1WJ6A

Solution structure of rsgi ruh-024, a pb1 domain in human cdna, kiaa0049
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
GSSGSSGPHSMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords KIAA0049 protein
total genus 18
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj6A01
2KD0A 1S1QB 2JUOA 1IYFA 2ZVNA 3ZLZA 2LXCA 3Q3FA 4PS3A 4DXAB 2KNBA 4GXBA 2N9XA 3N32A 1TBEA 2MSED 3A9JA 2CHWA 5JZEB 1M94A 2UWQA 3UINB 4B95A 3K9PB 3PT2B 5AZGA 5C1ZA 1WX8A 3B0AA 3PPAA 5L95C 2A4ZA 4EZLA 4ANUA 4HVBA 2N1VA 3QX1A 4ZDVA 5L83A 4KV2A 1KM7A 5D6JB 2PE6B 4F7ZA 4EZKA 1XT9B 2D11A 2ASQA 2ZNVC 1R4NI 1YX6B 2DZKA 2B3AA 4NPNA 2K39A 2LI5A 3OLMD 2N7EA 1VCBA 4KSKC 3ZVVA 2G3QB 2CHXA 3BINA 1EO6A 2G4DB 2N9EB 3DPDA 3IG3A 4MSMB 3TJPA 3WAOA 2PPHA 4IM3A 5BO4B 1OEYA 4ANWA 2RPQA 1SGHA 4WQOB 4DHJD 1WZ0A 1C3TA 2J7QB 3ZW3A 4ICUA 3B08A 4IWQA 4TUUA 3PV1A 4XC2A 3W1SA 1UELA 2AL3A 4FJVB 3QWZB 1LQBA 1Q5WB 1J19A 1WRDB 3AULA 3AU5A 1Z2MA 1GG3A 2LASA 2LRUA 3UGBB 4G11A 3HM3A 2EMSA 5DPRA 3TBLD 2RR9A 1GJZA 4TV3A 4AP4C 3A9KB 3JW0X 2D07B 2M17A 4EEWA 5JHBA 4NAWB 2FCNA 3PZDA 4GGQA 4G0NB 5EDSA 2VRRB 4K81A 3ZRCA 3VTWA 1WGHA 4NAWA 3VTVA 2C5LC 2KC2A 4AWJA 4MGZE 1ZW7A 2KQSA 4ZRJA 1E8ZA 2NVUI 4WJNA 1WH3A 3DVNV 1Q1OA 2FCQA 1WXAA 2K25A 2KDBA 2IO2B 1F9JA 2WX1A 5DPTA 2C9WB 2KTRA 3QARA 4W9GA 2KANA 2MRPA 4XZ4A 3ZNHB 4A3OA 4BBNF 3DVNU 2KMCA 5LLIA 2N1WA 1WXMA 4KSLC 2R2OA 2MBHA 3APDA 1UH6A 2KLGA 4IW0A 4FN2A 4HCNB 2J0MA 4GDKB 4YL8A 1I35A 2LGYA 2Y5BB 3H7PA 4N9F4 2ZCCA 2CR5A 2JT4B 2KFKA 4JIOU 1P1AA 2IY0B 4KIKB 2LRWA 2V1YA 3N30A 3CSFA 2DHZA 2QHOA 2I1KA 3DBLI 5DCNA 4W9KA 2NR2A 1AARA 1WR1A 2LJ5A 2LVOA 1LXDA 3M3JA 4MELA 2K6QA 1BT0A 2CS4A 3DDCB 3RYTA 1WR6E 4DHZE 2M1MA 4RM9A 3PTFC 2GOWA 4IC7B 3MHSD 2R2QA 4DBGA 1J8CA 4FADA 1LM8B 2O2VA 4JQWC 5KHQA 3B1LX 1KLVA 3DVGY 1WGRA 5FR6A 3R7RA 3ML9A 2MP2B 4HXDA 1YJ1A 2CHZA 2KDIA 3DBSA 2LUEA 3KUZA 4K1RB 3TIXA 1G6JA 4FJYA 3MJWA 2BWFA 2HJ8A 2HTHA 1KJTA 3L16A 1U4AA 4NY0A 3H6NA 2JRIB 3L0WB 3L54A 5C23A 2PE9A 3PRMB 3VH3B 1MG8A 3HIZA 1RAXA 2YLMA 4W9FA 5LXHA 2KK8A 3DOWA 3A1QB 3U30A 5CHFA 1ZKHA 2JXXA 3A9KA 4IUMB 4IM2A 4WJPA 2ZPYA 3VUYA 5IA7A 4WWOA 3OJ4B 2FIDA 1WGGA 2KX3A 3EECA 2BKRB 4GDLB 3DBRI 4F8CB 1EF1A 2DAFA 2JY6A 1WY8A 2L7RA 3HM6X 5JHAA 4GMVA 3KYCD 3PREA 3SHQA 1GUAB 4CYEA 1P0RA 2M8SA 3DVGX 2MBBB 3L13A 2FCSA 3JSVA 2RSUA 3QIJA 4AUQC 2Z59B 1H8CA 4PS8A 2PJHA 4IWOA 2V4LA 2KXJA 3WALA 4FBJB 2A5UA 2WDTB 3X23A 4M8NA 3L17A 3EHVA 3PSEB 4K7SA 4P7IA 1XQQA 2PEAA 4I6LB 1WYWB 5G2NA 4HWIB 3WAPA 1JRUA 1YX5B 3L08A 3EC8A 4BKSA 2MBEA 2C7HA 1WX7A 2O6VB 5J17A 3VFKA 2KDEB 3VDZA 2ZNVB 1V80A 3PLVA 3V61A 4MGKE 2KKCA 3PS6A 2YVCA 1C1YB 1V5OA 3ZNZB 4MM3A 2MBQA 4MEMA 4KVGB 3ZDMC 1UZXB 1D3ZA 3KUCB 3A4SC 2G45B 4AJWA 4E71A 4HPLB 2D2QA 4WAAA 2OOBB 2XEWA 3CSTA 4EKUA 1X1MA 2BYFA 2MW5A 4OVUA 2KJHB 2O6VD 4HCPB 4RM8A 2L0FA 2UYZB 2KWVB 3LJ3A 2XBBC 3EFUA 3T8MA 2W9NA 4G3XB 2GBKA 2GMIC 3R7QA 3QHTA 4DWFA 4ICVA 2DZMA 2L0TA 2NBUA 4DDGD 3ZIMA 1UBQA 3VVWB 4PYZA 3IVFA 1FXTB 4JL9A 3WIMA 1OQYA 3K9OB 3APFA 2NPTB 4FLHA 5E6OA 4TQ0A 3V6CB 4W9EA 4MDKE 3VTUA 1NBFC 3A1QA 3H7SA 1WGYA 2ZJDA 4WJQA 5GMVA 4WWPA 3HHMA 2DX5B 4MGIE 3QC8B 5AZFA 3A9JB 3ECIA 3RT3B 3IBEA 4DDID 3NOBA 3VQIA 3M62B 3SU8X 5HKHA 4IG7B 3ML8A 5LXIB 4TQ1A 4FHKA 1XD3B 2FCMA 2CKHB 2K8BA 3NZSA 4II3B 3VUWA 2D10A 1E8YA 2XK5B 2GBJA 2FAZA 3HK0A 4KZ0A 1ISNA 2DYMA 2O6VA 3UQAA 3T9LA 5DPWA 1NDDA 1E7UA 3RD2A 1WZ3A 2AYOB 3GZNI 3IHPC 3QAQA 2BPSA 4NNJB 2WYQA 2KVRA 2NBVB 4ZYNA 1YD8U 2IBIB 3QJZA 3U7DA 2KFKB 2C7NB 2GBMA 2GBRA 4HDQA 1V49A 3D32A 2KLCA 4HPMB 2J0KA 3TMPB 4PS7A 2KHWB 1VD2A 2RD0A 3NZUA 2BYEA 2DYBA 4GU2A 4HLEA 2MA9B 5TR5A 3PHWB 3DCGA 3AI5A 4HK2A 3PGEA 2MWSB 4GN1A 1V86A 2NS5A 1H4RA 4IWPA 5J2RA 2BKFA 1IPGA 1YIWA 4II2B 4KZCA 3RULA 4BBNC 4AJYB 1WXSA 4F1SA 2MLBA 2KQ7A 3W1SC 3CF6E 5IAAC 4FHJA 4W9HA 2LXAA 2MQJA 3PRPB 4EUTA 4GDKA 4GDLA 5E6PA 1SE9A 2JVCA 3RZWC 3CMMB 3SDLC 2BF8B 4KDIC 1TTNA 4MSQB 1CMXB 2BGFA 2N7DA 3VHTC 4TKNA 1V6EA 1WJNA 4BVUC 5E6NA 1E7VA 2KFJA 3M63B 1E8WA 3PLUA 1QZEA 1V9JA 2DYOA 2HD5B 2ZCBA 1RFAA 1Z5SB 2KC1A 4LDTD 3UF8A 2LVPA 2O2VB 4FA6A 1ZGUB 1E90A 3ZUNA 1S3SG 2KN5A 3M95A 3R66C 2D3GA 4NJ7A 3ZNGC 4DHZB 2WX0A 2N9PC 4K7UA 4ANVA 4HDOA 3NS8A 1WM2A 2G4SA 2L00B 4W9DA 2EKEC 2LD9A 3VAWA 1EUVB 1HE8A 2NBWB 1SIFA 3ZKJC 2KZRA 3JVZX 1KOTA 2JWZA 2IZVB 2L76A 1E5WA 3OAWA 4NQKE 3U8ZA 3ZRFA 2JZZA 1WX9A 4BFRA 2HE7A 1I42A 3PHXB 2ZPNA 4I6PA 4CO7A 2ZVOA 3TL5A 1UBIA 4M0WB 3VUXA 2K6DB 2C60A 2BWES 2MBOA 1NI2A 2NPTA 5D94A 1P3QU 2JF5A 4RMAA 3DQVA 3NHEB 3QQ8B 4AOFA 1TZ1A 2XK5A 4K7WA 3WA0A 2MX2A 2L3ZA 4GOCA 2BYVE 1A5RA 3KVFB 4MJSB 5G55A 5KHOA 4DK5A 1K8RB 3RUIB 4WJOA 1WMHB 3BY4B 4LCDE 1YQBA 2MP2A 1WFYA 2IY1B 1V2YA 5J18A 4HJKA 1V81A 2RGFA 3AU4A 3KW5B 1T0YA 4URKA 2KMAA 4GB9A 5CTRC 4A20A 3TCAA 3ZO5B 1Y8RC 1P98A 2JZ3B 3VH4B 2KDFB 3ONSA 3H9DA 4J6IA 4NJ6A 4G50A 1WGDA 1OTRB 4W9LA 2IO3B 2KTFA 2MCNB 3N3KB 2FUHB 1L2NA 3X0WA 3VXWA 1WMHA 5AZHA 4KIKA 4FULA 3SD5A 2N4FA 3ZDTA 2ZEQA 3WAMA 4W9IA 3QCAA 3KYDD 2KJ6A 3ENEA 4E74A 2K8CA 5DPSA 3QK0A 3P2BA 3ZTDA 4ASWC 1Q0WB 2GBNA 3KUDB 4LJPB 4XX5A 2LGXA 1WE6A 2CU1A 5CHVC 2I1JA 1GNUA 3MTNB 4JGHB 4FJZA 4EZJA 2KO3A 4X57B 1RLFA 2FNJB 2KOXA 4ANXA 4MH0E 3RCZA 2DENB 1WJ6A 3WANA 4B6WA 1EF5A 3APCA 3IFWB 2KWUB 4ZRIA 2Z0EB 5AEKB 1OGWA 4BKGA 1V5TA 2DZIA 4PYUA 3PRZA 1GC6A 2JPHA 1GC7A 3S2AA 2IYDB 2LGDA 4BKTA 3Q3JA 1LFDA 4ZRKA 4WWNA 2KTRB 1WI0A 1P9DU 4B9KA 4DHJB 1WJUA 2AL6A 3LDZE 5D2MB 3H7PB 4CHKA 3OJ3A 4GIVA 2LZ6A 4KDLB 1L7YA 3R3MA 3V6EB 3DBHI 3V60A 3ZNID 4IM0A 2ZZPB 3ZTCA 4MJSA 5D7GA 1J0GA 3H1UA 1WM3A 2KJRA 3QA8A 4JLCA 3GOEA 3I3TB 2DAJA 1WE7A 2K1FA 3C0RB 2M4NA 3UIPB 4MGYE 3RZFA 1RRBA 3AXCA 1R4MI 2REXA 2Z0DB 3NY5A 2OJRA 2KX0A 3PVLA 3W1YA 2AWTA 5CX3A 1IP9A 1UD7A 2LVQA 3A4RA 3UIOB 4E3CA 4W9JA 4BOZB 1OEYJ 3KH0A 1WJ4A 3JYUA 2IO1B 3A33B 4M8MA 3V62A 4BKSD 1TGZB 2AEHA 2L8JA 2DZJA 4NQLB 2M0XA 3UQBA 2C7MB 2V3SA 3L10B 1WXVA 4BOSC 4LDTB 2FIFA 4A3PA 1WIAA 3ALBA 1PQSA 2IO0B 2JRHA 1E8XA 4I6NB 3JSVB 5CHWA 2KWCA 2WWZA 4GSWA 4W9CA 3O65B 4EFOA 5JH5C 2J0JA 4EOYA 2EMTA 4LJOB 2NCNA 1WF9A 1UGMA 4OVVA 2LWPA 2L05A 2K8HA
chains in the Genus database with same CATH superfamily
