3TIXA

Crystal structure of the chp1-tas3 complex core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
153
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDNDIIEAHREQIGGLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRSEMLSQRKLLAAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/protein binding
molecule keywords Ubiquitin-like protein SMT3,RNA-induced transcriptional sile
publication title The Chp1-Tas3 core is a multifunctional platform critical for gene silencing by RITS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tixA01
2JZZA 3X0WA 3DBSA 3PRMB 2BWES 1JRUA 4K81A 4KSLC 2GBNA 2KQSA 1WMHA 2JPHA 1C1YB 3PRPB 4BKGA 2MBQA 3PRZA 2GBKA 1EF5A 3IFWB 2ZNVC 3A1QB 2LI5A 3KYDD 4K7WA 4KSKC 4W9GA 3SU8X 1E8YA 1V5OA 3TBLD 4TV3A 3VVWB 5EDSA 1XD3B 4A3OA 2KMAA 1TBEA 2LGYA 5TR5A 1XQQA 2GMIC 3L08A 2ZCCA 1OQYA 5AZHA 2C60A 2V3SA 4FULA 4HWIB 4E74A 1WGYA 3RULA 3SHQA 2C7NB 4IM3A 2O6VD 3ML8A 3DDCB 4A3PA 1V49A 1Q0WB 2MP2B 1R4MI 2IYDB 4II2B 2HTHA 3W1SA 1FXTB 3WANA 2K6DB 1UELA 2DENB 2IY0B 4ICUA 4DHZE 3A4SC 1WJUA 4DK5A 2KZRA 1UBIA 2MA9B 4DXAB 4FJYA 3VXWA 3H7SA 1RRBA 3NHEB 4BKSD 2KFKA 1E8ZA 3V61A 2KQ7A 2IZVB 1H8CA 2KLGA 1T0YA 3SD5A 1WX7A 2LRWA 1WJNA 1V5TA 1WH3A 2DZIA 1H4RA 2LD9A 5DCNA 4IC7B 4AUQC 1WXAA 1NI2A 3DBLI 3A33B 3UINB 3KUCB 4AP4C 2FCSA 3APFA 4GDKA 1V2YA 2KFJA 2V1YA 2KN5A 3A9JA 4HXDA 3QHTA 1V80A 2LXCA 4ANWA 3U7DA 2KTFA 2DZMA 2NPTB 4CHKA 4F7ZA 1V81A 2ZJDA 2JVCA 5DPRA 2C9WB 1NDDA 2IO1B 3V6EB 1WJ4A 3RD2A 1YX6B 3WALA 3CSTA 5CX3A 1P98A 4TKNA 3BINA 2M8SA 2J7QB 3OLMD 2VRRB 4TUUA 1OEYA 4WQOB 1LQBA 1MG8A 4ZRKA 3QCAA 3V62A 2JRHA 2DYMA 5D2MB 2KC2A 2KXJA 3ZDMC 4IWQA 1OGWA 2KWCA 4ASWC 4MELA 2C5LC 4EZKA 4PS7A 4CYEA 4GDLA 4HPLB 5KHOA 1C3TA 3HM6X 5G55A 5IA7A 3MHSD 2DAJA 2N9XA 3A4RA 3T9LA 4BOZB 1KM7A 1GC6A 5AZFA 4W9IA 1WY8A 5AZGA 4W9EA 2CKHB 1P3QU 2L76A 3APDA 3MJWA 3M62B 4RMAA 3PPAA 1OEYJ 2N1VA 4WJQA 2O2VA 3ZDTA 3ZNHB 4WJPA 4DHZB 4ZRJA 4LJOB 3CSFA 1LM8B 2K39A 4XZ4A 2GBJA 2IO0B 4FHKA 1Q1OA 2GBMA 3VUXA 1G6JA 1WM2A 2KDFB 2D10A 3Q3FA 1I35A 4NPNA 3B0AA 4OVUA 1X1MA 1KLVA 2EMSA 2MQJA 3KUDB 3PHXB 4HJKA 2XK5A 4ICVA 1P9DU 3JYUA 3TL5A 2MBHA 2AYOB 5AEKB 4MH0E 3A9KA 2DZJA 3ENEA 4KDIC 4LJPB 2KX3A 1WIAA 4MM3A 1Y8RC 2BF8B 3HM3A 3K9OB 2RR9A 4MSQB 3N32A 3D32A 4HVBA 3KYCD 5L95C 4MJSA 3LDZE 1WI0A 2ZPNA 3AU5A 3IVFA 2LRUA 2WX0A 3QK0A 1J0GA 2WWZA 1IPGA 2FAZA 3TJPA 4JL9A 2LASA 4BOSC 1Q5WB 2RD0A 3VTVA 3S2AA 5C23A 1WR6E 2DYBA 2MRPA 3AULA 3B08A 1WRDB 3QA8A 1E90A 2EMTA 2KJRA 3DBRI 4II3B 1ZGUB 2QHOA 3ONSA 1IYFA 2PEAA 4IG7B 3GZNI 3H7PB 4IWPA 2BKRB 2KJ6A 3NY5A 3ZTDA 2OOBB 2MBEA 4FA6A 2MW5A 2BYEA 3VDZA 2G45B 2ZEQA 2KKCA 4W9KA 1S3SG 1V9JA 5G2NA 4GSWA 2N7EA 1D3ZA 3HK0A 2DHZA 4WJOA 3AU4A 2L8JA 1OTRB 1QZEA 4KIKA 2CHXA 2KWUB 3VTWA 4W9HA 2CU1A 1XT9B 4NAWB 2R2OA 5D94A 3TCAA 4MGIE 4FJZA 3W1YA 3L10B 3PZDA 2MBBB 2KK8A 1CMXB 3A1QA 4G3XB 2O6VB 3VFKA 2LWPA 2WX1A 4LCDE 2IO3B 3QWZB 3ZIMA 3PLUA 2RSUA 4G0NB 4DBGA 3PHWB 4W9FA 4GDKB 3W1SC 4IM2A 1ISNA 3ZNZB 2G3QB 3RZWC 3H1UA 3HHMA 2JZ3B 1E7UA 4G11A 3DVNU 4EUTA 1GJZA 4HDOA 3WAMA 4ANUA 2NBWB 4PYZA 1GUAB 1BT0A 4JLCA 4YL8A 1KOTA 5GMVA 2FCNA 3APCA 1WE7A 3JW0X 2AL3A 3DQVA 2I1JA 4FHJA 4RM8A 3UQBA 3IG3A 1WZ0A 2K25A 2BKFA 1WGHA 2Z0EB 4ANVA 2AL6A 2OJRA 2XBBC 2JF5A 1WXVA 2ZVNA 2IY1B 4JGHB 1TZ1A 2PE6B 2KWVB 1AARA 2FIFA 3PS6A 3HIZA 2M4NA 4MGYE 3WAOA 2NBUA 4WAAA 1RAXA 4MSMB 2NPTA 4B6WA 2Y5BB 1UD7A 1UZXB 2ZZPB 5IAAC 4B9KA 4K1RB 3UIOB 3NZSA 5LXIB 3JVZX 3ZW3A 1F9JA 1P0RA 5D7GA 1V6EA 4PS3A 3UIPB 3UQAA 2O2VB 2KTRB 3JSVB 3X23A 3ZNGC 3QAQA 2FCQA 4GOCA 2DAFA 4DHJD 1A5RA 3PT2B 4MGKE 3CMMB 1J19A 5CHWA 4EOYA 4EZLA 4DWFA 4NJ6A 2MLBA 1GNUA 4BFRA 1WGRA 5L83A 2LGXA 1RLFA 2G4SA 4IWOA 1SE9A 4MGZE 5DPWA 4KV2A 2DYOA 3A9KB 2XEWA 3RZFA 3V6CB 3M63B 3KH0A 4WWOA 3ZUNA 2KX0A 3ML9A 4EKUA 1UGMA 3MTNB 4AWJA 4F8CB 2NS5A 5BO4B 2REXA 4GU2A 1E8XA 3RT3B 2D2QA 2JT4B 2IO2B 2LXAA 4OVVA 2V4LA 1R4NI 4CO7A 3P2BA 4HK2A 5D6JB 4FN2A 2L0FA 2EKEC 1SIFA 4W9LA 2BGFA 4NNJB 5C1ZA 1K8RB 3PTFC 1Z2MA 1YQBA 4F1SA 5CTRC 4GGQA 2N9PC 3PLVA 4FJVB 1GG3A 2KLCA 2N9EB 3WAPA 2LUEA 3L54A 2GBRA 4HCPB 3O65B 2W9NA 4AJYB 1WMHB 2BPSA 4GXBA 3N3KB 3ALBA 2KDIA 1P1AA 2L0TA 3NS8A 4KVGB 4ZRIA 2B3AA 4NQKE 4HPMB 2D07B 4DDGD 5CHFA 2KD0A 2FCMA 3L17A 3VHTC 2KNBA 3PGEA 4FADA 3KW5B 3N30A 1YJ1A 4W9CA 3QJZA 2Z0DB 2PE9A 1YD8U 1EF1A 2LJ5A 2MCNB 3U30A 3ZVVA 1UBQA 4MDKE 3ZRCA 1PQSA 2BYFA 3VH4B 5KHQA 3L16A 1U4AA 3ZO5B 1E5WA 2KMCA 5JHAA 1M94A 2R2QA 4EZJA 4GB9A 2WDTB 4KZ0A 3EECA 5LLIA 3H7PA 3NOBA 5FR6A 1WF9A 4A20A 2KFKB 3B1LX 3QQ8B 4ANXA 5J17A 2MSED 1ZKHA 4GMVA 4I6LB 1TTNA 3R66C 1I42A 3IHPC 4I6NB 3VAWA 1RFAA 3WA0A 4JIOU 4EEWA 3DPDA 4URKA 3UGBB 5JZEB 3OAWA 3R7RA 3ZLZA 3EC8A 1L7YA 2L00B 2KO3A 3IBEA 4N9F4 4ZDVA 3QC8B 2LVPA 4IM0A 5CHVC 3UF8A 2N4FA 3A9JB 4HLEA 2WYQA 3KUZA 2N7DA 3VQIA 2MP2A 4XX5A 4TQ0A 2FNJB 3CF6E 4RM9A 3Q3JA 2KANA 2LZ6A 3K9PB 4I6PA 3R7QA 2NBVB 4NAWA 3ZKJC 2IBIB 4JQWC 5JHBA 4AJWA 4B95A 2L7RA 2M17A 1LFDA 1GC7A 1EUVB 2BYVE 2NCNA 2NVUI 2YVCA 2O6VA 4WWNA 3NZUA 2LVOA 4WJNA 2YLMA 3BY4B 2KDEB 1KJTA 2C7MB 4BBNC 3M3JA 2FIDA 2K8BA 3ZTCA 2MBOA 4IW0A 5E6OA 3KVFB 1E7VA 2I1KA 3OJ3A 2AEHA 3GOEA 5HKHA 3DOWA 2L3ZA 3SDLC 4BKSA 4GDLB 4X57B 1WX9A 4BKTA 5J2RA 2KHWB 1SGHA 3R3MA 3VH3B 2DX5B 3PV1A 2K1FA 3WIMA 3LJ3A 1WYWB 2KVRA 4M8MA 2JRIB 3AI5A 3DBHI 2Z59B 4KZCA 3TMPB 1WXMA 2LGDA 3H9DA 3U8ZA 2J0KA 4W9DA 4BBNF 3RYTA 2JY6A 4K7UA 1TGZB 3DVNV 3PSEB 4EFOA 2G4DB 2M0XA 4DDID 3C0RB 4GN1A 1J8CA 4ZYNA 3EFUA 1ZW7A 2MX2A 2ZCBA 4KDLB 2KOXA 3T8MA 3H6NA 1HE8A 1WXSA 2UYZB 1WGGA 1VD2A 2M1MA 4W9JA 1WM3A 1EO6A 2A4ZA 3RCZA 2C7HA 2KC1A 2KDBA 3VUYA 2NR2A 4IUMB 4PYUA 1WR1A 4GIVA 3L13A 4NY0A 2ZPYA 3L0WB 2CR5A 2XK5B 2J0MA 4WWPA 1LXDA 2LVQA 2JWZA 2MWSB 3PVLA 3VTUA 4P7IA 4AOFA 4DHJB 1L2NA 2UWQA 2CHWA 5JH5C 2RGFA 2L05A 3ECIA 3ZRFA 3RUIB 3M95A 3VUWA 2KTRA 3JSVA 5DPTA 3DCGA 3AXCA 2ZVOA 4NJ7A 1WFYA 4MJSB 4LDTD 2K6QA 1Z5SB 1E8WA 5E6NA 1YX5B 2PPHA 1WE6A 3OJ4B 5J18A 2PJHA 4E3CA 2BWFA 2D3GA 1NBFC 2J0JA 4HCNB 3QARA 2FUHB 3DVGX 3QIJA 2D11A 1WJ6A 4PS8A 4XC2A 2K8CA 2GOWA 4TQ1A 1UH6A 1YIWA 4HDQA 2JUOA 4LDTB 3DVGY 2DZKA 5DPSA 2N1WA 4NQLB 4E71A 2AWTA 3V60A 1WX8A 4J6IA 4FLHA 4MEMA 3PREA 2HE7A 1IP9A 2RPQA 1WZ3A 5LXHA 2HJ8A 2A5UA 2CS4A 3TIXA 1V86A 2ZNVB 4K7SA 2JXXA 3ZNID 2CHZA 3QX1A 2K8HA 5E6PA 2ASQA 4FBJB 3EHVA 4M8NA 2KJHB 4M0WB 4BVUC 1S1QB 1VCBA 4G50A 4KIKB 3I3TB 1WGDA 2HD5B
chains in the Genus database with same CATH superfamily
