3TIXA

Crystal structure of the chp1-tas3 complex core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
153
Chain Sequence
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDNDIIEAHREQIGGLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRSEMLSQRKLLAAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3,RNA-induced transcriptional sile
publication title The Chp1-Tas3 core is a multifunctional platform critical for gene silencing by RITS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation/protein binding
total genus 45
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3tixA01
1L2NA 2DZKA 4KZCA 3TJPA 3V61A 3VUWA 4GDLB 4HCPB 2M1MA 2GMIC 1WGRA 3C0RB 3L54A 4W9IA 1WGHA 2D11A 1WZ3A 2DAJA 3NZSA 5J2RA 1H8CA 4B9KA 4MM3A 3U7DA 1VD2A 3DVNV 3UF8A 2MA9B 3K9OB 5AZHA 2KWCA 5CHVC 5G2NA 2O6VA 4IC7B 4RM8A 3NOBA 3L08A 2AWTA 2D3GA 2L7RA 3PRZA 4TKNA 2N1WA 3OLMD 4N9F4 2KLCA 3W1YA 1RFAA 2CS4A 4PS7A 3AU4A 3W1SC 4IM0A 2EKEC 2L8JA 2OJRA 4DXAB 2KQ7A 2RGFA 4FJYA 4IG7B 1SE9A 2AL6A 2IBIB 4W9JA 4EUTA 1EF5A 2M4NA 3GOEA 2LWPA 1UGMA 2MP2A 1CMXB 2LD9A 1Z5SB 4AP4C 4WQOB 3VUXA 3EECA 1WE6A 1WGYA 1Q0WB 4FHKA 1OEYJ 4EKUA 1WGDA 4MELA 2OOBB 2L0TA 2Y5BB 2V1YA 1J19A 1WJUA 4MGKE 1UBQA 3H7PB 1LFDA 1V86A 3DOWA 2REXA 3JW0X 2YVCA 4W9DA 4WJQA 3UQBA 4K7UA 4FADA 2JPHA 3B08A 2J0KA 2WX1A 1AARA 3KYCD 4PS3A 3CSFA 5AZFA 3EC8A 5CHWA 3AU5A 2WDTB 1FXTB 3A9KA 4ICVA 4TQ0A 2LGDA 2KWUB 1V5TA 4OVVA 3L10B 1S1QB 1Y8RC 4MH0E 3JVZX 2MBBB 4ZRIA 4G11A 4W9LA 3KVFB 4GB9A 4IW0A 3RT3B 3LDZE 2KOXA 1V6EA 4A3PA 3OJ3A 4G3XB 2JRHA 4W9GA 1UZXB 5EDSA 2N7DA 1ZW7A 2AEHA 2DHZA 2ZJDA 5BO4B 1U4AA 4HXDA 2L00B 4GXBA 1NI2A 2KKCA 3RYTA 4KZ0A 4NY0A 2D10A 3ZNID 2JUOA 1HE8A 1JRUA 1E8YA 2CKHB 2V4LA 1GC6A 1T0YA 1E7UA 2KC1A 5JHAA 1KM7A 4ZDVA 4E74A 1P1AA 1WFYA 1E8XA 4ANUA 5C1ZA 2C5LC 1LM8B 2GBRA 2O2VA 2MLBA 3A9JA 1OQYA 2XEWA 2L05A 3JSVA 3QAQA 3A33B 4W9FA 4M0WB 5IA7A 2WX0A 4IWQA 2K39A 1XT9B 3KUZA 4LDTB 4BBNC 5KHQA 1EF1A 2MBHA 3V62A 1SGHA 1ISNA 2MBEA 3H6NA 3R66C 2KDIA 4II3B 4K7WA 4EEWA 4GIVA 3PLUA 3KYDD 1P3QU 2FUHB 1WMHB 2MCNB 1WGGA 4IWOA 1NBFC 4LJOB 5GMVA 2IO1B 1L7YA 1IP9A 3HM3A 2I1JA 1RRBA 4CO7A 3PHXB 3ZNGC 4GDLA 4I6PA 5L83A 4K7SA 2LVPA 4IM3A 1XD3B 4NQLB 2N1VA 3PLVA 2K6QA 5IAAC 1OTRB 5CX3A 3VUYA 2J0MA 2VRRB 3WALA 3T9LA 3JYUA 1XQQA 3PV1A 4FA6A 3Q3FA 1YX6B 3APFA 2DAFA 2I1KA 1M94A 3UGBB 1H4RA 2KTFA 3PTFC 4RMAA 5CHFA 3HK0A 2J7QB 2AYOB 2K8CA 4PYZA 4FBJB 3H1UA 2JT4B 2JY6A 3EHVA 2UYZB 1I42A 5LXHA 2KN5A 1WIAA 4GOCA 2C7NB 2HD5B 2KK8A 3U8ZA 4FLHA 3MHSD 3ZLZA 2K6DB 2KWVB 1GJZA 3HIZA 3AULA 2BYEA 4TUUA 1WYWB 2EMTA 1R4MI 2MX2A 2KNBA 2ZEQA 4EZJA 2IZVB 2KX0A 1MG8A 3H7PA 1E90A 5E6NA 4KSLC 3V6EB 1J0GA 2NS5A 4ANWA 4FJZA 3VFKA 3IHPC 2BWFA 4TV3A 2NPTB 2BKRB 2ZVOA 2DYMA 4NJ7A 3HHMA 2C7MB 3QX1A 5LLIA 2XK5B 2JXXA 3PS6A 3OAWA 3PSEB 1GNUA 2ASQA 4M8MA 4W9HA 1WH3A 3A1QB 4HK2A 2Z0EB 3ZW3A 2CHWA 2L0FA 3KUDB 3ZKJC 3B0AA 4HCNB 3D32A 4K1RB 1V9JA 3S2AA 2BWES 2BKFA 2M8SA 4KDIC 5L95C 2K8BA 3A4RA 2DENB 3N30A 3UIOB 2KHWB 4IM2A 2N9PC 1WJNA 3NHEB 4MSQB 4XZ4A 5E6OA 4DK5A 5FR6A 4EOYA 1YX5B 2G4DB 4W9EA 4FHJA 4FULA 1WX9A 1GUAB 2BF8B 2PPHA 4I6LB 4M8NA 1WR1A 4PYUA 4BBNF 4CYEA 3SU8X 3PRPB 1I35A 1WM3A 3VQIA 4G50A 2LXCA 3TCAA 5LXIB 4HJKA 4JIOU 4HDOA 3M63B 2ZNVC 2FCQA 5G55A 3Q3JA 1LQBA 3SHQA 4ANXA 2KO3A 1WRDB 4FJVB 2LI5A 1ZKHA 1UELA 3DVNU 4KDLB 2QHOA 4GDKB 3RCZA 4A20A 1BT0A 3H7SA 3UIPB 3PHWB 5J18A 4HLEA 2KVRA 1C1YB 2NVUI 3IG3A 1IYFA 2MBQA 4HVBA 4RM9A 2KLGA 4PS8A 2MP2B 5D7GA 1LXDA 4JLCA 1EO6A 3K9PB 4MJSB 1TZ1A 2BGFA 2MQJA 4WAAA 3ALBA 4ZRKA 4MDKE 1KOTA 4II2B 2M17A 2KMAA 1WMHA 3B1LX 3NY5A 2DZIA 2IY0B 3N3KB 5AZGA 3QHTA 3QA8A 1C3TA 2KMCA 1YD8U 2CR5A 4HPLB 3VTVA 2KD0A 3OJ4B 2O6VD 2R2OA 1E8WA 2K1FA 1E8ZA 4K81A 4XC2A 1WR6E 2DZJA 2IYDB 2CHXA 3DBLI 3I3TB 2NBVB 2KTRB 3ONSA 3V60A 3TL5A 3ZTCA 2LRUA 2BYVE 3PREA 2UWQA 1Q1OA 2KDFB 1TGZB 2WWZA 4P7IA 1Z2MA 2JRIB 3ZDMC 4MSMB 4XX5A 2KJ6A 2M0XA 1WXVA 2G3QB 4MGYE 3ML9A 4WWPA 2WYQA 3ENEA 3ZUNA 1ZGUB 3QK0A 3WAOA 3U30A 3R3MA 4GSWA 4HPMB 4EZLA 1UH6A 2PEAA 4KV2A 3DBHI 1UD7A 4NAWB 2JZZA 2D07B 1OGWA 2DYBA 2KFKB 1S3SG 5DPTA 2CU1A 1OEYA 3CMMB 2B3AA 1X1MA 1GG3A 3MJWA 2FAZA 3DBRI 3VH4B 2JZ3B 4HDQA 4AOFA 1E7VA 4IWPA 2A4ZA 1UBIA 4GU2A 3X0WA 4X57B 5DPWA 2R2QA 1IPGA 4F1SA 1WX7A 4MGZE 3ZNZB 2NBWB 4KSKC 4ANVA 2ZPYA 2NPTA 2L76A 3QCAA 3WA0A 4AJWA 2LVOA 2PJHA 5DPRA 1J8CA 3ZVVA 2XK5A 3PPAA 5D6JB 3AI5A 4AWJA 4DDID 1V81A 4W9CA 3RULA 4BVUC 4J6IA 3A1QA 4FN2A 4DHJB 1YIWA 1TBEA 4GN1A 4KIKB 2HE7A 2ZZPB 3QQ8B 2LGXA 2RR9A 4BKSD 2G45B 3WAMA 1RAXA 4LJPB 2IO0B 3BINA 3QJZA 3HM6X 1WY8A 2ZPNA 3IVFA 3L13A 4DDGD 4AJYB 2FCNA 2K8HA 3VDZA 2MWSB 1WF9A 1KJTA 3IFWB 4F7ZA 2JF5A 3PT2B 2DX5B 4JGHB 2LGYA 1D3ZA 2C60A 5KHOA 3WIMA 3CSTA 2KDEB 1WZ0A 2MRPA 3TMPB 1G6JA 3DQVA 3EFUA 4WJNA 4ZRJA 2NCNA 4KVGB 5D2MB 1P0RA 2Z0DB 2NR2A 4GMVA 4JQWC 3PZDA 2LRWA 2KDBA 3L0WB 3WAPA 2A5UA 4DHJD 1GC7A 5JH5C 1QZEA 4JL9A 4GDKA 5CTRC 1PQSA 3TBLD 2D2QA 2AL3A 2NBUA 4AUQC 5HKHA 1WI0A 2LZ6A 2KC2A 2N4FA 3IBEA 1V2YA 4ICUA 3TIXA 1P9DU 2IO3B 2K25A 4BKTA 3M62B 1A5RA 4HWIB 1V49A 4ASWC 3AXCA 4MJSA 2KJRA 4NQKE 2HJ8A 3ZRCA 2RD0A 3ZRFA 2DYOA 2Z59B 3RUIB 2O6VB 4WJOA 2IY1B 2BYFA 2DZMA 3VHTC 2G4SA 4E71A 3DPDA 2LASA 3UQAA 1WM2A 3VVWB 3VXWA 4A3OA 1RLFA 3L16A 3PVLA 3LJ3A 2KQSA 2KTRA 3M3JA 1KLVA 3W1SA 2FIFA 4MEMA 2GBNA 3KW5B 3DBSA 2YLMA 4WWOA 5DCNA 4BOZB 3APDA 3QARA 4GGQA 2C9WB 1WXMA 2FCSA 2LUEA 3BY4B 3QC8B 3ZTDA 3ECIA 3GZNI 4W9KA 1SIFA 3SDLC 3VTUA 3DVGX 4CHKA 4MGIE 5D94A 3ML8A 1NDDA 3T8MA 4NJ6A 3ZDTA 3PRMB 2MSED 5JHBA 4NNJB 2FCMA 2N7EA 4NAWA 1VCBA 3DDCB 2EMSA 2N9EB 4E3CA 5JZEB 1R4NI 2KFKA 2ZVNA 3SD5A 4EZKA 3VTWA 4BOSC 4DWFA 2LVQA 2CHZA 2PE9A 1E5WA 1YQBA 2BPSA 3A9KB 3QIJA 4EFOA 3KUCB 4BKSA 3VH3B 4URKA 3L17A 3QWZB 3NS8A 1YJ1A 3RD2A 2RPQA 3R7QA 2N9XA 2KX3A 3A4SC 2PE6B 5AEKB 2ZCBA 3APCA 2KZRA 4YL8A 1K8RB 2V3SA 2GBKA 2HTHA 4G0NB 3NZUA 1WJ6A 5TR5A 5J17A 4B6WA 2JWZA 2MW5A 1Q5WB 2XBBC 1WE7A 3M95A 2JVCA 3O65B 4BFRA 2MBOA 4DHZB 1TTNA 3DVGY 3KH0A 2LJ5A 4WWNA 4BKGA 4F8CB 1WX8A 3X23A 1V5OA 5C23A 1P98A 2FNJB 4WJPA 4ZYNA 3WANA 4OVUA 4KIKA 4B95A 2C7HA 2ZCCA 4IUMB 3RZFA 1WXAA 2IO2B 5E6PA 1WXSA 3R7RA 1EUVB 3PGEA 4I6NB 3ZNHB 3CF6E 4DBGA 2O2VB 2KANA 2ZNVB 3A9JB 4TQ1A 1F9JA 2FIDA 2GBJA 3JSVB 3RZWC 3P2BA 3UINB 2KXJA 2RSUA 2GOWA 5DPSA 2KJHB 2L3ZA 2LXAA 4LCDE 2GBMA 4DHZE 4NPNA 1V80A 3ZO5B 2W9NA 3MTNB 3ZIMA 1WJ4A 3N32A 3VAWA 3DCGA 4LDTD 3H9DA 3V6CB 2KFJA 2J0JA
chains in the Genus database with same CATH superfamily
