1LO5D

Crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
233
structure length
233
Chain Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIAIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal Structure of a SEA Variant in Complex with MHC Class II Reveals the Ability of SEA to Crosslink MHC Molecules
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lo5D01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1lo5D02
1XXGA 2WV6D 1AW7A 1JWUD 2SEBD 2IPKD 4UDUC 1BXTA 1YN5A 2CHBD 4RFBA 3BVMA 1B44D 1LTSD 4C56C 1CK1A 1LTRD 1RDPD 4RH6A 3V05A 1I4RA 1LTTD 5FKAC 4RGTA 1BCPC 1KLGD 1PYWD 1QILA 1STEA 1L0YB 5ELCA 1DYQA 1TY2A 1BCPD 4L63B 4RGMA 1BCPB 3BVGA 5ELFA 2XRQD 1I4XA 1MD2D 1LTAD 1GOZA 5ELEA 1ENFA 5D3IB 1LT6D 1XTCD 1FNVA 1LT4D 5TSSA 2O2LD 1TS2A 3BYTB 1HA5A 4RGNA 1PZKD 1I4PA 1D5ZC 1FGBD 2NTSA 1EEFD 4O1NA 3OWEB 1CHPD 1UUPA 4ZYSA 1EWCA 1CT1D 1KLUD 1DJRD 1SJED 1S5BD 1V1PB 2XRSD 1EU4A 2AQ2B 1PZID 3W2DA 2J4XA 1D6EC 3R2TA 1G8ZD 2XN9C 1PRTD 2XNAC 1D5MC 1S5CD 1T5XD 1EU3A 1BCPF 5FK9C 1PRTB 1V1PA 4Z9CB 1I4GA 3TSSA 3EA6A 4RHRA 5I4DA 4TSSA 1CHQD 1JCKB 3BVZA 1PTOH 4NZLB 4DXGA 1SJHD 3O13A 1PTOD 2Z8LA 2QEJC 1PTOB 2ICIA 1LT3D 1SE2A 1JR0D 1YN4A 4RGOS 1SE4A 1SBBB 2TSSA 1HXYD 1ET9A 1S5FD 1JQYD 1LTBD 1I4QA 1RCVD 2IJ0A 1FNUA 1CQVA 1PRTC 3BYYB 3DWQA 4BWGB 4DXFA 1S5DD 2RDGA 1FD7D 1SE3A 5D3DA 1D5XC 1YN3A 4K6LA 4RCOA 1I4HA 1PRTF 1RD9D 1TY0A 5ELDA 1LT5D 1M4VA 1F77A 1LTID 1JWSD 2R61A 3GP7A 3DWAA 1TS3A 1S5ED 4L6TB 5ELBA 1PTOC 3MFGA 3MC0B 1B1ZA 2G9HD 1EFID 3BZDB 1EEID 1HTLD 1RF2D 1LLRD 2NTTA 1TS5A 1JWMD 2QILA 1PTOF 1HQRD 3EFXD 3DWPA 3R2IA 1KTKA 1AN8A 1PZJD 3URYA 2AQ3B 1ET6A 1V1OA 3KLSX 1FNWA 4OHJA 3SEBA 1UNSA 2RDHA 1L0XB 1SXTA 1LO5D 4RHSA 3R8BA 1ESFA 1TS4A 1SEBD 1LTGD 2AQ1B 3CHBD
chains in the Genus database with same CATH superfamily
4DR5L 2A4ZA 3DVGX 4BZAA 4KD3A 1JJ2A 5J2RA 4XC2A 4NPSA 4DV6L 3CC7A 3PO3H 1VF5C 4IM3A 1UGMA 4ZUJA 2W3RA 2SEBD 4FLHA 4K1RB 5LXHA 1XPOA 4R4IA 1N6ZA 3H7PA 1S4ZA 3PGEA 4CBVA 4R8NA 3S1QH 3A1QA 4HXDA 3NVVA 2KQ3A 2PYKA 3UI2A 1C4PA 2JPHA 1JRUA 3CCJA 2NVYH 3BJUA 2EYMA 4XX5A 3GTPB 4G7ZC 5IP7H 4B3ML 2CWAA 1KLGD 3OW7A 4K5WA 2JA5B 2M56B 3IAM1 4CKEA 1K51A 3MVVA 1VCIA 2MFIA 2Z1CA 2WXNA 3TN2A 2K9XA 2N3SA 5C44B 4XZ4A 1PFBA 1TKWB 2XK5A 4A3IB 4RGMA 2V1YA 1C9OA 1D1IA 3NTHA 2HTME 2MJEA 1QOFA 3J7ZC 2Z0DB 1JOQA 1EIHA 2BE5D 3KDFB 4WJOA 5KRUA 2GBMA 3TJPA 3STBD 4BBSG 5K36H 4HSVA 4K14A 1L0WA 4ANXA 2O2LD 1IPGA 1UELA 1Y1WG 4LF7Q 1K8GA 4LF8L 1I42A 1UE7A 3OWEB 4LK1C 5M9OA 1HUNA 1QZGA 1EQVA 1MGSA 2FXQA 1DJRD 1OQYA 2Z0SA 3WOFA 5JZEB 1BBXC 4US8A 1NSNS 4K8JA 4KK7A 5KYLA 1PZID 4QIWE 3QO2A 1FRRA 4LFAL 3I91A 2JA8G 1DZ1A 3KUZA 3VRBB 1IKLA 1D5MC 2J7QB 1SF0A 5D14A 3TL5A 4PYUA 4LNNA 2O4XA 3M9BA 4O42A 2F0UA 2QCZA 1NEKB 3K0YA 1H9KA 1CKNA 4A3LH 4IPHA 1LM0A 4DV0Q 1M94A 2X6GA 2K5DA 3FMCA 3H09A 3D32A 2MO0A 3BY4B 1JWAD 4FXCA 4G7HC 4HDOA 3C3LA 4AUQC 1RIPA 4W9DA 2F0PA 4BBRB 3PUVA 1AZPA 4DDID 3PGZA 2WWZA 1C4QA 1IGDA 3FRPB 1EY0A 2O5IC 3TIXA 3FKIB 1NE3A 5L37A 5A2QE 2KC1A 3GOEA 2Y0SE 3CCRA 4A3MB 5H92C 2O6VA 4L5RC 3ETRA 3Q69A 1FR3A 3S14H 5HG2A 1E8YA 5IT9L 2LASA 1WFYA 5GADC 3UDIA 1ASYA 5JEAJ 1N5XA 3EC8A 4ACFA 1E22A 1G51A 3I70A 1SE8A 5ELBA 1V5TA 4C1NI 2LZ6A 5BO4B 3RYTA 1Q12A 4DA2A 1LGRA 2NVXB 2UYZB 4GDKB 4OXPA 3HG9A 5CR3A 2R7FA 3NBHA 1IYVA 4GKKL 2O6VD 2JP1A 3HOYG 3PIPA 2KQSA 4S17A 2KCTA 1FM0D 3VUYA 2BYTA 5EBCA 1HHVA 3DWPA 2V3NA 2PI2E 1EY9A 2ZM6Q 3VH3B 4RCNA 2Q2UA 1DGJA 4H13C 4YTMB 2UU9L 1A5RA 2VXWA 1HZAA 1M1KC 1DOIA 2NBVB 1GJXA 3CCUA 1PH9A 2GBJA 5C2TB 2JA6B 3K57A 1P3QU 2WDRB 3L2PA 2KWDA 4J6HA 5ELOA 3B1LX 2SDFA 2EXDA 3AE9B 1WR1A 3ERSX 4KD4A 2DNFA 2ZZPB 2EYFA 4DV2Q 5M5XH 4S0RA 5EKIA 1QUQB 2C7NB 2HDLA 5DAUA 2D0PA 3PO3B 2BCOA 1JROA 1CMXB 4LJPB 2D3CA 1HPCA 1VQAA 4IJLA 1LTTD 5D65A 3DM3A 3E3XA 3S1QB 4YHHL 1IP9A 2EYLA 1WTWA 3HOVG 2ZPYA 4FBJB 1WMHB 1BCPD 2NVYB 1X9NA 1SIFA 4LNIA 3KJPA 2F0GA 4IWQA 5HKHA 2YTYA 4JOIA 3P75A 2K50A 3N3KB 3BVGA 2XWBB 4XE0A 1Y1VG 5C4HA 2DJFC 5D2MB 2LEKA 3C1EA 1LTAD 5GAEC 5I2YA 1T3QA 1V81A 4QL5A 2BS3B 3SFDB 3EUB2 4YY3L 1VDZA 3NY5A 1IBKQ 1WJNA 4C3IH 1LT4D 1Q86C 5J1ZA 4XQNA 1K3BC 3NVWA 2E3TA 4IUTA 3PIOA 4DDGD 4IOCA 1BBWA 1PZKD 2RHSB 5C4XG 5M5WH 1F9SA 1XNQQ 3DHQA 1XLPA 3NZUA 1V1PB 4YCVA 4DV3L 4JK1C 4J3OD 4PS7A 2UUAQ 1X3QA 3JYUA 3IBEA 4YSYB 1L0VB 1NMGA 5G5HA 3KLRA 2MBOA 4B9WA 2PI2A 1PRTD 3OIQA 4LF6L 4OWWB 1NDDA 1CI3M 4HCNB 5FK9C 2JYOA 3L10B 3TSSA 3M4PA 4FO2A 4RHRA 1WX8A 2IW3A 2PJHA 3OMGA 3DBRI 4X66Q 1TKYA 4X62Q 2R92G 2DAFA 3EFCA 3KWLA 5E6JA 1UE6A 1SE9A 