1ET9A

Crystal structure of the superantigen spe-h from streptococcus pyogenes
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
195
Chain Sequence
NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKNLSVFFEKDWISQEFKDKEVDIYALSAQERYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPERANTIGEN SPE-H
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 56
structure length 195
sequence length 204
ec nomenclature
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1et9A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1et9A01
1T5XD 4K6LA 1KLUD 3O13A 1EEID 1AW7A 1LT5D 5D3DA 3TSSA 1D5ZC 3R2IA 5D3IB 4RH6A 2RDGA 1PZID 3DWAA 3DWPA 3GP7A 1BCPB 1EWCA 3R8BA 3V05A 1PZJD 1L0XB 1DJRD 4RGTA 1KLGD 5ELDA 4C56C 1YN5A 1AN8A 1TY0A 4UDUC 1CQVA 3W2DA 1EEFD 4RFBA 1HA5A 4RHSA 1S5FD 2QILA 1PTOB 1HTLD 4DXGA 1TS2A 2AQ2B 4NZLB 3URYA 1SJHD 3BVMA 1I4QA 1SE2A 1LT3D 2CHBD 1FNUA 1F77A 1LTID 1PRTF 1XXGA 2QEJC 1B1ZA 1YN4A 1I4GA 5ELEA 1BXTA 2NTTA 1RDPD 1S5DD 5ELCA 1XTCD 1LT6D 5ELFA 1V1PA 2Z8LA 1LTBD 1PTOC 1LTSD 2IJ0A 1SJED 5ELBA 1FGBD 1ET9A 1PRTD 1ENFA 2O2LD 1FNVA 2XNAC 1JCKB 1PZKD 2RDHA 1V1OA 1EU4A 1QILA 1S5BD 1FNWA 4L6TB 1JWSD 1JWUD 3BVGA 1LTAD 2NTSA 2SEBD 1TS4A 1UNSA 4O1NA 3MC0B 1UUPA 1ESFA 4RHRA 1RF2D 3BZDB 3EA6A 3R2TA 2AQ1B 1LLRD 4L63B 1CT1D 1PRTC 1PTOH 1FD7D 3BYTB 1PYWD 4TSSA 1I4PA 2TSSA 1L0YB 1D6EC 1MD2D 4ZYSA 1D5MC 3SEBA 2G9HD 1M4VA 1KTKA 1PRTB 3CHBD 1JR0D 4RGMA 1HQRD 1BCPF 1TY2A 1EFID 4BWGB 1SE4A 1TS3A 1I4XA 3MFGA 1SE3A 1G8ZD 1I4RA 1S5ED 4Z9CB 2AQ3B 1S5CD 5FK9C 1ET6A 1CHPD 2XN9C 2ICIA 1RD9D 1HXYD 1LT4D 1LTGD 1SBBB 1JWMD 5FKAC 4DXFA 1EU3A 3DWQA 1YN3A 1DYQA 1CK1A 1JQYD 1PTOF 1BCPD 1LTRD 3BYYB 1CHQD 1V1PB 2XRQD 5TSSA 1SEBD 4OHJA 1TS5A 2WV6D 2XRSD 5I4DA 1LTTD 1RCVD 1SXTA 1STEA 2R61A 3EFXD 1B44D 3BVZA 3KLSX 4RGOS 1D5XC 2IPKD 2J4XA 1I4HA 4RGNA 1PTOD 1GOZA 1LO5D 1BCPC 4RCOA 3OWEB
chains in the Genus database with same CATH superfamily
4K6LA 2JJQA 1JMLA 1NTGA 3JAMc 4OX9L 5D3IB 3KF8A 3QB3A 3C19A 1PZID 3PQIA 2MWSB 4KN7C 3AEDB 5DPSA 3BDCA 4GZYC 3UIPB 5A2QL 2UXBL 3VYUA 3A1QA 3JAMi 3E5SA 3HOZG 2BH2A 1DCZA 1MIUA 1C4PA 3A9KA 5L37A 2IHFA 2DAFA 2WFWA 3CCUA 2Z9HA 1XMOL 1S5FD 5JJZA 3HVDA 4H02A 3QARA 2MBBB 1HTLD 2WP9B 1R4NI 1ZYRC 3N1XC 2Z6KA 4RF0A 2D5GA 1XTDA 2AL3A 3BVMA 4Y7NH 2FCMA 4OZCA 3PREA 4K2KA 4ICVA 3PHWB 1CKOA 4HAEA 4DHJD 1NR2A 2B2TC 3D4RA 4ZK9B 4K0KQ 3RULA 2K05A 2SOBA 4QIWE 4FDBA 4U68A 2V3PA 3GE3C 5G2NA 1GUGA 4AP4C 2PTLA 2M0AA 3V62A 4POGA 1VQFA 1WD0A 3N9YC 2BA0A 2RDFA 4BY1B 2CCZA 1PUTA 3C0RB 4MIUA 5J3BA 3AB5A 1HZ9A 3UQBA 2K28A 5KNBA 1OXXK 3PMFA 1SNQA 5L83A 1ENCA 3KYDD 4IUPA 2NCNA 3QO2A 1JMCA 1FNWA 1JJCB 2E74C 5C3XA 4DAVA 4HIKA 3FMCA 2AYOB 3IL8A 2BVCA 1AARA 4Q5VA 3P20A 4JWSC 4P1CC 3TUOA 3T3NA 3U52E 4FO2A 2CJOA 1RF2D 3DHQA 4RMFA 2INPE 3NVVA 2GN5A 1EFWA 1MJEA 3MA2B 4YWMA 3J7ZC 4X65L 1J7BA 1D6EC 1IYUA 3QX1A 4JI7L 3CPFA 1YHQA 2V4IB 1EYCA 5KHOA 3A55A 4YWGG 3ZNHB 1H4RA 2ZNVB 1DGSA 3CXCA 3PLVA 3ZLZA 2WKDA 1UD7A 4ZRQA 3ND9A 4CKBA 3S2HH 4R4TA 4KIKA 3RMHA 2EYPA 4BWGB 4JPSA 5M9OA 1SRUA 2HQEA 3Q3OC 3I63C 2O6VA 1S5CD 2EELA 1Q82C 1MI2A 3F2CA 4JE3B 4LF7L 5LXHA 4DV3L 1DYQA 2YLMA 2BTEA 2PMZB 1RM6C 2LGYA 1L0VB 1VQMA 1Z6HA 1BCPD 5CC4A 2B63B 4DR7L 5J1ZA 5HFYA 2Z0EB 2L0CA 1V1PB 2EJMA 4IUVA 2HT1A 1X54A 4B6WA 2KWVB 1VDZA 4R1JA 4LF4L 2L05A 1WFQA 3SHQA 2VQFL 3HFZB 1OEYJ 3PCOB 4QB4A 3H3VH 3ZRFA 4HJKA 4A3LH 4IM3A 1X56A 2E8GA 1KJTA 4IZ8A 2LZ6A 4FNFA 4PS7A 2G45B 3FHWA 1I4HA 2MP2A 1C4CA 4IDIA 3RNBC 2BF8B 3ITPA 2RSOA 4ZQ3A 3P2BA 2LI5A 4MDKE 5HI1A 3ZJVA 2CQAA 1V49A 1J9OA 2FFKB 1OXVA 4AIMA 2NB0A 3OTOQ 1E7VA 4HWIB 3KDFB 3QK0A 3R2IA 1EIYB 4IOIE 4WQMA 1E7PB 4RM9A 1B3AA 1SNDA 3S1RH 3S17B 2RBMA 3ZUNA 3CWIA 1X6OA 2KQ7A 3PSIA 2WXOA 4A3EH 1EM7A 2Z0DB 1C0AA 3Q3MC 4LK0M 4S3SA 1X55A 2PMZE 4W9GA 4GSWA 4LNFA 1PMRA 3ULLA 2J52A 4LFBQ 3FPUB 2REXA 1Y69U 4XDCA 1T0QC 1DOLA 1NVID 2JT4B 2AUJD 5GADC 1B50A 2OEOA 3IT4B 2DYMA 2F52A 2KFKB 4GLSC 1RKNA 3U7ZA 1EO6A 1XYIA 4GLXA 1E6EB 4HDOA 2Q2HA 1STYA 3EUB2 3FKYA 5LMNW 2KKCA 3JVZX 1BXTA 5DPRA 4QL5A 3U4VA 4HR7B 4GOCA 4FF4A 3NBIA 4G11A 3VUXA 2Z8LA 4LW1A 3G6EA 2IJ0A 2KN5A 1SJED 3H6MA 1AE2A 4OIJA 1HR0L 1ILPA 1P98A 2LGDA 3VXWA 4H13C 3Q8BA 1N36L 4N9F4 3T9LA 3KUPA 1GC7A 1HZ5A 2JRIB 4R4IA 2V1CC 3PV1A 4I7ZC 3MHSD 2HIVA 3HRDD 3RN9C 2B2YA 3PZ7A 3A4SC 3W5UB 1KABA 1YX6B 3MFYA 2GBNA 2SEBD 4P7IA 3NJTA 3P4PB 2P5ZX 4JI3L 4DUZQ 3HKZG 4DR2Q 4E74A 2N9EB 4TQUS 4R8NA 2Y5CA 1PA6A 1L6UA 4MH0E 1PH4A 2AQ1B 3GV3A 2JEAI 2L76A 1II3A 2A19A 3RZDH 1WX8A 2JZ3B 1L0YB 4DR5L 2CHWA 5F2DA 2E6XA 4M00A 2WP8J 4ZAIA 4AYBB 1WE6A 2HCCA 1TIFA 5IP4D 2QKIC 5JJLA 2E75C 2JA6H 2UXDL 4HLEA 3CHBD 2XIWA 3CQZH 4XC2A 2LRWA 4A3EG 4RGMA 4HJ7A 4A3JB 1UZXB 5AFWA 2I5MX 1EQRA 3W5OA 5TR5A 1TY2A 4CO7A 4K3BA 4KHPL 3QAQA 3ICEA 2WXNA 4LF9L 2MJDA 1VQOA 1WTVA 5KIXA 3NUCA 4FYDA 4JPBW 1RD9D 1YQ4B 4GKKL 3R3OA 2K50A 2N9XA 1DOXA 2L7RA 2ZXOA 3J81E 4ALPA 2KUMA 1HTOA 2XBBC 4LJZC 2A68D 2QGQA 1T0SC 2I07B 1L2FA 2R7ZB 3GTLH 4OO1H 5CTRC 5HGQA 3RNGC 3PUYA 2NBUA 1UGJA 3IVFA 1PV4A 4YT0B 3RZFA 4RGNA 3SR6A 3KLWA 1VQIA 4ME3A 1H8CA 2WXPA 3BIID 4AYBE 5IP7H 