2JZZA 2GBNA 1FRDA 2JPHA 3PRPB 1HA5A 4BKGA 3PRZA 3KYDD 4W9GA 1E8YA 5EDSA 4A3OA 2LGYA 1XQQA 2WNMA 3L08A 2BVCA 4HWIB 4CQNA 3RULA 4IM3A 3ML8A 1V49A 2MP2B 3WANA 1R4MI 1TS4A 2KZRA 1UBIA 1HTQA 3NHEB 2VH2A 1N63A 2KQ7A 1MHHE 1WX7A 2H89B 1V5TA 2AQ2B 4ZHPA 1GAQB 1TKYA 1ZDXA 1FRRA 3T3OA 2V1YA 1KLGD 2KTFA 2DZMA 4F7ZA 1V81A 2IDYA 1FNUA 3V6EB 1YJJA 5CX3A 4TKNA 2M8SA 3OLMD 2VRRB 1LQBA 2LJIA 1MG8A 3QCAA 3AEGB 2DYMA 5D2MB 2KC2A 2KXJA 1VZ8A 4REZA 3Q3NC 5KHOA 5G55A 2DAJA 2E6XA 3AE8B 5AZFA 4W9IA 3DBRB 3RNCC 1XCQL 2ICIA 3M62B 3BK1A 2N1VA 4WJQA 5HG2A 1KF6B 4DHZB 4ZRJA 3AE7B 4XZ4A 4FHKA 2KDFB 2D10A 4NPNA 3SFEB 2L32A 4A8XC 1K50A 3JYUA 1DOYA 1EU4A 1TY2A 1Y8RC 3HM3A 3K9OB 5BMHA 2WXFA 1J0GA 4P16A 3VTVA 1EWCA 1B9RA 5C23A 2EMTA 4YTMB 4WH4A 2PEAA 4FA6A 1F2RC 1GOZA 2BYEA 3VDZA 4GSWA 4M00A 3W9CB 1SE2A 1D3ZA 2DHZA 3L4PA 4KIKA 1E7PB 3VTWA 1K51A 1P7FA 3P42A 4FJZA 4ACFA 1RFKA 3PZDA 2E3TA 2CJNA 3CWIA 2IGHA 3VRAB 1N5XA 2LWPA 2IO3B 3QWZB 1TS5A 3PLUA 3ZIMA 2IPKD 3PHWB 3W1SC 4KKIA 1ISNA 2BT6A 4BAXA 3HHMA 3ZXVA 4S0RA 3AEEB 4EUTA 1GJZA 4HDOA 4WURA 4JLCA 1BT0A 1NEKB 3JW0X 4YSXB 4RM8A 2BKFA 1ZOYB 2Z0EB 4ANVA 2OEDA 2W54A 1PGXA 1RAXA 5AUKA 2Y5BB 2EKIA 2ZZPB 2OHFA 5IAAC 1OFFA 3UIOB 2KACA 2M56B 3E9SA 3ZW3A 1F9JA 4YT0B 3X23A 1JWMD 3PZ8A 3PT2B 4EOYA 4NJ6A 4BFRA 2LGXA 5IN7A 2XEWA 4WWOA 3ZQ4A 2REXA 4GU2A 5AUIA 2JT4B 2LXAA 1RWSA 4M02A 2V4LA 1R4NI 2B76B 3P2BA 4HK2A 4FN2A 4OZCA 2L0FA 2QSDA 2EKEC 2WGSA 2IGDA 3TUOA 1YQ4B 2WXPA 1Z2MA 1J7CA 4F1SA 4GGQA 5IP4D 5FK9C 4HCPB 4AJYB 1WMHB 4USAA 3N3KB 1P1AA 3B2GA 1T3QA 2B3AA 2INNE 4HPMB 3VR8B 5BMIA 3DBLB 2Z0DB 1UBQA 4NZLB 1TS2A 3VH4B 4AS1A 2LMCA 2WDTB 4KZ0A 1A70A 3FKYA 1WF9A 1QLBB 3AB5A 2KFKB 3U52E 2MSED 1I42A 3IHPC 1RFAA 3WA0A 1WWTA 3C8YA 3OAWA 3R7RA 1L7YA 2RPVA 3QC8B 5CHVC 5H92C 1XF5L 2N0SB 4TQ0A 2N7DA 3VQIA 1C76A 3CF6E 3Q3JA 2ACZB 4N58A 1E0ZA 4JQWC 1EWYC 2M17A 3P4RB 2BYVE 2NVUI 2YVCA 3W2DA 2O6VA 4WWNA 2NTTA 3NZUA 4LNNA 1SSNA 2BS2B 3BY4B 2C7MB 3M3JA 1UF0A 3J9CA 3ZTCA 4IW0A 3TEZA 3DOWA 2L3ZA 4GDLB 5J2RA 3Q3OC 5GXGB 3VH3B 1JWAD 3AEFB 3WIMA 3LJ3A 1WYWB 4QAYA 1BMLC 2J0KA 2JY6A 1BXTA 3PSEB 3C0RB 2K0PA 1XEEA 4ZYNA 2MX2A 3FILA 2ZCBA 4KDLB 2KQ4X 3H6NA 1WXSA 4W9JA 2XN9C 3RCZA 2XNAC 2CR5A 2J0MA 2JWZA 1WYGA 2RGFA 3GZNB 3RUIB 3M95A 3Q14C 1WFYA 2K6QA 1Z5SB 5J18A 2WU2B 2BWFA 3TEWA 2PIAA 3EGRA 3RFZB 3ETRA 3DVGX 2D11A 2V3NA 2K8CA 1I4PA 2WXJA 2DZKA 4E71A 1I4QA 3PREA 2Y5PA 1IP9A 2A5UA 4RGOS 1V86A 5EE3A 2WXRA 4M8NA 2KJHB 4M0WB 4L2YA 2VZKB 1DOIA 2KYWA 1EF5A 3AE5B 3N1ZC 3X0WA 2BWES 1B1ZA 2KMMA 3N20C 3IFWB 2G9HD 3A1QB 4K7WA 2V0GA 1V5OA 1IBXB 1XD3B 2KMAA 1TBEA 2MEKA 5TR5A 1KRHA 2C60A 2J53A 2V3SA 1ET6A 2H88B 5EE9A 1Q0WB 2IYDB 4II2B 1FXTB 1ZXHA 1UELA 1FXAA 2BW2A 2IY0B 4DHZE 3A4SC 1WJUA 2MA9B 4DXAB 4FJYA 3VXWA 1H8CA 1E8ZA 1T0YA 3SD5A 1JMLA 3ABVB 1WH3A 1NI2A 4KX6B 4YTNB 3UINB 4AP4C 2FCSA 4GDKA 1V2YA 2KFJA 3B2FA 3Q3MC 4ANWA 4WIPA 1HZ5A 2V3PA 1NYRA 2C9WB 2JX5A 3LYYA 3SR6A 2ZW1A 4RNAA 3U2SC 1L6UA 3WALA 1P98A 5EE0A 4WQOB 1MPEA 2DLBA 1FM0D 3BVMA 2JZPA 3AN1A 4IWQA 2JQRB 3NVWA 4MELA 2C5LC 4LK0M 2QILA 1C3TA 2D3CA 3HM6X 1C4CA 1D5MC 5AZGA 2CKHB 3IT4B 1SF0A 2O2VA 3ZNHB 4JWSC 2QJLA 1XLPA 2GBJA 2IO0B 2GBMA 1WM2A 1I35A 1TKEA 3B0AA 4OVUA 2X38A 1KLVA 4AQ7A 3Q69A 4C7YA 1D6EC 2AYOB 1V1PB 3A9KA 3ZXRA 2DZJA 2KX3A 3OG5A 2I38A 4MSQB 3N32A 4HVBA 4IDIA 1E10A 1N6ZA 1JCKB 4NJCA 1D4BA 2FAZA 1XLOA 1EU3A 2AQ1B 3BYTB 1JRPA 3S2AA 3QA8A 1ROEA 3KQ4A 3DBRI 4II3B 2RDHA 3H7PB 3NS1A 2OOBB 2MBEA 2ZEQA 4W9KA 1V9JA 2TSSA 1TY0A 1OTRB 1QZEA 3AEAB 3DHHC 1R7SA 1VZ6A 2J42A 3P1MA 1XT9B 4YXDB 4NAWB 5D94A 4OZBA 3TCAA 1YN5A 1FNWA 3KWVA 1QOBA 2RSUA 5I4DA 4W9FA 1YMHE 4IM2A 3H1UA 1MJDA 4HJGE 1C9FA 2NBWB 1TYGB 4PYZA 2FCNA 2HJ1A 1FFVA 2PTLA 4FHJA 1T0SC 3IG3A 2K25A 3AEBB 2OJRA 4HKZE 4L1BA 3GE3C 2K9XA 2ZVNA 2IY1B 4JGHB 2FIFA 2CU3A 3VRBB 2NBUA 2WLBA 2FBWB 4OZAA 4B6WA 1UZXB 1SJHD 1L0VB 5LXIB 3JVZX 1P0RA 5D7GA 4PS3A 3UIPB 2KTRB 2FCQA 2RDGA 2DAFA 3BZDB 4MGKE 1UGJA 5G5GA 1J19A 5CHWA 4DWFA 1IGDA 1C79A 2MLBA 1RLFA 3Q8BA 1RM6C 3MFGA 5DPWA 4KV2A 2DYOA 3MTNB 1E8XA 3RT3B 2IO2B 1E9MA 3MC0B 4HEA1 2OJWA 1SIFA 3ZJTA 4NNJB 3PTFC 1YQBA 5CTRC 3TEYA 2PKOA 1GG3A 2KLCA 1CK1A 1R4MB 3ZGZA 4GXBA 1TZOA 2BYTA 5HHDG 2L0TA 4XYCA 1AWDA 1TJEA 4KGTA 4DDGD 1XCTL 2BB5A 2KD0A 3L17A 3VHTC 2KNBA 3PGEA 4FADA 2WXQA 3KW5B 1YJ1A 4W9CA 4M01A 2MCNB 1T5XD 2QIEB 1PQSA 2BYFA 1U4AA 1ENFA 4S17A 2BS4B 2YEPB 3BYYB 3EECA 1T6BX 3B1LX 5J17A 1HTOA 5FKAC 1AYFA 5JZEB 1FMAD 1PYWD 2L00B 3AMZA 4MH8A 3E56A 4N9F4 4IM0A 2N4FA 3A9JB 2WYQA 3KUZA 3OWEB 4XX5A 3VR9B 1F77A 1E6EB 4A9AA 2NBVB 4ITKA 3ZYYX 2QEJC 1XXGA 2YLMA 1KJTA 1BUIC 4BBNC 2FIDA 4K3CA 2K8BA 1F52A 5BMGA 5E6OA 3KVFB 3OJ3A 2WHIA 3GOEA 4BKSA 1WSPA 2DNFA 1WX9A 2KHWB 3R3MA 3H8HA 1FPYA 1NYQA 3AI5A 4KZCA 3TMPB 1WXMA 3U8ZA 3RYTA 3KLSX 4EFOA 2M0XA 4GN1A 3N1YC 1Y56A 3IAS1 1V1OA 2KOXA 3T8MA 1HE8A 2UYZB 3BVGA 2SAKA 2SEBD 2HD5B 2KC1A 4IUMB 1DGJA 1WR1A 3L13A 4GIVA 1XO3A 2ZPYA 4NY0A 2XK5B 3VTUA 3PO0A 2UWQA 1QILA 4MM3B 1JROA 2L05A 2WDVB 1OQQA 4A55A 4YWGG 4MJSB 1E8WA 5E6NA 1YX5B 2PPHA 3OJ4B 2PJHA 4E3CA 1QKZA 1NBFC 2FUHB 3NVZA 3RNFC 3QIJA 4PS8A 4XC2A 3GS2A 2GOWA 1UH6A 4HDQA 2JUOA 3V60A 4J6IA 3DHIC 3AE1B 1WZ3A 3N9YC 2JWUA 2ONQA 2MJDA 1GPXA 2CHZA 2K8HA 5IOIA 1FCLA 1N60A 2LGIA 4FBJB 3EHVA 1WRIA 4G50A 1NVID 3ZRCA 2N9KA 4BZAA 3PRMB 4KSLC 4K81A 4EE2A 1WMHA 2JU6X 1C1YB 1YJIA 3EFCA 4RFBA 2GBKA 4KSKC 4TV3A 5D3IB 3IAM1 2GMIC 2N7JA 2ZCCA 4FULA 3SHQA 2O6VD 4A3PA 4RGTA 3O13A 3KWLA 2HTHA 2K6DB 4TMAB 2DENB 1SEBD 3H7SA 1RRBA 2KFKA 2IZVB 4YSYB 1WJNA 2DZIA 1H4RA 2LD9A 4AUQC 1WXAA 4TSSA 1XLQA 2KWDA 3A33B 3KUCB 3APFA 3I5JC 1V80A 2LXCA 2MH7A 3U7DA 2NPTB 4CHKA 1SJED 2JVCA 2JYEA 5DPRA 1NDDA 1WJ4A 3RD2A 3CSTA 5HFYA 5BYQA 4HPPA 3BINA 4O1NA 1HEZE 1OEYA 4UDUC 2J52A 3FILB 1AN8A 2JRHA 3ZDMC 5FR3A 1OGWA 2KWCA 3EUB2 4ZYSA 2JXTA 4PS7A 1AW7A 1P7EA 4GDLA 4HPLB 1JWBD 5IA7A 3MHSD 4MACA 3A4RA 3AE4B 4KGRA 3W5UB 1K52A 5EE1A 1GC6A 1JWSD 1TKGA 1OEYJ 3CSFA 3VUXA 1G6JA 1Q1OA 3P4SB 4JE3B 2HTME 2MQJA 3AE6B 3KUDB 2GLSA 1P9DU 3DWMA 4KDIC 1WIAA 2RR9A 3D32A 4JX1C 4C4VA 1SIJA 3KYCD 3URYA 5L95C 3AU5A 2WX0A 1STEA 3QK0A 2WWZA 1IPGA 3TJPA 1GB4A 1MFWA 4BOSC 1PFDA 3AULA 2DYBA 2MRPA 1QQRA 2LFIA 1E90A 2QHOA 3ONSA 2WXIA 4US8A 4IWPA 2BKRB 2KJ6A 1JW9D 1L0XB 2DWQA 2K5PA 2MW5A 1UWXA 3T3NA 2KKCA 5G2NA 1NI3A 2N7EA 2WS3B 3Q8EA 4WJOA 3AU4A 3LXFA 2J4XA 2GRIA 2KWUB 4W9HA 5LNK1 2CU1A 5JXVA 4N6EB 2R2OA 4MGIE 3L10B 3AV8A 3A1QA 2ZW0A 1PGBA 3VFKA 1QOFA 1IBXA 4LCDE 4DBGA 4A6QA 4GDKB 2G3QB 4HROA 2JZ3B 2K22A 2M19A 2KDMA 1E7UA 1YOVB 4YL8A 1KOTA 5GMVA 2L1AA 3APCA 3GP7A 1SBBB 2AL3A 3DQVA 2I1JA 4YSZB 4OVZA 2BTEA 3NG0A 3HVDA 2AL6A 1WXVA 1MG4A 2WXKA 1TZ1A 2KWVB 1AARA 3PS6A 2Y3AA 2M4NA 4MGYE 3BVZA 4P1CC 1KFYB 1KLUD 3AE9B 1UD7A 4K1RB 4LNOA 3UQAA 2O2VB 3JSVB 4GOCA 1Q10A 4DHJD 1A5RA 3Q8FA 1MHXA 4EZLA 4RH6A 1ZP0B 2G4SA 4IWOA 1RYJA 5IO9A 4MGZE 1V97A 3V05A 1J7BA 3A9KB 3V6CB 1ZXIA 3KH0A 3M63B 3ML9A 4EKUA 4AWJA 3NZ3A 4F8CB 1N5WA 2WP9B 1IUEA 2WXNA 4K3BA 1HXYD 4LNKA 1ZE3D 4HKQA 4CO7A 1YN3A 2MHJA 2D3AA 4W9LA 2BGFA 3AE3B 3ZJUA 3U4EG 3NUHB 3DHGC 4WAFA 3PLVA 3WAPA 2QC8A 3L54A 2GBRA 3O65B 4N59A 1V1PA 2KDIA 2D3BA 4KVGB 4ZRIA 1QOAA 1YQ3B 4NQKE 5CHFA 1ZPSA 2FCMA 2BBCA 4RCOA 3N30A 2IJ0A 1LO5D 1YD8U 1EF1A 2LJ5A 3ZVVA 4MDKE 5KHQA 2KAJA 3ZO5B 2KMCA 5JHAA 1M94A 2ON8A 2R2QA 2AQ3B 5LLIA 3H7PA 3NOBA 2WXGA 4ANXA 3DBHB 1TTNA 3R66C 1F2RI 4I6NB 4URKA 3UGBB 4NAMA 3ZLZA 3EC8A 2CJOA 1FIQA 3FC4A 3IBEA 2LVPA 4HLEA 2MJEA 2MP2A 2FNJB 2KANA 3NRZA 2LZ6A 3DWGC 3K9PB 4I6PA 3IT6B 4JWUC 4PT5A 5HI1A 4NAWA 3HVZA 3ZKJC 5JHBA 4B95A 2PLPA 2L7RA 1LFDA 1GC7A 1EUVB 1FCCC 2LVOA 4WJNA 1CJEA 4RF1A 2KDEB 1PDXA 2MBOA 1L0YB 2WDQB 2I1KA 2AEHA 3SDLC 3C19A 3RMKC 3HUIA 2WXMA 4X57B 4RF0A 4RGNA 1SGHA 3WCQA 2DX5B 3PV1A 3U7ZA 3Q8AA 2K1FA 2WDRB 2KVRA 2L83A 3H9DA 1TGZB 2G4DB 4ZRQA 1J8CA 3EFUA 1ZW7A 3Q6BA 2LUMA 1WGGA 3PZ7A 2M1MA 2A4ZA 5C2TB 4PYUA 1I4HA 3R2IA 4WWPA 1LXDA 2LVQA 4P7IA 4AOFA 3NJTA 3ZRFA 3VUWA 2KTRA 3DCGA 3AXCA 2JYTA 4NJ7A 4LDTD 1OQRA 4HCNB 3QARA 4ZHOA 4HRSA 