4NJ6A

Pb1 domain of atarf7
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
TYTAVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVAHENAILLVGDDPWEEFVNCVQSIKILSSAEVQQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Auxin response factor 7
publication title Molecular basis for AUXIN RESPONSE FACTOR protein interaction and the control of auxin response repression.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 19
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nj6A00
3WALA 3ONSA 3QHTA 1Q0WB 3VVWB 3UINB 4DXAB 3DBLI 3HM3A 1WZ0A 3HM6X 2BWFA 4G3XB 4EEWA 4EZKA 3A9KB 1P0RA 4HPLB 1AARA 5E6NA 3H6NA 4DHZB 3KYDD 4TUUA 1OEYJ 4WWPA 1NBFC 2V3SA 3SDLC 3TBLD 2L0FA 1WRDB 2KTRB 5BO4B 2D11A 2IO1B 2OOBB 3PRZA 4IWOA 4MELA 4HVBA 2D07B 3DCGA 2CHXA 2K39A 4HWIB 3MHSD 4A20A 1ZKHA 4FULA 5LLIA 2KWUB 3OJ3A 2G4DB 2IYDB 3JYUA 2O6VA 4FJVB 3KW5B 4ZDVA 2DZKA 4AP4C 2KVRA 3RULA 3PT2B 2AWTA 5CHWA 5D7GA 4ASWC 4BBNF 4WQOB 3RT3B 1WM2A 4KDIC 4EZJA 3RZWC 4AJYB 2MBHA 4KSLC 3ML9A 4W9IA 1K8RB 3VTVA 2DZIA 2G45B 2MP2B 3ZDTA 3QAQA 3QWZB 1Z5SB 1RAXA 3L13A 1P9DU 2CU1A 3W1YA 4W9KA 2OJRA 3APCA 2WX0A 2IO2B 3ZDMC 4B9KA 1WGDA 1ZGUB 3PV1A 1WGHA 2O2VB 5LXIB 3RZFA 4MJSB 3Q3FA 1T0YA 1U4AA 4EOYA 1BT0A 1V49A 2JZ3B 3JSVB 4WWOA 1E8WA 1M94A 1WJ4A 2A5UA 2V1YA 1YQBA 1UBQA 2R2QA 1WXAA 3H7SA 2BWES 5G2NA 3DDCB 3V60A 2XK5A 2BYFA 3EC8A 2JXXA 4NJ7A 1WGRA 1GC7A 3PTFC 3UF8A 3A4RA 3UQBA 3H7PB 4ZRJA 2NPTB 3QIJA 3P2BA 1E90A 4MGYE 1TZ1A 4M0WB 5G55A 3PGEA 2J0MA 2CHZA 3ZNID 4GXBA 4DDGD 2D2QA 5HKHA 3CF6E 1OQYA 1WYWB 1Y8RC 1J8CA 4IM2A 4ANWA 5JH5C 3DVGY 1WZ3A 4NPNA 3VFKA 2MQJA 4JGHB 2LXAA 4ICVA 2XEWA 4GDKB 2NS5A 2JT4B 3OJ4B 1WMHB 2IY1B 4BFRA 4IW0A 3ZVVA 2REXA 2ZPNA 3A1QB 2DYOA 2N7EA 1H4RA 2LGYA 4B95A 3VHTC 1E8XA 3PHWB 3TCAA 4RMAA 1WR6E 4EKUA 2LRWA 4DHJB 1SIFA 2BF8B 2RR9A 3VTWA 4NAWA 2BGFA 4PYZA 3A9JB 2Z0EB 1WGYA 1V86A 2MBEA 2N7DA 2LVPA 2KC2A 4WAAA 2C9WB 3U8ZA 4W9JA 2EMTA 2V4LA 4KIKB 2GBKA 2MLBA 3H9DA 4GSWA 3QCAA 1NI2A 2LXCA 2GOWA 4DHZE 1VD2A 3NY5A 4ZYNA 1KJTA 3DVNV 2KJRA 4PS3A 1I42A 3DVNU 3X0WA 4A3OA 3N32A 3CSFA 4FBJB 3AULA 3N30A 1WX9A 2JWZA 1Q5WB 3M95A 2J7QB 2KFKB 2YVCA 3TMPB 1V80A 1XD3B 4NQKE 1WJUA 3T9LA 2GBMA 1E7VA 2MA9B 4OVVA 1GNUA 2C60A 4IM0A 1E8YA 2YLMA 3MTNB 4MSMB 4HLEA 2ASQA 1UGMA 3UIOB 2PPHA 3IG3A 4PS7A 2JZZA 2KZRA 3KH0A 2CS4A 1RFAA 4EUTA 1SE9A 2MP2A 2MWSB 1YIWA 3RYTA 2W9NA 3NS8A 1IYFA 1GUAB 3NZSA 2K8BA 1VCBA 1V9JA 2LGXA 3L16A 1QZEA 3QARA 4GMVA 1J0GA 5J2RA 2K6QA 4GOCA 2KFJA 4RM9A 2MX2A 2O2VA 3AU5A 1GG3A 1WXSA 3X23A 2ZPYA 1KLVA 5E6PA 4MJSA 2KKCA 1LXDA 3L10B 4DK5A 4HDOA 2RD0A 1LFDA 2BKFA 2C5LC 2L00B 2L05A 2M17A 5CTRC 3ZO5B 3IHPC 4MH0E 1WX7A 3PS6A 2L76A 3UGBB 3VUXA 1IPGA 5JZEB 1X1MA 4W9HA 2KO3A 4GN1A 1MG8A 1ISNA 4WJQA 4JQWC 5EDSA 4WJNA 2ZCBA 3M63B 4WJPA 2HJ8A 2IBIB 2HE7A 2CR5A 4JLCA 3SU8X 2FCNA 3IFWB 3KUZA 2DX5B 3PZDA 1UH6A 2GBRA 3KYCD 4KV2A 1P1AA 4IC7B 4I6PA 2MBBB 5J18A 1WF9A 3QK0A 2PJHA 2JUOA 2NPTA 1GC6A 4J6IA 3VQIA 1YD8U 4HCPB 1TTNA 2KX0A 4NJ6A 4KZCA 3C0RB 4W9FA 2PE6B 4BOSC 4DBGA 1WX8A 2LI5A 2CKHB 2J0JA 2DHZA 2N9XA 2Z0DB 1V81A 3AXCA 3DBRI 2LGDA 4CHKA 2KMCA 2GBNA 2K8CA 2Z59B 5CHVC 2JRHA 1WXVA 1E5WA 4GDKA 1V6EA 3A33B 3QC8B 2HTHA 1WMHA 4WWNA 3A1QA 2JPHA 2D10A 2JVCA 4HDQA 5C1ZA 2KQSA 2MBOA 1EUVB 1WM3A 4NNJB 1WJ6A 4LCDE 1C1YB 4P7IA 2BPSA 4DHJD 2L3ZA 4W9DA 3L08A 2FNJB 4K81A 2KK8A 2LJ5A 3AI5A 2MW5A 2GBJA 3ML8A 4AJWA 1HE8A 4K7WA 3R7RA 3A9JA 1R4NI 2B3AA 2NR2A 3EFUA 2MCNB 4KIKA 4TKNA 2RPQA 3OLMD 1EO6A 2C7HA 4GIVA 3BINA 4MSQB 4W9CA 2KLCA 4F8CB 1F9JA 2KMAA 2ZNVC 3V6EB 2WDTB 2MSED 4ANUA 5AZHA 4F1SA 3K9OB 5L83A 4KDLB 4I6LB 1V2YA 2KXJA 1L2NA 1CMXB 3PHXB 4NY0A 5D94A 1XQQA 2IZVB 2BYVE 5TR5A 3NHEB 1S1QB 3HIZA 4OVUA 2Y5BB 1WE7A 5LXHA 4EFOA 1C3TA 3B0AA 1WH3A 3MJWA 4WJOA 4GDLB 4HCNB 3A9KA 3DQVA 4HPMB 3WA0A 3ZNGC 5FR6A 2LVQA 3CMMB 4G0NB 2IY0B 1LQBA 3APFA 5D6JB 2DAFA 3AU4A 2M1MA 3R66C 2KTRA 3PLVA 3VUWA 4AOFA 2DAJA 3TJPA 2LD9A 3WAMA 2LWPA 3B1LX 3DPDA 1WR1A 1Z2MA 3WANA 4ZRKA 4CYEA 3ZNZB 5JHAA 1V5OA 1S3SG 1WY8A 4MGZE 5J17A 1FXTB 3I3TB 2QHOA 2IO0B 2M4NA 2N9EB 3CSTA 1A5RA 1UZXB 4M8NA 3OAWA 4TQ1A 4DDID 2I1JA 5AZGA 1WI0A 1OTRB 3QJZA 2FIDA 3ZKJC 2BYEA 4FHKA 3N3KB 4W9LA 4ANXA 2AYOB 4FHJA 3ECIA 2KDEB 2M0XA 3ZRFA 3TL5A 4BKTA 1WJNA 3V6CB 1PQSA 3JW0X 4FJYA 4FJZA 3U7DA 4E74A 3M62B 4MM3A 3UQAA 2ZVOA 3GOEA 5DPTA 3R3MA 1YX5B 2K8HA 1Q1OA 2VRRB 4FLHA 4KVGB 2AEHA 4YL8A 2DZMA 3HK0A 1TGZB 4NAWB 3W1SA 4BOZB 3DBSA 3JSVA 1KM7A 4NQLB 4JL9A 3NOBA 3PVLA 2WWZA 2C7MB 3R7QA 3S2AA 1IP9A 2LZ6A 1UD7A 2BKRB 2ZNVB 4BKGA 2IO3B 3ZUNA 2KDFB 2ZZPB 4LDTD 2N9PC 2LUEA 1R4MI 4II3B 3PSEB 1LM8B 3PLUA 4I6NB 2DENB 1I35A 3NZUA 4ZRIA 4EZLA 2NBWB 2O6VD 4E71A 4PYUA 1UBIA 4BKSD 3ZTDA 2LASA 4G11A 3DBHI 4TQ0A 4BKSA 4GB9A 2PEAA 4LJPB 2LVOA 4DWFA 4GGQA 3H7PA 2I1KA 2G3QB 2GMIC 2JRIB 3ZW3A 1P3QU 3SHQA 4IG7B 2K6DB 5KHOA 5KHQA 4AWJA 4KZ0A 2HD5B 2NCNA 2AL3A 3WAOA 5DCNA 2MRPA 1YJ1A 3JVZX 2A4ZA 4M8MA 4FADA 2MBQA 1RRBA 3Q3JA 4LDTB 3RCZA 3VAWA 3VDZA 3VH3B 3WIMA 4IUMB 4RM8A 2KD0A 2WYQA 2UYZB 3PRMB 4X57B 4LJOB 2DYMA 5IA7A 3QX1A 4CO7A 3D32A 4AUQC 1OEYA 3U30A 2O6VB 4K1RB 2KTFA 4XX5A 3VUYA 3V62A 3QQ8B 4JIOU 3WAPA 5AEKB 2N4FA 2KLGA 2PE9A 3IVFA 5IAAC 2XBBC 2RGFA 2WX1A 5GMVA 3RD2A 1SGHA 3VH4B 3ZIMA 4F7ZA 3KUDB 3BY4B 4MGIE 4HXDA 3ZLZA 1D3ZA 5AZFA 4TV3A 4G50A 2FCSA 1E8ZA 3TIXA 2L0TA 2KQ7A 5C23A 4A3PA 3H1UA 1G6JA 2KHWB 5D2MB 4GU2A 4BVUC 1XT9B 1WGGA 1NDDA 2KX3A 2FCQA 3VXWA 2G4SA 3PRPB 3ZRCA 3KUCB 1EF1A 3QA8A 4IWPA 1WFYA 4XC2A 1WE6A 3LDZE 4MDKE 4GDLA 5CHFA 5L95C 1KOTA 3V61A 2JF5A 1ZW7A 4B6WA 3PPAA 3T8MA 2FAZA 1UELA 4XZ4A 3DOWA 5JHBA 3HHMA 5DPSA 1E7UA 3EHVA 2CHWA 4PS8A 2ZCCA 3APDA 3VTUA 4ANVA 3IBEA 2DYBA 2L8JA 4MGKE 1OGWA 2EMSA 2KFKA 3L17A 5DPRA 2XK5B 1RLFA 2KWVB 2M8SA 5CX3A 1GJZA 2K25A 1H8CA 3SD5A 5E6OA 4MEMA 3M3JA 4N9F4 2ZJDA 1JRUA 3PREA 4II2B 2LRUA 3ALBA 2KC1A 2NBVB 3ENEA 2DZJA 2KN5A 1P98A 2N1WA 3EECA 3K9PB 4HK2A 2ZEQA 5DPWA 3ZNHB 3A4SC 3L0WB 4URKA 1WIAA 2NBUA 1YX6B 4K7UA 4KSKC 4IWQA 1L7YA 2KANA 2KDBA 2ZVNA 4K7SA 1J19A 2JY6A 4W9GA 2FCMA 2EKEC 1TBEA 2D3GA 4FA6A 3UIPB 2K1FA 4FN2A 2KDIA 3W1SC 3DVGX 2C7NB 3KVFB 4E3CA 2KWCA 3O65B 2L7RA 1V5TA 3LJ3A 1EF5A 4BBNC 4HJKA 2J0KA 3L54A 2R2OA 2KJ6A 2FIFA 2NVUI 2KJHB 2KNBA 3ZTCA 2RSUA 4IM3A 3GZNI 4ICUA 2AL6A 1WXMA 2FUHB 2KOXA 2N1VA 3RUIB 4W9EA 3B08A 2UWQA
chains in the Genus database with same CATH superfamily
