1WJ6A

Solution structure of rsgi ruh-024, a pb1 domain in human cdna, kiaa0049
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
b'GSSGSSGPHSMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0049 protein
publication title Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj6A01
2BF8B 3R66C 2LVPA 1WF9A 1VD2A 3OJ3A 2J0KA 4ZRJA 1OEYJ 4W9IA 1GJZA 4II3B 3BINA 4FJYA 2K8BA 2LJ5A 1V80A 3ZTDA 4AP4C 5C23A 4LDTD 2C5LC 1XD3B 2DZMA 3H1UA 3W1SA 4MH0E 2K1FA 3NZSA 2L0TA 3RYTA 2DENB 3NHEB 3M95A 3UINB 2CR5A 3ZW3A 2D2QA 1KJTA 3B08A 4W9KA 4PYZA 2ZPYA 2KANA 3TJPA 4E74A 1ZKHA 1XQQA 3ZLZA 5J2RA 4NAWA 3UF8A 2ZNVB 4NAWB 3A4RA 2OOBB 2LRWA 4WWNA 3HM6X 3ZTCA 2O6VB 2IO3B 1WXAA 1OTRB 1XT9B 2K6QA 1P0RA 2M0XA 2JXXA 1WXSA 2RSUA 2KQSA 3ECIA 2HE7A 5IA7A 2J0JA 5TR5A 2G4SA 4K7UA 4WWPA 3LDZE 4W9DA 2MA9B 4HXDA 1C1YB 2K6DB 2C60A 1NI2A 2IO0B 2PPHA 5C1ZA 4GIVA 2NBWB 1GUAB 4A3PA 2RPQA 4WJQA 4ANXA 3IVFA 1Z2MA 3VUXA 4GXBA 2GBKA 4F1SA 1EF1A 2KDEB 4MELA 3KH0A 1GNUA 4FA6A 5KHQA 2KN5A 2V3SA 2KD0A 1NBFC 3JVZX 1YX6B 3H9DA 2FCQA 2L76A 4EUTA 2L8JA 3PV1A 4GU2A 4KSKC 4XC2A 5CHWA 4P7IA 3WANA 2LUEA 1E5WA 3QQ8B 4MJSA 3UIPB 4BKGA 1YX5B 1WM3A 4GDLA 2BKRB 1IYFA 3HIZA 4DBGA 3PT2B 2I1JA 3NY5A 1UELA 3TMPB 2ZPNA 3ZNGC 4ANVA 4MGKE 2L00B 3SHQA 2MX2A 4TV3A 3V62A 2KDFB 2YLMA 2FNJB 2A4ZA 2C7NB 2ASQA 4GGQA 1RLFA 2LXCA 2RGFA 3OAWA 3H7SA 3IBEA 2IY0B 5KHOA 2N9EB 2O2VA 4AJWA 2JRHA 2BPSA 1V5OA 2KTRA 3QHTA 4F8CB 2KDIA 2WDTB 2ZVOA 5DPTA 2M1MA 3IFWB 3KYCD 2FUHB 5JHAA 4HPMB 4KZCA 2O6VD 4GB9A 3VAWA 2EMSA 2L3ZA 2LVOA 2LVQA 3DPDA 4FLHA 2Z0DB 4KDIC 1SGHA 1YD8U 4MGIE 3ZDTA 3PRZA 3VXWA 4F7ZA 5IAAC 4MDKE 2K25A 3PS6A 4WJOA 3B0AA 2IY1B 4A20A 4AJYB 3ALBA 3T8MA 2V1YA 3VHTC 1WGGA 3DQVA 1MG8A 2KX0A 4HDQA 5JH5C 4FHJA 2G45B 2PE9A 2JVCA 4RM8A 4GN1A 3U30A 3DBSA 3IHPC 1H8CA 4KDLB 2MBOA 1WX8A 4FADA 3WAMA 4G3XB 2LWPA 2FCNA 4WJPA 2B3AA 1IPGA 2KVRA 4KSLC 4WWOA 3A9KA 1LQBA 2KFJA 4JQWC 1WXVA 3GZNI 2WX0A 3N32A 1Q1OA 2LXAA 3KUDB 2G4DB 3CMMB 5G2NA 1OEYA 2KJ6A 4W9FA 1YJ1A 1JRUA 2DZKA 2JZZA 1Q5WB 2G3QB 3A33B 2FIDA 3B1LX 4G0NB 3X0WA 2MP2B 2MCNB 1S3SG 3QCAA 1YIWA 2DYMA 3QAQA 2NCNA 2WWZA 3ZNZB 2KMAA 1CMXB 1WXMA 3ML8A 4ZYNA 5D94A 5D2MB 2L05A 1E7VA 1RRBA 2NBVB 1UZXB 1WR1A 1ZGUB 2XEWA 3VUYA 3CSFA 1WFYA 5G55A 5AZFA 1P98A 2RD0A 1R4MI 1WMHA 2XK5A 3ZO5B 2C7MB 4IM2A 5EDSA 3KUZA 3BY4B 2KFKA 4GDKA 4BVUC 2D10A 2JPHA 5E6PA 4AUQC 1E7UA 3TL5A 2REXA 3VDZA 2KFKB 4DHJB 2MQJA 2KJHB 2MLBA 3TCAA 5AEKB 2N7EA 3L10B 2AEHA 1GC6A 2GBNA 2YVCA 3L17A 2BYVE 4LJOB 1KOTA 1P1AA 2JF5A 4OVUA 3V60A 1H4RA 1QZEA 2LGYA 1TGZB 5GMVA 2IZVB 3V6CB 3R3MA 3H7PA 4ICUA 1OQYA 4NQKE 1KLVA 1WGDA 2DHZA 1UGMA 1WJUA 3D32A 3H7PB 2GBJA 2FCSA 3TIXA 5LXHA 1EUVB 1TTNA 2NR2A 2OJRA 2QHOA 5L83A 1ZW7A 5J17A 4BKSA 2R2OA 4HJKA 4NPNA 4PS7A 3L16A 1WGRA 4FN2A 2L0FA 4CO7A 1P3QU 4ZRIA 2K8CA 1L2NA 2AL6A 1V86A 2LD9A 3A9JA 1Q0WB 2FAZA 1Z5SB 3U8ZA 4A3OA 2Y5BB 3QIJA 2W9NA 2LZ6A 1RAXA 2CHWA 4HCNB 5CHFA 2DZJA 1V9JA 1J8CA 1I42A 2MBEA 1V5TA 3VQIA 2KZRA 4DWFA 2JRIB 1WX7A 4EZKA 2UYZB 4IUMB 2ZNVC 1WM2A 4ASWC 2JT4B 2N1VA 2N9PC 2Z59B 2FCMA 4EFOA 2LGXA 1YQBA 3AU4A 5CHVC 1WRDB 4YL8A 3W1YA 2GOWA 2WX1A 4MM3A 5BO4B 3EHVA 2KTFA 4IW0A 4LCDE 4MJSB 3PSEB 4M0WB 3R7QA 2ZZPB 4GDLB 2MW5A 3SDLC 2N7DA 2WYQA 3APCA 2K8HA 4M8NA 2KMCA 3AI5A 2J0MA 4DHJD 4AWJA 2KC1A 5DPRA 3PHXB 4E3CA 3DVNU 4JLCA 3VVWB 3KVFB 4IWPA 4RM9A 3WAPA 3ENEA 2KC2A 2O2VB 2KTRB 3L13A 2BYEA 3VTUA 2KLCA 2KWCA 3KW5B 4DHZE 5D6JB 3PRPB 1FXTB 2JZ3B 1K8RB 4GOCA 2DAJA 4KZ0A 2JY6A 4JL9A 3N30A 1WYWB 2CHZA 2KJRA 2CU1A 1R4NI 1Y8RC 5E6NA 4ZRKA 3UIOB 4W9GA 2HD5B 4BFRA 3UQAA 2CKHB 4PS8A 3ZVVA 2N9XA 3NZUA 4HLEA 3T9LA 3I3TB 2M4NA 2J7QB 3VFKA 3A1QA 1BT0A 4KIKA 4MSMB 2KXJA 4W9LA 3NOBA 3S2AA 4W9HA 2NBUA 2EMTA 3A1QB 4HDOA 3VTVA 4FBJB 2NPTA 3JSVA 3L54A 3WAOA 4TQ1A 3PPAA 1A5RA 1UBIA 3KYDD 3PTFC 3HHMA 3V61A 1D3ZA 3A9KB 4ICVA 4NNJB 4ANWA 1UD7A 4TKNA 1WI0A 3P2BA 3PLUA 3DDCB 5AZHA 3GOEA 4E71A 1WE6A 4ANUA 4NJ6A 2CHXA 1WJ4A 3M63B 4II2B 1WGYA 3UQBA 4HK2A 4BKTA 4BOSC 4I6PA 3DBLI 3WA0A 3MHSD 1UBQA 4IM0A 4RMAA 2KO3A 4MSQB 4BBNF 3APFA 3QK0A 2KK8A 1M94A 4BOZB 2LASA 5DPWA 4HWIB 3V6EB 4KV2A 3PGEA 1L7YA 3RZWC 2L7RA 3TBLD 3VTWA 1WJ6A 2JUOA 4JIOU 3Q3JA 1WX9A 3RZFA 4FHKA 1HE8A 3ZUNA 3AULA 3CSTA 4HCPB 4W9CA 2DAFA 3SU8X 4EZJA 1P9DU 3O65B 4PYUA 3AXCA 3RCZA 1GC7A 1WMHB 2XK5B 4WJNA 1EO6A 5FR6A 1VCBA 4GDKB 1KM7A 2KLGA 1TBEA 3MTNB 2NVUI 5D7GA 1OGWA 1C3TA 2UWQA 4DK5A 2MBBB 2ZCBA 4K81A 4MGZE 4WQOB 4B6WA 2C9WB 3QA8A 2Z0EB 2DX5B 2N1WA 3RULA 1EF5A 1U4AA 4JGHB 1G6JA 1I35A 2ZEQA 4N9F4 3QARA 1V49A 3DVGX 4DDGD 1SE9A 3WIMA 2BGFA 2IBIB 3EC8A 1J0GA 4AOFA 3U7DA 2MSED 1S1QB 2KWVB 4BBNC 4B9KA 5L95C 2PE6B 4ZDVA 4LJPB 2MBQA 3WALA 4DXAB 2D07B 3PRMB 3W1SC 4I6NB 3M3JA 3X23A 2GBMA 2K39A 2KQ7A 3A9JB 4IC7B 1V6EA 2KKCA 3RT3B 2KNBA 3ONSA 4CYEA 5CX3A 2O6VA 2IYDB 1WZ3A 2BYFA 4IWQA 4M8MA 2JWZA 3C0RB 2KOXA 2KWUB 3ZNID 4OVVA 2MBHA 3AU5A 2AYOB 3M62B 3N3KB 5E6OA 3ZIMA 4PS3A 3KUCB 1WJNA 3IG3A 2ZJDA 4G11A 4NJ7A 1E8ZA 2KDBA 3HK0A 1ISNA 2ZCCA 4EKUA 1LXDA 1NDDA 2EKEC 3OJ4B 3RD2A 4WAAA 1WIAA 1WR6E 2NS5A 3DVGY 3R7RA 2BWFA 2LI5A 2IO2B 2C7HA 3JYUA 3QJZA 1V81A 1TZ1A 4B95A 4FULA 3K9PB 4CHKA 4I6LB 3QWZB 1WY8A 3PHWB 4URKA 3APDA 2GMIC 2MWSB 2AL3A 4DDID 1GG3A 2XBBC 4EEWA 2PEAA 1E8YA 4X57B 1E8WA 4DHZB 2GBRA 2HJ8A 1T0YA 5AZGA 5LLIA 2I1KA 3NS8A 4FJZA 4EOYA 2D11A 3ZRCA 4TUUA 4BKSD 5JZEB 4K7SA 3ZDMC 3QC8B 3DCGA 1WH3A 2MRPA 5DCNA 3UGBB 2V4LA 1F9JA 4IM3A 3RUIB 3DBRI 1J19A 4XX5A 2M17A 1UH6A 1WE7A 3L08A 4IWOA 3QX1A 4NY0A 1X1MA 4LDTB 4XZ4A 4W9EA 1RFAA 4KIKB 3VH3B 3VUWA 4TQ0A 2N4FA 3JW0X 1V2YA 3LJ3A 4KVGB 2A5UA 3K9OB 2NPTB 3DVNV 3JSVB 3L0WB 1WZ0A 2BKFA 4HPLB 5HKHA 2DZIA 4J6IA 2M8SA 4FJVB 3EFUA 4NQLB 4G50A 4EZLA 2PJHA 2DYBA 2RR9A 3DBHI 5J18A 5DPSA 4K7WA 5JHBA 2CS4A 3ZKJC 2IO1B 1SIFA 2KHWB 4W9JA 3HM3A 1LFDA 3OLMD 2VRRB 3PLVA 3Q3FA 1IP9A 4HVBA 1LM8B 1PQSA 2D3GA 3SD5A 3PZDA 3H6NA 3EECA 4IG7B 3ZRFA 3MJWA 1AARA 2ZVNA 2BWES 1E90A 2FIFA 2KX3A 2AWTA 1WGHA 3VH4B 3CF6E 2R2QA 2HTHA 2DYOA 5LXIB 5CTRC 3ZNHB 3DOWA 4MGYE 3ML9A 1E8XA 3PVLA 2MP2A 3A4SC 4GMVA 2LRUA 2LGDA 4MEMA 3PREA 4K1RB 4GSWA
chains in the Genus database with same CATH superfamily
