1ET9A

Crystal structure of the superantigen spe-h from streptococcus pyogenes
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
195
Chain Sequence
NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKNLSVFFEKDWISQEFKDKEVDIYALSAQERYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords SUPERANTIGEN SPE-H
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 56
structure length 195
sequence length 204
ec nomenclature
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1et9A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1et9A01
3TSSA 1UUPA 1JWMD 1CT1D 1PTOB 4L63B 1BCPC 1LTRD 4UDUC 5D3IB 1PRTC 1TS4A 4O1NA 5ELEA 1I4XA 1AW7A 1FNWA 1LTGD 1ENFA 1LTBD 2TSSA 2XRQD 1CHQD 1F77A 1JR0D 1SEBD 1TY2A 1PZJD 1HTLD 1SXTA 1I4HA 1I4QA 1L0XB 1LTAD 1D6EC 1LT3D 4L6TB 1DYQA 3BVMA 1EU3A 1D5XC 1LTTD 3SEBA 5ELBA 4RGNA 2QEJC 1HA5A 4DXGA 1JQYD 5ELCA 1D5MC 3MC0B 2XNAC 1S5DD 1V1PA 1S5ED 3DWQA 1LLRD 2R61A 5FK9C 4NZLB 4RGMA 1FD7D 1PTOC 4RHRA 2QILA 1SE2A 2NTTA 1M4VA 5TSSA 2Z8LA 1CQVA 2AQ1B 1CHPD 1ESFA 3BZDB 1FNUA 4C56C 1RD9D 1BCPD 2SEBD 1CK1A 1QILA 1I4PA 1JWUD 3BYYB 4DXFA 1PRTD 4RFBA 1PTOH 1RDPD 1UNSA 1D5ZC 2XRSD 1LT4D 3W2DA 1FNVA 1EU4A 1LO5D 3MFGA 1LTID 1KLUD 1G8ZD 3OWEB 3URYA 1YN5A 3V05A 1LTSD 1TS3A 4Z9CB 4BWGB 1EEFD 1BCPF 1PZKD 1JCKB 1PRTF 1SJED 2XN9C 2O2LD 5FKAC 1PTOD 3GP7A 1SE4A 3DWPA 2ICIA 4OHJA 1JWSD 1EFID 1TS5A 4RGTA 3EA6A 1PZID 1T5XD 2G9HD 4RCOA 2J4XA 5I4DA 1GOZA 4RGOS 3DWAA 3R8BA 2NTSA 4RHSA 4ZYSA 1FGBD 1HXYD 2RDHA 3O13A 1I4GA 1DJRD 4TSSA 1ET6A 1PYWD 1PTOF 1SBBB 3CHBD 3R2TA 5D3DA 5ELDA 3BVZA 1TS2A 1SJHD 1XXGA 1L0YB 2AQ2B 1EEID 3KLSX 1BCPB 2IJ0A 1LT6D 3BVGA 1YN4A 1STEA 1PRTB 1XTCD 1KLGD 1AN8A 2RDGA 1ET9A 1V1PB 4K6LA 1B44D 4RH6A 2CHBD 2AQ3B 1TY0A 1S5FD 1S5BD 1EWCA 1B1ZA 3BYTB 1I4RA 1RCVD 1RF2D 5ELFA 2WV6D 1YN3A 3EFXD 1HQRD 1MD2D 1LT5D 3R2IA 1V1OA 2IPKD 1KTKA 1BXTA 1SE3A 1S5CD
chains in the Genus database with same CATH superfamily
4C3JG 4WWOA 5K5PA 1E2ZA 1JC7A 2DYBA 2JY6A 5J1ZA 1F2RC 2A4ZA 1JROA 5HI1A 1IBKL 3P4QB 3SK4A 4F7XA 1PRTC 1BT0A 1F2LA 3AE5B 3DBHB 2ICEC 2K5QA 1RKNA 3KH0A 4H44C 2AWOA 4P1BC 2HIVA 4HJGE 3QX1A 1EWHA 4PG3A 2DLBA 3HK0A 4E6IA 2KKCA 4REZA 2A6EC 2JXMB 1NI2A 2CJOA 1UGMA 1MHHE 4XT1B 2LGXA 4W9IA 2L9HA 4DUYQ 4M02A 1S5ED 3ML8A 3VAWA 5IGDA 1K83B 3S2HH 2N9KA 1HFGA 4GLVB 4BKSD 2NVQH 2VUMB 2B39A 4B08A 3S16H 2NTTA 3HM6X 1QOAA 5C0XI 3VDYA 4IJHA 4V190 3HOVH 3GTMB 3MP9A 2KQ3A 4XQNA 1Y1VB 4A3DG 1D7QA 2SEBD 3L2PA 1QUQA 2ZTDA 4B3ML 2E2JB 1NEKB 3OLMD 1MGSA 4HJ5A 4A3JH 5M5YB 1K8RB 5JHBA 3QAQA 4YSZB 3Q8EA 5EDSA 3FC4A 1SYCA 3MXGA 2X69A 3P4PB 2VQFL 4KHZA 5J39A 1V8CA 2LZ6A 1QVCA 1VQIA 2FFKB 1QWYA 2K52A 3URYA 4BBSB 2MX2A 1L4ZB 1LV9A 5C3WA 2M19A 2MEKA 3ZXVA 4UY8C 4YHHL 3K57A 5IYCG 2CH4W 3AE3B 3PHWB 1YJNA 1IKMA 4YSYB 2NN6I 1CQFA 3H7PA 2D3BA 5FOBB 1H4RA 3LJ3A 2MO1A 1FFUA 5KHOA 2JA7G 3OHXC 5C0XH 5AZHA 3E9IA 3WDNA 2YTYA 3E6ZX 1LGRA 2PEAA 1P9DU 1N62A 4XWTA 1FJGL 1IBXB 3ONAB 1KXLA 4MT5A 4RHSA 4IFDJ 4JBWA 3GTJH 1HXYD 5T1IA 1WMHA 1Q81C 3AEAB 4YWGG 3P4SB 1EZ6A 4JV5L 2FMCA 3LGJA 1PTOF 1YNJD 2WXQA 2DJGC 4NXMQ 2WP9B 5H8YE 1VR9A 4HJ7A 3V60A 3G7LA 5BN5A 1VZ8A 2CFMA 4APVA 2WAQG 2F0WA 2N88A 2UUCL 3A8JE 3I4NB 1UD7A 3SFEB 1RFAA 1AE3A 2N9LA 1EIYB 2F0OA 4QGUA 4GKKL 2BPSA 1N33L 2M0XA 1PFMA 4FYDA 1E6EB 2F0TA 3EFCA 4XDCA 3JC66 2KLGA 4ODGA 2CHWA 2UU9L 1JJGA 4WJ3M 4JI8L 4A3MH 3AFPA 4DV4L 4A93G 1XLQA 2JRIB 1K28A 3AN1A 1OFFA 2BT6A 3CMMB 2GB1A 2LKVA 4DNIA 2WINB 1C7YA 5AUKA 2NPTA 1TKGA 4EKUA 1E8YA 3CQZB 4LF5Q 2V3PA 3VRAB 1CTMA 2BDNA 5L83A 3DLLA 1KM7A 2KCCA 3DBLB 2XSCA 1KDAA 2JA6B 4OO1I 2KLCA 5BR8L 2XTIA 3A9JB 2PNHA 3NTIA 3A8IE 1HHVA 2E2HB 4LFCQ 4JI3L 2JXXA 4GN3B 5CBAE 3BDLA 3TEHB 1RM6C 3H7SA 1EIHA 5ELEA 1K8OA 2O2VA 4A6QA 4KIKB 3H3VI 4GKJL 1SEBD 1UZXB 1HTLD 3Q3FA 3RN2A 4A55A 1SNDA 2EYFA 5CX3A 3QOJA 1N34L 1DOMA 4XXEA 4HXDA 1PH3A 4CDCC 5BN4A 5GXGB 1E2WA 2NB0A 3GTOB 3M4YA 1AZPA 2ALYB 1KAWA 1Z5SB 3H09A 4ZK9B 2F0FA 5EBDA 1G6ZA 3G4SA 2FINB 3A55A 2M0AA 3IAM1 3PLVA 4FHKA 2MLBA 4A3IG 2PE9A 5IYBH 4OO1H 4AWJA 3N30A 4ALPA 4DUZQ 3HOXG 2K5WA 3T16A 1Q5WB 1NYQA 3JAML 1CHPD 4DR1L 1YX6B 2J42A 4EZJA 1DOXA 5IGBA 3TBIB 2O6VD 3BZCA 2PO4A 2M2LA 3AEVA 2UXBQ 4DXFA 2PCFB 4WJQA 3D31A 5CGKA 4LJZC 3UDGA 1LO5D 5CMDA 3JAMi 1Z9FA 1LTID 1CZWA 3A9KB 5BYSA 2CWAA 5MPOA 1G8ZD 1RODA 2MQHA 1A2UA 4B3TL 1E8ZA 5HG2A 3UQBA 3G48A 2E2IB 2AWTA 2NWGA 4JBMA 2HTHA 4JW0A 3A33B 1IZ6A 3UIPB 4MM3A 2Q8RE 4DPGA 2DNFA 3K6OA 2NVUI 4AYBG 1K8AC 3VYUA 3U2SC 2QDLA 4ZAIA 1OGWA 4IJLA 3DXJC 1JALA 1UE7A 2ZTEA 3M63B 1PTOD 2N49A 4YCUA 2MNAA 4CJ2C 1KQSA 1PVOA 1E5WA 4XC2A 4DV3L 1L7YA 2XK5B 5HGQA 2KFKA 1LFDA 4ZOHC 4K5VA 4RGTA 5E4WC 1V5TA 1WGKA 3PRMB 1T5XD 4GOCA 3RNAC 3EJIA 3TRZA 3BWUD 1C4PA 5IKCM 2F0UA 4JX1C 5LMUQ 1MG8A 1L5PA 4DK0A 4HAEA 2NVYH 5IE8A 1ONLA 1VQBA 3KF8A 5ELDA 1PH4A 4ZYNA 3AM9A 5D3DA 3FKIB 3S14H 2KQ4X 4MGKE 2WB1G 1VQNA 3QOLA 4IPGA 1VQ8A 1Y69U 2DY7A 3NENA 1UE5A 3AEEB 1Z6HA 2YTVA 2DWQA 2I2YA 4NQLB 2E3TA 4HKQA 3X3MA 1PRTB 1XTCD 2RDGA 1C1YB 3N3KB 2K05A 4WH4A 1G2TA 4KLKA 1ILPA 2IBIB 3UI3A 2F0LA 2F0SA 2I5LX 1L6UA 1VF5C 2WKDA 5FJ8H 4LF6L 2KJXA 