3ONSA 3TUOA 1TY2A 1JROA 2UU7A 3DBLI 3HM6X 3AE2B 4RGMA 1P0RA 2BW2A 5IN7A 3H6NA 4DHZB 4WWPA 1L0XB 1MHHE 3SDLC 3TBLD 2L52A 2KTRB 4OZBA 3ZYYX 1SB3C 4IWOA 4HVBA 4KGRA 3DCGA 3DBRB 4FULA 4FJVB 2O6VA 4ZDVA 4AP4C 1N6ZA 1WM2A 4KDIC 4KSLC 1K8RB 3QAQA 3L13A 1P9DU 2CU1A 1QOAA 3APCA 2WX0A 2IO2B 3PV1A 5LXIB 1AN8A 1YN4A 3Q6BA 3RZFA 4EOYA 1QOBA 3JSVB 4KKJA 1E8WA 1L4DB 1YQBA 2RDGA 4TMAB 2R2QA 3LXFA 3H7SA 5G2NA 2XK5A 2AQ1B 1FCCC 2CJOA 2JXXA 3Q8AA 4NJ7A 2QIEB 1KF6B 1PDXA 1WGRA 1GC7A 1F1HA 3PTFC 1SJED 1FIQA 4RF0A 2NPTB 2Y3AA 4M0WB 2J0MA 4TSSA 2CHZA 2L1AA 4DDGD 3W5VB 1OQYA 1QOGA 5JH5C 2JXTA 2MQJA 4BZAA 3B2GA 3R2IA 1E8XA 5FK9C 3I57A 2LRWA 4DHJB 2K22A 3Q8BA 1OFFA 1SIFA 1TS2A 2RR9A 4EE2A 1T6BX 1C76A 1MVKA 2KC2A 4RCOA 4BAXA 1ZE3D 1NI2A 2LXCA 2GOWA 4ZYNA 2KJRA 4PS3A 2WLBA 2D3AA 3GE8C 1Q5WB 3M95A 2KFKB 2I38A 3AEAB 2C60A 1L0VB 4HLEA 4HPPA 2JZZA 3KH0A 1RFAA 3NS8A 1UGJA 3NZSA 1F2RC 1V9JA 3QARA 4GMVA 3C8YA 2K6QA 3HUIA 4GOCA 2MX2A 2O2VA 2SAKA 3ZJVA 2ZPYA 5GXGB 4DK5A 1ZUD2 3U52E 2C5LC 2L05A 2M17A 1RWSA 1STEA 1SBBB 4MACA 1WXQA 4W9HA 3DHIC 2AQ3B 4WJQA 3IT4B 4LNFA 2HE7A 3RI7C 2DX5B 2KACA 3PZDA 1UH6A 2GBRA 4KV2A 2MBBB 2PJHA 2JUOA 2WU2B 2WQYB 4HCPB 1TTNA 3RNCC 2R61A 2PE6B 1L6UA 2N9LA 3DHHC 1WSPA 2LI5A 3AE9B 2BBCA 1QKZA 2GRIA 3Q2AC 1WXVA 1L6VA 1HZ5A 2MEKA 3I63C 4WWNA 2IPKD 1WM3A 4NNJB 1SXTA 1C1YB 2PTLA 2IGDA 4YTMB 1N5WA 2FNJB 3ZXRA 2MW5A 1HE8A 4K7WA 1R4NI 1XXGA 4KIKA 4TKNA 2RPQA 4F8CB 4W9CA 2KMAA 2Z8LA 3V6EB 2WDTB 2MSED 1QQRA 4ANUA 5AZHA 1VZ7A 1XLPA 4KDLB 3GZNB 2QJLA 1V2YA 2J4XA 1F0ZA 4HJGE 1EM7A 2Y5BB 1C3TA 3B0AA 3MJWA 1T5XD 3DBLB 4HCNB 3DQVA 3NVYA 5FR6A 2IY0B 3ZQ4A 4WWMA 2TSSA 2KTRA 3TJPA 2LWPA 3DPDA 1JWSD 4CYEA 5JHAA 1E10A 1FXTB 2N9EB 2EELA 1UZXB 4DDID 5EE0A 1N63A 5AZGA 1OTRB 3QJZA 1JQ4A 1J7AA 1YMHE 2IGGA 4JE3B 2KDEB 4BKTA 2WXIA 1PQSA 3JW0X 3U7DA 4E74A 2LHEA 3HVZA 3UQAA 3GOEA 5DPTA 4OZAA 1P7FA 1YX5B 4KVGB 2AEHA 1TGZB 2WDQB 3AH7A 4BOZB 2WS3B 3JSVA 3MFGA 1L0YB 2C7MB 3R7QA 3BVGA 3HRDD 1UD7A 2IJ0A 2KDFB 1F52A 2ZZPB 2N9PC 1HA5A 3TSSA 2DENB 2VZKB 4EZLA 4ACFA 4P1BC 4G11A 3DBHI 3ZW3A 1FXAA 5FKAC 4AWJA 1SSNA 1XCTL 3WAOA 3AE4B 2A4ZA 3FAHA 2MBQA 1RRBA 3AN1A 4LDTB 3RCZA 3AEEB 2JSVX 4OW0A 4LJOB 1OEYA 2O6VB 3BK1A 3V62A 3QQ8B 1Y56A 5AEKB 2RGFA 1SGHA 3ZLZA 2V4IB 2LMCA 4HXDA 1HEZE 4G50A 1SEBD 4B0MA 1N62A 5C3JB 2G4SA 2KDMA 1TKEA 2MHJA 1WFYA 1KOTA 4GDLA 5CHFA 4IOIE 3SEBA 3V61A 2H89B 5AUIA 1ZW7A 1UWMA 1JWBD 1C78A 1JWMD 2QC8A 3EHVA 2ZCCA 3APDA 5G5HA 4A55A 2KFKA 2XK5B 5CX3A 2K25A 3VRAB 5E6OA 3W5UB 3SFDB 1V1PA 1JRUA 5IKCM 1TYGB 2ONQA 4HK2A 2ZEQA 5DPWA 2WXKA 3L0WB 4URKA 1F2RI 1YX6B 4KSKC 2KDBA 4K7SA 2PVOD 4LNKA 1TBEA 2D3GA 4FA6A 2K1FA 3DVGX 2KWCA 1V5TA 4BBNC 2J0KA 3ZTCA 1MFWA 2AL6A 1FEHA 2FUHB 1BUIC 4NZLB 3B08A 3ZJTA 3VVWB 2B76B 4DXAB 4JWUC 1UUPA 4G3XB 4EEWA 3A9KB 5E6NA 1AARA 1E0ZA 5C2TB 1NBFC 1NEKB 3VR8B 1WRDB 2D11A 2IO1B 3PRZA 4MELA 1WWTA 1AW7A 2KWUB 2G4DB 2IYDB 3NRZA 3Q3OC 1FD6A 2KVRA 3RULA 5CHWA 2AWTA 3AMZA 4WQOB 3MJ5A 3UI3A 4EZJA 3RZWC 2MBHA 3ML9A 4ZRPA 2DZIA 2G45B 2H88B 3QWZB 2OJRA 2K0PA 4N6EB 2O2VB 4OZCA 3BYYB 1R4NB 4WWOA 2A5UA 2Y5PA 3RNGC 1UBQA 1WXAA 3V60A 3DDCB 4Q2JA 4WIPA 3RNAC 3EC8A 1SE2A 3UF8A 1TS3A 1NYRA 3H7PB 4RGTA 4ZRJA 2LHDA 3P2BA 2MJEA 3ZNID 2WNMA 1QILA 2D2QA 1Y8RC 3ZXVA 4NPNA 3IAM1 3OJ4B 2WGSA 2REXA 1JMLA 2N7EA 2V9HA 4B95A 3PHWB 3TCAA 4RMAA 1NYQA 2ZW0A 4EKUA 3AE5B 2LEKA 1UNSA 1ZXIA 2IGHA 2WXMA 2BGFA 5BMGA 1WGYA 1V86A 2C9WB 4W9JA 1UWXA 2EMTA 4KIKB 4OVZA 1TJEA 2GBKA 5HI1A 4DHZE 1VD2A 3NY5A 2PKOA 1D5XC 3CSFA 1FNWA 3AULA 2JWZA 4K3CA 4M01A 1ESFA 1XD3B 4NQKE 3T9LA 1E7VA 5AUKA 5EE1A 1E8YA 4P6VF 2PPHA 4HKZE 1VDVA 4B0EA 1SE9A 2MP2A 1YIWA 2G9HD 3L16A 2RPVA 4D2KA 2KFJA 2XNAC 4RM9A 3AU5A 1GG3A 1WXSA 3TEWA 3V05A 3CWIA 4HDOA 2WXHA 2L00B 1WX7A 1V8CA 2NTSA 1YQ4B 5JZEB 1X1MA 5G5GA 4C7YA 4JQWC 2ZCBA 4JLCA 3SU8X 3I5JC 3KUZA 4O1NA 3U2SC 1P1AA 1TKGA 2LFIA 1WF9A 2JWUA 1SJHD 2KX0A 2ACZB 4KZCA 2DLBA 3C0RB 3W9CB 2DHZA 3AXCA 1KLGD 1ZPSA 4CHKA 1JWUD 2BYTA 5CHVC 3SFEB 1WMHA 3A1QA 2JPHA 4NJCA 5D3IB 2KQSA 1ROEA 1WJ6A 2Y5CA 3AI5A 3ML8A 4AJWA 3R7RA 2Q5WD 2B3AA 2NR2A 4RGOS 1L4ZB 3OLMD 1EO6A 1FO4A 4MSQB 2KLCA 1F9JA 1L2NA 4NY0A 1XQQA 2IZVB 2JQRB 1LO5D 5TR5A 4OVUA 4EFOA 3B2FA 4WJOA 4XWTA 4N59A 4GDLB 3A9KA 3WA0A 4G0NB 1LQBA 4XYCA 3APFA 2GLSA 2M1MA 4AOFA 3PLVA 5HG2A 3WAMA 2DWQA 2ZW1A 3WANA 1V1OA 4MGZE 1WY8A 5J17A 1I4PA 3ZGZA 1ENFA 3CSTA 1V1PB 4M8NA 2I1JA 3VRBB 2XN9C 2BYEA 4FHKA 1FXIA 3ECIA 1WJNA 3TEZA 3M62B 5LNK1 4HKQA 1Q1OA 2VRRB 4FLHA 1QF6A 3HK0A 1OQRA 4HROA 3ABVB 1VR9A 2W3RA 3DBSA 2WP9B 4JL9A 1FRDA 1JWAD 2WWZA 4YXDB 3S2AA 1IP9A 2BKRB 4BKGA 4LDTD 2BS4B 1EWYC 1R4MI 4II3B 4I6NB 1FM0D 4ZRIA 2HJ1A 2NBWB 1FCLA 2O6VD 4E71A 4BKSD 3P42A 3ZTDA 1BMLC 4GB9A 2PEAA 2N9KA 4GGQA 3H7PA 3FILB 3SHQA 2K6DB 5KHOA 5KHQA 2HD5B 4IKGA 4M8MA 1FFUA 1XCQL 4FADA 3VH3B 4RM8A 1D5ZC 4ZOHC 3PRMB 4X57B 1IUEA 3QX1A 3B9JA 4K1RB 2KTFA 3VUYA 3WAPA 4RF1A 2N4FA 2KLGA 2PE9A 4B9KA 2XBBC 4F7ZA 3BY4B 4MGIE 3LB8C 1D3ZA 4US8A 2INPE 1J7CA 2BQQA 4BVUC 1XT9B 2FBWB 1WGGA 1NDDA 2KX3A 3NG0A 1DYQA 3KUCB 4XC2A 5L95C 1KLUD 4RH6A 5H92C 4A6QA 5HHDG 3DOWA 5JHBA 4MT5A 2DBYA 3HHMA 2CHWA 3PO0A 2DYBA 5DPRA 2MJDA 2KWVB 1I4QA 2ZJDA 3ALBA 2KC1A 3ENEA 4AQ7A 3BWUD 4KGSA 3A4SC 2BB5A 3P4PB 2KYWA 4K7UA 1J19A 1K50A 2EKEC 3DWMA 3W1SC 2WXLA 2HDEA 3LJ3A 1EF5A 2FIFA 2KJHB 2KNBA 2L83A 4ICUA 4PT5A 2V3NA 3DWGC 2GI9A 2EKIA 2UWQA 3WALA 3QHTA 3R2TA 2KWDA 1DOIA 3UINB 4PK1A 1GAQB 3HM3A 4US9A 2BWFA 1OEYJ 2V3SA 2L0FA 3BVZA 5BO4B 3RNBC 2OOBB 2D07B 4HWIB 3MHSD 1XEEA 1ZKHA 5LLIA 3OJ3A 3JYUA 1HXYD 3KW5B 3PT2B 2VH2A 4BBNF 3RN9C 1SIJA 3RT3B 4ITKA 1IBXA 3VTVA 2MP2B 3ZDTA 4L23A 5IO9A 4A8XC 1CJEA 4MM3B 4DQOC 3W1YA 4USAA 1I4RA 3ZDMC 1WGDA 1ZGUB 1EWCA 1QOFA 3Q3FA 1T0YA 1U4AA 1BT0A 1ZOYB 2RMMA 1YN3A 1V49A 1RM6C 4A90A 1YN5A 2BWES 4J3OD 3AE8B 4QAYA 4WH4A 1FNVA 3UQBA 3MHZA 4P1CC 2QSDA 3QIJA 1E90A 5BYRA 1MPEA 1TZ1A 5G55A 1CQVA 4GXBA 3P1MA 1MG4A 4RNAA 1WZ3A 1GOZA 2LXAA 2WHIA 2XEWA 1C77A 4ICVA 3Q3MC 4OHJA 2NS5A 2D5GA 1WMHB 2IY1B 4MH8A 2AQ2B 4IW0A 4BFRA 1TS4A 3A1QB 3AEFB 2DYOA 2JZPA 1H4RA 3DHGC 1E9MA 2BF8B 4K3BA 4YTNB 1QT9A 1A70A 4C56C 4PYZA 2Z0EB 2D3CA 1ZXHA 3AEBB 3U8ZA 4LNIA 3IXSA 1MI0A 3DVNU 3X0WA 3N32A 4FBJB 3N30A 1I4HA 1R4MB 2N0SB 2IDYA 2J7QB 2YVCA 3Q8EA 3TMPB 1V80A 1K53A 1C4AA 1WJUA 2L32A 4HRSA 4OVVA 1XF5L 5JXVA 1KH0A 3MTNB 1EU4A 3FILA 2ASQA 1UGMA 3MC0B 3IG3A 4PS7A 2KZRA 4WQMA 2CS4A 4EUTA 3TEYA 2K5PA 1GUAB 3EA6A 1VCBA 2LGXA 3RNFC 1QZEA 5J2RA 5TSSA 4ARIA 3X23A 1KLVA 2BTEA 5E6PA 2HTME 2INCC 4MJSA 1E6EB 2KKCA 5EE9A 2N7JA 3FC4A 4RFBA 1LFDA 3ZO5B 5CTRC 3AV8A 5IOIA 3PS6A 2AX5A 1KTKA 2KO3A 4L2YA 4GN1A 1MG8A 1ISNA 4WJNA 3M63B 4WJPA 2FCNA 3RFZB 1CK1A 4ZHPA 5J18A 4I6PA 4UDUC 4WAFA 3P4QB 3QK0A 5EE3A 4J6IA 4NJ6A 1VZ8A 3IAS1 4M00A 2CKHB 2J0JA 2Z0DB 1NVID 2JRHA 4GDKA 1V6EA 4HDQA 5C1ZA 2MBOA 1EUVB 4P7IA 2BPSA 4DHJD 4W9DA 3L08A 1TT5B 4LLGM 3OWEB 1TKYA 2MJ3A 2LJ5A 2GBJA 2I2YA 3A9JA 3N9YC 3EFUA 1AWDA 2JYTA 2C7HA 3BINA 3PZ7A 2ZNVC 1HTQA 2LGSA 3EGRA 3K9OB 1LGRA 3BZDB 5BMIA 2KXJA 3AE6B 1CMXB 3PHXB 2J42A 2BYVE 1FPYA 3NHEB 3HIZA 2D3BA 1WE7A 1YJJA 2KN4A 4LNNA 1CZPA 3N1ZC 2KVZA 2G1EA 3CMMB 2W54A 4KKIA 5H8YE 3B1LX 2W3SA 3GB1A 1V5OA 1FFVA 1S3SG 1UF0A 3N1XC 1J7BA 3WCQA 2IO0B 2J52A 2RDHA 3OAWA 2PMVA 3DBHB 2VH1A 3ZKJC 4W9LA 4ANXA 3N3KB 2AYOB 4FHJA 2E3TA 4M02A 2QEJC 3V6CB 4XDCA 4NAMA 4MM3A 2ZVOA 2K8HA 1MHXA 2DZMA 4S17A 2X38A 3BVMA 4LNOA 4NAWB 2W82A 1KM7A 3LYYA 2BS2B 4ZRQA 1VJKA 3PVLA 2OHFA 1ET9A 2IO3B 2LUEA 2LUMA 5I4DA 1D6EC 1DOXA 2NMQA 3GE3C 4PYUA 4C4VA 4TQ0A 4HEA1 4BKSA 3NVVA 4LJPB 2LVOA 3T3OA 3H8HA 2I1KA 2G3QB 1XLNA 2JRIB 4IG7B 1GPXA 2KMMA 4XE0A 3N1YC 2NCNA 1PGAA 2AL3A 5DCNA 3ZJUA 3WIMA 4IUMB 4YSXB 2KD0A 2WYQA 2UYZB 4AUQC 2OEDA 1YJIA 4JIOU 2WDRB 1TY0A 3IVFA 5IAAC 3RD2A 3VH4B 2WX1A 1IBXB 1XO3A 1N5XA 5AZFA 1DGJA 4TV3A 2FCSA 2PLPA 5D3DA 5C23A 4A3PA 1R7SA 1M4VA 1G6JA 5D2MB 4GU2A 1AYFA 1MJDA 3ZRCA 3QA8A 4IWPA 4MDKE 2JF5A 1TZOA 1UELA 4XZ4A 1ET6A 4XGAB 2FE8A 2J53A 1E7UA 4PS8A 4S0RA 3IBEA 1SF0A 3L17A 1RLFA 1IGCA 3TEXA 4N9F4 1YQ3B 2NBVB 4R3DA 3MP9A 5MPOA 1KRHA 