1ET9A

Crystal structure of the superantigen spe-h from streptococcus pyogenes
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
195
Chain Sequence
NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKNLSVFFEKDWISQEFKDKEVDIYALSAQERYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPERANTIGEN SPE-H
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 56
structure length 195
sequence length 204
ec nomenclature
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1et9A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1et9A01
1SE2A 2IPKD 1B1ZA 1ENFA 1S5BD 1PZID 4Z9CB 1PTOH 2G9HD 3BYYB 1L0XB 1FGBD 5FKAC 1EEID 1EU4A 3EA6A 4O1NA 1I4XA 1ET6A 2AQ1B 1DJRD 1I4PA 3R8BA 1XXGA 1AN8A 3O13A 1YN4A 1TS3A 2CHBD 4OHJA 1EFID 2XRSD 1PYWD 3DWPA 1EU3A 1LT6D 1SBBB 1LTGD 4RHSA 3BYTB 1FNWA 1L0YB 1RD9D 1CQVA 4K6LA 3BVGA 4RCOA 1QILA 1PTOD 1SJED 1DYQA 4C56C 3DWAA 2AQ2B 4RH6A 1JCKB 4NZLB 1MD2D 1TS2A 1SJHD 1JWUD 1LTSD 1CHQD 1FD7D 1SE3A 1V1PB 1EEFD 3CHBD 1STEA 3EFXD 3SEBA 4DXFA 4L63B 2NTTA 1PZKD 1SE4A 1I4HA 1M4VA 1HA5A 2XRQD 1PRTD 1CT1D 3MC0B 4ZYSA 1UUPA 4RGTA 1BXTA 1D5ZC 1TS5A 1D6EC 3KLSX 4RGOS 3OWEB 2ICIA 2IJ0A 2RDHA 1D5MC 4RGNA 1D5XC 5ELCA 1PZJD 1PTOC 5ELBA 3R2IA 2AQ3B 2XN9C 1S5ED 1CHPD 3URYA 1RCVD 4RHRA 1PTOB 5TSSA 1KLGD 3V05A 1FNUA 1BCPD 1T5XD 1BCPC 1F77A 5ELDA 1TS4A 2NTSA 5ELFA 1ET9A 2O2LD 1B44D 1UNSA 1LTID 1LTRD 2QILA 1I4QA 3TSSA 5FK9C 1JQYD 1V1OA 1JWSD 2SEBD 4L6TB 5ELEA 1BCPB 5I4DA 1XTCD 1PTOF 4RFBA 1S5CD 4RGMA 5D3DA 1PRTC 4TSSA 2RDGA 1LT5D 2TSSA 1HTLD 1KLUD 1V1PA 2QEJC 1I4RA 5D3IB 1SXTA 1LO5D 1YN3A 1PRTB 3BZDB 1BCPF 3R2TA 1KTKA 2J4XA 1TY2A 1TY0A 4DXGA 1GOZA 1RDPD 2R61A 1HQRD 3DWQA 1CK1A 1G8ZD 1ESFA 1LT3D 1PRTF 1HXYD 1FNVA 1EWCA 4UDUC 4BWGB 3W2DA 1LTAD 1LLRD 3GP7A 1LT4D 1S5FD 1JWMD 1JR0D 3MFGA 1S5DD 1RF2D 1SEBD 2Z8LA 1LTBD 3BVMA 2XNAC 2WV6D 1YN5A 3BVZA 1I4GA 1AW7A 1LTTD
chains in the Genus database with same CATH superfamily
3SR1A 1EZ6A 4KKIA 2B3AA 4CJ2C 2A6HD 2KMMA 2I1JA 4GOPB 3GTLB 3BWUD 1WOCA 4GXBA 4IKGA 1SNCA 4QB4A 3U7DA 3WAOA 4JYAQ 2KX3A 1DOXA 5I9PA 1B53A 2NZHA 1E9MA 2UUAQ 1FGBD 3GTQH 2I46A 2WINB 3AEVA 3EA6A 2FXQA 1MG8A 3KYDD 1HZBA 2WDVB 4B95A 1JALA 2WXGA 1WXSA 2JP1A 3CCUA 1JB7A 2MJDA 5A2QL 3EGRA 2IX0A 2VXWA 4FDBA 3U50C 4EQOA 2H4OA 1QT9A 1HNWL 2LXAA 3DM1A 4F1SA 2JZ3B 3KUCB 3SFEB 2VUMB 5IY0A 1Q8KA 4A76A 1WZ3A 4YSZB 1GJXA 5IO9A 2WXRA 2V1YA 4GDLA 2ZXPA 4GKJL 4NJ6A 2LY7A 3D6CA 3PREA 4FULA 4BBRH 5KNBA 2V3SA 1FFVA 3CMMB 4B3SL 2JA7G 2Z59B 2KMCA 2AQ2B 4HCNB 5G3LD 1CA6A 4K8JA 2RSNA 3I72A 4DV2L 2CWPA 2QGQA 2KBNA 2E3TA 1LTSD 4BKTA 2ZTCA 3SDZA 3GQBA 4GNXC 3I4NH 4A93H 3JYUA 4MN3A 3AEEB 1HR0W 3P4SB 2VH1A 3KF6A 5AJ3L 2KD0A 2BPSA 2BS2B 3BDOA 3CW2C 3PZ8A 1STNA 2EZVA 4DN4M 3M3YH 5IP9G 4JYAL 2KYWA 1SFOH 1NY4A 4RGTA 1IPGA 2E6XA 4RMAA 2UUAL 3IG3A 1ZXTA 2BA0A 3AV8A 3I3TB 2INNE 2IJ0A 2YU9H 3IFDA 3PQIA 3AFPA 5M5XB 2D3BA 2NVUI 5ELBA 3QR8A 4X57B 2B2YC 2MFIA 3NXWA 4I7AA 1TWFB 2FFKB 5E1FA 1HR0Q 2FAZA 4RMFA 4DR6Q 3W1SA 3ZNGC 4K2KA 2KTFA 1O7IA 3FC4A 2I07B 2FUHB 5E6NA 5JJKA 2QILA 1B44D 2AUKA 4AP4C 5LNK1 1I4QA 2KECA 4LJOB 1U4MA 1RTOA 4A4IA 1NJIC 1AWDA 4A3MH 1KDBA 1Q0WB 1ROEA 2PMZB 2NR2A 3OJ3A 3CMEA 4BFRA 1F9PA 3ONAB 2LMCA 3KJPA 4LJPB 2EYFA 3DBSA 2VQEQ 2OWOA 2EY5A 1HTLD 1TWAH 1FXTB 3HGBA 3VH3B 3B0AA 3OLMD 2MJ3A 4R4TA 5M3MB 2JA5G 1WH3A 2BYFA 2UU7A 1GUTA 1QG7A 1PRTB 4ME3A 4OVZA 2F0PA 3QOLA 1RHPA 2ZJDA 1VLBA 1L5PA 3R7RA 1QJOA 4E6IA 1Y69U 2OHFA 1WCMB 4A3CH 2ON8A 2L5TA 1QKZA 1KLVA 2V3PA 1CSQA 1KL9A 3K9PB 2MBQA 3GE3C 4NJCA 1YNXA 4BBNC 1N63A 2WAQG 3TZUA 1HR0L 1B2TA 2K0PA 4DR6L 1WTOA 2AX5A 2XNAC 2WV6D 4ME5A 4N58A 3VXWA 2NVYH 2HE7A 2L83A 4HWIB 5C23A 3SVMA 1KHIA 5JPNC 5J3BA 4A3BH 1G6ZA 3ETRA 2A1AA 1ZDXA 2OOBB 3NG0A 2BKRB 4BKSD 5BMIA 4R1JA 1RWSA 3GV6A 3HOWB 2INPE 4O1NA 3BG3A 1X3FA 1MSHA 4PG3A 3K5OA 2F0UA 2DZIA 2D9UA 2F0MA 2K1BA 2VQEL 2MP2A 4F8CB 3TEWA 4S0RA 2FUG1 3D6WA 2MW5A 3ML9A 3WAMA 3DHGC 4DHZE 3S1MH 1DZ1A 3S2AA 5K5PA 2EXDA 1PH7A 3S1QH 4G7OC 1IYUA 2ZTEA 2NBUA 4MGZE 4XT3B 1WGKA 5IIFA 2F0QA 5HY6A 3G6JB 4OO1G 2BB5A 2JT4B 1YNTE 3FKIB 2I38A 1A15A 2BQQA 2BS4B 2FINB 3PRMB 1TS2A 3DCGA 4A20A 1LGRA 2RD0A 1SE3A 1EM7A 3CCRA 1BQQT 1YQ3B 2KDEB 5AUIA 1TVXA 4FJZA 2K75A 4O42A 3TP5A 3NTHA 4DK6C 1AH9A 4GLSC 4WIPA 3UIOB 1C48A 1DM0B 3UQBA 1TKWB 1ICFB 2SNSA 3BJUA 1WTVA 4YT0B 4DR2Q 1FEHA 3VRBB 4W9IA 2CQOA 4XQQA 1B4OA 4HDOA 2PPHA 2EELA 4R3DA 2RF4A 1MBYA 1PFBA 2L32A 1NR2A 2O5JC 3HOXH 1D5MC 2JQOA 1Q1EA 1JICA 5ELCA 2DAJA 4IUTA 1JJ2A 1XTDA 4JX1C 5K36H 1FIQA 3BK2A 1UD7A 5GAHC 5IYCG 1L4DB 3HKSA 3M3JA 1FNUA 5J22A 1BCPD 4O2DA 3LX0A 1Q46A 2JXXA 3AU4A 3PS6A 5D94A 1V5TA 3TBIB 3H7PB 2CHXA 1U9RA 1W6KA 3CP0A 3DHHC 2VZKD 1SNPA 1BCPB 5IP4D 2AKWB 3QAQA 3O65B 5CYUA 1MI0A 3AEFB 1J5EL 1S5CD 4LMQD 1OQQA 1AP0A 2RDGA 3KF8B 4JOIA 3J81L 3Q23A 1KLUD 4DAMA 2VZKB 2LVQA 2F3WA 3AM9A 3RPFC 2FMCA 4EQ5A 1C1YB 1WGRA 1I3QH 1IXRA 3I8ZA 1SMYD 4M8AA 3RNUA 3H3VC 4X6AH 4K1RB 3HKZG 4R8NA 3RD4A 1UGMA 1OQRA 1PVOA 3I63C 2K6DB 1L6UA 3JSVB 4FJYA 4FYDA 1NBFC 3KYCD 4A3OA 5L37A 4FO2A 3KOJA 4KY5A 1C7YA 4M00A 4KKJA 4DR2L 3WANA 4BY1G 1WI0A 1OXUA 1K0SA 