2BKFA 1LO5D 4J8QA 3CC7A 3LWUA 4JQWC 3M7NA 5CHVC 2ZVNA 2HHHL 2LMCA 2GOWA 2E2JH 1S3OA 3NOBA 4WJQA 3VRBB 4K81A 1T9HA 1VQGA 2B2UA 3S24A 2EY6A 2ZW0A 4IOAA 4JOIA 1G291 4OWXB 1W6KA 5IP9H 1KXLA 2MLBA 2WXFA 4F7ZA 1NBFC 2V0GA 3ZJTA 2EVBA 3DBLI 3K59A 3H3VI 3IG3A 1EOVA 1F2ZA 1Q5WB 4DK5A 4ID6A 2F0DA 4EZJA 3WAPA 4JI2L 1YNJC 3F1ZA 3J81c 4BBRB 4X64L 2JA6G 2QDFA 5C6AA 4FJYA 4A3KH 3FILA 1I50H 3KYHC 1LXDA 3J81i 1B8AA 3NZ3A 1I4QA 2CHBD 2F4VL 3HVZA 2KYWA 4X66Q 5E6OA 3HRZC 1QWYA 3KLSA 5IYCH 1B1ZA 1V5TA 2B3GA 1HUMA 1I4GA 4IOCA 3PUZA 3SVMA 1YVCA 2JX5A 4MM3B 1WSPA 4MNOA 4RKBA 1EWHA 3Q8DA 4ME5A 4JC0A 4FHKA 3VYSA 1PGXA 2KTRB 4YXDB 3RN5A 2MA9B 1B4OA 4I65A 2DUDA 5M5XB 4B3SQ 2GLSA 1STGA 5M5YH 3DWMA 4L1BA 3MEHA 4WWNA 2CKZB 2KC1A 4LNOA 4GB9A 3G4SA 3ZTCA 2FIDA 4OO1G 2JZPA 4KI0A 2IY5B 1UE6A 4XZ4A 1OEYA 1TZ1A 4XYCA 2NTSA 2F0UA 5FLXL 2INCC 1FD6A 4H44C 2JA5B 1D3ZA 1B3QA 1F9SA 2B39A 4HTHA 4DHJB 3F8TA 2LVOA 2KFJA 3RI7C 1DOIA 3HIZA 5MPOA 3KOJA 3QOJA 5EPKA 3I9V1 2X6GA 2KBNA 3NTKA 3BYTB 3RR5A 4DR4L 1Y1WG 4BBSB 4Y52H 2R2QA 3V3XA 1KM7A 4BOZB 4EZLA 1JOQA 5IP9G 1WTQA 3CMAA 2PQEA 5I6WA 4TKNA 1GJZA 3PIP3 1FXTB 1WWTA 4IC7B 3BY4B 3DDCB 3NVZA 3VHTC 1NEKB 2K8HA 5J17A 1XLPA 3DBRI 4C00A 1WGHA 3T1HL 3L17A 4GDKA 1H9RA 1BQQT 1I4XA 1SE3A 3W1SA 4JG2A 3G71A 4DV5L 4BVUC 1YEZA 2ENBA 4DV4Q 1L4DB 2KMAA 3W1YA 2Q8IB 2C60A 4A3KG 2IBIB 2ICIA 4XDDA 3WOFA 4DV1L 1SBBB 4NAWB 2D0PA 1C77A 4FBJB 1DOKA 3T3OA 1WXVA 3I91A 1ZGUB 4V190 5EKIA 1GUOA 5J22A 3QWZB 3H6NA 4L5QA 3U8ZA 2KA7A 1K8MA 3DUZA 3F2DA 3T51B 5IYCG 1QJOA 3R3MA 2RR9A 1M90C 3C8YA 5ELNA 1NYQA 4NAMA 1FYCA 1E8YA 2WDVB 4KHZA 4A3MB 1STBA 3AEAB 1OO9B 1SXTA 2K4KA 3I90A 4RKLA 4YCWA 1V8QA 3T56B 3U9OA 2J4XA 1C9FA 1IBLQ 4BKSD 1MG4A 4O42A 4N58A 4W9CA 4DQOC 4JBMA 3GTPB 1C48A 3L3OC 1E0ZA 1XMQL 5M5WB 5IGBA 2Q5WD 4IWQA 4W9KA 3GTKB 5IOIA 4N9PA 4IFDJ 1JWBD 3J80L 1V9JA 3OWEB 3RNUA 3NS1A 5T8IA 1KHIA 1BO0A 3S9WA 1KD1C 3S14H 4NPNA 3NS8A 2K33A 3RZOH 2K5QA 2KCNA 2GVAA 3MXNA 4WAFA 1BCPB 1A8VA 1FXIA 1TKYA 4R4CA 1VQEA 1DJRD 3AE2B 2BE5D 3HP3A 5ISRA 4HPMB 1D7QA 2ZJDA 1WX7A 1CSPA 1LACA 2B2VC 3L7ZC 3CIRB 5G55A 5FR3A 1U4RA 1T5EA 4MGYE 1EYDA 4FLHA 4M01A 1K8OA 4E6IA 2E2IH 4DXGA 1TS2A 1M8AA 4NP5A 1Q1OA 2LFNA 5CV8A 1ROEA 4I6PA 1G6JA 1YJ1A 4K5VA 1KRTA 2IO3B 5EE3A 4A3GH 1EQVA 1V43A 3CRKC 3MHBA 1PRTF 3KDFA 3PO3B 2O2VA 1UELA 3SK5A 3S2DH 2RVLA 1FM0D 4RMAA 4K8JA 4NDXA 1CKMA 4GNXA 3HS0C 3GTMB 2PLPA 2DX5B 1VQ8A 2FE8A 2D07B 4IG7B 2WU2B 4QUFA 1LTSD 3GTJH 3UIOB 4DGZA 3AULA 3VYTA 5I2XA 2KWCA 4J6IA 1I3QH 1RTOA 2MQHA 1YJNA 3QJZA 4X3SA 2GBRA 1QKZA 4HJAA 4ANWA 1QZEA 4CDDC 2ZTCA 1F2RC 3H7PA 1TZOA 4YY3Q 3E56A 2W9NA 3LXFA 5AZHA 1KRSA 2DJFC 2KFKA 4GGQA 1E90A 2F0LA 1P8LA 1KNAA 3I3TB 1J0GA 2PO4A 1V9PA 3UE0A 3MC0B 1EY5A 3KJOA 1C9OA 1A63A 4JK1C 1E7ZA 4K5WA 1F9PA 2CH4A 1UGMA 2KCMA 4C7ZA 3GO5A 2B29A 2XVSA 4HIMA 2F0PA 3MZ5A 1HNWL 2MEKA 3ZQ4A 4UPAA 2NVUI 3B1LX 1WJJA 3BG3A 2BGFA 2EKEC 2Z0SA 3OWFA 3S1NB 1YNNC 2G9DA 5I2YA 3ML8A 1XNQQ 3SD5A 4IJHA 3AI5A 1B9NA 1QQRA 5I6YA 1Y14B 2YU9B 4KZ0A 1B53A 3L4PA 1VDVA 2G4SA 4GN5A 1ML0D 2OWOA 1AZPA 2UU7A 3BZCA 1CHPD 1H9KA 3K80C 1K8GA 4BY1H 1EYAA 2KQ3A 4A3DH 1YN3A 2RSNA 2HE7A 1UEAB 4FXGC 3VR6A 4EX5A 1IBMQ 1PTOF 4A3GG 2UUAQ 1GJXA 1P7FA 3R66C 4PYZA 3ZNZB 4L2YA 1JQ4A 2DZMA 3RMKC 2MRPA 4JI1L 2D5DA 4O0AA 1JRPA 1KDAA 3WA0A 1U4LA 4OHJA 1XPOA 1ZXIA 2KXJA 2K5DA 2ZCCA 1D2BA 4NXNL 3ML9A 1LYLA 1VRAB 2RKSA 3PF5A 3V61A 2CQOA 4DK0A 1A15A 5JH5C 1VQNA 1XLQA 2K22A 3X3NA 3GZNI 4W9JA 1PHJA 1MJCA 4FVMA 2LY7A 2KJ6A 2NVYB 4X57B 1SFOB 1KLUD 4J15A 3STBC 1VQPA 1S40A 1V2YA 4FULA 4JIOU 4BY7B 1K51A 4RH6A 3TBLD 1LQBA 3ZXRA 1ZYRD 2I2YA 4IN3A 3NRZA 3OIQA 1ICWA 5JHAA 3K57A 3N1YC 3J9CA 5JOBA 1EOTA 3MXPA 5KYIA 4B3ML 2NR2A 4XQJA 3VR2A 2VUMH 1YIJA 4UDUC 3RNAC 1NNXA 1UWVA 4FJZA 1QUQB 3W2DA 2K6QA 1DD2A 3A9JB 3BINA 2BYVE 3DBHB 4D2KA 1PVOA 1Z9FA 4LFAQ 2L1BA 1E2WA 4ZRZA 1CQFA 3IFWB 1NI2A 1VLBA 4LMQD 3TZDA 4KGSA 5M3MH 2B63H 1WX9A 1J8CA 2TMPA 2M56B 5IWAQ 1L5PA 1V80A 2UUCL 1TQOA 3KF6B 1EWYC 3Q8AA 2K14A 1ICFB 4CKCA 4R4OA 3SK6A 2E5LQ 2KLCA 3GS2A 1I35A 3CRLC 3CW2C 3NVYA 3ZKJC 1A70A 3CD6A 4BY1G 3UI3A 2E76C 4A8XC 4CGYB 4A3DG 3IRBA 3LB8C 2N8NA 4XGAB 3HKSA 2N49A 3RFZB 1V1QA 1KFYB 5E6PA 3WAOA 4XWTA 2IYDB 2GBJA 1QOAA 2WXMA 1KDBA 1G2SA 3A0JA 3DEPA 3OJ4B 4JGHB 4JBJA 2IY1B 1ENFA 2L32A 4HCNB 4HEA1 4CYEA 1RFAA 4WH4A 4BA2I 4PT5A 2RDHA 3GTGB 2YTYA 1V1OA 3A5UA 4R3DA 1XPRA 3EROA 1S5BD 3RT3B 4L6TB 3S17H 3ETRA 3EIVA 2QMTA 3M4OB 1G2TA 2JYOA 2NPTA 3VVWB 2XWBB 2JPHA 5LL6S 2LHEA 5EBCA 2BE5C 3A5ZB 3CPWA 2C7HA 3NQTA 3GQBA 4A4IA 3TMPB 3A56A 1V8CA 4OVZA 1PRTC 4HMIA 1LM0A 3H15A 2JEBI 2D3CA 2KTRA 3T1YQ 1A3TA 4A75A 5CV4A 1HZ6A 2O5JC 1ZKHA 4XT3B 4KX6B 5BN3A 1PGBA 4JV5Q 4XYQA 1VQJA 2WXKA 4KKUA 5BN5A 4QGUA 1QT9A 1CA6A 4CHKA 2DLBA 4DDID 2IY0B 2R92B 1G8ZD 1YNTE 3FC4A 2F0WA 2JXTA 3CF6E 4A3FB 1LFDA 4WJNA 1HNXL 2B63G 4M0WB 2GVBA 1JWMD 3PT2B 1OQYA 2PIAA 1N32L 1RYJA 5J39A 1VJKA 2BS4B 4DNTB 5KGUA 1YZ6A 2RMMA 3I70A 5EPLA 5IWAL 1WH3A 1QB5D 1Y56A 3UINB 4IKGA 1EQQA 2N9KA 1K28A 1E2VA 1XLOA 2EY1A 5IGFA 1TS5A 5LXIB 1DXMA 3EFXD 2OT2A 3A8JE 3M95A 3EHVA 1WM2A 3B0AA 4HIOA 