4RGTA

2.0 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with 3-n-acetylneuraminyl-n-acetyllactosamine.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
191
Chain Sequence
b'HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKESEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 2.0 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with 3-N-Acetylneuraminyl-N-acetyllactosamine.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 64
structure length 191
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgtA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgtA01
1UNSA 2O2LD 1PRTC 1LTSD 1FNVA 1HA5A 1SE2A 4TSSA 2CHBD 1SJHD 1S5ED 5I4DA 1LT5D 4ZYSA 4RFBA 1S5FD 1S5DD 2XRSD 5D3DA 1PRTF 1YN4A 2AQ1B 1PTOC 1CHQD 1LTRD 1L0YB 2J4XA 3DWAA 3URYA 5ELEA 5ELBA 1TS3A 1CHPD 1LT4D 1LTAD 1ET9A 4Z9CB 5ELFA 4O1NA 3R2TA 5FK9C 1L0XB 1PZID 1PTOF 1KLUD 1LTTD 1SEBD 1PRTB 1SXTA 1LTGD 4BWGB 3EA6A 3KLSX 1BCPD 3R2IA 4RH6A 1LT3D 3V05A 1PTOH 3MC0B 1FGBD 3EFXD 1HXYD 1SE4A 4L6TB 3BVZA 2AQ2B 1V1PB 5TSSA 1EU4A 1V1PA 1ESFA 1SE3A 3DWPA 1AW7A 1EU3A 1TS2A 2R61A 1I4QA 1JCKB 1MD2D 1STEA 1D5ZC 4RCOA 4C56C 1DJRD 4UDUC 1B44D 1I4PA 1I4GA 2AQ3B 1BCPC 2TSSA 1EEFD 4RGNA 1ENFA 1B1ZA 1FD7D 3BVMA 5FKAC 1TY2A 1PYWD 1FNWA 2SEBD 2RDHA 3GP7A 3W2DA 2WV6D 1T5XD 1YN3A 1BCPF 4OHJA 4K6LA 1JWMD 1SBBB 2IPKD 1JR0D 1TS4A 2RDGA 3OWEB 2ICIA 3BYTB 3DWQA 3BYYB 1JWSD 1CQVA 1PTOB 3BZDB 1I4RA 1RF2D 1D5MC 1XXGA 1I4HA 1AN8A 1D6EC 2XNAC 2XN9C 2IJ0A 4DXGA 1G8ZD 1BCPB 1LTID 1EFID 1M4VA 1TS5A 1UUPA 1I4XA 4RHSA 4DXFA 2Z8LA 1XTCD 4RGTA 1S5CD 4L63B 1GOZA 1CK1A 1EWCA 1QILA 1SJED 1HQRD 4RGMA 1KLGD 1EEID 1JQYD 2QEJC 2QILA 1DYQA 1TY0A 1RD9D 3SEBA 2NTSA 3O13A 3BVGA 4RHRA 3TSSA 1LT6D 1PRTD 2XRQD 1HTLD 3MFGA 4NZLB 1LLRD 2NTTA 5D3IB 1RCVD 2G9HD 1BXTA 1KTKA 1LO5D 1PZKD 1F77A 1S5BD 5ELCA 1LTBD 5ELDA 1PTOD 1JWUD 1YN5A 1ET6A 3CHBD 4RGOS 1FNUA 1PZJD 1RDPD 1CT1D 3R8BA 1V1OA 1D5XC
chains in the Genus database with same CATH superfamily
2JEAI 4POGA 1YNJD 2K01A 2CVRA 4R4TA 4GDKB 2RGFA 1I3QH 2C9OA 3I55A 4IN3A 3ZJYC 2LVPA 1SLJA 5JPMC 2UXCQ 4YWKA 3FMCA 3W3AA 3HOVH 3I63C 1FFUA 5CV6A 1R4MI 1TVXA 3KDFB 3HP3A 4B0MA 1L0YB 3DWAA 4PYZA 4NY0A 3SU8X 4KZCA 3AI5A 4QUFA 1QOGA 2H88B 4TQ1A 2IYDB 3A7LA 5FLXL 4DAYB 5KNCA 5I2YA 1A70A 1VQEA 4ME3A 3KUZA 1L0VB 3R66C 3VYRA 2D11A 1F2LA 4HCPB 3UI3A 2OQ0A 2EYPA 1PTOH 3U4VA 1C78A 5AFWA 1B70B 2DZIA 3A0JA 1SR3A 3MEHA 3HKZE 3Q8DA 5LL6S 2KVRA 3P4RB 4UPAA 1CZPA 2I2YA 2K8HA 4GXBA 1DM0B 2B8GA 4II3B 2FJ2A 4XWTA 2KA7A 4DR7L 1VRAB 4YTMB 4HEA1 4TRDA 5H92C 2PNRC 3GV6A 1PH7A 5BN3A 2KACA 1VQIA 2OXPA 2AQ3B 4GZYC 1HR0W 4DV0L 1UBIA 3HK0A 4DUZL 2MJEA 1PYWD 3SR1A 3BWUD 1WCMH 4DWFA 2PVGC 1NYQA 5LLIA 3D3RA 1Q1EA 4OHJA 3UDFA 2VW9A 4X64Q 3A8KE 1I6HH 4YSYB 4UAIA 4W9KA 1E9MA 3QIJA 1T9HA 2E2HH 3TQYA 3DWQA 5M5WB 1I94L 3UIOB 4S3SA 3HOXG 3WOEA 2MBHA 5AUKA 2LGYA 2KECA 2IX3A 4HIOA 4GLXA 3HM6X 1D6EC 2F0IA 4AP4C 2GLSA 3WDNA 4ANUA 2Z0DB 1G8ZD 1S3OA 1D4BA 4A3BG 1WXSA 2MW5A 1V86A 1M94A 2LGSA 2Q8TA 1WI0A 3BZCA 3D31A 1NSNS 5AZGA 3EJIA 3T3OA 1GOZA 1NBFC 2SAKA 2V3PA 2WQYB 4PS3A 4W9IA 4GKKL 2M0AA 3SFDB 1ZUD2 3BDCA 2WX0A 1E5WA 2IW3A 3M7GA 4FYDA 2A5UA 2DZJA 3T16A 2HTHA 3JAME 1VQ4A 4FJZA 5DNFA 4DNTB 5LMNQ 3HOZH 1OQYA 4EX5A 1FO4A 3PIO3 3IAM1 4HLEA 2N9KA 4QGUA 5EKLA 3OMGA 2EZVA 3VYSA 2FCSA 1H9JA 2BYFA 3X0WA 2RSNA 4ZAIA 3TZDA 2EELA 4LJZC 4FHKA 1XMQL 4HWIB 4HMIA 2R92G 1F2YA 2DNFA 2PEAA 2R7DA 3UI2A 3RNUA 1SMYC 2Y5CA 3Q6BA 3J7AF 3QK0A 2EYOA 2KZRA 3S2HB 4CDDC 5GQOA 1WJ6A 3KFUA 1B4OA 3VR3A 1T6BX 4WWPA 2MSED 2BH2A 2RA4A 1O7ZA 2KJXA 1NNXA 2AUKA 2O2LD 3I2ZA 2KN4A 2VZAA 1K8AC 4ASWC 4FBJB 5C1ZA 2KENA 4J15A 2XBBC 2XK5A 1J5EL 3K9PB 5CMDA 2L9HA 2ALYB 4LUVA 2PZTA 2WDTB 2DLBA 4FP5D 4E3CA 2BYTA 1YN4A 4JI7Q 2J42A 1K28A 1PLFA 2PYKA 1Z7TA 2LXAA 3I4NG 2Q2IA 4PS7A 2FXQA 1CHPD 4H0LC 1YD8U 2KVMA 3PZ8A 5TR5A 4BZAA 2R2OA 4OWXB 1O7LA 4WJNA 4XYCA 3D32A 3SDLC 2ZJPA 2FCQA 1PZID 4JYAL 2GBNA 2JUOA 3H6NA 1IBKQ 2ON8A 2H1EA 3ZGZA 4OO1I 4LTUA 1TWFH 3W1YA 2B63H 3S1RB 1NTGA 3HEJA 1PQSA 1WMHA 4KIKA 4CKCA 2IT1A 1CA6A 2VB3X 5HY6A 3KBXA 2E2IB 4DNIA 2UXDQ 2KHSA 2LFNA 4DHJB 5C3JB 2IO3B 4JI3L 2IX0A 1QE6A 4RAUC 4TVAB 2EMSA 1JMLA 3I56A 1V1PA 4IWOA 4RNAA 1EY4A 1K83H 1WR6E 1VR9A 1C9FA 2AEHA 3NWTA 4LF8L 4C56C 1SB3C 4JI1Q 2K5PA 1V2YA 1XNQQ 1I4PA 5T8IA 4CDCC 4XQNA 2BA0A 4A76A 2MLBA 1CZGA 3G6EA 1ZXTA 2RVLA 1W6KA 5IP9G 3IVFA 5FKAC 3D8GA 3ER0A 3GTGH 1RTNA 2O4XA 3E6ZX 2OTJA 4HR7B 5J18A 5NUCA 3W2DA 4XXEA 2PI2A 3DEPA 2KO3A 1J7AA 3P63A 3TP5A 4KN4C 3FKIH 1QG7A 4DV1L 1SIJA 2KUMA 3BYTB 5M5YH 1NYRA 1F9SA 4LF6L 2UYZB 4WWOA 1DOXA 4GB9A 4GS3A 4LNQA 2PPHA 5FLMG 1ROEA 1H8CA 1J7CA 1EFID 4C3IG 1RLFA 1EWIA 2F3IA 2JQOA 2NVXH 2J53A 3J81c 1ONLA 4L8JA 5D65A 3TP7A 2UXCL 4P71A 2KN5A 4DU9A 4RCNA 2GVAA 2KDEB 2PLPA 2EYJA 2C9WB 4BKSA 4NKLA 1VCIA 1NCVA 3U4ZA 3NOBA 4KJNA 3LJ3A 3PIPA 1PFNA 2K5HA 1IUEA 4K5WA 3J81E 1PRTD 1ZPSA 3KF8B 2J0KA 2L00B 3VVWB 4HEDA 2D2CC 4YCUA 2F0GA 3TIXA 1VQOA 4R8IA 3MZ5A 1TBEA 1IYUA 4LNOA 4E71A 1FJGL 1TYGB 1PH2A 4A3GH 3GS2A 3R7RA 5G5GA 2MA9B 2HJ1A 2AL3A 1H95A 2IGGA 2JY6A 4A6QA 1MHWC 2ZPNA 