4S3SA 4BWGB 5JVG3 4U68A 3SDLC 2WLBA 3U7ZA 2B39A 1B9MA 4KLKA 1HQMC 2MHVA 3MFGA 2IY5B 4MJSA 3VYUA 2MBHA 2L0FA 2WB1E 1CA5A 2WP9B 4N9TA 1LTBD 1V9PA 1JT8A 1YHBA 5M5XH 1VQMA 1XLOA 3KLSX 3CU7A 2ZCBA 1CTMA 2Q2UA 1SE2A 3Q8DA 4L5TA 2MRPA 1ENFA 3KW5B 4M01A 3OIPA 1TWGB 2JA7H 1UE1A 4EZLA 1G6JA 4MEMA 3GO5A 3TP6A 1D7QA 5C5MA 4JG2A 3MJ5A 2KHIA 3JAML 1NI3A 3ZKJC 3SK5A 2EVBA 3O13A 3STBD 1TXYA 1PGAA 2LKVA 1E7PB 4A6QA 4ACFA 3TDQA 2PMVA 4BY7G 1EFID 4HCPB 1IBXB 3A4SC 1U4AA 2GB1A 3CPWA 3KDFA 1EU3A 1QOFA 3HG9A 2I5MX 5M3MH 5HI1A 4ZLTF 2FBWB 2C7NB 3NZ3A 1PH2A 3T3OA 1SROA 3BVGA 2ZT9C 3A55A 1AFPA 5CTRC 3I4OA 3RUZA 5IYDG 1X1MA 2O6VA 2FCQA 3ZJUA 1J8CA 2M0XA 1QVCA 1T0RC 3PUWA 1TKYA 4DV3Q 3CKIB 1MSGA 5D65A 4URKA 1EYDA 2D2QA 3SK4A 3NBIA 4KN7C 3H1UA 5KNDA 5C5LA 3PIPA 2KQ7A 2M0AA 3GZNB 3VAWA 2XGTA 4NXMQ 4A3KG 1H95A 2X8XX 4K7SA 1VQ9A 1ONLA 2WAQE 1B70B 4L63B 1FR3A 1WX9A 2JVCA 3PUXA 1I4HA 3CAMA 5H1SE 3GTJH 5C3EG 5LHY1 4H44C 2ZEQA 3PHWB 2LI5A 3UDIA 3VR6A 2E75C 5CR3A 3CCQA 1CZPA 1VQ8A 2Y5BB 5EE9A 1NSNS 3KLSA 2QA4A 1QOAA 1M90C 2JA5H 2PYKA 3HM3A 1DGJA 4KJOA 1VQLA 2L8JA 1AARA 1IL2A 2ATWA 4CHTB 3HOWH 3C8YA 1GVPA 3RR5A 2CJNA 2VB2X 4LK1C 2DZKA 1S1QB 2KWCA 2JA9A 3L13A 5J1ZA 1WTPA 3DXJC 4YSXB 4I65A 2RMMA 1N62A 3RMHA 3MC9A 1LXDA 1OEYA 3AE9B 2QSDA 1JMCA 2G4DB 2ZNVC 4A3FB 5DPTA 3NTKA 4RKBA 1A3VA 1Y8PB 2O4XA 2WP8J 4DV3L 2LD9A 4C80A 1VS0A 3I7FA 2VZAA 1EFWA 1Y1WB 1L2FA 4KX6B 4II2B 2GBMA 3CWIA 1IHZA 1E24A 3TCAA 2F0TA 4TQ1A 1WGGA 2KDBA 2WXFA 1VQHA 1N5XA 4NXML 1EY0A 1NAPA 2MUYA 4A8XC 1BUIC 3SU8X 5JXVA 1BUVT 5CHFA 2PI2A 4CKEA 3A0JA 4F88A 3IAYA 5I6YA 1F9RA 2OXPA 3KYHC 2OEOA 1VMPA 1EF5A 3P4RB 4GU2A 2Z6KA 1SYDA 4G3XB 2JA8B 3D4RA 4K14A 2DYOA 3W1YA 3DHIC 1K8AC 5AZGA 2PZWA 5EKLA 2WKCA 3U4VA 1MJCA 2FCNA 3RLFA 4H2AA 2O2VB 1LFDA 2Z8LA 3AE2B 1XYIA 4DA2A 3I56A 4HEDA 1I4GA 1G51A 2GA4B 3QWNA 1YIJA 4IURA 1QLBB 2SAKA 2R7DA 4WH4A 1QUQB 1BBXC 2EY2A 4OO1H 1NBWA 2WGSA 2DHZA 3PMFA 2XIWA 4DV6Q 4HROA 3X0WA 1DOKA 1OTCA 1HH2P 1XMQQ 4B08A 1TIFA 1XXGA 3NHEB 4IFDI 5BMHA 1AZQA 2QJLA 1SIFA 4W9KA 1Q90A 1I50B 5COYA 3K58A 2KVZA 2HQLA 3B9JA 3GE8C 3UE1A 5BN5A 2Z4IA 3K7AH 3AYHB 5E6PA 5FLXc 4CGYB 2KHJA 1LT6D 1Q12A 1STYA 2BA1A 3FHWA 4PQXA 4DAYB 1R9TH 1E7VA 3NJTA 5FR6A 3HKZE 1YJIA 2WIIB 4QF4A 3K57A 3CCLA 4W9FA 5J18A 5FOBB 1YHAA 2A5HA 4DDGD 2NVXH 3ZNHB 4EOYA 2ICEC 1E8YA 4TQUS 3UE0A 3U58A 1WMHB 4BOZB 4BZAA 3DWAA 1EYGA 3LYYA 5C0XG 1IW7D 1VF5C 3FPUB 1MD2D 3JAMc 1EWYC 5C4ZA 2UUCQ 5IYCH 2L0TA 5IODA 3DOWA 2CVRA 3ONSA 1L1OB 3NE5B 5CV9A 4REZA 4FVMA 4W9GA 3TUOA 4LFAQ 1HZAA 2NTTA 4M1UB 5EKIA 2C7MB 3AE5B 4C7ZA 1SRUA 3GDEA 4GDKA 2KEDA 3KUDB 2ZJRA 2D0OA 3UDGA 2ALYB 3W5OA 1JROA 1A2UA 1Q86C 1KIXA 1IGDA 1XLNA 4DV6L 3KVFB 1IKLA 5CX3A 4PYZA 5CMDA 4KHPQ 3DWGC 1ZYRD 1KRSA 3R93A 1TWGH 4ZRPA 2D2CC 3ZRFA 3NENA 3K0YA 2BE5D 1ENCA 4R8IA 1XPUA 1YX6B 1GM5A 4J6HA 2LVPA 3N3KB 1DOYA 5IOCA 3HOYB 3K7UC 3F2CA 2Y5PA 4M02A 1X56A 4BY1H 3BZCA 1E6EB 4LNFA 4C3HG 4KI0A 4DQOC 4TRDA 1ET9A 1QOHA 5CV5A 4FF2A 2KWDA 3MHZA 1EO6A 4M0WA 4F7XA 3Q69A 3Q8EA 4L6TB 2SEBD 1HCZA 2OCEA 5ELEA 4XQNA 1XTCD 1PTOF 4GMVA 3A5ZB 3H9DA 4A3PA 4L8JA 5LLIA 2JRHA 1QNKA 3OPOA 1VQDA 3RNAC 4ZHPA 3RFZB 1XO3A 2QEJC 4GN3B 2UUCL 1I4RA 1EUVB 4XT1B 1C79A 5AUKA 3KH0A 2MBOA 1IL8A 3E0EA 1Y56A 2UWQA 3BZDB 2IX1A 5KHQA 4LFAL 3R2TA 2JSOA 1RYJA 1MFWA 3F8TA 3I3CA 4KY6A 3SD5A 1XJVA 3ZRCA 4DXGA 5M5WH 1KAWA 4K6DA 1JJGA 3A7LA 2L15A 3J81E 2EYJA 4HDQA 1HXYD 4KHPL 2JYTA 1LLRD 3UI2A 4C00A 1NUCA 1G91A 2KJ6A 4BY7H 4AYBB 3S14H 5BN4A 3J7AV 1PH9A 3QJZA 2VNUD 2IY1B 4HMIA 2NVQH 1E8WA 4WJWA 4PS7A 1WR1A 2KN4A 5IGFA 4L2YA 3A8JE 1WM2A 2NCNA 2DN8A 3IRBA 3R7QA 3SFDB 1KRTA 1NYQA 4JC0A 5AZHA 5IYDH 4LF7Q 2R92H 1EUJA 2L1BA 1ZPSA 2ZTDA 1E0BA 3R3MA 2CW0C 2K5QA 3I4MB 4NY0A 2B76B 5G5GA 1X55A 1B9NA 1DOLA 1L0XB 2ASBA 1EY8A 2J42A 5FKAC 4MZ9A 1Q81C 3S17H 3WOEA 3RD2A 1F52A 1WY8A 3F1ZA 1U0LA 2PZTA 3DLLA 4A3LH 4DKAC 1ZOYB 1Y1VG 2R2OA 1TS3A 4XDXA 1IUEA 4OVVA 3PO3G 4QUFA 1SE9A 2WDQB 2DNEA 2CCZA 2MJEA 4Y7NB 1SR3A 1HZ5A 4C2MH 1MJEA 2KC2A 4CDDC 2QF7A 3PZDA 4RA8A 4WAAA 4HJAA 2N9EB 3JAME 1WRIA 2J0JA 3VRAB 5CV6A 1PTOD 3TEZA 2A6ED 2N8NA 3HIZA 1ENAA 3HRZC 3LWEA 2N0SB 4M8MA 2F4IA 1PA6A 3CC7A 1UF0A 4PZ7A 3RMKC 1E8ZA 5EE0A 3LB8C 2E2HB 1ESRA 3GV3A 4ANWA 5C4JB 3I90A 3B6YA 4IOAA 4A3CG 1HA6A 4QAYA 2ES2A 2LRWA 2AUJD 1E10A 2NZOA 1XPRA 4IFDH 3MXNA 3SE0A 4ICUA 4CHKA 1TBEA 2N88A 4LF7L 3N1YC 3BDLA 1UWMA 4LK0M 3T16A 3E6ZX 4P71A 1MIUA 4XYCA 2D3CA 4X3KA 1UUPA 5C6AA 4WFN3 4JI8Q 2LS01 3JAMi 3BS1A 2NS5A 4NXNQ 1ZUD2 4A9AA 1D5ZC 4PNYA 2ZW0A 2IHEA 4YTNB 4RNAA 1Q10A 2Z1CA 3B08A 4QMGA 4YSYB 1EQTA 5CV7A 5EBDA 4X66Q 1F2RC 3E9HA 2H88B 4A3BG 4C3JB 2W9NA 4OW0A 4MHEA 3FKYA 2AQ3B 2XN9C 4XGAB 1FRRA 5KYIA 4IWOA 1RCVD 1GJZA 2JWUA 1ISNA 3M4QA 4A3GG 2RVLA 3T13A 2A4ZA 4G57A 3AXCA 1K83B 2ZJQA 3AEBB 1T5XD 3MVVA 5IP7G 4IO9A 3IT6B 4NQLB 4KK7A 2N9KA 1H9RA 1UNSA 1Z2MA 2BT6A 1VQPA 5JVH3 2LWPA 5HFYA 3ZTCA 1PYBA 1OFFA 3OAWA 3MFYA 4W9CA 4WWOA 5TR5A 1P7FA 4MELA 4K5WA 2WXJA 1S72A 3HOVG 1ZKHA 1LT5D 3IFTA 2Q2HA 4XQJA 2NYZD 4IUUA 5DAUA 3L4PA 4WRDA 3M4OB 1YN3A 2KVMA 4IC7B 2CH4W 4GNXA 4WJ4A 1EWIA 3HP3A 3ND9A 