2R6GA 4BKSA 3OTOQ 5IYDG 3U4VA 4G7OC 3NUCA 1E24A 1ENAA 1F9PA 2EJMA 4AYBB 1SIJA 4KSLC 2WKCA 3CPFA 1SBBB 1WXVA 5J18A 2ZVNA 3KF6B 4UPAA 1UE5A 4NP5A 4JI5L 1HNXL 4DV1L 3WIMA 1EQTA 1S5DD 3G6JB 2WXMA 1N9WA 2A1AA 1FD7D 1XEEA 4BBSH 4NAMA 1N62A 1XPUA 4HEDA 5I9OA 5FLXL 4ANWA 1EY5A 3TEXA 5JH5C 3LJ3A 1YITA 4EOYA 3A5UA 3GV3A 1PTOC 5CV8A 1IBLQ 2EOTA 3CP0A 3S14B 3KH0A 2BDNA 1WTVA 2RBMA 3EIVA 3ULJA 2V4IB 4P1BC 2N1VA 4WJ3M 4MN3A 3CCMA 1RL2A 3TP6A 2K4KA 1EYGA 4RA8A 4II3B 1J7AA 2EY2A 2WXHA 3I4OA 1PHJA 1SROA 4GKJQ 1CJEA 1WGRA 1YJWA 1WJ4A 2WDVB 1L4ZB 4OHJA 1DOKA 2LFIA 1FXAA 2UWQA 4B3TQ 1AARA 1RLFA 2B39A 1YX5B 1NTGA 3NWSA 3R8BA 1V80A 1SEBD 2FIDA 3SFEB 3CC4A 3CHBD 2OF1A 4BA1I 3RLFA 2DY7A 4JWUC 4EQNA 2EVBA 5LLIA 2VL6A 1K28A 4BY7H 3KQ4A 5C4JH 2QDBA 1T0SC 2N0SB 4HK2A 5IA7A 4P73A 1K73C 1WRIA 2KKCA 2HD5B 4LNOA 4W9KA 2FJ2A 4WWPA 4ZHPA 1SYFA 2KDEB 1X3PA 5M5XB 2UUBQ 1STEA 4I6LB 1STNA 5IYBG 1YJIA 1DD2A 4JLCA 3L17A 2K39A 3VR9B 2L8JA 4X64L 3S24A 2UUCQ 1B9MA 4TQ1A 3SXHA 2GBNA 4WH4A 4JBJA 1QT9A 3EROA 3STBC 4KGSA 3EBEA 4DR2L 3DEPA 1GB4A 2KDIA 2HTHA 4DNRB 3BZKA 3I56A 3HOYH 3Q6BA 3UI3A 2WYQA 4XXEA 3QOLA 4LUZA 2EY6A 1WE7A 3DBHB 1VQFA 3R3OA 2OCEA 1HH2P 4K7WA 1RHPA 3TP5A 3P1MA 1KIXA 4DUZL 4LJZC 4C3IB 1ZOYB 2OEOA 3ZRCA 4C7ZA 3A8KE 2MJ8A 3PV0A 4PMWA 2EKIA 5GROA 2LMCA 3HKZE 1T9HA 3K5OA 2AQ2B 2CVRA 4IURA 5M5WB 3AU5A 1F9RA 4DUYL 3CCLA 2DLBA 2OQ0A 4EZJA 4A93H 1V43A 4ZKCB 2VUMG 2E8GA 2V0GA 1V97A 3F2CA 5EQ0A 3QWNA 2LGIA 2GRIA 2KDBA 2K32A 4DGZA 4KV6A 2NBWB 3HOVH 3IXSA 3A8IE 3K0XA 2O5JC 2BA1A 1C76A 2JSVX 4A3KG 1GUTA 1C79A 1Z9FA 4PMBA 2ZXPA 2KYWA 4JYAL 1BOSA 1Y1VH 5LMNL 3J9CA 3Q3OC 2IJ0A 1I4QA 3ZDMC 2NPTB 4GGQA 5D94A 4ZRPA 3V6CB 1I5FA 4JI4L 3B9JA 3D3RA 1EM7A 1Z2MA 2N9LA 4EE2A 3ZDTA 1D5XC 3VUWA 2WDTB 3VHTC 3L3OC 3AE4B 2BKRB 4A3CG 1EWHA 1PV4A 2EY1A 1M4VA 2JA9A 5C4XH 2BKFA 4KVGB 5COYA 4BBSB 3GS2A 4V0BA 4TKNA 3GE8C 3GD7A 4GMVA 3AU7A 1WTHA 1F9JA 1J0GA 2B8FA 3CXCA 3V6EB 3GO5A 4A76A 1C77A 1PH2A 3KYHC 5C5LA 2K52A 2L1AA 3X23A 1CUKA 2CH4A 2Z6BA 1K50A 2B76B 3M4YA 1HNZQ 1SXTA 1U9RA 2EQSA 2R92H 2FIFA 2I38A 4KHPL 2QW7A 4R8IA 4C7YA 5LMUL 4K5XA 2PNHA 4PZ8A 1KAWA 2LD9A 2QCPX 5E1FA 5IYDH 2X6LA 3ONSA 2QF7A 1KRHA 4IFDJ 2B2VA 2KCMA 5M3FG 3PS6A 2HCCA 5FR6A 1F0ZA 1WD1A 2ES2A 1IKMA 2F0WA 1XCQL 4BY7B 4DV1Q 2J0MA 3A7LA 4TVAB 4JI8Q 2NMQA 5C23A 1JW9D 3T1YL 5FKAC 2V1CC 4J15A 5C4JB 2BS4B 1BCPC 2KECA 4CO7A 2AWOA 3C0RB 1DXMA 1WTRA 4FNFA 2IO1B 3ZTDA 1L0YB 5IN7A 2L9HA 1F2RC 3I5JC 2GBRA 1DYQA 3A9JB 1N33Q 3HOWG 4UP7A 1ICWA 4ASWC 4L63B 2A19A 4GN3B 1WTQA 5ELFA 2KBNA 3K8AA 3NWTA 4LW1A 2N78A 2WXIA 4OWTB 2BPSA 3U9SA 3VTWA 3F1ZA 3L13A 3MHSD 2Y5CA 5CHWA 3CCEA 2JA7G 1XTCD 2JU6X 1PH1A 4JOIC 3B2GA 3J81i 1K8AC 3WDNA 3QG1A 4DV5Q 1PGXA 3JSVA 1E1TA 4NXNQ 4A3GG 1B8AA 1GUNA 1HA5A 4L8JA 4ZRZA 2G1EA 5IE8A 4JI1Q 2A5UA 2I0QA 3HOYB 4I6PA 3ZNID 3RFZB 4ANVA 3E0EA 1VQIA 4MIUA 5IWAL 4MM3B 1KLUD 2BF8B 2NVQH 1WX9A 2N55A 2YEPB 4IZ8A 4DV4Q 3L0OA 4J1MA 1GAQB 1XX8A 3TZDA 4LDTB 1BCPF 2WLBA 4DWFA 1K9MC 2GOWA 4TQ0A 3K59A 1FO4A 2F0DA 1ESRA 4I7ZC 4A93B 2GN5A 3PF5A 4DXGA 4OZAA 4DAMA 3ZYYX 5IYBH 2W82A 1I3QH 4OVUA 2PE9A 5BR8Q 1T0RC 1EY4A 4YCWA 3TS0A 1AYFA 4QAYA 1ET9A 3HOVB 1WVLA 1J7CA 4JI2Q 3AH7A 4LMQD 3PHXB 3C2PA 2LJIA 3HEJA 3IKJA 4HJ8A 3MXNB 1XMQL 2V3SA 2R7ZG 3D8GA 1Y1VB 3K5MA 3AEDB 3W5VB 1I4HA 4II2B 1PRTF 4FF1A 1STAA 1XNRL 2GB1A 3SR6A 1LT5D 4R4OA 2IGDA 3X0WA 2BDOA 2WAQG 4PK1A 2V4DA 3J80L 3K5NA 4F1SA 1S5ED 3RNAC 2JQRB 4XGAB 3ND8A 4PMCA 2ZXRA 2Q8TA 3S2DB 1TWGH 3JVZX 3VYTA 2F0EA 1JE4A 1HTLD 2CCZA 1LLRD 1EYAA 4C2MH 2Q8RE 5C4XB 1O7LA 1HR0Q 3ICEA 2C7MB 1SYGA 4EX5A 3RZWC 4E6IA 2EMTA 5L95C 1LQBA 1HQRD 4N9PA 1E2ZA 2LXCA 5CV7A 3SVMA 3NTKA 3FILB 2MEKA 1E8WA 2IO2B 2E75C 4DNIA 2MBHA 4HWIB 3ZKJC 2RDHA 2EE1A 3K58A 1HZCA 2YTXA 1L2FA 4RHSA 2QMTA 4XDDA 2GVBA 4LUVA 3PO0A 3AQQA 2BQQA 4HKQA 3E5SA 2F0NA 3PTFC 2AQ1B 4IG7B 2MQJA 1SYBA 2C9WB 2QGQA 1WMHA 1HTQA 2MPMA 3D31A 1SB3C 2R92B 1F2ZA 2KQ4X 1QNKA 4JQWC 4DR3Q 1L1OB 1GB1A 2JJQA 2HDMA 2IX1A 3SGIA 2WGSA 4CQNA 4GLAC 2D11A 3IVFA 3TEZA 4B95A 1Q1EA 3B0AA 2MBEA 4BBNC 2JWZA 3BK2A 1X54A 2GA4B 1QJOA 1QILA 2JQOA 1AEXA 3VYSA 3RN2A 4B3RQ 1SNCA 1OEYJ 2DZJA 2IO0B 1MG4A 4NQKE 3AECB 3JAME 4LF7L 4NJ6A 4A3CH 3I4MG 1XLOA 3LB8C 1HQMC 2F0FA 2KWUB 3KW5B 2N9PC 2Q2TA 1GOZA 4HKZE 4RM9A 4IC7B 5D3IB 3V3XA 3BG3A 1E7ZA 4X3UA 5BN3A 3KLSA 2ZEQA 4WQOB 3HVZA 3WAPA 2CR5A 1HR0W 2KNBA 1TVXA 1GKHA 2K05A 4RGNA 4AH6A 2N7JA 2HQLA 2M4NA 4IALA 3MJWA 1HZ5A 3VR4A 1IZ6A 3UDXA 2PPHA 1EU4A 2EXZA 3P7JA 4DV0L 1SGHA 4EZKA 3K7UC 3H94A 4M01A 2LVPA 2J4XA 2E2DC 3TQYA 