5BMHA

Nitroxide spin labels in protein gb1: t44 mutant, crystal form b
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWCYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
publication title Rotameric preferences of a protein spin label at edge-strand beta-sheet sites.
pubmed doi rcsb
source organism Streptococcus sp. group g
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5bmhA00
1K53A 2JSVX 5BMHA 3GB1A 4HKZE 3MP9A 1YMHE 1MPEA 2IGGA 2PLPA 5BMIA 1GB4A 1Q10A 2NMQA 1PGAA 2ON8A 1XCQL 3UI3A 1F2RI 4HJGE 2LHEA 1IBXA 2ZW1A 1D4BA 1IGDA 2J52A 1XF5L 1QKZA 1MI0A 1JMLA 5HHDG 4IKGA 3V3XA 4GLSC 1GB1A 1F2RC 1K51A 1ZXHA 5HFYA 1UWXA 2I38A 2N9LA 4D2KA 1K52A 1YNTE 4WH4A 4IOIE 4OZBA 2IGDA 2JWUA 2QMTA 1PGBA 2KN4A 2QSDA 5HI1A 1MHHE 3FILB 2GI9A 1KH0A 2LHDA 4OZCA 1IGCA 2JXTA 1EM7A 1HZ6A 2KQ4X 2IGHA 2I2YA 1MVKA 1C9FA 2N9KA 2RMMA 5JXVA 4KGSA 2KACA 2KWDA 2ONQA 2ZW0A 2LUMA 1P7FA 2N7JA 1FD6A 2JU6X 3FILA 1K50A 1HEZE 4KGRA 1XCTL 2KDMA 1FCCC 4KGTA 2PTLA 5BMGA 2JZPA 1P7EA 5HG2A 4OZAA 1HZ5A 2LGIA 2J53A 2K0PA 2GB1A 1FCLA 2OEDA 2PW9A 4MACA 2EELA 1IBXB 2RPVA 1MHXA 1PGXA
chains in the Genus database with same CATH superfamily
2LRWA 4KIKB 4EE2A 4LDTB 4YSZB 1BUIC 3OJ4B 2L3ZA 3KH0A 4GDKB 3M95A 1N61A 4M02A 4FLHA 5D2MB 2J52A 2VZKD 4CHKA 4K7UA 3TBLD 4LNIA 4XYCA 1WI0A 2L76A 2WWZA 1GC7A 3QARA 3EC8A 5T8IA 3UF8A 1J8CA 3ZXRA 4DDGD 2OJRA 3WCQA 2D3GA 3EECA 2VZKB 3ZQ4A 1LGRA 3DWGC 4DHJD 2C7HA 2R61A 2Z59B 3TJPA 2ZNVC 3Q8BA 4LLGM 1ZOYB 4YSXB 4WAAA 2QSDA 1ACCA 3N9YC 3I5JC 3PGEA 4TMAB 1KTKA 2HTME 2JXTA 2OHFA 4E71A 3SEBA 1EM7A 3DVNU 4DHJB 3URYA 4DHZE 1YOVB 1HTOA 1LO5D 1RWSA 2PE6B 1YQ3B 2G45B 2IDYA 3PVLA 1WFYA 2BW2A 1WYWB 2C7MB 3DBRB 2NBWB 2NTTA 4REZA 1TS5A 2JZPA 5G5HA 3ZRCA 1XT9B 1YX6B 3AE6B 2FCSA 3Q2AC 1PYWD 5BYSA 1LQBA 2K0PA 3GE8C 1TY2A 1SGHA 2PW9A 4PYZA 1SJED 1IBXB 4FADA 1RAXA 5FR3A 4HKQA 1VR9A 4EUTA 2AQ3B 3KWVA 4XE0A 1R4NB 1DOIA 1UNSA 3TEXA 2L0FA 2MP2A 1NI3A 5AUKA 4YTMB 1P1AA 2LVQA 2KFKA 1D4BA 4NAMA 2JT4B 4MDKE 3DBSA 1V1PB 2GBMA 4J3OD 1SSNA 3R2TA 2KDEB 5C2TB 1WGDA 2GBNA 2W54A 5G2NA 1GB1A 2J4XA 3H9DA 2V0GA 4YTNB 1HXYD 4NZLB 4D2KA 4N6EB 4HROA 3SHQA 3U7DA 1YJ1A 5EE9A 4O1NA 5EE3A 1H4RA 1UBQA 2N1WA 5C1ZA 3HRDD 2DLBA 3U7ZA 1WMHB 2ZVOA 3L16A 1WX9A 4II2B 1VCBA 4HPMB 2ONQA 2GBRA 1BMLC 5JHAA 3VQIA 4S0RA 3DVNV 4MGKE 3RNFC 3ABVB 2GBKA 5LXHA 3MC0B 4RFBA 2JWZA 3M62B 1P7EA 1WE7A 2JQRB 3PV1A 4ASWC 4TQ1A 5HG2A 2IO0B 2KLCA 5L83A 2RD0A 5D94A 1S1QB 1E10A 4OHJA 2FUHB 3KW5B 3QWZB 4WWOA 2AQ1B 3DBHB 1PUTA 1WZ3A 3DBLB 3QC8B 3Q8EA 4LNKA 2KLGA 2J42A 2UYZB 3MJ5A 4HPLB 4BKTA 4F1SA 2L7RA 1E5WA 3PZDA 1WXSA 1TS4A 2M8SA 1I4QA 3PTFC 3ALBA 2MA9B 2ON8A 3RUIB 3KQ4A 3WAPA 2DZIA 1FNUA 1F0ZA 1WXAA 4TQ0A 1TZOA 2BYFA 3D32A 4AWJA 3MC9A 1KF6B 3Q3OC 4GLSC 2N7DA 3Q3FA 3L08A 3RZWC 4FHKA 4M01A 1E7UA 2EKEC 4OVVA 3APDA 1I4PA 1OEYA 2BVCA 2FBWB 3BK2A 3W1SC 2NS5A 4EOYA 3AE8B 3TEYA 2W55A 2JUOA 3I3TB 1KLUD 1F52A 3N1YC 2ZPYA 3AE5B 3BIID 3RULA 3RN9C 1NBFC 2NVUI 3Q6BA 4MEMA 2WXIA 3VAWA 5JH5C 2VH2A 2Z8LA 4CQNA 3V61A 2UWQA 2J0KA 2VRRB 3ZTDA 3VTVA 1RFKA 2LI5A 5JHBA 1FD6A 2EMTA 3FILA 3V6EB 3OLMD 4K3BA 1R4MB 1SBBB 1I35A 4A9AA 2RPQA 4I6PA 2WXPA 1EU3A 3AEFB 3NJTA 1EWYC 3DQVA 2LRUA 2D07B 2J53A 2C5LC 2WP9B 2OEDA 1TY0A 4C7ZA 2CU1A 5BYRA 3P4QB 2FUG1 1SEBD 2V4LA 1FMAD 4GDLA 3PZ7A 3X23A 2DZJA 5BMHA 1I7HA 3GB1A 2KYWA 2GLSA 2GBJA 2L8JA 2LGYA 2W9NA 2WS3B 1WGYA 3Q8FA 1GB4A 1VD2A 2IJ0A 3SR6A 2XEWA 1ZPSA 1CQVA 4LK0M 3T3NA 1AWDA 2WXGA 2WXQA 4ITKA 1C77A 4P16A 4C56C 3MJWA 3VVWB 4HVBA 4A6QA 4G3XB 4N9F4 1GPXA 1FFVA 1CJEA 3ZVVA 4W9JA 4HXDA 2M0AA 4IW0A 1WR6E 2DHZA 2D2QA 5FKAC 2Y5PA 1EF5A 4ZHOA 2ICIA 3DDCB 3AEBB 3B2FA 3U52E 1EWCA 1SF0A 2KK8A 4JGHB 1EUVB 4MGYE 3QAQA 5CX3A 2QIEB 3AE1B 3IG3A 1YN3A 4TSSA 4KKIA 3L17A 1VRAB 3RD2A 3LJ3A 5DCNA 2MEKA 4GB9A 2PE9A 2NTSA 3IT4B 2KACA 2MBBB 2KWDA 2AYOB 3PRZA 3TEZA 2RDGA 3L13A 1T0YA 3Q8CA 2D11A 4IDIA 4WQOB 2RGFA 3EA6A 4RH6A 2KVZA 4HCNB 3QQ8B 5IOIA 3SU8X 2WDVB 4ZRJA 3H1UA 4AP4C 3IBEA 1YJJA 1IPGA 3AB5A 4DHZB 2FCMA 3T9LA 1WMHA 1SIFA 2FIDA 3OWEB 1OGWA 2KC2A 3RFZB 1Z5SB 1TBEA 2ZNVB 3A4SC 1OTRB 3RI7C 2BS2B 2BGFA 3GS2A 3RCZA 5H8YE 2IYDB 3ZDTA 3VUWA 3N1ZC 3BINA 3ZIMA 3PREA 3ZUNA 1UH6A 3V3XA 3NHEB 1K51A 3RPFC 3SFDB 1PQSA 3L0WB 3A9JA 1XQQA 1Q0WB 4L23A 3AMZA 2KO3A 2G4DB 1RLFA 1MFWA 1VLBA 2XK5B 4WJPA 5TR5A 2MWSB 2EMSA 2KC1A 5DPRA 2MH7A 1D6EC 3FKYA 2D3BA 3CF6E 1MHHE 2LGSA 4NPNA 5EE0A 3X0WA 2KAJA 2WU5B 2L52A 4ANVA 2IGHA 2WXHA 1MVKA 2WYQA 3AE9B 4BBNF 4JPSA 4A3PA 5C23A 2BT6A 2MSED 2WXFA 1TIFA 2MHJA 1E9MA 2WU2B 2N7JA 3P1MA 1GOZA 3WA0A 3GP7A 2MW5A 1XD3B 3APCA 3WALA 2CU3A 1QOAA 2W82A 3O65B 2CHXA 2FIFA 2IPKD 1KLGD 3NZSA 3QX1A 3ZNID 3T3OA 2NPTB 2KMMA 3DWMA 1HQRD 2WDTB 3WAOA 3NS1A 4MGZE 4MH8A 1WM3A 2MRPA 4G0NB 1IP9A 4BKSD 3GE3C 3MP9A 1AW7A 2K6QA 3PO0A 3M63B 3W5VB 3NVYA 4XWWA 1YQBA 2G9HD 3OAWA 1WE6A 1CK1A 1T0SC 1UELA 4P1CC 2ZZPB 2LD9A 1N63A 1FRRA 2M17A 3BYTB 1MI0A 1V1OA 4WQMA 3NS8A 2LXAA 1RYJA 4YWGG 1C79A 1WGRA 3UIOB 2D5GA 1L0VB 2MBQA 3CMMB 2DNFA 3A1QB 1YNTE 4EZJA 5IA7A 3ZW3A 4WWMA 1GNUA 2M19A 2L32A 3IAS1 4W9KA 3ML9A 3NRZA 2KJ6A 4ANUA 3FILB 5J17A 1R4NI 1T0RC 2JPHA 4IUMB 1XLPA 4DDID 4IM3A 2AL3A 3PHXB 4IWPA 5D7GA 3KUDB 3ZO5B 1NDDA 2DYOA 3JW0X 1T3QA 2ASQA 3NG0A 2M56B 1C4PA 3CWIA 1HEZE 4P1BC 