3TIXA

Crystal structure of the chp1-tas3 complex core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
153
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDNDIIEAHREQIGGLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRSEMLSQRKLLAAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Chp1-Tas3 core is a multifunctional platform critical for gene silencing by RITS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation/protein binding
molecule keywords Ubiquitin-like protein SMT3,RNA-induced transcriptional sile
total genus 45
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tixA01
5JHBA 4WWNA 1L7YA 3ML9A 4JLCA 2JZ3B 1OTRB 2GBKA 3EECA 3KYDD 3PHWB 3RYTA 3X23A 3ZKJC 4BOZB 5J2RA 3DVGY 4IM0A 2FAZA 3PRZA 1M94A 4MEMA 5GMVA 1WJ6A 1WM3A 2CU1A 3QX1A 2K25A 5KHQA 4W9DA 3APFA 5DPWA 4MSMB 3WIMA 4LJOB 3ZW3A 1TGZB 1GJZA 2BF8B 4HDOA 4EFOA 3QJZA 1E8YA 3EHVA 3M3JA 3A9KA 4ANVA 4ZRKA 2K8CA 2NPTB 3KVFB 1C1YB 3OJ3A 5CHFA 3CSTA 3WALA 1V49A 2UWQA 3R7RA 2KWUB 3UQBA 2MW5A 1LXDA 1WMHB 3QK0A 4G11A 3VUWA 2XK5A 3D32A 1E8WA 3VTVA 4ICUA 3PV1A 4F7ZA 1LM8B 1P0RA 2K6DB 2KDBA 4E71A 4XC2A 2CHZA 3B1LX 2AEHA 3OJ4B 4KIKB 2DX5B 1GC7A 3PREA 3TBLD 1SE9A 1RFAA 3A9JB 5CHVC 3QHTA 2HD5B 3GZNI 4HCNB 2NBUA 5E6OA 4B9KA 2XBBC 3L54A 4WJOA 3VDZA 2M0XA 2JF5A 2JXXA 4FLHA 4NQKE 1IYFA 5DPTA 3VH3B 3ZIMA 4NAWB 2DYBA 5JHAA 2JRHA 4NAWA 4AWJA 4NQLB 1ISNA 3PGEA 4NNJB 3DQVA 4WAAA 1EF5A 1WX9A 2NVUI 2LGDA 3U7DA 2B3AA 2L7RA 2MBHA 4IG7B 2DYOA 4KSLC 3VXWA 4URKA 2FUHB 2J0MA 3KUZA 5IA7A 4HXDA 1CMXB 4I6PA 1TTNA 4MGZE 3ZNZB 3LJ3A 2AYOB 4WWOA 3ZO5B 3BY4B 1E8XA 4DHZE 2NS5A 3KW5B 1MG8A 2LRUA 3RCZA 3R3MA 1WGYA 2MP2A 3QCAA 2KQ7A 3IBEA 4GOCA 1YQBA 3MTNB 4EZLA 1YX6B 1WGGA 4BOSC 3M95A 3P2BA 3ONSA 3V60A 5J17A 2JZZA 1WMHA 3JW0X 1WR6E 3VVWB 2MA9B 2W9NA 2KHWB 4WQOB 3X0WA 3L08A 3HM6X 1L2NA 2D11A 1WE6A 1PQSA 4FA6A 2AL6A 4M8MA 4W9CA 2DZIA 2IY1B 5AZFA 2CKHB 2IBIB 2LWPA 3JYUA 4GU2A 2ZVNA 1WZ3A 2KNBA 2KANA 2MWSB 4W9EA 2XEWA 4GDLB 4WWPA 1YX5B 3PPAA 4FULA 4PYZA 4HJKA 3CSFA 3T8MA 3A4RA 4II3B 4W9HA 4WJQA 2OJRA 4MH0E 1WH3A 1WIAA 3TCAA 3PRPB 3VAWA 2ZEQA 2Z59B 1SIFA 1E7UA 1XT9B 4PS3A 2L76A 3UINB 2O6VD 2HJ8A 3PS6A 2MP2B 2LI5A 4TQ1A 4HPLB 4M8NA 1WY8A 1Q5WB 3LDZE 2MSED 4GDKB 3CMMB 4BKSD 4DHJD 2KQSA 2O2VA 1S1QB 5L95C 4K81A 2BWFA 3UQAA 3U30A 2ZCCA 1I42A 1IPGA 2KDEB 2BKFA 2J0JA 4RMAA 2LXCA 2N1VA 4MGKE 3ZTCA 2AL3A 1OEYJ 2JUOA 2JWZA 2KJRA 1WYWB 1WM2A 3ZDTA 4EOYA 2M8SA 4DDID 3O65B 1E5WA 2KMAA 2L0TA 2J0KA 2IO2B 1QZEA 2GOWA 4CO7A 3ZVVA 1V80A 4HDQA 2V4LA 2FIDA 3WAMA 3R7QA 3AU5A 3SU8X 1UELA 3R66C 4BBNC 1V5OA 1BT0A 2IZVB 1WJNA 4AUQC 1EF1A 3C0RB 1Q1OA 3V6CB 3A33B 3SHQA 1TBEA 1J8CA 1RLFA 5CHWA 2O6VB 1WE7A 4GDKA 2D10A 2REXA 3VTWA 2G45B 1OQYA 2EMSA 4B6WA 4CYEA 3QARA 3W1SC 3UF8A 4E3CA 4PS8A 1NBFC 2KC1A 2KDIA 1U4AA 2JY6A 2NR2A 3APCA 1C3TA 5LXHA 3IG3A 3ZNGC 2KFKA 1P9DU 3I3TB 3JSVA 3DOWA 3PLUA 3V6EB 3RD2A 2AWTA 3HIZA 1UH6A 1VD2A 3KUDB 2G4SA 3N3KB 1LQBA 2C7HA 1WGDA 4E74A 4MJSA 1H4RA 1HE8A 3RZWC 3ML8A 2IO3B 4MJSB 2FNJB 1KJTA 2KKCA 3A9JA 2R2OA 3V61A 4IWOA 2Z0DB 2DENB 2N1WA 2MQJA 5CTRC 3Q3JA 4K7SA 4ZRIA 4F8CB 2KLGA 1F9JA 3KH0A 2EKEC 2ZJDA 4XZ4A 4BVUC 4BBNF 3ZTDA 3VQIA 1WJ4A 3PSEB 3L16A 3WAOA 2NCNA 3WAPA 3EFUA 2GBRA 2VRRB 4F1SA 4G0NB 2LRWA 5CX3A 4DWFA 4X57B 3TL5A 1Y8RC 3EC8A 3HK0A 3OAWA 3ZNHB 2C7NB 2KWVB 4AJYB 3N30A 4ZDVA 4HCPB 3DVGX 1X1MA 4IWPA 3UGBB 2JVCA 3JSVB 3L17A 3PT2B 5LLIA 3TMPB 2KMCA 4KZ0A 2XK5B 2Z0EB 4EZKA 3QWZB 1GUAB 3AULA 2KC2A 3AXCA 1UGMA 1UZXB 2R2QA 3ENEA 3BINA 3SD5A 2K8HA 2KK8A 4AOFA 4KDIC 2WWZA 1ZW7A 1S3SG 2YLMA 2JPHA 1WGRA 2KOXA 2MLBA 2DAJA 4GDLA 5E6PA 4MDKE 3PTFC 1UBIA 4ZYNA 2CHXA 1V6EA 3APDA 1ZKHA 2PPHA 3PZDA 1IP9A 2LVQA 3NS8A 3QIJA 2V3SA 4W9GA 2KXJA 2HTHA 4DBGA 2JT4B 2NBVB 3IFWB 3H7PA 2KFJA 1V81A 2BKRB 4GN1A 1V9JA 2PE6B 1JRUA 2KTFA 4IC7B 2N7EA 2KX3A 1YJ1A 4DHJB 3JVZX 4WJNA 3HHMA 3N32A 2L05A 3CF6E 1H8CA 2IO0B 1WXAA 2PEAA 2KLCA 1UD7A 2EMTA 4GXBA 1KOTA 1WRDB 1RAXA 2KZRA 4BKTA 1A5RA 2CHWA 4EUTA 2N9EB 4W9IA 2LZ6A 4JQWC 1WXSA 2C5LC 3VTUA 4HPMB 2MCNB 2NBWB 1Z5SB 3M62B 2IY0B 1RRBA 2LVOA 2YVCA 4EKUA 3ALBA 3IVFA 2A5UA 4A3OA 1G6JA 3M63B 3RUIB 1OEYA 4YL8A 2PE9A 3WA0A 3OLMD 2KX0A 2Y5BB 4ZRJA 5D7GA 3H6NA 1SGHA 4DHZB 1WZ0A 2K1FA 2CS4A 2FCQA 3DPDA 4LJPB 5C23A 3VFKA 2RSUA 1WI0A 2BPSA 1D3ZA 1E90A 4I6LB 3WANA 4MSQB 4EZJA 3AI5A 4TV3A 3DDCB 4W9LA 5FR6A 4ICVA 2DYMA 5JH5C 4KSKC 2O2VB 2KVRA 5KHOA 3MJWA 3RZFA 4KDLB 4BKSA 4IUMB 5TR5A 3PLVA 4CHKA 4GMVA 2OOBB 5AZGA 1FXTB 4NJ6A 1OGWA 1R4MI 4JGHB 2ZCBA 3NY5A 4MGIE 2KDFB 4OVVA 3V62A 1WR1A 1GC6A 5IAAC 4KV2A 5AEKB 2LVPA 4PYUA 5HKHA 3SDLC 2K39A 1TZ1A 1WXMA 3QC8B 2BYVE 1NDDA 2ZVOA 3KYCD 5BO4B 2GBJA 1WGHA 3H7PB 1YIWA 3HM3A 4IM3A 5LXIB 3A1QB 3UIPB 3H7SA 3IHPC 2IYDB 5AZHA 2ZNVB 3VUYA 3A1QA 2RPQA 2DZKA 4BFRA 5EDSA 1E8ZA 3ECIA 3H1UA 3PHXB 3U8ZA 2A4ZA 3ZNID 4IM2A 4G50A 3S2AA 3ZLZA 4A20A 3PVLA 4DXAB 4HLEA 1UBQA 2FCSA 5L83A 4WJPA 2BYEA 2C7MB 4ASWC 3A9KB 3PRMB 2MBBB 2M1MA 1T0YA 2MBOA 2N7DA 2RD0A 2O6VA 4GSWA 4MGYE 4OVUA 3ZDMC 1XQQA 2KTRB 1EO6A 1EUVB 4J6IA 2WX1A 1V86A 4KIKA 3W1YA 3NHEB 3TJPA 2BYFA 4HK2A 2G4DB 2LXAA 2IO1B 4M0WB 3NOBA 2DZMA 4K1RB 2GBNA 2KTRA 3B0AA 2DHZA 4ANXA 4NJ7A 4W9KA 2RGFA 2CR5A 3GOEA 2D3GA 3L0WB 4N9F4 4NY0A 4ANUA 2DAFA 4JL9A 1WXVA 2KJ6A 2KJHB 4A3PA 2L0FA 1VCBA 1P3QU 1KM7A 4FADA 3ZUNA 4AJWA 2L8JA 4II2B 3TIXA 3Q3FA 2L00B 3QAQA 3RT3B 5G2NA 1Q0WB 3DBRI 3RULA 4DDGD 1AARA 1V2YA 2I1KA 2I1JA 3NZUA 2FCNA 2LUEA 2C60A 2KD0A 3K9OB 1P98A 4FBJB 1NI2A 4TQ0A 4RM8A 1I35A 2MX2A 3QA8A 3A4SC 3L13A 4GGQA 3DVNV 2GBMA 4LDTB 2LGXA 1WJUA 2N4FA 2LGYA 4FHKA 4P7IA 3VHTC 2KFKB 4IWQA 4AP4C 2UYZB 4TUUA 1LFDA 2N9XA 2NPTA 2LD9A 3B08A 2WDTB 3H9DA 2KWCA 3DBLI 2WX0A 3MHSD 5J18A 1R4NI 2V1YA 2ASQA 2ZZPB 4K7WA 2DZJA 2LASA 3DVNU 3DCGA 1K8RB 2MBQA 1Z2MA 4MM3A 3L10B 2FIFA 1P1AA 2RR9A 2KN5A 2L3ZA 4LDTD 2LJ5A 2BGFA 5D94A 3T9LA 3VUXA 3DBSA 4HWIB 4B95A 3QQ8B 3ZRFA 2D07B 1GG3A 4ANWA 3NZSA 4TKNA 1GNUA 4W9FA 2PJHA 4JIOU 4XX5A 2BWES 2KO3A 5G55A 2WYQA 4I6NB 2ZPYA 4GIVA 1WF9A 2FCMA 4EEWA 2K6QA 3K9PB 3VH4B 3KUCB 4KVGB 3W1SA 3UIOB 1J0GA 4FJZA 2K8BA 2QHOA 4K7UA 4FJYA 2M4NA 5DCNA 4DK5A 1E7VA 2MRPA 4HVBA 2ZPNA 2C9WB 2M17A 3AU4A 4FHJA 4NPNA 5DPRA 3ZRCA 1WFYA 4BKGA 4IW0A 5DPSA 1XD3B 5D2MB 1J19A 4G3XB 2G3QB 4GB9A 1V5TA 2GMIC 5JZEB 2ZNVC 4PS7A 1ZGUB 2D2QA 5D6JB 5E6NA 2J7QB 2N9PC 4FN2A 1KLVA 2MBEA 4KZCA 3DBHI 4MELA 1YD8U 4RM9A 1WX7A 1WX8A 5C1ZA 2JRIB 4W9JA 4FJVB 4LCDE 2HE7A
chains in the Genus database with same CATH superfamily
