1ET9A

Crystal structure of the superantigen spe-h from streptococcus pyogenes
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
195
Chain Sequence
b'NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKNLSVFFEKDWISQEFKDKEVDIYALSAQERYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPERANTIGEN SPE-H
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 56
structure length 195
sequence length 204
ec nomenclature
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1et9A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1et9A01
1TS2A 4O1NA 3GP7A 1RDPD 1B1ZA 5ELEA 4RHRA 1EEFD 4C56C 1KLUD 1RF2D 1MD2D 1M4VA 2AQ2B 1SE2A 4TSSA 1B44D 3EFXD 1LTBD 1LO5D 1LT6D 1TS5A 1LTSD 1LTID 1AN8A 1S5FD 1BCPC 1EEID 1PRTB 1UNSA 3URYA 1HA5A 4RHSA 1JWUD 1BCPF 3KLSX 1QILA 1PRTF 1D5XC 2RDGA 2NTSA 2XNAC 1PZKD 5D3IB 1FNWA 2XN9C 1BXTA 1FNVA 4NZLB 1CK1A 1CT1D 2IPKD 3SEBA 1V1OA 1EFID 4DXFA 1KLGD 1SE4A 1JWMD 1FNUA 3BYYB 2R61A 5FKAC 4RGTA 1YN4A 1LLRD 1I4GA 1PYWD 1JR0D 1BCPD 1G8ZD 1S5CD 1PTOB 4RGNA 1L0XB 3MC0B 4RGMA 5ELFA 2O2LD 1LT5D 1PZJD 4K6LA 3EA6A 1JQYD 4DXGA 1PRTC 1GOZA 5ELCA 1PTOF 1S5BD 1S5ED 1SE3A 4UDUC 3O13A 2IJ0A 1JWSD 4RCOA 1TY0A 1XTCD 2J4XA 3BVMA 3CHBD 2ICIA 4OHJA 1I4HA 1XXGA 1TS4A 3DWQA 1EU3A 4ZYSA 5ELBA 1TY2A 1JCKB 3BVGA 1I4XA 2NTTA 1D5ZC 1KTKA 1CHPD 1SEBD 2CHBD 1ESFA 2Z8LA 1LT4D 1PTOC 1PRTD 2AQ1B 3MFGA 2RDHA 3OWEB 1HQRD 2AQ3B 3R2IA 1YN5A 1LTAD 1SXTA 1TS3A 1FD7D 1PTOH 4L6TB 1V1PB 1LTTD 2SEBD 3BVZA 1V1PA 1EWCA 1L0YB 1HTLD 3R2TA 1ET9A 1STEA 1RD9D 1DJRD 5I4DA 1ET6A 2XRQD 1UUPA 1I4RA 1SJHD 3DWAA 3BZDB 3BYTB 2G9HD 3TSSA 1T5XD 1EU4A 1D5MC 1LTRD 2QEJC 1PTOD 1RCVD 4L63B 5D3DA 5ELDA 1SJED 5FK9C 1BCPB 5TSSA 1PZID 4BWGB 1YN3A 2WV6D 1CQVA 1D6EC 1F77A 2TSSA 4Z9CB 4RFBA 1ENFA 3W2DA 2QILA 1I4PA 1LTGD 1HXYD 3DWPA 1DYQA 1LT3D 4RH6A 1SBBB 1CHQD 4RGOS 2XRSD 3V05A 3R8BA 1I4QA 1AW7A 1FGBD 1S5DD
chains in the Genus database with same CATH superfamily
3IVFA 2G1EA 3RI7C 1WGDA 2K32A 3GDEA 2WLBA 1OXXK 4JI7L 1YMHE 4HROA 5C0XH 4CKCA 5JPMC 2CS4A 1KLUD 1NR4A 2D62A 3T1YQ 1SMXA 2K5DA 1MD2D 3U58A 1F1HA 3R7QA 3ZUNA 4HN7A 3VTUA 3PO3G 1QVGA 5H92C 1TS5A 2K5QA 2IY1B 4PYZA 1YX6B 2GA4B 1G2SA 5IOCA 1CFMA 2C5LC 3W9CB 2BT6A 2DLBA 5J17A 4DV0Q 1X32A 3T16A 2YTXA 1HNWL 1BNZA 1GUTA 3T1HL 2O5JC 4X6AH 1E8YA 3HZXA 4XDXA 4NPNA 1OGWA 1Q46A 2N9LA 2BTEA 3S2HB 4MELA 3CMAA 2K5PA 1JT8A 2KDFB 3EIVA 4K81A 4JWSC 1E1OA 4A3PA 1KLGD 5C1ZA 3T13A 3SR1A 4IG7B 2LMCA 3SE0A 4I65A 1YQ4B 1VQGA 5JPNC 3VFKA 3OLMD 4R8IA 3PPAA 4DV3Q 4LF6L 1BUIC 2EZVA 2E2HH 4QJFA 2B2WA 4JI1Q 3S17B 3KDFB 3QJYA 4IUTA 2V3SA 3UIPB 3APDA 2PPBC 1SE3A 2NZHA 3J7ZC 4GB9A 3IRBA 4OVZA 4EQNA 3PO2G 1HA6A 1H9SB 5DLQE 4ICVA 3WAPA 1F9RA 3S17H 1J7BA 1XLOA 4AYBE 1OXVA 1I7HA 2F0DA 1R4MB 1IXRA 1HR0Q 1UWXA 2FE8A 3KUZA 1B3QA 4ZYSA 3CCEA 2JSVX 1UEAB 4KKJA 2G9DA 1GJZA 3CW2C 3H0GB 3PLVA 4S3SA 3SHLA 1H8CA 4DUZL 1KTKA 2W55A 4C80A 3TEWA 1CHPD 1E6EB 1YITA 1FPYA 4ZDVA 1RFKA 3GTLH 1ZE3D 4LFBQ 4OEMB 4TMAB 3MFGA 3KW5B 2PTLA 3BDCA 2DNFA 2B2YA 4M8MA 4TQUS 4S17A 4LWCA 3DHQA 3RZWC 2OT2A 4LK0M 3I3CA 3I4MG 3QC8B 3ZDMC 3M4YA 5HGTA 1OQQA 1X6OA 2AL3A 1K53A 3HOZB 2BGFA 3ZXVA 4NNJB 4ICUA 2K5WA 1RM6C 4FULA 2F0GA 5D6JB 5BYRA 3GTOB 2M0XA 2HJ8A 4ZRZA 1B9NA 4JBJA 4OVUA 1SIJA 1EWYC 4HTHA 1WXMA 2DZKA 1K51A 1B9RA 3GTJB 4FF3A 2G9HD 4DR5L 3TBLD 3H94A 4A3DB 4OO1I 1VDVA 1WZ0A 3TSSA 4JI2L 4RF0A 2BA0A 3Q24A 1N33Q 4QF4A 3L0WB 3MEHA 1WGYA 1X3PA 3PMFA 3FPPA 5FR6A 3JC66 5C0XJ 2EQSA 1IYVA 1SB3C 4G3XB 3NVWA 1XMOL 3MTSA 1F2YA 4RH6A 1LQBA 4L8JA 1C4CA 2KT7A 3KJPA 1HZBA 2XK5B 3LXFA 1FGBD 2F3WA 1TS2A 4MGIE 2FMMA 1WRIA 4BA1I 4QAYA 2ZTCA 3KQ4A 4WJNA 4HIOA 5EDSA 2WXOA 2WKCA 4P1BC 1VF5C 2ZXRA 3CWIA 3GTMH 2LRUA 3GTPB 5JOBA 1LTBD 2L11A 1A62A 1V81A 2VH1A 1Q1BA 2HDLA 3TEXA 5IGEA 3VYUA 1LTID 1S5FD 1YNND 3NHEB 5L95C 3AH7A 2Q2HA 1MSGA 1QLBB 2BE5D 4N9PA 3PQIA 2JA7G 1XNRL 4BY1B 1A70A 1SF0A 4BBSB 4X62L 4AOFA 1FD6A 1FCLA 3KUPA 2I2YA 4V0BA 3S1MB 4DNIA 2KJXA 1WJNA 1WF9A 5FLXL 1EWIA 4GZYC 2CFMA 2F0TA 3E9HA 5FJ8H 1BXTA 4KIKB 2UU7A 4ZRIA 5C3JB 5CGKA 2VQFQ 3S1MH 1KXLA 2KN4A 4K7SA 3BYYB 1L1OC 5FKAC 4P1CC 4RGTA 1BBUA 3ERQA 2J42A 4MDKE 1H9MA 1V9PA 3B6YA 4H7BA 1PYWD 2BDNA 4O42A 1BCPD 3MC0B 4C3JG 1ML0D 2N3SA 3BJUA 4DV7L 1WRDB 5IT9E 1E90A 2GBJA 4A9AA 1H4RA 4IFDG 3RNEC 3VRAB 2HQLA 3BZCA 4QB4A 4HPMB 3QJZA 2KXJA 1WGHA 2N7EA 4EQPA 1WM3A 2Y0SB 2F0OA 4PG3A 4RCOA 4FO2A 4U68A 2Q5WD 2BH2A 3GZNI 4IM0A 1IP9A 1GUWA 3WANA 1KAWA 5IGFA 3OJ4B 2K7VA 2B3GA 4JYAQ 2ZW1A 4TV3A 3HK0A 1MJDA 1CKMA 2HTME 2A68D 3A7AB 1JWBD 2WGSA 2WINB 1XJVA 4JI3L 4A3LH 2F0LA 3IL8A 5C2TB 4ZYNA 2QC8A 1D5ZC 4GN5A 4CYEA 4YL8A 4LF7L 2LUEA 2F4VQ 1Q86C 3D3RA 4LF4Q 1TIFA 3H7PB 4A20A 3EHVA 1SXTA 1WCMH 2Z0EB 4E71A 5IGGA 4L1BA 2Z59B 1V1PB 3OHXC 4DHZB 2VUMG 1BMLC 3AE4B 1YIJA 2V4IB 5GROA 3GB1A 1ZW7A 4KKUA 1STHA 2K5VA 3CCVA 4LF9L 3ITPA 4CO7A 3FVQA 1SYGA 2MUYA 3HM6X 3AEAB 4G7OC 5A35A 1ILQA 5E4XA 3DBRI 1R4NB 5G3LF 1JB3A 2NVQB 1UD7A 4PQXA 3I4MH 1OQYA 4GGQA 4WAAA 4J6IA 2K25A 3I4LA 3QB3A 1IBXA 2CQOA 4GOPB 1N36L 4KKTA 2D0PA 1SGHA 1WX9A 4JOIA 1JC7A 3DWPA 5E6PA 1DGJA 1HFGA 4EFOA 1Y1VG 3PUVA 4MM3B 