1R7SA

Putidaredoxin (fe2s2 ferredoxin), c73g mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLEGVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Structure of C73G putidaredoxin from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transfer
total genus 28
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1r7sA00
3NVZA 3B9JA 1QOBA 4JWUC 2QIEB 3LXFA 1FO4A 1RWSA 3AEAB 3SFDB 3EUB2 2CJOA 1R7SA 1UWMA 4ZOHC 4HROA 2W3SA 4FXCA 3SFEB 2HTME 1FM0D 2QJLA 1JWAD 1DOXA 3FAHA 3P4SB 1XLQA 1J7AA 1IUEA 2WLBA 3B2FA 5MPOA 3AE2B 3CWIA 3AEGB 1VJKA 2WP9B 4YXDB 1E9MA 2H89B 2KMMA 4WQMA 4YTPB 1DOIA 5AUKA 1OQQA 3AE4B 1NI3A 2PIAA 3ABVB 1KF6B 2WDVB 2H88B 1E0ZA 1ZUD2 2G1EA 1FXAA 3HUIA 1ZOYB 2K5PA 3ETRA 5EE0A 1CJEA 3DWGC 3P4PB 1I7HA 2WDRB 1V8CA 5AUIA 4ZHPA 2M56B 1OQRA 3HVZA 4YSXB 3AEEB 2Q5WD 2WS3B 4US9A 1E10A 1FFVA 3WCQA 4YTNB 2BS2B 3B2GA 1TKEA 1VDVA 1FRRA 1QOAA 1RM6C 1YQ3B 1N5WA 1N62A 1PUTA 2ACZB 2OHFA 3AEBB 3P63A 1F0ZA 1KFYB 4ITKA 2MJEA 3AN1A 3AV8A 4WWMA 2MJDA 1XO3A 5H92C 4HRSA 1FXIA 1PFDA 3AEDB 4N58A 4YSYB 3LB8C 5G5HA 5GXGB 1YQ4B 3ZYYX 1NVID 1V97A 2WU2B 3P1MA 2Y5CA 1WYGA 2AX5A 3W5UB 3DWMA 4YSZB 2K22A 3AE7B 2KAJA 1VLBA 2BS4B 2W55A 3AE8B 1QLBB 1NEKB 1NYQA 2MJ3A 4A9AA 1TYGB 3CIRB 4C80A 2W3RA 1N61A 1ZP0B 3AE5B 4P6VF 5EE1A 1L6VA 1NYRA 5H8YE 2B76B 1L0VB 1L5PA 3BIID 4LTUA 3RPFC 4YTMB 1E6EB 4JWSC 3NVYA 1A70A 3AE9B 1FRDA 1WGKA 2BT6A 2K9XA 4N59A 1EWYC 1T3QA 4ZHOA 1RYJA 3HRDD 1JRPA 3L4PA 1N60A 2CJNA 5EE9A 4USAA 4C7ZA 3PO0A 1JWBD 2W54A 3AECB 3NS1A 1L6UA 1QOFA 3P4QB 1SB3C 1FIQA 1JW9D 1ZXIA 2DWQA 2E3TA 2JX5A 1OFFA 1J7BA 3AE6B 3NRZA 4US8A 3W9CB 5C3JB 1SF0A 2LEKA 1GPXA 3KWLA 4KX6B 4IDIA 1QF6A 3VR8B 1RFKA 5EE3A 3VRBB 1E7PB 1ROEA 1GAQB 1YJIA 2PVOD 3NVVA 1DOYA 2DBYA 5G5GA 1JQ4A 2PVGC 1JROA 1WRIA 3NVWA 1XLNA 1WXQA 1YJJA 1TKYA 1AWDA 1JALA 1KRHA 2PKOA 1SIJA 3AEFB 1N63A 3VRAB 1B9RA 3SR6A 5C2TB 3AE3B 1WWTA 1J7CA 2EKIA 3AH7A 1XLOA 4YT0B 2N0SB 3AM9A 1QT9A 2L52A 2BS3B 2WQYB 1DGJA 1NENB 3FC4A 1TJEA 2WU5B 3P4RB 2L83A 1CZPA 2FBWB 3AB5A 3AE1B 2M19A 1XLPA 1FMAD 3AMZA 1TKGA 4N6EB 3W5VB 1AYFA 2CU3A 3VR9B 1PDXA 2WDQB 2JQRB 1QOGA 2MH7A 4C7YA 1FFUA 1N5XA 4JX1C
chains in the Genus database with same CATH superfamily
2L32A 4HLEA 4NPNA 4DDID 2K0PA 3FAHA 1WZ0A 3B2FA 1VZ6A 3W1YA 1E9MA 1LFDA 3UQBA 2XN9C 5G2NA 3KYCD 2ZCCA 2N1VA 4MH0E 3ENEA 1CJEA 4II3B 1V8CA 4RGNA 4RNAA 1E10A 3AXCA 1FNWA 1FRRA 1P1AA 5FKAC 1B1ZA 5D3DA 4LK0M 2INPE 2E6XA 3IBEA 3MHSD 4E3CA 3JSVB 4DXAB 3EA6A 3AE8B 3IAM1 1EF5A 3B1LX 4DHZE 3C0RB 1Q0WB 2GRIA 2BW2A 3HVDA 2GBRA 3W2DA 4WH4A 4LTUA 2GBNA 2FCQA 5AZHA 5IP4D 2LHEA 4K7SA 2K8BA 4NJCA 2L7RA 1I35A 4FJYA 2CJNA 3SD5A 1T0SC 3IXSA 3PLUA 2N9EB 3U8ZA 3PT2B 1JW9D 4H2AA 4GDKB 4MELA 4TQ1A 4K1RB 2IGDA 1IGCA 2KN5A 4W9GA 4W9LA 3VRAB 2INNE 3VXWA 4D2KA 4ZRQA 3BZDB 3KVFB 3OJ4B 4EOYA 3RUIB 2WXFA 1TTNA 1WMHB 4GOCA 1SJED 3ECIA 1N6ZA 1EU4A 5T8IA 2QIEB 2WXOA 4FHKA 1L2NA 2W3SA 1WZ3A 1JWAD 1DOXA 2REXA 4M00A 2WLBA 3QJZA 4NAMA 3AULA 3DDCB 2K8HA 2L8JA 2KLCA 1SXTA 3HUIA 1ZOYB 3V05A 5IKCM 3O13A 2FAZA 1YX6B 2C9WB 3ZNGC 2D3BA 2Y5BB 1SBBB 4N58A 1MHXA 5D6JB 1SSNA 1V97A 2GOWA 2Y5CA 2AX5A 4NZLB 1L0XB 4W9HA 1VLBA 4L1BA 3APCA 4FHJA 2BS4B 2WXJA 2ZJDA 1WSPA 1XXGA 1PGXA 4A3PA 3BK1A 3VUYA 4J6IA 3ZUNA 2KX0A 3GE3C 2LVOA 2DZJA 4UDUC 4BKTA 3MJ5A 3X23A 1GUAB 1N60A 2K1FA 4GMVA 2V4IB 1D5MC 2D3CA 2N7JA 1C1YB 2E3TA 4FJVB 1J7BA 1GPXA 4ZRJA 1GAQB 1AN8A 3R2TA 1ENFA 1V1OA 3OG5A 4JWSC 4MGIE 2LGYA 2KQ7A 1WWTA 5CX3A 3A1QA 3E56A 4LNOA 2INDC 4C56C 3OLMD 1E7UA 2KVRA 2LJ5A 2V3PA 3TUOA 2KQSA 2KFKB 4DHJB 2N7EA 1TT5B 4L2YA 3DVNV 3LXFA 3TEYA 1UWMA 3K9OB 3SFEB 1ZDXA 3Q3JA 2QJLA 1SE9A 1OGWA 2KWDA 4TMAB 2EMSA 2H89B 4WQOB 1GC7A 2KJ6A 1I4RA 5DPWA 5HKHA 3ZJTA 1ZE3D 2K25A 1XQQA 2DNFA 2PIAA 1WJ4A 3NHEB 4RMAA 2DYOA 3P4PB 3I3TB 3L13A 4ZHPA 3IT6B 2M4NA 2KN4A 1QKZA 1WGYA 4WJOA 3NZUA 1E90A 4ITKA 2ICIA 5L83A 2HD5B 3HM3A 4KGTA 2KC2A 2WX0A 1WYGA 1C4PA 4NAWB 2KAJA 3PV1A 4HJGE 2NPTA 1WX9A 1NEKB 3T8MA 1NYQA 2SAKA 3AI5A 1WGDA 4YTMB 1HXYD 2QCZA 3S2AA 1UD7A 1JRPA 3ZRCA 1QOFA 2N4FA 1HTOA 2N9KA 3HIZA 2DYBA 4IWQA 3M95A 4KX6B 1QF6A 3IAS1 4CO7A 3DBSA 1IP9A 4NQKE 3Q6BA 1WXQA 3WAMA 4CYEA 1S1QB 2LUMA 3JW0X 4XDCA 1CQVA 1VZ7A 4YT0B 2RPVA 3B0AA 3SHQA 1D5ZC 4O1NA 1AYFA 1WXAA 2B3AA 3B9JA 2KMAA 1BUIC 2HJ1A 2Y5PA 1FO4A 3AEAB 2I1JA 4HROA 2J4XA 1WE7A 4ANWA 2IBIB 4ARIA 3CWIA 5E6JA 1OQQA 3KYDD 3NZ3A 5J2RA 3DHHC 1Q5WB 5E6PA 3RNAC 3MP9A 1ZPSA 4YSXB 3I9V1 3AEEB 4W9EA 2WS3B 4F8CB 2BS2B 3PREA 4IWPA 5L95C 2MW5A 3U4EG 2KFJA 2JYTA 1E8XA 5J18A 2LXCA 1D3ZA 1YIWA 1MHHE 5JXVA 3P2BA 2GBKA 2WNMA 4G11A 4F1SA 1M94A 4MGYE 3RPFC 3RNEC 4LNNA 2BT6A 1XT9B 3ZO5B 3DBHI 3TEWA 1JWBD 2J0JA 2W54A 1WMHA 3ML8A 4MSQB 3VAWA 4N9F4 1WM3A 2DZKA 5EE3A 4RCOA 5IOIA 1JROA 3DVGX 1LQBA 3BK2A 1ET9A 4WJQA 3SR6A 3ZNHB 1K52A 1FNVA 1F1HA 2KLGA 2Z0DB 2KMCA 4BKSD 1JWUD 3VR9B 3IFWB 2NMQA 1AW7A 1TY2A 2BQQA 3TEXA 1XLQA 1KTKA 4RGMA 4WJNA 1VZ8A 2WP9B 2KMMA 3H9DA 2AWTA 2G4SA 3EC8A 1FXTB 1FXAA 3ZNID 5GMVA 1ZKHA 4MH8A 4OZBA 3UIOB 1TY0A 2ACZB 3TMPB 3PLVA 4WWMA 4GDLB 1UZXB 3QQ8B 1JWSD 1YQ4B 2O6VB 4XC2A 3ZNZB 2ZW0A 4P6VF 3T3OA 4EZJA 2GMIC 1EF1A 2QILA 2WX1A 2L0TA 2LXAA 4ANXA 4A20A 4PYZA 3UIPB 3GB1A 2IDYA 2N1WA 3DQVA 1WGHA 2IJ0A 1FIQA 4KDIC 4P1CC 3ZJUA 3U2SC 2RDGA 1HA5A 2Z0EB 3I57A 2BPSA 1YJJA 2PKOA 2VZKD 1JALA 4ZYSA 1N63A 1IYFA 3H6NA 1S3SG 2V1YA 3NS8A 1JMLA 2L52A 1KM7A 4HKQA 4E74A 2L83A 2FBWB 2PMVA 3DCGA 4DQOC 2HJ8A 2JXTA 2M8SA 2EKEC 3SFDB 4CHKA 2NR2A 2JF5A 1FCCC 3R3MA 5CHVC 2OEDA 1OQYA 3O65B 4B0EA 1IUEA 3A9JB 4YTPB 3WIMA 4BBNC 3IVFA 2DHZA 3NUHB 3NG0A 4NAWA 4I6LB 2K5PA 3FKYA 4DHZB 2M56B 4B6WA 