2F0EA 4ZRZA 3PRZA 4ZK9B 1OGWA 3CF5A 1GHKA 2X6LA 2MCNB 1EL0A 2GBNA 2HDLA 4JI8L 4Q0FA 3ZO5B 4PZ8A 4NXNL 1PFNA 2MA9B 2W3SA 1XLQA 2MBBB 1KD1C 4UDUC 4LNIA 4ZUIA 5JEAJ 3M4YA 1C4CA 3S24A 4X66L 1JR0D 4X3TA 2KX0A 1SNQA 4KGSA 2DY8A 3PV1A 1HZCA 4UPAA 3BK1A 3FILA 3NQIA 5I9OA 3ICEA 1LYLA 3AE8B 3DBHB 4PK1A 4GOPC 3BVMA 2B2YA 1HTOA 1EQVA 1EOTA 4DR5Q 2F52A 4P16A 3MA2B 1ILQA 2QEXA 4UP9A 2A6HC 5ISRA 2DWQA 3RZOH 4GZYC 5K36G 1E0ZA 3T8MA 2E8GA 5C0XH 2XK5A 4N59A 5AZFA 3GTGB 5LMNW 1QNUA 4LFCQ 2BW2A 3MHSD 4DK1A 1KH0A 3NY5A 3TBLD 3UF8A 4IUPA 3ZLZA 3M85A 2VUMG 1JW9D 3DBHI 1W6JA 2CH4A 2E2IH 1SN8A 1QF6A 5G55A 1PYWD 5GAEC 3RZDH 3ULJA 3A1QA 3FEWX 4LF9Q 1WE6A 3NVYA 4XDDA 1JE4A 4K6LA 5LXHA 1GUOA 3CQZB 4LJZC 5LMNQ 1E3PA 1WD0A 4XXEA 3VDZA 1BT0A 4J8QA 4KKUA 2MJ8A 4PYUA 2GVAA 4WQOB 1SMXA 2F0LA 3PCOB 4AJWA 1V80A 4B9XA 3CHBD 4C3HH 4GIVA 1PH3A 1STEA 3K81C 1EY9A 4H7BA 4IQZA 3VR5A 4DR5L 2KJXA 5HGQA 1K53A 4LNOA 5M3FB 2CU1A 3H91A 1CT1D 3TZDA 5EPJA 1KAAA 3PO2B 4G7ZC 2PZUA 1EIGA 1F9QA 4GLAC 1HNZQ 3APFA 5KIXA 1FJGQ 3I4MH 3VYRA 4LFCL 2FHTA 4DHZB 1ZKOA 4RGNA 2B2UC 2E2DC 4PS8A 1OXSC 5IWAQ 3C0RB 2OTJA 2KMAA 2YVCA 2KQ3A 4KD4A 2L9HA 2KKCA 1YQBA 2CFMA 1HTQA 2HUGA 3PF5A 5KRUA 4HLEA 3KK7A 3KJOA 4WJQA 4A3EB 4LF9L 4DUYQ 4CJ0B 2YTXA 2SOBA 1TWHB 3K5LA 4H02A 1X3QA 2LUMA 3HFZB 5LMNL 1I6HH 2DLBA 3B2FA 4DR1Q 5BO4B 1RTNA 4OELB 3M95A 2JSVX 3I5JC 1PRTC 4Y52H 3H0GB 5M3MG 1O80A 1V1PA 4P75A 2BF8B 2I1KA 3ZNZB 2J52A 3A56A 1SDFA 5FJ8G 2RHSB 1S40A 2REXA 1STAA 1T0QC 2JEAI 2RHQB 2V4DA 1TWCB 1WCMG 2CKHB 1CM9A 5LL6X 4KZCA 2KXJA 1VQCA 1N36Q 3EROA 3HOZB 2PTLA 2XBBC 3ZQ4A 4PZ6A 4DU9A 1HNZL 3VR9B 1C4AA 1Y1VH 3EUB2 1LTAD 1FJGL 4WJNA 3PO3H 2WXHA 5IWAL 2D62A 2P5ZX 4ZCKA 2XWJB 3L16A 3A9JB 2RDFA 2DUDA 4YCVA 1YN5A 2ZJPA 4K2LA 4MTKA 3APDA 3G4SA 4DDID 3KLRA 1WE7A 2KCCA 4Z9CB 1TQOA 4DUYL 1HUMA 1L2NA 4F87A 1C0AA 5EPKA 3HOWG 1N32Q 3B2GA 1I5FA 1SNOA 1Y8NB 4J3OD 4DR1L 2Y0SG 1GUAB 4BBNF 2G1EA 2IGGA 3CF6E 1TT5B 4B3MQ 3C3LA 4HK2A 4ZHOA 2EYHA 2YYZA 1W2BA 1ACCA 4I6LB 1DONA 4JI0Q 1STGA 1YN4A 2N9XA 3CRKC 4TMAB 3A74A 1A3UA 1I42A 2G9DA 1PH8A 1YJWA 4HKQA 2LFNA 2Z0EB 2V4IB 1WTWA 3VTUA 3NBHB 2ENBA 1KDAA 3QJYA 3M4OH 4KIKB 3Q8FA 4EE2A 4X64Q 1N36L 3H6NA 3T4AC 1NYRA 2DZJA 1PV4A 4JV5Q 2KDIA 3NTIA 2D07B 4BKGA 2WB1B 4IPDA 4A3IH 1XPOA 3FKIG 4JPSA 2EDGA 1DYQA 1IYFA 2W82A 3SK8A 3RNFC 3BINA 1ZGUB 4HJ5A 4A3GH 1SSOA 4BAXA 4OEMB 1AZPA 1H9KA 2Z4HA 3W1GA 1EIFA 5IP7H 2R93B 4CDEC 2F03A 3RNCC 2Q2IA 4ICVA 2BH2A 1PZKD 5M5YB 3F2BA 2N4FA 2NPTB 2V9HA 1FXAA 4MM3A 3HOUB 1N32L 4ZYSA 4IWPA 1X9NA 5IT9c 3HOVH 4RM9A 3UI3A 2PE6B 3AI5A 3OWEB 5LMUQ 1JC7A 4B3ML 2ZZPB 2K28A 2RBMA 3VUYA 2HIVA 4JI0L 3L2PA 3R2IA 4LF4Q 3R66C 2IYDB 2MH7A 3TMPB 4HJ9A 1WTXA 4CJ1B 2PNRC 1WSPA 2NBWB 4UP7A 2KVRA 1BKBA 2YTVA 4FF3A 3ZGZA 3IHPC 2EYPA 4USAA 1BCPC 4OWXB 1TS4A 5ELFA 1WJ4A 1XWEA 1F0ZA 1LTRD 3PVLA 4BBSB 4JV5L 5FK9C 1JQYD 1ASYA 4JIOU 2E5LQ 4QIWE 4FF4A 3SHLA 2LHEA 1AE2A 3T1HQ 2LJ5A 2QIEB 3ZXRA 4AOFA 1OXTA 3DPDA 1UE5A 4KTAA 1F1HA 5JZEB 2BYTA 3I4LA 4ARIA 1TU2B 2SDFA 1U4PA 1D4BA 1PFMA 3GTLH 1MPEA 1V86A 5KNCA 1PUTA 3PZ7A 1D1IA 1SMYC 4K81A 1B9RA 2M19A 1CUKA 3EIVA 3RI7C 3DM3A 3MTSA 1IGCA 1PYSB 1YBYA 3V2TA 2UXBQ 3ZTDA 5EKKA 2NB0A 3TEHB 3A9KA 2AHOB 2B3GA 2BYVE 4GDLB 4LNNA 2KK8A 2V4LA 2X38A 4DV0Q 5M3FH 3M9BA 4DAVA 1P8LA 5LMUL 3K0XA 4LF6Q 1LT4D 4B3TQ 2VUMH 3P75A 3E56A 1VD2A 2A69D 3NUHB 3L0OA 1GUNA 1S5DD 2IX3A 4LF4L 4AQYQ 2PW9A 3VYSA 2KC1A 1UEBA 2EYOA 2K5VA 1QVFA 2WXLA 2LRUA 1T5EA 3I73A 1H9SA 1LTTD 4W9DA 2E2JB 2IO1B 1B1ZA 3KF6B 4NPNA 1WXMA 1VCIA 4UP8A 3F2DA 2E5LL 3GS2A 2JK8A 2LXJA 3T1HL 2HD3A 1B7YB 2K33A 1ASZA 3GTKB 3MC8A 3MJWA 1C3TA 4IUNA 4IUQA 3Q3NC 2K5HA 4YHHQ 4HVBA 4LFBQ 1FD6A 1HFGA 2R7ZB 3STBC 4ZOHC 3EJIA 1V6EA 4IDIA 2B2VC 1GC7A 3PUVA 1UBQA 3ML8A 1TGZB 4RHSA 1HPCA 2UXBL 2AWTA 5E7NA 2KT7A 3WAPA 1VQNA 1UAPA 4RF0A 2LGDA 1VQGA 5FLXL 2JZPA 1A63A 2Z6BA 2KFKA 1VQ5A 2JEBI 4M8NA 4DV0L 1A3TA 1TWFH 1RIPA 2LHDA 3FPPA 4FNFA 4U673 5T1IA 4LF6L 2K14A 2INCC 4B3TL 3HOZH 3RZWC 4AUQC 3R3OA 5IA7A 1L6VA 3RNGC 4FXDA 1C76A 1TJEA 2LMCB 2BBCA 2B63B 1PQSA 3GOEA 3A33B 2BTEA 1BMLC 1CHQD 3TN2A 3MHBA 2G45B 3PRPB 5IT9E 3QC8B 2KN5A 1E1TA 3W5UB 2A73B 4DK3C 1MGSA 1SE4A 3MWYW 2HDEA 2L1AA 1O78A 3NWSA 2CR5A 4V0BA 4P1BC 2JA6B 1Z7TA 1YNND 2VL6A 4P72A 5KYLA 4KGTA 4DXAB 5CV4A 2L52A 3DVGY 1JQ4A 3TP7A 4AH6A 2K50A 3SK6A 4DPGA 2GOWA 2LUEA 3NWTA 1BNZA 1VZ8A 2RDHA 5FJ8H 2CS4A 2QW7A 4ID6A 2Y0SE 4Q2JA 1OXXK 4LFBL 2HCIA 4PV1C 4JBKA 2R92G 3GTPB 3EHVA 4KZ0A 5C3JB 1WCMH 3U9OA 1C77A 2JJQA 1SLJA 1ICWA 1YOVB 2D5GA 3AECB 2M2LA 3OW2A 2UXCQ 2N3SA 3V6CB 4A3FG 4A3LG 1V97A 1VQBA 4G7HC 4P2CB 4POGA 1WGHA 4C3IB 4BOSC 3J7ZC 5C4XB 4WORA 2QC8A 3TEXA 2JXMB 1Y1WG 3J80c 4IOIE 4JBMA 4W9EA 4RGMA 3I57A 4EZKA 1D3ZA 4MSQB 3L9AX 3IAS1 3MAQA 2MP2B 4XDCA 1YJ9A 4ZYNA 4E74A 1C8CA 2JY6A 5C2TB 1KRHA 2GMIC 1UE6A 4LUZA 4PS3A 5GXGB 4JWSC 1OXVA 3NPPA 4WWPA 1U4LA 3Q8CA 4ANXA 3S1RB 1FL0A 2KCTA 2Z9HA 4EX5A 3W5VB 1TKEA 2JA8G 1ZXHA 2MP1A 1NEKB 4OWTB 3OWFA 2FJ2A 4IFDG 2K03A 1UGJA 1HTPA 2K5WA 2RCFA 5ELOA 5KGUA 1SEBD 4R4CA 1J6QA 1UWVA 3VR4A 5EDSA 3P2BA 2BCOA 3ERSX 3GTMB 2UXCL 3TS0A 3FKIH 1WGYA 