1J8IA 2F03A 4JW0A 3CSFA 2K6DB 4FXCA 4ARIA 1FEHA 3AEFB 4RCOA 3P63A 2LGXA 3I4MB 4AJWA 1GB4A 2WXIA 1GO3E 2KC2A 3O13A 4BKGA 4LLGM 1D5ZC 2Z6BA 3PZ8A 4W9EA 4XX5A 1Q1EA 4CKEA 4A3JH 3JAML 3AFQA 5JZEB 1RHPA 2K1BA 5EJWA 2J53A 2CVRA 2F0IA 2JVCA 4IWPA 4YTNB 5GQOA 1L1OB 3AH7A 1NMGA 2ZPYA 1HA5A 4HIDA 1PH2A 1UBQA 2W54A 4G3XB 5C4JB 4P16A 3C1FA 3QCAA 1OQQA 4G4KA 2ZJQA 3GB1A 3ZRCA 2IX3A 2M00A 5D65A 2Q2IA 1ZOYB 3ALBA 2WXQA 2AWNA 2Y5BB 4MJSA 4YSZB 2R7ZH 1JC7A 1YN4A 4APVA 3RN2A 1Q12A 1YITA 1HNZQ 5C0XJ 2D9UA 4KK7A 1VR9A 2GI9A 3NHEB 3MVVA 5AEKB 3QOLA 2MFIA 2W55A 1OGWA 4K3CA 1AEXA 4CQNA 3L9AX 1WTRA 1E3PA 4RA8A 1TBEA 2EYHA 4F1SA 1RFKA 2KEEA 3WALA 3PIPA 3M4PA 3LNNA 2XNAC 4K7SA 5CYUA 1EU4A 1U4PA 4JI8L 2VL6A 2VQEQ 5BYRA 3RNCC 4R4QA 2GBMA 1N34Q 2WB1E 2D2CC 3QQ8B 1XLNA 5FO7B 5DEHA 4X3UA 2G4DB 3P4QB 2D62A 3KUDB 1BOSA 1UUPA 1VQ7A 1ENAA 5G5HA 3V6CB 3D4DA 4AYBG 4HJ9A 3FKIB 4JYAQ 1WGYA 2LEKA 4BBRH 2UUBQ 1LLRD 1ZPSA 3R7RA 2ONQA 3OAWA 3BZKA 4BKTA 2FMCA 2KVZA 2FAZA 4HRSA 4A3JG 3UDGA 1EY0A 4W9IA 3V96A 4X6AH 3EJIA 4ZYSA 1F9RA 3OIPA 3V2TA 1A62A 1SNPA 5BMIA 2XTIA 1PH8A 4LNIA 2VY3A 5FO9B 2UU9L 1TYGB 1SYCA 1T6BX 3PUXA 3TP8A 2M2LA 2JA9A 3DPDA 3HHMA 4YSYB 4IPDA 4IFDH 1HTQA 5D2MB 3FEWX 3K8AA 2NUCA 1EY7A 4ZUIA 1N33L 1ISNA 4HCEA 4FF1A 5FK9C 2KDEB 2PW9A 4DV6L 4KKSA 1N9WA 2QEXA 4B0EA 1LT4D 5M5XH 3VUYA 1C4AA 1LGRA 1WJ6A 4NJCA 3I73A 1WTPA 1TWGB 1BVSA 2R7ZG 5LMNQ 3KUCB 2L0FA 5TSSA 1J7CA 2IDYA 4TKOB 1VMPA 4K1RB 2D3BA 2QW7A 1D8LA 2NZOA 1QOHA 5JVG3 2ZT9C 1SE8A 2R2OA 1P7EA 3SK4A 4HKZE 2VW9A 2JA5H 5EE0A 2JRHA 3ONSA 2RD0A 5I9OA 2OQKA 1P9DU 2H89B 3TEHB 2WWZA 2EYOA 2JE6I 3PIOA 4GOPA 4HJ5A 3SK8A 4ZCKA 3JW0X 1LUZA 1YNJD 3CC4A 1WMHB 5GAHC 1IBKQ 1RTNA 3X0WA 3TS2A 3S2AA 1EY4A 3VRAB 2EMSA 2DY8A 3NTIA 1L0XB 5KEEA 2OHFA 4K6DA 4IWOA 4BBRG 3NVWA 3J7A5 2GBKA 2C5CA 4F87A 1TTNA 4LNNA 2FINB 4C1NK 3SDZA 5LLIA 4K0KL 1RRBA 3NTHA 4KY5A 2EY2A 4GKJQ 1CMXB 3AEBB 3M3JA 1E22A 1YQBA 1WI5A 5BR8Q 2BW2A 2KLGA 4KD3A 3AECB 4BBNF 2LXCA 4B3RQ 3B2GA 5A35A 2HD5B 3IHPC 1U4MA 3VDZA 1Q8IA 1Q81C 3AE3B 4FXKC 4DR6Q 1SE9A 2KDIA 3CMEA 3LJ3A 4IFDG 4X3TA 2J0KA 2MQJA 1F77A 4A3MH 4C2MB 1F2MA 3K7UC 1E24A 3ZXVA 4DNIA 4X62Q 5JPNC 1WD1A 3MEFA 1N62A 1ZXHA 2HCIA 3IXSA 4F88A 2LVQA 3K58A 4N6EB 5CV6A 2PCFB 2HJ8A 2J0TD 1G6PA 2K6AA 1CZPA 3GTPH 5M5WH 4BAXA 1QUQA 3GTKH 3A9JA 1HA6A 4ZDVA 3A7LA 1ET9A 1AFPA 3DMUA 5KNCA 3AE7B 4AH6A 2WS3B 2K7VA 3PO2B 1TWFB 4HSVA 5DNFA 1PZKD 5IA7A 2JA5G 5CHFA 3SR1A 1O7LA 1UBIA 4ZKBB 5IE8A 1ACCA 4ILWA 1WXMA 3KF6A 2YEPF 4PNYA 5C2TB 4PZ8A 3MWYW 5JEAJ 1Q10A 2MW5A 4BBSG 1N5WA 4RM8A 4W9LA 2EY5A 2B2WA 4WJ3M 2EKIA 1XCQL 1KAWA 4L63B 1P1AA 1T3QA 4WURA 3NELA 3ZTDA 5EGTA 1TR5A 1W2BA 3TRZA 1WRIA 3DM3A 1TKWB 3JC66 3MHZA 5H8YE 2BKRB 2IO0B 3HOYB 1Z2MA 4IUNA 3W9CB 4NKLA 2K5NA 3HOUH 1TGZB 4K7WA 3LGJA 2M8SA 4GLAC 3IFTA 1HQMC 3UDXA 3GTMH 1WTXA 2H1EA 1E9MA 1GUAB 4PMCA 2MBHA 4G7OC 2FUG1 2UYZB 1WI0A 4UHVA 1VMCA 1KL9A 1X32A 4KD4A 4I6NB 2KWUB 2JF5A 2F0QA 5FOBB 4DR1Q 3DVGX 3QIAA 3P1MA 4LUVA 5AJ3Q 2MBOA 3DWQA 3QC8B 3BJUA 1TT2A 4IPGA 2LKVA 4A3MG 2NVXB 2JN4A 3HG9A 1X65A 1HPCA 1Q86C 3PHXB 2FCNA 5C23A 2XRQD 3OTOL 1STNA 3L2PA 4FJVB 1K83B 1SLJA 3GD7A 3L54A 3OJ3A 4X62L 1WJNA 2PNRC 4R8IA 2IGDA 2W3SA 2Q8TA 4YHHQ 2PKOA 2A6EC 2R61A 1NUCA 3K5OA 3QG1A 2I5HA 2A73B 3M7GA 3B9JA 1OQRA 4ICUA 1GC6A 4JX1C 3HOZB 3HOVH 4RGOS 5JHBA 2V9HA 4IFDI 1G51A 1E8ZA 1MFWA 4A76A 4KGRA 3DHHC 4ITKA 1STHA 4IM2A 3E0JA 2R93B 3D32A 3D3RA 1YJJA 4M0WA 5D7GA 2BS2B 2O4XA 3NWTA 1XEEA 1HR0W 3PUVA 4XDXA 5LMUQ 4LFBL 3E0EA 4HSPA 3LX0A 3S1NH 4ACFA 2ALYB 3V05A 1SNMA 3H0GB 1TWCB 3A8IE 1EWCA 1QVGA 2BWES 1WYDA 4FADA 3IKJA 2A5UA 1HUNA 2Y3AA 3N3KB 4IM0A 5L95C 3TEZA 2BYEA 2NZHA 1FCCC 3AE6B 2QIEB 2CKHB 2RA4A 1TY0A 3CU7A 2AKWB 1IBXB 1B70B 4RHSA 1Y8RC 3VDYA 1SNCA 1UE5A 2KHWB 3AN1A 2R7DA 1VQ9A 3HOUG 1I6HB 3ND8A 2ASBA 4WORA 3Q23A 3J81L 3PO3G 1NCVA 3CP0A 4BOSC 3PS6A 1WJ4A 4FF3A 2V4DA 2JA7B 5C4XB 1IYFA 1R4QB 5CMDA 2OOBB 1WXQA 1Y8OB 4WJ4A 3TP6A 2FBWB 4B0MA 1V86A 5ELEA 4I6LB 4MEMA 1IW7D 2GA4B 5BN4A 1Y1WH 2WDRB 2E2DC 1VQLA 4B3TQ 1OTRB 3U58A 2KT7A 5HKHA 3L13A 1HRJA 1LTBD 4DUZL 1L1OA 1AZQA 3CAMA 1OXTA 4ABNA 4DR2L 4DDGD 1KLVA 2NVYH 3TMEA 1SFOH 2F0GA 2F4IA 3ERSX 2O2LD 4BKSA 4BY7H 2JQRB 1PFBA 1FPYA 3H3VC 5C44H 1I94Q 5DLQE 1V5OA 4KY6A 3Q8EA 4LAAA 3HOVG 3UI2A 1JWUD 2N55A 1YNND 2N7EA 2WNMA 1TS4A 4BBNC 1UNSA 4REZA 4L5SA 1W3SA 4KGTA 3APFA 4A3OA 3NPPA 2PW7A 1B2TA 5D94A 4AOFA 5EBDA 2LGIA 2LXAA 1PYWD 1HZBA 1I4PA 3NY5A 4B9KA 1SF0A 3P4SB 4YIJA 3CCSA 5DM63 3ZO5B 1QF6A 4J6HA 1VQ4A 1I7HA 2N7DA 5EKLA 1FR3A 4DV0Q 2LS01 3PF4A 4L23A 3ZIMA 3OSOA 3CSTA 1VQ6A 3ZJYC 1MHHE 2K03A 2L3ZA 4C3JB 4R9WA 2L9HA 4NPSA 3GTQB 2ZM6Q 2LFIA 5FKAC 2OTJA 1WGRA 1NSNS 2F0TA 2LXJA 4JBWA 3KYCD 3X3MA 4LNQA 2HTHA 3DVNU 4YWKA 3W1GA 3GTGH 1UWMA 3STBD 5IGCA 3N6RA 3EGRA 2ZW1A 3M4OH 1XO3A 1JB3A 2EIFA 2ZCBA 1T0YA 2Z6KC 3BVZA 2BPSA 1HEZE 4A90A 2K8CA 4EOYA 2FJ2A 3TL5A 4Q0FA 1BF4A 4H0LC 1GB1A 1E1OA 4BY7G 4BS9A 4A93B 1D4BA 5C44G 4LF8Q 1F9QA 4WQOB 1FRRA 1JRUA 2MPMA 4IQZA 4CHTB 3I56A 1AWDA 1EEID 4PV1C 3KFUA 2DNEA 5LL6X 3TCAA 4HDQA 5C0XH 1M94A 1JE4A 3SDLC 3DWPA 3DWGC 2Q8RE 4K5XA 