4RGTA

2.0 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with 3-n-acetylneuraminyl-n-acetyllactosamine.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
191
Chain Sequence
HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKESEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 2.0 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with 3-N-Acetylneuraminyl-N-acetyllactosamine.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 64
structure length 191
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgtA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgtA01
1CT1D 1V1PB 3MC0B 1LTAD 1B1ZA 1G8ZD 1PRTC 1ENFA 5FK9C 3DWQA 3TSSA 3GP7A 4BWGB 1UNSA 1DYQA 1LT4D 1PZID 2QEJC 1EFID 5D3IB 2NTTA 4NZLB 3EFXD 1TS3A 1CHQD 1FD7D 3BYYB 1LT5D 1YN3A 1S5FD 5ELBA 1S5BD 1BCPC 1HXYD 1LT6D 2O2LD 4C56C 1KLUD 4RCOA 4L6TB 1HTLD 1LTID 1TY2A 3KLSX 1TS4A 4RGOS 1AN8A 3R2IA 1ET9A 1YN4A 2SEBD 1HA5A 3OWEB 4L63B 1SJHD 4RGMA 1M4VA 1PTOB 1SEBD 2AQ3B 1SE2A 4RFBA 1I4HA 1YN5A 1D5MC 2IJ0A 3DWAA 1PTOC 1LT3D 2AQ1B 4RGTA 1FGBD 3R2TA 4DXGA 5I4DA 2G9HD 1BCPB 2QILA 4O1NA 1L0YB 3URYA 2IPKD 1RCVD 2XN9C 1JWUD 4DXFA 1L0XB 1I4PA 5D3DA 1JR0D 1LTRD 1LLRD 5ELCA 1XTCD 1F77A 1D6EC 1LTTD 1I4QA 1V1OA 2WV6D 1EU3A 5ELFA 3V05A 1CK1A 1ESFA 2Z8LA 1XXGA 1JQYD 2RDHA 1PRTF 4ZYSA 1FNUA 2AQ2B 2NTSA 1GOZA 1RDPD 2CHBD 2XNAC 1D5ZC 5ELDA 1MD2D 4UDUC 1KLGD 2TSSA 3R8BA 1LO5D 1RF2D 1SJED 1SE3A 1STEA 4Z9CB 1BCPF 1EU4A 1FNVA 1PZKD 1KTKA 1LTGD 1DJRD 3BZDB 1JCKB 1SE4A 2J4XA 1B44D 3BVZA 3W2DA 1SBBB 1I4RA 3BVMA 4TSSA 1LTSD 2R61A 1SXTA 3CHBD 1EWCA 1JWMD 1PRTD 4RHRA 1UUPA 1S5DD 1EEFD 1I4GA 3BVGA 2RDGA 1LTBD 4K6LA 1T5XD 1V1PA 3DWPA 1CHPD 4RHSA 1D5XC 1I4XA 1PTOF 4RGNA 1JWSD 5FKAC 1BCPD 1ET6A 1S5ED 1TS2A 1FNWA 1S5CD 4RH6A 1TS5A 1PYWD 1CQVA 1PZJD 2ICIA 5ELEA 1AW7A 1QILA 1TY0A 4OHJA 3BYTB 1EEID 1HQRD 3MFGA 1PTOH 2XRSD 1PRTB 1BXTA 3EA6A 5TSSA 1PTOD 2XRQD 1RD9D 3SEBA 3O13A
chains in the Genus database with same CATH superfamily
1CT1D 2DY8A 4LDTB 1UWXA 3MC0B 2A74C 5JJZA 2R2OA 4DV7L 3GTJH 1GJXA 1CMXB 1MPEA 3G48A 2PYKA 2ACZB 4P1BC 3VRBB 3ZNZB 5JH5C 1S40A 1I6HB 4NXNL 2E2HH 2A68C 4FN2A 2NTTA 4A3JB 1UZXB 3U4VA 1YN3A 3U50C 1P8LA 5ELBA 3RN9C 2LFNA 1BCPC 2C7HA 3CMEA 1JJCB 1TWCB 3HOXB 3TMEA 4HSVA 2XWBB 1N32L 1E7UA 2FUHB 4XYQA 2YEPF 3ZLZA 3X3MA 3M7NA 2ZXPA 2JA6B 2KWCA 4HJ7A 2NB0A 4RGMA 1IYUA 3VR6A 4IUTA 2LVPA 5IE8A 4K7SA 4N8FA 3PIP3 4LNIA 2L15A 2HUGA 4OZAA 4DHJB 3AULA 1OQQA 4DK0A 1L7YA 3DWAA 4X65L 4BS9A 2EJMA 1I5FA 1B7YB 2N7EA 1VF5C 2QC8A 4DQOC 1HR0W 3DBSA 3B08A 2KMMA 4HCEA 3URYA 4KTAA 3TBIB 1K8RB 2IPKD 3SFEB 4FXDA 2BBCA 3A4SC 2WAQG 2LKVA 1U4AA 1BOSA 3NS8A 4P2CB 2H4OA 2NVUI 3OIQA 3VR9B 4F87A 1NMFA 2WV6D 2JA8H 4DR7Q 1KRHA 3MXNA 2TMPA 4NMZA 1T0RC 3L13A 1HPCA 2MJEA 1YVCA 5CBAE 2KECA 1QZEA 4CJ2C 5JPNC 3K58A 3DHGC 1XCTL 5BMIA 4FF3A 2PI2E 5E3FA 4A3GH 3I4LA 2NTSA 3SD5A 2PW9A 5C5MA 4LF5L 2WX1A 4KDIC 2XGTA 3KBGA 3JSVB 4JI5Q 1LO5D 1EZ6A 2MFIA 4OELB 5IWAQ 4DR6L 4KY5A 1OQYA 3STBC 1NCVA 2CU1A 2NMQA 3H9DA 3L54A 2KOXA 4IJHA 3HOUB 2FCNA 4OW0A 4TUUA 4G4KA 2LWPA 3ZTDA 1H9KA 4A3OA 4KV6A 4BBSH 1FNVA 5I2XA 3AEDB 4TKNA 1SFOB 2MQJA 4W9JA 4DR3L 2J4XA 1NE3A 4QMGA 1JOKA 1C78A 1HTOA 2BDOA 2D0OA 2BE5C 5C3XA 4C3IG 2NVXB 4HMIA 1SAPA 3PO3G 3ZXRA 3PUXA 2IX0A 4QJFA 3KYCD 2OJWA 1EEFD 2HIVA 4RKLA 3MJWA 1PGAA 2JA5B 1C79A 4A3EH 2ZVNA 3HKZE 1QUQA 2F0JA 2DNFA 1VR9A 1ASZA 3SDZA 3U4EG 1TS5A 4C2MB 4LF8Q 2UXDL 2Y0SG 3BJUA 2DAFA 5M5WH 3H3VC 4YCUA 1JT8A 3BG3A 2CW0C 2PE9A 3K9OB 4GN1A 4FP5D 5C4ZA 4A6QA 1VQDA 1DONA 1YHQA 2R7ZH 2UUBL 2E8GA 1M1KC 2PJHA 1JJGA 3O13A 3G4SA 1YNXA 2SDFA 1GG3A 2KN5A 1QF6A 4IUNA 1E0ZA 4WH4A 2QHOA 3MXGA 5G3LF 5JOBA 1E22A 1CFMA 1MJCA 2KQ7A 4A3FG 1A15A 4I6NB 1Q1BA 2NZOA 1VQIA 4EZJA 2ENBA 4TQUS 4LF7Q 4IOAA 1S5BD 3NZ3A 2K50A 2AL6A 2BA1A 2WXPA 5HURA 4GOPC 1E8ZA 3GTPH 3TEWA 3P1HA 4Y52H 5C23A 4GMVA 2LJIA 4KLKA 1QOAA 1A2UA 2D3CA 5IYBG 2BS2B 3LJ3A 1HFNA 2RCNA 2HD3A 2C5LC 1AN8A 1KRSA 4WORA 1C9FA 2WKCA 4TV3A 1RODA 1QCBD 2GVBA 2K75A 4RFBA 1UWMA 4LWCA 3LGJA 2QGQA 3RN5A 3C46A 1GC6A 2WACA 1WJJA 1VJKA 2LGDA 5FO8B 3KFUA 1Y1VH 3RFZB 4CO7A 3JSVA 3BK2A 2X6LA 3R2TA 4ILWA 4KY7A 2UXBQ 3GTJB 1XLPA 1KL9A 1ZUD2 3DLLA 2MP1A 2JUOA 2R7DA 2E2HB 2BPSA 1FCLA 2WDTB 2K5WA 4FNFA 1UWVA 3KUZA 4KSKC 5FJ8H 2BKRB 5JZEB 4RA8A 2F0PA 2LVQA 2L5TA 4BBRH 2NCNA 2ES2A 1F77A 4YY3L 2D62A 3U9OA 1LTTD 5K36H 2DBYA 5GADC 4HMJA 1K52A 4XDDA 2BW2A 2QJLA 4K14A 5BN5A 2RSUA 1JQYD 3AE5B 3UGBB 4DK3C 1EIGA 1A0IA 4O2DA 3IFTA 4K0KQ 4KJNA 2H89B 1S3SG 3APCA 4JI6L 1MHXA 2GLSA 2I0QA 2UUAL 1T0QC 3CMAA 3H3VH 3KWVA 4HPMB 3BZCA 4NDXA 3V96A 1YITA 5LNK1 1STEA 2DHZA 2WWZA 5HGQA 2KKCA 3P42A 3KF6B 1VQCA 2J0KA 4C3JH 1X3EA 3AM9A 2ZJPA 2G3QB 3FILB 2L52A 3PZDA 1SXTA 2KYWA 2DLBA 1SRUA 3DPDA 3H3VI 4POGA 3RNEC 3QG1A 2Q8IB 2WXKA 2WB1E 1FVIA 4MGZE 1KF6B 2HHHL 4FJYA 3GOEA 3B0AA 1WMHA 1R4PB 1YNND 1VQLA 4A3GB 4A3DG 1K0SA 2A6EC 2K01A 5JEAG 5AUKA 3AEFB 4LK1C 5LLIA 1AFPA 2DZJA 4YXDB 2LRUA 2NS5A 5AZGA 3NWTA 5IGEA 1WTRA 3RMKC 1VQ8A 4X66L 4H2AA 1NUCA 1UE7A 2MSED 4LF6Q 1BBUA 3AE2B 5G2NA 1WTVA 2CHZA 2EJFC 3DWMA 1G6JA 3M4QA 1VD2A 1VZ7A 