1R7SA

Putidaredoxin (fe2s2 ferredoxin), c73g mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLEGVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer
molecule keywords Putidaredoxin
publication title Structure of C73G putidaredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 28
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1r7sA00
4C7YA 5G5HA 1FXAA 3RPFC 3ABVB 1DGJA 2OHFA 1J7AA 3VR9B 1AYFA 3AE2B 2N0SB 3NVWA 3W5UB 1A70A 1RYJA 2W55A 2W54A 3HVZA 2WS3B 1GPXA 4A9AA 1ZP0B 1XLQA 2W3SA 2WU2B 1TKYA 1V97A 3AECB 3DWMA 2CU3A 2CJNA 1PDXA 2KAJA 3NRZA 4C80A 1JALA 2LEKA 4FXCA 1FXIA 2QJLA 1JWBD 1IUEA 2EKIA 2Q5WD 3P4RB 2BS2B 1FFVA 1NYRA 3P63A 1KRHA 1FM0D 2WU5B 3AB5A 4USAA 3AE1B 3SFDB 1QOFA 4YSXB 2WLBA 3B2GA 4WWMA 1XO3A 1E7PB 1N5WA 1JWAD 3AE7B 3AE5B 4HROA 1TKEA 3BIID 5GXGB 3WCQA 3KWLA 3NVYA 3W5VB 4YTPB 1JROA 1E10A 1ZOYB 1CZPA 1L0VB 1QLBB 1YQ3B 1FFUA 3HRDD 1N61A 1OQRA 4N6EB 2M19A 4KX6B 1YQ4B 5C2TB 3FAHA 1TJEA 1QOGA 1L6VA 1VJKA 4ITKA 2BT6A 3DWGC 3VR8B 3ETRA 5EE1A 1XLOA 2JQRB 1L5PA 3AE8B 3B9JA 4YTMB 3AN1A 3AEAB 5G5GA 5AUKA 2PVGC 1QT9A 3AH7A 3EUB2 1CJEA 4P6VF 1NEKB 3W9CB 1NYQA 3AEDB 4YXDB 5H8YE 1WXQA 1XLPA 2PIAA 3HUIA 1XLNA 4US8A 2MJ3A 2E3TA 5AUIA 2WDVB 3P4QB 4YSYB 1WYGA 3NS1A 3AEGB 2M56B 1JRPA 2Y5CA 1TKGA 2W3RA 5C3JB 1PUTA 1RFKA 3NVVA 1NENB 4YT0B 3ZYYX 1N63A 4JWSC 1DOYA 2PVOD 2DBYA 3LB8C 1WRIA 5EE9A 2BS3B 4N59A 1V8CA 2L52A 3LXFA 4US9A 2H88B 3AE3B 3NVZA 1AWDA 4ZOHC 1E6EB 1WGKA 1UWMA 1ZUD2 1N62A 1J7BA 1FRRA 1ZXIA 2HTME 2K5PA 2K9XA 3P4SB 1FO4A 3P1MA 1RM6C 4HRSA 3AEFB 4LTUA 1KFYB 1R7SA 2DWQA 2MJDA 4WQMA 3SR6A 1DOIA 3AMZA 1FIQA 1L6UA 2G1EA 4ZHOA 5H92C 2PKOA 3AM9A 1RWSA 1DOXA 4JX1C 2WDQB 1YJJA 3P4PB 4YSZB 5MPOA 3AEEB 1KF6B 1NVID 3PO0A 2MH7A 1OQQA 3AEBB 2BS4B 1QOBA 3SFEB 1VDVA 3L4PA 1NI3A 3CIRB 2QIEB 2ACZB 3AE9B 3FC4A 2L83A 3CWIA 2MJEA 1JW9D 2CJOA 2H89B 2WQYB 1SF0A 4ZHPA 1B9RA 1EWYC 1GAQB 1N60A 2JX5A 1VLBA 2K22A 2KMMA 2WDRB 3AE4B 1OFFA 1SIJA 3AE6B 1SB3C 3AV8A 4N58A 4YTNB 3VRBB 1PFDA 2AX5A 1FMAD 1JQ4A 1T3QA 2WP9B 1TYGB 1WWTA 1YJIA 2FBWB 4IDIA 1J7CA 1F0ZA 1FRDA 1QOAA 3B2FA 1ROEA 1N5XA 1E0ZA 4JWUC 1E9MA 1I7HA 4C7ZA 3VRAB 5EE3A 1QF6A 2B76B 5EE0A
chains in the Genus database with same CATH superfamily
1UBQA 4M01A 2KDFB 5BYSA 4K81A 2WS3B 2IGHA 4RGMA 3V61A 1WM3A 2NBUA 2IO2B 4ICVA 1PDXA 4K3BA 5DPTA 1F2RC 3AB5A 3BK1A 4OZCA 1QOFA 1H4RA 2M0XA 1XO3A 1ENFA 3LYYA 1GNUA 1GB4A 3RT3B 3VTUA 2N9KA 4W9DA 3ZVVA 3DWGC 3BZDB 3ZO5B 4GIVA 1SJHD 1IPGA 3NZSA 3N20C 4IOIE 3UIOB 2FCMA 1WZ0A 3GOEA 1WX8A 3UI3A 4II2B 3IFWB 1DOYA 2JRHA 1KH0A 1V8CA 3PSEB 4KIKB 2H88B 3MJWA 2AL6A 2KWUB 4LDTD 3SU8X 3PHWB 3QAQA 2I1KA 3A4SC 4OZAA 4WQMA 4BKSA 3VXWA 1WM2A 4ZHOA 3B1LX 2WXOA 1IGCA 3TEZA 5JHBA 2BS4B 1LFDA 2M8SA 2ACZB 3CWIA 1IBXA 4J3OD 2SEBD 1SIJA 3VRBB 3N32A 4ZRQA 1GB1A 2FE8A 4HDQA 4RNAA 1J8CA 2FBWB 2NR2A 4A55A 2ZW0A 2KLGA 4C7ZA 1TGZB 1WH3A 3RMKC 2IZVB 3BY4B 4RGNA 2WDTB 3BWUD 1WGYA 4C7YA 4HEA1 5G5HA 1FXAA 3ML9A 4ZYSA 2KDBA 4NY0A 4HPMB 4F1SA 1WX7A 3ZRCA 3HVZA 4K1RB 2BTEA 2C5LC 1GOZA 1OEYA 2LRUA 3QARA 3NRZA 2LEKA 1FXIA 3RNAC 2EKIA 1NYRA 3VAWA 1V86A 1V6EA 2KDEB 3SFDB 3H8HA 1N5WA 4KZ0A 1JWAD 2D3CA 3PZ7A 5I4DA 5HG2A 4JL9A 4C4VA 3DOWA 1N61A 1OQRA 2PW9A 4RM8A 2WXLA 5C2TB 5D94A 3VR8B 5D7GA 1L5PA 3AE8B 2XK5A 3VH4B 2ASQA 4K7SA 5BYRA 1SJED 1WXSA 1WR6E 2M4NA 4P6VF 1NYQA 4ARCA 2KX0A 2PIAA 2MJ3A 1IP9A 1C4AA 2KTRB 2A4ZA 2JZPA 1HTQA 1OGWA 4P16A 1MI0A 1NENB 5C1ZA 1UWXA 1WRIA 4N59A 1J19A 2N1VA 2KO3A 2K6QA 3SHQA 1UWMA 2N9EB 3PV1A 3KWVA 3PREA 4DHJD 2J0MA 4K7UA 2LGSA 1YJJA 2KQ4X 1KF6B 4EOYA 1VZ8A 3L17A 2MJEA 1NI2A 1Z2MA 1B9RA 2W82A 4MACA 2GOWA 3V62A 3N1XC 3R2IA 2IGGA 5DPSA 3RZFA 3ZXVA 2XEWA 4G50A 2QC8A 3H1UA 1WXAA 1JWUD 5EE3A 4XDDA 3PTFC 1LGRA 5LXIB 1J7AA 1PGBA 1F9JA 1V1PB 2MEKA 1ZP0B 1V97A 2CS4A 4FBJB 1V81A 2AQ2B 1E90A 3OG5A 2WU5B 5GMVA 3SD5A 3BK2A 1EU4A 3BVZA 3ZJVA 3UIPB 3BIID 4EZLA 2J0JA 2K39A 3NVYA 5D6JB 1Z5SB 3S2AA 1N6ZA 1CZPA 3KVFB 3HRDD 2N4FA 1KLUD 2GBKA 1NBFC 2J52A 3KLSX 3C19A 4IM2A 2D07B 4MGYE 2BW2A 4BKTA 3ZXRA 3WALA 3IBEA 1WYGA 2NS5A 2M56B 3A33B 1E5WA 4W9JA 1LQBA 4HK2A 1WX9A 4GDLA 1XEEA 3BYTB 2G4DB 2BGFA 3LXFA 2KTFA 2LD9A 2K5PA 1WRDB 2O6VD 2DWQA 2JRIB 4RF0A 1ZE3D 4ZRJA 2K8BA 5MPOA 1L0XB 3IT6B 4B9KA 3PT2B 5JHAA 1VDVA 1MPEA 3WAMA 4II3B 3WANA 3FC4A 2KFKA 3Q3JA 3BVGA 3U2SC 1LXDA 2KMMA 3N1YC 2MX2A 5HI1A 1FMAD 2O2VB 4LCDE 1STEA 1WWTA 4XWTA 3Q8BA 4KKJA 2JY6A 1F1HA 3M63B 3Q6BA 3W1SC 2DZKA 3T8MA 3ZJTA 2KVZA 4Q2JA 3KUCB 3RULA 3VHTC 4PT5A 2FCSA 2WX0A 1AYFA 3PZ8A 4LNKA 4E74A 2NVUI 3P2BA 3DWMA 3JVZX 1TKYA 4FHKA 2ZJDA 4DDGD 1PGAA 1H8CA 3QCAA 3P63A 1FCLA 4NNJB 1UF0A 3TEYA 1OQYA 4ACFA 4EFOA 3V3XA 1TS4A 1ZOYB 5HKHA 3N9YC 1XCTL 3L08A 4NQLB 1I35A 4A6QA 4M8MA 2ICIA 2JVCA 1MFWA 1YD8U 2KWVB 3PLVA 4BBNF 1SXTA 4JQWC 3AEGB 1UD7A 3PGEA 3IHPC 4ANXA 1UBIA 3K9PB 1OTRB 3EGRA 2IY1B 3FKYA 4JWSC 1R4NB 2PVOD 3LB8C 1TTNA 2OEDA 3FILB 1TT5B 1N62A 4YWGG 4D2KA 2DAJA 3LDZE 3PPAA 4MJSA 4HRSA 1KFYB 1R7SA 3DHGC 4DHJB 2EELA 3VTVA 5AZFA 3H7PA 5J18A 3RUIB 5T8IA 2DYOA 3PO0A 3RZWC 1VZ7A 4WIPA 1XD3B 1V49A 2QCZA 5BMGA 2NCNA 4BOZB 3DBSA 3AV8A 2JSVX 1UH6A 3DBHI 4RF1A 4NJ6A 4B0MA 2D2QA 1E9MA 4YL8A 4WQOB 4KZCA 3U30A 3MJ5A 2J42A 1ZDVA 3Q2AC 1WR1A 2XN9C 1E7VA 1F77A 1RYJA 2WXMA 3SDLC 3GB1A 3KYDD 2KAJA 1EU3A 1SE3A 3RN9C 4X57B 2BS2B 1XXGA 4DXGA 1K53A 1Q10A 2EMTA 4NAWB 3AE7B 3JSVB 4HROA 4WAFA 3VUYA 3J9CA 4GDKB 1E8YA 2XNAC 1WE7A 3DBRI 3H7SA 2RDHA 1YQ4B 2ZCCA 1GC6A 1VJKA 2YVCA 3O65B 1V5TA 2LRWA 1TZ1A 3A9JB 5IN7A 2BYVE 4CO7A 4WAAA 4OZBA 1KLVA 2HTHA 2KACA 4TV3A 1K50A 1YNTE 4YT0B 3EFUA 4IM3A 4KIKA 3N3KB 2IYDB 2FIFA 3AE3B 