5BMHA

Nitroxide spin labels in protein gb1: t44 mutant, crystal form b
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWCYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Rotameric preferences of a protein spin label at edge-strand beta-sheet sites.
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5bmhA00
4OZAA 4KGSA 3FILA 1HZ5A 2I2YA 4OZBA 1K52A 1YMHE 1MPEA 1XCTL 2ZW0A 2QMTA 4IOIE 2RPVA 1ZXHA 1Q10A 1PGBA 1MHHE 2N7JA 2QSDA 1P7FA 5HHDG 5BMGA 2ZW1A 1XF5L 2JSVX 2GB1A 5HG2A 1D4BA 4HKZE 4OZCA 1GB1A 4KGTA 1JMLA 2JU6X 4GLSC 1XCQL 2ONQA 1K51A 1FCLA 5JXVA 2PTLA 1IGCA 4IKGA 5BMIA 3V3XA 1F2RI 5BMHA 2N9KA 2I38A 2NMQA 5HI1A 2N9LA 1MI0A 2KQ4X 4MACA 2LUMA 1P7EA 1K50A 2KWDA 4HJGE 2KDMA 1K53A 2LGIA 2KACA 2ON8A 2JZPA 2J53A 1UWXA 1QKZA 2IGDA 4WH4A 1PGAA 3GB1A 4KGRA 1IGDA 1IBXB 3FILB 2JXTA 2OEDA 4D2KA 2IGGA 2K0PA 2LHEA 1MHXA 1GB4A 1FCCC 2RMMA 1IBXA 2LHDA 1EM7A 5HFYA 3UI3A 2JWUA 3MP9A 2PLPA 2KN4A 1F2RC 2IGHA 1PGXA 1FD6A 1KH0A 1C9FA 2EELA 2GI9A 1MVKA 1YNTE 2PW9A 1HEZE 1HZ6A 2J52A
chains in the Genus database with same CATH superfamily
1LXDA 2N9PC 4MGKE 2PVGC 3DDCB 1Q0WB 4NAWB 3V6EB 4J6IA 1WM2A 1WMHB 1N63A 2QHOA 4BBNC 4F7ZA 2FUG1 4F8CB 2RPVA 3Q6BA 1PFDA 4W9JA 2N7JA 4PYUA 1J7CA 1F1HA 2J0KA 1VCBA 3CWIA 3KVFB 1E9MA 1SEBD 2KDFB 2OHFA 3PV1A 3W5VB 5J2RA 1YIWA 3TEXA 3I57A 4GIVA 2EMTA 1XO3A 4B0MA 2PTLA 2RPQA 2NTSA 1F2RI 4C80A 3QA8A 1F77A 2KQ4X 1TZ1A 4MH0E 1KTKA 1WH3A 4DHZB 2LGIA 4IM3A 3KH0A 2YEPB 2WXFA 1N6ZA 3PS6A 1HQRD 2M1MA 1VZ6A 4LLGM 5LNK1 1DGJA 3AU5A 3BYTB 1L0YB 1FRDA 4AP4C 2LXCA 3HM6X 2WDVB 3AMZA 1YX5B 2K0PA 2KWUB 3UGBB 2X38A 3HHMA 1DOYA 1JWMD 3OWEB 3R3MA 1WE6A 2MBHA 1F9JA 1FXAA 4YTPB 1KLGD 4G50A 4GXBA 4P16A 3W1SA 3T8MA 4BFRA 4WIPA 1WFYA 1D6EC 4ANXA 4ZRQA 1V8CA 1WGHA 1RFAA 4GDLA 2KC2A 5EE9A 2V3NA 3RNBC 3DVNU 4OZAA 3PRZA 3ZKJC 1EF5A 2LVPA 3SFEB 2RDBC 1UELA 1YMHE 3V05A 3P2BA 3AECB 2H88B 3KW5B 4W9DA 1ZXHA 3EECA 2AYOB 1J19A 3MC0B 3LDZE 3CF6E 1N60A 3B9JA 2K8BA 5C23A 2JSVX 3R66C 4NJ7A 1FXIA 2K5PA 4ZDVA 3VR9B 4ZRPA 1P1AA 1FNVA 2XK5A 2V9HA 1P9DU 2GLSA 3B2GA 3JYUA 2K8CA 1TS5A 1HTQA 4RCOA 5FK9C 2B76B 1UBQA 4ZOHC 1UNSA 2KWDA 4HJGE 4LNFA 1F0ZA 2QCZA 2L83A 3APDA 2DYMA 4KSLC 1PGAA 5JHAA 2FCQA 4JGHB 1IGDA 1WX7A 3H7PA 3GE8C 2KFJA 2DLBA 3H8HA 3LJ3A 3PZDA 4II3B 3VAWA 1GB4A 1IBXA 3NVVA 4S17A 1QLBB 5HFYA 1EM7A 5MPOA 4DDID 1LO5D 3VXWA 4I6LB 2HTHA 2PLPA 2MCNB 2UU7A 2TSSA 2RDGA 3KYDD 3Q14C 4YSYB 1I4HA 2QJLA 1C4AA 4MEMA 3JVZX 4DWFA 2KJ6A 4W9HA 2XBBC 1Z2MA 3V61A 3RN9C 1LQBA 3ZW3A 2HE7A 2O6VB 4IUMB 4IWOA 2JYEA 1HZ5A 4X57B 4XE0A 1OQRA 3AE8B 3U7DA 3ZVVA 1MPEA 1NYRA 3IAM1 1AWDA 2L8JA 3DQVA 5TR5A 4KIKB 3TMPB 2GBMA 4K81A 2KK8A 1KLUD 3NY5A 1G6JA 3B08A 3QQ8B 1UZXB 1TZOA 1E8ZA 2WX1A 4W9GA 3SEBA 2N4FA 1FCLA 1I7HA 1YJ1A 5D3IB 4DHZE 5G5HA 3CIRB 2WQYB 2LMCA 3VRAB 4FN2A 2KX3A 1E7PB 3MHZA 4IM0A 1ZDVA 3AB5A 3ML9A 4RF1A 1MFWA 1P7EA 3P42A 1SXTA 4I6NB 4NQKE 2BYTA 4TQ1A 3PRMB 3PZ7A 1WR1A 4II2B 3WA0A 2ZVNA 2JXXA 2VH2A 5IA7A 2DAJA 3FC4A 2KD0A 1YX6B 3O13A 3DBHB 3P4RB 5AZFA 5FKAC 4YL8A 5DPWA 3CSTA 1I4XA 3L08A 3AE3B 3NHEB 5FR6A 1OFFA 5DPRA 2KN4A 1LM8B 3P63A 4NQLB 3EUB2 4WQOB 2MP2A 3I5JC 5J17A 2M0AA 4HDQA 4XWWA 1D5XC 4P1BC 2IBIB 4HWIB 2O6VD 3AEBB 1KLVA 1ZOYB 1XCTL 1EU4A 2KHWB 5LXHA 4IDIA 1QILA 3UQAA 2BWES 4FBJB 3NVYA 4AWJA 2NS5A 3NG0A 1SE2A 2HJ8A 4C7ZA 3IFWB 3L13A 1QOGA 4WAFA 5HG2A 4ICVA 4YTNB 4HEA1 3ZXRA 2WWZA 2JY6A 2WXPA 3H1UA 2WXNA 3UINB 1IGCA 3VH4B 4ICUA 2PE9A 1R7SA 2JT4B 2IO3B 3UIPB 3VQIA 2KDEB 4M01A 1L6VA 2GBNA 2BB6A 2KACA 3TEZA 4K3CA 3BZDB 4HKQA 3JW0X 3W5UB 1V1PA 1XLPA 2KKCA 3L0WB 3A9KB 2A5UA 3PGEA 1WRDB 1IP9A 1VLBA 4GDKA 4YXDB 2LVOA 3GS2A 4FJZA 2IDYA 2LHDA 4W9EA 3QWZB 3TCAA 3MFGA 2CKHB 2C9WB 5BYRA 1U4AA 1K8RB 1KF6B 3FAHA 1I4RA 4HRSA 4NZLB 3DOWA 4BKSA 1R4MI 2YVCA 3EHVA 1TGZB 1N61A 1S3SG 5JHBA 3ALBA 1AW7A 2J52A 2ZNVB 2KVZA 3BIID 1AYFA 2I2YA 2AQ1B 1D5ZC 1GJZA 1YN4A 1E90A 4W9IA 3EFUA 1XQQA 1P0RA 2X8XX 1L0VB 2Y5BB 1WXSA 1FO4A 3RMKC 1E8WA 2M56B 3RNCC 2FCSA 3A4RA 3NZSA 3Q69A 4WWOA 3BYYB 1EUVB 3SR6A 3DBLI 3P4QB 2XNAC 3DCGA 3AE4B 4ZHPA 1NENB 4LCDE 3GZNB 4IKGA 2ZCBA 3ZXVA 2W82A 2PE6B 2RD0A 1KOTA 4YSZB 2O2VB 3EGRA 3U2SC 2RSUA 3Q3OC 5TSSA 3WANA 3SFDB 1ZXIA 2Y5PA 1LGRA 1D3ZA 2L32A 1TS4A 2ON8A 4DXAB 2ZPYA 5H8YE 1J8CA 2D11A 2N9EB 2KLCA 4A9AA 3OJ4B 2JRHA 1V81A 4A20A 3W9CB 2M8SA 1WXMA 1XEEA 4N59A 1C1YB 2JXTA 3DWGC 2PIAA 4HVBA 2LGDA 1YD8U 2R2OA 3C8YA 1Q1OA 1AARA 4M8MA 1L4ZB 1PUTA 1GC6A 1D5MC 2MSED 4HPLB 3U7ZA 4JPSA 4IWPA 1WSPA 4FA6A 1RM6C 2JWZA 2KXJA 3Q3FA 3IVFA 3AEEB 5JZEB 2INCC 1RYJA 4M0WA 1I4PA 1CJEA 1JALA 2HDEA 3C0RB 2L05A 2MHJA 4CYEA 4LJPB 2BS2B 4AJWA 2LGXA 1JRPA 5L83A 1ZP0B 2ZCCA 5IAAC 3ZGZA 4GU2A 4A3PA 1WJ4A 4ACFA 4L23A 3Q8BA 1SJED 1L4DB 2ONQA 1V49A 2WDRB 2C60A 5AEKB 2CHZA 1WX9A 2MX2A 1WXAA 1I42A 3SHQA 2N9KA 3V62A 2N9LA 1MI0A 2HTME 3RI7C 4P7IA 3ML8A 2KT7A 4DXGA 3M3JA 4N58A 3PZ8A 3Q3JA 3JSVA 2RR9A 1NEKB 3ZNID 2EKEC 2WXRA 3U8ZA 3QK0A 4FHJA 4KVGB 2WXOA 2DHZA 4MGYE 1UGJA 2WXGA 2K22A 2N9XA 3UI3A 4GDLB 4WJPA 1F2RC 2JX5A 2E3TA 1Y8RC 4MDKE 3H6NA 4GSWA 1Q10A 2E6XA 3TEYA 2NBUA 1JWSD 1K52A 1WWTA 2NVUI 2ZW0A 1YN3A 1H4RA 3GP7A 3NZ3A 2VZKB 2J7QB 4IOIE 3I3TB 1EWYC 4RMAA 1EU3A 2BBCA 2QDFA 2FIFA 3AU4A 3C19A 2XK5B 2KVRA 2EMSA 3ZIMA 4ZYSA 1WF9A 4AJYB 