4NJ6A

Pb1 domain of atarf7
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
TYTAVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVAHENAILLVGDDPWEEFVNCVQSIKILSSAEVQQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Auxin response factor 7
publication title Molecular basis for AUXIN RESPONSE FACTOR protein interaction and the control of auxin response repression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 19
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nj6A00
4ZRKA 2L3ZA 3RUIB 2LVQA 4LJOB 2PE6B 1UZXB 1VCBA 3LDZE 3VFKA 3U8ZA 4ZRIA 2RPQA 3KH0A 2AWTA 2K1FA 2KMAA 2CHWA 2XK5B 5LLIA 4LJPB 5JZEB 2KMCA 4FJYA 1I42A 1WJNA 4W9KA 4WAAA 4MJSA 1IYFA 1WJ6A 1WX7A 3ZIMA 5DPRA 5GMVA 3UIOB 2Z0EB 1WZ0A 1LM8B 1V2YA 1NDDA 1WM3A 1UH6A 3EECA 2FCSA 3PRPB 3HM3A 3SHQA 1EF1A 4FHKA 2JPHA 1MG8A 3ZNID 1YIWA 2KANA 2LUEA 3B0AA 4MSMB 2C5LC 2CHXA 1EF5A 2DZMA 2MBOA 4XC2A 2L0FA 2WYQA 3VH3B 4WQOB 2LWPA 3T8MA 1WY8A 2FCQA 3HHMA 4IWOA 4FLHA 4B9KA 1OEYA 2EMSA 2KJRA 5E6OA 2LXAA 4WJPA 3NOBA 3JYUA 1C3TA 2VRRB 2L0TA 3KUDB 4LDTB 3A9JA 2C7NB 1P9DU 2G4SA 1ZW7A 3KW5B 1UD7A 2O6VB 1E90A 3KUZA 1UBQA 3PHWB 4WJQA 4DDGD 3AI5A 2KC2A 2BPSA 3M62B 3W1SC 3L08A 1P1AA 3U30A 3VTVA 2CR5A 4NNJB 2G45B 4FN2A 4MEMA 2JY6A 4II2B 5E6NA 5L83A 4ANWA 4HVBA 2O6VD 2IY0B 4KSLC 1E8YA 4M8NA 4W9CA 2KDEB 3NZUA 4MSQB 4GMVA 2MBHA 3HM6X 2KTFA 5KHOA 3QK0A 5IAAC 4EEWA 4IWQA 2PJHA 2N7EA 1WRDB 3KVFB 3APDA 3HIZA 2DAFA 5G2NA 1WH3A 2BF8B 2N1WA 5JHBA 2MP2B 4MGYE 2D11A 1I35A 2J0MA 2JVCA 2LZ6A 2NVUI 4HDOA 3PT2B 1S1QB 4K81A 2KN5A 3ONSA 1YX6B 2PPHA 4ICUA 2FIFA 3SD5A 4I6PA 2BYVE 3VH4B 3W1YA 4E74A 1OTRB 4F8CB 1Z5SB 2O2VB 4HCNB 5J18A 3DVGX 4W9LA 1IPGA 4A20A 2A5UA 3MJWA 3OJ3A 2JXXA 3QA8A 3ZNGC 2KTRB 1ISNA 3M95A 1E5WA 2V1YA 3B08A 4NPNA 2KK8A 2IY1B 2K25A 2IZVB 4I6NB 1QZEA 4MELA 2L05A 2AEHA 2D2QA 3ML8A 2M17A 3AU5A 2ZCCA 3DQVA 2MWSB 2O2VA 1KJTA 4GB9A 3IHPC 4GDLB 2JF5A 2J0JA 2PEAA 2KLCA 1GJZA 1NBFC 1JRUA 4FHJA 4GN1A 1XQQA 4W9HA 3A1QA 4EZLA 2NCNA 2K39A 1WGHA 2MSED 3O65B 2GBMA 2CHZA 2LASA 3WAMA 4BFRA 1WX9A 2MLBA 2IBIB 1YD8U 4WWNA 3A4RA 4DWFA 5E6PA 3APCA 4MH0E 3A9KB 5AZGA 2FUHB 1KOTA 1WFYA 3VDZA 4F1SA 2NBUA 2KX3A 2JWZA 1E8XA 4HPLB 5BO4B 2NPTA 3ZTCA 2J0KA 4I6LB 3DBRI 3X23A 3UF8A 3TIXA 4HCPB 3QCAA 2BWES 3ZO5B 1WXMA 2BKRB 4MGKE 3GOEA 3WANA 4XX5A 4RMAA 1P98A 3IG3A 1WMHB 3QIJA 3H7SA 2GOWA 1YQBA 2GMIC 2RD0A 3N32A 5CHWA 1X1MA 1OGWA 1HE8A 2K8BA 3GZNI 3RYTA 1TGZB 4HK2A 4IM3A 2C7MB 4EZKA 3DVGY 1SE9A 5JH5C 2KJHB 4P7IA 1OQYA 3SDLC 5L95C 4TQ1A 2LGDA 4DHJB 5FR6A 3PTFC 2K8HA 1WMHA 3ZVVA 1Q5WB 3C0RB 4MGZE 2MBBB 3ENEA 2XK5A 1V81A 4RM9A 2KX0A 2KQSA 3V61A 4GGQA 2NBVB 1GUAB 2Z59B 4IWPA 1GG3A 1WGDA 4BVUC 3ZNZB 2N9PC 2JRHA 3Q3FA 4JL9A 1WYWB 4KV2A 4GSWA 4BKTA 1WJUA 1YX5B 3QX1A 1V5OA 1VD2A 4DHJD 4DHZB 2ZZPB 3WA0A 3AU4A 5D94A 3M3JA 2R2QA 4W9EA 1P0RA 1WF9A 1WXVA 1SGHA 3RULA 4IG7B 3ZTDA 1YJ1A 2HE7A 2KJ6A 4HDQA 1D3ZA 2CKHB 2DYOA 3VTUA 3AULA 4KDLB 4G11A 3X0WA 3TMPB 3DVNU 2C60A 3H7PB 3TCAA 4PYZA 2AL6A 2LRWA 3KYDD 4GXBA 3ZLZA 3UQBA 4DK5A 5CHFA 5IA7A 4FULA 1C1YB 2LI5A 4MM3A 4EFOA 2EKEC 2FIDA 5AZHA 1TBEA 1KM7A 2ZNVB 1S3SG 4EZJA 4TUUA 1XT9B 2KHWB 3VUYA 2O6VA 3PS6A 4CHKA 2ZVOA 4XZ4A 1R4MI 2ZCBA 1Z2MA 4K7UA 2LRUA 4N9F4 2GBNA 1WM2A 4AWJA 3QHTA 1U4AA 2BYEA 2IO3B 1P3QU 3DPDA 3M63B 1WE6A 2MX2A 3NS8A 3NZSA 3NHEB 3PV1A 3R3MA 3WALA 4KIKB 1G6JA 2OJRA 2JZZA 1WGGA 1L7YA 5JHAA 5G55A 5C1ZA 4BKSD 1TTNA 4HPMB 2GBJA 1V86A 2NBWB 3CMMB 2N9XA 3B1LX 4ASWC 3L10B 3ZKJC 2XEWA 4DDID 2IO0B 2UWQA 3PGEA 2ASQA 3VQIA 3L16A 3CF6E 4OVUA 3DBLI 4BOZB 4CO7A 2C7HA 2N7DA 3DCGA 4G3XB 3CSTA 2Y5BB 3ML9A 3T9LA 3K9PB 2HJ8A 2MP2A 4WJOA 3RCZA 4BOSC 2LXCA 2HTHA 4EUTA 4TQ0A 2WX0A 3I3TB 1H4RA 4DBGA 2KWUB 3H6NA 2MBEA 2DYMA 3TJPA 1F9JA 1EUVB 3QAQA 3DBSA 4JQWC 4OVVA 1SIFA 3HK0A 2LD9A 4KZ0A 3MHSD 2B3AA 4GDKB 2D07B 3TBLD 4M0WB 1T0YA 3ECIA 2ZVNA 2KTRA 3N3KB 4K1RB 3VAWA 2MCNB 3VUXA 3P2BA 1J19A 2L00B 3ZRFA 4IUMB 3WIMA 3UIPB 4ZDVA 2KOXA 2W9NA 1E7UA 1AARA 3OLMD 3V6CB 2M8SA 3DVNV 3KYCD 1UGMA 4YL8A 2EMTA 4GDLA 3U7DA 1RLFA 2R2OA 2D10A 1WXSA 2D3GA 1WZ3A 3Q3JA 4GOCA 2KC1A 3ZW3A 1LFDA 3EFUA 4PS8A 3UINB 3PPAA 1J0GA 3H9DA 2YVCA 2N4FA 4HLEA 3PLVA 3D32A 4B6WA 4FBJB 1A5RA 3PZDA 2KFKB 2N9EB 4E71A 2LGXA 3A9KA 4AJYB 5KHQA 2M4NA 3V60A 3L0WB 2NS5A 3LJ3A 2KDBA 3K9OB 3TL5A 4AUQC 3EHVA 3MTNB 4PS3A 3PREA 2MQJA 2CU1A 2FNJB 1ZKHA 2IYDB 4TV3A 3ZRCA 3IVFA 4KZCA 5AEKB 2C9WB 4BBNC 2DZKA 3DOWA 3L54A 2M0XA 4FJVB 3VVWB 5DCNA 4CYEA 3PRMB 1RFAA 3R7QA 3IFWB 2KVRA 3QJZA 4GU2A 2RR9A 2DX5B 4MJSB 2DYBA 2DZIA 4X57B 3V62A 2JT4B 4WWPA 1V49A 1UELA 3QWZB 3WAPA 4F7ZA 2BGFA 4JIOU 3IBEA 5LXHA 1Q1OA 4JLCA 1RRBA 2M1MA 1E7VA 1K8RB 1EO6A 2DZJA 2MA9B 3N30A 5HKHA 1IP9A 3CSFA 3VHTC 1WJ4A 4NQLB 3ALBA 2KFJA 2KD0A 4AJWA 2G4DB 2FCNA 3PSEB 1GC6A 4TKNA 4K7WA 2WX1A 2KDIA 4W9DA 3ZDMC 2MW5A 4FADA 4PS7A 4URKA 3PRZA 4NJ6A 4FA6A 4KSKC 1V9JA 2JRIB 2DENB 1R4NI 4LCDE 1WGRA 2OOBB 4ICVA 3RZWC 4ANVA 3A9JB 1BT0A 3V6EB 1OEYJ 2JZ3B 1PQSA 3H7PA 3PLUA 2CS4A 3OJ4B 3R7RA 3W1SA 4BBNF 2I1KA 5AZFA 3OAWA 1WE7A 4HWIB 3UGBB 2JUOA 1E8ZA 2A4ZA 5C23A 2AYOB 1WI0A 2MRPA 4GIVA 2ZPYA 3R66C 5D2MB 1TZ1A 2WWZA 4W9JA 5D7GA 2DHZA 3DDCB 2G3QB 1H8CA 2KWVB 3PHXB 2KLGA 5CTRC 5CX3A 1NI2A 4BKSA 1WR1A 4PYUA 4LDTD 4W9GA 4IC7B 1LQBA 2ZJDA 3QC8B 2FCMA 3JVZX 4E3CA 4HJKA 2RGFA 4KIKA 3BINA 5D6JB 2ZNVC 3RD2A 1J8CA 1GC7A 5DPTA 2HD5B 2N1VA 1E8WA 4G50A 1WIAA 1UBIA 2Z0DB 2AL3A 3AXCA 4ANUA 2QHOA 1WX8A 2BYFA 1V5TA 2PE9A 3JSVB 3VXWA 3ZUNA 2K8CA 3EC8A 4K7SA 2KKCA 1V80A 1RAXA 2KQ7A 3H1UA 3JW0X 3QQ8B 4II3B 5DPSA 5J2RA 2REXA 4A3PA 2MBQA 2LVOA 3ZDTA 3DBHI 3NY5A 1CMXB 4DXAB 5J17A 1WGYA 5TR5A 2ZPNA 4B95A 3BY4B 4FJZA 2KXJA 3PVLA 2K6DB 2LGYA 4KDIC 2GBKA 4W9FA 4WJNA 3JSVA 4ZRJA 2L76A 5DPWA 2L8JA 2KWCA 4MDKE 4RM8A 2KDFB 1Y8RC 2ZEQA 2DAJA 4ZYNA 3QARA 3L17A 1L2NA 3A1QB 4NJ7A 3ZNHB 2V4LA 2NR2A 4GDKA 4AP4C 3L13A 2LVPA 4HXDA 3RT3B 2RSUA 3KUCB 3RZFA 4EOYA 4NQKE 3VTWA 2KO3A 4WWOA 4BKGA 2I1JA 1WXAA 1FXTB 2FAZA 4NAWB 3WAOA 3A33B 4IM0A 4M8MA 2J7QB 1WR6E 1LXDA 1V6EA 3SU8X 2KZRA 4W9IA 4NY0A 1ZGUB 2NPTB 3VUWA 2IO2B 2GBRA 3APFA 4KVGB 5CHVC 4IW0A 2L7RA 4JGHB 3UQAA 4MGIE 4A3OA 2UYZB 4NAWA 2KNBA 4DHZE 4EKUA 1GNUA 2IO1B 1KLVA 2YLMA 2K6QA 4AOFA 2KFKA 4J6IA 2BKFA 2V3SA 4IM2A 2XBBC 1XD3B 3S2AA 4ANXA 5EDSA 1M94A 2WDTB 1Q0WB 2LJ5A 3A4SC 2BWFA 5LXIB 4G0NB
chains in the Genus database with same CATH superfamily
