4RGTA

2.0 angstrom crystal structure of superantigen-like protein from staphylococcus aureus in complex with 3-n-acetylneuraminyl-n-acetyllactosamine.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
194
structure length
191
Chain Sequence
b'HNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYFVGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEFSKEVDVKVTRKESEKSKDSKFKITKEEISLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title 2.0 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus in Complex with 3-N-Acetylneuraminyl-N-acetyllactosamine.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Toxin
total genus 64
structure length 191
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgtA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgtA01
1EFID 1TS2A 1EU3A 1YN5A 1EEID 5TSSA 4BWGB 1ET6A 1SJHD 4O1NA 3V05A 1D5XC 2TSSA 1BCPF 1B1ZA 2IJ0A 4UDUC 4ZYSA 1FGBD 1FNWA 1V1PA 2G9HD 4RHSA 2NTSA 1LTID 1PTOB 1KLGD 1HXYD 2IPKD 1F77A 3BVZA 1LTBD 5D3DA 1UUPA 1PZID 1D5ZC 1TY2A 4Z9CB 1EEFD 1ET9A 1EWCA 1I4RA 1LTTD 1PTOF 1EU4A 1SXTA 1D5MC 1LTSD 3MFGA 1XTCD 1YN4A 1KTKA 1MD2D 2XRSD 1G8ZD 1BCPB 1QILA 1V1OA 1RCVD 1FNVA 3GP7A 5ELFA 1CT1D 2RDHA 1I4HA 1PZKD 1L0YB 1T5XD 1JCKB 1ENFA 1PRTD 1I4PA 1SEBD 2XN9C 1TS3A 3DWPA 1LT3D 4TSSA 2CHBD 1RF2D 2RDGA 1SBBB 5D3IB 1KLUD 2Z8LA 3R8BA 1LT6D 1TS4A 1S5DD 3O13A 1RD9D 2ICIA 1M4VA 3URYA 1PRTC 2QILA 3EA6A 1CQVA 3W2DA 5ELEA 2AQ3B 5FKAC 1JWMD 1LLRD 1CHQD 5ELCA 4DXFA 5ELDA 4NZLB 1I4XA 1SE4A 1UNSA 4RGNA 1PYWD 1AN8A 4OHJA 5ELBA 3KLSX 3BYYB 1FD7D 1FNUA 1TS5A 3R2IA 2O2LD 3OWEB 4RFBA 1SE3A 1AW7A 1CHPD 4RGTA 5I4DA 1SE2A 3TSSA 4K6LA 3BZDB 4RCOA 5FK9C 1JWUD 1XXGA 3BVMA 3CHBD 1LO5D 1BCPC 1D6EC 1LTAD 1PTOD 4RH6A 3EFXD 1TY0A 1S5CD 1YN3A 1B44D 3MC0B 1PRTB 2QEJC 1DJRD 1L0XB 1LT4D 2J4XA 1DYQA 1PTOH 1I4GA 3R2TA 1GOZA 1HTLD 1RDPD 1CK1A 4L63B 4DXGA 1S5ED 1STEA 1S5FD 4C56C 2AQ1B 1JWSD 2R61A 1PRTF 3SEBA 1PTOC 3BYTB 1BCPD 4RGMA 4L6TB 1V1PB 2WV6D 1JQYD 2AQ2B 1LTGD 1JR0D 1BXTA 4RGOS 1I4QA 3BVGA 3DWAA 1LT5D 1SJED 1LTRD 2SEBD 2XNAC 1PZJD 4RHRA 2XRQD 1HA5A 2NTTA 3DWQA 1HQRD 1S5BD 1ESFA
chains in the Genus database with same CATH superfamily
3A0JA 5G55A 2E8GA 4BBSH 4DV3L 4OO1I 2Q8TA 2H1EA 1HTQA 2AWOA 1DCZA 5L37A 5EJWA 5FO9B 3VUXA 4AJYB 2I46A 1HRJA 3CCJA 5JVG3 4LF8L 4PYZA 2R3ZA 1H9RA 1WTWA 5IWAQ 2EYMA 5FLXc 3CU7A 2AUKA 5E6PA 1TWGB 4CKBA 2EXDA 4B9KA 1IKLA 2KWDA 4GU2A 3QG1A 1R4QB 3PT2B 3A8JE 5D3DA 5EBDA 4ZK9B 1FM0D 4DV6Q 2DX5B 2REXA 1TY2A 3TCAA 1N61A 2B2YC 2FXQA 3JC66 5IT9L 1RRBA 3DBRB 1JALA 3FPPA 3PHXB 1TVXA 5CX3A 1E7VA 2UUBQ 1KJTA 2ZCBA 3Q8CA 3LXFA 1NMFA 3S17H 2NVQB 2YTXA 1HNXL 2RMMA 2ZVOA 4A3KG 2HHHQ 4R4OA 5AJ3L 1RCVD 5ELFA 1CT1D 4C3HH 2F0QA 1G6JA 1GC7A 4R9WA 2KHSA 1VQ7A 2KHJA 2R92B 1SSOA 2QSDA 4A3FB 1JMCA 2CS4A 1TS3A 1L2FA 1K8AC 3RD4A 4W9IA 3C1EA 4KV6A 3SE0A 3NUCA 1N32Q 2MRPA 3TIXA 1E6EB 2MCNB 1PFMA 1U4PA 3PGZA 2VNUD 3D0FA 1J7BA 4W9KA 3ETRA 3K5MA 3W2DA 4A3JH 4S0RA 4GKKQ 3DWGC 3IVFA 1EQRA 4KGSA 2NVYH 4HEA1 2RKSA 1B7YB 1IPGA 2QF7A 4KDLB 4I7AA 3K9OB 1WE7A 1SE4A 1PYWD 4OHJA 1RYJA 1XPOA 3S1QB 1EQVA 2L0CA 1CTMA 4DK1A 1PYSB 2NVXH 3E56A 4EFOA 1NENB 3IL8A 3NPPA 1ACCA 4DV0L 1HZ5A 2B2VC 3K7AB 4WURA 3WAOA 3J81c 4F88A 4A3BH 3PSIA 4OWTB 4EQ5A 1Y1WB 4L5QA 5IYBG 2WAQE 2OQKA 1NVID 4KGRA 5K5PA 1EUJA 2KEEA 4L23A 4ANXA 4F7ZA 2UUCQ 1YQBA 2UU9Q 2H88B 2K39A 3VYUA 4BBRG 4IWQA 4W9JA 2BYEA 3SFEB 4IKGA 1EM7A 1OXXK 2ID0A 3CCLA 1V5OA 1V8QA 1JMLA 2JQRB 2VZAA 3OLMD 3PLUA 3J7A5 4IW0A 3VRBB 5I2XA 2L3ZA 2EDGA 2L7RA 3PUYA 4HEDA 3TRZA 4LDTD 3V6EB 2B2YA 2LI5A 4HMJA 3IAS1 4ZRZA 4KY7A 1KNEA 4JPBW 1W2BA 3DQVA 1ZXHA 4NB3A 3FVQA 1XNQQ 3U9OA 3Q8AA 2LFIA 2OQ0A 2MW5A 2OT2A 3TEHB 4A3OA 4AJWA 3EUB2 5I6WA 1NY4A 3D6WA 5HI1A 4LFBQ 4DV4L 4DK5A 2QIEB 1TIID 3ZXRA 4GXBA 3OSOA 3GTKH 3IFTA 1VRAB 2RCFA 2DAJA 3Q3MC 3WALA 1FCCC 4LNFA 3ZIMA 1GO3E 2FMMA 2RSOA 2R93H 3GB1A 1QE6A 4O2DA 3S24A 3R66C 2JZZA 1KRHA 4N9F4 4P16A 1Q12A 3GE8C 1UEBA 3PIO3 2BE5C 3J7AF 3FHWA 3HIZA 3MP9A 4A93G 1RM6C 5D14A 1RLFA 2INDC 3P7JA 2FE8A 2L15A 1Z6HA 2LS01 1S4ZA 4LK1C 4QUFA 1DGJA 2XTIA 3H91A 3MJ5A 3MHBA 3V62A 3PVLA 4LF4L 5CBAE 1VMPA 2KOLA 4HDOA 3AYHB 4S17A 2J7ZA 5M5XH 4A3MB 2IWHA 2B2VA 4CDFC 1L0VB 1LABA 1N9WA 3FEWX 2E5LL 4A90A 5JEAH 1MKHA 1HXYD 2WHIA 1EIGA 2NYZD 1HR0W 4TVAB 1LTBD 5E1FA 5C6AA 1L6VA 4NJ7A 1DGSA 5H92C 5H1SE 3QO2A 3MEFA 3PUWA 3DBHI 1FJGQ 2F0TA 3NBHB 1YN4A 4R8IA 4GMVA 4RKBA 5AZFA 1JE4A 3P63A 2X69A 1B53A 5IYCH 2A73B 2FCSA 3QWNA 4EQNA 1UH6A 1UGMA 2A6ED 2K5QA 1D2BA 2N49A 4GIVA 1EWHA 2LGSA 3H0GB 1CZGA 1T5XD 1UBIA 3W5UB 5FR3A 5JXVA 1PDXA 4NXNL 1EY8A 1QG7A 4B08A 4BA1I 2HDEA 1IZ6A 2KQ3A 5JJZA 1VF7A 4HCEA 4DR2Q 4PS3A 1RL2A 1EO6A 2KMMA 5IYDG 2MO0A 3NBHA 1F9JA 2K6QA 4KHZA 3LJ3A 2IBIB 1FMAD 2LRUA 1T9HA 4CDDC 1E8WA 1TWAH 4QMGA 4FF1A 3S1RB 3T1YL 2PVGC 1PH6A 1N62A 4NZLB 3ZO5B 3FPUB 1VQHA 2QDLA 3RZOH 1VZ8A 2HE7A 2QJLA 1I4XA 1TZOA 1PH7A 1AN8A 2BGFA 5HG2A 1L6UA 4LTUA 2C9WB 2NR2A 2FUG1 4K0KQ 3KYDD 4OELB 1ZYRD 1TZ1A 5T8IA 4M0WB 1SNMA 4YWMA 3Q14C 4FXCA 3DVGY 3NXWA 2QDBA 1QLBB 4IC7B 2D0PA 4GN3B 3T3NA 1JC7A 3CC7A 1KABA 3HVZA 1PTOD 2PQEA 3I4MB 3VAWA 2VQFQ 2E2JH 2WX0A 2YTVA 1VQAA 5EE1A 3AULA 3WOEA 1L0XB 4B9XA 1H9SB 3AU4A 5G5GA 3DVNV 2BCOA 1I42A 4RKLA 3RLFA 1LM8B 3LNNA 3U7ZA 1BF4A 3SXHA 3GOEA 3KF6B 1JWSD 1UE5A 5EGTA 2IHFA 3SEBA 5EKLA 3PIPA 1CMXB 2HQEA 5FLMG 4M0WA 3ZNGC 4UP8A 3NHHA 5IOIA 4DV5L 1I50H 5D65A 1C8CA 4GNXC 1FPYA 2E2IB 1VQGA 3QAQA 2E75C 3I56A 3D4DA 2BVCA 3V60A 3DWAA 5EPKA 3NZUA 3JAMc 4DAYA 2Q2TA 1STYA 4B3ML 4XWWA 1WOCA 2IY0B 1ZE3D 2JA7H 4QB4A 2KLCA 4TMAB 4KKUA 3N3KB 1BUVT 1MPEA 4NKLA 1WJ6A 3ULPA 1SJHD 3KF6A 2EYJA 2C5CA 3C3LA 3V61A 3TZUA 4O1NA 2K01A 2P5ZX 2L83A 1LTLA 2Y5PA 3LDZE 1R9TH 2UXCQ 4RHSA 4LF6Q 2FINB 2K25A 5JVH3 3CCRA 3F2CA 3GTJB 4ME5A 3AM9A 3MJWA 5M3FG 3TN2A 4PYUA 2JYTA 2J0JA 3M4OH 1BBXC 1SR3A 3F1ZA 3J80c 1F77A 5M5WH 1P9DU 4JI5Q 1PZID 2F0HA 1I94Q 3HOWB 2C7NB 4HVBA 4C7YA 4GNXB 3AEEB 1PTOF 2HIVA 1E2VA 1LTSD 1V86A 1WR1A 5IODA 3RYTA 1JJ2A 2NVTB 3LWEA 2AUJD 1X9NA 3QR8A 4FLHA 2BWES 2XRSD 1N33L 1SE9A 1WTVA 1GUGA 2B63B 2ZJRA 3GTOB 3WIMA 2OEDA 2SNSA 3KUCB 3RPFC 3T1HL 1PZKD 1QOAA 1PRTD 2N8NA 2E74C 4X3TA 2G4SA 1SEBD 5C3EG 1CFMA 1WX7A 3ZGZA 4ZKBB 5D94A 2XSCA 1CA6A 3V6CB 3NZSA 3I90A 2CHBD 2L9HA 2MBOA 2PLPA 1YMHE 4KJOA 3ERQA 2BDOA 2NBVB 3I3TB 3QK0A 1AZPA 5GROA 2ICIA 4JYAL 5IGEA 2LVPA 3KUPA 2EYFA 3VYTA 1TU2B 2QILA 2INNE 3C46A 5HKHA 3C19A 4H13C 2RSNA 4I6NB 2OJWA 1G51A 4X3SA 2O6VD 3L9AX 4OWWB 2HJ1A 1ASYA 5IOCA 2I0QA 4KY6A 1E0BA 4C3JH 2K32A 4PZ6A 1V1QA 3S15H 4FBJB 4AH6A 3T51B 2WXKA 4ZUIA 2W82A 2RA4A 1X32A 3OTOQ 1WGRA 1L2NA 1F2MA 2YV5A 1SFOB 2Q5WD 4ZRJA 3MEHA 2BYVE 2LVQA 4JI8L 1GD7A 1X3GA 1XT9B 4QJFA 3GV6A 4XWTA 1R4MB 2KMCA 3EJIA 3A9JA 4GZYC 2X8XX 1UZXB 2L4NA 1BCPC 5IT9c 1K9MC 3AEGB 5EE9A 1H8CA 5C44B 1NCVA 4GOCA 3TMPB 4FP5D 5BYRA 2V4DA 3S1MB 3MA2B 3E0JA 3S2HB 1OXTA 2JK8A 3VH4B 1PYBA 3GS2A 2BOSA 5BMIA 3T53B 2E2JB 1PRTF 3UDFA 3BS1A 1RODA 4OVUA 3ECIA 3BG3A 3HOZG 1DM0B 4IZ8A 2WXIA 2QCPX 5E4XA 3EN2A 5IGGA 4ANWA 2JYOA 4TV3A 2MHJA 2ASQA 3A5UA 1C1YB 1K3BC 3FKIG 1ZOYB 3BJUA 3P75A 3X3NA 4B0MA 2SEBD 4QIWE 1PZJD 4DV2Q 1AE3A 2CKZB 1Q8KA 1RWSA 1TWFH 2E6XA 1ESFA 3L2PA 2KWVB 4QQBX 2QEXA 1X3PA 2YU9H 1F2YA 1YN5A 3MHSD 1H9KA 3PTFC 3EC8A 4K2KA 3W5OA 5IP7H 5KRUA 3UE0A 2UXDL 3GD7A 3PSEB 2XVSA 4O42A 1IYUA 3V05A 4A3DH 2JA7B 2V4IB 2EYLA 4GN5A 4I65A 3H6NA 1Y1VG 2V3NA 4AYBB 4HTHA 4EZLA 4NPNA 1OEYJ 2DZIA 3PO2G 2CW0C 2MJEA 4L1BA 4BBSG 2Z59B 1K51A 1KDCA 2PNRC 2C60A 5J17A 2K1BA 1WZ3A 4OWXB 3ONSA 2A69D 1I6HH 3KBXA 4R4CA 4XX5A 1B4OA 1NYRA 3CC2A 4NAWB 3UGBB 3ZKJC 3PV0A 2Z4IA 5E6OA 2JVCA 2UXBL 1W6JA 2CU3A 2YEPB 1VQCA 3E6ZX 1P1AA 2KZRA 1XYIA 1J5EQ 2W3SA 1EYGA 1NEKB 3WANA 2L55A 3F8TA 4DK6C 3ZTCA 2EYOA 2PI2A 2ZVNA 1L7YA 4XXEA 1AEXA 3DM1A 1RF2D 3KDFB 3MXPA 3P1HA 2INPE 3J81i 3KUZA 5CHFA 3CCMA 5J39A 4Q5VA 5LMUQ 4BY1H 2HCIA 2IO1B 1VF5C 2I1JA 4A3EH 1WGYA 2JXMB 1CQVA 2GBJA 1NMGA 4C3HG 1VDVA 4A3KB 1WFYA 3Q8FA 1X6OA 5LMNQ 2UU7A 3Q69A 2VH1A 3K5OA 4R3DA 1F2ZA 1VQFA 4EZKA 4K5VA 1TGZB 2BS2B 4NXML 3NG0A 4K7UA 4WJQA 1IYJB 3KLSX 1IP9A 1NBFC 2F0IA 1FD6A 1FD7D 5IGBA 2KQ4X 4DR5Q 1T6BX 4WWNA 4X65Q 5JH5C 3KYHC 4F8MA 3ZTDA 5J3BA 3KDFA 3AB9A 2M00A 1VQ5A 2F3IA 4A3JG 3SHQA 1S3SG 4EZJA 1IBMQ 2LJIA 5JPNC 3BZDB 4POFA 3IHPC 3IKJA 1O7ZA 4C1NI 5C4HA 2OF1A 2F52A 5IWAL 4RH6A 2JEAI 4FO2A 3Q8DA 4DR6Q 1TY0A 1T0QC 4BKGA 4JI1Q 1J0GA 2L05A 1RJTA 3T56B 2VL6A 1HHVA 1DJRD 1VCIA 2DY8A 4GSWA 1ZDXA 1HTLD 1QB5D 2OCEA 4L63B 3HUIA 3U8ZA 3T16A 4DV6L 4LF9Q 3RUZA 1E7ZA 1AARA 1B8AA 2ZTCA 1E1OA 1NI2A 1WTQA 3TUOA 1O78A 1FGUA 1Q81C 3LWUA 1A3VA 2RDFA 4DGZA 4BBRB 3D32A 4F87A 3R3MA 3TP8A 2UUBL 1P7FA 4WAAA 3PRPB 3NE5B 5T1IA 1PFNA 1PH3A 3M85A 3N9YC 1I35A 4JWSC 1ZKOA 1D4BA 1AWDA 2HD3A 1EZ8A 3TREA 5FLMH 5E4WC 3S2DH 3A9KB 3BY4B 4I7ZC 2GBRA 5HURA 1WTRA 1HA5A 4YHHQ 3IT6B 2KKCA 3W1YA 4E71A 1SYFA 4KN7C 2JU6X 1BQQT 1N36Q 3MC8A 2BBCA 1SF0A 1WH3A 4FJYA 2RR9A 2RGFA 1ET6A 2XWJB 4BFRA 1N32L 4GOPC 1IYFA 1TKGA 3U4ZA 1D5XC 1HQMC 2TSSA 4ZRQA 4Y7NH 3ZUNA 4HCPB 1KOTA 1T0RC 1C4PA 3MC9A 4GS3A 4PMCA 4GKKL 1MI0A 2R93G 3MWYW 5DCNA 2NTSA 3EBEA 1OFFA 4DFAA 2M0AA 2PKOA 2NB0A 2PZUA 3A9KA 4JBKA 4IM0A 3CPWA 1DOIA 1O7YA 2MGSA 1GUWA 4A93B 4FYDA 2L11A 2KENA 2NBFA 3D4WA 3B0AA 4E74A 1YI2A 2RF4A 1JT8A 1ZXIA 1LFDA 1WCMG 1QUQA 2UU9L 2K8CA 3P4QB 4XQJA 1FNVA 2Q2HA 4FXGC 4HJKA 4NJCA 5IO9A 1NR2A 2PO4A 5JEAG 1XMOQ 2WKDA 3L0WB 3ZRFA 1MG4A 2KT7A 3GE3C 3OWFA 4AQ7A 1Y8PB 1XNQL 5J18A 2EKIA 4EUTA 3U50C 5FOBB 5IYCG 3PO3H 2MO1A 3AEFB 4A3IH 5M3MH 4JL9A 4CQNA 2NUCA 4WORA 1A0IA 4JI7Q 4HIKA 4DXFA 3CPFA 3GTGB 4LFBL 4QCLA 1XF5L 2KJ6A 3CCVA 1W6KA 2N88A 1PFDA 1GUOA 1O7LA 2PQAB 3A74A 3E9HA 5BN3A 3S1NH 1V8CA 2JRHA 3ND8A 2DZJA 2NBUA 2MJ3A 3KVFB 2CCZA 4RMAA 2MNAA 4X62Q 3GV3A 2ZCCA 2JA6H 1UWMA 3VVWB 3PHWB 1I5FA 4RCOA 2PIAA 5MPOA 3TL5A 1NBWA 2VB3X 4FVMA 1II3A 4IQZA 1FFVA 2HQLA 3PPAA 5FO8B 3IAM1 1S5CD 3MFYA 1YN3A 1XLOA 1WTHA 4MT5A 4NQKE 1SSNA 3PRZA 4POGA 5FJ8H 4MN3A 1I4GA 2PQAA 4MZ9A 1GOZA 3JAMi 1C0AA 1ZP0B 2KJRA 1X1MA 4MDKE 5AUIA 3LYYA 1EIFA 1STEA 4RCNA 4YWGG 1FCLA 4N59A 1HZBA 2R61A 3A8KE 1FJGL 1IGDA 2D2QA 3DHGC 2RSUA 3CQZB 4KMUC 4JGHB 4KDIC 1YJNA 5E6NA 4L6TB 1TIFA 2I07B 3K5NA 4IFDH 1JQYD 3U30A 1WX8A 4WJ3M 5L83A 2HDMA 1HNZQ 4HAEA 2UXBQ 1HE8A 3BVGA 5C0XH 5G2NA 1LT5D 3UDXA 