3TIXA

Crystal structure of the chp1-tas3 complex core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
153
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDNDIIEAHREQIGGLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRSEMLSQRKLLAAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Chp1-Tas3 core is a multifunctional platform critical for gene silencing by RITS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation/protein binding
molecule keywords Ubiquitin-like protein SMT3,RNA-induced transcriptional sile
total genus 45
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tixA01
2C9WB 3VTWA 3T9LA 1P98A 1WI0A 2AL3A 2N4FA 3VFKA 3APCA 4AJYB 4MSMB 2LUEA 1GC7A 3AU5A 3RCZA 1Q5WB 3PS6A 5GMVA 2FCNA 2MCNB 3H1UA 5D7GA 2N1VA 2KDEB 3CSFA 3JSVB 2CHZA 1K8RB 3OJ3A 2NBWB 3HIZA 3V6CB 4K7SA 3UINB 3W1YA 1V5TA 1L2NA 4MGKE 4GDLB 4CYEA 3DDCB 2DZMA 1SE9A 1E7VA 2K8BA 3M63B 2DYOA 2GBMA 2PPHA 2XK5A 4YL8A 2L0FA 2LGXA 4G0NB 4MEMA 4WJOA 4TQ1A 2HD5B 1WRDB 2MQJA 1RFAA 1WZ0A 2NPTA 3QQ8B 3H9DA 4DHJD 1G6JA 2AYOB 1XT9B 3IHPC 2ZVNA 3A1QB 3QC8B 4ASWC 3IG3A 2PJHA 4I6PA 4ZDVA 1X1MA 4GMVA 1IYFA 2J0JA 2G4DB 2R2OA 3AI5A 3OAWA 4HPLB 2C7MB 2OJRA 2OOBB 2KOXA 2V1YA 1J19A 3ENEA 4HJKA 3IBEA 3HM3A 2WWZA 3PTFC 3TJPA 2MBEA 2BYEA 2N7DA 3K9OB 5LXIB 4XC2A 3B08A 4KSKC 2L05A 1V2YA 5D94A 2LGDA 2MBQA 4WJPA 3U8ZA 3PSEB 2MP2A 4CHKA 3TL5A 2KX0A 1OGWA 3X0WA 2O6VB 2CR5A 3ZKJC 4MDKE 3OLMD 4DDGD 4NQLB 3APFA 2D10A 5E6OA 3NZUA 2XBBC 4DHZB 2CS4A 2WX0A 3QX1A 2BYFA 4W9EA 1WXSA 3DQVA 3R3MA 3QAQA 4EEWA 3L54A 3AU4A 3RZFA 2RSUA 3JYUA 3W1SA 2GBKA 3NY5A 1ZW7A 3ZVVA 4OVUA 1WH3A 5J2RA 3UIOB 1SGHA 2GBRA 2IYDB 4K7WA 1TZ1A 2PE6B 4BKGA 4HXDA 2NBVB 3VDZA 1WMHB 2BF8B 3DBSA 5DPRA 4DXAB 2NCNA 3B1LX 4J6IA 2Z0EB 1C1YB 4B6WA 3B0AA 4KVGB 4MGYE 4W9CA 1OQYA 2FNJB 2MBOA 4ANVA 2JVCA 1CMXB 3PVLA 2WYQA 1S1QB 4TUUA 4HLEA 1WY8A 2XEWA 1RAXA 2ZJDA 2K25A 1NBFC 3D32A 2O6VD 3RUIB 3CMMB 2XK5B 4ICUA 3NHEB 3N32A 4A20A 3AXCA 3HK0A 3L10B 3MTNB 2ZVOA 1UH6A 4PS8A 1E8WA 2RD0A 3EC8A 1ISNA 1YX5B 4WWOA 5KHOA 3UQBA 4BBNF 3X23A 2KVRA 3VXWA 4WJNA 1V81A 1Q1OA 3ZO5B 3QA8A 4MJSA 2K6DB 1VCBA 2LJ5A 4KZ0A 2KANA 3CSTA 3UQAA 3ZUNA 3KUDB 2G3QB 2KC2A 4GDKA 1WE6A 2REXA 3TIXA 4BVUC 1VD2A 1S3SG 2BGFA 3EFUA 3PHWB 1WM3A 1KJTA 3A4SC 4IM0A 1P0RA 3ZTCA 2WX1A 3QIJA 2MSED 4HK2A 2MBHA 4BOZB 2JPHA 1BT0A 1NI2A 1I35A 1L7YA 5FR6A 5CHVC 4BBNC 2LVQA 1P1AA 1WE7A 5EDSA 3SDLC 4DK5A 3S2AA 4ANXA 1E8YA 2BKFA 2KMAA 1R4MI 2G4SA 3TCAA 3UIPB 4BKTA 4CO7A 1H4RA 4FA6A 4G50A 1WF9A 2ASQA 5J17A 4II3B 1XD3B 3VUXA 1M94A 5AEKB 3PT2B 3A4RA 5BO4B 3K9PB 2LGYA 4K7UA 3VUWA 1WFYA 1WX7A 2UWQA 4EFOA 1WYWB 3A9JB 3A9KB 4GDLA 2DAJA 2DYBA 4DHJB 2KWCA 4IWOA 4WAAA 4ZRJA 2MLBA 3N30A 1A5RA 3ML9A 2Y5BB 2FUHB 3U7DA 3VH4B 3WAMA 1GUAB 1FXTB 2D2QA 4KIKB 3ZRFA 5C23A 2KNBA 3KW5B 3WIMA 5DPTA 1OEYA 4G11A 3ZW3A 3WA0A 3KUZA 2BPSA 2KD0A 2LD9A 2RPQA 3U30A 2C60A 3WAPA 3C0RB 3WALA 2M0XA 2LXAA 4NPNA 3ZLZA 2KXJA 3DBHI 2N1WA 1WJUA 4JQWC 5CTRC 4FADA 2C5LC 2KFJA 2NVUI 1KM7A 4W9GA 3ZDTA 4HDOA 1EF5A 2PEAA 2KJRA 2LWPA 3QCAA 2CHXA 3VAWA 3VHTC 4AJWA 3RULA 3DBLI 4DBGA 2JRIB 2N9EB 3M95A 3JW0X 5J18A 2LXCA 3H7PB 4P7IA 2DHZA 4RM9A 4A3PA 3A33B 4MGZE 4WQOB 2A4ZA 1PQSA 4LCDE 5DPWA 2MRPA 3L17A 4LDTB 2O6VA 2ZNVC 2ZPNA 4EOYA 3DPDA 2D07B 1V6EA 3LDZE 3NS8A 2K6QA 3I3TB 5D6JB 1T0YA 2ZEQA 4GXBA 1UBIA 2VRRB 2NR2A 2BWES 1R4NI 4I6NB 4ANUA 4B95A 3SHQA 3WAOA 2NBUA 1P3QU 4AWJA 2WDTB 3KVFB 4NQKE 5LLIA 3DBRI 3V6EB 2MW5A 2KX3A 2DZIA 2M8SA 2YVCA 4M8MA 2DAFA 2AEHA 2LI5A 3KH0A 4MELA 4GU2A 3MJWA 5AZGA 2KMCA 2A5UA 2IBIB 2ZZPB 4GGQA 2J7QB 1WM2A 1LFDA 2IZVB 1UGMA 2KDIA 1WIAA 4A3OA 4FHKA 3H7PA 3LJ3A 4FJYA 1Z2MA 2NS5A 4LJPB 4M0WB 1WGRA 2EMSA 2CKHB 2KJHB 2L76A 2LASA 2NPTB 3PHXB 5D2MB 4AUQC 3EHVA 2LZ6A 4NAWB 5JHAA 1F9JA 3EECA 1YJ1A 3NZSA 4FULA 2KWUB 4BOSC 2K39A 4W9KA 4EZKA 1V80A 3H6NA 4EKUA 4URKA 3OJ4B 3L16A 4W9DA 3TMPB 3T8MA 1RLFA 1LQBA 2LVPA 4W9LA 2KTFA 3A9JA 3WANA 2KLGA 5JHBA 5E6NA 2JWZA 2FCMA 2N9PC 4DWFA 4ZYNA 4KSLC 3KUCB 1WXVA 3NOBA 2CHWA 2DZJA 4FLHA 5CHFA 4IG7B 3VTUA 4PYZA 4IM2A 1E7UA 1YQBA 2DZKA 2KTRA 1HE8A 2KWVB 3BINA 5HKHA 2JY6A 2FIFA 1GC6A 2HJ8A 4DHZE 2ZCCA 4E71A 2RGFA 3PGEA 4E3CA 4KV2A 4NY0A 3R7QA 4HPMB 4IC7B 2J0MA 2V3SA 4B9KA 1WGDA 1J0GA 4JGHB 2JZZA 4ZRIA 4IWQA 1YX6B 3O65B 3PZDA 3VH3B 2JT4B 1V5OA 2HE7A 4GB9A 3BY4B 4HVBA 2JUOA 2KJ6A 3ALBA 5C1ZA 3A1QA 4KZCA 2BKRB 4EUTA 5L95C 1GG3A 1SIFA 1YD8U 1WGHA 2DYMA 4FBJB 4GOCA 1E8ZA 2KFKA 4G3XB 4IUMB 3VQIA 2L8JA 2L00B 2Z0DB 2D3GA 2MA9B 2R2QA 4ZRKA 1WGGA 1TBEA 2HTHA 1MG8A 3L0WB 3CF6E 3P2BA 1IP9A 2FCSA 2O2VB 3L08A 2GOWA 2EMTA 2FIDA 4JLCA 4MSQB 2K8HA 4TV3A 5AZHA 1KOTA 3ONSA 2I1KA 4EZJA 1V9JA 4IM3A 3ECIA 3ZDMC 2V4LA 2M1MA 2QHOA 3RYTA 4TKNA 1LM8B 1V49A 2KFKB 4WWNA 1GJZA 4AP4C 3DVNU 4BKSA 1UELA 2BYVE 3ZNGC 4MJSB 3PREA 3DCGA 3PPAA 2JRHA 4NNJB 2PE9A 2MX2A 5L83A 4OVVA 2DX5B 1Z5SB 4NAWA 5LXHA 4GN1A 3QK0A 2RR9A 2GBNA 3AULA 2ZCBA 1WJ6A 4WJQA 4I6LB 3ZIMA 2KQ7A 2KKCA 1E90A 1AARA 3DVNV 1WX8A 1EUVB 2L0TA 3PRZA 2M17A 4M8NA 3RZWC 3PV1A 3SU8X 3ZNID 1WGYA 2ZPYA 2KDFB 2B3AA 3QWZB 5CX3A 3M62B 1WMHA 2MWSB 3L13A 2JXXA 3KYDD 4RM8A 1WXMA 4FJZA 2K8CA 4ICVA 4II2B 4K81A 4W9HA 4BFRA 2I1JA 2LRUA 4NJ6A 5TR5A 1WX9A 3ZNHB 3HHMA 4E74A 4JIOU 1ZGUB 3VUYA 2LRWA 3TBLD 4GIVA 3QHTA 5JZEB 3M3JA 1GNUA 2YLMA 3HM6X 1NDDA 1WR1A 4XZ4A 2L3ZA 4PS3A 4F7ZA 2LVOA 1J8CA 1ZKHA 4N9F4 2DENB 3ZRCA 3R7RA 3IFWB 3V60A 2JZ3B 2KQSA 1WJNA 2C7NB 2AL6A 2C7HA 1WXAA 3JVZX 3JSVA 3R66C 1U4AA 4HCNB 2KO3A 1RRBA 2KC1A 4TQ0A 3UGBB 3VVWB 2N9XA 1UBQA 3V61A 5IAAC 1QZEA 2KHWB 2GBJA 2IY1B 1TGZB 1I42A 2CU1A 4IW0A 2GMIC 2K1FA 3PRMB 3APDA 1E8XA 1WZ3A 4KDIC 4F1SA 3H7SA 5AZFA 1E5WA 4W9FA 4K1RB 1H8CA 3DVGY 4FJVB 2IY0B 3PLVA 1IPGA 1P9DU 1UZXB 4IWPA 4LDTD 2J0KA 3ML8A 1C3TA 2KN5A 2G45B 3QJZA 4AOFA 3Q3JA 1D3ZA 2IO0B 2O2VA 2IO3B 2KZRA 3GZNI 3GOEA 4W9JA 4PYUA 3A9KA 2KTRB 2FCQA 2ZNVB 4EZLA 3PRPB 3VTVA 2BWFA 2W9NA 2IO2B 4LJOB 1WR6E 4XX5A 1OEYJ 4HWIB 2MP2B 2JF5A 4MH0E 4MM3A 3ZNZB 2IO1B 5KHQA 1Y8RC 3N3KB 4JL9A 4FHJA 4GSWA 2Z59B 4W9IA 1XQQA 4BKSD 3W1SC 2KDBA 2M4NA 5E6PA 3RT3B 3UF8A 4KIKA 2MBBB 4WWPA 3SD5A 4NJ7A 4HCPB 5G2NA 5G55A 3IVFA 2N7EA 3KYCD 3V62A 2D11A 4ANWA 5CHWA 1WJ4A 2KLCA 3Q3FA 4PS7A 4KDLB 1TTNA 1V86A 1YIWA 3DVGX 4X57B 3MHSD 1Q0WB 3PLUA 2UYZB 1UD7A 4F8CB 5JH5C 4GDKB 1EO6A 3QARA 4RMAA 1EF1A 2AWTA 5DCNA 2FAZA 2L7RA 1LXDA 3ZTDA 5IA7A 1OTRB 4FN2A 4HDQA 1JRUA 3DOWA 3RD2A 5DPSA 1KLVA 2EKEC 4DDID 4MGIE 2KK8A
chains in the Genus database with same CATH superfamily