5JHBA 4JLCA 3DWMA 3RYTA 2K0PA 3X23A 3ZKJC 3DBHB 2WXHA 3PRZA 1WM3A 3SEBA 5KHQA 3APFA 3WIMA 1T0RC 1PYWD 1TGZB 1GJZA 2BF8B 3EHVA 5EE9A 1C1YB 3OJ3A 5CHFA 1ESFA 1SJED 1XCTL 4IKGA 3WALA 2KWUB 3UQBA 2MW5A 4G11A 4BZAA 2XK5A 3D32A 1WXQA 3PV1A 1P0RA 4P1CC 4XC2A 2CHZA 3OJ4B 3PREA 1GC7A 1YJIA 1MVKA 4HROA 5FK9C 3AE5B 5E6OA 4B9KA 2XBBC 1T6BX 3VDZA 3V3XA 1KTKA 2DYBA 1SJHD 2V4IB 4M02A 3Q8FA 4AWJA 2KN4A 1EWYC 4WAAA 1I4QA 1WX9A 3U7DA 2LGDA 4HKZE 1BUIC 4LNIA 1NYRA 3ZNZB 4YT0B 4WWOA 1FFUA 1MJDA 3R3MA 3RCZA 1PGAA 3MTNB 1YX6B 3CWIA 3ONSA 5J17A 2JZZA 2E3TA 3TUOA 2W9NA 5C3JB 3L08A 2WXMA 2WS3B 1L6UA 1WE6A 1PQSA 4FA6A 2BT6A 4M8MA 2FBWB 2DZIA 2IBIB 2LWPA 4JX1C 3BZDB 4GU2A 4LLGM 3P4PB 1Y56A 4MM3B 2KANA 2K22A 2XEWA 5H8YE 4GDLB 4FULA 4PYZA 4HJKA 3A4RA 4WJQA 2WP9B 1PGXA 1SIFA 1E7UA 4PS3A 1WYGA 4A9AA 2Y3AA 2MP2B 4M8NA 1WY8A 3LDZE 4RF1A 4GDKB 4BKSD 4HKQA 4DHJD 2O2VA 1GB4A 2WXKA 2W3SA 1I42A 2KDEB 1N6ZA 2LXCA 1ACCA 1B1ZA 3NVZA 1WM2A 3VR9B 4DDID 1E5WA 2KMAA 2BS4B 2IO2B 2AQ3B 1V80A 2QSDA 3CIRB 2GB1A 3SU8X 1V5OA 4AUQC 1EF1A 1J8CA 1RWSA 4GDKA 2JZPA 3AEBB 1HTOA 3QARA 2EKIA 4JE3B 2KC1A 1J7BA 4WAFA 4ACFA 2WXOA 5LXHA 1IUEA 3IG3A 3ZNGC 3AEFB 3JSVA 3HIZA 3KUDB 1C76A 3NJTA 3RZWC 1JWBD 2IO3B 3ML8A 4MJSB 1KJTA 2R2OA 1AWDA 1EU4A 3NVWA 3V61A 4IWOA 4US9A 2ONQA 2N1WA 3PO0A 5CTRC 3R2TA 2KLGA 3H8HA 2ZJDA 2RDGA 4BBNF 4BVUC 1AN8A 3VQIA 1WJ4A 3WAOA 1XLNA 1N62A 3UI3A 3R8BA 1CQVA 1L4ZB 5CX3A 1SE2A 3RPFC 1Y8RC 3ZNHB 2C7NB 2V0GA 1TYGB 3GZNB 3JSVB 3L17A 3PT2B 1VDVA 2ZW0A 4EZKA 1GUAB 2VH1A 3AXCA 4JWSC 2R2QA 4M00A 2HDEA 1L0XB 4JPSA 2BB6A 3P4RB 2MLBA 4GDLA 4P6VF 1UBIA 2CHXA 1V6EA 1ZKHA 1L5PA 1FMAD 2LVQA 4W9GA 5IO9A 3H7PA 1V81A 2PE6B 3ETRA 3HHMA 2L05A 2WLBA 1NENB 2KLCA 1UD7A 2EMTA 4ZRQA 4GXBA 1KOTA 1RAXA 1WGKA 1WXSA 2C5LC 1TJEA 1RRBA 2LVOA 4EKUA 1G6JA 3M63B 2PTLA 1STEA 2PE9A 3WA0A 3OLMD 1IGDA 4D2KA 1HTQA 4B0EA 4DHZB 4US8A 3IXSA 4LJPB 4ITKA 1D3ZA 2WXQA 4I6LB 3WANA 3BYYB 3ZJUA 4W9LA 2I2YA 4PT5A 3AE4B 1V8CA 4KSKC 2MJ3A 5KHOA 4KDLB 4IUMB 2ICIA 5IKCM 4GMVA 4NJ6A 4LK0M 1GAQB 1GC6A 5AEKB 4PYUA 1GPXA 3EGRA 4DXFA 3QC8B 3J9CA 2ZVOA 3GB1A 1YQ4B 1WGHA 3HM3A 4IM3A 5AZHA 2YEPF 1EU3A 2QILA 4A8XC 1FNUA 2WGSA 1N63A 2RPQA 1IGCA 1E8ZA 3B2GA 2NTSA 3ZNID 1VJKA 4DXAB 2Y5CA 3PVLA 4LTUA 5FR3A 5IN7A 1KLUD 5IOIA 1QILA 4USAA 3DWGC 3DBLB 2INPE 3A9KB 2M1MA 2MBOA 2VZKB 4REZA 4J6IA 1FM0D 2WX1A 2BYFA 2G4DB 2LXAA 4M0WB 4LNOA 3B0AA 1FCLA 4NJ7A 2CR5A 3GOEA 1TKGA 4N9F4 2M0AA 1QF6A 1WXVA 2KJ6A 2L0FA 1VCBA 2WXPA 1KM7A 4FADA 3ZUNA 3B2FA 2L00B 3QAQA 2I1KA 2JWUA 2K9XA 3HRDD 2MX2A 3A4SC 3L13A 2CJNA 4ZOHC 2GBMA 3Q6BA 1FO4A 4FHKA 3VHTC 1V97A 4AP4C 2UYZB 1BXTA 2NTTA 3IAM1 1VZ7A 1XCQL 3DBLI 3MHSD 2MJEA 2DNFA 1K8RB 4MM3A 2RR9A 1NYQA 1OQRA 4LDTD 1QQRA 1K52A 5D94A 1FCCC 4B95A 1GG3A 5GXGB 3I63C 2PJHA 1ZPSA 4I6NB 2ZPYA 4GIVA 1WF9A 3MJ5A 4KVGB 1J0GA 3UIOB 2QHOA 3AE6B 1WSPA 2J42A 3Q69A 2ZPNA 1WFYA 4IW0A 5DPSA 1XD3B 4RGMA 3C19A 2IPKD 4GB9A 4LNNA 1V5TA 2GMIC 5JZEB 2N9PC 1KLVA 1V1PB 4MELA 1WX8A 4YTPB 2SEBD 4AQ7A 1SE4A 1L7YA 2JZ3B 3EECA 1HEZE 3DVGY 4IM0A 2FAZA 2LGSA 1WJ6A 1C9FA 2CU1A 2K25A 5DPWA 4MSMB 4NZLB 5HI1A 1CK1A 1E8YA 3ZXVA 4ZRKA 1HA5A 2NPTB 2UWQA 1WMHB 3W5UB 1E8WA 4ICUA 1LM8B 2K6DB 4O1NA 1FRRA 2KDBA 4E71A 3FILB 4NJCA 1RFAA 5CHVC 4HCNB 2NBUA 2PKOA 3L54A 3MHZA 5HHDG 2JXXA 4FLHA 3RNGC 1IYFA 1FRDA 1TS5A 5DPTA 3ZIMA 1YN5A 5JHAA 2JRHA 4NAWA 1ISNA 3V05A 3VRAB 2B3AA 2L7RA 2INCC 2DYOA 3AN1A 2G1EA 2J0MA 3KUZA 3AEEB 1TTNA 4MGZE 1B9RA 3IT4B 2NS5A 1MG8A 1WGYA 1FNVA 3RI7C 1YQBA 1JMLA 2XNAC 3P2BA 3V60A 3JW0X 1I4RA 2D11A 1JWMD 1RYJA 2AL6A 3VRBB 4A6QA 3KWLA 2ZVNA 3FAHA 4Q2JA 3OG5A 3AB5A 2I38A 3PPAA 3CSFA 3T8MA 1I4XA 3BVMA 1WIAA 2GI9A 3TCAA 3VAWA 2ZEQA 3UINB 3PS6A 1L6VA 2LI5A 4HPLB 1Q5WB 2V3PA 3CMMB 1S1QB 2VZKD 2DLBA 4RMAA 3HVZA 2N1VA 3ZTCA 2AL3A 2BS2B 1SSNA 2KJRA 1IBXA 3ZDTA 4IOIE 2M8SA 3KLSX 4CO7A 1QZEA 3RFZB 2LHEA 4HDQA 2W82A 2QJLA 2W3RA 3R7QA 4BBNC 1KFYB 1UELA 2KT7A 3ZYYX 1TBEA 2KWDA 1R4NB 2O6VB 1WE7A 3VTWA 2REXA 2WU2B 1ZOYB 3W1SC 1TKEA 4P1BC 4ZRPA 4PS8A 2V9HA 2NR2A 1P9DU 3DOWA 3PLUA 4YTMB 1F2RI 1QOAA 3RD2A 3AEDB 1VD2A 4E74A 1VRAB 4C7ZA 2FNJB 2KKCA 3A9JA 2K5PA 2J4XA 1T0SC 3Q3JA 2JXTA 3KH0A 2EKEC 2QCZA 3W2DA 2BYTA 3HVDA 3N1YC 4J3OD 2LRWA 4C56C 5BYRA 3HK0A 3OAWA 4OHJA 2KWVB 3IAS1 1X1MA 4IWPA 3TMPB 2KMCA 4XWWA 3QWZB 4XYCA 3BINA 2M56B 2RDBC 2WWZA 4EE2A 3AM9A 1WGRA 1N5WA 4ZHOA 3PTFC 3APDA 3PZDA 1IP9A 3SFDB 3NS8A 3QIJA 2V3SA 4DBGA 2HTHA 4C4VA 2NBVB 2KFJA 4IC7B 2KTFA 2KX3A 1YJ1A 4WJNA 1H8CA 1SIJA 1HXYD 3R2IA 1WRDB 2KZRA 4EUTA 3OWEB 1YN4A 1F2RC 2W54A 3VTUA 4HPMB 1GB1A 1JWAD 3ALBA 3IVFA 3RUIB 3Q3MC 2KX0A 2Y5BB 1QOGA 1SGHA 4HEA1 1WZ0A 1E10A 2CS4A 3DPDA 5C23A 1VR9A 5G5GA 1XLPA 3TEYA 4MSQB 4EZJA 3DDCB 3GP7A 5FR6A 3AV8A 4ICVA 3P63A 3GE3C 2KVRA 3RZFA 4CHKA 2OOBB 1OGWA 4JGHB 2BW2A 3NY5A 4MGIE 1PDXA 2ZW1A 4OVVA 1ZP0B 2J52A 3T3OA 3SDLC 1TZ1A 2JX5A 3GS2A 5BO4B 1MHXA 1TY0A 1YIWA 2GLSA 2L32A 3BIID 3N1XC 4LNFA 1UWMA 4YXDB 4IDIA 5E6JA 3IT6B 2BVCA 3H1UA 2A4ZA 4IM2A 4G50A 2D5GA 1K50A 2N0SB 3BK1A 4A20A 2D3CA 3PZ8A 1L0VB 3HUIA 4WJPA 1N60A 4ASWC 2RD0A 4OVUA 5T8IA 1EUVB 1E6EB 1V86A 4HK2A 2DZMA 3FC4A 3NVVA 4KGRA 4W9KA 2RGFA 2LUMA 2D3GA 4QAYA 2BTEA 4JL9A 2KJHB 5HFYA 1XLQA 4AJWA 3Q3FA 5G2NA 1Q0WB 4KKIA 3RULA 3ZQ4A 2I1JA 3NZUA 2WU5B 3DHIC 1P98A 4TQ0A 3MC9A 3RMKC 2LFIA 4L23A 2N4FA 3BWUD 2WXGA 4TMAB 2KFKB 4IWQA 5MPOA 2WXRA 2NPTA 1FXAA 3B08A 3H9DA 2KWCA 2Z8LA 1QT9A 1R4NI 2V1YA 2ASQA 2ZZPB 2DZJA 1I7HA 1Z2MA 1P1AA 1XEEA 2KDMA 3T9LA 4ANWA 1TY2A 4W9FA 1VZ8A 5IP4D 2WYQA 4WWMA 3N9YC 3K9PB 3W1SA 2K8BA 1E7VA 4HVBA 1FEHA 3ZRCA 1K51A 3SR6A 5D2MB 1J19A 2H89B 4RNAA 1J7CA 2ZNVC 4PS7A 5D6JB 2J7QB 1SBBB 4FN2A 1ZXHA 3DBHI 1YD8U 5I4DA 4W9JA 5JXVA 4LCDE 3KUCB 1JALA 4WWNA 1OTRB 2QDFA 3AH7A 2FE8A 1M94A 4MEMA 5GMVA 3ZXRA 2ON8A 4MH8A 5TSSA 3A9KA 2K8CA 3KVFB 2JQRB 5BYSA 1V49A 3R7RA 3QK0A 4OW0A 3EA6A 1JW9D 3VTVA 2GRIA 1UUPA 2KAJA 3RNEC 2UU7A 4KIKB 3QHTA 3AE7B 2JYTA 1ZUD2 2PLPA 4MACA 2WQYB 5BMIA 1MPEA 2IGHA 5EE1A 3VH3B 2OJWA 3ZGZA 3AE9B 4NQLB 3PGEA 4NNJB 3DQVA 3MP9A 1EF5A 2NVUI 2MBHA 4IG7B 4KSLC 3VXWA 4URKA 1UNSA 3LJ3A 1SF0A 2AYOB 1NEKB 3BY4B 3NRZA 4DHZE 3QCAA 2JU6X 4GOCA 2SAKA 4BOSC 1WGGA 3M95A 1FFVA 1PUTA 4RF0A 3X0WA 4WQOB 4B0MA 1D5ZC 4W9CA 1Q10A 3SFEB 2CKHB 2E6XA 2BB5A 3ZJVA 2MWSB 4W9EA 1LGRA 1TS2A 2LEKA 1YX5B 1YNTE 3AECB 4II3B 4W9HA 4XDCA 2OJRA 1WH3A 3RNBC 2Z59B 4M01A 2L76A 3ABVB 2O6VD 2HJ8A 4TQ1A 2HTME 4XE0A 2MSED 2KQSA 2BWFA 2WXIA 2ZCCA 3P4SB 1P7FA 2J0JA 4MGKE 1OEYJ 3URYA 1WYWB 1DYQA 4JWUC 3O65B 2L0TA 2J0KA 3ZVVA 2V4LA 3WAMA 3AU5A 3U4EG 3R66C 1RM6C 3E56A 1BT0A 4P16A 3FILA 1Q1OA 4ARCA 3V6CB 3A33B 3SHQA 4ARIA 5BYQA 1RLFA 5CHWA 1HQRD 2G45B 1OQYA 2EMSA 2LJIA 3AE2B 4B6WA 4CYEA 2PMVA 3UF8A 4E3CA 4HRSA 2KDIA 1F77A 1U4AA 2JY6A 3APCA 3W9CB 4BAXA 3T3NA 2KFKA 3I3TB 3V6EB 3Q14C 2AWTA 3N3KB 1LQBA 2C7HA 4MJSA 1H4RA 1HE8A 1TS3A 2OHFA 2RMMA 2PIAA 2NMQA 2Z0DB 3RNAC 2DENB 2MQJA 4K7SA 4RFBA 4F8CB 1F9JA 2KACA 2INDC 4XZ4A 3ZTDA 2WDRB 3Q8EA 3PSEB 1CJEA 3WAPA 2VRRB 4G0NB 1TZOA 4X57B 3TEXA 4HPPA 4KX6B 3EC8A 1JCKB 4AJYB 3N30A 4HCPB 2LHDA 5AUKA 2JVCA 5LLIA 4KGSA 4KZ0A 2XK5B 2Z0EB 2JYEA 3AULA 1HZ6A 1UZXB 1T0QC 4KDIC 1ZW7A 1S3SG 2YLMA 2JPHA 4PK1A 5D3IB 2KOXA 2DAJA 1DOYA 2PPHA 4XDDA 2PVOD 1XLOA 3IFWB 2QEJC 2BKRB 1V9JA 4C00A 1JRUA 3KQ4A 2KQ4X 3CF6E 1WXAA 2RDHA 2ACZB 4W9IA 2LZ6A 4R3DA 1WWTA 1Z5SB 3M62B 1E7PB 2YVCA 1GOZA 2A5UA 3W5VB 2G9HD 3I9V1 5D7GA 1VZ6A 3VFKA 1WRIA 1I4GA 1WI0A 2BPSA 1E90A 4YWGG 3AE8B 3I5JC 1FNWA 3AI5A 1ZE3D 2DYMA 3BVZA 5JH5C 1E0ZA 2O2VB 3AE3B 3MJWA 4OZBA 5TR5A 2ZCBA 2J53A 4DXGA 3Q2AC 3V62A 1WR1A 3DBRB 4KV2A 2LVPA 5HKHA 2K39A 1NDDA 4ZYSA 3KYCD 4YSZB 1FD6A 2AQ2B 3A1QB 1F0ZA 3UIPB 3IHPC 2IYDB 1ENFA 4ZHPA 4BFRA 5EDSA 1L0YB 3ECIA 3BYTB 1SE3A 4S17A 3S2AA 1BMLC 1UBQA 2FCSA 3MC8A 4XWTA 5L83A 2BYEA 4N58A 3RNCC 2C7MB 3PRMB 2Y5PA 1T0YA 3PZ7A 3ZDMC 1MFWA 1ET6A 2KTRB 1EO6A 3W1YA 4KIKA 3EFCA 3NHEB 3TJPA 5AUIA 2IO1B 4MT5A 4K1RB 2GBNA 4ANXA 2FUG1 1K53A 3L0WB 4NY0A 4ANUA 2DAFA 