1WJ6A

Solution structure of rsgi ruh-024, a pb1 domain in human cdna, kiaa0049
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
GSSGSSGPHSMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords KIAA0049 protein
publication title Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
rcsb
source organism Homo sapiens
total genus 18
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj6A01
3ZRFA 4IM0A 2A4ZA 2IO1B 3PLUA 5D7GA 2C7NB 1QZEA 4IWQA 1V49A 2BYEA 3A33B 3PRZA 2MBEA 4AP4C 2DZJA 1YJ1A 2WWZA 4PYUA 1MG8A 1EO6A 1I42A 4BOSC 1P9DU 1YD8U 2FCSA 3JVZX 3QA8A 4FN2A 3WAMA 3K9OB 3M63B 2LJ5A 3B0AA 4AOFA 2K39A 2MX2A 4ZDVA 1LQBA 3L13A 3H7PB 1V5TA 4DWFA 2J0JA 2KK8A 3D32A 2BGFA 2KHWB 4BFRA 2IO3B 2KJHB 3Q3JA 2KWCA 4MGIE 4MSMB 2AL3A 2DX5B 5HKHA 2K8CA 3KYDD 2OOBB 4LDTB 3UQBA 4K7WA 3QQ8B 1KM7A 2AYOB 2KDFB 1WRDB 2LASA 3HHMA 2KANA 3QX1A 1G6JA 2O6VA 3QJZA 1S1QB 2I1KA 2J0MA 2LRUA 2RSUA 4CHKA 1L7YA 4LDTD 3EHVA 4YL8A 2JT4B 2K8HA 2FCQA 4W9FA 2GBKA 3B08A 2MRPA 4I6PA 2CU1A 3VTWA 3H9DA 3KW5B 1JRUA 4JIOU 5AZHA 3NHEB 4GGQA 2LXAA 3VXWA 4MELA 1UBIA 3KUCB 1WJ6A 4GU2A 5AZGA 1WXSA 1KJTA 4ANVA 3TCAA 4IM2A 2GBJA 3L16A 4DBGA 2N4FA 2KD0A 2NCNA 2PE9A 1H4RA 2V1YA 2L00B 3ZNGC 3APCA 4B9KA 4DDID 4EFOA 2L7RA 4HJKA 2JWZA 5DPSA 3UIOB 1LFDA 3KYCD 2C5LC 4GDKA 4NNJB 4MEMA 2KTFA 2RR9A 3IG3A 2EMSA 4PYZA 4ZYNA 1P98A 2KVRA 2BYVE 2MBHA 2W9NA 1V6EA 3HK0A 3IFWB 3MTNB 1WGDA 2IY0B 3H1UA 4WJNA 4W9LA 3QARA 1WMHB 4NQKE 3L17A 2KDEB 3VFKA 2D07B 4KIKA 3TMPB 2DYBA 4EEWA 1J8CA 1CMXB 3T9LA 4DK5A 1Z2MA 2GBNA 3TIXA 2KWUB 1OTRB 3U30A 2GBRA 3ZNHB 2L76A 2FCNA 3GZNI 1GG3A 2D11A 2KC2A 2G4SA 4KVGB 2C9WB 4F7ZA 4ANWA 2EKEC 4ICUA 1UGMA 1C3TA 3TL5A 2JUOA 3OAWA 2GBMA 3A1QB 1OEYA 4MM3A 4TQ1A 4X57B 2JZZA 4FADA 2BWES 4JGHB 1FXTB 4ZRKA 4M8NA 5KHOA 4AUQC 4CO7A 2PE6B 3L0WB 5LXIB 4ASWC 2QHOA 2L05A 3TJPA 4A3PA 1WIAA 4FHKA 2K1FA 3EC8A 3C0RB 3NS8A 4KDLB 4RMAA 2K6QA 1YIWA 2NBVB 3A4SC 2IO2B 4GB9A 4BKGA 4E3CA 2MBOA 2J7QB 2HTHA 3ENEA 4TKNA 4WQOB 4XZ4A 4EZLA 1ZKHA 3WIMA 2ZVOA 1RFAA 2LVQA 1L2NA 3B1LX 1VD2A 3EFUA 4XC2A 1AARA 4DDGD 3AXCA 3ZDTA 3R7QA 4HWIB 1WGRA 2N9EB 1OEYJ 5C23A 2MW5A 1TGZB 2PPHA 1V2YA 4II3B 1TZ1A 4HVBA 2OJRA 2K6DB 2NPTA 4N9F4 1NI2A 3JSVA 3PGEA 4IUMB 1BT0A 4K7SA 2M1MA 3ZNID 3DVGY 4GIVA 3L10B 2D10A 3LDZE 2RGFA 4W9HA 3MHSD 3VQIA 5EDSA 3R7RA 4G11A 2JY6A 2MBBB 3NOBA 3A4RA 3QCAA 4NAWB 4EZJA 1UH6A 2KXJA 1V81A 5J2RA 3CMMB 4W9DA 4AJWA 3DBSA 2O6VB 4FLHA 4TUUA 4W9KA 4HLEA 1WR6E 2MSED 1Q1OA 2DZIA 3R66C 4MJSA 3V62A 2MBQA 2KDBA 4BKSA 1D3ZA 3VH4B 2O6VD 3M62B 2N1WA 1WXMA 3N30A 4KZ0A 1WJNA 4ICVA 1IP9A 5D6JB 2LGXA 2MP2B 2N7EA 3N32A 4MH0E 5D2MB 3UF8A 2KTRA 2KLGA 2BWFA 2KNBA 3AU5A 1EF1A 2LXCA 2CR5A 3VUWA 3R3MA 4K1RB 2HE7A 4GXBA 3N3KB 2DZMA 4FA6A 2ZNVB 2KMCA 2XK5A 3KUZA 3A9JB 4MGZE 3PHWB 2ZEQA 4GDKB 2M8SA 5CHVC 2MWSB 2DZKA 3DOWA 1Q5WB 2D3GA 2LUEA 3ZIMA 5AEKB 5L95C 2C7HA 3APDA 4K7UA 2KFJA 3ZO5B 2DYOA 3AI5A 1WFYA 2N7DA 5FR6A 1EUVB 1WX8A 3QC8B 5GMVA 3ZUNA 2WDTB 3V60A 1HE8A 4G0NB 3RZWC 4KSLC 5J17A 4HPMB 2G3QB 3UGBB 3X23A 4LJPB 1ZW7A 1UZXB 4DXAB 2KJRA 2MA9B 5TR5A 3VUXA 3PVLA 2ZPNA 3L08A 3QWZB 2M17A 4WJOA 4DHJB 1OGWA 5E6NA 2Z0EB 2BYFA 4GOCA 2O2VA 4MSQB 2KLCA 1WJ4A 2KFKB 2L0FA 3V6CB 2CHWA 3ML9A 3UINB 1NDDA 4DHJD 2ZZPB 4J6IA 1WR1A 1TBEA 4FULA 2PJHA 1SE9A 4BVUC 1WGGA 1WH3A 2DYMA 3H7PA 4HDOA 3RULA 2IYDB 2JRHA 1E8WA 4II2B 1IPGA 2CHZA 3O65B 4KV2A 2UYZB 5IA7A 1RLFA 5CHWA 1E8XA 3TBLD 2NBWB 3RD2A 1P0RA 1UBQA 1WM3A 1XT9B 2UWQA 3PZDA 1U4AA 2AWTA 3ZDMC 2LRWA 3PTFC 2LGYA 4OVVA 1WXVA 1TTNA 4IC7B 3W1SA 2YVCA 2JF5A 1J0GA 3GOEA 3K9PB 4A20A 2KQSA 2K25A 2ZNVC 4GDLB 4KSKC 3ZNZB 3NY5A 4WJPA 2NPTB 3HM6X 4MGKE 1WI0A 5E6PA 3WAOA 4BOZB 1WF9A 2IO0B 4F1SA 2AL6A 2LGDA 1SGHA 4DHZB 3ONSA 2BPSA 4EKUA 1A5RA 3HM3A 4JLCA 4FJYA 2N9XA 3WA0A 3U7DA 3VHTC 4AJYB 1E8ZA 1WE6A 2BKFA 3T8MA 2CKHB 3ZW3A 2BKRB 2DHZA 5DCNA 1ZGUB 3ZVVA 3OJ4B 4ANUA 2JPHA 2I1JA 2M0XA 1OQYA 1WXAA 3NZSA 5JHAA 2LVOA 2V4LA 2Z0DB 3DCGA 4W9GA 1WMHA 2R2OA 2L8JA 1V9JA 4WWOA 2KMAA 2JVCA 1Z5SB 2AEHA 2HD5B 1V80A 4BKSD 2N1VA 3A9KA 2YLMA 4RM8A 2NVUI 2KTRB 4MGYE 4MDKE 3VDZA 1GC6A 2IBIB 1WZ3A 5JZEB 2Z59B 1SIFA 3DQVA 1KLVA 1Y8RC 2GOWA 1WM2A 1XQQA 3ECIA 3OJ3A 4TQ0A 2FIDA 4GSWA 3BY4B 3PRPB 5JHBA 3IBEA 2XEWA 4IW0A 5LXHA 3DPDA 1F9JA 2MLBA 3Q3FA 5G2NA 2KX3A 4GN1A 4I6NB 2CHXA 2V3SA 3L54A 3MJWA 3CSTA 2KQ7A 5LLIA 5C1ZA 1J19A 4HK2A 4WWPA 3UIPB 3HIZA 4G3XB 1P1AA 1I35A 3PT2B 4E74A 5BO4B 4DHZE 2KJ6A 1NBFC 1YX5B 4M8MA 3VUYA 5DPRA 2G4DB 3EECA 1C1YB 3PREA 4PS3A 3UQAA 5G55A 3IVFA 1E7VA 3DDCB 4LJOB 2L3ZA 3M95A 4E71A 4EUTA 2CS4A 4RM9A 3V61A 2ZCCA 4BKTA 4WAAA 2O2VB 1E8YA 1UELA 4B6WA 1WZ0A 4BBNC 2WYQA 4W9EA 2LVPA 5CHFA 2R2QA 2REXA 4NY0A 2ZJDA 4NJ6A 3ZTCA 4KIKB 3WAPA 1YQBA 4WJQA 1GC7A 3VTUA 4EOYA 2KZRA 1WE7A 3U8ZA 1WJUA 2KDIA 2GMIC 4NAWA 3ZLZA 3LJ3A 4B95A 1RRBA 3S2AA 3KVFB 3DVNV 1M94A 4HXDA 4EZKA 4FBJB 2KX0A 3APFA 4AWJA 5L83A 3RCZA 3AU4A 5DPTA 2ASQA 1YX6B 4K81A 3AULA 2DENB 2C7MB 4GMVA 1V5OA 1GUAB 2FAZA 2LD9A 1WX7A 3PPAA 4IWOA 4NPNA 5D94A 1LXDA 3KH0A 5J18A 2FUHB 1S3SG 2KC1A 4G50A 2FCMA 4TV3A 4NQLB 4PS7A 2B3AA 4JL9A 3RT3B 2MP2A 3RUIB 3X0WA 1H8CA 2VRRB 1UD7A 3VH3B 2WX0A 2WX1A 1RAXA 2RD0A 3M3JA 5E6OA 2HJ8A 3A9JA 4ZRJA 5DPWA 4A3OA 3I3TB 3NZUA 4ANXA 2EMTA 1Q0WB 2KN5A 4BBNF 3RYTA 2KOXA 3WALA 1GJZA 3ZKJC 2LWPA 3ALBA 4FJVB 3ML8A 3CSFA 4CYEA 3H6NA 5CX3A 3PLVA 3H7SA 1E5WA 3WANA 2C60A 4W9CA 3JSVB 3QIJA 1E7UA 2FIFA 1VCBA 4WWNA 5KHQA 1WGYA 1WY8A 3A9KB 3PV1A 4IWPA 1PQSA 2DAJA 2L0TA 5IAAC 2A5UA 2K8BA 4NJ7A 4W9JA 2PEAA 2RPQA 3QK0A 3DBHI 4LCDE 1KOTA 2LI5A 2N9PC 3DVNU 1EF5A 2ZCBA 3VTVA 4URKA 5JH5C 3JYUA 3QAQA 1GNUA 4JQWC 1P3QU 1WYWB 2KFKA 2KWVB 2JXXA 4FJZA 4ZRIA 2D2QA 3SDLC 2LZ6A 2NR2A 3OLMD 4MJSB 1ISNA 5AZFA 1XD3B 3VAWA 1WX9A 1T0YA 2BF8B 1E90A 2ZPYA 1WGHA 4HCNB 2IZVB 2KO3A 3DBLI 4HCPB 4I6LB 3RZFA 3W1SC 3ZRCA 2JRIB 2KKCA 3PSEB 1R4NI 1X1MA 4IM3A 2IY1B 2ZVNA 3P2BA 4HDQA 2MCNB 3BINA 2M4NA 3IHPC 4XX5A 3SHQA 3DVGX 2DAFA 3VVWB 3JW0X 1V86A 4HPLB 1LM8B 4M0WB 4KZCA 3ZTDA 4FHJA 2FNJB 2XK5B 4KDIC 3A1QA 3SU8X 4PS8A 3V6EB 1IYFA 4GDLA 3SD5A 3PRMB 3DBRI 1R4MI 2G45B 1K8RB 5CTRC 3W1YA 3KUDB 2NS5A 2J0KA 2XBBC 3CF6E 2MQJA 2NBUA 3PHXB 4F8CB 2Y5BB 4P7IA 4OVUA 4W9IA 3QHTA 4IG7B 3PS6A 2JZ3B
chains in the Genus database with same CATH superfamily