1WJ6A 2W82A 4TQ1A 2W3RA 4LNIA 4LDTB 3DVGY 1DOXA 5DPSA 4P1BC 3TSSA 2AX5A 2WQYB 4LNFA 2AWTA 2V9HA 4C80A 4FLHA 3NVYA 1ACCA 2RPQA 4A90A 4H2AA 5LXHA 3RPFC 2HJ8A 2CS4A 2ZNVB 4K7SA 2LHEA 3P4PB 1D5ZC 2QDFA 1VLBA 4BVUC 1S1QB 1VCBA 4KIKB 3I3TB 3P4QB 1WGDA 1CQVA 3DBSA 3RNBC 1JRUA 2KQSA 4Q2JA 2MBQA 4XDDA 1SXTA 3Q2AC 4B0EA 2ZNVC 2LI5A 3TBLD 3SU8X 3VVWB 1IGCA 1QOGA 4ARIA 1UWMA 1D5XC 1FXIA 1OQYA 5AZHA 3CIRB 3R8BA 4E74A 1WGYA 2C7NB 1DYQA 3DDCB 1ZDVA 1JQ4A 2I2YA 3W1SA 3EA6A 2MJ3A 2M0AA 5D3DA 4ICUA 4DK5A 4BKSD 1SE4A 3V61A 3SFDB 2KLGA 1V8CA 2LRWA 5IKCM 1UUPA 5DCNA 3BWUD 1QT9A 4IC7B 3DBLI 2W55A 1CZPA 1I4XA 4RGMA 3RNEC 2KN5A 3TEXA 3A9JA 2D5GA 2RDBC 3QHTA 3Q8CA 4ZOHC 1HQRD 2ZJDA 1L5PA 2IO1B 3RN9C 1YX6B 3IXSA 4XWWA 2J7QB 1ZUD2 4TUUA 3GB1A 4ZRKA 3V62A 1WGKA 3HRDD 4ASWC 4EZKA 4CYEA 4OHJA 1FEHA 1GB1A 2N9XA 3T9LA 4BOZB 1KM7A 1WY8A 4W9EA 2GB1A 2L76A 1P3QU 3MJWA 3APDA 4RMAA 3PPAA 3ZDTA 4WJPA 4LJOB 3LB8C 1LM8B 2K39A 4J3OD 3Q3FA 2KN4A 2VH1A 2INDC 1X1MA 2EMSA 2UU7A 3PHXB 2Z8LA 4HJKA 2XK5A 4ICVA 3TL5A 1VRAB 5C3JB 2MBHA 4XWTA 5AEKB 4MH0E 3ENEA 4LJPB 4MM3A 4LLGM 2BF8B 5MPOA 1N61A 3N1XC 1L6VA 1TIFA 3AM9A 4MJSA 3LDZE 1WI0A 2ZPNA 3IVFA 2LRUA 4JL9A 3AEDB 4IOIE 4IKGA 2LASA 1J7AA 1Q5WB 2RD0A 2BB6A 1WR6E 3B08A 1WRDB 4DQOC 2KJRA 4LTUA 1ZGUB 1IYFA 3GE8C 3I9V1 4IG7B 3GZNI 1I7HA 1SE3A 1KTKA 3NY5A 3ZTDA 3BK2A 2IGGA 2G45B 1C77A 3RI7C 1S3SG 2LHDA 3HK0A 1K53A 2L8JA 2CHXA 3MHZA 1VDVA 1JALA 2R61A 3MC8A 1TS3A 3W1YA 3AECB 1YN4A 1T0QC 2MBBB 2KK8A 1CMXB 1VJKA 4G3XB 1F1HA 2O6VB 4YTPB 2N9LA 1F0ZA 2WX1A 3RNAC 4ARCA 4G0NB 1TT5B 3ZNZB 3RZWC 2DBYA 5H8YE 4G11A 3DVNU 3WAMA 1M4VA 4ANUA 2JSVX 1GUAB 1WE7A 2K3UA 3UQBA 1WZ0A 1WGHA 2WU5B 4WQMA 2XBBC 2JF5A 1YNTE 1C4AA 1L4DB 2PE6B 1R4NB 3HIZA 1SB3C 3WAOA 4WAAA 4MSMB 2NPTA 3UI3A 4L23A 4B9KA 1I4RA 3NZSA 1L4ZB 3V3XA 1V6EA 1UNSA 3ZNGC 1QF6A 3QAQA 2LEKA 1NENB 2BS3B 5E6JA 3CMMB 1ET9A 1GNUA 1WGRA 5L83A 4FXCA 1SE9A 3RZFA 1FD6A 3ZUNA 1HZ6A 2KX0A 1UGMA 1N62A 4XGAB 2NS5A 2GI9A 5BO4B 4C4VB 4C7ZA 1PGAA 2D2QA 4OVVA 3RNGC 5D6JB 4WWMA 3I63C 2INPE 4MT5A 5C1ZA 1K8RB 1JWUD 5BYSA 1PUTA 2WXHA 2N9PC 4FJVB 3NVVA 3MC9A 2N9EB 1LGRA 2LUEA 2W9NA 2BPSA 3ALBA 3NS8A 2VZKD 1MI0A 1KH0A 2D07B 1FNVA 4R3DA 2Y5CA 2L52A 1FFUA 2EELA 3QJZA 1T0RC 1C4PA 2PE9A 2PMVA 1WXQA 3U30A 1FO4A 4M0WA 1I4GA 3L16A 1E5WA 4EZJA 4GB9A 4B0MA 2QCZA 5FR6A 4A20A 3I57A 5G5HA 3QQ8B 3ZJVA 4I6LB 1ZKHA 4GMVA 4KKJA 3VAWA 2FE8A 4ZRPA 4JIOU 2LGSA 4EEWA 3DPDA 2BQQA 2KO3A 4XDCA 5T8IA 1ESFA 2HDEA 2FUG1 4ZDVA 3B9JA 3UF8A 3AE2B 4C56C 4XE0A 4RM9A 2INCC 4OW0A 3R7QA 3W5VB 1EM7A 2QMTA 2IBIB 4AJWA 2PVGC 1VR9A 2NCNA 2NTSA 5BYRA 2Q5WD 3SEBA 2W3SA 4C00A 4DXGA 4D2KA 3BIID 1E7VA 2YEPF 5HKHA 4BKTA 3MJ5A 2G1EA 2WXLA 3FAHA 4M8MA 2JRIB 3DBHI 2Z59B 4PK1A 2LGDA 3P63A 4W9DA 4BBNF 1C78A 4K7UA 3DVNV 4DDID 2KT7A 5TSSA 2RMMA 3MP9A 3AH7A 4GLSC 2PVOD 4KGSA 2X8XX 1VD2A 1WM3A 1EO6A 1XLNA 2C7HA 2KDBA 3VUYA 2NR2A 3L0WB 3PVLA 2MWSB 4DHJB 1L2NA 2CHWA 5JH5C 3ECIA 2V4IB 3JSVA 5DPTA 2ZVOA 1WE6A 2D3GA 2J0JA 3R2TA 4JPSA 2KVZA 1YIWA 2WXOA 4P6VF 1MVKA 2N1WA 1VZ7A 4NQLB 1WX8A 4MEMA 2HE7A 3TIXA 2JXXA 4US9A 3ZNID 3QX1A 2PW9A 5E6PA 2ASQA 4DXFA 2NMQA 4HXDA
chains in the Genus database with same CATH topology
2JZZA 3X0WA 3DBSA 3PRMB 2BWES 1JRUA 4K81A 4KSLC 2GBNA 2KQSA 1WMHA 2JPHA 1C1YB 3PRPB 4BKGA 2MBQA 3PRZA 2GBKA 1EF5A 3IFWB 2ZNVC 3A1QB 2LI5A 3KYDD 4K7WA 4KSKC 4W9GA 3SU8X 1E8YA 1V5OA 3TBLD 4TV3A 3VVWB 5EDSA 1XD3B 4A3OA 2KMAA 1TBEA 2LGYA 5TR5A 1XQQA 2GMIC 3L08A 2ZCCA 1OQYA 5AZHA 2C60A 2V3SA 4FULA 4HWIB 4E74A 1WGYA 3RULA 3SHQA 2C7NB 4IM3A 2O6VD 3ML8A 3DDCB 4A3PA 1V49A 1Q0WB 2MP2B 1R4MI 2IYDB 4II2B 2HTHA 3W1SA 1FXTB 3WANA 2K6DB 1UELA 2DENB 2IY0B 4ICUA 4DHZE 3A4SC 1WJUA 4DK5A 2KZRA 1UBIA 2MA9B 4DXAB 4FJYA 3VXWA 3H7SA 1RRBA 3NHEB 4BKSD 2KFKA 1E8ZA 3V61A 2KQ7A 2IZVB 1H8CA 2KLGA 1T0YA 3SD5A 1WX7A 2LRWA 1WJNA 1V5TA 1WH3A 2DZIA 1H4RA 2LD9A 5DCNA 4IC7B 4AUQC 1WXAA 1NI2A 3DBLI 3A33B 3UINB 3KUCB 4AP4C 2FCSA 3APFA 4GDKA 1V2YA 2KFJA 2V1YA 2KN5A 3A9JA 4HXDA 3QHTA 1V80A 2LXCA 4ANWA 3U7DA 2KTFA 2DZMA 2NPTB 4CHKA 4F7ZA 1V81A 2ZJDA 2JVCA 5DPRA 2C9WB 1NDDA 2IO1B 3V6EB 1WJ4A 3RD2A 1YX6B 3WALA 3CSTA 5CX3A 1P98A 4TKNA 3BINA 2M8SA 2J7QB 3OLMD 2VRRB 4TUUA 1OEYA 4WQOB 1LQBA 1MG8A 4ZRKA 3QCAA 3V62A 2JRHA 2DYMA 5D2MB 2KC2A 2KXJA 3ZDMC 4IWQA 1OGWA 2KWCA 4ASWC 4MELA 2C5LC 4EZKA 4PS7A 4CYEA 4GDLA 4HPLB 5KHOA 1C3TA 3HM6X 5G55A 5IA7A 3MHSD 2DAJA 2N9XA 3A4RA 3T9LA 4BOZB 1KM7A 1GC6A 5AZFA 4W9IA 1WY8A 5AZGA 4W9EA 2CKHB 1P3QU 2L76A 3APDA 3MJWA 3M62B 4RMAA 3PPAA 1OEYJ 2N1VA 4WJQA 2O2VA 3ZDTA 3ZNHB 4WJPA 4DHZB 4ZRJA 4LJOB 3CSFA 1LM8B 2K39A 4XZ4A 2GBJA 2IO0B 4FHKA 1Q1OA 2GBMA 3VUXA 1G6JA 1WM2A 2KDFB 2D10A 3Q3FA 1I35A 4NPNA 3B0AA 4OVUA 1X1MA 1KLVA 2EMSA 2MQJA 3KUDB 3PHXB 4HJKA 2XK5A 4ICVA 1P9DU 3JYUA 3TL5A 2MBHA 2AYOB 5AEKB 4MH0E 3A9KA 2DZJA 3ENEA 4KDIC 4LJPB 2KX3A 1WIAA 4MM3A 1Y8RC 2BF8B 3HM3A 3K9OB 2RR9A 4MSQB 3N32A 3D32A 4HVBA 3KYCD 5L95C 4MJSA 3LDZE 1WI0A 2ZPNA 3AU5A 3IVFA 2LRUA 2WX0A 3QK0A 1J0GA 2WWZA 1IPGA 2FAZA 3TJPA 4JL9A 2LASA 4BOSC 1Q5WB 2RD0A 3VTVA 3S2AA 5C23A 1WR6E 2DYBA 2MRPA 3AULA 3B08A 1WRDB 3QA8A 1E90A 2EMTA 2KJRA 3DBRI 4II3B 1ZGUB 2QHOA 3ONSA 1IYFA 2PEAA 4IG7B 3GZNI 3H7PB 4IWPA 2BKRB 2KJ6A 3NY5A 3ZTDA 2OOBB 2MBEA 4FA6A 2MW5A 2BYEA 3VDZA 2G45B 2ZEQA 2KKCA 4W9KA 1S3SG 1V9JA 5G2NA 4GSWA 2N7EA 1D3ZA 3HK0A 2DHZA 4WJOA 3AU4A 2L8JA 1OTRB 1QZEA 4KIKA 2CHXA 2KWUB 3VTWA 4W9HA 2CU1A 1XT9B 4NAWB 2R2OA 5D94A 3TCAA 4MGIE 4FJZA 3W1YA 3L10B 3PZDA 2MBBB 2KK8A 1CMXB 3A1QA 4G3XB 2O6VB 3VFKA 2LWPA 2WX1A 4LCDE 2IO3B 3QWZB 3ZIMA 3PLUA 2RSUA 4G0NB 4DBGA 3PHWB 4W9FA 4GDKB 3W1SC 4IM2A 1ISNA 3ZNZB 2G3QB 3RZWC 3H1UA 3HHMA 2JZ3B 1E7UA 4G11A 3DVNU 4EUTA 1GJZA 4HDOA 3WAMA 4ANUA 2NBWB 4PYZA 1GUAB 1BT0A 4JLCA 4YL8A 1KOTA 5GMVA 2FCNA 3APCA 1WE7A 3JW0X 2AL3A 3DQVA 2I1JA 4FHJA 4RM8A 3UQBA 3IG3A 1WZ0A 2K25A 2BKFA 1WGHA 2Z0EB 4ANVA 2AL6A 2OJRA 2XBBC 2JF5A 1WXVA 2ZVNA 2IY1B 4JGHB 1TZ1A 2PE6B 2KWVB 1AARA 2FIFA 3PS6A 3HIZA 2M4NA 4MGYE 3WAOA 2NBUA 4WAAA 1RAXA 4MSMB 2NPTA 4B6WA 2Y5BB 1UD7A 1UZXB 2ZZPB 5IAAC 4B9KA 4K1RB 3UIOB 3NZSA 5LXIB 3JVZX 3ZW3A 1F9JA 1P0RA 5D7GA 1V6EA 4PS3A 3UIPB 3UQAA 2O2VB 2KTRB 3JSVB 3X23A 3ZNGC 3QAQA 2FCQA 4GOCA 2DAFA 4DHJD 1A5RA 3PT2B 4MGKE 3CMMB 1J19A 5CHWA 4EOYA 4EZLA 4DWFA 4NJ6A 2MLBA 1GNUA 4BFRA 1WGRA 5L83A 2LGXA 1RLFA 2G4SA 4IWOA 1SE9A 4MGZE 5DPWA 4KV2A 2DYOA 3A9KB 2XEWA 3RZFA 3V6CB 3M63B 3KH0A 4WWOA 3ZUNA 2KX0A 3ML9A 4EKUA 1UGMA 3MTNB 4AWJA 4F8CB 2NS5A 5BO4B 2REXA 4GU2A 1E8XA 3RT3B 2D2QA 2JT4B 2IO2B 2LXAA 4OVVA 2V4LA 1R4NI 4CO7A 3P2BA 4HK2A 5D6JB 4FN2A 2L0FA 2EKEC 1SIFA 4W9LA 2BGFA 4NNJB 5C1ZA 1K8RB 3PTFC 1Z2MA 1YQBA 4F1SA 5CTRC 4GGQA 2N9PC 3PLVA 4FJVB 1GG3A 2KLCA 2N9EB 3WAPA 2LUEA 3L54A 2GBRA 4HCPB 3O65B 2W9NA 4AJYB 1WMHB 2BPSA 4GXBA 3N3KB 3ALBA 2KDIA 1P1AA 2L0TA 3NS8A 4KVGB 4ZRIA 2B3AA 4NQKE 4HPMB 2D07B 4DDGD 5CHFA 2KD0A 2FCMA 3L17A 3VHTC 2KNBA 3PGEA 4FADA 3KW5B 3N30A 1YJ1A 4W9CA 3QJZA 2Z0DB 2PE9A 1YD8U 1EF1A 2LJ5A 2MCNB 3U30A 3ZVVA 1UBQA 4MDKE 3ZRCA 1PQSA 2BYFA 3VH4B 5KHQA 3L16A 1U4AA 3ZO5B 1E5WA 2KMCA 5JHAA 1M94A 2R2QA 4EZJA 4GB9A 2WDTB 4KZ0A 3EECA 5LLIA 3H7PA 3NOBA 5FR6A 1WF9A 4A20A 2KFKB 3B1LX 3QQ8B 4ANXA 5J17A 2MSED 1ZKHA 4GMVA 4I6LB 1TTNA 