5AZHA 3O13A 2L7RA 3U8ZA 1D4BA 4ARIA 3W1YA 4EKUA 3QA8A 2RGFA 2IJ0A 5AEKB 1FEHA 1DOXA 4JX1C 1SE4A 1HEZE 3V6EB 4HXDA 1QOBA 3SFEB 2KQ7A 1ESFA 2L83A 4XGAB 2HDEA 2MW5A 4W9CA 2L76A 2JX5A 5FK9C 2WWZA 4NJ7A 2LUEA 5CTRC 1P7EA 1TS3A 2ZVOA 1WIAA 4FLHA 3ZW3A 3URYA 1N5XA 1T0RC 4LNNA 1CQVA 1S3SG 4LNOA 3V6CB 1QF6A 4OW0A 3ABVB 5KHQA 3LJ3A 1A70A 1GPXA 3QQ8B 3ZNHB 4IWQA 2WXHA 1MHXA 1FCCC 2Z0EB 1AN8A 3APCA 4USAA 4DHZE 1SBBB 2IGDA 2RPVA 2PTLA 4WJOA 3DVNU 3M95A 4H2AA 3ZKJC 4N6EB 1SIFA 3ML8A 1C3TA 2NMQA 3MP9A 2JQRB 2D11A 2DENB 1FXTB 3AH7A 3T9LA 2KTRA 1QZEA 3DDCB 3VVWB 2PE6B 2HJ8A 5TR5A 2GB1A 2K25A 3TSSA 1WMHB 2K0PA 5C3JB 4E71A 4MT5A 2DX5B 1AWDA 1C9FA 3L0WB 4FJYA 2KC2A 3SR6A 3RNCC 3MHZA 1FIQA 1WGHA 5EDSA 1V1OA 1IGDA 2G45B 3NG0A 2LJ5A 4XX5A 2JZZA 1EWCA 4GSWA 4OVUA 3V05A 4HVBA 2PEAA 4RGOS 4W9FA 4IWPA 2ZZPB 1GAQB 1WGDA 4BBNC 1VLBA 4N58A 1OFFA 4MH0E 5E6JA 3TIXA 4P7IA 2MHJA 1R4NI 3GP7A 1YJ1A 5LLIA 2V3PA 2LHEA 2IO3B 1I7HA 2G1EA 1HE8A 2I38A 3NUHB 4P1BC 1J0GA 1V1PA 2W54A 3RNGC 1U4AA 1XLQA 2IPKD 3Q3OC 2CJNA 2MSED 2VRRB 1EF5A 2K3UA 1WJNA 2G3QB 3WAOA 4XE0A 1ZKHA 3AE1B 3DHIC 2MBBB 1FNUA 3DPDA 1QQRA 5IO9A 1C1YB 1E10A 3QJZA 4HWIB 2M0AA 3M3JA 3HK0A 4ASWC 3N30A 4KX6B 3APFA 3FAHA 3ETRA 2N7JA 1V9JA 4MGZE 1P7FA 2LZ6A 3W9CB 2L05A 2RPQA 3NOBA 2AL3A 4OHJA 2WDVB 2VH2A 3MFGA 4IUMB 1SSNA 2L1AA 2KVRA 1EM7A 4UDUC 3NVVA 2OJRA 2KZRA 5JH5C 5EE9A 2BS3B 5JZEB 2C7HA 5LNK1 3PS6A 3BVMA 4LNFA 2UU7A 1DOIA 3AMZA 1L6UA 1AARA 3SEBA 3AM9A 4HCNB 5J2RA 2V0GA 1CMXB 1YMHE 1OQQA 3EA6A 2J7QB 4F8CB 3I3TB 2D10A 3VUXA 4JGHB 2O2VA 5DPRA 2I1JA 3DBHB 2BQQA 3I9V1 2KMAA 2WXFA 1T0QC 3A1QB 3GE8C 1WXVA 5DCNA 5IP4D 2KWCA 4HDOA 2OJWA 3B2FA 2V4LA 4HCPB 1YN5A 4I6LB 1WJUA 3UF8A 1R4MB 3RI7C 2ZCBA 1WE6A 4EE2A 2Z59B 3DQVA 1A5RA 4B0EA 4URKA 1T5XD 2EKEC 1C76A 4C80A 3P4RB 2Q5WD 1TS2A 3DBRB 3CF6E 4I6PA 2BYTA 3AU4A 3PRPB 2LWPA 2DHZA 1MG8A 1QLBB 2L32A 1ET9A 4CYEA 2DZJA 1TS5A 4AQ7A 1ZXHA 1L6VA 1PGXA 2BT6A 1AW7A 2BWFA 4PS7A 4AS1A 2EMSA 4OVZA 2CHZA 4E3CA 2LHDA 4US8A 5AUIA 4IG7B 4WURA 2KKCA 2KDMA 4GMVA 3X23A 2KMCA 4B6WA 1PUTA 3IG3A 3ZUNA 3RYTA 3FILA 2WXIA 2LASA 2C60A 2ZEQA 4A3PA 2A5UA 1E6EB 1YX6B 5FR6A 1ZUD2 2BB5A 1J7BA 2KQSA 4BVUC 2C9WB 1V2YA 4AP4C 4RH6A 2D5GA 2PLPA 2WXKA 4IC7B 2GRIA 3PHXB 2V4IB 4PYUA 2RDBC 2LFIA 5BYQA 2WXGA 2GBNA 1D6EC 2KWDA 1MHHE 3TCAA 4MSQB 4MSMB 1MG4A 2ONQA 5FR3A 4LDTB 3GE3C 3ALBA 2L3ZA 4FJVB 4C56C 4CQNA 3CSFA 3I5JC 4JWUC 1DYQA 3VRAB 3QWZB 4TSSA 4ZRKA 2BYFA 3NJTA 3UQAA 1DGJA 3NZ3A 1P9DU 3BINA 3NVWA 1VD2A 3I63C 2WU2B 3MC0B 2BBCA 1YN3A 2ZNVC 4NAWA 3Q3FA 3TMPB 3JSVA 2DYMA 4KGSA 4GDKA 5GXGB 2RSUA 3OAWA 4G0NB 4DXFA 1JROA 1HTOA 1YQ3B 4CHKA 1TBEA 2MP2B 5DPWA 1KM7A 2L8JA 1TJEA 2CHWA 2R2QA 3A9JA 3JYUA 1L2NA 1VZ6A 2C7NB 1I4HA 4TKNA 2AEHA 1FNWA 3AN1A 1SE2A 2BKRB 2D3AA 4W9LA 4MM3B 3TBLD 4F7ZA 4AJYB 3R3MA 4K7WA 3MC8A 4WWNA 3E56A 5D3DA 4KV2A 2DBYA 4BZAA 2M17A 4LJPB 2BWES 4NZLB 2J53A 4M02A 1ZXIA 2HTME 3P4SB 4KDIC 4WWOA 3R7QA 1RM6C 4IKGA 4KDLB 1F52A 1HQRD 4GGQA 2WXRA 1K51A 3GZNI 3A9KB 4IW0A 3AEEB 2LJIA 4KSKC 3ZGZA 3ZNGC 1TY2A 3UINB 3W2DA 2NPTB 4ANVA 2KJRA 1HZ6A 4ICUA 4GN1A 4BFRA 3QIJA 3WAPA 2JWZA 2VH1A 3R66C 4JIOU 3W1SA 3Q8FA 2X8XX 2INNE 1ZGUB 4RM9A 3JW0X 3QHTA 2N0SB 1UUPA 3IXSA 4FADA 1KOTA 1S1QB 3QC8B 4KSLC 1JALA 2QJLA 1GC7A 4HLEA 1KRHA 1FM0D 3T3OA 1CK1A 4DHZB 4YSXB 1E7PB 3KH0A 4FULA 3IT4B 3KWLA 4NAMA 3RNEC 2MQJA 1IYFA 3V60A 2GBMA 3NY5A 4FJZA 1R4MI 2JYEA 2B3AA 2CR5A 2GBJA 1V80A 3TL5A 3AXCA 1WXMA 1XLOA 4LK0M 5G5GA 2PVGC 1ZW7A 3ECIA 4J6IA 5BO4B 2N7EA 4ZRIA 1WMHA 2INPE 4LJOB 1XCQL 2VZKD 3NHEB 2ZW1A 4G11A 4A3OA 2BF8B 1FO4A 1FRRA 4W9IA 4LTUA 1YQBA 4S17A 4EZJA 4YSZB 2N7DA 3ZLZA 2FUHB 1E8XA 2NTSA 4AOFA 4KGRA 4TQ0A 3HIZA 2IO0B 4ANWA 1WY8A 5E6NA 2CKHB 2NBVB 2YEPF 3VH3B 2KN5A 1TYGB 1XF5L 4L1BA 1MJDA 2O6VB 5IOIA 4DDID 2WNMA 4MELA 1Q5WB 3TEXA 3Q8CA 2MCNB 2KLCA 2W55A 1JRUA 2FUG1 2DNFA 3RFZB 1YX5B 4NQKE 2HD5B 2ZNVB 2QILA 4WWPA 2MBQA 2RD0A 3VQIA 1TKEA 2WXNA 4M0WB 2LGYA 1HZ5A 4YTPB 4M8NA 4W9HA 1EF1A 5G2NA 2I2YA 2LGIA 3MTNB 4S0RA 3EHVA 3GS2A 1C79A 1CJEA 3NS8A 3AU5A 2N1WA 2JPHA 3Q8EA 1FNVA 3T3NA 3NS1A 1TKGA 1X1MA 4N9F4 2RR9A 1N63A 3L10B 1JWMD 1KTKA 3NVZA 1WGKA 2INDC 1JCKB 4GB9A 3ZDTA 2INCC 4BKSD 1RWSA 2PMVA 4WJNA 1BUIC 2DZMA 4FA6A 3PRMB 5HFYA 3ZIMA 2REXA 4ZHPA 2G9HD 3Q8AA 3AE6B 3VTWA 2JZ3B 3A1QA 3U7ZA 4GLSC 2DLBA 2QMTA 2MLBA 5CHVC 3DVGY 4AJWA 2W9NA 1WZ3A 2D3GA 5C23A 4XDCA 1SE9A 1UELA 3RPFC 4EUTA 2OHFA 4BOSC 3ZNZB 3X0WA 4QAYA 3I57A 2G4SA 4W9GA 3AECB 2BB6A 4MGKE 4GU2A 1JWBD 3RNBC 2V1YA 1K8RB 1Q1OA 3WCQA 2GBRA 1UZXB 2LVQA 4ANUA 1FFUA 1I4PA 3VDZA 4PS8A 3D32A 2GMIC 4O1NA 2N9XA 3AEAB 5CX3A 1QT9A 3ZRFA 1ISNA 2K1FA 2NBWB 3EUB2 3K9OB 4HKZE 3HUIA 1VRAB 4KGTA 1GUAB 1JRPA 2PJHA 1KJTA 4JPSA 2VZKB 1WFYA 1D3ZA 3ZYYX 4I6NB 2IY0B 1WYWB 1WGRA 1C4CA 4TMAB 5G55A 2E6XA 2KJHB 3GZNB 4K3CA 1C77A 4HKQA 2IDYA 3P1MA 4TUUA 2LXCA 2KHWB 2PKOA 2JF5A 2LMCA 3P4PB 2R61A 2K8CA 2XBBC 1B1ZA 3L4PA 3AE9B 3B0AA 4MDKE 1L4ZB 2UYZB 4B95A 2CJOA 2H89B 3E9SA 1WJ4A 4C00A 1I42A 1M4VA 5J17A 1T3QA 2WP9B 3Q3MC 5D3IB 1I4GA 5IKCM 2WHIA 2KFJA 1F0ZA 3UGBB 1P98A 4TQ1A 2RMMA 5TSSA 3VUWA 4WJPA 1WSPA 1UGJA 4WH4A 3ONSA 3AE2B 1QILA 2FIDA 1RRBA 4EZKA 2W3SA 1YOVB 5JXVA 4FXCA 1FFVA 2PPHA 4EEWA 3DHHC 1P3QU 4WWMA 3C0RB 4HPPA 2RDGA 2MP2A 2DAFA 1L0VB 5BMIA 5E6PA 3KQ4A 1TZOA 1I4QA 3PZDA 3HVDA 4ITKA 4W9KA 2GLSA 5FKAC 3Q14C 4XWWA 2K8HA 2MBEA 1NEKB 4MM3A 4REZA 5H8YE 3QK0A 1XLPA 4MGIE 2J4XA 2BYEA 3OLMD 2IO1B 2WYQA 1HA5A 1KLGD 2FAZA 1RFKA 2L52A 4AWJA 2JYTA 5CHFA 4MH8A 2KJ6A 2N9LA 2HE7A 2MJDA 2KYWA 3AEFB 1WJ6A 2GI9A 3A9KA 2WX1A 4NPNA 5H92C 1NDDA 1TIFA 1NVID 5HHDG 4A20A 1SEBD 