3R66C 2LVPA 4KKJA 2J0KA 4W9IA 4YSZB 2NTSA 4FJYA 2K8BA 2CU3A 1V80A 3ZTDA 4AP4C 3AEAB 4K3CA 3H1UA 1IGDA 1JW9D 3W1SA 2L0TA 3H8HA 3RYTA 2CR5A 1UUPA 3B08A 4PYZA 3EUB2 3NVWA 3RNFC 3TJPA 1ZKHA 1C77A 2WU2B 3ZLZA 4NAWA 1XEEA 4RCOA 1SJHD 4NZLB 2ZNVB 4NAWB 1IBXA 2OOBB 3HM6X 1IBXB 3ZTCA 1JQ4A 1OTRB 2JXXA 3C8YA 4J3OD 2Q5WD 2J0JA 2RDGA 3LDZE 4W9DA 1C1YB 2C60A 5AUKA 5G5HA 4GIVA 4XWWA 2OEDA 4A3PA 4ANXA 3AH7A 3AV8A 4LTUA 4LNIA 1TS5A 1L4DB 4FA6A 2KAJA 2E3TA 1NBFC 2QIEB 3ZGZA 3AE1B 2L76A 1AWDA 4XC2A 3QQ8B 4MJSA 5BYRA 1WM3A 4DBGA 1UELA 3TMPB 1TS3A 2MX2A 4TV3A 2KDFB 2YLMA 1VJKA 2ASQA 3ZJTA 1FEHA 1RLFA 2JRHA 2BPSA 3VR8B 2ZVOA 5DPTA 4HPMB 1N6ZA 2O6VD 3EFCA 4GB9A 3VAWA 5EE3A 2L3ZA 2Z0DB 3MP9A 2INDC 3ZDTA 3VXWA 3VRBB 2LGIA 3NS1A 3VHTC 1MG8A 2KX0A 3OWEB 4RM8A 3IXSA 4KKIA 1H8CA 2EKIA 4G3XB 2LWPA 2KVRA 4KSLC 4WWOA 2LXAA 1C4CA 2BS3B 3GP7A 1OEYA 3TEYA 1YJ1A 3A33B 1S3SG 4YWGG 1K52A 2DYMA 2NCNA 2KMAA 1CMXB 2L05A 1E7VA 3N1XC 5MPOA 2NBVB 1E6EB 1QOFA 3CSFA 1Q10A 2C7MB 1YNTE 4YT0B 3BY4B 3GS2A 4BVUC 5E6PA 1JROA 1NVID 1L0VB 1RFKA 2N7EA 2YVCA 2BYVE 2VH2A 3R3MA 3H7PA 2PVOD 1YN5A 3H7PB 2OJRA 3MC9A 2R2OA 4HJKA 4PS7A 1E9MA 4FN2A 2V4IB 1QQRA 2JU6X 3BIID 1P3QU 1N5XA 1L2NA 2AL6A 1ESFA 1L5PA 1ZP0B 1ZDXA 1V86A 2FAZA 5BMHA 3UI3A 3U8ZA 1FFVA 4A3OA 2Y5BB 2W9NA 2H88B 1L4ZB 2WXIA 1ROEA 4ZYSA 1MHXA 2JT4B 3Q8FA 2Z59B 2RDBC 3RNBC 1WRDB 4YL8A 3W1YA 3Q3MC 4XGAB 2WX1A 5BO4B 4LCDE 4M0WB 3R7QA 4GDLB 2MW5A 3AI5A 2J0MA 3Q8AA 2KC1A 5DPRA 5IOIA 3DVNU 2LGSA 4IWPA 2I38A 4WIPA 3ENEA 5LNK1 3CWIA 2KTRB 1FFUA 2KLCA 2IGDA 3KW5B 4DHZE 4USAA 3PRPB 5IKCM 4KZ0A 2JY6A 4JL9A 4ARIA 3N30A 2CHZA 2KJRA 3UIOB 4BFRA 4WH4A 3I3TB 1QF6A 3T3OA 3S2AA 4KGTA 2D3BA 2NBUA 1GAQB 1MPEA 4HDOA 2GI9A 3JSVA 2IPKD 4A8XC 2WQYB 1D3ZA 4NNJB 3GE8C 1CZPA 3P2BA 2BT6A 4BZAA 4ANUA 1SEBD 4NJ6A 4YXDB 1WJ4A 2BW2A 2BQQA 3Q6BA 4BOSC 3DBLI 1N61A 3MHSD 1UBQA 1AYFA 2DBYA 1NI3A 3RZWC 2L7RA 1WJ6A 2HDEA 3Q3JA 1WX9A 3RZFA 4HCPB 2D3AA 2DAFA 3SU8X 4EZJA 2QJLA 1TYGB 4HRSA 1WMHB 4HROA 4WJNA 4DXFA 1EO6A 5FR6A 1L0XB 4LNNA 2KLGA 3FILB 3P63A 1SE3A 2MBBB 1YMHE 1R4MB 3RULA 1KFYB 1SXTA 1G6JA 4LNKA 3WIMA 1GB1A 2BGFA 2KWVB 4BBNC 1IGCA 2D07B 2GB1A 2RMMA 4I6NB 4DQOC 1PDXA 2GBMA 4RGOS 3RT3B 4CYEA 2KKCA 4M8MA 2IYDB 3FKYA 2Z8LA 3C0RB 2KOXA 1YQ4B 2XNAC 2M0AA 2GRIA 4OVVA 2MBHA 3ZIMA 3V3XA 2KQ4X 4G11A 2ACZB 1ISNA 3OJ4B 3RD2A 2HJ1A 4M01A 1J7BA 3O13A 1HTOA 3JYUA 1CQVA 1TZ1A 2JSVX 3NVYA 3K9PB 4I6LB 4URKA 2GMIC 1D5ZC 4X57B 1QOBA 1E7PB 1E8WA 2D11A 3ZDMC 5HFYA 1J19A 4XX5A 2M17A 2WXLA 3QX1A 3VH3B 2WXNA 2YEPB 1V2YA 2NPTB 3DVNV 1FXAA 2BKFA 5HHDG 4J6IA 1R4NB 3BVMA 5C2TB 1E10A 4XDCA 3PLVA 2MJ3A 1FO4A 2D3GA 3H6NA 3ZRFA 4IG7B 2HTME 2ZVNA 3W9CB 3GZNB 3L4PA 2KX3A 1VZ6A 1WYGA 2DYOA 5CTRC 1VRAB 4MGYE 1VLBA 2K3UA 4WAFA 2MP2A 1FXIA 3A4SC 2LGDA 2WP9B 2WXGA 4BOZB 4K1RB 1WRIA 1T3QA 1WF9A 4M02A 2N0SB 4ZRJA 1R7SA 3N1ZC 5C23A 4C7ZA 2BS4B 4XE0A 1M4VA 4MH0E 1KH0A 1QOAA 4IKGA 2DENB 3ZW3A 1KJTA 2G1EA 4E74A 4LNOA 1L6VA 3UF8A 4GLSC 1FPYA 2LRWA 4WWNA 2O6VB 1WXAA 2M0XA 2RSUA 3ECIA 2HE7A 5TR5A 1DOIA 2G4SA 2MA9B 4YTPB 2IO0B 4ZHOA 2AX5A 4REZA 1XLOA 2MH7A 3MC8A 4WJQA 3AE5B 2PKOA 2BYTA 2IGHA 4LLGM 4F1SA 3KH0A 2KN5A 3B2GA 3ETRA 2KD0A 3AEBB 1AN8A 1YX6B 3J9CA 2FE8A 2FCQA 1UWMA 4EUTA 3PV1A 3DHHC 4KSKC 5CHWA 2LUEA 3MHZA 1RM6C 2WNMA 1YX5B 3TUOA 1D4BA 3PT2B 4L2YA 2Y5CA 4A90A 1QLBB 4GGQA 3EA6A 1UF0A 1VDVA 2O2VA 5BYQA 1V5OA 3QHTA 2KDIA 2WDTB 3IFWB 2FUHB 3P4QB 4KZCA 2EMSA 1LGRA 3V05A 4FLHA 1SGHA 1YD8U 4MGIE 3W5UB 3P4PB 3PS6A 4WJOA 3B0AA 3AN1A 4A20A 3T8MA 1WGGA 4HDQA 5JH5C 2G45B 2KYWA 2PE9A 4GN1A 1JWBD 1PGXA 4YTNB 2WXRA 1EWCA 2ZW0A 3A9KA 3GZNI 1T0SC 2WX0A 1Q1OA 3NVVA 2LHDA 3KUDB 3CMMB 1ZE3D 4M00A 4W9FA 1I7HA 3B1LX 2MCNB 1HEZE 1F2RI 3ZNZB 1WXMA 3ML8A 4C56C 1TT5B 2VZKD 4PK1A 1C78A 1UZXB 2PMVA 5G55A 5AZFA 2KACA 1C76A 3KUZA 2DWQA 2JPHA 3TCAA 3L10B 1PFDA 2GBNA 1KOTA 4LJOB 3IAS1 4FXCA 2JF5A 2ON8A 4OVUA 1XO3A 2WXJA 1TGZB 5GMVA 2XN9C 4TSSA 4ICUA 1OQYA 4OHJA 2FCSA 2OHFA 2KVZA 2QEJC 4BKSA 3L16A 3DWMA 5AUIA 4HKQA 4CO7A 3ZXRA 3A9JA 1E0ZA 1WSPA 1QOGA 1XCQL 4HCNB 1V9JA 2MBEA 1TKGA 3VQIA 2PW9A 4IUMB 2ZNVC 1WM2A 2N1VA 2N9PC 2WXPA 4P6VF 4EFOA 1FMAD 4MM3A 1SB3C 4MJSB 4MM3B 2ZZPB 2N7DA 2WYQA 2WXMA 4DHJD 2INPE 4E3CA 4XDDA 4RM9A 3L13A 2BYEA 3R2TA 4LNFA 5HI1A 4GOCA 1ET6A 4ZRKA 3DBRB 2HD5B 4PS8A 3ZVVA 3NZUA 4HLEA 2J7QB 3VFKA 4KIKA 3NOBA 1YJIA 3Q2AC 4HJGE 1TKYA 3PPAA 1SE2A 1J7AA 3BVGA 3BYTB 3V61A 2R61A 3NG0A 1TZOA 1UD7A 1ZDVA 1WI0A 3PLUA 3M63B 4II2B 2PVGC 4BKTA 2AQ3B 4I6PA 3WA0A 4IM0A 2KO3A 4BBNF 3RMKC 1JWAD 2Y3AA 3QK0A 1M94A 1GB4A 1CJEA 5TSSA 3TBLD 2B76B 3U52E 4S17A 3AULA 5IO9A 3ZUNA 1KTKA 2KN4A 1KRHA 1GC7A 3RCZA 4AS1A 1YJJA 2AQ2B 1KM7A 3URYA 1TBEA 1OGWA 4ZRPA 2UWQA 4DK5A 2ZCBA 4B6WA 2C9WB 1SJED 3QA8A 2N1WA 1EF5A 2J53A 1C79A 3HUIA 4US9A 1FCCC 3EC8A 4B9KA 4ZDVA 2FBWB 1XF5L 1FCLA 1ZXHA 2K39A 1UNSA 4EE2A 4IC7B 3ONSA 1WZ3A 2BYFA 2JWZA 1UGJA 3ZNID 5BYSA 1SE4A 2W3SA 3U2SC 4EKUA 3RNCC 1ZUD2 4WAAA 1WIAA 1F1HA 2MEKA 2LI5A 1PGAA 5C3JB 1VR9A 1ET9A 1V81A 5G5GA 2WDVB 4CHKA 3N9YC 3QWZB 3APDA 3BWUD 4QAYA 1I4GA 2JXTA 4DDID 3E9SA 2XBBC 1T5XD 2PEAA 4Q2JA 3KQ4A 1T0YA 1EU3A 2I1KA 2ONQA 4KGSA 3ZRCA 4BKSD 1I4PA 5JZEB 2JYTA 2W3RA 3DCGA 1OQRA 2V4LA 4IM3A 3RUIB 3DBRI 1I4RA 3Q3NC 1WE7A 4IWOA 4NY0A 1X1MA 4W9EA 1RFAA 2WGSA 2N4FA 2BB5A 2LFIA 3ABVB 2A5UA 3JSVB 2NTTA 1L0YB 2M8SA 3MFGA 2PJHA 4US8A 2H89B 1FNVA 2IO1B 2KHWB 1C4PA 3HM3A 1MHHE 1HQRD 4C7YA 1TY0A 1IP9A 1AW7A 1TY2A 3SD5A 4OZBA 3MJWA 1AARA 2BWES 1E90A 1WGHA 5H92C 1SSNA 2OJWA 5LXIB 1KF6B 5EE9A 1YQ3B 2LRUA 4GMVA 3I5JC 4GSWA 1JWUD 2BF8B 4A6QA 3PO0A 3I9V1 3BINA 3VRAB 5I4DA 2LJ5A 4K3BA 2Y5PA 1I4HA 5BMGA 1XLPA 2K1FA 3NZSA 3NHEB 1EWYC 2WS3B 2LJIA 2KANA 3A4RA 1QT9A 4P16A 4XYCA 1TKEA 2IO3B 2K6QA 1P0RA 2CJNA 1WXSA 3AB5A 2KQSA 5IA7A 2K0PA 4K7UA 4L1BA 2BTEA 4HXDA 4R3DA 2K6DB 1BXTA 1N63A 1BMLC 1NI2A 5C1ZA 1GUAB 2WDRB 2RPQA 2WXFA 1Z2MA 4RF0A 2JYEA 1EF1A 2KDEB 3Q3OC 3Q69A 5KHQA 2L83A 4WWMA 3AE3B 1V1OA 2E6XA 2G9HD 3WANA 4P7IA 1E5WA 3HIZA 4ANVA 2ZPNA 3ZNGC 4MGKE 1PUTA 2INCC 3V62A 1UWXA 2QSDA 2C7NB 2LXCA 2RGFA 1XCTL 2IY0B 2N9EB 2VZKB 2K22A 2WXHA 2L32A 2M1MA 3IT6B 3KYCD 1NYQA 4F7ZA 1L6UA 1PYWD 1FRRA 2K25A 5HG2A 4AJYB 3NZ3A 1ZXIA 1D6EC 2DNFA 3U30A 3DBSA 3AEEB 4KDLB 1WX8A 1ACCA 4WJPA 3IAM1 1LQBA 4JQWC 1MG4A 3DWGC 3AM9A 1P7EA 2G4DB 2LHEA 1MVKA 1JRUA 2DZKA 2JZZA 1Q5WB 2G3QB 2RPVA 3X0WA 4H2AA 2MP2B 2PLPA 1XLNA 2J52A 1YIWA 2WWZA 4ZYNA 5D94A 5D2MB 2LMCA 2RDHA 3VUYA 1P98A 2RD0A 1R4MI 2KT7A 1DOXA 3ZO5B 2XK5A 4IM2A 1XLQA 4ACFA 5EDSA 4LK0M 4GDKA 2KFKA 2D10A 3I63C 3TL5A 2REXA 4DHJB 2KFKB 4ZOHC 5IN7A 2KJHB 2PTLA 4ARCA 2AEHA 1F52A 3L17A 1P1AA 3V60A 3ZYYX 1QZEA 2LGYA 1F2RC 1KLVA 3TIXA 1EUVB 2NR2A 2QHOA 1ZW7A 5J17A 1WGRA 2M19A 1HTQA 4XWTA 2BVCA 1V1PA 2LD9A 1V1PB 1Q0WB 3MJ5A 3QIJA 4ZHPA 2CHWA 2DZJA 4DWFA 2KZRA 1FNUA 2N9KA 2UYZB 4ASWC 3AMZA 2FCMA 2LGXA 1YQBA 2QMTA 3Q8BA 4OZAA 5GXGB 3EHVA 1WXQA 2V0GA 3RNGC 2K8HA 4M8NA 1VZ7A 3PHXB 3ZXVA 3N20C 3P4SB 3KWVA 3AECB 3BYYB 2INNE 2O2VB 3VTUA 1YOVB 2KWCA 3SFEB 2JZ3B 2DAJA 5EE0A 2NMQA 1R4NI 5E6NA 1T0RC 5FK9C 3A1QA 1BT0A 4MSMB 4W9LA 2KXJA 3P42A 1B9RA 1QILA 3A1QB 2EMTA 3TEWA 4RNAA 1VZ8A 1A5RA 1SBBB 3KYDD 3HHMA 2ICIA 4S0RA 3A9KB 4ICVA 5FR3A 1FM0D 4HEA1 4IOIE 5AZHA 3GOEA 2J42A 1IUEA 3UQBA 4HK2A 3MC0B 1N62A 4RMAA 3APFA 2KK8A 1B1ZA 1MJDA 3NUHB 4HWIB 3PGEA 2JUOA 3ZJVA 4JIOU 4AQ7A 4FHKA 1HE8A 1FD6A 5H8YE 4NJCA 1OQQA 1VCBA 2UU7A 1I4XA 1JWMD 3MTNB 2NVUI 2M56B 4WQMA 2BB6A 3B9JA 4N6EB 3CIRB 2N9LA 3AE8B 4JGHB 1I35A 3QARA 1HZ6A 3DVGX 4DDGD 3W2DA 1SE9A 2IBIB 2L52A 4NAMA 4AOFA 2MSED 1JRPA 3W5VB 2PE6B 4LJPB 2MBQA 4DXAB 3W1SC 3M3JA 2KQ7A 3A9JB 1SF0A 1YN3A 1V6EA 2KNBA 2KWUB 4RGNA 3N3KB 2JZPA 3M62B 4ITKA 5E6OA 3KUCB 1WJNA 3IG3A 2KDBA 1LXDA 1NDDA 2EKEC 1WR6E 2NS5A 3RPFC 2BWFA 4PT5A 3U7ZA 2FUG1 4B95A 1N5WA 3TSSA 3BK2A 4RFBA 2SEBD 3N1YC 1OFFA 1GG3A 3AEDB 1C4AA 5FKAC 1JMLA 3SEBA 4EEWA 2QCZA 4DHZB 5AZGA 5LLIA 3NS8A 4RGMA 4EOYA 2V9HA 1WH3A 2MRPA 5DCNA 3UGBB 1JALA 2LUMA 3RFZB 3L08A 4XZ4A 1EM7A 4KIKB 3VUWA 3KWLA 3LJ3A 5HKHA 3K9OB 3L0WB 4HPLB 4FJVB 2J4XA 2DYBA 5J18A 5JHBA 2CS4A 3ZKJC 3DHIC 4W9JA 3OLMD 2VRRB 3PZ7A 3Q3FA 1LM8B 1PQSA 2W82A 3PZ8A 3EECA 2MHJA 3RNEC 2AWTA 2WHIA 3ZNHB 3DBLB 1KLGD 5D3IB 4MEMA 3PREA 1MI0A 