2N9LA 1EWYC 5GMVA 3PS6A 3LXFA 2R61A 2N1VA 3JSVB 3U52E 4JWSC 3V6CB 2V0GA 1L2NA 3RPFC 3URYA 4CYEA 2DYOA 3GS2A 2XK5A 2PPHA 3BK2A 3GE3C 4MEMA 1GPXA 3NVVA 1ACCA 3H9DA 2LHEA 3IHPC 3QC8B 4ZDVA 3W5VB 4GMVA 1IYFA 2G4DB 1K53A 3AI5A 2HJ1A 1FCLA 5IN7A 2OJRA 1I4PA 1XCTL 2KOXA 2V9HA 3AEEB 4H2AA 1L4ZB 5LXIB 2L05A 1V2YA 2WXMA 1OGWA 2RPVA 3X0WA 3RN9C 1WYGA 4MDKE 1ZDXA 3GB1A 5E6OA 4D2KA 4S0RA 3QX1A 1WXSA 3MFGA 3QAQA 3AEDB 4S17A 2JYTA 3N1YC 3W1SA 3EUB2 2AX5A 1HTOA 4LK0M 3VDZA 2BF8B 5DPRA 2WNMA 1XCQL 2MJDA 4IKGA 1L6UA 5I4DA 2JVCA 1CMXB 2JU6X 1D4BA 2ZJDA 1RAXA 4XDDA 2K25A 1N5WA 1NBFC 2O6VD 2XK5B 1P7EA 1QILA 3N32A 3AXCA 3MTNB 2ZVOA 1UH6A 2J4XA 2PMVA 1L4DB 3EC8A 1ISNA 5KHOA 1PDXA 1PGBA 4OZBA 2KVRA 2Y3AA 4B0EA 2GI9A 3ZO5B 4MJSA 2KANA 3UQAA 1GB4A 2V3PA 2KC2A 3TIXA 4BVUC 4YTNB 5FK9C 4US8A 2BGFA 1J7BA 3A4SC 3IT4B 4IM0A 1QF6A 2PVOD 2WX1A 3QIJA 4HK2A 2MBHA 2LGIA 4M01A 1NI2A 1NVID 4DK5A 4ANXA 2BKFA 2J53A 1TS4A 1FPYA 3UIPB 4FA6A 5J17A 4IDIA 5AEKB 1B1ZA 2UWQA 4MT5A 2DYBA 1KLGD 4DHJB 3I5JC 4WAAA 5AUKA 2X38A 4PT5A 1FXTB 2D2QA 4KIKB 4WWMA 3ZRFA 3AE6B 3VRBB 3C0RB 4FADA 1WJUA 5CTRC 4HRSA 3W5UB 2NVUI 5TSSA 1K50A 4YTPB 1D5ZC 3QCAA 3RULA 1QLBB 2WXGA 1D6EC 2LXCA 3H7PB 4A3PA 1SB3C 4M0WA 4MGZE 1PQSA 3L17A 2ZPNA 4EOYA 3N20C 2D07B 3LDZE 1ET9A 3ZJUA 2ZEQA 4GXBA 2QMTA 2NR2A 2NBUA 4C4VA 2WLBA 3P4QB 5AZGA 2IBIB 2ZZPB 2J7QB 1N60A 4FHKA 3N1XC 2K9XA 1ZPSA 2EMSA 1VZ8A 3EA6A 4FULA 4W9KA 4EKUA 4W9DA 3T8MA 4W9LA 2KTFA 5JHBA 1I4XA 3LB8C 1DOIA 5E6NA 4RGTA 2JWZA 2ZW0A 3KUCB 5CHFA 2DZJA 4IG7B 1JROA 1NYQA 4PYZA 3VTUA 2H89B 1E7UA 1FXAA 3BINA 5HKHA 2FIFA 1F2RI 2PLPA 1GC6A 2WXLA 2RGFA 3AM9A 2WXKA 4KV2A 1V97A 4HPMB 4IC7B 1UF0A 2V3SA 4B9KA 1KRHA 4HVBA 3BY4B 2KJ6A 5C1ZA 4KZCA 4EUTA 1OQQA 2DLBA 3HVDA 3VQIA 3PO0A 2MA9B 2R2QA 4ZRKA 1WGGA 3CF6E 2FCSA 3L08A 1C4CA 2GOWA 4TV3A 1KOTA 1HEZE 2XNAC 3ECIA 4JE3B 2WXNA 1GJZA 3DVNU 3SFEB 3NJTA 3PREA 1FFVA 3PPAA 1KFYB 2JRHA 3E9SA 4OVVA 3AULA 2KQ7A 2IPKD 4LNNA 1DGJA 3PRZA 1ZUD2 3PV1A 2ZPYA 1NYRA 4PK1A 1WMHA 2MWSB 1IGCA 4RM8A 4BFRA 4NJ6A 4GLSC 3NVZA 3HHMA 4E74A 1R7SA 3KQ4A 1ZGUB 3VUYA 2K0PA 3TBLD 1T5XD 3M3JA 2INNE 2INDC 2M0AA 2WXPA 1NDDA 2MHJA 2L3ZA 2DBYA 2ONQA 1J8CA 4N9F4 3W2DA 4XGAB 3V60A 1MHHE 2KQSA 2C7NB 1J7CA 1I4HA 1U4AA 2I38A 4NZLB 3VVWB 1EU3A 1UBQA 3I63C 2GBJA 2IY1B 3TEXA 2CU1A 1AN8A 4WAFA 1E8XA 1TKGA 1E5WA 1ZP0B 1UZXB 2W54A 1V1OA 1C3TA 1FO4A 3U4EG 2LFIA 1XLQA 2IO3B 4PYUA 2KTRB 4WQMA 4EZLA 2W9NA 1WRIA 2IO2B 4LJOB 1HTQA 3VR9B 4HKQA 1F77A 2IO1B 5KHQA 2VH1A 1IGDA 1Y8RC 4C4VB 2Z59B 2G1EA 3SD5A 3SR6A 1TT5B 4RFBA 3DHGC 3IVFA 3KYCD 4ZHOA 2D11A 4ANWA 4N58A 1KH0A 4PS7A 4KDLB 1V86A 2KVZA 1SBBB 4F8CB 4K3BA 3RMKC 4GDKB 3QARA 5DCNA 4A8XC 2AWTA 2Y5PA 2FAZA 1I4RA 2L7RA 4HDQA 4L23A 3RD2A 4MGIE 2KK8A 3ZJTA 3VTWA 1WI0A 3VFKA 2KAJA 3PZ8A 4AJYB 2LJIA 4OZCA 2LUEA 2N0SB 5IO9A 3AU5A 1T0QC 2FCNA 1K8RB 3UINB 4KKJA 1V5TA 3BZDB 1SXTA 4MGKE 4GDLB 2ZW1A 4QAYA 2L52A 1E7VA 3M63B 4YL8A 2L0FA 4OVZA 4WJOA 2HD5B 1WRDB 2NPTA 4A55A 1XT9B 3IG3A 1CQVA 1C76A 1IBXB 2J0JA 1T6BX 2OOBB 2V1YA 2V3NA 1M4VA 3AB5A 3IBEA 2WWZA 3B9JA 3TJPA 1ROEA 1UWMA 2BYEA 3T3NA 3K9OB 4KSKC 2LGDA 4WJPA 4YSXB 1XLOA 4REZA 2O6VB 2CR5A 1QQRA 3APFA 1N5XA 2XBBC 4JWUC 1FNVA 3DQVA 5IP4D 2RSUA 3JYUA 4WH4A 3ZVVA 4OVUA 1WH3A 1MFWA 4RCOA 3MJ5A 2PE6B 4BKGA 3NUHB 1WMHB 3DBSA 3TEZA 3B1LX 4B6WA 2GLSA 3VR8B 4TMAB 3PVLA 4XWTA 4HLEA 2AQ3B 2XEWA 4HEA1 4KKIA 2W3SA 1V8CA 3CMMB 3NHEB 3L10B 2RD0A 4WWOA 3AV8A 3UQBA 3X23A 2MEKA 1UUPA 1Q1OA 1IBXA 1T0RC 1WXQA 4P1CC 4RGOS 3KUDB 1HQRD 1N63A 3ZTCA 1XF5L 1L0YB 4M02A 1TS3A 2LEKA 2GB1A 1BT0A 1I35A 2WQYB 5FR6A 1P1AA 3DBRB 5G5HA 3DBHB 4BKTA 1H4RA 3MHZA 4CO7A 3PT2B 2QDFA 3K9PB 4LNKA 4ACFA 4B0MA 1WFYA 2L32A 1YN5A 2I2YA 2MLBA 3N30A 2KT7A 2BW2A 3ML9A 3TUOA 3U7DA 5C23A 3KW5B 3WIMA 1FRRA 3WA0A 4AQ7A 2KD0A 2LD9A 2LMCA 3U30A 2C60A 3WAPA 3WALA 3ZLZA 2M0XA 4J3OD 4JQWC 1FIQA 1JWSD 2FUG1 2C5LC 2QEJC 3HVZA 4W9GA 2PEAA 2KJRA 3AE8B 3VHTC 3WCQA 2XN9C 3JW0X 5J18A 4RM9A 2DHZA 3A33B 1AW7A 4WQOB 2A4ZA 4LCDE 1TY0A 2O6VA 2ZNVC 1YN3A 2NTSA 5D6JB 1T0YA 2VRRB 2BWES 4ANUA 3RNFC 2WDTB 3KVFB 4DQOC 1V1PA 3DBRI 2KX3A 1MVKA 2M8SA 2DAFA 1J7AA 2LI5A 4GU2A 5D3IB 3MJWA 3GP7A 1WM2A 1SJHD 1UGMA 1WIAA 1ZXIA 3H7PA 1Z2MA 4M0WB 3MC9A 3V05A 4ZHPA 3RNCC 2NPTB 2LASA 3Q3OC 4AUQC 3EHVA 3AH7A 2BB6A 3NZSA 2KWUB 4BOSC 2K39A 1D5XC 1V80A 3IAM1 3ABVB 2N9KA 1RLFA 1LQBA 5T8IA 4XYCA 2DNFA 3A9JA 1WWTA 1ZE3D 2M56B 1JWBD 3ZXRA 2SEBD 4M00A 3NOBA 1WXVA 4FLHA 2CHWA 4A90A 1UGJA 1F0ZA 2DZKA 5EE1A 2EKIA 1SJED 3B2GA 3P4SB 2HJ8A 4DHZE 1FCCC 3R7QA 1I7HA 2OEDA 1YX6B 1JW9D 4OW0A 3VH3B 3ALBA 3BIID 2BKRB 3FILA 1GG3A 1SIFA 1YD8U 2DYMA 4HROA 1BUIC 4FBJB 1E8ZA 4IUMB 1SE3A 2CJNA 1E10A 2N7JA 2L8JA 3AE9B 2L00B 2Z0DB 3BWUD 2D3GA 2HTHA 1TBEA 1MG8A 1IP9A 2EMTA 4JLCA 2K8HA 4NAMA 1JMLA 1YMHE 2KYWA 3O13A 4IM3A 2JXTA 1QOBA 2M1MA 2QHOA 3RYTA 3V3XA 5BMHA 4AP4C 4BKSA 1UELA 3BVMA 2WGSA 1FMAD 5IOIA 3Q8FA 4NAWA 3Q14C 3QK0A 2RR9A 1N6ZA 4WJQA 5H92C 3ZIMA 2G9HD 1PFDA 1QKZA 2L0TA 3ZNID 1PYWD 4M8NA 2M17A 1JWAD 2RMMA 4RGNA 2MJEA 3R8BA 3QWZB 1C4PA 2PW9A 3L13A 1FNUA 3SEBA 4II2B 4K81A 3ZNHB 2KQ4X 3C8YA 2K3UA 4YSYB 1F52A 5EE0A 1VLBA 4P1BC 1HZ5A 1QOAA 4KX6B 4PS3A 2LVOA 1ZKHA 3ZRCA 1KTKA 3IFWB 2JZ3B 4JX1C 1D5MC 1WXAA 3JVZX 3Q3NC 4HCNB 2V4IB 4ZRQA 2KC1A 3UGBB 2ICIA 4YXDB 1QZEA 2KHWB 2RDGA 1ET6A 3PRMB 3APDA 5AZFA 3DVGY 4FJVB 3KWVA 3PLVA 4LNFA 3QJZA 1D3ZA 1C4AA 2O2VA 2WXFA 2KZRA 3GZNI 2TSSA 3A9KA 3PRPB 1OEYJ 2MP2B 2JF5A 1KLUD 4MM3A 3ZNZB 4FHJA 1C77A 2B76B 2JYEA 2M4NA 4KIKA 2BBCA 4HCPB 1FNWA 2N7EA 3V62A 2KWDA 3BYYB 3KWLA 3MHSD 1Q0WB 2W55A 2UYZB 1UD7A 3PLUA 2QC8A 1EO6A 4RMAA 1EF1A 5IA7A 2D3AA 3AEBB 4DDID 1SE2A 1L0XB 1P98A 3T9LA 2AL3A 1L6VA 3APCA 4MSMB 1TS5A 2MCNB 5D7GA 2KDEB 3AE7B 1SF0A 2NBWB 4ZYSA 4WIPA 3W1YA 3I9V1 3ETRA 2DZMA 2K8BA 1VJKA 4FXCA 2LGXA 2YEPB 1RM6C 2WU5B 5H8YE 2K5PA 1GB1A 3Q6BA 1XEEA 1RFAA 1WZ0A 4DHJD 1G6JA 2AYOB 3GE8C 3A1QB 4ASWC 4I6PA 2PJHA 1X1MA 4OHJA 3Q69A 2VZKD 2R2OA 3OAWA 1VZ7A 1J19A 4HJKA 2N7DA 4XC2A 2MBQA 2KX0A 3AEAB 4A9AA 4NQLB 2J52A 3NZUA 1C79A 2WX0A 4W9EA 1XXGA 5AUIA 1JCKB 3R3MA 4KGRA 3RZFA 4C56C 4C00A 2IDYA 3UIOB 1E0ZA 1SGHA 2GBRA 4K7WA 5HI1A 2NBVB 4DXAB 2NCNA 4J6IA 2IGHA 3B0AA 4KVGB 2WXJA 1KF6B 4W9CA 2FNJB 4ANVA 2D3BA 4TUUA 1WY8A 3D32A 3Q2AC 2QSDA 3AE3B 3RUIB 4ICUA 1F1HA 2FBWB 1RFKA 1N61A 4HPPA 1K52A 1XLNA 1E8WA 1MPEA 1YX5B 3Q8CA 4BBNF 3VXWA 4WJNA 3QA8A 2LJ5A 4KZ0A 1HZ6A 3CSTA 2NMQA 3ZUNA 2G3QB 1WE6A 2REXA 4C80A 3EFUA 1KJTA 4KGSA 1T3QA 2MSED 2WXIA 3AECB 2PIAA 2JPHA 2NTTA 1L7YA 5CHVC 5EDSA 1QOFA 5FR3A 1R4MI 3C19A 2QJLA 4II3B 1XD3B 1M94A 5BO4B 4K7UA 2LGYA 3VUWA 2BS2B 3AE1B 4EFOA 3A9JB 3A9KB 1NEKB 2DAJA 2KWCA 3U2SC 4ZRJA 1A5RA 2FUHB 3WAMA 1GUAB 2DWQA 1PGAA 3ZW3A 2GRIA 3KUZA 1Q10A 1I4GA 2RPQA 4NPNA 2KXJA 3DBHI 2KFJA 2BQQA 3LYYA 1KM7A 3ZDTA 1JQ4A 1EF5A 2CHXA 3VAWA 4AJWA 1T0SC 3DBLI 4DBGA 3OWEB 2N9EB 3M95A 4P7IA 1WSPA 5DPWA 2MRPA 2MH7A 1EM7A 1VR9A 3I3TB 1EWCA 2AQ1B 3SHQA 4A6QA 3OG5A 4AWJA 4ARIA 4NQKE 2BS3B 2YVCA 2DZIA 2AEHA 4MELA 2E3TA 1B9RA 2KMCA 2A5UA 2KDMA 2IZVB 5BMIA 2KDIA 4A3OA 3LJ3A 3AE5B 2HDEA 4K3CA 2L76A 3PHXB 1PGXA 1ENFA 2LZ6A 1E9MA 3AMZA 3NRZA 4NAWB 5JHAA 1GOZA 1YJ1A 1NENB 2VZKB 3FAHA 3H6NA 3L4PA 4P6VF 1STEA 4TSSA 2LVPA 4IOIE 2FCMA 4DWFA 4ZYNA 3BVZA 4IM2A 1YQBA 2KTRA 1HE8A 2KWVB 2JY6A 3PGEA 4E3CA 2LHDA 4NY0A 2MJ3A 1RYJA 2J0MA 1FXIA 1WGDA 1MI0A 1J0GA 1YJJA 1LGRA 4JGHB 2JZZA 4ZRIA 4IWQA 3H8HA 3O65B 3Q8EA 3PZDA 1V5OA 2WDVB 1BXTA 2JUOA 4DXFA 5L95C 1WGHA 1VZ6A 1TIFA 3P63A 4GOCA 1TS2A 5BMGA 5BYQA 2ACZB 2KFKA 4G3XB 4RGMA 5IKCM 1AWDA 1PUTA 3TEWA 3L0WB 1V1PB 2O2VB 3BYTB 3DHIC 2FIDA 4MSQB 3RI7C 4EZJA 1V9JA 1YQ3B 4NJCA 4TKNA 5EE3A 1LM8B 1V49A 3EGRA 3ZNGC 1RWSA 3DWMA 4MJSB 2MX2A 1DOXA 2DX5B 1Z5SB 3TEYA 1WJ6A 4I6LB 2KKCA 1E90A 1AARA 3DVNV 1WX8A 3SU8X 1WGYA 3IAS1 3M62B 3KYDD 4FJZA 2K8CA 4ICVA 2HTME 2I1JA 3PZ7A 5TR5A 4XWWA 4JIOU 2LRWA 3HUIA 1BMLC 5JZEB 1YJIA 3HRDD 1YOVB 3DWGC 3BK1A 3HM6X 3RNBC 1WR1A 2LGSA 3R7RA 1WJNA 2AL6A 1TKEA 3R66C 