4RGTA

2.0 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with 3-n-acetylneuraminyl-n-acetyllactosamine.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
191
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKESEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.0 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with 3-N-Acetylneuraminyl-N-acetyllactosamine.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
molecule keywords Putative uncharacterized protein
total genus 64
structure length 191
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgtA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgtA01
1B44D 2WV6D 1CQVA 1SBBB 1BCPC 1LT6D 3R2TA 1LTTD 1UUPA 3DWQA 3KLSX 1L0XB 1SE4A 1S5ED 1BCPB 4RH6A 1GOZA 1EEID 1PYWD 2TSSA 5D3DA 1TS2A 4UDUC 4BWGB 1TS5A 1PTOF 2NTTA 1HA5A 1STEA 1V1PA 1S5DD 1TS4A 3SEBA 1HQRD 1TY0A 1RF2D 5ELEA 1PZKD 1JWUD 1TS3A 1FNVA 4NZLB 1G8ZD 1I4XA 1S5CD 1PRTB 1I4GA 1XXGA 5ELBA 3MFGA 1RD9D 1I4RA 1LLRD 1AN8A 1I4PA 1LTBD 1ET6A 1S5FD 1RDPD 1V1PB 4C56C 1HXYD 1EFID 1JWMD 2G9HD 2RDHA 2AQ2B 1CHQD 1I4HA 1LT5D 2AQ1B 2IPKD 3DWAA 2XRSD 1V1OA 2RDGA 3BVGA 1PRTC 4RGMA 4RGTA 1LTSD 2CHBD 1BCPD 2XNAC 1BXTA 2QEJC 1ESFA 3EA6A 3CHBD 1XTCD 1SE3A 1LT3D 1SXTA 4RGNA 3BYTB 1CHPD 4RCOA 1ET9A 1LTGD 4L6TB 1YN4A 3V05A 1RCVD 1FNUA 3BVMA 1LT4D 1F77A 2O2LD 1EWCA 1SJHD 5D3IB 1JCKB 1JR0D 5ELDA 3URYA 2IJ0A 1AW7A 4RHRA 1T5XD 5I4DA 1CK1A 1PRTF 1SE2A 5ELFA 1YN3A 3R8BA 1M4VA 1D5XC 1UNSA 1SEBD 1CT1D 1ENFA 3BZDB 1D5MC 2XN9C 1SJED 1LO5D 4RFBA 2QILA 4RHSA 1PZID 4RGOS 2J4XA 1JQYD 1FGBD 1EU4A 2ICIA 1PTOC 1LTAD 2R61A 1LTRD 1I4QA 1PZJD 1S5BD 1KTKA 4O1NA 1FD7D 3W2DA 1JWSD 1YN5A 1EEFD 4Z9CB 1L0YB 1PTOH 4OHJA 1PRTD 3TSSA 1B1ZA 3R2IA 3GP7A 1QILA 1HTLD 5ELCA 4TSSA 5TSSA 1D6EC 1DYQA 2NTSA 1EU3A 1LTID 3BVZA 1TY2A 4L63B 4ZYSA 2Z8LA 3O13A 4K6LA 3EFXD 1PTOD 5FKAC 3DWPA 4DXGA 4DXFA 1BCPF 2AQ3B 3OWEB 1KLUD 1DJRD 1D5ZC 2SEBD 1PTOB 1MD2D 3MC0B 1FNWA 1KLGD 2XRQD 3BYYB 5FK9C
chains in the Genus database with same CATH superfamily
4KGRA 1X54A 2E2HH 2M0XA 3K9PB 2B2WA 3JAMi 1U0LA 2I46A 2WINB 5GQOA 3RZDB 5E6OA 4KVGB 1F9RA 1OFFA 2F03A 4M01A 4DFAA 1TS5A 2M0AA 2N9EB 2M2LA 3DUZA 1BBXC 5J39A 3J81i 5IAAC 2ZJDA 5M9OA 4MGIE 1D1KA 1JJCB 2R2QA 5KYIA 4F88A 1DOYA 2D0PA 3PRMB 1PA6A 4C4VA 4IWQA 1I4XA 1SNQA 3LWEA 4NMZA 3AE8B 1CI3M 1EQVA 4GN3B 4L8JA 4YTMB 1NYQA 3WAMA 2PNHA 2HHHL 4J3OD 1I4RA 4AUQC 4NXNQ 2Q8RE 2PYKA 2W55A 3SR1A 3K5OA 5M3MG 3T1YL 1G2TA 1LT5D 3PTFC 3TIXA 2MJ8A 1EIFA 2DUDA 2B2YA 3K8AA 4QB4A 3SVMA 3X0WA 4IALA 4XYOA 1C48A 3HKZB 1IYVA 4ME5A 2IBIB 4ANUA 2JJQA 3AEAB 2QCZA 1D1IA 2XNAC 3L10B 1XLOA 3KWVA 4B08A 1S3OA 5IT9L 1T0YA 1NY4A 3KF8A 4E71A 1JB7A 2Q2IA 2KZRA 4GLVB 5CHFA 2Y0SE 1FRDA 2YYZA 1S1QB 2IY1B 5C2TB 3FKIG 4C1NI 2RHQB 4H02A 4ZUJA 3BS1A 4RCOA 3HRDD 3HK0A 2BB6A 5GAGC 3AEDB 4I6NB 3I4NH 1AE3A 1LT4D 1LM0A 5HHDG 3I2ZA 4FXCA 2NZHA 1ILPA 1CFMA 3OYYA 3GTLB 4DR7L 2HJ1A 2KJXA 4JI2L 4II3B 1FXIA 1YJ9A 3C2PA 2KKCA 5I9PA 3CCJA 1SRUA 4HDQA 3GTQB 2BF8B 5AZGA 4JI1Q 2VZAA 4L5TA 4PYUA 4LF4L 3VQIA 4BFRA 3AV8A 4K5WA 1VRAB 4YSXB 2JE6I 2NVYB 3JAML 4OZBA 4IFDI 1OQRA 1SMXA 2PW7A 4H13C 3QB3A 2O6VA 4G0NB 4MJSB 3I72A 2K6QA 3L17A 2WDTB 2WAQG 1GJXA 2L12A 1K53A 1QOFA 2JA8G 2KQSA 4W9KA 2UUAL 1P9DU 4W9FA 5CX3A 2ZNVC 1HZBA 4P1CC 4ZRKA 5H8YE 1IBKQ 2F0TA 2WS3B 2L8JA 3MHSD 4HR7B 3F2BA 4LK1C 1QZHA 3QOJA 2KLCA 2HDMA 1RYJA 3PF5A 1YNJD 3TSSA 1GHJA 3IHPC 4GGQA 3L0OA 5D7GA 2ZTCA 2AX5A 4GKKQ 5IY0A 2GBJA 2CS4A 3GTPB 4IG7B 2A73B 3R7RA 3WCQA 4HJ7A 3AQQA 5I6YA 1K83B 4A90A 4WJ4A 3Q8AA 2EYOA 1E7PB 2N78A 1XJVA 2KMCA 2XBBC 2JQOA 4C3HH 3CMAA 3MC8A 4BA2I 1MI2A 4O2DA 1HNWQ 1HNXQ 3V6CB 3AB5A 4CJ0B 4LJZC 2JSOA 1EYCA 4DR3Q 5BN3A 3MTSA 2UXBQ 4LAAA 5I9OA 1N62A 3E9IA 2I1JA 3HOYH 2GVBA 3GE3C 4NY0A 3ZNZB 2UU9Q 3ZQ4A 1VQPA 1MJCA 5M5XB 2Q8IB 2PQEA 3HG9A 2HJ8A 1L0VB 1TWAB 4I7AA 4IFDG 2FINB 3DVNV 1C76A 3OWFA 4JX1C 5J18A 3NS1A 3RD2A 4BWGB 3OIQA 5BR8L 3R93A 2QCPX 2DJGC 4B9KA 3HHMA 4EQOA 3CCMA 3ZRCA 4JOIA 3UQBA 1E2WA 4YTNB 4F1SA 2AUJD 5G55A 2K28A 1S5CD 1DGJA 5EKIA 2KT7A 3N3KB 1HZCA 1JW9D 3WWVA 4F8CB 2XK5A 4LF5L 4XQJA 5FJ8H 1VQKA 3W5OA 2MBBB 1YNNC 3ECIA 3RPFC 5CTRC 3VAWA 2BYVE 1SNPA 2ICEC 4XQQA 2LEKA 5DPRA 4DPGA 4EZLA 3KK7A 1CHQD 3DWGC 2F3WA 4HJ5A 4YTPB 2CR5A 4AP4C 1J6QA 1B70B 3APDA 4XDDA 4RGMA 2MPMA 3SDLC 2N7EA 2LUMA 3PUZA 1QUQA 1J5EL 3N1ZC 2JVCA 1H4RA 4V0BA 4DR5Q 5FR6A 1BKBA 5GXGB 4URKA 2CH4A 4P74A 1X3GA 3QQ8B 1PFSA 3AE9B 4A3EB 3IBEA 3HM6X 4DHZB 3STBC 4QAYA 4US9A 3CSFA 4LF6Q 4RM8A 3VUWA 5IGGA 4DUZQ 2LI5A 1KNAA 2KCMA 4WORA 1XNQL 2Z59B 3AU5A 1L2NA 4DV4L 4XIGS 1WE6A 2KDFB 2LFIA 1OXVA 4KZ0A 1OXXK 1JR0D 1JRUA 4BY1G 4JI0L 3UF8A 3HOVH 4PS3A 3DBRI 3S1MH 1Q81C 3I70A 3VYSA 3CF5A 4KDIC 3DHIC 3W1YA 5ELFA 2IY5B 1ZOYB 3QIJA 2D10A 4CDCC 4NAWB 1BBWA 1I50B 3Q6BA 2QDBA 3VR4A 3PV1A 3NK9A 4IW0A 3GD7A 1N6ZA 2LSSA 4ZQ3A 1XPRA 3J81E 3DM3A 4LLGM 5JPNC 4WIPA 4BBNF 4WJNA 4PYZA 5KIXA 2O4XA 5IOCA 3H3VI 1LTRD 1SLJA 2HDEA 2NPTA 2J0JA 1MSHA 1QZEA 2C9WB 1JWSD 4I65A 2EYMA 2ZJPA 2VZKD 5E6PA 4C3JB 2LUEA 2QGQA 4B0EA 3J81c 3R2IA 4DAVA 2NVXH 2WX0A 1B9NA 1EY5A 3TRZA 3UQAA 4HKQA 