2QDFA 1LO5D 1VD2A 3OJ3A 1OEYJ 1GJZA 4II3B 4LDTD 2C5LC 1XD3B 2DZMA 1TS4A 1GPXA 2VH1A 4JE3B 4JWSC 3M95A 1PGBA 5EE1A 3UINB 2D2QA 4W9KA 2ZPYA 2BBCA 3AE4B 4D2KA 1XQQA 5J2RA 4DXGA 5JXVA 1XT9B 4N59A 1DOYA 1D5XC 1TIFA 4WWPA 4JWUC 2PPHA 1FNWA 2NBWB 3HVZA 3IVFA 3VUXA 4GXBA 2GBKA 4MELA 1RYJA 1GNUA 2SAKA 2V3SA 3AEFB 4P1CC 1T0QC 3JVZX 3H9DA 3VR9B 5T8IA 2L8JA 2V3PA 4GU2A 4BKGA 3UIPB 4M0WA 4GDLA 1IYFA 2BKRB 2I1JA 3NY5A 4TMAB 1MFWA 3E56A 2L00B 2YEPF 3SHQA 1XXGA 1A70A 2FNJB 2A4ZA 3RNAC 3OAWA 3H7SA 3IBEA 5KHOA 4AJWA 4C00A 2KTRA 1D5MC 4F8CB 1CK1A 5JHAA 5E6JA 2LVQA 2LVOA 3DPDA 4KDIC 3PRZA 5IAAC 4MDKE 2IY1B 3ALBA 2V1YA 3DQVA 1JWSD 4UDUC 4FHJA 2WDQB 2JVCA 3IHPC 3LXFA 2IJ0A 2MBOA 4FADA 3WAMA 4N58A 2FCNA 3AEGB 3GE3C 2B3AA 1IPGA 3R2IA 1J7CA 2KFJA 2JWUA 1WXVA 3N32A 4B0MA 5G2NA 2MJEA 2KJ6A 2FIDA 4G0NB 2WXOA 3QCAA 1ZPSA 4A9AA 1TJEA 3QAQA 3SFDB 5BMIA 2MJDA 3NVZA 1RRBA 3RN9C 1ZGUB 1WR1A 2XEWA 3BK1A 1WFYA 3WCQA 2KMMA 3I57A 5D3DA 3AE6B 1TS2A 1WMHA 4YSYB 4AUQC 1E7UA 2V3NA 3C19A 4KX6B 3VDZA 3FILA 2MQJA 2MLBA 1WGKA 4P1BC 3GB1A 5AEKB 4RF1A 1GC6A 1KLUD 2BS2B 1H4RA 2IZVB 3V6CB 4WURA 4NQKE 1WGDA 2DHZA 1UGMA 1WJUA 3D32A 2GBJA 5LXHA 1TTNA 3Q8CA 2WXQA 2LEKA 5L83A 2KWDA 1V97A 4NPNA 1F0ZA 4ZRQA 1DGJA 2L0FA 4RH6A 4YTMB 4ZRIA 1V8CA 2K8CA 3HRDD 3EGRA 1Z5SB 1NYRA 2LZ6A 1RAXA 1J8CA 1I42A 5CHFA 4MACA 1V5TA 2JRIB 1WX7A 4EZKA 2CJOA 1BUIC 3AU4A 5CHVC 2DLBA 2EELA 2JQRB 2GOWA 3ZQ4A 1SIJA 2KTFA 4IW0A 3PSEB 3SDLC 4HKZE 3APCA 2KMCA 1HXYD 4HPPA 3LB8C 4AWJA 1T6BX 4YSXB 4JLCA 4O1NA 3VVWB 3KVFB 4L23A 3WAPA 3BZDB 2KC2A 5D6JB 1FXTB 1K8RB 2TSSA 1WYWB 2CU1A 1Y8RC 1DYQA 4W9GA 3UQAA 2CKHB 2D5GA 2N9XA 3TEXA 2D3CA 4JX1C 3T9LA 2M4NA 1ENFA 4W9HA 5IP4D 1QKZA 3VTVA 4FBJB 2NPTA 3L54A 3WAOA 4MT5A 1FRDA 4TQ1A 3DBHB 3RI7C 3FC4A 3P4RB 1UBIA 3PTFC 1HZ5A 4OZCA 2GLSA 3IT4B 4ANWA 3AE9B 1FIQA 4TKNA 1HA5A 1I4QA 3DDCB 3R8BA 1P7FA 4E71A 1WE6A 3Q8EA 2CHXA 1WGYA 1STEA 2QC8A 1Y56A 2L1AA 4MSQB 1K53A 1K51A 1YN4A 1GOZA 2LASA 5DPWA 3V6EB 4KV2A 1L7YA 3VTWA 4W9CA 3CSTA 2I2YA 1P9DU 3O65B 4PYUA 3AXCA 4RGTA 2X38A 2XK5B 3AE7B 4GDKB 5D7GA 1JCKB 1C3TA 4WQOB 4K81A 4MGZE 4IDIA 2Z0EB 2DX5B 2IDYA 1U4AA 2ZEQA 4N9F4 1V49A 1J0GA 2K5PA 1S1QB 5L95C 3TEZA 3WALA 3PRMB 2ZW1A 3X23A 2W54A 3DHGC 5CX3A 2O6VA 4IWQA 1RWSA 1NEKB 2JX5A 3AU5A 2AYOB 4PS3A 3Q14C 2WU5B 2ZJDA 4NJ7A 1E8ZA 3HK0A 1N60A 2ZCCA 1NENB 4JPSA 3DVGY 3R7RA 4B0EA 3FAHA 1K50A 2IO2B 2AQ1B 2C7HA 4OW0A 2WXKA 3SR6A 4MH8A 3QJZA 4FULA 3T3NA 3BVZA 1WY8A 3PHWB 1WWTA 2MWSB 4C4VA 2AL3A 4OVZA 4C4VB 1E8YA 4BAXA 2GBRA 2HJ8A 3AE2B 4FJZA 4TUUA 2PIAA 4K7SA 3QC8B 3HVDA 1F77A 1F9JA 1UH6A 4LDTB 4TQ0A 2IGGA 3JW0X 4KVGB 4CQNA 3LYYA 1WZ0A 2DZIA 3EFUA 4NQLB 4G50A 4EZLA 2RR9A 3DBHI 5DPSA 4K7WA 1C9FA 3ZJUA 1SIFA 3NRZA 1LFDA 3P1MA 4HVBA 2K9XA 3OG5A 2WLBA 3NJTA 3PZDA 2QILA 2KDMA 4A55A 3KLSX 2X8XX 1ZOYB 2FIFA 3VH4B 4C80A 3U4EG 3CF6E 2R2QA 2W55A 2HTHA 3B2FA 3DOWA 3ML9A 1E8XA 3PVLA 4KGRA 1EU4A 3U7DA 2N7JA
chains in the Genus database with same CATH topology
2BF8B 3R66C 2LVPA 1WF9A 1VD2A 3OJ3A 2J0KA 4ZRJA 1OEYJ 4W9IA 1GJZA 4II3B 3BINA 4FJYA 2K8BA 2LJ5A 1V80A 3ZTDA 4AP4C 5C23A 4LDTD 2C5LC 1XD3B 2DZMA 3H1UA 3W1SA 4MH0E 2K1FA 3NZSA 2L0TA 3RYTA 2DENB 3NHEB 3M95A 3UINB 2CR5A 3ZW3A 2D2QA 1KJTA 3B08A 4W9KA 4PYZA 2ZPYA 2KANA 3TJPA 4E74A 1ZKHA 1XQQA 3ZLZA 5J2RA 4NAWA 3UF8A 2ZNVB 4NAWB 3A4RA 2OOBB 2LRWA 4WWNA 3HM6X 3ZTCA 2O6VB 2IO3B 1WXAA 1OTRB 1XT9B 2K6QA 1P0RA 2M0XA 2JXXA 1WXSA 2RSUA 2KQSA 3ECIA 2HE7A 5IA7A 2J0JA 5TR5A 2G4SA 4K7UA 4WWPA 3LDZE 4W9DA 2MA9B 4HXDA 1C1YB 2K6DB 2C60A 1NI2A 2IO0B 2PPHA 5C1ZA 4GIVA 2NBWB 1GUAB 4A3PA 2RPQA 4WJQA 4ANXA 3IVFA 1Z2MA 3VUXA 4GXBA 2GBKA 4F1SA 1EF1A 2KDEB 4MELA 3KH0A 1GNUA 4FA6A 5KHQA 2KN5A 2V3SA 2KD0A 1NBFC 3JVZX 1YX6B 3H9DA 2FCQA 2L76A 4EUTA 2L8JA 3PV1A 4GU2A 4KSKC 4XC2A 5CHWA 4P7IA 3WANA 2LUEA 1E5WA 3QQ8B 4MJSA 3UIPB 4BKGA 1YX5B 1WM3A 4GDLA 2BKRB 1IYFA 3HIZA 4DBGA 3PT2B 2I1JA 3NY5A 1UELA 3TMPB 2ZPNA 3ZNGC 4ANVA 4MGKE 2L00B 3SHQA 2MX2A 4TV3A 3V62A 2KDFB 2YLMA 2FNJB 2A4ZA 2C7NB 2ASQA 4GGQA 1RLFA 2LXCA 2RGFA 3OAWA 3H7SA 3IBEA 2IY0B 5KHOA 2N9EB 2O2VA 4AJWA 2JRHA 2BPSA 1V5OA 2KTRA 3QHTA 4F8CB 2KDIA 2WDTB 2ZVOA 5DPTA 2M1MA 3IFWB 3KYCD 2FUHB 5JHAA 4HPMB 4KZCA 2O6VD 4GB9A 3VAWA 2EMSA 2L3ZA 2LVOA 2LVQA 3DPDA 4FLHA 2Z0DB 4KDIC 1SGHA 1YD8U 4MGIE 3ZDTA 3PRZA 3VXWA 4F7ZA 5IAAC 4MDKE 2K25A 3PS6A 4WJOA 3B0AA 2IY1B 4A20A 4AJYB 3ALBA 3T8MA 2V1YA 3VHTC 1WGGA 3DQVA 1MG8A 2KX0A 4HDQA 5JH5C 4FHJA 2G45B 2PE9A 2JVCA 4RM8A 4GN1A 3U30A 3DBSA 3IHPC 1H8CA 4KDLB 2MBOA 1WX8A 4FADA 3WAMA 4G3XB 2LWPA 2FCNA 4WJPA 2B3AA 1IPGA 2KVRA 4KSLC 4WWOA 3A9KA 1LQBA 2KFJA 4JQWC 1WXVA 3GZNI 2WX0A 3N32A 1Q1OA 2LXAA 3KUDB 2G4DB 3CMMB 5G2NA 1OEYA 2KJ6A 4W9FA 1YJ1A 1JRUA 2DZKA 2JZZA 1Q5WB 2G3QB 3A33B 2FIDA 3B1LX 4G0NB 3X0WA 2MP2B 2MCNB 1S3SG 3QCAA 1YIWA 2DYMA 3QAQA 2NCNA 2WWZA 3ZNZB 2KMAA 1CMXB 1WXMA 3ML8A 4ZYNA 5D94A 5D2MB 2L05A 1E7VA 1RRBA 2NBVB 1UZXB 1WR1A 1ZGUB 2XEWA 3VUYA 3CSFA 1WFYA 5G55A 5AZFA 1P98A 2RD0A 1R4MI 1WMHA 2XK5A 3ZO5B 2C7MB 4IM2A 5EDSA 3KUZA 3BY4B 2KFKA 4GDKA 4BVUC 2D10A 2JPHA 5E6PA 4AUQC 1E7UA 3TL5A 2REXA 3VDZA 2KFKB 4DHJB 2MQJA 2KJHB 2MLBA 3TCAA 5AEKB 2N7EA 3L10B 2AEHA 1GC6A 2GBNA 2YVCA 3L17A 2BYVE 4LJOB 1KOTA 1P1AA 2JF5A 4OVUA 3V60A 1H4RA 1QZEA 2LGYA 1TGZB 5GMVA 2IZVB 3V6CB 3R3MA 3H7PA 4ICUA 1OQYA 4NQKE 1KLVA 1WGDA 2DHZA 1UGMA 1WJUA 3D32A 3H7PB 2GBJA 2FCSA 3TIXA 5LXHA 1EUVB 1TTNA 2NR2A 2OJRA 2QHOA 5L83A 1ZW7A 5J17A 4BKSA 2R2OA 4HJKA 4NPNA 4PS7A 3L16A 1WGRA 4FN2A 2L0FA 4CO7A 1P3QU 4ZRIA 2K8CA 1L2NA 2AL6A 1V86A 2LD9A 3A9JA 1Q0WB 2FAZA 1Z5SB 3U8ZA 4A3OA 2Y5BB 3QIJA 2W9NA 2LZ6A 1RAXA 2CHWA 4HCNB 5CHFA 2DZJA 1V9JA 1J8CA 1I42A 2MBEA 1V5TA 3VQIA 2KZRA 4DWFA 2JRIB 1WX7A 4EZKA 2UYZB 4IUMB 2ZNVC 1WM2A 4ASWC 2JT4B 2N1VA 2N9PC 2Z59B 2FCMA 4EFOA 2LGXA 1YQBA 3AU4A 5CHVC 1WRDB 4YL8A 3W1YA 2GOWA 2WX1A 4MM3A 5BO4B 3EHVA 2KTFA 4IW0A 4LCDE 4MJSB 3PSEB 4M0WB 3R7QA 2ZZPB 4GDLB 2MW5A 3SDLC 2N7DA 2WYQA 3APCA 2K8HA 4M8NA 2KMCA 3AI5A 2J0MA 4DHJD 4AWJA 2KC1A 5DPRA 3PHXB 4E3CA 3DVNU 4JLCA 3VVWB 3KVFB 4IWPA 4RM9A 3WAPA 3ENEA 2KC2A 2O2VB 2KTRB 3L13A 2BYEA 3VTUA 2KLCA 2KWCA 3KW5B 4DHZE 5D6JB 3PRPB 1FXTB 2JZ3B 1K8RB 4GOCA 2DAJA 4KZ0A 2JY6A 4JL9A 3N30A 1WYWB 2CHZA 2KJRA 2CU1A 1R4NI 1Y8RC 5E6NA 4ZRKA 3UIOB 4W9GA 2HD5B 4BFRA 3UQAA 2CKHB 4PS8A 3ZVVA 2N9XA 3NZUA 4HLEA 3T9LA 3I3TB 2M4NA 2J7QB 3VFKA 3A1QA 1BT0A 4KIKA 4MSMB 2KXJA 4W9LA 3NOBA 3S2AA 4W9HA 2NBUA 2EMTA 3A1QB 4HDOA 3VTVA 4FBJB 2NPTA 3JSVA 3L54A 3WAOA 4TQ1A 3PPAA 1A5RA 1UBIA 3KYDD 3PTFC 3HHMA 3V61A 1D3ZA 3A9KB 4ICVA 4NNJB 4ANWA 1UD7A 4TKNA 1WI0A 3P2BA 3PLUA 3DDCB 5AZHA 3GOEA 4E71A 1WE6A 4ANUA 4NJ6A 2CHXA 1WJ4A 3M63B 4II2B 1WGYA 3UQBA 4HK2A 4BKTA 4BOSC 4I6PA 3DBLI 3WA0A 3MHSD 1UBQA 4IM0A 4RMAA 2KO3A 4MSQB 4BBNF 3APFA 3QK0A 2KK8A 1M94A 4BOZB 2LASA 5DPWA 4HWIB 3V6EB 4KV2A 3PGEA 1L7YA 3RZWC 2L7RA 3TBLD 3VTWA 1WJ6A 2JUOA 4JIOU 3Q3JA 1WX9A 3RZFA 4FHKA 1HE8A 3ZUNA 3AULA 3CSTA 4HCPB 4W9CA 2DAFA 3SU8X 4EZJA 1P9DU 3O65B 4PYUA 3AXCA 3RCZA 1GC7A 1WMHB 2XK5B 4WJNA 1EO6A 5FR6A 1VCBA 4GDKB 1KM7A 2KLGA 1TBEA 3MTNB 2NVUI 5D7GA 1OGWA 1C3TA 2UWQA 4DK5A 2MBBB 2ZCBA 4K81A 4MGZE 4WQOB 4B6WA 2C9WB 3QA8A 2Z0EB 2DX5B 2N1WA 3RULA 