4RGTA

2.0 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with 3-n-acetylneuraminyl-n-acetyllactosamine.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
191
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKESEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.0 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with 3-N-Acetylneuraminyl-N-acetyllactosamine.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Putative uncharacterized protein
total genus 64
structure length 191
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgtA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgtA01
3SEBA 2ICIA 2Z8LA 1D5XC 2XNAC 1ET6A 1G8ZD 1PTOC 2O2LD 1HA5A 1LTTD 1LO5D 2CHBD 2NTTA 5ELBA 2SEBD 1EWCA 1YN5A 3DWPA 1V1PB 5FKAC 3R8BA 3MFGA 4UDUC 3BVZA 1TY0A 2QEJC 1I4QA 1EU3A 1PRTF 1PTOB 5I4DA 3EFXD 1XXGA 5ELCA 1RD9D 1PTOH 3CHBD 3W2DA 2WV6D 1LTSD 1AN8A 1BCPF 1S5CD 1I4RA 4DXFA 1TS3A 1D6EC 1CK1A 2AQ3B 1FNUA 1GOZA 3BVMA 1EU4A 2XRSD 1S5ED 1PTOD 1FD7D 1SXTA 1DJRD 1LTRD 1PZJD 1RCVD 1BCPD 2NTSA 4L63B 1AW7A 1STEA 1PRTD 2XN9C 1JWMD 4DXGA 1CHQD 1CQVA 2R61A 1LTBD 1SJED 1LTGD 1V1OA 3GP7A 3BVGA 1SBBB 2XRQD 4C56C 3V05A 1JCKB 1SJHD 4RGTA 1RF2D 1TS4A 1HXYD 1I4XA 5D3IB 1L0XB 1TS2A 3KLSX 2QILA 1SE4A 1T5XD 3EA6A 4RCOA 1I4GA 1YN4A 1B44D 1DYQA 5ELFA 1LTID 1BCPC 3BYYB 1LT5D 1SE3A 1V1PA 5ELDA 1BXTA 1LTAD 2J4XA 4RHSA 1TS5A 1CT1D 2G9HD 1HQRD 1XTCD 1MD2D 1BCPB 1FGBD 1SEBD 4L6TB 1EEID 1D5ZC 1S5DD 3DWAA 1JWSD 1PZID 4OHJA 5TSSA 2AQ2B 1HTLD 1JWUD 1EEFD 2AQ1B 2RDHA 1FNVA 1KLGD 1PTOF 2IPKD 3OWEB 1ESFA 1UNSA 5FK9C 3URYA 1FNWA 3BYTB 1UUPA 1PZKD 1LT3D 2TSSA 1PRTB 1L0YB 4K6LA 1ET9A 1TY2A 1F77A 1RDPD 1B1ZA 1KTKA 4RFBA 1LT6D 1D5MC 5ELEA 1M4VA 4RGOS 4ZYSA 1I4HA 2IJ0A 3BZDB 1QILA 2RDGA 3R2IA 1ENFA 4RH6A 4Z9CB 1LT4D 4RGMA 1PYWD 4TSSA 1S5BD 4RGNA 3MC0B 1LLRD 1YN3A 3TSSA 1I4PA 1S5FD 4RHRA 1EFID 3R2TA 1JQYD 4BWGB 5D3DA 4O1NA 1KLUD 1JR0D 1SE2A 4NZLB 1PRTC 1CHPD 3DWQA 3O13A
chains in the Genus database with same CATH superfamily
1Y1VB 4DGZA 2DHZA 2KHSA 5M3FH 1XMOL 3UDXA 4E3CA 2JA8B 4P1CC 3HOVH 3A33B 1VCIA 4A3GH 2F0VA 2GRIA 3DEPA 4PZ6A 4HVBA 3I55A 1K53A 1T3QA 1PYSB 4FXDA 2O2LD 3AU4A 1WGDA 3TCAA 1ZW7A 3UDGA 2ZXPA 3IFWB 3ITPA 4ITKA 4DR5Q 3NS1A 4YSYB 5IP7G 3SR6A 4E6IA 2CWPA 3PIOA 2F0KA 3R8BA 3RZDB 4W9LA 2J53A 5CX3A 1D1KA 2KD0A 1W6JA 4IWPA 1EU3A 4M01A 2B2YC 5BMIA 2KJXA 1QVCA 3T4AC 1C3TA 3CHBD 1GVPA 2PE9A 1IBXA 2WV6D 1SYCA 3RNUA 1N36L 1HZ5A 4PG3A 4ANVA 3T56B 4GGQA 3ZTCA 1GAQB 1WTQA 4DXFA 1NVID 1G6PA 1PGXA 2C7HA 3FILB 2AL6A 3PO2B 2WFWA 4WFN3 3MAQA 2BT6A 2WXMA 1V2YA 3A8IE 1FD7D 1T9HA 4KGSA 4EE2A 4JPBW 1FD6A 4RF0A 1Y1WB 1Q46A 1KLVA 3TDQA 4JBWA 2Y0SG 2BYVE 2ID0A 4LF8L 1Y1VH 4C1NK 2QA4A 5CV4A 4C3HH 4C56C 3KF6B 3PUWA 4A3MG 2L00B 3Q3OC 3F2DA 4TMAB 4YTPB 4WJ4A 1HXYD 1UAPA 1YJJA 2PNRC 2IY1B 2NVQH 4N9PA 4DAYA 2UWQA 1K8GA 3A1QB 4A3EB 4AH6A 4AQYQ 3WOEA 3M4YA 3PHXB 4ZOHC 1DYQA 3GTOB 5GAHC 2R7DA 1LTID 2ZNVB 4KK7A 3N1XC 1KOTA 1EYAA 2B2WA 1YIWA 1CT1D 1YNND 2NYZD 2DENB 1UGJA 2GLSA 3OIPA 4P16A 2KVMA 2FCSA 3VVWB 4EQOA 2UU7A 3V60A 1SEBD 3I57A 1VQ6A 1XLPA 5TSSA 4A3JG 5BYQA 1VQFA 4MNOA 1Q8KA 3STBD 5C0XJ 2LASA 4IOIE 1VQHA 3GTJH 2VH2A 2E76C 1I6VC 1SYBA 1EOTA 3HZXA 3URYA 1E8YA 3N9YC 1YJIA 1OGWA 2NVQB 2IT1A 1UUPA 1LT3D 1QZEA 4C2MH 3PLUA 3QCAA 3PREA 3U7DA 1K8AC 4DPGA 2L12A 4KJNA 1ET9A 3IXSA 2DYBA 4ZRIA 1RDPD 2EY6A 2NVTH 1LT6D 1N61A 1WX7A 1D5MC 2MQHA 2UXCQ 1ZDVA 1UELA 4RGOS 4K2KA 2Z0DB 5LHY1 3ZKJC 1K50A 3QX1A 5IT9E 5C0XI 3ZO5B 2LVQA 3AE4B 1NE3A 1MHWC 2ZJQA 5BMHA 4EVOA 1XLOA 2MUYA 2LVOA 1VZ6A 1A3UA 1EL0A 3MTNB 4A3BB 1QQRA 3UE0A 4GN3B 3AB9A 3G4SA 4G7HC 1QZHA 4RM8A 2D5GA 5IODA 1YMHE 3R2TA 4BBNF 4DAVA 4X66Q 4MELA 3G7LA 5EDSA 5C4JB 2JRHA 1QOHA 2ASQA 3RYTA 2VQFL 4XQJA 4IW0A 4HLEA 1SE2A 3DBLB 4V190 4XC2A 3RUZA 4H44C 5KNCA 3FRPB 4K7WA 3CW2C 4OL7A 3SEBA 1KDCA 4A90A 3W1YA 2R2QA 3S2AA 5CV6A 2HT1A 1TT2A 2G3QB 4FF1A 4G4KA 2Z8LA 3A9JB 1PQSA 4DNRB 2NN6H 5HKHA 2JQRB 2WAQE 2IBIB 4FF3A 1BDOA 5AUKA 3HOXB 1PLFA 1JWAD 2M4NA 4A3BH 3GTOH 1VQ8A 2QIEB 2WDTB 4QAYA 3T53B 1E1TA 4CKEA 3HOWG 4LNIA 3OLMD 1FXIA 3ML8A 1KQSA 3OSOA 4LLGM 5IP4D 4UAIA 2ZVNA 5M3FB 1PTOH 1O78A 1LFDA 2O6VA 3PCOB 3Q23A 3NZ3A 1F1HA 3LJ3A 1KRTA 4AIMA 4XGAB 1S1QB 2BGFA 3DVNV 1S3OA 3OMCA 1IGCA 4W9EA 4YHHQ 3Q22A 4P71A 1FM0D 3UQAA 1ICFB 2PE6B 4YTNB 4JI7L 1LTRD 4UP8A 5C4JH 5M5YH 4I7AA 1Q1EA 1JJGA 2FAZA 2CQOA 1UWVA 1F2ZA 5IGCA 3AH7A 3U52E 4AQ7A 2GMIC 1KF6B 1R4NB 1BOSA 1JWMD 2Q2UA 2CWAA 2LRUA 3KUCB 5HFYA 4L1BA 5JXVA 1WM3A 2RD0A 1QWYA 2OTLA 1T0RC 2PW9A 1E22A 1XTDA 1EO6A 4IG7B 5BN3A 4DK3C 3TJPA 1SJHD 4RGTA 3CPWA 1I5FA 1DZ1A 1QT9A 2J0KA 1Q1OA 4K7SA 4JPSA 4Q0FA 1SIFA 2JXMB 4WQOB 3ZRCA 2K7VA 2ZJRA 2KQ4X 1E2WA 3S1NH 1VQ9A 3EA6A 3SFEB 4DQOC 2EJMA 2PQAB 1HEZE 1F52A 1OXUA 4QMGA 2HTHA 4A3BG 1DM0B 1LT5D 5LMNL 1BO0A 4RCNA 1KXLA 1IW7C 2XTIA 2K8CA 3J9CA 3JAME 1C9OA 1JB3A 1H9JA 2JN4A 2RDBC 1U0LA 3HOZB 3KFUA 3PO3H 1EWIA 5IAAC 1KABA 4B3RQ 3HOVB 1I35A 2H88B 1IBKQ 5EPKA 1FR3A 1A63A 3GTPH 1SYDA 2AQ2B 2EYPA 5BN4A 5HGQA 1FMAD 1JALA 5BR8Q 1PH6A 1FFUA 1E3PA 5JEAG 1EYGA 4POGA 3HOUG 2KHWB 1N6ZA 2RPVA 2PMZE 