1L2NA 3VUWA 2M1MA 2GMIC 4W9IA 1WGHA 2DAJA 1NI3A 3NZSA 1SF0A 4MM3A 2INPE 3AB5A 2BBCA 3UF8A 3FKYA 3N1ZC 3Q6BA 2KWCA 4IC7B 2WXJA 2AWTA 4A6QA 4N9F4 1RFAA 3W1SC 2INNE 4IM0A 2OJRA 2OHFA 4DXAB 2AL6A 3I57A 3FILA 1FCCC 5BMGA 2LWPA 2LD9A 1YQ3B 2K3UA 1GB1A 1YJIA 4KX6B 1OEYJ 4MELA 4A55A 2OOBB 1WJUA 1UBQA 1E10A 1TS2A 2WXGA 3RNFC 1UNSA 3KYCD 3NJTA 5AZFA 3EC8A 1J7BA 2KQ4X 2Y3AA 5CHWA 2WDTB 2WLBA 3AE9B 1ESFA 5HI1A 4OW0A 4IW0A 1V6EA 1DOIA 4N58A 3GE3C 1ZW7A 2DHZA 2LMCA 3GB1A 3HVDA 1NI2A 3HVZA 2V3PA 3RYTA 2D10A 3ABVB 3NRZA 4RF1A 1FD6A 2WXFA 2RDGA 1E7UA 1KM7A 2JXTA 4XWTA 1P1AA 2L83A 5C1ZA 1LM8B 2MLBA 2L05A 2E6XA 3A33B 2J42A 1KF6B 2WX0A 4Q2JA 4EEWA 1N60A 3URYA 1P3QU 2FUHB 1JQ4A 4JWSC 5IO9A 2WDRB 3EA6A 1A70A 3AEGB 4CO7A 3Q8FA 4K7SA 4NQLB 3AE7B 1QLBB 1ENFA 2K6QA 2Y5CA 4RFBA 3ZXVA 2J0MA 2WXIA 2BB6A 1ET6A 2VRRB 3MC0B 4JX1C 4FA6A 1T6BX 3UGBB 1JWBD 3PTFC 3DHIC 4RMAA 3IAM1 2J7QB 5CHFA 5GXGB 5C2TB 2JT4B 3EHVA 2PVOD 3BVGA 1WIAA 2C7NB 4PT5A 2KK8A 3U8ZA 5E6JA 3MHZA 3MHSD 4ITKA 1KFYB 4XYCA 3ZLZA 2BYEA 4C4VA 4EZJA 2IZVB 1FNWA 3MJ5A 1OFFA 3H7PA 1E90A 3AMZA 5E6NA 1J0GA 1HTOA 4FJZA 2W55A 1SXTA 2NPTB 2BKRB 3BYTB 5HG2A 1E0ZA 3HHMA 2K9XA 3QX1A 4YSYB 2JXXA 2MH7A 3PS6A 3I63C 4W9HA 1UGJA 1SBBB 1L5PA 3B0AA 3U4EG 4HCNB 3D32A 2BB5A 3S2AA 2W82A 3SR6A 1C76A 5L95C 2BS4B 4M02A 1XXGA 2KHWB 1P7FA 2N9PC 1WJNA 5E6OA 1T0RC 2EKIA 3NUHB 4TMAB 2G4DB 4P1CC 4W9EA 2BF8B 2PPHA 1WR1A 4PYUA 4BBNF 1I35A 1WM3A 4G50A 4HJKA 4JIOU 2FCQA 4N59A 2KO3A 2KT7A 1SE2A 1C9FA 1HA5A 2GRIA 3H7SA 1DGJA 1ZOYB 1T5XD 5IP4D 1VJKA 3UI3A 1KTKA 2MP2B 5D7GA 4MJSB 4ZRKA 3K9PB 1TZ1A 4WH4A 2MQJA 2KMAA 2MJEA 2IY0B 2CJNA 3QHTA 3QA8A 1YOVB 1HXYD 1RYJA 1YD8U 4HPLB 4DQOC 3I5JC 4CQNA 1E8ZA 2DZJA 2CHXA 3TL5A 1MI0A 2LRUA 3PREA 2L1AA 5AUKA 1F0ZA 2KDFB 3T3OA 4WWPA 4O1NA 1ZGUB 3EFCA 5BYRA 4EZLA 1UH6A 2PEAA 3DBHI 2DYBA 1S3SG 1X1MA 1GG3A 5BYSA 3DBRI 4AOFA 4HDQA 2A4ZA 1UBIA 2WHIA 3X0WA 4X57B 2SAKA 4MGZE 3P4SB 3ZNZB 4ANVA 3AN1A 2QILA 4AJWA 4N6EB 2WU5B 3A1QA 4FN2A 1YIWA 4GN1A 4RF0A 4ACFA 2N9LA 1TZOA 4BKSD 1I4QA 3Q3NC 3WAMA 4C7YA 1RAXA 3QJZA 1ET9A 2IGDA 3IVFA 4DDGD 1T3QA 1VDVA 4AJYB 2FCNA 2KACA 4A9AA 1KJTA 2BQQA 1GOZA 2JF5A 1I4PA 3DHHC 2KDEB 3TEWA 2LGSA 1F1HA 1G6JA 3H8HA 1HTQA 1P0RA 2MEKA 2Z0DB 2NR2A 3WAPA 2A5UA 3V3XA 4GDKA 5CTRC 1QF6A 3TBLD 3TIXA 2N7JA 4C80A 1F2RC 1C77A 4HWIB 1A5RA 2RD0A 1AWDA 3RUIB 2M19A 2IY1B 1AN8A 1NEKB 4ZHPA 2G4SA 2JYEA 3P1MA 1J7AA 4USAA 2WQYB 3L16A 3PVLA 2KTRA 3E9SA 4IOIE 2VZKB 2IGHA 1NYRA 1QOAA 2YLMA 4TSSA 5DCNA 3QARA 3ZJVA 3ZTDA 1TS4A 3AE8B 1SIFA 3VTUA 4MGIE 1CJEA 3T8MA 4HEA1 3ZDTA 4BZAA 2MSED 4NNJB 1SEBD 5JZEB 2KFKA 4NZLB 2H89B 3R8BA 3VTWA 2QIEB 4EZKA 2CHZA 1TS3A 2PE9A 1E5WA 3KUCB 3VH3B 3L17A 3VR9B 2VZKD 1L0YB 3NS8A 2MJDA 1AYFA 4OHJA 3BK2A 3HRDD 3DWGC 2ZCBA 5IN7A 2OJWA 2RDHA 2QEJC 5TR5A 1EU4A 2MW5A 4HJGE 2JVCA 1FNUA 4F8CB 1WX8A 4S17A 4OZBA 4IUMB 1WXAA 1WXSA 1FFUA 2L52A 4I6NB 3ZNHB 2O2VB 1F9JA 2GBJA 3RZWC 2RSUA 1FRRA 2L3ZA 4WIPA 3Q3MC 2W9NA 3DCGA 1XLPA 1SB3C 4G11A 3TJPA 4GDLB 4HCPB 3BVZA 1K53A 3L54A 2D11A 4M01A 4RGTA 4B9KA 2VH1A 2ON8A 3U7DA 2MA9B 3T3NA 5CHVC 2O6VA 4RM8A 5T8IA 3RI7C 3AEDB 3L08A 3PRZA 2D3GA 4TKNA 4YSZB 1D5ZC 2N1WA 3OLMD 2KLCA 3W1YA 4PS7A 4LNNA 3ZQ4A 1D4BA 2N9KA 2X38A 4IG7B 4EUTA 5I4DA 1EF5A 4KGSA 1L4ZB 2M4NA 3U52E 2LUMA 1D5XC 4WQOB 3VUXA 1C79A 1TKGA 4EKUA 3KWVA 2L0TA 2V1YA 1J19A 3N1YC 4K7UA 4FADA 2JPHA 4YXDB 3AH7A 3B08A 3TSSA 4PS3A 1FXTB 3A9KA 4DXFA 2KWUB 4IDIA 1V5TA 1C4AA 1Y8RC 4MH0E 1VZ6A 2KDMA 3NVZA 4XE0A 3PO0A 4US9A 3RT3B 3LDZE 5MPOA 4A3PA 5EDSA 1UZXB 1L0VB 3AEFB 3CIRB 1RM6C 2EELA 2HDEA 4KZ0A 4NY0A 1WGKA 4RNAA 3RNBC 5H8YE 3P4RB 1JRUA 1E8YA 2CKHB 2KVZA 2V4LA 1WSPA 4LNKA 4ZDVA 1EWYC 4P6VF 3JSVA 3QAQA 5IA7A 3ETRA 1XT9B 3KUZA 5G5HA 2MBHA 1ISNA 3I9V1 3ZJTA 2KDIA 3KQ4A 3PLUA 3KYDD 2QCZA 1RFKA 1WGGA 1WYGA 4IWOA 4LJOB 1L7YA 4C7ZA 2LJIA 2I1JA 3PHXB 5L83A 1XD3B 5IAAC 1OTRB 3IAS1 3EGRA 3NG0A 2DAFA 2KTFA 3HK0A 1YN3A 2AYOB 2K8CA 4FBJB 1KLUD 3SFDB 1STEA 1UF0A 4FLHA 2KWVB 1GJZA 4TUUA 1R4MI 4REZA 3MFGA 2W3RA 1C4CA 5EE9A 1LO5D 4ANWA 3IHPC 2C7MB 1N63A 5LLIA 2K5PA 5IKCM 3PSEB 4M8MA 1WH3A 4HK2A 2L0FA 3MC9A 1NYQA 2AQ2B 3E56A 5IOIA 4ARCA 2BWES 4WWMA 3AECB 1JCKB 3UIOB 4MSQB 5FR6A 4EOYA 1YX5B 4OVZA 4I6LB 1WX9A 2JSVX 1PGAA 3VQIA 3PZ7A 5LXIB 3Q3JA 2GI9A 1CK1A 2Q5WD 2YEPB 4FJVB 1UELA 3UIPB 3PHWB 3SFEB 1C1YB 3BK1A 1UWMA 2WXMA 4NAMA 1LXDA 3RNEC 1EO6A 2BGFA 2FE8A 3B1LX 2ONQA 1D6EC 1C3TA 5G5GA 2KD0A 3W9CB 2R2OA 1E8WA 4XC2A 1WR6E 1PFDA 2NBVB 2CU3A 2WXOA 2UWQA 1Q1OA 2TSSA 2JRIB 4RH6A 4MSMB 4YSXB 2KJ6A 1WXVA 4MGYE 4XDCA 1JRPA 3U30A 3R3MA 4NAWB 2D07B 2CU1A 4WAFA 3MJWA 2FAZA 5C3JB 3Q8BA 2WXHA 3VH4B 2B76B 4IWPA 3TUOA 2PTLA 2JU6X 3DBLB 5DPWA 2R2QA 1GAQB 1SIJA 3W5VB 4KKIA 2NPTA 3WA0A 2PJHA 5DPRA 3ZVVA 2WS3B 5D6JB 4A90A 1V81A 2INDC 5FR3A 4BVUC 1IUEA 4KIKB 5EE3A 3ZYYX 2PKOA 1DOYA 1PGBA 2ZPNA 2FBWB 4KGTA 3AE2B 3VDZA 2MWSB 1JW9D 3IFWB 3PT2B 2K0PA 1FRDA 2C60A 1WZ0A 2PVGC 4WJNA 3LB8C 2V4IB 2AQ3B 1HZ6A 4GMVA 1XO3A 3L0WB 1JMLA 4JL9A 1EU3A 3P63A 3LXFA 2D2QA 4P16A 4AUQC 1L6UA 2RMMA 2KC2A 4BKTA 3M62B 3W2DA 4ASWC 4MJSA 3ZRCA 3ZRFA 2AX5A 1YJJA 2E3TA 1N61A 2BT6A 3VVWB 4A3OA 1VLBA 1KLVA 3W1SA 4MEMA 2GBNA 3MP9A 5AUIA 1WRIA 4BOZB 3APDA 4GGQA 2C9WB 5JXVA 2LUEA 3QC8B 2JYTA 2UU7A 3GZNI 3SDLC 3DVGX 3ML8A 3V05A 1P7EA 2PIAA 2WXPA 3J9CA 3ZJUA 2N7EA 1VCBA 2EMSA 3BIID 2PMVA 2LVQA 2WXRA 3P4PB 1TKYA 3QIJA 4BKSA 3QWZB 3SEBA 1ZXIA 4MACA 1IGCA 2N9XA 2PE6B 1N62A 2QSDA 2D3CA 1WJ6A 2JWZA 3AEAB 1Q5WB 2XBBC 3DVGY 1KRHA 4WWNA 1V5OA 1P98A 1R4NB 2ACZB 3TEXA 2C7HA 4K3CA 3RZFA 1TIFA 3RNAC 1MFWA 2M0AA 3B9JA 3R7RA 2KN4A 3PGEA 3CF6E 1YMHE 1XCQL 3A9JB 4TQ1A 1FCLA 3UINB 4EE2A 2GOWA 1TY2A 5BMHA 4P1BC 4DHZE 2MJ3A 3ZO5B 1Q10A 3ZIMA 1WXQA 3VAWA 4LDTD 3H9DA 3KLSX 2J0JA 3FC4A 4NJCA 2DZKA 3V61A 3FAHA 3C0RB 1WZ3A 1LGRA 2CJOA 2DLBA 2FUG1 5D3DA 1GPXA 4US8A 2EKEC 2KQ7A 2RGFA 4FJYA 4W9JA 3R2IA 3L4PA 4ZYSA 1UGMA 2V0GA 4ZRPA 1WGYA 1Q0WB 2LHEA 4FHKA 2ZW1A 1WGDA 2BVCA 3Q3OC 3BVMA 1V86A 3DOWA 2REXA 3JW0X 2YVCA 4WJQA 1J7CA 5H92C 3UQBA 1TT5B 3VRAB 1RWSA 4TQ0A 4ICVA 2LGDA 2NMQA 4OZAA 1S1QB 4MT5A 1I4GA 2W3SA 2WDVB 2MBBB 4ZRIA 1EWCA 4W9LA 1JWSD 2KOXA 2JRHA 4W9GA 2N7DA 3DWMA 2AEHA 5BO4B 1U4AA 3GE8C 2L00B 4GXBA 4B0MA 1E9MA 5D3IB 1CQVA 4B0EA 1MPEA 2KWDA 1XEEA 1T0YA 5JHAA 4E74A 3AE3B 3ZGZA 4JWUC 1FMAD 1SE4A 5LNK1 2O2VA 1OQYA 2KAJA 2XEWA 4RCOA 1ZPSA 4ZOHC 4W9FA 4M0WB 3NVVA 2XN9C 2K39A 4BBNC 1EF1A 3V62A 4XDDA 3ZXRA 2MBEA 3R66C 1IBXA 4K7WA 4GIVA 4LNIA 1WMHB 2WXQA 1NBFC 4YTNB 3HM3A 4YT0B 3ZNGC 1V8CA 4GDLA 4I6PA 2W54A 4IKGA 2N1VA 3PLVA 5CX3A 4HRSA 3JYUA 1XQQA 3PV1A 3Q3FA 1YX6B 1N5WA 3APFA 2I1KA 1M94A 4PYZA 3H1UA 4XWWA 2UYZB 5LXHA 2KN5A 3BYYB 2HD5B 2V3NA 4KKJA 2K6DB 3AULA 1DYQA 4JE3B 3RN9C 2QJLA 2KX0A 1MG8A 2BS2B 4AQ7A 4KSLC 1L6VA 3VFKA 2BWFA 1FIQA 2ZVOA 2DYMA 4NJ7A 1SJED 4S0RA 1PYWD 2XK5B 3OAWA 2AQ1B 4UDUC 1VZ7A 1XCTL 2D3BA 1SE3A 3ZKJC 1D5MC 2DWQA 4K1RB 1XF5L 1V9JA 1ZP0B 2BKFA 2M8SA 4KDIC 3N30A 2JQRB 4DK5A 3NHEB 4XZ4A 3GS2A 3N20C 4FHJA 3OWEB 4CYEA 2D3AA 2LXCA 3TCAA 4HDOA 3M63B 5G55A 3SHQA 2X8XX 4ANXA 1KH0A 1WRDB 2LGIA 2LI5A 3P42A 4KDLB 3RCZA 4A20A 4HLEA 2MBQA 4HVBA 2PLPA 4RM9A 2KLGA 4PS8A 2I38A 2H88B 4JLCA 2HJ1A 4MDKE 2M17A 1V1OA 3NY5A 2NTTA 1FO4A 3N3KB 5AZGA 2KMCA 1QOBA 3OJ4B 2O6VD 1K52A 2IYDB 3I3TB 3ONSA 3V60A 1JWAD 1TGZB 2WWZA 4XGAB 1Z2MA 3ZDMC 4XX5A 2WGSA 2WYQA 3ENEA 2JX5A 3WAOA 3AE1B 4GSWA 4KV2A 1UD7A 3VRBB 3NVYA 1OEYA 2B3AA 1GB4A 1V1PB 1E7VA 4GU2A 3IT6B 1IPGA 2IJ0A 4F1SA 3IT4B 4KSKC 4WQMA 2ZPYA 3B2GA 3MC8A 2D5GA 3QCAA 2L76A 4YTMB 1FXIA 3PPAA 4DXGA 4W9CA 1T0QC 3DBHB 3NVWA 4DHJB 1TBEA 2HE7A 3QQ8B 3PZ8A 2G45B 2Y5PA 4D2KA 3DBRB 2IO0B 1PGXA 3HM6X 3L13A 4J3OD 2K8HA 1WF9A 2LGYA 1D3ZA 3WIMA 3CSTA 1KLGD 2KMMA 2MRPA 3Q14C 3DQVA 3EFUA 4ZRJA 3BWUD 4KVGB 5D2MB 4JQWC 3PZDA 2BTEA 4WURA 4DHJD 3W5UB 5JH5C 3O13A 1PQSA 2WU2B 3RNGC 1WI0A 2N4FA 3IBEA 4ICUA 1ZDVA 1QT9A 1OQQA 2QDFA 4MM3B 4NQKE 2HJ8A 2DYOA 2Z59B 4WJOA 3RNCC 2BYFA 3VHTC 1N6ZA 4E71A 1PDXA 3M3JA 3FILB 