3RZFA 3AEBB 4B95A 2KEDA 1SDFA 1E2ZA 5CV9A 4QQBX 2D3AA 2LD9A 1CZPA 4KKSA 2R7ZG 4DR2L 2ENBA 3S2DH 2ZXOA 2KA7A 2I5MX 1BBXC 1M90C 4HPLB 3W1YA 1XEEA 2J0JA 4HJGE 2SNMA 3A54A 2MHJA 5AZFA 2F0KA 2KHSA 1KDBA 4ASWC 3N1ZC 2JE6I 3PUZA 4YHHL 1F9JA 3AE9B 2K3UA 1AFPA 2CCZA 4N6EB 1V80A 1MBYA 3Q2AC 4Y52H 5HY6A 1EEID 3RUZA 1MI0A 2D11A 2KMCA 3RZDB 1II3A 2MJ3A 2MBHA 2Y0SE 2MSED 3B2FA 4FDBA 2JN4A 3M4QA 4RHSA 4XTCS 2K5HA 2Y5BB 3D4DA 1D5XC 4C2MB 4IOCA 3OW7A 1FYCA 3NE5B 5AJ3L 2HHHQ 4W9LA 3U50C 2CJOA 3MHSD 1S3OA 1E7PB 1ZGUB 1YHBA 2JA6H 5C23A 3LDZE 4J1MA 2E76C 1JMLA 1ZKHA 4WWMA 5DAUA 2IGGA 1CT1D 2D5DA 1C4QA 5HGQA 3LJ3A 1E22A 4XT1B 1FNUA 3D4RA 2CKHB 1STNA 2ON8A 4AQYL 1EY8A 1LLRD 5C44B 3OG5A 4Q0FA 1U5KA 3RN9C 1S5CD 3P7JA 3K81C 5ELFA 5TR5A 1L0XB 3J7YW 3FKIB 2DZJA 4KV6A 1WE7A 4DHZE 5ELCA 1IPGA 1ENCA 4B3SL 1U0LA 2B2UA 3TQYA 1HEZE 3A33B 3L16A 4YIJA 5ISRA 3C0RB 1X3FA 5M3FG 3CC4A 4FJZA 4DR3L 5BMIA 4MH0E 3ZDTA 5BYSA 4DUYQ 4AIMA 4K5WA 3N52A 1VQJA 1EFWA 2MP2A 2WQYB 3Q3MC 5J22A 1MJEA 2K8CA 1PH7A 3LGJA 1B8AA 4HWIB 4BBRG 1QF6A 4RNAA 1FXIA 3VUWA 1D7QA 1RJTA 1C77A 4DV6L 3V96A 3I63C 3SK5A 1BQQT 4C3HG 4QY7A 2R2QA 3NS8A 4JI4Q 3WIMA 3A9KA 1A5RA 4POGA 2B8GA 1UH6A 2AQ3B 1IL2A 4R4OA 4IALA 2KACA 1K9MC 4MT5A 1WTQA 3H1UA 1KC8C 1PFDA 1TWGH 4A8XC 1T0QC 1J7CA 1Y1WB 1TWFB 3KDFA 5CORA 3EVQA 2EVBA 3GV3A 3OYYA 2Z6KC 2MP1A 4IJHA 4PMCA 1H9SA 2F3VA 2RSNA 2VQEL 1N34L 1N61A 1WH3A 1HNXQ 1ZUD2 2ZCBA 4FADA 1TWHH 1Z9FA 4JG2A 1V2YA 1CSQA 4DR1Q 2L83A 2IDYA 5J18A 1WIAA 2Q8RE 3E0EA 2ASQA 3PV0A 4BXXH 2WACA 4DA2A 1NCVA 3BINA 1N32L 1T5XD 1L0VB 2K6QA 4LNFA 1N60A 2QEJC 2OQKA 3GTQB 2I07B 1SE9A 3PUYA 4A3JB 5KHQA 2Z6BA 2KWVB 5CHVC 4Y7NB 2L15A 4CKBA 4HCEA 1N63A 2E2DC 3QOLA 3MA2B 2O6VB 3EGRA 3GTQH 1WXQA 1CI3M 3VR9B 2FFKB 4C3IG 2BKFA 1ASZA 3FP9A 1MHHE 1IW7C 2QGQA 3AFQA 4RGOS 1Q8IA 2IL8A 3R8BA 4Y7NH 5E7NA 1I50H 4XYQA 3UDIA 3KFUA 1QZEA 4MZ9A 1JJGA 2WX1A 4YSXB 4LFAQ 2LVPA 4ITKA 4DWFA 4YT0B 3DVNV 4R3DA 4JVZA 2KHIA 1Q8KA 1WJ4A 4K1RB 1V5TA 5JEAJ 1B4OA 1LM0A 5M3MH 2IT1A 5D2MB 5G55A 3NPPA 2EY6A 5IY0A 5IWAQ 5C4XG 4EQ5A 1E9MA 2PJHA 1EY0A 3CPWA 1Y69U 5FLMH 1Y1VH 1WTHA 4W9JA 1GJXA 2VS1A 3LWUA 1GUGA 1CJEA 1E0ZA 1ENAA 4OO1H 5KYLA 2OF1A 1EUJA 1L2FA 2RDGA 2VB2X 3CCSA 2X6LA 2AUJD 2JRIB 3EUB2 2K14A 4ZHPA 3HG9A 4GN4B 5EPLA 3CCMA 4IOIE 2XK5A 4JX1C 2Z9HA 2KHWB 2EDGA 2BB6A 2G4SA 1L2NA 2LMCB 2WXIA 5BMGA 2K28A 3T4AC 2JA5G 4A3CH 5BR8L 1IBLQ 3A0JA 4KY6A 2ZT9C 3RNUA 2B2WC 4A3FB 1VQNA 1WJ6A 4PYUA 3ETRA 4AJWA 2WYQA 2Q8IB 2RGFA 1GC6A 2L4NA 4A3FH 3TEZA 3I5JC 1TY0A 1JROA 1R4MI 2F0IA 1QG7A 3GOEA 2L3ZA 1I4HA 1VQ9A 2OEDA 3RFZB 1F0ZA 3DLLA 3SK8A 4G50A 4FVMA 2PMVA 4HDOA 4NJ6A 2IHEA 3TN2A 1WX8A 1CMXB 1VLBA 2FIDA 4LF8L 1ZPSA 3J80i 2LSSA 2K9XA 2DYOA 2RD0A 2UXDQ 1P7FA 1PRTD 3HKSA 1VZ7A 4GKKQ 4NXNL 4NP5A 1I6HB 5M3FH 5IP7G 3F2BA 2ZNVB 3M85A 2ZNVC 3AE3B 5E6OA 1WTRA 3P2BA 2YTYA 5JHAA 2KBNA 2J7QB 3STBC 5IT9L 5EBDA 2GMIC 3V61A 5EKLA 5KYIA 4X64Q 1UZXB 4W9KA 5AUKA 3C46A 3GZNB 1IBML 3KK7A 4LNNA 2PCFB 5D94A 1AP0A 3R7RA 1D8LA 1SN8A 3BG3A 4N59A 1FGUA 1C1YB 2DYMA 1RAXA 1I94Q 3S1QH 4HSVA 5AFWA 3D4WA 4IPDA 3P1MA 2F1MA 2KHJA 5C4ZA 2ZCCA 1KDAA 5E4WC 4KZCA 3X0WA 4JI0L 4WJQA 1ZDXA 2KMMA 1KNEA 3KBXA 4IUNA 3JAME 4EZKA 2MRPA 1ZXTA 4A3MG 3KH0A 3SGIA 3TIXA 1ACCA 1PA6A 2F3IA 2R93B 4Q2JA 1P1AA 2FINB 3KLRA 4JC0A 5M9OA 3NUHB 4F1SA 1VQCA 1EF5A 5K5PA 2Q2UA 2JYTA 3SDLC 2R93H 3W5VB 5HKHA 4XC2A 3GTGH 2QEXA 1TJEA 3ZLZA 2NN6I 2F52A 2Q2TA 1FEHA 4A3IB 4KK7A 1GHKA 2ZJDA 2B2VA 2KCNA 1FJGQ 3KJOA 5LNK1 5C3EB 1FVIA 1KAAA 3A55A 3AM9A 5C0XG 1F2MA 1CA5A 1EM7A 2A6EC 3KWVA 3FC4A 4OIJA 5C3EH 4OGQC 3PIP3 1JOKA 2LHDA 1OXUA 2WWZA 4A6QA 2I1JA 3KBGA 1T0RC 4GOCA 4F87A 4N9F4 4P7IA 2FUG1 2J53A 2LJIA 3ZTCA 2INPE 2BDOA 2DY7A 4LUVA 1KM7A 2PE9A 1BUVT 4B3MQ 1WYWB 3DCGA 2C9OA 2IWHA 3WOEA 4YWMA 3CCLA 3A9JB 3KF8B 1FNVA 2H89B 2KWUB 4EZLA 3P42A 1RYJA 4LUZA 2OHFA 3T56B 4H44C 3S15H 2N1WA 1WMHA 3FHWA 1MFWA 1JOOA 2PNRC 5JH5C 2CHXA 3KUDB 3U2SC 2REXA 5T1IA 3RMHA 5CV4A 2CHWA 3BK1A 1PTOB 4C00A 1YZ6A 2E6XA 5M5XH 4PS8A 3RLNA 2FJ2A 1NENB 1WJJA 1DD2A 3PVLA 4KGTA 2I5LX 1C0AA 4LNIA 4M8NA 3ZW3A 3VVWB 1F52A 3TMPB 4LAAA 2EYMA 1SMYC 2D2CC 2M00A 3N6RA 4EEWA 4EOYA 1VMCA 2A5UA 3UE1A 2LUMA 3QWZB 3A74A 2EKIA 1G291 1CM9A 4ZCKA 2UXBL 2FCNA 1FIQA 2MO0A 2GVBA 4OHJA 4JI1L 4EQOA 1EL0A 3U7DA 1H9JA 4DU9A 1TS4A 1WD1A 1OTCA 1OTRB 1FRDA 1J6QA 3AU7A 4CDDC 5M5YB 3E0JA 1SNMA 4HJ7A 3NTKA 3V2TA 4KHPL 3MP9A 4A3GB 3N20C 4IWOA 4MGKE 5IAAC 4CHKA 2D0OA 2MNAA 2HTHA 1PH5A 3PSIA 4YWKA 1MG4A 2KLCA 5C5MA 2Z8LA 4IUPA 1K8AC 2LXAA 2AQ1B 3K80C 1JWAD 4QGUA 3IFWB 1HPCA 1GUOA 4RMAA 4PMBA 5EGTA 2NBWB 1K83B 2BS3B 1E3PA 3QARA 1F2RI 3PHWB 3H0GG 1LTTD 2JA8B 1Q1EA 4IM2A 1SE8A 4KDLB 4HIMA 4RA8A 2QCZA 3U7ZA 3QIAA 4M0WB 3ZJTA 1CUKA 4PNYA 1ISNA 4LFCQ 2XRQD 2J0MA 2JWZA 3DQVA 1N5XA 2G5DA 1SJHD 2IO3B 2WDVB 4G0NB 3TZUA 1PGBA 1R4NI 3OTOQ 4QIWE 3B0AA 1D5MC 4L63B 1SAPA 4L5TA 2NZ1D 3G4SA 3DPDA 1IGDA 2E2IH 5C3WA 1Y8RC 1CTMA 3F1ZA 5BN5A 3NK9A 4JOIC 1AE3A 5FO8B 4ID6A 5IYCH 2OCEA 1PHJA 2AWOA 1NR2A 1I4PA 3FMCA 1HXYD 2RF4A 2DENB 3RNBC 1SBBB 3CQZB 2IZVB 4A3EH 1VQDA 1IKMA 4A3DG 2A5HA 1E8ZA 3SVMA 