1EF5A 1U4AA 4JGHB 1G6JA 1I35A 2ZEQA 4N9F4 3QARA 1V49A 3DVGX 4DDGD 1SE9A 3WIMA 2BGFA 2IBIB 3EC8A 1J0GA 4AOFA 3U7DA 2MSED 1S1QB 2KWVB 4BBNC 4B9KA 5L95C 2PE6B 4ZDVA 4LJPB 2MBQA 3WALA 4DXAB 2D07B 3PRMB 3W1SC 4I6NB 3M3JA 3X23A 2GBMA 2K39A 2KQ7A 3A9JB 4IC7B 1V6EA 2KKCA 3RT3B 2KNBA 3ONSA 4CYEA 5CX3A 2O6VA 2IYDB 1WZ3A 2BYFA 4IWQA 4M8MA 2JWZA 3C0RB 2KOXA 2KWUB 3ZNID 4OVVA 2MBHA 3AU5A 2AYOB 3M62B 3N3KB 5E6OA 3ZIMA 4PS3A 3KUCB 1WJNA 3IG3A 2ZJDA 4G11A 4NJ7A 1E8ZA 2KDBA 3HK0A 1ISNA 2ZCCA 4EKUA 1LXDA 1NDDA 2EKEC 3OJ4B 3RD2A 4WAAA 1WIAA 1WR6E 2NS5A 3DVGY 3R7RA 2BWFA 2LI5A 2IO2B 2C7HA 3JYUA 3QJZA 1V81A 1TZ1A 4B95A 4FULA 3K9PB 4CHKA 4I6LB 3QWZB 1WY8A 3PHWB 4URKA 3APDA 2GMIC 2MWSB 2AL3A 4DDID 1GG3A 2XBBC 4EEWA 2PEAA 1E8YA 4X57B 1E8WA 4DHZB 2GBRA 2HJ8A 1T0YA 5AZGA 5LLIA 2I1KA 3NS8A 4FJZA 4EOYA 2D11A 3ZRCA 4TUUA 4BKSD 5JZEB 4K7SA 3ZDMC 3QC8B 3DCGA 1WH3A 2MRPA 5DCNA 3UGBB 2V4LA 1F9JA 4IM3A 3RUIB 3DBRI 1J19A 4XX5A 2M17A 1UH6A 1WE7A 3L08A 4IWOA 3QX1A 4NY0A 1X1MA 4LDTB 4XZ4A 4W9EA 1RFAA 4KIKB 3VH3B 3VUWA 4TQ0A 2N4FA 3JW0X 1V2YA 3LJ3A 4KVGB 2A5UA 3K9OB 2NPTB 3DVNV 3JSVB 3L0WB 1WZ0A 2BKFA 4HPLB 5HKHA 2DZIA 4J6IA 2M8SA 4FJVB 3EFUA 4NQLB 4G50A 4EZLA 2PJHA 2DYBA 2RR9A 3DBHI 5J18A 5DPSA 4K7WA 5JHBA 2CS4A 3ZKJC 2IO1B 1SIFA 2KHWB 4W9JA 3HM3A 1LFDA 3OLMD 2VRRB 3PLVA 3Q3FA 1IP9A 4HVBA 1LM8B 1PQSA 2D3GA 3SD5A 3PZDA 3H6NA 3EECA 4IG7B 3ZRFA 3MJWA 1AARA 2ZVNA 2BWES 1E90A 2FIFA 2KX3A 2AWTA 1WGHA 3VH4B 3CF6E 2R2QA 2HTHA 2DYOA 5LXIB 5CTRC 3ZNHB 3DOWA 4MGYE 3ML9A 1E8XA 3PVLA 2MP2A 3A4SC 4GMVA 2LRUA 2LGDA 4MEMA 3PREA 4K1RB 4GSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BF8 B;  3R66 C;  2LVP A;  1WF9 A;  1VD2 A;  3OJ3 A;  2J0K A;  4ZRJ A;  1OEY J;  4W9I A;  1GJZ A;  4II3 B;  3BIN A;  4FJY A;  2K8B A;  2LJ5 A;  1V80 A;  3ZTD A;  4AP4 C;  5C23 A;  4LDT D;  2C5L C;  1XD3 B;  2DZM A;  3H1U A;  3W1S A;  4MH0 E;  2K1F A;  3NZS A;  2L0T A;  3RYT A;  2DEN B;  3NHE B;  3M95 A;  3UIN B;  2CR5 A;  3ZW3 A;  2D2Q A;  1KJT A;  3B08 A;  4W9K A;  4PYZ A;  2ZPY A;  2KAN A;  3TJP A;  4E74 A;  1ZKH A;  1XQQ A;  3ZLZ A;  5J2R A;  4NAW A;  3UF8 A;  2ZNV B;  4NAW B;  3A4R A;  2OOB B;  2LRW A;  4WWN A;  3HM6 X;  3ZTC A;  2O6V B;  2IO3 B;  1WXA A;  1OTR B;  1XT9 B;  2K6Q A;  1P0R A;  2M0X A;  2JXX A;  1WXS A;  2RSU A;  2KQS A;  3ECI A;  2HE7 A;  5IA7 A;  2J0J A;  5TR5 A;  2G4S A;  4K7U A;  4WWP A;  3LDZ E;  4W9D A;  2MA9 B;  4HXD A;  1C1Y B;  2K6D B;  2C60 A;  1NI2 A;  2IO0 B;  2PPH A;  5C1Z A;  4GIV A;  2NBW B;  1GUA B;  4A3P A;  2RPQ A;  4WJQ A;  4ANX A;  3IVF A;  1Z2M A;  3VUX A;  4GXB A;  2GBK A;  4F1S A;  1EF1 A;  2KDE B;  4MEL A;  3KH0 A;  1GNU A;  4FA6 A;  5KHQ A;  2KN5 A;  2V3S A;  2KD0 A;  1NBF C;  3JVZ X;  1YX6 B;  3H9D A;  2FCQ A;  2L76 A;  4EUT A;  2L8J A;  3PV1 A;  4GU2 A;  4KSK C;  4XC2 A;  5CHW A;  4P7I A;  3WAN A;  2LUE A;  1E5W A;  3QQ8 B;  4MJS A;  3UIP B;  4BKG A;  1YX5 B;  1WM3 A;  4GDL A;  2BKR B;  1IYF A;  3HIZ A;  4DBG A;  3PT2 B;  2I1J A;  3NY5 A;  1UEL A;  3TMP B;  2ZPN A;  3ZNG C;  4ANV A;  4MGK E;  2L00 B;  3SHQ A;  2MX2 A;  4TV3 A;  3V62 A;  2KDF B;  2YLM A;  2FNJ B;  2A4Z A;  2C7N B;  2ASQ A;  4GGQ A;  1RLF A;  2LXC A;  2RGF A;  3OAW A;  3H7S A;  3IBE A;  2IY0 B;  5KHO A;  2N9E B;  2O2V A;  4AJW A;  2JRH A;  2BPS A;  1V5O A;  2KTR A;  3QHT A;  4F8C B;  2KDI A;  2WDT B;  2ZVO A;  5DPT A;  2M1M A;  3IFW B;  3KYC D;  2FUH B;  5JHA A;  4HPM B;  4KZC A;  2O6V D;  4GB9 A;  3VAW A;  2EMS A;  2L3Z A;  2LVO A;  2LVQ A;  3DPD A;  4FLH A;  2Z0D B;  4KDI C;  1SGH A;  1YD8 U;  4MGI E;  3ZDT A;  3PRZ A;  3VXW A;  4F7Z A;  5IAA C;  4MDK E;  2K25 A;  3PS6 A;  4WJO A;  3B0A A;  2IY1 B;  4A20 A;  4AJY B;  3ALB A;  3T8M A;  2V1Y A;  3VHT C;  1WGG A;  3DQV A;  1MG8 A;  2KX0 A;  4HDQ A;  5JH5 C;  4FHJ A;  2G45 B;  2PE9 A;  2JVC A;  4RM8 A;  4GN1 A;  3U30 A;  3DBS A;  3IHP C;  1H8C A;  4KDL B;  2MBO A;  1WX8 A;  4FAD A;  3WAM A;  4G3X B;  2LWP A;  2FCN A;  4WJP A;  2B3A A;  1IPG A;  2KVR A;  4KSL C;  4WWO A;  3A9K A;  1LQB A;  2KFJ A;  4JQW C;  1WXV A;  3GZN I;  2WX0 A;  3N32 A;  1Q1O A;  2LXA A;  3KUD B;  2G4D B;  3CMM B;  5G2N A;  1OEY A;  2KJ6 A;  4W9F A;  1YJ1 A;  1JRU A;  2DZK A;  2JZZ A;  1Q5W B;  2G3Q B;  3A33 B;  2FID A;  3B1L X;  4G0N B;  3X0W A;  2MP2 B;  2MCN B;  1S3S G;  3QCA A;  1YIW A;  2DYM A;  3QAQ A;  2NCN A;  2WWZ A;  3ZNZ B;  2KMA A;  1CMX B;  1WXM A;  3ML8 A;  4ZYN A;  5D94 A;  5D2M B;  2L05 A;  1E7V A;  1RRB A;  2NBV B;  1UZX B;  1WR1 A;  1ZGU B;  2XEW A;  3VUY A;  3CSF A;  1WFY A;  5G55 A;  5AZF A;  1P98 A;  2RD0 A;  1R4M I;  1WMH A;  2XK5 A;  3ZO5 B;  2C7M B;  4IM2 A;  5EDS A;  3KUZ A;  3BY4 B;  2KFK A;  4GDK A;  4BVU C;  2D10 A;  2JPH A;  5E6P A;  4AUQ C;  1E7U A;  3TL5 A;  2REX A;  3VDZ A;  2KFK B;  4DHJ B;  2MQJ A;  2KJH B;  2MLB A;  3TCA A;  5AEK B;  2N7E A;  3L10 B;  2AEH A;  1GC6 A;  2GBN A;  2YVC A;  3L17 A;  2BYV E;  4LJO B;  1KOT A;  1P1A A;  2JF5 A;  4OVU A;  3V60 A;  1H4R A;  1QZE A;  2LGY A;  1TGZ B;  5GMV A;  2IZV B;  3V6C B;  3R3M A;  3H7P A;  4ICU A;  1OQY A;  4NQK E;  1KLV A;  1WGD A;  2DHZ A;  1UGM A;  1WJU A;  3D32 A;  3H7P B;  2GBJ A;  2FCS A;  3TIX A;  5LXH A;  1EUV B;  1TTN A;  2NR2 A;  2OJR A;  2QHO A;  5L83 A;  1ZW7 A;  5J17 A;  4BKS A;  2R2O A;  4HJK A;  4NPN A;  4PS7 A;  3L16 A;  1WGR A;  4FN2 A;  2L0F A;  4CO7 A;  1P3Q U;  4ZRI A;  2K8C A;  1L2N A;  2AL6 A;  1V86 A;  2LD9 A;  3A9J A;  1Q0W B;  2FAZ A;  1Z5S B;  3U8Z A;  4A3O A;  2Y5B B;  3QIJ A;  2W9N A;  2LZ6 A;  1RAX A;  2CHW A;  4HCN B;  5CHF A;  2DZJ A;  1V9J A;  1J8C A;  1I42 A;  2MBE A;  1V5T A;  3VQI A;  2KZR A;  4DWF A;  2JRI B;  1WX7 A;  4EZK A;  2UYZ B;  4IUM B;  2ZNV C;  1WM2 A;  4ASW C;  2JT4 B;  2N1V A;  2N9P C;  2Z59 B;  2FCM A;  4EFO A;  2LGX A;  1YQB A;  3AU4 A;  5CHV C;  1WRD B;  4YL8 A;  3W1Y A;  2GOW A;  2WX1 A;  4MM3 A;  5BO4 B;  3EHV A;  2KTF A;  4IW0 A;  4LCD E;  4MJS B;  3PSE B;  4M0W B;  3R7Q A;  2ZZP B;  4GDL B;  2MW5 A;  3SDL C;  2N7D A;  2WYQ A;  3APC A;  2K8H A;  4M8N A;  2KMC A;  3AI5 A;  2J0M A;  4DHJ D;  4AWJ A;  2KC1 A;  5DPR A;  3PHX B;  4E3C A;  3DVN U;  4JLC A;  3VVW B;  3KVF B;  4IWP A;  4RM9 A;  3WAP A;  3ENE A;  2KC2 A;  2O2V B;  2KTR B;  3L13 A;  2BYE A;  3VTU A;  2KLC A;  2KWC A;  3KW5 B;  4DHZ E;  5D6J B;  3PRP B;  1FXT B;  2JZ3 B;  1K8R B;  4GOC A;  2DAJ A;  4KZ0 A;  2JY6 A;  4JL9 A;  3N30 A;  1WYW B;  2CHZ A;  2KJR A;  2CU1 A;  1R4N I;  1Y8R C;  5E6N A;  4ZRK A;  3UIO B;  4W9G A;  2HD5 B;  4BFR A;  3UQA A;  2CKH B;  4PS8 A;  3ZVV A;  2N9X A;  3NZU A;  4HLE A;  3T9L A;  3I3T B;  2M4N A;  2J7Q B;  3VFK A;  3A1Q A;  1BT0 A;  4KIK A;  4MSM B;  2KXJ A;  4W9L A;  3NOB A;  3S2A A;  4W9H A;  2NBU A;  2EMT A;  3A1Q B;  4HDO A;  3VTV A;  4FBJ B;  2NPT A;  3JSV A;  3L54 A;  3WAO A;  4TQ1 A;  3PPA A;  1A5R A;  1UBI A;  3KYD D;  3PTF C;  3HHM A;  3V61 A;  1D3Z A;  3A9K B;  4ICV A;  4NNJ B;  4ANW A;  1UD7 A;  4TKN A;  1WI0 A;  3P2B A;  3PLU A;  3DDC B;  5AZH A;  3GOE A;  4E71 A;  1WE6 A;  4ANU A;  4NJ6 A;  2CHX A;  1WJ4 A;  3M63 B;  4II2 B;  1WGY A;  3UQB A;  4HK2 A;  4BKT