1EZ8A 1K8AC 4JI0Q 2ZXPA 5G5GA 2YTVA 2NVQB 4X66L 2PVOD 2L8JA 1ONLA 3P1HA 3ERQA 3LWEA 2R92H 2E2HB 3KBGA 1YJWA 2KAJA 1CQVA 2A5HA 2RSUA 4A3FH 1ZW7A 2JUOA 5FJ8H 2IX1A 4KDLB 4MGZE 2OXPA 3NUHB 1W6JA 1C78A 3E6ZX 2N9LA 2MHVA 3L10B 5G3LF 1YX5B 3QWNA 2ZTEA 4AUQC 1PH7A 3PSEB 4N9TA 2R3ZA 5C3EB 3KUZA 2A6HC 3EC8A 4GXBA 2AQ2B 3RPFC 4B3SL 4XQQA 2LHDA 3DHIC 3H91A 1LTLA 1IKLA 1WMHA 1J7AA 4TUUA 4ZRPA 3OOCA 3CCMA 2ZPNA 3G7LA 3MTSA 4EQNA 2G1EA 4KKTA 2EZVA 3C46A 1L4ZB 2RHSB 4USAA 4MH8A 3I4NB 4P6VF 1V1PA 3J80E 3EECA 2MSED 2RDBC 4J1MA 1SSNA 1WOCA 2VS1A 3I4MH 1FGBD 1R4MB 4QCLA 1EY8A 4WWOA 4UP8A 4Q2JA 2PYKA 1QZHA 1PDXA 1PRTD 1WVLA 1JJGA 1FNVA 1CA5A 1SIJA 2L1AA 3M3YB 1SROA 4A3IB 3PIO3 1SIFA 2YV5A 2X38A 2LXKA 3N1ZC 3HZXA 3RCZA 4TQ0A 2WXJA 4QQBX 2CJNA 4HN7A 3P42A 2IW3A 2FNJB 4O1NA 1JICA 4EQOA 2Z4IA 3M85A 4K7UA 1EZ6A 5AUIA 4ANVA 1CZWA 4NQKE 4U673 3ULJA 3R2TA 4LFCQ 4QUCA 1RAXA 4A9AA 5C0XG 4DV4L 1XX8A 4TSSA 2VNUD 2WIIB 2PW5A 2FXQA 4GDLB 5K36H 2B2TA 3PV0A 3AE8B 5BYSA 4DPGA 1D5MC 2LRUA 3QIJA 1SYDA 2G9HD 2QJLA 1F0ZA 2RHQB 1C4QA 2R92G 1E7UA 4NXMQ 1SYFA 1PH5A 1WTHA 1MBYA 4A3FG 5FJ8G 5HURA 2LJ5A 4UAIA 1S1QB 3BS1A 1I4RA 3MC9A 2I46A 4EGVA 5LHY1 5JJIA 3C3LA 2K0PA 1IW7C 3I4OA 3DBHI 2KMCA 3H1UA 3OHXC 1QLBB 1UAPA 1XJVA 1IBLL 1PFNA 4ZHPA 2N88A 3SGIA 3EN2A 2KVRA 2PQAB 1WIAA 4JCVE 2AUKA 5E6JA 5GXGB 5KHQA 1EUVB 1A0IA 3VR3A 4HROA 1F2RI 2J0MA 3BU2A 2NVTB 3NZSA 2L55A 2PNHA 3KLSX 4DF7A 3TN2A 1C79A 3I4MG 1SDFA 3DOWA 3I57A 1GXDC 3FKIH 1PTOD 1PH6A 1N6ZA 4UP9A 3UGBB 4F8MA 4RCNA 4QF4A 3K5NA 4KHVA 1NYRA 3AFPA 1WGKA 1XCTL 3C2PA 3GV6A 1ZDXA 4CBVA 1PYBA 2AHOB 2UXCQ 2GMIC 1T0RC 1V81A 1ILQA 2IT1A 3Q14C 1NAPA 2KECA 4WRDA 2QDBA 2L11A 4TMAB 2WB1G 4AS1A 3OMCA 2WINB 4EEWA 3ONAB 3VTUA 3U4ZA 3FDTA 4MHEA 2JY6A 2LGSA 2V4LA 5JVH3 4A20A 1GHJA 4XQNA 2B2YC 4KDIC 4KSKC 2FIFA 5K36G 2JA8B 2BA1A 2KDMA 3TDQA 1XT9B 2XSCA 1D1KA 5KRUA 3MJWA 2O6VB 2H88B 1TWHB 5JEAH 3L16A 3URYA 1SJHD 3GTLB 1Z47A 2VH1A 3SE0A 5C0XI 4DAPA 1Y8NB 1IP9A 1FJGQ 2WXHA 4YY3L 2KZRA 2KTFA 4AQYQ 2LASA 2LD9A 3U50C 2BDNA 4DUYQ 3G48A 1R7SA 1QOBA 2Z1CA 1BNZA 5NUCA 3AE9B 4FHJA 2EOTA 2KX3A 2E2JB 1K53A 2ASQA 1PLFA 1FFUA 3K7AB 1MKHA 2JYTA 4PG3A 4S17A 3I3CA 4JI4Q 2BYTA 1WCMB 4LF5Q 4RF1A 4E3CA 2WAQB 1HCZA 1VQAA 1BR9A 1L7YA 3BK2A 3HOXB 2ZTDA 1GHKA 3ZW3A 2KO3A 3I8ZA 3FKIG 1LTAD 2L15A 3NHHA 1YJIA 2L00B 1P0RA 1XNQL 2EYMA 1TVXA 4DV2Q 1HE8A 4KKJA 1E8XA 2ZZPB 1K3RA 2H5XA 2W3RA 4GN1A 3UQAA 1HHVA 2KCTA 1VQBA 3OW2A 5IYDH 2TSSA 3DVNV 3VUWA 4LUOA 4J3OD 1PH1A 3S16B 1NY4A 1IBML 4JI5Q 3I72A 2UUAL 2KK8A 2MHJA 2XK5B 4HPPA 5E6NA 4C2MH 1GVPA 2MJ3A 4DR3Q 2F0KA 3MFGA 2JZZA 4WJOA 2K25A 3J7AF 1H95A 2L4NA 1ET6A 2DYBA 2IGGA 1LTGD 4DXFA 5JEAG 1I42A 2KHIA 2A4ZA 5IGEA 4N59A 3WIMA 2WAQE 4DK1A 4MM3A 3PO2H 1TWFH 4N8FA 5IODA 1A2TA 5M3FB 3D4WA 4N8X1 1C7YA 4BXXG 2MCNB 1K52A 5FR6A 3TZUA 1TXYA 3K9PB 2KJRA 2LJIA 3HK0A 1STEA 1P16A 3NZUA 2PPHA 4NJ7A 4JI6Q 1EY6A 3ABVB 2ATWA 1JROA 1NJIC 1D5XC 3D31A 3Q3JA 4C4VB 1OTCA 2L0TA 3AU5A 4A3BB 3A7AB 3WWVA 5EE1A 4DXAB 2C9OA 4DAMA 3NG0A 4OONA 3PZDA 3TEXA 1E1TA 4LFAL 3NWSA 3M9BA 1CZGA 4OEMB 4B9XA 1CFMA 2PVGC 3I55A 2ACZB 1YJ9A 4C1NI 3Q22A 3GP7A 3RUZA 4LF6Q 1QOFA 3LDZE 4RGTA 1XNRQ 3UDFA 3EBEA 2Y5PA 2MX2A 2MBEA 3TP5A 2E5LL 2XWJB 4A6QA 3VAWA 5IYDG 3DHGC 1EEFD 4KTAA 5E1FA 2QILA 3CC2A 4OX9Q 4G7HC 1JALA 2NVXH 3S15B 1Y1VB 3AXCA 1JT8A 2ICEC 3NSWA 3H7SA 1TWAB 1VQCA 4DU9A 4IO9A 5AUKA 2UXBQ 1LT3D 4WIPA 1K83H 1HTPA 2KN4A 1QNKA 3J7AV 3ZDTA 3E9IA 5IT9E 3GE8C 3IAS1 3ER0A 4C3HB 1IL2A 4M8NA 4NAWA 4CDEC 5C3JB 2NTTA 2OCEA 2KJXA 1XMOQ 5IKCM 3F2UA 1QZGA 3FP9A 3TIXA 3PO2G 2KHSA 3D8GA 5CV9A 4P72A 1TKGA 2R93H 3MXUA 2KMMA 1PTOC 1H9MA 4DWFA 4WWMA 3X23A 5C1ZA 1EYGA 1PFSA 1JOOA 2N7JA 4C3IB 4NNJB 3JAME 2WX1A 1ASYA 4NW2A 3OG5A 1JCKB 1TWCH 3H0GH 3T1YL 3A8KE 5C4ZA 2WDQB 3EFUA 2IGHA 4ANXA 3P75A 4LJOB 1Q1BA 4JV5L 4ASWC 2SDFA 4OGQC 2IX0A 2Y0SB 2WLBA 3ENEA 1ESFA 2KDFB 2CR5A 1FO4A 3EA6A 5CGKA 3FAHA 1I6HH 2HDLA 3OMGA 2MO0A 3KH0A 2ZNVC 2KQSA 2M1MA 1IL8A 4LWCA 4US9A 5IT9c 3M63B 4YSXB 5IY0A 2DJGC 5C4XH 2JA7H 5JXVA 1PRTB 5IOCA 1LV9A 4LDTD 2EMTA 5J18A 1TU2B 4DHZB 1CM9A 4JVZA 1PH9A 4M1UB 4GU2A 3A33B 5BYQA 2F0MA 3JSVB 1TS3A 5A2QE 5EQ0A 5KYLA 3GTJB 2A6ED 3AU7A 2B8GA 1I3QB 4X65Q 2XN9C 1R9TB 2O5IC 1WZ0A 5AZGA 4I7AA 3W5VB 3U7DA 3W1BA 1EU3A 2MH7A 3AM9A 1L2NA 4JI7Q 4ANUA 5CR3A 1AE3A 5H1SE 4EE2A 1LTRD 2M9VA 2EJGC 4XYOA 5HG2A 4PQXA 1KIXA 4GDLA 4FA6A 2Y0SE 2FHTA 3VR8B 3L0WB 2QCPX 4URKA 5I4DA 1JORA 2ZJPA 2DBYA 2R93G 3I4LA 2MJEA 4ZYNA 2K39A 1VS0A 2N4FA 2V1YA 4LF7Q 3RZWC 4DK3C 4DV3Q 1GOZA 3AMUA 4W9DA 2EYFA 1ZEQX 2MNAA 2KENA 2A74C 3BDLA 3H0GG 5E3FA 5GROA 3T16A 4GNXC 4DR7Q 1UF0A 3U2SC 2B8FA 4DA2A 4NJ6A 2N9PC 2WU5B 5IAAC 4DHZE 4LF4Q 2PI2E 2A1AA 5CX3A 2MUYA 2PQAA 5GAGC 2J7ZA 2VQFQ 3HUIA 3SFDB 2YTXA 5DAUA 1JWAD 1QE6A 4RWSC 3CCRA 4GN4B 5KNDA 2WQYB 4LNKA 2BWFA 1B9RA 2I5LX 2F0SA 1AP0A 1YN5A 4WAAA 1CKNB 3D0FA 5HGTA 3L0OA 4C3JH 2A8VA 5DCNA 4A3DB 2F3IA 1SB3C 2HDMA 4XIGS 1WXAA 3GTQH 4YCVA 1HNZL 5FO8B 4WJWA 4JWUC 1B9MA 1PTOB 2JA7G 5C4XG 2DZIA 4GLVB 1BDOA 1VZ6A 2HJ1A 2EDGA 1FL0A 2J7QB 1GUNA 4NZLB 2HUGA 3PPAA 4GIVA 2CHZA 4BBSH 