2LVQA 2J52A 1FM0D 2PE6B 3LDZE 3KH0A 2K1FA 5LLIA 2CHWA 2FUG1 4WAAA 4MJSA 1TS2A 5DPRA 3AE9B 2INPE 1FO4A 1SSNA 1FNVA 1ROEA 2BT6A 1WZ0A 1NDDA 4A9AA 1SJED 1UH6A 3EECA 2FCSA 3SHQA 2VZKD 1SJHD 3V05A 1T0RC 1YIWA 4MSMB 3BVGA 3VH3B 1QKZA 4WQOB 2D3BA 3HHMA 4FLHA 1AN8A 1OEYA 4YXDB 3BK1A 1RM6C 4WJPA 3NOBA 1UUPA 3DWGC 2V4IB 1T5XD 1ZXHA 3DBHB 2EKIA 4RGNA 5JXVA 3URYA 2JY6A 5E6NA 1SIJA 5L83A 4Q2JA 1XXGA 3OWEB 4GMVA 2KTFA 4DXFA 4HROA 3QK0A 4IWQA 2N7EA 3KVFB 4P1CC 1EU3A 2DAFA 5G2NA 1RFKA 1SE3A 1I35A 2J0MA 2NVUI 2I38A 3AM9A 4ICUA 3SD5A 2QDFA 4E74A 1OTRB 4F8CB 1JROA 1QILA 3RN9C 3DWMA 4W9LA 1IPGA 5HI1A 2A5UA 5BMHA 3M95A 3NS1A 1RWSA 3DQVA 4WQMA 1XQQA 2JYEA 2MSED 3CWIA 2GBMA 3HVZA 1WX9A 1EM7A 2NMQA 2WU2B 2Y5PA 3Q8EA 1I4XA 4I6LB 3DBRI 3UF8A 1YJIA 3ZO5B 2BKRB 1DOYA 3FAHA 3AECB 4XX5A 4MH8A 1FEHA 3H7SA 1M4VA 1QOFA 2RD0A 5CHWA 1OGWA 4EZKA 3DVGY 5JH5C 1MI0A 3RNGC 5L95C 1BXTA 4C4VB 3FKYA 1WMHA 2LHDA 4MGZE 2IDYA 2AX5A 2XK5A 1V81A 4RM9A 2KX0A 2KQSA 3V61A 2NBVB 4BVUC 3ZNZB 4BKTA 1WYWB 4GSWA 1VD2A 2RPVA 3VR8B 4DHJD 2E3TA 1XLOA 4LLGM 2R2QA 4JPSA 4IG7B 4HRSA 2HE7A 1D3ZA 3VTUA 1ZDXA 2D5GA 2IPKD 2LRWA 4GXBA 5CHFA 1C1YB 2INDC 1XCTL 1XT9B 2O6VA 2V3PA 1U4AA 2IO3B 1P3QU 3PV1A 3NS8A 1VLBA 3R3MA 4ZRPA 1FMAD 1E7PB 1L7YA 5EE3A 1K53A 4P1BC 1OFFA 1FD6A 4MACA 2E6XA 3NZ3A 2BBCA 3CMMB 1C79A 4TSSA 2PLPA 3I9V1 3VQIA 2INCC 3CF6E 4M02A 4G3XB 3P42A 3T9LA 2MP2A 2WXOA 2SEBD 2I2YA 2HTHA 3I3TB 3H6NA 2MBEA 1F9JA 3TEYA 1TS5A 4GDKB 2D07B 5C3JB 4K1RB 3VUXA 2MCNB 3NVYA 2JWUA 2WP9B 4ZDVA 3ETRA 3OLMD 2M8SA 1KRHA 2EMTA 3U7DA 2MJEA 2R2OA 1IGCA 3Q3JA 1AYFA 1LFDA 3EFUA 4YTNB 3UINB 1J0GA 3AE2B 2N4FA 4HLEA 1A5RA 3PZDA 1J7CA 2NS5A 3LJ3A 1JMLA 4PS3A 3B2GA 1ZKHA 2MEKA 2ON8A 1ENFA 3GE8C 2C9WB 4B0MA 2KYWA 1ACCA 1QT9A 1EWYC 3PZ8A 1PYWD 4MJSB 1FRRA 1KLGD 2DYBA 2PVOD 2MJDA 4X57B 3V62A 2JT4B 1V49A 3QWZB 2LEKA 2W3RA 4F7ZA 4JIOU 4L2YA 1B1ZA 4YSXB 2M1MA 3N1XC 2MA9B 1IP9A 3CSFA 3VHTC 1FPYA 2FCNA 3PSEB 4YWGG 4TKNA 2QSDA 2KDIA 4OHJA 3DHHC 3ZDMC 4QAYA 1D5ZC 3W5VB 4YT0B 1BT0A 1OEYJ 1SF0A 3H7PA 2X8XX 4HWIB 3UGBB 3W2DA 3LYYA 1L6VA 1Y56A 1EWCA 5C23A 2WGSA 3BK2A 4GIVA 5AUIA 1FNWA 2WWZA 2WXLA 3DDCB 3AE7B 4BKSA 1GB1A 2WNMA 3IXSA 1ZE3D 2ZW1A 3QC8B 2FE8A 4E3CA 3NRZA 4KIKA 1UNSA 3IAM1 4XWWA 1J8CA 2LMCA 1QOAA 2KACA 1WIAA 2WXNA 5IO9A 2AL3A 2QHOA 1WX8A 1V5TA 2KKCA 3AV8A 3QQ8B 5J2RA 2MBQA 3ZDTA 2ACZB 2K22A 4W9FA 4WJNA 3SFEB 2JYTA 3RNEC 3I63C 4RCOA 4RM8A 2KDFB 2BYTA 3Q8CA 1L2NA 4NJ7A 4PK1A 1JWMD 1L4ZB 4AP4C 4M0WA 3KUCB 2WDVB 2KO3A 2I1JA 1WXAA 4XDDA 4IM0A 4M8MA 1ZXIA 2MJ3A 2RDGA 2AQ2B 3SU8X 1C77A 1ZDVA 2KZRA 4W9IA 4NY0A 2VH2A 2KT7A 1LO5D 3LB8C 4S0RA 4IW0A 4PT5A 4NAWA 1WRIA 1GNUA 2IO1B 2K6QA 3PZ7A 5HHDG 5EDSA 1XD3B 1Q0WB 3WCQA 3R8BA 4G0NB 4ZRKA 3DHIC 1F0ZA 1E9MA 4HKQA 1UZXB 4ZRIA 2H88B 2RPQA 2XK5B 4FJYA 1WJNA 2M56B 1IYFA 1WX7A 5GMVA 4ZOHC 1LM8B 2KMMA 1EF1A 2WXJA 4CQNA 1OQQA 4RNAA 3ZNID 2KANA 2LUEA 2CHXA 2DZMA 2LWPA 1WY8A 2N9LA 3GE3C 4IWOA 1TY0A 2EMSA 4WIPA 2N9KA 3JYUA 3KQ4A 3AH7A 3KUDB 4LDTB 2LUMA 3A9JA 2G4SA 1UD7A 2O6VB 1BMLC 1UBQA 3AI5A 3M62B 2K0PA 1P1AA 3VTVA 2CR5A 2G45B 4MEMA 4DXGA 5HFYA 2WXHA 4M8NA 3RFZB 1MHXA 4W9CA 4MSQB 3NZUA 2BQQA 4YTMB 1E10A 1TS3A 1HA5A 2PJHA 1WRDB 2WLBA 3APDA 2BF8B 2MP2B 2JVCA 4HDOA 4BZAA 4NZLB 2KN5A 2PKOA 4OW0A 1TS4A 3ONSA 2FIFA 4I6PA 2BYVE 2WXGA 1I4HA 2O2VB 5J18A 3MJWA 1ISNA 1E5WA 3B08A 2K25A 3ML8A 4KKJA 2M17A 2ZCCA 1D4BA 3NVVA 1XLPA 2JF5A 2J0JA 2PEAA 4OZCA 1HZ5A 5BYSA 4W9HA 4EZLA 2LGIA 2NCNA 3AEFB 4J3OD 4S17A 1WGHA 4WH4A 3GZNB 2CHZA 2MLBA 4WWNA 5E6PA 1DOXA 3Q6BA 3APCA 5AZGA 4C7YA 1FNUA 3VDZA 2HDEA 1J7BA 2NBUA 4OVZA 4HPLB 2GB1A 3X23A 2R61A 4KX6B 1WXMA 3IG3A 4ACFA 3AE5B 1TYGB 3N32A 2K8BA 1HE8A 5FKAC 1KTKA 3VR9B 1L0VB 4IM3A 4WAFA 4L23A 1HEZE 3SDLC 3FC4A 2LGDA 5FR6A 3ZJTA 2K8HA 1VRAB 3ZVVA 2MBBB 3W5UB 2Z59B 4K3BA 1GG3A 1PFDA 2JRHA 3Q3FA 4JL9A 1WJUA 1YX5B 1V5OA 2ZZPB 1R4MB 4C7ZA 2V0GA 5D94A 1KH0A 1P0RA 1WXVA 3ZTDA 2J53A 2HJ1A 2WXQA 3AULA 4KDLB 3DVNU 3AEGB 3H7PB 3BIID 2WXKA 3J9CA 2J4XA 2LI5A 4MM3A 1TBEA 1KM7A 1IBXB 2LHEA 2KN4A 2ZNVB 3N1YC 4EZJA 3DBLB 4CHKA 2L32A 2ZCBA 2WS3B 2LRUA 1VZ8A 2BS4B 3ABVB 4N9F4 2BYEA 3DPDA 2MX2A 3NHEB 1N5XA 4KIKB 1PGXA 2BVCA 2OJRA 2PIAA 5G55A 5TSSA 3R2TA 2L1AA 1V86A 1I7HA 1VZ6A 2N9XA 2VH1A 3B1LX 2XEWA 1GPXA 4WWMA 3L16A 3MC0B 3NVWA 2N7DA 3DCGA 3CSTA 3K9PB 3OG5A 1C9FA 3RCZA 4BOSC 2LXCA 3AE1B 4TQ0A 1GOZA 2WX0A 4DBGA 4EE2A 2KWUB 1F77A 1SIFA 3NJTA 1FXAA 4M0WB 3TBLD 2ZVNA 3P2BA 3ZRFA 3WIMA 3P1MA 2BTEA 3UIPB 4O1NA 3DVNV 2RDBC 2D10A 1WZ3A 3LXFA 2KC1A 3ZW3A 3EUB2 3VRBB 3TEXA 2RMMA 3B9JA 2YVCA 3ZGZA 2PMVA 4RF1A 2LFIA 3D32A 4B6WA 2LGXA 3A9KA 4AJYB 2M4NA 3SFDB 3V60A 3TL5A 1GAQB 3MTNB 2MQJA 3TUOA 4REZA 3ZRCA 4KZCA 2WXMA 3DOWA 4FJVB 3VVWB 3SR6A 5DCNA 3AE8B 3R7QA 1R4NB 3IFWB 2DX5B 4RFBA 2W54A 1V1PA 2DZIA 5HG2A 3WAPA 3NUHB 1Q1OA 1CK1A 2WXIA 2DZJA 1PGBA 2K5PA 1WJ4A 4NQLB 2KD0A 4K7WA 2WX1A 2UU7A 1QLBB 1ZOYB 1VR9A 4NJ6A 2QC8A 4FA6A 1V9JA 2JRIB 4LK0M 1WGRA 3A9JB 3V6EB 2JZ3B 1N5WA 1N62A 1XO3A 2I1KA 1TKYA 3OAWA 2JUOA 1YQ3B 1L0YB 2AYOB 3R66C 4W9JA 5D7GA 3BYTB 2G3QB 1H8CA 3PHXB 5CTRC 3Q8BA 1NI2A 4RGTA 4PYUA 4LDTD 1LQBA 2FCMA 1GB4A 1WGKA 4YSZB 2ZNVC 4XDCA 1N61A 5DPTA 1E8WA 2Z0DB 4RH6A 3AXCA 2OEDA 2BYFA 3JSVB 1V80A 3AE4B 3U2SC 3ZJUA 4ZYSA 1WGYA 2WXPA 5TR5A 2KXJA 2K6DB 2LGYA 1F52A 3P63A 2KWCA 1Y8RC 1C4PA 2DAJA 3FILB 1DOIA 3ZNHB 3GB1A 3EGRA 2KAJA 2RSUA 1PDXA 1MHHE 4NQKE 2WDQB 4BKGA 2QEJC 2OHFA 1HQRD 3N9YC 3VUWA 4HKZE 5CHVC 3U7ZA 2L7RA 3UQAA 4MGIE 2QCZA 1KLVA 1P7FA 2YLMA 4GLSC 1XEEA 4K3CA 4ARIA 2KFKA 1RYJA 4J6IA 2WHIA 2BKFA 2V3SA 2BWFA 1K50A 4NAMA 3RUIB 3MC8A 3VFKA 1VCBA 3U8ZA 5G5HA 2VZKB 2AWTA 5JZEB 2EELA 1I42A 1NYQA 1WJ6A 3ZIMA 2YEPB 5G5GA 1WM3A 3PRPB 1UGJA 3HM3A 4FHKA 2JPHA 1MG8A 2BS3B 4YSYB 1EF5A 2MBOA 5H92C 4XC2A 2FCQA 3RNFC 4B9KA 4MM3B 5E6OA 4M01A 2WXRA 2N7JA 1I4PA 4KKIA 2OJWA 1E90A 4WJQA 2KDMA 3TEZA 2KC2A 3W1SC 1CZPA 4IDIA 4AS1A 4NNJB 4HJGE 4ANWA 3W9CB 2IY0B 1E8YA 4KGSA 1CQVA 3UI3A 2MBHA 3AN1A 3HM6X 1UWMA 1IGDA 4XWTA 5IAAC 4EEWA 1R7SA 2QMTA 3BVMA 2G1EA 1WH3A 1YN4A 2LZ6A 1S1QB 4K81A 2ONQA 1YX6B 4ITKA 3W1YA 4IOIE 2MHJA 5C2TB 4MT5A 3P4PB 3IT6B 1I4GA 3OJ3A 3QA8A 1YNTE 2JXXA 3ZNGC 2W82A 2B76B 4HEA1 4NPNA 1ET9A 3NG0A 1QZEA 5IP4D 2D2QA 1WSPA 4ZRQA 3AU5A 2JXTA 1C76A 1HTOA 3Q2AC 1GJZA 3CIRB 1JRUA 1NBFC 4GN1A 5IOIA 3A1QA 1FXIA 2K39A 4BFRA 1T0QC 1YD8U 2DLBA 4DWFA 4MH0E 3A9KB 2FUHB 1KOTA 1FRDA 1WFYA 4F1SA 1E8XA 5BO4B 2M0AA 3MJ5A 5IN7A 3N1ZC 3TIXA 4HCPB 3QCAA 3GOEA 1D5XC 1ESFA 1WMHB 3QIJA 4AQ7A 2GOWA 2GMIC 4N6EB 1V1PB 1X1MA 1K52A 3GZNI 3N20C 4ARCA 1TGZB 4ZHOA 4HK2A 2TSSA 2Y5CA 3ZXVA 4P7IA 2PTLA 4DHJB 3KWLA 4RGMA 2DWQA 1Q5WB 1EU4A 1JCKB 3E9SA 1WGDA 1P7EA 4KV2A 2XN9C 3BYYB 1WF9A 3EA6A 2KJ6A 4HDQA 5BYRA 2CKHB 2DYOA 4G11A 3X0WA 3TMPB 3BVZA 2BW2A 3TCAA 2ICIA 4RGOS 2AL6A 1SBBB 3ZLZA 2ZW0A 1BUIC 2CJOA 4FULA 4EFOA 2FIDA 5AZHA 2RDHA 2FBWB 3GP7A 1S3SG 1PUTA 4TUUA 1I4RA 1HTQA 3VUYA 3PS6A 1J7AA 4H2AA 1R4MI 1Z2MA 4UDUC 1V8CA 2GBNA 1WM2A 1B9RA 3QHTA 3M63B 1WE6A 1SB3C 1UF0A 3WALA 1WGGA 4US8A 1TTNA 2D3AA 2NBWB 1JW9D 4ASWC 2UWQA 3PGEA 2ASQA 5D3IB 1FFVA 1KLUD 2QIEB 4BOZB 4OVUA 3DBLI 2C7HA 1C4CA 1T6BX 5BMGA 3ML9A 2BB6A 4WJOA 1MPEA 1MJDA 4EUTA 1H4RA 2DYMA 3DBSA 4JQWC 1C78A 2LD9A 3R2IA 4KZ0A 3ECIA 2KTRA 3VAWA 2W55A 4IUMB 4NJCA 2KOXA 1E7UA 1AARA 5EE0A 1V97A 3KYCD 1UGMA 4GDLA 1RLFA 2D3GA 4GOCA 3Q3NC 3V3XA 3TEWA 1I4QA 1VJKA 4PS8A 3VRAB 2KVZA 1TKEA 2KFKB 5KHQA 2IGGA 5FK9C 3L0WB 4AUQC 4US9A 2KDBA 4M00A 4TV3A 1VDVA 5AEKB 3H8HA 4BBNC 2JSVX 5AUKA 3L54A 4CYEA 3PRMB 1RFAA 2KVRA 1SXTA 4WWPA 1UELA 4DQOC 2PW9A 2BGFA 3IBEA 4JLCA 1K8RB 5HKHA 3N30A 1JALA 1MFWA 3HVDA 4OZBA 3ZJVA 3ALBA 2KFJA 1NYRA 4AJWA 2QILA 4W9DA 4URKA 1ZPSA 3PRZA 2DENB 1R4NI 3RZWC 2OOBB 4ICVA 3Q3OC 1SE4A 3R7RA 4BBNF 5AZFA 1DGJA 1WE7A 1TZOA 2MRPA 2ZPYA 4D2KA 1TZ1A 2DHZA 3RMKC 2KLGA 1FFUA 1D5MC 4W9GA 4R3DA 1MVKA 2ZJDA 4IC7B 3BINA 5D6JB 3C8YA 5LNK1 2N1VA 4G50A 1XCQL 2PE9A 3VXWA 3ZUNA 3AB5A 4K7SA 5D3DA 1NENB 3GS2A 2V9HA 4LNIA 5DPSA 4RF0A 5J17A 1XLNA 1CMXB 3NY5A 2ZPNA 4B95A 3PVLA 1KFYB 2L8JA 4MDKE 1F1HA 2IGDA 2M19A 