4FJZA 2H88B 4EEWA 4C7YA 2FCQA 2ZPNA 1YQ4B 4M0WA 2V4IB 4GDLB 3NUHB 3MTNB 1VZ7A 1SE4A 3L4PA 1I4HA 2Y5CA 4DBGA 1L5PA 2WXJA 1S3SG 3U2SC 4C00A 1L6UA 1MHXA 3WANA 4GU2A 2DBYA 1FO4A 3AH7A 2IO1B 4LCDE 4L1BA 1F77A 1SXTA 2BPSA 4MSMB 3AV8A 1PGAA 3RNAC 2KFJA 3UI3A 3VRAB 2WDRB 4K3CA 1WGHA 3ZNGC 1GUAB 3WAMA 1QKZA 4PT5A 2LJIA 4A20A 1DYQA 3QK0A 4IC7B 3ZJVA 2DENB 3PHWB 2YEPF 1ZXHA 4QAYA 2N9LA 4PS3A 2KTRA 1EO6A 1E8YA 4ANXA 3EFUA 1R7SA 2HJ1A 2IGDA 3DBHI 4I6NB 3ZJUA 1WR1A 4TKNA 3DBLI 3DHGC 1KOTA 3PZ8A 4LNNA 3DHHC 4AJWA 4OZCA 4B0MA 3UGBB 1V6EA 1L6VA 3AEEB 4ZHPA 5H92C 4EKUA 2N9KA 2KNBA 3ZYYX 2CR5A 4ICUA 1ZE3D 4XZ4A 2R2QA 1WWTA 2N9XA 5AZGA 1DGJA 1Q5WB 4A90A 1WX8A 2DWQA 1TGZB 1QT9A 1N6ZA 3H7PA 2LZ6A 1FCCC 1P3QU 3B9JA 3QCAA 3FAHA 1ZW7A 1TS3A 3NY5A 1C3TA 2ZCCA 5IAAC 4XC2A 2V3PA 1LM8B 5BO4B 1ESFA 5DPTA 2B76B 3V60A 2PVGC 2XK5A 4EFOA 1NYRA 3N20C 2MCNB 4MACA 1ZDVA 4K81A 4WJOA 1E6EB 1T6BX 2N7EA 1UF0A 1FXAA 5G55A 5GMVA 1D3ZA 1HTQA 5LXIB 2B3AA 1WY8A 1KRHA 4M8NA 1RFAA 3A9JB 1JQ4A 2HTHA 2LVOA 1C4CA 3GZNI 2C60A 1FRDA 2LHEA 5E6OA 2LMCA 3K9OB 1R4MI 1FIQA 2SAKA 2M4NA 3KUZA 1JMLA 1E8WA 3I63C 1I4RA 5AZFA 2DAFA 1LFDA 2I1KA 1C78A 2JF5A 2LJ5A 2VH1A 3P63A 2LUEA 1K52A 1JWSD 1WXVA 2NPTA 3RNGC 1MJDA 2CHZA 3IXSA 4WURA 4HRSA 1L7YA 3VXWA 4WWPA 2E3TA 3APFA 1WIAA 2KN4A 4HDQA 1H8CA 2NCNA 1ZKHA 2Y3AA 3U30A 4RF0A 1WJ4A 1IGCA 2DX5B 1QILA 3DVGY 3PRMB 1E7PB 1FNWA 4W9FA 1XLNA 4WWNA 2BYTA 4RCOA 1Y8RC 1YX5B 4NY0A 4BKSA 1KFYB 3HVZA 1UD7A 2KMAA 2JRHA 4YTPB 2WXNA 1TYGB 2KQSA 3EFCA 4GSWA 1IUEA 4JE3B 3A1QA 4NJ7A 3NVWA 1P98A 2FCNA 4F8CB 1BXTA 4BOZB 1UWMA 4A55A 3MC8A 5LLIA 5LNK1 2MLBA 2RPVA 3GZNB 1QF6A 3LB8C 3TMPB 1ZXIA 2PMVA 4JX1C 1V49A 3NVVA 1L0YB 4C80A 2KKCA 4ZRIA 2KWUB 3MFGA 2IGGA 5EE1A 4UDUC 1X1MA 3TEWA 4USAA 3AE4B 3V6CB 2PEAA 3QA8A 2O2VA 1QZEA 2J7QB 1TTNA 2KVRA 1U4AA 1HA5A 1OEYJ 3Q14C 4N58A 4A8XC 2LASA 2XBBC 2BQQA 2NBUA 2QCZA 1NVID 2WX0A 1FM0D 2L05A 3Q3NC 2KHWB 5E6NA 1E0ZA 4C4VA 3P4SB 1V97A 4JQWC 4DXGA 1YIWA 4RGOS 1C4AA 4CYEA 2Y5BB 5HI1A 3R3MA 2J0JA 4K7SA 2GI9A 2CKHB 4XDCA 2LEKA 2ACZB 2BYVE 4IWOA 2K8HA 1JWUD 3W1SA 1WGKA 4M0WB 3V05A 4WIPA 1CMXB 4KX6B 3VH4B 2KDIA 2GOWA 3JYUA 4KGSA 1TZ1A 1GAQB 3RYTA 2LUMA 4NAWB 1N60A 1JWBD 3BVZA 3RT3B 2WGSA 4BZAA 4M8MA 2WLBA 4I6LB 4NJ6A 3A4RA 3IFWB 1J7BA 4GOCA 3ZKJC 1KJTA 3AECB 4YXDB 1HZ5A 5BYQA 5IP4D 3B2GA 2X38A 1J7AA 5DPSA 4B0EA 3PRPB 4NNJB 1UBIA 4ZYSA 1FFUA 2L0TA 2A5UA 2I1JA 1QLBB 4HKZE 3AU4A 4MJSA 3DVGX 3IHPC 2WQYB 2YLMA 2D3CA 3RZFA 1UZXB 3CSTA 4FJVB 3LDZE 4JWUC 1XCQL 2KTRB 1ET9A 2RDHA 4RGNA 2K8CA 4IM0A 4DXFA 2QDFA 1XF5L 1SE3A 4LJPB 1NI2A 3RNBC 1C1YB 1TKEA 4IKGA 1VJKA 4AS1A 4IM2A 4P6VF 3BY4B 4G50A 2HJ8A 5HFYA 4ZDVA 2DAJA 3KLSX 3M3JA 2BYEA 4KDLB 3ONSA 1JW9D 4RMAA 2M0XA 1BT0A 1SJHD 1OQYA 1XLQA 3TIXA 3K9PB 1G6JA 1FPYA 3BVGA 2OOBB 3H7PB 4W9CA 2JY6A 2CHWA 4MELA 5D3DA 5TSSA 2KX3A 4RGMA 1WGGA 1WJUA 1WYGA 2BS4B 3ZDMC 2ZW0A 4KZCA 1Y56A 2AL6A 1AN8A 4MM3B 3HUIA 2PTLA 1E8ZA 3CSFA 3RMKC 2DZMA 4ACFA 4LTUA 3J9CA 3KYDD 3DHIC 4XWTA 2K8BA 3N3KB 4FA6A 3PSEB 1FCLA 4JL9A 2WXOA 1Q1OA 1PFDA 4XGAB 3AE2B 1WJNA 3VH3B 1FNVA 2ZEQA 1F9JA 1ENFA 4IG7B 3SFEB 1OQQA 2IZVB 3A9KB 3AE3B 1WZ0A 1VDVA 3HM6X 1A5RA 1ET6A 4K7WA 2MJEA 2AQ2B 2Z0DB 4BBNC 2N9PC 2MQJA 1RRBA 4FN2A 3MHZA 4W9LA 4PS8A 3AEDB 2DZKA 5JZEB 4M00A 2C9WB 2JXXA 4IWQA 1Z2MA 4FHJA 1I42A 4XX5A 2WHIA 5MPOA 1TT5B 2LXCA 3KYCD 4IOIE 1EU4A 2ZJDA 2GRIA 3AU5A 1WF9A 3HM3A 1JWAD 2JZ3B 5KHOA 4B6WA 3NVZA 2RR9A 1TJEA 2INDC 2CJNA 2IBIB 2XNAC 3I9V1 3P4PB 1ZUD2 2PJHA 4FULA 4URKA 4HLEA 4CO7A 3DCGA 3HVDA 1MG8A 2KZRA 2RDBC 3AI5A 3P42A 3SD5A 2BBCA 2BWES 3PLVA 3W9CB 1LXDA 4DXAB 4AOFA 3N32A 2MBOA 3VUXA 4E74A 2K25A 3R2IA 3IAM1 2C7NB 3W1YA 3AEGB 2LVPA 3BYYB 3R66C 2K39A 3SDLC 2MBHA 2PKOA 2W3SA 2FE8A 4HPPA 2O2VB 4KSLC 1N5XA 3IVFA 2BKRB 3V62A 4R3DA 1AYFA 1XXGA 3DOWA 4H2AA 4JWSC 1V2YA 2N1VA 3ML8A 5BMIA 2SEBD 4L2YA 2NMQA 4NQLB 4C4VB 4NAWA 2FAZA 1WXQA 2E6XA 4FXCA 2BS3B 4LNOA 5G5GA 5DPWA 1FXIA 5HHDG 1EF1A 1XLOA 1UWXA 5I4DA 2AX5A 1WSPA 1V5TA 4ICVA 4DK5A 4RNAA 4E3CA 1V9JA 1B9RA 1J7CA 3Q8AA 3ZTCA 5AUIA 2J0MA 3I57A 2CS4A 2V3SA 3UIPB 2RSUA 3VHTC 4HJKA 2KWVB 3BZDB 1V5OA 2G4SA 3PLUA 2QEJC 1C9FA 3JSVA 1UGJA 4HK2A 4BVUC 3U4EG 1P7FA 4AJYB 1V8CA 3AEAB 2JYEA 2GMIC 1V86A 1NEKB 1QOFA 1JROA 1ISNA 1SE9A 3H6NA 2AEHA 4KDIC 2LGIA 4HDOA 4MJSB 2MJ3A 2GB1A 1T0QC 2N9EB 1GC6A 2K5PA 1SB3C 2K6DB 2WXRA 2EELA 1JRUA 1K8RB 1OQRA 3AM9A 4A3OA 3OG5A 3O13A 3L10B 3VDZA 1YMHE 5FK9C 1JWMD 2KX0A 1QOBA 3JVZX 3AE7B 3B1LX 1QOGA 5CHVC 1OFFA 1JCKB 2HD5B 3TL5A 2INPE 4WJNA 2JRIB 3TUOA 4MM3A 4ZRKA 4B9KA 3Q3JA 3Q69A 2MBEA 1L4DB 2KDFB 1KM7A 2YVCA 1SE2A 1F2RC 5J18A 3VRBB 4N59A 5AZHA 3DPDA 1ZP0B 4HCPB 3UQBA 2AWTA 2KOXA 4FJYA 2WNMA 3S2AA 2JWUA 2DYMA 3NZ3A 3GOEA 2O6VD 3IT6B 4TUUA 3R7RA 1ZDXA 1KLVA 5GXGB 1E8XA 1STEA 2W3RA 1WRIA 2EKIA 3A9KA 4EZKA 1VZ6A 2LGXA 3RNEC 2K1FA 3C0RB 3TCAA 2KJHB 2REXA 4HWIB 3AXCA 1UGMA 2O6VB 4BFRA 1P0RA 4NQKE 5J2RA 4PS7A 3QHTA 2JVCA 2LFIA 3VUYA 1WX7A 2V1YA 5BMGA 3N1XC 4W9GA 1TKGA 4BAXA 3ZRFA 2IY1B 3AN1A 3T8MA 1L2NA 4ZYNA 2M1MA 2KQ7A 3ZLZA 4LJOB 4MH0E 2ZCBA 1TS2A 4GXBA 2D10A 1PGXA 2BF8B 2KXJA 4S17A 2H89B 1DOYA 3LYYA 1K53A 5D3IB 2BKFA 2K22A 3B0AA 4OVUA 4P7IA 2IO3B 2XN9C 3P2BA 4W9EA 1WM2A 1A70A 4HJGE 3N30A 1N5WA 3W5UB 2L1AA 4KIKA 1GG3A 1UUPA 