1WJ6A

Solution structure of rsgi ruh-024, a pb1 domain in human cdna, kiaa0049
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
GSSGSSGPHSMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0049 protein
publication title Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj6A01
3SU8X 3UF8A 2RD0A 1V5OA 4G0NB 2DHZA 3ECIA 3UIPB 3PRPB 3MTNB 1TGZB 4XX5A 1KOTA 4LJOB 4JLCA 1F9JA 3PPAA 3WANA 4DDGD 1KLVA 2AWTA 2XEWA 4BFRA 4II2B 2KJHB 3H7SA 3N32A 2L00B 1WGDA 2IY0B 4ANVA 1J0GA 2MW5A 3L17A 1EF1A 2BYFA 4AP4C 4PS8A 4W9GA 1V81A 3QA8A 2XBBC 2VRRB 4DDID 2KFJA 1UZXB 2LGYA 2PEAA 1OEYJ 4GXBA 1WGHA 3VTWA 2J0KA 3H9DA 3R7QA 4LJPB 1WF9A 1RRBA 4MEMA 3KYDD 2JVCA 2M8SA 3L08A 4ZRJA 3ZO5B 4J6IA 2V3SA 2OJRA 3IFWB 3KW5B 2NPTB 4KVGB 3DBSA 4NPNA 2KMCA 2DENB 3RUIB 2IO1B 4FJZA 1WH3A 2IZVB 4CYEA 4WQOB 1A5RA 3ZVVA 3MHSD 3K9OB 4BBNF 1AARA 3DCGA 4K81A 1WIAA 3DVGX 3A9JA 3ZRCA 1P98A 4EUTA 2JRHA 2LRUA 1OEYA 2A5UA 4B9KA 4LDTB 3M3JA 3DVNU 1QZEA 2K1FA 2LXCA 3CF6E 2KTRB 3P2BA 4IW0A 4MGYE 4TQ0A 1ZGUB 2KX0A 3H7PA 3RD2A 2MLBA 3VFKA 2O6VD 1LQBA 1VD2A 2DZKA 3IG3A 2IYDB 2IBIB 4WJNA 1EO6A 3VDZA 2IO3B 4IM0A 4M8MA 4EZKA 3W1SC 2WYQA 1Q1OA 2JPHA 4WAAA 3PSEB 4HWIB 3HHMA 4KDLB 1ISNA 1YD8U 2J0JA 2KHWB 2NCNA 2QHOA 3AI5A 2LVQA 3BINA 4LCDE 3L54A 1LXDA 4AOFA 5LLIA 1TZ1A 1M94A 4GU2A 1YX5B 4W9DA 3L10B 1WE7A 3JSVA 5JHAA 3WAOA 1YIWA 3ML9A 4WWPA 2ZCCA 4FHKA 3IVFA 2KD0A 2O6VA 2FIDA 4BKGA 5IA7A 1EUVB 2DX5B 2Y5BB 3WAPA 4BOSC 1WMHB 1WY8A 2FNJB 2AL6A 2A4ZA 2YLMA 4HLEA 1WJ6A 4GDLB 1WJ4A 2D07B 1GJZA 3VXWA 1WRDB 2BYEA 2KN5A 3PVLA 2PPHA 1GUAB 3GZNI 3H7PB 4I6LB 1WXAA 2NBVB 3OJ3A 3T8MA 4A3PA 1WX9A 3ALBA 4G11A 2LGDA 3TJPA 4B95A 1D3ZA 2KMAA 2LVOA 3NOBA 1Z2MA 2JF5A 2D10A 2W9NA 4WJPA 4FA6A 3U8ZA 2K25A 4HPLB 3ML8A 4W9KA 4FADA 4URKA 1S1QB 3IBEA 5J2RA 3DBLI 3KYCD 3ZKJC 1GC7A 3DQVA 4LDTD 4KZCA 2HD5B 3ZNZB 2K8HA 3RT3B 2FCSA 3LJ3A 4HDQA 3VTVA 2EKEC 2XK5B 3DPDA 3HM6X 4MGZE 3ONSA 1WXSA 2BWFA 2ZEQA 4DHJB 2G45B 2DZMA 4G50A 3HIZA 5LXHA 3TL5A 3QARA 2LXAA 4FJVB 1Y8RC 2MX2A 2L76A 3PTFC 5E6NA 5BO4B 2KFKB 3WIMA 4W9HA 1PQSA 4W9IA 5AEKB 2GBNA 1WYWB 3SDLC 2KJ6A 2ZNVC 2LRWA 2DZIA 2N7DA 4GDKB 3B1LX 1WX7A 1WFYA 2N1VA 2ZCBA 3EFUA 1WM3A 2DAFA 2KX3A 4RMAA 2KOXA 3O65B 3M62B 4EFOA 3UQAA 1P3QU 1NI2A 3NZSA 2DYOA 4EZLA 2NVUI 3PS6A 4PS7A 3PREA 3JYUA 3UINB 2KTRA 5LXIB 2MP2B 4B6WA 2GMIC 2JZ3B 2RR9A 2JXXA 3VUWA 4K7WA 2G4DB 1CMXB 1E7VA 2IO0B 1FXTB 3MJWA 4FULA 3KVFB 4AJWA 4FLHA 2K6DB 4WJOA 4NQKE 4EEWA 1WZ0A 2C60A 3KUDB 2REXA 4W9JA 2KNBA 4IWQA 1E5WA 3ZTDA 3OAWA 4IC7B 3TMPB 2GBMA 5JH5C 3B08A 2GOWA 4IUMB 2LGXA 4KV2A 3VQIA 2DYBA 5JZEB 2KLCA 3KH0A 2KANA 2LVPA 3OJ4B 2NR2A 4CO7A 5KHOA 3UIOB 1Q5WB 4M0WB 3PLVA 2RGFA 4ANWA 1MG8A 3DOWA 3QAQA 2M17A 2J0MA 3QX1A 4MSQB 1S3SG 2C7MB 3A1QB 3PLUA 4JGHB 4PYZA 4JQWC 2CHXA 4DHJD 4DHZB 3OLMD 1WMHA 5D2MB 1WGRA 4GDLA 1VCBA 1V9JA 4ZRIA 2I1JA 2FCMA 1OTRB 3AU5A 1C1YB 1BT0A 2KC2A 2ZNVB 2GBKA 2ZPYA 4AUQC 3B0AA 4FN2A 5HKHA 4ASWC 5J17A 1NDDA 2JT4B 1U4AA 3M63B 2BPSA 2D3GA 3IHPC 1WI0A 3V60A 4RM8A 2KK8A 2KQ7A 4YL8A 4E71A 4TUUA 2MA9B 4PS3A 3RZFA 3WALA 4AJYB 3S2AA 1P1AA 2BYVE 3D32A 4WJQA 3TCAA 3ZDTA 3RULA 3PV1A 2Z0DB 3H6NA 3PHXB 4IG7B 5CHVC 4DXAB 2XK5A 4EOYA 2KDFB 3AXCA 4A3OA 3SD5A 1C3TA 4KSLC 2LZ6A 2IY1B 2R2OA 3W1SA 3GOEA 2JZZA 2ASQA 3NS8A 4KZ0A 4IM2A 2R2QA 5C23A 3RCZA 3VVWB 1Q0WB 2KFKA 2Z59B 3EC8A 4P7IA 3WA0A 3KUZA 3ZDMC 3VH4B 1XT9B 3PRMB 2G4SA 3Q3JA 3PZDA 4KSKC 2N9PC 1E8XA 5D7GA 1WJUA 1UD7A 5E6OA 2C5LC 2JWZA 4DBGA 2BF8B 1GC6A 4GDKA 1WGGA 4IWPA 4TQ1A 4GGQA 4GSWA 2O2VB 4HCNB 4OVVA 4GN1A 1H8CA 4F8CB 4FHJA 1WE6A 3CSTA 2N7EA 2UWQA 2B3AA 3VTUA 1L7YA 2KC1A 2M1MA 3ZNHB 5DPWA 2ZJDA 2MP2A 2KKCA 3R66C 3HK0A 5DPSA 1J8CA 2MBOA 1IP9A 3JVZX 4MSMB 2AYOB 1WXMA 3H1UA 2PE9A 4BBNC 2HTHA 3A4SC 1XD3B 1GG3A 1UBQA 4GB9A 3LDZE 3VUXA 3TBLD 2ZVOA 1WGYA 2WDTB 2K6QA 2L0FA 4GMVA 2LI5A 4MGKE 1NBFC 2YVCA 2KTFA 5L95C 3U30A 5GMVA 2CS4A 4NAWB 4ZYNA 4DWFA 3EHVA 4NJ6A 3ENEA 2DZJA 4DK5A 2KJRA 4K7SA 2DAJA 4HJKA 2AEHA 2ZZPB 5JHBA 5DCNA 3PHWB 5D94A 4IWOA 1E8WA 2K8CA 2KWCA 5G55A 2MCNB 3RYTA 3A1QA 3A9KB 5TR5A 3V6CB 3ZIMA 4NNJB 1WJNA 3W1YA 4HK2A 5AZFA 4K7UA 4M8NA 2PE6B 3ZNGC 3ZLZA 2N1WA 2KZRA 4W9EA 4AWJA 2GBJA 4MH0E 3SHQA 3QIJA 4W9FA 2NBWB 4MELA 3T9LA 3ZRFA 3U7DA 2LASA 1TBEA 2CU1A 4WWNA 3KUCB 4I6PA 1LFDA 3L16A 2MSED 3PRZA 1XQQA 1E8YA 3L0WB 1RFAA 1RAXA 4GIVA 4NY0A 1ZKHA 3QJZA 2KQSA 4HPMB 1X1MA 2N4FA 3APFA 2FAZA 2UYZB 2IO2B 5DPRA 1YX6B 3ZTCA 5D6JB 2C9WB 4ICUA 2I1KA 4F7ZA 3UQBA 2LD9A 1YJ1A 3NHEB 3RZWC 4E74A 3UGBB 4OVUA 1V6EA 3QK0A 4TKNA 4BKTA 5IAAC 2JRIB 2WX0A 4EZJA 3DVNV 4HVBA 2CHWA 3K9PB 2CR5A 3ZW3A 1L2NA 2KLGA 4JL9A 1GNUA 3VHTC 1UGMA 1E8ZA 1WR1A 3V61A 2JY6A 2LWPA 4KIKB 4DHZE 4MJSA 3VAWA 2L3ZA 4ANUA 3L13A 2FCNA 2O2VA 4NQLB 3WAMA 3QCAA 2L0TA 4MGIE 5DPTA 3AULA 3I3TB 1EF5A 1OGWA 1H4RA 2LJ5A 4FBJB 1P9DU 2BKRB 2J7QB 3N3KB 4TV3A 2N9XA 3QHTA 5CHFA 3VUYA 4W9LA 3QC8B 3VH3B 5CHWA 4F1SA 2L05A 2N9EB 1I35A 1R4MI 2CHZA 2KWVB 4X57B 3ZNID 2MWSB 2M0XA 2AL3A 4N9F4 3N30A 2L8JA 3Q3FA 2FUHB 1V5TA 1IYFA 1T0YA 1YQBA 4GOCA 4BOZB 1RLFA 1SE9A 4NAWA 1Z5SB 3BY4B 4HCPB 4WWOA 2MBBB 1WZ3A 3PGEA 3CMMB 2M4NA 3NZUA 5CTRC 2V4LA 4EKUA 2K39A 3EECA 2EMSA 2MQJA 4MJSB 5AZGA 4E3CA 4ZDVA 2RSUA 3JW0X 3PT2B 3DDCB 3NY5A 3HM3A 4HDOA 3A9KA 3DVGY 2MBQA 4K1RB 1WM2A 5E6PA 2HE7A 4FJYA 4XZ4A 4G3XB 3V6EB 4KDIC 2NS5A 3C0RB 2D2QA 2Z0EB 1UBIA 4W9CA 4NJ7A 5AZHA 1P0RA 2MRPA 2CKHB 3A9JB 1IPGA 3CSFA 4II3B 4BKSD 2C7NB 3DBHI 4ZRKA 3APDA 1V86A 2K8BA 2EMTA 4MDKE 4MM3A 1LM8B 2JUOA 5G2NA 1JRUA 1KJTA 1R4NI 1WX8A 1V2YA 3M95A 4ICVA 3QWZB 5KHQA 2MBEA 1SGHA 1WR6E 1UH6A 3ZUNA 2RPQA 4JIOU 5FR6A 2KWUB 4I6NB 4BVUC 2KDEB 3DBRI 3APCA 2OOBB 4ANXA 4CHKA 2DYMA 5CX3A 2KVRA 4PYUA 1V80A 3A33B 1G6JA 2KXJA 1WXVA 2MBHA 1UELA 3V62A 5C1ZA 3X0WA 1OQYA 1KM7A 2PJHA 2ZPNA 3TIXA 2BGFA 1I42A 5L83A 2NBUA 3QQ8B 4RM9A 1E90A 3AU4A 2BWES 2KO3A 4KIKA 2L7RA 1E7UA 4BKSA 1V49A 2V1YA 1ZW7A 2C7HA 3JSVB 1TTNA 2HJ8A 2BKFA 5J18A 2FCQA 3A4RA 1HE8A 4IM3A 2LUEA 4HXDA 2O6VB 1SIFA 2G3QB 2FIFA 3R3MA 2GBRA 1K8RB 2NPTA 2ZVNA 2KDBA 2WWZA 4XC2A 3R7RA 5EDSA 2WX1A 3X23A 2D11A 2KDIA 1J19A 4A20A
chains in the Genus database with same CATH superfamily