3KW5B 3DBSA 1WXMA 1HZ5A 2FCSA 3BY4B 2I2YA 4PK1A 3ECIA 4W9KA 1YNTE 3C19A 4LK0M 3PRMB 2FCMA 4NAWA 4E3CA 1VRAB 3SD5A 2BPSA 4L1BA 4EFOA 1XLQA 2GB1A 4QAYA 4URKA 2WNMA 3VR8B 1XLOA 1YJ1A 3RD2A 3AE5B 3R7QA 2KX3A 3AE4B 3A4SC 5AEKB 1MHHE 2J4XA 4YL8A 1K8RB 2V3SA 2BS3B 2HTHA 4G0NB 2INCC 3TEZA 3NZUA 5J17A 4B6WA 2ZW0A 1WE7A 4HPPA 1TTNA 1ZUD2 2QMTA 2LJ5A 4BKGA 2FNJB 4ZYNA 3WANA 4KIKA 4B95A 4L2YA 2IO2B 1M4VA 5E6PA 2V9HA 1EUVB 4DBGA 2KANA 1F77A 2FIDA 2KXJA 5DPSA 3RMKC 1HEZE 2KJHB 1QOGA 2LXAA 2GBMA 1R7SA 1V80A 3MTNB 1WJ4A 3N32A 1MG4A 1JWMD 3RPFC 4KZCA 1JROA 1WGRA 2RDBC 4ZHOA 5J2RA 1H8CA 1T0SC 1BMLC 1VD2A 3DVNV 3K9OB 1YN4A 5AZHA 5G2NA 3NOBA 2L7RA 4RGNA 2CS4A 3AU4A 1JALA 2L8JA 1SE9A 2IBIB 1B9RA 1JWUD 5EE0A 3GOEA 2MP2A 1CMXB 4AP4C 1Z5SB 3AE6B 1WWTA 3EECA 2IGGA 3LYYA 1WE6A 4C4VB 4C56C 1NENB 2Y5BB 4MGKE 1QKZA 3EUB2 3H7PB 1LFDA 1N5XA 4LNOA 1UWXA 4W9DA 2WDQB 1YQ4B 1ZE3D 2J0KA 2WX1A 1AARA 3CSFA 3AU5A 2WP9B 1L0XB 4OVVA 1I4RA 3L10B 1B1ZA 2WXKA 3JVZX 3RFZB 1QQRA 3KVFB 4GB9A 1ROEA 1SSNA 2R61A 3OJ3A 4G3XB 1F2RI 1I4HA 4R3DA 3IXSA 2JZPA 2JWUA 2ZJDA 4HXDA 3KWLA 2ICIA 3B2FA 4FXCA 2KKCA 1FM0D 5FK9C 1TY0A 3ZNID 2JUOA 1HE8A 1IGDA 1GC6A 2KC1A 1VZ8A 2YEPF 1WFYA 2Z8LA 1E8XA 1HQRD 3NZ3A 2BW2A 3Q8CA 4LTUA 4ANUA 2C5LC 1FEHA 2GBRA 3A9JA 3Q69A 4IWQA 4LDTB 2IPKD 5KHQA 3AM9A 1SGHA 3H6NA 4RGOS 4II3B 1TKEA 2WXLA 2MCNB 3R2TA 5GMVA 2IO1B 1IP9A 1RRBA 2LVPA 4IM3A 1FFVA 3VUYA 3WALA 2GLSA 3T9LA 5EE1A 3AV8A 1ZXHA 5HFYA 1F52A 4LLGM 2G1EA 1EM7A 1H4RA 4C00A 2SEBD 1I42A 2JY6A 2NTSA 4GOCA 2PW9A 4AS1A 1NVID 3HIZA 1WYWB 2EMTA 2MX2A 5HHDG 2KNBA 2ZEQA 3V6EB 4A8XC 2IDYA 2NS5A 1UUPA 4TV3A 3HUIA 1E7PB 1GNUA 2ASQA 3A1QB 2Z0EB 3ZW3A 2CHWA 3KUDB 4JPSA 1C78A 2DNFA 2J52A 5BMIA 1R4MB 2K8BA 3A4RA 2DENB 4IM2A 3N9YC 4FULA 1GUAB 4M8NA 1XLNA 3PRPB 3SU8X 1TS5A 1V97A 2ZNVC 1LQBA 2N0SB 1TJEA 1ZKHA 1AW7A 1SJHD 2HTME 3DVNU 2QHOA 4GDKB 1BT0A 4M0WA 1MVKA 5J18A 2KVRA 1CZPA 2NVUI 3IG3A 1IYFA 1OQRA 4WAAA 1KOTA 3OG5A 3ALBA 4II2B 4HKZE 1C4PA 1WMHA 2DZIA 2CR5A 3VTVA 1I7HA 2K1FA 4K81A 3ZTCA 1VR9A 3DBLI 2KTRB 4H2AA 1MHXA 2BYVE 1ZDXA 4P7IA 2M0XA 1I4XA 2G3QB 3ML9A 2BYTA 3ZUNA 3QK0A 5BYQA 3NS1A 1TYGB 4HPMB 4RGMA 2JZZA 1OGWA 2KFKB 5DPTA 1K51A 3CMMB 1ACCA 2JZ3B 4KGRA 4HKQA 3AEEB 1FXAA 1WX7A 2NBWB 4YWGG 2G9HD 1E6EB 1DOXA 2LVOA 1J8CA 2XK5A 4AWJA 3AI5A 4DDID 1FPYA 2LHDA 3RULA 4J6IA 1IBXB 4MH8A 3BZDB 1FNVA 3P4QB 2ZZPB 3CWIA 3C8YA 2LFIA 2LGXA 2RR9A 3U7ZA 4LJPB 3Q2AC 1BUIC 3BINA 1WY8A 3Q8EA 3Q8AA 1L4DB 1YN5A 4F7ZA 1MJDA 2DX5B 4JGHB 5KHOA 4LNFA 1BXTA 3TMPB 3GP7A 2NCNA 4YTPB 2WXNA 3AEBB 2LRWA 2KDBA 1GC7A 1QZEA 2AL3A 2NBUA 5HKHA 2LZ6A 1V2YA 1P9DU 2IO3B 2K25A 4GLSC 4ZRQA 3U2SC 1V49A 3AXCA 2KJRA 2OEDA 2O6VB 2DZMA 3WCQA 1Y56A 3DPDA 2LASA 3UQAA 3TEYA 1WM2A 4OZCA 3VXWA 1RLFA 3LJ3A 2KQSA 4HROA 2FIFA 4BAXA 1QOFA 4K3BA 4WWOA 2L32A 4CHKA 2KYWA 5D94A 2MHJA 1NDDA 1PUTA 4NJ6A 5JHBA 3DDCB 2N9EB 1R4NI 2DBYA 2ZVNA 4BOSC 3DHGC 4DWFA 1YQBA 3A9KB 1V1PA 2RPQA 3N1XC 3APCA 2KZRA 2GBKA 2XNAC 2QC8A 3GZNB 5TSSA 3M95A 3O65B 4BFRA 4DHZB 2MBOA 3KH0A 3X23A 5C23A 4WJPA 4OVUA 4ARIA 2ZCCA 2ZNVB 3JSVB 2VH2A 3P2BA 2M56B 1K50A 5FKAC 4LCDE 2J53A 4NPNA 4M00A 2K22A 2RPVA 4L23A 2LEKA 1QILA 3V6CB 2KFJA
chains in the Genus database with same CATH topology
1L2NA 2DZKA 4KZCA 3TJPA 3V61A 3VUWA 4GDLB 4HCPB 2M1MA 2GMIC 1WGRA 3C0RB 3L54A 4W9IA 1WGHA 2D11A 1WZ3A 2DAJA 3NZSA 5J2RA 1H8CA 4B9KA 4MM3A 3U7DA 1VD2A 3DVNV 3UF8A 2MA9B 3K9OB 5AZHA 2KWCA 5CHVC 5G2NA 2O6VA 4IC7B 4RM8A 3NOBA 3L08A 2AWTA 2D3GA 2L7RA 3PRZA 4TKNA 2N1WA 3OLMD 4N9F4 2KLCA 3W1YA 1RFAA 2CS4A 4PS7A 3AU4A 3W1SC 4IM0A 2EKEC 2L8JA 2OJRA 4DXAB 2KQ7A 2RGFA 4FJYA 4IG7B 1SE9A 2AL6A 2IBIB 4W9JA 4EUTA 1EF5A 2M4NA 3GOEA 2LWPA 1UGMA 2MP2A 1CMXB 2LD9A 1Z5SB 4AP4C 4WQOB 3VUXA 3EECA 1WE6A 1WGYA 1Q0WB 4FHKA 1OEYJ 4EKUA 1WGDA 4MELA 2OOBB 2L0TA 2Y5BB 2V1YA 1J19A 1WJUA 4MGKE 1UBQA 3H7PB 1LFDA 1V86A 3DOWA 2REXA 3JW0X 2YVCA 4W9DA 4WJQA 3UQBA 4K7UA 4FADA 2JPHA 3B08A 2J0KA 2WX1A 1AARA 3KYCD 4PS3A 3CSFA 5AZFA 3EC8A 5CHWA 3AU5A 2WDTB 1FXTB 3A9KA 4ICVA 4TQ0A 2LGDA 2KWUB 1V5TA 4OVVA 3L10B 1S1QB 1Y8RC 4MH0E 3JVZX 2MBBB 4ZRIA 4G11A 4W9LA 3KVFB 4GB9A 4IW0A 3RT3B 3LDZE 2KOXA 1V6EA 4A3PA 3OJ3A 4G3XB 2JRHA 4W9GA 1UZXB 5EDSA 2N7DA 1ZW7A 2AEHA 2DHZA 2ZJDA 5BO4B 1U4AA 4HXDA 2L00B 4GXBA 1NI2A 2KKCA 3RYTA 4KZ0A 4NY0A 2D10A 3ZNID 2JUOA 1HE8A 1JRUA 1E8YA 2CKHB 2V4LA 1GC6A 1T0YA 1E7UA 2KC1A 5JHAA 1KM7A 4ZDVA 4E74A 1P1AA 1WFYA 1E8XA 4ANUA 5C1ZA 2C5LC 1LM8B 2GBRA 2O2VA 2MLBA 3A9JA 1OQYA 2XEWA 2L05A 3JSVA 3QAQA 3A33B 4W9FA 4M0WB 5IA7A 2WX0A 4IWQA 2K39A 1XT9B 3KUZA 4LDTB 4BBNC 5KHQA 1EF1A 2MBHA 3V62A 1SGHA 1ISNA 2MBEA 3H6NA 3R66C 2KDIA 4II3B 4K7WA 4EEWA 4GIVA 3PLUA 3KYDD 1P3QU 2FUHB 1WMHB 2MCNB 1WGGA 4IWOA 1NBFC 4LJOB 5GMVA 2IO1B 1L7YA 1IP9A 3HM3A 2I1JA 1RRBA 4CO7A 3PHXB 3ZNGC 4GDLA 4I6PA 5L83A 4K7SA 2LVPA 4IM3A 1XD3B 4NQLB 2N1VA 3PLVA 2K6QA 5IAAC 1OTRB 5CX3A 3VUYA 2J0MA 2VRRB 3WALA 3T9LA 3JYUA 1XQQA 3PV1A 4FA6A 3Q3FA 1YX6B 3APFA 2DAFA 2I1KA 1M94A 3UGBB 1H4RA 2KTFA 3PTFC 4RMAA 5CHFA 3HK0A 2J7QB 2AYOB 2K8CA 4PYZA 4FBJB 3H1UA 2JT4B 2JY6A 3EHVA 2UYZB 1I42A 5LXHA 2KN5A 1WIAA 4GOCA 2C7NB 2HD5B 2KK8A 3U8ZA 4FLHA 3MHSD 3ZLZA 2K6DB 2KWVB 1GJZA 3HIZA 3AULA 2BYEA 4TUUA 1WYWB 2EMTA 1R4MI 2MX2A 2KNBA 2ZEQA 4EZJA 2IZVB 2KX0A 1MG8A 3H7PA 1E90A 5E6NA 4KSLC 3V6EB 1J0GA 2NS5A 4ANWA 4FJZA 3VFKA 3IHPC 2BWFA 4TV3A 2NPTB 2BKRB 2ZVOA 2DYMA 4NJ7A 3HHMA 2C7MB 3QX1A 5LLIA 2XK5B 2JXXA 3PS6A 3OAWA 3PSEB 1GNUA 2ASQA 4M8MA 4W9HA 1WH3A 3A1QB 4HK2A 2Z0EB 3ZW3A 2CHWA 2L0FA 3KUDB 3ZKJC 3B0AA 4HCNB 3D32A 4K1RB 1V9JA 3S2AA 2BWES 2BKFA 2M8SA 4KDIC 5L95C 2K8BA 3A4RA 2DENB 3N30A 3UIOB 2KHWB 4IM2A 2N9PC 1WJNA 3NHEB 4MSQB 4XZ4A 5E6OA 4DK5A 5FR6A 4EOYA 1YX5B 2G4DB 4W9EA 4FHJA 4FULA 1WX9A 1GUAB 2BF8B 2PPHA 4I6LB 4M8NA 1WR1A 4PYUA 4BBNF 4CYEA 3SU8X 3PRPB 1I35A 1WM3A 3VQIA 4G50A 2LXCA 3TCAA 5LXIB 4HJKA 4JIOU 4HDOA 3M63B 2ZNVC 2FCQA 5G55A 3Q3JA 1LQBA 3SHQA 4ANXA 2KO3A 1WRDB 4FJVB 2LI5A 1ZKHA 1UELA 3DVNU 4KDLB 2QHOA 4GDKB 3RCZA 4A20A 1BT0A 3H7SA 3UIPB 3PHWB 5J18A 4HLEA 2KVRA 1C1YB 2NVUI 3IG3A 1IYFA 2MBQA 4HVBA 4RM9A 2KLGA 4PS8A 2MP2B 5D7GA 1LXDA 4JLCA 1EO6A 3K9PB 4MJSB 1TZ1A 2BGFA 2MQJA 4WAAA 3ALBA 4ZRKA 4MDKE 1KOTA 4II2B 2M17A 2KMAA 1WMHA 3B1LX 3NY5A 2DZIA 2IY0B 3N3KB 5AZGA 3QHTA 3QA8A 1C3TA 2KMCA 1YD8U 2CR5A 4HPLB 3VTVA 2KD0A 3OJ4B 2O6VD 2R2OA 1E8WA 2K1FA 1E8ZA 4K81A 4XC2A 1WR6E 2DZJA 2IYDB 2CHXA 3DBLI 3I3TB 2NBVB 2KTRB 3ONSA 3V60A 3TL5A 3ZTCA 2LRUA 2BYVE 3PREA 2UWQA 1Q1OA 2KDFB 1TGZB 2WWZA 4P7IA 1Z2MA 2JRIB 3ZDMC 4MSMB 4XX5A 2KJ6A 2M0XA 1WXVA 2G3QB 4MGYE 3ML9A 4WWPA 2WYQA 3ENEA 3ZUNA 1ZGUB 3QK0A 3WAOA 3U30A 3R3MA 4GSWA 4HPMB 4EZLA 1UH6A 2PEAA 4KV2A 3DBHI 1UD7A 4NAWB 2JZZA 2D07B 1OGWA 2DYBA 2KFKB 1S3SG 5DPTA 2CU1A 1OEYA 3CMMB 2B3AA 1X1MA 1GG3A 3MJWA 2FAZA 3DBRI 3VH4B 2JZ3B 4HDQA 4AOFA 1E7VA 4IWPA 2A4ZA 1UBIA 4GU2A 3X0WA 4X57B 5DPWA 2R2QA 1IPGA 4F1SA 1WX7A 4MGZE 3ZNZB 2NBWB 4KSKC 4ANVA 2ZPYA 2NPTA 2L76A 3QCAA 3WA0A 4AJWA 2LVOA 2PJHA 5DPRA 1J8CA 3ZVVA 2XK5A 3PPAA 5D6JB 3AI5A 4AWJA 4DDID 1V81A 4W9CA 3RULA 4BVUC 4J6IA 3A1QA 4FN2A 4DHJB 1YIWA 1TBEA 4GN1A 4KIKB 2HE7A 2ZZPB 3QQ8B 2LGXA 2RR9A 4BKSD 2G45B 3WAMA 1RAXA 4LJPB 2IO0B 3BINA 3QJZA 3HM6X 1WY8A 2ZPNA 3IVFA 3L13A 4DDGD 