4XXEA 3D6CA 2DNCA 1XQQA 4XT1B 3NXWA 1XXGA 2F0VA 1WGGA 2QEJC 4YTMB 1QG7A 1XF5L 3VTVA 5JPMC 2VQEL 5E7NA 1RDPD 5ELCA 1N34L 1MG8A 2MBQA 2PMVA 1A6XA 3RD4A 2DZJA 1KC8C 4II2B 2C35B 3ULPA 4A93H 1YHAA 1XWEA 2H4OA 2QCZA 3PO0A 4IUMB 1U0LA 3Q24A 4JYAL 4AJYB 2UUBL 2NBVB 4PS8A 2B3AA 1SAPA 1X3FA 2EXZA 2DNFA 3A4RA 1QVFA 1NDDA 1SMYC 2B2VA 3S1MB 4LUZA 1FXAA 2XGTA 2ZVOA 3H9DA 2VUMB 1KH0A 1BT0A 2VXWA 3BDOA 5T1GA 4HJGE 1EY9A 4MSMB 4ZLTF 2NVQH 2E2HH 3R7QA 4KV6A 1NBWA 1EF1A 3FRPB 3B2FA 4OZBA 4PYUA 1QCBD 4KLKA 3MXNB 1DGJA 1JW9D 1BBUA 5M3MB 1HR0Q 1GG3A 2F0OA 5LNK1 4G50A 1S3SG 4X3KA 5JJKA 1N36Q 1MI0A 1RWSA 2L52A 5C3EH 3GTOB 4NY0A 4S0RA 1R4NB 1BUIC 2X8XX 3WANA 4M02A 3RLFA 2PE6B 3N20C 1KTKA 4P74A 1X9NA 3DCGA 4EUTA 4C3JG 4KSLC 3EFCA 1BCPF 2CWPA 5LMNL 2I0QA 4JI3Q 2BOSA 4MZ9A 4OW0A 1EFID 3DQVA 2M17A 1L6VA 1H9SB 2KACA 1SR3A 1GUSA 2AQ3B 3I4NH 1WRDB 4XE0A 5EAYA 1X3PA 5CV7A 4DR5Q 2O2VB 1PFDA 2NS5A 1IZ6A 4FP5D 2M4NA 4II3B 4GNXB 2OTLA 2UXDQ 3HOWB 2EJFC 1JE5A 4A3IH 1Q3LA 3M3YH 3Q3FA 1CHQD 2GB1A 3Q2AC 3AV8A 1SSOA 3QA8A 4US8A 3MTNB 1IBKL 1SEBD 4KHPQ 1NR4A 4KMUC 4BA1I 2C9WB 4LF9Q 1RCVD 1WTWA 2XK5A 4OL7A 4A93G 1B44D 4WFN3 3UE1A 3S1QB 3PO3H 1F2YA 2IPKD 3KLRA 3T13A 4GKKQ 3H7PB 3PTFC 4G0NB 4ZRJA 3PGEA 2V3SA 3CF5A 4DFAA 1SYBA 4UP7A 2DGYA 1FFVA 3MC8A 1GPXA 3AEGB 4GKJL 1K8RB 2CWAA 1AW7A 5BR8L 3B08A 4CDCC 2A6HD 2MGSA 4B3RL 1PQSA 2OJRA 3BK1A 3EVQA 3VH4B 1N63A 4ZRKA 2AX5A 4KJNA 4DR6L 2EPBA 2AL6A 2F0JA 4C56C 2IHEA 5D6JB 3DLLA 1FCLA 3MXGA 2K01A 4IPCA 1O7IA 5C3EG 1TT5B 2ID0A 4RFBA 4M8MA 1BKBA 4C4VA 3APCA 2HHHQ 1UE1A 4DKAC 3PGZA 1EUJA 2K9XA 2GRIA 4A3LG 3Q3NC 4OIKA 1WGDA 1BUVT 2FMMA 2BB5A 2O6VD 2OQ0A 1FNUA 1PFMA 3I4NG 2NVTH 5BO4B 1I5FA 3VA7A 1IKMA 1WR6E 2ZJRA 4KKIA 4QY7A 4JI2Q 2F3WA 4DBGA 4X64Q 1VF7A 2I38A 4HK2A 1IHZA 2YU9H 2JWUA 2KEDA 4A3IG 4KN4C 1WE7A 1X1MA 2WDTB 5ELBA 2A69D 2JSOA 4FXDA 1Q0WB 3PRZA 2F4VQ 2BYFA 2FCSA 2F0FA 1MHWC 3ZNID 5HHDG 2HD3A 3IBEA 3SU8X 3C1EA 4G7ZC 2K5PA 2IWHA 1F9JA 4MN3A 2QDLA 4CJ1B 1IYJB 2ZEQA 4IW0A 3K9OB 4NB3A 2W82A 2V3NA 2JP1A 3TP7A 2SAKA 3OLMD 3AQQA 4P75A 4LK1C 2KHJA 4QJFA 2JA8H 5ELOA 1A3UA 4NMZA 3NBHB 4G57A 3Q8CA 4HVBA 1X3GA 4DR1L 3N30A 3AE5B 1TWHH 3G6JB 5AJ3L 1PXUA 2QF7A 3SEBA 1EWIA 4MT5A 4CDFC 4DV7Q 1KRHA 4KY7A 2CH4W 4PMBA 3AU4A 2JXMB 1GNUA 1SE4A 5IGDA 3T53B 3FVQA 4YHHL 1KDCA 4DR4Q 1U9RA 4HPLB 4OXPA 3VH3B 3AMZA 1GUTA 1HXYD 4V0BA 2VRRB 4BFRA 3K7AH 4JLCA 4ZKCB 4EKUA 4HJ8A 1WCMH 2WACA 1G91A 3TREA 2AWOA 2BDOA 1K73C 3ZVVA 1YBYA 3HEJA 3T1HQ 3AE4B 4Y7NB 5LMUL 3HOXH 2HTME 3NP8A 3I7FA 4DV5Q 2XRSD 3P4RB 2JQOA 1LTTD 2RQXA 2KANA 4LDTB 2N0SB 2DHZA 1V6EA 2PI2A 4DV1Q 1A3VA 3JSVA 4DN4M 2DYOA 1I6VC 1E10A 2L5TA 1CSQA 1BCPC 4W9FA 2NPTB 1DZ1A 3K0XA 5C4HA 1R4MI 1GD7A 1T5XD 2OF1A 2RCNA 4EQ5A 3CCQA 4HMJA 1EF5A 2JK8A 3P7JA 3TSSA 3B6YA 5I9PA 1VF5C 3S16H 1YQ3B 2QHOA 1EQTA 1YHBA 2RDGA 4POFA 2BQQA 4P2CB 5IIFA 2VB2X 3CCEA 3H8HA 5IN7A 2JA8G 4PK1A 1MSHA 1ZXTA 1AN8A 1Q46A 5FLXE 3KW5B 4OVUA 1O7YA 3K5LA 3VYRA 2F3VA 1XMQQ 1V97A 2KQ4X 5E4WC 3CCJA 1MSGA 1PYSB 1EIFA 1STAA 3MJ5A 1WYWB 3GDEA 4B3TL 3H09A 3KWVA 2LVPA 1LM8B 2KNBA 1DM0B 2RF4A 3NENA 4TVAB 2D3AA 1RODA 2DAJA 5M3FH 4DV7L 2KWDA 2YYZA 5IP7G 1E5WA 2NN6H 4CJ0B 1MGSA 2F0EA 3TJPA 1KOTA 1I94L 2Q2UA 3Q6SA 5EKKA 3S2HB 4AQ7A 3ZJUA 3R93A 1O78A 1RIPA 5G3LD 3U9SA 1A2UA 1CKNA 1WCMG 2BCOA 3RNFC 4ODGA 4A3BH 3NE5B 1X3QA 4B95A 4DAYB 2PE9A 1ZKOA 1EL0A 2WAQG 2ZXRA 1WZ3A 4YCUA 2D3GA 3HOXG 1UH6A 3VR9B 1SGHA 2I1JA 4GS3A 2PEAA 5DM73 1F2LA 1OXSC 4H7BA 5FLXc 4H2AA 1GUWA 1XD3B 2JU6X 2VZKD 5C5MA 2WGSA 1QOGA 3PLUA 1TIID 3I2ZA 1L0WA 3DXJC 1G6ZA 2XEWA 3EQLC 4MACA 3DBLB 1PDQA 4MGIE 3ECIA 4K14A 3BWUD 3F2BA 4DV0L 2X69A 4HXDA 4L5TA 3IAYA 4KV2A 3BZDB 3VQIA 1HH2P 4IALA 1CT1D 5IGGA 3N32A 2D0OA 1BBXC 3CKIB 3SFEB 3S15H 1Y1VH 1WTOA 3HKZB 2ZM6L 1MD2D 3AEEB 4QAYA 1TWAH 3UDIA 1C76A 4PZ6A 2LUEA 3M4QA 4GOPC 1FRDA 1N8RC 1ZUD2 3HM6X 3PUWA 1EIGA 4C3HH 5C5LA 3S1RB 1C3TA 4B9WA 1WYGA 2K75A 5H92C 3NK9A 4Z9CB 4HCSA 4A3EB 3VFKA 3E3XA 3DM1A 2CW0D 4MJSB 5EPJA 1FGUA 5D14A 1HNWQ 4A55A 5M3FG 4P1BC 4OWWB 1WM3A 2DN8A 2KX0A 1CK1A 4C3IH 2NN6G 3KF8B 5GMVA 2WXLA 2A69C 2UWQA 3RYTA 5C4JH 4LF8L 3U30A 2M19A 4OO1I 3A1QB 5CBEE 4OVVA 1K0RA 1VQDA 1WXSA 2YEPB 3A9KB 1ZP0B 2IO2B 4OWTB 5JAVA 3JYUA 4A3BG 3KJPA 1EIHA 4JI0L 1WFYA 1Q8KA 3Q8FA 1VQ5A 3NQIA 2N1WA 1IXRA 1H9SA 3HKZE 3SXHA 3J80c 1A5RA 1VCBA 1HFNA 1HZAA 4CJ2C 3HOUB 2IZVB 3IAM1 1CI3M 2LUMA 3ZNGC 2X6LA 2L83A 3RLNA 4GN3B 2FUHB 2OEDA 1Q90A 2KOXA 4JI1Q 4KZCA 1LT5D 1RJTA 2A68C 2K5VA 3M4YA 3J80i 4RAUC 1MPEA 2WXGA 1SNOA 3K6OA 1P3QU 1KF6B 3R8BA 1PZJD 4NXNQ 1BMLC 3DBRB 1KLGD 5ELDA 2KDBA 2LSSA 4MELA 5HY6A 2HDEA 1YI2A 1SMXA 1Y1VG 1R9TH 1IPGA 4FF2A 3ZYYX 3MAQA 2RPQA 3AEVA 3RZDB 4F8CB 2VH2A 2MJ8A 2VB3X 4RNAA 4KJOA 1DOYA 3H94A 4C3HG 1CUKA 1KNEA 2B2WC 1SE2A 1TKEA 3CCLA 2JA6B 1O7ZA 4OELB 4B3MQ 2C5LC 1LTID 3CQZB 4P73A 3HOVB 4KVGB 2FCQA 1N60A 3TEWA 1VQKA 1IGCA 1JJ2A 3WOEA 4O2DA 2BB6A 2M0XA 1XTCD 1UWXA 2NMQA 4XWWA 4C3IG 3RNEC 1LT6D 2PZWA 5ELFA 2J42A 4XTCS 1K3BC 4PMWA 3V6EB 4LJPB 3DEOA 4LFCL 1BBWA 1JB7A 2UUCQ 2BBCA 3L08A 3OW7A 3PRMB 4GMVA 5FLMH 3KK7A 4IUQA 1NI3A 1N61A 3WDNA 