1Y56A 3NVZA 1ICFB 3IT4B 4X66L 4A3KB 4K3BA 4O1NA 2ZM6Q 5G3LD 1B1ZA 2MJDA 2PE6B 4C56C 1UBQA 2W3RA 3QG1A 1YHAA 3DEOA 1FFVA 1F2LA 1WTPA 1J5EQ 3M9BA 1YHQA 2NMQA 1EQTA 2N88A 4A3MH 2NVTB 1NUCA 4URKA 2ICEC 1LTLA 4ZUJA 3EN2A 1WXSA 2N4FA 1XTDA 4H02A 3NVYA 2R2OA 3VYTA 5MPOA 1OQRA 4BVUC 2HD3A 1TT5B 1B9MA 1C76A 2NPTA 2O6VA 4LW1A 1C9OA 3HKZB 3MXNA 3TEHB 3Q8DA 1UE5A 4IQZA 5JZEB 2QA4A 2X8XX 4GLAC 4IUUA 3UDFA 1EYGA 1NBFC 2WX0A 2E5LQ 4LF5L 2O5IC 2RKSA 4B3TQ 1WTXA 5LMNQ 1V49A 3NTIA 1RWSA 5FJ8G 3ML9A 2YLMA 3PCOB 1WI5A 1WTOA 2H4OA 4ZAIA 2VQFL 3D32A 1PZJD 2NBFA 4M8AA 1GNUA 4I6NB 5IP4D 1TYGB 1JQYD 3H09A 1IHZA 2FCSA 1Q12A 2B2UC 2LVOA 5T1GA 2PW7A 1KRHA 2PO4A 2Z0SA 2MP2B 1TKYA 1G6ZA 4BY7B 1ZKOA 3NRZA 4HMJA 2JYOA 4NQKE 5T8IA 2WHIA 2A69D 3OWFA 4C7YA 2VL6A 1P0RA 5CHFA 3ZJUA 1HZ9A 5EJWA 2B3AA 4OXPA 2JZZA 3Q8AA 2GBKA 2UUCQ 4JYAL 2NTTA 1UF0A 1JOQA 2L0CA 2VZKD 3S2HH 2Y0SG 3HM3A 1ESFA 3SDZA 3A9KB 5EE0A 4MH8A 3UE0A 4AP4C 1M1KC 2AMCB 3S1NB 4A3LG 4QCLA 5J2RA 1EY9A 3BU2A 1E10A 5BN4A 4PZ6A 2IO2B 1E2VA 1PDXA 4DHJD 4Q5VA 3RCZA 1R7SA 2F4VL 3TREA 1IBKQ 3W1SA 3BVZA 2I5HA 4GS3A 2WDQB 1EWCA 1HTLD 1L0YB 2LEKA 1LGRA 2UWQA 1U4PA 2R7FA 1STEA 1WCMG 4P71A 5M5WB 1NI2A 2HDEA 3DVNU 1ET6A 4K0KL 3CAMA 3HOWB 1VQ8A 4B0MA 3VYSA 2KJHB 2PI2A 4NY0A 3L08A 5DPWA 5ELDA 3RNFC 2ZJQA 5DPTA 1BCPB 4A3BB 4ZRPA 3LNNA 2NYZD 1YN3A 2J52A 2VH2A 3KYCD 3WAOA 3H0GH 3W1BA 4RFBA 4FF2A 1U4LA 3HKZE 2UXCQ 1KABA 2N78A 1D4BA 3J7A5 1ROEA 4ANVA 5C4HA 3I4NB 2KTRA 1B7YB 5CC4A 1WE6A 4I6LB 4K7WA 1WGGA 2L7RA 1AZPA 3I91A 1A6XA 1WXVA 3DBSA 2Q2IA 2YU9B 5E6NA 4ANUA 1E7UA 4JCVE 2A68C 3HOZH 2DBYA 1GO3E 1KF6B 3N1YC 2AEHA 4K2LA 1YI2A 1L7YA 1QVCA 2F0UA 1C4AA 2N9XA 3GTOH 4LJOB 3RT3B 2CW0C 2EY1A 2WP8J 3AE6B 3KWLA 1U4RA 3H9DA 3VA7A 2WXHA 3QQ8B 1ESRA 2MBQA 1XCTL 3GTJH 1KJTA 4X3SA 4JI8Q 3HVZA 3Q23A 3DEPA 5H1SE 4A3DH 4GKJL 4YSYB 1LM8B 4NAMA 4P6VF 1HA5A 2WU5B 2EIFA 3GTKB 5D65A 2L5TA 2R3ZA 5L37A 2CJNA 2NTSA 2D3BA 1JMCA 3NTHA 1FNWA 2CH4A 3JAML 2E2JB 2KECA 4ABNA 1PGXA 3C8YA 2WB1B 3KLSA 3DWGC 5JEAG 5IA7A 3U8ZA 3E5SA 2B63B 2H5XA 2HHHL 1IGCA 3QA8A 2JA6G 1RL2A 2CQAA 3K0YA 2L9HA 3VDZA 4R4QA 4DAVA 2FMCA 3U4EG 1QOBA 3VUXA 2W9NA 2IX3A 2EPBA 4S0RA 2NN6H 1NVID 4FBJB 2RHSB 1JICA 4DR7L 5G2NA 4WQOB 1HUNA 4C4VA 2WIIB 1RFAA 4P16A 1KOTA 3GTPH 2FAZA 3V3XA 1S5BD 1TR5A 2UU9Q 3M95A 5COYA 3RLOA 4JE3B 2EMSA 1SRUA 1GVPA 2D2QA 5C44G 2LXCA 2M0AA 1B53A 2BKRB 1PH1A 4XQJA 5AZGA 1XMQL 2L52A 4BY1H 2DWQA 1EU3A 1D1IA 2UUAL 4BBSH 1YD8U 4KLKA 1T0YA 3JSVA 1SYEA 3A9JA 3KF8A 4FF1A 2QDFA 4KSLC 4OX9Q 1I4XA 4W9DA 4FHJA 2WXFA 2ZJPA 2RR9A 2QF7A 4BKSD 1HZ6A 2M4NA 3M4OB 3PZ8A 3I2ZA 2UUBQ 2CU1A 5IOIA 2IX0A 3VAWA 3J9CA 4IUQA 2WU2B 3PV1A 3T9LA 5F2DA 4JI6Q 1ASYA 2LGXA 4GDLA 5CYUA 4KKIA 3RNGC 1BO0A 4ZRKA 1GHJA 3I4OA 3LB8C 2LWPA 1VQ5A 2KFKB 5CBEE 4DFAA 4IUVA 2N1VA 4KMUC 2KYWA 2ACZB 1DOLA 2M2LA 1KQSA 3ZRCA 4KSKC 1DJRD 3HRZC 1STGA 5I4DA 3K7AB 2BS4B 3OOCA 1YQBA 2EELA 1Y14B 2WFWA 3ALBA 5JVG3 4FHKA 1WTWA 5KRUA 3DWMA 2JQOA 1K8GA 3T1HQ 5IGBA 4KVGB 2F0NA 2J0TD 5KGUA 3ZVVA 3CKIB 4GLVB 1OEYA 2SOBA 1PFNA 4KY5A 4BXXG 4Z9CB 2OTJA 5E1FA 2AUKA 1X65A 1T6BX 2YVCA 2JT4B 1PYBA 3CRKC 3NJTA 4ZKBB 2WB1E 4FJVB 1TT2A 2EYHA 4QL5A 2MBBB 2V9HA 2ASBA 1F2RC 2GLSA 2Q8TA 3S16B 1AZQA 3NY5A 3VR5A 3IAYA 1STYA 5G5HA 4LF6Q 2XGTA 4DDID 4CQNA 3OIPA 4M0WA 3L3OC 3QWNA 3T3OA 3PO2B 3UGBB 3HVDA 4B3RL 4KTAA 2L00B 4LK1C 4HIKA 4LFAL 2MX2A 3K58A 2I46A 3TEYA 1YVCA 4LNQA 3HOVB 4MHEA 1WI0A 3D6WA 3HEJA 4KN4C 2BOSA 2KJRA 3HS0C 5M3MG 1A63A 2ALYB 1IL8A 3IFDA 4GOPC 3NZUA 2F0JA 1BOSA 4DAPA 1HNZL 2VB3X 4XXEA 3HOVH 1FO4A 4KHVA 2NVQH 5FLMG 1C4PA 2OXPA 2ATWA 2KO3A 4FYDA 4U673 4B0EA 3TL5A 2KKCA 1GC7A 2N0SB 4OO1G 4IO9A 2KZRA 3EROA 2IW3A 1PFMA 1VRAB 3VDYA 2RDBC 5CR3A 1X1MA 2WAQB 1FL0A 3AEDB 3MXGA 1WMHB 1XLNA 3L9AX 1V6EA 1X54A 2LRWA 1HHVA 3N9YC 1Q3LA 3PRPB 2E74C 1SSNA 2JA9A 5LMUQ 1L5PA 3PGZA 3R3OA 1EQVA 1WD0A 3JAMc 4W9GA 2ZW0A 2KENA 4DXGA 1Q81C 4W9HA 5L83A 4A3CG 1DM0B 1PTOF 4AQ7A 5A2QE 3MHBA 1IBLL 1ZOYB 2HJ1A 2G4DB 4HDQA 5IIFA 3Q6SA 2C5CA 4HEDA 4UP8A 1O7YA 4DR5Q 3PGEA 5JEAH 2CVRA 4XYOA 3RZDH 3D0FA 1QNKA 2OQ0A 1HZ5A 1KRSA 4JBKA 3CU7A 2IO0B 3QO2A 4A3FG 2JXTA 3ZO5B 3PIPA 4C2MH 4QMGA 2WXJA 1XMOQ 2L8JA 5C4JB 3AU5A 3S14B 1NBWA 2NVYB 1NJIC 1SSOA 2PZUA 3ZKJC 4ZUIA 2RDHA 3KF6A 3BDOA 1VS0A 3ZNHB 1I3QB 2NUCA 4LMQD 3A1QB 4HRSA 5C44H 3CF5A 1C78A 3I55A 2WXGA 2KOXA 1V5OA 2EKEC 4K2KA 2UXDL 3SFEB 3FKIH 5HG2A 2GVAA 5LHY1 4XGAB 1QUQA 2DHZA 4WORA 3A4SC 5LMNW 1QVFA 2JZ3B 3HOUB 3P4PB 2BWES 3FAHA 1CSPA 4K5XA 2JA7B 5AUIA 1I4RA 3AECB 2RHQB 2AWTA 4FXGC 2QMTA 3FRPB 4AS1A 5CHWA 3I72A 4X62Q 5C6AA 2C60A 5FR3A 3WCQA 4R4TA 2G45B 5TSSA 1QE6A 1PMRA 4JV5L 2MO1A 2KN5A 5H8YE 3TJPA 2Z4HA 3VHTC 1DYQA 1MJCA 4NQLB 1CHQD 3N32A 3APFA 1N8RC 1GUNA 1DZ1A 4C3JB 1TKEA 1WFYA 2RSUA 3MC9A 2F0PA 3VTVA 2WAQE 4ILWA 1ZXHA 3RZOB 3J7AF 2NB0A 4HSPA 3NENA 5NUCA 5IYBG 2N9PC 4GDKB 4MSMB 1Y1WH 4DV7Q 1TWFH 2F0MA 4YCWA 4OZAA 3H8HA 2PZWA 2R93G 4TSSA 1WR6E 2F0EA 3U4VA 3TS2A 4DN4M 4L2YA 4M02A 1GB1A 3ERSX 4ME5A 2B29A 3NP8A 1TBEA 2B39A 1P8LA 1AN8A 3U9SA 3CMEA 1DOMA 4WJWA 4DV1Q 4MEMA 1PRTB 4BKSA 1YNJC 1FJGL 1GPXA 2F0HA 5GMVA 