1VZ8A 2E2DC 3UDXA 4MELA 1Q12A 1K3BC 3T13A 4V0BA 1FCCC 1PA6A 1WX9A 4C1NK 1E8XA 1WXAA 1GUGA 1XMQQ 5GXGB 5FR3A 1D1IA 3NTHA 2ATWA 1EIHA 3HOVG 1NR2A 3VUYA 2CQAA 1A5RA 1LTAD 1B1ZA 3G7LA 3QARA 4ZKBB 2DAJA 3HG9A 2BTEA 3CCMA 2JN4A 1J8CA 4CJ1B 4P7IA 1K28A 2K5QA 3RZOH 1SNQA 5D14A 1DOMA 4MTNA 4OWXB 2RMMA 4IWPA 4DUZL 1IBML 3GTGH 5FOBB 1QG7A 1STNA 1GC7A 2GVAA 3JAMc 1GM5A 5I9PA 4XIGS 1E5WA 2D10A 4FJZA 4MGYE 4XGAB 4WRDA 4DR5L 3EUB2 2RA4A 4IUQA 4DAVA 2YLMA 3J9CA 2WLBA 1EQTA 1U4PA 4RGOS 5LMNL 4M0WB 2B76B 4TVAB 1VQ7A 3QCAA 2KEDA 1MIUA 1YHAA 1YN4A 1YJNA 5COYA 2EPBA 3T9LA 3T3OA 2R7ZB 5CTRC 3S1QH 3VYRA 1UE5A 1IGCA 3Q3MC 4GDKA 4J3OD 1RYJA 3KLWA 4EQOA 1X32A 3P7JA 3IAS1 2VB3X 3I72A 1BBWA 3E9HA 4HDQA 3KF6A 4KIKB 2BKFA 1LM0A 1RCVD 2EMTA 2DJFC 2WAQE 1BMLC 1N60A 3A5UA 1N8RC 1I4PA 5D3DA 1HEZE 3DEOA 3E5SA 1X3QA 4UPAA 3CC4A 3FILA 1YJ1A 4JWSC 4PQXA 4PV1C 1FM0D 2KVZA 1D6EC 5M5XH 3IXSA 3G71A 4JI3L 1VQ5A 4DR2L 3GTPB 4E74A 2R93H 3DQVA 1CSPA 4IM3A 1A8VA 2KQ4X 1CM9A 3NUCA 2MGSA 4YWKA 1ZGUB 3DVGY 1HR0Q 1WXVA 3I5JC 4ANXA 1WYDA 3ML9A 4Q5VA 2EY5A 2GBMA 2HCIA 2AMCB 4A3MG 5A2QE 4AYBG 2A1AA 3J7AF 3DOWA 4WWNA 1WTHA 3A0JA 5AEKB 2WDVB 1HJPA 1EY4A 1KABA 5IGBA 1N32Q 4H44C 2OEDA 3TZDA 1YNJC 1B2TA 4OIKA 3EC8A 4WWPA 1F9RA 1O80A 3UF8A 4JI8Q 4CDCC 2CWPA 1L1OC 3PIPA 4HN7A 5J2RA 4TSSA 3ND8A 3QC8B 1YBYA 2EYJA 5CHVC 1H9JA 1IBXA 4X65Q 1ZXIA 2MRPA 3OYYA 4BBRB 4DAYB 3CCEA 3PCOB 3UDIA 2A68D 1DOLA 3JAML 1E1TA 1FYCA 1BF4A 1GVPA 1PH4A 1D5XC 1TKYA 3S17H 4JI1L 3BK1A 4WJQA 1NSNS 2I5LX 3M85A 3ALBA 1BCPD 1EY7A 2EY6A 4PG3A 4IW0A 1IW7C 1S5ED 5J18A 2HTHA 4L23A 3V61A 2O5IC 1JOQA 3CCSA 2ZW0A 2UUCQ 4GB9A 2Y0SE 1LABA 1HNZL 3SXHA 1SYDA 1TY0A 3ICEA 4C3JB 1WD1A 4NXML 2Y5PA 1Y1WH 3FP9A 2B63H 3PGEA 2ZJRA 2QDLA 4LFCQ 4M8NA 2V3PA 1BXTA 4ZRQA 1IBXB 1ZEQX 1K73C 2K32A 4S17A 3SK5A 3DWGC 4CHKA 4QCLA 2MLBA 3VTVA 4DKAC 3PT2B 2CHWA 3HRDD 3PPAA 5DPRA 4JBWA 1BUVT 2M4NA 4DV3L 1LT4D 5DCNA 3VYSA 5D3IB 1K8AC 4B3SL 1Q3LA 2EYPA 1IYVA 1WGYA 4KIKA 4FHJA 4LJZC 4E71A 1UGJA 3HOYH 4FLHA 1E90A 1WTQA 4X62L 3Q23A 4BY1G 1EY9A 3HHMA 1TZOA 2IT1A 2IY5B 2FIDA 4C3IH 2EQSA 3PO3H 3C3LA 1OXSC 3C2PA 5IOIA 4I6PA 1PLFA 2KTFA 2NVQH 4LLGM 4W9LA 2JXMB 4A3KH 5IYCH 4MNOA 3S1RH 1ILPA 1M4VA 4TQ1A 3K9PB 1K0RA 3STBD 3DUZA 2UXDQ 1A62A 5M9OA 3AE4B 3HM3A 3DBRI 1I3QH 1T3QA 3PF4A 1D5MC 2G9DA 4URKA 1WCMB 1SROA 5EBDA 4X57B 1HZ5A 2W3RA 4XQJA 2MBBB 2VQFL 4HCSA 1MHHE 2BE5D 4HVBA 2XBBC 2I2YA 5T1IA 2MEKA 2MH7A 4K3CA 3EGRA 4IWOA 1CSQA 4XE0A 4EZKA 2CJOA 3RZOB 2B2WA 4AJWA 2LVOA 2B29A 3NVZA 3GTGB 2ZNVB 4PYZA 1GUWA 1WE7A 3FKIG 1KQSA 2OQKA 4DAYA 4DR4Q 1F2MA 5KYIA 2Z8LA 3PVLA 1XXGA 2D3GA 3VFKA 3W1YA 3K57A 4A20A 1JWAD 1MVKA 2X38A 4BVUC 5C44G 3A8IE 1QVFA 1SNOA 1A3VA 2K14A 4K5VA 4KZCA 1Y69U 1VCBA 4QF4A 3EJIA 3ONAB 4A3FH 4HXDA 3S2HH 4R4IA 1PMRA 2I1KA 1XNQL 3N30A 3K7UC 2W9NA 4K5WA 4DUYQ 2IW3A 2CW0D 2K5VA 4YCVA 5EBCA 2KCTA 1P1AA 1NYQA 4LF9L 3FPPA 4QGUA 4W9KA 3J7ZC 2V1CC 4XQNA 4JX1C 2D2CC 1HQMC 4JGHB 3K0XA 5IYBH 3H1UA 2DNCA 5EPLA 4IUMB 4CBVA 2LD9A 4JI2L 3ULJA 5EDSA 2RPVA 2J52A 2ZXOA 4QAYA 1J0GA 5C6AA 4HJ5A 2J0TD 2MA9B 3GB1A 1PGBA 4MT5A 2UU9L 3L9AX 2XTIA 1DD2A 5AUIA 1BNZA 1WZ0A 2LZ6A 3UE0A 5FKAC 1NVID 4B3RQ 3Q6SA 4RWSC 4YY3Q 2K28A 1NI3A 1KDAA 1FNWA 2QKIC 4AQYL 4LTUA 4GKKQ 2KLCA 5JEAJ 1X3PA 3ZRFA 2FINB 1G2TA 3PSEB 2K05A 4JI6Q 1SR3A 1Z47A 4HIKA 1PH2A 1T6BX 2IHEA 4J6HA 2PNRC 5E4XA 4IUVA 4YSZB 3T1HL 5IGCA 1FR3A 1Q46A 1XLNA 1V1PB 1IZ6A 1II3A 1C7YA 1PRTC 3IRBA 4II2B 3RNGC 3ONSA 1KH0A 4JG2A 2D11A 1AEXA 4MTKA 4S3SA 4NY0A 3TSSA 1BKBA 2MJ8A 5GAGC 1IBLL 5DM73 1V49A 3OLMD 4HROA 3L08A 2KCMA 1WWTA 1EWYC 3I4OA 1OFFA 3KJOA 2BB5A 3H6NA 3RLFA 3P75A 1EQQA 1VQKA 4GNXC 1Q1EA 4JOIC 3DBLI 2FMCA 2BT6A 3VUWA 3NELA 2D07B 4M00A 4US9A 5MPOA 4HJ9A 3CP0A 5IYDG 4KN7C 3S1MH 1FPYA 2EMSA 4KHVA 2BYFA 4NQKE 3H0GG 5IGDA 1Y1WB 1ET9A 2LY7A 3F2UA 2B63B 1V8QA 2KACA 2L55A 2GBRA 2V3SA 4JLCA 3I73A 3GTKH 2QDFA 1SEBD 2ALYB 4A3DH 1F52A 3MEHA 3I3CA 4HCPB 4IFDH 4P1CC 4GLXA 1CTMA 5E7NA 3HOWH 4IWQA 3Q8BA 5IGGA 2JT4B 4NJCA 5AZHA 1EY0A 2WXGA 5IA7A 2BS4B 1GHJA 5I4DA 1BT0A 2W55A 2D5GA 5IOCA 3VDYA 1SN8A 1WE6A 3CPFA 1F9SA 2B2VA 5F2DA 2XN9C 4IJLA 1LQBA 3WCQA 4O42A 1UELA 3T4AC 4IZ8A 3OW7A 1JR0D 2CH4A 3J80i 1J7AA 1WXMA 1JC7A 1ZE3D 3DBRB 3HVZA 4IFDI 3T8MA 4MH8A 1V1OA 1OEYA 3V05A 2CHXA 4AP4C 5IP4D 3HGBA 3CXCA 2A6ED 2VUMG 1HZ9A 3HOVH 4PS3A 1C76A 4K1RB 4C3HG 2A4ZA 2JA7B 4IOIE 4A3KB 1IBMQ 3S1RB 2M2LA 4DAMA 1D5ZC 4KHPL 2KDIA 4UDUC 4AYBE 3FC4A 3QJYA 3EN2A 3NTKA 2ONQA 4C7YA 1SLJA 1N34L 2Z0EB 1B9RA 4FDBA 5LMNQ 2J0JA 3KBXA 5LL6X 4K7UA 5C3EH 1DGJA 3U8ZA 3A33B 2ZCCA 5C0XG 2ZJQA 1PH3A 2IGHA 3RNFC 3NEMA 3U9SA 2L0FA 1AE2A 3D4DA 3Q22A 4OX9Q 3GE8C 3S2AA 1EWCA 2N4FA 1WYWB 3TBLD 2JWUA 1U5KA 3PQIA 4RHRA 3OWFA 3HS0C 3J7A5 2JE6I 2MBEA 3FKYA 3EBEA 1S5DD 4X64L 2VY3A 4A93B 3NHHA 2ZT9C 2VQEQ 1WXSA 1T5XD 1V1PA 4CDEC 3C1FA 4ANWA 3VAWA 4FADA 1E6EB 2YTVA 4RGNA 2N8NA 1YIJA 1ROEA 2FXQA 4DV5Q 1XLOA 3A9KA 3D32A 3PUZA 4B3TL 1MKHA 4OIJA 1ASYA 1C4PA 1QKZA 4A3BG 5KRUA 2G4DB 1FXAA 1HTQA 4AIMA 1RAXA 3LB8C 3H91A 4PYUA 4WAFA 4KKSA 4JYAQ 1TGZB 1KIXA 2F0NA 3APFA 2DGYA 3M4YA 3B9JA 4DV2L 2JEBI 