3APDA 4FULA 2FE8A 3WCQA 1VDVA 2WHIA 1I4GA 2KOXA 3N9YC 2YEPB 2CHWA 4ANVA 3RYTA 2BWFA 3OJ3A 2MCNB 4KGSA 3MJWA 3U7ZA 3Q2AC 1R4NI 3B08A 2KDIA 1ZP0B 2NTSA 1L6VA 2DZIA 1L5PA 2KVZA 3ZTCA 1J19A 1WGKA 4N59A 4ZHOA 1HE8A 1RFAA 2ZEQA 3ZGZA 2KACA 1SB3C 1F2RC 5AZGA 4A8XC 4RH6A 1PYWD 3M3JA 2J0MA 4JQWC 1JWMD 4XZ4A 4LNFA 2HTHA 3X0WA 2KNBA 1XD3B 4KZ0A 5C2TB 3AH7A 3FC4A 1FCLA 2LVPA 3AE1B 1K53A 3AMZA 2D3GA 2JSVX 3NOBA 5DCNA 2WDQB 1L4ZB 1J0GA 1MG8A 2KO3A 3TCAA 4JX1C 3KUDB 3RFZB 2DENB 1UGJA 5J17A 2KWVB 3EGRA 1MJDA 1BMLC 2BBCA 1ET6A 4NQLB 1ZDVA 5MPOA 4YXDB 2L05A 3BVZA 1ZW7A 2QHOA 3VUXA 1GG3A 2BGFA 2K6QA 2D10A 3N20C 2J7QB 2K39A 5DPRA 1YN5A 4PS7A 3HHMA 4GLSC 1C77A 3T3NA 1YD8U 4ASWC 5JH5C 4B0MA 4JPSA 2CHXA 1E8WA 3L54A 3U52E 2ZNVB 2J0KA 5TR5A 2WU2B 4BKGA 2RDBC 3DWMA 2ZVOA 3GE8C 2WXMA 3P42A 2WGSA 2LUEA 3FILA 4XX5A 2M1MA 2ON8A 5EE1A 3DVGY 4JIOU 4WURA 2WXLA 2G9HD 1TBEA 1IGDA 5C23A 2CS4A 4BOSC 2BKFA 2MA9B 3RN9C 3DBRB 4USAA 3L0WB 4G50A 4LDTB 2DWQA 2JX5A 3DHGC 2DLBA 3N30A 1XF5L 1MVKA 2Z8LA 1JRUA 5G55A 3RMKC 2L00B 5C1ZA 3Q3MC 3UF8A 1J7CA 5CHFA 2O6VD 4GSWA 1P0RA 1DGJA 4HPPA 4L23A 2HDEA 4KSLC 4LJOB 3W5VB 2CU3A 2IPKD 4RF1A 2R2OA 4K7UA 2ASQA 4AQ7A 4BAXA 4KKJA 3ML9A 1PQSA 3ZDTA 1HZ5A 2KTRB 3AE2B 1WY8A 4P1BC 2O6VA 3VTUA 3EFCA 4ARCA 1ZUD2 4IM2A 2UU7A 2UWQA 4IWOA 2XEWA 1TS2A 1GB1A 1BXTA 4G3XB 1BT0A 3EHVA 3QIJA 2IGHA 4B95A 2FIDA 1RM6C 1I42A 3AEBB 4W9IA 3VH3B 1E5WA 2RMMA 4HCNB 3J9CA 3OAWA 3Q8BA 4A6QA 5GXGB 2MWSB 2MBHA 1KH0A 1YNTE 2K6DB 1NI2A 1TZ1A 3TIXA 4JGHB 4NNJB 2PE9A 1Y56A 4M0WB 1P7EA 1V1PB 2KWUB 4URKA 3AE9B 4WAAA 4FN2A 1EWYC 2MX2A 4XYCA 1IBXA 3Q69A 3PO0A 2KXJA 2D2QA 2MHJA 1LXDA 2BTEA 4B9KA 3VTWA 2MBOA 3KUZA 2WXQA 4AP4C 4W9CA 3PRZA 2JZZA 5BYQA 2MP2B 1JQ4A 2RDHA 2WXPA 4NY0A 4FJZA 3IG3A 2KYWA 1T5XD 2N0SB 1TS3A 1H4RA 2XNAC 1T0YA 4ICUA 1MI0A 4P7IA 2V3SA 3VTVA 4C4VA 2JUOA 4C00A 1YN4A 2WXNA 4KVGB 4AJYB 2HTME 4OVZA 3CSFA 1VR9A 4K7WA 3VQIA 1V5TA 2KJRA 3Q8CA 3AEGB 2L1AA 2C7MB 1DOIA 3QHTA 1NI3A 2C7HA 1NBFC 3BINA 2PPHA 4TKNA 5EE0A 3ETRA 3WAOA 4DK5A 3JVZX 1WR6E 4ZRIA 2QSDA 2ZPNA 3R7RA 2KC1A 2Z59B 3ZDMC 1N62A 1L7YA 2LD9A 3PZ7A 3GZNB 1V6EA 2J53A 1XO3A 4IM3A 5H92C 2RPQA 1G6JA 2AL3A 2NBUA 3HM6X 3JSVA 3W5UB 2O2VB 3ZQ4A 4F7ZA 2KT7A 4HEA1 5AEKB 2NS5A 1YJ1A 1ZXHA 1L4DB 4PYUA 2LASA 4LLGM 4QAYA 1E6EB 2GBMA 2IO3B 3PZDA 3U7DA 1KLUD 2LGSA 2I2YA 2WXGA 3MC9A 2WDTB 4FLHA 2YLMA 2KDEB 3L4PA 3LJ3A 4MGKE 3PPAA 2N9PC 4BBNF 3E9SA 1P3QU 4GDKA 1F2RI 3NRZA 2IGGA 4US8A 1SF0A 2LEKA 2RR9A 4HDQA 1KOTA 2AL6A 3SEBA 4XE0A 1ZGUB 3VRBB 2DBYA 1AWDA 2XK5B 3AEFB 3L08A 1SIJA 3N32A 4IC7B 4NJ6A 5CHWA 4LNIA 4FADA 3Q3OC 1LGRA 1F77A 1WI0A 2JWZA 3C8YA 4JE3B 4N6EB 2CKHB 2QC8A 1FFUA 3NJTA 3BYYB 4W9KA 3EUB2 1Z5SB 3GZNI 2MBEA 4LDTD 1J7AA 4IUMB 5AUKA 1IPGA 3UQAA 2WYQA 4MSMB 4GGQA 2PTLA 2OJWA 3DWGC 2KTFA 1I7HA 3VVWB 2J42A 1E8ZA 3TJPA 3CF6E 1FPYA 1C79A 1N5WA 1PUTA 2ZNVC 4KV2A 4S17A 3AV8A 4HDOA 1LO5D 3KW5B 3ZYYX 2BF8B 1WFYA 1YN3A 4W9JA 2SEBD 1WH3A 2AQ1B 3LYYA 1ACCA 2LRWA 2K22A 2KKCA 2LJIA 2N9LA 2UYZB 2W55A 1TYGB 1WRDB 2JWUA 1N61A 3AE5B 5H8YE 3NZSA 1I4XA 2AEHA 1HTQA 5BMIA 4IM0A 5EE9A 5JHBA 2DAFA 3L16A 1UBIA 4HXDA 4DHJD 3AE6B 5C3JB 5HHDG 1SE3A 4RF0A 3VUWA 1E7PB 1YJIA 5BMGA 4BFRA 1K51A 2GBJA 2CR5A 2ZZPB 2BYTA 2JZ3B 2KTRA 1C4CA 3AE3B 3VFKA 2EKIA 4OZCA 4EZKA 1WGRA 2BS3B 2WQYB 2LMCA 4EKUA 3A1QB 3AB5A 1UBQA 4KSKC 5CTRC 2KFKA 3VR8B 3N3KB 2V9HA 1YMHE 1E8YA 1R7SA 4ZOHC 1FM0D 1WIAA 1STEA 2X8XX 3V62A 2G3QB 5D94A 3EFUA 2EELA 3ABVB 2WDVB 2L0FA 3DBLB 2H88B 4ZDVA 1Q10A 1V81A 3Q8EA 3Q3FA 4DXGA 1EUVB 2I38A 2KK8A 3HVZA 4K3CA 4AJWA 1WXVA 4M0WA 1FFVA 1V1PA 2KHWB 4DWFA 2MSED 4AOFA 4A55A 3VDZA 2LZ6A 4K3BA 2IZVB 3EECA 1I4PA 1SIFA 1FNUA 1PGAA 4HPLB 2MP2A 4WWPA 1P98A 3CIRB 2W3RA 1MG4A 1L0VB 2WXIA 4A90A 3NVYA 2KJHB 2K9XA 2IO2B 1NDDA 3HRDD 1E7VA 4JLCA 2BB6A 4KIKB 2C5LC 4KGRA 1CK1A 1LM8B 3A9KB 4I6NB 2V0GA 4ZYNA 2QDFA 1FD6A 4BOZB 4HWIB 3R7QA 4AWJA 3VHTC 2PVOD 2PVGC 3R2IA 3MHZA 4NJ7A 3PHXB 2CHZA 3A4SC 3ZLZA 1C78A 1GC6A 1D6EC 3DBLI 1I4HA 1CMXB 3ZVVA 2A4ZA 5LXIB 1XLPA 1EM7A 2WXHA 2MQJA 3RNFC 3V6EB 1QOGA 4AS1A 1Q1OA 3UINB 2J52A 1FEHA 2WXKA 3PTFC 3MC0B 4R3DA 3BWUD 4MJSB 4IKGA 4XDDA 5HG2A 2V4LA 5IO9A 5EDSA 4M01A 4HVBA 3Q14C 4LCDE 1WX8A 3AE4B 3M63B 1OEYA 2O2VA 2G1EA 5TSSA 1WXMA 2FCSA 2JXXA 2DAJA 3H7PB 1OQRA 3Q3NC 4AUQC 3RT3B 4GB9A 1WJNA 3B2GA 3A4RA 2VH2A 3PS6A 1F0ZA 3ZW3A 2L3ZA 2X38A 3M62B 2MJDA 1PFDA 1GJZA 4YWGG 1DYQA 4J3OD 3P1MA 3DHIC 4MT5A 1P7FA 4HPMB 1QLBB 2XK5A 1C3TA 2B76B 3BIID 2DX5B 2JRHA 1A70A 3ZJVA 1T3QA 1RYJA 2ZPYA 2IO1B 3AECB 3NS1A 3P4QB 2RSUA 5IA7A 4CQNA 3UGBB 3KQ4A 1OFFA 4WIPA 3KWLA 2CU1A 5LNK1 4PK1A 2C7NB 4PS8A 3NVWA 1XLNA 1KRHA 2KANA 3CMMB 1XCTL 2ZVNA 2YEPF 1GOZA 3V3XA 5IAAC 4FA6A 2G4DB 4EE2A 5HI1A 2MEKA 1UNSA 2JYEA 3P4RB 4TSSA 1CZPA 1WE6A 2FCMA 2MH7A 4OVUA 1N5XA 5JZEB 3NVZA 3VH4B 2KDFB 1QOBA 1RWSA 3QWZB 4WJPA 4DXFA 3V60A 3ALBA 3R66C 2OJRA 1KLGD 2KX3A 1QZEA 4MACA 1JCKB 5FR6A 3ZTDA 4K81A 2ZCBA 5KHQA 1PGBA 3ZRFA 2L76A 1WF9A 4KZCA 4XWTA 3TEZA 1GB4A 1KFYB 4GDLA 4KDLB 2FCNA 2GI9A 4JL9A 1UH6A 1FXIA 5G5HA 1M4VA 1GNUA 3JYUA 4WWOA 3T9LA 2NBVB 1KJTA 2QEJC 2TSSA 2DYMA 3TBLD 3KUCB 3RNCC 2PJHA 2M0XA 3IHPC 2LHDA 1P9DU 2XBBC 1HZ6A 4BZAA 2KZRA 3DBRI 1SEBD 4E71A 1YQBA 4GN1A 1WM2A 4PS3A 2BYVE 4MM3B 3RI7C 3W1SA 1I4QA 3OWEB 3W9CB 4IDIA 1WJ6A 2ONQA 5DPTA 2W82A 3PSEB 4GIVA 1D5XC 2KD0A 1HQRD 1V80A 2YVCA 1B9RA 1D4BA 4X57B 1KLVA 3V61A 3GP7A 4M02A 1WXSA 1XLOA 3W1SC 4RM8A 3AM9A 4W9DA 4A3OA 4EUTA 2RD0A 3BVGA 1FMAD 2K8CA 2K3UA 4ZRKA 2N9XA 2W9NA 4ICVA 2IYDB 2JQRB 1MFWA 3URYA 3H1UA 2I1KA 3TSSA 1WR1A 1UELA 5D2MB 4RM9A 2D3AA 2NCNA 4XWWA 5LXHA 3RNGC 