2QILA 3GP7A 4CQNA 1I4XA 4ZHOA 1WIAA 2NBUA 2INDC 4IWQA 2ZVNA 4W9GA 1NENB 2FCMA 2RDBC 2INNE 5BYSA 4LTUA 2GB1A 3URYA 3AE7B 4FN2A 2C7NB 3U7ZA 3BK2A 3O65B 2L7RA 3HVDA 3SR6A 3AECB 2R2OA 3W2DA 2WXOA 2RSUA 4IM3A 2WXJA 2VZKD 2N1VA 3NS1A 1Q0WB 3AEDB 1SE4A 1WZ0A 4EZKA 4HPLB 3MC9A 1Q10A 3KYDD 4TUUA 2X8XX 2JYEA 1YNTE 2CHXA 1P7EA 2K39A 4A20A 2DZKA 5D7GA 4ASWC 1C4PA 2M19A 4YSZB 4AJYB 3N20C 4W9IA 1HZ6A 5HFYA 1JALA 1Z5SB 1RAXA 4W9KA 5BMHA 5IP4D 2BT6A 1WGHA 4MJSB 2PVGC 2V0GA 1B1ZA 2JZ3B 1M94A 1T0SC 1WJ4A 3NUHB 2V1YA 4AS1A 1I4GA 1PYWD 2BYFA 2PW9A 1C79A 1D4BA 1EU3A 4KGTA 1QLBB 3A4RA 1C9FA 1RYJA 4MGYE 4C00A 3PGEA 3P4SB 1N60A 1GB4A 5HKHA 3CF6E 1WYWB 1J8CA 4IM2A 4ANWA 3DVGY 2NTTA 3VFKA 4JGHB 3E9SA 4GDKB 1DOYA 2JT4B 3ZVVA 2ZPNA 2WXPA 2JU6X 2LGYA 3VHTC 2V3PA 4FXCA 1TIFA 1WR6E 1C4CA 1JRPA 3FKYA 3VTWA 3VR9B 4NAWA 3IT6B 2QMTA 3A9JB 2N7DA 2MBEA 2LVPA 4WAAA 2V4LA 2MLBA 3H9DA 4GSWA 3QCAA 3O13A 1BXTA 4YWGG 1VLBA 1KJTA 3DVNV 1I42A 4A3OA 2MH7A 1WX9A 2GBMA 2MA9B 1GNUA 4IM0A 3RPFC 2YLMA 4MSMB 1JW9D 3UIOB 3L4PA 1PGXA 2MWSB 3C19A 3RYTA 2W9NA 1IYFA 3KQ4A 2K8BA 2ICIA 1J0GA 2LGIA 2K9XA 1LXDA 3L10B 2RD0A 2BKFA 4A9AA 3IHPC 4MH0E 2QDFA 4RGNA 2L76A 3UGBB 3VUXA 3NZ3A 1IPGA 2DNFA 2KQ4X 2PIAA 5FR3A 5EDSA 1ZDVA 3RMKC 1ZP0B 2HJ8A 2IBIB 3P63A 2CR5A 4DXFA 1OQQA 3IFWB 1V97A 1F77A 3KYCD 2FUG1 4IC7B 2NPTA 1GC6A 3VQIA 1YD8U 3KWVA 4M0WA 2OJWA 4W9FA 1VRAB 4BOSC 4DBGA 1WX8A 3Q8CA 2N9XA 1V81A 2WXFA 3DBRI 1HQRD 1RFKA 2LGDA 2KMCA 1T3QA 2GBNA 2K8CA 2Z59B 3U4EG 4C4VB 1E5WA 2M56B 3A33B 3QC8B 2HTHA 1IGDA 1E7PB 1WGKA 2D10A 2JVCA 1VZ6A 3OG5A 4LCDE 2L3ZA 4K81A 2KK8A 3I9V1 1I7HA 4P16A 4JX1C 2MCNB 4GIVA 3BIID 4JWSC 4F1SA 5L83A 1WYGA 1B9RA 4I6LB 3AB5A 1K52A 3Q3NC 4GLSC 5D94A 1TS5A 4C7ZA 1S1QB 4DXGA 5LXHA 2KAJA 1WH3A 4YT0B 4HPMB 3R8BA 3ZNGC 2QCZA 1NI3A 2LVQA 2SEBD 5D6JB 2DAFA 1FMAD 3AU4A 3R66C 3VUWA 2DAJA 2LD9A 2WXRA 1WR1A 1Z2MA 4ZRKA 3ZNZB 1D5MC 4L1BA 4YSYB 3I3TB 2QHOA 2M4NA 3MC8A 1A5RA 4TQ1A 2LJIA 1WI0A 5BYQA 2FIDA 1PUTA 3E56A 3ZRFA 2M0XA 3TL5A 2WXNA 3Q8FA 4XDDA 4FJYA 4FJZA 3R3MA 4YL8A 2JX5A 3KLSX 1XLQA 2WDVB 4XWWA 1FRRA 5E6JA 3W1SA 4NQLB 1ZDXA 3NOBA 1HTOA 2LZ6A 2ZNVB 3ZUNA 1L5PA 1PGBA 1YOVB 3PSEB 1LM8B 3PLUA 1I35A 2WXQA 3AE3B 3NZUA 3P4RB 4N58A 3J9CA 1UBIA 2CU3A 3CIRB 2LASA 2K3UA 4DWFA 2GMIC 1P3QU 3Q14C 1K51A 2YEPF 1T0QC 4KZ0A 2BB6A 2MRPA 1YJ1A 3BYTB 3EUB2 3JVZX 3RNEC 3Q3JA 3VDZA 3KWLA 3VAWA 2WXGA 5IA7A 2DYMA 1GB1A 4CO7A 3D32A 3U30A 4XX5A 3AEGB 5T8IA 5GMVA 3ZIMA 3KUDB 2YEPB 1E8ZA 3TIXA 2L0TA 2KQ7A 3H1UA 1FNUA 2KHWB 2FCQA 3VXWA 3NVWA 3PRPB 2WU5B 1EF1A 1N61A 1WE6A 3LDZE 3PZ8A 4JPSA 2W55A 4B6WA 3PPAA 3T8MA 2FAZA 3V3XA 3AE1B 5DPSA 3VTUA 4C80A 4ANVA 3T3NA 2L8JA 4MGKE 1OGWA 2EMSA 1GJZA 2KT7A 2M8SA 1H8CA 3SD5A 3NVZA 4MEMA 2M0AA 4ARCA 3M3JA 4WURA 4KX6B 1WRIA 1T0RC 3PREA 4II2B 2LRUA 2DZJA 2KN5A 4IDIA 1P98A 2N1WA 3EECA 3K9PB 4YTPB 3ZNHB 3EFCA 3Q69A 1KFYB 4H2AA 1SE3A 1L7YA 1XLOA 2KANA 2JY6A 2E6XA 3UIPB 2BVCA 2KDIA 3NJTA 3KVFB 4E3CA 2CJNA 4HJKA 3L54A 2KJ6A 2NVUI 1ACCA 1PFDA 3GZNI 4LK0M 1JCKB 4ZYSA 3ETRA 2BS3B 4REZA 2ON8A 1WXMA 2KOXA 3AM9A 3RUIB 4W9EA 3GS2A
chains in the Genus database with same CATH topology
3WALA 3ONSA 3QHTA 1Q0WB 3VVWB 3UINB 4DXAB 3DBLI 3HM3A 1WZ0A 3HM6X 2BWFA 4G3XB 4EEWA 4EZKA 3A9KB 1P0RA 4HPLB 1AARA 5E6NA 3H6NA 4DHZB 3KYDD 4TUUA 1OEYJ 4WWPA 1NBFC 2V3SA 3SDLC 3TBLD 2L0FA 1WRDB 2KTRB 5BO4B 2D11A 2IO1B 2OOBB 3PRZA 4IWOA 4MELA 4HVBA 2D07B 3DCGA 2CHXA 2K39A 4HWIB 3MHSD 4A20A 1ZKHA 4FULA 5LLIA 2KWUB 3OJ3A 2G4DB 2IYDB 3JYUA 2O6VA 4FJVB 3KW5B 4ZDVA 2DZKA 4AP4C 2KVRA 3RULA 3PT2B 2AWTA 5CHWA 5D7GA 4ASWC 4BBNF 4WQOB 3RT3B 1WM2A 4KDIC 4EZJA 3RZWC 4AJYB 2MBHA 4KSLC 3ML9A 4W9IA 1K8RB 3VTVA 2DZIA 2G45B 2MP2B 3ZDTA 3QAQA 3QWZB 1Z5SB 1RAXA 3L13A 1P9DU 2CU1A 3W1YA 4W9KA 2OJRA 3APCA 2WX0A 2IO2B 3ZDMC 4B9KA 1WGDA 1ZGUB 3PV1A 1WGHA 2O2VB 5LXIB 3RZFA 4MJSB 3Q3FA 1T0YA 1U4AA 4EOYA 1BT0A 1V49A 2JZ3B 3JSVB 4WWOA 1E8WA 1M94A 1WJ4A 2A5UA 2V1YA 1YQBA 1UBQA 2R2QA 1WXAA 3H7SA 2BWES 5G2NA 3DDCB 3V60A 2XK5A 2BYFA 3EC8A 2JXXA 4NJ7A 1WGRA 1GC7A 3PTFC 3UF8A 3A4RA 3UQBA 3H7PB 4ZRJA 2NPTB 3QIJA 3P2BA 1E90A 4MGYE 1TZ1A 4M0WB 5G55A 3PGEA 2J0MA 2CHZA 3ZNID 4GXBA 4DDGD 2D2QA 5HKHA 3CF6E 1OQYA 1WYWB 1Y8RC 1J8CA 4IM2A 4ANWA 5JH5C 3DVGY 1WZ3A 4NPNA 3VFKA 2MQJA 4JGHB 2LXAA 4ICVA 2XEWA 4GDKB 2NS5A 2JT4B 3OJ4B 1WMHB 2IY1B 4BFRA 4IW0A 3ZVVA 2REXA 2ZPNA 3A1QB 2DYOA 2N7EA 1H4RA 2LGYA 4B95A 3VHTC 1E8XA 3PHWB 3TCAA 4RMAA 1WR6E 4EKUA 2LRWA 4DHJB 1SIFA 2BF8B 2RR9A 3VTWA 4NAWA 2BGFA 4PYZA 3A9JB 2Z0EB 1WGYA 1V86A 2MBEA 2N7DA 2LVPA 2KC2A 4WAAA 2C9WB 3U8ZA 4W9JA 2EMTA 2V4LA 4KIKB 2GBKA 2MLBA 3H9DA 4GSWA 3QCAA 1NI2A 2LXCA 2GOWA 4DHZE 1VD2A 3NY5A 4ZYNA 1KJTA 3DVNV 2KJRA 4PS3A 1I42A 3DVNU 3X0WA 4A3OA 3N32A 3CSFA 4FBJB 3AULA 3N30A 1WX9A 2JWZA 1Q5WB 3M95A 2J7QB 2KFKB 2YVCA 3TMPB 1V80A 1XD3B 4NQKE 1WJUA 3T9LA 2GBMA 1E7VA 2MA9B 4OVVA 1GNUA 2C60A 4IM0A 1E8YA 2YLMA 3MTNB 4MSMB 4HLEA 2ASQA 1UGMA 3UIOB 2PPHA 3IG3A 4PS7A 2JZZA 2KZRA 3KH0A 2CS4A 1RFAA 4EUTA 1SE9A 2MP2A 2MWSB 1YIWA 3RYTA 2W9NA 3NS8A 1IYFA 1GUAB 3NZSA 2K8BA 1VCBA 1V9JA 2LGXA 3L16A 1QZEA 3QARA 4GMVA 1J0GA 5J2RA 2K6QA 4GOCA 2KFJA 4RM9A 2MX2A 2O2VA 3AU5A 1GG3A 1WXSA 3X23A 2ZPYA 1KLVA 5E6PA 4MJSA 2KKCA 1LXDA 3L10B 4DK5A 4HDOA 2RD0A 1LFDA 2BKFA 2C5LC 2L00B 2L05A 2M17A 5CTRC 3ZO5B 3IHPC 4MH0E 1WX7A 3PS6A 2L76A 3UGBB 3VUXA 1IPGA 5JZEB 1X1MA 4W9HA 2KO3A 4GN1A 1MG8A 1ISNA 4WJQA 4JQWC 5EDSA 4WJNA 2ZCBA 3M63B 4WJPA 2HJ8A 2IBIB 2HE7A 2CR5A 4JLCA 3SU8X 2FCNA 3IFWB 3KUZA 2DX5B 3PZDA 1UH6A 2GBRA 3KYCD 4KV2A 1P1AA 4IC7B 4I6PA 2MBBB 5J18A 1WF9A 3QK0A 2PJHA 2JUOA 2NPTA 1GC6A 4J6IA 3VQIA 1YD8U 4HCPB 1TTNA 2KX0A 4NJ6A 4KZCA 3C0RB 4W9FA 2PE6B 4BOSC 4DBGA 1WX8A 2LI5A 2CKHB 2J0JA 2DHZA 2N9XA 2Z0DB 1V81A 3AXCA 3DBRI 2LGDA 4CHKA 2KMCA 2GBNA 2K8CA 2Z59B 5CHVC 2JRHA 1WXVA 1E5WA 4GDKA 1V6EA 3A33B 3QC8B 2HTHA 1WMHA 4WWNA 3A1QA 2JPHA 2D10A 2JVCA 4HDQA 5C1ZA 2KQSA 2MBOA 1EUVB 1WM3A 4NNJB 1WJ6A 4LCDE 1C1YB 4P7IA 2BPSA 4DHJD 2L3ZA 4W9DA 3L08A 2FNJB 4K81A 2KK8A 2LJ5A 3AI5A 2MW5A 2GBJA 3ML8A 4AJWA 1HE8A 4K7WA 3R7RA 3A9JA 1R4NI 2B3AA 2NR2A 3EFUA 2MCNB 4KIKA 4TKNA 2RPQA 3OLMD 1EO6A 2C7HA 4GIVA 3BINA 4MSQB 4W9CA 2KLCA 4F8CB 1F9JA 2KMAA 2ZNVC 3V6EB 2WDTB 2MSED 4ANUA 5AZHA 4F1SA 3K9OB 5L83A 4KDLB 4I6LB 1V2YA 2KXJA 1L2NA 1CMXB 3PHXB 4NY0A 5D94A 1XQQA 2IZVB 2BYVE 5TR5A 3NHEB 1S1QB 3HIZA 4OVUA 2Y5BB 1WE7A 5LXHA 4EFOA 1C3TA 3B0AA 1WH3A 3MJWA 4WJOA 4GDLB 4HCNB 3A9KA 3DQVA 4HPMB 3WA0A 3ZNGC 5FR6A 2LVQA 3CMMB 4G0NB 2IY0B 1LQBA 3APFA 5D6JB 2DAFA 3AU4A 2M1MA 3R66C 2KTRA 3PLVA 3VUWA 4AOFA 2DAJA 3TJPA 2LD9A 3WAMA 2LWPA 3B1LX 3DPDA 1WR1A 1Z2MA 3WANA 4ZRKA 4CYEA 3ZNZB 5JHAA 1V5OA 1S3SG 1WY8A 4MGZE 5J17A 1FXTB 3I3TB 2QHOA 2IO0B 2M4NA 2N9EB 3CSTA 1A5RA 1UZXB 4M8NA 3OAWA 4TQ1A 4DDID 2I1JA 5AZGA 1WI0A 1OTRB 3QJZA 2FIDA 3ZKJC 2BYEA 4FHKA 3N3KB 4W9LA 4ANXA 2AYOB 4FHJA 3ECIA 2KDEB 2M0XA 3ZRFA 3TL5A 4BKTA 1WJNA 3V6CB 1PQSA 3JW0X 4FJYA 4FJZA 3U7DA 4E74A 3M62B 4MM3A 3UQAA 2ZVOA 3GOEA 5DPTA 3R3MA 1YX5B 2K8HA 1Q1OA 2VRRB 4FLHA 4KVGB 2AEHA 4YL8A 2DZMA 3HK0A 1TGZB 4NAWB 3W1SA 4BOZB 3DBSA 3JSVA 1KM7A 4NQLB 4JL9A 3NOBA 3PVLA 2WWZA 2C7MB 3R7QA 3S2AA 1IP9A 2LZ6A 1UD7A 2BKRB 2ZNVB 4BKGA 2IO3B 3ZUNA 2KDFB 2ZZPB 