3QARA 3A1QB 4OZAA 2LVPA 5T8IA 4HXDA 3RT3B 1SEBD 4EOYA 3VTWA 1FCCC 3PO0A 1CJEA 1FXTB 2K9XA 3WAOA 4NAWB 3A33B 1WR6E 4JWSC 2IO2B 2GBRA 3APFA 4KVGB 4B0EA 1NVID 3BWUD 4A3OA 4DHZE 2KNBA 3TSSA 4AOFA 1A70A 1ZP0B 3T3OA 3MP9A 4IM2A 1DYQA 2IGHA 2XBBC 3S2AA 4ANXA 1AW7A 1M94A 3A4SC 2L52A 1T3QA 5LXIB 4N59A 1Q10A 2L3ZA 4A8XC 1JQ4A 4LJOB 1HXYD 4XGAB 2KMAA 4LJPB 2KMCA 4W9KA 1ET6A 1UWXA 3UIOB 2Z0EB 1V2YA 2K3UA 1XF5L 4ZHPA 2LJIA 2JU6X 1V1OA 3B0AA 2C5LC 1TY2A 2L0FA 2WYQA 1PGAA 4LNFA 3T8MA 3ZQ4A 2KJRA 2LXAA 1C3TA 2VRRB 2L0TA 2C7NB 1P9DU 1ZW7A 3KW5B 1FCLA 3KUZA 3PHWB 4DDGD 2BPSA 1STEA 3L08A 3U30A 4FN2A 1F2RC 2JX5A 4II2B 4HVBA 2O6VD 4KSLC 1L0XB 2KDEB 4XYCA 5KHOA 1WYGA 3U52E 1SE2A 2AQ1B 2DBYA 2AQ3B 1NEKB 3HIZA 3P4RB 3DHGC 2N1WA 5JHBA 4MGYE 2D11A 3PT2B 2PPHA 1TIFA 3VH4B 3T3NA 4KGTA 1Z5SB 4HCNB 3DVGX 4A20A 3P4SB 2SAKA 2KTRB 3RI7C 2V1YA 2KK8A 2IY1B 1K51A 2D3CA 2IZVB 4I6NB 4MELA 2L05A 2AEHA 3DBRB 3NVZA 2MWSB 2O2VA 1KJTA 4GB9A 3IHPC 4GDLB 4IKGA 4P6VF 2INNE 2KLCA 2J42A 1ZUD2 1OQRA 1JWAD 4FHJA 3L4PA 3O65B 3WAMA 2LASA 4YTPB 2IBIB 3A4RA 3RNCC 2PVGC 1JRPA 4LNNA 2KX3A 2JWZA 2NPTA 3ZTCA 2J0KA 4WURA 5MPOA 2V3NA 2BWES 4MGKE 3WANA 1TJEA 4RMAA 1P98A 3I5JC 1YQBA 3RYTA 3HRDD 2C7MB 1SE9A 2KJHB 4JWUC 1OQYA 4TQ1A 1L4DB 3Q8FA 3PTFC 5FR3A 3C0RB 2JQRB 1YQ4B 3ENEA 4GGQA 1GUAB 4IWPA 2Y3AA 2N9PC 1C4AA 3I57A 3QX1A 2XNAC 4DHZB 3WA0A 3AU4A 3M3JA 4W9EA 3RULA 1SGHA 1YJ1A 1L5PA 2C60A 1QOGA 3AEEB 4PYZA 3KYDD 3Q69A 3UQBA 2GRIA 4DK5A 5IA7A 4HPPA 2BS2B 1FIQA 2EKEC 2N0SB 2IJ0A 1TKGA 2KHWB 2ZVOA 4XZ4A 4K7UA 4C00A 4AWJA 3AEAB 3NZSA 4A55A 1IBXA 5EE9A 1G6JA 2Q5WD 2JZZA 5JHAA 5C1ZA 2JZPA 4BKSD 4HPMB 2GBJA 3L10B 3ZKJC 4BAXA 4DDID 2IO0B 1MG4A 4CO7A 1E6EB 2Y5BB 2HJ8A 1YN3A 3KWVA 3AMZA 3TJPA 1EUVB 3QAQA 4OVVA 4USAA 3HK0A 3MHSD 5IKCM 2B3AA 2GI9A 1T0YA 3N3KB 3AE6B 1J19A 2L00B 2W9NA 3HUIA 3V6CB 4C80A 4YL8A 1LGRA 1WWTA 2H89B 1WXSA 1YOVB 4TMAB 3C19A 3RPFC 3U4EG 5EE1A 2CJNA 2GLSA 3PPAA 3H9DA 2CU3A 3BZDB 3B2FA 3PLVA 4FBJB 2N9EB 4E71A 4N58A 3K9OB 3EHVA 4FXCA 3MC9A 3PREA 2CU1A 2FNJB 2QJLA 2IYDB 3IT4B 1AWDA 3IVFA 2LGSA 2DZKA 2M0XA 3Q14C 4JX1C 4GU2A 3QJZA 2RR9A 2L83A 1QF6A 2MH7A 5BYQA 2W3SA 5LXHA 4C4VA 1RRBA 1E7VA 2NTTA 1EO6A 1QOBA 4L1BA 2G4DB 1GC6A 2MW5A 4FADA 4PS7A 3IAS1 2WU5B 4P16A 4KSKC 5BMIA 4LCDE 4ANVA 3ZYYX 3MFGA 1PQSA 3PLUA 5E6JA 2CS4A 3OJ4B 3W1SA 2BB5A 2KWDA 2DNFA 2KQ4X 1L6UA 3RNAC 1E8ZA 2A4ZA 1JWSD 1WI0A 5D2MB 3Q8AA 1YJJA 1NI3A 2KWVB 5CX3A 1WR1A 1F2RI 5GXGB 4JE3B 5I4DA 3JVZX 1N6ZA 2RGFA 3O13A 4HJKA 3AEBB 3AE3B 1WXQA 2X38A 3RD2A 1D6EC 1GC7A 2HD5B 2YEPF 1UBIA 4A90A 1N60A 4ANUA 1HZ6A 2K8CA 3EC8A 1N63A 4LTUA 1JWBD 1RAXA 2KQ7A 3H1UA 3JW0X 4II3B 4LNKA 2REXA 4A3PA 5H8YE 2LVOA 1QQRA 3DBHI 4DXAB 3BY4B 4FJZA 4KDIC 3Q3MC 2GBKA 3JSVA 4ZRJA 3E56A 4A6QA 2L76A 1YMHE 2WQYB 3MHZA 5DPWA 4LNOA 2WXFA 2ZEQA 4ZYNA 3L17A 2V4LA 2NR2A 4GDKA 3L13A 3RNBC 2G9HD 3AEDB 1E0ZA 1VZ7A 3RZFA 2WDRB 4WWOA 3FILA 2FAZA 3EFCA 2J7QB 4C56C 1LXDA 1V6EA 1YN5A 1XLQA 1ZGUB 1KF6B 2NPTB 2Z8LA 3ZXRA 4JGHB 2UYZB 4EKUA 1JWUD 1TT5B 3SEBA 3KLSX 1IUEA 2HTME 2NTSA 4XE0A 3P4QB 4KGRA 2WDTB 2LJ5A 1T0SC
chains in the Genus database with same CATH topology
4ZRKA 2L3ZA 3RUIB 2LVQA 4LJOB 2PE6B 1UZXB 1VCBA 3LDZE 3VFKA 3U8ZA 4ZRIA 2RPQA 3KH0A 2AWTA 2K1FA 2KMAA 2CHWA 2XK5B 5LLIA 4LJPB 5JZEB 2KMCA 4FJYA 1I42A 1WJNA 4W9KA 4WAAA 4MJSA 1IYFA 1WJ6A 1WX7A 3ZIMA 5DPRA 5GMVA 3UIOB 2Z0EB 1WZ0A 1LM8B 1V2YA 1NDDA 1WM3A 1UH6A 3EECA 2FCSA 3PRPB 3HM3A 3SHQA 1EF1A 4FHKA 2JPHA 1MG8A 3ZNID 1YIWA 2KANA 2LUEA 3B0AA 4MSMB 2C5LC 2CHXA 1EF5A 2DZMA 2MBOA 4XC2A 2L0FA 2WYQA 3VH3B 4WQOB 2LWPA 3T8MA 1WY8A 2FCQA 3HHMA 4IWOA 4FLHA 4B9KA 1OEYA 2EMSA 2KJRA 5E6OA 2LXAA 4WJPA 3NOBA 3JYUA 1C3TA 2VRRB 2L0TA 3KUDB 4LDTB 3A9JA 2C7NB 1P9DU 2G4SA 1ZW7A 3KW5B 1UD7A 2O6VB 1E90A 3KUZA 1UBQA 3PHWB 4WJQA 4DDGD 3AI5A 2KC2A 2BPSA 3M62B 3W1SC 3L08A 1P1AA 3U30A 3VTVA 2CR5A 4NNJB 2G45B 4FN2A 4MEMA 2JY6A 4II2B 5E6NA 5L83A 4ANWA 4HVBA 2O6VD 2IY0B 4KSLC 1E8YA 4M8NA 4W9CA 2KDEB 3NZUA 4MSQB 4GMVA 2MBHA 3HM6X 2KTFA 5KHOA 3QK0A 5IAAC 4EEWA 4IWQA 2PJHA 2N7EA 1WRDB 3KVFB 3APDA 3HIZA 2DAFA 5G2NA 1WH3A 2BF8B 2N1WA 5JHBA 2MP2B 4MGYE 2D11A 1I35A 2J0MA 2JVCA 2LZ6A 2NVUI 4HDOA 3PT2B 1S1QB 4K81A 2KN5A 3ONSA 1YX6B 2PPHA 4ICUA 2FIFA 3SD5A 4I6PA 2BYVE 3VH4B 3W1YA 4E74A 1OTRB 4F8CB 1Z5SB 2O2VB 4HCNB 5J18A 3DVGX 4W9LA 1IPGA 4A20A 2A5UA 3MJWA 3OJ3A 2JXXA 3QA8A 3ZNGC 2KTRB 1ISNA 3M95A 1E5WA 2V1YA 3B08A 4NPNA 2KK8A 2IY1B 2K25A 2IZVB 4I6NB 1QZEA 4MELA 2L05A 2AEHA 2D2QA 3ML8A 2M17A 3AU5A 2ZCCA 3DQVA 2MWSB 2O2VA 1KJTA 4GB9A 3IHPC 4GDLB 2JF5A 2J0JA 2PEAA 2KLCA 1GJZA 1NBFC 1JRUA 4FHJA 4GN1A 1XQQA 4W9HA 3A1QA 4EZLA 2NCNA 2K39A 1WGHA 2MSED 3O65B 2GBMA 2CHZA 2LASA 3WAMA 4BFRA 1WX9A 2MLBA 2IBIB 1YD8U 4WWNA 3A4RA 4DWFA 5E6PA 3APCA 4MH0E 3A9KB 5AZGA 2FUHB 1KOTA 1WFYA 3VDZA 4F1SA 2NBUA 2KX3A 2JWZA 1E8XA 4HPLB 5BO4B 2NPTA 3ZTCA 2J0KA 4I6LB 3DBRI 3X23A 3UF8A 3TIXA 4HCPB 3QCAA 2BWES 3ZO5B 1WXMA 2BKRB 4MGKE 3GOEA 3WANA 4XX5A 4RMAA 1P98A 3IG3A 1WMHB 3QIJA 3H7SA 2GOWA 1YQBA 2GMIC 2RD0A 3N32A 5CHWA 1X1MA 1OGWA 1HE8A 2K8BA 3GZNI 3RYTA 1TGZB 4HK2A 4IM3A 2C7MB 4EZKA 3DVGY 1SE9A 5JH5C 2KJHB 4P7IA 1OQYA 3SDLC 5L95C 4TQ1A 2LGDA 4DHJB 5FR6A 3PTFC 2K8HA 1WMHA 3ZVVA 1Q5WB 3C0RB 4MGZE 2MBBB 3ENEA 2XK5A 1V81A 4RM9A 2KX0A 2KQSA 3V61A 4GGQA 2NBVB 1GUAB 2Z59B 4IWPA 1GG3A 1WGDA 4BVUC 3ZNZB 2N9PC 2JRHA 3Q3FA 4JL9A 1WYWB 4KV2A 4GSWA 4BKTA 1WJUA 1YX5B 3QX1A 1V5OA 1VD2A 4DHJD 4DHZB 2ZZPB 3WA0A 3AU4A 5D94A 3M3JA 2R2QA 4W9EA 1P0RA 1WF9A 1WXVA 1SGHA 3RULA 4IG7B 3ZTDA 1YJ1A 2HE7A 2KJ6A 4HDQA 1D3ZA 2CKHB 2DYOA 3VTUA 3AULA 4KDLB 4G11A 3X0WA 3TMPB 3DVNU 2C60A 3H7PB 3TCAA 4PYZA 2AL6A 2LRWA 3KYDD 4GXBA 3ZLZA 3UQBA 4DK5A 5CHFA 5IA7A 4FULA 1C1YB 2LI5A 4MM3A 4EFOA 2EKEC 2FIDA 5AZHA 1TBEA 1KM7A 2ZNVB 1S3SG 4EZJA 4TUUA 1XT9B 2KHWB 3VUYA 2O6VA 3PS6A 4CHKA 2ZVOA 4XZ4A 1R4MI 2ZCBA 1Z2MA 4K7UA 2LRUA 4N9F4 2GBNA 1WM2A 4AWJA 3QHTA 1U4AA 2BYEA 2IO3B 1P3QU 3DPDA 3M63B 1WE6A 2MX2A 3NS8A 3NZSA 3NHEB 3PV1A 3R3MA 3WALA 4KIKB 1G6JA 2OJRA 2JZZA 1WGGA 1L7YA 5JHAA 5G55A 5C1ZA 4BKSD 1TTNA 4HPMB 2GBJA 1V86A 2NBWB 3CMMB 2N9XA 3B1LX 4ASWC 3L10B 3ZKJC 2XEWA 4DDID 2IO0B 2UWQA 3PGEA 2ASQA 3VQIA 3L16A 3CF6E 4OVUA 3DBLI 4BOZB 4CO7A 2C7HA 2N7DA 3DCGA 4G3XB 3CSTA 2Y5BB 3ML9A 3T9LA 3K9PB 2HJ8A 2MP2A 4WJOA 3RCZA 4BOSC 2LXCA 2HTHA 4EUTA 4TQ0A 2WX0A 3I3TB 1H4RA 4DBGA 2KWUB 3H6NA 2MBEA 2DYMA 3TJPA 1F9JA 1EUVB 3QAQA 3DBSA 4JQWC 4OVVA 1SIFA 3HK0A 2LD9A 4KZ0A 3MHSD 2B3AA 4GDKB 2D07B 3TBLD 4M0WB 1T0YA 3ECIA 2ZVNA 2KTRA 3N3KB 4K1RB 3VAWA 2MCNB 3VUXA 3P2BA 1J19A 2L00B 3ZRFA 4IUMB 3WIMA 3UIPB 4ZDVA 2KOXA 2W9NA 1E7UA 1AARA 3OLMD 3V6CB 2M8SA 3DVNV 3KYCD 1UGMA 4YL8A 2EMTA 4GDLA 3U7DA 1RLFA 2R2OA 2D10A 1WXSA 2D3GA 1WZ3A 3Q3JA 4GOCA 2KC1A 3ZW3A 1LFDA 3EFUA 4PS8A 3UINB 3PPAA 1J0GA 3H9DA 2YVCA 2N4FA 4HLEA 3PLVA 3D32A 4B6WA 4FBJB 1A5RA 3PZDA 2KFKB 2N9EB 4E71A 2LGXA 3A9KA 4AJYB 5KHQA 2M4NA 3V60A 3L0WB 2NS5A 3LJ3A 2KDBA 3K9OB 3TL5A 4AUQC 3EHVA 3MTNB 4PS3A 3PREA 2MQJA 2CU1A 2FNJB 1ZKHA 2IYDB 4TV3A 3ZRCA 3IVFA 4KZCA 5AEKB 2C9WB 4BBNC 2DZKA 3DOWA 3L54A 2M0XA 4FJVB 3VVWB 5DCNA 4CYEA 3PRMB 1RFAA 3R7QA 3IFWB 2KVRA 3QJZA 4GU2A 2RR9A 2DX5B 4MJSB 2DYBA 2DZIA 4X57B 3V62A 2JT4B 4WWPA 1V49A 