1XEEA 2RD0A 4G0NB 2DHZA 3ECIA 3MTNB 2HDEA 4C80A 1TGZB 1KOTA 4JLCA 1F9JA 1KLVA 2XEWA 4LNKA 2KJHB 2IY0B 3AEAB 1I7HA 4AP4C 1SE2A 4W9GA 3AH7A 3DWMA 4DDID 2KFJA 1JCKB 2PEAA 4GXBA 3H9DA 3R7QA 2DBYA 4LJPB 3KYDD 2M8SA 4AQ7A 3IFWB 4N59A 4KVGB 1VZ6A 3RUIB 1ENFA 4NPNA 2IO1B 4FJZA 1JROA 3NUHB 4K3BA 4OZCA 3ZVVA 5HI1A 3DCGA 4K81A 1WIAA 2JRHA 2A5UA 4B9KA 4LDTB 1ZDXA 4IW0A 4TQ0A 2KTRB 2WU2B 3H7PA 4R3DA 2G1EA 2IYDB 4WJNA 2IO3B 1OQRA 1I4XA 2WYQA 1T0QC 4WIPA 4WAAA 4US8A 3PSEB 4HWIB 3AE8B 1YD8U 3AI5A 1VJKA 2LVQA 5JXVA 4AOFA 4ZHOA 1TZ1A 4GU2A 1YX5B 4W9DA 1WE7A 3ZXRA 3WAOA 3ML9A 2ZCCA 4FHKA 2KD0A 2O6VA 2Y5BB 1WY8A 5BMIA 1WJ6A 1GJZA 2BYEA 2GI9A 5FK9C 1PFDA 4S0RA 1WXAA 2IGHA 1WX9A 1IGDA 1FIQA 1P7FA 1Z2MA 2W9NA 3I5JC 4YSYB 1MHXA 4QAYA 4FADA 2K25A 1J7AA 3RFZB 1WGKA 3IBEA 5J2RA 2LMCA 1XCTL 5IO9A 3BK1A 4BZAA 4HDQA 2EKEC 3DPDA 4JWUC 2ZEQA 4DHJB 4ZRQA 1TIFA 5HFYA 1F0ZA 2K5PA 5LXHA 3TL5A 3QARA 1Y8RC 4Q2JA 2L76A 5E6NA 5BO4B 2KFKB 4LNFA 1YQ4B 2JXTA 4M02A 1WYWB 1TT5B 4ZRPA 1WFYA 3EFUA 2KX3A 4RMAA 3N20C 3O65B 2GB1A 3UQAA 4EZLA 1JALA 5LXIB 2KTRA 4USAA 2MP2B 4B6WA 3U4EG 4JX1C 3W5UB 5IP4D 4MH8A 1E7VA 2IO0B 1FXTB 4FLHA 5AUIA 4WJOA 2UU7A 3KUDB 4KGSA 1ET9A 4YSXB 1N60A 4IWQA 1HTOA 2GBMA 3B2GA 2JYEA 3B08A 3I63C 1HA5A 4WH4A 1T3QA 1Q5WB 3PLVA 5IOIA 3DWGC 3Q6BA 3AE2B 4L1BA 4MSQB 3PLUA 1DYQA 2JX5A 5BYQA 1VCBA 1LGRA 1F77A 3AU5A 4ASWC 5J17A 2L1AA 2BBCA 3M63B 4N6EB 3BYYB 2L52A 4YL8A 4TUUA 3SFEB 3PZ7A 3WALA 4AJYB 1YJIA 1P1AA 2BYVE 4WJQA 3TCAA 2L83A 2K3UA 2KDFB 3AXCA 4A3OA 3SD5A 1FNWA 2JZZA 2INPE 3RCZA 1Q0WB 2KFKA 3KUZA 3IT6B 2WXIA 3PRMB 2G4SA 2X38A 1E8XA 3B9JA 1GC6A 1SF0A 1WGGA 3V3XA 2QSDA 1YN5A 2O2VB 1H8CA 4F8CB 3CSTA 2PLPA 3ZNHB 1FO4A 3U2SC 3NVZA 1XLPA 2MP2A 2KKCA 3FC4A 2KT7A 3A4SC 3LDZE 3VUXA 1AW7A 3BK2A 2ZVOA 1WGYA 2WDTB 2LI5A 4MGKE 5GMVA 2MJEA 3TSSA 4DWFA 4NJ6A 2DZJA 3VRAB 4HJKA 2AEHA 2ZZPB 5JHBA 5D94A 4IWOA 3IXSA 2K8CA 1T5XD 2MCNB 5AUKA 2WQYB 3ZLZA 4AWJA 1C79A 2PIAA 4MH0E 3SHQA 4W9FA 3U7DA 3AEGB 4JE3B 4WWNA 4M00A 3L16A 1XQQA 1E8YA 4MM3B 4NY0A 4HPMB 3APFA 2FAZA 3Q8CA 1K51A 2UYZB 5DPRA 3NVYA 2KN4A 2J4XA 2IDYA 3ZTCA 2NTSA 2JWUA 4D2KA 3RZWC 4E74A 3UGBB 4BKTA 3P42A 4XWWA 1UGJA 3IT4B 2CHWA 3K9PB 1NVID 2KLGA 1GNUA 1MVKA 3ZJUA 4KIKB 4C56C 2Z8LA 2FCNA 3ETRA 2MH7A 2M56B 1AN8A 2O2VA 4NQLB 4MGIE 3AULA 1OGWA 4FBJB 3N3KB 4TV3A 1MJDA 1BXTA 3LB8C 1EU3A 3ABVB 3FAHA 2L8JA 1IYFA 1VZ7A 3Q8FA 1NYRA 3AE3B 1WZ3A 5H8YE 2V4LA 1UUPA 3EECA 4MJSB 2EMSA 4ZDVA 3AEEB 2WXRA 3NY5A 5IN7A 4RNAA 2M0AA 5H92C 2BS2B 4XZ4A 3C0RB 2IPKD 2Z0EB 1UBIA 3BIID 1P0RA 2MRPA 3CSFA 3W9CB 4ZRKA 4IKGA 2EMTA 4MM3A 1KFYB 1V2YA 1SGHA 1WR6E 2RPQA 2KWUB 4I6NB 3ZGZA 4RF0A 2LGSA 2KVRA 4PYUA 2N7JA 2V0GA 1WXVA 1UELA 5C1ZA 3X0WA 2PJHA 2ZPNA 4TMAB 3N1XC 3QQ8B 2WDQB 4A6QA 2KO3A 4KIKA 1E7UA 1EM7A 1V49A 1ZW7A 3JSVB 1TTNA 1OQQA 5J18A 2FCQA 2OJWA 3R3MA 2TSSA 1L6UA 2NPTA 2ZVNA 3AEBB 2KDBA 2NTTA 3R7RA 3X23A 2D11A 2KDIA 2INCC 2KACA 3UF8A 3UIPB 1V5OA 4J3OD 1L5PA 4LJOB 3DHIC 3PPAA 2AWTA 1FM0D 3AE9B 1WGDA 5FR3A 1OFFA 1I4GA 5HHDG 4KGTA 4OVZA 2FUG1 1OEYJ 3AEFB 1RRBA 3L08A 4TSSA 4J6IA 1V97A 3MFGA 2KMCA 2DENB 2WLBA 4ACFA 1WH3A 4CYEA 1ZE3D 1A5RA 3MHSD 4ZYSA 2MEKA 1J7CA 4OHJA 3ZRCA 3BYTB 1V1OA 1QZEA 3KWLA 1ZGUB 2WXOA 4DQOC 3IG3A 1EO6A 1ZP0B 2WXPA 4EZKA 5C3JB 1Q1OA 3HHMA 2QHOA 3L54A 4RGTA 5T8IA 3L10B 4ARCA 1FXAA 3JSVA 2GRIA 1KRHA 4A55A 2HJ1A 3IVFA 4BAXA 1EUVB 1E9MA 4HLEA 4BOSC 1WMHB 2A4ZA 3E56A 2AL6A 3VXWA 3GZNI 3H7PB 1HZ6A 3GE3C 3T8MA 4A3PA 3ALBA 2LGDA 2KMAA 4O1NA 3NOBA 2JF5A 4WJPA 2RDBC 4W9KA 1S1QB 3N1ZC 4LNNA 4H2AA 1GC7A 4YTNB 2RPVA 2K8HA 3GZNB 1BUIC 4ITKA 3RT3B 3VTVA 2INDC 3HM6X 3ONSA 2BWFA 5G5GA 2BYTA 4IDIA 2DZMA 4G50A 3HIZA 3LYYA 3HUIA 2JU6X 1WYGA 3WIMA 1PQSA 2K9XA 3VR9B 3R2IA 2KJ6A 2H89B 2LRWA 2DZIA 2N7DA 5I4DA 2LFIA 3B1LX 3R2TA 1QOGA 1VRAB 2KOXA 2ONQA 3MC8A 2K0PA 1YNTE 4L23A 4PS7A 3VR8B 2GMIC 1FEHA 1QOFA 2QCZA 2JZ3B 4XDCA 3VUWA 4K7WA 1GB4A 4AS1A 2KQ4X 4AJWA 2BS4B 4NQKE 3P63A 2KNBA 5LNK1 3TMPB 1C76A 1NI3A 4KV2A 3GE8C 4M0WB 4JPSA 3VRBB 4LK0M 4ANWA 1YOVB 2J0MA 2KMMA 1QQRA 3A1QB 4PYZA 2CHXA 1WMHA 3HVDA 1WGRA 1V9JA 3RNBC 2I1JA 3MJ5A 1OTRB 3P4PB 1ET6A 3B0AA 5HKHA 3ZQ4A 2BPSA 2WXQA 1WI0A 3Q3OC 4RM8A 2KK8A 4E71A 5TSSA 4PS3A 2BS3B 3OG5A 3AM9A 3RULA 4IG7B 4EOYA 4KSLC 2CJNA 1PGAA 2IY1B 2KWDA 2R2OA 2V3NA 2ASQA 4KZ0A 4DXGA 1WWTA 2VZKD 3EC8A 3VH4B 1XT9B 3Q3JA 2N9PC 1WJUA 1UD7A 2C5LC 4DBGA 1KLUD 1QKZA 1NYQA 2J52A 3NVVA 2B3AA 1L7YA 2KC1A 2M1MA 3T3NA 5DPWA 3KLSX 2IGDA 2H88B 3HK0A 2MBOA 1DGJA 1IP9A 2AYOB 1WXMA 3H1UA 3AB5A 4GB9A 3GB1A 3TBLD 1B9RA 2ACZB 4GMVA 2YVCA 4HJGE 3U30A 1XO3A 3EHVA 4HEA1 3TEZA 3TEYA 4M0WA 1T0RC 3SFDB 4C4VB 2KWCA 3V6CB 5G55A 3A1QA 1WJNA 4M8NA 1F2RC 3ZXVA 2WXKA 2GBJA 1XLNA 1I4RA 1TBEA 2CU1A 1L0XB 4I6PA 1RFAA 3AEDB 2KQSA 1JQ4A 1IBXB 5D6JB 2PVGC 4ICUA 1HQRD 4F7ZA 2BTEA 1YJ1A 1V6EA 3QK0A 1TS3A 2WU5B 4RCOA 1RWSA 1TS4A 2WX0A 2WXLA 3AECB 1CZPA 1D6EC 1L2NA 4JL9A 1SIJA 1UGMA 1TKGA 2EELA 1JWBD 4YWGG 2LWPA 4HPPA 1ACCA 1SXTA 2WP9B 1Q10A 3WAMA 3I57A 4MT5A 3QCAA 2L0TA 1FXIA 3I3TB 2N0SB 1Y56A 3C8YA 5CHFA 3P1MA 3QHTA 2BQQA 3DHHC 4XDDA 3RI7C 2L05A 2N9EB 1R4MI 4LLGM 4X57B 1STEA 2AL3A 4N9F4 1T0YA 1ROEA 4BOZB 1MHHE 1SE9A 3BZDB 4XYCA 1Z5SB 4WAFA 2MBBB 1EU4A 3CMMB 2K39A 4E3CA 1R4MB 1SEBD 1JW9D 3JW0X 3NJTA 3PT2B 3DDCB 4C4VA 3HM3A 4NAMA 3KWVA 2MBQA 4K1RB 1WM2A 4HRSA 2HE7A 5E6PA 4YTMB 1V1PB 4FJYA 1HZ5A 4NJ7A 2CKHB 4PK1A 2J53A 4BKSD 3DBHI 3APDA 1C77A 3W5VB 2JUOA 5G2NA 1N62A 3M95A 1WX8A 2SAKA 4MACA 5BYRA 1IBXA 4JIOU 4YTPB 2KDEB 3DBRI 3APCA 2OOBB 1DOIA 1V80A 3A33B 2KXJA 3DBHB 4P6VF 4C7ZA 1KM7A 1MPEA 1FCCC 1I42A 4US9A 2NBUA 5L83A 4RM9A 2BWES 1CQVA 2K22A 2C7HA 3UI3A 2HJ8A 2BKFA 3DBRB 1FNUA 4IM3A 3PO0A 1SIFA 2FIFA 4P16A 1MG4A 1MI0A 3ZJVA 5LLIA 4WWMA 4A20A 3PRPB 4XX5A 3WANA 2WXNA 4BFRA 2MJDA 1DOYA 4II2B 1QOAA 3H7SA 3N32A 2QIEB 4ANVA 1J0GA 2MW5A 4P1CC 1EF1A 2BYFA 1V81A 4A8XC 2XBBC 2VRRB 1FFVA 1UZXB 3VTWA 1TKYA 2J0KA 1WF9A 4MEMA 2M19A 4ZRJA 3ZO5B 3KW5B 2NPTB 1V1PA 4ZOHC 2X8XX 1TS5A 2IZVB 4HKZE 4WQOB 5C2TB 3Q69A 1AARA 3DVGX 2VH1A 3M3JA 2K1FA 3CF6E 3P2BA 4MGYE 2KX0A 3RD2A 2MLBA 3VFKA 1LQBA 2DZKA 1GB1A 3ZYYX 4IM0A 4WQMA 3W1SC 1K50A 1V8CA 2JZPA 1TZOA 3HRDD 2NCNA 2J0JA 4YT0B 1LXDA 3EGRA 4YSZB 4C7YA 3URYA 1RFKA 1FNVA 5JHAA 1YIWA 3EA6A 2D3CA 2FIDA 4BKGA 3J9CA 3WAPA 2FNJB 5IKCM 2YLMA 2V9HA 2D07B 1WRDB 4I6LB 1C4CA 2NBVB 4G11A 4EE2A 3TJPA 2D3AA 2D10A 2JSVX 4HPLB 3ML8A 3O13A 2W54A 1D5XC 3DBLI 3KYCD 4KZCA 2HD5B 2FCSA 3LJ3A 4MGZE 2G45B 1N6ZA 3IAM1 2XN9C 4FJVB 2WXFA 1XLQA 2LGIA 3SDLC 2WHIA 1KTKA 2ZNVC 1WX7A 2N1VA 2ZCBA 1WM3A 2CU3A 2AQ3B 4EFOA 1NI2A 2DYOA 2NVUI 3BVZA 3PREA 3JYUA 2QDFA 5GXGB 1SJED 4OZAA 1KLGD 1F52A 4FULA 1E7PB 1L6VA 2VZKB 4EEWA 1WZ0A 2C60A 2REXA 4W9JA 3OAWA 5EE0A 4RGMA 2GOWA 3VQIA 1BMLC 2KLCA 3KH0A 2QC8A 2NR2A 3UIOB 1D5ZC 1MG8A 2M17A 3QX1A 4OZBA 1S3SG 2C7MB 1SSNA 2KVZA 3OLMD 4ZRIA 1EWCA 1RYJA 2LHDA 2IGGA 1YN4A 2FCMA 1BT0A 2KC2A 2GBKA 2ZPYA 4FN2A 4REZA 1NDDA 2JT4B 1U4AA 3V60A 2QMTA 2JYTA 3D32A 2V3PA 2Z0DB 3H6NA 5CHVC 4DXAB 4LNIA 1C3TA 2LZ6A 2ZW0A 3NZ3A 4DXFA 2WGSA 5FKAC 3N1YC 2R2QA 5C23A 3VVWB 2Z59B 4P7IA 3WA0A 3PZDA 4KSKC 5D7GA 4P1BC 4KKIA 5E6OA 2BF8B 4TQ1A 4IWPA 4GGQA 4GSWA 4HCNB 4A90A 4GN1A 1QT9A 1KH0A 1WE6A 2AX5A 2N7EA 2UWQA 2FE8A 4M01A 1FMAD 1TS2A 3P4RB 5DPSA 2RDHA 3V05A 1JWSD 1J8CA 2AQ2B 4BBNC 4ZHPA 2HTHA 2WDVB 4KGRA 1K53A 1ESFA 4YXDB 3DHGC 2K6QA 2L0FA 3RNGC 5L95C 2RMMA 4NAWB 1SB3C 3ENEA 4DK5A 2KJRA 3GP7A 2WXMA 2D5GA 1TY2A 4K3CA 1E8WA 3BWUD 1UWMA 1T0SC 5AZFA 4K7UA 4PT5A 2PE6B 3ZNGC 2N1WA 2KZRA 1ZDVA 2NBWB 3MC0B 3KQ4A 2LASA 1AWDA 1WSPA 3KUCB 2FBWB 3L0WB 1C78A 3TEWA 1ZKHA 3IAS1 2PKOA 2N4FA 2I1KA 3NHEB 1D4BA 4ARIA 4TKNA 4XE0A 4EZJA 3DVNV 3AN1A 2WXHA 3AV8A 1F2RI 3VHTC 2PW9A 2IJ0A 2W55A 3V61A 1ZXIA 2N9LA 1JWMD 2L3ZA 3L13A 2I2YA 2R61A 4B0MA 5D3IB 5DPTA 2LJ5A 1P9DU 3N9YC 2J7QB 2N9XA 1ZPSA 4W9LA 3VH3B 1ZUD2 2XNAC 1I35A 2WDRB 4OW0A 3ZNID 2MWSB 2M0XA 1IGCA 1RM6C 2RDGA 4CQNA 3Q3FA 1N63A 1JWAD 1JWUD 4GOCA 2BT6A 4NAWA 3BY4B 4HCPB 4WWOA 3PGEA 3TUOA 2M4NA 1WRIA 4NZLB 2MQJA 3BVMA 2RSUA 4HDOA 3DVGY 2B76B 5BMGA 1FPYA 3AE6B 2Y3AA 3V6EB 4KDIC 5D3DA 2I38A 2NS5A 1UF0A 2D2QA 4W9CA 1QILA 3A9JB 1IPGA 4II3B 1C4AA 2C7NB 1V86A 4RGOS 1J7BA 3RNCC 1KJTA 1R4NI 1UH6A 4BVUC 1NEKB 