3KWLA 3WAMA 2Y0SG 4KIKB 4GOPB 2NBWB 2J0JA 1QILA 2QC8A 1GKHA 1TWGH 3K0YA 1KQSA 1VCIA 2NN6I 3BVGA 4ZUJA 1C1YB 2E3TA 2RGFA 4LCDE 4C7YA 5J2RA 2OJWA 4NXML 3PRPB 3RUIB 2KVMA 1UEBA 3QJYA 1X3EA 1WF9A 4MSQB 4MTKA 2AEHA 3I5JC 4ZOHC 4BXXH 4P71A 1VD2A 1CTMA 1PTOH 3Q69A 3TEYA 4IUTA 4AWJA 1VQHA 2SNSA 1M1KC 5E4XA 2WX0A 4IUUA 1M4VA 1IBXA 3TS0A 1RLFA 3CMMB 1JR0D 1Y1WB 2BH8A 4EVOA 2QSDA 1HQRD 4DK6C 3ZDMC 1J5EQ 2EYLA 2Z59B 3KBXA 4A3CH 2HQLA 2DWQA 2MP2B 3AYHB 2CS4A 3QHTA 2F0NA 2NWGA 1VZ8A 1S5ED 3DVGY 3GOEA 3IFDA 2EYJA 2KD0A 4HEDA 1MVKA 4NQLB 2G3QB 5C44B 2D11A 1YMHE 3DBSA 1IGDA 1TJEA 2CU3A 5EE9A 2SNMA 2CFMA 5IO9A 4F7XA 3MP9A 1FMAD 4A3KB 5DPTA 3NBHA 3BYYB 1I50B 3Q6BA 4GDKB 2DY7A 3S1MH 2UXCL 1XPUA 4YTPB 3Q0AA 2Z4HA 1CJEA 1E2ZA 4TV3A 3OYYA 5K5PA 3W3AA 1HNXQ 2ES2A 3M62B 2WYQA 4E71A 1R4PB 3RLOA 1PGAA 2K04A 1AH9A 1N32Q 2WXRA 5FLMG 4ZHOA 1PH3A 1GAQB 5CORA 3GTOH 4TRDA 3QR8A 1YD8U 3VR4A 2B2UC 2F1MA 5M5YB 4A3PA 1ESRA 4RG1A 3K5MA 4JOIC 5D3DA 4EZKA 3SHLA 1OFFA 1FIQA 4HKQA 5GAEC 1YOVB 3DWAA 1L1OC 3E9HA 2MO1A 2DZKA 1YIWA 1KAAA 4OZAA 4WJPA 4C80A 1U5KA 2KOLA 3LYYA 2RCFA 3A74A 1MHXA 1ZDVA 1H9JA 2MP1A 3U4EG 2K8BA 1NMFA 4K2LA 2BS3B 1FJGL 3E9SA 4L5RC 4AQYL 1VZ7A 4UY8C 4JL9A 1MJDA 3APDA 5DPWA 1S4ZA 1QVCA 2CW0C 4DUYL 2PJHA 4IPHA 3HOWH 1WJUA 4L8JA 1Z5SB 4ZRIA 1NENB 1E8WA 4A3CG 4BZAA 1OXUA 4JI4L 2B76B 3KVFB 5CHWA 1JOKA 2HIXA 2K5HA 4LF5L 1Z7TA 3VR5A 1J5EL 5EDSA 2EQSA 3HOYH 2PPBC 1K9MC 1SMYD 3FPPA 4TQ1A 2DENB 5C3WA 1S5DD 3K81C 3S1QH 1WR1A 2CHXA 3IT6B 1SN8A 5IYBH 3GZNB 3T4AC 2QA4A 2WKCA 1LABA 5CV5A 4DV2L 2K3UA 2JXXA 3OPOA 2VUMG 2NZ1D 2Q2TA 2PZTA 2C7NB 1HFGA 1O80A 1ASZA 2EE1A 2F0HA 1ZE3D 2AMCB 3KQ4A 2N1VA 2NBFA 2R7FA 1JWSD 1K0SA 5M3MG 4JI5L 4MGKE 2LWPA 2K52A 2PZUA 3WCQA 4QMGA 2BT6A 2K1FA 4EFOA 2IO1B 2CU1A 1DOMA 4M8AA 1QNUA 3V60A 4RHRA 4DR3L 1F1HA 2R6GA 3HM3A 2D10A 1B7YB 3TQYA 4DNRB 5COYA 3TBIB 1FD7D 4IJLA 3HOZH 2EXDA 4JBKA 2JWZA 3PVLA 3O65B 1S72A 5BMGA 3CCVA 4JI8Q 4DAYA 3AB9A 2KJHB 3S14B 4B08A 1K50A 4IURA 2I1KA 1SYGA 3RZOB 5IT9L 2N3SA 1C8CA 3W1SC 2IL8A 5CBAE 4ULLA 2VZAA 4MTNA 1D1IA 4HCPB 3J81j 2VZKB 1J6QA 1U4AA 3HOWG 1HZCA 5BMHA 2KCCA 1WY8A 3A54A 4JI6L 2L12A 2JSVX 5T1IA 1N5XA 2LMCB 2INNE 2JYEA 3VA5A 1NE3A 3NEMA 2C7MB 4YL8A 2E2IB 3UF8A 3HGBA 1JQYD 3HOYG 2UU9Q 3D6WA 3N52A 2ON8A 2AWTA 1E0BA 4LTUA 1AYFA 3AE1B 2WB1B 4A3GB 2INDC 4PS3A 3RD2A 2N78A 2WV6D 1N33Q 1YNXA 1FVIA 1IUEA 5IYBG 4LF6L 2D2QA 3S2DB 1IYVA 2WHIA 3VTWA 3ZGZA 4DV6Q 1SYEA 3T8MA 2K32A 2K5WA 4YWLA 1UE7A 2G5DA 2NYZD 1Y8PB 1Q7YC 1DONA 1XNRL 2YVCA 1HJPA 3J7YW 1GM5A 1RL2A 1J19A 4FN2A 4W9HA 4K8IA 1F52A 5AZFA 4EQPA 4QIWB 3FILB 4ARCA 4PZ7A 4WWPA 2RPVA
chains in the Genus database with same CATH topology
4K6LA 1JMLA 5D3IB 3KF8A 3QB3A 1PZID 4KN7C 3AEDB 3BDCA 4GZYC 5A2QL 3VYUA 3E5SA 1C4PA 1DCZA 1S5FD 5JJZA 3HVDA 1HTLD 2WP9B 1ZYRC 4RF0A 2D5GA 3BVMA 4OZCA 4K2KA 4HAEA 1NR2A 2B2TC 3D4RA 4ZK9B 2K05A 2SOBA 4U68A 2V3PA 1GUGA 2PTLA 2M0AA 1WD0A 3N9YC 2BA0A 2RDFA 4BY1B 1PUTA 4MIUA 3AB5A 2K28A 5KNBA 1OXXK 3PMFA 1SNQA 1ENCA 4IUPA 2WDRB 3QO2A 4GDKB 1FNWA 2E74C 5C3XA 4DAVA 4HROA 3FMCA 3IL8A 4Q5VA 3P20A 4JWSC 3TUOA 3T3NA 3U52E 4FO2A 2CJOA 1RF2D 3DHQA 2INPE 3NVVA 3MA2B 1J7BA 1D6EC 1IYUA 2V4IB 1EYCA 3A55A 4YWGG 2WKDA 4ZRQA 3ND9A 4CKBA 3RMHA 2EYPA 4BWGB 4JPSA 5M9OA 2HQEA 1S5CD 2EELA 1MI2A 4JE3B 2BTEA 1DYQA 2PMZB 1RM6C 1L0VB 1Z6HA 1BCPD 5CC4A 2B63B 5HFYA 5J1ZA 2L0CA 1V1PB 2EJMA 4IUVA 1VDZA 4QB4A 4IZ8A 4FNFA 1I4HA 1C4CA 4IDIA 3ITPA 2RSOA 4ZQ3A 5HI1A 3ZJVA 2CQAA 1J9OA 2FFKB 1OXVA 2NB0A 3R2IA 4IOIE 4WQMA 1E7PB 1B3AA 1SNDA 3S17B 2RBMA 3CWIA 2WXOA 1EM7A 4LK0M 4S3SA 1PMRA 2J52A 3FPUB 1Y69U 4XDCA 1DOLA 1NVID 2AUJD 1B50A 2OEOA 3IT4B 2DYMA 4GLSC 1RKNA 3U7ZA 1XYIA 1E6EB 3EUB2 1STYA 1BXTA 4HR7B 4FF4A 3NBIA 2Z8LA 2IJ0A 1SJED 3H6MA 4OIJA 1ILPA 4H13C 3Q8BA 3KUPA 1HZ5A 4I7ZC 3HRDD 2B2YA 3PZ7A 3W5UB 1KABA 3MFYA 2SEBD 3P4PB 4TQUS 4R8NA 2Y5CA 1L6UA 2JEAI 2AQ1B 3GV3A 1II3A 1L0YB 5F2DA 2E6XA 2WP8J 4ZAIA 4AYBB 2HCCA 2QKIC 2E75C 3CHBD 2XIWA 4RGMA 4A3JB 5AFWA 1TY2A 2WXNA 2MJDA 1WTVA 5KIXA 3NUCA 4FYDA 1RD9D 1YQ4B 3R3OA 1DOXA 2ZXOA 3J81E 2KUMA 4LJZC 2A68D 2I07B 2R7ZB 4OO1H 3PUYA 1UGJA 4YT0B 4RGNA 3SR6A 2WXPA 3BIID 1LO5D 4J8QA 3LWUA 3M7NA 2LMCA 3VRBB 2B2UA 2EY6A 2ZW0A 1G291 1W6KA 2WXFA 2V0GA 3ZJTA 2EVBA 3K59A 1F2ZA 4ID6A 2F0DA 1YNJC 4BBRB 5C6AA 3FILA 3NZ3A 1I4QA 2CHBD 3HVZA 3HRZC 1QWYA 3KLSA 1B1ZA 1HUMA 1I4GA 4MM3B 3PUZA 3SVMA 2JX5A 1WSPA 4RKBA 1EWHA 4ME5A 3VYSA 1PGXA 4YXDB 1B4OA 4I65A 5M5XB 1STGA 3DWMA 4L1BA 3MEHA 4OO1G 4KI0A 2NTSA 2F0UA 5FLXL 1FD6A 4H44C 2JA5B 1F9SA 2B39A 4HTHA 1DOIA 5MPOA 3QOJA 5EPKA 3I9V1 2X6GA 3NTKA 3V3XA 3BYTB 4BBSB 1JOQA 1WTQA 2PQEA 5I6WA 3PIP3 1WWTA 3NVZA 1NEKB 1XLPA 1H9RA 1BQQT 1I4XA 1SE3A 3W1SA 2ENBA 1L4DB 2Q8IB 4XDDA 2ICIA 3WOFA 1SBBB 4NAWB 1C77A 1DOKA 3T3OA 3I91A 4V190 5EKIA 1GUOA 5J22A 2KA7A 1K8MA 3DUZA 3T51B 1QJOA 3C8YA 4NAMA 1NYQA 1FYCA 2WDVB 4KHZA 4A3MB 1STBA 3AEAB 1OO9B 1SXTA 3I90A 4RKLA 1V8QA 3T56B 3U9OA 2J4XA 1C9FA 4O42A 4N58A 3GTPB 1C48A 3L3OC 1E0ZA 5M5WB 5IGBA 2Q5WD 5BYRA 3GTKB 4N9PA 4IFDJ 1JWBD 3J80L 3OWEB 3NS1A 5T8IA 1BO0A 3S9WA 2K33A 4WAFA 