4AJYB 2FCNA 2K8HA 3VDZA 2MWSB 1WF9A 1KJTA 3IFWB 4F7ZA 2JF5A 3PT2B 2DX5B 4JGHB 2LGYA 1D3ZA 2C60A 5KHOA 3WIMA 3CSTA 2KDEB 1WZ0A 2MRPA 3TMPB 1G6JA 3DQVA 3EFUA 4WJNA 4ZRJA 2NCNA 4KVGB 5D2MB 1P0RA 2Z0DB 2NR2A 4GMVA 4JQWC 3PZDA 2LRWA 2KDBA 3L0WB 3WAPA 2A5UA 4DHJD 1GC7A 5JH5C 1QZEA 4JL9A 4GDKA 5CTRC 1PQSA 3TBLD 2D2QA 2AL3A 2NBUA 4AUQC 5HKHA 1WI0A 2LZ6A 2KC2A 2N4FA 3IBEA 1V2YA 4ICUA 3TIXA 1P9DU 2IO3B 2K25A 4BKTA 3M62B 1A5RA 4HWIB 1V49A 4ASWC 3AXCA 4MJSA 2KJRA 4NQKE 2HJ8A 3ZRCA 2RD0A 3ZRFA 2DYOA 2Z59B 3RUIB 2O6VB 4WJOA 2IY1B 2BYFA 2DZMA 3VHTC 2G4SA 4E71A 3DPDA 2LASA 3UQAA 1WM2A 3VVWB 3VXWA 4A3OA 1RLFA 3L16A 3PVLA 3LJ3A 2KQSA 2KTRA 3M3JA 1KLVA 3W1SA 2FIFA 4MEMA 2GBNA 3KW5B 3DBSA 2YLMA 4WWOA 5DCNA 4BOZB 3APDA 3QARA 4GGQA 2C9WB 1WXMA 2FCSA 2LUEA 3BY4B 3QC8B 3ZTDA 3ECIA 3GZNI 4W9KA 1SIFA 3SDLC 3VTUA 3DVGX 4CHKA 4MGIE 5D94A 3ML8A 1NDDA 3T8MA 4NJ6A 3ZDTA 3PRMB 2MSED 5JHBA 4NNJB 2FCMA 2N7EA 4NAWA 1VCBA 3DDCB 2EMSA 2N9EB 4E3CA 5JZEB 1R4NI 2KFKA 2ZVNA 3SD5A 4EZKA 3VTWA 4BOSC 4DWFA 2LVQA 2CHZA 2PE9A 1E5WA 1YQBA 2BPSA 3A9KB 3QIJA 4EFOA 3KUCB 4BKSA 3VH3B 4URKA 3L17A 3QWZB 3NS8A 1YJ1A 3RD2A 2RPQA 3R7QA 2N9XA 2KX3A 3A4SC 2PE6B 5AEKB 2ZCBA 3APCA 2KZRA 4YL8A 1K8RB 2V3SA 2GBKA 2HTHA 4G0NB 3NZUA 1WJ6A 5TR5A 5J17A 4B6WA 2JWZA 2MW5A 1Q5WB 2XBBC 1WE7A 3M95A 2JVCA 3O65B 4BFRA 2MBOA 4DHZB 1TTNA 3DVGY 3KH0A 2LJ5A 4WWNA 4BKGA 4F8CB 1WX8A 3X23A 1V5OA 5C23A 1P98A 2FNJB 4WJPA 4ZYNA 3WANA 4OVUA 4KIKA 4B95A 2C7HA 2ZCCA 4IUMB 3RZFA 1WXAA 2IO2B 5E6PA 1WXSA 3R7RA 1EUVB 3PGEA 4I6NB 3ZNHB 3CF6E 4DBGA 2O2VB 2KANA 2ZNVB 3A9JB 4TQ1A 1F9JA 2FIDA 2GBJA 3JSVB 3RZWC 3P2BA 3UINB 2KXJA 2RSUA 2GOWA 5DPSA 2KJHB 2L3ZA 2LXAA 4LCDE 2GBMA 4DHZE 4NPNA 1V80A 3ZO5B 2W9NA 3MTNB 3ZIMA 1WJ4A 3N32A 3VAWA 3DCGA 4LDTD 3H9DA 3V6CB 2KFJA 2J0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2N A;  2DZK A;  4KZC A;  3TJP A;  3V61 A;  3VUW A;  4GDL B;  4HCP B;  2M1M A;  2GMI C;  1WGR A;  3C0R B;  3L54 A;  4W9I A;  1WGH A;  2D11 A;  1WZ3 A;  2DAJ A;  3NZS A;  5J2R A;  1H8C A;  4B9K A;  4MM3 A;  3U7D A;  1VD2 A;  3DVN V;  3UF8 A;  2MA9 B;  3K9O B;  5AZH A;  2KWC A;  5CHV C;  5G2N A;  2O6V A;  4IC7 B;  4RM8 A;  3NOB A;  3L08 A;  2AWT A;  2D3G A;  2L7R A;  3PRZ A;  4TKN A;  2N1W A;  3OLM D;  4N9F 4;  2KLC A;  3W1Y A;  1RFA A;  2CS4 A;  4PS7 A;  3AU4 A;  3W1S C;  4IM0 A;  2EKE C;  2L8J A;  2OJR A;  4DXA B;  2KQ7 A;  2RGF A;  4FJY A;  4IG7 B;  1SE9 A;  2AL6 A;  2IBI B;  4W9J A;  4EUT A;  1EF5 A;  2M4N A;  3GOE A;  2LWP A;  1UGM A;  2MP2 A;  1CMX B;  2LD9 A;  1Z5S B;  4AP4 C;  4WQO B;  3VUX A;  3EEC A;  1WE6 A;  1WGY A;  1Q0W B;  4FHK A;  1OEY J;  4EKU A;  1WGD A;  4MEL A;  2OOB B;  2L0T A;  2Y5B B;  2V1Y A;  1J19 A;  1WJU A;  4MGK E;  1UBQ A;  3H7P B;  1LFD A;  1V86 A;  3DOW A;  2REX A;  3JW0 X;  2YVC A;  4W9D A;  4WJQ A;  3UQB A;  4K7U A;  4FAD A;  2JPH A;  3B08 A;  2J0K A;  2WX1 A;  1AAR A;  3KYC D;  4PS3 A;  3CSF A;  5AZF A;  3EC8 A;  5CHW A;  3AU5 A;  2WDT B;  1FXT B;  3A9K A;  4ICV A;  4TQ0 A;  2LGD A;  2KWU B;  1V5T A;  4OVV A;  3L10 B;  1S1Q B;  1Y8R C;  4MH0 E;  3JVZ X;  2MBB B;  4ZRI A;  4G11 A;  4W9L A;  3KVF B;  4GB9 A;  4IW0 A;  3RT3 B;  3LDZ E;  2KOX A;  1V6E A;  4A3P A;  3OJ3 A;  4G3X B;  2JRH A;  4W9G A;  1UZX B;  5EDS A;  2N7D A;  1ZW7 A;  2AEH A;  2DHZ A;  2ZJD A;  5BO4 B;  1U4A A;  4HXD A;  2L00 B;  4GXB A;  1NI2 A;  2KKC A;  3RYT A;  4KZ0 A;  4NY0 A;  2D10 A;  3ZNI D;  2JUO A;  1HE8 A;  1JRU A;  1E8Y A;  2CKH B;  2V4L A;  1GC6 A;  1T0Y A;  1E7U A;  2KC1 A;  5JHA A;  1KM7 A;  4ZDV A;  4E74 A;  1P1A A;  1WFY A;  1E8X A;  4ANU A;  5C1Z A;  2C5L C;  1LM8 B;  2GBR A;  2O2V A;  2MLB A;  3A9J A;  1OQY A;  2XEW A;  2L05 A;  3JSV A;  3QAQ A;  3A33 B;  4W9F A;  4M0W B;  5IA7 A;  2WX0 A;  4IWQ A;  2K39 A;  1XT9 B;  3KUZ A;  4LDT B;  4BBN C;  5KHQ A;  1EF1 A;  2MBH A;  3V62 A;  1SGH A;  1ISN A;  2MBE A;  3H6N A;  3R66 C;  2KDI A;  4II3 B;  4K7W A;  4EEW A;  4GIV A;  3PLU A;  3KYD D;  1P3Q U;  2FUH B;  1WMH B;  2MCN B;  1WGG A;  4IWO A;  1NBF C;  4LJO B;  5GMV A;  2IO1 B;  1L7Y A;  1IP9 A;  3HM3 A;  2I1J A;  1RRB A;  4CO7 A;  3PHX B;  3ZNG C;  4GDL A;  4I6P A;  5L83 A;  4K7S A;  2LVP A;  4IM3 A;  1XD3 B;  4NQL B;  2N1V A;  3PLV A;  2K6Q A;  5IAA C;  1OTR B;  5CX3 A;  3VUY A;  2J0M A;  2VRR B;  3WAL A;  3T9L A;  3JYU A;  1XQQ A;  3PV1 A;  4FA6 A;  3Q3F A;  1YX6 B;  3APF A;  2DAF A;  2I1K A;  1M94 A;  3UGB B;  1H4R A;  2KTF A;  3PTF C;  4RMA A;  5CHF A;  3HK0 A;  2J7Q B;  2AYO B;  2K8C A;  4PYZ A;  4FBJ B;  3H1U A;  2JT4 B;  2JY6 A;  3EHV A;  2UYZ B;  1I42 A;  5LXH A;  2KN5 A;  1WIA A;  4GOC A;  2C7N B;  2HD5 B;  2KK8 A;  3U8Z A;  4FLH A;  3MHS D;  3ZLZ A;  2K6D B;  2KWV B;  1GJZ A;  3HIZ A;  3AUL A;  2BYE A;  4TUU A;  1WYW B;  2EMT A;  1R4M I;  2MX2 A;  2KNB A;  2ZEQ A;  4EZJ A;  2IZV B;  2KX0 A;  1MG8 A;  3H7P A;  1E90 A;  5E6N A;  4KSL C;  3V6E B;  1J0G A;  2NS5 A;  4ANW A;  4FJZ A;  3VFK A;  3IHP C;  2BWF A;  4TV3 A;  2NPT B;  2BKR B;  2ZVO A;  2DYM A;  4NJ7 A;  3HHM A;  2C7M B;  3QX1 A;  5LLI A;  2XK5 B;  2JXX A;  3PS6 A;  3OAW A;  3PSE B;  1GNU A;  2ASQ A;  4M8M A;  4W9H A;  1WH3 A;  3A1Q B;  4HK2 A;  2Z0E B;  3ZW3 A;  2CHW A;  2L0F A;  3KUD B;  3ZKJ C;  3B0A A;  4HCN B;  3D32 A;  4K1R B;  1V9J A;  3S2A A;  2BWE S;  2BKF A;  2M8S A;  4KDI C;  5L95 C;  2K8B A;  3A4R A;  2DEN B;  3N30 A;  3UIO B;  2KHW B;  4IM2 A;  2N9P C;  1WJN A;  3NHE B;  4MSQ B;  4XZ4 A;  5E6O A;  4DK5 A;  5FR6 A;  4EOY A;  1YX5 B;  2G4D B;  4W9E A;  4FHJ A;  4FUL A;  1WX9 A;  1GUA B;  2BF8 B;  2PPH A;  4I6L B;  4M8N A;  1WR1 A;  4PYU A;  4BBN F;  4CYE A;  3SU8 X;  3PRP B;  1I35 A;  1WM3 A;  3VQI A;  4G50 A;  2LXC A;  3TCA A;  5LXI B;  4HJK A;  4JIO U;  4HDO A;  3M63 B;  2ZNV C;  2FCQ A;  5G55 A;  3Q3J A;  1LQB A;  3SHQ A;  4ANX A;  2KO3 A;  1WRD B;  4FJV B;  2LI5 A;  1ZKH A;  1UEL A;  3DVN U;  4KDL B;  2QHO A;  4GDK B;  3RCZ A;  4A20 A;  1BT0 A;  3H7S A;  3UIP B;  3PHW B;  5J18 A;  4HLE A;  2KVR A;  1C1Y B;  2NVU I;  3IG3 A;  1IYF A;  2MBQ A;  4HVB A;  4RM9 A;  2KLG A;  4PS8 A;  2MP2 B;  5D7G A;  1LXD A;  4JLC A;  1EO6 A;  3K9P B;  4MJS B;  1TZ1 A;  2BGF A;  2MQJ A;  4WAA A;  3ALB A;  4ZRK A;  4MDK E;  1KOT A;  4II2 B;  2M17 A;  2KMA A;  1WMH A;  3B1L X;  3NY5 A;  2DZI A;  2IY0 B;  3N3K B;  5AZG A;  3QHT A;  3QA8 A;  1C3T A;  2KMC A;  1YD8 U;  2CR5 A;  4HPL B;  3VTV A;  2KD0 A;  3OJ4 B;  2O6V D;  2R2O A;  1E8W A;  2K1F A;  1E8Z A;  4K81 A;  4XC2 A;  1WR6 E;  2DZJ A;  2IYD B;  2CHX A;  3DBL I;  3I3T B;  2NBV B;  2KTR B;  3ONS A;  3V60 A;  3TL5 A;  3ZTC A;  2LRU A;  2BYV E;  3PRE A;  2UWQ A;  1Q1O A;  2KDF B;  1TGZ B;  2WWZ A;  4P7I A;  1Z2M A;  2JRI B;  3ZDM C;  4MSM B;  4XX5 A;  2KJ6 A;  2M0X A;  1WXV A;  2G3Q B;  4MGY E;  3ML9 A;  4WWP A;  2WYQ A;  3ENE A;  3ZUN A;  1ZGU B;  3QK0 A;  3WAO A;  3U30 A;  3R3M A;  4GSW A;  4HPM B;  4EZL A;  1UH6 A;  2PEA A;  4KV2 A;  3DBH I;  1UD7 A;  4NAW B;  2JZZ A;  2D07 B;  1OGW A;  2DYB A;  2KFK B;  1S3S G;  5DPT A;  2CU1 A;  1OEY A;  3CMM B;  2B3A A;  1X1M A;  1GG3 A;  3MJW A;  2FAZ A;  3DBR I;  3VH4 B;  2JZ3 B;  4HDQ A;  4AOF A;  1E7V A;  4IWP