3MFGA 2IO1B 1QZEA 3Q69A 4P6VF 3BVZA 4IWQA 2XN9C 2BYEA 3PRZA 2WWZA 4RH6A 4BOSC 1IGDA 1CZPA 4C4VA 2D5GA 3B0AA 4RF0A 1JW9D 1LQBA 1J7BA 2WXLA 3PZ7A 1C4CA 1SBBB 4DWFA 3Q3JA 4FXCA 4MGIE 1TKGA 1HA5A 1KM7A 2LASA 1WRDB 3QX1A 1NI3A 3QJZA 5GXGB 2I1KA 2BB5A 2K22A 4HKQA 2MRPA 1EWCA 2SAKA 3NHEB 1UBIA 5H92C 1SJHD 1KJTA 4IM2A 3L16A 4DBGA 1UWMA 2KD0A 4DDID 4EFOA 4B9KA 3MP9A 3RI7C 2L7RA 2WXPA 4KKJA 3AM9A 4MEMA 3V6CB 1SB3C 1P98A 3PHXB 2EELA 1PGAA 3UI3A 3QARA 3TEWA 4NQKE 2W55A 2D07B 4EEWA 1J8CA 3TIXA 3B2GA 4NAMA 2GBRA 1BXTA 1GG3A 1AN8A 2C9WB 4ANWA 1PGBA 1UGMA 1GB4A 3TL5A 1F1HA 4MM3A 1SSNA 1OEYA 4FADA 5IO9A 4JGHB 5EE1A 4JWSC 2PE6B 4C7YA 1OFFA 4KDLB 4RF1A 4OZAA 1YIWA 2NBVB 4E3CA 2J7QB 2EKIA 2HTHA 3ENEA 4TKNA 3KLSX 1ZKHA 2ZVOA 1RFAA 2LVQA 3EFUA 4XC2A 3W5UB 4WAFA 2N9EB 3MHZA 4A55A 1I4RA 3ZNID 2M1MA 3DVGY 1YNTE 4GIVA 3L10B 2D10A 3VQIA 2KDMA 3A4RA 2V3NA 1DOYA 1UH6A 2D3BA 2KXJA 1UNSA 4W9DA 1AWDA 1KRHA 3R66C 2DZIA 1WRIA 5BMGA 4BKSA 1D6EC 3VH4B 2O6VD 1AYFA 4JPSA 2WU2B 1QOGA 5G5GA 2L1AA 2WXOA 1KF6B 2N7EA 4MH0E 4UDUC 2KTRA 2KNBA 1EF1A 3DHGC 2INNE 3AECB 2KMCA 3FILA 3KUZA 1STEA 4MGZE 3PHWB 4GDKB 5CHVC 2D3GA 2LUEA 2HJ1A 3ZO5B 2DYOA 2BTEA 3OWEB 1DGJA 4G0NB 1SE3A 3UGBB 3X23A 2V4IB 4LJPB 2MJEA 1EU3A 3PVLA 2ZPNA 3L08A 2M17A 1I4HA 3E56A 4GOCA 2O2VA 4L2YA 4REZA 1WJ4A 3AEFB 3ML9A 1WR1A 3AE7B 1TBEA 1R4MB 3I57A 4BVUC 1FFVA 1SE9A 3I63C 4II2B 2CHZA 4J3OD 1E8XA 2WXJA 1P0RA 3PZDA 3ZDMC 2LRWA 2FBWB 4HPPA 2B76B 1J0GA 3AEEB 1DOIA 2ZNVC 1I4XA 4WJPA 1GB1A 2W54A 2IO0B 3RN9C 4HJGE 2AL6A 2LGDA 1PDXA 2BW2A 3ONSA 4EKUA 2K0PA 4A6QA 5E6JA 2BKFA 3ZW3A 2CKHB 5DCNA 3OJ4B 2JPHA 1WXAA 3NS1A 1FNVA 2Z0DB 3Q8EA 2R2OA 3N1YC 4XDCA 3PO0A 2KMAA 3EFCA 1V80A 3GB1A 2N1VA 2AQ3B 3A9KA 2KYWA 3VDZA 3W5VB 5JZEB 3DQVA 1WWTA 1XLPA 4GSWA 3W2DA 3Q3MC 1FCCC 2MLBA 5T8IA 4HK2A 3PT2B 1L0VB 1NBFC 2FE8A 1JWSD 1K51A 3EECA 1M4VA 4PS3A 1E7VA 1C4PA 4EUTA 2WXGA 1E8YA 1UELA 1WZ0A 1SE2A 2WYQA 4W9EA 5IKCM 1L4DB 1YQBA 4WJQA 2KZRA 1L0XB 2JWUA 4XGAB 3ZLZA 3LJ3A 1IGCA 3S2AA 3AE1B 4OZBA 2PVGC 1XF5L 2ASQA 1YX6B 2ON8A 5C3JB 3AULA 2DENB 2C7MB 4GMVA 1WSPA 2LD9A 4CQNA 3RFZB 4K3CA 4JL9A 3RT3B 1ZUD2 2MP2A 3X0WA 2GRIA 1UD7A 1UGJA 2WX0A 3AE5B 4MH8A 2HJ8A 4ZRJA 5DPWA 4A3OA 3I3TB 2WU5B 2MJ3A 2PLPA 2LWPA 4CYEA 3CSFA 4HROA 4H2AA 3WANA 3LXFA 1VCBA 1WGYA 4IWPA 1PQSA 3AMZA 4XWWA 2RPQA 5IP4D 1KOTA 1EF5A 2ZCBA 2VZKD 4FJZA 2D2QA 1UF0A 2NMQA 2BF8B 1T0YA 2ZPYA 2IZVB 2QILA 3W1SC 2HTME 1ZE3D 4IM3A 2ZVNA 1P7FA 4S17A 4OW0A 2WGSA 2MCNB 2M4NA 4XX5A 2L52A 3VVWB 1V86A 4HPLB 1HTQA 3SU8X 3GE8C 4PS8A 3V6EB 1YN5A 3PRMB 3SD5A 5IOIA 5CTRC 1CQVA 3KUDB 2J0KA 1ZOYB 3TUOA 3IAS1 1T3QA 1JMLA 3QHTA 3R2IA 4IM0A 5D7GA 4LNFA 1V49A 1HZ5A 4PYUA 3H8HA 1EO6A 2RMMA 4WH4A 1TY0A 4FN2A 1N5WA 4OZCA 3WAMA 3M63B 4LNOA 3L13A 3H7PB 2J0JA 3D32A 2BGFA 2KHWB 4RCOA 2IO3B 2LHEA 2DX5B 1IUEA 4LDTB 3QQ8B 1Y56A 3HHMA 3P63A 3ZJTA 2E6XA 3FKYA 1S1QB 2RSUA 4CHKA 1JCKB 1L7YA 3B08A 4I6PA 2CU1A 4JIOU 2WQYB 5AZHA 2LHDA 3VXWA 4GGQA 3VRBB 1WJ6A 1WXSA 2GBJA 2N4FA 3RNAC 3ZNGC 2L00B 3APCA 2BYTA 1OQRA 5DPSA 3UIOB 1LFDA 2K9XA 3KYCD 1MFWA 2C5LC 4NNJB 2KTFA 2I2YA 2KVRA 3HK0A 3IFWB 2WS3B 4WJNA 4DQOC 4LNNA 4RNAA 3L17A 2KDEB 4ACFA 3VFKA 3TMPB 1CMXB 2MEKA 4JE3B 1OTRB 2M0AA 3GZNI 1ZP0B 4IKGA 1WGKA 3SFDB 4F7ZA 2K5PA 2ZW1A 2EKEC 2VZKB 1XCTL 1QOFA 2BWES 3HRDD 2BB6A 4ZRKA 5KHOA 4CO7A 1FD6A 5LXIB 2QHOA 2L05A 3TJPA 1C4AA 4FHKA 2K1FA 3NS8A 2K6QA 2JSVX 5EE9A 4KKIA 4EZLA 2KVZA 5HFYA 1L2NA 4YSZB 4DDGD 1SJED 3R7QA 2YEPF 1OEYJ 2MJDA 1V2YA 1V1OA 2OJRA 1K52A 2K6DB 2NPTA 4N9F4 4D2KA 4YT0B 2V9HA 4C4VB 1J7AA 3IT6B 3LDZE 4YSXB 1FNUA 2IGGA 2WXQA 4ZRPA 4G11A 3BK2A 1XLOA 1FXAA 3QCAA 4NAWB 5LNK1 2G1EA 5J2RA 2WLBA 1D5XC 4W9KA 5FR3A 2MSED 1Q1OA 4XDDA 3NZ3A 4MJSA 3ZXRA 2MBQA 3DWMA 2WDQB 4GLSC 2N1WA 3N30A 1WJNA 2BS3B 5D2MB 3UF8A 2KLGA 2LXCA 3VUWA 5FK9C 2DZMA 1F2RI 1ZXIA 2XK5A 2ZEQA 3TEXA 3NVYA 2MWSB 4KGRA 4K7UA 2KFJA 3AI5A 1WFYA 2GB1A 2N7DA 5FR6A 1FCLA 3ZUNA 5GMVA 4L1BA 2WDTB 3V60A 3P4RB 1JWMD 4O1NA 3AEAB 3DBLB 3AE4B 1ZW7A 1HXYD 1UZXB 3ZQ4A 2KJRA 1R4NB 2MA9B 5TR5A 4TMAB 4YSYB 4NZLB 5D3IB 4WJOA 4DHJB 5E6NA 1SE4A 4KGTA 4MSQB 4US9A 2J53A 3UINB 3ZYYX 1XO3A 3Q3NC 3DBRB 4FULA 1VRAB 1V8CA 1WH3A 2DYMA 2WXNA 1IPGA 2UYZB 1RLFA 3TBLD 2NBWB 2UWQA 1XXGA 3PTFC 2LGYA 3W1SA 3GOEA 3K9PB 2KQSA 4GDLB 1ESFA 2J4XA 2CJOA 2IGHA 1WF9A 1SGHA 4R3DA 4P1CC 3NVZA 4FJYA 1LO5D 4OHJA 1F0ZA 1N60A 2BKRB 4QAYA 4ANUA 5HG2A 3RNBC 1OQYA 2LVOA 2V4LA 4W9GA 4LTUA 2L8JA 3U52E 1NENB 2PTLA 2IPKD 2KTRB 4MGYE 4MDKE 1GC6A 1TY2A 1SIFA 1Y8RC 2GOWA 1WM2A 1XQQA 4TQ0A 2V0GA 2FIDA 1C76A 2KAJA 3BY4B 3PRPB 3AB5A 1L4ZB 3IBEA 2XEWA 5LXHA 1F9JA 3Q3FA 2KX3A 4GN1A 2CHXA 5EE0A 1FM0D 3CSTA 2KQ7A 3P1MA 5LLIA 1KLGD 2KACA 3UIPB 2KJ6A 3BZDB 1MI0A 3VUYA 1C1YB 1GPXA 5G55A 2JQRB 3DDCB 2OJWA 4E71A 3W9CB 3V61A 4BKTA 1E0ZA 2PVOD 4WAAA 5IN7A 2O2VB 4B6WA 4WWMA 1VLBA 4KIKB 3WAPA 1GC7A 3VTUA 4EOYA 1V97A 4M00A 1WJUA 3R8BA 3BYTB 3DVNV 4HXDA 3LYYA 3R2TA 4ARCA 2KX0A 4AWJA 3EUB2 5BMHA 3IXSA 2FAZA 1WX7A 3P42A 3PPAA 2FUHB 4DXFA 1QILA 3CIRB 3RUIB 1ZPSA 1VJKA 2PKOA 3VH3B 1YJJA 2RD0A 1VZ8A 1B1ZA 3MC8A 4ANXA 2EMTA 1Q0WB 2KN5A 2J42A 3ZKJC 3ALBA 3BIID 1QLBB 4W9CA 3JSVB 2SEBD 3B9JA 4WWNA 5KHQA 1WY8A 3A9KB 1MG4A 2DAJA 1ENFA 2A5UA 2K8BA 2PEAA 2JX5A 4LCDE 1T6BX 2N9PC 2RDBC 3HVZA 1GNUA 3E9SA 1P3QU 1WYWB 2KWVB 2QMTA 2NR2A 1F77A 1ISNA 4IDIA 4HCPB 1PUTA 5BMIA 2D3AA 3N1XC 1X1MA 1TS2A 3P2BA 4AQ7A 3BINA 1YJIA 2DAFA 2D3CA 4M0WB 2BBCA 3A1QA 3DWGC 3W1YA 2XBBC 3Q6BA 4F8CB 4OVUA 1T5XD 3DHHC 1YN4A 2PIAA 1FRDA 3PS6A 2YEPB 3PLUA 2C7NB 1JQ4A 4YXDB 3L4PA 2K3UA 1I42A 4PT5A 3AV8A 2FCSA 3JVZX 3QA8A 1ZDVA 3ZJVA 4TSSA 3K9OB 2LJ5A 4AOFA 4ZDVA 1N63A 3VR9B 1TKEA 1JALA 4KX6B 2KK8A 5AUKA 2KJHB 2KWCA 4MSMB 5HKHA 1KLUD 2K8CA 2L32A 1G6JA 2KANA 4XE0A 2O6VA 1DYQA 2J0MA 2LRUA 4YTPB 4LDTD 4S0RA 4YL8A 2JT4B 2FCQA 4W9FA 1QOBA 2GBKA 3VTWA 3H9DA 3KW5B 2LXAA 4MELA 4GU2A 5AZGA 3TCAA 1TT5B 2W3RA 2PE9A 2JWZA 1N61A 3MC9A 1NVID 2EMSA 4PYZA 4ZYNA 3V05A 2MBHA 2W9NA 4DXGA 1WGDA 2IY0B 1HTOA 1WMHB 1FIQA 2DYBA 3AEGB 2ACZB 4K3BA 1N62A 3BVGA 2JXTA 3T9LA 4DK5A 2GBNA 2LGSA 3U30A 2L76A 2FCNA 2D11A 4KVGB 5C2TB 4ICUA 2INPE 2JUOA 3TEYA 4TQ1A 4X57B 1LGRA 1V1PA 4M8NA 4JWUC 2N9LA 1WIAA 3EC8A 4RMAA 3A4SC 2OEDA 2MBOA 1FFUA 4YTNB 4P1BC 1I4QA 3B1LX 2E3TA 3ZDTA 4HWIB 5C23A 2PMVA 2PPHA 1TZ1A 3ETRA 2JZPA 2L83A 1NI2A 2LUMA 1BT0A 5D3DA 4N58A 3URYA 2N0SB 2RGFA 3MHSD 2QIEB 5FKAC 3R7RA 3KWLA 1TS5A 2MBBB 4ZRQA 4EZJA 4A8XC 4AJWA 4C7ZA 3DBSA 4TUUA 4HLEA 1D3ZA 1Q10A 1WXMA 1NYRA 4ICVA 1IP9A 2LGXA 3AU5A 2CR5A 1L0YB 2ONQA 3R3MA 2HE7A 4GXBA 3N3KB 2ZNVB 3A9JB 2M8SA 1IBXB 2DZKA 3DOWA 3GS2A 1Q5WB 2C7HA 1EU4A 1EUVB 1WX8A 3QC8B 1F52A 1KTKA 1C77A 1HE8A 2JYTA 2G3QB 4HKZE 3RNGC 3VUXA 5BYSA 2Z0EB 2BYFA 1ACCA 2KLCA 2DBYA 2KFKB 4DHJD 1NDDA 2ZZPB 2GI9A 1PFDA 1FRRA 2PJHA 1JWBD 3H7PA 4HDOA 2IYDB 2JRHA 1E8WA 5IA7A 3RNFC 3AE2B 3ABVB 3RD2A 1WM3A 4ZHPA 1U4AA 2AWTA 4OVVA 3NVVA 1TTNA 2YVCA 4AS1A 2JF5A 2QDFA 1N6ZA 1VDVA 4A20A 1TZOA 4KSKC 3ZNZB 2NPTB 1BMLC 4USAA 1BUIC 1WI0A 3WAOA 4C00A 4F1SA 1I4GA 1AW7A 2QCZA 2BPSA 4US8A 4JX1C 1E9MA 3HM3A 5JXVA 4JLCA 3VHTC 1E8ZA 4PK1A 3ZVVA 3NZSA 2Y3AA 3DCGA 2H89B 2IGDA 1V9JA 1I4PA 4WWOA 4BZAA 3EA6A 2JVCA 1Z5SB 2AEHA 1YMHE 2WXKA 4BKSD 2Y5PA 2PW9A 2YLMA 2IBIB 2Z59B 1KLVA 3ECIA 1YN3A 1VZ7A 1P7EA 1JRPA 2WP9B 4IW0A 1T0SC 3DPDA 2J52A 5G2NA 2BS4B 4I6NB 3MJWA 2V3SA 5C1ZA 3O13A 2DLBA 1D5MC 4NJCA 3HIZA 2WXHA 1J7CA 1P1AA 4G3XB 1I35A 1XLNA 3Q2AC 1NEKB 2KQ4X 5DPRA 2G4DB 3UQAA 2NTTA 3AE6B 3GZNB 3IVFA 4LJOB 1TIFA 3BWUD 4BBNC 2LVPA 3SR6A 5CHFA 1N5XA 2R2QA 2REXA 4NY0A 2RPVA 4NJ6A 1HEZE 3T3OA 3SFEB 1WE7A 2UU7A 4NAWA 2MH7A 3KVFB 2QJLA 4FBJB 3U2SC 5L83A 3FC4A 3RCZA 4RGOS 5DPTA 4YWGG 4HRSA 1V5OA 4MM3B 2NTSA 4IWOA 4NPNA 5D94A 3RPFC 5J18A 1S3SG 2KC1A 1KFYB 2FCMA 4NQLB 1KH0A 4N6EB 4PS7A 4KGSA 1H8CA 2VRRB 3AE8B 4P16A 3RNCC 2M56B 1RAXA 5E6OA 1E10A 2N9KA 3OG5A 3NZUA 2WDRB 3NUHB 2KOXA 1DOXA 3WALA 1GJZA 3P4SB 3H6NA 5CX3A 3PLVA 3V3XA 3H7SA 1E5WA 3IT4B 4C80A 2C60A 2KT7A 1QF6A 4ZOHC 2FIFA 1SF0A 4A90A 2VH2A 1D5ZC 3AE3B 2L0TA 2G9HD 5IAAC 4NJ7A 1EM7A 2QSDA 1ZXHA 3QK0A 3DBHI 2LI5A 1HZ6A 3VTVA 4URKA 3QAQA 1VR9A 1C79A 3BVMA 1PGXA 