1LO5D

Crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
233
structure length
233
Chain Sequence
b'SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIAIYLYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal Structure of a SEA Variant in Complex with MHC Class II Reveals the Ability of SEA to Crosslink MHC Molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 54
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lo5D01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1lo5D02
2AQ3B 3BVZA 1CHQD 1BCPB 1ET6A 2J4XA 4UDUC 4RGMA 5ELEA 3URYA 5ELCA 1PTOB 3KLSX 1B44D 1LTID 1HTLD 1RDPD 3EA6A 5ELDA 1S5ED 1TS2A 1KTKA 2IJ0A 2XRQD 1CHPD 1PZID 1LTSD 1M4VA 3GP7A 1XTCD 5D3DA 1ENFA 3SEBA 4RGOS 1SJHD 1LTRD 1FD7D 1LTBD 1PRTC 1PZJD 1EEFD 4DXGA 1PTOH 1JWUD 1TY0A 4RFBA 3R2TA 4RGNA 1I4PA 4Z9CB 2QEJC 1KLGD 1FNUA 1ET9A 2Z8LA 1L0YB 4TSSA 1LT6D 1RCVD 3BVMA 1YN3A 1L0XB 2RDGA 1FNVA 1EWCA 1JQYD 1BCPF 1F77A 1TS3A 1S5CD 1SEBD 2G9HD 3O13A 1FGBD 4RGTA 1D5XC 4C56C 1PRTD 5FKAC 4O1NA 1AW7A 4RH6A 2WV6D 5TSSA 4ZYSA 3MC0B 1YN4A 3W2DA 1V1OA 1G8ZD 5ELFA 3BVGA 3R2IA 1HXYD 1D6EC 4DXFA 3DWAA 2CHBD 2NTSA 1BCPC 1CT1D 1UUPA 1I4QA 4L63B 3DWQA 1SJED 1LT4D 1EU4A 1JCKB 1LT5D 1HA5A 1KLUD 1LTGD 1D5ZC 4NZLB 1EEID 1AN8A 1PYWD 1JWSD 1PTOF 1BXTA 4RHRA 1S5DD 1DYQA 5D3IB 1EFID 2TSSA 2RDHA 1PRTB 1GOZA 1V1PA 2O2LD 3EFXD 1JR0D 3DWPA 3BYTB 1RD9D 1LTTD 1FNWA 1CK1A 3R8BA 1CQVA 1SE3A 4BWGB 5I4DA 3BZDB 1TS5A 2XNAC 1TS4A 1BCPD 1SBBB 2SEBD 2XN9C 1LTAD 1LLRD 1PTOD 4RHSA 1I4RA 1QILA 2QILA 2NTTA 4RCOA 1I4XA 1PTOC 1B1ZA 1SE4A 1MD2D 1EU3A 1S5BD 1SXTA 5ELBA 1RF2D 3BYYB 1HQRD 3TSSA 3V05A 1I4HA 1SE2A 1YN5A 1PZKD 1STEA 1S5FD 3MFGA 1JWMD 1T5XD 5FK9C 1UNSA 2AQ1B 1LT3D 1D5MC 1LO5D 1I4GA 1XXGA 2XRSD 4K6LA 2ICIA 1TY2A 1V1PB 2AQ2B 4L6TB 1PRTF 1DJRD 1ESFA 2IPKD 3CHBD 4OHJA 2R61A 3OWEB
chains in the Genus database with same CATH superfamily
4KY6A 1BCPB 1I94L 4LF7Q 1Q1EA 2MW5A 3MEFA 4FF1A 3K9PB 4MGIE 3G6JB 2NVYH 1PV4A 2PPBC 5JZEB 5DNFA 2LMCA 1QLBB 4C3JH 4RF0A 4A3LG 1ICFB 4X6AH 2JEBI 4B9XA 2IT1A 2UU7A 3GP7A 2F0MA 2ZPNA 5DPTA 4YWLA 1HZBA 1PRTC 1BMLC 2Z4HA 3HKZG 4EE2A 3R7RA 4LDTB 2N8NA 4DK1A 2K39A 1WF9A 2CH4W 3HOWB 4BKSA 5IKCM 4LJOB 3FRPB 1FJGL 3OWFA 2VQEQ 3TN2A 2NVTH 4KY7A 5IA7A 3H6NA 2CVRA 4LNKA 5ELOA 4GLVB 1C78A 4M0WA 3PRZA 1VQBA 2EY2A 4KKTA 4D2KA 1S5CD 2ZTCA 3NEMA 4DHZE 4OELB 1A3UA 3GTOH 1I3QB 1IW7D 3BINA 4NPNA 4JQWC 4BA1I 3S9WA 1WX8A 5L83A 2WS3B 2LXCA 3MVVA 1EY4A 5BYSA 1VF5C 1XCQL 4CJ1B 3H7PA 1GUSA 1O7YA 1XNQQ 2OOBB 3DBRB 3CWIA 1RYJA 2XK5B 3SR6A 3ALBA 3AH7A 3A7AB 2R7ZB 1J19A 4XXEA 1LT4D 3NK9A 2JZ3B 1FFVA 2MBOA 5KRUA 3RNUA 2JA8B 4N8X1 4A3DH 1JMLA 2EMTA 5C3EH 1XEEA 3HOVH 4KV2A 2GVAA 5G2NA 1B9RA 2CKZB 1ASYA 1P1AA 3FILA 3FPPA 3ECIA 4FXDA 2JQOA 2LS01 2HIVA 2B2YC 4XTCS 4ZAIA 2EXDA 3UDFA 4DAYA 4KY5A 5JJZA 4GOCA 2A19A 1WZ0A 1V49A 4LNIA 4B0EA 1CQVA 3M95A 5LXIB 1SRUA 3H94A 1VDVA 2O2VB 4BWGB 5I4DA 4FJYA 2MSED 2GBKA 2UXBQ 4LCDE 2X8XX 1OQYA 4XYCA 2WACA 2ONQA 2J0JA 3PMFA 3RCZA 2AUKA 4MIUA 2YVCA 4GOPA 2G3QB 1Q8KA 2M0AA 3TJPA 5D2MB 3K6OA 5C44G 2V3NA 4MDKE 2LGDA 5HFYA 3CQZB 2V4DA 1WTWA 4P7IA 4V190 4IFDG 2ZCBA 3ERQA 3MFGA 2NVQH 3ZVVA 1G51A 3C2PA 5C4XB 4GN5A 1CFMA 1JWMD 1Q1BA 3R3OA 2CH4A 1V6EA 1KRHA 2VRRB 4QJFA 2NBVB 2J0MA 4MTKA 4JI4Q 5GROA 3J81j 1VQPA 3KUDB 3MHBA 3HKSA 2F0HA 3H3VC 4CDFC 1BQQT 1QOHA 3VUYA 3D6WA 1K8AC 1R7SA 2MEKA 5BR8Q 1AZQA 2MQHA 3FEWX 2BF8B 4WH4A 3CSTA 3CMAA 2F0KA 2OXPA 4JBMA 3EVQA 2KNBA 1SSOA 3J80i 4NJ7A 2RR9A 2UWQA 2IBIB 4L5SA 3H9DA 4NW2A 2JA7G 1PFSA 2K3UA 5I2YA 4B9WA 4JI2Q 2WP8J 3T16A 3SK5A 4H13C 1UE6A 2VQFL 2ZTEA 2NUCA 3B0AA 4X57B 2KFKA 4CO7A 2MO1A 1BNZA 4K0KL 2M2LA 1K3BC 2NVXB 3E5SA 1ACCA 2J42A 2K8BA 2WXOA 2JYEA 2WGSA 1EY6A 1WYDA 4RG1A 4BKSD 4QL5A 2QEJC 1WWTA 3A8IE 2R93G 3ZXRA 1LT6D 4RWSC 4MNOA 3ND9A 2WXJA 4LF6L 3G48A 3PT2B 1XQQA 4C3HB 3U7DA 2RMMA 3TEHB 1HHVA 4BY1G 1EY0A 3A9KA 1GUTA 3PLUA 2EE1A 4GN4B 1SGHA 4II3B 2YLMA 1PUTA 3SDZA 1L0WA 4KGSA 3WA0A 2N7JA 1WM2A 5EPKA 4L5QA 1E7UA 1HFGA 4DV4Q 4AQYQ 2KN4A 2ON8A 3QQ8B 3W2DA 4POFA 3NVZA 3JC66 4GGQA 1QUQA 1NVID 1E7PB 2KDIA 5LL6X 4G50A 2E2DC 1NJIC 1EYGA 1TWHB 1L4DB 3VDZA 1EIFA 1STGA 4NAWA 4WQOB 1SNCA 1FCCC 1H4RA 1BCPC 1QVGA 2VW9A 2M00A 2PIAA 3MXNA 4CDDC 2G4DB 3KUZA 1Q8IA 2IO0B 4GLSC 4MHEA 4NZLB 1RJTA 2KECA 4IUUA 3PO3H 3N9YC 1XD3B 4DHJD 3I72A 2R7DA 1B2TA 4XQJA 3PCOB 4UY8C 2M0XA 1JR0D 1CUKA 3KWLA 3RPFC 4ME5A 1K28A 1V8CA 1MJCA 3BYTB 2R92B 2QW7A 2UUAQ 4DV5Q 5C5LA 2N9XA 4IJHA 4A3GB 4HKZE 1SE3A 2E5LL 1EM7A 3TMEA 1VZ8A 3MC9A 3QAQA 3W5VB 1TS4A 4HMIA 3PO0A 4FDBA 1V5OA 3Q8DA 1PTOD 3RN5A 1C0AA 2QILA 3WANA 3SK6A 5FJ8H 4A3MH 1XNQL 3KYDD 1Q81C 1F2MA 1KHIA 5ELBA 3TEWA 2HDEA 3J81i 1TR5A 2YU9H 2D3CA 1E22A 1SAPA 3W1SC 5MPOA 3PUXA 3RULA 4MSMB 4ZKCB 4AQ7A 4DR2L 5BMIA 3B2GA 4ARCA 3P1HA 3DWGC 4FJZA 3ICEA 3U58A 3GTPB 2RHSB 2L83A 5DPRA 5C4ZA 1Y1WG 3HGBA 3FC4A 4QQBX 4HVBA 5C0XJ 1ZUD2 4K1RB 4C3JB 1VQ4A 3RZFA 5IGBA 4FJVB 2ACZB 2F0JA 1WJUA 1HJPA 5ELNA 1DXMA 2KHIA 1I7HA 1NDDA 1YJIA 2FCSA 5T1IA 4B08A 4Y7NB 2OT2A 4X62L 2K33A 2PMZE 3K7AB 4FYDA 1WZ3A 1NBWA 3G6EA 3ONSA 2L15A 1X1MA 