4MHEA 2N7EA 3WANA 2LGDA 2GOWA 3NRZA 4C00A 1N36L 3J81L 2ZVNA 2MBBB 3KDFA 5LL6S 3L08A 3R7RA 2JA8B 2D2CC 1QUQB 1GHJA 1A2TA 2FIDA 1HA6A 1C8CA 2FNJB 2NVXH 1JWBD 2N78A 2R7DA 4O1NA 3J81i 4X66L 4W9GA 5D7GA 1LTGD 4TQ1A 1LTBD 3N1ZC 1CHQD 3HKZB 4HJKA 1TY2A 5JVG3 2V4IB 1N9WA 1L0XB 2C9WB 2I38A 1W6JA 4GLAC 2NVQB 1SRUA 3VTVA 1DZ1A 1FIQA 4ICVA 4A3GB 3S16B 3CMAA 1S40A 2QDBA 4R4IA 1B50A 3Q22A 3H7PB 1ZDVA 3NZSA 4G50A 2WXGA 1I42A 4FJYA 4DHZB 2BF8B 2ZTCA 4KJOA 4LCDE 1PYSB 3I73A 4RGMA 2DAJA 1VQKA 2WACA 4QUCA 1C9OA 1PQSA 5GMVA 4A3JB 1K53A 4IPDA 2N4FA 2N9EB 5TSSA 4IUUA 2LGYA 2WWZA 4N6EB 2RSNA 1WMHB 4HKZE 4MEMA 4HPLB 4WWNA 4OWTB 4PMCA 1K9MC 2PW7A 4C2MH 4MTKA 3A74A 4OXPA 2HUGA 2K5VA 4R1JA 1WVLA 4OX9L 1TGZB 1SYBA 4F1SA 1UNSA 2ID0A 4DAYA 1V5OA 1STNA 2MBHA 2EY2A 1PFDA 2QIEB 2WXNA 2LXKA 2YYZA 1M90C 2NVTB 1ZUD2 1Q3LA 1WTHA 2B29A 3OIQA 5EPLA 3PIO3 4A3BG 1MVKA 4BY1G 3OWEB 2RVLA 3Q69A 3NVYA 1QNUA 4M8MA 1NBWA 4PZ6A 1PH1A 4WAAA 3X0WA 3VUYA 2K8BA 4J1MA 2MP1A 2KCNA 2I0QA 1YQBA 3AEBB 1JCKB 4JBJA 4RM9A 2EDGA 1ILQA 4HDOA 2NPTB 2UXCL 5IO9A 3GTQB 1XF5L 2ZW0A 2A73B 1GM5A 4K0KL 3KF6A 3GTJB 3HVZA 4OHJA 4B3MQ 1R9TH 5IYDH 1Y1WG 4LMQD 2C7HA 3JAME 2CS4A 1STHA 3K81C 3RUZA 2G9HD 2OT2A 2Z59B 2MBQA 2CW0D 2VQFQ 1O7LA 3RLFA 1X56A 1XNQL 3DPDA 2SNMA 2L7RA 1WJNA 1NBFC 5IYCH 3W5UB 2VNUD 3SDZA 1XLPA 1O7ZA 3AECB 5H92C 1YNNC 3AQQA 3D6WA 3HOYG 1WWTA 4RMAA 3SK5A 4C80A 2IJ0A 1LT6D 2MFIA 3CC2A 2ZXPA 3KUPA 3PSEB 2YU9H 1EYAA 4GOPB 1WGHA 3BG3A 1II3A 2Y0SG 4HLEA 5C3XA 4YT0B 3TN2A 4YTPB 2DUDA 1NAPA 2CHBD 5DEHA 4K6DA 4B95A 1TY0A 2K5HA 1RIPA 1S5FD 3MWYW 4ARCA 3A4RA 4WAFA 1PGBA 1IP9A 2BGFA 1RCVD 2DY8A 3CRLC 3KLSA 4KD3A 2GBNA 1Y56A 2L00B 4A3FB 3RNUA 1WTXA 3CSFA 2L4NA 1QJOA 2RF4A 1BXTA 4JV5Q 3OMGA 3TSSA 1H9SA 3NZ3A 4FN2A 3WALA 4WIPA 2UUCQ 2C60A 5BMHA 2K5PA 1S72A 2OHFA 1N32L 1A3VA 4A93H 1RL2A 2CQAA 3HS0C 3ITPA 4UPAA 1N33Q 1SIJA 5HKHA 5M3FG 3QR8A 3KFUA 1VQLA 2LVOA 1YQ4B 1LXDA 3GV6A 1AARA 1QZHA 4MM3B 1LTAD 1VRAB 5IN7A 1GUTA 3DBHI 1JW9D 3STBD 2JXTA 4IUTA 4K3BA 1TVXA 1JQ4A 2JRHA 3VYRA 4P72A 5KNBA 3SVMA 5DCNA 4RGNA 1PFNA 1F9QA 1VF7A 1HZ5A 1OO9B 5ELCA 4JE3B 3RNCC 1E8XA 3QWNA 1OXXK 2WNMA 3PSIA 2LXAA 3W1YA 5EQ0A 5M5WH 4JWSC 3VDZA 4PQXA 5FK9C 5BR8Q 3K80C 5C4JB 2KFKB 3J81E 4GN4B 5I9PA 3N52A 4JG2A 1FM0D 1K51A 2KN5A 3HVDA 4A3CG 3KBXA 4JI3Q 4S3SA 4BKGA 2Z8LA 4DKAC 3AU4A 5J3BA 3CU7A 1WSPA 3HOUH 2KCMA 3DHGC 3QA8A 3Q23A 2GBJA 3CIRB 3LNNA 4A75A 1H9KA 4DV5L 2KACA 2O4XA 1N34Q 5EE3A 2KO3A 1WZ3A 4A3PA 3NQTA 2KWCA 3QJYA 1FNVA 2WHIA 3H0GG 5CV6A 4DN4M 4M8AA 2J0KA 4EE2A 3E56A 5ISRA 4K7WA 4ANXA 3AE4B 4LK1C 3HOXH 3QK0A 2KDFB 4WFN3 1WX9A 1LTSD 3VR2A 3ZNGC 4LF9L 2DHZA 4W9DA 5E4XA 3BINA 1CJEA 2BWFA 1SMYD 3H15A 1X6OA 4KN7C 3SE0A 1YJ1A 4YXDB 3F2UA 2TMPA 1UWMA 1XCTL 4N9PA 2EKEC 3KDFB 1GUAB 3GP7A 1SE4A 4DK1A 2N7JA 2NVYB 3MVVA 4BY7B 1MFWA 2B2VC 1CSQA 3DCGA 2GVBA 5FO7B 4KKJA 4AJWA 5FR6A 2VUMH 4HCEA 3S14B 1A62A 1YJ9A 2FBWB 3TEZA 2WQYB 4IM2A 1XTDA 3NS1A 3W1BA 3E0JA 2UYZB 3AE6B 5IP7G 4B3TQ 2A6HC 1Q8KA 3O13A 2L05A 2M8SA 3IVFA 4AIMA 1Y1VH 3GS2A 3PF5A 1IHZA 3CC7A 1MJCA 2KVZA 2Y5PA 2B2VA 1YIJA 1YHBA 5FLXc 1FXIA 1WYWB 2WXMA 4US9A 5JXVA 2MJ8A 2RDBC 1YJWA 5HHDG 2PLPA 1UWVA 3OOCA 1STEA 2VQEL 2DNCA 2EJGC 1T0YA 2OJRA 4KGTA 1ET9A 1NDDA 1TWFH 1NVID 4DV3Q 4B9KA 4BKTA 5I9OA 1KF6B 4K7UA 3BY4B 2A5UA 2YVCA 4TUUA 2KCTA 1ZP0B 3BYTB 2C35B 3P20A 1QOGA 4EGVA 2NVXB 4CHKA 4W9CA 1KLVA 2IY5B 2KVMA 2JA9A 3I55A 4DR5Q 3EHVA 1BMLC 3I63C 1WFYA 5C6AA 3KJPA 2HJ1A 3Q8DA 2KT7A 3IFTA 5C3JB 3DEPA 1SNPA 3IXSA 4KK7A 1JWMD 3AYHB 1NCVA 4DAYB 4DQOC 4JIOU 3KQ4A 3LB8C 3TDQA 5JEAG 1WTVA 4XZ4A 3PUYA 2Q8TA 5I2XA 1L2NA 3TIXA 1ZOYB 1YHQA 1PH5A 1NI3A 2Z0DB 1E9MA 2KAJA 2CHXA 3MTNB 1IYFA 1WX8A 1OEYJ 2EVBA 4LF6Q 1MI2A 1QG7A 3W5VB 2L0CA 1K73C 1TWHH 1KRHA 5J18A 4L5SA 1IUEA 1N36Q 4DXGA 2E2DC 3KF6B 4RAUC 1D5MC 1PYBA 2R92G 5FO8B 1V86A 4RNAA 4KN4C 1EY6A 2ES2A 4C2MB 1YD8U 4ABNA 1NTGA 3OMCA 4N9F4 2C5CA 3I9V1 2L76A 2PMZE 1SE2A 4X3UA 1O7YA 4HIKA 1UF0A 1ZEQX 4MJSB 2N3SA 1EY5A 4X66Q 1D1KA 1F9RA 4OONA 1ZXIA 2KQSA 4LFBL 2LSSA 4FF3A 3ULJA 2WS3B 3HFZB 4YY3Q 5IAAC 2WU5B 3S15H 2RCNA 4TVAB 3D4WA 4OWWB 1I6VC 3CWIA 1CKNA 1XPUA 2V1YA 4MSMB 4L23A 4ZCKA 1FD6A 2CHZA 1OQYA 1HZ6A 2W55A 2MUYA 4IFDI 1Q10A 3CMEA 1YIWA 1Z2MA 2A19A 2IYDB 2L8JA 2H1EA 4DAVA 1DGSA 4KHPL 4IUPA 1TTNA 1BCPF 2K03A 4KJNA 5ELNA 4MGZE 4ANVA 4C3IG 1IPGA 5D65A 1WTQA 3VA5A 4DR3L 4DAMA 5C44G 2GMIC 5LMNL 1KD1C 2QW7A 3GTOH 3ND8A 2GBMA 4TMAB 3ZRFA 2EJFC 2IDYA 4A3EG 1H9SB 3PPAA 2EYMA 3PCOB 4OX9Q 2INNE 3APCA 1K8MA 1WI5A 3PUWA 4K8IA 3T3NA 2H88B 2JA7B 5HGTA 2INPE 4JI4Q 1N63A 2OWOA 2XEWA 5IA7A 4MNOA 2Z6KC 1FGBD 2YU9B 3N6RA 2GN5A 2RPQA 1SYEA 1I4GA 4XDDA 1EIGA 2FAZA 3ZTDA 4LNIA 4IM0A 3N9YC 2IGHA 4IFDH 4OEMB 1SJHD 3G6JB 3NE5B 2CU1A 2KMCA 1RLFA 4JGHB 4HJ8A 1EYCA 2UXCQ 2VXWA 3GQBA 3GDEA 2K6AA 3D6CA 4K0KQ 3D4RA 2V1CC 4LFAL 2B3AA 4WJOA 2ZVOA 2BE5D 2Z6KA 2WAQB 3E5SA 3ER0A 2DN8A 1F2RI 4LNOA 2E5LL 1UWXA 2JX5A 3J80L 5ELOA 4LNNA 4A9AA 3W9CB 4L5QA 2HHHL 1BOSA 1B70B 3KLWA 2HT1A 3AEGB 3HZXA 4CKEA 4EVOA 1XNQQ 4A93B 1C76A 3AE8B 1KRSA 5I6WA 3HOZG 2E76C 1XCQL 4GXBA 3NUCA 4GDKA 1V80A 