4RGTA

2.0 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with 3-n-acetylneuraminyl-n-acetyllactosamine.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
191
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKESEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Putative uncharacterized protein
publication title 2.0 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with 3-N-Acetylneuraminyl-N-acetyllactosamine.
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 64
structure length 191
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgtA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgtA01
4RHSA 1D5MC 2R61A 1KLGD 1PTOF 1B1ZA 1D6EC 1FGBD 1JQYD 5FK9C 1ET9A 1I4PA 1PZID 1SBBB 1LO5D 4NZLB 1LTAD 1D5ZC 2AQ2B 2O2LD 1HQRD 3R8BA 1HTLD 1CHPD 4RCOA 3BYYB 3MFGA 4O1NA 1LTGD 1DJRD 2XN9C 1F77A 1ENFA 1JWSD 1TS3A 1DYQA 1LLRD 2Z8LA 1TS2A 1I4XA 1JCKB 1KTKA 1BXTA 1JWMD 1EWCA 1S5DD 1S5BD 2XNAC 1SXTA 5ELBA 1KLUD 1TY2A 1JR0D 1LT4D 1TY0A 4C56C 3DWQA 2QILA 1BCPD 1SE2A 2TSSA 4RGOS 1MD2D 3OWEB 4TSSA 4BWGB 3R2TA 1SEBD 1AN8A 3GP7A 5TSSA 1PRTD 1CK1A 5ELCA 4ZYSA 1B44D 2IPKD 1I4RA 2AQ3B 1LTTD 2G9HD 1XTCD 2NTSA 2RDHA 1V1PB 1HA5A 3BVMA 4RGNA 1PZJD 1L0XB 1XXGA 1LTRD 5D3DA 2XRSD 1YN3A 1BCPB 4K6LA 1LTBD 1I4QA 1YN5A 1I4GA 1ESFA 1LTSD 1CQVA 1FNWA 1RF2D 1EFID 1FD7D 1LTID 1UNSA 1PRTB 1V1OA 1RDPD 1S5CD 4OHJA 3DWAA 3EA6A 3CHBD 1D5XC 1RCVD 4RGTA 1PTOD 1ET6A 2XRQD 1BCPC 2J4XA 4L63B 1RD9D 5FKAC 4RGMA 1S5FD 1CHQD 1BCPF 1LT3D 1SJHD 5D3IB 4DXGA 4RH6A 4DXFA 1PRTC 1SJED 1T5XD 1PZKD 5ELDA 3W2DA 3KLSX 1PRTF 4RHRA 1L0YB 1G8ZD 1LT5D 1PYWD 5ELEA 2QEJC 3DWPA 1TS4A 1HXYD 4Z9CB 1FNVA 3SEBA 3BVGA 3MC0B 1S5ED 3R2IA 1YN4A 2SEBD 1V1PA 2IJ0A 3BYTB 1PTOB 1LT6D 2ICIA 3O13A 3TSSA 1EU4A 4RFBA 1FNUA 1STEA 3URYA 4L6TB 3V05A 1EEFD 2WV6D 1QILA 5ELFA 1CT1D 1TS5A 1AW7A 1SE4A 1GOZA 1SE3A 1PTOH 1UUPA 3EFXD 3BVZA 5I4DA 1JWUD 4UDUC 1EU3A 2AQ1B 1M4VA 2NTTA 1EEID 1I4HA 2CHBD 2RDGA 1PTOC 3BZDB
chains in the Genus database with same CATH superfamily
2EXDA 4IQZA 2KWVB 1WVLA 3A33B 2UUBQ 4XT1B 2AWNA 1MJDA 5E6PA 1FGBD 3M85A 2GVAA 4ID6A 3QCAA 2B8FA 1AZQA 4HMIA 4GKKQ 1LTAD 1K73C 4QUFA 4DK5A 2AMCB 3FRPB 3BIID 4TKNA 1QVCA 2F1MA 3VYTA 3RPFC 3I7FA 4IJHA 2L1AA 1FD6A 5EAYA 3VDYA 3K9OB 4DK1A 2N78A 5D7GA 3SK8A 3AMUA 2IGHA 3QOLA 1JWSD 4J8QA 1B9RA 2HHHQ 5IP9G 1RFKA 5TR5A 1EYAA 3CPFA 4Y7NB 2Z4HA 2WB1E 4JYAQ 1TKWB 2MJ3A 3HHMA 4GNXB 1J8CA 1VCIA 2E8GA 4JI1L 3OSOA 1KNAA 5IYBG 2FUG1 3GO5A 3VR6A 5GQOA 1VZ8A 4BBRH 3AEEB 4J6IA 4P6VF 1LGRA 2JSVX 4IM3A 5IGEA 3B2FA 4KSLC 5J2RA 5CV9A 2EYLA 3KWVA 1WXMA 4GN3B 2QGQA 4DV7Q 1WJNA 3A54A 3EIVA 1MPEA 3N6RA 3S2HB 2XIWA 4WORA 4TUUA 2F0PA 2AQ3B 4JBJA 1QVFA 4YCWA 5FLXc 4RAUC 2ZNVB 2M9VA 4DR2Q 1L5PA 4AQYL 5JJLA 2KVRA 1R9TH 3QWZB 3OW2A 4IC7B 2DX5B 5AUKA 3HOUH 2K75A 1HZBA 5LHY1 5IYDH 2JA6H 4B6WA 1PH4A 5DPWA 3ND9A 3DBSA 5M5XH 2K5VA 1D3ZA 3KUDB 1EIGA 2VZKD 2YTXA 4II3B 3F2DA 4CO7A 1SRUA 1H9SA 2EVBA 5C0XG 5FJ8G 2BA0A 5DM63 4KN7C 3K5NA 4B3TL 3N30A 4MSMB 5CHVC 3HOWB 3QJZA 4F7XA 4EOYA 4P16A 1A0IA 2ZXRA 2Q8TA 1A15A 2E2HH 1YNNC 3K7AH 2UXCL 1HTOA 5IT9L 4JOIA 2YU9H 3GTJB 3I72A 2LGIA 1EY8A 4RKBA 3RI7C 1NENB 1HHVA 1RODA 1ZW7A 2F0TA 1XNRL 2DENB 2DNFA 4HSVA 1WFQA 2KCNA 1A8VA 2PYKA 3F2CA 4MACA 3NWSA 1R7SA 1C77A 2GBRA 2LKVA 4TQ0A 2VS1A 5CC4A 1F9RA 3J80L 2CU3A 1Y14B 3S1RB 3RFZB 4HIMA 2HD3A 2MBEA 2ALYB 3A8IE 1R4NB 3Q8EA 2H4OA 4DR5L 3NSWA 3V60A 4G57A 3VFKA 4GIVA 2RDBC 2D62A 3C19A 5FOBB 2LVOA 4RFBA 4A3KG 1FNUA 1STEA 1E7UA 1BMLC 3EHVA 3VTVA 2ATWA 3CSFA 2B2YA 1MSGA 4BFRA 2YV5A 3C3LA 2M17A 5CORA 1CZPA 3A56A 2VUMH 1Q0WB 2ZCBA 4E74A 4X65Q 5EPJA 4EZLA 3U50C 3HOVG 1MJCA 1CKNB 2L11A 3A8KE 4KLKA 3J7AF 2WXGA 1OXSC 2EY1A 2DZJA 5CR3A 3H0GH 2JA8H 1YZ6A 2O5IC 3I56A 2XK5B 2FCMA 4MGYE 2R61A 4X3TA 1D4BA 2KHIA 1HRJA 1BF4A 5ELNA 4A90A 1HJPA 2DYMA 3GV3A 4N9PA 1LTLA 2QMTA 1DGSA 1LQBA 3KW5B 3T8MA 3T4AC 3H09A 1E22A 1EWHA 1GVPA 3EFUA 3HS0C 4XZ4A 1HTLD 3S1QH 3E9HA 3JAML 4JOIC 1N62A 2XN9C 2DY7A 3WA0A 1TS3A 1QZGA 3DM1A 4M0WB 1R4QB 5CV6A 4NAWA 1TS2A 3HVZA 1D7QA 1G6JA 4I6NB 2E74C 4B3RL 3NZ3A 3I70A 1Q1EA 3A7AB 3ZJYC 5AZHA 3SR1A 5J18A 1RLFA 2JP1A 1TY0A 2K0PA 1X65A 1N8RC 3OWEB 3PUWA 1ZXHA 5GAEC 5C4ZA 4I6LB 2KDFB 4ARIA 2OF1A 5TSSA 3OG5A 2N3SA 4JI8Q 1FCCC 3ONAB 1XLNA 2B8GA 2B2YC 4PMCA 2L0FA 3P2BA 1UH6A 3I9V1 4ACFA 4DK6C 1WM2A 5C44H 2JA7H 2CJNA 2RDHA 2JQOA 2JZZA 4MN3A 3GTOB 2ID0A 1AH9A 2KJ6A 1XXGA 1L2FA 3G7LA 1VDVA 1QT9A 2KYWA 1X54A 4F1SA 1BCPB 3I5JC 3DLLA 4MEMA 3R3MA 4PYZA 3PSEB 1C4QA 4DGZA 2BYFA 1B2TA 2GVBA 2ZM6Q 3U4ZA 1VQAA 1TYGB 2L00B 3AE1B 3HRDD 3SR6A 5J39A 3DBHI 3GS2A 2WKDA 3VUYA 2Z1CA 1OEYA 1R4MB 1PH2A 1NE3A 1ACCA 3FKIG 1EY5A 1P1AA 2LXCA 2F0HA 2WB1B 4AS1A 2RVLA 2REXA 4KVGB 5EE1A 4G7HC 1F1HA 2CQAA 4FN2A 4MDKE 4FBJB 2MO0A 4DWFA 1WZ3A 4DXFA 4RKLA 1L0WA 4R8IA 2R92H 1U9RA 1MG4A 2M0XA 2QDBA 3A8JE 5IGGA 4K2KA 1WGRA 4C3JG 3J81c 4DFAA 2NUCA 1VDZA 4F88A 2GB1A 3K59A 1TXYA 3CMEA 4A20A 5BYQA 3BVGA 4KY5A 4ANWA 3GTLB 1PFSA 1VQDA 2SEBD 3I3CA 4A3MG 4A75A 2D3BA 4JWSC 1LT6D 4K5XA 5C4XH 4GDKB 4PYUA 1E7PB 4K5WA 2LUMA 3AFQA 4K81A 1GJZA 2B2UA 2CS4A 2BYVE 