4FBJB 1K0SA 1WH3A 2JSVX 1P8LA 4GU2A 3QOJA 3TP7A 1B44D 2JWZA 2WDTB 4A3DG 3HIZA 3GTKB 2UXBL 1H9SA 2EYMA 3VR4A 5C3EG 1JOKA 4YHHQ 4JOIA 3I3TB 3SDLC 4JBWA 1CA6A 2NVTB 1ZP0B 2IY5B 1CTMA 2K01A 3ER0A 4J1MA 2YEPB 3ZYYX 2I46A 5FR6A 4A55A 3LXFA 3TZUA 3CCSA 3IFDA 1B3AA 4ZKBB 2FUHB 2INNE 3VR6A 2UUCL 4JV5L 2JJQA 4A8XC 5CBEE 3MAQA 3GTOB 1K8GA 3KWVA 2K03A 3HS0C 3K81C 3Q8FA 3T1HQ 3CKIB 3IT6B 1VQDA 1ET9A 4CDCC 4IUTA 2JE6I 4TSSA 2Z1CA 1WE7A 5HHDG 1HZAA 3VRBB 1FNVA 3G4SA 4I7ZC 4BVUC 5DM73 1A2UA 3BDLA 4II2B 1E3PA 1YNJD 3DEPA 4RGTA 2JZPA 3OIQA 4A93B 3SFDB 4FO2A 1G291 1VZ6A 5M3MG 2WB1B 3ULJA 4JI5Q 4NQKE 3I91A 1YITA 4UP7A 5DEHA 1LTLA 3GDEA 3AU4A 2K25A 5AUKA 2NMQA 2IGGA 5AUIA 2R7FA 3HOVB 3E9SA 2ZPYA 5IP9H 3L7ZC 2BA0A 1V9JA 3C0RB 2UUBL 3APCA 1D2BA 1II3A 2F0GA 1MJDA 1JROA 3S14B 2QMTA 4YSYB 1EIYB 4BZAA 3L2PA 1LT5D 4PS7A 2LSSA 4X66Q 1ZKHA 5BYQA 2F0PA 5M5YH 1EEID 1WI0A 2AEHA 4C3IG 1W2BA 4W9JA 4HLEA 4UPAA 4XZ4A 4S0RA 3MTSA 4J6IA 2GBNA 2EY6A 2EYJA 2BQQA 4K5VA 4XGAB 4HSVA 4BBRG 5HURA 4ZYNA 3QR8A 5IIFA 2NR2A 5CX3A 1PYSB 2JA9A 2KENA 2PZUA 2L9HA 4A3JH 4ZRJA 4IURA 4CJ2C 2K8HA 4LFBL 1TKEA 2Q2UA 1TS5A 2MBBB 3HVZA 3HOXB 3MHZA 1VQOA 1OQQA 2BBCA 1EF1A 4XYOA 2K50A 2EY5A 4JLCA 5JVG3 4HJ8A 2B76B 4KD3A 2KMAA 1FCLA 4PMCA 3ZTCA 3NG0A 1PTOC 1WR1A 2KD0A 2IGDA 3ZNHB 1SR3A 3SXHA 2M4NA 3V05A 1SF0A 5C3JB 5IN7A 2LY7A 1UE5A 1ZYRD 4LNQA 1STEA 4KHPL 4DNIA 1WY8A 2K5HA 2PCFB 2F0QA 3E9IA 4NNJB 3CCMA 4C2MB 2WHIA 1LT3D 5C3WA 1F9JA 2Q8TA 4JBJA 2LGYA 2AQ2B 4GMVA 1Q7YC 1LUZA 3CXCA 1UWMA 2GI9A 3GZNB 1KRSA 3TP5A 2E2JB 2XGTA 1J0GA 1LV9A 2J4XA 3CW2C 1DM0B 4IZ8A 1ONLA 1ZXHA 1MPEA 5EBDA 3MXPA 2B63B 3CC7A 1NYQA 1UGJA 2FAZA 4LMQD 3PRMB 2ZJRA 1NENB 4KMUC 4A3CG 3CRKC 2XRQD 2B2TA 2KT7A 1FRRA 2YYZA 1CHPD 4KJOA 2L32A 1M4VA 1S4ZA 1PA6A 4KKIA 2KHSA 2BA1A 3N20C 3P1MA 1MI2A 2L1AA 1MHXA 2K05A 5IOCA 1FD7D 2MX2A 5K5PA 5CV5A 1XYIA 2KX0A 3H3VI 3IXSA 1D3ZA 5HI1A 3IVFA 2BH2A 4WURA 1CZGA 4RM9A 2N9PC 3T13A 3L17A 2UU9Q 1BBUA 1WGYA 2KXJA 4PS3A 1SNPA 4OX9Q 1KLGD 1WCMB 3CCJA 3HOUH 3QOLA 3U4ZA 4AYBG 3BK2A 3RUIB 3I63C 4PS8A 3OLMD 1HNZL 4NMZA 1D8LA 1EQRA 1ZEQX 3EBEA 4BY7G 2AL3A 2WDQB 2EYHA 2Z6BA 3DCGA 2LVPA 3BJUA 1OTCA 1YHAA 1F77A 2K7VA 2NZHA 4DR3Q 1SFOH 2BS2B 2DWQA 3HOYB 3I3CA 3STBC 3CSFA 4HPMB 2FIDA 4GDKA 1IKMA 3ZJTA 1MG8A 1ZE3D 5IWAQ 2ENBA 3NXWA 4LLGM 4NXNQ 1QG7A 1DOLA 3H0GB 2LRWA 1JE4A 4G57A 2L1BA 2KBNA 1C4AA 1V86A 4A3FG 2ZJDA 3B08A 3ZDTA 1C48A 3MC0B 3T3NA 4BXXH 3QWZB 2KOLA 5D7GA 4P75A 3Q8CA 3VHTC 5ELFA 1EIGA 4POGA 5JEAG 1GAQB 3PO3B 1MBYA 5LMNL 3M62B 1E1TA 4BBNC 3AEVA 2CQAA 1NR4A 4IN3A 3D3RA 4DXFA 1T6BX 3DOWA 4LUOA 4OZAA 3S1RH 1HTOA 3HOZB 2EJFC 2JUOA 3LYYA 3J7YW 1EU4A 1JCKB 4MELA 4BKTA 4AH6A 2L76A 3KF6B 1G91A 1SMXA 3V3XA 1PYWD 4A76A 4ZUIA 4DDID 2F0TA 2ZT9C 3F2BA 2L3ZA 4X3UA 2KTRA 4A3MB 1N60A 5H1SE 1ZDVA 5CBAE 3HP3A 5JPMC 4ALPA 1Z2MA 2L52A 3B2FA 2HDLA 3W1BA 3MTNB 1N9WA 2L00B 1IYVA 4A3PA 3DHHC 4RF1A 4JI0L 3OG5A 2NBFA 5CV6A 2JPHA 3UDIA 3D6CA 5GMVA 1S1QB 2NPTB 3DHQA 3D4WA 4I7AA 5C2TB 1J5EQ 3TBIB 1HR0Q 4BOSC 3FKIH 2B2YA 3H91A 1JB7A 3F1ZA 3NTKA 1CQFA 2F52A 2O5IC 3IL8A 4A3OA 3S16B 2WX1A 2KACA 4CQNA 3B9JA 3M4QA 3AMZA 1STNA 3T53B 3PPAA 3QJYA 2EQSA 4XDXA 1UH6A 2ALYB 1EOVA 4DR6L 2RVLA 2ES2A 4XT1B 1F2RC 2WIIB 1OEYJ 4K2LA 3QHTA 4L8JA 1PFMA 3URYA 3A5UA 4B95A 1MIUA 1L2FA 1TWFB 3OHXC 1N5WA 1RFKA 4J3OD 4LFCQ 2W3RA 4IWPA 3PGZA 4JL9A 2MQJA 2AKWB 1GB1A 1C1YB 2WINB 2MBEA 2EYLA 4OL7A 3ERSX 4MJSB 3SEBA 4YWMA 3DBRI 5FOBB 4IM2A 5E6NA 3PLVA 2VH1A 3ZW3A 1PYBA 2KMCA 4PK1A 5CV9A 2PQAA 1KD1C 1PFBA 4X64L 3KLSA 1VMPA 4OZCA 3S24A 5AZGA 4X3TA 4JI6L 1IHZA 1C9FA 5D94A 3DBHI 3Q3NC 1R4QB 4BA2I 2WXLA 1JC7A 3C46A 3AEEB 1IYFA 4PQXA 1XPRA 4K7SA 2KQSA 2UXCQ 5M3FB 1YOVB 2WXMA 1KABA 3N30A 4K81A 5JHBA 3C3LA 2MRPA 1TS3A 5CTRC 3RNAC 4DV2Q 1J8IA 1GUGA 4J8QA 1IBMQ 5IY0A 3UQAA 2VXWA 2RGFA 1PRTD 1LGRA 2KWVB 3CAMA 1YX5B 1NTGA 2PPHA 1F2LA 4ASWC 2WLBA 1FM0D 1R4NB 1G8ZD 1IL2A 1NMGA 4I6NB 2QGQA 5JXVA 5EE0A 5G5GA 1E2WA 4LF8Q 4CKEA 3QK0A 1SLJA 2L0FA 4N6EB 1CT1D 1VQEA 4LFAL 1EYDA 4GZYC 1N32Q 1EYAA 3JYUA 3AEFB 1VQGA 5C5MA 1HA5A 1U0LA 4R4OA 4ICVA 3ZUNA 4CYEA 2EYOA 5H8YE 4OX9L 5C44H 2OTJA 4LF4Q 1VQ7A 1T9HA 4EZKA 2QEXA 4LK0M 4MH8A 4X3SA 3IAM1 5JHAA 2HIXA 4JI8L 1EWIA 2IHFA 3L54A 4BOZB 2LGSA 2CHXA 2EXZA 2EJGC 2PMZB 3V96A 4IFDH 5BYRA 4DR3L 2PE9A 4US9A 1RD9D 4HSPA 2FHTA 4YL8A 3WIMA 3AULA 1VMCA 3EIVA 4KDIC 2KA7A 4WJ3M 4NXNL 4R1JA 3VR9B 4NP5A 1Q5WB 2XNAC 1A0IA 3W9CB 3K9OB 3QWNA 2V3SA 1IXRA 4KN7C 5CC4A 3WCQA 2ZM6Q 3DM3A 2BS3B 1CJEA 4URKA 4REZA 3VUWA 4LF5Q 3AQQA 2K04A 1X3QA 5IGEA 5EGTA 1JRUA 4EFOA 3UI3A 1IKLA 1P98A 1KIXA 3L13A 2DNCA 1RTNA 2PE6B 4ZRZA 3VRAB 2F0SA 5IOIA 4BKGA 3RFZB 2WFWA 1CSPA 4RA8A 2IYDB 3P4QB 1VLBA 3PZ8A 4IG7B 2JA7H 1ZGUB 2FNJB 4QAYA 1N5XA 1TZOA 2NN6G 3HZXA 4K6LA 5AJ3L 1A2TA 3OYYA 2XIWA 1TY2A 4PNYA 4IO9A 1HZ5A 5AEKB 5DAUA 3X0WA 4HJ9A 2WB1E 2JK8A 3QO2A 2N9KA 3KH0A 3NVWA 4HJKA 4TKNA 3KUCB 2K14A 2SNMA 3CCUA 3OWEB 4ZUJA 2WDVB 2ZNVB 2ZZPB 2HJ8A 1KOTA 2MCNB 2JA6G 3I4NG 4LUVA 3S2DB 1LXDA 4IOAA 1FL0A 2C5CA 2K32A 3KLSX 2D62A 5CV8A 3W1SA 1RDPD 2R2QA 2OEDA 3IBEA 2PJHA 5I6YA 5EAYA 