A;  2A4Z A;  1UBI A;  4GU2 A;  3X0W A;  4X57 B;  5DPW A;  2R2Q A;  1IPG A;  4F1S A;  1WX7 A;  4MGZ E;  3ZNZ B;  2NBW B;  4KSK C;  4ANV A;  2ZPY A;  2NPT A;  2L76 A;  3QCA A;  3WA0 A;  4AJW A;  2LVO A;  2PJH A;  5DPR A;  1J8C A;  3ZVV A;  2XK5 A;  3PPA A;  5D6J B;  3AI5 A;  4AWJ A;  4DDI D;  1V81 A;  4W9C A;  3RUL A;  4BVU C;  4J6I A;  3A1Q A;  4FN2 A;  4DHJ B;  1YIW A;  1TBE A;  4GN1 A;  4KIK B;  2HE7 A;  2ZZP B;  3QQ8 B;  2LGX A;  2RR9 A;  4BKS D;  2G45 B;  3WAM A;  1RAX A;  4LJP B;  2IO0 B;  3BIN A;  3QJZ A;  3HM6 X;  1WY8 A;  2ZPN A;  3IVF A;  3L13 A;  4DDG D;  4AJY B;  2FCN A;  2K8H A;  3VDZ A;  2MWS B;  1WF9 A;  1KJT A;  3IFW B;  4F7Z A;  2JF5 A;  3PT2 B;  2DX5 B;  4JGH B;  2LGY A;  1D3Z A;  2C60 A;  5KHO A;  3WIM A;  3CST A;  2KDE B;  1WZ0 A;  2MRP A;  3TMP B;  1G6J A;  3DQV A;  3EFU A;  4WJN A;  4ZRJ A;  2NCN A;  4KVG B;  5D2M B;  1P0R A;  2Z0D B;  2NR2 A;  4GMV A;  4JQW C;  3PZD A;  2LRW A;  2KDB A;  3L0W B;  3WAP A;  2A5U A;  4DHJ D;  1GC7 A;  5JH5 C;  1QZE A;  4JL9 A;  4GDK A;  5CTR C;  1PQS A;  3TBL D;  2D2Q A;  2AL3 A;  2NBU A;  4AUQ C;  5HKH A;  1WI0 A;  2LZ6 A;  2KC2 A;  2N4F A;  3IBE A;  1V2Y A;  4ICU A;  3TIX A;  1P9D U;  2IO3 B;  2K25 A;  4BKT A;  3M62 B;  1A5R A;  4HWI B;  1V49 A;  4ASW C;  3AXC A;  4MJS A;  2KJR A;  4NQK E;  2HJ8 A;  3ZRC A;  2RD0 A;  3ZRF A;  2DYO A;  2Z59 B;  3RUI B;  2O6V B;  4WJO A;  2IY1 B;  2BYF A;  2DZM A;  3VHT C;  2G4S A;  4E71 A;  3DPD A;  2LAS A;  3UQA A;  1WM2 A;  3VVW B;  3VXW A;  4A3O A;  1RLF A;  3L16 A;  3PVL A;  3LJ3 A;  2KQS A;  2KTR A;  3M3J A;  1KLV A;  3W1S A;  2FIF A;  4MEM A;  2GBN A;  3KW5 B;  3DBS A;  2YLM A;  4WWO A;  5DCN A;  4BOZ B;  3APD A;  3QAR A;  4GGQ A;  2C9W B;  1WXM A;  2FCS A;  2LUE A;  3BY4 B;  3QC8 B;  3ZTD A;  3ECI A;  3GZN I;  4W9K A;  1SIF A;  3SDL C;  3VTU A;  3DVG X;  4CHK A;  4MGI E;  5D94 A;  3ML8 A;  1NDD A;  3T8M A;  4NJ6 A;  3ZDT A;  3PRM B;  2MSE D;  5JHB A;  4NNJ B;  2FCM A;  2N7E A;  4NAW A;  1VCB A;  3DDC B;  2EMS A;  2N9E B;  4E3C A;  5JZE B;  1R4N I;  2KFK A;  2ZVN A;  3SD5 A;  4EZK A;  3VTW A;  4BOS C;  4DWF A;  2LVQ A;  2CHZ A;  2PE9 A;  1E5W A;  1YQB A;  2BPS A;  3A9K B;  3QIJ A;  4EFO A;  3KUC B;  4BKS A;  3VH3 B;  4URK A;  3L17 A;  3QWZ B;  3NS8 A;  1YJ1 A;  3RD2 A;  2RPQ A;  3R7Q A;  2N9X A;  2KX3 A;  3A4S C;  2PE6 B;  5AEK B;  2ZCB A;  3APC A;  2KZR A;  4YL8 A;  1K8R B;  2V3S A;  2GBK A;  2HTH A;  4G0N B;  3NZU A;  1WJ6 A;  5TR5 A;  5J17 A;  4B6W A;  2JWZ A;  2MW5 A;  1Q5W B;  2XBB C;  1WE7 A;  3M95 A;  2JVC A;  3O65 B;  4BFR A;  2MBO A;  4DHZ B;  1TTN A;  3DVG Y;  3KH0 A;  2LJ5 A;  4WWN A;  4BKG A;  4F8C B;  1WX8 A;  3X23 A;  1V5O A;  5C23 A;  1P98 A;  2FNJ B;  4WJP A;  4ZYN A;  3WAN A;  4OVU A;  4KIK A;  4B95 A;  2C7H A;  2ZCC A;  4IUM B;  3RZF A;  1WXA A;  2IO2 B;  5E6P A;  1WXS A;  3R7R A;  1EUV B;  3PGE A;  4I6N B;  3ZNH B;  3CF6 E;  4DBG A;  2O2V B;  2KAN A;  2ZNV B;  3A9J B;  4TQ1 A;  1F9J A;  2FID A;  2GBJ A;  3JSV B;  3RZW C;  3P2B A;  3UIN B;  2KXJ A;  2RSU A;  2GOW A;  5DPS A;  2KJH B;  2L3Z A;  2LXA A;  4LCD E;  2GBM A;  4DHZ E;  4NPN A;  1V80 A;  3ZO5 B;  2W9N A;  3MTN B;  3ZIM A;  1WJ4 A;  3N32 A;  3VAW A;  3DCG A;  4LDT D;  3H9D A;  3V6C B;  2KFJ A;  2J0J A; 
#chains in the Genus database with same CATH topology
 1L2N A;  3VUW A;  2M1M A;  2GMI C;  4W9I A;  1WGH A;  2DAJ A;  1NI3 A;  3NZS A;  1SF0 A;  4MM3 A;  2INP E;  3AB5 A;  2BBC A;  3UF8 A;  3FKY A;  3N1Z C;  3Q6B A;  2KWC A;  4IC7 B;  2WXJ A;  2AWT A;  4A6Q A;  4N9F 4;  1RFA A;  3W1S C;  2INN E;  4IM0 A;  2OJR A;  2OHF A;  4DXA B;  2AL6 A;  3I57 A;  3FIL A;  1FCC C;  5BMG A;  2LWP A;  2LD9 A;  1YQ3 B;  2K3U A;  1GB1 A;  1YJI A;  4KX6 B;  1OEY J;  4MEL A;  4A55 A;  2OOB B;  1WJU A;  1UBQ A;  1E10 A;  1TS2 A;  2WXG A;  3RNF C;  1UNS A;  3KYC D;  3NJT A;  5AZF A;  3EC8 A;  1J7B A;  2KQ4 X;  2Y3A A;  5CHW A;  2WDT B;  2WLB A;  3AE9 B;  1ESF A;  5HI1 A;  4OW0 A;  4IW0 A;  1V6E A;  1DOI A;  4N58 A;  3GE3 C;  1ZW7 A;  2DHZ A;  2LMC A;  3GB1 A;  3HVD A;  1NI2 A;  3HVZ A;  2V3P A;  3RYT A;  2D10 A;  3ABV B;  3NRZ A;  4RF1 A;  1FD6 A;  2WXF A;  2RDG A;  1E7U A;  1KM7 A;  2JXT A;  4XWT A;  1P1A A;  2L83 A;  5C1Z A;  1LM8 B;  2MLB A;  2L05 A;  2E6X A;  3A33 B;  2J42 A;  1KF6 B;  2WX0 A;  4Q2J A;  4EEW A;  1N60 A;  3URY A;  1P3Q U;  2FUH B;  1JQ4 A;  4JWS C;  5IO9 A;  2WDR B;  3EA6 A;  1A70 A;  3AEG B;  4CO7 A;  3Q8F A;  4K7S A;  4NQL B;  3AE7 B;  1QLB B;  1ENF A;  2K6Q A;  2Y5C A;  4RFB A;  3ZXV A;  2J0M A;  2WXI A;  2BB6 A;  1ET6 A;  2VRR B;  3MC0 B;  4JX1 C;  4FA6 A;  1T6B X;  3UGB B;  1JWB D;  3PTF C;  3DHI C;  4RMA A;  3IAM 1;  2J7Q B;  5CHF A;  5GXG B;  5C2T B;  2JT4 B;  3EHV A;  2PVO D;  3BVG A;  1WIA A;  2C7N B;  4PT5 A;  2KK8 A;  3U8Z A;  5E6J A;  3MHZ A;  3MHS D;  4ITK A;  1KFY B;  4XYC A;  3ZLZ A;  2BYE A;  4C4V A;  4EZJ A;  2IZV B;  1FNW A;  3MJ5 A;  1OFF A;  3H7P A;  1E90 A;  3AMZ A;  5E6N A;  1J0G A;  1HTO A;  4FJZ A;  2W55 A;  1SXT A;  2NPT B;  2BKR B;  3BYT B;  5HG2 A;  1E0Z A;  3HHM A;  2K9X A;  3QX1 A;  4YSY B;  2JXX A;  2MH7 A;  3PS6 A;  3I63 C;  4W9H A;  1UGJ A;  1SBB B;  1L5P A;  3B0A A;  3U4E G;  4HCN B;  3D32 A;  2BB5 A;  3S2A A;  2W82 A;  3SR6 A;  1C76 A;  5L95 C;  2BS4 B;  4M02 A;  1XXG A;  2KHW B;  1P7F A;  2N9P C;  1WJN A;  5E6O A;  1T0R C;  2EKI A;  3NUH B;  4TMA B;  2G4D B;  4P1C C;  4W9E A;  2BF8 B;  2PPH A;  1WR1 A;  4PYU A;  4BBN F;  1I35 A;  1WM3 A;  4G50 A;  4HJK A;  4JIO U;  2FCQ A;  4N59 A;  2KO3 A;  2KT7 A;  1SE2 A;  1C9F A;  1HA5 A;  2GRI A;  3H7S A;  1DGJ A;  1ZOY B;  1T5X D;  5IP4 D;  1VJK A;  3UI3 A;  1KTK A;  2MP2 B;  5D7G A;  4MJS B;  4ZRK A;  3K9P B;  1TZ1 A;  4WH4 A;  2MQJ A;  2KMA A;  2MJE A;  2IY0 B;  2CJN A;  3QHT A;  3QA8 A;  1YOV B;  1HXY D;  1RYJ A;  1YD8 U;  4HPL B;  4DQO C;  3I5J C;  4CQN A;  1E8Z A;  2DZJ A;  2CHX A;  3TL5 A;  1MI0 A;  2LRU A;  3PRE A;  2L1A A;  5AUK A;  1F0Z A;  2KDF B;  3T3O A;  4WWP A;  4O1N A;  1ZGU B;  3EFC A;  5BYR A;  4EZL A;  1UH6 A;  2PEA A;  3DBH I;  2DYB A;  1S3S G;  1X1M A;  1GG3 A;  5BYS A;  3DBR I;  4AOF A;  4HDQ A;  2A4Z A;  1UBI A;  2WHI A;  3X0W A;  4X57 B;  2SAK A;  4MGZ E;  3P4S B;  3ZNZ B;  4ANV A;  3AN1 A;  2QIL A;  4AJW A;  4N6E B;  2WU5 B;  3A1Q A;  4FN2 A;  1YIW A;  4GN1 A;  4RF0 A;  4ACF A;  2N9L A;  1TZO A;  4BKS D;  1I4Q A;  3Q3N C;  3WAM A;  4C7Y A;  1RAX A;  3QJZ A;  1ET9 A;  2IGD A;  3IVF A;  4DDG D;  1T3Q A;  1VDV A;  4AJY B;  2FCN A;  2KAC A;  4A9A A;  1KJT A;  2BQQ A;  1GOZ A;  2JF5 A;  1I4P A;  3DHH C;  2KDE B;  3TEW A;  2LGS A;  1F1H A;  1G6J A;  3H8H A;  1HTQ A;  1P0R A;  2MEK A;  2Z0D B;  2NR2 A;  3WAP A;  2A5U A;  3V3X A;  4GDK A;  5CTR C;  1QF6 A;  3TBL D;  3TIX A;  2N7J A;  4C80 A;  1F2R C;  1C77 A;  4HWI B;  1A5R A;  2RD0 A;  1AWD A;  3RUI B;  2M19 A;  2IY1 B;  1AN8 A;  1NEK B;  4ZHP A;  2G4S A;  2JYE A;  3P1M A;  1J7A A;  4USA A;  2WQY B;  3L16 A;  3PVL A;  2KTR A;  3E9S A;  4IOI E;  2VZK B;  2IGH A;  1NYR A;  1QOA A;  2YLM A;  4TSS A;  5DCN A;  3QAR A;  3ZJV A;  3ZTD A;  1TS4 A;  3AE8 B;  1SIF A;  3VTU A;  4MGI E;  1CJE