5BMHA

Nitroxide spin labels in protein gb1: t44 mutant, crystal form b
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
b'MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWCYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Rotameric preferences of a protein spin label at edge-strand beta-sheet sites.
pubmed doi rcsb
source organism Streptococcus sp. group g
molecule tags Immune system
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5bmhA00
2KWDA 2N9KA 1MHXA 4HJGE 1GB4A 1JMLA 2JZPA 1C9FA 5HI1A 2JU6X 4KGRA 2JSVX 4GLSC 1YNTE 1MI0A 3MP9A 3GB1A 1KH0A 2LGIA 2ON8A 2LHDA 1FCLA 5BMHA 3UI3A 5HG2A 1QKZA 1FD6A 1HEZE 2GI9A 1ZXHA 1P7EA 2PW9A 4IOIE 2GB1A 2J53A 1XCTL 5BMGA 1MVKA 1IBXA 3FILA 1F2RI 4OZBA 5HFYA 1HZ5A 2KACA 2PTLA 2RPVA 2I38A 2KN4A 1IBXB 1F2RC 4D2KA 1IGCA 3FILB 2N9LA 3V3XA 2K0PA 2LUMA 2OEDA 2LHEA 1PGAA 1IGDA 2NMQA 1K52A 2QSDA 2I2YA 2J52A 2ONQA 1K53A 2PLPA 1YMHE 2JXTA 4MACA 2JWUA 4HKZE 1D4BA 2IGHA 2ZW1A 1MPEA 1PGBA 1K50A 4OZAA 2EELA 2KDMA 1HZ6A 2RMMA 1P7FA 2IGGA 1EM7A 1UWXA 4KGTA 1FCCC 2IGDA 4IKGA 5HHDG 1Q10A 4WH4A 2ZW0A 1XF5L 5JXVA 2KQ4X 4KGSA 5BMIA 1PGXA 2QMTA 4OZCA 1XCQL 1GB1A 2N7JA 1MHHE 1K51A
chains in the Genus database with same CATH superfamily
1WZ0A 3K9OB 2NTTA 1P1AA 1UF0A 4KX6B 1ZW7A 1JMLA 3NVZA 3PLVA 2LVPA 3M62B 2LXAA 2K39A 3KWLA 4FJZA 4AQ7A 4G50A 4WJQA 1QOBA 1TZOA 1LXDA 4W9JA 1YIWA 1ZE3D 3PSEB 5TR5A 2KHWB 2HD5B 1WI0A 2V0GA 3PO0A 1FXAA 4C7YA 4NPNA 4WJOA 2LASA 3ETRA 4N58A 2I1KA 3MHZA 4LNNA 1LGRA 4RGMA 1CK1A 2WDVB 2DYBA 1TJEA 4HVBA 2KJHB 2K5PA 3DQVA 2A5UA 3NZSA 5LXIB 4PK1A 3HM3A 4NQKE 4EUTA 2RDBC 1H8CA 1KLUD 2VZKD 4KZ0A 5DPTA 5C1ZA 4G11A 1UWMA 1WWTA 4RF0A 2O2VB 1WGYA 3RNFC 1HE8A 1V49A 4II2B 4DHJB 3APCA 3PRMB 1ZPSA 2WX1A 4II3B 1VZ6A 3VRAB 4P1BC 1C4CA 4LDTB 4HK2A 2GBKA 4M02A 3EECA 3V05A 3I57A 3QK0A 5JHAA 4ANUA 5EE1A 3DBRB 3O65B 3OG5A 2JVCA 3HM6X 3AEFB 3MC0B 1NYQA 4GMVA 1XCQL 2WXQA 1UZXB 2FIFA 3DVNU 3JYUA 1P0RA 2KWDA 5DPRA 2WXMA 3QHTA 2EKIA 2Y3AA 4BBNC 3PLUA 4G3XB 2KNBA 2JU6X 1FFUA 2M19A 2WP9B 2PJHA 1TS3A 3MJWA 4O1NA 3MP9A 2FNJB 2IDYA 3GB1A 1VRAB 2XN9C 3N3KB 4W9IA 2JZ3B 2BWES 3A1QA 5C2TB 3RNEC 1WZ3A 1YQ3B 4ICUA 4NNJB 4DHJD 1KM7A 1RRBA 5H92C 2I1JA 3U52E 5KHOA 2GMIC 3A9KA 3N32A 2I38A 2IYDB 2LRWA 3RCZA 3AEBB 3Q3FA 4YSXB 2WU2B 4LDTD 2QJLA 3RFZB 4TUUA 1V1PA 4FA6A 1VJKA 3AH7A 2BF8B 1GAQB 2RGFA 2DX5B 2GBNA 3P63A 4HPMB 1HXYD 4A3OA 2J52A 2MW5A 2BB6A 3KVFB 1SGHA 4KDLB 2WGSA 4AOFA 2IY0B 4WAAA 2QCZA 1M4VA 1FXIA 3KUDB 4DXGA 4PYUA 2AL6A 3ZXRA 2PMVA 2KKCA 4GDKA 1TYGB 2N1VA 3R3MA 1Q10A 1JALA 1XT9B 1XF5L 3UINB 4J6IA 4NAWB 1C4PA 3VDZA 1VZ8A 1L6UA 2FAZA 1E5WA 2N7JA 2LFIA 4DXAB 1Q5WB 2N9KA 2SEBD 2BYEA 1WRDB 1B1ZA 2DBYA 3QA8A 2YLMA 1EU4A 2ZEQA 4C00A 2CR5A 3ZJVA 3RNGC 1WE6A 3Q8AA 4ARIA 4DHZB 5AEKB 4FHKA 3RPFC 2JX5A 2LGIA 3AE1B 1I7HA 1CQVA 1HA5A 4WWNA 4I6NB 4YSZB 1SJHD 2J4XA 4K3CA 1D5MC 2Y5CA 4HRSA 4WQMA 2JUOA 2Q5WD 3UIOB 3DBLB 2BB5A 2C5LC 3A1QB 4NJ6A 3HHMA 1MVKA 1P9DU 2FUHB 4OZBA 2CKHB 1E7UA 1Z2MA 1I4GA 2BS3B 1J7AA 2AX5A 5D7GA 3L13A 3WIMA 4A90A 4YTPB 3A9KB 1WMHA 3VR8B 1E0ZA 2LWPA 3ENEA 4C4VA 2JF5A 1WJ6A 4TSSA 4ZRIA 1V1PB 3SU8X 1V97A 2CU3A 1TS5A 2PLPA 2K8BA 4ITKA 1NI3A 2L76A 3Q2AC 1UD7A 1CJEA 4IM3A 1UGMA 4ASWC 4REZA 3AU5A 3ZTDA 1ZOYB 4GB9A 1WXAA 3U30A 2HJ8A 1WFYA 3N20C 2INCC 1ZKHA 2L0FA 3QIJA 2PEAA 1WR6E 4B9KA 2QHOA 2WDQB 2YVCA 4GDKB 4HJKA 3QJZA 1MJDA 1JWSD 4N6EB 1HTOA 1R4MI 1GB1A 1V8CA 2BYFA 4LJOB 5IKCM 3ZNHB 4TMAB 1XD3B 4EE2A 1MHXA 4XDDA 4HLEA 2KFKA 2L7RA 3KWVA 2ASQA 3NUHB 1C9FA 2W55A 4XC2A 2WXPA 2DZMA 5E6NA 1SE2A 1JWAD 4MSQB 4BFRA 1XLNA 1IUEA 1OQYA 4TKNA 5CHWA 1KH0A 4BOSC 4M01A 5CHFA 1QKZA 3C0RB 2D2QA 1L2NA 2UYZB 2R2OA 1UNSA 4ZRQA 2D3GA 2J53A 3AV8A 2GBJA 4CYEA 4JL9A 3NOBA 3ZNZB 2KN4A 3Q3NC 3CSFA 3FC4A 3NRZA 2AQ1B 3ZJTA 3DPDA 4FN2A 1WMHB 4FADA 2DENB 5CTRC 2MJDA 4C4VB 2KWVB 2D3CA 4L1BA 2KFJA 5IAAC 1MPEA 3I9V1 3R7RA 4S17A 5D94A 3P42A 1UBIA 4HEA1 3K9PB 4MSMB 2XK5A 2KDIA 4XZ4A 1WGKA 2KQSA 2MQJA 4FHJA 1SJED 4GOCA 3BZDB 3TUOA 4KGTA 3PHWB 3IG3A 4NQLB 4WAFA 2WYQA 3NS8A 2WDTB 3AE7B 5BMIA 1PGXA 1QLBB 3TJPA 4TQ1A 2RPQA 2WXNA 1PFDA 2PE9A 2KLGA 3LXFA 2INPE 4JLCA 3BVZA 1CMXB 3W2DA 1Y56A 2JPHA 4PT5A 3PZ8A 2KFKB 3A33B 3HVZA 4LTUA 2IO1B 2KDBA 2ZCCA 3SHQA 2C7NB 4HPPA 4XDCA 2AYOB 3KYDD 2INDC 2MJEA 1FNUA 1SIJA 2XBBC 4FJVB 4A6QA 2ON8A 4HDQA 2MLBA 1T3QA 1HEZE 2GI9A 5C3JB 3ZO5B 1P7EA 4A3PA 2PW9A 1C4AA 3VXWA 4K3BA 2L05A 3IBEA 2MBQA 1ZGUB 1WJ4A 3DVGY 2QC8A 3BYTB 2N9LA 2K0PA 2LHEA 2BS4B 3RYTA 2OHFA 1DOXA 3ECIA 2NMQA 1KJTA 2BVCA 2QSDA 4RH6A 4EZLA 3ONSA 2RDGA 2K3UA 4OVVA 2AL3A 2C9WB 3WAPA 3WCQA 3PPAA 3B2FA 1NDDA 3RULA 1PUTA 3IXSA 2XK5B 1C79A 1BMLC 4HPLB 4OW0A 4K1RB 4I6LB 4OVZA 1YQBA 2Z0EB 1SBBB 3OAWA 4ICVA 2JYEA 2R61A 2KYWA 2FCNA 4RCOA 4JQWC 5D2MB 4BOZB 1T0RC 3HVDA 5HI1A 1UBQA 1RYJA 2PVOD 1DOIA 4JPSA 4RGOS 3ZVVA 2MHJA 2WXKA 4GIVA 1JROA 1WY8A 2RR9A 4EZJA 2DYOA 2H89B 2W3SA 3ZGZA 3E56A 5EE3A 4USAA 3SFDB 3L17A 4W9FA 1FNVA 3WALA 3UF8A 3I63C 2CU1A 1V86A 2GB1A 2BQQA 3PT2B 1OEYJ 1L0YB 1ENFA 3P1MA 4H2AA 2RPVA 2NS5A 3B9JA 4BVUC 4RF1A 1GG3A 2M8SA 2JWZA 2ZNVB 4ZYNA 1GOZA 1MG8A 4KDIC 2I2YA 2G1EA 2ONQA 2QEJC 4DWFA 4MT5A 3TSSA 2LVOA 2X8XX 2CS4A 3EHVA 4WURA 2W9NA 3GE3C 1P7FA 2IGGA 3AE4B 1VD2A 4ZRPA 2M1MA 1SEBD 3Q3MC 3SD5A 5AUKA 