2N7DA 3BY4B 3P4SB 4IW0A 2VZKB 3LDZE 1SGHA 1YX5B 3A9JA 1J8CA 1UUPA 4WQMA 3BYTB 3RZWC 4GXBA 3AU5A 4II2B 3Q8FA 3ZKJC 2WDRB 2DZMA 2MRPA 4RGTA 5D3IB 3U30A 2M17A 4EFOA 2HE7A 3ZXVA 1TKEA 4GU2A 1QOAA 3A33B 2R2QA 1YQ3B 2JZPA 1RLFA 2FIFA 3SDLC 5AZFA 2NVUI 4IG7B 4KIKA 2FNJB 5HFYA 1A5RA 3A9KA 4HK2A 4YSZB 5BYSA 3GS2A 3RCZA 2JT4B 3I63C 4XGAB 2D11A 4DBGA 4A9AA 3D32A 3BVMA 2R61A 2BVCA 3HK0A 1SE4A 2JRIB 1AARA 1EO6A 3DPDA 2WXRA 3QX1A 2RGFA 2LWPA 1VD2A 2NBWB 2FUG1 2A5UA 2LGIA 1C4AA 1L6UA 2QMTA 3PRMB 2C60A 4IOIE 2GB1A 4G0NB 3DBHB 1VRAB 4OHJA 3K9PB 1RAXA 3QK0A 2JU6X 4S0RA 5FR3A 1RFKA 1RRBA 1DOYA 3ZIMA 4MJSA 4WWNA 2D07B 1QQRA 1ISNA 1YOVB 2PW9A 1VCBA 1F9JA 5KHOA 4M8MA 4BVUC 2BKRB 3DOWA 1OTRB 4W9FA 5I4DA 2M19A 1TKGA 4C7YA 1HEZE 1T0RC 1SJHD 3H7PA 3APFA 4FBJB 3TL5A 3C19A 2EMTA 2CJOA 1Y8RC 1MPEA 2VRRB 4TQ0A 3WA0A 2AQ2B 2KQ4X 2ZW1A 3PHWB 1KF6B 2MBBB 3WAPA 1E0ZA 3N1XC 3UI3A 5AUIA 4OZAA 2WWZA 3ONSA 2Q5WD 4YTNB 4I6PA 1V5OA 2BYEA 2KDBA 2MJEA 1EU3A 3AN1A 1C76A 5IN7A 4HRSA 4HCPB 3RD2A 3WALA 2LGXA 5BO4B 1C9FA 3RNBC 3PRPB 3N1ZC 3H7SA 5JHAA 3FILB 1NYRA 3MTNB 2MBQA 4PT5A 1QILA 1FRDA 4P16A 3ZXRA 2BWES 3H8HA 3PGEA 1XCQL 4C7ZA 1TZOA 3RZFA 3IT4B 1T6BX 1V2YA 4EEWA 3RULA 2Y3AA 3PVLA 1ROEA 1R4MB 1TGZB 1WRIA 3DVNU 1TKYA 3NY5A 3L17A 1Z2MA 5E6NA 1F52A 2KWCA 4OVVA 3SU8X 1NENB 4OW0A 1TJEA 2WU5B 2PE6B 1V49A 4YL8A 4HJKA 1PDXA 3I5JC 4LJPB 4BKSA 1WGGA 1K50A 4JWUC 1L0YB 3MC8A 1XEEA 2PLPA 4FXCA 3L10B 2FUHB 2LI5A 1WYWB 2AYOB 5DPSA 2MLBA 1VJKA 1TS4A 3KLSX 1WJUA 2JY6A 2AQ3B 1T0QC 4WAFA 1V9JA 2JPHA 2KDMA 2INCC 2OOBB 4RGOS 4US9A 4TV3A 2G45B 4MDKE 5BMHA 3QC8B 2OHFA 1U4AA 3N1YC 3P63A 4MGZE 2IY1B 1WX7A 3GOEA 4MM3A 2NTTA 4ANUA 4YSYB 1UF0A 3AEDB 3Q8AA 3LB8C 3QARA 1NVID 2LRUA 3KWVA 3CSTA 1X1MA 4MEMA 4EZLA 2BYFA 1R4MI 4ZRPA 3AE7B 5FK9C 2GLSA 2LFIA 2IO0B 4HKZE 2V3NA 4DDGD 2MJ3A 1ESFA 5BYRA 1R4NB 3WANA 1OEYJ 3QA8A 4LNKA 3KH0A 4REZA 1IBXB 3AU4A 2VH1A 1TIFA 5D7GA 1ZXIA 2LGDA 1V86A 5E6OA 4KKIA 2PEAA 4ACFA 1H8CA 2NPTB 1EWCA 3NVVA 2JVCA 5G5GA 2D5GA 3PZ8A 4C80A 4M8NA 5LLIA 2BB5A 1TS5A 4RFBA 3R8BA 1K8RB 1QT9A 4Q2JA 1UGMA 3MFGA 4TUUA 2LVQA 3V6CB 1UWXA 1SE2A 2M0AA 4C4VB 2IY0B 3QAQA 3QCAA
chains in the Genus database with same CATH topology
3NVZA 1QOBA 2L32A 1RWSA 1AW7A 1YN4A 4DXFA 1TY2A 2WXNA 2HTME 3TEXA 4OVZA 2K0PA 3FAHA 1VR9A 1XLQA 1KTKA 4RGMA 3B2FA 3VQIA 3Q8CA 1VZ6A 3AEGB 1VZ8A 2WP9B 1E9MA 1KLGD 2KMMA 2L1AA 1DOIA 2XN9C 1NI3A 4MACA 1JCKB 5EE0A 1FXAA 3ETRA 1CJEA 1PGBA 1V8CA 4RGNA 4RNAA 1E10A 2QSDA 4XWTA 1FNWA 1FRRA 4MH8A 4OZBA 1TY0A 2ACZB 1N62A 5FKAC 3TEZA 1GB4A 1KFYB 3PZ7A 1B1ZA 4WWMA 5D3DA 2J53A 4GDLB 1XO3A 2GI9A 4LK0M 5H92C 1FXIA 5G5HA 1M4VA 1JWSD 1YQ4B 2INPE 2E6XA 2QEJC 2TSSA 3W5UB 2DYMA 3EA6A 3ZQ4A 2ZW0A 3AE8B 3IAM1 4HEA1 2LHDA 2GRIA 4P6VF 2BW2A 3HVDA 3T3OA 1HZ6A 3W2DA 1ZXHA 1L4DB 2QILA 4LTUA 4WH4A 4LLGM 1E6EB 1KLUD 2LHEA 1SEBD 2I2YA 4NJCA 2WXGA 3GB1A 2IDYA 3L4PA 2CJNA 3IXSA 4MM3B 2IJ0A 3W1SA 3E9SA 1FIQA 1JW9D 3ZJUA 1F2RI 1I4QA 3NRZA 2IGGA 3OWEB 4GDKB 4H2AA 3U2SC 4TQ1A 3W9CB 2IGDA 1SF0A 2RDGA 2LEKA 4US8A 1HA5A 4IDIA 1IGCA 2ONQA 3SEBA 4XE0A 3I57A 3VRBB 2W82A 2DBYA 1D5XC 1YJJA 2PKOA 2VZKD 1AWDA 1JALA 1HQRD 3AEFB 4ZYSA 1SIJA 1N63A 3VRAB 1B9RA 1D4BA 2INNE 4D2KA 3GP7A 4ZRQA 3BZDB 1F77A 1XLOA 3AM9A 1JMLA 2L52A 3C8YA 4HKQA 2L83A 2FBWB 2PMVA 2WXFA 3BVGA 1FMAD 4JE3B 2K3UA 4N6EB 4DQOC 1SJED 2JQRB 2JXTA 1FFUA 3URYA 3BYYB 1EU4A 3TSSA 5T8IA 2QIEB 4XWWA 3SFDB 2WXOA 3EUB2 1FCCC 2W3SA 1JWAD 2OEDA 1DOXA 3P4SB 4B0EA 1IUEA 1J7AA 2VZKB 2WLBA 4NAMA 1UUPA 4WQMA 4YTPB 5AUKA 3BYTB 3NUHB 1SXTA 3HUIA 1ZOYB 2K5PA 2PTLA 3Q8FA 3DWGC 1I7HA 2WDRB 4RGTA 2J42A 2M56B 3V05A 5D3IB 2FE8A 3WCQA 1TKEA 1VDVA 1QOAA 3O13A 1I4GA 1C79A 1N5WA 1PUTA 1YQ3B 2JZPA 3N9YC 3AV8A 1LO5D 2YEPB 1SBBB 4N58A 3ZYYX 5HFYA 1MHXA 1YN3A 1SSNA 1V97A 2SEBD 2AQ1B 3LYYA 1ACCA 2Y5CA 2AX5A 4YSZB 4KGSA 2K22A 5BYSA 3GS2A 4NZLB 1L0XB 2LJIA 3U7ZA 1VLBA 4L1BA 2N9LA 2BS4B 2W55A 2WXJA 1WSPA 1XXGA 1PGXA 4A9AA 1TYGB 2JWUA 3AE5B 1N61A 1ZP0B 2NTSA 3BK1A 5H8YE 1L6VA 3BVMA 1L5PA 2R61A 1I4XA 1SE4A 1WGKA 4UDUC 3MJ5A 4N59A 4ZHOA 2WXRA 5BMIA 1N60A 5EE9A 2FUG1 3ZGZA 2KACA 2LGIA 1C4AA 1L6UA 2QMTA 2V4IB 1D5MC 1SB3C 4IOIE 1F2RC 2GB1A 2N7JA 2E3TA 4A8XC 1J7BA 1VRAB 3AE6B 5C3JB 4OHJA 5HHDG 1GPXA 4RH6A 1SE3A 2JU6X 5FR3A 1RFKA 1PYWD 4RF0A 1E7PB 1GAQB 1YJIA 1AN8A 1DOYA 3R2TA 5BMGA 1ENFA 1JWMD 1V1OA 1K51A 4JWSC 2BYTA 1QQRA 2PW9A 1C4CA 3AE3B 5C2TB 1WWTA 2EKIA 4OZCA 3AH7A 2BS3B 2WQYB 2LMCA 3FC4A 3E56A 1FCLA 5I4DA 3AE1B 3AB5A 4C56C 1K53A 2M19A 3AMZA 2JSVX 1TKGA 2WDQB 1L4ZB 2V3PA 1HEZE 4C7YA 3TUOA 4JX1C 3VR8B 1SJHD 4L2YA 3LXFA 3RFZB 1YMHE 1UGJA 3TEYA 2CJOA 1R7SA 1UWMA 4ZOHC 3EGRA 3SFEB 1BMLC 1FM0D 1ZDXA 2BBCA 2QJLA 1ET6A 1MPEA 1ZDVA 1STEA 5MPOA 2KWDA 4TQ0A 4TMAB 4YXDB 2H89B 1I4RA 2AQ2B 2KQ4X 3ZJTA 3BVZA 1ZE3D 2EELA 2ZW1A 2PIAA 3ABVB 1KF6B 2WDVB 2H88B 1E0ZA 1Q10A 3Q8EA 2DYOA 4DXGA 3P4PB 3UI3A 5AUIA 4OZAA 4ZHPA 2I38A 3HVZA 2Q5WD 4M0WA 1FFVA 1V1PA 3IT6B 1YN5A 4YTNB 2KN4A 4GLSC 1C77A 1QKZA 3T3NA 4B0MA 4JPSA 4ITKA 2MJEA 2ICIA 4A55A 1EU3A 3AN1A 3U52E 1C76A 4KGTA 4HRSA 2WU2B 1WYGA 1C4PA 3DWMA 4NAWB 1I4PA 2KAJA 1C9FA 2WXMA 4HJGE 1FNUA 1PGAA 3P42A 1NEKB 1NYQA 2SAKA 3CIRB 2W3RA 3FILA 3FILB 2ON8A 1NYRA 5EE1A 4YTMB 1L0VB 1HXYD 2WXIA 4A90A 4WURA 2WXLA 2G9HD 4PT5A 1QILA 3NVYA 1FRDA 1IGDA 2K9XA 4P16A 3HRDD 1JRPA 3H8HA 4USAA 1XCQL 2BB6A 4C7ZA 1TZOA 1QOFA 3IT4B 4KGRA 1CK1A 2N9KA 2DWQA 1T6BX 2JX5A 2DLBA 2V0GA 1XF5L 4KX6B 1QF6A 2Y3AA 1FD6A 3IAS1 1MVKA 2Z8LA 1ROEA 2PVOD 2PVGC 1WRIA 1WXQA 1TKYA 3R2IA 3MHZA 2LUMA 4XDCA 1CQVA 1J7CA 1C78A 1D6EC 1VZ7A 4YT0B 1I4HA 2RPVA 1DGJA 1NENB 4OW0A 