2O6VD 2KJRA 4FVMA 1YQ3B 3O65B 2PMZE 2FE8A 2LY7A 4WRDA 1D5XC 5CV5A 1VQ5A 2BOSA 3CQZH 3K7AH 4IUQA 2Z6KA 2LSSA 2IGDA 1QF6A 2R7FA 4X3SA 2BWES 3MHZA 2PMZB 2UUCQ 2WXQA 1L0WA 3RZOB 4HJ8A 1TIFA 4L5QA 2NUCA 3LWEA 2KANA 3HVDA 2BBCA 2N49A 1MBYA 4MH8A 2LGIA 3OIPA 2BS4B 3AEVA 3MHBA 4XT3B 1YI2A 5JEAH 1MJCA 3IKJA 1Y1WG 1IW7C 4X65Q 1XMOQ 3VH3B 3E5SA 4A3MH 1L6VA 4LK0M 2MEKA 2LJ5A 5DAUA 1LT4D 3I7FA 3MJWA 1Q7YC 2LFIA 2MP1A 3FPPA 4AJWA 1AE2A 3HVZA 2JA7B 1KLUD 1OXXK 4BFRA 1V97A 1OEYA 5IE8A 4BWGB 4DDGD 2B2UA 1Y69U 4QIWE 5FOBB 1WTXA 2JA5H 4A3DB 4IM3A 2GMIC 4YTPB 3VTWA 3Q6SA 1E90A 1UEBA 1MJEA 1WZ0A 2PZUA 4EFOA 1XWEA 2AKWB 1OXSC 4QIWB 3ZDMC 2G1EA 5M5XH 1KDCA 4IFDG 4XT1B 5CBAE 2ZJDA 3GO5A 3RNBC 1I3QB 1SE3A 1E24A 1UBQA 4CJ0B 3CF6E 4GMVA 3KJPA 2MHJA 1JCKB 4PQXA 4XE0A 1SSOA 2OT2A 2WU2B 4M8MA 4FXGC 1F9RA 3N30A 3HOVB 2K14A 5IAAC 2JXXA 2K5QA 1HA6A 3NHEB 5GXGB 4DR1Q 2JWUA 1KHIA 5BYSA 1FNWA 1WVLA 1FXTB 2PCFB 3PLUA 4FLHA 3L17A 1IBML 1AZQA 4CGYB 3AEFB 5C44G 1R4NI 5AEKB 2C7HA 3LGJA 5IO9A 2YTYA 3I4OA 1VQ9A 1GXDC 4X3TA 1GG3A 2IY1B 3OJ3A 4HIMA 1PTOB 4LNIA 1W3SA 4WWMA 2MH7A 3HOYG 3UE0A 3CWIA 1F0ZA 4RMAA 5D14A 5CV4A 2F0MA 3PUZA 3SHLA 4LFBQ 3F2UA 4DR2Q 1VZ8A 4Y7NH 2NPTB 1LYLA 3ZQ4A 5GAHC 1S5CD 1Y56A 4DKAC 1V80A 2K28A 1QQRA 1SYDA 1CZWA 2B8FA 4DK0A 2Z4HA 4JI7L 1EEID 2K8CA 2WXHA 2F0WA 2N0SB 4K8IA 3ZW3A 4GN4B 3C8YA 4JCVE 5EBCA 1NVID 3TS0A 2XK5B 4JX1C 4LLGM 4A3FG 4Q2JA 3VA5A 1IYFA 1ICFB 4KKSA 3SEBA 1Q86C 1OGWA 3A56A 1U4MA 4GLAC 1CTMA 3PF5A 2HD3A 4I7AA 4RHRA 3UDIA 2BB5A 1JT8A 2F03A 3Q8EA 2L55A 1J9OA 1WCMB 2EJFC 2VH2A 2W55A 1PH9A 3Q8BA 2I5MX 1ACCA 3WCQA 5C23A 2G9HD 4XZ4A 2A73B 1KTKA 1QNKA 2ID0A 3JAMi 1I6HB 1B8AA 4FDBA 1HHVA 1P3QU 2IY0B 3KF6B 3IAS1 1S5BD 3KLRA 5C4XH 2E2HB 1X1MA 2W3RA 3JVZX 2L5TA 3LWUA 4IPDA 2I1KA 1CJEA 1PTOD 1TJEA 4KSLC 2CQOA 1Y8NB 4X66L 4DA2A 1WMHB 3U9SA 2CU3A 2LGXA 4P2CB 4DV7L 2GBMA 3AEGB 3DBHI 4PT5A 5EE3A 2WXPA 5EGTA 2DHZA 4DUYQ 2ZCCA 3OG5A 2A6ED 1R4MB 5BMGA 4MGKE 5IP7G 3A1QB 5FJ8G 1XQQA 1XT9B 2CHBD 1BBWA 1BNZA 2JWZA 1EY9A 2EVBA 4F87A 4BY1G 1E8WA 1HNWQ 4K0KQ 1PFDA 1B3AA 3HOZB 2AQ1B 1D1KA 2ENBA 1TWAH 5M9OA 4EE2A 2OCEA 4JV5L 3UIPB 3NTKA 3K5MA 2ES2A 3PSIA 3NVZA 1EY6A 1LTAD 4NXML 1TR5A 1VLBA 2XGTA 3C1EA 2F0TA 3I73A 4RMFA 4B3TL 1Y8PB 2QDBA 4A3EG 2BGFA 2ZZPB 1WTWA 4KMUC 5LMNW 4FN2A 3AV8A 4YSZB 2A68C 1CM9A 2AWNA 3WAPA 3HOWG 1GM5A 1WD1A 2YLMA 1A3VA 1VQGA 4RKBA 2KC2A 1RODA 1TXYA 1C79A 3K5LA 1QNUA 1CSQA 3N32A 3NE5B 2HIVA 1SE4A 4G4KA 4L6TB 1IXRA 1OFFA 3X3MA 3H7PA 2ZNVC 3D6WA 2ZPYA 4LF7Q 4JOIA 1RTOA 1PUTA 2IO2B 1J19A 3RLOA 4MM3B 3BDOA 2X8XX 4W9GA 2K1BA 1HUNA 3EHVA 2OQKA 4K3BA 4ILWA 2R7ZH 1YJWA 1EYDA 3OTOQ 2WDRB 3E56A 5BN5A 4MTKA 3DVGX 3BU2A 2JYOA 3QC8B 5JVG3 1WX8A 5EJWA 3F1ZA 2QMTA 1FD7D 4W9LA 2WYQA 1PA6A 1QVCA 4NPSA 5E6OA 4YT0B 4IPCA 4KV6A 3J80L 3U58A 2A5HA 3Q2AC 1WGGA 5MPOA 3D4DA 4KY7A 2NWGA 1YHQA 4NJ6A 2VZKB 1E1TA 4DR4L 5IYBH 1NE3A 1TWFB 4GNXB 2WX1A 3NEMA 2B63B 3VRAB 4IO9A 4DK5A 5LHY1 1GUAB 1I4RA 2KWDA 1E6EB 1N5WA 1X3EA 4NXNQ 1H9KA 4Q0FA 4PS8A 2IO0B 1QB5D 2XNAC 4GN3B 1JORA 4LFAQ 4DGZA 1EWYC 1SIFA 2D5GA 2N7JA 3PGZA 2WHIA 2E8GA 2QCPX 3W1SC 3L13A 1O80A 3ETRA 1DXMA 3RN2A 1K83B 4JI0Q 3AE3B 3Q8FA 3ABVB 4G50A 4E6IA 1HQRD 2DN8A 4EGVA 2D3GA 5C0XJ 1EY8A 3U2SC 4WURA 4X65L 3KUCB 1QOAA 3RI7C 1N9WA 2BKRB 2YVCA 2YYZA 5KHQA 4EVOA 3M9BA 3CC7A 3HM3A 3GTGB 5I6YA 2K3UA 2UXBQ 4B3RQ 1K0RA 2B2WC 3MFGA 2J7QB 2L52A 2HDMA 3V60A 1IYJB 3K81C 1HCZA 2WS3B 4MNOA 1D7QA 1SFOH 2KEEA 3FKIB 3GTKH 5L83A 4BXXG 3OWFA 4XGAB 1KQSA 3GZNB 3VXWA 2BKFA 5JEAJ 2UUBQ 2LHEA 1K8MA 2A1AA 2I07B 3U4EG 4AYBE 3RNEC 3HOXH 3DBLB 1BT0A 3ERSX 1JE4A 2NVXB 2PNHA 3ITPA 1XO3A 4DV3L 5JHAA 1TWCH 2B2YC 4AYBB 2KMCA 4EQOA 4QMGA 3A4SC 2F3VA 4IUUA 2DJGC 4MSMB 4DAVA 2F0UA 1VQDA 2MJ8A 4OEMB 1NR4A 1PFSA 1X3FA 4DV2L 3F2BA 4ZRKA 1X32A 2KDFB 1HQMC 4LNNA 4F7ZA 3PCOB 2NZ1D 2CWPA 5BN4A 1Q1OA 2QC8A 3PRPB 1HNZQ 2DWQA 4JI5L 1XLPA 3VAWA 5BMIA 2SNMA 2R93H 2D62A 3R2TA 1L0XB 4G7OC 3I8ZA 2FCMA 1G2TA 1U9RA 2INDC 4W9EA 4A3GB 1BCPD 2RQXA 1B9MA 3V05A 1GUNA 4KLKA 4DR2L 3KW5B 1STHA 4C00A 5IGDA 4JL9A 4NJ7A 4NQLB 2GB1A 1QVFA 1N34Q 2HUGA 2L05A 4DV5Q 3M62B 3ZJVA 2K32A 4BBRG 1MI2A 2PQAA 3E3XA 2O5IC 3DPDA 3EGRA 2QKIC 3CQZB 3K7AB 4X62Q 3AMUA 3VRBB 1V1QA 3AU5A 1EU3A 4IURA 5IIFA 3P2BA 3QO2A 1STEA 1JC7A 3KLSA 4P73A 3GTOH 1HEZE 3A9JA 3DCGA 3NBIA 3UQAA 1EEFD 2V3SA 3VR4A 2A19A 3N3KB 4IWQA 4A3MB 1TKYA 1XLNA 2DNEA 4ABNA 2MWSB 2D07B 1AFPA 1RHPA 5EE9A 2MBBB 3QWNA 2JXMB 1ASZA 4B3ML 1EUJA 3I4MG 3I4NH 2B2YA 5HGTA 4A3CH 1JWMD 4EQ5A 3W5VB 2LRUA 1U5KA 1ZKOA 3L3OC 4LK1C 3OWEB 2VQFL 3ZJTA 3KYDD 2JA5B 1C3TA 4EQNA 2XTIA 3L54A 2AHOB 5E6JA 3TREA 2BDOA 3Q69A 3KYHC 1UGMA 1S72A 1KNAA 1SE8A 2I5LX 3DLLA 4H13C 3RN5A 1I6VC 5M5XB 2NN6G 1YHBA 1DOKA 1SRUA 2MJDA 2K75A 4L63B 3V62A 3CMEA 1FRDA 3ZNID 3ZO5B 2Z4IA 2PKOA 2REXA 5HHDG 2KQ7A 2JP1A 1I7HA 1SNOA 1K73C 2VS1A 3QAQA 3T56B 1DYQA 3I72A 1N8RC 3QR8A 5C3EG 3APFA 1UGJA 3TEXA 2X69A 4KGRA 3G4SA 1L1OA 2JZPA 2KHWB 1HR0L 2XVSA 4V0BA 4C3HH 5EBDA 4F7XA 2HCCA 2LI5A 4UY8C 3S1NH 1VQ6A 3AYHB 4DK1A 5IGBA 4HJAA 4A93G 1ZKHA 2WNMA 4IWPA 4KSKC 1KF6B 1YN5A 1ET6A 2EXZA 2INPE 3H0GG 