4DBGA 1S3OA 3J80i 4U673 1YI2A 1G91A 2CKZB 3VUXA 4MTNA 1E8WA 3GB1A 3QIAA 4YL8A 2HDEA 5FR3A 5GQOA 2WDVB 2OCEA 4IOAA 3T53B 2NBFA 4KDLB 1ZKOA 1AW7A 3ZQ4A 1B53A 3T1YQ 2EELA 1HEZE 3SGIA 3N1YC 3KBGA 1TKEA 2BCOA 1FO4A 3FKIH 5JPNC 4YWMA 5M5WB 3GOEA 2C7MB 3TBLD 2DX5B 4YWKA 3QO2A 2GRIA 1D5XC 2XWJB 4KY6A 5EE1A 5BYQA 1V9JA 4OVZA 1QF6A 3J7AV 4WWPA 1TIID 5ELBA 2K8HA 2JQOA 3W3AA 3RNBC 3HOUB 3DWQA 2ZCBA 4EZLA 3S17B 3ZVVA 4GU2A 1CM9A 4K1RB 5G5HA 5IGFA 1FD7D 5M3FH 4H7BA 1FMAD 3PHXB 2JJQA 4JI1Q 5C5MA 2BW2A 4ZKBB 3GE3C 2JA5G 4JI7L 1WTWA 1N32Q 1WCMG 3TREA 2PMZB 2VZAA 3NPPA 3MHBA 4HIOA 2F3VA 1NMFA 3R3MA 2JA8H 2LJ5A 2BB5A 1BCPD 3HOXB 4DK6C 4JOIC 2FE8A 1JJCB 3BYYB 1N8RC 3SR1A 1EO6A 1YOVB 3JVZX 4HVBA 2PZUA 1I3QH 2B63H 3P1HA 5IY0A 4HCSA 5K36G 3PO2G 4A90A 3QARA 4A3CH 3A8KE 1C3TA 4MIUA 4BBRG 3Q3MC 1YN5A 4J6IA 4L5TA 4ME5A 2D0PA 5M5XB 1X3EA 4DR7L 2Z0EB 2F3WA 2UXDL 4BWGB 3QWZB 1Z7TA 1WJJA 2F4IA 1HR0Q 3TUOA 2UU7A 4GB9A 2IY1B 5IT9c 4NDXA 1J8IA 2LVQA 4A3GH 3I3TB 2DJFC 4F7ZA 1ICFB 4FF4A 4NKLA 2OEDA 4US8A 3DWPA 2EOTA 1FVIA 3EVQA 3KUDB 3M4QA 3H0GH 1EFID 2N9PC 1QOFA 1TS5A 1HZAA 2MHVA 4LJOB 4DF7A 4IWOA 2EYJA 2WDRB 2EQSA 2EJMA 1ASYA 3CD6A 5A35A 2LJIA 4RGOS 1XPOA 3VUWA 4PYZA 1HH2P 3MEHA 4B3SL 1DOLA 3NBHA 1AE2A 1TWFB 2WLBA 4K81A 3Q3OC 2K1BA 2HE7A 3W1GA 4LF9Q 1NUCA 2A69D 1FL0A 2KOLA 4FXDA 2WXPA 4R4TA 4ZUJA 3KLSX 5AJ3Q 1G51A 1U4RA 3GTKH 2LI5A 2L52A 4II2B 2WB1B 2Y3AA 2NVTH 2K6DB 2NCNA 1KLGD 2ZNVC 3SR6A 3ZJTA 1VMPA 2A5HA 1GJXA 2Y0SE 5IP7H 5C3EG 3PGZA 1HZBA 4X64Q 5HY6A 3QG1A 3PIOA 3U8ZA 1KABA 1RF2D 5C4XG 4M00A 1W3SA 1YN3A 5JHAA 3GTQH 1C77A 1LT5D 3NEMA 3T56B 1V8QA 4HRSA 1U0LA 1XMOL 1SR3A 1SE3A 4FJVB 4XWWA 2N9XA 1WFQA 4CDEC 4G4KA 2A68D 1TWGH 3CCLA 4ID6A 5M9OA 5D3IB 1XD3B 4RM8A 1CKNB 1EY9A 1TWHB 3DM3A 2VQEQ 3PO3G 4K8JA 3AULA 2MCNB 1ENFA 3IAYA 4TQ0A 2CH4A 3OSOA 2QEXA 1ENCA 2B2YC 4FLHA 1GUOA 1WJ6A 3M62B 3RFZB 1GNUA 4R4OA 3K9PB 1DYQA 1OTCA 1E24A 4BXXG 2LGSA 3A1QB 4CQNA 3P75A 1T0RC 3H91A 3ZNZB 2D3AA 4K5WA 1TQOA 4QIWE 1ROEA 3J80E 1Y8NB 3IAS1 3MC0B 1X9NA 3CAMA 4CHTB 1KNAA 1LABA 1IBLL 2WGSA 2DZIA 4EQPA 4N58A 2B2YA 1XNRL 1V81A 3LX0A 3VYSA 4JPBW 3NS8A 1NR4A 3S15B 1QT9A 1O7IA 2BS2B 4GN5A 4MN3A 3ZJUA 4EQ5A 4A3FH 5E6PA 2RDFA 3HGBA 1ESFA 3HKZE 4C56C 4NPNA 4A3LH 1WR1A 3V6CB 4EX5A 3IFDA 4JI6L 1U5KA 5CHWA 2MBOA 1SNQA 2R7FA 3RLOA 1GD7A 4NMZA 4IWQA 2UUAQ 1U4LA 1RJTA 1L0WA 5IGEA 3DQVA 1BBUA 4DHZE 4EFOA 4FO2A 4DR6L 2K50A 3ZRCA 5GADC 1E3PA 2AYOB 1GJZA 3K7AB 4G57A 1FPYA 2PW5A 1NYRA 5IP9G 4JL9A 1WGRA 3E9HA 3H6MA 4AH6A 1PH7A 2XN9C 1P0RA 2BKRB 2KDEB 2IGGA 3FPPA 2WYQA 5G5GA 3Q8AA 2C9OA 4KY5A 1P16A 4J6HA 3PV1A 2E75C 4LFBQ 1YHAA 2JSVX 4GNXC 2WX1A 5C4JH 3PQIA 1J19A 1ISNA 1Y8RC 3JSVB 5IWAL 3EA6A 2KZRA 2WFWA 1EWIA 4M0WA 5AZGA 3TCAA 4P16A 2ZJDA 1NJIC 2KK8A 1STYA 4LF7L 3M3YB 4PZ8A 4C3IH 2KX0A 1W2BA 3DBRB 1RYJA 3KYCD 4KKUA 1QOHA 4DV6L 1PYWD 2YTXA 1WTPA 1GC7A 5E6NA 4FVMA 4TV3A 1BNZA 3S2DH 4GN1A 4GNXA 2AQ2B 4P7IA 1F2YA 1Y8OB 1AH9A 2AUJD 4KKTA 1XMQL 5C23A 4CDFC 4OGQC 1LTLA 2GVAA 1YNND 3G6EA 4PK1A 1MG4A 3L7ZC 4B3RL 1TKWB 2EKIA 4H02A 5DPRA 3PMFA 2LUEA 2LRWA 4G3XB 1M1KC 3KW5B 3UINB 2Q2TA 2Y0SB 2KMMA 3E3XA 5D94A 3RT3B 1KFYB 1I4RA 3C2PA 3AU5A 3IG3A 2LY7A 3NTKA 2KMAA 2VB3X 2R2QA 5JJZA 5G3LF 1YJIA 3GTGH 4HMJA 3BIID 3CCRA 4BY7H 3H1UA 3FKYA 2EIFA 3OIPA 3H3VC 1BQQT 4C7ZA 5DLQE 3TQYA 1CSPA 4B9XA 1SFOB 1CT1D 2R93H 2HQEA 4PMBA 3U50C 1TS4A 4WQOB 4KY7A 3K0YA 2L11A 5EKLA 3APFA 1Q12A 1T0SC 1M8AA 2BA0A 3AMZA 3CP0A 4J3OD 2IHFA 1R7SA 1F77A 1U4MA 1N5WA 1C9FA 3D0FA 2E74C 4OZCA 1D6EC 1TWAH 3C3LA 3DM1A 4I7ZC 4P71A 5M3FB 1ML0D 2KOXA 2HHHQ 3IBEA 1L1OC 3SEBA 4A3OA 4GLXA 3EQLC 2PVOD 2D2QA 4JPSA 1B8AA 3L0WB 4QIWB 4DHJD 1EUJA 4QQBX 4JVZA 3VVWB 3GZNI 2F0DA 4ZRIA 3U30A 1HNXL 3A4SC 2DNEA 4LW1A 2QF7A 1ZYRD 3RCZA 4RWSC 3AEDB 2MQJA 4MH0E 3PIP3 3Q8CA 4OL7A 4N8X1 2K3UA 1I3QB 2B63B 3WAPA 3HIZA 4KSKC 4NAMA 1L1OA 4KMUC 1MSGA 4Y7NH 1KAAA 4C7YA 2K33A 2F0NA 2ZEQA 3HOWG 3NBHB 2ZJRA 1E90A 3I4MG 3HUIA 2KHIA 4GS3A 5EKKA 2NUCA 5AEKB 1N6ZA 1T9HA 1YNJC 4GSWA 3ICEA 4AQYL 4C3JH 2OTJA 1HCZA 4DXAB 3TEWA 2O5JC 3KWLA 2A8VA 2JA5H 1VS0A 2WDQB 1WCMH 3MC8A 3RUIB 3FVQA 5KIXA 3H0GB 4R4CA 1SE8A 1PZKD 1FGUA 1Q8IA 5LHY1 4K3CA 4BS9A 2Y5CA 3PS6A 4AQ7A 4JI7Q 2K7VA 4V0BA 1JE4A 1VQCA 1IBKQ 1X32A 3M7NA 2V3NA 4HSVA 1LM8B 3IL8A 4U68A 4DGZA 5I2YA 1YBYA 4P74A 5K36H 3PO2H 2BOSA 1UGJA 2X8XX 1CKMA 2IL8A 4BBRH 2LASA 2EZVA 3GTKB 4C3HG 2K28A 1GHKA 1SIFA 4E74A 3A7AB 4MDKE 3CSTA 3UDIA 3L4PA 2DBYA 1UE1A 4YSXB 1TU2B 1O80A 5GROA 1WE6A 2L0TA 2UXDQ 1SB3C 3NELA 3FILA 5EE0A 4ITKA 3ZIMA 2G5DA 1HTQA 3H94A 3I4LA 4A3DH 5G3LD 3I72A 1WM3A 1ZKHA 3LYYA 4IUMB 2K75A 1YNXA 3L16A 3GTPH 4KKIA 2LFNA 2MPMA 4G11A 3AB9A 3T1HL 4K7SA 3OW2A 2AL6A 1A5RA 4I7AA 4QMGA 1JWAD 1R4MB 2R2OA 1X54A 4BOZB 1WH3A 4FP5D 5JOBA 1J9OA 1TWGB 4FULA 1A70A 4LNKA 4BBNF 3TEXA 3Q24A 1V1QA 2IGDA 4B3SQ 1FEHA 2O2VB 3I56A 1IW7D 5G2NA 1ZE3D 3RZWC 4CKBA 3VR8B 2K8CA 3DHIC 2ZPNA 1S3SG 3CXCA 2LGIA 3KK7A 3PT2B 2REXA 2NBVB 2JA7H 2Q2UA 3Q0AA 3OYYA 4YHHQ 1BO0A 4G0NB 1ZXHA 1BUVT 1NMGA 5C4XH 4W9FA 1KH0A 3VR4A 2XRQD 4X65L 4DV7L 1TWCH 2I1KA 4TKOB 4IN3A 1I4QA 1LT3D 4HIMA 