4LDTD 2N9PC 2LUEA 1R4MI 4II3B 3PSEB 1LM8B 3PLUA 4I6NB 2DENB 1I35A 3NZUA 4ZRIA 4EZLA 2NBWB 2O6VD 4E71A 4PYUA 1UBIA 4BKSD 3ZTDA 2LASA 4G11A 3DBHI 4TQ0A 4BKSA 4GB9A 2PEAA 4LJPB 2LVOA 4DWFA 4GGQA 3H7PA 2I1KA 2G3QB 2GMIC 2JRIB 3ZW3A 1P3QU 3SHQA 4IG7B 2K6DB 5KHOA 5KHQA 4AWJA 4KZ0A 2HD5B 2NCNA 2AL3A 3WAOA 5DCNA 2MRPA 1YJ1A 3JVZX 2A4ZA 4M8MA 4FADA 2MBQA 1RRBA 3Q3JA 4LDTB 3RCZA 3VAWA 3VDZA 3VH3B 3WIMA 4IUMB 4RM8A 2KD0A 2WYQA 2UYZB 3PRMB 4X57B 4LJOB 2DYMA 5IA7A 3QX1A 4CO7A 3D32A 4AUQC 1OEYA 3U30A 2O6VB 4K1RB 2KTFA 4XX5A 3VUYA 3V62A 3QQ8B 4JIOU 3WAPA 5AEKB 2N4FA 2KLGA 2PE9A 3IVFA 5IAAC 2XBBC 2RGFA 2WX1A 5GMVA 3RD2A 1SGHA 3VH4B 3ZIMA 4F7ZA 3KUDB 3BY4B 4MGIE 4HXDA 3ZLZA 1D3ZA 5AZFA 4TV3A 4G50A 2FCSA 1E8ZA 3TIXA 2L0TA 2KQ7A 5C23A 4A3PA 3H1UA 1G6JA 2KHWB 5D2MB 4GU2A 4BVUC 1XT9B 1WGGA 1NDDA 2KX3A 2FCQA 3VXWA 2G4SA 3PRPB 3ZRCA 3KUCB 1EF1A 3QA8A 4IWPA 1WFYA 4XC2A 1WE6A 3LDZE 4MDKE 4GDLA 5CHFA 5L95C 1KOTA 3V61A 2JF5A 1ZW7A 4B6WA 3PPAA 3T8MA 2FAZA 1UELA 4XZ4A 3DOWA 5JHBA 3HHMA 5DPSA 1E7UA 3EHVA 2CHWA 4PS8A 2ZCCA 3APDA 3VTUA 4ANVA 3IBEA 2DYBA 2L8JA 4MGKE 1OGWA 2EMSA 2KFKA 3L17A 5DPRA 2XK5B 1RLFA 2KWVB 2M8SA 5CX3A 1GJZA 2K25A 1H8CA 3SD5A 5E6OA 4MEMA 3M3JA 4N9F4 2ZJDA 1JRUA 3PREA 4II2B 2LRUA 3ALBA 2KC1A 2NBVB 3ENEA 2DZJA 2KN5A 1P98A 2N1WA 3EECA 3K9PB 4HK2A 2ZEQA 5DPWA 3ZNHB 3A4SC 3L0WB 4URKA 1WIAA 2NBUA 1YX6B 4K7UA 4KSKC 4IWQA 1L7YA 2KANA 2KDBA 2ZVNA 4K7SA 1J19A 2JY6A 4W9GA 2FCMA 2EKEC 1TBEA 2D3GA 4FA6A 3UIPB 2K1FA 4FN2A 2KDIA 3W1SC 3DVGX 2C7NB 3KVFB 4E3CA 2KWCA 3O65B 2L7RA 1V5TA 3LJ3A 1EF5A 4BBNC 4HJKA 2J0KA 3L54A 2R2OA 2KJ6A 2FIFA 2NVUI 2KJHB 2KNBA 3ZTCA 2RSUA 4IM3A 3GZNI 4ICUA 2AL6A 1WXMA 2FUHB 2KOXA 2N1VA 3RUIB 4W9EA 3B08A 2UWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAL A;  3ONS A;  3QHT A;  1Q0W B;  3VVW B;  3UIN B;  4DXA B;  3DBL I;  3HM3 A;  1WZ0 A;  3HM6 X;  2BWF A;  4G3X B;  4EEW A;  4EZK A;  3A9K B;  1P0R A;  4HPL B;  1AAR A;  5E6N A;  3H6N A;  4DHZ B;  3KYD D;  4TUU A;  1OEY J;  4WWP A;  1NBF C;  2V3S A;  3SDL C;  3TBL D;  2L0F A;  1WRD B;  2KTR B;  5BO4 B;  2D11 A;  2IO1 B;  2OOB B;  3PRZ A;  4IWO A;  4MEL A;  4HVB A;  2D07 B;  3DCG A;  2CHX A;  2K39 A;  4HWI B;  3MHS D;  4A20 A;  1ZKH A;  4FUL A;  5LLI A;  2KWU B;  3OJ3 A;  2G4D B;  2IYD B;  3JYU A;  2O6V A;  4FJV B;  3KW5 B;  4ZDV A;  2DZK A;  4AP4 C;  2KVR A;  3RUL A;  3PT2 B;  2AWT A;  5CHW A;  5D7G A;  4ASW C;  4BBN F;  4WQO B;  3RT3 B;  1WM2 A;  4KDI C;  4EZJ A;  3RZW C;  4AJY B;  2MBH A;  4KSL C;  3ML9 A;  4W9I A;  1K8R B;  3VTV A;  2DZI A;  2G45 B;  2MP2 B;  3ZDT A;  3QAQ A;  3QWZ B;  1Z5S B;  1RAX A;  3L13 A;  1P9D U;  2CU1 A;  3W1Y A;  4W9K A;  2OJR A;  3APC A;  2WX0 A;  2IO2 B;  3ZDM C;  4B9K A;  1WGD A;  1ZGU B;  3PV1 A;  1WGH A;  2O2V B;  5LXI B;  3RZF A;  4MJS B;  3Q3F A;  1T0Y A;  1U4A A;  4EOY A;  1BT0 A;  1V49 A;  2JZ3 B;  3JSV B;  4WWO A;  1E8W A;  1M94 A;  1WJ4 A;  2A5U A;  2V1Y A;  1YQB A;  1UBQ A;  2R2Q A;  1WXA A;  3H7S A;  2BWE S;  5G2N A;  3DDC B;  3V60 A;  2XK5 A;  2BYF A;  3EC8 A;  2JXX A;  4NJ7 A;  1WGR A;  1GC7 A;  3PTF C;  3UF8 A;  3A4R A;  3UQB A;  3H7P B;  4ZRJ A;  2NPT B;  3QIJ A;  3P2B A;  1E90 A;  4MGY E;  1TZ1 A;  4M0W B;  5G55 A;  3PGE A;  2J0M A;  2CHZ A;  3ZNI D;  4GXB A;  4DDG D;  2D2Q A;  5HKH A;  3CF6 E;  1OQY A;  1WYW B;  1Y8R C;  1J8C A;  4IM2 A;  4ANW A;  5JH5 C;  3DVG Y;  1WZ3 A;  4NPN A;  3VFK A;  2MQJ A;  4JGH B;  2LXA A;  4ICV A;  2XEW A;  4GDK B;  2NS5 A;  2JT4 B;  3OJ4 B;  1WMH B;  2IY1 B;  4BFR A;  4IW0 A;  3ZVV A;  2REX A;  2ZPN A;  3A1Q B;  2DYO A;  2N7E A;  1H4R A;  2LGY A;  4B95 A;  3VHT C;  1E8X A;  3PHW B;  3TCA A;  4RMA A;  1WR6 E;  4EKU A;  2LRW A;  4DHJ B;  1SIF A;  2BF8 B;  2RR9 A;  3VTW A;  4NAW A;  2BGF A;  4PYZ A;  3A9J B;  2Z0E B;  1WGY A;  1V86 A;  2MBE A;  2N7D A;  2LVP A;  2KC2 A;  4WAA A;  2C9W B;  3U8Z A;  4W9J A;  2EMT A;  2V4L A;  4KIK B;  2GBK A;  2MLB A;  3H9D A;  4GSW A;  3QCA A;  1NI2 A;  2LXC A;  2GOW A;  4DHZ E;  1VD2 A;  3NY5 A;  4ZYN A;  1KJT A;  3DVN V;  2KJR A;  4PS3 A;  1I42 A;  3DVN U;  3X0W A;  4A3O A;  3N32 A;  3CSF A;  4FBJ B;  3AUL A;  3N30 A;  1WX9 A;  2JWZ A;  1Q5W B;  3M95 A;  2J7Q B;  2KFK B;  2YVC A;  3TMP B;  1V80 A;  1XD3 B;  4NQK E;  1WJU A;  3T9L A;  2GBM A;  1E7V A;  2MA9 B;  4OVV A;  1GNU A;  2C60 A;  4IM0 A;  1E8Y A;  2YLM A;  3MTN B;  4MSM B;  4HLE A;  2ASQ A;  1UGM A;  3UIO B;  2PPH A;  3IG3 A;  4PS7 A;  2JZZ A;  2KZR A;  3KH0 A;  2CS4 A;  1RFA A;  4EUT A;  1SE9 A;  2MP2 A;  2MWS B;  1YIW A;  3RYT A;  2W9N A;  3NS8 A;  1IYF A;  1GUA B;  3NZS A;  2K8B A;  1VCB A;  1V9J A;  2LGX A;  3L16 A;  1QZE A;  3QAR A;  4GMV A;  1J0G A;  5J2R A;  2K6Q A;  4GOC A;  2KFJ A;  4RM9 A;  2MX2 A;  2O2V A;  3AU5 A;  1GG3 A;  1WXS A;  3X23 A;  2ZPY A;  1KLV A;  5E6P A;  4MJS A;  2KKC A;  1LXD A;  3L10 B;  4DK5 A;  4HDO A;  2RD0 A;  1LFD A;  2BKF A;  2C5L C;  2L00 B;  2L05 A;  2M17 A;  5CTR C;  3ZO5 B;  3IHP C;  4MH0 E;  1WX7 A;  3PS6 A;  2L76 A;  3UGB B;  3VUX A;  1IPG A;  5JZE B;  1X1M A;  4W9H A;  2KO3 A;  4GN1 A;  1MG8 A;  1ISN A;  4WJQ A;  4JQW C;  5EDS A;  4WJN A;  2ZCB A;  3M63 B;  4WJP A;  2HJ8 A;  2IBI B;  2HE7 A;  2CR5 A;  4JLC A;  3SU8 X;  2FCN A;  3IFW B;  3KUZ A;  2DX5 B;  3PZD A;  1UH6 A;  2GBR A;  3KYC D;  4KV2 A;  1P1A A;  4IC7 B;  4I6P A;  2MBB B;  5J18 A;  1WF9 A;  3QK0 A;  2PJH A;  2JUO A;  2NPT A;  1GC6 A;  4J6I A;  3VQI A;  1YD8 U;  4HCP B;  1TTN A;  2KX0 A;  4NJ6 A;  4KZC A;  3C0R B;  4W9F A;  2PE6 B;  4BOS C;  4DBG A;  1WX8 A;  2LI5 A;  2CKH B;  2J0J A;  2DHZ A;  2N9X A;  2Z0D B;  1V81 A;  3AXC A;  3DBR I;  2LGD A;  4CHK A;  2KMC A;  2GBN A;  2K8C A;  2Z59 B;  5CHV C;  2JRH A;  1WXV A;  1E5W A;  4GDK A;  1V6E A;  3A33 B;  3QC8 B;  2HTH A;  1WMH A;  4WWN A;  3A1Q A;  2JPH A;  2D10 A;  2JVC A;  4HDQ A;  5C1Z A;  2KQS A;  2MBO A;  1EUV B;  1WM3 A;  4NNJ B;  1WJ6 A;  4LCD E;  1C1Y B;  4P7I A;  2BPS A;  4DHJ D;  2L3Z A;  4W9D A;  3L08 A;  2FNJ B;  4K81 A;  2KK8 A;  2LJ5 A;  3AI5 A;  2MW5 A;  2GBJ A;  3ML8 A;  4AJW A;  1HE8 A;  4K7W A;  3R7R A;  3A9J A;  1R4N I;  2B3A A;  2NR2 A;  3EFU A;  2MCN B;  4KIK A;  4TKN A;  2RPQ A;  3OLM D;  1EO6 A;  2C7H A;  4GIV A;  3BIN A;  4MSQ B;  4W9C A;  2KLC A;  4F8C B;  1F9J A;  2KMA A;  2ZNV C;  3V6E B;  2WDT B;  2MSE D;  4ANU A;  5AZH A;  4F1S A;  3K9O B;  5L83 A;  4KDL B;  4I6L B;  1V2Y A;  2KXJ A;  1L2N A;  1CMX B;  3PHX B;  4NY0 A;  5D94 A;  1XQQ A;  2IZV B;  2BYV E;  5TR5 A;  3NHE B;  1S1Q B;  3HIZ A;  4OVU A;  2Y5B B;  1WE7 A;  5LXH A;  4EFO A;  1C3T A;  3B0A A;  1WH3 A;  3MJW A;  4WJO A;  4GDL B;  4HCN B;  3A9K A;  3DQV A;  4HPM B;  3WA0 A;  3ZNG C;  5FR6 A;  2LVQ A;  3CMM B;  4G0N B;  2IY0 B;  1LQB A;  3APF A;  5D6J B;  2DAF A;  3AU4 A;  2M1M A;  3R66 C;  2KTR A;  3PLV A;  3VUW A;  4AOF A;  2DAJ A;  3TJP A;  2LD9 A;  3WAM A;  2LWP A;  3B1L X;  3DPD A;  1WR1 A;  1Z2M A;  3WAN A;  4ZRK A;  4CYE A;  3ZNZ B;  5JHA A;  1V5O A;  1S3S G;  1WY8 A;  4MGZ E;  5J17 A;  1FXT B;  3I3T B;  2QHO A;  2IO0 B;  2M4N A;  2N9E B;  3CST A;  1A5R A;  1UZX B;  4M8N A;  3OAW A;  4TQ1 A;  4DDI D;  2I1J A;  5AZG