2PIAA 3Q3MC 2X8XX 4GN1A 1NYQA 2KWCA 3ZNHB 4GDKA 1PDXA 4NJCA 5CHFA 2K3UA 2I38A 4RGTA 5EDSA 1E90A 3BK1A 4EZLA 1XO3A 4OW0A 4ARIA 4US9A 1I4GA 4W9HA 4WH4A 3KUCB 4OZBA 1J0GA 2QMTA 4TV3A 2BB6A 3BWUD 1TKYA 1KH0A 2Z0EB 3ZGZA 4JIOU 4Q2JA 2A4ZA 1HZ6A 2KQ4X 2BWFA 5IKCM 3VFKA 5JXVA 2MJDA 4RM8A 1HE8A 4ARCA 2L00B 1YJIA 2K9XA 3U8ZA 2JU6X 4DWFA 1ZGUB 1J19A 1ROEA 2KDMA 1F1HA 1YN4A 3HK0A 3VR8B 1V80A 2NBVB 5CTRC 3VTUA 4X57B 4F7ZA 3ETRA 4US8A 2WXKA 2WX1A 1DOXA 4B95A 2BB5A 2D3AA 4J6IA 4AUQC 1MG4A 1MPEA 4DQOC 2TSSA 2PLPA 1WRDB 1T5XD 4PYUA 4MT5A 2UU7A 1Q10A 3CIRB 1FXTB 3FC4A 4ZRPA 1IBXA 3R7QA 2ZW1A 2KDBA 1WH3A 3NZUA 2L83A 2QHOA 3P4RB 2DYBA 5IN7A 2KJRA 4ANWA 2N0SB 3UINB 1NENB 4WAFA 4LNFA 1N62A 1GJZA 4MGIE 1JALA 1CZPA 1D5XC 1XEEA 3H7SA 3OJ3A 1D5MC 3PS6A 2QILA 4RM9A 3JSVB 3ZJTA 2KANA 1V1PA 5L95C 2QC8A 3ECIA 4YL8A 2N4FA 2G1EA 3QIJA 4WJQA 2QJLA 2Q5WD 4G11A 4KV2A 3ENEA 1I4XA 2I2YA 2R2OA 1L0XB 3E56A 4BKGA 2MP2B 1L4ZB 2V3NA 4K1RB 5FR6A 5AEKB 1M4VA 4AQ7A 2KFKB 1K50A 5HKHA 4GMVA 1XCTL 3RNCC 4KGTA 4KKJA 1JRPA 4W9DA 3E9SA 1AARA 3NOBA 1SIJA 4BOSC 3ZXVA 3PT2B 4OZAA 4FBJB 3R8BA 4OVZA 1V81A 2OJWA 2FNJB 5IO9A 4HEA1 4KZ0A 4GIVA 2WXLA 5KHQA 2JSVX 2KTFA 2KMCA 3TSSA 3ZNZB 5E6JA 1YN5A 4KSKC 3EUB2 1P9DU 2O6VA 2INNE 2JX5A 1F2RI 2INCC 3BVMA 1IGDA 3B08A 2LWPA 3HIZA 2BTEA 1WJ6A 1YD8U 5D6JB 2KN5A 1E7VA 2KD0A 2CJOA 3MHSD 4W9IA 5CHWA 2PPHA 3H8HA 1QQRA 2NR2A 2WDQB 1PGBA 3EHVA 4YSYB 3C19A 2YEPB 2LHDA 4ZRQA 3LXFA 2WXMA 2KT7A 5E6PA 2G3QB 4ZOHC 2IO2B 2IY0B 3PPAA 3UQAA 1IYFA 2RMMA 4PK1A 2HDEA 3KWLA 1D5ZC 2MX2A 4II3B 1FEHA 4YT0B 4GGQA 4KGRA 4XDDA 3KVFB 5C3JB 1WXMA 3WIMA 2LGDA 3L54A 2HE7A 2V9HA 2JZZA 3A33B 1M94A 3C8YA 1RM6C 2JYTA 2ZVNA 4LDTD 4RF1A 3VTWA 4KVGB 2PVOD 3W2DA 4MSQB 3QJZA 3EGRA 1VZ8A 3HHMA 4JLCA 1C76A 3DBRI 1B1ZA 3AULA 3VR9B
chains in the Genus database with same CATH topology
3O13A 1ZXIA 2PMVA 4EE2A 4JX1C 3OWEB 4YSZB 3NVVA 1L0YB 1YMHE 5FK9C 4C80A 1BUIC 3RFZB 1JWMD 3MFGA 4GDKB 1QOBA 2IGGA 3AE7B 5EE1A 4UDUC 1QOGA 3TEWA 1N61A 1OFFA 1JCKB 4USAA 3AE4B 2INPE 2BS2B 3GS2A 5H8YE 3TUOA 2J52A 2VZKD 1HA5A 4N58A 4A8XC 3Q69A 1L4DB 3V3XA 1SE2A 1F2RC 1NVID 1K51A 3VRBB 3RPFC 4N59A 1FM0D 3SFDB 5T8IA 1ZP0B 1E0ZA 4L23A 3P4SB 3AMZA 1V97A 3WCQA 4DXGA 2VZKB 1VLBA 3ZQ4A 3DWGC 4RGOS 2R61A 2WNMA 3Q8BA 1C4AA 4LLGM 2MH7A 2JWUA 1ZOYB 2DYMA 1D6EC 4YSXB 3NZ3A 5HI1A 2QSDA 3IT6B 1MHHE 1ACCA 3N9YC 2GI9A 1ZDXA 5GXGB 4TMAB 5EE0A 1STEA 2LEKA 2ACZB 2KAJA 4XDCA 1JWUD 1KTKA 2W3RA 1WRIA 2EKIA 2HTME 2JXTA 2OHFA 1WGKA 3W1SA 3V05A 2WU5B 3SEBA 1EM7A 2L52A 1VZ6A 2IGHA 4WIPA 2WXHA 3URYA 4KX6B 1MVKA 3AE9B 1LO5D 4JPSA 1RWSA 4KGSA 1YQ3B 2BT6A 2IDYA 1GAQB 2LUMA 2WXFA 1E9MA 2WU2B 2N7JA 4NAWB 1N60A 1JWBD 3BVZA 3P1MA 1GOZA 2BW2A 2WLBA 2LFIA 3GP7A 2NTTA 1J7BA 1TS5A 4REZA 5BMGA 2JZPA 5G5HA 3AECB 4YXDB 1TKGA 2CU3A 1QOAA 2W82A 3AN1A 3AE6B 1HZ5A 2IPKD 1KLGD 1PYWD 5BYQA 5BYSA 3T3OA 2K0PA 3B2GA 2KMMA 1TY2A 2X38A 1J7AA 3DWMA 1HQRD 4B0EA 2PW9A 3NS1A 1SJED 4MH8A 1IBXB 1TS2A 4ZYSA 1FFUA 1PGXA 5FR3A 4HKQA 2H89B 1DOYA 3LYYA 1K53A 5D3IB 1VR9A 1QLBB 2AQ3B 2K22A 3KWVA 4HKZE 3MP9A 4XE0A 1AW7A 3PO0A 1DOIA 3W5VB 1UNSA 3NVYA 2XN9C 4XWWA 3TEXA 2WQYB 2G9HD 1NI3A 5AUKA 4YTMB 1CK1A 4JWUC 1A70A 1XCQL 1ET9A 2RDHA 4HJGE 4RGNA 1D4BA 1N63A 3W5UB 1N5WA 4NAMA 1FRRA 4DXFA 1V1PB 2L1AA 3BYTB 1XF5L 1MI0A 1SE3A 1V1OA 4WQMA 1UUPA 4J3OD 1SSNA 2PIAA 3R2TA 1TKEA 4IKGA 1NYQA 1RYJA 1VJKA 5C2TB 4AS1A 4P6VF 2W54A 4YWGG 1C79A 1GB1A 1PDXA 2J4XA 4NJCA 5HFYA 2K3UA 2D5GA 2I38A 2V0GA 4RGTA 1L0VB 4YTNB 3BK1A 1HXYD 3KLSX 4NZLB 4D2KA 1XO3A 4OW0A 4ARIA 1YNTE 4US9A 4N6EB 4HROA 1JW9D 1I4GA 4WH4A 4WWMA 4OZBA 2M19A 1SJHD 2L32A 1XLQA 5EE9A 3IAS1 4O1NA 2QMTA 5EE3A 3NRZA 2BB6A 3BWUD 3FILB 3HRDD 2DLBA 1TKYA 1KH0A 3BVGA 3U7ZA 3ZGZA 1XLPA 4Q2JA 1HZ6A 2KQ4X 5D3DA 5D7GA 5TSSA 4RGMA 5JXVA 2DYOA 2MJDA 1T3QA 1WYGA 2BS4B 2ONQA 1BMLC 2ZW0A 1Y56A 4ARCA 3VQIA 2M56B 1C4PA 1YJIA 2K9XA 2JU6X 3CWIA 1HEZE 1AN8A 4MM3B 2H88B 4C7YA 1ROEA 3ABVB 2KDMA 1YN4A 1YQ4B 3MC0B 3HUIA 4RFBA 4M0WA 2V4IB 3VR8B 2PTLA 4GDLB 3NUHB 1P7EA 1VZ7A 2JQRB 4TQ1A 5HG2A 1SE4A 4LTUA 3J9CA 3L4PA 4XWTA 1I4HA 2Y5CA 1L5PA 2WXJA 1FCLA 3ETRA 3U2SC 2WXOA 1E10A 1PFDA 4US8A 2WXKA 3AE2B 4OHJA 1FNVA 1DOXA 1L6UA 1MHXA 2BB5A 1ENFA 2AQ1B 2DBYA 1FO4A 1PUTA 3SFEB 3AH7A 4L1BA 3Q8EA 1F77A 1SXTA 1OQQA 2J42A 1MPEA 4DQOC 3MJ5A 3AE3B 2TSSA 1VDVA 2PLPA 1T5XD 1TS4A 4MT5A 1I4QA 3AV8A 1Q10A 1PGAA 1ET6A 2ON8A 3CIRB 3FC4A 4ZRPA 2MJEA 2AQ2B 3KQ4A 3UI3A 1IBXA 2ZW1A 1FNUA 3VRAB 1F0ZA 2WDRB 4TQ0A 1TZOA 2L83A 3P4RB 3MHZA 1QKZA 4PT5A 2LJIA 1DYQA 3ZJVA 3AEDB 1KF6B 4GLSC 2N0SB 2YEPF 1ZXHA 1NENB 2N9LA 4WAFA 1N62A 1JALA 1CZPA 1D5XC 1XEEA 1I4PA 1D5MC 2FBWB 5MPOA 3BK2A 2QILA 1R7SA 4IOIE 3ZJTA 1EU4A 2IGDA 1V1PA 3AE8B 3ZJUA 2GRIA 3TEYA 2W55A 1KLUD 1JWAD 3PZ8A 2G1EA 3NVZA 4OZCA 4B0MA 1TJEA 3AE5B 3BIID 2QJLA 2Q5WD 1L6VA 2CJNA 3AEEB 2XNAC 3I9V1 1I4XA 4ZHPA 2I2YA 5H92C 1L0XB 2WXIA 2N9KA 3P4PB 1ZUD2 3E56A 3ZYYX 2Z8LA 1ZE3D 4CQNA 1L4ZB 2V3NA 1WWTA 1M4VA 1RFKA 1DGJA 3HVDA 4AQ7A 1FD6A 4A90A 3FILA 1K50A 2DWQA 1QT9A 3P42A 1SBBB 1XCTL 2BBCA 1FCCC 4A9AA 3B9JA 2WXPA 4KGTA 1EU3A 3AEFB 3FAHA 1JRPA 4KKJA 1TS3A 3E9SA 3W9CB 1SIJA 1EWYC 2V3PA 4OZAA 1ESFA 3R2IA 3IAM1 2J53A 2B76B 3R8BA 2PVGC 4OVZA 3AEGB 1NYRA 2WP9B 2OEDA 1TY0A 3BYYB 4MACA 4C7ZA 2W3SA 