3R66C 1I42A 3IHPC 4I6NB 3VAWA 1RFAA 3WA0A 4JIOU 4EEWA 3DPDA 4URKA 3UGBB 5JZEB 3OAWA 3R7RA 3ZLZA 3EC8A 1L7YA 2L00B 2KO3A 3IBEA 4N9F4 4ZDVA 3QC8B 2LVPA 4IM0A 5CHVC 3UF8A 2N4FA 3A9JB 4HLEA 2WYQA 3KUZA 2N7DA 3VQIA 2MP2A 4XX5A 4TQ0A 2FNJB 3CF6E 4RM9A 3Q3JA 2KANA 2LZ6A 3K9PB 4I6PA 3R7QA 2NBVB 4NAWA 3ZKJC 2IBIB 4JQWC 5JHBA 4AJWA 4B95A 2L7RA 2M17A 1LFDA 1GC7A 1EUVB 2BYVE 2NCNA 2NVUI 2YVCA 2O6VA 4WWNA 3NZUA 2LVOA 4WJNA 2YLMA 3BY4B 2KDEB 1KJTA 2C7MB 4BBNC 3M3JA 2FIDA 2K8BA 3ZTCA 2MBOA 4IW0A 5E6OA 3KVFB 1E7VA 2I1KA 3OJ3A 2AEHA 3GOEA 5HKHA 3DOWA 2L3ZA 3SDLC 4BKSA 4GDLB 4X57B 1WX9A 4BKTA 5J2RA 2KHWB 1SGHA 3R3MA 3VH3B 2DX5B 3PV1A 2K1FA 3WIMA 3LJ3A 1WYWB 2KVRA 4M8MA 2JRIB 3AI5A 3DBHI 2Z59B 4KZCA 3TMPB 1WXMA 2LGDA 3H9DA 3U8ZA 2J0KA 4W9DA 4BBNF 3RYTA 2JY6A 4K7UA 1TGZB 3DVNV 3PSEB 4EFOA 2G4DB 2M0XA 4DDID 3C0RB 4GN1A 1J8CA 4ZYNA 3EFUA 1ZW7A 2MX2A 2ZCBA 4KDLB 2KOXA 3T8MA 3H6NA 1HE8A 1WXSA 2UYZB 1WGGA 1VD2A 2M1MA 4W9JA 1WM3A 1EO6A 2A4ZA 3RCZA 2C7HA 2KC1A 2KDBA 3VUYA 2NR2A 4IUMB 4PYUA 1WR1A 4GIVA 3L13A 4NY0A 2ZPYA 3L0WB 2CR5A 2XK5B 2J0MA 4WWPA 1LXDA 2LVQA 2JWZA 2MWSB 3PVLA 3VTUA 4P7IA 4AOFA 4DHJB 1L2NA 2UWQA 2CHWA 5JH5C 2RGFA 2L05A 3ECIA 3ZRFA 3RUIB 3M95A 3VUWA 2KTRA 3JSVA 5DPTA 3DCGA 3AXCA 2ZVOA 4NJ7A 1WFYA 4MJSB 4LDTD 2K6QA 1Z5SB 1E8WA 5E6NA 1YX5B 2PPHA 1WE6A 3OJ4B 5J18A 2PJHA 4E3CA 2BWFA 2D3GA 1NBFC 2J0JA 4HCNB 3QARA 2FUHB 3DVGX 3QIJA 2D11A 1WJ6A 4PS8A 4XC2A 2K8CA 2GOWA 4TQ1A 1UH6A 1YIWA 4HDQA 2JUOA 4LDTB 3DVGY 2DZKA 5DPSA 2N1WA 4NQLB 4E71A 2AWTA 3V60A 1WX8A 4J6IA 4FLHA 4MEMA 3PREA 2HE7A 1IP9A 2RPQA 1WZ3A 5LXHA 2HJ8A 2A5UA 2CS4A 3TIXA 1V86A 2ZNVB 4K7SA 2JXXA 3ZNID 2CHZA 3QX1A 2K8HA 5E6PA 2ASQA 4FBJB 3EHVA 4M8NA 2KJHB 4M0WB 4BVUC 1S1QB 1VCBA 4G50A 4KIKB 3I3TB 1WGDA 2HD5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZZ A;  3X0W A;  3DBS A;  3PRM B;  2BWE S;  1JRU A;  4K81 A;  4KSL C;  2GBN A;  2KQS A;  1WMH A;  2JPH A;  1C1Y B;  3PRP B;  4BKG A;  2MBQ A;  3PRZ A;  2GBK A;  1EF5 A;  3IFW B;  2ZNV C;  3A1Q B;  2LI5 A;  3KYD D;  4K7W A;  4KSK C;  4W9G A;  3SU8 X;  1E8Y A;  1V5O A;  3TBL D;  4TV3 A;  3VVW B;  5EDS A;  1XD3 B;  4A3O A;  2KMA A;  1TBE A;  2LGY A;  5TR5 A;  1XQQ A;  2GMI C;  3L08 A;  2ZCC A;  1OQY A;  5AZH A;  2C60 A;  2V3S A;  4FUL A;  4HWI B;  4E74 A;  1WGY A;  3RUL A;  3SHQ A;  2C7N B;  4IM3 A;  2O6V D;  3ML8 A;  3DDC B;  4A3P A;  1V49 A;  1Q0W B;  2MP2 B;  1R4M I;  2IYD B;  4II2 B;  2HTH A;  3W1S A;  1FXT B;  3WAN A;  2K6D B;  1UEL A;  2DEN B;  2IY0 B;  4ICU A;  4DHZ E;  3A4S C;  1WJU A;  4DK5 A;  2KZR A;  1UBI A;  2MA9 B;  4DXA B;  4FJY A;  3VXW A;  3H7S A;  1RRB A;  3NHE B;  4BKS D;  2KFK A;  1E8Z A;  3V61 A;  2KQ7 A;  2IZV B;  1H8C A;  2KLG A;  1T0Y A;  3SD5 A;  1WX7 A;  2LRW A;  1WJN A;  1V5T A;  1WH3 A;  2DZI A;  1H4R A;  2LD9 A;  5DCN A;  4IC7 B;  4AUQ C;  1WXA A;  1NI2 A;  3DBL I;  3A33 B;  3UIN B;  3KUC B;  4AP4 C;  2FCS A;  3APF A;  4GDK A;  1V2Y A;  2KFJ A;  2V1Y A;  2KN5 A;  3A9J A;  4HXD A;  3QHT A;  1V80 A;  2LXC A;  4ANW A;  3U7D A;  2KTF A;  2DZM A;  2NPT B;  4CHK A;  4F7Z A;  1V81 A;  2ZJD A;  2JVC A;  5DPR A;  2C9W B;  1NDD A;  2IO1 B;  3V6E B;  1WJ4 A;  3RD2 A;  1YX6 B;  3WAL A;  3CST A;  5CX3 A;  1P98 A;  4TKN A;  3BIN A;  2M8S A;  2J7Q B;  3OLM D;  2VRR B;  4TUU A;  1OEY A;  4WQO B;  1LQB A;  1MG8 A;  4ZRK A;  3QCA A;  3V62 A;  2JRH A;  2DYM A;  5D2M B;  2KC2 A;  2KXJ A;  3ZDM C;  4IWQ A;  1OGW A;  2KWC A;  4ASW C;  4MEL A;  2C5L C;  4EZK A;  4PS7 A;  4CYE A;  4GDL A;  4HPL B;  5KHO A;  1C3T A;  3HM6 X;  5G55 A;  5IA7 A;  3MHS D;  2DAJ A;  2N9X A;  3A4R A;  3T9L A;  4BOZ B;  1KM7 A;  1GC6 A;  5AZF A;  4W9I A;  1WY8 A;  5AZG A;  4W9E A;  2CKH B;  1P3Q U;  2L76 A;  3APD A;  3MJW A;  3M62 B;  4RMA A;  3PPA A;  1OEY J;  2N1V A;  4WJQ A;  2O2V A;  3ZDT A;  3ZNH B;  4WJP A;  4DHZ B;  4ZRJ A;  4LJO B;  3CSF A;  1LM8 B;  2K39 A;  4XZ4 A;  2GBJ A;  2IO0 B;  4FHK A;  1Q1O A;  2GBM A;  3VUX A;  1G6J A;  1WM2 A;  2KDF B;  2D10 A;  3Q3F A;  1I35 A;  4NPN A;  3B0A A;  4OVU A;  1X1M A;  1KLV A;  2EMS A;  2MQJ A;  3KUD B;  3PHX B;  4HJK A;  2XK5 A;  4ICV A;  1P9D U;  3JYU A;  3TL5 A;  2MBH A;  2AYO B;  5AEK B;  4MH0 E;  3A9K A;  2DZJ A;  3ENE A;  4KDI C;  4LJP B;  2KX3 A;  1WIA A;  4MM3 A;  1Y8R C;  2BF8 B;  3HM3 A;  3K9O B;  2RR9 A;  4MSQ B;  3N32 A;  3D32 A;  4HVB A;  3KYC D;  5L95 C;  4MJS A;  3LDZ E;  1WI0 A;  2ZPN A;  3AU5 A;  3IVF A;  2LRU A;  2WX0 A;  3QK0 A;  1J0G A;  2WWZ A;  1IPG A;  2FAZ A;  3TJP A;  4JL9 A;  2LAS A;  4BOS C;  1Q5W B;  2RD0 A;  3VTV A;  3S2A A;  5C23 A;  1WR6 E;  2DYB A;  2MRP A;  3AUL A;  3B08 A;  1WRD B;  3QA8 A;  1E90 A;  2EMT A;  2KJR A;  3DBR I;  4II3 B;  1ZGU B;  2QHO A;  3ONS A;  1IYF A;  2PEA A;  4IG7 B;  3GZN I;  3H7P B;  4IWP A;  2BKR B;  2KJ6 A;  3NY5 A;  3ZTD A;  2OOB B;  2MBE A;  4FA6 A;  2MW5 A;  2BYE A;  3VDZ A;  2G45 B;  2ZEQ A;  2KKC A;  4W9K A;  1S3S G;  1V9J A;  5G2N A;  4GSW A;  2N7E A;  1D3Z A;  3HK0 A;  2DHZ A;  4WJO A;  3AU4 A;  2L8J A;  1OTR B;  1QZE A;  4KIK A;  2CHX A;  2KWU B;  3VTW A;  4W9H A;  2CU1 A;  1XT9 B;  4NAW B;  2R2O A;  5D94 A;  3TCA A;  4MGI E;  4FJZ A;  3W1Y A;  3L10 B;  3PZD A;  2MBB B;  2KK8 A;  1CMX B;  3A1Q A;  4G3X B;  2O6V B;  3VFK A;  2LWP A;  2WX1 A;  4LCD E;  2IO3 B;  3QWZ B;  3ZIM A;  3PLU A;  2RSU A;  4G0N B;  4DBG A;  3PHW B;  4W9F A;  4GDK B;  3W1S C;  4IM2 A;  1ISN A;  3ZNZ B;  2G3Q B;  3RZW C;  3H1U A;  3HHM A;  2JZ3 B;  1E7U A;  4G11 A;  3DVN U;  4EUT A;  1GJZ A;  4HDO A;  3WAM A;  4ANU A;  2NBW B;  4PYZ A;  1GUA B;  1BT0 A;  4JLC A;  4YL8 A;  1KOT A;  5GMV A;  2FCN A;  3APC A;  1WE7 A;  3JW0 X;  2AL3 A;  3DQV A;  2I1J A;  4FHJ A;  4RM8 A;  3UQB A;  3IG3 A;  1WZ0 A;  2K25 A;  2BKF A;  1WGH A;  2Z0E B;  4ANV A;  2AL6 A;  2OJR A;  2XBB C;  2JF5 A;  1WXV A;  2ZVN A;  2IY1 B;  4JGH B;  1TZ1 A;  2PE6 B;  2KWV B;  1AAR A;  2FIF A;  3PS6 A;  3HIZ A;  2M4N A;  4MGY E;  3WAO A;  2NBU A;  4WAA A;  1RAX A;  4MSM B;  2NPT A;  4B6W A;  2Y5B B;  1UD7 A;  1UZX B;  2ZZP B;  5IAA C;  4B9K A;  4K1R B;  3UIO B;  3NZS A;  5LXI B;  3JVZ X;  3ZW3 A;  1F9J A;  1P0R A;  5D7G A;  1V6E A;  4PS3 A;  3UIP B;  3UQA A;  2O2V B;  2KTR B;  3JSV B;  3X23 A;  3ZNG C;  3QAQ A;  2FCQ A;  4GOC A;  2DAF A;  4DHJ D;  1A5R A;  3PT2 B;  4MGK E;  3CMM B;  1J19 A;  5CHW A;  4EOY A;  4EZL A;  4DWF A;  4NJ6 A;  2MLB A;  1GNU A;  4BFR A;  1WGR A;  5L83 A;  2LGX A;  1RLF A;  2G4S A;  4IWO A;  1SE9 A;  4MGZ E;  5DPW A;  4KV2 A;  2DYO A;  3A9K B;  2XEW A;  3RZF A;  3V6C B;  3M63 B;  3KH0 A;  4WWO A;  3ZUN A;  2KX0 A;  3ML9 A;  4EKU A;  1UGM A;  3MTN B;  4AWJ A;  4F8C B;  2NS5 A;  5BO4 B;  2REX A;  4GU2 A;  1E8X A;  3RT3 B;  2D2Q A;  2JT4 B;  2IO2 B;  2LXA A;  4OVV A;  2V4L A;  1R4N I;  4CO7 A;  3P2B A;  4HK2 A;  5D6J B;  4FN2 A;  2L0F A;  2EKE C;  1SIF A;  4W9L A;  2BGF A;  4NNJ B;  5C1Z A;  1K8R B;  3PTF C;  1Z2M A;  1YQB A;  4F1S A;  5CTR C;  4GGQ A;  2N9P C;  3PLV A;  4FJV B;  1GG3 A;  2KLC A;  2N9E B;  3WAP A;  2LUE A;  3L54 A;  2GBR A;  4HCP B;  3O65 B;  2W9N A;  4AJY B;  1WMH B;  2BPS A;  4GXB A;  3N3K B;  3ALB A;  2KDI A;  1P1A A;  2L0T A;  