2IO0B 2MJ3A 1NVID 5EE9A 5BYRA 3PVLA 1N60A 3AE5B 2KQ4X 1J19A 1KFYB 4M8NA 4DQOC 1FRDA 4FJYA 3B08A 2MP2A 4BBNF 2FCQA 1OGWA 4NAWA 2BWFA 2JSVX 2X38A 1LQBA 1YNTE 4MGYE 3SR6A 2K9XA 3R2IA 1WXSA 1WX9A 5L83A 2CHZA 3ZRFA 2WXRA 4HWIB 1NYRA 1WRIA 1RLFA 1A5RA 4OVUA 2ZVNA 3AB5A 2NR2A 5L95C 1F2RI 3A9JA 2H88B 2NBWB 4UDUC 1AARA 5BO4B 1J8CA 5IN7A 4D2KA 1IGCA 4K81A 3V3XA 3DHGC 4RNAA 3RN9C 2KZRA 3U7ZA 4AP4C 2V4IB 1I4QA 3ML8A 2MBEA 3AULA 1YJJA 1AWDA 3RT3B 2IBIB 3TL5A 4RFBA 3TBLD 1R4NB 2ZW1A 2KLCA 2MEKA 1PGBA 2V3NA 3Q69A 1V5OA 2KDEB 4XGAB 5JHBA 4KV2A 3VVWB 3P4RB 1RAXA 1UWXA 2K8HA 2N4FA 1JQ4A 3AEGB 3PREA 1MG4A 1V1OA 3T3NA 2L3ZA 3WAOA 5JXVA 4RM8A 2KT7A 1XLQA 1M94A 2KVZA 3VUXA 3OJ3A 3OJ4B 1T0YA 3H7SA 2RSUA 4GGQA 5E6JA 2LZ6A 3Q14C 3BK2A 1TIFA 2LRUA 3AE9B 1A70A 1F52A 4J3OD 4EKUA 2D3BA 2MP2B 4GSWA 3SDLC 3ZDTA 2KXJA 3RUIB 5BYSA 2PKOA 2IO3B 3KQ4A 1JRUA 2OJWA 2QDFA 4WIPA 4A9AA 2KMAA 3J9CA 1E8XA 2DNFA 1P3QU 4B95A 1LM8B 1YQ4B 5FK9C 2FCMA 1KOTA 4MEMA 2M0AA 3R7QA 1IP9A 5FR6A 1NENB 2V4LA 3NZUA 3WA0A 3L16A 3AE3B 2BKFA 2B3AA 4L2YA 3AM9A 3N1XC 4WQOB 1V9JA 3EA6A 2LGXA 5AZGA 1TGZB 1E90A 1F2RC 4MGZE 3TEWA 3A9JB 4K7SA 5FR3A 3URYA 2N7EA 2K8CA 3NHEB 1IGDA 1RM6C 5E6OA 4XWTA 4NJCA 2MH7A 1T0SC 2K6DB 2IGHA 2MBOA 2KO3A 2KWUB 4KVGB 3TEXA 3DOWA 1T0QC 4OZAA 3VUWA 3D32A 5J18A 3U8ZA 3BK1A 3IVFA 2CHWA 2AWTA 4HCPB 1FM0D 2TSSA 4F8CB 2KANA 1F9JA 3ZTCA 4ZOHC 2Z59B 5T8IA 2V9HA 2N9PC 1R7SA 1E6EB 4DHZE 4AJWA 5J17A 1C1YB 4X57B 4WJNA 1TT5B 5J2RA 2JZPA 1DOYA 1PYWD 1RFKA 2HE7A 2CHXA 1JWUD 4W9KA 3ZNID 4GLSC 3MC8A 3ZIMA 1GJZA 2AQ2B 1MI0A 2UU7A 3TMPB 2O6VA 4WJPA 4NAMA 1VCBA 1OFFA 3VTWA 5HG2A 4K7UA 3MTNB 1FD6A 2DZKA 2KTFA 1LO5D 4W9LA 4C56C 4W9GA 3A4SC 1GNUA 3VFKA 1JRPA 3V60A 2DZIA 4IOIE 1KLVA 1IBXA 3RNBC 3V6EB 2D07B 1WSPA 4LK0M 2KJ6A 1G6JA 2ZVOA 1SE3A 3QCAA 5EE0A 3PZ7A 1KRHA 2BW2A 2LXCA 4CQNA 4PYZA 1TZ1A 3V62A 4IWQA 3LJ3A 2LJ5A 3QAQA 5H8YE 4PS8A 3PTFC 2WXLA 3A4RA 2JXTA 2Z8LA 4ACFA 1J7BA 1WGRA 2NVUI 5G5HA 1N61A 2EELA 4AUQC 1WR1A 1ZP0B 3T3OA 1FCCC 1BUIC 3IT6B 3BVGA 2NBVB 2FUG1 3OWEB 1KTKA 2Y5PA 3RNCC 1D6EC 1VDVA 4JE3B 1TTNA 5G55A 2QMTA 1SE4A 3FAHA 2R2QA 4NZLB 3QWZB 4JWSC 4YTNB 1MFWA 4ZRJA 4A8XC 1WM2A 1F77A 3P2BA 2E3TA 3P4PB 3AU4A 4RM9A 3AEDB 1CZPA 4JWUC 3ZYYX 2G3QB 3W5UB 1JCKB 1T5XD 4LLGM 3ZRCA 4BAXA 2O6VB 2BKRB 1DYQA 3MFGA 3NG0A 1WYWB 1L4ZB 1PQSA 2EMTA 3FILA 4MH8A 5HFYA 4PS7A 5BYQA 1FO4A 1IBXB 3VRBB 4BKGA 3MHSD 1L0XB 2J0MA 3NS1A 4CO7A 2BGFA 4ZHOA 5KHQA 1QOAA 2BPSA 2WXFA 4F1SA 1ZUD2 2KMMA 1C77A 1R4MB 1I42A 4GXBA 2IJ0A 4R3DA 2KOXA 1GC6A 1N5WA 4EOYA 1OEYA 2WX0A 1SF0A 4BZAA 3DBSA 3ZDMC 1EUVB 1EO6A 1FFVA 3H6NA 3ML9A 2EKEC 1Z5SB 3ZLZA 3U4EG 2WXHA 1UUPA 2L52A 4WH4A 2GOWA 4AWJA 3AEAB 2VH2A 2C7HA 2LVQA 1MHHE 4RGTA 1ET9A 1I4HA 1YD8U 2DAJA 2L32A 1C78A 5TSSA 1SSNA 1L4DB 2KTRA 1GB4A 2HJ1A 2O6VD 5C23A 3X23A 3NY5A 2UWQA 4GU2A 1I4XA 1E7VA 2NCNA 4IC7B 2N9XA 4KGRA 1WF9A 1D3ZA 5FKAC 2AQ3B 1OTRB 3DBHB 2G4SA 3IT4B 3DBRI 4RMAA 4MH0E 1SE9A 3VHTC 3TEZA 2LHDA 1YJIA 2VH1A 3X0WA 1QF6A 1E9MA 3UGBB 4KKIA 2L1AA 4WWOA 2CJNA 2IPKD 1IYFA 3QQ8B 4CHKA 2KACA 2N1WA 1XLOA 3N1ZC 4HCNB 3KLSX 3N30A 3FILB 1L0VB 3PHXB 3JVZX 1LFDA 1V5TA 4K7WA 2HTHA 4B6WA 1TKGA 2VZKB 3BINA 2MCNB 2NPTA 3EFCA 3Q8FA 3RZFA 3OLMD 3ALBA 1L5PA 1Q1OA 1UH6A 4E3CA 1WX8A 4N9F4 3QC8B 1L6VA 3PRPB 2KK8A 3IFWB 1C3TA 2V3PA 3M3JA 1TBEA 4ZRKA 1J0GA 2A4ZA 4DK5A 4C7ZA 1BT0A 2WS3B 2GLSA 2K6QA 3ABVB 4DDGD 1N63A 1T6BX 1YN5A 4HDOA 3P4SB 2L83A 3TEYA 1KLGD 1QILA 1OQQA 4FULA 1D5XC 2BYTA 1C76A 2JXXA 4AJYB 2RDHA 4WWMA 1D5ZC 4LNFA 4W9DA 3AMZA 5D3DA 3L54A 4MDKE 2BBCA 4HJGE 3L0WB 4NY0A 1NI2A 4MELA 4P7IA 2OOBB 2BYVE 1U4AA 2LI5A 4US8A 4HROA 3APFA 2G4DB 2KTRB 1E10A 3VH3B 4OHJA 2KX0A 1FXTB 2AEHA 5D3IB 2G9HD 4FLHA 2WWZA 3RI7C 2RD0A 2KX3A 1RFAA 1WXMA 3GZNB 2WU5B 2KC1A 1V81A 3B1LX 2D11A 3EC8A 3SEBA 1VLBA 2WHIA 4MM3A 1QQRA 3NVYA 1ACCA 3C8YA 3Q8CA 4IM0A 4KSLC 2PPHA 1HZ5A 4L23A 1JWBD 3W5VB 3I5JC 2LGYA 3QARA 4KKJA 2JY6A 3HUIA 2ZCBA 4WWPA 2WNMA 1GUAB 2M4NA 4TV3A 3UIPB 4B0MA 4XWWA 4EFOA 1I4RA 4IW0A 2MA9B 3T8MA 4MACA 4HKZE 4C80A 2NPTB 5CX3A 2M0XA 4JIOU 5LNK1 1WX7A 3DBLI 1WGDA 4BKSA 5D6JB 1QT9A 1ROEA 3L08A 2PIAA 3GP7A 2IO2B 3I3TB 3LB8C 2ZPNA 3JSVA 1XQQA 4IUMB 1ET6A 1UGJA 4IKGA 2DAFA 3ZW3A 5HHDG 3TCAA 3IHPC 2KJRA 4S0RA 4E71A 3GS2A 4Q2JA 1FRRA 1EF1A 2LGDA 2D10A 2N7DA 3PRZA 3VAWA 1XEEA 3E9SA 2DLBA 2G45B 2LJIA 2WLBA 4M8MA 1IPGA 4A55A 3MJ5A 3M95A 3U2SC 2KN5A 4MGIE 3AE8B 2GBMA 4LNOA 3PZDA 2M17A 1QZEA 3W9CB 3FKYA 4M00A 3DVGX 4NJ7A 3V61A 4LCDE 1DGJA 1E8YA 3JW0X 2E6XA 4YT0B 2GRIA 3PV1A 2HTME 1K8RB 4IWPA 1H4RA 2JZZA 3UI3A 3NZ3A 1V80A 3UQAA 2IY1B 3SFEB 1L7YA 1ZXHA 2ICIA 3W1SA 1ISNA 3KUCB 1B9RA 1SB3C 2JQRB 1FIQA 1YX5B 2JRIB 1WJNA 2DHZA 4MM3B 3UQBA 2KQ7A 1WIAA 3CIRB 5DCNA 2WDRB 2INNE 3BYYB 2N9EB 3T9LA 4XYCA 2LGSA 3W1YA 1V6EA 1TS2A 3N9YC 3Q8EA 1K52A 2SAKA 2V3SA 1TKYA 3NJTA 1J7CA 2J0KA 1K53A 2J0JA 4LJPB 2MX2A 4A20A 1YMHE 1AW7A 2KVRA 3AXCA 1WXQA 4MGKE 1K50A 2L0TA 4YSYB 3RNAC 3DDCB 3VUYA 4ANXA 2K22A 3AN1A 1WGGA 2KDMA 2RMMA 5LXHA 1XXGA 4LNIA 3H7PA 3BIID 4KZCA 3CF6E 4P6VF 3V6CB 2BS2B 3NVVA 3JSVB 3QX1A 1RWSA 2KDFB 2J42A 1EWCA 2KWCA 4KGSA 2WXOA 3AI5A 4HXDA 4OZCA 2HDEA 1K51A 1EWYC 1OQRA 2JYTA 1HQRD 1XLPA 3W1SC 3M63B 1P98A 2LMCA 2W54A 3C19A 4GDLA 5LLIA 3IAM1 4IM2A 2KC2A 3EUB2 5IOIA 3HK0A 