2PKOA 1ZDVA 5BYRA 2FE8A 3P4QB 2FUG1 4HEA1 1SEBD 1N5XA 1FMAD 1E6EB 1T6BX 2WXLA 3PZ7A 2JSVX 4R3DA 5BMHA 1I7HA 1AYFA 3GB1A 1XXGA 4H2AA 2WS3B 4JWSC 1FXAA 3TSSA 5E6JA 5BMIA 2SEBD 1KRHA 1YN5A 3Q8FA 1GB4A 4L2YA 2IJ0A 3SR6A 3EUB2 1JQ4A 1ZPSA 1CQVA 1C4CA 2INNE 2JX5A 2NMQA 4LK0M 1F2RI 3T3NA 1FRDA 2LHEA 3BVMA 1AWDA 2LMCA 2WXGA 1WXQA 2E6XA 2WXQA 1IGDA 1C77A 4FXCA 4ITKA 1FIQA 4P16A 4C56C 2BS3B 2SAKA 4A6QA 5G5GA 1GPXA 1JMLA 1FXIA 1FFVA 5HHDG 1I4RA 1CJEA 1XLOA 2M0AA 1C78A 1UWXA 5FKAC 5I4DA 4ZHOA 2BTEA 3P63A 2Y5PA 2AX5A 2ICIA 1K52A 1WSPA 3AEBB 1JWSD 3B2FA 4RNAA 3U52E 1EWCA 1SF0A 2CJOA 1B9RA 1J7CA 3Q8AA 3H8HA 3IXSA 5AUIA 4WURA 2QIEB 4HRSA 1QQRA 3AE1B 3I57A 2E3TA 2WDQB 1YN3A 1PGBA 4TSSA 4YSYB 2KN4A 3BZDB 2YEPB 2Y3AA 2LHDA 4RF0A 4KKIA 4ZRQA 1IGCA 3LXFA 2WXMA 1QILA 1VRAB 1E7PB 4ZOHC 2MEKA 1FNWA 2QEJC 1XLNA 2BYTA 1C9FA 4RCOA 2NTSA 2RMMA 3IT4B 1UGJA 2KACA 2KWDA 2HDEA 3KWLA 1D5ZC 3U4EG 3TEZA 1P7FA 2RDGA 1FEHA 1V8CA 3Q8CA 4IDIA 1KFYB 3AEAB 3HVZA 4YT0B 2JYEA 4KGRA 4YTPB 4XDDA 3EA6A 5C3JB 2WXNA 4RH6A 1TYGB 1NEKB 1QOFA 1IUEA 1JROA 2WDVB 3C8YA 1RM6C 2JYTA 4JE3B 2LGIA 4RF1A 3NVWA 2MJ3A 2PVOD 2GB1A 3W2DA 1BXTA 1UWMA 4A55A 2K5PA 1SB3C 3EGRA 5LNK1 1VZ8A 1YJJA 2WXRA 1C76A 2EELA 1OQRA 1B1ZA 2RPVA 3AB5A 3AM9A 3VR9B 1QF6A 3LB8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K53 A;  2JSV X;  5BMH A;  3GB1 A;  4HKZ E;  3MP9 A;  1YMH E;  1MPE A;  2IGG A;  2PLP A;  5BMI A;  1GB4 A;  1Q10 A;  2NMQ A;  1PGA A;  2ON8 A;  1XCQ L;  3UI3 A;  1F2R I;  4HJG E;  2LHE A;  1IBX A;  2ZW1 A;  1D4B A;  1IGD A;  2J52 A;  1XF5 L;  1QKZ A;  1MI0 A;  1JML A;  5HHD G;  4IKG A;  3V3X A;  4GLS C;  1GB1 A;  1F2R C;  1K51 A;  1ZXH A;  5HFY A;  1UWX A;  2I38 A;  2N9L A;  4D2K A;  1K52 A;  1YNT E;  4WH4 A;  4IOI E;  4OZB A;  2IGD A;  2JWU A;  2QMT A;  1PGB A;  2KN4 A;  2QSD A;  5HI1 A;  1MHH E;  3FIL B;  2GI9 A;  1KH0 A;  2LHD A;  4OZC A;  1IGC A;  2JXT A;  1EM7 A;  1HZ6 A;  2KQ4 X;  2IGH A;  2I2Y A;  1MVK A;  1C9F A;  2N9K A;  2RMM A;  5JXV A;  4KGS A;  2KAC A;  2KWD A;  2ONQ A;  2ZW0 A;  2LUM A;  1P7F A;  2N7J A;  1FD6 A;  2JU6 X;  3FIL A;  1K50 A;  1HEZ E;  4KGR A;  1XCT L;  2KDM A;  1FCC C;  4KGT A;  2PTL A;  5BMG A;  2JZP A;  1P7E A;  5HG2 A;  4OZA A;  1HZ5 A;  2LGI A;  2J53 A;  2K0P A;  2GB1 A;  1FCL A;  2OED A;  2PW9 A;  4MAC A;  2EEL A;  1IBX B;  2RPV A;  1MHX A;  1PGX A; 
#chains in the Genus database with same CATH topology
 2LRW A;  4KIK B;  4EE2 A;  4LDT B;  4YSZ B;  1BUI C;  3OJ4 B;  2L3Z A;  3KH0 A;  4GDK B;  3M95 A;  1N61 A;  4M02 A;  4FLH A;  5D2M B;  2J52 A;  2VZK D;  4CHK A;  4K7U A;  3TBL D;  4LNI A;  4XYC A;  1WI0 A;  2L76 A;  2WWZ A;  1GC7 A;  3QAR A;  3EC8 A;  5T8I A;  3UF8 A;  1J8C A;  3ZXR A;  4DDG D;  2OJR A;  3WCQ A;  2D3G A;  3EEC A;  2VZK B;  3ZQ4 A;  1LGR A;  3DWG C;  4DHJ D;  2C7H A;  2R61 A;  2Z59 B;  3TJP A;  2ZNV C;  3Q8B A;  4LLG M;  1ZOY B;  4YSX B;  4WAA A;  2QSD A;  1ACC A;  3N9Y C;  3I5J C;  3PGE A;  4TMA B;  1KTK A;  2HTM E;  2JXT A;  2OHF A;  4E71 A;  3SEB A;  1EM7 A;  3DVN U;  4DHJ B;  3URY A;  4DHZ E;  1YOV B;  1HTO A;  1LO5 D;  1RWS A;  2PE6 B;  1YQ3 B;  2G45 B;  2IDY A;  3PVL A;  1WFY A;  2BW2 A;  1WYW B;  2C7M B;  3DBR B;  2NBW B;  2NTT A;  4REZ A;  1TS5 A;  2JZP A;  5G5H A;  3ZRC A;  1XT9 B;  1YX6 B;  3AE6 B;  2FCS A;  3Q2A C;  1PYW D;  5BYS A;  1LQB A;  2K0P A;  3GE8 C;  1TY2 A;  1SGH A;  2PW9 A;  4PYZ A;  1SJE D;  1IBX B;  4FAD A;  1RAX A;  5FR3 A;  4HKQ A;  1VR9 A;  4EUT A;  2AQ3 B;  3KWV A;  4XE0 A;  1R4N B;  1DOI A;  1UNS A;  3TEX A;  2L0F A;  2MP2 A;  1NI3 A;  5AUK A;  4YTM B;  1P1A A;  2LVQ A;  2KFK A;  1D4B A;  4NAM A;  2JT4 B;  4MDK E;  3DBS A;  1V1P B;  2GBM A;  4J3O D;  1SSN A;  3R2T A;  2KDE B;  5C2T B;  1WGD A;  2GBN A;  2W54 A;  5G2N A;  1GB1 A;  2J4X A;  3H9D A;  2V0G A;  4YTN B;  1HXY D;  4NZL B;  4D2K A;  4N6E B;  4HRO A;  3SHQ A;  3U7D A;  1YJ1 A;  5EE9 A;  4O1N A;  5EE3 A;  1H4R A;  1UBQ A;  2N1W A;  5C1Z A;  3HRD D;  2DLB A;  3U7Z A;  1WMH B;  2ZVO A;  3L16 A;  1WX9 A;  4II2 B;  1VCB A;  4HPM B;  2ONQ A;  2GBR A;  1BML C;  5JHA A;  3VQI A;  4S0R A;  3DVN V;  4MGK E;  3RNF C;  3ABV B;  2GBK A;  5LXH A;  3MC0 B;  4RFB A;  2JWZ A;  3M62 B;  1P7E A;  1WE7 A;  2JQR B;  3PV1 A;  4ASW C;  4TQ1 A;  5HG2 A;  2IO0 B;  2KLC A;  5L83 A;  2RD0 A;  5D94 A;  1S1Q B;  1E10 A;  4OHJ A;  2FUH B;  3KW5 B;  3QWZ B;  4WWO A;  2AQ1 B;  3DBH B;  1PUT A;  1WZ3 A;  3DBL B;  3QC8 B;  3Q8E A;  4LNK A;  2KLG A;  2J42 A;  2UYZ B;  3MJ5 A;  4HPL B;  4BKT A;  4F1S A;  2L7R A;  1E5W A;  3PZD A;  1WXS A;  1TS4 A;  2M8S A;  1I4Q A;  3PTF C;  3ALB A;  2MA9 B;  2ON8 A;  3RUI B;  3KQ4 A;  3WAP A;  2DZI A;  1FNU A;  1F0Z A;  1WXA A;  4TQ0 A;  1TZO A;  2BYF A;  3D32 A;  4AWJ A;  3MC9 A;  1KF6 B;  3Q3O C;  4GLS C;  2N7D A;  3Q3F A;  3L08 A;  3RZW C;  4FHK A;  4M01 A;  1E7U A;  2EKE C;  4OVV A;  3APD A;  1I4P A;  1OEY A;  2BVC A;  2FBW B;  3BK2 A;  3W1S C;  2NS5 A;  4EOY A;  3AE8 B;  3TEY A;  2W55 A;  2JUO A;  3I3T B;  1KLU D;  1F52 A;  3N1Y C;  2ZPY A;  3AE5 B;  3BII D;  3RUL A;  3RN9 C;  1NBF C;  2NVU I;  3Q6B A;  4MEM A;  2WXI A;  3VAW A;  5JH5 C;  2VH2 A;  2Z8L A;  4CQN A;  3V61 A;  2UWQ A;  2J0K A;  2VRR