1UELA 3QWZB 3WAPA 4F7ZA 2BGFA 4JIOU 3IBEA 5LXHA 1Q1OA 4JLCA 1RRBA 2M1MA 1E7VA 1K8RB 1EO6A 2DZJA 2MA9B 3N30A 5HKHA 1IP9A 3CSFA 3VHTC 1WJ4A 4NQLB 3ALBA 2KFJA 2KD0A 4AJWA 2G4DB 2FCNA 3PSEB 1GC6A 4TKNA 4K7WA 2WX1A 2KDIA 4W9DA 3ZDMC 2MW5A 4FADA 4PS7A 4URKA 3PRZA 4NJ6A 4FA6A 4KSKC 1V9JA 2JRIB 2DENB 1R4NI 4LCDE 1WGRA 2OOBB 4ICVA 3RZWC 4ANVA 3A9JB 1BT0A 3V6EB 1OEYJ 2JZ3B 1PQSA 3H7PA 3PLUA 2CS4A 3OJ4B 3R7RA 3W1SA 4BBNF 2I1KA 5AZFA 3OAWA 1WE7A 4HWIB 3UGBB 2JUOA 1E8ZA 2A4ZA 5C23A 2AYOB 1WI0A 2MRPA 4GIVA 2ZPYA 3R66C 5D2MB 1TZ1A 2WWZA 4W9JA 5D7GA 2DHZA 3DDCB 2G3QB 1H8CA 2KWVB 3PHXB 2KLGA 5CTRC 5CX3A 1NI2A 4BKSA 1WR1A 4PYUA 4LDTD 4W9GA 4IC7B 1LQBA 2ZJDA 3QC8B 2FCMA 3JVZX 4E3CA 4HJKA 2RGFA 4KIKA 3BINA 5D6JB 2ZNVC 3RD2A 1J8CA 1GC7A 5DPTA 2HD5B 2N1VA 1E8WA 4G50A 1WIAA 1UBIA 2Z0DB 2AL3A 3AXCA 4ANUA 2QHOA 1WX8A 2BYFA 1V5TA 2PE9A 3JSVB 3VXWA 3ZUNA 2K8CA 3EC8A 4K7SA 2KKCA 1V80A 1RAXA 2KQ7A 3H1UA 3JW0X 3QQ8B 4II3B 5DPSA 5J2RA 2REXA 4A3PA 2MBQA 2LVOA 3ZDTA 3DBHI 3NY5A 1CMXB 4DXAB 5J17A 1WGYA 5TR5A 2ZPNA 4B95A 3BY4B 4FJZA 2KXJA 3PVLA 2K6DB 2LGYA 4KDIC 2GBKA 4W9FA 4WJNA 3JSVA 4ZRJA 2L76A 5DPWA 2L8JA 2KWCA 4MDKE 4RM8A 2KDFB 1Y8RC 2ZEQA 2DAJA 4ZYNA 3QARA 3L17A 1L2NA 3A1QB 4NJ7A 3ZNHB 2V4LA 2NR2A 4GDKA 4AP4C 3L13A 2LVPA 4HXDA 3RT3B 2RSUA 3KUCB 3RZFA 4EOYA 4NQKE 3VTWA 2KO3A 4WWOA 4BKGA 2I1JA 1WXAA 1FXTB 2FAZA 4NAWB 3WAOA 3A33B 4IM0A 4M8MA 2J7QB 1WR6E 1LXDA 1V6EA 3SU8X 2KZRA 4W9IA 4NY0A 1ZGUB 2NPTB 3VUWA 2IO2B 2GBRA 3APFA 4KVGB 5CHVC 4IW0A 2L7RA 4JGHB 3UQAA 4MGIE 4A3OA 2UYZB 4NAWA 2KNBA 4DHZE 4EKUA 1GNUA 2IO1B 1KLVA 2YLMA 2K6QA 4AOFA 2KFKA 4J6IA 2BKFA 2V3SA 4IM2A 2XBBC 1XD3B 3S2AA 4ANXA 5EDSA 1M94A 2WDTB 1Q0WB 2LJ5A 3A4SC 2BWFA 5LXIB 4G0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRK A;  2L3Z A;  3RUI B;  2LVQ A;  4LJO B;  2PE6 B;  1UZX B;  1VCB A;  3LDZ E;  3VFK A;  3U8Z A;  4ZRI A;  2RPQ A;  3KH0 A;  2AWT A;  2K1F A;  2KMA A;  2CHW A;  2XK5 B;  5LLI A;  4LJP B;  5JZE B;  2KMC A;  4FJY A;  1I42 A;  1WJN A;  4W9K A;  4WAA A;  4MJS A;  1IYF A;  1WJ6 A;  1WX7 A;  3ZIM A;  5DPR A;  5GMV A;  3UIO B;  2Z0E B;  1WZ0 A;  1LM8 B;  1V2Y A;  1NDD A;  1WM3 A;  1UH6 A;  3EEC A;  2FCS A;  3PRP B;  3HM3 A;  3SHQ A;  1EF1 A;  4FHK A;  2JPH A;  1MG8 A;  3ZNI D;  1YIW A;  2KAN A;  2LUE A;  3B0A A;  4MSM B;  2C5L C;  2CHX A;  1EF5 A;  2DZM A;  2MBO A;  4XC2 A;  2L0F A;  2WYQ A;  3VH3 B;  4WQO B;  2LWP A;  3T8M A;  1WY8 A;  2FCQ A;  3HHM A;  4IWO A;  4FLH A;  4B9K A;  1OEY A;  2EMS A;  2KJR A;  5E6O A;  2LXA A;  4WJP A;  3NOB A;  3JYU A;  1C3T A;  2VRR B;  2L0T A;  3KUD B;  4LDT B;  3A9J A;  2C7N B;  1P9D U;  2G4S A;  1ZW7 A;  3KW5 B;  1UD7 A;  2O6V B;  1E90 A;  3KUZ A;  1UBQ A;  3PHW B;  4WJQ A;  4DDG D;  3AI5 A;  2KC2 A;  2BPS A;  3M62 B;  3W1S C;  3L08 A;  1P1A A;  3U30 A;  3VTV A;  2CR5 A;  4NNJ B;  2G45 B;  4FN2 A;  4MEM A;  2JY6 A;  4II2 B;  5E6N A;  5L83 A;  4ANW A;  4HVB A;  2O6V D;  2IY0 B;  4KSL C;  1E8Y A;  4M8N A;  4W9C A;  2KDE B;  3NZU A;  4MSQ B;  4GMV A;  2MBH A;  3HM6 X;  2KTF A;  5KHO A;  3QK0 A;  5IAA C;  4EEW A;  4IWQ A;  2PJH A;  2N7E A;  1WRD B;  3KVF B;  3APD A;  3HIZ A;  2DAF A;  5G2N A;  1WH3 A;  2BF8 B;  2N1W A;  5JHB A;  2MP2 B;  4MGY E;  2D11 A;  1I35 A;  2J0M A;  2JVC A;  2LZ6 A;  2NVU I;  4HDO A;  3PT2 B;  1S1Q B;  4K81 A;  2KN5 A;  3ONS A;  1YX6 B;  2PPH A;  4ICU A;  2FIF A;  3SD5 A;  4I6P A;  2BYV E;  3VH4 B;  3W1Y A;  4E74 A;  1OTR B;  4F8C B;  1Z5S B;  2O2V B;  4HCN B;  5J18 A;  3DVG X;  4W9L A;  1IPG A;  4A20 A;  2A5U A;  3MJW A;  3OJ3 A;  2JXX A;  3QA8 A;  3ZNG C;  2KTR B;  1ISN A;  3M95 A;  1E5W A;  2V1Y A;  3B08 A;  4NPN A;  2KK8 A;  2IY1 B;  2K25 A;  2IZV B;  4I6N B;  1QZE A;  4MEL A;  2L05 A;  2AEH A;  2D2Q A;  3ML8 A;  2M17 A;  3AU5 A;  2ZCC A;  3DQV A;  2MWS B;  2O2V A;  1KJT A;  4GB9 A;  3IHP C;  4GDL B;  2JF5 A;  2J0J A;  2PEA A;  2KLC A;  1GJZ A;  1NBF C;  1JRU A;  4FHJ A;  4GN1 A;  1XQQ A;  4W9H A;  3A1Q A;  4EZL A;  2NCN A;  2K39 A;  1WGH A;  2MSE D;  3O65 B;  2GBM A;  2CHZ A;  2LAS A;  3WAM A;  4BFR A;  1WX9 A;  2MLB A;  2IBI B;  1YD8 U;  4WWN A;  3A4R A;  4DWF A;  5E6P A;  3APC A;  4MH0 E;  3A9K B;  5AZG A;  2FUH B;  1KOT A;  1WFY A;  3VDZ A;  4F1S A;  2NBU A;  2KX3 A;  2JWZ A;  1E8X A;  4HPL B;  5BO4 B;  2NPT A;  3ZTC A;  2J0K A;  4I6L B;  3DBR I;  3X23 A;  3UF8 A;  3TIX A;  4HCP B;  3QCA A;  2BWE S;  3ZO5 B;  1WXM A;  2BKR B;  4MGK E;  3GOE A;  3WAN A;  4XX5 A;  4RMA A;  1P98 A;  3IG3 A;  1WMH B;  3QIJ A;  3H7S A;  2GOW A;  1YQB A;  2GMI C;  2RD0 A;  3N32 A;  5CHW A;  1X1M A;  1OGW A;  1HE8 A;  2K8B A;  3GZN I;  3RYT A;  1TGZ B;  4HK2 A;  4IM3 A;  2C7M B;  4EZK A;  3DVG Y;  1SE9 A;  5JH5 C;  2KJH B;  4P7I A;  1OQY A;  3SDL C;  5L95 C;  4TQ1 A;  2LGD A;  4DHJ B;  5FR6 A;  3PTF C;  2K8H A;  1WMH A;  3ZVV A;  1Q5W B;  3C0R B;  4MGZ E;  2MBB B;  3ENE A;  2XK5 A;  1V81 A;  4RM9 A;  2KX0 A;  2KQS A;  3V61 A;  4GGQ A;  2NBV B;  1GUA B;  2Z59 B;  4IWP A;  1GG3 A;  1WGD A;  4BVU C;  3ZNZ B;  2N9P C;  2JRH A;  3Q3F A;  4JL9 A;  1WYW B;  4KV2 A;  4GSW A;  4BKT A;  1WJU A;  1YX5 B;  3QX1 A;  1V5O A;  1VD2 A;  4DHJ D;  4DHZ B;  2ZZP B;  3WA0 A;  3AU4 A;  5D94 A;  3M3J A;  2R2Q A;  4W9E A;  1P0R A;  1WF9 A;  1WXV A;  1SGH A;  3RUL A;  4IG7 B;  3ZTD A;  1YJ1 A;  2HE7 A;  2KJ6 A;  4HDQ A;  1D3Z A;  2CKH B;  2DYO A;  3VTU A;  3AUL A;  4KDL B;  4G11 A;  3X0W A;  3TMP B;  3DVN U;  2C60 A;  3H7P B;  3TCA A;  4PYZ A;  2AL6 A;  2LRW A;  3KYD D;  4GXB A;  3ZLZ A;  3UQB A;  4DK5 A;  5CHF A;  5IA7 A;  4FUL A;  1C1Y B;  2LI5 A;  4MM3 A;  4EFO A;  2EKE C;  2FID A;  5AZH A;  1TBE A;  1KM7 A;  2ZNV B;  1S3S G;  4EZJ A;  4TUU A;  1XT9 B;  2KHW B;  3VUY A;  2O6V A;  3PS6 A;  4CHK A;  2ZVO A;  4XZ4 A;  1R4M I;  2ZCB A;  1Z2M A;  4K7U A;  2LRU A;  4N9F 4;  2GBN A;  1WM2 A;  4AWJ A;  3QHT A;  1U4A A;  2BYE A;  2IO3 B;  1P3Q U;  3DPD A;  3M63 B;  1WE6 A;  2MX2 A;  3NS8 A;  3NZS A;  3NHE B;  3PV1 A;  3R3M A;  3WAL A;  4KIK B;  1G6J A;  2OJR A;  2JZZ A;  1WGG A;  1L7Y A;  5JHA A;  5G55 A;  5C1Z A;  4BKS D;  1TTN A;  4HPM B;  2GBJ A;  1V86 A;  2NBW B;  3CMM B;  2N9X A;  3B1L X;  4ASW C;  3L10 B;  3ZKJ C;  2XEW A;  4DDI D;  2IO0 B;  2UWQ A;  3PGE A;  2ASQ A;  3VQI A;  3L16 A;  3CF6 E;  4OVU A;  3DBL I;  4BOZ B;  4CO7 A;  2C7H A;  2N7D A;  3DCG A;  4G3X B;  3CST A;  2Y5B B;  3ML9 A;  3T9L A;  3K9P B;  2HJ8 A;  2MP2 A;  4WJO A;  3RCZ A;  4BOS C;  2LXC A;  2HTH A;  4EUT A;  4TQ0 A;  2WX0 A;  3I3T B;  1H4R A;  4DBG A;  2KWU B;  3H6N A;  2MBE A;  2DYM A;  3TJP A;  1F9J A;  1EUV B;  3QAQ A;  3DBS A;  4JQW C;  4OVV A;  1SIF A;  3HK0 A;  2LD9 A;  4KZ0 A;  3MHS D;  2B3A A;  4GDK B;  2D07 B;  3TBL D;  4M0W B;  1T0Y A;  3ECI A;  2ZVN A;  2KTR A;  3N3K B;  4K1R B;  3VAW A;  2MCN B;  3VUX A;  3P2B A;  1J19 A;  2L00 B;  3ZRF A;  4IUM B;  3WIM A;  3UIP B;  4ZDV A;  2KOX A;  2W9N A;  1E7U A;  1AAR A;  3OLM D;  3V6C B;  2M8S A;  3DVN V;  3KYC D;  1UGM A;  4YL8 A;  2EMT A;  4GDL A;  3U7D A;  1RLF A;  2R2O A;  2D10 A;  1WXS A;  2D3G A;  1WZ3 A;  3Q3J A;  4GOC A;  2KC1 A;  3ZW3 A;  1LFD A;  3EFU A;  4PS8 A;  3UIN B;  3PPA