1TJEA 2WU5B 4L23A 2HDEA 1D5ZC 1XLPA 4O1NA 1EM7A 2WXHA 1AYFA 2CU3A 2IPKD 3W5VB 1PDXA 4RF1A 1QOGA 3B9JA 1K50A 4AS1A 1BUIC 4JWUC 2J52A 2Y5PA 1FO4A 3AEAB 4AQ7A 1FEHA 1L0YB 4KKJA 2WXKA 4HROA 1XEEA 2PLPA 4FXCA 3MC0B 2J4XA 4R3DA 3BWUD 4IKGA 4XDDA 5HG2A 1HZ5A 4ARIA 3AE2B 3CWIA 5E6JA 1VJKA 1TS4A 1OQQA 3KLSX 3AE4B 3NZ3A 4ARCA 2AQ3B 4WAFA 1ZUD2 2G1EA 5TSSA 2KDMA 1TS2A 1GB1A 1BXTA 3MP9A 4RGOS 1OQRA 1ZPSA 4YSXB 3I9V1 3AEEB 4US9A 2WS3B 2IGHA 2BS2B 3B2GA 5BMHA 1RM6C 3AEBB 2OHFA 3P63A 1F0ZA 2RMMA 2X38A 2MJDA 3J9CA 3U4EG 2NTTA 4YSYB 1PFDA 3AEDB 3Q8BA 3Q8AA 3LB8C 5GXGB 4A6QA 2JYTA 1NVID 4YWGG 3KWVA 1DYQA 1KH0A 1YNTE 3P1MA 4J3OD 4MT5A 4ZRPA 3AE7B 1MHHE 1P7FA 5FK9C 1Y56A 5JXVA 2LFIA 1QLBB 4HKZE 2V3NA 2WNMA 2MJ3A 1ESFA 5BYRA 2B76B 3RPFC 3BIID 1P7EA 1V1PB 1A70A 3AE9B 3ZJVA 2BT6A 1EWYC 1T3QA 1RYJA 4REZA 1IBXA 1IBXB 3Q69A 3TEWA 3PO0A 1JWBD 2W54A 3AECB 3NS1A 3P4QB 5D7GA 4CQNA 1ZXIA 2BTEA 3KQ4A 1OFFA 4WIPA 2WXQA 3KWLA 5LNK1 4KKIA 5EE3A 5BYQA 1EWCA 3NVVA 1JQ4A 2RDHA 4RCOA 5G5GA 1JROA 2D5GA 2WXPA 3NVWA 1XLNA 3BK2A 3PZ8A 1ET9A 1KRHA 4C80A 1XCTL 2YEPF 1GOZA 3V3XA 3SR6A 2BB5A 1TS5A 1K52A 1FNVA 1T5XD 4EE2A 4RFBA 3R8BA 2N0SB 1TS3A 1QT9A 5HI1A 2MEKA 1UNSA 2JYEA 2XNAC 4Q2JA 3P4RB 4TSSA 1CZPA 3MFGA 1MI0A 1JWUD 1UWXA 3VR9B 1SE2A 2M0AA 2MH7A 2NMQA 1N5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVZ A;  3B9J A;  1QOB A;  4JWU C;  2QIE B;  3LXF A;  1FO4 A;  1RWS A;  3AEA B;  3SFD B;  3EUB 2;  2CJO A;  1R7S A;  1UWM A;  4ZOH C;  4HRO A;  2W3S A;  4FXC A;  3SFE B;  2HTM E;  1FM0 D;  2QJL A;  1JWA D;  1DOX A;  3FAH A;  3P4S B;  1XLQ A;  1J7A A;  1IUE A;  2WLB A;  3B2F A;  5MPO A;  3AE2 B;  3CWI A;  3AEG B;  1VJK A;  2WP9 B;  4YXD B;  1E9M A;  2H89 B;  2KMM A;  4WQM A;  4YTP B;  1DOI A;  5AUK A;  1OQQ A;  3AE4 B;  1NI3 A;  2PIA A;  3ABV B;  1KF6 B;  2WDV B;  2H88 B;  1E0Z A;  1ZUD 2;  2G1E A;  1FXA A;  3HUI A;  1ZOY B;  2K5P A;  3ETR A;  5EE0 A;  1CJE A;  3DWG C;  3P4P B;  1I7H A;  2WDR B;  1V8C A;  5AUI A;  4ZHP A;  2M56 B;  1OQR A;  3HVZ A;  4YSX B;  3AEE B;  2Q5W D;  2WS3 B;  4US9 A;  1E10 A;  1FFV A;  3WCQ A;  4YTN B;  2BS2 B;  3B2G A;  1TKE A;  1VDV A;  1FRR A;  1QOA A;  1RM6 C;  1YQ3 B;  1N5W A;  1N62 A;  1PUT A;  2ACZ B;  2OHF A;  3AEB B;  3P63 A;  1F0Z A;  1KFY B;  4ITK A;  2MJE A;  3AN1 A;  3AV8 A;  4WWM A;  2MJD A;  1XO3 A;  5H92 C;  4HRS A;  1FXI A;  1PFD A;  3AED B;  4N58 A;  4YSY B;  3LB8 C;  5G5H A;  5GXG B;  1YQ4 B;  3ZYY X;  1NVI D;  1V97 A;  2WU2 B;  3P1M A;  2Y5C A;  1WYG A;  2AX5 A;  3W5U B;  3DWM A;  4YSZ B;  2K22 A;  3AE7 B;  2KAJ A;  1VLB A;  2BS4 B;  2W55 A;  3AE8 B;  1QLB B;  1NEK B;  1NYQ A;  2MJ3 A;  4A9A A;  1TYG B;  3CIR B;  4C80 A;  2W3R A;  1N61 A;  1ZP0 B;  3AE5 B;  4P6V F;  5EE1 A;  1L6V A;  1NYR A;  5H8Y E;  2B76 B;  1L0V B;  1L5P A;  3BII D;  4LTU A;  3RPF C;  4YTM B;  1E6E B;  4JWS C;  3NVY A;  1A70 A;  3AE9 B;  1FRD A;  1WGK A;  2BT6 A;  2K9X A;  4N59 A;  1EWY C;  1T3Q A;  4ZHO A;  1RYJ A;  3HRD D;  1JRP A;  3L4P A;  1N60 A;  2CJN A;  5EE9 A;  4USA A;  4C7Z A;  3PO0 A;  1JWB D;  2W54 A;  3AEC B;  3NS1 A;  1L6U A;  1QOF A;  3P4Q B;  1SB3 C;  1FIQ A;  1JW9 D;  1ZXI A;  2DWQ A;  2E3T A;  2JX5 A;  1OFF A;  1J7B A;  3AE6 B;  3NRZ A;  4US8 A;  3W9C B;  5C3J B;  1SF0 A;  2LEK A;  1GPX A;  3KWL A;  4KX6 B;  4IDI A;  1QF6 A;  3VR8 B;  1RFK A;  5EE3 A;  3VRB B;  1E7P B;  1ROE A;  1GAQ B;  1YJI A;  2PVO D;  3NVV A;  1DOY A;  2DBY A;  5G5G A;  1JQ4 A;  2PVG C;  1JRO A;  1WRI A;  3NVW A;  1XLN A;  1WXQ A;  1YJJ A;  1TKY A;  1AWD A;  1JAL A;  1KRH A;  2PKO A;  1SIJ A;  3AEF B;  1N63 A;  3VRA B;  1B9R A;  3SR6 A;  5C2T B;  3AE3 B;  1WWT A;  1J7C A;  2EKI A;  3AH7 A;  1XLO A;  4YT0 B;  2N0S B;  3AM9 A;  1QT9 A;  2L52 A;  2BS3 B;  2WQY B;  1DGJ A;  1NEN B;  3FC4 A;  1TJE A;  2WU5 B;  3P4R B;  2L83 A;  1CZP A;  2FBW B;  3AB5 A;  3AE1 B;  2M19 A;  1XLP A;  1FMA D;  3AMZ A;  1TKG A;  4N6E B;  3W5V B;  1AYF A;  2CU3 A;  3VR9 B;  1PDX A;  2WDQ B;  2JQR B;  1QOG A;  2MH7 A;  4C7Y A;  1FFU A;  1N5X A;  4JX1 C; 
#chains in the Genus database with same CATH topology
 2L32 A;  4HLE A;  4NPN A;  4DDI D;  2K0P A;  3FAH A;  1WZ0 A;  3B2F A;  1VZ6 A;  3W1Y A;  1E9M A;  1LFD A;  3UQB A;  2XN9 C;  5G2N A;  3KYC D;  2ZCC A;  2N1V A;  4MH0 E;  3ENE A;  1CJE A;  4II3 B;  1V8C A;  4RGN A;  4RNA A;  1E10 A;  3AXC A;  1FNW A;  1FRR A;  1P1A A;  5FKA C;  1B1Z A;  5D3D A;  4LK0 M;  2INP E;  2E6X A;  3IBE A;  3MHS D;  4E3C A;  3JSV B;  4DXA B;  3EA6 A;  3AE8 B;  3IAM 1;  1EF5 A;  3B1L X;  4DHZ E;  3C0R B;  1Q0W B;  2GRI A;  2BW2 A;  3HVD A;  2GBR A;  3W2D A;  4WH4 A;  4LTU A;  2GBN A;  2FCQ A;  5AZH A;  5IP4 D;  2LHE A;  4K7S A;  2K8B A;  4NJC A;  2L7R A;  1I35 A;  4FJY A;  2CJN A;  3SD5 A;  1T0S C;  3IXS A;  3PLU A;  2N9E B;  3U8Z A;  3PT2 B;  1JW9 D;  4H2A A;  4GDK B;  4MEL A;  4TQ1 A;  4K1R B;  2IGD A;  1IGC A;  2KN5 A;  4W9G A;  4W9L A;  3VRA B;  2INN E;  3VXW A;  4D2K A;  4ZRQ A;  3BZD B;  3KVF B;  3OJ4 B;  4EOY A;  3RUI B;  2WXF A;  1TTN A;  1WMH B;  4GOC A;  1SJE D;  3ECI A;  1N6Z A;  1EU4 A;  5T8I A;  2QIE B;  2WXO A;  4FHK A;  1L2N A;  2W3S A;  1WZ3 A;  1JWA D;  1DOX A;  2REX A;  4M00 A;  2WLB A;  3QJZ A;  4NAM A;  3AUL A;  3DDC B;  2K8H A;  2L8J A;  2KLC A;  1SXT A;  3HUI A;  1ZOY B;  3V05 A;  5IKC M;  3O13 A;  2FAZ A;  1YX6 B;  2C9W B;  3ZNG C;  2D3B A;  2Y5B B;  1SBB B;  4N58 A;  1MHX A;  5D6J B;  1SSN A;  1V97 A;  2GOW A;  2Y5C A;  2AX5 A;  4NZL B;  1L0X B;  4W9H A;  1VLB A;  4L1B A;  3APC A;  4FHJ A;  2BS4 B;  2WXJ A;  2ZJD A;  1WSP A;  1XXG A;  1PGX A;  4A3P A;  3BK1 A;  3VUY A;  4J6I A;  3ZUN A;  2KX0 A;  3GE3 C;  2LVO A;  2DZJ A;  4UDU C;  4BKT A;  3MJ5 A;  3X23 A;  1GUA B;  1N60 A;  2K1F A;  4GMV A;  2V4I B;  1D5M C;  2D3C A;  2N7J A;  1C1Y B;  2E3T A;  4FJV B;  1J7B A;  1GPX A;  4ZRJ A;  1GAQ B;  1AN8 A;  3R2T A;  1ENF A;  1V1O A;  3OG5 A;  4JWS C;  4MGI E;  2LGY A;  2KQ7 A;  1WWT A;  5CX3 A;  3A1Q A;  3E56 A;  4LNO A;  2IND C;  4C56 C;  3OLM D;  1E7U A;  2KVR A;  2LJ5 A;  2V3P A;  3TUO A;  2KQS A;  2KFK B;  4DHJ B;  2N7E A;  1TT5 B;  4L2Y A;  3DVN V;  3LXF A;  3TEY A;  1UWM A;  3K9O B;  3SFE B;  1ZDX A;  3Q3J A;  2QJL A;  1SE9 A;  1OGW A;  2KWD A;  4TMA B;  2EMS A;  2H89 B;  4WQO B;  1GC7 A;  2KJ6 A;  1I4R A;  5DPW A;  5HKH A;  3ZJT A;  1ZE3 D;  2K25 A;  1XQQ A;  2DNF A;  2PIA A;  1WJ4 A;  3NHE B;  4RMA A;  2DYO A;  3P4P B;  3I3T B;  3L13 A;  4ZHP A;  3IT6 B;  2M4N A;  2KN4 A;  1QKZ A;  1WGY A;  4WJO A;  3NZU A;  1E90 A;  4ITK A;  2ICI A;  5L83 A;  2HD5 B;  3HM3 A;  4KGT A;  2KC2 A;  2WX0 A;  1WYG A;  1C4P A;  4NAW B;  2KAJ A;  3PV1 A;  4HJG E;  2NPT A;  1WX9 A;  1NEK B;  3T8M A;  1NYQ A;  2SAK A;  3AI5 A;  1WGD A;  4YTM B;  1HXY D;  2QCZ A;  3S2A A;  1UD7 A;  1JRP A;  3ZRC A;  1QOF A;  2N4F A;  1HTO A;  2N9K A;  3HIZ A;  2DYB A;  4IWQ A;  3M95 A;  4KX6 B;  1QF6 A;  3IAS 1;  4CO7 A;  3DBS A;  1IP9 A;  4NQK E;  3Q6B A;  1WXQ A;  3WAM A;  4CYE A;  1S1Q B;  2LUM A;  3JW0 X;  4XDC A;  1CQV A;  1VZ7 A;  4YT0 B;  2RPV A;  3B0A A;  3SHQ A;  1D5Z C;  4O1N A;  1AYF A;  1WXA A;  2B3A A;  3B9J A;  2KMA A;  1BUI C;  2HJ1 A;  2Y5P A;  1FO4 A;  3AEA B;  2I1J A;  4HRO A;  2J4X A;  1WE7 A;  4ANW A;  2IBI B;  4ARI A;  3CWI A;  5E6J A;  1OQQ A;  3KYD D;  3NZ3 A;  5J2R A;  3DHH C;  1Q5W B;  5E6P A;  3RNA C;  3MP9 A;  1ZPS A;  4YSX B;  3I9V 1;  3AEE B;  4W9E A;  2WS3 B;  4F8C B;  2BS2 B;  3PRE A;  4IWP A;  5L95 C;  2MW5 A;  3U4E G;  2KFJ A;  2JYT A;  1E8X A;  5J18 A;  2LXC A;  1D3Z A;  1YIW A;  1MHH E;  5JXV A;  3P2B A;  2GBK A;  2WNM A;  4G11 A;  4F1S A;  1M94 A;  4MGY E;  3RPF C;  3RNE C;  4LNN A;  2BT6 A;  1XT9 B;  3ZO5 B;  3DBH I;  3TEW A;  1JWB D;  2J0J A;  2W54 A;  1WMH A;  3ML8 A;  4MSQ B;  3VAW A;  4N9F 4;  1WM3 A;  2DZK A;  5EE3 A;  4RCO A;  5IOI A;  1JRO A;  3DVG X;  1LQB A;  3BK2 A;  1ET9 A;  4WJQ A;  3SR6 A;  3ZNH B;  1K52 A;  1FNV A;  1F1H A;  2KLG A;  2Z0D B;  2KMC A;  4BKS D;  1JWU D;  3VR9 B;  3IFW B;  2NMQ A;  1AW7 A;  1TY2 A;  2BQQ A;  3TEX A;  1XLQ A;  1KTK A;  4RGM A;  4WJN A;  1VZ8 A;  2WP9 B;  2KMM A;  3H9D A;  2AWT A;  2G4S A;  3EC8 A;  1FXT B;  1FXA A;  3ZNI D;  5GMV A;  1ZKH A;  4MH8 A;  4OZB A;  3UIO B;  1TY0 A;  2ACZ B;  3TMP B;  3PLV A;  4WWM A;  4GDL B;  1UZX B;  3QQ8 B;  1JWS D;  1YQ4 B;  2O6V B;  4XC2 A;  3ZNZ B;  2ZW0 A;  4P6V F;  3T3O A;  4EZJ A;  2GMI C;  1EF1 A;  2QIL A;  2WX1 A;  2L0T A;  2LXA A;  4ANX A;  4A20 A;  4PYZ A;  3UIP B;  3GB1 A;  2IDY A;  2N1W A;  3DQV A;  1WGH A;  2IJ0 A;  1FIQ A;  4KDI C;  4P1C C;  3ZJU A;  3U2S C;  2RDG A;  1HA5 A;  2Z0E B;  3I57 A;  2BPS A;  1YJJ A;  2PKO A;  2VZK D;  1JAL A;  4ZYS A;  1N63 A;  1IYF A;  3H6N A;  1S3S G;  2V1Y A;  3NS8 A;  1JML A;  2L52 A;  1KM7 A;  4HKQ A;  4E74 A;  2L83 A;  2FBW B;  2PMV A;  3DCG A;  4DQO C;  2HJ8 A;  2JXT A;  2M8S A;  2EKE C;  3SFD B;  4CHK A;  2NR2 A;  2JF5 A;  1FCC C;  3R3M A;  5CHV C;  2OED A;  1OQY A;  3O65 B;  4B0E A;  1IUE A;  3A9J B;  4YTP B;  3WIM A;  4BBN C;  3IVF A;  2DHZ A;  3NUH B;  3NG0 A;  4NAW A;  4I6L B;  2K5P A;  3FKY A;  4DHZ B;  2M56 B;  4B6W A;  3APD A;  4FUL A;  2FE8 A;  3WCQ A;  1VDV A;  2WHI A;  1I4G A;  2KOX A;  3N9Y C;  2YEP B;  2CHW A;  4ANV A;  3RYT A;  2BWF A;  3OJ3 A;  2MCN B;  4KGS A;  3MJW A;  3U7Z A;  3Q2A C;  1R4N I;  3B08 A;  2KDI A;  1ZP0 B;  2NTS A;  1L6V A;  2DZI A;  1L5P A;  2KVZ A;  3ZTC A;  1J19 A;  1WGK A;  4N59 A;  4ZHO A;  1HE8 A;  1RFA A;  2ZEQ A;  3ZGZ A;  2KAC A;  1SB3 C;  1F2R C;  5AZG A;  4A8X C;  4RH6 A;  1PYW D;  3M3J A;  2J0M A;  4JQW C;  1JWM D;  4XZ4 A;  4LNF A;  2HTH A;  3X0W A;  2KNB A;  1XD3 B;  4KZ0 A;  5C2T B;  3AH7 A;  3FC4 A;  1FCL A;  2LVP A;  3AE1 B;  1K53 A;  3AMZ A;  2D3G A;  2JSV X;  3NOB A;  5DCN A;  2WDQ B;  1L4Z B;  1J0G A;  1MG8 A;  2KO3 A;  3TCA A;  4JX1 C;  3KUD B;  3RFZ B;  2DEN B;  1UGJ A;  5J17 A;  2KWV B;  3EGR A;  1MJD A;  1BML C;  2BBC A;  1ET6 A;  4NQL B;  1ZDV A;  5MPO A;  4YXD B;  2L05 A;  3BVZ A;  1ZW7 A;  2QHO A;  3VUX A;  1GG3 A;  2BGF A;  2K6Q A;  2D10 A;  3N20 C;  2J7Q B;  2K39 A;  5DPR A;  1YN5 A;  4PS7 A;  3HHM A;  4GLS C;  1C77 A;  3T3N A;  1YD8 U;  4ASW C;  5JH5 C;  4B0M A;  4JPS A;  2CHX A;  1E8W A;  3L54 A;  3U52 E;  2ZNV B;  2J0K A;  5TR5 A;  2WU2 B;  4BKG A;  2RDB C;  3DWM A;  2ZVO A;  3GE8 C;  2WXM A;  3P42 A;  2WGS A;  2LUE A;  3FIL A;  4XX5 A;  2M1M A;  2ON8 A;  5EE1 A;  3DVG Y;  4JIO U;  4WUR A;  2WXL A;  2G9H D;  1TBE A;  1IGD A;  5C23 A;  2CS4 A;  4BOS C;  2BKF A;  2MA9 B;  3RN9 C;  3DBR B;  4USA A;  3L0W B;  4G50 A;  4LDT B;  2DWQ A;  2JX5 A;  3DHG C;  2DLB A;  3N30 A;  1XF5 L;  1MVK A;  2Z8L A;  1JRU A;  5G55 A;  3RMK C;  2L00 B;  5C1Z A;  3Q3M C;  3UF8 A;  1J7C A;  5CHF A;  2O6V D;  4GSW A;  1P0R A;  1DGJ A;  4HPP A;  4L23 A;  2HDE A;  4KSL C;  4LJO B;  3W5V B;  2CU3 A;  2IPK D;  4RF1 A;  2R2O A;  4K7U A;  2ASQ A;  4AQ7 A;  4BAX A;  4KKJ A;  3ML9 A;  1PQS A;  3ZDT A;  1HZ5 A;  2KTR B;  3AE2 B;  1WY8 A;  4P1B C;  2O6V A;  3VTU A;  3EFC A;  4ARC A;  1ZUD 2;  4IM2 A;  2UU7 A;  2UWQ A;  4IWO A;  2XEW A;  1TS2 A;  1GB1 