1Y1VG 3V62A 5C4HA 2C7MB 1WGGA 1TVXA 4B3ML 3QX1A 1W6KA 1PMRA 3U9SA 4C1NI 4W9GA 2RF4A 4DXGA 1QCBD 3SFEB 3GTGB 1E2VA 2XK5A 1TWAH 4JPBW 1DONA 1CA5A 1WX9A 1G2SA 2L0TA 2PI2E 3A54A 4FVMA 2MPMA 4KI0A 4N9TA 2WAQE 4NQLB 1CZWA 1FNUA 4R3DA 1VCIA 2XSCA 3KLWA 1U4MA 3VYUA 3ZTDA 1CKOA 5CR3A 2I5HA 5LL6S 1YNXA 3T1YL 2EKEC 2KWUB 3NHEB 4MM3B 1KQSA 3CC2A 4IUQA 2GRIA 2LHEA 3NVVA 4DXAB 1Z47A 3C19A 3FKIG 2A4ZA 4XIGS 4K2KA 1PGXA 3S1RB 3NENA 5EBCA 2BYTA 1EZ6A 2QDFA 4LFCL 1MI0A 3I8ZA 3KBXA 2NZOA 5I9PA 2O5JC 5JJIA 1YQ3B 1LM0A 2O2VA 2NBWB 4M8NA 1MHWC 1X3EA 1Y14B 1Q10A 1PVOA 3KYHC 1K53A 4KIKB 4CHTB 4JK1C 1KNAA 2HD5B 3TL5A 1FYCA 3ZLZA 3T8MA 1KNEA 5KIXA 3Q14C 2RDFA 5CHWA 1F2ZA 1C76A 2GBJA 4GKKQ 1I6VC 1I50H 1XNRQ 1C79A 3IAS1 1QOGA 2BTEA 4EOYA 1KLUD 1T0YA 2V9HA 1LTGD 1EUJA 4I65A 5F2DA 3VR5A 4GKJQ 5NUCA 3L0OA 2ZEQA 3UGBB 1DYQA 1U4LA 4R8NA 1V43A 1YNTE 3VA7A 1TKWB 2KWCA 3NJTA 1Q90A 3NQTA 2I0QA 4PT5A 2I5LX 1I5FA 1EWYC 1PDXA 2JA8G 2WKDA 1Y1WH 2DYMA 3A8JE 2LVQA 2KDFB 4JW0A 4DK5A 4LNOA 4GLAC 1LYLA 3LJ3A 2ZW1A 1Z7TA 3PRPB 1XLPA 3VAWA 1BCPD 1QWYA 5J3BA 1GC7A 3BK1A 4RMAA 1JJCB 1NI2A 1HNXQ 3NQIA 3Q3JA 2NTTA 1J6QA 1L1OC 1X54A 5C0XI 3Q24A 3WOEA 4B3RL 1BVSA 1WJ6A 3AFPA 2JF5A 2WXQA 3HK0A 4IWOA 1B70B 4C80A 2A68C 3A9JB 3NS1A 5LLIA 4EQPA 4G7ZC 2D5GA 4OO1I 1SROA 4ULLA 1XF5L 2AQ1B 4LDTD 1HNWL 2OWOA 3ENEA 3J80E 3G71A 2K5WA 1CM9A 2JXXA 1BT0A 2AWOA 4IM3A 4OHJA 2PLPA 1H9KA 4OONA 5COYA 2L12A 2R61A 2KUMA 4DGZA 3U30A 2AQ3B 2NYZD 3Q22A 1O7IA 2XWBB 1IGCA 4GB9A 2SAKA 4K6DA 1RODA 3GV6A 2CR5A 2I1KA 4YSXB 1DD2A 2BYEA 2LGXA 3AV8A 4R4QA 1XX8A 3D31A 1TS2A 1QQRA 2RCNA 2BE5C 1F52A 1N34L 4A20A 4YT0B 2DGYA 2EYPA 1JJ2A 2F0VA 3I4MH 4K5WA 1A5RA 3J80L 2NS5A 3N1ZC 1GHKA 1SJHD 4EVOA 1LTRD 4HCSA 5M3MH 5GAEC 1F2RI 2BWES 4M01A 1TWCH 2B8FA 1XWEA 3SK4A 2Z9HA 4RFBA 2ID0A 1KH0A 1HR0W 3KF8B 3TP6A 3KUPA 4BS9A 1WIAA 1GJXA 2GBMA 4AYBE 3KW5B 1XMOQ 1HPCA 1X55A 2BDNA 1P7FA 3RYTA 3ZNZB 1GO3E 2Y0SE 1YN3A 2K22A 1IBLQ 3NSWA 5AZFA 1PXUA 3J7AF 2DJFC 3NBHA 4IFDJ 3AEGB 4DR7L 2M8SA 4IW0A 1HH2P 4DR5Q 1WTOA 2C60A 4F7ZA 3F2CA 2VH2A 1AWDA 4C3IH 3DVGX 3N6RA 4L5RC 4NAMA 1BUVT 4X65L 4C3HG 4JI7L 3AE6B 2V3PA 4MT5A 1V1OA 5G3LF 2LEKA 3AFQA 3A1QB 5C44B 2IO2B 4BBRH 1Q12A 2H1EA 2N49A 2W82A 3LB8C 1VQJA 2A74C 3RNGC 1RL2A 4L1BA 4M8AA 1D6EC 1Z6HA 1KL9A 2ZNVC 3Q3FA 2CJNA 1G6PA 1UUPA 4IQZA 4XT3B 1QOAA 2NB0A 4RAUC 4DFAA 2JXTA 3IHPC 3OJ4B 2WWZA 3AYHB 1S72A 3S1NH 4W9DA 2A73B 2WU2B 5J39A 3J80c 2JRHA 1Q3LA 2AX5A 1YQ4B 4DUZL 2PVOD 3TRZA 5JJLA 1XO3A 4LF7L 1WMHB 1EFWA 4GDLB 1XLOA 2SDFA 4PZ8A 2IHEA 5BN3A 1SYCA 3VTUA 4DV7Q 3GZNI 3PVLA 3PIP3 1LTTD 3U50C 3VYSA 2KJ6A 1L6VA 2VZKB 1NSNS 3PHWB 1S3SG 3V61A 4Q5VA 4AUQC 3BG3A 5M5WB 3U4EG 1KLVA 2JA7B 5DPWA 1YHQA 3ZJVA 2RBMA 4CKBA 2NVUI 4WFN3 2K52A 1IBXB 3UE1A 1EY8A 1WR6E 5EE3A 4JIOU 1F9QA 4PZ7A 2TMPA 1YEZA 2ZXPA 3MZ5A 4DR1Q 4JI3Q 3VH4B 2AHOB 4Y52H 2VQEL 2LRUA 2WXNA 3DM1A 5C6AA 3J81L 4GKKL 4A3CH 2OQ0A 5JVH3 1BUIC 2HTHA 5JAVA 4EUTA 4W9KA 4ZHOA 4JGHB 2R93B 3X3NA 4E6IA 1LO5D 2GOWA 3J9CA 2D07B 3AB5A 5EPJA 5G5HA 1TBEA 3AXCA 1SMYC 3CHBD 4BY1B 2Y5BB 4NXMQ 2CW0C 3I2ZA 4W9CA 3MXGA 5IT9E 1MG4A 2K1FA 3UDGA 2D2CC 4DK0A 1TU2B 1YD8U 4F88A 1E9MA 2D11A 1EQVA 3RMHA 3RT3B 3AE4B 2D9UA 5BN4A 5ELDA 1QOFA 4BY7H 2EZVA 2JA5B 2DNFA 3M9BA 4IJLA 2Q2IA 1DOXA 4A3KB 1C7YA 2CU3A 2ZVNA 2JYTA 1XTCD 2D3GA 4RGOS 3UE0A 3FP9A 4WRDA 1GM5A 1D1KA 5IT9L 2N55A 2NVYB 1WXVA 3UIPB 2ZTDA 5HGTA 4A3FH 1LABA 2KFKB 3CU7A 1BKBA 3R2TA 1GD7A 2GA4B 1KM7A 1O80A 3QA8A 4GS3A 4A3IH 5JEAH 2QF7A 2GMIC 2V1CC 4YTMB 3S2AA 1QNUA 4DV1Q 2B2UC 2K6DB 4IC7B 1U4RA 5M9OA 2IZVB 3DPDA 3A8KE 3FDTA 1SYGA 4XE0A 4H0LC 1GC6A 3TEYA 4TQ1A 3IKJA 1E90A 1LM8B 3F2UA 2N78A 3J81c 2HHHQ 3F8TA 1SEBD 2PI2A 2NCNA 1FGBD 2Q2TA 2VB2X 3E56A 3RN9C 3PUYA 1D4BA 1YJNA 3R66C 2BYVE 1I50B 2J7QB 1AW7A 2NZ1D 2QCZA 2J7ZA 1WFQA 1XTDA 2PW9A 5FO9B 1YMHE 4G7OC 5I6WA 2PEAA 1VRAB 1F9RA 1C9OA 3I73A 4F8MA 2AL6A 2OQKA 4G4KA 1N36Q 1U4PA 4YWGG 3JW0X 4HTHA 1A63A 3NE5B 3ETRA 1Y1WB 2IY0B 4DNRB 4MEMA 4JI4L 3STBD 4HROA 5AZHA 3L10B 2WX0A 3Q8AA 2D0OA 4LJPB 2KCMA 3MXUA 4U673 3I4MG 3L0WB 1JWSD 4DV3Q 4HAEA 4ID6A 2BT6A 1X3FA 5IT9c 2F03A 1L5PA 2YV5A 2KVMA 4OIJA 5BR8L 4QGUA 3ZDMC 5CHFA 2KFJA 2ICEC 4PZ6A 3H15A 3L16A 3H6MA 2DY7A 1FXTB 3ABVB 4DR4Q 3NVYA 1GUWA 3TQYA 3R8BA 2KLGA 4A3DB 4ANWA 2VNUD 5C3EB 2K0PA 4JI2L 4HJGE 2QDBA 4TMAB 2K5VA 1GB4A 2IO1B 3AE8B 3K7UC 3GTLH 1VQKA 2J52A 2KC1A 2P5ZX 4DDGD 2E8GA 2GN5A 4UP9A 1OTRB 1GJZA 2N3SA 2BKFA 3NOBA 2K6AA 4NPSA 2MHVA 5IYBH 3TSSA 1K8RB 4C4VB 2QKIC 4JVZA 2D5DA 4FF4A 4CDEC 1K8MA 1YX6B 1WTHA 5E3FA 2F0LA 2F0OA 1BBWA 1A6XA 1X6OA 1PGAA 5E6JA 4LNFA 2WAQB 4TQ0A 2E76C 4KHZA 1E8ZA 1XPOA 2WXKA 4EQNA 4YCUA 1NAPA 2MJEA 2FBWB 2F4IA 4K3CA 1HE8A 5KNBA 3WAPA 1LFDA 2Q8RE 3RZOH 2NVQB 3DVNV 3EGRA 4DV4L 4AQYL 2JEAI 4MJSA 2FUG1 3KLRA 3AE1B 4ZRKA 2MP2B 2WP9B 3W1YA 3AI5A 4N8FA 1OQRA 3MA2B 4ITKA 1IYJB 3SHLA 1EWHA 1XMQQ 1LTSD 1R4NI 5BMHA 1K9MC 1J7CA 1QKZA 4OXPA 4A3BH 2F4VQ 2SNSA 4P72A 2W9NA 4JWUC 1PZJD 2DX5B 4DV6Q 4DA2A 2HD3A 2PMVA 4DAVA 2WXHA 4QY7A 4A3EG 3V6EB 1I4PA 2FCQA 2C7HA 1FGUA 4C3IB 4IPCA 4NB3A 2N7DA 4Z9CB 1WFYA 5TR5A 2LHDA 