2JX5A 4TQ0A 3IXSA 2N9XA 5LNK1 1I42A 3RNGC 2GMIC 2K1FA 3RNAC 3H7SA 1H8CA 2IY0B 3J9CA 3P4RB 1K51A 3ML8A 2G45B 5C2TB 4AOFA 3Q3JA 2IO0B 4W9JA 1YN4A 2FE8A 5GXGB 2FCQA 2ZNVB 2BWFA 2WS3B 1WR6E 3B2FA 4XX5A 5C3JB 4HWIB 4MH0E 4KGTA 3N3KB 4JL9A 4W9IA 1XQQA 3EFCA 4BKSD 2KDBA 1MHXA 3RT3B 3UF8A 4WWPA 2IGGA 1AYFA 4NJ7A 5G2NA 3AE2B 1WJ4A 2KLCA 1ZDVA 3Q3FA 2H88B 3DVGX 4X57B 4EE2A 3ZJVA 3MC8A 3RNEC 4Q2JA 1R4NB 3ZTDA 4MM3B 1JRUA 5DPSA 1KLVA 4P16A 2L1AA 2C9WB 2N4FA 1SEBD 1GC7A 3RCZA 1Q5WB 1VDVA 3H1UA 2PTLA 1MG4A 3CSFA 2CHZA 3OJ3A 3HIZA 4K7SA 4L1BA 1IUEA 3DDCB 1SE9A 1OFFA 2GBMA 3P4PB 4G0NB 4TQ1A 2WP9B 5FKAC 2MQJA 3QQ8B 2IJ0A 1Y56A 2ZVNA 1TYGB 5BYSA 1EU4A 4MH8A 4HPLB 2C7MB 3ENEA 4ZRPA 3HM3A 2BTEA 4JPSA 3PTFC 4BZAA 2MBEA 2OJWA 3B08A 2E6XA 5D94A 3SFDB 3U8ZA 3PSEB 2MP2A 4CHKA 3TL5A 3ZKJC 3OLMD 4DDGD 2D10A 1ESFA 2WXHA 4DHZB 2CS4A 1ZXHA 2BYFA 4LLGM 4HKZE 4EEWA 1FFUA 3L54A 3AU4A 2GBKA 2JWUA 2QCZA 3NY5A 1ZW7A 4RF0A 5J2RA 4AS1A 2IYDB 1WGKA 2RDHA 1TZ1A 4HXDA 2OHFA 4LNIA 2Z0EB 1C1YB 4XE0A 4MGYE 1OQYA 1E6EB 2MBOA 4R3DA 4O1NA 3P42A 2WYQA 1S1QB 1L5PA 2KN4A 2W3RA 1DOYA 4UDUC 3ZYYX 1C9FA 4A20A 3HK0A 1OQRA 1P7FA 4PS8A 3U7ZA 4LNOA 2AQ2B 1V81A 2YEPF 2K6DB 1VCBA 1FRDA 1JRPA 1F2RC 1FEHA 4GDKA 3DBLB 5G5GA 3AN1A 1VD2A 1S3SG 3PHWB 4RH6A 1WM3A 3NVWA 1P0RA 4USAA 3Q3MC 4BOZB 3AEFB 3R2IA 4BBNC 2LVQA 1WE7A 3SDLC 2WXOA 3S2AA 1E8YA 3Q8BA 2KMAA 2G4SA 4WURA 3TCAA 4G50A 1WF9A 2ASQA 3VUXA 2JZPA 3A4RA 1WX7A 2PVGC 3MP9A 1TKYA 4ITKA 2K22A 4YWGG 1WYWB 4GDLA 3MC0B 3W9CB 4IWOA 2D3CA 4N6EB 2Y5BB 3VH4B 3Q8AA 2KNBA 1E7PB 5DPTA 4C7ZA 1OEYA 4G11A 2BPSA 2WXQA 2LXAA 2N1WA 4HDOA 2LWPA 2CU3A 2WXRA 1QOGA 2JRIB 4YSZB 4LTUA 3I57A 2Y5CA 4LDTB 1VRAB 3DPDA 1V6EA 3NS8A 2LUMA 2K6QA 3P1MA 1UBIA 4I6NB 1R4NI 4B95A 3WAOA 2IGDA 1P3QU 1UWXA 5LLIA 3V6EB 2MW5A 4M8MA 1HA5A 5E6JA 3KH0A 3N9YC 4GGQA 1A70A 2WU2B 1JWUD 1LFDA 3ZXVA 1YNTE 3ZGZA 3CIRB 1L0VB 2ON8A 4FJYA 2NS5A 4LJPB 1WGRA 3AE4B 1FD6A 2CKHB 2KJHB 2KACA 4N59A 5D2MB 4YT0B 1F9JA 3EECA 5D3DA 1UNSA 4EZKA 1CZPA 2INCC 4URKA 3OJ4B 3L16A 4XDCA 1JALA 3TMPB 2Z8LA 2PKOA 3WANA 2KLGA 1R4MB 1HXYD 1XO3A 2N9PC 2QIEB 1TY2A 3NVYA 4KSLC 4US9A 1XLPA 1I4QA 2W82A 4E71A 2ZCCA 4YTMB 2M19A 3E56A 1GAQB 3FC4A 3T3OA 2JT4B 2HE7A 4GB9A 3A1QA 4ZOHC 2BT6A 3NG0A 4CQNA 3CWIA 2WDQB 2Q5WD 1MJDA 3P2BA 1YQ4B 3RFZB 1CK1A 1ZOYB 3R2TA 5AZHA 3ONSA 2I1KA 3ZDMC 2V4LA 4WWNA 2KFKB 3TSSA 2BYVE 3DCGA 4HJGE 4NNJB 2PE9A 5L83A 2D5GA 5LXHA 2CJOA 2WDRB 2X8XX 4GN1A 2JSVX 4RF1A 2GBNA 2ZCBA 2RDBC 1EUVB 3GZNB 3IT6B 3RZWC 2KDFB 2B3AA 2BYTA 5CX3A 2JXXA 5BYRA 1WXMA 2L83A 3AEGB 3KLSX 3ZQ4A 3UI3A 4OZAA 4W9HA 5HG2A 2EELA 2LRUA 1WX9A 2KMMA 3VRAB 4GIVA 3QHTA 3DHHC 1GNUA 5MPOA 2YLMA 2SAKA 4XZ4A 4F7ZA 2DENB 1SIJA 2C7HA 1DYQA 3JSVA 2KO3A 1RRBA 2BB5A 3V61A 2QILA 5IAAC 1FM0D 4DXGA 1TGZB 4IW0A 1WZ3A 4KDIC 4F1SA 4W9FA 4K1RB 3N1ZC 2BVCA 5JXVA 4IWPA 4LDTD 1IPGA 1P9DU 2J0KA 2KN5A 2JQRB 3GOEA 4RNAA 2WHIA 4BAXA 2VH2A 1CJEA 3NZ3A 1N62A 5HFYA 1TZOA 3VTVA 4ARCA 1SSNA 1JWMD 1SE4A 4GSWA 3FILB 3W1SC 5E6PA 2MBBB 5HHDG 1QT9A 1LO5D 5G55A 2INPE 1NI3A 5CHWA 2BS4B 1TTNA 1YIWA 3BVGA 3NS1A 4L2YA 4MACA 2UU7A 5JH5C 3FKYA 5EE9A 4C7YA 1C78A 1LXDA 1OTRB 4FN2A 3DOWA 1TJEA 2EKEC 2J42A
chains in the Genus database with same CATH topology
2C9WB 3VTWA 3T9LA 1P98A 1WI0A 2AL3A 2N4FA 3VFKA 3APCA 4AJYB 4MSMB 2LUEA 1GC7A 3AU5A 3RCZA 1Q5WB 3PS6A 5GMVA 2FCNA 2MCNB 3H1UA 5D7GA 2N1VA 2KDEB 3CSFA 3JSVB 2CHZA 1K8RB 3OJ3A 2NBWB 3HIZA 3V6CB 4K7SA 3UINB 3W1YA 1V5TA 1L2NA 4MGKE 4GDLB 4CYEA 3DDCB 2DZMA 1SE9A 1E7VA 2K8BA 3M63B 2DYOA 2GBMA 2PPHA 2XK5A 4YL8A 2L0FA 2LGXA 4G0NB 4MEMA 4WJOA 4TQ1A 2HD5B 1WRDB 2MQJA 1RFAA 1WZ0A 2NPTA 3QQ8B 3H9DA 4DHJD 1G6JA 2AYOB 1XT9B 3IHPC 2ZVNA 3A1QB 3QC8B 4ASWC 3IG3A 2PJHA 4I6PA 4ZDVA 1X1MA 4GMVA 1IYFA 2J0JA 2G4DB 2R2OA 3AI5A 3OAWA 4HPLB 2C7MB 2OJRA 2OOBB 2KOXA 2V1YA 1J19A 3ENEA 4HJKA 3IBEA 3HM3A 2WWZA 3PTFC 3TJPA 2MBEA 2BYEA 2N7DA 3K9OB 5LXIB 4XC2A 3B08A 4KSKC 2L05A 1V2YA 5D94A 2LGDA 2MBQA 4WJPA 3U8ZA 3PSEB 2MP2A 4CHKA 3TL5A 2KX0A 1OGWA 3X0WA 2O6VB 2CR5A 3ZKJC 4MDKE 3OLMD 4DDGD 4NQLB 3APFA 2D10A 5E6OA 3NZUA 2XBBC 4DHZB 2CS4A 2WX0A 3QX1A 2BYFA 4W9EA 1WXSA 3DQVA 3R3MA 3QAQA 4EEWA 3L54A 3AU4A 3RZFA 2RSUA 3JYUA 3W1SA 2GBKA 3NY5A 1ZW7A 3ZVVA 4OVUA 1WH3A 5J2RA 3UIOB 1SGHA 2GBRA 2IYDB 4K7WA 1TZ1A 2PE6B 4BKGA 4HXDA 2NBVB 3VDZA 1WMHB 2BF8B 3DBSA 5DPRA 4DXAB 2NCNA 3B1LX 4J6IA 2Z0EB 1C1YB 4B6WA 3B0AA 4KVGB 4MGYE 4W9CA 1OQYA 2FNJB 2MBOA 4ANVA 2JVCA 1CMXB 3PVLA 2WYQA 1S1QB 4TUUA 4HLEA 1WY8A 2XEWA 1RAXA 2ZJDA 2K25A 1NBFC 3D32A 2O6VD 3RUIB 3CMMB 2XK5B 4ICUA 3NHEB 3N32A 4A20A 3AXCA 3HK0A 3L10B 3MTNB 2ZVOA 1UH6A 4PS8A 1E8WA 2RD0A 3EC8A 1ISNA 1YX5B 4WWOA 5KHOA 3UQBA 4BBNF 3X23A 2KVRA 3VXWA 4WJNA 1V81A 1Q1OA 3ZO5B 3QA8A 4MJSA 2K6DB 1VCBA 2LJ5A 4KZ0A 2KANA 3CSTA 3UQAA 3ZUNA 3KUDB 2G3QB 2KC2A 4GDKA 1WE6A 2REXA 3TIXA 4BVUC 1VD2A 1S3SG 2BGFA 3EFUA 3PHWB 1WM3A 1KJTA 3A4SC 4IM0A 1P0RA 3ZTCA 2WX1A 3QIJA 2MSED 4HK2A 2MBHA 4BOZB 2JPHA 1BT0A 1NI2A 1I35A 1L7YA 5FR6A 5CHVC 4BBNC 2LVQA 1P1AA 1WE7A 5EDSA 3SDLC 4DK5A 3S2AA 4ANXA 1E8YA 2BKFA 2KMAA 1R4MI 2G4SA 3TCAA 3UIPB 4BKTA 4CO7A 1H4RA 4FA6A 4G50A 1WF9A 2ASQA 5J17A 4II3B 1XD3B 3VUXA 1M94A 5AEKB 3PT2B 3A4RA 5BO4B 3K9PB 2LGYA 4K7UA 3VUWA 1WFYA 1WX7A 2UWQA 4EFOA 1WYWB 3A9JB 3A9KB 4GDLA 2DAJA 2DYBA 4DHJB 2KWCA 4IWOA 4WAAA 4ZRJA 2MLBA 3N30A 1A5RA 3ML9A 2Y5BB 2FUHB 3U7DA 3VH4B 3WAMA 1GUAB 1FXTB 2D2QA 4KIKB 3ZRFA 5C23A 2KNBA 3KW5B 3WIMA 5DPTA 1OEYA 4G11A 3ZW3A 3WA0A 3KUZA 2BPSA 2KD0A 2LD9A 2RPQA 3U30A 2C60A 3WAPA 3C0RB 3WALA 2M0XA 2LXAA 4NPNA 3ZLZA 2KXJA 3DBHI 2N1WA 1WJUA 4JQWC 5CTRC 4FADA 2C5LC 2KFJA 2NVUI 1KM7A 4W9GA 3ZDTA 4HDOA 1EF5A 2PEAA 2KJRA 2LWPA 3QCAA 2CHXA 3VAWA 3VHTC 4AJWA 3RULA 3DBLI 4DBGA 2JRIB 2N9EB 3M95A 3JW0X 5J18A 2LXCA 3H7PB 4P7IA 2DHZA 4RM9A 4A3PA 3A33B 4MGZE 4WQOB 2A4ZA 1PQSA 4LCDE 5DPWA 2MRPA 3L17A 4LDTB 2O6VA 2ZNVC 2ZPNA 4EOYA 3DPDA 2D07B 1V6EA 3LDZE 3NS8A 2K6QA 3I3TB 5D6JB 1T0YA 2ZEQA 4GXBA 1UBIA 2VRRB 2NR2A 2BWES 1R4NI 4I6NB 4ANUA 4B95A 3SHQA 3WAOA 2NBUA 1P3QU 4AWJA 2WDTB 3KVFB 4NQKE 5LLIA 3DBRI 3V6EB 2MW5A 2KX3A 2DZIA 2M8SA 2YVCA 4M8MA 2DAFA 2AEHA 2LI5A 3KH0A 4MELA 4GU2A 3MJWA 5AZGA 2KMCA 2A5UA 2IBIB 2ZZPB 4GGQA 2J7QB 1WM2A 1LFDA 2IZVB 1UGMA 2KDIA 1WIAA 4A3OA 4FHKA 3H7PA 3LJ3A 4FJYA 1Z2MA 2NS5A 4LJPB 4M0WB 1WGRA 2EMSA 2CKHB 2KJHB 2L76A 2LASA 2NPTB 3PHXB 5D2MB 4AUQC 3EHVA 2LZ6A 4NAWB 5JHAA 1F9JA 3EECA 1YJ1A 3NZSA 4FULA 2KWUB 4BOSC 2K39A 4W9KA 4EZKA 1V80A 3H6NA 4EKUA 4URKA 3OJ4B 3L16A 4W9DA 3TMPB 3T8MA 1RLFA 1LQBA 2LVPA 4W9LA 2KTFA 3A9JA 3WANA 2KLGA 5JHBA 5E6NA 2JWZA 2FCMA 2N9PC 4DWFA 4ZYNA 4KSLC 3KUCB 1WXVA 3NOBA 2CHWA 2DZJA 4FLHA 5CHFA 4IG7B 3VTUA 4PYZA 4IM2A 1E7UA 1YQBA 2DZKA 2KTRA 1HE8A 2KWVB 3BINA 5HKHA 2JY6A 2FIFA 1GC6A 2HJ8A 4DHZE 2ZCCA 4E71A 2RGFA 3PGEA 4E3CA 4KV2A 4NY0A 3R7QA 4HPMB 4IC7B 2J0MA 2V3SA 4B9KA 1WGDA 1J0GA 4JGHB 2JZZA 4ZRIA 4IWQA 1YX6B 3O65B 3PZDA 3VH3B 2JT4B 1V5OA 2HE7A 4GB9A 3BY4B 4HVBA 2JUOA 2KJ6A 3ALBA 5C1ZA 3A1QA 4KZCA 2BKRB 4EUTA 5L95C 1GG3A 1SIFA 1YD8U 1WGHA 2DYMA 4FBJB 4GOCA 1E8ZA 2KFKA 4G3XB 4IUMB 3VQIA 2L8JA 2L00B 2Z0DB 2D3GA 2MA9B 2R2QA 4ZRKA 1WGGA 1TBEA 2HTHA 1MG8A 3L0WB 3CF6E 3P2BA 1IP9A 2FCSA 2O2VB 3L08A 2GOWA 2EMTA 2FIDA 4JLCA 4MSQB 