3TIXA

Crystal structure of the chp1-tas3 complex core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
153
Chain Sequence
b'ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDNDIIEAHREQIGGLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRSEMLSQRKLLAAVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3,RNA-induced transcriptional sile
publication title The Chp1-Tas3 core is a multifunctional platform critical for gene silencing by RITS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation/protein binding
total genus 45
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tixA01
3C0RB 1Q1OA 1WX7A 4WJOA 3A4SC 3IFWB 2JRIB 3V60A 1V6EA 3ONSA 1WXMA 3DVGY 4YL8A 4DHZB 4BOSC 4NQLB 1WXVA 3AU4A 1KM7A 3OJ4B 4LCDE 2DZMA 2KJHB 2N9PC 1F9JA 2GBMA 4MGZE 1V2YA 5J18A 4W9JA 4HPLB 4BKSD 2DYOA 1R4MI 4EUTA 2PJHA 1E7UA 2W9NA 4BBNC 1WR1A 4AJWA 4G11A 3PPAA 4M8NA 4WWOA 2O2VA 3B08A 3M95A 4F8CB 4HCPB 2NPTB 2KWVB 4FJYA 4W9FA 5DPTA 3PRMB 3L10B 3PREA 2MBEA 2MSED 5D94A 1TBEA 3PHWB 2FNJB 3O65B 3QARA 4WWPA 2BKFA 3PZDA 2N9XA 4M0WB 1WYWB 1NDDA 1WGRA 2C7MB 5TR5A 1WE6A 2GMIC 2WX1A 3PVLA 4DXAB 1X1MA 2WX0A 4W9KA 3N3KB 3DBLI 2LVPA 3HM3A 5DPSA 2KNBA 4ANUA 3A1QA 1OEYA 1V49A 2KD0A 4FJVB 3APDA 4K1RB 2KK8A 2ZNVC 1WF9A 4PYUA 2XK5A 4HVBA 3U30A 3SDLC 2EMSA 3ZKJC 2AL6A 3V61A 4KIKB 3A9JA 2MBQA 3PV1A 2J0KA 3DPDA 4I6PA 2WWZA 4GB9A 4ICVA 3VUYA 3CMMB 3VTWA 1Q0WB 2MP2B 3MJWA 3PRZA 3CSFA 2ZCBA 4K7UA 1GUAB 2NCNA 2A4ZA 2IBIB 4TQ0A 1TTNA 2V1YA 1WXSA 1UBQA 4IWPA 1WR6E 3Q3FA 4NNJB 1OTRB 3DVNU 2CS4A 2J0JA 5E6PA 4NAWA 3WIMA 2D2QA 2KWUB 3ML8A 5AZHA 2AWTA 4F7ZA 3SU8X 3RT3B 2JF5A 4WJPA 1XT9B 2ZCCA 2JWZA 3K9PB 1J0GA 2N4FA 4HWIB 4KVGB 2IY0B 4DDGD 1YQBA 3JSVB 4W9LA 3MHSD 2IO0B 5IAAC 2KJ6A 4EFOA 4EZJA 4DK5A 4LJPB 3JVZX 3V62A 3OLMD 3KUCB 1KOTA 4BBNF 4TKNA 1E5WA 4ZRKA 1YIWA 2HD5B 2CHZA 5JHBA 3L08A 1AARA 5C1ZA 3H9DA 4MGYE 1UBIA 2B3AA 3ZNID 2HE7A 2LGXA 2NPTA 2ZJDA 2KX3A 2ZNVB 3H7SA 4CO7A 4DHJB 3ZO5B 2DAJA 2KTRB 1IPGA 3V6EB 1MG8A 4K81A 2CKHB 2JPHA 3ZTCA 3QJZA 3EC8A 4FN2A 2DX5B 2D10A 3ECIA 4II3B 2G4DB 3ZRCA 1RRBA 2IO3B 2N7DA 3VFKA 1ZW7A 2Y5BB 1M94A 2EKEC 2BWES 5HKHA 2LVOA 3RZWC 1WGYA 3L54A 5D6JB 2GBNA 2LUEA 3TMPB 3WALA 5CHVC 4LDTD 3VDZA 4JQWC 4MJSA 4A3OA 1S1QB 2XBBC 1NI2A 2FCMA 2LWPA 2KLCA 4DBGA 1WX8A 4KZCA 3NZUA 2IYDB 4FLHA 5E6NA 1J19A 1UGMA 3DBHI 1WGGA 3HM6X 3IG3A 4XZ4A 3U8ZA 3UGBB 2L8JA 2K8CA 3DVNV 1WMHB 3QC8B 1E90A 2DZIA 4GDLB 4E71A 2ZEQA 3TBLD 3VXWA 2A5UA 2KWCA 3D32A 4ZRIA 2Z0EB 2R2OA 3R7RA 1E8YA 1LXDA 2KFJA 4G3XB 2PE6B 4G50A 2K6QA 4GIVA 3RULA 2FCQA 4PS3A 3DVGX 3KW5B 4HDOA 2JT4B 2NVUI 2RGFA 5J2RA 1EO6A 2DENB 4DWFA 2JUOA 1WM3A 4W9DA 1KLVA 1Y8RC 3Q3JA 4GXBA 1V81A 1BT0A 2FIFA 3QK0A 3RD2A 3H1UA 2CHXA 2LGDA 3A4RA 3W1YA 4A20A 1KJTA 1T0YA 2I1JA 4FHKA 2J7QB 3A9KA 5DPWA 4XC2A 4MGKE 2Z59B 4FJZA 2L0FA 4WWNA 4IM3A 2KJRA 2KQSA 3B0AA 3RCZA 4BOZB 4KSLC 4MELA 4W9IA 4IWQA 4E3CA 4EZLA 3PTFC 4RM8A 3JSVA 2ASQA 2L7RA 5G55A 4EZKA 4W9GA 3T9LA 2J0MA 2N7EA 2K6DB 3DDCB 4EKUA 4IG7B 3ZTDA 2LXCA 2I1KA 3R3MA 2KFKB 3DBRI 4FADA 1L2NA 4IWOA 4ZDVA 1WX9A 2KDBA 4MGIE 1IYFA 4B6WA 2M8SA 4J6IA 2KTRA 1OGWA 2N1WA 2UYZB 4BFRA 4FULA 4WJNA 4NJ6A 2L0TA 5JHAA 2WYQA 3NZSA 5IA7A 2KZRA 3T8MA 5BO4B 1GC7A 2V3SA 3MTNB 3HIZA 2GBRA 5D2MB 3UQAA 4G0NB 4I6NB 1WM2A 2JVCA 1P0RA 5FR6A 4GDKA 3VH3B 5G2NA 4ZRJA 3W1SA 1WH3A 2IO2B 2CHWA 4CYEA 2GBKA 2K39A 1Z5SB 2KKCA 4RM9A 2Z0DB 2LRUA 2DHZA 4IW0A 3DOWA 3A33B 1PQSA 3VVWB 1LM8B 1Z2MA 3H7PB 4KDLB 3ZNHB 4ASWC 2BKRB 2D11A 4BVUC 2JRHA 4K7WA 3APCA 4F1SA 4B95A 2NBWB 3H6NA 2NR2A 4ANVA 1E8WA 3PT2B 1WXAA 4HK2A 1QZEA 1RFAA 3ZNGC 4FBJB 2XEWA 3WAPA 3I3TB 2RPQA 1R4NI 1RAXA 1E8ZA 2BWFA 2LASA 3U7DA 1I35A 1GNUA 2M17A 2BYVE 1WE7A 2C7NB 3RYTA 3L0WB 2YLMA 1WFYA 2REXA 3UIOB 3VQIA 3QCAA 1VCBA 1V86A 2O6VB 4WAAA 1HE8A 4E74A 1V9JA 3EFUA 3HHMA 4OVUA 3APFA 3N32A 4A3PA 1SGHA 2BF8B 2IZVB 2KMCA 2V4LA 4JIOU 5KHQA 1WJNA 4RMAA 3CSTA 2BGFA 2O2VB 2RD0A 4WQOB 1RLFA 4HLEA 4ANXA 3VUWA 4HJKA 4GMVA 5LXHA 1ZKHA 4KDIC 3WAMA 4B9KA 4PS8A 2MBBB 4ZYNA 4NJ7A 2CU1A 1V5TA 3ZUNA 2KN5A 3RZFA 5AZGA 4K7SA 2K25A 3WAOA 2RSUA 3AULA 4HCNB 1WJUA 3ALBA 4KSKC 2N1VA 4WJQA 3NOBA 3A1QB 3UQBA 2DZKA 5DCNA 3AU5A 3K9OB 1NBFC 2KTFA 2LVQA 4KIKA 5L95C 3L17A 4DHJD 1GG3A 2MW5A 3SD5A 5L83A 2FIDA 4EOYA 3TIXA 3EHVA 2L76A 4W9CA 3TJPA 3X23A 2D3GA 2MP2A 3ZRFA 2LD9A 3QWZB 5EDSA 3GZNI 5J17A 4MSQB 3IHPC 1WJ6A 4PYZA 2M4NA 3ZVVA 2GOWA 3OAWA 3TL5A 2FUHB 3GOEA 3ZW3A 3M63B 3S2AA 3KUZA 2AYOB 4IM0A 4N9F4 3DCGA 4I6LB 5CTRC 1H8CA 1EF1A 2MRPA 2L05A 3EECA 2OJRA 1WRDB 4W9HA 2PEAA 3VTUA 4MH0E 2BYFA 4P7IA 2JXXA 4NY0A 5AEKB 3B1LX 3LDZE 4NAWB 2N9EB 2YVCA 3R66C 2KQ7A 1GJZA 1YX6B 2AL3A 4FHJA 3HK0A 4JGHB 4MEMA 1L7YA 2KC1A 2QHOA 4KZ0A 4IC7B 1UD7A 2AEHA 2NBUA 1OEYJ 3CF6E 3L16A 4HDQA 2O6VA 1JRUA 3BINA 4MM3A 3M3JA 4GU2A 2MQJA 3QX1A 4W9EA 3OJ3A 3UIPB 4IUMB 4NQKE 1YJ1A 5AZFA 4ANWA 3VH4B 4AP4C 4EEWA 2IO1B 2MLBA 1YX5B 3QA8A 5DPRA 1J8CA 3N30A 1LQBA 3PGEA 2C9WB 2KHWB 2L3ZA 2KVRA 3ZDTA 2MWSB 3KH0A 4KV2A 3NY5A 3M62B 1WZ0A 2MBOA 4JL9A 3KUDB 2OOBB 4BKGA 4AOFA 1SE9A 5JZEB 2VRRB 5JH5C 3NHEB 2FCNA 2EMTA 3DQVA 1VD2A 3WANA 3PLVA 4MDKE 4GGQA 5CX3A 2M0XA 4FA6A 4M8MA 1IP9A 4MJSB 5E6OA 3PRPB 1C3TA 2L00B 2LRWA 5GMVA 1P98A 1WMHA 1P3QU 3JW0X 4GDLA 2CR5A 4AWJA 1V80A 3V6CB 4NPNA 2ZPNA 3RUIB 3ZNZB 4BKSA 5D7GA 2LZ6A 4PS7A 2K8HA 1I42A 2G4SA 2IY1B 3IBEA 1E7VA 3ZIMA 2UWQA 3W1SC 1SIFA 2D07B 4AUQC 2FCSA 2ZVNA 1P9DU 2BYEA 1D3ZA 4LJOB 3JYUA 2HJ8A 3VHTC 1LFDA 2LI5A 2G45B 2DYMA 2KMAA 3DBSA 3TCAA 3AI5A 2JZZA 3PSEB 3P2BA 1XD3B 3A9KB 4HXDA 3PLUA 1WGDA 3ENEA 3L13A 3SHQA 4URKA 3X0WA 1UELA 3WA0A 3UF8A 2JZ3B 3ZDMC 2DAFA 2GBJA 2LGYA 2KLGA 1WIAA 1S3SG 4ICUA 4JLCA 4DDID 4GOCA 5CHWA 2BPSA 1ZGUB 1YD8U 2KFKA 1TZ1A 1UH6A 3IVFA 2KC2A 2JY6A 4GN1A 4LDTB 4TV3A 3PS6A 3LJ3A 1FXTB 2NBVB 2KO3A 1WI0A 2LJ5A 4X57B 2KDEB 1A5RA 2PPHA 2K1FA 4GSWA 1K8RB 2NS5A 4OVVA 5KHOA 2ZVOA 5LLIA 5C23A 3R7QA 2KDIA 2C5LC 2C60A 1P1AA 2R2QA 1WY8A 2ZZPB 4CHKA 2K8BA 5LXIB 1U4AA 2O6VD 3PHXB 4IM2A 3KVFB 2HTHA 1ISNA 2KOXA 1OQYA 3VAWA 4TQ1A 1WJ4A 2G3QB 3AXCA 2XK5B 2MCNB 2DYBA 3BY4B 4AJYB 1G6JA 1GC6A 2RR9A 1H4RA 3KYDD 1EUVB 2LXAA 3QQ8B 3NS8A 4GDKB 3A9JB 4TUUA 4HPMB 1XQQA 4BKTA 2WDTB 2DZJA 3VUXA 1C1YB 3ML9A 3ZLZA 2KANA 3KYCD 2M1MA 1TGZB 4MSMB 1Q5WB 1CMXB 3H7PA 3UINB 2MA9B 1WZ3A 2FAZA 3VTVA 2MX2A 2ZPYA 2KXJA 1UZXB 3QIJA 2KX0A 1EF5A 2C7HA 2MBHA 3QHTA 3QAQA 5CHFA 4XX5A 2KDFB 1E8XA 1WGHA 2PE9A 4II2B 1V5OA 4DHZE
chains in the Genus database with same CATH superfamily