A;  1WI0 A;  1OTR B;  3QJZ A;  2FID A;  3ZKJ C;  2BYE A;  4FHK A;  3N3K B;  4W9L A;  4ANX A;  2AYO B;  4FHJ A;  3ECI A;  2KDE B;  2M0X A;  3ZRF A;  3TL5 A;  4BKT A;  1WJN A;  3V6C B;  1PQS A;  3JW0 X;  4FJY A;  4FJZ A;  3U7D A;  4E74 A;  3M62 B;  4MM3 A;  3UQA A;  2ZVO A;  3GOE A;  5DPT A;  3R3M A;  1YX5 B;  2K8H A;  1Q1O A;  2VRR B;  4FLH A;  4KVG B;  2AEH A;  4YL8 A;  2DZM A;  3HK0 A;  1TGZ B;  4NAW B;  3W1S A;  4BOZ B;  3DBS A;  3JSV A;  1KM7 A;  4NQL B;  4JL9 A;  3NOB A;  3PVL A;  2WWZ A;  2C7M B;  3R7Q A;  3S2A A;  1IP9 A;  2LZ6 A;  1UD7 A;  2BKR B;  2ZNV B;  4BKG A;  2IO3 B;  3ZUN A;  2KDF B;  2ZZP B;  4LDT D;  2N9P C;  2LUE A;  1R4M I;  4II3 B;  3PSE B;  1LM8 B;  3PLU A;  4I6N B;  2DEN B;  1I35 A;  3NZU A;  4ZRI A;  4EZL A;  2NBW B;  2O6V D;  4E71 A;  4PYU A;  1UBI A;  4BKS D;  3ZTD A;  2LAS A;  4G11 A;  3DBH I;  4TQ0 A;  4BKS A;  4GB9 A;  2PEA A;  4LJP B;  2LVO A;  4DWF A;  4GGQ A;  3H7P A;  2I1K A;  2G3Q B;  2GMI C;  2JRI B;  3ZW3 A;  1P3Q U;  3SHQ A;  4IG7 B;  2K6D B;  5KHO A;  5KHQ A;  4AWJ A;  4KZ0 A;  2HD5 B;  2NCN A;  2AL3 A;  3WAO A;  5DCN A;  2MRP A;  1YJ1 A;  3JVZ X;  2A4Z A;  4M8M A;  4FAD A;  2MBQ A;  1RRB A;  3Q3J A;  4LDT B;  3RCZ A;  3VAW A;  3VDZ A;  3VH3 B;  3WIM A;  4IUM B;  4RM8 A;  2KD0 A;  2WYQ A;  2UYZ B;  3PRM B;  4X57 B;  4LJO B;  2DYM A;  5IA7 A;  3QX1 A;  4CO7 A;  3D32 A;  4AUQ C;  1OEY A;  3U30 A;  2O6V B;  4K1R B;  2KTF A;  4XX5 A;  3VUY A;  3V62 A;  3QQ8 B;  4JIO U;  3WAP A;  5AEK B;  2N4F A;  2KLG A;  2PE9 A;  3IVF A;  5IAA C;  2XBB C;  2RGF A;  2WX1 A;  5GMV A;  3RD2 A;  1SGH A;  3VH4 B;  3ZIM A;  4F7Z A;  3KUD B;  3BY4 B;  4MGI E;  4HXD A;  3ZLZ A;  1D3Z A;  5AZF A;  4TV3 A;  4G50 A;  2FCS A;  1E8Z A;  3TIX A;  2L0T A;  2KQ7 A;  5C23 A;  4A3P A;  3H1U A;  1G6J A;  2KHW B;  5D2M B;  4GU2 A;  4BVU C;  1XT9 B;  1WGG A;  1NDD A;  2KX3 A;  2FCQ A;  3VXW A;  2G4S A;  3PRP B;  3ZRC A;  3KUC B;  1EF1 A;  3QA8 A;  4IWP A;  1WFY A;  4XC2 A;  1WE6 A;  3LDZ E;  4MDK E;  4GDL A;  5CHF A;  5L95 C;  1KOT A;  3V61 A;  2JF5 A;  1ZW7 A;  4B6W A;  3PPA A;  3T8M A;  2FAZ A;  1UEL A;  4XZ4 A;  3DOW A;  5JHB A;  3HHM A;  5DPS A;  1E7U A;  3EHV A;  2CHW A;  4PS8 A;  2ZCC A;  3APD A;  3VTU A;  4ANV A;  3IBE A;  2DYB A;  2L8J A;  4MGK E;  1OGW A;  2EMS A;  2KFK A;  3L17 A;  5DPR A;  2XK5 B;  1RLF A;  2KWV B;  2M8S A;  5CX3 A;  1GJZ A;  2K25 A;  1H8C A;  3SD5 A;  5E6O A;  4MEM A;  3M3J A;  4N9F 4;  2ZJD A;  1JRU A;  3PRE A;  4II2 B;  2LRU A;  3ALB A;  2KC1 A;  2NBV B;  3ENE A;  2DZJ A;  2KN5 A;  1P98 A;  2N1W A;  3EEC A;  3K9P B;  4HK2 A;  2ZEQ A;  5DPW A;  3ZNH B;  3A4S C;  3L0W B;  4URK A;  1WIA A;  2NBU A;  1YX6 B;  4K7U A;  4KSK C;  4IWQ A;  1L7Y A;  2KAN A;  2KDB A;  2ZVN A;  4K7S A;  1J19 A;  2JY6 A;  4W9G A;  2FCM A;  2EKE C;  1TBE A;  2D3G A;  4FA6 A;  3UIP B;  2K1F A;  4FN2 A;  2KDI A;  3W1S C;  3DVG X;  2C7N B;  3KVF B;  4E3C A;  2KWC A;  3O65 B;  2L7R A;  1V5T A;  3LJ3 A;  1EF5 A;  4BBN C;  4HJK A;  2J0K A;  3L54 A;  2R2O A;  2KJ6 A;  2FIF A;  2NVU I;  2KJH B;  2KNB A;  3ZTC A;  2RSU A;  4IM3 A;  3GZN I;  4ICU A;  2AL6 A;  1WXM A;  2FUH B;  2KOX A;  2N1V A;  3RUI B;  4W9E A;  3B08 A;  2UWQ A; 
#chains in the Genus database with same CATH topology
 3ONS A;  3TUO A;  1TY2 A;  1JRO A;  2UU7 A;  3DBL I;  3HM6 X;  3AE2 B;  4RGM A;  1P0R A;  2BW2 A;  5IN7 A;  3H6N A;  4DHZ B;  4WWP A;  1L0X B;  1MHH E;  3SDL C;  3TBL D;  2L52 A;  2KTR B;  4OZB A;  3ZYY X;  1SB3 C;  4IWO A;  4HVB A;  4KGR A;  3DCG A;  3DBR B;  4FUL A;  4FJV B;  2O6V A;  4ZDV A;  4AP4 C;  1N6Z A;  1WM2 A;  4KDI C;  4KSL C;  1K8R B;  3QAQ A;  3L13 A;  1P9D U;  2CU1 A;  1QOA A;  3APC A;  2WX0 A;  2IO2 B;  3PV1 A;  5LXI B;  1AN8 A;  1YN4 A;  3Q6B A;  3RZF A;  4EOY A;  1QOB A;  3JSV B;  4KKJ A;  1E8W A;  1L4D B;  1YQB A;  2RDG A;  4TMA B;  2R2Q A;  3LXF A;  3H7S A;  5G2N A;  2XK5 A;  2AQ1 B;  1FCC C;  2CJO A;  2JXX A;  3Q8A A;  4NJ7 A;  2QIE B;  1KF6 B;  1PDX A;  1WGR A;  1GC7 A;  1F1H A;  3PTF C;  1SJE D;  1FIQ A;  4RF0 A;  2NPT B;  2Y3A A;  4M0W B;  2J0M A;  4TSS A;  2CHZ A;  2L1A A;  4DDG D;  3W5V B;  1OQY A;  1QOG A;  5JH5 C;  2JXT A;  2MQJ A;  4BZA A;  3B2G A;  3R2I A;  1E8X A;  5FK9 C;  3I57 A;  2LRW A;  4DHJ B;  2K22 A;  3Q8B A;  1OFF A;  1SIF A;  1TS2 A;  2RR9 A;  4EE2 A;  1T6B X;  1C76 A;  1MVK A;  2KC2 A;  4RCO A;  4BAX A;  1ZE3 D;  1NI2 A;  2LXC A;  2GOW A;  4ZYN A;  2KJR A;  4PS3 A;  2WLB A;  2D3A A;  3GE8 C;  1Q5W B;  3M95 A;  2KFK B;  2I38 A;  3AEA B;  2C60 A;  1L0V B;  4HLE A;  4HPP A;  2JZZ A;  3KH0 A;  1RFA A;  3NS8 A;  1UGJ A;  3NZS A;  1F2R C;  1V9J A;  3QAR A;  4GMV A;  3C8Y A;  2K6Q A;  3HUI A;  4GOC A;  2MX2 A;  2O2V A;  2SAK A;  3ZJV A;  2ZPY A;  5GXG B;  4DK5 A;  1ZUD 2;  3U52 E;  2C5L C;  2L05 A;  2M17 A;  1RWS A;  1STE A;  1SBB B;  4MAC A;  1WXQ A;  4W9H A;  3DHI C;  2AQ3 B;  4WJQ A;  3IT4 B;  4LNF A;  2HE7 A;  3RI7 C;  2DX5 B;  2KAC A;  3PZD A;  1UH6 A;  2GBR A;  4KV2 A;  2MBB B;  2PJH A;  2JUO A;  2WU2 B;  2WQY B;  4HCP B;  1TTN A;  3RNC C;  2R61 A;  2PE6 B;  1L6U A;  2N9L A;  3DHH C;  1WSP A;  2LI5 A;  3AE9 B;  2BBC A;  1QKZ A;  2GRI A;  3Q2A C;  1WXV A;  1L6V A;  1HZ5 A;  2MEK A;  3I63 C;  4WWN A;  2IPK D;  1WM3 A;  4NNJ B;  1SXT A;  1C1Y B;  2PTL A;  2IGD A;  4YTM B;  1N5W A;  2FNJ B;  3ZXR A;  2MW5 A;  1HE8 A;  4K7W A;  1R4N I;  1XXG A;  4KIK A;  4TKN A;  2RPQ A;  4F8C B;  4W9C A;  2KMA A;  2Z8L A;  3V6E B;  2WDT B;  2MSE D;  1QQR A;  4ANU A;  5AZH A;  1VZ7 A;  1XLP A;  4KDL B;  3GZN B;  2QJL A;  1V2Y A;  2J4X A;  1F0Z A;  4HJG E;  1EM7 A;  2Y5B B;  1C3T A;  3B0A A;  3MJW A;  1T5X D;  3DBL B;  4HCN B;  3DQV A;  3NVY A;  5FR6 A;  2IY0 B;  3ZQ4 A;  4WWM A;  2TSS A;  2KTR A;  3TJP A;  2LWP A;  3DPD A;  1JWS D;  4CYE A;  5JHA A;  1E10 A;  1FXT B;  2N9E B;  2EEL A;  1UZX B;  4DDI D;  5EE0 A;  1N63 A;  5AZG A;  1OTR B;  3QJZ A;  1JQ4 A;  1J7A A;  1YMH E;  2IGG A;  4JE3 B;  2KDE B;  4BKT A;  2WXI A;  1PQS A;  3JW0 X;  3U7D A;  4E74 A;  2LHE A;  3HVZ A;  3UQA A;  3GOE A;  5DPT A;  4OZA A;  1P7F A;  1YX5 B;  4KVG B;  2AEH A;  1TGZ B;  2WDQ B;  3AH7 A;  4BOZ B;  2WS3 B;  3JSV A;  3MFG A;  1L0Y B;  2C7M B;  3R7Q A;  3BVG A;  3HRD D;  1UD7 A;  2IJ0 A;  2KDF B;  1F52 A;  2ZZP B;  2N9P C;  1HA5 A;  3TSS A;  2DEN B;  2VZK B;  4EZL A;  4ACF A;  4P1B C;  4G11 A;  3DBH I;  3ZW3 A;  1FXA A;  5FKA C;  4AWJ A;  1SSN A;  1XCT L;  3WAO A;  3AE4 B;  2A4Z A;  3FAH A;  2MBQ A;  1RRB A;  3AN1 A;  4LDT B;  3RCZ A;  3AEE B;  2JSV X;  4OW0 A;  4LJO B;  1OEY A;  2O6V B;  3BK1 A;  3V62 A;  3QQ8 B;  1Y56 A;  5AEK B;  2RGF A;  1SGH A;  3ZLZ A;  2V4I B;  2LMC A;  4HXD A;  1HEZ E;  4G50 A;  1SEB D;  4B0M A;  1N62 A;  5C3J B;  2G4S A;  2KDM A;  1TKE A;  2MHJ A;  1WFY A;  1KOT A;  4GDL A;  5CHF A;  4IOI E;  3SEB A;  3V61 A;  2H89 B;  5AUI A;  1ZW7 A;  1UWM A;  1JWB D;  1C78 A;  1JWM D;  2QC8 A;  3EHV A;  2ZCC A;  3APD A;  5G5H A;  4A55 A;  2KFK A;  2XK5 B;  5CX3 A;  2K25 A;  3VRA B;  5E6O A;  3W5U B;  3SFD B;  1V1P A;  1JRU A;  5IKC M;  1TYG B;  2ONQ A;  4HK2 A;  2ZEQ A;  5DPW A;  2WXK A;  3L0W B;  