2K8HA 4TV3A 5AZHA 1KOTA 3ONSA 2I1KA 4EZJA 1V9JA 4IM3A 3ECIA 3ZDMC 2V4LA 2M1MA 2QHOA 3RYTA 4TKNA 1LM8B 1V49A 2KFKB 4WWNA 1GJZA 4AP4C 3DVNU 4BKSA 1UELA 2BYVE 3ZNGC 4MJSB 3PREA 3DCGA 3PPAA 2JRHA 4NNJB 2PE9A 2MX2A 5L83A 4OVVA 2DX5B 1Z5SB 4NAWA 5LXHA 4GN1A 3QK0A 2RR9A 2GBNA 3AULA 2ZCBA 1WJ6A 4WJQA 4I6LB 3ZIMA 2KQ7A 2KKCA 1E90A 1AARA 3DVNV 1WX8A 1EUVB 2L0TA 3PRZA 2M17A 4M8NA 3RZWC 3PV1A 3SU8X 3ZNID 1WGYA 2ZPYA 2KDFB 2B3AA 3QWZB 5CX3A 3M62B 1WMHA 2MWSB 3L13A 2JXXA 3KYDD 4RM8A 1WXMA 4FJZA 2K8CA 4ICVA 4II2B 4K81A 4W9HA 4BFRA 2I1JA 2LRUA 4NJ6A 5TR5A 1WX9A 3ZNHB 3HHMA 4E74A 4JIOU 1ZGUB 3VUYA 2LRWA 3TBLD 4GIVA 3QHTA 5JZEB 3M3JA 1GNUA 2YLMA 3HM6X 1NDDA 1WR1A 4XZ4A 2L3ZA 4PS3A 4F7ZA 2LVOA 1J8CA 1ZKHA 4N9F4 2DENB 3ZRCA 3R7RA 3IFWB 3V60A 2JZ3B 2KQSA 1WJNA 2C7NB 2AL6A 2C7HA 1WXAA 3JVZX 3JSVA 3R66C 1U4AA 4HCNB 2KO3A 1RRBA 2KC1A 4TQ0A 3UGBB 3VVWB 2N9XA 1UBQA 3V61A 5IAAC 1QZEA 2KHWB 2GBJA 2IY1B 1TGZB 1I42A 2CU1A 4IW0A 2GMIC 2K1FA 3PRMB 3APDA 1E8XA 1WZ3A 4KDIC 4F1SA 3H7SA 5AZFA 1E5WA 4W9FA 4K1RB 1H8CA 3DVGY 4FJVB 2IY0B 3PLVA 1IPGA 1P9DU 1UZXB 4IWPA 4LDTD 2J0KA 3ML8A 1C3TA 2KN5A 2G45B 3QJZA 4AOFA 3Q3JA 1D3ZA 2IO0B 2O2VA 2IO3B 2KZRA 3GZNI 3GOEA 4W9JA 4PYUA 3A9KA 2KTRB 2FCQA 2ZNVB 4EZLA 3PRPB 3VTVA 2BWFA 2W9NA 2IO2B 4LJOB 1WR6E 4XX5A 1OEYJ 4HWIB 2MP2B 2JF5A 4MH0E 4MM3A 3ZNZB 2IO1B 5KHQA 1Y8RC 3N3KB 4JL9A 4FHJA 4GSWA 2Z59B 4W9IA 1XQQA 4BKSD 3W1SC 2KDBA 2M4NA 5E6PA 3RT3B 3UF8A 4KIKA 2MBBB 4WWPA 3SD5A 4NJ7A 4HCPB 5G2NA 5G55A 3IVFA 2N7EA 3KYCD 3V62A 2D11A 4ANWA 5CHWA 1WJ4A 2KLCA 3Q3FA 4PS7A 4KDLB 1TTNA 1V86A 1YIWA 3DVGX 4X57B 3MHSD 1Q0WB 3PLUA 2UYZB 1UD7A 4F8CB 5JH5C 4GDKB 1EO6A 3QARA 4RMAA 1EF1A 2AWTA 5DCNA 2FAZA 2L7RA 1LXDA 3ZTDA 5IA7A 1OTRB 4FN2A 4HDQA 1JRUA 3DOWA 3RD2A 5DPSA 1KLVA 2EKEC 4DDID 4MGIE 2KK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9W B;  3VTW A;  3T9L A;  1P98 A;  1WI0 A;  2AL3 A;  2N4F A;  3VFK A;  3APC A;  4AJY B;  4MSM B;  2LUE A;  1GC7 A;  3AU5 A;  3RCZ A;  1Q5W B;  3PS6 A;  5GMV A;  2FCN A;  2MCN B;  3H1U A;  5D7G A;  2N1V A;  2KDE B;  3CSF A;  3JSV B;  2CHZ A;  1K8R B;  3OJ3 A;  2NBW B;  3HIZ A;  3V6C B;  4K7S A;  3UIN B;  3W1Y A;  1V5T A;  1L2N A;  4MGK E;  4GDL B;  4CYE A;  3DDC B;  2DZM A;  1SE9 A;  1E7V A;  2K8B A;  3M63 B;  2DYO A;  2GBM A;  2PPH A;  2XK5 A;  4YL8 A;  2L0F A;  2LGX A;  4G0N B;  4MEM A;  4WJO A;  4TQ1 A;  2HD5 B;  1WRD B;  2MQJ A;  1RFA A;  1WZ0 A;  2NPT A;  3QQ8 B;  3H9D A;  4DHJ D;  1G6J A;  2AYO B;  1XT9 B;  3IHP C;  2ZVN A;  3A1Q B;  3QC8 B;  4ASW C;  3IG3 A;  2PJH A;  4I6P A;  4ZDV A;  1X1M A;  4GMV A;  1IYF A;  2J0J A;  2G4D B;  2R2O A;  3AI5 A;  3OAW A;  4HPL B;  2C7M B;  2OJR A;  2OOB B;  2KOX A;  2V1Y A;  1J19 A;  3ENE A;  4HJK A;  3IBE A;  3HM3 A;  2WWZ A;  3PTF C;  3TJP A;  2MBE A;  2BYE A;  2N7D A;  3K9O B;  5LXI B;  4XC2 A;  3B08 A;  4KSK C;  2L05 A;  1V2Y A;  5D94 A;  2LGD A;  2MBQ A;  4WJP A;  3U8Z A;  3PSE B;  2MP2 A;  4CHK A;  3TL5 A;  2KX0 A;  1OGW A;  3X0W A;  2O6V B;  2CR5 A;  3ZKJ C;  4MDK E;  3OLM D;  4DDG D;  4NQL B;  3APF A;  2D10 A;  5E6O A;  3NZU A;  2XBB C;  4DHZ B;  2CS4 A;  2WX0 A;  3QX1 A;  2BYF A;  4W9E A;  1WXS A;  3DQV A;  3R3M A;  3QAQ A;  4EEW A;  3L54 A;  3AU4 A;  3RZF A;  2RSU A;  3JYU A;  3W1S A;  2GBK A;  3NY5 A;  1ZW7 A;  3ZVV A;  4OVU A;  1WH3 A;  5J2R A;  3UIO B;  1SGH A;  2GBR A;  2IYD B;  4K7W A;  1TZ1 A;  2PE6 B;  4BKG A;  4HXD A;  2NBV B;  3VDZ A;  1WMH B;  2BF8 B;  3DBS A;  5DPR A;  4DXA B;  2NCN A;  3B1L X;  4J6I A;  2Z0E B;  1C1Y B;  4B6W A;  3B0A A;  4KVG B;  4MGY E;  4W9C A;  1OQY A;  2FNJ B;  2MBO A;  4ANV A;  2JVC A;  1CMX B;  3PVL A;  2WYQ A;  1S1Q B;  4TUU A;  4HLE A;  1WY8 A;  2XEW A;  1RAX A;  2ZJD A;  2K25 A;  1NBF C;  3D32 A;  2O6V D;  3RUI B;  3CMM B;  2XK5 B;  4ICU A;  3NHE B;  3N32 A;  4A20 A;  3AXC A;  3HK0 A;  3L10 B;  3MTN B;  2ZVO A;  1UH6 A;  4PS8 A;  1E8W A;  2RD0 A;  3EC8 A;  1ISN A;  1YX5 B;  4WWO A;  5KHO A;  3UQB A;  4BBN F;  3X23 A;  2KVR A;  3VXW A;  4WJN A;  1V81 A;  1Q1O A;  3ZO5 B;  3QA8 A;  4MJS A;  2K6D B;  1VCB A;  2LJ5 A;  4KZ0 A;  2KAN A;  3CST A;  3UQA A;  3ZUN A;  3KUD B;  2G3Q B;  2KC2 A;  4GDK A;  1WE6 A;  2REX A;  3TIX A;  4BVU C;  1VD2 A;  1S3S G;  2BGF A;  3EFU A;  3PHW B;  1WM3 A;  1KJT A;  3A4S C;  4IM0 A;  1P0R A;  3ZTC A;  2WX1 A;  3QIJ A;  2MSE D;  4HK2 A;  2MBH A;  4BOZ B;  2JPH A;  1BT0 A;  1NI2 A;  1I35 A;  1L7Y A;  5FR6 A;  5CHV C;  4BBN C;  2LVQ A;  1P1A A;  1WE7 A;  5EDS A;  3SDL C;  4DK5 A;  3S2A A;  4ANX A;  1E8Y A;  2BKF A;  2KMA A;  1R4M I;  2G4S A;  3TCA A;  3UIP B;  4BKT A;  4CO7 A;  1H4R A;  4FA6 A;  4G50 A;  1WF9 A;  2ASQ A;  5J17 A;  4II3 B;  1XD3 B;  3VUX A;  1M94 A;  5AEK B;  3PT2 B;  3A4R A;  5BO4 B;  3K9P B;  2LGY A;  4K7U A;  3VUW A;  1WFY A;  1WX7 A;  2UWQ A;  4EFO A;  1WYW B;  3A9J B;  3A9K B;  4GDL A;  2DAJ A;  2DYB A;  4DHJ B;  2KWC A;  4IWO A;  4WAA A;  4ZRJ A;  2MLB A;  3N30 A;  1A5R A;  3ML9 A;  2Y5B B;  2FUH B;  3U7D A;  3VH4 B;  3WAM A;  1GUA B;  1FXT B;  2D2Q A;  4KIK B;  3ZRF A;  5C23 A;  2KNB A;  3KW5 B;  3WIM A;  5DPT A;  1OEY A;  4G11 A;  3ZW3 A;  3WA0 A;  3KUZ A;  2BPS A;  2KD0 A;  2LD9 A;  2RPQ A;  3U30 A;  2C60 A;  3WAP A;  3C0R B;  3WAL A;  2M0X A;  2LXA A;  4NPN A;  3ZLZ A;  2KXJ A;  3DBH I;  2N1W A;  1WJU A;  4JQW C;  5CTR C;  4FAD A;  2C5L C;  2KFJ A;  2NVU I;  1KM7 A;  4W9G A;  3ZDT A;  4HDO A;  1EF5 A;  2PEA A;  2KJR A;  2LWP A;  3QCA A;  2CHX A;  3VAW A;  3VHT C;  4AJW A;  3RUL A;  3DBL I;  4DBG A;  2JRI B;  2N9E B;  3M95 A;  3JW0 X;  5J18 A;  2LXC A;  3H7P B;  4P7I A;  2DHZ A;  4RM9 A;  4A3P A;  3A33 B;  4MGZ E;  4WQO B;  2A4Z A;  1PQS A;  4LCD E;  5DPW A;  2MRP A;  3L17 A;  4LDT B;  2O6V A;  2ZNV C;  2ZPN A;  4EOY A;  3DPD A;  2D07 B;  1V6E A;  3LDZ E;  3NS8 A;  2K6Q A;  3I3T B;  5D6J B;  1T0Y A;  2ZEQ A;  4GXB A;  1UBI A;  2VRR B;  2NR2 A;  2BWE S;  1R4N I;  4I6N B;  4ANU A;  4B95 A;  3SHQ A;  3WAO A;  2NBU A;  1P3Q U;  4AWJ A;  2WDT B;  3KVF B;  4NQK E;  5LLI A;  3DBR I;  3V6E B;  2MW5 A;  2KX3 A;  2DZI A;  2M8S A;  2YVC A;  4M8M A;  2DAF A;  2AEH A;  2LI5 A;  3KH0 A;  4MEL A;  4GU2 A;  3MJW A;  5AZG A;  2KMC A;  2A5U A;  2IBI B;  2ZZP B;  4GGQ A;  2J7Q B;  1WM2 A;  1LFD A;  2IZV B;  1UGM A;  2KDI A;  1WIA A;  4A3O A;  4FHK A;  3H7P A;  3LJ3 A;  4FJY A;  1Z2M A;  2NS5 A;  4LJP B;  4M0W B;  1WGR A;  2EMS A;  2CKH B;  2KJH B;  2L76 A;  2LAS A;  2NPT B;  3PHX B;  5D2M B;  4AUQ C;  3EHV A;  2LZ6 A;  4NAW B;  5JHA A;  1F9J A;  3EEC A;  1YJ1 A;  3NZS A;  4FUL A;  2KWU B;  4BOS C;  2K39 A;  4W9K A;  4EZK A;  1V80 A;  3H6N A;  4EKU A;  4URK A;  3OJ4 B;  3L16 A;  4W9D A;  3TMP B;  3T8M A;  1RLF A;  1LQB A;  2LVP A;  4W9L A;  2KTF A;  3A9J A;  3WAN A;  2KLG A;  5JHB A;  5E6N A;  2JWZ A;  2FCM A;  2N9P C;  4DWF A;  4ZYN A;  4KSL C;  3KUC B;  1WXV A;  3NOB A;  2CHW A;  2DZJ A;  4FLH A;  5CHF A;  4IG7 B;  3VTU A;  4PYZ A;  4IM2 A;  1E7U A;  1YQB A;  2DZK A;  2KTR A;  1HE8 A;  2KWV B;  3BIN A;  5HKH A;  2JY6 A;  2FIF A;  1GC6 A;  2HJ8 A;  4DHZ E;  2ZCC A;  4E71 A;  2RGF A;  3PGE A;  4E3C A;  4KV2 A;  4NY0 A;  3R7Q A;  4HPM B;  4IC7 B;  