2NPTA 3U52E 2LVOA 2KC1A 4L2YA 1BXTA 1D5MC 1D5XC 2WQYB 4JLCA 1EWYC 1IBXB 4YTNB 1I4XA 4HPLB 1PFDA 4AUQC 2Y5BB 4IM0A 2IBIB 2L0FA 4RGTA 4P1CC 2X38A 4BAXA 4IDIA 2DZIA 2FCNA 1QOAA 3M62B 4HJKA 1E8WA 2YLMA 4A90A 4DBGA 3W5UB 4WJQA 4DXAB 4BKGA 3OJ3A 2SAKA 2CU3A 1FD6A 4XC2A 1IUEA 3Q3NC 2MBOA 3DBLB 1ET6A 1YN4A 4ZRPA 1T6BX 3W5VB 2KNBA 1UGMA 2M19A 4C4VB 3WA0A 1WGGA 1QOGA 2MWSB 2QDFA 5EE1A 1VR9A 2WXPA 1VCBA 2NTTA 3B08A 2KDIA 2XK5B 1WXQA 1XLNA 3L16A 1E7UA 4R3DA 3HM3A 3R2TA 4DWFA 3EFCA 2BVCA 4RCOA 2Y5PA 2WXJA 4US9A 4GXBA 3DVNV 4ZOHC 2L0TA 4XYCA 4PK1A 2KX3A 2BPSA 3RNFC 3IAS1 4RMAA 2M1MA 3UQBA 2JWUA 1WF9A 5D2MB 4A8XC 1BMLC 3Q69A 2AWTA 3AEBB 1NI3A 3CIRB 2QIEB 3DCGA 1JW9D 4FHJA 1N60A 3AE4B 2OOBB 1SB3C 3CMMB 1T0YA 1EO6A 2ZPYA 2O6VA 2LGDA 1C78A 3TJPA 1TY0A 3AI5A 3ZQ4A 1GJZA 1FRDA 1QKZA 2KANA 2K6DB 2MA9B 4KKIA 1M94A 3TEWA 2Y3AA 2DYBA 3VR9B 2JXTA 2ZVNA 3PRZA 5BMHA 4DK5A 4A9AA 3OWEB 3H6NA 3R7RA 4JE3B 2V3SA 1OEYJ 5CHWA 2QHOA 3RD2A 2QEJC 3ENEA 1ACCA 4M0WA 3AE5B 2WXQA 3L13A 4W9EA 2V3NA 2KD0A 2MRPA 2YEPB 4LLGM 1Y8RC 2AYOB 3TUOA 3B9JA 4YTMB 2LVPA 3IAM1 2E3TA 4XZ4A 3P4QB 3R8BA 4MEMA 2KK8A 3A4RA 3QX1A 1MVKA 2W3RA 4NJCA 1T0SC 2C7MB 1FPYA 4DQOC 4GDLB 1P0RA 2KN4A 1JMLA 2MBHA 1G6JA 3C8YA 2WDQB 2KXJA 1WI0A 1V5OA 3PLUA 2MH7A 3ZNID 4L23A 2Z8LA 2Z0DB 1ZDXA 1GG3A 3CSTA 1C4PA 2KFKB 4PYZA 4LNIA 1YJIA 3RCZA 1PYWD 2ZPNA 5L83A 3KW5B 3EECA 1I4RA 2JXXA 5IA7A 3HM6X 1RFAA 2AQ1B 2TSSA 3EC8A 1SGHA 4GOCA 2R2OA 1D5ZC 3KUZA 1RLFA 2L00B 3ZTDA 3NZUA 4FN2A 2HJ1A 1JWSD 2CHXA 5E6OA 1BT0A 2JU6X 3ZDMC 5LXHA 2WLBA 3B2GA 3N1ZC 1L7YA 1EUVB 2ON8A 2J0KA 2AQ3B 2CU1A 3H9DA 1XQQA 3HHMA 2N9PC 2D3BA 3DVGX 2WGSA 4OVVA 2LI5A 1F2RI 1UNSA 1HXYD 1Q0WB 1L0YB 3BYYB 1Y56A 5AUKA 3IVFA 3KUDB 4PS3A 3AEDB 2BKFA 1LO5D 4YXDB 1P1AA 3ZTCA 4YSYB 2Y5CA 3MHSD 2PE9A 2LXAA 1E8ZA 5AZGA 2FNJB 4M00A 3DBLI 3VFKA 1L4DB 3L54A 2JUOA 1K52A 3ZJUA 3MC9A 2K9XA 2UWQA 3PVLA 4G3XB 3U7DA 4MJSB 2JT4B 2KOXA 2QSDA 3APDA 3H7PB 3AULA 4IWOA 4HJGE 3U4EG 2KT7A 2LGXA 2FCQA 3OJ4B 1SF0A 4RFBA 2K22A 2V9HA 2WDRB 1RAXA 1YIWA 3P42A 1LM8B 5IAAC 3WIMA 5KHOA 2AX5A 1JQ4A 1XT9B 5L95C 3KYCD 4KVGB 1J7CA 1ROEA 2LUMA 1PQSA 4ZDVA 1ZPSA 1E0ZA 4ZYNA 2B76B 5EE0A
chains in the Genus database with same CATH topology
2J42A 1ZDVA 4WH4A 1DGJA 3NZ3A 5BYSA 2XN9C 3AE2B 3NVWA 1QILA 1RYJA 1F77A 2WXMA 2WS3B 2IGHA 4RGMA 3GB1A 2W3SA 2WU2B 3MC0B 2BBCA 1YN3A 1PDXA 2KAJA 1EU3A 5JXVA 4FXCA 1SE3A 2BS2B 1XXGA 4DXGA 1FFVA 1K53A 1Q10A 1F2RC 3AB5A 3BK1A 4NAWB 4OZCA 1QOFA 2DYMA 4KGSA 4WWMA 1XO3A 3AE7B 4WAFA 4HROA 5GXGB 3J9CA 1ENFA 2RDGA 3LYYA 4GDKB 4DXFA 1JROA 1L0VB 5BMIA 1YQ3B 2XNAC 1GB4A 2N9KA 2RDHA 1YQ4B 1TJEA 3KQ4A 1TZOA 1I4QA 1VJKA 3HVDA 4ITKA 1VZ6A 3DWGC 1I4HA 3BZDB 5FKAC 1FNWA 3AN1A 4XWWA 1SE2A 1SJHD 1NEKB 4REZA 5H8YE 1XLPA 4OZBA 4IOIE 4MM3B 2J4XA 2KACA 1K50A 1HA5A 1KLGD 1YNTE 3E56A 3UI3A 5D3DA 1RFKA 4YT0B 1DOYA 2DBYA 1KH0A 1V8CA 2L52A 2JYTA 2H88B 3AE3B 4NZLB 3O13A 4MH8A 1D4BA 4ARIA 2J53A 1ZXIA 2HTME 3P4SB 1RM6C 2N9LA 3AEFB 2MJDA 4IKGA 4OZAA 2IJ0A 4WQMA 1HQRD 2GI9A 2WXRA 1FEHA 4ZHOA 5H92C 1K51A 2WXOA 1DOXA 4JX1C 1IGCA 1SE4A 1HEZE 3AEEB 1NVID 2LJIA 3TEZA 2BS4B 1QOBA 3SFEB 5HHDG 3ZGZA 1SEBD 1ESFA 2ACZB 1TY2A 2L83A 3U52E 3CWIA 4L2YA 1BXTA 2HDEA 3W2DA 1IBXA 1D5MC 1D5XC 2WQYB 4J3OD 1EWYC 2JX5A 2SEBD 5FK9C 1IBXB 1SIJA 4YTNB 3VRBB 1I4XA 1PFDA 4ZRQA 1GB1A 1HZ6A 1P7EA 2FE8A 4RNAA 1TS3A 4RGTA 2X38A 2FBWB 4A55A 2ZW0A 4IDIA 1QOAA 3URYA 1N5XA 4C7ZA 3W1SA 3Q8FA 1CQVA 4RGNA 3BWUD 4A90A 2INNE 1QF6A 4C7YA 4OW0A 4HEA1 5G5HA 1FXAA 4ZYSA 3ABVB 3W5UB 2N0SB 1A70A 1UUPA 3HVZA 3IXSA 1GPXA 2SAKA 2BTEA 2CU3A 1FD6A 1GOZA 2WXHA 3NRZA 1MHXA 1JALA 1FCCC 2LEKA 1FXIA 2QJLA 2EKIA 1IUEA 1AN8A 1NYRA 1KRHA 1FM0D 4USAA 3T3OA 1SBBB 2IGDA 3SFDB 2RPVA 3H8HA 1CK1A 2PTLA 4YSXB 1E7PB 1ET6A 1JWAD 1N5WA 3PZ7A 4H2AA 3IT4B 1YN4A 4ZRPA 1T6BX 3KWLA 4NAMA 5I4DA 3W5VB 5HG2A 4N6EB 1N61A 1OQRA 2PW9A 2M19A 2JYEA 2WXLA 5C2TB 1QOGA 2NMQA 3MP9A 3VR8B 5EE1A 1XLOA 2JQRB 5D7GA 1L5PA 3AE8B 1VR9A 4LK0M 5G5GA 2WXPA 2PVGC 3AH7A 5BYRA 1SJED 2NTTA 4P6VF 1NYQA 4ARCA 1WXQA 2PIAA 1XLNA 2MJ3A 1C4AA 2GB1A 2INPE 4R3DA 1XCQL 2JZPA 2VZKD 4P16A 3TSSA 1MI0A 2K0PA 3R2TA 5C3JB 1NENB 1UWXA 4RCOA 2Y5PA 1WRIA 2ZW1A 4N59A 4MT5A 2WXJA 4US9A 1AWDA 4ZOHC 1C9FA 1UWMA 3KWVA 1FO4A 1FRRA 4LTUA 3SR6A 3MHZA 1FIQA 1V1OA 1IGDA 3IAS1 2JWUA 1YJJA 4YSZB 2KQ4X 1KF6B 4A8XC 1BMLC 3Q69A 3AEBB 2NTSA 1EWCA 3V05A 1NI3A 1VZ8A 3CIRB 2QIEB 4KGRA 4TQ0A 4RGOS 2MJEA 1JW9D 1B9RA 1GAQB 1N60A 2W82A 1VLBA 3AE4B 4N58A 1OFFA 1SB3C 5E6JA 2YEPF 4MACA 1TYGB 1XF5L 4L1BA 3GP7A 1C78A 3R2IA 2V3PA 1TY0A 2IGGA 2LHEA 3ZQ4A 1FRDA 2WNMA 1QKZA 1I7HA 4KKIA 1JWUD 3TEXA 5EE0A 5EE3A 2G1EA 4XDDA 3Q8CA 3TEWA 2I38A 2Y3AA 3NUHB 1J7AA 2JXTA 3VR9B 1V1PA 5BMHA 2W55A 1PGBA 2W54A 1V1PB 2MEKA 3OWEB 1ZP0B 1XLQA 2FUG1 2IPKD 1V97A 4JE3B 4A9AA 2CJNA 2AQ2B 3RFZB 2K3UA 4XE0A 2WU5B 2QEJC 3AE1B 2QILA 3BK2A 1FNUA 1ACCA 1EU4A 3BVZA 4M0WA 3VQIA 3ZJVA 3AE5B 1TKEA 2WXNA 3BIID 2WXQA 3NVYA 1QQRA 1HZ5A 4YTPB 1E10A 1CZPA 3HRDD 2V3NA 2M0AA 2I2YA 1KLUD 2LGIA 2YEPB 4KX6B 3FAHA 4LLGM 2J52A 3KLSX 3ETRA 3GS2A 2N7JA 3TUOA 3B9JA 1C79A 4YTMB 2BW2A 1CJEA 1P7FA 3W9CB 3IAM1 4OHJA 2E3TA 2WDVB 3MFGA 3P4QB 1WYGA 3Q8EA 3R8BA 1FNVA 1SSNA 2L1AA 3NS1A 3T3NA 2M56B 1EM7A 1TKGA 1MVKA 4UDUC 2W3RA 3NVVA 1N63A 4NJCA 5EE9A 1XEEA 2BS3B 3BYTB 1JWMD 3LXFA 1KTKA 4DQOC 3NVZA 4GDLB 1WGKA 2KN4A 5LNK1 2K5PA 3BVMA 2DWQA 1DOIA 3AMZA 1JCKB 4RF0A 1L6UA 1JMLA 1ZE3D 3SEBA 3AM9A 1RWSA 3C8YA 2WDQB 2PMVA 5MPOA 2V0GA 1BUIC 1L0XB 1YMHE 3IT6B 2MH7A 1OQQA 5HFYA 1VDVA 3EA6A 1MPEA 4L23A 2Z8LA 3FC4A 1ZDXA 3BVGA 4ZHPA 1C4PA 2G9HD 3U2SC 3Q8AA 2KMMA 