2JUOA 3ZLZA 4DXAB 2KNBA 2N9XA 1TBEA 2WXKA 5JZEB 3UINB 3Q2AC 5AZGA 1WX8A 3PPAA 4YSYB 4EZLA 5AUIA 2PE6B 1R4NI 2DZKA 3OLMD 3GZNB 2K5PA 1VCBA 1HZ5A 3IG3A 2JWUA 2RPQA 3O13A 4WQOB 4GLSC 4DHJD 1C3TA 2QCZA 3B08A 3T3NA 1UELA 1J19A 1C76A 3Q8BA 4NJCA 3AEFB 2RR9A 3KLSX 2Y3AA 4TV3A 3RFZB 2D07B 4NAWB 3ZGZA 2L52A 4JWSC 2FUG1 1WGHA 4NAWA 1R4NB 4WIPA 2C5LC 4MGZE 1ZW7A 4ZRJA 1E8ZA 4M0WA 2K25A 2C9WB 1HA5A 1L0YB 3ZNHB 4BBNF 3DVNU 4US8A 4YTPB 5LLIA 2N1WA 4N58A 1OFFA 3APDA 2KLGA 1N63A 4YL8A 1I4HA 2WXGA 2ZCCA 3ZQ4A 5T8IA 2V1YA 3CSFA 5DCNA 1R7SA 4W9KA 2NR2A 1AARA 2LJ5A 3M3JA 3DDCB 4DHZE 1UWMA 1D5XC 5HI1A 4DBGA 1J8CA 1LM8B 1C4CA 5KHQA 3BVZA 1YJ1A 3DBSA 4HXDA 2LUEA 4ZHPA 3TEXA 2HJ8A 1KJTA 4NY0A 2BT6A 3L54A 3PRMB 1ESFA 1ZDVA 1RAXA 3U30A 3DOWA 3NJTA 3A9KA 3IXSA 2ZPYA 5IA7A 1WGGA 2KX3A 1EF1A 2DAFA 5BMHA 1K53A 3DVGX 2FCSA 2RSUA 1HEZE 3GE3C 3N9YC 4IWOA 3SR6A 5IN7A 4XDCA 2K3UA 3EHVA 3MJ5A 4P7IA 3ZJUA 3AE3B 1WYWB 2MBEA 1N61A 3NVZA 3HUIA 2AQ1B 1KFYB 2EKIA 3RNBC 1NYQA 4RF0A 4AQ7A 1V5OA 3ZNZB 4MM3A 1K52A 3A4SC 2G45B 1MI0A 4WAAA 2OOBB 2XEWA 1DYQA 5H92C 2BYFA 3FAHA 4OVUA 2O6VD 1SE3A 1Y56A 4OZCA 4G3XB 4DWFA 1XLNA 3ZIMA 1UBQA 1T0QC 4P1CC 3WIMA 1C9FA 1NI3A 4W9EA 3VTUA 1V97A 2VZKB 5GMVA 4MGIE 3QC8B 4N6EB 2QC8A 4MM3B 3NOBA 3VQIA 4IG7B 1WGKA 1IBXA 3ZJTA 2K8BA 1E8YA 2BQQA 2GBJA 3N20C 1ISNA 4KZ0A 2JU6X 3UQAA 2BYTA 1T6BX 5DPWA 1NDDA 3DWMA 3RD2A 1EWYC 2ACZB 2AYOB 2JZPA 2WXFA 3QAQA 2IBIB 2GBMA 2GBRA 4HDQA 1RWSA 1PYWD 4HPMB 2J0KA 1FO4A 1XLQA 2BYEA 3DCGA 4HK2A 3OWEB 3MC8A 3PGEA 3B2FA 1V86A 4IWPA 3AEEB 1TKGA 4II2B 4BBNC 3RULA 1M4VA 3CIRB 4AJYB 2MLBA 2N0SB 1KTKA 3CF6E 5IAAC 5EE1A 3BZDB 3PRPB 4KDIC 1V6EA 1WJNA 3ETRA 4O1NA 3MHZA 2LMCA 1ZXIA 3UF8A 1RFAA 3ZUNA 4EE2A 1JWMD 2EELA 1ROEA 4DHZB 1WM2A 1SE2A 2L00B 2EKEC 2LD9A 4ZHOA 2KAJA 3ZKJC 3JVZX 1KOTA 4NQKE 3OAWA 1T0RC 2NMQA 1FCCC 1MPEA 3AB5A 2VH1A 1AYFA 3NS1A 3J9CA 5D94A 4RMAA 1YQ3B 1FCLA 2WU2B 2L3ZA 3KVFB 5KHOA 1FEHA 4DK5A 3SFEB 1VRAB 4LCDE 1F52A 2HTME 3AE6B 3MP9A 1WFYA 3BVGA 3PO0A 3KW5B 1T0YA 2WXHA 5D3DA 1IGDA 3TCAA 3ZO5B 1P98A 2M19A 1TKYA 3VH4B 3H9DA 1HXYD 4G50A 1KLUD 4ZOHC 4W9LA 1L2NA 2MCNB 2FUHB 3X0WA 1ZOYB 1WMHA 4KIKA 4FULA 2N4FA 3ZDTA 2I2YA 2ZEQA 4W9IA 3QCAA 2K8CA 1SSNA 2J53A 4XGAB 4ASWC 2QIEB 4XX5A 4XYCA 2I1JA 1YN4A 3DWGC 1RLFA 2B76B 2FNJB 4MH0E 3HVZA 5EE0A 4J3OD 1VZ8A 4A8XC 1OGWA 4IOIE 1L6UA 1GOZA 4PYUA 2DZIA 1EU4A 3Q3JA 2KTRB 1QOBA 4B9KA 2OHFA 1WJUA 2AL6A 5D2MB 3H7PB 2W3RA 3C8YA 1FMAD 2MJ3A 2ZZPB 3VR8B 3W5VB 3QA8A 2J52A 3I3TB 3UIPB 5BMIA 2BS3B 3AXCA 2REXA 3FILA 1XCQL 3PVLA 2AWTA 3P42A 2LVQA 2WU5B 3KH0A 1WJ4A 3JYUA 1RM6C 2ZW1A 2M0XA 2C7MB 1YNTE 1WXVA 3ALBA 4RGNA 4I6NB 3O65B 1WF9A 3B2GA 1FD6A 1S1QB 2ZVNA 2M56B 3Q3FA 3DBLB 4UDUC 2I38A 2CHWA 1SJHD 4B95A 4WWMA 5L95C 2A4ZA 2D3AA 4ZDVA 4ARIA 1KM7A 2ON8A 4MH8A 2D11A 2ZNVC 3NVWA 3ZVVA 4MSMB 3TJPA 3WAOA 1VDVA 2PPHA 5BO4B 2KQ4X 4RNAA 2WDRB 1XCTL 2WNMA 2J7QB 1T5XD 5BMGA 1TS5A 4IWQA 4FJVB 3QWZB 1WRDB 3AULA 3BK1A 1GG3A 4G11A 2EMSA 4AP4C 5G5HA 2M17A 2FCNA 4GGQA 5EDSA 4RGMA 3GS2A 4MT5A 3VTWA 1ZPSA 1JROA 2Y5PA 3P63A 3R2TA 1RYJA 1WH3A 1JWAD 2IO2B 3T3OA 2WX1A 4A3OA 1FPYA 2LHEA 2MRPA 3U52E 2WXPA 2R2OA 4RGOS 1PDXA 5C2TB 1UH6A 4HCNB 1E7PB 2Y5BB 3H7PA 4N9F4 2CR5A 3AH7A 1JCKB 4JIOU 2I1KA 5E6JA 2WXOA 4MELA 2CJOA 1BT0A 1TS2A 1P7FA 2DLBA 2IGDA 3PTFC 2R2QA 4FADA 4JQWC 3B1LX 2BB6A 3E56A 3W9CB 1G6JA 2CHZA 1ZP0B 4K1RB 3TIXA 2INCC 2BWFA 2HTHA 3L0WB 2YLMA 5CHFA 1ZKHA 4IUMB 2WDQB 2FIDA 2UU7A 3EECA 1Q10A 2BKRB 5GXGB 1WY8A 2L7RA 4CYEA 1P0RA 4KGTA 2VZKD 1UF0A 3AECB 4ZYSA 2MBBB 2INPE 3JSVA 3QIJA 1LO5D 4PS8A 1UNSA 1N6ZA 2R61A 2KXJA 1V1PA 2BS2B 3X23A 3L17A 3AEAB 3PSEB 1IUEA 4C4VA 1YX5B 1F0ZA 4BKSA 1YJJA 2C7HA 1WX7A 1JWSD 3VFKA 4M00A 3GB1A 3PLVA 3V61A 3PS6A 3RNEC 4L23A 4MACA 1C1YB 4ZRQA 1XO3A 4MEMA 4KVGB 1UZXB 1E6EB 4HPLB 2D2QA 3P4RB 1VZ7A 3CSTA 4IKGA 2KJHB 4HCPB 2L0FA 3MFGA 3AE1B 1TY2A 4TMAB 3LJ3A 3EFUA 4DXFA 2GBKA 3QHTA 4ICVA 2DZMA 4XE0A 3RNAC 4DDGD 3U2SC 3VVWB 1MFWA 4YXDB 3K9OB 2QJLA 3APFA 2NPTB 1PGBA 1UGJA 5E6OA 3AV8A 1HQRD 2JYTA 1NBFC 3H7SA 1WGYA 2ZJDA 4REZA 3OG5A 4PT5A 1QOGA 3Q8CA 5AZFA 3PZ8A 3A9JB 3IBEA 2CJNA 1P7EA 3SU8X 1XXGA 4TQ1A 1GB4A 2KN4A 3VUWA 2CKHB 3NZSA 3DHIC 3T9LA 2GB1A 3IHPC 2W3SA 4NNJB 4ZYNA 2NBVB 1YD8U 1YJIA 4RFBA 3ZYYX 3D32A 3EA6A 3TMPB 1VD2A 3NZUA 3PHWB 1TY0A 1GB1A 4GN1A 2K9XA 3U7ZA 4FHJA 2MQJA 2WGSA 4EUTA 4GDLA 2L32A 1F1HA 2JVCA 1I4GA 3N1ZC 1CMXB 2RDBC 3AE7B 2N7DA 4TKNA 5G5GA 1R4MB 5HG2A 3UI3A 3AN1A 1QZEA 2LJIA 2O2VB 4FA6A 2J42A 1S3SG 2KN5A 3P4PB 2D3GA 1F2RI 4P1BC 3VAWA 4C7ZA 1SIFA 3Q8AA 2L76A 4BFRA 1I42A 2HE7A 2INDC 3PHXB 2ZPNA 4I6PA 1I4PA 1UBIA 3EFCA 2K6DB 2NPTA 2BS4B 4IDIA 3NHEB 3QQ8B 4AOFA 1YMHE 1C78A 2XK5A 2NTTA 4GOCA 2BYVE 4MJSB 3P1MA 1K8RB 3RUIB 1CK1A 3RNGC 3BY4B 2MP2A 4HJKA 1V81A 4WAFA 3AU4A 4JE3B 1ACCA 2KMAA 4GB9A 1YN3A 1TS4A 4H2AA 1Y8RC 4YSZB 2KDFB 1BMLC 2QMTA 3ONSA 1KRHA 4J6IA 1OTRB 2IO3B 1CJEA 3SD5A 1GPXA 2Y5CA 2KJ6A 1WSPA 2GBNA 3WCQA 1WE6A 5CHVC 1GNUA 3MTNB 3RI7C 1F2RC 1N5WA 4EZJA 1ENFA 1UUPA 4ANXA 2K22A 2DENB 1WJ6A 3APCA 3R2IA 3DHGC 4BKGA 1I4XA 1J7AA 2IYDB 4ZRKA 1K51A 1FFUA 3OJ3A 4GIVA 2TSSA 1QOAA 3R3MA 1J0GA 3H1UA 1WM3A 2KJRA 2WHIA 2DAJA 2K1FA 3C0RB 3Q6BA 1QILA 2QSDA 2ONQA 1AW7A 2WXIA 4BOZB 1OEYJ 4JWUC 1TS3A 2IO1B 3A33B 5FK9C 2AEHA 2DZJA 1K50A 3L10B 1D4BA 4A3PA 1WIAA 1YN5A 2KWCA 4B0MA 4EOYA 1KLGD 4LJOB 4TSSA 4M02A 2LWPA 2XNAC 3P4QB 2LXCA 2BBCA 4GXBA 1NENB 4C4VB 2Z8LA 2MSED 3A9JA 3W2DA 1M94A 4R3DA 3K9PB 3PT2B 5C1ZA 1C77A 4ANUA 5L83A 3QX1A 1JRPA 1T3QA 3Q3NC 4F7ZA 3Q14C 1XT9B 5BYRA 2ASQA 4LK0M 1YX6B 2B3AA 4NPNA 2K39A 2PVOD 2LI5A 1XF5L 3RNFC 1E10A 1OQQA 2G3QB 2G4DB 2N9EB 1KH0A 4YTMB 2WXRA 3I5JC 1WZ0A 4TUUA 3PV1A 5IO9A 4XC2A 4USAA 1Q5WB 2WLBA 1Z2MA 3NRZA 3UGBB 2L1AA 2KWDA 3HM3A 1L4DB 3TBLD 2WXQA 1TIFA 4EEWA 3BYTB 1STEA 4RGTA 5JHBA 1FM0D 1PGXA 2VRRB 5EE9A 3VTVA 2KC2A 4AWJA 1E9MA 1JW9D 2NVUI 3IT4B 3DVNV 1Q1OA 2FCQA 1WXAA 2KDBA 3QARA 1PGAA 2KANA 4W9GA 4XZ4A 2FBWB 3ZXRA 3IT6B 2LEKA 4KSLC 1SBBB 4IW0A 2V3NA 4ARCA 2J0MA 2LGYA 4DQOC 3AEGB 2KFKA 2LRWA 1JQ4A 4JX1C 2DHZA 2QHOA 3DBLI 4A6QA 1WR1A 2KT7A 2LVOA 1LXDA 3LYYA 2K6QA 5I4DA 3W5UB 2HDEA 1WR6E 2M1MA 2WS3B 2Q5WD 3TSSA 2GOWA 2MJDA 3DVGY 5FR6A 4C7YA 3ML9A 2MP2B 3MJWA 1TJEA 2SAKA 3L16A 4AS1A 1MHHE 2PE9A 1MG8A 2KK8A 2JXXA 4A9AA 2DBYA 4WJPA 1EU3A 1V1PB 5BYQA 4WWOA 5JXVA 1HTQA 2JY6A 5JHAA 3HM6X 5FKAC 4GMVA 3KYCD 3PREA 4YSXB 4ZRPA 2PIAA 2QDFA 3VRBB 1HZ6A 4FBJB 4M8NA 4K7SA 4P16A 1XQQA 1JWBD 2D5GA 2PEAA 4I6LB 3WAPA 3BIID 1VZ6A 4KKIA 1MVKA 2O6VB 1SB3C 2KDEB 4JPSA 2ZNVB 1V80A 3NVVA 4OHJA 2KKCA 2QEJC 2YVCA 3NG0A 4WH4A 3DBHB 2MBQA 2PKOA 3ZDMC 2AQ3B 4AJWA 4C80A 4P6VF 4EKUA 2MW5A 1AWDA 2E3TA 2KYWA 1FRRA 4RM8A 1FRDA 2KDMA 2KWVB 4YWGG 3T8MA 4ACFA 3R7QA 2GMIC 2MJEA 3TUOA 2L0TA 2NBUA 4PYZA 1SF0A 4JL9A 3Q8EA 3GP7A 4TQ0A 3AMZA 4MDKE 1XLPA 4WJQA 4CQNA 3FILB 4NZLB 2DWQA 4HKZE 3HHMA 2DX5B 1MG4A 3ECIA 4DDID 4HRSA 2OJWA 3LXFA 2BTEA 1F77A 3ML8A 5LXIB 2WQYB 4FHKA 1XD3B 2FCMA 4II3B 2D10A 5C3JB 2FAZA 1DOXA 1WZ3A 3GZNI 2BPSA 2KVRA 3NVYA 1C79A 3QJZA 2C7NB 1V49A 2KLCA 1I4QA 4PS7A 2KHWB 2RD0A 4GU2A 4HLEA 2AQ2B 2MWSB 1ZXHA 2NS5A 4B0EA 1IGCA 1YIWA 4KZCA 2V4IB 3Q3OC 3RPFC 4F1SA 2LGSA 4LNKA 4XDDA 1L0XB 2LHDA 3W1SC 3KQ4A 2FE8A 5E6PA 1SE9A 3RZWC 3SDLC 2BF8B 1TTNA 2VH2A 4L2YA 5E6NA 1E8WA 1FNVA 2DYOA 2HD5B 2ZCBA 1Z5SB 2G9HD 2KC1A 2L83A 1I7HA 4LDTD 4BZAA 2LVPA 1E90A 4L1BA 3M95A 2W54A 4NJ7A 3DBRB 2XN9C 4HPPA 4K7UA 4ANVA 4HDOA 1WYGA 2G4SA 1L4ZB 1VR9A 1HE8A 2NBWB 2JWZA 2IZVB 3U8ZA 1E5WA 1WX9A 1QT9A 3CWIA 2V3PA 3TL5A 4A55A 4M0WB 3VUXA 2BWES 1NI2A 2WXNA 1P3QU 2JF5A 1TZ1A 3I57A 2N7JA 3N1XC 4LNIA 4C56C 1A5RA 1TKEA 4WJOA 1YQBA 2IY1B 1V2YA 1FNUA 2RGFA 1CZPA 2H88B 3Q8FA 4A20A 2DNFA 2JZ3B 1T0SC 4YT0B 4OZAA 4NJ6A 1WGDA 3N3KB 1KF6B 3VXWA 5LNK1 1QOFA 2RPVA 3AM9A 3KYDD 2LGIA 4E74A 4M01A 1Q0WB 3KUDB 4LJPB 3HVDA 2LGXA 4JGHB 4X57B 3I63C 1DGJA 3RCZA 1FFVA 3WANA 4B6WA 1EF5A 2KWUB 4ZRIA 2Z0EB 4XWTA 4DXGA 1FIQA 3PRZA 1J7CA 2JPHA 1GC7A 4WWNA 1WI0A 2PVGC 3ZJVA 4DHJB 5FR3A 1WXQA 3LDZE 4CHKA 3E9SA 1L0VB 3GE8C 2JX5A 2W82A 2PMVA 4PK1A 1MJDA 4KDLB 3ZTCA 4MJSA 4JLCA 1VJKA 1WE7A 4YTNB 3EUB2 1D5ZC 4MGYE 3RZFA 1RRBA 1R4MI 1N5XA 2OJRA 2KX0A 4FXCA 2D3BA 5TSSA 5CX3A 1J7BA 1N60A 2BW2A 1SXTA 