2QIEB 4WH4A 4UDUC 2IGDA 2L8JA 3TIXA 3RT3B 1ET9A 4DQOC 1AARA 1I4PA 1IBXB 2FCNA 2WHIA 2C60A 1ZDVA 2KD0A 4WURA 1NI2A 1KH0A 1I35A 4GGQA 4LDTB 2B76B 2LGXA 1WJUA 5LNK1 2X8XX 1YOVB 4P7IA 4C80A 4TUUA 2N9XA 1V1OA 2WDTB 2DBYA 4GLSC 2WX0A 1MG4A 4S0RA 4K7WA 1N5XA 2IDYA 3MC0B 3P4QB 2WXNA 1OFFA 3N1ZC 1SEBD 3L10B 3LXFA 2KN5A 2BGFA 4WQMA 4HWIB 2WXJA 3QQ8B 2D07B 3NZSA 1D5MC 3NZ3A 1D6EC 4JIOU 2KO3A 2WDQB 5G55A 1NI3A 2WNMA 2FCMA 3VH4B 5DCNA 5HG2A 2M4NA 1JWUD 2MRPA 3AU4A 2C9WB 2M17A 2CJOA 3I57A 5DPRA 3TEWA 3Q3OC 4BKGA 1C4PA 4G3XB 2G3QB 4FXCA 1ZGUB 1D5XC 2MBEA 1F1HA 3Q8AA 4RM9A 1WX7A 5C1ZA 2K3UA 2JRIB 4K3BA 3AEGB 3ML9A 3PHWB 5J2RA 2GBKA 3KYDD 1KLGD 3MFGA 4BOZB 3DHHC 2N9LA 1XF5L 1C79A 4WIPA 3QX1A 3FKYA 1RFKA 4W9DA 1QOFA 4LJOB 3ZW3A 4HDOA 4EFOA 3QJZA 3M3JA 4ANVA 4LNKA 3L4PA 4N59A 1FXIA 3CSTA 1LXDA 4N6EB 3VUWA 4L2YA 1ZXIA 4F7ZA 2QC8A 5FKAC 3Q8BA 3B1LX 2AEHA 3TBLD 2DX5B 1SE9A 3A9JB 4TSSA 2HD5B 3GZNI 5C2TB 4WJOA 2M0XA 2JF5A 4NQKE 4NAWB 1YMHE 2PW9A 1T5XD 2FUHB 5IA7A 4HXDA 1CMXB 4I6PA 3ZO5B 1E8XA 3KW5B 2LRUA 1UWXA 2MP2A 2KQ7A 3IBEA 4EZLA 2MEKA 1WMHA 1WR6E 3VVWB 2MA9B 2KHWB 3HM6X 1L2NA 2M19A 5AZFA 2IY1B 2RPVA 4C4VB 1R4MB 1C4CA 3JYUA 1WZ3A 2KNBA 4OZCA 4WWPA 2BS3B 1XO3A 3P1MA 4MH0E 3PRPB 1XT9B 4HJGE 1V1PA 2KMMA 1I4HA 1MHHE 1P7EA 5EE0A 1J7AA 5L95C 4K81A 2W55A 2CU3A 1JROA 1EWCA 3UQAA 2D3BA 3U30A 1IPGA 1YQ3B 2BKFA 2LMCA 1M4VA 2JUOA 2MHJA 1C77A 2JWZA 4AS1A 4EOYA 2GOWA 2FIDA 2MJDA 2AQ1B 2IZVB 3RNFC 1WJNA 1OQQA 2D3AA 3C0RB 2R61A 2AX5A 1T3QA 2KYWA 2WDVB 2D10A 1JQ4A 3Q3NC 1NBFC 1VLBA 1C3TA 3E9SA 1UF0A 1UH6A 4CQNA 2G4SA 1WGDA 3VR8B 2L52A 1QLBB 1N61A 3AEAB 1TIFA 4ZRIA 2L83A 2H88B 4A90A 1SB3C 3L16A 1HZ5A 2L1AA 2NCNA 4YTNB 3EFUA 2GBRA 4OZAA 1JWSD 4F1SA 3ZJTA 4DWFA 3TL5A 2LGIA 4ZDVA 4M0WA 3DVGX 3UGBB 3O13A 1CZPA 1F52A 1LO5D 4XGAB 1AYFA 2N9KA 4YSXB 1TS4A 1SXTA 2KC2A 1UGMA 3AMZA 5D3DA 3ENEA 3SD5A 1A70A 2K8HA 2KK8A 4AOFA 3B9JA 1E9MA 5G5HA 1C78A 1FPYA 5E6PA 4MDKE 4ZYNA 1YJJA 3U52E 5BMHA 1PGBA 1FIQA 2KXJA 2JT4B 4RGOS 4GN1A 2N7EA 2TSSA 4DHJB 3AE1B 3JVZX 3N32A 2IO0B 2IGGA 5EE3A 2PEAA 2QMTA 4BKTA 1A5RA 2CHWA 2N9EB 4JQWC 1TKYA 3KWVA 2KVZA 2Q5WD 2MCNB 2NBWB 1QOBA 2IY0B 4A3OA 4KKJA 4A55A 1OEYA 4YL8A 1JRPA 3NG0A 4ZRJA 1C4AA 3H6NA 3P42A 2K1FA 2FCQA 1YN3A 2RSUA 4KGTA 2X38A 4TV3A 5BMGA 3DHGC 4BKSA 3PLVA 5AZGA 1FXTB 3LYYA 1R4MI 1NVID 2KDFB 5IAAC 1R7SA 2JSVX 3U7ZA 1WXMA 2IJ0A 2BYVE 2VH2A 3NUHB 2GBJA 3H7PB 1DGJA 5LXIB 1KRHA 4NAMA 3H7SA 2ZNVB 3VUYA 2WXFA 3A1QA 2DZKA 3N20C 1ROEA 3Q8CA 3PHXB 3U8ZA 2YEPB 1L4DB 3ZLZA 4HLEA 3TEZA 1ZDXA 3U2SC 2DWQA 2MBBB 2N7DA 3GE8C 2O6VA 3C8YA 4MGYE 4GSWA 1XQQA 1UGJA 1QKZA 4YSYB 3NOBA 2KTRA 2DHZA 3EUB2 3NVYA 4A3PA 1P3QU 4RGTA 1PFDA 4II2B 3DBRI 2WXLA 4DDGD 1V2YA 1D4BA 3WCQA 2LUEA 2MH7A 3LB8C 1EM7A 3K9OB 4FBJB 3RN9C 4H2AA 4RM8A 3QA8A 3DVNV 2LGYA 1KF6B 1LFDA 2LD9A 3NS1A 2EELA 5H92C 5J18A 1AW7A 2INNE 2LASA 4RH6A 3DVNU 3BK2A 3DCGA 1DOXA 2MBQA 3BVGA 2FIFA 4L1BA 2L3ZA 2BBCA 2LJ5A 3VUXA 2N7JA 3DBSA 4K3CA 3ZRFA 4OVZA 4TKNA 1GNUA 4XX5A 2BWES 2PVGC 1XXGA 4EEWA 1MI0A 2K6QA 4FJZA 4K7UA 4DK5A 4FJYA 2HJ1A 2OEDA 1TT5B 4FHJA 4NPNA 4RCOA 1DOIA 2BQQA 3TSSA 4RGNA 2D2QA 5E6NA 2XN9C 4KZCA 2V3NA 4FJVB 4C7YA 2HE7A
chains in the Genus database with same CATH topology
5JHBA 4WWNA 1L7YA 3ML9A 4JLCA 2JZ3B 1OTRB 2GBKA 3EECA 3KYDD 3PHWB 3RYTA 3X23A 3ZKJC 4BOZB 5J2RA 3DVGY 4IM0A 2FAZA 3PRZA 1M94A 4MEMA 5GMVA 1WJ6A 1WM3A 2CU1A 3QX1A 2K25A 5KHQA 4W9DA 3APFA 5DPWA 4MSMB 3WIMA 4LJOB 3ZW3A 1TGZB 1GJZA 2BF8B 4HDOA 4EFOA 3QJZA 1E8YA 3EHVA 3M3JA 3A9KA 4ANVA 4ZRKA 2K8CA 2NPTB 3KVFB 1C1YB 3OJ3A 5CHFA 3CSTA 3WALA 1V49A 2UWQA 3R7RA 2KWUB 3UQBA 2MW5A 1LXDA 1WMHB 3QK0A 4G11A 3VUWA 2XK5A 3D32A 1E8WA 3VTVA 4ICUA 3PV1A 4F7ZA 1LM8B 1P0RA 2K6DB 2KDBA 4E71A 4XC2A 2CHZA 3B1LX 2AEHA 3OJ4B 4KIKB 2DX5B 1GC7A 3PREA 3TBLD 1SE9A 1RFAA 3A9JB 5CHVC 3QHTA 2HD5B 3GZNI 4HCNB 2NBUA 5E6OA 4B9KA 2XBBC 3L54A 4WJOA 3VDZA 2M0XA 2JF5A 2JXXA 4FLHA 4NQKE 1IYFA 5DPTA 3VH3B 3ZIMA 4NAWB 2DYBA 5JHAA 2JRHA 4NAWA 4AWJA 4NQLB 1ISNA 3PGEA 4NNJB 3DQVA 4WAAA 1EF5A 1WX9A 2NVUI 2LGDA 3U7DA 2B3AA 2L7RA 2MBHA 4IG7B 2DYOA 4KSLC 3VXWA 4URKA 2FUHB 2J0MA 3KUZA 5IA7A 4HXDA 1CMXB 4I6PA 1TTNA 4MGZE 3ZNZB 3LJ3A 2AYOB 4WWOA 3ZO5B 3BY4B 1E8XA 4DHZE 2NS5A 3KW5B 1MG8A 2LRUA 3RCZA 3R3MA 1WGYA 2MP2A 3QCAA 2KQ7A 3IBEA 4GOCA 1YQBA 3MTNB 4EZLA 1YX6B 1WGGA 4BOSC 3M95A 3P2BA 3ONSA 3V60A 5J17A 2JZZA 1WMHA 3JW0X 1WR6E 3VVWB 2MA9B 2W9NA 2KHWB 4WQOB 3X0WA 3L08A 3HM6X 1L2NA 2D11A 1WE6A 1PQSA 4FA6A 2AL6A 4M8MA 4W9CA 2DZIA 2IY1B 5AZFA 2CKHB 2IBIB 2LWPA 3JYUA 4GU2A 2ZVNA 1WZ3A 2KNBA 2KANA 2MWSB 4W9EA 2XEWA 4GDLB 4WWPA 1YX5B 3PPAA 4FULA 4PYZA 4HJKA 3CSFA 3T8MA 3A4RA 4II3B 4W9HA 4WJQA 2OJRA 4MH0E 1WH3A 1WIAA 3TCAA 3PRPB 3VAWA 2ZEQA 2Z59B 1SIFA 1E7UA 1XT9B 4PS3A 2L76A 3UINB 2O6VD 2HJ8A 3PS6A 2MP2B 2LI5A 4TQ1A 4HPLB 4M8NA 1WY8A 1Q5WB 3LDZE 2MSED 4GDKB 3CMMB 4BKSD 4DHJD 2KQSA 2O2VA 1S1QB 5L95C 4K81A 2BWFA 3UQAA 3U30A 2ZCCA 1I42A 1IPGA 2KDEB 2BKFA 2J0JA 4RMAA 2LXCA 2N1VA 4MGKE 3ZTCA 2AL3A 1OEYJ 2JUOA 2JWZA 2KJRA 1WYWB 1WM2A 3ZDTA 4EOYA 2M8SA 4DDID 3O65B 1E5WA 2KMAA 2L0TA 2J0KA 2IO2B 1QZEA 2GOWA 4CO7A 3ZVVA 1V80A 4HDQA 2V4LA 2FIDA 3WAMA 3R7QA 3AU5A 3SU8X 1UELA 3R66C 4BBNC 1V5OA 1BT0A 2IZVB 1WJNA 4AUQC 1EF1A 3C0RB 1Q1OA 3V6CB 3A33B 3SHQA 1TBEA 1J8CA 1RLFA 5CHWA 2O6VB 1WE7A 4GDKA 2D10A 2REXA 3VTWA 2G45B 1OQYA 2EMSA 4B6WA 4CYEA 3QARA 3W1SC 3UF8A 4E3CA 4PS8A 1NBFC 2KC1A 2KDIA 1U4AA 2JY6A 2NR2A 3APCA 1C3TA 5LXHA 3IG3A 3ZNGC 2KFKA 1P9DU 3I3TB 3JSVA 3DOWA 3PLUA 3V6EB 3RD2A 2AWTA 3HIZA 1UH6A 1VD2A 3KUDB 2G4SA 3N3KB 1LQBA 2C7HA 1WGDA 4E74A 4MJSA 1H4RA 1HE8A 3RZWC 3ML8A 2IO3B 4MJSB 2FNJB 1KJTA 2KKCA 3A9JA 2R2OA 3V61A 4IWOA 2Z0DB 2DENB 2N1WA 2MQJA 5CTRC 3Q3JA 4K7SA 4ZRIA 4F8CB 2KLGA 1F9JA 3KH0A 2EKEC 2ZJDA 4XZ4A 4BVUC 4BBNF 3ZTDA 3VQIA 1WJ4A 3PSEB 3L16A 3WAOA 2NCNA 3WAPA 3EFUA 2GBRA 2VRRB 4F1SA 4G0NB 2LRWA 5CX3A 4DWFA 4X57B 3TL5A 1Y8RC 3EC8A 3HK0A 3OAWA 3ZNHB 2C7NB 2KWVB 4AJYB 3N30A 4ZDVA 4HCPB 3DVGX 1X1MA 4IWPA 3UGBB 2JVCA 3JSVB 3L17A 3PT2B 5LLIA 3TMPB 2KMCA 4KZ0A 2XK5B 2Z0EB 4EZKA 3QWZB 1GUAB 3AULA 2KC2A 3AXCA 1UGMA 1UZXB 2R2QA 3ENEA 3BINA 3SD5A 2K8HA 2KK8A 4AOFA 4KDIC 2WWZA 1ZW7A 1S3SG 2YLMA 2JPHA 1WGRA 2KOXA 2MLBA 2DAJA 4GDLA 5E6PA 4MDKE 3PTFC 1UBIA 4ZYNA 2CHXA 1V6EA 3APDA 1ZKHA 2PPHA 3PZDA 1IP9A 2LVQA 3NS8A 3QIJA 2V3SA 4W9GA 2KXJA 2HTHA 4DBGA 2JT4B 2NBVB 3IFWB 3H7PA 2KFJA 1V81A 2BKRB 4GN1A 1V9JA 2PE6B 1JRUA 2KTFA 4IC7B 2N7EA 2KX3A 1YJ1A 4DHJB 3JVZX 4WJNA 3HHMA 3N32A 2L05A 3CF6E 1H8CA 2IO0B 1WXAA 2PEAA 2KLCA 1UD7A 2EMTA 4GXBA 1KOTA 1WRDB 1RAXA 2KZRA 4BKTA 1A5RA 2CHWA 4EUTA 2N9EB 4W9IA 2LZ6A 4JQWC 1WXSA 2C5LC 3VTUA 4HPMB 2MCNB 2NBWB 1Z5SB 3M62B 2IY0B 1RRBA 2LVOA 2YVCA 4EKUA 3ALBA 3IVFA 2A5UA 4A3OA 1G6JA 3M63B 3RUIB 1OEYA 4YL8A 2PE9A 3WA0A 3OLMD 2KX0A 2Y5BB 4ZRJA 5D7GA 3H6NA 1SGHA 4DHZB 1WZ0A 2K1FA 2CS4A 2FCQA 3DPDA 4LJPB 5C23A 3VFKA 2RSUA 1WI0A 2BPSA 1D3ZA 1E90A 4I6LB 3WANA 4MSQB 4EZJA 3AI5A 4TV3A 3DDCB 4W9LA 5FR6A 4ICVA 2DYMA 5JH5C 4KSKC 2O2VB 2KVRA 5KHOA 3MJWA 3RZFA 4KDLB 4BKSA 4IUMB 5TR5A 3PLVA 4CHKA 4GMVA 2OOBB 5AZGA 1FXTB 4NJ6A 1OGWA 1R4MI 4JGHB 2ZCBA 3NY5A 4MGIE 2KDFB 4OVVA 3V62A 1WR1A 1GC6A 5IAAC 4KV2A 5AEKB 2LVPA 4PYUA 5HKHA 3SDLC 2K39A 