3SHLA 2PZWA 4F7ZA 4HIMA 3SFDB 3J81i 3VVWB 2WFWA 4RNAA 4ITKA 3QAQA 3QWZB 4EUTA 1C8CA 4XDXA 3I57A 2FHTA 3RPFC 3MXPA 2NN6G 1YD8U 4RMAA 1WD0A 4A3MH 2X69A 1SIFA 3GTLH 1WJUA 4GOCA 1JJ2A 5FK9C 1CUKA 3AEEB 2KJRA 2V0GA 3MHZA 1EFID 2F0EA 2IX3A 5C3JB 2VZKB 1N33L 5KNCA 3VA5A 2F4VQ 2K8CA 1H9MA 2Q2TA 1SE9A 4CJ0B 2WP8J 4DV4Q 2YU9H 3PV0A 4HJ8A 2K0PA 4JBKA 4KSLC 1Q5WB 4EQPA 1SNDA 1P7FA 4L2YA 1J7BA 2OWOA 4MZ9A 3A5ZB 2UXCL 2K1FA 3M95A 4MACA 4LNQA 3VXWA 4E6IA 2CQOA 4WWMA 1F2LA 2RF4A 5EKKA 2KFKB 1QNUA 1FIQA 3PRZA 2WGSA 2WXQA 5CV6A 1YNJD 1ICFB 2O5JC 2IJ0A 2F0GA 3ZDMC 5IKCM 2AX5A 3H7PB 4JI4L 5FLXL 4NXMQ 3ULPA 3SVMA 1L0YB 4W9CA 2Q8RE 1JWUD 2GBNA 3ITPA 1EF5A 3HOZG 2WDRB 3TL5A 1Q8KA 2YTYA 2PMZE 5DEHA 2VS1A 3W1BA 4K7WA 4GKJQ 4LNNA 1VMPA 3OTOQ 2X6GA 4RAUC 4DDID 1E24A 3Q8DA 3N9YC 1HUMA 4LAAA 1M94A 4LJOB 1EO6A 4MSMB 4ICVA 4LFAL 3AQQA 2X8XX 1ZXTA 2WINB 4B3SQ 4ZDVA 3S1MB 1IW7D 2RSNA 4QL5A 2EVBA 3X0WA 4PMBA 4QIWB 1AE3A 4V190 4BXXG 2C9WB 5KYLA 5BYSA 1T5EA 3OW2A 1SYEA 1XWEA 2K5NA 2N88A 2FCQA 1FRRA 1SE3A 2LUEA 2M8SA 1K9MC 5M3FG 1Z2MA 4M01A 1EU4A 2NPTA 1T0SC 5BR8L 4IUPA 5KGUA 3D8GA 5KHOA 4BKGA 3SE0A 3UINB 2L11A 3EFCA 1WI5A 2KX0A 3R7QA 4TQ0A 1L2FA 2LXCA 5FLMG 1IGDA 2LASA 4GGQA 3RULA 1DM0B 2D3AA 4LNKA 3D4WA 5CV9A 1UUPA 3RYTA 1BR9A 1X65A 2E2JB 2D5DA 2JYEA 4IM0A 1QVGA 4OONA 3Q3OC 3ERQA 3DWPA 1W3SA 4OGQC 1OXXK 2IX1A 5J22A 4HKQA 1C4AA 5J1ZA 3ZJYC 3I4NG 1AARA 3OJ3A 2VZKD 2F0VA 4UY8C 3F2CA 5ELOA 1I42A 3KH0A 4HK2A 4LK0M 2CH4W 3GZNI 2F0DA 4WJ4A 2NBVB 4DK5A 5HG2A 3J7YW 2PLPA 3J80E 1AW7A 1VZ6A 1BO0A 2IHFA 5C3EB 2AYOB 1Y8OB 1C0AA 2LHDA 3QOLA 4MIUA 4P74A 4ABNA 5T8IA 1K51A 5CYUA 2N9KA 3KOJA 5FO7B 3AB5A 3I4MG 1PH1A 1PRTB 4GIVA 3KLSA 1RFAA 1H9SB 4IPGA 2W54A 4R3DA 2LI5A 2KFKA 2ZM6L 1AZQA 1OTRB 4RF0A 1MI2A 1RIPA 3NP8A 1KNAA 5JVH3 2ZPYA 3ABVB 4L5QA 4A3IB 1PZID 4JI7Q 2QEJC 2FUG1 4A76A 3E9SA 3W9CB 2XK5B 5E1FA 2I38A 4QB4A 3J7AV 3S1NH 2N78A 2KVMA 3QJZA 3MTNB 1FD6A 3TREA 2E2IB 1KJTA 1PH7A 2JPHA 4KHZA 2UU9Q 2JRHA 1TWFH 1EL0A 1AH9A 2R2QA 5FO9B 3A9JB 3LXFA 3H94A 1GO3E 3UQAA 2I07B 2NVTH 2JX5A 2EYLA 3S15B 5IAAC 2JA7G 1OXTA 1VQHA 2RHQB 1GUOA 4HAEA 4CDDC 2KANA 3HFZB 4MSQB 3F2BA 3DHQA 2GOWA 2B2TA 1V86A 1B70B 1XT9B 1PTOC 2QCZA 1DOIA 4RGTA 4XYCA 1STBA 3M3YH 1STGA 1MSHA 2M0XA 3P2BA 2G9HD 2CFMA 2L0CA 2QILA 4PNYA 4DF7A 4DGZA 1STAA 1Q81C 1D7QA 1NTGA 1ENCA 2B2UC 3MXUA 5CV4A 5GROA 4DV0L 3NHEB 4ZRIA 1E7PB 3NVYA 1JOOA 2F0OA 3I55A 1S1QB 2IZVB 3J81E 3ZW3A 5JXVA 4KKJA 4GZYC 4A93G 2N9XA 3VQIA 2HTME 1EU3A 4RM9A 2WIIB 1IBLQ 1HE8A 1ESRA 4UAIA 1KNEA 5JVG3 3I63C 1Z7TA 4ZYSA 5EAYA 3K8AA 4XWTA 1WGRA 2AQ2B 1ICWA 2RSOA 3CQZH 3APDA 3IAYA 3RZFA 1SIJA 3FVQA 1XNRQ 2K5PA 2MBOA 3KQ4A 1Q0WB 4ZCKA 4R8IA 2HQEA 1ZXHA 1T9HA 4DNIA 2E75C 2K6QA 2MP2B 3TEYA 1PZKD 2DWQA 3U58A 1EQRA 1B44D 4FF1A 2LSSA 1FJGQ 3LX0A 1A70A 4P6VF 3D4RA 5IYDH 1S3OA 5EKLA 1G6PA 3H0GH 1PRTD 5M3MH 3RT3B 5EE3A 3PO2H 3N3KB 5C0XJ 3PSIA 4ZUIA 1B3QA 4HSPA 1X54A 1H9SA 4A9AA 2RDGA 4IOCA 2BA0A 3S2DH 1TJEA 3R66C 1BDOA 2IYDB 1EM7A 1I4XA 2N55A 1PH5A 1Q7YC 3GS2A 5AZFA 1JWSD 5IT9E 3CCLA 1CA5A 1ET6A 4C1NI 4BBNF 4WQOB 2J7ZA 4GSWA 2RDFA 3A8KE 2R92G 4YWGG 1CQVA 3PIOA 1HNXL 4LFBQ 1TBEA 2WHIA 1IYFA 2V4LA 2B8FA 3L0OA 3L3OC 3A9JA 4C00A 1Q1OA 4WJNA 3RUZA 1JQ4A 4OHJA 1PFMA 1EEID 2M00A 3AE3B 3ML8A 2LS01 2L7RA 3ZJTA 1PTOH 2VUMH 2OT2A 4OXPA 3AB9A 4H13C 1XD3B 4LCDE 2ID0A 1B53A 1QOFA 3IBEA 2PPHA 2JA8B 3GZNB 1YIWA 3R3MA 3ZNID 2D9UA 1EYGA 1FFUA 2BGFA 1QZGA 4QQBX 1AWDA 4G3XB 2B39A 4ME5A 3DWQA 1TQOA 4A3JG 2F0UA 5C4XH 4BWGB 1OQRA 5HI1A 4IUUA 4N58A 3RD4A 4BKSD 4KJOA 1GD7A 2XWJB 3EFXD 4FHKA 1P3QU 2XEWA 2GBKA 4OEMB 4LF4Q 3CCUA 3HOXG 4X64Q 2GBJA 2VNUD 1ZYRC 5GMVA 2IO3B 4C56C 2BVCA 1PH9A 2CR5A 4MGKE 3TEZA 4OVZA 4B3MQ 4BY7H 3OHXC 4BBSB 2MJDA 3WAMA 2JA6G 3V6EB 3FEWX 3AFQA 3R93A 4HJKA 2B3AA 2AWOA 2KHWB 2LEKA 5E6OA 1JMLA 2KJ6A 5JHAA 2SEBD 3L4PA 3DVNV 1XMOL 5C3WA 3T1YL 2NVYH 1GNUA 3A54A 1K50A 2SNMA 2IGGA 4WJ3M 4R4QA 4ACFA 1E1OA 3AEGB 1SYCA 1WIAA 1FEHA 3TRZA 1L4DB 4TKOB 1X56A 2MHJA 2C5CA 1CJEA 4IKGA 1BCPB 1ENAA 1JE4A 1SMXA 4A3EB 2MP2A 1R4QB 1A3TA 2KA7A 2OJRA 2RGFA 5BN3A 1EY5A 1N61A 2V1YA 4ULLA 5CC4A 5D7GA 4BA1I 2DX5B 4FBJB 5ELCA 4B9WA 1F9QA 2GA4B 1WSPA 1J5EL 1WTWA 1UEAB 4JL9A 1TWFB 4A3CG 4AUQC 5M5WB 4LNFA 4UP9A 2EJGC 2PVOD 3M63B 3ZIMA 1EWHA 2EOTA 2NN6H 4BOSC 1OEYJ 1TIFA 1N33Q 3ZGZA 4KX6B 1HNWQ 1WGKA 1SYBA 1NENB 1V9JA 1RDPD 3AE1B 3ZJVA 2D0PA 3M3JA 1KLGD 1CKNB 2JEAI 3HOUG 2EKIA 1V2YA 2VXWA 2BWFA 1STHA 1MSGA 4OO1G 4JC0A 2AHOB 2JYOA 1DGSA 4OZBA 2WU5B 3GDEA 4JV5L 2V3NA 3O65B 1LTSD 3CHBD 4BKSA 3LNNA 4DV7Q 5LMNW 2BYEA 4KN4C 1N36L 3MFYA 1XX8A 1SSNA 5AFWA 1LFDA 4NXNQ 2JA5G 5AJ3L 3GO5A 4NPNA 3PHWB 5IO9A 2EXZA 1LTBD 4K2KA 4EQ5A 3IT4B 3CD6A 3MA2B 2ZTEA 2PQAB 4CKBA 1TVXA 2L76A 2KHSA 3PLVA 1G291 2EIFA 1QNKA 3BDOA 1WFQA 3WOEA 5BN4A 3WIMA 1S5CD 1Y1VB 3HKZB 1MBYA 3HOZH 4G50A 5DPWA 1GUSA 1L6VA 5L95C 2RBMA 3I91A 4QUCA 1JALA 1E0BA 3NXWA 1UH6A 4JI0L 4OL7A 2ZVOA 3NG0A 1YNTE 4DA2A 2HD5B 2QCPX 1D1KA 3D0FA 2V4DA 3VYUA 2A6HC 2BDNA 5TSSA 4XT3B 4PZ7A 1WTPA 1RRBA 1GUAB 2ZCBA 5M3MB 2DNEA 3PO2B 1XEEA 2E3TA 2WYQA 1DOXA 4BXXH 1B8AA 2M1MA 1EZ8A 