2JY6A 4XC2A 4TV3A 1WTQA 3RNCC 2KTFA 4ZQ3A 3KF6A 4W9LA 3D0FA 4DV5L 2UUAL 1WXMA 2K9XA 4BBRB 2BS4B 1VQIA 2E2IH 4KGRA 4XDDA 4ZRIA 2B3AA 4DK6C 3S17H 1HTPA 2UYZB 3L08A 2BGFA 1WCMG 3PUWA 3RNBC 3ZNID 3H3VH 2FFKB 5ISRA 3OJ3A 3N52A 4AJYB 3Q8EA 3HKZE 3S1NB 1V9PA 4YXDB 3PIO3 1V81A 1SDFA 2QHOA 2F3IA 2OHFA 4MGZE 2RHQB 4DUYQ 5JPNC 3BVGA 5KNDA 2UXDQ 4QB4A 4B3TQ 2L05A 4JX1C 1YJ1A 3F2DA 1PQSA 4B3SQ 1GVPA 1VD2A 2NPTA 2Q2HA 1N33Q 3PO2H 2E2HH 3I9V1 3S1QH 3WWVA 2KN5A 2MBHA 1YIWA 1JQ4A 4YIJA 2BW2A 2INDC 1IL8A 2WDRB 1TKYA 1HRJA 1A8VA 3DBSA 5GXGB 3W5OA 3HOZG 4GLXA 3Q0AA 1C8CA 1JRPA 5T8IA 4IPDA 3GE3C 4CHKA 3G7LA 4RM8A 1R9TH 3FMCA 4YHHL 4KKJA 2NN6H 1UE1A 1TJEA 4A3IG 1SIJA 1X9NA 3BDOA 4X3KA 2L55A 4WORA 5GAGC 3PV1A 5KYIA 3I7FA 3U2SC 3I56A 4P71A 5I2XA 1A70A 3E0EA 4HN7A 2X69A 3LWUA 1UWVA 1WGKA 4L23A 2ZXRA 3GO5A 1IZ6A 3PF5A 2K28A 4RCOA 2JA6H 3I4NH 4F8CB 1MD2D 1EU3A 1S5BD 4J6HA 3A56A 4JYAQ 2H88B 2M19A 3DVNU 4FHJA 5IO9A 3MEHA 1NMFA 4A4IA 3T1HL 1SB3C 4ANXA 1NI3A 2RSNA 1YN5A 1GPXA 1Y1VH 1OEYA 4AYBB 5JEAJ 1B4OA 1PH5A 3MFYA 1I4GA 1RHPA 3GB1A 5A35A 1MKHA 3TDQA 4BY7B 1V2YA 1E10A 3JAMi 2Y0SB 1KDCA 3KK7A 2YU9B 3T4AC 4E3CA 2OJWA 1Y69U 1HTQA 2YTXA 4JI5L 5E7NA 1P9DU 3RNEC 3K5LA 1L1OA 3GV3A 2F0EA 2MGSA 1K8OA 3AE2B 2BDOA 2LXKA 3IRBA 3N32A 1VQLA 4M02A 2KDMA 4A3FB 1QE6A 4WJNA 2H5XA 2JZZA 5G55A 1IBKQ 1WGHA 2A6EC 2JSOA 2B2WC 3EA6A 4HIDA 4PMWA 4H2AA 5IP4D 4NKLA 2LGIA 1J9OA 1X56A 1VQ8A 1MHHE 1MVKA 1TZ1A 1WGDA 2INPE 4ZRPA 1PH1A 3A5ZB 3M7NA 3AEBB 1G6JA 3MC8A 3DLLA 3UQBA 4YY3Q 2E6XA 3GTMH 2F0IA 4X66L 2N1WA 5HG2A 1UELA 2KOXA 2BKRB 2L5TA 1AE2A 4KJNA 5I9OA 3GE8C 3BIID 4P6VF 2W55A 5FO8B 1UEAB 2QIEB 1I3QH 2Z8LA 3WDNA 3CCQA 3AECB 4KZ0A 1ZOYB 3ZRFA 5E1FA 4MSQB 3U52E 1X32A 4TKOB 4MACA 3H8HA 5A2QE 5IYBG 1L2NA 1JQYD 3GOEA 2NBUA 3OMCA 1TYGB 1D1IA 3LDZE 3BU2A 1VQAA 2LJ5A 3CMEA 3UF8A 1XPUA 2R7ZH 1JALA 2IX0A 3D4DA 1I94Q 2I1JA 1A3TA 2J0TD 1UZXB 2W3SA 3A55A 3AB9A 1C3TA 2LFIA 5FLXE 2JA8H 5EE9A 2LZ6A 3I4OA 5A2QL 4MN3A 2F3WA 4DV6L 1FIQA 4I6LB 3VDYA 1O7LA 3VA5A 4KZCA 1K73C 1EIHA 2MH7A 4RMFA 4HCNB 2KHJA 3KDFB 4WJPA 4L5TA 3TS2A 4OZBA 1AN8A 1F2YA 1M8AA 1PDQA 3RLNA 1JORA 1TIID 4A3BG 3CCRA 2X6LA 4BAXA 1MJEA 2HQEA 2SOBA 1FJGQ 3VYRA 2VUMG 1C4PA 2RDHA 5FLXL 2N9EB 2ZJQA 3QARA 4QUCA 3QCAA 2PZTA 4NDXA 2KTRB 2X6GA 3QIAA 3N1YC 4IKGA 1OXXK 2QSDA 4QIWE 3EN2A 5M5YB 4RNAA 2JN4A 1JE5A 3ZKJC 2K1BA 3W5UB 1T0QC 3VR3A 4A9AA 1WXQA 4HDOA 1QZGA 4QMGA 1J8CA 2SEBD 3E6ZX 3FKYA 3TMPB 1SYDA 4EQ5A 2HJ1A 4ME3A 5KYLA 4FNFA 2N1VA 1FPYA 5C4XH 3UIOB 2EOTA 3Q8BA 3L4PA 5E4WC 2W54A 2A5HA 4B3TL 4ODGA 4BBSG 1SNOA 1E8YA 2UU9L 3BYYB 4A3JB 3RZOB 1FXIA 3VTVA 1SE2A 5L37A 3VYTA 1PZKD 5IYDG 2ZW0A 1JJGA 3ZXVA 1T5XD 4US8A 5FK9C 2QC8A 4KTAA 1XXGA 4ABNA 4N9F4 2C7NB 3A4SC 2MJ3A 1FRDA 1C4CA 2IO3B 4GNXB 3CCVA 3UI2A 2AWNA 5IWAL 3S15H 1HA6A 4WJQA 5BO4B 1DOYA 1D7QA 3L3OC 3P20A 1W6JA 3Q3MC 3WAMA 4MZ9A 1N62A 1WE6A 2N4FA 4MM3A 1BF4A 4UDUC 2H4OA 3PO2G 1WTRA 2VZAA 5EQ0A 4AWJA 1T0SC 4HPLB 1K3RA 1HTLD 2XTIA 2LUEA 2O4XA 1QB5D 5M5XH 1MSGA 1S5ED 2KJRA 1EUVB 4R4CA 1KTKA 2A68D 4IPHA 3NP8A 5FLXc 2YTYA 4TVAB 4K7WA 2RD0A 4ZHPA 1K52A 5GADC 5D3DA 1ENFA 4ZLTF 2K5NA 2LASA 3NRZA 1TGZB 3R93A 2Q5WD 1NBFC 2IX3A 2L4NA 4KIKA 1YI2A 2F0WA 2E2IB 1PTOH 1UF0A 2RDBC 3OIPA 4C3HH 3PZ7A 3FPUB 4IFDI 4FA6A 4RGNA 2O6VB 3J7AV 5FO7B 2RPVA 1JICA 1SE9A 3M63B 4LTUA 4AP4C 2ASQA 3S1MH 4UAIA 3K5OA 4ANVA 5E4XA 1AARA 1DOKA 3RD2A 5EKIA 4XQQA 1RWSA 1YHBA 1TIFA 1L0XB 1I35A 2N9LA 1EWCA 5IGGA 2KVZA 1ISNA 2BE5D 2M9VA 2DENB 3DHGC 1XT9B 3SHQA 2M56B 4P73A 1RM6C 5EPLA 2KZRA 1VDZA 3HOUB 1M94A 1EZ8A 3CRLC 3RR5A 1IBKL 2E2HB 4QCLA 4RH6A 2KX3A 2WV6D 5TSSA 4ZYSA 4FF3A 4OWXB 3S1QB 1YN4A 3OW7A 2LI5A 3PGEA 2G45B 5E6PA 1IP9A 1J5EL 1SFOB 1HR0L 5J2RA 2DZJA 1UEBA 2B2UA 1JB3A 3HEJA 1FXAA 4ZDVA 2NWGA 3VFKA 3HG9A 3OMGA 1WXSA 4JCVE 2JT4B 4KKUA 3QG1A 2VQFQ 4FLHA 4LNNA 2R92H 3PS6A 3VH3B 1L4ZB 4E74A 1UBQA 2VB3X 1F9SA 2MJDA 3A9JA 3HOWG 4K0KQ 1SYEA 3M4YA 1P3QU 1V80A 1BXTA 2IGHA 1DGJA 3KOJA 4MH0E 3PIPA 3M7GA 3M3YH 3NWTA 3X3MA 4B9KA 1VQ5A 3I4NB 2KMMA 2KQ7A 3ZGZA 1RTOA 4LF6Q 2F0NA 3PV0A 2KDBA 2LXAA 4W9HA 2F0UA 1K0RA 3JSVB 1IPGA 1Y1VB 3MJ5A 1ENCA 3DQVA 1K83H 2PW5A 1FD6A 3C1EA 4KKSA 4HCEA 3GTPH 1PH6A 4YTPB 3X23A 1QT9A 1WJJA 3J7A5 3FHWA 2DYOA 4DV0Q 4M1UB 2YTVA 3E0JA 3APDA 1SNDA 5EJWA 2Q8IB 1GXDC 4F7XA 3IFTA 2KDEB 4Y7NH 2R2OA 5IYCG 3K7AH 2DJGC 1WTVA 2R7ZG 2RSOA 1EL0A 4H7BA 2PO4A 1PFNA 1T3QA 4N58A 4QUFA 4L2YA 2UXCL 3NUHB 2OF1A 1UAPA 1D5MC 3KF8A 4S3SA 2JX5A 4DV2L 1V1PB 2B39A 2LUMA 5JH5C 1IBML 1PRTF 3GTKH 3A4RA 3EC8A 2F1MA 1O78A 3FKIB 1RFAA 1JOQA 5DPSA 2DUDA 5J1ZA 1TT2A 5C0XH 4CKCA 3BVZA 1ET6A 3EFUA 4WWMA 1SNQA 3GTMB 3APFA 1LTID 3BDCA 3EJIA 2A5UA 1HCZA 4ILWA 1VF7A 3M4PA 5IODA 3HKZB 1E7VA 1CKNB 3SGIA 1MSHA 3EUB2 4LF8L 4OO1H 4M00A 4JPSA 2E5LQ 1Z5SB 1U4AA 3CCEA 1R4MB 1N32L 2FMCA 3I57A 3V6CB 1V5TA 1NR2A 1L6UA 3A1QA 1SMYD 1STYA 2DY8A 4LK1C 4NJ6A 2CW0D 3DUZA 2CS4A 1HZ6A 4LF4L 2G9DA 1Y8RC 2MHJA 1N61A 1CSQA 4A93H 4FP5D 5C4XG 2HTME 4EZLA 2CHZA 2MP1A 5CGKA 4R8IA 4DR2Q 1TWGH 3EQLC 2D2QA 4KK7A 5CV4A 1TT5B 3DBHB 4B6WA 2PNHA 3E9HA 2CWPA 1WMHA 3Q3OC 4GDLA 