1TZ1A 1WXMA 3QC8B 2BYVE 1NDDA 2ZVOA 3KYCD 5BO4B 2GBJA 1WGHA 3H7PB 1YIWA 3HM3A 4IM3A 5LXIB 3A1QB 3UIPB 3H7SA 3IHPC 2IYDB 5AZHA 2ZNVB 3VUYA 3A1QA 2RPQA 2DZKA 4BFRA 5EDSA 1E8ZA 3ECIA 3H1UA 3PHXB 3U8ZA 2A4ZA 3ZNID 4IM2A 4G50A 3S2AA 3ZLZA 4A20A 3PVLA 4DXAB 4HLEA 1UBQA 2FCSA 5L83A 4WJPA 2BYEA 2C7MB 4ASWC 3A9KB 3PRMB 2MBBB 2M1MA 1T0YA 2MBOA 2N7DA 2RD0A 2O6VA 4GSWA 4MGYE 4OVUA 3ZDMC 1XQQA 2KTRB 1EO6A 1EUVB 4J6IA 2WX1A 1V86A 4KIKA 3W1YA 3NHEB 3TJPA 2BYFA 4HK2A 2G4DB 2LXAA 2IO1B 4M0WB 3NOBA 2DZMA 4K1RB 2GBNA 2KTRA 3B0AA 2DHZA 4ANXA 4NJ7A 4W9KA 2RGFA 2CR5A 3GOEA 2D3GA 3L0WB 4N9F4 4NY0A 4ANUA 2DAFA 4JL9A 1WXVA 2KJ6A 2KJHB 4A3PA 2L0FA 1VCBA 1P3QU 1KM7A 4FADA 3ZUNA 4AJWA 2L8JA 4II2B 3TIXA 3Q3FA 2L00B 3QAQA 3RT3B 5G2NA 1Q0WB 3DBRI 3RULA 4DDGD 1AARA 1V2YA 2I1KA 2I1JA 3NZUA 2FCNA 2LUEA 2C60A 2KD0A 3K9OB 1P98A 4FBJB 1NI2A 4TQ0A 4RM8A 1I35A 2MX2A 3QA8A 3A4SC 3L13A 4GGQA 3DVNV 2GBMA 4LDTB 2LGXA 1WJUA 2N4FA 2LGYA 4FHKA 4P7IA 3VHTC 2KFKB 4IWQA 4AP4C 2UYZB 4TUUA 1LFDA 2N9XA 2NPTA 2LD9A 3B08A 2WDTB 3H9DA 2KWCA 3DBLI 2WX0A 3MHSD 5J18A 1R4NI 2V1YA 2ASQA 2ZZPB 4K7WA 2DZJA 2LASA 3DVNU 3DCGA 1K8RB 2MBQA 1Z2MA 4MM3A 3L10B 2FIFA 1P1AA 2RR9A 2KN5A 2L3ZA 4LDTD 2LJ5A 2BGFA 5D94A 3T9LA 3VUXA 3DBSA 4HWIB 4B95A 3QQ8B 3ZRFA 2D07B 1GG3A 4ANWA 3NZSA 4TKNA 1GNUA 4W9FA 2PJHA 4JIOU 4XX5A 2BWES 2KO3A 5G55A 2WYQA 4I6NB 2ZPYA 4GIVA 1WF9A 2FCMA 4EEWA 2K6QA 3K9PB 3VH4B 3KUCB 4KVGB 3W1SA 3UIOB 1J0GA 4FJZA 2K8BA 2QHOA 4K7UA 4FJYA 2M4NA 5DCNA 4DK5A 1E7VA 2MRPA 4HVBA 2ZPNA 2C9WB 2M17A 3AU4A 4FHJA 4NPNA 5DPRA 3ZRCA 1WFYA 4BKGA 4IW0A 5DPSA 1XD3B 5D2MB 1J19A 4G3XB 2G3QB 4GB9A 1V5TA 2GMIC 5JZEB 2ZNVC 4PS7A 1ZGUB 2D2QA 5D6JB 5E6NA 2J7QB 2N9PC 4FN2A 1KLVA 2MBEA 4KZCA 3DBHI 4MELA 1YD8U 4RM9A 1WX7A 1WX8A 5C1ZA 2JRIB 4W9JA 4FJVB 4LCDE 2HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JHB A;  4WWN A;  1L7Y A;  3ML9 A;  4JLC A;  2JZ3 B;  1OTR B;  2GBK A;  3EEC A;  3KYD D;  3PHW B;  3RYT A;  3X23 A;  3ZKJ C;  4BOZ B;  5J2R A;  3DVG Y;  4IM0 A;  2FAZ A;  3PRZ A;  1M94 A;  4MEM A;  5GMV A;  1WJ6 A;  1WM3 A;  2CU1 A;  3QX1 A;  2K25 A;  5KHQ A;  4W9D A;  3APF A;  5DPW A;  4MSM B;  3WIM A;  4LJO B;  3ZW3 A;  1TGZ B;  1GJZ A;  2BF8 B;  4HDO A;  4EFO A;  3QJZ A;  1E8Y A;  3EHV A;  3M3J A;  3A9K A;  4ANV A;  4ZRK A;  2K8C A;  2NPT B;  3KVF B;  1C1Y B;  3OJ3 A;  5CHF A;  3CST A;  3WAL A;  1V49 A;  2UWQ A;  3R7R A;  2KWU B;  3UQB A;  2MW5 A;  1LXD A;  1WMH B;  3QK0 A;  4G11 A;  3VUW A;  2XK5 A;  3D32 A;  1E8W A;  3VTV A;  4ICU A;  3PV1 A;  4F7Z A;  1LM8 B;  1P0R A;  2K6D B;  2KDB A;  4E71 A;  4XC2 A;  2CHZ A;  3B1L X;  2AEH A;  3OJ4 B;  4KIK B;  2DX5 B;  1GC7 A;  3PRE A;  3TBL D;  1SE9 A;  1RFA A;  3A9J B;  5CHV C;  3QHT A;  2HD5 B;  3GZN I;  4HCN B;  2NBU A;  5E6O A;  4B9K A;  2XBB C;  3L54 A;  4WJO A;  3VDZ A;  2M0X A;  2JF5 A;  2JXX A;  4FLH A;  4NQK E;  1IYF A;  5DPT A;  3VH3 B;  3ZIM A;  4NAW B;  2DYB A;  5JHA A;  2JRH A;  4NAW A;  4AWJ A;  4NQL B;  1ISN A;  3PGE A;  4NNJ B;  3DQV A;  4WAA A;  1EF5 A;  1WX9 A;  2NVU I;  2LGD A;  3U7D A;  2B3A A;  2L7R A;  2MBH A;  4IG7 B;  2DYO A;  4KSL C;  3VXW A;  4URK A;  2FUH B;  2J0M A;  3KUZ A;  5IA7 A;  4HXD A;  1CMX B;  4I6P A;  1TTN A;  4MGZ E;  3ZNZ B;  3LJ3 A;  2AYO B;  4WWO A;  3ZO5 B;  3BY4 B;  1E8X A;  4DHZ E;  2NS5 A;  3KW5 B;  1MG8 A;  2LRU A;  3RCZ A;  3R3M A;  1WGY A;  2MP2 A;  3QCA A;  2KQ7 A;  3IBE A;  4GOC A;  1YQB A;  3MTN B;  4EZL A;  1YX6 B;  1WGG A;  4BOS C;  3M95 A;  3P2B A;  3ONS A;  3V60 A;  5J17 A;  2JZZ A;  1WMH A;  3JW0 X;  1WR6 E;  3VVW B;  2MA9 B;  2W9N A;  2KHW B;  4WQO B;  3X0W A;  3L08 A;  3HM6 X;  1L2N A;  2D11 A;  1WE6 A;  1PQS A;  4FA6 A;  2AL6 A;  4M8M A;  4W9C A;  2DZI A;  2IY1 B;  5AZF A;  2CKH B;  2IBI B;  2LWP A;  3JYU A;  4GU2 A;  2ZVN A;  1WZ3 A;  2KNB A;  2KAN A;  2MWS B;  4W9E A;  2XEW A;  4GDL B;  4WWP A;  1YX5 B;  3PPA A;  4FUL A;  4PYZ A;  4HJK A;  3CSF A;  3T8M A;  3A4R A;  4II3 B;  4W9H A;  4WJQ A;  2OJR A;  4MH0 E;  1WH3 A;  1WIA A;  3TCA A;  3PRP B;  3VAW A;  2ZEQ A;  2Z59 B;  1SIF A;  1E7U A;  1XT9 B;  4PS3 A;  2L76 A;  3UIN B;  2O6V D;  2HJ8 A;  3PS6 A;  2MP2 B;  2LI5 A;  4TQ1 A;  4HPL B;  4M8N A;  1WY8 A;  1Q5W B;  3LDZ E;  2MSE D;  4GDK B;  3CMM B;  4BKS D;  4DHJ D;  2KQS A;  2O2V A;  1S1Q B;  5L95 C;  4K81 A;  2BWF A;  3UQA A;  3U30 A;  2ZCC A;  1I42 A;  1IPG A;  2KDE B;  2BKF A;  2J0J A;  4RMA A;  2LXC A;  2N1V A;  4MGK E;  3ZTC A;  2AL3 A;  1OEY J;  2JUO A;  2JWZ A;  2KJR A;  1WYW B;  1WM2 A;  3ZDT A;  4EOY A;  2M8S A;  4DDI D;  3O65 B;  1E5W A;  2KMA A;  2L0T A;  2J0K A;  2IO2 B;  1QZE A;  2GOW A;  4CO7 A;  3ZVV A;  1V80 A;  4HDQ A;  2V4L A;  2FID A;  3WAM A;  3R7Q A;  3AU5 A;  3SU8 X;  1UEL A;  3R66 C;  4BBN C;  1V5O A;  1BT0 A;  2IZV B;  1WJN A;  4AUQ C;  1EF1 A;  3C0R B;  1Q1O A;  3V6C B;  3A33 B;  3SHQ A;  1TBE A;  1J8C A;  1RLF A;  5CHW A;  2O6V B;  1WE7 A;  4GDK A;  2D10 A;  2REX A;  3VTW A;  2G45 B;  1OQY A;  2EMS A;  4B6W A;  4CYE A;  3QAR A;  3W1S C;  3UF8 A;  4E3C A;  4PS8 A;  1NBF C;  2KC1 A;  2KDI A;  1U4A A;  2JY6 A;  2NR2 A;  3APC A;  1C3T A;  5LXH A;  3IG3 A;  3ZNG C;  2KFK A;  1P9D U;  3I3T B;  3JSV A;  3DOW A;  3PLU A;  3V6E B;  3RD2 A;  2AWT A;  3HIZ A;  1UH6 A;  1VD2 A;  3KUD B;  2G4S A;  3N3K B;  1LQB A;  2C7H A;  1WGD A;  4E74 A;  4MJS A;  1H4R A;  1HE8 A;  3RZW C;  3ML8 A;  2IO3 B;  4MJS B;  2FNJ B;  1KJT A;  2KKC A;  3A9J A;  2R2O A;  3V61 A;  4IWO A;  2Z0D B;  2DEN B;  2N1W A;  2MQJ A;  5CTR C;  3Q3J A;  4K7S A;  4ZRI A;  4F8C B;  2KLG A;  1F9J A;  3KH0 A;  2EKE C;  2ZJD A;  4XZ4 A;  4BVU C;  4BBN F;  3ZTD A;  3VQI A;  1WJ4 A;  3PSE B;  3L16 A;  3WAO A;  2NCN A;  3WAP A;  3EFU A;  2GBR A;  2VRR B;  4F1S A;  4G0N B;  2LRW A;  5CX3 A;  4DWF A;  4X57 B;  3TL5 A;  1Y8R C;  3EC8 A;  3HK0 A;  3OAW A;  3ZNH B;  2C7N B;  2KWV B;  4AJY B;  3N30 A;  4ZDV A;  4HCP B;  3DVG X;  1X1M A;  4IWP A;  3UGB B;  2JVC A;  3JSV B;  3L17 A;  3PT2 B;  5LLI A;  3TMP B;  2KMC A;  4KZ0 A;  2XK5 B;  2Z0E B;  4EZK A;  3QWZ B;  1GUA B;  3AUL A;  2KC2 A;  3AXC A;  1UGM A;  1UZX B;  2R2Q A;  3ENE A;  3BIN A;  3SD5 A;  2K8H A;  2KK8 A;  4AOF A;  4KDI C;  2WWZ A;  1ZW7 A;  1S3S G;  2YLM A;  2JPH A;  1WGR A;  2KOX A;  2MLB A;  2DAJ A;  4GDL A;  5E6P A;  4MDK E;  3PTF C;  1UBI A;  4ZYN A;  2CHX A;  1V6E A;  3APD A;  1ZKH A;  2PPH A;  3PZD A;  1IP9 A;  2LVQ A;  3NS8 A;  3QIJ A;  2V3S A;  4W9G A;  2KXJ A;  2HTH A;  4DBG A;  2JT4 B;  2NBV B;  3IFW B;  3H7P A;  2KFJ A;  1V81 A;  2BKR B;  4GN1 A;  1V9J A;  2PE6 B;  1JRU A;  2KTF A;  4IC7 B;  2N7E A;  2KX3 A;  1YJ1 A;  4DHJ B;  3JVZ X;  4WJN A;  3HHM A;  3N32 A;  2L05 A;  3CF6 E;  1H8C A;  2IO0 B;  1WXA A;  2PEA A;  2KLC A;  1UD7 A;  2EMT A;  4GXB A;  1KOT A;  1WRD B;  1RAX A;  2KZR A;  4BKT A;  1A5R A;  2CHW A;  4EUT A;  2N9E B;  4W9I A;  2LZ6 A;  4JQW C;  1WXS A;  2C5L C;  3VTU A;  4HPM B;  2MCN B;  2NBW B;  1Z5S B;  3M62 B;  2IY0 B;  1RRB A;  2LVO A;  2YVC A;  4EKU A;  3ALB A;  3IVF A;  2A5U A;  4A3O A;  1G6J A;  3M63 B;  3RUI B;  1OEY A;  4YL8 A;  2PE9 A;  3WA0 A;  3OLM D;  2KX0 A;  2Y5B B;  4ZRJ A;  5D7G A;  3H6N A;  