3EGRA 5GXGB 2V1YA 1ZDXA 2FCSA 3ZXVA 4LNKA 1N62A 1EU3A 3N1YC 2FBWB 2W3RA 4YWGG 2ZJDA 2JT4B 3DCGA 5DPWA 2C60A 3ZNGC 2MBHA 4M0WA 4HKQA 4KIKA 3AE6B 1WE7A 2K25A 5AUIA 1S1QB 2D5GA 2PTLA 4EEWA 3BVMA 3CSTA 3AECB 5IO9A 2LUMA 1TKEA 3H9DA 1TS4A 2L00B 4BKSD 4AS1A 3MC9A 3VQIA 1WH3A 3B2GA 2C7MB 5MPOA 5EDSA 2LEKA 5HKHA 1ZXIA 3VTVA 1E8ZA 2WXGA 3KYCD 3LDZE 4E74A 1JW9D 3ZJUA 3HIZA 1SIFA 3DHIC 2JRHA 5I4DA 2IGDA 3H7PB 1YN4A 1S3SG 3Q8BA 2ZZPB 4IWOA 4YXDB 3KH0A 2QILA 4ARCA 3H1UA 4US9A 3RZWC 2J7QB 2WXJA 2MSED 3ZQ4A 1X1MA 2KD0A 4W9HA 2NTSA 4G0NB 3L4PA 4BKTA 3CWIA 4GDLB 1XO3A 1KF6B 4JGHB 1YX6B 1UELA 4FBJB 1N6ZA 3DBHI 1WM3A 5BMHA 1N5XA 3Q3JA 2PE6B 2MBBB 2Y5BB 1BXTA 4KSKC 3S2AA 4B0EA 2GBRA 3RMKC 4ANWA 4DXFA 4W9EA 5BMGA 4YTMB 3WANA 3PS6A 4M0WB 3L10B 4DDID 2VRRB 1NBFC 4KIKB 3R8BA 2REXA 3GOEA 1NEKB 1I4PA 4I6PA 1WGHA 2DWQA 4PS3A 1WYGA 2Z0DB 1EF5A 2B76B 2W82A 3ZKJC 2FE8A 3TIXA 2YEPF 4XX5A 2JWUA 4ANVA 3BWUD 2LUEA 2XNAC 1WXVA 4IG7B 2CJOA 2ACZB 4TQ0A 1ESFA 1QOGA 2EMSA 5DPSA 3VH4B 2WXIA 3EFUA 1FEHA 2KAJA 2XEWA 4GN1A 3NVWA 1V2YA 3APDA 3PGEA 4MJSA 5G2NA 3AE2B 5IP4D 1AYFA 1FMAD 2N0SB 2OJRA 3U7DA 2M56B 2L8JA 3KUZA 3DVNV 2LD9A 5G5GA 1HTQA 1TY2A 1VR9A 3R2TA 3IAS1 3KW5B 1QOFA 1STEA 5JZEB 4FXCA 4P1CC 4ZDVA 1SXTA 1YOVB 5JH5C 1FPYA 1VZ7A 3VR9B 3Q3OC 1WJUA 4JX1C 4W9CA 4QAYA 3DHHC 2QIEB 3LYYA 5AZHA 1FCLA 1E7PB 1PDXA 2DZJA 2PVGC 4ZYSA 2YEPB 4URKA 4DBGA 5AZFA 4ZHPA 3P4QB 2DYMA 2WQYB 2MRPA 4XE0A 3GZNI 1XCTL 1I35A 3WAMA 1Q0WB 3HRDD 3B0AA 1FNWA 1YN3A 1YJ1A 1F0ZA 2OEDA 2FIDA 5E6PA 1PGAA 2O2VA 3DWGC 2K1FA 3BY4B 3DWMA 1Y8RC 5GMVA 3R66C 1E8WA 2D3AA 2ZPYA 2KMCA 1GPXA 3ZUNA 3GE8C 1D4BA 2IZVB 5IA7A 1F1HA 1TY0A 4RGNA 4YL8A 4N59A 3O13A 4IDIA 2BTEA 4F7ZA 1HZ6A 1AN8A 1ZDVA 1JWMD 1EM7A 3H8HA 3AEEB 5CHVC 2NBUA 2ZW0A 4P16A 3Q6BA 2MWSB 2ZNVC 3VTUA 4EZKA 2BT6A 4MJSB 1R4NI 3CMMB 3RD2A 1GC7A
chains in the Genus database with same CATH topology
2LJIA 2WLBA 4A55A 2INPE 3MJ5A 2NTTA 4KX6B 3U2SC 1JMLA 2JZPA 3NVZA 1DOYA 1PYWD 3BVZA 1RFKA 3AE8B 3W2DA 1Y56A 4PT5A 1JWUD 3PZ8A 3HVZA 3KWLA 4GLSC 4LTUA 4AQ7A 3W9CB 1QOBA 1TZOA 2AQ2B 4XDCA 1DGJA 1MI0A 2E6XA 4YT0B 2GRIA 2MJEA 1FNUA 1SIJA 4A6QA 2HTME 2ON8A 1ZE3D 4NAMA 1OFFA 3UI3A 1T3QA 3NZ3A 5HG2A 1FD6A 3SFEB 1HEZE 2GI9A 1ZXHA 5C3JB 1LO5D 2ICIA 3W1SA 1P7EA 4C56C 2PW9A 2V0GA 3PO0A 1FXAA 1B9RA 1SB3C 1JRPA 1C4AA 4IOIE 4C7YA 2JQRB 3ETRA 1FIQA 4N58A 1IBXA 3MHZA 4RGMA 1WSPA 4LK0M 1CK1A 1SE3A 2WDVB 4MM3B 5EE0A 1TJEA 3CIRB 2WDRB 3BYTB 2INNE 2N9LA 2K5PA 2K0PA 3BYYB 3PZ7A 1KRHA 2BW2A 2LHEA 4CQNA 2BS4B 2OHFA 1DOXA 1KLUD 1TS2A 2VZKD 3N9YC 3LXFA 3Q8EA 2NMQA 1UWMA 1WWTA 1K52A 2SAKA 2QSDA 4RF0A 5H8YE 4RH6A 1TKYA 2WXLA 1J7CA 1K53A 2RDGA 1YMHE 2JXTA 2K3UA 2Z8LA 1AW7A 3WCQA 3B2FA 1J7BA 1ZPSA 1WXQA 5G5HA 1K50A 4YSYB 1N61A 2EELA 1VZ6A 2K22A 3VRAB 3AN1A 1ZP0B 1PUTA 1C4CA 2KDMA 3IXSA 2RMMA 3T3OA 1XXGA 3BIID 1FCCC 4P6VF 3V05A 1C79A 1BUIC 1BMLC 3I57A 3IT6B 2BS2B 4OW0A 3BVGA 5EE1A 4OVZA 3NVVA 1SBBB 2FUG1 1RWSA 3OWEB 2J42A 1EWCA 3AEFB 1KTKA 2JYEA 2Y5PA 2R61A 1NYQA 2WXOA 3MC0B 4KGSA 1D6EC 1VDVA 4JE3B 2QMTA 4OZCA 1SE4A 1XCQL 2HDEA 2WXQA 3FAHA 1K51A 4NZLB 1EWYC 1OQRA 2JYTA 4JWSC 2KWDA 4RCOA 4YTNB 1HQRD 1XLPA 4A8XC 2WXMA 2LMCA 1F77A 2EKIA 2Y3AA 3HVDA 2W54A 5HI1A 2E3TA 3IAM1 1RYJA 1FFUA 2JU6X 2M19A 1DOIA 2PVOD 4JPSA 3P4PB 4RGOS 2WP9B 2WXKA 3EUB2 1JROA 1TS3A 3EGRA 5GXGB 3AEDB 1CZPA 1ZDXA 2DYOA 3MP9A 4JWUC 4O1NA 2IDYA 3ZYYX 2H89B 3GB1A 2W3SA 1VRAB 3ZGZA 2XN9C 3E56A 5EE3A 4USAA 1N62A 1EU3A 3SFDB 2FBWB 2W3RA 4YWGG 3W5UB 1JCKB 1T5XD 1FNVA 4LLGM 5C2TB 1DYQA 1YQ3B 3MFGA 4M0WA 4HKQA 1L4ZB 3AE6B 2GB1A 5H92C 1L0YB 3U52E 1ENFA 3FILA 4MH8A 5AUIA 5HFYA 3P1MA 4H2AA 2D5GA 2RPVA 2PTLA 2I38A 3AEBB 3B9JA 4RF1A 5BYQA 1FO4A 1IBXB 4YSXB 2WU2B 3BVMA 3VRBB 1L0XB 3AECB 2QJLA 3RFZB 2LUMA 1TKEA 3NS1A 1TS4A 1V1PA 4AS1A 1VJKA 1GOZA 3AH7A 4ZHOA 1GAQB 3VQIA 3P63A 3B2GA 1HXYD 2I2YA 1QOAA 5MPOA 2J52A 2G1EA 2BB6A 2ONQA 2WXFA 2QEJC 1ZUD2 2KMMA 1C77A 4MT5A 3TSSA 2LEKA 2IJ0A 1ZXIA 4R3DA 1M4VA 1FXIA 2WXGA 1JW9D 4WURA 3ZJUA 1N5WA 4DXGA 1SF0A 1P7FA 2IGGA 3AE4B 1FFVA 2PMVA 4ZRPA 5I4DA 1TYGB 1SEBD 2IGDA 5AUKA 3U4EG 2WXHA 1UUPA 2MJ3A 1Q10A 2L52A 4WH4A 1JALA 1NVID 5EE9A 5BYRA 1YN4A 1XF5L 1N60A 3AEAB 3AE5B 2KQ4X 4NAWB 1C4PA 1KFYB 1L6UA 1VZ8A 3Q8BA 4DQOC 1FRDA 4YXDB 2N7JA 1MHHE 2LFIA 4RGTA 1ET9A 1I4HA 2QILA 4ARCA 2N9KA 2L32A 1C78A 2SEBD 1SSNA 5TSSA 1L4DB 1GB4A 4US9A 2WXJA 1B1ZA 1I4XA 2DBYA 1EU4A 3ZQ4A 4KGRA 2JSVX 2X38A 2NTSA 3L4PA 3ZJVA 1YNTE 5FKAC 2AQ3B 3CWIA 3SR6A 3Q8AA 4GDLB 4ARIA 1XO3A 3IT4B 1KF6B 2K9XA 3R2IA 3RPFC 2JX5A 2LGIA 3TEZA 2LHDA 3AE1B 5BMHA 1I7HA 1YJIA 1N5XA 2WXRA 1CQVA 1HA5A 1NYRA 4YSZB 1SJHD 1BXTA 1WRIA 2J4XA 1QF6A 1E9MA 1D5MC 2Y5CA 4KKIA 4HRSA 4WQMA 4B0EA 2L1AA 2Q5WD 2CJNA 4DXFA 2BB5A 3AB5A 5BMGA 4YTMB 1MVKA 2IPKD 1F2RI 4OZBA 2H88B 4UDUC 2KACA 3R8BA 1XLOA 3KLSX 1I4GA 1NEKB 2BS3B 1J7AA 1I4PA 4D2KA 2AX5A 5D7GA 1IGCA 3FILB 3V3XA 4A90A 4YTPB 4RNAA 1L0VB 3VR8B 1E0ZA 2DWQA 3U7ZA 1TKGA 2V4IB 2VZKB 1I4QA 1WYGA 2B76B 2W82A 1YJJA 2FE8A 3Q8FA 4TSSA 1V1PB 1AWDA 1V97A 1L5PA 2CU3A 2YEPF 4RFBA 1TS5A 2PLPA 4ITKA 1NI3A 1L6VA 1CJEA 2JWUA 3BWUD 2ZW1A 2V3PA 2MEKA 1PGBA 2XNAC 2V3NA 3Q69A 4EE2A 2CJOA 2ACZB 4REZA 4TQ0A 1ESFA 1QOGA 4C7ZA 1ZOYB 2WS3B 3ABVB 3P4RB 1N63A 1T6BX 1UWXA 2WXIA 1JQ4A 1FEHA 1YN5A 