B;  3ZTD A;  3VTV A;  1RFK A;  2LI5 A;  5JHB A;  1FD6 A;  2EMT A;  3FIL A;  3V6E B;  3OLM D;  4K3B A;  1R4M B;  1SBB B;  1I35 A;  4A9A A;  2RPQ A;  4I6P A;  2WXP A;  1EU3 A;  3AEF B;  3NJT A;  1EWY C;  3DQV A;  2LRU A;  2D07 B;  2J53 A;  2C5L C;  2WP9 B;  2OED A;  1TY0 A;  4C7Z A;  2CU1 A;  5BYR A;  3P4Q B;  2FUG 1;  1SEB D;  2V4L A;  1FMA D;  4GDL A;  3PZ7 A;  3X23 A;  2DZJ A;  5BMH A;  1I7H A;  3GB1 A;  2KYW A;  2GLS A;  2GBJ A;  2L8J A;  2LGY A;  2W9N A;  2WS3 B;  1WGY A;  3Q8F A;  1GB4 A;  1VD2 A;  2IJ0 A;  3SR6 A;  2XEW A;  1ZPS A;  1CQV A;  4LK0 M;  3T3N A;  1AWD A;  2WXG A;  2WXQ A;  4ITK A;  1C77 A;  4P16 A;  4C56 C;  3MJW A;  3VVW B;  4HVB A;  4A6Q A;  4G3X B;  4N9F 4;  1GPX A;  1FFV A;  1CJE A;  3ZVV A;  4W9J A;  4HXD A;  2M0A A;  4IW0 A;  1WR6 E;  2DHZ A;  2D2Q A;  5FKA C;  2Y5P A;  1EF5 A;  4ZHO A;  2ICI A;  3DDC B;  3AEB B;  3B2F A;  3U52 E;  1EWC A;  1SF0 A;  2KK8 A;  4JGH B;  1EUV B;  4MGY E;  3QAQ A;  5CX3 A;  2QIE B;  3AE1 B;  3IG3 A;  1YN3 A;  4TSS A;  4KKI A;  3L17 A;  1VRA B;  3RD2 A;  3LJ3 A;  5DCN A;  2MEK A;  4GB9 A;  2PE9 A;  2NTS A;  3IT4 B;  2KAC A;  2MBB B;  2KWD A;  2AYO B;  3PRZ A;  3TEZ A;  2RDG A;  3L13 A;  1T0Y A;  3Q8C A;  2D11 A;  4IDI A;  4WQO B;  2RGF A;  3EA6 A;  4RH6 A;  2KVZ A;  4HCN B;  3QQ8 B;  5IOI A;  3SU8 X;  2WDV B;  4ZRJ A;  3H1U A;  4AP4 C;  3IBE A;  1YJJ A;  1IPG A;  3AB5 A;  4DHZ B;  2FCM A;  3T9L A;  1WMH A;  1SIF A;  2FID A;  3OWE B;  1OGW A;  2KC2 A;  3RFZ B;  1Z5S B;  1TBE A;  2ZNV B;  3A4S C;  1OTR B;  3RI7 C;  2BS2 B;  2BGF A;  3GS2 A;  3RCZ A;  5H8Y E;  2IYD B;  3ZDT A;  3VUW A;  3N1Z C;  3BIN A;  3ZIM A;  3PRE A;  3ZUN A;  1UH6 A;  3V3X A;  3NHE B;  1K51 A;  3RPF C;  3SFD B;  1PQS A;  3L0W B;  3A9J A;  1XQQ A;  1Q0W B;  4L23 A;  3AMZ A;  2KO3 A;  2G4D B;  1RLF A;  1MFW A;  1VLB A;  2XK5 B;  4WJP A;  5TR5 A;  2MWS B;  2EMS A;  2KC1 A;  5DPR A;  2MH7 A;  1D6E C;  3FKY A;  2D3B A;  3CF6 E;  1MHH E;  2LGS A;  4NPN A;  5EE0 A;  3X0W A;  2KAJ A;  2WU5 B;  2L52 A;  4ANV A;  2IGH A;  2WXH A;  1MVK A;  2WYQ A;  3AE9 B;  4BBN F;  4JPS A;  4A3P A;  5C23 A;  2BT6 A;  2MSE D;  2WXF A;  1TIF A;  2MHJ A;  1E9M A;  2WU2 B;  2N7J A;  3P1M A;  1GOZ A;  3WA0 A;  3GP7 A;  2MW5 A;  1XD3 B;  3APC A;  3WAL A;  2CU3 A;  1QOA A;  2W82 A;  3O65 B;  2CHX A;  2FIF A;  2IPK D;  1KLG D;  3NZS A;  3QX1 A;  3ZNI D;  3T3O A;  2NPT B;  2KMM A;  3DWM A;  1HQR D;  2WDT B;  3WAO A;  3NS1 A;  4MGZ E;  4MH8 A;  1WM3 A;  2MRP A;  4G0N B;  1IP9 A;  4BKS D;  3GE3 C;  3MP9 A;  1AW7 A;  2K6Q A;  3PO0 A;  3M63 B;  3W5V B;  3NVY A;  4XWW A;  1YQB A;  2G9H D;  3OAW A;  1WE6 A;  1CK1 A;  1T0S C;  1UEL A;  4P1C C;  2ZZP B;  2LD9 A;  1N63 A;  1FRR A;  2M17 A;  3BYT B;  1MI0 A;  1V1O A;  4WQM A;  3NS8 A;  2LXA A;  1RYJ A;  4YWG G;  1C79 A;  1WGR A;  3UIO B;  2D5G A;  1L0V B;  2MBQ A;  3CMM B;  2DNF A;  3A1Q B;  1YNT E;  4EZJ A;  5IA7 A;  3ZW3 A;  4WWM A;  1GNU A;  2M19 A;  2L32 A;  3IAS 1;  4W9K A;  3ML9 A;  3NRZ A;  2KJ6 A;  4ANU A;  3FIL B;  5J17 A;  1R4N I;  1T0R C;  2JPH A;  4IUM B;  1XLP A;  4DDI D;  4IM3 A;  2AL3 A;  3PHX B;  4IWP A;  5D7G A;  3KUD B;  3ZO5 B;  1NDD A;  2DYO A;  3JW0 X;  1T3Q A;  2ASQ A;  3NG0 A;  2M56 B;  1C4P A;  3CWI A;  1HEZ E;  4P1B C;  4FJZ A;  2H88 B;  4EEW A;  4C7Y A;  2FCQ A;  2ZPN A;  1YQ4 B;  4M0W A;  2V4I B;  4GDL B;  3NUH B;  3MTN B;  1VZ7 A;  1SE4 A;  3L4P A;  1I4H A;  2Y5C A;  4DBG A;  1L5P A;  2WXJ A;  1S3S G;  3U2S C;  4C00 A;  1L6U A;  1MHX A;  3WAN A;  4GU2 A;  2DBY A;  1FO4 A;  3AH7 A;  2IO1 B;  4LCD E;  4L1B A;  1F77 A;  1SXT A;  2BPS A;  4MSM B;  3AV8 A;  1PGA A;  3RNA C;  2KFJ A;  3UI3 A;  3VRA B;  2WDR B;  4K3C A;  1WGH A;  3ZNG C;  1GUA B;  3WAM A;  1QKZ A;  4PT5 A;  2LJI A;  4A20 A;  1DYQ A;  3QK0 A;  4IC7 B;  3ZJV A;  2DEN B;  3PHW B;  2YEP F;  1ZXH A;  4QAY A;  2N9L A;  4PS3 A;  2KTR A;  1EO6 A;  1E8Y A;  4ANX A;  3EFU A;  1R7S A;  2HJ1 A;  2IGD A;  3DBH I;  4I6N B;  3ZJU A;  1WR1 A;  4TKN A;  3DBL I;  3DHG C;  1KOT A;  3PZ8 A;  4LNN A;  3DHH C;  4AJW A;  4OZC A;  4B0M A;  3UGB B;  1V6E A;  1L6V A;  3AEE B;  4ZHP A;  5H92 C;  4EKU A;  2N9K A;  2KNB A;  3ZYY X;  2CR5 A;  4ICU A;  1ZE3 D;  4XZ4 A;  2R2Q A;  1WWT A;  2N9X A;  5AZG A;  1DGJ A;  1Q5W B;  4A90 A;  1WX8 A;  2DWQ A;  1TGZ B;  1QT9 A;  1N6Z A;  3H7P A;  2LZ6 A;  1FCC C;  1P3Q U;  3B9J A;  3QCA A;  3FAH A;  1ZW7 A;  1TS3 A;  3NY5 A;  1C3T A;  2ZCC A;  5IAA C;  4XC2 A;  2V3P A;  1LM8 B;  5BO4 B;  1ESF A;  5DPT A;  2B76 B;  3V60 A;  2PVG C;  2XK5 A;  4EFO A;  1NYR A;  3N20 C;  2MCN B;  4MAC A;  1ZDV A;  4K81 A;  4WJO A;  1E6E B;  1T6B X;  2N7E A;  1UF0 A;  1FXA A;  5G55 A;  5GMV A;  1D3Z A;  1HTQ A;  5LXI B;  2B3A A;  1WY8 A;  1KRH A;  4M8N A;  1RFA A;  3A9J B;  1JQ4 A;  2HTH A;  2LVO A;  1C4C A;  3GZN I;  2C60 A;  1FRD A;  2LHE A;  5E6O A;  2LMC A;  3K9O B;  1R4M I;  1FIQ A;  2SAK A;  2M4N A;  3KUZ A;  1JML A;  1E8W A;  3I63 C;  1I4R A;  5AZF A;  2DAF A;  1LFD A;  2I1K A;  1C78 A;  2JF5 A;  2LJ5 A;  2VH1 A;  3P63 A;  2LUE A;  1K52 A;  1JWS D;  1WXV A;  2NPT A;  3RNG C;  1MJD A;  2CHZ A;  3IXS A;  4WUR A;  4HRS A;  1L7Y A;  3VXW A;  4WWP A;  2E3T A;  3APF A;  1WIA A;  