1WX7A 1FM0D 3A4SC 2JRIB 1E0ZA 1V6EA 2W82A 2MH7A 2DNFA 3IT6B 3N1XC 2IGHA 2L1AA 1V2YA 5J18A 5IOIA 4WIPA 4W9JA 1L6VA 5H92C 1R4MI 4EUTA 1FO4A 1UF0A 3PPAA 3PZ7A 4WWOA 2O2VA 3B08A 3M95A 1TKYA 3TEZA 1FPYA 4WURA 3PREA 2LGSA 2FNJB 1TKEA 2N9XA 2INPE 1R7SA 1WYWB 1I4GA 1BMLC 3Q69A 3ZQ4A 3HM3A 5DPSA 5FKAC 4C80A 4ANUA 1HA5A 1V49A 4FJVB 4K1RB 2KK8A 2ZNVC 2QC8A 1QT9A 1CJEA 4KIKB 1VR9A 3A9JA 1XXGA 2J0KA 2E6XA 3VUYA 2FE8A 2RDGA 2ZCBA 4K7UA 2RDHA 2V1YA 1TKGA 1WXSA 1WR6E 2QCZA 4NNJB 1E7PB 3ML8A 3RN9C 1VJKA 2AWTA 4F7ZA 1SE4A 3RT3B 3EGRA 2JF5A 1J0GA 3RNFC 2N4FA 4KVGB 5IAAC 1C77A 4EZJA 4DK5A 1T0QC 3KWLA 1KOTA 4BBNF 4TKNA 4ZRKA 1ZOYB 2J4XA 2HD5B 2CHZA 1N62A 3H7SA 4DHJB 1IPGA 2V9HA 2JPHA 3QJZA 3EC8A 2DX5B 4II3B 2N7DA 3RI7C 1N5XA 4JX1C 5EE1A 2R61A 2BWES 2LVOA 3L54A 2GBNA 3TMPB 4YTNB 1NI2A 2W55A 2WHIA 2IYDB 1UGMA 3DBHI 2L8JA 2K8CA 1WMHB 4GDLB 3VXWA 3P4QB 1LXDA 3TEXA 2K6QA 4HDOA 2X38A 2RGFA 2Y5CA 1KLVA 3ZGZA 4DWFA 3AEFB 3Q3JA 4GXBA 1V81A 1BT0A 2FIFA 4A20A 1KJTA 1JALA 2J7QB 4M01A 4MGKE 4WWNA 4E3CA 4EZLA 1TY0A 1ACCA 3MP9A 3JSVA 2L7RA 4YSXB 2N7EA 3DDCB 4IG7B 3ZTDA 3HVZA 2I1KA 2KFKB 4C00A 2KTRA 4HPPA 4WJNA 5JHAA 2QJLA 1IGCA 2BW2A 5IKCM 1R4NB 2GBRA 3UQAA 3W5UB 4YXDB 2QSDA 1WM2A 2JVCA 4GDKA 1V8CA 1WH3A 2JWUA 2GB1A 2MJ3A 2WU2B 2Z0DB 4IW0A 4AQ7A 3MC0B 1PQSA 2L52A 3MFGA 3ZNHB 4ASWC 3AE5B 3APCA 2NBWB 2N0SB 2NR2A 1RFAA 3AECB 4YTPB 3WAPA 3H8HA 2BWFA 1F52A 1MHHE 1I35A 3L0WB 1WFYA 3UIOB 3VRAB 1V9JA 4A3PA 4JE3B 3RNEC 3CSTA 4HLEA 3VUWA 4B9KA 4PS8A 4XE0A 2BQQA 1ENFA 4NJ7A 3ZUNA 1MPEA 2PW9A 2KACA 5AZGA 4XDDA 4K7SA 2K25A 3WAOA 3AULA 3GS2A 4QAYA 4USAA 4C56C 4KIKA 2LVQA 5L95C 4IOIE 3TIXA 3IHPC 3ZXVA 2WXKA 3ZW3A 3M63B 3S2AA 1NYQA 2AYOB 4IM0A 4N9F4 1DOIA 2MRPA 3BIID 4W9HA 2PEAA 4OVZA 3HVDA 2BYFA 1PUTA 4XWWA 1MJDA 4LNKA 2KQ7A 3OWEB 3LXFA 1GJZA 2AL3A 4JGHB 1V1OA 2KC1A 1JWAD 1UD7A 3NS1A 2D5GA 3URYA 3CF6E 3TSSA 2XNAC 2SEBD 4MM3A 3QX1A 4W9EA 3DWMA 1KH0A 4IUMB 2G9HD 3AB5A 2IO1B 2MLBA 2LFIA 3FC4A 1LQBA 4ZOHC 2M56B 4YSZB 4KKIA 2JYEA 2WGSA 1N63A 2VZKB 4KV2A 3GB1A 4BKGA 2ONQA 1VD2A 3PLVA 4MDKE 5CX3A 5I4DA 4O1NA 4US8A 1TT5B 1L0VB 1C3TA 1WMHA 4GDLA 1J7AA 4BKSA 2LZ6A 2K8HA 1EU3A 1I7HA 1I42A 2G4SA 2UWQA 2D07B 4BAXA 3BYTB 1P9DU 3NRZA 3DHGC 3ZYYX 1D3ZA 3TUOA 2WXOA 3Q3MC 2J53A 3DBSA 2M19A 3PLUA 3ENEA 1UELA 2WXIA 3RPFC 3ZDMC 2KLGA 4ICUA 1S3SG 2D3BA 2BPSA 1MVKA 2KFKA 1QF6A 4LDTB 4GN1A 3LJ3A 2ACZB 1FXTB 3LYYA 2LJ5A 4Q2JA 2KDEB 4X57B 2NS5A 3E56A 2MJDA 2R2QA 1P1AA 2O6VD 3KVFB 2HTHA 4XWTA 2KOXA 1OQYA 1WJ4A 2G3QB 2VH2A 2MCNB 5BYQA 4AJYB 1GC6A 1TJEA 1H4RA 1AW7A 2BB5A 3A9JB 4L23A 4DQOC 2JYTA 1JWSD 1FEHA 1PGAA 1R4MB 2WDTB 3ML9A 2IJ0A 3KYCD 3AE2B 2AQ3B 1CMXB 2MA9B 4ARCA 2MX2A 2ZPYA 2QMTA 2KXJA 2KX0A 4XX5A 3QAQA 2WU5B 1WGHA 1V5OA 5TSSA 3C0RB 3IAS1 2D3AA 1L0YB 1KLUD 4BOSC 2HTME 4RGNA 4HPLB 1E7UA 4G11A 4M8NA 4GLSC 2WP9B 3P4RB 2KWVB 4FJYA 3PRMB 3L10B 5MPOA 1DGJA 1C4PA 3B2GA 3O65B 3QARA 4R3DA 1NDDA 4LK0M 3PVLA 3Q2AC 1X1MA 1TZOA 2WX0A 1YQ3B 2K3UA 2KNBA 3OG5A 1PFDA 3APDA 1QQRA 1WF9A 3HUIA 4PYUA 2XK5A 1ET9A 3SDLC 3ZKJC 3V61A 1ZUD2 3HRDD 2WWZA 1D5ZC 5G5HA 5BMGA 2W3RA 3BVMA 3MJWA 3PRZA 3CSFA 1GUAB 2NCNA 2A4ZA 2IBIB 4XDCA 4IWPA 3Q3FA 1OTRB 3W2DA 3DVNU 4KGRA 2CS4A 2J0JA 3WIMA 3U7ZA 4ZYSA 3SU8X 4ZRQA 3P42A 4WJPA 2JWZA 3K9PB 4M00A 1YN3A 4W9LA 3JSVB 2IO0B 1D4BA 3I57A 3JVZX 3MJ5A 3L08A 5C1ZA 3U2SC 3DBHB 2B3AA 3ZNID 2HE7A 1JQ4A 2NPTA 2ZJDA 4CO7A 3ZO5B 2KTRB 3AE8B 2BT6A 2IGDA 4TMAB 1K50A 3CWIA 4K81A 4HROA 4OW0A 1TS2A 3NVWA 2D10A 1RRBA 2J52A 3L4PA 4M02A 1M94A 1RWSA 2EKEC 1ZDVA 4K3CA 5HKHA 3AM9A 4AS1A 5D6JB 2LUEA 3WALA 1JMLA 5CHVC 4A3OA 3VDZA 1SB3C 3RFZB 2KLCA 1WX8A 2K0PA 2CU3A 5E6NA 2IGGA 3QC8B 4E71A 1E90A 1C4CA 2A5UA 4ZRIA 1RYJA 2R2OA 1E8YA 2KFJA 2KN4A 1MI0A 2PE6B 4YWGG 4GIVA 3RULA 2FCQA 1JWUD 2JT4B 1EO6A 2DENB 2KYWA 1VRAB 2L32A 1KTKA 2K5PA 3NG0A 4LNNA 3A4RA 3W1YA 4LNOA 1JRPA 1T0YA 2I1JA 4KGSA 3KLSX 2Z59B 3Q6BA 4ARIA 1XEEA 4HEA1 4KSLC 1YQ4B 5C3JB 3IXSA 5G55A 2J0MA 2AQ2B 3R3MA 3DBRI 4ZRPA 3J9CA 4FADA 3WCQA 3NZ3A 1WX9A 2KDBA 1IYFA 1VLBA 1XF5L 4B6WA 2UYZB 3BVGA 4RF0A 4BFRA 1JROA 4PT5A 5EE0A 3B9JA 5IA7A 2QEJC 1P0RA 3VH3B 4ZRJA 2IO2B 1XCQL 4XGAB 2INNE 3NVYA 2GBKA 1L0XB 2K39A 1M4VA 1UNSA 2MJEA 3UI3A 3VVWB 1LM8B 5JXVA 4KDLB 2BKRB 2D11A 2LMCA 2JRHA 4K7WA 3BK1A 4WH4A 4B95A 3H6NA 1E8WA 1SBBB 1F2RI 2RPQA 4ZHPA 1RAXA 1E8ZA 3TEYA 2REXA 3VQIA 4WAAA 4MM3B 4E74A 3T3NA 3MC8A 3APFA 3N32A 1SGHA 2BF8B 2KMCA 2V4LA 5AUKA 4ZHOA 1K53A 5KHQA 3Q3OC 4OHJA 1EM7A 4ANXA 4GMVA 2YEPF 3RNGC 3KWVA 2D3CA 2CU1A 1V5TA 3BVZA 2RSUA 2J42A 4HCNB 1WJUA 4KSKC 3AEGB 1RFKA 1YMHE 3K9OB 1E9MA 2PMVA 4WAFA 1NBFC 4DHJD 2WXHA 2FIDA 4EOYA 3SEBA 4W9CA 2D3GA 3ZRFA 5EDSA 1WJ6A 4PYZA 1XO3A 3ZVVA 2GOWA 3TL5A 2FUHB 2WXLA 1K52A 1YJIA 5CTRC 1EF1A 2INCC 2WLBA 2WXJA 3EECA 2OJRA 1WRDB 3VTUA 4MH0E 2N9EB 2YVCA 5BMIA 1T3QA 1Y56A 5BYSA 1YX6B 3HK0A 3IAM1 1T5XD 4KZ0A 1JWMD 1TS5A 4HDQA 1JRUA 2HDEA 1SIJA 4NAMA 4GU2A 3BYYB 3C19A 2LEKA 4ANWA 2LJIA 1YX5B 3QA8A 5DPRA 2C9WB 2L3ZA 3AMZA 2KVRA 1FNWA 3VR8B 1SXTA 3B2FA 1WZ0A 2OOBB 5JZEB 2B76B 2FCNA 3WANA 1WXQA 1EWCA 3AEDB 4MJSB 2KDMA 3FILA 1TY2A 2LRWA 1P98A 5HG2A 1P7EA 4RGOS 3V6CB 3GP7A 1NVID 2IY1B 2LHEA 1E7VA 1C78A 2W54A 2FBWB 3VR9B 1SJED 4ACFA 2HJ8A 2G45B 2KMAA 3PSEB 1IUEA 1SJHD 3MC9A 4HXDA 4WWMA 3L13A 4URKA 3WA0A 2JZ3B 2DAFA 2GBJA 2LGYA 2OEDA 4L1BA 4DDID 4GOCA 1ZGUB 3IVFA 1UH6A 2KC2A 2JY6A 3PS6A 3MHZA 4S0RA 2NBVB 1UWXA 1Q10A 2KO3A 3SR6A 2EELA 1TIFA 2K1FA 1K8RB 4OVVA 2ZVOA 3R7QA 2KDIA 2C60A 1WY8A 2ZZPB 5LXIB 4IM2A 1KFYB 2XK5B 3BY4B 1G6JA 3Q8AA 3PZ8A 2RR9A 3KYDD 2DBYA 1WWTA 5EE3A 1XQQA 3NJTA 4BKTA 1DOXA 2DZJA 1C1YB 3P63A 3ZLZA 1XLOA 1TGZB 1OFFA 2BVCA 4TSSA 2V0GA 4BZAA 2JX5A 1EF5A 2PLPA 1FRRA 2KDFB 3ZJVA 4II2B 1QLBB 4P6VF 1Q1OA 1FMAD 2INDC 1FFUA 3DVGY 4DHZB 1V97A 3DHIC 1WXVA 3AU4A 3EUB2 1ZXHA 2DZMA 2N9PC 2GBMA 4RFBA 3AE6B 1WSPA 1ZPSA 2V4IB 4HKQA 2PJHA 2W9NA 4BBNC 4AJWA 4J3OD 4IKGA 4F8CB 1KLGD 1XLQA 2NPTB 2MSED 5D94A 4UDUC 2KMMA 4WWPA 2BKFA 4HRSA 3EFCA 2C7MB 5TR5A 2GMIC 2N7JA 2WX1A 4MH8A 4REZA 1BXTA 3DBLI 3R8BA 3RNAC 4KKJA 1I4RA 1YJJA 3U30A 1MG4A 2EMSA 2AL6A 2MBQA 4GB9A 2K9XA 1B1ZA 1Q0WB 2MP2B 2VZKD 1TTNA 1UBQA 4IDIA 5IP4D 5E6PA 1E6EB 4LNFA 2D2QA 4DXFA 1QOAA 1XT9B 2IY0B 1YQBA 3TEWA 1N61A 4EFOA 4A9AA 4LJPB 3V62A 3W5VB 1ESFA 1E5WA 1I4HA 1N6ZA 4RGTA 1UBIA 4NJCA 1I4PA 2WQYB 1YN5A 2KX3A 2LUMA 4P16A 2OHFA 1IBXB 3RNBC 3V6EB 1MG8A 2CKHB 2WDRB 4RNAA 1N5WA 4FN2A 2JSVX 1GPXA 3ECIA 4YSYB 2IO3B 2KWDA 3VFKA 3P1MA 2KVZA 3AEBB 3RZWC 2QIEB 4LDTD 4JQWC 4MJSA 2ON8A 2XBBC 4OZBA 4K3BA 4KZCA 3U52E 3N9YC 2Y5PA 4MT5A 4FLHA 1J19A 3IG3A 4XZ4A 3UGBB 2SAKA 3DVNV 3SFEB 2DZIA 5FK9C 3R7RA 2IPKD 2RMMA 2BS3B 3DBRB 3KW5B 2NVUI 5J2RA 3AV8A 3QK0A 2BYTA 1D6EC 2Z8LA 5BYRA 4FJZA 2L0FA 2QILA 4IM3A 4MACA 3AN1A 1GAQB 2KJRA 3B0AA 2V3PA 2OJWA 1E10A 3AE4B 4IWQA 3PTFC 4RM8A 5HHDG 2ASQA 3NUHB 1QOGA 1SSNA 2WXPA 4EZKA 4W9GA 3T9LA 2K6DB 1MFWA 2LXCA 2NTTA 4C7YA 5HFYA 4DXGA 4IWOA 1WGKA 4MGIE 1AWDA 1OGWA 1I4XA 2N1WA 2WYQA 3NZSA 3T8MA 2V3SA 3MTNB 2PVGC 4JWSC 5D2MB 4G0NB 4I6NB 5FR6A 2K22A 3W1SA 1T0SC 2FUG1 2H88B 1GOZA 4CYEA 2DLBA 1SF0A 2KKCA 4RM9A 2LRUA 2DHZA 2N9LA 3H7PB 2Q5WD 2WNMA 3LB8C 1LGRA 4JPSA 3PT2B 4FBJB 1C4AA 3ZNGC 2XEWA 3I3TB 2BBCA 3U7DA 2LASA 2KAJA 1GNUA 2M17A 4KX6B 2YEPB 2E3TA 3E9SA 3QCAA 1VCBA 1V86A 1HE8A 3EFUA 2AX5A 4OVUA 2IZVB 4RMAA 1MHXA 4WQOB 3EA6A 5LXHA 4KDIC 3WAMA 1FNVA 1NENB 4RGMA 1FCCC 3RZFA 4PK1A 1HTOA 2N1VA 1UWMA 3A1QB 3UQBA 2DZKA 5DCNA 1P7FA 4S17A 3FILB 2KTFA 3L17A 1GG3A 5L83A 1HZ5A 3EHVA 3TJPA 3VRBB 2MP2A 5D3DA 3QWZB 3GZNI 3SFDB 4HJGE 4MSQB 1ZP0B 3ZXRA 4OZAA 3I63C 3Q8CA 2H89B 3GOEA 2I38A 1EWYC 1H8CA 2L05A 4N58A 1TS3A 1QOBA 4NAWB 5GXGB 3R66C 4LNIA 4FHJA 4MEMA 1D5XC 1L7YA 2ZW0A 1CZPA 1KF6B 2NBUA 1OEYJ 3L16A 2O6VA 3BINA 3M3JA 1OQRA 2UU7A 3OJ3A 3RMKC 1ZE3D 3UIPB 1OQQA 3BWUD 1IBXA 3VH4B 4RH6A 4AP4C 1VZ8A 4EEWA 1WYGA 1J8CA 3PGEA 1SEBD 1LO5D 3ZDTA 2MWSB 2QDFA 3KH0A 3O13A 2WXFA 3NY5A 2MBOA 4JL9A 1QILA 1SE9A 2VRRB 1DYQA 3NHEB 3P4SB 