A;  1BXT A;  4G3X B;  1BT0 A;  3EHV A;  3QIJ A;  2IGH A;  4B95 A;  2FID A;  1RM6 C;  1I42 A;  3AEB B;  4W9I A;  3VH3 B;  1E5W A;  2RMM A;  4HCN B;  3J9C A;  3OAW A;  3Q8B A;  4A6Q A;  5GXG B;  2MWS B;  2MBH A;  1KH0 A;  1YNT E;  2K6D B;  1NI2 A;  1TZ1 A;  3TIX A;  4JGH B;  4NNJ B;  2PE9 A;  1Y56 A;  4M0W B;  1P7E A;  1V1P B;  2KWU B;  4URK A;  3AE9 B;  4WAA A;  4FN2 A;  1EWY C;  2MX2 A;  4XYC A;  1IBX A;  3Q69 A;  3PO0 A;  2KXJ A;  2D2Q A;  2MHJ A;  1LXD A;  2BTE A;  4B9K A;  3VTW A;  2MBO A;  3KUZ A;  2WXQ A;  4AP4 C;  4W9C A;  3PRZ A;  2JZZ A;  5BYQ A;  2MP2 B;  1JQ4 A;  2RDH A;  2WXP A;  4NY0 A;  4FJZ A;  3IG3 A;  2KYW A;  1T5X D;  2N0S B;  1TS3 A;  1H4R A;  2XNA C;  1T0Y A;  4ICU A;  1MI0 A;  4P7I A;  2V3S A;  3VTV A;  4C4V A;  2JUO A;  4C00 A;  1YN4 A;  2WXN A;  4KVG B;  4AJY B;  2HTM E;  4OVZ A;  3CSF A;  1VR9 A;  4K7W A;  3VQI A;  1V5T A;  2KJR A;  3Q8C A;  3AEG B;  2L1A A;  2C7M B;  1DOI A;  3QHT A;  1NI3 A;  2C7H A;  1NBF C;  3BIN A;  2PPH A;  4TKN A;  5EE0 A;  3ETR A;  3WAO A;  4DK5 A;  3JVZ X;  1WR6 E;  4ZRI A;  2QSD A;  2ZPN A;  3R7R A;  2KC1 A;  2Z59 B;  3ZDM C;  1N62 A;  1L7Y A;  2LD9 A;  3PZ7 A;  3GZN B;  1V6E A;  2J53 A;  1XO3 A;  4IM3 A;  5H92 C;  2RPQ A;  1G6J A;  2AL3 A;  2NBU A;  3HM6 X;  3JSV A;  3W5U B;  2O2V B;  3ZQ4 A;  4F7Z A;  2KT7 A;  4HEA 1;  5AEK B;  2NS5 A;  1YJ1 A;  1ZXH A;  1L4D B;  4PYU A;  2LAS A;  4LLG M;  4QAY A;  1E6E B;  2GBM A;  2IO3 B;  3PZD A;  3U7D A;  1KLU D;  2LGS A;  2I2Y A;  2WXG A;  3MC9 A;  2WDT B;  4FLH A;  2YLM A;  2KDE B;  3L4P A;  3LJ3 A;  4MGK E;  3PPA A;  2N9P C;  4BBN F;  3E9S A;  1P3Q U;  4GDK A;  1F2R I;  3NRZ A;  2IGG A;  4US8 A;  1SF0 A;  2LEK A;  2RR9 A;  4HDQ A;  1KOT A;  2AL6 A;  3SEB A;  4XE0 A;  1ZGU B;  3VRB B;  2DBY A;  1AWD A;  2XK5 B;  3AEF B;  3L08 A;  1SIJ A;  3N32 A;  4IC7 B;  4NJ6 A;  5CHW A;  4LNI A;  4FAD A;  3Q3O C;  1LGR A;  1F77 A;  1WI0 A;  2JWZ A;  3C8Y A;  4JE3 B;  4N6E B;  2CKH B;  2QC8 A;  1FFU A;  3NJT A;  3BYY B;  4W9K A;  3EUB 2;  1Z5S B;  3GZN I;  2MBE A;  4LDT D;  1J7A A;  4IUM B;  5AUK A;  1IPG A;  3UQA A;  2WYQ A;  4MSM B;  4GGQ A;  2PTL A;  2OJW A;  3DWG C;  2KTF A;  1I7H A;  3VVW B;  2J42 A;  1E8Z A;  3TJP A;  3CF6 E;  1FPY A;  1C79 A;  1N5W A;  1PUT A;  2ZNV C;  4KV2 A;  4S17 A;  3AV8 A;  4HDO A;  1LO5 D;  3KW5 B;  3ZYY X;  2BF8 B;  1WFY A;  1YN3 A;  4W9J A;  2SEB D;  1WH3 A;  2AQ1 B;  3LYY A;  1ACC A;  2LRW A;  2K22 A;  2KKC A;  2LJI A;  2N9L A;  2UYZ B;  2W55 A;  1TYG B;  1WRD B;  2JWU A;  1N61 A;  3AE5 B;  5H8Y E;  3NZS A;  1I4X A;  2AEH A;  1HTQ A;  5BMI A;  4IM0 A;  5EE9 A;  5JHB A;  2DAF A;  3L16 A;  1UBI A;  4HXD A;  4DHJ D;  3AE6 B;  5C3J B;  5HHD G;  1SE3 A;  4RF0 A;  3VUW A;  1E7P B;  1YJI A;  5BMG A;  4BFR A;  1K51 A;  2GBJ A;  2CR5 A;  2ZZP B;  2BYT A;  2JZ3 B;  2KTR A;  1C4C A;  3AE3 B;  3VFK A;  2EKI A;  4OZC A;  4EZK A;  1WGR A;  2BS3 B;  2WQY B;  2LMC A;  4EKU A;  3A1Q B;  3AB5 A;  1UBQ A;  4KSK C;  5CTR C;  2KFK A;  3VR8 B;  3N3K B;  2V9H A;  1YMH E;  1E8Y A;  1R7S A;  4ZOH C;  1FM0 D;  1WIA A;  1STE A;  2X8X X;  3V62 A;  2G3Q B;  5D94 A;  3EFU A;  2EEL A;  3ABV B;  2WDV B;  2L0F A;  3DBL B;  2H88 B;  4ZDV A;  1Q10 A;  1V81 A;  3Q8E A;  3Q3F A;  4DXG A;  1EUV B;  2I38 A;  2KK8 A;  3HVZ A;  4K3C A;  4AJW A;  1WXV A;  4M0W A;  1FFV A;  1V1P A;  2KHW B;  4DWF A;  2MSE D;  4AOF A;  4A55 A;  3VDZ A;  2LZ6 A;  4K3B A;  2IZV B;  3EEC A;  1I4P A;  1SIF A;  1FNU A;  1PGA A;  4HPL B;  2MP2 A;  4WWP A;  1P98 A;  3CIR B;  2W3R A;  1MG4 A;  1L0V B;  2WXI A;  4A90 A;  3NVY A;  2KJH B;  2K9X A;  2IO2 B;  1NDD A;  3HRD D;  1E7V A;  4JLC A;  2BB6 A;  4KIK B;  2C5L C;  4KGR A;  1CK1 A;  1LM8 B;  3A9K B;  4I6N B;  2V0G A;  4ZYN A;  2QDF A;  1FD6 A;  4BOZ B;  4HWI B;  3R7Q A;  4AWJ A;  3VHT C;  2PVO D;  2PVG C;  3R2I A;  3MHZ A;  4NJ7 A;  3PHX B;  2CHZ A;  3A4S C;  3ZLZ A;  1C78 A;  1GC6 A;  1D6E C;  3DBL I;  1I4H A;  1CMX B;  3ZVV A;  2A4Z A;  5LXI B;  1XLP A;  1EM7 A;  2WXH A;  2MQJ A;  3RNF C;  3V6E B;  1QOG A;  4AS1 A;  1Q1O A;  3UIN B;  2J52 A;  1FEH A;  2WXK A;  3PTF C;  3MC0 B;  4R3D A;  3BWU D;  4MJS B;  4IKG A;  4XDD A;  5HG2 A;  2V4L A;  5IO9 A;  5EDS A;  4M01 A;  4HVB A;  3Q14 C;  4LCD E;  1WX8 A;  3AE4 B;  3M63 B;  1OEY A;  2O2V A;  2G1E A;  5TSS A;  1WXM A;  2FCS A;  2JXX A;  2DAJ A;  3H7P B;  1OQR A;  3Q3N C;  4AUQ C;  3RT3 B;  4GB9 A;  1WJN A;  3B2G A;  3A4R A;  2VH2 A;  3PS6 A;  1F0Z A;  3ZW3 A;  2L3Z A;  2X38 A;  3M62 B;  2MJD A;  1PFD A;  1GJZ A;  4YWG G;  1DYQ A;  4J3O D;  3P1M A;  3DHI C;  4MT5 A;  1P7F A;  4HPM B;  1QLB B;  2XK5 A;  1C3T A;  2B76 B;  3BII D;  2DX5 B;  2JRH A;  1A70 A;  3ZJV A;  1T3Q A;  1RYJ A;  2ZPY A;  2IO1 B;  3AEC B;  3NS1 A;  3P4Q B;  2RSU A;  5IA7 A;  4CQN A;  3UGB B;  3KQ4 A;  1OFF A;  4WIP A;  3KWL A;  2CU1 A;  5LNK 1;  4PK1 A;  2C7N B;  4PS8 A;  3NVW A;  1XLN A;  1KRH A;  2KAN A;  3CMM B;  1XCT L;  2ZVN A;  2YEP F;  1GOZ A;  3V3X A;  5IAA C;  4FA6 A;  2G4D B;  4EE2 A;  5HI1 A;  2MEK A;  1UNS A;  2JYE A;  3P4R B;  4TSS A;  1CZP A;  1WE6 A;  2FCM A;  2MH7 A;  4OVU A;  1N5X A;  5JZE B;  3NVZ A;  3VH4 B;  2KDF B;  1QOB A;  1RWS A;  3QWZ B;  4WJP A;  4DXF A;  3V60 A;  3ALB A;  3R66 C;  2OJR A;  1KLG D;  2KX3 A;  1QZE A;  4MAC A;  1JCK B;  5FR6 A;  3ZTD A;  4K81 A;  2ZCB A;  5KHQ A;  1PGB A;  3ZRF A;  2L76 A;  1WF9 A;  4KZC A;  4XWT A;  3TEZ A;  1GB4 A;  1KFY B;  4GDL A;  4KDL B;  2FCN A;  2GI9 A;  4JL9 A;  1UH6 A;  1FXI A;  5G5H A;  1M4V A;  1GNU A;  3JYU A;  