2L1BA 3EQLC 2EXDA 1RRBA 3DQVA 4RKBA 1ILPA 1H9MA 4QCLA 1MGSA 3AFPA 4O2DA 1WX8A 1Q3LA 5C4XB 4JI4Q 4JCVE 1WR6E 1WX9A 4WJNA 1F77A 4H13C 4ZHOA 1P3QU 3L4PA 4A3JB 3F8TA 1VZ7A 4RFBA 2LGDA 2EMSA 2AWOA 2HE7A 5DNFA 1IPGA 5JJKA 3ULLA 4DUYL 2KN4A 4LF7Q 1YX5B 4NMZA 2FMCA 4A4IA 5CORA 4DR7L 4JWUC 5I6YA 3J81c 1UGMA 2B2VC 3AMUA 1MSHA 2D07B 2KFKA 2LXAA 2IY5B 1ONLA 4Z9CB 4HEDA 1AP0A 1EM7A 2JSOA 1E8WA 1LM8B 3DLLA 1X9NA 4DR7Q 4FF2A 2WX0A 5KRUA 5IT9c 1ZE3D 3OW2A 2ZXRA 1GC6A 4A3KG 2D9UA 5BYRA 3AECB 3RPFC 4PS3A 3NHHA 2EY1A 1OFFA 1UBQA 3H1UA 3QHTA 4BKSD 4JYAL 2XSCA 3R3OA 3PO3G 2LXKA 4NP5A 1KRHA 4FA6A 1SNOA 3R93A 3FKIB 1Z7TA 2XBBC 4JOIA 1RODA 1XPUA 3KK7A 3W1SC 1IP9A 1LV9A 4DN4M 5CGKA 1TKYA 1WXQA 2KQ3A 5L37A 1SNQA 5LMNQ 4LK1C 1LTTD 1LO5D 1EQRA 2DX5B 3VH4B 3PO2G 2E2JH 4N6EB 3P2BA 3SK5A 1YN5A 3DWPA 5CC4A 5IP9H 1MI0A 1ZPSA 2RMMA 1TWCH 2LS01 2MA9B 1TWGH 2FINB 1X3QA 4JBMA 4OO1H 2CJOA 2WX1A 4MGZE 3VTVA 1WGHA 1HHVA 4I6NB 2Y5PA 5AZGA 1N34L 4GN4B 1A15A 1T0YA 2MWSB 3AN1A 2JY6A 4A3CH 3AE5B 1WE6A 2Y5CA 2VZKB 3X0WA 3ND8A 3BVMA 3H0GB 2XRSD 1SXTA 2EDGA 3S1RB 1WFQA 1SYGA 2DNCA 1B50A 1J7CA 2YEPB 3NTHA 4BOZB 2F0TA 1Z5SB 3GTQH 3CC2A 2HDMA 3H9DA 3IL8A 2LSSA 2PYKA 1H9SA 3P7JA 4KKUA 2E5LL 2ACZB 2E8GA 3E0EA 3GTLB 1JE4A 3AE1B 3IVFA 1V97A 2G4DB 1TKEA 4MTNA 4C3JB 4DA2A 3CCUA 2ZCBA 3H15A 2K6QA 3NQTA 1M94A 4C3JG 4HKZE 3AB5A 1I4XA 2N7DA 1SMYC 3C46A 2L83A 3KUDB 2NPTB 2K5NA 3GTJB 3D31A 5CV7A 4LJOB 5EAYA 5T8IA 5T1GA 1V1PA 1E7PB 3RNCC 1BXTA 1YEZA 1QOAA 4JI6Q 3H0GG 2EKEC 1GUWA 2QCZA 5C3XA 4A3MB 1HNZQ 3KDFA 2NZOA 2N49A 4IUTA 2K1BA 2GBRA 2WWZA 2MBQA 3CC4A 3RZOB 1ESRA 1JWUD 2AQ1B 3HOYG 1A0IA 2EYFA 1HFGA 1ESFA 3L7ZC 5FO9B 4MJSB 4M02A 2PI2E 2CU1A 2B39A 2ZT9C 4HJ8A 3DWGC 3GZNI 4A3PA 3L2PA 3DBHI 5DCNA 4BY7G 4H0LC 3H7SA 5EGTA 2YEPF 1EOVA 4FULA 1YX6B 2UXBL 2XVSA 1DCZA 1QNUA 4O0AA 3MHSD 4KKSA 4X66L 3S1QH 2GBJA 1DOXA 4J8QA 1AE3A 5IYBG 2C5LC 2V3NA 3VR6A 2FHTA 1WCMH 1WD0A 2MQJA 1SNDA 3FPPA 2IWHA 4AJYB 4DAYB 3RUIB 3CAMA 4CDDC 3T1HL 2N7EA 2PTLA 1IZ6A 2L55A 3AE6B 2CH4A 2KDFB 2NVUI 1JQYD 4YCUA 4EX5A 5M3MB 3WANA 3QB3A 2H5XA 4IFDI 3U50C 4BBSH 5D3DA 2CQAA 5J39A 4WIPA 1VMPA 2LGYA 3NVZA 2IHFA 1Y1VG 4JI4L 2NS5A 1YNJC 1N63A 1EF5A 4OO1I 4B6WA 2ZCCA 4A93H 2KC1A 2KFJA 3JW0X 3CKIB 3UGBB 2HJ1A 1ET6A 1G8ZD 3NTIA 5C3EG 1E7VA 4BBSG 1L7YA 3J7ZC 3ECIA 4FNFA 3KBXA 2LUMA 5EE0A 2B2TA 2Z9HA 4IM2A 4JL9A 5K36H 2HHHL 4HR7B 2N0SB 3I4LA 5FKAC 1C79A 2K5QA 1OQYA 3R3MA 3RMKC 1GUTA 2F0SA 2AX5A 3DXJC 5C44H 1VQMA 3HOUB 1MSGA 3HM6X 1JJCB 1XXGA 4HTHA 2WXKA 2CHXA 1C48A 1BR9A 1CZGA 4XX5A 3A9KA 3AXCA 1FCLA 3TMPB 2KEEA 1PFSA 1I6HH 3L17A 4IURA 4NXNL 4C3IG 1SGHA 2MBHA 4DAMA 4HCPB 3OJ3A 1Y8OB 5CYUA 2Z6BA 3NUCA 2ONQA 1STEA 1WJNA 2LRWA 5I2YA 3PVLA 5E6NA 2Y5BB 4ZKBB 4JQWC 4S3SA 4BBRB 1WTWA 2ALYB 3PSIA 2PKOA 2I5MX 5EJWA 1LTGD 3DBRI 3WCQA 2LMCB 3AE7B 1EY6A 4XT3B 4DK1A 2WGSA 4DR1Q 3I2ZA 2DN8A 1TS4A 4KTAA 2A74C 1U4RA 1K8OA 4GOPA 1A3VA 5FLXc 4KGRA 2JPHA 4HIKA 1TS2A 2UXDL 4RKLA 3QAQA 1VQ7A 3ND9A 4CHKA 3FKYA 3ULJA 1SB3C 2V1YA 3CCJA 2LXJA 1M1KC 3HEJA 4AP4C 1TS5A 2OT2A 1L5PA 2AYOB 1DGJA 1P8LA 4BXXH 3AE2B 2PCFB 3NVWA 4A3KH 2PPBC 3IAS1 4HIOA 1UWXA 4DR5L 1I3QH 3C1FA 5DAUA 4JE3B 2F52A 4BBRH 4HROA 4LWCA 2DZMA 1J8CA 3NBHB 3JAMc 3PUXA 1EFWA 1EF1A 2FE8A 3W5UB 2X69A 2SAKA 2LY7A 1WF9A 1YOVB 2JZPA 3PZ7A 4MEMA 4FJZA 1WR1A 2WXOA 3U2SC 1SNMA 1KD1C 3PUZA 4DV5L 2MJDA 3T51B 3EJIA 2BS3B 2QMTA 4HIMA 1QUQB 1PRTB 2CW0C 3DM1A 1BBXC 4FJVB 4MT5A 4AS1A 3HRZC 4BY1B 1J7AA 2VZKD 2CHZA 4CDCC 1X3GA 1EY0A 1C76A 4CJ0B 4OO1G 3NOBA 2MLBA 4DV0Q 3S2DB 4CGYB 3RN5A 1QE6A 4JI5Q 1PVOA 2K50A 2A5HA 2KYWA 5IOCA 2HUGA 1LLRD 3TSSA 1I4PA 2I38A 4Y7NH 2KJ6A 5IYBH 4HPMB 1XF5L 4PT5A 4PK1A 1NMFA 3QOLA 4WWNA 2F0LA 1ILQA 2M19A 1ACCA 2F3IA 4AUQC 1DOLA 1JR0D 4DR2L 3FEWX 3Q8EA 1TWHH 4K7UA 2CKHB 2B2UC 4RWSC 3U4ZA 2EVBA 3DPDA 4ICUA 3AEFB 4MJSA 4FVMA 2BA1A 2EJFC 4HEA1 2HD5B 4KKTA 1L1OB 2W55A 4P73A 3SFDB 3AYHB 2EJGC 5LMUQ 1K73C 2E2HH 3M85A 4WAAA 2DNFA 2HD3A 2BF8B 2R92G 2B2TC 2KCTA 2A5UA 2ZM6L 4A9AA 2BWFA 3MFGA 2B8FA 3CMMB 1CA6A 1GO3E 3GTMB 2KLGA 1PRTF 3F2CA 1FIQA 1WFYA 1SF0A 4URKA 1S4ZA 4GKJQ 3H3VC 3PT2B 1C4PA 1CSQA 2L32A 4K5VA 4JI1L 2KA7A 2R7FA 2HIXA 3KF8A 3DDCB 3PUVA 3V2TA 4TVAB 4Q5VA 2RVLA 4K8JA 1PTOD 3HOYH 1V1QA 3TP7A 2L0CA 4JV5L 4U68A 2OTJA 3AM9A 1C4CA 1VDVA 1EZ8A 2XN9C 5ELNA 1CQVA 1U9RA 5IYCG 4A3EG 4L5QA 5G2NA 3VH3B 2K1FA 2L15A 5D14A 3CF5A 2CR5A 2RPQA 3QWZB 4BKGA 2F4IA 2K3UA 1SIJA 2KNBA 1XNQQ 2AEHA 4EOYA 3RMHA 4WAFA 1V49A 3N32A 3I4NG 3K7UC 1B53A 4G3XB 3V61A 3S16H 1Y1WG 1P7EA 2LJ5A 2QSDA 4RHSA 3I56A 2M56B 1PGAA 2PNHA 2R7ZG 1MD2D 1BCPB 2KVRA 3NSWA 2MJ8A 4ODGA 5FR6A 3NBHA 2QKIC 3HUIA 1HUMA 2G4SA 3QIJA 3V62A 4K8IA 3W1SA 3I4NH 2INCC 1UE7A 3S1MB 3OWEB 1YHAA 4K2LA 3I3CA 1Y1WH 5DEHA 3X3MA 4FHJA 4KY6A 3DVNU 4YHHL 3O65B 1YNNC 1WZ3A 3Q8DA 3ALBA 3KUPA 4A3IB 2CCZA 1S40A 1MG4A 5JOBA 2F0NA 1R9TH 3I4MB 3QR8A 1RAXA 2G9DA 3TL5A 1NTGA 3TMEA 2QJLA 4JK1C 3JAML 1SE9A 2KCNA 3FPUB 5IGEA 3IAYA 4B0EA 1RKNA 2JA8G 1J8IA 4A20A 1QILA 3H8HA 3TS2A 2WS3B 4BAXA 1UBIA 3R2IA 1X6OA 1V6EA 3FILA 2KOXA 4P2CB 3A56A 4W9JA 4CJ1B 1S5BD 1N9WA 5J1ZA 1OEYJ 2ZW1A 2I0QA 