2K5QA 2KCNA 3MXNA 1BCPB 1FXIA 1TKYA 1DJRD 3AE2B 2BE5D 3HP3A 5ISRA 1LACA 2B2VC 3L7ZC 3CIRB 5FR3A 1U4RA 1T5EA 1EYDA 1K8OA 4E6IA 4DXGA 1TS2A 1M8AA 4NP5A 2LFNA 5CV8A 1ROEA 4K5VA 5EE3A 1EQVA 1V43A 3CRKC 3MHBA 1PRTF 3PO3B 3SK5A 1FM0D 2RVLA 4K8JA 4NDXA 3HS0C 3GTMB 2PLPA 2FE8A 2WU2B 4QUFA 1LTSD 4DGZA 3VYTA 5I2XA 1RTOA 4X3SA 1QKZA 1F2RC 1TZOA 3E56A 3LXFA 2F0LA 1KNAA 2PO4A 3MC0B 1EY5A 4JK1C 4K5WA 1F9PA 3GO5A 3ZQ4A 2XVSA 2F0PA 3MZ5A 2MEKA 3BG3A 3OWFA 3S1NB 1YNNC 2G9DA 5I2YA 1B9NA 1QQRA 5I6YA 2YU9B 1B53A 3L4PA 1VDVA 1ML0D 1AZPA 1CHPD 1H9KA 1EYAA 2KQ3A 1YN3A 2RSNA 1UEAB 4FXGC 3VR6A 1GJXA 1P7FA 1PTOF 1JQ4A 4L2YA 2D5DA 1JRPA 1KDAA 1U4LA 4OHJA 1ZXIA 2K5DA 1D2BA 1VRAB 2RKSA 4DK0A 1A15A 1XLQA 2K22A 3X3NA 4FVMA 2LY7A 2NVYB 1SFOB 1KLUD 4BY7B 1K51A 4RH6A 1ZYRD 2I2YA 4IN3A 3NRZA 3OIQA 1ICWA 3K57A 3J9CA 5JOBA 1EOTA 3MXPA 5KYIA 4XQJA 3VR2A 4UDUC 3W2DA 4D2KA 1DD2A 2L1BA 1E2WA 4ZRZA 1CQFA 1VLBA 4LMQD 3TZDA 4KGSA 2TMPA 2M56B 1L5PA 1EWYC 1TQOA 3Q8AA 4CKCA 3SK6A 3GS2A 3CRLC 3NVYA 1A70A 3UI3A 2E76C 4A8XC 4CGYB 3LB8C 1KFYB 4XWTA 1QOAA 2WXMA 1KDBA 1G2SA 3DEPA 2L32A 1ENFA 4HEA1 4WH4A 4BA2I 4PT5A 2RDHA 3GTGB 4R3DA 1V1OA 3EROA 1S5BD 4L6TB 3ETRA 2QMTA 3M4OB 1G2TA 2JYOA 2XWBB 2LHEA 5LL6S 5EBCA 2BE5C 3NQTA 3GQBA 3A56A 1V8CA 4OVZA 1PRTC 4HMIA 2JEBI 1HZ6A 1A3TA 5CV4A 2O5JC 4XT3B 4KX6B 5BN3A 1PGBA 4XYQA 2WXKA 4KKUA 5BN5A 1QT9A 1CA6A 2DLBA 2R92B 1G8ZD 1YNTE 3FC4A 2F0WA 2JXTA 4A3FB 1JWMD 2PIAA 1RYJA 2BS4B 5J39A 1VJKA 4DNTB 5KGUA 2RMMA 3I70A 5EPLA 1Y56A 1QB5D 4IKGA 2N9KA 1E2VA 1XLOA 2EY1A 5IGFA 1TS5A 1DXMA 3EFXD 2OT2A 3A8JE 1J8IA 2F03A 4FXCA 4ARIA 1FEHA 3AEFB 4RCOA 3P63A 3I4MB 1GB4A 2WXIA 3O13A 4LLGM 1D5ZC 3PZ8A 1Q1EA 4CKEA 3JAML 1RHPA 2K1BA 5EJWA 2J53A 2CVRA 2F0IA 4YTNB 3AH7A 1HA5A 2W54A 5C4JB 4P16A 3C1FA 1OQQA 4G4KA 3GB1A 2IX3A 2M00A 5D65A 1ZOYB 2WXQA 2AWNA 4YSZB 1JC7A 1YN4A 1Q12A 1VR9A 5C0XJ 2D9UA 4KK7A 2GI9A 3MVVA 3QOLA 2W55A 4CQNA 1AEXA 3L9AX 1WTRA 4RA8A 2EYHA 1RFKA 2KEEA 3LNNA 2XNAC 5CYUA 1EU4A 1U4PA 2D2CC 1XLNA 5FO7B 5DEHA 4X3UA 3P4QB 2D62A 1BOSA 1UUPA 1ENAA 5G5HA 3D4DA 3FKIB 2LEKA 4DQOC 1ZPSA 1LLRD 2ONQA 2FMCA 4HRSA 1EY0A 3V96A 3EJIA 4ZYSA 1F9RA 3OIPA 3V2TA 1SNPA 5BMIA 5FO9B 1TYGB 1SYCA 1T6BX 3PUXA 3TP8A 2M2LA 4YSYB 4IFDH 3FEWX 2NUCA 1EY7A 4ZUIA 4HCEA 4FF1A 5FK9C 2PW9A 4KKSA 4B0EA 1LT4D 1C4AA 4NJCA 3I73A 1WTPA 1TWGB 5TSSA 1J7CA 2IDYA 4TKOB 1VMPA 5JVG3 1QOHA 2ZT9C 1P7EA 3SK4A 4HKZE 5EE0A 5I9OA 2H89B 2EYOA 2JE6I 3SK8A 1YNJD 1RTNA 3VRAB 1EY4A 2DY8A 3NTIA 1L0XB 5KEEA 2OHFA 4K6DA 3NVWA 2C5CA 4F87A 2FINB 4C1NK 3SDZA 3NTHA 4KY5A 2EY2A 3AEBB 2BW2A 4KD3A 3AECB 3B2GA 5A35A 1U4MA 1Q8IA 3AE3B 4FXKC 4IFDG 4X3TA 1F77A 4C2MB 1F2MA 1WD1A 1N62A 5JPNC 1ZXHA 3IXSA 2HCIA 4F88A 3K58A 4N6EB 5CV6A 2PCFB 2J0TD 2K6AA 1CZPA 1HA6A 3A7LA 1ET9A 1AFPA 3DMUA 5KNCA 3AE7B 2WS3B 2K7VA 3PO2B 1TWFB 4HSVA 5DNFA 1PZKD 3SR1A 1O7LA 4ZKBB 1ACCA 4ILWA 2YEPF 4PNYA 5C2TB 3MWYW 5JEAJ 1Q10A 1N5WA 2EY5A 2B2WA 2EKIA 1XCQL 1T3QA 4L63B 4WURA 5EGTA 1TR5A 1WRIA 3MHZA 1TKWB 5H8YE 3HOYB 3W9CB 4IUNA 4NKLA 3IFTA 1HQMC 1WTXA 2H1EA 1E9MA 4PMCA 4G7OC 2FUG1 1VMCA 4KD4A 1X32A 2F0QA 5FOBB 3QIAA 3P1MA 3DWQA 2NVXB 1TT2A 2LKVA 3HG9A 1HPCA 2XRQD 1STNA 1K83B 3GD7A 2IGDA 3Q8CA 2PNRC 4R8IA 4C7ZA 2W3SA 2Q8TA 2PKOA 5JXVA 2A6EC 2R61A 1NUCA 3K5OA 3QG1A 2A73B 3M7GA 3B9JA 1OQRA 4JX1C 3HOZB 4RGOS 4IFDI 4KGRA 4ITKA 1STHA 3E0JA 2R93B 3D3RA 1YJJA 4M0WA 5D7GA 2BS2B 2O4XA 3NWTA 1XEEA 3PUVA 4XDXA 4HSPA 3LX0A 3V05A 1SNMA 3H0GB 1TWCB 3A8IE 1EWCA 3IKJA 2Y3AA 1HUNA 3TEZA 3AE6B 1FCCC 2QIEB 2RA4A 1TY0A 3CU7A 1IBXB 4RHSA 1SNCA 3AN1A 1I6HB 3ND8A 4WORA 3Q23A 3J81L 1NCVA 4FF3A 2V4DA 2JA7B 5C4XB 1R4QB 5CMDA 1WXQA 1Y8OB 3TP6A 2FBWB 4B0MA 5ELEA 1IW7D 2GA4B 5BN4A 2E2DC 1HRJA 1LTBD 1AZQA 1OXTA 4ABNA 3TMEA 2F0GA 2F4IA 2O2LD 2JQRB 1PFBA 3H3VC 4KY6A 3Q8EA 4LAAA 3UI2A 1JWUD 2N55A 1YNND 2WNMA 1TS4A 1UNSA 4REZA 4KGTA 3NPPA 2PW7A 1B2TA 5EBDA 2LGIA 1PYWD 1I4PA 1SF0A 3P4SB 4YIJA 5DM63 1QF6A 4J6HA 1I7HA 5EKLA 1FR3A 2LS01 4L23A 3OSOA 1MHHE 2K03A 4C3JB 4R9WA 2L9HA 3GTQB 2LFIA 5FKAC 1NSNS 2F0TA 4JBWA 3X3MA 1UWMA 5IGCA 3N6RA 3EGRA 2ZW1A 1XO3A 1JB3A 3BVZA 1HEZE 4A90A 2FJ2A 4Q0FA 1BF4A 4H0LC 1GB1A 4BS9A 4A93B 1D4BA 1F9QA 1FRRA 2MPMA 4IQZA 4CHTB 1AWDA 1EEID 4PV1C 2DNEA 5LL6X 5C0XH 1JE4A 3DWPA 3DWGC 2Q8RE 4K5XA 1EZ8A 2ZXPA 5G5GA 2PVOD 2NVQB 1ONLA 3P1HA 3ERQA 3LWEA 2E2HB 2KAJA 3KBGA 1CQVA 2A5HA 2IX1A 2OXPA 3NUHB 1W6JA 1C78A 3E6ZX 2N9LA 2MHVA 5G3LF 3QWNA 4N9TA 2R3ZA 5C3EB 2A6HC 2AQ2B 3RPFC 4XQQA 2LHDA 3H91A 1IKLA 1J7AA 4ZRPA 3OOCA 3G7LA 3MTSA 4EQNA 2G1EA 4KKTA 2EZVA 3C46A 1L4ZB 4USAA 4MH8A 3I4NB 4P6VF 1V1PA 3J80E 4J1MA 1SSNA 1FGBD 4QCLA 1EY8A 4Q2JA 2PYKA 1PDXA 1PRTD 1WVLA 1FNVA 1CA5A 1SIJA 2L1AA 3M3YB 4A3IB 3PIO3 2X38A 3HZXA 4TQ0A 2WXJA 2CJNA 4HN7A 3P42A 2IW3A 4O1NA 1JICA 4EQOA 2Z4IA 3M85A 5AUIA 1EZ6A 1CZWA 4U673 3R2TA 4QUCA 4A9AA 5C0XG 1XX8A 4TSSA 2VNUD 2WIIB 2PW5A 4GDLB 5K36H 2B2TA 3PV0A 3AE8B 5BYSA 1D5MC 1SYDA 2G9HD 2QJLA 1F0ZA 1C4QA 1SYFA 1MBYA 5HURA 4UAIA 3BS1A 1I4RA 2I46A 4EGVA 5LHY1 3C3LA 2K0PA 1IW7C 3OHXC 1QLBB 1UAPA 1PFNA 4ZHPA 2N88A 2AUKA 5E6JA 5GXGB 3VR3A 1F2RI 2NVTB 