5D2MB 3AV8A 3U7DA 3GTOH 1IL8A 1VF7A 1EYCA 3NQTA 1PGXA 3CF6E 2FMMA 2KMCA 4ZAIA 2Q8TA 4HR7B 1CHQD 1A2TA 4P75A 2K22A 2IDYA 3DCGA 4GXBA 3V60A 1SYGA 2G4SA 2JSVX 3M7GA 3I2ZA 2GB1A 1KLUD 4RCOA 5HFYA 4HIOA 4WFN3 2WXNA 5FLMH 2A73B 2N9LA 2RKSA 1KRTA 1K53A 3CCQA 1I7HA 4M0WA 4LF5Q 1U4LA 4GLAC 1YJJA 2EYFA 5M5YH 1IP9A 4DR6Q 3CRKC 3CSFA 1XPUA 1PFBA 1JICA 4K5XA 4YHHL 1PTOB 4M8AA 2PKOA 5EE1A 3NZUA 2WS3B 3JAMi 2PI2A 3PRPB 5LMUL 4FYDA 3I4NH 2F03A 5HHDG 2PW7A 4DR3Q 2PMVA 1CKNA 3E3XA 5E4WC 5HGTA 2J0MA 5LHY1 3AEBB 3BWUD 1GUTA 2RQXA 1EYDA 2E5LL 4G57A 4FF4A 2L05A 1N9WA 4PMWA 4CHTB 4GOPB 5C4XB 3MC8A 2O4XA 4DXFA 1Q8IA 5DAUA 1JWBD 4MHEA 2XVSA 1VLBA 5CBEE 4X3KA 5H8YE 4P16A 3VUXA 4DPGA 1C48A 1KC8C 4JE3B 4A8XC 2OHFA 2O2VB 4BY7B 1YX6B 2DZKA 1R4MI 1X3FA 1N62A 2RDHA 1GXDC 5EKIA 1FNUA 1MG8A 3FMCA 2KDEB 1HZ6A 2PQAA 2I1JA 2AUJD 3BZKA 4ARCA 3DEPA 1MD2D 2N1VA 1VQ6A 1K3RA 3NZSA 3R8BA 1RF2D 1L4ZB 2JJQA 3RNBC 4H7BA 2K04A 3D31A 4FXCA 2NWGA 1PH8A 1UBIA 2EKEC 1E7ZA 2UUBQ 2INCC 4DK6C 1J7CA 3BZDB 2HDEA 1JCKB 3NJTA 3N6RA 2K33A 4FXGC 3W2DA 1I4RA 1J9OA 1E2WA 3NBIA 2KQSA 2DUDA 4U673 4UP7A 1KD1C 4WURA 2JZZA 3W3AA 2YEPB 3ECIA 2CWAA 3W5OA 4JWUC 4RKBA 5IY0A 3BDLA 3NE5B 4KKTA 1CA6A 2K03A 3M4PA 1MJEA 2C7NB 2MCNB 4A3GG 4C80A 2Y5CA 3WALA 1CHPD 2NZHA 2F0KA 2LRWA 2WB1B 4KKIA 4DR7L 2EDGA 2KWUB 4GDLB 1WGDA 2KEEA 3S1QB 2K9XA 1YQBA 4M8MA 3TQYA 2R7FA 2K1BA 3FDTA 1TWGH 2KTRB 4KVGB 1SYFA 2KDFB 5KNBA 2OOBB 4JIOU 4HIDA 4M02A 3KK7A 4DNRB 4ZRPA 2K39A 4JI5L 2BYVE 1VDVA 1VQAA 3EIVA 3QB3A 2JY6A 1SNMA 2AUKA 3K7AH 3N1XC 4XC2A 3RNCC 4L5TA 2WXLA 2DENB 2BS3B 3SDLC 3AE6B 1WF9A 5CR3A 1EWIA 1PTOD 2FFKB 2WKDA 4IN3A 4LMQD 5M5XB 1XPRA 2LJ5A 2EY1A 3AU4A 4YL8A 2B2YC 2PEAA 3J80c 4YT0B 2R93B 2EYMA 2JP1A 1ENFA 1YQ4B 3W5VB 1PUTA 1DYQA 2I5HA 2Z4HA 4KD4A 2NBWB 2PZTA 1E2ZA 2HDLA 1STYA 2YYZA 5GAEC 4GOPA 2HE7A 4X6AH 1TWHH 2H5XA 3MEFA 1XF5L 2O6VD 5T1GA 2Z59B 3B2GA 4PT5A 1NNXA 2F0MA 5CGKA 3RLOA 1VQNA 2KUMA 1UE1A 1SSOA 2MW5A 2UUAQ 2LFIA 2O2VA 2UWQA 3Q24A 3Q2AC 2R7ZG 2K4KA 4KK7A 1HA5A 5ISRA 1JW9D 5LXIB 2BOSA 1NI2A 1WXQA 1MHWC 2HJ8A 1KAWA 5JJIA 1TTNA 4YWMA 2ZZPB 3K5LA 2A8VA 5IN7A 1F0ZA 5HY6A 3S24A 2KC2A 3VRAB 3AECB 4K2LA 3RZWC 2R92H 3S17B 1F9JA 5D6JB 1VQJA 3CAMA 1G6ZA 1P0RA 5FR6A 2IY0B 3NY5A 2ZTCA 2WAQB 4NB3A 3QO2A 1XTCD 2HHHQ 1X9NA 4EZLA 2D3BA 1C3TA 4CKEA 4LF7L 3PREA 1PFSA 3PGZA 4RG1A 2IY1B 3B6YA 3SK8A 1I94L 3V3XA 3W5UB 1E3PA 4OVVA 3IHPC 5M5YB 5BMGA 4X66Q 2XNAC 3FPUB 4LUOA 5JEAH 3J81c 1ZW7A 2KT7A 1C77A 1P98A 4KGTA 4GDLA 4F8MA 4L5RC 4YTPB 3H7SA 3ZDTA 3Q0AA 2INNE 2KTRA 1TWCH 1BCPF 3E9IA 3QHTA 2A69C 1R4MB 5E6PA 1HFGA 1TYGB 3WA0A 2KENA 3BVZA 5FJ8G 1MFWA 4A75A 3T1YQ 2JA6H 3HOYB 2UXBL 3AN1A 4BBRG 4MN3A 1J8IA 4ZYNA 3UIPB 2PZUA 3ZKJC 2PPBC 3A55A 4C3IB 4IPDA 1OXUA 3PO3B 1SE8A 5C4JH 3JAME 2NVQB 2VH1A 2BCOA 4JBJA 2F3IA 2FJ2A 2NZ1D 4DUZQ 3E6ZX 2F0WA 2CKHB 3E56A 3TIXA 2E76C 5EPKA 1ZYRD 5I6WA 1EY8A 2C35B 1BQQT 4DR5Q 1ZPSA 2R3ZA 1I3QB 4KY6A 5C4HA 1Q82C 1TS2A 3PUVA 4W9EA 2ICEC 4AS1A 1L1OB 4K6DA 4K8IA 3I70A 4C3JG 4GU2A 1OXVA 2DJGC 2JSOA 1NBFC 1OGWA 2Y0SB 3MJ5A 4Q2JA 4ZRJA 4AWJA 5IT9c 1QZHA 3OG5A 3PUWA 5D94A 3MFGA 4KD3A 2IO1B 3P4QB 3UQBA 4W9DA 3F1ZA 1HHVA 3DM3A 1YN5A 1VQEA 4JBMA 1TR5A 4U68A 1R7SA 3I90A 3A74A 4GN4B 3TN2A 1SGHA 1V6EA 3V2TA 3Q8EA 1O7IA 1QWYA 4OO1H 4NZLB 1LXDA 4DBGA 4HTHA 2HQLA 5EPJA 3BYYB 4JI3Q 4DR2Q 4FA6A 1XJVA 1S5FD 4A3FB 3S2HB 4F8CB 3T3NA 2NVXH 2N9EB 1HXYD 2KBNA 1JROA 2SOBA 3J81L 1RKNA 4AH6A 5I2YA 2WXOA 3DBHI 1TS4A 1OO9B 3QOJA 2JRIB 3EHVA 1IPGA 2HJ1A 4A90A 3R2IA 4HPPA 4DHZB 1K8MA 4EVOA 3K7AB 1SJHD 4LF6L 2IL8A 2EYOA 4OO1I 2MBHA 4MJSB 3F2DA 4N6EB 3GTQH 5G3LD 1B9NA 3ENEA 1WCMG 5I9OA 1ZKOA 1GB4A 1PH6A 1JB7A 2FBWB 1P9DU 5EGTA 5L37A 4LUVA 2AQ1B 5BMHA 3HZXA 1XMQL 2FCSA 1E8YA 1E7VA 2QIEB 3A4RA 1RTOA 1UE6A 1V81A 4US8A 2JXXA 2MO0A 3PRMB 1QQRA 3K6OA 1JMCA 4X3SA 2Z4IA 2WXHA 1TWHB 4XTCS 1HTPA 3TEHB 3MTSA 5IP7G 3TP7A 4DV6L 1UAPA 3QIAA 4DXAB 3I56A 2PNHA 3HIZA 2KQ3A 4TRDA 4MDKE 3SHQA 3HUIA 3PF5A 4JI1Q 1CK1A 3VH4B 2C9OA 1JE5A 3AMZA 1S72A 4R4CA 2KDMA 2QDBA 3IAM1 2AEHA 4NKLA 4KI0A 5IT9L 2EYHA 1KDCA 1HNZQ 3DBLB 2TSSA 1N6ZA 3MVVA 5NUCA 3HM6X 3P4PB 1W2BA 1TKWB 4DU9A 2WXFA 1WVLA 1RHPA 2ON8A 3PS6A 2KNBA 1L1OA 1XCQL 2P5ZX 2I5MX 1DJRD 3NTIA 3BINA 4ZQ3A 3AFPA 1VCIA 2XIWA 2A6HD 4M1UB 4YHHQ 3BVMA 1DXMA 1IKLA 4YSXB 1FXIA 2F3VA 5IP9G 2WQYB 3CC2A 1PFNA 1R4NI 3AEAB 2KLGA 1N5XA 4AOFA 1LYLA 3RUIB 3WOFA 4DV3Q 2JQOA 3K80C 4B08A 1IBKL 4FXKC 4CYEA 3JW0X 2Q2HA 4X62Q 3V6CB 1PYSB 1NMGA 3GTKB 2IO2B 1QUQB 4KV2A 4XQQA 4A3DB 1HR0L 2DZMA 3WAOA 1YEZA 4FVMA 3HOWB 2L4NA 4DWFA 4BY1H 1FFVA 2H88B 1KM7A 1SMYC 1SDFA 1SB3C 4DN4M 1VDZA 1TIID 2PQEA 4NP5A 4B9XA 3DVGX 2LGIA 1SNCA 3HEJA 2KJHB 4JI8L 1A3UA 2EZVA 2MPMA 3RR5A 2G45B 4REZA 4I6LB 2XRQD 1RD9D 1NY4A 1VMCA 3IVFA 4MJSA 1GKHA 3MC9A 5J3BA 2VQFQ 2QA4A 4WJWA 1WYGA 3HOVB 2KWDA 4USAA 4KMUC 3AXCA 3RN2A 5GQOA 5C4JB 1YQ3B 2V9HA 4B6WA 1EUJA 2BQQA 4POFA 2Q2IA 1I50H 1TS3A 4G7ZC 1LT5D 1WX7A 3CCJA 1FXTB 3AMUA 1AP0A 1LT6D 4P73A 1IL2A 3KLSX 3FKIH 1Y1WG 5DM63 2B63G 4OWWB 1KHIA 5JJKA 2JWZA 1CI3M 2UUCL 2FIFA 4C4VB 5D65A 2VZAA 1GAQB 3D6CA 5IGFA 1XNQQ 4L63B 1C1YB 