3RZWC 1VR9A 2KMCA 3KUDB 1XCQL 4RM9A 3AEDB 4B9KA 1CMXB 1T0QC 4DXFA 1HA5A 2ZVOA 2KMAA 1WJ6A 1FPYA 5D7GA 4EEWA 4WJQA 5C3JB 2WXQA 4DK5A 2Z0EB 4M8NA 4DBGA 3URYA 3A33B 4TV3A 4FADA 1KM7A 1YJIA 3BVGA 1WJUA 4WJOA 2BYFA 3RFZB 1C4CA 4B0EA 3EC8A 1TT5B 3H7PB 4MGIE 4MSMB 3A9JA 5CHVC 1IBXB 2MA9B 1BT0A 4MH8A 1ACCA 3M63B 4D2KA 1VZ8A 2BYEA 4LK0M 3KQ4A 4OVVA 3WCQA 2G3QB 2HD5B 3ONSA 3AEAB 2JWUA 3O65B 3K9PB 2DYOA 4C00A 2MBEA 2RGFA 1V5OA 3Q8FA 2JUOA 2WX0A 1C9FA 1GG3A 2D07B 2WP9B 2FBWB 4B95A 2J4XA 4P1CC 1ET9A 2LD9A 2PW9A 4XYCA 2LI5A 4XDDA 2MJDA 3RPFC 5IKCM 4OVUA 3PTFC 2MQJA 1SF0A 1NI2A 2VZKD 1N5WA 5FR3A 2R2QA 2ZEQA 3P1MA 2MRPA 3DBHI 1PGBA 1MHHE 3PT2B 3OJ3A 2IPKD 5E6JA 3DHHC 3RNAC 5IN7A 4Q2JA 1WGGA 3NUHB 2VH1A 1E0ZA 4OZCA 1K51A 2D2QA 1TBEA 2XEWA 1FFVA 4G0NB 5EE3A 3V3XA 5AZHA 4C4VB 2Q5WD 4LDTB 1H8CA 4BOSC 2WHIA 2JQRB 4WJNA 3PSEB 2WXMA 1PQSA 3RCZA 3ZNHB 1MJDA 2BF8B 2JYTA 4CO7A 1E5WA 3QCAA 1ZE3D 2ICIA 2DZIA 1TS3A 1QQRA 2BVCA 3HVZA 3RUIB 3ZJUA 3VTUA 2PVOD 5CTRC 4ZYNA 3FILB 2GMIC 4TQ0A 4LNOA 3A1QA 4FHKA 1WYWB 2V0GA 4C4VA 4HLEA 2MP2B 1OGWA 3LXFA 2KDBA 3K9OB 4PT5A 2L52A 2L76A 2WXIA 3WAMA 2PEAA 1P98A 2GI9A 4JWUC 1ZGUB 3RT3B 1TY2A 1TIFA 4LJOB 3VTWA 1KFYB 4YSXB 2D10A 2LEKA 2WU2B 3T3NA 5E6NA 2AWTA 3FILA 4XGAB 4JQWC 1V2YA 2L3ZA 4USAA 1YQBA 1QF6A 1FIQA 1V86A 4ANUA 4MT5A 3DBRB 4A3OA 3GOEA 1UD7A 3PLUA 3QIJA 4IG7B 4KZ0A 2DZMA 1L2NA 2I1JA 4TSSA 4W9KA 1TKEA 2GB1A 4FJYA 3AN1A 2K25A 4ZRJA 2KNBA 4RNAA 3DHIC 3H9DA 3AEFB 2V1YA 2L1AA 2JU6X 1YJJA 4RFBA 2B3AA 2BT6A 3MC9A 3R7RA 4JX1C 4BVUC 2EKIA 5JXVA 3UF8A 1C76A 1T6BX 5G5GA 4LDTD 1TYGB 2MLBA 5BMHA 3U30A 2LGYA 3ZUNA 4PS7A 2LUMA 4LTUA 2IZVB 4ANWA 2K3UA 1V1PB 2QILA 4MSQB 4KX6B 2J53A 1UWXA 4AUQC 2DZJA 5AUKA 4DHJB 4GDKB 3GE3C 4L1BA 2LVQA 3Q8EA 2IO0B 4US8A 5IOIA 3GZNI 2BGFA 2RDHA 2WNMA 3T9LA 5KHQA 1A5RA 3VUXA 2KTFA 4FXCA 2BPSA 4AS1A 2V3SA 4M00A 2WXJA 1KH0A 1QT9A 5D6JB 1E7VA 4OHJA 3L4PA 2OOBB 4BKGA 4EZLA 4I6PA 4HCNB 1L6UA 5D94A 2IJ0A 3MHSD 1IYFA 2CJNA 4OVZA 2G4DB 2M19A 2QMTA 2KMMA 3RYTA 4N9F4 5EE1A 1JQ4A 5C2TB 3BVMA 1EWCA 4IW0A 2LRWA 2MJ3A 1JCKB 5H92C 2UYZB 4A90A 4MM3A 4K7WA 2ZJDA 5BMGA 1E6EB 4W9CA 3ZQ4A 4EZJA 3B2FA 3OG5A 3VFKA 2INPE 2L00B 4HKZE 4EFOA 3EA6A 1GB1A 2NBVB 1B1ZA 3U4EG 1SE3A 3L54A 3ZTCA 2WDQB 3HRDD 5DPTA 2JZZA 4EE2A 2LXAA 3ZDMC 4EUTA 1ZW7A 2NMQA 4RGTA 1C78A 3VUWA 1XLNA 3AE2B 2LRUA 2QEJC 1V6EA 2BS3B 1MG4A 1I4QA 4JWSC 2YEPF 1C4PA 1QKZA 3MJ5A 4HROA 2FIDA 3HVDA 3V60A 4DHJD 2MBBB 3PRPB 2KLGA 4E74A 2UWQA 2Y5CA 3S2AA 1UBIA 1E10A 1FCCC 1ZPSA 1FNUA 2BW2A 2L0TA 2AX5A 1X1MA 2MBQA 1NI3A 3DBSA 1LFDA 4ZRKA 4BKSD 2DAFA 4WWMA 1JWBD 2KWVB 4FJVB 4M0WB 1PGXA 1WR6E 3AI5A 3CSFA 4BZAA 2D3GA 4BAXA 2MW5A 1M94A 2M17A 1XXGA 4KGSA 4WQMA 1V5TA 4OZBA 3IT6B 1WM3A 1Q5WB 3ZRCA 4KDIC 5AZGA 5LLIA 3TBLD 3VUYA 3HIZA 4XDCA 1OEYJ 2CU1A 3RZFA 1CQVA 4GB9A 3TUOA 3VH3B 4NY0A 4C56C 4RGNA 4M02A 1XF5L 4K1RB 3B1LX 5E6PA 4CHKA 1I4GA 2KYWA 1D4BA 2YLMA 1WX8A 1T0YA 2BKFA 4KGTA 4HDOA 4DDGD 2NCNA 1FEHA 2KAJA 4MJSA 1L5PA 4DQOC 3BINA 3BVZA 3AE7B 3IBEA 3Q2AC 4FLHA 3JSVB 2JF5A 5HI1A 4S0RA 1K50A 2KDMA 1K53A 1BMLC 3KLSX 3P4PB 2JZPA 2AQ3B 4WH4A 2KQ7A 2NBWB 1MG8A 2D3BA 1WIAA 1TKYA 4KGRA 1NBFC 3OAWA 2OJWA 1TTNA 4A55A 2ASQA 1R4NB 4F1SA 1ISNA 3W1YA 3MTNB 2BKRB 3PLVA 2W9NA 5GMVA 5JH5C 3DVGY 4JL9A 3IXSA 1V1OA 1GNUA 2DENB 2AQ2B 4BOZB 2AEHA 2DWQA 4JE3B 1T3QA 2PPHA 2JZ3B 5CX3A 4URKA 3V6CB 3QAQA 4E3CA 4BKTA 5HKHA 3DVNV 1UWMA 1ZKHA 3RD2A 3HUIA 1N5XA 4MGZE 2MEKA 1JROA 3AE1B 4G11A 1HXYD 2WXKA 2KJRA 5GXGB 4NAWA 4RGOS 5G2NA 2WU5B 4WWNA 1WMHA 2DYBA 2GOWA 1JWUD 1YOVB 2SEBD 4W9LA 3NRZA 2ACZB 3ZTDA 2KOXA 1TJEA 2KDIA 3NVZA 3IHPC 4EKUA 5BYQA 2I1KA 1QOAA 1WGDA 1WE7A 4P6VF 2IYDB 3N3KB 3DVGX 1RWSA 2WS3B 5G55A 3VDZA 2Z59B 3L10B 4GMVA 3NS8A 4PS8A 2WXHA 2N1VA 1N62A 4MACA 4IWQA 1RFKA 4HJKA 3A9JB 2K6DB 1ENFA 3ETRA 4B6WA 1XLOA 1RLFA 3CMMB 2XN9C 4HCPB 1SJHD 1RAXA 1SBBB 1UUPA 2CHXA 2KANA 3N20C 4LNNA 1WRIA 2ZPNA 1XT9B 4WWPA 3NOBA 4KKJA 4A8XC 1UGMA 3P4SB 3RNEC 1TKGA 5DCNA 1EF1A 1JW9D 3NVWA 3PHWB 1T5XD 2PMVA 3MP9A 2BB5A 2Y3AA 4PK1A 2K1FA 3VRBB 1VJKA 2N0SB 4KV2A 3EFCA 1E8YA 1SB3C 2GBRA 2VRRB 2QSDA 1J7BA 3R2TA 2ZW1A 3AE6B 4J3OD 3BK1A 2LFIA 3PHXB 1GAQB 2KFKB 3KUCB 4PYZA 1QZEA 4JLCA 4OW0A 1YQ3B 1NDDA 1JMLA 1GC7A 2K9XA 3Q3NC 3PVLA 1J0GA 3BWUD 1WXQA 2JVCA 3SD5A 2CHWA 2PJHA 3IAS1 3TIXA 2IY0B 4PS3A 4XZ4A 4KZCA 4R3DA 2AL3A 4NAMA 1FRRA 2BYVE 3UIOB 1ESFA 3N1YC 1IPGA 2LUEA 2PKOA 1XLQA 1Y56A 4IC7B 4GN1A 3H7SA 1CK1A 2FUHB 2G4SA 2LJ5A 2HJ1A 2LWPA 2N1WA 3DBRI 1WXVA 2BS4B 3QC8B 2L0FA 3R8BA 2NTTA 2K6QA 4YT0B 4YTMB 5BYSA 2CR5A 4KDLB 4TUUA 3WAPA 3A4SC 2FNJB 3PPAA 2KFKA 3Q8CA 1DOIA 4JIOU 3AXCA 3X23A 3A1QB 5EE0A 3N1XC 4HK2A 5E6OA 2NPTB 2MH7A 2N7DA 1XD3B 2DNFA 4US9A 1L7YA 2G45B 1FM0D 2D3AA 1P3QU 4G3XB 2QC8A 4IM2A 2J42A 1SIJA 2D5GA 4GOCA 3PO0A 5BO4B 3TJPA 2A4ZA 2W55A 1PYWD 1HTOA 1TY0A 2R61A 2KO3A 2IGHA 1OTRB 2EELA 4FULA 1WJNA 4LNKA 4QAYA 3BY4B 1V97A 1VD2A 2LGSA 2C7MB 2NPTA 3AE5B 2LASA 3N9YC 4K3BA 5T8IA 3AEGB 2O6VA 3E56A 3ZYYX 3M62B 2DBYA 5HHDG 5C1ZA 3DWMA 1C79A 1B9RA 1SE4A 3QHTA 4KIKA 3ZLZA 1VDVA 4AQ7A 2GRIA 2DX5B 3DHGC 3UQBA 3VTVA 3WALA 1F52A 3W2DA 1T0RC 3ZNZB 3ZO5B 1NYQA 4KSKC 2FCMA 5BMIA 4UDUC 1KJTA 1GUAB 1WGRA 1WI0A 1SE9A 2KQSA 3NJTA 4EOYA 4ZHOA 2I38A 2IO1B 2KC1A 4CQNA 3ZJVA 