3A8KE 3P4QB 2E76C 4WWMA 3BYYB 1E2WA 3Q2AC 1E1OA 1EEID 3A8IE 1PH6A 2IGHA 1ET6A 1Q5WB 2UYZB 4GB9A 4AIMA 2W55A 4RWSC 1VR9A 1R4NB 4A3KB 3NVVA 1N8RC 2DZMA 3PF4A 3IBEA 4ODGA 1RLFA 2K5PA 1I6VC 1YJJA 3VDYA 5KHOA 4D2KA 4DBGA 1WZ0A 4TVAB 5LL6S 4AS1A 2I5HA 2NVTB 5IGEA 4HPPA 3D3RA 2ONQA 1BVSA 3VQIA 2WXQA 5A35A 5D2MB 1GPXA 1L1OC 1SYBA 1ILPA 1AYFA 1SIJA 2C9WB 2LASA 2N78A 4P73A 3FAHA 1JCKB 4NZLB 1IW7C 1UEAB 3P20A 1R4NI 2X6GA 2GI9A 1C4PA 3I91A 3K80C 1YX5B 2L3ZA 2DYBA 1T0SC 4L23A 4MT5A 1MJDA 3SEBA 1NCVA 5FLMH 4MIUA 4HR7B 4FLHA 4KGRA 5ELNA 1IZ6A 2XRQD 5J2RA 1JE5A 1EY4A 4FADA 3IVFA 4MSMB 1GUSA 5GMVA 4W9HA 3AMUA 2MNAA 1MHHE 4JL9A 3ZXVA 4ASWC 4L5QA 4OL7A 1JRUA 2OF1A 3Q3JA 1UELA 1F9SA 2DY7A 3MEFA 2BE5C 1QZGA 3I70A 5CV8A 1VRAB 3MXUA 4TKNA 4B9WA 4MJSB 3NZUA 4CDFC 2HTHA 2L11A 4B9KA 3AU7A 4NW2A 4EVOA 1GB1A 4KKTA 3PT2B 3AE3B 1T9HA 3TQYA 3P42A 1VQ4A 3HVZA 2ZPYA 4JE3B 2KCNA 3ULLA 1KFYB 3DBRB 2F0NA 2OJRA 2LXCA 4NNJB 3X3NA 2KQSA 3DVNU 3Q3FA 3P1HA 2K8HA 5J17A 1V49A 2BWES 2C9OA 1YNJD 4A3JB 1FXIA 1LO5D 1XMQL 2BDOA 3PUYA 3L10B 1CJEA 2B63H 2JU6X 1TY2A 4IN3A 3A4RA 4YL8A 2RPQA 3CCJA 4JQWC 3PIO3 2EOTA 3KDFB 1V2YA 2O6VD 1PLFA 4NAWA 4W9JA 3TJPA 2DJFC 1DXMA 1PXUA 2M56B 1GXDC 2PEAA 2PQEA 1KQSA 2VS1A 4N6EB 4FHJA 4AYBG 1Y14B 3DBRI 1Y8RC 2O6VB 2Q8TA 3QO2A 1XEEA 4K3BA 4LDTB 3QOJA 3MP9A 3NP8A 3CC4A 1E22A 2BH8A 2VB3X 2B29A 1RL2A 1Q82C 5C4HA 3GTPH 2AL3A 3I4MG 1S5BD 4LUVA 4KV2A 3V62A 4LLGM 5JEAG 2WYQA 4NDXA 1JWBD 4B3RQ 2BYEA 2GN5A 1X65A 2EE1A 2K6AA 5GQOA 2PW7A 4HMJA 4IPCA 2AQ1B 2NN6I 4OIJA 4DV5Q 4ZKCB 2OQKA 5NUCA 2LJIA 4C4VA 5C4XH 1MKHA 2CHBD 1J19A 3EVQA 4LUOA 4OHJA 1N33Q 4FXGC 2VH2A 2QDLA 1TR5A 2I5LX 1DGSA 3TRZA 1WVLA 3APCA 3DWPA 3G48A 3QK0A 4IM0A 1NDDA 1ZP0B 2KTRA 4HAEA 2NUCA 2L0CA 2EIFA 1QILA 4A75A 2DNFA 1PDQA 3ZVVA 2A6EC 2C35B 2GBJA 2D5DA 3D4WA 1XMOQ 1V9JA 3S1RH 4HRSA 3H8HA 2PQAB 2ZW1A 4GLVB 3W3AA 1JWUD 3RULA 1WF9A 1EEFD 2KDMA 5FLXE 1MVKA 3IXSA 4A3FH 3EECA 5HKHA 4GOPA 3Q3MC 1BR9A 4LF8Q 1E5WA 2C60A 5BYRA 4LF5Q 1EOVA 1M4VA 1NTGA 1TTNA 1Y1WH 3VUXA 3W9CB 1GUWA 4B3RL 4HEA1 1V1QA 4ZAIA 2G4SA 2A8VA 1WYDA 3GTMH 3L54A 1HHVA 4DV4Q 1V8CA 3WCQA 2KJRA 4DV5L 2YTYA 1GKHA 1CKNB 5F2DA 4JI3Q 3HM6X 4BBRB 3PGZA 4HJKA 1S5ED 1N33L 1Z6HA 3FRPB 4A55A 2IBIB 1PTOB 1QZEA 2LXKA 3BY4B 2JA8H 2NTSA 1VQAA 4ZQ3A 1K8OA 1HEZE 1Z47A 1PMRA 4A93B 3I4NB 1H4RA 2M00A 1WI5A 1KNAA 2TMPA 1UH6A 1WTHA 1KDCA 3I2ZA 3ITPA 1STHA 3S9WA 1XMOL 3RT3B 1YJNA 4ZKBB 3D31A 5DM73 3M3YB 1WR6E 3PHXB 4GSWA 2AMCB 2TSSA 1WX7A 2QHOA 4I6PA 3TMEA 5L95C 4CDCC 1IBLQ 2EJMA 3IL8A 2A68D 2IGDA 3M7NA 2L05A 2KZRA 2XTIA 2YU9B 1J8IA 4A3IG 2IO0B 3P4PB 3C19A 2RA4A 4NJ7A 4CKCA 1L0WA 1EWHA 1SE8A 1WD1A 4LF8L 3RCZA 4LF5L 1R7SA 4DV7Q 4JI4Q 4HN7A 4YWLA 2GBRA 5HURA 3U4EG 1G8ZD 1I50H 3EQLC 1EWCA 3Q24A 4DV4L 2PPBC 2XEWA 4E3CA 5C1ZA 4DR3Q 3KQ4A 4JI3L 2YEPF 3QX1A 4ANUA 4G4KA 2B2UA 3LDZE 2IW3A 4A3MB 1IYVA 3PPAA 3RN2A 1SXTA 4JI7Q 1WJ6A 1SJED 1QWYA 5EE1A 3QA8A 3TIXA 1TWAB 2MSED 3JW0X 5HHDG 5JH5C 4NMZA 1VQOA 2RR9A 4XTCS 2M17A 2EKIA 1SAPA 4GDKB 4YWGG 1IBKQ 4F7ZA 2WXIA 3WIMA 2WXNA 2BDNA 2F3VA 2RGFA 2F0JA 3VFKA 4DHJD 1CSPA 1OEYJ 2C7HA 3E9SA 4GKKQ 2KLGA 4MH8A 3ZIMA 3VTVA 2UUBQ 2Q8RE 4A3DB 3KWVA 3Q14C 2L55A 1RODA 3I9V1 3NHHA 3H6MA 1IBLL 2CQAA 3D0FA 2ZVOA 3P63A 4H0LC 1JOQA 4JBJA 1LTGD 4DV7L 1Q8IA 4JI4L 4C7YA 2RKSA 5I2YA 3AH7A 4B0MA 2WDTB 2F0DA 3PSIA 1K3RA 1QE6A 3A5UA 4CYEA 3E0JA 1P16A 5C44B 4M0WB 3VA5A 3HOYH 3P1MA 1WXQA 2K1FA 4DR3L 2J53A 4KSKC 3RZFA 3IKJA 1HUNA 2FE8A 4QCLA 3M63B 1FD7D 1VZ6A 3GTOB 2NBVB 2Q5WD 2C5LC 3T56B 1M94A 2QMTA 3VA7A 4JI7L 1EF1A 5IKCM 1X32A 2DNCA 5M3FG 1YD8U 4OGQC 4ZRIA 3DMUA 4P1CC 4BS9A 3PO2G 1PFSA 3Q22A 3LJ3A 4BKSA 3CPFA 3S1MB 3U8ZA 3S15B 4RGOS 2H89B 5C3WA 4GKKL 1KF6B 5IT9L 2UUBL 3QG1A 1ZEQX 2LZ6A 4MGYE 3X23A 1ZE3D 3URYA 3T1YQ 1SNMA 3OIQA 1WJNA 1TT2A 4RHRA 2Y5CA 3RUIB 5TSSA 4A3EG 2NMQA 5HG2A 3V61A 4MGIE 4ZUJA 1X3EA 2O2LD 1LTID 3SXHA 3AMZA 4GN4B 2F0HA 5BYSA 4DFAA 3WALA 4AJYB 4KN4C 4DGZA 3B1LX 2IT1A 3ENEA 2N7DA 2KNBA 3NQTA 4OIKA 5D3IB 4KHZA 2R3ZA 4XIGS 5GADC 1E7ZA 1EZ8A 5C3XA 4JI5Q 1K51A 4IJLA 3WA0A 3ZJVA 5I2XA 3HOXB 3TREA 4TUUA 5JEAH 5JOBA 3FP9A 2UU9Q 3AE1B 3PO0A 4EEWA 3HOZG 3H15A 2YV5A 1KM7A 4WAFA 1WTRA 2R61A 1K73C 2ACZB 1PRTF 4GOCA 4IM2A 1F2YA 2JWZA 1CI3M 3OHXC 3K5MA 3CIRB 4Y7NH 1RM6C 3UQAA 2WNMA 1S5FD 4K5XA 3DEOA 5EQ0A 1WGDA 4QY7A 3T1YL 2A19A 4US8A 2L76A 3CCMA 4JBWA 4JWUC 5DM63 2PE9A 2JRIB 1C9FA 4QIWB 2QDBA 2N1WA 2BB6A 2A74C 5D14A 3H7PA 3KUZA 4WWNA 2BKFA 2N7JA 1C9OA 1K0RA 3VR3A 1JWAD 2BVCA 1D8LA 2K8CA 3MXNB 2LSSA 1PTOH 1I3QB 2R2QA 1V5OA 2E2HH 4JI6Q 2IO2B 3BZKA 5C4JH 2J7ZA 3J7A5 4R4QA 4WJOA 4MTNA 3KF8A 4DV1Q 4IOCA 4HPMB 4IG7B 5GROA 2BWFA 3HHMA 1ML0D 3WDNA 3VUWA 2KFJA 2K01A 2D0PA 2IZVB 1J7BA 3AEDB 3T53B 3X3MA 4EKUA 3JSVA 4JI5L 1S3SG 1WJUA 3Q6SA 4YTMB 2K05A 1UE7A 2FCSA 2UU9L 4XWWA 1SBBB 1HRJA 1P3QU 1GD7A 4P74A 2KQ4X 5H8YE 2B2WA 1RFKA 2WB1G 1SYFA 2PNHA 3BU2A 3VR2A 4C3JH 1RJTA 4BXXH 2CHZA 1L7YA 5LXIB 4FF1A 3DBLB 2AL6A 4C56C 3EN2A 4LNQA 1E2ZA 1K83H 2JA7B 2R7FA 3AE7B 2R93G 4CQNA 1FYCA 1X3PA 2EY6A 5BN3A 1GAQB 1FO4A 1CMXB 1FPYA 4YWKA 3V96A 2QKIC 2JYOA 2AEHA 