3AE6B 3U7ZA 4GLSC 5HI1A 2DLBA 2QMTA 3I9V1 1FMAD 2WXFA 1STEA 1WWTA 1YJIA 4XWTA 3Q8BA 1PYWD 4KKJA 3B2FA 3ZJTA 1YN5A 4XDCA 1I4RA 4Q2JA 4PT5A 2AQ1B 2TSSA 3RPFC 2OHFA 4EE2A 1D5ZC 1AYFA 3PZ8A 3I57A 3DWMA 4B0EA 1TKYA 3AECB 1T5XD 1C76A 2BB6A 1PGAA 4C80A 1JWBD 2Q5WD 3P4RB 1TS2A 1JWSD 3P63A 1FCLA 2JU6X 3TEYA 2WLBA 3B2GA 2BYTA 3WCQA 2ON8A 2AQ3B 3V3XA 1TS4A 1ZOYB 1QLBB 2L32A 1ET9A 1FFUA 1I4PA 3N9YC 1F2RI 1TS5A 1XCTL 1UNSA 1HXYD 4AQ7A 1L0YB 1ZXHA 1L6VA 1PGXA 2BT6A 1AW7A 3BYYB 4AS1A 4O1NA 1Y56A 4OVZA 4A6QA 3AEAB 5AUKA 1QT9A 2LHDA 2ICIA 3EUB2 3AEDB 4YXDB 1LO5D 4HKZE 3HUIA 4US8A 1SXTA 5AUIA 1VRAB 4WURA 4YSYB 2KDMA 4KGTA 3AEGB 2Y5CA 1JRPA 4JPSA 3EGRA 2VZKB 1PUTA 3ZYYX 4JWSC 2PVOD 3LB8C 3FILA 1L4DB 2WXIA 1C4CA 4TMAB 2OEDA 3FILB 1E6EB 1K52A 2E6XA 1ZUD2 1N62A 2BB5A 4YWGG 1J7BA 4D2KA 1C77A 3ZJUA 2K9XA 4HKQA 2IDYA 3P1MA 4HRSA 1KFYB 1R7SA 2EELA 2PKOA 2QSDA 4RH6A 2LMCA 5T8IA 3P4PB 2D5GA 2DYOA 2PLPA 3PO0A 2R61A 2WXKA 4HJGE 3U4EG 1B1ZA 1VZ7A 2GRIA 3L4PA 2V4IB 4WIPA 5BYQA 2LFIA 2WXGA 3AE9B 1L4ZB 5BMGA 2CJOA 1D6EC 2H89B 3E9SA 1SF0A 4RFBA 2KWDA 2K22A 2WDRB 1MHHE 3AV8A 3P42A 1M4VA 2AX5A 2ONQA 5FR3A 1T3QA 1JQ4A 2WP9B 5D3IB 2JSVX 1I4GA 1J7CA 1F0ZA 4RF1A 4C56C 1ROEA 4B0MA 4TQ1A 2LUMA 2RMMA 5TSSA 1ZPSA 4JWUC 1E9MA 4CQNA 1E0ZA 1DYQA 3VRAB 1WSPA 4TSSA 3MJ5A 2B76B 1UGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7Y A;  5G5H A;  1FXA A;  3RPF C;  3ABV B;  1DGJ A;  2OHF A;  1J7A A;  3VR9 B;  1AYF A;  3AE2 B;  2N0S B;  3NVW A;  3W5U B;  1A70 A;  1RYJ A;  2W55 A;  2W54 A;  3HVZ A;  2WS3 B;  1GPX A;  4A9A A;  1ZP0 B;  1XLQ A;  2W3S A;  2WU2 B;  1TKY A;  1V97 A;  3AEC B;  3DWM A;  2CU3 A;  2CJN A;  1PDX A;  2KAJ A;  3NRZ A;  4C80 A;  1JAL A;  2LEK A;  4FXC A;  1FXI A;  2QJL A;  1JWB D;  1IUE A;  2EKI A;  2Q5W D;  3P4R B;  2BS2 B;  1FFV A;  1NYR A;  3P63 A;  1KRH A;  1FM0 D;  2WU5 B;  3AB5 A;  4USA A;  3AE1 B;  3SFD B;  1QOF A;  4YSX B;  2WLB A;  3B2G A;  4WWM A;  1XO3 A;  1E7P B;  1N5W A;  1JWA D;  3AE7 B;  3AE5 B;  4HRO A;  1TKE A;  3BII D;  5GXG B;  3WCQ A;  3KWL A;  3NVY A;  3W5V B;  4YTP B;  1JRO A;  1E10 A;  1ZOY B;  1CZP A;  1L0V B;  1QLB B;  1YQ3 B;  1FFU A;  3HRD D;  1N61 A;  1OQR A;  4N6E B;  2M19 A;  4KX6 B;  1YQ4 B;  5C2T B;  3FAH A;  1TJE A;  1QOG A;  1L6V A;  1VJK A;  4ITK A;  2BT6 A;  3DWG C;  3VR8 B;  3ETR A;  5EE1 A;  1XLO A;  2JQR B;  1L5P A;  3AE8 B;  3B9J A;  4YTM B;  3AN1 A;  3AEA B;  5G5G A;  5AUK A;  2PVG C;  1QT9 A;  3AH7 A;  3EUB 2;  1CJE A;  4P6V F;  1NEK B;  3W9C B;  1NYQ A;  3AED B;  4YXD B;  5H8Y E;  1WXQ A;  1XLP A;  2PIA A;  3HUI A;  1XLN A;  4US8 A;  2MJ3 A;  2E3T A;  5AUI A;  2WDV B;  3P4Q B;  4YSY B;  1WYG A;  3NS1 A;  3AEG B;  2M56 B;  1JRP A;  2Y5C A;  1TKG A;  2W3R A;  5C3J B;  1PUT A;  1RFK A;  3NVV A;  1NEN B;  4YT0 B;  3ZYY X;  1N63 A;  4JWS C;  1DOY A;  2PVO D;  2DBY A;  3LB8 C;  1WRI A;  5EE9 A;  2BS3 B;  4N59 A;  1V8C A;  2L52 A;  3LXF A;  4US9 A;  2H88 B;  3AE3 B;  3NVZ A;  1AWD A;  4ZOH C;  1E6E B;  1WGK A;  1UWM A;  1ZUD 2;  1N62 A;  1J7B A;  1FRR A;  1ZXI A;  2HTM E;  2K5P A;  2K9X A;  3P4S B;  1FO4 A;  3P1M A;  1RM6 C;  4HRS A;  3AEF B;  4LTU A;  1KFY B;  1R7S A;  2DWQ A;  2MJD A;  4WQM A;  3SR6 A;  1DOI A;  3AMZ A;  1FIQ A;  1L6U A;  2G1E A;  4ZHO A;  5H92 C;  2PKO A;  3AM9 A;  1RWS A;  1DOX A;  4JX1 C;  2WDQ B;  1YJJ A;  3P4P B;  4YSZ B;  5MPO A;  3AEE B;  1KF6 B;  1NVI D;  3PO0 A;  2MH7 A;  1OQQ A;  3AEB B;  2BS4 B;  1QOB A;  3SFE B;  1VDV A;  3L4P A;  1NI3 A;  3CIR B;  2QIE B;  2ACZ B;  3AE9 B;  3FC4 A;  2L83 A;  3CWI A;  2MJE A;  1JW9 D;  2CJO A;  2H89 B;  2WQY B;  1SF0 A;  4ZHP A;  1B9R A;  1EWY C;  1GAQ B;  1N60 A;  2JX5 A;  1VLB A;  2K22 A;  2KMM A;  2WDR B;  3AE4 B;  1OFF A;  1SIJ A;  3AE6 B;  1SB3 C;  3AV8 A;  4N58 A;  4YTN B;  3VRB B;  1PFD A;  2AX5 A;  1FMA D;  1JQ4 A;  1T3Q A;  2WP9 B;  1TYG B;  1WWT A;  1YJI A;  2FBW B;  4IDI A;  1J7C A;  1F0Z A;  1FRD A;  1QOA A;  3B2F A;  1ROE A;  1N5X A;  1E0Z A;  4JWU C;  1E9M A;  1I7H A;  4C7Z A;  3VRA B;  5EE3 A;  1QF6 A;  2B76 B;  5EE0 A; 
#chains in the Genus database with same CATH topology
 1UBQ A;  4M01 A;  2KDF B;  5BYS A;  4K81 A;  2WS3 B;  2IGH A;  4RGM A;  3V61 A;  1WM3 A;  2NBU A;  2IO2 B;  4ICV A;  1PDX A;  4K3B A;  5DPT A;  1F2R C;  3AB5 A;  3BK1 A;  4OZC A;  1QOF A;  1H4R A;  2M0X A;  1XO3 A;  1ENF A;  3LYY A;  1GNU A;  1GB4 A;  3RT3 B;  3VTU A;  2N9K A;  4W9D A;  3ZVV A;  3DWG C;  3BZD B;  3ZO5 B;  4GIV A;  1SJH D;  1IPG A;  3NZS A;  3N20 C;  4IOI E;  3UIO B;  2FCM A;  1WZ0 A;  3GOE A;  1WX8 A;  3UI3 A;  4II2 B;  3IFW B;  1DOY A;  2JRH A;  1KH0 A;  1V8C A;  3PSE B;  4KIK B;  2H88 B;  3MJW A;  2AL6 A;  2KWU B;  4LDT D;  3SU8 X;  3PHW B;  3QAQ A;  2I1K A;  3A4S C;  4OZA A;  4WQM A;  4BKS A;  3VXW A;  1WM2 A;  4ZHO A;  3B1L X;  2WXO A;  1IGC A;  3TEZ A;  5JHB A;  2BS4 B;  1LFD A;  2M8S A;  2ACZ B;  3CWI A;  1IBX A;  4J3O D;  2SEB D;  1SIJ A;  3VRB B;  3N32 A;  4ZRQ A;  1GB1 A;  2FE8 A;  4HDQ A;  4RNA A;  1J8C A;  2FBW B;  2NR2 A;  4A55 A;  2ZW0 A;  2KLG A;  4C7Z A;  1TGZ B;  1WH3 A;  3RMK C;  2IZV B;  3BY4 B;  4RGN A;  2WDT B;  3BWU D;  1WGY A;  4C7Y A;  4HEA 1;  5G5H A;  1FXA A;  3ML9 A;  4ZYS A;  2KDB A;  4NY0 A;  4HPM B;  4F1S A;  1WX7 A;  3ZRC A;  3HVZ A;  4K1R B;  2BTE A;  2C5L C;  1GOZ A;  1OEY A;  2LRU A;  3QAR A;  3NRZ A;  2LEK A;  1FXI A;  3RNA C;  2EKI A;  1NYR A;  3VAW A;  1V86 A;  1V6E A;  2KDE B;  3SFD B;  3H8H A;  1N5W A;  4KZ0 A;  1JWA D;  2D3C A;  3PZ7 A;  5I4D A;  5HG2 A;  4JL9 A;  4C4V A;  3DOW A;  1N61 