4WWO A;  3T9L A;  2NBV B;  1KJT A;  2QEJ C;  2TSS A;  2DYM A;  3TBL D;  3KUC B;  3RNC C;  2PJH A;  2M0X A;  3IHP C;  2LHD A;  1P9D U;  2XBB C;  1HZ6 A;  4BZA A;  2KZR A;  3DBR I;  1SEB D;  4E71 A;  1YQB A;  4GN1 A;  1WM2 A;  4PS3 A;  2BYV E;  4MM3 B;  3RI7 C;  3W1S A;  1I4Q A;  3OWE B;  3W9C B;  4IDI A;  1WJ6 A;  2ONQ A;  5DPT A;  2W82 A;  3PSE B;  4GIV A;  1D5X C;  2KD0 A;  1HQR D;  1V80 A;  2YVC A;  1B9R A;  1D4B A;  4X57 B;  1KLV A;  3V61 A;  3GP7 A;  4M02 A;  1WXS A;  1XLO A;  3W1S C;  4RM8 A;  3AM9 A;  4W9D A;  4A3O A;  4EUT A;  2RD0 A;  3BVG A;  1FMA D;  2K8C A;  2K3U A;  4ZRK A;  2N9X A;  2W9N A;  4ICV A;  2IYD B;  2JQR B;  1MFW A;  3URY A;  3H1U A;  2I1K A;  3TSS A;  1WR1 A;  1UEL A;  5D2M B;  4RM9 A;  2D3A A;  2NCN A;  4XWW A;  5LXH A;  3RNG C;  2N7D A;  3BY4 B;  3P4S B;  4IW0 A;  2VZK B;  3LDZ E;  1SGH A;  1YX5 B;  3A9J A;  1J8C A;  1UUP A;  4WQM A;  3BYT B;  3RZW C;  4GXB A;  3AU5 A;  4II2 B;  3Q8F A;  3ZKJ C;  2WDR B;  2DZM A;  2MRP A;  4RGT A;  5D3I B;  3U30 A;  2M17 A;  4EFO A;  2HE7 A;  3ZXV A;  1TKE A;  4GU2 A;  1QOA A;  3A33 B;  2R2Q A;  1YQ3 B;  2JZP A;  1RLF A;  2FIF A;  3SDL C;  5AZF A;  2NVU I;  4IG7 B;  4KIK A;  2FNJ B;  5HFY A;  1A5R A;  3A9K A;  4HK2 A;  4YSZ B;  5BYS A;  3GS2 A;  3RCZ A;  2JT4 B;  3I63 C;  4XGA B;  2D11 A;  4DBG A;  4A9A A;  3D32 A;  3BVM A;  2R61 A;  2BVC A;  3HK0 A;  1SE4 A;  2JRI B;  1AAR A;  1EO6 A;  3DPD A;  2WXR A;  3QX1 A;  2RGF A;  2LWP A;  1VD2 A;  2NBW B;  2FUG 1;  2A5U A;  2LGI A;  1C4A A;  1L6U A;  2QMT A;  3PRM B;  2C60 A;  4IOI E;  2GB1 A;  4G0N B;  3DBH B;  1VRA B;  4OHJ A;  3K9P B;  1RAX A;  3QK0 A;  2JU6 X;  4S0R A;  5FR3 A;  1RFK A;  1RRB A;  1DOY A;  3ZIM A;  4MJS A;  4WWN A;  2D07 B;  1QQR A;  1ISN A;  1YOV B;  2PW9 A;  1VCB A;  1F9J A;  5KHO A;  4M8M A;  4BVU C;  2BKR B;  3DOW A;  1OTR B;  4W9F A;  5I4D A;  2M19 A;  1TKG A;  4C7Y A;  1HEZ E;  1T0R C;  1SJH D;  3H7P A;  3APF A;  4FBJ B;  3TL5 A;  3C19 A;  2EMT A;  2CJO A;  1Y8R C;  1MPE A;  2VRR B;  4TQ0 A;  3WA0 A;  2AQ2 B;  2KQ4 X;  2ZW1 A;  3PHW B;  1KF6 B;  2MBB B;  3WAP A;  1E0Z A;  3N1X C;  3UI3 A;  5AUI A;  4OZA A;  2WWZ A;  3ONS A;  2Q5W D;  4YTN B;  4I6P A;  1V5O A;  2BYE A;  2KDB A;  2MJE A;  1EU3 A;  3AN1 A;  1C76 A;  5IN7 A;  4HRS A;  4HCP B;  3RD2 A;  3WAL A;  2LGX A;  5BO4 B;  1C9F A;  3RNB C;  3PRP B;  3N1Z C;  3H7S A;  5JHA A;  3FIL B;  1NYR A;  3MTN B;  2MBQ A;  4PT5 A;  1QIL A;  1FRD A;  4P16 A;  3ZXR A;  2BWE S;  3H8H A;  3PGE A;  1XCQ L;  4C7Z A;  1TZO A;  3RZF A;  3IT4 B;  1T6B X;  1V2Y A;  4EEW A;  3RUL A;  2Y3A A;  3PVL A;  1ROE A;  1R4M B;  1TGZ B;  1WRI A;  3DVN U;  1TKY A;  3NY5 A;  3L17 A;  1Z2M A;  5E6N A;  1F52 A;  2KWC A;  4OVV A;  3SU8 X;  1NEN B;  4OW0 A;  1TJE A;  2WU5 B;  2PE6 B;  1V49 A;  4YL8 A;  4HJK A;  1PDX A;  3I5J C;  4LJP B;  4BKS A;  1WGG A;  1K50 A;  4JWU C;  1L0Y B;  3MC8 A;  1XEE A;  2PLP A;  4FXC A;  3L10 B;  2FUH B;  2LI5 A;  1WYW B;  2AYO B;  5DPS A;  2MLB A;  1VJK A;  1TS4 A;  3KLS X;  1WJU A;  2JY6 A;  2AQ3 B;  1T0Q C;  4WAF A;  1V9J A;  2JPH A;  2KDM A;  2INC C;  2OOB B;  4RGO S;  4US9 A;  4TV3 A;  2G45 B;  4MDK E;  5BMH A;  3QC8 B;  2OHF A;  1U4A A;  3N1Y C;  3P63 A;  4MGZ E;  2IY1 B;  1WX7 A;  3GOE A;  4MM3 A;  2NTT A;  4ANU A;  4YSY B;  1UF0 A;  3AED B;  3Q8A A;  3LB8 C;  3QAR A;  1NVI D;  2LRU A;  3KWV A;  3CST A;  1X1M A;  4MEM A;  4EZL A;  2BYF A;  1R4M I;  4ZRP A;  3AE7 B;  5FK9 C;  2GLS A;  2LFI A;  2IO0 B;  4HKZ E;  2V3N A;  4DDG D;  2MJ3 A;  1ESF A;  5BYR A;  1R4N B;  3WAN A;  1OEY J;  3QA8 A;  4LNK A;  3KH0 A;  4REZ A;  1IBX B;  3AU4 A;  2VH1 A;  1TIF A;  5D7G A;  1ZXI A;  2LGD A;  1V86 A;  5E6O A;  4KKI A;  2PEA A;  4ACF A;  1H8C A;  2NPT B;  1EWC A;  3NVV A;  2JVC A;  5G5G A;  2D5G A;  3PZ8 A;  4C80 A;  4M8N A;  5LLI A;  2BB5 A;  1TS5 A;  4RFB A;  3R8B A;  1K8R B;  1QT9 A;  4Q2J A;  1UGM A;  3MFG A;  4TUU A;  2LVQ A;  3V6C B;  1UWX A;  1SE2 A;  2M0A A;  4C4V B;  2IY0 B;  3QAQ A;  3QCA A; 
#chains in the Genus database with same CATH homology
 3NVZ A;  1QOB A;  2L32 A;  1RWS A;  1AW7 A;  1YN4 A;  4DXF A;  1TY2 A;  2WXN A;  2HTM E;  3TEX A;  4OVZ A;  2K0P A;  3FAH A;  1VR9 A;  1XLQ A;  1KTK A;  4RGM A;  3B2F A;  3VQI A;  3Q8C A;  1VZ6 A;  3AEG B;  1VZ8 A;  2WP9 B;  1E9M A;  1KLG D;  2KMM A;  2L1A A;  1DOI A;  2XN9 C;  1NI3 A;  4MAC A;  1JCK B;  5EE0 A;  1FXA A;  3ETR A;  1CJE A;  1PGB A;  1V8C A;  4RGN A;  4RNA A;  1E10 A;  2QSD A;  4XWT A;  1FNW A;  1FRR A;  4MH8 A;  4OZB A;  1TY0 A;  2ACZ B;  1N62 A;  5FKA C;  3TEZ A;  1GB4 A;  1KFY B;  3PZ7 A;  1B1Z A;  4WWM A;  5D3D A;  2J53 A;  4GDL B;  1XO3 A;  2GI9 A;  4LK0 M;  5H92 C;  1FXI A;  5G5H A;  1M4V A;  1JWS D;  1YQ4 B;  2INP E;  2E6X A;  2QEJ C;  2TSS A;  3W5U B;  2DYM A;  3EA6 A;  3ZQ4 A;  2ZW0 A;  3AE8 B;  3IAM 1;  4HEA 1;  2LHD A;  2GRI A;  4P6V F;  2BW2 A;  3HVD A;  3T3O A;  1HZ6 A;  3W2D A;  1ZXH A;  1L4D B;  2QIL A;  4LTU A;  4WH4 A;  4LLG M;  1E6E B;  1KLU D;  2LHE A;  1SEB D;  2I2Y A;  4NJC A;  2WXG A;  3GB1 A;  2IDY A;  3L4P A;  2CJN A;  3IXS A;  4MM3 B;  2IJ0 A;  3W1S A;  3E9S A;  1FIQ A;  1JW9 D;  3ZJU A;  1F2R I;  1I4Q A;  3NRZ A;  2IGG A;  3OWE B;  4GDK B;  4H2A A;  3U2S C;  4TQ1 A;  3W9C B;  2IGD A;  1SF0 A;  2RDG A;  2LEK A;  4US8 A;  1HA5 A;  4IDI A;  1IGC A;  2ONQ A;  3SEB A;  4XE0 A;  3I57 A;  3VRB B;  2W82 A;  2DBY A;  1D5X C;  1YJJ A;  2PKO A;  2VZK D;  1AWD A;  1JAL A;  1HQR D;  3AEF B;  4ZYS A;  1SIJ A;  1N63 A;  3VRA B;  1B9R A;  1D4B A;  2INN E;  