4Y7NB 3CSFA 2XWJB 3P1HA 2UUAQ 2F0KA 4A3JG 1U4AA 3OOCA 1N33Q 3H7PB 4O2DA 1GUWA 2KJ6A 2HJ8A 1B50A 2NBUA 3BJUA 5AZHA 3TS2A 2BCOA 1S5ED 5IT9c 4ITKA 4ZYSA 2A69C 1KRSA 3J7ZC 3RPFC 2K22A 4LF9L 3RZWC 3TL5A 5E6NA 1VMCA 2LXJA 2B76B 3S14H 4IFDI 2F0NA 3ML9A 1PH4A 5KNBA 4F8MA 2CH4A 2AX5A 2IO1B 3IFWB 1XPOA 4G7ZC 1IBXA 3OLMD 4YIJA 2YU9H 2F0DA 3H3VI 1MI0A 2G4SA 3A4RA 5IT9E 3H15A 2D10A 5C4XB 3PRZA 4LFAL 2HQLA 4IM2A 3DBRI 1EO6A 4PMBA 1R4PB 5E7NA 1WTRA 3W1GA 1S4ZA 3P75A 2O2VB 5IGCA 5C5MA 2KKCA 5K36H 5EPJA 4ICVA 2WGSA 4B0EA 1VQJA 1AYFA 2Q5WD 1ESFA 4CYEA 4V190 2O6VA 4HCEA 3AE7B 2OJWA 4KHPL 2CHZA 3A5UA 3K0XA 1L4DB 2V1YA 3W9CB 4KTAA 3HKZG 4ARCA 3GOEA 4NW2A 1I4GA 2IL8A 4HJ5A 1VQPA 1ENAA 2KFKA 3CIRB 4FJYA 1H9RA 3MXPA 4C7ZA 3DBSA 3MA2B 4MZ9A 2KMAA 1BBXC 1B1ZA 1EWHA 1TWAB 3BVMA 2KK8A 1HNXQ 1PFMA 4NAWB 3AEEB 2X38A 2LEKA 4GLVB 2NVQH 1RIPA 2LGDA 1NEKB 2ZNVB 4M00A 2CHWA 4YTNB 1JOQA 3NK9A 3CSTA 1KL9A 2WFWA 5KNDA 3Q24A 1V9JA 1EY5A 4DR3L 1STGA 2PO4A 3BZDB 1X3QA 3STBD 4BY7G 4P6VF 2C5CA 4IG7B 4KJOA 1KNEA 3TBLD 2C7NB 3NENA 1EQQA 1UUPA 3A55A 2KAJA 3UDXA 3AB5A 4OIKA 4IZ8A 2D0PA 4RGTA 4QF4A 1EWCA 2JA6H 4LAAA 4IFDH 2R7ZB 3KUDB 2I46A 3OHXC 1MKHA 3U9OA 2WKDA 2E5LQ 1P0RA 4P1CC 2WLBA 4JI6Q 4NAMA 2JA9A 1VF7A 4IALA 3SGIA 3H3VH 1C4PA 4TUUA 5IYCG 1BDOA 1C9OA 4A8XC 3EVQA 2PW9A 4WJQA 1BOSA 1EFWA 4XX5A 2NR2A 1VMPA 4IJHA 1CKMA 2N9PC 1TZOA 3UE1A 2ICEC 5J22A 3JAMc 3QG1A 1OXUA 3K6OA 3DBHB 5AJ3L 1ZDXA 1F77A 4K7SA 4MIUA 3H3VC 5HG2A 2FIDA 1XNRQ 2WXOA 1C77A 1L7YA 2CJOA 1T3QA 3CHBD 2F1MA 3ND9A 4ZK9B 5IA7A 1G2SA 4MGIE 1RDPD 4F8CB 1V6EA 4X62L 1GVPA 1CKNB 5IWAL 3F2DA 4RF0A 3PIP3 4ANXA 2PIAA 2KVZA 2N1VA 1EOTA 2UWQA 1V81A 4ACFA 1SE2A 2Z0EB 2WU5B 4FF4A 3GE3C 4JBJA 2PQAB 3TUOA 3ZXVA 3U8ZA 1EZ6A 1V9PA 1Y1VG 2X6LA 4H2AA 4ZDVA 3NZUA 2BVCA 2CQAA 4WAAA 3E9SA 1H9MA 4LWCA 3CCVA 1WRIA 2WP9B 4XIGS 5ELEA 1GUTA 2N4FA 1BUVT 4JQWC 4K7WA 1ZEQX 3DHHC 3B2FA 4LMQD 1QOBA 5C6AA 5KEEA 1YJNA 4MGZE 3RMKC 4DV6Q 1SFOB 3U50C 3RUIB 3IRBA 3VR8B 4C2MH 1GUOA 3GTKB 5CGKA 3H1UA 4MJSB 4N9TA 3R2IA 3T1HQ 1WXAA 4OW0A 2V1CC 4C7YA 4MHEA 2F0PA 1K52A 3DQVA 2KDBA 3EQLC 1TWGH 5LMUQ 3HOXB 2OEOA 3M3YH 3VR9B 5JPNC 2B3AA 1YNND 2AQ2B 2K5DA 3SK4A 1EU4A 4FO2A 1OQRA 5JJLA 1WZ3A 2ZXRA 2KTRB 1TWCB 3ULJA 3KQ4A 5IY0A 4HPMB 4OGQC 1HFNA 2G4DB 1P16A 2F4VQ 1SAPA 3NPPA 4LF5Q 5HURA 1IBLQ 5IODA 2A8VA 2OEDA 1G91A 1VD2A 5JOBA 2WKCA 1JROA 4DR6Q 3VDZA 2QA4A 1ENFA 3ECIA 4J8QA 1GC6A 4WJ3M 1O78A 2M17A 3I5JC 3GDEA 1P9DU 3EN2A 1GHJA 1GUSA 1N36Q 2IX1A 2MUYA 5FO7B 1UZXB 4FJVB 4YXDB 4ZHPA 1YN3A 3C19A 2BTEA 2R93B 1IZ6A 5JJKA 2Y0SE 5KYIA 5A2QL 3JC66 1WGYA 4FULA 4XDDA 1B9RA 3N9YC 4DBGA 2M9VA 3V6EB 3OW2A 4A3EH 2ZW1A 1NMFA 3ICEA 2PW7A 2B39A 5E4XA 4C3JG 1UE5A 2ZVOA 3AE1B 3AECB 2Y0SB 2N1WA 3HOWH 4HJ7A 4QUCA 1AN8A 1S1QB 1F2MA 1F2ZA 1A62A 3TBIB 2IJ0A 3MXNA 2B2TA 1HPCA 2OTLA 2ZW0A 1TS5A 4A3LH 1ZXHA 3NSWA 1L2FA 4EQPA 4R4CA 2XWBB 3DM3A 1VQ8A 1Q0WB 1SJED 1B2TA 5BYQA 3T9LA 3UQBA 3M7NA 1I50H 1STBA 3BIID 1JQYD 4FXKC 3H7SA 3GTOB 2PZWA 3PGEA 2HQEA 3QJYA 2KQ3A 3CKIB 3K57A 4UP8A 2Z6KC 2C60A 5DM63 1RL2A 2G9DA 3V3XA 5C3WA 2VQEQ 3VR6A 2NVYB 1BUIC 5JJIA 1JOKA 3I4NB 4XQQA 1SSNA 4DAMA 3OW7A 4LF4Q 3HRDD 3A8JE 1FVIA 4DHJD 2F0HA 4M0WA 2JEBI 4BOSC 5M3MH 2JA8H 1TU2B 3E0JA 1G291 2XSCA 2NBWB 1PZJD 1WJJA 2CS4A 5CHWA 1Q8IA 1MSHA 1U4RA 4G7HC 2FCNA 2RD0A 3K5NA 4ANVA 2JU6X 1IGDA 4GKJQ 4IUVA 2B2UC 2KCTA 4B3SQ 1FNVA 5CR3A 1CA5A 4TSSA 2JRHA 1Q46A 4OO1H 1WR1A 3GD7A 3L0OA 3M63B 5G2NA 4RFBA 2WXJA 1EY0A 4DK6C 3PF4A 1WTHA 1K50A 2W3SA 2EOTA 1EUVB 2BYEA 1FL0A 5EPLA 1C4QA 4LFCQ 1SGHA 2DZKA 1YOVB 2WAQE 4ZUIA 2QIEB 2RSUA 5ELBA 1KJTA 4MT5A 3RULA 3VFKA 5LNK1 3OSOA 3QOJA 2BYVE 3CC2A 4RF1A 1BF4A 4KGSA 3C3LA 2WAQB 1BBUA 2B2VA 4C3HB 4K5VA 2Y3AA 3EA6A 4K8JA 3S1NB 4CKEA 1NR2A 2ZEQA 1YX5B 1LT3D 4CJ2C 2A6HD 2GBJA 3EFXD 2ASQA 4G57A 4ZLTF 1ZP0B 1HXYD 1VQAA 3K0YA 4FNFA 3UF8A 1CFMA 4C80A 3TMPB 3R3OA 5J1ZA 5TSSA 4J3OD 4OVVA 1PMRA 1SMXA 4W9FA 3H94A 1L4ZB 1SNDA 3EC8A 2I5HA 2CW0C 2K52A 2BE5C 2KHIA 1I4QA 2INCC 2WDQB 3PHXB 3MWYW 3BS1A 3T51B 2NVUI 5CV8A 3ZDTA 1DJRD 3L16A 1FRRA 4X64L 4CDEC 2WIIB 3KOJA 4HXDA 4YWGG 4GOPC 3HOVG 2NN6I 5HFYA 3S14B 5D94A 4AOFA 4X6AH 1HTOA 2JE6I 4X57B 1FCCC 4AH6A 2ACZB 1QCBD 2YU9B 5ISRA 3HHMA 2F0VA 1Y14B 2IPKD 2UU9Q 1JICA 1TS4A 1HZ9A 2VUMH 4IFDJ 3LYYA 1EYGA 4KDLB 4OVZA 4CO7A 1IP9A 4K2KA 4HROA 1CQVA 3KYCD 1PDQA 3HIZA 4GDLA 2EY1A 1P1AA 1A3TA 5CYUA 5GROA 2PQEA 1I4XA 5LMNL 2KMMA 1VDVA 4A3OA 5LXIB 4HPPA 1H9SA 2L0FA 3OJ4B 1NI2A 3ONAB 2CWAA 4HMJA 1QILA 5M3FG 4BVUC 2FIFA 1GD7A 1AH9A 1ZYRC 2LKVA 5J3BA 2Y5BB 3M4YA 1GNUA 1HZ6A 3L08A 4AUQC 5G55A 1DCZA 1O7IA 4O0AA 2H5XA 1DOIA 5C4JH 3J81L 3SK6A 3ALBA 2WXGA 3IG3A 1MIUA 4DF7A 2DNCA 1FD6A 4DV6L 2Q2UA 1A6XA 5D3IB 2FUG1 2NVQB 3DWGC 4XDXA 1U4PA 1WCMG 3A9KA 3P20A 4KV2A 3CXCA 4HRSA 1JQ4A 3OIQA 4JC0A 4B9XA 3FKYA 1PGAA 5L37A 5AUIA 4QL5A 1Q90A 3HOUH 5LMUL 2L8JA 3S17H 1UEAB 4OXPA 4GOPA 3EROA 1EYCA 2HHHQ 4IPHA 3MVVA 1AZPA 1T0SC 1B7YB 1VQCA 4JBWA 2JZZA 4XDCA 1FMAD 4CBVA 4P16A 5T1IA 4PNYA 3PV0A 4LF5L 4HCSA 4HCNB 2NN6H 2JA6B 3FILA 5HI1A 3ULLA 3GE8C 2FINB 2BH8A 3A7AB 1RJTA 3ZYYX 4B08A 3WANA 1HJPA 