4WAAA 2AL6A 2D3CA 2FE8A 3L16A 3Q3MC 2G9HD 2IY1B 2WXLA 2IGDA 3WAOA 1DOXA 3ABVB 1CZPA 2FAZA 1ROEA 1A70A 2BQQA 3QARA 1VRAB 4REZA 5CHFA 3U52E 3NS1A 4ZRIA 2QIEB 3KWLA 1V9JA 5D3DA 1OQYA 1UH6A 2V4IB 2WLBA 3ZRFA 1GOZA 1I35A 2G1EA 1FMAD 2INDC 2M4NA 3J9CA 3NZUA 3BK2A 1E7UA 2M0XA 3RULA 2ZNVC 5IO9A 5LXIB 4ANVA 4E71A 2WGSA 4RF0A 2INNE 1HE8A 3I63C 1HZ6A 3TEWA 1KRHA 4TKNA 3ECIA 4O1NA 5CHWA 4MM3B 2BWFA 1C77A 4NPNA 2KZRA 5KHOA 2IO2B 2W3RA 3RNFC 1WYGA 5I4DA 3HK0A 4NJCA 3AH7A 1P7FA 3E9SA 4RGMA 4WURA 1SSNA 4NJ6A 4HXDA 2KJHB 2KX0A 3SDLC 3DPDA 1AN8A 1BUIC 3N32A 1STEA 4LNIA 2KWCA 4GLSC 2LZ6A 3RNGC 1SIFA 3AV8A 1OQQA 2J0JA 2BTEA 2JPHA 1JRUA 2WYQA 4KKIA 3T3OA 3R7QA 3KWVA 1WZ0A 1SGHA 3ZNGC 4HPPA 1T0SC 2Z8LA 3N30A 4YWGG 3AM9A 1C3TA 1VZ7A 3GB1A 3HM3A 4HPMB 1YN5A 2WDTB 3APCA 2OEDA 3TL5A 2GBJA 2IGGA 1WY8A 2H89B 3N1ZC 2LHEA 5DPSA 3MC8A 2NR2A 3A9KA 2J0MA 4TMAB 2SAKA 2L7RA 2N7EA 1BXTA 1RRBA 4W9FA 2W3SA 5IP4D 1GPXA 5L95C 3ZDTA 3X0WA 2K39A 3SU8X 2C7HA 1WZ3A 3WIMA 4EZKA 1MVKA 1V80A 4H2AA 3APFA 5AUIA 1WGKA 4K7UA 3ZJTA 4ASWC 2GBKA 1WGYA 3LYYA 3QJZA 2FCNA 2CS4A 1EO6A 4ARIA 1R4NI 1Z5SB 4RH6A 2LJIA 1ET6A 2K8HA 5D2MB 1ZDXA 3R2IA 2REXA 3D32A 4MJSB 2C7NB 2KTRB 4BBNF 4NNJB 4AOFA 2CU3A 3KUZA 1FNWA 2ZZPB 2V4LA 1QOBA 2KN5A 4K7SA 4L2YA 4XX5A 3OLMD 4ITKA 1TS2A 4MELA 1YQ4B 1L0XB 4N6EB 3AULA 4XWTA 1PDXA 2MBOA 4XC2A 2O2VA 3Q8AA 1R4MB 1QOFA 3KYCD 2W54A 3PREA 2OJRA 3B0AA 2DZKA 1DYQA 2KTRA 3IT4B 2V3PA 3VR8B 2MWSB 3QX1A 3W1SC 3TSSA 1UF0A 3ENEA 3IG3A 3I9V1 1NVID 2CJOA 3AE9B 3VVWB 5J18A 2Z0DB 1MHXA 1FFUA 1J7AA 4GGQA 2RMMA 2JRIB 5EDSA 3MJWA 4RM8A 4A6QA 1JWAD 2C5LC 1OEYA 4ARCA 1S1QB 4C7YA 1E8XA 3DBLB 1IUEA 3VHTC 1FD6A 3L17A 1M4VA 1YNTE 2MJEA 1ZUD2 1FXTB 3LB8C 3FKYA 1HEZE 3M95A
chains in the Genus database with same CATH topology
2LEKA 2WU2B 2PVGC 3T3NA 3FILA 2Y3AA 3BIID 1AYFA 4NAWB 2I2YA 3VRBB 2AQ1B 1N63A 1D5ZC 4USAA 1VJKA 1QF6A 2N0SB 1YN4A 1FIQA 2FUG1 2RPVA 1PFDA 4MT5A 1SB3C 2N7JA 2QSDA 1J7BA 1J7CA 1L0VB 3R2TA 2ZW1A 3AE6B 4J3OD 4TSSA 1FO4A 1TKEA 3CWIA 2GB1A 2LFIA 3BK1A 3AN1A 1E9MA 2M56B 1SEBD 4RNAA 1GAQB 3W5VB 2OHFA 3AEFB 4OW0A 2L1AA 1YQ3B 3Q69A 1JMLA 2K9XA 2JU6X 3BYYB 1YJJA 4RFBA 3SR6A 3TEXA 3BWUD 3P4QB 2BT6A 2XNAC 1WXQA 3I57A 4JX1C 2EKIA 3AE4B 1XO3A 3IAS1 4ZHPA 5JXVA 4B0MA 2PTLA 1NENB 2NTSA 4IKGA 4R3DA 2W82A 1C76A 1T6BX 4NAMA 4YSZB 1F2RI 5G5GA 4C80A 3EGRA 1TYGB 3U2SC 5BMHA 1FRRA 1ESFA 1F77A 2KQ4X 2LUMA 4LTUA 1KTKA 5TSSA 2PKOA 3SFDB 1XLQA 1Y56A 1ZXIA 2Y5PA 2K3UA 1CK1A 2L32A 2LGIA 1V1PB 2QILA 2YEPB 2BS4B 2WXFA 4KX6B 1TS4A 2ON8A 2J53A 1HQRD 2NTTA 4YT0B 3R8BA 1UWXA 5H8YE 1VZ6A 4YTMB 4LLGM 5BYSA 5LNK1 1DGJA 3BYTB 5AUKA 4A9AA 4GDKB 1L0YB 3Q8CA 1DOIA 1FRDA 5EE0A 3W9CB 1XEEA 4N59A 2WDVB 2JXTA 3DWGC 2PIAA 3AMZA 4L1BA 2MH7A 2K0PA 3Q8EA 4US9A 3C8YA 1FM0D 2X38A 1DOYA 4US8A 1L4ZB 1JWMD 2J42A 1PUTA 2RDHA 2WNMA 3OWEB 1SIJA 1D5MC 2D5GA 1FXAA 3PO0A 4YTPB 4FXCA 1KLGD 2W55A 4P16A 4AS1A 1PYWD 3U7ZA 3W1SA 1TY0A 4JPSA 2R61A 1WSPA 4WIPA 1RM6C 1D6EC 2IGHA 2WXJA 1KH0A 1V8CA 4ZRQA 1QT9A 2EELA 4OHJA 3L4PA 3AEEB 5EE9A 2V3NA 1V97A 1RYJA 4M0WA 1I4PA 4OZAA 1CJEA 1JALA 2HDEA 1L6UA 3SFEB 2IJ0A 1YMHE 3AE5B 2CJNA 4OVZA 3V05A 2M19A 2QMTA 3N9YC 2KMMA 3AECB 5T8IA 5EE1A 1JQ4A 5C2TB 2H88B 1EWCA 3BVMA 2BS2B 1ZXHA 2MJ3A 1JCKB 3AEGB 5H92C 4A90A 3E56A 3ZYYX 3MC0B 1N60A 3B9JA 1JRPA 2DBYA 5HHDG 5BMGA 1ZP0B 1E6EB 3DWMA 3ZQ4A 3ZGZA 2JSVX 1C79A 3B2FA 1B9RA 1SE4A 1FXIA 2INPE 2K5PA 4HKZE 4L23A 3EA6A 1VDVA 4AQ7A 2GRIA 3VR9B 1GB1A 1B1ZA 3Q8BA 3U4EG 1SE3A 1SJED 4ZRPA 1FNVA 1L4DB 2ONQA 2WDRB 3W2DA 2WDQB 3HRDD 1NYQA 4EE2A 3B2GA 5BMIA 4UDUC 1TS5A 4RCOA 2N9KA 4ZHOA 2I38A 2NMQA 5FK9C 2B76B 2N9LA 1MI0A 4RGTA 4ZOHC 2HTME 1C78A 4CQNA 1XLNA 1UNSA 3ZJVA 2KWDA 4HJGE 3AE2B 4DXGA 2FE8A 4N58A 2QEJC 3PZ8A 1F0ZA 2BS3B 1I4QA 1NEKB 2G9HD 4JWSC 2L83A 2YEPF 1C4PA 1QKZA 2WXLA 3MJ5A 2DYMA 3HVDA 4HROA 2WXRA 2IGDA 1PGAA 1DOXA 3ABVB 1CZPA 1IGDA 1ROEA 1A70A 1VRAB 4REZA 3U52E 3NS1A 2WXOA 2Y5CA 2QIEB 3KWLA 2DLBA 1UGJA 3H8HA 1E10A 5D3DA 1GB4A 1FCCC 2WXGA 1ZPSA 1FNUA 2BW2A 3NVVA 1IBXA 2AX5A 2K22A 2V4IB 1QLBB 2WLBA 1NI3A 5HFYA 1EM7A 3UI3A 1GOZA 5MPOA 1LO5D 4WWMA 2G1EA 1FMAD 3J9CA 3BK2A 2PLPA 4GDLB 2TSSA 1JWBD 2RDGA 1F2RC 2JX5A 1PGXA 4YSYB 1I4HA 2QJLA 2E3TA 1C4AA 4RF0A 2INNE 1Q10A 1HZ6A 2E6XA 3TEYA 3TEWA 1KRHA 1XXGA 1JWSD 4KGSA 4O1NA 4MM3B 2JYEA 1HZ5A 4WQMA 4XE0A 1OQRA 3AE8B 1K52A 3IT6B 4OZBA 1MPEA 1WWTA 2ZW0A 1C77A 1NYRA 1YN3A 3GP7A 3NZ3A 2VZKB 3IAM1 4IOIE 1AWDA 4XDCA 1EWYC 1EU3A 2W3RA 2BBCA 1WYGA 5I4DA 1CQVA 3TUOA 4NJCA 3AH7A 4C56C 1P7FA 3E9SA 4RGNA 4RGMA 4WURA 1XF5L 1SSNA 1KLUD 4ZYSA 1AN8A 1BUIC 1D4BA 1I4GA 1VR9A 1STEA 1TZOA 4KGTA 4GLSC 1XCQL 1FEHA 2KAJA 3SEBA 3AEDB 1L5PA 1FCLA 4DQOC 1I7HA 5D3IB 3BVZA 5G5HA 3CIRB 3AE7B 2WQYB 2LMCA 4DXFA 1HA5A 3VRAB 3AV8A 1OQQA 2BTEA 5D7GA 1E7PB 3MHZA 4KKIA 5C3JB 1ZDVA 2WXQA 3AB5A 5HI1A 3T3OA 3KWVA 4RF1A 1P7EA 1K50A 3URYA 2KDMA 1YJIA 1SXTA 1K53A 3BVGA 1BMLC 3KLSX 3P42A 3P4PB 4TQ1A 2BYTA 3PZ7A 2JZPA 1C4CA 3RFZB 2Z8LA 4B0EA 4YWGG 2AQ3B 3AM9A 4WH4A 1VZ7A 3GB1A 1YN5A 1TKYA 3FC4A 4KGRA 1IBXB 4MH8A 2OEDA 1ACCA 4A55A 4D2KA 1VZ8A 2IGGA 4LK0M 2H89B 3O13A 2LHEA 3KQ4A 3P4RB 5FKAC 3WCQA 4TMAB 2SAKA 1BXTA 3AEAB 2JWUA 2W3SA 1I4XA 3AE3B 2DYOA 1GPXA 3IXSA 1V1OA 1OFFA 2KN4A 2AQ2B 3P63A 3EUB2 