5C23A 1GPXA 4XTCS 4LCDE 1UUPA 4LF8Q 4YHHQ 5FR3A 2CJOA 2LXAA 1V9PA 3IL8A 3T1HQ 1PH1A 3ZTCA 3LWEA 2JA5H 2RCFA 4B3SL 2C9OA 1I4HA 1AARA 1EYCA 1F2ZA 4C3IG 1OQYA 4HEA1 1H9RA 4PZ7A 3DVNV 3RUIB 1D5MC 4A3LG 2HJ8A 3U9OA 1WWTA 5CBAE 3D0FA 3Q6BA 2UXBQ 4C4VA 4IPHA 5KEEA 1PZID 2K1FA 4LAAA 1T0QC 4V190 1F2RI 2NBVB 4LJPB 5LL6S 3OW7A 2MRPA 4ZOHC 2J42A 1HNXL 5HG2A 5M3MG 4A3CG 2PW7A 1LTGD 2EJGC 2K50A 1K8OA 3C1EA 2VW9A 2R7FA 2JXMB 2KDMA 3I4MG 3MTSA 3VUWA 4A3OA 5JXVA 2LXKA 3HRZC 3HOZG 4BBRB 3Q22A 3CSTA 4ZRZA 3QIAA 4A3BG 1PFMA 2K6DB 3AE9B 3VHTC 2C9WB 4CDCC 4A4IA 1VQJA 2VNUD 2N0SB 1N60A 3ITPA 4C56C 2Z4IA 2WS3B 3EFCA 4DHJD 3AN1A 4FXGC 1D1KA 1TKGA 3M4PA 1GJXA 2WU5B 4IPCA 2GLSA 2J0TD 4XE0A 4BY1H 1T5EA 4QUCA 4TSSA 3HKZE 1IBXB 3RMKC 4M8AA 3P4QB 3QR8A 1NBFC 1DM0B 1KAWA 2B2UC 2JQRB 3J7A5 4DF7A 3KYHC 3NPPA 3D4DA 3HOUB 2LUEA 4JI7Q 2Y3AA 1JB7A 2JA6B 1JOQA 2G9HD 2B3AA 5BR8Q 4E6IA 4PV1C 5M5XB 4QQBX 1RAXA 1HA5A 2BW2A 3NUHB 1GUNA 3UF8A 4BOSC 1K0SA 1A2UA 3UI3A 4ALPA 1ZDVA 3HM3A 1TU2B 4DPGA 4K1RB 3WALA 4AQ7A 3RZDH 3GZNB 5CV4A 1IKMA 1YN5A 2J53A 2NN6I 2BS2B 2ZEQA 2ZPYA 2R3ZA 2E2HB 5K36H 4WWMA 4KK7A 3K7AB 2XWBB 1GM5A 2Q2UA 4DAMA 2YU9B 1ROEA 3W5UB 4EQOA 3F2BA 4FF1A 2B2WA 4HJKA 1W6KA 4II2B 2KLGA 4XIGS 4A3JH 4XDCA 1L4DB 3UDIA 5EBCA 3AE5B 2AL3A 2JRIB 4B9WA 3FKYA 3Q3FA 4WWNA 5H8YE 2Q8IB 2OXPA 3ZYYX 2MSED 1I5FA 1VQKA 2LI5A 3AEDB 4ILWA 3FP9A 2DHZA 3PREA 5M9OA 1VQHA 3WAMA 2K6QA 1DOKA 4FXCA 1AEXA 1ZXIA 1BUVT 2E2DC 5EGTA 3CCLA 2BB5A 4DHJB 4G4KA 5IP9H 2ZTEA 1YJIA 4HSPA 3VR8B 1PYWD 1QB5D 4LMQD 3Q3OC 1OXTA 4IUMB 3VR3A 2HE7A 3R2IA 4JE3B 4PG3A 1IYFA 2TMPA 1SSNA 5AJ3L 5FLXE 2JVCA 2VQFL 1MJEA 5IYBH 4MH8A 1WTWA 2DJGC 4K7UA 1N5WA 4MZ9A 2WDVB 2IO0B 1NAPA 3H0GB 2JA8B 1EOVA 3LXFA 2G1EA 3VYRA 4ZRIA 3RYTA 2R6GA 4HPMB 5IYCG 4JI4Q 3RLNA 2QDLA 2UU9L 4BAXA 1MSHA 4PZ8A 2A19A 3KBGA 3AH7A 4IM0A 2MWSB 5JVH3 3FEWX 3GB1A 3MA2B 2OWOA 1JICA 2MPMA 3S1QB 3DMUA 3NVYA 2F0SA 4IUVA 5COYA 1UBQA 1GD7A 2INCC 1FRDA 4L2YA 1Q82C 3L9AX 2B2WC 1BUIC 1WYWB 3CQZH 3SHLA 4XT3B 3FAHA 3NBHB 3VRAB 4A6QA 1AE3A 4PMWA 1TGZB 3AE7B 3QA8A 3U4EG 5JZEB 5FJ8H 1C4AA 2PIAA 2NN6H 1KQSA 1V6EA 2L76A 3RN9C 2QKIC 3P42A 4YY3Q 2EIFA 2BE5D 1LM8B 2WYQA 2K8HA 3PO0A 4GXBA 1YJNA 4JI3L 4X66L 4A8XC 2MO1A 1YJWA 5EDSA 2QEXA 4LFAL 1JMCA 4FXKC 5ELBA 1LT4D 1HTQA 1HH2P 1BVSA 3I4OA 4JK1C 4NXML 2A73B 3BG3A 5KNBA 2QW7A 5C3XA 5C44B 1VQFA 2HDEA 2SDFA 2BWFA 1CKNA 2ZNVC 4HAEA 4KD4A 2YVCA 3EJIA 4CDEC 2DNEA 1PH9A 1B44D 1J9OA 4GU2A 3TZDA 2LGXA 1TWGH 3E0JA 2NB0A 1VQ9A 4BBSB 2DZKA 2XK5A 4B08A 1NUCA 2CW0D 4A3EG 4CKBA 3C2PA 4X62Q 4KKSA 1HR0L 3WANA 3NEMA 3OWFA 2K22A 2BKRB 1PZJD 3IFTA 1E3PA 1SE9A 5JEAG 1O80A 1R4NI 2I5HA 2RPQA 3C46A 5KNCA 1EIFA 4APVA 1PH7A 2IHFA 2RR9A 4IUTA 5EKIA 2UUAL 4IW0A 4X64L 3RN5A 2KT7A 2Y5PA 4HKZE 3E5SA 4OHJA 1I50B 1TWHH 4Y7NH 3TEHB 3I4NB 1V9JA 4PS7A 2B2VA 1WMHB 4HJAA 3M62B 2DLBA 2R92B 1PTOD 4EVOA 2F03A 1NY4A 4JV5L 1MHHE 1V86A 3CCVA 4IKGA 4S17A 5C5MA 4WJOA 2K5QA 1CHQD 1P3QU 1L6UA 1XCQL 3AMZA 4KKTA 4J15A 4OL7A 3T53B 2VH1A 1T5XD 2D5DA 3CCJA 3HKZB 2GBNA 4US8A 1ONLA 1WXSA 1L0YB 5C4XB 3KJOA 5HURA 3P1HA 1V81A 2PPBC 2K01A 3KF8A 2DZMA 1SNCA 2KNBA 2ZW1A 2AYOB 3X0WA 3PSIA 3CRLC 4KZ0A 2RHQB 4AJWA 3FPPA 5C3WA 3S1MH 3TDQA 2BWES 2L7RA 4J3OD 3VR9B 3MXGA 4FADA 1EEFD 3CU7A 3OLMD 4HJ8A 1KHIA 1Z9FA 2N7DA 4IFDG 1X3GA 2WAQG 1SE4A 1YOVB 2EELA 3FC4A 2GI9A 4X6AH 4C7YA 4K14A 3E6ZX 3V62A 1IL2A 1H9KA 4MH0E 4DDID 1M4VA 3MHSD 4FP5D 2KK8A 4KHVA 3GTPH 4JI6L 3FILB 4JI1Q 1I94L 2O6VB 3H94A 1PTOF 3D3RA 2D3GA 3IFWB 1UD7A 4YXDB 2MLBA 2N9EB 2HUGA 4DXAB 2MJ8A 1X1MA 3QX1A 4O0AA 3SK4A 3WOFA 4BBNF 1PGBA 2K52A 4M8NA 2B2VC 3MXUA 1H8CA 1SB3C 3DBHB 4S3SA 4C1NK 3HOYG 3I3TB 1XMOQ 2KFJA 3AFPA 1IBML 3G6EA 3I57A 1YHBA 4HCPB 2Q2TA 1IBKL 1JALA 1VQOA 5DPTA 3K80C 1HUNA 4AQYQ 4LK0M 2KCMA 2AUJD 2BH2A 2CHWA 3LJ3A 4P1BC 4GDKA 4RF0A 1OQRA 1GB4A 4CGYB 1Q10A 3EVQA 1PDXA 2QILA 5E4WC 2V9HA 1FM0D 4RGOS 3A0JA 3CCRA 1QNKA 2RHSB 1EL0A 1R4MI 4IO9A 4F8MA 1M90C 4JI5L 4C3JH 1P0RA 3KOJA 4XYOA 3OOCA 3L10B 2IY0B 2F0EA 2KA7A 2N55A 4OWTB 1KRHA 3AEAB 1PRTD 2UXCQ 1L4ZB 1VLBA 1YQ4B 3KQ4A 3PF5A 4A3MH 2J0JA 3O65B 3CMMB 2EMTA 4EUTA 1O7ZA 1XNRQ 1KXLA 2FCNA 5JJIA 1CSQA 4ANUA 1QOHA 5IT9c 2D0PA 2IX0A 1TQOA 3NTKA 4GLAC 1OTCA 5T1GA 2KQSA 4KGRA 3QB3A 4QGUA 4A3JB 4C80A 1LTSD 2LJ5A 2KTFA 2OQ0A 4JIOU 4DR5Q 3NZUA 3LB8C 1LTID 1JJGA 1NEKB 3J80c 1WJ6A 3GDEA 2DYOA 5GADC 4A3LH 2BYTA 2JX5A 1PDQA 2OTJA 2QA4A 4MJSB 2BCOA 3NELA 2N7EA 4GN1A 3ZLZA 2NZOA 4JPBW 2K7VA 1EYGA 1SYGA 3D4WA 3P75A 1JWAD 1VD2A 3B1LX 4L63B 4KMUC 4BS9A 4P72A 5M3MH 3J81j 3CCUA 1YHQA 1HR0W 1QWYA 3AE2B 3PTFC 4DV0Q 2KX0A 1WGDA 2PW9A 3TP5A 4DDGD 2WXFA 3DHGC 5IOIA 3VQIA 1NDDA 3I91A 1WRIA 1WR6E 4KD3A 2L55A 1FFVA 3I4MH 1WTRA 2EPBA 1YIJA 1PRTF 4RHRA 2RSUA 3IT6B 3SFEB 2VB2X 4LJOB 3HOZH 3UE0A 3VAWA 1CA5A 2JYTA 3H3VH 4A3BH 3DVNU 1LM0A 5JHBA 2KFKA 4OONA 1T6BX 3DVGY 1H9MA 3PV0A 4HTHA 4TKOB 5M3FG 3AV8A 3WAPA 3AULA 2FINB 4A3DG 5LMNL 3CIRB 4NQLB 2KWUB 2NPTB 2VH2A 2YEPB 3RNGC 2L1BA 1TS5A 4DUYL 2FXQA 3W9CB 1QCBD 1UELA 3N52A 4WRDA 3KUZA 4KJOA 4IURA 3I55A 1PH6A 2K25A 4AOFA 3CQZB 3KLSA 5FLMG 3SHQA 1C9FA 4AH6A 4DR3L 