2E6XA 2WAQE 1O7ZA 3S1QB 4OVUA 4OZAA 2JA7H 4EQNA 1F1HA 5IP9H 2Z8LA 5C3JB 4DV6L 1TR5A 1II3A 2LRWA 2A5UA 3C19A 1E0BA 4BA1I 1WR6E 1TYGB 4AJWA 2G5DA 4A3LG 4HCPB 3NUHB 2JEBI 3H6MA 3W1BA 5C3EG 3SK8A 3T56B 2K1FA 2JXMB 3FKIB 4KY6A 1F9JA 1WI0A 3Q0AA 1K8MA 1BCPC 2B2YC 3GV6A 2KMAA 2K5HA 1SSNA 2VB3X 2FCMA 3CSTA 4K3BA 1KLVA 1C4QA 3EIVA 5LMNL 2UUBL 3S1QH 2V3PA 3ETRA 4A3OA 1BF4A 1A63A 3EQLC 2J53A 1FCLA 2EIFA 4UDUC 3K7AB 3GB1A 4K3CA 1JMCA 4C00A 2L55A 5EQ0A 1KAWA 2B63B 4MDKE 4WJPA 1E8XA 1WTRA 3J81L 1TY0A 2E2IB 2MJ3A 5L37A 1S4ZA 4DV2Q 2VS1A 4NW2A 1N36L 4B3TL 2I07B 1L4ZB 2EJMA 2O2VA 2PJHA 1Q1EA 3D31A 3MFGA 4BKSA 2A6EC 4IQZA 5EE9A 1NTGA 3PRPB 3PCOB 4ZRZA 4XE0A 4IUVA 3HP3A 3DQVA 2KCNA 3HOZB 4K7WA 2G9HD 1EFID 2B2TC 1RFKA 4DQOC 5A35A 1NJIC 2IPKD 1P8LA 3LJ3A 3ZW3A 2V4DA 3JAMc 1HPCA 1HUMA 1UE1A 4NB3A 3Q3OC 2NMQA 5AFWA 2UXCL 3F8TA 3K80C 5J1ZA 1F2RC 2QDFA 4HRSA 1CZWA 1J8CA 3NOBA 1GAQB 4A20A 3VVWB 3IT4B 1MKHA 1YIJA 4X3KA 1VQLA 1DM0B 2N49A 1I6HH 1E8ZA 2XVSA 1PUTA 4X62L 1PH1A 1Q1OA 3MJWA 4ITKA 3K81C 3SHQA 1U4LA 3T4AC 4FBJB 1UWXA 1A3VA 4MT5A 2NZOA 1T5EA 1R9TH 3KDFB 1F0ZA 1SJHD 3CC4A 5ELNA 4LNIA 3Q14C 2V4LA 5C0XJ 1JB3A 2WB1B 3P63A 5EPLA 4KD3A 2D3GA 2N9PC 1Q86C 3L08A 3Q3JA 3CQZB 2A8VA 3JSVA 5C44G 3E0EA 4US8A 3R8BA 4A3GH 1BUIC 2OTLA 3GTOB 5LLIA 1IYUA 3Q6SA 1D5XC 1VCIA 1X56A 3P4SB 4I7ZC 1WX8A 1Y8OB 2IGDA 5GADC 1CZPA 1OGWA 4FNFA 4BKTA 4HVBA 1CA6A 3AE6B 2ZPYA 3AFQA 2NB0A 3PHWB 1PZJD 4LJPB 1C79A 2WXFA 2Y3AA 2F0PA 1HJPA 3ENEA 2Z6KA 3KUCB 2CQAA 2RF4A 3HRZC 2VQFQ 2N9KA 3FC4A 3I4LA 1HE8A 1LFDA 1SIFA 3U52E 3BINA 3DBHI 3FKYA 3ULJA 4ILWA 2VUMG 4LFBL 1V1QA 3RT3B 1B50A 4TQ1A 4UP8A 3L9AX 4DNIA 5KHQA 2UU9L 2F1MA 1TBEA 1C3TA 3S2DH 1WIAA 5HURA 4LCDE 3DWPA 2MJDA 3MXPA 3QHTA 4OO1I 1FL0A 1D2BA 1EY9A 3DBLB 2JA6B 1LGRA 5BN4A 2WXHA 2LJIA 5IA7A 1RIPA 4DK3C 3PIOA 3L2PA 4JLCA 3CKIB 3SE0A 1MJEA 1QNUA 4KHZA 5IGEA 3N20C 1WFYA 3K58A 3IXSA 5CBAE 1MPEA 1ENCA 2C7MB 3M95A 2X6GA 5KHOA 1EY6A 3FPUB 3PO3B 2DHZA 2B2VC 4OIKA 3A74A 2N3SA 3GOEA 2M56B 4TMAB 2VQEQ 3UDIA 5C0XI 4KX6B 4M0WA 4G4KA 5GROA 2O6VD 3VYTA 2I5HA 5FR3A 1RF2D 3B08A 3K0XA 4NZLB 1AP0A 4GU2A 4JI3Q 4K8JA 2O2VB 4GDLB 1C9FA 1Z9FA 4F7XA 2JA7G 1WM3A 4OIJA 3ZDTA 5IYDG 4X66Q 1ASZA 1KRTA 3M4QA 1H95A 2PW9A 5GAEC 1JMLA 2BWFA 1PDQA 2AQ2B 1I4HA 1WXSA 1V81A 1IYJB 1WR1A 1W6JA 1WZ0A 1C4CA 4PS8A 1FM0D 4K7UA 2RDGA 3IVFA 2Z4IA 5EBDA 1TIFA 4RGTA 4DUZL 4BZAA 4YSYB 3VR3A 3RULA 1Z7TA 4JYAQ 1ESFA 5JOBA 4QCLA 3EA6A 3P1HA 2LZ6A 3DVNU 1MG4A 1F2YA 1P0RA 3IFWB 2JZZA 2HCCA 1L1OA 2YVCA 1IPGA 2K9XA 3B2GA 3WOEA 1TKYA 4UAIA 1E22A 3R7QA 4XYCA 2INNE 4CHTB 1QVCA 1RCVD 2KXJA 1SE9A 1WVLA 5D3IB 1F77A 3RLNA 1DCZA 1O80A 2N55A 1UF0A 4ARCA 1WSPA 4QUCA 3VDZA 4XT1B 1L0WA 1KABA 2MNAA 5D94A 3NG0A 4F7ZA 4MGKE 2MP2B 3Q8BA 3UDXA 4X3TA 1N8RC 3J80E 2QKIC 3BZKA 1L2FA 1VS0A 5JEAH 1LQBA 1NCVA 1UE6A 4FA6A 3AMUA 1E8WA 3PV0A 4CDEC 1WXVA 2VZKB 1N63A 2JSVX 1LO5D 1Y1VG 2QILA 2N1WA 1GC6A 2ZTEA 3VHTC 1IW7C 2KHIA 4A9AA 5EPKA 1SFOB 3NZ3A 3CPWA 4DWFA 3FKIH 1YHAA 1ZKOA 4KKSA 2JA8B 1B8AA 2WGSA 3TUOA 3ONAB 1WE7A 5H1SE 4BY7B 4KLKA 4DR2L 1WJJA 2E8GA 5LL6X 3MC9A 2KECA 2PZWA 1B1ZA 2MQHA 1GJZA 2DN8A 3IFTA 2XWBB 2JX5A 1PDXA 3OAWA 1KDBA 4B3MQ 1CKNB 1RLFA 1QILA 1IHZA 2BB5A 1JOKA 2JA7B 2XEWA 4GDKB 1VQ7A 5EAYA 1SGHA 3KFUA 2BE5C 4HJKA 4XQNA 4BS9A 4P16A 1TVXA 4LF7Q 1YNXA 4ZYSA 4NJ6A 4UY8C 4DGZA 4WAAA 5E6JA 3LDZE 4A3DG 1B9RA 5LMNQ 4M8NA 5IODA 4DU9A 3H7PA 1VDZA 3NJTA 1PYSB 2JP1A 4JV5Q 3ZRFA 3N52A 1GUGA 4R9WA 4LK0M 5FLXE 3KLSA 4HJAA 1ACCA 1OQYA 4X65Q 2VH1A 2D0OA 3A1QB 1E7ZA 3OJ4B 3ONSA 2NN6I 1LTTD 4R4TA 3M4OH 2K3UA 4DK6C 3NTHA 2AMCB 1NENB 3RYTA 4DK5A 2CCZA 1VR9A 1IW7D 4ZRJA 1GOZA 2AEHA 2TSSA 3ZYYX 1J7AA 4ZRPA 2GN5A 2H4OA 2REXA 1VQEA 3BY4B 2F4VQ 2Z0SA 3MXNA 1F2RI 4WWPA 4XWTA 5M3FH 2NBVB 1HQRD 3HKZE 3PUYA 4A93B 3TDQA 2KO3A 2B3AA 3BDCA 1GHKA 3P42A 1SN8A 3TEYA 2A69C 2IY0B 3B0AA 4ZHPA 3MXGA 3QJYA 1RD9D 1JICA 3OPOA 1NEKB 3S17B 2ENBA 4DF7A 4CQNA 3EHVA 2AQ1B 1NNXA 4WQOB 2X69A 1QVFA 2FAZA 2PZTA 4J1MA 1A3TA 4R8NA 2EYFA 3PIPA 2PTLA 1E2VA 2I2YA 3CD6A 1HHVA 2AWTA 3EN2A 4AQYL 2CQOA 3AULA 3CCEA 1R4MI 3ALBA 4GLXA 1Y8PB 3A56A 4L5SA 3WALA 1NR2A 1E1OA 4QMGA 2KENA 2B39A 2B29A 1GB1A 4PQXA 2I38A 4QIWB 4C3IH 3TN2A 3LB8C 4ANXA 1I6HB 1Y8NB 3Q8DA 1CA5A 2FIDA 3WAPA 2C60A 1EY0A 2SOBA 4K2KA 3ER0A 2IHEA 4A3EG 4FJYA 2YEPB 2F3VA 4A3BG 3EC8A 2BYEA 2CHXA 3AECB 2KCCA 1HZAA 4J15A 3DPDA 2WU5B 1YN3A 3P4QB 2E3TA 4REZA 4FVMA 2MO0A 3UDFA 4IWOA 4H44C 3R3MA 1B3QA 4U673 2L52A 4PV1C 5M5WB 2Y5PA 3CCVA 2JYEA 1CM9A 2PVGC 3NRZA 2BH8A 3BIID 3RN2A 1SSOA 3T1HQ 3GTJB 1NAPA 2F0VA 4HSVA 3J9CA 1S5BD 4HJ9A 1IL2A 4DV3L 4S3SA 4GNXB 3C8YA 4S17A 3H3VC 1TKEA 3E9HA 1FJGL 3J7A5 3MAQA 1NMFA 1VQHA 2MLBA 4K1RB 1YITA 3WANA 3QJZA 1IL8A 1ZUD2 1IBLQ 1I42A 1XT9B 3A8IE 4A6QA 3PZDA 5M3MH 2GVAA 1FPYA 4PS7A 4LJOB 2DYMA 2IX0A 1YHQA 4N59A 1YX6B 3MXNB 2LXJA 3T1YQ 1X9NA 4JI0Q 1WY8A 2FUHB 4B3SQ 3DLLA 1WF9A 2F4IA 3DBLI 1E0ZA 3DBSA 5IWAL 4C1NK 3UE0A 1JOQA 1WTOA 5CV4A 1WTXA 2WXKA 2PMVA 2HQLA 4RF1A 4UP7A 5M5YH 4C3IG 3ZXRA 1SBBB 4CJ1B 5DAUA 1J0GA 3IFDA 2CJNA 4OWTB 2KTFA 4JI3L 5JAVA 1KFYB 5IT9c 4X3SA 1SE4A 1S5ED 3L7ZC 1BCPB 