A;  3T8M A;  4HEA 1;  3ZDT A;  4BZA A;  2MSE D;  4NNJ B;  1SEB D;  5JZE B;  2KFK A;  4NZL B;  2H89 B;  3R8B A;  3VTW A;  2QIE B;  4EZK A;  2CHZ A;  1TS3 A;  2PE9 A;  1E5W A;  3KUC B;  3VH3 B;  3L17 A;  3VR9 B;  2VZK D;  1L0Y B;  3NS8 A;  2MJD A;  1AYF A;  4OHJ A;  3BK2 A;  3HRD D;  3DWG C;  2ZCB A;  5IN7 A;  2OJW A;  2RDH A;  2QEJ C;  5TR5 A;  1EU4 A;  2MW5 A;  4HJG E;  2JVC A;  1FNU A;  4F8C B;  1WX8 A;  4S17 A;  4OZB A;  4IUM B;  1WXA A;  1WXS A;  1FFU A;  2L52 A;  4I6N B;  3ZNH B;  2O2V B;  1F9J A;  2GBJ A;  3RZW C;  2RSU A;  1FRR A;  2L3Z A;  4WIP A;  3Q3M C;  2W9N A;  3DCG A;  1XLP A;  1SB3 C;  4G11 A;  3TJP A;  4GDL B;  4HCP B;  3BVZ A;  1K53 A;  3L54 A;  2D11 A;  4M01 A;  4RGT A;  4B9K A;  2VH1 A;  2ON8 A;  3U7D A;  2MA9 B;  3T3N A;  5CHV C;  2O6V A;  4RM8 A;  5T8I A;  3RI7 C;  3AED B;  3L08 A;  3PRZ A;  2D3G A;  4TKN A;  4YSZ B;  1D5Z C;  2N1W A;  3OLM D;  2KLC A;  3W1Y A;  4PS7 A;  4LNN A;  3ZQ4 A;  1D4B A;  2N9K A;  2X38 A;  4IG7 B;  4EUT A;  5I4D A;  1EF5 A;  4KGS A;  1L4Z B;  2M4N A;  3U52 E;  2LUM A;  1D5X C;  4WQO B;  3VUX A;  1C79 A;  1TKG A;  4EKU A;  3KWV A;  2L0T A;  2V1Y A;  1J19 A;  3N1Y C;  4K7U A;  4FAD A;  2JPH A;  4YXD B;  3AH7 A;  3B08 A;  3TSS A;  4PS3 A;  1FXT B;  3A9K A;  4DXF A;  2KWU B;  4IDI A;  1V5T A;  1C4A A;  1Y8R C;  4MH0 E;  1VZ6 A;  2KDM A;  3NVZ A;  4XE0 A;  3PO0 A;  4US9 A;  3RT3 B;  3LDZ E;  5MPO A;  4A3P A;  5EDS A;  1UZX B;  1L0V B;  3AEF B;  3CIR B;  1RM6 C;  2EEL A;  2HDE A;  4KZ0 A;  4NY0 A;  1WGK A;  4RNA A;  3RNB C;  5H8Y E;  3P4R B;  1JRU A;  1E8Y A;  2CKH B;  2KVZ A;  2V4L A;  1WSP A;  4LNK A;  4ZDV A;  1EWY C;  4P6V F;  3JSV A;  3QAQ A;  5IA7 A;  3ETR A;  1XT9 B;  3KUZ A;  5G5H A;  2MBH A;  1ISN A;  3I9V 1;  3ZJT A;  2KDI A;  3KQ4 A;  3PLU A;  3KYD D;  2QCZ A;  1RFK A;  1WGG A;  1WYG A;  4IWO A;  4LJO B;  1L7Y A;  4C7Z A;  2LJI A;  2I1J A;  3PHX B;  5L83 A;  1XD3 B;  5IAA C;  1OTR B;  3IAS 1;  3EGR A;  3NG0 A;  2DAF A;  2KTF A;  3HK0 A;  1YN3 A;  2AYO B;  2K8C A;  4FBJ B;  1KLU D;  3SFD B;  1STE A;  1UF0 A;  4FLH A;  2KWV B;  1GJZ A;  4TUU A;  1R4M I;  4REZ A;  3MFG A;  2W3R A;  1C4C A;  5EE9 A;  1LO5 D;  4ANW A;  3IHP C;  2C7M B;  1N63 A;  5LLI A;  2K5P A;  5IKC M;  3PSE B;  4M8M A;  1WH3 A;  4HK2 A;  2L0F A;  3MC9 A;  1NYQ A;  2AQ2 B;  3E56 A;  5IOI A;  4ARC A;  2BWE S;  4WWM A;  3AEC B;  1JCK B;  3UIO B;  4MSQ B;  5FR6 A;  4EOY A;  1YX5 B;  4OVZ A;  4I6L B;  1WX9 A;  2JSV X;  1PGA A;  3VQI A;  3PZ7 A;  5LXI B;  3Q3J A;  2GI9 A;  1CK1 A;  2Q5W D;  2YEP B;  4FJV B;  1UEL A;  3UIP B;  3PHW B;  3SFE B;  1C1Y B;  3BK1 A;  1UWM A;  2WXM A;  4NAM A;  1LXD A;  3RNE C;  1EO6 A;  2BGF A;  2FE8 A;  3B1L X;  2ONQ A;  1D6E C;  1C3T A;  5G5G A;  2KD0 A;  3W9C B;  2R2O A;  1E8W A;  4XC2 A;  1WR6 E;  1PFD A;  2NBV B;  2CU3 A;  2WXO A;  2UWQ A;  1Q1O A;  2TSS A;  2JRI B;  4RH6 A;  4MSM B;  4YSX B;  2KJ6 A;  1WXV A;  4MGY E;  4XDC A;  1JRP A;  3U30 A;  3R3M A;  4NAW B;  2D07 B;  2CU1 A;  4WAF A;  3MJW A;  2FAZ A;  5C3J B;  3Q8B A;  2WXH A;  3VH4 B;  2B76 B;  4IWP A;  3TUO A;  2PTL A;  2JU6 X;  3DBL B;  5DPW A;  2R2Q A;  1GAQ B;  1SIJ A;  3W5V B;  4KKI A;  2NPT A;  3WA0 A;  2PJH A;  5DPR A;  3ZVV A;  2WS3 B;  5D6J B;  4A90 A;  1V81 A;  2IND C;  5FR3 A;  4BVU C;  1IUE A;  4KIK B;  5EE3 A;  3ZYY X;  2PKO A;  1DOY A;  1PGB A;  2ZPN A;  2FBW B;  4KGT A;  3AE2 B;  3VDZ A;  2MWS B;  1JW9 D;  3IFW B;  3PT2 B;  2K0P A;  1FRD A;  2C60 A;  1WZ0 A;  2PVG C;  4WJN A;  3LB8 C;  2V4I B;  2AQ3 B;  1HZ6 A;  4GMV A;  1XO3 A;  3L0W B;  1JML A;  4JL9 A;  1EU3 A;  3P63 A;  3LXF A;  2D2Q A;  4P16 A;  4AUQ C;  1L6U A;  2RMM A;  2KC2 A;  4BKT A;  3M62 B;  3W2D A;  4ASW C;  4MJS A;  3ZRC A;  3ZRF A;  2AX5 A;  1YJJ A;  2E3T A;  1N61 A;  2BT6 A;  3VVW B;  4A3O A;  1VLB A;  1KLV A;  3W1S A;  4MEM A;  2GBN A;  3MP9 A;  5AUI A;  1WRI A;  4BOZ B;  3APD A;  4GGQ A;  2C9W B;  5JXV A;  2LUE A;  3QC8 B;  2JYT A;  2UU7 A;  3GZN I;  3SDL C;  3DVG X;  3ML8 A;  3V05 A;  1P7E A;  2PIA A;  2WXP A;  3J9C A;  3ZJU A;  2N7E A;  1VCB A;  2EMS A;  3BII D;  2PMV A;  2LVQ A;  2WXR A;  3P4P B;  1TKY A;  3QIJ A;  4BKS A;  3QWZ B;  3SEB A;  1ZXI A;  4MAC A;  1IGC A;  2N9X A;  2PE6 B;  1N62 A;  2QSD A;  2D3C A;  1WJ6 A;  2JWZ A;  3AEA B;  1Q5W B;  2XBB C;  3DVG Y;  1KRH A;  4WWN A;  1V5O A;  1P98 A;  1R4N B;  2ACZ B;  3TEX A;  2C7H A;  4K3C A;  3RZF A;  1TIF A;  3RNA C;  1MFW A;  2M0A A;  3B9J A;  3R7R A;  2KN4 A;  3PGE A;  3CF6 E;  1YMH E;  1XCQ L;  3A9J B;  4TQ1 A;  1FCL A;  3UIN B;  4EE2 A;  2GOW A;  1TY2 A;  5BMH A;  4P1B C;  4DHZ E;  2MJ3 A;  3ZO5 B;  1Q10 A;  3ZIM A;  1WXQ A;  3VAW A;  4LDT D;  3H9D A;  3KLS X;  2J0J A;  3FC4 A;  4NJC A;  2DZK A;  3V61 A;  3FAH A;  3C0R B;  1WZ3 A;  1LGR A;  2CJO A;  2DLB A;  2FUG 1;  5D3D A;  1GPX A;  4US8 A;  2EKE C;  2KQ7 A;  2RGF A;  4FJY A;  4W9J A;  3R2I A;  3L4P A;  4ZYS A;  1UGM A;  2V0G A;  4ZRP A;  1WGY A;  1Q0W B;  2LHE A;  4FHK A;  2ZW1 A;  1WGD A;  2BVC A;  3Q3O C;  3BVM A;  1V86 A;  3DOW A;  2REX A;  3JW0 X;  2YVC A;  4WJQ A;  1J7C A;  5H92 C;  3UQB A;  1TT5 B;  3VRA B;  1RWS A;  4TQ0 A;  4ICV A;  2LGD A;  2NMQ A;  4OZA A;  1S1Q B;  4MT5 A;  1I4G A;  2W3S A;  2WDV B;  2MBB B;  4ZRI A;  1EWC A;  4W9L A;  1JWS D;  2KOX A;  2JRH A;  4W9G A;  2N7D A;  3DWM A;  2AEH A;  5BO4 B;  1U4A A;  3GE8 C;  2L00 B;  4GXB A;  4B0M A;  1E9M A;  5D3I B;  1CQV A;  4B0E A;  1MPE A;  2KWD A;  1XEE A;  1T0Y A;  5JHA A;  4E74 A;  3AE3 B;  3ZGZ A;  4JWU C;  1FMA D;  1SE4 A;  5LNK 1;  2O2V A;  1OQY A;  2KAJ A;  2XEW A;  4RCO A;  1ZPS A;  4ZOH C;  4W9F A;  4M0W B;  3NVV A;  2XN9 C;  2K39 A;  4BBN C;  1EF1 A;  3V62 A;  4XDD A;  3ZXR A;  2MBE A;  3R66 C;  1IBX A;  4K7W A;  4GIV A;  4LNI A;  1WMH B;  2WXQ A;  1NBF C;  4YTN B;  3HM3 A;  4YT0 B;  3ZNG C;  1V8C A;  4GDL A;  4I6P A;  2W54 A;  4IKG A;  2N1V A;  3PLV A;  5CX3 A;  4HRS A;  3JYU A;  1XQQ A;  3PV1 A;  3Q3F A;  1YX6 B;  1N5W A;  3APF A;  2I1K A;  1M94 A;  4PYZ A;  3H1U A;  4XWW A;  2UYZ B;  5LXH A;  2KN5 A;  3BYY B;  2HD5 B;  2V3N A;  4KKJ A;  2K6D B;  3AUL A;  1DYQ A;  4JE3 B;  3RN9 C;  2QJL A;  2KX0 A;  1MG8 A;  2BS2 B;  4AQ7 A;  4KSL C;  1L6V A;  3VFK A;  2BWF A;  1FIQ A;  2ZVO A;  2DYM A;  4NJ7 A;  1SJE D;  4S0R A;  1PYW D;  2XK5 B;  3OAW A;  2AQ1 B;  4UDU C;  1VZ7 A;  1XCT L;  2D3B A;  1SE3 A;  3ZKJ C;  1D5M C;  2DWQ A;  4K1R B;  1XF5 L;  1V9J A;  1ZP0 B;  2BKF A;  2M8S A;  4KDI C;  3N30 A;  2JQR B;  4DK5 A;  3NHE B;  4XZ4 A;  3GS2 A;  3N20 C;  4FHJ A;  3OWE B;  4CYE A;  2D3A A;  2LXC A;  3TCA A;  4HDO A;  3M63 B;  5G55 A;  3SHQ A;  2X8X X;  4ANX A;  1KH0 A;  1WRD B;  2LGI A;  2LI5 A;  3P42 A;  4KDL B;  3RCZ A;  4A20 A;  4HLE A;  2MBQ A;  4HVB A;  2PLP A;  4RM9 A;  2KLG A;  4PS8 A;  2I38 A;  2H88 B;  4JLC A;  2HJ1 A;  4MDK E;  2M17 A;  1V1O A;  3NY5 A;  2NTT A;  1FO4 A;  3N3K B;  5AZG A;  2KMC A;  1QOB A;  3OJ4 B;  2O6V D;  1K52 A;  2IYD B;  3I3T B;  3ONS A;  3V60 A;  1JWA D;  1TGZ B;  2WWZ A;  4XGA B;  1Z2M A;  3ZDM C;  4XX5 A;  2WGS A;  2WYQ A;  3ENE A;  2JX5 A;  3WAO A;  3AE1 B;  4GSW A;  4KV2 A;  1UD7 A;  3VRB B;  