1FXAA 3UIOB 2SEBD 4M8MA 4OW0A 1BUIC 1TGZB 2L8JA 4NQLB 1SIJA 1WRIA 4BOSC 2X8XX 4WQMA 1PQSA 4LNFA 2JRHA 1E8XA 1SE4A 4W9CA 5JH5C 2J0JA 1L6VA 4US9A 1UGMA 2M0AA 1NYRA 4S0RA 2D3CA 2KD0A 1IYFA 1VLBA 2V9HA 4QAYA 4RF1A 4PS3A 2BVCA 3N32A 1ET9A 2UWQA 3B0AA 3AE5B 2N9KA 2JQRB 1MHXA 4HVBA 2N1VA 4KV2A 1D5MC 1SJED 5D6JB 4EZKA 4C00A 2OEDA 3MC0B 1QF6A 2N7EA 4KSKC 1N62A 2CHXA 3BINA 1EO6A 3DPDA 2WXLA 4IM3A 1OEYA 4ANWA 1SGHA 3ZW3A 4ICUA 3N1YC 3W1SA 2AL3A 1LQBA 5HFYA 3AU5A 1JMLA 2IDYA 1QKZA 2IPKD 2LASA 2LRUA 1QQRA 5DPRA 3I9V1 2YEPF 3ABVB 1GJZA 1I4RA 3A9KB 3JW0X 1EWCA 1EM7A 3PZDA 4G0NB 2KACA 4K81A 3ZRCA 4BAXA 2JXTA 1BXTA 2KQSA 2G1EA 3LB8C 3V05A 1TT5B 4RCOA 4WJNA 3AE9B 1F9JA 3BK2A 5DPTA 2KTRA 5IKCM 2KMCA 1WXMA 3IAS1 3URYA 2MBHA 2WXJA 5MPOA 4FN2A 1I35A 4GDKB 3EGRA 2JT4B 1D6EC 1P1AA 2IY0B 2QILA 4KIKB 3N30A 1AN8A 1TYGB 2HJ1A 3FC4A 2CS4A 3RYTA 2GLSA 4RM9A 1C4PA 4IC7B 3MHSD 4S17A 2MH7A 2O2VA 1KLVA 1LGRA 1WGRA 2GRIA 3R7RA 2KDIA 3KUZA 4FJYA 1U4AA 3H6NA 2JRIB 2LFIA 5C23A 2J4XA 3VH3B 3HIZA 2PLPA 4W9FA 5LXHA 3A1QB 4IM2A 2N9LA 3AE4B 3VUYA 3OJ4B 2YEPB 4GDLB 1V1OA 4F8CB 3DBRI 2WP9B 3SHQA 3AEBB 1TZOA 1GUAB 2M8SA 1ZUD2 3L13A 5AUKA 1NEKB 4AUQC 2Z59B 1H8CA 4OZBA 3NZ3A 2PJHA 2V4LA 1PUTA 4ITKA 1YOVB 4OVZA 3WALA 2A5UA 2WDTB 3BWUD 3ZXVA 4HKQA 3SEBA 5G2NA 4HWIB 1JRUA 3L08A 3EC8A 3HRDD 3FKYA 5J17A 4N59A 2BB5A 3DHHC 2K0PA 3VDZA 3R8BA 2H89B 3C19A 4MGKE 1D3ZA 3KUCB 4E71A 2JSVX 1X1MA 3Q69A 2MHJA 2MEKA 3P4SB 1B1ZA 2ZW0A 2UYZB 4KX6B 2XBBC 2X38A 2W9NA 1FNWA 2NTSA 5EE3A 2RMMA 4LNOA 3AE2B 4KKJA 3IVFA 1FXTB 4WURA 1OQYA 4FLHA 2GI9A 3V6CB 3IAM1 3VR9B 3A1QA 2PTLA 4WWPA 2INNE 4KGSA 5H8YE 3NUHB 3RT3B 3MC9A 3M62B 5HKHA 2KVZA 5HHDG 1GAQB 2RDGA 2XK5B 3HK0A 3RN9C 5BYSA 2DYMA 2O6VA 1ET6A 3BYYB 1E7UA 2WYQA 3B9JA 3TEZA 3U7DA 2KFKB 2PW9A 3KWVA 1XLOA 2DYBA 2MA9B 4KGRA 5TR5A 2ICIA 3AI5A 1H4RA 1ZDXA 5J2RA 2BKFA 1IPGA 2V0GA 1B9RA 3SFDB 2IJ0A 1WXSA 3L4PA 1DOIA 1E0ZA 2KQ7A 4W9HA 2LXAA 4GDKA 3CMMB 4MSQB 3RNCC 2BGFA 1JALA 3VHTC 4BVUC 1E7VA 2KFJA 3M63B 3PLUA 1V9JA 3KWLA 1SEBD 1ZGUB 2KMMA 1CQVA 3R66C 3ZNGC 2WX0A 2N9PC 3NS8A 1PFDA 4W9DA 2AX5A 1A70A 1EUVB 3AE8B 2KZRA 3ZRFA 2JZZA 4CO7A 2ZVOA 1FXIA 5D3IB 2C60A 4XWWA 2MBOA 4A90A 2WDVB 2E6XA 3DQVA 3WA0A 4K7WA 2MX2A 5G55A 3RMKC 2JYEA 1OQRA 2IGGA 1WMHB 3TEWA 5J18A 2LUMA 4URKA 3Q3MC 4D2KA 1HTOA 5CTRC 2IGHA 1ZE3D 3AEDB 2WXMA 1RFKA 1IBXB 2KTFA 4Q2JA 5AZHA 1L5PA 1XEEA 3WAMA 5IP4D 3ENEA 4HJGE 5DPSA 3QK0A 3P2BA 3ZTDA 2CU1A 1C4AA 3BVMA 4FJZA 2KO3A 2KOXA 1UWXA 3TEYA 1YQ4B 1V8CA 3IFWB 5AEKB 4HROA 1V5TA 1GC6A 3S2AA 2LGDA 4BKTA 1LFDA 3VRAB 1P9DU 3PZ7A 2LZ6A 3V3XA 1L7YA 3V6EB 3DBHI 3V60A 3ZNID 4IM0A 5D7GA 4LNNA 1WWTA 3GOEA 2M4NA 1QLBB 3U4EG 2Z0DB 4LTUA 3NY5A 1DOYA 3W1YA 4NAMA 2CU3A 1IP9A 1UD7A 3A4RA 4E3CA 4RH6A 4W9JA 3H8HA 4LLGM 2RDHA 3V62A 4BKSD 3UQBA 2V3SA 4LDTB 2FIFA 2IO0B 4HEA1 1JWUD 2W55A 5IOIA 1NVID 4K3CA 3JSVB 5CHWA 2WWZA 4GSWA 4EFOA 2EMTA 4K3BA 2NCNA 4OVVA 2L05A 2K8HA
chains in the Genus database with same CATH topology
2KD0A 1S1QB 2JUOA 1IYFA 2ZVNA 3ZLZA 2LXCA 3Q3FA 4PS3A 4DXAB 2KNBA 4GXBA 2N9XA 3N32A 1TBEA 2MSED 3A9JA 2CHWA 5JZEB 1M94A 2UWQA 3UINB 4B95A 3K9PB 3PT2B 5AZGA 5C1ZA 1WX8A 3B0AA 3PPAA 5L95C 2A4ZA 4EZLA 4ANUA 4HVBA 2N1VA 3QX1A 4ZDVA 5L83A 4KV2A 1KM7A 5D6JB 2PE6B 4F7ZA 4EZKA 1XT9B 2D11A 2ASQA 2ZNVC 1R4NI 1YX6B 2DZKA 2B3AA 4NPNA 2K39A 2LI5A 3OLMD 2N7EA 1VCBA 4KSKC 3ZVVA 2G3QB 2CHXA 3BINA 1EO6A 2G4DB 2N9EB 3DPDA 3IG3A 4MSMB 3TJPA 3WAOA 2PPHA 4IM3A 5BO4B 1OEYA 4ANWA 2RPQA 1SGHA 4WQOB 4DHJD 1WZ0A 1C3TA 2J7QB 3ZW3A 4ICUA 3B08A 4IWQA 4TUUA 3PV1A 4XC2A 3W1SA 1UELA 2AL3A 4FJVB 3QWZB 1LQBA 1Q5WB 1J19A 1WRDB 3AULA 3AU5A 1Z2MA 1GG3A 2LASA 2LRUA 3UGBB 4G11A 3HM3A 2EMSA 5DPRA 3TBLD 2RR9A 1GJZA 4TV3A 4AP4C 3A9KB 3JW0X 2D07B 2M17A 4EEWA 5JHBA 4NAWB 2FCNA 3PZDA 4GGQA 4G0NB 5EDSA 2VRRB 4K81A 3ZRCA 3VTWA 1WGHA 4NAWA 3VTVA 2C5LC 2KC2A 4AWJA 4MGZE 1ZW7A 2KQSA 4ZRJA 1E8ZA 2NVUI 4WJNA 1WH3A 3DVNV 1Q1OA 2FCQA 1WXAA 2K25A 2KDBA 2IO2B 1F9JA 2WX1A 5DPTA 2C9WB 2KTRA 3QARA 4W9GA 2KANA 2MRPA 4XZ4A 3ZNHB 4A3OA 4BBNF 3DVNU 2KMCA 5LLIA 2N1WA 1WXMA 4KSLC 2R2OA 2MBHA 3APDA 1UH6A 2KLGA 4IW0A 4FN2A 4HCNB 2J0MA 4GDKB 4YL8A 1I35A 2LGYA 2Y5BB 3H7PA 4N9F4 2ZCCA 2CR5A 2JT4B 2KFKA 4JIOU 1P1AA 2IY0B 4KIKB 2LRWA 2V1YA 3N30A 3CSFA 2DHZA 2QHOA 2I1KA 3DBLI 5DCNA 4W9KA 2NR2A 1AARA 1WR1A 2LJ5A 2LVOA 1LXDA 3M3JA 4MELA 2K6QA 1BT0A 2CS4A 3DDCB 3RYTA 1WR6E 4DHZE 2M1MA 4RM9A 3PTFC 2GOWA 4IC7B 3MHSD 2R2QA 4DBGA 1J8CA 4FADA 1LM8B 2O2VA 4JQWC 5KHQA 3B1LX 1KLVA 3DVGY 1WGRA 5FR6A 3R7RA 3ML9A 2MP2B 4HXDA 1YJ1A 2CHZA 2KDIA 3DBSA 2LUEA 3KUZA 4K1RB 3TIXA 1G6JA 4FJYA 3MJWA 2BWFA 2HJ8A 2HTHA 1KJTA 3L16A 1U4AA 4NY0A 3H6NA 2JRIB 3L0WB 3L54A 5C23A 2PE9A 3PRMB 3VH3B 1MG8A 3HIZA 1RAXA 2YLMA 4W9FA 5LXHA 2KK8A 3DOWA 3A1QB 3U30A 5CHFA 1ZKHA 2JXXA 3A9KA 4IUMB 4IM2A 4WJPA 2ZPYA 3VUYA 5IA7A 4WWOA 3OJ4B 2FIDA 1WGGA 2KX3A 3EECA 2BKRB 4GDLB 3DBRI 4F8CB 1EF1A 2DAFA 2JY6A 1WY8A 2L7RA 3HM6X 5JHAA 4GMVA 3KYCD 3PREA 3SHQA 1GUAB 4CYEA 1P0RA 2M8SA 3DVGX 2MBBB 3L13A 2FCSA 3JSVA 2RSUA 3QIJA 4AUQC 2Z59B 1H8CA 4PS8A 2PJHA 4IWOA 2V4LA 2KXJA 3WALA 4FBJB 2A5UA 2WDTB 3X23A 4M8NA 3L17A 3EHVA 3PSEB 4K7SA 4P7IA 1XQQA 2PEAA 4I6LB 1WYWB 5G2NA 4HWIB 3WAPA 1JRUA 1YX5B 3L08A 3EC8A 4BKSA 2MBEA 2C7HA 1WX7A 2O6VB 5J17A 3VFKA 2KDEB 3VDZA 2ZNVB 1V80A 3PLVA 3V61A 4MGKE 2KKCA 3PS6A 2YVCA 1C1YB 1V5OA 3ZNZB 4MM3A 2MBQA 4MEMA 4KVGB 3ZDMC 1UZXB 1D3ZA 3KUCB 3A4SC 2G45B 4AJWA 4E71A 4HPLB 2D2QA 4WAAA 2OOBB 2XEWA 3CSTA 4EKUA 1X1MA 2BYFA 2MW5A 4OVUA 2KJHB 2O6VD 4HCPB 4RM8A 2L0FA 2UYZB 2KWVB 3LJ3A 2XBBC 3EFUA 3T8MA 2W9NA 4G3XB 2GBKA 2GMIC 3R7QA 3QHTA 4DWFA 4ICVA 2DZMA 2L0TA 2NBUA 4DDGD 3ZIMA 1UBQA 3VVWB 4PYZA 3IVFA 1FXTB 4JL9A 3WIMA 1OQYA 3K9OB 3APFA 2NPTB 4FLHA 5E6OA 4TQ0A 3V6CB 4W9EA 4MDKE 3VTUA 1NBFC 3A1QA 3H7SA 1WGYA 2ZJDA 4WJQA 5GMVA 4WWPA 3HHMA 2DX5B 4MGIE 3QC8B 5AZFA 3A9JB 3ECIA 3RT3B 3IBEA 4DDID 3NOBA 3VQIA 3M62B 3SU8X 5HKHA 4IG7B 3ML8A 5LXIB 4TQ1A 4FHKA 1XD3B 2FCMA 2CKHB 2K8BA 3NZSA 4II3B 3VUWA 2D10A 1E8YA 2XK5B 2GBJA 2FAZA 3HK0A 4KZ0A 1ISNA 2DYMA 2O6VA 3UQAA 3T9LA 5DPWA 1NDDA 1E7UA 3RD2A 1WZ3A 2AYOB 3GZNI 3IHPC 3QAQA 2BPSA 4NNJB 2WYQA 2KVRA 2NBVB 4ZYNA 1YD8U 2IBIB 3QJZA 3U7DA 2KFKB 2C7NB 2GBMA 2GBRA 4HDQA 1V49A 3D32A 2KLCA 4HPMB 2J0KA 3TMPB 4PS7A 2KHWB 1VD2A 2RD0A 3NZUA 2BYEA 2DYBA 4GU2A 4HLEA 2MA9B 5TR5A 3PHWB 3DCGA 3AI5A 4HK2A 3PGEA 2MWSB 4GN1A 1V86A 2NS5A 1H4RA 4IWPA 5J2RA 2BKFA 1IPGA 1YIWA 4II2B 4KZCA 3RULA 4BBNC 4AJYB 1WXSA 4F1SA 2MLBA 2KQ7A 3W1SC 3CF6E 5IAAC 4FHJA 4W9HA 2LXAA 2MQJA 3PRPB 4EUTA 4GDKA 4GDLA 5E6PA 1SE9A 2JVCA 3RZWC 3CMMB 3SDLC 2BF8B 4KDIC 1TTNA 4MSQB 1CMXB 2BGFA 2N7DA 3VHTC 4TKNA 1V6EA 1WJNA 4BVUC 5E6NA 1E7VA 2KFJA 3M63B 1E8WA 3PLUA 1QZEA 1V9JA 2DYOA 2HD5B 2ZCBA 1RFAA 1Z5SB 2KC1A 4LDTD 3UF8A 2LVPA 2O2VB 4FA6A 1ZGUB 1E90A 3ZUNA 1S3SG 2KN5A 3M95A 3R66C 2D3GA 4NJ7A 3ZNGC 4DHZB 2WX0A 2N9PC 4K7UA 4ANVA 4HDOA 3NS8A 1WM2A 2G4SA 2L00B 4W9DA 2EKEC 2LD9A 3VAWA 1EUVB 1HE8A 2NBWB 1SIFA 3ZKJC 2KZRA 3JVZX 1KOTA 2JWZA 2IZVB 2L76A 1E5WA 3OAWA 4NQKE 3U8ZA 3ZRFA 2JZZA 1WX9A 4BFRA 2HE7A 1I42A 3PHXB 2ZPNA 4I6PA 4CO7A 2ZVOA 3TL5A 1UBIA 4M0WB 3VUXA 2K6DB 2C60A 2BWES 2MBOA 1NI2A 2NPTA 5D94A 