1YN3A 4I6PA 1XD3B 4EGVA 5CV9A 3PPAA 1BMLC 1ZKHA 3P1HA 4RF1A 1H8CA 4US8A 2WIIB 3S14H 1NYQA 3QA8A 5JPMC 1WYGA 2MRPA 2INNE 1D8LA 3R66C 4IKGA 2B2UA 1TGZB 2F3VA 1JRUA 3X23A 4HPPA 4WWPA 2IW3A 4KDLB 4H02A 2N1WA 5KGUA 5IGBA 4AYBB 5BMGA 2IX0A 4P75A 3UI2A 5GAEC 3KUZA 3N3KB 1K3RA 4DNTB 3NRZA 1EWCA 1AEXA 4YT0B 2HQEA 2ZNVC 3MXNB 1Y8RC 4TQ0A 3RI7C 2DYMA 3OIQA 1NMGA 2IX1A 3HVZA 2BYEA 5J17A 2WXNA 4ASWC 1WH3A 4BA2I 4BXXG 3SXHA 3NELA 2JA8H 1Q82C 3CCVA 4ZUJA 4OVZA 2LGXA 3IHPC 1F2YA 2JYOA 1TS3A 4NDXA 4FXGC 5J3BA 2MHVA 1FNUA 5FJ8G 4DR3Q 3WA0A 1EU4A 5DM63 1ML0D 2DYOA 2Z59B 4IUMB 5AEKB 1AW7A 2ZTEA 3HOZH 1IW7D 3PO3B 3OPOA 2D3CA 2K9XA 3DHHC 3PF4A 2KDIA 4EQPA 1N5XA 1CHQD 4LUVA 1WGYA 3U4VA 3VHTC 2SNSA 1Z2MA 2Y3AA 3W5OA 1SBBB 2K5VA 4TRDA 3U9SA 2NVXB 2AL3A 1TIFA 3X3NA 4GLVB 2NVYB 3ZNGC 1TU2B 5H8YE 1OO9B 4JGHB 3WAMA 2OQKA 2FNJB 2L0FA 3MP9A 5M9OA 2JE6I 2KO3A 1R4MB 4K0KL 1VQPA 1YJ1A 2NB0A 2Q8TA 2PI2A 4JI2Q 1DOKA 2FCQA 4MH8A 1EY9A 2J4XA 3D0FA 4B95A 4JV5Q 1JB7A 1JT8A 1E2VA 3VUWA 4DFAA 3DCGA 2M9VA 1MFWA 3STBC 1ZYRD 2PEAA 4X3SA 2R93G 1ZKOA 1JWSD 1Q7YC 2D5DA 3S2HB 1GHKA 3VQIA 1PFMA 4IALA 3A9KB 2NN6I 1MJCA 1WSPA 4DR4Q 4LFCQ 2LWPA 1NNXA 5FK9C 3DHGC 3ERSX 2CKZB 5M5YB 5JHAA 4OIKA 2WB1B 3WDNA 1FCCC 3JC66 3KLWA 1SSOA 4HPLB 2V9HA 1WGGA 1NENB 3QO2A 1TYGB 4RMAA 3VDZA 3F1ZA 1X54A 3U9OA 1EWHA 5IKCM 1V86A 4IUNA 4K5WA 2N9XA 2VUMB 3PIPA 2A19A 2NMQA 3T3NA 3LXFA 2OF1A 3DM3A 3HKZE 3J7AF 1XPOA 3BDCA 3MXUA 1IBLL 5EBDA 5LL6X 4II2B 2SDFA 2E2JB 1ISNA 3M3YB 1PYWD 3KH0A 4W9KA 5I9OA 3ZJUA 4GDLB 2HCIA 4KSKC 2F0MA 4MSQB 4F1SA 3KBGA 1GG3A 3TBLD 4LNQA 2JYEA 3CCRA 4O42A 3TREA 2X38A 1YVCA 4JI6L 3C19A 1YD8U 3LWUA 3BZKA 1FVIA 1T0SC 3L9AX 3V96A 2JA6H 3IAM1 3PGEA 2CFMA 4WORA 4GLXA 4X65L 3BU2A 4YCWA 2KMCA 3B6YA 2KMAA 3NZSA 2LGIA 3VA5A 4AYBE 2JA5H 1UE6A 3KQ4A 2B8GA 3AU5A 2UUBQ 5EE9A 4M8MA 1VQ5A 3GDEA 1WI5A 3RT3B 2XNAC 1D7QA 2A6ED 3L0WB 1I94Q 1BUVT 1BF4A 2FCMA 2ON8A 4GDKA 5H92C 1YHBA 4JBJA 1JROA 2KJHB 2KJRA 2J42A 3IBEA 1WRDB 3MJ5A 2G45B 2F0OA 4KY5A 4P72A 3DOWA 1Q0WB 3A0JA 1D2BA 3TS0A 1E90A 1NI3A 2CHWA 1L2FA 4UDUC 5EKIA 3K5NA 3J7YW 2JA5G 3SHQA 3OG5A 2KQ7A 4DV3Q 4OELB 5ELCA 2V0GA 3D4DA 1KDBA 3WWVA 1V5OA 4X3KA 1V5TA 3T13A 3PRMB 1F9SA 1MKHA 2LI5A 1E10A 1X3PA 2CU3A 4LW1A 5IYDG 2F1MA 3E9HA 4YWGG 4JLCA 2JA7G 5IP7H 2I5LX 1DJRD 2IGDA 1RCVD 3A55A 1N32L 3RLNA 3DWMA 1G91A 2K52A 3I9V1 2DUDA 2KZRA 3GTQB 3SK4A 3EGRA 4DXGA 4BBNC 2F0QA 5GROA 1V1OA 5JVG3 2F0JA 3PUYA 4IN3A 2BWES 5M5XB 1VQBA 3I72A 1JICA 2AWTA 4R9WA 4GDKB 3J80c 5CHFA 4RAUC 2WLBA 5GXGB 3KLSX 1NY4A 5C3WA 1OXTA 1XPRA 1QJOA 3ETRA 3K7AB 3K7AH 1E24A 1H9SB 2JX5A 4XYQA 2MBEA 3BYYB 3OJ4B 5ELDA 2J52A 1VF5C 2NBWB 2F0PA 1TJEA 3SDLC 4A3MH 2C9OA 4J3OD 4RNAA 1XNRL 2IO3B 2LEKA 5I2XA 1XTCD 1WJJA 3I7FA 4BKSA 5IN7A 2EOTA 3ML9A 2K01A 3J81L 2R6GA 1Q10A 2MX2A 1D5ZC 1S5DD 3NJTA 3VUYA 3FC4A 3UINB 3CSTA 3WAOA 4R4QA 5M5WH 5A2QE 3DUZA 3AE3B 1EEFD 2J0MA 1N36Q 5CTRC 1GUAB 2LMCA 3ZLZA 5G5GA 2HTME 4CKBA 5EE3A 3HRDD 3TEWA 2GOWA 2Z0SA 4Y7NB 2EE1A 2K5PA 3NVYA 1HH2P 4A75A 1WGRA 2RA4A 3BK1A 3VXWA 3H7PA 4CKCA 3SK6A 3PIP3 2BE5C 4HXDA 1K28A 2PZWA 3A4RA 1FL0A 1PH7A 3BINA 1CKOA 2RDGA 4BKTA 4JVZA 5LMNW 4DV4Q 2KWCA 1Q81C 3I4MG 4XDDA 4RH6A 1O7LA 5E1FA 4X65Q 4R8NA 4HJ9A 2JVCA 4REZA 4C2MB 4A3CG 1NDDA 1UZXB 2J0JA 3DVGX 3M95A 2RDFA 3NK9A 4ZLTF 5C4XH 2UXCL 2UXDQ 2LHEA 3S16B 1KLUD 1PH3A 1HRJA 2BDOA 2WYQA 2VY3A 3UIPB 4A6QA 3ULPA 4ANXA 1J9OA 2NUCA 1GUSA 4X6AH 3MEFA 4LF4Q 1X3EA 4HCEA 3J7A5 1FRRA 4EEWA 4BY7B 2N9PC 3FAHA 1B4OA 4DU9A 4RM9A 3E5SA 1D5XC 3ZXRA 3CRKC 2B76B 1YI2A 2K4KA 2UXBQ 3I73A 4KJOA 1HNXQ 3HOYB 2WDVB 4ZDVA 3L54A 3A8KE 1WE7A 4NY0A 2FUHB 3HGBA 3PS6A 2WXGA 3K80C 2PMZB 1WXSA 4RG1A 1YQ3B 3BVZA 3NPPA 2YTVA 2WDQB 3IT4B 3CRLC 2BH2A 3N20C 3A9JA 4NJCA 4S17A 3W5VB 5I4DA 1ICWA 2KCCA 3EFXD 2WXHA 1ZDXA 3UF8A 5C4ZA 4NQLB 4QF4A 3KW5B 2JK8A 5EPJA 2QCPX 4XQQA 3J81j 2N1VA 1G2TA 4IUPA 4X64Q 1WWTA 4IUQA 2O6VB 3E9SA 3OOCA 1FXAA 4IWOA 2IZVB 4MZ9A 2MBOA 2XEWA 2N9LA 1TWCB 1KRSA 3L13A 2PQAA 1KL9A 1E1OA 2KVZA 1S3SG 1UH6A 2XRQD 3PTFC 3PZDA 3SDZA 1B2TA 1E6EB 3CU7A 1SMYD 1UE5A 1NCVA 1IKLA 2D0OA 1KDAA 4OX9L 4ILWA 2ES2A 4K3BA 5C44B 2UUAL 2EQSA 3E3XA 3HIZA 4AJWA 3U4EG 4DV2Q 5E6JA 1WGKA 2R92B 4GS3A 4RCOA 4AQYL 4ZAIA 3CQZH 4X62Q 4EZLA 4LJZC 2A69D 3A74A 2KOLA 4X3TA 4DKAC 1L0VB 2FCNA 3QC8B 1ZOYB 5IO9A 4OIJA 3HFZB 5JEAH 3I90A 2ZW0A 1JRPA 1MHXA 2VUMH 1C4AA 1QOFA 1O80A 2WU5B 4YL8A 3S2DH 5I6WA 2ZJPA 1NBWA 2N4FA 3KWVA 1Q90A 2KEDA 1KHIA 5JHBA 4BFRA 1I94L 4C1NI 2L7RA 5IGGA 4GN1A 4M0WB 2IL8A 3Q8BA 4I6LB 3DBSA 3HK0A 3VRAB 4L23A 4WRDA 4C4VB 3AU7A 1SR3A 1PFDA 4A3FB 2TSSA 3CCSA 4W9IA 4J15A 3CQZB 2PPHA 3CIRB 3GE3C 2V4LA 4PZ7A 1EY7A 2K32A 4IPGA 1H4RA 3FDTA 1MHHE 4W9DA 1VD2A 1M4VA 1YQ4B 3D6CA 2IJ0A 4LF5Q 3DEOA 4A3KB 2C7NB 1ASYA 1VQIA 4L5SA 1LACA 1XX8A 1V81A 3M7NA 1LT4D 2YV5A 1YJNA 2D2QA 1RTNA 3KYHC 5JAVA 3TP5A 1S5FD 5J18A 1B7YB 2ZPYA 4XDXA 4APVA 2SOBA 4NAMA 3CF6E 3T8MA 3ZUNA 1VQCA 3A7LA 3MEHA 5K5PA 1XMOQ 3K9PB 3MXPA 1B3QA 1Y8NB 1XCQL 4HDOA 2BOSA 3J80L 3I5JC 1GC7A 4UP7A 2F3WA 5E4XA 2QF7A 5C4XG 4DV5Q 4H7BA 4KLKA 1RIPA 3LX0A 1IUEA 1V9PA 3UDIA 3K0XA 1VQAA 3OW7A 