1SGH A;  4DHZ B;  1WZ0 A;  2K1F A;  2CS4 A;  2FCQ A;  3DPD A;  4LJP B;  5C23 A;  3VFK A;  2RSU A;  1WI0 A;  2BPS A;  1D3Z A;  1E90 A;  4I6L B;  3WAN A;  4MSQ B;  4EZJ A;  3AI5 A;  4TV3 A;  3DDC B;  4W9L A;  5FR6 A;  4ICV A;  2DYM A;  5JH5 C;  4KSK C;  2O2V B;  2KVR A;  5KHO A;  3MJW A;  3RZF A;  4KDL B;  4BKS A;  4IUM B;  5TR5 A;  3PLV A;  4CHK A;  4GMV A;  2OOB B;  5AZG A;  1FXT B;  4NJ6 A;  1OGW A;  1R4M I;  4JGH B;  2ZCB A;  3NY5 A;  4MGI E;  2KDF B;  4OVV A;  3V62 A;  1WR1 A;  1GC6 A;  5IAA C;  4KV2 A;  5AEK B;  2LVP A;  4PYU A;  5HKH A;  3SDL C;  2K39 A;  1TZ1 A;  1WXM A;  3QC8 B;  2BYV E;  1NDD A;  2ZVO A;  3KYC D;  5BO4 B;  2GBJ A;  1WGH A;  3H7P B;  1YIW A;  3HM3 A;  4IM3 A;  5LXI B;  3A1Q B;  3UIP B;  3H7S A;  3IHP C;  2IYD B;  5AZH A;  2ZNV B;  3VUY A;  3A1Q A;  2RPQ A;  2DZK A;  4BFR A;  5EDS A;  1E8Z A;  3ECI A;  3H1U A;  3PHX B;  3U8Z A;  2A4Z A;  3ZNI D;  4IM2 A;  4G50 A;  3S2A A;  3ZLZ A;  4A20 A;  3PVL A;  4DXA B;  4HLE A;  1UBQ A;  2FCS A;  5L83 A;  4WJP A;  2BYE A;  2C7M B;  4ASW C;  3A9K B;  3PRM B;  2MBB B;  2M1M A;  1T0Y A;  2MBO A;  2N7D A;  2RD0 A;  2O6V A;  4GSW A;  4MGY E;  4OVU A;  3ZDM C;  1XQQ A;  2KTR B;  1EO6 A;  1EUV B;  4J6I A;  2WX1 A;  1V86 A;  4KIK A;  3W1Y A;  3NHE B;  3TJP A;  2BYF A;  4HK2 A;  2G4D B;  2LXA A;  2IO1 B;  4M0W B;  3NOB A;  2DZM A;  4K1R B;  2GBN A;  2KTR A;  3B0A A;  2DHZ A;  4ANX A;  4NJ7 A;  4W9K A;  2RGF A;  2CR5 A;  3GOE A;  2D3G A;  3L0W B;  4N9F 4;  4NY0 A;  4ANU A;  2DAF A;  4JL9 A;  1WXV A;  2KJ6 A;  2KJH B;  4A3P A;  2L0F A;  1VCB A;  1P3Q U;  1KM7 A;  4FAD A;  3ZUN A;  4AJW A;  2L8J A;  4II2 B;  3TIX A;  3Q3F A;  2L00 B;  3QAQ A;  3RT3 B;  5G2N A;  1Q0W B;  3DBR I;  3RUL A;  4DDG D;  1AAR A;  1V2Y A;  2I1K A;  2I1J A;  3NZU A;  2FCN A;  2LUE A;  2C60 A;  2KD0 A;  3K9O B;  1P98 A;  4FBJ B;  1NI2 A;  4TQ0 A;  4RM8 A;  1I35 A;  2MX2 A;  3QA8 A;  3A4S C;  3L13 A;  4GGQ A;  3DVN V;  2GBM A;  4LDT B;  2LGX A;  1WJU A;  2N4F A;  2LGY A;  4FHK A;  4P7I A;  3VHT C;  2KFK B;  4IWQ A;  4AP4 C;  2UYZ B;  4TUU A;  1LFD A;  2N9X A;  2NPT A;  2LD9 A;  3B08 A;  2WDT B;  3H9D A;  2KWC A;  3DBL I;  2WX0 A;  3MHS D;  5J18 A;  1R4N I;  2V1Y A;  2ASQ A;  2ZZP B;  4K7W A;  2DZJ A;  2LAS A;  3DVN U;  3DCG A;  1K8R B;  2MBQ A;  1Z2M A;  4MM3 A;  3L10 B;  2FIF A;  1P1A A;  2RR9 A;  2KN5 A;  2L3Z A;  4LDT D;  2LJ5 A;  2BGF A;  5D94 A;  3T9L A;  3VUX A;  3DBS A;  4HWI B;  4B95 A;  3QQ8 B;  3ZRF A;  2D07 B;  1GG3 A;  4ANW A;  3NZS A;  4TKN A;  1GNU A;  4W9F A;  2PJH A;  4JIO U;  4XX5 A;  2BWE S;  2KO3 A;  5G55 A;  2WYQ A;  4I6N B;  2ZPY A;  4GIV A;  1WF9 A;  2FCM A;  4EEW A;  2K6Q A;  3K9P B;  3VH4 B;  3KUC B;  4KVG B;  3W1S A;  3UIO B;  1J0G A;  4FJZ A;  2K8B A;  2QHO A;  4K7U A;  4FJY A;  2M4N A;  5DCN A;  4DK5 A;  1E7V A;  2MRP A;  4HVB A;  2ZPN A;  2C9W B;  2M17 A;  3AU4 A;  4FHJ A;  4NPN A;  5DPR A;  3ZRC A;  1WFY A;  4BKG A;  4IW0 A;  5DPS A;  1XD3 B;  5D2M B;  1J19 A;  4G3X B;  2G3Q B;  4GB9 A;  1V5T A;  2GMI C;  5JZE B;  2ZNV C;  4PS7 A;  1ZGU B;  2D2Q A;  5D6J B;  5E6N A;  2J7Q B;  2N9P C;  4FN2 A;  1KLV A;  2MBE A;  4KZC A;  3DBH I;  4MEL A;  1YD8 U;  4RM9 A;  1WX7 A;  1WX8 A;  5C1Z A;  2JRI B;  4W9J A;  4FJV B;  4LCD E;  2HE7 A; 
#chains in the Genus database with same CATH topology
 5JHB A;  4JLC A;  3DWM A;  3RYT A;  2K0P A;  3X23 A;  3ZKJ C;  3DBH B;  2WXH A;  3PRZ A;  1WM3 A;  3SEB A;  5KHQ A;  3APF A;  3WIM A;  1T0R C;  1PYW D;  1TGZ B;  1GJZ A;  2BF8 B;  3EHV A;  5EE9 A;  1C1Y B;  3OJ3 A;  5CHF A;  1ESF A;  1SJE D;  1XCT L;  4IKG A;  3WAL A;  2KWU B;  3UQB A;  2MW5 A;  4G11 A;  4BZA A;  2XK5 A;  3D32 A;  1WXQ A;  3PV1 A;  1P0R A;  4P1C C;  4XC2 A;  2CHZ A;  3OJ4 B;  3PRE A;  1GC7 A;  1YJI A;  1MVK A;  4HRO A;  5FK9 C;  3AE5 B;  5E6O A;  4B9K A;  2XBB C;  1T6B X;  3VDZ A;  3V3X A;  1KTK A;  2DYB A;  1SJH D;  2V4I B;  4M02 A;  3Q8F A;  4AWJ A;  2KN4 A;  1EWY C;  4WAA A;  1I4Q A;  1WX9 A;  3U7D A;  2LGD A;  4HKZ E;  1BUI C;  4LNI A;  1NYR A;  3ZNZ B;  4YT0 B;  4WWO A;  1FFU A;  1MJD A;  3R3M A;  3RCZ A;  1PGA A;  3MTN B;  1YX6 B;  3CWI A;  3ONS A;  5J17 A;  2JZZ A;  2E3T A;  3TUO A;  2W9N A;  5C3J B;  3L08 A;  2WXM A;  2WS3 B;  1L6U A;  1WE6 A;  1PQS A;  4FA6 A;  2BT6 A;  4M8M A;  2FBW B;  2DZI A;  2IBI B;  2LWP A;  4JX1 C;  3BZD B;  4GU2 A;  4LLG M;  3P4P B;  1Y56 A;  4MM3 B;  2KAN A;  2K22 A;  2XEW A;  5H8Y E;  4GDL B;  4FUL A;  4PYZ A;  4HJK A;  3A4R A;  4WJQ A;  2WP9 B;  1PGX A;  1SIF A;  1E7U A;  4PS3 A;  1WYG A;  4A9A A;  2Y3A A;  2MP2 B;  4M8N A;  1WY8 A;  3LDZ E;  4RF1 A;  4GDK B;  4BKS D;  4HKQ A;  4DHJ D;  2O2V A;  1GB4 A;  2WXK A;  2W3S A;  1I42 A;  2KDE B;  1N6Z A;  2LXC A;  1ACC A;  1B1Z A;  3NVZ A;  1WM2 A;  3VR9 B;  4DDI D;  1E5W A;  2KMA A;  2BS4 B;  2IO2 B;  2AQ3 B;  1V80 A;  2QSD A;  3CIR B;  2GB1 A;  3SU8 X;  1V5O A;  4AUQ C;  1EF1 A;  1J8C A;  1RWS A;  4GDK A;  2JZP A;  3AEB B;  1HTO A;  3QAR A;  2EKI A;  4JE3 B;  2KC1 A;  1J7B A;  4WAF A;  4ACF A;  2WXO A;  5LXH A;  1IUE A;  3IG3 A;  3ZNG C;  3AEF B;  3JSV A;  3HIZ A;  3KUD B;  1C76 A;  3NJT A;  3RZW C;  1JWB D;  2IO3 B;  3ML8 A;  4MJS B;  1KJT A;  2R2O A;  1AWD A;  1EU4 A;  3NVW A;  3V61 A;  4IWO A;  4US9 A;  2ONQ A;  2N1W A;  3PO0 A;  5CTR C;  3R2T A;  2KLG A;  3H8H A;  2ZJD A;  2RDG A;  4BBN F;  4BVU C;  1AN8 A;  3VQI A;  1WJ4 A;  3WAO A;  1XLN A;  1N62 A;  3UI3 A;  3R8B A;  1CQV A;  1L4Z B;  5CX3 A;  1SE2 A;  3RPF C;  1Y8R C;  3ZNH B;  2C7N B;  2V0G A;  1TYG B;  3GZN B;  3JSV B;  3L17 A;  3PT2 B;  1VDV A;  2ZW0 A;  4EZK A;  1GUA B;  2VH1 A;  3AXC A;  4JWS C;  2R2Q A;  4M00 A;  2HDE A;  1L0X B;  4JPS A;  2BB6 A;  3P4R B;  2MLB A;  4GDL A;  4P6V F;  1UBI A;  2CHX A;  1V6E A;  1ZKH A;  1L5P A;  1FMA D;  2LVQ A;  4W9G A;  5IO9 A;  3H7P A;  1V81 A;  2PE6 B;  3ETR A;  3HHM A;  2L05 A;  2WLB A;  1NEN B;  2KLC A;  1UD7 A;  2EMT A;  4ZRQ A;  4GXB A;  1KOT A;  1RAX A;  1WGK A;  1WXS A;  2C5L C;  1TJE A;  1RRB A;  2LVO A;  4EKU A;  1G6J A;  3M63 B;  2PTL A;  1STE A;  2PE9 A;  3WA0 A;  3OLM D;  1IGD A;  4D2K A;  1HTQ A;  4B0E A;  4DHZ B;  4US8 A;  3IXS A;  4LJP B;  4ITK A;  1D3Z A;  2WXQ A;  4I6L B;  3WAN A;  3BYY B;  3ZJU A;  4W9L A;  2I2Y A;  4PT5 A;  3AE4 B;  1V8C A;  4KSK C;  2MJ3 A;  5KHO A;  4KDL B;  4IUM B;  2ICI A;  5IKC M;  4GMV A;  4NJ6 A;  4LK0 M;  1GAQ B;  1GC6 A;  5AEK B;  4PYU A;  1GPX A;  3EGR A;  4DXF A;  3QC8 B;  3J9C A;  2ZVO A;  3GB1 A;  1YQ4 B;  1WGH A;  3HM3 A;  4IM3 A;  5AZH A;  2YEP F;  1EU3 A;  2QIL A;  4A8X C;  1FNU A;  2WGS A;  1N63 A;  2RPQ A;  1IGC A;  1E8Z A;  3B2G A;  2NTS A;  3ZNI D;  1VJK A;  4DXA B;  2Y5C A;  3PVL A;  4LTU A;  5FR3 A;  5IN7 A;  1KLU D;  5IOI A;  1QIL A;  4USA A;  3DWG C;  3DBL B;  2INP E;  3A9K B;  2M1M A;  2MBO A;  2VZK B;  4REZ A;  4J6I A;  1FM0 D;  2WX1 A;  2BYF A;  2G4D B;  2LXA A;  4M0W B;  4LNO A;  3B0A A;  1FCL A;  4NJ7 A;  2CR5 A;  3GOE A;  1TKG A;  4N9F 4;  2M0A A;  1QF6 A;  1WXV A;  2KJ6 A;  2L0F A;  1VCB A;  2WXP A;  1KM7 A;  4FAD A;  3ZUN A;  3B2F A;  2L00 B;  3QAQ A;  2I1K A;  2JWU A;  2K9X A;  3HRD D;  2MX2 A;  3A4S