4D2KA 5JH5C 2EMTA 3DQVA 1NI3A 5BMHA 1NYRA 4GGQA 4FA6A 5E6OA 2NTSA 2L00B 5GMVA 4C7ZA 2JZPA 2Y3AA 1YOVB 1V80A 4NPNA 2ZPNA 5H8YE 3RUIB 4PS7A 1HEZE 2M0AA 3ZIMA 3W1SC 1SIFA 4AUQC 1F77A 1C79A 2ZVNA 2BYEA 4LJOB 3AI5A 2JZZA 4A55A 3P2BA 1XD3B 3A9KB 3AE1B 3X0WA 3UF8A 1FFVA 1WIAA 5CHWA 3I5JC 2HJ1A 4NZLB 4EE2A 1JWBD 1PDXA 5IO9A 4TV3A 1A70A 1A5RA 2PPHA 4GSWA 5KHOA 2MEKA 3N1YC 1HZ6A 4H2AA 5C23A 2C5LC 2WXGA 4CHKA 2K8BA 1U4AA 3PHXB 1ISNA 3VAWA 2W3SA 4YTMB 1EUVB 3QQ8B 3NS8A 1SE2A 3R2TA 4TUUA 2WDVB 3U4EG 3VUXA 3N1ZC 3Q8EA 3Q14C 2M1MA 4MSMB 4RCOA 1Q5WB 3H7PA 1WZ3A 3VTVA 1UZXB 2MBHA 3QHTA 1J7CA 1VZ7A 2PE9A 4WJOA 5EE9A 3GE8C 3IFWB 3V60A 3ONSA 2WXQA 1WXMA 2BB6A 4YL8A 3PO0A 4NQLB 1KM7A 1SE3A 4N59A 3OJ4B 1L6UA 2WS3B 4LCDE 2KJHB 1F9JA 4MGZE 3DBLB 2JU6X 2WXRA 4BKSD 2DYOA 1WR1A 1YNTE 1B9RA 2KQ4X 5AUIA 3AH7A 4HCPB 4W9FA 5DPTA 2MBEA 1FCLA 1TBEA 3FKYA 3PHWB 2IDYA 3PZDA 1PYWD 1CK1A 4M0WB 1K51A 2VH1A 1WGRA 1WE6A 4RF1A 1WRIA 2PVOD 4DXAB 5HI1A 5LNK1 4W9KA 2N9KA 3N3KB 2LVPA 3A1QA 3V3XA 1OEYA 2KD0A 2PKOA 1GB4A 4HVBA 3PV1A 3DPDA 4I6PA 4ICVA 3CMMB 3VTWA 1L4DB 1C9FA 4LLGM 4TQ0A 1J7BA 2ZW1A 4NAWA 1CQVA 2KWUB 5AZHA 2ZCCA 1FRDA 3P4PB 4KGTA 4HWIB 2L83A 4DDGD 3AE7B 3MHSD 2KJ6A 2I2YA 3OLMD 3KUCB 1F0ZA 1XLNA 3NVZA 1YIWA 5JHBA 1AARA 3H9DA 1V1PB 4MGYE 1PGBA 2JXTA 2LGXA 2ZNVB 2DAJA 1ZXIA 2V3NA 1JCKB 3ZTCA 4A90A 3W9CB 4ITKA 3ETRA 2DWQA 4C4VB 2G4DB 3ZRCA 1ZW7A 1QKZA 2Y5BB 4FXCA 1FIQA 2CJNA 2AQ1B 1WGYA 1S1QB 3R2IA 1ZDXA 2FCMA 2LWPA 4DBGA 1FNUA 1L5PA 3NZUA 3Q8BA 3HM6X 1WGGA 3U8ZA 1F2RC 3V05A 2RDBC 2ZEQA 3TBLD 2KWCA 3D32A 2Z0EB 4G3XB 1VZ6A 4G50A 1L4ZB 4PS3A 3DVGX 4A6QA 2JUOA 1WM3A 4P1CC 4W9DA 5T8IA 1ROEA 1Y8RC 3RD2A 2WXNA 3H1UA 2CHXA 2LGDA 4FHKA 1HTQA 3A9KA 2BS2B 5DPWA 4XC2A 3I9V1 2KQSA 3ZJUA 3RCZA 4BOZB 2WDQB 4MELA 4W9IA 3Q3NC 2LGIA 3AEAB 2NMQA 4EKUA 1I4QA 3ABVB 1L2NA 4ZDVA 1FXAA 5FR3A 2M8SA 4J6IA 1YN4A 2PIAA 4FULA 4NJ6A 2L0TA 2KZRA 5BO4B 1GC7A 3HIZA 1C76A 1IGDA 5G2NA 3N20C 2CHWA 1Z5SB 1EU4A 3CIRB 3DOWA 3A33B 1Z2MA 3NVVA 4WQMA 4BVUC 4CQNA 1N60A 4F1SA 2ICIA 4ANVA 1WXAA 4HK2A 1QZEA 3RNCC 1R4NI 3C8YA 2BYVE 1WE7A 2C7NB 3RYTA 2YLMA 3AE3B 2O6VB 1T0RC 1STEA 3HHMA 1QOFA 4JIOU 1GB1A 1WJNA 5G5GA 2BGFA 2O2VB 2RD0A 1RLFA 3GZNB 4HJKA 4M0WA 1ZKHA 2KT7A 1DOYA 3FAHA 3KQ4A 2MBBB 4ZYNA 1AN8A 1UUPA 5IN7A 4YT0B 2KN5A 1UGJA 2GLSA 5D3IB 3ALBA 4WJQA 3NOBA 1XLPA 2RPVA 4B0EA 3AU5A 2GRIA 2MW5A 3SD5A 1D5MC 2L76A 3X23A 1ET6A 2LD9A 5J17A 2M4NA 3IT4B 3OAWA 2GI9A 2LHDA 3KUZA 4US9A 1AYFA 3DCGA 4I6LB 2JQRB 4P7IA 2JXXA 4NY0A 5AEKB 3B1LX 2G1EA 3LDZE 1FXIA 2PTLA 4B0MA 1TYGB 2QHOA 1TS4A 4IC7B 2AEHA 1XCTL 2MQJA 4OZCA 1V1PA 1FD6A 4NQKE 1YJ1A 5AZFA 1VDVA 5C2TB 3N30A 1KRHA 2KHWB 4C4VA 3ZJTA 4L2YA 3BK2A 4N6EB 3M62B 3KUDB 4AOFA 2MHJA 1T6BX 3AE9B 2EKIA 5E6JA 2M0XA 4M8MA 3AEEB 1IP9A 1F1HA 3PRPB 2XN9C 1P3QU 3JW0X 2CR5A 4AWJA 3T3OA 3ZNZB 5D7GA 4LTUA 2WXMA 1NEKB 3IBEA 4XYCA 2FCSA 3JYUA 4HKZE 3VHTC 1LFDA 2CJOA 2LI5A 2DYMA 3TCAA 1RM6C 1WGDA 3SHQA 3GE3C 4JLCA 1YD8U 1HXYD 3DHHC 1TZ1A 2TSSA 1WI0A 2BTEA 4P1BC 2X8XX 5LLIA 4JWUC 3BZDB 2BS4B 4TQ1A 3AXCA 2DYBA 3DWGC 2LXAA 3Q8FA 4GDKB 4HPMB 1PGXA 1BUIC 2KANA 1HQRD 3UINB 2FAZA 1JW9D 3QIJA 2C7HA 5CHFA 4A8XC 1E8XA 4DHZE
chains in the Genus database with same CATH topology
3C0RB 1Q1OA 1WX7A 4WJOA 3A4SC 3IFWB 2JRIB 3V60A 1V6EA 3ONSA 1WXMA 3DVGY 4YL8A 4DHZB 4BOSC 4NQLB 1WXVA 3AU4A 1KM7A 3OJ4B 4LCDE 2DZMA 2KJHB 2N9PC 1F9JA 2GBMA 4MGZE 1V2YA 5J18A 4W9JA 4HPLB 4BKSD 2DYOA 1R4MI 4EUTA 2PJHA 1E7UA 2W9NA 4BBNC 1WR1A 4AJWA 4G11A 3PPAA 4M8NA 4WWOA 2O2VA 3B08A 3M95A 4F8CB 4HCPB 2NPTB 2KWVB 4FJYA 4W9FA 5DPTA 3PRMB 3L10B 3PREA 2MBEA 2MSED 5D94A 1TBEA 3PHWB 2FNJB 3O65B 3QARA 4WWPA 2BKFA 3PZDA 2N9XA 4M0WB 1WYWB 1NDDA 1WGRA 2C7MB 5TR5A 1WE6A 2GMIC 2WX1A 3PVLA 4DXAB 1X1MA 2WX0A 4W9KA 3N3KB 3DBLI 2LVPA 3HM3A 5DPSA 2KNBA 4ANUA 3A1QA 1OEYA 1V49A 2KD0A 4FJVB 3APDA 4K1RB 2KK8A 2ZNVC 1WF9A 4PYUA 2XK5A 4HVBA 3U30A 3SDLC 2EMSA 3ZKJC 2AL6A 3V61A 4KIKB 3A9JA 2MBQA 3PV1A 2J0KA 3DPDA 4I6PA 2WWZA 4GB9A 4ICVA 3VUYA 3CMMB 3VTWA 1Q0WB 2MP2B 3MJWA 3PRZA 3CSFA 2ZCBA 4K7UA 1GUAB 2NCNA 2A4ZA 2IBIB 4TQ0A 1TTNA 2V1YA 1WXSA 1UBQA 4IWPA 1WR6E 3Q3FA 4NNJB 1OTRB 3DVNU 2CS4A 2J0JA 5E6PA 4NAWA 3WIMA 2D2QA 2KWUB 3ML8A 5AZHA 2AWTA 4F7ZA 3SU8X 3RT3B 2JF5A 4WJPA 1XT9B 2ZCCA 2JWZA 3K9PB 1J0GA 2N4FA 4HWIB 4KVGB 2IY0B 4DDGD 1YQBA 3JSVB 4W9LA 3MHSD 2IO0B 5IAAC 2KJ6A 4EFOA 4EZJA 4DK5A 4LJPB 3JVZX 3V62A 3OLMD 3KUCB 1KOTA 4BBNF 4TKNA 1E5WA 4ZRKA 1YIWA 2HD5B 2CHZA 5JHBA 3L08A 1AARA 5C1ZA 3H9DA 4MGYE 1UBIA 2B3AA 3ZNID 2HE7A 2LGXA 2NPTA 2ZJDA 2KX3A 2ZNVB 3H7SA 4CO7A 4DHJB 3ZO5B 2DAJA 2KTRB 1IPGA 3V6EB 1MG8A 4K81A 2CKHB 2JPHA 3ZTCA 3QJZA 3EC8A 4FN2A 2DX5B 2D10A 3ECIA 4II3B 2G4DB 3ZRCA 1RRBA 2IO3B 2N7DA 3VFKA 1ZW7A 2Y5BB 1M94A 2EKEC 2BWES 5HKHA 2LVOA 3RZWC 1WGYA 3L54A 5D6JB 2GBNA 2LUEA 3TMPB 3WALA 5CHVC 4LDTD 3VDZA 4JQWC 4MJSA 4A3OA 1S1QB 2XBBC 1NI2A 2FCMA 2LWPA 2KLCA 4DBGA 1WX8A 4KZCA 3NZUA 2IYDB 4FLHA 5E6NA 1J19A 1UGMA 3DBHI 1WGGA 3HM6X 3IG3A 4XZ4A 3U8ZA 3UGBB 2L8JA 2K8CA 3DVNV 1WMHB 3QC8B 1E90A 2DZIA 4GDLB 4E71A 2ZEQA 3TBLD 3VXWA 2A5UA 2KWCA 3D32A 4ZRIA 2Z0EB 2R2OA 3R7RA 1E8YA 1LXDA 2KFJA 4G3XB 2PE6B 4G50A 2K6QA 4GIVA 3RULA 2FCQA 4PS3A 3DVGX 3KW5B 4HDOA 2JT4B 2NVUI 2RGFA 5J2RA 1EO6A 2DENB 4DWFA 2JUOA 1WM3A 4W9DA 1KLVA 1Y8RC 3Q3JA 4GXBA 1V81A 1BT0A 2FIFA 3QK0A 3RD2A 3H1UA 2CHXA 2LGDA 3A4RA 3W1YA 4A20A 1KJTA 1T0YA 2I1JA 4FHKA 2J7QB 3A9KA 5DPWA 4XC2A 4MGKE 2Z59B 4FJZA 2L0FA 4WWNA 4IM3A 2KJRA 2KQSA 3B0AA 3RCZA 4BOZB 4KSLC 4MELA 4W9IA 4IWQA 4E3CA 4EZLA 3PTFC 4RM8A 3JSVA 2ASQA 2L7RA 5G55A 4EZKA 4W9GA 3T9LA 2J0MA 2N7EA 2K6DB 3DDCB 4EKUA 4IG7B 3ZTDA 2LXCA 2I1KA 3R3MA 2KFKB 3DBRI 4FADA 1L2NA 4IWOA 4ZDVA 1WX9A 2KDBA 4MGIE 1IYFA 4B6WA 2M8SA 4J6IA 2KTRA 1OGWA 2N1WA 2UYZB 4BFRA 4FULA 4WJNA 4NJ6A 2L0TA 5JHAA 2WYQA 3NZSA 5IA7A 2KZRA 3T8MA 5BO4B 1GC7A 2V3SA 3MTNB 3HIZA 2GBRA 5D2MB 3UQAA 4G0NB 4I6NB 1WM2A 2JVCA 1P0RA 5FR6A 4GDKA 3VH3B 5G2NA 4ZRJA 3W1SA 1WH3A 2IO2B 2CHWA 4CYEA 2GBKA 2K39A 1Z5SB 2KKCA 4RM9A 2Z0DB 2LRUA 2DHZA 4IW0A 3DOWA 3A33B 1PQSA 3VVWB 1LM8B 1Z2MA 3H7PB 4KDLB 3ZNHB 4ASWC 2BKRB 2D11A 4BVUC 2JRHA 4K7WA 3APCA 4F1SA 4B95A 2NBWB 3H6NA 2NR2A 4ANVA 1E8WA 3PT2B 1WXAA 4HK2A 1QZEA 1RFAA 3ZNGC 4FBJB 2XEWA 3WAPA 3I3TB 2RPQA 1R4NI 1RAXA 1E8ZA 2BWFA 2LASA 3U7DA 1I35A 1GNUA 2M17A 2BYVE 1WE7A 2C7NB 3RYTA 3L0WB 2YLMA 1WFYA 2REXA 3UIOB 3VQIA 3QCAA 1VCBA 1V86A 2O6VB 4WAAA 1HE8A 4E74A 1V9JA 3EFUA 3HHMA 4OVUA 3APFA 3N32A 4A3PA 1SGHA 2BF8B 2IZVB 2KMCA 2V4LA 4JIOU 5KHQA 1WJNA 4RMAA 3CSTA 2BGFA 2O2VB 2RD0A 4WQOB 1RLFA 4HLEA 4ANXA 3VUWA 4HJKA 4GMVA 5LXHA 1ZKHA 4KDIC 3WAMA 4B9KA 4PS8A 2MBBB 4ZYNA 4NJ7A 2CU1A 1V5TA 3ZUNA 2KN5A 3RZFA 5AZGA 4K7SA 2K25A 3WAOA 2RSUA 3AULA 4HCNB 1WJUA 3ALBA 4KSKC 2N1VA 4WJQA 3NOBA 3A1QB 3UQBA 2DZKA 5DCNA 3AU5A 3K9OB 1NBFC 2KTFA 2LVQA 4KIKA 5L95C 3L17A 4DHJD 1GG3A 2MW5A 3SD5A 5L83A 2FIDA 4EOYA 3TIXA 3EHVA 2L76A 4W9CA 3TJPA 3X23A 2D3GA 2MP2A 3ZRFA 2LD9A 3QWZB 5EDSA 3GZNI 5J17A 4MSQB 3IHPC 1WJ6A 4PYZA 2M4NA 3ZVVA 2GOWA 3OAWA 3TL5A 2FUHB 3GOEA 3ZW3A 3M63B 3S2AA 3KUZA 2AYOB 4IM0A 4N9F4 3DCGA 4I6LB 5CTRC 1H8CA 1EF1A 2MRPA 2L05A 3EECA 2OJRA 1WRDB 4W9HA 2PEAA 3VTUA 4MH0E 2BYFA 4P7IA 2JXXA 4NY0A 5AEKB 3B1LX 3LDZE 