1TS4A 2JXXA 3SDLC 2LZ6A 3OLMD 2AQ1B 1WX9A 3DHIC 1WGHA 4HCNB 2BVCA 3RZFA 2QEJC 2JRIB 1QQRA 1I7HA 2IY1B 3N1ZC 3IHPC 3DVGX 1LM8B 1RYJA 3FILB 4KDIC 1GAQB 4GDLA 1FO4A 1R4MI 1L6UA 3U7ZA 2W82A 3CF6E 2W3SA 1C9FA 2AQ2B 2XNAC 3P4PB 1MPEA 2JZ3B 3ZRFA 5BYQA 2A4ZA 2N7JA 5AUIA 3AE9B 3A33B 2MBEA 3TSSA 4AP4C 2DZJA 3T3NA 1YJ1A 2LMCA 3KWVA 1MG8A 4A9AA 1EWYC 4WQMA 3ZJUA 1P9DU 1YD8U 5MPOA 1C78A 3I9V1 2K39A 2MX2A 1V5TA 1ROEA 4LNIA 3MJ5A 3RMKC 3N9YC 4BFRA 2RDHA 2AL3A 3AH7A 3KYDD 2OOBB 3UQBA 4K7WA 3DBHB 2AYOB 2KDFB 1TJEA 3EHVA 2K8HA 3Q8AA 1JRUA 3KUCB 1ZDXA 4ANVA 2NCNA 1H4RA 2V1YA 1QT9A 4HJKA 3SEBA 4RGTA 3AEDB 1QKZA 4GDKA 4WIPA 2RR9A 3IG3A 1FNWA 2BYVE 3MTNB 1V6EA 1NYQA 3H1UA 4W9LA 5EE3A 3BYYB 4KIKA 3VRAB 1B9RA 2Y5CA 1Z2MA 3J9CA 2KWUB 3BK1A 3ZNHB 2KC2A 2G4SA 1VZ6A 2CU3A 1C3TA 3OAWA 4XYCA 2GBMA 3A1QB 2JZZA 1FXTB 1JROA 4AUQC 3L0WB 4ASWC 4A3PA 2IJ0A 3C0RB 1XLQA 4GB9A 2IO2B 4BKGA 1YOVB 2I38A 3WCQA 2KN4A 4XZ4A 1TKYA 4WQOB 1JWAD 5HHDG 3WIMA 1VD2A 1AARA 1R7SA 3AXCA 1WGRA 2MW5A 2BT6A 1WYGA 1TGZB 4II3B 4HVBA 3AEBB 3NG0A 2LGIA 3PGEA 3JSVA 4K7SA 4IUMB 1MHHE 4W9HA 4RFBA 5EDSA 3IAM1 1E7PB 1A70A 2JY6A 3NOBA 1RWSA 3KQ4A 1V81A 3CMMB 2O6VB 4FLHA 1WR6E 4LNKA 3V62A 2GLSA 2KDBA 2X38A 3M62B 5BYRA 2RDGA 4KZ0A 4XWTA 5D6JB 2ICIA 2MP2B 3N32A 2BWFA 1XEEA 4K1RB 3ZXVA 4FA6A 4M0WA 2V3PA 4WURA 1CK1A 1HQRD 3ZIMA 5L95C 5AEKB 3APDA 2VH1A 1GOZA 4EE2A 3RZWC 4KSLC 3ZGZA 5J17A 4YTMB 1SXTA 4HPMB 1FXIA 4DXAB 3QWZB 1ET9A 3TEZA 3AN1A 1OGWA 2KWDA 3I5JC 1FPYA 4RGMA 3C8YA 1A5RA 2L0FA 2CHWA 3CWIA 1V1PB 4HEA1 4J6IA 1UUPA 1K53A 3MC0B 1WGGA 2BS2B 3RULA 4ITKA 1L5PA 4KV2A 3O65B 1E6EB 4LK0M 2X8XX 5CHWA 1UBQA 1XT9B 1WXVA 4IC7B 2WDVB 2TSSA 5I4DA 2K25A 3NY5A 3HM6X 4MGKE 3FAHA 5E6PA 4BOZB 2WXIA 4DHZB 1OQQA 2AX5A 3VR8B 2N9XA 3WA0A 3U7DA 4AJYB 1WE6A 3T8MA 2R61A 3C19A 2WXMA 2DHZA 1ZGUB 4M02A 1RFKA 2I1JA 4OVZA 2M0XA 1PYWD 3U4EG 5JHAA 4L23A 1WMHA 2LEKA 1FEHA 4LLGM 2HD5B 3GE3C 1SIJA 4MT5A 4RM8A 2NVUI 1WZ3A 4B0MA 3PZ8A 3OJ3A 1RM6C 1FMAD 2M19A 5JHBA 4RGNA 2WXRA 1CJEA 3L54A 1J19A 4WWPA 2QC8A 4E74A 5BO4B 4DHZE 1YX5B 5H8YE 3HVDA 4M8MA 5HI1A 3NJTA 3PREA 1UWXA 3Q8BA 3GP7A 2L3ZA 3M95A 2CS4A 4RM9A 2ZCCA 3Q3OC 2DNFA 1F2RC 2Q5WD 1YQ4B 2ZJDA 3ZTCA 1K50A 1JWUD 4ZHOA 3U8ZA 3NRZA 2GMIC 2INDC 4B95A 1RRBA 1XCQL 1L6VA 1M94A 2FUG1 4EZKA 1MJDA 4ARIA 3APFA 1T0RC 3AU4A 4K81A 2INCC 1GUAB 4Q2JA 1LXDA 3KH0A 2JU6X 4G50A 4TV3A 2MHJA 5G5HA 4IOIE 2B3AA 2CJNA 1YQ3B 4ZYSA 1SEBD 2WX1A 3M3JA 1WXQA 3A9JA 1IBXA 4N59A 4BBNF 2WNMA 3RYTA 3Q8CA 4FJVB 3ML8A 3Q14C 2OHFA 4B0EA 3QIJA 1E7UA 2WHIA 2H88B 3PV1A 2HDEA 3NVWA 4M01A 2LJIA 4W9JA 3EGRA 2ZW0A 3LB8C 3DVNU 5JH5C 3JYUA 3Q8FA 4JQWC 1TYGB 2KFKA 3HUIA 4ZRIA 4MJSB 5AZFA 1XD3B 3VAWA 1E90A 3DBLI 2KO3A 1T0QC 4I6LB 3ZRCA 5TSSA 2KKCA 3PSEB 1MVKA 1R4NI 4HDQA 2Z8LA 2JYEA 2LFIA 3SHQA 4BAXA 4C56C 3JW0X 2WXFA 4KZCA 3ZTDA 3P4QB 4FHJA 2FNJB 2XK5B 2IDYA 2BQQA 3RNEC 1IYFA 3B2FA 2DWQA 3DBRI 2G45B 1K8RB 3N20C 2NS5A 1TS3A 1ET6A 2MQJA 2NBUA 1QOAA 2Y5BB 1MHXA 4P7IA 4W9IA 4MACA 4IG7B 1D4BA 2KMMA 2KDIA
chains in the Genus database with same CATH topology
3ZRFA 4IM0A 2A4ZA 2IO1B 3PLUA 5D7GA 2C7NB 1QZEA 4IWQA 1V49A 2BYEA 3A33B 3PRZA 2MBEA 4AP4C 2DZJA 1YJ1A 2WWZA 4PYUA 1MG8A 1EO6A 1I42A 4BOSC 1P9DU 1YD8U 2FCSA 3JVZX 3QA8A 4FN2A 3WAMA 3K9OB 3M63B 2LJ5A 3B0AA 4AOFA 2K39A 2MX2A 4ZDVA 1LQBA 3L13A 3H7PB 1V5TA 4DWFA 2J0JA 2KK8A 3D32A 2BGFA 2KHWB 4BFRA 2IO3B 2KJHB 3Q3JA 2KWCA 4MGIE 4MSMB 2AL3A 2DX5B 5HKHA 2K8CA 3KYDD 2OOBB 4LDTB 3UQBA 4K7WA 3QQ8B 1KM7A 2AYOB 2KDFB 1WRDB 2LASA 3HHMA 2KANA 3QX1A 1G6JA 2O6VA 3QJZA 1S1QB 2I1KA 2J0MA 2LRUA 2RSUA 4CHKA 1L7YA 4LDTD 3EHVA 4YL8A 2JT4B 2K8HA 2FCQA 4W9FA 2GBKA 3B08A 2MRPA 4I6PA 2CU1A 3VTWA 3H9DA 3KW5B 1JRUA 4JIOU 5AZHA 3NHEB 4GGQA 2LXAA 3VXWA 4MELA 1UBIA 3KUCB 1WJ6A 4GU2A 5AZGA 1WXSA 1KJTA 4ANVA 3TCAA 4IM2A 2GBJA 3L16A 4DBGA 2N4FA 2KD0A 2NCNA 2PE9A 1H4RA 2V1YA 2L00B 3ZNGC 3APCA 4B9KA 4DDID 4EFOA 2L7RA 4HJKA 2JWZA 5DPSA 3UIOB 1LFDA 3KYCD 2C5LC 4GDKA 4NNJB 4MEMA 2KTFA 2RR9A 3IG3A 2EMSA 4PYZA 4ZYNA 1P98A 2KVRA 2BYVE 2MBHA 2W9NA 1V6EA 3HK0A 3IFWB 3MTNB 1WGDA 2IY0B 3H1UA 4WJNA 4W9LA 3QARA 1WMHB 4NQKE 3L17A 2KDEB 3VFKA 2D07B 4KIKA 3TMPB 2DYBA 4EEWA 1J8CA 1CMXB 3T9LA 4DK5A 1Z2MA 2GBNA 3TIXA 2KWUB 1OTRB 3U30A 2GBRA 3ZNHB 2L76A 2FCNA 3GZNI 1GG3A 2D11A 2KC2A 2G4SA 4KVGB 2C9WB 4F7ZA 4ANWA 2EKEC 4ICUA 1UGMA 1C3TA 3TL5A 2JUOA 3OAWA 2GBMA 3A1QB 1OEYA 4MM3A 4TQ1A 4X57B 2JZZA 4FADA 2BWES 4JGHB 1FXTB 4ZRKA 4M8NA 5KHOA 4AUQC 4CO7A 2PE6B 3L0WB 5LXIB 4ASWC 2QHOA 2L05A 3TJPA 4A3PA 1WIAA 4FHKA 2K1FA 3EC8A 3C0RB 3NS8A 4KDLB 4RMAA 2K6QA 1YIWA 2NBVB 3A4SC 2IO2B 4GB9A 4BKGA 4E3CA 2MBOA 2J7QB 2HTHA 3ENEA 4TKNA 4WQOB 4XZ4A 4EZLA 1ZKHA 3WIMA 2ZVOA 1RFAA 2LVQA 1L2NA 3B1LX 1VD2A 3EFUA 4XC2A 1AARA 4DDGD 3AXCA 3ZDTA 3R7QA 4HWIB 1WGRA 2N9EB 1OEYJ 5C23A 2MW5A 1TGZB 2PPHA 1V2YA 4II3B 1TZ1A 4HVBA 2OJRA 2K6DB 2NPTA 4N9F4 1NI2A 3JSVA 3PGEA 4IUMB 1BT0A 4K7SA 2M1MA 3ZNID 3DVGY 4GIVA 3L10B 2D10A 3LDZE 2RGFA 4W9HA 3MHSD 3VQIA 5EDSA 3R7RA 4G11A 2JY6A 2MBBB 3NOBA 3A4RA 3QCAA 4NAWB 4EZJA 1UH6A 2KXJA 1V81A 5J2RA 3CMMB 4W9DA 4AJWA 3DBSA 2O6VB 4FLHA 4TUUA 4W9KA 4HLEA 1WR6E 2MSED 1Q1OA 2DZIA 3R66C 4MJSA 3V62A 2MBQA 2KDBA 4BKSA 1D3ZA 3VH4B 2O6VD 3M62B 2N1WA 1WXMA 3N30A 4KZ0A 1WJNA 4ICVA 1IP9A 5D6JB 2LGXA 2MP2B 2N7EA 3N32A 4MH0E 5D2MB 3UF8A 2KTRA 2KLGA 2BWFA 2KNBA 3AU5A 1EF1A 2LXCA 2CR5A 3VUWA 3R3MA 4K1RB 2HE7A 4GXBA 3N3KB 2DZMA 4FA6A 2ZNVB 2KMCA 2XK5A 3KUZA 3A9JB 4MGZE 3PHWB 2ZEQA 4GDKB 2M8SA 5CHVC 2MWSB 2DZKA 3DOWA 1Q5WB 2D3GA 2LUEA 3ZIMA 5AEKB 5L95C 2C7HA 3APDA 4K7UA 2KFJA 3ZO5B 2DYOA 3AI5A 1WFYA 2N7DA 5FR6A 1EUVB 1WX8A 3QC8B 5GMVA 3ZUNA 2WDTB 3V60A 1HE8A 4G0NB 3RZWC 4KSLC 5J17A 4HPMB 2G3QB 3UGBB 3X23A 4LJPB 1ZW7A 1UZXB 4DXAB 2KJRA 2MA9B 5TR5A 3VUXA 3PVLA 2ZPNA 3L08A 3QWZB 2M17A 4WJOA 4DHJB 1OGWA 5E6NA 2Z0EB 2BYFA 4GOCA 2O2VA 4MSQB 2KLCA 1WJ4A 2KFKB 2L0FA 3V6CB 2CHWA 3ML9A 3UINB 1NDDA 4DHJD 2ZZPB 4J6IA 1WR1A 1TBEA 4FULA 2PJHA 1SE9A 4BVUC 1WGGA 1WH3A 2DYMA 3H7PA 4HDOA 3RULA 2IYDB 2JRHA 1E8WA 4II2B 1IPGA 2CHZA 3O65B 4KV2A 2UYZB 5IA7A 1RLFA 5CHWA 1E8XA 3TBLD 2NBWB 3RD2A 1P0RA 1UBQA 1WM3A 1XT9B 2UWQA 3PZDA 1U4AA 2AWTA 3ZDMC 2LRWA 3PTFC 2LGYA 4OVVA 1WXVA 1TTNA 4IC7B 3W1SA 2YVCA 2JF5A 1J0GA 3GOEA 3K9PB 4A20A 2KQSA 2K25A 2ZNVC 4GDLB 4KSKC 3ZNZB 3NY5A 4WJPA 2NPTB 3HM6X 4MGKE 1WI0A 5E6PA 3WAOA 4BOZB 1WF9A 2IO0B 4F1SA 2AL6A 2LGDA 1SGHA 4DHZB 3ONSA 2BPSA 4EKUA 1A5RA 3HM3A 4JLCA 4FJYA 2N9XA 3WA0A 3U7DA 3VHTC 4AJYB 1E8ZA 1WE6A 2BKFA 3T8MA 2CKHB 3ZW3A 2BKRB 2DHZA 5DCNA 1ZGUB 3ZVVA 3OJ4B 4ANUA 2JPHA 2I1JA 2M0XA 1OQYA 1WXAA 3NZSA 5JHAA 2LVOA 2V4LA 2Z0DB 3DCGA 4W9GA 1WMHA 2R2OA 2L8JA 1V9JA 4WWOA 2KMAA 2JVCA 1Z5SB 2AEHA 2HD5B 1V80A 4BKSD 2N1VA 3A9KA 2YLMA 4RM8A 2NVUI 2KTRB 4MGYE 4MDKE 3VDZA 1GC6A 2IBIB 1WZ3A 5JZEB 2Z59B 1SIFA 3DQVA 1KLVA 1Y8RC 2GOWA 1WM2A 1XQQA 3ECIA 3OJ3A 4TQ0A 2FIDA 4GSWA 3BY4B 3PRPB 5JHBA 3IBEA 2XEWA 4IW0A 5LXHA 3DPDA 1F9JA 2MLBA 3Q3FA 5G2NA 2KX3A 4GN1A 4I6NB 2CHXA 2V3SA 3L54A 3MJWA 3CSTA 2KQ7A 5LLIA 5C1ZA 1J19A 4HK2A 4WWPA 3UIPB 3HIZA 4G3XB 1P1AA 1I35A 3PT2B 4E74A 5BO4B 4DHZE 2KJ6A 1NBFC 1YX5B 4M8MA 3VUYA 5DPRA 2G4DB 3EECA 1C1YB 3PREA 4PS3A 3UQAA 5G55A 3IVFA 1E7VA 3DDCB 4LJOB 