1STHA 4O0AA 3EHVA 2LMCB 1RLFA 2ZM6L 2ASBA 2Z0EB 5CORA 5LHY1 5FKAC 4X62Q 3BY4B 4LF5L 1H9JA 2XWJB 1NY4A 3S14H 3DBLB 4BFRA 1C77A 2PZWA 4P74A 3ONAB 3RZWC 4GNXC 2M1MA 3R2IA 1FFUA 5EDSA 1HXYD 3CPFA 5GQOA 4OWTB 1WYWB 4LF9Q 2KEDA 2MA9B 3H09A 1HZCA 1AE3A 1IBXA 2KKCA 2FIFA 1V8QA 2K5PA 5FR3A 1SJED 4KVGB 4PYUA 4F87A 2RA4A 2GVBA 4WAAA 5DLQE 2Z6KC 2UUCQ 1D5ZC 2HQLA 4JV5Q 4M0WB 5L95C 3RI7C 2E74C 3HOXH 3K59A 1EFID 1EY5A 3AE5B 4N59A 1YVCA 3LWEA 2EKIA 1ZKOA 3EFXD 1QZEA 3W3AA 4HRSA 3KBGA 2HDMA 1JMCA 2XBBC 2REXA 1W3SA 3K5NA 1PFDA 2BVCA 4OEMB 3DVGY 3U7ZA 2C9OA 4DAMA 1JWBD 2AYOB 4ZCKA 1WRDB 3H7PB 2XN9C 4OVVA 4K8IA 3J7ZC 1QILA 1B50A 1NNXA 4C2MH 2EELA 2RSUA 5CV7A 2KJXA 4APVA 1BBXC 3VUXA 3TEXA 1B1ZA 1EYCA 1QVCA 3S15B 1PH8A 4OWWB 4C1NK 1SN8A 2F0DA 3RLOA 1WSPA 3R3MA 2HE7A 2IDYA 1KAAA 1V1QA 2E2JH 4C00A 3ULLA 1NEKB 4DHJB 2UUBQ 3FILB 1SSNA 1OXVA 5FLMG 5M5XB 2FJ2A 4JE3B 4XWTA 4XQNA 4DN4M 3OTOQ 4KGTA 2QCPX 4L6TB 2B63H 1ESFA 4DAYB 5C4JH 4YCVA 3J81E 3HHMA 4DNTB 3P4SB 3W1GA 3NHHA 1L0VB 3SK8A 1B8AA 4A3EH 2KHWB 4DAPA 3B1LX 5D14A 4RGMA 2DBYA 1ZXIA 3KFUA 3OAWA 1HZ9A 1PTOB 2K4KA 2R92G 3IT4B 3P63A 4IM0A 5HKHA 2PVGC 2Z0DB 3NPPA 3MWYW 4A3GG 2EVBA 3I90A 4GN3B 4GOPB 1LQBA 2KC2A 3MHSD 3BZCA 1X65A 4OGQC 3S1MB 3PUVA 1PZID 1E2ZA 2KCCA 3GD7A 2A69D 4LFBQ 1V97A 1WCMH 4M8MA 2K5QA 1IW7C 1XNRL 3FVQA 4DV0L 4AJWA 3P2BA 1AH9A 1EQTA 3NZUA 1UWXA 1JWUD 1TY0A 2JA5G 5DCNA 5JJKA 1WJNA 4A3KG 4GKJL 3A0JA 5JOBA 3NWSA 3HOYH 3AEAB 4IDIA 4UHVA 3EFCA 3RNFC 1A62A 1GG3A 1NE3A 2EJMA 3NTHA 1TKGA 3RZDH 4KHPQ 2B2WA 3H0GH 1RCVD 3K0XA 4WJ4A 2J0KA 1YBYA 1E0BA 1HFNA 3T9LA 4C3JG 2BCOA 4FXGC 4HJAA 1TWAB 1BCPF 1DGSA 4ICUA 3TCAA 4OIKA 4OW0A 3O13A 4IALA 3D4RA 3QB3A 3NBHB 4QIWB 5AFWA 1E1OA 5D65A 5EE1A 1OXUA 1HNXL 4C56C 2KCTA 2BWFA 2LKVA 5KHOA 4KLKA 3PIOA 4P1CC 3ZNGC 3AE7B 4F1SA 4CGYB 3HOZH 4XDCA 3SU8X 4PV1C 2VZKD 2M17A 3U9OA 1X3PA 1SIFA 3AE9B 5C0XG 3K58A 1TXYA 3K80C 1OXTA 3Q6BA 3DWMA 4KDLB 3VQIA 3SE0A 4DPGA 3M3YB 5C1ZA 3NS8A 4KSKC 4C4VA 1ENAA 4HEDA 1RRBA 3Q6SA 3T56B 2CU1A 2EPBA 4OO1G 2B2VC 1K83B 1F0ZA 2CCZA 5D3IB 3GTQH 3A9KB 3HUIA 3D32A 4FXCA 2I2YA 1GOZA 4YWKA 1GKHA 5LNK1 1QZHA 1HNZQ 2OTLA 4O42A 4O2DA 4A93G 2F3VA 2IW3A 2JP1A 2WB1G 1QUQB 4JI1Q 1IUEA 4ARIA 5E6OA 4R4IA 4YSZB 5IP7H 3S16H 2CJOA 3KQ4A 3Q69A 2MP2A 5CMDA 4NAWB 3RN2A 3OW2A 3MP9A 3MXNB 3HOVG 1L7YA 2LJIA 1ML0D 4LF9L 3S2HH 1HQRD 3N1XC 1T5EA 1H95A 1AP0A 4ACFA 1WI5A 5LMNQ 1C4QA 3KJPA 1XMOL 2QJLA 1S5FD 3V2TA 4CJ0B 2CWAA 1ZDXA 3TUOA 1IBLL 1UNSA 1TWFH 5DM63 2E3TA 1O7ZA 1LACA 4AOFA 1EF5A 1U9RA 4DR5L 1Y8NB 1QOBA 2JU6X 1B53A 2OJRA 1ASZA 2C5LC 3UDXA 1Q1OA 4E71A 1EY9A 3P4PB 2WAQG 3HFZB 1VCBA 1STAA 2WKCA 2JQRB 3PSEB 3VR8B 4WIPA 4ANUA 3ZO5B 1I6HH 1WRIA 4P1BC 4C7ZA 1NUCA 1S40A 2CFMA 2IL8A 3AEDB 2R3ZA 1ILQA 4XWWA 2Y5CA 3HOXG 1VQ9A 3IG3A 2JXMB 2GBRA 3C1FA 2FCNA 4JI0Q 5CHVC 2HT1A 1TWGB 4TUUA 1LTBD 1CZPA 4KHVA 1EEFD 1ESRA 2A69C 4K7UA 1FO4A 1F1HA 2K6QA 5M3FH 2MUYA 5IGFA 2CKHB 4HIOA 3AM9A 1FR3A 4HDQA 1WVLA 4I6PA 3QJZA 3OOCA 4HIKA 1M90C 2V4IB 3I4MB 4IUNA 4FADA 4EQOA 1KDBA 3NZ3A 1OXSC 4PG3A 2K5DA 1I42A 5M3MB 3OTOL 4DV7L 3BVMA 2MBQA 4V0BA 2A6ED 1TWCB 1YQBA 1PLFA 3CPWA 2RDGA 2Z59B 3R7QA 4K5XA 3WAOA 1PHJA 2Z0SA 4DF7A 5IGCA 2XVSA 2FE8A 4C7YA 1E0ZA 1KDAA 4P2CB 4DR6Q 5J22A 2G1EA 3PSIA 1ROEA 2L7RA 1D5XC 2WQYB 1H9SB 1H9MA 2IX1A 2IY1B 4O1NA 2PW7A 4ZK9B 3DMUA 4HJ7A 4IOCA 3ZRCA 2LXJA 4LWCA 2KYWA 1N8RC 3CC4A 2VUMH 1WM3A 1WJ4A 4DR1L 4JI3L 2JYOA 2B63G 2DAFA 2L8JA 5KHQA 3LX0A 3T3OA 1DOMA 1F9PA 3K57A 2EY1A 4DQOC 1K50A 5CYUA 3M85A 3Q23A 2NTSA 4KD4A 5T1GA 1I4QA 4XX5A 4L63B 1KRTA 4G7HC 4GSWA 2D10A 1E7ZA 2QDLA 1YIJA 5IGDA 3CCLA 1G6ZA 2OCEA 2A6HD 3I4LA 3SVMA 3K5MA 1U5KA 4NXML 5LMUQ 1UD7A 4GOPC 4G3XB 3GTJH 1PH9A 4BBSH 4LJZC 4DKAC 1YNND 1PTOF 4RHRA 3ZJYC 4X64Q 4LW1A 1S5DD 1MGSA 1FMAD 3IFWB 3AN1A 2TSSA 4JI6Q 3TBLD 2BOSA 3RUZA 5IYDH 1GNUA 1SYBA 2KANA 1FNWA 4K14A 3HOYG 3D8GA 2C9WB 2RCFA 2RKSA 3CIRB 1A3VA 5K36H 1JT8A 2KCNA 1VS0A 2DAJA 3H0GG 4FF2A 3GQBA 1XLNA 4NY0A 4DHZB 3ZJUA 3IAYA 3I55A 1Y8PB 2N88A 2INCC 2PTLA 4EGVA 3TREA 1SE4A 3JAME 1SYFA 5C4JB 3PO3G 1N6ZA 1RAXA 1UGMA 2BPSA 4WAFA 5KNCA 2MWSB 3L9AX 2ZJPA 1CI3M 1I4HA 4A3EB 1P0RA 5KEEA 4DV1L 3BWUD 1GUNA 3KJOA 1KJTA 2KQ4X 2DN8A 1RKNA 3S2DH 2H89B 4IUPA 4LFAQ 2XRSD 4H02A 3TS0A 1Y56A 2DLBA 2HHHL 2ICIA 3PREA 2AWTA 5IAAC 2D3AA 3A74A 3CF5A 1YJWA 1BR9A 3NELA 2GLSA 2WNMA 1KFYB 3ML9A 3JAML 3M4OH 3P4RB 4N9PA 4R9WA 4IWQA 1PH2A 4RKLA 2ZCCA 1CHQD 2MLBA 4LUZA 5FJ8G 5ELEA 4A3MG 1DZ1A 3BZKA 2ATWA 5ELCA 1KXLA 4JI8Q 1XCTL 2J53A 2LD9A 2V4LA 4MGKE 5J17A 2Y0SG 4DBGA 1H9RA 3RD4A 2X38A 2LWPA 3GTGH 4JI1L 2L11A 2KVRA 3O65B 3A7LA 4FN2A 5LXHA 4WJOA 2IJ0A 1B7YB 5GAHC 1N36L 3VVWB 4FXKC 1SNMA 3RZDB 4FHKA 1YNJC 1VQ6A 1AEXA 2EMSA 3N3KB 3WALA 1BDOA 3HVDA 2BH8A 3HM3A 2Z4IA 1KC8C 1G2TA 1TTNA 1WGRA 1K51A 3KVFB 4W9FA 2A1AA 1ZW7A 1Y8OB 3SD5A 1OGWA 2DNEA 1CMXB 2L0CA 1IYUA 3B6YA 4DV3L 1YZ6A 4WJWA 1J7BA 4EEWA 2FXQA 3DEOA 2NN6I 1MFWA 4EZJA 5IP7G 1WX7A 1OO9B 3PHXB 1KAWA 4EX5A 1EO6A 2N7EA 4BBNF 1KF6B 2DZKA 3KDFA 4DR4L 3VR2A 4S17A 1CKMA 3P42A 4JG2A 1PH3A 5AJ3Q 2PQEA 1P7EA 1OFFA 2WXGA 2G9HD 4AS1A 4A3IB 