A;  1OQR A;  2PW9 A;  4RM8 A;  2WXL A;  5C2T B;  5D94 A;  3VR8 B;  5D7G A;  1L5P A;  3AE8 B;  2XK5 A;  3VH4 B;  2ASQ A;  4K7S A;  5BYR A;  1SJE D;  1WXS A;  1WR6 E;  2M4N A;  4P6V F;  1NYQ A;  4ARC A;  2KX0 A;  2PIA A;  2MJ3 A;  1IP9 A;  1C4A A;  2KTR B;  2A4Z A;  2JZP A;  1HTQ A;  1OGW A;  4P16 A;  1MI0 A;  1NEN B;  5C1Z A;  1UWX A;  1WRI A;  4N59 A;  1J19 A;  2N1V A;  2KO3 A;  2K6Q A;  3SHQ A;  1UWM A;  2N9E B;  3PV1 A;  3KWV A;  3PRE A;  4DHJ D;  2J0M A;  4K7U A;  2LGS A;  1YJJ A;  2KQ4 X;  1KF6 B;  4EOY A;  1VZ8 A;  3L17 A;  2MJE A;  1NI2 A;  1Z2M A;  1B9R A;  2W82 A;  4MAC A;  2GOW A;  3V62 A;  3N1X C;  3R2I A;  2IGG A;  5DPS A;  3RZF A;  3ZXV A;  2XEW A;  4G50 A;  2QC8 A;  3H1U A;  1WXA A;  1JWU D;  5EE3 A;  4XDD A;  3PTF C;  1LGR A;  5LXI B;  1J7A A;  1PGB A;  1F9J A;  1V1P B;  2MEK A;  1ZP0 B;  1V97 A;  2CS4 A;  4FBJ B;  1V81 A;  2AQ2 B;  1E90 A;  3OG5 A;  2WU5 B;  5GMV A;  3SD5 A;  3BK2 A;  1EU4 A;  3BVZ A;  3ZJV A;  3UIP B;  3BII D;  4EZL A;  2J0J A;  2K39 A;  3NVY A;  5D6J B;  1Z5S B;  3S2A A;  1N6Z A;  1CZP A;  3KVF B;  3HRD D;  2N4F A;  1KLU D;  2GBK A;  1NBF C;  2J52 A;  3KLS X;  3C19 A;  4IM2 A;  2D07 B;  4MGY E;  2BW2 A;  4BKT A;  3ZXR A;  3WAL A;  3IBE A;  1WYG A;  2NS5 A;  2M56 B;  3A33 B;  1E5W A;  4W9J A;  1LQB A;  4HK2 A;  1WX9 A;  4GDL A;  1XEE A;  3BYT B;  2G4D B;  2BGF A;  3LXF A;  2KTF A;  2LD9 A;  2K5P A;  1WRD B;  2O6V D;  2DWQ A;  2JRI B;  4RF0 A;  1ZE3 D;  4ZRJ A;  2K8B A;  5MPO A;  1L0X B;  3IT6 B;  4B9K A;  3PT2 B;  5JHA A;  1VDV A;  1MPE A;  3WAM A;  4II3 B;  3WAN A;  3FC4 A;  2KFK A;  3Q3J A;  3BVG A;  3U2S C;  1LXD A;  2KMM A;  3N1Y C;  2MX2 A;  5HI1 A;  1FMA D;  2O2V B;  4LCD E;  1STE A;  1WWT A;  4XWT A;  3Q8B A;  4KKJ A;  2JY6 A;  1F1H A;  3M63 B;  3Q6B A;  3W1S C;  2DZK A;  3T8M A;  3ZJT A;  2KVZ A;  4Q2J A;  3KUC B;  3RUL A;  3VHT C;  4PT5 A;  2FCS A;  2WX0 A;  1AYF A;  3PZ8 A;  4LNK A;  4E74 A;  2NVU I;  3P2B A;  3DWM A;  3JVZ X;  1TKY A;  4FHK A;  2ZJD A;  4DDG D;  1PGA A;  1H8C A;  3QCA A;  3P63 A;  1FCL A;  4NNJ B;  1UF0 A;  3TEY A;  1OQY A;  4ACF A;  4EFO A;  3V3X A;  1TS4 A;  1ZOY B;  5HKH A;  3N9Y C;  1XCT L;  3L08 A;  4NQL B;  1I35 A;  4A6Q A;  4M8M A;  2ICI A;  2JVC A;  1MFW A;  1YD8 U;  2KWV B;  3PLV A;  4BBN F;  1SXT A;  4JQW C;  3AEG B;  1UD7 A;  3PGE A;  3IHP C;  4ANX A;  1UBI A;  3K9P B;  1OTR B;  3EGR A;  2IY1 B;  3FKY A;  4JWS C;  1R4N B;  2PVO D;  3LB8 C;  1TTN A;  2OED A;  3FIL B;  1TT5 B;  1N62 A;  4YWG G;  4D2K A;  2DAJ A;  3LDZ E;  3PPA A;  4MJS A;  4HRS A;  1KFY B;  1R7S A;  3DHG C;  4DHJ B;  2EEL A;  3VTV A;  5AZF A;  3H7P A;  5J18 A;  3RUI B;  5T8I A;  2DYO A;  3PO0 A;  3RZW C;  1VZ7 A;  4WIP A;  1XD3 B;  1V49 A;  2QCZ A;  5BMG A;  2NCN A;  4BOZ B;  3DBS A;  3AV8 A;  2JSV X;  1UH6 A;  3DBH I;  4RF1 A;  4NJ6 A;  4B0M A;  2D2Q A;  1E9M A;  4YL8 A;  4WQO B;  4KZC A;  3U30 A;  3MJ5 A;  2J42 A;  1ZDV A;  3Q2A C;  1WR1 A;  2XN9 C;  1E7V A;  1F77 A;  1RYJ A;  2WXM A;  3SDL C;  3GB1 A;  3KYD D;  2KAJ A;  1EU3 A;  1SE3 A;  3RN9 C;  4X57 B;  2BS2 B;  1XXG A;  4DXG A;  1K53 A;  1Q10 A;  2EMT A;  4NAW B;  3AE7 B;  3JSV B;  4HRO A;  4WAF A;  3VUY A;  3J9C A;  4GDK B;  1E8Y A;  2XNA C;  1WE7 A;  3DBR I;  3H7S A;  2RDH A;  1YQ4 B;  2ZCC A;  1GC6 A;  1VJK A;  2YVC A;  3O65 B;  1V5T A;  2LRW A;  1TZ1 A;  3A9J B;  5IN7 A;  2BYV E;  4CO7 A;  4WAA A;  4OZB A;  1KLV A;  2HTH A;  2KAC A;  4TV3 A;  1K50 A;  1YNT E;  4YT0 B;  3EFU A;  4IM3 A;  4KIK A;  3N3K B;  2IYD B;  2FIF A;  3AE3 B;  5AZH A;  3O13 A;  2L7R A;  3U8Z A;  1D4B A;  4ARI A;  3W1Y A;  4EKU A;  3QA8 A;  2RGF A;  2IJ0 A;  5AEK B;  1FEH A;  1DOX A;  4JX1 C;  1SE4 A;  1HEZ E;  3V6E B;  4HXD A;  1QOB A;  3SFE B;  2KQ7 A;  1ESF A;  2L83 A;  4XGA B;  2HDE A;  2MW5 A;  4W9C A;  2L76 A;  2JX5 A;  5FK9 C;  2WWZ A;  4NJ7 A;  2LUE A;  5CTR C;  1P7E A;  1TS3 A;  2ZVO A;  1WIA A;  4FLH A;  3ZW3 A;  3URY A;  1N5X A;  1T0R C;  4LNN A;  1CQV A;  1S3S G;  4LNO A;  3V6C B;  1QF6 A;  4OW0 A;  3ABV B;  5KHQ A;  3LJ3 A;  1A70 A;  1GPX A;  3QQ8 B;  3ZNH B;  4IWQ A;  2WXH A;  1MHX A;  1FCC C;  2Z0E B;  1AN8 A;  3APC A;  4USA A;  4DHZ E;  1SBB B;  2IGD A;  2RPV A;  2PTL A;  4WJO A;  3DVN U;  3M95 A;  4H2A A;  3ZKJ C;  4N6E B;  1SIF A;  3ML8 A;  1C3T A;  2NMQ A;  3MP9 A;  2JQR B;  2D11 A;  2DEN B;  1FXT B;  3AH7 A;  3T9L A;  2KTR A;  1QZE A;  3DDC B;  3VVW B;  2PE6 B;  2HJ8 A;  5TR5 A;  2GB1 A;  2K25 A;  3TSS A;  1WMH B;  2K0P A;  5C3J B;  4E71 A;  4MT5 A;  2DX5 B;  1AWD A;  1C9F A;  3L0W B;  4FJY A;  2KC2 A;  3SR6 A;  3RNC C;  3MHZ A;  1FIQ A;  1WGH A;  5EDS A;  1V1O A;  1IGD A;  2G45 B;  3NG0 A;  2LJ5 A;  4XX5 A;  2JZZ A;  1EWC A;  4GSW A;  4OVU A;  3V05 A;  4HVB A;  2PEA A;  4RGO S;  4W9F A;  4IWP A;  2ZZP B;  1GAQ B;  1WGD A;  4BBN C;  1VLB A;  4N58 A;  1OFF A;  4MH0 E;  5E6J A;  3TIX A;  4P7I A;  2MHJ A;  1R4N I;  3GP7 A;  1YJ1 A;  5LLI A;  2V3P A;  2LHE A;  2IO3 B;  1I7H A;  2G1E A;  1HE8 A;  2I38 A;  3NUH B;  4P1B C;  1J0G A;  1V1P A;  2W54 A;  3RNG C;  1U4A A;  1XLQ A;  2IPK D;  3Q3O C;  2CJN A;  2MSE D;  2VRR B;  1EF5 A;  2K3U A;  1WJN A;  2G3Q B;  3WAO A;  4XE0 A;  1ZKH A;  3AE1 B;  3DHI C;  2MBB B;  1FNU A;  3DPD A;  1QQR A;  5IO9 A;  1C1Y B;  1E10 A;  3QJZ A;  4HWI B;  2M0A A;  3M3J A;  3HK0 A;  4ASW C;  3N30 A;  4KX6 B;  3APF A;  3FAH A;  3ETR A;  2N7J A;  1V9J A;  4MGZ E;  1P7F A;  2LZ6 A;  3W9C B;  2L05 A;  2RPQ A;  3NOB A;  2AL3 A;  4OHJ A;  2WDV B;  2VH2 A;  3MFG A;  4IUM B;  1SSN A;  2L1A A;  2KVR