4NNJB 2Z0SA 2LMCB 1QB5D 3D6WA 3VYTA 1M90C 5C44H 2N9PC 2V4IB 5C2TB 5J17A 4CDFC 5CHFA 5C1ZA 1V43A 1UEBA 4ARIA 4HEDA 4LFCL 4LF9Q 4BA2I 4G7HC 3VA7A 3GTMH 1LT3D 1EOVA 1V97A 1FGBD 5IODA 1QOGA 4TMAB 3H7PA 3CU7A 4DXGA 2JZ3B 1L6UA 3DBHB 2LXAA 2M17A 2K6AA 4GNXB 1EQVA 3T56B 4JI2Q 3HOYG 2ZXRA 4FO2A 2AKWB 1WOCA 3JVZX 1V8CA 5KIXA 1LTRD 3Q8FA 1LLRD 2Y3AA 1RM6C 4APVA 4WJOA 3L17A 2EY2A 3MZ5A 4ZUJA 4MGIE 3U52E 2B2WC 1EYAA 5ELFA 3T16A 1ESFA 2K8BA 3K0YA 4LDTD 3Q8AA 1OTCA 3PLUA 3VTWA 4A3KG 5IYCG 3A7LA 1C4CA 4G7OC 5LXHA 3L0WB 3K5MA 2RVLA 1EOTA 4AQYQ 2LUMA 4G11A 1ONLA 1V1QA 5A2QL 3GTQB 1B50A 4IC7B 4N59A 3L7ZC 3CKIB 3WDNA 4A3MB 2WNMA 4AYBB 2VRRB 3GTLB 3EECA 1WX8A 4L5SA 2QEXA 2QSDA 3CIRB 5EJWA 1D8LA 3EFUA 3T1HQ 2VB2X 1SE4A 4B95A 4EEWA 1FL0A 1L0WA 5LL6S 2W3SA 3X23A 3S9WA 1NR4A 2DZIA 1TT2A 3IG3A 1I35A 2B2YA 2YU9B 4I65A 4HKZE 3PO0A 3KWLA 1XO3A 4DHJD 3KVFB 3E0EA 3B1LX 3BVGA 2A5UA 3A8JE 3Q69A 1WMHB 3EROA 3NQIA 4JCVE 4YTNB 4X3TA 3RD2A 3OMGA 4DR4L 1PDQA 4P71A 4HWIB 4WAAA 3PTFC 1VQBA 1RTNA 1VQGA 2BH2A 2JF5A 3U7ZA 3W1SC 1L0VB 4GLSC 4F7XA 1R4NB 3N52A 1TKEA 2PW5A 3Q3FA 4A3LG 1I94Q 1JRPA 1IYJB 1QILA 3ZVVA 4XX5A 3D3RA 2OTJA 2PE6B 2N3SA 1F2ZA 4DUYL 3H8HA 3U4ZA 1CQFA 1X6OA 3W1GA 4C4VA 3KF8B 1TZ1A 4EKUA 2LXJA 1KFYB 1RFKA 2KHJA 2F3WA 2LMCA 2CS4A 3DHHC 2MHVA 3P20A 3QX1A 1KXLA 1IUEA 1G8ZD 2Z9HA 1XTDA 2ZPNA 2GRIA 2KZRA 2M56B 2SNSA 3MP9A 1KLVA 4B9KA 1UGMA 3RZDH 1WGHA 2BB6A 4BKTA 4NPSA 4GNXA 4JOIA 2N7JA 2L8JA 1FD7D 2XK5A 1KOTA 2A19A 1ZP0B 3H6MA 1IKMA 1EY6A 4CKCA 4B3RL 3VDZA 1U4RA 4L6TB 1ACCA 3CMMB 3ZO5B 1LTID 1I6VC 4GN3B 4EX5A 4BY1B 4L8JA 1V9PA 2MQHA 2ZEQA 4F1SA 5IIFA 2IGDA 2IBIB 4KHPQ 3JC66 3NVWA 2ZNVC 4GKKL 3S16H 4DDGD 3QWNA 5H92C 1P16A 1M8AA 2ASQA 3HVDA 1N34Q 4C3HH 2WXJA 2AQ3B 1SE2A 2KCCA 1ZDXA 4EOYA 2MNAA 3VR8B 4GDKB 3GD7A 4H0LC 5I6YA 5CV5A 3S14H 2A69D 3Q14C 1D4BA 2Y5BB 3UI3A 4S0RA 5GAHC 5FLXE 1R9TH 5CV8A 1HZAA 2L1BA 2N7DA 3QA8A 1MGSA 3DXJC 4R4OA 1Z9FA 1W6KA 5C0XH 3T53B 3OAWA 3ZUNA 2UYZB 1L0XB 1I50B 1VQ9A 2B2VC 3ZNHB 4JVZA 2MO1A 2Z6KC 4G0NB 3SR6A 1T0YA 1O7ZA 4CGYB 2MX2A 2PMZB 1PXUA 4B3TQ 2AWTA 4HLEA 3AE8B 3FKIB 2K6DB 2INDC 2WU2B 1YHBA 1LM8B 1ILQA 5C0XI 5DPTA 4A3PA 1Q86C 3PZ8A 4NJ6A 4IFDG 5ELNA 1JRUA 5C44B 2KWVB 4P72A 3HOWG 2KC1A 4DV2Q 1FO4A 1SJED 1VS0A 4A3BH 1IXRA 3ND9A 3GTMB 2H1EA 1PVOA 4DV1L 1H4RA 2E74C 1NBWA 2FE8A 1W6JA 2RCFA 2FNJB 1VQPA 1L5PA 4I7AA 2JU6X 2LGSA 5E6NA 1SBBB 2J53A 5JHBA 3S1NB 4FJVB 4JQWC 5KEEA 3CCRA 1JWMD 5G55A 2MBQA 3KF8A 3VTUA 3BY4B 2PCFB 3ZTCA 1Q90A 4DR1L 4AJYB 1PYBA 5A35A 3HK0A 3LYYA 1WCMH 2NVTB 2L3ZA 2LHEA 3BDCA 2F0TA 2WXIA 1DOYA 2VW9A 2GMIC 4MH0E 4DV6Q 4A4IA 2N49A 3RNUA 2JVCA 3AH7A 1F9PA 1ZKHA 3MWYW 3SR1A 2UXCQ 4H02A 4MM3B 5C3EG 3H09A 4R8NA 5IP7H 3M3YB 3KUCB 1GJZA 3GV3A 2NN6I 2KVRA 1O7LA 3CCVA 1YJIA 1G2SA 3KLRA 3I9V1 3BYTB 2NUCA 2J42A 2HCCA 2JQRB 4Y7NH 4XXEA 4JI4Q 2ASBA 1O78A 2WX0A 5BO4B 2YVCA 4OX9L 3CSTA 3DHIC 4PZ8A 5J39A 2RR9A 2R6GA 4A3IG 4OZCA 2KN4A 4RMFA 3VR2A 3R7RA 3CQZB 2VQEL 4WWOA 4LW1A 4XT1B 1QOBA 3F8TA 3AE7B 5C5LA 3N1ZC 3M62B 4CQNA 4DV5L 2Z1CA 4LFAQ 2O2LD 4NAWB 3R3OA 1U4MA 5IP9H 2KAJA 1IBKQ 4JK1C 3NRZA 2KHIA 2DN8A 3NBHB 1YMHE 2NR2A 2RD0A 3VR4A 3P63A 2B8GA 4JYAL 1DOKA 3LDZE 4FF2A 1TXYA 1V5OA 4J6IA 1V80A 5EE0A 3H0GB 4PK1A 5CX3A 1J6QA 1C9OA 5BR8Q 4IQZA 1E2VA 3S2DB 3KUDB 1WRDB 3H15A 1QLBB 4B0MA 1O7YA 3JYUA 3FAHA 2L83A 2KK8A 2KXJA 2B3GA 5M3FH 4C7ZA 4BBNC 3RZDB 2K8HA 3NENA 2KMAA 3M4OH 4UHVA 5JPMC 2L32A 2RDBC 1YOVB 3OPOA 1Z6HA 1WGGA 3BIID 1A63A 3I8ZA 1WFYA 2Q2UA 3OIPA 4XYOA 3KJPA 3VR5A 3TS0A 2F4VL 3V62A 4BZAA 2EXDA 5DLQE 4F88A 1WTXA 1WJ6A 3Q3JA 1GB1A 4DV4L 2F4IA 2FCMA 3CRLC 2WXRA 1PRTF 1U9RA 2Z6BA 3IFDA 2L9HA 4K8JA 2JK8A 2VUMB 3S16B 1BUIC 3PHXB 4W9FA 3AU7A 5ELDA 4C3HB 3CW2C 1WM3A 1XQQA 4ALPA 3CC7A 1SMYD 2XSCA 2C60A 3C8YA 5TR5A 3T51B 5CV7A 3S14B 1WTOA 2NBFA 3EQLC 3DVNU 4MM3A 1VQ4A 3RMHA 1KTKA 4WQMA 3ZNGC 1LTGD 1R9TB 2O6VB 1Y8RC 4XDCA 2BYTA 2ZM6Q 2CVRA 3E0JA 3SK4A 5DPSA 4YIJA 1WZ3A 3I4MH 3A1QB 2KCNA 5G5GA 1VQOA 2K5DA 3LWUA 1VQMA 1WRIA 4J8QA 2K25A 2AWNA 3CWIA 2F1MA 1WJNA 4GKJL 3OTOL 4ANVA 5JAVA 3SK6A 4RHSA 1LACA 4EGVA 2NBUA 1H9RA 4GLVB 4NAMA 3SU8X 1C4QA 1WR6E 1NAPA 3TZUA 1AYFA 5G5HA 2NVYB 4K3BA 3N32A 1KAAA 1E9MA 2DYOA 4ZRZA 4A3BB 1PZJD 2ICIA 4NAWA 5ELEA 3LWEA 1N5WA 4BAXA 2F52A 1LTLA 2KX3A 3N1YC 4II3B 1UBQA 1Q10A 1E10A 4DHZE 1LUZA 1K8GA 3NBHA 3OSOA 3X3NA 1K83H 3OMCA 1LGRA 1PHJA 2AL3A 2JA7H 2W82A 1WH3A 2JA8G 4WJPA 4JPBW 1P7EA 3MHBA 3L16A 4HPLB 4RH6A 3SEBA 2F0IA 4ZK9B 3UDGA 2YTXA 4LNOA 2Q5WD 4DV0Q 2JZPA 3RCZA 4BOZB 4ZLTF 1QVCA 3GP7A 1UF0A 4K81A 3ZQ4A 4HEA1 1NDDA 1EIFA 5JJLA 2RHSB 3NUHB 3ZXVA 4J1MA 1NYRA 4ZHOA 3K5OA 4HRSA 1WM2A 4BBSG 3A7AB 4N9F4 4W9HA 3NWSA 4R4TA 2BH8A 1HTLD 4DNTB 1TY2A 5IWAL 4A93H 2L00B 5KNDA 1YI2A 1ISNA 3ZRCA 1JB3A 3IFWB 2L0TA 2SAKA 1RWSA 2PVGC 3OWEB 2ZTDA 1PQSA 2IWHA 4Y7NB 3TS2A 1D2BA 1PDXA 3AU5A 1XYIA 1I4HA 1B4OA 1PFDA 4KGSA 1EUVB 1XLQA 3L2PA 3VR3A 4ZKCB 2WXMA 4R1JA 3VHTC 4A3EG 4YWLA 2CJNA 2B2UA 5H1SE 4XWWA 2B2TC 4UP8A 3TP8A 4ZHPA 1CZGA 1WY8A 3QIJA 1EF1A 4NQLB 3TP6A 4A3LH 1K8OA 2O6VA 2IO0B 4AQ7A 1PV4A 3WWVA 3NVVA 1F1HA 4JI7L 1YJ9A 1V5TA 