2PVOD 4CHKA 1G6JA 3CIRB 1OQYA 3TIXA 2BGFA 3W2DA 1R4NB 1E90A 3AU4A 3TEXA 2HTME 2Q5WD 4BKSA 2L7RA 1R7SA 2KAJA 3A4RA 1HE8A 2PMVA 1JRPA 4NJCA 2WXJA 2GBRA 1K8RB 1QF6A 2WWZA 2GLSA 4XC2A 5EDSA 2WX1A 1L0VB 1J19A 3SU8X 3RPFC 4S17A 4DDGD 2L00B 3L17A 4PS8A 1FFUA 3QA8A 3AE1B 1NENB 2VH2A 2G9HD 2LGYA 4XWTA 1WGHA 4IOIE 2JVCA 2DWQA 2V3SA 2OJRA 1D5MC 2QEJC 1A70A 3DBSA 1WXQA 1YQ3B 3EUB2 3K9OB 4BBNF 1N5XA 3A9JA 1P98A 4EUTA 2LRUA 1OEYA 3DVNU 1L0YB 2LXCA 2YEPF 2AQ1B 2O6VD 1PDXA 1SBBB 1VD2A 2IBIB 3VDZA 4M8MA 2J42A 4RGNA 4HROA 2JPHA 1E10A 4KDLB 1ISNA 2KHWB 3BINA 4LCDE 3U7ZA 1KF6B 1M94A 1PUTA 2ON8A 4WWPA 3RNEC 3P4SB 5IA7A 2DX5B 3SR6A 1B1ZA 4GDLB 1WJ4A 2QILA 3AE4B 2KN5A 3PVLA 1E6EB 2PPHA 1GUAB 1I4QA 3OJ3A 2JQRB 1QLBB 3B2FA 4B95A 1D3ZA 2LVOA 4A9AA 3NS1A 3Q14C 1TYGB 4FA6A 1VDVA 3U8ZA 3Q3NC 1VZ8A 4URKA 5BYSA 3ZKJC 3DQVA 4LDTD 3LXFA 1T6BX 3ZNZB 2XK5B 1WXSA 3AE7B 2LXAA 2MX2A 3PTFC 3Q8BA 4W9HA 1YMHE 4W9IA 3U52E 5AEKB 2GBNA 2MJ3A 1E0ZA 4GDKB 2NMQA 1UWXA 2DAFA 3Q8EA 1VLBA 3M62B 1P3QU 3NZSA 1XXGA 1EWYC 3PS6A 3UINB 1DOXA 2RR9A 2JXXA 2G4DB 1CMXB 1YN3A 1GAQB 3MJWA 5BMHA 1K52A 2V4IB 3KVFB 5EE1A 3CWIA 2K6DB 3NVWA 4B0EA 1E5WA 3ZTDA 1AYFA 4IC7B 5MPOA 5JH5C 4IUMB 3RNFC 2LGXA 2DYBA 2DNFA 5JZEB 2KANA 2LVPA 3OJ4B 4CO7A 5KHOA 2RGFA 3QAQA 3DOWA 1TKEA 4JGHB 4JQWC 4DHJD 4DHZB 5D2MB 4GDLA 1L4ZB 3RN9C 1C1YB 2CJOA 1YJJA 2ZNVB 4LNOA 3AE5B 4AUQC 2E6XA 3HVZA 3FKYA 2D3GA 3IHPC 4LTUA 2ICIA 2KQ7A 2OHFA 1FRDA 2MA9B 3RZFA 1LO5D 3S2AA 3ZDTA 1TY0A 4KKJA 3T3OA 3PV1A 3FILB 3PHXB 1PYWD 2XK5A 1SE4A 1TJEA 2Y5PA 3W1SA 3GOEA 3NS8A 3RMKC 2BB5A 2LHEA 4IM2A 5G5HA 2W82A 3ZDMC 2JWZA 4GDKA 1IUEA 1PGBA 2L32A 4OVVA 3NG0A 2BVCA 4FHJA 3VTUA 2ZJDA 3R66C 4XGAB 1XLOA 3JVZX 4MSMB 4C00A 2PE9A 1XD3B 1GG3A 1UBQA 2W3RA 4KX6B 1NBFC 2KTFA 2CS4A 3P4QB 4ZYNA 2WS3B 2ZW1A 2WXGA 1I4HA 4K7SA 2DAJA 1N5WA 5DCNA 3DBLB 3PHWB 1HEZE 2Y5CA 3RYTA 4GLSC 3A9KB 5TR5A 5EE3A 3ZIMA 4NNJB 1VR9A 3W1YA 4HK2A 4WURA 2EKIA 4UDUC 4W9EA 3QIJA 1MFWA 3ZRFA 4MELA 3T9LA 4L2YA 1LFDA 2MSED 3PRZA 4GIVA 1RAXA 2N9KA 1HXYD 3QJZA 1X1MA 1PGXA 3SEBA 2IO2B 2OEDA 1YX6B 2C9WB 3UQBA 2LD9A 3FILA 4OVUA 3BVGA 5IAAC 2JRIB 4HVBA 3R8BA 2SEBD 3ZW3A 2CR5A 2YEPB 1CK1A 1E8ZA 5EE9A 1WR1A 2BB6A 2JY6A 1M4VA 4DHZE 4MJSA 3VAWA 2DLBA 1QOBA 4ANUA 3NRZA 1CJEA 4RF1A 4JWSC 3WCQA 5E6JA 3RNAC 4HKQA 1EF5A 3MHZA 1H4RA 1L4DB 2BKRB 3MC9A 3VUYA 3QC8B 4N58A 5CHWA 4F1SA 2MHJA 2LUMA 2CHZA 2KWVB 2LJIA 1GPXA 3N30A 2FUHB 1V5TA 1YQBA 2WNMA 3AMZA 1RLFA 1XF5L 3Q2AC 3NZUA 5CTRC 4EKUA 5AZGA 3L4PA 1GOZA 3EFCA 1FD6A 3A9KA 1JMLA 1HTQA 3OWEB 2E3TA 2KDMA 4G3XB 3Q8AA 5AZHA 3ZJTA 1XCQL 2W3SA 1ZOYB 2QJLA 1ZXHA 2K8BA 4MDKE 1LM8B 2LEKA 3MP9A 1JRUA 4ICVA 1C4PA 3Q3MC 5KHQA 3QWZB 2MBEA 3GS2A 4FXCA 1SJHD 3ZUNA 5FR6A 4RFBA 4ANXA 2BW2A 1UNSA 2DYMA 1SE3A 5CX3A 2INNE 1N61A 3I9V1 2MBHA 2PTLA 3V62A 1C9FA 1P7EA 2V1YA 3H8HA 1FCLA 3C19A 2LUEA 4HXDA 2O6VB 2D3BA 2G3QB 1FRRA 3E9SA 1F1HA 4RH6A 2KYWA 3PZ8A 5HG2A 1I4PA
chains in the Genus database with same CATH topology
3SU8X 3UF8A 2RD0A 1V5OA 4G0NB 2DHZA 3ECIA 3UIPB 3PRPB 3MTNB 1TGZB 4XX5A 1KOTA 4LJOB 4JLCA 1F9JA 3PPAA 3WANA 4DDGD 1KLVA 2AWTA 2XEWA 4BFRA 4II2B 2KJHB 3H7SA 3N32A 2L00B 1WGDA 2IY0B 4ANVA 1J0GA 2MW5A 3L17A 1EF1A 2BYFA 4AP4C 4PS8A 4W9GA 1V81A 3QA8A 2XBBC 2VRRB 4DDID 2KFJA 1UZXB 2LGYA 2PEAA 1OEYJ 4GXBA 1WGHA 3VTWA 2J0KA 3H9DA 3R7QA 4LJPB 1WF9A 1RRBA 4MEMA 3KYDD 2JVCA 2M8SA 3L08A 4ZRJA 3ZO5B 4J6IA 2V3SA 2OJRA 3IFWB 3KW5B 2NPTB 4KVGB 3DBSA 4NPNA 2KMCA 2DENB 3RUIB 2IO1B 4FJZA 1WH3A 2IZVB 4CYEA 4WQOB 1A5RA 3ZVVA 3MHSD 3K9OB 4BBNF 1AARA 3DCGA 4K81A 1WIAA 3DVGX 3A9JA 3ZRCA 1P98A 4EUTA 2JRHA 2LRUA 1OEYA 2A5UA 4B9KA 4LDTB 3M3JA 3DVNU 1QZEA 2K1FA 2LXCA 3CF6E 2KTRB 3P2BA 4IW0A 4MGYE 4TQ0A 1ZGUB 2KX0A 3H7PA 3RD2A 2MLBA 3VFKA 2O6VD 1LQBA 1VD2A 2DZKA 3IG3A 2IYDB 2IBIB 4WJNA 1EO6A 3VDZA 2IO3B 4IM0A 4M8MA 4EZKA 3W1SC 2WYQA 1Q1OA 2JPHA 4WAAA 3PSEB 4HWIB 3HHMA 4KDLB 1ISNA 1YD8U 2J0JA 2KHWB 2NCNA 2QHOA 3AI5A 2LVQA 3BINA 4LCDE 3L54A 1LXDA 4AOFA 5LLIA 1TZ1A 1M94A 4GU2A 1YX5B 4W9DA 3L10B 1WE7A 3JSVA 5JHAA 3WAOA 1YIWA 3ML9A 4WWPA 2ZCCA 4FHKA 3IVFA 2KD0A 2O6VA 2FIDA 4BKGA 5IA7A 1EUVB 2DX5B 2Y5BB 3WAPA 4BOSC 1WMHB 1WY8A 2FNJB 2AL6A 2A4ZA 2YLMA 4HLEA 1WJ6A 4GDLB 1WJ4A 2D07B 1GJZA 3VXWA 1WRDB 2BYEA 2KN5A 3PVLA 2PPHA 1GUAB 3GZNI 3H7PB 4I6LB 1WXAA 2NBVB 3OJ3A 3T8MA 4A3PA 1WX9A 3ALBA 4G11A 2LGDA 3TJPA 4B95A 1D3ZA 2KMAA 2LVOA 3NOBA 1Z2MA 2JF5A 2D10A 2W9NA 4WJPA 4FA6A 3U8ZA 2K25A 4HPLB 3ML8A 4W9KA 4FADA 4URKA 1S1QB 3IBEA 5J2RA 3DBLI 3KYCD 3ZKJC 1GC7A 3DQVA 4LDTD 4KZCA 2HD5B 3ZNZB 2K8HA 3RT3B 2FCSA 3LJ3A 4HDQA 3VTVA 2EKEC 2XK5B 3DPDA 3HM6X 4MGZE 3ONSA 1WXSA 2BWFA 2ZEQA 4DHJB 2G45B 2DZMA 4G50A 3HIZA 5LXHA 3TL5A 3QARA 2LXAA 4FJVB 1Y8RC 2MX2A 2L76A 3PTFC 5E6NA 5BO4B 2KFKB 3WIMA 4W9HA 1PQSA 4W9IA 5AEKB 2GBNA 1WYWB 3SDLC 2KJ6A 2ZNVC 2LRWA 2DZIA 2N7DA 4GDKB 3B1LX 1WX7A 1WFYA 2N1VA 2ZCBA 3EFUA 1WM3A 2DAFA 2KX3A 4RMAA 2KOXA 3O65B 3M62B 4EFOA 3UQAA 1P3QU 1NI2A 3NZSA 2DYOA 4EZLA 2NVUI 3PS6A 4PS7A 3PREA 3JYUA 3UINB 2KTRA 5LXIB 2MP2B 4B6WA 2GMIC 2JZ3B 2RR9A 2JXXA 3VUWA 4K7WA 2G4DB 1CMXB 1E7VA 2IO0B 1FXTB 3MJWA 4FULA 3KVFB 4AJWA 4FLHA 2K6DB 4WJOA 4NQKE 4EEWA 1WZ0A 2C60A 3KUDB 2REXA 4W9JA 2KNBA 4IWQA 1E5WA 3ZTDA 3OAWA 4IC7B 3TMPB 2GBMA 5JH5C 3B08A 2GOWA 4IUMB 2LGXA 4KV2A 3VQIA 2DYBA 5JZEB 2KLCA 3KH0A 2KANA 2LVPA 3OJ4B 2NR2A 4CO7A 5KHOA 3UIOB 1Q5WB 4M0WB 3PLVA 2RGFA 4ANWA 1MG8A 3DOWA 3QAQA 2M17A 2J0MA 3QX1A 4MSQB 1S3SG 2C7MB 3A1QB 3PLUA 4JGHB 4PYZA 4JQWC 2CHXA 4DHJD 4DHZB 3OLMD 1WMHA 5D2MB 1WGRA 4GDLA 1VCBA 1V9JA 4ZRIA 2I1JA 2FCMA 1OTRB 3AU5A 1C1YB 1BT0A 2KC2A 2ZNVB 2GBKA 2ZPYA 4AUQC 3B0AA 4FN2A 5HKHA 4ASWC 5J17A 1NDDA 2JT4B 1U4AA 3M63B 2BPSA 2D3GA 3IHPC 1WI0A 3V60A 4RM8A 2KK8A 2KQ7A 4YL8A 4E71A 4TUUA 2MA9B 4PS3A 3RZFA 3WALA 4AJYB 3S2AA 1P1AA 2BYVE 3D32A 4WJQA 3TCAA 3ZDTA 3RULA 3PV1A 2Z0DB 3H6NA 3PHXB 4IG7B 5CHVC 4DXAB 2XK5A 4EOYA 2KDFB 3AXCA 4A3OA 3SD5A 1C3TA 4KSLC 2LZ6A 2IY1B 2R2OA 3W1SA 3GOEA 2JZZA 2ASQA 3NS8A 4KZ0A 4IM2A 2R2QA 5C23A 3RCZA 3VVWB 1Q0WB 2KFKA 2Z59B 3EC8A 4P7IA 3WA0A 3KUZA 3ZDMC 3VH4B 1XT9B 3PRMB 2G4SA 3Q3JA 3PZDA 4KSKC 2N9PC 1E8XA 5D7GA 1WJUA 1UD7A 5E6OA 2C5LC 2JWZA 4DBGA 2BF8B 1GC6A 4GDKA 1WGGA 4IWPA 4TQ1A 4GGQA 4GSWA 2O2VB 4HCNB 4OVVA 4GN1A 1H8CA 4F8CB 4FHJA 1WE6A 3CSTA 2N7EA 2UWQA 2B3AA 3VTUA 1L7YA 2KC1A 2M1MA 3ZNHB 5DPWA 2ZJDA 2MP2A 2KKCA 3R66C 3HK0A 5DPSA 1J8CA 2MBOA 1IP9A 3JVZX 4MSMB 2AYOB 1WXMA 3H1UA 2PE9A 4BBNC 2HTHA 3A4SC 1XD3B 1GG3A 1UBQA 4GB9A 3LDZE 3VUXA 3TBLD 2ZVOA 1WGYA 2WDTB 2K6QA 2L0FA 4GMVA 2LI5A 4MGKE 1NBFC 2YVCA 2KTFA 5L95C 3U30A 5GMVA 2CS4A 4NAWB 4ZYNA 4DWFA 3EHVA 4NJ6A 3ENEA 2DZJA 4DK5A 2KJRA 4K7SA 2DAJA 4HJKA 2AEHA 2ZZPB 5JHBA 5DCNA 3PHWB 5D94A 4IWOA 1E8WA 2K8CA 2KWCA 5G55A 2MCNB 3RYTA 3A1QA 3A9KB 5TR5A 3V6CB 3ZIMA 4NNJB 1WJNA 3W1YA 4HK2A 5AZFA 4K7UA 4M8NA 2PE6B 3ZNGC 3ZLZA 2N1WA 2KZRA 4W9EA 4AWJA 2GBJA 4MH0E 3SHQA 3QIJA 4W9FA 2NBWB 4MELA 3T9LA 3ZRFA 3U7DA 2LASA 1TBEA 2CU1A 4WWNA 3KUCB 4I6PA 1LFDA 3L16A 2MSED 3PRZA 1XQQA 1E8YA 3L0WB 1RFAA 1RAXA 4GIVA 4NY0A 1ZKHA 3QJZA 2KQSA 4HPMB 1X1MA 2N4FA 3APFA 2FAZA 2UYZB 2IO2B 5DPRA 1YX6B 3ZTCA 5D6JB 2C9WB 4ICUA 2I1KA 4F7ZA 3UQBA 2LD9A 1YJ1A 3NHEB 3RZWC 