A;  1EM7 A;  4UDU C;  3NVV A;  2OJR A;  2KZR A;  5JH5 C;  5EE9 A;  2BS3 B;  5JZE B;  2C7H A;  5LNK 1;  3PS6 A;  3BVM A;  4LNF A;  2UU7 A;  1DOI A;  3AMZ A;  1L6U A;  1AAR A;  3SEB A;  3AM9 A;  4HCN B;  5J2R A;  2V0G A;  1CMX B;  1YMH E;  1OQQ A;  3EA6 A;  2J7Q B;  4F8C B;  3I3T B;  2D10 A;  3VUX A;  4JGH B;  2O2V A;  5DPR A;  2I1J A;  3DBH B;  2BQQ A;  3I9V 1;  2KMA A;  2WXF A;  1T0Q C;  3A1Q B;  3GE8 C;  1WXV A;  5DCN A;  5IP4 D;  2KWC A;  4HDO A;  2OJW A;  3B2F A;  2V4L A;  4HCP B;  1YN5 A;  4I6L B;  1WJU A;  3UF8 A;  1R4M B;  3RI7 C;  2ZCB A;  1WE6 A;  4EE2 A;  2Z59 B;  3DQV A;  1A5R A;  4B0E A;  4URK A;  1T5X D;  2EKE C;  1C76 A;  4C80 A;  3P4R B;  2Q5W D;  1TS2 A;  3DBR B;  3CF6 E;  4I6P A;  2BYT A;  3AU4 A;  3PRP B;  2LWP A;  2DHZ A;  1MG8 A;  1QLB B;  2L32 A;  1ET9 A;  4CYE A;  2DZJ A;  1TS5 A;  4AQ7 A;  1ZXH A;  1L6V A;  1PGX A;  2BT6 A;  1AW7 A;  2BWF A;  4PS7 A;  4AS1 A;  2EMS A;  4OVZ A;  2CHZ A;  4E3C A;  2LHD A;  4US8 A;  5AUI A;  4IG7 B;  4WUR A;  2KKC A;  2KDM A;  4GMV A;  3X23 A;  2KMC A;  4B6W A;  1PUT A;  3IG3 A;  3ZUN A;  3RYT A;  3FIL A;  2WXI A;  2LAS A;  2C60 A;  2ZEQ A;  4A3P A;  2A5U A;  1E6E B;  1YX6 B;  5FR6 A;  1ZUD 2;  2BB5 A;  1J7B A;  2KQS A;  4BVU C;  2C9W B;  1V2Y A;  4AP4 C;  4RH6 A;  2D5G A;  2PLP A;  2WXK A;  4IC7 B;  2GRI A;  3PHX B;  2V4I B;  4PYU A;  2RDB C;  2LFI A;  5BYQ A;  2WXG A;  2GBN A;  1D6E C;  2KWD A;  1MHH E;  3TCA A;  4MSQ B;  4MSM B;  1MG4 A;  2ONQ A;  5FR3 A;  4LDT B;  3GE3 C;  3ALB A;  2L3Z A;  4FJV B;  4C56 C;  4CQN A;  3CSF A;  3I5J C;  4JWU C;  1DYQ A;  3VRA B;  3QWZ B;  4TSS A;  4ZRK A;  2BYF A;  3NJT A;  3UQA A;  1DGJ A;  3NZ3 A;  1P9D U;  3BIN A;  3NVW A;  1VD2 A;  3I63 C;  2WU2 B;  3MC0 B;  2BBC A;  1YN3 A;  2ZNV C;  4NAW A;  3Q3F A;  3TMP B;  3JSV A;  2DYM A;  4KGS A;  4GDK A;  5GXG B;  2RSU A;  3OAW A;  4G0N B;  4DXF A;  1JRO A;  1HTO A;  1YQ3 B;  4CHK A;  1TBE A;  2MP2 B;  5DPW A;  1KM7 A;  2L8J A;  1TJE A;  2CHW A;  2R2Q A;  3A9J A;  3JYU A;  1L2N A;  1VZ6 A;  2C7N B;  1I4H A;  4TKN A;  2AEH A;  1FNW A;  3AN1 A;  1SE2 A;  2BKR B;  2D3A A;  4W9L A;  4MM3 B;  3TBL D;  4F7Z A;  4AJY B;  3R3M A;  4K7W A;  3MC8 A;  4WWN A;  3E56 A;  5D3D A;  4KV2 A;  2DBY A;  4BZA A;  2M17 A;  4LJP B;  2BWE S;  4NZL B;  2J53 A;  4M02 A;  1ZXI A;  2HTM E;  3P4S B;  4KDI C;  4WWO A;  3R7Q A;  1RM6 C;  4IKG A;  4KDL B;  1F52 A;  1HQR D;  4GGQ A;  2WXR A;  1K51 A;  3GZN I;  3A9K B;  4IW0 A;  3AEE B;  2LJI A;  4KSK C;  3ZGZ A;  3ZNG C;  1TY2 A;  3UIN B;  3W2D A;  2NPT B;  4ANV A;  2KJR A;  1HZ6 A;  4ICU A;  4GN1 A;  4BFR A;  3QIJ A;  3WAP A;  2JWZ A;  2VH1 A;  3R66 C;  4JIO U;  3W1S A;  3Q8F A;  2X8X X;  2INN E;  1ZGU B;  4RM9 A;  3JW0 X;  3QHT A;  2N0S B;  1UUP A;  3IXS A;  4FAD A;  1KOT A;  1S1Q B;  3QC8 B;  4KSL C;  1JAL A;  2QJL A;  1GC7 A;  4HLE A;  1KRH A;  1FM0 D;  3T3O A;  1CK1 A;  4DHZ B;  4YSX B;  1E7P B;  3KH0 A;  4FUL A;  3IT4 B;  3KWL A;  4NAM A;  3RNE C;  2MQJ A;  1IYF A;  3V60 A;  2GBM A;  3NY5 A;  4FJZ A;  1R4M I;  2JYE A;  2B3A A;  2CR5 A;  2GBJ A;  1V80 A;  3TL5 A;  3AXC A;  1WXM A;  1XLO A;  4LK0 M;  5G5G A;  2PVG C;  1ZW7 A;  3ECI A;  4J6I A;  5BO4 B;  2N7E A;  4ZRI A;  1WMH A;  2INP E;  4LJO B;  1XCQ L;  2VZK D;  3NHE B;  2ZW1 A;  4G11 A;  4A3O A;  2BF8 B;  1FO4 A;  1FRR A;  4W9I A;  4LTU A;  1YQB A;  4S17 A;  4EZJ A;  4YSZ B;  2N7D A;  3ZLZ A;  2FUH B;  1E8X A;  2NTS A;  4AOF A;  4KGR A;  4TQ0 A;  3HIZ A;  2IO0 B;  4ANW A;  1WY8 A;  5E6N A;  2CKH B;  2NBV B;  2YEP F;  3VH3 B;  2KN5 A;  1TYG B;  1XF5 L;  4L1B A;  1MJD A;  2O6V B;  5IOI A;  4DDI D;  2WNM A;  4MEL A;  1Q5W B;  3TEX A;  3Q8C A;  2MCN B;  2KLC A;  2W55 A;  1JRU A;  2FUG 1;  2DNF A;  3RFZ B;  1YX5 B;  4NQK E;  2HD5 B;  2ZNV B;  2QIL A;  4WWP A;  2MBQ A;  2RD0 A;  3VQI A;  1TKE A;  2WXN A;  4M0W B;  2LGY A;  1HZ5 A;  4YTP B;  4M8N A;  4W9H A;  1EF1 A;  5G2N A;  2I2Y A;  2LGI A;  3MTN B;  4S0R A;  3EHV A;  3GS2 A;  1C79 A;  1CJE A;  3NS8 A;  3AU5 A;  2N1W A;  2JPH A;  3Q8E A;  1FNV A;  3T3N A;  3NS1 A;  1TKG A;  1X1M A;  4N9F 4;  2RR9 A;  1N63 A;  3L10 B;  1JWM D;  1KTK A;  3NVZ A;  1WGK A;  2IND C;  1JCK B;  4GB9 A;  3ZDT A;  2INC C;  4BKS D;  1RWS A;  2PMV A;  4WJN A;  1BUI C;  2DZM A;  4FA6 A;  3PRM B;  5HFY A;  3ZIM A;  2REX A;  4ZHP A;  2G9H D;  3Q8A A;  3AE6 B;  3VTW A;  2JZ3 B;  3A1Q A;  3U7Z A;  4GLS C;  2DLB A;  2QMT A;  2MLB A;  5CHV C;  3DVG Y;  4AJW A;  2W9N A;  1WZ3 A;  2D3G A;  5C23 A;  4XDC A;  1SE9 A;  1UEL A;  3RPF C;  4EUT A;  2OHF A;  4BOS C;  3ZNZ B;  3X0W A;  4QAY A;  3I57 A;  2G4S A;  4W9G A;  3AEC B;  2BB6 A;  4MGK E;  4GU2 A;  1JWB D;  3RNB C;  2V1Y A;  1K8R B;  1Q1O A;  3WCQ A;  2GBR A;  1UZX B;  2LVQ A;  4ANU A;  1FFU A;  1I4P A;  3VDZ A;  4PS8 A;  3D32 A;  2GMI C;  4O1N A;  2N9X A;  3AEA B;  5CX3 A;  1QT9 A;  3ZRF A;  1ISN A;  2K1F A;  2NBW B;  3EUB 2;  3K9O B;  4HKZ E;  3HUI A;  1VRA B;  4KGT A;  1GUA B;  1JRP A;  2PJH A;  1KJT A;  4JPS A;  2VZK B;  1WFY A;  1D3Z A;  3ZYY X;  4I6N B;  2IY0 B;  1WYW B;  1WGR A;  1C4C A;  4TMA B;  5G55 A;  2E6X A;  2KJH B;  3GZN B;  4K3C A;  1C77 A;  4HKQ A;  2IDY A;  3P1M A;  4TUU A;  2LXC A;  2KHW B;  2PKO A;  2JF5 A;  2LMC A;  3P4P B;  2R61 A;  2K8C A;  2XBB C;  1B1Z A;  3L4P A;  3AE9 B;  3B0A A;  4MDK E;  1L4Z B;  2UYZ B;  4B95 A;  2CJO A;  2H89 B;  3E9S A;  1WJ4 A;  4C00 A;  1I42 A;  1M4V A;  5J17 A;  1T3Q A;  2WP9 B;  3Q3M C;  5D3I B;  1I4G A;  5IKC M;  2WHI A;  2KFJ A;  1F0Z A;  3UGB B;  1P98 A;  4TQ1 A;  2RMM