1YEZA 1LTRD 2K33A 5COYA 3HOZH 1Y14B 3M62B 4YSYB 4RAUC 4A4IA 2PMVA 4BOZB 2D62A 3J80i 2RCNA 3S16B 3AN1A 2F03A 2E2HB 2CH4W 2EY2A 2ONQA 4DA2A 3RN5A 4A9AA 4G0NB 5TSSA 3HP3A 2SDFA 2OOBB 4DR2L 3FMCA 2KWUB 5ELNA 4M8AA 2QC8A 3P4SB 1P98A 4UDUC 4ZYSA 4HK2A 2IGGA 4J8QA 1EY4A 4R4IA 1JRPA 4HJ8A 1KAAA 1MJCA 4W9FA 2Q8IB 4NMZA 3SR1A 5BN4A 4JI3Q 3ZNID 2KUMA 4A3CH 1K53A 1WXVA 1C9FA 4ZRPA 1K3RA 2I5LX 2V3PA 2PYKA 5JOBA 5IKCM 1GUSA 3W1SC 2F0OA 4F1SA 4K0KL 1LV9A 5T1GA 3NELA 3DWMA 5DNFA 3A7AB 1QQRA 3K9PB 3S14H 1S3OA 1HTPA 1V1OA 1X3QA 3H8HA 3TEXA 3GP7A 1A15A 4IOAA 5GMVA 2XIWA 2JUOA 1VQNA 2RDHA 3DHIC 4FDBA 5M3FB 1WZ0A 4DHZE 4XZ4A 1F9PA 4M8MA 2FAZA 4K1RB 4IO9A 2VQFL 3F2UA 2XN9C 1VLBA 1TWCH 3I4OA 5C4JB 4X66Q 1AZQA 2L76A 4HPMB 4LNNA 3NQIA 2JA8B 1STNA 3AE8B 1Q86C 4W9HA 4IALA 2Z8LA 5CV5A 2F0NA 3W3AA 1FXIA 4ZHOA 2B2UC 5AFWA 3QOJA 3URYA 2MQHA 1YITA 1TWHH 2CH4A 3K0YA 1J7CA 1WMHB 3Q6SA 3TEWA 1JWMD 5KNBA 1SMYC 1HNWL 1GB4A 4IM2A 1WFQA 1L5PA 2D07B 4ICVA 2GVAA 1JB7A 4JI0Q 1EY6A 2EJMA 2EY1A 5KIXA 5M5YH 5C3EB 2KMAA 4NNJB 1FNUA 1TS5A 2F0EA 2WB1E 4DAVA 3RN9C 3I4NH 4DR4L 5L95C 4MM3B 4APVA 1N5XA 4MGKE 3T4AC 2K52A 1WI0A 2A6HC 2BDNA 3IRBA 4WRDA 1A63A 3UI2A 3OW2A 3ZW3A 2K5DA 3T8MA 3PIOA 4WJWA 1MSHA 3KFUA 3D4RA 1JWUD 2Z6KA 1WMHA 5C3XA 3M7GA 4C3JG 2C9OA 1D7QA 1YJ1A 4HPLB 4OIKA 3NSWA 2D11A 1E22A 2EJGC 2UXCL 4LF6L 2MX2A 3BDCA 1OQRA 1IW7C 2ZW1A 1C3TA 1WM2A 1QOGA 3OPOA 2K22A 3NRZA 1WIAA 2I5MX 4JI5L 2WB1G 4C1NK 1K83B 1UELA 3PUZA 1I94L 2J53A 2JX5A 1EY0A 4AQYQ 3N6RA 4DAMA 2F4VQ 1Z2MA 4DBGA 3P1MA 3ICEA 2K14A 2MSED 4HCNB 2OXPA 4BKSA 1PUTA 3PCOB 3AI5A 4R4QA 4WJNA 1GB1A 1PMRA 4A3LG 1SJED 3Q0AA 4C3IH 2K5VA 3CSTA 3E9SA 5EKIA 3DWQA 1E90A 3Q3OC 1Y8NB 4YY3L 2YLMA 2LUMA 3H6MA 2KC2A 4PMWA 3M7NA 2ZNVC 4AS1A 1F9QA 1YNND 2IGDA 4IURA 2JE6I 2AX5A 4ZAIA 4A3PA 4ABNA 3UDIA 4BBNC 4EE2A 4FXKC 1KRSA 1RHPA 4LJOB 3IXSA 3F2DA 3FKIB 4P73A 3VR8B 4MGIE 2BPSA 5CV6A 2VZKB 2Z0SA 3KF8B 2OTLA 1HFNA 3RI7C 3L3OC 3VUYA 4I6LB 2AL3A 1YHAA 4OW0A 5IIFA 1GPXA 1EIHA 2DHZA 1UUPA 4P1BC 4N9TA 3OTOL 2N7EA 4LNIA 4PS7A 1U4RA 1LTTD 5IP7G 3S2AA 2K9XA 3TDQA 1Y69U 2EQSA 4A3DG 2EVBA 4KLKA 3HKZE 3GTPB 4KHVA 5GQOA 1NYQA 2PMZE 1FXAA 2D3CA 1Y1VB 3I2ZA 1PH2A 5D6JB 4A76A 2A1AA 3GO5A 3GDEA 4JCVE 4BVUC 1A3UA 4B95A 3HOUG 2DNCA 5EDSA 3DLLA 1K73C 3EFCA 2KDFB 4OONA 3NVYA 4K8JA 2PCFB 5IE8A 3PO2B 2L0FA 4A8XC 2K3UA 4KD4A 1J6QA 4TSSA 5CORA 1WCMH 4K14A 4BBSB 1QNKA 3PV1A 4KSKC 1DZ1A 4QIWB 3A55A 2K03A 3TJPA 2KCMA 1YHQA 5C4XH 1KLUD 4PQXA 2IHEA 4R1JA 2J0MA 4X57B 2MH7A 4II2B 3AH7A 4HN7A 2DZKA 1BVSA 3VR5A 4A6QA 1XEEA 5ELCA 3HKZG 3U7DA 2CJOA 1QCBD 1J8CA 2N3SA 1GUTA 4HXDA 2M19A 2GA4B 5ELBA 4JWUC 3M9BA 1TWHB 4IUQA 4E6IA 2WU2B 2K75A 5KYIA 1SE3A 4H02A 4DV2L 1STBA 1TTNA 4BY1G 5EKKA 4A3EG 3S17B 3FILB 3KYCD 3Q3NC 2CR5A 3HOVH 4C3HB 5KNDA 3SK5A 1ENAA 2KACA 1LO5D 3RNFC 1E2ZA 1ILQA 2F1MA 1D6EC 2ZW0A 2KTRB 3I7FA 4XC2A 5BR8Q 3MC0B 3VH3B 2YYZA 4ZHPA 1K50A 3M95A 3ZNZB 4DXGA 3K5LA 2HDLA 2MJ8A 4LF7Q 4V190 3QQ8B 2EZVA 1WR6E 3UINB 2N7JA 4A3JB 4GLSC 1HPCA 2EY5A 3Q8BA 4P6VF 2L32A 3RD2A 1L1OC 4HSPA 1OO9B 1CKNB 5GAGC 3FILA 4US8A 2NVYB 1QWYA 2QDFA 1KC8C 3L0OA 3R7RA 4PZ7A 3AE6B 5HGQA 1VQOA 3QX1A 2NVXB 5M9OA 2OWOA 2WP8J 1PGBA 5CTRC 2BW2A 1JW9D 2EELA 5AZGA 4A3BB 4QF4A 1J5EL 2KTRA 2G45B 2MBHA 2LJ5A 3EECA 1Z9FA 1P3QU 2N9XA 1TS2A 1C7YA 1LM0A 1Q90A 2FMCA 1IBKQ 3PZ7A 4P1CC 2PW9A 1G2SA 4JBMA 4NPSA 3HFZB 3WWVA 3HOXH 2DNFA 3B1LX 3EQLC 1OXSC 5LMUL 2ES2A 3TS0A 1BCPF 3RZFA 4YTNB 1MI2A 2F0JA 4A3GH 4XDDA 4B6WA 1EOVA 4ULLA 1P0RA 5LMNL 1C4QA 3MXUA 2MWSB 2YTYA 3AB5A 4IPHA 1HNWQ 1IL2A 1MIUA 4JOIC 5LXHA 3ENEA 1JJCB 1ICFB 4X6AH 1VQEA 2CU1A 3ZJVA 4DR5L 3TP5A 4X65L 4DR4Q 1VCBA 2LD9A 1FYCA 4N6EB 1DOYA 1KM7A 4WJOA 2MJDA 3STBC 4IWOA 2BTEA 3GTKB 1H9SA 1SB3C 1JORA 3M3YH 3N32A 1IBML 4WQOB 2VUMH 2R93B 1KF6B 2JXTA 3VA7A 3MXNB 1JCKB 1KDBA 4YL8A 4DR6L 3HM6X 3VYRA 4JI1L 2YEPF 3CC4A 4JX1C 1QVGA 1Y8RC 1RFAA 4ZYNA 2HTHA 2L1AA 1Q3LA 1SYBA 1JE5A 2KQ7A 1VZ6A 5CV8A 4C2MH 1KIXA 2D3AA 1FR3A 4LF9L 1C77A 4YWKA 3DBHB 4JE3B 2WXFA 5M5XB 5AEKB 1QZHA 2VQEQ 1NUCA 1WJJA 5FKAC 3BK2A 2WKCA 3CIRB 2JA9A 4TRDA 3DVGX 5CHVC 1EYDA 4PMBA 1SAPA 3MXNA 3ZDTA 2WXRA 2BT6A 1C48A 1UE1A 1OEYA 3GZNI 2B29A 4YHHL 3AE3B 2XGTA 2VRRB 3PO3G 4LK0M 4A3IG 5M3MG 4YY3Q 1N36L 3H7SA 2V1YA 2BWFA 2ZPNA 1WI5A 1NTGA 4FULA 4WAFA 2DJGC 3CRLC 3DMUA 3FRPB 4KGTA 4GNXA 4K5XA 1SMXA 1P7EA 2NCNA 4HJGE 1HZ6A 2K04A 4MIUA 2E2DC 3A1QB 3AFPA 1DONA 1NAPA 2RHSB 4XYCA 4K7WA 4JIOU 1PTOH 1QNUA 1K8GA 2JT4B 3IG3A 3ZNHB 5D7GA 2JA6G 4RF0A 4BXXH 4GLXA 4II3B 2GBNA 2CWPA 2MBEA 3N1YC 3SFDB 1XMQQ 4MJSB 1TWAB 2SAKA 3BYTB 2WYQA 5EE0A 3RZOB 1CJEA 2WV6D 2VB2X 3K7UC 5E7NA 4FHJA 4KZ0A 2N55A 3VHTC 3PIP3 3CD6A 3OOCA 3CF6E 3NTKA 2HCCA 1DD2A 4XYOA 2K5PA 4LLGM 4ZCKA 3J7ZC 3W1BA 2ZXRA 4HJ7A 5FJ8G 1YJWA 1XMOL 3A1QA 1K0RA 1SROA 3I63C 1XTDA 2Q2UA 4DNRB 3IFDA 1YX6B 4N9PA 1EU3A 2M2LA 1CA5A 1KAWA 1PA6A 1MJEA 1DOMA 1I3QH 3IAYA 4P2CB 4A3LH 5DM63 1JWAD 4IFDG 5CV9A 3WAPA 4PS8A 4MJSA 3UIPB 1LUZA 1KDAA 2EKEC 2SNMA 1WD1A 2M0XA 1UEAB 3HS0C 3AE2B 2WACA 4G50A 1IUEA 5C0XG 2GMIC 4IUUA 4JI7L 3QIAA 4HLEA 4ICUA 4IM3A 1K52A 3RMHA 4MTNA 4A20A 5DPWA 3BVZA 3BINA 