4NAWB 2N9EB 2YVCA 3R66C 2KQ7A 1GJZA 1YX6B 2AL3A 4FHJA 3HK0A 4JGHB 4MEMA 1L7YA 2KC1A 2QHOA 4KZ0A 4IC7B 1UD7A 2AEHA 2NBUA 1OEYJ 3CF6E 3L16A 4HDQA 2O6VA 1JRUA 3BINA 4MM3A 3M3JA 4GU2A 2MQJA 3QX1A 4W9EA 3OJ3A 3UIPB 4IUMB 4NQKE 1YJ1A 5AZFA 4ANWA 3VH4B 4AP4C 4EEWA 2IO1B 2MLBA 1YX5B 3QA8A 5DPRA 1J8CA 3N30A 1LQBA 3PGEA 2C9WB 2KHWB 2L3ZA 2KVRA 3ZDTA 2MWSB 3KH0A 4KV2A 3NY5A 3M62B 1WZ0A 2MBOA 4JL9A 3KUDB 2OOBB 4BKGA 4AOFA 1SE9A 5JZEB 2VRRB 5JH5C 3NHEB 2FCNA 2EMTA 3DQVA 1VD2A 3WANA 3PLVA 4MDKE 4GGQA 5CX3A 2M0XA 4FA6A 4M8MA 1IP9A 4MJSB 5E6OA 3PRPB 1C3TA 2L00B 2LRWA 5GMVA 1P98A 1WMHA 1P3QU 3JW0X 4GDLA 2CR5A 4AWJA 1V80A 3V6CB 4NPNA 2ZPNA 3RUIB 3ZNZB 4BKSA 5D7GA 2LZ6A 4PS7A 2K8HA 1I42A 2G4SA 2IY1B 3IBEA 1E7VA 3ZIMA 2UWQA 3W1SC 1SIFA 2D07B 4AUQC 2FCSA 2ZVNA 1P9DU 2BYEA 1D3ZA 4LJOB 3JYUA 2HJ8A 3VHTC 1LFDA 2LI5A 2G45B 2DYMA 2KMAA 3DBSA 3TCAA 3AI5A 2JZZA 3PSEB 3P2BA 1XD3B 3A9KB 4HXDA 3PLUA 1WGDA 3ENEA 3L13A 3SHQA 4URKA 3X0WA 1UELA 3WA0A 3UF8A 2JZ3B 3ZDMC 2DAFA 2GBJA 2LGYA 2KLGA 1WIAA 1S3SG 4ICUA 4JLCA 4DDID 4GOCA 5CHWA 2BPSA 1ZGUB 1YD8U 2KFKA 1TZ1A 1UH6A 3IVFA 2KC2A 2JY6A 4GN1A 4LDTB 4TV3A 3PS6A 3LJ3A 1FXTB 2NBVB 2KO3A 1WI0A 2LJ5A 4X57B 2KDEB 1A5RA 2PPHA 2K1FA 4GSWA 1K8RB 2NS5A 4OVVA 5KHOA 2ZVOA 5LLIA 5C23A 3R7QA 2KDIA 2C5LC 2C60A 1P1AA 2R2QA 1WY8A 2ZZPB 4CHKA 2K8BA 5LXIB 1U4AA 2O6VD 3PHXB 4IM2A 3KVFB 2HTHA 1ISNA 2KOXA 1OQYA 3VAWA 4TQ1A 1WJ4A 2G3QB 3AXCA 2XK5B 2MCNB 2DYBA 3BY4B 4AJYB 1G6JA 1GC6A 2RR9A 1H4RA 3KYDD 1EUVB 2LXAA 3QQ8B 3NS8A 4GDKB 3A9JB 4TUUA 4HPMB 1XQQA 4BKTA 2WDTB 2DZJA 3VUXA 1C1YB 3ML9A 3ZLZA 2KANA 3KYCD 2M1MA 1TGZB 4MSMB 1Q5WB 1CMXB 3H7PA 3UINB 2MA9B 1WZ3A 2FAZA 3VTVA 2MX2A 2ZPYA 2KXJA 1UZXB 3QIJA 2KX0A 1EF5A 2C7HA 2MBHA 3QHTA 3QAQA 5CHFA 4XX5A 2KDFB 1E8XA 1WGHA 2PE9A 4II2B 1V5OA 4DHZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0R B;  1Q1O A;  1WX7 A;  4WJO A;  3A4S C;  3IFW B;  2JRI B;  3V60 A;  1V6E A;  3ONS A;  1WXM A;  3DVG Y;  4YL8 A;  4DHZ B;  4BOS C;  4NQL B;  1WXV A;  3AU4 A;  1KM7 A;  3OJ4 B;  4LCD E;  2DZM A;  2KJH B;  2N9P C;  1F9J A;  2GBM A;  4MGZ E;  1V2Y A;  5J18 A;  4W9J A;  4HPL B;  4BKS D;  2DYO A;  1R4M I;  4EUT A;  2PJH A;  1E7U A;  2W9N A;  4BBN C;  1WR1 A;  4AJW A;  4G11 A;  3PPA A;  4M8N A;  4WWO A;  2O2V A;  3B08 A;  3M95 A;  4F8C B;  4HCP B;  2NPT B;  2KWV B;  4FJY A;  4W9F A;  5DPT A;  3PRM B;  3L10 B;  3PRE A;  2MBE A;  2MSE D;  5D94 A;  1TBE A;  3PHW B;  2FNJ B;  3O65 B;  3QAR A;  4WWP A;  2BKF A;  3PZD A;  2N9X A;  4M0W B;  1WYW B;  1NDD A;  1WGR A;  2C7M B;  5TR5 A;  1WE6 A;  2GMI C;  2WX1 A;  3PVL A;  4DXA B;  1X1M A;  2WX0 A;  4W9K A;  3N3K B;  3DBL I;  2LVP A;  3HM3 A;  5DPS A;  2KNB A;  4ANU A;  3A1Q A;  1OEY A;  1V49 A;  2KD0 A;  4FJV B;  3APD A;  4K1R B;  2KK8 A;  2ZNV C;  1WF9 A;  4PYU A;  2XK5 A;  4HVB A;  3U30 A;  3SDL C;  2EMS A;  3ZKJ C;  2AL6 A;  3V61 A;  4KIK B;  3A9J A;  2MBQ A;  3PV1 A;  2J0K A;  3DPD A;  4I6P A;  2WWZ A;  4GB9 A;  4ICV A;  3VUY A;  3CMM B;  3VTW A;  1Q0W B;  2MP2 B;  3MJW A;  3PRZ A;  3CSF A;  2ZCB A;  4K7U A;  1GUA B;  2NCN A;  2A4Z A;  2IBI B;  4TQ0 A;  1TTN A;  2V1Y A;  1WXS A;  1UBQ A;  4IWP A;  1WR6 E;  3Q3F A;  4NNJ B;  1OTR B;  3DVN U;  2CS4 A;  2J0J A;  5E6P A;  4NAW A;  3WIM A;  2D2Q A;  2KWU B;  3ML8 A;  5AZH A;  2AWT A;  4F7Z A;  3SU8 X;  3RT3 B;  2JF5 A;  4WJP A;  1XT9 B;  2ZCC A;  2JWZ A;  3K9P B;  1J0G A;  2N4F A;  4HWI B;  4KVG B;  2IY0 B;  4DDG D;  1YQB A;  3JSV B;  4W9L A;  3MHS D;  2IO0 B;  5IAA C;  2KJ6 A;  4EFO A;  4EZJ A;  4DK5 A;  4LJP B;  3JVZ X;  3V62 A;  3OLM D;  3KUC B;  1KOT A;  4BBN F;  4TKN A;  1E5W A;  4ZRK A;  1YIW A;  2HD5 B;  2CHZ A;  5JHB A;  3L08 A;  1AAR A;  5C1Z A;  3H9D A;  4MGY E;  1UBI A;  2B3A A;  3ZNI D;  2HE7 A;  2LGX A;  2NPT A;  2ZJD A;  2KX3 A;  2ZNV B;  3H7S A;  4CO7 A;  4DHJ B;  3ZO5 B;  2DAJ A;  2KTR B;  1IPG A;  3V6E B;  1MG8 A;  4K81 A;  2CKH B;  2JPH A;  3ZTC A;  3QJZ A;  3EC8 A;  4FN2 A;  2DX5 B;  2D10 A;  3ECI A;  4II3 B;  2G4D B;  3ZRC A;  1RRB A;  2IO3 B;  2N7D A;  3VFK A;  1ZW7 A;  2Y5B B;  1M94 A;  2EKE C;  2BWE S;  5HKH A;  2LVO A;  3RZW C;  1WGY A;  3L54 A;  5D6J B;  2GBN A;  2LUE A;  3TMP B;  3WAL A;  5CHV C;  4LDT D;  3VDZ A;  4JQW C;  4MJS A;  4A3O A;  1S1Q B;  2XBB C;  1NI2 A;  2FCM A;  2LWP A;  2KLC A;  4DBG A;  1WX8 A;  4KZC A;  3NZU A;  2IYD B;  4FLH A;  5E6N A;  1J19 A;  1UGM A;  3DBH I;  1WGG A;  3HM6 X;  3IG3 A;  4XZ4 A;  3U8Z A;  3UGB B;  2L8J A;  2K8C A;  3DVN V;  1WMH B;  3QC8 B;  1E90 A;  2DZI A;  4GDL B;  4E71 A;  2ZEQ A;  3TBL D;  3VXW A;  2A5U A;  2KWC A;  3D32 A;  4ZRI A;  2Z0E B;  2R2O A;  3R7R A;  1E8Y A;  1LXD A;  2KFJ A;  4G3X B;  2PE6 B;  4G50 A;  2K6Q A;  4GIV A;  3RUL A;  2FCQ A;  4PS3 A;  3DVG X;  3KW5 B;  4HDO A;  2JT4 B;  2NVU I;  2RGF A;  5J2R A;  1EO6 A;  2DEN B;  4DWF A;  2JUO A;  1WM3 A;  4W9D A;  1KLV A;  1Y8R C;  3Q3J A;  4GXB A;  1V81 A;  1BT0 A;  2FIF A;  3QK0 A;  3RD2 A;  3H1U A;  2CHX A;  2LGD A;  3A4R A;  3W1Y A;  4A20 A;  1KJT A;  1T0Y A;  2I1J A;  4FHK A;  2J7Q B;  3A9K A;  5DPW A;  4XC2 A;  4MGK E;  2Z59 B;  4FJZ A;  2L0F A;  4WWN A;  4IM3 A;  2KJR A;  2KQS A;  3B0A A;  3RCZ A;  4BOZ B;  4KSL C;  4MEL A;  4W9I A;  4IWQ A;  4E3C A;  4EZL A;  3PTF C;  4RM8 A;  3JSV A;  2ASQ A;  2L7R A;  5G55 A;  4EZK A;  4W9G A;  3T9L A;  2J0M A;  2N7E A;  2K6D B;  3DDC B;  4EKU A;  4IG7 B;  3ZTD A;  2LXC A;  2I1K A;  3R3M A;  2KFK B;  3DBR I;  4FAD A;  1L2N A;  4IWO A;  4ZDV A;  1WX9 A;  2KDB A;  4MGI E;  1IYF A;  4B6W A;  2M8S A;  4J6I A;  2KTR A;  1OGW A;  2N1W A;  2UYZ B;  4BFR A;  4FUL A;  4WJN A;  4NJ6 A;  2L0T A;  5JHA A;  2WYQ A;  3NZS A;  5IA7 A;  2KZR A;  3T8M A;  5BO4 B;  1GC7 A;  2V3S A;  3MTN B;  3HIZ A;  2GBR A;  5D2M B;  3UQA A;  4G0N B;  4I6N B;  1WM2 A;  2JVC A;  1P0R A;  5FR6 A;  4GDK A;  3VH3 B;  5G2N A;  4ZRJ A;  3W1S A;  1WH3 A;  2IO2 B;  2CHW A;  4CYE A;  2GBK A;  2K39 A;  1Z5S B;  2KKC A;  4RM9 A;  2Z0D B;  2LRU A;  2DHZ A;  4IW0 A;  3DOW A;  3A33 B;  1PQS A;  3VVW B;  1LM8 B;  1Z2M A;  3H7P B;  4KDL B;  3ZNH B;  4ASW C;  2BKR B;  2D11 A;  4BVU C;  2JRH A;  4K7W A;  3APC A;  4F1S A;  4B95 A;  2NBW B;  3H6N A;  2NR2 A;  4ANV A;  1E8W A;  3PT2 B;  1WXA A;  4HK2 A;  1QZE A;  1RFA A;  3ZNG C;  4FBJ B;  2XEW A;  3WAP A;  3I3T B;  2RPQ A;  1R4N I;  1RAX A;  1E8Z A;  2BWF A;  2LAS A;  3U7D A;  1I35 A;  1GNU A;  2M17 A;  2BYV E;  1WE7 A;  2C7N B;  3RYT A;  3L0W B;  2YLM A;  1WFY A;  2REX A;  3UIO B;  3VQI A;  3QCA A;  1VCB A;  1V86 A;  2O6V B;  4WAA A;  1HE8 A;  4E74 A;  1V9J A;  3EFU A;  3HHM A;  4OVU A;  3APF A;  3N32 A;  4A3P A;  1SGH A;  2BF8 B;  2IZV B;  2KMC A;  2V4L A;  4JIO U;  5KHQ A;  1WJN A;  4RMA A;  3CST A;  2BGF A;  2O2V B;  2RD0 A;  4WQO B;  1RLF A;  4HLE A;  4ANX A;  3VUW A;  4HJK A;  4GMV A;  5LXH A;  1ZKH A;  4KDI C;  3WAM A;  4B9K A;  4PS8 A;  2MBB B;  4ZYN A;  4NJ7 A;  2CU1 A;  1V5T A;  3ZUN A;  2KN5 A;  3RZF A;  5AZG A;  4K7S A;  2K25 A;  3WAO A;  2RSU A;  3AUL A;  4HCN B;  1WJU A;  3ALB A;  4KSK C;  2N1V A;  4WJQ A;  3NOB A;  3A1Q B;  3UQB A;  2DZK A;  5DCN A;  3AU5 A;  3K9O B;  1NBF C;  2KTF A;  2LVQ A;  