4USAA 2NPTB 4A3IG 1E2WA 4FJYA 3MXNB 5GADC 4A3JH 2D5GA 3L4PA 1HR0W 2JY6A 3AE1B 4RCNA 5C3EG 3SK6A 3CCQA 1F2ZA 1JORA 1BBWA 2IHFA 4GIVA 2QJLA 2K6AA 2M19A 2I38A 4A93B 1M8AA 3HUIA 4BFRA 2ZPNA 1O7IA 5GAEC 2OJWA 4NW2A 2DAJA 4US9A 3U4ZA 2RSOA 5EQ0A 4X65L 2VUMB 1G2TA 1AYFA 4A93H 1I4GA 1BF4A 2BQQA 3AE8B 3TCAA 2V4DA 5JJKA 4J8QA 2DY8A 1C9FA 2KVMA 3SU8X 2RDFA 3AULA 5CV5A 4LF9Q 1PFSA 3C1EA 4O2DA 4YXDB 2LXKA 3S9WA 4UDUC 1EZ8A 4G7HC 2LJ5A 5HI1A 3S2AA 2N9KA 1E5WA 5FO7B 2ZJRA 1G91A 3Q6BA 1YBYA 4XZ4A 2LI5A 2DJFC 4E6IA 3CCJA 3DHHC 3MC8A 2EE1A 1L0WA 3P4QB 4DV5Q 1EIFA 3P4RB 2DNCA 4ZQ3A 1SLJA 2AX5A 3OMGA 5C5LA 1N36Q 2MJ8A 4UHVA 1NI3A 2KNBA 4BA2I 4IURA 4ACFA 4IPGA 2KDMA 1YQ3B 4DNTB 3Q22A 1HUMA 1T3QA 2QDLA 1JQ4A 2LS01 2QCPX 3ZIMA 4L23A 2L76A 3J7AV 4DR2Q 4BBNC 3WWVA 4N8FA 1XYIA 2AKWB 2WDRB 1VQHA 1TS3A 1SFOB 3OJ3A 5KIXA 4A55A 2KAJA 4A3GG 3QOJA 1LFDA 1WZ3A 1VF7A 3J80c 5G5GA 4YHHQ 2LKVA 1ET9A 2EOTA 1RD9D 4LJZC 2MW5A 5EKIA 4HMIA 1NMFA 4AJYB 4DR4L 4GLSC 4K14A 3BZDB 2KCCA 4OVVA 2I0QA 4I7ZC 4DXAB 3ULLA 2JA8G 4I7AA 3I3TB 3K5NA 4G7ZC 1A2UA 4K5VA 2ZVNA 4K7UA 4DV2L 4YTPB 2B2YC 3L10B 2R7DA 1BDOA 2C7HA 2YYZA 3AB5A 2A73B 2M17A 2RQXA 1EYAA 4IFDJ 2R6GA 2QHOA 5GAGC 2KTRB 1W6JA 3I70A 4II3B 3BK2A 3AU4A 3P20A 5HHDG 4XT3B 1I4QA 4HJ9A 1I6HH 4E74A 2F03A 3ULJA 5IYCG 2GB1A 3D6CA 2KFKA 1TIID 1ZDVA 1YNTE 3SD5A 3KOJA 3K0XA 2JU6X 4A3EG 1ZYRC 1RF2D 3MTNB 1SYCA 1SR3A 1L1OA 4B3SQ 2LZ6A 2RCFA 5FO9B 2JQRB 3HOYB 2AHOB 1IZ6A 1UGJA 1VMPA 2KCMA 4DR3Q 4A3KG 1YJ1A 4WQMA 2D3CA 2CWPA 1B50A 1IW7D 4DKAC 3BS1A 3HOYH 1MVKA 4C3HB 4AYBG 5DNFA 5IYBH 2A6HC 4N58A 3WAMA 1PVOA 1EO6A 1VCBA 1V86A 2XNAC 4HEA1 4LDTD 2DUDA 4PS3A 2A8VA 2KDIA 1E7VA 3PRMB 5HFYA 2KVZA 2DJGC 2OEOA 4DK3C 1XQQA 1P7EA 2PVGC 1J7AA 2L0TA 2FHTA 1VQLA 1EFID 4KV2A 2QKIC 3RPFC 2BH8A 4HKQA 4AUQC 2KMAA 1HZAA 1WY8A 4KZ0A 4XE0A 1G6JA 1YJIA 2DGYA 4TRDA 2WXKA 3PTFC 1S40A 1KFYB 4A3IH 4CDFC 3DVGX 1S72A 3UDXA 3MFYA 4R1JA 4B3TL 4C4VB 3T1YL 5LMNL 3CC2A 5JJZA 1GOZA 2AYOB 4XQQA 4C7ZA 2K03A 3AQQA 4QUCA 2JRHA 1S5ED 1YOVB 3BIID 3AE7B 3BVMA 4NJCA 3CHBD 2PI2E 2FBWB 4XWTA 1N32Q 1JE4A 1YJNA 1CZWA 3JSVB 2K52A 3EQLC 4DV0L 3HOXB 2EJGC 3FILA 3RD2A 5IKCM 3MJ5A 1UBIA 5ELOA 2KDEB 1EZ6A 3UI3A 2M8SA 4BOZB 1SYDA 1WJUA 5CX3A 3IT6B 3Q3NC 4X3KA 1YJWA 1LT4D 1PTOC 4BY7G 4GDLB 1Z6HA 4MGZE 3DUZA 1JALA 1LTAD 1OXTA 2EY5A 4G4KA 2UUCL 1FXTB 1JW9D 1WSPA 2Y5PA 3OSOA 3ZNZB 2C35B 1PTOH 3C1FA 5C4XB 3QK0A 2N7DA 4DV3L 2SEBD 3TP8A 3WOFA 3E3XA 4EUTA 4OZBA 4ARIA 3PUXA 3ND9A 1S1QB 1WXAA 4D2KA 4DR6Q 5A2QL 2JEAI 3W5UB 4W9FA 2D9UA 3DWAA 1Q7YC 4FXDA 3PZDA 4KI0A 2NZOA 2ZXPA 1WVLA 4OONA 2R92B 3RUIB 3Q3FA 2FCQA 3EFUA 5D3DA 1HR0L 1EUVB 3NELA 5M5YH 4BWGB 2QW7A 4OWTB 4A3GH 1Y8PB 1CA6A 2R92H 1K3BC 1VZ8A 2KC1A 2E75C 2WS3B 3QHTA 1R9TB 1ENFA 5JVH3 3D31A 2WP9B 1C7YA 1IYJB 3A1QA 3STBD 1A3VA 1VDZA 2K33A 1XD3B 5EE3A 3WA0A 1A3UA 4LFBL 2A74C 2RA4A 3I7FA 3EJIA 4J15A 4NZLB 2CU3A 5BR8Q 1JE5A 3RULA 3V62A 4XDDA 2F0SA 3GP7A 1K83H 1GUAB 1GB4A 4NDXA 4ODGA 4IC7B 3ZQ4A 2JA8H 1XX8A 2C7MB 2YV5A 1K3RA 4ZKCB 1JJ2A 4TKNA 1VJKA 2O2VB 5I6WA 1TTNA 3A4RA 2A1AA 2WDTB 3I4NG 1UWMA 2VZKB 3HOZG 2K05A 1LTSD 3GQBA 2NVXB 1O80A 3BWUD 3NBHB 4GN3B 1J19A 3A8IE 4ME3A 3B9JA 2BCOA 4XYCA 3B1LX 3O65B 2HQEA 3RLFA 2LASA 1KDCA 4UPAA 2BPSA 4DK5A 3KUCB 1N33L 1F9QA 2XSCA 4DHJB 5I6YA 3C3LA 4LF8Q 2XN9C 4HJKA 1C48A 3HFZB 2BVCA 3ZGZA 1QWYA 3FDTA 2VY3A 1STBA 3NHHA 2RPVA 2GBNA 3CQZH 3P1HA 4NXNQ 4FF4A 3TP7A 3K7UC 3PSEB 3FEWX 2HE7A 3F8TA 1NDDA 3R3MA 4GDKA 5IYDH 3PZ7A 4A3KH 1Z47A 1YN4A 3RR5A 2A6ED 3VR4A 3ML8A 3WDNA 4JK1C 2SDFA 5DM73 1JRUA 5EBCA 4P72A 1WWTA 4KY7A 1VQ7A 2K8BA 2PW5A 3S24A 3SFDB 3UIOB 3ZRFA 1VQFA 4HIDA 3E6ZX 3ZYYX 3MZ5A 2NVTH 3I8ZA 4ZRJA 2IJ0A 3L0OA 2NN6G 5JHBA 4A76A 2FXQA 1RTOA 3J80E 4LNKA 1Q0WB 3N1XC 5AZHA 2PMZB 3J81i 4JI0Q 1B2TA 4A90A 3Q69A 4PZ7A 4HR7B 1QOGA 1PFBA 1TZOA 3Q8CA 5BN3A 4GLXA 2XVSA 4BY1G 4BBSG 2CH4W 4MTKA 3KF6B 4XWWA 2K4KA 1FR3A 1LXDA 3S1RB 3L13A 3IHPC 3OWEB 3RD4A 1HQRD 3DOWA 1SMYD 4M01A 4OX9L 1XNQQ 5DPSA 4DF7A 2HDMA 2ID0A 5DM63 3UF8A 4IPHA 2F0FA 2V3PA 3CIRB 3I57A 4RF1A 1FD7D 3K9PB 1QUQB 1EF1A 2KQ3A 4ARCA 1RIPA 4EVOA 2K39A 4JI6L 4GNXA 3Q14C 3U52E 5IGDA 2VZAA 1GM5A 1Q1OA 1OEYJ 3AXCA 2MCNB 3TZDA 2EYOA 3H6NA 3JYUA 4BY7H 1JJCB 1E8WA 2K1BA 1LTRD 1VZ6A 1RCVD 1Z2MA 4HVBA 3UQBA 1PYSB 3NG0A 1QQRA 3IFTA 3ZJVA 1N6ZA 1D6EC 1N62A 3DBHI 4DV4Q 1F77A 2TSSA 4YY3Q 4HJ8A 1YNNC 2PNHA 2DAFA 4AWJA 3A8JE 1EIHA 4DQOC 2BE5C 3S1NH 4IFDI 1Q10A 4YCVA 3AEVA 4YWGG 4LF4L 4IWPA 2LGIA 4IM3A 4FNFA 2XEWA 2QIEB 2Y5CA 1RDPD 2BF8B 4DAYA 5KNDA 3NZSA 3HHMA 2E2HB 1V8QA 1EQRA 4WWPA 1W3SA 5M5WH 3OAWA 4OIKA 1LT6D 3HOWH 1KHIA 2PQEA 3AEEB 2UXBQ 3RN2A 4NXMQ 3TP5A 3SHQA 4W9IA 1BCPC 5CBAE 3L2PA 2PVOD 1VQMA 4OW0A 1N5WA 2HIXA 4IJLA 3LWEA 1PRTF 3TBIB 4KHPQ 2XIWA 4YWLA 4A3BH 1W2BA 2PMZE 4ZLTF 3DXJC 1ILPA 5D3IB 1I42A 1WGRA 4POFA 3HOVG 3M62B 5DPRA 3GE3C 5K36G 3SEBA 3GTLB 4EE2A 1V1OA 3I4NH 4NJ7A 2F0WA 1DOIA 3B2GA 3K9OB 4GU2A 4J3OD 1LV9A 3J81j 2YU9H 5IP9H 1JR0D 1G8ZD 4YCUA 4CDEC 4JI5Q 2BWFA 3Q3OC 3Q8BA 2EXZA 2O2LD 1YNXA 3K5LA 2BS2B 4UAIA 1SYFA 2K0PA 3A56A 4LUOA 2BYTA 1HJPA 1UGMA 2WAQG 3K5MA 