2KN4 A;  4HDQ A;  1H8C A;  2NCN A;  1ZKH A;  2Y3A A;  3U30 A;  4RF0 A;  1WJ4 A;  1IGC A;  2DX5 B;  1QIL A;  3DVG Y;  3PRM B;  1E7P B;  1FNW A;  4W9F A;  1XLN A;  4WWN A;  2BYT A;  4RCO A;  1Y8R C;  1YX5 B;  4NY0 A;  4BKS A;  1KFY B;  3HVZ A;  1UD7 A;  2KMA A;  2JRH A;  4YTP B;  2WXN A;  1TYG B;  2KQS A;  3EFC A;  4GSW A;  1IUE A;  4JE3 B;  3A1Q A;  4NJ7 A;  3NVW A;  1P98 A;  2FCN A;  4F8C B;  1BXT A;  4BOZ B;  1UWM A;  4A55 A;  3MC8 A;  5LLI A;  5LNK 1;  2MLB A;  2RPV A;  3GZN B;  1QF6 A;  3LB8 C;  3TMP B;  1ZXI A;  2PMV A;  4JX1 C;  1V49 A;  3NVV A;  1L0Y B;  4C80 A;  2KKC A;  4ZRI A;  2KWU B;  3MFG A;  2IGG A;  5EE1 A;  4UDU C;  1X1M A;  3TEW A;  4USA A;  3AE4 B;  3V6C B;  2PEA A;  3QA8 A;  2O2V A;  1QZE A;  2J7Q B;  1TTN A;  2KVR A;  1U4A A;  1HA5 A;  1OEY J;  3Q14 C;  4N58 A;  4A8X C;  2LAS A;  2XBB C;  2BQQ A;  2NBU A;  2QCZ A;  1NVI D;  2WX0 A;  1FM0 D;  2L05 A;  3Q3N C;  2KHW B;  5E6N A;  1E0Z A;  4C4V A;  3P4S B;  1V97 A;  4JQW C;  4DXG A;  1YIW A;  4RGO S;  1C4A A;  4CYE A;  2Y5B B;  5HI1 A;  3R3M A;  2J0J A;  4K7S A;  2GI9 A;  2CKH B;  4XDC A;  2LEK A;  2ACZ B;  2BYV E;  4IWO A;  2K8H A;  1JWU D;  3W1S A;  1WGK A;  4M0W B;  3V05 A;  4WIP A;  1CMX B;  4KX6 B;  3VH4 B;  2KDI A;  2GOW A;  3JYU A;  4KGS A;  1TZ1 A;  1GAQ B;  3RYT A;  2LUM A;  4NAW B;  1N60 A;  1JWB D;  3BVZ A;  3RT3 B;  2WGS A;  4BZA A;  4M8M A;  2WLB A;  4I6L B;  4NJ6 A;  3A4R A;  3IFW B;  1J7B A;  4GOC A;  3ZKJ C;  1KJT A;  3AEC B;  4YXD B;  1HZ5 A;  5BYQ A;  5IP4 D;  3B2G A;  2X38 A;  1J7A A;  5DPS A;  4B0E A;  3PRP B;  4NNJ B;  1UBI A;  4ZYS A;  1FFU A;  2L0T A;  2A5U A;  2I1J A;  1QLB B;  4HKZ E;  3AU4 A;  4MJS A;  3DVG X;  3IHP C;  2WQY B;  2YLM A;  2D3C A;  3RZF A;  1UZX B;  3CST A;  4FJV B;  3LDZ E;  4JWU C;  1XCQ L;  2KTR B;  1ET9 A;  2RDH A;  4RGN A;  2K8C A;  4IM0 A;  4DXF A;  2QDF A;  1XF5 L;  1SE3 A;  4LJP B;  1NI2 A;  3RNB C;  1C1Y B;  1TKE A;  4IKG A;  1VJK A;  4AS1 A;  4IM2 A;  4P6V F;  3BY4 B;  4G50 A;  2HJ8 A;  5HFY A;  4ZDV A;  2DAJ A;  3KLS X;  3M3J A;  2BYE A;  4KDL B;  3ONS A;  1JW9 D;  4RMA A;  2M0X A;  1BT0 A;  1SJH D;  1OQY A;  1XLQ A;  3TIX A;  3K9P B;  1G6J A;  1FPY A;  3BVG A;  2OOB B;  3H7P B;  4W9C A;  2JY6 A;  2CHW A;  4MEL A;  5D3D A;  5TSS A;  2KX3 A;  4RGM A;  1WGG A;  1WJU A;  1WYG A;  2BS4 B;  3ZDM C;  2ZW0 A;  4KZC A;  1Y56 A;  2AL6 A;  1AN8 A;  4MM3 B;  3HUI A;  2PTL A;  1E8Z A;  3CSF A;  3RMK C;  2DZM A;  4ACF A;  4LTU A;  3J9C A;  3KYD D;  3DHI C;  4XWT A;  2K8B A;  3N3K B;  4FA6 A;  3PSE B;  1FCL A;  4JL9 A;  2WXO A;  1Q1O A;  1PFD A;  4XGA B;  3AE2 B;  1WJN A;  3VH3 B;  1FNV A;  2ZEQ A;  1F9J A;  1ENF A;  4IG7 B;  3SFE B;  1OQQ A;  2IZV B;  3A9K B;  3AE3 B;  1WZ0 A;  1VDV A;  3HM6 X;  1A5R A;  1ET6 A;  4K7W A;  2MJE A;  2AQ2 B;  2Z0D B;  4BBN C;  2N9P C;  2MQJ A;  1RRB A;  4FN2 A;  3MHZ A;  4W9L A;  4PS8 A;  3AED B;  2DZK A;  5JZE B;  4M00 A;  2C9W B;  2JXX A;  4IWQ A;  1Z2M A;  4FHJ A;  1I42 A;  4XX5 A;  2WHI A;  5MPO A;  1TT5 B;  2LXC A;  3KYC D;  4IOI E;  1EU4 A;  2ZJD A;  2GRI A;  3AU5 A;  1WF9 A;  3HM3 A;  1JWA D;  2JZ3 B;  5KHO A;  4B6W A;  3NVZ A;  2RR9 A;  1TJE A;  2IND C;  2CJN A;  2IBI B;  2XNA C;  3I9V 1;  3P4P B;  1ZUD 2;  2PJH A;  4FUL A;  4URK A;  4HLE A;  4CO7 A;  3DCG A;  3HVD A;  1MG8 A;  2KZR A;  2RDB C;  3AI5 A;  3P42 A;  3SD5 A;  2BBC A;  2BWE S;  3PLV A;  3W9C B;  1LXD A;  4DXA B;  4AOF A;  3N32 A;  2MBO A;  3VUX A;  4E74 A;  2K25 A;  3R2I A;  3IAM 1;  2C7N B;  3W1Y A;  3AEG B;  2LVP A;  3BYY B;  3R66 C;  2K39 A;  3SDL C;  2MBH A;  2PKO A;  2W3S A;  2FE8 A;  4HPP A;  2O2V B;  4KSL C;  1N5X A;  3IVF A;  2BKR B;  3V62 A;  4R3D A;  1AYF A;  1XXG A;  3DOW A;  4H2A A;  4JWS C;  1V2Y A;  2N1V A;  3ML8 A;  5BMI A;  2SEB D;  4L2Y A;  2NMQ A;  4NQL B;  4C4V B;  4NAW A;  2FAZ A;  1WXQ A;  2E6X A;  4FXC A;  2BS3 B;  4LNO A;  5G5G A;  5DPW A;  1FXI A;  5HHD G;  1EF1 A;  1XLO A;  1UWX A;  5I4D A;  2AX5 A;  1WSP A;  1V5T A;  4ICV A;  4DK5 A;  4RNA A;  4E3C A;  1V9J A;  1B9R A;  1J7C A;  3Q8A A;  3ZTC A;  5AUI A;  2J0M A;  3I57 A;  2CS4 A;  2V3S A;  3UIP B;  2RSU A;  3VHT C;  4HJK A;  2KWV B;  3BZD B;  1V5O A;  2G4S A;  3PLU A;  2QEJ C;  1C9F A;  3JSV A;  1UGJ A;  4HK2 A;  4BVU C;  3U4E G;  1P7F A;  4AJY B;  1V8C A;  3AEA B;  2JYE A;  2GMI C;  1V86 A;  1NEK B;  1QOF A;  1JRO A;  1ISN A;  1SE9 A;  3H6N A;  2AEH A;  4KDI C;  2LGI A;  4HDO A;  4MJS B;  2MJ3 A;  2GB1 A;  1T0Q C;  2N9E B;  1GC6 A;  2K5P A;  1SB3 C;  2K6D B;  2WXR A;  2EEL A;  1JRU A;  1K8R B;  1OQR A;  3AM9 A;  4A3O A;  3OG5 A;  3O13 A;  3L10 B;  3VDZ A;  1YMH E;  5FK9 C;  1JWM D;  2KX0 A;  1QOB A;  3JVZ X;  3AE7 B;  3B1L X;  1QOG A;  5CHV C;  1OFF A;  1JCK B;  2HD5 B;  3TL5 A;  2INP E;  4WJN A;  2JRI B;  3TUO A;  4MM3 A;  4ZRK A;  4B9K A;  3Q3J A;  3Q69 A;  2MBE A;  1L4D B;  2KDF B;  1KM7 A;  2YVC A;  1SE2 A;  1F2R C;  5J18 A;  3VRB B;  4N59 A;  5AZH A;  3DPD A;  1ZP0 B;  4HCP B;  3UQB A;  2AWT A;  2KOX A;  4FJY A;  2WNM A;  3S2A A;  2JWU A;  2DYM A;  3NZ3 A;  3GOE A;  2O6V D;  3IT6 B;  4TUU A;  3R7R A;  1ZDX A;  1KLV A;  5GXG B;  1E8X A;  1STE A;  2W3R A;  1WRI A;  2EKI A;  3A9K A;  4EZK A;  