3NS8 A;  4KVG B;  4ZRI A;  2B3A A;  4NQK E;  4HPM B;  2D07 B;  4DDG D;  5CHF A;  2KD0 A;  2FCM A;  3L17 A;  3VHT C;  2KNB A;  3PGE A;  4FAD A;  3KW5 B;  3N30 A;  1YJ1 A;  4W9C A;  3QJZ A;  2Z0D B;  2PE9 A;  1YD8 U;  1EF1 A;  2LJ5 A;  2MCN B;  3U30 A;  3ZVV A;  1UBQ A;  4MDK E;  3ZRC A;  1PQS A;  2BYF A;  3VH4 B;  5KHQ A;  3L16 A;  1U4A A;  3ZO5 B;  1E5W A;  2KMC A;  5JHA A;  1M94 A;  2R2Q A;  4EZJ A;  4GB9 A;  2WDT B;  4KZ0 A;  3EEC A;  5LLI A;  3H7P A;  3NOB A;  5FR6 A;  1WF9 A;  4A20 A;  2KFK B;  3B1L X;  3QQ8 B;  4ANX A;  5J17 A;  2MSE D;  1ZKH A;  4GMV A;  4I6L B;  1TTN A;  3R66 C;  1I42 A;  3IHP C;  4I6N B;  3VAW A;  1RFA A;  3WA0 A;  4JIO U;  4EEW A;  3DPD A;  4URK A;  3UGB B;  5JZE B;  3OAW A;  3R7R A;  3ZLZ A;  3EC8 A;  1L7Y A;  2L00 B;  2KO3 A;  3IBE A;  4N9F 4;  4ZDV A;  3QC8 B;  2LVP A;  4IM0 A;  5CHV C;  3UF8 A;  2N4F A;  3A9J B;  4HLE A;  2WYQ A;  3KUZ A;  2N7D A;  3VQI A;  2MP2 A;  4XX5 A;  4TQ0 A;  2FNJ B;  3CF6 E;  4RM9 A;  3Q3J A;  2KAN A;  2LZ6 A;  3K9P B;  4I6P A;  3R7Q A;  2NBV B;  4NAW A;  3ZKJ C;  2IBI B;  4JQW C;  5JHB A;  4AJW A;  4B95 A;  2L7R A;  2M17 A;  1LFD A;  1GC7 A;  1EUV B;  2BYV E;  2NCN A;  2NVU I;  2YVC A;  2O6V A;  4WWN A;  3NZU A;  2LVO A;  4WJN A;  2YLM A;  3BY4 B;  2KDE B;  1KJT A;  2C7M B;  4BBN C;  3M3J A;  2FID A;  2K8B A;  3ZTC A;  2MBO A;  4IW0 A;  5E6O A;  3KVF B;  1E7V A;  2I1K A;  3OJ3 A;  2AEH A;  3GOE A;  5HKH A;  3DOW A;  2L3Z A;  3SDL C;  4BKS A;  4GDL B;  4X57 B;  1WX9 A;  4BKT A;  5J2R A;  2KHW B;  1SGH A;  3R3M A;  3VH3 B;  2DX5 B;  3PV1 A;  2K1F A;  3WIM A;  3LJ3 A;  1WYW B;  2KVR A;  4M8M A;  2JRI B;  3AI5 A;  3DBH I;  2Z59 B;  4KZC A;  3TMP B;  1WXM A;  2LGD A;  3H9D A;  3U8Z A;  2J0K A;  4W9D A;  4BBN F;  3RYT A;  2JY6 A;  4K7U A;  1TGZ B;  3DVN V;  3PSE B;  4EFO A;  2G4D B;  2M0X A;  4DDI D;  3C0R B;  4GN1 A;  1J8C A;  4ZYN A;  3EFU A;  1ZW7 A;  2MX2 A;  2ZCB A;  4KDL B;  2KOX A;  3T8M A;  3H6N A;  1HE8 A;  1WXS A;  2UYZ B;  1WGG A;  1VD2 A;  2M1M A;  4W9J A;  1WM3 A;  1EO6 A;  2A4Z A;  3RCZ A;  2C7H A;  2KC1 A;  2KDB A;  3VUY A;  2NR2 A;  4IUM B;  4PYU A;  1WR1 A;  4GIV A;  3L13 A;  4NY0 A;  2ZPY A;  3L0W B;  2CR5 A;  2XK5 B;  2J0M A;  4WWP A;  1LXD A;  2LVQ A;  2JWZ A;  2MWS B;  3PVL A;  3VTU A;  4P7I A;  4AOF A;  4DHJ B;  1L2N A;  2UWQ A;  2CHW A;  5JH5 C;  2RGF A;  2L05 A;  3ECI A;  3ZRF A;  3RUI B;  3M95 A;  3VUW A;  2KTR A;  3JSV A;  5DPT A;  3DCG A;  3AXC A;  2ZVO A;  4NJ7 A;  1WFY A;  4MJS B;  4LDT D;  2K6Q A;  1Z5S B;  1E8W A;  5E6N A;  1YX5 B;  2PPH A;  1WE6 A;  3OJ4 B;  5J18 A;  2PJH A;  4E3C A;  2BWF A;  2D3G A;  1NBF C;  2J0J A;  4HCN B;  3QAR A;  2FUH B;  3DVG X;  3QIJ A;  2D11 A;  1WJ6 A;  4PS8 A;  4XC2 A;  2K8C A;  2GOW A;  4TQ1 A;  1UH6 A;  1YIW A;  4HDQ A;  2JUO A;  4LDT B;  3DVG Y;  2DZK A;  5DPS A;  2N1W A;  4NQL B;  4E71 A;  2AWT A;  3V60 A;  1WX8 A;  4J6I A;  4FLH A;  4MEM A;  3PRE A;  2HE7 A;  1IP9 A;  2RPQ A;  1WZ3 A;  5LXH A;  2HJ8 A;  2A5U A;  2CS4 A;  3TIX A;  1V86 A;  2ZNV B;  4K7S A;  2JXX A;  3ZNI D;  2CHZ A;  3QX1 A;  2K8H A;  5E6P A;  2ASQ A;  4FBJ B;  3EHV A;  4M8N A;  2KJH B;  4M0W B;  4BVU C;  1S1Q B;  1VCB A;  4G50 A;  4KIK B;  3I3T B;  1WGD A;  2HD5 B; 
#chains in the Genus database with same CATH topology
 2JZZ A;  2GBN A;  1FRD A;  2JPH A;  3PRP B;  1HA5 A;  4BKG A;  3PRZ A;  3KYD D;  4W9G A;  1E8Y A;  5EDS A;  4A3O A;  2LGY A;  1XQQ A;  2WNM A;  3L08 A;  2BVC A;  4HWI B;  4CQN A;  3RUL A;  4IM3 A;  3ML8 A;  1V49 A;  2MP2 B;  3WAN A;  1R4M I;  1TS4 A;  2KZR A;  1UBI A;  1HTQ A;  3NHE B;  2VH2 A;  1N63 A;  2KQ7 A;  1MHH E;  1WX7 A;  2H89 B;  1V5T A;  2AQ2 B;  4ZHP A;  1GAQ B;  1TKY A;  1ZDX A;  1FRR A;  3T3O A;  2V1Y A;  1KLG D;  2KTF A;  2DZM A;  4F7Z A;  1V81 A;  2IDY A;  1FNU A;  3V6E B;  1YJJ A;  5CX3 A;  4TKN A;  2M8S A;  3OLM D;  2VRR B;  1LQB A;  2LJI A;  1MG8 A;  3QCA A;  3AEG B;  2DYM A;  5D2M B;  2KC2 A;  2KXJ A;  1VZ8 A;  4REZ A;  3Q3N C;  5KHO A;  5G55 A;  2DAJ A;  2E6X A;  3AE8 B;  5AZF A;  4W9I A;  3DBR B;  3RNC C;  1XCQ L;  2ICI A;  3M62 B;  3BK1 A;  2N1V A;  4WJQ A;  5HG2 A;  1KF6 B;  4DHZ B;  4ZRJ A;  3AE7 B;  4XZ4 A;  4FHK A;  2KDF B;  2D10 A;  4NPN A;  3SFE B;  2L32 A;  4A8X C;  1K50 A;  3JYU A;  1DOY A;  1EU4 A;  1TY2 A;  1Y8R C;  3HM3 A;  3K9O B;  5BMH A;  2WXF A;  1J0G A;  4P16 A;  3VTV A;  1EWC A;  1B9R A;  5C23 A;  2EMT A;  4YTM B;  4WH4 A;  2PEA A;  4FA6 A;  1F2R C;  1GOZ A;  2BYE A;  3VDZ A;  4GSW A;  4M00 A;  3W9C B;  1SE2 A;  1D3Z A;  2DHZ A;  3L4P A;  4KIK A;  1E7P B;  3VTW A;  1K51 A;  1P7F A;  3P42 A;  4FJZ A;  4ACF A;  1RFK A;  3PZD A;  2E3T A;  2CJN A;  3CWI A;  2IGH A;  3VRA B;  1N5X A;  2LWP A;  2IO3 B;  3QWZ B;  1TS5 A;  3PLU A;  3ZIM A;  2IPK D;  3PHW B;  3W1S C;  4KKI A;  1ISN A;  2BT6 A;  4BAX A;  3HHM A;  3ZXV A;  4S0R A;  3AEE B;  4EUT A;  1GJZ A;  4HDO A;  4WUR A;  4JLC A;  1BT0 A;  1NEK B;  3JW0 X;  4YSX B;  4RM8 A;  2BKF A;  1ZOY B;  2Z0E B;  4ANV A;  2OED A;  2W54 A;  1PGX A;  1RAX A;  5AUK A;  2Y5B B;  2EKI A;  2ZZP B;  2OHF A;  5IAA C;  1OFF A;  3UIO B;  2KAC A;  2M56 B;  3E9S A;  3ZW3 A;  1F9J A;  4YT0 B;  3X23 A;  1JWM D;  3PZ8 A;  3PT2 B;  4EOY A;  4NJ6 A;  4BFR A;  2LGX A;  5IN7 A;  2XEW A;  4WWO A;  3ZQ4 A;  2REX A;  4GU2 A;  5AUI A;  2JT4 B;  2LXA A;  1RWS A;  4M02 A;  2V4L A;  1R4N I;  2B76 B;  3P2B A;  4HK2 A;  4FN2 A;  4OZC A;  2L0F A;  2QSD A;  2EKE C;  2WGS A;  2IGD A;  3TUO A;  1YQ4 B;  2WXP A;  1Z2M A;  1J7C A;  4F1S A;  4GGQ A;  5IP4 D;  5FK9 C;  4HCP B;  4AJY B;  1WMH B;  4USA A;  3N3K B;  1P1A A;  3B2G A;  1T3Q A;  2B3A A;  2INN E;  4HPM B;  3VR8 B;  5BMI A;  3DBL B;  2Z0D B;  1UBQ A;  4NZL B;  1TS2 A;  3VH4 B;  4AS1 A;  2LMC A;  2WDT B;  4KZ0 A;  1A70 A;  3FKY A;  1WF9 A;  1QLB B;  3AB5 A;  2KFK B;  3U52 E;  2MSE D;  1I42 A;  3IHP C;  1RFA A;  3WA0 A;  1WWT A;  3C8Y A;  3OAW A;  3R7R A;  1L7Y A;  2RPV A;  3QC8 B;  5CHV C;  5H92 C;  1XF5 L;  2N0S B;  4TQ0 A;  2N7D A;  3VQI A;  1C76 A;  3CF6 E;  3Q3J A;  2ACZ B;  4N58 A;  1E0Z A;  4JQW C;  1EWY C;  2M17 A;  3P4R B;  2BYV E;  2NVU I;  2YVC A;  3W2D A;  2O6V A;  4WWN A;  2NTT A;  3NZU A;  4LNN A;  1SSN A;  2BS2 B;  3BY4 B;  2C7M B;  3M3J A;  1UF0 A;  3J9C A;  3ZTC A;  4IW0 A;  3TEZ A;  3DOW A;  2L3Z A;  4GDL B;  5J2R A;  3Q3O C;  5GXG B;  3VH3 B;  1JWA D;  3AEF B;  3WIM A;  3LJ3 A;  1WYW B;  4QAY A;  1BML C;  2J0K A;  2JY6 A;  1BXT A;  3PSE B;  3C0R B;  2K0P A;  1XEE A;  4ZYN A;  2MX2 A;  3FIL A;  2ZCB A;  4KDL B;  2KQ4 X;  3H6N A;  1WXS A;  4W9J A;  2XN9 C;  3RCZ A;  2XNA C;  2CR5 A;  2J0M A;  2JWZ A;  1WYG A;  2RGF A;  3GZN B;  3RUI B;  3M95 A;  3Q14 C;  1WFY A;  2K6Q A;  1Z5S B;  5J18 A;  2WU2 B;  2BWF A;  3TEW A;  2PIA A;  3EGR A;  3RFZ B;  3ETR A;  3DVG X;  2D11 A;  2V3N A;  2K8C A;  1I4P A;  2WXJ A;  2DZK A;  4E71 A;  1I4Q A;  3PRE A;  2Y5P A;  1IP9 A;  2A5U A;  4RGO S;  1V86 A;  5EE3 A;  2WXR A;  4M8N A;  2KJH B;  4M0W B;  4L2Y A;  2VZK B;  1DOI A;  2KYW A;  1EF5 A;  3AE5 B;  3N1Z C;  3X0W A;  2BWE S;  1B1Z A;  2KMM A;  3N20 C;  3IFW B;  2G9H D;  3A1Q B;  4K7W A;  2V0G