2J0M A;  2V3S A;  4B9K A;  1WGD A;  1J0G A;  4JGH B;  2JZZ A;  4ZRI A;  4IWQ A;  1YX6 B;  3O65 B;  3PZD A;  3VH3 B;  2JT4 B;  1V5O A;  2HE7 A;  4GB9 A;  3BY4 B;  4HVB A;  2JUO A;  2KJ6 A;  3ALB A;  5C1Z A;  3A1Q A;  4KZC A;  2BKR B;  4EUT A;  5L95 C;  1GG3 A;  1SIF A;  1YD8 U;  1WGH A;  2DYM A;  4FBJ B;  4GOC A;  1E8Z A;  2KFK A;  4G3X B;  4IUM B;  3VQI A;  2L8J A;  2L00 B;  2Z0D B;  2D3G A;  2MA9 B;  2R2Q A;  4ZRK A;  1WGG A;  1TBE A;  2HTH A;  1MG8 A;  3L0W B;  3CF6 E;  3P2B A;  1IP9 A;  2FCS A;  2O2V B;  3L08 A;  2GOW A;  2EMT A;  2FID A;  4JLC A;  4MSQ B;  2K8H A;  4TV3 A;  5AZH A;  1KOT A;  3ONS A;  2I1K A;  4EZJ A;  1V9J A;  4IM3 A;  3ECI A;  3ZDM C;  2V4L A;  2M1M A;  2QHO A;  3RYT A;  4TKN A;  1LM8 B;  1V49 A;  2KFK B;  4WWN A;  1GJZ A;  4AP4 C;  3DVN U;  4BKS A;  1UEL A;  2BYV E;  3ZNG C;  4MJS B;  3PRE A;  3DCG A;  3PPA A;  2JRH A;  4NNJ B;  2PE9 A;  2MX2 A;  5L83 A;  4OVV A;  2DX5 B;  1Z5S B;  4NAW A;  5LXH A;  4GN1 A;  3QK0 A;  2RR9 A;  2GBN A;  3AUL A;  2ZCB A;  1WJ6 A;  4WJQ A;  4I6L B;  3ZIM A;  2KQ7 A;  2KKC A;  1E90 A;  1AAR A;  3DVN V;  1WX8 A;  1EUV B;  2L0T A;  3PRZ A;  2M17 A;  4M8N A;  3RZW C;  3PV1 A;  3SU8 X;  3ZNI D;  1WGY A;  2ZPY A;  2KDF B;  2B3A A;  3QWZ B;  5CX3 A;  3M62 B;  1WMH A;  2MWS B;  3L13 A;  2JXX A;  3KYD D;  4RM8 A;  1WXM A;  4FJZ A;  2K8C A;  4ICV A;  4II2 B;  4K81 A;  4W9H A;  4BFR A;  2I1J A;  2LRU A;  4NJ6 A;  5TR5 A;  1WX9 A;  3ZNH B;  3HHM A;  4E74 A;  4JIO U;  1ZGU B;  3VUY A;  2LRW A;  3TBL D;  4GIV A;  3QHT A;  5JZE B;  3M3J A;  1GNU A;  2YLM A;  3HM6 X;  1NDD A;  1WR1 A;  4XZ4 A;  2L3Z A;  4PS3 A;  4F7Z A;  2LVO A;  1J8C A;  1ZKH A;  4N9F 4;  2DEN B;  3ZRC A;  3R7R A;  3IFW B;  3V60 A;  2JZ3 B;  2KQS A;  1WJN A;  2C7N B;  2AL6 A;  2C7H A;  1WXA A;  3JVZ X;  3JSV A;  3R66 C;  1U4A A;  4HCN B;  2KO3 A;  1RRB A;  2KC1 A;  4TQ0 A;  3UGB B;  3VVW B;  2N9X A;  1UBQ A;  3V61 A;  5IAA C;  1QZE A;  2KHW B;  2GBJ A;  2IY1 B;  1TGZ B;  1I42 A;  2CU1 A;  4IW0 A;  2GMI C;  2K1F A;  3PRM B;  3APD A;  1E8X A;  1WZ3 A;  4KDI C;  4F1S A;  3H7S A;  5AZF A;  1E5W A;  4W9F A;  4K1R B;  1H8C A;  3DVG Y;  4FJV B;  2IY0 B;  3PLV A;  1IPG A;  1P9D U;  1UZX B;  4IWP A;  4LDT D;  2J0K A;  3ML8 A;  1C3T A;  2KN5 A;  2G45 B;  3QJZ A;  4AOF A;  3Q3J A;  1D3Z A;  2IO0 B;  2O2V A;  2IO3 B;  2KZR A;  3GZN I;  3GOE A;  4W9J A;  4PYU A;  3A9K A;  2KTR B;  2FCQ A;  2ZNV B;  4EZL A;  3PRP B;  3VTV A;  2BWF A;  2W9N A;  2IO2 B;  4LJO B;  1WR6 E;  4XX5 A;  1OEY J;  4HWI B;  2MP2 B;  2JF5 A;  4MH0 E;  4MM3 A;  3ZNZ B;  2IO1 B;  5KHQ A;  1Y8R C;  3N3K B;  4JL9 A;  4FHJ A;  4GSW A;  2Z59 B;  4W9I A;  1XQQ A;  4BKS D;  3W1S C;  2KDB A;  2M4N A;  5E6P A;  3RT3 B;  3UF8 A;  4KIK A;  2MBB B;  4WWP A;  3SD5 A;  4NJ7 A;  4HCP B;  5G2N A;  5G55 A;  3IVF A;  2N7E A;  3KYC D;  3V62 A;  2D11 A;  4ANW A;  5CHW A;  1WJ4 A;  2KLC A;  3Q3F A;  4PS7 A;  4KDL B;  1TTN A;  1V86 A;  1YIW A;  3DVG X;  4X57 B;  3MHS D;  1Q0W B;  3PLU A;  2UYZ B;  1UD7 A;  4F8C B;  5JH5 C;  4GDK B;  1EO6 A;  3QAR A;  4RMA A;  1EF1 A;  2AWT A;  5DCN A;  2FAZ A;  2L7R A;  1LXD A;  3ZTD A;  5IA7 A;  1OTR B;  4FN2 A;  4HDQ A;  1JRU A;  3DOW A;  3RD2 A;  5DPS A;  1KLV A;  2EKE C;  4DDI D;  4MGI E;  2KK8 A; 
#chains in the Genus database with same CATH topology
 2N9L A;  1EWY C;  5GMV A;  3PS6 A;  3LXF A;  2R61 A;  2N1V A;  3JSV B;  3U52 E;  4JWS C;  3V6C B;  2V0G A;  1L2N A;  3RPF C;  3URY A;  4CYE A;  2DYO A;  3GS2 A;  2XK5 A;  2PPH A;  3BK2 A;  3GE3 C;  4MEM A;  1GPX A;  3NVV A;  1ACC A;  3H9D A;  2LHE A;  3IHP C;  3QC8 B;  4ZDV A;  3W5V B;  4GMV A;  1IYF A;  2G4D B;  1K53 A;  3AI5 A;  2HJ1 A;  1FCL A;  5IN7 A;  2OJR A;  1I4P A;  1XCT L;  2KOX A;  2V9H A;  3AEE B;  4H2A A;  1L4Z B;  5LXI B;  2L05 A;  1V2Y A;  2WXM A;  1OGW A;  2RPV A;  3X0W A;  3RN9 C;  1WYG A;  4MDK E;  1ZDX A;  3GB1 A;  5E6O A;  4D2K A;  4S0R A;  3QX1 A;  1WXS A;  3MFG A;  3QAQ A;  3AED B;  4S17 A;  2JYT A;  3N1Y C;  3W1S A;  3EUB 2;  2AX5 A;  1HTO A;  4LK0 M;  3VDZ A;  2BF8 B;  5DPR A;  2WNM A;  1XCQ L;  2MJD A;  4IKG A;  1L6U A;  5I4D A;  2JVC A;  1CMX B;  2JU6 X;  1D4B A;  2ZJD A;  1RAX A;  4XDD A;  2K25 A;  1N5W A;  1NBF C;  2O6V D;  2XK5 B;  1P7E A;  1QIL A;  3N32 A;  3AXC A;  3MTN B;  2ZVO A;  1UH6 A;  2J4X A;  2PMV A;  1L4D B;  3EC8 A;  1ISN A;  5KHO A;  1PDX A;  1PGB A;  4OZB A;  2KVR A;  2Y3A A;  4B0E A;  2GI9 A;  3ZO5 B;  4MJS A;  2KAN A;  3UQA A;  1GB4 A;  2V3P A;  2KC2 A;  3TIX A;  4BVU C;  4YTN B;  5FK9 C;  4US8 A;  2BGF A;  1J7B A;  3A4S C;  3IT4 B;  4IM0 A;  1QF6 A;  2PVO D;  2WX1 A;  3QIJ A;  4HK2 A;  2MBH A;  2LGI A;  4M01 A;  1NI2 A;  1NVI D;  4DK5 A;  4ANX A;  2BKF A;  2J53 A;  1TS4 A;  1FPY A;  3UIP B;  4FA6 A;  5J17 A;  4IDI A;  5AEK B;  1B1Z A;  2UWQ A;  4MT5 A;  2DYB A;  1KLG D;  4DHJ B;  3I5J C;  4WAA A;  5AUK A;  2X38 A;  4PT5 A;  1FXT B;  2D2Q A;  4KIK B;  4WWM A;  3ZRF A;  3AE6 B;  3VRB B;  3C0R B;  4FAD A;  1WJU A;  5CTR C;  4HRS A;  3W5U B;  2NVU I;  5TSS A;  1K50 A;  4YTP B;  1D5Z C;  3QCA A;  3RUL A;  1QLB B;  2WXG A;  1D6E C;  2LXC A;  3H7P B;  4A3P A;  1SB3 C;  4M0W A;  4MGZ E;  1PQS A;  3L17 A;  2ZPN A;  4EOY A;  3N20 C;  2D07 B;  3LDZ E;  1ET9 A;  3ZJU A;  2ZEQ A;  4GXB A;  2QMT A;  2NR2 A;  2NBU A;  4C4V A;  2WLB A;  3P4Q B;  5AZG A;  2IBI B;  2ZZP B;  2J7Q B;  1N60 A;  4FHK A;  3N1X C;  2K9X A;  1ZPS A;  2EMS A;  1VZ8 A;  3EA6 A;  4FUL A;  4W9K A;  4EKU A;  4W9D A;  3T8M A;  4W9L A;  2KTF A;  5JHB A;  1I4X A;  3LB8 C;  1DOI A;  5E6N A;  4RGT A;  2JWZ A;  2ZW0 A;  3KUC B;  5CHF A;  2DZJ A;  4IG7 B;  1JRO A;  1NYQ A;  4PYZ A;  3VTU A;  2H89 B;  1E7U A;  1FXA A;  3BIN A;  5HKH A;  2FIF A;  1F2R I;  2PLP A;  1GC6 A;  2WXL A;  2RGF A;  3AM9 A;  2WXK A;  4KV2 A;  1V97 A;  4HPM B;  4IC7 B;  1UF0 A;  2V3S A;  4B9K A;  1KRH A;  4HVB A;  3BY4 B;  2KJ6 A;  5C1Z A;  4KZC A;  4EUT A;  1OQQ A;  2DLB A;  3HVD A;  3VQI A;  3PO0 A;  2MA9 B;  2R2Q A;  4ZRK A;  1WGG A;  3CF6 E;  2FCS A;  3L08 A;  1C4C A;  2GOW A;  4TV3 A;  1KOT A;  1HEZ E;  2XNA C;  3ECI A;  4JE3 B;  2WXN A;  1GJZ A;  3DVN U;  3SFE B;  3NJT A;  3PRE A;  1FFV A;  3PPA A;  1KFY B;  2JRH A;  3E9S A;  4OVV A;  3AUL A;  2KQ7 A;  2IPK D;  4LNN A;  1DGJ A;  3PRZ A;  1ZUD 2;  3PV1 A;  2ZPY A;  1NYR A;  4PK1 A;  1WMH A;  2MWS B;  1IGC A;  4RM8 A;  4BFR A;  4NJ6 A;  4GLS C;  3NVZ A;  3HHM A;  4E74 A;  1R7S A;  3KQ4 A;  1ZGU B;  3VUY A;  2K0P A;  3TBL D;  1T5X D;  3M3J A;  2INN E;  2IND C;  2M0A A;  2WXP A;  1NDD A;  2MHJ A;  2L3Z A;  2DBY A;  2ONQ A;  1J8C A;  4N9F 4;  3W2D A;  4XGA B;  3V60 A;  1MHH E;  2KQS A;  2C7N B;  1J7C A;  1I4H A;  1U4A A;  2I38 A;  4NZL B;  3VVW B;  1EU3 A;  1UBQ A;  3I63 C;  2GBJ A;  2IY1 B;  3TEX A;  2CU1 A;  1AN8 A;  4WAF A;  1E8X A;  1TKG A;  1E5W A;  1ZP0 B;  1UZX B;  2W54 A;  1V1O A;  1C3T A;  1FO4 A;  3U4E G;  2LFI A;  1XLQ A;  2IO3 B;  4PYU A;  2KTR B;  4WQM A;  4EZL A;  2W9N A;  1WRI A;  2IO2 B;  4LJO B;  1HTQ A;  3VR9 B;  4HKQ A;  1F77 A;  2IO1 B;  5KHQ A;  2VH1 A;  1IGD A;  1Y8R C;  4C4V B;  2Z59 B;  2G1E A;  3SD5 A;  3SR6 A;  1TT5 B;  4RFB