4KIK A;  5L95 C;  3L17 A;  4DHJ D;  1GG3 A;  2MW5 A;  3SD5 A;  5L83 A;  2FID A;  4EOY A;  3TIX A;  3EHV A;  2L76 A;  4W9C A;  3TJP A;  3X23 A;  2D3G A;  2MP2 A;  3ZRF A;  2LD9 A;  3QWZ B;  5EDS A;  3GZN I;  5J17 A;  4MSQ B;  3IHP C;  1WJ6 A;  4PYZ A;  2M4N A;  3ZVV A;  2GOW A;  3OAW A;  3TL5 A;  2FUH B;  3GOE A;  3ZW3 A;  3M63 B;  3S2A A;  3KUZ A;  2AYO B;  4IM0 A;  4N9F 4;  3DCG A;  4I6L B;  5CTR C;  1H8C A;  1EF1 A;  2MRP A;  2L05 A;  3EEC A;  2OJR A;  1WRD B;  4W9H A;  2PEA A;  3VTU A;  4MH0 E;  2BYF A;  4P7I A;  2JXX A;  4NY0 A;  5AEK B;  3B1L X;  3LDZ E;  4NAW B;  2N9E B;  2YVC A;  3R66 C;  2KQ7 A;  1GJZ A;  1YX6 B;  2AL3 A;  4FHJ A;  3HK0 A;  4JGH B;  4MEM A;  1L7Y A;  2KC1 A;  2QHO A;  4KZ0 A;  4IC7 B;  1UD7 A;  2AEH A;  2NBU A;  1OEY J;  3CF6 E;  3L16 A;  4HDQ A;  2O6V A;  1JRU A;  3BIN A;  4MM3 A;  3M3J A;  4GU2 A;  2MQJ A;  3QX1 A;  4W9E A;  3OJ3 A;  3UIP B;  4IUM B;  4NQK E;  1YJ1 A;  5AZF A;  4ANW A;  3VH4 B;  4AP4 C;  4EEW A;  2IO1 B;  2MLB A;  1YX5 B;  3QA8 A;  5DPR A;  1J8C A;  3N30 A;  1LQB A;  3PGE A;  2C9W B;  2KHW B;  2L3Z A;  2KVR A;  3ZDT A;  2MWS B;  3KH0 A;  4KV2 A;  3NY5 A;  3M62 B;  1WZ0 A;  2MBO A;  4JL9 A;  3KUD B;  2OOB B;  4BKG A;  4AOF A;  1SE9 A;  5JZE B;  2VRR B;  5JH5 C;  3NHE B;  2FCN A;  2EMT A;  3DQV A;  1VD2 A;  3WAN A;  3PLV A;  4MDK E;  4GGQ A;  5CX3 A;  2M0X A;  4FA6 A;  4M8M A;  1IP9 A;  4MJS B;  5E6O A;  3PRP B;  1C3T A;  2L00 B;  2LRW A;  5GMV A;  1P98 A;  1WMH A;  1P3Q U;  3JW0 X;  4GDL A;  2CR5 A;  4AWJ A;  1V80 A;  3V6C B;  4NPN A;  2ZPN A;  3RUI B;  3ZNZ B;  4BKS A;  5D7G A;  2LZ6 A;  4PS7 A;  2K8H A;  1I42 A;  2G4S A;  2IY1 B;  3IBE A;  1E7V A;  3ZIM A;  2UWQ A;  3W1S C;  1SIF A;  2D07 B;  4AUQ C;  2FCS A;  2ZVN A;  1P9D U;  2BYE A;  1D3Z A;  4LJO B;  3JYU A;  2HJ8 A;  3VHT C;  1LFD A;  2LI5 A;  2G45 B;  2DYM A;  2KMA A;  3DBS A;  3TCA A;  3AI5 A;  2JZZ A;  3PSE B;  3P2B A;  1XD3 B;  3A9K B;  4HXD A;  3PLU A;  1WGD A;  3ENE A;  3L13 A;  3SHQ A;  4URK A;  3X0W A;  1UEL A;  3WA0 A;  3UF8 A;  2JZ3 B;  3ZDM C;  2DAF A;  2GBJ A;  2LGY A;  2KLG A;  1WIA A;  1S3S G;  4ICU A;  4JLC A;  4DDI D;  4GOC A;  5CHW A;  2BPS A;  1ZGU B;  1YD8 U;  2KFK A;  1TZ1 A;  1UH6 A;  3IVF A;  2KC2 A;  2JY6 A;  4GN1 A;  4LDT B;  4TV3 A;  3PS6 A;  3LJ3 A;  1FXT B;  2NBV B;  2KO3 A;  1WI0 A;  2LJ5 A;  4X57 B;  2KDE B;  1A5R A;  2PPH A;  2K1F A;  4GSW A;  1K8R B;  2NS5 A;  4OVV A;  5KHO A;  2ZVO A;  5LLI A;  5C23 A;  3R7Q A;  2KDI A;  2C5L C;  2C60 A;  1P1A A;  2R2Q A;  1WY8 A;  2ZZP B;  4CHK A;  2K8B A;  5LXI B;  1U4A A;  2O6V D;  3PHX B;  4IM2 A;  3KVF B;  2HTH A;  1ISN A;  2KOX A;  1OQY A;  3VAW A;  4TQ1 A;  1WJ4 A;  2G3Q B;  3AXC A;  2XK5 B;  2MCN B;  2DYB A;  3BY4 B;  4AJY B;  1G6J A;  1GC6 A;  2RR9 A;  1H4R A;  3KYD D;  1EUV B;  2LXA A;  3QQ8 B;  3NS8 A;  4GDK B;  3A9J B;  4TUU A;  4HPM B;  1XQQ A;  4BKT A;  2WDT B;  2DZJ A;  3VUX A;  1C1Y B;  3ML9 A;  3ZLZ A;  2KAN A;  3KYC D;  2M1M A;  1TGZ B;  4MSM B;  1Q5W B;  1CMX B;  3H7P A;  3UIN B;  2MA9 B;  1WZ3 A;  2FAZ A;  3VTV A;  2MX2 A;  2ZPY A;  2KXJ A;  1UZX B;  3QIJ A;  2KX0 A;  1EF5 A;  2C7H A;  2MBH A;  3QHT A;  3QAQ A;  5CHF A;  4XX5 A;  2KDF B;  1E8X A;  1WGH A;  2PE9 A;  4II2 B;  1V5O A;  4DHZ E; 
#chains in the Genus database with same CATH topology
 1WX7 A;  1FM0 D;  3A4S C;  2JRI B;  1E0Z A;  1V6E A;  2W82 A;  2MH7 A;  2DNF A;  3IT6 B;  3N1X C;  2IGH A;  2L1A A;  1V2Y A;  5J18 A;  5IOI A;  4WIP A;  4W9J A;  1L6V A;  5H92 C;  1R4M I;  4EUT A;  1FO4 A;  1UF0 A;  3PPA A;  3PZ7 A;  4WWO A;  2O2V A;  3B08 A;  3M95 A;  1TKY A;  3TEZ A;  1FPY A;  4WUR A;  3PRE A;  2LGS A;  2FNJ B;  1TKE A;  2N9X A;  2INP E;  1R7S A;  1WYW B;  1I4G A;  1BML C;  3Q69 A;  3ZQ4 A;  3HM3 A;  5DPS A;  5FKA C;  4C80 A;  4ANU A;  1HA5 A;  1V49 A;  4FJV B;  4K1R B;  2KK8 A;  2ZNV C;  2QC8 A;  1QT9 A;  1CJE A;  4KIK B;  1VR9 A;  3A9J A;  1XXG A;  2J0K A;  2E6X A;  3VUY A;  2FE8 A;  2RDG A;  2ZCB A;  4K7U A;  2RDH A;  2V1Y A;  1TKG A;  1WXS A;  1WR6 E;  2QCZ A;  4NNJ B;  1E7P B;  3ML8 A;  3RN9 C;  1VJK A;  2AWT A;  4F7Z A;  1SE4 A;  3RT3 B;  3EGR A;  2JF5 A;  1J0G A;  3RNF C;  2N4F A;  4KVG B;  5IAA C;  1C77 A;  4EZJ A;  4DK5 A;  1T0Q C;  3KWL A;  1KOT A;  4BBN F;  4TKN A;  4ZRK A;  1ZOY B;  2J4X A;  2HD5 B;  2CHZ A;  1N62 A;  3H7S A;  4DHJ B;  1IPG A;  2V9H A;  2JPH A;  3QJZ A;  3EC8 A;  2DX5 B;  4II3 B;  2N7D A;  3RI7 C;  1N5X A;  4JX1 C;  5EE1 A;  2R61 A;  2BWE S;  2LVO A;  3L54 A;  2GBN A;  3TMP B;  4YTN B;  1NI2 A;  2W55 A;  2WHI A;  2IYD B;  1UGM A;  3DBH I;  2L8J A;  2K8C A;  1WMH B;  4GDL B;  3VXW A;  3P4Q B;  1LXD A;  3TEX A;  2K6Q A;  4HDO A;  2X38 A;  2RGF A;  2Y5C A;  1KLV A;  3ZGZ A;  4DWF A;  3AEF B;  3Q3J A;  4GXB A;  1V81 A;  1BT0 A;  2FIF A;  4A20 A;  1KJT A;  1JAL A;  2J7Q B;  4M01 A;  4MGK E;  4WWN A;  4E3C A;  4EZL A;  1TY0 A;  1ACC A;  3MP9 A;  3JSV A;  2L7R A;  4YSX B;  2N7E A;  3DDC B;  4IG7 B;  3ZTD A;  3HVZ A;  2I1K A;  2KFK B;  4C00 A;  2KTR A;  4HPP A;  4WJN A;  5JHA A;  2QJL A;  1IGC A;  2BW2 A;  5IKC M;  1R4N B;  2GBR A;  3UQA A;  3W5U B;  4YXD B;  2QSD A;  1WM2 A;  2JVC A;  4GDK A;  1V8C A;  1WH3 A;  2JWU A;  2GB1 A;  2MJ3 A;  2WU2 B;  2Z0D B;  4IW0 A;  4AQ7 A;  3MC0 B;  1PQS A;  2L52 A;  3MFG A;  3ZNH B;  4ASW C;  3AE5 B;  3APC A;  2NBW B;  2N0S B;  2NR2 A;  1RFA A;  3AEC B;  4YTP B;  3WAP A;  3H8H A;  2BWF A;  1F52 A;  1MHH E;  1I35 A;  3L0W B;  1WFY A;  3UIO B;  3VRA B;  1V9J A;  4A3P A;  4JE3 B;  3RNE C;  3CST A;  4HLE A;  3VUW A;  4B9K A;  4PS8 A;  4XE0 A;  2BQQ A;  1ENF A;  4NJ7 A;  3ZUN A;  1MPE A;  2PW9 A;  2KAC A;  5AZG A;  4XDD A;  4K7S A;  2K25 A;  3WAO A;  3AUL A;  3GS2 A;  4QAY A;  4USA A;  4C56 C;  4KIK A;  2LVQ A;  5L95 C;  4IOI E;  3TIX A;  3IHP C;  3ZXV A;  2WXK A;  3ZW3 A;  3M63 B;  3S2A A;  1NYQ A;  2AYO B;  4IM0 A;  4N9F 4;  1DOI A;  2MRP A;  3BII D;  4W9H A;  2PEA A;  4OVZ A;  3HVD A;  2BYF A;  1PUT A;  4XWW A;  1MJD A;  4LNK A;  2KQ7 A;  3OWE B;  3LXF A;  1GJZ A;  2AL3 A;  4JGH B;  1V1O A;  2KC1 A;  1JWA D;  1UD7 A;  3NS1 A;  2D5G A;  3URY A;  3CF6 E;  3TSS A;  2XNA C;  2SEB D;  4MM3 A;  3QX1 A;  4W9E A;  3DWM A;  1KH0 A;  4IUM B;  2G9H D;  3AB5 A;  2IO1 B;  2MLB A;  2LFI A;  3FC4 A;  1LQB A;  4ZOH C;  2M56 B;  4YSZ B;  4KKI A;  2JYE A;  2WGS A;  1N63 A;  2VZK B;  4KV2 A;  3GB1 A;  4BKG A;  2ONQ A;  1VD2 A;  3PLV A;  4MDK E;  5CX3 A;  5I4D A;  4O1N A;  4US8 A;  1TT5 B;  1L0V B;  1C3T A;  1WMH A;  4GDL A;  1J7A A;  4BKS A;  2LZ6 A;  2K8H A;  1EU3 A;  1I7H A;  1I42 A;  2G4S A;  2UWQ A;  2D07 B;  4BAX A;  3BYT B;  1P9D U;  3NRZ A;  3DHG C;  3ZYY X;  1D3Z A;  3TUO A;  2WXO A;  3Q3M C;  2J53 A;  3DBS A;  2M19 A;  3PLU A;  3ENE A;  1UEL A;  2WXI A;  3RPF C;  3ZDM C;  2KLG A;  4ICU A;  1S3S G;  2D3B A;  2BPS A;  1MVK A;  2KFK A;  1QF6 A;  4LDT B;  4GN1 A;  3LJ3 A;  2ACZ B;  1FXT B;  3LYY A;  2LJ5 A;  4Q2J A;  2KDE B;  4X57 B;  2NS5 A;  3E56 A;  2MJD A;  2R2Q A;  1P1A A;  2O6V D;  3KVF B;  2HTH A;  4XWT A;  2KOX A;  1OQY A;  1WJ4 A;  2G3Q B;  2VH2 A;  2MCN B;  5BYQ A;  4AJY B;  1GC6 A;  1TJE A;  1H4R