A;  1V5O A;  1IBX B;  1XD3 B;  2KMA A;  1TBE A;  2MEK A;  5TR5 A;  1KRH A;  2C60 A;  2J53 A;  2V3S A;  1ET6 A;  2H88 B;  5EE9 A;  1Q0W B;  2IYD B;  4II2 B;  1FXT B;  1ZXH A;  1UEL A;  1FXA A;  2BW2 A;  2IY0 B;  4DHZ E;  3A4S C;  1WJU A;  2MA9 B;  4DXA B;  4FJY A;  3VXW A;  1H8C A;  1E8Z A;  1T0Y A;  3SD5 A;  1JML A;  3ABV B;  1WH3 A;  1NI2 A;  4KX6 B;  4YTN B;  3UIN B;  4AP4 C;  2FCS A;  4GDK A;  1V2Y A;  2KFJ A;  3B2F A;  3Q3M C;  4ANW A;  4WIP A;  1HZ5 A;  2V3P A;  1NYR A;  2C9W B;  2JX5 A;  3LYY A;  3SR6 A;  2ZW1 A;  4RNA A;  3U2S C;  1L6U A;  3WAL A;  1P98 A;  5EE0 A;  4WQO B;  1MPE A;  2DLB A;  1FM0 D;  3BVM A;  2JZP A;  3AN1 A;  4IWQ A;  2JQR B;  3NVW A;  4MEL A;  2C5L C;  4LK0 M;  2QIL A;  1C3T A;  2D3C A;  3HM6 X;  1C4C A;  1D5M C;  5AZG A;  2CKH B;  3IT4 B;  1SF0 A;  2O2V A;  3ZNH B;  4JWS C;  2QJL A;  1XLP A;  2GBJ A;  2IO0 B;  2GBM A;  1WM2 A;  1I35 A;  1TKE A;  3B0A A;  4OVU A;  2X38 A;  1KLV A;  4AQ7 A;  3Q69 A;  4C7Y A;  1D6E C;  2AYO B;  1V1P B;  3A9K A;  3ZXR A;  2DZJ A;  2KX3 A;  3OG5 A;  2I38 A;  4MSQ B;  3N32 A;  4HVB A;  4IDI A;  1E10 A;  1N6Z A;  1JCK B;  4NJC A;  1D4B A;  2FAZ A;  1XLO A;  1EU3 A;  2AQ1 B;  3BYT B;  1JRP A;  3S2A A;  3QA8 A;  1ROE A;  3KQ4 A;  3DBR I;  4II3 B;  2RDH A;  3H7P B;  3NS1 A;  2OOB B;  2MBE A;  2ZEQ A;  4W9K A;  1V9J A;  2TSS A;  1TY0 A;  1OTR B;  1QZE A;  3AEA B;  3DHH C;  1R7S A;  1VZ6 A;  2J42 A;  3P1M A;  1XT9 B;  4YXD B;  4NAW B;  5D94 A;  4OZB A;  3TCA A;  1YN5 A;  1FNW A;  3KWV A;  1QOB A;  2RSU A;  5I4D A;  4W9F A;  1YMH E;  4IM2 A;  3H1U A;  1MJD A;  4HJG E;  1C9F A;  2NBW B;  1TYG B;  4PYZ A;  2FCN A;  2HJ1 A;  1FFV A;  2PTL A;  4FHJ A;  1T0S C;  3IG3 A;  2K25 A;  3AEB B;  2OJR A;  4HKZ E;  4L1B A;  3GE3 C;  2K9X A;  2ZVN A;  2IY1 B;  4JGH B;  2FIF A;  2CU3 A;  3VRB B;  2NBU A;  2WLB A;  2FBW B;  4OZA A;  4B6W A;  1UZX B;  1SJH D;  1L0V B;  5LXI B;  3JVZ X;  1P0R A;  5D7G A;  4PS3 A;  3UIP B;  2KTR B;  2FCQ A;  2RDG A;  2DAF A;  3BZD B;  4MGK E;  1UGJ A;  5G5G A;  1J19 A;  5CHW A;  4DWF A;  1IGD A;  1C79 A;  2MLB A;  1RLF A;  3Q8B A;  1RM6 C;  3MFG A;  5DPW A;  4KV2 A;  2DYO A;  3MTN B;  1E8X A;  3RT3 B;  2IO2 B;  1E9M A;  3MC0 B;  4HEA 1;  2OJW A;  1SIF A;  3ZJT A;  4NNJ B;  3PTF C;  1YQB A;  5CTR C;  3TEY A;  2PKO A;  1GG3 A;  2KLC A;  1CK1 A;  1R4M B;  3ZGZ A;  4GXB A;  1TZO A;  2BYT A;  5HHD G;  2L0T A;  4XYC A;  1AWD A;  1TJE A;  4KGT A;  4DDG D;  1XCT L;  2BB5 A;  2KD0 A;  3L17 A;  3VHT C;  2KNB A;  3PGE A;  4FAD A;  2WXQ A;  3KW5 B;  1YJ1 A;  4W9C A;  4M01 A;  2MCN B;  1T5X D;  2QIE B;  1PQS A;  2BYF A;  1U4A A;  1ENF A;  4S17 A;  2BS4 B;  2YEP B;  3BYY B;  3EEC A;  1T6B X;  3B1L X;  5J17 A;  1HTO A;  5FKA C;  1AYF A;  5JZE B;  1FMA D;  1PYW D;  2L00 B;  3AMZ A;  4MH8 A;  3E56 A;  4N9F 4;  4IM0 A;  2N4F A;  3A9J B;  2WYQ A;  3KUZ A;  3OWE B;  4XX5 A;  3VR9 B;  1F77 A;  1E6E B;  4A9A A;  2NBV B;  4ITK A;  3ZYY X;  2QEJ C;  1XXG A;  2YLM A;  1KJT A;  1BUI C;  4BBN C;  2FID A;  4K3C A;  2K8B A;  1F52 A;  5BMG A;  5E6O A;  3KVF B;  3OJ3 A;  2WHI A;  3GOE A;  4BKS A;  1WSP A;  2DNF A;  1WX9 A;  2KHW B;  3R3M A;  3H8H A;  1FPY A;  1NYQ A;  3AI5 A;  4KZC A;  3TMP B;  1WXM A;  3U8Z A;  3RYT A;  3KLS X;  4EFO A;  2M0X A;  4GN1 A;  3N1Y C;  1Y56 A;  3IAS 1;  1V1O A;  2KOX A;  3T8M A;  1HE8 A;  2UYZ B;  3BVG A;  2SAK A;  2SEB D;  2HD5 B;  2KC1 A;  4IUM B;  1DGJ A;  1WR1 A;  3L13 A;  4GIV A;  1XO3 A;  2ZPY A;  4NY0 A;  2XK5 B;  3VTU A;  3PO0 A;  2UWQ A;  1QIL A;  4MM3 B;  1JRO A;  2L05 A;  2WDV B;  1OQQ A;  4A55 A;  4YWG G;  4MJS B;  1E8W A;  5E6N A;  1YX5 B;  2PPH A;  3OJ4 B;  2PJH A;  4E3C A;  1QKZ A;  1NBF C;  2FUH B;  3NVZ A;  3RNF C;  3QIJ A;  4PS8 A;  4XC2 A;  3GS2 A;  2GOW A;  1UH6 A;  4HDQ A;  2JUO A;  3V60 A;  4J6I A;  3DHI C;  3AE1 B;  1WZ3 A;  3N9Y C;  2JWU A;  2ONQ A;  2MJD A;  1GPX A;  2CHZ A;  2K8H A;  5IOI A;  1FCL A;  1N60 A;  2LGI A;  4FBJ B;  3EHV A;  1WRI A;  4G50 A;  1NVI D;  3ZRC A;  2N9K A;  4BZA A;  3PRM B;  4KSL C;  4K81 A;  4EE2 A;  1WMH A;  2JU6 X;  1C1Y B;  1YJI A;  3EFC A;  4RFB A;  2GBK A;  4KSK C;  4TV3 A;  5D3I B;  3IAM 1;  2GMI C;  2N7J A;  2ZCC A;  4FUL A;  3SHQ A;  2O6V D;  4A3P A;  4RGT A;  3O13 A;  3KWL A;  2HTH A;  2K6D B;  4TMA B;  2DEN B;  1SEB D;  3H7S A;  1RRB A;  2KFK A;  2IZV B;  4YSY B;  1WJN A;  2DZI A;  1H4R A;  2LD9 A;  4AUQ C;  1WXA A;  4TSS A;  1XLQ A;  2KWD A;  3A33 B;  3KUC B;  3APF A;  3I5J C;  1V80 A;  2LXC A;  2MH7 A;  3U7D A;  2NPT B;  4CHK A;  1SJE D;  2JVC A;  2JYE A;  5DPR A;  1NDD A;  1WJ4 A;  3RD2 A;  3CST A;  5HFY A;  5BYQ A;  4HPP A;  3BIN A;  4O1N A;  1HEZ E;  1OEY A;  4UDU C;  2J52 A;  3FIL B;  1AN8 A;  2JRH A;  3ZDM C;  5FR3 A;  1OGW A;  2KWC A;  3EUB 2;  4ZYS A;  2JXT A;  4PS7 A;  1AW7 A;  1P7E A;  4GDL A;  4HPL B;  1JWB D;  5IA7 A;  3MHS D;  4MAC A;  3A4R A;  3AE4 B;  4KGR A;  3W5U B;  1K52 A;  5EE1 A;  1GC6 A;  1JWS D;  1TKG A;  1OEY J;  3CSF A;  3VUX A;  1G6J A;  1Q1O A;  3P4S B;  4JE3 B;  2HTM E;  2MQJ A;  3AE6 B;  3KUD B;  2GLS A;  1P9D U;  3DWM A;  4KDI C;  1WIA A;  2RR9 A;  3D32 A;  4JX1 C;  4C4V A;  1SIJ A;  3KYC D;  3URY A;  5L95 C;  3AU5 A;  2WX0 A;  1STE A;  3QK0 A;  2WWZ A;  1IPG A;  3TJP A;  1GB4 A;  1MFW A;  4BOS C;  1PFD A;  3AUL A;  2DYB A;  2MRP A;  1QQR A;  2LFI A;  1E90 A;  2QHO A;  3ONS A;  2WXI A;  4US8 A;  4IWP A;  2BKR B;  2KJ6 A;  1JW9 D;  1L0X B;  2DWQ A;  2K5P A;  2MW5 A;  1UWX A;  3T3N A;  2KKC A;  5G2N A;  1NI3 A;  2N7E A;  2WS3 B;  3Q8E A;  4WJO A;  3AU4 A;  3LXF A;  2J4X A;  2GRI A;  2KWU B;  4W9H A;  5LNK 1;  2CU1 A;  5JXV A;  4N6E B;  2R2O A;  4MGI E;  3L10 B;  3AV8 A;  3A1Q A;  2ZW0 A;  1PGB A;  3VFK A;  1QOF A;  1IBX A;  4LCD E;  4DBG A;  4A6Q A;  4GDK B;  2G3Q B;  4HRO A;  2JZ3 B;  2K22 A;  2M19 A;  2KDM A;  1E7U A;  1YOV B;  4YL8 A;  1KOT A;  5GMV A;  2L1A A;  3APC A;  3GP7 A;  1SBB B;  2AL3 A;  3DQV A;  2I1J A;  4YSZ B;  4OVZ A;  2BTE A;  3NG0 A;  3HVD A;  2AL6 A;  1WXV A;  1MG4 A;  2WXK A;  1TZ1 A;  2KWV B;  1AAR A;  3PS6 A;  2Y3A A;  2M4N A;  4MGY E;  3BVZ A;  4P1C C;  1KFY B;  1KLU D;  3AE9 B;  1UD7 A;  4K1R B;  4LNO A;  3UQA A;  2O2V B;  3JSV B;  4GOC A;  1Q10 A;  4DHJ D;  1A5R A;  3Q8F A;  1MHX A;  4EZL A;  4RH6 A;  1ZP0 B;  2G4S A;  4IWO A;  1RYJ A;  5IO9 A;  4MGZ E;  1V97 A;  3V05 A;  1J7B A;  3A9K B;  3V6C B;  1ZXI A;  3KH0 A;  3M63 B;  3ML9 A;  4EKU A;  4AWJ A;  3NZ3 A;  4F8C B;  1N5W A;  2WP9 B;  1IUE A;  2WXN A;  4K3B A;  1HXY D;  4LNK A;  1ZE3 D;  4HKQ A;  4CO7 A;  1YN3 A;  2MHJ A;  2D3A A;  4W9L A;  2BGF A;  3AE3 B;  3ZJU A;  3U4E G;  3NUH B;  3DHG C;  4WAF A;  3PLV A;  3WAP A;  2QC8 A;  3L54 A;  2GBR A;  3O65 B;  4N59 A;  1V1P A;  2KDI A;  2D3B A;  4KVG B;  4ZRI A;  1QOA A;  1YQ3 B;  4NQK E;  5CHF A;  1ZPS A;  2FCM A;  2BBC A;  4RCO A;  3N30 A;  2IJ0 A;  1LO5 D;  1YD8 U;  1EF1 A;  2LJ5 A;  3ZVV A;  4MDK E;  5KHQ A;  2KAJ A;  3ZO5 B;  2KMC A;  5JHA A;  1M94 A;  2ON8 A;  2R2Q A;  2AQ3 B;  5LLI A;  3H7P A;  3NOB A;  2WXG A;  4ANX A;  3DBH B;  1TTN A;  3R66 C;  1F2R I;  4I6N B;  4URK A;  3UGB B;  4NAM A;  3ZLZ A;  