1AZPA 5BN5A 1BO0A 3HOWH 4W9EA 3HRDD 2F0FA 3TP8A 3Q2AC 5C23A 4DU9A 3NTIA 3JAMc 2YEPF 4MGYE 3NBIA 5D6JB 4HMJA 2G5DA 3AMUA 3GTQB 1ILPA 2GB1A 3DWAA 1SE8A 1XLQA 4Q2JA 1EOTA 3K8AA 2JRIB 4B3MQ 2PNRC 2VS1A 1GUOA 1TQOA 3DWQA 1B9MA 2D3BA 2RPQA 4K8JA 3PUZA 3BS1A 1H8CA 4USAA 1AFPA 4IUVA 1AYFA 2WXRA 1JWAD 4WWPA 4A3LH 2ZXOA 4A90A 2A6HC 1NCVA 2G4SA 2KJHB 2LVOA 2HUGA 4QF4A 2VY3A 4KX6B 4GDKB 1PRTB 1ZYRC 5H92C 1YNNC 3KYCD 5IYCH 4WWNA 4GNXA 5C3XA 5M3FG 1R4PB 3PQIA 3H7SA 2FCMA 1Q86C 3S2HB 3T1YQ 2WU5B 5IP9G 1XMQL 2HCIA 2AMCB 3EECA 2ZVOA 4PYZA 3U8ZA 2F4VL 1SBBB 3UINB 1JW9D 1LTAD 4JWSC 1LLRD 1VQFA 1E8XA 3ML8A 2Z6KA 2HCCA 2IWHA 2KLCA 3C8YA 4G11A 2CHWA 2WXPA 4U68A 2PYKA 3AU7A 3PF4A 2DZMA 4HCPB 2VL6A 4WQMA 1B3QA 1R4MI 4YTNB 3NZSA 4W9IA 1SXTA 1RF2D 3P7JA 5BMGA 1WD1A 3OSOA 3I70A 2EYFA 2BB6A 1P16A 3GTLB 4JOIC 1HUNA 3SR1A 1I6HB 2EDGA 4RKBA 2O6VA 4B0MA 1S3OA 1ZXTA 5LMUL 2K75A 3HRZC 1QVFA 3HM6X 4A3JG 2KWDA 2N0SB 4KV6A 4ZRQA 4OVZA 1DJRD 3ZIMA 2IPKD 4R4TA 1VZ7A 2KAJA 4YCWA 1WXAA 3E3XA 1DCZA 3CQZH 1JOOA 1UBIA 4IUMB 1BOSA 3MJWA 1ZPSA 2JWUA 2DZIA 1VQNA 1L1OB 4TRDA 2QA4A 4A6QA 4DUYL 1Q82C 2UXDL 2EIFA 1GHJA 4UP8A 4CBVA 3OPOA 3DBLI 4B3SL 2Y5PA 3ZQ4A 3T51B 1E5WA 1XJVA 4HPPA 5J18A 4HEA1 1N33L 4P16A 2MFIA 4XYQA 4HJ5A 4MTNA 1EY7A 3P75A 4OVUA 2AUJD 1PGBA 3CMMB 3VXWA 1STBA 2K8CA 1VJKA 3M3JA 4HR7B 5K36G 2JVCA 2KO3A 4K3BA 5LMNW 4B3RQ 2I5MX 4IPGA 4HKQA 3DXJC 1E8WA 2LFNA 1WD0A 4A3BB 3H1UA 1QF6A 5HGQA 1L0YB 1WTXA 4TQUS 3U4VA 2VUMB 1UE7A 2D0PA 2WXFA 3I5JC 4Q0FA 5KGUA 1DOIA 4LAAA 1HNWQ 2MJ8A 4PMBA 1M1KC 1YJJA 2DYBA 4HWIB 2NVXH 5IE8A 2I07B 2WXIA 1VR9A 1FVIA 2FMMA 3AU5A 3K0YA 1QNKA 1PH4A 1J7AA 3DDCB 3JSVA 4G0NB 2Y3AA 4J15A 4JYAL 4AIMA 3PZDA 1WYGA 3GTJB 4EKUA 4BBSB 3QIJA 3S17B 1QJOA 3HOUG 3LNNA 1FEHA 3V60A 1WTPA 4WWOA 2PQAB 1YJ9A 1N34Q 2FINB 2CHBD 2DHZA 3RMKC 3LGJA 1HUMA 1WOCA 3VTWA 4H44C 3CF6E 2B3GA 1Q46A 1VQCA 4HK2A 1HEZE 4FULA 4IOIE 2V0GA 3PTFC 2WYQA 4JC0A 2KQ3A 5M5WH 2XEWA 4DK3C 2A8VA 3QC8B 1VQHA 1TWHH 4GN1A 4GXBA 2CQOA 4BXXG 1V1PA 2O2LD 1X3GA 1VQMA 3PO2B 3DHIC 3WOFA 2KK8A 4GIVA 1E24A 3DWPA 2KEEA 1CK1A 3EROA 5FLMH 3CP0A 4ZOHC 4RCNA 2B29A 3CD6A 3BZDB 4DR7Q 1N63A 2I38A 4DWFA 2OEOA 2RQXA 1E6EB 3A33B 1B9NA 4RHSA 1I4RA 4YY3L 1GUAB 4KN4C 2R93H 4NJCA 2B2VA 3TEZA 1CKNA 1R9TB 4X65Q 4JI7Q 1I4XA 4HXDA 3ND8A 1HQMC 1IGDA 1PH7A 4KSLC 1RIPA 3M4OB 4BY1H 5G3LD 4A3GH 1Q0WB 3AE3B 4A75A 1A15A 2B8GA 2MNAA 3TZDA 2PKOA 3NUCA 3RLFA 1ICWA 2BYFA 2B2TC 4HIMA 2E75C 3GS2A 3JVZX 2JA6B 2R6GA 1Z9FA 2O6VD 2V1YA 5EKLA 2MO0A 1EQQA 2BB5A 3FAHA 3TIXA 4JBKA 1T0RC 2C35B 5HY6A 2JA5H 3ULPA 1NYRA 3NY5A 4A3KH 3ITPA 4DUZQ 5EKKA
chains in the Genus database with same CATH topology
4KY6A 1BCPB 1Q1EA 4FF1A 3G6JB 2PPBC 5DNFA 2LMCA 1QLBB 4RF0A 2JEBI 4B9XA 2IT1A 3GP7A 2F0MA 1PRTC 1BMLC 2Z4HA 4EE2A 4DK1A 3HOWB 3FRPB 3OWFA 3TN2A 4KY7A 2CVRA 1C78A 4M0WA 2EY2A 4KKTA 4D2KA 1S5CD 1A3UA 1I3QB 1IW7D 4BA1I 3S9WA 2WS3B 3MVVA 1EY4A 5BYSA 1VF5C 1XCQL 4CJ1B 1GUSA 1O7YA 3CWIA 1RYJA 3SR6A 3AH7A 3A7AB 2R7ZB 4XXEA 1LT4D 3NK9A 1FFVA 5KRUA 2JA8B 1JMLA 1XEEA 1B9RA 3FILA 3FPPA 4FXDA 2LS01 4XTCS 2B2YC 4ZAIA 4DAYA 5JJZA 4KY5A 4B0EA 1CQVA 1VDVA 3H94A 4BWGB 5I4DA 2WACA 2ONQA 3PMFA 2AUKA 4MIUA 2M0AA 3K6OA 2V3NA 5HFYA 3CQZB 2V4DA 1WTWA 4V190 4IFDG 3ERQA 3MFGA 3C2PA 5C4XB 1CFMA 1JWMD 1Q1BA 3R3OA 1KRHA 3MHBA 2F0HA 3H3VC 1BQQT 1QOHA 3D6WA 1R7SA 2MEKA 1AZQA 3FEWX 4WH4A 2F0KA 2OXPA 3EVQA 1SSOA 4NW2A 2K3UA 5I2YA 4B9WA 2WP8J 3T16A 3SK5A 4H13C 2NUCA 1BNZA 2M2LA 2NVXB 3E5SA 1ACCA 2J42A 2WXOA 2JYEA 1EY6A 2QEJC 1WWTA 3A8IE 1LT6D 4RWSC 3ND9A 2WXJA 4C3HB 2RMMA 1HHVA 1EY0A 1GUTA 2EE1A 1PUTA 3SDZA 4KGSA 2N7JA 5EPKA 1HFGA 2KN4A 2ON8A 3W2DA 3NVZA 1NVID 1E7PB 5LL6X 2E2DC 1L4DB 1TWHB 1STGA 1SNCA 1FCCC 1BCPC 2PIAA 2M00A 3MXNA 1Q8IA 4GLSC 4MHEA 4NZLB 1RJTA 2KECA 4IUUA 3N9YC 3I72A 1B2TA 4XQJA 1JR0D 3KWLA 3RPFC 4ME5A 1V8CA 3BYTB 2R92B 5C5LA 4A3GB 4HKZE 1SE3A 1EM7A 3TMEA 1VZ8A 3W5VB 1TS4A 4HMIA 3PO0A 1PTOD 2QILA 3SK6A 1F2MA 5ELBA 3TEWA 2HDEA 1TR5A 1SAPA 5MPOA 3PUXA 4ZKCB 4AQ7A 4ARCA 5BMIA 3B2GA 3P1HA 3DWGC 2L83A 3GTPB 5C4ZA 3FC4A 3HGBA 5C0XJ 1ZUD2 4C3JB 5IGBA 2ACZB 2F0JA 1DXMA 1I7HA 1YJIA 5T1IA 4B08A 4Y7NB 2OT2A 4FYDA 2K33A 3K7AB 2JSVX 3QOJA 3TP7A 1B44D 3GTKB 3VR4A 1H9SA 2EYMA 1JOKA 4JBWA 1CA6A 2NVTB 1ZP0B 1CTMA 2K01A 4J1MA 2YEPB 3ZYYX 2I46A 4A55A 3TZUA 3IFDA 1B3AA 4ZKBB 2INNE 3VR6A 4A8XC 5CBEE 3MAQA 3GTOB 3KWVA 2K03A 3HS0C 3Q8FA 3CKIB 3IT6B 1ET9A 4IUTA 2JE6I 4TSSA 2Z1CA 5HHDG 3VRBB 1FNVA 4I7ZC 5DM73 1A2UA 3BDLA 1YNJD 3DEPA 4RGTA 2JZPA 3OIQA 4A93B 3SFDB 4FO2A 1G291 1VZ6A 2WB1B 3I91A 5DEHA 5AUKA 2NMQA 2IGGA 5AUIA 3HOVB 3E9SA 3L7ZC 2BA0A 1D2BA 1II3A 2F0GA 1JROA 3S14B 2QMTA 4YSYB 1LT5D 5BYQA 2F0PA 1EEID 4C3IG 3MTSA 2EY6A 2EYJA 4K5VA 4HSVA 5HURA 5IIFA 2PZUA 2L9HA 4IURA 4CJ2C 1TKEA 1TS5A 3HVZA 3MHZA 3HOXB 1OQQA 2BBCA 4XYOA 2EY5A 5JVG3 2B76B 4KD3A 1FCLA 4PMCA 1PTOC 2IGDA 3SXHA 3V05A 1SF0A 5C3JB 2LY7A 1ZYRD 1STEA 2PCFB 2F0QA 4C2MB 1LT3D 5C3WA 2Q8TA 2AQ2B 1UWMA 2GI9A 3TP5A 2E2JB 1LV9A 2J4XA 1DM0B 4IZ8A 1ONLA 1ZXHA 1MPEA 5EBDA 3MXPA 2B63B 1NYQA 1UGJA 4LMQD 1NENB 4KMUC 2L32A 3CRKC 2XRQD 