2G5DA 4HJGE 3HOZB 1ZDVA 4IURA 4ZOHC 1YZ6A 3A1QA 4WIPA 4LF8L 1U0LA 3NK9A 3MAQA 3WANA 4KKUA 1TWAH 3ZJUA 4QIWE 2CU3A 3J81j 3W1SA 1B9MA 4W9GA 1ML0D 3BS1A 1MI0A 3P4RB 4GS3A 5CHWA 3UE1A 2DYBA 1HNXQ 4I7ZC 3AEVA 3P1MA 3PZ7A 4KGRA 2DY7A 1X1MA 2WP9B 2K5HA 2QW7A 2EE1A 1HUNA 2LGXA 4Z9CB 2KDBA 3QQ8B 3GTOB 4D2KA 5CMDA 3TJPA 1F2RC 2K52A 2NYZD 4IALA 5M3FB 4IFDJ 2OQ0A 4DFAA 1GHKA 1FGUA 1HRJA 1CKMA 1QJOA 2ZW1A 4ICUA 5DNFA 3WAPA 4NJ7A 3M4OB 2R61A 5L83A 2GN5A 3SGIA 2BF8B 4IG7B 4NW2A 2MUYA 3IKJA 1B3AA 3FHWA 3AI5A 1QE6A 1MG4A 4PMCA 1SF0A 3IT6B 4EQNA 1I6HH 4YCWA 3A9KB 1YX5B 2LGYA 4N8X1 3KYDD 3G6JB 4A3JH 2F0SA 4LJPB 4JPSA 1Y1VG 4BFRA 2JA9A 3HKZG 1HA6A 3Q8CA 3QK0A 1BVSA 4LUZA 3I4NB 3GV6A 1QT9A 3IL8A 3K81C 3HOXH 5E6JA 4B0EA 1S4ZA 3UIOB 5HKHA 2N0SB 3J80L 2L1AA 1XNRL 4L1BA 2OF1A 3CF5A 1LV9A 1TKGA 2C7MB 3AE9B 4PS8A 1D3ZA 1XMOQ 2HIXA 3KDFB 2A5HA 1DZ1A 3ETRA 1HQRD 4JW0A 5K36G 5M3MG 1WJ4A 2XRSD 3OOCA 3PO2G 5BYQA 3EA6A 4ME3A 3B2FA 1Z5SB 1YJWA 1VQFA 1FJGL 3I4MB 1CZWA 2HDMA 2ZJDA 3C0RB 4DV1Q 3DDCB 4EFOA 2KO3A 3A56A 3KW5B 4IM2A 2E6XA 1AZPA 1Y14B 4ID6A 1WI0A 2JYTA 2MJ3A 1UNSA 2CCZA 4IPHA 1XPOA 3U2SC 1VRAB 4K0KL 1YNNC 3EVQA 4IPCA 2Z6KA 1J5EQ 2OEOA 1G91A 2PIAA 4DR1Q 2F0HA 4ODGA 1TT5B 2F0FA 5EE9A 3I3TB 3TUOA 2PTLA 2E2JH 1N63A 4PS7A 3NOBA 3DM1A 3PV1A 2CKZB 1WR1A 4A3CH 2REXA 4Q0FA 4ASWC 4XZ4A 4ANUA 3PIO3 4LFBL 2DYMA 1CKOA 1BBXC 4IO9A 3N20C 2K3UA 3QR8A 1K83B 3ULLA 2GI9A 4IDIA 2WDQB 3U30A 2D2QA 1GUNA 3CPWA 2OTLA 2RPQA 4DK1A 3HKSA 3KUPA 4QUFA 3HOUH 4FULA 3TMPB 4YSYB 4JV5Q 5C4XG 3UDFA 4HCNB 1SFOH 3DMUA 2VH2A 1DCZA 2KD0A 4O1NA 3ZYYX 2G1EA 2M9VA 3TEXA 1N36Q 3HRZC 1RLFA 1NJIC 2KJXA 2OXPA 5AJ3Q 1NEKB 1TWGB 3TP5A 3UI2A 3FRPB 2EELA 1ZOYB 1F2RI 4BY7G 2QF7A 3BU2A 4EE2A 1IHZA 2L12A 1I4QA 5FLXc 2PO4A 2KOLA 4N9PA 1KDBA 4N9TA 4LF4L 3K59A 2JA5H 3G6EA 1RJTA 3NPPA 4O0AA 4B3ML 4A55A 2Z0DB 4A3IH 3PMFA 1MJDA 2MWSB 3ERSX 2INPE 2BWES 1RL2A 1GOZA 2CHBD 3KYHC 3P4SB 5CORA 1L2NA 4C2MH 2E2IH 1FRDA 4JI0Q 5KHQA 1UD7A 1X55A 2UU7A 4KZ0A 1F2YA 2NPTB 4YTMB 2JXTA 5EQ0A 1JORA 1QOHA 2K7VA 4PZ6A 2N1WA 1SNPA 2F0QA 3M9BA 3S15H 1E8WA 4OVUA 4X3UA 2QMTA 4E3CA 1Y56A 3KDFA 3GE3C 3RI7C 1Y8PB 1GPXA 3GQBA 1J19A 3MXNB 4KDLB 4W9IA 3AYHB 4RCNA 5K5PA 1I4GA 2WB1G 4K6LA 4R9WA 2HT1A 5BYRA 2J7QB 1TU2B 4GN5A 1EIYB 2OCEA 3Q3NC 1PTOF 3Q6BA 1TWAB 3K5NA 3PUYA 1X3GA 3ER0A 4QY7A 1EFWA 1A6XA 3NS1A 2VL6A 1H95A 4MEMA 4DAPA 3RNAC 1H8CA 1HNWL 3L10B 1G51A 3TCAA 1HH2P 4HJAA 1CZPA 1HZCA 1PYWD 2KFJA 3OJ4B 4J15A 1HCZA 4ZRKA 3VH3B 3NSWA 1FMAD 2M0AA 1HZBA 2R92B 2F0LA 4HDOA 3C1EA 2YV5A 4OWTB 1Y8NB 2M19A 4RM8A 4RF1A 3RLNA 3MHSD 3HP3A 5LMUQ 3I7FA 3C19A 2LXKA 2R93G 3TDQA 2FAZA 2I46A 2E5LQ
chains in the Genus database with same CATH topology
1CT1D 2DY8A 1UWXA 3MC0B 2A74C 5JJZA 1GJXA 1MPEA 2ACZB 2PYKA 3VRBB 1I6HB 2A68C 2NTTA 4A3JB 1YN3A 5ELBA 2LFNA 1BCPC 1TWCB 3HOXB 3TMEA 4HSVA 2XWBB 4XYQA 2YEPF 3X3MA 3M7NA 2ZXPA 2JA6B 2NB0A 4RGMA 1IYUA 3VR6A 4IUTA 3PIP3 4OZAA 2HUGA 1OQQA 4DK0A 3DWAA 4BS9A 2EJMA 1VF5C 4DQOC 2KMMA 4HCEA 3URYA 4KTAA 3TBIB 2IPKD 3SFEB 4FXDA 2BBCA 2LKVA 1BOSA 4P2CB 2H4OA 3OIQA 3VR9B 4F87A 2WV6D 1KRHA 3MXNA 2TMPA 4NMZA 1HPCA 2MJEA 5CBAE 2KECA 4CJ2C 5JPNC 3K58A 5BMIA 1XCTL 4FF3A 5E3FA 3I4LA 2NTSA 2PW9A 5C5MA 3KBGA 1LO5D 1EZ6A 4KY5A 1NCVA 2NMQA 4OW0A 3HOUB 4G4KA 1H9KA 4KV6A 1FNVA 5I2XA 3AEDB 1SFOB 2J4XA 4QMGA 1JOKA 1C78A 2BDOA 2BE5C 5C3XA 4C3IG 2NVXB 4HMIA 1SAPA 3PUXA 2IX0A 1EEFD 4RKLA 1PGAA 2JA5B 1C79A 2F0JA 1VR9A 3SDZA 3U4EG 1TS5A 4C2MB 3H3VC 3BG3A 2CW0C 4FP5D 5C4ZA 4A6QA 1DONA 3O13A 2SDFA 1QF6A 4IUNA 1E0ZA 4WH4A 3MXGA 5G3LF 5JOBA 1CFMA 1A15A 1Q1BA 2ENBA 4TQUS 3NZ3A 1S5BD 2BA1A 2WXPA 5HURA 3TEWA 3P1HA 2LJIA 1QOAA 1A2UA 2BS2B 1HFNA 1AN8A 4WORA 1C9FA 2WKCA 1RODA 1QCBD 4RFBA 1UWMA 3C46A 1VJKA 2WACA 5FO8B 3RFZB 3BK2A 2X6LA 3R2TA 4ILWA 4KY7A 3GTJB 1XLPA 1ZUD2 2MP1A 2E2HB 1FCLA 2K5WA 4FNFA 4RA8A 2F0PA 2L5TA 1F77A 2D62A 3U9OA 1LTTD 5K36H 2DBYA 4HMJA 1K52A 4XDDA 2BW2A 2QJLA 4K14A 5BN5A 1JQYD 3AE5B 1EIGA 2H89B 3IFTA 4KJNA 1MHXA 3KWVA 4NDXA 3V96A 5LNK1 1STEA 3P42A 3AM9A 3FILB 2L52A 1SXTA 2DLBA 3QG1A 2Q8IB 2WXKA 1KF6B 1R4PB 1YNND 4A3GB 2A6EC 2K01A 5JEAG 5AUKA 3AEFB 4LK1C 1AFPA 4YXDB 3NWTA 5IGEA 1WTRA 4H2AA 1NUCA 3AE2B 1WTVA 2EJFC 3DWMA 1VZ7A 1VZ8A 2E2DC 1Q12A 3T13A 4V0BA 5GXGB 5FR3A 4C1NK 1GUGA 1D1IA 3NTHA 1EIHA 1NR2A 2CQAA 1LTAD 1B1ZA 3G7LA 4ZKBB 3HG9A 2BTEA 4CJ1B 2K5QA 1SNQA 5D14A 1DOMA 2RMMA 5FOBB 1QG7A 1STNA 5I9PA 4XIGS 4WRDA 3EUB2 2RA4A 4IUQA 4DAVA 3J9CA 2WLBA 1EQTA 1U4PA 4RGOS 2B76B 2KEDA 1YN4A 5COYA 2EPBA 3T3OA 2R7ZB 3VYRA 1IGCA 4J3OD 1RYJA 4EQOA 1X32A 3P7JA 3IAS1 2VB3X 3I72A 1RCVD 1BMLC 1N60A 5D3DA 1I4PA 1HEZE 3DEOA 3E5SA 1X3QA 3FILA 4JWSC 4PQXA 4PV1C 1FM0D 1D6EC 3IXSA 3GTPB 2KQ4X 1CM9A 3NUCA 2MGSA 4Q5VA 2EY5A 2HCIA 3J7AF 5A2QE 2WDVB 1KABA 1EY4A 5IGBA 4H44C 2OEDA 3TZDA 1YNJC 1B2TA 4OIKA 1F9RA 1O80A 4HN7A 4TSSA 3ND8A 2EYJA 1H9JA 1ZXIA 4BBRB 2A68D 1DOLA 3JAML 1BF4A 1FYCA 1D5XC 1TKYA 3BK1A 1NSNS 3M85A 1BCPD 1EY7A 2EY6A 1IW7C 1S5ED 4L23A 2O5IC 1JOQA 2ZW0A 1LABA 3SXHA 1SYDA 1TY0A 4C3JB 1WD1A 2Y5PA 2V3PA 1BXTA 4ZRQA 1IBXB 1ZEQX 2K32A 3SK5A 3DWGC 4QCLA 3HRDD 