1LT5D 4J6IA 1KOTA 1IBKL 2OJRA 4JOIC 3I57A 1N36L 4OX9Q 2K50A 4PZ7A 1LTRD 5HGQA 3HOZG 2JYTA 3LDZE 3QIAA 4WH4A 4DK3C 4PZ8A 3DBRB 3Q23A 3AULA 1LTLA 4JPSA 4Z9CB 4IQZA 2UXDL 3GB1A 3CU7A 4EUTA 1YNJC 1WXQA 1ZGUB 3N1XC 2F3WA 4KIKB 3IAYA 2K04A 4IOIE 2KX0A 1WIAA 3PUXA 3SD5A 3N20C 2HDEA 5G3LF 2LS01 1FGBD 1OQQA 4BOZB 3I91A 5EAYA 4JI1L 1C48A 4LNKA 1XNQL 3U52E 3V61A 1FM0D 1MFWA 5CC4A 2NYZD 2N9LA 4XWWA 3D6CA 1V1PB 4MTNA 2FFKB 2HD5B 2J0MA 3H0GH 4DR5Q 1EL0A 2KHJA 5JVH3 1Q10A 4ZRJA 4Y52H 2CU1A 2DYMA 4A3JH 3AFQA 1SYEA 2RDBC 4RCOA 3IT4B 1SE9A 2J0TD 5BR8Q 2IHEA 2PI2E 3PRMB 1HZ5A 1WX7A 2EYFA 1E7UA 2EXDA 1ZDVA 4EZJA 2NZOA 1FXIA 4R8NA 1C1YB 3J7A5 2EYMA 5G5HA 3GTJH 3BZKA 3E9IA 3QB3A 4REZA 3RD2A 4NMZA 1TZ1A 4C2MB 1L2NA 2PTLA 1TKEA 3HUIA 4ZRPA 1VQLA 4A20A 4M8AA 1RF2D 3K59A 1WD0A 2B63G 1WX9A 3UINB 1VQ7A 1TWGB 2RPVA 1HZBA 3M3YB 1J8IA 4B3SL 1M4VA 1MPEA 4DXFA 2FMMA 2WXMA 4M8NA 3QWZB 3NZSA 3A74A 4ZYNA 2DY8A 1GJZA 1UWVA 3K58A 3H09A 5I6WA 1OEYJ 3I9V1 1G6PA 1V49A 1SMYD 2LXCA 4GSWA 2M00A 2QJLA 2YV5A 2QILA 2IDYA 4JI4Q 3PO2G 2QGQA 3CAMA 1X3PA 3MXUA 1LV9A 3S9WA 2Q2HA 2D2QA 1B53A 3T1YQ 2L12A 3SXHA 4GIVA 1KDBA 2RBMA 1BXTA 1KRTA 2L32A 1K8OA 1LO5D 4JK1C 4A3EB 3TN2A 1YVCA 3OYYA 4L5SA 3QCAA 3FKIG 1UF0A 3Q8CA 1LTBD 4A55A 1X3GA 3J81j 5BMHA 2UUCL 3HOWB 1JWUD 1ZOYB 4IM0A 3HGBA 4BY7H 1WSPA 3KJOA 4KKJA 2V3NA 1UNSA 1XMOL 2K4KA 1LTSD 2QHOA 1AP0A 1Q81C 1WGDA 4WIPA 2N7DA 4UHVA 1I50B 4BKSD 4DV4Q 2Z9HA 3ZXRA 2A74C 2K5NA 1EOVA 5FR6A 1NI3A 1C4CA 3G7LA 3PO3G 3A33B 3RR5A 5CHFA 1CHQD 5E3FA 1E8XA 4IKGA 3S16H 2VZKD 1VDZA 3URYA 5GADC 3AM9A 5DPTA 3FAHA 1QKZA 4IPGA 4KX6B 1ET9A 5M5YB 1ESRA 5ELFA 1Z2MA 2JT4B 2QF7A 1BKBA 2RR9A 1SNPA 4S17A 1M90C 3NQIA 4LUZA 5CV9A 2AMCB 4GOCA 1SXTA 4DAYA 4JW0A 3FC4A 4GDKA 2VH1A 4JWUC 3VUWA 2HT1A 3MC8A 4LDTB 3NRZA 4GGQA 5C0XG 5BYRA 5M3MB 2JA8B 4KKIA 4IJLA 4A3GG 2DGYA 1UWMA 1IYVA 2L3ZA 3ULPA 4A3BH 1J7BA 5K5PA 1T0QC 4HJ9A 3FDTA 5I2XA 2WXRA 4GDLB 4WJOA 2NZHA 2VNUD 3CRLC 4DR1L 1Q3LA 2R61A 2N7EA 1H9SB 3M3JA 1WTOA 5KHOA 1E8YA 1UE6A 5E1FA 1KAWA 3NBHA 3L2PA 3QX1A 2LWPA 5CBEE 1C8CA 1EM7A 1T5EA 3K9OB 3MJ5A 2TSSA 2MGSA 1KD1C 5KGUA 4RA8A 4OZBA 3V96A 5HKHA 1Y1VH 4DAPA 3GTPH 3Q3OC 3TP8A 3IT6B 2DUDA 4DR7Q 1EYAA 5JEAG 1YX6B 3HFZB 4R4IA 3GP7A 2KX3A 4S0RA 2WV6D 2L0CA 2R92H 4LFBL 2ZJRA 3N1YC 1IPGA 4K6LA 1EQRA 1YJ9A 1FFVA 3PV1A 2JF5A 1YHAA 4DV0Q 1UE7A 4LJPB 2KOLA 2WXKA 4HIKA 1P98A 3CCRA 4TKOB 2JA5G 1V5TA 2EKEC 5DEHA 5IYDG 2SOBA 4P74A 1L1OC 2DBYA 4N59A 4DXGA 2Q8IB 1K0SA 4I6PA 4GOPB 1N60A 4HSVA 4A3IG 3IFDA 2LZ6A 1XTCD 1E2WA 3EIVA 1WGKA 3L9AX 4HN7A 2E2IH 4BBSG 4WFN3 2KWUB 1QJOA 3W5UB 4AJYB 4IC7B 4QY7A 1Y8OB 1KLGD 4K14A 4HDOA 3RUZA 2QEJC 1NJIC 2GBKA 3FILB 3U7DA 1YNXA 4OIJA 4BBNC 3CPFA 4L5TA 2EY2A 1RD9D 3BK1A 3WIMA 2KEDA 4K2LA 1UELA 2F4IA 3SK8A 4GKKQ 4NZLB 1VZ6A 4UP9A 2AYOB 1DD2A 2L4NA 4IW0A 1OXTA 3ML8A 3VUYA 1XJVA 2VUMB 4DUYL 2EPBA 3P1MA 2JYEA 2F0OA 3LNNA 3AE9B 2L11A 1EIYB 3C0RB 1FPYA 3RCZA 2GRIA 1IW7D 1E22A 4C3JH 3GTMH 3TDQA 2NMQA 3NXWA 1SF0A 1HNWL 4K0KL 2AL6A 1V1OA 3S1QH 3C2PA 3PREA 2GN5A 3SE0A 2R2QA 1LXDA 1VZ7A 1PRTC 4ZRIA 2PE6B 4K3CA 3PMFA 3KUPA 2NBFA 2M0XA 3U30A 1YMHE 2KT7A 2CCZA 2AWTA 3WA0A 3VYTA 4NP5A 1PV4A 5FLXc 1E0BA 1TKWB 2WXFA 5IP9H 2ZCBA 1E2ZA 1EF5A 2GVBA 2IGHA 3IFTA 5C4JB 3CPWA 2JJQA 3ZTDA 1VQBA 3BDLA 4A3KG 3WOFA 1WH3A 1HZAA 1J5EQ 1XTDA 4OWWB 3JW0X 3VR2A 3RFZB 2QDFA 1JJGA 5FK9C 5DM73 4LF7L 1SNQA 2QDLA 1LTGD 4RWSC 5FLXE 1E1OA 3X3NA 2VY3A 3CMAA 3CCQA 3HOUB 1BR9A 2G5DA 4RH6A 5FLMH 4L5RC 3G71A 3B9JA 3PVLA 3S17B 4TKNA 3RYTA 3W5OA 3MC0B 4C1NI 4NNJB 3OTOL 4C3IH 2KD0A 4WJPA 4CKBA 1WJUA 2EY6A 1ILPA 4URKA 1E10A 2LVQA 3BVZA 1WE7A 4IOAA 2ZTDA 1FEHA 4JLCA 1I35A 1VS0A 4JYAQ 4RG1A 3X23A 3NWSA 1AW7A 4J1MA 3J80i 1I42A 3TCAA 1KRHA 1WF9A 4JGHB 2MP2A 4UDUC 2NS5A 4KZ0A 4TV3A 4MN3A 3RT3B 4N58A 4JI3Q 3T4AC 1TKGA 4G11A 1LQBA 3ZVVA 4DXAB 4I7ZC 2KDIA 3M4PA 4NXNL 1GB4A 1XLOA 3KBGA 1VJKA 2RDHA 1XF5L 3FVQA 5T1GA 3QQ8B 3M4QA 5KIXA 2RMMA 4LF8Q 3RNGC 4JBKA 2E2DC 3KLWA 3T8MA 1CMXB 4FXDA 4NQKE 3CCJA 2PJHA 4WJ4A 2WB1E 4DHZE 1WXVA 2KWVB 4J6HA 2KFJA 4JI0L 4K1RB 1TWHH 2K05A 2BDNA 2MO0A 1A8VA 2E6XA 1IKMA 1XXGA 3AE8B 1YJIA 2M56B 2B3GA 2WB1B 3AH7A 4DHZB 2XN9C 3CMMB 4OL7A 1KC8C 3DDCB 1BQQT 3NTHA 2INNE 1E8ZA 2EY5A 3H0GB 4OONA 4P75A 4POFA 1WYWB 3Q22A 2FAZA 3B1LX 4HJGE 3SR6A 4DV1Q 2UXBL 2SDFA 5EKKA 4LF6Q 4B3RL 1NDDA 1LABA 3Q0AA 1R4NB 3MTNB 3PHWB 2LJIA 4RGMA 3UGBB 4KY5A 3SFEB 4NB3A 2GI9A 5BO4B 3GQBA 2R7ZG 1K53A 3N52A 3RLNA 1Y1WH 4BAXA 2OF1A 2F0LA 4GN5A 1SDFA 3J7AV 3RD4A 2MBOA 4EKUA 1E7VA 2X6GA 2OOBB 1LT6D 4YL8A 2WWZA 3Q3FA 3I90A 2UUBL 1SYBA 2NTTA 2K33A 3KF8A 2LHDA 3NELA 5L95C 3SVMA 3GTJB 4BBNF 3CC4A 2YTVA 2DX5B 1KIXA 1TIID 1WWTA 2MO1A 3F2CA 2A4ZA 2OHFA 4G0NB 4AS1A 4A75A 5IYBG 3SHQA 2IHFA 1FXAA 3DUZA 1JW9D 4AQYQ 4R4OA 1CT1D 4NPNA 4YWMA 2I1JA 4MACA 4DPGA 1Z6HA 2DYOA 1FJGQ 1Q12A 1HA5A 4US8A 2A68D 4KKUA 1NBWA 4Q5VA 1EQTA 1JWBD 4HKZE 1MGSA 2GA4B 3NHHA 1HNZL 1RFKA 3MTSA 5M3FH 1A0IA 3D0FA 1S5FD 4XYOA 1QZEA 2XRSD 4YCVA 2AWOA 3TP6A 1PRTF 3HKZB 2MHVA 4B6WA 2CJNA 2V0GA 1PTOC 2EIFA 3NBHB 3KK7A 3H8HA 5DPSA 3TEYA 2KCMA 1TS3A 5EDSA 3PPAA 5C44H 