A;  1J0G A;  3H9D A;  2YVC A;  2N4F A;  4HLE A;  3PLV A;  3D32 A;  4B6W A;  4FBJ B;  1A5R A;  3PZD A;  2KFK B;  2N9E B;  4E71 A;  2LGX A;  3A9K A;  4AJY B;  5KHQ A;  2M4N A;  3V60 A;  3L0W B;  2NS5 A;  3LJ3 A;  2KDB A;  3K9O B;  3TL5 A;  4AUQ C;  3EHV A;  3MTN B;  4PS3 A;  3PRE A;  2MQJ A;  2CU1 A;  2FNJ B;  1ZKH A;  2IYD B;  4TV3 A;  3ZRC A;  3IVF A;  4KZC A;  5AEK B;  2C9W B;  4BBN C;  2DZK A;  3DOW A;  3L54 A;  2M0X A;  4FJV B;  3VVW B;  5DCN A;  4CYE A;  3PRM B;  1RFA A;  3R7Q A;  3IFW B;  2KVR A;  3QJZ A;  4GU2 A;  2RR9 A;  2DX5 B;  4MJS B;  2DYB A;  2DZI A;  4X57 B;  3V62 A;  2JT4 B;  4WWP A;  1V49 A;  1UEL A;  3QWZ B;  3WAP A;  4F7Z A;  2BGF A;  4JIO U;  3IBE A;  5LXH A;  1Q1O A;  4JLC A;  1RRB A;  2M1M A;  1E7V A;  1K8R B;  1EO6 A;  2DZJ A;  2MA9 B;  3N30 A;  5HKH A;  1IP9 A;  3CSF A;  3VHT C;  1WJ4 A;  4NQL B;  3ALB A;  2KFJ A;  2KD0 A;  4AJW A;  2G4D B;  2FCN A;  3PSE B;  1GC6 A;  4TKN A;  4K7W A;  2WX1 A;  2KDI A;  4W9D A;  3ZDM C;  2MW5 A;  4FAD A;  4PS7 A;  4URK A;  3PRZ A;  4NJ6 A;  4FA6 A;  4KSK C;  1V9J A;  2JRI B;  2DEN B;  1R4N I;  4LCD E;  1WGR A;  2OOB B;  4ICV A;  3RZW C;  4ANV A;  3A9J B;  1BT0 A;  3V6E B;  1OEY J;  2JZ3 B;  1PQS A;  3H7P A;  3PLU A;  2CS4 A;  3OJ4 B;  3R7R A;  3W1S A;  4BBN F;  2I1K A;  5AZF A;  3OAW A;  1WE7 A;  4HWI B;  3UGB B;  2JUO A;  1E8Z A;  2A4Z A;  5C23 A;  2AYO B;  1WI0 A;  2MRP A;  4GIV A;  2ZPY A;  3R66 C;  5D2M B;  1TZ1 A;  2WWZ A;  4W9J A;  5D7G A;  2DHZ A;  3DDC B;  2G3Q B;  1H8C A;  2KWV B;  3PHX B;  2KLG A;  5CTR C;  5CX3 A;  1NI2 A;  4BKS A;  1WR1 A;  4PYU A;  4LDT D;  4W9G A;  4IC7 B;  1LQB A;  2ZJD A;  3QC8 B;  2FCM A;  3JVZ X;  4E3C A;  4HJK A;  2RGF A;  4KIK A;  3BIN A;  5D6J B;  2ZNV C;  3RD2 A;  1J8C A;  1GC7 A;  5DPT A;  2HD5 B;  2N1V A;  1E8W A;  4G50 A;  1WIA A;  1UBI A;  2Z0D B;  2AL3 A;  3AXC A;  4ANU A;  2QHO A;  1WX8 A;  2BYF A;  1V5T A;  2PE9 A;  3JSV B;  3VXW A;  3ZUN A;  2K8C A;  3EC8 A;  4K7S A;  2KKC A;  1V80 A;  1RAX A;  2KQ7 A;  3H1U A;  3JW0 X;  3QQ8 B;  4II3 B;  5DPS A;  5J2R A;  2REX A;  4A3P A;  2MBQ A;  2LVO A;  3ZDT A;  3DBH I;  3NY5 A;  1CMX B;  4DXA B;  5J17 A;  1WGY A;  5TR5 A;  2ZPN A;  4B95 A;  3BY4 B;  4FJZ A;  2KXJ A;  3PVL A;  2K6D B;  2LGY A;  4KDI C;  2GBK A;  4W9F A;  4WJN A;  3JSV A;  4ZRJ A;  2L76 A;  5DPW A;  2L8J A;  2KWC A;  4MDK E;  4RM8 A;  2KDF B;  1Y8R C;  2ZEQ A;  2DAJ A;  4ZYN A;  3QAR A;  3L17 A;  1L2N A;  3A1Q B;  4NJ7 A;  3ZNH B;  2V4L A;  2NR2 A;  4GDK A;  4AP4 C;  3L13 A;  2LVP A;  4HXD A;  3RT3 B;  2RSU A;  3KUC B;  3RZF A;  4EOY A;  4NQK E;  3VTW A;  2KO3 A;  4WWO A;  4BKG A;  2I1J A;  1WXA A;  1FXT B;  2FAZ A;  4NAW B;  3WAO A;  3A33 B;  4IM0 A;  4M8M A;  2J7Q B;  1WR6 E;  1LXD A;  1V6E A;  3SU8 X;  2KZR A;  4W9I A;  4NY0 A;  1ZGU B;  2NPT B;  3VUW A;  2IO2 B;  2GBR A;  3APF A;  4KVG B;  5CHV C;  4IW0 A;  2L7R A;  4JGH B;  3UQA A;  4MGI E;  4A3O A;  2UYZ B;  4NAW A;  2KNB A;  4DHZ E;  4EKU A;  1GNU A;  2IO1 B;  1KLV A;  2YLM A;  2K6Q A;  4AOF A;  2KFK A;  4J6I A;  2BKF A;  2V3S A;  4IM2 A;  2XBB C;  1XD3 B;  3S2A A;  4ANX A;  5EDS A;  1M94 A;  2WDT B;  1Q0W B;  2LJ5 A;  3A4S C;  2BWF A;  5LXI B;  4G0N B; 
#chains in the Genus database with same CATH topology
 2LVQ A;  2J52 A;  1FM0 D;  2PE6 B;  3LDZ E;  3KH0 A;  2K1F A;  5LLI A;  2CHW A;  2FUG 1;  4WAA A;  4MJS A;  1TS2 A;  5DPR A;  3AE9 B;  2INP E;  1FO4 A;  1SSN A;  1FNV A;  1ROE A;  2BT6 A;  1WZ0 A;  1NDD A;  4A9A A;  1SJE D;  1UH6 A;  3EEC A;  2FCS A;  3SHQ A;  2VZK D;  1SJH D;  3V05 A;  1T0R C;  1YIW A;  4MSM B;  3BVG A;  3VH3 B;  1QKZ A;  4WQO B;  2D3B A;  3HHM A;  4FLH A;  1AN8 A;  1OEY A;  4YXD B;  3BK1 A;  1RM6 C;  4WJP A;  3NOB A;  1UUP A;  3DWG C;  2V4I B;  1T5X D;  1ZXH A;  3DBH B;  2EKI A;  4RGN A;  5JXV A;  3URY A;  2JY6 A;  5E6N A;  1SIJ A;  5L83 A;  4Q2J A;  1XXG A;  3OWE B;  4GMV A;  2KTF A;  4DXF A;  4HRO A;  3QK0 A;  4IWQ A;  2N7E A;  3KVF B;  4P1C C;  1EU3 A;  2DAF A;  5G2N A;  1RFK A;  1SE3 A;  1I35 A;  2J0M A;  2NVU I;  2I38 A;  3AM9 A;  4ICU A;  3SD5 A;  2QDF A;  4E74 A;  1OTR B;  4F8C B;  1JRO A;  1QIL A;  3RN9 C;  3DWM A;  4W9L A;  1IPG A;  5HI1 A;  2A5U A;  5BMH A;  3M95 A;  3NS1 A;  1RWS A;  3DQV A;  4WQM A;  1XQQ A;  2JYE A;  2MSE D;  3CWI A;  2GBM A;  3HVZ A;  1WX9 A;  1EM7 A;  2NMQ A;  2WU2 B;  2Y5P A;  3Q8E A;  1I4X A;  4I6L B;  3DBR I;  3UF8 A;  1YJI A;  3ZO5 B;  2BKR B;  1DOY A;  3FAH A;  3AEC B;  4XX5 A;  4MH8 A;  1FEH A;  3H7S A;  1M4V A;  1QOF A;  2RD0 A;  5CHW A;  1OGW A;  4EZK A;  3DVG Y;  5JH5 C;  1MI0 A;  3RNG C;  5L95 C;  1BXT A;  4C4V B;  3FKY A;  1WMH A;  2LHD A;  4MGZ E;  2IDY A;  2AX5 A;  2XK5 A;  1V81 A;  4RM9 A;  2KX0 A;  2KQS A;  3V61 A;  2NBV B;  4BVU C;  3ZNZ B;  4BKT A;  1WYW B;  4GSW A;  1VD2 A;  2RPV A;  3VR8 B;  4DHJ D;  2E3T A;  1XLO A;  4LLG M;  2R2Q A;  4JPS A;  4IG7 B;  4HRS A;  2HE7 A;  1D3Z A;  3VTU A;  1ZDX A;  2D5G A;  2IPK D;  2LRW A;  4GXB A;  5CHF A;  1C1Y B;  2IND C;  1XCT L;  1XT9 B;  2O6V A;  2V3P A;  1U4A A;  2IO3 B;  1P3Q U;  3PV1 A;  3NS8 A;  1VLB A;  3R3M A;  4ZRP A;  1FMA D;  1E7P B;  1L7Y A;  5EE3 A;  1K53 A;  4P1B C;  1OFF A;  1FD6 A;  4MAC A;  2E6X A;  3NZ3 A;  2BBC A;  3CMM B;  1C79 A;  4TSS A;  2PLP A;  3I9V 1;  3VQI A;  2INC C;  3CF6 E;  4M02 A;  4G3X B;  3P42 A;  3T9L A;  2MP2 A;  2WXO A;  2SEB D;  2I2Y A;  2HTH A;  3I3T B;  3H6N A;  2MBE A;  1F9J A;  3TEY A;  1TS5 A;  4GDK B;  2D07 B;  5C3J B;  4K1R B;  3VUX A;  2MCN B;  3NVY A;  2JWU A;  2WP9 B;  4ZDV A;  3ETR A;  3OLM D;  2M8S A;  1KRH A;  2EMT A;  3U7D A;  2MJE A;  2R2O A;  1IGC A;  3Q3J A;  1AYF A;  1LFD A;  3EFU A;  4YTN B;  3UIN B;  1J0G A;  3AE2 B;  2N4F A;  4HLE A;  1A5R A;  3PZD A;  1J7C A;  2NS5 A;  3LJ3 A;  1JML A;  4PS3 A;  3B2G A;  1ZKH A;  2MEK A;  2ON8 A;  1ENF A;  3GE8 C;  2C9W B;  4B0M A;  2KYW A;  1ACC A;  1QT9 A;  1EWY C;  3PZ8 A;  1PYW D;  4MJS B;  1FRR A;  1KLG D;  2DYB A;  2PVO D;  2MJD A;  4X57 B;  3V62 A;  2JT4 B;  1V49 A;  3QWZ B;  2LEK A;  2W3R A;  4F7Z A;  4JIO U;  4L2Y A;  1B1Z A;  4YSX B;  2M1M A;  3N1X C;  2MA9 B;  1IP9 A;  3CSF A;  3VHT C;  1FPY A;  2FCN A;  3PSE B;  4YWG G;  4TKN A;  2QSD A;  2KDI A;  4OHJ A;  3DHH C;  3ZDM C;  4QAY A;  1D5Z C;  3W5V B;  4YT0 B;  1BT0 A;  1OEY J;  1SF0 A;  3H7P A;  2X8X X;  4HWI B;  3UGB B;  3W2D A;  3LYY A;  1L6V A;  1Y56 A;  1EWC A;  5C23 A;  2WGS A;  3BK2 A;  4GIV A;  5AUI A;  1FNW A;  2WWZ A;  2WXL A;  3DDC B;  3AE7 B;  4BKS A;  1GB1 A;  2WNM A;  3IXS A;  1ZE3 D;  2ZW1 A;  3QC8 B;  2FE8 A;  4E3C A;  3NRZ A;  4KIK A;  1UNS A;  3IAM 1;  4XWW A;  1J8C A;  2LMC A;  1QOA A;  2KAC A;  1WIA A;  2WXN A;  5IO9 A;  2AL3 A;  2QHO A;  1WX8 A;  1V5T A;  2KKC A;  3AV8 A;  3QQ8 B;  5J2R A;  2MBQ A;  3ZDT A;  2ACZ B;  2K22 A;  4W9F A;  4WJN A;  3SFE B;  2JYT A;  3RNE C;  3I63 C;  4RCO A;  4RM8 A;  2KDF B;  2BYT A;  3Q8C A;  1L2N A;  4NJ7 A;  4PK1 A;  1JWM D;  1L4Z B;  4AP4 C;  4M0W A;  3KUC B;  2WDV B;  2KO3 A;  2I1J A;  1WXA A;  4XDD A;  4IM0 A;  4M8M A;  1ZXI A;  2MJ3 A;  2RDG A;  2AQ2 B;  3SU8 X;  1C77 A;  1ZDV A;  2KZR A;  