2OHFA 3ZXVA 3PLVA 4OXPA 2I5HA 5BN5A 3PRMB 1SXTA 5C3WA 3M3JA 3BWUD 4XIGS 2DNEA 1GHKA 1UWVA 4X62L 1U4LA 1I50B 4M01A 2F4IA 4WFN3 4K3CA 1BCPB 3DEOA 2WLBA 3ZLZA 2UYZB 1XPRA 2B2WC 3ZJYC 1I4HA 2KCCA 1B9MA 1L0YB 4A3CG 1UF0A 4H2AA 4WJPA 1ZGUB 4JV5Q 1WTPA 2KVZA 4ODGA 1YX5B 2KN4A 2Y0SE 4ID6A 4KD3A 3PF4A 2BH8A 3E5SA 3P20A 2GI9A 3UF8A 5JJLA 4CBVA 4DXAB 1WVLA 1S72A 4JVZA 2PW7A 4GN4B 4L5RC 5I9PA 3CCQA 3HOUH 1TBEA 4RM9A 1B3AA 4RA8A 2BA1A 2LRWA 2V1CC 1ZYRC 2D5DA 2F0MA 1R9TB 1EZ6A 2A68C 4RM8A 4LF5Q 1LLRD 4DF7A 2L00B 2GN5A 1GVPA 3M4OB 3N30A 3PUXA 1VQIA 5KYLA 1F1HA 4MNOA 3C1FA 5M5WB 1HNZL 2BS3B 2GRIA 2WS3B 4OL7A 4DAPA 3GZNB 3PREA 2IO3B 4RNAA 3I9V1 1DXMA 3D31A 5JEAJ 2KECA 2DYOA 3DHQA 3RNCC 1KLVA 1A8VA 1QF6A 1AW7A 3QOLA 2MQJA 2HIXA 2Y0SG 1E8ZA 3A5ZB 1QJOA 1A2TA 1VJKA 2XBBC 3HOYH 1F52A 2W9NA 4HMIA 4BY7H 1AE2A 4DU9A 4DR7Q 1IKMA 2ZTDA 1WE6A 2CFMA 3FAHA 4IUNA 3CHBD 4LW1A 3TBIB 3A4SC 2MLBA 5BYSA 1PXUA 3ZYYX 3G6EA 1M8AA 1JWBD 4QY7A 1YIJA 4YIJA 3I4NG 4CKCA 4EGVA 1B44D 2A8VA 3ML8A 4NAWA 3GTMH 2R7ZH 2H89B 1V80A 1LT4D 1L0WA 4DHZB 4P72A 3W1GA 1N60A 4JI3L 1LGRA 2VY3A 3QB3A 1CK1A 2KHIA 2ZEQA 5LHY1 2ZM6Q 4C4VB 2AL6A 4IPCA 2KX0A 2L5TA 3NTHA 2FHTA 5LXIB 2LEKA 2I2YA 3H09A 4MHEA 1MHWC 4IUTA 2K0PA 2A4ZA 1ICWA 1BOSA 2FCMA 2Y3AA 4C3JB 3P42A 4MM3A 4UHVA 4HROA 4ASWC 3S15B 2WP9B 4JW0A 1TJEA 3VR9B 1MJDA 2KC1A 2G3QB 2O2VB 2R2QA 2EPBA 3FKYA 5I6YA 4W9LA 2M1MA 2RPVA 4MELA 4RHRA 5KNCA 3Q24A 1WXMA 5LMNW 1R4PB 2K8HA 2WB1B 4X66L 3NOBA 1EY9A 1O7IA 4G11A 3NQTA 4C4VA 3L17A 3PMFA 4J1MA 3CRKC 1EY5A 3TS2A 1YNTE 4J3OD 2UUAQ 2KJHB 3K8AA 5DLQE 1RTOA 2B76B 2GBMA 2F0UA 1ZW7A 1B1ZA 3GTLH 2F0LA 1C4CA 1E7PB 3U4VA 5IGDA 4DQOC 3PQIA 4C3IG 3BDOA 1YD8U 4AP4C 1J8IA 2JA5H 5IP9G 2O2VA 3HM3A 1HFGA 2LKVA 2ZXOA 2DN8A 5HGTA 4JI0L 4BOSC 3CW2C 2RHQB 1EWCA 3HEJA 2R7DA 1EQQA 1BO0A 1VMCA 4OGQC 2IGHA 3A54A 1CZWA 2NVUI 4IDIA 3DEPA 4BKSD 2WIIB 4R4TA 1WTXA 2IX0A 3I4MG 4JC0A 3KJOA 3C2PA 3L54A 4TQ1A 1YBYA 4ALPA 3Q8EA 1E0ZA 1F2RI 4G3XB 2PEAA 2N7DA 4PT5A 4B3SQ 4DV1Q 2PE6B 3PO0A 2KDMA 1EL0A 3APDA 1TWFB 4UAIA 1PQSA 3G71A 5FO7B 5KEEA 2DJFC 2WINB 2LGDA 2WWZA 2YU9B 1XNRQ 2INCC 3ZRCA 5CV4A 3RMKC 1T0YA 1NR4A 4MACA 4K6DA 4DK0A 3WDNA 3O13A 4FN2A 5KHQA 2IX1A 4A3DB 1WYGA 2PTLA 4X3KA 3KWLA 4GDLB 3HRZC 4AQYL 4DWFA 4LJPB 3RZDH 1UWXA 2FCNA 4R8NA 5IGFA 2F4VL 4GKJQ 1BR9A 3Q3FA 4W9EA 3UI3A 2J7QB 4B3RQ 5ELDA 2A6HD 4RMFA 3RNUA 1VQPA 3GTQH 1GC6A 2JPHA 4ANVA 1RFKA 3HOUB 2FUHB 1Q46A 2CHXA 5G5HA 1JICA 1AYFA 4IUMB 3BYYB 3VR2A 1CZPA 1ML0D 3H94A 1YZ6A 5C4XG 2JY6A 4FJZA 3W5VB 2LHDA 3BU2A 2KWCA 1HEZE 1I6HB 3ER0A 4B0EA 3KWVA 4L5TA 3JVZX 4GOPB 3N1XC 4FHKA 5G3LD 4XDCA 4ZUJA 1IW7D 1EFWA 2EXZA 1C4AA 1OQYA 2C7HA 3OG5A 3QWZB 5DPTA 3QC8B 1SIJA 1MFWA 1GM5A 2LXCA 4GDLA 5NUCA 2R2OA 3HKZB 2AKWB 2D3GA 1R7SA 2VZKD 4ZOHC 2PMZB 1YOVB 3EFXD 2MBQA 1XCQL 2KEDA 4K2LA 2NS5A 2N1WA 1QZGA 4TUUA 1TWGH 1GJZA 1ISNA 3VRAB 3VTWA 1RDPD 4BY1B 4A3EB 3KW5B 4QUCA 4JI4Q 2N1VA 4LNOA 4REZA 3HOVG 1XCTL 1XQQA 1NI3A 4AOFA 4DDGD 4S3SA 2JSOA 4GOPA 1WM3A 3AU7A 1E1TA 4FADA 2F0KA 3CSFA 2WFWA 5A35A 1TT5B 2KVMA 3I73A 3ZDMC 4QL5A 1SNOA 2NVQH 3I91A 1WRDB 4RF1A 3FC4A 4CJ2C 2K05A 3B2GA 4DUZQ 4IOIE 2DYBA 4ZRKA 3HG9A 4CDCC 4B3TQ 1WF9A 4ME3A 2LXAA 3C0RB 2A5HA 4KY5A 1F2RC 3K81C 2EOTA 2R92H 2JEBI 1S5BD 3VA5A 4CKEA 4A3FH 1G91A 1JRUA 2EE1A 1PLFA 5CMDA 2BYFA 2AWNA 1V5TA 1PHJA 1PGXA 4BWGB 1V2YA 3KH0A 4ITKA 3UIOB 3CAMA 2LHEA 1SGHA 1K8OA 2W3RA 1W3SA 1K8RB 1PFBA 2A69C 2AHOB 2K7VA 3K58A 2MUYA 1TKWB 5G3LF 2IW3A 2LVOA 3LGJA 2BE5D 2G5DA 3CMAA 1J7AA 5CBEE 2ICEC 1A3TA 1N63A 2IPKD 2OJRA 1TQOA 4ARIA 4Z9CB 3JSVB 1C9OA 3C8YA 1P8LA 2E76C 3K7AH 4K81A 3HOXG 2K1FA 5LLIA 1Y1WH 2JP1A 4NW2A 5DAUA 1NSNS 1WX9A 3NVVA 5C2TB 1ZPSA 1MD2D 4A3GG 2HD5B 2IT1A 4IFDI 4XT3B 2X38A 4ZLTF 4IOCA 1STAA 1M1KC 1PDQA 2KK8A 3S2DB 3RCZA 3RNEC 3CF5A 5C0XI 3MTSA 1VQ4A 3TZDA 4KTAA 4XT1B 4XTCS 1GJXA 2LY7A 4PZ8A 3ND9A 1LT3D 4LUZA 5BR8L 5C4ZA 3IT4B 5GXGB 4HJ5A 2RDGA 2V4LA 2BH2A 2ENBA 3JSVA 3OIQA 1EWIA 2K6AA 1RD9D 1LACA 4LF7L 5E3FA 4Y7NB 3VQIA 5ELOA 1CQFA 2VUMG 2B39A 2AQ3B 3B2FA 4IWPA 4BBNF 1PH9A 2G1EA 2IL8A 3KOJA 4HRSA 2EJFC 4IG7B 4O0AA 3A33B 3L10B 5HY6A 4N8X1 4EQOA 3R2IA 1EYAA 1E9MA 1IGCA 2NWGA 3P2BA 4MEMA 1YVCA 4UY8C 1J9OA 3BZCA 4OO1H 1QT9A 4LNKA 5IN7A 1IBKL 1E3PA 4G7ZC 1FIQA 2M8SA 2DUDA 2VW9A 1SE2A 4EEWA 2L12A 2QCZA 3S9WA 4DPGA 4DHJB 1OXUA 2SOBA 3NHEB 4J6IA 4LFAQ 5EPLA 1HUNA 1TT2A 3ZJTA 4A3MH 1WJ4A 2KTFA 2GLSA 2KA7A 2L1BA 1EUVB 1SYGA 3PZ8A 3ML9A 5BYQA 1BBWA 1WGGA 3DHHC 3RNBC 1S1QB 1S5ED 3PO3B 2Z0DB 2RD0A 4LUVA 3OAWA 4NP5A 5M3MB 4A3IB 3Q2AC 4USAA 3OMGA 1YNJC 4RGMA 1B50A 4BAXA 3NK9A 4PNYA 2PZWA 1YQ3B 3ONAB 1JR0D 4K3BA 4C7ZA 4Q0FA 2M17A 4N58A 3S1NB 4YTMB 2NZ1D 3A8IE 1XJVA 2FJ2A 2ZJDA 1L4DB 1PVOA 1SN8A 5HHDG 3H0GH 4BXXG 4KN4C 4DNTB 2JA6B 4CYEA 3O65B 3W1SA 3TEYA 1X3FA 4DR1Q 3RLOA 1D8LA 4LFCQ 1TKEA 2QHOA 4NY0A 1EEID 3ABVB 3DCGA 2G4DB 2IZVB 2AYOB 1BMLC 3SVMA 3D6CA 2KDEB 5DEHA 2VQEL 1MSGA 1WYDA 2G9HD 2MHVA 3DVNU 4LCDE 2ZXPA 1YQ4B 1IBLQ 4H0LC 3S1RH 3STBD 2C7MB 4E3CA 3J81j 4X64Q 2BF8B 3AU5A 1EQTA 2DGYA 2ACZB 3E3XA 2EIFA 3K6OA 4LWCA 3HVDA 4XGAB 5C3JB 1CSQA 1V49A 2D9UA 4DNIA 1VS0A 4BKTA 1I4RA 