A;  1AW7 A;  2BB5 A;  3A9J B;  4L23 A;  4DQO C;  2JYT A;  1JWS D;  1FEH A;  1PGA A;  1R4M B;  2WDT B;  3ML9 A;  2IJ0 A;  3KYC D;  3AE2 B;  2AQ3 B;  1CMX B;  2MA9 B;  4ARC A;  2MX2 A;  2ZPY A;  2QMT A;  2KXJ A;  2KX0 A;  4XX5 A;  3QAQ A;  2WU5 B;  1WGH A;  1V5O A;  5TSS A;  3C0R B;  3IAS 1;  2D3A A;  1L0Y B;  1KLU D;  4BOS C;  2HTM E;  4RGN A;  4HPL B;  1E7U A;  4G11 A;  4M8N A;  4GLS C;  2WP9 B;  3P4R B;  2KWV B;  4FJY A;  3PRM B;  3L10 B;  5MPO A;  1DGJ A;  1C4P A;  3B2G A;  3O65 B;  3QAR A;  4R3D A;  1NDD A;  4LK0 M;  3PVL A;  3Q2A C;  1X1M A;  1TZO A;  2WX0 A;  1YQ3 B;  2K3U A;  2KNB A;  3OG5 A;  1PFD A;  3APD A;  1QQR A;  1WF9 A;  3HUI A;  4PYU A;  2XK5 A;  1ET9 A;  3SDL C;  3ZKJ C;  3V61 A;  1ZUD 2;  3HRD D;  2WWZ A;  1D5Z C;  5G5H A;  5BMG A;  2W3R A;  3BVM A;  3MJW A;  3PRZ A;  3CSF A;  1GUA B;  2NCN A;  2A4Z A;  2IBI B;  4XDC A;  4IWP A;  3Q3F A;  1OTR B;  3W2D A;  3DVN U;  4KGR A;  2CS4 A;  2J0J A;  3WIM A;  3U7Z A;  4ZYS A;  3SU8 X;  4ZRQ A;  3P42 A;  4WJP A;  2JWZ A;  3K9P B;  4M00 A;  1YN3 A;  4W9L A;  3JSV B;  2IO0 B;  1D4B A;  3I57 A;  3JVZ X;  3MJ5 A;  3L08 A;  5C1Z A;  3U2S C;  3DBH B;  2B3A A;  3ZNI D;  2HE7 A;  1JQ4 A;  2NPT A;  2ZJD A;  4CO7 A;  3ZO5 B;  2KTR B;  3AE8 B;  2BT6 A;  2IGD A;  4TMA B;  1K50 A;  3CWI A;  4K81 A;  4HRO A;  4OW0 A;  1TS2 A;  3NVW A;  2D10 A;  1RRB A;  2J52 A;  3L4P A;  4M02 A;  1M94 A;  1RWS A;  2EKE C;  1ZDV A;  4K3C A;  5HKH A;  3AM9 A;  4AS1 A;  5D6J B;  2LUE A;  3WAL A;  1JML A;  5CHV C;  4A3O A;  3VDZ A;  1SB3 C;  3RFZ B;  2KLC A;  1WX8 A;  2K0P A;  2CU3 A;  5E6N A;  2IGG A;  3QC8 B;  4E71 A;  1E90 A;  1C4C A;  2A5U A;  4ZRI A;  1RYJ A;  2R2O A;  1E8Y A;  2KFJ A;  2KN4 A;  1MI0 A;  2PE6 B;  4YWG G;  4GIV A;  3RUL A;  2FCQ A;  1JWU D;  2JT4 B;  1EO6 A;  2DEN B;  2KYW A;  1VRA B;  2L32 A;  1KTK A;  2K5P A;  3NG0 A;  4LNN A;  3A4R A;  3W1Y A;  4LNO A;  1JRP A;  1T0Y A;  2I1J A;  4KGS A;  3KLS X;  2Z59 B;  3Q6B A;  4ARI A;  1XEE A;  4HEA 1;  4KSL C;  1YQ4 B;  5C3J B;  3IXS A;  5G55 A;  2J0M A;  2AQ2 B;  3R3M A;  3DBR I;  4ZRP A;  3J9C A;  4FAD A;  3WCQ A;  3NZ3 A;  1WX9 A;  2KDB A;  1IYF A;  1VLB A;  1XF5 L;  4B6W A;  2UYZ B;  3BVG A;  4RF0 A;  4BFR A;  1JRO A;  4PT5 A;  5EE0 A;  3B9J A;  5IA7 A;  2QEJ C;  1P0R A;  3VH3 B;  4ZRJ A;  2IO2 B;  1XCQ L;  4XGA B;  2INN E;  3NVY A;  2GBK A;  1L0X B;  2K39 A;  1M4V A;  1UNS A;  2MJE A;  3UI3 A;  3VVW B;  1LM8 B;  5JXV A;  4KDL B;  2BKR B;  2D11 A;  2LMC A;  2JRH A;  4K7W A;  3BK1 A;  4WH4 A;  4B95 A;  3H6N A;  1E8W A;  1SBB B;  1F2R I;  2RPQ A;  4ZHP A;  1RAX A;  1E8Z A;  3TEY A;  2REX A;  3VQI A;  4WAA A;  4MM3 B;  4E74 A;  3T3N A;  3MC8 A;  3APF A;  3N32 A;  1SGH A;  2BF8 B;  2KMC A;  2V4L A;  5AUK A;  4ZHO A;  1K53 A;  5KHQ A;  3Q3O C;  4OHJ A;  1EM7 A;  4ANX A;  4GMV A;  2YEP F;  3RNG C;  3KWV A;  2D3C A;  2CU1 A;  1V5T A;  3BVZ A;  2RSU A;  2J42 A;  4HCN B;  1WJU A;  4KSK C;  3AEG B;  1RFK A;  1YMH E;  3K9O B;  1E9M A;  2PMV A;  4WAF A;  1NBF C;  4DHJ D;  2WXH A;  2FID A;  4EOY A;  3SEB A;  4W9C A;  2D3G A;  3ZRF A;  5EDS A;  1WJ6 A;  4PYZ A;  1XO3 A;  3ZVV A;  2GOW A;  3TL5 A;  2FUH B;  2WXL A;  1K52 A;  1YJI A;  5CTR C;  1EF1 A;  2INC C;  2WLB A;  2WXJ A;  3EEC A;  2OJR A;  1WRD B;  3VTU A;  4MH0 E;  2N9E B;  2YVC A;  5BMI A;  1T3Q A;  1Y56 A;  5BYS A;  1YX6 B;  3HK0 A;  3IAM 1;  1T5X D;  4KZ0 A;  1JWM D;  1TS5 A;  4HDQ A;  1JRU A;  2HDE A;  1SIJ A;  4NAM A;  4GU2 A;  3BYY B;  3C19 A;  2LEK A;  4ANW A;  2LJI A;  1YX5 B;  3QA8 A;  5DPR A;  2C9W B;  2L3Z A;  3AMZ A;  2KVR A;  1FNW A;  3VR8 B;  1SXT A;  3B2F A;  1WZ0 A;  2OOB B;  5JZE B;  2B76 B;  2FCN A;  3WAN A;  1WXQ A;  1EWC A;  3AED B;  4MJS B;  2KDM A;  3FIL A;  1TY2 A;  2LRW A;  1P98 A;  5HG2 A;  1P7E A;  4RGO S;  3V6C B;  3GP7 A;  1NVI D;  2IY1 B;  2LHE A;  1E7V A;  1C78 A;  2W54 A;  2FBW B;  3VR9 B;  1SJE D;  4ACF A;  2HJ8 A;  2G45 B;  2KMA A;  3PSE B;  1IUE A;  1SJH D;  3MC9 A;  4HXD A;  4WWM A;  3L13 A;  4URK A;  3WA0 A;  2JZ3 B;  2DAF A;  2GBJ A;  2LGY A;  2OED A;  4L1B A;  4DDI D;  4GOC A;  1ZGU B;  3IVF A;  1UH6 A;  2KC2 A;  2JY6 A;  3PS6 A;  3MHZ A;  4S0R A;  2NBV B;  1UWX A;  1Q10 A;  2KO3 A;  3SR6 A;  2EEL A;  1TIF A;  2K1F A;  1K8R B;  4OVV A;  2ZVO A;  3R7Q A;  2KDI A;  2C60 A;  1WY8 A;  2ZZP B;  5LXI B;  4IM2 A;  1KFY B;  2XK5 B;  3BY4 B;  1G6J A;  3Q8A A;  3PZ8 A;  2RR9 A;  3KYD D;  2DBY A;  1WWT A;  5EE3 A;  1XQQ A;  3NJT A;  4BKT A;  1DOX A;  2DZJ A;  1C1Y B;  3P63 A;  3ZLZ A;  1XLO A;  1TGZ B;  1OFF A;  2BVC A;  4TSS A;  2V0G A;  4BZA A;  2JX5 A;  1EF5 A;  2PLP A;  1FRR A;  2KDF B;  3ZJV A;  4II2 B;  1QLB B;  4P6V F;  1Q1O A;  1FMA D;  2IND C;  1FFU A;  3DVG Y;  4DHZ B;  1V97 A;  3DHI C;  1WXV A;  3AU4 A;  3EUB 2;  1ZXH A;  2DZM A;  2N9P C;  2GBM A;  4RFB A;  3AE6 B;  1WSP A;  1ZPS A;  2V4I B;  4HKQ A;  2PJH A;  2W9N A;  4BBN C;  4AJW A;  4J3O D;  4IKG A;  4F8C B;  1KLG D;  1XLQ A;  2NPT B;  2MSE D;  5D94 A;  4UDU C;  2KMM A;  4WWP A;  2BKF A;  4HRS A;  3EFC A;  2C7M B;  5TR5 A;  2GMI C;  2N7J A;  2WX1 A;  4MH8 A;  4REZ A;  1BXT A;  3DBL I;  3R8B A;  3RNA C;  4KKJ A;  1I4R A;  1YJJ A;  3U30 A;  1MG4 A;  2EMS A;  2AL6 A;  2MBQ A;  4GB9 A;  2K9X A;  1B1Z A;  1Q0W B;  2MP2 B;  2VZK D;  1TTN A;  1UBQ A;  4IDI A;  5IP4 D;  5E6P A;  1E6E B;  4LNF A;  2D2Q A;  4DXF A;  1QOA A;  1XT9 B;  2IY0 B;  1YQB A;  3TEW A;  1N61 A;  4EFO A;  4A9A A;  4LJP B;  3V62 A;  3W5V B;  1ESF A;  1E5W A;  1I4H A;  1N6Z A;  4RGT A;  1UBI A;  4NJC A;  1I4P A;  2WQY B;  1YN5 A;  2KX3 A;  2LUM A;  4P16 A;  2OHF A;  1IBX B;  3RNB C;  3V6E B;  1MG8 A;  2CKH B;  2WDR B;  4RNA A;  1N5W A;  4FN2 A;  2JSV X;  1GPX A;  3ECI A;  4YSY B;  2IO3 B;  2KWD A;  3VFK A;  3P1M A;  2KVZ A;  3AEB B;  3RZW C;  2QIE B;  4LDT D;  4JQW C;  4MJS A;  2ON8 A;  2XBB C;  4OZB A;  4K3B A;  4KZC A;  3U52 E;  3N9Y C;  2Y5P A;  4MT5 A;  4FLH A;  1J19 A;  3IG3 A;  4XZ4 A;  3UGB B;  2SAK A;  3DVN V;  3SFE B;  2DZI A;  5FK9 C;  3R7R A;  2IPK D;  2RMM A;  2BS3 B;  3DBR B;  3KW5 B;  2NVU I;  5J2R A;  3AV8 A;  3QK0 A;  2BYT A;  1D6E C;  2Z8L A;  5BYR A;  4FJZ A;  2L0F A;  2QIL A;  4IM3 A;  4MAC A;  3AN1 A;  1GAQ B;  2KJR A;  3B0A A;  2V3P A;  2OJW A;  1E10 A;  3AE4 B;  4IWQ A;  3PTF C;  4RM8 A;  5HHD G;  2ASQ A;  3NUH B;  1QOG A;  1SSN A;  2WXP A;  4EZK A;  4W9G A;  3T9L A;  2K6D B;  1MFW A;  2LXC A;  2NTT A;  4C7Y A;  5HFY A;  4DXG A;  4IWO A;  1WGK A;  4MGI E;  1AWD A;  1OGW A;  1I4X A;  2N1W A;  2WYQ A;  3NZS A;  3T8M A;  2V3S A;  3MTN B;  2PVG C;  4JWS C;  5D2M B;  4G0N B;  4I6N B;  5FR6 A;  2K22 A;  3W1S A;  1T0S C;  2FUG 1;  2H88 B;  1GOZ A;  4CYE A;  2DLB A;  1SF0 A;  2KKC A;  4RM9 A;  2LRU A;  2DHZ A;  2N9L A;  3H7P B;  2Q5W D;  2WNM A;  3LB8 C;  1LGR A;  4JPS A;  3PT2 B;  4FBJ B;  1C4A A;  3ZNG C;  2XEW A;  3I3T B;  2BBC A;  3U7D A;  2LAS A;  2KAJ A;  1GNU A;  2M17 A;  4KX6 B;  2YEP B;  2E3T A;  3E9S A;  3QCA A;  1VCB A;  1V86 A;  1HE8 A;  3EFU A;  2AX5 A;  4OVU A;  2IZV B;  4RMA A;  1MHX A;  4WQO B;  3EA6 A;  5LXH A;  4KDI C;  3WAM A;  1FNV A;  1NEN B;  4RGM A;  1FCC C;  3RZF A;  