2L3ZA 3M95A 4E71A 4EUTA 2CS4A 4RM9A 3V61A 2ZCCA 4BKTA 4WAAA 2O2VB 1E8YA 1UELA 4B6WA 1WZ0A 4BBNC 2WYQA 4W9EA 2LVPA 5CHFA 2R2QA 2REXA 4NY0A 2ZJDA 4NJ6A 3ZTCA 4KIKB 3WAPA 1YQBA 4WJQA 1GC7A 3VTUA 4EOYA 2KZRA 1WE7A 3U8ZA 1WJUA 2KDIA 2GMIC 4NAWA 3ZLZA 3LJ3A 4B95A 1RRBA 3S2AA 3KVFB 3DVNV 1M94A 4HXDA 4EZKA 4FBJB 2KX0A 3APFA 4AWJA 5L83A 3RCZA 3AU4A 5DPTA 2ASQA 1YX6B 4K81A 3AULA 2DENB 2C7MB 4GMVA 1V5OA 1GUAB 2FAZA 2LD9A 1WX7A 3PPAA 4IWOA 4NPNA 5D94A 1LXDA 3KH0A 5J18A 2FUHB 1S3SG 2KC1A 4G50A 2FCMA 4TV3A 4NQLB 4PS7A 2B3AA 4JL9A 3RT3B 2MP2A 3RUIB 3X0WA 1H8CA 2VRRB 1UD7A 3VH3B 2WX0A 2WX1A 1RAXA 2RD0A 3M3JA 5E6OA 2HJ8A 3A9JA 4ZRJA 5DPWA 4A3OA 3I3TB 3NZUA 4ANXA 2EMTA 1Q0WB 2KN5A 4BBNF 3RYTA 2KOXA 3WALA 1GJZA 3ZKJC 2LWPA 3ALBA 4FJVB 3ML8A 3CSFA 4CYEA 3H6NA 5CX3A 3PLVA 3H7SA 1E5WA 3WANA 2C60A 4W9CA 3JSVB 3QIJA 1E7UA 2FIFA 1VCBA 4WWNA 5KHQA 1WGYA 1WY8A 3A9KB 3PV1A 4IWPA 1PQSA 2DAJA 2L0TA 5IAAC 2A5UA 2K8BA 4NJ7A 4W9JA 2PEAA 2RPQA 3QK0A 3DBHI 4LCDE 1KOTA 2LI5A 2N9PC 3DVNU 1EF5A 2ZCBA 3VTVA 4URKA 5JH5C 3JYUA 3QAQA 1GNUA 4JQWC 1P3QU 1WYWB 2KFKA 2KWVB 2JXXA 4FJZA 4ZRIA 2D2QA 3SDLC 2LZ6A 2NR2A 3OLMD 4MJSB 1ISNA 5AZFA 1XD3B 3VAWA 1WX9A 1T0YA 2BF8B 1E90A 2ZPYA 1WGHA 4HCNB 2IZVB 2KO3A 3DBLI 4HCPB 4I6LB 3RZFA 3W1SC 3ZRCA 2JRIB 2KKCA 3PSEB 1R4NI 1X1MA 4IM3A 2IY1B 2ZVNA 3P2BA 4HDQA 2MCNB 3BINA 2M4NA 3IHPC 4XX5A 3SHQA 3DVGX 2DAFA 3VVWB 3JW0X 1V86A 4HPLB 1LM8B 4M0WB 4KZCA 3ZTDA 4FHJA 2FNJB 2XK5B 4KDIC 3A1QA 3SU8X 4PS8A 3V6EB 1IYFA 4GDLA 3SD5A 3PRMB 3DBRI 1R4MI 2G45B 1K8RB 5CTRC 3W1YA 3KUDB 2NS5A 2J0KA 2XBBC 3CF6E 2MQJA 2NBUA 3PHXB 4F8CB 2Y5BB 4P7IA 4OVUA 4W9IA 3QHTA 4IG7B 3PS6A 2JZ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRF A;  4IM0 A;  2A4Z A;  2IO1 B;  3PLU A;  5D7G A;  2C7N B;  1QZE A;  4IWQ A;  1V49 A;  2BYE A;  3A33 B;  3PRZ A;  2MBE A;  4AP4 C;  2DZJ A;  1YJ1 A;  2WWZ A;  4PYU A;  1MG8 A;  1EO6 A;  1I42 A;  4BOS C;  1P9D U;  1YD8 U;  2FCS A;  3JVZ X;  3QA8 A;  4FN2 A;  3WAM A;  3K9O B;  3M63 B;  2LJ5 A;  3B0A A;  4AOF A;  2K39 A;  2MX2 A;  4ZDV A;  1LQB A;  3L13 A;  3H7P B;  1V5T A;  4DWF A;  2J0J A;  2KK8 A;  3D32 A;  2BGF A;  2KHW B;  4BFR A;  2IO3 B;  2KJH B;  3Q3J A;  2KWC A;  4MGI E;  4MSM B;  2AL3 A;  2DX5 B;  5HKH A;  2K8C A;  3KYD D;  2OOB B;  4LDT B;  3UQB A;  4K7W A;  3QQ8 B;  1KM7 A;  2AYO B;  2KDF B;  1WRD B;  2LAS A;  3HHM A;  2KAN A;  3QX1 A;  1G6J A;  2O6V A;  3QJZ A;  1S1Q B;  2I1K A;  2J0M A;  2LRU A;  2RSU A;  4CHK A;  1L7Y A;  4LDT D;  3EHV A;  4YL8 A;  2JT4 B;  2K8H A;  2FCQ A;  4W9F A;  2GBK A;  3B08 A;  2MRP A;  4I6P A;  2CU1 A;  3VTW A;  3H9D A;  3KW5 B;  1JRU A;  4JIO U;  5AZH A;  3NHE B;  4GGQ A;  2LXA A;  3VXW A;  4MEL A;  1UBI A;  3KUC B;  1WJ6 A;  4GU2 A;  5AZG A;  1WXS A;  1KJT A;  4ANV A;  3TCA A;  4IM2 A;  2GBJ A;  3L16 A;  4DBG A;  2N4F A;  2KD0 A;  2NCN A;  2PE9 A;  1H4R A;  2V1Y A;  2L00 B;  3ZNG C;  3APC A;  4B9K A;  4DDI D;  4EFO A;  2L7R A;  4HJK A;  2JWZ A;  5DPS A;  3UIO B;  1LFD A;  3KYC D;  2C5L C;  4GDK A;  4NNJ B;  4MEM A;  2KTF A;  2RR9 A;  3IG3 A;  2EMS A;  4PYZ A;  4ZYN A;  1P98 A;  2KVR A;  2BYV E;  2MBH A;  2W9N A;  1V6E A;  3HK0 A;  3IFW B;  3MTN B;  1WGD A;  2IY0 B;  3H1U A;  4WJN A;  4W9L A;  3QAR A;  1WMH B;  4NQK E;  3L17 A;  2KDE B;  3VFK A;  2D07 B;  4KIK A;  3TMP B;  2DYB A;  4EEW A;  1J8C A;  1CMX B;  3T9L A;  4DK5 A;  1Z2M A;  2GBN A;  3TIX A;  2KWU B;  1OTR B;  3U30 A;  2GBR A;  3ZNH B;  2L76 A;  2FCN A;  3GZN I;  1GG3 A;  2D11 A;  2KC2 A;  2G4S A;  4KVG B;  2C9W B;  4F7Z A;  4ANW A;  2EKE C;  4ICU A;  1UGM A;  1C3T A;  3TL5 A;  2JUO A;  3OAW A;  2GBM A;  3A1Q B;  1OEY A;  4MM3 A;  4TQ1 A;  4X57 B;  2JZZ A;  4FAD A;  2BWE S;  4JGH B;  1FXT B;  4ZRK A;  4M8N A;  5KHO A;  4AUQ C;  4CO7 A;  2PE6 B;  3L0W B;  5LXI B;  4ASW C;  2QHO A;  2L05 A;  3TJP A;  4A3P A;  1WIA A;  4FHK A;  2K1F A;  3EC8 A;  3C0R B;  3NS8 A;  4KDL B;  4RMA A;  2K6Q A;  1YIW A;  2NBV B;  3A4S C;  2IO2 B;  4GB9 A;  4BKG A;  4E3C A;  2MBO A;  2J7Q B;  2HTH A;  3ENE A;  4TKN A;  4WQO B;  4XZ4 A;  4EZL A;  1ZKH A;  3WIM A;  2ZVO A;  1RFA A;  2LVQ A;  1L2N A;  3B1L X;  1VD2 A;  3EFU A;  4XC2 A;  1AAR A;  4DDG D;  3AXC A;  3ZDT A;  3R7Q A;  4HWI B;  1WGR A;  2N9E B;  1OEY J;  5C23 A;  2MW5 A;  1TGZ B;  2PPH A;  1V2Y A;  4II3 B;  1TZ1 A;  4HVB A;  2OJR A;  2K6D B;  2NPT A;  4N9F 4;  1NI2 A;  3JSV A;  3PGE A;  4IUM B;  1BT0 A;  4K7S A;  2M1M A;  3ZNI D;  3DVG Y;  4GIV A;  3L10 B;  2D10 A;  3LDZ E;  2RGF A;  4W9H A;  3MHS D;  3VQI A;  5EDS A;  3R7R A;  4G11 A;  2JY6 A;  2MBB B;  3NOB A;  3A4R A;  3QCA A;  4NAW B;  4EZJ A;  1UH6 A;  2KXJ A;  1V81 A;  5J2R A;  3CMM B;  4W9D A;  4AJW A;  3DBS A;  2O6V B;  4FLH A;  4TUU A;  4W9K A;  4HLE A;  1WR6 E;  2MSE D;  1Q1O A;  2DZI A;  3R66 C;  4MJS A;  3V62 A;  2MBQ A;  2KDB A;  4BKS A;  1D3Z A;  3VH4 B;  2O6V D;  3M62 B;  2N1W A;  1WXM A;  3N30 A;  4KZ0 A;  1WJN A;  4ICV A;  1IP9 A;  5D6J B;  2LGX A;  2MP2 B;  2N7E A;  3N32 A;  4MH0 E;  5D2M B;  3UF8 A;  2KTR A;  2KLG A;  2BWF A;  2KNB A;  3AU5 A;  1EF1 A;  2LXC A;  2CR5 A;  3VUW A;  3R3M A;  4K1R B;  2HE7 A;  4GXB A;  3N3K B;  2DZM A;  4FA6 A;  2ZNV B;  2KMC A;  2XK5 A;  3KUZ A;  3A9J B;  4MGZ E;  3PHW B;  2ZEQ A;  4GDK B;  2M8S A;  5CHV C;  2MWS B;  2DZK A;  3DOW A;  1Q5W B;  2D3G A;  2LUE A;  3ZIM A;  5AEK B;  5L95 C;  2C7H A;  3APD A;  4K7U A;  2KFJ A;  3ZO5 B;  2DYO A;  3AI5 A;  1WFY A;  2N7D A;  5FR6 A;  1EUV B;  1WX8 A;  3QC8 B;  5GMV A;  3ZUN A;  2WDT B;  3V60 A;  1HE8 A;  4G0N B;  3RZW C;  4KSL C;  5J17 A;  4HPM B;  2G3Q B;  3UGB B;  3X23 A;  4LJP B;  1ZW7 A;  1UZX B;  4DXA B;  2KJR A;  2MA9 B;  5TR5 A;  3VUX A;  3PVL A;  2ZPN A;  3L08 A;  3QWZ B;  2M17 A;  4WJO A;  4DHJ B;  1OGW A;  5E6N A;  2Z0E B;  2BYF A;  4GOC A;  2O2V A;  4MSQ B;  2KLC A;  1WJ4 A;  2KFK B;  2L0F A;  3V6C B;  2CHW A;  3ML9 A;  3UIN B;  1NDD A;  4DHJ D;  2ZZP B;  4J6I A;  1WR1 A;  1TBE A;  4FUL A;  2PJH A;  1SE9 A;  4BVU C;  1WGG A;  1WH3 A;  2DYM A;  3H7P A;  4HDO A;  3RUL A;  2IYD B;  2JRH A;  1E8W A;  4II2 B;  1IPG A;  2CHZ A;  3O65 B;  4KV2 A;  2UYZ B;  5IA7 A;  1RLF A;  5CHW A;  1E8X A;  3TBL D;  2NBW B;  3RD2 A;  1P0R A;  1UBQ A;  1WM3 A;  1XT9 B;  2UWQ A;  3PZD A;  1U4A A;  2AWT A;  3ZDM C;  2LRW A;  3PTF C;  2LGY A;  4OVV A;  1WXV A;  1TTN A;  4IC7 B;  3W1S A;  2YVC A;  2JF5 A;  1J0G A;  3GOE A;  3K9P B;  4A20 A;  2KQS A;  2K25 A;  2ZNV C;  4GDL B;  4KSK C;  3ZNZ B;  3NY5 A;  4WJP A;  2NPT B;  3HM6 X;  4MGK E;  1WI0 A;  5E6P A;  3WAO A;  4BOZ B;  1WF9 A;  2IO0 B;  4F1S A;  2AL6 A;  2LGD A;  1SGH A;  4DHZ B;  3ONS A;  2BPS A;  4EKU A;  1A5R A;  3HM3 A;  4JLC A;  4FJY A;  2N9X A;  3WA0 A;  3U7D A;  3VHT C;  4AJY B;  1E8Z A;  1WE6 A;  2BKF A;  3T8M A;  2CKH B;  3ZW3 A;  2BKR B;  2DHZ A;  5DCN A;  1ZGU B;  3ZVV A;  3OJ4 B;  4ANU A;  2JPH A;  2I1J A;  2M0X A;  1OQY A;  1WXA A;  3NZS A;  5JHA A;  2LVO A;  2V4L A;  2Z0D B;  3DCG A;  4W9G A;  1WMH A;  2R2O A;  2L8J A;  1V9J A;  4WWO A;  2KMA A;  2JVC A;  1Z5S B;  2AEH A;  2HD5 B;  1V80 A;  4BKS D;  2N1V A;  3A9K A;  2YLM A;  4RM8 A;  2NVU