1PDXA 3CF5A 1N34L 4EOYA 2KBNA 4C1NK 5IT9L 4DV5L 1WE6A 2A6EC 1WGRA 3C1FA 1EQVA 3KLSX 3JSVA 3HOYH 1HFGA 1QZGA 1NUCA 5EE1A 4RM9A 3CRKC 2AUJD 1R9TH 2H89B 1QWYA 5H1SE 4ALPA 3I4LA 3K7UC 3FRPB 4O42A 4JIOU 5A2QE 4BY7B 4FHJA 3Q14C 2WXNA 3RZDH 3BY4B 1J6QA 3Q8AA 5JZEB 1K3RA 3RNAC 4W9HA 1STYA 2KTFA 4LUOA 1PHJA 4CJ1B 2FUHB 3A9JB 4P72A 1D5ZC 4A3FH 2B2TC 3CW2C 3ZKJC 4ZKCB 3BG3A 3NUHB 2K7VA 2HIXA 3FP9A 2K9XA 4K7UA 5H8YE 2IZVB 1MVKA 2DENB 3S16B 1TY2A 3VA7A 3BK2A 1Q82C 1C76A 1DOYA 3MHSD 2F0JA 1A2UA 2R93G 3CCSA 2ICIA 2JZ3B 1ENCA 3TJPA 4BKGA 1D5MC 1GKHA 1I4HA 2PVOD 2W9NA 4L1BA 4A3BB 1GO3E 4KDIC 1G6ZA 1VQFA 3VH4B 2Y0SG 3GTQH 1IBMQ 1LTID 3NJTA 1I5FA 3TRZA 1YNTE 3AEDB 1HTPA 4LW1A 1JMCA 5IP7H 3KWLA 1CUKA 2WINB 5FJ8H 2J52A 2NPTA 2PW5A 1XPUA 4W9JA 1WI5A 4FADA 2EDGA 5LL6X 2DZMA 4ICUA 1R7SA 2BS2B 4BY1H 2RSOA 4H44C 4CDFC 2NVTH 2K39A 4CHKA 1BO0A 1UD7A 3GZNI 4KGTA 1F52A 1V5OA 1RFAA 2E74C 1Y1VB 3GTPB 1BMLC 4MEMA 1YIWA 5I9OA 3DBLI 4KKTA 2D3CA 2LMCA 1HTLD 1F9QA 1L1OB 2J0JA 2VL6A 1YEZA 3J7YW 2R92B 3KH0A 3A5ZB 1YQ4B 1GPXA 2UUAL 1NMGA 4JBMA 1N33L 4A3CG 1T0YA 2MJ3A 4M1UB 5ELCA 2CR5A 3C46A 3KF6A 4ARIA 3NVYA 2HCIA 3KVFB 2JRIB 2KJHB 2BQQA 2C7MB 3L10B 1DZ1A 4R4QA 3R8BA 3MFYA 1WJNA 1BVSA 2B2VC 3JAML 3AQQA 3MXGA 4DFAA 4FF3A 1S3SG 4AWJA 3Q3NC 3S2AA 3B2GA 2RF4A 3PSEB 3PUWA 5C0XI 1WTPA 3PZDA 1X54A 3A1QA 3B08A 2LXKA 3HS0C 1HTQA 4DN4M 4X66Q 2ZT9C 4F88A 2EKIA 3P4QB 4DV7Q 4GNXC 1IGCA 3AU7A 2LUEA 2MP2B 4HJKA 3EUB2 3DMUA 2P5ZX 2J4XA 3DEOA 2MX2A 3PO2H 1IBXB 1Z47A 1PFBA 1SN8A 1WRDB 4MDKE 4O1NA 2Q8RE 4WWNA 4LJOB 1PTOF 1TT2A 1KXLA 2JSOA 1AARA 1PRTB 1JRPA 4A3PA 2BA1A 5C4ZA 1ISNA 2WAQG 1EF1A 1Z9FA 3AN1A 4C3HG 3DWMA 4JV5Q 1M8AA 4HAEA 2M8SA 2WXIA 2MRPA 3CCMA 4C3JB 4NXMQ 1PYSB 4QQBX 3GTMB 1UH6A 3VUXA 3WAMA 3NG0A 4B3TQ 3PZ7A 3MC9A 3S1QB 1KM7A 2XIWA 1NY4A 4RKLA 5E4WC 2MCNB 4ZCKA 2O6VB 4ANWA 1HNXL 1N61A 3EECA 1E7ZA 2JN4A 1XX8A 1JB7A 2Z59B 4MM3A 4WORA 2WDVB 1MD2D 1R4QB 4HSPA 2KDMA 2F0EA 5I9PA 3DHIC 3S1MH 3L4PA 2EJGC 2KFKB 4LNFA 2KOXA 5A35A 4N6EB 4CQNA 1BCPC 1IKLA 4NDXA 2CKHB 1VQHA 2DAJA 1E0ZA 4RGNA 3KWVA 3PQIA 2MNAA 2M19A 3PO3H 3L7ZC 1D3ZA 4ZQ3A 4W9DA 1F1HA 1KFYB 1CSPA 2JA7G 2N9XA 4AIMA 4HDQA 3F8TA 3L0WB 1V8QA 2PE9A 1TQOA 3QARA 2F0QA 4GN1A 1SBBB 4BXXH 4MH0E 3M85A 2FBWB 4A3DG 5D7GA 3RMHA 4AQYL 3A8IE 4YHHQ 1WFYA 2KC1A 1EZ8A 3PIOA 4QB4A 4GNXA 1C4AA 1DGJA 1XD3B 4WQMA 2YTXA 4JI2Q 5CX3A 4C4VA 4C3IB 2E5LL 1E3PA 4M01A 5C0XH 4JI6L 1KH0A 2BW2A 1JB3A 3P7JA 2EMTA 1K51A 1P7FA 2VRRB 4OZAA 2V4IB 1D8LA 4DR4Q 5K36G 4OVUA 4EEWA 3ZNGC 4LCDE 4E74A 1OO9B 1TGZB 2F0SA 2E2JH 3M4OH 4II2B 3ZRCA 5J17A 3GTLH 4AQ7A 1P7EA 4MSQB 3MAQA 2EYHA 4I6NB 1XCTL 1QUQA 3ENEA 1D2BA 1HRJA 3FEWX 3EFUA 1TY0A 3H9DA 1XNRL 2L76A 3O13A 5EPKA 4FF2A 5CORA 1MHXA 2MPMA 3DHQA 3VR5A 3BINA 4HPLB 1QT9A 1RCVD 1WGHA 4USAA 2OWOA 1YJ1A 4UP7A 5JJZA 2A69D 2GOWA 4KY6A 2XEWA 1TWHB 3CP0A 1LACA 3VYUA 1D1IA 2V4DA 4JVZA 1FNUA 3JSVB 5CTRC 3U7ZA 5IGFA 3G6JB 4BBRH 2ZM6Q 4IUPA 1FIQA 5IYDH 3NS1A 1C0AA 2KQSA 2L83A 1J8CA 1PH8A 3PS6A 4A3IH 2RPQA 2ZXOA 1YITA 4N8FA 4BBSH 3Q3JA 4P1BC 2JA6G 3I3CA 1UAPA 3NP8A 3S2DH 3NUCA 2KCNA 1WFQA 1X6OA 1Y1WB 2D5DA 3IBEA 1DOMA 3T1HL 4DV3Q 1WTVA 1AWDA 3I4MH 1WJ4A 3LX0A 4DNRB 2Z6BA 5EKIA 5C3XA 1PH5A 2CHXA 2KYWA 1OTCA 2R6GA 1YJJA 4GU2A 2Q2TA 3HRZC 2LRWA 2EE1A 3QHTA 1GC7A 3P4PB 3RZFA 1B3QA 3DXJC 4DV2Q 2RCFA 2R3ZA 3DM1A 4XYQA 1JE5A 4ID6A 4QJFA 2K0PA 4WQOB 3ZJUA 2F4VL 3AE2B 1IHZA 1SNMA 1YZ6A 4X3UA 1IBLL 4XQJA 4JI8Q 2FHTA 4JI5Q 5C5LA 1XLQA 2G3QB 3AFPA 1QOFA 4PMCA 4DR6L 2C5LC 1II3A 3E0EA 2QSDA 1X65A 4H7BA 1TS2A 4HTHA 1HE8A 3J80c 2RHSB 4MELA 4G3XB 5C2TB 1PH3A 5M3FB 2KQ4X 1K3BC 2F52A 3ERQA 3ND8A 2BS3B 3DOWA 4B9WA 1X56A 1RAXA 3DVNV 3TEZA 3TZUA 2JK8A 1IL2A 5C3EH 4EZKA 3R93A 1K9MC 1W2BA 3CCUA 5ELNA 1A63A 1T0RC 5C44B 4A3KH 5COYA 2RDFA 1BCPF 3J80E 4JE3B 2LMCB 1E7PB 1JR0D 1HH2P 1SYFA 3G48A 4IOCA 4A93H 1Y8RC 1G6JA 1LM8B 1W6JA 1DGSA 3HOYB 1L5PA 3ZNHB 4OZCA 2MQHA 1LUZA 3CCLA 2B29A 2CH4W 1R9TB 1TTNA 3H6MA 3MXNB 3S15H 4ZRQA 3ONSA 2K5VA 5JH5C 4B3MQ 1STNA 2ZTCA 2D0OA 3I70A 2JQRB 2M2LA 2JVCA 3ZUNA 2Y5PA 3RZDB 2K03A 3CCEA 5IOCA 1GJXA 2KLGA 4K5XA 2VQFQ 2LUMA 2HE7A 1CK1A 2VQEL 3ZNZB 1B9NA 4A3FB 1WYGA 1KDAA 2EYLA 2RCNA 5C4HA 3AE4B 4LF4L 4R9WA 3Q3MC 3V6CB 3QJZA 1PYBA 3STBC 3PUVA 5GAEC 4YY3Q 1JJ2A 4D2KA 4P7IA 4R3DA 2IY5B 4HK2A 2XRQD 4N8X1 2GBRA 3APCA 3OPOA 1X9NA 3ZIMA 1XCQL 2KCCA 3APDA 1WOCA 3K80C 1U0LA 2PPBC 4GKJL 1OTRB 2K25A 4M0WB 4US9A 4ZHOA 2HTME 1DOLA 2K5WA 2L15A 1Q8KA 2Z0SA 4I6LB 2N3SA 2W82A 3D4RA 5FR3A 1YBYA 2N8NA 2L1AA 1N32Q 3GTQB 2L7RA 1F9PA 1DONA 4KHZA 2G45B 1HR0Q 3DHGC 5JXVA 4KVGB 4LFCL 4WJWA 4A3LG 2DY7A 5JHBA 3M95A 5EQ0A 4BY1B 4XC2A 5CV7A 2NVTB 1SJHD 3OAWA 1LFDA 2M1MA 3IL8A 3R3MA 2E76C 1XEEA 5KYLA 3QA8A 2BT6A 1RKNA 3S24A 1QVGA 4A9AA 4MGYE 3NVVA 1MG4A 3H91A 4YWLA 3AXCA 1FGUA 4N9F4 1K8GA 3QOLA 2LASA 2EJMA 4KD3A 1SYCA 4OWTB 4YHHL 1Q1BA 4JI2L 4LF9Q 1U4LA 4KI0A 2YEPF 1S40A 4APVA 3AE6B 2BB6A 1SYGA 5M5WH 1ZE3D 5DPRA 2Z1CA 2SNSA 5DLQE 5M3MG 2JA8G 2BF8B 1RRBA 2RKSA 1QLBB 4C4VB 4YCWA 2O2VA 1C7YA 1VF5C 3A54A 4AYBG 5IGEA 1WM2A 3AMZA 3DVGY 4PMWA 3HKSA 3DWPA 4HIDA 1KLVA 3N1ZC 2MBEA 