4DUZL 3ICEA 1HUNA 3A1QA 5FLMH 4HJGE 1GB1A 1HNZL 4NQKE 3DHQA 4ZRPA 2JA9A 4NXMQ 2FBWB 2W3SA 2ZEQA 3ENEA 5ELBA 2K5WA 3PF5A 2BBCA 5KNBA 2XGTA 3FVQA 4HJAA 2AWNA 1MBYA 3M7GA 4BY1H 3CSFA 3ZNHB 1R9TB 3Q3JA 3AI5A 1V1PB 4PYZA 4WQMA 1J7BA 4FDBA 3LB8C 3H3VI 4XWTA 3HOZG 4HIDA 2QEJC 3MC9A 3P4SB 4FYDA 5E6PA 3SU8X 2B63H 3MXGA 4KN7C 1WI0A 4LCDE 4LF9Q 1FO4A 1EQQA 2KANA 4KD3A 1Q5WB 4LDTD 1GM5A 5D6JB 4N58A 4DR6L 4GB9A 2PZUA 2L1AA 4BBRG 2NCNA 2AQ3B 4RA8A 2IY0B 3VRBB 3HHMA 3Q69A 2V4DA 2L9HA 1WTRA 1T0QC 1VMCA 4TKNA 2GN5A 4HJ7A 3ZJTA 3PV1A 1MG8A 2I1JA 2JP1A 4JBKA 1TWAH 2BW2A 1IL2A 2BS2B 2M00A 1WOCA 4NJ7A 5EKLA 3WALA 5IA7A 1NEKB 5G5HA 5BO4B 3GP7A 3H94A 3BVGA 3BZCA 1VQJA 1N8RC 1PH8A 1YZ6A 1PMRA 4A3LG 2BTEA 1KFYB 2OOBB 3P1MA 5G3LD 2WAQB 2UUAQ 2DY8A 4P1BC 4BOSC 5LL6S 3KJOA 3H0GH 3S1RH 4B9WA 2R93B 4LK0M 2NWGA 2WACA 1CKMA 1JORA 2E3TA 3QQ8B 1B9NA 1U4MA 3IT6B 5ELFA 3GV3A 3S15B 1E5WA 1K8MA 5DM73 3APCA 3M63B 5CBAE 2KWUB 2B63B 2RKSA 2C5CA 5FO7B 4NAWB 5J2RA 3HOWH 3SVMA 1K51A 5G55A 4GLAC 3HOWB 4C3JH 1IYJB 2ATWA 1FGBD 3VDYA 4BY7H 5AJ3L 1S72A 3Q0AA 2C7MB 3EVQA 5BN5A 2DBYA 1JMLA 3MVVA 3HOXG 1J19A 2UYZB 2IPKD 3TZUA 1UNSA 4USAA 3Q6BA 4TV3A 1FNWA 1STBA 4IZ8A 2FIFA 1TWFH 1E0BA 4LAAA 1TWFB 3H6MA 3ZJVA 1PZKD 2PW5A 3NP8A 4ANWA 1UWMA 5K36G 4NPNA 4K6LA 4C3HG 1WMHA 1KTKA 2K04A 1SE8A 3ZQ4A 5L95C 1QCBD 2EY2A 4GNXC 2Z0EB 2H4OA 4C4VA 2FFKB 2KFKB 2GB1A 5TR5A 3VR5A 1QVGA 3SK8A 3RZOH 3HKSA 2XK5A 1R7SA 4EFOA 4IC7B 1CZPA 4C3IH 3CD6A 3W3AA 1WYWB 5G3LF 4OONA 1VDZA 4RHRA 4LFBL 2WP9B 4KN4C 4BWGB 1WTOA 1GJZA 5COYA 2OHFA 4W9FA 3WOFA 2INPE 4O1NA 3D4RA 3Q14C 5EQ0A 4OZAA 3FMCA 4IPHA 1GHJA 5HURA 4MACA 2B2YA 4D2KA 4F7ZA 5E7NA 4WWMA 1R4NI 4A3IH 2RCNA 2W82A 2IX3A 2BE5D 2NBFA 1AYFA 2WP8J 1WCMB 3GTKB 2M0AA 1WRIA 5AZFA 2B2VA 4B3TL 4LF5L 2WXQA 3JSVA 4GOPB 5BR8L 1QVFA 1P9DU 2D10A 4QUFA 3LWEA 4JI3Q 1FXTB 1VQDA 4YIJA 3SR1A 3VTWA 4A3DB 1JQ4A 2JU6X 2WXIA 4IFDG 3BWUD 3Q3FA 5CV8A 4YSZB 1WD1A 2NVTB 2RGFA 1A70A 3I91A 1K3BC 3W9CB 3PQIA 3E9IA 3F2BA 4HMIA 2EPBA 4A93G 2QW7A 1OXXK 5JJZA 4K0KQ 2OCEA 4A93B 3IKJA 2FMMA 5GAGC 1RJTA 2I1KA 4TQ1A 2AKWB 4DR6Q 3C0RB 3VYUA 1CK1A 3S2HH 2AUKA 2LGSA 3N30A 1VQLA 1GOZA 2JQOA 5JPNC 3A5ZB 4M00A 2A6HD 3A4SC 5E3FA 2VW9A 3H09A 4L63B 3V6EB 1J5EQ 1TZOA 3EIVA 3RZDH 4N8FA 1II3A 1XMQQ 2KTFA 4JI7Q 3CWIA 1VQGA 4B9KA 5HY6A 5FJ8H 1SN8A 1O7IA 3KJPA 4FXCA 1QUQA 1WVLA 4WURA 3RN9C 1H95A 1QOGA 1STHA 4ZQ3A 1STAA 1NUCA 1XNQL 2MPMA 2WXJA 3M62B 3PSEB 2VQEQ 2Y0SB 3U7ZA 2K14A 1J0GA 1M8AA 4LF9L 2NVYH 3N6RA 3EFCA 4HRSA 4K3CA 1R4QB 1ZEQX 1X3FA 4HSPA 1CMXB 1HTPA 3NBIA 2BKRB 3TEYA 2P5ZX 1H9KA 1B44D 1P0RA 1WIAA 1HFNA 3UQBA 3B1LX 5JH5C 4ZRZA 1SFOH 3VR3A 3K59A 4HN7A 1G6JA 2VQFQ 2F0UA 2EMTA 1VZ8A 4R1JA 4YY3L 4QY7A 1I7HA 1Z47A 1GUOA 2BDNA 5LNK1 1PZID 1C77A 3DVGY 1EIGA 3HG9A 1K52A 3VA7A 3KF6A 1VQEA 1OXSC 3D3RA 1N33Q 2F4VQ 3AE8B 1PH5A 3KLSA 4KZ0A 4CDEC 3NWTA 3I70A 5EBCA 5JVH3 2UUCQ 1X1MA 1GUNA 1XLNA 2VL6A 2XWJB 3AE9B 1K83B 3VUXA 2KX0A 1AZQA 1A2TA 5IP9G 4BVUC 4XWWA 3T1YL 4WJWA 2E2IH 3D8GA 4ARCA 1WJ4A 4ZYSA 3ZDTA 1FJGL 2DLBA 4LFBQ 2MGSA 1BQQT 2B63G 3TIXA 4JX1C 3M3JA 1QNKA 3ONSA 4EUTA 2D0PA 5CBEE 2RF4A 4RGNA 2Q8IB 1FPYA 1I50B 3MC0B 2LZ6A 3K5LA 1V8QA 1RFAA 1PUTA 4K1RB 2MW5A 2WXLA 4I65A 1WCMG 1CTMA 3OMGA 2Z4IA 2LJIA 1DD2A 3ZJYC 4IQZA 3K8AA 5C5LA 1L0WA 2Q8RE 4DXAB 2DJGC 1LXDA 1HZ6A 3NEMA 4R4TA 2OWOA 1G51A 2QGQA 1IL8A 2RSOA 3I8ZA 2FJ2A 2I46A 5D7GA 5AZHA 4YSXB 2N7JA 2PLPA 2BPSA 2CHBD 3IRBA 2NTTA 4ZUIA 4G57A 4QL5A 2RSUA 3UI3A 2F0WA 1TKWB 2B3AA 2KKCA 4PMWA 4EKUA 1NBFC 1I4QA 1O7ZA 1G2SA 4DV2L 4B08A 1KNAA 1E7ZA 1U5KA 3OHXC 3QIAA 5IGDA 1C4QA 1EZ6A 1S5CD 4C3HB 2KTRA 2YVCA 3NS8A 5CV5A 1KJTA 4N9F4 3GTPB 1I50H 4MSMB 2R93H 2JZZA 4J6IA 4M8AA 3EN2A 2GA4B 5IYCH 4A3EH 1KM7A 2H89B 2WXRA 4S0RA 3HOXH 1OQQA 2IYDB 3DBLI 1RL2A 1J5EL 2WXFA 3HM3A 3N52A 2K03A 2M8SA 3PRPB 4LNNA 1U4AA 2JSVX 1Q8IA 1C0AA 2WQYB 2M1MA 4FJYA 1HZBA 1F2RI 3SE0A 4LF6L 4WWOA 1CJEA 1HTQA 1ZP0B 3BIID 3V05A 5M3FG 1TWHB 4LNKA 1N62A 1T5EA 1WTVA 2YLMA 3DMUA 3CCLA 3C2PA 3KOJA 3PO2H 1PGBA 3L08A 1T5XD 1JJ2A 5JJIA 5CR3A 3SHLA 1QF6A 5FOBB 2EYMA 3M3YH 2WHIA 4BA1I 2EY5A 1V9JA 1J6QA 2D3GA 1HTOA 2QDFA 2PMVA 4B9XA 3MC8A 3TUOA 4MN3A 3L3OC 3HOUH 4YXDB 3VR8B 4ME3A 4OHJA 1U4LA 4ZK9B 4JI5L 3F2UA 2GI9A 2Z6KC 4K6DA 3MA2B 3OYYA 2LHDA 2F0GA 4GOPC 3B0AA 4C7YA 2BA0A 4GZYC 2O5JC 2DWQA 2KENA 1A8VA 4X64L 3M4OH 4HKQA 1Z6HA 1FRDA 4NKLA 4L2YA 3GS2A 4WJQA 3HVDA 4C00A 2G5DA 5IY0A 3D32A 1SFOB 4MGKE 4LF4L 2K0PA 4DV1Q 3U30A 4DV6L 1H9RA 4ZHPA 1E8ZA 5DPTA 5M5XH 4CJ2C 2RSNA 4KSLC 2MH7A 2WKCA 4JW0A 4YWMA 4B3SQ 1BKBA 2D2CC 1L6UA 2KACA 3S9WA 5HI1A 1D4BA 4IPDA 3OAWA 2KCMA 2XWBB 4X57B 5I9PA 1V43A 2O2VA 3I63C 2WB1G 3QWNA 4OEMB 1A3TA 1ENFA 3U8ZA 1F2MA 5LMUL 2PJHA 1RM6C 2W54A 2A68C 1MVKA 2KK8A 4BZAA 1RLFA 1EFID 3E6ZX 3H6NA 2I2YA 2IDYA 3GTGH 2JF5A 4KIKA 2EYHA 4OWWB 1WY8A 2MCNB 3VAWA 2E74C 5FLXL 3ZRFA 5C4HA 5M5WB 3NENA 3GTLH 4HCSA 2RCFA 3AEGB 4M0WA 2ICIA 1IBLQ 5HGTA 2KBNA 2L76A 1LTLA 1EUVB 3B2FA 3V3XA 5D94A 1ROEA 2BYTA 4CYEA 1HZ9A 1NR2A 4OVVA 1EYDA 2E2DC 1R4MI 2KECA 1XYIA 1F9JA 1PDXA 2V4IB 4HCNB 1JWBD 4G7ZC 1BT0A 1UEAB 1R4PB 5F2DA 3TP8A 