A;  4BOS C;  4I6P A;  3DBL I;  3WA0 A;  3MHS D;  1UBQ A;  4IM0 A;  4RMA A;  2KO3 A;  4MSQ B;  4BBN F;  3APF A;  3QK0 A;  2KK8 A;  1M94 A;  4BOZ B;  2LAS A;  5DPW A;  4HWI B;  3V6E B;  4KV2 A;  3PGE A;  1L7Y A;  3RZW C;  2L7R A;  3TBL D;  3VTW A;  1WJ6 A;  2JUO A;  4JIO U;  3Q3J A;  1WX9 A;  3RZF A;  4FHK A;  1HE8 A;  3ZUN A;  3AUL A;  3CST A;  4HCP B;  4W9C A;  2DAF A;  3SU8 X;  4EZJ A;  1P9D U;  3O65 B;  4PYU A;  3AXC A;  3RCZ A;  1GC7 A;  1WMH B;  2XK5 B;  4WJN A;  1EO6 A;  5FR6 A;  1VCB A;  4GDK B;  1KM7 A;  2KLG A;  1TBE A;  3MTN B;  2NVU I;  5D7G A;  1OGW A;  1C3T A;  2UWQ A;  4DK5 A;  2MBB B;  2ZCB A;  4K81 A;  4MGZ E;  4WQO B;  4B6W A;  2C9W B;  3QA8 A;  2Z0E B;  2DX5 B;  2N1W A;  3RUL A;  1EF5 A;  1U4A A;  4JGH B;  1G6J A;  1I35 A;  2ZEQ A;  4N9F 4;  3QAR A;  1V49 A;  3DVG X;  4DDG D;  1SE9 A;  3WIM A;  2BGF A;  2IBI B;  3EC8 A;  1J0G A;  4AOF A;  3U7D A;  2MSE D;  1S1Q B;  2KWV B;  4BBN C;  4B9K A;  5L95 C;  2PE6 B;  4ZDV A;  4LJP B;  2MBQ A;  3WAL A;  4DXA B;  2D07 B;  3PRM B;  3W1S C;  4I6N B;  3M3J A;  3X23 A;  2GBM A;  2K39 A;  2KQ7 A;  3A9J B;  4IC7 B;  1V6E A;  2KKC A;  3RT3 B;  2KNB A;  3ONS A;  4CYE A;  5CX3 A;  2O6V A;  2IYD B;  1WZ3 A;  2BYF A;  4IWQ A;  4M8M A;  2JWZ A;  3C0R B;  2KOX A;  2KWU B;  3ZNI D;  4OVV A;  2MBH A;  3AU5 A;  2AYO B;  3M62 B;  3N3K B;  5E6O A;  3ZIM A;  4PS3 A;  3KUC B;  1WJN A;  3IG3 A;  2ZJD A;  4G11 A;  4NJ7 A;  1E8Z A;  2KDB A;  3HK0 A;  1ISN A;  2ZCC A;  4EKU A;  1LXD A;  1NDD A;  2EKE C;  3OJ4 B;  3RD2 A;  4WAA A;  1WIA A;  1WR6 E;  2NS5 A;  3DVG Y;  3R7R A;  2BWF A;  2LI5 A;  2IO2 B;  2C7H A;  3JYU A;  3QJZ A;  1V81 A;  1TZ1 A;  4B95 A;  4FUL A;  3K9P B;  4CHK A;  4I6L B;  3QWZ B;  1WY8 A;  3PHW B;  4URK A;  3APD A;  2GMI C;  2MWS B;  2AL3 A;  4DDI D;  1GG3 A;  2XBB C;  4EEW A;  2PEA A;  1E8Y A;  4X57 B;  1E8W A;  4DHZ B;  2GBR A;  2HJ8 A;  1T0Y A;  5AZG A;  5LLI A;  2I1K A;  3NS8 A;  4FJZ A;  4EOY A;  2D11 A;  3ZRC A;  4TUU A;  4BKS D;  5JZE B;  4K7S A;  3ZDM C;  3QC8 B;  3DCG A;  1WH3 A;  2MRP A;  5DCN A;  3UGB B;  2V4L A;  1F9J A;  4IM3 A;  3RUI B;  3DBR I;  1J19 A;  4XX5 A;  2M17 A;  1UH6 A;  1WE7 A;  3L08 A;  4IWO A;  3QX1 A;  4NY0 A;  1X1M A;  4LDT B;  4XZ4 A;  4W9E A;  1RFA A;  4KIK B;  3VH3 B;  3VUW A;  4TQ0 A;  2N4F A;  3JW0 X;  1V2Y A;  3LJ3 A;  4KVG B;  2A5U A;  3K9O B;  2NPT B;  3DVN V;  3JSV B;  3L0W B;  1WZ0 A;  2BKF A;  4HPL B;  5HKH A;  2DZI A;  4J6I A;  2M8S A;  4FJV B;  3EFU A;  4NQL B;  4G50 A;  4EZL A;  2PJH A;  2DYB A;  2RR9 A;  3DBH I;  5J18 A;  5DPS A;  4K7W A;  5JHB A;  2CS4 A;  3ZKJ C;  2IO1 B;  1SIF A;  2KHW B;  4W9J A;  3HM3 A;  1LFD A;  3OLM D;  2VRR B;  3PLV A;  3Q3F A;  1IP9 A;  4HVB A;  1LM8 B;  1PQS A;  2D3G A;  3SD5 A;  3PZD A;  3H6N A;  3EEC A;  4IG7 B;  3ZRF A;  3MJW A;  1AAR A;  2ZVN A;  2BWE S;  1E90 A;  2FIF A;  2KX3 A;  2AWT A;  1WGH A;  3VH4 B;  3CF6 E;  2R2Q A;  2HTH A;  2DYO A;  5LXI B;  5CTR C;  3ZNH B;  3DOW A;  4MGY E;  3ML9 A;  1E8X A;  3PVL A;  2MP2 A;  3A4S C;  4GMV A;  2LRU A;  2LGD A;  4MEM A;  3PRE A;  4K1R B;  4GSW A; 
#chains in the Genus database with same CATH topology
 3R66 C;  2LVP A;  4KKJ A;  2J0K A;  4W9I A;  4YSZ B;  2NTS A;  4FJY A;  2K8B A;  2CU3 A;  1V80 A;  3ZTD A;  4AP4 C;  3AEA B;  4K3C A;  3H1U A;  1IGD A;  1JW9 D;  3W1S A;  2L0T A;  3H8H A;  3RYT A;  2CR5 A;  1UUP A;  3B08 A;  4PYZ A;  3EUB 2;  3NVW A;  3RNF C;  3TJP A;  1ZKH A;  1C77 A;  2WU2 B;  3ZLZ A;  4NAW A;  1XEE A;  4RCO A;  1SJH D;  4NZL B;  2ZNV B;  4NAW B;  1IBX A;  2OOB B;  3HM6 X;  1IBX B;  3ZTC A;  1JQ4 A;  1OTR B;  2JXX A;  3C8Y A;  4J3O D;  2Q5W D;  2J0J A;  2RDG A;  3LDZ E;  4W9D A;  1C1Y B;  2C60 A;  5AUK A;  5G5H A;  4GIV A;  4XWW A;  2OED A;  4A3P A;  4ANX A;  3AH7 A;  3AV8 A;  4LTU A;  4LNI A;  1TS5 A;  1L4D B;  4FA6 A;  2KAJ A;  2E3T A;  1NBF C;  2QIE B;  3ZGZ A;  3AE1 B;  2L76 A;  1AWD A;  4XC2 A;  3QQ8 B;  4MJS A;  5BYR A;  1WM3 A;  4DBG A;  1UEL A;  3TMP B;  1TS3 A;  2MX2 A;  4TV3 A;  2KDF B;  2YLM A;  1VJK A;  2ASQ A;  3ZJT A;  1FEH A;  1RLF A;  2JRH A;  2BPS A;  3VR8 B;  2ZVO A;  5DPT A;  4HPM B;  1N6Z A;  2O6V D;  3EFC A;  4GB9 A;  3VAW A;  5EE3 A;  2L3Z A;  2Z0D B;  3MP9 A;  2IND C;  3ZDT A;  3VXW A;  3VRB B;  2LGI A;  3NS1 A;  3VHT C;  1MG8 A;  2KX0 A;  3OWE B;  4RM8 A;  3IXS A;  4KKI A;  1H8C A;  2EKI A;  4G3X B;  2LWP A;  2KVR A;  4KSL C;  4WWO A;  2LXA A;  1C4C A;  2BS3 B;  3GP7 A;  1OEY A;  3TEY A;  1YJ1 A;  3A33 B;  1S3S G;  4YWG G;  1K52 A;  2DYM A;  2NCN A;  2KMA A;  1CMX B;  2L05 A;  1E7V A;  3N1X C;  5MPO A;  2NBV B;  1E6E B;  1QOF A;  3CSF A;  1Q10 A;  2C7M B;  1YNT E;  4YT0 B;  3BY4 B;  3GS2 A;  4BVU C;  5E6P A;  1JRO A;  1NVI D;  1L0V B;  1RFK A;  2N7E A;  2YVC A;  2BYV E;  2VH2 A;  3R3M A;  3H7P A;  2PVO D;  1YN5 A;  3H7P B;  2OJR A;  3MC9 A;  2R2O A;  4HJK A;  4PS7 A;  1E9M A;  4FN2 A;  2V4I B;  1QQR A;  2JU6 X;  3BII D;  1P3Q U;  1N5X A;  1L2N A;  2AL6 A;  1ESF A;  1L5P A;  1ZP0 B;  1ZDX A;  1V86 A;  2FAZ A;  5BMH A;  3UI3 A;  3U8Z A;  1FFV A;  4A3O A;  2Y5B B;  2W9N A;  2H88 B;  1L4Z B;  2WXI A;  1ROE A;  4ZYS A;  1MHX A;  2JT4 B;  3Q8F A;  2Z59 B;  2RDB C;  3RNB C;  1WRD B;  4YL8 A;  3W1Y A;  3Q3M C;  4XGA B;  2WX1 A;  5BO4 B;  4LCD E;  4M0W B;  3R7Q A;  4GDL B;  2MW5 A;  3AI5 A;  2J0M A;  3Q8A A;  2KC1 A;  5DPR A;  5IOI A;  3DVN U;  2LGS A;  4IWP A;  2I38 A;  4WIP A;  3ENE A;  5LNK 1;  3CWI A;  2KTR B;  1FFU A;  2KLC A;  2IGD A;  3KW5 B;  4DHZ E;  4USA A;  3PRP B;  5IKC M;  4KZ0 A;  2JY6 A;  4JL9 A;  4ARI A;  3N30 A;  2CHZ A;  2KJR A;  3UIO B;  4BFR A;  4WH4 A;  3I3T B;  1QF6 A;  3T3O A;  3S2A A;  4KGT A;  2D3B A;  2NBU A;  1GAQ B;  1MPE A;  4HDO A;  2GI9 A;  3JSV A;  2IPK D;  4A8X C;  2WQY B;  1D3Z A;  4NNJ B;  3GE8 C;  1CZP A;  3P2B A;  2BT6 A;  4BZA A;  4ANU A;  1SEB D;  4NJ6 A;  4YXD B;  1WJ4 A;  2BW2 A;  2BQQ A;  3Q6B A;  4BOS C;  3DBL I;  1N61 A;  3MHS D;  1UBQ A;  1AYF A;  2DBY A;  1NI3 A;  3RZW C;  2L7R A;  1WJ6 A;  2HDE A;  3Q3J A;  1WX9 A;  3RZF A;  4HCP B;  2D3A A;  2DAF A;  3SU8 X;  4EZJ A;  2QJL A;  1TYG B;  4HRS A;  1WMH B;  4HRO A;  4WJN A;  4DXF A;  1EO6 A;  5FR6 A;  1L0X B;  4LNN A;  2KLG A;  3FIL B;  3P63 A;  1SE3 A;  2MBB B;  1YMH E;  1R4M B;  3RUL A;  1KFY B;  1SXT A;  1G6J A;  4LNK A;  3WIM A;  1GB1 A;  2BGF A;  2KWV B;  4BBN C;  1IGC A;  2D07 B;  2GB1 A;  2RMM A;  4I6N B;  4DQO C;  1PDX A;  2GBM A;  4RGO S;  3RT3 B;  4CYE A;  2KKC A;  4M8M A;  2IYD B;  3FKY A;  2Z8L A;  3C0R B;  2KOX A;  1YQ4 B;  2XNA C;  2M0A A;  2GRI A;  4OVV A;  2MBH A;  3ZIM A;  3V3X A;  2KQ4 X;  4G11 A;  2ACZ B;  1ISN A;  3OJ4 B;  3RD2 A;  2HJ1 A;  4M01 A;  1J7B A;  3O13 A;  1HTO A;  3JYU A;  1CQV A;  1TZ1 A;  2JSV X;  3NVY A;  3K9P B;  4I6L B;  4URK A;  2GMI C;  1D5Z C;  4X57 B;  1QOB A;  1E7P B;  1E8W A;  2D11 A;  3ZDM C;  5HFY A;  1J19 A;  4XX5 A;  2M17 A;  2WXL A;  3QX1 A;  3VH3 B;  2WXN A;  2YEP B;  1V2Y A;  2NPT B;  3DVN V;  1FXA A;  2BKF A;  5HHD G;  4J6I A;  1R4N B;  3BVM A;  5C2T B;  1E10 A;  4XDC A;  3PLV A;  2MJ3 A;  1FO4 A;  2D3G