3B6YA 3KDFA 1B44D 3T53B 4PG3A 1PGXA 1A15A 2UU9L 4ODGA 5IYCH 4OO1G 1ICWA 2LD9A 4ZOHC 2MFIA 2DJFC 4L2YA 2JX5A 2W54A 3EFCA 1JRUA 4B95A 4TQUS 1K8RB 1QUQB 4B9KA 3PO2B 3RLFA 4NAWA 4KK7A 1XPRA 1T5XD 4KHPQ 1YNNC 1F9JA 1N5XA 5IN7A 4JPBW 1SNCA 1HUMA 4JG2A 1PH6A 1PVOA 2RDGA 3NTIA 5KRUA 1WM3A 4BKTA 4ZKBB 3BYYB 3AEBB 1JWSD 3SK5A 2ZM6L 4IUMB 2D3AA 1VQNA 2ZTEA 3EBEA 3S2HH 2BPSA 1F2RI 1BCPB 3OMCA 4RHSA 2KWCA 2DYBA 2Z8LA 2N88A 3D4WA 3B0AA 3AU4A 4KHVA 3ZRFA 3N6RA 3J81i 1CI3M 3FHWA 1GHKA 1V8CA 2ASBA 3VDYA 1STAA 1RWSA 3GV3A 1MJDA 1WY8A 4ME5A 2HDLA 4DR3Q 1N62A 3UDGA 3R7QA 3K5OA 3ZLZA 2J7ZA 2I0QA 4N9PA 3S1MB 3NVWA 4TQ0A 4K6DA 2FMCA 4A90A 2D9UA 2K6QA 2EQSA 4A3MG 1SROA 1FYCA 4FF1A 5DCNA 1JWAD 2NBVB 3VTVA 2E3TA 2WXLA 2NTSA 3PO3B 3BVGA 1YIJA 1FR3A 3TSSA 2I38A 2N9EB 1MSGA 5IOIA 2HHHL 2QW7A 2TMPA 4XTCS 1RM6C 2V9HA 4BA1I 1MG8A 2ZVNA 3A9KB 4LDTD 4DUZQ 1XYIA 2E75C 2VB2X 3W1SA 1CQFA 4ZRZA 4IUNA 3S1RH 1QZHA 4JI8L 2VUMG 1NENB 4GLSC 1J0GA 5ELDA 3I3TB 1V43A 3AEAB 1RYJA 3VHTC 1PH1A 1WTQA 3W1BA 1M1KC 1I94Q 5F2DA 3NY5A 2KLCA 3AE5B 5G3LD 3V2TA 2QCZA 1A2TA 4ZUJA 3E9HA 4QCLA 3PTFC 5CHVC 5EE0A 4OX9L 3RN9C 5GAGC 2O5JC 1CKNA 5AJ3Q 3J9CA 3TEWA 1EIGA 4CHTB 3WAOA 2E2JB 3M4OB 2M4NA 3IHPC 3IXSA 4DQOC 2B2WA 3T13A 3GTLB 4DDID 5I4DA 4RM8A 1S5DD 5D3DA 5IWAQ 3NZ3A 3K8AA 2F0FA 1JJCB 4I65A 1CKOA 1JOOA 4M02A 2LVOA 4OELB 2VXWA 1A3UA 1EY7A 4KN7C 2ONQA 1O7YA 4PV1C 2CW0D 1MHHE 2BE5D 2IWHA 2FNJB 2JPHA 4IDIA 1NAPA 2MBQA 1LTTD 4DR5L 1SEBD 3WALA 5DPWA 2N55A 2NVYH 3LXFA 4ULLA 3PO0A 1TT5B 1GB1A 1XMQQ 4BS9A 1JALA 2JSVX 4MJSA 4YSXB 3HOUG 4X3KA 1AEXA 2CFMA 4BBRB 2DAFA 4JWSC 5BR8L 2L1BA 1YQBA 1F2RC 5JAVA 1EIHA 2IBIB 1GUGA 5LXHA 2N78A 1AE3A 2YEPB 1Z5SB 5ELOA 2KXJA 3CD6A 4A3IB 1ZW7A 2QEXA 2RHQB 4K81A 5IKCM 1IL8A 2KTRA 5J39A 1KABA 4BBSB 1QOHA 3SDZA 3TMEA 4YY3L 1VQKA 3S2DB 3PLVA 3ZTCA 4FA6A 1ILQA 5D2MB 2A6HC 3WWVA 1E2VA 1GAQB 4HKQA 1N63A 4WAFA 5E6PA 1LM0A 1EIFA 3I4MB 1VQMA 2SEBD 3LB8C 1VCBA 1ML0D 3VQIA 2JXTA 2K1FA 2K6DB 1ZYRD 4NJCA 4U673 5C4XG 3VTUA 2K8BA 2K6AA 2UU7A 2MQJA 4PZ6A 3FPUB 1N32L 3MEFA 3P42A 1L6UA 1H4RA 4PYUA 2ZJQA 5D6JB 1ZXIA 5GMVA 2WB1G 4R1JA 4JI4L 2PMVA 1WYDA 4TMAB 3RNFC 4IUTA 1PXUA 2ZXPA 3DVNU 1X55A 4FXCA 3RNCC 3T3NA 5FO8B 2NB0A 2H4OA 1UE1A 3T1YL 3RZOH 2KNBA 3P4SB 5AZFA 2D3BA 1Q5WB 2ATWA 2NCNA 2C35B 2L0TA 3PT2B 3AB9A 4F1SA 2BWFA 4H02A 1KAAA 3TEHB 5C3EB 1P8LA 1WXMA 4EZLA 3MP9A 4U68A 4PK1A 4KD4A 3NS8A 4HVBA 2V4LA 1A5RA 1FCLA 4BA2I 1LLRD 4A3KB 2WACA 2CKZB 3JYUA 2WP8J 5IP4D 3PUYA 2JA7H 4A93B 1PZKD 1N6ZA 4L23A 3NQTA 1PGBA 1HZCA 3HG9A 5IGGA 5FO9B 4A3DH 5J2RA 4QAYA 1LGRA 3S15B 4DV4L 4RGOS 4W9CA 3HZXA 1ASYA 1UWXA 4A4IA 1G51A 1OXVA 4A3JB
chains in the Genus database with same CATH topology
2JEAI 1YNJD 2K01A 2CVRA 2C9OA 4IN3A 5JPMC 3FMCA 3W3AA 1FFUA 5CV6A 1TVXA 3HP3A 4B0MA 1L0YB 3DWAA 4QUFA 1QOGA 2H88B 4TQ1A 3A7LA 5FLXL 1A70A 5KNCA 5I2YA 4GDKB 1L0VB 3VYRA 1F2LA 3UI3A 2EYPA 1PTOH 1C78A 5AFWA 3MEHA 5LL6S 3P4RB 1CZPA 2I2YA 1DM0B 2B8GA 4XWTA 2FJ2A 2KA7A 1VRAB 4YTMB 4HEA1 4TRDA 5H92C 2PNRC 3GV6A 5BN3A 2KACA 2OXPA 2AQ3B 4GZYC 2MJEA 1PYWD 3SR1A 3BWUD 2PVGC 1NYQA 3D3RA 1Q1EA 4OHJA 3A8KE 4YSYB 4UAIA 1E9MA 3DWQA 5M5WB 4S3SA 3WOEA 5AUKA 2KECA 2IX3A 1D6EC 2F0IA 3WDNA 1G8ZD 1D4BA 2Q8TA 3D31A 1NSNS 3EJIA 3T3OA 1GOZA 2SAKA 2V3PA 2WQYB 3SFDB 2M0AA 1ZUD2 3BDCA 2IW3A 3M7GA 4FYDA 3T16A 3JAME 5DNFA 4DNTB 1FO4A 3PIO3 3IAM1 2N9KA 5EKLA 3OMGA 2EZVA 3VYSA 1H9JA 2RSNA 4ZAIA 3TZDA 2EELA 4LJZC 4HMIA 1F2YA 3UI2A 1SMYC 2Y5CA 3J7AF 2EYOA 3S2HB 1T6BX 1B4OA 3VR3A 2RA4A 1O7ZA 2KJXA 2AUKA 2KN4A 2O2LD 5CMDA 2L9HA 2PZTA 2DLBA 4FP5D 2BYTA 1YN4A 2J42A 1PLFA 2PYKA 1Z7TA 1CHPD 4H0LC 3PZ8A 2KVMA 1O7LA 1PZID 2ON8A 2H1EA 3ZGZA 4OO1I 4LTUA 3S1RB 3HEJA 4CKCA 2IT1A 1CA6A 2VB3X 3KBXA 2E2IB 2KHSA 2LFNA 5C3JB 2IX0A 1QE6A 4RAUC 1JMLA 1V1PA 4RNAA 1EY4A 1VR9A 1C9FA 3NWTA 4C56C 1SB3C 2K5PA 5T8IA 1I4PA 4XQNA 2BA0A 1CZGA 1ZXTA 2RVLA 1W6KA 5FKAC 3D8GA 1RTNA 2O4XA 3E6ZX 4HR7B 5NUCA 3W2DA 4XXEA 3DEPA 1J7AA 3P63A 3TP5A 4KN4C 1QG7A 1SIJA 2KUMA 3BYTB 1NYRA 1F9SA 1DOXA 1ROEA 1J7CA 1EFID 4C3IG 2J53A 1ONLA 4L8JA 5D65A 3TP7A 2PLPA 4DU9A 4RCNA 2EYJA 4NKLA 1VCIA 1NCVA 4KJNA 1PFNA 1IUEA 4K5WA 3J81E 1PRTD 1ZPSA 4HEDA 2D2CC 2F0GA 4R8IA 3MZ5A 1IYUA 1TYGB 3GS2A 5G5GA 2IGGA 4A6QA 4FVMA 1YQ3B 2FE8A 2LY7A 4WRDA 1D5XC 5CV5A 2BOSA 4IUQA 2IGDA 1QF6A 4X3SA 3MHZA 2PMZB 2WXQA 3HVDA 3RZOB 2NUCA 3LWEA 4MH8A 2BBCA 1MBYA 2LGIA 3OIPA 2BS4B 3MHBA 4XT3B 5JEAH 3IKJA 1IW7C 3E5SA 1L6VA 4LK0M 2MEKA 5DAUA 1LT4D 2LFIA 2MP1A 3FPPA 3HVZA 2JA7B 1KLUD 1OXXK 1V97A 4BWGB 2B2UA 1Y69U 5FOBB 1WTXA 4A3DB 4YTPB 3Q6SA 2PZUA 1XWEA 1OXSC 4QIWB 2G1EA 1KDCA 4IFDG 4XT1B 5CBAE 3GO5A 1I3QB 1SE3A 4CJ0B 1JCKB 4PQXA 4XE0A 1SSOA 2OT2A 2WU2B 4FXGC 1F9RA 3HOVB 2K5QA 1HA6A 5GXGB 2JWUA 5BYSA 1FNWA 1WVLA 2PCFB 1AZQA 4CGYB 3AEFB 1GXDC 4X3TA 1PTOB 4WWMA 2MH7A 3CWIA 1F0ZA 5D14A 5CV4A 2F0MA 3SHLA 3PUZA 1VZ8A 3F2UA 3ZQ4A 1S5CD 1Y56A 2K28A 1QQRA 1SYDA 1CZWA 2B8FA 4DK0A 2Z4HA 1EEID 2WXHA 2F0WA 2N0SB 4K8IA 3C8YA 5EBCA 1NVID 4LLGM 4JX1C 4Q2JA 3VA5A 4KKSA 3SEBA 3A56A 1U4MA 3TEYA 1CTMA 4RHRA 2BB5A 3Q8EA 2F03A 2L55A 1J9OA 1WCMB 2EJFC 