3AEGB 2KAJA 1V1OA 3NVWA 2L83A 3P4SB 3T3NA 3TEYA 1KLGD 1QILA 2WDQB 1OQQA 4GDKB 1D5XC 5JXVA 1C76A 1JWSD 3AE2B 2BYTA 1AYFA 2RDHA 4WWMA 1FMAD 2N0SB 4N6EB 1D5ZC 1XLQA 2M56B 1GB1A 1V8CA 3AMZA 5D3DA 5E6JA 5G5GA 4TMAB 1TY2A 3BK2A 1VR9A 1MHXA 2BBCA 3IAS1 3R2TA 4HJGE 1QOFA 4XDDA 1STEA 1A70A 3AE9B 4J3OD 4FXCA 3KWVA 4US8A 3NUHB 5BYSA 1C9FA 1SXTA 2PKOA 4HROA 3KQ4A 2W55A 1E10A 4WIPA 4A9AA 2WXPA 3J9CA 1VZ7A 4OHJA 1SE2A 1JWAD 3VR9B 1XLNA 1IUEA 5D3IB 2G9HD 1YQ4B 4JX1C 2QIEB 1KH0A 3LYYA 5FK9C 1FCLA 1E7PB 1QKZA 1PDXA 2M0AA 2PVGC 4ZYSA 2YEPB 1NENB 2WU5B 3AE3B 4ZHPA 3P4QB 1UNSA 2DYMA 2WQYB 4ZRQA 4XE0A 4L2YA 3AM9A 3SEBA 1VLBA 2J53A 3AV8A 1XCTL 1QQRA 3NVYA 1ACCA 3C8YA 3Q8CA 1HZ5A 4L23A 1JWBD 3EA6A 3HRDD 3W5VB 2KN4A 1FNWA 1YN3A 1F2RC 1F0ZA 3TEWA 5FR3A 2OEDA 4KKJA 3FC4A 3URYA 3NRZA 1PGAA 3DWGC 2AQ1B 3DWMA 3HUIA 1IGDA 1RM6C 3ZJTA 2WNMA 4XWTA 4B0MA 4NJCA 4XWWA 1I4RA 2MH7A 2MJDA 1GPXA 4MACA 4L1BA 4HKZE 1D4BA 4C80A 2IGHA 1MPEA 3I9V1 3TEXA 5LNK1 3P42A 4OZAA 4HEA1 1QT9A 1ROEA 1TY0A 4RGNA 4N59A 3O13A 4IDIA 2PIAA 3BK1A 3GP7A 2BTEA 1WGKA 1HZ6A 1AN8A 1ZDVA 1JWMD 1EM7A 1SJED 3LB8C 1FM0D 3BZDB 2TSSA 4KGTA 3TUOA 3H8HA 1ET6A 1UGJA 4IKGA 3AEEB 5HHDG 4ZOHC 3GS2A 4Q2JA 5T8IA 4P16A 2ZW0A 4WAFA 1FRRA 3AE7B 2BT6A 1R7SA 5BMIA 1PGXA 1QLBB 4TQ1A 2WXNA 1PFDA 1E6EB 1XEEA 3E9SA 2DLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWD A;  2N9K A;  1MHX A;  4HJG E;  1GB4 A;  1JML A;  2JZP A;  1C9F A;  5HI1 A;  2JU6 X;  4KGR A;  2JSV X;  4GLS C;  1YNT E;  1MI0 A;  3MP9 A;  3GB1 A;  1KH0 A;  2LGI A;  2ON8 A;  2LHD A;  1FCL A;  5BMH A;  3UI3 A;  5HG2 A;  1QKZ A;  1FD6 A;  1HEZ E;  2GI9 A;  1ZXH A;  1P7E A;  2PW9 A;  4IOI E;  2GB1 A;  2J53 A;  1XCT L;  5BMG A;  1MVK A;  1IBX A;  3FIL A;  1F2R I;  4OZB A;  5HFY A;  1HZ5 A;  2KAC A;  2PTL A;  2RPV A;  2I38 A;  2KN4 A;  1IBX B;  1F2R C;  4D2K A;  1IGC A;  3FIL B;  2N9L A;  3V3X A;  2K0P A;  2LUM A;  2OED A;  2LHE A;  1PGA A;  1IGD A;  2NMQ A;  1K52 A;  2QSD A;  2I2Y A;  2J52 A;  2ONQ A;  1K53 A;  2PLP A;  1YMH E;  2JXT A;  4MAC A;  2JWU A;  4HKZ E;  1D4B A;  2IGH A;  2ZW1 A;  1MPE A;  1PGB A;  1K50 A;  4OZA A;  2EEL A;  2KDM A;  1HZ6 A;  2RMM A;  1P7F A;  2IGG A;  1EM7 A;  1UWX A;  4KGT A;  1FCC C;  2IGD A;  4IKG A;  5HHD G;  1Q10 A;  4WH4 A;  2ZW0 A;  1XF5 L;  5JXV A;  2KQ4 X;  4KGS A;  5BMI A;  1PGX A;  2QMT A;  4OZC A;  1XCQ L;  1GB1 A;  2N7J A;  1MHH E;  1K51 A; 
#chains in the Genus database with same CATH topology
 1WZ0 A;  3K9O B;  2NTT A;  1P1A A;  1UF0 A;  4KX6 B;  1ZW7 A;  1JML A;  3NVZ A;  3PLV A;  2LVP A;  3M62 B;  2LXA A;  2K39 A;  3KWL A;  4FJZ A;  4AQ7 A;  4G50 A;  4WJQ A;  1QOB A;  1TZO A;  1LXD A;  4W9J A;  1YIW A;  1ZE3 D;  3PSE B;  5TR5 A;  2KHW B;  2HD5 B;  1WI0 A;  2V0G A;  3PO0 A;  1FXA A;  4C7Y A;  4NPN A;  4WJO A;  2LAS A;  3ETR A;  4N58 A;  2I1K A;  3MHZ A;  4LNN A;  1LGR A;  4RGM A;  1CK1 A;  2WDV B;  2DYB A;  1TJE A;  4HVB A;  2KJH B;  2K5P A;  3DQV A;  2A5U A;  3NZS A;  5LXI B;  4PK1 A;  3HM3 A;  4NQK E;  4EUT A;  2RDB C;  1H8C A;  1KLU D;  2VZK D;  4KZ0 A;  5DPT A;  5C1Z A;  4G11 A;  1UWM A;  1WWT A;  4RF0 A;  2O2V B;  1WGY A;  3RNF C;  1HE8 A;  1V49 A;  4II2 B;  4DHJ B;  3APC A;  3PRM B;  1ZPS A;  2WX1 A;  4II3 B;  1VZ6 A;  3VRA B;  4P1B C;  1C4C A;  4LDT B;  4HK2 A;  2GBK A;  4M02 A;  3EEC A;  3V05 A;  3I57 A;  3QK0 A;  5JHA A;  4ANU A;  5EE1 A;  3DBR B;  3O65 B;  3OG5 A;  2JVC A;  3HM6 X;  3AEF B;  3MC0 B;  1NYQ A;  4GMV A;  1XCQ L;  2WXQ A;  1UZX B;  2FIF A;  3DVN U;  3JYU A;  1P0R A;  2KWD A;  5DPR A;  2WXM A;  3QHT A;  2EKI A;  2Y3A A;  4BBN C;  3PLU A;  4G3X B;  2KNB A;  2JU6 X;  1FFU A;  2M19 A;  2WP9 B;  2PJH A;  1TS3 A;  3MJW A;  4O1N A;  3MP9 A;  2FNJ B;  2IDY A;  3GB1 A;  1VRA B;  2XN9 C;  3N3K B;  4W9I A;  2JZ3 B;  2BWE S;  3A1Q A;  5C2T B;  3RNE C;  1WZ3 A;  1YQ3 B;  4ICU A;  4NNJ B;  4DHJ D;  1KM7 A;  1RRB A;  5H92 C;  2I1J A;  3U52 E;  5KHO A;  2GMI C;  3A9K A;  3N32 A;  2I38 A;  2IYD B;  2LRW A;  3RCZ A;  3AEB B;  3Q3F A;  4YSX B;  2WU2 B;  4LDT D;  2QJL A;  3RFZ B;  4TUU A;  1V1P A;  4FA6 A;  1VJK A;  3AH7 A;  2BF8 B;  1GAQ B;  2RGF A;  2DX5 B;  2GBN A;  3P63 A;  4HPM B;  1HXY D;  4A3O A;  2J52 A;  2MW5 A;  2BB6 A;  3KVF B;  1SGH A;  4KDL B;  2WGS A;  4AOF A;  2IY0 B;  4WAA A;  2QCZ A;  1M4V A;  1FXI A;  3KUD B;  4DXG A;  4PYU A;  2AL6 A;  3ZXR A;  2PMV A;  2KKC A;  4GDK A;  1TYG B;  2N1V A;  3R3M A;  1Q10 A;  1JAL A;  1XT9 B;  1XF5 L;  3UIN B;  4J6I A;  4NAW B;  1C4P A;  3VDZ A;  1VZ8 A;  1L6U A;  2FAZ A;  1E5W A;  2N7J A;  2LFI A;  4DXA B;  1Q5W B;  2N9K A;  2SEB D;  2BYE A;  1WRD B;  1B1Z A;  2DBY A;  3QA8 A;  2YLM A;  1EU4 A;  2ZEQ A;  4C00 A;  2CR5 A;  3ZJV A;  3RNG C;  1WE6 A;  3Q8A A;  4ARI A;  4DHZ B;  5AEK B;  4FHK A;  3RPF C;  2JX5 A;  2LGI A;  3AE1 B;  1I7H A;  1CQV A;  1HA5 A;  4WWN A;  4I6N B;  4YSZ B;  1SJH D;  2J4X A;  4K3C A;  1D5M C;  2Y5C A;  4HRS A;  4WQM A;  2JUO A;  2Q5W D;  3UIO B;  3DBL B;  2BB5 A;  2C5L C;  3A1Q B;  4NJ6 A;  3HHM A;  1MVK A;  1P9D U;  2FUH B;  4OZB A;  2CKH B;  1E7U A;  1Z2M A;  1I4G A;  2BS3 B;  1J7A A;  2AX5 A;  5D7G A;  3L13 A;  3WIM A;  4A90 A;  4YTP B;  3A9K B;  1WMH A;  3VR8 B;  1E0Z A;  2LWP A;  