1A0IA 4RKLA 2A4ZA 3NS1A 2L55A 2H1EA 3PUWA 3E9SA 5LMUL 1I35A 1E1TA 4MIUA 3AFPA 1S3SG 3W3AA 1XLPA 4V190 2ICIA 3PF4A 2OWOA 4WAFA 4I6PA 2LXJA 4HAEA 2NBUA 2KQ7A 3GTKH 2A19A 5ELNA 1MHXA 2TMPA 1V1QA 1JRPA 4JPBW 1E8XA 3GD7A 5HURA 2E2JH 4G57A 3IG3A 3AE2B 3PT2B 3PRZA 3F2DA 1K8OA 1K52A 2K6DB 2JXMB 4WIPA 5JAVA 1JB7A 3VR2A 3I56A 2B63H 3OMCA 4WJPA 1X9NA 4X66Q 2DZMA 2JX5A 3ER0A 3NQTA 4K6DA 1YN5A 4J6HA 3PIO3 4FN2A 3QCAA 2K5NA 3RN5A 3PO0A 4BBNF 2PQAB 2NWGA 5JXVA 4DPGA 3L17A 4P73A 3VRBB 1N9WA 3VR6A 1NEKB 3X3NA 2HT1A 3GTMB 2K8HA 3K5OA 1PH3A 2KWCA 4TVAB 2PIAA 3FKIG 3I73A 1WOCA 1VQPA 2FNJB 2NS5A 1E7ZA 3Q8FA 3JW0X 1X56A 2BBCA 4YTNB 4PS7A 4DUYL 1L4ZB 3V60A 1SJED 5FK9C 1BVSA 3AMZA 1PZID 2WXMA 2DNEA 4NPSA 2MJEA 3HOUG 2E3TA 1TWAB 2L1BA 1K73C 1VR9A 3NZ3A 1DGSA 2QILA 1VQIA 1LTGD 1VQAA 1WFQA 4LF5Q 2HCIA 4JI7Q 1LT3D 4KD4A 1XPOA 2JP1A 2NBVB 3GE8C 3M4OH 3PO3B 2JF5A 1SNDA 1ICWA 4JI4L 1RLFA 2DYBA 3NWSA 1TWAH 1C3TA 1EWHA 1S5DD 3TS0A 4ULLA 4B9XA 1VQOA 2GBMA 1AH9A 1B70B 5J1ZA 3PO3H 2J0KA 1QCBD 2JK8A 1O7ZA 1AARA 4JQWC 2MGSA 4GN1A 3DHIC 3ONAB 3VYRA 3RMKC 1L1OB 1HH2P 3IBEA 4US8A 5I2YA 4WRDA 3AMUA 5JJIA 2WKDA 3NSWA 2F4IA 3K7AH 5LL6X 3CP0A 2KCTA 1Y1WG 2KANA 1HNWQ 3C19A 1HNXL 4MACA 2LFNA 1STAA 4EKUA 3K8AA 4M00A 3PLUA 4DR1L 4FLHA 1EOVA 1R4QB 3DVGY 3NOBA 3J81E 1HQMC 1F9SA 2JWUA 2FCMA 1E24A 1CQFA 1QILA 4IZ8A 4C1NK 1H95A 2KFJA 2LY7A 2WXQA 1K8RB 1QZGA 3T51B 4DV1L 4BZAA 3VR3A 2PEAA 4TUUA 2L0FA 5J3BA 1QOAA 3P63A 4WURA 1XF5L 4F7ZA 1L4DB 2XTIA 1I5FA 4A3JG 4JBMA 1A8VA 2INNE 1CK1A 1X3QA 3A7LA 2OJRA 3G6EA 2B2VC 4DXFA 3Q0AA 2CW0D 4FA6A 2F0QA 4WWNA 2X69A 1V97A 3PREA 3ABVB 3S16H 1WCMB 3NEMA 2UYZB 1V9JA 3LX0A 2O2VA 4KN7C 3DBLB 5I9OA 2YEPB 4K6LA 3PO2H 4K3CA 4A93G 2HIVA 3IAM1 5IGCA 4WH4A 4H2AA 4K0KQ 3NBHA 1RODA 4FP5D 4RM9A 1KNAA 1O78A 4XIGS 2WXLA 5IWAL 1PUTA 4OELB 1NTGA 1K8MA 5K36H 2N9EB 4BKTA 5D14A 1XTCD 2ZZPB 4JBWA 5LXIB 3PS6A 4DUZQ 4RKBA 4L5SA 3NBIA 3FILB 1YEZA 3DWQA 3TDQA 2B2TA 4LLGM 1VCIA 3I4MB 5EAYA 2BA1A 2EY2A 3NQIA 4KHZA 3GS2A 1H9KA 4PK1A 1HTOA 2GOWA 1Z5SB 3CF6E 4CKEA 2IYDB 2W82A 1SNPA 3D8GA 3NXWA 2BB5A 2JZPA 1NSNS 1FRRA 4DV5L 1U4MA 2JJQA 3MAQA 1UE6A 4YSZB 2KD0A 1Q82C 5I9PA 1PH8A 5DEHA 3S2DB 4HCSA 2IGDA 4NAWA 1SIFA 4P75A 5IODA 1EIGA 1Q5WB 4IOAA 1A2TA 1OXSC 1DXMA 1CKOA 1SNOA 5LXHA 4F8MA 4GSWA 2MPMA 2K50A 4WJOA 4CDCC 1K28A 3CC7A 1UEBA 4JI2Q 3DHGC 4II2B 4F8CB 4JLCA 1WR1A 3AEGB 1XPRA 4UP7A 1TGZB 2BW2A 4XX5A 4GKJQ 4X57B 4B08A 1GKHA 1P16A 4UP9A 2L32A 4MN3A 1T9HA 4DK0A 4F88A 3J80L 3A5UA 2QSDA 4MJSA 3R66C 4OZCA 3V6EB 1YIWA 2RBMA 1MSHA 4R8NA 1V8CA 4HLEA 1B3AA 3V6CB 2PZTA 4R4IA 5C4JH 4HCNB 2JA6B 3S14H 2LFIA 3RNCC 1MKHA 2NVYH 3H7SA 5KEEA 2XRSD 3V05A 2L12A 1S4ZA 2D10A 1AEXA 1I3QH 1RKNA 4GKKL 3M63B 3JAMi 2JYEA 1NY4A 4IPCA 2J7ZA 4JGHB 4NKLA 4HKZE 1HE8A 4XDCA 4RHRA 1EEFD 1QKZA 3QIJA 4IW0A 2K22A 4DR7Q 3SR6A 2KOLA 1M4VA 2D07B 2AQ2B 2WNMA 1SE2A 3MVVA 3C2PA 4K8JA 3CCUA 4X64L 3EFXD 3HOUH 1LO5D 2M1MA 1XNRQ 2JA7H 3E9IA 5FLXc 1CKNB 1IUEA 2IO1B 3VUYA 5EE1A 2ONQA 1UNSA 1XMQQ 3ZNID 3H15A 1R4PB 3URYA 1I94L 2UUAQ 1JWUD 4ALPA 4NB3A 3DBHB 4GXBA 1L6UA 2PYKA 3Q3JA 4HJAA 1Y8NB 1KH0A 4F7XA 2EJMA 2AL6A 1ONLA 4RAUC 3HOYG 1M94A 3UQAA 2Y3AA 4C1NI 3IXSA 1MIUA 4C3JH 3VR8B 2NR2A 4IFDH 1XPUA 3M7GA 3UI2A 5C3XA 3RZOH 2KUMA 1TWGB 3UINB 1T0SC 2WXNA 1X3EA 3QR8A 2MEKA 3HIZA 3K6OA 2MBEA 3T8MA 2EJFC 1ZP0B 1PRTC 1TWCB 3I90A 2QDBA 1U4AA 1O7LA 2CWAA 4A75A 2XWJB 4HCPB 1KLVA 1TKWB 2KK8A 3JVZX 4L5RC 4HJ5A 1TWHB 1XCQL 2XWBB 2FUHB 2G3QB 2MBOA 3G48A 1OFFA 1K0RA 2LGYA 3KVFB 3ICEA 2PW9A 4JI3Q 1GUSA 1TWCH 4RWSC 2JSOA 3H3VI 1A3TA 2IY0B 1XXGA 2LVQA 2X6GA 2MH7A 4MSQB 4B6WA 1G51A 4EGVA 4RMFA 1LABA 4LF7Q 5CV7A 2B76B 5GQOA 4CHTB 5ELBA 4B3ML 4UY8C 3EFCA 5KNCA 4R9WA 4ZHOA 1EY7A 2K1FA 1SEBD 2Z4IA 2CHBD 1U9RA 2RMMA 3BDLA 1WYGA 1SYBA 1I50B 2VUMH 3R2IA 1QZHA 1XLQA 4LCDE 3HOXG 3ZTDA 1IKLA 3U9OA 1AWDA 1J8IA 5C0XI 1QB5D 4KJOA 1TQOA 4KD3A 1DOYA 3A8KE 2VRRB 1BKBA 1CZGA 4GNXB 4GNXC 4DNRB 4B3RQ 5JJLA 1PQSA 1FMAD 1XO3A 3N3KB 2GN5A 3R2TA 1NMGA 4LDTB 3K57A 1HZCA 5M3MB 3MWYW 3CMMB 1K50A 3EC8A 1PH4A 4OWXB 2N49A 3MJWA 3KYDD 5I2XA 2HCCA 2M9VA 2EMTA 1P3QU 2JPHA 3AYHB 4JW0A 1Y1VB 3MEFA 4CJ2C 1VQ4A 3BYTB 2XBBC 4WWOA 2F0VA 1HNZQ 4PZ8A 2IY5B 1QT9A 4BOSC 1EU4A 2BYVE 4DR6L 2R7ZB 2KC2A 1W6KA 3VA5A 3M3JA 5DCNA 1SNCA 3VQIA 4DAMA 1IYFA 4WJ3M 3VXWA 2R7ZH 4BKGA 2V0GA 1VD2A 5EKKA 1VQKA 3X3MA 2B8FA 3GO5A 2ZTEA 3WALA 2K75A 1LYLA 3AN1A 4JWUC 3W1SC 1P9DU 2R92G 4DBGA 2PQAA 4DK1A 4DAYB 1SFOH 4REZA 1HTPA 5ELEA 4FXCA 2LGSA 1AE2A 5KNBA 3TRZA 1QNUA 2LHEA 4CJ0B 1VQ6A 4GMVA 4RM8A 5J39A 3A5ZB 1EOTA 2Z1CA 1DCZA 3Q8EA 5EE9A 1D3ZA 2MFIA 4M1UB 2IBIB 3I9V1 4LFCL 4B9WA 1GAQB 2V3NA 5AEKB 3VH4B 5IO9A 5AJ3Q 3LYYA 2DN8A 3OTOL 4A4IA 2IX1A 2DX5B 1BCPF 2NCNA 4JPSA 5LLIA 3F2CA 3VTWA 4ZRQA 1QOHA 2V4LA 4DGZA 1PZKD 4X3TA 4AQYQ 1UE1A 3TP6A 5CMDA 2N55A 3ZNGC 1NE3A 5D7GA 3U30A 5CTRC 5EPKA 2IPKD 3PHXB 4KIKA 1NYQA 2M56B 2MQHA 3CCRA 1JWMD 2SNSA 2H88B 3APCA 3T3NA 5M3FB 1WYDA 3IKJA 1PH2A 2HD5B 3QAQA 1XWEA 1FCCC 2ZM6L 4RGMA 1YNJD 1FM0D 1LT5D 3DMUA 2C7NB 4R4CA 3QX1A 3EA6A 3KLWA 4BBRB 5IYDG 5IN7A 1YX5B 2O6VD 1J5EL 2CHZA 1MPEA 