4E74A 3UGBB 4OVUA 1V6EA 3QK0A 4TKNA 4BKTA 5IAAC 2JRIB 2WX0A 4EZJA 3DVNV 4HVBA 2CHWA 3K9PB 2CR5A 3ZW3A 1L2NA 2KLGA 4JL9A 1GNUA 3VHTC 1UGMA 1E8ZA 1WR1A 3V61A 2JY6A 2LWPA 4KIKB 4DHZE 4MJSA 3VAWA 2L3ZA 4ANUA 3L13A 2FCNA 2O2VA 4NQLB 3WAMA 3QCAA 2L0TA 4MGIE 5DPTA 3AULA 3I3TB 1EF5A 1OGWA 1H4RA 2LJ5A 4FBJB 1P9DU 2BKRB 2J7QB 3N3KB 4TV3A 2N9XA 3QHTA 5CHFA 3VUYA 4W9LA 3QC8B 3VH3B 5CHWA 4F1SA 2L05A 2N9EB 1I35A 1R4MI 2CHZA 2KWVB 4X57B 3ZNID 2MWSB 2M0XA 2AL3A 4N9F4 3N30A 2L8JA 3Q3FA 2FUHB 1V5TA 1IYFA 1T0YA 1YQBA 4GOCA 4BOZB 1RLFA 1SE9A 4NAWA 1Z5SB 3BY4B 4HCPB 4WWOA 2MBBB 1WZ3A 3PGEA 3CMMB 2M4NA 3NZUA 5CTRC 2V4LA 4EKUA 2K39A 3EECA 2EMSA 2MQJA 4MJSB 5AZGA 4E3CA 4ZDVA 2RSUA 3JW0X 3PT2B 3DDCB 3NY5A 3HM3A 4HDOA 3A9KA 3DVGY 2MBQA 4K1RB 1WM2A 5E6PA 2HE7A 4FJYA 4XZ4A 4G3XB 3V6EB 4KDIC 2NS5A 3C0RB 2D2QA 2Z0EB 1UBIA 4W9CA 4NJ7A 5AZHA 1P0RA 2MRPA 2CKHB 3A9JB 1IPGA 3CSFA 4II3B 4BKSD 2C7NB 3DBHI 4ZRKA 3APDA 1V86A 2K8BA 2EMTA 4MDKE 4MM3A 1LM8B 2JUOA 5G2NA 1JRUA 1KJTA 1R4NI 1WX8A 1V2YA 3M95A 4ICVA 3QWZB 5KHQA 2MBEA 1SGHA 1WR6E 1UH6A 3ZUNA 2RPQA 4JIOU 5FR6A 2KWUB 4I6NB 4BVUC 2KDEB 3DBRI 3APCA 2OOBB 4ANXA 4CHKA 2DYMA 5CX3A 2KVRA 4PYUA 1V80A 3A33B 1G6JA 2KXJA 1WXVA 2MBHA 1UELA 3V62A 5C1ZA 3X0WA 1OQYA 1KM7A 2PJHA 2ZPNA 3TIXA 2BGFA 1I42A 5L83A 2NBUA 3QQ8B 4RM9A 1E90A 3AU4A 2BWES 2KO3A 4KIKA 2L7RA 1E7UA 4BKSA 1V49A 2V1YA 1ZW7A 2C7HA 3JSVB 1TTNA 2HJ8A 2BKFA 5J18A 2FCQA 3A4RA 1HE8A 4IM3A 2LUEA 4HXDA 2O6VB 1SIFA 2G3QB 2FIFA 3R3MA 2GBRA 1K8RB 2NPTA 2ZVNA 2KDBA 2WWZA 4XC2A 3R7RA 5EDSA 2WX1A 3X23A 2D11A 2KDIA 1J19A 4A20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SU8 X;  3UF8 A;  2RD0 A;  1V5O A;  4G0N B;  2DHZ A;  3ECI A;  3UIP B;  3PRP B;  3MTN B;  1TGZ B;  4XX5 A;  1KOT A;  4LJO B;  4JLC A;  1F9J A;  3PPA A;  3WAN A;  4DDG D;  1KLV A;  2AWT A;  2XEW A;  4BFR A;  4II2 B;  2KJH B;  3H7S A;  3N32 A;  2L00 B;  1WGD A;  2IY0 B;  4ANV A;  1J0G A;  2MW5 A;  3L17 A;  1EF1 A;  2BYF A;  4AP4 C;  4PS8 A;  4W9G A;  1V81 A;  3QA8 A;  2XBB C;  2VRR B;  4DDI D;  2KFJ A;  1UZX B;  2LGY A;  2PEA A;  1OEY J;  4GXB A;  1WGH A;  3VTW A;  2J0K A;  3H9D A;  3R7Q A;  4LJP B;  1WF9 A;  1RRB A;  4MEM A;  3KYD D;  2JVC A;  2M8S A;  3L08 A;  4ZRJ A;  3ZO5 B;  4J6I A;  2V3S A;  2OJR A;  3IFW B;  3KW5 B;  2NPT B;  4KVG B;  3DBS A;  4NPN A;  2KMC A;  2DEN B;  3RUI B;  2IO1 B;  4FJZ A;  1WH3 A;  2IZV B;  4CYE A;  4WQO B;  1A5R A;  3ZVV A;  3MHS D;  3K9O B;  4BBN F;  1AAR A;  3DCG A;  4K81 A;  1WIA A;  3DVG X;  3A9J A;  3ZRC A;  1P98 A;  4EUT A;  2JRH A;  2LRU A;  1OEY A;  2A5U A;  4B9K A;  4LDT B;  3M3J A;  3DVN U;  1QZE A;  2K1F A;  2LXC A;  3CF6 E;  2KTR B;  3P2B A;  4IW0 A;  4MGY E;  4TQ0 A;  1ZGU B;  2KX0 A;  3H7P A;  3RD2 A;  2MLB A;  3VFK A;  2O6V D;  1LQB A;  1VD2 A;  2DZK A;  3IG3 A;  2IYD B;  2IBI B;  4WJN A;  1EO6 A;  3VDZ A;  2IO3 B;  4IM0 A;  4M8M A;  4EZK A;  3W1S C;  2WYQ A;  1Q1O A;  2JPH A;  4WAA A;  3PSE B;  4HWI B;  3HHM A;  4KDL B;  1ISN A;  1YD8 U;  2J0J A;  2KHW B;  2NCN A;  2QHO A;  3AI5 A;  2LVQ A;  3BIN A;  4LCD E;  3L54 A;  1LXD A;  4AOF A;  5LLI A;  1TZ1 A;  1M94 A;  4GU2 A;  1YX5 B;  4W9D A;  3L10 B;  1WE7 A;  3JSV A;  5JHA A;  3WAO A;  1YIW A;  3ML9 A;  4WWP A;  2ZCC A;  4FHK A;  3IVF A;  2KD0 A;  2O6V A;  2FID A;  4BKG A;  5IA7 A;  1EUV B;  2DX5 B;  2Y5B B;  3WAP A;  4BOS C;  1WMH B;  1WY8 A;  2FNJ B;  2AL6 A;  2A4Z A;  2YLM A;  4HLE A;  1WJ6 A;  4GDL B;  1WJ4 A;  2D07 B;  1GJZ A;  3VXW A;  1WRD B;  2BYE A;  2KN5 A;  3PVL A;  2PPH A;  1GUA B;  3GZN I;  3H7P B;  4I6L B;  1WXA A;  2NBV B;  3OJ3 A;  3T8M A;  4A3P A;  1WX9 A;  3ALB A;  4G11 A;  2LGD A;  3TJP A;  4B95 A;  1D3Z A;  2KMA A;  2LVO A;  3NOB A;  1Z2M A;  2JF5 A;  2D10 A;  2W9N A;  4WJP A;  4FA6 A;  3U8Z A;  2K25 A;  4HPL B;  3ML8 A;  4W9K A;  4FAD A;  4URK A;  1S1Q B;  3IBE A;  5J2R A;  3DBL I;  3KYC D;  3ZKJ C;  1GC7 A;  3DQV A;  4LDT D;  4KZC A;  2HD5 B;  3ZNZ B;  2K8H A;  3RT3 B;  2FCS A;  3LJ3 A;  4HDQ A;  3VTV A;  2EKE C;  2XK5 B;  3DPD A;  3HM6 X;  4MGZ E;  3ONS A;  1WXS A;  2BWF A;  2ZEQ A;  4DHJ B;  2G45 B;  2DZM A;  4G50 A;  3HIZ A;  5LXH A;  3TL5 A;  3QAR A;  2LXA A;  4FJV B;  1Y8R C;  2MX2 A;  2L76 A;  3PTF C;  5E6N A;  5BO4 B;  2KFK B;  3WIM A;  4W9H A;  1PQS A;  4W9I A;  5AEK B;  2GBN A;  1WYW B;  3SDL C;  2KJ6 A;  2ZNV C;  2LRW A;  2DZI A;  2N7D A;  4GDK B;  3B1L X;  1WX7 A;  1WFY A;  2N1V A;  2ZCB A;  3EFU A;  1WM3 A;  2DAF A;  2KX3 A;  4RMA A;  2KOX A;  3O65 B;  3M62 B;  4EFO A;  3UQA A;  1P3Q U;  1NI2 A;  3NZS A;  2DYO A;  4EZL A;  2NVU I;  3PS6 A;  4PS7 A;  3PRE A;  3JYU A;  3UIN B;  2KTR A;  5LXI B;  2MP2 B;  4B6W A;  2GMI C;  2JZ3 B;  2RR9 A;  2JXX A;  3VUW A;  4K7W A;  2G4D B;  1CMX B;  1E7V A;  2IO0 B;  1FXT B;  3MJW A;  4FUL A;  3KVF B;  4AJW A;  4FLH A;  2K6D B;  4WJO A;  4NQK E;  4EEW A;  1WZ0 A;  2C60 A;  3KUD B;  2REX A;  4W9J A;  2KNB A;  4IWQ A;  1E5W A;  3ZTD A;  3OAW A;  4IC7 B;  3TMP B;  2GBM A;  5JH5 C;  3B08 A;  2GOW A;  4IUM B;  2LGX A;  4KV2 A;  3VQI A;  2DYB A;  5JZE B;  2KLC A;  3KH0 A;  2KAN A;  2LVP A;  3OJ4 B;  2NR2 A;  4CO7 A;  5KHO A;  3UIO B;  1Q5W B;  4M0W B;  3PLV A;  2RGF A;  4ANW A;  1MG8 A;  3DOW A;  3QAQ A;  2M17 A;  2J0M A;  3QX1 A;  4MSQ B;  1S3S G;  2C7M B;  3A1Q B;  3PLU A;  4JGH B;  4PYZ A;  4JQW C;  2CHX A;  4DHJ D;  4DHZ B;  3OLM D;  1WMH A;  5D2M B;  1WGR A;  4GDL A;  1VCB A;  1V9J A;  4ZRI A;  2I1J A;  2FCM A;  1OTR B;  3AU5 A;  1C1Y B;  1BT0 A;  2KC2 A;  2ZNV B;  2GBK A;  2ZPY A;  4AUQ C;  3B0A A;  4FN2 A;  5HKH A;  4ASW C;  5J17 A;  1NDD A;  2JT4 B;  1U4A A;  3M63 B;  2BPS A;  2D3G A;  3IHP C;  1WI0 A;  3V60 A;  4RM8 A;  2KK8 A;  2KQ7 A;  4YL8 A;  4E71 A;  4TUU A;  2MA9 B;  4PS3 A;  3RZF A;  3WAL A;  4AJY B;  3S2A A;  1P1A A;  2BYV E;  3D32 A;  4WJQ A;  3TCA A;  3ZDT A;  3RUL A;  3PV1 A;  2Z0D B;  3H6N A;  3PHX B;  4IG7 B;  5CHV C;  4DXA B;  2XK5 A;  4EOY A;  2KDF B;  3AXC A;  4A3O A;  3SD5 A;  1C3T A;  4KSL C;  2LZ6 A;  2IY1 B;  2R2O A;  3W1S A;  3GOE A;  2JZZ A;  2ASQ A;  3NS8 A;  4KZ0 A;  4IM2 A;  2R2Q A;  5C23 A;  3RCZ A;  3VVW B;  1Q0W B;  2KFK A;  2Z59 B;  3EC8 A;  4P7I A;  3WA0 A;  3KUZ A;  3ZDM C;  3VH4 B;  1XT9 B;  3PRM B;  2G4S A;  3Q3J A;  3PZD A;  4KSK C;  2N9P C;  1E8X A;  5D7G A;  1WJU A;  1UD7 A;  5E6O A;  2C5L C;  2JWZ A;  4DBG A;  2BF8 B;  1GC6 A;  4GDK A;  1WGG A;  4IWP A;  4TQ1 A;  4GGQ A;  4GSW A;  2O2V B;  4HCN B;  4OVV A;  4GN1 A;  1H8C A;  4F8C B;  4FHJ A;  1WE6 A;  3CST A;  2N7E A;  2UWQ A;  2B3A A;  3VTU A;  1L7Y A;  2KC1 A;  2M1M A;  3ZNH B;  5DPW A;  2ZJD A;  2MP2 A;  2KKC A;  3R66 C;  3HK0 A;  5DPS A;  1J8C A;  2MBO A;  1IP9 A;  3JVZ X;  4MSM B;  2AYO B;  1WXM A;  3H1U A;  2PE9 A;  4BBN C;  2HTH A;  3A4S C;  1XD3 B;  1GG3 A;  1UBQ A;  4GB9 A;  3LDZ E;  3VUX A;  3TBL D;  2ZVO A;  1WGY A;  2WDT B;  2K6Q A;  2L0F A;  4GMV A;  2LI5 A;  4MGK E;  1NBF C;  2YVC A;  2KTF A;  5L95 C;  3U30 A;  5GMV A;  2CS4 A;  4NAW B;  4ZYN A;  4DWF A;  3EHV A;  4NJ6 A;  3ENE A;  2DZJ A;  4DK5 A;  2KJR A;  4K7S A;  2DAJ A;  4HJK A;  2AEH A;  2ZZP B;  5JHB A;  