3ENE A;  4C4V A;  2JF5 A;  1WJ6 A;  4TSS A;  4ZRI A;  1V1P B;  3SU8 X;  1V97 A;  2CU3 A;  1TS5 A;  2PLP A;  2K8B A;  4ITK A;  1NI3 A;  2L76 A;  3Q2A C;  1UD7 A;  1CJE A;  4IM3 A;  1UGM A;  4ASW C;  4REZ A;  3AU5 A;  3ZTD A;  1ZOY B;  4GB9 A;  1WXA A;  3U30 A;  2HJ8 A;  1WFY A;  3N20 C;  2INC C;  1ZKH A;  2L0F A;  3QIJ A;  2PEA A;  1WR6 E;  4B9K A;  2QHO A;  2WDQ B;  2YVC A;  4GDK B;  4HJK A;  3QJZ A;  1MJD A;  1JWS D;  4N6E B;  1HTO A;  1R4M I;  1GB1 A;  1V8C A;  2BYF A;  4LJO B;  5IKC M;  3ZNH B;  4TMA B;  1XD3 B;  4EE2 A;  1MHX A;  4XDD A;  4HLE A;  2KFK A;  2L7R A;  3KWV A;  2ASQ A;  3NUH B;  1C9F A;  2W55 A;  4XC2 A;  2WXP A;  2DZM A;  5E6N A;  1SE2 A;  1JWA D;  4MSQ B;  4BFR A;  1XLN A;  1IUE A;  1OQY A;  4TKN A;  5CHW A;  1KH0 A;  4BOS C;  4M01 A;  5CHF A;  1QKZ A;  3C0R B;  2D2Q A;  1L2N A;  2UYZ B;  2R2O A;  1UNS A;  4ZRQ A;  2D3G A;  2J53 A;  3AV8 A;  2GBJ A;  4CYE A;  4JL9 A;  3NOB A;  3ZNZ B;  2KN4 A;  3Q3N C;  3CSF A;  3FC4 A;  3NRZ A;  2AQ1 B;  3ZJT A;  3DPD A;  4FN2 A;  1WMH B;  4FAD A;  2DEN B;  5CTR C;  2MJD A;  4C4V B;  2KWV B;  2D3C A;  4L1B A;  2KFJ A;  5IAA C;  1MPE A;  3I9V 1;  3R7R A;  4S17 A;  5D94 A;  3P42 A;  1UBI A;  4HEA 1;  3K9P B;  4MSM B;  2XK5 A;  2KDI A;  4XZ4 A;  1WGK A;  2KQS A;  2MQJ A;  4FHJ A;  1SJE D;  4GOC A;  3BZD B;  3TUO A;  4KGT A;  3PHW B;  3IG3 A;  4NQL B;  4WAF A;  2WYQ A;  3NS8 A;  2WDT B;  3AE7 B;  5BMI A;  1PGX A;  1QLB B;  3TJP A;  4TQ1 A;  2RPQ A;  2WXN A;  1PFD A;  2PE9 A;  2KLG A;  3LXF A;  2INP E;  4JLC A;  3BVZ A;  1CMX B;  3W2D A;  1Y56 A;  2JPH A;  4PT5 A;  3PZ8 A;  2KFK B;  3A33 B;  3HVZ A;  4LTU A;  2IO1 B;  2KDB A;  2ZCC A;  3SHQ A;  2C7N B;  4HPP A;  4XDC A;  2AYO B;  3KYD D;  2IND C;  2MJE A;  1FNU A;  1SIJ A;  2XBB C;  4FJV B;  4A6Q A;  2ON8 A;  4HDQ A;  2MLB A;  1T3Q A;  1HEZ E;  2GI9 A;  5C3J B;  3ZO5 B;  1P7E A;  4A3P A;  2PW9 A;  1C4A A;  3VXW A;  4K3B A;  2L05 A;  3IBE A;  2MBQ A;  1ZGU B;  1WJ4 A;  3DVG Y;  2QC8 A;  3BYT B;  2N9L A;  2K0P A;  2LHE A;  2BS4 B;  3RYT A;  2OHF A;  1DOX A;  3ECI A;  2NMQ A;  1KJT A;  2BVC A;  2QSD A;  4RH6 A;  4EZL A;  3ONS A;  2RDG A;  2K3U A;  4OVV A;  2AL3 A;  2C9W B;  3WAP A;  3WCQ A;  3PPA A;  3B2F A;  1NDD A;  3RUL A;  1PUT A;  3IXS A;  2XK5 B;  1C79 A;  1BML C;  4HPL B;  4OW0 A;  4K1R B;  4I6L B;  4OVZ A;  1YQB A;  2Z0E B;  1SBB B;  3OAW A;  4ICV A;  2JYE A;  2R61 A;  2KYW A;  2FCN A;  4RCO A;  4JQW C;  5D2M B;  4BOZ B;  1T0R C;  3HVD A;  5HI1 A;  1UBQ A;  1RYJ A;  2PVO D;  1DOI A;  4JPS A;  4RGO S;  3ZVV A;  2MHJ A;  2WXK A;  4GIV A;  1JRO A;  1WY8 A;  2RR9 A;  4EZJ A;  2DYO A;  2H89 B;  2W3S A;  3ZGZ A;  3E56 A;  5EE3 A;  4USA A;  3SFD B;  3L17 A;  4W9F A;  1FNV A;  3WAL A;  3UF8 A;  3I63 C;  2CU1 A;  1V86 A;  2GB1 A;  2BQQ A;  3PT2 B;  1OEY J;  1L0Y B;  1ENF A;  3P1M A;  4H2A A;  2RPV A;  2NS5 A;  3B9J A;  4BVU C;  4RF1 A;  1GG3 A;  2M8S A;  2JWZ A;  2ZNV B;  4ZYN A;  1GOZ A;  1MG8 A;  4KDI C;  2I2Y A;  2G1E A;  2ONQ A;  2QEJ C;  4DWF A;  4MT5 A;  3TSS A;  2LVO A;  2X8X X;  2CS4 A;  3EHV A;  4WUR A;  2W9N A;  3GE3 C;  1P7F A;  2IGG A;  3AE4 B;  1VD2 A;  4ZRP A;  2M1M A;  1SEB D;  3Q3M C;  3SD5 A;  5AUK A;  2IO0 B;  2MJ3 A;  1NVI D;  5EE9 A;  5BYR A;  3PVL A;  1N60 A;  3AE5 B;  2KQ4 X;  1J19 A;  1KFY B;  4M8N A;  4DQO C;  1FRD A;  4FJY A;  3B08 A;  2MP2 A;  4BBN F;  2FCQ A;  1OGW A;  4NAW A;  2BWF A;  2JSV X;  2X38 A;  1LQB A;  1YNT E;  4MGY E;  3SR6 A;  2K9X A;  3R2I A;  1WXS A;  1WX9 A;  5L83 A;  2CHZ A;  3ZRF A;  2WXR A;  4HWI B;  1NYR A;  1WRI A;  1RLF A;  1A5R A;  4OVU A;  2ZVN A;  3AB5 A;  2NR2 A;  5L95 C;  1F2R I;  3A9J A;  2H88 B;  2NBW B;  4UDU C;  1AAR A;  5BO4 B;  1J8C A;  5IN7 A;  4D2K A;  1IGC A;  4K81 A;  3V3X A;  3DHG C;  4RNA A;  3RN9 C;  2KZR A;  3U7Z A;  4AP4 C;  2V4I B;  1I4Q A;  3ML8 A;  2MBE A;  3AUL A;  1YJJ A;  1AWD A;  3RT3 B;  2IBI B;  3TL5 A;  4RFB A;  3TBL D;  1R4N B;  2ZW1 A;  2KLC A;  2MEK A;  1PGB A;  2V3N A;  3Q69 A;  1V5O A;  2KDE B;  4XGA B;  5JHB A;  4KV2 A;  3VVW B;  3P4R B;  1RAX A;  1UWX A;  2K8H A;  2N4F A;  1JQ4 A;  3AEG B;  3PRE A;  1MG4 A;  1V1O A;  3T3N A;  2L3Z A;  3WAO A;  5JXV A;  4RM8 A;  2KT7 A;  1XLQ A;  1M94 A;  2KVZ A;  3VUX A;  3OJ3 A;  3OJ4 B;  1T0Y A;  3H7S A;  2RSU A;  4GGQ A;  5E6J A;  2LZ6 A;  3Q14 C;  3BK2 A;  1TIF A;  2LRU A;  3AE9 B;  1A70 A;  1F52 A;  4J3O D;  4EKU A;  2D3B A;  2MP2 B;  4GSW A;  3SDL C;  3ZDT A;  2KXJ A;  3RUI B;  5BYS A;  2PKO A;  2IO3 B;  3KQ4 A;  1JRU A;  2OJW A;  2QDF A;  4WIP A;  4A9A A;  2KMA A;  3J9C A;  1E8X A;  2DNF A;  1P3Q U;  4B95 A;  1LM8 B;  1YQ4 B;  5FK9 C;  2FCM A;  1KOT A;  4MEM A;  2M0A A;  3R7Q A;  1IP9 A;  5FR6 A;  1NEN B;  2V4L A;  3NZU A;  3WA0 A;  3L16 A;  3AE3 B;  2BKF A;  2B3A A;  4L2Y A;  3AM9 A;  3N1X C;  4WQO B;  1V9J A;  3EA6 A;  2LGX A;  5AZG A;  1TGZ B;  1E90 A;  1F2R C;  4MGZ E;  3TEW A;  3A9J B;  4K7S A;  5FR3 A;  3URY A;  2N7E A;  2K8C A;  3NHE B;  1IGD A;  1RM6 C;  5E6O A;  4XWT A;  4NJC A;  2MH7 A;  1T0S C;  2K6D B;  2IGH A;  2MBO A;  2KO3 A;  2KWU B;  4KVG B;  3TEX A;  3DOW A;  1T0Q C;  4OZA A;  3VUW A;  3D32 A;  5J18 A;  3U8Z A;  3BK1 A;  3IVF A;  2CHW A;  2AWT A;  