2B2TA 4OZBA 1FRRA 2YYZA 1CHPD 4KJOA 1M4VA 1S4ZA 4KKIA 2KHSA 2BA1A 3P1MA 1MI2A 2L1AA 1MHXA 2K05A 5IOCA 1FD7D 5K5PA 5CV5A 1XYIA 3IXSA 5HI1A 4WURA 1CZGA 3T13A 1SNPA 1KLGD 1WCMB 3BK2A 3QOLA 4NMZA 1ZEQX 2WDQB 2EYHA 3LXFA 2BS2B 2K7VA 1F77A 2DWQA 3HOYB 3I3CA 3ZJTA 1IKMA 1ZE3D 2ENBA 3NXWA 4LLGM 1QG7A 1DOLA 3H0GB 1JE4A 2L1BA 4G57A 1C4AA 1C48A 3MC0B 3T3NA 5D7GA 2KOLA 3Q8CA 5ELFA 1EIGA 5JEAG 1GAQB 3PO3B 1MBYA 2CQAA 1NR4A 4IN3A 3D3RA 4DXFA 1T6BX 4OZAA 3HOZB 2EJFC 3LYYA 3J7YW 1EU4A 1JCKB 1G91A 3V3XA 1PYWD 4ZUIA 2F0TA 2ZT9C 4X3UA 4A3MB 1N60A 1ZDVA 5CBAE 3HP3A 5JPMC 2L52A 3B2FA 2HDLA 1IYVA 4RF1A 2NBFA 5CV6A 3D6CA 3DHQA 3D4WA 5C2TB 3TBIB 2B2YA 3H91A 3NTKA 1CQFA 2O5IC 3IL8A 3S16B 2KACA 4CQNA 3B9JA 3AMZA 1STNA 3T53B 3QJYA 4XDXA 2RVLA 4XT1B 1F2RC 2WIIB 4K2LA 4L8JA 1PFMA 3URYA 1TWFB 1N5WA 3OHXC 1RFKA 4J3OD 2W3RA 1GB1A 2WINB 2EYLA 4OL7A 3SEBA 5FOBB 5CV9A 1PFBA 3KLSA 1VMPA 4OZCA 4X3TA 1IHZA 1C9FA 1R4QB 4BA2I 2WXLA 1JC7A 3C46A 3AEEB 4PQXA 5M3FB 2WXMA 1KABA 3C3LA 1TS3A 1J8IA 1GUGA 4J8QA 2VXWA 1PRTD 1F2LA 2WLBA 1FM0D 1G8ZD 5JXVA 5EE0A 5G5GA 1E2WA 4CKEA 4N6EB 1CT1D 1EYDA 4GZYC 1EYAA 3AEFB 5C5MA 1HA5A 2EYOA 5H8YE 4LK0M 4MH8A 4X3SA 3IAM1 2EXZA 2EJGC 2PMZB 3V96A 4IFDH 5BYRA 4US9A 1RD9D 4HSPA 2FHTA 1VMCA 2KA7A 3VR9B 4NP5A 2XNAC 3W9CB 3QWNA 4KN7C 5CC4A 3WCQA 2BS3B 1CJEA 4REZA 2K04A 1X3QA 5IGEA 5EGTA 3UI3A 1IKLA 2DNCA 1RTNA 4ZRZA 2F0SA 3RFZB 4RA8A 3P4QB 1VLBA 3PZ8A 1N5XA 1TZOA 2NN6G 3HZXA 4K6LA 1A2TA 2XIWA 1TY2A 4PNYA 1HZ5A 5DAUA 3QO2A 2N9KA 3NVWA 2SNMA 2WDVB 3OWEB 4ZUJA 3S2DB 2C5CA 2K32A 3KLSX 2D62A 5CV8A 3W1SA 1RDPD 2OEDA 5I6YA 5C4HA 1TVXA 1W6KA 1PMRA 3U9SA 4C1NI 4DXGA 1QCBD 3SFEB 3GTGB 1E2VA 1DONA 1CA5A 1G2SA 3A54A 4FVMA 2MPMA 4KI0A 4N9TA 1CZWA 1FNUA 4R3DA 1VCIA 2XSCA 1U4MA 3VYUA 5CR3A 5LL6S 4MM3B 4IUQA 2GRIA 2LHEA 3NVVA 1Z47A 4XIGS 4K2KA 1PGXA 3S1RB 5EBCA 2BYTA 1EZ6A 1MI0A 3I8ZA 3KBXA 5I9PA 2O5JC 1YQ3B 1Q10A 1K53A 4CHTB 4JK1C 1KNAA 1FYCA 1KNEA 5KIXA 2RDFA 1F2ZA 1C76A 1I6VC 1C79A 3IAS1 1QOGA 2BTEA 1KLUD 1LTGD 4I65A 3VR5A 5F2DA 5NUCA 1DYQA 1U4LA 4R8NA 1V43A 1YNTE 3VA7A 1TKWB 4PT5A 1Q90A 3NQTA 1EWYC 1PDXA 2WKDA 2DYMA 3A8JE 2ZW1A 1Z7TA 1XLPA 1BCPD 1QWYA 3BK1A 3NQIA 2NTTA 5C0XI 3Q24A 3WOEA 2WXQA 4C80A 2A68C 3NS1A 4EQPA 4G7ZC 2D5GA 4OO1I 4ULLA 1XF5L 2AQ1B 3J80E 2K5WA 1CM9A 2AWOA 4OHJA 2PLPA 1H9KA 5COYA 2L12A 2R61A 2KUMA 4DGZA 2AQ3B 2NYZD 3Q22A 2XWBB 1IGCA 2SAKA 4K6DA 1RODA 3GV6A 4YSXB 1DD2A 3AV8A 1XX8A 3D31A 1TS2A 1QQRA 2BE5C 4YT0B 2EYPA 2F0VA 4K5WA 3J80L 1GHKA 1SJHD 4EVOA 1LTRD 4HCSA 1F2RI 2B8FA 1XWEA 3SK4A 4RFBA 2ID0A 1KH0A 3TP6A 3KUPA 4BS9A 1GJXA 1HPCA 1P7FA 2BDNA 1YN3A 2K22A 3NSWA 1PXUA 3J7AF 3NBHA 4IFDJ 3AEGB 1WTOA 1AWDA 3N6RA 4NAMA 1BUVT 4C3HG 3AE6B 2V3PA 4MT5A 1V1OA 5G3LF 2LEKA 5C44B 1Q12A 2H1EA 2W82A 3LB8C 2A74C 4L1BA 4M8AA 1D6EC 1Z6HA 2CJNA 1UUPA 4IQZA 4XT3B 1QOAA 2NB0A 4RAUC 4DFAA 2JXTA 2A73B 2WU2B 5J39A 1Q3LA 2AX5A 1YQ4B 2PVOD 1XO3A 4GDLB 1XLOA 2SDFA 5BN3A 1SYCA 3PIP3 1LTTD 3VYSA 1L6VA 2VZKB 1NSNS 4Q5VA 3BG3A 5M5WB 3U4EG 2JA7B 3ZJVA 2RBMA 4CKBA 4WFN3 1IBXB 1EY8A 5EE3A 1F9QA 3VRAB 2TMPA 2ZXPA 3MZ5A 2WXNA 3DM1A 5C6AA 3J81L 1BUIC 4ZHOA 5JVH3 5JAVA 2R93B 3X3NA 4E6IA 1LO5D 3J9CA 3AB5A 5G5HA 5EPJA 1SMYC 3CHBD 4BY1B 2CW0C 3MXGA 5IT9E 2D2CC 4DK0A 1TU2B 4F88A 1E9MA 1EQVA 3RMHA 3AE4B 2D9UA 5BN4A 5ELDA 1QOFA 2EZVA 2JA5B 1DOXA 4A3KB 2CU3A 2JYTA 1XTCD 4RGOS 4WRDA 1D1KA 5IT9L 2N55A 2NVYB 5HGTA 1LABA 3CU7A 3R2TA 2GA4B 1O80A 5JEAH 2QF7A 4YTMB 1QNUA 2B2UC 1U4RA 5M9OA 3A8KE 3FDTA 1SYGA 4XE0A 4H0LC 3TEYA 4TQ1A 3IKJA 3F2UA 1SEBD 1FGBD 2VB2X 3E56A 3PUYA 1D4BA 1I50B 1AW7A 2NZ1D 2J7ZA 2PW9A 5FO9B 1YMHE 4G7OC 5I6WA 1VRAB 1F9RA 3I73A 4F8MA 4G4KA 1U4PA 4YWGG 4HTHA 3NE5B 3ETRA 1Y1WB 4DNRB 4HROA 3Q8AA 4U673 3MXUA 1JWSD 2BT6A 4HAEA 4ID6A 2F03A 1L5PA 2KVMA 4OIJA 2ICEC 3H6MA 2DY7A 3ABVB 3NVYA 1GUWA 3R8BA 4A3DB 2VNUD 5C3EB 2K0PA 4HJGE 4TMAB 2QDBA 1GB4A 3AE8B 2J52A 2K6AA 2MHVA 3TSSA 2QKIC 2D5DA 4FF4A 1K8MA 5E6JA 5E3FA 1A6XA 2F0LA 2F0OA 1PGAA 4TQ0A 2WAQB 2E76C 4KHZA 2WXKA 4EQNA 1NAPA 2MJEA 2FBWB 2F4IA 5KNBA 2Q8RE 2NVQB 3EGRA 2JEAI 2FUG1 3KLRA 3AE1B 2WP9B 1OQRA 3MA2B 4ITKA 3SHLA 1EWHA 1LTSD 5BMHA 1J7CA 1QKZA 2SNSA 4JWUC 1PZJD 4DA2A 2PMVA 4DAVA 2WXHA 1I4PA 4C3IB 4Z9CB 2LHDA 1WTQA 4ZQ3A 2K9XA 4BBRB 2BS4B 4KGRA 4XDDA 1HTPA 3PUWA 2FFKB 5ISRA 3N52A 3Q8EA 3S1NB 4YXDB 3PIO3 1SDFA 2OHFA 5JPNC 3BVGA 5KNDA 4QB4A 4JX1C 3I9V1 1JQ4A 4YIJA 2BW2A 1IL8A 2WDRB 1TKYA 1HRJA 5GXGB 3Q0AA 1C8CA 1JRPA 5T8IA 3G7LA 3FMCA 4KKJA 2NN6H 1TJEA 1SIJA 3BDOA 4X3KA 2L55A 4WORA 5KYIA 3U2SC 5I2XA 1A70A 4HN7A 2X69A 3LWUA 1WGKA 4L23A 2ZXRA 3GO5A 2K28A 4RCOA 1MD2D 1EU3A 1S5BD 4J6HA 3A56A 2H88B 2M19A 3MEHA 1SB3C 1NI3A 2RSNA 1YN5A 1GPXA 4AYBB 5JEAJ 1B4OA 3MFYA 1I4GA 1RHPA 3GB1A 5A35A 3TDQA 4BY7B 1E10A 2Y0SB 1KDCA 3KK7A 2YU9B 3T4AC 1Y69U 3K5LA 3GV3A 2F0EA 2MGSA 1K8OA 3AE2B 2BDOA 2KDMA 4A3FB 1QE6A 2A6EC 2JSOA 2B2WC 3EA6A 4PMWA 4H2AA 4NKLA 2LGIA 1J9OA 1MHHE 1MVKA 2INPE 4ZRPA 3M7NA 3AEBB 2E6XA 2F0IA 5HG2A 2L5TA 4KJNA 5I9OA 3BIID 4P6VF 2W55A 5FO8B 1UEAB 2QIEB 2Z8LA 3WDNA 1ZOYB 5E1FA 3U52E 1X32A 4TKOB 4MACA 3H8HA 5A2QE 1JQYD 