3NVY A;  1OEY A;  2B3A A;  1GB4 A;  1V1P B;  1E7V A;  4GU2 A;  3IT6 B;  1IPG A;  2IJ0 A;  4F1S A;  3IT4 B;  4KSK C;  4WQM A;  2ZPY A;  3B2G A;  3MC8 A;  2D5G A;  3QCA A;  2L76 A;  4YTM B;  1FXI A;  3PPA A;  4DXG A;  4W9C A;  1T0Q C;  3DBH B;  3NVW A;  4DHJ B;  1TBE A;  2HE7 A;  3QQ8 B;  3PZ8 A;  2G45 B;  2Y5P A;  4D2K A;  3DBR B;  2IO0 B;  1PGX A;  3HM6 X;  3L13 A;  4J3O D;  2K8H A;  1WF9 A;  2LGY A;  1D3Z A;  3WIM A;  3CST A;  1KLG D;  2KMM A;  2MRP A;  3Q14 C;  3DQV A;  3EFU A;  4ZRJ A;  3BWU D;  4KVG B;  5D2M B;  4JQW C;  3PZD A;  2BTE A;  4WUR A;  4DHJ D;  3W5U B;  5JH5 C;  3O13 A;  1PQS A;  2WU2 B;  3RNG C;  1WI0 A;  2N4F A;  3IBE A;  4ICU A;  1ZDV A;  1QT9 A;  1OQQ A;  2QDF A;  4MM3 B;  4NQK E;  2HJ8 A;  2DYO A;  2Z59 B;  4WJO A;  3RNC C;  2BYF A;  3VHT C;  1N6Z A;  4E71 A;  1PDX A;  3M3J A;  3FIL B;  3KW5 B;  3DBS A;  1WXM A;  1HZ5 A;  2FCS A;  3BY4 B;  2I2Y A;  4PK1 A;  3ECI A;  4W9K A;  1YNT E;  3C19 A;  4LK0 M;  3PRM B;  2FCM A;  4NAW A;  4E3C A;  1VRA B;  3SD5 A;  2BPS A;  4L1B A;  4EFO A;  1XLQ A;  2GB1 A;  4QAY A;  4URK A;  2WNM A;  3VR8 B;  1XLO A;  1YJ1 A;  3RD2 A;  3AE5 B;  3R7Q A;  2KX3 A;  3AE4 B;  3A4S C;  5AEK B;  1MHH E;  2J4X A;  4YL8 A;  1K8R B;  2V3S A;  2BS3 B;  2HTH A;  4G0N B;  2INC C;  3TEZ A;  3NZU A;  5J17 A;  4B6W A;  2ZW0 A;  1WE7 A;  4HPP A;  1TTN A;  1ZUD 2;  2QMT A;  2LJ5 A;  4BKG A;  2FNJ B;  4ZYN A;  3WAN A;  4KIK A;  4B95 A;  4L2Y A;  2IO2 B;  1M4V A;  5E6P A;  2V9H A;  1EUV B;  4DBG A;  2KAN A;  1F77 A;  2FID A;  2KXJ A;  5DPS A;  3RMK C;  1HEZ E;  2KJH B;  1QOG A;  2LXA A;  2GBM A;  1R7S A;  1V80 A;  3MTN B;  1WJ4 A;  3N32 A;  1MG4 A;  1JWM D;  3RPF C;  4KZC A;  1JRO A;  1WGR A;  2RDB C;  4ZHO A;  5J2R A;  1H8C A;  1T0S C;  1BML C;  1VD2 A;  3DVN V;  3K9O B;  1YN4 A;  5AZH A;  5G2N A;  3NOB A;  2L7R A;  4RGN A;  2CS4 A;  3AU4 A;  1JAL A;  2L8J A;  1SE9 A;  2IBI B;  1B9R A;  1JWU D;  5EE0 A;  3GOE A;  2MP2 A;  1CMX B;  4AP4 C;  1Z5S B;  3AE6 B;  1WWT A;  3EEC A;  2IGG A;  3LYY A;  1WE6 A;  4C4V B;  4C56 C;  1NEN B;  2Y5B B;  4MGK E;  1QKZ A;  3EUB 2;  3H7P B;  1LFD A;  1N5X A;  4LNO A;  1UWX A;  4W9D A;  2WDQ B;  1YQ4 B;  1ZE3 D;  2J0K A;  2WX1 A;  1AAR A;  3CSF A;  3AU5 A;  2WP9 B;  1L0X B;  4OVV A;  1I4R A;  3L10 B;  1B1Z A;  2WXK A;  3JVZ X;  3RFZ B;  1QQR A;  3KVF B;  4GB9 A;  1ROE A;  1SSN A;  2R61 A;  3OJ3 A;  4G3X B;  1F2R I;  1I4H A;  4R3D A;  3IXS A;  2JZP A;  2JWU A;  2ZJD A;  4HXD A;  3KWL A;  2ICI A;  3B2F A;  4FXC A;  2KKC A;  1FM0 D;  5FK9 C;  1TY0 A;  3ZNI D;  2JUO A;  1HE8 A;  1IGD A;  1GC6 A;  2KC1 A;  1VZ8 A;  2YEP F;  1WFY A;  2Z8L A;  1E8X A;  1HQR D;  3NZ3 A;  2BW2 A;  3Q8C A;  4LTU A;  4ANU A;  2C5L C;  1FEH A;  2GBR A;  3A9J A;  3Q69 A;  4IWQ A;  4LDT B;  2IPK D;  5KHQ A;  3AM9 A;  1SGH A;  3H6N A;  4RGO S;  4II3 B;  1TKE A;  2WXL A;  2MCN B;  3R2T A;  5GMV A;  2IO1 B;  1IP9 A;  1RRB A;  2LVP A;  4IM3 A;  1FFV A;  3VUY A;  3WAL A;  2GLS A;  3T9L A;  5EE1 A;  3AV8 A;  1ZXH A;  5HFY A;  1F52 A;  4LLG M;  2G1E A;  1EM7 A;  1H4R A;  4C00 A;  2SEB D;  1I42 A;  2JY6 A;  2NTS A;  4GOC A;  2PW9 A;  4AS1 A;  1NVI D;  3HIZ A;  1WYW B;  2EMT A;  2MX2 A;  5HHD G;  2KNB A;  2ZEQ A;  3V6E B;  4A8X C;  2IDY A;  2NS5 A;  1UUP A;  4TV3 A;  3HUI A;  1E7P B;  1GNU A;  2ASQ A;  3A1Q B;  2Z0E B;  3ZW3 A;  2CHW A;  3KUD B;  4JPS A;  1C78 A;  2DNF A;  2J52 A;  5BMI A;  1R4M B;  2K8B A;  3A4R A;  2DEN B;  4IM2 A;  3N9Y C;  4FUL A;  1GUA B;  4M8N A;  1XLN A;  3PRP B;  3SU8 X;  1TS5 A;  1V97 A;  2ZNV C;  1LQB A;  2N0S B;  1TJE A;  1ZKH A;  1AW7 A;  1SJH D;  2HTM E;  3DVN U;  2QHO A;  4GDK B;  1BT0 A;  4M0W A;  1MVK A;  5J18 A;  2KVR A;  1CZP A;  2NVU I;  3IG3 A;  1IYF A;  1OQR A;  4WAA A;  1KOT A;  3OG5 A;  3ALB A;  4II2 B;  4HKZ E;  1C4P A;  1WMH A;  2DZI A;  2CR5 A;  3VTV A;  1I7H A;  2K1F A;  4K81 A;  3ZTC A;  1VR9 A;  3DBL I;  2KTR B;  4H2A A;  1MHX A;  2BYV E;  1ZDX A;  4P7I A;  2M0X A;  1I4X A;  2G3Q B;  3ML9 A;  2BYT A;  3ZUN A;  3QK0 A;  5BYQ A;  3NS1 A;  1TYG B;  4HPM B;  4RGM A;  2JZZ A;  1OGW A;  2KFK B;  5DPT A;  1K51 A;  3CMM B;  1ACC A;  2JZ3 B;  4KGR A;  4HKQ A;  3AEE B;  1FXA A;  1WX7 A;  2NBW B;  4YWG G;  2G9H D;  1E6E B;  1DOX A;  2LVO A;  1J8C A;  2XK5 A;  4AWJ A;  3AI5 A;  4DDI D;  1FPY A;  2LHD A;  3RUL A;  4J6I A;  1IBX B;  4MH8 A;  3BZD B;  1FNV A;  3P4Q B;  2ZZP B;  3CWI A;  3C8Y A;  2LFI A;  2LGX A;  2RR9 A;  3U7Z A;  4LJP B;  3Q2A C;  1BUI C;  3BIN A;  1WY8 A;  3Q8E A;  3Q8A A;  1L4D B;  1YN5 A;  4F7Z A;  1MJD A;  2DX5 B;  4JGH B;  5KHO A;  4LNF A;  1BXT A;  3TMP B;  3GP7 A;  2NCN A;  4YTP B;  2WXN A;  3AEB B;  2LRW A;  2KDB A;  1GC7 A;  1QZE A;  2AL3 A;  2NBU A;  5HKH A;  2LZ6 A;  1V2Y A;  1P9D U;  2IO3 B;  2K25 A;  4GLS C;  4ZRQ A;  3U2S C;  1V49 A;  3AXC A;  2KJR A;  2OED A;  2O6V B;  2DZM A;  3WCQ A;  1Y56 A;  3DPD A;  2LAS A;  3UQA A;  3TEY A;  1WM2 A;  4OZC A;  3VXW A;  1RLF A;  3LJ3 A;  2KQS A;  4HRO A;  2FIF A;  4BAX A;  1QOF A;  4K3B A;  4WWO A;  2L32 A;  4CHK A;  2KYW A;  5D94 A;  2MHJ A;  1NDD A;  1PUT A;  4NJ6 A;  5JHB A;  3DDC B;  2N9E B;  1R4N I;  2DBY A;  2ZVN A;  4BOS C;  3DHG C;  4DWF A;  1YQB A;  3A9K B;  1V1P A;  2RPQ A;  3N1X C;  3APC A;  2KZR A;  2GBK A;  2XNA C;  2QC8 A;  3GZN B;  5TSS A;  3M95 A;  3O65 B;  4BFR A;  4DHZ B;  2MBO A;  3KH0 A;  3X23 A;  5C23 A;  4WJP A;  4OVU A;  4ARI A;  2ZCC A;  2ZNV B;  3JSV B;  2VH2 A;  3P2B A;  2M56 B;  1K50 A;  5FKA C;  4LCD E;  2J53 A;  4NPN A;  4M00 A;  2K22 A;  2RPV A;  4L23 A;  2LEK A;  1QIL A;  3V6C B;  2KFJ A; 
#chains in the Genus database with same CATH homology
 1L2N A;  2DZK A;  4KZC A;  3TJP A;  3V61 A;  3VUW A;  4GDL B;  4HCP B;  2M1M A;  2GMI C;  1WGR A;  3C0R B;  3L54 A;  4W9I A;  1WGH A;  2D11 A;  1WZ3 A;  2DAJ A;  3NZS A;  5J2R A;  1H8C A;  4B9K A;  4MM3 A;  3U7D A;  1VD2 A;  3DVN V;  3UF8 A;  2MA9 B;  3K9O B;  5AZH A;  2KWC A;  5CHV C;  5G2N A;  2O6V A;  4IC7 B;  4RM8 A;  3NOB A;  3L08 A;  2AWT A;  2D3G A;  2L7R A;  3PRZ A;  4TKN A;  2N1W A;  3OLM D;  4N9F 4;  2KLC A;  3W1Y A;  1RFA A;  2CS4 A;  4PS7 A;  3AU4 A;  3W1S C;  4IM0 A;  2EKE C;  2L8J A;  2OJR A;  4DXA B;  2KQ7 A;  2RGF A;  4FJY A;  4IG7 B;  1SE9 A;  2AL6 A;  2IBI B;  4W9J A;  4EUT A;  1EF5 A;  2M4N A;  3GOE A;  2LWP A;  1UGM A;  2MP2 A;  1CMX B;  2LD9 A;  1Z5S B;  4AP4 C;  4WQO B;  3VUX A;  3EEC A;  1WE6 A;  1WGY A;  1Q0W B;  4FHK A;  1OEY J;  4EKU A;  1WGD A;  4MEL A;  2OOB B;  2L0T A;  2Y5B B;  2V1Y A;  1J19 A;  1WJU A;  4MGK E;  1UBQ A;  3H7P B;  1LFD A;  1V86 A;  3DOW A;  2REX A;  3JW0 X;  2YVC A;  4W9D A;  4WJQ A;  3UQB A;  4K7U A;  4FAD A;  2JPH A;  3B08 A;  2J0K A;  2WX1 A;  1AAR A;  3KYC D;  4PS3 A;  3CSF A;  5AZF A;  3EC8 A;  5CHW A;  3AU5 A;  2WDT B;  1FXT B;  3A9K A;  4ICV A;  4TQ0 A;  2LGD A;  2KWU B;  1V5T A;  4OVV A;  3L10 B;  1S1Q B;  1Y8R C;  4MH0 E;  3JVZ X;  2MBB B;  4ZRI A;  4G11 A;  4W9L A;  3KVF B;  4GB9 A;  4IW0 A;  3RT3 B;  3LDZ E;  2KOX A;  1V6E A;  4A3P A;  3OJ3 A;  4G3X B;  2JRH A;  4W9G A;  1UZX B;  5EDS A;  2N7D A;  1ZW7 A;  2AEH A;  2DHZ A;  2ZJD A;  5BO4 B;  