3PZ8A 4ME5A 5M3MG 1A62A 2YTXA 1TWAB 4B3RL 1WXAA 2Y0SE 1TY0A 3E56A 1AFPA 3AFQA 1SYFA 2K8HA 4GU2A 4E74A 1O7YA 5IIFA 1F2RC 4R8IA 1Y8PB 4NXNQ 1LTSD 1BCPF 3CC7A 2KDEB 2PW7A 1RYJA 3BS1A 1YBYA 4G11A 2ZM6Q 4LJPB 5J22A 2OQ0A 1G6ZA 3GZNB 1AWDA 2UUCL 3TQYA 5JJLA 1P98A 3KYDD 4NJ6A 1QZGA 5CHVC 2JYTA 2WXPA 3GE8C 2VRRB 4EZJA 1C8CA 3AQQA 5C23A 4FF4A 1CKNB 2EYOA 4PZ8A 3GB1A 4EZKA 1ASZA 2ZZPB 5T1IA 4ZYNA 2K05A 2JEBI 1GNUA 4Q2JA 1FFVA 1GUGA 2JWZA 4GNXA 1EY8A 2Q2IA 1KIXA 4PMCA 3S1QB 2JEAI 4KX6B 4LNFA 1RF2D 4EQNA 2MNAA 1HNWL 4DBGA 5DLQE 5KNDA 4XE0A 2J7QB 4AYBG 1TT5B 4ICVA 3S1MH 1LM0A 3ERQA 4DHZE 3CCQA 2BVCA 1IBML 2KAJA 1BCPC 4J1MA 1X55A 1SNPA 2VB2X 3AULA 4LTUA 3P42A 5C44G 4B3MQ 2G9HD 4L5TA 3ZTDA 2KUMA 3PHWB 4XXEA 1YITA 4L5RC 3B9JA 2K5DA 1Y69U 1C1YB 5ELOA 2D11A 3VYTA 2DZJA 3RZWC 3ZDMC 3CCMA 2MBBB 4DV6Q 4LMQD 2D3BA 1P16A 4KY7A 3NXWA 4DHZB 2R2OA 4NAWA 5C3JB 3QARA 1NSNS 4N9TA 3RN2A 2K22A 4IFDH 4IM0A 2GBKA 4KZCA 1AH9A 4KKIA 3RD2A 2BKFA 1IKMA 4OZBA 4CBVA 1B1ZA 3M9BA 1PXUA 2L4NA 2MJEA 3HP3A 4K81A 1WTXA 4DV4L 3BDLA 3MHBA 2LXCA 3PLVA 4CO7A 3RNGC 3M4QA 1VRAB 1U4PA 2ZVOA 2WINB 4PMBA 1F9RA 1CFMA 1E9MA 2F0DA 3P4PB 3J7AV 2JA6G 1E7UA 1QKZA 3A54A 3T1HQ 3GQBA 3NE5B 1T6BX 1QG7A 4POFA 1PFBA 4RMFA 1IXRA 1UEBA 1K8RB 5E6OA 2VB3X 1CUKA 1SLJA 2YTYA 1AARA 2KC2A 4YY3Q 1TR5A 2EYJA 4NW2A 2IO0B 4LFAQ 4JI2L 2R7ZH 4A3JH 4OX9Q 3ZXVA 3G71A 3A5UA 1CHPD 3ZNID 3RNEC 3KF8B 1PFNA 4CHTB 1VR9A 3ER0A 4MGIE 1JOOA 5NUCA 1Q1BA 1F0ZA 2LFIA 1Y14B 2REXA 4LF8Q 4IDIA 2IGHA 1LABA 3TP6A 1SAPA 1PTOC 3A8JE 2F0IA 1YHQA 4IOCA 4DR4L 1HA5A 2OJWA 3JYUA 2M17A 5DPWA 1DOMA 2SEBD 1LQBA 5LLIA 2X6LA 1XMQL 1XEEA 2JUOA 2PVGC 1P7FA 1AZPA 5IYDH 4GKJL 1XNRQ 2RHQB 1A6XA 4UP9A 3TEZA 1GPXA 2O4XA 3K0YA 2ZJDA 1ENCA 2JA5B 3W2DA 1W3SA 2NVXH 2EIFA 3NUHB 2K5HA 1I4RA 3VR2A 2V3SA 4KMUC 1RHPA 2KLCA 5EKKA 2CS4A 4DHJD 4QGUA 2RQXA 3R7QA 1BNZA 1B9RA 2K6AA 3RULA 2FIDA 2N3SA 4P7IA 1Y56A 2RR9A 3BK2A 4PQXA 2ASBA 4F8CB 5A2QL 3AEDB 3T3OA 1PRTD 2K25A 3IG3A 2R61A 4TUUA 1TTNA 2N9KA 4II3B 2F0EA 1HCZA 4GKKQ 2I5HA 2DAFA 4EQ5A 3N1ZC 3CMEA 3C1EA 4KI0A 2WAQG 1ZXHA 1TXYA 1DXMA 1JCKB 2RBMA 3EBEA 4PYUA 4B3TQ 2JA7H 3PMFA 1I6HB 3QJYA 1IYVA 2QILA 2K33A 3M4OB 1D1IA 1SE4A 1EIFA 1I4GA 3S15H 1YN4A 1RTOA 3TN2A 3GO5A 1L6VA 3UDFA 3AEEB 1HZAA 1HPCA 3N1YC 1WZ0A 2MHJA 5IT9L 3VFKA 4IUUA 3SD5A 4JI3L 4YWKA 1QB5D 2VNUD 3VTUA 1HQRD 5CHWA 2OXPA 1L4DB 5IWAL 4U673 2O6VD 1SSNA 4AOFA 4FO2A 3T16A 2IGGA 4IPCA 4L6TB 4DUZQ 3T1YQ 1ZXIA 2ZXOA 1VS0A 3ZNZB 3PIO3 1C78A 2EELA 1BBUA 4TQUS 5EPLA 2OEDA 1PH9A 2FXQA 2DGYA 4WJPA 1NJIC 2DJFC 4QUCA 3GTKH 2K75A 4CDFC 2JA7B 3JVZX 1HZCA 4DR3L 3GV6A 2W3RA 4XYCA 4V0BA 3S24A 1VQKA 3GOEA 4P6VF 2LD9A 4MM3A 3P4QB 1E2ZA 5L83A 1Q86C 3RD4A 4AWJA 4JYAQ 4DDGD 3CP0A 4TKOB 3RZFA 2KWVB 1NYRA 3C8YA 4W9GA 4G50A 2HIVA 3ZYYX 3CPFA 1NR4A 2ZTCA 2KMMA 2N9EB 3FKIH 2V3PA 4DV0L 2GVBA 1E8XA 2O5IC 3G48A 1W2BA 4QJFA 2QDBA 1LYLA 1IBXB 1PYBA 4GSWA 2IHEA 2NR2A 2QC8A 2A6HC 3NZUA 4MH0E 1JW9D 1E0ZA 1CI3M 2B2WC 2X8XX 4L8JA 4ALPA 1WJUA 5AFWA 3KYCD 1EUJA 4DR1L 4F88A 4JIOU 5JZEB 2A1AA 4X62L 3K9OB 1FYCA 4ZRQA 1SRUA 2WB1E 1YIJA 5D2MB 1KNEA 1NI2A 4N8X1 2EYLA 4JG2A 4DAPA 3Q8CA 1L2NA 2MEKA 3P63A 3CCEA 2KTRB 2W9NA 3AV8A 3ONAB 4MHEA 4LF6Q 1KH0A 4IFDJ 4C7ZA 2KHJA 4HMJA 3DBHB 5C0XH 4JC0A 1SYEA 3BJUA 2L11A 3IFTA 2Z4HA 3QG1A 4YWLA 2E2IB 2Z1CA 3AEAB 5GQOA 1EIYB 1JE5A 3AMZA 4W9CA 5GMVA 2VUMG 2CH4W 1PTOB 2PIAA 1STYA 4DV3L 1RD9D 4P74A 1TQOA 4DV7L 1HR0L 4JI0L 2XK5B 3Q6SA 1AN8A 4GLSC 4XDCA 4GIVA 3L16A 2Z6KA 4CQNA 2J7ZA 4C3IB 4JI1Q 1Z9FA 4OWTB 1RWSA 1STGA 2HJ8A 3EUB2 2KHIA 1PH2A 2HDEA 2RHSB 2E2HB 1PZJD 2NTSA 4K5XA 3EECA 2HCCA 1HNWQ 2KDMA 3ZGZA 2KN5A 2FUG1 3PV0A 1C7YA 2C35B 1LTBD 1EIHA 4DHJB 2LVPA 1GJXA 4IJLA 4J6HA 4JI8L 3EC8A 4IO9A 4GXBA 1N32Q 4GDLA 4FN2A 4B3ML 1LUZA 3DHIC 3I4OA 4KHVA 1B9MA 3EFUA 1B70B 3TEHB 1BUIC 3MHZA 4WH4A 5DPSA 1L0XB 2K6DB 1XWEA 2A68D 3NTKA 1CQFA 5EE1A 1YNXA 3LGJA 1MI2A 3M4PA 3NQIA 4R4CA 1MJEA 3APDA 2AUJD 4M1UB 2L52A 4OVUA 5C2TB 1EY5A 1AE2A 1TWGB 1HNXL 3MXNA 3TEXA 1OXVA 1K9MC 4MGYE 3RNAC 3WAPA 1L1OC 4R4IA 3HKZB 1IYUA 2BS4B 4KIKB 5D65A 5ISRA 1EQVA 5IOIA 2E6XA 1EEID 3DWAA 1XLQA 1CZWA 1WM2A 3R7RA 2K8BA 1PTOF 4A3IG 4KV2A 1DOYA 4LNOA 2BYFA 5FLMG 2JT4B 2K39A 3K57A 2L3ZA 1XO3A 2MP2B 3T9LA 2NBVB 1Q12A 2ZTDA 4I7ZC 1N5WA 3QJZA 2E75C 3L10B 2JJQA 1TVXA 3J81i 3RNBC 1A2UA 1VF7A 1STNA 1D3ZA 3GD7A 2UU9L 5C6AA 2NZHA 4DF7A 3H91A 2LUEA 2D62A 5ELEA 2N88A 1K0RA 3S17H 2GBNA 3BZDB 1FGUA 1SDFA 4KDIC 4R4OA 2R3ZA 4ABNA 2A69C 4PNYA 1WYDA 2NZ1D 2WU2B 1UF0A 5DPRA 4TSSA 3K5OA 2M0XA 4LUZA 2H1EA 1QLBB 1IBMQ 2KDBA 3RLOA 2WNMA 3RFZB 1XJVA 4KGTA 4A3FH 2Q5WD 3NY5A 3BG3A 5A35A 4ACFA 4F87A 1EYCA 2YU9B 4MM3B 4NB3A 1PV4A 2F0HA 2BQQA 2JWUA 2JRIB 4KHPQ 2C60A 3Q3NC 3FP9A 3P4RB 3MWYW 4A3LH 4DWFA 1DONA 4DK6C 2Q2HA 3HKZG 1YNJD 2E5LQ 2L8JA 4PS7A 2CVRA 4W9HA 2PZTA 2J0TD 4ARIA 3NVVA 4NNJB 2KXJA 2VH1A 4HJ5A 3K6OA 4LUOA 2Q2TA 5KHQA 3MFYA 1FJGQ 5IWAQ 2IO2B 3D4WA 3AEBB 3MZ5A 2ICEC 2VXWA 1ZGUB 5KYLA 2N55A 3W1GA 2DZIA 4A3DG 1MIUA 1GB4A 1BVSA 4LFCL 2G1EA 2NN6G 2PO4A 4QIWB 2X6GA 1DOIA 2OJRA 5LXIB 5FO8B 1D6EC 3U58A 1WTPA 3Q2AC 3ABVB 5KYIA 2BH8A 