3Q8FA 2M0AA 1C9FA 2DWQA 4JE3B 1MVKA 4H2AA 2WP9B 2FBWB 4XWWA 2J4XA 1T3QA 1ET9A 5AUIA 1WGKA 2PW9A 1D5XC 3ZJTA 1UWMA 4XDDA 2MJDA 3RPFC 3LYYA 3AEBB 3HUIA 1N5XA 1SF0A 2MEKA 1JROA 1ZOYB 1XCTL 3AE1B 1EU4A 1HXYD 2WXKA 2VZKD 1N5WA 4IDIA 1QILA 5GXGB 5FR3A 4ARIA 3NVYA 3P1MA 4RH6A 1PGBA 4RGOS 1MHHE 2WU5B 2IPKD 2LJIA 1SE2A 1ET6A 4C7ZA 5E6JA 1JWUD 1ZDXA 2SEBD 3NRZA 3R2IA 4Q2JA 1QOGA 2ACZB 4WAFA 5HG2A 1TJEA 3NUHB 3NVZA 1E0ZA 4YTNB 4OZCA 4HEA1 5BYQA 1QOAA 1K51A 2CU3A 1FNWA 2WXPA 4P6VF 1QOBA 2WXNA 2BB5A 1IGCA 4L2YA 1RWSA 1FFVA 2WS3B 4ITKA 5EE3A 1R7SA 1TS2A 3V3XA 1YQ4B 2Q5WD 1L0XB 4N6EB 2JQRB 4XWTA 1PDXA 3VQIA 2WXMA 2WXHA 1N62A 4MACA 2JYTA 1L6VA 2BB6A 1RFKA 3Q8AA 1QOFA 1ZE3D 2W54A 2ICIA 2KACA 3TEZA 1ENFA 3ETRA 1TS3A 1XLOA 1QQRA 3HVZA 3BZDB 1DYQA 4HKQA 3W5UB 3ZJUA 3IT4B 1V1PA 1XLPA 2V3PA 2PVOD 2XN9C 3VR8B 3TSSA 3I9V1 1NVID 3FILB 1SJHD 2CJOA 3AE9B 1UUPA 1SBBB 1VLBA 4TQ0A 4YXDB 1MHXA 1FFUA 1J7AA 3GS2A 2V0GA 2RMMA 2IDYA 2LHDA 4A6QA 1WRIA 1JWAD 3LXFA 3MFGA 4PT5A 4ARCA 4C7YA 2L52A 4KKJA 5BYRA 4A8XC 1KF6B 3P4SB 3FAHA 2WXIA 1I4RA 4HRSA 1IUEA 4NZLB 1TKGA 1FD6A 1JW9D 2GI9A 3NVWA 4JWUC 1M4VA 1N61A 1YNTE 2MJEA 1TY2A 1ZUD2 3LB8C 1T5XD 2PMVA 1KFYB 4YSXB 1HEZE 3MP9A 1AW7A 2J52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZA A;  4KGS A;  3FIL A;  1HZ5 A;  2I2Y A;  4OZB A;  1K52 A;  1YMH E;  1MPE A;  1XCT L;  2ZW0 A;  2QMT A;  4IOI E;  2RPV A;  1ZXH A;  1Q10 A;  1PGB A;  1MHH E;  2N7J A;  2QSD A;  1P7F A;  5HHD G;  5BMG A;  2ZW1 A;  1XF5 L;  2JSV X;  2GB1 A;  5HG2 A;  1D4B A;  4HKZ E;  4OZC A;  1GB1 A;  4KGT A;  1JML A;  2JU6 X;  4GLS C;  1XCQ L;  2ONQ A;  1K51 A;  1FCL A;  5JXV A;  2PTL A;  1IGC A;  4IKG A;  5BMI A;  3V3X A;  1F2R I;  5BMH A;  2N9K A;  2I38 A;  2NMQ A;  5HI1 A;  2N9L A;  1MI0 A;  2KQ4 X;  4MAC A;  2LUM A;  1P7E A;  1K50 A;  2KWD A;  4HJG E;  2KDM A;  1K53 A;  2LGI A;  2KAC A;  2ON8 A;  2JZP A;  2J53 A;  1UWX A;  1QKZ A;  2IGD A;  4WH4 A;  1PGA A;  3GB1 A;  4KGR A;  1IGD A;  1IBX B;  3FIL B;  2JXT A;  2OED A;  4D2K A;  2IGG A;  2K0P A;  2LHE A;  1MHX A;  1GB4 A;  1FCC C;  2RMM A;  1IBX A;  2LHD A;  1EM7 A;  5HFY A;  3UI3 A;  2JWU A;  3MP9 A;  2PLP A;  2KN4 A;  1F2R C;  2IGH A;  1PGX A;  1FD6 A;  1KH0 A;  1C9F A;  2EEL A;  2GI9 A;  1MVK A;  1YNT E;  2PW9 A;  1HEZ E;  1HZ6 A;  2J52 A; 
#chains in the Genus database with same CATH topology
 1LXD A;  2N9P C;  4MGK E;  2PVG C;  3DDC B;  1Q0W B;  4NAW B;  3V6E B;  4J6I A;  1WM2 A;  1WMH B;  1N63 A;  2QHO A;  4BBN C;  4F7Z A;  2FUG 1;  4F8C B;  2RPV A;  3Q6B A;  1PFD A;  4W9J A;  2N7J A;  4PYU A;  1J7C A;  1F1H A;  2J0K A;  1VCB A;  3CWI A;  3KVF B;  1E9M A;  1SEB D;  2KDF B;  2OHF A;  3PV1 A;  3W5V B;  5J2R A;  1YIW A;  3TEX A;  3I57 A;  4GIV A;  2EMT A;  1XO3 A;  4B0M A;  2PTL A;  2RPQ A;  2NTS A;  1F2R I;  4C80 A;  3QA8 A;  1F77 A;  2KQ4 X;  1TZ1 A;  4MH0 E;  1KTK A;  1WH3 A;  4DHZ B;  2LGI A;  4IM3 A;  3KH0 A;  2YEP B;  2WXF A;  1N6Z A;  3PS6 A;  1HQR D;  2M1M A;  1VZ6 A;  4LLG M;  5LNK 1;  1DGJ A;  3AU5 A;  3BYT B;  1L0Y B;  1FRD A;  4AP4 C;  2LXC A;  3HM6 X;  2WDV B;  3AMZ A;  1YX5 B;  2K0P A;  2KWU B;  3UGB B;  2X38 A;  3HHM A;  1DOY A;  1JWM D;  3OWE B;  3R3M A;  1WE6 A;  2MBH A;  1F9J A;  1FXA A;  4YTP B;  1KLG D;  4G50 A;  4GXB A;  4P16 A;  3W1S A;  3T8M A;  4BFR A;  4WIP A;  1WFY A;  1D6E C;  4ANX A;  4ZRQ A;  1V8C A;  1WGH A;  1RFA A;  4GDL A;  2KC2 A;  5EE9 A;  2V3N A;  3RNB C;  3DVN U;  4OZA A;  3PRZ A;  3ZKJ C;  1EF5 A;  2LVP A;  3SFE B;  2RDB C;  1UEL A;  1YMH E;  3V05 A;  3P2B A;  3AEC B;  2H88 B;  3KW5 B;  4W9D A;  1ZXH A;  3EEC A;  2AYO B;  1J19 A;  3MC0 B;  3LDZ E;  3CF6 E;  1N60 A;  3B9J A;  2K8B A;  5C23 A;  2JSV X;  3R66 C;  4NJ7 A;  1FXI A;  2K5P A;  4ZDV A;  3VR9 B;  4ZRP A;  1P1A A;  1FNV A;  2XK5 A;  2V9H A;  1P9D U;  2GLS A;  3B2G A;  3JYU A;  2K8C A;  1TS5 A;  1HTQ A;  4RCO A;  5FK9 C;  2B76 B;  1UBQ A;  4ZOH C;  1UNS A;  2KWD A;  4HJG E;  4LNF A;  1F0Z A;  2QCZ A;  2L83 A;  3APD A;  2DYM A;  4KSL C;  1PGA A;  5JHA A;  2FCQ A;  4JGH B;  1IGD A;  1WX7 A;  3H7P A;  3GE8 C;  2KFJ A;  2DLB A;  3H8H A;  3LJ3 A;  3PZD A;  4II3 B;  3VAW A;  1GB4 A;  1IBX A;  3NVV A;  4S17 A;  1QLB B;  5HFY A;  1EM7 A;  5MPO A;  4DDI D;  1LO5 D;  3VXW A;  4I6L B;  2HTH A;  2PLP A;  2MCN B;  2UU7 A;  2TSS A;  2RDG A;  3KYD D;  3Q14 C;  4YSY B;  1I4H A;  2QJL A;  1C4A A;  4MEM A;  3JVZ X;  4DWF A;  2KJ6 A;  4W9H A;  2XBB C;  1Z2M A;  3V61 A;  3RN9 C;  1LQB A;  3ZW3 A;  2HE7 A;  2O6V B;  4IUM B;  4IWO A;  2JYE A;  1HZ5 A;  4X57 B;  4XE0 A;  1OQR A;  3AE8 B;  3U7D A;  3ZVV A;  1MPE A;  1NYR A;  3IAM 1;  1AWD A;  2L8J A;  3DQV A;  5TR5 A;  4KIK B;  3TMP B;  2GBM A;  4K81 A;  2KK8 A;  1KLU D;  3NY5 A;  1G6J A;  3B08 A;  3QQ8 B;  1UZX B;  1TZO A;  1E8Z A;  2WX1 A;  4W9G A;  3SEB A;  2N4F A;  1FCL A;  1I7H A;  1YJ1 A;  5D3I B;  4DHZ E;  5G5H A;  3CIR B;  2WQY B;  2LMC A;  3VRA B;  4FN2 A;  2KX3 A;  1E7P B;  3MHZ A;  4IM0 A;  1ZDV A;  3AB5 A;  3ML9 A;  4RF1 A;  1MFW A;  1P7E A;  3P42 A;  1SXT A;  4I6N B;  4NQK E;  2BYT A;  4TQ1 A;  3PRM B;  3PZ7 A;  1WR1 A;  4II2 B;  3WA0 A;  2ZVN A;  2JXX A;  2VH2 A;  5IA7 A;  2DAJ A;  3FC4 A;  2KD0 A;  