I;  2KTR B;  4MGY E;  4MDK E;  3VDZ A;  1GC6 A;  2IBI B;  1WZ3 A;  5JZE B;  2Z59 B;  1SIF A;  3DQV A;  1KLV A;  1Y8R C;  2GOW A;  1WM2 A;  1XQQ A;  3ECI A;  3OJ3 A;  4TQ0 A;  2FID A;  4GSW A;  3BY4 B;  3PRP B;  5JHB A;  3IBE A;  2XEW A;  4IW0 A;  5LXH A;  3DPD A;  1F9J A;  2MLB A;  3Q3F A;  5G2N A;  2KX3 A;  4GN1 A;  4I6N B;  2CHX A;  2V3S A;  3L54 A;  3MJW A;  3CST A;  2KQ7 A;  5LLI A;  5C1Z A;  1J19 A;  4HK2 A;  4WWP A;  3UIP B;  3HIZ A;  4G3X B;  1P1A A;  1I35 A;  3PT2 B;  4E74 A;  5BO4 B;  4DHZ E;  2KJ6 A;  1NBF C;  1YX5 B;  4M8M A;  3VUY A;  5DPR A;  2G4D B;  3EEC A;  1C1Y B;  3PRE A;  4PS3 A;  3UQA A;  5G55 A;  3IVF A;  1E7V A;  3DDC B;  4LJO B;  2L3Z A;  3M95 A;  4E71 A;  4EUT A;  2CS4 A;  4RM9 A;  3V61 A;  2ZCC A;  4BKT A;  4WAA A;  2O2V B;  1E8Y A;  1UEL A;  4B6W A;  1WZ0 A;  4BBN C;  2WYQ A;  4W9E A;  2LVP A;  5CHF A;  2R2Q A;  2REX A;  4NY0 A;  2ZJD A;  4NJ6 A;  3ZTC A;  4KIK B;  3WAP A;  1YQB A;  4WJQ A;  1GC7 A;  3VTU A;  4EOY A;  2KZR A;  1WE7 A;  3U8Z A;  1WJU A;  2KDI A;  2GMI C;  4NAW A;  3ZLZ A;  3LJ3 A;  4B95 A;  1RRB A;  3S2A A;  3KVF B;  3DVN V;  1M94 A;  4HXD A;  4EZK A;  4FBJ B;  2KX0 A;  3APF A;  4AWJ A;  5L83 A;  3RCZ A;  3AU4 A;  5DPT A;  2ASQ A;  1YX6 B;  4K81 A;  3AUL A;  2DEN B;  2C7M B;  4GMV A;  1V5O A;  1GUA B;  2FAZ A;  2LD9 A;  1WX7 A;  3PPA A;  4IWO A;  4NPN A;  5D94 A;  1LXD A;  3KH0 A;  5J18 A;  2FUH B;  1S3S G;  2KC1 A;  4G50 A;  2FCM A;  4TV3 A;  4NQL B;  4PS7 A;  2B3A A;  4JL9 A;  3RT3 B;  2MP2 A;  3RUI B;  3X0W A;  1H8C A;  2VRR B;  1UD7 A;  3VH3 B;  2WX0 A;  2WX1 A;  1RAX A;  2RD0 A;  3M3J A;  5E6O A;  2HJ8 A;  3A9J A;  4ZRJ A;  5DPW A;  4A3O A;  3I3T B;  3NZU A;  4ANX A;  2EMT A;  1Q0W B;  2KN5 A;  4BBN F;  3RYT A;  2KOX A;  3WAL A;  1GJZ A;  3ZKJ C;  2LWP A;  3ALB A;  4FJV B;  3ML8 A;  3CSF A;  4CYE A;  3H6N A;  5CX3 A;  3PLV A;  3H7S A;  1E5W A;  3WAN A;  2C60 A;  4W9C A;  3JSV B;  3QIJ A;  1E7U A;  2FIF A;  1VCB A;  4WWN A;  5KHQ A;  1WGY A;  1WY8 A;  3A9K B;  3PV1 A;  4IWP A;  1PQS A;  2DAJ A;  2L0T A;  5IAA C;  2A5U A;  2K8B A;  4NJ7 A;  4W9J A;  2PEA A;  2RPQ A;  3QK0 A;  3DBH I;  4LCD E;  1KOT A;  2LI5 A;  2N9P C;  3DVN U;  1EF5 A;  2ZCB A;  3VTV A;  4URK A;  5JH5 C;  3JYU A;  3QAQ A;  1GNU A;  4JQW C;  1P3Q U;  1WYW B;  2KFK A;  2KWV B;  2JXX A;  4FJZ A;  4ZRI A;  2D2Q A;  3SDL C;  2LZ6 A;  2NR2 A;  3OLM D;  4MJS B;  1ISN A;  5AZF A;  1XD3 B;  3VAW A;  1WX9 A;  1T0Y A;  2BF8 B;  1E90 A;  2ZPY A;  1WGH A;  4HCN B;  2IZV B;  2KO3 A;  3DBL I;  4HCP B;  4I6L B;  3RZF A;  3W1S C;  3ZRC A;  2JRI B;  2KKC A;  3PSE B;  1R4N I;  1X1M A;  4IM3 A;  2IY1 B;  2ZVN A;  3P2B A;  4HDQ A;  2MCN B;  3BIN A;  2M4N A;  3IHP C;  4XX5 A;  3SHQ A;  3DVG X;  2DAF A;  3VVW B;  3JW0 X;  1V86 A;  4HPL B;  1LM8 B;  4M0W B;  4KZC A;  3ZTD A;  4FHJ A;  2FNJ B;  2XK5 B;  4KDI C;  3A1Q A;  3SU8 X;  4PS8 A;  3V6E B;  1IYF A;  4GDL A;  3SD5 A;  3PRM B;  3DBR I;  1R4M I;  2G45 B;  1K8R B;  5CTR C;  3W1Y A;  3KUD B;  2NS5 A;  2J0K A;  2XBB C;  3CF6 E;  2MQJ A;  2NBU A;  3PHX B;  4F8C B;  2Y5B B;  4P7I A;  4OVU A;  4W9I A;  3QHT A;  4IG7 B;  3PS6 A;  2JZ3 B; 
#chains in the Genus database with same CATH topology
 3MFG A;  2IO1 B;  1QZE A;  3Q69 A;  4P6V F;  3BVZ A;  4IWQ A;  2XN9 C;  2BYE A;  3PRZ A;  2WWZ A;  4RH6 A;  4BOS C;  1IGD A;  1CZP A;  4C4V A;  2D5G A;  3B0A A;  4RF0 A;  1JW9 D;  1LQB A;  1J7B A;  2WXL A;  3PZ7 A;  1C4C A;  1SBB B;  4DWF A;  3Q3J A;  4FXC A;  4MGI E;  1TKG A;  1HA5 A;  1KM7 A;  2LAS A;  1WRD B;  3QX1 A;  1NI3 A;  3QJZ A;  5GXG B;  2I1K A;  2BB5 A;  2K22 A;  4HKQ A;  2MRP A;  1EWC A;  2SAK A;  3NHE B;  1UBI A;  5H92 C;  1SJH D;  1KJT A;  4IM2 A;  3L16 A;  4DBG A;  1UWM A;  2KD0 A;  4DDI D;  4EFO A;  4B9K A;  3MP9 A;  3RI7 C;  2L7R A;  2WXP A;  4KKJ A;  3AM9 A;  4MEM A;  3V6C B;  1SB3 C;  1P98 A;  3PHX B;  2EEL A;  1PGA A;  3UI3 A;  3QAR A;  3TEW A;  4NQK E;  2W55 A;  2D07 B;  4EEW A;  1J8C A;  3TIX A;  3B2G A;  4NAM A;  2GBR A;  1BXT A;  1GG3 A;  1AN8 A;  2C9W B;  4ANW A;  1PGB A;  1UGM A;  1GB4 A;  3TL5 A;  1F1H A;  4MM3 A;  1SSN A;  1OEY A;  4FAD A;  5IO9 A;  4JGH B;  5EE1 A;  4JWS C;  2PE6 B;  4C7Y A;  1OFF A;  4KDL B;  4RF1 A;  4OZA A;  1YIW A;  2NBV B;  4E3C A;  2J7Q B;  2EKI A;  2HTH A;  3ENE A;  4TKN A;  3KLS X;  1ZKH A;  2ZVO A;  1RFA A;  2LVQ A;  3EFU A;  4XC2 A;  3W5U B;  4WAF A;  2N9E B;  3MHZ A;  4A55 A;  1I4R A;  3ZNI D;  2M1M A;  3DVG Y;  1YNT E;  4GIV A;  3L10 B;  2D10 A;  3VQI A;  2KDM A;  3A4R A;  2V3N A;  1DOY A;  1UH6 A;  2D3B A;  2KXJ A;  1UNS A;  4W9D A;  1AWD A;  1KRH A;  3R66 C;  2DZI A;  1WRI A;  5BMG A;  4BKS A;  1D6E C;  3VH4 B;  2O6V D;  1AYF A;  4JPS A;  2WU2 B;  1QOG A;  5G5G A;  2L1A A;  2WXO A;  1KF6 B;  2N7E A;  4MH0 E;  4UDU C;  2KTR A;  2KNB A;  1EF1 A;  3DHG C;  2INN E;  3AEC B;  2KMC A;  3FIL A;  3KUZ A;  1STE A;  4MGZ E;  3PHW B;  4GDK B;  5CHV C;  2D3G A;  2LUE A;  2HJ1 A;  3ZO5 B;  2DYO A;  2BTE A;  3OWE B;  1DGJ A;  4G0N B;  1SE3 A;  3UGB B;  3X23 A;  2V4I B;  4LJP B;  2MJE A;  1EU3 A;  3PVL A;  2ZPN A;  3L08 A;  2M17 A;  1I4H A;  3E56 A;  4GOC A;  2O2V A;  4L2Y A;  4REZ A;  1WJ4 A;  3AEF B;  3ML9 A;  1WR1 A;  3AE7 B;  1TBE A;  1R4M B;  3I57 A;  4BVU C;  1FFV A;  1SE9 A;  3I63 C;  4II2 B;  2CHZ A;  4J3O D;  1E8X A;  2WXJ A;  1P0R A;  3PZD A;  3ZDM C;  2LRW A;  2FBW B;  4HPP A;  2B76 B;  1J0G A;  3AEE B;  1DOI A;  2ZNV C;  1I4X A;  4WJP A;  1GB1 A;  2W54 A;  2IO0 B;  3RN9 C;  4HJG E;  2AL6 A;  2LGD A;  1PDX A;  2BW2 A;  3ONS A;  4EKU A;  2K0P A;  4A6Q A;  5E6J A;  2BKF A;  3ZW3 A;  2CKH B;  5DCN A;  3OJ4 B;  2JPH A;  1WXA A;  3NS1 A;  1FNV A;  2Z0D B;  3Q8E A;  2R2O A;  3N1Y C;  4XDC A;  3PO0 A;  2KMA A;  3EFC A;  1V80 A;  3GB1 A;  2N1V A;  2AQ3 B;  3A9K A;  2KYW A;  3VDZ A;  3W5V B;  5JZE B;  3DQV A;  1WWT A;  1XLP A;  4GSW A;  3W2D A;  3Q3M C;  1FCC C;  2MLB A;  5T8I A;  4HK2 A;  3PT2 B;  1L0V B;  1NBF C;  2FE8 A;  1JWS D;  1K51 A;  3EEC A;  1M4V A;  4PS3 A;  1E7V A;  1C4P A;  4EUT A;  2WXG A;  1E8Y A;  1UEL A;  1WZ0 A;  1SE2 A;  2WYQ A;  4W9E A;  5IKC M;  1L4D B;  1YQB A;  4WJQ A;  2KZR A;  1L0X B;  2JWU A;  4XGA B;  3ZLZ A;  3LJ3 A;  1IGC A;  3S2A A;  3AE1 B;  4OZB A;  2PVG C;  1XF5 L;  2ASQ A;  1YX6 B;  2ON8 A;  5C3J B;  3AUL A;  2DEN B;  2C7M B;  4GMV A;  1WSP A;  2LD9 A;  4CQN A;  3RFZ B;  4K3C A;  4JL9 A;  3RT3 B;  1ZUD 2;  2MP2 A;  3X0W A;  2GRI A;  1UD7 A;  1UGJ A;  2WX0 A;  3AE5 B;  4MH8 A;  2HJ8 A;  4ZRJ A;  5DPW A;  4A3O A;  3I3T B;  2WU5 B;  2MJ3 A;  2PLP A;  2LWP A;  4CYE A;  3CSF A;  4HRO A;  4H2A A;  3WAN A;  3LXF A;  1VCB A;  1WGY A;  4IWP A;  1PQS A;  3AMZ A;  4XWW A;  2RPQ A;  5IP4 D;  1KOT A;  1EF5 A;  2ZCB A;  2VZK D;  4FJZ A;  2D2Q A;  1UF0 A;  2NMQ A;  2BF8 B;  1T0Y A;  2ZPY A;  2IZV B;  2QIL A;  3W1S C;  2HTM E;  1ZE3 D;  4IM3 A;  2ZVN A;  1P7F A;  4S17 A;  4OW0 A;  2WGS A;  2MCN B;  2M4N A;  4XX5 A;  2L52 A;  3VVW B;  1V86 A;  4HPL B;  1HTQ A;  3SU8 X;  3GE8 C;  4PS8 A;  3V6E B;  1YN5 A;  3PRM B;  3SD5 A;  5IOI A;  5CTR C;  1CQV A;  3KUD B;  2J0K A;  1ZOY B;  