4HCP B;  1FM0 D;  2TSS A;  4F8C B;  2KAN A;  1F9J A;  3ZTC A;  4ZOH C;  2Z59 B;  5T8I A;  2V9H A;  2N9P C;  1R7S A;  1E6E B;  4DHZ E;  4AJW A;  5J17 A;  1C1Y B;  4X57 B;  4WJN A;  1TT5 B;  5J2R A;  2JZP A;  1DOY A;  1PYW D;  1RFK A;  2HE7 A;  2CHX A;  1JWU D;  4W9K A;  3ZNI D;  4GLS C;  3MC8 A;  3ZIM A;  1GJZ A;  2AQ2 B;  1MI0 A;  2UU7 A;  3TMP B;  2O6V A;  4WJP A;  4NAM A;  1VCB A;  1OFF A;  3VTW A;  5HG2 A;  4K7U A;  3MTN B;  1FD6 A;  2DZK A;  2KTF A;  1LO5 D;  4W9L A;  4C56 C;  4W9G A;  3A4S C;  1GNU A;  3VFK A;  1JRP A;  3V60 A;  2DZI A;  4IOI E;  1KLV A;  1IBX A;  3RNB C;  3V6E B;  2D07 B;  1WSP A;  4LK0 M;  2KJ6 A;  1G6J A;  2ZVO A;  1SE3 A;  3QCA A;  5EE0 A;  3PZ7 A;  1KRH A;  2BW2 A;  2LXC A;  4CQN A;  4PYZ A;  1TZ1 A;  3V62 A;  4IWQ A;  3LJ3 A;  2LJ5 A;  3QAQ A;  5H8Y E;  4PS8 A;  3PTF C;  2WXL A;  3A4R A;  2JXT A;  2Z8L A;  4ACF A;  1J7B A;  1WGR A;  2NVU I;  5G5H A;  1N61 A;  2EEL A;  4AUQ C;  1WR1 A;  1ZP0 B;  3T3O A;  1FCC C;  1BUI C;  3IT6 B;  3BVG A;  2NBV B;  2FUG 1;  3OWE B;  1KTK A;  2Y5P A;  3RNC C;  1D6E C;  1VDV A;  4JE3 B;  1TTN A;  5G55 A;  2QMT A;  1SE4 A;  3FAH A;  2R2Q A;  4NZL B;  3QWZ B;  4JWS C;  4YTN B;  1MFW A;  4ZRJ A;  4A8X C;  1WM2 A;  1F77 A;  3P2B A;  2E3T A;  3P4P B;  3AU4 A;  4RM9 A;  3AED B;  1CZP A;  4JWU C;  3ZYY X;  2G3Q B;  3W5U B;  1JCK B;  1T5X D;  4LLG M;  3ZRC A;  4BAX A;  2O6V B;  2BKR B;  1DYQ A;  3MFG A;  3NG0 A;  1WYW B;  1L4Z B;  1PQS A;  2EMT A;  3FIL A;  4MH8 A;  5HFY A;  4PS7 A;  5BYQ A;  1FO4 A;  1IBX B;  3VRB B;  4BKG A;  3MHS D;  1L0X B;  2J0M A;  3NS1 A;  4CO7 A;  2BGF A;  4ZHO A;  5KHQ A;  1QOA A;  2BPS A;  2WXF A;  4F1S A;  1ZUD 2;  2KMM A;  1C77 A;  1R4M B;  1I42 A;  4GXB A;  2IJ0 A;  4R3D A;  2KOX A;  1GC6 A;  1N5W A;  4EOY A;  1OEY A;  2WX0 A;  1SF0 A;  4BZA A;  3DBS A;  3ZDM C;  1EUV B;  1EO6 A;  1FFV A;  3H6N A;  3ML9 A;  2EKE C;  1Z5S B;  3ZLZ A;  3U4E G;  2WXH A;  1UUP A;  2L52 A;  4WH4 A;  2GOW A;  4AWJ A;  3AEA B;  2VH2 A;  2C7H A;  2LVQ A;  1MHH E;  4RGT A;  1ET9 A;  1I4H A;  1YD8 U;  2DAJ A;  2L32 A;  1C78 A;  5TSS A;  1SSN A;  1L4D B;  2KTR A;  1GB4 A;  2HJ1 A;  2O6V D;  5C23 A;  3X23 A;  3NY5 A;  2UWQ A;  4GU2 A;  1I4X A;  1E7V A;  2NCN A;  4IC7 B;  2N9X A;  4KGR A;  1WF9 A;  1D3Z A;  5FKA C;  2AQ3 B;  1OTR B;  3DBH B;  2G4S A;  3IT4 B;  3DBR I;  4RMA A;  4MH0 E;  1SE9 A;  3VHT C;  3TEZ A;  2LHD A;  1YJI A;  2VH1 A;  3X0W A;  1QF6 A;  1E9M A;  3UGB B;  4KKI A;  2L1A A;  4WWO A;  2CJN A;  2IPK D;  1IYF A;  3QQ8 B;  4CHK A;  2KAC A;  2N1W A;  1XLO A;  3N1Z C;  4HCN B;  3KLS X;  3N30 A;  3FIL B;  1L0V B;  3PHX B;  3JVZ X;  1LFD A;  1V5T A;  4K7W A;  2HTH A;  4B6W A;  1TKG A;  2VZK B;  3BIN A;  2MCN B;  2NPT A;  3EFC A;  3Q8F A;  3RZF A;  3OLM D;  3ALB A;  1L5P A;  1Q1O A;  1UH6 A;  4E3C A;  1WX8 A;  4N9F 4;  3QC8 B;  1L6V A;  3PRP B;  2KK8 A;  3IFW B;  1C3T A;  2V3P A;  3M3J A;  1TBE A;  4ZRK A;  1J0G A;  2A4Z A;  4DK5 A;  4C7Z A;  1BT0 A;  2WS3 B;  2GLS A;  2K6Q A;  3ABV B;  4DDG D;  1N63 A;  1T6B X;  1YN5 A;  4HDO A;  3P4S B;  2L83 A;  3TEY A;  1KLG D;  1QIL A;  1OQQ A;  4FUL A;  1D5X C;  2BYT A;  1C76 A;  2JXX A;  4AJY B;  2RDH A;  4WWM A;  1D5Z C;  4LNF A;  4W9D A;  3AMZ A;  5D3D A;  3L54 A;  4MDK E;  2BBC A;  4HJG E;  3L0W B;  4NY0 A;  1NI2 A;  4MEL A;  4P7I A;  2OOB B;  2BYV E;  1U4A A;  2LI5 A;  4US8 A;  4HRO A;  3APF A;  2G4D B;  2KTR B;  1E10 A;  3VH3 B;  4OHJ A;  2KX0 A;  1FXT B;  2AEH A;  5D3I B;  2G9H D;  4FLH A;  2WWZ A;  3RI7 C;  2RD0 A;  2KX3 A;  1RFA A;  1WXM A;  3GZN B;  2WU5 B;  2KC1 A;  1V81 A;  3B1L X;  2D11 A;  3EC8 A;  3SEB A;  1VLB A;  2WHI A;  4MM3 A;  1QQR A;  3NVY A;  1ACC A;  3C8Y A;  3Q8C A;  4IM0 A;  4KSL C;  2PPH A;  1HZ5 A;  4L23 A;  1JWB D;  3W5V B;  3I5J C;  2LGY A;  3QAR A;  4KKJ A;  2JY6 A;  3HUI A;  2ZCB A;  4WWP A;  2WNM A;  1GUA B;  2M4N A;  4TV3 A;  3UIP B;  4B0M A;  4XWW A;  4EFO A;  1I4R A;  4IW0 A;  2MA9 B;  3T8M A;  4MAC A;  4HKZ E;  4C80 A;  2NPT B;  5CX3 A;  2M0X A;  4JIO U;  5LNK 1;  1WX7 A;  3DBL I;  1WGD A;  4BKS A;  5D6J B;  1QT9 A;  1ROE A;  3L08 A;  2PIA A;  3GP7 A;  2IO2 B;  3I3T B;  3LB8 C;  2ZPN A;  3JSV A;  1XQQ A;  4IUM B;  1ET6 A;  1UGJ A;  4IKG A;  2DAF A;  3ZW3 A;  5HHD G;  3TCA A;  3IHP C;  2KJR A;  4S0R A;  4E71 A;  3GS2 A;  4Q2J A;  1FRR A;  1EF1 A;  2LGD A;  2D10 A;  2N7D A;  3PRZ A;  3VAW A;  1XEE A;  3E9S A;  2DLB A;  2G45 B;  2LJI A;  2WLB A;  4M8M A;  1IPG A;  4A55 A;  3MJ5 A;  3M95 A;  3U2S C;  2KN5 A;  4MGI E;  3AE8 B;  2GBM A;  4LNO A;  3PZD A;  2M17 A;  1QZE A;  3W9C B;  3FKY A;  4M00 A;  3DVG X;  4NJ7 A;  3V61 A;  4LCD E;  1DGJ A;  1E8Y A;  3JW0 X;  2E6X A;  4YT0 B;  2GRI A;  3PV1 A;  2HTM E;  1K8R B;  4IWP A;  1H4R A;  2JZZ A;  3UI3 A;  3NZ3 A;  1V80 A;  3UQA A;  2IY1 B;  3SFE B;  1L7Y A;  1ZXH A;  2ICI A;  3W1S A;  1ISN A;  3KUC B;  1B9R A;  1SB3 C;  2JQR B;  1FIQ A;  1YX5 B;  2JRI B;  1WJN A;  2DHZ A;  4MM3 B;  3UQB A;  2KQ7 A;  1WIA A;  3CIR B;  5DCN A;  2WDR B;  2INN E;  3BYY B;  2N9E B;  3T9L A;  4XYC A;  2LGS A;  3W1Y A;  1V6E A;  1TS2 A;  3N9Y C;  3Q8E A;  1K52 A;  2SAK A;  2V3S A;  1TKY A;  3NJT A;  1J7C A;  2J0K A;  1K53 A;  2J0J A;  4LJP