1YX6 B;  3O13 A;  3DBH B;  3P4R B;  5AZF A;  5FKA C;  4YL8 A;  5DPW A;  3CST A;  1I4X A;  3L08 A;  3AE3 B;  3NHE B;  5FR6 A;  1OFF A;  5DPR A;  2KN4 A;  1LM8 B;  3P63 A;  4NQL B;  3EUB 2;  4WQO B;  2MP2 A;  3I5J C;  5J17 A;  2M0A A;  4HDQ A;  4XWW A;  1D5X C;  4P1B C;  2IBI B;  4HWI B;  2O6V D;  3AEB B;  1KLV A;  1ZOY B;  1XCT L;  1EU4 A;  2KHW B;  5LXH A;  4IDI A;  1QIL A;  3UQA A;  2BWE S;  4FBJ B;  3NVY A;  4AWJ A;  2NS5 A;  3NG0 A;  1SE2 A;  2HJ8 A;  4C7Z A;  3IFW B;  3L13 A;  1QOG A;  4WAF A;  5HG2 A;  4ICV A;  4YTN B;  4HEA 1;  3ZXR A;  2WWZ A;  2JY6 A;  2WXP A;  3H1U A;  2WXN A;  3UIN B;  1IGC A;  3VH4 B;  4ICU A;  2PE9 A;  1R7S A;  2JT4 B;  2IO3 B;  3UIP B;  3VQI A;  2KDE B;  4M01 A;  1L6V A;  2GBN A;  2BB6 A;  2KAC A;  3TEZ A;  4K3C A;  3BZD B;  4HKQ A;  3JW0 X;  3W5U B;  1V1P A;  1XLP A;  2KKC A;  3L0W B;  3A9K B;  2A5U A;  3PGE A;  1WRD B;  1IP9 A;  1VLB A;  4GDK A;  4YXD B;  2LVO A;  3GS2 A;  4FJZ A;  2IDY A;  2LHD A;  4W9E A;  3QWZ B;  3TCA A;  3MFG A;  2CKH B;  2C9W B;  5BYR A;  1U4A A;  1K8R B;  1KF6 B;  3FAH A;  1I4R A;  4HRS A;  4NZL B;  3DOW A;  4BKS A;  1R4M I;  2YVC A;  3EHV A;  1TGZ B;  1N61 A;  1S3S G;  5JHB A;  3ALB A;  1AW7 A;  2J52 A;  2ZNV B;  2KVZ A;  3BII D;  1AYF A;  2I2Y A;  2AQ1 B;  1D5Z C;  1GJZ A;  1YN4 A;  1E90 A;  4W9I A;  3EFU A;  1XQQ A;  1P0R A;  2X8X X;  1L0V B;  2Y5B B;  1WXS A;  1FO4 A;  3RMK C;  1E8W A;  2M56 B;  3RNC C;  2FCS A;  3A4R A;  3NZS A;  3Q69 A;  4WWO A;  3BYY B;  1EUV B;  3SR6 A;  3DBL I;  3P4Q B;  2XNA C;  3DCG A;  3AE4 B;  4ZHP A;  1NEN B;  4LCD E;  3GZN B;  4IKG A;  2ZCB A;  3ZXV A;  2W82 A;  2PE6 B;  2RD0 A;  1KOT A;  4YSZ B;  2O2V B;  3EGR A;  3U2S C;  2RSU A;  3Q3O C;  5TSS A;  3WAN A;  3SFD B;  1ZXI A;  2Y5P A;  1LGR A;  1D3Z A;  2L32 A;  1TS4 A;  2ON8 A;  4DXA B;  2ZPY A;  5H8Y E;  1J8C A;  2D11 A;  2N9E B;  2KLC A;  4A9A A;  3OJ4 B;  2JRH A;  1V81 A;  4A20 A;  3W9C B;  2M8S A;  1WXM A;  1XEE A;  4N59 A;  1C1Y B;  2JXT A;  3DWG C;  2PIA A;  4HVB A;  2LGD A;  1YD8 U;  2R2O A;  3C8Y A;  1Q1O A;  1AAR A;  4M8M A;  1L4Z B;  1PUT A;  1GC6 A;  1D5M C;  2MSE D;  4HPL B;  3U7Z A;  4JPS A;  4IWP A;  1WSP A;  4FA6 A;  1RM6 C;  2JWZ A;  2KXJ A;  3Q3F A;  3IVF A;  3AEE B;  5JZE B;  2INC C;  1RYJ A;  4M0W A;  1I4P A;  1CJE A;  1JAL A;  2HDE A;  3C0R B;  2L05 A;  2MHJ A;  4CYE A;  4LJP B;  2BS2 B;  4AJW A;  2LGX A;  1JRP A;  5L83 A;  1ZP0 B;  2ZCC A;  5IAA C;  3ZGZ A;  4GU2 A;  4A3P A;  1WJ4 A;  4ACF A;  4L23 A;  3Q8B A;  1SJE D;  1L4D B;  2ONQ A;  1V49 A;  2WDR B;  2C60 A;  5AEK B;  2CHZ A;  1WX9 A;  2MX2 A;  1WXA A;  1I42 A;  3SHQ A;  2N9K A;  3V62 A;  2N9L A;  1MI0 A;  2HTM E;  3RI7 C;  4P7I A;  3ML8 A;  2KT7 A;  4DXG A;  3M3J A;  4N58 A;  3PZ8 A;  3Q3J A;  3JSV A;  2RR9 A;  1NEK B;  3ZNI D;  2EKE C;  2WXR A;  3U8Z A;  3QK0 A;  4FHJ A;  4KVG B;  2WXO A;  2DHZ A;  4MGY E;  1UGJ A;  2WXG A;  2K22 A;  2N9X A;  3UI3 A;  4GDL B;  4WJP A;  1F2R C;  2JX5 A;  2E3T A;  1Y8R C;  4MDK E;  3H6N A;  4GSW A;  1Q10 A;  2E6X A;  3TEY A;  2NBU A;  1JWS D;  1K52 A;  1WWT A;  2NVU I;  2ZW0 A;  1YN3 A;  1H4R A;  3GP7 A;  3NZ3 A;  2VZK B;  2J7Q B;  4IOI E;  3I3T B;  1EWY C;  4RMA A;  1EU3 A;  2BBC A;  2QDF A;  2FIF A;  3AU4 A;  3C19 A;  2XK5 B;  2KVR A;  2EMS A;  3ZIM A;  4ZYS A;  1WF9 A;  4AJY B;  3RZW C;  1VR9 A;  2KMC A;  3KUD B;  1XCQ L;  4RM9 A;  3AED B;  4B9K A;  1CMX B;  1T0Q C;  4DXF A;  1HA5 A;  2ZVO A;  2KMA A;  1WJ6 A;  1FPY A;  5D7G A;  4EEW A;  4WJQ A;  5C3J B;  2WXQ A;  4DK5 A;  2Z0E B;  4M8N A;  4DBG A;  3URY A;  3A33 B;  4TV3 A;  4FAD A;  1KM7 A;  1YJI A;  3BVG A;  1WJU A;  4WJO A;  2BYF A;  3RFZ B;  1C4C A;  4B0E A;  3EC8 A;  1TT5 B;  3H7P B;  4MGI E;  4MSM B;  3A9J A;  5CHV C;  1IBX B;  2MA9 B;  1BT0 A;  4MH8 A;  1ACC A;  3M63 B;  4D2K A;  1VZ8 A;  2BYE A;  4LK0 M;  3KQ4 A;  4OVV A;  3WCQ A;  2G3Q B;  2HD5 B;  3ONS A;  3AEA B;  2JWU A;  3O65 B;  3K9P B;  2DYO A;  4C00 A;  2MBE A;  2RGF A;  1V5O A;  3Q8F A;  2JUO A;  2WX0 A;  1C9F A;  1GG3 A;  2D07 B;  2WP9 B;  2FBW B;  4B95 A;  2J4X A;  4P1C C;  1ET9 A;  2LD9 A;  2PW9 A;  4XYC A;  2LI5 A;  4XDD A;  2MJD A;  3RPF C;  5IKC M;  4OVU A;  3PTF C;  2MQJ A;  1SF0 A;  1NI2 A;  2VZK D;  1N5W A;  5FR3 A;  2R2Q A;  2ZEQ A;  3P1M A;  2MRP A;  3DBH I;  1PGB A;  1MHH E;  3PT2 B;  3OJ3 A;  2IPK D;  5E6J A;  3DHH C;  3RNA C;  5IN7 A;  4Q2J A;  1WGG A;  3NUH B;  2VH1 A;  1E0Z A;  4OZC A;  1K51 A;  2D2Q A;  1TBE A;  2XEW A;  1FFV A;  4G0N B;  5EE3 A;  3V3X A;  5AZH A;  4C4V B;  2Q5W D;  4LDT B;  1H8C A;  4BOS C;  2WHI A;  2JQR B;  4WJN A;  3PSE B;  2WXM A;  1PQS A;  3RCZ A;  3ZNH B;  1MJD A;  2BF8 B;  2JYT A;  4CO7 A;  1E5W A;  3QCA A;  1ZE3 D;  2ICI A;  2DZI A;  1TS3 A;  1QQR A;  2BVC A;  3HVZ A;  3RUI B;  3ZJU A;  3VTU A;  2PVO D;  5CTR C;  4ZYN A;  3FIL B;  2GMI C;  4TQ0 A;  4LNO A;  3A1Q A;  4FHK A;  1WYW B;  2V0G A;  4C4V A;  4HLE A;  2MP2 B;  1OGW A;  3LXF A;  2KDB A;  3K9O B;  4PT5 A;  2L52 A;  2L76 A;  2WXI A;  3WAM A;  2PEA A;  1P98 A;  2GI9 A;  4JWU C;  1ZGU B;  3RT3 B;  1TY2 A;  1TIF A;  4LJO B;  3VTW A;  1KFY B;  4YSX B;  2D10 A;  2LEK A;  2WU2 B;  3T3N A;  5E6N A;  2AWT A;  