A;  3DHG C;  3IVF A;  3KYC D;  4ZHO A;  2D11 A;  4ANW A;  4N58 A;  1KH0 A;  4PS7 A;  4KDL B;  1V86 A;  2KVZ A;  1SBB B;  4F8C B;  4K3B A;  3RMK C;  4GDK B;  3QAR A;  5DCN A;  4A8X C;  2AWT A;  2Y5P A;  2FAZ A;  1I4R A;  2L7R A;  4HDQ A;  4L23 A;  3RD2 A;  4MGI E;  2KK8 A;  3ZJT A;  3VTW A;  1WI0 A;  3VFK A;  2KAJ A;  3PZ8 A;  4AJY B;  2LJI A;  4OZC A;  2LUE A;  2N0S B;  5IO9 A;  3AU5 A;  1T0Q C;  2FCN A;  1K8R B;  3UIN B;  4KKJ A;  1V5T A;  3BZD B;  1SXT A;  4MGK E;  4GDL B;  2ZW1 A;  4QAY A;  2L52 A;  1E7V A;  3M63 B;  4YL8 A;  2L0F A;  4OVZ A;  4WJO A;  2HD5 B;  1WRD B;  2NPT A;  4A55 A;  1XT9 B;  3IG3 A;  1CQV A;  1C76 A;  1IBX B;  2J0J A;  1T6B X;  2OOB B;  2V1Y A;  2V3N A;  1M4V A;  3AB5 A;  3IBE A;  2WWZ A;  3B9J A;  3TJP A;  1ROE A;  1UWM A;  2BYE A;  3T3N A;  3K9O B;  4KSK C;  2LGD A;  4WJP A;  4YSX B;  1XLO A;  4REZ A;  2O6V B;  2CR5 A;  1QQR A;  3APF A;  1N5X A;  2XBB C;  4JWU C;  1FNV A;  3DQV A;  5IP4 D;  2RSU A;  3JYU A;  4WH4 A;  3ZVV A;  4OVU A;  1WH3 A;  1MFW A;  4RCO A;  3MJ5 A;  2PE6 B;  4BKG A;  3NUH B;  1WMH B;  3DBS A;  3TEZ A;  3B1L X;  4B6W A;  2GLS A;  3VR8 B;  4TMA B;  3PVL A;  4XWT A;  4HLE A;  2AQ3 B;  2XEW A;  4HEA 1;  4KKI A;  2W3S A;  1V8C A;  3CMM B;  3NHE B;  3L10 B;  2RD0 A;  4WWO A;  3AV8 A;  3UQB A;  3X23 A;  2MEK A;  1UUP A;  1Q1O A;  1IBX A;  1T0R C;  1WXQ A;  4P1C C;  4RGO S;  3KUD B;  1HQR D;  1N63 A;  3ZTC A;  1XF5 L;  1L0Y B;  4M02 A;  1TS3 A;  2LEK A;  2GB1 A;  1BT0 A;  1I35 A;  2WQY B;  5FR6 A;  1P1A A;  3DBR B;  5G5H A;  3DBH B;  4BKT A;  1H4R A;  3MHZ A;  4CO7 A;  3PT2 B;  2QDF A;  3K9P B;  4LNK A;  4ACF A;  4B0M A;  1WFY A;  2L32 A;  1YN5 A;  2I2Y A;  2MLB A;  3N30 A;  2KT7 A;  2BW2 A;  3ML9 A;  3TUO A;  3U7D A;  5C23 A;  3KW5 B;  3WIM A;  1FRR A;  3WA0 A;  4AQ7 A;  2KD0 A;  2LD9 A;  2LMC A;  3U30 A;  2C60 A;  3WAP A;  3WAL A;  3ZLZ A;  2M0X A;  4J3O D;  4JQW C;  1FIQ A;  1JWS D;  2FUG 1;  2C5L C;  2QEJ C;  3HVZ A;  4W9G A;  2PEA A;  2KJR A;  3AE8 B;  3VHT C;  3WCQ A;  2XN9 C;  3JW0 X;  5J18 A;  4RM9 A;  2DHZ A;  3A33 B;  1AW7 A;  4WQO B;  2A4Z A;  4LCD E;  1TY0 A;  2O6V A;  2ZNV C;  1YN3 A;  2NTS A;  5D6J B;  1T0Y A;  2VRR B;  2BWE S;  4ANU A;  3RNF C;  2WDT B;  3KVF B;  4DQO C;  1V1P A;  3DBR I;  2KX3 A;  1MVK A;  2M8S A;  2DAF A;  1J7A A;  2LI5 A;  4GU2 A;  5D3I B;  3MJW A;  3GP7 A;  1WM2 A;  1SJH D;  1UGM A;  1WIA A;  1ZXI A;  3H7P A;  1Z2M A;  4M0W B;  3MC9 A;  3V05 A;  4ZHP A;  3RNC C;  2NPT B;  2LAS A;  3Q3O C;  4AUQ C;  3EHV A;  3AH7 A;  2BB6 A;  3NZS A;  2KWU B;  4BOS C;  2K39 A;  1D5X C;  1V80 A;  3IAM 1;  3ABV B;  2N9K A;  1RLF A;  1LQB A;  5T8I A;  4XYC A;  2DNF A;  3A9J A;  1WWT A;  1ZE3 D;  2M56 B;  1JWB D;  3ZXR A;  2SEB D;  4M00 A;  3NOB A;  1WXV A;  4FLH A;  2CHW A;  4A90 A;  1UGJ A;  1F0Z A;  2DZK A;  5EE1 A;  2EKI A;  1SJE D;  3B2G A;  3P4S B;  2HJ8 A;  4DHZ E;  1FCC C;  3R7Q A;  1I7H A;  2OED A;  1YX6 B;  1JW9 D;  4OW0 A;  3VH3 B;  3ALB A;  3BII D;  2BKR B;  3FIL A;  1GG3 A;  1SIF A;  1YD8 U;  2DYM A;  4HRO A;  1BUI C;  4FBJ B;  1E8Z A;  4IUM B;  1SE3 A;  2CJN A;  1E10 A;  2N7J A;  2L8J A;  3AE9 B;  2L00 B;  2Z0D B;  3BWU D;  2D3G A;  2HTH A;  1TBE A;  1MG8 A;  1IP9 A;  2EMT A;  4JLC A;  2K8H A;  4NAM A;  1JML A;  1YMH E;  2KYW A;  3O13 A;  4IM3 A;  2JXT A;  1QOB A;  2M1M A;  2QHO A;  3RYT A;  3V3X A;  5BMH A;  4AP4 C;  4BKS A;  1UEL A;  3BVM A;  2WGS A;  1FMA D;  5IOI A;  3Q8F A;  4NAW A;  3Q14 C;  3QK0 A;  2RR9 A;  1N6Z A;  4WJQ A;  5H92 C;  3ZIM A;  2G9H D;  1PFD A;  1QKZ A;  2L0T A;  3ZNI D;  1PYW D;  4M8N A;  2M17 A;  1JWA D;  2RMM A;  4RGN A;  2MJE A;  3R8B A;  3QWZ B;  1C4P A;  2PW9 A;  3L13 A;  1FNU A;  3SEB A;  4II2 B;  4K81 A;  3ZNH B;  2KQ4 X;  3C8Y A;  2K3U A;  4YSY B;  1F52 A;  5EE0 A;  1VLB A;  4P1B C;  1HZ5 A;  1QOA A;  4KX6 B;  4PS3 A;  2LVO A;  1ZKH A;  3ZRC A;  1KTK A;  3IFW B;  2JZ3 B;  4JX1 C;  1D5M C;  1WXA A;  3JVZ X;  3Q3N C;  4HCN B;  2V4I B;  4ZRQ A;  2KC1 A;  3UGB B;  2ICI A;  4YXD B;  1QZE A;  2KHW B;  2RDG A;  1ET6 A;  3PRM B;  3APD A;  5AZF A;  3DVG Y;  4FJV B;  3KWV A;  3PLV A;  4LNF A;  3QJZ A;  1D3Z A;  1C4A A;  2O2V A;  2WXF A;  2KZR A;  3GZN I;  2TSS A;  3A9K A;  3PRP B;  1OEY J;  2MP2 B;  2JF5 A;  1KLU D;  4MM3 A;  3ZNZ B;  4FHJ A;  1C77 A;  2B76 B;  2JYE A;  2M4N A;  4KIK A;  2BBC A;  4HCP B;  1FNW A;  2N7E A;  3V62 A;  2KWD A;  3BYY B;  3KWL A;  3MHS D;  1Q0W B;  2W55 A;  2UYZ B;  1UD7 A;  3PLU A;  2QC8 A;  1EO6 A;  4RMA A;  1EF1 A;  5IA7 A;  2D3A A;  3AEB B;  4DDI D;  1SE2 A;  1L0X B;  1P98 A;  3T9L A;  2AL3 A;  1L6V A;  3APC A;  4MSM B;  1TS5 A;  2MCN B;  5D7G A;  2KDE B;  3AE7 B;  1SF0 A;  2NBW B;  4ZYS A;  4WIP A;  3W1Y A;  3I9V 1;  3ETR A;  2DZM A;  2K8B A;  1VJK A;  4FXC A;  2LGX A;  2YEP B;  1RM6 C;  2WU5 B;  5H8Y E;  2K5P A;  1GB1 A;  3Q6B A;  1XEE A;  1RFA A;  1WZ0 A;  4DHJ D;  1G6J A;  2AYO B;  3GE8 C;  3A1Q B;  4ASW C;  4I6P A;  2PJH A;  1X1M A;  4OHJ A;  3Q69 A;  2VZK D;  2R2O A;  3OAW A;  1VZ7 A;  1J19 A;  4HJK A;  2N7D A;  4XC2 A;  2MBQ A;  2KX0 A;  3AEA B;  4A9A A;  4NQL B;  2J52 A;  3NZU A;  1C79 A;  2WX0 A;  4W9E A;  1XXG A;  5AUI A;  1JCK B;  3R3M A;  4KGR A;  3RZF A;  4C56 C;  4C00 A;  2IDY A;  3UIO B;  1E0Z A;  1SGH A;  2GBR A;  4K7W A;  5HI1 A;  2NBV B;  4DXA B;  2NCN A;  4J6I A;  2IGH A;  3B0A A;  4KVG B;  2WXJ A;  1KF6 B;  4W9C A;  2FNJ B;  4ANV A;  2D3B A;  4TUU A;  1WY8 A;  3D32 A;  3Q2A C;  2QSD A;  3AE3 B;  3RUI B;  4ICU A;  1F1H A;  2FBW B;  1RFK A;  1N61 A;  4HPP A;  1K52 A;  1XLN A;  1E8W A;  1MPE A;  1YX5 B;  3Q8C A;  4BBN F;  3VXW A;  4WJN A;  3QA8 A;  2LJ5 A;  4KZ0 A;  1HZ6 A;  3CST A;  2NMQ A;  3ZUN A;  2G3Q B;  1WE6 A;  2REX A;  4C80 A;  3EFU A;  1KJT A;  4KGS A;  1T3Q A;  2MSE D;  2WXI A;  3AEC B;  2PIA A;  2JPH A;  2NTT A;  1L7Y A;  5CHV C;  5EDS A;  1QOF A;  5FR3 A;  1R4M I;  3C19 A;  2QJL A;  4II3 B;  1XD3 B;  1M94 A;  5BO4 B;  4K7U A;  2LGY A;  3VUW A;  2BS2 B;  3AE1 B;  4EFO A;  3A9J B;  3A9K B;  1NEK B;  2DAJ A;  2KWC A;  3U2S C;  4ZRJ A;  1A5R A;  2FUH B;  3WAM A;  1GUA B;  2DWQ A;  1PGA A;  3ZW3 A;  2GRI A;  3KUZ A;  1Q10 A;  1I4G A;  2RPQ A;  4NPN A;  2KXJ A;  3DBH I;  2KFJ A;  2BQQ A;  3LYY A;  1KM7 A;  3ZDT A;  1JQ4 A;  1EF5 A;  2CHX A;  3VAW A;  4AJW A;  1T0S C;  3DBL I;  4DBG A;  3OWE B;  2N9E B;  3M95 A;  4P7I A;  1WSP A;  5DPW A;  2MRP A;  2MH7 A;  1EM7 A;  1VR9 A;  3I3T B;  1EWC A;  2AQ1 B;  3SHQ A;  4A6Q A;  3OG5 A;  4AWJ A;  4ARI A;  4NQK E;  2BS3 B;  2YVC A;  2DZI A;  2AEH A;  4MEL A;  2E3T A;  1B9R A;  2KMC A;  2A5U A;  2KDM A;  2IZV B;  5BMI A;  2KDI A;  4A3O A;  3LJ3 A;  3AE5 B;  2HDE A;  4K3C A;  2L76 A;  3PHX B;  1PGX A;  1ENF A;  2LZ6 A;  1E9M A;  3AMZ A;  3NRZ A;  4NAW B;  5JHA A;  1GOZ A;  1YJ1 A;  1NEN B;  2VZK B;  3FAH A;  3H6N A;  3L4P A;  4P6V F;  1STE A;  4TSS A;  2LVP A;  4IOI E;  2FCM A;  4DWF A;  4ZYN A;  3BVZ A;  4IM2 A;  1YQB A;  2KTR A;  1HE8 A;  2KWV B;  2JY6 A;  3PGE A;  4E3C A;  2LHD A;  4NY0 A;  2MJ3 A;  1RYJ A;  2J0M A;  1FXI A;  1WGD A;  1MI0 A;  1J0G A;  1YJJ A;  1LGR A;  4JGH B;  2JZZ A;  4ZRI A;  4IWQ A;  