3TUO A;  3IAS 1;  1T3Q A;  1JML A;  3QHT A;  3R2I A;  4IM0 A;  5D7G A;  4LNF A;  1V49 A;  1HZ5 A;  4PYU A;  3H8H A;  1EO6 A;  2RMM A;  4WH4 A;  1TY0 A;  4FN2 A;  1N5W A;  4OZC A;  3WAM A;  3M63 B;  4LNO A;  3L13 A;  3H7P B;  2J0J A;  3D32 A;  2BGF A;  2KHW B;  4RCO A;  2IO3 B;  2LHE A;  2DX5 B;  1IUE A;  4LDT B;  3QQ8 B;  1Y56 A;  3HHM A;  3P63 A;  3ZJT A;  2E6X A;  3FKY A;  1S1Q B;  2RSU A;  4CHK A;  1JCK B;  1L7Y A;  3B08 A;  4I6P A;  2CU1 A;  4JIO U;  2WQY B;  5AZH A;  2LHD A;  3VXW A;  4GGQ A;  3VRB B;  1WJ6 A;  1WXS A;  2GBJ A;  2N4F A;  3RNA C;  3ZNG C;  2L00 B;  3APC A;  2BYT A;  1OQR A;  5DPS A;  3UIO B;  1LFD A;  2K9X A;  3KYC D;  1MFW A;  2C5L C;  4NNJ B;  2KTF A;  2I2Y A;  2KVR A;  3HK0 A;  3IFW B;  2WS3 B;  4WJN A;  4DQO C;  4LNN A;  4RNA A;  3L17 A;  2KDE B;  4ACF A;  3VFK A;  3TMP B;  1CMX B;  2MEK A;  4JE3 B;  1OTR B;  2M0A A;  3GZN I;  1ZP0 B;  4IKG A;  1WGK A;  3SFD B;  4F7Z A;  2K5P A;  2ZW1 A;  2EKE C;  2VZK B;  1XCT L;  1QOF A;  2BWE S;  3HRD D;  2BB6 A;  4ZRK A;  5KHO A;  4CO7 A;  1FD6 A;  5LXI B;  2QHO A;  2L05 A;  3TJP A;  1C4A A;  4FHK A;  2K1F A;  3NS8 A;  2K6Q A;  2JSV X;  5EE9 A;  4KKI A;  4EZL A;  2KVZ A;  5HFY A;  1L2N A;  4YSZ B;  4DDG D;  1SJE D;  3R7Q A;  2YEP F;  1OEY J;  2MJD A;  1V2Y A;  1V1O A;  2OJR A;  1K52 A;  2K6D B;  2NPT A;  4N9F 4;  4D2K A;  4YT0 B;  2V9H A;  4C4V B;  1J7A A;  3IT6 B;  3LDZ E;  4YSX B;  1FNU A;  2IGG A;  2WXQ A;  4ZRP A;  4G11 A;  3BK2 A;  1XLO A;  1FXA A;  3QCA A;  4NAW B;  5LNK 1;  2G1E A;  5J2R A;  2WLB A;  1D5X C;  4W9K A;  5FR3 A;  2MSE D;  1Q1O A;  4XDD A;  3NZ3 A;  4MJS A;  3ZXR A;  2MBQ A;  3DWM A;  2WDQ B;  4GLS C;  2N1W A;  3N30 A;  1WJN A;  2BS3 B;  5D2M B;  3UF8 A;  2KLG A;  2LXC A;  3VUW A;  5FK9 C;  2DZM A;  1F2R I;  1ZXI A;  2XK5 A;  2ZEQ A;  3TEX A;  3NVY A;  2MWS B;  4KGR A;  4K7U A;  2KFJ A;  3AI5 A;  1WFY A;  2GB1 A;  2N7D A;  5FR6 A;  1FCL A;  3ZUN A;  5GMV A;  4L1B A;  2WDT B;  3V60 A;  3P4R B;  1JWM D;  4O1N A;  3AEA B;  3DBL B;  3AE4 B;  1ZW7 A;  1HXY D;  1UZX B;  3ZQ4 A;  2KJR A;  1R4N B;  2MA9 B;  5TR5 A;  4TMA B;  4YSY B;  4NZL B;  5D3I B;  4WJO A;  4DHJ B;  5E6N A;  1SE4 A;  4KGT A;  4MSQ B;  4US9 A;  2J53 A;  3UIN B;  3ZYY X;  1XO3 A;  3Q3N C;  3DBR B;  4FUL A;  1VRA B;  1V8C A;  1WH3 A;  2DYM A;  2WXN A;  1IPG A;  2UYZ B;  1RLF A;  3TBL D;  2NBW B;  2UWQ A;  1XXG A;  3PTF C;  2LGY A;  3W1S A;  3GOE A;  3K9P B;  2KQS A;  4GDL B;  1ESF A;  2J4X A;  2CJO A;  2IGH A;  1WF9 A;  1SGH A;  4R3D A;  4P1C C;  3NVZ A;  4FJY A;  1LO5 D;  4OHJ A;  1F0Z A;  1N60 A;  2BKR B;  4QAY A;  4ANU A;  5HG2 A;  3RNB C;  1OQY A;  2LVO A;  2V4L A;  4W9G A;  4LTU A;  2L8J A;  3U52 E;  1NEN B;  2PTL A;  2IPK D;  2KTR B;  4MGY E;  4MDK E;  1GC6 A;  1TY2 A;  1SIF A;  1Y8R C;  2GOW A;  1WM2 A;  1XQQ A;  4TQ0 A;  2V0G A;  2FID A;  1C76 A;  2KAJ A;  3BY4 B;  3PRP B;  3AB5 A;  1L4Z B;  3IBE A;  2XEW A;  5LXH A;  1F9J A;  3Q3F A;  2KX3 A;  4GN1 A;  2CHX A;  5EE0 A;  1FM0 D;  3CST A;  2KQ7 A;  3P1M A;  5LLI A;  1KLG D;  2KAC A;  3UIP B;  2KJ6 A;  3BZD B;  1MI0 A;  3VUY A;  1C1Y B;  1GPX A;  5G55 A;  2JQR B;  3DDC B;  2OJW A;  4E71 A;  3W9C B;  3V61 A;  4BKT A;  1E0Z A;  2PVO D;  4WAA A;  5IN7 A;  2O2V B;  4B6W A;  4WWM A;  1VLB A;  4KIK B;  3WAP A;  1GC7 A;  3VTU A;  4EOY A;  1V97 A;  4M00 A;  1WJU A;  3R8B A;  3BYT B;  3DVN V;  4HXD A;  3LYY A;  3R2T A;  4ARC A;  2KX0 A;  4AWJ A;  3EUB 2;  5BMH A;  3IXS A;  2FAZ A;  1WX7 A;  3P42 A;  3PPA A;  2FUH B;  4DXF A;  1QIL A;  3CIR B;  3RUI B;  1ZPS A;  1VJK A;  2PKO A;  3VH3 B;  1YJJ A;  2RD0 A;  1VZ8 A;  1B1Z A;  3MC8 A;  4ANX A;  2EMT A;  1Q0W B;  2KN5 A;  2J42 A;  3ZKJ C;  3ALB A;  3BII D;  1QLB B;  4W9C A;  3JSV B;  2SEB D;  3B9J A;  4WWN A;  5KHQ A;  1WY8 A;  3A9K B;  1MG4 A;  2DAJ A;  1ENF A;  2A5U A;  2K8B A;  2PEA A;  2JX5 A;  4LCD E;  1T6B X;  2N9P C;  2RDB C;  3HVZ A;  1GNU A;  3E9S A;  1P3Q U;  1WYW B;  2KWV B;  2QMT A;  2NR2 A;  1F77 A;  1ISN A;  4IDI A;  4HCP B;  1PUT A;  5BMI A;  2D3A A;  3N1X C;  1X1M A;  1TS2 A;  3P2B A;  4AQ7 A;  3BIN A;  1YJI A;  2DAF A;  2D3C A;  4M0W B;  2BBC A;  3A1Q A;  3DWG C;  3W1Y A;  2XBB C;  3Q6B A;  4F8C B;  4OVU A;  1T5X D;  3DHH C;  1YN4 A;  2PIA A;  1FRD A;  3PS6 A;  2YEP B;  3PLU A;  2C7N B;  1JQ4 A;  4YXD B;  3L4P A;  2K3U A;  1I42 A;  4PT5 A;  3AV8 A;  2FCS A;  3JVZ X;  3QA8 A;  1ZDV A;  3ZJV A;  4TSS A;  3K9O B;  2LJ5 A;  4AOF A;  4ZDV A;  1N63 A;  3VR9 B;  1TKE A;  1JAL A;  4KX6 B;  2KK8 A;  5AUK A;  2KJH B;  2KWC A;  4MSM B;  5HKH A;  1KLU D;  2K8C A;  2L32 A;  1G6J A;  2KAN A;  4XE0 A;  2O6V A;  1DYQ A;  2J0M A;  2LRU A;  4YTP B;  4LDT D;  4S0R A;  4YL8 A;  2JT4 B;  2FCQ A;  4W9F A;  1QOB A;  2GBK A;  3VTW A;  3H9D A;  3KW5 B;  2LXA A;  4MEL A;  4GU2 A;  5AZG A;  3TCA A;  1TT5 B;  2W3R A;  2PE9 A;  2JWZ A;  1N61 A;  3MC9 A;  1NVI D;  2EMS A;  4PYZ A;  4ZYN A;  3V05 A;  2MBH A;  2W9N A;  4DXG A;  1WGD A;  2IY0 B;  1HTO A;  1WMH B;  1FIQ A;  2DYB A;  3AEG B;  2ACZ B;  4K3B A;  1N62 A;  3BVG A;  2JXT A;  3T9L A;  4DK5 A;  2GBN A;  2LGS A;  3U30 A;  2L76 A;  2FCN A;  2D11 A;  4KVG B;  5C2T B;  4ICU A;  2INP E;  2JUO A;  3TEY A;  4TQ1 A;  4X57 B;  1LGR A;  1V1P A;  4M8N A;  4JWU C;  2N9L A;  1WIA A;  3EC8 A;  4RMA A;  3A4S C;  2OED A;  2MBO A;  1FFU A;  4YTN B;  4P1B C;  1I4Q A;  3B1L X;  2E3T A;  3ZDT A;  4HWI B;  5C23 A;  2PMV A;  2PPH A;  1TZ1 A;  3ETR A;  2JZP A;  2L83 A;  1NI2 A;  2LUM A;  1BT0 A;  5D3D A;  4N58 A;  3URY A;  2N0S B;  2RGF A;  3MHS D;  2QIE B;  5FKA C;  3R7R A;  3KWL A;  1TS5 A;  2MBB B;  4ZRQ A;  4EZJ A;  4A8X C;  4AJW A;  4C7Z A;  3DBS A;  4TUU A;  4HLE A;  1D3Z A;  1Q10 A;  1WXM A;  1NYR A;  4ICV A;  1IP9 A;  2LGX A;  3AU5 A;  2CR5 A;  1L0Y B;  2ONQ A;  3R3M A;  2HE7 A;  4GXB A;  3N3K B;  2ZNV B;  3A9J B;  2M8S A;  1IBX B;  2DZK A;  3DOW A;  3GS2 A;  1Q5W B;  2C7H A;  1EU4 A;  1EUV B;  1WX8 A;  3QC8 B;  1F52 A;  1KTK A;  1C77 A;  1HE8 A;  2JYT A;  2G3Q B;  4HKZ E;  3RNG C;  3VUX A;  5BYS A;  2Z0E B;  2BYF A;  1ACC A;  2KLC A;  2DBY A;  2KFK B;  4DHJ D;  1NDD A;  2ZZP B;  2GI9 A;  1PFD A;  1FRR A;  2PJH A;  1JWB D;  3H7P A;  4HDO A;  2IYD B;  2JRH A;  1E8W A;  5IA7 A;  3RNF C;  3AE2 B;  3ABV B;  3RD2 A;  1WM3 A;  4ZHP A;  1U4A A;  2AWT A;  4OVV A;  3NVV A;  1TTN A;  2YVC A;  4AS1 A;  2JF5 A;  2QDF A;  1N6Z A;  1VDV A;  4A20 A;  1TZO A;  4KSK C;  3ZNZ B;  2NPT B;  1BML C;  4USA A;  1BUI C;  1WI0 A;  3WAO A;  4C00 A;  4F1S A;  1I4G A;  1AW7 A;  2QCZ A;  2BPS A;  4US8 A;  4JX1 C;  1E9M A;  3HM3 A;  5JXV A;  4JLC A;  3VHT C;  1E8Z A;  4PK1 A;  3ZVV A;  3NZS A;  2Y3A A;  3DCG A;  2H89 B;  2IGD A;  1V9J A;  1I4P A;  4WWO A;  4BZA A;  3EA6 A;  2JVC A;  1Z5S B;  2AEH A;  1YMH E;  2WXK A;  4BKS D;  2Y5P A;  2PW9 A;  2YLM A;  2IBI B;  2Z59 B;  1KLV A;  3ECI A;  1YN3 A;  1VZ7 A;  1P7E A;  1JRP A;  2WP9 B;  4IW0 A;  1T0S C;  3DPD A;  2J52 A;  5G2N A;  2BS4 B;  4I6N B;  3MJW A;  2V3S A;  5C1Z A;  3O13 A;  2DLB A;  1D5M C;  4NJC A;  3HIZ A;  2WXH A;  1J7C A;  1P1A A;  4G3X B;  1I35 A;  1XLN A;  3Q2A C;  1NEK