3FIL A;  4XGA B;  4JQW C;  1V2Y A;  2L3Z A;  4USA A;  1YQB A;  1QF6 A;  1FIQ A;  1V86 A;  4ANU A;  4MT5 A;  3DBR B;  4A3O A;  3GOE A;  1UD7 A;  3PLU A;  3QIJ A;  4IG7 B;  4KZ0 A;  2DZM A;  1L2N A;  2I1J A;  4TSS A;  4W9K A;  1TKE A;  2GB1 A;  4FJY A;  3AN1 A;  2K25 A;  4ZRJ A;  2KNB A;  4RNA A;  3DHI C;  3H9D A;  3AEF B;  2V1Y A;  2L1A A;  2JU6 X;  1YJJ A;  4RFB A;  2B3A A;  2BT6 A;  3MC9 A;  3R7R A;  4JX1 C;  4BVU C;  2EKI A;  5JXV A;  3UF8 A;  1C76 A;  1T6B X;  5G5G A;  4LDT D;  1TYG B;  2MLB A;  5BMH A;  3U30 A;  2LGY A;  3ZUN A;  4PS7 A;  2LUM A;  4LTU A;  2IZV B;  4ANW A;  2K3U A;  1V1P B;  2QIL A;  4MSQ B;  4KX6 B;  2J53 A;  1UWX A;  4AUQ C;  2DZJ A;  5AUK A;  4DHJ B;  4GDK B;  3GE3 C;  4L1B A;  2LVQ A;  3Q8E A;  2IO0 B;  4US8 A;  5IOI A;  3GZN I;  2BGF A;  2RDH A;  2WNM A;  3T9L A;  5KHQ A;  1A5R A;  3VUX A;  2KTF A;  4FXC A;  2BPS A;  4AS1 A;  2V3S A;  4M00 A;  2WXJ A;  1KH0 A;  1QT9 A;  5D6J B;  1E7V A;  4OHJ A;  3L4P A;  2OOB B;  4BKG A;  4EZL A;  4I6P A;  4HCN B;  1L6U A;  5D94 A;  2IJ0 A;  3MHS D;  1IYF A;  2CJN A;  4OVZ A;  2G4D B;  2M19 A;  2QMT A;  2KMM A;  3RYT A;  4N9F 4;  5EE1 A;  1JQ4 A;  5C2T B;  3BVM A;  1EWC A;  4IW0 A;  2LRW A;  2MJ3 A;  1JCK B;  5H92 C;  2UYZ B;  4A90 A;  4MM3 A;  4K7W A;  2ZJD A;  5BMG A;  1E6E B;  4W9C A;  3ZQ4 A;  4EZJ A;  3B2F A;  3OG5 A;  3VFK A;  2INP E;  2L00 B;  4HKZ E;  4EFO A;  3EA6 A;  1GB1 A;  2NBV B;  1B1Z A;  3U4E G;  1SE3 A;  3L54 A;  3ZTC A;  2WDQ B;  3HRD D;  5DPT A;  2JZZ A;  4EE2 A;  2LXA A;  3ZDM C;  4EUT A;  1ZW7 A;  2NMQ A;  4RGT A;  1C78 A;  3VUW A;  1XLN A;  3AE2 B;  2LRU A;  2QEJ C;  1V6E A;  2BS3 B;  1MG4 A;  1I4Q A;  4JWS C;  2YEP F;  1C4P A;  1QKZ A;  3MJ5 A;  4HRO A;  2FID A;  3HVD A;  3V60 A;  4DHJ D;  2MBB B;  3PRP B;  2KLG A;  4E74 A;  2UWQ A;  2Y5C A;  3S2A A;  1UBI A;  1E10 A;  1FCC C;  1ZPS A;  1FNU A;  2BW2 A;  2L0T A;  2AX5 A;  1X1M A;  2MBQ A;  1NI3 A;  3DBS A;  1LFD A;  4ZRK A;  4BKS D;  2DAF A;  4WWM A;  1JWB D;  2KWV B;  4FJV B;  4M0W B;  1PGX A;  1WR6 E;  3AI5 A;  3CSF A;  4BZA A;  2D3G A;  4BAX A;  2MW5 A;  1M94 A;  2M17 A;  1XXG A;  4KGS A;  4WQM A;  1V5T A;  4OZB A;  3IT6 B;  1WM3 A;  1Q5W B;  3ZRC A;  4KDI C;  5AZG A;  5LLI A;  3TBL D;  3VUY A;  3HIZ A;  4XDC A;  1OEY J;  2CU1 A;  3RZF A;  1CQV A;  4GB9 A;  3TUO A;  3VH3 B;  4NY0 A;  4C56 C;  4RGN A;  4M02 A;  1XF5 L;  4K1R B;  3B1L X;  5E6P A;  4CHK A;  1I4G A;  2KYW A;  1D4B A;  2YLM A;  1WX8 A;  1T0Y A;  2BKF A;  4KGT A;  4HDO A;  4DDG D;  2NCN A;  1FEH A;  2KAJ A;  4MJS A;  1L5P A;  4DQO C;  3BIN A;  3BVZ A;  3AE7 B;  3IBE A;  3Q2A C;  4FLH A;  3JSV B;  2JF5 A;  5HI1 A;  4S0R A;  1K50 A;  2KDM A;  1K53 A;  1BML C;  3KLS X;  3P4P B;  2JZP A;  2AQ3 B;  4WH4 A;  2KQ7 A;  2NBW B;  1MG8 A;  2D3B A;  1WIA A;  1TKY A;  4KGR A;  1NBF C;  3OAW A;  2OJW A;  1TTN A;  4A55 A;  2ASQ A;  1R4N B;  4F1S A;  1ISN A;  3W1Y A;  3MTN B;  2BKR B;  3PLV A;  2W9N A;  5GMV A;  5JH5 C;  3DVG Y;  4JL9 A;  3IXS A;  1V1O A;  1GNU A;  2DEN B;  2AQ2 B;  4BOZ B;  2AEH A;  2DWQ A;  4JE3 B;  1T3Q A;  2PPH A;  2JZ3 B;  5CX3 A;  4URK A;  3V6C B;  3QAQ A;  4E3C A;  4BKT A;  5HKH A;  3DVN V;  1UWM A;  1ZKH A;  3RD2 A;  3HUI A;  1N5X A;  4MGZ E;  2MEK A;  1JRO A;  3AE1 B;  4G11 A;  1HXY D;  2WXK A;  2KJR A;  5GXG B;  4NAW A;  4RGO S;  5G2N A;  2WU5 B;  4WWN A;  1WMH A;  2DYB A;  2GOW A;  1JWU D;  1YOV B;  2SEB D;  4W9L A;  3NRZ A;  2ACZ B;  3ZTD A;  2KOX A;  1TJE A;  2KDI A;  3NVZ A;  3IHP C;  4EKU A;  5BYQ A;  2I1K A;  1QOA A;  1WGD A;  1WE7 A;  4P6V F;  2IYD B;  3N3K B;  3DVG X;  1RWS A;  2WS3 B;  5G55 A;  3VDZ A;  2Z59 B;  3L10 B;  4GMV A;  3NS8 A;  4PS8 A;  2WXH A;  2N1V A;  1N62 A;  4MAC A;  4IWQ A;  1RFK A;  4HJK A;  3A9J B;  2K6D B;  1ENF A;  3ETR A;  4B6W A;  1XLO A;  1RLF A;  3CMM B;  2XN9 C;  4HCP B;  1SJH D;  1RAX A;  1SBB B;  1UUP A;  2CHX A;  2KAN A;  3N20 C;  4LNN A;  1WRI A;  2ZPN A;  1XT9 B;  4WWP A;  3NOB A;  4KKJ A;  4A8X C;  1UGM A;  3P4S B;  3RNE C;  1TKG A;  5DCN A;  1EF1 A;  1JW9 D;  3NVW A;  3PHW B;  1T5X D;  2PMV A;  3MP9 A;  2BB5 A;  2Y3A A;  4PK1 A;  2K1F A;  3VRB B;  1VJK A;  2N0S B;  4KV2 A;  3EFC A;  1E8Y A;  1SB3 C;  2GBR A;  2VRR B;  2QSD A;  1J7B A;  3R2T A;  2ZW1 A;  3AE6 B;  4J3O D;  3BK1 A;  2LFI A;  3PHX B;  1GAQ B;  2KFK B;  3KUC B;  4PYZ A;  1QZE A;  4JLC A;  4OW0 A;  1YQ3 B;  1NDD A;  1JML A;  1GC7 A;  2K9X A;  3Q3N C;  3PVL A;  1J0G A;  3BWU D;  1WXQ A;  2JVC A;  3SD5 A;  2CHW A;  2PJH A;  3IAS 1;  3TIX A;  2IY0 B;  4PS3 A;  4XZ4 A;  4KZC A;  4R3D A;  2AL3 A;  4NAM A;  1FRR A;  2BYV E;  3UIO B;  1ESF A;  3N1Y C;  1IPG A;  2LUE A;  2PKO A;  1XLQ A;  1Y56 A;  4IC7 B;  4GN1 A;  3H7S A;  1CK1 A;  2FUH B;  2G4S A;  2LJ5 A;  2HJ1 A;  2LWP A;  2N1W A;  3DBR I;  1WXV A;  2BS4 B;  3QC8 B;  2L0F A;  3R8B A;  2NTT A;  2K6Q A;  4YT0 B;  4YTM B;  5BYS A;  2CR5 A;  4KDL B;  4TUU A;  3WAP A;  3A4S C;  2FNJ B;  3PPA A;  2KFK A;  3Q8C A;  1DOI A;  4JIO U;  3AXC A;  3X23 A;  3A1Q B;  5EE0 A;  3N1X C;  4HK2 A;  5E6O A;  2NPT B;  2MH7 A;  2N7D A;  1XD3 B;  2DNF A;  4US9 A;  1L7Y A;  2G45 B;  1FM0 D;  2D3A A;  1P3Q U;  4G3X B;  2QC8 A;  4IM2 A;  2J42 