3HOUG 2LGSA 4IWQA 1FGUA 4JVZA 4GNXB 4HIMA 3L0WB 3QIJA 1K52A 2B2TC 3IT4B 4JI6L 1PRTD 3MC0B 2INDC 1E8XA 1QOBA 4RM8A 1LTLA 4X62Q 2K39A 4WURA 3DBLI 1ZW7A 1D6EC 4PMBA 4DV1L 2KOXA 5I6WA 2VQFQ 2ICIA 1BDOA 1VQ6A 4S17A 1KOTA 1PZJD 1KJTA 3DEPA 3SR6A 1B3AA 1JJCB 1G2SA 3K5NA 5H92C 1P1AA 2YLMA 1IBXA 4B6WA 3HEJA 5EPLA 1PH1A 2Y3AA 4A3DH 3FILB 3E3XA 1IBMQ 2ZXOA 2B2VA 1WX8A 5ELDA 4BBSG 1D2BA 2Q8IB 3I55A 3QIAA 3PLUA 2D3GA 4MACA 2EXZA 3ULPA 1JWSD 1CKMA 3V3XA 4CBVA 3TP8A 3ALBA 3ERQA 1UWXA 4DK0A 3PIP3 5IGDA 1EYCA 1VCBA 5DEHA 3GTJB 1HNXQ 2DBYA 2LGIA 2XK5B 4KSLC 1WFYA 1EY5A 5C44H 4HIOA 2LEKA 3J80L 1HJPA 2CKZB 1YIWA 4XWTA 2L4NA 4EUTA 4FBJB 1M1KC 1BCPF 2JA5B 3ECIA 4FHKA 4PMWA 3W1BA 3BDCA 1Q7YC 1MHXA 3ZUNA 1WRDB 1E7UA 3GTGH 2PVGC 2F0FA 2LGXA 3GTOH 4EQPA 4JW0A 2Y0SB 1GUGA 1QCBD 3A1QB 4HJ8A 1F2MA 4X62L 1L4ZB 1FNVA 4RKLA 1X6OA 5FLMG 4X64L 3E5SA 4X65Q 2VQFL 1VF7A 3M4PA 3KUPA 4PMCA 5D7GA 2WDRB 2A69C 3G6EA 3S15H 4OZCA 3PSEB 2WX1A 4OONA 2WAQB 1T3QA 3LXFA 1VQEA 3CQZH 2HT1A 2EMTA 2IY0B 3K6OA 2F0VA 1MI2A 4J15A 1IBML 4HKZE 4ZDVA 4ULLA 1OO9B 4JI1Q 5HGTA 1J5EQ 4LW1A 3H7SA 2N9PC 1QB5D 3VR8B 1YVCA 2B2WC 1EU4A 2EMSA 2N9LA 1OTRB 5BMGA 1HNXL 2R7ZG 2N49A 4OVUA 1I7HA 2C5CA 3S16B 1YJ1A 2K25A 5IAAC 1PHJA 1C4QA 2DJGC 1VZ7A 3W1SC 3J81j 3CC2A 1N60A 1TZOA 1A2TA 3ZJYC 1TZ1A 5JHAA 3PO2H 3N9YC 3G7LA 1XNRQ 1A6XA 2M1MA 5IYBG 3C1EA 5JJIA 2WXOA 2M8SA 1BBWA 1Q3LA 2AWOA 3BYTB 3OTOQ 3OYYA 3Q0AA 4K8IA 5DCNA 2F0GA 2WU5B 2KOLA 2PW5A 4RCNA 5D6JB 1PDXA 4X65L 4ZRKA 5BYQA 4LTUA 2B63G 4HCEA 2QCZA 2O2VA 1A62A 1FFUA 4JPBW 3A7AB 4A3EH 2BGFA 1JOKA 4QQBX 2EJGC 2Z0SA 1RAXA 2PMZE 2PLPA 1TWHH 1V1PB 5EGTA 2GRIA 1QUQA 3QARA 2LGYA 2XWBB 2JA6G 1W3SA 3AN1A 2EY1A 4JI1L 1HA5A 4IPHA 3H0GH 1SYGA 1K9MC 4LCDE 1YNNC 4OZAA 2WXPA 1MHWC 1EY7A 2H5XA 3K7AB 2N1VA 1R9TB 1BOSA 3EFUA 4CO7A 3LWUA 2J0KA 1SYCA 3ER0A 4I7ZC 4YWMA 2I0QA 3ZYYX 4OO1I 1NVID 1V81A 2K22A 1GB4A 5FO8B 3PTFC 1TWCH 3K8AA 2B8FA 5E4XA 2NVXB 2HJ1A 1STBA 3E9IA 2KWVB 1CHPD 1IP9A 1CKOA 4WJ3M 1DD2A 4FP5D 4DAYA 4F8MA 1XNRL 4ZRJA 3V05A 2CHWA 4ALPA 4ITKA 3PV0A 4KDLB 4AQYL 2ASQA 4IM3A 4IZ8A 2JPHA 1EQQA 3AB5A 3U30A 4C3IG 3OTOL 2K5DA 5C4XG 3DUZA 1V1OA 1DCZA 1WMHA 2AYOB 1YQ4B 1A5RA 1GHJA 4FXKC 5I4DA 1N6ZA 2L7RA 1Y8OB 5JJZA 1WTQA 4NP5A 3FVQA 2O5IC 2K6QA 1EQRA 3ZDTA 5D3DA 3D8GA 5EE3A 1L1OA 1U5KA 2OTLA 3M7GA 1EY6A 4HIKA 5FR3A 4N8FA 4MDKE 3CCVA 1B8AA 1LUZA 2F0KA 4G0NB 4YHHL 2IO3B 4UY8C 4ARCA 1E90A 3N1ZC 3HKZB 3G71A 1RFAA 4DUZQ 3SGIA 4JLCA 4YTPB 4YCWA 2XVSA 5AEKB 1RDPD 3L3OC 3AU5A 5DPSA 1HQRD 1CK1A 1E2VA 4HSPA 1ESFA 2KLCA 2G5DA 2EYLA 4BY1B 2KACA 1SSNA 3IAM1 3GP7A 4QL5A 2IDYA 4X3SA 5IP9H 2KHSA 3CCEA 3S1NB 3CSFA 4POFA 4KDIC 3VYTA 4QJFA 1LQBA 1H9JA 1GO3E 3GB1A 4MGKE 2JUOA 4K3CA 3WOFA 5A2QE 2IL8A 3HRDD 3J9CA 1K8MA 4OWWB 1HZ9A 3H3VI 2B8GA 2M9VA 3S2HB 4MM3B 3NVZA 2RCNA 2HQEA 1IYJB 5CHWA 2XSCA 1R4QB 5G2NA 2R93H 3KBGA 2FNJB 5DNFA 1I4XA 3HS0C 1NI2A 3UINB 1YZ6A 1DJRD 3R8BA 5M5WB 5M5YH 1HZ6A 1QQRA 3VVWB 2ZPNA 1AN8A 4XC2A 5IN7A 3HOUH 2VRRB 3RNBC 4FN2A 5FO7B 3AEAB 2MPMA 1GG3A 2D10A 1I35A 4IPGA 2KO3A 3AFQA 1M8AA 4L5RC 4R4OA 4BY7B 1I94Q 4OX9Q 5E6OA 3S14B 4DUZL 3RN5A 3H09A 2MGSA 2NVQB 1PGXA 1T6BX 4NAMA 3TEYA 4WJPA 2GBKA 4RCOA 5FO9B 3AQQA 3RLOA 1HFNA 2Z0DB 5CHVC 1FMAD 2CU3A 1UBIA 2D11A 3GZNI 1JRPA 4KY7A 1A0IA 4C1NK 4JOIC 5GAGC 2R92B 4AWJA 4RH6A 1XCQL 4HJ7A 4N9F4 2J7QB 2WX0A 1Q1OA 4PT5A 2J0MA 2ZVNA 4B0EA 3CCSA 4GLXA 1N9WA 5KEEA 3S17B 3OSOA 4BBSH 4CKBA 2A5UA 3UDXA 2IHFA 1BO0A 1PFDA 2MO0A 2KEEA 1WXVA 2HD5B 3AEGB 2F4VQ 1X3GA 2PQAA 1ZDVA 4GGQA 4IW0A 5EJWA 2Q2TA 5IOIA 1LM0A 3NEMA 1N34Q 5C3EB 2LVOA 2M4NA 2H1EA 1BXTA 4C2MB 1LACA 3A9KB 2KDFB 1XQQA 1TS5A 1G291 1B3QA 4K7WA 2W54A 2JXTA 3J7AF 4JI2Q 4K7UA 4KMUC 5IGBA 3U2SC 2JN4A 3KWLA 3Q6BA 2QCPX 1JORA 3L08A 1WXAA 1J7CA 3NELA 2EQSA 1K3BC 1NENB 3V6EB 2K52A 5JAVA 3S16H 1NMFA 3T51B 1Q1BA 1I94L 4OX9L 1SF0A 3GD7A 1RRBA 1CKNA 3TS2A 1H9SB 3PLVA 3HVDA 1DOIA 1EYAA 3M62B 3QCAA 1H9MA 1G6PA 1U4RA 1FCLA 3J81c 4TQ0A 4HJGE 3ABVB 3AE6B 2ZNVB 4FJVB 3D4DA 4A3JG 2MWSB 2E2JH 3F2UA 4KHVA 5CBEE 3UIPB 2KANA 3NVWA 1YNJC 1Z5SB 2KA7A 1VQFA 1BF4A 1V8QA 1ZYRC 4DR7Q 2NWGA 1VQKA 1FM0D 3C46A 3MZ5A 3NK9A 4C1NI 3GTKH 3HOYG 4KKSA 1K8GA 2F4VL 2RPVA 5DLQE 3JC66 1GOZA 2JQRB 1WJJA 1VDVA 1N34L 2R7ZH 2HDMA 5CORA 4P7IA 3J80E 2PO4A 3QQ8B 2F0IA 2NN6G 2QDFA 3W2DA 2MBEA 3EFCA 3N1XC 4H13C 4JI2L 2KFKB 2FCMA 4BA2I 2L00B 1XCTL 2JZZA 1VMCA 3QHTA 5IYBH 5L83A 2PIAA 4XZ4A 1FVIA 1PH5A 3VHTC 4DNRB 2N7EA 3QB3A 2KJHB 4P6VF 4GN5A 3FMCA 1PGBA 3HUIA 2IPKD 2AWNA 1J9OA 2KUMA 2VW9A 1PZID 2KCMA 4N8X1 3N20C 3NOBA 2ZM6Q 4JGHB 1FCCC 2CWAA 4OXPA 2G9HD 2WFWA 2K5NA 5T1GA 1ZXIA 4LWCA 1OQYA 3HZXA 1WFQA 3J80i 2F1MA 1KABA 4YXDB 4EZJA 1JB3A 2K4KA 2GVBA 4EQNA 3EBEA 2WXMA 2HIXA 1LV9A 5E3FA 1WIAA 2GLSA 2JA6H 4TKOB 4DR7L 1JMLA 1YMHE 5JJLA 1VQIA 2XRSD 3DWMA 2F0WA 3DVNV 3AE4B 3NSWA 2K32A 3ZNID 1NR4A 3L7ZC 1KXLA 1RD9D 1R4MB 1CQVA 2KENA 1F2LA 2E74C 4EFOA 1N5WA 4YCUA 3H3VH 3NS8A 4R9WA 2RSOA 1HE8A 1N61A 1QOGA 1P9DU 2HHHQ 3RZOB 2FIFA 3V60A 4US9A 1C78A 1SNDA 4J6IA 4BA1I 4C3IH 1YI2A 1TKGA 3S1NH 3N6RA 4GS3A 4XX5A 3RLNA 2N55A 5E4WC 3OMGA 5CBAE 