1P3QU 2JF5A 4RMAA 3DQVA 3NHEB 3QQ8B 4AOFA 1TZ1A 2XK5A 4K7WA 3WA0A 2MX2A 2L3ZA 4GOCA 2BYVE 1A5RA 3KVFB 4MJSB 5G55A 5KHOA 4DK5A 1K8RB 3RUIB 4WJOA 1WMHB 3BY4B 4LCDE 1YQBA 2MP2A 1WFYA 2IY1B 1V2YA 5J18A 4HJKA 1V81A 2RGFA 3AU4A 3KW5B 1T0YA 4URKA 2KMAA 4GB9A 5CTRC 4A20A 3TCAA 3ZO5B 1Y8RC 1P98A 2JZ3B 3VH4B 2KDFB 3ONSA 3H9DA 4J6IA 4NJ6A 4G50A 1WGDA 1OTRB 4W9LA 2IO3B 2KTFA 2MCNB 3N3KB 2FUHB 1L2NA 3X0WA 3VXWA 1WMHA 5AZHA 4KIKA 4FULA 3SD5A 2N4FA 3ZDTA 2ZEQA 3WAMA 4W9IA 3QCAA 3KYDD 2KJ6A 3ENEA 4E74A 2K8CA 5DPSA 3QK0A 3P2BA 3ZTDA 4ASWC 1Q0WB 2GBNA 3KUDB 4LJPB 4XX5A 2LGXA 1WE6A 2CU1A 5CHVC 2I1JA 1GNUA 3MTNB 4JGHB 4FJZA 4EZJA 2KO3A 4X57B 1RLFA 2FNJB 2KOXA 4ANXA 4MH0E 3RCZA 2DENB 1WJ6A 3WANA 4B6WA 1EF5A 3APCA 3IFWB 2KWUB 4ZRIA 2Z0EB 5AEKB 1OGWA 4BKGA 1V5TA 2DZIA 4PYUA 3PRZA 1GC6A 2JPHA 1GC7A 3S2AA 2IYDB 2LGDA 4BKTA 3Q3JA 1LFDA 4ZRKA 4WWNA 2KTRB 1WI0A 1P9DU 4B9KA 4DHJB 1WJUA 2AL6A 3LDZE 5D2MB 3H7PB 4CHKA 3OJ3A 4GIVA 2LZ6A 4KDLB 1L7YA 3R3MA 3V6EB 3DBHI 3V60A 3ZNID 4IM0A 2ZZPB 3ZTCA 4MJSA 5D7GA 1J0GA 3H1UA 1WM3A 2KJRA 3QA8A 4JLCA 3GOEA 3I3TB 2DAJA 1WE7A 2K1FA 3C0RB 2M4NA 3UIPB 4MGYE 3RZFA 1RRBA 3AXCA 1R4MI 2REXA 2Z0DB 3NY5A 2OJRA 2KX0A 3PVLA 3W1YA 2AWTA 5CX3A 1IP9A 1UD7A 2LVQA 3A4RA 3UIOB 4E3CA 4W9JA 4BOZB 1OEYJ 3KH0A 1WJ4A 3JYUA 2IO1B 3A33B 4M8MA 3V62A 4BKSD 1TGZB 2AEHA 2L8JA 2DZJA 4NQLB 2M0XA 3UQBA 2C7MB 2V3SA 3L10B 1WXVA 4BOSC 4LDTB 2FIFA 4A3PA 1WIAA 3ALBA 1PQSA 2IO0B 2JRHA 1E8XA 4I6NB 3JSVB 5CHWA 2KWCA 2WWZA 4GSWA 4W9CA 3O65B 4EFOA 5JH5C 2J0JA 4EOYA 2EMTA 4LJOB 2NCNA 1WF9A 1UGMA 4OVVA 2LWPA 2L05A 2K8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KD0 A;  1S1Q B;  2JUO A;  1IYF A;  2ZVN A;  3ZLZ A;  2LXC A;  3Q3F A;  4PS3 A;  4DXA B;  2KNB A;  4GXB A;  2N9X A;  3N32 A;  1TBE A;  2MSE D;  3A9J A;  2CHW A;  5JZE B;  1M94 A;  2UWQ A;  3UIN B;  4B95 A;  3K9P B;  3PT2 B;  5AZG A;  5C1Z A;  1WX8 A;  3B0A A;  3PPA A;  5L95 C;  2A4Z A;  4EZL A;  4ANU A;  4HVB A;  2N1V A;  3QX1 A;  4ZDV A;  5L83 A;  4KV2 A;  1KM7 A;  5D6J B;  2PE6 B;  4F7Z A;  4EZK A;  1XT9 B;  2D11 A;  2ASQ A;  2ZNV C;  1R4N I;  1YX6 B;  2DZK A;  2B3A A;  4NPN A;  2K39 A;  2LI5 A;  3OLM D;  2N7E A;  1VCB A;  4KSK C;  3ZVV A;  2G3Q B;  2CHX A;  3BIN A;  1EO6 A;  2G4D B;  2N9E B;  3DPD A;  3IG3 A;  4MSM B;  3TJP A;  3WAO A;  2PPH A;  4IM3 A;  5BO4 B;  1OEY A;  4ANW A;  2RPQ A;  1SGH A;  4WQO B;  4DHJ D;  1WZ0 A;  1C3T A;  2J7Q B;  3ZW3 A;  4ICU A;  3B08 A;  4IWQ A;  4TUU A;  3PV1 A;  4XC2 A;  3W1S A;  1UEL A;  2AL3 A;  4FJV B;  3QWZ B;  1LQB A;  1Q5W B;  1J19 A;  1WRD B;  3AUL A;  3AU5 A;  1Z2M A;  1GG3 A;  2LAS A;  2LRU A;  3UGB B;  4G11 A;  3HM3 A;  2EMS A;  5DPR A;  3TBL D;  2RR9 A;  1GJZ A;  4TV3 A;  4AP4 C;  3A9K B;  3JW0 X;  2D07 B;  2M17 A;  4EEW A;  5JHB A;  4NAW B;  2FCN A;  3PZD A;  4GGQ A;  4G0N B;  5EDS A;  2VRR B;  4K81 A;  3ZRC A;  3VTW A;  1WGH A;  4NAW A;  3VTV A;  2C5L C;  2KC2 A;  4AWJ A;  4MGZ E;  1ZW7 A;  2KQS A;  4ZRJ A;  1E8Z A;  2NVU I;  4WJN A;  1WH3 A;  3DVN V;  1Q1O A;  2FCQ A;  1WXA A;  2K25 A;  2KDB A;  2IO2 B;  1F9J A;  2WX1 A;  5DPT A;  2C9W B;  2KTR A;  3QAR A;  4W9G A;  2KAN A;  2MRP A;  4XZ4 A;  3ZNH B;  4A3O A;  4BBN F;  3DVN U;  2KMC A;  5LLI A;  2N1W A;  1WXM A;  4KSL C;  2R2O A;  2MBH A;  3APD A;  1UH6 A;  2KLG A;  4IW0 A;  4FN2 A;  4HCN B;  2J0M A;  4GDK B;  4YL8 A;  1I35 A;  2LGY A;  2Y5B B;  3H7P A;  4N9F 4;  2ZCC A;  2CR5 A;  2JT4 B;  2KFK A;  4JIO U;  1P1A A;  2IY0 B;  4KIK B;  2LRW A;  2V1Y A;  3N30 A;  3CSF A;  2DHZ A;  2QHO A;  2I1K A;  3DBL I;  5DCN A;  4W9K A;  2NR2 A;  1AAR A;  1WR1 A;  2LJ5 A;  2LVO A;  1LXD A;  3M3J A;  4MEL A;  2K6Q A;  1BT0 A;  2CS4 A;  3DDC B;  3RYT A;  1WR6 E;  4DHZ E;  2M1M A;  4RM9 A;  3PTF C;  2GOW A;  4IC7 B;  3MHS D;  2R2Q A;  4DBG A;  1J8C A;  4FAD A;  1LM8 B;  2O2V A;  4JQW C;  5KHQ A;  3B1L X;  1KLV A;  3DVG Y;  1WGR A;  5FR6 A;  3R7R A;  3ML9 A;  2MP2 B;  4HXD A;  1YJ1 A;  2CHZ A;  2KDI A;  3DBS A;  2LUE A;  3KUZ A;  4K1R B;  3TIX A;  1G6J A;  4FJY A;  3MJW A;  2BWF A;  2HJ8 A;  2HTH A;  1KJT A;  3L16 A;  1U4A A;  4NY0 A;  3H6N A;  2JRI B;  3L0W B;  3L54 A;  5C23 A;  2PE9 A;  3PRM B;  3VH3 B;  1MG8 A;  3HIZ A;  1RAX A;  2YLM A;  4W9F A;  5LXH A;  2KK8 A;  3DOW A;  3A1Q B;  3U30 A;  5CHF A;  1ZKH A;  2JXX A;  3A9K A;  4IUM B;  4IM2 A;  4WJP A;  2ZPY A;  3VUY A;  5IA7 A;  4WWO A;  3OJ4 B;  2FID A;  1WGG A;  2KX3 A;  3EEC A;  2BKR B;  4GDL B;  3DBR I;  4F8C B;  1EF1 A;  2DAF A;  2JY6 A;  1WY8 A;  2L7R A;  3HM6 X;  5JHA A;  4GMV A;  3KYC D;  3PRE A;  3SHQ A;  1GUA B;  4CYE A;  1P0R A;  2M8S A;  3DVG X;  2MBB B;  3L13 A;  2FCS A;  3JSV A;  2RSU A;  3QIJ A;  4AUQ C;  2Z59 B;  1H8C A;  4PS8 A;  2PJH A;  4IWO A;  2V4L A;  2KXJ A;  3WAL A;  4FBJ B;  2A5U A;  2WDT B;  3X23 A;  4M8N A;  3L17 A;  3EHV A;  3PSE B;  4K7S A;  4P7I A;  1XQQ A;  2PEA A;  4I6L B;  1WYW B;  5G2N A;  4HWI B;  3WAP A;  1JRU A;  1YX5 B;  3L08 A;  3EC8 A;  4BKS A;  2MBE A;  2C7H A;  1WX7 A;  2O6V B;  5J17 A;  3VFK A;  2KDE B;  3VDZ A;  2ZNV B;  1V80 A;  3PLV A;  3V61 A;  4MGK E;  2KKC A;  3PS6 A;  2YVC A;  1C1Y B;  1V5O A;  3ZNZ B;  4MM3 A;  2MBQ A;  4MEM A;  4KVG B;  3ZDM C;  1UZX B;  1D3Z A;  3KUC B;  3A4S C;  2G45 B;  4AJW A;  4E71 A;  4HPL B;  2D2Q A;  4WAA A;  2OOB B;  2XEW A;  3CST A;  4EKU A;  1X1M A;  2BYF A;  2MW5 A;  4OVU A;  2KJH B;  2O6V D;  4HCP B;  4RM8 A;  2L0F A;  2UYZ B;  2KWV B;  3LJ3 A;  2XBB C;  3EFU A;  3T8M A;  2W9N A;  4G3X B;  2GBK A;  2GMI C;  3R7Q A;  3QHT A;  4DWF A;  4ICV A;  2DZM A;  2L0T A;  2NBU A;  4DDG D;  3ZIM A;  1UBQ A;  3VVW B;  4PYZ A;  3IVF A;  1FXT B;  4JL9 A;  3WIM A;  1OQY A;  3K9O B;  3APF A;  2NPT B;  4FLH A;  5E6O A;  4TQ0 A;  3V6C B;  4W9E A;  4MDK E;  3VTU A;  1NBF C;  3A1Q A;  3H7S A;  1WGY A;  2ZJD A;  4WJQ A;  5GMV A;  4WWP A;  3HHM A;  2DX5 B;  4MGI E;  3QC8 B;  5AZF A;  3A9J B;  3ECI A;  3RT3 B;  3IBE A;  4DDI D;  3NOB A;  3VQI A;  3M62 B;  3SU8 X;  5HKH A;  4IG7 B;  3ML8 A;  5LXI B;  4TQ1 A;  4FHK A;  1XD3 B;  2FCM A;  2CKH B;  2K8B A;  3NZS A;  4II3 B;  3VUW A;  2D10 A;  1E8Y A;  2XK5 B;  2GBJ A;  2FAZ A;  3HK0 A;  4KZ0 A;  1ISN A;  2DYM A;  2O6V A;  3UQA A;  3T9L A;  5DPW A;  1NDD A;  1E7U A;  3RD2 A;  1WZ3 A;  2AYO B;  3GZN I;  3IHP C;  3QAQ A;  2BPS A;  4NNJ B;  2WYQ A;  2KVR A;  2NBV B;  4ZYN A;  1YD8 U;  2IBI B;  3QJZ A;  3U7D A;  2KFK B;  2C7N B;  2GBM A;  2GBR A;  4HDQ A;  1V49 A;  3D32 A;  2KLC A;  4HPM B;  2J0K A;  3TMP B;  4PS7 A;  2KHW B;  1VD2 A;  2RD0 A;  3NZU A;  2BYE A;  2DYB A;  4GU2 A;  4HLE A;  2MA9 B;  5TR5 A;  3PHW B;  3DCG A;  3AI5 A;  4HK2 A;  3PGE A;  2MWS B;  4GN1 A;  1V86 A;  2NS5 A;  1H4R A;  4IWP A;  5J2R A;  2BKF A;  1IPG A;  1YIW A;  4II2 B;  4KZC A;  3RUL A;  4BBN C;  4AJY B;  1WXS A;  4F1S A;  2MLB A;  2KQ7 A;  3W1S C;  3CF6 E;  5IAA C;  4FHJ A;  4W9H A;  2LXA A;  2MQJ A;  3PRP B;  4EUT A;  4GDK A;  4GDL A;  5E6P A;  1SE9 A;  2JVC A;  3RZW C;  3CMM B;  3SDL C;  2BF8 B;  4KDI C;  1TTN A;  4MSQ B;  1CMX B;  2BGF A;  2N7D A;  3VHT C;  4TKN A;  1V6E A;  1WJN A;  4BVU C;  5E6N A;  1E7V