4PK1 A;  1HTO A;  2N1V A;  1UWM A;  3A1Q B;  3UQB A;  2DZK A;  5DCN A;  1P7F A;  4S17 A;  3FIL B;  2KTF A;  3L17 A;  1GG3 A;  5L83 A;  1HZ5 A;  3EHV A;  3TJP A;  3VRB B;  2MP2 A;  5D3D A;  3QWZ B;  3GZN I;  3SFD B;  4HJG E;  4MSQ B;  1ZP0 B;  3ZXR A;  4OZA A;  3I63 C;  3Q8C A;  2H89 B;  3GOE A;  2I38 A;  1EWY C;  1H8C A;  2L05 A;  4N58 A;  1TS3 A;  1QOB A;  4NAW B;  5GXG B;  3R66 C;  4LNI A;  4FHJ A;  4MEM A;  1D5X C;  1L7Y A;  2ZW0 A;  1CZP A;  1KF6 B;  2NBU A;  1OEY J;  3L16 A;  2O6V A;  3BIN A;  3M3J A;  1OQR A;  2UU7 A;  3OJ3 A;  3RMK C;  1ZE3 D;  3UIP B;  1OQQ A;  3BWU D;  1IBX A;  3VH4 B;  4RH6 A;  4AP4 C;  1VZ8 A;  4EEW A;  1WYG A;  1J8C A;  3PGE A;  1SEB D;  1LO5 D;  3ZDT A;  2MWS B;  2QDF A;  3KH0 A;  3O13 A;  2WXF A;  3NY5 A;  2MBO A;  4JL9 A;  1QIL A;  1SE9 A;  2VRR B;  1DYQ A;  3NHE B;  3P4S B;  4D2K A;  5JH5 C;  2EMT A;  3DQV A;  1NI3 A;  5BMH A;  1NYR A;  4GGQ A;  4FA6 A;  5E6O A;  2NTS A;  2L00 B;  5GMV A;  4C7Z A;  2JZP A;  2Y3A A;  1YOV B;  1V80 A;  4NPN A;  2ZPN A;  5H8Y E;  3RUI B;  4PS7 A;  1HEZ E;  2M0A A;  3ZIM A;  3W1S C;  1SIF A;  4AUQ C;  1F77 A;  1C79 A;  2ZVN A;  2BYE A;  4LJO B;  3AI5 A;  2JZZ A;  4A55 A;  3P2B A;  1XD3 B;  3A9K B;  3AE1 B;  3X0W A;  3UF8 A;  1FFV A;  1WIA A;  5CHW A;  3I5J C;  2HJ1 A;  4NZL B;  4EE2 A;  1JWB D;  1PDX A;  5IO9 A;  4TV3 A;  1A70 A;  1A5R A;  2PPH A;  4GSW A;  5KHO A;  2MEK A;  3N1Y C;  1HZ6 A;  4H2A A;  5C23 A;  2C5L C;  2WXG A;  4CHK A;  2K8B A;  1U4A A;  3PHX B;  1ISN A;  3VAW A;  2W3S A;  4YTM B;  1EUV B;  3QQ8 B;  3NS8 A;  1SE2 A;  3R2T A;  4TUU A;  2WDV B;  3U4E G;  3VUX A;  3N1Z C;  3Q8E A;  3Q14 C;  2M1M A;  4MSM B;  4RCO A;  1Q5W B;  3H7P A;  1WZ3 A;  3VTV A;  1UZX B;  2MBH A;  3QHT A;  1J7C A;  1VZ7 A;  2PE9 A;  4WJO A;  5EE9 A;  3GE8 C;  3IFW B;  3V60 A;  3ONS A;  2WXQ A;  1WXM A;  2BB6 A;  4YL8 A;  3PO0 A;  4NQL B;  1KM7 A;  1SE3 A;  4N59 A;  3OJ4 B;  1L6U A;  2WS3 B;  4LCD E;  2KJH B;  1F9J A;  4MGZ E;  3DBL B;  2JU6 X;  2WXR A;  4BKS D;  2DYO A;  1WR1 A;  1YNT E;  1B9R A;  2KQ4 X;  5AUI A;  3AH7 A;  4HCP B;  4W9F A;  5DPT A;  2MBE A;  1FCL A;  1TBE A;  3FKY A;  3PHW B;  2IDY A;  3PZD A;  1PYW D;  1CK1 A;  4M0W B;  1K51 A;  2VH1 A;  1WGR A;  1WE6 A;  4RF1 A;  1WRI A;  2PVO D;  4DXA B;  5HI1 A;  5LNK 1;  4W9K A;  2N9K A;  3N3K B;  2LVP A;  3A1Q A;  3V3X A;  1OEY A;  2KD0 A;  2PKO A;  1GB4 A;  4HVB A;  3PV1 A;  3DPD A;  4I6P A;  4ICV A;  3CMM B;  3VTW A;  1L4D B;  1C9F A;  4LLG M;  4TQ0 A;  1J7B A;  2ZW1 A;  4NAW A;  1CQV A;  2KWU B;  5AZH A;  2ZCC A;  1FRD A;  3P4P B;  4KGT A;  4HWI B;  2L83 A;  4DDG D;  3AE7 B;  3MHS D;  2KJ6 A;  2I2Y A;  3OLM D;  3KUC B;  1F0Z A;  1XLN A;  3NVZ A;  1YIW A;  5JHB A;  1AAR A;  3H9D A;  1V1P B;  4MGY E;  1PGB A;  2JXT A;  2LGX A;  2ZNV B;  2DAJ A;  1ZXI A;  2V3N A;  1JCK B;  3ZTC A;  4A90 A;  3W9C B;  4ITK A;  3ETR A;  2DWQ A;  4C4V B;  2G4D B;  3ZRC A;  1ZW7 A;  1QKZ A;  2Y5B B;  4FXC A;  1FIQ A;  2CJN A;  2AQ1 B;  1WGY A;  1S1Q B;  3R2I A;  1ZDX A;  2FCM A;  2LWP A;  4DBG A;  1FNU A;  1L5P A;  3NZU A;  3Q8B A;  3HM6 X;  1WGG A;  3U8Z A;  1F2R C;  3V05 A;  2RDB C;  2ZEQ A;  3TBL D;  2KWC A;  3D32 A;  2Z0E B;  4G3X B;  1VZ6 A;  4G50 A;  1L4Z B;  4PS3 A;  3DVG X;  4A6Q A;  2JUO A;  1WM3 A;  4P1C C;  4W9D A;  5T8I A;  1ROE A;  1Y8R C;  3RD2 A;  2WXN A;  3H1U A;  2CHX A;  2LGD A;  4FHK A;  1HTQ A;  3A9K A;  2BS2 B;  5DPW A;  4XC2 A;  3I9V 1;  2KQS A;  3ZJU A;  3RCZ A;  4BOZ B;  2WDQ B;  4MEL A;  4W9I A;  3Q3N C;  2LGI A;  3AEA B;  2NMQ A;  4EKU A;  1I4Q A;  3ABV B;  1L2N A;  4ZDV A;  1FXA A;  5FR3 A;  2M8S A;  4J6I A;  1YN4 A;  2PIA A;  4FUL A;  4NJ6 A;  2L0T A;  2KZR A;  5BO4 B;  1GC7 A;  3HIZ A;  1C76 A;  1IGD A;  5G2N A;  3N20 C;  2CHW A;  1Z5S B;  1EU4 A;  3CIR B;  3DOW A;  3A33 B;  1Z2M A;  3NVV A;  4WQM A;  4BVU C;  4CQN A;  1N60 A;  4F1S A;  2ICI A;  4ANV A;  1WXA A;  4HK2 A;  1QZE A;  3RNC C;  1R4N I;  3C8Y A;  2BYV E;  1WE7 A;  2C7N B;  3RYT A;  2YLM A;  3AE3 B;  2O6V B;  1T0R C;  1STE A;  3HHM A;  1QOF A;  4JIO U;  1GB1 A;  1WJN A;  5G5G A;  2BGF A;  2O2V B;  2RD0 A;  1RLF A;  3GZN B;  4HJK A;  4M0W A;  1ZKH A;  2KT7 A;  1DOY A;  3FAH A;  3KQ4 A;  2MBB B;  4ZYN A;  1AN8 A;  1UUP A;  5IN7 A;  4YT0 B;  2KN5 A;  1UGJ A;  2GLS A;  5D3I B;  3ALB A;  4WJQ A;  3NOB A;  1XLP A;  2RPV A;  4B0E A;  3AU5 A;  2GRI A;  2MW5 A;  3SD5 A;  1D5M C;  2L76 A;  3X23 A;  1ET6 A;  2LD9 A;  5J17 A;  2M4N A;  3IT4 B;  3OAW A;  2GI9 A;  2LHD A;  3KUZ A;  4US9 A;  1AYF A;  3DCG A;  4I6L B;  2JQR B;  4P7I A;  2JXX A;  4NY0 A;  5AEK B;  3B1L X;  2G1E A;  3LDZ E;  1FXI A;  2PTL A;  4B0M A;  1TYG B;  2QHO A;  1TS4 A;  4IC7 B;  2AEH A;  1XCT L;  2MQJ A;  4OZC A;  1V1P A;  1FD6 A;  4NQK E;  1YJ1 A;  5AZF A;  1VDV A;  5C2T B;  3N30 A;  1KRH A;  2KHW B;  4C4V A;  3ZJT A;  4L2Y A;  3BK2 A;  4N6E B;  3M62 B;  3KUD B;  4AOF A;  2MHJ A;  1T6B X;  3AE9 B;  2EKI A;  5E6J A;  2M0X A;  4M8M A;  3AEE B;  1IP9 A;  1F1H A;  3PRP B;  2XN9 C;  1P3Q U;  3JW0 X;  2CR5 A;  4AWJ A;  3T3O A;  3ZNZ B;  5D7G A;  4LTU A;  2WXM A;  1NEK B;  3IBE A;  4XYC A;  2FCS A;  3JYU A;  4HKZ E;  3VHT C;  1LFD A;  2CJO A;  2LI5 A;  2DYM A;  3TCA A;  1RM6 C;  1WGD A;  3SHQ A;  3GE3 C;  4JLC A;  1YD8 U;  1HXY D;  3DHH C;  1TZ1 A;  2TSS A;  1WI0 A;  2BTE A;  4P1B C;  2X8X X;  5LLI A;  4JWU C;  3BZD B;  2BS4 B;  4TQ1 A;  3AXC A;  2DYB A;  3DWG C;  2LXA A;  3Q8F A;  4GDK B;  4HPM B;  1PGX A;  1BUI C;  2KAN A;  1HQR D;  3UIN B;  2FAZ A;  1JW9 D;  3QIJ A;  2C7H A;  5CHF A;  4A8X C;  1E8X A;  4DHZ E; 
#chains in the Genus database with same CATH homology
 3C0R B;  1Q1O A;  1WX7 A;  4WJO A;  3A4S C;  3IFW B;  2JRI B;  3V60 A;  1V6E A;  3ONS A;  1WXM A;  3DVG Y;  4YL8 A;  4DHZ B;  4BOS C;  4NQL B;  1WXV A;  3AU4 A;  1KM7 A;  3OJ4 B;  4LCD E;  2DZM A;  2KJH B;  2N9P C;  1F9J A;  2GBM A;  4MGZ E;  1V2Y A;  5J18 A;  4W9J A;  4HPL B;  4BKS D;  2DYO A;  1R4M I;  4EUT A;  2PJH A;  1E7U A;  2W9N A;  4BBN C;  1WR1 A;  4AJW A;  4G11 A;  3PPA A;  4M8N A;  4WWO A;  2O2V A;  3B08 A;  3M95 A;  4F8C B;  4HCP B;  2NPT B;  2KWV B;  4FJY A;  4W9F A;  5DPT A;  3PRM B;  3L10 B;  3PRE A;  2MBE A;  2MSE D;  5D94 A;  1TBE A;  3PHW B;  2FNJ B;  3O65 B;  3QAR A;  4WWP A;  2BKF A;  3PZD A;  2N9X A;  4M0W B;  1WYW B;  1NDD A;  1WGR A;  2C7M B;  5TR5 A;  1WE6 A;  2GMI C;  2WX1 A;  3PVL A;  4DXA B;  1X1M A;  2WX0 A;  4W9K A;  3N3K B;  3DBL I;  2LVP A;  3HM3 A;  5DPS A;  2KNB A;  4ANU A;  3A1Q A;  1OEY A;  1V49 A;  2KD0 A;  4FJV B;  3APD A;  4K1R B;  2KK8 A;  2ZNV C;  1WF9 A;  4PYU A;  2XK5 A;  4HVB A;  3U30 A;  3SDL C;  2EMS A;  3ZKJ C;  2AL6 A;  3V61 A;  4KIK B;  3A9J A;  2MBQ A;  3PV1 A;  2J0K A;  3DPD A;  4I6P A;  2WWZ A;  4GB9 A;  4ICV A;  3VUY A;  3CMM B;  3VTW A;  1Q0W B;  2MP2 B;  3MJW A;  3PRZ A;  3CSF A;  2ZCB A;  4K7U A;  1GUA B;  2NCN A;  2A4Z A;  2IBI B;  4TQ0 A;  1TTN A;  2V1Y A;  1WXS A;  1UBQ A;  4IWP A;  1WR6 E;  3Q3F A;  4NNJ B;  1OTR B;  3DVN U;  2CS4 A;  2J0J A;  5E6P A;  4NAW A;  3WIM A;  2D2Q A;  2KWU B;  3ML8 A;  5AZH A;  2AWT A;  4F7Z A;  3SU8 X;  3RT3 B;  