2K4KA 1VDVA 2FCNA 1PH5A 2OOBB 4QGUA 1PYWD 2WDRB 1WJ4A 4DR3L 4JI5L 5IO9A 1JWAD 3ZNGC 2OQKA 1ONLA 3H0GG 3Q2AC 1V1PA 5CHVC 3NPPA 2CU1A 2WXLA 1VF5C 1N61A 4L1BA 4JI2Q 3APCA 2D2CC 2M8SA 3FILA 1CKNA 1I5FA 4GDLA 1EWIA 2HIVA 5BR8Q 1J7CA 1G291 1WGDA 2LGDA 1J5EQ 4KKTA 1CUKA 3CCLA 1X1MA 5I6WA 4M0WB 4DNTB 4W9IA 3JC66 1GO3E 1HXYD 2WB1G 5A2QL 2E5LL 5IE8A 3EVQA 3GZNB 3KH0A 4GSWA 2LFNA 1F2ZA 3ZXVA 1PV4A 1C8CA 4POGA 5LL6S 5KNBA 4GNXC 4EVOA 4E3CA 3GV3A 4WJWA 4NP5A 2VH2A 3HOYG 1VLBA 3KJPA 2MWSB 2ZZPB 1BXTA 1IGCA 4B3RQ 5E3FA 1XTCD 4DAPA 5JPMC 3EUB2 4NAMA 2ZVNA 1LXDA 1QZGA 2K50A 2MP2A 3UE1A 1SXTA 3L0WB 2LKVA 4W9CA 2SNSA 3VR8B 5HGTA 5KRUA 4RMFA 2EVBA 1R7SA 2IX3A 1EO6A 3NENA 3HVZA 2A1AA 3S15H 1YN4A 4L6TB 4C3HG 1GPXA 4PG3A 3V05A 1EUJA 4RNAA 1DXMA 1XYIA 1VQFA 4M1UB 5I2YA 2KQ4X 3L4PA 2JEAI 1V9PA 3BWUD 1C77A 1DOMA 1VQ6A 4A3DH 2IJ0A 1AW7A 1TJEA 1L1OB 2R93B 3CP0A 3PGEA 3RNAC 1SIJA 4LF6L 3BU2A 4DR1Q 1SE2A 5C4XB 4P1BC 2OWOA 4YWGG 2OT2A 1Q5WB 2F0WA 2MHVA 3NQIA 4LMQD 1AH9A 3VUXA 4LNQA 1M8AA 5KEEA 2GBKA 2WX1A 3VYRA 2DAFA 2PIAA 1ICFB 1RODA 3GZNI 1U5KA 1U4MA 3QC8B 1X3FA 2MSED 4C2MH 1TWGH 4GOPB 1I4QA 2VL6A 2CHWA 4FULA 3DHQA 1YN5A 2BWES 2RDBC 3S1NH 3EBEA 2KOXA 1DD2A 1Q46A 1N5WA 4HPMB 2KTRA 3CMMB 3V60A 1HR0W 1GUOA 1PRTD 1K3BC 1GVPA 5FJ8G 2F0GA 3JSVB 4NXML 4DBGA 2DNCA 2KVZA 4A3IG 4KY5A 2LS01 4RA8A 3S16H 3IAM1 2NYZD 3N1YC 2D11A 3T53B 2NVXB 2RSOA 4ID6A 4KSKC 5CGKA 4HAEA 2L32A 1WWTA 4N9F4 4TUUA 1X55A 1ZGUB 3G48A 1H9JA 4L63B 4RAUC 5BMHA 2W54A 3UINB 4DR7Q 2CU3A 3AEBB 2CW0D 2R92G 1K8AC 3MXUA 1IZ6A 1WTWA 2JYOA 4TKOB 3VDYA 4QY7A 2LASA 2MFIA 4A3FG 3A8JE 3JAME 2I0QA 2JK8A 4FO2A 4BXXH 5FK9C 3TJPA 2XWJB 4DHJD 2QMTA 1B44D 2K7VA 2WV6D 1UE7A 3I90A 3R2TA 2GRIA 4C3JG 1XF5L 3SD5A 1I50H 3ZNHB 2KWCA 4M8AA 3U58A 3KLSX 4FDBA 3X3NA 4RCNA 3IAYA 3RZOB 2JXTA 1HNZL 4DHZE 4JBKA 4RH6A 3DCGA 3SGIA 2CH4W 3EFCA 4G7HC 3GTOH 5AEKB 1HA5A 3AEFB 5G3LD 4IJLA 3QWZB 3RUZA 3V3XA 4JI6L 1OXSC 1T6BX 2FCSA 1TS3A 3DVGY 2NWGA 4JI4Q 2NS5A 1PH4A 4NDXA 1T0SC 3HOXH 4GKJQ 1P1AA 1EIGA 1AARA 2EXDA 2J0KA 4DAMA 2MHJA 1DZ1A 2F0KA 2CWAA 4DAYB 4YWLA 4P2CB 5KYLA 1MIUA 2ZXRA 4A3KB 4WWNA 1NE3A 2I1KA 2BYFA 2UU7A 1ZKHA 2KJ6A 2AHOB 2FCQA 2GBRA 5EDSA 1Q10A 4A3KH 1C0AA 2K5VA 4BY1H 1PVOA 4RG1A 3N6RA 4DR2Q 4WWOA 4DDGD 2L1BA 1YJNA 3I4NB 4XTCS 4BBRH 2KFJA 3CIRB 3UI2A 1EYAA 3S15B 3MEFA 4RGNA 1PXUA 2RQXA 3NELA 2UUCL 1S40A 2L7RA 3NVVA 3RNEC 3JW0X 1PHJA 3NBHA 4KKIA 4KJOA 1FNUA 1UWVA 2EE1A 2Q8TA 3OW2A 5CMDA 1MGSA 1EWCA 4A3FH 1ZPSA 3KDFA 2BA1A 2G45B 3NVYA 4MH8A 3T9LA 1LUZA 3OOCA 2R92B 4U68A 5F2DA 2WXPA 4JK1C 3PUVA 5CBEE 3RNFC 2LJ5A 4RHRA 2GOWA 1A3UA 1PFNA 1TIID 2F52A 4OONA 4JPBW 3K57A 4ZOHC 2IWHA 2DYBA 2C9OA 1GM5A 1JJ2A 5EKLA 5C4ZA 3S1RH 2B2UC 3M3YH 2DY7A 2NPTB 1S3SG 1SEBD 4ZKBB 4GOPA 1F52A 1CT1D 3RN5A 4JBWA 4OGQC 3M4PA 4LDTB 3TEZA 1YJ1A 2QSDA 4MSMB 1JQYD 2IO2B 4KY7A 2HD3A 4E6IA 3H3VH 4ZCKA 4ZHOA 1XCQL 4JI1L 4GN1A 3AE1B 4DAYA 4B0MA 2ES2A 3W2DA 1NBWA 2B2TA 3PGZA 1STYA 1VQAA 1OXTA 4OVVA 4OHJA 5KGUA 1XPOA 3DM1A 4LF9Q 1W3SA 4WQMA 4IOIE 4J6HA 3CXCA 2F0MA 1BUVT 4IM0A 1EIHA 3LWUA 4Y7NH 3FILB 4FP5D 2HD5B 2L15A 3VR2A 1BO0A 1WFQA 3DWMA 4YXDB 4GZYC 1LTID 3FP9A 4PMBA 2ZCBA 4RF0A 2EY6A 4IOCA 4A3KG 3KUDB 1K8RB 4KSLC 2K05A 4KHPQ 1K73C 1D5ZC 4DR4L 1PLFA 2AUKA 2RKSA 4JG2A 2FFKB 1AYFA 2WLBA 4AIMA 4P7IA 1A5RA 3MC0B 1FNWA 2ZNVB 3QO2A 3OTOQ 4MGZE 1GUNA 1L7YA 1CQVA 3KBGA 4YWMA 1L4DB 1LT6D 1SAPA 3BJUA 2NVQB 2K32A 3I4NG 1V9JA 3MJ5A 1JE4A 1STNA 2NVYH 1C1YB 4G7OC 3J7AF 3D8GA 2R7DA 1PQSA 5CV7A 5M3MB 4XYQA 2KOLA 4CKBA 3C46A 1PGAA 2UYZB 2SDFA 1DOLA 2NBFA 1VJKA 3TZUA 1O78A 1Q90A 1UGMA 2MH7A 5T8IA 3PO0A 4EOYA 1WYWB 5ELEA 3Q3MC 4BOZB 4FXDA 1PZKD 1P3QU 3W9CB 2ZXOA 1I3QH 2H88B 2LVQA 2VUMH 3TS0A 3AH7A 1R4PB 5CR3A 3VYUA 2AWOA 2K0PA 4DKAC 3NVWA 5IKCM 5M5WH 1V1PB 2K5DA 2K6AA 4C56C 4BBSB 3D4RA 2Q5WD 5EE1A 3VUYA 1ASYA 4HMJA 1V5OA 1G91A 2KLGA 3ZJTA 1I3QB 1I94L 5C0XG 2K75A 2CKZB 2D9UA 5D14A 3SHLA 3T13A 3OJ3A 2E2IH 2MP1A 4YCWA 2K01A 4JV5L 1PRTC 2CHBD 4KN7C 2GBMA 2O5IC 4W9GA 2R7FA 4UP9A 3K59A 4JI8Q 3HVDA 5H92C 3M7NA 1J7BA 3PPAA 1UZXB 3RI7C 4NJCA 3CCUA 3A5ZB 3FPPA 5JVH3 2Z0EB 3NE5B 3B1LX 3RUIB 4N9PA 5D65A 2OTJA 4LFCQ 3WAOA 4EFOA 1EUVB 5AJ3Q 4A3MH 5FO7B 2D07B 3NP8A 1CTMA 1Y56A 2ZTDA 5EPJA 3AU7A 4JYAL 2D5DA 3R3OA 4A3JB 3OIPA 1Z47A 3NUCA 3HS0C 5ELDA 1N36Q 1TWHB 4B3TQ 2UXDQ 1C4PA 1WGKA 4BBNC 3GTGH 4JI7L 2JUOA 5IWAQ 2Y5BB 3MA2B 4POFA 3DHHC 2MQJA 2BS4B 4K0KL 5GMVA 1VQIA 1SNDA 2F3IA 4PZ6A 1LYLA 4GNXA 5ELOA 2ZM6Q 3PHXB 5D2MB 2BPSA 3JVZX 4MN3A 1K8GA 3ZTCA 2KBNA 4CGYB 5G3LF 1C7YA 2A74C 2PO4A 3D3RA 1E2ZA 1EIYB 1VQMA 4B3ML 4NXMQ 1GUWA 1IUEA 4JCVE 1QKZA 2J42A 4W9LA 2ICIA 5IP7G 1N32L 2CJOA 3NS8A 1XEEA 1VQ8A 2O6VB 4TRDA 3OSOA 4JL9A 2LMCA 4NAWA 3ABVB 4LF7L 4I6LB 3CPFA 3K0YA 1HFNA 4IPCA 1L6VA 4DDID 1VQGA 2X6LA 1D8LA 4ZYNA 3K6OA 2F0SA 3WDNA 3S24A 3M3YB 2RGFA 5TSSA 1ENAA 2OEDA 3Q8FA 3PQIA 4HIDA 3A9KB 1A2UA 3GTPH 3AE2B 2J0TD 3P75A 1TY2A 3VH3B 3S16B 1BBUA 2BDOA 5FKAC 1FXTB 1FGUA 4DXFA 4ASWC 2PVOD 5CYUA 2L00B 1HZ6A 2IHFA 2WB1E 1WCMB 1UH6A 3Q22A 2E75C 2ZPNA 4XZ4A 3S2HB 1WX9A 3V61A 1GKHA 2NUCA 5FLMH 3BDOA 2XGTA 4A3CH 2KX3A 