C;  3L13 A;  2CJN A;  4ZOH C;  2GBM A;  3Q6B A;  1FO4 A;  4FHK A;  3VHT C;  1V97 A;  4AP4 C;  2UYZ B;  1BXT A;  2NTT A;  3IAM 1;  1VZ7 A;  1XCQ L;  3DBL I;  3MHS D;  2MJE A;  2DNF A;  1K8R B;  4MM3 A;  2RR9 A;  1NYQ A;  1OQR A;  4LDT D;  1QQR A;  1K52 A;  5D94 A;  1FCC C;  4B95 A;  1GG3 A;  5GXG B;  3I63 C;  2PJH A;  1ZPS A;  4I6N B;  2ZPY A;  4GIV A;  1WF9 A;  3MJ5 A;  4KVG B;  1J0G A;  3UIO B;  2QHO A;  3AE6 B;  1WSP A;  2J42 A;  3Q69 A;  2ZPN A;  1WFY A;  4IW0 A;  5DPS A;  1XD3 B;  4RGM A;  3C19 A;  2IPK D;  4GB9 A;  4LNN A;  1V5T A;  2GMI C;  5JZE B;  2N9P C;  1KLV A;  1V1P B;  4MEL A;  1WX8 A;  4YTP B;  2SEB D;  4AQ7 A;  1SE4 A;  1L7Y A;  2JZ3 B;  3EEC A;  1HEZ E;  3DVG Y;  4IM0 A;  2FAZ A;  2LGS A;  1WJ6 A;  1C9F A;  2CU1 A;  2K25 A;  5DPW A;  4MSM B;  4NZL B;  5HI1 A;  1CK1 A;  1E8Y A;  3ZXV A;  4ZRK A;  1HA5 A;  2NPT B;  2UWQ A;  1WMH B;  3W5U B;  1E8W A;  4ICU A;  1LM8 B;  2K6D B;  4O1N A;  1FRR A;  2KDB A;  4E71 A;  3FIL B;  4NJC A;  1RFA A;  5CHV C;  4HCN B;  2NBU A;  2PKO A;  3L54 A;  3MHZ A;  5HHD G;  2JXX A;  4FLH A;  3RNG C;  1IYF A;  1FRD A;  1TS5 A;  5DPT A;  3ZIM A;  1YN5 A;  5JHA A;  2JRH A;  4NAW A;  1ISN A;  3V05 A;  3VRA B;  2B3A A;  2L7R A;  2INC C;  2DYO A;  3AN1 A;  2G1E A;  2J0M A;  3KUZ A;  3AEE B;  1TTN A;  4MGZ E;  1B9R A;  3IT4 B;  2NS5 A;  1MG8 A;  1WGY A;  1FNV A;  3RI7 C;  1YQB A;  1JML A;  2XNA C;  3P2B A;  3V60 A;  3JW0 X;  1I4R A;  2D11 A;  1JWM D;  1RYJ A;  2AL6 A;  3VRB B;  4A6Q A;  3KWL A;  2ZVN A;  3FAH A;  4Q2J A;  3OG5 A;  3AB5 A;  2I38 A;  3PPA A;  3CSF A;  3T8M A;  1I4X A;  3BVM A;  1WIA A;  2GI9 A;  3TCA A;  3VAW A;  2ZEQ A;  3UIN B;  3PS6 A;  1L6V A;  2LI5 A;  4HPL B;  1Q5W B;  2V3P A;  3CMM B;  1S1Q B;  2VZK D;  2DLB A;  4RMA A;  3HVZ A;  2N1V A;  3ZTC A;  2AL3 A;  2BS2 B;  1SSN A;  2KJR A;  1IBX A;  3ZDT A;  4IOI E;  2M8S A;  3KLS X;  4CO7 A;  1QZE A;  3RFZ B;  2LHE A;  4HDQ A;  2W82 A;  2QJL A;  2W3R A;  3R7Q A;  4BBN C;  1KFY B;  1UEL A;  2KT7 A;  3ZYY X;  1TBE A;  2KWD A;  1R4N B;  2O6V B;  1WE7 A;  3VTW A;  2REX A;  2WU2 B;  1ZOY B;  3W1S C;  1TKE A;  4P1B C;  4ZRP A;  4PS8 A;  2V9H A;  2NR2 A;  1P9D U;  3DOW A;  3PLU A;  4YTM B;  1F2R I;  1QOA A;  3RD2 A;  3AED B;  1VD2 A;  4E74 A;  1VRA B;  4C7Z A;  2FNJ B;  2KKC A;  3A9J A;  2K5P A;  2J4X A;  1T0S C;  3Q3J A;  2JXT A;  3KH0 A;  2EKE C;  2QCZ A;  3W2D A;  2BYT A;  3HVD A;  3N1Y C;  4J3O D;  2LRW A;  4C56 C;  5BYR A;  3HK0 A;  3OAW A;  4OHJ A;  2KWV B;  3IAS 1;  1X1M A;  4IWP A;  3TMP B;  2KMC A;  4XWW A;  3QWZ B;  4XYC A;  3BIN A;  2M56 B;  2RDB C;  2WWZ A;  4EE2 A;  3AM9 A;  1WGR A;  1N5W A;  4ZHO A;  3PTF C;  3APD A;  3PZD A;  1IP9 A;  3SFD B;  3NS8 A;  3QIJ A;  2V3S A;  4DBG A;  2HTH A;  4C4V A;  2NBV B;  2KFJ A;  4IC7 B;  2KTF A;  2KX3 A;  1YJ1 A;  4WJN A;  1H8C A;  1SIJ A;  1HXY D;  3R2I A;  1WRD B;  2KZR A;  4EUT A;  3OWE B;  1YN4 A;  1F2R C;  2W54 A;  3VTU A;  4HPM B;  1GB1 A;  1JWA D;  3ALB A;  3IVF A;  3RUI B;  3Q3M C;  2KX0 A;  2Y5B B;  1QOG A;  1SGH A;  4HEA 1;  1WZ0 A;  1E10 A;  2CS4 A;  3DPD A;  5C23 A;  1VR9 A;  5G5G A;  1XLP A;  3TEY A;  4MSQ B;  4EZJ A;  3DDC B;  3GP7 A;  5FR6 A;  3AV8 A;  4ICV A;  3P63 A;  3GE3 C;  2KVR A;  3RZF A;  4CHK A;  2OOB B;  1OGW A;  4JGH B;  2BW2 A;  3NY5 A;  4MGI E;  1PDX A;  2ZW1 A;  4OVV A;  1ZP0 B;  2J52 A;  3T3O A;  3SDL C;  1TZ1 A;  2JX5 A;  3GS2 A;  5BO4 B;  1MHX A;  1TY0 A;  1YIW A;  2GLS A;  2L32 A;  3BII D;  3N1X C;  4LNF A;  1UWM A;  4YXD B;  4IDI A;  5E6J A;  3IT6 B;  2BVC A;  3H1U A;  2A4Z A;  4IM2 A;  4G50 A;  2D5G A;  1K50 A;  2N0S B;  3BK1 A;  4A20 A;  2D3C A;  3PZ8 A;  1L0V B;  3HUI A;  4WJP A;  1N60 A;  4ASW C;  2RD0 A;  4OVU A;  5T8I A;  1EUV B;  1E6E B;  1V86 A;  4HK2 A;  2DZM A;  3FC4 A;  3NVV A;  4KGR A;  4W9K A;  2RGF A;  2LUM A;  2D3G A;  4QAY A;  2BTE A;  4JL9 A;  2KJH B;  5HFY A;  1XLQ A;  4AJW A;  3Q3F A;  5G2N A;  1Q0W B;  4KKI A;  3RUL A;  3ZQ4 A;  2I1J A;  3NZU A;  2WU5 B;  3DHI C;  1P98 A;  4TQ0 A;  3MC9 A;  3RMK C;  2LFI A;  4L23 A;  2N4F A;  3BWU D;  2WXG A;  4TMA B;  2KFK B;  4IWQ A;  5MPO A;  2WXR A;  2NPT A;  1FXA A;  3B08 A;  3H9D A;  2KWC A;  2Z8L A;  1QT9 A;  1R4N I;  2V1Y A;  2ASQ A;  2ZZP B;  2DZJ A;  1I7H A;  1Z2M A;  1P1A A;  1XEE A;  2KDM A;  3T9L A;  4ANW A;  1TY2 A;  4W9F A;  1VZ8 A;  5IP4 D;  2WYQ A;  4WWM A;  3N9Y C;  3K9P B;  3W1S A;  2K8B A;  1E7V A;  4HVB A;  1FEH A;  3ZRC A;  1K51 A;  3SR6 A;  5D2M B;  1J19 A;  2H89 B;  4RNA A;  1J7C A;  2ZNV C;  4PS7 A;  5D6J B;  2J7Q B;  1SBB B;  4FN2 A;  1ZXH A;  3DBH I;  1YD8 U;  5I4D A;  4W9J A;  5JXV A;  4LCD E;  3KUC B;  1JAL A;  4WWN A;  1OTR B;  2QDF A;  3AH7 A;  2FE8 A;  1M94 A;  4MEM A;  5GMV A;  3ZXR A;  2ON8 A;  4MH8 A;  5TSS A;  3A9K A;  2K8C A;  3KVF B;  2JQR B;  5BYS A;  1V49 A;  3R7R A;  3QK0 A;  4OW0 A;  3EA6 A;  1JW9 D;  3VTV A;  2GRI A;  1UUP A;  2KAJ A;  3RNE C;  2UU7 A;  4KIK B;  3QHT A;  3AE7 B;  2JYT A;  1ZUD 2;  2PLP A;  4MAC A;  2WQY B;  5BMI A;  1MPE A;  2IGH A;  5EE1 A;  3VH3 B;  2OJW A;  3ZGZ A;  3AE9 B;  4NQL B;  3PGE A;  4NNJ B;  3DQV A;  3MP9 A;  1EF5 A;  2NVU I;  2MBH A;  4IG7 B;  4KSL C;  3VXW A;  4URK A;  1UNS A;  3LJ3 A;  1SF0 A;  2AYO B;  1NEK B;  3BY4 B;  3NRZ A;  4DHZ E;  3QCA A;  2JU6 X;  4GOC A;  2SAK A;  4BOS C;  1WGG A;  3M95 A;  1FFV A;  1PUT A;  4RF0 A;  3X0W A;  4WQO B;  4B0M A;  1D5Z C;  4W9C A;  1Q10 A;  3SFE B;  2CKH B;  2E6X A;  2BB5 A;  3ZJV A;  2MWS B;  4W9E A;  1LGR A;  1TS2 A;  2LEK A;  1YX5 B;  1YNT E;  3AEC B;  4II3 B;  4W9H A;  4XDC A;  2OJR A;  1WH3 A;  3RNB C;  2Z59 B;  4M01 A;  2L76 A;  3ABV B;  2O6V D;  2HJ8 A;  4TQ1 A;  2HTM E;  4XE0 A;  2MSE D;  2KQS A;  2BWF A;  2WXI A;  2ZCC A;  3P4S B;  1P7F A;  2J0J A;  4MGK E;  1OEY J;  3URY A;  1WYW B;  1DYQ A;  4JWU C;  3O65 B;  2L0T A;  2J0K A;  3ZVV A;  2V4L A;  3WAM A;  3AU5 A;  3U4E G;  3R66 C;  1RM6 C;  3E56 A;  1BT0 A;  4P16 A;  3FIL A;  1Q1O A;  4ARC A;  3V6C B;  3A33 B;  3SHQ A;  4ARI A;  5BYQ A;  1RLF A;  5CHW A;  1HQR D;  2G45 B;  1OQY A;  2EMS A;  2LJI A;  3AE2 B;  4B6W A;  4CYE A;  2PMV A;  3UF8 A;  4E3C A;  4HRS A;  2KDI A;  1F77 A;  1U4A A;  2JY6 A;  3APC A;  3W9C B;  4BAX A;  3T3N A;  2KFK A;  3I3T B;  3V6E B;  3Q14 C;  2AWT A;  3N3K B;  1LQB A;  2C7H A;  4MJS A;  1H4R A;  1HE8 A;  1TS3 A;  2OHF A;  2RMM A;  2PIA A;  2NMQ A;  2Z0D B;  3RNA C;  2DEN B;  2MQJ A;  4K7S A;  4RFB A;  4F8C B;  1F9J A;  2KAC A;  2IND C;  4XZ4 A;  3ZTD A;  2WDR B;  3Q8E A;  3PSE B;  1CJE A;  3WAP A;  2VRR B;  4G0N B;  1TZO A;  4X57 B;  3TEX A;  4HPP A;  4KX6 B;  3EC8 A;  1JCK B;  4AJY B;  3N30 A;  4HCP B;  2LHD A;  5AUK A;  2JVC A;  5LLI A;  4KGS A;  4KZ0 A;  2XK5 B;  2Z0E B;  2JYE A;  3AUL A;  1HZ6 A;  1UZX B;  1T0Q C;  4KDI C;  1ZW7 A;  1S3S G;  2YLM A;  2JPH A;  4PK1 A;  5D3I B;  2KOX A;  2DAJ A;  1DOY A;  2PPH A;  4XDD A;  2PVO D;  1XLO A;  3IFW B;  2QEJ C;  2BKR B;  1V9J A;  4C00 A;  1JRU A;  3KQ4 A;  2KQ4 X;  3CF6 E;  1WXA A;  2RDH A;  2ACZ B;  4W9I A;  2LZ6 A;  4R3D A;  1WWT A;  1Z5S B;  3M62 B;  1E7P B;  2YVC A;  1GOZ A;  2A5U A;  3W5V B;  2G9H D;  3I9V 