4URK A;  1F2R I;  1YX6 B;  4KSK C;  2KDB A;  4K7S A;  2PVO D;  4LNK A;  1TBE A;  2D3G A;  4FA6 A;  2K1F A;  3DVG X;  2KWC A;  1V5T A;  4BBN C;  2J0K A;  3ZTC A;  1MFW A;  2AL6 A;  1FEH A;  2FUH B;  1BUI C;  4NZL B;  3B08 A;  3ZJT A;  3VVW B;  2B76 B;  4DXA B;  4JWU C;  1UUP A;  4G3X B;  4EEW A;  3A9K B;  5E6N A;  1AAR A;  1E0Z A;  5C2T B;  1NBF C;  1NEK B;  3VR8 B;  1WRD B;  2D11 A;  2IO1 B;  3PRZ A;  4MEL A;  1WWT A;  1AW7 A;  2KWU B;  2G4D B;  2IYD B;  3NRZ A;  3Q3O C;  1FD6 A;  2KVR A;  3RUL A;  5CHW A;  2AWT A;  3AMZ A;  4WQO B;  3MJ5 A;  3UI3 A;  4EZJ A;  3RZW C;  2MBH A;  3ML9 A;  4ZRP A;  2DZI A;  2G45 B;  2H88 B;  3QWZ B;  2OJR A;  2K0P A;  4N6E B;  2O2V B;  4OZC A;  3BYY B;  1R4N B;  4WWO A;  2A5U A;  2Y5P A;  3RNG C;  1UBQ A;  1WXA A;  3V60 A;  3DDC B;  4Q2J A;  4WIP A;  3RNA C;  3EC8 A;  1SE2 A;  3UF8 A;  1TS3 A;  1NYR A;  3H7P B;  4RGT A;  4ZRJ A;  2LHD A;  3P2B A;  2MJE A;  3ZNI D;  2WNM A;  1QIL A;  2D2Q A;  1Y8R C;  3ZXV A;  4NPN A;  3IAM 1;  3OJ4 B;  2WGS A;  2REX A;  1JML A;  2N7E A;  2V9H A;  4B95 A;  3PHW B;  3TCA A;  4RMA A;  1NYQ A;  2ZW0 A;  4EKU A;  3AE5 B;  2LEK A;  1UNS A;  1ZXI A;  2IGH A;  2WXM A;  2BGF A;  5BMG A;  1WGY A;  1V86 A;  2C9W B;  4W9J A;  1UWX A;  2EMT A;  4KIK B;  4OVZ A;  1TJE A;  2GBK A;  5HI1 A;  4DHZ E;  1VD2 A;  3NY5 A;  2PKO A;  1D5X C;  3CSF A;  1FNW A;  3AUL A;  2JWZ A;  4K3C A;  4M01 A;  1ESF A;  1XD3 B;  4NQK E;  3T9L A;  1E7V A;  5AUK A;  5EE1 A;  1E8Y A;  4P6V F;  2PPH A;  4HKZ E;  1VDV A;  4B0E A;  1SE9 A;  2MP2 A;  1YIW A;  2G9H D;  3L16 A;  2RPV A;  4D2K A;  2KFJ A;  2XNA C;  4RM9 A;  3AU5 A;  1GG3 A;  1WXS A;  3TEW A;  3V05 A;  3CWI A;  4HDO A;  2WXH A;  2L00 B;  1WX7 A;  1V8C A;  2NTS A;  1YQ4 B;  5JZE B;  1X1M A;  5G5G A;  4C7Y A;  4JQW C;  2ZCB A;  4JLC A;  3SU8 X;  3I5J C;  3KUZ A;  4O1N A;  3U2S C;  1P1A A;  1TKG A;  2LFI A;  1WF9 A;  2JWU A;  1SJH D;  2KX0 A;  2ACZ B;  4KZC A;  2DLB A;  3C0R B;  3W9C B;  2DHZ A;  3AXC A;  1KLG D;  1ZPS A;  4CHK A;  1JWU D;  2BYT A;  5CHV C;  3SFE B;  1WMH A;  3A1Q A;  2JPH A;  4NJC A;  5D3I B;  2KQS A;  1ROE A;  1WJ6 A;  2Y5C A;  3AI5 A;  3ML8 A;  4AJW A;  3R7R A;  2Q5W D;  2B3A A;  2NR2 A;  4RGO S;  1L4Z B;  3OLM D;  1EO6 A;  1FO4 A;  4MSQ B;  2KLC A;  1F9J A;  1L2N A;  4NY0 A;  1XQQ A;  2IZV B;  2JQR B;  1LO5 D;  5TR5 A;  4OVU A;  4EFO A;  3B2F A;  4WJO A;  4XWT A;  4N59 A;  4GDL B;  3A9K A;  3WA0 A;  4G0N B;  1LQB A;  4XYC A;  3APF A;  2GLS A;  2M1M A;  4AOF A;  3PLV A;  5HG2 A;  3WAM A;  2DWQ A;  2ZW1 A;  3WAN A;  1V1O A;  4MGZ E;  1WY8 A;  5J17 A;  1I4P A;  3ZGZ A;  1ENF A;  3CST A;  1V1P B;  4M8N A;  2I1J A;  3VRB B;  2XN9 C;  2BYE A;  4FHK A;  1FXI A;  3ECI A;  1WJN A;  3TEZ A;  3M62 B;  5LNK 1;  4HKQ A;  1Q1O A;  2VRR B;  4FLH A;  1QF6 A;  3HK0 A;  1OQR A;  4HRO A;  3ABV B;  1VR9 A;  2W3R A;  3DBS A;  2WP9 B;  4JL9 A;  1FRD A;  1JWA D;  2WWZ A;  4YXD B;  3S2A A;  1IP9 A;  2BKR B;  4BKG A;  4LDT D;  2BS4 B;  1EWY C;  1R4M I;  4II3 B;  4I6N B;  1FM0 D;  4ZRI A;  2HJ1 A;  2NBW B;  1FCL A;  2O6V D;  4E71 A;  4BKS D;  3P42 A;  3ZTD A;  1BML C;  4GB9 A;  2PEA A;  2N9K A;  4GGQ A;  3H7P A;  3FIL B;  3SHQ A;  2K6D B;  5KHO A;  5KHQ A;  2HD5 B;  4IKG A;  4M8M A;  1FFU A;  1XCQ L;  4FAD A;  3VH3 B;  4RM8 A;  1D5Z C;  4ZOH C;  3PRM B;  4X57 B;  1IUE A;  3QX1 A;  3B9J A;  4K1R B;  2KTF A;  3VUY A;  3WAP A;  4RF1 A;  2N4F A;  2KLG A;  2PE9 A;  4B9K A;  2XBB C;  4F7Z A;  3BY4 B;  4MGI E;  3LB8 C;  1D3Z A;  4US8 A;  2INP E;  1J7C A;  2BQQ A;  4BVU C;  1XT9 B;  2FBW B;  1WGG A;  1NDD A;  2KX3 A;  3NG0 A;  1DYQ A;  3KUC B;  4XC2 A;  5L95 C;  1KLU D;  4RH6 A;  5H92 C;  4A6Q A;  5HHD G;  3DOW A;  5JHB A;  4MT5 A;  2DBY A;  3HHM A;  2CHW A;  3PO0 A;  2DYB A;  5DPR A;  2MJD A;  2KWV B;  1I4Q A;  2ZJD A;  3ALB A;  2KC1 A;  3ENE A;  4AQ7 A;  3BWU D;  4KGS A;  3A4S C;  2BB5 A;  3P4P B;  2KYW A;  4K7U A;  1J19 A;  1K50 A;  2EKE C;  3DWM A;  3W1S C;  2WXL A;  2HDE A;  3LJ3 A;  1EF5 A;  2FIF A;  2KJH B;  2KNB A;  2L83 A;  4ICU A;  4PT5 A;  2V3N A;  3DWG C;  2GI9 A;  2EKI A;  2UWQ A;  3WAL A;  3QHT A;  3R2T A;  2KWD A;  1DOI A;  3UIN B;  4PK1 A;  1GAQ B;  3HM3 A;  4US9 A;  2BWF A;  1OEY J;  2V3S A;  2L0F A;  3BVZ A;  5BO4 B;  3RNB C;  2OOB B;  2D07 B;  4HWI B;  3MHS D;  1XEE A;  1ZKH A;  5LLI A;  3OJ3 A;  3JYU A;  1HXY D;  3KW5 B;  3PT2 B;  2VH2 A;  4BBN F;  3RN9 C;  1SIJ A;  3RT3 B;  4ITK A;  1IBX A;  3VTV A;  2MP2 B;  3ZDT A;  4L23 A;  5IO9 A;  4A8X C;  1CJE A;  4MM3 B;  4DQO C;  3W1Y A;  4USA A;  1I4R A;  3ZDM C;  1WGD A;  1ZGU B;  1EWC A;  1QOF A;  3Q3F A;  1T0Y A;  1U4A A;  1BT0 A;  1ZOY B;  2RMM A;  1YN3 A;  1V49 A;  1RM6 C;  4A90 A;  1YN5 A;  2BWE S;  4J3O D;  3AE8 B;  4QAY A;  4WH4 A;  1FNV A;  3UQB A;  3MHZ A;  4P1C C;  2QSD A;  3QIJ A;  1E90 A;  5BYR A;  1MPE A;  1TZ1 A;  5G55 A;  1CQV A;  4GXB A;  3P1M A;  1MG4 A;  4RNA A;  1WZ3 A;  1GOZ A;  2LXA A;  2WHI A;  2XEW A;  1C77 A;  4ICV A;  3Q3M C;  4OHJ A;  2NS5 A;  2D5G A;  1WMH B;  2IY1 B;  4MH8 A;  2AQ2 B;  4IW0 A;  4BFR A;  1TS4 A;  3A1Q B;  3AEF B;  2DYO A;  2JZP A;  1H4R A;  3DHG C;  1E9M A;  2BF8 B;  4K3B A;  4YTN B;  1QT9 A;  1A70 A;  4C56 C;  4PYZ A;  2Z0E B;  2D3C A;  1ZXH A;  3AEB B;  3U8Z A;  4LNI A;  3IXS A;  1MI0 A;  3DVN U;  3X0W A;  3N32 A;  4FBJ B;  3N30 A;  1I4H A;  1R4M B;  2N0S B;  2IDY A;  2J7Q B;  2YVC A;  3Q8E A;  3TMP B;  1V80 A;  1K53 A;  1C4A A;  1WJU A;  2L32 A;  4HRS A;  4OVV A;  1XF5 L;  5JXV A;  1KH0 A;  3MTN B;  1EU4 A;  3FIL A;  2ASQ A;  1UGM A;  3MC0 B;  3IG3 A;  4PS7 A;  2KZR A;  4WQM A;  2CS4 A;  4EUT A;  3TEY A;  2K5P A;  1GUA B;  3EA6 A;  1VCB A;  2LGX A;  3RNF C;  1QZE A;  5J2R A;  5TSS A;  4ARI A;  3X23 A;  1KLV A;  2BTE A;  5E6P A;  2HTM E;  2INC C;  4MJS A;  1E6E B;  2KKC A;  5EE9 A;  2N7J A;  3FC4 A;  4RFB A;  1LFD A;  3ZO5 B;  5CTR C;  3AV8 A;  5IOI A;  3PS6 A;  2AX5 A;  1KTK A;  2KO3 A;  4L2Y A;  4GN1 A;  1MG8 A;  1ISN A;  4WJN A;  3M63 B;  4WJP A;  2FCN A;  3RFZ B;  1CK1 A;  4ZHP A;  5J18 A;  4I6P A;  4UDU C;  4WAF A;  3P4Q B;  3QK0 A;  5EE3 A;  4J6I A;  4NJ6 A;  1VZ8 A;  3IAS 1;  4M00 A;  2CKH B;  2J0J A;  2Z0D B;  1NVI D;  2JRH A;  4GDK A;  1V6E A;  4HDQ A;  5C1Z A;  2MBO A;  1EUV B;  4P7I A;  2BPS A;  4DHJ D;  4W9D A;  3L08 A;  1TT5 B;  4LLG M;  3OWE B;  1TKY A;  2MJ3 A;  2LJ5 A;  2GBJ A;  2I2Y A;  3A9J A;  3N9Y C;  3EFU A;  1AWD A;  2JYT A;  2C7H A;  3BIN A;  3PZ7 A;  2ZNV C;  1HTQ A;  2LGS A;  3EGR A;  3K9O B;  1LGR A;  3BZD B;  5BMI A;  2KXJ A;  3AE6 B;  1CMX B;  3PHX B;  2J42 A;  2BYV E;  1FPY A;  3NHE B;  3HIZ A;  2D3B A;  1WE7 A;  1YJJ A;  2KN4 A;  4LNN A;  1CZP A;  3N1Z C;  2KVZ A;  2G1E A;  3CMM B;  2W54 A;  4KKI A;  5H8Y E;  3B1L X;  2W3S A;  3GB1 A;  1V5O A;  1FFV A;  1S3S G;  1UF0 A;  3N1X C;  1J7B A;  3WCQ A;  2IO0 B;  2J52 A;  2RDH A;  3OAW A;  2PMV A;  3DBH B;  2VH1 A;  3ZKJ C;  4W9L A;  4ANX A;  3N3K B;  2AYO B;  4FHJ A;  2E3T A;  4M02 A;  2QEJ C;  3V6C B;  4XDC A;  4NAM A;  4MM3 A;  2ZVO A;  2K8H A;  1MHX A;  2DZM A;  4S17 A;  2X38 A;  3BVM A;  4LNO A;  4NAW B;  2W82 A;  1KM7 A;  