2ZM6L 1YITA 1R4MI 2DAFA 5E6JA 4N9PA 4II3B 2W3RA 2E2IB 2Z6KC 4XYOA 2ZCCA 3N52A 3VH4B 3H94A 3CMAA 4MNOA 2IWHA 3RZDB 3S2HH 4IFDJ 1J7AA 1YHQA 3TL5A 1FRDA 3S2DB 2BOSA 1JOOA 4BBRG 3N30A 4G11A 1PTOC 1IKMA 4HSVA 2JYEA 5J39A 5C0XI 2MQHA 1S3OA 2F3IA 4R4IA 1P0RA 1CFMA 4Q5VA 4XE0A 3UGBB 4BVUC 5T8IA 4QUCA 4K5VA 5G5HA 3Q8AA 4QGUA 3GTQB 4A93G 4DNTB 1VDZA 3I4NG 3BIID 5DPWA 3TSSA 1NE3A 4C3HB 1K50A 3OJ4B 3D32A 4L1BA 2V3NA 2OEDA 4KJNA 2EJFC 3OG5A 4UHVA 4MH0E 1K28A 3MEHA 2DX5B 2K3UA 4WQMA 2HHHL 1GC6A 2K8BA 4TSSA 3DVGX 3A54A 4RF1A 3KBXA 4IUVA 5M9OA 1TYGB 1O7LA 2WACA 4ANVA 2OJWA 1II3A 2A68C 4C3JG 4BXXG 4G50A 2G3QB 2WQYB 2HTME 4IALA 2J4XA 4A90A 4NB3A 3J81i 2MO1A 2V1CC 2JX5A 2SNMA 3PUZA 2OT2A 4NQKE 2I2YA 1VQJA 3DWQA 4A3KH 5DPRA 1Z9FA 4IUMB 3MXPA 2MX2A 2KAJA 2PJHA 4X3UA 4AQ7A 1AEXA 3PGEA 2VY3A 1J0GA 1JWMD 5C3EH 4A3MG 4J1MA 1XF5L 5EBCA 5IE8A 3QWZB 3RN9C 4E71A 4LAAA 1I6HB 1TIID 2OQ0A 1CZWA 3N32A 1DOMA 2NVTH 2BS3B 1CZGA 1NNXA 1XX8A 1D1KA 4JK1C 1QVGA 2D3AA 4ILWA 5IGCA 1SFOB 2KHWB 3NS1A 3C1FA 2HCCA 2CW0D 3U9SA 4HXDA 5AFWA 2K04A 4K0KQ 2PKOA 1L0VB 4A3DG 2MLBA 1I4PA 3KFUA 4NKLA 3MTNB 4YIJA 4HCSA 3DHQA 1P98A 5MPOA 1BBUA 3WWVA 3RYTA 1Y1VB 2UXDQ 5C0XJ 3ZW3A 1K8RB 3PO3B 1P7EA 4YY3Q 2WU2B 2R6GA 4DWFA 4ABNA 4RG1A 5JHBA 1F2ZA 3K59A 4FXCA 2RDBC 3K9OB 1XNQQ 1FNWA 1VJKA 1L0YB 3NRZA 1H8CA 4O0AA 2WKDA 4JCVE 5C44G 3J7YW 1YEZA 4KV6A 3DQVA 3U52E 4L5SA 2FMMA 3UDFA 2CJOA 5JPMC 1XLPA 1O7ZA 4NPSA 1PH4A 1EIYB 3Q3OC 4HTHA 1EIHA 3A9JA 2V0GA 3CXCA 1RKNA 4FA6A 4HPLB 1SJHD 2NZ1D 3FDTA 2J0TD 2JE6I 3EFXD 4DXFA 1SGHA 2DENB 2JF5A 2WHIA 4DNIA 4XYQA 2F0OA 3T9LA 4KVGB 2FIDA 4DHJB 4OZBA 4GN1A 3IFWB 4DR4Q 1F9JA 1WYGA 5CGKA 3P7JA 1X54A 5EAYA 4K0KL 2EYMA 4A3JH 5BR8Q 5IGGA 1MG4A 2HJ8A 2L12A 4NAWB 3CSTA 3PIOA 3L17A 3NZSA 4KD3A 1D5XC 2LFIA 2KWUB 2NVYB 2MEKA 2MHJA 3ND8A 2EKEC 1O7YA 1XT9B 1UZXB 3SHQA 3CD6A 4A3IB 3OW7A 3EC8A 4A3BB 2UXDL 2DYMA 3AULA 3NBHA 4YY3L 4KIKA 1KLGD 2K7VA 1QZHA 1LABA 2DGYA 4AYBE 4A3GB 1F77A 1SYEA 1NMGA 1XNQL 4I6NB 4W9LA 2NN6H 4EGVA 5CC4A 2K9XA 3U4ZA 3C2PA 1R4PB 3Q8BA 2RQXA 3HK0A 4RFBA 1A8VA 2RSUA 2WS3B 1IBKL 2F0SA 3T3NA 3HOVB 1S4ZA 1CQFA 3S1QB 1HNWQ 1T0YA 5G3LF 3HOXG 2WXKA 4HIDA 4C4VB 2MQJA 3LNNA 3AB9A 4TV3A 1F2RI 4DK5A 2NPTA 3VTWA 1KNEA 1KTKA 2PVOD 3OOCA 1TY0A 2YEPB 4LNKA 1SB3C 3ZDMC 1B50A 3OMCA 1V43A 4APVA 1AE3A 4DR4L 1XD3B 4GKJQ 3DDCB 4ZRQA 2B2TA 3MXGA 2PI2E 2KTRB 4RAUC 5BR8L 1LT3D 1WWTA 3LGJA 2PCFB 4UAIA 1LM8B 4DAPA 4V190 3NUCA 4B3SQ 1A70A 2X69A 1G2TA 4IJHA 2WWZA 4LDTD 2ID0A 2EPBA 4DV2Q 1VQ7A 3H0GG 1RF2D 2ZXRA 3KLWA 1KC8C 3RNEC 3S2DH 3JVZX 1GNUA 4DF7A 3ZJTA 1WM3A 3BVZA 1AW7A 5AJ3Q 2NBFA 1WYWB 3CRLC
chains in the Genus database with same CATH topology
3SR1A 1EZ6A 4KKIA 4CJ2C 2A6HD 2KMMA 4IKGA 4A55A 3GTLB 3BWUD 1SNCA 4QB4A 1DOXA 5I9PA 1B53A 1E9MA 1FGBD 2I46A 2WINB 3EA6A 2WDVB 1JALA 2WXGA 2JP1A 2MJDA 5A2QL 3EGRA 2IX0A 2VXWA 1QT9A 4EQOA 2H4OA 3DM1A 3SFEB 2VUMB 4YSZB 1GJXA 2WXRA 2ZXPA 2LY7A 3D6CA 5KNBA 1FFVA 2AQ2B 5G3LD 1CA6A 4K8JA 2RSNA 3I72A 2E3TA 1LTSD 3SDZA 3GQBA 4MN3A 3AEEB 3P4SB 2BS2B 3BDOA 3PZ8A 1STNA 2EZVA 4DN4M 4RGTA 2E6XA 1ZXTA 2BA0A 3AV8A 2INNE 2IJ0A 3IFDA 5M5XB 5ELBA 2B2YC 3NXWA 5E1FA 1TWFB 2FFKB 3W1SA 4K2KA 3FC4A 2I07B 2QILA 1B44D 2AUKA 5LNK1 1I4QA 2KECA 1U4MA 1RTOA 1ROEA 1AWDA 1KDBA 2PMZB 1F9PA 3ONAB 2LMCA 2EYFA 2EY5A 1HTLD 3HGBA 2MJ3A 5M3MB 4OVZA 1GUTA 1QG7A 1PRTB 2F0PA 3QOLA 1RHPA 1VLBA 1L5PA 1QJOA 4E6IA 1Y69U 2OHFA 1WCMB 2ON8A 2L5TA 1QKZA 2V3PA 4NJCA 1N63A 3TZUA 1B2TA 2K0PA 1WTOA 2AX5A 2XNAC 2WV6D 4ME5A 4N58A 2L83A 3SVMA 3ETRA 5JPNC 1G6ZA 1ZDXA 5BMIA 1RWSA 3GV6A 3HOWB 2INPE 4O1NA 3BG3A 1MSHA 2F0UA 3K5OA 2D9UA 2F0MA 2K1BA 3TEWA 2FUG1 3D6WA 1DZ1A 5K5PA 4G7OC 1IYUA 4XT3B 1WGKA 5IIFA 2F0QA 3G6JB 4OO1G 2BB5A 1YNTE 3FKIB 2I38A 1A15A 2BS4B 2FINB 1TS2A 1SE3A 1EM7A 1YQ3B 1BQQT 5AUIA 1TVXA 4O42A 3TP5A 3NTHA 4GLSC 4WIPA 1C48A 1DM0B 1TKWB 2SNSA 1WTVA 4YT0B 1FEHA 3VRBB 4XQQA 1B4OA 4R3DA 2EELA 1MBYA 1PFBA 2L32A 1NR2A 2O5JC 1D5MC 4JX1C 1Q1EA 1JICA 5ELCA 4IUTA 5K36H 1FIQA 3BK2A 1L4DB 1FNUA 5J22A 1BCPD 3LX0A 3TBIB 1U9RA 1W6KA 2VZKD 1SNPA 1BCPB 5CYUA 1MI0A 3AEFB 1S5CD 4LMQD 1OQQA 1AP0A 2RDGA 3J81L 3Q23A 2VZKB 1KLUD 3AM9A 2F3WA 3RPFC 2FMCA 3I8ZA 1SMYD 4M8AA 3H3VC 4R8NA 3RD4A 4H2AA 1OQRA 1L6UA 4FYDA 4FO2A 4KY5A 4KKJA 1OXUA 4S3SA 4BWGB 5JVG3 4U68A 2WLBA 3U7ZA 2B39A 1B9MA 1HQMC 2MHVA 3MFGA 3VYUA 1CA5A 2WP9B 4N9TA 1LTBD 1XLOA 3KLSX 3CU7A 1CTMA 1SE2A 1ENFA 3OIPA 1TWGB 3GO5A 3TP6A 5C5MA 3MJ5A 3JAML 1NI3A 3SK5A 2EVBA 3O13A 1PGAA 2LKVA 1E7PB 4A6QA 3TDQA 2PMVA 1EFID 1IBXB 2GB1A 1EU3A 1QOFA 3HG9A 5HI1A 4ZLTF 2FBWB 3NZ3A 3T3OA 3BVGA 2ZT9C 3A55A 1AFPA 3RUZA 3ZJUA 3PUWA 1TKYA 3CKIB 1MSGA 5D65A 1EYDA 3SK4A 3NBIA 4KN7C 5KNDA 5C5LA 2M0AA 1ONLA 4L63B 1FR3A 3PUXA 1I4HA 5LHY1 4H44C 3VR6A 2E75C 5CR3A 1CZPA 5EE9A 1NSNS 3KLSA 1QOAA 2PYKA 1DGJA 4KJOA 3C8YA 4CHTB 2CJNA 2VB2X 4LK1C 5J1ZA 1WTPA 3DXJC 4YSXB 4I65A 2RMMA 1N62A 3RMHA 3AE9B 2QSDA 4A3FB 3NTKA 4RKBA 1A3VA 1Y8PB 2O4XA 2WP8J 4C80A 1Y1WB 4KX6B 3CWIA 1IHZA 2F0TA 4TQ1A 2WXFA 1N5XA 1EY0A 1NAPA 2MUYA 4A8XC 1BUIC 5JXVA 1BUVT 4CKEA 4F88A 3IAYA 5I6YA 1F9RA 2OXPA 