1;  5D7G A;  1VZ6 A;  3VFK A;  1WRI A;  1I4G A;  1WI0 A;  2BPS A;  1E90 A;  4YWG G;  3AE8 B;  3I5J C;  1FNW A;  3AI5 A;  1ZE3 D;  2DYM A;  3BVZ A;  5JH5 C;  1E0Z A;  2O2V B;  3AE3 B;  3MJW A;  4OZB A;  5TR5 A;  2ZCB A;  2J53 A;  4DXG A;  3Q2A C;  3V62 A;  1WR1 A;  3DBR B;  4KV2 A;  2LVP A;  5HKH A;  2K39 A;  1NDD A;  4ZYS A;  3KYC D;  4YSZ B;  1FD6 A;  2AQ2 B;  3A1Q B;  1F0Z A;  3UIP B;  3IHP C;  2IYD B;  1ENF A;  4ZHP A;  4BFR A;  5EDS A;  1L0Y B;  3ECI A;  3BYT B;  1SE3 A;  4S17 A;  3S2A A;  1BML C;  1UBQ A;  2FCS A;  3MC8 A;  4XWT A;  5L83 A;  2BYE A;  4N58 A;  3RNC C;  2C7M B;  3PRM B;  2Y5P A;  1T0Y A;  3PZ7 A;  3ZDM C;  1MFW A;  1ET6 A;  2KTR B;  1EO6 A;  3W1Y A;  4KIK A;  3EFC A;  3NHE B;  3TJP A;  5AUI A;  2IO1 B;  4MT5 A;  4K1R B;  2GBN A;  4ANX A;  2FUG 1;  1K53 A;  3L0W B;  4NY0 A;  4ANU A;  2DAF A;  2QIE B;  4WH4 A;  4UDU C;  2IGD A;  2L8J A;  3TIX A;  3RT3 B;  1ET9 A;  4DQO C;  1AAR A;  1I4P A;  1IBX B;  2FCN A;  2WHI A;  2C60 A;  1ZDV A;  2KD0 A;  4WUR A;  1NI2 A;  1KH0 A;  1I35 A;  4GGQ A;  4LDT B;  2B76 B;  2LGX A;  1WJU A;  5LNK 1;  2X8X X;  1YOV B;  4P7I A;  4C80 A;  4TUU A;  2N9X A;  1V1O A;  2WDT B;  2DBY A;  4GLS C;  2WX0 A;  1MG4 A;  4S0R A;  4K7W A;  1N5X A;  2IDY A;  3MC0 B;  3P4Q B;  2WXN A;  1OFF A;  3N1Z C;  1SEB D;  3L10 B;  3LXF A;  2KN5 A;  2BGF A;  4WQM A;  4HWI B;  2WXJ A;  3QQ8 B;  2D07 B;  3NZS A;  1D5M C;  3NZ3 A;  1D6E C;  4JIO U;  2KO3 A;  2WDQ B;  5G55 A;  1NI3 A;  2WNM A;  2FCM A;  3VH4 B;  5DCN A;  5HG2 A;  2M4N A;  1JWU D;  2MRP A;  3AU4 A;  2C9W B;  2M17 A;  2CJO A;  3I57 A;  5DPR A;  3TEW A;  3Q3O C;  4BKG A;  1C4P A;  4G3X B;  2G3Q B;  4FXC A;  1ZGU B;  1D5X C;  2MBE A;  1F1H A;  3Q8A A;  4RM9 A;  1WX7 A;  5C1Z A;  2K3U A;  2JRI B;  4K3B A;  3AEG B;  3ML9 A;  3PHW B;  5J2R A;  2GBK A;  3KYD D;  1KLG D;  3MFG A;  4BOZ B;  3DHH C;  2N9L A;  1XF5 L;  1C79 A;  4WIP A;  3QX1 A;  3FKY A;  1RFK A;  4W9D A;  1QOF A;  4LJO B;  3ZW3 A;  4HDO A;  4EFO A;  3QJZ A;  3M3J A;  4ANV A;  4LNK A;  3L4P A;  4N59 A;  1FXI A;  3CST A;  1LXD A;  4N6E B;  3VUW A;  4L2Y A;  1ZXI A;  4F7Z A;  2QC8 A;  5FKA C;  3Q8B A;  3B1L X;  2AEH A;  3TBL D;  2DX5 B;  1SE9 A;  3A9J B;  4TSS A;  2HD5 B;  3GZN I;  5C2T B;  4WJO A;  2M0X A;  2JF5 A;  4NQK E;  4NAW B;  1YMH E;  2PW9 A;  1T5X D;  2FUH B;  5IA7 A;  4HXD A;  1CMX B;  4I6P A;  3ZO5 B;  1E8X A;  3KW5 B;  2LRU A;  1UWX A;  2MP2 A;  2KQ7 A;  3IBE A;  4EZL A;  2MEK A;  1WMH A;  1WR6 E;  3VVW B;  2MA9 B;  2KHW B;  3HM6 X;  1L2N A;  2M19 A;  5AZF A;  2IY1 B;  2RPV A;  4C4V B;  1R4M B;  1C4C A;  3JYU A;  1WZ3 A;  2KNB A;  4OZC A;  4WWP A;  2BS3 B;  1XO3 A;  3P1M A;  4MH0 E;  3PRP B;  1XT9 B;  4HJG E;  1V1P A;  2KMM A;  1I4H A;  1MHH E;  1P7E A;  5EE0 A;  1J7A A;  5L95 C;  4K81 A;  2W55 A;  2CU3 A;  1JRO A;  1EWC A;  3UQA A;  2D3B A;  3U30 A;  1IPG A;  1YQ3 B;  2BKF A;  2LMC A;  1M4V A;  2JUO A;  2MHJ A;  1C77 A;  2JWZ A;  4AS1 A;  4EOY A;  2GOW A;  2FID A;  2MJD A;  2AQ1 B;  2IZV B;  3RNF C;  1WJN A;  1OQQ A;  2D3A A;  3C0R B;  2R61 A;  2AX5 A;  1T3Q A;  2KYW A;  2WDV B;  2D10 A;  1JQ4 A;  3Q3N C;  1NBF C;  1VLB A;  1C3T A;  3E9S A;  1UF0 A;  1UH6 A;  4CQN A;  2G4S A;  1WGD A;  3VR8 B;  2L52 A;  1QLB B;  1N61 A;  3AEA B;  1TIF A;  4ZRI A;  2L83 A;  2H88 B;  4A90 A;  1SB3 C;  3L16 A;  1HZ5 A;  2L1A A;  2NCN A;  4YTN B;  3EFU A;  2GBR A;  4OZA A;  1JWS D;  4F1S A;  3ZJT A;  4DWF A;  3TL5 A;  2LGI A;  4ZDV A;  4M0W A;  3DVG X;  3UGB B;  3O13 A;  1CZP A;  1F52 A;  1LO5 D;  4XGA B;  1AYF A;  2N9K A;  4YSX B;  1TS4 A;  1SXT A;  2KC2 A;  1UGM A;  3AMZ A;  5D3D A;  3ENE A;  3SD5 A;  1A70 A;  2K8H A;  2KK8 A;  4AOF A;  3B9J A;  1E9M A;  5G5H A;  1C78 A;  1FPY A;  5E6P A;  4MDK E;  4ZYN A;  1YJJ A;  3U52 E;  5BMH A;  1PGB A;  1FIQ A;  2KXJ A;  2JT4 B;  4RGO S;  4GN1 A;  2N7E A;  2TSS A;  4DHJ B;  3AE1 B;  3JVZ X;  3N32 A;  2IO0 B;  2IGG A;  5EE3 A;  2PEA A;  2QMT A;  4BKT A;  1A5R A;  2CHW A;  2N9E B;  4JQW C;  1TKY A;  3KWV A;  2KVZ A;  2Q5W D;  2MCN B;  2NBW B;  1QOB A;  2IY0 B;  4A3O A;  4KKJ A;  4A55 A;  1OEY A;  4YL8 A;  1JRP A;  3NG0 A;  4ZRJ A;  1C4A A;  3H6N A;  3P42 A;  2K1F A;  2FCQ A;  1YN3 A;  2RSU A;  4KGT A;  2X38 A;  4TV3 A;  5BMG A;  3DHG C;  4BKS A;  3PLV A;  5AZG A;  1FXT B;  3LYY A;  1R4M I;  1NVI D;  2KDF B;  5IAA C;  1R7S A;  2JSV X;  3U7Z A;  1WXM A;  2IJ0 A;  2BYV E;  2VH2 A;  3NUH B;  2GBJ A;  3H7P B;  1DGJ A;  5LXI B;  1KRH A;  4NAM A;  3H7S A;  2ZNV B;  3VUY A;  2WXF A;  3A1Q A;  2DZK A;  3N20 C;  1ROE A;  3Q8C A;  3PHX B;  3U8Z A;  2YEP B;  1L4D B;  3ZLZ A;  4HLE A;  3TEZ A;  1ZDX A;  3U2S C;  2DWQ A;  2MBB B;  2N7D A;  3GE8 C;  2O6V A;  3C8Y A;  4MGY E;  4GSW A;  1XQQ A;  1UGJ A;  1QKZ A;  4YSY B;  3NOB A;  2KTR A;  2DHZ A;  3EUB 2;  3NVY A;  4A3P A;  1P3Q U;  4RGT A;  1PFD A;  4II2 B;  3DBR I;  2WXL A;  4DDG D;  1V2Y A;  1D4B A;  3WCQ A;  2LUE A;  2MH7 A;  3LB8 C;  1EM7 A;  3K9O B;  4FBJ B;  3RN9 C;  4H2A A;  4RM8 A;  3QA8 A;  3DVN V;  2LGY A;  1KF6 B;  1LFD A;  2LD9 A;  3NS1 A;  2EEL A;  5H92 C;  5J18 A;  1AW7 A;  2INN E;  2LAS A;  4RH6 A;  3DVN U;  3BK2 A;  3DCG A;  1DOX A;  2MBQ A;  3BVG A;  2FIF A;  4L1B A;  2L3Z A;  2BBC A;  2LJ5 A;  3VUX A;  2N7J A;  3DBS A;  4K3C A;  3ZRF A;  4OVZ A;  4TKN A;  1GNU A;  4XX5 A;  2BWE S;  2PVG C;  1XXG A;  4EEW A;  1MI0 A;  2K6Q A;  4FJZ A;  4K7U A;  4DK5 A;  4FJY A;  2HJ1 A;  2OED A;  1TT5 B;  4FHJ A;  4NPN A;  4RCO A;  1DOI A;  2BQQ A;  3TSS A;  4RGN A;  2D2Q A;  5E6N A;  2XN9 C;  4KZC A;  2V3N A;  4FJV B;  4C7Y A;  2HE7 A; 
#chains in the Genus database with same CATH homology
 5JHB A;  4WWN A;  1L7Y A;  3ML9 A;  4JLC A;  2JZ3 B;  1OTR B;  2GBK A;  3EEC A;  3KYD D;  3PHW B;  3RYT A;  3X23 A;  3ZKJ C;  4BOZ B;  5J2R A;  3DVG Y;  4IM0 A;  2FAZ A;  3PRZ A;  1M94 A;  4MEM A;  5GMV A;  1WJ6 A;  1WM3 A;  2CU1 A;  3QX1 A;  2K25 A;  5KHQ A;  4W9D A;  3APF A;  5DPW A;  4MSM B;  3WIM A;  4LJO B;  3ZW3 A;  1TGZ B;  1GJZ A;  2BF8 B;  4HDO A;  4EFO A;  3QJZ A;  1E8Y A;  3EHV A;  3M3J A;  3A9K A;  4ANV A;  4ZRK A;  2K8C A;  2NPT B;  3KVF B;  1C1Y B;  3OJ3 A;  5CHF A;  3CST A;  3WAL A;  1V49 A;  2UWQ A;  3R7R A;  2KWU B;  3UQB A;  2MW5 A;  1LXD A;  1WMH B;  3QK0 A;  4G11 A;  3VUW A;  2XK5 A;  3D32 A;  1E8W A;  3VTV A;  4ICU A;  3PV1 A;  4F7Z A;  1LM8 B;  1P0R A;  2K6D B;  2KDB A;  4E71 A;  4XC2 A;  2CHZ A;  3B1L X;  2AEH A;  3OJ4 B;  4KIK B;  2DX5 B;  1GC7 A;  3PRE A;  3TBL D;  1SE9 A;  1RFA A;  3A9J B;  5CHV C;  3QHT A;  2HD5 B;  3GZN I;  4HCN B;  2NBU A;  5E6O A;  4B9K A;  2XBB C;  3L54 A;  4WJO A;  3VDZ A;  2M0X A;  2JF5 A;  2JXX A;  4FLH A;  4NQK E;  1IYF A;  5DPT A;  3VH3 B;  3ZIM A;  4NAW B;  2DYB A;  5JHA A;  2JRH A;  4NAW A;  4AWJ A;  4NQL B;  1ISN A;  3PGE A;  4NNJ B;  3DQV A;  4WAA A;  1EF5 A;  1WX9 A;  2NVU I;  2LGD A;  3U7D A;  2B3A A;  2L7R A;  2MBH A;  4IG7 B;  2DYO A;  4KSL C;  3VXW A;  4URK A;  2FUH B;  2J0M A;  3KUZ A;  5IA7 A;  4HXD A;  1CMX B;  4I6P A;  1TTN A;  4MGZ E;  3ZNZ B;  3LJ3 A;  2AYO B;  4WWO A;  3ZO5 B;  3BY4 B;  1E8X A;  4DHZ E;  2NS5 A;  3KW5 B;  1MG8 A;  