1UUPA 2PEAA 4MH0E 3H6NA 5MPOA 3A0JA 4GLAC 1XWEA 3KW5B 2BW2A 1DOIA 1CJEA 1EEID 3GO5A 1FFVA 2QW7A 1BT0A 2W3RA 5IYDH 2C7HA 3RMHA 2PPHA 3Q69A 3A9KA 1EY4A 3APFA 2NVTB 3C1FA 4LUVA 2JA6G 4KTAA 2R93H 2N9XA 2XK5B 3DBRB 4GDKA 4JPSA 3I4MH 2N4FA 1G8ZD 1C78A 2C5LC 4N9TA 1WJ6A 3VTWA 1QJOA 3J80c 4K5VA 5ELBA 2WHIA 4HIKA 3D6CA 3QR8A 2KACA 2KK8A 4Y52H 3ITPA 2IT1A 1DONA 1B3AA 1FD6A 1SYGA 2M19A 1Y1VB 1VQJA 3DWAA 1PH9A 2KWVB 4RWSC 2IX1A 1ZDVA 3A7LA 2UUCQ 2L11A 1YNJC 2VB2X 4QUFA 4CBVA 2D2QA 1YJJA 4A75A 4MJSA 1MHHE 2R6GA 1YNTE 4GLSC 1N34L 4LUOA 1K3RA 1FEHA 1QE6A 1KD1C 1A2TA 3M7GA 4A3JG 1MJDA 2YEPF 3RZOH 1IKLA 2EPBA 5CV5A 1A62A 3S17H 3EFUA 1BOSA 5IYCH 3U2SC 3GTKB 1FO4A 1ICWA 4RM9A 1X3QA 3TP6A 2VQEL 1KJTA 3H1UA 2JT4B 4BBRB 2XSCA 1J19A 1EQQA 1YIWA 5KNCA 1IBML 5M3FB 4II2B 4N6EB 3VR9B 2WWZA 3W1SA 2XTIA 4OX9L 4C3HB 3QA8A 4M02A 3URYA 2K22A 4KK7A 1T5XD 2YV5A 3AFPA 3CRLC 4JVZA 1K83H 3A5UA 2G4SA 1B2TA 1XLQA 4DNRB 2ZW0A 4JBMA 4BKSD 3SFEB 4X66L 2H1EA 3FHWA 3Q8EA 4MTKA 3ZDMC 3MHBA 4AYBG 2KMMA 2VXWA 4EGVA 1K28A 1NI2A 3H15A 1YX5B 1QVGA 2E76C 1STHA 4OW0A 2EY5A 2L5TA 2Z9HA 2W3SA 3J81j 2E2HB 3J7ZC 1VMPA 3W5VB 3HOXB 5D6JB 1PH2A 4L23A 3AYHB 4Z9CB 3G6EA 4IZ8A 4WJ3M 2K14A 3PO2H 4OELB 2JA5H 4JI4L 4F8MA 1L6UA 2BDNA 4B9XA 2KFKA 2LXAA 3SXHA 4HN7A 5C4HA 3PO2G 1HTLD 4BBSG 3HGBA 1XLNA 3AMZA 1EWHA 2PCFB 3NBIA 2FUG1 1X32A 3ZKJC 2AYOB 2YTVA 1EQTA 4GS3A 4BY7H 2L83A 3CU7A 3EFXD 3I9V1 2A69D 2PI2A 1WGYA 3ERSX 4JE3B 3SK5A 4A3BH 1BCPF 1K51A 2ZT9C 1WD1A 1KLUD 2HDLA 4BY7G 2KEEA 3K5LA 2Z0DB 3SK4A 4A4IA 4JI5Q 4IFDJ 3N9YC 4FJZA 3U4EG 1OTRB 1JQ4A 5KNDA 4JWUC 2L05A 2WU2B 4MACA 1GUTA 3GTMH 3T16A 4ICVA 3TMEA 1QF6A 4FLHA 3DWQA 3AE5B 2BBCA 5C3EB 1STBA 1T0RC 3H7PB 2WYQA 3VH4B 4AS1A 1XLPA 1JROA 3WOFA 3IG3A 2DZKA 4KIKA 3L54A 1HR0L 1STEA 3UIOB 1M90C 1WJNA 2VNUD 3AU4A 5BYSA 3P4RB 1JWUD 5TR5A 1FFUA 4CKCA 1X65A 4L5QA 4DV5Q 2B63G 1C9OA 4XXEA 3ZJYC 1VQNA 5JJIA 4IUMB 4JWSC 4IPGA 4LWCA 2ZJQA 1TT5B 3T51B 4G57A 4R3DA 1WX7A 5E1FA 4A8XC 2AWNA 3PZ8A 2N7DA 2EZVA 4B3RL 4DV0L 2MO1A 4BY1B 1RFAA 1KL9A 4ZRIA 5EE0A 1HQMC 3I56A 4XDXA 1KRHA 5C4XH 2KWDA 2A6HD 4HJ8A 1P7FA 4ZKCB 2Y5CA 5HY6A 2UWQA 1MG8A 3HFZB 4DV3Q 1UGJA 4X65L 1M94A 4W9EA 2KVMA 2DYOA 4YL8A 1V43A 3CHBD 3I55A 1E5WA 3B6YA 4ANVA 4PZ7A 4QIWE 1R9TB 1YQBA 4HTHA 1TKWB 3H91A 4XT3B 4YWKA 3RD4A 4LW1A 1KXLA 2E2DC 2RCNA 3NHEB 2PMZB 3GS2A 5M5YB 3CAMA 4G50A 1NVID 2K33A 4E74A 3TQYA 4P75A 3U50C 5JJKA 3EGRA 5DM73 1UE5A 3CC7A 3NBHB 4DV1L 2VUMB 3ZVVA 1K9MC 1N9WA 4EKUA 4TV3A 3ZGZA 3HOWG 5JZEB 5EKKA 2YU9H 5G5HA 1CK1A 3A4RA 1JORA 3HOWH 5CC4A 3QCAA 1LACA 4JOIC 5IYBH 4WAFA 1VMCA 2HIXA 3C3LA 2FIFA 1HCZA 3FDTA 1SROA 3FMCA 4PZ8A 3I5JC 1ENFA 1MHXA 1SDFA 2XN9C 4RGOS 5JEAJ 4DK1A 1Y1WH 1FMAD 1KM7A 3VR5A 2XIWA 2LWPA 4K7SA 5C1ZA 4FF4A 2RD0A 2WFWA 1Z6HA 4ZLTF 4QF4A 2DZMA 1Q3LA 4K8IA 2R61A 5AZHA 2BE5D 1EF5A 2M4NA 3X23A 1EYGA 1WI5A 2GI9A 2D3AA 1WXQA 2CHZA 1LTLA 3D0FA 4FXKC 1Q8IA 5LMNW 4LF8Q 3Q8CA 2VRRB 3ULPA 5C4XG 1D7QA 3PLUA 2OF1A 4IUQA 5C3WA 1UELA 4WWMA 4ZDVA 5LXHA 1GB4A 4HKZE 3I8ZA 3OMCA 2WIIB 3KF6A 3M9BA 4ZRQA 1QNKA 3DHGC 1TWHH 2E5LQ 1DOKA 2F0DA 3BDLA 2CWPA 2AQ3B 3F2CA 2D5GA 3RZWC 1E10A 1S72A 5C6AA 5C5MA 3KWLA 4IWPA 4DUYL 4WFN3 4R4CA 1JC7A 2V1YA 2L4NA 2J7QB 4WH4A 2V0GA 2INCC 2JRIB 2K5PA 2PI2E 4MEMA 4YHHL 2E2JH 3KYCD 5CHWA 1E90A 3CW2C 3P1MA 1YMHE 4YCUA 4X57B 4EQPA 4TKNA 4ICUA 5AJ3L 2HHHQ 1PTOF 1DGSA 3CF6E 1X6OA 4HDOA 3ZTDA 1YJWA 1KIXA 1H9MA 1RKNA 1PYBA 3A8KE 1J9OA 1JT8A 4LF9L 3TZDA 5JJLA 5C4JB 1LM8B 2OJWA 5AZFA 3NQTA 1IBLL 2JF5A 4XWWA 2KN5A 1SNOA 4DA2A 1KNEA 3SU8X 3RCZA 2Q2HA 4A3FB 2ONQA 4ACFA 2KTRB 5IN7A 3IL8A 2I5LX 1WMHA 2RHSB 5IGCA 4LNFA 3VA7A 1YNND 2DNEA 2N1VA 1EZ6A 3RR5A 2NZ1D 5L95C 4KHPL 3H0GB 4GKJL 1FCCC 4BKGA 4MHEA 1B7YB 1WYGA 1I7HA 5JEAG 1BCPD 2PNRC 1R4NI 1E6EB 3H8HA 5COYA 3A55A 2LVPA 3GQBA 4PMCA 2GLSA 4CDDC 3A33B 1W2BA 1EZ8A 1KDAA 2VW9A 2BGFA 2EMTA 3ZNID 5JXVA 3KUZA 4H7BA 3LX0A 1ILQA 1WXMA 3RN9C 2NBUA 4NPNA 3OHXC 2DX5B 2Y0SB 3C0RB 4A3EH 1AFPA 2PQAB 3V96A 2JY6A 2KUMA 2B63H 2IGHA 3U7DA 3CWIA 2AKWB 2F0NA 1PH8A 1XCTL 4FADA 4IJHA 3S14B 1STAA 1YEZA 2R7ZB 2RMMA 4Q0FA 5I4DA 2L1AA 2B2VA 1EY8A 2RSNA 5K36H 4IOAA 3N32A 3QAQA 2E2JB 1HRJA 1U4RA 2A4ZA 2F0HA 4ZK9B 2GMIC 3RNBC 4HLEA 4M8MA 3KLWA 3HZXA 5DPTA 3U4VA 3PO3H 2EKEC 2EYHA 1K8OA 3AE7B 3VRBB 5IGFA 1FGBD 4GMVA 2KHSA 2MRPA 1N60A 4BAXA 4ABNA 3E5SA 5DLQE 1SNCA 2JA8H 1K50A 1QWYA 4KD4A 2MBOA 3ND9A 4O1NA 1WRIA 4K6DA 1EEFD 4HROA 1PTOH 5AUKA 1KF6B 3DXJC 1XMOL 4KI0A 1JOOA 5CV8A 5EJWA 1UWMA 1V86A 4KDLB 2JA9A 2R3ZA 2A6HC 1ISNA 3KQ4A 1PGXA 3N30A 2ZXPA 3NXWA 3S2DB 2DJFC 1FYCA 3T1HL 3W1SC 3NY5A 2WXMA 1VQCA 3OTOL 1WH3A 1KH0A 4KGSA 4C3JH 2HT1A 1QLBB 3BZCA 3I7FA 5M5XH 1HZ5A 2LHDA 4LTUA 1A0IA 2WP8J 4H0LC 1SYEA 1BDOA 2JU6X 2QJLA 2K5WA 2K6DB 1H9KA 2HTME 4MM3A 3VFKA 2SEBD 2MEKA 1XQQA 1V6EA 1MD2D 4DR1L 1XTDA 3W1GA 2H89B 2XRQD 3BG3A 2G1EA 1IYFA 2OHFA 4DR6Q 1IKMA 2Q2UA 1QUQB 1ZEQX 2ZM6L 2EKIA 2ZEQA 5IT9E 4WJQA 1VQ4A 4B3SL 4JW0A 3TREA 1EOTA 4USAA 3TMPB 1CSQA 3STBD 2WXIA 3IAS1 4P72A 3JYUA 4EX5A 3O65B 1WCMG 4AJYB 4ANWA 3PVLA 2IW3A 4MIUA 1BR9A 2F0QA 2Y0SG 1TKGA 4IFDH 1ZXHA 1ROEA 1CMXB 