2OEOA 1VMPA 3P4RB 1SYDA 2JA8B 3D4RA 4K14A 2DYOA 2PZWA 5EKLA 2WKCA 3RLFA 2Z8LA 3AE2B 1XYIA 4DA2A 4HEDA 1I4GA 2GA4B 3QWNA 2SAKA 4IURA 1QLBB 4WH4A 1BBXC 2EY2A 4OO1H 3PMFA 2XIWA 4HROA 1DOKA 4B08A 1XXGA 4IFDI 5BMHA 1AZQA 2QJLA 1Q90A 1I50B 5COYA 3K58A 3B9JA 5BN5A 2Z4IA 4CGYB 1LT6D 1Q12A 1STYA 2BA1A 4PQXA 1YJIA 2WIIB 4QF4A 3K57A 5FOBB 2A5HA 2ICEC 4TQUS 3DWAA 3LYYA 5C0XG 1IW7D 1VF5C 3FPUB 1MD2D 1EWYC 5C4ZA 5IODA 3TUOA 2CVRA 4REZA 3NE5B 5CV9A 4FVMA 2NTTA 4M1UB 5EKIA 3AE5B 2KEDA 1JROA 1A2UA 1IGDA 1XLNA 1IKLA 5CMDA 3DWGC 1ZYRD 3R93A 4ZRPA 2D2CC 3K0YA 2BE5D 1ENCA 4R8IA 4J6HA 1DOYA 5IOCA 3HOYB 2Y5PA 1E6EB 4C3HG 4KI0A 4DQOC 4TRDA 1ET9A 1QOHA 5CV5A 4FF2A 2KWDA 3MHZA 4M0WA 4F7XA 3Q69A 3Q8EA 4L6TB 2SEBD 1HCZA 5ELEA 4XQNA 1XTCD 1PTOF 4L8JA 1QNKA 3OPOA 4ZHPA 3RFZB 1XO3A 2QEJC 1I4RA 4XT1B 1C79A 5AUKA 1IL8A 1Y56A 3BZDB 2IX1A 3R2TA 2JSOA 1RYJA 3I3CA 4KY6A 4DXGA 4K6DA 3A7LA 3J81E 2EYJA 1HXYD 2JYTA 1LLRD 3UI2A 1NUCA 1G91A 4AYBB 5BN4A 3J7AV 2VNUD 4HMIA 4WJWA 2KN4A 5IGFA 4L2YA 3A8JE 3SFDB 2DN8A 1NYQA 1ZPSA 2L1BA 1E0BA 2CW0C 2K5QA 3I4MB 2B76B 5G5GA 1B9NA 1DOLA 1L0XB 1EY8A 2J42A 5FKAC 3WOEA 2PZTA 1ZOYB 1TS3A 4XDXA 1IUEA 4QUFA 2WDQB 2DNEA 2MJEA 4Y7NB 1HZ5A 2QF7A 4RA8A 3JAME 1WRIA 3VRAB 5CV6A 1PTOD 3TEZA 2A6ED 1ENAA 3HRZC 3LWEA 2N0SB 2F4IA 5EE0A 3LB8C 2E2HB 1ESRA 3GV3A 5C4JB 3I90A 1HA6A 2AUJD 1E10A 4IFDH 3MXNA 3SE0A 2N88A 4LK0M 3BDLA 1UWMA 3T16A 3E6ZX 4X3KA 1UUPA 5C6AA 4WFN3 3BS1A 2LS01 1ZUD2 4A9AA 1D5ZC 4PNYA 2ZW0A 4YTNB 4RNAA 1Q10A 2Z1CA 4YSYB 4QMGA 1EQTA 5CV7A 5EBDA 1F2RC 2H88B 4C3JB 4OW0A 4MHEA 2AQ3B 2XN9C 1FRRA 5KYIA 1RCVD 2JWUA 2RVLA 3T13A 4G57A 1K83B 3AEBB 1T5XD 3MVVA 3IT6B 4KK7A 2N9KA 1H9RA 1UNSA 2BT6A 5HFYA 5JVH3 1OFFA 3MFYA 1P7FA 4K5WA 2WXJA 1LT5D 3IFTA 4XQJA 2NYZD 4IUUA 5DAUA 3L4PA 4WRDA 3M4OB 1YN3A 2KVMA 3HP3A 3ND9A 2F0EA 4ZRZA 4ZK9B 1GHKA 2X6LA 1EL0A 2HDLA 4Q0FA 1PFNA 2W3SA 1XLQA 4UDUC 4ZUIA 5JEAJ 3M4YA 1C4CA 1JR0D 4X3TA 1SNQA 4KGSA 2DY8A 3BK1A 3FILA 3NQIA 5I9OA 3AE8B 3BVMA 2B2YA 1EQVA 1EOTA 4P16A 3MA2B 1ILQA 2A6HC 5ISRA 2DWQA 4GZYC 5K36G 1E0ZA 5C0XH 4N59A 3GTGB 1QNUA 2BW2A 4DK1A 1KH0A 4IUPA 3M85A 1JW9D 1W6JA 1QF6A 1PYWD 3FEWX 3NVYA 4XDDA 1JE4A 4K6LA 1GUOA 3CQZB 4LJZC 1WD0A 4XXEA 4J8QA 4KKUA 2MJ8A 2F0LA 4B9XA 3CHBD 1STEA 1EY9A 4H7BA 4IQZA 3VR5A 2KJXA 1K53A 5M3FB 3H91A 1CT1D 3TZDA 5EPJA 1KAAA 3PO2B 4G7ZC 2PZUA 1EIGA 1F9QA 5KIXA 3VYRA 2FHTA 1ZKOA 4RGNA 2B2UC 2E2DC 1OXSC 2KQ3A 4KD4A 2L9HA 2HUGA 5KRUA 3KK7A 4A3EB 4CJ0B 3K5LA 2SOBA 1TWHB 2LUMA 1X3QA 3B2FA 2DLBA 1RTNA 2JSVX 1PRTC 3H0GB 1O80A 1V1PA 2J52A 3A56A 1SDFA 1STAA 2JEAI 2V4DA 1TWCB 1CM9A 5LL6X 3EROA 3HOZB 2PTLA 3ZQ4A 4DU9A 3VR9B 1C4AA 3EUB2 1LTAD 2WXHA 2D62A 2XWJB 2RDFA 1YN5A 4K2LA 3KLRA 2KCCA 4Z9CB 1TQOA 1HUMA 4F87A 5EPKA 3B2GA 1SNOA 1Y8NB 4J3OD 2G1EA 2IGGA 3C3LA 4ZHOA 2EYHA 2YYZA 1ACCA 1DONA 1STGA 1YN4A 3CRKC 4TMAB 1A3UA 2G9DA 4HKQA 2LFNA 2V4IB 1WTWA 2ENBA 1KDAA 3QJYA 3Q8FA 4EE2A 3T4AC 1NYRA 3NTIA 2WB1B 4JPSA 2EDGA 1DYQA 2W82A 3SK8A 1SSOA 1AZPA 1H9KA 2Z4HA 2R93B 2F03A 1PZKD 5M5YB 1FXAA 3HOUB 4ZYSA 3UI3A 3OWEB 1JC7A 2K28A 2RBMA 3R2IA 2MH7A 1WTXA 4CJ1B 2PNRC 1WSPA 4FF3A 3ZGZA 2EYPA 4USAA 1BCPC 1TS4A 5ELFA 1XWEA 1F0ZA 1LTRD 4BBSB 5FK9C 1JQYD 4FF4A 3SHLA 2LHEA 2QIEB 1OXTA 4KTAA 4ARIA 2BYTA 3I4LA 1TU2B 2SDFA 1U4PA 1D4BA 1PFMA 1MPEA 5KNCA 1PUTA 3PZ7A 1D1IA 1SMYC 1B9RA 2M19A 3MTSA 1IGCA 3V2TA 5EKKA 2NB0A 4GDLB 2X38A 4DAVA 1LT4D 3E56A 3P75A 2A69D 3NUHB 1GUNA 1S5DD 2IX3A 2PW9A 3VYSA 2EYOA 2WXLA 1T5EA 3I73A 1H9SA 1LTTD 2E2JB 1B1ZA 1VCIA 3GS2A 3GTKB 2K33A 4IUNA 4IUQA 1FD6A 1HFGA 2R7ZB 4ZOHC 3EJIA 4IDIA 2B2VC 3PUVA 4RHSA 1HPCA 1UAPA 4RF0A 5FLXL 2JZPA 2JEBI 1A3TA 2LHDA 3FPPA 4FNFA 4U673 5T1IA 3R3OA 1L6VA 4FXDA 1C76A 1TJEA 2LMCB 2BBCA 2B63B 2BTEA 1BMLC 1CHQD 3TN2A 3MHBA 5IT9E 3W5UB 2A73B 1MGSA 1SE4A 3MWYW 2HDEA 2L1AA 1O78A 3NWSA 4V0BA 2JA6B 1Z7TA 1YNND 5KYLA 4KGTA 1JQ4A 5CV4A 2L52A 3TP7A 3SK6A 3NWTA 1BNZA 1VZ8A 2RDHA 4ID6A 4Q2JA 1OXXK 2HCIA 4PV1C 3GTPB 5C3JB 3U9OA 1C77A 1ICWA 2D5GA 3AECB 2M2LA 1V97A 4G7HC 4P2CB 4C3IB 5C4XB 4WORA 3TEXA 2JXMB 4IOIE 4RGMA 3I57A 3L9AX 3IAS1 3MAQA 4XDCA 1C8CA 5C2TB 1KRHA 5GXGB 4JWSC 1OXVA 3NPPA 1U4LA 3Q8CA 3S1RB 3W5VB 1TKEA 1ZXHA 2MP1A 1NEKB 3OWFA 2FJ2A 4IFDG 2K03A 1UGJA 1HTPA 2K5WA 5KGUA 1SEBD 3VR4A 2BCOA 3GTMB 3A8KE 3P4QB 2E76C 4WWMA 3BYYB 1E2WA 1EEID 3A8IE 2IGHA 1ET6A 2W55A 4RWSC 1VR9A 4A3KB 3NVVA 4ODGA 2K5PA 1I6VC 1YJJA 4D2KA 5LL6S 4AS1A 2NVTB 5IGEA 3D3RA 2ONQA 3VQIA 2WXQA 5A35A 1GPXA 1AYFA 1SYBA 1ILPA 1SIJA 3FAHA 1JCKB 4NZLB 1IW7C 1UEAB 3P20A 2X6GA 2GI9A 1C4PA 3I91A 4L23A 4MT5A 3SEBA 1NCVA 4MIUA 4HR7B 4KGRA 2XRQD 1EY4A 1GUSA 3AMUA 1MHHE 4OL7A 2OF1A 1F9SA 2DY7A 2BE5C 3I70A 5CV8A 1VRAB 3MXUA 4B9WA 2L11A 3AU7A 4NW2A 4EVOA 1GB1A 4KKTA 3AE3B 3P42A 3HVZA 4JE3B 2KCNA 1KFYB 2F0NA 3X3NA 3P1HA 2C9OA 1YNJD 4A3JB 1FXIA 1LO5D 2BDOA 3PUYA 1CJEA 2JU6X 1TY2A 4IN3A 3PIO3 2EOTA 1PLFA 1DXMA 1PXUA 2M56B 1GXDC 2PQEA 4N6EB 2Q8TA 3QO2A 1XEEA 3QOJA 3MP9A 3NP8A 2VB3X 5C4HA 1S5BD 4LLGM 5JEAG 4NDXA 1JWBD 2EE1A 2K6AA 2PW7A 4HMJA 2AQ1B 2NN6I 4OIJA 4ZKCB 5NUCA 2LJIA 2CHBD 3EVQA 4OHJA 4FXGC 1TR5A 1WVLA 