3H8H A;  3O65 B;  3Q8E A;  3PZD A;  1V5O A;  2WDV B;  1BXT A;  2JUO A;  4DXF A;  5L95 C;  1WGH A;  1VZ6 A;  1TIF A;  3P63 A;  4GOC A;  1TS2 A;  5BMG A;  5BYQ A;  2ACZ B;  2KFK A;  4G3X B;  4RGM A;  5IKC M;  1AWD A;  1PUT A;  3TEW A;  3L0W B;  1V1P B;  2O2V B;  3BYT B;  3DHI C;  2FID A;  4MSQ B;  3RI7 C;  4EZJ A;  1V9J A;  1YQ3 B;  4NJC A;  4TKN A;  5EE3 A;  1LM8 B;  1V49 A;  3EGR A;  3ZNG C;  1RWS A;  3DWM A;  4MJS B;  2MX2 A;  1DOX A;  2DX5 B;  1Z5S B;  3TEY A;  1WJ6 A;  4I6L B;  2KKC A;  1E90 A;  1AAR A;  3DVN V;  1WX8 A;  3SU8 X;  1WGY A;  3IAS 1;  3M62 B;  3KYD D;  4FJZ A;  2K8C A;  4ICV A;  2HTM E;  2I1J A;  3PZ7 A;  5TR5 A;  4XWW A;  4JIO U;  2LRW A;  3HUI A;  1BML C;  5JZE B;  1YJI A;  3HRD D;  1YOV B;  3DWG C;  3BK1 A;  3HM6 X;  3RNB C;  1WR1 A;  2LGS A;  3R7R A;  1WJN A;  2AL6 A;  1TKE A;  3R66 C;  2JX5 A;  4TQ0 A;  3IXS A;  2N9X A;  5LNK 1;  1I42 A;  3RNG C;  2GMI C;  2K1F A;  3RNA C;  3H7S A;  1H8C A;  2IY0 B;  3J9C A;  3P4R B;  1K51 A;  3ML8 A;  2G45 B;  5C2T B;  4AOF A;  3Q3J A;  2IO0 B;  4W9J A;  1YN4 A;  2FE8 A;  5GXG B;  2FCQ A;  2ZNV B;  2BWF A;  2WS3 B;  1WR6 E;  3B2F A;  4XX5 A;  5C3J B;  4HWI B;  4MH0 E;  4KGT A;  3N3K B;  4JL9 A;  4W9I A;  1XQQ A;  3EFC A;  4BKS D;  2KDB A;  1MHX A;  3RT3 B;  3UF8 A;  4WWP A;  2IGG A;  1AYF A;  4NJ7 A;  5G2N A;  3AE2 B;  1WJ4 A;  2KLC A;  1ZDV A;  3Q3F A;  2H88 B;  3DVG X;  4X57 B;  4EE2 A;  3ZJV A;  3MC8 A;  3RNE C;  4Q2J A;  1R4N B;  3ZTD A;  4MM3 B;  1JRU A;  5DPS A;  1KLV A;  4P16 A;  2L1A A;  2C9W B;  2N4F A;  1SEB D;  1GC7 A;  3RCZ A;  1Q5W B;  1VDV A;  3H1U A;  2PTL A;  1MG4 A;  3CSF A;  2CHZ A;  3OJ3 A;  3HIZ A;  4K7S A;  4L1B A;  1IUE A;  3DDC B;  1SE9 A;  1OFF A;  2GBM A;  3P4P B;  4G0N B;  4TQ1 A;  2WP9 B;  5FKA C;  2MQJ A;  3QQ8 B;  2IJ0 A;  1Y56 A;  2ZVN A;  1TYG B;  5BYS A;  1EU4 A;  4MH8 A;  4HPL B;  2C7M B;  3ENE A;  4ZRP A;  3HM3 A;  2BTE A;  4JPS A;  3PTF C;  4BZA A;  2MBE A;  2OJW A;  3B08 A;  2E6X A;  5D94 A;  3SFD B;  3U8Z A;  3PSE B;  2MP2 A;  4CHK A;  3TL5 A;  3ZKJ C;  3OLM D;  4DDG D;  2D10 A;  1ESF A;  2WXH A;  4DHZ B;  2CS4 A;  1ZXH A;  2BYF A;  4LLG M;  4HKZ E;  4EEW A;  1FFU A;  3L54 A;  3AU4 A;  2GBK A;  2JWU A;  2QCZ A;  3NY5 A;  1ZW7 A;  4RF0 A;  5J2R A;  4AS1 A;  2IYD B;  1WGK A;  2RDH A;  1TZ1 A;  4HXD A;  2OHF A;  4LNI A;  2Z0E B;  1C1Y B;  4XE0 A;  4MGY E;  1OQY A;  1E6E B;  2MBO A;  4R3D A;  4O1N A;  3P42 A;  2WYQ A;  1S1Q B;  1L5P A;  2KN4 A;  2W3R A;  1DOY A;  4UDU C;  3ZYY X;  1C9F A;  4A20 A;  3HK0 A;  1OQR A;  1P7F A;  4PS8 A;  3U7Z A;  4LNO A;  2AQ2 B;  1V81 A;  2YEP F;  2K6D B;  1VCB A;  1FRD A;  1JRP A;  1F2R C;  1FEH A;  4GDK A;  3DBL B;  5G5G A;  3AN1 A;  1VD2 A;  1S3S G;  3PHW B;  4RH6 A;  1WM3 A;  3NVW A;  1P0R A;  4USA A;  3Q3M C;  4BOZ B;  3AEF B;  3R2I A;  4BBN C;  2LVQ A;  1WE7 A;  3SDL C;  2WXO A;  3S2A A;  1E8Y A;  3Q8B A;  2KMA A;  2G4S A;  4WUR A;  3TCA A;  4G50 A;  1WF9 A;  2ASQ A;  3VUX A;  2JZP A;  3A4R A;  1WX7 A;  2PVG C;  3MP9 A;  1TKY A;  4ITK A;  2K22 A;  4YWG G;  1WYW B;  4GDL A;  3MC0 B;  3W9C B;  4IWO A;  2D3C A;  4N6E B;  2Y5B B;  3VH4 B;  3Q8A A;  2KNB A;  1E7P B;  5DPT A;  4C7Z A;  1OEY A;  4G11 A;  2BPS A;  2WXQ A;  2LXA A;  2N1W A;  4HDO A;  2LWP A;  2CU3 A;  2WXR A;  1QOG A;  2JRI B;  4YSZ B;  4LTU A;  3I57 A;  2Y5C A;  4LDT B;  1VRA B;  3DPD A;  1V6E A;  3NS8 A;  2LUM A;  2K6Q A;  3P1M A;  1UBI A;  4I6N B;  1R4N I;  4B95 A;  3WAO A;  2IGD A;  1P3Q U;  1UWX A;  5LLI A;  3V6E B;  2MW5 A;  4M8M A;  1HA5 A;  5E6J A;  3KH0 A;  3N9Y C;  4GGQ A;  1A70 A;  2WU2 B;  1JWU D;  1LFD A;  3ZXV A;  1YNT E;  3ZGZ A;  3CIR B;  1L0V B;  2ON8 A;  4FJY A;  2NS5 A;  4LJP B;  1WGR A;  3AE4 B;  1FD6 A;  2CKH B;  2KJH B;  2KAC A;  4N59 A;  5D2M B;  4YT0 B;  1F9J A;  3EEC A;  5D3D A;  1UNS A;  4EZK A;  1CZP A;  2INC C;  4URK A;  3OJ4 B;  3L16 A;  4XDC A;  1JAL A;  3TMP B;  2Z8L A;  2PKO A;  3WAN A;  2KLG A;  1R4M B;  1HXY D;  1XO3 A;  2N9P C;  2QIE B;  1TY2 A;  3NVY A;  4KSL C;  4US9 A;  1XLP A;  1I4Q A;  2W82 A;  4E71 A;  2ZCC A;  4YTM B;  2M19 A;  3E56 A;  1GAQ B;  3FC4 A;  3T3O A;  2JT4 B;  2HE7 A;  4GB9 A;  3A1Q A;  4ZOH C;  2BT6 A;  3NG0 A;  4CQN A;  3CWI A;  2WDQ B;  2Q5W D;  1MJD A;  3P2B A;  1YQ4 B;  3RFZ B;  1CK1 A;  1ZOY B;  3R2T A;  5AZH A;  3ONS A;  2I1K A;  3ZDM C;  2V4L A;  4WWN A;  2KFK B;  3TSS A;  2BYV E;  3DCG A;  4HJG E;  4NNJ B;  2PE9 A;  5L83 A;  2D5G A;  5LXH A;  2CJO A;  2WDR B;  2X8X X;  4GN1 A;  2JSV X;  4RF1 A;  2GBN A;  2ZCB A;  2RDB C;  1EUV B;  3GZN B;  3IT6 B;  3RZW C;  2KDF B;  2B3A A;  2BYT A;  5CX3 A;  2JXX A;  5BYR A;  1WXM A;  2L83 A;  3AEG B;  3KLS X;  3ZQ4 A;  3UI3 A;  4OZA A;  4W9H A;  5HG2 A;  2EEL A;  2LRU A;  1WX9 A;  2KMM A;  3VRA B;  4GIV A;  3QHT A;  3DHH C;  1GNU A;  5MPO A;  2YLM A;  2SAK A;  4XZ4 A;  4F7Z A;  2DEN B;  1SIJ A;  2C7H A;  1DYQ A;  3JSV A;  2KO3 A;  1RRB A;  2BB5 A;  3V61 A;  2QIL A;  5IAA C;  1FM0 D;  4DXG A;  1TGZ B;  4IW0 A;  1WZ3 A;  4KDI C;  4F1S A;  4W9F A;  4K1R B;  3N1Z C;  2BVC A;  5JXV A;  4IWP A;  4LDT D;  1IPG A;  1P9D U;  2J0K A;  2KN5 A;  2JQR B;  3GOE A;  4RNA A;  2WHI A;  4BAX A;  2VH2 A;  1CJE A;  3NZ3 A;  1N62 A;  5HFY A;  1TZO A;  3VTV A;  4ARC A;  1SSN A;  1JWM D;  1SE4 A;  4GSW A;  3FIL B;  3W1S C;  5E6P A;  2MBB B;  5HHD G;  1QT9 A;  1LO5 D;  5G55 A;  2INP E;  1NI3 A;  5CHW A;  2BS4 B;  1TTN A;  1YIW A;  3BVG A;  3NS1 A;  4L2Y A;  4MAC A;  2UU7 A;  5JH5 C;  3FKY A;  5EE9 A;  4C7Y A;  1C78 A;  1LXD A;  1OTR B;  4FN2 A;  3DOW A;  1TJE A;  2EKE C;  2J42 A; 
#chains in the Genus database with same CATH homology
 2C9W B;  3VTW A;  3T9L A;  1P98 A;  1WI0 A;  2AL3 A;  2N4F A;  3VFK A;  3APC A;  4AJY B;  4MSM B;  2LUE A;  1GC7 A;  3AU5 A;  3RCZ A;  1Q5W B;  3PS6 A;  5GMV A;  2FCN A;  2MCN B;  3H1U A;  5D7G A;  2N1V A;  2KDE B;  3CSF A;  3JSV B;  2CHZ A;  1K8R B;  3OJ3 A;  2NBW B;  3HIZ A;  3V6C B;  4K7S A;  3UIN B;  3W1Y A;  1V5T A;  1L2N A;  4MGK E;  4GDL B;  4CYE A;  3DDC B;  2DZM A;  1SE9 A;  1E7V A;  2K8B A;  3M63 B;  2DYO A;  2GBM A;  2PPH A;  2XK5 A;  4YL8 A;  2L0F A;  2LGX A;  4G0N B;  4MEM A;  4WJO A;  4TQ1 A;  2HD5 B;  1WRD B;  2MQJ A;  1RFA A;  1WZ0 A;  2NPT A;  3QQ8 B;  3H9D A;  4DHJ D;  1G6J A;  2AYO B;  1XT9 B;  3IHP C;  2ZVN A;  3A1Q B;  3QC8 B;  4ASW C;  3IG3 A;  2PJH A;  4I6P A;  4ZDV A;  1X1M A;  4GMV A;  1IYF A;  2J0J A;  2G4D B;  2R2O A;  3AI5 A;  3OAW A;  4HPL B;  2C7M B;  2OJR A;  2OOB B;  2KOX A;  2V1Y A;  1J19 A;  3ENE A;  4HJK A;  3IBE A;  3HM3 A;  2WWZ A;  3PTF C;  3TJP A;  2MBE A;  2BYE A;  2N7D A;  3K9O B;  5LXI B;  4XC2 A;  3B08 A;  4KSK C;  2L05 A;  1V2Y A;  5D94 A;  2LGD A;  2MBQ A;  4WJP A;  3U8Z A;  3PSE B;  2MP2 A;  4CHK A;  3TL5 A;  2KX0 A;  1OGW A;  3X0W A;  2O6V B;  2CR5 A;  3ZKJ C;  4MDK E;  3OLM D;  4DDG D;  4NQL B;  3APF A;  2D10 A;  5E6O A;  3NZU A;  2XBB C;  4DHZ B;  2CS4 A;  2WX0 A;  3QX1 A;  2BYF A;  4W9E A;  1WXS A;  3DQV A;  3R3M A;  3QAQ A;  4EEW A;  3L54 A;  3AU4 A;  3RZF A;  2RSU A;  3JYU A;  3W1S A;  2GBK A;  3NY5 A;  1ZW7 A;  3ZVV A;  4OVU A;  1WH3 A;  5J2R A;  