3EC8 A;  2CJO A;  1FIQ A;  3FC4 A;  3IBE A;  2LVP A;  4HLE A;  2MJE A;  2MP2 A;  2FNJ B;  2KAN A;  3NRZ A;  2LZ6 A;  3DWG C;  3K9P B;  4I6P A;  3IT6 B;  4JWU C;  4PT5 A;  5HI1 A;  4NAW A;  3HVZ A;  3ZKJ C;  5JHB A;  4B95 A;  2PLP A;  2L7R A;  1LFD A;  1GC7 A;  1EUV B;  1FCC C;  2LVO A;  4WJN A;  1CJE A;  4RF1 A;  2KDE B;  1PDX A;  2MBO A;  1L0Y B;  2WDQ B;  2I1K A;  2AEH A;  3SDL C;  3C19 A;  3RMK C;  3HUI A;  2WXM A;  4X57 B;  4RF0 A;  4RGN A;  1SGH A;  3WCQ A;  2DX5 B;  3PV1 A;  3U7Z A;  3Q8A A;  2K1F A;  2WDR B;  2KVR A;  2L83 A;  3H9D A;  1TGZ B;  2G4D B;  4ZRQ A;  1J8C A;  3EFU A;  1ZW7 A;  3Q6B A;  2LUM A;  1WGG A;  3PZ7 A;  2M1M A;  2A4Z A;  5C2T B;  4PYU A;  1I4H A;  3R2I A;  4WWP A;  1LXD A;  2LVQ A;  4P7I A;  4AOF A;  3NJT A;  3ZRF A;  3VUW A;  2KTR A;  3DCG A;  3AXC A;  2JYT A;  4NJ7 A;  4LDT D;  1OQR A;  4HCN B;  3QAR A;  4ZHO A;  4HRS A;  1WJ6 A;  2W82 A;  4TQ1 A;  2W3R A;  4LNI A;  4LDT B;  3DVG Y;  1DOX A;  5DPS A;  4P1B C;  3TSS A;  2AX5 A;  2WQY B;  4LNF A;  2AWT A;  2V9H A;  4C80 A;  4FLH A;  3NVY A;  1ACC A;  2RPQ A;  4A90 A;  4H2A A;  5LXH A;  3RPF C;  2HJ8 A;  2CS4 A;  2ZNV B;  4K7S A;  2LHE A;  3P4P B;  1D5Z C;  2QDF A;  1VLB A;  4BVU C;  1S1Q B;  1VCB A;  4KIK B;  3I3T B;  3P4Q B;  1WGD A;  1CQV A;  3DBS A;  3RNB C;  1JRU A;  2KQS A;  4Q2J A;  2MBQ A;  4XDD A;  1SXT A;  3Q2A C;  4B0E A;  2ZNV C;  2LI5 A;  3TBL D;  3SU8 X;  3VVW B;  1IGC A;  1QOG A;  4ARI A;  1UWM A;  1D5X C;  1FXI A;  1OQY A;  5AZH A;  3CIR B;  3R8B A;  4E74 A;  1WGY A;  2C7N B;  1DYQ A;  3DDC B;  1ZDV A;  1JQ4 A;  2I2Y A;  3W1S A;  3EA6 A;  2MJ3 A;  2M0A A;  5D3D A;  4ICU A;  4DK5 A;  4BKS D;  1SE4 A;  3V61 A;  3SFD B;  2KLG A;  1V8C A;  2LRW A;  5IKC M;  1UUP A;  5DCN A;  3BWU D;  1QT9 A;  4IC7 B;  3DBL I;  2W55 A;  1CZP A;  1I4X A;  4RGM A;  3RNE C;  2KN5 A;  3TEX A;  3A9J A;  2D5G A;  2RDB C;  3QHT A;  3Q8C A;  4ZOH C;  1HQR D;  2ZJD A;  1L5P A;  2IO1 B;  3RN9 C;  1YX6 B;  3IXS A;  4XWW A;  2J7Q B;  1ZUD 2;  4TUU A;  3GB1 A;  4ZRK A;  3V62 A;  1WGK A;  3HRD D;  4ASW C;  4EZK A;  4CYE A;  4OHJ A;  1FEH A;  1GB1 A;  2N9X A;  3T9L A;  4BOZ B;  1KM7 A;  1WY8 A;  4W9E A;  2GB1 A;  2L76 A;  1P3Q U;  3MJW A;  3APD A;  4RMA A;  3PPA A;  3ZDT A;  4WJP A;  4LJO B;  3LB8 C;  1LM8 B;  2K39 A;  4J3O D;  3Q3F A;  2KN4 A;  2VH1 A;  2IND C;  1X1M A;  2EMS A;  2UU7 A;  3PHX B;  2Z8L A;  4HJK A;  2XK5 A;  4ICV A;  3TL5 A;  1VRA B;  5C3J B;  2MBH A;  4XWT A;  5AEK B;  4MH0 E;  3ENE A;  4LJP B;  4MM3 A;  4LLG M;  2BF8 B;  5MPO A;  1N61 A;  3N1X C;  1L6V A;  1TIF A;  3AM9 A;  4MJS A;  3LDZ E;  1WI0 A;  2ZPN A;  3IVF A;  2LRU A;  4JL9 A;  3AED B;  4IOI E;  4IKG A;  2LAS A;  1J7A A;  1Q5W B;  2RD0 A;  2BB6 A;  1WR6 E;  3B08 A;  1WRD B;  4DQO C;  2KJR A;  4LTU A;  1ZGU B;  1IYF A;  3GE8 C;  3I9V 1;  4IG7 B;  3GZN I;  1I7H A;  1SE3 A;  1KTK A;  3NY5 A;  3ZTD A;  3BK2 A;  2IGG A;  2G45 B;  1C77 A;  3RI7 C;  1S3S G;  2LHD A;  3HK0 A;  1K53 A;  2L8J A;  2CHX A;  3MHZ A;  1VDV A;  1JAL A;  2R61 A;  3MC8 A;  1TS3 A;  3W1Y A;  3AEC B;  1YN4 A;  1T0Q C;  2MBB B;  2KK8 A;  1CMX B;  1VJK A;  4G3X B;  1F1H A;  2O6V B;  4YTP B;  2N9L A;  1F0Z A;  2WX1 A;  3RNA C;  4ARC A;  4G0N B;  1TT5 B;  3ZNZ B;  3RZW C;  2DBY A;  5H8Y E;  4G11 A;  3DVN U;  3WAM A;  1M4V A;  4ANU A;  2JSV X;  1GUA B;  1WE7 A;  2K3U A;  3UQB A;  1WZ0 A;  1WGH A;  2WU5 B;  4WQM A;  2XBB C;  2JF5 A;  1YNT E;  1C4A A;  1L4D B;  2PE6 B;  1R4N B;  3HIZ A;  1SB3 C;  3WAO A;  4WAA A;  4MSM B;  2NPT A;  3UI3 A;  4L23 A;  4B9K A;  1I4R A;  3NZS A;  1L4Z B;  3V3X A;  1V6E A;  1UNS A;  3ZNG C;  1QF6 A;  3QAQ A;  2LEK A;  1NEN B;  2BS3 B;  5E6J A;  3CMM B;  1ET9 A;  1GNU A;  1WGR A;  5L83 A;  4FXC A;  1SE9 A;  3RZF A;  1FD6 A;  3ZUN A;  1HZ6 A;  2KX0 A;  1UGM A;  1N62 A;  4XGA B;  2NS5 A;  2GI9 A;  5BO4 B;  4C4V B;  4C7Z A;  1PGA A;  2D2Q A;  4OVV A;  3RNG C;  5D6J B;  4WWM A;  3I63 C;  2INP E;  4MT5 A;  5C1Z A;  1K8R B;  1JWU D;  5BYS A;  1PUT A;  2WXH A;  2N9P C;  4FJV B;  3NVV A;  3MC9 A;  2N9E B;  1LGR A;  2LUE A;  2W9N A;  2BPS A;  3ALB A;  3NS8 A;  2VZK D;  1MI0 A;  1KH0 A;  2D07 B;  1FNV A;  4R3D A;  2Y5C A;  2L52 A;  1FFU A;  2EEL A;  3QJZ A;  1T0R C;  1C4P A;  2PE9 A;  2PMV A;  1WXQ A;  3U30 A;  1FO4 A;  4M0W A;  1I4G A;  3L16 A;  1E5W A;  4EZJ A;  4GB9 A;  4B0M A;  2QCZ A;  5FR6 A;  4A20 A;  3I57 A;  5G5H A;  3QQ8 B;  3ZJV A;  4I6L B;  1ZKH A;  4GMV A;  4KKJ A;  3VAW A;  2FE8 A;  4ZRP A;  4JIO U;  2LGS A;  4EEW A;  3DPD A;  2BQQ A;  2KO3 A;  4XDC A;  5T8I A;  1ESF A;  2HDE A;  2FUG 1;  4ZDV A;  3B9J A;  3UF8 A;  3AE2 B;  4C56 C;  4XE0 A;  4RM9 A;  2INC C;  4OW0 A;  3R7Q A;  3W5V B;  1EM7 A;  2QMT A;  2IBI B;  4AJW A;  2PVG C;  1VR9 A;  2NCN A;  2NTS A;  5BYR A;  2Q5W D;  3SEB A;  2W3S A;  4C00 A;  4DXG A;  4D2K A;  3BII D;  1E7V A;  2YEP F;  5HKH A;  4BKT A;  3MJ5 A;  2G1E A;  2WXL A;  3FAH A;  4M8M A;  2JRI B;  3DBH I;  2Z59 B;  4PK1 A;  2LGD A;  3P63 A;  4W9D A;  4BBN F;  1C78 A;  4K7U A;  3DVN V;  4DDI D;  2KT7 A;  5TSS A;  2RMM A;  3MP9 A;  3AH7 A;  4GLS C;  2PVO D;  4KGS A;  2X8X X;  1VD2 A;  1WM3 A;  1EO6 A;  1XLN A;  2C7H A;  2KDB A;  3VUY A;  2NR2 A;  3L0W B;  3PVL A;  2MWS B;  4DHJ B;  1L2N A;  2CHW A;  5JH5 C;  3ECI A;  2V4I B;  3JSV A;  5DPT A;  2ZVO A;  1WE6 A;  2D3G A;  2J0J A;  3R2T A;  4JPS A;  2KVZ A;  1YIW A;  2WXO A;  4P6V F;  1MVK A;  2N1W A;  1VZ7 A;  4NQL B;  1WX8 A;  4MEM A;  2HE7 A;  3TIX A;  2JXX A;  4US9 A;  3ZNI D;  3QX1 A;  2PW9 A;  5E6P A;  2ASQ A;  4DXF A;  2NMQ A;  4HXD A; 
#chains in the Genus database with same CATH homology
 2JZZ A;  3X0W A;  3DBS A;  3PRM B;  2BWE S;  1JRU A;  4K81 A;  4KSL C;  2GBN A;  2KQS A;  1WMH A;  2JPH A;  1C1Y B;  3PRP B;  4BKG A;  2MBQ A;  3PRZ A;  2GBK A;  1EF5 A;  3IFW B;  2ZNV C;  3A1Q B;  2LI5 A;  3KYD D;  4K7W A;  4KSK C;  4W9G A;  3SU8 X;  1E8Y A;  1V5O A;  3TBL D;  4TV3 A;  3VVW B;  5EDS A;  1XD3 B;  4A3O A;  2KMA A;  1TBE A;  2LGY A;  5TR5 A;  1XQQ A;  2GMI C;  3L08 A;  2ZCC A;  1OQY A;  5AZH A;  2C60 A;  2V3S A;  4FUL A;  4HWI B;  4E74 A;  1WGY A;  3RUL A;  3SHQ A;  2C7N B;  4IM3 A;  2O6V D;  3ML8 A;  3DDC B;  4A3P A;  1V49 A;  1Q0W B;  2MP2 B;  1R4M I;  2IYD B;  4II2 B;  2HTH A;  3W1S A;  1FXT B;  3WAN A;  2K6D B;  1UEL A;  2DEN B;  2IY0 B;  4ICU A;  4DHZ E;  3A4S C;  1WJU A;  4DK5 A;  2KZR A;  1UBI A;  2MA9 B;  4DXA B;  4FJY A;  3VXW A;  3H7S A;  1RRB A;  3NHE B;  4BKS D;  2KFK A;  1E8Z A;  3V61 A;  2KQ7 A;  2IZV B;  1H8C A;  2KLG A;  1T0Y A;  3SD5 A;  1WX7 A;  2LRW A;  1WJN A;  1V5T A;  1WH3 A;  2DZI A;  1H4R A;  2LD9 A;  5DCN A;  4IC7 B;  4AUQ C;  1WXA A;  1NI2 A;  3DBL I;  3A33 B;  3UIN B;  3KUC B;  4AP4 C;  2FCS A;  3APF A;  4GDK A;  1V2Y A;  2KFJ A;  2V1Y A;  2KN5 A;  3A9J A;  4HXD A;  3QHT A;  1V80 A;  2LXC A;  4ANW A;  3U7D A;  2KTF A;  2DZM A;  2NPT B;  4CHK A;  4F7Z A;  1V81 A;  2ZJD A;  2JVC A;  5DPR A;  2C9W B;  1NDD A;  2IO1 B;  3V6E B;  1WJ4 A;  3RD2 A;  1YX6 B;  3WAL A;  3CST A;  5CX3 A;  1P98 A;  4TKN A;  3BIN A;  2M8S A;  2J7Q B;  3OLM D;  2VRR B;  4TUU A;  1OEY A;  4WQO B;  