4TMAB 5CV5A 4R4IA 3KUPA 4POFA 1A63A 3MXNA 2QC8A 2R2OA 4A3IG 5D65A 2LFIA 2DJFC 3HOXG 2J7ZA 1NI2A 3EROA 2L05A 4ZQ3A 2AWOA 2W3SA 3K81C 3VXWA 1E2VA 1JQ4A 2JWZA 3BINA 5G2NA 2KVMA 2N9PC 4WWOA 4LF4L 1CMXB 3PHXB 4HIDA 3TMPB 1F0ZA 4CJ0B 5KYLA 4RMFA 1S40A 4NNJB 1HFNA 1E0ZA 5LL6X 3GZNI 4EKUA 2AL6A 3DM3A 3H9DA 1QOAA 4MGZE 1C48A 4N9F4 3Q3NC 4MSQB 1Q8IA 4EZKA 4CDDC 1YNXA 2IO3B 1DOLA 1TWGB 3PUZA 4R9WA 4EX5A 2DUDA 4A3KB 1O7YA 3J7ZC 4JG2A 2IHEA 5FO9B 1S3OA 2L0TA 3PQIA 4W9IA 5IODA 1SNOA 3JYUA 3OMCA 4HR7B 3AEVA 1FRRA 3KK7A 2A8VA 1HZCA 2L8JA 1SIFA 1ZGUB 1VQEA 4IWQA 1V49A 2V4IB 3VR5A 4IUPA 1S1QB 2CWAA 1MVKA 3I2ZA 2PQEA 1KABA 3CKIB 1HQMC 1SNQA 2Z6KA 1ZKOA 5GAGC 5IYCH 5C3EG 1DOMA 1TWHB 3PIO3 1GUWA 1TJEA 1WXQA 2D2CC 2J52A 3ZRCA 4NAMA 2PTLA 5BN5A 3K5MA 1K52A 1TWFH 3CC2A 4DQOC 2NZ1D 4KHZA 3TS2A 2JPHA 4L5RC 1SIJA 2KJXA 3JVZX 1J8IA 1T0SC 4LF7L 1E2ZA 4KIKA 1HPCA 3KJPA 3E9SA 3J81i 2DGYA 1N34Q 4W9JA 1WCMG 1S5FD 2JF5A 3Q2AC 1F9JA 2KWCA 1GHJA 1SJHD 2I07B 2EZVA 1PFNA 4GGQA 1SMXA 2EMSA 4B3SQ 3V61A 2EJFC 2CKZB 1PZKD 3K0YA 5ELDA 1N32L 1JORA 1WTPA 1DONA 1ZUD2 3BZKA 3S1MB 1KFYB 5IGFA 4I6PA 5ELEA 2PZUA 4ZUIA 4ZK9B 3STBD 1IW7D 3SEBA 1H95A 2UWQA 4CHKA 2HDLA 4LK1C 3PIP3 1PXUA 3BYTB 3ZTDA 3TEZA 1HNXQ 1OO9B 2X69A 5LMUL 3LX0A 5C3JB 1D8LA 1PYSB 3KF6B 3AM9A 4POGA 3RZOH 2LMCB 3VVWB 3JSVB 3GTPB 4JI0L 2KTRB 2Y5CA 2DYBA 1ILQA 2B3GA 3D8GA 1RKNA 2E2IH 3ZNGC 3PRPB 1E2WA 2V1CC 1NI3A 4A3EH 3DXJC 4FHKA 3ZJTA 3VYSA 1PMRA 4IN3A 5JEAJ 3H1UA 3TUOA 4XQNA 3IVFA 3BZDB 4ANXA 3OTOL 2KEEA 2DZIA 3AECB 4E71A 1WMHA 4NY0A 3CCMA 1Y1VG 2V3PA 5JEAH 1GXDC 1BT0A 4H0LC 1I4PA 2LXJA 1ZYRD 1DD2A 1EWYC 4HVBA 2JJQA 4A3GG 4LW1A 3PUXA 5LMNW 1P7FA 1ICFB 1STNA 3R8BA 4LNOA 2WDQB 3M9BA 4JW0A 3ZGZA 1G2SA 1WIAA 1G6PA 1Y8OB 2OTLA 2AX5A 4RM9A 4TQ1A 1VMCA 2KAJA 4MGKE 4ZHOA 2Z8LA 4DR4L 3ICEA 1E8WA 1I4XA 2I5LX 1VQ8A 2KEDA 4B9KA 3RUZA 4L5QA 4C3JB 2FMMA 4ZKCB 1G6ZA 3GOEA 3MZ5A 3VTUA 3PHWB 2F4VL 3GTGB 1ZXTA 4UHVA 4KY6A 4A3MB 1BCPD 4DV5L 1EIHA 1TIFA 3N20C 4F7ZA 3QG1A 1IHZA 2HT1A 3RNBC 4GB9A 1JMLA 1E1OA 2V1YA 3R2TA 1QZEA 4DUZL 1F9SA 2PZTA 4KTAA 3S15H 3R66C 1J5EL 1FVIA 5ELCA 2BT6A 3KUCB 3I73A 2KO3A 4UY8C 3PV1A 4IFDJ 4FJZA 1E1TA 3FILA 3SU8X 2PO4A 4BOZB 3S17H 1IZ6A 2KWDA 2RGFA 1L0XB 4IFDH 4FF4A 3E0EA 3NE5B 4MHEA 2R7ZG 3AB5A 4YSXB 4FVMA 3JW0X 2ZW0A 4CQNA 1F52A 2EXZA 5M5WH 2P5ZX 5AUIA 5HI1A 1I42A 5KRUA 4ARCA 1U4PA 4IOIE 2BE5C 1WRDB 2H5XA 1LABA 2E5LL 1SGHA 5KHOA 5M3MB 1RDPD 3NHHA 5T1IA 3AE8B 5AJ3Q 2JYEA 1NCVA 2VQFQ 1GUOA 1YD8U 3UDGA 2OHFA 5IO9A 1HTPA 1UAPA 2EE1A 2NWGA 2X6GA 5J3BA 3TQYA 1WTXA 4W9EA 3SDLC 2MQHA 2D11A 3I4MB 2D5GA 1SMYD 4XYQA 1RD9D 1J6QA 1C78A 3TEYA 2F0QA 4X3SA 3HOZB 2K3UA 1BCPF 1A70A 1C0AA 1KLVA 1LT3D 3IRBA 3PGZA 1A3VA 5ISRA 2PI2A 3HOYH 2F52A 4DXGA 4A3BB 2IGGA 4A3FH 3PVLA 3FMCA 5JJZA 2BPSA 4LNNA 3ULPA 4AIMA 3RN2A 1O78A 2ASBA 1CKOA 4BBSH 4JI2L 2R2QA 2KBNA 1Q7YC 1RFAA 3HZXA 2CW0C 1VMPA 3ZW3A 1TS4A 2WXQA 1ZDXA 2CH4W 4K7SA 5JHAA 1T0RC 1YN4A 3RT3B 3EC8A 3TEWA 5IT9E 3TSSA 3ZNHB 1CKMA 5C5LA 4P1CC 3GQBA 3GTQH 2GA4B 3U30A 2UYZB 1XLPA 3J7AV 2O2VB 4ME3A 1AW7A 2EJMA 1FJGL 1BO0A 4X66Q 4JI3Q 1LFDA 5D2MB 1I50H 2EOTA 3I4NH 4AYBG 3J80E 2WAQE 4GSWA 3MEHA 3N1ZC 5J1ZA 2JYOA 1PTOC 4MJSA 2IDYA 1KLGD 2ON8A 1VQ7A 1EUJA 4HCSA 2UUBL 4C7ZA 1WZ0A 4I65A 4NXMQ 4BBNC 1JQYD 4MM3A 2JY6A 4GKKL 3UI2A 3QARA 5IWAL 2BTEA 4EZJA 3H91A 1SNPA 4P2CB 3IAYA 3K5LA 3DPDA 2Z0DB 1CHPD 4RCOA 3BYYB 4YTMB 2WIIB 1JT8A 2ZJPA 3BU2A 1DJRD 4GLSC 2V3SA 1U4MA 4LFBQ 3BK2A 4GS3A 4IG7B 1HR0Q 2I46A 1EF1A 1B50A 1FO4A 2CHXA 2B29A 1SDFA 1V97A 4ICVA 3NTHA 4ZDVA 2FAZA 4JYAL 4XWWA 4B0EA 1TVXA 1PA6A 2JT4B 3RD2A 4P7IA 2PE6B 5C1ZA 3A4SC 1HE8A 2NPTA 3ZVVA 1X32A 2UUAQ 2BVCA 1QOGA 4X64Q 1MD2D 2R7DA 4L5TA 2CKHB 3HVDA 3U2SC 2KQ3A 2EYMA 2MGSA 2K5NA 2RDFA 5IOCA 3JAME 1WD1A 1N33L 3PO3G 4IJLA 1ASZA 1UWMA 2MJEA 2F0LA 4OO1G 3LGJA 4DV7L 3HK0A 1DCZA 5M3FH 4BXXG 1WXVA 4A3DH 1YNJD 4R4CA 2I5MX 1T9HA 4URKA 1WXAA 2WXHA 3L3OC 3EECA 2V0GA 2B63H 3C8YA 4RMAA 4HJ5A 2FCQA 5FR6A 1TWCH 1TWFB 5D3DA 1EZ8A 3QC8B 2E3TA 1Z7TA 3W5OA 5E7NA 1KNEA 4GLVB 4G7OC 1PUTA 3AXCA 5FLMH 1F2RC 4ZRKA 4U68A 1A62A 3LNNA 2E76C 4DV3L 3OAWA 3Q0AA 3Q8BA 5A35A 2JA9A 4LWCA 3S24A 2J7QB 2N1VA 3EA6A 5DCNA 3CHBD 4OEMB 1TR5A 2EY2A 3K8AA 1CFMA 4A3IH 3M3YH 1E90A 2W9NA 4Q0FA 2EDGA 4L8JA 1YX5B 4HJGE 4LF6L 3X3MA 2G4DB 2EYOA 3R3OA 1LXDA 5BMHA 2N9KA 4RGMA 1FXTB 1E24A 2PKOA 1HEZE 1PRTC 4CDFC 5C0XI 2H1EA 3W2DA 3KLSX 3A9KB 2UUCL 2KC2A 3DWPA 5C4JH 4OZCA 5BN4A 3RZOB 1AYFA 4BKSA 1X3QA 1YHAA 2ZXOA 1S5ED 3ULJA 4BY7G 2KQ7A 2E2IB 5JOBA 3MJ5A 4C00A 1V8QA 3L13A 4GN4B 4A3EB 1AZPA 4NP5A 5E6OA 1B7YB 1Q90A 4L6TB 2VL6A 4BA2I 1QILA 2F0JA 5ELOA 1IBMQ 3IAM1 2PQAB 4GNXA 2WB1G 1IBKQ 1GOZA 1X3PA 2KQ4X 3MAQA 1X6OA 4JC0A 4ODGA 4ZRPA 2WFWA 1WX9A 5A2QL 1GC7A 3BVZA 3ECIA 2N88A 4WJ3M 4I7ZC 3PF4A 2MW5A 2KHSA 5IAAC 2C7HA 1XF5L 4M8MA 1P7EA 3GE3C 2C35B 4WH4A 2EY5A 2JSOA 3IG3A 4OW0A 2FIDA 3C0RB 1XLQA 3DEPA 3KDFB 1YJ1A 2HJ1A 5FO8B 1C8CA 5KGUA 2FHTA 1E7VA 2AQ2B 2O2LD 1WJUA 1ZOYB 4KDLB 4S0RA 1FMAD 1VRAB 1U0LA 1HQRD 5EPLA 1B53A 1K3RA 1WJJA 3K6OA 1D1IA 2IW3A 1E9MA 3RNAC 3K5OA 1V80A 4GMVA 1VF5C 3AYHB 2F0GA 1ISNA 5AZFA 1MFWA 5HFYA 1HZAA 2L52A 2K5WA 4IPGA 4MNOA 1V5TA 1U4RA 1WY8A 2H88B 4TQUS 4PQXA 5CV8A 1WR1A 3MHBA 1IYJB 3L16A 4NPNA 4DK3C 3P4PB 3U52E 2N49A 4YTPB 2L9HA 4DV1Q 3A9JB 4DV2L 1JR0D 4RG1A 5L37A 3HFZB 3S15B 1HZ6A 2WGSA 4FLHA 3T13A 2QJLA 3APCA 2LMCA 2ZPNA 3CXCA 2KTRA 5C0XJ 1SFOH 2ICEC 3S17B 3CP0A 1I7HA 2L4NA 2LFNA 4Q2JA 1PGXA 4V0BA 1FXIA 3GP7A 4EE2A 5I9PA 2WAQB 3J7YW 4FF2A 2L32A 2EYJA 5C0XH 5KYIA 3MP9A 2WLBA 5AEKB 2ZT9C 5MPOA 4GOPB 5M5WB 4EQ5A 4GNXC 1PGAA 2GOWA 2LHDA 4UPAA 3J80i 3H6MA 1IGCA 1AFPA 1FEHA 3DDCB 4ICUA 3RMHA 2A5HA 2Q5WD 1MHXA 1KL9A 3TREA 4YT0B 1E0BA 1I4GA 1CQVA 4FNFA 4DR7L 2LZ6A 3AU5A 4LNIA 1RF2D 4NXNQ 3NS1A 2IGDA 1X55A 1EFID 3U7DA 4PT5A 3M95A 1TT2A 4BVUC 3ML9A 1HUMA 2KMMA 1DOYA 2HIXA 3RLFA 1CQFA 4OIKA 5IE8A 1UEAB 3P7JA 2K8BA 3H7SA 5LMNQ 4Q5VA 3T1YL 1AE2A 4OX9Q 3HOYB 4HXDA 4A3FB 3SGIA 1QVGA 4IDIA 1ET6A 4DUYQ 5FKAC 2NZHA 1KD1C 2HTME 3NWTA 2AHOB 4A3KH 2FE8A 1J0GA 1O7IA 2HD5B 3MHZA 3IAS1 2VXWA 3M4YA 4RH6A 3J81L 2I0QA 3PMFA 3HOVH 1E5WA 5E4XA 3CCEA 4DR6L 2N8NA 2WXRA 1JE5A 3U7ZA 4ZLTF 3MVVA 3GTQB 3WWVA 3LDZE 3I8ZA 2PVGC 3DEOA 3P4RB 1QF6A 3EN2A 3KFUA 2O6VD 1Q1BA 1QLBB 4DV6Q 2BB6A 2KX3A 4XQQA 4M0WA 4H13C 3R7RA 1J7AA 3L54A 4DV4L 4JWUC 1VQCA 3RULA 4IZ8A 3URYA 3VA5A 4LF4Q 2CR5A 1C4CA 1CUKA 1H9SB 3SK6A 2K39A 3L08A 3LYYA 4WFN3 1RHPA 3EBEA 4IALA 1P9DU 4LF8L 5JPMC 1SE8A 1L1OB 2BGFA 3KLWA 5I4DA 5EE9A 4LF9L 1EU3A 4UP7A 4OVVA 2WQYB 3QOJA 1EZ6A 4OXPA 1YMHE 1SSOA 1ESRA 2A69D 4K0KL 4ANVA 2R7ZH 2JXTA 4AP4C 5K5PA 1BNZA 4DKAC 3ZJUA 3RZWC 1WE6A 3CD6A 2NR2A 2F0IA 1WFYA 3ZKJC 1ILPA 2VUMG 2PMZE 1E10A 1UE5A 1C3TA 3PUYA 2DBYA 2WXIA 3UDXA 2KD0A 5JH5C 3ZJVA 3VDZA 1MHWC 1NSNS 4K6DA 3STBC 1IW7C 3SE0A 1E8ZA 2A6HD 2JRHA 3TBIB 1V1QA 4MIUA 1BDOA 4KGTA 1V5OA 2IL8A 4MTNA 3HP3A 2K32A 2R93G 1I6HH 2WU2B 4JX1C 1C9OA 4QY7A 3AB9A 4IOAA 1E6EB 3GE8C 1DXMA 3V6EB 2OT2A 3M7GA 3CC7A 2WP8J 1KLUD 4OO1I 4EQPA 5M3FB 3AE4B 5KHQA 3VR2A 2ENBA 2LSSA 1G51A 4A3DB 3TL5A 2O2VA 4QJFA 5JAVA 1QUQB 1G2TA 1TKEA 1VQIA 1WYGA 2M8SA 2F0VA 2Z9HA 4JBWA 4N9TA 4R4TA 2NS5A 2HDMA 2MP1A 4W9LA 3N3KB 2B63B 4B0MA 1WH3A 1Y56A 1UGJA 4LF7Q 1IBLL 1TWCB 4IUNA 4J1MA 3H3VI 4JI7L 1OXUA 3TZUA 2OQKA 3GV6A 2IPKD 3E3XA 1ZKHA 1LTTD 3FKIH 1ZYRC 3Q3JA 1B3AA 1V1PB 2M19A 3VYUA 3KWLA 1A5RA 4YCUA 1N32Q 4DNIA 2XRSD 1CA6A 4K6LA 1I4QA 2MHVA 1FL0A 3M3YB 2JZ3B 1F2LA 1VQGA 3NQTA 4A3IB 1Y69U 3S1NH 1AWDA 4NAWB 5EE0A 2RPVA 3U9SA 4KSKC 2RKSA 4I7AA 5I6YA 4AWJA 4HMJA 4XQJA 1VQMA 4LNFA 4W9FA 1Q81C 1S5CD 1M8AA 1SROA 2A68C 4B3TQ 4IOCA 4K8IA 3H7PB 2ACZB 1ENAA 5C44G 2JA7G 3M4OH 3D4RA 4ASWC 4R1JA 3GTGH 2KACA 4LUOA 2B2TA 2LRWA 1BCPC 4JI0Q 4XWTA 3APFA 2JUOA 2KMCA 2MBBB 1MG8A 4DN4M 1UE1A 2F0UA 5E3FA 5GROA 5C4JB 1Q8KA 3VA7A 3H15A 4WIPA 2PMVA 4B3ML 3A1QB 3OTOQ 3TRZA 2XBBC 1XPUA 1G8ZD 3L4PA 5BO4B 4N6EB 3DOWA 2NCNA 1XNQL 3VH3B 4W9HA 3NXWA 1P98A 4C3IH 2PJHA 2UU7A 4XYCA 3QHTA 1Q12A 1HCZA 1QZHA 2J0KA 2IJ0A 4KDIC 4YWKA 2Q2IA 2ICIA 3AI5A 3TIXA 1YEZA 2E2JH 5CBEE 3U58A 4GZYC 4G0NB 4HROA 5BMGA 1CJEA 3UGBB 3PO3H 1KDBA 3K0XA 2MH7A 2V4DA 1WX8A 2OJWA 2BDOA 5C2TB 3PPAA 4OO1H 4JBMA 1IYUA 4A3CH 4WQOB 4DR4Q 4H2AA 2NBWB 3DBRB 1WF9A 2VQEL 2LD9A 1QQRA 2MNAA 4LFCL 4C2MH 1WD0A 1FPYA 5E6JA 3P20A 2MBHA 2F0KA 2F4VQ 3NQIA 1GB1A 1IBXA 4RHSA 1SMYC 1GUSA 3G71A 2JEAI 1DGJA 4AYBE 4DV5Q 2X38A 2NVYH 1TTNA 1B1ZA 3ZQ4A 4FULA 2BQQA 2SNSA 3X23A 4K3CA 2ZZPB 1WOCA 2JK8A 2YEPF 1D5ZC 5T8IA 2NYZD 5NUCA 2VRRB 3T51B 4XC2A 3SFDB 2CVRA 4U673 4C3HG 2MCNB 2BS4B 2WX0A 3I4LA 3RNUA 3TP8A 1K83H 2B2TC 5IP7G 1EQRA 2JA5G 1F77A 2F0WA 5DLQE 4QCLA 1WTVA 3A9KA 1DYQA 1LLRD 3NBIA 1K28A 3JAMc 1P8LA 1WGYA 4JL9A 4LJZC 2WXKA 4G50A 3NS8A 4BKSD 4LNKA 1N5XA 1A3UA 4B3RQ 1SFOB 4NJCA 1U5KA 1EY7A 1SYCA 1S5BD 5D6JB 3QIJA 1C4PA 2D3CA 1XMQL 2B76B 3FHWA 3NP8A 1KRTA 3DWQA 2RCNA 1VQBA 2F3IA 1XCTL 2E5LQ 3OPOA 2PQAA 5GXGB 1YJ9A 5H92C 4BWGB 1NVID 3W5VB 1VQLA 2KOLA 4LNQA 1AN8A 3FDTA 1CZWA 1LV9A 4ZYSA 2WXLA 2IT1A 2M00A 1EQVA 4BY7H 2WXMA 3ETRA 4C4VB 4CBVA 2LVQA 2OEOA 1UE7A 2IX1A 4X62L 2L3ZA 1H4RA 3KDFA 2QF7A 3UIPB 2CWPA 3VR4A 2IY5B 1A2TA 2K05A 1STGA 4YIJA 2A6ED 1YN3A 2PMZB 1Y1VB 4JI2Q 4BY1G 1Q86C 3M3JA 1U4AA 4KGSA 4WQMA 4MT5A 3CAMA 2FNJB 1FNWA 1EY6A 3MWYW 5I6WA 2RMMA 4A3GB 1J7BA 2ZCCA 2KHJA 5M5YH 1N9WA 1VCBA 3AU4A 2I38A 3PGEA 4ITKA 1D5XC 2D2QA 5G5GA 1EYDA 1PH5A 3IFDA 1GUAB 1L0VB 1VS0A 5IY0A 4WJ4A 2K6AA 5HGTA 3HOVB 4KI0A 1TBEA 3A9JA 3MEFA 1FJGQ 5CHWA 2D10A 1V43A 3NY5A 4HJ7A 3SXHA 1XQQA 2F4IA 4P75A 3DBLB 3HUIA 3ERQA 1IKLA 5K36G 3DUZA 5L83A 2XSCA 4XDXA 1MIUA 2WACA 4OELB 2NVUI 2MBOA 4N58A 3NBHA 1YNJC 1Y1WG 2INDC 4A3JG 3T16A 1LT5D 4BA1I 5GAHC 2QEJC 1LYLA 4NDXA 1J7CA 1O7LA 4REZA 3ZXRA 4GOPA 2BH8A 1N63A 5IWAQ 1PFDA 3N1YC 3NRZA 1C7YA 3W1BA 4A93G 4W9GA 3IHPC 3TJPA 2K9XA 5I9OA 1XLOA 3EGRA 3UQBA 4TRDA 4JBKA 1EY4A 3KYDD 5H1SE 1K0RA 2L83A 1WYDA 5C6AA 2R7ZB 3ER0A 5BYRA 2HIVA 4DR1L 2ZVNA 5J17A 1VQ4A 5CMDA 4WURA 2LVPA 3RNFC 4YCVA 4OZAA 1C76A 2NBFA 2RDGA 4FJVB 5J22A 4JVZA 2G3QB 5EQ0A 2LJIA 4YWMA 3N32A 2JE6I 4GN5A 2CQOA 5FK9C 1T0YA 1HFGA 4FHJA 2VZAA 1SBBB 4LF5L 3ZDTA 4XDDA 4IFDI 1N33Q 3PO2G 2LEKA 4NZLB 3A74A 4A55A 1RWSA 5CX3A 3J9CA 1STYA 3OHXC 5IGBA 