A;  3H6N A;  3ZRF A;  4IG7 B;  2HTM E;  2ZVN A;  3W9C B;  3GZN B;  3L4P A;  2KX3 A;  1VZ6 A;  1WYG A;  2DYO A;  5CTR C;  1VRA B;  4MGY E;  1VLB A;  2K3U A;  4WAF A;  2MP2 A;  1FXI A;  3A4S C;  2LGD A;  2WP9 B;  2WXG A;  4BOZ B;  4K1R B;  1WRI A;  1T3Q A;  1WF9 A;  4M02 A;  2N0S B;  4ZRJ A;  1R7S A;  3N1Z C;  5C23 A;  4C7Z A;  2BS4 B;  4XE0 A;  1M4V A;  4MH0 E;  1KH0 A;  1QOA A;  4IKG A;  2DEN B;  3ZW3 A;  1KJT A;  2G1E A;  4E74 A;  4LNO A;  1L6V A;  3UF8 A;  4GLS C;  1FPY A;  2LRW A;  4WWN A;  2O6V B;  1WXA A;  2M0X A;  2RSU A;  3ECI A;  2HE7 A;  5TR5 A;  1DOI A;  2G4S A;  2MA9 B;  4YTP B;  2IO0 B;  4ZHO A;  2AX5 A;  4REZ A;  1XLO A;  2MH7 A;  3MC8 A;  4WJQ A;  3AE5 B;  2PKO A;  2BYT A;  2IGH A;  4LLG M;  4F1S A;  3KH0 A;  2KN5 A;  3B2G A;  3ETR A;  2KD0 A;  3AEB B;  1AN8 A;  1YX6 B;  3J9C A;  2FE8 A;  2FCQ A;  1UWM A;  4EUT A;  3PV1 A;  3DHH C;  4KSK C;  5CHW A;  2LUE A;  3MHZ A;  1RM6 C;  2WNM A;  1YX5 B;  3TUO A;  1D4B A;  3PT2 B;  4L2Y A;  2Y5C A;  4A90 A;  1QLB B;  4GGQ A;  3EA6 A;  1UF0 A;  1VDV A;  2O2V A;  5BYQ A;  1V5O A;  3QHT A;  2KDI A;  2WDT B;  3IFW B;  2FUH B;  3P4Q B;  4KZC A;  2EMS A;  1LGR A;  3V05 A;  4FLH A;  1SGH A;  1YD8 U;  4MGI E;  3W5U B;  3P4P B;  3PS6 A;  4WJO A;  3B0A A;  3AN1 A;  4A20 A;  3T8M A;  1WGG A;  4HDQ A;  5JH5 C;  2G45 B;  2KYW A;  2PE9 A;  4GN1 A;  1JWB D;  1PGX A;  4YTN B;  2WXR A;  1EWC A;  2ZW0 A;  3A9K A;  3GZN I;  1T0S C;  2WX0 A;  1Q1O A;  3NVV A;  2LHD A;  3KUD B;  3CMM B;  1ZE3 D;  4M00 A;  4W9F A;  1I7H A;  3B1L X;  2MCN B;  1HEZ E;  1F2R I;  3ZNZ B;  1WXM A;  3ML8 A;  4C56 C;  1TT5 B;  2VZK D;  4PK1 A;  1C78 A;  1UZX B;  2PMV A;  5G55 A;  5AZF A;  2KAC A;  1C76 A;  3KUZ A;  2DWQ A;  2JPH A;  3TCA A;  3L10 B;  1PFD A;  2GBN A;  1KOT A;  4LJO B;  3IAS 1;  4FXC A;  2JF5 A;  2ON8 A;  4OVU A;  1XO3 A;  2WXJ A;  1TGZ B;  5GMV A;  2XN9 C;  4TSS A;  4ICU A;  1OQY A;  4OHJ A;  2FCS A;  2OHF A;  2KVZ A;  2QEJ C;  4BKS A;  3L16 A;  3DWM A;  5AUI A;  4HKQ A;  4CO7 A;  3ZXR A;  3A9J A;  1E0Z A;  1WSP A;  1QOG A;  1XCQ L;  4HCN B;  1V9J A;  2MBE A;  1TKG A;  3VQI A;  2PW9 A;  4IUM B;  2ZNV C;  1WM2 A;  2N1V A;  2N9P C;  2WXP A;  4P6V F;  4EFO A;  1FMA D;  4MM3 A;  1SB3 C;  4MJS B;  4MM3 B;  2ZZP B;  2N7D A;  2WYQ A;  2WXM A;  4DHJ D;  2INP E;  4E3C A;  4XDD A;  4RM9 A;  3L13 A;  2BYE A;  3R2T A;  4LNF A;  5HI1 A;  4GOC A;  1ET6 A;  4ZRK A;  3DBR B;  2HD5 B;  4PS8 A;  3ZVV A;  3NZU A;  4HLE A;  2J7Q B;  3VFK A;  4KIK A;  3NOB A;  1YJI A;  3Q2A C;  4HJG E;  1TKY A;  3PPA A;  1SE2 A;  1J7A A;  3BVG A;  3BYT B;  3V61 A;  2R61 A;  3NG0 A;  1TZO A;  1UD7 A;  1ZDV A;  1WI0 A;  3PLU A;  3M63 B;  4II2 B;  2PVG C;  4BKT A;  2AQ3 B;  4I6P A;  3WA0 A;  4IM0 A;  2KO3 A;  4BBN F;  3RMK C;  1JWA D;  2Y3A A;  3QK0 A;  1M94 A;  1GB4 A;  1CJE A;  5TSS A;  3TBL D;  2B76 B;  3U52 E;  4S17 A;  3AUL A;  5IO9 A;  3ZUN A;  1KTK A;  2KN4 A;  1KRH A;  1GC7 A;  3RCZ A;  4AS1 A;  1YJJ A;  2AQ2 B;  1KM7 A;  3URY A;  1TBE A;  1OGW A;  4ZRP A;  2UWQ A;  4DK5 A;  2ZCB A;  4B6W A;  2C9W B;  1SJE D;  3QA8 A;  2N1W A;  1EF5 A;  2J53 A;  1C79 A;  3HUI A;  4US9 A;  1FCC C;  3EC8 A;  4B9K A;  4ZDV A;  2FBW B;  1XF5 L;  1FCL A;  1ZXH A;  2K39 A;  1UNS A;  4EE2 A;  4IC7 B;  3ONS A;  1WZ3 A;  2BYF A;  2JWZ A;  1UGJ A;  3ZNI D;  5BYS A;  1SE4 A;  2W3S A;  3U2S C;  4EKU A;  3RNC C;  1ZUD 2;  4WAA A;  1WIA A;  1F1H A;  2MEK A;  2LI5 A;  1PGA A;  5C3J B;  1VR9 A;  1ET9 A;  1V81 A;  5G5G A;  2WDV B;  4CHK A;  3N9Y C;  3QWZ B;  3APD A;  3BWU D;  4QAY A;  1I4G A;  2JXT A;  4DDI D;  3E9S A;  2XBB C;  1T5X D;  2PEA A;  4Q2J A;  3KQ4 A;  1T0Y A;  1EU3 A;  2I1K A;  2ONQ A;  4KGS A;  3ZRC A;  4BKS D;  1I4P A;  5JZE B;  2JYT A;  2W3R A;  3DCG A;  1OQR A;  2V4L A;  4IM3 A;  3RUI B;  3DBR I;  1I4R A;  3Q3N C;  1WE7 A;  4IWO A;  4NY0 A;  1X1M A;  4W9E A;  1RFA A;  2WGS A;  2N4F A;  2BB5 A;  2LFI A;  3ABV B;  2A5U A;  3JSV B;  2NTT A;  1L0Y B;  2M8S A;  3MFG A;  2PJH A;  4US8 A;  2H89 B;  1FNV A;  2IO1 B;  2KHW B;  1C4P A;  3HM3 A;  1MHH E;  1HQR D;  4C7Y A;  1TY0 A;  1IP9 A;  1AW7 A;  1TY2 A;  3SD5 A;  4OZB A;  3MJW A;  1AAR A;  2BWE S;  1E90 A;  1WGH A;  5H92 C;  1SSN A;  2OJW A;  5LXI B;  1KF6 B;  5EE9 A;  1YQ3 B;  2LRU A;  4GMV A;  3I5J C;  4GSW A;  1JWU D;  2BF8 B;  4A6Q A;  3PO0 A;  3I9V 1;  3BIN A;  3VRA B;  5I4D A;  2LJ5 A;  4K3B A;  2Y5P A;  1I4H A;  5BMG A;  1XLP A;  2K1F A;  3NZS A;  3NHE B;  1EWY C;  2WS3 B;  2LJI A;  2KAN A;  3A4R A;  1QT9 A;  4P16 A;  4XYC A;  1TKE A;  2IO3 B;  2K6Q A;  1P0R A;  2CJN A;  1WXS A;  3AB5 A;  2KQS A;  5IA7 A;  2K0P A;  4K7U A;  4L1B A;  2BTE A;  4HXD A;  4R3D A;  2K6D B;  1BXT A;  1N63 A;  1BML C;  1NI2 A;  5C1Z A;  1GUA B;  2WDR B;  2RPQ A;  2WXF A;  1Z2M A;  4RF0 A;  2JYE A;  1EF1 A;  2KDE B;  3Q3O C;  3Q69 A;  5KHQ A;  2L83 A;  4WWM A;  3AE3 B;  1V1O A;  2E6X A;  2G9H D;  3WAN A;  4P7I A;  1E5W A;  3HIZ A;  4ANV A;  2ZPN A;  3ZNG C;  4MGK E;  1PUT A;  2INC C;  3V62 A;  1UWX A;  2QSD A;  2C7N B;  2LXC A;  2RGF A;  1XCT L;  2IY0 B;  2N9E B;  2VZK B;  2K22 A;  2WXH A;  2L32 A;  2M1M A;  3IT6 B;  3KYC D;  1NYQ A;  4F7Z A;  1L6U A;  1PYW D;  1FRR A;  2K25 A;  5HG2 A;  4AJY B;  3NZ3 A;  1ZXI A;  1D6E C;  2DNF A;  3U30 A;  3DBS A;  3AEE B;  4KDL B;  1WX8 A;  1ACC A;  4WJP A;  3IAM 1;  1LQB A;  4JQW C;  1MG4 A;  3DWG C;  3AM9 A;  1P7E A;  2G4D B;  2LHE A;  1MVK A;  1JRU A;  2DZK A;  2JZZ A;  1Q5W B;  2G3Q B;  2RPV A;  3X0W A;  4H2A A;  2MP2 B;  2PLP A;  1XLN A;  2J52 A;  1YIW A;  2WWZ A;  4ZYN A;  5D94 A;  5D2M B;  2LMC A;  2RDH A;  3VUY A;  1P98 A;  2RD0 A;  1R4M I;  2KT7 A;  1DOX A;  3ZO5 B;  2XK5 A;  4IM2 A;  1XLQ A;  4ACF A;  5EDS A;  4LK0 M;  4GDK A;  2KFK A;  2D10 A;  3I63 C;  3TL5 A;  2REX A;  4DHJ B;  2KFK B;  4ZOH C;  5IN7 A;  2KJH B;  2PTL A;  4ARC A;  2AEH A;  1F52 A;  3L17 A;  1P1A A;  3V60 A;  3ZYY X;  1QZE A;  2LGY A;  1F2R C;  1KLV A;  3TIX A;  1EUV B;  2NR2 A;  2QHO A;  1ZW7 A;  5J17 A;  1WGR A;  2M19 A;  1HTQ A;  4XWT A;  2BVC A;  1V1P A;  2LD9 A;  1V1P B;  1Q0W B;  3MJ5 A;  3QIJ A;  4ZHP A;  2CHW A;  2DZJ A;  4DWF A;  2KZR A;  1FNU A;  2N9K A;  2UYZ B;  4ASW C;  3AMZ A;  2FCM A;  2LGX A;  1YQB A;  2QMT A;  3Q8B A;  4OZA A;  5GXG B;  3EHV A;  1WXQ A;  2V0G A;  3RNG C;  2K8H A;  4M8N A;  1VZ7 A;  3PHX B;  3ZXV A;  3N20 C;  3P4S B;  3KWV A;  3AEC B;  3BYY B;  2INN E;  2O2V B;  3VTU A;  1YOV B;  2KWC A;  3SFE B;  2JZ3 B;  2DAJ A;  5EE0 A;  2NMQ A;  1R4N I;  5E6N A;  1T0R C;  5FK9 C;  3A1Q A;  1BT0 A;  4MSM B;  4W9L A;  2KXJ A;  3P42 A;  1B9R A;  1QIL A;  3A1Q B;  2EMT A;  3TEW A;  4RNA A;  1VZ8 A;  1A5R A;  1SBB B;  3KYD D;  3HHM A;  2ICI A;  4S0R A;  3A9K B;  4ICV A;  5FR3 A;  1FM0 D;  4HEA 1;  4IOI E;  5AZH A;  3GOE A;  2J42 A;  1IUE A;  3UQB A;  4HK2 A;  3MC0 B;  1N62 A;  4RMA A;  3APF A;  2KK8 A;  1B1Z A;  1MJD A;  3NUH B;  4HWI B;  3PGE A;  2JUO A;  3ZJV A;  4JIO U;  4AQ7 A;  4FHK A;  1HE8 A;  1FD6 A;  5H8Y E;  4NJC A;  1OQQ A;  1VCB A;  2UU7 A;  1I4X A;  1JWM D;  3MTN B;  2NVU I;  2M56 B;  4WQM A;  2BB6 A;  3B9J