A;  5TSS A;  3VUW A;  4WJP A;  1WSP A;  1UGJ A;  4WH4 A;  3ONS A;  3AE2 B;  1QIL A;  2FID A;  1RRB A;  4EZK A;  2W3S A;  1YOV B;  5JXV A;  4FXC A;  1FFV A;  2PPH A;  4EEW A;  3DHH C;  1P3Q U;  4WWM A;  3C0R B;  4HPP A;  2RDG A;  2MP2 A;  2DAF A;  1L0V B;  5BMI A;  5E6P A;  3KQ4 A;  1TZO A;  1I4Q A;  3PZD A;  3HVD A;  4ITK A;  4W9K A;  2GLS A;  5FKA C;  3Q14 C;  4XWW A;  2K8H A;  2MBE A;  1NEK B;  4MM3 A;  4REZ A;  5H8Y E;  3QK0 A;  1XLP A;  4MGI E;  2J4X A;  2BYE A;  3OLM D;  2IO1 B;  2WYQ A;  1HA5 A;  1KLG D;  2FAZ A;  1RFK A;  2L52 A;  4AWJ A;  2JYT A;  5CHF A;  4MH8 A;  2KJ6 A;  2N9L A;  2HE7 A;  2MJD A;  2KYW A;  3AEF B;  1WJ6 A;  2GI9 A;  3A9K A;  2WX1 A;  4NPN A;  5H92 C;  1NDD A;  1TIF A;  1NVI D;  5HHD G;  4A20 A;  1SEB D;  2NPT A;  3U52 E;  2LVO A;  2KC1 A;  4L2Y A;  1BXT A;  1D5M C;  1D5X C;  2WQY B;  4JLC A;  1EWY C;  1IBX B;  4YTN B;  1I4X A;  4HPL B;  1PFD A;  4AUQ C;  2Y5B B;  4IM0 A;  2IBI B;  2L0F A;  4RGT A;  4P1C C;  2X38 A;  4BAX A;  4IDI A;  2DZI A;  2FCN A;  1QOA A;  3M62 B;  4HJK A;  1E8W A;  2YLM A;  4A90 A;  4DBG A;  3W5U B;  4WJQ A;  4DXA B;  4BKG A;  3OJ3 A;  2SAK A;  2CU3 A;  1FD6 A;  4XC2 A;  1IUE A;  3Q3N C;  2MBO A;  3DBL B;  1ET6 A;  1YN4 A;  4ZRP A;  1T6B X;  3W5V B;  2KNB A;  1UGM A;  2M19 A;  4C4V B;  3WA0 A;  1WGG A;  1QOG A;  2MWS B;  2QDF A;  5EE1 A;  1VR9 A;  2WXP A;  1VCB A;  2NTT A;  3B08 A;  2KDI A;  2XK5 B;  1WXQ A;  1XLN A;  3L16 A;  1E7U A;  4R3D A;  3HM3 A;  3R2T A;  4DWF A;  3EFC A;  2BVC A;  4RCO A;  2Y5P A;  2WXJ A;  4US9 A;  4GXB A;  3DVN V;  4ZOH C;  2L0T A;  4XYC A;  4PK1 A;  2KX3 A;  2BPS A;  3RNF C;  3IAS 1;  4RMA A;  2M1M A;  3UQB A;  2JWU A;  1WF9 A;  5D2M B;  4A8X C;  1BML C;  3Q69 A;  2AWT A;  3AEB B;  1NI3 A;  3CIR B;  2QIE B;  3DCG A;  1JW9 D;  4FHJ A;  1N60 A;  3AE4 B;  2OOB B;  1SB3 C;  3CMM B;  1T0Y A;  1EO6 A;  2ZPY A;  2O6V A;  2LGD A;  1C78 A;  3TJP A;  1TY0 A;  3AI5 A;  3ZQ4 A;  1GJZ A;  1FRD A;  1QKZ A;  2KAN A;  2K6D B;  2MA9 B;  4KKI A;  1M94 A;  3TEW A;  2Y3A A;  2DYB A;  3VR9 B;  2JXT A;  2ZVN A;  3PRZ A;  5BMH A;  4DK5 A;  4A9A A;  3OWE B;  3H6N A;  3R7R A;  4JE3 B;  2V3S A;  1OEY J;  5CHW A;  2QHO A;  3RD2 A;  2QEJ C;  3ENE A;  1ACC A;  4M0W A;  3AE5 B;  2WXQ A;  3L13 A;  4W9E A;  2V3N A;  2KD0 A;  2MRP A;  2YEP B;  4LLG M;  1Y8R C;  2AYO B;  3TUO A;  3B9J A;  4YTM B;  2LVP A;  3IAM 1;  2E3T A;  4XZ4 A;  3P4Q B;  3R8B A;  4MEM A;  2KK8 A;  3A4R A;  3QX1 A;  1MVK A;  2W3R A;  4NJC A;  1T0S C;  2C7M B;  1FPY A;  4DQO C;  4GDL B;  1P0R A;  2KN4 A;  1JML A;  2MBH A;  1G6J A;  3C8Y A;  2WDQ B;  2KXJ A;  1WI0 A;  1V5O A;  3PLU A;  2MH7 A;  3ZNI D;  4L23 A;  2Z8L A;  2Z0D B;  1ZDX A;  1GG3 A;  3CST A;  1C4P A;  2KFK B;  4PYZ A;  4LNI A;  1YJI A;  3RCZ A;  1PYW D;  2ZPN A;  5L83 A;  3KW5 B;  3EEC A;  1I4R A;  2JXX A;  5IA7 A;  3HM6 X;  1RFA A;  2AQ1 B;  2TSS A;  3EC8 A;  1SGH A;  4GOC A;  2R2O A;  1D5Z C;  3KUZ A;  1RLF A;  2L00 B;  3ZTD A;  3NZU A;  4FN2 A;  2HJ1 A;  1JWS D;  2CHX A;  5E6O A;  1BT0 A;  2JU6 X;  3ZDM C;  5LXH A;  2WLB A;  3B2G A;  3N1Z C;  1L7Y A;  1EUV B;  2ON8 A;  2J0K A;  2AQ3 B;  2CU1 A;  3H9D A;  1XQQ A;  3HHM A;  2N9P C;  2D3B A;  3DVG X;  2WGS A;  4OVV A;  2LI5 A;  1F2R I;  1UNS A;  1HXY D;  1Q0W B;  1L0Y B;  3BYY B;  1Y56 A;  5AUK A;  3IVF A;  3KUD B;  4PS3 A;  3AED B;  2BKF A;  1LO5 D;  4YXD B;  1P1A A;  3ZTC A;  4YSY B;  2Y5C A;  3MHS D;  2PE9 A;  2LXA A;  1E8Z A;  5AZG A;  2FNJ B;  4M00 A;  3DBL I;  3VFK A;  1L4D B;  3L54 A;  2JUO A;  1K52 A;  3ZJU A;  3MC9 A;  2K9X A;  2UWQ A;  3PVL A;  4G3X B;  3U7D A;  4MJS B;  2JT4 B;  2KOX A;  2QSD A;  3APD A;  3H7P B;  3AUL A;  4IWO A;  4HJG E;  3U4E G;  2KT7 A;  2LGX A;  2FCQ A;  3OJ4 B;  1SF0 A;  4RFB A;  2K22 A;  2V9H A;  2WDR B;  1RAX A;  1YIW A;  3P42 A;  1LM8 B;  5IAA C;  3WIM A;  5KHO A;  2AX5 A;  1JQ4 A;  1XT9 B;  5L95 C;  3KYC D;  4KVG B;  1J7C A;  1ROE A;  2LUM A;  1PQS A;  4ZDV A;  1ZPS A;  1E0Z A;  4ZYN A;  2B76 B;  5EE0 A; 
#chains in the Genus database with same CATH homology
 2J42 A;  1ZDV A;  4WH4 A;  1DGJ A;  3NZ3 A;  5BYS A;  2XN9 C;  3AE2 B;  3NVW A;  1QIL A;  1RYJ A;  1F77 A;  2WXM A;  2WS3 B;  2IGH A;  4RGM A;  3GB1 A;  2W3S A;  2WU2 B;  3MC0 B;  2BBC A;  1YN3 A;  1PDX A;  2KAJ A;  1EU3 A;  5JXV A;  4FXC A;  1SE3 A;  2BS2 B;  1XXG A;  4DXG A;  1FFV A;  1K53 A;  1Q10 A;  1F2R C;  3AB5 A;  3BK1 A;  4NAW B;  4OZC A;  1QOF A;  2DYM A;  4KGS A;  4WWM A;  1XO3 A;  3AE7 B;  4WAF A;  4HRO A;  5GXG B;  3J9C A;  1ENF A;  2RDG A;  3LYY A;  4GDK B;  4DXF A;  1JRO A;  1L0V B;  5BMI A;  1YQ3 B;  2XNA C;  1GB4 A;  2N9K A;  2RDH A;  1YQ4 B;  1TJE A;  3KQ4 A;  1TZO A;  1I4Q A;  1VJK A;  3HVD A;  4ITK A;  1VZ6 A;  3DWG C;  1I4H A;  3BZD B;  5FKA C;  1FNW A;  3AN1 A;  4XWW A;  1SE2 A;  1SJH D;  1NEK B;  4REZ A;  5H8Y E;  1XLP A;  4OZB A;  4IOI E;  4MM3 B;  2J4X A;  2KAC A;  1K50 A;  1HA5 A;  1KLG D;  1YNT E;  3E56 A;  3UI3 A;  5D3D A;  1RFK A;  4YT0 B;  1DOY A;  2DBY A;  1KH0 A;  1V8C A;  2L52 A;  2JYT A;  2H88 B;  3AE3 B;  4NZL B;  3O13 A;  4MH8 A;  1D4B A;  4ARI A;  2J53 A;  1ZXI A;  2HTM E;  3P4S B;  1RM6 C;  2N9L A;  3AEF B;  2MJD A;  4IKG A;  4OZA A;  2IJ0 A;  4WQM A;  1HQR D;  2GI9 A;  2WXR A;  1FEH A;  4ZHO A;  5H92 C;  1K51 A;  2WXO A;  1DOX A;  4JX1 C;  1IGC A;  1SE4 A;  1HEZ E;  3AEE B;  1NVI D;  2LJI A;  3TEZ A;  2BS4 B;  1QOB A;  3SFE B;  5HHD G;  3ZGZ A;  1SEB D;  1ESF A;  2ACZ B;  1TY2 A;  2L83 A;  3U52 E;  3CWI A;  4L2Y A;  1BXT A;  2HDE A;  3W2D