2LRU A;  3RCZ A;  3R3M A;  1WGY A;  2MP2 A;  3QCA A;  2KQ7 A;  3IBE A;  4GOC A;  1YQB A;  3MTN B;  4EZL A;  1YX6 B;  1WGG A;  4BOS C;  3M95 A;  3P2B A;  3ONS A;  3V60 A;  5J17 A;  2JZZ A;  1WMH A;  3JW0 X;  1WR6 E;  3VVW B;  2MA9 B;  2W9N A;  2KHW B;  4WQO B;  3X0W A;  3L08 A;  3HM6 X;  1L2N A;  2D11 A;  1WE6 A;  1PQS A;  4FA6 A;  2AL6 A;  4M8M A;  4W9C A;  2DZI A;  2IY1 B;  5AZF A;  2CKH B;  2IBI B;  2LWP A;  3JYU A;  4GU2 A;  2ZVN A;  1WZ3 A;  2KNB A;  2KAN A;  2MWS B;  4W9E A;  2XEW A;  4GDL B;  4WWP A;  1YX5 B;  3PPA A;  4FUL A;  4PYZ A;  4HJK A;  3CSF A;  3T8M A;  3A4R A;  4II3 B;  4W9H A;  4WJQ A;  2OJR A;  4MH0 E;  1WH3 A;  1WIA A;  3TCA A;  3PRP B;  3VAW A;  2ZEQ A;  2Z59 B;  1SIF A;  1E7U A;  1XT9 B;  4PS3 A;  2L76 A;  3UIN B;  2O6V D;  2HJ8 A;  3PS6 A;  2MP2 B;  2LI5 A;  4TQ1 A;  4HPL B;  4M8N A;  1WY8 A;  1Q5W B;  3LDZ E;  2MSE D;  4GDK B;  3CMM B;  4BKS D;  4DHJ D;  2KQS A;  2O2V A;  1S1Q B;  5L95 C;  4K81 A;  2BWF A;  3UQA A;  3U30 A;  2ZCC A;  1I42 A;  1IPG A;  2KDE B;  2BKF A;  2J0J A;  4RMA A;  2LXC A;  2N1V A;  4MGK E;  3ZTC A;  2AL3 A;  1OEY J;  2JUO A;  2JWZ A;  2KJR A;  1WYW B;  1WM2 A;  3ZDT A;  4EOY A;  2M8S A;  4DDI D;  3O65 B;  1E5W A;  2KMA A;  2L0T A;  2J0K A;  2IO2 B;  1QZE A;  2GOW A;  4CO7 A;  3ZVV A;  1V80 A;  4HDQ A;  2V4L A;  2FID A;  3WAM A;  3R7Q A;  3AU5 A;  3SU8 X;  1UEL A;  3R66 C;  4BBN C;  1V5O A;  1BT0 A;  2IZV B;  1WJN A;  4AUQ C;  1EF1 A;  3C0R B;  1Q1O A;  3V6C B;  3A33 B;  3SHQ A;  1TBE A;  1J8C A;  1RLF A;  5CHW A;  2O6V B;  1WE7 A;  4GDK A;  2D10 A;  2REX A;  3VTW A;  2G45 B;  1OQY A;  2EMS A;  4B6W A;  4CYE A;  3QAR A;  3W1S C;  3UF8 A;  4E3C A;  4PS8 A;  1NBF C;  2KC1 A;  2KDI A;  1U4A A;  2JY6 A;  2NR2 A;  3APC A;  1C3T A;  5LXH A;  3IG3 A;  3ZNG C;  2KFK A;  1P9D U;  3I3T B;  3JSV A;  3DOW A;  3PLU A;  3V6E B;  3RD2 A;  2AWT A;  3HIZ A;  1UH6 A;  1VD2 A;  3KUD B;  2G4S A;  3N3K B;  1LQB A;  2C7H A;  1WGD A;  4E74 A;  4MJS A;  1H4R A;  1HE8 A;  3RZW C;  3ML8 A;  2IO3 B;  4MJS B;  2FNJ B;  1KJT A;  2KKC A;  3A9J A;  2R2O A;  3V61 A;  4IWO A;  2Z0D B;  2DEN B;  2N1W A;  2MQJ A;  5CTR C;  3Q3J A;  4K7S A;  4ZRI A;  4F8C B;  2KLG A;  1F9J A;  3KH0 A;  2EKE C;  2ZJD A;  4XZ4 A;  4BVU C;  4BBN F;  3ZTD A;  3VQI A;  1WJ4 A;  3PSE B;  3L16 A;  3WAO A;  2NCN A;  3WAP A;  3EFU A;  2GBR A;  2VRR B;  4F1S A;  4G0N B;  2LRW A;  5CX3 A;  4DWF A;  4X57 B;  3TL5 A;  1Y8R C;  3EC8 A;  3HK0 A;  3OAW A;  3ZNH B;  2C7N B;  2KWV B;  4AJY B;  3N30 A;  4ZDV A;  4HCP B;  3DVG X;  1X1M A;  4IWP A;  3UGB B;  2JVC A;  3JSV B;  3L17 A;  3PT2 B;  5LLI A;  3TMP B;  2KMC A;  4KZ0 A;  2XK5 B;  2Z0E B;  4EZK A;  3QWZ B;  1GUA B;  3AUL A;  2KC2 A;  3AXC A;  1UGM A;  1UZX B;  2R2Q A;  3ENE A;  3BIN A;  3SD5 A;  2K8H A;  2KK8 A;  4AOF A;  4KDI C;  2WWZ A;  1ZW7 A;  1S3S G;  2YLM A;  2JPH A;  1WGR A;  2KOX A;  2MLB A;  2DAJ A;  4GDL A;  5E6P A;  4MDK E;  3PTF C;  1UBI A;  4ZYN A;  2CHX A;  1V6E A;  3APD A;  1ZKH A;  2PPH A;  3PZD A;  1IP9 A;  2LVQ A;  3NS8 A;  3QIJ A;  2V3S A;  4W9G A;  2KXJ A;  2HTH A;  4DBG A;  2JT4 B;  2NBV B;  3IFW B;  3H7P A;  2KFJ A;  1V81 A;  2BKR B;  4GN1 A;  1V9J A;  2PE6 B;  1JRU A;  2KTF A;  4IC7 B;  2N7E A;  2KX3 A;  1YJ1 A;  4DHJ B;  3JVZ X;  4WJN A;  3HHM A;  3N32 A;  2L05 A;  3CF6 E;  1H8C A;  2IO0 B;  1WXA A;  2PEA A;  2KLC A;  1UD7 A;  2EMT A;  4GXB A;  1KOT A;  1WRD B;  1RAX A;  2KZR A;  4BKT A;  1A5R A;  2CHW A;  4EUT A;  2N9E B;  4W9I A;  2LZ6 A;  4JQW C;  1WXS A;  2C5L C;  3VTU A;  4HPM B;  2MCN B;  2NBW B;  1Z5S B;  3M62 B;  2IY0 B;  1RRB A;  2LVO A;  2YVC A;  4EKU A;  3ALB A;  3IVF A;  2A5U A;  4A3O A;  1G6J A;  3M63 B;  3RUI B;  1OEY A;  4YL8 A;  2PE9 A;  3WA0 A;  3OLM D;  2KX0 A;  2Y5B B;  4ZRJ A;  5D7G A;  3H6N A;  1SGH A;  4DHZ B;  1WZ0 A;  2K1F A;  2CS4 A;  2FCQ A;  3DPD A;  4LJP B;  5C23 A;  3VFK A;  2RSU A;  1WI0 A;  2BPS A;  1D3Z A;  1E90 A;  4I6L B;  3WAN A;  4MSQ B;  4EZJ A;  3AI5 A;  4TV3 A;  3DDC B;  4W9L A;  5FR6 A;  4ICV A;  2DYM A;  5JH5 C;  4KSK C;  2O2V B;  2KVR A;  5KHO A;  3MJW A;  3RZF A;  4KDL B;  4BKS A;  4IUM B;  5TR5 A;  3PLV A;  4CHK A;  4GMV A;  2OOB B;  5AZG A;  1FXT B;  4NJ6 A;  1OGW A;  1R4M I;  4JGH B;  2ZCB A;  3NY5 A;  4MGI E;  2KDF B;  4OVV A;  3V62 A;  1WR1 A;  1GC6 A;  5IAA C;  4KV2 A;  5AEK B;  2LVP A;  4PYU A;  5HKH A;  3SDL C;  2K39 A;  1TZ1 A;  1WXM A;  3QC8 B;  2BYV E;  1NDD A;  2ZVO A;  3KYC D;  5BO4 B;  2GBJ A;  1WGH A;  3H7P B;  1YIW A;  3HM3 A;  4IM3 A;  5LXI B;  3A1Q B;  3UIP B;  3H7S A;  3IHP C;  2IYD B;  5AZH A;  2ZNV B;  3VUY A;  3A1Q A;  2RPQ A;  2DZK A;  4BFR A;  5EDS A;  1E8Z A;  3ECI A;  3H1U A;  3PHX B;  3U8Z A;  2A4Z A;  3ZNI D;  4IM2 A;  4G50 A;  3S2A A;  3ZLZ A;  4A20 A;  3PVL A;  4DXA B;  4HLE A;  1UBQ A;  2FCS A;  5L83 A;  4WJP A;  2BYE A;  2C7M B;  4ASW C;  3A9K B;  3PRM B;  2MBB B;  2M1M A;  1T0Y A;  2MBO A;  2N7D A;  2RD0 A;  2O6V A;  4GSW A;  4MGY E;  4OVU A;  3ZDM C;  1XQQ A;  2KTR B;  1EO6 A;  1EUV B;  4J6I A;  2WX1 A;  1V86 A;  4KIK A;  3W1Y A;  3NHE B;  3TJP A;  2BYF A;  4HK2 A;  2G4D B;  2LXA A;  2IO1 B;  4M0W B;  3NOB A;  2DZM A;  4K1R B;  2GBN A;  2KTR A;  3B0A A;  2DHZ A;  4ANX A;  4NJ7 A;  4W9K A;  2RGF A;  2CR5 A;  3GOE A;  2D3G A;  3L0W B;  4N9F 4;  4NY0 A;  4ANU A;  2DAF A;  4JL9 A;  1WXV A;  2KJ6 A;  2KJH B;  4A3P A;  2L0F A;  1VCB A;  1P3Q U;  1KM7 A;  4FAD A;  3ZUN A;  4AJW A;  2L8J A;  4II2 B;  3TIX A;  3Q3F A;  2L00 B;  3QAQ A;  3RT3 B;  5G2N A;  1Q0W B;  3DBR I;  3RUL A;  4DDG D;  1AAR A;  1V2Y A;  2I1K A;  2I1J A;  3NZU A;  2FCN A;  2LUE A;  2C60 A;  2KD0 A;  3K9O B;  1P98 A;  4FBJ B;  1NI2 A;  4TQ0 A;  4RM8 A;  1I35 A;  2MX2 A;  3QA8 A;  3A4S C;  3L13 A;  4GGQ A;  3DVN V;  2GBM A;  4LDT B;  2LGX A;  1WJU A;  2N4F A;  2LGY A;  4FHK A;  4P7I A;  3VHT C;  2KFK B;  4IWQ A;  4AP4 C;  2UYZ B;  4TUU A;  1LFD A;  2N9X A;  2NPT A;  2LD9 A;  3B08 A;  2WDT B;  3H9D A;  2KWC A;  3DBL I;  2WX0 A;  3MHS D;  5J18 A;  1R4N I;  2V1Y A;  2ASQ A;  2ZZP B;  4K7W A;  2DZJ A;  2LAS A;  3DVN U;  3DCG A;  1K8R B;  2MBQ A;  1Z2M A;  4MM3 A;  3L10 B;  2FIF A;  1P1A A;  2RR9 A;  2KN5 A;  2L3Z A;  4LDT D;  2LJ5 A;  2BGF A;  5D94 A;  3T9L A;  3VUX A;  3DBS A;  4HWI B;  4B95 A;  3QQ8 B;  3ZRF A;  2D07 B;  1GG3 A;  4ANW A;  3NZS A;  4TKN A;  1GNU A;  4W9F A;  2PJH A;  4JIO U;  4XX5 A;  2BWE S;  2KO3 A;  5G55 A;  2WYQ A;  4I6N B;  2ZPY A;  4GIV A;  1WF9 A;  2FCM A;  4EEW A;  2K6Q A;  3K9P B;  3VH4 B;  3KUC B;  4KVG B;  3W1S A;  3UIO B;  1J0G A;  4FJZ A;  2K8B A;  2QHO A;  4K7U A;  4FJY A;  2M4N A;  5DCN A;  4DK5 A;  1E7V A;  2MRP A;  4HVB A;  2ZPN A;  2C9W B;  2M17 A;  3AU4 A;  4FHJ A;  4NPN A;  5DPR A;  3ZRC A;  1WFY A;  4BKG A;  4IW0 A;  5DPS A;  1XD3 B;  5D2M B;  1J19 A;  4G3X B;  2G3Q B;  4GB9 A;  1V5T A;  2GMI C;  5JZE B;  2ZNV C;  4PS7 A;  1ZGU B;  2D2Q A;  5D6J B;  5E6N A;  2J7Q B;  2N9P C;  4FN2 A;  1KLV A;  2MBE A;  4KZC A;  3DBH I;  4MEL A;  1YD8 U;  4RM9 A;  1WX7 A;  1WX8 A;  5C1Z A;  2JRI B;  4W9J A;  4FJV B;  4LCD E;  2HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...