3UIO B;  1SGH A;  2GBR A;  2IYD B;  4K7W A;  1TZ1 A;  2PE6 B;  4BKG A;  4HXD A;  2NBV B;  3VDZ A;  1WMH B;  2BF8 B;  3DBS A;  5DPR A;  4DXA B;  2NCN A;  3B1L X;  4J6I A;  2Z0E B;  1C1Y B;  4B6W A;  3B0A A;  4KVG B;  4MGY E;  4W9C A;  1OQY A;  2FNJ B;  2MBO A;  4ANV A;  2JVC A;  1CMX B;  3PVL A;  2WYQ A;  1S1Q B;  4TUU A;  4HLE A;  1WY8 A;  2XEW A;  1RAX A;  2ZJD A;  2K25 A;  1NBF C;  3D32 A;  2O6V D;  3RUI B;  3CMM B;  2XK5 B;  4ICU A;  3NHE B;  3N32 A;  4A20 A;  3AXC A;  3HK0 A;  3L10 B;  3MTN B;  2ZVO A;  1UH6 A;  4PS8 A;  1E8W A;  2RD0 A;  3EC8 A;  1ISN A;  1YX5 B;  4WWO A;  5KHO A;  3UQB A;  4BBN F;  3X23 A;  2KVR A;  3VXW A;  4WJN A;  1V81 A;  1Q1O A;  3ZO5 B;  3QA8 A;  4MJS A;  2K6D B;  1VCB A;  2LJ5 A;  4KZ0 A;  2KAN A;  3CST A;  3UQA A;  3ZUN A;  3KUD B;  2G3Q B;  2KC2 A;  4GDK A;  1WE6 A;  2REX A;  3TIX A;  4BVU C;  1VD2 A;  1S3S G;  2BGF A;  3EFU A;  3PHW B;  1WM3 A;  1KJT A;  3A4S C;  4IM0 A;  1P0R A;  3ZTC A;  2WX1 A;  3QIJ A;  2MSE D;  4HK2 A;  2MBH A;  4BOZ B;  2JPH A;  1BT0 A;  1NI2 A;  1I35 A;  1L7Y A;  5FR6 A;  5CHV C;  4BBN C;  2LVQ A;  1P1A A;  1WE7 A;  5EDS A;  3SDL C;  4DK5 A;  3S2A A;  4ANX A;  1E8Y A;  2BKF A;  2KMA A;  1R4M I;  2G4S A;  3TCA A;  3UIP B;  4BKT A;  4CO7 A;  1H4R A;  4FA6 A;  4G50 A;  1WF9 A;  2ASQ A;  5J17 A;  4II3 B;  1XD3 B;  3VUX A;  1M94 A;  5AEK B;  3PT2 B;  3A4R A;  5BO4 B;  3K9P B;  2LGY A;  4K7U A;  3VUW A;  1WFY A;  1WX7 A;  2UWQ A;  4EFO A;  1WYW B;  3A9J B;  3A9K B;  4GDL A;  2DAJ A;  2DYB A;  4DHJ B;  2KWC A;  4IWO A;  4WAA A;  4ZRJ A;  2MLB A;  3N30 A;  1A5R A;  3ML9 A;  2Y5B B;  2FUH B;  3U7D A;  3VH4 B;  3WAM A;  1GUA B;  1FXT B;  2D2Q A;  4KIK B;  3ZRF A;  5C23 A;  2KNB A;  3KW5 B;  3WIM A;  5DPT A;  1OEY A;  4G11 A;  3ZW3 A;  3WA0 A;  3KUZ A;  2BPS A;  2KD0 A;  2LD9 A;  2RPQ A;  3U30 A;  2C60 A;  3WAP A;  3C0R B;  3WAL A;  2M0X A;  2LXA A;  4NPN A;  3ZLZ A;  2KXJ A;  3DBH I;  2N1W A;  1WJU A;  4JQW C;  5CTR C;  4FAD A;  2C5L C;  2KFJ A;  2NVU I;  1KM7 A;  4W9G A;  3ZDT A;  4HDO A;  1EF5 A;  2PEA A;  2KJR A;  2LWP A;  3QCA A;  2CHX A;  3VAW A;  3VHT C;  4AJW A;  3RUL A;  3DBL I;  4DBG A;  2JRI B;  2N9E B;  3M95 A;  3JW0 X;  5J18 A;  2LXC A;  3H7P B;  4P7I A;  2DHZ A;  4RM9 A;  4A3P A;  3A33 B;  4MGZ E;  4WQO B;  2A4Z A;  1PQS A;  4LCD E;  5DPW A;  2MRP A;  3L17 A;  4LDT B;  2O6V A;  2ZNV C;  2ZPN A;  4EOY A;  3DPD A;  2D07 B;  1V6E A;  3LDZ E;  3NS8 A;  2K6Q A;  3I3T B;  5D6J B;  1T0Y A;  2ZEQ A;  4GXB A;  1UBI A;  2VRR B;  2NR2 A;  2BWE S;  1R4N I;  4I6N B;  4ANU A;  4B95 A;  3SHQ A;  3WAO A;  2NBU A;  1P3Q U;  4AWJ A;  2WDT B;  3KVF B;  4NQK E;  5LLI A;  3DBR I;  3V6E B;  2MW5 A;  2KX3 A;  2DZI A;  2M8S A;  2YVC A;  4M8M A;  2DAF A;  2AEH A;  2LI5 A;  3KH0 A;  4MEL A;  4GU2 A;  3MJW A;  5AZG A;  2KMC A;  2A5U A;  2IBI B;  2ZZP B;  4GGQ A;  2J7Q B;  1WM2 A;  1LFD A;  2IZV B;  1UGM A;  2KDI A;  1WIA A;  4A3O A;  4FHK A;  3H7P A;  3LJ3 A;  4FJY A;  1Z2M A;  2NS5 A;  4LJP B;  4M0W B;  1WGR A;  2EMS A;  2CKH B;  2KJH B;  2L76 A;  2LAS A;  2NPT B;  3PHX B;  5D2M B;  4AUQ C;  3EHV A;  2LZ6 A;  4NAW B;  5JHA A;  1F9J A;  3EEC A;  1YJ1 A;  3NZS A;  4FUL A;  2KWU B;  4BOS C;  2K39 A;  4W9K A;  4EZK A;  1V80 A;  3H6N A;  4EKU A;  4URK A;  3OJ4 B;  3L16 A;  4W9D A;  3TMP B;  3T8M A;  1RLF A;  1LQB A;  2LVP A;  4W9L A;  2KTF A;  3A9J A;  3WAN A;  2KLG A;  5JHB A;  5E6N A;  2JWZ A;  2FCM A;  2N9P C;  4DWF A;  4ZYN A;  4KSL C;  3KUC B;  1WXV A;  3NOB A;  2CHW A;  2DZJ A;  4FLH A;  5CHF A;  4IG7 B;  3VTU A;  4PYZ A;  4IM2 A;  1E7U A;  1YQB A;  2DZK A;  2KTR A;  1HE8 A;  2KWV B;  3BIN A;  5HKH A;  2JY6 A;  2FIF A;  1GC6 A;  2HJ8 A;  4DHZ E;  2ZCC A;  4E71 A;  2RGF A;  3PGE A;  4E3C A;  4KV2 A;  4NY0 A;  3R7Q A;  4HPM B;  4IC7 B;  2J0M A;  2V3S A;  4B9K A;  1WGD A;  1J0G A;  4JGH B;  2JZZ A;  4ZRI A;  4IWQ A;  1YX6 B;  3O65 B;  3PZD A;  3VH3 B;  2JT4 B;  1V5O A;  2HE7 A;  4GB9 A;  3BY4 B;  4HVB A;  2JUO A;  2KJ6 A;  3ALB A;  5C1Z A;  3A1Q A;  4KZC A;  2BKR B;  4EUT A;  5L95 C;  1GG3 A;  1SIF A;  1YD8 U;  1WGH A;  2DYM A;  4FBJ B;  4GOC A;  1E8Z A;  2KFK A;  4G3X B;  4IUM B;  3VQI A;  2L8J A;  2L00 B;  2Z0D B;  2D3G A;  2MA9 B;  2R2Q A;  4ZRK A;  1WGG A;  1TBE A;  2HTH A;  1MG8 A;  3L0W B;  3CF6 E;  3P2B A;  1IP9 A;  2FCS A;  2O2V B;  3L08 A;  2GOW A;  2EMT A;  2FID A;  4JLC A;  4MSQ B;  2K8H A;  4TV3 A;  5AZH A;  1KOT A;  3ONS A;  2I1K A;  4EZJ A;  1V9J A;  4IM3 A;  3ECI A;  3ZDM C;  2V4L A;  2M1M A;  2QHO A;  3RYT A;  4TKN A;  1LM8 B;  1V49 A;  2KFK B;  4WWN A;  1GJZ A;  4AP4 C;  3DVN U;  4BKS A;  1UEL A;  2BYV E;  3ZNG C;  4MJS B;  3PRE A;  3DCG A;  3PPA A;  2JRH A;  4NNJ B;  2PE9 A;  2MX2 A;  5L83 A;  4OVV A;  2DX5 B;  1Z5S B;  4NAW A;  5LXH A;  4GN1 A;  3QK0 A;  2RR9 A;  2GBN A;  3AUL A;  2ZCB A;  1WJ6 A;  4WJQ A;  4I6L B;  3ZIM A;  2KQ7 A;  2KKC A;  1E90 A;  1AAR A;  3DVN V;  1WX8 A;  1EUV B;  2L0T A;  3PRZ A;  2M17 A;  4M8N A;  3RZW C;  3PV1 A;  3SU8 X;  3ZNI D;  1WGY A;  2ZPY A;  2KDF B;  2B3A A;  3QWZ B;  5CX3 A;  3M62 B;  1WMH A;  2MWS B;  3L13 A;  2JXX A;  3KYD D;  4RM8 A;  1WXM A;  4FJZ A;  2K8C A;  4ICV A;  4II2 B;  4K81 A;  4W9H A;  4BFR A;  2I1J A;  2LRU A;  4NJ6 A;  5TR5 A;  1WX9 A;  3ZNH B;  3HHM A;  4E74 A;  4JIO U;  1ZGU B;  3VUY A;  2LRW A;  3TBL D;  4GIV A;  3QHT A;  5JZE B;  3M3J A;  1GNU A;  2YLM A;  3HM6 X;  1NDD A;  1WR1 A;  4XZ4 A;  2L3Z A;  4PS3 A;  4F7Z A;  2LVO A;  1J8C A;  1ZKH A;  4N9F 4;  2DEN B;  3ZRC A;  3R7R A;  3IFW B;  3V60 A;  2JZ3 B;  2KQS A;  1WJN A;  2C7N B;  2AL6 A;  2C7H A;  1WXA A;  3JVZ X;  3JSV A;  3R66 C;  1U4A A;  4HCN B;  2KO3 A;  1RRB A;  2KC1 A;  4TQ0 A;  3UGB B;  3VVW B;  2N9X A;  1UBQ A;  3V61 A;  5IAA C;  1QZE A;  2KHW B;  2GBJ A;  2IY1 B;  1TGZ B;  1I42 A;  2CU1 A;  4IW0 A;  2GMI C;  2K1F A;  3PRM B;  3APD A;  1E8X A;  1WZ3 A;  4KDI C;  4F1S A;  3H7S A;  5AZF A;  1E5W A;  4W9F A;  4K1R B;  1H8C A;  3DVG Y;  4FJV B;  2IY0 B;  3PLV A;  1IPG A;  1P9D U;  1UZX B;  4IWP A;  4LDT D;  2J0K A;  3ML8 A;  1C3T A;  2KN5 A;  2G45 B;  3QJZ A;  4AOF A;  3Q3J A;  1D3Z A;  2IO0 B;  2O2V A;  2IO3 B;  2KZR A;  3GZN I;  3GOE A;  4W9J A;  4PYU A;  3A9K A;  2KTR B;  2FCQ A;  2ZNV B;  4EZL A;  3PRP B;  3VTV A;  2BWF A;  2W9N A;  2IO2 B;  4LJO B;  1WR6 E;  4XX5 A;  1OEY J;  4HWI B;  2MP2 B;  2JF5 A;  4MH0 E;  4MM3 A;  3ZNZ B;  2IO1 B;  5KHQ A;  1Y8R C;  3N3K B;  4JL9 A;  4FHJ A;  4GSW A;  2Z59 B;  4W9I A;  1XQQ A;  4BKS D;  3W1S C;  2KDB A;  2M4N A;  5E6P A;  3RT3 B;  3UF8 A;  4KIK A;  2MBB B;  4WWP A;  3SD5 A;  4NJ7 A;  4HCP B;  5G2N A;  5G55 A;  3IVF A;  2N7E A;  3KYC D;  3V62 A;  2D11 A;  4ANW A;  5CHW A;  1WJ4 A;  2KLC A;  3Q3F A;  4PS7 A;  4KDL B;  1TTN A;  1V86 A;  1YIW A;  3DVG X;  4X57 B;  3MHS D;  1Q0W B;  3PLU A;  2UYZ B;  1UD7 A;  4F8C B;  5JH5 C;  4GDK B;  1EO6 A;  3QAR A;  4RMA A;  1EF1 A;  2AWT A;  5DCN A;  2FAZ A;  2L7R A;  1LXD A;  3ZTD A;  5IA7 A;  1OTR B;  4FN2 A;  4HDQ A;  1JRU A;  3DOW A;  3RD2 A;  5DPS A;  1KLV A;  2EKE C;  4DDI D;  4MGI E;  2KK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...