4W9I A;  4NY0 A;  2VH2 A;  2KT7 A;  1LO5 D;  3LB8 C;  4S0R A;  4IW0 A;  4PT5 A;  4NAW A;  1WRI A;  1GNU A;  2IO1 B;  2K6Q A;  3PZ7 A;  5HHD G;  5EDS A;  1XD3 B;  1Q0W B;  3WCQ A;  3R8B A;  4G0N B;  4ZRK A;  3DHI C;  1F0Z A;  1E9M A;  4HKQ A;  1UZX B;  4ZRI A;  2H88 B;  2RPQ A;  2XK5 B;  4FJY A;  1WJN A;  2M56 B;  1IYF A;  1WX7 A;  5GMV A;  4ZOH C;  1LM8 B;  2KMM A;  1EF1 A;  2WXJ A;  4CQN A;  1OQQ A;  4RNA A;  3ZNI D;  2KAN A;  2LUE A;  2CHX A;  2DZM A;  2LWP A;  1WY8 A;  2N9L A;  3GE3 C;  4IWO A;  1TY0 A;  2EMS A;  4WIP A;  2N9K A;  3JYU A;  3KQ4 A;  3AH7 A;  3KUD B;  4LDT B;  2LUM A;  3A9J A;  2G4S A;  1UD7 A;  2O6V B;  1BML C;  1UBQ A;  3AI5 A;  3M62 B;  2K0P A;  1P1A A;  3VTV A;  2CR5 A;  2G45 B;  4MEM A;  4DXG A;  5HFY A;  2WXH A;  4M8N A;  3RFZ B;  1MHX A;  4W9C A;  4MSQ B;  3NZU A;  2BQQ A;  4YTM B;  1E10 A;  1TS3 A;  1HA5 A;  2PJH A;  1WRD B;  2WLB A;  3APD A;  2BF8 B;  2MP2 B;  2JVC A;  4HDO A;  4BZA A;  4NZL B;  2KN5 A;  2PKO A;  4OW0 A;  1TS4 A;  3ONS A;  2FIF A;  4I6P A;  2BYV E;  2WXG A;  1I4H A;  2O2V B;  5J18 A;  3MJW A;  1ISN A;  1E5W A;  3B08 A;  2K25 A;  3ML8 A;  4KKJ A;  2M17 A;  2ZCC A;  1D4B A;  3NVV A;  1XLP A;  2JF5 A;  2J0J A;  2PEA A;  4OZC A;  1HZ5 A;  5BYS A;  4W9H A;  4EZL A;  2LGI A;  2NCN A;  3AEF B;  4J3O D;  4S17 A;  1WGH A;  4WH4 A;  3GZN B;  2CHZ A;  2MLB A;  4WWN A;  5E6P A;  1DOX A;  3Q6B A;  3APC A;  5AZG A;  4C7Y A;  1FNU A;  3VDZ A;  2HDE A;  1J7B A;  2NBU A;  4OVZ A;  4HPL B;  2GB1 A;  3X23 A;  2R61 A;  4KX6 B;  1WXM A;  3IG3 A;  4ACF A;  3AE5 B;  1TYG B;  3N32 A;  2K8B A;  1HE8 A;  5FKA C;  1KTK A;  3VR9 B;  1L0V B;  4IM3 A;  4WAF A;  4L23 A;  1HEZ E;  3SDL C;  3FC4 A;  2LGD A;  5FR6 A;  3ZJT A;  2K8H A;  1VRA B;  3ZVV A;  2MBB B;  3W5U B;  2Z59 B;  4K3B A;  1GG3 A;  1PFD A;  2JRH A;  3Q3F A;  4JL9 A;  1WJU A;  1YX5 B;  1V5O A;  2ZZP B;  1R4M B;  4C7Z A;  2V0G A;  5D94 A;  1KH0 A;  1P0R A;  1WXV A;  3ZTD A;  2J53 A;  2HJ1 A;  2WXQ A;  3AUL A;  4KDL B;  3DVN U;  3AEG B;  3H7P B;  3BII D;  2WXK A;  3J9C A;  2J4X A;  2LI5 A;  4MM3 A;  1TBE A;  1KM7 A;  1IBX B;  2LHE A;  2KN4 A;  2ZNV B;  3N1Y C;  4EZJ A;  3DBL B;  4CHK A;  2L32 A;  2ZCB A;  2WS3 B;  2LRU A;  1VZ8 A;  2BS4 B;  3ABV B;  4N9F 4;  2BYE A;  3DPD A;  2MX2 A;  3NHE B;  1N5X A;  4KIK B;  1PGX A;  2BVC A;  2OJR A;  2PIA A;  5G55 A;  5TSS A;  3R2T A;  2L1A A;  1V86 A;  1I7H A;  1VZ6 A;  2N9X A;  2VH1 A;  3B1L X;  2XEW A;  1GPX A;  4WWM A;  3L16 A;  3MC0 B;  3NVW A;  2N7D A;  3DCG A;  3CST A;  3K9P B;  3OG5 A;  1C9F A;  3RCZ A;  4BOS C;  2LXC A;  3AE1 B;  4TQ0 A;  1GOZ A;  2WX0 A;  4DBG A;  4EE2 A;  2KWU B;  1F77 A;  1SIF A;  3NJT A;  1FXA A;  4M0W B;  3TBL D;  2ZVN A;  3P2B A;  3ZRF A;  3WIM A;  3P1M A;  2BTE A;  3UIP B;  4O1N A;  3DVN V;  2RDB C;  2D10 A;  1WZ3 A;  3LXF A;  2KC1 A;  3ZW3 A;  3EUB 2;  3VRB B;  3TEX A;  2RMM A;  3B9J A;  2YVC A;  3ZGZ A;  2PMV A;  4RF1 A;  2LFI A;  3D32 A;  4B6W A;  2LGX A;  3A9K A;  4AJY B;  2M4N A;  3SFD B;  3V60 A;  3TL5 A;  1GAQ B;  3MTN B;  2MQJ A;  3TUO A;  4REZ A;  3ZRC A;  4KZC A;  2WXM A;  3DOW A;  4FJV B;  3VVW B;  3SR6 A;  5DCN A;  3AE8 B;  3R7Q A;  1R4N B;  3IFW B;  2DX5 B;  4RFB A;  2W54 A;  1V1P A;  2DZI A;  5HG2 A;  3WAP A;  3NUH B;  1Q1O A;  1CK1 A;  2WXI A;  2DZJ A;  1PGB A;  2K5P A;  1WJ4 A;  4NQL B;  2KD0 A;  4K7W A;  2WX1 A;  2UU7 A;  1QLB B;  1ZOY B;  1VR9 A;  4NJ6 A;  2QC8 A;  4FA6 A;  1V9J A;  2JRI B;  4LK0 M;  1WGR A;  3A9J B;  3V6E B;  2JZ3 B;  1N5W A;  1N62 A;  1XO3 A;  2I1K A;  1TKY A;  3OAW A;  2JUO A;  1YQ3 B;  1L0Y B;  2AYO B;  3R66 C;  4W9J A;  5D7G A;  3BYT B;  2G3Q B;  1H8C A;  3PHX B;  5CTR C;  3Q8B A;  1NI2 A;  4RGT A;  4PYU A;  4LDT D;  1LQB A;  2FCM A;  1GB4 A;  1WGK A;  4YSZ B;  2ZNV C;  4XDC A;  1N61 A;  5DPT A;  1E8W A;  2Z0D B;  4RH6 A;  3AXC A;  2OED A;  2BYF A;  3JSV B;  1V80 A;  3AE4 B;  3U2S C;  3ZJU A;  4ZYS A;  1WGY A;  2WXP A;  5TR5 A;  2KXJ A;  2K6D B;  2LGY A;  1F52 A;  3P63 A;  2KWC A;  1Y8R C;  1C4P A;  2DAJ A;  3FIL B;  1DOI A;  3ZNH B;  3GB1 A;  3EGR A;  2KAJ A;  2RSU A;  1PDX A;  1MHH E;  4NQK E;  2WDQ B;  4BKG A;  2QEJ C;  2OHF A;  1HQR D;  3N9Y C;  3VUW A;  4HKZ E;  5CHV C;  3U7Z A;  2L7R A;  3UQA A;  4MGI E;  2QCZ A;  1KLV A;  1P7F A;  2YLM A;  4GLS C;  1XEE A;  4K3C A;  4ARI A;  2KFK A;  1RYJ A;  4J6I A;  2WHI A;  2BKF A;  2V3S A;  2BWF A;  1K50 A;  4NAM A;  3RUI B;  3MC8 A;  3VFK A;  1VCB A;  3U8Z A;  5G5H A;  2VZK B;  2AWT A;  5JZE B;  2EEL A;  1I42 A;  1NYQ A;  1WJ6 A;  3ZIM A;  2YEP B;  5G5G A;  1WM3 A;  3PRP B;  1UGJ A;  3HM3 A;  4FHK A;  2JPH A;  1MG8 A;  2BS3 B;  4YSY B;  1EF5 A;  2MBO A;  5H92 C;  4XC2 A;  2FCQ A;  3RNF C;  4B9K A;  4MM3 B;  5E6O A;  4M01 A;  2WXR A;  2N7J A;  1I4P A;  4KKI A;  2OJW A;  1E90 A;  4WJQ A;  2KDM A;  3TEZ A;  2KC2 A;  3W1S C;  1CZP A;  4IDI A;  4AS1 A;  4NNJ B;  4HJG E;  4ANW A;  3W9C B;  2IY0 B;  1E8Y A;  4KGS A;  1CQV A;  3UI3 A;  2MBH A;  3AN1 A;  3HM6 X;  1UWM A;  1IGD A;  4XWT A;  5IAA C;  4EEW A;  1R7S A;  2QMT A;  3BVM A;  2G1E A;  1WH3 A;  1YN4 A;  2LZ6 A;  1S1Q B;  4K81 A;  2ONQ A;  1YX6 B;  4ITK A;  3W1Y A;  4IOI E;  2MHJ A;  5C2T B;  4MT5 A;  3P4P B;  3IT6 B;  1I4G A;  3OJ3 A;  3QA8 A;  1YNT E;  2JXX A;  3ZNG C;  2W82 A;  2B76 B;  4HEA 1;  4NPN A;  1ET9 A;  3NG0 A;  1QZE A;  5IP4 D;  2D2Q A;  1WSP A;  4ZRQ A;  3AU5 A;  2JXT A;  1C76 A;  1HTO A;  3Q2A C;  1GJZ A;  3CIR B;  1JRU A;  1NBF C;  4GN1 A;  5IOI A;  3A1Q A;  1FXI A;  2K39 A;  4BFR A;  1T0Q C;  1YD8 U;  2DLB A;  4DWF A;  4MH0 E;  3A9K B;  2FUH B;  1KOT A;  1FRD A;  1WFY A;  4F1S A;  1E8X A;  5BO4 B;  2M0A A;  3MJ5 A;  5IN7 A;  3N1Z C;  3TIX A;  4HCP B;  3QCA A;  3GOE A;  1D5X C;  1ESF A;  1WMH B;  3QIJ A;  4AQ7 A;  2GOW A;  2GMI C;  4N6E B;  1V1P B;  1X1M A;  1K52 A;  3GZN I;  3N20 C;  4ARC A;  1TGZ B;  4ZHO A;  4HK2 A;  2TSS A;  2Y5C A;  3ZXV A;  4P7I A;  2PTL A;  4DHJ B;  3KWL A;  4RGM A;  2DWQ A;  1Q5W B;  1EU4 A;  1JCK B;  3E9S A;  1WGD A;  1P7E A;  4KV2 A;  2XN9 C;  3BYY B;  1WF9 A;  3EA6 A;  2KJ6 A;  4HDQ A;  5BYR A;  2CKH B;  2DYO A;  4G11 A;  3X0W A;  3TMP B;  3BVZ A;  2BW2 A;  3TCA A;  2ICI A;  4RGO S;  2AL6 A;  1SBB B;  3ZLZ A;  2ZW0 A;  1BUI C;  2CJO A;  4FUL A;  4EFO A;  2FID A;  5AZH A;  2RDH A;  2FBW B;  3GP7 A;  1S3S G;  1PUT A;  4TUU A;  1I4R A;  1HTQ A;  3VUY A;  3PS6 A;  1J7A A;  4H2A A;  1R4M I;  1Z2M A;  4UDU C;  1V8C A;  2GBN A;  1WM2 A;  1B9R A;  3QHT A;  3M63 B;  1WE6 A;  1SB3 C;  1UF0 A;  3WAL A;  1WGG A;  4US8 A;  1TTN A;  2D3A A;  2NBW B;  1JW9 D;  4ASW C;  2UWQ A;  3PGE A;  2ASQ A;  5D3I B;  1FFV A;  1KLU D;  2QIE B;  4BOZ B;  4OVU A;  3DBL I;  2C7H A;  1C4C A;  1T6B X;  5BMG A;  3ML9 A;  2BB6 A;  4WJO A;  1MPE A;  1MJD A;  4EUT A;  1H4R A;  2DYM A;  3DBS A;  4JQW C;  1C78 A;  2LD9 A;  3R2I A;  4KZ0 A;  3ECI A;  2KTR A;  3VAW A;  2W55 A;  4IUM B;  4NJC A;  2KOX A;  1E7U A;  1AAR A;  5EE0 A;  1V97 A;  3KYC D;  1UGM A;  4GDL A;  1RLF A;  2D3G A;  4GOC A;  3Q3N C;  3V3X A;  3TEW A;  1I4Q A;  1VJK A;  4PS8 A;  3VRA B;  2KVZ A;  1TKE A;  2KFK B;  5KHQ A;  2IGG A;  