3SD5A 5HKHA 4F8CB 1I6HB 3D6WA 2K5PA 4K2LA 2WDRB 3IXSA 2SNMA 2A4ZA 1JOKA 3FVQA 1XMOL 2C5LC 3NVWA 5DAUA 2Y0SG 4GKJL 1ENFA 1KDAA 3CW2C 3NG0A 2N4FA 4DHZE 2AUKA 3MC8A 3RCZA 1PVOA 1GNUA 5DM73 3PRZA 5LXHA 3APDA 1HNWL 1MI0A 2DWQA 4JLCA 3UIOB 1BKBA 1JCKB 1KTKA 3A55A 1KAAA 2CCZA 3S14H 2N9XA 5IP4D 1GUTA 4USAA 2Z6KC 1XTDA 2HQLA 3ERSX 2F0DA 1VR9A 2DNCA 4DAPA 4KHPL 2IO2B 4HN7A 2PZWA 1FGUA 1HNZL 5BMIA 4GOPC 1PQSA 4DV3Q 1FFUA 1C1YB 4HK2A 3FKIB 1UWXA 4QMGA 1L1OA 2NN6G 3DCGA 3GTKH 2MJDA 3W3AA 4LF6Q 1TZ1A 1QE6A 2UXDL 2RBMA 2NMQA 3ABVB 4YSYB 5F2DA 5FO7B 2MBQA 3PS6A 3VH4B 4JGHB 3S1NB 4AYBB 1ENCA 1EQTA 4RCNA 5EJWA 2EYHA 1G91A 1KIXA 1PH3A 1MGSA 1EIYB 1GG3A 1J19A 2LASA 1JC7A 1BOSA 3IKJA 2QSDA 2A68D 2KC1A 2FMCA 2DN8A 3M4OB 4KKIA 2UUCQ 2FFKB 1IPGA 3P63A 1N61A 1YITA 4KV2A 2KCCA 1CSPA 1Q3LA 1BBUA 4RNAA 1PH8A 4WJNA 2FJ2A 3DWAA 4OGQC 3R93A 2XGTA 2JXXA 3N1XC 2WINB 3S16H 1Z6HA 2JWUA 1RCVD 2NVQB 2HCCA 4L5SA 2BF8B 4ZKBB 3BS1A 1W6JA 4DV0L 2O6VA 4OVZA 2WXPA 1I6VC 4FXDA 3DQVA 3DHIC 2CFMA 1QUQA 4C3IB 2KOXA 3F1ZA 1SJED 5AZGA 5HHDG 1DOXA 1JOOA 2RD0A 2VZKB 2X8XX 3PRMB 4LDTD 2CU1A 4A3PA 2R93H 1TT5B 2E2JB 4ZRQA 3VUXA 3PO3B 4XXEA 5BN3A 1HXYD 1RL2A 3GD7A 4HEDA 3KYCD 1N36L 3MC0B 5CTRC 2A74C 2JEBI 3GTMB 5G55A 1JE4A 2LRUA 1QG7A 4DAYB 1V1PA 1L1OC 2DY8A 3MXPA 1ZP0B 4KKJA 4FA6A 1II3A 3O13A 3OJ4B 1RYJA 2M4NA 4C2MB 4OIJA 1CT1D 2M56B 2QCPX 4H7BA 1SE3A 2JU6X 2NVYB 4ULLA 1K8MA 1OXXK 1QOFA 1PHJA 2UU9Q 4DNTB 1FIQA 3D6CA 4EFOA 3H7PA 5JJKA 1EEID 1VZ7A 4DV2Q 2LGYA 1NR2A 3T3NA 2KHWB 1X3FA 2D3AA 4LTUA 4G7ZC 2G45B 3LWUA 1K83B 2C7MB 1JB3A 1NR4A 2JZPA 2KZRA 3D32A 1ICWA 3CRKC 1XO3A 5BYSA 5LXIB 4OVUA 4PZ6A 5EKLA 4IUQA 3A7LA 1K9MC 3OIQA 2E75C 3NENA 4NMZA 3A4RA 4NJ7A 3WIMA 5DPRA 3KF8B 3HOWG 1WM3A 3QK0A 4DK0A 1D2BA 2LY7A 3A1QA 2Z59B 4WJQA 1TWAH 1AP0A 3JC66 2G4SA 2N7JA 4NPSA 2G5DA 4RWSC 2W82A 3K57A 4LDTB 4O2DA 3B9JA 1I3QH 1JWMD 1XD3B 3UINB 4LFAQ 1JROA 2DAFA 2XNAC 4DR7Q 4BKGA 1EWIA 1XPOA 2VY3A 2BBCA 4HDQA 4D2KA 2BKFA 4BY7B 1SE2A 3S2DH 1VQPA 4JCVE 2TSSA 3K58A 2FIFA 5DNFA 2V3NA 3NHEB 3PZDA 1BBWA 1EQQA 4GDLB 2EYFA 3T1YQ 1N6ZA 4HPPA 1B4OA 2A69C 1L7YA 1UF0A 2NVXH 3PLVA 3F8TA 2ASQA 4EGVA 1Y8NB 3CF6E 3DWGC 2GBJA 4DAVA 4K5VA 2KN5A 1HZ9A 2HHHL 2NVTH 2I1JA 4M01A 2F3VA 4MELA 5M5YB 1STAA 4BKTA 1LTRD 3VTWA 2H89B 4E3CA 3AEBB 2LGSA 3KVFB 2KDBA 4ZYNA 1Z2MA 4DR6Q 2BS3B 1ML0D 1NYRA 1B8AA 4W9CA 3KLRA 3L0WB 2QDFA 2A6HC 3RNCC 4G3XB 1KC8C 1OGWA 1FD7D 4C1NI 4DHZB 1F2MA 1UNSA 3Q23A 4P73A 3WCQA 2MEKA 4UP9A 3MJWA 3PT2B 4DV4Q 1MBYA 3HIZA 2L15A 3WAOA 4MGIE 3X3NA 2WXJA 3P1MA 5CYUA 4ZAIA 5FLXL 4A9AA 3CMAA 2EY6A 3F2UA 1WI5A 2WP9B 2J4XA 1WX7A 4C3HH 1N34L 2K5HA 4JV5Q 2AWTA 3DBRI 3BWUD 2IY1B 5CV7A 3TP6A 2ONQA 4KY7A 5IP7H 2IZVB 4PMBA 4LF9Q 2MQJA 2RF4A 1IL8A 5D3IB 2IWHA 4CHTB 4DR2L 3DHHC 1NNXA 4EQNA 3L2PA 2KLCA 3BZCA 4K0KQ 1TZOA 3VRBB 1OFFA 2Z0SA 5EPKA 1KH0A 2MA9B 2EKEC 4IWOA 1DOIA 2ZJRA 2N1WA 2LWPA 3AE6B 3PCOB 2QHOA 2KUMA 3V96A 1MI2A 2E6XA 1X56A 3QQ8B 5CHFA 2K03A 1EU4A 2MP2B 1CTMA 4NKLA 3Q14C 4GOCA 2KANA 2RSNA 1DZ1A 3HOXH 4WJPA 3CCQA 2N9LA 1NTGA 4HCEA 4JPSA 4NQKE 3T9LA 3AEFB 3B0AA 4OWXB 1PTOH 3K7UC 3S2AA 1X3EA 3QWNA 1B3QA 2LGDA 2AQ1B 4RF1A 2K5DA 1UGMA 4HIOA 1JJ2A 4RM8A 2DAJA 4M1UB 4JI6Q 4PNYA 4YWLA 3DWMA 4H44C 3G4SA 1I94Q 3PIOA 3RLOA 1CZGA 3E9IA 2GMIC 4HCNB 1ET9A 1F9PA 3BDOA 4NJ6A 4B9XA 1V2YA 2WHIA 2K4KA 2D0OA 4CYEA 1R9TB 1UE6A 2VB3X 2ZJDA 1IBLQ 2SOBA 3MFGA 3S14B 4IWPA 3TEXA 4YSZB 5DEHA 1W3SA 2KFKB 1HA6A 4PS3A 1QKZA 3G6JB 4X65L 5HGQA 4TV3A 1S3SG 4R4QA 3HM6X 4B95A 1GUGA 2G9DA 2YLMA 1RIPA 2EQSA 1WTOA 3EUB2 1Z5SB 1SLJA 1OEYJ 3KBXA 3IT4B 2YTVA 3ND8A 4M02A 3Q6SA 1Q1OA 4N8X1 3GTKB 3HEJA 3H6NA 1YNND 2NBUA 4YL8A 1JW9D 4A76A 2OCEA 1T3QA 1LUZA 3NJTA 3V6CB 5C3EH 1Y1WH 1JJCB 2OEDA 2F3WA 1K51A 2FCSA 4JI5Q 2L12A 2JN4A 2MX2A 1IXRA 3PIPA 2ES2A 4CJ2C 2HQEA 2GBKA 1CK1A 4CJ1B 4A93H 5I2YA 3MXNB 4ME5A 1IYVA 3TP7A 3ZUNA 3Q8AA 3UDFA 1VQ5A 1Q5WB 3DBLI 3ENEA 5LLIA 3T3OA 3RR5A 3SDZA 4IPDA 3EQLC 2XWJB 3BVMA 4J6HA 2QIEB 3C1FA 4RGNA 5KIXA 1TIID 5G5HA 1R4PB 2F0FA 1K3BC 4MTKA 3U4VA 1IP9A 4B3MQ 1WCMH 2CHZA 4QAYA 1YQBA 3RZFA 2GBMA 2GN5A 5IA7A 3FPUB 4K7WA 4UAIA 3S16B 2RSOA 1XNQQ 3M4QA 3KF6A 2VUMB 2M0AA 2I2YA 2M2LA 2XEWA 4R8NA 1EO6A 3JSVA 4K8JA 1XWEA 1YBYA 3TMEA 2PLPA 2W54A 4X57B 3DHQA 3M63B 2BA1A 2KDIA 1XPRA 3U8ZA 1OXVA 3PO2H 4FJYA 4JI8L 4AJYB 4LUVA 1UZXB 2PI2E 4QIWE 2R93B 1Y8PB 3QJYA 1WGHA 1B70B 1WTQA 2VQEQ 5CGKA 4LFCQ 2HTHA 2WKCA 2A5UA 1FYCA 4OZBA 1GO3E 4F87A 3TCAA 4BBRG 1GAQB 1Q46A 3NTIA 1SYFA 2ZM6L 1EY0A 2PVOD 1BR9A 1RM6C 2WWZA 1FNVA 2ZVOA 3B2GA 4IM2A 1GC6A 4ZCKA 3AQQA 5IN7A 1L2NA 1FXAA 2YYZA 2PEAA 2HCIA 2A6EC 1G291 4DBGA 1Y1VH 2BOSA 1EY9A 2F0NA 1JRPA 3PZ8A 3A5ZB 1RJTA 4HKQA 4A3GH 4WJWA 1PYBA 1OQQA 3HOUG 2K8CA 3B08A 3P4SB 5IYDG 3PZ7A 3Q8FA 1EF5A 4QF4A 2JA6G 3QAQA 4KIKB 3NUCA 1K8AC 2ZTCA 2CHBD 2RA4A 3V05A 1XMQQ 2WDTB 5GMVA 4DR3Q 4EEWA 4LUZA 1NMGA 5KNDA 1EFWA 1D6EC 5JPNC 2JA7B 5HY6A 3JAMi 1EUVB 1TWAB 2A1AA 4X3UA 1VJKA 1KOTA 1IGDA 2KJHB 4FO2A 2MFIA 1I3QB 2B39A 4O1NA 2K33A 2LHEA 2W3RA 4NB3A 4FYDA 5A2QE 2F0MA 4LFBL 1V8CA 2D07B 2OJRA 4L1BA 3BDLA 3ZNID 1SNDA 1QJOA 1KF6B 5IGDA 3S2DB 4YHHL 