A;  4N6E B;  3CIR B;  2N9L A;  3AE8 B;  4JGH B;  1I35 A;  3QAR A;  1HZ6 A;  3DVG X;  4DDG D;  3W2D A;  1SE9 A;  2IBI B;  2L52 A;  4NAM A;  4AOF A;  2MSE D;  1JRP A;  3W5V B;  2PE6 B;  4LJP B;  2MBQ A;  4DXA B;  3W1S C;  3M3J A;  2KQ7 A;  3A9J B;  1SF0 A;  1YN3 A;  1V6E A;  2KNB A;  2KWU B;  4RGN A;  3N3K B;  2JZP A;  3M62 B;  4ITK A;  5E6O A;  3KUC B;  1WJN A;  3IG3 A;  2KDB A;  1LXD A;  1NDD A;  2EKE C;  1WR6 E;  2NS5 A;  3RPF C;  2BWF A;  4PT5 A;  3U7Z A;  2FUG 1;  4B95 A;  1N5W A;  3TSS A;  3BK2 A;  4RFB A;  2SEB D;  3N1Y C;  1OFF A;  1GG3 A;  3AED B;  1C4A A;  5FKA C;  1JML A;  3SEB A;  4EEW A;  2QCZ A;  4DHZ B;  5AZG A;  5LLI A;  3NS8 A;  4RGM A;  4EOY A;  2V9H A;  1WH3 A;  2MRP A;  5DCN A;  3UGB B;  1JAL A;  2LUM A;  3RFZ B;  3L08 A;  4XZ4 A;  1EM7 A;  4KIK B;  3VUW A;  3KWL A;  3LJ3 A;  5HKH A;  3K9O B;  3L0W B;  4HPL B;  4FJV B;  2J4X A;  2DYB A;  5J18 A;  5JHB A;  2CS4 A;  3ZKJ C;  3DHI C;  4W9J A;  3OLM D;  2VRR B;  3PZ7 A;  3Q3F A;  1LM8 B;  1PQS A;  2W82 A;  3PZ8 A;  3EEC A;  2MHJ A;  3RNE C;  2AWT A;  2WHI A;  3ZNH B;  3DBL B;  1KLG D;  5D3I B;  4MEM A;  3PRE A;  1MI0 A;  2QDF A;  1LO5 D;  1VD2 A;  3OJ3 A;  1OEY J;  1GJZ A;  4II3 B;  4LDT D;  2C5L C;  1XD3 B;  2DZM A;  1TS4 A;  1GPX A;  2VH1 A;  4JE3 B;  4JWS C;  3M95 A;  1PGB A;  5EE1 A;  3UIN B;  2D2Q A;  4W9K A;  2ZPY A;  2BBC A;  3AE4 B;  4D2K A;  1XQQ A;  5J2R A;  4DXG A;  5JXV A;  1XT9 B;  4N59 A;  1DOY A;  1D5X C;  1TIF A;  4WWP A;  4JWU C;  2PPH A;  1FNW A;  2NBW B;  3HVZ A;  3IVF A;  3VUX A;  4GXB A;  2GBK A;  4MEL A;  1RYJ A;  1GNU A;  2SAK A;  2V3S A;  3AEF B;  4P1C C;  1T0Q C;  3JVZ X;  3H9D A;  3VR9 B;  5T8I A;  2L8J A;  2V3P A;  4GU2 A;  4BKG A;  3UIP B;  4M0W A;  4GDL A;  1IYF A;  2BKR B;  2I1J A;  3NY5 A;  4TMA B;  1MFW A;  3E56 A;  2L00 B;  2YEP F;  3SHQ A;  1XXG A;  1A70 A;  2FNJ B;  2A4Z A;  3RNA C;  3OAW A;  3H7S A;  3IBE A;  5KHO A;  4AJW A;  4C00 A;  2KTR A;  1D5M C;  4F8C B;  1CK1 A;  5JHA A;  5E6J A;  2LVQ A;  2LVO A;  3DPD A;  4KDI C;  3PRZ A;  5IAA C;  4MDK E;  2IY1 B;  3ALB A;  2V1Y A;  3DQV A;  1JWS D;  4UDU C;  4FHJ A;  2WDQ B;  2JVC A;  3IHP C;  3LXF A;  2IJ0 A;  2MBO A;  4FAD A;  3WAM A;  4N58 A;  2FCN A;  3AEG B;  3GE3 C;  2B3A A;  1IPG A;  3R2I A;  1J7C A;  2KFJ A;  2JWU A;  1WXV A;  3N32 A;  4B0M A;  5G2N A;  2MJE A;  2KJ6 A;  2FID A;  4G0N B;  2WXO A;  3QCA A;  1ZPS A;  4A9A A;  1TJE A;  3QAQ A;  3SFD B;  5BMI A;  2MJD A;  3NVZ A;  1RRB A;  3RN9 C;  1ZGU B;  1WR1 A;  2XEW A;  3BK1 A;  1WFY A;  3WCQ A;  2KMM A;  3I57 A;  5D3D A;  3AE6 B;  1TS2 A;  1WMH A;  4YSY B;  4AUQ C;  1E7U A;  2V3N A;  3C19 A;  4KX6 B;  3VDZ A;  3FIL A;  2MQJ A;  2MLB A;  1WGK A;  4P1B C;  3GB1 A;  5AEK B;  4RF1 A;  1GC6 A;  1KLU D;  2BS2 B;  1H4R A;  2IZV B;  3V6C B;  4WUR A;  4NQK E;  1WGD A;  2DHZ A;  1UGM A;  1WJU A;  3D32 A;  2GBJ A;  5LXH A;  1TTN A;  3Q8C A;  2WXQ A;  2LEK A;  5L83 A;  2KWD A;  1V97 A;  4NPN A;  1F0Z A;  4ZRQ A;  1DGJ A;  2L0F A;  4RH6 A;  4YTM B;  4ZRI A;  1V8C A;  2K8C A;  3HRD D;  3EGR A;  1Z5S B;  1NYR A;  2LZ6 A;  1RAX A;  1J8C A;  1I42 A;  5CHF A;  4MAC A;  1V5T A;  2JRI B;  1WX7 A;  4EZK A;  2CJO A;  1BUI C;  3AU4 A;  5CHV C;  2DLB A;  2EEL A;  2JQR B;  2GOW A;  3ZQ4 A;  1SIJ A;  2KTF A;  4IW0 A;  3PSE B;  3SDL C;  4HKZ E;  3APC A;  2KMC A;  1HXY D;  4HPP A;  3LB8 C;  4AWJ A;  1T6B X;  4YSX B;  4JLC A;  4O1N A;  3VVW B;  3KVF B;  4L23 A;  3WAP A;  3BZD B;  2KC2 A;  5D6J B;  1FXT B;  1K8R B;  2TSS A;  1WYW B;  2CU1 A;  1Y8R C;  1DYQ A;  4W9G A;  3UQA A;  2CKH B;  2D5G A;  2N9X A;  3TEX A;  2D3C A;  4JX1 C;  3T9L A;  2M4N A;  1ENF A;  4W9H A;  5IP4 D;  1QKZ A;  3VTV A;  4FBJ B;  2NPT A;  3L54 A;  3WAO A;  4MT5 A;  1FRD A;  4TQ1 A;  3DBH B;  3RI7 C;  3FC4 A;  3P4R B;  1UBI A;  3PTF C;  1HZ5 A;  4OZC A;  2GLS A;  3IT4 B;  4ANW A;  3AE9 B;  1FIQ A;  4TKN A;  1HA5 A;  1I4Q A;  3DDC B;  3R8B A;  1P7F A;  4E71 A;  1WE6 A;  3Q8E A;  2CHX A;  1WGY A;  1STE A;  2QC8 A;  1Y56 A;  2L1A A;  4MSQ B;  1K53 A;  1K51 A;  1YN4 A;  1GOZ A;  2LAS A;  5DPW A;  3V6E B;  4KV2 A;  1L7Y A;  3VTW A;  4W9C A;  3CST A;  2I2Y A;  1P9D U;  3O65 B;  4PYU A;  3AXC A;  4RGT A;  2X38 A;  2XK5 B;  3AE7 B;  4GDK B;  5D7G A;  1JCK B;  1C3T A;  4WQO B;  4K81 A;  4MGZ E;  4IDI A;  2Z0E B;  2DX5 B;  2IDY A;  1U4A A;  2ZEQ A;  4N9F 4;  1V49 A;  1J0G A;  2K5P A;  1S1Q B;  5L95 C;  3TEZ A;  3WAL A;  3PRM B;  2ZW1 A;  3X23 A;  2W54 A;  3DHG C;  5CX3 A;  2O6V A;  4IWQ A;  1RWS A;  1NEK B;  2JX5 A;  3AU5 A;  2AYO B;  4PS3 A;  3Q14 C;  2WU5 B;  2ZJD A;  4NJ7 A;  1E8Z A;  3HK0 A;  1N60 A;  2ZCC A;  1NEN B;  4JPS A;  3DVG Y;  3R7R A;  4B0E A;  3FAH A;  1K50 A;  2IO2 B;  2AQ1 B;  2C7H A;  4OW0 A;  2WXK A;  3SR6 A;  4MH8 A;  3QJZ A;  4FUL A;  3T3N A;  3BVZ A;  1WY8 A;  3PHW B;  1WWT A;  2MWS B;  4C4V A;  2AL3 A;  4OVZ A;  4C4V B;  1E8Y A;  4BAX A;  2GBR A;  2HJ8 A;  3AE2 B;  4FJZ A;  4TUU A;  2PIA A;  4K7S A;  3QC8 B;  3HVD A;  1F77 A;  1F9J A;  1UH6 A;  4LDT B;  4TQ0 A;  2IGG A;  3JW0 X;  4KVG B;  4CQN A;  3LYY A;  1WZ0 A;  2DZI A;  3EFU A;  4NQL B;  4G50 A;  4EZL A;  2RR9 A;  3DBH I;  5DPS A;  4K7W A;  1C9F A;  3ZJU A;  1SIF A;  3NRZ A;  1LFD A;  3P1M A;  4HVB A;  2K9X A;  3OG5 A;  2WLB A;  3NJT A;  3PZD A;  2QIL A;  2KDM A;  4A55 A;  3KLS X;  2X8X X;  1ZOY B;  2FIF A;  3VH4 B;  4C80 A;  3U4E G;  3CF6 E;  2R2Q A;  2W55 A;  2HTH A;  3B2F A;  3DOW A;  3ML9 A;  1E8X A;  3PVL A;  4KGR A;  1EU4 A;  3U7D A;  2N7J A; 
#chains in the Genus database with same CATH homology
 2BF8 B;  3R66 C;  2LVP A;  1WF9 A;  1VD2 A;  3OJ3 A;  2J0K A;  4ZRJ A;  1OEY J;  4W9I A;  1GJZ A;  4II3 B;  3BIN A;  4FJY A;  2K8B A;  2LJ5 A;  1V80 A;  3ZTD A;  4AP4 C;  5C23 A;  4LDT D;  2C5L C;  1XD3 B;  2DZM A;  3H1U A;  3W1S A;  4MH0 E;  2K1F A;  3NZS A;  2L0T A;  3RYT A;  2DEN B;  3NHE B;  3M95 A;  3UIN B;  2CR5 A;  3ZW3 A;  2D2Q A;  1KJT A;  3B08 A;  4W9K A;  4PYZ A;  2ZPY A;  2KAN A;  3TJP A;  4E74 A;  1ZKH A;  1XQQ A;  3ZLZ A;  5J2R A;  4NAW A;  3UF8 A;  2ZNV B;  4NAW B;  3A4R A;  2OOB B;  2LRW A;  4WWN A;  3HM6 X;  3ZTC A;  2O6V B;  2IO3 B;  1WXA A;  1OTR B;  1XT9 B;  2K6Q A;  1P0R A;  2M0X A;  2JXX A;  1WXS A;  2RSU A;  2KQS A;  3ECI A;  2HE7 A;  5IA7 A;  2J0J A;  5TR5 A;  2G4S A;  4K7U A;  4WWP A;  3LDZ E;  4W9D A;  2MA9 B;  4HXD A;  1C1Y B;  2K6D B;  2C60 A;  1NI2 A;  2IO0 B;  2PPH A;  5C1Z A;  4GIV A;  2NBW B;  1GUA B;  4A3P A;  2RPQ A;  4WJQ A;  4ANX A;  3IVF A;  1Z2M A;  3VUX A;  4GXB A;  2GBK A;  4F1S A;  1EF1 A;  2KDE B;  4MEL A;  3KH0 A;  1GNU A;  4FA6 A;  5KHQ A;  2KN5 A;  2V3S A;  2KD0 A;  1NBF C;  3JVZ X;  1YX6 B;  3H9D A;  2FCQ A;  2L76 A;  4EUT A;  2L8J A;  3PV1 A;  4GU2 A;  4KSK C;  4XC2 A;  5CHW A;  4P7I A;  3WAN A;  2LUE A;  1E5W A;  3QQ8 B;  4MJS A;  3UIP B;  4BKG A;  1YX5 B;  1WM3 A;  4GDL A;  2BKR B;  1IYF A;  3HIZ A;  4DBG A;  3PT2 B;  2I1J A;  3NY5 A;  1UEL A;  3TMP B;  2ZPN A;  3ZNG C;  4ANV A;  4MGK E;  2L00 B;  3SHQ A;  2MX2 A;  4TV3 A;  3V62 A;  2KDF B;  2YLM A;  2FNJ B;  2A4Z A;  2C7N B;  2ASQ A;  4GGQ A;  1RLF A;  2LXC A;  2RGF A;  3OAW A;  3H7S A;  3IBE A;  2IY0 B;  5KHO A;  2N9E B;  2O2V A;  4AJW A;  2JRH A;  2BPS A;  1V5O A;  2KTR A;  3QHT A;  4F8C B;  2KDI A;  2WDT B;  2ZVO A;  5DPT A;  2M1M A;  3IFW B;  3KYC D;  2FUH B;  5JHA A;  4HPM B;  4KZC A;  2O6V D;  4GB9 A;  3VAW A;  2EMS A;  2L3Z A;  2LVO A;  2LVQ A;  3DPD A;  4FLH A;  2Z0D B;  4KDI C;  1SGH A;  1YD8 U;  4MGI E;  3ZDT A;  3PRZ A;  3VXW A;  4F7Z A;  5IAA C;  4MDK E;  2K25 A;  3PS6 A;  4WJO A;  3B0A A;  2IY1 B;  4A20 A;  4AJY B;  3ALB A;  3T8M A;  2V1Y A;  3VHT C;  1WGG A;  3DQV A;  1MG8 A;  2KX0 A;  4HDQ A;  5JH5 C;  4FHJ A;  2G45 B;  2PE9 A;  2JVC A;  4RM8 A;  4GN1 A;  3U30 A;  3DBS A;  3IHP C;  1H8C A;  4KDL B;  2MBO A;  1WX8 A;  4FAD A;  3WAM A;  4G3X B;  2LWP A;  2FCN A;  4WJP A;  2B3A A;  1IPG A;  2KVR A;  4KSL C;  4WWO A;  3A9K A;  1LQB A;  2KFJ A;  4JQW C;  1WXV A;  3GZN I;  2WX0 A;  3N32 A;  1Q1O A;  2LXA A;  3KUD B;  2G4D B;  3CMM B;  5G2N A;  1OEY A;  2KJ6 A;  4W9F A;  1YJ1 A;  1JRU A;  2DZK A;  2JZZ A;  1Q5W B;  2G3Q B;  3A33 B;  2FID A;  3B1L X;  4G0N B;  3X0W A;  2MP2 B;  2MCN B;  1S3S G;  3QCA A;  1YIW A;  2DYM A;  3QAQ A;  2NCN A;  2WWZ A;  3ZNZ B;  2KMA A;  1CMX B;  1WXM A;  3ML8 A;  4ZYN A;  5D94 A;  5D2M B;  2L05 A;  1E7V A;  1RRB A;  2NBV B;  1UZX B;  1WR1 A;  1ZGU B;  2XEW A;  3VUY A;  3CSF A;  1WFY A;  5G55 A;  5AZF A;  1P98 A;  2RD0 A;  1R4M I;  1WMH A;  2XK5 A;  3ZO5 B;  2C7M B;  4IM2 A;  5EDS A;  3KUZ A;  3BY4 B;  2KFK A;  4GDK A;  4BVU C;  2D10 A;  2JPH A;  5E6P A;  4AUQ C;  1E7U A;  3TL5 A;  2REX A;  3VDZ A;  2KFK B;  4DHJ B;  2MQJ A;  2KJH B;  2MLB A;  3TCA A;  5AEK B;  2N7E A;  3L10 B;  2AEH A;  1GC6 A;  2GBN A;  2YVC A;  3L17 A;  2BYV E;  4LJO B;  1KOT A;  1P1A A;  2JF5 A;  4OVU A;  3V60 A;  1H4R A;  1QZE A;  2LGY A;  1TGZ B;  5GMV A;  2IZV B;  3V6C B;  3R3M A;  3H7P A;  4ICU A;  1OQY A;  4NQK E;  1KLV A;  1WGD A;  2DHZ A;  1UGM A;  1WJU A;  3D32 A;  3H7P B;  2GBJ A;  2FCS A;  3TIX A;  5LXH A;  1EUV B;  1TTN A;  2NR2 A;  2OJR A;  2QHO A;  5L83 A;  1ZW7 A;  5J17 A;  4BKS A;  2R2O A;  4HJK A;  4NPN A;  4PS7 A;  3L16 A;  1WGR A;  4FN2 A;  2L0F A;  4CO7 A;  1P3Q U;  4ZRI A;  2K8C A;  1L2N A;  2AL6 A;  1V86 A;  2LD9 A;  3A9J A;  1Q0W B;  2FAZ A;  1Z5S B;  3U8Z A;  4A3O A;  2Y5B B;  3QIJ A;  2W9N A;  2LZ6 A;  1RAX A;  2CHW A;  4HCN B;  5CHF A;  2DZJ A;  1V9J A;  1J8C A;  1I42 A;  2MBE A;  1V5T A;  3VQI A;  2KZR A;  4DWF A;  2JRI B;  1WX7 A;  4EZK A;  2UYZ B;  4IUM B;  2ZNV C;  1WM2 A;  4ASW C;  2JT4 B;  2N1V A;  2N9P C;  2Z59 B;  2FCM A;  4EFO A;  2LGX A;  1YQB A;  3AU4 A;  5CHV C;  1WRD B;  4YL8 A;  3W1Y A;  2GOW A;  2WX1 A;  4MM3 A;  5BO4 B;  3EHV A;  2KTF A;  4IW0 A;  4LCD E;  4MJS B;  3PSE B;  4M0W B;  3R7Q A;  2ZZP B;  4GDL B;  2MW5 A;  3SDL C;  2N7D A;  2WYQ A;  3APC A;  2K8H A;  4M8N A;  2KMC A;  3AI5 A;  2J0M A;  4DHJ D;  4AWJ A;  2KC1 A;  5DPR A;  3PHX B;  4E3C A;  3DVN U;  4JLC A;  3VVW B;  3KVF B;  4IWP A;  4RM9 A;  3WAP A;  3ENE A;  2KC2 A;  2O2V B;  2KTR B;  3L13 A;  2BYE A;  3VTU A;  2KLC A;  2KWC A;  3KW5 B;  4DHZ E;  5D6J B;  3PRP B;  1FXT B;  2JZ3 B;  1K8R B;  4GOC A;  2DAJ A;  4KZ0 A;  2JY6 A;  4JL9 A;  3N30 A;  1WYW B;  2CHZ A;  2KJR A;  2CU1 A;  1R4N I;  1Y8R C;  5E6N A;  4ZRK A;  3UIO B;  4W9G A;  2HD5 B;  4BFR A;  3UQA A;  2CKH B;  4PS8 A;  3ZVV A;  2N9X A;  3NZU A;  4HLE A;  3T9L A;  3I3T B;  2M4N A;  2J7Q B;  3VFK A;  3A1Q A;  1BT0 A;  4KIK A;  4MSM B;  2KXJ A;  4W9L A;  3NOB A;  3S2A A;  4W9H A;  2NBU A;  2EMT A;  3A1Q B;  4HDO A;  3VTV A;  4FBJ B;  2NPT A;  3JSV A;  3L54 A;  3WAO A;  4TQ1 A;  3PPA A;  1A5R A;  1UBI A;  3KYD D;  3PTF C;  3HHM A;  3V61 A;  1D3Z A;  3A9K B;  4ICV A;  4NNJ B;  4ANW A;  1UD7 A;  4TKN A;  1WI0 A;  3P2B A;  3PLU A;  3DDC B;  5AZH A;  3GOE A;  4E71 A;  1WE6 A;  4ANU A;  4NJ6 A;  2CHX A;  1WJ4 A;  3M63 B;  4II2 B;  1WGY A;  3UQB A;  4HK2 A;  4BKT A;  4BOS C;  4I6P A;  3DBL I;  3WA0 A;  3MHS D;  1UBQ A;  4IM0 A;  4RMA A;  2KO3 A;  4MSQ B;  4BBN F;  3APF A;  3QK0 A;  2KK8 A;  1M94 A;  4BOZ B;  2LAS A;  5DPW A;  4HWI B;  3V6E B;  4KV2 A;  3PGE A;  1L7Y A;  3RZW C;  2L7R A;  3TBL D;  3VTW A;  1WJ6 A;  2JUO A;  4JIO U;  3Q3J A;  1WX9 A;  3RZF A;  4FHK A;  1HE8 A;  3ZUN A;  3AUL A;  3CST A;  4HCP B;  4W9C A;  2DAF A;  3SU8 X;  4EZJ A;  1P9D U;  3O65 B;  4PYU A;  3AXC A;  3RCZ A;  1GC7 A;  1WMH B;  2XK5 B;  4WJN A;  1EO6 A;  5FR6 A;  1VCB A;  4GDK B;  1KM7 A;  2KLG A;  1TBE A;  3MTN B;  2NVU I;  5D7G A;  1OGW A;  1C3T A;  2UWQ A;  4DK5 A;  2MBB B;  2ZCB A;  4K81 A;  4MGZ E;  4WQO B;  4B6W A;  2C9W B;  3QA8 A;  2Z0E B;  2DX5 B;  2N1W A;  3RUL A;  1EF5 A;  1U4A A;  4JGH B;  1G6J A;  1I35 A;  2ZEQ A;  4N9F 4;  3QAR A;  1V49 A;  3DVG X;  4DDG D;  1SE9 A;  3WIM A;  2BGF A;  2IBI B;  3EC8 A;  1J0G A;  4AOF A;  3U7D A;  2MSE D;  1S1Q B;  2KWV B;  4BBN C;  4B9K A;  5L95 C;  2PE6 B;  4ZDV A;  4LJP B;  2MBQ A;  3WAL A;  4DXA B;  2D07 B;  3PRM B;  3W1S C;  4I6N B;  3M3J A;  3X23 A;  2GBM A;  2K39 A;  2KQ7 A;  3A9J B;  4IC7 B;  1V6E A;  2KKC A;  3RT3 B;  2KNB A;  3ONS A;  4CYE A;  5CX3 A;  2O6V A;  2IYD B;  1WZ3 A;  2BYF A;  4IWQ A;  4M8M A;  2JWZ A;  3C0R B;  2KOX A;  2KWU B;  3ZNI D;  4OVV A;  2MBH A;  3AU5 A;  2AYO B;  3M62 B;  3N3K B;  5E6O A;  3ZIM A;  4PS3 A;  3KUC B;  1WJN A;  3IG3 A;  2ZJD A;  4G11 A;  4NJ7 A;  1E8Z A;  2KDB A;  3HK0 A;  1ISN A;  2ZCC A;  4EKU A;  1LXD A;  1NDD A;  2EKE C;  3OJ4 B;  3RD2 A;  4WAA A;  1WIA A;  1WR6 E;  2NS5 A;  3DVG Y;  3R7R A;  2BWF A;  2LI5 A;  2IO2 B;  2C7H A;  3JYU A;  3QJZ A;  1V81 A;  1TZ1 A;  4B95 A;  4FUL A;  3K9P B;  4CHK A;  4I6L B;  3QWZ B;  1WY8 A;  3PHW B;  4URK A;  3APD A;  2GMI C;  2MWS B;  2AL3 A;  4DDI D;  1GG3 A;  2XBB C;  4EEW A;  2PEA A;  1E8Y A;  4X57 B;  1E8W A;  4DHZ B;  2GBR A;  2HJ8 A;  1T0Y A;  5AZG A;  5LLI A;  2I1K A;  3NS8 A;  4FJZ A;  4EOY A;  2D11 A;  3ZRC A;  4TUU A;  4BKS D;  5JZE B;  4K7S A;  3ZDM C;  3QC8 B;  3DCG A;  1WH3 A;  2MRP A;  5DCN A;  3UGB B;  2V4L A;  1F9J A;  4IM3 A;  3RUI B;  3DBR I;  1J19 A;  4XX5 A;  2M17 A;  1UH6 A;  1WE7 A;  3L08 A;  4IWO A;  3QX1 A;  4NY0 A;  1X1M A;  4LDT B;  4XZ4 A;  4W9E A;  1RFA A;  4KIK B;  3VH3 B;  3VUW A;  4TQ0 A;  2N4F A;  3JW0 X;  1V2Y A;  3LJ3 A;  4KVG B;  2A5U A;  3K9O B;  2NPT B;  3DVN V;  3JSV B;  3L0W B;  1WZ0 A;  2BKF A;  4HPL B;  5HKH A;  2DZI A;  4J6I A;  2M8S A;  4FJV B;  3EFU A;  4NQL B;  4G50 A;  4EZL A;  2PJH A;  2DYB A;  2RR9 A;  3DBH I;  5J18 A;  5DPS A;  4K7W A;  5JHB A;  2CS4 A;  3ZKJ C;  2IO1 B;  1SIF A;  2KHW B;  4W9J A;  3HM3 A;  1LFD A;  3OLM D;  2VRR B;  3PLV A;  3Q3F A;  1IP9 A;  4HVB A;  1LM8 B;  1PQS A;  2D3G A;  3SD5 A;  3PZD A;  3H6N A;  3EEC A;  4IG7 B;  3ZRF A;  3MJW A;  1AAR A;  2ZVN A;  2BWE S;  1E90 A;  2FIF A;  2KX3 A;  2AWT A;  1WGH A;  3VH4 B;  3CF6 E;  2R2Q A;  2HTH A;  2DYO A;  5LXI B;  5CTR C;  3ZNH B;  3DOW A;  4MGY E;  3ML9 A;  1E8X A;  3PVL A;  2MP2 A;  3A4S C;  4GMV A;  2LRU A;  2LGD A;  4MEM A;  3PRE A;  4K1R B;  4GSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...