1JB7A 2DYOA 5GQOA 1NI3A 2BT6A 4P71A 2NS5A 3QA8A 4BBNF 1N61A 1EU3A 3Q3MC 2EKEC 3KF6A 5EE3A 1AP0A 1LTLA 2NB0A 5CBEE 2E5LQ 3I57A 5I2XA 1EF5A 5KNBA 1PH7A 1C78A 4KHZA 2JXTA 2NBUA 4NJ7A 4YTPB 1FVIA 2OTLA 3A5ZB 2XVSA 4P1CC 4C4VA 2A68D 4DBGA 1XCTL 2K5NA 5CC4A 3HOUH 3P4PB 2ICIA 5IGGA 3HOWH 1F52A 4ZCKA 1WYDA 1WX7A 2KD0A 2C60A 5FJ8H 2O2VA 3OAWA 5I6YA 3S9WA 5FLMG 4DK3C 1I3QB 1CA6A 1WZ0A 4OWXB 2E2HH 3AMZA 1PFMA 4NKLA 3IFWB 3APFA 3QIAA 4KKJA 2PZUA 2C5LC 2CHZA 4KJOA 1I94Q 1OTCA 2DYBA 1UEAB 4A3GH 3CKIB 1D3ZA 1TY0A 1OXVA 3SD5A 2ZM6L 4LF4Q 5L83A 2Q2HA 3S2HH 3VR2A 2R61A 5IP9G 3VTVA 1Q7YC 4DK5A 2PZTA 3BK1A 2INDC 1TS5A 5AZHA 2QILA 3AV8A 4A3BG 3DBRB 3RD2A 3RMKC 4N8X1 2BVCA 5A35A 4K2KA 3U9OA 2KJXA 1V86A 1TWGB 3WALA 4DV2L 3S1NH 2RGFA 4C2MB 1AN8A 2M2LA 5C4ZA 4JPBW 1V9PA 3PSIA 3LYYA 4MSMB 3U8ZA 1C4AA 1GUGA 4FYDA 4WJ4A 1EIYB 1WXSA 2HDEA 4XT3B 1WGHA 2BGFA 2DUDA 1QF6A 3KF8B 1WOCA 4LUOA 2SNSA 2GI9A 3RCZA 4KDIC 4AOFA 2L52A 3UDFA 4XDXA 3TZUA 1HJPA 2JT4B 3AE1B 1Y56A 3T51B 4HEA1 2BWES 3MJ5A 1VS0A 3G6EA 3V05A 5CBAE 1IBKL 1QLBB 2B2VC 2R7ZH 3P2BA 2G5DA 2YTVA 3E9IA 3AEGB 3U52E 2VQFQ 3T3OA 1TY2A 3AE7B 1LV9A 1CQFA 3LGJA 3PUXA 2MRPA 1Q8KA 1I4XA 3D0FA 1XNQL 2E76C 2UUAL 3ZRFA 3D4RA 3MA2B 1WI0A 3CMEA 3P4RB 5K5PA 5CMDA 2MP1A 2K8CA 3TEWA 5JVG3 2UXDQ 5HGTA 3RNGC 2BW2A 2LI5A 1MG8A 2JF5A 3TDQA 3RZDH 2XIWA 2EMSA 4O1NA 4MJSA 1CHPD 2WFWA 4X66L 5EE9A 4X62L 2B63H 4DR1Q 3P42A 3WAMA 3B08A 2A5HA 2XRSD 2QEXA 3MXUA 3OTOL 3GTLH 3RNBC 1GD7A 1D4BA 1QB5D 2K01A 2VY3A 3CCVA 1N63A 3R2TA 1YQ4B 1YNJD 1JOKA 2M0XA 2YLMA 3WANA 2BYEA 2MO1A 2DGYA 2J52A 2LUEA 1EQRA 1GPXA 3Q8BA 2KMAA 3PUYA 1JCKB 5M3FB 3DVGY 1C48A 4NZLB 1K8OA 3Q14C 5CTRC 2K03A 3KWVA 1S3OA 3S1MH 4M0WA 3I4MH 1IW7D 1JR0D 2IO3B 2R7DA 5E6NA 1F2RI 1IBLL 2QHOA 1JJCB 5E4WC 3AEAB 3OJ4B 5BYRA 3HOUB 2EYPA 5IGFA 3HOWB 3U7ZA 3T4AC 4IPCA 4P2CB 3K7AH 3BU2A 1VD2A 4M8AA 3IG3A 5BMIA 1N36Q 1R9TH 1J7BA 4WAAA 4IPGA 3H15A 4A3EG 2B29A 4WJPA 3SHQA 1J8IA 4L5QA 3RR5A 1RD9D 4HTHA 4GKJL 1OXXK 2E2HB 2WXLA 4LNFA 1HTPA 1R4NI 1Q82C 2JA7B 4K8IA 1JWSD 1RFKA 1WD0A 4B3TL 2RPVA 1UWVA 1SNPA 4WWNA 3EFUA 2K5QA 2L3ZA 4F7XA 4A3GB 2ZCCA 2UU7A 2K3UA 3DBSA 3GTJH 4J6IA 2K5WA 5IT9c 3S2HB 1EL0A 1F2LA 5LXIB 4IUNA 4B9XA 2LHEA 5MPOA 1A3VA 3M3JA 2XEWA 2FUHB 1G2SA 1X3FA 4HIDA 1ACCA 1P9DU 4GDLB 1G6JA 1KTKA 2MHVA 2NZ1D 5JJIA 2KMCA 4L5SA 1VQBA 1B7YB 1EQQA 1H9SA 3H3VC 3HKSA 1OQRA 3T8MA 1EWIA 3S1NB 5IOIA 2UUBL 1LT3D 1YJJA 4NXMQ 4MGKE 3A9JA 1E8ZA 2E74C 4EKUA 4X65Q 4Q5VA 2EJFC 3QCAA 2AEHA 2I1JA 2UUCL 1S72A 3PZDA 4NAWA 1VQJA 2J0TD 1HFNA 1YN5A 5FLMH 2W54A 3TS2A 2W55A 1WJ6A 3N52A 4YCUA 1B4OA 1GC6A 4K2LA 3RLOA 1BR9A 1HTOA 3MAQA 4GNXB 1ZGUB 3MTNB 1A15A 3N1XC 2CW0D 4FJVB 1H9MA 3TRZA 5EKKA 4DAPA 2FBWB 2OTJA 3R66C 2VRRB 4A3FG 2M1MA 3H7SA 4ARCA 1MIUA 1C0AA 2I5LX 1IBMQ 1FL0A 2R7ZB 5AZFA 1LACA 3CRLC 5IP9H 4DK1A 5C3EG 4N9F4 2IT1A 3AEVA 1QVGA 2ZJDA 4EQ5A 3KFUA 1E3PA 3Q3NC 4OZBA 2WAQB 4A3BH 5JJZA 5HI1A 1ZKOA 3GTQH 5BYQA 2WB1E 4W9LA 4JG2A 4H7BA 2KHWB 1U4LA 1N8RC 1L5PA 3ZO5B 3HOXG 4GOCA 5M3MH 3TREA 3MEHA 1UUPA 1TKGA 4PV1C 4UHVA 2BS2B 1PYSB 1BT0A 4WAFA 2PVGC 4BS9A 2KTFA 1K8MA 3RZDB 4LF5Q 1A62A 2KHIA 1HZ6A 1UBQA 4LDTD 3I4NG 2B63B 2I5HA 2ACZB 1FFVA 3Q3JA 4MT5A 1S5CD 4K0KQ 4A6QA 5AEKB 1SNOA 2AHOB 3MHBA 4JC0A 3QJYA 3GTLB 2AL3A 2JXXA 4KGTA 3MTSA 3QARA 3FAHA 1O7YA 1LABA 2K8BA 2VZKB 4G4KA 4IN3A 4YTNB 4JV5Q 4C3JG 2F0OA 4BFRA 1PTOH 1KL9A 2A68C 5E7NA 1A3UA 4NNJB 3H1UA 4IO9A 1KM7A 1C4CA 3M95A 5DPSA 3KUDB 3OOCA 1ZXHA 3MP9A 3H8HA 4APVA 1X55A 4JI6Q 1XLQA 4XTCS 2YVCA 1ML0D 2F3WA 1VQ5A 4KZCA 1MVKA 4A3DG 3N32A 5JHAA 1LTBD 3S1MB 2Y0SG 4R4CA 4U673 3PIP3 3I4MB 3AE3B 2F0IA 3HGBA 2HUGA 2A6HC 2ASQA 2RDGA 2K1FA 1SSNA 4P6VF 1TWCH 2QDFA 1UGJA 1RJTA 3Q8CA 4RCOA 2JK8A 3QOJA 2N9EB 3WA0A 1RKNA 3DM1A 1F1HA 3NVYA 1WTPA 4DR4Q 3K7AB 2ENBA 1PA6A 1HNZL 1LTID 1E8XA 4A4IA 4IOAA 4KKUA 2N7EA 3ITPA 4EGVA 1R9TB 1VCBA 3TBLD 3EGRA 2EY5A 4DK6C 3M4OH 4RF1A 2DN8A 4DHZE 1EEID 2RHQB 1NY4A 1WGDA 1XMOQ 3TMEA 2E6XA 3ENEA 2KC2A 1L1OA 2ZTCA 1HNWQ 1KRTA 5E3FA 3PREA 3GTJB 1VQCA 3R2IA 1Z5SB 5J3BA 4JI0Q 4YXDB 1FD6A 5AJ3Q 3KLSX 3KUCB 1TWFB 4JI8L 2JY6A 2ZNVC 3N6RA 2LRWA 2A6ED 1SAPA 5C0XI 3A4RA 1Y1WH 2L11A 2WB1G 3M7NA 1NCVA 3AEFB 4OGQC 4RF0A 2WV6D 1Z6HA 4FVMA 2HJ1A 2MQHA 5GXGB 3PRZA 1JWUD 1N33L 1KAAA 4Y52H 2OT2A 2QSDA 4L1BA 1E9MA 2F0KA 2CQOA 5JXVA 3Q6SA 4ZAIA 1ZDVA 4O0AA 4C56C 1B2TA 4AIMA 1K83H 4A75A 3ULPA 3PIO3 2Q5WD 4GU2A 2JEAI 2JA8H 1PYWD 4IOIE 1U4RA 4J8QA 3KUPA 1OO9B 2XTIA 4DV5L 4TV3A 4FP5D 4NXNL 1XD3B 4E71A 4JI1L 1TWAH 1E7PB 3J81j 2WXGA 4YIJA 3VDZA 