5C4HA 4A4IA 1VQ9A 2LWPA 2JT4B 4ZRQA 2GA4B 2ZXRA 1P7EA 1SNOA 2O6VA 5FLMG 3I70A 1WZ0A 3IT4B 3A0JA 3APDA 1FJGQ 2PPHA 3CPWA 2OOBB 2Q5WD 1PXUA 4PS3A 4KD4A 1XMOQ 4ZHPA 4HN7A 4ZQ3A 2GBRA 3I57A 4LLGM 2BVCA 2JZPA 1LUZA 3S24A 1T6BX 1FFVA 5C1ZA 4LF8L 1PTOC 1N60A 1QQRA 1X65A 2R92B 1A0IA 4MGYE 4LUZA 2EXZA 1Q82C 2B2TC 4IOCA 4M0WB 5EE9A 3WCQA 4PT5A 1SROA 2FMMA 1K3RA 1PDQA 1WGYA 4BXXH 2ENBA 2FXQA 4DV2L 3ZYYX 2KN4A 3VHTC 4LUOA 4GKKQ 3BZDB 1RD9D 5JPMC 5FO9B 1YEZA 4XQJA 1ACCA 1YJJA 2LHDA 3NG0A 4GNXB 2UU9Q 3VTWA 4JI8Q 2VY3A 4DV4Q 4KGSA 2HD3A 2B2TA 4KKSA 3GTLH 3GO5A 2BS4B 3GD7A 1F2ZA 1NY4A 3QQ8B 2RHQB 1P7FA 2CR5A 1E7VA 4UHVA 4ANWA 5HURA 3DWGC 1XNRQ 3J81j 2PW9A 1EF1A 3I5JC 2IO0B 1PRTF 5D14A 1SSOA 3DDCB 2JYOA 4JI2L 1GUWA 5LXHA 3FAHA 1GVPA 1LYLA 1QB5D 5KYIA 3ETRA 4C3IB 3LWUA 1JB3A 2AUKA 3KF8B 2ICIA 5EGTA 3TZDA 3S17H 4JI6Q 1B9NA 4GKJQ 1EWYC 3PTFC 3PZDA 2N8NA 1XLOA 1TT2A 4POFA 3ZUNA 3S1MH 3S2DB 4S0RA 3MAQA 1YNTE 2WXLA 1C4QA 1Q1EA 5KYLA 2A1AA 3AE2B 2G1EA 3C8YA 3ZO5B 1K52A 3WA0A 2FUHB 4A3IH 4DR6Q 2KBNA 4DR4L 3OW7A 2F0HA 1JE5A 3NP8A 3K59A 1UEBA 3CKIB 4C1NI 3FDTA 1SBBB 3S1RB 2UUBL 2R7ZG 1TYGB 3B1LX 3MJWA 5CV5A 1XO3A 2KFJA 4H0LC 1TZOA 3DVGX 3QC8B 3P1MA 2L1BA 4ZLTF 3EC8A 1TIFA 1PGXA 4DR1Q 2VB2X 3IFWB 4POGA 1GAQB 3GTGB 3A54A 1QOBA 4EOYA 2KQ7A 2EYHA 5M5XH 3AB5A 4B0MA 3I91A 3PLUA 4IC7B 1PH9A 1E0BA 2KTRA 3K9OB 4PV1C 1DONA 3PRZA 3ZW3A 2B3GA 3HOVG 1P3QU 4IO9A 2R93B 1V43A 1L1OB 4LF7Q 1C48A 2PPBC 4A3JG 2PTLA 2AMCB 3OPOA 4LK0M 1H9MA 2FCMA 4DV6Q 2INCC 2CQOA 4BAXA 4GLSC 1UUPA 1FXTB 3U4VA 1SMXA 3TP6A 1WXMA 3HOZB 5G55A 1TWAB 2K9XA 2KANA 3FMCA 3AMUA 3L54A 3NHEB 1XMQQ 3PUZA 4YCVA 1ASZA 2SOBA 1U4PA 3NBIA 4ZKCB 2WAQE 2F4VL 1H95A 3UE1A 2HD5B 2RKSA 4HEA1 4FF2A 1VQEA 3HRDD 2KVRA 2N7DA 4L6TB 1JOKA 3J9CA 1LTTD 2D07B 2SDFA 4LF4L 2IO2B 2XBBC 3DHQA 5C0XG 1HR0W 2IX0A 5BN3A 4XDXA 4Y7NB 1I6HH 4R9WA 2C7NB 1KRTA 2BQQA 1A3UA 4KGRA 1Z47A 2OF1A 3VYTA 1CA5A 1TT5B 3NK9A 1VCBA 1J7BA 4RA8A 4FADA 5M3MG 1D2BA 4E3CA 2FCQA 1YMHE 4QB4A 1E7UA 4IW0A 1BVSA 4C3JB 2SNSA 1Q86C 4HSPA 4RKLA 2QMTA 3L17A 3CCVA 1PH6A 4EEWA 2CW0C 1FNUA 2JA5B 2F0MA 1WCMB 1YITA 3RI7C 2I5HA 1QILA 4JYAL 2Z4IA 3MXNA 1SNMA 3FILB 1JWUD 4CJ0B 1PRTD 4USAA 5EAYA 5E7NA 2D11A 4A3KG 1D5ZC 1EYDA 3U58A 3GZNB 4LTUA 1NSNS 1EU4A 4LF5L 2AHOB 2L15A 2NN6G 3MFGA 2AKWB 2PMVA 4A3MG 2FUG1 2DYMA 1PH8A 1STAA 3C19A 2L83A 2J0MA 4HK2A 2W3SA 3TMPB 2A6ED 2MA9B 3PO2B 4Z9CB 3HOWH 4DNTB 4LFCL 3KYDD 4IALA 1I50H 4BBRB 4FJZA 5F2DA 5CV4A 2IHEA 4DK3C 2WIIB 4IDIA 1SYDA 5AFWA 3G71A 2NBWB 3OG5A 4A8XC 4HDQA 3NWSA 3PUVA 4M1UB 1QKZA 2N1WA 3GV3A 2MBEA 1AZQA 4YTNB 2XGTA 2LS01 1GKHA 3M4PA 4OELB 4L1BA 1PDXA 1FCLA 3AE1B 1HQMC 3Q3JA 3HM3A 4AQYQ 2ONQA 4RCOA 4A3DB 4N59A 4II3B 3P2BA 3WIMA 2NTSA 1XQQA 1VQGA 1NENB 4BVUC 2RDHA 3RZDH 1V6EA 3GTPB 3EGRA 1VQ4A 2YEPB 3BJUA 4NB3A 4P6VF 4O0AA 3JAMc 1DD2A 1EEID 4L8JA 3NSWA 1FRRA 3DBRI 4ULLA 4Q5VA 5CHFA 1V49A 4ILWA 4DDGD 3QJZA 1DGJA 1E0ZA 1YZ6A 5J22A 4HCPB 3L13A 3STBC 2ZXOA 4AYBE 4OO1G 1B44D 4RH6A 4C3HH 1B9RA 3HP3A 2UXBL 1JRPA 2MP2A 3K7AH 2G9DA 3NVWA 4A3BH 1D4BA 4BY1H 3DVNV 4JC0A 4GIVA 3R7QA 5C3EB 1B2TA 5DPSA 5J17A 2RSOA 4IPHA 1VQ6A 1AP0A 5C4XB 3K8AA 3FRPB 1TWCB 5CTRC 1PTOB 1C4CA 4N8FA 4L63B 4ACFA 1WE7A 3KVFB 4GDLA 2OEOA 2KC1A 2WB1E 1Y1WH 3U4EG 3M3YH 3D4DA 2JQRB 5EBCA 1WXQA 4RKBA 3VA7A 1AFPA 3T1HQ 4PYUA 3BU2A 1HUNA 2ZW1A 3ZLZA 1PFBA 2K4KA 4C4VA 1I5FA 3PO3B 2KHWB 5LLIA 1FRDA 4P73A 1X3FA 2HCCA 5TR5A 1SMYC 2F0JA 3FPUB 3HOYH 2F1MA 5KGUA 1PH2A 1BKBA 2M1MA 1V1PA 2QCZA 2RD0A 3B0AA 4OW0A 2K5NA 3CF5A 2B8GA 1FXAA 4RHRA 2OTLA 3T9LA 2MJEA 5CYUA 2QILA 2VS1A 1M4VA 3ULLA 1CZPA 1QZEA 1PGAA 2Z9HA 2PI2A 3GTLB 2ON8A 4G7OC 3NUHB 3N20C 4TKNA 5FLMH 2BTEA 4X65Q 1UBIA 1G2SA 5AUIA 1P98A 2IW3A 2NMQA 1CK1A 2PE6B 2ZZPB 3HHMA 3P63A 2HDLA 1MSHA 1Q0WB 4NNJB 1AEXA 3ZGZA 3V96A 1SFOH 3J81c 3M4OB 2Q2IA 3DOWA 4FXGC 5BMIA 2WXHA 3KUCB 3PZ7A 1F0ZA 2Z6BA 3P4RB 2QGQA 4HPPA 5FJ8G 5CV7A 2Y5BB 1F2MA 3V05A 1HNZL 2CJNA 2K39A 4LF8Q 1OQQA 2KTRB 2EPBA 3I8ZA 4RF1A 5KRUA 3S1MB 3A5ZB 3GE8C 3VH4B 3K5LA 4HIDA 4UAIA 3A9KA 4I6LB 1J6QA 3NOBA 1BR9A 4K2LA 2OQ0A 3C46A 1VQFA 3X23A 2JYEA 2WU2B 2MO0A 4A3IB 2EMTA 4BA2I 4FXCA 2VZKB 4IUVA 2D62A 4XX5A 2D10A 2K14A 4EQOA 4OIKA 2DZJA 4QL5A 4AUQC 2RPVA 1L4DB 4NAWA 3L3OC 2KWVB 1EY4A 1IGCA 3B2GA 5JH5C 2ZCCA 2B2UC 1XYIA 3PIPA 1WGGA 3T51B 3CRKC 2XK5A 4FF1A 1WGDA 2K0PA 3CCMA 2PQAA 3VRBB 4JOIA 2PQEA 1HJPA 4HJAA 1B9MA 2GLSA 1VD2A 4JI2Q 1QZGA 1UE6A 2EY6A 1XX8A 2JEBI 3WOFA 3O65B 4OIJA 1BUIC 1QCBD 1WOCA 2FCNA 4LWCA 2IO3B 1GPXA 5AZFA 2B2UA 4IUQA 1VZ6A 2D0OA 4AYBB 2MWSB 3EFUA 4JI5L 2BYFA 4DV5Q 1WD1A 2R7ZH 3IT6B 2PI2E 3HEJA 3ONSA 3PO0A 1WD0A 1L2FA 1GG3A 3KJOA 1MD2D 1F9JA 4M8NA 1KDCA 1R4MI 1SN8A 2F3IA 4DR4Q 2ZM6L 2DGYA 3V2TA 3CCEA 2UUBQ 5GAHC 3UI2A 2HJ8A 3MXNB 1OXTA 4AP4C 3RMKC 3NZUA 4MGIE 4ARIA 1UH6A 1F9PA 4NJCA 3DUZA 4F87A 3RD2A 4ASWC 2JPHA 5DNFA 4QUFA 5IOIA 1I6HB 3UF8A 1DOIA 1I94L 1AWDA 1P1AA 2E6XA 1D8LA 4DK5A 1E1OA 3BVMA 4J15A 4WQMA 4MH8A 3SXHA 3OJ3A 2BS3B 2BWES 1JRUA 5IYDG 3ZXRA 2IO1B 2K1FA 4O2DA 1JQYD 3TP5A 2YEPF 2B2WC 3D8GA 2CU3A 4CBVA 1J5EL 1ESRA 2L55A 3ZDTA 4NZLB 3ZNID 