4D2K A;  3GP7 A;  4ZRQ A;  3BZD B;  1F77 A;  1XLO A;  3AM9 A;  1JML A;  2L52 A;  3C8Y A;  4HKQ A;  2L83 A;  2FBW B;  2PMV A;  2WXF A;  3BVG A;  1FMA D;  4JE3 B;  2K3U A;  4N6E B;  4DQO C;  1SJE D;  2JQR B;  2JXT A;  1FFU A;  3URY A;  3BYY B;  1EU4 A;  3TSS A;  5T8I A;  2QIE B;  4XWW A;  3SFD B;  2WXO A;  3EUB 2;  1FCC C;  2W3S A;  1JWA D;  2OED A;  1DOX A;  3P4S B;  4B0E A;  1IUE A;  1J7A A;  2VZK B;  2WLB A;  4NAM A;  1UUP A;  4WQM A;  4YTP B;  5AUK A;  3BYT B;  3NUH B;  1SXT A;  3HUI A;  1ZOY B;  2K5P A;  2PTL A;  3Q8F A;  3DWG C;  1I7H A;  2WDR B;  4RGT A;  2J42 A;  2M56 B;  3V05 A;  5D3I B;  2FE8 A;  3WCQ A;  1TKE A;  1VDV A;  1QOA A;  3O13 A;  1I4G A;  1C79 A;  1N5W A;  1PUT A;  1YQ3 B;  2JZP A;  3N9Y C;  3AV8 A;  1LO5 D;  2YEP B;  1SBB B;  4N58 A;  3ZYY X;  5HFY A;  1MHX A;  1YN3 A;  1SSN A;  1V97 A;  2SEB D;  2AQ1 B;  3LYY A;  1ACC A;  2Y5C A;  2AX5 A;  4YSZ B;  4KGS A;  2K22 A;  5BYS A;  3GS2 A;  4NZL B;  1L0X B;  2LJI A;  3U7Z A;  1VLB A;  4L1B A;  2N9L A;  2BS4 B;  2W55 A;  2WXJ A;  1WSP A;  1XXG A;  1PGX A;  4A9A A;  1TYG B;  2JWU A;  3AE5 B;  1N61 A;  1ZP0 B;  2NTS A;  3BK1 A;  5H8Y E;  1L6V A;  3BVM A;  1L5P A;  2R61 A;  1I4X A;  1SE4 A;  1WGK A;  4UDU C;  3MJ5 A;  4N59 A;  4ZHO A;  2WXR A;  5BMI A;  1N60 A;  5EE9 A;  2FUG 1;  3ZGZ A;  2KAC A;  2LGI A;  1C4A A;  1L6U A;  2QMT A;  2V4I B;  1D5M C;  1SB3 C;  4IOI E;  1F2R C;  2GB1 A;  2N7J A;  2E3T A;  4A8X C;  1J7B A;  1VRA B;  3AE6 B;  5C3J B;  4OHJ A;  5HHD G;  1GPX A;  4RH6 A;  1SE3 A;  2JU6 X;  5FR3 A;  1RFK A;  1PYW D;  4RF0 A;  1E7P B;  1GAQ B;  1YJI A;  1AN8 A;  1DOY A;  3R2T A;  5BMG A;  1ENF A;  1JWM D;  1V1O A;  1K51 A;  4JWS C;  2BYT A;  1QQR A;  2PW9 A;  1C4C A;  3AE3 B;  5C2T B;  1WWT A;  2EKI A;  4OZC A;  3AH7 A;  2BS3 B;  2WQY B;  2LMC A;  3FC4 A;  3E56 A;  1FCL A;  5I4D A;  3AE1 B;  3AB5 A;  4C56 C;  1K53 A;  2M19 A;  3AMZ A;  2JSV X;  1TKG A;  2WDQ B;  1L4Z B;  2V3P A;  1HEZ E;  4C7Y A;  3TUO A;  4JX1 C;  3VR8 B;  1SJH D;  4L2Y A;  3LXF A;  3RFZ B;  1YMH E;  1UGJ A;  3TEY A;  2CJO A;  1R7S A;  1UWM A;  4ZOH C;  3EGR A;  3SFE B;  1BML C;  1FM0 D;  1ZDX A;  2BBC A;  2QJL A;  1ET6 A;  1MPE A;  1ZDV A;  1STE A;  5MPO A;  2KWD A;  4TQ0 A;  4TMA B;  4YXD B;  2H89 B;  1I4R A;  2AQ2 B;  2KQ4 X;  3ZJT A;  3BVZ A;  1ZE3 D;  2EEL A;  2ZW1 A;  2PIA A;  3ABV B;  1KF6 B;  2WDV B;  2H88 B;  1E0Z A;  1Q10 A;  3Q8E A;  2DYO A;  4DXG A;  3P4P B;  3UI3 A;  5AUI A;  4OZA A;  4ZHP A;  2I38 A;  3HVZ A;  2Q5W D;  4M0W A;  1FFV A;  1V1P A;  3IT6 B;  1YN5 A;  4YTN B;  2KN4 A;  4GLS C;  1C77 A;  1QKZ A;  3T3N A;  4B0M A;  4JPS A;  4ITK A;  2MJE A;  2ICI A;  4A55 A;  1EU3 A;  3AN1 A;  3U52 E;  1C76 A;  4KGT A;  4HRS A;  2WU2 B;  1WYG A;  1C4P A;  3DWM A;  4NAW B;  1I4P A;  2KAJ A;  1C9F A;  2WXM A;  4HJG E;  1FNU A;  1PGA A;  3P42 A;  1NEK B;  1NYQ A;  2SAK A;  3CIR B;  2W3R A;  3FIL A;  3FIL B;  2ON8 A;  1NYR A;  5EE1 A;  4YTM B;  1L0V B;  1HXY D;  2WXI A;  4A90 A;  4WUR A;  2WXL A;  2G9H D;  4PT5 A;  1QIL A;  3NVY A;  1FRD A;  1IGD A;  2K9X A;  4P16 A;  3HRD D;  1JRP A;  3H8H A;  4USA A;  1XCQ L;  2BB6 A;  4C7Z A;  1TZO A;  1QOF A;  3IT4 B;  4KGR A;  1CK1 A;  2N9K A;  2DWQ A;  1T6B X;  2JX5 A;  2DLB A;  2V0G A;  1XF5 L;  4KX6 B;  1QF6 A;  2Y3A A;  1FD6 A;  3IAS 1;  1MVK A;  2Z8L A;  1ROE A;  2PVO D;  2PVG C;  1WRI A;  1WXQ A;  1TKY A;  3R2I A;  3MHZ A;  2LUM A;  4XDC A;  1CQV A;  1J7C A;  1C78 A;  1D6E C;  1VZ7 A;  4YT0 B;  1I4H A;  2RPV A;  1DGJ A;  1NEN B;  4OW0 A;  1TJE A;  2WU5 B;  4L23 A;  2HDE A;  1D5Z C;  1XLP A;  4O1N A;  1EM7 A;  2WXH A;  1AYF A;  2CU3 A;  2IPK D;  3W5V B;  1PDX A;  4RF1 A;  1QOG A;  3B9J A;  1K50 A;  4AS1 A;  1BUI C;  4JWU C;  2J52 A;  2Y5P A;  1FO4 A;  3AEA B;  4AQ7 A;  1FEH A;  1L0Y B;  4KKJ A;  2WXK A;  4HRO A;  1XEE A;  2PLP A;  4FXC A;  3MC0 B;  2J4X A;  4R3D A;  3BWU D;  4IKG A;  4XDD A;  5HG2 A;  1HZ5 A;  4ARI A;  3AE2 B;  3CWI A;  5E6J A;  1VJK A;  1TS4 A;  1OQQ A;  3KLS X;  3AE4 B;  3NZ3 A;  4ARC A;  2AQ3 B;  4WAF A;  1ZUD 2;  2G1E A;  5TSS A;  2KDM A;  1TS2 A;  1GB1 A;  1BXT A;  3MP9 A;  4RGO S;  1OQR A;  1ZPS A;  4YSX B;  3I9V 1;  3AEE B;  4US9 A;  2WS3 B;  2IGH A;  2BS2 B;  3B2G A;  5BMH A;  1RM6 C;  3AEB B;  2OHF A;  3P63 A;  1F0Z A;  2RMM A;  2X38 A;  2MJD A;  3J9C A;  3U4E G;  2NTT A;  4YSY B;  1PFD A;  3AED B;  3Q8B A;  3Q8A A;  3LB8 C;  5GXG B;  4A6Q A;  2JYT A;  1NVI D;  4YWG G;  3KWV A;  1DYQ A;  1KH0 A;  1YNT E;  3P1M A;  4J3O D;  4MT5 A;  4ZRP A;  3AE7 B;  1MHH E;  1P7F A;  5FK9 C;  1Y56 A;  5JXV A;  2LFI A;  1QLB B;  4HKZ E;  2V3N A;  2WNM A;  2MJ3 A;  1ESF A;  5BYR A;  2B76 B;  3RPF C;  3BII D;  1P7E A;  1V1P B;  1A70 A;  3AE9 B;  3ZJV A;  2BT6 A;  1EWY C;  1T3Q A;  1RYJ A;  4REZ A;  1IBX A;  1IBX B;  3Q69 A;  3TEW A;  3PO0 A;  1JWB D;  2W54 A;  3AEC B;  3NS1 A;  3P4Q B;  5D7G A;  4CQN A;  1ZXI A;  2BTE A;  3KQ4 A;  1OFF A;  4WIP A;  2WXQ A;  3KWL A;  5LNK 1;  4KKI A;  5EE3 A;  5BYQ A;  1EWC A;  3NVV A;  1JQ4 A;  2RDH A;  4RCO A;  5G5G A;  1JRO A;  2D5G A;  2WXP A;  3NVW A;  1XLN A;  3BK2 A;  3PZ8 A;  1ET9 A;  1KRH A;  4C80 A;  1XCT L;  2YEP F;  1GOZ A;  3V3X A;  3SR6 A;  2BB5 A;  1TS5 A;  1K52 A;  1FNV A;  1T5X D;  4EE2 A;  4RFB A;  3R8B A;  2N0S B;  1TS3 A;  1QT9 A;  5HI1 A;  2MEK A;  1UNS A;  2JYE A;  2XNA C;  4Q2J A;  3P4R B;  4TSS A;  1CZP A;  3MFG A;  1MI0 A;  1JWU D;  1UWX A;  3VR9 B;  1SE2 A;  2M0A A;  2MH7 A;  2NMQ A;  1N5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...