2W55A 3Q8BA 1ACCA 3WCQA 2G9HD 2A73B 1KTKA 1QNKA 2ID0A 1I6HB 1HHVA 4RF0A 3IAS1 1S5BD 3KLRA 2E2HB 2W3RA 2L5TA 3LWUA 1CJEA 1PTOD 1TJEA 1Y8NB 4DA2A 2CU3A 3U9SA 3AEGB 4P2CB 4PT5A 5EE3A 2WXPA 5EGTA 2A6ED 5BMGA 2CHBD 1BNZA 1EY9A 2EVBA 4F87A 1PFDA 1B3AA 3HOZB 2AQ1B 1D1KA 2ENBA 5M9OA 4EE2A 3NTKA 3K5MA 3NVZA 1EY6A 1LTAD 1TR5A 1VLBA 3C1EA 2F0TA 3I73A 1Y8PB 2QDBA 1WTWA 4KMUC 4YSZB 3AV8A 2A68C 1CM9A 2AWNA 1WD1A 1A3VA 4RKBA 1RODA 1C79A 3K5LA 1QNUA 3NE5B 1SE4A 4G4KA 4L6TB 1OFFA 3X3MA 3D6WA 1RTOA 1PUTA 4MM3B 3BDOA 2K1BA 1HUNA 4ILWA 1EYDA 2WDRB 3E56A 5BN5A 2JYOA 5JVG3 5EJWA 2QMTA 1FD7D 4YT0B 4KV6A 3J80L 2A5HA 5MPOA 3D4DA 4KY7A 2NWGA 2VZKB 1TWFB 2B63B 3VRAB 5LHY1 1I4RA 2KWDA 1E6EB 1N5WA 1H9KA 4Q0FA 1QB5D 2XNAC 2D5GA 1JORA 4DGZA 1EWYC 2N7JA 2QCPX 1O80A 3ETRA 1DXMA 1K83B 3AE3B 3Q8FA 3ABVB 4E6IA 1HQRD 2DN8A 4EGVA 5C0XJ 1EY8A 3U2SC 4WURA 1QOAA 2YYZA 4EVOA 3GTGB 5I6YA 2K3UA 2B2WC 3MFGA 2L52A 2HDMA 1HCZA 2WS3B 2KEEA 3FKIB 3OWFA 5JEAJ 2LHEA 1K8MA 2I07B 3U4EG 1JE4A 2NVXB 3ITPA 1XO3A 2B2YC 4AYBB 4EQOA 4QMGA 2F3VA 4IUUA 4DAVA 2F0UA 2MJ8A 1NR4A 1X32A 1HQMC 2NZ1D 5BN4A 5BMIA 2DWQA 1XLPA 2SNMA 2D62A 3R2TA 1L0XB 4G7OC 3I8ZA 1G2TA 1U9RA 4A3GB 1BCPD 2RQXA 1B9MA 3V05A 1GUNA 1STHA 5IGDA 2GB1A 2HUGA 3ZJVA 2K32A 3EGRA 1MI2A 2O5IC 2QKIC 3CQZB 3K7AB 3AMUA 3VRBB 1EU3A 4IURA 5IIFA 3QO2A 1STEA 1JC7A 3KLSA 1HEZE 3NBIA 1EEFD 3VR4A 4A3MB 1TKYA 1XLNA 2DNEA 4ABNA 1AFPA 1RHPA 5EE9A 3QWNA 2JXMB 2B2YA 5HGTA 1JWMD 3W5VB 1ZKOA 3L3OC 4LK1C 3OWEB 3ZJTA 2JA5B 4EQNA 5E6JA 2BDOA 3Q69A 1KNAA 4H13C 1I6VC 5M5XB 2NN6G 1DOKA 2MJDA 4L63B 1FRDA 2Z4IA 2PKOA 5HHDG 2JP1A 1I7HA 1SNOA 3T56B 1DYQA 3I72A 1UGJA 3TEXA 2X69A 4KGRA 2JZPA 2XVSA 4V0BA 4F7XA 5EBDA 2HCCA 4DK1A 5IGBA 2WNMA 1KF6B 1YN5A 1ET6A 2EXZA 2INPE 4Y7NB 2XWJB 3P1HA 2F0KA 3OOCA 1GUWA 1B50A 2BCOA 1S5ED 4ITKA 4ZYSA 2A69C 3RPFC 2K22A 1VMCA 2B76B 4IFDI 2F0NA 5KNBA 4F8MA 2AX5A 4G7ZC 1IBXA 4YIJA 2F0DA 1MI0A 5IT9E 5C4XB 4PMBA 1R4PB 1WTRA 1S4ZA 3P75A 5IGCA 5C5MA 5K36H 5EPJA 4B0EA 1AYFA 2Q5WD 1ESFA 4V190 4HCEA 3AE7B 1L4DB 3W9CB 4KTAA 4ARCA 4NW2A 1I4GA 2IL8A 1ENAA 3CIRB 4C7ZA 1H9RA 3MXPA 3MA2B 1BBXC 1B1ZA 1EWHA 1TWAB 3BVMA 4NAWB 1PFMA 3AEEB 2X38A 2LEKA 4YTNB 1NEKB 1JOQA 3NK9A 5KNDA 3Q24A 1EY5A 1STGA 2PO4A 3BZDB 1X3QA 4P6VF 2C5CA 4KJOA 1KNEA 1UUPA 3A55A 2KAJA 3AB5A 4OIKA 4IZ8A 4RGTA 4QF4A 1EWCA 4LAAA 4IFDH 2R7ZB 2I46A 3OHXC 3U9OA 2WKDA 2WLBA 4NAMA 1VF7A 4IALA 1C4PA 1BDOA 4A8XC 3EVQA 2PW9A 1BOSA 1VMPA 1TZOA 2ICEC 5J22A 3QG1A 1OXUA 3K6OA 1ZDXA 1F77A 4MIUA 3H3VC 5HG2A 2WXOA 1C77A 2CJOA 1T3QA 3CHBD 2F1MA 3ND9A 4ZK9B 1G2SA 1RDPD 3PIP3 2PIAA 1EOTA 1SE2A 2WU5B 4FF4A 3TUOA 1EZ6A 2X6LA 4H2AA 2CQAA 3E9SA 1H9MA 1WRIA 2WP9B 4XIGS 5ELEA 1GUTA 1BUVT 1ZEQX 3B2FA 4LMQD 1QOBA 5C6AA 5KEEA 1SFOB 3VR8B 1GUOA 3GTKB 5CGKA 4N9TA 3R2IA 4OW0A 4C7YA 4MHEA 2F0PA 1K52A 3EQLC 3HOXB 2OEOA 3VR9B 5JPNC 1YNND 2AQ2B 2K5DA 3SK4A 1EU4A 4FO2A 1OQRA 2ZXRA 1TWCB 3KQ4A 4OGQC 1HFNA 1SAPA 3NPPA 5HURA 2OEDA 5IODA 1G91A 5JOBA 2WKCA 1JROA 1ENFA 4J8QA 1O78A 2IX1A 1GHJA 1GUSA 4YXDB 4ZHPA 2MUYA 5FO7B 2BTEA 1YN3A 2R93B 5KYIA 5A2QL 4XDDA 1B9RA 3N9YC 2M9VA 2ZW1A 2PW7A 2B39A 5E4XA 4C3JG 3AE1B 3AECB 2Y0SB 4QUCA 1AN8A 1F2MA 1F2ZA 3TBIB 2IJ0A 3MXNA 2B2TA 1HPCA 2ZW0A 1TS5A 1ZXHA 3NSWA 4EQPA 2XWBB 1SJED 1B2TA 5BYQA 3M7NA 1STBA 3BIID 1JQYD 4FXKC 3GTOB 2PZWA 2HQEA 3QJYA 2KQ3A 3CKIB 3K57A 5DM63 2G9DA 3V3XA 5C3WA 3VR6A 2NVYB 1BUIC 1JOKA 3I4NB 4XQQA 1SSNA 3OW7A 3HRDD 3A8JE 2F0HA 4M0WA 2JEBI 1TU2B 3E0JA 1G291 2XSCA 1PZJD 1Q8IA 1MSHA 1U4RA 4G7HC 3K5NA 2JU6X 1IGDA 4IUVA 2B2UC 1FNVA 5CR3A 1CA5A 4TSSA 4OO1H 3GD7A 4RFBA 2WXJA 1EY0A 1K50A 2W3SA 2EOTA 5EPLA 1C4QA 2QIEB 4MT5A 5LNK1 4ZUIA 5ELBA 3OSOA 3QOJA 4RF1A 1BF4A 4KGSA 3C3LA 2WAQB 2B2VA 4C3HB 4K5VA 2Y3AA 3EA6A 4K8JA 3S1NB 4CKEA 1NR2A 1LT3D 4CJ2C 2A6HD 3EFXD 4G57A 4ZLTF 1ZP0B 1HXYD 3K0YA 4FNFA 1CFMA 4C80A 3R3OA 5J1ZA 5TSSA 4J3OD 1PMRA 3H94A 1L4ZB 1SNDA 2CW0C 2BE5C 1I4QA 2WDQB 3MWYW 3BS1A 3T51B 5CV8A 1DJRD 1FRRA 2WIIB 4YWGG 2NN6I 5HFYA 3S14B 2JE6I 1FCCC 2ACZB 1QCBD 2YU9B 5ISRA 2F0VA 2IPKD 4IFDJ 1JICA 1TS4A 4OVZA 3LYYA 4K2KA 4HROA 1CQVA 1PDQA 2EY1A 1A3TA 5CYUA 2KMMA 2PQEA 1I4XA 1VDVA 1H9SA 3ONAB 4HMJA 1QILA 1ZYRC 2LKVA 3M4YA 1HZ6A 1DCZA 1DOIA 3J81L 3SK6A 2WXGA 4DF7A 2DNCA 1FD6A 1A6XA 5D3IB 2FUG1 2NVQB 3DWGC 4XDXA 1U4PA 3P20A 1JQ4A 4HRSA 3OIQA 4B9XA 1PGAA 5AUIA 1Q90A 1UEAB 3EROA 1EYCA 3MVVA 1AZPA 4JBWA 4XDCA 1FMAD 4CBVA 4P16A 5T1IA 4PNYA 3PV0A 4HCSA 2NN6H 2JA6B 3FILA 5HI1A 2FINB 3A7AB 1RJTA 3ZYYX 4B08A 1LT5D 3I57A 1LTRD 2JYTA 3QIAA 4WH4A 3Q23A 4JPSA 4Z9CB 4IQZA 3GB1A 3CU7A 1YNJC 1WXQA 2F3WA 3IAYA 2K04A 4IOIE 3PUXA 2HDEA 5G3LF 2LS01 1FGBD 1OQQA 3I91A 3U52E 1C48A 1FM0D 5CC4A 2NYZD 2N9LA 4XWWA 3D6CA 1V1PB 2FFKB 1EL0A 5JVH3 1Q10A 2DYMA 1SYEA 4RCOA 3IT4B 2J0TD 1HZ5A 2EYFA 1ZDVA 1FXIA 4R8NA 2EYMA 5G5HA 4REZA 3QB3A 4NMZA 4C2MB 2PTLA 1TKEA 3HUIA 4ZRPA 4M8AA 1RF2D 3K59A 1WD0A 1TWGB 2RPVA 3M3YB 1J8IA 1MPEA 1M4VA 4DXFA 2FMMA 2WXMA 2DY8A 3K58A 3H09A 5I6WA 3I9V1 1SMYD 2M00A 2QJLA 2QILA 2IDYA 1X3PA 3MXUA 1LV9A 3S9WA 1B53A 2L12A 3SXHA 1KDBA 2RBMA 1BXTA 2L32A 1K8OA 1LO5D 4JK1C 4A3EB 3TN2A 