4X3KA 2I46A 5JJLA 5JJKA 2JWUA 1MKHA 4FDBA 3S1QB 1EQVA 3SFDB 2PZTA 2XWBB 4W9JA 3V62A 1B7YB 1MJEA 1IL8A 4DDID 5FLXL 1CQVA 2XVSA 3Q8FA 3RYTA 1DXMA 2EYPA 3ULPA 1Q1OA 2F4VQ 2EMSA 2KDIA 2D9UA 2UWQA 1IKLA 2B2WA 3S9WA 1IYUA 5IOCA 4OVVA 3F1ZA 3ZJYC 3HOWB 1SF0A 1PA6A 4GZYC 3I4MB 2WXRA 1WJUA 4LF4Q 3W2DA 1I50B 2QDFA 3KUZA 5M3MH 3U9OA 4ICUA 3VFKA 2JVCA 3A56A 1Q46A 2WXFA 3KOJA 3WWVA 2G4SA 4HCNB 2MP2B 4ZRZA 5JEAH 2JK8A 4B6WA 1NNXA 3HRZC 2BE5C 4JLCA 3B2FA 5BMGA 4IZ8A 4DV1L 4QY7A 2CKHB 2KTFA 1S1QB 2F0KA 5IP4D 3V61A 4XYCA 3ZJVA 1EM7A 3CF6E 4DWFA 4X62L 4A3KH 1X3PA 1B3QA 1IYVA 5H1SE 5J2RA 3RZDB 5IGGA 1VJKA 1BF4A 2NN6H 1ZPSA 3Q14C 4JYAQ 2MRPA 1JOOA 2KWDA 3EIVA 4R8IA 2R92H 2AL3A 3AI5A 1RHPA 3PRPB 4A20A 2D5GA 4FBJB 4RCNA 4KDIC 4LDTB 1KDBA 4GDLB 5JZEB 3MXUA 2H4OA 3ERSX 4DV0L 1PUTA 2W54A 1STGA 3BK2A 5BO4B 4BFRA 4WJWA 1EF5A 2D3CA 2I5MX 4YCWA 1DJRD 1HPCA 1WYGA 2F0VA 2QSDA 4C3HB 4LAAA 1K3BC 3M9BA 4S17A 1YX5B 1TS2A 4F88A 4C4VB 2NYZD 1A15A 5DM63 2QCPX 1BBWA 2WXIA 3PGEA 2JUOA 4CGYB 5LL6X 4A3BB 4GOPC 1RTOA 2NZ1D 4BY1B 1HZ9A 1X3QA 5COYA 2F0PA 2BKFA 3L10B 2CVRA 1AN8A 4UP8A 1V1PB 5DAUA 4JWUC 1MIUA 4GDKB 4F8CB 1K0RA 2B8FA 1EWCA 2Z4HA 4WURA 1EQQA 3HOUG 4PS8A 2WV6D 2IT1A 1RTNA 5EJWA 2KXJA 4WJ4A 4F8MA 1HQRD 4ZRJA 4GOPA 1Y1WB 3I90A 4DU9A 1HFNA 3M7GA 1WR6E 4WJNA 3C0RB 5C44H 4ZUIA 1D1IA 2CCZA 2W3RA 2ACZB 5BYRA 4CYEA 3B6YA 1FR3A 1CUKA 4KHPQ 3LWEA 2KJ6A 1BCPC 3HKSA 4NQKE 1R4QB 4A3EH 1RAXA 2KWUB 3J7YW 4DR3Q 1I4XA 3BDOA 3I3CA 1SYFA 5LMNQ 2FHTA 1OQRA 4OZAA 1PMRA 3SD5A 1B3AA 2LMCA 1KL9A 1HUMA 2EXDA 2KECA 3HG9A 3NTHA 3S1RH 3HOYB 4NXNL 2KHJA 3ECIA 1SXTA 4IOIE 4UP9A 4NJ6A 1G291 2L5TA 1Y14B 4QJFA 2JP1A 2XIWA 1WTRA 3H3VH 1TBEA 3A5UA 4W9KA 2LUMA 3DWMA 1RFKA 1NR2A 1MHWC 2QEJC 1IGDA 1HA5A 4IWPA 4HWIB 3RN9C 3IRBA 2BH8A 2JN4A 2VUMG 2FCSA 2WXJA 2SAKA 4KZCA 4WWMA 4G7ZC 5EPJA 1F52A 3MEFA 2D5DA 3Q6SA 2AEHA 4JQWC 3TEYA 4P1CC 3K5MA 2IX1A 2EYLA 3MJ5A 1A8VA 2VH2A 4NAWB 1Y1VG 1JMCA 1E7PB 3NVZA 2PYKA 1U4AA 4LNQA 2AQ1B 3ERQA 3P42A 3OWFA 2KA7A 4RF0A 4IKGA 4BKSA 3KLRA 1DOYA 1MHXA 2RA4A 4LFAQ 3RNEC 3VQIA 2E5LQ 3I2ZA 2RCFA 1VQAA 1FYCA 4TQUS 4RFBA 2PQAB 3HOZH 2BB6A 3AE9B 3UGBB 1G6JA 2J7ZA 2XRSD 1LT4D 4BBSG 4DR5L 1WF9A 2A69C 2V3SA 4K14A 2INDC 2R6GA 2DYOA 1KLUD 5DPWA 1XT9B 2M9VA 1VDVA 1GUGA 2LFIA 3ENEA 2HQLA 2VRRB 2I07B 2KD0A 1EEFD 4NP5A 2P5ZX 4JI0L 1J7CA 1YVCA 2MH7A 2YV5A 3ND9A 4R4QA 1KJTA 5C0XJ 5T8IA 1V9PA 4G7HC 1RRBA 4MACA 2R3ZA 2WP8J 4PNYA 1SE9A 1WX7A 1LQBA 5FLXE 2DZMA 2GI9A 4XT3B 1P8LA 3F2BA 1PZID 2Q8IB 4I6NB 4AS1A 4W9EA 3I7FA 3E0EA 2V9HA 3EUB2 4AJYB 5I4DA 3DWAA 3R8BA 5DM73 5JEAJ 3LXFA 2LHEA 2A68C 2BYTA 1JORA 1C4AA 3NQIA 3U7ZA 1UEAB 4CJ1B 2QA4A 5L37A 1ET6A 1TXYA 1HNZQ 3CHBD 1IL2A 3I4NG 1MI0A 3U9SA 1R4NB 3DBSA 3SDLC 2A74C 1GB1A 3FHWA 3J7A5 2R7ZB 2V4LA 4R3DA 2OJWA 3DVGY 1I7HA 1YN4A 3SHLA 1K8GA 1IXRA 4HJ9A 2RR9A 4ZRKA 1EL0A 1GUSA 2VW9A 2ZNVB 2J0TD 2KENA 2BYEA 3S2HB 1FCCC 3QB3A 1XWEA 4JCVE 4YY3L 1JICA 1ENAA 1VCIA 1B1ZA 1XEEA 3JW0X 2VZKD 4ZHOA 1J7AA 2JA6G 4MSQB 4P2CB 3E9SA 5EPKA 1S4ZA 1EY0A 3RNGC 4Q0FA 5I6YA 3NHHA 3T13A 1OTRB 4H2AA 1V1OA 3HOVB 2EYOA 2F0GA 2ZPYA 3FEWX 4OZBA 3SHQA 3RZOH 2V4DA 1H8CA 5JAVA 4DR7Q 3Q8BA 3V6EB 1VQDA 3CCSA 1KHIA 4UDUC 1QVFA 2A6HD 1ZDXA 3RULA 4DR2L 4M01A 2KHSA 2MJ3A 5IT9L 3J7AF 4W9LA 1JB7A 2TSSA 1JR0D 3CC4A 1PZJD 1I4HA 5C4ZA 4XE0A 4JI5Q 2KJHB 3K5OA 4OWXB 2W9NA 1VDZA 3A7LA 2YLMA 2RGFA 2W82A 2Z1CA 1EU3A 2PVGC 4XIGS 1JJ2A 3JYUA 4JI4L 2IY0B 5IIFA 1ICWA 4URKA 1CMXB 4IURA 2LEKA 3TS0A 1J0GA 4XQQA 2NZHA 1S5DD 2ZM6Q 3K58A 1WRDB 1HZCA 3WAMA 2MHJA 1EOTA 2G3QB 1V97A 1JT8A 3PUXA 1GXDC 3VTUA 2J0JA 2B76B 2EY5A 3AU7A 3SU8X 5C3EH 1IBML 3QHTA 5M3MB 4KZ0A 1LACA 1VQOA 4IFDG 2NZOA 3J80c 3S1NH 1WI0A 3F2CA 4NW2A 3AEFB 1GUNA 1OXUA 3ML9A 3TZUA 1I94Q 1HNWL 3OTOL 1Q7YC 2EY1A 1PTOH 2QHOA 4KV2A 1T3QA 1BBXC 3J7ZC 1WY8A 4MJSA 4HPMB 4O42A 2DZKA 3AFQA 3IKJA 1U9RA 4DNRB 4A3KB 1J5EQ 2K22A 2NS5A 2HCIA 1WM2A 4A3MB 3PO3H 1EUVB 2PNRC 2JWZA 1A3TA 1TR5A 2JSOA 4WRDA 4IM3A 3NY5A 1TKYA 3T1YL 3RN5A 1V2YA 2MJDA 4EZKA 2LVPA 4WJPA 2Q2HA 2ATWA 4HEDA 1YQ3B 2F03A 1JWSD 4LUVA 3TL5A 4FNFA 1OXSC 4NY0A 2M56B 2RQXA 5L95C 1Y8PB 4KTAA 1M94A 3V3XA 2J4XA 3FKIG 2GBKA 1GB4A 1E7ZA 4QF4A 5CC4A 5D6JB 4IPCA 1KC8C 3TP7A 4L5RC 1JMLA 1TZ1A 2LMCB 2F0EA 3ZNHB 2N1VA 4TSSA 1PV4A 3WAOA 1IBLQ 3DHHC 4CDDC 3M85A 4JI1L 3MXPA 1XXGA 4DV1Q 3M4OH 3T3OA 5GAGC 1BCPB 1Q90A 4GMVA 4FXKC 4X62Q 1SLJA 3C1EA 4IUNA 3ZDMC 3SK6A 5GAEC 2L12A 3U4ZA 1HTOA 2JYTA 2FJ2A 1S5BD 5C44B 4RMFA 3AV8A 1E22A 1H9JA 1EQTA 3T4AC 2CWPA 5LXIB 2JA8G 1N61A 4DV0Q 4A3EB 1ZYRC 4UP7A 1VQPA 1OEYA 3ZKJC 2M4NA 5IP9H 1K0SA 1X1MA 4ANUA 3R2IA 4LDTD 2ASBA 1WJ4A 4DUYL 4D2KA 1KTKA 1ZXTA 2B63G 1C0AA 5JVH3 3N32A 4X3TA 1HR0L 2K6QA 3RPFC 1X55A 4YTMB 3HKZG 4A76A 3MA2B 1FNWA 2KJRA 2K5DA 1PLFA 4X57B 1KIXA 1DOKA 2BA1A 3CCJA 2IX3A 4A3GG 4L2YA 2D3GA 5IGCA 2L32A 1QVGA 2ASQA 1F9SA 3MTSA 3Q2AC 3VR6A 5IWAQ 2PKOA 1KOTA 5EKIA 4K2KA 1SSNA 2VL6A 4LNFA 1MBYA 2Z0SA 3R3OA 2BYVE 3TMEA 1WTOA 2R61A 1HRJA 4HR7B 5D2MB 3P7JA 1ZW7A 3Q3NC 3CCUA 3NWTA 5CHVC 5AJ3L 1VQMA 1D3ZA 5CV9A 1UELA 3K7UC 3MHZA 3RMHA 1DCZA 3MZ5A 2X38A 1CZGA 2K04A 1K83H 