5G3LD 1XX8A 1TKYA 1WGGA 1YX6B 1IUEA 2J0MA 3BK1A 3PLUA 3T1HL 2Y0SE 4L23A 1YVCA 4DAYA 1EWCA 3SVMA 1S5DD 3W1YA 1SXTA 1S72A 1ZPSA 1TY2A 1VQ6A 2EKIA 4R4OA 2NVXB 2MHJA 1WE7A 2AKWB 2UXBL 2Q2HA 4WWPA 1SAPA 3TS0A 3Q24A 3UQAA 2WXOA 4DU9A 1KRSA 1BQQT 1Y8RC 1M94A 3E56A 2NVTB 3TBLD 1NMFA 2KENA 3ML8A 1A3TA 2IYDB 3NVZA 3W1SA 3ALBA 1K8RB 3I90A 2KDEB 5EE3A 1I4RA 2NTSA 1XTCD 4UP8A 1FR3A 4ABNA 4N8FA 3H0GG 5IIFA 2JA8G 2PE9A 1YI2A 1F2YA 1XJVA 1KDCA 3R7QA 3S2HH 4AUQC 1ESFA 1E8YA 5LNK1 1XEEA 1SYDA 1SR3A 4QL5A 2KXJA 1ZE3D 4C3HB 4KN4C 1V1OA 2KMAA 5G3LF 2GRIA 2O5JC 4HJ9A 4DNRB 1RTNA 3T56B 2JA5B 3NK9A 2PNHA 1WGKA 2D9UA 3A5UA 2INPE 2C7NB 4RGTA 3QO2A 5E1FA 4M00A 4DR1Q 3MC9A 3Q3MC 5D14A 3CCSA 1ZEQX 5BR8L 3HOWH 2MUYA 3ULLA 3ZXVA 2K14A 3L17A 5IKCM 5DPSA 3OJ3A 4GDLA 2LS01 4ZHPA 1S4ZA 3GTJH 1WTHA 4W9DA 1WJ4A 3L7ZC 2INNE 5IGCA 1OTRB 1X9NA 1BBXC 4LF5Q 3HOXB 2K28A 4ZRJA 4X3KA 3NVVA 4N59A 4KV6A 2W55A 1KJTA 1PTOB 3H3VC 3MFYA 2L5TA 3S1RH 2PCFB 5LMUQ 2I1KA 1PFBA 3W1SC 1JWBD 4HWIB 2Z6BA 2Y5BB 2WV6D 3AEGB 5ELFA 4A3FG 4GKJQ 4K3BA 2PNRC 2IO1B 3ZDMC 3WOEA 3J81E 4BBSG 2KJRA 3EFXD 2FBWB 1HNWQ 1JWUD 4BY1B 4UDUC 1F9QA 3HKSA 3K9PB 1M1KC 2NTTA 4KKUA 4HPLB 2NVQH 2ZXPA 4BZAA 4R3DA 5AFWA 4KHPQ 1W2BA 1B9MA 1HNZQ 4QIWB 2C5CA 1SYBA 5I2XA 2QCZA 4W9KA 5D94A 1LO5D 2SAKA 3Q8DA 3V3XA 3MTNB 1L6VA 5C4HA 2RQXA 3RZDB 3HGBA 2UXDQ 1EOTA 3I4NG 1B9NA 3OYYA 3BDCA 1YIWA 3S9WA 4WAAA 3N9YC 4HIKA 2WXNA 5E6NA 3GTMH 3HG9A 2R92G 4HDOA 2F0OA 2PW5A 4BXXH 4JI4L 1XYIA 5C3EB 5EBDA 1QNUA 1Y1WB 1NBWA 2M1MA 1BXTA 1RTOA 4PS8A 2ZJQA 3TN2A 4DV1L 3ZIMA 2MP2A 4A93B 3HKZG 1VF7A 3ONSA 3RNEC 1RRBA 4GLXA 1E8XA 5C4XG 1CM9A 3UE1A 3Q69A 1VQNA 1C79A 1E7ZA 4ZUJA 1SF0A 4YTNB 4DUZQ 1SEBD 4QB4A 3CPWA 1SN8A 1J5EQ 2KECA 2OOBB 3DVGX 4HLEA 3G48A 4P71A 1WCMB 2Q8RE 3L0OA 4JQWC 4MM3B 4TVAB 3BY4B 4IUUA 1H9JA 2KN4A 1K50A 4H02A 3PUVA 4YY3L 3Q8CA 4XGAB 4KJNA 4CKEA 2PPHA 2ZTDA 1PV4A 1ASYA 1P16A 2BDNA 1Z47A 1I35A 1LTBD 1NYQA 1STHA 4G11A 4NXNL 1K53A 2X6LA 4FF3A 3PO2B 3H8HA 3B6YA 3GTOH 1N36Q 5JVG3 1KM7A 1A6XA 2IX3A 3KH0A 4YWGG 1PRTB 2KCTA 2CH4A 3AU7A 4O42A 3SK5A 2C60A 1EM7A 2FUHB 4RA8A 4OX9L 3CF5A 3W1GA 1SYEA 3NOBA 2Y0SB 4LLGM 5L95C 2B63G 4KZCA 2KKCA 2K04A 3RD4A 2XRQD 1PLFA 4NW2A 1NJIC 1HZ5A 4US9A 2BYEA 2V4LA 2YTYA 2XTIA 1GKHA 2AEHA 4HRSA 3D31A 4P74A 3WDNA 4FDBA 2XVSA 4KX6B 1UWVA 4XX5A 1MKHA 4DA2A 2Z0EB 4PK1A 2K1BA 2WX1A 1WI0A 4OWWB 4Z9CB 1SNMA 1WSPA 1STBA 4CKCA 1YJJA 2KVZA 3V2TA 2L0CA 1UBIA 3NZSA 4DV6L 1QOBA 3ZNZB 1U4LA 1K8GA 3CC4A 3CWIA 1JRUA 3AE3B 1CI3M 1LACA 2WNMA 1YNTE 2IBIB 4Y52H 3I63C 4WAFA 1FCLA 3GTLH 3OMGA 3BJUA 3OIPA 5EKKA 2O4XA 1GHKA 1YQ3B 2EYPA 3M7NA 3ZO5B 1UEBA 1VZ6A 3ZRFA 3IBEA 1XT9B
chains in the Genus database with same CATH topology
4IQZA 1WVLA 4XT1B 2AWNA 1FGBD 3M85A 4ID6A 2B8FA 1AZQA 4HMIA 1LTAD 4QUFA 3FRPB 3BIID 3RPFC 2F1MA 3VYTA 2L1AA 1FD6A 4DK1A 5D7GA 3SK8A 3AMUA 2IGHA 3QOLA 1JWSD 4J8QA 1B9RA 1RFKA 1EYAA 4Y7NB 2Z4HA 2MJ3A 1TKWB 1VCIA 3OSOA 1KNAA 2FUG1 3GO5A 3VR6A 1VZ8A 3AEEB 4P6VF 2JSVX 5IGEA 3B2FA 5CV9A 2EYLA 3KWVA 3A54A 1MPEA 3N6RA 3S2HB 2XIWA 4WORA 2F0PA 2AQ3B 4RAUC 2M9VA 1L5PA 5AUKA 5LHY1 3ND9A 1EIGA 2VZKD 1H9SA 2EVBA 5C0XG 3K5NA 2BA0A 5DM63 4KN7C 3HOWB 4F7XA 4P16A 4DQOC 2ZXRA 2Q8TA 1A15A 1YNNC 2LGIA 3BK2A 5IT9L 3GTJB 3I72A 1EY8A 4RKBA 1NENB 1HHVA 1RODA 2F0TA 4HSVA 2KCNA 2PYKA 4MACA 3NWSA 1R7SA 1C77A 4TQ0A 2LKVA 5CC4A 1F9RA 3J80L 2CU3A 3S1RB 3RFZB 3A8IE 3Q8EA 2H4OA 3NSWA 4G57A 2D62A 5FOBB 4RFBA 1FNUA 1STEA 1BMLC 2B2YA 1MSGA 3C3LA 5CORA 1CZPA 3A56A 5EPJA 2L11A 3A8KE 3J7AF 2WXGA 1OXSC 2EY1A 5CR3A 2O5IC 2R61A 4X3TA 1D4BA 1HRJA 1BF4A 4A90A 2DYMA 3GV3A 4N9PA 2QMTA 3T4AC 3H09A 1EWHA 3HS0C 1HTLD 3JAML 1N62A 2XN9C 2DY7A 1TS3A 3DM1A 1R4QB 5CV6A 1TS2A 3HVZA 2E74C 3NZ3A 3I70A 1Q1EA 3A7AB 3SR1A 2JP1A 1TY0A 2K0PA 3OWEB 3PUWA 1ZXHA 5C4ZA 4ARIA 2OF1A 5TSSA 1FCCC 3ONAB 1XLNA 2B8GA 2B2YC 4PMCA 3I9V1 2CJNA 2RDHA 4MN3A 3GTOB 2ID0A 1XXGA 3G7LA 1VDVA 1QT9A 1BCPB 1C4QA 4DGZA 1B2TA 1TYGB 3AE1B 3HRDD 3SR6A 5J39A 3GS2A 2WKDA 2Z1CA 1ACCA 1EY5A 2F0HA 2WB1B 4AS1A 2RVLA 5EE1A 4G7HC 2CQAA 4DXFA 4RKLA 4R8IA 1U9RA 2QDBA 3A8JE 5IGGA 4K2KA 4C3JG 4DFAA 2NUCA 1VDZA 4F88A 2GB1A 3K59A 5BYQA 3BVGA 4KY5A 3GTLB 3I3CA 2SEBD 4JWSC 1LT6D 4K5XA 4GDKB 1E7PB 4K5WA 2LUMA 2B2UA 1GPXA 4XTCS 1UUPA 5FR3A 2CJOA 3IL8A 3LWEA 2C9OA 1I4HA 1EYCA 1F2ZA 4C3IG 4HEA1 1H9RA 1D5MC 3U9OA 1WWTA 5CBAE 5KEEA 1PZID 4LAAA 4V190 1F2RI 5LL6S 3OW7A 2J42A 5HG2A 2PW7A 1LTGD 2EJGC 1K8OA 3C1EA 2JXMB 2KDMA 3MTSA 5JXVA 3HRZC 4BBRB 3Q22A 4ZRZA 3QIAA 3AE9B 1PFMA 2VNUD 2N0SB 1N60A 3ITPA 4C56C 2Z4IA 2WS3B 3AN1A 4FXGC 1D1KA 1TKGA 1GJXA 2WU5B 2J0TD 4XE0A 1T5EA 4QUCA 4TSSA 1IBXB 4M8AA 3P4QB 1DM0B 2B2UC 2JQRB 4DF7A 3NPPA 3D4DA 3HOUB 2Y3AA 2JA6B 1JOQA 2G9HD 4E6IA 4PV1C 5M5XB 1HA5A 2BW2A 3NUHB 1GUNA 3UI3A 1A2UA 1ZDVA 4AQ7A 1TU2B 5CV4A 1IKMA 1YN5A 2J53A 2NN6I 2BS2B 2R3ZA 2E2HB 5K36H 4WWMA 4KK7A 3K7AB 2XWBB 1ROEA 2YU9B 3W5UB 4EQOA 4FF1A 2B2WA 1W6KA 4XIGS 4XDCA 1L4DB 5EBCA 3AE5B 4B9WA 5H8YE 2Q8IB 2OXPA 3ZYYX 3AEDB 4ILWA 5M9OA 1DOKA 4FXCA 1AEXA 1ZXIA 1BUVT 2E2DC 5EGTA 2BB5A 4G4KA 1YJIA 4HSPA 3VR8B 1PYWD 1QB5D 4LMQD 1OXTA 