A;  2KFJ A;  3M63 B;  1E8W A;  3PLU A;  1QZE A;  1V9J A;  2DYO A;  2HD5 B;  2ZCB A;  1RFA A;  1Z5S B;  2KC1 A;  4LDT D;  3UF8 A;  2LVP A;  2O2V B;  4FA6 A;  1ZGU B;  1E90 A;  3ZUN A;  1S3S G;  2KN5 A;  3M95 A;  3R66 C;  2D3G A;  4NJ7 A;  3ZNG C;  4DHZ B;  2WX0 A;  2N9P C;  4K7U A;  4ANV A;  4HDO A;  3NS8 A;  1WM2 A;  2G4S A;  2L00 B;  4W9D A;  2EKE C;  2LD9 A;  3VAW A;  1EUV B;  1HE8 A;  2NBW B;  1SIF A;  3ZKJ C;  2KZR A;  3JVZ X;  1KOT A;  2JWZ A;  2IZV B;  2L76 A;  1E5W A;  3OAW A;  4NQK E;  3U8Z A;  3ZRF A;  2JZZ A;  1WX9 A;  4BFR A;  2HE7 A;  1I42 A;  3PHX B;  2ZPN A;  4I6P A;  4CO7 A;  2ZVO A;  3TL5 A;  1UBI A;  4M0W B;  3VUX A;  2K6D B;  2C60 A;  2BWE S;  2MBO A;  1NI2 A;  2NPT A;  5D94 A;  1P3Q U;  2JF5 A;  4RMA A;  3DQV A;  3NHE B;  3QQ8 B;  4AOF A;  1TZ1 A;  2XK5 A;  4K7W A;  3WA0 A;  2MX2 A;  2L3Z A;  4GOC A;  2BYV E;  1A5R A;  3KVF B;  4MJS B;  5G55 A;  5KHO A;  4DK5 A;  1K8R B;  3RUI B;  4WJO A;  1WMH B;  3BY4 B;  4LCD E;  1YQB A;  2MP2 A;  1WFY A;  2IY1 B;  1V2Y A;  5J18 A;  4HJK A;  1V81 A;  2RGF A;  3AU4 A;  3KW5 B;  1T0Y A;  4URK A;  2KMA A;  4GB9 A;  5CTR C;  4A20 A;  3TCA A;  3ZO5 B;  1Y8R C;  1P98 A;  2JZ3 B;  3VH4 B;  2KDF B;  3ONS A;  3H9D A;  4J6I A;  4NJ6 A;  4G50 A;  1WGD A;  1OTR B;  4W9L A;  2IO3 B;  2KTF A;  2MCN B;  3N3K B;  2FUH B;  1L2N A;  3X0W A;  3VXW A;  1WMH A;  5AZH A;  4KIK A;  4FUL A;  3SD5 A;  2N4F A;  3ZDT A;  2ZEQ A;  3WAM A;  4W9I A;  3QCA A;  3KYD D;  2KJ6 A;  3ENE A;  4E74 A;  2K8C A;  5DPS A;  3QK0 A;  3P2B A;  3ZTD A;  4ASW C;  1Q0W B;  2GBN A;  3KUD B;  4LJP B;  4XX5 A;  2LGX A;  1WE6 A;  2CU1 A;  5CHV C;  2I1J A;  1GNU A;  3MTN B;  4JGH B;  4FJZ A;  4EZJ A;  2KO3 A;  4X57 B;  1RLF A;  2FNJ B;  2KOX A;  4ANX A;  4MH0 E;  3RCZ A;  2DEN B;  1WJ6 A;  3WAN A;  4B6W A;  1EF5 A;  3APC A;  3IFW B;  2KWU B;  4ZRI A;  2Z0E B;  5AEK B;  1OGW A;  4BKG A;  1V5T A;  2DZI A;  4PYU A;  3PRZ A;  1GC6 A;  2JPH A;  1GC7 A;  3S2A A;  2IYD B;  2LGD A;  4BKT A;  3Q3J A;  1LFD A;  4ZRK A;  4WWN A;  2KTR B;  1WI0 A;  1P9D U;  4B9K A;  4DHJ B;  1WJU A;  2AL6 A;  3LDZ E;  5D2M B;  3H7P B;  4CHK A;  3OJ3 A;  4GIV A;  2LZ6 A;  4KDL B;  1L7Y A;  3R3M A;  3V6E B;  3DBH I;  3V60 A;  3ZNI D;  4IM0 A;  2ZZP B;  3ZTC A;  4MJS A;  5D7G A;  1J0G A;  3H1U A;  1WM3 A;  2KJR A;  3QA8 A;  4JLC A;  3GOE A;  3I3T B;  2DAJ A;  1WE7 A;  2K1F A;  3C0R B;  2M4N A;  3UIP B;  4MGY E;  3RZF A;  1RRB A;  3AXC A;  1R4M I;  2REX A;  2Z0D B;  3NY5 A;  2OJR A;  2KX0 A;  3PVL A;  3W1Y A;  2AWT A;  5CX3 A;  1IP9 A;  1UD7 A;  2LVQ A;  3A4R A;  3UIO B;  4E3C A;  4W9J A;  4BOZ B;  1OEY J;  3KH0 A;  1WJ4 A;  3JYU A;  2IO1 B;  3A33 B;  4M8M A;  3V62 A;  4BKS D;  1TGZ B;  2AEH A;  2L8J A;  2DZJ A;  4NQL B;  2M0X A;  3UQB A;  2C7M B;  2V3S A;  3L10 B;  1WXV A;  4BOS C;  4LDT B;  2FIF A;  4A3P A;  1WIA A;  3ALB A;  1PQS A;  2IO0 B;  2JRH A;  1E8X A;  4I6N B;  3JSV B;  5CHW A;  2KWC A;  2WWZ A;  4GSW A;  4W9C A;  3O65 B;  4EFO A;  5JH5 C;  2J0J A;  4EOY A;  2EMT A;  4LJO B;  2NCN A;  1WF9 A;  1UGM A;  4OVV A;  2LWP A;  2L05 A;  2K8H A; 
#chains in the Genus database with same CATH topology
 2JUO A;  3ZLZ A;  4DXA B;  2KNB A;  2N9X A;  1TBE A;  2WXK A;  5JZE B;  3UIN B;  3Q2A C;  5AZG A;  1WX8 A;  3PPA A;  4YSY B;  4EZL A;  5AUI A;  2PE6 B;  1R4N I;  2DZK A;  3OLM D;  3GZN B;  2K5P A;  1VCB A;  1HZ5 A;  3IG3 A;  2JWU A;  2RPQ A;  3O13 A;  4WQO B;  4GLS C;  4DHJ D;  1C3T A;  2QCZ A;  3B08 A;  3T3N A;  1UEL A;  1J19 A;  1C76 A;  3Q8B A;  4NJC A;  3AEF B;  2RR9 A;  3KLS X;  2Y3A A;  4TV3 A;  3RFZ B;  2D07 B;  4NAW B;  3ZGZ A;  2L52 A;  4JWS C;  2FUG 1;  1WGH A;  4NAW A;  1R4N B;  4WIP A;  2C5L C;  4MGZ E;  1ZW7 A;  4ZRJ A;  1E8Z A;  4M0W A;  2K25 A;  2C9W B;  1HA5 A;  1L0Y B;  3ZNH B;  4BBN F;  3DVN U;  4US8 A;  4YTP B;  5LLI A;  2N1W A;  4N58 A;  1OFF A;  3APD A;  2KLG A;  1N63 A;  4YL8 A;  1I4H A;  2WXG A;  2ZCC A;  3ZQ4 A;  5T8I A;  2V1Y A;  3CSF A;  5DCN A;  1R7S A;  4W9K A;  2NR2 A;  1AAR A;  2LJ5 A;  3M3J A;  3DDC B;  4DHZ E;  1UWM A;  1D5X C;  5HI1 A;  4DBG A;  1J8C A;  1LM8 B;  1C4C A;  5KHQ A;  3BVZ A;  1YJ1 A;  3DBS A;  4HXD A;  2LUE A;  4ZHP A;  3TEX A;  2HJ8 A;  1KJT A;  4NY0 A;  2BT6 A;  3L54 A;  3PRM B;  1ESF A;  1ZDV A;  1RAX A;  3U30 A;  3DOW A;  3NJT A;  3A9K A;  3IXS A;  2ZPY A;  5IA7 A;  1WGG A;  2KX3 A;  1EF1 A;  2DAF A;  5BMH A;  1K53 A;  3DVG X;  2FCS A;  2RSU A;  1HEZ E;  3GE3 C;  3N9Y C;  4IWO A;  3SR6 A;  5IN7 A;  4XDC A;  2K3U A;  3EHV A;  3MJ5 A;  4P7I A;  3ZJU A;  3AE3 B;  1WYW B;  2MBE A;  1N61 A;  3NVZ A;  3HUI A;  2AQ1 B;  1KFY B;  2EKI A;  3RNB C;  1NYQ A;  4RF0 A;  4AQ7 A;  1V5O A;  3ZNZ B;  4MM3 A;  1K52 A;  3A4S C;  2G45 B;  1MI0 A;  4WAA A;  2OOB B;  2XEW A;  1DYQ A;  5H92 C;  2BYF A;  3FAH A;  4OVU A;  2O6V D;  1SE3 A;  1Y56 A;  4OZC A;  4G3X B;  4DWF A;  1XLN A;  3ZIM A;  1UBQ A;  1T0Q C;  4P1C C;  3WIM A;  1C9F A;  1NI3 A;  4W9E A;  3VTU A;  1V97 A;  2VZK B;  5GMV A;  4MGI E;  3QC8 B;  4N6E B;  2QC8 A;  4MM3 B;  3NOB A;  3VQI A;  4IG7 B;  1WGK A;  1IBX A;  3ZJT A;  2K8B A;  1E8Y A;  2BQQ A;  2GBJ A;  3N20 C;  1ISN A;  4KZ0 A;  2JU6 X;  3UQA A;  2BYT A;  1T6B X;  5DPW A;  1NDD A;  3DWM A;  3RD2 A;  1EWY C;  2ACZ B;  2AYO B;  2JZP A;  2WXF A;  3QAQ A;  2IBI B;  2GBM A;  2GBR A;  4HDQ A;  1RWS A;  1PYW D;  4HPM B;  2J0K A;  1FO4 A;  1XLQ A;  2BYE A;  3DCG A;  4HK2 A;  3OWE B;  3MC8 A;  3PGE A;  3B2F A;  1V86 A;  4IWP A;  3AEE B;  1TKG A;  4II2 B;  4BBN C;  3RUL A;  1M4V A;  3CIR B;  4AJY B;  2MLB A;  2N0S B;  1KTK A;  3CF6 E;  5IAA C;  5EE1 A;  3BZD B;  3PRP B;  4KDI C;  1V6E A;  1WJN A;  3ETR A;  4O1N A;  3MHZ A;  2LMC A;  1ZXI A;  3UF8 A;  1RFA A;  3ZUN A;  4EE2 A;  1JWM D;  2EEL A;  1ROE A;  4DHZ B;  1WM2 A;  1SE2 A;  2L00 B;  2EKE C;  2LD9 A;  4ZHO A;  2KAJ A;  3ZKJ C;  3JVZ X;  1KOT A;  4NQK E;  3OAW A;  1T0R C;  2NMQ A;  1FCC C;  1MPE A;  3AB5 A;  2VH1 A;  1AYF A;  3NS1 A;  3J9C A;  5D94 A;  4RMA A;  1YQ3 B;  1FCL A;  2WU2 B;  2L3Z A;  3KVF B;  5KHO A;  1FEH A;  4DK5 A;  3SFE B;  1VRA B;  4LCD E;  1F52 A;  2HTM E;  3AE6 B;  3MP9 A;  1WFY A;  3BVG A;  3PO0 A;  3KW5 B;  1T0Y A;  2WXH A;  5D3D A;  1IGD A;  3TCA A;  3ZO5 B;  1P98 A;  2M19 A;  1TKY A;  3VH4 B;  3H9D A;  1HXY D;  4G50 A;  1KLU D;  4ZOH C;  4W9L A;  1L2N A;  2MCN B;  2FUH B;  3X0W A;  1ZOY B;  1WMH A;  4KIK A;  4FUL A;  2N4F A;  3ZDT A;  2I2Y A;  2ZEQ A;  4W9I A;  3QCA A;  2K8C A;  1SSN A;  2J53 A;  4XGA B;  4ASW C;  2QIE B;  4XX5 A;  4XYC A;  2I1J A;  1YN4 A;  3DWG C;  1RLF A;  2B76 B;  2FNJ B;  4MH0 E;  3HVZ A;  5EE0 A;  4J3O D;  1VZ8 A;  4A8X C;  1OGW A;  4IOI E;  1L6U A;  1GOZ A;  4PYU A;  2DZI A;  1EU4 A;  3Q3J A;  2KTR B;  1QOB A;  4B9K A;  2OHF A;  1WJU A;  2AL6 A;  5D2M B;  3H7P B;  2W3R A;  3C8Y A;  1FMA D;  2MJ3 A;  2ZZP B;  3VR8 B;  3W5V B;  3QA8 A;  2J52 A;  3I3T B;  3UIP B;  5BMI A;  2BS3 B;  3AXC A;  2REX A;  3FIL A;  1XCQ L;  3PVL A;  2AWT A;  3P42 A;  2LVQ A;  2WU5 B;  3KH0 A;  1WJ4 A;  3JYU A;  1RM6 C;  2ZW1 A;  2M0X A;  2C7M B;  1YNT E;  1WXV A;  3ALB