1VZ6 A;  2LGX A;  3RNE C;  2K1F A;  3C0R B;  3TCA A;  2KJH B;  2REX A;  4HWI B;  3AXC A;  1UGM A;  2O6V B;  4BFR A;  1P0R A;  4NQK E;  5J2R A;  4PS7 A;  3QHT A;  2JVC A;  2LFI A;  3VUY A;  1WX7 A;  2V1Y A;  5BMG A;  3N1X C;  4W9G A;  1TKG A;  4BAX A;  3ZRF A;  2IY1 B;  3AN1 A;  3T8M A;  1L2N A;  4ZYN A;  2M1M A;  2KQ7 A;  3ZLZ A;  4LJO B;  4MH0 E;  2ZCB A;  1TS2 A;  4GXB A;  2D10 A;  1PGX A;  2BF8 B;  2KXJ A;  4S17 A;  2H89 B;  1DOY A;  3LYY A;  1K53 A;  5D3I B;  2BKF A;  2K22 A;  3B0A A;  4OVU A;  4P7I A;  2IO3 B;  2XN9 C;  3P2B A;  4W9E A;  1WM2 A;  1A70 A;  4HJG E;  3N30 A;  1N5W A;  3W5U B;  2L1A A;  4KIK A;  1GG3 A;  1UUP A;  2PIA A;  3Q3M C;  2X8X X;  4GN1 A;  1NYQ A;  2KWC A;  3ZNH B;  4GDK A;  1PDX A;  4NJC A;  5CHF A;  2K3U A;  2I38 A;  4RGT A;  5EDS A;  1E90 A;  3BK1 A;  4EZL A;  1XO3 A;  4OW0 A;  4ARI A;  4US9 A;  1I4G A;  4W9H A;  4WH4 A;  3KUC B;  4OZB A;  1J0G A;  2QMT A;  4TV3 A;  2BB6 A;  3BWU D;  1TKY A;  1KH0 A;  2Z0E B;  3ZGZ A;  4JIO U;  4Q2J A;  2A4Z A;  1HZ6 A;  2KQ4 X;  2BWF A;  5IKC M;  3VFK A;  5JXV A;  2MJD A;  4RM8 A;  1HE8 A;  4ARC A;  2L00 B;  1YJI A;  2K9X A;  3U8Z A;  2JU6 X;  4DWF A;  1ZGU B;  1J19 A;  1ROE A;  2KDM A;  1F1H A;  1YN4 A;  3HK0 A;  3VR8 B;  1V80 A;  2NBV B;  5CTR C;  3VTU A;  4X57 B;  4F7Z A;  3ETR A;  4US8 A;  2WXK A;  2WX1 A;  1DOX A;  4B95 A;  2BB5 A;  2D3A A;  4J6I A;  4AUQ C;  1MG4 A;  1MPE A;  4DQO C;  2TSS A;  2PLP A;  1WRD B;  1T5X D;  4PYU A;  4MT5 A;  2UU7 A;  1Q10 A;  3CIR B;  1FXT B;  3FC4 A;  4ZRP A;  1IBX A;  3R7Q A;  2ZW1 A;  2KDB A;  1WH3 A;  3NZU A;  2L83 A;  2QHO A;  3P4R B;  2DYB A;  5IN7 A;  2KJR A;  4ANW A;  2N0S B;  3UIN B;  1NEN B;  4WAF A;  4LNF A;  1N62 A;  1GJZ A;  4MGI E;  1JAL A;  1CZP A;  1D5X C;  1XEE A;  3H7S A;  3OJ3 A;  1D5M C;  3PS6 A;  2QIL A;  4RM9 A;  3JSV B;  3ZJT A;  2KAN A;  1V1P A;  5L95 C;  2QC8 A;  3ECI A;  4YL8 A;  2N4F A;  2G1E A;  3QIJ A;  4WJQ A;  2QJL A;  2Q5W D;  4G11 A;  4KV2 A;  3ENE A;  1I4X A;  2I2Y A;  2R2O A;  1L0X B;  3E56 A;  4BKG A;  2MP2 B;  1L4Z B;  2V3N A;  4K1R B;  5FR6 A;  5AEK B;  1M4V A;  4AQ7 A;  2KFK B;  1K50 A;  5HKH A;  4GMV A;  1XCT L;  3RNC C;  4KGT A;  4KKJ A;  1JRP A;  4W9D A;  3E9S A;  1AAR A;  3NOB A;  1SIJ A;  4BOS C;  3ZXV A;  3PT2 B;  4OZA A;  4FBJ B;  3R8B A;  4OVZ A;  1V81 A;  2OJW A;  2FNJ B;  5IO9 A;  4HEA 1;  4KZ0 A;  4GIV A;  2WXL A;  5KHQ A;  2JSV X;  2KTF A;  2KMC A;  3TSS A;  3ZNZ B;  5E6J A;  1YN5 A;  4KSK C;  3EUB 2;  1P9D U;  2O6V A;  2INN E;  2JX5 A;  1F2R I;  2INC C;  3BVM A;  1IGD A;  3B08 A;  2LWP A;  3HIZ A;  2BTE A;  1WJ6 A;  1YD8 U;  5D6J B;  2KN5 A;  1E7V A;  2KD0 A;  2CJO A;  3MHS D;  4W9I A;  5CHW A;  2PPH A;  3H8H A;  1QQR A;  2NR2 A;  2WDQ B;  1PGB A;  3EHV A;  4YSY B;  3C19 A;  2YEP B;  2LHD A;  4ZRQ A;  3LXF A;  2WXM A;  2KT7 A;  5E6P A;  2G3Q B;  4ZOH C;  2IO2 B;  2IY0 B;  3PPA A;  3UQA A;  1IYF A;  2RMM A;  4PK1 A;  2HDE A;  3KWL A;  1D5Z C;  2MX2 A;  4II3 B;  1FEH A;  4YT0 B;  4GGQ A;  4KGR A;  4XDD A;  3KVF B;  5C3J B;  1WXM A;  3WIM A;  2LGD A;  3L54 A;  2HE7 A;  2V9H A;  2JZZ A;  3A33 B;  1M94 A;  3C8Y A;  1RM6 C;  2JYT A;  2ZVN A;  4LDT D;  4RF1 A;  3VTW A;  4KVG B;  2PVO D;  3W2D A;  4MSQ B;  3QJZ A;  3EGR A;  1VZ8 A;  3HHM A;  4JLC A;  1C76 A;  3DBR I;  1B1Z A;  3AUL A;  3VR9 B; 
#chains in the Genus database with same CATH homology
 3O13 A;  1ZXI A;  2PMV A;  4EE2 A;  4JX1 C;  3OWE B;  4YSZ B;  3NVV A;  1L0Y B;  1YMH E;  5FK9 C;  4C80 A;  1BUI C;  3RFZ B;  1JWM D;  3MFG A;  4GDK B;  1QOB A;  2IGG A;  3AE7 B;  5EE1 A;  4UDU C;  1QOG A;  3TEW A;  1N61 A;  1OFF A;  1JCK B;  4USA A;  3AE4 B;  2INP E;  2BS2 B;  3GS2 A;  5H8Y E;  3TUO A;  2J52 A;  2VZK D;  1HA5 A;  4N58 A;  4A8X C;  3Q69 A;  1L4D B;  3V3X A;  1SE2 A;  1F2R C;  1NVI D;  1K51 A;  3VRB B;  3RPF C;  4N59 A;  1FM0 D;  3SFD B;  5T8I A;  1ZP0 B;  1E0Z A;  4L23 A;  3P4S B;  3AMZ A;  1V97 A;  3WCQ A;  4DXG A;  2VZK B;  1VLB A;  3ZQ4 A;  3DWG C;  4RGO S;  2R61 A;  2WNM A;  3Q8B A;  1C4A A;  4LLG M;  2MH7 A;  2JWU A;  1ZOY B;  2DYM A;  1D6E C;  4YSX B;  3NZ3 A;  5HI1 A;  2QSD A;  3IT6 B;  1MHH E;  1ACC A;  3N9Y C;  2GI9 A;  1ZDX A;  5GXG B;  4TMA B;  5EE0 A;  1STE A;  2LEK A;  2ACZ B;  2KAJ A;  4XDC A;  1JWU D;  1KTK A;  2W3R A;  1WRI A;  2EKI A;  2HTM E;  2JXT A;  2OHF A;  1WGK A;  3W1S A;  3V05 A;  2WU5 B;  3SEB A;  1EM7 A;  2L52 A;  1VZ6 A;  2IGH A;  4WIP A;  2WXH A;  3URY A;  4KX6 B;  1MVK A;  3AE9 B;  1LO5 D;  4JPS A;  1RWS A;  4KGS A;  1YQ3 B;  2BT6 A;  2IDY A;  1GAQ B;  2LUM A;  2WXF A;  1E9M A;  2WU2 B;  2N7J A;  4NAW B;  1N60 A;  1JWB D;  3BVZ A;  3P1M A;  1GOZ A;  2BW2 A;  2WLB A;  2LFI A;  3GP7 A;  2NTT A;  1J7B A;  1TS5 A;  4REZ A;  5BMG A;  2JZP A;  5G5H A;  3AEC B;  4YXD B;  1TKG A;  2CU3 A;  1QOA A;  2W82 A;  3AN1 A;  3AE6 B;  1HZ5 A;  2IPK D;  1KLG D;  1PYW D;  5BYQ A;  5BYS A;  3T3O A;  2K0P A;  3B2G A;  2KMM A;  1TY2 A;  2X38 A;  1J7A A;  3DWM A;  1HQR D;  4B0E A;  2PW9 A;  3NS1 A;  1SJE D;  4MH8 A;  1IBX B;  1TS2 A;  4ZYS A;  1FFU A;  1PGX A;  5FR3 A;  4HKQ A;  2H89 B;  1DOY A;  3LYY A;  1K53 A;  5D3I B;  1VR9 A;  1QLB B;  2AQ3 B;  2K22 A;  3KWV A;  4HKZ E;  3MP9 A;  4XE0 A;  1AW7 A;  3PO0 A;  1DOI A;  3W5V B;  1UNS A;  3NVY A;  2XN9 C;  4XWW A;  3TEX A;  2WQY B;  2G9H D;  1NI3 A;  5AUK A;  4YTM B;  1CK1 A;  4JWU C;  1A70 A;  1XCQ L;  1ET9 A;  2RDH A;  4HJG E;  4RGN A;  1D4B A;  1N63 A;  3W5U B;  1N5W A;  4NAM A;  1FRR A;  4DXF A;  1V1P B;  2L1A A;  3BYT B;  1XF5 L;  1MI0 A;  1SE3 A;  1V1O A;  4WQM A;  1UUP A;  4J3O D;  1SSN A;  2PIA A;  3R2T A;  1TKE A;  4IKG A;  1NYQ A;  1RYJ A;  1VJK A;  5C2T B;  4AS1 A;  4P6V F;  2W54 A;  4YWG G;  1C79 A;  1GB1 A;  1PDX A;  2J4X A;  4NJC A;  5HFY A;  2K3U A;  2D5G A;  2I38 A;  2V0G A;  4RGT A;  1L0V B;  4YTN B;  3BK1 A;  1HXY D;  3KLS X;  4NZL B;  4D2K A;  1XO3 A;  4OW0 A;  4ARI A;  1YNT E;  4US9 A;  4N6E B;  4HRO A;  1JW9 D;  1I4G A;  4WH4 A;  4WWM A;  4OZB A;  2M19 A;  1SJH D;  2L32 A;  1XLQ A;  5EE9 A;  3IAS 1;  4O1N A;  2QMT A;  5EE3 A;  3NRZ A;  2BB6 A;  3BWU D;  3FIL B;  3HRD D;  2DLB A;  1TKY A;  1KH0 A;  3BVG A;  3U7Z A;  3ZGZ A;  1XLP A;  4Q2J A;  1HZ6 A;  2KQ4 X;  5D3D A;  5D7G A;  5TSS A;  4RGM A;  5JXV A;  2DYO A;  2MJD A;  1T3Q A;  1WYG A;  2BS4 B;  2ONQ A;  1BML C;  2ZW0 A;  1Y56 A;  4ARC A;  3VQI A;  2M56 B;  1C4P A;  1YJI A;  2K9X A;  2JU6 X;  3CWI A;  1HEZ E;  1AN8 A;  4MM3 B;  2H88 B;  4C7Y A;  1ROE A;  3ABV B;  2KDM A;  1YN4 A;  1YQ4 B;  3MC0 B;  3HUI A;  4RFB A;  4M0W A;  2V4I B;  3VR8 B;  2PTL A;  4GDL B;  3NUH B;  1P7E A;  1VZ7 A;  2JQR B;  4TQ1 A;  5HG2 A;  1SE4 A;  4LTU A;  3J9C A;  3L4P A;  4XWT A;  1I4H A;  2Y5C A;  1L5P A;  2WXJ A;  1FCL A;  3ETR A;  3U2S C;  2WXO A;  1E10 A;  1PFD A;  4US8 A;  2WXK A;  3AE2 B;  4OHJ A;  1FNV A;  1DOX A;  1L6U A;  1MHX A;  2BB5 A;  1ENF A;  2AQ1 B;  2DBY A;  1FO4 A;  1PUT A;  3SFE B;  3AH7 A;  4L1B A;  3Q8E A;  1F77 A;  1SXT A;  1OQQ A;  2J42 A;  1MPE A;  4DQO C;  3MJ5 A;  3AE3 B;  2TSS A;  1VDV A;  2PLP A;  1T5X D;  1TS4 A;  4MT5 A;  1I4Q A;  3AV8 A;  1Q10 A;  1PGA A;  1ET6 A;  2ON8 A;  3CIR B;  3FC4 A;  4ZRP A;  2MJE A;  2AQ2 B;  3KQ4 A;  3UI3 A;  1IBX A;  2ZW1 A;  1FNU A;  3VRA B;  1F0Z A;  2WDR B;  4TQ0 A;  1TZO A;  2L83 A;  3P4R B;  3MHZ A;  1QKZ A;  4PT5 A;  2LJI A;  1DYQ A;  3ZJV A;  3AED B;  1KF6 B;  4GLS C;  2N0S B;  2YEP F;  1ZXH A;  1NEN B;  2N9L A;  4WAF A;  1N62 A;  1JAL A;  1CZP A;  1D5X C;  1XEE A;  1I4P A;  1D5M C;  2FBW B;  5MPO A;  3BK2 A;  2QIL A;  1R7S A;  4IOI E;  3ZJT A;  1EU4 A;  2IGD A;  1V1P A;  3AE8 B;  3ZJU A;  2GRI A;  3TEY A;  2W55 A;  1KLU D;  1JWA D;  3PZ8 A;  2G1E A;  3NVZ A;  4OZC A;  4B0M A;  1TJE A;  3AE5 B;  3BII D;  2QJL A;  2Q5W D;  1L6V A;  2CJN A;  3AEE B;  2XNA C;  3I9V 1;  1I4X A;  4ZHP A;  2I2Y A;  5H92 C;  1L0X B;  2WXI A;  2N9K A;  3P4P B;  1ZUD 2;  3E56 A;  3ZYY X;  2Z8L A;  1ZE3 D;  4CQN A;  1L4Z B;  2V3N A;  1WWT A;  1M4V A;  1RFK A;  1DGJ A;  3HVD A;  4AQ7 A;  1FD6 A;  4A90 A;  3FIL A;  1K50 A;  2DWQ A;  1QT9 A;  3P42 A;  1SBB B;  1XCT L;  2BBC A;  1FCC C;  4A9A A;  3B9J A;  2WXP A;  4KGT A;  1EU3 A;  3AEF B;  3FAH A;  1JRP A;  4KKJ A;  1TS3 A;  3E9S A;  3W9C B;  1SIJ A;  1EWY C;  2V3P A;  4OZA A;  1ESF A;  3R2I A;  3IAM 1;  2J53 A;  2B76 B;  3R8B A;  2PVG C;  4OVZ A;  3AEG B;  1NYR A;  2WP9 B;  2OED A;  1TY0 A;  3BYY B;  4MAC A;  4C7Z A;  2W3S A;  2PKO A;  1ZDV A;  5BYR A;  2FE8 A;  3P4Q B;  2FUG 1;  4HEA 1;  1SEB D;  1N5X A;  1FMA D;  1E6E B;  1T6B X;  2WXL A;  3PZ7 A;  2JSV X;  4R3D A;  5BMH A;  1I7H A;  1AYF A;  3GB1 A;  1XXG A;  4H2A A;  2WS3 B;  4JWS C;  1FXA A;  3TSS A;  5E6J A;  5BMI A;  2SEB D;  1KRH A;  1YN5 A;  3Q8F A;  1GB4 A;  4L2Y A;  2IJ0 A;  3SR6 A;  3EUB 2;  1JQ4 A;  1ZPS A;  1CQV A;  1C4C A;  2INN E;  2JX5 A;  2NMQ A;  4LK0 M;  1F2R I;  3T3N A;  1FRD A;  2LHE A;  3BVM A;  1AWD A;  2LMC A;  2WXG A;  1WXQ A;  2E6X A;  2WXQ A;  1IGD A;  1C77 A;  4FXC A;  4ITK A;  1FIQ A;  4P16 A;  4C56 C;  2BS3 B;  2SAK A;  4A6Q A;  5G5G A;  1GPX A;  1JML A;  1FXI A;  1FFV A;  5HHD G;  1I4R A;  1CJE A;  1XLO A;  2M0A A;  1C78 A;  1UWX A;  5FKA C;  5I4D A;  4ZHO A;  2BTE A;  3P63 A;  2Y5P A;  2AX5 A;  2ICI A;  1K52 A;  1WSP A;  3AEB B;  1JWS D;  3B2F A;  4RNA A;  3U52 E;  1EWC A;  1SF0 A;  2CJO A;  1B9R A;  1J7C A;  3Q8A A;  3H8H A;  3IXS A;  5AUI A;  4WUR A;  2QIE B;  4HRS A;  1QQR A;  3AE1 B;  3I57 A;  2E3T A;  2WDQ B;  1YN3 A;  1PGB A;  4TSS A;  4YSY B;  2KN4 A;  3BZD B;  2YEP B;  2Y3A A;  2LHD A;  4RF0 A;  4KKI A;  4ZRQ A;  1IGC A;  3LXF A;  2WXM A;  1QIL A;  1VRA B;  1E7P B;  4ZOH C;  2MEK A;  1FNW A;  2QEJ C;  1XLN A;  2BYT A;  1C9F A;  4RCO A;  2NTS A;  2RMM A;  3IT4 B;  1UGJ A;  2KAC A;  2KWD A;  2HDE A;  3KWL A;  1D5Z C;  3U4E G;  3TEZ A;  1P7F A;  2RDG A;  1FEH A;  1V8C A;  3Q8C A;  4IDI A;  1KFY B;  3AEA B;  3HVZ A;  4YT0 B;  2JYE A;  4KGR A;  4YTP B;  4XDD A;  3EA6 A;  5C3J B;  2WXN A;  4RH6 A;  1TYG B;  1NEK B;  1QOF A;  1IUE A;  1JRO A;  2WDV B;  3C8Y A;  1RM6 C;  2JYT A;  4JE3 B;  2LGI A;  4RF1 A;  3NVW A;  2MJ3 A;  2PVO D;  2GB1 A;  3W2D A;  1BXT A;  1UWM A;  4A55 A;  2K5P A;  1SB3 C;  3EGR A;  5LNK 1;  1VZ8 A;  1YJJ A;  2WXR A;  1C76 A;  2EEL A;  1OQR A;  1B1Z A;  2RPV A;  3AB5 A;  3AM9 A;  3VR9 B;  1QF6 A;  3LB8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...