B;  2MX2 A;  4A20 A;  1YMH E;  1AW7 A;  2KVR A;  3AXC A;  1WXQ A;  4MGK E;  1K50 A;  2L0T A;  4YSY B;  3RNA C;  3DDC B;  3VUY A;  4ANX A;  2K22 A;  3AN1 A;  1WGG A;  2KDM A;  2RMM A;  5LXH A;  1XXG A;  4LNI A;  3H7P A;  3BII D;  4KZC A;  3CF6 E;  4P6V F;  3V6C B;  2BS2 B;  3NVV A;  3JSV B;  3QX1 A;  1RWS A;  2KDF B;  2J42 A;  1EWC A;  2KWC A;  4KGS A;  2WXO A;  3AI5 A;  4HXD A;  4OZC A;  2HDE A;  1K51 A;  1EWY C;  1OQR A;  2JYT A;  1HQR D;  1XLP A;  3W1S C;  3M63 B;  1P98 A;  2LMC A;  2W54 A;  3C19 A;  4GDL A;  5LLI A;  3IAM 1;  4IM2 A;  2KC2 A;  3EUB 2;  5IOI A;  3HK0 A;  3EGR A;  5GXG B;  2V1Y A;  1ZDX A;  2FCS A;  3ZXV A;  4LNK A;  1N62 A;  1EU3 A;  3N1Y C;  2FBW B;  2W3R A;  4YWG G;  2ZJD A;  2JT4 B;  3DCG A;  5DPW A;  2C60 A;  3ZNG C;  2MBH A;  4M0W A;  4HKQ A;  4KIK A;  3AE6 B;  1WE7 A;  2K25 A;  5AUI A;  1S1Q B;  2D5G A;  2PTL A;  4EEW A;  3BVM A;  3CST A;  3AEC B;  5IO9 A;  2LUM A;  1TKE A;  3H9D A;  1TS4 A;  2L00 B;  4BKS D;  4AS1 A;  3MC9 A;  3VQI A;  1WH3 A;  3B2G A;  2C7M B;  5MPO A;  5EDS A;  2LEK A;  5HKH A;  1ZXI A;  3VTV A;  1E8Z A;  2WXG A;  3KYC D;  3LDZ E;  4E74 A;  1JW9 D;  3ZJU A;  3HIZ A;  1SIF A;  3DHI C;  2JRH A;  5I4D A;  2IGD A;  3H7P B;  1YN4 A;  1S3S G;  3Q8B A;  2ZZP B;  4IWO A;  4YXD B;  3KH0 A;  2QIL A;  4ARC A;  3H1U A;  4US9 A;  3RZW C;  2J7Q B;  2WXJ A;  2MSE D;  3ZQ4 A;  1X1M A;  2KD0 A;  4W9H A;  2NTS A;  4G0N B;  3L4P A;  4BKT A;  3CWI A;  4GDL B;  1XO3 A;  1KF6 B;  4JGH B;  1YX6 B;  1UEL A;  4FBJ B;  1N6Z A;  3DBH I;  1WM3 A;  5BMH A;  1N5X A;  3Q3J A;  2PE6 B;  2MBB B;  2Y5B B;  1BXT A;  4KSK C;  3S2A A;  4B0E A;  2GBR A;  3RMK C;  4ANW A;  4DXF A;  4W9E A;  5BMG A;  4YTM B;  3WAN A;  3PS6 A;  4M0W B;  3L10 B;  4DDI D;  2VRR B;  1NBF C;  4KIK B;  3R8B A;  2REX A;  3GOE A;  1NEK B;  1I4P A;  4I6P A;  1WGH A;  2DWQ A;  4PS3 A;  1WYG A;  2Z0D B;  1EF5 A;  2B76 B;  2W82 A;  3ZKJ C;  2FE8 A;  3TIX A;  2YEP F;  4XX5 A;  2JWU A;  4ANV A;  3BWU D;  2LUE A;  2XNA C;  1WXV A;  4IG7 B;  2CJO A;  2ACZ B;  4TQ0 A;  1ESF A;  1QOG A;  2EMS A;  5DPS A;  3VH4 B;  2WXI A;  3EFU A;  1FEH A;  2KAJ A;  2XEW A;  4GN1 A;  3NVW A;  1V2Y A;  3APD A;  3PGE A;  4MJS A;  5G2N A;  3AE2 B;  5IP4 D;  1AYF A;  1FMA D;  2N0S B;  2OJR A;  3U7D A;  2M56 B;  2L8J A;  3KUZ A;  3DVN V;  2LD9 A;  5G5G A;  1HTQ A;  1TY2 A;  1VR9 A;  3R2T A;  3IAS 1;  3KW5 B;  1QOF A;  1STE A;  5JZE B;  4FXC A;  4P1C C;  4ZDV A;  1SXT A;  1YOV B;  5JH5 C;  1FPY A;  1VZ7 A;  3VR9 B;  3Q3O C;  1WJU A;  4JX1 C;  4W9C A;  4QAY A;  3DHH C;  2QIE B;  3LYY A;  5AZH A;  1FCL A;  1E7P B;  1PDX A;  2DZJ A;  2PVG C;  4ZYS A;  2YEP B;  4URK A;  4DBG A;  5AZF A;  4ZHP A;  3P4Q B;  2DYM A;  2WQY B;  2MRP A;  4XE0 A;  3GZN I;  1XCT L;  1I35 A;  3WAM A;  1Q0W B;  3HRD D;  3B0A A;  1FNW A;  1YN3 A;  1YJ1 A;  1F0Z A;  2OED A;  2FID A;  5E6P A;  1PGA A;  2O2V A;  3DWG C;  2K1F A;  3BY4 B;  3DWM A;  1Y8R C;  5GMV A;  3R66 C;  1E8W A;  2D3A A;  2ZPY A;  2KMC A;  1GPX A;  3ZUN A;  3GE8 C;  1D4B A;  2IZV B;  5IA7 A;  1F1H A;  1TY0 A;  4RGN A;  4YL8 A;  4N59 A;  3O13 A;  4IDI A;  2BTE A;  4F7Z A;  1HZ6 A;  1AN8 A;  1ZDV A;  1JWM D;  1EM7 A;  3H8H A;  3AEE B;  5CHV C;  2NBU A;  2ZW0 A;  4P16 A;  3Q6B A;  2MWS B;  2ZNV C;  3VTU A;  4EZK A;  2BT6 A;  4MJS B;  1R4N I;  3CMM B;  3RD2 A;  1GC7 A; 
#chains in the Genus database with same CATH homology
 2LJI A;  2WLB A;  4A55 A;  2INP E;  3MJ5 A;  2NTT A;  4KX6 B;  3U2S C;  1JML A;  2JZP A;  3NVZ A;  1DOY A;  1PYW D;  3BVZ A;  1RFK A;  3AE8 B;  3W2D A;  1Y56 A;  4PT5 A;  1JWU D;  3PZ8 A;  3HVZ A;  3KWL A;  4GLS C;  4LTU A;  4AQ7 A;  3W9C B;  1QOB A;  1TZO A;  2AQ2 B;  4XDC A;  1DGJ A;  1MI0 A;  2E6X A;  4YT0 B;  2GRI A;  2MJE A;  1FNU A;  1SIJ A;  4A6Q A;  2HTM E;  2ON8 A;  1ZE3 D;  4NAM A;  1OFF A;  3UI3 A;  1T3Q A;  3NZ3 A;  5HG2 A;  1FD6 A;  3SFE B;  1HEZ E;  2GI9 A;  1ZXH A;  5C3J B;  1LO5 D;  2ICI A;  3W1S A;  1P7E A;  4C56 C;  2PW9 A;  2V0G A;  3PO0 A;  1FXA A;  1B9R A;  1SB3 C;  1JRP A;  1C4A A;  4IOI E;  4C7Y A;  2JQR B;  3ETR A;  1FIQ A;  4N58 A;  1IBX A;  3MHZ A;  4RGM A;  1WSP A;  4LK0 M;  1CK1 A;  1SE3 A;  2WDV B;  4MM3 B;  5EE0 A;  1TJE A;  3CIR B;  2WDR B;  3BYT B;  2INN E;  2N9L A;  2K5P A;  2K0P A;  3BYY B;  3PZ7 A;  1KRH A;  2BW2 A;  2LHE A;  4CQN A;  2BS4 B;  2OHF A;  1DOX A;  1KLU D;  1TS2 A;  2VZK D;  3N9Y C;  3LXF A;  3Q8E A;  2NMQ A;  1UWM A;  1WWT A;  1K52 A;  2SAK A;  2QSD A;  4RF0 A;  5H8Y E;  4RH6 A;  1TKY A;  2WXL A;  1J7C A;  1K53 A;  2RDG A;  1YMH E;  2JXT A;  2K3U A;  2Z8L A;  1AW7 A;  3WCQ A;  3B2F A;  1J7B A;  1ZPS A;  1WXQ A;  5G5H A;  1K50 A;  4YSY B;  1N61 A;  2EEL A;  1VZ6 A;  2K22 A;  3VRA B;  3AN1 A;  1ZP0 B;  1PUT A;  1C4C A;  2KDM A;  3IXS A;  2RMM A;  3T3O A;  1XXG A;  3BII D;  1FCC C;  4P6V F;  3V05 A;  1C79 A;  1BUI C;  1BML C;  3I57 A;  3IT6 B;  2BS2 B;  4OW0 A;  3BVG A;  5EE1 A;  4OVZ A;  3NVV A;  1SBB B;  2FUG 1;  1RWS A;  3OWE B;  2J42 A;  1EWC A;  3AEF B;  1KTK A;  2JYE A;  2Y5P A;  2R61 A;  1NYQ A;  2WXO A;  3MC0 B;  4KGS A;  1D6E C;  1VDV A;  4JE3 B;  2QMT A;  4OZC A;  1SE4 A;  1XCQ L;  2HDE A;  2WXQ A;  3FAH A;  1K51 A;  4NZL B;  1EWY