2L55A 3KLSX 4DF7A 3TN2A 1C79A 1SDFA 3I57A 1GXDC 1PTOD 4F8MA 4RCNA 4QF4A 3K5NA 4KHVA 1NYRA 1WGKA 1XCTL 3C2PA 3GV6A 1ZDXA 4CBVA 1ILQA 2IT1A 1NAPA 2KECA 4WRDA 2QDBA 2L11A 4TMAB 4AS1A 3OMCA 2WINB 3ONAB 3FDTA 4MHEA 5JVH3 1GHJA 4XQNA 2B2YC 5K36G 2JA8B 2BA1A 2KDMA 3TDQA 2XSCA 1D1KA 5KRUA 2H88B 1TWHB 5JEAH 3URYA 1SJHD 3GTLB 1Z47A 3SE0A 5C0XI 4DAPA 1Y8NB 2WXHA 2BDNA 1R7SA 1QOBA 2Z1CA 1BNZA 5NUCA 3AE9B 2EOTA 2E2JB 1K53A 1PLFA 1FFUA 3K7AB 2JYTA 3I3CA 2BYTA 1WCMB 4RF1A 2WAQB 1HCZA 1BR9A 3BK2A 3HOXB 1GHKA 3I8ZA 3NHHA 1LTAD 1YJIA 2EYMA 1TVXA 4KKJA 2W3RA 1HHVA 2TSSA 4J3OD 3S16B 3I72A 2MJ3A 2F0KA 3MFGA 3J7AF 2L4NA 1ET6A 2IGGA 1LTGD 4DXFA 5JEAG 5IGEA 4N59A 4DK1A 5IODA 1A2TA 5M3FB 3D4WA 1K52A 3TZUA 2LJIA 1STEA 1EY6A 3ABVB 1JROA 1D5XC 3D31A 4A3BB 3A7AB 5EE1A 2C9OA 3TEXA 3NWSA 1CZGA 4B9XA 1CFMA 2PVGC 2ACZB 4C1NI 3Q22A 3GP7A 3RUZA 1QOFA 4RGTA 2Y5PA 3TP5A 2XWJB 4A6QA 1EEFD 4KTAA 5E1FA 2QILA 4G7HC 1JALA 3S15B 1Y1VB 2ICEC 3NSWA 5AUKA 1TWAB 4DU9A 1LT3D 4WIPA 1HTPA 2KN4A 1QNKA 3J7AV 5IT9E 3IAS1 4C3HB 5C3JB 2NTTA 2KJXA 3F2UA 2KHSA 3D8GA 5CV9A 1TKGA 2KMMA 3MXUA 1PTOC 1H9MA 4WWMA 1JOOA 2N7JA 4C3IB 3JAME 4NW2A 1JCKB 3A8KE 5C4ZA 2WDQB 2IGHA 3P75A 1Q1BA 2SDFA 4OGQC 2IX0A 2Y0SB 2WLBA 1ESFA 1FO4A 3EA6A 5CGKA 3FAHA 2HDLA 3OMGA 4US9A 1IL8A 4YSXB 1PRTB 5IOCA 1LV9A 1TU2B 1CM9A 4M1UB 5BYQA 2F0MA 1TS3A 5A2QE 5EQ0A 5KYLA 3GTJB 2A6ED 3AU7A 2B8GA 1I3QB 3W5VB 2XN9C 1R9TB 2O5IC 1EU3A 2MH7A 3AM9A 5CR3A 4EE2A 1LTRD 2M9VA 2EJGC 4XYOA 5HG2A 4PQXA 2FHTA 3VR8B 2QCPX 5I4DA 1JORA 2DBYA 2MJEA 3I4LA 1GOZA 3AMUA 2EYFA 1ZEQX 2A74C 3BDLA 5E3FA 3T16A 3U2SC 2B8FA 4DA2A 2WU5B 2MUYA 3SFDB 2J7ZA 3HUIA 5DAUA 1JWAD 1QE6A 4RWSC 5KNDA 2WQYB 1B9RA 2F0SA 1AP0A 1YN5A 5HGTA 4A3DB 1SB3C 2HDMA 4XIGS 5FO8B 4WJWA 4JWUC 1B9MA 1PTOB 1BDOA 1VZ6A 2EDGA 1GUNA 4NZLB 2HUGA 4XXEA 3D6CA 2DNCA 4XT1B 3NXWA 1XXGA 2F0VA 2QEJC 4YTMB 1QG7A 1XF5L 5JPMC 1RDPD 5ELCA 2PMVA 1A6XA 3RD4A 1XWEA 2H4OA 3PO0A 3Q24A 1SAPA 2EXZA 1SMYC 2B2VA 3S1MB 1FXAA 2VUMB 1KH0A 2VXWA 3BDOA 5T1GA 4HJGE 1EY9A 4ZLTF 4KV6A 3FRPB 3B2FA 4OZBA 1QCBD 1DGJA 1JW9D 5M3MB 5LNK1 2F0OA 4X3KA 1RWSA 1MI0A 2L52A 3GTOB 1BUIC 3RLFA 1KTKA 4C3JG 1BCPF 2BOSA 4OW0A 1EFID 1L6VA 1H9SB 2KACA 1GUSA 2AQ3B 4XE0A 1X3PA 5CV7A 1PFDA 4FP5D 3HOWB 2EJFC 1Q3LA 1CHQD 2GB1A 3AV8A 1SSOA 4US8A 1SEBD 1NR4A 4KMUC 4BA1I 1RCVD 1WTWA 4OL7A 1B44D 4WFN3 3S1QB 1F2YA 2IPKD 3KLRA 3T13A 4DFAA 1SYBA 1FFVA 3AEGB 1AW7A 2A6HD 2MGSA 3BK1A 3EVQA 1N63A 2AX5A 4KJNA 2EPBA 2F0JA 4C56C 1FCLA 3MXGA 2K01A 2ID0A 4RFBA 2K9XA 2GRIA 4OIKA 1BUVT 2FMMA 2BB5A 1FNUA 1PFMA 3VA7A 1IKMA 4KKIA 2F3WA 1VF7A 2I38A 1IHZA 2JWUA 2KEDA 4KN4C 5ELBA 2A69D 2JSOA 4FXDA 2F0FA 5HHDG 3C1EA 4G7ZC 2K5PA 2IWHA 4MN3A 4CJ1B 2W82A 2V3NA 2JP1A 3TP7A 2SAKA 4LK1C 1A3UA 4NMZA 4G57A 3AE5B 3G6JB 1PXUA 2QF7A 3SEBA 4MT5A 1KRHA 4KY7A 4PMBA 2JXMB 1SE4A 5IGDA 3T53B 3FVQA 1KDCA 1U9RA 3AMZA 1GUTA 1HXYD 4V0BA 4ZKCB 2WACA 1G91A 2AWOA 2BDOA 3HEJA 3AE4B 4Y7NB 2HTME 3NP8A 2XRSD 3P4RB 2RQXA 1LTTD 2N0SB 1A3VA 4DN4M 2DYOA 1I6VC 1E10A 2L5TA 1BCPC 1DZ1A 5C4HA 1T5XD 2OF1A 2JZPA 4HMJA 1GPXA 3P7JA 3TSSA 5I9PA 1VF5C 1YQ3B 1EQTA 2RDGA 4P2CB 5IIFA 2VB2X 3H8HA 1MSHA 1ZXTA 1AN8A 5FLXE 1O7YA 3K5LA 3VYRA 2F3VA 1V97A 2KQ4X 5E4WC 1MSGA 1STAA 3MJ5A 3H09A 3KWVA 1DM0B 1RODA 2KWDA 2YYZA 2NN6H 4CJ0B 1MGSA 2F0EA 3Q6SA 5EKKA 3S2HB 4AQ7A 3ZJUA 3R93A 1O78A 5G3LD 3U9SA 1A2UA 2BCOA 4ODGA 3NE5B 1X3QA 1ZKOA 1EL0A 2ZXRA 3VR9B 5DM73 1F2LA 1OXSC 4H7BA 4H2AA 1GUWA 2JU6X 2VZKD 5C5MA 1QOGA 1TIID 1G6ZA 3DXJC 4MACA 3RFZB 3EQLC 1PDQA 4K14A 3BWUD 2X69A 3IAYA 3BZDB 3VQIA 4IALA 1CT1D 5IGGA 1BBXC 3CKIB 3SFEB 1WTOA 3HKZB 1MD2D 3AEEB 1C76A 1FRDA 1ZUD2 3PUWA 1EIGA 5C5LA 3S1RB 4B9WA 1WYGA 5H92C 3NK9A 4Z9CB 4HCSA 4A3EB 3DM1A 2CW0D 4A55A 5EPJA 5D14A 2DN8A 1CK1A 2NN6G 2WXLA 2A69C 2M19A 4OO1I 5CBEE 2YEPB 1ZP0B 5JAVA 1EIHA 3Q8FA 3NQIA 1H9SA 3SXHA 1HFNA 4CJ2C 3HOUB 3IAM1 1CI3M 2LUMA 2X6LA 2L83A 2OEDA 1Q90A 1LT5D 1RJTA 2A68C 3M4YA 2WXGA 1MPEA 4RAUC 1SNOA 3K6OA 1KF6B 3R8BA 1PZJD 1BMLC 1KLGD 5ELDA 2HDEA 4FF2A 3ZYYX 3MAQA 3RZDB 2MJ8A 2VB3X 4RNAA 4KJOA 1DOYA 3H94A 4C3HG 1KNEA 2B2WC 1SE2A 1TKEA 2JA6B 1O7ZA 1LTID 3CQZB 3HOVB 1N60A 3TEWA 1IGCA 3WOEA 2BB6A 2NMQA 1XTCD 1UWXA 4XWWA 4C3IG 1LT6D 2PZWA 5ELFA 2J42A 4XTCS 4PMWA 3DEOA 2BBCA 3OW7A 3KK7A 4IUQA 1NI3A 1N61A 3WDNA 3KWLA 1QILA 2E3TA 3K0YA 1VCIA 2NN6I 3BVGA 4ZUJA 4C7YA 2KVMA 3QJYA 4ZOHC 3Q69A 1CTMA 1PTOH 3TEYA 4IUTA 2SNSA 5E4XA 4IUUA 1M4VA 1IBXA 1JR0D 1Y1WB 4EVOA 2QSDA 1HQRD 2EYLA 3KBXA 2DWQA 2F0NA 2NWGA 1VZ8A 1S5ED 3IFDA 2EYJA 4HEDA 1MVKA 5C44B 1YMHE 1IGDA 1TJEA 2CU3A 5EE9A 2SNMA 4F7XA 3MP9A 1FMAD 4A3KB 3NBHA 3BYYB 1I50B 2DY7A 4YTPB 3Q0AA 2Z4HA 1CJEA 1E2ZA 5K5PA 3W3AA 1R4PB 1PGAA 2K04A 2WXRA 4ZHOA 1GAQB 5CORA 4TRDA 3VR4A 2B2UC 2F1MA 5M5YB 1ESRA 3K5MA 5D3DA 3SHLA 1OFFA 1FIQA 4HKQA 3DWAA 4OZAA 1KAAA 4C80A 2KOLA 3LYYA 1MHXA 1ZDVA 1H9JA 2MP1A 3U4EG 4K2LA 2BS3B 3E9SA 1VZ7A 1S4ZA 2CW0C 4L8JA 1NENB 1OXUA 2B76B 1JOKA 3VR5A 1Z7TA 2PPBC 1SMYD 3FPPA 4TQ1A 5C3WA 1S5DD 3IT6B 3T4AC 2WKCA 1LABA 5CV5A 2K3UA 3OPOA 2NZ1D 2PZTA 1HFGA 1O80A 2EE1A 2F0HA 1ZE3D 3KQ4A 2NBFA 1JWSD 3WCQA 2PZUA