B;  2KQ4 X;  5DPR A;  2G4D B;  3UQA A;  2NTT A;  3AE6 B;  3GZN B;  3IVF A;  4LJO B;  1TIF A;  3BWU D;  4BBN C;  2LVP A;  3SR6 A;  5CHF A;  1N5X A;  2R2Q A;  2REX A;  4NY0 A;  2RPV A;  4NJ6 A;  1HEZ E;  3T3O A;  3SFE B;  1WE7 A;  2UU7 A;  4NAW A;  2MH7 A;  3KVF B;  2QJL A;  4FBJ B;  3U2S C;  5L83 A;  3FC4 A;  3RCZ A;  4RGO S;  5DPT A;  4YWG G;  4HRS A;  1V5O A;  4MM3 B;  2NTS A;  4IWO A;  4NPN A;  5D94 A;  3RPF C;  5J18 A;  1S3S G;  2KC1 A;  1KFY B;  2FCM A;  4NQL B;  1KH0 A;  4N6E B;  4PS7 A;  4KGS A;  1H8C A;  2VRR B;  3AE8 B;  4P16 A;  3RNC C;  2M56 B;  1RAX A;  5E6O A;  1E10 A;  2N9K A;  3OG5 A;  3NZU A;  2WDR B;  3NUH B;  2KOX A;  1DOX A;  3WAL A;  1GJZ A;  3P4S B;  3H6N A;  5CX3 A;  3PLV A;  3V3X A;  3H7S A;  1E5W A;  3IT4 B;  4C80 A;  2C60 A;  2KT7 A;  1QF6 A;  4ZOH C;  2FIF A;  1SF0 A;  4A90 A;  2VH2 A;  1D5Z C;  3AE3 B;  2L0T A;  2G9H D;  5IAA C;  4NJ7 A;  1EM7 A;  2QSD A;  1ZXH A;  3QK0 A;  3DBH I;  2LI5 A;  1HZ6 A;  3VTV A;  4URK A;  3QAQ A;  1VR9 A;  1C79 A;  3BVM A;  1PGX A;  1TS4 A;  2JXX A;  3SDL C;  2LZ6 A;  3OLM D;  2AQ1 B;  1WX9 A;  3DHI C;  1WGH A;  4HCN B;  2BVC A;  3RZF A;  2QEJ C;  2JRI B;  1QQR A;  1I7H A;  2IY1 B;  3N1Z C;  3IHP C;  3DVG X;  1LM8 B;  1RYJ A;  3FIL B;  4KDI C;  1GAQ B;  4GDL A;  1FO4 A;  1R4M I;  1L6U A;  3U7Z A;  2W82 A;  3CF6 E;  2W3S A;  1C9F A;  2AQ2 B;  2XNA C;  3P4P B;  1MPE A;  2JZ3 B;  3ZRF A;  5BYQ A;  2A4Z A;  2N7J A;  5AUI A;  3AE9 B;  3A33 B;  2MBE A;  3TSS A;  4AP4 C;  2DZJ A;  3T3N A;  1YJ1 A;  2LMC A;  3KWV A;  1MG8 A;  4A9A A;  1EWY C;  4WQM A;  3ZJU A;  1P9D U;  1YD8 U;  5MPO A;  1C78 A;  3I9V 1;  2K39 A;  2MX2 A;  1V5T A;  1ROE A;  4LNI A;  3MJ5 A;  3RMK C;  3N9Y C;  4BFR A;  2RDH A;  2AL3 A;  3AH7 A;  3KYD D;  2OOB B;  3UQB A;  4K7W A;  3DBH B;  2AYO B;  2KDF B;  1TJE A;  3EHV A;  2K8H A;  3Q8A A;  1JRU A;  3KUC B;  1ZDX A;  4ANV A;  2NCN A;  1H4R A;  2V1Y A;  1QT9 A;  4HJK A;  3SEB A;  4RGT A;  3AED B;  1QKZ A;  4GDK A;  4WIP A;  2RR9 A;  3IG3 A;  1FNW A;  2BYV E;  3MTN B;  1V6E A;  1NYQ A;  3H1U A;  4W9L A;  5EE3 A;  3BYY B;  4KIK A;  3VRA B;  1B9R A;  2Y5C A;  1Z2M A;  3J9C A;  2KWU B;  3BK1 A;  3ZNH B;  2KC2 A;  2G4S A;  1VZ6 A;  2CU3 A;  1C3T A;  3OAW A;  4XYC A;  2GBM A;  3A1Q B;  2JZZ A;  1FXT B;  1JRO A;  4AUQ C;  3L0W B;  4ASW C;  4A3P A;  2IJ0 A;  3C0R B;  1XLQ A;  4GB9 A;  2IO2 B;  4BKG A;  1YOV B;  2I38 A;  3WCQ A;  2KN4 A;  4XZ4 A;  1TKY A;  4WQO B;  1JWA D;  5HHD G;  3WIM A;  1VD2 A;  1AAR A;  1R7S A;  3AXC A;  1WGR A;  2MW5 A;  2BT6 A;  1WYG A;  1TGZ B;  4II3 B;  4HVB A;  3AEB B;  3NG0 A;  2LGI A;  3PGE A;  3JSV A;  4K7S A;  4IUM B;  1MHH E;  4W9H A;  4RFB A;  5EDS A;  3IAM 1;  1E7P B;  1A70 A;  2JY6 A;  3NOB A;  1RWS A;  3KQ4 A;  1V81 A;  3CMM B;  2O6V B;  4FLH A;  1WR6 E;  4LNK A;  3V62 A;  2GLS A;  2KDB A;  2X38 A;  3M62 B;  5BYR A;  2RDG A;  4KZ0 A;  4XWT A;  5D6J B;  2ICI A;  2MP2 B;  3N32 A;  2BWF A;  1XEE A;  4K1R B;  3ZXV A;  4FA6 A;  4M0W A;  2V3P A;  4WUR A;  1CK1 A;  1HQR D;  3ZIM A;  5L95 C;  5AEK B;  3APD A;  2VH1 A;  1GOZ A;  4EE2 A;  3RZW C;  4KSL C;  3ZGZ A;  5J17 A;  4YTM B;  1SXT A;  4HPM B;  1FXI A;  4DXA B;  3QWZ B;  1ET9 A;  3TEZ A;  3AN1 A;  1OGW A;  2KWD A;  3I5J C;  1FPY A;  4RGM A;  3C8Y A;  1A5R A;  2L0F A;  2CHW A;  3CWI A;  1V1P B;  4HEA 1;  4J6I A;  1UUP A;  1K53 A;  3MC0 B;  1WGG A;  2BS2 B;  3RUL A;  4ITK A;  1L5P A;  4KV2 A;  3O65 B;  1E6E B;  4LK0 M;  2X8X X;  5CHW A;  1UBQ A;  1XT9 B;  1WXV A;  4IC7 B;  2WDV B;  2TSS A;  5I4D A;  2K25 A;  3NY5 A;  3HM6 X;  4MGK E;  3FAH A;  5E6P A;  4BOZ B;  2WXI A;  4DHZ B;  1OQQ A;  2AX5 A;  3VR8 B;  2N9X A;  3WA0 A;  3U7D A;  4AJY B;  1WE6 A;  3T8M A;  2R61 A;  3C19 A;  2WXM A;  2DHZ A;  1ZGU B;  4M02 A;  1RFK A;  2I1J A;  4OVZ A;  2M0X A;  1PYW D;  3U4E G;  5JHA A;  4L23 A;  1WMH A;  2LEK A;  1FEH A;  4LLG M;  2HD5 B;  3GE3 C;  1SIJ A;  4MT5 A;  4RM8 A;  2NVU I;  1WZ3 A;  4B0M A;  3PZ8 A;  3OJ3 A;  1RM6 C;  1FMA D;  2M19 A;  5JHB A;  4RGN A;  2WXR A;  1CJE A;  3L54 A;  1J19 A;  4WWP A;  2QC8 A;  4E74 A;  5BO4 B;  4DHZ E;  1YX5 B;  5H8Y E;  3HVD A;  4M8M A;  5HI1 A;  3NJT A;  3PRE A;  1UWX A;  3Q8B A;  3GP7 A;  2L3Z A;  3M95 A;  2CS4 A;  4RM9 A;  2ZCC A;  3Q3O C;  2DNF A;  1F2R C;  2Q5W D;  1YQ4 B;  2ZJD A;  3ZTC A;  1K50 A;  1JWU D;  4ZHO A;  3U8Z A;  3NRZ A;  2GMI C;  2IND C;  4B95 A;  1RRB A;  1XCQ L;  1L6V A;  1M94 A;  2FUG 1;  4EZK A;  1MJD A;  4ARI A;  3APF A;  1T0R C;  3AU4 A;  4K81 A;  2INC C;  1GUA B;  4Q2J A;  1LXD A;  3KH0 A;  2JU6 X;  4G50 A;  4TV3 A;  2MHJ A;  5G5H A;  4IOI E;  2B3A A;  2CJN A;  1YQ3 B;  4ZYS A;  1SEB D;  2WX1 A;  3M3J A;  1WXQ A;  3A9J A;  1IBX A;  4N59 A;  4BBN F;  2WNM A;  3RYT A;  3Q8C A;  4FJV B;  3ML8 A;  3Q14 C;  2OHF A;  4B0E A;  3QIJ A;  1E7U A;  2WHI A;  2H88 B;  3PV1 A;  2HDE A;  3NVW A;  4M01 A;  2LJI A;  4W9J A;  3EGR A;  2ZW0 A;  3LB8 C;  3DVN U;  5JH5 C;  3JYU A;  3Q8F A;  4JQW C;  1TYG B;  2KFK A;  3HUI A;  4ZRI A;  4MJS B;  5AZF A;  1XD3 B;  3VAW A;  1E90 A;  3DBL I;  2KO3 A;  1T0Q C;  4I6L B;  3ZRC A;  5TSS A;  2KKC A;  3PSE B;  1MVK A;  1R4N I;  4HDQ A;  2Z8L A;  2JYE A;  2LFI A;  3SHQ A;  4BAX A;  4C56 C;  3JW0 X;  2WXF A;  4KZC A;  3ZTD A;  3P4Q B;  4FHJ A;  2FNJ B;  2XK5 B;  2IDY A;  2BQQ A;  3RNE C;  1IYF A;  3B2F A;  2DWQ A;  3DBR I;  2G45 B;  1K8R B;  3N20 C;  2NS5 A;  1TS3 A;  1ET6 A;  2MQJ A;  2NBU A;  1QOA A;  2Y5B B;  1MHX A;  4P7I A;  4W9I A;  4MAC A;  4IG7 B;  1D4B A;  2KMM A;  2KDI A; 
#chains in the Genus database with same CATH homology
 3ZRF A;  4IM0 A;  2A4Z A;  2IO1 B;  3PLU A;  5D7G A;  2C7N B;  1QZE A;  4IWQ A;  1V49 A;  2BYE A;  3A33 B;  3PRZ A;  2MBE A;  4AP4 C;  2DZJ A;  1YJ1 A;  2WWZ A;  4PYU A;  1MG8 A;  1EO6 A;  1I42 A;  4BOS C;  1P9D U;  1YD8 U;  2FCS A;  3JVZ X;  3QA8 A;  4FN2 A;  3WAM A;  3K9O B;  3M63 B;  2LJ5 A;  3B0A A;  4AOF A;  2K39 A;  2MX2 A;  4ZDV A;  1LQB A;  3L13 A;  3H7P B;  1V5T A;  4DWF A;  2J0J A;  2KK8 A;  3D32 A;  2BGF A;  2KHW B;  4BFR A;  2IO3 B;  2KJH B;  3Q3J A;  2KWC A;  4MGI E;  4MSM B;  2AL3 A;  2DX5 B;  5HKH A;  2K8C A;  3KYD D;  2OOB B;  4LDT B;  3UQB A;  4K7W A;  3QQ8 B;  1KM7 A;  2AYO B;  2KDF B;  1WRD B;  2LAS A;  3HHM A;  2KAN A;  3QX1 A;  1G6J A;  2O6V A;  3QJZ A;  1S1Q B;  2I1K A;  2J0M A;  2LRU A;  2RSU A;  4CHK A;  1L7Y A;  4LDT D;  3EHV A;  4YL8 A;  2JT4 B;  2K8H A;  2FCQ A;  4W9F A;  2GBK A;  3B08 A;  2MRP A;  4I6P A;  2CU1 A;  3VTW A;  3H9D A;  3KW5 B;  1JRU A;  4JIO U;  5AZH A;  3NHE B;  4GGQ A;  2LXA A;  3VXW A;  4MEL A;  1UBI A;  3KUC B;  1WJ6 A;  4GU2 A;  5AZG A;  1WXS A;  1KJT A;  4ANV A;  3TCA A;  4IM2 A;  2GBJ A;  3L16 A;  4DBG A;  2N4F A;  2KD0 A;  2NCN A;  2PE9 A;  1H4R A;  2V1Y A;  2L00 B;  3ZNG C;  3APC A;  4B9K A;  4DDI D;  4EFO A;  2L7R A;  4HJK A;  2JWZ A;  5DPS A;  3UIO B;  1LFD A;  3KYC D;  2C5L C;  4GDK A;  4NNJ B;  4MEM A;  2KTF A;  2RR9 A;  3IG3 A;  2EMS A;  4PYZ A;  4ZYN A;  1P98 A;  2KVR A;  2BYV E;  2MBH A;  2W9N A;  1V6E A;  3HK0 A;  3IFW B;  3MTN B;  1WGD A;  2IY0 B;  3H1U A;  4WJN A;  