3VR3A 3R2IA 4JE3B 2TMPA 1SSNA 5FLXE 4MH8A 1WTWA 1N5WA 2WDVB 1NAPA 3H0GB 2JA8B 3LXFA 2G1EA 3VYRA 2R6GA 1MSHA 3KBGA 3AH7A 5JVH3 3FEWX 3GB1A 3MA2B 1JICA 2MPMA 3S1QB 3DMUA 3NVYA 2F0SA 4IUVA 5COYA 4L2YA 1FRDA 3L9AX 2B2WC 1BUIC 3SHLA 4XT3B 3FAHA 3VRAB 4A6QA 4PMWA 3AE7B 3U4EG 1C4AA 2PIAA 2NN6H 2QKIC 3P42A 3PO0A 2BE5D 4A8XC 4FXKC 5ELBA 1LT4D 4JK1C 2A73B 3BG3A 5KNBA 5C3XA 5C44B 2HDEA 2SDFA 4HAEA 4KD4A 3EJIA 2DNEA 1B44D 1J9OA 3TZDA 4BBSB 3E0JA 2NB0A 4B08A 1NUCA 2CW0D 4CKBA 3C2PA 4KKSA 3OWFA 2K22A 1PZJD 3IFTA 5JEAG 1O80A 3C46A 5KNCA 4IUTA 5EKIA 2Y5PA 4HKZE 3E5SA 4OHJA 1I50B 3I4NB 2B2VA 2DLBA 2R92B 4EVOA 1PTOD 2F03A 1MHHE 4IKGA 5C5MA 2K5QA 1CHQD 1L6UA 1XCQL 3AMZA 4KKTA 4OL7A 3T53B 1T5XD 2D5DA 3HKZB 4US8A 1ONLA 1L0YB 5C4XB 5HURA 3P1HA 2PPBC 2K01A 3KF8A 1SNCA 2ZW1A 3CRLC 3FPPA 5C3WA 4J3OD 3TDQA 3VR9B 3MXGA 1EEFD 3CU7A 4IFDG 1SE4A 2EELA 3FC4A 2GI9A 4C7YA 4K14A 3E6ZX 1H9KA 1M4VA 4FP5D 4KHVA 3FILB 3H94A 1PTOF 3D3RA 4YXDB 2HUGA 2MJ8A 3SK4A 3WOFA 1PGBA 2B2VC 3MXUA 1SB3C 4S3SA 4C1NK 3I57A 1JALA 1HUNA 4LK0M 2AUJD 4RF0A 1OQRA 1GB4A 4CGYB 1Q10A 3EVQA 1PDXA 2QILA 5E4WC 1FM0D 4RGOS 1QNKA 1EL0A 4F8MA 4XYOA 3OOCA 2F0EA 2KA7A 2N55A 1KRHA 3AEAB 1PRTD 1L4ZB 1VLBA 1YQ4B 3KQ4A 1O7ZA 1QOHA 2IX0A 1TQOA 3NTKA 4KGRA 5T1GA 3QB3A 4A3JB 4C80A 1LTSD 3LB8C 1LTID 1NEKB 2DYOA 2BYTA 2JX5A 1PDQA 2BCOA 2K7VA 1SYGA 3D4WA 3P75A 1JWAD 4L63B 4KMUC 4BS9A 1QWYA 3AE2B 2PW9A 3TP5A 2WXFA 3VQIA 3I91A 1WRIA 4KD3A 2L55A 1FFVA 1WTRA 2EPBA 1PRTF 4RHRA 3IT6B 3SFEB 2VB2X 1CA5A 2JYTA 1T6BX 1H9MA 3PV0A 4HTHA 4TKOB 3AV8A 2FINB 3CIRB 2YEPB 2L1BA 1TS5A 3W9CB 1QCBD 3N52A 4WRDA 4KJOA 4IURA 3CQZB 3KLSA 1C9FA 4TMAB 5CV5A 3KUPA 3MXNA 5D65A 2LFIA 2J7ZA 3EROA 4ZQ3A 2AWOA 2W3SA 1E2VA 1JQ4A 1F0ZA 2KVMA 4CJ0B 5KYLA 1HFNA 1E0ZA 5LL6X 1QOAA 1C48A 1Q8IA 1DOLA 1TWGB 3PUZA 4R9WA 4A3KB 1O7YA 5FO9B 5IODA 1SNOA 3OMCA 4HR7B 1FRRA 3KK7A 2V4IB 3VR5A 4IUPA 1MVKA 2PQEA 1KABA 3CKIB 1HQMC 1SNQA 1TJEA 1ZKOA 2SAKA 1GUWA 1WXQA 1DOMA 1TWHB 3PIO3 2J52A 2D2CC 4NAMA 2PTLA 5BN5A 3K5MA 1K52A 2NZ1D 4KHZA 1SIJA 2KJXA 1J8IA 1E2ZA 1HPCA 3E9SA 1S5FD 1GHJA 1SJHD 2I07B 2EZVA 1PFNA 2EJFC 1PZKD 3K0YA 5ELDA 1JORA 1WTPA 1DONA 1ZUD2 3S1MB 1KFYB 5IGFA 5ELEA 2PZUA 4ZUIA 4ZK9B 1IW7D 3SEBA 2HDLA 4LK1C 3PIP3 1PXUA 3BYTB 3TEZA 1OO9B 2X69A 3LX0A 5C3JB 3AM9A 2LMCB 3GTPB 2Y5CA 1ILQA 3D8GA 1RKNA 1E2WA 1NI3A 3DXJC 3ZJTA 3VYSA 1PMRA 4IN3A 5JEAJ 3TUOA 4XQNA 3BZDB 3AECB 2KEEA 2V3PA 5JEAH 1GXDC 4H0LC 1I4PA 1ZYRD 1DD2A 1EWYC 1P7FA 3PUXA 1STNA 3R8BA 2WDQB 3ZGZA 1G2SA 1Y8OB 2AX5A 4TQ1A 1VMCA 2KAJA 4ZHOA 2Z8LA 1I4XA 2KEDA 3RUZA 4ZKCB 4C3JB 2FMMA 1G6ZA 3MZ5A 3GTGB 1ZXTA 4KY6A 4A3MB 1BCPD 1EIHA 3QG1A 1IHZA 1JMLA 3R2TA 1F9SA 2PZTA 4KTAA 5ELCA 2BT6A 3I73A 4IFDJ 3FILA 2PO4A 2KWDA 1L0XB 4IFDH 4FF4A 3NE5B 4MHEA 3AB5A 4YSXB 4FVMA 2ZW0A 4CQNA 2EXZA 5AUIA 5HI1A 5KRUA 4ARCA 1U4PA 4IOIE 2BE5C 1LABA 5M3MB 1RDPD 3NHHA 5T1IA 3AE8B 2JYEA 1NCVA 1GUOA 2OHFA 1HTPA 1UAPA 2EE1A 2NWGA 2X6GA 1WTXA 3I4MB 2D5GA 1SMYD 4XYQA 1RD9D 1C78A 3TEYA 2F0QA 4X3SA 3HOZB 2K3UA 1BCPF 1A70A 1LT3D 4A3BB 1A3VA 5ISRA 2IGGA 4DXGA 3FMCA 5JJZA 1O78A 3HZXA 2CW0C 1VMPA 1TS4A 2WXQA 1ZDXA 1YN4A 3TEWA 5IT9E 3TSSA 5C5LA 3GQBA 2GA4B 1XLPA 3J7AV 1AW7A 2EJMA 1BO0A 2EOTA 3J80E 3MEHA 5J1ZA 2JYOA 1PTOC 2IDYA 1KLGD 2ON8A 4HCSA 4C7ZA 4I65A 1JQYD 3UI2A 2BTEA 3H91A 1SNPA 4P2CB 3IAYA 3K5LA 1CHPD 4RCOA 3BYYB 4YTMB 2WIIB 1DJRD 4GLSC 1U4MA 2I46A 1B50A 1FO4A 1SDFA 1V97A 3NTHA 4XWWA 4B0EA 1TVXA 1X32A 1QOGA 1MD2D 3HVDA 3U2SC 2KQ3A 2EYMA 2MGSA 3JAME 2RDFA 5IOCA 1UWMA 1WD1A 2MJEA 2F0LA 4OO1G 1DCZA 1YNJD 2WXHA 3L3OC 2V0GA 3C8YA 1TWFB 5D3DA 1EZ8A 2E3TA 1Z7TA 1KNEA 4G7OC 1PUTA 1F2RC 4U68A 3LNNA 2E76C 3Q8BA 3Q0AA 5A35A 3EA6A 3CHBD 1TR5A 2EY2A 1CFMA 4Q0FA 2EDGA 4L8JA 4HJGE 3X3MA 2EYOA 3R3OA 5BMHA 2N9KA 4RGMA 2PKOA 1HEZE 1PRTC 5C0XI 2H1EA 3W2DA 3KLSX 3DWPA 4OZCA 5BN4A 3RZOB 1AYFA 1X3QA 2ZXOA 1S5ED 2E2IB 5JOBA 3MJ5A 1V8QA 4A3EB 1AZPA 4NP5A 1Q90A 4L6TB 4BA2I 1QILA 2F0JA 3IAM1 1GOZA 1X3PA 2KQ4X 3MAQA 4ZRPA 4ODGA 5A2QL 3BVZA 2N88A 4I7ZC 2KHSA 1XF5L 1P7EA 4WH4A 2EY5A 2JSOA 4OW0A 1XLQA 3DEPA 5FO8B 1C8CA 5KGUA 2FHTA 2AQ2B 2O2LD 1ZOYB 1FMAD 1VRAB 1HQRD 5EPLA 1B53A 3K6OA 1D1IA 2IW3A 1E9MA 3K5OA 1VF5C 2F0GA 5HFYA 2L52A 2K5WA 1U4RA 2H88B 4TQUS 4PQXA 5CV8A 3MHBA 3P4PB 3U52E 4YTPB 2L9HA 1JR0D 3S15B 1HZ6A 3T13A 2QJLA 2LMCA 5C0XJ 2ICEC 3S17B 1I7HA 2L4NA 2LFNA 4Q2JA 1PGXA 4V0BA 1FXIA 3GP7A 4EE2A 5I9PA 2WAQB 3J7YW 4FF2A 2L32A 2EYJA 5C0XH 5KYIA 3MP9A 2WLBA 2ZT9C 5MPOA 5M5WB 1PGAA 2LHDA 3H6MA 1IGCA 1AFPA 1FEHA 3RMHA 2A5HA 2Q5WD 1MHXA 4YT0B 1E0BA 1I4GA 1CQVA 4FNFA 1RF2D 3NS1A 2IGDA 1EFID 4PT5A 1TT2A 1HUMA 2KMMA 1DOYA 3RLFA 1CQFA 4OIKA 1UEAB 3P7JA 4Q5VA 3HOYB 4A3FB 4IDIA 1ET6A 5FKAC 2HTME 3NWTA 2FE8A 3MHZA 3IAS1 2VXWA 3M4YA 4RH6A 3J81L 3PMFA 5E4XA 3U7ZA 2WXRA 4ZLTF 3MVVA 3GTQB 3I8ZA 2PVGC 3DEOA 3P4RB 1QF6A 1Q1BA 1QLBB 2BB6A 4XQQA 4M0WA 4H13C 1J7AA 4JWUC 4IZ8A 3URYA 3VA5A 1C4CA 3SK6A 1H9SB 3LYYA 4WFN3 1RHPA 4IALA 5JPMC 5EE9A 5I4DA 1EU3A 2WQYB 3QOJA 1EZ6A 1YMHE 1SSOA 1ESRA 2A69D 2JXTA 5K5PA 1BNZA 3ZJUA 2F0IA 1ILPA 1E10A 3PUYA 2DBYA 2WXIA 3ZJVA 1NSNS 4K6DA 1IW7C 3SE0A 