A;  1SIJ A;  2D5G A;  4GOC A;  3PO0 A;  5BO4 B;  3TJP A;  2A4Z A;  2W55 A;  1PYW D;  1HTO A;  1TY0 A;  2R61 A;  2KO3 A;  2IGH A;  1OTR B;  2EEL A;  4FUL A;  1WJN A;  4LNK A;  4QAY A;  3BY4 B;  1V97 A;  1VD2 A;  2LGS A;  2C7M B;  2NPT A;  3AE5 B;  2LAS A;  3N9Y C;  4K3B A;  5T8I A;  3AEG B;  2O6V A;  3E56 A;  3ZYY X;  3M62 B;  2DBY A;  5HHD G;  5C1Z A;  3DWM A;  1C79 A;  1B9R A;  1SE4 A;  3QHT A;  4KIK A;  3ZLZ A;  1VDV A;  4AQ7 A;  2GRI A;  2DX5 B;  3DHG C;  3UQB A;  3VTV A;  3WAL A;  1F52 A;  3W2D A;  1T0R C;  3ZNZ B;  3ZO5 B;  1NYQ A;  4KSK C;  2FCM A;  5BMI A;  4UDU C;  1KJT A;  1GUA B;  1WGR A;  1WI0 A;  1SE9 A;  2KQS A;  3NJT A;  4EOY A;  4ZHO A;  2I38 A;  2IO1 B;  2KC1 A;  4CQN A;  3ZJV A;  4WAA A;  2AL6 A;  2D3C A;  2FE8 A;  3L16 A;  3Q3M C;  2G9H D;  2IY1 B;  2WXL A;  2IGD A;  3WAO A;  1DOX A;  3ABV B;  1CZP A;  2FAZ A;  1ROE A;  1A70 A;  2BQQ A;  3QAR A;  1VRA B;  4REZ A;  5CHF A;  3U52 E;  3NS1 A;  4ZRI A;  2QIE B;  3KWL A;  1V9J A;  5D3D A;  1OQY A;  1UH6 A;  2V4I B;  2WLB A;  3ZRF A;  1GOZ A;  1I35 A;  2G1E A;  1FMA D;  2IND C;  2M4N A;  3J9C A;  3NZU A;  3BK2 A;  1E7U A;  2M0X A;  3RUL A;  2ZNV C;  5IO9 A;  5LXI B;  4ANV A;  4E71 A;  2WGS A;  4RF0 A;  2INN E;  1HE8 A;  3I63 C;  1HZ6 A;  3TEW A;  1KRH A;  4TKN A;  3ECI A;  4O1N A;  5CHW A;  4MM3 B;  2BWF A;  1C77 A;  4NPN A;  2KZR A;  5KHO A;  2IO2 B;  2W3R A;  3RNF C;  1WYG A;  5I4D A;  3HK0 A;  4NJC A;  3AH7 A;  1P7F A;  3E9S A;  4RGM A;  4WUR A;  1SSN A;  4NJ6 A;  4HXD A;  2KJH B;  2KX0 A;  3SDL C;  3DPD A;  1AN8 A;  1BUI C;  3N32 A;  1STE A;  4LNI A;  2KWC A;  4GLS C;  2LZ6 A;  3RNG C;  1SIF A;  3AV8 A;  1OQQ A;  2J0J A;  2BTE A;  2JPH A;  1JRU A;  2WYQ A;  4KKI A;  3T3O A;  3R7Q A;  3KWV A;  1WZ0 A;  1SGH A;  3ZNG C;  4HPP A;  1T0S C;  2Z8L A;  3N30 A;  4YWG G;  3AM9 A;  1C3T A;  1VZ7 A;  3GB1 A;  3HM3 A;  4HPM B;  1YN5 A;  2WDT B;  3APC A;  2OED A;  3TL5 A;  2GBJ A;  2IGG A;  1WY8 A;  2H89 B;  3N1Z C;  2LHE A;  5DPS A;  3MC8 A;  2NR2 A;  3A9K A;  2J0M A;  4TMA B;  2SAK A;  2L7R A;  2N7E A;  1BXT A;  1RRB A;  4W9F A;  2W3S A;  5IP4 D;  1GPX A;  5L95 C;  3ZDT A;  3X0W A;  2K39 A;  3SU8 X;  2C7H A;  1WZ3 A;  3WIM A;  4EZK A;  1MVK A;  1V80 A;  4H2A A;  3APF A;  5AUI A;  1WGK A;  4K7U A;  3ZJT A;  4ASW C;  2GBK A;  1WGY A;  3LYY A;  3QJZ A;  2FCN A;  2CS4 A;  1EO6 A;  4ARI A;  1R4N I;  1Z5S B;  4RH6 A;  2LJI A;  1ET6 A;  2K8H A;  5D2M B;  1ZDX A;  3R2I A;  2REX A;  3D32 A;  4MJS B;  2C7N B;  2KTR B;  4BBN F;  4NNJ B;  4AOF A;  2CU3 A;  3KUZ A;  1FNW A;  2ZZP B;  2V4L A;  1QOB A;  2KN5 A;  4K7S A;  4L2Y A;  4XX5 A;  3OLM D;  4ITK A;  1TS2 A;  4MEL A;  1YQ4 B;  1L0X B;  4N6E B;  3AUL A;  4XWT A;  1PDX A;  2MBO A;  4XC2 A;  2O2V A;  3Q8A A;  1R4M B;  1QOF A;  3KYC D;  2W54 A;  3PRE A;  2OJR A;  3B0A A;  2DZK A;  1DYQ A;  2KTR A;  3IT4 B;  2V3P A;  3VR8 B;  2MWS B;  3QX1 A;  3W1S C;  3TSS A;  1UF0 A;  3ENE A;  3IG3 A;  3I9V 1;  1NVI D;  2CJO A;  3AE9 B;  3VVW B;  5J18 A;  2Z0D B;  1MHX A;  1FFU A;  1J7A A;  4GGQ A;  2RMM A;  2JRI B;  5EDS A;  3MJW A;  4RM8 A;  4A6Q A;  1JWA D;  2C5L C;  1OEY A;  4ARC A;  1S1Q B;  4C7Y A;  1E8X A;  3DBL B;  1IUE A;  3VHT C;  1FD6 A;  3L17 A;  1M4V A;  1YNT E;  2MJE A;  1ZUD 2;  1FXT B;  3LB8 C;  3FKY A;  1HEZ E;  3M95 A; 
#chains in the Genus database with same CATH homology
 2LEK A;  2WU2 B;  2PVG C;  3T3N A;  3FIL A;  2Y3A A;  3BII D;  1AYF A;  4NAW B;  2I2Y A;  3VRB B;  2AQ1 B;  1N63 A;  1D5Z C;  4USA A;  1VJK A;  1QF6 A;  2N0S B;  1YN4 A;  1FIQ A;  2FUG 1;  2RPV A;  1PFD A;  4MT5 A;  1SB3 C;  2N7J A;  2QSD A;  1J7B A;  1J7C A;  1L0V B;  3R2T A;  2ZW1 A;  3AE6 B;  4J3O D;  4TSS A;  1FO4 A;  1TKE A;  3CWI A;  2GB1 A;  2LFI A;  3BK1 A;  3AN1 A;  1E9M A;  2M56 B;  1SEB D;  4RNA A;  1GAQ B;  3W5V B;  2OHF A;  3AEF B;  4OW0 A;  2L1A A;  1YQ3 B;  3Q69 A;  1JML A;  2K9X A;  2JU6 X;  3BYY B;  1YJJ A;  4RFB A;  3SR6 A;  3TEX A;  3BWU D;  3P4Q B;  2BT6 A;  2XNA C;  1WXQ A;  3I57 A;  4JX1 C;  2EKI A;  3AE4 B;  1XO3 A;  3IAS 1;  4ZHP A;  5JXV A;  4B0M A;  2PTL A;  1NEN B;  2NTS A;  4IKG A;  4R3D A;  2W82 A;  1C76 A;  1T6B X;  4NAM A;  4YSZ B;  1F2R I;  5G5G A;  4C80 A;  3EGR A;  1TYG B;  3U2S C;  5BMH A;  1FRR A;  1ESF A;  1F77 A;  2KQ4 X;  2LUM A;  4LTU A;  1KTK A;  5TSS A;  2PKO A;  3SFD B;  1XLQ A;  1Y56 A;  1ZXI A;  2Y5P A;  2K3U A;  1CK1 A;  2L32 A;  2LGI A;  1V1P B;  2QIL A;  2YEP B;  2BS4 B;  2WXF A;  4KX6 B;  1TS4 A;  2ON8 A;  2J53 A;  1HQR D;  2NTT A;  4YT0 B;  3R8B A;  1UWX A;  5H8Y E;  1VZ6 A;  4YTM B;  4LLG M;  5BYS A;  5LNK 1;  1DGJ A;  3BYT B;  5AUK A;  4A9A A;  4GDK B;  1L0Y B;  3Q8C A;  1DOI A;  1FRD A;  5EE0 A;  3W9C B;  1XEE A;  4N59 A;  2WDV B;  2JXT A;  3DWG C;  2PIA A;  3AMZ A;  4L1B A;  2MH7 A;  2K0P A;  3Q8E A;  4US9 A;  3C8Y A;  1FM0 D;  2X38 A;  1DOY A;  4US8 A;  1L4Z B;  1JWM D;  2J42 A;  1PUT A;  2RDH A;  2WNM A;  3OWE B;  1SIJ A;  1D5M C;  2D5G A;  1FXA A;  3PO0 A;  4YTP B;  4FXC A;  1KLG D;  2W55 A;  4P16 A;  4AS1 A;  1PYW D;  3U7Z A;  3W1S A;  1TY0 A;  4JPS A;  2R61 A;  1WSP A;  4WIP A;  1RM6 C;  1D6E C;  2IGH A;  2WXJ A;  1KH0 A;  1V8C A;  4ZRQ A;  1QT9 