2ZJPA 4OVUA 2AX5A 4NXNQ 2C5LC 1RWSA 4B3RQ 2H5XA 5HFYA 2BDOA 1I4PA 3MFYA 1JOQA 4X64L 3UDFA 5LNK1 3ALBA 1SDFA 3EBEA 5IT9E 2IZVB 1RDPD 2RBMA 4KSLC 1QNKA 4IQZA 4DA2A 1TJEA 2G4DB 2HDMA 4KV6A 2WXKA 3AXCA 3LDZE 3MHSD 3GTMH 1A6XA 1GO3E 5KEEA 2N0SB 2ZT9C 5A2QL 1ZGUB 3S2AA 2E2JH 3TS2A 5E6JA 3M95A 4K5XA 5M5YH 1TS3A 4NXML 4MZ9A 1PHJA 2NBUA 4E71A 1SJED 2O2LD 3T8MA 4CKCA 2ZJQA 4KX6B 2K32A 1CI3M 1NE3A 2QKIC 3U7DA 4BBSH 4B9WA 1EIFA 1SGHA 1XJVA 5E6OA 3NJTA 4Q2JA 3BK1A 3I4OA 2KNBA 2J53A 1IW7C 3S1QH 2JF5A 1EYGA 1X3GA 1O78A 1STBA 2HIXA 1GOZA 4C1NK 1MJDA 4KVGB 1T0QC 4PS7A 4ZYSA 1B4OA 1WXVA 3TJPA 1E10A 2F52A 2JU6X 4W9HA 3RZFA 2X6GA 1F1HA 1LM0A 3W1SC 3BVZA 1HNXQ 2NR2A 4JI0Q 3W5OA 3H6NA 3Q6BA 1KNEA 2OXPA 3I4MH 1E1TA 2VH1A 2DENB 3DBLI 1CFMA 1CA6A 3QCAA 4I6PA 4TRDA 3BVGA 2BH2A 2KDBA 1T5EA 5CBEE 2JZ3B 1XLNA 4I65A 4BZAA 4GGQA 3UE0A 2DAFA 4NJ7A 4KI0A 3EN2A 5T1GA 2AQ3B 2LXJA 2X6LA 2H89B 3RZOB 2JE6I 2AWNA 4A3FG 3BS1A 3KWVA 3PZ8A 3I4NH 3W1SA 2EE1A 2V0GA 1VQJA 3RR5A 3F2DA 2UUAL 3PF4A 1G6PA 2I1JA 4XYOA 4A3LG 1IYJB 1BDOA 3QIJA 1AYFA 2WX0A 4ZDVA 5C5LA 1H9RA 1SNCA 4EUTA 1VQHA 2O5IC 3TP8A 2M00A 3RLNA 1SYGA 2MGSA 1GC6A 2F0IA 1WXAA 1HTPA 1LTRD 1OXVA 1N5XA 3H9DA 1XPRA 1EY7A 2O6VB 4DUZL 3CQZH 3OAWA 2E8GA 3CCQA 1IBXA 3NVVA 1L6VA 2KX3A 2JA6H 3N1XC 4BA1I 4XTCS 5IYBG 3R66C 4ME3A 4JK1C 1VZ7A 1VQ7A 2E2HH 1UBQA 2J52A 1EZ8A 2IWHA 2JZZA 4X3SA 1WIAA 1CKOA 5KHQA 1EQRA 3NXWA 2L1AA 1C79A 2BBCA 4HROA 3EROA 1VQ5A 4MELA 3CPFA 2J7QB 3B08A 2XNAC 2RMMA 2WDTB 3S1NB 2LRUA 2KDMA 1LLRD 4HMIA 5E3FA 1R9TB 3M3JA 3OJ4B 1PFSA 2KEEA 3D3RA 5IODA 5KNCA 3A1QA 3H8HA 4EQNA 3VXWA 1E2VA 2JEAI 2QC8A 4B0EA 1UAPA 4X6AH 2L3ZA 2LD9A 4DR2Q 1W6KA 1QE6A 3BDCA 5NUCA 3R93A 2LXCA 4XYQA 1DM0B 4KHVA 3PVLA 2KC2A 3A9JA 2FIFA 2L0FA 3B9JA 4YIJA 4QCLA 2MW5A 4P75A 4WORA 1EOVA 2OQKA 5KNDA 2N55A 5JJIA 3AH7A 4Y52H 2G45B 3VR9B 3ZTCA 5LMUL 1QLBB 4BBNC 1J8CA 2WXOA 3IHPC 3PREA 4CO7A 4KIKA 4FA6A 3UDXA 3RNFC 3WOEA 3CW2C 1VMCA 4HTHA 4N9TA 3VR3A 4DFAA 1MPEA 5CR3A 2HTME 4BY7G 1Q1BA 4RG1A 3X3NA 2KUMA 1IBMQ 5FKAC 4XGAB 2PIAA 4AOFA 3UQAA 3VH3B 4R8NA 3L9AX 1WYDA 2E2IH 2R93G 4YWLA 4BOSC 5CORA 4DV7Q 1HNWQ 3C1FA 3F8TA 3OTOQ 2PJHA 3PV0A 1WXSA 3FP9A 1VLBA 3U52E 4DHJB 1L0VB 4ZRPA 3MC9A 2PZWA 3BZKA 2QJLA 4IG7B 2F0QA 2RSUA 3RD4A 1R4PB 3SK8A 1SAPA 4J8QA 3D32A 3DVNU 3UIOB 2M17A 2K25A 3K0XA 3KYHC 5LMNW 3R2TA 4NPSA 3JSVA 2WKCA 1L0YB 3EECA 5A2QE 4LJPB 1EFWA 1A63A 3L0OA 3ABVB 1R4NI 4DV2Q 4DAPA 4H13C 2K01A 4K6LA 1K50A 3K5NA 5CV8A 5DPTA 1HE8A 4QAYA 2RHSB 3DMUA 3DEOA 5ELFA 1WRIA 5C2TB 3EFXD 4PMWA 5E1FA 4FHJA 2KEDA 3AE7B 1I35A 4JBKA 2MSED 1C78A 1EY8A 2IPKD 3VR5A 4PZ7A 2KYWA 1S5CD
chains in the Genus database with same CATH topology
4C3JG 5K5PA 1E2ZA 1JC7A 5J1ZA 1F2RC 1JROA 5HI1A 3P4QB 3SK4A 4F7XA 1PRTC 1F2LA 3AE5B 2ICEC 2K5QA 1RKNA 4H44C 2AWOA 4HJGE 1EWHA 2DLBA 4E6IA 4REZA 2A6EC 2JXMB 2CJOA 1MHHE 4XT1B 2L9HA 1S5ED 5IGDA 1K83B 2N9KA 1HFGA 2VUMB 2B39A 4B08A 2NTTA 1QOAA 5C0XI 4V190 3GTMB 3MP9A 2KQ3A 4XQNA 1Y1VB 2SEBD 1NEKB 2E2JB 1MGSA 5M5YB 4YSZB 3Q8EA 3FC4A 1SYCA 3MXGA 2X69A 3P4PB 4KHZA 5J39A 1V8CA 2FFKB 3URYA 1QWYA 4BBSB 1L4ZB 1LV9A 5C3WA 2M19A 2MEKA 3K57A 3AE3B 4YSYB 1IKMA 2NN6I 1CQFA 5FOBB 1FFUA 3OHXC 5C0XH 3WDNA 3E6ZX 1N62A 4XWTA 1IBXB 3ONAB 4MT5A 4RHSA 4IFDJ 4JBWA 1HXYD 5T1IA 3AEAB 4YWGG 3P4SB 1EZ6A 2FMCA 2WXQA 1PTOF 1YNJD 2WP9B 5H8YE 1VR9A 3G7LA 5BN5A 1VZ8A 3I4NB 2F0WA 2N88A 3SFEB 3A8JE 2N9LA 2F0OA 1PFMA 4FYDA 1E6EB 2F0TA 4XDCA 4ODGA 1XLQA 3AN1A 1OFFA 2BT6A 5AUKA 2GB1A 2LKVA 2WINB 1TKGA 3CQZB 3VRAB 2V3PA 1CTMA 2BDNA 2KCCA 2XSCA 1KDAA 2JA6B 4OO1I 3NTIA 3A8IE 1HHVA 2E2HB 5CBAE 1RM6C 3BDLA 1EIHA 5ELEA 1K8OA 4A6QA 1SEBD 1HTLD 4A55A 1SNDA 2EYFA 3QOJA 1DOMA 4XXEA 5BN4A 5GXGB 1E2WA 2NB0A 3GTOB 3M4YA 1AZPA 3H09A 4ZK9B 2F0FA 5EBDA 1G6ZA 2FINB 3A55A 2M0AA 3IAM1 4OO1H 2J42A 2K5WA 3T16A 1NYQA 3JAML 1CHPD 1DOXA 5IGBA 3TBIB 2PO4A 2M2LA 4DXFA 2PCFB 3D31A 5CGKA 4LJZC 1LO5D 5CMDA 1LTID 1CZWA 5BYSA 5MPOA 1G8ZD 1RODA 1A2UA 5HG2A 2E2IB 2NWGA 2Q8RE 3K6OA 3VYUA 3U2SC 4ZAIA 3DXJC 1JALA 1PTOD 4CJ2C 4ZOHC 4K5VA 4RGTA 5E4WC 1WGKA 1T5XD 3EJIA 3BWUD 1C4PA 2F0UA 4JX1C 1L5PA 4DK0A 4HAEA 1ONLA 3KF8A 5ELDA 3AM9A 5D3DA 3FKIB 2KQ4X 3QOLA 1Y69U 2DY7A 3AEEB 1Z6HA 2DWQA 2I2YA 2E3TA 4HKQA 3X3MA 1PRTB 1XTCD 2RDGA 4WH4A 2K05A 1G2TA 1ILPA 3UI3A 2F0LA 2F0SA 1L6UA 1VF5C 2WKDA 2KJXA 4MHEA 3NRZA 3J81L 5LL6S 2JA8B 2D2CC 1GHJA 1A2TA 1HA6A 1C8CA 1JWBD 4O1NA 5D7GA 1LTGD 4TQ1A 1LTBD 1CHQD 3HKZB 1TY2A 5JVG3 2V4IB 1L0XB 2I38A 1W6JA 2NVQB 1DZ1A 1FIQA 4A3GB 3S16B 1B50A 2QDBA 3Q22A 1ZDVA 2WXGA 4KJOA 3I73A 4RGMA 2WACA 4QUCA 4A3JB 1K53A 5TSSA 4IUUA 4N6EB 2RSNA 4HKZE 4PMCA 2PW7A 2HUGA 1WVLA 1SYBA 1UNSA 2ID0A 4DAYA 1STNA 2EY2A 1PFDA 2QIEB 2WXNA 2YYZA 2NVTB 1ZUD2 1Q3LA 3OIQA 5EPLA 3PIO3 1MVKA 3Q69A 3OWEB 2RVLA 3NVYA 1QNUA 4J1MA 2MP1A 2KCNA 3AEBB 1JCKB 2EDGA 1ILQA 3GTQB 1XF5L 2ZW0A 2A73B 3GTJB 3HVZA 4OHJA 4LMQD 3JAME 1STHA 3RUZA 2G9HD 2OT2A 2CW0D 1O7LA 3RLFA 2SNMA 3W5UB 2VNUD 3SDZA 1XLPA 1O7ZA 3AECB 5H92C 1YNNC 3D6WA 1WWTA 3SK5A 4C80A 2IJ0A 1LT6D 2ZXPA 3KUPA 1EYAA 3BG3A 1II3A 5C3XA 4YT0B 3TN2A 4YTPB 1NAPA 2CHBD 5DEHA 