4DDGD 3FPUB 4L5QA 4XQNA 3O13A 2RVLA 1FFUA 2KJ6A 1WM2A 4BBRH 2MQJA 2BYEA 1RHPA 4DV6Q 1GG3A 3OW2A 1OO9B 1NAPA 2MWSB 2WXRA 3TMEA 4X3UA 3TUOA 3J81L 3S1QB 2EXDA 1PLFA 1SROA 4MNOA 4APVA 2JUOA 4C3HH 2PLPA 4HPPA 2D3GA 4IN3A 4FXKC 4JV5Q 2N7JA 2PKOA 3BVGA 1JCKB 1EY5A 1P98A 1DONA 3CSFA 1T5EA 4KGRA 3CSTA 1WX7A 1J9OA 3IAS1 3HP3A 5CV8A 4E3CA 2W54A 2ES2A 2KWDA 2ZVOA 3HKZG 2E5LL 5LL6S 1A15A 2KQSA 3ONSA 1KL9A 1K0SA 2K04A 1UELA 1ZEQX 2L1AA 3HGBA 1HFNA 2VQEQ 1N34Q 3GTGB 1PDQA 3H7PA 3HRDD 1VQEA 3EECA 2INCC 2INDC 4W9CA 1V1PA 1C8CA 4EX5A 3FKYA 4ZOHC 1XNQL 4IWQA 1XT9B 2EYJA 1GXDC 4W9EA 4RG1A 3NUCA 1YJ9A 4C3IB 2X38A 3M3YB 2KX0A 1H9RA 4LTUA 2ZTDA 4EZJA 3EBEA 3G7LA 5FOBB 3ULPA 2KX3A 2N8NA 4ANWA 2CR5A 1V43A 1TVXA 3HOXH 2ZPYA 1UWVA 1J8CA 4C3IH 1TZ1A 4QIWB 3M3YH 3DBRB 2KLGA 4IUMB 1UAPA 4KDIC 1CQVA 5FLXE 3AEFB 2VXWA 1MG8A 2OTLA 3L54A 4GOPA 5KHOA 1HRJA 1TKGA 2RCNA 3X23A 3ZXRA 2OOBB 4X65Q 2LGDA 4TKOB 4KGSA 1D1KA 4PT5A 3S15B 4MM3A 1LACA 3BZKA 4YY3L 4DV4L 3P4SB 1HTQA 4HXDA 3ND8A 3SK4A 1QOFA 2HUGA 5C4XH 3PIOA 1TU2B 5M5XB 4LNOA 4MTNA 4NMZA 2RPQA 3K59A 1IBKL 3RYTA 2KEEA 1B44D 1EYCA 4G11A 2V1CC 2MA9B 1MGSA 3MXPA 4N8X1 1RRBA 4O0AA 2GBRA 2YTVA 4QUFA 1KD1C 1EYDA 3T53B 1Y8OB 4P74A 4A3OA 4TQ0A 1PV4A 3GV6A 2O4XA 3HOWG 3E56A 1WTVA 5BMHA 2IGHA 3KLSX 1J0GA 1SNQA 2JA5B 2KQ4X 4NXML 1L6VA 3W5OA 3MHZA 1PH9A 2GI9A 2KTFA 2Z0DB 1IYUA 4CGYB 1G6PA 1R9TH 1BR9A 2L05A 4B9KA 1RTNA 1ZYRD 2CKZB 3F2UA 3MXUA 2JA5H 2UXCL 1YJJA 3M7NA 4A3BG 1Z7TA 3NVVA 1EY4A 4KJNA 4IDIA 2A69C 1SE4A 4PMWA 2R61A 4AH6A 3DBLI 3CD6A 1X55A 1DOXA 1PH6A 2JVCA 1F9PA 1C79A 4RGNA 1GD7A 1I6VC 3CRLC 3P75A 4WFN3 3OIQA 1MHWC 4N9TA 3W1GA 2NVUI 5BO4B 2SAKA 1CKNA 5IP9G 2P5ZX 2A6HD 2YEPF 3AI5A 4DR4Q 2WXPA 4JI5L 1FXAA 3CXCA 2NVXH 1JWSD 1LUZA 1NNXA 3H6MA 4LJPB 5BYQA 2J4XA 3CPFA 5IE8A 2AWNA 2GRIA 3ZJYC 4JI8L 3KYHC 4KX6B 2B2TC 2ZEQA 4P2CB 2VNUD 3H91A 4DV2Q 3UDGA 2E2IB 3ENEA 2KDBA 2JEBI 1MI2A 1TY2A 1VQBA 4OL7A 3M4PA 4HK2A 5E6JA 4JL9A 5IP7H 4H13C 3DM3A 3DM1A 1PGAA 4WJ4A 5IT9c 4PV1C 1PXUA 3G6JB 5GAHC 2I1KA 1IBXB 4A3EB 4TQ1A 2EYLA 1HCZA 1DOKA 4NAWB 5EPJA 4ZK9B 3J81c 1E0BA 3AB9A 3ECIA 4IKGA 2EYPA 2WB1G 4ANXA 1IBMQ 2MLBA 3AE5B 1ZXIA 3L7ZC 4L6TB 1BT0A 2B63G 2PPHA 3SXHA 1Q90A 3G71A 1EIYB 4JIOU 4H0LC 3PF5A 2Z6KA 4A3MB 1UUPA 1QJOA 3H3VC 2EYFA 4CJ1B 2UU9L 1NYRA 4AYBB 2V1YA 2MHVA 3N30A 2FIFA 3AV8A 4MJSB 3NWTA 2K01A 3BY4B 3DDCB 2JXXA 4BS9A 3H3VH 4BAXA 1PTOD 5E3FA 3B08A 5GXGB 3RNAC 4K8IA 3VH3B 2WV6D 1WGKA 3OPOA 1D2BA 1X3GA 1KIXA 3W2DA 2DZIA 3R93A 2VW9A 2W3SA 4CBVA 1UE7A 1EQQA 4OWWB 2E8GA 1EY6A 3S1RH 2BYFA 2UUBL 1KRTA 2C9WB 2KVRA 5CV6A 4MGYE 1AW7A 4YTMB 4DK6C 1TXYA
chains in the Genus database with same CATH topology
2G1EA 2K32A 2WLBA 1OXXK 1YMHE 4HROA 5C0XH 4CKCA 5JPMC 1KLUD 1NR4A 2D62A 2K5DA 1MD2D 4HN7A 5H92C 1TS5A 2K5QA 2GA4B 1G2SA 5IOCA 1CFMA 3W9CB 2BT6A 2DLBA 1X32A 3T16A 2O5JC 1BNZA 1GUTA 3HZXA 4XDXA 2N9LA 2BTEA 3S2HB 2K5PA 4JWSC 1KLGD 3T13A 3SR1A 2LMCA 3SE0A 4I65A 1YQ4B 5JPNC 4R8IA 1BUIC 2EZVA 2B2WA 3S17B 3QJYA 4IUTA 2PPBC 1SE3A 4OVZA 4EQNA 1HA6A 1H9SB 1F9RA 1J7BA 1XLOA 1OXVA 1I7HA 2F0DA 2FE8A 1UWXA 4ZYSA 2JSVX 4KKJA 1UEAB 2G9DA 3H0GB 4S3SA 3SHLA 1KTKA 2W55A 4C80A 3TEWA 1CHPD 1E6EB 1RFKA 1ZE3D 4TMAB 3MFGA 2PTLA 3BDCA 2B2YA 4TQUS 3DHQA 2OT2A 4LK0M 3I3CA 3M4YA 5HGTA 1OQQA 1K53A 3HOZB 2K5WA 1RM6C 2F0GA 5BYRA 3GTOB 4ZRZA 1B9NA 1SIJA 1EWYC 4HTHA 1B9RA 1K51A 3GTJB 4FF3A 2G9HD 3H94A 4A3DB 4OO1I 1VDVA 3TSSA 4RF0A 2BA0A 3Q24A 4QF4A 3MEHA 1X3PA 3PMFA 3FPPA 5C0XJ 1IYVA 1SB3C 3NVWA 3MTSA 1F2YA 4RH6A 4L8JA 1C4CA 3LXFA 1FGBD 2F3WA 1TS2A 2FMMA 1WRIA 4BA1I 3KQ4A 2WXOA 2WKCA 1VF5C 2ZXRA 3CWIA 3GTPB 5JOBA 1LTBD 2L11A 1Q1BA 2HDLA 3TEXA 5IGEA 3VYUA 1LTID 1S5FD 1YNND 3AH7A 1MSGA 1QLBB 2BE5D 4N9PA 4BY1B 1A70A 1SF0A 4BBSB 1FD6A 1FCLA 3KUPA 2I2YA 4V0BA 3S1MB 2KJXA 5FLXL 4GZYC 2F0TA 1BXTA 5C3JB 5CGKA 2KN4A 3BYYB 5FKAC 4RGTA 3ERQA 2J42A 1H9MA 4H7BA 4O42A 1PYWD 2BDNA 1BCPD 3MC0B 4C3JG 1ML0D 4A9AA 5IT9E 3VRAB 4IFDG 4QB4A 4EQPA 2Y0SB 2F0OA 4RCOA 2Q5WD 4FO2A 4U68A 1GUWA 5IGFA 2K7VA 2ZW1A 2HTME 2A68D 3A7AB 1JWBD 2WINB 2F0LA 3IL8A 5C2TB 1D5ZC 3D3RA 1SXTA 5IGGA 4L1BA 1V1PB 3OHXC 1BMLC 3AE4B 2V4IB 3GB1A 4KKUA 1STHA 3ITPA 3FVQA 1SYGA 2MUYA 3AEAB 4G7OC 5A35A 1ILQA 5E4XA 5G3LF 1JB3A 2NVQB 4PQXA 3I4LA 3QB3A 1IBXA 4KKTA 1JC7A 3DWPA 1DGJA 1HFGA 3PUVA 4MM3B 3AEBB 2KEDA 1SDFA 1E2ZA 5CV9A 1CZPA 4KKSA 2ENBA 2ZXOA 2KA7A 1BBXC 1XEEA 4HJGE 2SNMA 3A54A 2F0KA 2KHSA 1KDBA 2JE6I 3PUZA 3AE9B 2K3UA 1AFPA 4N6EB 1MBYA 1EEID 3RUZA 1MI0A 2MJ3A 3RZDB 1II3A 3B2FA 4XTCS 4RHSA 3D4DA 1D5XC 4C2MB 3OW7A 1FYCA 3NE5B 2CJOA 1E7PB 4J1MA 2E76C 1JMLA 4WWMA 5DAUA 2IGGA 1CT1D 2D5DA 1C4QA 2ON8A 4XT1B 1FNUA 3D4RA 1STNA 1EY8A 1LLRD 5C44B 4Q0FA 1S5CD 3P7JA 5ELFA 1L0XB 3J7YW 3FKIB 4KV6A 5ELCA 1ENCA 1HEZE 2B2UA 4YIJA 5ISRA 5BMIA 5BYSA 4K5WA 3N52A 2WQYB 5J22A 1QF6A 4RNAA 1FXIA 1RJTA 1C77A 3V96A 3SK5A 1BQQT 4C3HG 2B8GA 2AQ3B 4IALA 2KACA 4MT5A 1WTQA 1PFDA 4A8XC 1J7CA 1Y1WB 1TWFB 5CORA 3EVQA 2EVBA 3GV3A 2MP1A 4PMCA 1H9SA 2F3VA 2RSNA 1N61A 1ZUD2 2L83A 2IDYA 2Q8RE 3PV0A 2WACA 4DA2A 1NCVA 1T5XD 1L0VB 1N60A 2QEJC 3GTQB 2I07B 