5DCN A;  3PHW B;  5D94 A;  4IWO A;  1E8W A;  2K8C A;  2KWC A;  5G55 A;  2MCN B;  3RYT A;  3A1Q A;  3A9K B;  5TR5 A;  3V6C B;  3ZIM A;  4NNJ B;  1WJN A;  3W1Y A;  4HK2 A;  5AZF A;  4K7U A;  4M8N A;  2PE6 B;  3ZNG C;  3ZLZ A;  2N1W A;  2KZR A;  4W9E A;  4AWJ A;  2GBJ A;  4MH0 E;  3SHQ A;  3QIJ A;  4W9F A;  2NBW B;  4MEL A;  3T9L A;  3ZRF A;  3U7D A;  2LAS A;  1TBE A;  2CU1 A;  4WWN A;  3KUC B;  4I6P A;  1LFD A;  3L16 A;  2MSE D;  3PRZ A;  1XQQ A;  1E8Y A;  3L0W B;  1RFA A;  1RAX A;  4GIV A;  4NY0 A;  1ZKH A;  3QJZ A;  2KQS A;  4HPM B;  1X1M A;  2N4F A;  3APF A;  2FAZ A;  2UYZ B;  2IO2 B;  5DPR A;  1YX6 B;  3ZTC A;  5D6J B;  2C9W B;  4ICU A;  2I1K A;  4F7Z A;  3UQB A;  2LD9 A;  1YJ1 A;  3NHE B;  3RZW C;  4E74 A;  3UGB B;  4OVU A;  1V6E A;  3QK0 A;  4TKN A;  4BKT A;  5IAA C;  2JRI B;  2WX0 A;  4EZJ A;  3DVN V;  4HVB A;  2CHW A;  3K9P B;  2CR5 A;  3ZW3 A;  1L2N A;  2KLG A;  4JL9 A;  1GNU A;  3VHT C;  1UGM A;  1E8Z A;  1WR1 A;  3V61 A;  2JY6 A;  2LWP A;  4KIK B;  4DHZ E;  4MJS A;  3VAW A;  2L3Z A;  4ANU A;  3L13 A;  2FCN A;  2O2V A;  4NQL B;  3WAM A;  3QCA A;  2L0T A;  4MGI E;  5DPT A;  3AUL A;  3I3T B;  1EF5 A;  1OGW A;  1H4R A;  2LJ5 A;  4FBJ B;  1P9D U;  2BKR B;  2J7Q B;  3N3K B;  4TV3 A;  2N9X A;  3QHT A;  5CHF A;  3VUY A;  4W9L A;  3QC8 B;  3VH3 B;  5CHW A;  4F1S A;  2L05 A;  2N9E B;  1I35 A;  1R4M I;  2CHZ A;  2KWV B;  4X57 B;  3ZNI D;  2MWS B;  2M0X A;  2AL3 A;  4N9F 4;  3N30 A;  2L8J A;  3Q3F A;  2FUH B;  1V5T A;  1IYF A;  1T0Y A;  1YQB A;  4GOC A;  4BOZ B;  1RLF A;  1SE9 A;  4NAW A;  1Z5S B;  3BY4 B;  4HCP B;  4WWO A;  2MBB B;  1WZ3 A;  3PGE A;  3CMM B;  2M4N A;  3NZU A;  5CTR C;  2V4L A;  4EKU A;  2K39 A;  3EEC A;  2EMS A;  2MQJ A;  4MJS B;  5AZG A;  4E3C A;  4ZDV A;  2RSU A;  3JW0 X;  3PT2 B;  3DDC B;  3NY5 A;  3HM3 A;  4HDO A;  3A9K A;  3DVG Y;  2MBQ A;  4K1R B;  1WM2 A;  5E6P A;  2HE7 A;  4FJY A;  4XZ4 A;  4G3X B;  3V6E B;  4KDI C;  2NS5 A;  3C0R B;  2D2Q A;  2Z0E B;  1UBI A;  4W9C A;  4NJ7 A;  5AZH A;  1P0R A;  2MRP A;  2CKH B;  3A9J B;  1IPG A;  3CSF A;  4II3 B;  4BKS D;  2C7N B;  3DBH I;  4ZRK A;  3APD A;  1V86 A;  2K8B A;  2EMT A;  4MDK E;  4MM3 A;  1LM8 B;  2JUO A;  5G2N A;  1JRU A;  1KJT A;  1R4N I;  1WX8 A;  1V2Y A;  3M95 A;  4ICV A;  3QWZ B;  5KHQ A;  2MBE A;  1SGH A;  1WR6 E;  1UH6 A;  3ZUN A;  2RPQ A;  4JIO U;  5FR6 A;  2KWU B;  4I6N B;  4BVU C;  2KDE B;  3DBR I;  3APC A;  2OOB B;  4ANX A;  4CHK A;  2DYM A;  5CX3 A;  2KVR A;  4PYU A;  1V80 A;  3A33 B;  1G6J A;  2KXJ A;  1WXV A;  2MBH A;  1UEL A;  3V62 A;  5C1Z A;  3X0W A;  1OQY A;  1KM7 A;  2PJH A;  2ZPN A;  3TIX A;  2BGF A;  1I42 A;  5L83 A;  2NBU A;  3QQ8 B;  4RM9 A;  1E90 A;  3AU4 A;  2BWE S;  2KO3 A;  4KIK A;  2L7R A;  1E7U A;  4BKS A;  1V49 A;  2V1Y A;  1ZW7 A;  2C7H A;  3JSV B;  1TTN A;  2HJ8 A;  2BKF A;  5J18 A;  2FCQ A;  3A4R A;  1HE8 A;  4IM3 A;  2LUE A;  4HXD A;  2O6V B;  1SIF A;  2G3Q B;  2FIF A;  3R3M A;  2GBR A;  1K8R B;  2NPT A;  2ZVN A;  2KDB A;  2WWZ A;  4XC2 A;  3R7R A;  5EDS A;  2WX1 A;  3X23 A;  2D11 A;  2KDI A;  1J19 A;  4A20 A; 
#chains in the Genus database with same CATH topology
 1XEE A;  2RD0 A;  4G0N B;  2DHZ A;  3ECI A;  3MTN B;  2HDE A;  4C80 A;  1TGZ B;  1KOT A;  4JLC A;  1F9J A;  1KLV A;  2XEW A;  4LNK A;  2KJH B;  2IY0 B;  3AEA B;  1I7H A;  4AP4 C;  1SE2 A;  4W9G A;  3AH7 A;  3DWM A;  4DDI D;  2KFJ A;  1JCK B;  2PEA A;  4GXB A;  3H9D A;  3R7Q A;  2DBY A;  4LJP B;  3KYD D;  2M8S A;  4AQ7 A;  3IFW B;  4N59 A;  4KVG B;  1VZ6 A;  3RUI B;  1ENF A;  4NPN A;  2IO1 B;  4FJZ A;  1JRO A;  3NUH B;  4K3B A;  4OZC A;  3ZVV A;  5HI1 A;  3DCG A;  4K81 A;  1WIA A;  2JRH A;  2A5U A;  4B9K A;  4LDT B;  1ZDX A;  4IW0 A;  4TQ0 A;  2KTR B;  2WU2 B;  3H7P A;  4R3D A;  2G1E A;  2IYD B;  4WJN A;  2IO3 B;  1OQR A;  1I4X A;  2WYQ A;  1T0Q C;  4WIP A;  4WAA A;  4US8 A;  3PSE B;  4HWI B;  3AE8 B;  1YD8 U;  3AI5 A;  1VJK A;  2LVQ A;  5JXV A;  4AOF A;  4ZHO A;  1TZ1 A;  4GU2 A;  1YX5 B;  4W9D A;  1WE7 A;  3ZXR A;  3WAO A;  3ML9 A;  2ZCC A;  4FHK A;  2KD0 A;  2O6V A;  2Y5B B;  1WY8 A;  5BMI A;  1WJ6 A;  1GJZ A;  2BYE A;  2GI9 A;  5FK9 C;  1PFD A;  4S0R A;  1WXA A;  2IGH A;  1WX9 A;  1IGD A;  1FIQ A;  1P7F A;  1Z2M A;  2W9N A;  3I5J C;  4YSY B;  1MHX A;  4QAY A;  4FAD A;  2K25 A;  1J7A A;  3RFZ B;  1WGK A;  3IBE A;  5J2R A;  2LMC A;  1XCT L;  5IO9 A;  3BK1 A;  4BZA A;  4HDQ A;  2EKE C;  3DPD A;  4JWU C;  2ZEQ A;  4DHJ B;  4ZRQ A;  1TIF A;  5HFY A;  1F0Z A;  2K5P A;  5LXH A;  3TL5 A;  3QAR A;  1Y8R C;  4Q2J A;  2L76 A;  5E6N A;  5BO4 B;  2KFK B;  4LNF A;  1YQ4 B;  2JXT A;  4M02 A;  1WYW B;  1TT5 B;  4ZRP A;  1WFY A;  3EFU A;  2KX3 A;  4RMA A;  3N20 C;  3O65 B;  2GB1 A;  3UQA A;  4EZL A;  1JAL A;  5LXI B;  2KTR A;  4USA A;  2MP2 B;  4B6W A;  3U4E G;  4JX1 C;  3W5U B;  5IP4 D;  4MH8 A;  1E7V A;  2IO0 B;  1FXT B;  4FLH A;  5AUI A;  4WJO A;  2UU7 A;  3KUD B;  4KGS A;  1ET9 A;  4YSX B;  1N60 A;  4IWQ A;  1HTO A;  2GBM A;  3B2G A;  2JYE A;  3B08 A;  3I63 C;  1HA5 A;  4WH4 A;  1T3Q A;  1Q5W B;  3PLV A;  5IOI A;  3DWG C;  3Q6B A;  3AE2 B;  4L1B A;  4MSQ B;  3PLU A;  1DYQ A;  2JX5 A;  5BYQ A;  1VCB A;  1LGR A;  1F77 A;  3AU5 A;  4ASW C;  5J17 A;  2L1A A;  2BBC A;  3M63 B;  4N6E B;  3BYY B;  2L52 A;  4YL8 A;  4TUU A;  3SFE B;  3PZ7 A;  3WAL A;  4AJY B;  1YJI A;  1P1A A;  2BYV E;  4WJQ A;  3TCA A;  2L83 A;  2K3U A;  2KDF B;  3AXC A;  4A3O A;  3SD5 A;  1FNW A;  2JZZ A;  2INP E;  3RCZ A;  1Q0W B;  2KFK A;  3KUZ A;  3IT6 B;  2WXI A;  3PRM B;  2G4S A;  2X38 A;  1E8X A;  3B9J A;  1GC6 A;  1SF0 A;  1WGG A;  3V3X A;  2QSD A;  1YN5 A;  2O2V B;  1H8C A;  4F8C B;  3CST A;  2PLP A;  3ZNH B;  1FO4 A;  3U2S C;  3NVZ A;  1XLP A;  2MP2 A;  2KKC A;  3FC4 A;  2KT7 A;  3A4S C;  3LDZ E;  3VUX A;  1AW7 A;  3BK2 A;  2ZVO A;  1WGY A;  2WDT B;  2LI5 A;  4MGK E;  5GMV A;  2MJE A;  3TSS A;  4DWF A;  4NJ6 A;  2DZJ A;  3VRA B;  4HJK A;  2AEH A;  2ZZP B;  5JHB A;  5D94 A;  4IWO A;  3IXS A;  2K8C A;  1T5X D;  2MCN B;  5AUK A;  2WQY B;  3ZLZ A;  4AWJ A;  1C79 A;  2PIA A;  4MH0 E;  3SHQ A;  4W9F A;  3U7D A;  3AEG B;  4JE3 B;  4WWN A;  4M00 A;  3L16 A;  1XQQ A;  1E8Y A;  4MM3 B;  4NY0 A;  4HPM B;  3APF A;  2FAZ A;  3Q8C A;  1K51 A;  2UYZ B;  5DPR A;  3NVY A;  2KN4 A;  2J4X A;  2IDY A;  3ZTC A;  2NTS A;  2JWU A;  4D2K A;  3RZW C;  4E74 A;  3UGB B;  4BKT A;  3P42 A;  4XWW A;  1UGJ A;  3IT4 B;  2CHW A;  3K9P B;  1NVI D;  2KLG A;  1GNU A;  1MVK A;  3ZJU A;  4KIK B;  4C56 C;  2Z8L A;  2FCN A;  3ETR A;  2MH7 A;  2M56 B;  1AN8 A;  2O2V A;  4NQL B;  4MGI E;  3AUL A;  1OGW A;  4FBJ B;  3N3K B;  4TV3 A;  1MJD A;  1BXT A;  3LB8 C;  1EU3 A;  3ABV B;  3FAH A;  2L8J A;  1IYF A;  1VZ7 A;  3Q8F A;  1NYR A;  3AE3 B;  1WZ3 A;  5H8Y E;  2V4L A;  1UUP A;  3EEC A;  4MJS B;  2EMS A;  4ZDV A;  3AEE B;  2WXR A;  3NY5 A;  5IN7 A;  4RNA A;  2M0A A;  5H92 C;  2BS2 B;  4XZ4 A;  3C0R B;  2IPK D;  2Z0E B;  1UBI A;  3BII D;  1P0R A;  2MRP A;  3CSF A;  3W9C B;  4ZRK A;  4IKG A;  2EMT A;  4MM3 A;  1KFY B;  1V2Y A;  1SGH A;  1WR6 E;  2RPQ A;  2KWU B;  4I6N