1IGDA 3ZVVA 1IYFA 2M2LA 1A5RA 5M3MH 2MJ3A 1GD7A 1VQOA 1TZ1A 3NHEB 5LXHA 2BB5A 4FBJB 3BY4B 3J81E 4ULLA 3Q8FA 1JOKA 3UE1A 3HS0C 1SJED 4JI8Q 2DAJA 1KAAA 4IUVA 4PV1C 4N59A 4A3GG 4PS8A 1I3QB 2R7ZB 1XCTL 1UE1A 4YCVA 3S17B 2L5TA 4JOIC 4FXKC 3ZIMA 1MPEA 3I4NB 1UD7A 4FHKA 1TIID 2HDLA 3FKIG 5C0XG 4A76A 3AEVA 4A8XC 1C9FA 1JC7A 2F03A 2MSED 4HK2A 1KC8C 1VJKA 2ENBA 2LKVA 2MO0A 4NXML 2D3AA 4IOAA 4WJOA 1LTAD 1SNCA 3P20A 4HSVA 3GTGB 1LGRA 4FLHA 2A73B 2B29A 2IO1B 2PVOD 3MTSA 2HHHQ 1L1OA 4XTCS 4B0MA 1SMXA 1JMCA 3VYRA 5AUIA 1F9QA 1HTLD 2JXTA 1KLGD 4DK0A 5HG2A 2A6EC 1YQBA 4ZKCB 3FHWA 3KVFB 3W1BA 3BYTB 4DNIA 1GKHA 4DDID 1OQRA 3VR9B 2GVAA 3LDZE 4UHVA 3JAMi 4DV7Q 3L0OA 1HR0Q 4JI0Q 5MPOA 4C80A 4YTMB 3S14B 1IBKL 1JOQA 3E0JA 1V80A 3OTOL 4FADA 2VS1A 1I4HA 3IFDA 4F8MA 3Q8AA 1IHZA 1N33L 2F4VL 4OGQC 5HHDG 2EZVA 4HDQA 3KLRA 5IE8A 4RGMA 2NBUA 3MJWA 2KWDA 4WJ3M 1HE8A 1HR0W 4MIUA 1M90C 3I3TB 1K83H 3A7AB 3SGIA 3HOVG 4FP5D 2A4ZA 2BCOA 5KEEA 1PHJA 1GXDC 3K58A 4XT1B 2V1CC 1NAPA 1PA6A 1XT9B 4IM3A 2MFIA 3UIOB 4E71A 2UU9Q 1VLBA 2MO1A 3O13A 4LFAL 2AMCB 1VQ4A 1CSPA 4IWQA 5KHOA 2BB6A 3PGZA 4M8NA 3G6EA 5AJ3Q 5JEAJ 1RFKA 4MDKE 4DUYQ 3KWLA 1ZXTA 4F7XA 1PH1A 1W6KA 2OEOA 4B3SL 4US9A 3QOJA 1YJWA 1L4ZB 1EQTA 4GKKL 2KX3A 4OWXB 4KV6A 4BS9A 1OTRB 1PDQA 1TBEA 2EXZA 1WJ6A 3JSVB 3WIMA 3CMAA 1EY4A 2C9WB 3I4MH 3CXCA 4LDTB 4BY1G 3VYSA 2AHOB 2K28A 3H3VH 4ANUA 2WKDA 5FR3A 5CMDA 3Q24A 2INDC 1S5ED 5FLXE 1ENAA 2KQSA 3RR5A 4GNXB 4BBSB 1BCPD 3TZDA 3J80i 5C3EB 2GBMA 4ZRJA 2F0FA 2ZPNA 2KT7A 1CKNA 1DGSA 4GN5A 4G7OC 3QK0A 4HWIB 4A3OA 2I07B 2QHOA 5BYSA 1CM9A 4UPAA 5IGFA 2DNEA 2HQLA 3RNFC 5GADC 4HJKA 4DK5A 4X3UA 1X32A 3G6JB 4XQNA 2B3GA 4G0NB 3Q3MC 4R3DA 3P75A 2N78A 2YYZA 4MTKA 3BDOA 2MP2A 5D3IB 3LYYA 1QOBA 1OEYA 3KDFB 4NPSA 1G291 4OZCA 1N34Q 1KAWA 2R92H 1FEHA 2L0TA 4K14A 4KHZA 1B8AA 4H2AA 1SE3A 2EKIA 1YJ9A 1ZUD2 3NG0A 4A3DH 3K5MA 2VQEL 1MJDA 1V8CA 3GTMH 3C3LA 3K81C 1TKGA 4A3FG 2QDLA 2NPTA 4GOCA 1WXMA 3EROA 2TMPA 2SNMA 1HJPA 1K0SA 4KVGB 2RDHA 4Y52H 1XQQA 1FNVA 1OTCA 3V6CB 4QB4A 3RLFA 4DR2Q 3ZW3A 1X65A 1VQNA 4QQBX 1HA6A 4A3GB 2JXXA 3OTOQ 2JZ3B 3B08A 1F2LA 3VR4A 1EWYC 1CA5A 3B2GA 1HQMC 1B3AA 4IJHA 4JWSC 2XIWA 4KKJA 1WTHA 1L0YB 2QEXA 1WMHB 5C5MA 4ZRKA 3LNNA 3RCZA 3NWSA 1TY2A 2JA6B 4XIGS 2CW0D 4HAEA 2LFNA 2VZAA 5KIXA 1YNTE 4GMVA 2YU9H 1I42A 2DY7A 2PQEA 1SROA 3PRZA 2A8VA 1WXVA 1F9PA 4ZCKA 3TBIB 3EHVA 1P1AA 4XZ4A 1N60A 2O2VB 4A55A 3APFA 2N8NA 2WDRB 3D6WA 4KHPL 3H7PB 4ID6A 1PH4A 3DBRB 2MP1A 3OWFA 4KD4A 2CJNA 3S1NB 5C1ZA 2UUBL 3PO0A 3J80E 4LF7L 5C3EH 5E4WC 4XYOA 4OXPA 1ZYRC 4UY8C 5H1SE 3TRZA 1VCBA 4QIWE 2L05A 4NZLB 1PRTC 3DWQA 4DV1L 1X56A 2DZKA 1BBWA 4OW0A
chains in the Genus database with same CATH topology
1Y1VB 4DGZA 2KHSA 2JA8B 1VCIA 2F0VA 2GRIA 3DEPA 1K53A 1T3QA 4FXDA 2O2LD 2ZXPA 3ITPA 4ITKA 3NS1A 4YSYB 3SR6A 4E6IA 3RZDB 2F0KA 3R8BA 2J53A 1D1KA 1W6JA 1EU3A 2B2YC 5BMIA 2KJXA 3T4AC 1IBXA 3CHBD 2WV6D 1SYCA 1HZ5A 3T56B 1GAQB 1WTQA 4DXFA 1NVID 1PGXA 3FILB 3PO2B 4WFN3 3MAQA 2BT6A 2WXMA 3A8IE 1FD7D 4KGSA 4EE2A 1FD6A 4RF0A 1Y1WB 3TDQA 4JBWA 2ID0A 4C1NK 5CV4A 4C56C 3PUWA 4TMAB 4YTPB 1HXYD 1UAPA 1YJJA 2PNRC 4N9PA 4DAYA 4A3EB 3WOEA 3M4YA 4ZOHC 1DYQA 3GTOB 1LTID 4KK7A 1EYAA 2B2WA 1CT1D 1YNND 2NYZD 1UGJA 3OIPA 4P16A 2KVMA 4EQOA 1SEBD 3I57A 1XLPA 5TSSA 5BYQA 5C0XJ 4IOIE 2E76C 1I6VC 1SYBA 1EOTA 3HZXA 3URYA 3N9YC 1YJIA 2NVQB 2IT1A 1UUPA 1LT3D 3IXSA 2L12A 4KJNA 1ET9A 1RDPD 2EY6A 1LT6D 1N61A 1D5MC 1ZDVA 4RGOS 4K2KA 5LHY1 1K50A 5IT9E 5C0XI 3AE4B 5BMHA 4EVOA 1XLOA 2MUYA 1VZ6A 1A3UA 1EL0A 4A3BB 1QQRA 3AB9A 4G7HC 2D5GA 5IODA 1YMHE 3R2TA 4DAVA 3G7LA 5C4JB 1QOHA 4XQJA 1SE2A 4V190 3RUZA 4H44C 5KNCA 3FRPB 4OL7A 3SEBA 1KDCA 4A90A 5CV6A 1TT2A 4FF1A 4G4KA 2Z8LA 4DNRB 2NN6H 2JQRB 4FF3A 1BDOA 5AUKA 3HOXB 1PLFA 1JWAD 2QIEB 3T53B 4CKEA 1FXIA 3OSOA 4LLGM 4UAIA 5M3FB 1PTOH 1O78A 3Q23A 3NZ3A 3OMCA 1IGCA 3Q22A 1FM0D 4YTNB 1LTRD 3U52E 1Q1EA 4AQ7A 5IGCA 1F2ZA 3AH7A 1KF6B 1BOSA 1JWMD 4L1BA 5JXVA 1QWYA 2PW9A 5BN3A 1SJHD 4RGTA 4JPSA 1DZ1A 1QT9A 4Q0FA 2JXMB 5HFYA 2K7VA 2KQ4X 1E2WA 4DQOC 3SFEB 3EA6A 2EJMA 1HEZE 1OXUA 4QMGA 1DM0B 1LT5D 1BO0A 4RCNA 1IW7C 3J9CA 3JAME 1JB3A 1H9JA 3HOZB 1KABA 3HOVB 2H88B 5EPKA 1FR3A 1SYDA 2AQ2B 2EYPA 5BN4A 1FMAD 1JALA 1FFUA 5JEAG 2RPVA 3EQLC 2L1BA 4RKBA 1ILPA 1H9MA 4QCLA 1MGSA 1Q3LA 5C4XB 1F77A 4H13C 4ZHOA 3L4PA 4A3JB 1VZ7A 4RFBA 2AWOA 5DNFA 2KN4A 4NMZA 2FMCA 5CORA 4JWUC 5I6YA 2B2VC 3AMUA 1MSHA 1ONLA 4Z9CB 4HEDA 1AP0A 1EM7A 2JSOA 4FF2A 5KRUA 1ZE3D 2ZXRA 5BYRA 2D9UA 3RPFC 3AECB 3NHHA 2EY1A 1OFFA 2XSCA 3R3OA 4NP5A 1KRHA 1SNOA 3R93A 3FKIB 1Z7TA 1RODA 3KK7A 1LV9A 4DN4M 5CGKA 1TKYA 1WXQA 2KQ3A 1SNQA 4LK1C 1LTTD 1LO5D 4N6EB 3SK5A 1YN5A 3DWPA 5CC4A 1MI0A 2RMMA 1ZPSA 2LS01 2FINB 1X3QA 4OO1H 2CJOA 1HHVA 2Y5PA 1A15A 3AN1A 3AE5B 2Y5CA 2VZKB 3ND8A 3BVMA 3H0GB 2XRSD 1SXTA 2EDGA 3S1RB 2DNCA 1SYGA 1B50A 1J7CA 2YEPB 3NTHA 2F0TA 2HDMA 3IL8A 2PYKA 1H9SA 3P7JA 4KKUA 2ACZB 3GTLB 1JE4A 3AE1B 1V97A 1TKEA 4C3JB 4DA2A 3NQTA 4C3JG 4HKZE 3AB5A 1I4XA 1SMYC 3C46A 2L83A 3GTJB 3D31A 5CV7A 5T8IA 5T1GA 1V1PA 1E7PB 1BXTA 1QOAA 1GUWA 5C3XA 4A3MB 4IUTA 2K1BA 3RZOB 