3LYY A;  2BS2 B;  4ZRQ A;  1VJK A;  3PVL A;  2OHF A;  1ET9 A;  2IO3 B;  2LUE A;  2LUM A;  5I4D A;  1D6E C;  1DOX A;  2NMQ A;  3GE3 C;  4PYU A;  4C4V A;  4TQ0 A;  4HEA 1;  4BKS A;  3NVV A;  4LJP B;  2LVO A;  3T3O A;  3H8H A;  2I1K A;  2G3Q B;  1XLN A;  2JRI B;  4IG7 B;  1GPX A;  2KMM A;  4XE0 A;  3N1Y C;  2NCN A;  1PGA A;  2AL3 A;  5DCN A;  3ZJU A;  3WIM A;  4IUM B;  4YSX B;  2KD0 A;  2WYQ A;  2UYZ B;  4AUQ C;  2OED A;  1YJI A;  4JIO U;  2WDR B;  1TY0 A;  3IVF A;  5IAA C;  3RD2 A;  3VH4 B;  2WX1 A;  1IBX B;  1XO3 A;  1N5X A;  5AZF A;  1DGJ A;  4TV3 A;  2FCS A;  2PLP A;  5D3D A;  5C23 A;  4A3P A;  1R7S A;  1M4V A;  1G6J A;  5D2M B;  4GU2 A;  1AYF A;  1MJD A;  3ZRC A;  3QA8 A;  4IWP A;  4MDK E;  2JF5 A;  1TZO A;  1UEL A;  4XZ4 A;  1ET6 A;  4XGA B;  2FE8 A;  2J53 A;  1E7U A;  4PS8 A;  4S0R A;  3IBE A;  1SF0 A;  3L17 A;  1RLF A;  1IGC A;  3TEX A;  4N9F 4;  1YQ3 B;  2NBV B;  4R3D A;  3MP9 A;  5MPO A;  1KRH A;  2QIL A;  3GP7 A;  4CQN A;  1I4X A;  4ZHO A;  1WIA A;  2NBU A;  2IND C;  4IWQ A;  2ZVN A;  4W9G A;  1NEN B;  2FCM A;  2RDB C;  2INN E;  5BYS A;  4LTU A;  2GB1 A;  3URY A;  3AE7 B;  4FN2 A;  2C7N B;  3U7Z A;  3BK2 A;  3O65 B;  2L7R A;  3HVD A;  3SR6 A;  3AEC B;  2R2O A;  3W2D A;  2WXO A;  2RSU A;  4IM3 A;  2WXJ A;  2VZK D;  2N1V A;  3NS1 A;  1Q0W B;  3AED B;  1SE4 A;  1WZ0 A;  4EZK A;  4HPL B;  3MC9 A;  1Q10 A;  3KYD D;  4TUU A;  2X8X X;  2JYE A;  1YNT E;  2CHX A;  1P7E A;  2K39 A;  4A20 A;  2DZK A;  5D7G A;  4ASW C;  1C4P A;  2M19 A;  4YSZ B;  4AJY B;  3N20 C;  4W9I A;  1HZ6 A;  5HFY A;  1JAL A;  1Z5S B;  1RAX A;  4W9K A;  5BMH A;  5IP4 D;  2BT6 A;  1WGH A;  4MJS B;  2PVG C;  2V0G A;  1B1Z A;  2JZ3 B;  1M94 A;  1T0S C;  1WJ4 A;  3NUH B;  2V1Y A;  4AS1 A;  1I4G A;  1PYW D;  2BYF A;  2PW9 A;  1C79 A;  1D4B A;  1EU3 A;  4KGT A;  1QLB B;  3A4R A;  1C9F A;  1RYJ A;  4MGY E;  4C00 A;  3PGE A;  3P4S B;  1N60 A;  1GB4 A;  5HKH A;  3CF6 E;  1WYW B;  1J8C A;  4IM2 A;  4ANW A;  3DVG Y;  2NTT A;  3VFK A;  4JGH B;  3E9S A;  4GDK B;  1DOY A;  2JT4 B;  3ZVV A;  2ZPN A;  2WXP A;  2JU6 X;  2LGY A;  3VHT C;  2V3P A;  4FXC A;  1TIF A;  1WR6 E;  1C4C A;  1JRP A;  3FKY A;  3VTW A;  3VR9 B;  4NAW A;  3IT6 B;  2QMT A;  3A9J B;  2N7D A;  2MBE A;  2LVP A;  4WAA A;  2V4L A;  2MLB A;  3H9D A;  4GSW A;  3QCA A;  3O13 A;  1BXT A;  4YWG G;  1VLB A;  1KJT A;  3DVN V;  1I42 A;  4A3O A;  2MH7 A;  1WX9 A;  2GBM A;  2MA9 B;  1GNU A;  4IM0 A;  3RPF C;  2YLM A;  4MSM B;  1JW9 D;  3UIO B;  3L4P A;  1PGX A;  2MWS B;  3C19 A;  3RYT A;  2W9N A;  1IYF A;  3KQ4 A;  2K8B A;  2ICI A;  1J0G A;  2LGI A;  2K9X A;  1LXD A;  3L10 B;  2RD0 A;  2BKF A;  4A9A A;  3IHP C;  4MH0 E;  2QDF A;  4RGN A;  2L76 A;  3UGB B;  3VUX A;  3NZ3 A;  1IPG A;  2DNF A;  2KQ4 X;  2PIA A;  5FR3 A;  5EDS A;  1ZDV A;  3RMK C;  1ZP0 B;  2HJ8 A;  2IBI B;  3P63 A;  2CR5 A;  4DXF A;  1OQQ A;  3IFW B;  1V97 A;  1F77 A;  3KYC D;  2FUG 1;  4IC7 B;  2NPT A;  1GC6 A;  3VQI A;  1YD8 U;  3KWV A;  4M0W A;  2OJW A;  4W9F A;  1VRA B;  4BOS C;  4DBG A;  1WX8 A;  3Q8C A;  2N9X A;  1V81 A;  2WXF A;  3DBR I;  1HQR D;  1RFK A;  2LGD A;  2KMC A;  1T3Q A;  2GBN A;  2K8C A;  2Z59 B;  3U4E G;  4C4V B;  1E5W A;  2M56 B;  3A33 B;  3QC8 B;  2HTH A;  1IGD A;  1E7P B;  1WGK A;  2D10 A;  2JVC A;  1VZ6 A;  3OG5 A;  4LCD E;  2L3Z A;  4K81 A;  2KK8 A;  3I9V 1;  1I7H A;  4P16 A;  4JX1 C;  2MCN B;  4GIV A;  3BII D;  4JWS C;  4F1S A;  5L83 A;  1WYG A;  1B9R A;  4I6L B;  3AB5 A;  1K52 A;  3Q3N C;  4GLS C;  5D94 A;  1TS5 A;  4C7Z A;  1S1Q B;  4DXG A;  5LXH A;  2KAJ A;  1WH3 A;  4YT0 B;  4HPM B;  3R8B A;  3ZNG C;  2QCZ A;  1NI3 A;  2LVQ A;  2SEB D;  5D6J B;  2DAF A;  1FMA D;  3AU4 A;  3R66 C;  3VUW A;  2DAJ A;  2LD9 A;  2WXR A;  1WR1 A;  1Z2M A;  4ZRK A;  3ZNZ B;  1D5M C;  4L1B A;  4YSY B;  3I3T B;  2QHO A;  2M4N A;  3MC8 A;  1A5R A;  4TQ1 A;  2LJI A;  1WI0 A;  5BYQ A;  2FID A;  1PUT A;  3E56 A;  3ZRF A;  2M0X A;  3TL5 A;  2WXN A;  3Q8F A;  4XDD A;  4FJY A;  4FJZ A;  3R3M A;  4YL8 A;  2JX5 A;  3KLS X;  1XLQ A;  2WDV B;  4XWW A;  1FRR A;  5E6J A;  3W1S A;  4NQL B;  1ZDX A;  3NOB A;  1HTO A;  2LZ6 A;  2ZNV B;  3ZUN A;  1L5P A;  1PGB A;  1YOV B;  3PSE B;  1LM8 B;  3PLU A;  1I35 A;  2WXQ A;  3AE3 B;  3NZU A;  3P4R B;  4N58 A;  3J9C A;  1UBI A;  2CU3 A;  3CIR B;  2LAS A;  2K3U A;  4DWF A;  2GMI C;  1P3Q U;  3Q14 C;  1K51 A;  2YEP F;  1T0Q C;  4KZ0 A;  2BB6 A;  2MRP A;  1YJ1 A;  3BYT B;  3EUB 2;  3JVZ X;  3RNE C;  3Q3J A;  3VDZ A;  3KWL A;  3VAW A;  2WXG A;  5IA7 A;  2DYM A;  1GB1 A;  4CO7 A;  3D32 A;  3U30 A;  4XX5 A;  3AEG B;  5T8I A;  5GMV A;  3ZIM A;  3KUD B;  2YEP B;  1E8Z A;  3TIX A;  2L0T A;  2KQ7 A;  3H1U A;  1FNU A;  2KHW B;  2FCQ A;  3VXW A;  3NVW A;  3PRP B;  2WU5 B;  1EF1 A;  1N61 A;  1WE6 A;  3LDZ E;  3PZ8 A;  4JPS A;  2W55 A;  4B6W A;  3PPA A;  3T8M A;  2FAZ A;  3V3X A;  3AE1 B;  5DPS A;  3VTU A;  4C80 A;  4ANV A;  3T3N A;  2L8J A;  4MGK E;  1OGW A;  2EMS A;  1GJZ A;  2KT7 A;  2M8S A;  1H8C A;  3SD5 A;  3NVZ A;  4MEM A;  2M0A A;  4ARC A;  3M3J A;  4WUR A;  4KX6 B;  1WRI A;  1T0R C;  3PRE A;  4II2 B;  2LRU A;  2DZJ A;  2KN5 A;  4IDI A;  1P98 A;  2N1W A;  3EEC A;  3K9P B;  4YTP B;  3ZNH B;  3EFC A;  3Q69 A;  1KFY B;  4H2A A;  1SE3 A;  1L7Y A;  1XLO A;  2KAN A;  2JY6 A;  2E6X A;  3UIP B;  2BVC A;  2KDI A;  3NJT A;  3KVF B;  4E3C A;  2CJN A;  4HJK A;  3L54 A;  2KJ6 A;  2NVU I;  1ACC A;  1PFD A;  3GZN I;  4LK0 M;  1JCK B;  4ZYS A;  3ETR A;  2BS3 B;  4REZ A;  2ON8 A;  1WXM A;  2KOX A;  3AM9 A;  3RUI B;  4W9E A;  3GS2 A; 
#chains in the Genus database with same CATH homology
 3WAL A;  3ONS A;  3QHT A;  1Q0W B;  3VVW B;  3UIN B;  4DXA B;  3DBL I;  3HM3 A;  1WZ0 A;  3HM6 X;  2BWF A;  4G3X B;  4EEW A;  4EZK A;  3A9K B;  1P0R A;  4HPL B;  1AAR A;  5E6N A;  3H6N A;  4DHZ B;  3KYD D;  4TUU A;  1OEY J;  4WWP A;  1NBF C;  2V3S A;  3SDL C;  3TBL D;  2L0F A;  1WRD B;  2KTR B;  5BO4 B;  2D11 A;  2IO1 B;  2OOB B;  3PRZ A;  4IWO A;  4MEL A;  4HVB A;  2D07 B;  3DCG A;  2CHX A;  2K39 A;  4HWI B;  3MHS D;  4A20 A;  1ZKH A;  4FUL A;  5LLI A;  2KWU B;  3OJ3 A;  2G4D B;  2IYD B;  3JYU A;  2O6V A;  4FJV B;  3KW5 B;  4ZDV A;  2DZK A;  4AP4 C;  2KVR A;  3RUL A;  3PT2 B;  2AWT A;  5CHW A;  5D7G A;  4ASW C;  4BBN F;  4WQO B;  3RT3 B;  1WM2 A;  4KDI C;  4EZJ A;  3RZW C;  4AJY B;  2MBH A;  4KSL C;  3ML9 A;  4W9I A;  1K8R B;  3VTV A;  2DZI A;  2G45 B;  2MP2 B;  3ZDT A;  3QAQ A;  3QWZ B;  1Z5S B;  1RAX A;  3L13 A;  1P9D U;  2CU1 A;  3W1Y A;  4W9K A;  2OJR A;  3APC A;  2WX0 A;  2IO2 B;  3ZDM C;  4B9K A;  1WGD A;  1ZGU B;  3PV1 A;  1WGH A;  2O2V B;  5LXI B;  3RZF A;  4MJS B;  3Q3F A;  1T0Y A;  1U4A A;  4EOY A;  1BT0 A;  1V49 A;  2JZ3 B;  3JSV B;  4WWO A;  1E8W A;  1M94 A;  1WJ4 A;  2A5U A;  2V1Y A;  1YQB A;  1UBQ A;  2R2Q A;  1WXA A;  3H7S A;  2BWE S;  5G2N A;  3DDC B;  3V60 A;  2XK5 A;  2BYF A;  3EC8 A;  2JXX A;  4NJ7 A;  1WGR A;  1GC7 A;  3PTF C;  3UF8 A;  3A4R A;  3UQB A;  3H7P B;  4ZRJ A;  2NPT B;  3QIJ A;  3P2B A;  1E90 A;  4MGY E;  1TZ1 A;  4M0W B;  5G55 A;  3PGE A;  2J0M A;  2CHZ A;  3ZNI D;  4GXB A;  4DDG