B;  3ZGZ A;  4RF0 A;  2LGS A;  2KVR A;  4PYU A;  2N7J A;  2V0G A;  1WXV A;  1UEL A;  5C1Z A;  3X0W A;  2PJH A;  2ZPN A;  4TMA B;  3N1X C;  3QQ8 B;  2WDQ B;  4A6Q A;  2KO3 A;  4KIK A;  1E7U A;  1EM7 A;  1V49 A;  1ZW7 A;  3JSV B;  1TTN A;  1OQQ A;  5J18 A;  2FCQ A;  2OJW A;  3R3M A;  2TSS A;  1L6U A;  2NPT A;  2ZVN A;  3AEB B;  2KDB A;  2NTT A;  3R7R A;  3X23 A;  2D11 A;  2KDI A;  2INC C;  2KAC A;  3UF8 A;  3UIP B;  1V5O A;  4J3O D;  1L5P A;  4LJO B;  3DHI C;  3PPA A;  2AWT A;  1FM0 D;  3AE9 B;  1WGD A;  5FR3 A;  1OFF A;  1I4G A;  5HHD G;  4KGT A;  4OVZ A;  2FUG 1;  1OEY J;  3AEF B;  1RRB A;  3L08 A;  4TSS A;  4J6I A;  1V97 A;  3MFG A;  2KMC A;  2DEN B;  2WLB A;  4ACF A;  1WH3 A;  4CYE A;  1ZE3 D;  1A5R A;  3MHS D;  4ZYS A;  2MEK A;  1J7C A;  4OHJ A;  3ZRC A;  3BYT B;  1V1O A;  1QZE A;  3KWL A;  1ZGU B;  2WXO A;  4DQO C;  3IG3 A;  1EO6 A;  1ZP0 B;  2WXP A;  4EZK A;  5C3J B;  1Q1O A;  3HHM A;  2QHO A;  3L54 A;  4RGT A;  5T8I A;  3L10 B;  4ARC A;  1FXA A;  3JSV A;  2GRI A;  1KRH A;  4A55 A;  2HJ1 A;  3IVF A;  4BAX A;  1EUV B;  1E9M A;  4HLE A;  4BOS C;  1WMH B;  2A4Z A;  3E56 A;  2AL6 A;  3VXW A;  3GZN I;  3H7P B;  1HZ6 A;  3GE3 C;  3T8M A;  4A3P A;  3ALB A;  2LGD A;  2KMA A;  4O1N A;  3NOB A;  2JF5 A;  4WJP A;  2RDB C;  4W9K A;  1S1Q B;  3N1Z C;  4LNN A;  4H2A A;  1GC7 A;  4YTN B;  2RPV A;  2K8H A;  3GZN B;  1BUI C;  4ITK A;  3RT3 B;  3VTV A;  2IND C;  3HM6 X;  3ONS A;  2BWF A;  5G5G A;  2BYT A;  4IDI A;  2DZM A;  4G50 A;  3HIZ A;  3LYY A;  3HUI A;  2JU6 X;  1WYG A;  3WIM A;  1PQS A;  2K9X A;  3VR9 B;  3R2I A;  2KJ6 A;  2H89 B;  2LRW A;  2DZI A;  2N7D A;  5I4D A;  2LFI A;  3B1L X;  3R2T A;  1QOG A;  1VRA B;  2KOX A;  2ONQ A;  3MC8 A;  2K0P A;  1YNT E;  4L23 A;  4PS7 A;  3VR8 B;  2GMI C;  1FEH A;  1QOF A;  2QCZ A;  2JZ3 B;  4XDC A;  3VUW A;  4K7W A;  1GB4 A;  4AS1 A;  2KQ4 X;  4AJW A;  2BS4 B;  4NQK E;  3P63 A;  2KNB A;  5LNK 1;  3TMP B;  1C76 A;  1NI3 A;  4KV2 A;  3GE8 C;  4M0W B;  4JPS A;  3VRB B;  4LK0 M;  4ANW A;  1YOV B;  2J0M A;  2KMM A;  1QQR A;  3A1Q B;  4PYZ A;  2CHX A;  1WMH A;  3HVD A;  1WGR A;  1V9J A;  3RNB C;  2I1J A;  3MJ5 A;  1OTR B;  3P4P B;  1ET6 A;  3B0A A;  5HKH A;  3ZQ4 A;  2BPS A;  2WXQ A;  1WI0 A;  3Q3O C;  4RM8 A;  2KK8 A;  4E71 A;  5TSS A;  4PS3 A;  2BS3 B;  3OG5 A;  3AM9 A;  3RUL A;  4IG7 B;  4EOY A;  4KSL C;  2CJN A;  1PGA A;  2IY1 B;  2KWD A;  2R2O A;  2V3N A;  2ASQ A;  4KZ0 A;  4DXG A;  1WWT A;  2VZK D;  3EC8 A;  3VH4 B;  1XT9 B;  3Q3J A;  2N9P C;  1WJU A;  1UD7 A;  2C5L C;  4DBG A;  1KLU D;  1QKZ A;  1NYQ A;  2J52 A;  3NVV A;  2B3A A;  1L7Y A;  2KC1 A;  2M1M A;  3T3N A;  5DPW A;  3KLS X;  2IGD A;  2H88 B;  3HK0 A;  2MBO A;  1DGJ A;  1IP9 A;  2AYO B;  1WXM A;  3H1U A;  3AB5 A;  4GB9 A;  3GB1 A;  3TBL D;  1B9R A;  2ACZ B;  4GMV A;  2YVC A;  4HJG E;  3U30 A;  1XO3 A;  3EHV A;  4HEA 1;  3TEZ A;  3TEY A;  4M0W A;  1T0R C;  3SFD B;  4C4V B;  2KWC A;  3V6C B;  5G55 A;  3A1Q A;  1WJN A;  4M8N A;  1F2R C;  3ZXV A;  2WXK A;  2GBJ A;  1XLN A;  1I4R A;  1TBE A;  2CU1 A;  1L0X B;  4I6P A;  1RFA A;  3AED B;  2KQS A;  1JQ4 A;  1IBX B;  5D6J B;  2PVG C;  4ICU A;  1HQR D;  4F7Z A;  2BTE A;  1YJ1 A;  1V6E A;  3QK0 A;  1TS3 A;  2WU5 B;  4RCO A;  1RWS A;  1TS4 A;  2WX0 A;  2WXL A;  3AEC B;  1CZP A;  1D6E C;  1L2N A;  4JL9 A;  1SIJ A;  1UGM A;  1TKG A;  2EEL A;  1JWB D;  4YWG G;  2LWP A;  4HPP A;  1ACC A;  1SXT A;  2WP9 B;  1Q10 A;  3WAM A;  3I57 A;  4MT5 A;  3QCA A;  2L0T A;  1FXI A;  3I3T B;  2N0S B;  1Y56 A;  3C8Y A;  5CHF A;  3P1M A;  3QHT A;  2BQQ A;  3DHH C;  4XDD A;  3RI7 C;  2L05 A;  2N9E B;  1R4M I;  4LLG M;  4X57 B;  1STE A;  2AL3 A;  4N9F 4;  1T0Y A;  1ROE A;  4BOZ B;  1MHH E;  1SE9 A;  3BZD B;  4XYC A;  1Z5S B;  4WAF A;  2MBB B;  1EU4 A;  3CMM B;  2K39 A;  4E3C A;  1R4M B;  1SEB D;  1JW9 D;  3JW0 X;  3NJT A;  3PT2 B;  3DDC B;  4C4V A;  3HM3 A;  4NAM A;  3KWV A;  2MBQ A;  4K1R B;  1WM2 A;  4HRS A;  2HE7 A;  5E6P A;  4YTM B;  1V1P B;  4FJY A;  1HZ5 A;  4NJ7 A;  2CKH B;  4PK1 A;  2J53 A;  4BKS D;  3DBH I;  3APD A;  1C77 A;  3W5V B;  2JUO A;  5G2N A;  1N62 A;  3M95 A;  1WX8 A;  2SAK A;  4MAC A;  5BYR A;  1IBX A;  4JIO U;  4YTP B;  2KDE B;  3DBR I;  3APC A;  2OOB B;  1DOI A;  1V80 A;  3A33 B;  2KXJ A;  3DBH B;  4P6V F;  4C7Z A;  1KM7 A;  1MPE A;  1FCC C;  1I42 A;  4US9 A;  2NBU A;  5L83 A;  4RM9 A;  2BWE S;  1CQV A;  2K22 A;  2C7H A;  3UI3 A;  2HJ8 A;  2BKF A;  3DBR B;  1FNU A;  4IM3 A;  3PO0 A;  1SIF A;  2FIF A;  4P16 A;  1MG4 A;  1MI0 A;  3ZJV A;  5LLI A;  4WWM A;  4A20 A;  3PRP B;  4XX5 A;  3WAN A;  2WXN A;  4BFR A;  2MJD A;  1DOY A;  4II2 B;  1QOA A;  3H7S A;  3N32 A;  2QIE B;  4ANV A;  1J0G A;  2MW5 A;  4P1C C;  1EF1 A;  2BYF A;  1V81 A;  4A8X C;  2XBB C;  2VRR B;  1FFV A;  1UZX B;  3VTW A;  1TKY A;  2J0K A;  1WF9 A;  4MEM A;  2M19 A;  4ZRJ A;  3ZO5 B;  3KW5 B;  2NPT B;  1V1P A;  4ZOH C;  2X8X X;  1TS5 A;  2IZV B;  4HKZ E;  4WQO B;  5C2T B;  3Q69 A;  1AAR A;  3DVG X;  2VH1 A;  3M3J A;  2K1F A;  3CF6 E;  3P2B A;  4MGY E;  2KX0 A;  3RD2 A;  2MLB A;  3VFK A;  1LQB A;  2DZK A;  1GB1 A;  3ZYY X;  4IM0 A;  4WQM A;  3W1S C;  1K50 A;  1V8C A;  2JZP A;  1TZO A;  3HRD D;  2NCN A;  2J0J A;  4YT0 B;  1LXD A;  3EGR A;  4YSZ B;  4C7Y A;  3URY A;  1RFK A;  1FNV A;  5JHA A;  1YIW A;  3EA6 A;  2D3C A;  2FID A;  4BKG A;  3J9C A;  3WAP A;  2FNJ B;  5IKC M;  2YLM A;  2V9H A;  2D07 B;  1WRD B;  4I6L B;  1C4C A;  2NBV B;  4G11 A;  4EE2 A;  3TJP A;  2D3A A;  2D10 A;  2JSV X;  4HPL B;  3ML8 A;  3O13 A;  2W54 A;  1D5X C;  3DBL I;  3KYC D;  4KZC A;  2HD5 B;  2FCS A;  3LJ3 A;  4MGZ E;  2G45 B;  1N6Z A;  3IAM 1;  2XN9 C;  4FJV B;  2WXF A;  1XLQ A;  2LGI A;  3SDL C;  2WHI A;  1KTK A;  2ZNV C;  1WX7 A;  2N1V A;  2ZCB A;  1WM3 A;  2CU3 A;  2AQ3 B;  4EFO A;  1NI2 A;  2DYO A;  2NVU I;  3BVZ A;  3PRE A;  3JYU A;  2QDF A;  5GXG B;  1SJE D;  4OZA A;  1KLG D;  1F52 A;  4FUL A;  1E7P B;  1L6V A;  2VZK B;  4EEW A;  1WZ0 A;  2C60 A;  2REX A;  4W9J A;  3OAW A;  5EE0 A;  4RGM A;  2GOW A;  3VQI A;  1BML C;  2KLC A;  3KH0 A;  2QC8 A;  2NR2 A;  3UIO B;  1D5Z C;  1MG8 A;  2M17 A;  3QX1 A;  4OZB A;  1S3S G;  2C7M B;  1SSN A;  2KVZ A;  3OLM D;  4ZRI A;  1EWC A;  1RYJ A;  2LHD A;  2IGG A;  1YN4 A;  2FCM A;  1BT0 A;  2KC2 A;  2GBK A;  2ZPY A;  4FN2 A;  4REZ A;  1NDD A;  2JT4 B;  1U4A A;  3V60 A;  2QMT A;  2JYT A;  3D32 A;  2V3P A;  2Z0D B;  3H6N A;  5CHV C;  4DXA B;  4LNI A;  1C3T A;  2LZ6 A;  2ZW0 A;  3NZ3 A;  4DXF A;  2WGS A;  5FKA C;  3N1Y C;  2R2Q A;  5C23 A;  3VVW B;  2Z59 B;  4P7I A;  3WA0 A;  3PZD A;  4KSK C;  5D7G A;  4P1B C;  4KKI A;  5E6O A;  2BF8 B;  4TQ1 A;  4IWP A;  4GGQ A;  4GSW A;  4HCN B;  4A90 A;  4GN1 A;  1QT9 A;  1KH0 A;  1WE6 A;  2AX5 A;  2N7E A;  2UWQ A;  2FE8 A;  4M01 A;  1FMA D;  1TS2 A;  3P4R B;  5DPS A;  2RDH A;  3V05 A;  1JWS D;  1J8C A;  2AQ2 B;  4BBN C;  4ZHP A;  2HTH A;  2WDV B;  4KGR A;  1K53 A;  1ESF A;  4YXD B;  3DHG C;  2K6Q A;  2L0F A;  3RNG C;  5L95 C;  2RMM A;  4NAW B;  1SB3 C;  3ENE A;  4DK5 A;  2KJR A;  3GP7 A;  2WXM A;  2D5G A;  1TY2 A;  4K3C