4NDXA 3I8ZA 1QZEA 5JAVA 2B2UA 2FIDA 2DBYA 3AV8A 2Z4HA 4KK7A 5IP9H 2JRIB 3T13A 1UE7A 1LYLA 4U68A 3M4YA 4IUPA 1F9RA 2LGYA 3L16A 1KNAA 4LAAA 1SE8A 3AEDB 4UPAA 1TKYA 5C23A 3CCSA 3NJTA 4HJAA 1WJUA 3HOZB 3H3VH 1Q1BA 4NJ6A 1S40A 1KXLA 2MPMA 4DR3Q 1UBQA 1C78A 4G7HC 3NZ3A 2KBNA 2IY1B 3I4MH 2O5IC 1XX8A 1ONLA 2L52A 3PGEA 3WA0A 2EMSA 4PV1C 1E8YA 1E2WA 2D5GA 3UQAA 1SBBB 4G7OC 5D3IB 3AQQA 4YCWA 1KFYB 3U58A 2L8JA 4DK3C 5EQ0A 3RT3B 3D8GA 4ANUA 2LMCB 4GLAC 1M4VA 3H3VI 1FEHA 1D3ZA 1UAPA 2K50A 1XMQL 2MP2B 1MGSA 4XDXA 2L0TA 1A70A 1SRUA 4PG3A 3N52A 5IGCA 3OHXC 3FP9A 2NBWB 2PE9A 3I4LA 2KCNA 3QARA 4KKSA 2KN5A 2E2IH 4DDID 3AECB 4HDQA 3X0WA 3MTNB 1Q5WB 1SNDA 4A75A 4RFBA 2HUGA 4CJ1B 2ZNVB 2WAQG 4KKIA 3WCQA 1B3QA 4DV7Q 4HIOA 4OX9Q 5C5MA 1HTOA 3DBSA 3VFKA 5JPMC 2QA4A 3S14B 3KF8A 2WXHA 3NUHB 3EGRA 2V3SA 2LMCA 3RLNA 1HR0Q 1VQJA 3BK1A 3X23A 1YIWA 2K4KA 3BVMA 4IUVA 2MP2A 4KX6B 4MSQB 1P16A 3BIID 3ZQ4A 4P75A 2NPTB 2O4XA 2IY5B 4JK1C 1TWCB 2K28A 2RDBC 3OIPA 4KZCA 3GTJH 3H15A 2B2TC 1B9RA 2MBBB 1DYQA 1Q10A 1HZ9A 3EHVA 4DN4M 1V9PA 1TYGB 5C5LA 3U2SC 1L4ZB 1S5FD 2Y0SB 3VTUA 2RBMA 4CHKA 3HOWH 2PW5A 3HOYG 4BY7G 2WXJA 1SLJA 3DOWA 2VS1A 2KXJA 4YXDB 1BCPD 4JI6Q 2WXPA 1ASZA 4JBJA 1K0SA 3IFWB 1RIPA 2NVTH 4KSLC 2AQ2B 2RVLA 3JYUA 2DY7A 4FF4A 5M5YB 3VYSA 3M63B 4YCUA 2B63H 1V43A 3GTOH 1ZXTA 2F3VA 1WD0A 2R7ZG 1OTCA 3NY5A 3I4NB 4YWLA 4H44C 1SIFA 2LFNA 2NPTA 3L4PA 4EVOA 4DUYQ 2A19A 2GVBA 4JV5L 4HCSA 4KIKB 3PF5A 5E6JA 2LUEA 5DM73 1G6ZA 5BMHA 4JI2Q 1N34Q 3VDZA 4HSVA 3Q22A 2I38A 1MHHE 2LGXA 1YJIA 3SK6A 3N20C 3TQYA 3EIVA 1FRRA 4XYQA 1WXSA 2LWPA 1VQLA 3K59A 2ALYB 1E24A 1FNWA 2NN6G 3DUZA 3I55A 4LF5L 1X65A 3AMUA 2KJXA 3H3VC 3OJ4B 4ACFA 4LUOA 3I5JC 1Q7YC 3RFZB 1SYCA 5KHOA 3DBLI 1TXYA 2GBKA 2J0TD 4KIKA 3RZWC 1SNCA 2EMTA 3R7QA 1SNQA 2YVCA 1SFOH 1NE3A 2DZMA 3SU8X 5FLXE 1E5WA 2DAFA 2KDBA 3K0XA 1G8ZD 5CR3A 2OEOA 2B2TA 4DR7L 2ZTEA 4IFDJ 2CW0D 2JA5G 3PUVA 1OTRB 4C3IB 2GB1A 3NS8A 1Q82C 2K6DB 5IA7A 3TEZA 4LJZC 1HCZA 1CKNA 1Z7TA 2A68D 3EROA 3CMEA 5C0XJ 4CJ0B 5C44H 4KHPQ 3DWPA 3MXGA 4DV3Q 2JWZA 4I6PA 2PZTA 4G57A 2B8FA 3S1MH 4M1UB 1BDOA 2V0GA 3S2HH 1M94A 1L1OB 1LT6D 1EIYB 1S5DD 1K28A 2ZM6L 1NJIC 1VQKA 4LF8Q 1MHXA 1R4MI 1WSPA 1ZDVA 4KVGB 4ZQ3A 3EA6A 2XEWA 2WXOA 4IPDA 4DAYB 3SDLC 2LSSA 3K80C 2QMTA 4K7SA 3DXJC 1I7HA 2RPQA 1UNSA 5I9OA 3QJZA 2BA0A 2CVRA 1PGAA 3V96A 4ARCA 2X6LA 5LNK1 2E3TA 4BA2I 2CWAA 4WWMA 5AZHA 1EF5A 5K36H 3A4RA 2K5HA 3NWTA 1L1OA 1PH8A 1HNXQ 3VTVA 2W54A 2DENB 5AJ3Q 4J6HA 4K6LA 3AE5B 5FK9C 1WXQA 3U4EG 1XXGA 3AE9B 2UUAL 4ZRIA 1IL8A 5CC4A 4OVVA 1FVIA 4HJ9A 4JPSA 1YJJA 3J81E 1ZKHA 3CP0A 1WCMB 1IHZA 2BQQA 2N9KA 2LXKA 2KFJA 2WXGA 5C4XB 1YJ9A 1XPUA 3QIJA 4CGYB 2KFKB 1OXVA 2GOWA 1ESRA 3E0EA 1VZ7A 4K8IA 4DKAC 2JWUA 2KAJA 2KLGA 3AEBB 3T3OA 4JLCA 4Q2JA 1GG3A 1Q1OA 2JZPA 3SHLA 3G7LA 3ULJA 2Z0EB 1YNNC 1J19A 4B9WA 1U0LA 2EYPA 1VD2A 1UGJA 3TP7A 1WY8A 2JA8G 1O80A 4B3SL 3AFQA 4DV1L 1N8RC 4DV0Q 1X54A 3BDLA 2B3AA 2N9EB 4JOIA 2WX1A 3SD5A 2KX3A 3PO2H 3OYYA 5J2RA 2JF5A 1X3EA 1U9RA 3EFUA 1XNRL 2PPHA 5CGKA 2KFKA 3VR6A 2H5XA 1G291 3HOVB 4K5WA 1Q0WB 3CKIB 1Y56A 2Y5CA 4AIMA 2O5JC 2Q8RE 2BKRB 3L08A 5DPSA 3QJYA 1B9NA 4GKJL 4P74A 4HIMA 4A3KH 5JJKA 2I1KA 2UWQA 4B3RL 1KLGD 3DBLB 2R92G 4LDTB 4LNQA 2DYMA 4A3FG 4OZAA 3P4RB 4RG1A 1MG8A 4MSMB 5IAAC 3L7ZC 3SK8A 3H7PB 4WIPA 3A9JB 1D5MC 5LL6X 5GADC 1KD1C 4PK1A 1BUIC 1KTKA 4DV4Q 2Z9HA 1IBXB 1E10A 2DWQA 4V0BA 5EPJA 2F0FA 2H4OA 4XQQA 4BS9A 4MGZE 2BYTA 1ILPA 1HJPA 1H4RA 2D2CC 2KANA 2KYWA 1GXDC 2KNBA 1D1KA 1VQ6A 4IPGA 1JOKA 3VR3A 5EE3A 1ENFA 2C5LC 5D2MB 2PVOD 3KUDB 1Y8OB 2CQOA 3X3MA 3PZDA 3PS6A 3NWSA 1Y1WG 3H7PA 2CQAA 3HOXB 1FL0A 2A6EC 3SDZA 4LF4Q 2F0VA 2JSVX 5IYBH 1VDZA 1OGWA 1Q8IA 4JI4L 2JYEA 4A3GB 1G2TA 3JW0X 5ELEA 4CDEC 4OIJA 1GUNA 3KK7A 3T9LA 1IBXA 1HZAA 3GQBA 4BBRH 1JQ4A 4W9CA 3G6JB 1BNZA 2E5LQ 1WGDA 2LZ6A 1SYEA 2MEKA 3CWIA 4EKUA 2W55A 4RGNA 1RAXA 2JQOA 2LASA 3B9JA 4DUZL 1VQDA 1XD3B 1N5WA 4B3TL 2O2LD 3AMZA 3Q3JA 3ZVVA 2FCQA 4C80A 2LXJA 5FLXL 4YTPB 2WNMA 5CHWA 1CHPD 2D0OA 4WQMA 4RGTA 2J42A 4TQUS 3N1ZC 5I4DA 4Y52H 3M3YB 2M9VA 2ZT9C 4YSXB 3U9SA 3TSSA 2VUMB 1Z5SB 1YHBA 3KLRA 1MBYA 3HK0A 4OZCA 4YCVA 3KLWA 1LTAD 1VQ9A 3H1UA 2JXXA 3KLSA 4P7IA 4NXNQ 1HUMA 1SDFA 2J4XA 3MVVA 3R2TA 4XE0A 1H9JA 4C2MB 2VH2A 4OO1G 2N4FA 2A5UA 4TKOB 1EYCA 3R93A 4C56C 2WDQB 3NBIA 3TMEA 1C76A 4QAYA 1PTOC 1V97A 4A93H 3DDCB 5A2QE 2PJHA 5IP4D 2F0PA 1XLQA 3T1YQ 1XO3A 3ULLA 1T0SC 1LTGD 4KKJA 2CHZA 4A3MG 2N78A 4P71A 2K5WA 1CUKA 3NVWA 1I4QA 2ZZPB 2QKIC 2CKHB 1UD7A 2LGIA 4F8CB 1QOBA 1JOQA 4KI0A 1VR9A 4HWIB 1EOTA 1LQBA 4A55A 4EX5A 3RR5A 5ISRA 4D2KA 3NTIA 3I3CA 2F3WA 2WDTB 1U5KA 3AE4B 1R4NI 1RTNA 5F2DA 3J81L 3UE1A 4L5SA 2BB5A 1ZEQX 2IJ0A 3JAME 4MTKA 1KQSA 3V3XA 4AUQC 2B2WA 5KGUA 3A56A 3H0GG 1V81A 1HA6A 1LTID 1PTOB 3GTGH 2BB6A 5BO4B 1BT0A 2IDYA 1CM9A 1QOHA 1F0ZA 2R6GA 5C1ZA 2KHWB 2PNHA 1D5ZC 2Z6BA 2ZPYA 2NN6H 1EEFD 1ET9A 3CCEA 5DPRA 2ZJPA 3V2TA 2AMCB 4IJHA 2KCTA 1STHA 4OEMB 5EAYA 3UDGA 5FR6A 1B70B 1PFSA 1E8XA 1A5RA 1V9JA 4DV5Q 1WJNA 1WGKA 4DHJD 5IYDH 4HKZE 3U52E 1FRDA 3J80E 1T3QA 2BKFA 1FXTB 4EOYA 1HZCA 2NN6I 4RWSC 3J7YW 1Z47A 4YT0B 4B3MQ 4LMQD 4LFAL 