A;  4RGN A;  4I6N B;  3O65 B;  1WF9 A;  3B2G A;  1FD6 A;  1S1Q B;  2ZVN A;  2M56 B;  3Q3F A;  3DBL B;  4UDU C;  2I38 A;  2CHW A;  1SJH D;  4B95 A;  4WWM A;  5L95 C;  2A4Z A;  2D3A A;  4ZDV A;  4ARI A;  1KM7 A;  2ON8 A;  4MH8 A;  2D11 A;  2ZNV C;  3NVW A;  3ZVV A;  4MSM B;  3TJP A;  3WAO A;  1VDV A;  2PPH A;  5BO4 B;  2KQ4 X;  4RNA A;  2WDR B;  1XCT L;  2WNM A;  2J7Q B;  1T5X D;  5BMG A;  1TS5 A;  4IWQ A;  4FJV B;  3QWZ B;  1WRD B;  3AUL A;  3BK1 A;  1GG3 A;  4G11 A;  2EMS A;  4AP4 C;  5G5H A;  2M17 A;  2FCN A;  4GGQ A;  5EDS A;  4RGM A;  3GS2 A;  4MT5 A;  3VTW A;  1ZPS A;  1JRO A;  2Y5P A;  3P63 A;  3R2T A;  1RYJ A;  1WH3 A;  1JWA D;  2IO2 B;  3T3O A;  2WX1 A;  4A3O A;  1FPY A;  2LHE A;  2MRP A;  3U52 E;  2WXP A;  2R2O A;  4RGO S;  1PDX A;  5C2T B;  1UH6 A;  4HCN B;  1E7P B;  2Y5B B;  3H7P A;  4N9F 4;  2CR5 A;  3AH7 A;  1JCK B;  4JIO U;  2I1K A;  5E6J A;  2WXO A;  4MEL A;  2CJO A;  1BT0 A;  1TS2 A;  1P7F A;  2DLB A;  2IGD A;  3PTF C;  2R2Q A;  4FAD A;  4JQW C;  3B1L X;  2BB6 A;  3E56 A;  3W9C B;  1G6J A;  2CHZ A;  1ZP0 B;  4K1R B;  3TIX A;  2INC C;  2BWF A;  2HTH A;  3L0W B;  2YLM A;  5CHF A;  1ZKH A;  4IUM B;  2WDQ B;  2FID A;  2UU7 A;  3EEC A;  1Q10 A;  2BKR B;  5GXG B;  1WY8 A;  2L7R A;  4CYE A;  1P0R A;  4KGT A;  2VZK D;  1UF0 A;  3AEC B;  4ZYS A;  2MBB B;  2INP E;  3JSV A;  3QIJ A;  1LO5 D;  4PS8 A;  1UNS A;  1N6Z A;  2R61 A;  2KXJ A;  1V1P A;  2BS2 B;  3X23 A;  3L17 A;  3AEA B;  3PSE B;  1IUE A;  4C4V A;  1YX5 B;  1F0Z A;  4BKS A;  1YJJ A;  2C7H A;  1WX7 A;  1JWS D;  3VFK A;  4M00 A;  3GB1 A;  3PLV A;  3V61 A;  3PS6 A;  3RNE C;  4L23 A;  4MAC A;  1C1Y B;  4ZRQ A;  1XO3 A;  4MEM A;  4KVG B;  1UZX B;  1E6E B;  4HPL B;  2D2Q A;  3P4R B;  1VZ7 A;  3CST A;  4IKG A;  2KJH B;  4HCP B;  2L0F A;  3MFG A;  3AE1 B;  1TY2 A;  4TMA B;  3LJ3 A;  3EFU A;  4DXF A;  2GBK A;  3QHT A;  4ICV A;  2DZM A;  4XE0 A;  3RNA C;  4DDG D;  3U2S C;  3VVW B;  1MFW A;  4YXD B;  3K9O B;  2QJL A;  3APF A;  2NPT B;  1PGB A;  1UGJ A;  5E6O A;  3AV8 A;  1HQR D;  2JYT A;  1NBF C;  3H7S A;  1WGY A;  2ZJD A;  4REZ A;  3OG5 A;  4PT5 A;  1QOG A;  3Q8C A;  5AZF A;  3PZ8 A;  3A9J B;  3IBE A;  2CJN A;  1P7E A;  3SU8 X;  1XXG A;  4TQ1 A;  1GB4 A;  2KN4 A;  3VUW A;  2CKH B;  3NZS A;  3DHI C;  3T9L A;  2GB1 A;  3IHP C;  2W3S A;  4NNJ B;  4ZYN A;  2NBV B;  1YD8 U;  1YJI A;  4RFB A;  3ZYY X;  3D32 A;  3EA6 A;  3TMP B;  1VD2 A;  3NZU A;  3PHW B;  1TY0 A;  1GB1 A;  4GN1 A;  2K9X A;  3U7Z A;  4FHJ A;  2MQJ A;  2WGS A;  4EUT A;  4GDL A;  2L32 A;  1F1H A;  2JVC A;  1I4G A;  3N1Z C;  1CMX B;  2RDB C;  3AE7 B;  2N7D A;  4TKN A;  5G5G A;  1R4M B;  5HG2 A;  3UI3 A;  3AN1 A;  1QZE A;  2LJI A;  2O2V B;  4FA6 A;  2J42 A;  1S3S G;  2KN5 A;  3P4P B;  2D3G A;  1F2R I;  4P1B C;  3VAW A;  4C7Z A;  1SIF A;  3Q8A A;  2L76 A;  4BFR A;  1I42 A;  2HE7 A;  2IND C;  3PHX B;  2ZPN A;  4I6P A;  1I4P A;  1UBI A;  3EFC A;  2K6D B;  2NPT A;  2BS4 B;  4IDI A;  3NHE B;  3QQ8 B;  4AOF A;  1YMH E;  1C78 A;  2XK5 A;  2NTT A;  4GOC A;  2BYV E;  4MJS B;  3P1M A;  1K8R B;  3RUI B;  1CK1 A;  3RNG C;  3BY4 B;  2MP2 A;  4HJK A;  1V81 A;  4WAF A;  3AU4 A;  4JE3 B;  1ACC A;  2KMA A;  4GB9 A;  1YN3 A;  1TS4 A;  4H2A A;  1Y8R C;  4YSZ B;  2KDF B;  1BML C;  2QMT A;  3ONS A;  1KRH A;  4J6I A;  1OTR B;  2IO3 B;  1CJE A;  3SD5 A;  1GPX A;  2Y5C A;  2KJ6 A;  1WSP A;  2GBN A;  3WCQ A;  1WE6 A;  5CHV C;  1GNU A;  3MTN B;  3RI7 C;  1F2R C;  1N5W A;  4EZJ A;  1ENF A;  1UUP A;  4ANX A;  2K22 A;  2DEN B;  1WJ6 A;  3APC A;  3R2I A;  3DHG C;  4BKG A;  1I4X A;  1J7A A;  2IYD B;  4ZRK A;  1K51 A;  1FFU A;  3OJ3 A;  4GIV A;  2TSS A;  1QOA A;  3R3M A;  1J0G A;  3H1U A;  1WM3 A;  2KJR A;  2WHI A;  2DAJ A;  2K1F A;  3C0R B;  3Q6B A;  1QIL A;  2QSD A;  2ONQ A;  1AW7 A;  2WXI A;  4BOZ B;  1OEY J;  4JWU C;  1TS3 A;  2IO1 B;  3A33 B;  5FK9 C;  2AEH A;  2DZJ A;  1K50 A;  3L10 B;  1D4B A;  4A3P A;  1WIA A;  1YN5 A;  2KWC A;  4B0M A;  4EOY A;  1KLG D;  4LJO B;  4TSS A;  4M02 A;  2LWP A;  2XNA C;  3P4Q B;  2LXC A;  2BBC A;  4GXB A;  1NEN B;  4C4V B;  2Z8L A;  2MSE D;  3A9J A;  3W2D A;  1M94 A;  4R3D A;  3K9P B;  3PT2 B;  5C1Z A;  1C77 A;  4ANU A;  5L83 A;  3QX1 A;  1JRP A;  1T3Q A;  3Q3N C;  4F7Z A;  3Q14 C;  1XT9 B;  5BYR A;  2ASQ A;  4LK0 M;  1YX6 B;  2B3A A;  4NPN A;  2K39 A;  2PVO D;  2LI5 A;  1XF5 L;  3RNF C;  1E10 A;  1OQQ A;  2G3Q B;  2G4D B;  2N9E B;  1KH0 A;  4YTM B;  2WXR A;  3I5J C;  1WZ0 A;  4TUU A;  3PV1 A;  5IO9 A;  4XC2 A;  4USA A;  1Q5W B;  2WLB A;  1Z2M A;  3NRZ A;  3UGB B;  2L1A A;  2KWD A;  3HM3 A;  1L4D B;  3TBL D;  2WXQ A;  1TIF A;  4EEW A;  3BYT B;  1STE A;  4RGT A;  5JHB A;  1FM0 D;  1PGX A;  2VRR B;  5EE9 A;  3VTV A;  2KC2 A;  4AWJ A;  1E9M A;  1JW9 D;  2NVU I;  3IT4 B;  3DVN V;  1Q1O A;  2FCQ A;  1WXA A;  2KDB A;  3QAR A;  1PGA A;  2KAN A;  4W9G A;  4XZ4 A;  2FBW B;  3ZXR A;  3IT6 B;  2LEK A;  4KSL C;  1SBB B;  4IW0 A;  2V3N A;  4ARC A;  2J0M A;  2LGY A;  4DQO C;  3AEG B;  2KFK A;  2LRW A;  1JQ4 A;  4JX1 C;  2DHZ A;  2QHO A;  3DBL I;  4A6Q A;  1WR1 A;  2KT7 A;  2LVO A;  1LXD A;  3LYY A;  2K6Q A;  5I4D A;  3W5U B;  2HDE A;  1WR6 E;  2M1M A;  2WS3 B;  2Q5W D;  3TSS A;  2GOW A;  2MJD A;  3DVG Y;  5FR6 A;  4C7Y A;  3ML9 A;  2MP2 B;  3MJW A;  1TJE A;  2SAK A;  3L16 A;  4AS1 A;  1MHH E;  2PE9 A;  1MG8 A;  2KK8 A;  2JXX A;  4A9A A;  2DBY A;  4WJP A;  1EU3 A;  1V1P B;  5BYQ A;  4WWO A;  5JXV A;  1HTQ A;  2JY6 A;  5JHA A;  3HM6 X;  5FKA C;  4GMV A;  3KYC D;  3PRE A;  4YSX B;  4ZRP A;  2PIA A;  2QDF A;  3VRB B;  1HZ6 A;  4FBJ B;  4M8N A;  4K7S A;  4P16 A;  1XQQ A;  1JWB D;  2D5G A;  2PEA A;  4I6L B;  3WAP A;  3BII D;  1VZ6 A;  4KKI A;  1MVK A;  2O6V B;  1SB3 C;  2KDE B;  4JPS A;  2ZNV B;  1V80 A;  3NVV A;  4OHJ A;  2KKC A;  2QEJ C;  2YVC A;  3NG0 A;  4WH4 A;  3DBH B;  2MBQ A;  2PKO A;  3ZDM C;  2AQ3 B;  4AJW A;  4C80 A;  4P6V F;  4EKU A;  2MW5 A;  1AWD A;  2E3T A;  2KYW A;  1FRR A;  4RM8 A;  1FRD A;  2KDM A;  2KWV B;  4YWG G;  3T8M A;  4ACF A;  3R7Q A;  2GMI C;  2MJE A;  3TUO A;  2L0T A;  2NBU A;  4PYZ A;  1SF0 A;  4JL9 A;  3Q8E A;  3GP7 A;  4TQ0 A;  3AMZ A;  4MDK E;  1XLP A;  4WJQ A;  4CQN A;  3FIL B;  4NZL B;  2DWQ A;  4HKZ E;  3HHM A;  2DX5 B;  1MG4 A;  3ECI A;  4DDI D;  4HRS A;  2OJW A;  3LXF A;  2BTE A;  1F77 A;  3ML8 A;  5LXI B;  2WQY B;  4FHK A;  1XD3 B;  2FCM A;  4II3 B;  2D10 A;  5C3J B;  2FAZ A;  1DOX A;  1WZ3 A;  3GZN I;  2BPS A;  2KVR A;  3NVY A;  1C79 A;  3QJZ A;  2C7N B;  1V49 A;  2KLC A;  1I4Q A;  4PS7 A;  2KHW B;  2RD0 A;  4GU2 A;  4HLE A;  2AQ2 B;  2MWS B;  1ZXH A;  2NS5 A;  4B0E A;  1IGC A;  1YIW A;  4KZC A;  2V4I B;  3Q3O C;  3RPF C;  4F1S A;  2LGS A;  4LNK A;  4XDD A;  1L0X B;  2LHD A;  3W1S C;  3KQ4 A;  2FE8 A;  5E6P A;  1SE9 A;  3RZW C;  3SDL C;  2BF8 B;  1TTN A;  2VH2 A;  4L2Y A;  5E6N A;  1E8W A;  1FNV A;  2DYO A;  2HD5 B;  2ZCB A;  1Z5S B;  2G9H D;  2KC1 A;  2L83 A;  1I7H A;  4LDT D;  4BZA A;  2LVP A;  1E90 A;  4L1B A;  3M95 A;  2W54 A;  4NJ7 A;  3DBR B;  2XN9 C;  4HPP A;  4K7U A;  4ANV A;  4HDO A;  1WYG A;  2G4S A;  1L4Z