A;  1E8W A;  3BWU D;  1UWM A;  1T0S C;  5AZF A;  4K7U A;  4PT5 A;  2PE6 B;  3ZNG C;  2N1W A;  2KZR A;  1ZDV A;  2NBW B;  3MC0 B;  3KQ4 A;  2LAS A;  1AWD A;  1WSP A;  3KUC B;  2FBW B;  3L0W B;  1C78 A;  3TEW A;  1ZKH A;  3IAS 1;  2PKO A;  2N4F A;  2I1K A;  3NHE B;  1D4B A;  4ARI A;  4TKN A;  4XE0 A;  4EZJ A;  3DVN V;  3AN1 A;  2WXH A;  3AV8 A;  1F2R I;  3VHT C;  2PW9 A;  2IJ0 A;  2W55 A;  3V61 A;  1ZXI A;  2N9L A;  1JWM D;  2L3Z A;  3L13 A;  2I2Y A;  2R61 A;  4B0M A;  5D3I B;  5DPT A;  2LJ5 A;  1P9D U;  3N9Y C;  2J7Q B;  2N9X A;  1ZPS A;  4W9L A;  3VH3 B;  1ZUD 2;  2XNA C;  1I35 A;  2WDR B;  4OW0 A;  3ZNI D;  2MWS B;  2M0X A;  1IGC A;  1RM6 C;  2RDG A;  4CQN A;  3Q3F A;  1N63 A;  1JWA D;  1JWU D;  4GOC A;  2BT6 A;  4NAW A;  3BY4 B;  4HCP B;  4WWO A;  3PGE A;  3TUO A;  2M4N A;  1WRI A;  4NZL B;  2MQJ A;  3BVM A;  2RSU A;  4HDO A;  3DVG Y;  2B76 B;  5BMG A;  1FPY A;  3AE6 B;  2Y3A A;  3V6E B;  4KDI C;  5D3D A;  2I38 A;  2NS5 A;  1UF0 A;  2D2Q A;  4W9C A;  1QIL A;  3A9J B;  1IPG A;  4II3 B;  1C4A A;  2C7N B;  1V86 A;  4RGO S;  1J7B A;  3RNC C;  1KJT A;  1R4N I;  1UH6 A;  4BVU C;  1NEK B;  2PVO D;  4CHK A;  1G6J A;  3CIR B;  1OQY A;  3TIX A;  2BGF A;  3W2D A;  1R4N B;  1E90 A;  3AU4 A;  3TEX A;  2HTM E;  2Q5W D;  4BKS A;  2L7R A;  1R7S A;  2KAJ A;  3A4R A;  1HE8 A;  2PMV A;  1JRP A;  4NJC A;  2WXJ A;  2GBR A;  1K8R B;  1QF6 A;  2WWZ A;  2GLS A;  4XC2 A;  5EDS A;  2WX1 A;  1L0V B;  1J19 A;  3SU8 X;  3RPF C;  4S17 A;  4DDG D;  2L00 B;  3L17 A;  4PS8 A;  1FFU A;  3QA8 A;  3AE1 B;  1NEN B;  2VH2 A;  2G9H D;  2LGY A;  4XWT A;  1WGH A;  4IOI E;  2JVC A;  2DWQ A;  2V3S A;  2OJR A;  1D5M C;  2QEJ C;  1A70 A;  3DBS A;  1WXQ A;  1YQ3 B;  3EUB 2;  3K9O B;  4BBN F;  1N5X A;  3A9J A;  1P98 A;  4EUT A;  2LRU A;  1OEY A;  3DVN U;  1L0Y B;  2LXC A;  2YEP F;  2AQ1 B;  2O6V D;  1PDX A;  1SBB B;  1VD2 A;  2IBI B;  3VDZ A;  4M8M A;  2J42 A;  4RGN A;  4HRO A;  2JPH A;  1E10 A;  4KDL B;  1ISN A;  2KHW B;  3BIN A;  4LCD E;  3U7Z A;  1KF6 B;  1M94 A;  1PUT A;  2ON8 A;  4WWP A;  3RNE C;  3P4S B;  5IA7 A;  2DX5 B;  3SR6 A;  1B1Z A;  4GDL B;  1WJ4 A;  2QIL A;  3AE4 B;  2KN5 A;  3PVL A;  1E6E B;  2PPH A;  1GUA B;  1I4Q A;  3OJ3 A;  2JQR B;  1QLB B;  3B2F A;  4B95 A;  1D3Z A;  2LVO A;  4A9A A;  3NS1 A;  3Q14 C;  1TYG B;  4FA6 A;  1VDV A;  3U8Z A;  3Q3N C;  1VZ8 A;  4URK A;  5BYS A;  3ZKJ C;  3DQV A;  4LDT D;  3LXF A;  1T6B X;  3ZNZ B;  2XK5 B;  1WXS A;  3AE7 B;  2LXA A;  2MX2 A;  3PTF C;  3Q8B A;  4W9H A;  1YMH E;  4W9I A;  3U52 E;  5AEK B;  2GBN A;  2MJ3 A;  1E0Z A;  4GDK B;  2NMQ A;  1UWX A;  2DAF A;  3Q8E A;  1VLB A;  3M62 B;  1P3Q U;  3NZS A;  1XXG A;  1EWY C;  3PS6 A;  3UIN B;  1DOX A;  2RR9 A;  2JXX A;  2G4D B;  1CMX B;  1YN3 A;  1GAQ B;  3MJW A;  5BMH A;  1K52 A;  2V4I B;  3KVF B;  5EE1 A;  3CWI A;  2K6D B;  3NVW A;  4B0E A;  1E5W A;  3ZTD A;  1AYF A;  4IC7 B;  5MPO A;  5JH5 C;  4IUM B;  3RNF C;  2LGX A;  2DYB A;  2DNF A;  5JZE B;  2KAN A;  2LVP A;  3OJ4 B;  4CO7 A;  5KHO A;  2RGF A;  3QAQ A;  3DOW A;  1TKE A;  4JGH B;  4JQW C;  4DHJ D;  4DHZ B;  5D2M B;  4GDL A;  1L4Z B;  3RN9 C;  1C1Y B;  2CJO A;  1YJJ A;  2ZNV B;  4LNO A;  3AE5 B;  4AUQ C;  2E6X A;  3HVZ A;  3FKY A;  2D3G A;  3IHP C;  4LTU A;  2ICI A;  2KQ7 A;  2OHF A;  1FRD A;  2MA9 B;  3RZF A;  1LO5 D;  3S2A A;  3ZDT A;  1TY0 A;  4KKJ A;  3T3O A;  3PV1 A;  3FIL B;  3PHX B;  1PYW D;  2XK5 A;  1SE4 A;  1TJE A;  2Y5P A;  3W1S A;  3GOE A;  3NS8 A;  3RMK C;  2BB5 A;  2LHE A;  4IM2 A;  5G5H A;  2W82 A;  3ZDM C;  2JWZ A;  4GDK A;  1IUE A;  1PGB A;  2L32 A;  4OVV A;  3NG0 A;  2BVC A;  4FHJ A;  3VTU A;  2ZJD A;  3R66 C;  4XGA B;  1XLO A;  3JVZ X;  4MSM B;  4C00 A;  2PE9 A;  1XD3 B;  1GG3 A;  1UBQ A;  2W3R A;  4KX6 B;  1NBF C;  2KTF A;  2CS4 A;  3P4Q B;  4ZYN A;  2WS3 B;  2ZW1 A;  2WXG A;  1I4H A;  4K7S A;  2DAJ A;  1N5W A;  5DCN A;  3DBL B;  3PHW B;  1HEZ E;  2Y5C A;  3RYT A;  4GLS C;  3A9K B;  5TR5 A;  5EE3 A;  3ZIM A;  4NNJ B;  1VR9 A;  3W1Y A;  4HK2 A;  4WUR A;  2EKI A;  4UDU C;  4W9E A;  3QIJ A;  1MFW A;  3ZRF A;  4MEL A;  3T9L A;  4L2Y A;  1LFD A;  2MSE D;  3PRZ A;  4GIV A;  1RAX A;  2N9K A;  1HXY D;  3QJZ A;  1X1M A;  1PGX A;  3SEB A;  2IO2 B;  2OED A;  1YX6 B;  2C9W B;  3UQB A;  2LD9 A;  3FIL A;  4OVU A;  3BVG A;  5IAA C;  2JRI B;  4HVB A;  3R8B A;  2SEB D;  3ZW3 A;  2CR5 A;  2YEP B;  1CK1 A;  1E8Z A;  5EE9 A;  1WR1 A;  2BB6 A;  2JY6 A;  1M4V A;  4DHZ E;  4MJS A;  3VAW A;  2DLB A;  1QOB A;  4ANU A;  3NRZ A;  1CJE A;  4RF1 A;  4JWS C;  3WCQ A;  5E6J A;  3RNA C;  4HKQ A;  1EF5 A;  3MHZ A;  1H4R A;  1L4D B;  2BKR B;  3MC9 A;  3VUY A;  3QC8 B;  4N58 A;  5CHW A;  4F1S A;  2MHJ A;  2LUM A;  2CHZ A;  2KWV B;  2LJI A;  1GPX A;  3N30 A;  2FUH B;  1V5T A;  1YQB A;  2WNM A;  3AMZ A;  1RLF A;  1XF5 L;  3Q2A C;  3NZU A;  5CTR C;  4EKU A;  5AZG A;  3L4P A;  1GOZ A;  3EFC A;  1FD6 A;  3A9K A;  1JML A;  1HTQ A;  3OWE B;  2E3T A;  2KDM A;  4G3X B;  3Q8A A;  5AZH A;  3ZJT A;  1XCQ L;  2W3S A;  1ZOY B;  2QJL A;  1ZXH A;  2K8B A;  4MDK E;  1LM8 B;  2LEK A;  3MP9 A;  1JRU A;  4ICV A;  1C4P A;  3Q3M C;  5KHQ A;  3QWZ B;  2MBE A;  3GS2 A;  4FXC A;  1SJH D;  3ZUN A;  5FR6 A;  4RFB A;  4ANX A;  2BW2 A;  1UNS A;  2DYM A;  1SE3 A;  5CX3 A;  2INN E;  1N61 A;  3I9V 1;  2MBH A;  2PTL A;  3V62 A;  1C9F A;  1P7E A;  2V1Y A;  3H8H A;  1FCL A;  3C19 A;  2LUE A;  4HXD A;  2O6V B;  2D3B A;  2G3Q B;  1FRR A;  3E9S A;  1F1H A;  4RH6 A;  2KYW A;  3PZ8 A;  5HG2 A;  1I4P A; 
#chains in the Genus database with same CATH homology
 3SU8 X;  3UF8 A;  2RD0 A;  1V5O A;  4G0N B;  2DHZ A;  3ECI A;  3UIP B;  3PRP B;  3MTN B;  1TGZ B;  4XX5 A;  1KOT A;  4LJO B;  4JLC A;  1F9J A;  3PPA A;  3WAN A;  4DDG D;  1KLV A;  2AWT A;  2XEW A;  4BFR A;  4II2 B;  2KJH B;  3H7S A;  3N32 A;  2L00 B;  1WGD A;  2IY0 B;  4ANV A;  1J0G A;  2MW5 A;  3L17 A;  1EF1 A;  2BYF A;  4AP4 C;  4PS8 A;  4W9G A;  1V81 A;  3QA8 A;  2XBB C;  2VRR B;  4DDI D;  2KFJ A;  1UZX B;  2LGY A;  2PEA A;  1OEY J;  4GXB A;  1WGH A;  3VTW A;  2J0K A;  3H9D A;  3R7Q A;  4LJP B;  1WF9 A;  1RRB A;  4MEM A;  3KYD D;  2JVC A;  2M8S A;  3L08 A;  4ZRJ A;  3ZO5 B;  4J6I A;  2V3S A;  2OJR A;  3IFW B;  3KW5 B;  2NPT B;  4KVG B;  3DBS A;  4NPN A;  2KMC A;  2DEN B;  3RUI B;  2IO1 B;  4FJZ A;  1WH3 A;  2IZV B;  4CYE A;  4WQO B;  1A5R A;  3ZVV A;  3MHS D;  3K9O B;  4BBN F;  1AAR A;  3DCG A;  4K81 A;  1WIA A;  3DVG X;  3A9J A;  3ZRC A;  1P98 A;  4EUT A;  2JRH A;  2LRU A;  1OEY A;  2A5U A;  4B9K A;  4LDT B;  3M3J A;  3DVN U;  1QZE A;  2K1F A;  2LXC A;  3CF6 E;  2KTR B;  3P2B A;  4IW0 A;  4MGY E;  4TQ0 A;  1ZGU B;  2KX0 A;  3H7P A;  3RD2 A;  2MLB A;  3VFK A;  2O6V D;  1LQB A;  1VD2 A;  2DZK A;  3IG3 A;  2IYD B;  2IBI B;  4WJN A;  1EO6 A;  3VDZ A;  2IO3 B;  4IM0 A;  4M8M A;  4EZK A;  3W1S C;  2WYQ A;  1Q1O A;  2JPH A;  4WAA A;  3PSE B;  4HWI B;  3HHM A;  4KDL B;  1ISN A;  1YD8 U;  2J0J A;  2KHW B;  2NCN A;  2QHO A;  3AI5 A;  2LVQ A;  3BIN A;  4LCD E;  3L54 A;  1LXD A;  4AOF A;  5LLI A;  1TZ1 A;  1M94 A;  4GU2 A;  1YX5 B;  4W9D A;  3L10 