1LQB A;  1MG8 A;  4ZRK A;  3QCA A;  3V62 A;  2JRH A;  2DYM A;  5D2M B;  2KC2 A;  2KXJ A;  3ZDM C;  4IWQ A;  1OGW A;  2KWC A;  4ASW C;  4MEL A;  2C5L C;  4EZK A;  4PS7 A;  4CYE A;  4GDL A;  4HPL B;  5KHO A;  1C3T A;  3HM6 X;  5G55 A;  5IA7 A;  3MHS D;  2DAJ A;  2N9X A;  3A4R A;  3T9L A;  4BOZ B;  1KM7 A;  1GC6 A;  5AZF A;  4W9I A;  1WY8 A;  5AZG A;  4W9E A;  2CKH B;  1P3Q U;  2L76 A;  3APD A;  3MJW A;  3M62 B;  4RMA A;  3PPA A;  1OEY J;  2N1V A;  4WJQ A;  2O2V A;  3ZDT A;  3ZNH B;  4WJP A;  4DHZ B;  4ZRJ A;  4LJO B;  3CSF A;  1LM8 B;  2K39 A;  4XZ4 A;  2GBJ A;  2IO0 B;  4FHK A;  1Q1O A;  2GBM A;  3VUX A;  1G6J A;  1WM2 A;  2KDF B;  2D10 A;  3Q3F A;  1I35 A;  4NPN A;  3B0A A;  4OVU A;  1X1M A;  1KLV A;  2EMS A;  2MQJ A;  3KUD B;  3PHX B;  4HJK A;  2XK5 A;  4ICV A;  1P9D U;  3JYU A;  3TL5 A;  2MBH A;  2AYO B;  5AEK B;  4MH0 E;  3A9K A;  2DZJ A;  3ENE A;  4KDI C;  4LJP B;  2KX3 A;  1WIA A;  4MM3 A;  1Y8R C;  2BF8 B;  3HM3 A;  3K9O B;  2RR9 A;  4MSQ B;  3N32 A;  3D32 A;  4HVB A;  3KYC D;  5L95 C;  4MJS A;  3LDZ E;  1WI0 A;  2ZPN A;  3AU5 A;  3IVF A;  2LRU A;  2WX0 A;  3QK0 A;  1J0G A;  2WWZ A;  1IPG A;  2FAZ A;  3TJP A;  4JL9 A;  2LAS A;  4BOS C;  1Q5W B;  2RD0 A;  3VTV A;  3S2A A;  5C23 A;  1WR6 E;  2DYB A;  2MRP A;  3AUL A;  3B08 A;  1WRD B;  3QA8 A;  1E90 A;  2EMT A;  2KJR A;  3DBR I;  4II3 B;  1ZGU B;  2QHO A;  3ONS A;  1IYF A;  2PEA A;  4IG7 B;  3GZN I;  3H7P B;  4IWP A;  2BKR B;  2KJ6 A;  3NY5 A;  3ZTD A;  2OOB B;  2MBE A;  4FA6 A;  2MW5 A;  2BYE A;  3VDZ A;  2G45 B;  2ZEQ A;  2KKC A;  4W9K A;  1S3S G;  1V9J A;  5G2N A;  4GSW A;  2N7E A;  1D3Z A;  3HK0 A;  2DHZ A;  4WJO A;  3AU4 A;  2L8J A;  1OTR B;  1QZE A;  4KIK A;  2CHX A;  2KWU B;  3VTW A;  4W9H A;  2CU1 A;  1XT9 B;  4NAW B;  2R2O A;  5D94 A;  3TCA A;  4MGI E;  4FJZ A;  3W1Y A;  3L10 B;  3PZD A;  2MBB B;  2KK8 A;  1CMX B;  3A1Q A;  4G3X B;  2O6V B;  3VFK A;  2LWP A;  2WX1 A;  4LCD E;  2IO3 B;  3QWZ B;  3ZIM A;  3PLU A;  2RSU A;  4G0N B;  4DBG A;  3PHW B;  4W9F A;  4GDK B;  3W1S C;  4IM2 A;  1ISN A;  3ZNZ B;  2G3Q B;  3RZW C;  3H1U A;  3HHM A;  2JZ3 B;  1E7U A;  4G11 A;  3DVN U;  4EUT A;  1GJZ A;  4HDO A;  3WAM A;  4ANU A;  2NBW B;  4PYZ A;  1GUA B;  1BT0 A;  4JLC A;  4YL8 A;  1KOT A;  5GMV A;  2FCN A;  3APC A;  1WE7 A;  3JW0 X;  2AL3 A;  3DQV A;  2I1J A;  4FHJ A;  4RM8 A;  3UQB A;  3IG3 A;  1WZ0 A;  2K25 A;  2BKF A;  1WGH A;  2Z0E B;  4ANV A;  2AL6 A;  2OJR A;  2XBB C;  2JF5 A;  1WXV A;  2ZVN A;  2IY1 B;  4JGH B;  1TZ1 A;  2PE6 B;  2KWV B;  1AAR A;  2FIF A;  3PS6 A;  3HIZ A;  2M4N A;  4MGY E;  3WAO A;  2NBU A;  4WAA A;  1RAX A;  4MSM B;  2NPT A;  4B6W A;  2Y5B B;  1UD7 A;  1UZX B;  2ZZP B;  5IAA C;  4B9K A;  4K1R B;  3UIO B;  3NZS A;  5LXI B;  3JVZ X;  3ZW3 A;  1F9J A;  1P0R A;  5D7G A;  1V6E A;  4PS3 A;  3UIP B;  3UQA A;  2O2V B;  2KTR B;  3JSV B;  3X23 A;  3ZNG C;  3QAQ A;  2FCQ A;  4GOC A;  2DAF A;  4DHJ D;  1A5R A;  3PT2 B;  4MGK E;  3CMM B;  1J19 A;  5CHW A;  4EOY A;  4EZL A;  4DWF A;  4NJ6 A;  2MLB A;  1GNU A;  4BFR A;  1WGR A;  5L83 A;  2LGX A;  1RLF A;  2G4S A;  4IWO A;  1SE9 A;  4MGZ E;  5DPW A;  4KV2 A;  2DYO A;  3A9K B;  2XEW A;  3RZF A;  3V6C B;  3M63 B;  3KH0 A;  4WWO A;  3ZUN A;  2KX0 A;  3ML9 A;  4EKU A;  1UGM A;  3MTN B;  4AWJ A;  4F8C B;  2NS5 A;  5BO4 B;  2REX A;  4GU2 A;  1E8X A;  3RT3 B;  2D2Q A;  2JT4 B;  2IO2 B;  2LXA A;  4OVV A;  2V4L A;  1R4N I;  4CO7 A;  3P2B A;  4HK2 A;  5D6J B;  4FN2 A;  2L0F A;  2EKE C;  1SIF A;  4W9L A;  2BGF A;  4NNJ B;  5C1Z A;  1K8R B;  3PTF C;  1Z2M A;  1YQB A;  4F1S A;  5CTR C;  4GGQ A;  2N9P C;  3PLV A;  4FJV B;  1GG3 A;  2KLC A;  2N9E B;  3WAP A;  2LUE A;  3L54 A;  2GBR A;  4HCP B;  3O65 B;  2W9N A;  4AJY B;  1WMH B;  2BPS A;  4GXB A;  3N3K B;  3ALB A;  2KDI A;  1P1A A;  2L0T A;  3NS8 A;  4KVG B;  4ZRI A;  2B3A A;  4NQK E;  4HPM B;  2D07 B;  4DDG D;  5CHF A;  2KD0 A;  2FCM A;  3L17 A;  3VHT C;  2KNB A;  3PGE A;  4FAD A;  3KW5 B;  3N30 A;  1YJ1 A;  4W9C A;  3QJZ A;  2Z0D B;  2PE9 A;  1YD8 U;  1EF1 A;  2LJ5 A;  2MCN B;  3U30 A;  3ZVV A;  1UBQ A;  4MDK E;  3ZRC A;  1PQS A;  2BYF A;  3VH4 B;  5KHQ A;  3L16 A;  1U4A A;  3ZO5 B;  1E5W A;  2KMC A;  5JHA A;  1M94 A;  2R2Q A;  4EZJ A;  4GB9 A;  2WDT B;  4KZ0 A;  3EEC A;  5LLI A;  3H7P A;  3NOB A;  5FR6 A;  1WF9 A;  4A20 A;  2KFK B;  3B1L X;  3QQ8 B;  4ANX A;  5J17 A;  2MSE D;  1ZKH A;  4GMV A;  4I6L B;  1TTN A;  3R66 C;  1I42 A;  3IHP C;  4I6N B;  3VAW A;  1RFA A;  3WA0 A;  4JIO U;  4EEW A;  3DPD A;  4URK A;  3UGB B;  5JZE B;  3OAW A;  3R7R A;  3ZLZ A;  3EC8 A;  1L7Y A;  2L00 B;  2KO3 A;  3IBE A;  4N9F 4;  4ZDV A;  3QC8 B;  2LVP A;  4IM0 A;  5CHV C;  3UF8 A;  2N4F A;  3A9J B;  4HLE A;  2WYQ A;  3KUZ A;  2N7D A;  3VQI A;  2MP2 A;  4XX5 A;  4TQ0 A;  2FNJ B;  3CF6 E;  4RM9 A;  3Q3J A;  2KAN A;  2LZ6 A;  3K9P B;  4I6P A;  3R7Q A;  2NBV B;  4NAW A;  3ZKJ C;  2IBI B;  4JQW C;  5JHB A;  4AJW A;  4B95 A;  2L7R A;  2M17 A;  1LFD A;  1GC7 A;  1EUV B;  2BYV E;  2NCN A;  2NVU I;  2YVC A;  2O6V A;  4WWN A;  3NZU A;  2LVO A;  4WJN A;  2YLM A;  3BY4 B;  2KDE B;  1KJT A;  2C7M B;  4BBN C;  3M3J A;  2FID A;  2K8B A;  3ZTC A;  2MBO A;  4IW0 A;  5E6O A;  3KVF B;  1E7V A;  2I1K A;  3OJ3 A;  2AEH A;  3GOE A;  5HKH A;  3DOW A;  2L3Z A;  3SDL C;  4BKS A;  4GDL B;  4X57 B;  1WX9 A;  4BKT A;  5J2R A;  2KHW B;  1SGH A;  3R3M A;  3VH3 B;  2DX5 B;  3PV1 A;  2K1F A;  3WIM A;  3LJ3 A;  1WYW B;  2KVR A;  4M8M A;  2JRI B;  3AI5 A;  3DBH I;  2Z59 B;  4KZC A;  3TMP B;  1WXM A;  2LGD A;  3H9D A;  3U8Z A;  2J0K A;  4W9D A;  4BBN F;  3RYT A;  2JY6 A;  4K7U A;  1TGZ B;  3DVN V;  3PSE B;  4EFO A;  2G4D B;  2M0X A;  4DDI D;  3C0R B;  4GN1 A;  1J8C A;  4ZYN A;  3EFU A;  1ZW7 A;  2MX2 A;  2ZCB A;  4KDL B;  2KOX A;  3T8M A;  3H6N A;  1HE8 A;  1WXS A;  2UYZ B;  1WGG A;  1VD2 A;  2M1M A;  4W9J A;  1WM3 A;  1EO6 A;  2A4Z A;  3RCZ A;  2C7H A;  2KC1 A;  2KDB A;  3VUY A;  2NR2 A;  4IUM B;  4PYU A;  1WR1 A;  4GIV A;  3L13 A;  4NY0 A;  2ZPY A;  3L0W B;  2CR5 A;  2XK5 B;  2J0M A;  4WWP A;  1LXD A;  2LVQ A;  2JWZ A;  2MWS B;  3PVL A;  3VTU A;  4P7I A;  4AOF A;  4DHJ B;  1L2N A;  2UWQ A;  2CHW A;  5JH5 C;  2RGF A;  2L05 A;  3ECI A;  3ZRF A;  3RUI B;  3M95 A;  3VUW A;  2KTR A;  3JSV A;  5DPT A;  3DCG A;  3AXC A;  2ZVO A;  4NJ7 A;  1WFY A;  4MJS B;  4LDT D;  2K6Q A;  1Z5S B;  1E8W A;  5E6N A;  1YX5 B;  2PPH A;  1WE6 A;  3OJ4 B;  5J18 A;  2PJH A;  4E3C A;  2BWF A;  2D3G A;  1NBF C;  2J0J A;  4HCN B;  3QAR A;  2FUH B;  3DVG X;  3QIJ A;  2D11 A;  1WJ6 A;  4PS8 A;  4XC2 A;  2K8C A;  2GOW A;  4TQ1 A;  1UH6 A;  1YIW A;  4HDQ A;  2JUO A;  4LDT B;  3DVG Y;  2DZK A;  5DPS A;  2N1W A;  4NQL B;  4E71 A;  2AWT A;  3V60 A;  1WX8 A;  4J6I A;  4FLH A;  4MEM A;  3PRE A;  2HE7 A;  1IP9 A;  2RPQ A;  1WZ3 A;  5LXH A;  2HJ8 A;  2A5U A;  2CS4 A;  3TIX A;  1V86 A;  2ZNV B;  4K7S A;  2JXX A;  3ZNI D;  2CHZ A;  3QX1 A;  2K8H A;  5E6P A;  2ASQ A;  4FBJ B;  3EHV A;  4M8N A;  2KJH B;  4M0W B;  4BVU C;  1S1Q B;  1VCB A;  4G50 A;  4KIK B;  3I3T B;  1WGD A;  2HD5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...