1ESRA 1JWUD 2AQ1B 2EYFA 1HFGA 1ESFA 3L7ZC 5FO9B 2B39A 2ZT9C 3DWGC 4H0LC 5EGTA 2YEPF 2XVSA 1DCZA 1QNUA 4KKSA 1DOXA 4J8QA 2V3NA 3VR6A 1WD0A 2FHTA 1SNDA 3FPPA 2IWHA 2PTLA 3AE6B 2L55A 1JQYD 5M3MB 3QB3A 4IFDI 5D3DA 2CQAA 5J39A 4WIPA 1VMPA 3NVZA 1YNJC 1N63A 4OO1I 3CKIB 1ET6A 1G8ZD 3NTIA 4FNFA 3KBXA 2LUMA 5EE0A 2B2TA 5K36H 4HR7B 2N0SB 3I4LA 5FKAC 1C79A 2K5QA 1GUTA 2F0SA 2AX5A 3DXJC 3HOUB 1MSGA 1XXGA 4HTHA 2WXKA 1C48A 1BR9A 1CZGA 1FCLA 2KEEA 4IURA 4C3IG 1Y8OB 5CYUA 3NUCA 2ONQA 1STEA 5I2YA 4ZKBB 4S3SA 4BBRB 1WTWA 2PKOA 5EJWA 3WCQA 1LTGD 2LMCB 3AE7B 1EY6A 4XT3B 4DK1A 2DN8A 1TS4A 4KTAA 2A74C 1U4RA 1K8OA 4KGRA 1A3VA 1TS2A 4RKLA 3ND9A 1SB3C 3HEJA 1TS5A 2OT2A 1L5PA 3AE2B 1DGJA 3NVWA 2PCFB 2PPBC 3IAS1 1UWXA 3C1FA 5DAUA 4JE3B 4HROA 2FE8A 3PUXA 3W5UB 2X69A 2SAKA 2LY7A 2JZPA 3PZ7A 2WXOA 3U2SC 1SNMA 3PUZA 2MJDA 3T51B 3EJIA 2BS3B 2QMTA 4AS1A 1BBXC 1PRTB 2CW0C 3DM1A 4MT5A 3HRZC 4BY1B 1J7AA 2VZKD 1EY0A 1C76A 4CJ0B 4OO1G 3S2DB 4CGYB 1QE6A 2A5HA 5IOCA 2HUGA 1LLRD 3TSSA 1I4PA 2I38A 4PT5A 1XF5L 3QOLA 2F0LA 1ILQA 2M19A 1ACCA 1DOLA 1JR0D 3Q8EA 3FEWX 4RWSC 2B2UC 2EVBA 3AEFB 4FVMA 2BA1A 2EJFC 4HEA1 4KKTA 2W55A 3SFDB 2EJGC 3M85A 2B2TC 4A9AA 3MFGA 2B8FA 1CA6A 3GTMB 1PRTF 1FIQA 1SF0A 1S4ZA 3H3VC 1C4PA 2L32A 4K5VA 2KA7A 3KF8A 3PUVA 3V2TA 4Q5VA 2RVLA 4K8JA 1PTOD 3TP7A 2L0CA 4U68A 3AM9A 1C4CA 1VDVA 1EZ8A 2XN9C 1CQVA 1U9RA 5D14A 2F4IA 2K3UA 1SIJA 3RMHA 4WAFA 1B53A 1P7EA 2QSDA 4RHSA 2M56B 1PGAA 1MD2D 1BCPB 3NSWA 2MJ8A 4ODGA 3NBHA 2QKIC 3HUIA 1HUMA 4K8IA 3W1SA 3S1MB 3OWEB 4K2LA 3I3CA 5DEHA 3X3MA 4KY6A 1YNNC 3KUPA 4A3IB 5JOBA 2F0NA 3I4MB 2G9DA 3TMEA 2QJLA 4JK1C 3JAML 4B0EA 2KCNA 3FPUB 5IGEA 3IAYA 1RKNA 1J8IA 1QILA 3H8HA 2WS3B 3R2IA 3FILA 4P2CB 3A56A 4CJ1B 1S5BD 5J1ZA 2ZW1A 1YN3A 4EGVA 5CV9A 1BMLC 3P1HA 4RF1A 4US8A 2WIIB 1NYQA 5JPMC 1WYGA 2INNE 4IKGA 2B2UA 2F3VA 2IW3A 5KGUA 5IGBA 4AYBB 5BMGA 2IX0A 3UI2A 4DNTB 3NRZA 1EWCA 1AEXA 4YT0B 2HQEA 4TQ0A 2DYMA 3OIQA 3HVZA 2IX1A 2WXNA 4BA2I 3SXHA 4OVZA 4ZUJA 1F2YA 2JYOA 1TS3A 4NDXA 4FXGC 2MHVA 1FNUA 1EU4A 5DM63 1ML0D 2DYOA 1AW7A 3PO3B 2K9XA 1IW7D 3OPOA 4EQPA 1N5XA 1CHQD 2SNSA 2Y3AA 1SBBB 4TRDA 3U9SA 2NVXB 3X3NA 2NVYB 1TU2B 5H8YE 1OO9B 3MP9A 5M9OA 2JE6I 2NB0A 2Q8TA 1DOKA 4MH8A 1EY9A 2J4XA 1E2VA 4DFAA 2M9VA 1ZYRD 4X3SA 1ZKOA 1JWSD 1GHKA 2D5DA 3S2HB 3VQIA 1PFMA 4IALA 2NN6I 1WSPA 5FK9C 5M5YB 4OIKA 2WB1B 3WDNA 1FCCC 1SSOA 1NENB 3QO2A 1TYGB 3U9OA 1EWHA 4IUNA 4K5WA 2VUMB 2NMQA 3T3NA 3LXFA 2OF1A 3J7AF 3BDCA 3MXUA 5EBDA 5LL6X 2SDFA 2E2JB 3M3YB 1PYWD 5I9OA 3ZJUA 4GDLB 2HCIA 2F0MA 3KBGA 2JYEA 4O42A 2X38A 3LWUA 3IAM1 3L9AX 3V96A 4WORA 2LGIA 3VA5A 5EE9A 3KQ4A 2B8GA 2XNAC 2A6ED 1BF4A 1BUVT 5H92C 2ON8A 1JROA 2J42A 3MJ5A 2F0OA 4KY5A 1D2BA 1NI3A 4UDUC 5EKIA 3K5NA 3J7YW 5ELCA 2V0GA 3D4DA 1KDBA 4X3KA 3T13A 1F9SA 1E10A 1X3PA 2CU3A 2F1MA 4YWGG 1DJRD 2IGDA 1RCVD 3A55A 3DWMA 1G91A 3I9V1 3GTQB 3SK4A 3EGRA 4DXGA 2F0QA 1V1OA 5JVG3 2F0JA 3PUYA 4IN3A 5M5XB 3I72A 1JICA 4R9WA 4GDKB 4RAUC 2WLBA 5GXGB 3KLSX 5C3WA 1OXTA 3ETRA 1QJOA 3K7AB 1H9SB 2JX5A 4XYQA 3BYYB 5ELDA 2J52A 1VF5C 2F0PA 1TJEA 2C9OA 4J3OD 4RNAA 2LEKA 5I2XA 1XTCD 2EOTA 2K01A 3J81L 2R6GA 1Q10A 1D5ZC 1S5DD 3FC4A 5A2QE 3AE3B 3DUZA 1EEFD 2LMCA 5G5GA 2HTME 4CKBA 5EE3A 3HRDD 3TEWA 4Y7NB 2EE1A 2K5PA 3NVYA 2RA4A 3BK1A 4CKCA 3SK6A 3PIP3 2BE5C 2PZWA 2RDGA 4XDDA 4RH6A 1O7LA 5E1FA 4R8NA 4REZA 4C2MB 2RDFA 3NK9A 4ZLTF 2LHEA 3S16B 1KLUD 1HRJA 4A6QA 2BDOA 1J9OA 2NUCA 1GUSA 4HCEA 1FRRA 4BY7B 3FAHA 1B4OA 4DU9A 3E5SA 1D5XC 3CRKC 2B76B 3I73A 4KJOA 3HOYB 2WDVB 3A8KE 3HGBA 2WXGA 2PMZB 2WDQB 1YQ3B 3BVZA 3NPPA 3IT4B 3W5VB 4NJCA 3CRLC 5I4DA 1ICWA 2KCCA 3EFXD 2WXHA 1ZDXA 5C4ZA 4QF4A 5EPJA 2QCPX 4XQQA 1G2TA 4IUPA 1WWTA 4IUQA 3E9SA 3OOCA 1FXAA 2N9LA 1TWCB 2XRQD 3SDZA 1B2TA 1E6EB 3CU7A 1SMYD 1NCVA 1IKLA 1KDAA 4ILWA 5C44B 3U4EG 5E6JA 1WGKA 2R92B 4RCOA 4ZAIA 4LJZC 2A69D 2KOLA 4X3TA 1L0VB 1ZOYB 4OIJA 5JEAH 3I90A 2ZW0A 1JRPA 1MHXA 1C4AA 1QOFA 1O80A 2WU5B 5I6WA 3KWVA 1Q90A 2KEDA 4C1NI 5IGGA 2IL8A 3Q8BA 3VRAB 4L23A 4WRDA 3AU7A 1PFDA 4A3FB 2TSSA 3CQZB 3CIRB 1EY7A 2K32A 3FDTA 1MHHE 1M4VA 1YQ4B 3D6CA 2IJ0A 3DEOA 4A3KB 1LACA 1XX8A 3M7NA 1LT4D 1RTNA 5JAVA 3TP5A 1S5FD 4XDXA 4NAMA 2SOBA 3MEHA 3A7LA 5K5PA 3MXPA 1Y8NB 1XCQL 2BOSA 3J80L 2F3WA 5E4XA 2QF7A 4H7BA 1IUEA 3LX0A 4HJGE 1HUNA 3OW7A 1GB1A 3DHQA 4ZRPA 2W3SA 2FBWB 5ELBA 2K5WA 2BBCA 5KNBA 3FVQA 2AWNA 1MBYA 3M7GA 1R9TB 1V1PB 4WQMA 1J7BA 3LB8C 4XWTA 3P4SB 2QEJC 4FYDA 3MXGA 4KN7C 1FO4A 4KD3A 4N58A 2PZUA 2L1AA 2AQ3B 4RA8A 3VRBB 3Q69A 2V4DA 2L9HA 1WTRA 1VMCA 3ZJTA 2JP1A 2BW2A 2BS2B 2M00A 5EKLA 1NEKB 5G5HA 3GP7A 3H94A 3BVGA 1PMRA 2BTEA 1KFYB 3P1MA 5G3LD 2WAQB 2DY8A 5LL6S 2R93B 4B9WA 4LK0M 2NWGA 2WACA 1JORA 2E3TA 1B9NA 1U4MA 3IT6B 5ELFA 3GV3A 3S15B 1K8MA 5DM73 5CBAE 2B63B 2RKSA 2C5CA 5FO7B 4NAWB 3SVMA 1K51A 3HOWB 1FGBD 3Q0AA 3EVQA 5BN5A 2DBYA 1JMLA 3MVVA 2IPKD 3TZUA 1UNSA 4USAA 1FNWA 1STBA 4IZ8A 4LAAA 1E0BA 1TWFB 3H6MA 3ZJVA 1PZKD 2PW5A 3NP8A 1UWMA 5K36G 4K6LA 4C3HG 3ZQ4A 1KTKA 2K04A 1QCBD 2EY2A 2H4OA 2FFKB 2GB1A 3VR5A 3SK8A 1R7SA 1CZPA 3W3AA 5G3LF 1VDZA 4RHRA 2WP9B 4KN4C 4BWGB 1WTOA 5COYA 2OHFA 3WOFA 2INPE 