B;  1WE7 A;  3JSV A;  5JHA A;  3WAO A;  1YIW A;  3ML9 A;  4WWP A;  2ZCC A;  4FHK A;  3IVF A;  2KD0 A;  2O6V A;  2FID A;  4BKG A;  5IA7 A;  1EUV B;  2DX5 B;  2Y5B B;  3WAP A;  4BOS C;  1WMH B;  1WY8 A;  2FNJ B;  2AL6 A;  2A4Z A;  2YLM A;  4HLE A;  1WJ6 A;  4GDL B;  1WJ4 A;  2D07 B;  1GJZ A;  3VXW A;  1WRD B;  2BYE A;  2KN5 A;  3PVL A;  2PPH A;  1GUA B;  3GZN I;  3H7P B;  4I6L B;  1WXA A;  2NBV B;  3OJ3 A;  3T8M A;  4A3P A;  1WX9 A;  3ALB A;  4G11 A;  2LGD A;  3TJP A;  4B95 A;  1D3Z A;  2KMA A;  2LVO A;  3NOB A;  1Z2M A;  2JF5 A;  2D10 A;  2W9N A;  4WJP A;  4FA6 A;  3U8Z A;  2K25 A;  4HPL B;  3ML8 A;  4W9K A;  4FAD A;  4URK A;  1S1Q B;  3IBE A;  5J2R A;  3DBL I;  3KYC D;  3ZKJ C;  1GC7 A;  3DQV A;  4LDT D;  4KZC A;  2HD5 B;  3ZNZ B;  2K8H A;  3RT3 B;  2FCS A;  3LJ3 A;  4HDQ A;  3VTV A;  2EKE C;  2XK5 B;  3DPD A;  3HM6 X;  4MGZ E;  3ONS A;  1WXS A;  2BWF A;  2ZEQ A;  4DHJ B;  2G45 B;  2DZM A;  4G50 A;  3HIZ A;  5LXH A;  3TL5 A;  3QAR A;  2LXA A;  4FJV B;  1Y8R C;  2MX2 A;  2L76 A;  3PTF C;  5E6N A;  5BO4 B;  2KFK B;  3WIM A;  4W9H A;  1PQS A;  4W9I A;  5AEK B;  2GBN A;  1WYW B;  3SDL C;  2KJ6 A;  2ZNV C;  2LRW A;  2DZI A;  2N7D A;  4GDK B;  3B1L X;  1WX7 A;  1WFY A;  2N1V A;  2ZCB A;  3EFU A;  1WM3 A;  2DAF A;  2KX3 A;  4RMA A;  2KOX A;  3O65 B;  3M62 B;  4EFO A;  3UQA A;  1P3Q U;  1NI2 A;  3NZS A;  2DYO A;  4EZL A;  2NVU I;  3PS6 A;  4PS7 A;  3PRE A;  3JYU A;  3UIN B;  2KTR A;  5LXI B;  2MP2 B;  4B6W A;  2GMI C;  2JZ3 B;  2RR9 A;  2JXX A;  3VUW A;  4K7W A;  2G4D B;  1CMX B;  1E7V A;  2IO0 B;  1FXT B;  3MJW A;  4FUL A;  3KVF B;  4AJW A;  4FLH A;  2K6D B;  4WJO A;  4NQK E;  4EEW A;  1WZ0 A;  2C60 A;  3KUD B;  2REX A;  4W9J A;  2KNB A;  4IWQ A;  1E5W A;  3ZTD A;  3OAW A;  4IC7 B;  3TMP B;  2GBM A;  5JH5 C;  3B08 A;  2GOW A;  4IUM B;  2LGX A;  4KV2 A;  3VQI A;  2DYB A;  5JZE B;  2KLC A;  3KH0 A;  2KAN A;  2LVP A;  3OJ4 B;  2NR2 A;  4CO7 A;  5KHO A;  3UIO B;  1Q5W B;  4M0W B;  3PLV A;  2RGF A;  4ANW A;  1MG8 A;  3DOW A;  3QAQ A;  2M17 A;  2J0M A;  3QX1 A;  4MSQ B;  1S3S G;  2C7M B;  3A1Q B;  3PLU A;  4JGH B;  4PYZ A;  4JQW C;  2CHX A;  4DHJ D;  4DHZ B;  3OLM D;  1WMH A;  5D2M B;  1WGR A;  4GDL A;  1VCB A;  1V9J A;  4ZRI A;  2I1J A;  2FCM A;  1OTR B;  3AU5 A;  1C1Y B;  1BT0 A;  2KC2 A;  2ZNV B;  2GBK A;  2ZPY A;  4AUQ C;  3B0A A;  4FN2 A;  5HKH A;  4ASW C;  5J17 A;  1NDD A;  2JT4 B;  1U4A A;  3M63 B;  2BPS A;  2D3G A;  3IHP C;  1WI0 A;  3V60 A;  4RM8 A;  2KK8 A;  2KQ7 A;  4YL8 A;  4E71 A;  4TUU A;  2MA9 B;  4PS3 A;  3RZF A;  3WAL A;  4AJY B;  3S2A A;  1P1A A;  2BYV E;  3D32 A;  4WJQ A;  3TCA A;  3ZDT A;  3RUL A;  3PV1 A;  2Z0D B;  3H6N A;  3PHX B;  4IG7 B;  5CHV C;  4DXA B;  2XK5 A;  4EOY A;  2KDF B;  3AXC A;  4A3O A;  3SD5 A;  1C3T A;  4KSL C;  2LZ6 A;  2IY1 B;  2R2O A;  3W1S A;  3GOE A;  2JZZ A;  2ASQ A;  3NS8 A;  4KZ0 A;  4IM2 A;  2R2Q A;  5C23 A;  3RCZ A;  3VVW B;  1Q0W B;  2KFK A;  2Z59 B;  3EC8 A;  4P7I A;  3WA0 A;  3KUZ A;  3ZDM C;  3VH4 B;  1XT9 B;  3PRM B;  2G4S A;  3Q3J A;  3PZD A;  4KSK C;  2N9P C;  1E8X A;  5D7G A;  1WJU A;  1UD7 A;  5E6O A;  2C5L C;  2JWZ A;  4DBG A;  2BF8 B;  1GC6 A;  4GDK A;  1WGG A;  4IWP A;  4TQ1 A;  4GGQ A;  4GSW A;  2O2V B;  4HCN B;  4OVV A;  4GN1 A;  1H8C A;  4F8C B;  4FHJ A;  1WE6 A;  3CST A;  2N7E A;  2UWQ A;  2B3A A;  3VTU A;  1L7Y A;  2KC1 A;  2M1M A;  3ZNH B;  5DPW A;  2ZJD A;  2MP2 A;  2KKC A;  3R66 C;  3HK0 A;  5DPS A;  1J8C A;  2MBO A;  1IP9 A;  3JVZ X;  4MSM B;  2AYO B;  1WXM A;  3H1U A;  2PE9 A;  4BBN C;  2HTH A;  3A4S C;  1XD3 B;  1GG3 A;  1UBQ A;  4GB9 A;  3LDZ E;  3VUX A;  3TBL D;  2ZVO A;  1WGY A;  2WDT B;  2K6Q A;  2L0F A;  4GMV A;  2LI5 A;  4MGK E;  1NBF C;  2YVC A;  2KTF A;  5L95 C;  3U30 A;  5GMV A;  2CS4 A;  4NAW B;  4ZYN A;  4DWF A;  3EHV A;  4NJ6 A;  3ENE A;  2DZJ A;  4DK5 A;  2KJR A;  4K7S A;  2DAJ A;  4HJK A;  2AEH A;  2ZZP B;  5JHB A;  5DCN A;  3PHW B;  5D94 A;  4IWO A;  1E8W A;  2K8C A;  2KWC A;  5G55 A;  2MCN B;  3RYT A;  3A1Q A;  3A9K B;  5TR5 A;  3V6C B;  3ZIM A;  4NNJ B;  1WJN A;  3W1Y A;  4HK2 A;  5AZF A;  4K7U A;  4M8N A;  2PE6 B;  3ZNG C;  3ZLZ A;  2N1W A;  2KZR A;  4W9E A;  4AWJ A;  2GBJ A;  4MH0 E;  3SHQ A;  3QIJ A;  4W9F A;  2NBW B;  4MEL A;  3T9L A;  3ZRF A;  3U7D A;  2LAS A;  1TBE A;  2CU1 A;  4WWN A;  3KUC B;  4I6P A;  1LFD A;  3L16 A;  2MSE D;  3PRZ A;  1XQQ A;  1E8Y A;  3L0W B;  1RFA A;  1RAX A;  4GIV A;  4NY0 A;  1ZKH A;  3QJZ A;  2KQS A;  4HPM B;  1X1M A;  2N4F A;  3APF A;  2FAZ A;  2UYZ B;  2IO2 B;  5DPR A;  1YX6 B;  3ZTC A;  5D6J B;  2C9W B;  4ICU A;  2I1K A;  4F7Z A;  3UQB A;  2LD9 A;  1YJ1 A;  3NHE B;  3RZW C;  4E74 A;  3UGB B;  4OVU A;  1V6E A;  3QK0 A;  4TKN A;  4BKT A;  5IAA C;  2JRI B;  2WX0 A;  4EZJ A;  3DVN V;  4HVB A;  2CHW A;  3K9P B;  2CR5 A;  3ZW3 A;  1L2N A;  2KLG A;  4JL9 A;  1GNU A;  3VHT C;  1UGM A;  1E8Z A;  1WR1 A;  3V61 A;  2JY6 A;  2LWP A;  4KIK B;  4DHZ E;  4MJS A;  3VAW A;  2L3Z A;  4ANU A;  3L13 A;  2FCN A;  2O2V A;  4NQL B;  3WAM A;  3QCA A;  2L0T A;  4MGI E;  5DPT A;  3AUL A;  3I3T B;  1EF5 A;  1OGW A;  1H4R A;  2LJ5 A;  4FBJ B;  1P9D U;  2BKR B;  2J7Q B;  3N3K B;  4TV3 A;  2N9X A;  3QHT A;  5CHF A;  3VUY A;  4W9L A;  3QC8 B;  3VH3 B;  5CHW A;  4F1S A;  2L05 A;  2N9E B;  1I35 A;  1R4M I;  2CHZ A;  2KWV B;  4X57 B;  3ZNI D;  2MWS B;  2M0X A;  2AL3 A;  4N9F 4;  3N30 A;  2L8J A;  3Q3F A;  2FUH B;  1V5T A;  1IYF A;  1T0Y A;  1YQB A;  4GOC A;  4BOZ B;  1RLF A;  1SE9 A;  4NAW A;  1Z5S B;  3BY4 B;  4HCP B;  4WWO A;  2MBB B;  1WZ3 A;  3PGE A;  3CMM B;  2M4N A;  3NZU A;  5CTR C;  2V4L A;  4EKU A;  2K39 A;  3EEC A;  2EMS A;  2MQJ A;  4MJS B;  5AZG A;  4E3C A;  4ZDV A;  2RSU A;  3JW0 X;  3PT2 B;  3DDC B;  3NY5 A;  3HM3 A;  4HDO A;  3A9K A;  3DVG Y;  2MBQ A;  4K1R B;  1WM2 A;  5E6P A;  2HE7 A;  4FJY A;  4XZ4 A;  4G3X B;  3V6E B;  4KDI C;  2NS5 A;  3C0R B;  2D2Q A;  2Z0E B;  1UBI A;  4W9C A;  4NJ7 A;  5AZH A;  1P0R A;  2MRP A;  2CKH B;  3A9J B;  1IPG A;  3CSF A;  4II3 B;  4BKS D;  2C7N B;  3DBH I;  4ZRK A;  3APD A;  1V86 A;  2K8B A;  2EMT A;  4MDK E;  4MM3 A;  1LM8 B;  2JUO A;  5G2N A;  1JRU A;  1KJT A;  1R4N I;  1WX8 A;  1V2Y A;  3M95 A;  4ICV A;  3QWZ B;  5KHQ A;  2MBE A;  1SGH A;  1WR6 E;  1UH6 A;  3ZUN A;  2RPQ A;  4JIO U;  5FR6 A;  2KWU B;  4I6N B;  4BVU C;  2KDE B;  3DBR I;  3APC A;  2OOB B;  4ANX A;  4CHK A;  2DYM A;  5CX3 A;  2KVR A;  4PYU A;  1V80 A;  3A33 B;  1G6J A;  2KXJ A;  1WXV A;  2MBH A;  1UEL A;  3V62 A;  5C1Z A;  3X0W A;  1OQY A;  1KM7 A;  2PJH A;  2ZPN A;  3TIX A;  2BGF A;  1I42 A;  5L83 A;  2NBU A;  3QQ8 B;  4RM9 A;  1E90 A;  3AU4 A;  2BWE S;  2KO3 A;  4KIK A;  2L7R A;  1E7U A;  4BKS A;  1V49 A;  2V1Y A;  1ZW7 A;  2C7H A;  3JSV B;  1TTN A;  2HJ8 A;  2BKF A;  5J18 A;  2FCQ A;  3A4R A;  1HE8 A;  4IM3 A;  2LUE A;  4HXD A;  2O6V B;  1SIF A;  2G3Q B;  2FIF A;  3R3M A;  2GBR A;  1K8R B;  2NPT A;  2ZVN A;  2KDB A;  2WWZ A;  4XC2 A;  3R7R A;  5EDS A;  2WX1 A;  3X23 A;  2D11 A;  2KDI A;  1J19 A;  4A20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...