2B2UA 3DEOA 3G71A 4A3IB 3VXWA 4K2LA 4DV7L 4BXXG 1WMHB 4GOPC 1D4BA 1SMYC 3V62A 1TS4A 4AOFA 4I6PA 2EY2A 3W5UB 2DAJA 4HK2A 2PE6B 2RCFA 3W3AA 1SFOH 4LFAL 1TT2A 2GB1A 2NCNA 1LTBD 3P7JA 4FXGC 2A5HA 1Q82C 4A93G 1U9RA 2FMMA 1S5FD 2K5NA 4RKBA 1PFDA 1AWDA 2Z6KC 1X3PA 1D3ZA 2LVOA 1GD7A 2ID0A 4N8FA 2KWUB 1RAXA 2WXJA 3DMUA 1HZ9A 2RBMA 3H94A 3A54A 2P5ZX 2L76A 4GB9A 3BVGA 4IUNA 1IP9A 1Y69U 1ZP0B 3KYDD 1TWFH 1E1TA 2F0JA 1VF7A 2LHEA 2L9HA 1KDCA 1GNUA 1F9PA 4S0RA 2DY8A 2UXDL 4Q2JA 1SYFA 3QWNA 1O7LA 1IBXB 5CV6A 2WXQA 3OLMD 1LTGD 4A93H 2M17A 3L3OC 1MHWC 2O2LD 2YTXA 3X3MA 2A68D 1UBIA 3UDGA 1HH2P 1F9SA 1TWFB 4BBRG 1ZXTA 4YIJA 2J0MA 4HCEA 1XX8A 3TEWA 2ZW1A 1XMQL 4ARIA 2N8NA 1HFGA 4NXNL 4JC0A 3T8MA 4ZAIA 2IGGA 1NYRA 4YY3L 5JHAA 3QK0A 4RHSA 1ZYRD 5J3BA 3G7LA 3DEPA 1PZID 3U9SA 4JI7Q 3NZSA 1WRDB 2CW0C 1LTAD 1SYCA 2ATWA 1YQ3B 1HR0Q 3I4MB 2EYPA 1TWGB 1L0YB 1N34Q 2ASQA 2LGYA 1U4PA 1WM2A 3NTKA 2BVCA 3F1ZA 1VCBA 1QT9A 2LGXA 3ERQA 1R4QB 2C35B 3CMEA 5DPSA 5ELCA 5E4WC 2LXCA 2MBHA 4K81A 3MP9A 3AXCA 3U4ZA 2JA5B 4A3PA 4AQ7A 2W9NA 1MBYA 2F0IA 3AEEB 4ODGA 1UEBA 1CSPA 1V5TA 1VD2A 3OWEB 4TQ0A 3ZJVA 2PE9A 1IGDA 1BMLC 3I57A 3VA5A 1PH6A 1YVCA 3Q3NC 3PSIA 2KJHB 3P20A 1GC7A 3A1QA 3PO3G 1OXUA 4JI8L 4G3XB 3GTJH 4HEDA 4A3LH 3KJOA 2BS3B 2WAQB 1L0XB 2F0OA 2WKDA 4IUUA 2IO1B 5D3DA 3GTQH 2FJ2A 3TCAA 3HKZG 4ME3A 1I35A 1V80A 3EECA 1S5DD 5JVG3 1JRPA 2QF7A 3ZUNA 3IRBA 5J22A 1NBFC 3CCRA 5EBCA 4FF2A 3RMKC 2WXGA 1XD3B 3PLVA 2IO3B 4ALPA 1WYDA 1A8VA 2M9VA 4EQ5A 4GKKL 2AL6A 2K8BA 3M62B 1H8CA 2JPHA 1AN8A 5LMUQ 1E9MA 2JXXA 3TBLD 2ACZB 4JI6Q 4CJ2C 4X64Q 2KX0A 4LNKA 4KKUA 1QQRA 5J17A 4LNOA 1E8YA 5BMIA 1WGGA 1ZXIA 4P73A 3CCSA 2ALYB 4DR4Q 2KNBA 3HIZA 3VR6A 2PPBC 1LTSD 4MELA 4H2AA 3CCQA 1ML0D 2B3GA 2TMPA 2Q2TA 1PH3A 2WDQB 3QARA 2NVUI 2H5XA 1XO3A 2A6ED 1F2MA 4DHJB 3DBHB 2JYTA 4A3MB 3D6WA 3BYTB 3HOUB 4KKJA 1ZYRC 5BO4B 4O42A 2X8XX 3CRKC 5JHBA 1T3QA 3BVMA 2N7JA 4HPLB 1TXYA 2FBWB 2NVTH 3A7AB 1BVSA 2V3NA 1WGRA 1VZ7A 1K0RA 5CV9A 4A3IH 4KJNA 1YZ6A 1K52A 3J7YW 3TBIB 2JZ3B 5ISRA 1RM6C 5GAHC 5IP7H 3RNCC 2EMSA 3NHHA 1FXAA 4X3UA 2KC1A 5J2RA 4PT5A 2BYTA 4QJFA 1QOHA 2NR2A 1N5XA 3E3XA 1B4OA 2ZVOA 4C80A 4OEMB 2QEXA 2IDYA 2QDLA 1UNSA 3I91A 3SDZA 4XX5A 1PGBA 1ESRA 4R8IA 2OCEA 4YHHQ 3BZDB 4C7ZA 3S9WA 3MHZA 1VQ9A 1TWAH 1I94Q 1F2LA 4HWIB 2F0FA 3TP5A 3M4OB 1GG3A 2Z6BA 1TQOA 4IUTA 1WCMH 4R1JA 2JA6H 3MTNB 1PTOC 2BCOA 3PF4A 5C23A 2OEOA 3C1EA 1VQDA 3QOLA 1TWCH 4CDFC 1V2YA 4B95A 5C4JH 5IP9G 3I3CA 4ZUIA 2DZJA 1PH7A 2IYDB 2EYJA 4A3BB 2M00A 2UUAQ 4AWJA 1WD0A 4OL7A 1LV9A 4LFCL 1HNWL 1HNXL 2KHJA 4TSSA 2UXBL 4HXDA 3D32A 4CO7A 3LNNA 4IO9A 2KQ7A 3HOVG 4DV4Q 1DYQA 3IKJA 1O7YA 2V1CC 4A3CG 4FHJA 2BTEA 3P4PB 4K6LA 3MEHA 1PTOD 1YBYA 3I4OA 2D3CA 3AEVA 3RNGC 1YQ4B 3U8ZA 4L5RC 1W6KA 2MW5A 4K0KQ 2YLMA 3PZ7A 5DNFA 5E4XA 1EFWA 1TGZB 4OWXB 3BYYB 1EY7A 2A68C 1SF0A 1EM7A 2PKOA 4IM3A 1OQQA 2BS2B 2JZPA 4EZKA 4EZJA 2NBWB 5L83A 2IO0B 4WRDA 5IGBA 3EJIA 2JN4A 1A15A 1KAAA 4HIMA 4MSQB 4R4QA 3NZUA 2INDC 1TS2A 4R4OA 1RL2A 3GTGB 2R7ZH 3S14H 1N33L 2D62A 3DOWA 5BN5A 1TTNA 1H9RA 5LHY1 2F0LA 4IC7B 2KDMA 2N9LA 2IZVB 5C44H 1QB5D 1TZ1A 1E7VA 2EXZA 3VTUA 3KYHC 4PNYA 4OX9Q 1QOAA 2V3SA 1PRTB 1SB3C 3L13A 4JIOU 2KQ3A 4OXPA 3RLOA 4MNOA 3RNUA 1QOGA 3TEXA 2BOSA 3ZJUA 1PMRA 3ZLZA 1LLRD 1FVIA 2IL8A 5CORA 2E74C 1ET6A 4DR5L 5C3XA 4IUPA 4A76A 2OQ0A 1ZDXA 4NKLA 5E6NA 1JWMD 1JALA 2FMCA 1ZE3D 2LRUA 3U7ZA 4WJOA 4B6WA 3I4MG 1Z2MA 2F0UA 4JBJA 3I73A 5HFYA 1AEXA 2FHTA 1GXDC 3QIAA 1MSGA 4DUYQ 1AZPA 1G6PA 4EUTA 2RSUA 2DBYA 1RTNA 4ULLA 2QEJC 3FRPB 4BBSH 1AE2A 2B76B 4OO1H 2VQFL 3H09A 3HM3A 1KHIA 1LT3D 5C3EH 1T0QC 1KQSA 1Y1VH 5I2XA 2DZIA 4MM3B 4XGAB 2L0TA 2JA5G 4GXBA 1H9SA 3PUWA 5FLMG 3GTMB 1XMQQ 2WQYB 1UEAB 4P6VF 3NVZA 2LXKA 1G6ZA 4TQUS 2K8HA 3PUXA 3KUPA 2FE8A 4EE2A 3HKSA 4YY3Q 4DV2L 1YOVB 2KC2A 2RVLA 1SNMA 5C0XH 1WOCA 1YHBA 1IBXA 3PIO3 3PRZA 4HEA1 2X38A 4V190 3D4DA 1A70A 1KC8C 1QCBD 1EQRA 2KAJA 2WP9B 3E56A 3G4SA 1SYDA 2LMCB 1M4VA 2R7ZG 4BVUC 3DVGX 3M4YA 3B9JA 3RZDH 1D5MC 3Q23A 1QOBA 1SE8A 3TL5A 1EU4A 3PSEB 1CZGA 2J7ZA 3NWSA 2W82A 3E9SA 2MBQA 1RHPA 5E7NA 3TP7A 1CQFA 1E24A 5LNK1 2CVRA 1YD8U 3T3NA 3OMGA 3PS6A 3GP7A 4DV5L 1NR4A 1VQOA 4JGHB 1N32Q 2EYLA 4LFAQ 2SAKA 3H9DA 1A6XA 4NNJB 2KYWA 1KOTA 2PQAA 3AM9A 2NTSA 1EU3A 2JWZA 5K36G 4GIVA 4FF1A 5JH5C 2EOTA 1WTPA 4X6AH 1RTOA 1IBMQ 3ML8A 2WKCA 2KD0A 5BMGA 2K03A 1DJRD 3GTLH 2O5JC 3PT2B 3U30A 3D4WA 1PTOB 1AZQA 1EL0A 3ZO5B 2VY3A 3E6ZX 3VTVA 2KDIA 2F4VL 1E7UA 2GA4B 1Q0WB 1BQQT 1MVKA 4IM2A 4W9JA 3KOJA 4FYDA 4UHVA 4A3MG 1GUAB 1EWYC 1JE5A 2A19A 1G6JA 2Z4HA 3TP8A 4DV6Q 2KDEB 2LD9A 1DOXA 2PW5A 1X3EA 2FXQA 3QG1A 4TVAB 4YCVA 4HCNB 2MUYA 1NI3A 2EJGC 2EY1A 2NTTA 5LMUL 1CKMA 4APVA 1XNRQ 1EOVA 3BK1A 4CKEA 4OVZA 2HCIA 4BOSC 2FNJB 1OTCA 3PO2B 2QHOA 1E3PA 3S1NB 1MI0A 4L2YA 2UUBQ 5G5GA 2DNFA 2HE7A 4C2MB 3OG5A 1XXGA 1BNZA 1XPUA 3KVFB 1PFMA 3ICEA 4Q5VA 1I4PA 1Y1WG 2ON8A 2PLPA 4A3GG 3SR6A 2K8CA 3J80L 1Y14B 2BQQA 1OEYJ 3A9JB 1STGA 2K04A 3G6JB 1T9HA 2F0EA 4O0AA 2OJRA 2ASBA 2B2WC 2CFMA 2LGIA 2MCNB 3I3TB 4A3DB 4KHVA 2QC8A 4KGTA 5T1IA 4G7ZC 2NN6G 2EELA 2EQSA 2D3BA 4R4IA 2DLBA 1NSNS 2PMZE 1V97A 