2H89B 5IOCA 5DPTA 1TXYA 4KIKB 2JXMB 4BA2I 2JUOA 4DV4L 3CC2A 1WY8A 2HIVA 2FE8A 4EVOA 1WM2A 4G50A 1XPRA 3K9PB 3I2ZA 1WH3A 3ZGZA 4HJAA 1VMCA 1NR2A 2NZOA 1FCCC 2NN6I 1TTNA 4A3BB 5DEHA 3ZJYC 1UAPA 3GTQB 2MCNB 3WAOA 4CDEC 1BUIC 2L1BA 1YNJC 5T1IA 3VR8B 2WINB 5M3MB 1I6VC 4ABNA 2I46A 2LY7A 4RKLA 4GLSC 5BR8L 3FKYA 4JI3Q 5IY0A 2PIAA 2AWNA 1B9NA 1PQSA 1WF9A 4N6EB 2BE5C 3F2DA 3DUZA 3JW0X 3NG0A 1PFDA 2M8SA 5CV6A 4HN7A 4JI2L 1V49A 1IBXB 3A33B 4TSSA 5HHDG 3OIPA 2PPBC 5EDSA 1DM0B 3DMUA 2E2IH 1O80A 1LM8B 1TR5A 1OGWA 2PW5A 1V1QA 3SR1A 3JAMc 1YJ1A 2ZTEA 4A3FH 2LGYA 1GUSA 3V2TA 3OPOA 2L0FA 2L4NA 2N7DA 4F7ZA 1PTOB 2EYOA 3VR6A 3RZFA 3G4SA 1H9JA 2DNCA 2KCCA 3TEHB 1TU2B 2YU9H 2CQAA 5CGKA 4KI0A 5IGDA 1JRPA 2D5DA 3M7GA 5IGBA 2P5ZX 5C3EH 2FMMA 4HPMB 3W5OA 1KNEA 5NUCA 3U4ZA 2UXBQ 4POGA 4C3HG 1HR0L 1WGGA 5IT9E 2LXJA 1U5KA 2PQAB 5EAYA 5D3DA 2WXQA 3P20A 1E7UA 2R2QA 4K5VA 4REZA 4AWJA 3HZXA 3BZCA 1Y8OB 4NQLB 2L5TA 1SYCA 3LX0A 5E6PA 2WXKA 1TWCB 2N9XA 4RMAA 5EE0A 4FHKA 2Z59B 5KHOA 1B1ZA 1XWEA 1MJCA 3NE5B 2KWVB 1RTOA 2ZXOA 3KYCD 3KF8A 5C0XG 3L08A 4B0EA 4L5TA 1WYWB 2IY1B 4ZQ3A 4R3DA 1UD7A 3I4NH 4ZLTF 1YQBA 1KOTA 1V5OA 1IHZA 3M4OB 4LFBQ 1B9RA 4DR3L 4KY6A 1F9QA 1ZE3D 4D2KA 3JAMi 1EWYC 1UNSA 3G48A 2FINB 1PH6A 4WIPA 2QKIC 2XGTA 4C3JH 4DN4M 1J5EQ 2KLGA 2WXRA 4BVUC 3OWFA 3A1QB 4FF3A 4B3RL 1P98A 2FCSA 2N49A 1C9FA 1U4MA 4EQOA 3S2DH 2CH4W 3NK9A 3Q8EA 1EY7A 1G91A 4WFN3 2ZJQA 4ZRKA 4A3DH 1ZDXA 1Y1WB 1EOTA 2G9DA 4ZK9B 3VA7A 2AYOB 2LWPA 2JE6I 3A8JE 2CW0C 3ER0A 1TBEA 4N9TA 1B44D 4KGRA 2XK5B 3W1GA 4GLVB 1VZ7A 5E4XA 3R7QA 5FR3A 4OX9Q 1CZWA 4RGTA 4XWTA 1P0RA 3P63A 3F2UA 2M9VA 1UWMA 4OVZA 1TT2A 1W6JA 4A3OA 2L0CA 1K83B 2FMCA 2ON8A 2NN6G 2GBKA 3D6CA 4LJOB 2JA8B 4K3BA 2KANA 5KEEA 1WZ3A 3GQBA 1H9RA 3IAYA 1QOGA 3AEEB 2IHEA 2SNMA 3G71A 2E2JH 2ZT9C 1TWAB 2F4VQ 3FHWA 1T0QC 2EYHA 4RKBA 1LT6D 1KF6B 1LYLA 5G2NA 1FNVA 2ZJPA 1SNMA 2K1BA 4FJYA 3PQIA 3DWGC 4A3JG 1TS2A 2KOXA 2KUMA 1FPYA 5KGUA 5HURA 1UBIA 3SDLC 5CV5A 2E5LL 1SNQA 3KDFA 1UEBA 3H6NA 3HKZG 4BOZB 1EWCA 1II3A 1EFWA 3AFQA 4FA6A 1Q1BA 4NY0A 2RPQA 3PO2G 2RQXA 4M8NA 3Q2AC 4TKOB 1D7QA 2KWCA 3H3VI 1JORA 3SK5A 1TGZB 3OJ3A 4CYEA 1P7EA 3PT2B 1CKNB 2LRUA 1YHQA 4LTUA 4E74A 2F52A 2PO4A 4FJZA 1D8LA 5KNDA 2Y5BB 1RFAA 3BDOA 1VJKA 1L6VA 3TCAA 1OXSC 2IY5B 4L2YA 4XWWA 3Q24A 2HD3A 4IUUA 4YWGG 1YIJA 1I94L 2L05A 3J81L 4K7SA 3I3CA 1KRSA 3CCQA 1T6BX 4LF4L 2E2IB 4W9IA 1CZPA 1YNND 1VQ9A 5F2DA 4HIKA 1ZW7A 1HA6A 4A3FB 4PYZA 1PRTC 4BWGB 2PVOD 4B6WA 3VR5A 2YU9B 3TBIB 5FLXE 5C3EB 3N9YC 2F03A 1MHXA 2LGDA 3NBHB 4KN4C 1SFOH 1X1MA 1R4QB 3QR8A 4R1JA 2KOLA 3TMPB 2NZHA 4F8MA 5AUKA 2F1MA 3I90A 2B8GA 3A9KB 3CMMB 3U7DA 2IDYA 2G9HD 3BZDB 3NBIA 1QVCA 2G4DB 2NCNA 4MH8A 1E90A 2C9OA 4OIKA 3PUWA 2Z4HA 3IFDA 2WIIB 5IODA 2ICEC 4QIWB 2R93G 2Y3AA 4GDKA 3NRZA 1MHHE 3J7AV 3AB9A 4ME3A 3QQ8B 2HCIA 1V1OA 2A6EC 3SEBA 3I4NB 4MGYE 4GNXA 1FMAD 1YEZA 2REXA 2BTEA 4OZCA 3K81C 3O65B 1L1OC 1H4RA 1O78A 3FP9A 4YT0B 1X32A 4ZRQA 1Y8NB 1Q8IA 2VQFL 2LVOA 3K5LA 4WRDA 1XO3A 1JC7A 4C3JB 5DM63 3S15H 2IPKD 1HZ9A 1ASZA 4KZ0A 4X6AH 4GOPB 3C19A 3CMAA 3ZJTA 1E10A 3OG5A 5IIFA 1R4NB 5FO9B 1RTNA 1I4RA 1XTDA 1UZXB 4KN7C 3U30A 3ZVVA 4TQUS 3NQIA 3SE0A 4A3DB 4CGYB 2Y0SB 1Z7TA 2PW7A 4IUQA 4AYBE 1W2BA 2UXDL 2BBCA 1QUQA 3AB5A 4POFA 1AWDA 2VUMH 2B2TA 1RAXA 4K6DA 3N1YC 4IWOA 4OO1G 2A8VA 3Q0AA 3ONAB 2MBBB 3AYHB 4YSXB 2XRQD 3GV6A 4DR1L 4CJ1B 2W9NA 5C3XA 1Y69U 3HM6X 4CDCC 2JA6G 1GUAB 1E0ZA 5C0XH 4LFCQ 2RSUA 4OL7A 3A56A 1Q1OA 5LHY1 2HQEA 2KZRA 2WP9B 1DOXA 5EPJA 4A3KH 3SDZA 3MZ5A 4CDDC 3C8YA 2EDGA 3J7YW 1EIGA 3T1HQ 5E6OA 1B53A 1HUMA 1OTRB 5CHFA 1GHKA 2E2JB 4DV7Q 1WE6A 3ND9A 3W5UB 1FGBD 1J9OA 4ZYSA 2R2OA 2DAJA 4X3KA 1Q5WB 1NYRA 4IPDA 1VQ7A 3LXFA 4N59A 1VQDA 1O7IA 2K33A 2Z4IA 2Q2IA 4FXKC 1Z47A 4ODGA 3FVQA 1WWTA 1KABA 1N32Q 2RD0A 4PS8A 1BF4A 2GLSA 3RPFC 3W2DA 1X65A 5EPLA 5JOBA 4HJGE 3GTGB 2NWGA 3I3TB 1V1PA 2L00B 3KJOA 3HFZB 5IYCG 1V9JA 4NB3A 2FCNA 1FFUA 1DOMA 3ZIMA 2NBFA 4A90A 1B3QA 3BVZA 1FGUA 1NMFA 4R4TA 4UY8C 4IJHA 1ZXTA 2ASBA 3ABVB 1N36L 2KK8A 1SN8A 2IL8A 2QIEB 2RA4A 4HJKA 5K36G 1L7YA 5DCNA 4EQPA 2NN6H 3RN5A 1YZ6A 5G3LD 3VYRA 1ZP0B 2KVZA 1ENCA 4QJFA 4ALPA 1S5FD 2N1WA 2ZW0A 3ZJVA 2LJ5A 5JEAG 3KVFB 3DWQA 3HRDD 5KHQA 4DXFA 1JWBD 4F88A 4LF9Q 3QIJA 2MH7A 2W3SA 3R93A 1TZOA 4NJCA 5A2QL 5M3FH 1XJVA 4B3SQ 2KJ6A 4A3JH 4JWSC 1WJJA 2Z6KA 2L7RA 2PQEA 4DAYB 3F2BA 2QA4A 2VS1A 1E2WA 3MFGA 1SSOA 3MC0B 1EFID 1SFOB 1UH6A 3PO2H 1YMHE 2CJNA 4NXML 4DQOC 2UXCQ 4X65L 4AYBG 4UP9A 4A3LG 1VRAB 3M62B 4F87A 3CF5A 3HOZG 1VQEA 4YWKA 1IL8A 1E2VA 