D;  2D2Q A;  5HKH A;  3CF6 E;  1OQY A;  1WYW B;  1Y8R C;  1J8C A;  4IM2 A;  4ANW A;  5JH5 C;  3DVG Y;  1WZ3 A;  4NPN A;  3VFK A;  2MQJ A;  4JGH B;  2LXA A;  4ICV A;  2XEW A;  4GDK B;  2NS5 A;  2JT4 B;  3OJ4 B;  1WMH B;  2IY1 B;  4BFR A;  4IW0 A;  3ZVV A;  2REX A;  2ZPN A;  3A1Q B;  2DYO A;  2N7E A;  1H4R A;  2LGY A;  4B95 A;  3VHT C;  1E8X A;  3PHW B;  3TCA A;  4RMA A;  1WR6 E;  4EKU A;  2LRW A;  4DHJ B;  1SIF A;  2BF8 B;  2RR9 A;  3VTW A;  4NAW A;  2BGF A;  4PYZ A;  3A9J B;  2Z0E B;  1WGY A;  1V86 A;  2MBE A;  2N7D A;  2LVP A;  2KC2 A;  4WAA A;  2C9W B;  3U8Z A;  4W9J A;  2EMT A;  2V4L A;  4KIK B;  2GBK A;  2MLB A;  3H9D A;  4GSW A;  3QCA A;  1NI2 A;  2LXC A;  2GOW A;  4DHZ E;  1VD2 A;  3NY5 A;  4ZYN A;  1KJT A;  3DVN V;  2KJR A;  4PS3 A;  1I42 A;  3DVN U;  3X0W A;  4A3O A;  3N32 A;  3CSF A;  4FBJ B;  3AUL A;  3N30 A;  1WX9 A;  2JWZ A;  1Q5W B;  3M95 A;  2J7Q B;  2KFK B;  2YVC A;  3TMP B;  1V80 A;  1XD3 B;  4NQK E;  1WJU A;  3T9L A;  2GBM A;  1E7V A;  2MA9 B;  4OVV A;  1GNU A;  2C60 A;  4IM0 A;  1E8Y A;  2YLM A;  3MTN B;  4MSM B;  4HLE A;  2ASQ A;  1UGM A;  3UIO B;  2PPH A;  3IG3 A;  4PS7 A;  2JZZ A;  2KZR A;  3KH0 A;  2CS4 A;  1RFA A;  4EUT A;  1SE9 A;  2MP2 A;  2MWS B;  1YIW A;  3RYT A;  2W9N A;  3NS8 A;  1IYF A;  1GUA B;  3NZS A;  2K8B A;  1VCB A;  1V9J A;  2LGX A;  3L16 A;  1QZE A;  3QAR A;  4GMV A;  1J0G A;  5J2R A;  2K6Q A;  4GOC A;  2KFJ A;  4RM9 A;  2MX2 A;  2O2V A;  3AU5 A;  1GG3 A;  1WXS A;  3X23 A;  2ZPY A;  1KLV A;  5E6P A;  4MJS A;  2KKC A;  1LXD A;  3L10 B;  4DK5 A;  4HDO A;  2RD0 A;  1LFD A;  2BKF A;  2C5L C;  2L00 B;  2L05 A;  2M17 A;  5CTR C;  3ZO5 B;  3IHP C;  4MH0 E;  1WX7 A;  3PS6 A;  2L76 A;  3UGB B;  3VUX A;  1IPG A;  5JZE B;  1X1M A;  4W9H A;  2KO3 A;  4GN1 A;  1MG8 A;  1ISN A;  4WJQ A;  4JQW C;  5EDS A;  4WJN A;  2ZCB A;  3M63 B;  4WJP A;  2HJ8 A;  2IBI B;  2HE7 A;  2CR5 A;  4JLC A;  3SU8 X;  2FCN A;  3IFW B;  3KUZ A;  2DX5 B;  3PZD A;  1UH6 A;  2GBR A;  3KYC D;  4KV2 A;  1P1A A;  4IC7 B;  4I6P A;  2MBB B;  5J18 A;  1WF9 A;  3QK0 A;  2PJH A;  2JUO A;  2NPT A;  1GC6 A;  4J6I A;  3VQI A;  1YD8 U;  4HCP B;  1TTN A;  2KX0 A;  4NJ6 A;  4KZC A;  3C0R B;  4W9F A;  2PE6 B;  4BOS C;  4DBG A;  1WX8 A;  2LI5 A;  2CKH B;  2J0J A;  2DHZ A;  2N9X A;  2Z0D B;  1V81 A;  3AXC A;  3DBR I;  2LGD A;  4CHK A;  2KMC A;  2GBN A;  2K8C A;  2Z59 B;  5CHV C;  2JRH A;  1WXV A;  1E5W A;  4GDK A;  1V6E A;  3A33 B;  3QC8 B;  2HTH A;  1WMH A;  4WWN A;  3A1Q A;  2JPH A;  2D10 A;  2JVC A;  4HDQ A;  5C1Z A;  2KQS A;  2MBO A;  1EUV B;  1WM3 A;  4NNJ B;  1WJ6 A;  4LCD E;  1C1Y B;  4P7I A;  2BPS A;  4DHJ D;  2L3Z A;  4W9D A;  3L08 A;  2FNJ B;  4K81 A;  2KK8 A;  2LJ5 A;  3AI5 A;  2MW5 A;  2GBJ A;  3ML8 A;  4AJW A;  1HE8 A;  4K7W A;  3R7R A;  3A9J A;  1R4N I;  2B3A A;  2NR2 A;  3EFU A;  2MCN B;  4KIK A;  4TKN A;  2RPQ A;  3OLM D;  1EO6 A;  2C7H A;  4GIV A;  3BIN A;  4MSQ B;  4W9C A;  2KLC A;  4F8C B;  1F9J A;  2KMA A;  2ZNV C;  3V6E B;  2WDT B;  2MSE D;  4ANU A;  5AZH A;  4F1S A;  3K9O B;  5L83 A;  4KDL B;  4I6L B;  1V2Y A;  2KXJ A;  1L2N A;  1CMX B;  3PHX B;  4NY0 A;  5D94 A;  1XQQ A;  2IZV B;  2BYV E;  5TR5 A;  3NHE B;  1S1Q B;  3HIZ A;  4OVU A;  2Y5B B;  1WE7 A;  5LXH A;  4EFO A;  1C3T A;  3B0A A;  1WH3 A;  3MJW A;  4WJO A;  4GDL B;  4HCN B;  3A9K A;  3DQV A;  4HPM B;  3WA0 A;  3ZNG C;  5FR6 A;  2LVQ A;  3CMM B;  4G0N B;  2IY0 B;  1LQB A;  3APF A;  5D6J B;  2DAF A;  3AU4 A;  2M1M A;  3R66 C;  2KTR A;  3PLV A;  3VUW A;  4AOF A;  2DAJ A;  3TJP A;  2LD9 A;  3WAM A;  2LWP A;  3B1L X;  3DPD A;  1WR1 A;  1Z2M A;  3WAN A;  4ZRK A;  4CYE A;  3ZNZ B;  5JHA A;  1V5O A;  1S3S G;  1WY8 A;  4MGZ E;  5J17 A;  1FXT B;  3I3T B;  2QHO A;  2IO0 B;  2M4N A;  2N9E B;  3CST A;  1A5R A;  1UZX B;  4M8N A;  3OAW A;  4TQ1 A;  4DDI D;  2I1J A;  5AZG A;  1WI0 A;  1OTR B;  3QJZ A;  2FID A;  3ZKJ C;  2BYE A;  4FHK A;  3N3K B;  4W9L A;  4ANX A;  2AYO B;  4FHJ A;  3ECI A;  2KDE B;  2M0X A;  3ZRF A;  3TL5 A;  4BKT A;  1WJN A;  3V6C B;  1PQS A;  3JW0 X;  4FJY A;  4FJZ A;  3U7D A;  4E74 A;  3M62 B;  4MM3 A;  3UQA A;  2ZVO A;  3GOE A;  5DPT A;  3R3M A;  1YX5 B;  2K8H A;  1Q1O A;  2VRR B;  4FLH A;  4KVG B;  2AEH A;  4YL8 A;  2DZM A;  3HK0 A;  1TGZ B;  4NAW B;  3W1S A;  4BOZ B;  3DBS A;  3JSV A;  1KM7 A;  4NQL B;  4JL9 A;  3NOB A;  3PVL A;  2WWZ A;  2C7M B;  3R7Q A;  3S2A A;  1IP9 A;  2LZ6 A;  1UD7 A;  2BKR B;  2ZNV B;  4BKG A;  2IO3 B;  3ZUN A;  2KDF B;  2ZZP B;  4LDT D;  2N9P C;  2LUE A;  1R4M I;  4II3 B;  3PSE B;  1LM8 B;  3PLU A;  4I6N B;  2DEN B;  1I35 A;  3NZU A;  4ZRI A;  4EZL A;  2NBW B;  2O6V D;  4E71 A;  4PYU A;  1UBI A;  4BKS D;  3ZTD A;  2LAS A;  4G11 A;  3DBH I;  4TQ0 A;  4BKS A;  4GB9 A;  2PEA A;  4LJP B;  2LVO A;  4DWF A;  4GGQ A;  3H7P A;  2I1K A;  2G3Q B;  2GMI C;  2JRI B;  3ZW3 A;  1P3Q U;  3SHQ A;  4IG7 B;  2K6D B;  5KHO A;  5KHQ A;  4AWJ A;  4KZ0 A;  2HD5 B;  2NCN A;  2AL3 A;  3WAO A;  5DCN A;  2MRP A;  1YJ1 A;  3JVZ X;  2A4Z A;  4M8M A;  4FAD A;  2MBQ A;  1RRB A;  3Q3J A;  4LDT B;  3RCZ A;  3VAW A;  3VDZ A;  3VH3 B;  3WIM A;  4IUM B;  4RM8 A;  2KD0 A;  2WYQ A;  2UYZ B;  3PRM B;  4X57 B;  4LJO B;  2DYM A;  5IA7 A;  3QX1 A;  4CO7 A;  3D32 A;  4AUQ C;  1OEY A;  3U30 A;  2O6V B;  4K1R B;  2KTF A;  4XX5 A;  3VUY A;  3V62 A;  3QQ8 B;  4JIO U;  3WAP A;  5AEK B;  2N4F A;  2KLG A;  2PE9 A;  3IVF A;  5IAA C;  2XBB C;  2RGF A;  2WX1 A;  5GMV A;  3RD2 A;  1SGH A;  3VH4 B;  3ZIM A;  4F7Z A;  3KUD B;  3BY4 B;  4MGI E;  4HXD A;  3ZLZ A;  1D3Z A;  5AZF A;  4TV3 A;  4G50 A;  2FCS A;  1E8Z A;  3TIX A;  2L0T A;  2KQ7 A;  5C23 A;  4A3P A;  3H1U A;  1G6J A;  2KHW B;  5D2M B;  4GU2 A;  4BVU C;  1XT9 B;  1WGG A;  1NDD A;  2KX3 A;  2FCQ A;  3VXW A;  2G4S A;  3PRP B;  3ZRC A;  3KUC B;  1EF1 A;  3QA8 A;  4IWP A;  1WFY A;  4XC2 A;  1WE6 A;  3LDZ E;  4MDK E;  4GDL A;  5CHF A;  5L95 C;  1KOT A;  3V61 A;  2JF5 A;  1ZW7 A;  4B6W A;  3PPA A;  3T8M A;  2FAZ A;  1UEL A;  4XZ4 A;  3DOW A;  5JHB A;  3HHM A;  5DPS A;  1E7U A;  3EHV A;  2CHW A;  4PS8 A;  2ZCC A;  3APD A;  3VTU A;  4ANV A;  3IBE A;  2DYB A;  2L8J A;  4MGK E;  1OGW A;  2EMS A;  2KFK A;  3L17 A;  5DPR A;  2XK5 B;  1RLF A;  2KWV B;  2M8S A;  5CX3 A;  1GJZ A;  2K25 A;  1H8C A;  3SD5 A;  5E6O A;  4MEM A;  3M3J A;  4N9F 4;  2ZJD A;  1JRU A;  3PRE A;  4II2 B;  2LRU A;  3ALB A;  2KC1 A;  2NBV B;  3ENE A;  2DZJ A;  2KN5 A;  1P98 A;  2N1W A;  3EEC A;  3K9P B;  4HK2 A;  2ZEQ A;  5DPW A;  3ZNH B;  3A4S C;  3L0W B;  4URK A;  1WIA A;  2NBU A;  1YX6 B;  4K7U A;  4KSK C;  4IWQ A;  1L7Y A;  2KAN A;  2KDB A;  2ZVN A;  4K7S A;  1J19 A;  2JY6 A;  4W9G A;  2FCM A;  2EKE C;  1TBE A;  2D3G A;  4FA6 A;  3UIP B;  2K1F A;  4FN2 A;  2KDI A;  3W1S C;  3DVG X;  2C7N B;  3KVF B;  4E3C A;  2KWC A;  3O65 B;  2L7R A;  1V5T A;  3LJ3 A;  1EF5 A;  4BBN C;  4HJK A;  2J0K A;  3L54 A;  2R2O A;  2KJ6 A;  2FIF A;  2NVU I;  2KJH B;  2KNB A;  3ZTC A;  2RSU A;  4IM3 A;  3GZN I;  4ICU A;  2AL6 A;  1WXM A;  2FUH B;  2KOX A;  2N1V A;  3RUI B;  4W9E A;  3B08 A;  2UWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...