2JF5 A;  4WJP A;  1XT9 B;  2ZCC A;  2JWZ A;  3K9P B;  1J0G A;  2N4F A;  4HWI B;  4KVG B;  2IY0 B;  4DDG D;  1YQB A;  3JSV B;  4W9L A;  3MHS D;  2IO0 B;  5IAA C;  2KJ6 A;  4EFO A;  4EZJ A;  4DK5 A;  4LJP B;  3JVZ X;  3V62 A;  3OLM D;  3KUC B;  1KOT A;  4BBN F;  4TKN A;  1E5W A;  4ZRK A;  1YIW A;  2HD5 B;  2CHZ A;  5JHB A;  3L08 A;  1AAR A;  5C1Z A;  3H9D A;  4MGY E;  1UBI A;  2B3A A;  3ZNI D;  2HE7 A;  2LGX A;  2NPT A;  2ZJD A;  2KX3 A;  2ZNV B;  3H7S A;  4CO7 A;  4DHJ B;  3ZO5 B;  2DAJ A;  2KTR B;  1IPG A;  3V6E B;  1MG8 A;  4K81 A;  2CKH B;  2JPH A;  3ZTC A;  3QJZ A;  3EC8 A;  4FN2 A;  2DX5 B;  2D10 A;  3ECI A;  4II3 B;  2G4D B;  3ZRC A;  1RRB A;  2IO3 B;  2N7D A;  3VFK A;  1ZW7 A;  2Y5B B;  1M94 A;  2EKE C;  2BWE S;  5HKH A;  2LVO A;  3RZW C;  1WGY A;  3L54 A;  5D6J B;  2GBN A;  2LUE A;  3TMP B;  3WAL A;  5CHV C;  4LDT D;  3VDZ A;  4JQW C;  4MJS A;  4A3O A;  1S1Q B;  2XBB C;  1NI2 A;  2FCM A;  2LWP A;  2KLC A;  4DBG A;  1WX8 A;  4KZC A;  3NZU A;  2IYD B;  4FLH A;  5E6N A;  1J19 A;  1UGM A;  3DBH I;  1WGG A;  3HM6 X;  3IG3 A;  4XZ4 A;  3U8Z A;  3UGB B;  2L8J A;  2K8C A;  3DVN V;  1WMH B;  3QC8 B;  1E90 A;  2DZI A;  4GDL B;  4E71 A;  2ZEQ A;  3TBL D;  3VXW A;  2A5U A;  2KWC A;  3D32 A;  4ZRI A;  2Z0E B;  2R2O A;  3R7R A;  1E8Y A;  1LXD A;  2KFJ A;  4G3X B;  2PE6 B;  4G50 A;  2K6Q A;  4GIV A;  3RUL A;  2FCQ A;  4PS3 A;  3DVG X;  3KW5 B;  4HDO A;  2JT4 B;  2NVU I;  2RGF A;  5J2R A;  1EO6 A;  2DEN B;  4DWF A;  2JUO A;  1WM3 A;  4W9D A;  1KLV A;  1Y8R C;  3Q3J A;  4GXB A;  1V81 A;  1BT0 A;  2FIF A;  3QK0 A;  3RD2 A;  3H1U A;  2CHX A;  2LGD A;  3A4R A;  3W1Y A;  4A20 A;  1KJT A;  1T0Y A;  2I1J A;  4FHK A;  2J7Q B;  3A9K A;  5DPW A;  4XC2 A;  4MGK E;  2Z59 B;  4FJZ A;  2L0F A;  4WWN A;  4IM3 A;  2KJR A;  2KQS A;  3B0A A;  3RCZ A;  4BOZ B;  4KSL C;  4MEL A;  4W9I A;  4IWQ A;  4E3C A;  4EZL A;  3PTF C;  4RM8 A;  3JSV A;  2ASQ A;  2L7R A;  5G55 A;  4EZK A;  4W9G A;  3T9L A;  2J0M A;  2N7E A;  2K6D B;  3DDC B;  4EKU A;  4IG7 B;  3ZTD A;  2LXC A;  2I1K A;  3R3M A;  2KFK B;  3DBR I;  4FAD A;  1L2N A;  4IWO A;  4ZDV A;  1WX9 A;  2KDB A;  4MGI E;  1IYF A;  4B6W A;  2M8S A;  4J6I A;  2KTR A;  1OGW A;  2N1W A;  2UYZ B;  4BFR A;  4FUL A;  4WJN A;  4NJ6 A;  2L0T A;  5JHA A;  2WYQ A;  3NZS A;  5IA7 A;  2KZR A;  3T8M A;  5BO4 B;  1GC7 A;  2V3S A;  3MTN B;  3HIZ A;  2GBR A;  5D2M B;  3UQA A;  4G0N B;  4I6N B;  1WM2 A;  2JVC A;  1P0R A;  5FR6 A;  4GDK A;  3VH3 B;  5G2N A;  4ZRJ A;  3W1S A;  1WH3 A;  2IO2 B;  2CHW A;  4CYE A;  2GBK A;  2K39 A;  1Z5S B;  2KKC A;  4RM9 A;  2Z0D B;  2LRU A;  2DHZ A;  4IW0 A;  3DOW A;  3A33 B;  1PQS A;  3VVW B;  1LM8 B;  1Z2M A;  3H7P B;  4KDL B;  3ZNH B;  4ASW C;  2BKR B;  2D11 A;  4BVU C;  2JRH A;  4K7W A;  3APC A;  4F1S A;  4B95 A;  2NBW B;  3H6N A;  2NR2 A;  4ANV A;  1E8W A;  3PT2 B;  1WXA A;  4HK2 A;  1QZE A;  1RFA A;  3ZNG C;  4FBJ B;  2XEW A;  3WAP A;  3I3T B;  2RPQ A;  1R4N I;  1RAX A;  1E8Z A;  2BWF A;  2LAS A;  3U7D A;  1I35 A;  1GNU A;  2M17 A;  2BYV E;  1WE7 A;  2C7N B;  3RYT A;  3L0W B;  2YLM A;  1WFY A;  2REX A;  3UIO B;  3VQI A;  3QCA A;  1VCB A;  1V86 A;  2O6V B;  4WAA A;  1HE8 A;  4E74 A;  1V9J A;  3EFU A;  3HHM A;  4OVU A;  3APF A;  3N32 A;  4A3P A;  1SGH A;  2BF8 B;  2IZV B;  2KMC A;  2V4L A;  4JIO U;  5KHQ A;  1WJN A;  4RMA A;  3CST A;  2BGF A;  2O2V B;  2RD0 A;  4WQO B;  1RLF A;  4HLE A;  4ANX A;  3VUW A;  4HJK A;  4GMV A;  5LXH A;  1ZKH A;  4KDI C;  3WAM A;  4B9K A;  4PS8 A;  2MBB B;  4ZYN A;  4NJ7 A;  2CU1 A;  1V5T A;  3ZUN A;  2KN5 A;  3RZF A;  5AZG A;  4K7S A;  2K25 A;  3WAO A;  2RSU A;  3AUL A;  4HCN B;  1WJU A;  3ALB A;  4KSK C;  2N1V A;  4WJQ A;  3NOB A;  3A1Q B;  3UQB A;  2DZK A;  5DCN A;  3AU5 A;  3K9O B;  1NBF C;  2KTF A;  2LVQ A;  4KIK A;  5L95 C;  3L17 A;  4DHJ D;  1GG3 A;  2MW5 A;  3SD5 A;  5L83 A;  2FID A;  4EOY A;  3TIX A;  3EHV A;  2L76 A;  4W9C A;  3TJP A;  3X23 A;  2D3G A;  2MP2 A;  3ZRF A;  2LD9 A;  3QWZ B;  5EDS A;  3GZN I;  5J17 A;  4MSQ B;  3IHP C;  1WJ6 A;  4PYZ A;  2M4N A;  3ZVV A;  2GOW A;  3OAW A;  3TL5 A;  2FUH B;  3GOE A;  3ZW3 A;  3M63 B;  3S2A A;  3KUZ A;  2AYO B;  4IM0 A;  4N9F 4;  3DCG A;  4I6L B;  5CTR C;  1H8C A;  1EF1 A;  2MRP A;  2L05 A;  3EEC A;  2OJR A;  1WRD B;  4W9H A;  2PEA A;  3VTU A;  4MH0 E;  2BYF A;  4P7I A;  2JXX A;  4NY0 A;  5AEK B;  3B1L X;  3LDZ E;  4NAW B;  2N9E B;  2YVC A;  3R66 C;  2KQ7 A;  1GJZ A;  1YX6 B;  2AL3 A;  4FHJ A;  3HK0 A;  4JGH B;  4MEM A;  1L7Y A;  2KC1 A;  2QHO A;  4KZ0 A;  4IC7 B;  1UD7 A;  2AEH A;  2NBU A;  1OEY J;  3CF6 E;  3L16 A;  4HDQ A;  2O6V A;  1JRU A;  3BIN A;  4MM3 A;  3M3J A;  4GU2 A;  2MQJ A;  3QX1 A;  4W9E A;  3OJ3 A;  3UIP B;  4IUM B;  4NQK E;  1YJ1 A;  5AZF A;  4ANW A;  3VH4 B;  4AP4 C;  4EEW A;  2IO1 B;  2MLB A;  1YX5 B;  3QA8 A;  5DPR A;  1J8C A;  3N30 A;  1LQB A;  3PGE A;  2C9W B;  2KHW B;  2L3Z A;  2KVR A;  3ZDT A;  2MWS B;  3KH0 A;  4KV2 A;  3NY5 A;  3M62 B;  1WZ0 A;  2MBO A;  4JL9 A;  3KUD B;  2OOB B;  4BKG A;  4AOF A;  1SE9 A;  5JZE B;  2VRR B;  5JH5 C;  3NHE B;  2FCN A;  2EMT A;  3DQV A;  1VD2 A;  3WAN A;  3PLV A;  4MDK E;  4GGQ A;  5CX3 A;  2M0X A;  4FA6 A;  4M8M A;  1IP9 A;  4MJS B;  5E6O A;  3PRP B;  1C3T A;  2L00 B;  2LRW A;  5GMV A;  1P98 A;  1WMH A;  1P3Q U;  3JW0 X;  4GDL A;  2CR5 A;  4AWJ A;  1V80 A;  3V6C B;  4NPN A;  2ZPN A;  3RUI B;  3ZNZ B;  4BKS A;  5D7G A;  2LZ6 A;  4PS7 A;  2K8H A;  1I42 A;  2G4S A;  2IY1 B;  3IBE A;  1E7V A;  3ZIM A;  2UWQ A;  3W1S C;  1SIF A;  2D07 B;  4AUQ C;  2FCS A;  2ZVN A;  1P9D U;  2BYE A;  1D3Z A;  4LJO B;  3JYU A;  2HJ8 A;  3VHT C;  1LFD A;  2LI5 A;  2G45 B;  2DYM A;  2KMA A;  3DBS A;  3TCA A;  3AI5 A;  2JZZ A;  3PSE B;  3P2B A;  1XD3 B;  3A9K B;  4HXD A;  3PLU A;  1WGD A;  3ENE A;  3L13 A;  3SHQ A;  4URK A;  3X0W A;  1UEL A;  3WA0 A;  3UF8 A;  2JZ3 B;  3ZDM C;  2DAF A;  2GBJ A;  2LGY A;  2KLG A;  1WIA A;  1S3S G;  4ICU A;  4JLC A;  4DDI D;  4GOC A;  5CHW A;  2BPS A;  1ZGU B;  1YD8 U;  2KFK A;  1TZ1 A;  1UH6 A;  3IVF A;  2KC2 A;  2JY6 A;  4GN1 A;  4LDT B;  4TV3 A;  3PS6 A;  3LJ3 A;  1FXT B;  2NBV B;  2KO3 A;  1WI0 A;  2LJ5 A;  4X57 B;  2KDE B;  1A5R A;  2PPH A;  2K1F A;  4GSW A;  1K8R B;  2NS5 A;  4OVV A;  5KHO A;  2ZVO A;  5LLI A;  5C23 A;  3R7Q A;  2KDI A;  2C5L C;  2C60 A;  1P1A A;  2R2Q A;  1WY8 A;  2ZZP B;  4CHK A;  2K8B A;  5LXI B;  1U4A A;  2O6V D;  3PHX B;  4IM2 A;  3KVF B;  2HTH A;  1ISN A;  2KOX A;  1OQY A;  3VAW A;  4TQ1 A;  1WJ4 A;  2G3Q B;  3AXC A;  2XK5 B;  2MCN B;  2DYB A;  3BY4 B;  4AJY B;  1G6J A;  1GC6 A;  2RR9 A;  1H4R A;  3KYD D;  1EUV B;  2LXA A;  3QQ8 B;  3NS8 A;  4GDK B;  3A9J B;  4TUU A;  4HPM B;  1XQQ A;  4BKT A;  2WDT B;  2DZJ A;  3VUX A;  1C1Y B;  3ML9 A;  3ZLZ A;  2KAN A;  3KYC D;  2M1M A;  1TGZ B;  4MSM B;  1Q5W B;  1CMX B;  3H7P A;  3UIN B;  2MA9 B;  1WZ3 A;  2FAZ A;  3VTV A;  2MX2 A;  2ZPY A;  2KXJ A;  1UZX B;  3QIJ A;  2KX0 A;  1EF5 A;  2C7H A;  2MBH A;  3QHT A;  3QAQ A;  5CHF A;  4XX5 A;  2KDF B;  1E8X A;  1WGH A;  2PE9 A;  4II2 B;  1V5O A;  4DHZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...