1DOLA 5CORA 1MSGA 4KTAA 1VQ8A 1NJIC 2N8NA 1OEYA 2D9UA 1IUEA 3CSTA 5T8IA 4FULA 1VLBA 2JA7H 4DR6Q 5JPNC 3NS1A 5LL6S 4USAA 1MPEA 4PNYA 2K6QA 1PVOA 4WJQA 2WXPA 1IBML 4P16A 4DHJB 1DOYA 2EZVA 4AS1A 1TT5B 4KIKA 3QHTA 2CHBD 3FDTA 1RM6C 2D3AA 3AU4A 2KJRA 4XDCA 1X3GA 2ZJRA 4RH6A 3S15B 1GJZA 1U4PA 4CKBA 4P75A 4JBWA 2G4SA 5G5GA 3W9CB 4XIGS 2D07B 1VQHA 2X38A 1F2YA 5C5MA 2JYTA 4DU9A 3T56B 5BN4A 1BVSA 1PGAA 3RMHA 1MHWC 2DZIA 2OHFA 3B6YA 5H1SE 5JHBA 3EECA 4JPSA 1TJEA 3P1HA 2VUMB 1PDQA 4LF5L 5J17A 1ENFA 2OEDA 4A20A 4S3SA 2BH8A 1D1KA 2VW9A 1E7VA 2LUMA 2R93H 2CKZB 2LMCB 3NEMA 4K0KL 2A69D 2RCFA 4QUFA 1HRJA 2Z0EB 4JE3B 1I4PA 4LNKA 3W1SA 4A3KB 3R3MA 3NENA 3NELA 2HT1A 1TYGB 1YNTE 4JV5L 3PSEB 4RNAA 1CT1D 1L4DB 2ALYB 3IT6B 1G6PA 2FUG1 4FF4A 1EIFA 2K75A 2LXKA 1VF7A 3K80C 2F0JA 2CU3A 4W9CA 3CSFA 2WNMA 1G8ZD 1B70B 1EZ8A 4JI6L 3AE8B 4RWSC 1WXQA 4WQMA 3I7FA 5DNFA 4ULLA 5I9PA 1CFMA 2PQAA 3OW2A 2NR2A 4KMUC 3ML9A 1QVFA 4A9AA 2LFNA 3U50C 1PTOD 3VYUA 2OOBB 1C7YA 2CHWA 2QEJC 4C3IG 3CQZH 3MFYA 1JMCA 4FXGC 4NW2A 4DR4L 1YN4A 4DKAC 2BYVE 1MSHA 1BKBA 4W9HA 1BMLC 1JQYD 1KDCA 3NJTA 2KN4A 2JX5A 5FO7B 3K9OB 4HIOA 4AQYQ 3DXJC 1XMOL 4QY7A 3H3VH 3S2AA 2X8XX 3PZ7A 1VR9A 4GN5A 1HNWL 1FJGQ 4HCEA 1HEZE 3J80E 2NPTA 5ELDA 2GVAA 4MNOA 4JI0L 4IUPA 4X3SA 5AJ3L 1ISNA 1F77A 2B2YA 2BA0A 2D62A 5IGCA 3L0WB 4HPLB 2RSNA 3DWAA 1TS3A 3E6ZX 3Q3FA 4I65A 3NP8A 1KD1C 4A3JB 2L83A 2INCC 3W1BA 4B08A 3ZQ4A 1U0LA 4JX1C 3I63C 3L16A 3PRMB 1JWMD 4KHVA 4MACA 3HKZB 2FFKB 2EJGC 1A70A 1R7SA 4DR7Q 1KDBA 3PO2B 2MSED 1ROEA 4GN4B 3URYA 5IYCH 3U58A 1A63A 4HCPB 1EO6A 2HIXA 3CF6E 5C1ZA 3A7AB 4OEMB 3NHHA 4Q0FA 3RNUA 2MX2A 4ITKA 3DQVA 3CIRB 4MEMA 1ILQA 2PKOA 1LTGD 5HY6A 1FEHA 4LNQA 1ZPSA 3LNNA 1N34Q 1IYFA 2F3VA 3PV1A 4KKIA 2WU2B 5LL6X 1JJGA 4GNXC 2M19A 1QCBD 2KTRB 1BXTA 3EVQA 1T0YA 4JCVE 1J6QA 3G7LA 1STBA 4IFDI 5JEAH 3AMUA 4M02A 4MTNA 2RCNA 1TWFH 3ULLA 2AL6A 4MGIE 4HAEA 3WOEA 3AE2B 2BWFA 4KKTA 1YD8U 2WX1A 5IO9A 4A8XC 3TEYA 1J19A 3SK8A 3C1FA 3CAMA 3W3AA 2Q8IB 2KN5A 3JSVB 3ALBA 3DVNV 2HHHQ 3RNCC 4XYQA 1V8CA 1A2TA 1M8AA 4PQXA 2D10A 2B2TC 4OONA 3SK4A 1NENB 3KYDD 3ZUNA 1CSPA 5TSSA 4JI3L 4XYOA 3HOZH 2JRHA 4MZ9A 4A55A 3Q23A 4QCLA 5LNK1 1AH9A 4BY7G 3K6OA 1HFGA 3SHLA 2AUJD 4QQBX 3DPDA 4W9GA 1IYJB 1EEFD 3HUIA 2R93B 4YSZB 4FHJA 1W3SA 2PMZB 5HFYA 1V8QA 5GAGC 1QQRA 1K0RA 2FAZA 3GDEA 4KX6B 2LKVA 4ME5A 2TMPA 3C46A 5BYSA 2KDMA 1WXMA 2XN9C 2ZPNA 1GUOA 4GZYC 1T5XD 4MM3A 1H8CA 1XYIA 4P74A 3VUXA 1PYBA 5JJKA 1WSPA 1KQSA 4Z9CB 3TP8A 5I4DA 1CKMA 2UXBL 4K81A 2WXOA 4DK0A 4CJ0B 4Y7NH 2DENB 1K0SA 3PUZA 4QB4A 1FXIA 4W9FA 3D6WA 3AE5B 2WS3B 4NMZA 2VQEQ 2D5GA 2KT7A 2V9HA 1A8VA 1EOVA 1NI2A 3U4EG 2KFJA 3A9KA 2NYZD 4IDIA 4DF7A 1WXAA 2N9KA 3RNEC 3TUOA 2K5HA 2KFKB 2L76A 3BYYB 2N4FA 5C3JB 1WGKA 3CQZB 5AFWA 3EN2A 1ZYRD 3DLLA 1YOVB 4ILWA 2EYJA 1BUVT 4UP8A 2BH2A 4US9A 2JEBI 4LFBL 1GC7A 2PW9A 3UIPB 1RYJA 4G0NB 2L55A 3AULA 3Q8FA 4KV2A 4A93G 3GP7A 4L6TB 2KA7A 2IZVB 1WJUA 3MXNA 2WACA 2NUCA 1J5EL 4LCDE 4MDKE 1EUVB 1SYDA 2NTTA 1STGA 4WORA 2MJDA 1FXTB 2Z6KC 1UWXA 3X3MA 1LFDA 4XT1B 3FC4A 1SDFA 2F0TA 4GOPA 2AQ3B 3BS1A 2D2CC 5G3LF 3FPUB 2CS4A 2K14A 4WURA 4BKGA 1NAPA 4IFDG 3CPWA 2FCQA 1VQ4A 2YV5A 1KNAA 4OX9L 1TS4A 1ONLA 4G3XB 3EQLC 3FILA 3NSWA 3S16H 1E6EB 1EYCA 4JI7Q 2DBYA 2I1KA 1XF5L 3DBLI 2H5XA 4UDUC 2H88B 4K3CA 1YIWA 3PHWB 3BWUD 5EGTA 4Q2JA 1ZKHA 2OJRA 3OMCA 1MBYA 1LTRD 2KQ7A 2B2UA 5FLXc 2F4VL 3HHMA 4HVBA 2KVRA 3CW2C 4RMFA 1VZ8A 4ANUA 1I6HH 1GUWA 4BXXG 4LWCA 4DR5Q 1HZBA 2JN4A 3BDCA 2LGXA 2F0HA 4DV6Q 4TMAB 1VQGA 2RDBC 2KENA 1PH8A 1K8RB 4BAXA 2G45B 2F0QA 2VB2X 4IUVA 3T13A 2KEEA 5JJLA 3VVWB 1ZXIA 3OSOA 2FNJB 2K22A 3GTMH 2JZ3B 2A69C 1WTXA 1YHBA 4B3MQ 5IP4D 4H0LC 2I5MX 3Q8AA 3KK7A 4MSQB 2V3PA 1GVPA 3BYTB 3HS0C 4G57A 1D5ZC 5T1GA 3ECIA 3MXGA 5CV4A 1CA5A 1PLFA 3HOZB 1SJED 3QX1A 4FN2A 4X57B 3W1YA 4A3EH 3IL8A 1VQ6A 2DZKA 4OIJA 1G291 4BKSD 3H0GG 2NVTH 3J7AF 2VH1A 4CKCA 1R4MI 3QK0A 2KX0A 1I7HA 4HPPA 3UIOB 1FYCA 2XSCA 3W1SC 2WDQB 4C4VB 2VZAA 4IQZA 2IYDB 4OVVA 5FO8B 1Q3LA 4LF8Q 3EA6A 1PXUA 1YHAA 2Y5PA 3I9V1 2F3IA 3GZNI 3HK0A 4B9KA 1WRDB 2O2VB 2MP2B 4JW0A 2ZVOA 3AE6B 1CM9A 3NHEB 2XWJB 3O13A 3DHIC 1PDXA 3N20C 3M63B 1M90C 4BY1G 4Y7NB 4LFAQ 4DAYA 1K52A 3I8ZA 4U68A 4JVZA 2KXJA 1QNUA 2WKDA 1SE4A 2LHDA 2M0AA 1KC8C 3OYYA 4HJ5A 5EKLA 4M1UB 5I6WA 2K25A 1FNUA 1WCMG 4NDXA 2AWTA 4IW0A 1R4PB 2D0OA 3CRKC 4GN1A 5EPKA 1SYEA 1B3AA 3AFPA 2K7VA 3T16A 3MEFA 3NUHB 3Q8DA 1O7ZA 2JVCA 1G2TA 2AKWB 3V96A 2ZNVB 2IGHA 3AXCA 1C3TA 2WQYB 3X3NA 4R9WA 3HVDA 1S40A 1IW7C 4HRSA 3QB3A 4LAAA 2N88A 2KACA 