2DGYA 4IN3A 4DK0A 2R2OA 5FO8B 2NN6H 1CHPD 3AE3B 1O7IA 5FOBB 4PMWA 4F87A 3GTKH 3AN1A 1JWBD 1WZ3A 1Q8KA 1SMYD 3KF6B 5EE3A 2KANA 1VZ6A 4GN4B 1WTHA 1OEYA 4OWWB 1HTPA 1H9SB 4HJGE 1WJUA 2QIEB 4A55A 1P98A 2WACA 3CC2A 3LYYA 3J7AV 2WXOA 1PRTF 3KBXA 2M1MA 2N0SB 4LF5Q 1TZOA 2B8FA 3F2UA 5HKHA 5IGDA 2V4IB 5DPWA 1TU2B 5FO9B 3K7AH 1FJGQ 1R4MB 3E0JA 3P2BA 2EJFC 2I5MX 5A2QE 4DV0Q 3F2DA 1XMOQ 2QA4A 1WXAA 5AUIA 4RFBA 1SJED 3HOYB 3IT6B 2WDVB 1IXRA 1F9QA 2J4XA 3TS2A 2KA7A 4KMUC 2NVQH 2G3QB 4JQWC 4RMAA 3ND8A 3A9JA 5IIFA 1ZW7A 4LF4Q 3K7UC 3PMFA 4MZ9A 3NEMA 3L16A 4OO1G 4IURA 1HTOA 2KDBA 2L0CA 1V8CA 4LDTD 2L3ZA 2HUGA 3J80i 3UIPB 3AEGB 2JRHA 3N1XC 1Q1BA 3NWTA 2B8GA 2N88A 1IBKL 3VRAB 1G51A 2WXRA 5EGTA 4A3GB 1GUSA 3FAHA 3AB9A 2R93G 3M3JA 1HUNA 2K5QA 1EF1A 2RDFA 4B9WA 4IPDA 3CQZH 4Y7NB 2PZUA 2JQRB 3O13A 4DXGA 2K25A 5DCNA 2SNMA 1NMGA 5K5PA 2KHWB 1QG7A 1WTVA 4A3JH 4LFBQ 4QL5A 1L1OC 4LUZA 4N58A 5IYCG 1HEZE 1FR3A 3OW7A 1CKOA 3SK6A 4GN5A 4AQYQ 1YI2A 5JJZA 2HTHA 1EYDA 2MGSA 1WGHA 1LABA 4KV2A 4OZCA 3U9OA 4X62Q 2KJRA 5DM63 5NUCA 1MFWA 1FRRA 4GOCA 4QQBX 2G9DA 2KCTA 1WTQA 2WNMA 5BYRA 3S1RB 2LY7A 4XC2A 4YT0B 3HOWB 4KN4C 1NDDA 5BYQA 1OO9B 2KEDA 3SEBA 1YJIA 3HOZG 1V49A 4CHKA 3S1MB 1FNVA 3H0GH 1I4GA 4WURA 2R92H 3PIP3 4G11A 2MBEA 3HOZH 3MWYW 3GDEA 3MFYA 4K14A 2K52A 4KV6A 2BKFA 3GE8C 1K0SA 4DV7Q 3PREA 1RDPD 4KIKB 1B53A 3ULLA 2RDHA 3FEWX 5M3FG 1P16A 3AI5A 3TEHB 3NSWA 2XRSD 1Q12A 1V1OA 1UBQA 4XDCA 4HSPA 1R4NB 2INPE 1U4AA 5C5LA 1M1KC 2CKHB 3WA0A 5LXIB 4FF3A 1I6VC 2EDGA 3MVVA 2GBNA 2AL3A 3I63C 4LNNA 5G2NA 5FLXc 1VZ8A 1SE3A 4M00A 5IP4D 3RFZB 3Q24A 3K5MA 4C3IB 3AE4B 1VQBA 4MTNA 2MX2A 4AYBB 4P71A 3HOUH 3HOXG 4NJ7A 1ET9A 1VQ5A 1G2SA 2C5CA 3LGJA 3V2TA 4DN4M 2MA9B 4YSZB 4K5XA 2L0FA 1JCKB 5C44B 3HOUG 3UGBB 4NPSA 1Z5SB 5FLXL 3M63B 4EEWA 4RKLA 4IKGA 3ML9A 3K5NA 4HIOA 4J8QA 3LXFA 2KFKB 3B2FA 4N8X1 4FN2A 4NQKE 3Q3FA 1B9MA 3UI3A 2ZCCA 2K1BA 3RLFA 2HQEA 1FIQA 3KF8B 1XNQQ 1Y8RC 3RZFA 2C7NB 1JJGA 3BK2A 4DR6L 1HTQA 4X64L 3KLRA 2ZJRA 4DV1Q 2BH2A 5T1GA 4W9DA 5DEHA 4HMIA 1PFBA 3M85A 4J6IA 4DXAB 3S2HH 2DENB 3K9OB 3A4SC 4FJVB 3H7SA 2Z1CA 3ZIMA 3HEJA 2RPVA 2WXNA 1SR3A 1N33Q 5HI1A 4PK1A 2UXCQ 1J8IA 3EROA 1KTKA 1FD7D 3FVQA 2RA4A 3HUIA 1RWSA 4D2KA 1NUCA 2G4DB 1UD7A 1SYBA 1UAPA 3NTIA 2RR9A 2KN4A 3QX1A 4HPPA 2JWUA 1Y1WB 2K39A 1Q7YC 2BT6A 4IDIA 1KRSA 4AH6A 2YTYA 1HA6A 1P7EA 4C4VB 2J52A 2KVRA 4W9HA 5IYBG 1D6EC 2RPQA 4CYEA 1V8QA 2BA0A 3BVZA 3MZ5A 3WIMA 2YU9B 3T3OA 3DDCB 1L5PA 4C7YA 4NQLB 2OXPA 5HG2A 1TWCB 4UPAA 1HNZQ 4HCSA 3HOVB 4KZCA 4AYBE 4LF8L 3V6EB 5HGQA 2DWQA 1C4AA 2MJEA 2V9HA 5IOIA 1RRBA 1RJTA 2LGSA 1XNRL 1KLGD 3SFDB 2BKRB 4MGYE 4FHKA 3R66C 4IPHA 3S2AA
chains in the Genus database with same CATH topology
4KGRA 2B2WA 2WINB 2I46A 3RZDB 1F9RA 1OFFA 2F03A 4DFAA 1TS5A 2M0AA 2M2LA 3DUZA 1BBXC 5J39A 5M9OA 1D1KA 5KYIA 4F88A 1DOYA 1I4XA 1SNQA 3LWEA 4NMZA 3AE8B 1CI3M 1EQVA 4L8JA 4YTMB 1NYQA 4J3OD 1I4RA 2Q8RE 2PYKA 2W55A 3SR1A 3K5OA 1G2TA 1LT5D 2MJ8A 2B2YA 4QB4A 3SVMA 4IALA 4XYOA 1C48A 3HKZB 1IYVA 4ME5A 3AEAB 1D1IA 2XNAC 1XLOA 3KWVA 4B08A 5IT9L 3KF8A 1FRDA 2YYZA 5C2TB 4C1NI 4ZUJA 3BS1A 4RCOA 3HRDD 2BB6A 3AEDB 5HHDG 1LT4D 4FXCA 1ILPA 1CFMA 3GTLB 2KJXA 1FXIA 3C2PA 5I9PA 3GTQB 3VQIA 4YSXB 3AV8A 4K5WA 1VRAB 2JE6I 2NVYB 3JAML 4OZBA 4IFDI 1OQRA 2PW7A 4H13C 3QB3A 3I72A 1GJXA 2L12A 1K53A 1QOFA 5H8YE 2F0TA 2WS3B 4HR7B 4LK1C 3QOJA 2HDMA 1RYJA 1YNJD 3TSSA 1GHJA 5D7GA 2AX5A 3GTPB 2A73B 3WCQA 5I6YA 4A90A 1K83B 3Q8AA 2EYOA 1E7PB 4BA2I 1MI2A 3AB5A 4CJ0B 4LJZC 2JSOA 1EYCA 5BN3A 3MTSA 4LAAA 5I9OA 1N62A 3ZQ4A 5M5XB 2Q8IB 2PQEA 3HG9A 1L0VB 1TWAB 4IFDG 2FINB 1C76A 3OWFA 4JX1C 3NS1A 4BWGB 3OIQA 3R93A 2QCPX 4EQOA 1E2WA 4YTNB 2AUJD 2K28A 1S5CD 1DGJA 5EKIA 1JW9D 4XQJA 3RPFC 1YNNC 1SNPA 2ICEC 4XQQA 3KK7A 1CHQD 3DWGC 2F3WA 4YTPB 4XDDA 4RGMA 2MPMA 2LUMA 3PUZA 4V0BA 5GXGB 4A3EB 4US9A 5IGGA 1KNAA 4WORA 4XIGS 2LFIA 1OXVA 1OXXK 1JR0D 3I70A 3VYSA 5ELFA 1ZOYB 4NAWB 1I50B 2QDBA 3VR4A 3NK9A 3GD7A 4ZQ3A 3J81E 4WIPA 4LLGM 5JPNC 5KIXA 2O4XA 5IOCA 1LTRD 2HDEA 1MSHA 1JWSD 4I65A 2EYMA 2VZKD 4C3JB 4B0EA 4DAVA 3R2IA 1B9NA 1EY5A 4HKQA 2E6XA 1O7ZA 3S1QB 4OZAA 4EQNA 5C3JB 2Z8LA 1TR5A 1II3A 1E0BA 4BA1I 1TYGB 3NUHB 2JEBI 3H6MA 3SK8A 3T56B 2JXMB 3FKIB 4KY6A 3Q0AA 1K8MA 1BCPC 2B2YC 3GV6A 1SSNA 2VB3X 1C4QA 2V3PA 3ETRA 1BF4A 3EQLC 2J53A 1FCLA 4UDUC 3K7AB 3GB1A 2L55A 5EQ0A 2B63B 1WTRA 3J81L 1TY0A 2E2IB 2MJ3A 1S4ZA 4NW2A 2I07B 1L4ZB 2EJMA 1Q1EA 3D31A 3MFGA 2A6EC 4IQZA 5EE9A 4ZRZA 4XE0A 4IUVA 3HP3A 2KCNA 3HOZB 2G9HD 1EFID 2B2TC 1RFKA 4DQOC 5A35A 2IPKD 2V4DA 1HPCA 1HUMA 2NMQA 5AFWA 1F2RC 5J1ZA 4HRSA 1CZWA 1GAQB 3IT4B 4X3KA 1DM0B 4ITKA 5BYQA 1PUTA 2XVSA 1U4LA 3T4AC 1UWXA 1A3VA 4MT5A 1T5EA 1F0ZA 1SJHD 5C0XJ 1JB3A 2WB1B 3P63A 5EPLA 4KD3A 3CQZB 4US8A 3R8BA 1BUIC 3GTOB 1IYUA 1D5XC 1VCIA 3Q6SA 3P4SB 4I7ZC 1Y8OB 2IGDA 1CZPA 4FNFA 1CA6A 3AE6B 2NB0A 1PZJD 1C79A 2WXFA 2Y3AA 2F0PA 2CQAA 3HRZC 2N9KA 3FC4A 3I4LA 3U52E 4ILWA 1B50A 4TQ1A 3L9AX 2F1MA 5HURA 3DWPA 2MJDA 3MXPA 4OO1I 1D2BA 1EY9A 2JA6B 5BN4A 2WXHA 2LJIA 3CKIB 3SE0A 1QNUA 4KHZA 5IGEA 3K58A 3IXSA 5CBAE 1MPEA 1ENCA 2X6GA 1EY6A 3FPUB 