4W9L A;  3QAR A;  1WMH B;  4NQK E;  3L17 A;  2KDE B;  3VFK A;  2D07 B;  4KIK A;  3TMP B;  2DYB A;  4EEW A;  1J8C A;  1CMX B;  3T9L A;  4DK5 A;  1Z2M A;  2GBN A;  3TIX A;  2KWU B;  1OTR B;  3U30 A;  2GBR A;  3ZNH B;  2L76 A;  2FCN A;  3GZN I;  1GG3 A;  2D11 A;  2KC2 A;  2G4S A;  4KVG B;  2C9W B;  4F7Z A;  4ANW A;  2EKE C;  4ICU A;  1UGM A;  1C3T A;  3TL5 A;  2JUO A;  3OAW A;  2GBM A;  3A1Q B;  1OEY A;  4MM3 A;  4TQ1 A;  4X57 B;  2JZZ A;  4FAD A;  2BWE S;  4JGH B;  1FXT B;  4ZRK A;  4M8N A;  5KHO A;  4AUQ C;  4CO7 A;  2PE6 B;  3L0W B;  5LXI B;  4ASW C;  2QHO A;  2L05 A;  3TJP A;  4A3P A;  1WIA A;  4FHK A;  2K1F A;  3EC8 A;  3C0R B;  3NS8 A;  4KDL B;  4RMA A;  2K6Q A;  1YIW A;  2NBV B;  3A4S C;  2IO2 B;  4GB9 A;  4BKG A;  4E3C A;  2MBO A;  2J7Q B;  2HTH A;  3ENE A;  4TKN A;  4WQO B;  4XZ4 A;  4EZL A;  1ZKH A;  3WIM A;  2ZVO A;  1RFA A;  2LVQ A;  1L2N A;  3B1L X;  1VD2 A;  3EFU A;  4XC2 A;  1AAR A;  4DDG D;  3AXC A;  3ZDT A;  3R7Q A;  4HWI B;  1WGR A;  2N9E B;  1OEY J;  5C23 A;  2MW5 A;  1TGZ B;  2PPH A;  1V2Y A;  4II3 B;  1TZ1 A;  4HVB A;  2OJR A;  2K6D B;  2NPT A;  4N9F 4;  1NI2 A;  3JSV A;  3PGE A;  4IUM B;  1BT0 A;  4K7S A;  2M1M A;  3ZNI D;  3DVG Y;  4GIV A;  3L10 B;  2D10 A;  3LDZ E;  2RGF A;  4W9H A;  3MHS D;  3VQI A;  5EDS A;  3R7R A;  4G11 A;  2JY6 A;  2MBB B;  3NOB A;  3A4R A;  3QCA A;  4NAW B;  4EZJ A;  1UH6 A;  2KXJ A;  1V81 A;  5J2R A;  3CMM B;  4W9D A;  4AJW A;  3DBS A;  2O6V B;  4FLH A;  4TUU A;  4W9K A;  4HLE A;  1WR6 E;  2MSE D;  1Q1O A;  2DZI A;  3R66 C;  4MJS A;  3V62 A;  2MBQ A;  2KDB A;  4BKS A;  1D3Z A;  3VH4 B;  2O6V D;  3M62 B;  2N1W A;  1WXM A;  3N30 A;  4KZ0 A;  1WJN A;  4ICV A;  1IP9 A;  5D6J B;  2LGX A;  2MP2 B;  2N7E A;  3N32 A;  4MH0 E;  5D2M B;  3UF8 A;  2KTR A;  2KLG A;  2BWF A;  2KNB A;  3AU5 A;  1EF1 A;  2LXC A;  2CR5 A;  3VUW A;  3R3M A;  4K1R B;  2HE7 A;  4GXB A;  3N3K B;  2DZM A;  4FA6 A;  2ZNV B;  2KMC A;  2XK5 A;  3KUZ A;  3A9J B;  4MGZ E;  3PHW B;  2ZEQ A;  4GDK B;  2M8S A;  5CHV C;  2MWS B;  2DZK A;  3DOW A;  1Q5W B;  2D3G A;  2LUE A;  3ZIM A;  5AEK B;  5L95 C;  2C7H A;  3APD A;  4K7U A;  2KFJ A;  3ZO5 B;  2DYO A;  3AI5 A;  1WFY A;  2N7D A;  5FR6 A;  1EUV B;  1WX8 A;  3QC8 B;  5GMV A;  3ZUN A;  2WDT B;  3V60 A;  1HE8 A;  4G0N B;  3RZW C;  4KSL C;  5J17 A;  4HPM B;  2G3Q B;  3UGB B;  3X23 A;  4LJP B;  1ZW7 A;  1UZX B;  4DXA B;  2KJR A;  2MA9 B;  5TR5 A;  3VUX A;  3PVL A;  2ZPN A;  3L08 A;  3QWZ B;  2M17 A;  4WJO A;  4DHJ B;  1OGW A;  5E6N A;  2Z0E B;  2BYF A;  4GOC A;  2O2V A;  4MSQ B;  2KLC A;  1WJ4 A;  2KFK B;  2L0F A;  3V6C B;  2CHW A;  3ML9 A;  3UIN B;  1NDD A;  4DHJ D;  2ZZP B;  4J6I A;  1WR1 A;  1TBE A;  4FUL A;  2PJH A;  1SE9 A;  4BVU C;  1WGG A;  1WH3 A;  2DYM A;  3H7P A;  4HDO A;  3RUL A;  2IYD B;  2JRH A;  1E8W A;  4II2 B;  1IPG A;  2CHZ A;  3O65 B;  4KV2 A;  2UYZ B;  5IA7 A;  1RLF A;  5CHW A;  1E8X A;  3TBL D;  2NBW B;  3RD2 A;  1P0R A;  1UBQ A;  1WM3 A;  1XT9 B;  2UWQ A;  3PZD A;  1U4A A;  2AWT A;  3ZDM C;  2LRW A;  3PTF C;  2LGY A;  4OVV A;  1WXV A;  1TTN A;  4IC7 B;  3W1S A;  2YVC A;  2JF5 A;  1J0G A;  3GOE A;  3K9P B;  4A20 A;  2KQS A;  2K25 A;  2ZNV C;  4GDL B;  4KSK C;  3ZNZ B;  3NY5 A;  4WJP A;  2NPT B;  3HM6 X;  4MGK E;  1WI0 A;  5E6P A;  3WAO A;  4BOZ B;  1WF9 A;  2IO0 B;  4F1S A;  2AL6 A;  2LGD A;  1SGH A;  4DHZ B;  3ONS A;  2BPS A;  4EKU A;  1A5R A;  3HM3 A;  4JLC A;  4FJY A;  2N9X A;  3WA0 A;  3U7D A;  3VHT C;  4AJY B;  1E8Z A;  1WE6 A;  2BKF A;  3T8M A;  2CKH B;  3ZW3 A;  2BKR B;  2DHZ A;  5DCN A;  1ZGU B;  3ZVV A;  3OJ4 B;  4ANU A;  2JPH A;  2I1J A;  2M0X A;  1OQY A;  1WXA A;  3NZS A;  5JHA A;  2LVO A;  2V4L A;  2Z0D B;  3DCG A;  4W9G A;  1WMH A;  2R2O A;  2L8J A;  1V9J A;  4WWO A;  2KMA A;  2JVC A;  1Z5S B;  2AEH A;  2HD5 B;  1V80 A;  4BKS D;  2N1V A;  3A9K A;  2YLM A;  4RM8 A;  2NVU I;  2KTR B;  4MGY E;  4MDK E;  3VDZ A;  1GC6 A;  2IBI B;  1WZ3 A;  5JZE B;  2Z59 B;  1SIF A;  3DQV A;  1KLV A;  1Y8R C;  2GOW A;  1WM2 A;  1XQQ A;  3ECI A;  3OJ3 A;  4TQ0 A;  2FID A;  4GSW A;  3BY4 B;  3PRP B;  5JHB A;  3IBE A;  2XEW A;  4IW0 A;  5LXH A;  3DPD A;  1F9J A;  2MLB A;  3Q3F A;  5G2N A;  2KX3 A;  4GN1 A;  4I6N B;  2CHX A;  2V3S A;  3L54 A;  3MJW A;  3CST A;  2KQ7 A;  5LLI A;  5C1Z A;  1J19 A;  4HK2 A;  4WWP A;  3UIP B;  3HIZ A;  4G3X B;  1P1A A;  1I35 A;  3PT2 B;  4E74 A;  5BO4 B;  4DHZ E;  2KJ6 A;  1NBF C;  1YX5 B;  4M8M A;  3VUY A;  5DPR A;  2G4D B;  3EEC A;  1C1Y B;  3PRE A;  4PS3 A;  3UQA A;  5G55 A;  3IVF A;  1E7V A;  3DDC B;  4LJO B;  2L3Z A;  3M95 A;  4E71 A;  4EUT A;  2CS4 A;  4RM9 A;  3V61 A;  2ZCC A;  4BKT A;  4WAA A;  2O2V B;  1E8Y A;  1UEL A;  4B6W A;  1WZ0 A;  4BBN C;  2WYQ A;  4W9E A;  2LVP A;  5CHF A;  2R2Q A;  2REX A;  4NY0 A;  2ZJD A;  4NJ6 A;  3ZTC A;  4KIK B;  3WAP A;  1YQB A;  4WJQ A;  1GC7 A;  3VTU A;  4EOY A;  2KZR A;  1WE7 A;  3U8Z A;  1WJU A;  2KDI A;  2GMI C;  4NAW A;  3ZLZ A;  3LJ3 A;  4B95 A;  1RRB A;  3S2A A;  3KVF B;  3DVN V;  1M94 A;  4HXD A;  4EZK A;  4FBJ B;  2KX0 A;  3APF A;  4AWJ A;  5L83 A;  3RCZ A;  3AU4 A;  5DPT A;  2ASQ A;  1YX6 B;  4K81 A;  3AUL A;  2DEN B;  2C7M B;  4GMV A;  1V5O A;  1GUA B;  2FAZ A;  2LD9 A;  1WX7 A;  3PPA A;  4IWO A;  4NPN A;  5D94 A;  1LXD A;  3KH0 A;  5J18 A;  2FUH B;  1S3S G;  2KC1 A;  4G50 A;  2FCM A;  4TV3 A;  4NQL B;  4PS7 A;  2B3A A;  4JL9 A;  3RT3 B;  2MP2 A;  3RUI B;  3X0W A;  1H8C A;  2VRR B;  1UD7 A;  3VH3 B;  2WX0 A;  2WX1 A;  1RAX A;  2RD0 A;  3M3J A;  5E6O A;  2HJ8 A;  3A9J A;  4ZRJ A;  5DPW A;  4A3O A;  3I3T B;  3NZU A;  4ANX A;  2EMT A;  1Q0W B;  2KN5 A;  4BBN F;  3RYT A;  2KOX A;  3WAL A;  1GJZ A;  3ZKJ C;  2LWP A;  3ALB A;  4FJV B;  3ML8 A;  3CSF A;  4CYE A;  3H6N A;  5CX3 A;  3PLV A;  3H7S A;  1E5W A;  3WAN A;  2C60 A;  4W9C A;  3JSV B;  3QIJ A;  1E7U A;  2FIF A;  1VCB A;  4WWN A;  5KHQ A;  1WGY A;  1WY8 A;  3A9K B;  3PV1 A;  4IWP A;  1PQS A;  2DAJ A;  2L0T A;  5IAA C;  2A5U A;  2K8B A;  4NJ7 A;  4W9J A;  2PEA A;  2RPQ A;  3QK0 A;  3DBH I;  4LCD E;  1KOT A;  2LI5 A;  2N9P C;  3DVN U;  1EF5 A;  2ZCB A;  3VTV A;  4URK A;  5JH5 C;  3JYU A;  3QAQ A;  1GNU A;  4JQW C;  1P3Q U;  1WYW B;  2KFK A;  2KWV B;  2JXX A;  4FJZ A;  4ZRI A;  2D2Q A;  3SDL C;  2LZ6 A;  2NR2 A;  3OLM D;  4MJS B;  1ISN A;  5AZF A;  1XD3 B;  3VAW A;  1WX9 A;  1T0Y A;  2BF8 B;  1E90 A;  2ZPY A;  1WGH A;  4HCN B;  2IZV B;  2KO3 A;  3DBL I;  4HCP B;  4I6L B;  3RZF A;  3W1S C;  3ZRC A;  2JRI B;  2KKC A;  3PSE B;  1R4N I;  1X1M A;  4IM3 A;  2IY1 B;  2ZVN A;  3P2B A;  4HDQ A;  2MCN B;  3BIN A;  2M4N A;  3IHP C;  4XX5 A;  3SHQ A;  3DVG X;  2DAF A;  3VVW B;  3JW0 X;  1V86 A;  4HPL B;  1LM8 B;  4M0W B;  4KZC A;  3ZTD A;  4FHJ A;  2FNJ B;  2XK5 B;  4KDI C;  3A1Q A;  3SU8 X;  4PS8 A;  3V6E B;  1IYF A;  4GDL A;  3SD5 A;  3PRM B;  3DBR I;  1R4M I;  2G45 B;  1K8R B;  5CTR C;  3W1Y A;  3KUD B;  2NS5 A;  2J0K A;  2XBB C;  3CF6 E;  2MQJ A;  2NBU A;  3PHX B;  4F8C B;  2Y5B B;  4P7I A;  4OVU A;  4W9I A;  3QHT A;  4IG7 B;  3PS6 A;  2JZ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...