C;  1OQR A;  2JYT A;  4JWS C;  2KWD A;  4RCO A;  4YTN B;  1HQR D;  1XLP A;  4A8X C;  2WXM A;  2LMC A;  1F77 A;  2EKI A;  2Y3A A;  3HVD A;  2W54 A;  5HI1 A;  2E3T A;  3IAM 1;  1RYJ A;  1FFU A;  2JU6 X;  2M19 A;  1DOI A;  2PVO D;  4JPS A;  3P4P B;  4RGO S;  2WP9 B;  2WXK A;  3EUB 2;  1JRO A;  1TS3 A;  3EGR A;  5GXG B;  3AED B;  1CZP A;  1ZDX A;  2DYO A;  3MP9 A;  4JWU C;  4O1N A;  2IDY A;  3ZYY X;  2H89 B;  3GB1 A;  2W3S A;  1VRA B;  3ZGZ A;  2XN9 C;  3E56 A;  5EE3 A;  4USA A;  1N62 A;  1EU3 A;  3SFD B;  2FBW B;  2W3R A;  4YWG G;  3W5U B;  1JCK B;  1T5X D;  1FNV A;  4LLG M;  5C2T B;  1DYQ A;  1YQ3 B;  3MFG A;  4M0W A;  4HKQ A;  1L4Z B;  3AE6 B;  2GB1 A;  5H92 C;  1L0Y B;  3U52 E;  1ENF A;  3FIL A;  4MH8 A;  5AUI A;  5HFY A;  3P1M A;  4H2A A;  2D5G A;  2RPV A;  2PTL A;  2I38 A;  3AEB B;  3B9J A;  4RF1 A;  5BYQ A;  1FO4 A;  1IBX B;  4YSX B;  2WU2 B;  3BVM A;  3VRB B;  1L0X B;  3AEC B;  2QJL A;  3RFZ B;  2LUM A;  1TKE A;  3NS1 A;  1TS4 A;  1V1P A;  4AS1 A;  1VJK A;  1GOZ A;  3AH7 A;  4ZHO A;  1GAQ B;  3VQI A;  3P63 A;  3B2G A;  1HXY D;  2I2Y A;  1QOA A;  5MPO A;  2J52 A;  2G1E A;  2BB6 A;  2ONQ A;  2WXF A;  2QEJ C;  1ZUD 2;  2KMM A;  1C77 A;  4MT5 A;  3TSS A;  2LEK A;  2IJ0 A;  1ZXI A;  4R3D A;  1M4V A;  1FXI A;  2WXG A;  1JW9 D;  4WUR A;  3ZJU A;  1N5W A;  4DXG A;  1SF0 A;  1P7F A;  2IGG A;  3AE4 B;  1FFV A;  2PMV A;  4ZRP A;  5I4D A;  1TYG B;  1SEB D;  2IGD A;  5AUK A;  3U4E G;  2WXH A;  1UUP A;  2MJ3 A;  1Q10 A;  2L52 A;  4WH4 A;  1JAL A;  1NVI D;  5EE9 A;  5BYR A;  1YN4 A;  1XF5 L;  1N60 A;  3AEA B;  3AE5 B;  2KQ4 X;  4NAW B;  1C4P A;  1KFY B;  1L6U A;  1VZ8 A;  3Q8B A;  4DQO C;  1FRD A;  4YXD B;  2N7J A;  1MHH E;  2LFI A;  4RGT A;  1ET9 A;  1I4H A;  2QIL A;  4ARC A;  2N9K A;  2L32 A;  1C78 A;  2SEB D;  1SSN A;  5TSS A;  1L4D B;  1GB4 A;  4US9 A;  2WXJ A;  1B1Z A;  1I4X A;  2DBY A;  1EU4 A;  3ZQ4 A;  4KGR A;  2JSV X;  2X38 A;  2NTS A;  3L4P A;  3ZJV A;  1YNT E;  5FKA C;  2AQ3 B;  3CWI A;  3SR6 A;  3Q8A A;  4GDL B;  4ARI A;  1XO3 A;  3IT4 B;  1KF6 B;  2K9X A;  3R2I A;  3RPF C;  2JX5 A;  2LGI A;  3TEZ A;  2LHD A;  3AE1 B;  5BMH A;  1I7H A;  1YJI A;  1N5X A;  2WXR A;  1CQV A;  1HA5 A;  1NYR A;  4YSZ B;  1SJH D;  1BXT A;  1WRI A;  2J4X A;  1QF6 A;  1E9M A;  1D5M C;  2Y5C A;  4KKI A;  4HRS A;  4WQM A;  4B0E A;  2L1A A;  2Q5W D;  2CJN A;  4DXF A;  2BB5 A;  3AB5 A;  5BMG A;  4YTM B;  1MVK A;  2IPK D;  1F2R I;  4OZB A;  2H88 B;  4UDU C;  2KAC A;  3R8B A;  1XLO A;  3KLS X;  1I4G A;  1NEK B;  2BS3 B;  1J7A A;  1I4P A;  4D2K A;  2AX5 A;  5D7G A;  1IGC A;  3FIL B;  3V3X A;  4A90 A;  4YTP B;  4RNA A;  1L0V B;  3VR8 B;  1E0Z A;  2DWQ A;  3U7Z A;  1TKG A;  2V4I B;  2VZK B;  1I4Q A;  1WYG A;  2B76 B;  2W82 A;  1YJJ A;  2FE8 A;  3Q8F A;  4TSS A;  1V1P B;  1AWD A;  1V97 A;  1L5P A;  2CU3 A;  2YEP F;  4RFB A;  1TS5 A;  2PLP A;  4ITK A;  1NI3 A;  1L6V A;  1CJE A;  2JWU A;  3BWU D;  2ZW1 A;  2V3P A;  2MEK A;  1PGB A;  2XNA C;  2V3N A;  3Q69 A;  4EE2 A;  2CJO A;  2ACZ B;  4REZ A;  4TQ0 A;  1ESF A;  1QOG A;  4C7Z A;  1ZOY B;  2WS3 B;  3ABV B;  3P4R B;  1N63 A;  1T6B X;  1UWX A;  2WXI A;  1JQ4 A;  1FEH A;  1YN5 A;  3AEG B;  2KAJ A;  1V1O A;  3NVW A;  2L83 A;  3P4S B;  3T3N A;  3TEY A;  1KLG D;  1QIL A;  2WDQ B;  1OQQ A;  4GDK B;  1D5X C;  5JXV A;  1C76 A;  1JWS D;  3AE2 B;  2BYT A;  1AYF A;  2RDH A;  4WWM A;  1FMA D;  2N0S B;  4N6E B;  1D5Z C;  1XLQ A;  2M56 B;  1GB1 A;  1V8C A;  3AMZ A;  5D3D A;  5E6J A;  5G5G A;  4TMA B;  1TY2 A;  3BK2 A;  1VR9 A;  1MHX A;  2BBC A;  3IAS 1;  3R2T A;  4HJG E;  1QOF A;  4XDD A;  1STE A;  1A70 A;  3AE9 B;  4J3O D;  4FXC A;  3KWV A;  4US8 A;  3NUH B;  5BYS A;  1C9F A;  1SXT A;  2PKO A;  4HRO A;  3KQ4 A;  2W55 A;  1E10 A;  4WIP A;  4A9A A;  2WXP A;  3J9C A;  1VZ7 A;  4OHJ A;  1SE2 A;  1JWA D;  3VR9 B;  1XLN A;  1IUE A;  5D3I B;  2G9H D;  1YQ4 B;  4JX1 C;  2QIE B;  1KH0 A;  3LYY A;  5FK9 C;  1FCL A;  1E7P B;  1QKZ A;  1PDX A;  2M0A A;  2PVG C;  4ZYS A;  2YEP B;  1NEN B;  2WU5 B;  3AE3 B;  4ZHP A;  3P4Q B;  1UNS A;  2DYM A;  2WQY B;  4ZRQ A;  4XE0 A;  4L2Y A;  3AM9 A;  3SEB A;  1VLB A;  2J53 A;  3AV8 A;  1XCT L;  1QQR A;  3NVY A;  1ACC A;  3C8Y A;  3Q8C A;  1HZ5 A;  4L23 A;  1JWB D;  3EA6 A;  3HRD D;  3W5V B;  2KN4 A;  1FNW A;  1YN3 A;  1F2R C;  1F0Z A;  3TEW A;  5FR3 A;  2OED A;  4KKJ A;  3FC4 A;  3URY A;  3NRZ A;  1PGA A;  3DWG C;  2AQ1 B;  3DWM A;  3HUI A;  1IGD A;  1RM6 C;  3ZJT A;  2WNM A;  4XWT A;  4B0M A;  4NJC A;  4XWW A;  1I4R A;  2MH7 A;  2MJD A;  1GPX A;  4MAC A;  4L1B A;  4HKZ E;  1D4B A;  4C80 A;  2IGH A;  1MPE A;  3I9V 1;  3TEX A;  5LNK 1;  3P42 A;  4OZA A;  4HEA 1;  1QT9 A;  1ROE A;  1TY0 A;  4RGN A;  4N59 A;  3O13 A;  4IDI A;  2PIA A;  3BK1 A;  3GP7 A;  2BTE A;  1WGK A;  1HZ6 A;  1AN8 A;  1ZDV A;  1JWM D;  1EM7 A;  1SJE D;  3LB8 C;  1FM0 D;  3BZD B;  2TSS A;  4KGT A;  3TUO A;  3H8H A;  1ET6 A;  1UGJ A;  4IKG A;  3AEE B;  5HHD G;  4ZOH C;  3GS2 A;  4Q2J A;  5T8I A;  4P16 A;  2ZW0 A;  4WAF A;  1FRR A;  3AE7 B;  2BT6 A;  1R7S A;  5BMI A;  1PGX A;  1QLB B;  4TQ1 A;  2WXN A;  1PFD A;  1E6E B;  1XEE A;  3E9S A;  2DLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...