3PO3B 2B2VC 4OIKA 2M56B 4TMAB 5C0XI 4KX6B 4M0WA 4G4KA 3VYTA 5FR3A 1RF2D 4NZLB 1AP0A 4K8JA 4GDLB 1C9FA 4F7XA 4OIJA 2PW9A 1JMLA 1PDQA 2AQ2B 1I4HA 1W6JA 1C4CA 1FM0D 2RDGA 2Z4IA 5EBDA 4RGTA 4YSYB 3VR3A 1Z7TA 1ESFA 5JOBA 4QCLA 3EA6A 3P1HA 1F2YA 2HCCA 2K9XA 3B2GA 3WOEA 1TKYA 4UAIA 2INNE 4CHTB 1RCVD 1WVLA 5D3IB 1F77A 1DCZA 1O80A 2N55A 4ARCA 1WSPA 4QUCA 4XT1B 1KABA 3Q8BA 4X3TA 3J80E 2QKIC 5JEAH 1NCVA 3AMUA 3PV0A 2VZKB 1N63A 2JSVX 1LO5D 4A9AA 2QILA 1IW7C 5EPKA 1SFOB 3NZ3A 1ZKOA 4KKSA 2JA8B 3TUOA 3ONAB 4BY7B 5LL6X 2KECA 2PZWA 1B1ZA 2DN8A 3IFTA 2XWBB 2JX5A 1PDXA 1KDBA 1QILA 1IHZA 2BB5A 1JOKA 2JA7B 4GDKB 2BE5C 4XQNA 4BS9A 4P16A 1TVXA 4ZYSA 4DGZA 5E6JA 1B9RA 5IODA 4DU9A 1VDZA 2JP1A 3N52A 1GUGA 4R9WA 4LK0M 5FLXE 3KLSA 1ACCA 2NN6I 1LTTD 2K3UA 3NTHA 1NENB 1VR9A 1IW7D 1GOZA 2TSSA 3ZYYX 1J7AA 4ZRPA 2H4OA 3MXNA 1F2RI 4XWTA 1HQRD 3PUYA 4A93B 3TDQA 3BDCA 1GHKA 3P42A 3TEYA 2A69C 4ZHPA 3MXGA 3QJYA 1RD9D 1JICA 3OPOA 1NEKB 3S17B 2ENBA 4DF7A 4CQNA 2AQ1B 2X69A 2PZTA 4J1MA 1A3TA 4R8NA 2EYFA 2PTLA 2I2YA 1E2VA 1HHVA 1Y8PB 3A56A 1NR2A 4QMGA 2B39A 1GB1A 4PQXA 2I38A 4QIWB 3TN2A 3LB8C 1I6HB 1Y8NB 1CA5A 1EY0A 2SOBA 4K2KA 2YEPB 2F3VA 3AECB 2KCCA 3P4QB 2WU5B 1YN3A 2E3TA 4REZA 4FVMA 4H44C 4U673 2L52A 4PV1C 5M5WB 2Y5PA 2JYEA 1CM9A 2PVGC 3NRZA 3BIID 1SSOA 3GTJB 1NAPA 2F0VA 4HSVA 3J9CA 1S5BD 4S3SA 3C8YA 3H3VC 1TKEA 3MAQA 1IL8A 1ZUD2 3A8IE 4A6QA 2DYMA 2IX0A 4N59A 2F4IA 1E0ZA 4C1NK 1JOQA 1WTOA 5CV4A 1WTXA 2WXKA 2PMVA 4RF1A 4C3IG 1SBBB 4CJ1B 5DAUA 3IFDA 2CJNA 5JAVA 1KFYB 4X3SA 1SE4A 1S5ED 3L7ZC 1BCPB 1VDVA 1E10A 1PYWD 2WDRB 1JWAD 1ONLA 1V1PA 3NPPA 2WXLA 1VF5C 1N61A 4L1BA 2D2CC 3FILA 1J7CA 1G291 4KKTA 5I6WA 4DNTB 1HXYD 5A2QL 3EVQA 2LFNA 1F2ZA 1C8CA 5LL6S 5KNBA 4EVOA 3GV3A 4WJWA 4NP5A 1VLBA 1BXTA 1IGCA 3EUB2 5E3FA 1XTCD 4DAPA 5JPMC 4NAMA 1SXTA 2LKVA 2SNSA 3VR8B 5HGTA 5KRUA 2EVBA 1R7SA 2IX3A 3HVZA 1YN4A 4L6TB 4C3HG 1GPXA 3V05A 4RNAA 1DXMA 1XYIA 4M1UB 5I2YA 2KQ4X 3L4PA 2JEAI 3BWUD 1C77A 1DOMA 2IJ0A 1AW7A 1TJEA 2R93B 1SIJA 1SE2A 5C4XB 4YWGG 2OT2A 2F0WA 2MHVA 3NQIA 4LMQD 1M8AA 5KEEA 3VYRA 2PIAA 1RODA 1U4MA 1I4QA 3DHQA 1YN5A 1DD2A 1N5WA 1GUOA 1PRTD 2F0GA 2DNCA 4KY5A 2LS01 4RA8A 3IAM1 2NYZD 3T53B 2NVXB 2RSOA 4ID6A 5CGKA 4HAEA 2L32A 1WWTA 5BMHA 1H9JA 4L63B 4RAUC 2W54A 2CU3A 3AEBB 2CW0D 3MXUA 1WTWA 2JYOA 4TKOB 3A8JE 3JAME 4FO2A 5FK9C 2XWJB 2QMTA 1B44D 2K7VA 2WV6D 3I90A 3R2TA 2GRIA 4C3JG 1XF5L 4M8AA 3KLSX 3IAYA 3X3NA 4RCNA 3RZOB 2JXTA 4RH6A 4G7HC 1HA5A 3AEFB 5G3LD 3RUZA 3V3XA 1OXSC 1T6BX 1TS3A 2NWGA 4NDXA 1EIGA 1DZ1A 2F0KA 4P2CB 5KYLA 2ZXRA 4A3KB 1Q10A 3N6RA 2L1BA 3I4NB 4XTCS 3CIRB 3UI2A 1EYAA 3S15B 4RGNA 1PXUA 2RQXA 3NVVA 3NBHA 4KKIA 4KJOA 1FNUA 2EE1A 2Q8TA 5CMDA 1MGSA 1EWCA 1ZPSA 3NVYA 2BA1A 4MH8A 3OOCA 2R92B 4U68A 5F2DA 2WXPA 4JK1C 3PUVA 5CBEE 4RHRA 1A3UA 1PFNA 1TIID 4ZOHC 3K57A 2IWHA 2C9OA 5EKLA 5C4ZA 2B2UC 2DY7A 1SEBD 4ZKBB 1CT1D 4JBWA 4OGQC 3TEZA 2QSDA 1JQYD 4KY7A 4E6IA 4ZHOA 1XCQL 3AE1B 4DAYA 4B0MA 3W2DA 2B2TA 1STYA 1OXTA 4OHJA 5KGUA 3DM1A 4WQMA 4IOIE 4J6HA 2F0MA 1BUVT 1EIHA 3LWUA 3FILB 4FP5D 3VR2A 1BO0A 3DWMA 4YXDB 4GZYC 1LTID 4PMBA 4RF0A 2EY6A 2K05A 1D5ZC 1PLFA 2AUKA 2RKSA 2WLBA 2FFKB 1AYFA 3MC0B 1FNWA 3QO2A 1GUNA 1CQVA 3KBGA 1L4DB 2LEKA 1LT6D 1SAPA 2NVQB 2K32A 3MJ5A 1JE4A 1STNA 4G7OC 3J7AF 3D8GA 5CV7A 5M3MB 4XYQA 2KOLA 4CKBA 3C46A 1PGAA 2SDFA 1DOLA 2NBFA 1VJKA 3TZUA 1O78A 1Q90A 2MH7A 5T8IA 3PO0A 5ELEA 4FXDA 1PZKD 3W9CB 2ZXOA 2H88B 3AH7A 1R4PB 5CR3A 3VYUA 2AWOA 2K0PA 3NVWA 1V1PB 2K5DA 2K6AA 4C56C 4BBSB 3D4RA 2Q5WD 5EE1A 4HMJA 1G91A 3ZJTA 1I3QB 5C0XG 3SHLA 2D9UA 5D14A 3T13A 2MP1A 2K01A 1PRTC 2CHBD 4KN7C 2O5IC 3K59A 3HVDA 5H92C 3M7NA 1J7BA 4NJCA 5JVH3 3FPPA 3NE5B 4N9PA 5D65A 5FO7B 3NP8A 1CTMA 1Y56A 5EPJA 3AU7A 2D5DA 3R3OA 4A3JB 3OIPA 1Z47A 3NUCA 3HS0C 5ELDA 1TWHB 1C4PA 1WGKA 3MA2B 2BS4B 1SNDA 4MN3A 4CGYB 5G3LF 2A74C 2PO4A 3D3RA 1E2ZA 1GUWA 1IUEA 1QKZA 2J42A 2ICIA 2CJOA 1XEEA 4TRDA 3OSOA 2LMCA 3ABVB 3K0YA 1HFNA 1L6VA 2X6LA 3K6OA 2F0SA 3WDNA 3M3YB 5TSSA 1ENAA 2OEDA 3Q8FA 1A2UA 3AE2B 2J0TD 3P75A 1TY2A 3S16B 2BDOA 5FKAC 4DXFA 2PVOD 5CYUA 1HZ6A 1WCMB 3Q22A 2E75C 3S2HB 2NUCA 3BDOA 1UUPA 5MPOA 1XWEA 2BW2A 1DOIA 1CJEA 1EEID 3GO5A 1FFVA 2W3RA 3RMHA 3Q69A 1EY4A 2NVTB 3C1FA 4P6VF 4KTAA 4JPSA 1G8ZD 1C78A 4N9TA 1QJOA 4K5VA 5ELBA 3D6CA 2KACA 3ITPA 2IT1A 1DONA 1B3AA 1FD6A 1SYGA 2M19A 1Y1VB 3DWAA 4RWSC 2IX1A 1ZDVA 3A7LA 2L11A 1YNJC 2VB2X 4QUFA 4CBVA 1YJJA 1MHHE 2R6GA 1YNTE 4GLSC 1FEHA 1QE6A 1A2TA 3M7GA 2YEPF 3U2SC 1IKLA 2EPBA 5CV5A 1BOSA 3GTKB 1FO4A 1ICWA 1X3QA 3TP6A 4BBRB 2XSCA 5KNCA 5M3FB 4N6EB 3VR9B 3W1SA 4C3HB 3URYA 2K22A 4KK7A 1T5XD 3CRLC 1B2TA 1XLQA 4DNRB 2ZW0A 3SFEB 3Q8EA 2H1EA 3MHBA 2KMMA 2VXWA 4EGVA 4OW0A 2E76C 1STHA 2EY5A 2L5TA 2W3SA 2E2HB 1VMPA 3W5VB 3HOXB 4L23A 4Z9CB 4IZ8A 4F8MA 1L6UA 2BDNA 4B9XA 3SXHA 4HN7A 5C4HA 1HTLD 3HGBA 1XLNA 3AMZA 1EWHA 2PCFB 3NBIA 2FUG1 1X32A 1EQTA 2L83A 3I9V1 3CU7A 3EFXD 2A69D 4JE3B 3SK5A 1BCPF 1K51A 2ZT9C 1WD1A 1KLUD 2HDLA 2KEEA 3K5LA 3SK4A 4IFDJ 3N9YC 3U4EG 1JQ4A 5KNDA 4JWUC 2WU2B 4MACA 1GUTA 3T16A 3TMEA 1QF6A 3DWQA 3AE5B 2BBCA 5C3EB 1STBA 4AS1A 1XLPA 1JROA 3WOFA 1STEA 