2MBQA 3M4QA 3VXWA 4HROA 2B2YC 1PTOF 2KX3A 1C1YB 4PG3A 1NNXA 3VFKA 1GNUA 4FF2A 5M5YH 1ZUD2 4KLKA 2DNEA 1PFSA 2KDFB 3HM3A 2CWPA 2EELA 1LO5D 1WYGA 2MA9B 5FOBB 4A3PA 1ESFA 1P1AA 2INNE 5ELNA 1JOOA 2VH2A 2K5VA 4HJ9A 4GKKQ 1KLVA 1UE1A 2WU5B 2MUYA 4ZKBB 3NOBA 1OFFA 1NUCA 3JC66 5DM73 4DHJD 1AW7A 3HOXH 3CCSA 3V60A 1JMLA 2J0KA 1XT9B 1CKOA 3LDZE 3PMFA 1YNXA 2DY8A 1WGYA 3S16B 2C7HA 4IM0A 3HP3A 4HMJA 2KHSA 4RFBA 2UU9Q 2J42A 2V4LA 3DCGA 4LFCL 1RDPD 4GIVA 4BOSC 4GS3A 1K53A 3QC8B 1GHJA 4LK0M 5C3WA 3S17H 3T1HL 4ICUA 3BINA 4CDFC 4DV7L 1PMRA 2IY0B 3WWVA 4JBMA 1TWHH 3JAML 1I6HB 2CKHB 4I7AA 3H7PB 1MFWA 2WXJA 1Q46A 2FCMA 2IX0A 1N32L 1YQ3B 1SRUA 4MJSB 4DFAA 1RODA 4MTKA 4WWOA 1YI2A 1NBWA 4R4QA 4YHHQ 4N8FA 3VR3A 1MJDA 2KMMA 2RSOA 2XBBC 2RDFA 3GTMB 3KBGA 1B50A 2PE6B 2SOBA 4P7IA 4ZOHC 2FHTA 2KHJA 5DPRA 4IFDH 3DVNU 1CSQA 4O2DA 1ILPA 1VQLA 3PLVA 1VQPA 1S5BD 3WCQA 3UINB 5AZGA 3UE1A 4YY3Q 4XQJA 3NS8A 3SU8X 1I35A 3E0JA 3RI7C 2IHFA 1D6EC 3VTUA 3IFTA 3PZ8A 1Q90A 1LUZA 4ID6A 1STYA 3GE3C 1QE6A 2K6AA 3FPPA 4A3EB 1VQOA 3MC9A 2F4IA 5H8YE 3P4SB 3D4DA 2K0PA 2NVTB 4M0WB 5D7GA 1CHQD 4MELA 1SMXA 4HR7B 4LF9L 2JSOA 1WTOA 4DV3Q 2LS01 5AUIA 3GTOH 4B3SL 3T3NA 4BXXH 3RZOH 4EZLA 2KCNA 2Z8LA 2J7ZA 3H6MA 1BBUA 4PZ6A 3T53B 4OO1I 2BYFA 4LF6Q 1SE2A 1Q81C 1VDVA 3E9SA 4W9JA 4PT5A 2AUKA 4RGOS 3ZXVA 3SK6A 3Q22A 1ZYRC 2TSSA 3M3YH 2CJOA 4ZRJA 2JA5G 4ICVA 1RCVD 1SMYD 2CFMA 1CQVA 2PMZE 5J22A 1KHIA 3GTGH 1KH0A 1KXLA 3J81c 3PF4A 5C44G 2MWSB 2PCFB 2QJLA 2UXCL 4NPNA 2DYMA 4A3IG 2F0LA 4DPGA 2ATWA 1W6KA 3HIZA 1CTMA 1YN3A 5EE1A 2OXPA 3UF8A 3VH4B 1EYDA 1CZGA 4GXBA 4GB9A 3QJZA 2LXAA 4TUUA 3VQIA 4WJWA 3N30A 1NYQA 2YYZA 2WAQE 4JI5Q 4DR6L 4URKA 2B2WA 1HNXQ 1JALA 5EJWA 2PLPA 1KJTA 1PH5A 3H0GH 1H9SB 2KTRA 3A0JA 2O6VB 4ZRIA 4QUCA 3H9DA 1KDAA 4KJNA 1P8LA 4ZDVA 3HOUG 2JZPA 1FNWA 2CHXA 2ZTDA 3A74A 4KSKC 2M00A 3ERQA 2YEPF 2PEAA 5FJ8G 1L6UA 3E56A 4NAWB 4RM8A 3V61A 5IKCM 3J7A5 3UGBB 5M5YB 1V6EA 1E0BA 1IXRA 3CD6A 4GDLA 3ZLZA 3NZ3A 1XXGA 4GOPC 3VDYA 2JWUA 4B0MA 1VMPA 2DZMA 4BY1H 3DEOA 3IT4B 1L2NA 2K04A 5KIXA 4AQ7A 1TKEA 2ZCBA 1YX6B 1YJ9A 3MC8A 1WCMH 3I73A 2WXFA 4HIMA 3HOXB 2X69A 3CWIA 4EFOA 1P16A 3A54A 2WX0A 5JVH3 4BBRG 1QOBA 5CX3A 3RULA 1GXDC 3J80c 2LVQA 3MXPA 2MGSA 5C6AA 1RWSA 2MNAA 1I50H 2CU1A 2RR9A 3QWZB 4G11A 3ZNHB 2IGGA 1Q10A 3RLNA 3FKIG 1HE8A 1BDOA 1GO3E 2RKSA 4A3MG 2B2UC 1BCPB 1PUTA 1TIID 3DHGC 3S17B 4P72A 5KYIA 1OXTA 1X56A 4CHTB 1EZ6A 1V2YA 4PZ7A 1S1QB 2MHJA 4MGZE 1TWHB 1VZ6A 1D2BA 4ZHOA 3EHVA 4YWLA 2B3AA 4N58A 4JIOU 2EPBA 4RAUC 2IWHA 4X64Q 2KO3A 2NTSA 2L15A 4C3HH 1WFQA 1RRBA 4HCSA 1Y14B 5ISRA 3NZSA 3M85A 4HJ7A 4DR2Q 3ZTCA 4QGUA 1NBFC 4OW0A 1OQQA 2JZZA 2KAJA 3IHPC 4WWMA 5IAAC 4KY5A 3ML8A 2EIFA 1SLJA 4PS3A 2DX5B 1QG7A 3UQBA 2F0SA 3U2SC 1E1OA 1PRTB 2KFKA 3ZW3A 1JT8A 4H44C 2D2QA 2MJ3A 2BOSA 3J80i 2K6DB 1JQ4A 4DUZQ 2JYEA 3APCA 2IBIB 1LXDA 4AQYL 3S1RH 3NVZA 3DDCB 1Y8PB 2D3BA 4H02A 1XQQA 1A0IA 1SJHD 3RD4A 1VQMA 1FJGL 4E3CA 3A4SC 4GSWA 4QMGA 1WI5A 1WR6E 4KY7A 4DUYQ 3PO3G 2L0TA 1EF1A 4C80A 1BQQT 4BKTA 3ZJUA 3GTOB 4C00A 3AN1A 4V190 3KBXA 3RZOB 1JE5A 3RUZA 3RNFC 1DONA 4DNTB 1H95A 2B63G 2ZW1A 2RF4A 5IP7G 5DLQE 3M3YB 3PRPB 4EUTA 2M17A 3L4PA 4DR7L 1MI0A 2VZKD 2PZWA 3MWYW 2WB1B 3OLMD 2PMVA 3TP7A 4FXDA 1FRDA 4ARIA 2KLCA 3PPAA 2JRIB 5G55A 4JYAQ 2WHIA 3OHXC 5LMNQ 1JB3A 2ONQA 1A6XA 2L12A 3LWEA 1QKZA 3B2FA 4HLEA 4DAVA 1GG3A 4F8CB 4JI4Q 1N34L 5JAVA 1FIQA 3GTKH 1WM3A 2L32A 4WJNA 4FADA 2Z9HA 1P7FA 4HSPA 3I72A 3EFXD 3L9AX 2RMMA 2SAKA 2LSSA 4IM2A 1TIFA 1J8CA 1NR4A 5C0XJ 2VB3X 3H0GB 3E9HA 1AE2A 1N60A 1L0XB 2HE7A 1YJNA 1Y8RC 1KFYB 1WIAA 4QF4A 3DBHI 4CJ2C 1MKHA 1QZEA 2NVUI 2HJ8A 3AEBB 3DOWA 3ZXRA 2B3GA 1F2MA 4MHEA 3GTPH 3T9LA 4AJWA 4KKSA 3F8TA 2LGSA 2A73B 2DJGC 2JA5H 1N5WA 2HHHL 1UF0A 3BVMA 4BY1B 1QOAA 1LTSD 3I55A 1CK1A 2F0MA 5C44H 2G3QB 3PVLA 4KHPQ 1Q0WB 5CHVC 5HGQA 1DCZA 4OELB 5LMUQ 1PFNA 4A3IH 1G6ZA 4IKGA 3VRAB 1A2UA 1WCMB 5ELCA 1ICFB 2IX3A 2K5PA 1E5WA 1NVID 4KDLB 1STHA 1IGCA 1QWYA 1DGSA 2NVQB 4EEWA 5GAHC 3UQAA 3P4QB 2J53A 1AE3A 1MD2D 1I50B 3DHHC 5GMVA 5IGEA 3PCOB 3PLUA 2I2YA 3IRBA 5EBDA 1MI2A 2WP8J 2INPE 1YVCA 5ELEA 2OQKA 5LMNW 3UDGA 5BMHA 3T1YQ 4TRDA 1SR3A 1T5EA 5KNCA 4L23A 4ZUIA 3QAQA 4DHZB 3APDA 4HMIA 4IWPA 1MJEA 2K8HA 1VQNA 1PGBA 2J0JA 1A3TA 5CYUA 2PNRC 3EJIA 4XQQA 4CHKA 1C8CA 1PH3A 1X3EA 2MP2A 3DBLB 3BDLA 2KJHB 2MLBA 5BN5A 1U4AA 2GMIC 2C5CA 1AZQA 4XYCA 4YL8A 2K28A 3VAWA 2DHZA 3MHZA 4X3TA 2VQEL 2OJWA 2OWOA 3CU7A 4IUMB 3RN9C 3ZNGC 1EY8A 4YWMA 4C3HB 1TZ1A 1VQKA 3V62A 2XNAC 3ZNZB 3L54A 1S3SG 3KLWA 2A6HD 4W9EA 