B;  1VR9 A;  1HE8 A;  2NBW B;  2JWZ A;  2IZV B;  3U8Z A;  1E5W A;  1WX9 A;  1QT9 A;  3CWI A;  2V3P A;  3TL5 A;  4A55 A;  4M0W B;  3VUX A;  2BWE S;  1NI2 A;  2WXN A;  1P3Q U;  2JF5 A;  1TZ1 A;  3I57 A;  2N7J A;  3N1X C;  4LNI A;  4C56 C;  1A5R A;  1TKE A;  4WJO A;  1YQB A;  2IY1 B;  1V2Y A;  1FNU A;  2RGF A;  1CZP A;  2H88 B;  3Q8F A;  4A20 A;  2DNF A;  2JZ3 B;  1T0S C;  4YT0 B;  4OZA A;  4NJ6 A;  1WGD A;  3N3K B;  1KF6 B;  3VXW A;  5LNK 1;  1QOF A;  2RPV A;  3AM9 A;  3KYD D;  2LGI A;  4E74 A;  4M01 A;  1Q0W B;  3KUD B;  4LJP B;  3HVD A;  2LGX A;  4JGH B;  4X57 B;  3I63 C;  1DGJ A;  3RCZ A;  1FFV A;  3WAN A;  4B6W A;  1EF5 A;  2KWU B;  4ZRI A;  2Z0E B;  4XWT A;  4DXG A;  1FIQ A;  3PRZ A;  1J7C A;  2JPH A;  1GC7 A;  4WWN A;  1WI0 A;  2PVG C;  3ZJV A;  4DHJ B;  5FR3 A;  1WXQ A;  3LDZ E;  4CHK A;  3E9S A;  1L0V B;  3GE8 C;  2JX5 A;  2W82 A;  2PMV A;  4PK1 A;  1MJD A;  4KDL B;  3ZTC A;  4MJS A;  4JLC A;  1VJK A;  1WE7 A;  4YTN B;  3EUB 2;  1D5Z C;  4MGY E;  3RZF A;  1RRB A;  1R4M I;  1N5X A;  2OJR A;  2KX0 A;  4FXC A;  2D3B A;  5TSS A;  5CX3 A;  1J7B A;  1N60 A;  2BW2 A;  1SXT A;  1FXA A;  3UIO B;  2SEB D;  4M8M A;  4OW0 A;  1BUI C;  1TGZ B;  2L8J A;  4NQL B;  1SIJ A;  1WRI A;  4BOS C;  2X8X X;  4WQM A;  1PQS A;  4LNF A;  2JRH A;  1E8X A;  1SE4 A;  4W9C A;  5JH5 C;  2J0J A;  1L6V A;  4US9 A;  1UGM A;  2M0A A;  1NYR A;  4S0R A;  2D3C A;  2KD0 A;  1IYF A;  1VLB A;  2V9H A;  4QAY A;  4RF1 A;  4PS3 A;  2BVC A;  3N32 A;  1ET9 A;  2UWQ A;  3B0A A;  3AE5 B;  2N9K A;  2JQR B;  1MHX A;  4HVB A;  2N1V A;  4KV2 A;  1D5M C;  1SJE D;  5D6J B;  4EZK A;  4C00 A;  2OED A;  3MC0 B;  1QF6 A;  2N7E A;  4KSK C;  1N62 A;  2CHX A;  3BIN A;  1EO6 A;  3DPD A;  2WXL A;  4IM3 A;  1OEY A;  4ANW A;  1SGH A;  3ZW3 A;  4ICU A;  3N1Y C;  3W1S A;  2AL3 A;  1LQB A;  5HFY A;  3AU5 A;  1JML A;  2IDY A;  1QKZ A;  2IPK D;  2LAS A;  2LRU A;  1QQR A;  5DPR A;  3I9V 1;  2YEP F;  3ABV B;  1GJZ A;  1I4R A;  3A9K B;  3JW0 X;  1EWC A;  1EM7 A;  3PZD A;  4G0N B;  2KAC A;  4K81 A;  3ZRC A;  4BAX A;  2JXT A;  1BXT A;  2KQS A;  2G1E A;  3LB8 C;  3V05 A;  1TT5 B;  4RCO A;  4WJN A;  3AE9 B;  1F9J A;  3BK2 A;  5DPT A;  2KTR A;  5IKC M;  2KMC A;  1WXM A;  3IAS 1;  3URY A;  2MBH A;  2WXJ A;  5MPO A;  4FN2 A;  1I35 A;  4GDK B;  3EGR A;  2JT4 B;  1D6E C;  1P1A A;  2IY0 B;  2QIL A;  4KIK B;  3N30 A;  1AN8 A;  1TYG B;  2HJ1 A;  3FC4 A;  2CS4 A;  3RYT A;  2GLS A;  4RM9 A;  1C4P A;  4IC7 B;  3MHS D;  4S17 A;  2MH7 A;  2O2V A;  1KLV A;  1LGR A;  1WGR A;  2GRI A;  3R7R A;  2KDI A;  3KUZ A;  4FJY A;  1U4A A;  3H6N A;  2JRI B;  2LFI A;  5C23 A;  2J4X A;  3VH3 B;  3HIZ A;  2PLP A;  4W9F A;  5LXH A;  3A1Q B;  4IM2 A;  2N9L A;  3AE4 B;  3VUY A;  3OJ4 B;  2YEP B;  4GDL B;  1V1O A;  4F8C B;  3DBR I;  2WP9 B;  3SHQ A;  3AEB B;  1TZO A;  1GUA B;  2M8S A;  1ZUD 2;  3L13 A;  5AUK A;  1NEK B;  4AUQ C;  2Z59 B;  1H8C A;  4OZB A;  3NZ3 A;  2PJH A;  2V4L A;  1PUT A;  4ITK A;  1YOV B;  4OVZ A;  3WAL A;  2A5U A;  2WDT B;  3BWU D;  3ZXV A;  4HKQ A;  3SEB A;  5G2N A;  4HWI B;  1JRU A;  3L08 A;  3EC8 A;  3HRD D;  3FKY A;  5J17 A;  4N59 A;  2BB5 A;  3DHH C;  2K0P A;  3VDZ A;  3R8B A;  2H89 B;  3C19 A;  4MGK E;  1D3Z A;  3KUC B;  4E71 A;  2JSV X;  1X1M A;  3Q69 A;  2MHJ A;  2MEK A;  3P4S B;  1B1Z A;  2ZW0 A;  2UYZ B;  4KX6 B;  2XBB C;  2X38 A;  2W9N A;  1FNW A;  2NTS A;  5EE3 A;  2RMM A;  4LNO A;  3AE2 B;  4KKJ A;  3IVF A;  1FXT B;  4WUR A;  1OQY A;  4FLH A;  2GI9 A;  3V6C B;  3IAM 1;  3VR9 B;  3A1Q A;  2PTL A;  4WWP A;  2INN E;  4KGS A;  5H8Y E;  3NUH B;  3RT3 B;  3MC9 A;  3M62 B;  5HKH A;  2KVZ A;  5HHD G;  1GAQ B;  2RDG A;  2XK5 B;  3HK0 A;  3RN9 C;  5BYS A;  2DYM A;  2O6V A;  1ET6 A;  3BYY B;  1E7U A;  2WYQ A;  3B9J A;  3TEZ A;  3U7D A;  2KFK B;  2PW9 A;  3KWV A;  1XLO A;  2DYB A;  2MA9 B;  4KGR A;  5TR5 A;  2ICI A;  3AI5 A;  1H4R A;  1ZDX A;  5J2R A;  2BKF A;  1IPG A;  2V0G A;  1B9R A;  3SFD B;  2IJ0 A;  1WXS A;  3L4P A;  1DOI A;  1E0Z A;  2KQ7 A;  4W9H A;  2LXA A;  4GDK A;  3CMM B;  4MSQ B;  3RNC C;  2BGF A;  1JAL A;  3VHT C;  4BVU C;  1E7V A;  2KFJ A;  3M63 B;  3PLU A;  1V9J A;  3KWL A;  1SEB D;  1ZGU B;  2KMM A;  1CQV A;  3R66 C;  3ZNG C;  2WX0 A;  2N9P C;  3NS8 A;  1PFD A;  4W9D A;  2AX5 A;  1A70 A;  1EUV B;  3AE8 B;  2KZR A;  3ZRF A;  2JZZ A;  4CO7 A;  2ZVO A;  1FXI A;  5D3I B;  2C60 A;  4XWW A;  2MBO A;  4A90 A;  2WDV B;  2E6X A;  3DQV A;  3WA0 A;  4K7W A;  2MX2 A;  5G55 A;  3RMK C;  2JYE A;  1OQR A;  2IGG A;  1WMH B;  3TEW A;  5J18 A;  2LUM A;  4URK A;  3Q3M C;  4D2K A;  1HTO A;  5CTR C;  2IGH A;  1ZE3 D;  3AED B;  2WXM A;  1RFK A;  1IBX B;  2KTF A;  4Q2J A;  5AZH A;  1L5P A;  1XEE A;  3WAM A;  5IP4 D;  3ENE A;  4HJG E;  5DPS A;  3QK0 A;  3P2B A;  3ZTD A;  2CU1 A;  1C4A A;  3BVM A;  4FJZ A;  2KO3 A;  2KOX A;  1UWX A;  3TEY A;  1YQ4 B;  1V8C A;  3IFW B;  5AEK B;  4HRO A;  1V5T A;  1GC6 A;  3S2A A;  2LGD A;  4BKT A;  1LFD A;  3VRA B;  1P9D U;  3PZ7 A;  2LZ6 A;  3V3X A;  1L7Y A;  3V6E B;  3DBH I;  3V60 A;  3ZNI D;  4IM0 A;  5D7G A;  4LNN A;  1WWT A;  3GOE A;  2M4N A;  1QLB B;  3U4E G;  2Z0D B;  4LTU A;  3NY5 A;  1DOY A;  3W1Y A;  4NAM A;  2CU3 A;  1IP9 A;  1UD7 A;  3A4R A;  4E3C A;  4RH6 A;  4W9J A;  3H8H A;  4LLG M;  2RDH A;  3V62 A;  4BKS D;  3UQB A;  2V3S A;  4LDT B;  2FIF A;  2IO0 B;  4HEA 1;  1JWU D;  2W55 A;  5IOI A;  1NVI D;  4K3C A;  3JSV B;  5CHW A;  2WWZ A;  4GSW A;  4EFO A;  2EMT A;  4K3B A;  2NCN A;  4OVV A;  2L05 A;  2K8H A; 
#chains in the Genus database with same CATH homology
 2KD0 A;  1S1Q B;  2JUO A;  1IYF A;  2ZVN A;  3ZLZ A;  2LXC A;  3Q3F A;  4PS3 A;  4DXA B;  2KNB A;  4GXB A;  2N9X A;  3N32 A;  1TBE A;  2MSE D;  3A9J A;  2CHW A;  5JZE B;  1M94 A;  2UWQ A;  3UIN B;  4B95 A;  3K9P B;  3PT2 B;  5AZG A;  5C1Z A;  1WX8 A;  3B0A A;  3PPA A;  5L95 C;  2A4Z A;  4EZL A;  4ANU A;  4HVB A;  2N1V A;  3QX1 A;  4ZDV A;  5L83 A;  4KV2 A;  1KM7 A;  5D6J B;  2PE6 B;  4F7Z A;  4EZK A;  1XT9 B;  2D11 A;  2ASQ A;  2ZNV C;  1R4N I;  1YX6 B;  2DZK A;  2B3A A;  4NPN A;  2K39 A;  2LI5 A;  3OLM D;  2N7E A;  1VCB A;  4KSK C;  3ZVV A;  2G3Q B;  2CHX A;  3BIN A;  1EO6 A;  2G4D B;  2N9E B;  3DPD A;  3IG3 A;  4MSM B;  3TJP A;  3WAO A;  2PPH A;  4IM3 A;  5BO4 B;  1OEY A;  4ANW A;  2RPQ A;  1SGH A;  4WQO B;  4DHJ D;  1WZ0 A;  1C3T A;  2J7Q B;  3ZW3 A;  4ICU A;  3B08 A;  4IWQ A;  4TUU A;  3PV1 A;  4XC2 A;  3W1S A;  1UEL A;  2AL3 A;  4FJV B;  3QWZ B;  1LQB A;  1Q5W B;  1J19 A;  1WRD B;  3AUL A;  3AU5 A;  1Z2M A;  1GG3 A;  2LAS A;  2LRU A;  3UGB B;  4G11 A;  3HM3 A;  2EMS A;  5DPR A;  3TBL D;  2RR9 A;  1GJZ A;  4TV3 A;  4AP4 C;  3A9K B;  3JW0 X;  2D07 B;  2M17 A;  4EEW A;  5JHB A;  4NAW B;  2FCN A;  3PZD A;  4GGQ A;  4G0N B;  5EDS A;  2VRR B;  4K81 A;  3ZRC A;  3VTW A;  1WGH A;  4NAW A;  3VTV A;  2C5L C;  2KC2 A;  4AWJ A;  4MGZ E;  1ZW7 A;  2KQS A;  4ZRJ A;  1E8Z A;  2NVU I;  4WJN A;  1WH3 A;  3DVN V;  1Q1O A;  2FCQ A;  1WXA A;  2K25 A;  2KDB A;  2IO2 B;  1F9J A;  2WX1 A;  5DPT A;  2C9W B;  2KTR A;  3QAR A;  4W9G A;  2KAN A;  2MRP A;  4XZ4 