3Q8CA 4A55A 1LTBD 5BMHA 3HOWB 1JWUD 1ZOYB 3HGBA 1WSPA 4KKJA 2V3NA 1UNSA 1LTSD 1AP0A 4WIPA 1I50B 2A74C 1NI3A 1C4CA 3G7LA 1CHQD 5E3FA 4IKGA 2VZKD 1VDZA 3URYA 3AM9A 3FAHA 1QKZA 4KX6B 1ET9A 5M5YB 1ESRA 5ELFA 2QF7A 1SNPA 3NQIA 5CV9A 1SXTA 4DAYA 3FC4A 4JWUC 3NRZA 5BYRA 5C0XG 5M3MB 2JA8B 4KKIA 1UWMA 1IYVA 1J7BA 5K5PA 3FDTA 5I2XA 2WXRA 4GDLB 2VNUD 3CRLC 1Q3LA 2R61A 1H9SB 1WTOA 5E1FA 3NBHA 5CBEE 1C8CA 1EM7A 1T5EA 3MJ5A 2TSSA 2MGSA 5KGUA 4RA8A 4OZBA 3V96A 4DAPA 3TP8A 3IT6B 1EYAA 5JEAG 3GP7A 2WV6D 2L0CA 4K6LA 1FFVA 2KOLA 2WXKA 4TKOB 5DEHA 2SOBA 2DBYA 4N59A 4DXGA 2Q8IB 1N60A 4HSVA 3IFDA 1XTCD 1E2WA 1WGKA 3L9AX 4HN7A 4WFN3 1QJOA 3W5UB 1Y8OB 1KLGD 4K14A 3RUZA 2QEJC 3FILB 4OIJA 2EY2A 1RD9D 3BK1A 2KEDA 4K2LA 2F4IA 3SK8A 4NZLB 1VZ6A 1DD2A 2L4NA 1OXTA 2VUMB 2EPBA 3P1MA 2JYEA 2F0OA 3LNNA 3AE9B 2L11A 2GRIA 1IW7D 3TDQA 2NMQA 3NXWA 1SF0A 1V1OA 3C2PA 3SE0A 1VZ7A 1PRTC 3PMFA 3KUPA 2NBFA 1YMHE 3VYTA 4NP5A 1E0BA 1TKWB 2WXFA 1E2ZA 2IGHA 3IFTA 5C4JB 3BDLA 3WOFA 3VR2A 3RFZB 5FK9C 5DM73 1SNQA 5FLXE 1LTGD 4RWSC 3X3NA 3HOUB 1BR9A 4RH6A 3B9JA 3S17B 3MC0B 4C1NI 4CKBA 2EY6A 1ILPA 1E10A 3BVZA 1FEHA 3NWSA 1AW7A 4J1MA 1KRHA 4UDUC 4MN3A 4N58A 1TKGA 3T4AC 4I7ZC 1GB4A 1XLOA 3KBGA 1VJKA 2RDHA 1XF5L 3FVQA 5T1GA 5KIXA 2RMMA 2E2DC 4FXDA 4J6HA 2K05A 2BDNA 2E6XA 1IKMA 1XXGA 3AE8B 1YJIA 2M56B 3AH7A 2WB1B 2XN9C 4OL7A 1BQQT 3NTHA 2INNE 2EY5A 3H0GB 4HJGE 3Q22A 3SR6A 2SDFA 5EKKA 1LABA 3Q0AA 2LJIA 4RGMA 4KY5A 3SFEB 2GI9A 3GQBA 1K53A 3N52A 2OF1A 2F0LA 1SDFA 3J7AV 3RD4A 2X6GA 1LT6D 3I90A 1SYBA 2NTTA 2K33A 3KF8A 2LHDA 3SVMA 3GTJB 1TIID 1WWTA 2OHFA 4AS1A 1FXAA 3DUZA 1JW9D 1CT1D 4MACA 1Z6HA 2DYOA 1Q12A 1HA5A 4US8A 2A68D 4KKUA 4Q5VA 1JWBD 1EQTA 4HKZE 1MGSA 2GA4B 3NHHA 1RFKA 3MTSA 4XYOA 1S5FD 3TP6A 2XRSD 2AWOA 1PRTF 2MHVA 3HKZB 2V0GA 2CJNA 1PTOC 3KK7A 3H8HA 1TS3A 1PDXA 4C1NK 5IT9L 2A6EC 3C1FA 1EQVA 3KLSX 1HFGA 1NUCA 5EE1A 3CRKC 2AUJD 2H89B 1QWYA 3I4LA 4O42A 3FRPB 5A2QE 4BY7B 2WXNA 3Q8AA 1STYA 4CJ1B 1D5ZC 2B2TC 4ZKCB 3BG3A 3NUHB 2K7VA 2K9XA 5H8YE 1MVKA 3S16B 1TY2A 3VA7A 3BK2A 1C76A 1DOYA 2F0JA 1A2UA 2ICIA 1ENCA 1D5MC 1I4HA 2PVOD 4L1BA 4A3BB 1G6ZA 1LTID 1YNTE 3AEDB 1HTPA 3KWLA 2WINB 2J52A 2PW5A 2EDGA 5LL6X 1R7SA 2BS2B 2RSOA 4H44C 1BO0A 4KGTA 2E74C 1Y1VB 3GTPB 1BMLC 5I9OA 4KKTA 2LMCA 1HTLD 1F9QA 3J7YW 2R92B 1YQ4B 1GPXA 2MJ3A 4M1UB 5ELCA 4ARIA 3C46A 3NVYA 2HCIA 1DZ1A 3R8BA 3MFYA 2B2VC 3JAML 3MXGA 4DFAA 4FF3A 3B2GA 3PUWA 5C0XI 1WTPA 3HS0C 4DN4M 2ZT9C 4F88A 2EKIA 3P4QB 1IGCA 3AU7A 3EUB2 3DMUA 2J4XA 3DEOA 1IBXB 1Z47A 1PFBA 4O1NA 2Q8RE 1PTOF 1TT2A 2JSOA 1PRTB 1JRPA 2BA1A 5C4ZA 3AN1A 4C3HG 3DWMA 1M8AA 4HAEA 2WXIA 4C3JB 3GTMB 3PZ7A 3S1QB 2XIWA 4RKLA 5E4WC 1N61A 1XX8A 4WORA 2WDVB 1MD2D 1R4QB 4HSPA 2KDMA 2F0EA 5I9PA 3L4PA 2EJGC 5A35A 4N6EB 4CQNA 1BCPC 1IKLA 4NDXA 1E0ZA 4RGNA 3KWVA 2M19A 3L7ZC 4ZQ3A 1KFYB 1V8QA 1TQOA 2F0QA 1SBBB 3M85A 2FBWB 5D7GA 3RMHA 3A8IE 1EZ8A 1DGJA 4QB4A 1C4AA 4WQMA 4C3IB 5C0XH 1KH0A 2BW2A 1JB3A 3P7JA 4OZAA 1K51A 1P7FA 2V4IB 5K36G 1OO9B 2F0SA 4AQ7A 1P7EA 3MAQA 2EYHA 1XCTL 1D2BA 1HRJA 3FEWX 1TY0A 3O13A 5EPKA 4FF2A 5CORA 1MHXA 2MPMA 3DHQA 3VR5A 1QT9A 1RCVD 4USAA 5JJZA 2A69D 4KY6A 1TWHB 1LACA 3VYUA 1D1IA 2V4DA 1FNUA 3U7ZA 5IGFA 3G6JB 4IUPA 1FIQA 3NS1A 2L83A 2ZXOA 3I3CA 1UAPA 3NP8A 3NUCA 2KCNA 1Y1WB 2D5DA 1DOMA 1WTVA 1AWDA 3LX0A 4DNRB 5EKIA 5C3XA 2R6GA 1YJJA 3HRZC 2EE1A 3P4PB 3DXJC 2R3ZA 3DM1A 4XYQA 3ZJUA 4ID6A 2K0PA 3AE2B 1IHZA 1SNMA 4X3UA 4XQJA 2FHTA 1XLQA 5C5LA 1QOFA 4PMCA 1II3A 2QSDA 4H7BA 1TS2A 4HTHA 5M3FB 2KQ4X 3ERQA 3ND8A 2BS3B 4B9WA 3TEZA 3TZUA 3R93A 5C44B 5COYA 2RDFA 1BCPF 3J80E 4JE3B 2LMCB 1E7PB 1JR0D 1SYFA 1W6JA 3HOYB 1L5PA 4OZCA 1R9TB 3H6MA 4ZRQA 1STNA 3I70A 2JQRB 2M2LA 2Y5PA 3RZDB 2K03A 5IOCA 1GJXA 4K5XA 2LUMA 1CK1A 1B9NA 4A3FB 1WYGA 1KDAA 2EYLA 5C4HA 3AE4B 4R9WA 3PUVA 4D2KA 4R3DA 2XRQD 3OPOA 1XCQL 2KCCA 4US9A 2PPBC 4ZHOA 2HTME 1DOLA 2K5WA 2W82A 3D4RA 5FR3A 2L1AA 3GTQB 1F9PA 1DONA 4KHZA 5JXVA 4WJWA 2DY7A 5EQ0A 4BY1B 5CV7A 2NVTB 1SJHD 3IL8A 2E76C 1XEEA 5KYLA 2BT6A 1RKNA 4A9AA 3NVVA 3H91A 3QOLA 2EJMA 4KD3A 1SYCA 1Q1BA 1U4LA 4KI0A 2YEPF 3AE6B 2BB6A 1SYGA 1ZE3D 2Z1CA 2SNSA 2RKSA 1QLBB 1VF5C 3A54A 5IGEA 3AMZA 4PMWA 3DWPA 1B44D 3T53B 1PGXA 1A15A 4OO1G 4ODGA 1ICWA 4ZOHC 4L2YA 2JX5A 2W54A 4TQUS 3PO2B 3RLFA 4KK7A 1T5XD 1YNNC 1N5XA 1SNCA 1HUMA 2RDGA 3NTIA 5KRUA 4ZKBB 3BYYB 3AEBB 1JWSD 3SK5A 1F2RI 1BCPB 3OMCA 4RHSA 2Z8LA 2N88A 3D4WA 4KHVA 3N6RA 1GHKA 1CI3M 5C2TB 1V8CA 1RWSA 1STAA 3GV3A 4ME5A 2HDLA 1N62A 3K5OA 2J7ZA 4N9PA 3S1MB 3NVWA 4TQ0A 4K6DA 2FMCA 4A90A 2D9UA 4FF1A 1FYCA 1JWAD 2E3TA 2WXLA 2NTSA 3PO3B 3BVGA 2I38A 1FR3A 3TSSA 1MSGA 1RM6C 2TMPA 4XTCS 4BA1I 1XYIA 2E75C 2VB2X 3W1SA 1CQFA 4ZRZA 4IUNA 1NENB 4GLSC 5ELDA 1V43A 3AEAB 1RYJA 1WTQA 5F2DA 3AE5B 5G3LD 3V2TA 1A2TA 4ZUJA 4QCLA 5EE0A 2O5JC 3J9CA 3TEWA 1EIGA 4CHTB 2E2JB 3M4OB 4DQOC 3IXSA 2B2WA 3T13A 3GTLB 5I4DA 1S5DD 5D3DA 3NZ3A 2F0FA 4I65A 1JOOA 2VXWA 1A3UA 1EY7A 4KN7C 2ONQA 1O7YA 4PV1C 2CW0D 1MHHE 2BE5D 2IWHA 4IDIA 1NAPA 1LTTD 1SEBD 2N55A 3LXFA 4ULLA 3PO0A 1GB1A 4YSXB 4BS9A 1JALA 2JSVX 4X3KA 1AEXA 4BBRB 4JWSC 2L1BA 1F2RC 5JAVA 1EIHA 1GUGA