4LLGM 1I4GA 3IAS1 4HDQA 5JPMC 1YBYA 1HCZA 4M8MA 5IWAQ 2D3GA 4GLXA 3J81E 2DWQA 1PH4A 4BBRH 1X6OA 2ID0A 4FDBA 1QZHA 1FCLA 2H4OA 3A55A 3VA5A 1K3RA 3NQTA 3UE0A 3AI5A 3S1RB 4M00A 1IBXA 3FKIH 3RT3B 3H91A 1SMYC 2VNUD 4JGHB 3D4WA 4A3MH 1HXYD 2RVLA 5D6JB 1GM5A 1AFPA 4ZYNA 1EY6A 3NPPA 5M3MG 1BNZA 3NTIA 4K7UA 1IL2A 5J39A 2AMCB 3BIID 2R3ZA 1SE3A 5DPWA 2KVMA 3KOJA 2BB5A 3HRZC 5CV9A 2A74C 2H1EA 2QDLA 4K6LA 3AM9A 5BMGA 2NVXH 3LWUA 4UAIA 2PTLA 4JBKA 3NXWA 4I6NB 2BB6A 3I4LA 1R4MB 1XLNA 1QOHA 2MW5A 5TR5A 3L7ZC 3FEWX 1RF2D 4DXAB 2F0VA 2KEDA 1YNNC 3DWMA 4JL9A 1SNDA 4AP4C 1XMQQ 4JI7L 1BO0A 4C1NK 1TQOA 4OO1H 3GZNB 4RG1A 1OXUA 2I07B 4MH0E 3R7RA 3RUIB 1XNRQ 2AX5A 1PZJD 2QC8A 4H2AA 1ET6A 2B2WC 3GTKB 2JA6H 4AJYB 1ZEQX 2C35B 1IYUA 3N1ZC 1EUJA 3GB1A 1JICA
chains in the Genus database with same CATH topology
4KD3A 1VF5C 4ZUJA 2W3RA 2SEBD 1S4ZA 4CBVA 4R8NA 3NVVA 2KQ3A 2PYKA 3UI2A 1C4PA 2EYMA 3GTPB 4G7ZC 4K5WA 1KLGD 3OW7A 2JA5B 3IAM1 2M56B 4CKEA 1K51A 3MVVA 1VCIA 2Z1CA 2WXNA 3TN2A 2K9XA 5C44B 1PFBA 1TKWB 4A3IB 4RGMA 1D1IA 3NTHA 2HTME 2MJEA 1QOFA 1JOQA 1EIHA 2BE5D 5KRUA 5K36H 4HSVA 4K14A 2O2LD 4LK1C 3OWEB 5M9OA 1HUNA 1EQVA 1MGSA 1DJRD 3WOFA 1BBXC 4US8A 1NSNS 4K8JA 4KK7A 5KYLA 1PZID 3QO2A 1FRRA 3I91A 1DZ1A 3VRBB 1IKLA 1D5MC 1SF0A 5D14A 2O4XA 4O42A 2F0UA 1NEKB 3K0YA 1H9KA 2X6GA 2K5DA 3FMCA 3H09A 1JWAD 4FXCA 4G7HC 3C3LA 2F0PA 4BBRB 3PUVA 1AZPA 1C4QA 1IGDA 3FRPB 1EY0A 2O5IC 3FKIB 5A2QE 4A3MB 5H92C 3Q69A 3ETRA 5HG2A 1FR3A 5IT9L 1N5XA 5JEAJ 3I70A 5ELBA 4C1NI 1Q12A 4DA2A 2NVXB 4GDKB 3HG9A 5CR3A 3NBHA 1IYVA 2JP1A 2BYTA 1FM0D 5EBCA 1HHVA 3DWPA 2V3NA 1EY9A 4RCNA 1DGJA 4H13C 4YTMB 2VXWA 1DOIA 1GJXA 5C2TB 2JA6B 3K57A 2WDRB 2KWDA 4J6HA 2SDFA 3AE9B 4KD4A 2EYFA 5EKIA 2HDLA 5DAUA 3PO3B 1JROA 2BCOA 1HPCA 1LTTD 5D65A 3S1QB 2EYLA 1WTWA 1BCPD 2NVYB 2F0GA 3P75A 4XE0A 3BVGA 2XWBB 5C4HA 2LEKA 3C1EA 1LTAD 5I2YA 1T3QA 3SFDB 2BS3B 3EUB2 1VDZA 1LT4D 5J1ZA 4XQNA 3NVWA 2E3TA 4IUTA 1PZKD 1F9SA 3DHQA 1XLPA 1V1PB 4JK1C 1X3QA 4YSYB 1L0VB 5G5HA 3KLRA 4B9WA 1PRTD 3OIQA 1CI3M 5FK9C 2JYOA 3TSSA 4FO2A 4RHRA 2IW3A 3OMGA 1TKYA 3KWLA 5E6JA 2R6GA 4G7OC 3NUCA 1ENAA 1F9PA 2EJMA 4AYBB 1SIJA 2WKCA 1SBBB 4NP5A 1EQTA 1S5DD 3G6JB 2WXMA 1FD7D 1XEEA 4NAMA 1N62A 4HEDA 5I9OA 5FLXL 1EY5A 3TEXA 3S14B 5CV8A 1PTOC 3GV3A 2EOTA 2BDNA 1WTVA 2RBMA 2V4IB 4MN3A 3TP6A 4RA8A 1J7AA 2EY2A 2WXHA 1CJEA 2WDVB 1L4ZB 4OHJA 1DOKA 2LFIA 1FXAA 2B39A 3NWSA 3R8BA 1SEBD 3SFEB 3CHBD 2OF1A 4BA1I 3RLFA 2DY7A 4JWUC 4EQNA 2EVBA 3KQ4A 2QDBA 2N0SB 1WRIA 2FJ2A 4ZHPA 1SYFA 1X3PA 5M5XB 1STEA 1STNA 1YJIA 1DD2A 3VR9B 1B9MA 4TQ1A 3SXHA 1QT9A 4KGSA 3EROA 3DEPA 1GB4A 4DNRB 3UI3A 4XXEA 3QOLA 2EY6A 3R3OA 1RHPA 3TP5A 3P1MA 4LJZC 4C3IB 1ZOYB 2OEOA 4C7ZA 3A8KE 2MJ8A 3PV0A 4PMWA 2EKIA 2LMCA 3K5OA 2AQ2B 2CVRA 4IURA 5M5WB 1F9RA 2DLBA 1V43A 4ZKCB 2V0GA 1V97A 5EQ0A 3QWNA 2LGIA 2GRIA 2K32A 4DGZA 4KV6A 3IXSA 3A8IE 2O5JC 2BA1A 1C76A 2JSVX 1GUTA 1C79A 4PMBA 2ZXPA 1BOSA 3J9CA 2IJ0A 1I4QA 4ZRPA 3B9JA 3D3RA 1EM7A 2N9LA 4EE2A 1D5XC 3L3OC 3AE4B 1EWHA 2EY1A 1M4VA 5COYA 4BBSB 3GS2A 4V0BA 3GD7A 3AU7A 2B8FA 3GO5A 1C77A 5C5LA 2L1AA 1K50A 2B76B 3M4YA 1SXTA 1U9RA 2I38A 4R8IA 4C7YA 4K5XA 2QCPX 5E1FA 2X6LA 2QF7A 1KRHA 4IFDJ 2B2VA 2HCCA 1F0ZA 1WD1A 1IKMA 2F0WA 1XCQL 4BY7B 3A7LA 2NMQA 1JW9D 5FKAC 5C4JB 2BS4B 1BCPC 2KECA 2AWOA 1DXMA 1WTRA 4FNFA 1L0YB 2L9HA 1F2RC 1DYQA 1ICWA 4L63B 1WTQA 5ELFA 3NWTA 2WXIA 3U9SA 2Y5CA 1XTCD 2JU6X 3B2GA 3WDNA 3QG1A 1PGXA 1GUNA 1HA5A 4L8JA 4ZRZA 2G1EA 3HOYB 3RFZB 4MM3B 4MIUA 1KLUD 2N55A 2YEPB 4IZ8A 4J1MA 1GAQB 1XX8A 3TZDA 1BCPF 2WLBA 4TQ0A 3K59A 1FO4A 2F0DA 1ESRA 4I7ZC 4A93B 4DXGA 4OZAA 3ZYYX 2W82A 1EY4A 1AYFA 1ET9A 3HOVB 1WVLA 1J7CA 3AH7A 4LMQD 3C2PA 2LJIA 3HEJA 3IKJA 3AEDB 3D8GA 1Y1VB 3K5MA 3W5VB 1I4HA 1PRTF 4FF1A 1STAA 2GB1A 3SR6A 1LT5D 2IGDA 2BDOA 2V4DA 3J80L 3K5NA 1S5ED 2JQRB 3ND8A 4PMCA 2ZXRA 2Q8TA 3S2DB 3VYTA 2F0EA 1JE4A 1HTLD 1LLRD 1EYAA 5C4XB 2Q8RE 1O7LA 1SYGA 4E6IA 1HQRD 4N9PA 1E2ZA 5CV7A 3SVMA 3NTKA 3FILB 2MEKA 2E75C 2RDHA 2EE1A 3K58A 4RHSA 2QMTA 4XDDA 3PO0A 4HKQA 3E5SA 2F0NA 2AQ1B 1SYBA 2MPMA 3D31A 1SB3C 2R92B 1F2ZA 2KQ4X 1QNKA 1GB1A 2IX1A 2HDMA 4CQNA 3TEZA 1Q1EA 3BK2A 2GA4B 1QJOA 1QILA 1AEXA 3VYSA 1SNCA 3AECB 3JAME 1XLOA 3LB8C 1HQMC 2F0FA 1GOZA 4HKZE 5D3IB 3V3XA 3BG3A 4X3UA 5BN3A 3KLSA 3HVZA 1TVXA 2K05A 4RGNA 2N7JA 4IALA 1HZ5A 3VR4A 1EU4A 2EXZA 3P7JA 3H94A 2J4XA 2E2DC 2DYOA 1NI3A 2BT6A 1N61A 1EU3A 5EE3A 1AP0A 2NB0A 5CBEE 3I57A 5I2XA 5KNBA 1C78A 4KHZA 2JXTA 4YTPB 2XVSA 2A68D 1XCTL 5CC4A 3P4PB 2ICIA 5IGGA 5I6YA 3S9WA 1I3QB 1CA6A 