3PUYA 4A3JB 4Y7NB 4CKBA 4HCEA 1N63A 2E2DC 3QOLA 3MA2B 3VR9B 3EGRA 1WXQA 1CI3M 2FFKB 4C3IG 1MHHE 1IW7C 4RGOS 1Q8IA 2IL8A 3R8BA 4XYQA 4YSXB 4ITKA 4YT0B 4R3DA 5JEAJ 1B4OA 2IT1A 3NPPA 2EY6A 1E9MA 1EY0A 1Y69U 1GJXA 3LWUA 1GUGA 1CJEA 1E0ZA 1ENAA 4OO1H 5KYLA 2OF1A 2RDGA 2VB2X 2X6LA 2AUJD 3EUB2 4ZHPA 3HG9A 5EPLA 4IOIE 4JX1C 2EDGA 2BB6A 2LMCB 2WXIA 5BMGA 2K28A 3T4AC 4KY6A 2ZT9C 2B2WC 4A3FB 3ETRA 2Q8IB 2L4NA 3TEZA 1TY0A 1JROA 2F0IA 1QG7A 1I4HA 2OEDA 3RFZB 1F0ZA 3SK8A 4FVMA 2PMVA 3TN2A 1VLBA 1ZPSA 2K9XA 2DYOA 1P7FA 1PRTD 1VZ7A 4NP5A 1I6HB 3AE3B 3M85A 1WTRA 5IT9L 5EBDA 5EKLA 5KYIA 5AUKA 3C46A 3KK7A 2PCFB 1AP0A 3BG3A 4N59A 2DYMA 4HSVA 5AFWA 3D4WA 3P1MA 2F1MA 5C4ZA 1KDAA 5E4WC 1ZDXA 2KMMA 1KNEA 3KBXA 4IUNA 3JAME 1ZXTA 1ACCA 2R93B 4Q2JA 2FINB 3KLRA 5M9OA 3NUHB 5K5PA 2JYTA 3W5VB 1TJEA 2NN6I 1FEHA 4A3IB 4KK7A 1GHKA 2B2VA 2KCNA 5LNK1 5C3EB 1KAAA 3A55A 3AM9A 5C0XG 1F2MA 1CA5A 1EM7A 2A6EC 3KWVA 3FC4A 4OIJA 4OGQC 3PIP3 1JOKA 2LHDA 1OXUA 4A6QA 3KBGA 4F87A 2FUG1 2J53A 2LJIA 2INPE 2BDOA 2DY7A 1BUVT 2C9OA 2IWHA 3WOEA 1FNVA 2H89B 3P42A 1RYJA 2OHFA 3T56B 4H44C 1JOOA 2PNRC 3U2SC 5T1IA 3RMHA 5CV4A 3BK1A 1PTOB 2E6XA 2FJ2A 1NENB 4KGTA 1DD2A 4LAAA 2EYMA 1SMYC 2D2CC 2M00A 3N6RA 1VMCA 2LUMA 2EKIA 1G291 1CM9A 1FIQA 4OHJA 4EQOA 1EL0A 1H9JA 4DU9A 1TS4A 1WD1A 1FRDA 3AU7A 5M5YB 3E0JA 1SNMA 3NTKA 3V2TA 3MP9A 4A3GB 5C5MA 2Z8LA 4IUPA 2AQ1B 1JWAD 1HPCA 1GUOA 4PMBA 5EGTA 1K83B 2BS3B 1F2RI 2JA8B 1LTTD 1Q1EA 4RA8A 3U7ZA 3QIAA 3ZJTA 4PNYA 2XRQD 1N5XA 1SJHD 2WDVB 3TZUA 1PGBA 1D5MC 4L63B 1SAPA 2NZ1D 1IGDA 5C3WA 1CTMA 5BN5A 3NK9A 5FO8B 4ID6A 1QOAA 2AWOA 1I4PA 1NR2A 3FMCA 1HXYD 1SBBB 3CQZB 1IKMA 2A5HA 3NVZA 3SVMA 1Y56A 3IT4B 4A3KB 4O1NA 5G3LD 1B1ZA 2MJDA 4C56C 2W3RA 3QG1A 3DEOA 1FFVA 1F2LA 1WTPA 2NMQA 1EQTA 2N88A 2NVTB 1NUCA 2ICEC 4ZUJA 3NVYA 3VYTA 5MPOA 1OQRA 1B9MA 1C76A 3MXNA 3HKZB 4IQZA 4IUUA 2O5IC 2RKSA 1WTXA 3NTIA 1RWSA 1WTOA 2H4OA 4ZAIA 1PZJD 2NBFA 4M8AA 1TYGB 1JQYD 3H09A 1IHZA 1Q12A 2B2UC 5T1GA 2PW7A 1KRHA 2PO4A 1TKYA 1G6ZA 4BY7B 1ZKOA 3NRZA 4HMJA 2JYOA 5T8IA 2A69D 3OWFA 4C7YA 3ZJUA 5EJWA 3Q8AA 2NTTA 1JOQA 2L0CA 2VZKD 5EE0A 1ESFA 3SDZA 4MH8A 4QCLA 3S1NB 1EY9A 1E10A 5BN4A 1E2VA 1PDXA 4Q5VA 1R7SA 3W1SA 3BVZA 2WDQB 1EWCA 1HTLD 1L0YB 2LEKA 1U4PA 1STEA 2HDEA 5M5WB 1ET6A 3HOWB 4B0MA 3VYSA 5ELDA 1BCPB 4A3BB 4ZRPA 3LNNA 2NYZD 1YN3A 2J52A 4RFBA 4FF2A 1U4LA 1KABA 1D4BA 1ROEA 5C4HA 3I4NB 5CC4A 1AZPA 3I91A 1A6XA 2YU9B 2A68C 2DBYA 1KF6B 4K2LA 2F0UA 1C4AA 2CW0C 2EY1A 2WP8J 3AE6B 3KWLA 1U4RA 3VA7A 2WXHA 1ESRA 1XCTL 4X3SA 3HVZA 3Q23A 3DEPA 4YSYB 4NAMA 4P6VF 1HA5A 2WU5B 3GTKB 5D65A 2L5TA 2R3ZA 2CJNA 2NTSA 3NTHA 1FNWA 3JAML 2E2JB 2KECA 4ABNA 1PGXA 3C8YA 2WB1B 3KLSA 3DWGC 5JEAG 3E5SA 2B63B 1IGCA 2CQAA 3K0YA 2L9HA 4DAVA 2FMCA 3U4EG 1QOBA 2IX3A 2EPBA 2NN6H 1NVID 1JICA 1HUNA 2WIIB 4P16A 3V3XA 1S5BD 1TR5A 5COYA 4JE3B 2M0AA 1B53A 4XQJA 2L52A 2DWQA 1EU3A 1D1IA 1SYEA 3KF8A 4FF1A 1I4XA 2WXFA 2QF7A 1HZ6A 3M4OB 3PZ8A 2IX0A 3J9CA 4IUQA 2WU2B 5F2DA 4KKIA 5CYUA 1BO0A 1GHJA 3LB8C 5CBEE 4DFAA 4IUVA 4KMUC 2ACZB 1DOLA 2M2LA 1DJRD 3HRZC 1STGA 5I4DA 3K7AB 2BS4B 3OOCA 2EELA 5JVG3 1WTWA 5KRUA 3DWMA 5IGBA 2F0NA 2J0TD 5KGUA 3CKIB 2SOBA 1PFNA 4KY5A 4Z9CB 5E1FA 2AUKA 1T6BX 3CRKC 4ZKBB 1TT2A 2EYHA 1F2RC 2Q8TA 3S16B 1AZQA 3VR5A 3IAYA 1STYA 5G5HA 4CQNA 3OIPA 4M0WA 3L3OC 3QWNA 3T3OA 3PO2B 3HVDA 4KTAA 4LK1C 3K58A 2I46A 3TEYA 3HOVB 4MHEA 3D6WA 3HEJA 4KN4C 2BOSA 3HS0C 1IL8A 3IFDA 2F0JA 1BOSA 4DAPA 1FO4A 2VB3X 4XXEA 4KHVA 1C4PA 2OXPA 4FYDA 4U673 4B0EA 2N0SB 4OO1G 3EROA 2IW3A 1PFMA 1VRAB 3AEDB 5CR3A 2WAQB 3MXGA 1XLNA 3L9AX 3N9YC 1HHVA 1Q3LA 2E74C 1SSNA 1L5PA 3R3OA 1EQVA 1WD0A 2ZW0A 4DXGA 1DM0B 1PTOF 4AQ7A 5A2QE 3MHBA 1ZOYB 5IIFA 3Q6SA 2C5CA 4HEDA 1O7YA 5JEAH 2CVRA 4XYOA 1QNKA 1HZ5A 3CU7A 3QO2A 2JXTA 4QMGA 2WXJA 5C4JB 3S14B 2NVYB 1SSOA 2PZUA 4ZUIA 2RDHA 3BDOA 1I3QB 2NUCA 4LMQD 4HRSA 1C78A 2WXGA 4K2KA 3SFEB 5HG2A 5LHY1 4WORA 3HOUB 3P4PB 3FAHA 2JA7B 4K5XA 5AUIA 1I4RA 3AECB 4FXGC 2QMTA 3FRPB 4AS1A 3I72A 5C6AA 5FR3A 3WCQA 5TSSA 1QE6A 1PMRA 5H8YE 2Z4HA 1DYQA 1CHQD 1DZ1A 1GUNA 4C3JB 1TKEA 2F0PA 4ILWA 1ZXHA 3RZOB 3J7AF 2NB0A 4HSPA 5NUCA 4GDKB 2F0MA 4OZAA 3H8HA 2PZWA 4TSSA 2F0EA 4DN4M 4L2YA 1GB1A 4ME5A 3NP8A 2B39A 3U9SA 1AN8A 1DOMA 4WJWA 1PRTB 1YNJC 1GPXA 2F0HA 4USAA 1E2WA 3L4PA 2D5GA 3AE1B 4RCNA 3SK6A 1JORA 1F2ZA 2QJLA 2K6AA 2M19A 2I38A 4A93B 1M8AA 3HUIA 4US9A 4NW2A 2RSOA 5EQ0A 2VUMB 1G2TA 1AYFA 1I4GA 1BF4A 3AE8B 2V4DA 4J8QA 2DY8A 1C9FA 2KVMA 2RDFA 5CV5A 3C1EA 4YXDB 3S9WA 4UDUC 1EZ8A 4G7HC 5HI1A 2N9KA 5FO7B 1G91A 4E6IA 2EE1A 3P4QB 3P4RB 2DNCA 4ZQ3A 2AX5A 3OMGA 5C5LA 1NI3A 2MJ8A 4BA2I 4IURA 2KDMA 1YQ3B 4DNTB 3Q22A 1HUMA 1T3QA 1JQ4A 2LS01 2QCPX 4L23A 3J7AV 1XYIA 2WDRB 1TS3A 1SFOB 4A55A 5KIXA 2KAJA 3QOJA 1VF7A 5G5GA 2LKVA 1ET9A 2EOTA 1RD9D 4LJZC 5EKIA 4HMIA 4GLSC 4K14A 3BZDB 2KCCA 4I7ZC 3K5NA 4G7ZC 1A2UA 4K5VA 4YTPB 2B2YC 1BDOA 2YYZA 3AB5A 2A73B 2RQXA 1EYAA 4IFDJ 2R6GA 1W6JA 3I70A 3BK2A 3P20A 5HHDG 4XT3B 1I4QA 2F03A 2GB1A 3D6CA 1TIID 1ZDVA 1YNTE 2JU6X 1ZYRC 1RF2D 1SYCA 5FO9B 2JQRB 3HOYB 1UGJA 1VMPA 4WQMA 1B50A 1IW7D 3BS1A 1MVKA 4C3HB 5DNFA 