4O1NA 3D4RA 5EQ0A 4OZAA 3FMCA 1GHJA 5HURA 4MACA 2B2YA 4D2KA 4WWMA 2W82A 2IX3A 2BE5D 2NBFA 1AYFA 2WP8J 1WCMB 3GTKB 2M0AA 1WRIA 2B2VA 2WXQA 4QUFA 3LWEA 4YIJA 3SR1A 4A3DB 1JQ4A 2JU6X 2WXIA 4IFDG 3BWUD 4YSZB 5CV8A 1WD1A 2NVTB 3W9CB 1A70A 3I91A 4HMIA 2EPBA 1OXXK 5JJZA 4A93B 3IKJA 2FMMA 1RJTA 4TQ1A 3VYUA 1CK1A 2AUKA 1GOZA 5JPNC 2A6HD 5E3FA 3H09A 4L63B 1TZOA 1II3A 3CWIA 4FXCA 1WVLA 4WURA 1QOGA 1STHA 4ZQ3A 1STAA 1NUCA 2WXJA 2MPMA 3U7ZA 2Y0SB 1M8AA 3N6RA 4HRSA 1R4QB 1ZEQX 4HSPA 1HTPA 3NBIA 3TEYA 1H9KA 1B44D 1HFNA 4ZRZA 3VR3A 3K59A 4HN7A 2F0UA 1VZ8A 1I7HA 1Z47A 1GUOA 2BDNA 5LNK1 1PZID 1C77A 1EIGA 3HG9A 1K52A 3VA7A 3D3RA 1OXSC 3AE8B 3KLSA 5JVH3 3NWTA 3I70A 5EBCA 1GUNA 1XLNA 3AE9B 2XWJB 1K83B 1AZQA 1A2TA 4XWWA 4WJWA 4ARCA 3D8GA 4ZYSA 2DLBA 2MGSA 1BQQT 4JX1C 1QNKA 5CBEE 4RGNA 2Q8IB 1I50B 3MC0B 3K5LA 1V8QA 1PUTA 2WXLA 4I65A 1CTMA 3OMGA 2Z4IA 2LJIA 1DD2A 4IQZA 5C5LA 2Q8RE 1HZ6A 1IL8A 2RSOA 3I8ZA 2FJ2A 2I46A 5D7GA 4YSXB 2N7JA 2PLPA 2CHBD 4ZUIA 2NTTA 4G57A 3UI3A 2F0WA 1TKWB 4PMWA 1I4QA 1O7ZA 1G2SA 4B08A 1KNAA 3OHXC 3QIAA 5IGDA 1C4QA 1EZ6A 1S5CD 4C3HB 5CV5A 3GTPB 4M8AA 2GA4B 2H89B 2WXRA 1OQQA 2WXFA 3N52A 2K03A 2JSVX 1Q8IA 2WQYB 1F2RI 3SE0A 1CJEA 1ZP0B 3BIID 3V05A 1TWHB 1N62A 1T5EA 1WTVA 3DMUA 3C2PA 1PGBA 1T5XD 5CR3A 3SHLA 1QF6A 5FOBB 2EYMA 4BA1I 2EY5A 2PMVA 4B9XA 3TUOA 4MN3A 3L3OC 4YXDB 3VR8B 4OHJA 1U4LA 4ZK9B 3F2UA 2GI9A 4K6DA 3MA2B 2LHDA 2F0GA 4C7YA 2BA0A 4GZYC 2O5JC 2DWQA 4HKQA 1Z6HA 1FRDA 4NKLA 4L2YA 3GS2A 3HVDA 1SFOB 2K0PA 1H9RA 4ZHPA 4CJ2C 2RSNA 2MH7A 2WKCA 2D2CC 1L6UA 2KACA 3S9WA 5HI1A 1D4BA 2XWBB 5I9PA 1V43A 3QWNA 1A3TA 1ENFA 1F2MA 1RM6C 2W54A 2A68C 1MVKA 1EFID 3E6ZX 2I2YA 2IDYA 2EYHA 2E74C 5FLXL 5C4HA 5M5WB 4HCSA 3AEGB 4M0WA 2ICIA 5HGTA 3V3XA 3B2FA 1ROEA 2BYTA 1NR2A 1EYDA 2E2DC 2KECA 1XYIA 1PDXA 2V4IB 1JWBD 4G7ZC 1UEAB 1R4PB 5F2DA 3TP8A 3PZ8A 4ME5A 1TWAB 1TY0A 3E56A 1AFPA 1SYFA 1O7YA 5IIFA 1F2RC 4R8IA 1Y8PB 1LTSD 1BCPF 2PW7A 1RYJA 3BS1A 5J22A 1G6ZA 1AWDA 2JYTA 2WXPA 1C8CA 4FF4A 2EYOA 3GB1A 5T1IA 2K05A 2JEBI 4Q2JA 1FFVA 1GUGA 1EY8A 4PMCA 3S1QB 2JEAI 4KX6B 1RF2D 4EQNA 5KNDA 4XE0A 3ERQA 2KAJA 1BCPC 4J1MA 1SNPA 2VB2X 4LTUA 3P42A 2G9HD 2KUMA 4XXEA 3B9JA 2K5DA 1Y69U 3VYTA 4LMQD 4KY7A 3NXWA 5C3JB 1NSNS 4N9TA 2K22A 4IFDH 4KKIA 1IKMA 4OZBA 4CBVA 1B1ZA 1PXUA 2L4NA 2MJEA 3HP3A 1WTXA 3BDLA 3MHBA 1VRAB 1U4PA 2WINB 4PMBA 1F9RA 1CFMA 1E9MA 2F0DA 3P4PB 3J7AV 1QKZA 3A54A 3GQBA 3NE5B 1T6BX 1QG7A 1PFBA 2VB3X 1TR5A 2EYJA 4NW2A 1CHPD 4CHTB 1PFNA 1VR9A 1JOOA 5NUCA 1Q1BA 1F0ZA 2LFIA 4IDIA 2IGHA 1LABA 3TP6A 1SAPA 1PTOC 3A8JE 2F0IA 1HA5A 1DOMA 2SEBD 2X6LA 1XEEA 2PVGC 1P7FA 1AZPA 1A6XA 3TEZA 1GPXA 2O4XA 3K0YA 1ENCA 2JA5B 3W2DA 3NUHB 1I4RA 3VR2A 4KMUC 1RHPA 5EKKA 2RQXA 1BNZA 1B9RA 2K6AA 1Y56A 3BK2A 4PQXA 5A2QL 3AEDB 3T3OA 1PRTD 2R61A 2N9KA 2F0EA 1HCZA 3C1EA 4KI0A 1ZXHA 1DXMA 1JCKB 2RBMA 3PMFA 1I6HB 3QJYA 1IYVA 2QILA 2K33A 3M4OB 1D1IA 1SE4A 1I4GA 1YN4A 1RTOA 3TN2A 3GO5A 1L6VA 3AEEB 1HPCA 5IT9L 4IUUA 1QB5D 2VNUD 1HQRD 2OXPA 1L4DB 4U673 1SSNA 4FO2A 3T16A 2IGGA 4L6TB 1ZXIA 2ZXOA 3PIO3 1C78A 2EELA 4TQUS 5EPLA 2OEDA 4QUCA 2JA7B 3GV6A 2W3RA 4V0BA 4P6VF 3P4QB 1E2ZA 3RD4A 4TKOB 1NYRA 3C8YA 3ZYYX 1NR4A 2KMMA 2V3PA 2O5IC 2QDBA 1IBXB 2A6HC 1E0ZA 1JW9D 1CI3M 2B2WC 4L8JA 5AFWA 4F88A 1FYCA 4ZRQA 1KNEA 2EYLA 4DAPA 3Q8CA 2MEKA 3P63A 3AV8A 3ONAB 4MHEA 1KH0A 4IFDJ 4C7ZA 4HMJA 5C0XH 1SYEA 3IFTA 2L11A 3QG1A 2Z4HA 3AEAB 2E2IB 2Z1CA 3AMZA 1PTOB 2PIAA 1STYA 1RD9D 1TQOA 3Q6SA 1AN8A 4GLSC 4XDCA 4CQNA 2J7ZA 4C3IB 1RWSA 1STGA 3EUB2 2HDEA 2E2HB 1PZJD 2NTSA 4K5XA 2HCCA 2KDMA 3ZGZA 2FUG1 3PV0A 1LTBD 1EIHA 1GJXA 4J6HA 3MHZA 4KHVA 1B9MA 4WH4A 1BUIC 1L0XB 1XWEA 2A68D 3NTKA 1CQFA 5EE1A 1MI2A 3NQIA 2AUJD 4M1UB 2L52A 5C2TB 1EY5A 1TWGB 3TEXA 3MXNA 1OXVA 3HKZB 1IYUA 2BS4B 5D65A 5ISRA 1EQVA 2E6XA 1EEID 3DWAA 1XLQA 1CZWA 1PTOF 1DOYA 3K57A 1XO3A 1Q12A 4I7ZC 1N5WA 2E75C 1TVXA 1A2UA 1VF7A 1STNA 3GD7A 5C6AA 4DF7A 3H91A 2D62A 5ELEA 2N88A 3BZDB 1SDFA 2R3ZA 4ABNA 2A69C 4PNYA 2WU2B 2NZ1D 4TSSA 3K5OA 2H1EA 1QLBB 2WNMA 3RFZB 4KGTA 2Q5WD 3BG3A 5A35A 4F87A 1EYCA 2YU9B 4MM3B 2F0HA 2JWUA 3P4RB 3MWYW 1DONA 1YNJD 2CVRA 2PZTA 2J0TD 4ARIA 3NVVA 3K6OA 3MFYA 3D4WA 3AEBB 3MZ5A 2ICEC 2VXWA 5KYLA 2N55A 1GB4A 2G1EA 2NN6G 2PO4A 4QIWB 2X6GA 1DOIA 5FO8B 1D6EC 1WTPA 3ABVB 5KYIA 1IGDA 2M2LA 2MJ3A 2BB5A 3J81E 4ULLA 3Q8FA 1JOKA 3HS0C 1SJED 1KAAA 4IUVA 4PV1C 4N59A 1I3QB 2R7ZB 1XCTL 3S17B 2L5TA 4FXKC 1MPEA 3I4NB 1TIID 2HDLA 5C0XG 1C9FA 4A8XC 1JC7A 2F03A 1VJKA 2ENBA 2LKVA 1LTAD 1SNCA 3P20A 4HSVA 3GTGB 2A73B 2PVOD 3MTSA 4XTCS 4B0MA 5AUIA 3VYRA 1F9QA 1HTLD 2JXTA 1KLGD 4DK0A 5HG2A 2A6EC 4ZKCB 3BYTB 1OQRA 3VR9B 5MPOA 4C80A 4YTMB 3S14B 1JOQA 3E0JA 3IFDA 1I4HA 4F8MA 3Q8AA 1IHZA 4OGQC 5HHDG 2EZVA 3KLRA 4RGMA 2KWDA 4MIUA 3A7AB 4FP5D 2BCOA 5KEEA 1GXDC 3K58A 4XT1B 1NAPA 1VLBA 3O13A 2BB6A 5JEAJ 1RFKA 3KWLA 1ZXTA 4F7XA 4US9A 1W6KA 2OEOA 3QOJA 1L4ZB 1EQTA 4KV6A 4BS9A 1PDQA 2EXZA 1EY4A 3VYSA 2K28A 2WKDA 5FR3A 5CMDA 3Q24A 1S5ED 5FLXE 1ENAA 4BBSB 1BCPD 3TZDA 5C3EB 2F0FA 5BYSA 4G7OC 2I07B 1CM9A 5IGFA 2DNEA 4X3UA 1X32A 3G6JB 4XQNA 4R3DA 3P75A 2YYZA 3BDOA 5D3IB 3LYYA </