5FK9 C;  3L0W B;  4AUQ C;  4US9 A;  2KDB A;  4M00 A;  4TV3 A;  1VDV A;  5AEK B;  3H8H A;  4BBN C;  2JSV X;  5AUK A;  3L54 A;  4CYE A;  3PRM B;  1RFA A;  2KVR A;  1SXT A;  4WWP A;  1UEL A;  4DQO C;  2PW9 A;  2BGF A;  3IBE A;  4JLC A;  1K8R B;  5HKH A;  3N30 A;  1JAL A;  1MFW A;  3HVD A;  4OZB A;  3ZJV A;  3ALB A;  2KFJ A;  1NYR A;  4AJW A;  2QIL A;  4W9D A;  4URK A;  1ZPS A;  3PRZ A;  2DEN B;  1R4N I;  3RZW C;  2OOB B;  4ICV A;  3Q3O C;  1SE4 A;  3R7R A;  4BBN F;  5AZF A;  1DGJ A;  1WE7 A;  1TZO A;  2MRP A;  2ZPY A;  4D2K A;  1TZ1 A;  2DHZ A;  3RMK C;  2KLG A;  1FFU A;  1D5M C;  4W9G A;  4R3D A;  1MVK A;  2ZJD A;  4IC7 B;  3BIN A;  5D6J B;  3C8Y A;  5LNK 1;  2N1V A;  4G50 A;  1XCQ L;  2PE9 A;  3VXW A;  3ZUN A;  3AB5 A;  4K7S A;  5D3D A;  1NEN B;  3GS2 A;  2V9H A;  4LNI A;  5DPS A;  4RF0 A;  5J17 A;  1XLN A;  1CMX B;  3NY5 A;  2ZPN A;  4B95 A;  3PVL A;  1KFY B;  2L8J A;  4MDK E;  1F1H A;  2IGD A;  2M19 A;  3QAR A;  3A1Q B;  4OZA A;  2LVP A;  5T8I A;  4HXD A;  3RT3 B;  1SEB D;  4EOY A;  3VTW A;  1FCC C;  3PO0 A;  1CJE A;  1FXT B;  2K9X A;  3WAO A;  4NAW B;  3A33 B;  1WR6 E;  4JWS C;  2IO2 B;  2GBR A;  3APF A;  4KVG B;  4B0E A;  1NVI D;  3BWU D;  4A3O A;  4DHZ E;  2KNB A;  3TSS A;  4AOF A;  1A70 A;  1ZP0 B;  3T3O A;  3MP9 A;  4IM2 A;  1DYQ A;  2IGH A;  2XBB C;  3S2A A;  4ANX A;  1AW7 A;  1M94 A;  3A4S C;  2L52 A;  1T3Q A;  5LXI B;  4N59 A;  1Q10 A;  2L3Z A;  4A8X C;  1JQ4 A;  4LJO B;  1HXY D;  4XGA B;  2KMA A;  4LJP B;  2KMC A;  4W9K A;  1ET6 A;  1UWX A;  3UIO B;  2Z0E B;  1V2Y A;  2K3U A;  1XF5 L;  4ZHP A;  2LJI A;  2JU6 X;  1V1O A;  3B0A A;  2C5L C;  1TY2 A;  2L0F A;  2WYQ A;  1PGA A;  4LNF A;  3T8M A;  3ZQ4 A;  2KJR A;  2LXA A;  1C3T A;  2VRR B;  2L0T A;  2C7N B;  1P9D U;  1ZW7 A;  3KW5 B;  1FCL A;  3KUZ A;  3PHW B;  4DDG D;  2BPS A;  1STE A;  3L08 A;  3U30 A;  4FN2 A;  1F2R C;  2JX5 A;  4II2 B;  4HVB A;  2O6V D;  4KSL C;  1L0X B;  2KDE B;  4XYC A;  5KHO A;  1WYG A;  3U52 E;  1SE2 A;  2AQ1 B;  2DBY A;  2AQ3 B;  1NEK B;  3HIZ A;  3P4R B;  3DHG C;  2N1W A;  5JHB A;  4MGY E;  2D11 A;  3PT2 B;  2PPH A;  1TIF A;  3VH4 B;  3T3N A;  4KGT A;  1Z5S B;  4HCN B;  3DVG X;  4A20 A;  3P4S B;  2SAK A;  2KTR B;  3RI7 C;  2V1Y A;  2KK8 A;  2IY1 B;  1K51 A;  2D3C A;  2IZV B;  4I6N B;  4MEL A;  2L05 A;  2AEH A;  3DBR B;  3NVZ A;  2MWS B;  2O2V A;  1KJT A;  4GB9 A;  3IHP C;  4GDL B;  4IKG A;  4P6V F;  2INN E;  2KLC A;  2J42 A;  1ZUD 2;  1OQR A;  1JWA D;  4FHJ A;  3L4P A;  3O65 B;  3WAM A;  2LAS A;  4YTP B;  2IBI B;  3A4R A;  3RNC C;  2PVG C;  1JRP A;  4LNN A;  2KX3 A;  2JWZ A;  2NPT A;  3ZTC A;  2J0K A;  4WUR A;  5MPO A;  2V3N A;  2BWE S;  4MGK E;  3WAN A;  1TJE A;  4RMA A;  1P98 A;  3I5J C;  1YQB A;  3RYT A;  3HRD D;  2C7M B;  1SE9 A;  2KJH B;  4JWU C;  1OQY A;  4TQ1 A;  1L4D B;  3Q8F A;  3PTF C;  5FR3 A;  3C0R B;  2JQR B;  1YQ4 B;  3ENE A;  4GGQ A;  1GUA B;  4IWP A;  2Y3A A;  2N9P C;  1C4A A;  3I57 A;  3QX1 A;  2XNA C;  4DHZ B;  3WA0 A;  3AU4 A;  3M3J A;  4W9E A;  3RUL A;  1SGH A;  1YJ1 A;  1L5P A;  2C60 A;  1QOG A;  3AEE B;  4PYZ A;  3KYD D;  3Q69 A;  3UQB A;  2GRI A;  4DK5 A;  5IA7 A;  4HPP A;  2BS2 B;  1FIQ A;  2EKE C;  2N0S B;  2IJ0 A;  1TKG A;  2KHW B;  2ZVO A;  4XZ4 A;  4K7U A;  4C00 A;  4AWJ A;  3AEA B;  3NZS A;  4A55 A;  1IBX A;  5EE9 A;  1G6J A;  2Q5W D;  2JZZ A;  5JHA A;  5C1Z A;  2JZP A;  4BKS D;  4HPM B;  2GBJ A;  3L10 B;  3ZKJ C;  4BAX A;  4DDI D;  2IO0 B;  1MG4 A;  4CO7 A;  1E6E B;  2Y5B B;  2HJ8 A;  1YN3 A;  3KWV A;  3AMZ A;  3TJP A;  1EUV B;  3QAQ A;  4OVV A;  4USA A;  3HK0 A;  3MHS D;  5IKC M;  2B3A A;  2GI9 A;  1T0Y A;  3N3K B;  3AE6 B;  1J19 A;  2L00 B;  2W9N A;  3HUI A;  3V6C B;  4C80 A;  4YL8 A;  1LGR A;  1WWT A;  2H89 B;  1WXS A;  1YOV B;  4TMA B;  3C19 A;  3RPF C;  3U4E G;  5EE1 A;  2CJN A;  2GLS A;  3PPA A;  3H9D A;  2CU3 A;  3BZD B;  3B2F A;  3PLV A;  4FBJ B;  2N9E B;  4E71 A;  4N58 A;  3K9O B;  3EHV A;  4FXC A;  3MC9 A;  3PRE A;  2CU1 A;  2FNJ B;  2QJL A;  2IYD B;  3IT4 B;  1AWD A;  3IVF A;  2LGS A;  2DZK A;  2M0X A;  3Q14 C;  4JX1 C;  4GU2 A;  3QJZ A;  2RR9 A;  2L83 A;  1QF6 A;  2MH7 A;  5BYQ A;  2W3S A;  5LXH A;  4C4V A;  1RRB A;  1E7V A;  2NTT A;  1EO6 A;  1QOB A;  4L1B A;  2G4D B;  1GC6 A;  2MW5 A;  4FAD A;  4PS7 A;  3IAS 1;  2WU5 B;  4P16 A;  4KSK C;  5BMI A;  4LCD E;  4ANV A;  3ZYY X;  3MFG A;  1PQS A;  3PLU A;  5E6J A;  2CS4 A;  3OJ4 B;  3W1S A;  2BB5 A;  2KWD A;  2DNF A;  2KQ4 X;  1L6U A;  3RNA C;  1E8Z A;  2A4Z A;  1JWS D;  1WI0 A;  5D2M B;  3Q8A A;  1YJJ A;  1NI3 A;  2KWV B;  5CX3 A;  1WR1 A;  1F2R I;  5GXG B;  4JE3 B;  5I4D A;  3JVZ X;  1N6Z A;  2RGF A;  3O13 A;  4HJK A;  3AEB B;  3AE3 B;  1WXQ A;  2X38 A;  3RD2 A;  1D6E C;  1GC7 A;  2HD5 B;  2YEP F;  1UBI A;  4A90 A;  1N60 A;  4ANU A;  1HZ6 A;  2K8C A;  3EC8 A;  1N63 A;  4LTU A;  1JWB D;  1RAX A;  2KQ7 A;  3H1U A;  3JW0 X;  4II3 B;  4LNK A;  2REX A;  4A3P A;  5H8Y E;  2LVO A;  1QQR A;  3DBH I;  4DXA B;  3BY4 B;  4FJZ A;  4KDI C;  3Q3M C;  2GBK A;  3JSV A;  4ZRJ A;  3E56 A;  4A6Q A;  2L76 A;  1YMH E;  2WQY B;  3MHZ A;  5DPW A;  4LNO A;  2WXF A;  2ZEQ A;  4ZYN A;  3L17 A;  2V4L A;  2NR2 A;  4GDK A;  3L13 A;  3RNB C;  2G9H D;  3AED B;  1E0Z A;  1VZ7 A;  3RZF A;  2WDR B;  4WWO A;  3FIL A;  2FAZ A;  3EFC A;  2J7Q B;  4C56 C;  1LXD A;  1V6E A;  1YN5 A;  1XLQ A;  1ZGU B;  1KF6 B;  2NPT B;  2Z8L A;  3ZXR A;  4JGH B;  2UYZ B;  4EKU A;  1JWU D;  1TT5 B;  3SEB A;  3KLS X;  1IUE A;  2HTM E;  2NTS A;  4XE0 A;  3P4Q B;  4KGR A;  2WDT B;  2LJ5 A;  1T0S C; 
#chains in the Genus database with same CATH homology
 4ZRK A;  2L3Z A;  3RUI B;  2LVQ A;  4LJO B;  2PE6 B;  1UZX B;  1VCB A;  3LDZ E;  3VFK A;  3U8Z A;  4ZRI A;  2RPQ A;  3KH0 A;  2AWT A;  2K1F A;  2KMA A;  2CHW A;  2XK5 B;  5LLI A;  4LJP B;  5JZE B;  2KMC A;  4FJY A;  1I42 A;  1WJN A;  4W9K A;  4WAA A;  4MJS A;  1IYF A;  1WJ6 A;  1WX7 A;  3ZIM A;  5DPR A;  5GMV A;  3UIO B;  2Z0E B;  1WZ0 A;  1LM8 B;  1V2Y A;  1NDD A;  1WM3 A;  1UH6 A;  3EEC A;  2FCS A;  3PRP B;  3HM3 A;  3SHQ A;  1EF1 A;  4FHK A;  2JPH A;  1MG8 A;  3ZNI D;  1YIW A;  2KAN A;  2LUE A;  3B0A A;  4MSM B;  2C5L C;  2CHX A;  1EF5 A;  2DZM A;  2MBO A;  4XC2 A;  2L0F A;  2WYQ A;  3VH3 B;  4WQO B;  2LWP A;  3T8M A;  1WY8 A;  2FCQ A;  3HHM A;  4IWO A;  4FLH A;  4B9K A;  1OEY A;  2EMS A;  2KJR A;  5E6O A;  2LXA A;  4WJP A;  3NOB A;  3JYU A;  1C3T A;  2VRR B;  2L0T A;  3KUD B;  4LDT B;  3A9J A;  2C7N B;  1P9D U;  2G4S A;  1ZW7 A;  3KW5 B;  1UD7 A;  2O6V B;  1E90 A;  3KUZ A;  1UBQ A;  3PHW B;  4WJQ A;  4DDG D;  3AI5 A;  2KC2 A;  2BPS A;  3M62 B;  3W1S C;  3L08 A;  1P1A A;  3U30 A;  3VTV A;  2CR5 A;  4NNJ B;  2G45 B;  4FN2 A;  4MEM A;  2JY6 A;  4II2 B;  5E6N A;  5L83 A;  4ANW A;  4HVB A;  2O6V D;  2IY0 B;  4KSL C;  1E8Y A;  4M8N A;  4W9C A;  2KDE B;  3NZU A;  4MSQ B;  4GMV A;  2MBH A;  3HM6 X;  2KTF A;  5KHO A;  3QK0 A;  5IAA C;  4EEW A;  4IWQ A;  2PJH A;  2N7E A;  1WRD B;  3KVF B;  3APD A;  3HIZ A;  2DAF A;  5G2N A;  1WH3 A;  2BF8 B;  2N1W A;  5JHB A;  2MP2 B;  4MGY E;  2D11 A;  1I35 A;  2J0M A;  2JVC A;  2LZ6 