1U4A A;  4HXD A;  2L00 B;  4GXB A;  1NI2 A;  2KKC A;  3RYT A;  4KZ0 A;  4NY0 A;  2D10 A;  3ZNI D;  2JUO A;  1HE8 A;  1JRU A;  1E8Y A;  2CKH B;  2V4L A;  1GC6 A;  1T0Y A;  1E7U A;  2KC1 A;  5JHA A;  1KM7 A;  4ZDV A;  4E74 A;  1P1A A;  1WFY A;  1E8X A;  4ANU A;  5C1Z A;  2C5L C;  1LM8 B;  2GBR A;  2O2V A;  2MLB A;  3A9J A;  1OQY A;  2XEW A;  2L05 A;  3JSV A;  3QAQ A;  3A33 B;  4W9F A;  4M0W B;  5IA7 A;  2WX0 A;  4IWQ A;  2K39 A;  1XT9 B;  3KUZ A;  4LDT B;  4BBN C;  5KHQ A;  1EF1 A;  2MBH A;  3V62 A;  1SGH A;  1ISN A;  2MBE A;  3H6N A;  3R66 C;  2KDI A;  4II3 B;  4K7W A;  4EEW A;  4GIV A;  3PLU A;  3KYD D;  1P3Q U;  2FUH B;  1WMH B;  2MCN B;  1WGG A;  4IWO A;  1NBF C;  4LJO B;  5GMV A;  2IO1 B;  1L7Y A;  1IP9 A;  3HM3 A;  2I1J A;  1RRB A;  4CO7 A;  3PHX B;  3ZNG C;  4GDL A;  4I6P A;  5L83 A;  4K7S A;  2LVP A;  4IM3 A;  1XD3 B;  4NQL B;  2N1V A;  3PLV A;  2K6Q A;  5IAA C;  1OTR B;  5CX3 A;  3VUY A;  2J0M A;  2VRR B;  3WAL A;  3T9L A;  3JYU A;  1XQQ A;  3PV1 A;  4FA6 A;  3Q3F A;  1YX6 B;  3APF A;  2DAF A;  2I1K A;  1M94 A;  3UGB B;  1H4R A;  2KTF A;  3PTF C;  4RMA A;  5CHF A;  3HK0 A;  2J7Q B;  2AYO B;  2K8C A;  4PYZ A;  4FBJ B;  3H1U A;  2JT4 B;  2JY6 A;  3EHV A;  2UYZ B;  1I42 A;  5LXH A;  2KN5 A;  1WIA A;  4GOC A;  2C7N B;  2HD5 B;  2KK8 A;  3U8Z A;  4FLH A;  3MHS D;  3ZLZ A;  2K6D B;  2KWV B;  1GJZ A;  3HIZ A;  3AUL A;  2BYE A;  4TUU A;  1WYW B;  2EMT A;  1R4M I;  2MX2 A;  2KNB A;  2ZEQ A;  4EZJ A;  2IZV B;  2KX0 A;  1MG8 A;  3H7P A;  1E90 A;  5E6N A;  4KSL C;  3V6E B;  1J0G A;  2NS5 A;  4ANW A;  4FJZ A;  3VFK A;  3IHP C;  2BWF A;  4TV3 A;  2NPT B;  2BKR B;  2ZVO A;  2DYM A;  4NJ7 A;  3HHM A;  2C7M B;  3QX1 A;  5LLI A;  2XK5 B;  2JXX A;  3PS6 A;  3OAW A;  3PSE B;  1GNU A;  2ASQ A;  4M8M A;  4W9H A;  1WH3 A;  3A1Q B;  4HK2 A;  2Z0E B;  3ZW3 A;  2CHW A;  2L0F A;  3KUD B;  3ZKJ C;  3B0A A;  4HCN B;  3D32 A;  4K1R B;  1V9J A;  3S2A A;  2BWE S;  2BKF A;  2M8S A;  4KDI C;  5L95 C;  2K8B A;  3A4R A;  2DEN B;  3N30 A;  3UIO B;  2KHW B;  4IM2 A;  2N9P C;  1WJN A;  3NHE B;  4MSQ B;  4XZ4 A;  5E6O A;  4DK5 A;  5FR6 A;  4EOY A;  1YX5 B;  2G4D B;  4W9E A;  4FHJ A;  4FUL A;  1WX9 A;  1GUA B;  2BF8 B;  2PPH A;  4I6L B;  4M8N A;  1WR1 A;  4PYU A;  4BBN F;  4CYE A;  3SU8 X;  3PRP B;  1I35 A;  1WM3 A;  3VQI A;  4G50 A;  2LXC A;  3TCA A;  5LXI B;  4HJK A;  4JIO U;  4HDO A;  3M63 B;  2ZNV C;  2FCQ A;  5G55 A;  3Q3J A;  1LQB A;  3SHQ A;  4ANX A;  2KO3 A;  1WRD B;  4FJV B;  2LI5 A;  1ZKH A;  1UEL A;  3DVN U;  4KDL B;  2QHO A;  4GDK B;  3RCZ A;  4A20 A;  1BT0 A;  3H7S A;  3UIP B;  3PHW B;  5J18 A;  4HLE A;  2KVR A;  1C1Y B;  2NVU I;  3IG3 A;  1IYF A;  2MBQ A;  4HVB A;  4RM9 A;  2KLG A;  4PS8 A;  2MP2 B;  5D7G A;  1LXD A;  4JLC A;  1EO6 A;  3K9P B;  4MJS B;  1TZ1 A;  2BGF A;  2MQJ A;  4WAA A;  3ALB A;  4ZRK A;  4MDK E;  1KOT A;  4II2 B;  2M17 A;  2KMA A;  1WMH A;  3B1L X;  3NY5 A;  2DZI A;  2IY0 B;  3N3K B;  5AZG A;  3QHT A;  3QA8 A;  1C3T A;  2KMC A;  1YD8 U;  2CR5 A;  4HPL B;  3VTV A;  2KD0 A;  3OJ4 B;  2O6V D;  2R2O A;  1E8W A;  2K1F A;  1E8Z A;  4K81 A;  4XC2 A;  1WR6 E;  2DZJ A;  2IYD B;  2CHX A;  3DBL I;  3I3T B;  2NBV B;  2KTR B;  3ONS A;  3V60 A;  3TL5 A;  3ZTC A;  2LRU A;  2BYV E;  3PRE A;  2UWQ A;  1Q1O A;  2KDF B;  1TGZ B;  2WWZ A;  4P7I A;  1Z2M A;  2JRI B;  3ZDM C;  4MSM B;  4XX5 A;  2KJ6 A;  2M0X A;  1WXV A;  2G3Q B;  4MGY E;  3ML9 A;  4WWP A;  2WYQ A;  3ENE A;  3ZUN A;  1ZGU B;  3QK0 A;  3WAO A;  3U30 A;  3R3M A;  4GSW A;  4HPM B;  4EZL A;  1UH6 A;  2PEA A;  4KV2 A;  3DBH I;  1UD7 A;  4NAW B;  2JZZ A;  2D07 B;  1OGW A;  2DYB A;  2KFK B;  1S3S G;  5DPT A;  2CU1 A;  1OEY A;  3CMM B;  2B3A A;  1X1M A;  1GG3 A;  3MJW A;  2FAZ A;  3DBR I;  3VH4 B;  2JZ3 B;  4HDQ A;  4AOF A;  1E7V A;  4IWP A;  2A4Z A;  1UBI A;  4GU2 A;  3X0W A;  4X57 B;  5DPW A;  2R2Q A;  1IPG A;  4F1S A;  1WX7 A;  4MGZ E;  3ZNZ B;  2NBW B;  4KSK C;  4ANV A;  2ZPY A;  2NPT A;  2L76 A;  3QCA A;  3WA0 A;  4AJW A;  2LVO A;  2PJH A;  5DPR A;  1J8C A;  3ZVV A;  2XK5 A;  3PPA A;  5D6J B;  3AI5 A;  4AWJ A;  4DDI D;  1V81 A;  4W9C A;  3RUL A;  4BVU C;  4J6I A;  3A1Q A;  4FN2 A;  4DHJ B;  1YIW A;  1TBE A;  4GN1 A;  4KIK B;  2HE7 A;  2ZZP B;  3QQ8 B;  2LGX A;  2RR9 A;  4BKS D;  2G45 B;  3WAM A;  1RAX A;  4LJP B;  2IO0 B;  3BIN A;  3QJZ A;  3HM6 X;  1WY8 A;  2ZPN A;  3IVF A;  3L13 A;  4DDG D;  4AJY B;  2FCN A;  2K8H A;  3VDZ A;  2MWS B;  1WF9 A;  1KJT A;  3IFW B;  4F7Z A;  2JF5 A;  3PT2 B;  2DX5 B;  4JGH B;  2LGY A;  1D3Z A;  2C60 A;  5KHO A;  3WIM A;  3CST A;  2KDE B;  1WZ0 A;  2MRP A;  3TMP B;  1G6J A;  3DQV A;  3EFU A;  4WJN A;  4ZRJ A;  2NCN A;  4KVG B;  5D2M B;  1P0R A;  2Z0D B;  2NR2 A;  4GMV A;  4JQW C;  3PZD A;  2LRW A;  2KDB A;  3L0W B;  3WAP A;  2A5U A;  4DHJ D;  1GC7 A;  5JH5 C;  1QZE A;  4JL9 A;  4GDK A;  5CTR C;  1PQS A;  3TBL D;  2D2Q A;  2AL3 A;  2NBU A;  4AUQ C;  5HKH A;  1WI0 A;  2LZ6 A;  2KC2 A;  2N4F A;  3IBE A;  1V2Y A;  4ICU A;  3TIX A;  1P9D U;  2IO3 B;  2K25 A;  4BKT A;  3M62 B;  1A5R A;  4HWI B;  1V49 A;  4ASW C;  3AXC A;  4MJS A;  2KJR A;  4NQK E;  2HJ8 A;  3ZRC A;  2RD0 A;  3ZRF A;  2DYO A;  2Z59 B;  3RUI B;  2O6V B;  4WJO A;  2IY1 B;  2BYF A;  2DZM A;  3VHT C;  2G4S A;  4E71 A;  3DPD A;  2LAS A;  3UQA A;  1WM2 A;  3VVW B;  3VXW A;  4A3O A;  1RLF A;  3L16 A;  3PVL A;  3LJ3 A;  2KQS A;  2KTR A;  3M3J A;  1KLV A;  3W1S A;  2FIF A;  4MEM A;  2GBN A;  3KW5 B;  3DBS A;  2YLM A;  4WWO A;  5DCN A;  4BOZ B;  3APD A;  3QAR A;  4GGQ A;  2C9W B;  1WXM A;  2FCS A;  2LUE A;  3BY4 B;  3QC8 B;  3ZTD A;  3ECI A;  3GZN I;  4W9K A;  1SIF A;  3SDL C;  3VTU A;  3DVG X;  4CHK A;  4MGI E;  5D94 A;  3ML8 A;  1NDD A;  3T8M A;  4NJ6 A;  3ZDT A;  3PRM B;  2MSE D;  5JHB A;  4NNJ B;  2FCM A;  2N7E A;  4NAW A;  1VCB A;  3DDC B;  2EMS A;  2N9E B;  4E3C A;  5JZE B;  1R4N I;  2KFK A;  2ZVN A;  3SD5 A;  4EZK A;  3VTW A;  4BOS C;  4DWF A;  2LVQ A;  2CHZ A;  2PE9 A;  1E5W A;  1YQB A;  2BPS A;  3A9K B;  3QIJ A;  4EFO A;  3KUC B;  4BKS A;  3VH3 B;  4URK A;  3L17 A;  3QWZ B;  3NS8 A;  1YJ1 A;  3RD2 A;  2RPQ A;  3R7Q A;  2N9X A;  2KX3 A;  3A4S C;  2PE6 B;  5AEK B;  2ZCB A;  3APC A;  2KZR A;  4YL8 A;  1K8R B;  2V3S A;  2GBK A;  2HTH A;  4G0N B;  3NZU A;  1WJ6 A;  5TR5 A;  5J17 A;  4B6W A;  2JWZ A;  2MW5 A;  1Q5W B;  2XBB C;  1WE7 A;  3M95 A;  2JVC A;  3O65 B;  4BFR A;  2MBO A;  4DHZ B;  1TTN A;  3DVG Y;  3KH0 A;  2LJ5 A;  4WWN A;  4BKG A;  4F8C B;  1WX8 A;  3X23 A;  1V5O A;  5C23 A;  1P98 A;  2FNJ B;  4WJP A;  4ZYN A;  3WAN A;  4OVU A;  4KIK A;  4B95 A;  2C7H A;  2ZCC A;  4IUM B;  3RZF A;  1WXA A;  2IO2 B;  5E6P A;  1WXS A;  3R7R A;  1EUV B;  3PGE A;  4I6N B;  3ZNH B;  3CF6 E;  4DBG A;  2O2V B;  2KAN A;  2ZNV B;  3A9J B;  4TQ1 A;  1F9J A;  2FID A;  2GBJ A;  3JSV B;  3RZW C;  3P2B A;  3UIN B;  2KXJ A;  2RSU A;  2GOW A;  5DPS A;  2KJH B;  2L3Z A;  2LXA A;  4LCD E;  2GBM A;  4DHZ E;  4NPN A;  1V80 A;  3ZO5 B;  2W9N A;  3MTN B;  3ZIM A;  1WJ4 A;  3N32 A;  3VAW A;  3DCG A;  4LDT D;  3H9D A;  3V6C B;  2KFJ A;  2J0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...