A;  3ZNH B;  4A3O A;  4BBN F;  3DVN U;  2KMC A;  5LLI A;  2N1W A;  1WXM A;  4KSL C;  2R2O A;  2MBH A;  3APD A;  1UH6 A;  2KLG A;  4IW0 A;  4FN2 A;  4HCN B;  2J0M A;  4GDK B;  4YL8 A;  1I35 A;  2LGY A;  2Y5B B;  3H7P A;  4N9F 4;  2ZCC A;  2CR5 A;  2JT4 B;  2KFK A;  4JIO U;  1P1A A;  2IY0 B;  4KIK B;  2LRW A;  2V1Y A;  3N30 A;  3CSF A;  2DHZ A;  2QHO A;  2I1K A;  3DBL I;  5DCN A;  4W9K A;  2NR2 A;  1AAR A;  1WR1 A;  2LJ5 A;  2LVO A;  1LXD A;  3M3J A;  4MEL A;  2K6Q A;  1BT0 A;  2CS4 A;  3DDC B;  3RYT A;  1WR6 E;  4DHZ E;  2M1M A;  4RM9 A;  3PTF C;  2GOW A;  4IC7 B;  3MHS D;  2R2Q A;  4DBG A;  1J8C A;  4FAD A;  1LM8 B;  2O2V A;  4JQW C;  5KHQ A;  3B1L X;  1KLV A;  3DVG Y;  1WGR A;  5FR6 A;  3R7R A;  3ML9 A;  2MP2 B;  4HXD A;  1YJ1 A;  2CHZ A;  2KDI A;  3DBS A;  2LUE A;  3KUZ A;  4K1R B;  3TIX A;  1G6J A;  4FJY A;  3MJW A;  2BWF A;  2HJ8 A;  2HTH A;  1KJT A;  3L16 A;  1U4A A;  4NY0 A;  3H6N A;  2JRI B;  3L0W B;  3L54 A;  5C23 A;  2PE9 A;  3PRM B;  3VH3 B;  1MG8 A;  3HIZ A;  1RAX A;  2YLM A;  4W9F A;  5LXH A;  2KK8 A;  3DOW A;  3A1Q B;  3U30 A;  5CHF A;  1ZKH A;  2JXX A;  3A9K A;  4IUM B;  4IM2 A;  4WJP A;  2ZPY A;  3VUY A;  5IA7 A;  4WWO A;  3OJ4 B;  2FID A;  1WGG A;  2KX3 A;  3EEC A;  2BKR B;  4GDL B;  3DBR I;  4F8C B;  1EF1 A;  2DAF A;  2JY6 A;  1WY8 A;  2L7R A;  3HM6 X;  5JHA A;  4GMV A;  3KYC D;  3PRE A;  3SHQ A;  1GUA B;  4CYE A;  1P0R A;  2M8S A;  3DVG X;  2MBB B;  3L13 A;  2FCS A;  3JSV A;  2RSU A;  3QIJ A;  4AUQ C;  2Z59 B;  1H8C A;  4PS8 A;  2PJH A;  4IWO A;  2V4L A;  2KXJ A;  3WAL A;  4FBJ B;  2A5U A;  2WDT B;  3X23 A;  4M8N A;  3L17 A;  3EHV A;  3PSE B;  4K7S A;  4P7I A;  1XQQ A;  2PEA A;  4I6L B;  1WYW B;  5G2N A;  4HWI B;  3WAP A;  1JRU A;  1YX5 B;  3L08 A;  3EC8 A;  4BKS A;  2MBE A;  2C7H A;  1WX7 A;  2O6V B;  5J17 A;  3VFK A;  2KDE B;  3VDZ A;  2ZNV B;  1V80 A;  3PLV A;  3V61 A;  4MGK E;  2KKC A;  3PS6 A;  2YVC A;  1C1Y B;  1V5O A;  3ZNZ B;  4MM3 A;  2MBQ A;  4MEM A;  4KVG B;  3ZDM C;  1UZX B;  1D3Z A;  3KUC B;  3A4S C;  2G45 B;  4AJW A;  4E71 A;  4HPL B;  2D2Q A;  4WAA A;  2OOB B;  2XEW A;  3CST A;  4EKU A;  1X1M A;  2BYF A;  2MW5 A;  4OVU A;  2KJH B;  2O6V D;  4HCP B;  4RM8 A;  2L0F A;  2UYZ B;  2KWV B;  3LJ3 A;  2XBB C;  3EFU A;  3T8M A;  2W9N A;  4G3X B;  2GBK A;  2GMI C;  3R7Q A;  3QHT A;  4DWF A;  4ICV A;  2DZM A;  2L0T A;  2NBU A;  4DDG D;  3ZIM A;  1UBQ A;  3VVW B;  4PYZ A;  3IVF A;  1FXT B;  4JL9 A;  3WIM A;  1OQY A;  3K9O B;  3APF A;  2NPT B;  4FLH A;  5E6O A;  4TQ0 A;  3V6C B;  4W9E A;  4MDK E;  3VTU A;  1NBF C;  3A1Q A;  3H7S A;  1WGY A;  2ZJD A;  4WJQ A;  5GMV A;  4WWP A;  3HHM A;  2DX5 B;  4MGI E;  3QC8 B;  5AZF A;  3A9J B;  3ECI A;  3RT3 B;  3IBE A;  4DDI D;  3NOB A;  3VQI A;  3M62 B;  3SU8 X;  5HKH A;  4IG7 B;  3ML8 A;  5LXI B;  4TQ1 A;  4FHK A;  1XD3 B;  2FCM A;  2CKH B;  2K8B A;  3NZS A;  4II3 B;  3VUW A;  2D10 A;  1E8Y A;  2XK5 B;  2GBJ A;  2FAZ A;  3HK0 A;  4KZ0 A;  1ISN A;  2DYM A;  2O6V A;  3UQA A;  3T9L A;  5DPW A;  1NDD A;  1E7U A;  3RD2 A;  1WZ3 A;  2AYO B;  3GZN I;  3IHP C;  3QAQ A;  2BPS A;  4NNJ B;  2WYQ A;  2KVR A;  2NBV B;  4ZYN A;  1YD8 U;  2IBI B;  3QJZ A;  3U7D A;  2KFK B;  2C7N B;  2GBM A;  2GBR A;  4HDQ A;  1V49 A;  3D32 A;  2KLC A;  4HPM B;  2J0K A;  3TMP B;  4PS7 A;  2KHW B;  1VD2 A;  2RD0 A;  3NZU A;  2BYE A;  2DYB A;  4GU2 A;  4HLE A;  2MA9 B;  5TR5 A;  3PHW B;  3DCG A;  3AI5 A;  4HK2 A;  3PGE A;  2MWS B;  4GN1 A;  1V86 A;  2NS5 A;  1H4R A;  4IWP A;  5J2R A;  2BKF A;  1IPG A;  1YIW A;  4II2 B;  4KZC A;  3RUL A;  4BBN C;  4AJY B;  1WXS A;  4F1S A;  2MLB A;  2KQ7 A;  3W1S C;  3CF6 E;  5IAA C;  4FHJ A;  4W9H A;  2LXA A;  2MQJ A;  3PRP B;  4EUT A;  4GDK A;  4GDL A;  5E6P A;  1SE9 A;  2JVC A;  3RZW C;  3CMM B;  3SDL C;  2BF8 B;  4KDI C;  1TTN A;  4MSQ B;  1CMX B;  2BGF A;  2N7D A;  3VHT C;  4TKN A;  1V6E A;  1WJN A;  4BVU C;  5E6N A;  1E7V A;  2KFJ A;  3M63 B;  1E8W A;  3PLU A;  1QZE A;  1V9J A;  2DYO A;  2HD5 B;  2ZCB A;  1RFA A;  1Z5S B;  2KC1 A;  4LDT D;  3UF8 A;  2LVP A;  2O2V B;  4FA6 A;  1ZGU B;  1E90 A;  3ZUN A;  1S3S G;  2KN5 A;  3M95 A;  3R66 C;  2D3G A;  4NJ7 A;  3ZNG C;  4DHZ B;  2WX0 A;  2N9P C;  4K7U A;  4ANV A;  4HDO A;  3NS8 A;  1WM2 A;  2G4S A;  2L00 B;  4W9D A;  2EKE C;  2LD9 A;  3VAW A;  1EUV B;  1HE8 A;  2NBW B;  1SIF A;  3ZKJ C;  2KZR A;  3JVZ X;  1KOT A;  2JWZ A;  2IZV B;  2L76 A;  1E5W A;  3OAW A;  4NQK E;  3U8Z A;  3ZRF A;  2JZZ A;  1WX9 A;  4BFR A;  2HE7 A;  1I42 A;  3PHX B;  2ZPN A;  4I6P A;  4CO7 A;  2ZVO A;  3TL5 A;  1UBI A;  4M0W B;  3VUX A;  2K6D B;  2C60 A;  2BWE S;  2MBO A;  1NI2 A;  2NPT A;  5D94 A;  1P3Q U;  2JF5 A;  4RMA A;  3DQV A;  3NHE B;  3QQ8 B;  4AOF A;  1TZ1 A;  2XK5 A;  4K7W A;  3WA0 A;  2MX2 A;  2L3Z A;  4GOC A;  2BYV E;  1A5R A;  3KVF B;  4MJS B;  5G55 A;  5KHO A;  4DK5 A;  1K8R B;  3RUI B;  4WJO A;  1WMH B;  3BY4 B;  4LCD E;  1YQB A;  2MP2 A;  1WFY A;  2IY1 B;  1V2Y A;  5J18 A;  4HJK A;  1V81 A;  2RGF A;  3AU4 A;  3KW5 B;  1T0Y A;  4URK A;  2KMA A;  4GB9 A;  5CTR C;  4A20 A;  3TCA A;  3ZO5 B;  1Y8R C;  1P98 A;  2JZ3 B;  3VH4 B;  2KDF B;  3ONS A;  3H9D A;  4J6I A;  4NJ6 A;  4G50 A;  1WGD A;  1OTR B;  4W9L A;  2IO3 B;  2KTF A;  2MCN B;  3N3K B;  2FUH B;  1L2N A;  3X0W A;  3VXW A;  1WMH A;  5AZH A;  4KIK A;  4FUL A;  3SD5 A;  2N4F A;  3ZDT A;  2ZEQ A;  3WAM A;  4W9I A;  3QCA A;  3KYD D;  2KJ6 A;  3ENE A;  4E74 A;  2K8C A;  5DPS A;  3QK0 A;  3P2B A;  3ZTD A;  4ASW C;  1Q0W B;  2GBN A;  3KUD B;  4LJP B;  4XX5 A;  2LGX A;  1WE6 A;  2CU1 A;  5CHV C;  2I1J A;  1GNU A;  3MTN B;  4JGH B;  4FJZ A;  4EZJ A;  2KO3 A;  4X57 B;  1RLF A;  2FNJ B;  2KOX A;  4ANX A;  4MH0 E;  3RCZ A;  2DEN B;  1WJ6 A;  3WAN A;  4B6W A;  1EF5 A;  3APC A;  3IFW B;  2KWU B;  4ZRI A;  2Z0E B;  5AEK B;  1OGW A;  4BKG A;  1V5T A;  2DZI A;  4PYU A;  3PRZ A;  1GC6 A;  2JPH A;  1GC7 A;  3S2A A;  2IYD B;  2LGD A;  4BKT A;  3Q3J A;  1LFD A;  4ZRK A;  4WWN A;  2KTR B;  1WI0 A;  1P9D U;  4B9K A;  4DHJ B;  1WJU A;  2AL6 A;  3LDZ E;  5D2M B;  3H7P B;  4CHK A;  3OJ3 A;  4GIV A;  2LZ6 A;  4KDL B;  1L7Y A;  3R3M A;  3V6E B;  3DBH I;  3V60 A;  3ZNI D;  4IM0 A;  2ZZP B;  3ZTC A;  4MJS A;  5D7G A;  1J0G A;  3H1U A;  1WM3 A;  2KJR A;  3QA8 A;  4JLC A;  3GOE A;  3I3T B;  2DAJ A;  1WE7 A;  2K1F A;  3C0R B;  2M4N A;  3UIP B;  4MGY E;  3RZF A;  1RRB A;  3AXC A;  1R4M I;  2REX A;  2Z0D B;  3NY5 A;  2OJR A;  2KX0 A;  3PVL A;  3W1Y A;  2AWT A;  5CX3 A;  1IP9 A;  1UD7 A;  2LVQ A;  3A4R A;  3UIO B;  4E3C A;  4W9J A;  4BOZ B;  1OEY J;  3KH0 A;  1WJ4 A;  3JYU A;  2IO1 B;  3A33 B;  4M8M A;  3V62 A;  4BKS D;  1TGZ B;  2AEH A;  2L8J A;  2DZJ A;  4NQL B;  2M0X A;  3UQB A;  2C7M B;  2V3S A;  3L10 B;  1WXV A;  4BOS C;  4LDT B;  2FIF A;  4A3P A;  1WIA A;  3ALB A;  1PQS A;  2IO0 B;  2JRH A;  1E8X A;  4I6N B;  3JSV B;  5CHW A;  2KWC A;  2WWZ A;  4GSW A;  4W9C A;  3O65 B;  4EFO A;  5JH5 C;  2J0J A;  4EOY A;  2EMT A;  4LJO B;  2NCN A;  1WF9 A;  1UGM A;  4OVV A;  2LWP A;  2L05 A;  2K8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...