A;  2NVU I;  4HDO A;  3PT2 B;  1S1Q B;  4K81 A;  2KN5 A;  3ONS A;  1YX6 B;  2PPH A;  4ICU A;  2FIF A;  3SD5 A;  4I6P A;  2BYV E;  3VH4 B;  3W1Y A;  4E74 A;  1OTR B;  4F8C B;  1Z5S B;  2O2V B;  4HCN B;  5J18 A;  3DVG X;  4W9L A;  1IPG A;  4A20 A;  2A5U A;  3MJW A;  3OJ3 A;  2JXX A;  3QA8 A;  3ZNG C;  2KTR B;  1ISN A;  3M95 A;  1E5W A;  2V1Y A;  3B08 A;  4NPN A;  2KK8 A;  2IY1 B;  2K25 A;  2IZV B;  4I6N B;  1QZE A;  4MEL A;  2L05 A;  2AEH A;  2D2Q A;  3ML8 A;  2M17 A;  3AU5 A;  2ZCC A;  3DQV A;  2MWS B;  2O2V A;  1KJT A;  4GB9 A;  3IHP C;  4GDL B;  2JF5 A;  2J0J A;  2PEA A;  2KLC A;  1GJZ A;  1NBF C;  1JRU A;  4FHJ A;  4GN1 A;  1XQQ A;  4W9H A;  3A1Q A;  4EZL A;  2NCN A;  2K39 A;  1WGH A;  2MSE D;  3O65 B;  2GBM A;  2CHZ A;  2LAS A;  3WAM A;  4BFR A;  1WX9 A;  2MLB A;  2IBI B;  1YD8 U;  4WWN A;  3A4R A;  4DWF A;  5E6P A;  3APC A;  4MH0 E;  3A9K B;  5AZG A;  2FUH B;  1KOT A;  1WFY A;  3VDZ A;  4F1S A;  2NBU A;  2KX3 A;  2JWZ A;  1E8X A;  4HPL B;  5BO4 B;  2NPT A;  3ZTC A;  2J0K A;  4I6L B;  3DBR I;  3X23 A;  3UF8 A;  3TIX A;  4HCP B;  3QCA A;  2BWE S;  3ZO5 B;  1WXM A;  2BKR B;  4MGK E;  3GOE A;  3WAN A;  4XX5 A;  4RMA A;  1P98 A;  3IG3 A;  1WMH B;  3QIJ A;  3H7S A;  2GOW A;  1YQB A;  2GMI C;  2RD0 A;  3N32 A;  5CHW A;  1X1M A;  1OGW A;  1HE8 A;  2K8B A;  3GZN I;  3RYT A;  1TGZ B;  4HK2 A;  4IM3 A;  2C7M B;  4EZK A;  3DVG Y;  1SE9 A;  5JH5 C;  2KJH B;  4P7I A;  1OQY A;  3SDL C;  5L95 C;  4TQ1 A;  2LGD A;  4DHJ B;  5FR6 A;  3PTF C;  2K8H A;  1WMH A;  3ZVV A;  1Q5W B;  3C0R B;  4MGZ E;  2MBB B;  3ENE A;  2XK5 A;  1V81 A;  4RM9 A;  2KX0 A;  2KQS A;  3V61 A;  4GGQ A;  2NBV B;  1GUA B;  2Z59 B;  4IWP A;  1GG3 A;  1WGD A;  4BVU C;  3ZNZ B;  2N9P C;  2JRH A;  3Q3F A;  4JL9 A;  1WYW B;  4KV2 A;  4GSW A;  4BKT A;  1WJU A;  1YX5 B;  3QX1 A;  1V5O A;  1VD2 A;  4DHJ D;  4DHZ B;  2ZZP B;  3WA0 A;  3AU4 A;  5D94 A;  3M3J A;  2R2Q A;  4W9E A;  1P0R A;  1WF9 A;  1WXV A;  1SGH A;  3RUL A;  4IG7 B;  3ZTD A;  1YJ1 A;  2HE7 A;  2KJ6 A;  4HDQ A;  1D3Z A;  2CKH B;  2DYO A;  3VTU A;  3AUL A;  4KDL B;  4G11 A;  3X0W A;  3TMP B;  3DVN U;  2C60 A;  3H7P B;  3TCA A;  4PYZ A;  2AL6 A;  2LRW A;  3KYD D;  4GXB A;  3ZLZ A;  3UQB A;  4DK5 A;  5CHF A;  5IA7 A;  4FUL A;  1C1Y B;  2LI5 A;  4MM3 A;  4EFO A;  2EKE C;  2FID A;  5AZH A;  1TBE A;  1KM7 A;  2ZNV B;  1S3S G;  4EZJ A;  4TUU A;  1XT9 B;  2KHW B;  3VUY A;  2O6V A;  3PS6 A;  4CHK A;  2ZVO A;  4XZ4 A;  1R4M I;  2ZCB A;  1Z2M A;  4K7U A;  2LRU A;  4N9F 4;  2GBN A;  1WM2 A;  4AWJ A;  3QHT A;  1U4A A;  2BYE A;  2IO3 B;  1P3Q U;  3DPD A;  3M63 B;  1WE6 A;  2MX2 A;  3NS8 A;  3NZS A;  3NHE B;  3PV1 A;  3R3M A;  3WAL A;  4KIK B;  1G6J A;  2OJR A;  2JZZ A;  1WGG A;  1L7Y A;  5JHA A;  5G55 A;  5C1Z A;  4BKS D;  1TTN A;  4HPM B;  2GBJ A;  1V86 A;  2NBW B;  3CMM B;  2N9X A;  3B1L X;  4ASW C;  3L10 B;  3ZKJ C;  2XEW A;  4DDI D;  2IO0 B;  2UWQ A;  3PGE A;  2ASQ A;  3VQI A;  3L16 A;  3CF6 E;  4OVU A;  3DBL I;  4BOZ B;  4CO7 A;  2C7H A;  2N7D A;  3DCG A;  4G3X B;  3CST A;  2Y5B B;  3ML9 A;  3T9L A;  3K9P B;  2HJ8 A;  2MP2 A;  4WJO A;  3RCZ A;  4BOS C;  2LXC A;  2HTH A;  4EUT A;  4TQ0 A;  2WX0 A;  3I3T B;  1H4R A;  4DBG A;  2KWU B;  3H6N A;  2MBE A;  2DYM A;  3TJP A;  1F9J A;  1EUV B;  3QAQ A;  3DBS A;  4JQW C;  4OVV A;  1SIF A;  3HK0 A;  2LD9 A;  4KZ0 A;  3MHS D;  2B3A A;  4GDK B;  2D07 B;  3TBL D;  4M0W B;  1T0Y A;  3ECI A;  2ZVN A;  2KTR A;  3N3K B;  4K1R B;  3VAW A;  2MCN B;  3VUX A;  3P2B A;  1J19 A;  2L00 B;  3ZRF A;  4IUM B;  3WIM A;  3UIP B;  4ZDV A;  2KOX A;  2W9N A;  1E7U A;  1AAR A;  3OLM D;  3V6C B;  2M8S A;  3DVN V;  3KYC D;  1UGM A;  4YL8 A;  2EMT A;  4GDL A;  3U7D A;  1RLF A;  2R2O A;  2D10 A;  1WXS A;  2D3G A;  1WZ3 A;  3Q3J A;  4GOC A;  2KC1 A;  3ZW3 A;  1LFD A;  3EFU A;  4PS8 A;  3UIN B;  3PPA A;  1J0G A;  3H9D A;  2YVC A;  2N4F A;  4HLE A;  3PLV A;  3D32 A;  4B6W A;  4FBJ B;  1A5R A;  3PZD A;  2KFK B;  2N9E B;  4E71 A;  2LGX A;  3A9K A;  4AJY B;  5KHQ A;  2M4N A;  3V60 A;  3L0W B;  2NS5 A;  3LJ3 A;  2KDB A;  3K9O B;  3TL5 A;  4AUQ C;  3EHV A;  3MTN B;  4PS3 A;  3PRE A;  2MQJ A;  2CU1 A;  2FNJ B;  1ZKH A;  2IYD B;  4TV3 A;  3ZRC A;  3IVF A;  4KZC A;  5AEK B;  2C9W B;  4BBN C;  2DZK A;  3DOW A;  3L54 A;  2M0X A;  4FJV B;  3VVW B;  5DCN A;  4CYE A;  3PRM B;  1RFA A;  3R7Q A;  3IFW B;  2KVR A;  3QJZ A;  4GU2 A;  2RR9 A;  2DX5 B;  4MJS B;  2DYB A;  2DZI A;  4X57 B;  3V62 A;  2JT4 B;  4WWP A;  1V49 A;  1UEL A;  3QWZ B;  3WAP A;  4F7Z A;  2BGF A;  4JIO U;  3IBE A;  5LXH A;  1Q1O A;  4JLC A;  1RRB A;  2M1M A;  1E7V A;  1K8R B;  1EO6 A;  2DZJ A;  2MA9 B;  3N30 A;  5HKH A;  1IP9 A;  3CSF A;  3VHT C;  1WJ4 A;  4NQL B;  3ALB A;  2KFJ A;  2KD0 A;  4AJW A;  2G4D B;  2FCN A;  3PSE B;  1GC6 A;  4TKN A;  4K7W A;  2WX1 A;  2KDI A;  4W9D A;  3ZDM C;  2MW5 A;  4FAD A;  4PS7 A;  4URK A;  3PRZ A;  4NJ6 A;  4FA6 A;  4KSK C;  1V9J A;  2JRI B;  2DEN B;  1R4N I;  4LCD E;  1WGR A;  2OOB B;  4ICV A;  3RZW C;  4ANV A;  3A9J B;  1BT0 A;  3V6E B;  1OEY J;  2JZ3 B;  1PQS A;  3H7P A;  3PLU A;  2CS4 A;  3OJ4 B;  3R7R A;  3W1S A;  4BBN F;  2I1K A;  5AZF A;  3OAW A;  1WE7 A;  4HWI B;  3UGB B;  2JUO A;  1E8Z A;  2A4Z A;  5C23 A;  2AYO B;  1WI0 A;  2MRP A;  4GIV A;  2ZPY A;  3R66 C;  5D2M B;  1TZ1 A;  2WWZ A;  4W9J A;  5D7G A;  2DHZ A;  3DDC B;  2G3Q B;  1H8C A;  2KWV B;  3PHX B;  2KLG A;  5CTR C;  5CX3 A;  1NI2 A;  4BKS A;  1WR1 A;  4PYU A;  4LDT D;  4W9G A;  4IC7 B;  1LQB A;  2ZJD A;  3QC8 B;  2FCM A;  3JVZ X;  4E3C A;  4HJK A;  2RGF A;  4KIK A;  3BIN A;  5D6J B;  2ZNV C;  3RD2 A;  1J8C A;  1GC7 A;  5DPT A;  2HD5 B;  2N1V A;  1E8W A;  4G50 A;  1WIA A;  1UBI A;  2Z0D B;  2AL3 A;  3AXC A;  4ANU A;  2QHO A;  1WX8 A;  2BYF A;  1V5T A;  2PE9 A;  3JSV B;  3VXW A;  3ZUN A;  2K8C A;  3EC8 A;  4K7S A;  2KKC A;  1V80 A;  1RAX A;  2KQ7 A;  3H1U A;  3JW0 X;  3QQ8 B;  4II3 B;  5DPS A;  5J2R A;  2REX A;  4A3P A;  2MBQ A;  2LVO A;  3ZDT A;  3DBH I;  3NY5 A;  1CMX B;  4DXA B;  5J17 A;  1WGY A;  5TR5 A;  2ZPN A;  4B95 A;  3BY4 B;  4FJZ A;  2KXJ A;  3PVL A;  2K6D B;  2LGY A;  4KDI C;  2GBK A;  4W9F A;  4WJN A;  3JSV A;  4ZRJ A;  2L76 A;  5DPW A;  2L8J A;  2KWC A;  4MDK E;  4RM8 A;  2KDF B;  1Y8R C;  2ZEQ A;  2DAJ A;  4ZYN A;  3QAR A;  3L17 A;  1L2N A;  3A1Q B;  4NJ7 A;  3ZNH B;  2V4L A;  2NR2 A;  4GDK A;  4AP4 C;  3L13 A;  2LVP A;  4HXD A;  3RT3 B;  2RSU A;  3KUC B;  3RZF A;  4EOY A;  4NQK E;  3VTW A;  2KO3 A;  4WWO A;  4BKG A;  2I1J A;  1WXA A;  1FXT B;  2FAZ A;  4NAW B;  3WAO A;  3A33 B;  4IM0 A;  4M8M A;  2J7Q B;  1WR6 E;  1LXD A;  1V6E A;  3SU8 X;  2KZR A;  4W9I A;  4NY0 A;  1ZGU B;  2NPT B;  3VUW A;  2IO2 B;  2GBR A;  3APF A;  4KVG B;  5CHV C;  4IW0 A;  2L7R A;  4JGH B;  3UQA A;  4MGI E;  4A3O A;  2UYZ B;  4NAW A;  2KNB A;  4DHZ E;  4EKU A;  1GNU A;  2IO1 B;  1KLV A;  2YLM A;  2K6Q A;  4AOF A;  2KFK A;  4J6I A;  2BKF A;  2V3S A;  4IM2 A;  2XBB C;  1XD3 B;  3S2A A;  4ANX A;  5EDS A;  1M94 A;  2WDT B;  1Q0W B;  2LJ5 A;  3A4S C;  2BWF A;  5LXI B;  4G0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...