4N58A 2A6HC 2XNAC 4HEA1 5HFYA 2OEOA 1P7EA 2PVGC 1J7AA 2FHTA 1EFID 2QKIC 3RPFC 4HKQA 4XE0A 1YJIA 4TRDA 2WXKA 1KFYB 3MFYA 5JJZA 1GOZA 4XQQA 4C7ZA 2K03A 4QUCA 1S5ED 3BIID 3AE7B 3BVMA 4NJCA 3CHBD 2FBWB 4XWTA 1JE4A 1CZWA 3EQLC 3HOXB 2EJGC 3FILA 3MJ5A 1EZ6A 3UI3A 1SYDA 3IT6B 4X3KA 1LT4D 1PTOC 4GDLB 1Z6HA 3DUZA 1JALA 1LTAD 1OXTA 2EY5A 4G4KA 1JW9D 1WSPA 2Y5PA 3OSOA 1PTOH 3C1FA 5C4XB 2SEBD 3TP8A 3WOFA 4OZBA 4ARIA 3PUXA 3ND9A 4D2KA 5A2QL 2JEAI 3W5UB 2D9UA 3DWAA 4FXDA 4KI0A 2ZXPA 2R92B 1WVLA 5D3DA 4BWGB 1VZ8A 1Y8PB 1CA6A 2E75C 2WS3B 1R9TB 1ENFA 5JVH3 3D31A 2WP9B 1A3VA 1VDZA 2K33A 5EE3A 1A3UA 2A74C 2RA4A 4NZLB 3EJIA 2CU3A 4XDDA 2F0SA 3GP7A 1GB4A 4NDXA 4ODGA 3ZQ4A 1XX8A 4ZKCB 1VJKA 5I6WA 2VZKB 1UWMA 2K05A 1LTSD 3GQBA 2NVXB 1O80A 3BWUD 3A8IE 3B9JA 2BCOA 2HQEA 3RLFA 1KDCA 1F9QA 2XSCA 5I6YA 3C3LA 2XN9C 1C48A 3ZGZA 1QWYA 3FDTA 3NHHA 1STBA 2RPVA 3P1HA 4FF4A 3TP7A 3FEWX 3PZ7A 1Z47A 1YN4A 2A6ED 3VR4A 3WDNA 5DM73 2SDFA 4JK1C 5EBCA 1WWTA 4KY7A 2PW5A 3SFDB 3E6ZX 3ZYYX 3MZ5A 3I8ZA 2IJ0A 2NN6G 1RTOA 3J80E 2PMZB 1B2TA 4A90A 3Q69A 4HR7B 1QOGA 1PFBA 1TZOA 3Q8CA 5BN3A 2XVSA 4XWWA 1FR3A 3S1RB 3OWEB 3RD4A 1HQRD 1SMYD 4DF7A 2HDMA 2ID0A 5DM63 2V3PA 2F0FA 3CIRB 3I57A 4RF1A 1FD7D 2KQ3A 4ARCA 4EVOA 3U52E 5IGDA 3TZDA 2EYOA 2K1BA 1LTRD 1VZ6A 1RCVD 1QQRA 3IFTA 3ZJVA 1D6EC 1N62A 1F77A 2TSSA 1YNNC 3A8JE 1EIHA 4DQOC 2BE5C 4IFDI 1Q10A 4YWGG 2LGIA 4FNFA 2QIEB 2Y5CA 1RDPD 4DAYA 5KNDA 2E2HB 1V8QA 4OIKA 1LT6D 2PQEA 3AEEB 3TP5A 1BCPC 5CBAE 2PVOD 4OW0A 1N5WA 3LWEA 1PRTF 3TBIB 2XIWA 4ZLTF 3DXJC 1ILPA 5D3IB 5K36G 3SEBA 3GTLB 4EE2A 1V1OA 2F0WA 1DOIA 3B2GA 4J3OD 1LV9A 1JR0D 1G8ZD 3Q8BA 2EXZA 2O2LD 3K5LA 2BS2B 4UAIA 1SYFA 2K0PA 3A56A 2BYTA 3K5MA 4RKLA 3NS1A 2L55A 2H1EA 3PUWA 3E9SA 4MIUA 3W3AA 1XLPA 4V190 2ICIA 4WAFA 4HAEA 1MHXA 2TMPA 1JRPA 3GD7A 5HURA 4G57A 3AE2B 1K52A 1K8OA 4WIPA 2JXMB 5JAVA 3VR2A 3OMCA 2JX5A 3NQTA 4K6DA 1YN5A 4J6HA 3PIO3 3PO0A 2NWGA 5JXVA 3VRBB 3VR6A 1NEKB 3X3NA 3GTMB 3K5OA 2PIAA 3I73A 3Q8FA 4YTNB 2BBCA 1L4ZB 1SJED 5FK9C 3AMZA 1PZID 2WXMA 2DNEA 2MJEA 2E3TA 1TWAB 2L1BA 1VR9A 3NZ3A 2QILA 1LTGD 2HCIA 1LT3D 4KD4A 2JP1A 3PO3B 1SNDA 1ICWA 3NWSA 1EWHA 1S5DD 4ULLA 4B9XA 5J1ZA 1QCBD 1O7ZA 2MGSA 3ONAB 3VYRA 4US8A 5I2YA 4WRDA 3AMUA 2WKDA 3NSWA 2F4IA 5LL6X 4MACA 2LFNA 1STAA 1R4QB 3J81E 1HQMC 1F9SA 2JWUA 1CQFA 1QILA 4IZ8A 4C1NK 2WXQA 2LY7A 3T51B 3VR3A 4WURA 3P63A 1XF5L 1L4DB 2INNE 1CK1A 1X3QA 3A7LA 2B2VC 4DXFA 3Q0AA 2CW0D 2F0QA 2X69A 1V97A 3ABVB 1WCMB 3LX0A 4KN7C 5I9OA 2YEPB 4K6LA 3IAM1 5IGCA 4H2AA 3NBHA 1RODA 4FP5D 1KNAA 1O78A 4XIGS 2WXLA 1PUTA 5K36H 1K8MA 5D14A 1XTCD 4JBWA 4RKBA 3NBIA 3FILB 3DWQA 3TDQA 2B2TA 4LLGM 1VCIA 3I4MB 2BA1A 2EY2A 3NQIA 4KHZA 3GS2A 1H9KA 4CKEA 2W82A 1SNPA 3D8GA 3NXWA 2BB5A 2JZPA 1NSNS 1FRRA 1U4MA 3MAQA 4YSZB 5I9PA 5DEHA 3S2DB 4HCSA 2IGDA 5IODA 1EIGA 1A2TA 1OXSC 1DXMA 1SNOA 4F8MA 2MPMA 3AEGB 2BW2A 4B08A 2L32A 4MN3A 4DK0A 4F88A 3J80L 2QSDA 4OZCA 2RBMA 1MSHA 4R8NA 1V8CA 1B3AA 2PZTA 2JA6B 2LFIA 5KEEA 2XRSD 3V05A 2L12A 1S4ZA 1AEXA 1RKNA 2JYEA 2J7ZA 4NKLA 4HKZE 4XDCA 4RHRA 1EEFD 1QKZA 2K22A 3SR6A 2KOLA 1M4VA 2WNMA 2AQ2B 1SE2A 3MVVA 3C2PA 4K8JA 3EFXD 1LO5D 1IUEA 5EE1A 2ONQA 1UNSA 1R4PB 3URYA 1JWUD 1L6UA 2PYKA 1Y8NB 1KH0A 4F7XA 2EJMA 1ONLA 4RAUC 2Y3AA 4C1NI 3IXSA 3VR8B 4IFDH 3M7GA 3UI2A 5C3XA 2KUMA 1TWGB 2WXNA 2MEKA 3K6OA 2EJFC 1ZP0B 1PRTC 1TWCB 3I90A 2QDBA 1O7LA 2XWJB 1TKWB 1TWHB 1XCQL 2XWBB 1OFFA 2PW9A 1GUSA 4RWSC 2JSOA 1A3TA 1XXGA 2X6GA 2MH7A 4EGVA 2B76B 1LABA 5CV7A 4CHTB 5ELBA 5KNCA 4R9WA 4ZHOA 1EY7A 1SEBD 2Z4IA 2CHBD 1U9RA 2RMMA 3BDLA 1WYGA 1SYBA 1I50B 3R2IA 1XLQA 1IKLA 3U9OA 1AWDA 1J8IA 5C0XI 1QB5D 4KJOA 1TQOA 4KD3A 1DOYA 3A8KE 1CZGA 4DNRB 1FMAD 1XO3A 3R2TA 3K57A 5M3MB 3MWYW 1K50A 5I2XA 2HCCA 2M9VA 1Y1VB 4CJ2C 3BYTB 2F0VA 1QT9A 1EU4A 2R7ZB 1W6KA 3VA5A 1SNCA 3VQIA 2V0GA 5EKKA 3X3MA 2B8FA 3GO5A 3AN1A 4JWUC 4DK1A 4REZA 1HTPA 5ELEA 4FXCA 5KNBA 1QNUA 2LHEA 4CJ0B 5J39A 1EOTA 2Z1CA 1DCZA 3Q8EA 5EE9A 4M1UB 3I9V1 4B9WA 1GAQB 2V3NA 3LYYA 2DN8A 2IX1A 1BCPF 4JPSA 4ZRQA 1QOHA 4DGZA 1PZKD 4X3TA 3TP6A 5CMDA 2N55A 5D7GA 5EPKA 2IPKD 1NYQA 2M56B 1JWMD 2SNSA 2H88B 3T3NA 5M3FB 3IKJA 1XWEA 1FCCC 4RGMA 1YNJD 1FM0D 1LT5D 3DMUA 3EA6A 4BBRB 1MPEA 3FPUB 4XQNA 3O13A 2RVLA 1FFUA 1RHPA 2WXRA 1OO9B 1NAPA 3TMEA 4X3UA 3TUOA 3J81L 3S1QB 2PLPA 1PLFA 4IN3A 4FXKC 2N7JA 2PKOA 3BVGA 1JCKB 1EY5A 1DONA 4KGRA 1T5EA 1J9OA 3IAS1 3HP3A 5CV8A 2W54A 2KWDA 5LL6S 1A15A 2K04A 1ZEQX 2L1AA 3HGBA 1HFNA 3GTGB 1PDQA 3HRDD 4ZOHC 1V1PA 1C8CA 2EYJA 1GXDC 3NUCA 4C3IB 2X38A 3M3YB 1H9RA 4LTUA 3G7LA 5FOBB 1V43A 1TVXA 4QIWB 1UAPA 1CQVA 5FLXE 3AEFB 2VXWA 1HRJA 1TKGA 4TKOB 4KGSA 1D1KA 4PT5A 3S15B 1LACA 3P4SB 3ND8A 3SK4A 1QOFA 2HUGA 1TU2B 5M5XB 4NMZA 3K59A 2KEEA 1B44D 1EYCA 1MGSA 3MXPA 4QUFA 1EYDA 3T53B 1Y8OB 4TQ0A 3GV6A 2O4XA 3E56A 1WTVA 5BMHA 2IGHA 3KLSX 1SNQA 2JA5B 2KQ4X 1L6VA 3MHZA 2GI9A 1IYUA 4CGYB 1BR9A 1RTNA 1ZYRD 3F2UA 3MXUA 1YJJA 3M7NA 1Z7TA 3NVVA 1EY4A 4KJNA 4IDIA 2A69C 1SE4A 4PMWA 2R61A 1DOXA 1F9PA 1C79A 4RGNA 3CRLC 1I6VC 3P75A 4WFN3 3OIQA 4N9TA 2SAKA 2A6HD 2YEPF 2WXPA 1FXAA 1JWSD 3H6MA 5BYQA 2J4XA 2AWNA <