3DWPA 1ZP0B 4HAEA 2NUCA 2L0CA 1QILA 1PDQA 2A6EC 2D5DA 3D4WA 4HRSA 3H8HA 2ZW1A 3W3AA 1JWUD 1EEFD 2KDMA 5FLXE 1MVKA 3IXSA 1BR9A 5BYRA 1M4VA 3W9CB 1GUWA 4HEA1 4ZAIA 1HHVA 1V8CA 3WCQA 5F2DA 4BBRB 1S5ED 1Z6HA 3FRPB 1PTOB 2NTSA 4ZQ3A 1K8OA 1HEZE 1Z47A 1PMRA 4A93B 3I4NB 2M00A 2TMPA 1KNAA 1KDCA 3ITPA 1STHA 3S9WA 4ZKBB 3D31A 5DM73 3M3YB 2TSSA 3TMEA 2EJMA 3IL8A 2A68D 2IGDA 3M7NA 1J8IA 2YU9B 3P4PB 2RA4A 4CKCA 1EWHA 1WD1A 1R7SA 4HN7A 5HURA 3U4EG 1G8ZD 3Q24A 3EQLC 1EWCA 2PPBC 3KQ4A 2YEPF 4G4KA 2B2UA 2IW3A 4A3MB 1IYVA 1SXTA 5EE1A 1SJED 1QWYA 1TWAB 5HHDG 4NMZA 4XTCS 2EKIA 1SAPA 4GDKB 4YWGG 2WXIA 2WXNA 2BDNA 2F3VA 2F0JA 3E9SA 4MH8A 2Q8RE 4A3DB 3KWVA 2L55A 1RODA 3I9V1 3NHHA 3H6MA 2CQAA 3P63A 4H0LC 1JOQA 1LTGD 1Q8IA 4C7YA 2RKSA 5I2YA 3AH7A 4B0MA 2F0DA 1QE6A 3E0JA 5C44B 3VA5A 3P1MA 1WXQA 2J53A 3IKJA 1HUNA 2FE8A 4QCLA 1FD7D 1VZ6A 3GTOB 2Q5WD 2QMTA 3T56B 3VA7A 1X32A 2DNCA 4OGQC 3DMUA 4BS9A 3Q22A 3S1MB 3S15B 4RGOS 2H89B 5C3WA 1KF6B 5IT9L 3QG1A 1ZEQX 1ZE3D 3URYA 1SNMA 3OIQA 1TT2A 4RHRA 2Y5CA 5TSSA 2NMQA 5HG2A 4ZUJA 2O2LD 1LTID 3SXHA 3AMZA 5BYSA 2F0HA 4DFAA 4KN4C 4DGZA 2IT1A 3NQTA 4OIKA 5D3IB 4KHZA 2R3ZA 4XIGS 1EZ8A 5C3XA 1K51A 3ZJVA 5I2XA 3HOXB 5JEAH 5JOBA 3AE1B 3PO0A 4WAFA 1WTRA 2R61A 2ACZB 1PRTF 1F2YA 1CI3M 3OHXC 3K5MA 3CIRB 1RM6C 2WNMA 1S5FD 4K5XA 3DEOA 5EQ0A 4US8A 4JBWA 4JWUC 5DM63 1C9FA 4QIWB 2QDBA 2BB6A 2A74C 5D14A 2N7JA 4C7ZA 3VR3A 1JWAD 1PTOH 1I3QB 2J7ZA 3KF8A 1ML0D 3WDNA 2K01A 1J7BA 3AEDB 3T53B 3X3MA 4YTMB 3Q6SA 2K05A 4XWWA 1SBBB 1HRJA 2KQ4X 5H8YE 2B2WA 1RFKA 1SYFA 3VR2A 1RJTA 4FF1A 4C56C 1E2ZA 2JA7B 3AE7B 4CQNA 1FYCA 1X3PA 2EY6A 5BN3A 1GAQB 1FO4A 3V96A 2QKIC 2JYOA 1K52A 2B2TC 3IT4B 1PRTD 3MC0B 1QOBA 4WURA 1D6EC 4PMBA 5I6WA 2ICIA 1BDOA 1PZJD 3DEPA 3SR6A 1B3AA 3K5NA 1G2SA 5H92C 1IBXA 3HEJA 5EPLA 2Y3AA 3FILB 2ZXOA 2B2VA 5ELDA 1D2BA 2Q8IB 3QIAA 4MACA 2EXZA 1JWSD 3V3XA 4CBVA 3TP8A 3ERQA 1UWXA 4DK0A 3PIP3 5IGDA 1EYCA 5DEHA 3GTJB 2DBYA 2LGIA 1EY5A 2LEKA 3J80L 4XWTA 2L4NA 1BCPF 2JA5B 4PMWA 3BDCA 1MHXA 2PVGC 2F0FA 4EQPA 2Y0SB 1GUGA 1QCBD 1F2MA 1L4ZB 1FNVA 4RKLA 3E5SA 1VF7A 3KUPA 4PMCA 5D7GA 2WDRB 2A69C 4OZCA 2WAQB 1T3QA 3LXFA 3K6OA 2F0VA 1MI2A 4HKZE 4ULLA 1OO9B 5HGTA 1QB5D 3VR8B 2B2WC 1EU4A 2N9LA 5BMGA 1I7HA 2C5CA 3S16B 1C4QA 1VZ7A 1N60A 1TZOA 1A2TA 3N9YC 3G7LA 1A6XA 3C1EA 2WXOA 1Q3LA 2AWOA 3BYTB 3Q0AA 4K8IA 2F0GA 2WU5B 2KOLA 2PW5A 4RCNA 1PDXA 5BYQA 4LTUA 4HCEA 1FFUA 3A7AB 1JOKA 2EJGC 2PLPA 1V1PB 5EGTA 2GRIA 2XWBB 3AN1A 2EY1A 1HA5A 1SYGA 1YNNC 4OZAA 2WXPA 1EY7A 3K7AB 1R9TB 1BOSA 3LWUA 1SYCA 4I7ZC 4OO1I 1NVID 2K22A 3ZYYX 1GB4A 5FO8B 2B8FA 5E4XA 2NVXB 1STBA 1CHPD 1DD2A 4FP5D 4DAYA 4F8MA 3V05A 4ITKA 3PV0A 4IZ8A 3AB5A 4C3IG 2K5DA 3DUZA 1V1OA 1DCZA 1YQ4B 1GHJA 4FXKC 5I4DA 1Y8OB 5JJZA 1WTQA 4NP5A 3FVQA 2O5IC 5D3DA 3D8GA 5EE3A 3M7GA 1EY6A 5FR3A 2F0KA 4ARCA 3HKZB 4YTPB 2XVSA 1RDPD 3L3OC 1HQRD 1CK1A 1E2VA 4HSPA 1ESFA 2EYLA 4BY1B 2KACA 1SSNA 3IAM1 3GP7A 2IDYA 4X3SA 2KHSA 3S1NB 3VYTA 1H9JA 3GB1A 3WOFA 5A2QE 2IL8A 3HRDD 3J9CA 1K8MA 3S2HB 2B8GA 2M9VA 4MM3B 3NVZA 2HQEA 2XSCA 1R4QB 3KBGA 5DNFA 1I4XA 3HS0C 1DJRD 3R8BA 5M5WB 1HZ6A 1QQRA 1AN8A 5FO7B 3AEAB 2MPMA 1M8AA 4BY7B 3S14B 3H09A 2MGSA 2NVQB 1PGXA 1T6BX 4NAMA 3TEYA 4RCOA 5FO9B 1HFNA 1FMAD 2CU3A 1JRPA 4KY7A 4C1NK 2R92B 4RH6A 1XCQL 4PT5A 4B0EA 5KEEA 3S17B 3OSOA 4CKBA 1PFDA 1BO0A 2KEEA 3AEGB 1ZDVA 5EJWA 5C3EB 2H1EA 1BXTA 4C2MB 1LACA 1TS5A 1G291 2W54A 2JXTA 3J7AF 5IGBA 4KMUC 3U2SC 3KWLA 2QCPX 1JORA 1J7CA 1NENB 5JAVA 3T51B 1Q1BA 1SF0A 3GD7A 1H9SB 3HVDA 1DOIA 1EYAA 1H9MA 1U4RA 1FCLA 4TQ0A 4HJGE 3ABVB 3AE6B 3D4DA 3F2UA 4KHVA 5CBEE 3NVWA 1YNJC 2KA7A 1BF4A 1V8QA 1ZYRC 2NWGA 1FM0D 3C46A 3MZ5A 3NK9A 4C1NI 4KKSA 2RPVA 1GOZA 2JQRB 1VDVA 2HDMA 5CORA 3J80E 2PO4A 2F0IA 2NN6G 3W2DA 4H13C 4BA2I 1XCTL 1VMCA 2PIAA 4DNRB 3QB3A 4P6VF 3FMCA 1PGBA 3HUIA 2IPKD 2AWNA 1J9OA 2KUMA 1PZID 1FCCC 2G9HD 5T1GA 1ZXIA 3HZXA 2F1MA 1KABA 4YXDB 1JB3A 4EQNA 2WXMA 1LV9A 5E3FA 4TKOB 1JMLA 1YMHE 2XRSD 3DWMA 2F0WA 3AE4B 3NSWA 2K32A 1NR4A 3L7ZC 1RD9D 1CQVA 1F2LA 2E74C 1N5WA 4R9WA 2RSOA 1N61A 1QOGA 3RZOB 4US9A 1C78A 1SNDA 4BA1I 1TKGA 3N6RA 5CBAE 2N55A 5E4WC 3OMGA 5E6JA 4N9PA 2W3RA 2E2IB 4XYOA 3N52A 3H94A 2IWHA 3RZDB 4IFDJ 1J7AA 1FRDA 3S2DB 2BOSA 1JOOA 1PTOC 1IKMA 4HSVA 2JYEA 5J39A 5C0XI 1CFMA 4Q5VA 4XE0A 5T8IA 4QUCA 4K5VA 5G5HA 3Q8AA 3GTQB 4DNTB 1VDZA 3BIID 3TSSA 4C3HB 1K50A 4L1BA 2V3NA 2OEDA 4KJNA 2EJFC 3MEHA 2K3UA 4WQMA 4TSSA 3A54A 4RF1A 3KBXA 4IUVA 5M9OA 1TYGB 1O7LA 2WACA 1II3A 2A68C 4C3JG 2WQYB 2HTME 4IALA 2J4XA 4A90A 2JX5A 2SNMA 3PUZA 2OT2A 2I2YA 3DWQA 3MXPA 2KAJA 4X3UA 4AQ7A 1AEXA 1JWMD 4J1MA 1XF5L 5EBCA 4LAAA 1I6HB 1TIID 1CZWA 1DOMA 2BS3B 1CZGA 1XX8A 4JK1C 1D1KA 5IGCA 4ILWA 1SFOB 3NS1A 3C1FA 2HCCA 2CW0D 3U9SA 5AFWA 2K04A 2PKOA 1L0VB 1I4PA 4NKLA 4YIJA 4HCSA 3DHQA 5MPOA 1Y1VB 5C0XJ 3PO3B 1P7EA 2WU2B 2R6GA 4ABNA 1F2ZA 3K59A 4FXCA 1FNWA 1VJKA 1L0YB 3NRZA 2WKDA 3J7YW 4KV6A 3U52E 2FMMA 2CJOA 5JPMC 1XLPA 1O7ZA 4HTHA 1EIHA 2V0GA 1RKNA 1SJHD 2NZ1D 3FDTA 4DXFA 2J0TD 2JE6I 3EFXD 4XYQA 2F0OA 4OZBA 1WYGA 5CGKA 3P7JA 2EYMA 5IGGA 4NAWB 2L12A 4KD3A 1D5XC 2LFIA 2NVYB 2MEKA