4JBWA 1BUVT 1LT4D 3VYSA 5D3IB 1Q3LA 2EYPA 1IYVA 4LJZC 1UGJA 1WTQA 3Q23A 1EY9A 1TZOA 2IT1A 3C3LA 1OXSC 3C2PA 1PLFA 4LLGM 2JXMB 1ILPA 1M4VA 4TQ1A 3AE4B 3DUZA 5M9OA 1T3QA 1D5MC 2G9DA 1WCMB 5EBDA 1HZ5A 2W3RA 4XQJA 4HCSA 1MHHE 2BE5D 2I2YA 5T1IA 2MEKA 2MH7A 4XE0A 3EGRA 2CJOA 3RZOB 2B2WA 3NVZA 3GTGB 1GUWA 4DAYA 1F2MA 5KYIA 2Z8LA 1XXGA 3K57A 1JWAD 1MVKA 2X38A 3A8IE 1SNOA 1A3VA 4K5VA 1Y69U 4QF4A 3EJIA 3ONAB 1PMRA 4K5WA 2IW3A 2CW0D 5EBCA 1NYQA 3FPPA 4XQNA 4JX1C 2D2CC 1HQMC 2DNCA 5EPLA 4CBVA 2RPVA 2J52A 2ZXOA 5C6AA 2J0TD 3GB1A 1PGBA 4MT5A 3L9AX 1DD2A 5AUIA 1BNZA 5FKAC 1NVID 3Q6SA 4RWSC 2K28A 1NI3A 1KDAA 1FNWA 2QKIC 4LTUA 5JEAJ 1X3PA 2FINB 1G2TA 2K05A 1Z47A 1T6BX 4J6HA 2PNRC 5E4XA 4IUVA 4YSZB 5IGCA 1FR3A 1XLNA 1V1PB 1II3A 1PRTC 1KH0A 1AEXA 4S3SA 3TSSA 2MJ8A 5DM73 4HROA 1WWTA 1EWYC 1OFFA 2BB5A 3RLFA 3P75A 1Q1EA 2FMCA 2BT6A 4US9A 5MPOA 4KN7C 4KHVA 5IGDA 1Y1WB 1ET9A 2LY7A 3F2UA 2B63B 1V8QA 2KACA 2L55A 3I73A 1SEBD 3MEHA 3I3CA 4IFDH 1CTMA 4NJCA 3Q8BA 5IGGA 1EY0A 2WXGA 2BS4B 1GHJA 5I4DA 2W55A 2D5GA 5IOCA 1F9SA 2B2VA 5F2DA 2XN9C 3WCQA 4O42A 3T4AC 4IZ8A 3OW7A 1JR0D 1J7AA 3HVZA 1JC7A 1ZE3D 4IFDI 4MH8A 1V1OA 3V05A 3HGBA 2A6ED 1C76A 4C3HG 2JA7B 4IOIE 4A3KB 3S1RB 2M2LA 1D5ZC 4UDUC 3FC4A 3QJYA 3NTKA 2ONQA 4C7YA 1B9RA 3KBXA 5LL6X 1DGJA 5C0XG 2IGHA 3U9SA 3D4DA 3Q22A 1EWCA 2JWUA 4RHRA 3OWFA 3HS0C 2JE6I 1S5DD 4A93B 3NHHA 2ZT9C 1T5XD 1V1PA 3C1FA 1E6EB 4RGNA 1ROEA 1XLOA 3PUZA 4OIJA 1C4PA 1QKZA 5KRUA 1FXAA 3LB8C 3H91A 4WAFA 4KKSA 2F0NA 3M4YA 3B9JA 2JEBI 3SHLA 2PZWA 3SFDB 4RNAA 4ITKA 1C8CA 4XDXA 3I57A 2FHTA 3RPFC 3MXPA 2NN6G 1WD0A 2X69A 5FK9C 3AEEB 2V0GA 3MHZA 1EFID 2F0EA 2IX3A 5C3JB 2VZKB 5KNCA 3VA5A 1H9MA 4CJ0B 2WP8J 3PV0A 2K0PA 4EQPA 1SNDA 1P7FA 4L2YA 1J7BA 4MACA 4E6IA 4WWMA 1F2LA 5EKKA 1QNUA 1FIQA 2WXQA 5CV6A 1YNJD 2O5JC 2IJ0A 2F0GA 2AX5A 5FLXL 3SVMA 1L0YB 2Q8RE 1JWUD 3ITPA 2WDRB 5DEHA 1VMPA 2X6GA 4RAUC 3N9YC 1HUMA 4LAAA 1ZXTA 2WINB 3S1MB 1IW7D 2RSNA 2EVBA 4PMBA 4QIWB 4V190 5KYLA 5BYSA 1T5EA 1SYEA 1XWEA 2N88A 1FRRA 1SE3A 1EU4A 4IUPA 5KGUA 3D8GA 3SE0A 2L11A 4TQ0A 1IGDA 1DM0B 3D4WA 5CV9A 1UUPA 1BR9A 2E2JB 2D5DA 2JYEA 3ERQA 3DWPA 4OGQC 1OXXK 2IX1A 5J22A 4HKQA 1C4AA 5J1ZA 2VZKD 2F0VA 4LK0M 2F0DA 5HG2A 3J7YW 2PLPA 3J80E 1AW7A 1VZ6A 1BO0A 5C3EB 1Y8OB 2LHDA 3QOLA 4MIUA 4ABNA 5T8IA 1K51A 5CYUA 2N9KA 5FO7B 3AB5A 1PRTB 3KLSA 1H9SB 2W54A 4R3DA 1AZQA 4RF0A 1MI2A 3NP8A 1KNAA 5JVH3 3ABVB 4A3IB 1PZID 2FUG1 2QEJC 3E9SA 3W9CB 5E1FA 2I38A 4QB4A 3J7AV 1FD6A 2KVMA 2E2IB 4KHZA 1EL0A 5FO9B 3LXFA 3H94A 2I07B 2JX5A 2EYLA 3S15B 1OXTA 1GUOA 4HAEA 3DHQA 2B2TA 1PTOC 1DOIA 4RGTA 1STBA 1STGA 1MSHA 2G9HD 2L0CA 4PNYA 2QILA 4DF7A 4DGZA 1STAA 2B2UC 1ENCA 3MXUA 5CV4A 1E7PB 3NVYA 1JOOA 2F0OA 3J81E 5JXVA 4KKJA 4GZYC 3VQIA 2HTME 1EU3A 2WIIB 1ESRA 4UAIA 1KNEA 5JVG3 1Z7TA 4ZYSA 4XWTA 2AQ2B 1ICWA 2RSOA 3IAYA 1SIJA 3FVQA 2K5PA 3KQ4A 4R8IA 2HQEA 1ZXHA 3TEYA 2E75C 1PZKD 2DWQA 4FF1A 1B44D 3LX0A 1A70A 4P6VF 3D4RA 5EKLA 1PRTD 5EE3A 5C0XJ 4ZUIA 4HSPA 1H9SA 4A9AA 2RDGA 1TJEA 2BA0A 1BDOA 1EM7A 1I4XA 2N55A 3GS2A 1JWSD 5IT9E 1CA5A 1ET6A 4C1NI 2J7ZA 2RDFA 3A8KE 4YWGG 1CQVA 2B8FA 3L3OC 3RUZA 1JQ4A 4OHJA 1PFMA 1EEID 2M00A 3AE3B 2LS01 3ZJTA 1PTOH 2OT2A 3AB9A 4H13C 2ID0A 1B53A 1QOFA 2JA8B 2D9UA 1FFUA 1AWDA 2B39A 4ME5A 3DWQA 1TQOA 1OQRA 2F0UA 5HI1A 4BWGB 4IUUA 4N58A 3RD4A 4KJOA 2XWJB 3EFXD 2VNUD 1ZYRC 4C56C 3TEZA 4OVZA 3OHXC 4BBSB 2MJDA 3FEWX 3R93A 2AWOA 2LEKA 1JMLA 2SEBD 3L4PA 5C3WA 1K50A 3A54A 2SNMA 2IGGA 3AEGB 1SYCA 1FEHA 1L4DB 4TKOB 2C5CA 1CJEA 4IKGA 1BCPB 1ENAA 1JE4A 5D7GA 4A3EB 1R4QB 1A3TA 2KA7A 5BN3A 1EY5A 1N61A 4ULLA 5CC4A 4BA1I 5ELCA 4B9WA 1F9QA 2GA4B 1WSPA 1WTWA 1UEAB 1TWFB 5M5WB 2PVOD 2EJGC 1EWHA 2EOTA 2NN6H 3ZGZA 4KX6B 1WGKA 1SYBA 1NENB 1RDPD 3AE1B 3ZJVA 1KLGD 2JEAI 2EKIA 2VXWA 1STHA 1MSGA 4OO1G 2JYOA 4OZBA 2WU5B 2V3NA 1LTSD 3CHBD 3LNNA 4KN4C 3MFYA 1XX8A 1SSNA 5AFWA 3GO5A 2EXZA 1LTBD 4K2KA 3IT4B 3MA2B 4CKBA 1TVXA 2KHSA 1G291 1QNKA 3BDOA 3WOEA 5BN4A 1S5CD 1Y1VB 3HKZB 1MBYA 1GUSA 1L6VA 2RBMA 3I91A 4QUCA 1JALA 1E0BA 3NXWA 4OL7A 1YNTE 4DA2A 2QCPX 1D1KA 2V4DA 3VYUA 2A6HC 2BDNA 5TSSA 4XT3B 1WTPA 5M3MB 2DNEA 3PO2B 1XEEA 2E3TA 1DOXA 1EZ8A 3AV8A 1IL8A 1VF7A 1EYCA 3NQTA 1PGXA 2FMMA 4ZAIA 2Q8TA 4HR7B 1CHQD 1A2TA 2K22A 2IDYA 1SYGA 2JSVX 3M7GA 2GB1A 1KLUD 4RCOA 5HFYA 2WXNA 4WFN3 2A73B 2N9LA 2RKSA 1K53A 1I7HA 4M0WA 1U4LA 1YJJA 2EYFA 3CRKC 1PFBA 1JICA 4K5XA 2PKOA 1PTOB 4M8AA 5EE1A 2WS3B 4FYDA 2F03A 5HHDG 2PW7A 2PMVA 5E4WC 5HGTA 3AEBB 5LHY1 3BWUD 3TEXA 1GUTA 2RQXA 1EYDA 4G57A 4FF4A 4PMWA 4CHTB 5C4XB 2O4XA 4DXFA 1Q8IA 5DAUA 1JWBD 4MHEA 2XVSA 1VLBA 5CBEE 4X3KA 5H8YE 4P16A 1C48A 4JE3B 4A8XC 2OHFA 4BY7B 1N62A 2RDHA 1GXDC 5EKIA 1FNUA 3FMCA 1HZ6A 2AUJD 4ARCA 3DEPA 1MD2D 3R8BA 1RF2D 1L4ZB 4H7BA 2K04A 3D31A 4FXCA 2NWGA 1J7CA 3BZDB 2HDEA 1JCKB 3N6RA 2K33A 4FXGC 3W2DA 1I4RA 1J9OA 1E2WA 3NBIA 4WURA 4U673 2YEPB 3W3AA 4JWUC 4RKBA 3BDLA 3NE5B 4KKTA 1CA6A 2K03A 4C80A 2Y5CA 1CHPD 2F0KA 2WB1B 4KKIA 2EDGA 4GDLB 2KEEA 3S1QB 2K9XA 2K1BA 3FDTA 1SYFA 5KNBA 3KK7A 4DNRB 4ZRPA 1VDVA 3QB3A 1SNMA 2AUKA 2WXLA 2BS3B 3AE6B 5CR3A 1PTOD 2FFKB 2WKDA 4IN3A 