4EQPA 3APFA 3BZKA 4CO7A 1B2TA 1WYWB 1DOXA 2Y5BB 1QVCA 2XK5B 3MAQA 1I3QB 3VR4A 2N0SB 3R8BA 4KV2A 3SGIA 4ZKCB 1A2UA 1ENCA 1C79A 1WRIA 1PRTC 4JBWA 3W9CB 1EF1A 2F0GA 4L8JA 3CQZH 4KKTA 1EY7A 4A3BG 4GN1A 1BKBA 4FA6A 1X56A 2EY6A 4N8FA 3NEMA 2A74C 3TBLD 2ATWA 3SK4A 3Q23A 4MH0E 4WH4A 3ERSX 1EWYC 2RQXA 2AEHA 1E7UA 2KVRA 1CKOA 2XK5A 2JN4A 1A62A 4G4KA 2WXQA 3VXWA 3S16H 4LFCL 4DR1L 1SMYD 2E2HH 1N33Q 2VXWA 2HHHL 2J0KA 3UQBA 3QA8A 1KRTA 4C00A 4U673 3OJ3A 1Q1EA 2K8BA 3T1HQ 1XLPA 3E9IA 3MHZA 3NS1A 4CHTB 2ASBA 2F0DA 1CSPA 2JZ3B 1YNJD 1IBLL 2OTJA 4HKQA 3KJPA 1PRTB 1AP0A 2MFIA 4X64L 2IO2B 1WXAA 4BZAA 1H95A 2WAQB 3AEAB 3APCA 1QUQB 4M02A 2MP1A 4JYAQ 3CCUA 2AQ1B 4GDKB 2QW7A 1PH5A 3Q6BA 3NP8A 2WXNA 3HZXA 3ITPA 5IT9E 2JJQA 3L13A 3HGBA 1V1PB 1PH1A 1ZUD2 3OW7A 4XQNA 4ZDVA 1AFPA 3J7AV 2O6VB 1SNPA 1CI3M 4NQLB 1BXTA 3M4PA 1DOLA 2D10A 2HT1A 2FBWB 2XNAC 5M3FH 4DR3L 1G6PA 1HQRD 4W9DA 3HOWG 3EVQA 1EFID 1CKMA 2F0SA 4JI8Q 5C4JH 2UUCL 1IYVA 3HOYB 3NENA 5EBCA 2JA8H 4BY7B 3FDTA 1GUAB 2C35B 1MVKA 3H9DA 5H8YE 4IJLA 1R4NB 1HH2P 4GDKA 4MGYE 1U4MA 4X3UA 2KQSA 2B63G 4GGQA 3CMMB 1FGBD 1JOOA 1V1PA 2WGSA 2TMPA 1JROA 1PV4A 1NNXA 3GTMB 2R7ZB 3HKSA 1FO4A 2O6VA 2MA9B 3RUIB 5LL6S 1SYDA 1XWEA 4OVZA 1UE6A 5C3EH 5A2QL 5JHAA 1JB3A 2PPBC 4UP7A 1T5EA 1QKZA 1XLNA 2N9LA 5JZEB 2FFKB 1EU4A 2IO0B 3G48A 3MFGA 3D3RA 1F2LA 3MZ5A 1XTCD 5J22A 4JG2A 4DV7L 4OX9L 1GHJA 2IX3A 2NMQA 3KBGA 3DBRI 1GNUA 4TQ0A 5JHBA 4KJNA 2J52A 3OMCA 1QILA 1VQ8A 4M00A 1D1IA 4URKA 1HR0L 4NAMA 4W9GA 2WDVB 4US9A 3AE1B 5BMGA 4AWJA 5GAEC 1ROEA 1I4PA 2N9PC 4MH8A 3SR6A 5CV7A 2FNJB 5AUKA 5TR5A 4UP9A 4FXDA 2EYHA 4FJVB 4YSZB 3VDYA 3P4PB 2M4NA 2KOXA 4WWPA 3J9CA 1U4AA 4FF3A 1TS4A 2UXDQ 2V9HA 2ON8A 1JJGA 3B08A 2WU5B 3HHMA 1K83H 3JAML 3S1QH 1QVFA 2NZOA 3AE7B 4GLVB 3GTLB 2F0WA 1A6XA 1VQMA 4QGUA 4ILWA 4H7BA 4J15A 2CHWA 2QGQA 5CYUA 1CHQD 3I70A 4JI6L 2KD0A 2Z1CA 1OQQA 4WWOA 5GAHC 2JA5B 1FFUA 3RNAC 4L2YA 4HIDA 5C44G 3G4SA 2K5NA 4WJ4A 1GKHA 1F9SA 1TR5A 4FNFA 5J1ZA 5JJIA 1WGHA 3I57A 3RN2A 2XWBB 3OWEB 2R7FA 4DUYL 3RULA 1VQBA 3IBEA 4HR7B 4IN3A 2DLBA 3HRDD 3NVZA 1N6ZA 2Q2IA 4FF2A 4JI2L 1N34L 3R3OA 3J80L 1BBUA 5IY0A 3LX0A 3AXCA 1V6EA 2WDRB 2X6GA 4AYBE 2WXMA 3M4QA 2BS4B 2KO3A 4JQWC 3DM3A 3I72A 2PI2E 1WTOA 3K57A 1YNXA 1PH4A 3F2BA 5HFYA 4GB9A 1I6VC 3DPDA 4TKNA 3VUWA 3FKIH 2QEJC 3ZJUA 4HPPA 2B8GA 2AWTA 1STGA 3WAMA 2WXLA 3B6YA 2HTME 2NZHA 5K36G 1AH9A 1GAQB 3QHTA 1KH0A 4OZBA 1K8MA 1DOKA 3ALBA 2B3GA 3RZDB 2CJNA 3RNGC 1QOFA 1NDDA 1IXRA 3TP6A 3GTQB 5I2YA 2JA7G 2HJ8A 2Z6KC 1LXDA 3A7LA 3GTPH 1KL9A 2ZJQA 2M56B 4NXMQ 2D3BA 4F7XA 1KHIA 3WOFA 3CXCA 4AYBG 4RGOS 2WQYB 1Y1VH 2IYDB 1H9MA 1RKNA 1WWTA 1M90C 3QCAA 2G9DA 2XRQD 2NTTA 3AEVA 2FIFA 2KDIA 4M8NA 3KQ4A 4KHPL 1X55A 3LB8C
chains in the Genus database with same CATH topology
4OO1I 2Q8TA 2H1EA 2AWOA 1DCZA 5EJWA 5FO9B 2I46A 1HRJA 5JVG3 2R3ZA 1H9RA 1WTWA 2EYMA 3CU7A 2AUKA 1TWGB 4CKBA 1IKLA 2KWDA 3QG1A 1R4QB 3A8JE 5D3DA 5EBDA 4ZK9B 1FM0D 1TY2A 1N61A 2B2YC 5IT9L 1JALA 3FPPA 1TVXA 3Q8CA 3LXFA 2NVQB 2RMMA 1RCVD 5ELFA 1CT1D 2F0QA 4R9WA 2KHSA 2R92B 1SSOA 2QSDA 4A3FB 1TS3A 3RD4A 3C1EA 4KV6A 3SE0A 3NUCA 1E6EB 1PFMA 1U4PA 2VNUD 1J7BA 3ETRA 3K5MA 3W2DA 3DWGC 4KGSA 4HEA1 2RKSA 2QF7A 1SE4A 1PYWD 4OHJA 1RYJA 3S1QB 1EQVA 2L0CA 1CTMA 4DK1A 3E56A 1NENB 3IL8A 3NPPA 1ACCA 1HZ5A 2B2VC 3K7AB 4WURA 4F88A 1NVID 1Y1WB 4KGRA 5K5PA 2KEEA 4L23A 2H88B 3VYUA 3SFEB 4IKGA 1EM7A 1OXXK 2ID0A 2JQRB 1V8QA 1JMLA 3VRBB 5I2XA 2EDGA 3PUYA 4HEDA 2B2YA 4HMJA 3IAS1 4ZRZA 4KY7A 1KNEA 1ZXHA 3FVQA 3U9OA 3Q8AA 2LFIA 2OT2A 3EUB2 5I6WA 3D6WA 5HI1A 2QIEB 1TIID 3OSOA 1VRAB 3IFTA 1FCCC 2FMMA 2RSOA 3VRAB 1QE6A 1KRHA 4P16A 1Q12A 3PIO3 2BE5C 3J7AF 3MP9A 1RM6C 5D14A 3P7JA 2FE8A 1Z6HA 2LS01 1S4ZA 4LK1C 4QUFA 1DGJA 3H91A 3MJ5A 3MHBA 5CBAE 1VMPA 2KOLA 2J7ZA 4A3MB 2IWHA 2B2VA 1L0VB 1LABA 3FEWX 4A90A 5JEAH 1HXYD 1EIGA 2NYZD 5E1FA 1LTBD 5C6AA 1L6VA 5H92C 3QO2A 3PUWA 2F0TA 1YN4A 4R8IA 4RKBA 1JE4A 3P63A 2X69A 1B53A 2A73B 3QWNA 4EQNA 2A6ED 2K5QA 1D2BA 1EWHA 3H0GB 1CZGA 1T5XD 3W5UB 5FR3A 5JXVA 1PDXA 1EY8A 1QG7A 4B08A 4BA1I 2HDEA 5JJZA 2KQ3A 1VF7A 4HCEA 2KMMA 3NBHA 4KHZA 1FMAD 4QMGA 4FF1A 3S1RB 2PVGC 1N62A 4NZLB 3FPUB 2QJLA 1VZ8A 1I4XA 1TZOA 1AN8A 5HG2A 1L6UA 4LTUA 2FUG1 1ZYRD 5T8IA 1SNMA 4FXCA 3NXWA 2QDBA 1QLBB 3T3NA 1JC7A 1KABA 3HVZA 1PTOD 2PQEA 3I4MB 5EE1A 3WOEA 1L0XB 4B9XA 1H9SB 5G5GA 2BCOA 4RKLA 3RLFA 3U7ZA 3LNNA 1BF4A 3SXHA 1JWSD 5EGTA 3SEBA 5EKLA 2HQEA 4M0WA 3NHHA 5D65A 1C8CA 2E2IB 2E75C 3D4DA 3DWAA 5EPKA 4DAYA 1STYA 4XWWA 1ZE3D 4QB4A 4TMAB 4KKUA 1BUVT 1MPEA 4NKLA 1SJHD 2EYJA 2C5CA 3C3LA 3TZUA 4O1NA 2K01A 2L83A 2Y5PA 4RHSA 2FINB 5JVH3 3AM9A 3GTJB 4ME5A 3TN2A 2JYTA 1BBXC 1F77A 1PZID 2F0HA 3HOWB 4C7YA 3AEEB 1PTOF 1E2VA 1LTSD 5IODA 2NVTB 3LWEA 2AUJD 2XRSD 1WTVA 1GUGA 2B63B 3GTOB 2OEDA 2SNSA 3RPFC 1PZKD 1QOAA 1PRTD 2E74C 4X3TA 1SEBD 3ZGZA 1CFMA 4ZKBB 2XSCA 1CA6A 3I90A 2CHBD 2L9HA 2PLPA 1YMHE 4KJOA 3ERQA 2BDOA 1AZPA 2ICIA 5IGEA 3KUPA 2EYFA 3VYTA 1TU2B 2QILA 2INNE 3C46A 4H13C 2RSNA 4X3SA 3L9AX 5IOCA 4KY6A 1E0BA 2K32A 3T51B 2WXKA 4ZUIA 2W82A 2RA4A 1X32A 1F2MA 1SFOB 2Q5WD 3MEHA 3GV6A 4XWTA 3EJIA 4GZYC 2L4NA 