3OMCA 1TYGB 1D1IA 1JALA 2IX0A 3D4DA 1A3TA 2J0TD 2W3SA 3A55A 3AB9A 2LFIA 5FLXE 5EE9A 5A2QL 4MN3A 2F3WA 1FIQA 1O7LA 3VA5A 1EIHA 2MH7A 1AN8A 1F2YA 1M8AA 1PDQA 1JORA 1TIID 2X6LA 2HQEA 2SOBA 3VYRA 1C4PA 2RDHA 5FLXL 4QUCA 2PZTA 4NDXA 2X6GA 3QIAA 4IKGA 1OXXK 2QSDA 5M5YB 4RNAA 2K1BA 3W5UB 3VR3A 4A9AA 1WXQA 4QMGA 2SEBD 3E6ZX 1SYDA 5KYLA 4FNFA 2EOTA 3Q8BA 3L4PA 5E4WC 2W54A 2A5HA 4ODGA 1SNOA 3BYYB 4A3JB 3RZOB 1FXIA 1SE2A 3VYTA 1PZKD 2ZW0A 1T5XD 4US8A 5FK9C 4KTAA 1XXGA 4ABNA 2MJ3A 1FRDA 1C4CA 3UI2A 2AWNA 1DOYA 1HA6A 3L3OC 3P20A 1W6JA 1N62A 1BF4A 4UDUC 2H4OA 1WTRA 5EQ0A 1HTLD 2O4XA 1QB5D 1MSGA 1S5ED 1KTKA 2A68D 3NP8A 4ZHPA 1K52A 5D3DA 1ENFA 4ZLTF 3NRZA 3R93A 2Q5WD 2IX3A 2L4NA 2F0WA 2E2IB 1PTOH 3OIPA 3PZ7A 3FPUB 4IFDI 4RGNA 3J7AV 5FO7B 2RPVA 1JICA 4LTUA 4UAIA 3K5OA 5E4XA 1DOKA 5EKIA 4XQQA 1RWSA 1L0XB 2N9LA 1EWCA 5IGGA 2BE5D 2M9VA 2M56B 1RM6C 5EPLA 1VDZA 3HOUB 1EZ8A 3CRLC 2E2HB 4QCLA 4RH6A 2WV6D 5TSSA 4ZYSA 4FF3A 3S1QB 1YN4A 3OW7A 1SFOB 2B2UA 1JB3A 3HEJA 1FXAA 2NWGA 3HG9A 3OMGA 4KKUA 3QG1A 1L4ZB 2VB3X 1F9SA 2MJDA 1SYEA 3M4YA 1BXTA 2IGHA 1DGJA 3M7GA 3NWTA 3X3MA 3I4NB 2KMMA 3ZGZA 1RTOA 2F0NA 3PV0A 2F0UA 1Y1VB 3MJ5A 1ENCA 2PW5A 1FD6A 3C1EA 4KKSA 4HCEA 4YTPB 1QT9A 2DYOA 4M1UB 3E0JA 1SNDA 5EJWA 2Q8IB 1GXDC 4F7XA 3IFTA 1WTVA 2RSOA 1EL0A 4H7BA 2PO4A 1PFNA 1T3QA 4N58A 4QUFA 4L2YA 3NUHB 2OF1A 1UAPA 1D5MC 3KF8A 4S3SA 2JX5A 1V1PB 2B39A 2LUMA 1PRTF 2F1MA 1O78A 3FKIB 1JOQA 5J1ZA 1TT2A 5C0XH 4CKCA 3BVZA 1ET6A 4WWMA 1SNQA 3GTMB 1LTID 3BDCA 3EJIA 1HCZA 4ILWA 1VF7A 5IODA 3HKZB 1MSHA 3EUB2 4OO1H 4JPSA 3I57A 2FMCA 1NR2A 1L6UA 1SMYD 1STYA 2DY8A 4LK1C 2CW0D 3DUZA 1HZ6A 2G9DA 1N61A 4FP5D 2HTME 2MP1A 5CGKA 4R8IA 3EQLC 4KK7A 5CV4A 1STHA 2LMCB 5CORA 5LHY1 5FKAC 1H9JA 2XWJB 1C77A 2PZWA 3ONAB 3R2IA 1FFUA 1HXYD 2KEDA 3H09A 1IBXA 2K5PA 1V8QA 5FR3A 1SJED 4F87A 2RA4A 1D5ZC 2E74C 3K59A 1EFID 1EY5A 3AE5B 4N59A 3LWEA 2EKIA 1ZKOA 3EFXD 4HRSA 3W3AA 3KBGA 2HDMA 3K5NA 1PFDA 3U7ZA 2C9OA 1JWBD 2XN9C 4K8IA 1QILA 1B50A 2EELA 5CV7A 2KJXA 1BBXC 3TEXA 1B1ZA 1EYCA 3S15B 4C1NK 2F0DA 1WSPA 2IDYA 1KAAA 1NEKB 3FILB 1SSNA 1OXVA 5M5XB 4JE3B 2FJ2A 4XWTA 4XQNA 4DN4M 4KGTA 2QCPX 4L6TB 3P4SB 1ESFA 3J81E 4DNTB 3NHHA 1L0VB 3SK8A 4DAPA 5D14A 4RGMA 2DBYA 1ZXIA 1PTOB 3IT4B 3P63A 2PVGC 3NPPA 3MWYW 2EVBA 3I90A 4OGQC 3S1MB 3PUVA 1PZID 1E2ZA 2KCCA 3GD7A 2A69D 1V97A 2K5QA 1IW7C 3FVQA 1EQTA 1UWXA 1JWUD 1TY0A 5JOBA 3NWSA 3AEAB 4IDIA 2EJMA 3NTHA 1TKGA 2B2WA 1RCVD 1E0BA 1HFNA 4C3JG 2BCOA 4FXGC 1TWAB 1BCPF 4OIKA 4OW0A 3O13A 4IALA 3D4RA 3QB3A 5AFWA 4QIWB 5D65A 5EE1A 1OXUA 4C56C 2LKVA 3AE7B 4CGYB 4XDCA 4PV1C 2VZKD 3U9OA 1X3PA 3AE9B 5C0XG 3K58A 1OXTA 3DWMA 3VQIA 3SE0A 3M3YB 1ENAA 4HEDA 3Q6SA 3T56B 2EPBA 4OO1G 2B2VC 1K83B 1F0ZA 5D3IB 3HUIA 4FXCA 2I2YA 1GOZA 5LNK1 4O42A 2F3VA 2IW3A 2JP1A 1IUEA 4ARIA 4YSZB 2CJOA 3KQ4A 3Q69A 5CMDA 4NAWB 3MP9A 2LJIA 1ML0D 1HQRD 1T5EA 1AP0A 1C4QA 2QJLA 1S5FD 3V2TA 4CJ0B 1ZDXA 3TUOA 1UNSA 5DM63 2E3TA 1O7ZA 1LACA 1U9RA 1Y8NB 1QOBA 2JU6X 1B53A 1EY9A 3P4PB 1STAA 2WKCA 2JQRB 3VR8B 4WIPA 1WRIA 4C7ZA 1NUCA 2IL8A 3AEDB 2R3ZA 1ILQA 4XWWA 2Y5CA 2JXMB 3C1FA 1TWGB 1LTBD 1CZPA 4KHVA 1EEFD 1ESRA 2A69C 1FO4A 2MUYA 5IGFA 3AM9A 1FR3A 1WVLA 3OOCA 2V4IB 3I4MB 4IUNA 4EQOA 1KDBA 3NZ3A 1OXSC 2K5DA 5M3MB 3BVMA 4V0BA 2A6ED 1TWCB 1PLFA 2RDGA 4K5XA 5IGCA 4DF7A 2XVSA 2FE8A 1E0ZA 1KDAA 4P2CB 5J22A 2G1EA 1ROEA 1D5XC 2WQYB 1H9SB 1H9MA 2IX1A 4O1NA 2PW7A 4ZK9B 3DMUA 2JYOA 3T3OA 3LX0A 1DOMA 1F9PA 3K57A 2EY1A 4DQOC 1K50A 5CYUA 3M85A 3Q23A 2NTSA 4KD4A 5T1GA 1I4QA 4L63B 4G7HC 5IGDA 1G6ZA 3AECB 2A6HD 3I4LA 3SVMA 3K5MA 4LJZC 1YNND 1PTOF 4RHRA 1FMAD 1S5DD 1MGSA 3AN1A 2TSSA 2BOSA 3RUZA 1SYBA 1FNWA 4K14A 3D8GA 2RKSA 3CIRB 1A3VA 5K36H 2KCNA 4FF2A 3GQBA 1XLNA 3ZJUA 3IAYA 1Y8PB 2N88A 2PTLA 4EGVA 1SE4A 3JAME 1SYFA 5C4JB 4WAFA 5KNCA 3L9AX 1CI3M 1I4HA 4A3EB 5KEEA 3BWUD 1GUNA 2KQ4X 2DN8A 1RKNA 2H89B 4IUPA 2XRSD 2DLBA 1Y56A 2ICIA 1BR9A 2WNMA 3JAML 3P4RB 4N9PA 4R9WA 4RKLA 1CHQD 1DZ1A 5ELEA 1XCTL 2J53A 5ELCA 1H9RA 3RD4A 2X38A 2L11A 3A7LA 2IJ0A 4FXKC 1SNMA 3RZDB 1YNJC 1AEXA 1BDOA 3HVDA 2Z4IA 1G2TA 1K51A 1Y8OB 2DNEA 2L0CA 1IYUA 4WJWA 1J7BA 3DEOA 2NN6I 1OO9B 1KF6B 3VR2A 3P42A 2PQEA 1P7EA 1OFFA 2WXGA 2G9HD 4AS1A 4A3IB 1AZPA 5BN5A 1BO0A 3HRDD 2F0FA 3TP8A 4DU9A 3NTIA 2YEPF 3NBIA 4HMJA 3AMUA 3GTQB 1ILPA 2GB1A 3DWAA 1XLQA 4Q2JA 1EOTA 2PNRC 1GUOA 1TQOA 3DWQA 1B9MA 4K8JA 3PUZA 3BS1A 4USAA 1AFPA 4IUVA 1AYFA 2WXRA 1JWAD 4A90A 2ZXOA 2A6HC 1NCVA 4KX6B 2HUGA 4QF4A 4GDKB 1PRTB 1ZYRC 5H92C 1YNNC 5C3XA 1R4PB 3S2HB 2WU5B 2HCIA 1SBBB 1JW9D 1LTAD 4JWSC 1LLRD 2IWHA 2HCCA 4C7YA 3C8YA 2WXPA 4U68A 2PYKA 3AU7A 4WQMA 4YTNB 1SXTA 1RF2D 3P7JA 5BMGA 1WD1A 3OSOA 3I70A 2EYFA 2BB6A 3GTLB 1HUNA 3SR1A 1I6HB 2EDGA 4RKBA 4B0MA 1ZXTA 3HRZC 2KWDA 2N0SB 4KV6A 4ZRQA 4OVZA 1DJRD 2IPKD 1VZ7A 2KAJA 1DCZA 1JOOA 1BOSA 1ZPSA 2JWUA 4TRDA 4A6QA 1GHJA 4CBVA 3OPOA 2Y5PA 3ZQ4A 3T51B 4HEA1 4P16A 4XYQA 1EY7A 3P75A 2AUJD 1PGBA 1STBA 1VJKA 4HR7B 5K36G 4HKQA 3DXJC 2LFNA 1WD0A 4A3BB 1QF6A 1L0YB 1WTXA 4TQUS 2VUMB 2WXFA 4Q0FA 5KGUA 1DOIA 4LAAA 2MJ8A 4PMBA 1YJJA 2I07B 2WXIA 1VR9A 2FMMA 3K0YA 1QNKA