4LMQD 5M5XB 1IBXA 4YT0B 2EY1A 2B2YC 2R93B 2EYMA 2JP1A 1ENFA 1YQ4B 3W5VB 1PUTA 1DYQA 2Z4HA 4KD4A 2PZTA 1E2ZA 2HDLA 1STYA 2YYZA 3B2GA 4NAMA 1XF5L 5T1GA 4PT5A 2F0MA 5CGKA 2KUMA 1SSOA 2LFIA 3Q24A 4KK7A 1HA5A 5ISRA 1JW9D 2BOSA 1WXQA 1F0ZA 3K5LA 3VRAB 3AECB 4K2LA 3S17B 1G6ZA 2WAQB 3QO2A 1XTCD 4CKEA 3SK8A 3V3XA 3W5UB 5M5YB 5BMGA 2XNAC 3FPUB 5JEAH 1C77A 4KGTA 4YTPB 4F8MA 3Q0AA 2INNE 1BCPF 2A69C 1HFGA 1TYGB 3BVZA 3HOYB 3AN1A 4MN3A 1J8IA 2PZUA 2PPBC 3A55A 4C3IB 1OXUA 3PO3B 3JAME 2NVQB 2BCOA 2FJ2A 2NZ1D 3E6ZX 2F0WA 3E56A 2E76C 5EPKA 1ZYRD 5I6WA 1EY8A 1BQQT 1ZPSA 2R3ZA 1I3QB 4KY6A 5C4HA 1TS2A 3PUVA 2ICEC 4AS1A 4K6DA 4K8IA 3I70A 4C3JG 1OXVA 2JSOA 3MJ5A 2Y0SB 4Q2JA 3PUWA 3MFGA 4KD3A 3P4QB 1HHVA 1YN5A 1TR5A 4U68A 1R7SA 3I90A 3TN2A 3V2TA 3Q8EA 1QWYA 4OO1H 4NZLB 4HTHA 5EPJA 3BYYB 1S5FD 4A3FB 3S2HB 3T3NA 1HXYD 1JROA 2SOBA 3J81L 1RKNA 5I2YA 2WXOA 1TS4A 1OO9B 3QOJA 4A90A 3R2IA 1K8MA 4EVOA 3K7AB 1SJHD 4OO1I 2IL8A 2EYOA 4N6EB 5G3LD 1B9NA 5I9OA 1ZKOA 1GB4A 2FBWB 5EGTA 2AQ1B 5BMHA 3HZXA 2QIEB 1RTOA 4US8A 1QQRA 3K6OA 2WXHA 4X3SA 2Z4IA 1TWHB 4XTCS 1HTPA 3MTSA 3TP7A 1UAPA 3QIAA 2KQ3A 4TRDA 3HUIA 1CK1A 2C9OA 3AMZA 2KDMA 2QDBA 3IAM1 4NKLA 4KI0A 5IT9L 2EYHA 1KDCA 2TSSA 3MVVA 5NUCA 3P4PB 1TKWB 4DU9A 2WXFA 1WVLA 1RHPA 2ON8A 1XCQL 3NTIA 1DJRD 4ZQ3A 1VCIA 2XIWA 2A6HD 4M1UB 3BVMA 1DXMA 1IKLA 4YSXB 1FXIA 2F3VA 2WQYB 1PFNA 3AEAB 1N5XA 3WOFA 4B08A 4FXKC 3GTKB 4XQQA 4A3DB 4FVMA 3HOWB 2L4NA 1FFVA 2H88B 1SMYC 1SDFA 1SB3C 4DN4M 1VDZA 1TIID 2PQEA 4NP5A 4B9XA 2LGIA 1SNCA 3HEJA 1A3UA 2EZVA 2MPMA 4REZA 2XRQD 1RD9D 1VMCA 4WJWA 1WYGA 3HOVB 2KWDA 4USAA 4KMUC 5C4JB 1YQ3B 4G7ZC 1TS3A 1LT5D 3AMUA 1AP0A 1LT6D 3KLSX 5DM63 1CI3M 5D65A 1GAQB 3D6CA 5IGFA 4L63B 2LMCB 1QB5D 3D6WA 3VYTA 2V4IB 5C2TB 1V43A 4ARIA 4HEDA 4BA2I 4G7HC 3VA7A 1LT3D 1V97A 1FGBD 5IODA 1QOGA 4TMAB 3CU7A 4DXGA 1L6UA 2K6AA 1EQVA 3T56B 2ZXRA 4FO2A 1V8CA 5KIXA 1LTRD 3Q8FA 1LLRD 2Y3AA 1RM6C 4ZUJA 2EY2A 3MZ5A 3U52E 2B2WC 5ELFA 1EYAA 3T16A 1ESFA 3K0YA 3Q8AA 3A7LA 1C4CA 4G7OC 3K5MA 2RVLA 1EOTA 2LUMA 1ONLA 5A2QL 3GTQB 1B50A 4N59A 3L7ZC 3CKIB 3WDNA 4A3MB 2WNMA 4AYBB 3GTLB 2QSDA 3CIRB 5EJWA 2VB2X 1SE4A 5LL6S 2W3SA 3S9WA 1NR4A 1TT2A 2B2YA 2YU9B 4I65A 4HKZE 3PO0A 3KWLA 1XO3A 3BVGA 3A8JE 3Q69A 3EROA 3NQIA 4YTNB 4X3TA 3OMGA 1PDQA 3U7ZA 1RTNA 1L0VB 4GLSC 4F7XA 3N52A 1TKEA 2PW5A 1JRPA 1QILA 3D3RA 1F2ZA 3H8HA 1CQFA 1KFYB 1RFKA 2F3WA 2LMCA 2MHVA 3P20A 1IUEA 1G8ZD 2GRIA 2M56B 2SNSA 3MP9A 2BB6A 2N7JA 1FD7D 1ZP0B 3H6MA 1IKMA 1EY6A 4CKCA 1U4RA 4L6TB 1ACCA 1LTID 1I6VC 4BY1B 4L8JA 5IIFA 2IGDA 3NVWA 3QWNA 5H92C 3HVDA 1M8AA 2WXJA 2AQ3B 1SE2A 2KCCA 1ZDXA 3VR8B 4GDKB 3GD7A 4H0LC 5I6YA 5CV5A 2A69D 1D4BA 3UI3A 5FLXE 5CV8A 2L1BA 1MGSA 3DXJC 5C0XH 1W6KA 3T53B 1L0XB 1I50B 2B2VC 3SR6A 1O7ZA 4CGYB 2PMZB 1PXUA 3AE8B 3FKIB 2WU2B 1ILQA 5C0XI 3PZ8A 4IFDG 5C44B 1FO4A 1SJED 3ND9A 3GTMB 2H1EA 2E74C 2FE8A 1W6JA 1L5PA 2JU6X 1SBBB 2J53A 3S1NB 5KEEA 1JWMD 3KF8A 2PCFB 1Q90A 5A35A 3LYYA 2NVTB 2LHEA 3BDCA 2F0TA 2WXIA 1DOYA 3AH7A 1F9PA 3MWYW 3SR1A 4MM3B 3H09A 4R8NA 3M3YB 3GV3A 2NN6I 1O7LA 1YJIA 1G2SA 3KLRA 3I9V1 3BYTB 2NUCA 2J42A 2HCCA 2JQRB 4XXEA 1O78A 5J39A 2R6GA 4OZCA 2KN4A 3VR2A 3CQZB 4XT1B 1QOBA 3AE7B 4CQNA 5C5LA 2Z1CA 2O2LD 4NAWB 3R3OA 1U4MA 2KAJA 4JK1C 3NRZA 1YMHE 2DN8A 3P63A 3VR4A 2B8GA 1DOKA 4FF2A 5EE0A 3H0GB 4IQZA 1E2VA 3S2DB 1QLBB 4B0MA 1O7YA 3FAHA 2L83A 4C7ZA 3RZDB 5JPMC 2L32A 3OPOA 1Z6HA 3BIID 3I8ZA 3OIPA 4XYOA 3VR5A 4F88A 1WTXA 1GB1A 2F4IA 3CRLC 2WXRA 1PRTF 1U9RA 3IFDA 2L9HA 4K8JA 2VUMB 3S16B 1BUIC 3AU7A 5ELDA 4C3HB 3C8YA 1SMYD 2XSCA 3T51B 5CV7A 3S14B 1WTOA 2NBFA 3EQLC 3RMHA 1KTKA 4WQMA 1LTGD 1R9TB 4XDCA 2BYTA 2CVRA 3E0JA 3SK4A 4YIJA 2KCNA 5G5GA 2K5DA 3LWUA 1WRIA 4J8QA 2AWNA 3CWIA 2F1MA 5JAVA 3SK6A 4RHSA 1LACA 4EGVA 1H9RA 1C4QA 1NAPA 3TZUA 1AYFA 5G5HA 2NVYB 1KAAA 1E9MA 2DYOA 4ZRZA 4A3BB 1PZJD 2ICIA 5ELEA 3LWEA 1N5WA 1Q10A 1E10A 3NBHA 3OSOA 3X3NA 3OMCA 2W82A 1P7EA 3MHBA 4RH6A 3SEBA 2F0IA 4ZK9B 2Q5WD 2JZPA 4ZLTF 3ZQ4A 3GP7A 4HEA1 3NUHB 4J1MA 1NYRA 4ZHOA 3K5OA 4HRSA 3A7AB 3NWSA 1HTLD 4DNTB 1TY2A 5KNDA 1JB3A 2SAKA 1RWSA 2PVGC 3OWEB 2IWHA 4Y7NB 1D2BA 1PDXA 1XYIA 1I4HA 1B4OA 1PFDA 4KGSA 1XLQA 2WXMA 3VR3A 4ZKCB 2CJNA 2B2UA 4XWWA 2B2TC 3TP8A 4ZHPA 1CZGA 3TP6A 1K8OA 4AQ7A 3NVVA 4HJGE 3HOZB 1ZDVA 4IURA 4ZOHC 4WIPA 3NK9A 3MAQA 4KKUA 3ZJUA 2CU3A 3W1SA 1B9MA 1ML0D 3BS1A 1MI0A 3P4RB 4I7ZC 3P1MA 3PZ7A 4KGRA 2DY7A 2WP9B 2EE1A 1HUNA 4Z9CB 3GTOB 4D2KA 5CMDA 1F2RC 2NYZD 4IALA 5M3FB 4IFDJ 4DFAA 1GHKA 1HRJA 1QJOA 2ZW1A 5DNFA 3M4OB 2R61A 4NW2A 2MUYA 3IKJA 1B3AA 1QE6A 4PMCA 1SF0A 3IT6B 4EQNA 3G6JB 2F0SA 4JPSA 1HA6A 3Q8CA 3I4NB 3GV6A 1QT9A 3IL8A 5E6JA 4B0EA 1S4ZA 2N0SB 3J80L 2L1AA 4L1BA 2OF1A 1TKGA 1LV9A 3AE9B 2A5HA 1DZ1A 3ETRA 1HQRD 5K36G 2XRSD 3OOCA 5BYQA 3EA6A 3B2FA 3I4MB 1CZWA 2HDMA 3A56A 2E6XA 1AZPA 4ID6A 2JYTA 2MJ3A 1UNSA 3U2SC 1VRAB 1YNNC 3EVQA 1G91A 2OEOA 2PIAA 2F0HA 4ODGA 2F0FA 5EE9A 3TUOA 2PTLA 1N63A 3DM1A 4Q0FA 3PIO3 2DYMA 1BBXC 2K3UA 1K83B 2GI9A 4IDIA 2WDQB 1GUNA 4DK1A 3KUPA 4QUFA 4YSYB 3DMUA 1DCZA 4O1NA 3ZYYX 2G1EA 2M9VA 3HRZC 2KJXA 2OXPA 1NEKB 1TWGB 3TP5A 3UI2A 3FRPB 2EEL