3RNF C;  3N1X C;  3DHG C;  2RDB C;  3RNC C;  3I5J C;  3N1Z C;  3I63 C;  2INC C;  3DHH C;  3RI7 C;  3RNA C;  3RNG C;  3RN9 C;  3N20 C;  3Q3O C;  4P1B C;  1T0R C;  3GE3 C;  3Q2A C;  3RNE C;  3Q3M C;  1T0S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...