A;  2EEL A;  4OHJ A;  3L4P A;  3AEE B;  5EE9 A;  2V3N A;  1V97 A;  1RYJ A;  4M0W A;  1I4P A;  4OZA A;  1CJE A;  1JAL A;  2HDE A;  1L6U A;  3SFE B;  2IJ0 A;  1YMH E;  3AE5 B;  2CJN A;  4OVZ A;  3V05 A;  2M19 A;  2QMT A;  3N9Y C;  2KMM A;  3AEC B;  5T8I A;  5EE1 A;  1JQ4 A;  5C2T B;  2H88 B;  1EWC A;  3BVM A;  2BS2 B;  1ZXH A;  2MJ3 A;  1JCK B;  3AEG B;  5H92 C;  4A90 A;  3E56 A;  3ZYY X;  3MC0 B;  1N60 A;  3B9J A;  1JRP A;  2DBY A;  5HHD G;  5BMG A;  1ZP0 B;  1E6E B;  3DWM A;  3ZQ4 A;  3ZGZ A;  2JSV X;  1C79 A;  3B2F A;  1B9R A;  1SE4 A;  1FXI A;  2INP E;  2K5P A;  4HKZ E;  4L23 A;  3EA6 A;  1VDV A;  4AQ7 A;  2GRI A;  3VR9 B;  1GB1 A;  1B1Z A;  3Q8B A;  3U4E G;  1SE3 A;  1SJE D;  4ZRP A;  1FNV A;  1L4D B;  2ONQ A;  2WDR B;  3W2D A;  2WDQ B;  3HRD D;  1NYQ A;  4EE2 A;  3B2G A;  5BMI A;  4UDU C;  1TS5 A;  4RCO A;  2N9K A;  4ZHO A;  2I38 A;  2NMQ A;  5FK9 C;  2B76 B;  2N9L A;  1MI0 A;  4RGT A;  4ZOH C;  2HTM E;  1C78 A;  4CQN A;  1XLN A;  1UNS A;  3ZJV A;  2KWD A;  4HJG E;  3AE2 B;  4DXG A;  2FE8 A;  4N58 A;  2QEJ C;  3PZ8 A;  1F0Z A;  2BS3 B;  1I4Q A;  1NEK B;  2G9H D;  4JWS C;  2L83 A;  2YEP F;  1C4P A;  1QKZ A;  2WXL A;  3MJ5 A;  2DYM A;  3HVD A;  4HRO A;  2WXR A;  2IGD A;  1PGA A;  1DOX A;  3ABV B;  1CZP A;  1IGD A;  1ROE A;  1A70 A;  1VRA B;  4REZ A;  3U52 E;  3NS1 A;  2WXO A;  2Y5C A;  2QIE B;  3KWL A;  2DLB A;  1UGJ A;  3H8H A;  1E10 A;  5D3D A;  1GB4 A;  1FCC C;  2WXG A;  1ZPS A;  1FNU A;  2BW2 A;  3NVV A;  1IBX A;  2AX5 A;  2K22 A;  2V4I B;  1QLB B;  2WLB A;  1NI3 A;  5HFY A;  1EM7 A;  3UI3 A;  1GOZ A;  5MPO A;  1LO5 D;  4WWM A;  2G1E A;  1FMA D;  3J9C A;  3BK2 A;  2PLP A;  4GDL B;  2TSS A;  1JWB D;  2RDG A;  1F2R C;  2JX5 A;  1PGX A;  4YSY B;  1I4H A;  2QJL A;  2E3T A;  1C4A A;  4RF0 A;  2INN E;  1Q10 A;  1HZ6 A;  2E6X A;  3TEY A;  3TEW A;  1KRH A;  1XXG A;  1JWS D;  4KGS A;  4O1N A;  4MM3 B;  2JYE A;  1HZ5 A;  4WQM A;  4XE0 A;  1OQR A;  3AE8 B;  1K52 A;  3IT6 B;  4OZB A;  1MPE A;  1WWT A;  2ZW0 A;  1C77 A;  1NYR A;  1YN3 A;  3GP7 A;  3NZ3 A;  2VZK B;  3IAM 1;  4IOI E;  1AWD A;  4XDC A;  1EWY C;  1EU3 A;  2W3R A;  2BBC A;  1WYG A;  5I4D A;  1CQV A;  3TUO A;  4NJC A;  3AH7 A;  4C56 C;  1P7F A;  3E9S A;  4RGN A;  4RGM A;  4WUR A;  1XF5 L;  1SSN A;  1KLU D;  4ZYS A;  1AN8 A;  1BUI C;  1D4B A;  1I4G A;  1VR9 A;  1STE A;  1TZO A;  4KGT A;  4GLS C;  1XCQ L;  1FEH A;  2KAJ A;  3SEB A;  3AED B;  1L5P A;  1FCL A;  4DQO C;  1I7H A;  5D3I B;  3BVZ A;  5G5H A;  3CIR B;  3AE7 B;  2WQY B;  2LMC A;  4DXF A;  1HA5 A;  3VRA B;  3AV8 A;  1OQQ A;  2BTE A;  5D7G A;  1E7P B;  3MHZ A;  4KKI A;  5C3J B;  1ZDV A;  2WXQ A;  3AB5 A;  5HI1 A;  3T3O A;  3KWV A;  4RF1 A;  1P7E A;  1K50 A;  3URY A;  2KDM A;  1YJI A;  1SXT A;  1K53 A;  3BVG A;  1BML C;  3KLS X;  3P42 A;  3P4P B;  4TQ1 A;  2BYT A;  3PZ7 A;  2JZP A;  1C4C A;  3RFZ B;  2Z8L A;  4B0E A;  4YWG G;  2AQ3 B;  3AM9 A;  4WH4 A;  1VZ7 A;  3GB1 A;  1YN5 A;  1TKY A;  3FC4 A;  4KGR A;  1IBX B;  4MH8 A;  2OED A;  1ACC A;  4A55 A;  4D2K A;  1VZ8 A;  2IGG A;  4LK0 M;  2H89 B;  3O13 A;  2LHE A;  3KQ4 A;  3P4R B;  5FKA C;  3WCQ A;  4TMA B;  2SAK A;  1BXT A;  3AEA B;  2JWU A;  2W3S A;  1I4X A;  3AE3 B;  2DYO A;  1GPX A;  3IXS A;  1V1O A;  1OFF A;  2KN4 A;  2AQ2 B;  3P63 A;  3EUB 2;  3Q8F A;  2M0A A;  1C9F A;  2DWQ A;  4JE3 B;  1MVK A;  4H2A A;  2WP9 B;  2FBW B;  4XWW A;  2J4X A;  1T3Q A;  1ET9 A;  5AUI A;  1WGK A;  2PW9 A;  1D5X C;  3ZJT A;  1UWM A;  4XDD A;  2MJD A;  3RPF C;  3LYY A;  3AEB B;  3HUI A;  1N5X A;  1SF0 A;  2MEK A;  1JRO A;  1ZOY B;  1XCT L;  3AE1 B;  1EU4 A;  1HXY D;  2WXK A;  2VZK D;  1N5W A;  4IDI A;  1QIL A;  5GXG B;  5FR3 A;  4ARI A;  3NVY A;  3P1M A;  4RH6 A;  1PGB A;  4RGO S;  1MHH E;  2WU5 B;  2IPK D;  2LJI A;  1SE2 A;  1ET6 A;  4C7Z A;  5E6J A;  1JWU D;  1ZDX A;  2SEB D;  3NRZ A;  3R2I A;  4Q2J A;  1QOG A;  2ACZ B;  4WAF A;  5HG2 A;  1TJE A;  3NUH B;  3NVZ A;  1E0Z A;  4YTN B;  4OZC A;  4HEA 1;  5BYQ A;  1QOA A;  1K51 A;  2CU3 A;  1FNW A;  2WXP A;  4P6V F;  1QOB A;  2WXN A;  2BB5 A;  1IGC A;  4L2Y A;  1RWS A;  1FFV A;  2WS3 B;  4ITK A;  5EE3 A;  1R7S A;  1TS2 A;  3V3X A;  1YQ4 B;  2Q5W D;  1L0X B;  4N6E B;  2JQR B;  4XWT A;  1PDX A;  3VQI A;  2WXM A;  2WXH A;  1N62 A;  4MAC A;  2JYT A;  1L6V A;  2BB6 A;  1RFK A;  3Q8A A;  1QOF A;  1ZE3 D;  2W54 A;  2ICI A;  2KAC A;  3TEZ A;  1ENF A;  3ETR A;  1TS3 A;  1XLO A;  1QQR A;  3HVZ A;  3BZD B;  1DYQ A;  4HKQ A;  3W5U B;  3ZJU A;  3IT4 B;  1V1P A;  1XLP A;  2V3P A;  2PVO D;  2XN9 C;  3VR8 B;  3TSS A;  3I9V 1;  1NVI D;  3FIL B;  1SJH D;  2CJO A;  3AE9 B;  1UUP A;  1SBB B;  1VLB A;  4TQ0 A;  4YXD B;  1MHX A;  1FFU A;  1J7A A;  3GS2 A;  2V0G A;  2RMM A;  2IDY A;  2LHD A;  4A6Q A;  1WRI A;  1JWA D;  3LXF A;  3MFG A;  4PT5 A;  4ARC A;  4C7Y A;  2L52 A;  4KKJ A;  5BYR A;  4A8X C;  1KF6 B;  3P4S B;  3FAH A;  2WXI A;  1I4R A;  4HRS A;  1IUE A;  4NZL B;  1TKG A;  1FD6 A;  1JW9 D;  2GI9 A;  3NVW A;  4JWU C;  1M4V A;  1N61 A;  1YNT E;  2MJE A;  1TY2 A;  1ZUD 2;  3LB8 C;  1T5X D;  2PMV A;  1KFY B;  4YSX B;  1HEZ E;  3MP9 A;  1AW7 A;  2J52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...