1BCPC 5EE9A 3AEGB 5C44B 1NCVA 4FP5D 5BYRA 2V4DA 3S1MB 3MA2B 3E0JA 3S2HB 1OXTA 3GS2A 2BOSA 5BMIA 3T53B 2E2JB 1PRTF 3BS1A 1RODA 3BG3A 1DM0B 4IZ8A 2WXIA 2QCPX 5E4XA 5IGGA 2JYOA 1ZOYB 3P75A 3X3NA 4B0MA 2SEBD 1PZJD 1RWSA 2E6XA 1ESFA 1X3PA 1F2YA 1YN5A 1H9KA 4K2KA 5KRUA 3GD7A 2XVSA 4O42A 1IYUA 3V05A 2JA7B 2V4IB 2EYLA 4I65A 2V3NA 4AYBB 4HTHA 2CW0C 2MJEA 4L1BA 1K51A 1KDCA 2PNRC 2K1BA 2A69D 3KBXA 1B4OA 1NYRA 4NAWB 3PV0A 2Z4IA 1W6JA 2CU3A 2YEPB 3E6ZX 1XYIA 2W3SA 1NEKB 2L55A 2EYOA 4XXEA 1AEXA 3DM1A 1RF2D 3MXPA 2INPE 3P1HA 5J39A 4Q5VA 2HCIA 1VF5C 2JXMB 1CQVA 1VDVA 4C3HG 4A3KB 3Q8FA 3Q69A 3K5OA 4R3DA 1F2ZA 4K5VA 2BS2B 3KLSX 1FD6A 2F0IA 1FD7D 5IGBA 2KQ4X 1T6BX 4F8MA 3AB9A 2M00A 2LJIA 5JPNC 3BZDB 3IKJA 1O7ZA 4C1NI 5C4HA 2OF1A 2JEAI 4RH6A 4FO2A 1TY0A 1RJTA 3T56B 1HHVA 1DJRD 1VCIA 2DY8A 1ZDXA 1HTLD 1QB5D 3HUIA 4L63B 3T16A 3RUZA 3TUOA 1WTQA 1O78A 3LWUA 1A3VA 2RDFA 4DGZA 4BBRB 4F87A 3TP8A 1P7FA 3NE5B 5T1IA 1PFNA 3M85A 3N9YC 4JWSC 1ZKOA 1D4BA 1AWDA 1EZ8A 5E4WC 4I7ZC 5HURA 1WTRA 1HA5A 3IT6B 1SYFA 4KN7C 2JU6X 1BQQT 2BBCA 1SF0A 1ET6A 2XWJB 1TKGA 1D5XC 1HQMC 2TSSA 4ZRQA 1C4PA 4PMCA 1MI0A 3MWYW 2NTSA 1OFFA 4DFAA 2M0AA 2PKOA 2NB0A 2PZUA 1DOIA 1O7YA 2MGSA 1GUWA 4A93B 4FYDA 2L11A 2NBFA 3D4WA 1ZXIA 3P4QB 4XQJA 1FNVA 4FXGC 4NJCA 1NR2A 2PO4A 5JEAG 2WKDA 3OWFA 4AQ7A 1Y8PB 2EKIA 5FOBB 3AEFB 4CQNA 2NUCA 4WORA 4YTNB 4DXFA 3GTGB 4QCLA 1XF5L 1W6KA 2N88A 1PFDA 1GUOA 1O7LA 1V8CA 5BN3A 3ND8A 2MJ3A 3GV3A 1UWMA 4RCOA 2PIAA 2VB3X 4FVMA 1II3A 4IQZA 1FFVA 5FO8B 3IAM1 1S5CD 3MFYA 1YN3A 1XLOA 4MT5A 1SSNA 2W55A 4MN3A 1I4GA 1GOZA 1ZP0B 5AUIA 3LYYA 1STEA 4RCNA 4YWGG 1FCLA 4N59A 2R61A 3A8KE 1IGDA 3CQZB 4KMUC 4L6TB 2I07B 3K5NA 4IFDH 1JQYD 2HDMA 4HAEA 3BVGA 5C0XH 1LT5D 2K33A 1LTRD 5COYA 4YSYB 4RAUC 2PMVA 2D62A 3S16B 3AN1A 2F03A 2E2HB 2EY2A 2ONQA 4DA2A 4A9AA 5TSSA 3HP3A 2SDFA 3FMCA 4M8AA 3P4SB 4UDUC 4ZYSA 2IGGA 4J8QA 1EY4A 1JRPA 1KAAA 2Q8IB 4NMZA 3SR1A 5BN4A 2KUMA 1K53A 1C9FA 4ZRPA 2V3PA 2PYKA 5JOBA 1GUSA 2F0OA 1LV9A 5T1GA 3DWMA 5DNFA 3A7AB 1QQRA 1HTPA 1V1OA 1X3QA 3H8HA 3TEXA 3GP7A 1A15A 2XIWA 2RDHA 5M3FB 1F9PA 3F2UA 2XN9C 1VLBA 5C4JB 1AZQA 3NQIA 2JA8B 1STNA 3AE8B 4IALA 2Z8LA 5CV5A 2F0NA 3W3AA 1FXIA 4ZHOA 2B2UC 5AFWA 3QOJA 3URYA 3K0YA 1J7CA 3Q6SA 3TEWA 1JWMD 5KNBA 1SMYC 1GB4A 1L5PA 1EY6A 2EJMA 2EY1A 5KIXA 5C3EB 1FNUA 1TS5A 2F0EA 4DAVA 1N5XA 3T4AC 2A6HC 2BDNA 4WRDA 3UI2A 2K5DA 4WJWA 1MSHA 3D4RA 1JWUD 5C3XA 3M7GA 4C3JG 2C9OA 4OIKA 3NSWA 2EJGC 3BDCA 1OQRA 1IW7C 2ZW1A 1QOGA 3OPOA 2K22A 3NRZA 4C1NK 1K83B 3PUZA 2J53A 2JX5A 1EY0A 3N6RA 3P1MA 2OXPA 1PUTA 1GB1A 1PMRA 1SJED 3Q0AA 3E9SA 5EKIA 3DWQA 1Y8NB 2LUMA 3H6MA 4PMWA 3M7NA 4AS1A 1F9QA 1YNND 2IGDA 4IURA 2JE6I 2AX5A 4ZAIA 4ABNA 4EE2A 4FXKC 1RHPA 3IXSA 3FKIB 3VR8B 5CV6A 2VZKB 1HFNA 3L3OC 4OW0A 5IIFA 1GPXA 1EIHA 1UUPA 4N9TA 1U4RA 1LTTD 2K9XA 3TDQA 1Y69U 2EVBA 3GTPB 4KHVA 1NYQA 1FXAA 1Y1VB 3GO5A 1A3UA 2DNCA 3NVYA 4K8JA 2PCFB 3PO2B 4A8XC 2K3UA 4KD4A 5CORA 4TSSA 4BBSB 4K14A 1QNKA 1DZ1A 4QIWB 3A55A 2K03A 1KLUD 4PQXA 2MH7A 3AH7A 4HN7A 3VR5A 4A6QA 1XEEA 5ELCA 2CJOA 1QCBD 1GUTA 2M19A 2GA4B 5ELBA 4JWUC 1TWHB 4IUQA 4E6IA 2WU2B 5KYIA 1SE3A 1STBA 5EKKA 3S17B 3FILB 4C3HB 5KNDA 3SK5A 1ENAA 2KACA 1LO5D 1E2ZA 1ILQA 2F1MA 1D6EC 2ZW0A 3MC0B 2YYZA 4ZHPA 1K50A 4DXGA 3K5LA 2HDLA 2MJ8A 4V190 2EZVA 2N7JA 4A3JB 4GLSC 1HPCA 2EY5A 3Q8BA 4P6VF 2L32A 4HSPA 1OO9B 3FILA 4US8A 2NVYB 1QWYA 3AE6B 2NVXB 5M9OA 2WP8J 1PGBA 2BW2A 1JW9D 2EELA 4A3BB 4QF4A 1TS2A 1Q90A 2FMCA 3PZ7A 2PW9A 1G2SA 3EQLC 1OXSC 1BCPF 1MI2A 2F0JA 4XDDA 4ULLA 1C4QA 3MXUA 3AB5A 3ZJVA 3TP5A 4N6EB 1DOYA 1FYCA 2MJDA 2BTEA 3GTKB 1H9SA 1SB3C 1JORA 2R93B 1KF6B 2JXTA 3VA7A 1JCKB 1KDBA 3VYRA 2YEPF 4JX1C 2L1AA 1Q3LA 1SYBA 1VZ6A 5CV8A 1FR3A 1C77A 4JE3B 2WXFA 5M5XB 1NUCA 5FKAC 3BK2A 2WKCA 3CIRB 4TRDA 1EYDA 4PMBA 1SAPA 3MXNA 2WXRA 2BT6A 1C48A 3AE3B 4LK0M 4WAFA 3CRLC 3DMUA 3FRPB 4KGTA 4K5XA 1P7EA 4HJGE 1HZ6A 2K04A 4MIUA 2E2DC 1DONA 1NAPA 1PTOH 1QNUA 5D7GA 4RF0A 3SFDB 1TWAB 2SAKA 3BYTB 5EE0A 3RZOB 1CJEA 2WV6D 2VB2X 2N55A 3PIP3 3OOCA 3NTKA 2HCCA 1DD2A 4XYOA 2K5PA 4LLGM 2ZXRA 4DNRB 3IFDA 4N9PA 1EU3A 2M2LA 1CA5A 1JWAD 1DOMA 3IAYA 4P2CB 5DM63 4IFDG 5CV9A 1KDAA 2SNMA 1WD1A 1UEAB 3HS0C 3AE2B 2WACA 1IUEA 5C0XG 4IUUA 3QIAA 1K52A 3RMHA 3BVZA 2OHFA 5BN5A 1SXTA 5C3WA 3BWUD 4XIGS 2DNEA 1GHKA 1U4LA 1I50B 2F4IA 4WFN3 1BCPB 3DEOA 2WLBA 2B2WC 1I4HA 2KCCA 1B9MA 1L0YB 4H2AA 1WTPA 4ODGA 2KN4A 4ID6A 4KD3A 2GI9A 3E5SA 3P20A 4CBVA 1WVLA 2PW7A 5I9PA 1B3AA 4RA8A 2BA1A 1ZYRC 2D5DA 2F0MA 1R9TB 1EZ6A 2A68C 1LLRD 4DF7A 3M4OB 3PUXA 2BS3B 5KYLA 2WS3B 3C1FA 5M5WB 2GRIA 4OL7A 4DAPA 4RNAA 3I9V1 1DXMA 3D31A 5JEAJ 2KECA 2DYOA 3DHQA 1QF6A 1AW7A 3QOLA 1QJOA 1A2TA 1VJKA 4MM3B 4HMIA 4DU9A 3FAHA 1IKMA 4IUNA 3CHBD 3TBIB 5BYSA 1PXUA 3ZYYX 1M8AA 1JWBD 4YIJA 4CKCA 4EGVA 1B44D 2H89B 1LT4D 1N60A 3QB3A 1CK1A 5LHY1 2L5TA 3NTHA 2FHTA 2LEKA 2I2YA 3H09A 4MHEA 4IUTA 2K0PA 1ICWA 1BOSA 2Y3AA 3P42A 4C3JB 4HROA 3S15B 2WP9B 1TJEA 3VR9B 2EPBA 5I6YA 2RPVA 4RHRA 5KNCA 3Q24A 1R4PB 2WB1B 1EY9A 3NQTA 3PMFA 4J1MA 3CRKC 1EY5A 1YNTE 4J3OD 2B76B 1RTOA 2F0UA 1B1ZA 2F0LA 1C4CA 1E7PB 4DQOC 5IGDA 4C3IG 3BDOA 1J8IA 1HFGA 2LKVA 