4K6DA 1TY0A 1S5FD 3MWYW 4ARCA 4WAFA 1PGBA 1RCVD 2DY8A 3CRLC 3KLSA 4KD3A 1Y56A 4A3FB 1WTXA 2L4NA 1QJOA 1BXTA 3OMGA 3TSSA 1H9SA 3NZ3A 4WIPA 5BMHA 2K5PA 2OHFA 1A3VA 3HS0C 2CQAA 3ITPA 1SIJA 1YQ4B 3GV6A 4MM3B 1LTAD 1VRAB 1GUTA 1JQ4A 1JW9D 2JXTA 4IUTA 1TVXA 3VYRA 5KNBA 3SVMA 4RGNA 1PFNA 1F9QA 1VF7A 1HZ5A 1OO9B 5ELCA 4JE3B 3QWNA 1OXXK 2WNMA 5EQ0A 4JWSC 4PQXA 5FK9C 5C4JB 3J81E 5I9PA 3N52A 1K51A 1FM0D 3HVDA 3KBXA 4S3SA 2Z8LA 3CU7A 1WSPA 3Q23A 3CIRB 3LNNA 1H9KA 2KACA 2O4XA 5EE3A 3NQTA 3QJYA 1FNVA 5CV6A 4DN4M 4M8AA 4EE2A 3E56A 5ISRA 3AE4B 4LK1C 4WFN3 1LTSD 3VR2A 5E4XA 1CJEA 1SMYD 4KN7C 3SE0A 4YXDB 3F2UA 2TMPA 1UWMA 1XCTL 4N9PA 3GP7A 1SE4A 4DK1A 2N7JA 2NVYB 3MVVA 4BY7B 2B2VC 5FO7B 4KKJA 3S14B 4HCEA 2FBWB 3TEZA 2WQYB 3NS1A 3AE6B 3E0JA 2A6HC 3O13A 3GS2A 1IHZA 2Y5PA 2B2VA 1FXIA 2WXMA 4US9A 5JXVA 2MJ8A 5HHDG 2PLPA 3OOCA 1STEA 2DNCA 2EJGC 4KGTA 1ET9A 1NVID 5I9OA 1KF6B 1ZP0B 3BYTB 3P20A 1QOGA 4EGVA 2NVXB 2KVMA 1BMLC 5C6AA 3IFTA 5C3JB 3DEPA 1SNPA 3IXSA 4KK7A 1JWMD 1NCVA 4DQOC 3KQ4A 3LB8C 3TDQA 5JEAG 1WTVA 3PUYA 2Q8TA 5I2XA 1ZOYB 1NI3A 1E9MA 2KAJA 2EVBA 1MI2A 1QG7A 3W5VB 2L0CA 1KRHA 1IUEA 4DXGA 2E2DC 4RAUC 1D5MC 5FO8B 4RNAA 4KN4C 1EY6A 4C2MB 4ABNA 3OMCA 2C5CA 3I9V1 1SE2A 4X3UA 1O7YA 1ZEQX 1EY5A 1D1KA 1F9RA 1ZXIA 4FF3A 2WS3B 2WU5B 4PT5A 3D4WA 3CWIA 1I6VC 4L23A 1FD6A 2W55A 1HZ6A 2MUYA 4IFDI 1Q10A 2H1EA 4DAVA 4IUPA 1BCPF 2K03A 4KJNA 4C3IG 5D65A 1WTQA 3VA5A 3ND8A 4TMAB 2EJFC 2IDYA 1H9SB 2EYMA 2INNE 1K8MA 3PUWA 4K8IA 3T3NA 2H88B 2JA7B 5HGTA 2INPE 1N63A 1FGBD 2YU9B 3N6RA 1SYEA 1I4GA 4XDDA 1EIGA 3N9YC 2IGHA 4IFDH 1SJHD 3G6JB 3NE5B 1EYCA 2VXWA 3GQBA 2K6AA 3D6CA 3D4RA 2BE5D 2WAQB 3E5SA 2DN8A 1F2RI 1UWXA 2JX5A 3J80L 4A9AA 3W9CB 1BOSA 3AEGB 3HZXA 4CKEA 4EVOA 4A93B 1C76A 3AE8B 5I6WA 2E76C 1XCQL 3NUCA 4U673 1G91A 3GB1A 3QIAA 2HDEA 5FR3A 2WDVB 3T53B 2NBFA 1ZKOA 1AW7A 3ZQ4A 1B53A 2EELA 1HEZE 3KBGA 1TKEA 2BCOA 1FO4A 5JPNC 5M5WB 3QO2A 2GRIA 1D5XC 2XWJB 4KY6A 5EE1A 5BYQA 1QF6A 4OVZA 3J7AV 1TIID 5ELBA 3W3AA 3HOUB 3DWQA 3S17B 1CM9A 5G5HA 5IGFA 1FD7D 4H7BA 1FMAD 5C5MA 2BW2A 4ZKBB 1WTWA 2PMZB 3NPPA 3MHBA 2F3VA 2BB5A 1BCPD 3HOXB 2FE8A 3BYYB 3SR1A 2PZUA 3P1HA 4HCSA 5K36G 4A90A 3A8KE 4MIUA 1YN5A 4ME5A 5M5XB 2F3WA 3TUOA 4BWGB 1Z7TA 2F4IA 4NDXA 1J8IA 4FF4A 4NKLA 2OEDA 4US8A 3DWPA 2EOTA 3EVQA 1EFID 1QOFA 1TS5A 2MHVA 4DF7A 2EYJA 2WDRB 2EJMA 5A35A 2LJIA 4RGOS 3MEHA 1DOLA 3NBHA 1TWFB 2WLBA 2K1BA 1NUCA 2A69D 4FXDA 2KOLA 2WXPA 4ZUJA 3KLSX 1U4RA 2L52A 2WB1B 2Y3AA 3SR6A 1KLGD 3ZJTA 1VMPA 2A5HA 1GJXA 3QG1A 1KABA 1RF2D 1YN3A 1LT5D 3T56B 1V8QA 4HRSA 1SE3A 4XWWA 4G4KA 2A68D 4ID6A 5M9OA 5D3IB 1EY9A 1TWHB 4K8JA 1ENFA 3IAYA 4TQ0A 3OSOA 1ENCA 2B2YC 1GUOA 3RFZB 1DYQA 4CQNA 3P75A 3H91A 4K5WA 1TQOA 1ROEA 3J80E 1Y8NB 3IAS1 3MC0B 4CHTB 1KNAA 1LABA 4EQPA 4N58A 2B2YA 3LX0A 3VYSA 1NR4A 3S15B 1QT9A 2BS2B 3ZJUA 4MN3A 2RDFA 3HGBA 1ESFA 4C56C 3IFDA 1SNQA 4NMZA 1U4LA 1RJTA 5IGEA 4FO2A 3K7AB 4G57A 2PW5A 1NYRA 3H6MA 2XN9C 2IGGA 3FPPA 5G5GA 3Q8AA 2C9OA 4KY5A 4J6HA 2E75C 2JSVX 3EA6A 4M0WA 4P16A 1STYA 3M3YB 1RYJA 4KKUA 1QOHA 1PYWD 1WTPA 4FVMA 1BNZA 2AQ2B 1F2YA 1Y8OB 2AUJD 4KKTA 4OGQC 1YNND 3L7ZC 1TKWB 2EKIA 3PMFA 2Y0SB 2KMMA 1KFYB 1I4RA 3C2PA 2LY7A 3NTKA 2VB3X 5JJZA 5G3LF 1YJIA 4HMJA 3BIID 3OIPA 3H3VC 1BQQT 4C7ZA 4B9XA 1SFOB 1CT1D 2HQEA 4PMBA 1TS4A 4KY7A 3K0YA 2L11A 5EKLA 1Q12A 1M8AA 2BA0A 3AMZA 4J3OD 1R7SA 1F77A 1U4MA 1N5WA 1C9FA 2E74C 4OZCA 1D6EC 3C3LA 3DM1A 4I7ZC 5M3FB 1ML0D 3SEBA 4JPSA 3EQLC 2PVOD 4QIWB 2F0DA 2DNEA 2QF7A 1ZYRD 4RWSC 3AEDB 3PIP3 3Q8CA 4OL7A 2K3UA 1I3QB 2B63B 4NAMA 4C7YA 4KMUC 1MSGA 1KAAA 2K33A 2F0NA 3HUIA 5EKKA 2NUCA 1YNJC 1HCZA 3TEWA 2O5JC 3KWLA 2WDQB 3FVQA 5KIXA 3H0GB 1PZKD 1Q8IA 5LHY1 4BS9A 2Y5CA 4AQ7A 2K7VA 4V0BA 1JE4A 2V3NA 3M7NA 1X32A 4HSVA 3IL8A 4U68A 4DGZA 5I2YA 5K36H 2BOSA 1UGJA 2IL8A 2EZVA 3GTKB 4C3HG 2K28A 1GHKA 3A7AB 3L4PA 2DBYA 4YSXB 1TU2B 1O80A 3FILA 1SB3C 5EE0A 4ITKA 3H94A 3I4LA 3LYYA 5G3LD 3I72A 4KKIA 2LFNA 2MPMA 3AB9A 4QMGA 1JWAD 5JOBA 4FP5D 1J9OA 1TWGB 1A70A 3TEXA 3Q24A 2IGDA 1FEHA 1IW7D 1ZE3D 4CKBA 3VR8B 2LGIA 3KK7A 3Q0AA 1BO0A 1ZXHA 1BUVT 1KH0A 3VR4A 2XRQD 4TKOB 4IN3A 1I4QA 1LT3D 5C4HA 4ZRQA 2GA4B 2ZXRA 1P7EA 1SNOA 3IT4B 3I70A 2Q5WD 1PXUA 4KD4A 4ZHPA 4HN7A 4ZQ3A 3I57A 4LLGM 2JZPA 1T6BX 1FFVA 1PTOC 1N60A 1QQRA 2R92B 2EXZA 3WCQA 2B2TC 5EE9A 2FMMA 1PDQA 2ENBA 3ZYYX 2KN4A 3BZDB 1RD9D 5JPMC 5FO9B 1ACCA 4XQJA 1YJJA 2LHDA 4KGSA 2B2TA 4KKSA 3GO5A 2BS4B 3GD7A 1F2ZA 1P7FA 5HURA 3DWGC 2PW9A 1PRTF 5D14A 1SSOA 2JYOA 1GUWA 3FAHA 1QB5D 5KYIA 3ETRA 4C3IB 3LWUA 1JB3A 2AUKA 2ICIA 5EGTA 3TZDA 1EWYC 1B9NA 1XLOA 1TT2A 3S2DB 3MAQA 1YNTE 2WXLA 1C4QA 1Q1EA 5KYLA 3AE2B 2G1EA 3C8YA 1K52A 3OW7A 2F0HA 3NP8A 3K59A 1C77A 4C1NI 3CKIB 3S1RB 3FDTA 1SBBB 1TYGB 5CV5A 1XO3A 4H0LC 1TZOA 3P1MA 2L1BA 4ZLTF 1PGXA 2VB2X 1GAQB 3GTGB 3A54A 1QOBA 2EYHA 4B0MA 3AB5A 3I91A 1E0BA 4PV1C 1DONA 2R93B 1V43A 1C48A 2PPBC 2PTLA 3OPOA 4LK0M 1H9MA 4GLSC 1UUPA 3TP6A 3HOZB 1TWAB 2K9XA 3FMCA 3AMUA 3PUZA 2SOBA 1U4PA 3NBIA 4ZKCB 2RKSA 4FF2A 3HRDD 4L6TB 1JOKA 3J9CA 1LTTD 2SDFA 3DHQA 5C0XG 2IX0A 5BN3A 4XDXA 4Y7NB 4R9WA 4KGRA 1A3UA 