2A6HD 3TBIB 4MIUA 1BDOA 4KGTA 2IL8A 4JX1C 3HP3A 2K32A 2WU2B 3AB9A 1E6EB 1DXMA 2OT2A 3M7GA 2WP8J 1KLUD 4OO1I 4EQPA 5M3FB 3AE4B 3VR2A 2ENBA 4A3DB 5JAVA 1G2TA 1TKEA 1WYGA 2F0VA 4JBWA 4N9TA 2HDMA 2MP1A 2B63B 4B0MA 1Y56A 1UGJA 1TWCB 4IUNA 4J1MA 1OXUA 3TZUA 3GV6A 2IPKD 1LTTD 1ZYRC 1B3AA 1V1PB 2M19A 3VYUA 3KWLA 2XRSD 1CA6A 4K6LA 1I4QA 2MHVA 3M3YB 4NAWB 1F2LA 3NQTA 4A3IB 1Y69U 1AWDA 5EE0A 2RPVA 3U9SA 2RKSA 5I6YA 4HMJA 4XQJA 1S5CD 1M8AA 2A68C 4K8IA 2ACZB 1ENAA 3D4RA 2KACA 2B2TA 1BCPC 4XWTA 4DN4M 2F0UA 5E3FA 5C4JB 3VA7A 4WIPA 2PMVA 1G8ZD 3L4PA 4N6EB 3NXWA 1Q12A 1HCZA 2IJ0A 2ICIA 5CBEE 4GZYC 5BMGA 4HROA 1CJEA 1KDBA 2MH7A 2V4DA 2BDOA 5C2TB 4OO1H 1IYUA 4H2AA 1QQRA 1WD0A 5E6JA 3P20A 1GB1A 2F0KA 3NQIA 1IBXA 4RHSA 1SMYC 1GUSA 2JEAI 1DGJA 2X38A 3ZQ4A 1B1ZA 2SNSA 2YEPF 1D5ZC 5T8IA 2NYZD 5NUCA 3SFDB 3T51B 2CVRA 4U673 4C3HG 2BS4B 3I4LA 3TP8A 2B2TC 1F77A 2F0WA 4QCLA 1WTVA 1DYQA 1LLRD 3NBIA 4LJZC 2WXKA 1N5XA 1A3UA 1SFOB 4NJCA 1EY7A 1SYCA 1S5BD 1C4PA 2B76B 3NP8A 3DWQA 1XCTL 3OPOA 5GXGB 5H92C 4BWGB 1NVID 3W5VB 2KOLA 1AN8A 3FDTA 1CZWA 1LV9A 4ZYSA 2WXLA 2IT1A 2M00A 1EQVA 2WXMA 3ETRA 4CBVA 2OEOA 2IX1A 2QF7A 3VR4A 1A2TA 2K05A 1STGA 4YIJA 2A6ED 1YN3A 2PMZB 1Y1VB 4KGSA 4WQMA 4MT5A 1FNWA 1EY6A 3MWYW 5I6WA 2RMMA 4A3GB 1J7BA 2I38A 4ITKA 1D5XC 5G5GA 1EYDA 3IFDA 1L0VB 2K6AA 5HGTA 3HOVB 4KI0A 1V43A 3SXHA 2F4IA 3HUIA 3ERQA 1IKLA 5K36G 3DUZA 2XSCA 4XDXA 2WACA 4N58A 3NBHA 1YNJC 3T16A 1LT5D 4BA1I 2QEJC 4NDXA 1J7CA 1O7LA 4REZA 1PFDA 1N63A 3NRZA 2K9XA 5I9OA 1XLOA 3EGRA 4TRDA 1EY4A 2L83A 5C6AA 2R7ZB 5BYRA 5CMDA 4WURA 4OZAA 1C76A 2NBFA 2RDGA 5J22A 5EQ0A 2LJIA 2JE6I 5FK9C 1HFGA 1SBBB 4XDDA 4IFDI 4NZLB 2LEKA 4A55A 1RWSA 3J9CA 1STYA 3OHXC 5IGBA 1I6HB 3D6WA 2K5PA 4K2LA 2WDRB 3IXSA 2SNMA 1JOKA 3FVQA 3NVWA 5DAUA 1ENFA 1KDAA 2AUKA 5DM73 1MI0A 2DWQA 1JCKB 1KTKA 3A55A 1KAAA 1GUTA 4USAA 2F0DA 1VR9A 2DNCA 4DAPA 4HN7A 2PZWA 5BMIA 1FFUA 3FKIB 1UWXA 4QMGA 2NN6G 2MJDA 3W3AA 1QE6A 2RBMA 2NMQA 3ABVB 4YSYB 5F2DA 5FO7B 3S1NB 4AYBB 5EJWA 1ENCA 1EQTA 4RCNA 2EYHA 1G91A 1MGSA 1JC7A 1BOSA 3IKJA 2QSDA 2A68D 2FMCA 2DN8A 3M4OB 4KKIA 2FFKB 3P63A 1N61A 2KCCA 1Q3LA 4RNAA 2FJ2A 3DWAA 4OGQC 3R93A 2WINB 2JWUA 1Z6HA 1RCVD 2NVQB 2HCCA 4ZKBB 3BS1A 1W6JA 4OVZA 2WXPA 1I6VC 4FXDA 4C3IB 5HHDG 1SJED 1DOXA 1JOOA 2VZKB 2E2JB 4ZRQA 3PO3B 4XXEA 5BN3A 1HXYD 3GD7A 4HEDA 3MC0B 2A74C 2JEBI 3GTMB 1JE4A 1QG7A 4KKJA 1V1PA 2DY8A 3MXPA 1ZP0B 1II3A 3O13A 1RYJA 4C2MB 4OIJA 1CT1D 2M56B 2QCPX 4H7BA 1SE3A 2JU6X 2NVYB 4ULLA 1K8MA 1OXXK 1QOFA 4DNTB 1FIQA 3D6CA 1EEID 1VZ7A 1NR2A 3T3NA 4LTUA 4G7ZC 3LWUA 1K83B 1JB3A 1NR4A 2JZPA 1ICWA 3CRKC 1XO3A 5BYSA 5EKLA 4IUQA 3A7LA 3OIQA 2E75C 4NMZA 4DK0A 1D2BA 2LY7A 1AP0A 2N7JA 2W82A 4RWSC 3K57A 3B9JA 1JWMD 1JROA 2XNAC 2BBCA 4D2KA 4BY7B 1SE2A 2TSSA 3K58A 2V3NA 5DNFA 4GDLB 2EYFA 1B4OA 2A69C 4EGVA 1Y8NB 3DWGC 4DAVA 4K5VA 2F3VA 5M5YB 1STAA 1LTRD 2H89B 3AEBB 2BS3B 1ML0D 1NYRA 3KLRA 2A6HC 1FD7D 4C1NI 1F2MA 1UNSA 3Q23A 3WCQA 2MEKA 1MBYA 3X3NA 2WXJA 3P1MA 5CYUA 4ZAIA 5FLXL 4A9AA 2EY6A 3F2UA 2WP9B 4ZOHC 2J4XA 3BWUD 5CV7A 3TP6A 2ONQA 4KY7A 4PMBA 1IL8A 5D3IB 2IWHA 4CHTB 4EQNA 1TZOA 3VRBB 1OFFA 5EPKA 1KH0A 1DOIA 3AE6B 2KUMA 3V96A 1MI2A 2E6XA 2K03A 1EU4A 1CTMA 4NKLA 2RSNA 1DZ1A 2N9LA 4HCEA 4JPSA 3AEFB 1PTOH 3QWNA 2AQ1B 4RF1A 2K5DA 4M1UB 4PNYA 3DWMA 4H44C 1CZGA 1ET9A 1F9PA 3BDOA 4B9XA 1R9TB 2VB3X 2SOBA 3MFGA 3S14B 3TEXA 4YSZB 5DEHA 1HA6A 1QKZA 3G6JB 1GUGA 2G9DA 1WTOA 3EUB2 3KBXA 3IT4B 3ND8A 3Q6SA 3GTKB 3HEJA 1YNND 1JW9D 1T3QA 2OEDA 2F3WA 1K51A 2L12A 4CJ2C 2HQEA 1CK1A 4CJ1B 5I2YA 4ME5A 1IYVA 3TP7A 3Q8AA 3T3OA 3SDZA 3EQLC 2XWJB 3BVMA 4J6HA 2QIEB 3C1FA 4RGNA 5KIXA 1TIID 5G5HA 1R4PB 2F0FA 3FPUB 4UAIA 3S16B 2RSOA 2VUMB 2M0AA 2I2YA 2M2LA 4R8NA 4K8JA 1XWEA 3TMEA 2PLPA 2W54A 3DHQA 2BA1A 1OXVA 2R93B 1Y8PB 3QJYA 1WTQA 5CGKA 2WKCA 1FYCA 4OZBA 4F87A 1GAQB 3NTIA 1SYFA 1EY0A 2PVOD 1BR9A 1RM6C 3B2GA 1FNVA 1FXAA 2YYZA 2HCIA 2A6EC 1G291 2BOSA 1EY9A 2F0NA 1JRPA 3PZ8A 1RJTA 4HKQA 4WJWA 1OQQA 3P4SB 3PZ7A 3Q8FA 4QF4A 3NUCA 2CHBD 2RA4A 3V05A 5KNDA 1D6EC 5JPNC 2JA7B 1TWAB 1VJKA 4X3UA 1IGDA 4FO2A 1I3QB 2B39A 4O1NA 2K33A 2LHEA 2W3RA 4FYDA 5A2QE 2F0MA 1V8CA 4L1BA 3BDLA 1SNDA 1QJOA 1KF6B 5IGDA 3S2DB 1TKYA 5G3LD 1XX8A 3BK1A 1IUEA 4L23A 4DAYA 1EWCA 3SVMA 1S5DD 1SXTA 1ZPSA 1TY2A 2EKIA 2NVXB 1SAPA 3Q24A 2WXOA 4DU9A 1BQQT 3E56A 2NVTB 1A3TA 3NVZA 3W1SA 3I90A 5EE3A 1I4RA 2NTSA 1XTCD 4ABNA 1FR3A 5IIFA 1F2YA 1KDCA 1ESFA 5LNK1 1XEEA 1SYDA 1ZE3D 4C3HB 4KN4C 1V1OA 5G3LF 2GRIA 2O5JC 4DNRB 1RTNA 3T56B 2JA5B 3NK9A 1WGKA 2D9UA 2INPE 4RGTA 3QO2A 5E1FA 5D14A 1ZEQX 2MUYA 2LS01 4ZHPA 1S4ZA 3L7ZC 2INNE 5IGCA 1BBXC 3HOXB 2K28A 4X3KA 3NVVA 4N59A 4KV6A 2W55A 1PTOB 3H3VC 3MFYA 2L5TA 2PCFB 1PFBA 1JWBD 2WV6D 3AEGB 5ELFA 2PNRC 3WOEA 3J81E 3EFXD 2FBWB 1JWUD 4BY1B 4UDUC 1F9QA 2NTTA 4KKUA 2ZXPA 4R3DA 5AFWA 1B9MA 4QIWB 2C5CA 1SYBA 5I2XA 1LO5D 3V3XA 1L6VA 5C4HA 2RQXA 3RZDB 3HGBA 1EOTA 1B9NA 3BDCA 3S9WA 3N9YC 2WXNA 3HG9A 2F0OA 2PW5A 1XYIA 5C3EB 5EBDA 1QNUA 1Y1WB 1BXTA 1RTOA 3TN2A 4A93B 1VF7A 1CM9A 3Q69A 1C79A 4ZUJA 1SF0A 4YTNB 1SEBD 4QB4A 2KECA 1WCMB 2Q8RE 4MM3B 4IUUA 1H9JA 2KN4A