2ZXOA 2DN8A 5HGTA 1EWCA 3HEJA 1BO0A 1VMCA 4OGQC 2IGHA 3A54A 1CZWA 4IDIA 3DEPA 2WIIB 1WTXA 4TQ1A 2IX0A 3C2PA 1E0ZA 3Q8EA 1F2RI 3PO0A 2KDMA 1EL0A 1TWFB 4UAIA 5FO7B 5KEEA 2WINB 2YU9B 5CV4A 1NR4A 4MACA 4K6DA 4DK0A 3WDNA 3O13A 2IX1A 4A3DB 1WYGA 2PTLA 4X3KA 3KWLA 4GDLB 3HRZC 1UWXA 4R8NA 5IGFA 1BR9A 3UI3A 5ELDA 2A6HD 1RFKA 3HOUB 5G5HA 1JICA 1AYFA 3BYYB 3VR2A 1CZPA 1ML0D 3H94A 3W5VB 2LHDA 1HEZE 1I6HB 4B0EA 3KWVA 4XDCA 5G3LD 4ZUJA 1IW7D 2EXZA 1C4AA 1SIJA 5NUCA 3HKZB 1R7SA 2VZKD 4ZOHC 2PMZB 3EFXD 1XCQL 2KEDA 4K2LA 1RDPD 4BY1B 4A3EB 4QUCA 4REZA 1XCTL 1NI3A 4S3SA 2JSOA 3AU7A 2F0KA 5A35A 2KVMA 3I73A 4RF1A 1SNOA 3I91A 3FC4A 4CJ2C 2K05A 3B2GA 4IOIE 3HG9A 2A5HA 4KY5A 1F2RC 2EOTA 1G91A 2JEBI 1S5BD 3VA5A 4CKEA 2EE1A 1PLFA 5CMDA 2AWNA 1PGXA 4BWGB 4ITKA 2LHEA 2W3RA 1K8OA 1PFBA 2A69C 2K7VA 3K58A 2MUYA 1TKWB 5G3LF 2IW3A 2BE5D 1J7AA 5CBEE 2ICEC 1A3TA 1N63A 2IPKD 4ARIA 1TQOA 4Z9CB 3C8YA 2E76C 2JP1A 4NW2A 5DAUA 1NSNS 3NVVA 5C2TB 1ZPSA 1MD2D 2IT1A 4IFDI 4XT3B 2X38A 4ZLTF 1STAA 1PDQA 3S2DB 5C0XI 3MTSA 3TZDA 4KTAA 4XT1B 4XTCS 1GJXA 2LY7A 3ND9A 1LT3D 5C4ZA 3IT4B 5GXGB 2RDGA 2ENBA 3OIQA 2K6AA 1RD9D 1LACA 5E3FA 4Y7NB 3VQIA 1CQFA 2B39A 2AQ3B 3B2FA 2G1EA 2IL8A 4HRSA 2EJFC 4EQOA 3R2IA 1EYAA 1E9MA 1IGCA 2NWGA 1J9OA 4OO1H 1QT9A 4G7ZC 1FIQA 1SE2A 2L12A 3S9WA 1OXUA 2SOBA 5EPLA 1HUNA 1TT2A 3ZJTA 2KA7A 2L1BA 1SYGA 3PZ8A 5BYQA 1S5ED 3PO3B 4NP5A 5M3MB 4A3IB 4USAA 3OMGA 1YNJC 4RGMA 1B50A 3NK9A 4PNYA 2PZWA 1YQ3B 3ONAB 1JR0D 4C7ZA 4Q0FA 4N58A 3S1NB 4YTMB 2NZ1D 3A8IE 2FJ2A 1L4DB 5HHDG 4KN4C 4DNTB 2JA6B 3W1SA 3TEYA 1TKEA 1EEID 3ABVB 1BMLC 3SVMA 3D6CA 5DEHA 1MSGA 2G9HD 2MHVA 2ZXPA 1YQ4B 4H0LC 3HVDA 1EQTA 2ACZB 5C3JB 3K6OA 2D9UA 1I4RA 4NDXA 3I8ZA 3AV8A 5JAVA 2B2UA 2DBYA 2Z4HA 4KK7A 3T13A 4U68A 3M4YA 4IUPA 1F9RA 1KNAA 4LAAA 3AEDB 1TKYA 3HOZB 1Q1BA 2MPMA 1C78A 4G7HC 3NZ3A 2O5IC 1XX8A 1ONLA 2L52A 4PV1C 2D5GA 1E2WA 1SBBB 4G7OC 5D3IB 1KFYB 5EQ0A 3D8GA 2LMCB 1FEHA 1M4VA 1UAPA 1MGSA 4XDXA 1A70A 3N52A 5IGCA 3OHXC 3I4LA 2KCNA 4KKSA 3AECB 1SNDA 4RFBA 2HUGA 4CJ1B 3WCQA 4KKIA 5C5MA 5JPMC 3S14B 3KF8A 2WXHA 3NUHB 3EGRA 2LMCA 3BK1A 3BVMA 4IUVA 4KX6B 3BIID 3ZQ4A 2O4XA 4JK1C 1TWCB 2K28A 3OIPA 2B2TC 1B9RA 1DYQA 1Q10A 4DN4M 1TYGB 5C5LA 3U2SC 1L4ZB 1S5FD 2Y0SB 2RBMA 2PW5A 2WXJA 4YXDB 1BCPD 5MPOA 2WXPA 2AQ2B 2RVLA 2DY7A 4FF4A 5M5YB 3VYSA 1V43A 1ZXTA 2F3VA 1WD0A 3I4NB 4H44C 2LFNA 3L4PA 4EVOA 4HCSA 5E6JA 5DM73 1G6ZA 5BMHA 4HSVA 3Q22A 2I38A 1MHHE 1YJIA 3SK6A 1FRRA 4XYQA 3K59A 3DUZA 1FNWA 2NN6G 3AMUA 2KJXA 3H3VC 3RFZB 1SYCA 2J0TD 1SNCA 1SNQA 5FLXE 1G8ZD 5CR3A 2OEOA 2B2TA 4IFDJ 2CW0D 2GB1A 3PUVA 4C3IB 3TEZA 4LJZC 1HCZA 3EROA 1Z7TA 2A68D 5C0XJ 4CJ0B 3DWPA 3MXGA 2PZTA 4G57A 2B8FA 4M1UB 1BDOA 2V0GA 1LT6D 1S5DD 1ZDVA 1MHXA 1WSPA 4ZQ3A 3EA6A 2WXOA 2QMTA 3DXJC 1I7HA 1UNSA 5I9OA 2BA0A 2CVRA 1PGAA 3V96A 4ARCA 2X6LA 5LNK1 2E3TA 4BA2I 4WWMA 5K36H 3NWTA 2W54A 4J6HA 4K6LA 3AE5B 5FK9C 1WXQA 3U4EG 1XXGA 3AE9B 1IL8A 5CC4A 4JPSA 1YJJA 3J81E 2N9KA 1WCMB 1IHZA 2WXGA 5C4XB 4CGYB 1OXVA 1ESRA 1VZ7A 4K8IA 2KAJA 2JWUA 3AEBB 3T3OA 4Q2JA 2JZPA 3SHLA 3G7LA 1YNNC 4B9WA 2EYPA 1UGJA 3TP7A 1O80A 3BDLA 1U9RA 5CGKA 3VR6A 1G291 3HOVB 4K5WA 3CKIB 1Y56A 2Y5CA 2O5JC 2Q8RE 3QJYA 1B9NA 1KLGD 2DYMA 4OZAA 3P4RB 3L7ZC 3SK8A 4WIPA 1D5MC 5LL6X 1BUIC 1KTKA 1IBXB 1E10A 2DWQA 4V0BA 5EPJA 2F0FA 2H4OA 4XQQA 4BS9A 2BYTA 1ILPA 2D2CC 1GXDC 1D1KA 3VR3A 1JOKA 5EE3A 1ENFA 2PVOD 1Y8OB 3X3MA 3NWSA 2CQAA 3HOXB 2A6EC 3SDZA 2JSVX 2F0VA 1VDZA 1Q8IA 2JYEA 4A3GB 1G2TA 5ELEA 4OIJA 1GUNA 3KK7A 1IBXA 3GQBA 1JQ4A 3G6JB 1BNZA 3CWIA 2MEKA 1SYEA 4RGNA 3B9JA 1N5WA 2O2LD 3AMZA 4C80A 5FLXL 4YTPB 2WNMA 1CHPD 4WQMA 4RGTA 2J42A 4TQUS 5I4DA 3M3YB 2M9VA 2ZT9C 4YSXB 3U9SA 3TSSA 2VUMB 3KLRA 1MBYA 4OZCA 1LTAD 3KLSA 1HUMA 1SDFA 2J4XA 3MVVA 3R2TA 4XE0A 1H9JA 4C2MB 4OO1G 4TKOB 1EYCA 3R93A 4C56C 2WDQB 3NBIA 3TMEA 1C76A 1PTOC 1V97A 5A2QE 2F0PA 1XLQA 1XO3A 1LTGD 4KKJA 2K5WA 3NVWA 1I4QA 2QKIC 2LGIA 1QOBA 1JOQA 4KI0A 1VR9A 1EOTA 4A55A 5ISRA 4D2KA 3NTIA 3I3CA 2F3WA 3AE4B 1RTNA 5F2DA 3J81L 2BB5A 1ZEQX 2IJ0A 3JAME 3V3XA 2B2WA 5KGUA 3A56A 1HA6A 1LTID 1PTOB 2BB6A 2IDYA 1CM9A 1QOHA 1F0ZA 2R6GA 1D5ZC 2NN6H 1EEFD 1ET9A 3V2TA 1STHA 1WGKA 4HKZE 3U52E 1FRDA 3J80E 1T3QA 2NN6I 3J7YW 4RWSC 4YT0B 1Z47A 4LMQD 4EQPA 1B2TA 1DOXA 3MAQA 1I3QB 3VR4A 2N0SB 3R8BA 4ZKCB 1A2UA 1ENCA 1C79A 1WRIA 1PRTC 4JBWA 3W9CB 2F0GA 4L8JA 4KKTA 1EY7A 2EY6A 2A74C 3SK4A 3Q23A 4WH4A 1EWYC 2RQXA 4G4KA 2WXQA 1SMYD 2VXWA 4U673 1Q1EA 3MHZA 1XLPA 3NS1A 4CHTB 2F0DA 1YNJD 4HKQA 1PRTB 1AP0A 2WAQB 3AEAB 2MP1A 2AQ1B 4GDKB 3NP8A 2WXNA 3HZXA 3ITPA 5IT9E 3HGBA 1V1PB 1ZUD2 3OW7A 4XQNA 1AFPA 3J7AV 1SNPA 1CI3M 1BXTA 1DOLA 2FBWB 2XNAC 1HQRD 3EVQA 1EFID 2F0SA 1IYVA 3HOYB 5EBCA 4BY7B 1MVKA 3FDTA 5H8YE 1U4MA 4X3UA 1FGBD 1JOOA 1V1PA 2TMPA 1JROA 3GTMB 2R7ZB 1FO4A 5LL6S 1SYDA 1XWEA 4OVZA 5A2QL 1JB3A 2PPBC 1XLNA 1T5EA 1QKZA 2N9LA 2FFKB 1EU4A 3MFGA 3D3RA 1F2LA 3MZ5A 1XTCD 5J22A 2NMQA 1GHJA 2IX3A 4TQ0A 3KBGA 4KJNA 2J52A 3OMCA 1QILA 1D1IA 4NAMA 2WDVB 4US9A 3AE1B 5BMGA 1ROEA 1I4PA 4MH8A 3SR6A 5CV7A 5AUKA 4FXDA 2EYHA 4YSZB 3P4PB 3J9CA 4FF3A 1TS4A 2ON8A 2WU5B 3JAML 3AE7B 3GTLB 2F0WA 1A6XA