1Z47A 2OF1A 3VYTA 1CA5A 3NK9A 1J7BA 4RA8A 1D2BA 1YMHE 4QB4A 4C3JB 2SNSA 2QMTA 4HSPA 4RKLA 2CW0C 1FNUA 2JA5B 2F0MA 1WCMB 1QILA 3FILB 2Z4IA 3MXNA 1SNMA 1JWUD 4CJ0B 1PRTD 4USAA 1D5ZC 1EYDA 4LTUA 1NSNS 1EU4A 3MFGA 2NN6G 2PMVA 2FUG1 2DYMA 1STAA 2L83A 2W3SA 2A6ED 3PO2B 4Z9CB 4DNTB 4IALA 4BBRB 5F2DA 5CV4A 2WIIB 4IDIA 1SYDA 5AFWA 4A8XC 3NWSA 3PUVA 4M1UB 1QKZA 3GV3A 1AZQA 4YTNB 2LS01 4L1BA 1FCLA 1PDXA 3AE1B 1HQMC 2ONQA 4RCOA 4A3DB 4N59A 2NTSA 1NENB 2RDHA 3GTPB 3EGRA 2YEPB 4P6VF 1DD2A 1EEID 4L8JA 3NSWA 1FRRA 4ULLA 4Q5VA 4ILWA 1E0ZA 1DGJA 5J22A 2ZXOA 4OO1G 1B44D 4RH6A 1B9RA 3HP3A 1JRPA 2G9DA 3NVWA 1D4BA 5C3EB 1B2TA 2RSOA 1AP0A 5C4XB 3FRPB 1TWCB 1PTOB 1C4CA 4L63B 2OEOA 3U4EG 3D4DA 2JQRB 5EBCA 1WXQA 4RKBA 3VA7A 1AFPA 1HUNA 2ZW1A 1PFBA 3PO3B 1FRDA 2HCCA 1SMYC 2F0JA 3FPUB 2F1MA 5KGUA 1V1PA 4OW0A 2B8GA 1FXAA 4RHRA 2MJEA 5CYUA 2QILA 1M4VA 1CZPA 1PGAA 3GTLB 2ON8A 4G7OC 3NUHB 2BTEA 1G2SA 5AUIA 2IW3A 2NMQA 1CK1A 3P63A 2HDLA 1MSHA 1AEXA 3ZGZA 3V96A 3M4OB 4FXGC 5BMIA 2WXHA 3PZ7A 1F0ZA 3P4RB 5CV7A 1F2MA 3V05A 2CJNA 1OQQA 2EPBA 3I8ZA 4RF1A 5KRUA 3S1MB 3K5LA 4UAIA 1BR9A 4K2LA 3C46A 2JYEA 2WU2B 4A3IB 4FXCA 4BA2I 2VZKB 4IUVA 2D62A 4EQOA 4OIKA 2RPVA 1L4DB 3L3OC 1EY4A 1IGCA 3B2GA 2B2UC 1XYIA 3T51B 3CRKC 4FF1A 2K0PA 3VRBB 2PQEA 1B9MA 2EY6A 2JEBI 3WOFA 1XX8A 4OIJA 1BUIC 1QCBD 1GPXA 2B2UA 4IUQA 1VZ6A 4AYBB 1WD1A 3IT6B 3HEJA 3PO0A 1WD0A 1MD2D 1KDCA 3V2TA 3UI2A 1OXTA 4ARIA 1F9PA 4NJCA 3DUZA 4F87A 5DNFA 4QUFA 1I6HB 1DOIA 1AWDA 2E6XA 3BVMA 4WQMA 4MH8A 3SXHA 2BS3B 1JQYD 3TP5A 2YEPF 2B2WC 3D8GA 2CU3A 4CBVA 1ESRA 2L55A 4NZLB 4X3KA 2I46A 2JWUA 3S1QB 1EQVA 3SFDB 2PZTA 2XWBB 1IL8A 5FLXL 1CQVA 2XVSA 3Q8FA 1DXMA 2EYPA 2D9UA 1IKLA 2B2WA 3S9WA 1IYUA 5IOCA 3HOWB 1SF0A 4GZYC 3I4MB 2WXRA 3W2DA 1I50B 3U9OA 3A56A 2WXFA 4ZRZA 5JEAH 3HRZC 2BE5C 3B2FA 5BMGA 4IZ8A 2F0KA 3ZJVA 1EM7A 1X3PA 1IYVA 3RZDB 5IGGA 1VJKA 1BF4A 2NN6H 1ZPSA 1JOOA 2KWDA 4R8IA 1RHPA 2D5GA 4RCNA 1KDBA 4GDLB 3MXUA 2H4OA 1PUTA 3BK2A 2W54A 1STGA 4WJWA 1DJRD 1HPCA 1WYGA 2F0VA 2QSDA 4C3HB 4LAAA 1TS2A 4F88A 2NYZD 1A15A 5DM63 2QCPX 2WXIA 4CGYB 5LL6X 4A3BB 1RTOA 2NZ1D 4BY1B 1X3QA 5COYA 2F0PA 2CVRA 1AN8A 1V1PB 5DAUA 4JWUC 4GDKB 2B8FA 1EWCA 2Z4HA 4WURA 2WV6D 2IT1A 1RTNA 5EJWA 4F8MA 1HQRD 1Y1WB 3I90A 4DU9A 1HFNA 3M7GA 4ZUIA 1D1IA 2W3RA 2ACZB 5BYRA 1FR3A 3LWEA 1BCPC 1R4QB 3J7YW 1I4XA 3BDOA 3I3CA 1SYFA 4OZAA 2FHTA 1OQRA 1PMRA 1B3AA 2LMCA 3HG9A 1HUMA 3NTHA 2KECA 3HOYB 1SXTA 4IOIE 1G291 2L5TA 2JP1A 2XIWA 1WTRA 2LUMA 3DWMA 1RFKA 1NR2A 2QEJC 1IGDA 1HA5A 2WXJA 4WWMA 2SAKA 4G7ZC 5EPJA 2D5DA 3Q6SA 3TEYA 3K5MA 2IX1A 2EYLA 3MJ5A 4NAWB 1E7PB 3NVZA 2PYKA 2AQ1B 3ERQA 3P42A 3OWFA 2KA7A 4RF0A 4IKGA 1DOYA 3KLRA 1MHXA 2RA4A 3VQIA 4TQUS 2BB6A 1FYCA 3AE9B 4RFBA 2J7ZA 2XRSD 1LT4D 2A69C 4K14A 2R6GA 2DYOA 1KLUD 2M9VA 1VDVA 1GUGA 2LFIA 2I07B 1EEFD 4NP5A 1J7CA 2MH7A 3ND9A 5T8IA 5C0XJ 4G7HC 4MACA 2R3ZA 2WP8J 4PNYA 5FLXE 2GI9A 4XT3B 1PZID 2Q8IB 4AS1A 3EUB2 5I4DA 3DWAA 3R8BA 5DM73 5JEAJ 3LXFA 2LHEA 2A68C 2BYTA 1JORA 1C4AA 3NQIA 3U7ZA 1UEAB 4CJ1B 4HEA1 1ET6A 1MI0A 3CHBD 3U9SA 2A74C 1GB1A 2R7ZB 4R3DA 1I7HA 1YN4A 3SHLA 1EL0A 1GUSA 2J0TD 3S2HB 1FCCC 3QB3A 1XWEA 1XEEA 1JICA 1ENAA 1VCIA 1B1ZA 2VZKD 4ZHOA 1J7AA 4P2CB 3E9SA 5EPKA 1S4ZA 1EY0A 4Q0FA 5I6YA 3NHHA 3T13A 4H2AA 1V1OA 3HOVB 2EYOA 2F0GA 3FEWX 4OZBA 2V4DA 5JAVA 3Q8BA 4UDUC 2A6HD 1ZDXA 2KHSA 2MJ3A 5IT9L 3J7AF 2TSSA 1JR0D 1PZJD 1I4HA 5C4ZA 4XE0A 3K5OA 1VDZA 3A7LA 2W82A 2Z1CA 1EU3A 2PVGC 4XIGS 5IIFA 1ICWA 4IURA 2LEKA 4XQQA 1S5DD 3K58A 1EOTA 1V97A 3PUXA 1GXDC 2B76B 2EY5A 3AU7A 5M3MB 1LACA 4IFDG 4NW2A 3AEFB 1GUNA 1OXUA 3TZUA 2EY1A 1PTOH 1T3QA 1BBXC 4O42A 3IKJA 1U9RA 4DNRB 4A3KB 2K22A 2HCIA 4A3MB 2PNRC 1A3TA 1TR5A 2JSOA 4WRDA 1TKYA 2MJDA 4HEDA 1YQ3B 2F03A 1JWSD 4FNFA 1OXSC 2M56B 2RQXA 1Y8PB 4KTAA 3V3XA 2J4XA 1GB4A 5CC4A 4QF4A 1JMLA 3TP7A 2LMCB 2F0EA 4TSSA 3M85A 3MXPA 1XXGA 3T3OA 1BCPB 1Q90A 4FXKC 3C1EA 4IUNA 3SK6A 2L12A 2JYTA 2FJ2A 1S5BD 5C44B 3AV8A 1H9JA 1EQTA 3T4AC 1N61A 4A3EB 1ZYRC 3R2IA 4D2KA 1KTKA 1ZXTA 5JVH3 4X3TA 3RPFC 4YTMB 3MA2B 1FNWA 2K5DA 1PLFA 4L2YA 1DOKA 2BA1A 2IX3A 5IGCA 2L32A 1F9SA 3MTSA 3VR6A 2PKOA 5EKIA 4K2KA 1SSNA 1MBYA 3R3OA 3TMEA 1WTOA 2R61A 1HRJA 4HR7B 3P7JA 3NWTA 5CV9A 3MHZA 3RMHA 1DCZA 3MZ5A 2X38A 1CZGA 2K04A 2AX5A 1RWSA 5HFYA 2BDOA 1I4PA 3MFYA 1JOQA 5LNK1 1SDFA 5IT9E 1RDPD 2RBMA 1QNKA 4IQZA 4DA2A 1TJEA 2HDMA 4KV6A 2WXKA 1A6XA 5KEEA 2N0SB 2ZT9C 5A2QL 5E6JA 4K5XA 1TS3A 1SJED 2O2LD 4CKCA 4KX6B 2K32A 1CI3M 2QKIC 4B9WA 4Q2JA 3BK1A 2J53A 1IW7C 1O78A 1STBA 1GOZA 4C1NK 4ZYSA 1B4OA 1E10A 2JU6X 2X6GA 3BVZA 1KNEA 2OXPA 1CFMA 1CA6A 4TRDA 3BVGA 1T5EA 5CBEE 1XLNA 4I65A 4KI0A 5T1GA 2AQ3B 2H89B 2X6LA 3RZOB 2JE6I 2AWNA 3BS1A 3KWVA 3PZ8A 3W1SA 2V0GA 2EE1A 4XYOA 1BDOA 1AYFA 5C5LA 1H9RA 1SNCA 2O5IC 3TP8A 2M00A 1SYGA 2MGSA 2F0IA 1HTPA 1LTRD 1OXVA 1N5XA 1EY7A 1IBXA 3NVVA 1L6VA 4BA1I 4XTCS 4JK1C 1VZ7A 2J52A 1EZ8A 2IWHA 4X3SA 3NXWA 2L1AA 1C79A 2BBCA 4HROA 3EROA 2XNAC 2RMMA 3S1NB 2KDMA 1LLRD 4HMIA 5E3FA 1R9TB 3H8HA 2KEEA 3D3RA 5IODA 5KNCA 4EQNA 1E2VA 2JEAI 4B0EA 1UAPA 1W6KA 1QE6A 3BDCA 5NUCA 3R93A 4XYQA 1DM0B 4KHVA