2VNUD 5BYSA 3P4RB 1JWUD 1FFUA 4CKCA 4JWSC 4XXEA 3T51B 4G57A 4R3DA 4A8XC 5E1FA 2AWNA 3PZ8A 2EZVA 4BY1B 5EE0A 1HQMC 1KRHA 4XDXA 2KWDA 2A6HD 1P7FA 4ZKCB 2Y5CA 1UGJA 2KVMA 2DYOA 1V43A 3CHBD 1R9TB 4HTHA 1TKWB 3H91A 4XT3B 3RD4A 2E2DC 2PMZB 3GS2A 5M5YB 1NVID 2K33A 3EGRA 5DM73 2VUMB 3ZGZA 5EKKA 5G5HA 1CK1A 1JORA 5CC4A 1LACA 4WAFA 1VMCA 3C3LA 1HCZA 3FDTA 3FMCA 1ENFA 1MHXA 1SDFA 2XN9C 4RGOS 5JEAJ 4DK1A 1FMAD 3VR5A 2XIWA 4FF4A 1Z6HA 4ZLTF 4QF4A 1Q3LA 4K8IA 2R61A 2BE5D 2GI9A 1WXQA 4FXKC 1Q8IA 3Q8CA 2OF1A 4IUQA 5C3WA 4WWMA 1GB4A 4HKZE 3I8ZA 3OMCA 2WIIB 4ZRQA 1QNKA 1DOKA 2F0DA 3BDLA 2D5GA 2AQ3B 3KWLA 5C6AA 5C5MA 4WFN3 1JC7A 2L4NA 4WH4A 2V0GA 2K5PA 3P1MA 1YMHE 4EQPA 1PTOF 1H9MA 1RKNA 3A8KE 1J9OA 3TZDA 5C4JB 3NQTA 4XWWA 1SNOA 4DA2A 1KNEA 4A3FB 2ONQA 3IL8A 5IGCA 3VA7A 1YNND 2DNEA 1EZ6A 2NZ1D 3H0GB 1FCCC 4MHEA 1WYGA 1I7HA 5JEAG 1BCPD 2PNRC 1E6EB 3H8HA 5COYA 3A55A 3GQBA 4PMCA 1EZ8A 1KDAA 5JXVA 4H7BA 3LX0A 1ILQA 3OHXC 2Y0SB 1AFPA 3V96A 2KUMA 2IGHA 3CWIA 2F0NA 1XCTL 3S14B 1STAA 2R7ZB 2RMMA 4Q0FA 5I4DA 2L1AA 2B2VA 1EY8A 2RSNA 5K36H 2E2JB 1HRJA 1U4RA 2F0HA 4ZK9B 3HZXA 2EYHA 1K8OA 3AE7B 3VRBB 5IGFA 1FGBD 2KHSA 1N60A 4ABNA 3E5SA 1SNCA 1K50A 1QWYA 4KD4A 3ND9A 4O1NA 1WRIA 1EEFD 4K6DA 4HROA 1PTOH 5AUKA 1KF6B 3DXJC 4KI0A 1JOOA 5CV8A 5EJWA 1UWMA 2R3ZA 3KQ4A 2A6HC 1PGXA 2ZXPA 3NXWA 3S2DB 1FYCA 2WXMA 1KH0A 4KGSA 1QLBB 4LTUA 1HZ5A 2LHDA 2WP8J 4H0LC 1SYEA 1BDOA 2JU6X 2QJLA 2K5WA 1H9KA 2HTME 2SEBD 2MEKA 1MD2D 2H89B 2XRQD 3BG3A 2G1EA 2OHFA 1IKMA 1ZEQX 2EKIA 5IT9E 1EOTA 4USAA 2WXIA 3IAS1 2IW3A 4MIUA 1BR9A 2F0QA 1TKGA 4IFDH 1ZXHA 1ROEA 2B2UA 3DEOA 4A3IB 1D4BA 4K2LA 1SMYC 1TS4A 2EY2A 3W5UB 3W3AA 2GB1A 1TT2A 1LTBD 3P7JA 4FXGC 2A5HA 1U9RA 2FMMA 1S5FD 4RKBA 1PFDA 1AWDA 1X3PA 2ID0A 2WXJA 3DMUA 2RBMA 3H94A 3A54A 3BVGA 4IUNA 1Y69U 1ZP0B 2F0JA 1VF7A 2LHEA 2L9HA 1KDCA 1F9PA 2DY8A 4Q2JA 1SYFA 3QWNA 1O7LA 1IBXB 5CV6A 2WXQA 1LTGD 3L3OC 2O2LD 3X3MA 2A68D 1F9SA 1TWFB 1ZXTA 4YIJA 4HCEA 1XX8A 3TEWA 2ZW1A 4ARIA 1HFGA 4ZAIA 2IGGA 1NYRA 4RHSA 1ZYRD 3DEPA 3G7LA 1PZID 3U9SA 2CW0C 1LTAD 1SYCA 1YQ3B 3I4MB 2EYPA 1TWGB 1L0YB 1U4PA 3NTKA 1QT9A 3ERQA 1R4QB 5ELCA 5E4WC 3MP9A 2JA5B 4AQ7A 1MBYA 2F0IA 3AEEB 4ODGA 3OWEB 4TQ0A 3ZJVA 1IGDA 1BMLC 3I57A 3VA5A 3P20A 1OXUA 4HEDA 2BS3B 2WAQB 1L0XB 2F0OA 2WKDA 4IUUA 5D3DA 2FJ2A 1S5DD 5JVG3 1JRPA 2QF7A 5J22A 5EBCA 4FF2A 2WXGA 2M9VA 1AN8A 1E9MA 2ACZB 4CJ2C 4KKUA 1QQRA 5BMIA 1ZXIA 3VR6A 2PPBC 1LTSD 4H2AA 1ML0D 2TMPA 2WDQB 1XO3A 2A6ED 1F2MA 2JYTA 4A3MB 3D6WA 3BYTB 3HOUB 4KKJA 1ZYRC 4O42A 3CRKC 1T3QA 3BVMA 2N7JA 2FBWB 3A7AB 2V3NA 1VZ7A 1K52A 5CV9A 4KJNA 3J7YW 3TBIB 5ISRA 1RM6C 3NHHA 1FXAA 4X3UA 4PT5A 2BYTA 1QOHA 1N5XA 1B4OA 4C80A 2IDYA 3SDZA 1UNSA 3I91A 1PGBA 1ESRA 4R8IA 4C7ZA 3BZDB 3S9WA 3MHZA 1F2LA 2F0FA 3TP5A 3M4OB 4IUTA 1TQOA 1PTOC 2BCOA 2OEOA 3C1EA 3QOLA 3I3CA 4ZUIA 2EYJA 4A3BB 2M00A 1WD0A 4OL7A 1LV9A 4TSSA 3LNNA 1DYQA 3IKJA 1O7YA 2BTEA 3P4PB 4K6LA 3MEHA 1PTOD 1YQ4B 1W6KA 3PZ7A 5DNFA 5E4XA 3BYYB 1EY7A 2A68C 1SF0A 1EM7A 2PKOA 1OQQA 2BS2B 2JZPA 4WRDA 5IGBA 3EJIA 1A15A 1KAAA 1TS2A 3GTGB 2D62A 5BN5A 1H9RA 5LHY1 2F0LA 2KDMA 2N9LA 1QB5D 2EXZA 4PNYA 1QOAA 1PRTB 1SB3C 2KQ3A 1QOGA 3TEXA 2BOSA 3ZJUA 1PMRA 1LLRD 2IL8A 5CORA 2E74C 1ET6A 5C3XA 4IUPA 1ZDXA 4NKLA 1JWMD 1JALA 2FMCA 1ZE3D 3U7ZA 2F0UA 3I73A 5HFYA 1AEXA 2FHTA 1GXDC 3QIAA 1MSGA 1AZPA 2DBYA 1RTNA 4ULLA 2QEJC 3FRPB 2B76B 4OO1H 3H09A 1LT3D 5I2XA 4MM3B 1H9SA 3PUWA 3GTMB 2WQYB 1UEAB 3NVZA 1G6ZA 4TQUS 3PUXA 3KUPA 2FE8A 4EE2A 2RVLA 1SNMA 5C0XH 1IBXA 3PIO3 4HEA1 2X38A 4V190 3D4DA 1A70A 1QCBD 2KAJA 2WP9B 3E56A 1SYDA 2LMCB 1M4VA 3M4YA 3B9JA 1D5MC 3Q23A 1QOBA 1EU4A 1CZGA 2J7ZA 3NWSA 2W82A 3E9SA 1RHPA 3TP7A 1CQFA 5LNK1 2CVRA 3T3NA 3OMGA 3GP7A 1NR4A 2SAKA 2EYLA 1A6XA 3AM9A 2NTSA 1EU3A 5K36G 4FF1A 2EOTA 1WTPA 1RTOA 2WKCA 5BMGA 2K03A 1DJRD 2O5JC 3D4WA 1PTOB 1AZQA 1EL0A 3E6ZX 2GA4B 1BQQT 1MVKA 4FYDA 1EWYC 2Z4HA 3TP8A 1DOXA 2PW5A 3QG1A 2MUYA 1NI3A 2EJGC 2EY1A 2NTTA 3BK1A 4CKEA 4OVZA 2HCIA 3PO2B 3S1NB 1MI0A 4L2YA 5G5GA 4C2MB 1XXGA 1BNZA 1PFMA 4Q5VA 1I4PA 2PLPA 2ON8A 3SR6A 3J80L 1STGA 2K04A 3G6JB 2F0EA 2LGIA 2B2WC 4A3DB 4KHVA 4KGTA 5T1IA 4G7ZC 2NN6G 2EELA 2DLBA 1NSNS 1V97A 4IN3A 4DK0A 5FO8B 2NN6H 1CHPD 3AE3B 5FOBB 4PMWA 4F87A 3AN1A 1JWBD 1SMYD 5EE3A 1VZ6A 1HTPA 1H9SB 4HJGE 2QIEB 4A55A 2WACA 3LYYA 3J7AV 2WXOA 1PRTF 3KBXA 2N0SB 1TZOA 2B8FA 3F2UA 5IGDA 2V4IB 1TU2B 5FO9B 3E0JA 2EJFC 5A2QE 5AUIA 4RFBA 1SJED 3HOYB 3IT6B 2WDVB 1F9QA 2J4XA 2KA7A 4KMUC 3ND8A 5IIFA 3PMFA 4OO1G 4IURA 2L0CA 1V8CA 2HUGA 3AEGB 3VRAB 1Q1BA 3NWTA 2B8GA 2N88A 2WXRA 5EGTA 4A3GB 1GUSA 3FAHA 3AB9A 1HUNA 2K5QA 2JQRB 2RDFA 4B9WA 4Y7NB 2PZUA 3O13A 4DXGA 2SNMA 5K5PA 1QG7A 1WTVA 4N58A 1HEZE 1FR3A 3OW7A 3SK6A 5JJZA 1EYDA 2MGSA 1LABA 4OZCA 3U9OA 5DM63 5NUCA 1FRRA 2G9DA 1WTQA 2WNMA 5BYRA 3S1RB 2LY7A 4YT0B 3HOWB 4KN4C 1OO9B 2KEDA 3SEBA 1YJIA 3S1MB 1FNVA 1I4GA 4WURA 3PIP3 3MWYW 3MFYA 4K14A 4KV6A 1RDPD 1B53A 2RDHA 3FEWX 3NSWA 2XRSD 1Q12A 1V1OA 4XDCA 4HSPA 2INPE 5C5LA 4FF3A 1I6VC 2EDGA 3MVVA 1VZ8A 1SE3A 3RFZB 3Q24A 3K5MA 4C3IB 3AE4B 4AYBB 1ET9A 1G2SA 2C5CA 3V2TA 4YSZB 4DN4M 4K5XA 1JCKB </