A;  1IBX A;  1D5M C;  1D5X C;  2WQY B;  4J3O D;  1EWY C;  2JX5 A;  2SEB D;  5FK9 C;  1IBX B;  1SIJ A;  4YTN B;  3VRB B;  1I4X A;  1PFD A;  4ZRQ A;  1GB1 A;  1HZ6 A;  1P7E A;  2FE8 A;  4RNA A;  1TS3 A;  4RGT A;  2X38 A;  2FBW B;  4A55 A;  2ZW0 A;  4IDI A;  1QOA A;  3URY A;  1N5X A;  4C7Z A;  3W1S A;  3Q8F A;  1CQV A;  4RGN A;  3BWU D;  4A90 A;  2INN E;  1QF6 A;  4C7Y A;  4OW0 A;  4HEA 1;  5G5H A;  1FXA A;  4ZYS A;  3ABV B;  3W5U B;  2N0S B;  1A70 A;  1UUP A;  3HVZ A;  3IXS A;  1GPX A;  2SAK A;  2BTE A;  2CU3 A;  1FD6 A;  1GOZ A;  2WXH A;  3NRZ A;  1MHX A;  1JAL A;  1FCC C;  2LEK A;  1FXI A;  2QJL A;  2EKI A;  1IUE A;  1AN8 A;  1NYR A;  1KRH A;  1FM0 D;  4USA A;  3T3O A;  1SBB B;  2IGD A;  3SFD B;  2RPV A;  3H8H A;  1CK1 A;  2PTL A;  4YSX B;  1E7P B;  1ET6 A;  1JWA D;  1N5W A;  3PZ7 A;  4H2A A;  3IT4 B;  1YN4 A;  4ZRP A;  1T6B X;  3KWL A;  4NAM A;  5I4D A;  3W5V B;  5HG2 A;  4N6E B;  1N61 A;  1OQR A;  2PW9 A;  2M19 A;  2JYE A;  2WXL A;  5C2T B;  1QOG A;  2NMQ A;  3MP9 A;  3VR8 B;  5EE1 A;  1XLO A;  2JQR B;  5D7G A;  1L5P A;  3AE8 B;  1VR9 A;  4LK0 M;  5G5G A;  2WXP A;  2PVG C;  3AH7 A;  5BYR A;  1SJE D;  2NTT A;  4P6V F;  1NYQ A;  4ARC A;  1WXQ A;  2PIA A;  1XLN A;  2MJ3 A;  1C4A A;  2GB1 A;  2INP E;  4R3D A;  1XCQ L;  2JZP A;  2VZK D;  4P16 A;  3TSS A;  1MI0 A;  2K0P A;  3R2T A;  5C3J B;  1NEN B;  1UWX A;  4RCO A;  2Y5P A;  1WRI A;  2ZW1 A;  4N59 A;  4MT5 A;  2WXJ A;  4US9 A;  1AWD A;  4ZOH C;  1C9F A;  1UWM A;  3KWV A;  1FO4 A;  1FRR A;  4LTU A;  3SR6 A;  3MHZ A;  1FIQ A;  1V1O A;  1IGD A;  3IAS 1;  2JWU A;  1YJJ A;  4YSZ B;  2KQ4 X;  1KF6 B;  4A8X C;  1BML C;  3Q69 A;  3AEB B;  2NTS A;  1EWC A;  3V05 A;  1NI3 A;  1VZ8 A;  3CIR B;  2QIE B;  4KGR A;  4TQ0 A;  4RGO S;  2MJE A;  1JW9 D;  1B9R A;  1GAQ B;  1N60 A;  2W82 A;  1VLB A;  3AE4 B;  4N58 A;  1OFF A;  1SB3 C;  5E6J A;  2YEP F;  4MAC A;  1TYG B;  1XF5 L;  4L1B A;  3GP7 A;  1C78 A;  3R2I A;  2V3P A;  1TY0 A;  2IGG A;  2LHE A;  3ZQ4 A;  1FRD A;  2WNM A;  1QKZ A;  1I7H A;  4KKI A;  1JWU D;  3TEX A;  5EE0 A;  5EE3 A;  2G1E A;  4XDD A;  3Q8C A;  3TEW A;  2I38 A;  2Y3A A;  3NUH B;  1J7A A;  2JXT A;  3VR9 B;  1V1P A;  5BMH A;  2W55 A;  1PGB A;  2W54 A;  1V1P B;  2MEK A;  3OWE B;  1ZP0 B;  1XLQ A;  2FUG 1;  2IPK D;  1V97 A;  4JE3 B;  4A9A A;  2CJN A;  2AQ2 B;  3RFZ B;  2K3U A;  4XE0 A;  2WU5 B;  2QEJ C;  3AE1 B;  2QIL A;  3BK2 A;  1FNU A;  1ACC A;  1EU4 A;  3BVZ A;  4M0W A;  3VQI A;  3ZJV A;  3AE5 B;  1TKE A;  2WXN A;  3BII D;  2WXQ A;  3NVY A;  1QQR A;  1HZ5 A;  4YTP B;  1E10 A;  1CZP A;  3HRD D;  2V3N A;  2M0A A;  2I2Y A;  1KLU D;  2LGI A;  2YEP B;  4KX6 B;  3FAH A;  4LLG M;  2J52 A;  3KLS X;  3ETR A;  3GS2 A;  2N7J A;  3TUO A;  3B9J A;  1C79 A;  4YTM B;  2BW2 A;  1CJE A;  1P7F A;  3W9C B;  3IAM 1;  4OHJ A;  2E3T A;  2WDV B;  3MFG A;  3P4Q B;  1WYG A;  3Q8E A;  3R8B A;  1FNV A;  1SSN A;  2L1A A;  3NS1 A;  3T3N A;  2M56 B;  1EM7 A;  1TKG A;  1MVK A;  4UDU C;  2W3R A;  3NVV A;  1N63 A;  4NJC A;  5EE9 A;  1XEE A;  2BS3 B;  3BYT B;  1JWM D;  3LXF A;  1KTK A;  4DQO C;  3NVZ A;  4GDL B;  1WGK A;  2KN4 A;  5LNK 1;  2K5P A;  3BVM A;  2DWQ A;  1DOI A;  3AMZ A;  1JCK B;  4RF0 A;  1L6U A;  1JML A;  1ZE3 D;  3SEB A;  3AM9 A;  1RWS A;  3C8Y A;  2WDQ B;  2PMV A;  5MPO A;  2V0G A;  1BUI C;  1L0X B;  1YMH E;  3IT6 B;  2MH7 A;  1OQQ A;  5HFY A;  1VDV A;  3EA6 A;  1MPE A;  4L23 A;  2Z8L A;  3FC4 A;  1ZDX A;  3BVG A;  4ZHP A;  1C4P A;  2G9H D;  3U2S C;  3Q8A A;  2KMM A;  3AE6 B;  3U7Z A;  4GLS C;  5HI1 A;  2DLB A;  2QMT A;  3I9V 1;  1FMA D;  2WXF A;  1STE A;  1WWT A;  1YJI A;  4XWT A;  3Q8B A;  1PYW D;  4KKJ A;  3B2F A;  3ZJT A;  1YN5 A;  4XDC A;  1I4R A;  4Q2J A;  4PT5 A;  2AQ1 B;  2TSS A;  3RPF C;  2OHF A;  4EE2 A;  1D5Z C;  1AYF A;  3PZ8 A;  3I57 A;  3DWM A;  4B0E A;  1TKY A;  3AEC B;  1T5X D;  1C76 A;  2BB6 A;  1PGA A;  4C80 A;  1JWB D;  2Q5W D;  3P4R B;  1TS2 A;  1JWS D;  3P63 A;  1FCL A;  2JU6 X;  3TEY A;  2WLB A;  3B2G A;  2BYT A;  3WCQ A;  2ON8 A;  2AQ3 B;  3V3X A;  1TS4 A;  1ZOY B;  1QLB B;  2L32 A;  1ET9 A;  1FFU A;  1I4P A;  3N9Y C;  1F2R I;  1TS5 A;  1XCT L;  1UNS A;  1HXY D;  4AQ7 A;  1L0Y B;  1ZXH A;  1L6V A;  1PGX A;  2BT6 A;  1AW7 A;  3BYY B;  4AS1 A;  4O1N A;  1Y56 A;  4OVZ A;  4A6Q A;  3AEA B;  5AUK A;  1QT9 A;  2LHD A;  2ICI A;  3EUB 2;  3AED B;  4YXD B;  1LO5 D;  4HKZ E;  3HUI A;  4US8 A;  1SXT A;  5AUI A;  1VRA B;  4WUR A;  4YSY B;  2KDM A;  4KGT A;  3AEG B;  2Y5C A;  1JRP A;  4JPS A;  3EGR A;  2VZK B;  1PUT A;  3ZYY X;  4JWS C;  2PVO D;  3LB8 C;  3FIL A;  1L4D B;  2WXI A;  1C4C A;  4TMA B;  2OED A;  3FIL B;  1E6E B;  1K52 A;  2E6X A;  1ZUD 2;  1N62 A;  2BB5 A;  4YWG G;  1J7B A;  4D2K A;  1C77 A;  3ZJU A;  2K9X A;  4HKQ A;  2IDY A;  3P1M A;  4HRS A;  1KFY B;  1R7S A;  2EEL A;  2PKO A;  2QSD A;  4RH6 A;  2LMC A;  5T8I A;  3P4P B;  2D5G A;  2DYO A;  2PLP A;  3PO0 A;  2R61 A;  2WXK A;  4HJG E;  3U4E G;  1B1Z A;  1VZ7 A;  2GRI A;  3L4P A;  2V4I B;  4WIP A;  5BYQ A;  2LFI A;  2WXG A;  3AE9 B;  1L4Z B;  5BMG A;  2CJO A;  1D6E C;  2H89 B;  3E9S A;  1SF0 A;  4RFB A;  2KWD A;  2K22 A;  2WDR B;  1MHH E;  3AV8 A;  3P42 A;  1M4V A;  2AX5 A;  2ONQ A;  5FR3 A;  1T3Q A;  1JQ4 A;  2WP9 B;  5D3I B;  2JSV X;  1I4G A;  1J7C A;  1F0Z A;  4RF1 A;  4C56 C;  1ROE A;  4B0M A;  4TQ1 A;  2LUM A;  2RMM A;  5TSS A;  1ZPS A;  4JWU C;  1E9M A;  4CQN A;  1E0Z A;  1DYQ A;  3VRA B;  1WSP A;  4TSS A;  3MJ5 A;  2B76 B;  1UGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...