3AMZA 1PFMA 4NKLA 3QIAA 4KKJA 2PZUA 4KJOA 1UEAB 3CKIB 1TY0A 1OXVA 3VR2A 2R61A 2PZTA 3BK1A 1TS5A 2QILA 3AV8A 5A35A 4K2KA 3U9OA 2KJXA 1TWGB 4C2MB 1AN8A 2M2LA 5C4ZA 3LYYA 1C4AA 1GUGA 4FYDA 2HDEA 4XT3B 1QF6A 2SNSA 2GI9A 2L52A 4XDXA 3TZUA 3AE1B 1Y56A 3T51B 4HEA1 3MJ5A 3V05A 5CBAE 1QLBB 2B2VC 3AEGB 3U52E 3T3OA 1TY2A 3AE7B 1LV9A 1CQFA 3PUXA 1I4XA 2E76C 3D4RA 3MA2B 3P4RB 5K5PA 5CMDA 2MP1A 3TEWA 5JVG3 5HGTA 2BW2A 3TDQA 2XIWA 4O1NA 1CHPD 5EE9A 3P42A 2A5HA 2XRSD 3MXUA 1D4BA 1QB5D 2K01A 1N63A 3R2TA 1YQ4B 1YNJD 1JOKA 2J52A 1GPXA 3Q8BA 3PUYA 1JCKB 5M3FB 1C48A 4NZLB 1K8OA 2K03A 3KWVA 4M0WA 1IW7D 1JR0D 1F2RI 5E4WC 3AEAB 5BYRA 3HOUB 2EYPA 5IGFA 3HOWB 3U7ZA 3T4AC 4P2CB 4M8AA 5BMIA 1J7BA 1J8IA 1RD9D 4HTHA 2E2HB 1OXXK 2WXLA 1HTPA 1RFKA 2JA7B 4K8IA 1JWSD 1WD0A 2RPVA 1SNPA 2K5QA 4F7XA 4A3GB 2K3UA 2K5WA 1EL0A 3S2HB 1F2LA 4IUNA 4B9XA 2LHEA 5MPOA 1A3VA 1G2SA 1ACCA 4GDLB 1KTKA 2MHVA 2NZ1D 1H9SA 3H3VC 1OQRA 3S1NB 1YJJA 1LT3D 2E74C 4Q5VA 2EJFC 2J0TD 1HFNA 1YN5A 2W54A 2W55A 3N52A 1B4OA 4K2LA 1BR9A 3MAQA 1A15A 2CW0D 1H9MA 2FBWB 5EKKA 4DAPA 4ARCA 2R7ZB 1LACA 3CRLC 4DK1A 2IT1A 4OZBA 2WAQB 5JJZA 5HI1A 1ZKOA 5BYQA 4H7BA 1U4LA 1L5PA 3MEHA 1UUPA 1TKGA 4PV1C 2BS2B 4WAFA 2PVGC 4BS9A 1K8MA 3RZDB 1HZ6A 2B63B 2ACZB 1FFVA 4MT5A 1S5CD 4A6QA 1SNOA 3MHBA 3QJYA 3GTLB 4KGTA 3MTSA 3FAHA 1O7YA 1LABA 2VZKB 4G4KA 4IN3A 4YTNB 4C3JG 2F0OA 1PTOH 2A68C 1A3UA 1C4CA 3OOCA 1ZXHA 3MP9A 3H8HA 1XLQA 4XTCS 1ML0D 2F3WA 1MVKA 1LTBD 3S1MB 4U673 3PIP3 3I4MB 3AE3B 2F0IA 3HGBA 2HUGA 2A6HC 2RDGA 1SSNA 4P6VF 1UGJA 1RJTA 3Q8CA 4RCOA 3QOJA 1RKNA 3DM1A 3NVYA 1WTPA 2ENBA 3K7AB 1LTID 4KKUA 3ITPA 4EGVA 1R9TB 3EGRA 2EY5A 4RF1A 2DN8A 1EEID 3TMEA 2E6XA 5E3FA 4YXDB 3GTJB 3R2IA 1FD6A 3KLSX 1TWFB 3N6RA 2A6ED 1SAPA 5C0XI 2L11A 3M7NA 1NCVA 3AEFB 4OGQC 4RF0A 2WV6D 1Z6HA 4FVMA 5GXGB 1JWUD 1KAAA 2QSDA 2OT2A 4L1BA 1E9MA 2F0KA 5JXVA 3Q6SA 4ZAIA 1ZDVA 4C56C 1B2TA 2Q5WD 3PIO3 2JEAI 1PYWD 4IOIE 1U4RA 4J8QA 3KUPA 1OO9B 4FP5D 1E7PB 2WXGA 4YIJA 2H89B 5IOCA 2JXMB 4BA2I 2FE8A 4EVOA 3ZGZA 1VMCA 1NR2A 1FCCC 2NN6I 4A3BB 5DEHA 1UAPA 3GTQB 1BUIC 2L1BA 1YNJC 5T1IA 3VR8B 2WINB 5M3MB 1I6VC 4ABNA 2I46A 2LY7A 4RKLA 4GLSC 4N6EB 2PIAA 2AWNA 1B9NA 2BE5C 3DUZA 1PFDA 5CV6A 4HN7A 1IBXB 4TSSA 5HHDG 3OIPA 2PPBC 1DM0B 3DMUA 1O80A 1TR5A 2PW5A 3SR1A 1GUSA 3V2TA 3OPOA 2L4NA 1PTOB 2EYOA 3VR6A 1H9JA 2DNCA 2KCCA 4J3OD 1TU2B 1JRPA 2CQAA 5CGKA 4KI0A 5IGDA 4WIPA 2D5DA 3M7GA 5IGBA 2FMMA 1KNEA 5NUCA 4C3HG 5IT9E 5D3DA 2WXQA 3P20A 4K5VA 4REZA 3HZXA 1Y8OB 2L5TA 1SYCA 3LX0A 2WXKA 1TWCB 5EE0A 1B1ZA 1XWEA 3NE5B 1RTOA 2ZXOA 3KF8A 5C0XG 4B0EA 4ZQ3A 4R3DA 4ZLTF 1IHZA 3M4OB 1B9RA 4KY6A 1F9QA 1ZE3D 4D2KA 1EWYC 1UNSA 2FINB 2QKIC 4DN4M 2WXRA 3OWFA 4FF3A 1C9FA 1U4MA 4EQOA 3NK9A 3Q8EA 1EY7A 1G91A 4WFN3 1ZDXA 1Y1WB 1EOTA 2G9DA 4ZK9B 3VA7A 2JE6I 3A8JE 2CW0C 4N9TA 1B44D 4KGRA 1VZ7A 5E4XA 5FR3A 1CZWA 4RGTA 4XWTA 3P63A 3F2UA 2M9VA 1UWMA 4OVZA 1TT2A 1W6JA 2L0CA 1K83B 2FMCA 2ON8A 2NN6G 3D6CA 2JA8B 5KEEA 3GQBA 1H9RA 3IAYA 1QOGA 3AEEB 2SNMA 2ZT9C 1TWAB 2EYHA 4RKBA 1LT6D 1KF6B 1FNVA 1SNMA 2K1BA 3DWGC 1TS2A 2KUMA 5KGUA 5HURA 5CV5A 1SNQA 1EWCA 1II3A 1Q1BA 2RQXA 4TKOB 1JORA 3SK5A 1P7EA 4LTUA 2PO4A 5KNDA 3BDOA 1VJKA 1L6VA 1OXSC 4L2YA 4XWWA 3Q24A 4YWGG 4IUUA 3J81L 3I3CA 1T6BX 2E2IB 1CZPA 1YNND 5F2DA 1HA6A 4A3FB 1PRTC 4BWGB 2PVOD 3VR5A 2YU9B 3TBIB 5FLXE 5C3EB 3N9YC 2F03A 1MHXA 4KN4C 1R4QB 2KOLA 4F8MA 5AUKA 2F1MA 3I90A 2B8GA 2IDYA 2G9HD 3BZDB 3NBIA 4MH8A 2C9OA 4OIKA 3PUWA 2Z4HA 3IFDA 2WIIB 5IODA 2ICEC 4QIWB 2Y3AA 3NRZA 1MHHE 3J7AV 3AB9A 2HCIA 1V1OA 2A6EC 3SEBA 3I4NB 2BTEA 1FMAD 4OZCA 1O78A 4YT0B 1X32A 4ZRQA 1Y8NB 1Q8IA 3K5LA 4WRDA 1XO3A 1JC7A 4C3JB 5DM63 2IPKD 1E10A 3ZJTA 5IIFA 5FO9B 1RTNA 1I4RA 4KN7C 4TQUS 3NQIA 3SE0A 4A3DB 4CGYB 2Y0SB 1Z7TA 2PW7A 4IUQA 3AB5A 2BBCA 1AWDA 2B2TA 4K6DA 4OO1G 3Q0AA 3ONAB 4YSXB 2XRQD 3GV6A 4CJ1B 5C3XA 1Y69U 1E0ZA 5C0XH 4OL7A 3A56A 2WP9B 5LHY1 2HQEA 1DOXA 5EPJA 3SDZA 3MZ5A 3C8YA 2EDGA 3J7YW 1EIGA 1B53A 1HUMA 1GHKA 2E2JB 3ND9A 3W5UB 1FGBD 1J9OA 4ZYSA 4X3KA 3LXFA 1NYRA 4N59A 2K33A 2Z4IA 4ODGA 4FXKC 1Z47A 1WWTA 3FVQA 1KABA 1BF4A 3RPFC 3W2DA 5EPLA 5JOBA 4HJGE 3GTGB 2NWGA 1V1PA 1FFUA 1DOMA 2NBFA 4A90A 3BVZA 1ZXTA 3ABVB 2IL8A 2QIEB 2RA4A 5K36G 4EQPA 2NN6H 3VYRA 5G3LD 1ZP0B 1ENCA 1S5FD 2ZW0A 3ZJVA 5JEAG 3DWQA 3HRDD 4DXFA 1JWBD 4F88A 2MH7A 2W3SA 3R93A 1TZOA 4NJCA 5A2QL 4JWSC 2PQEA 1E2WA 3MFGA 1SSOA 3MC0B 1EFID 1SFOB 1YMHE 2CJNA 4DQOC 1VRAB 4F87A 1IL8A 1E2VA 1DOLA 5CORA 1MSGA 4KTAA 2D9UA 1IUEA 5T8IA 1VLBA 5JPNC 3NS1A 5LL6S 4USAA 1MPEA 4PNYA 2WXPA 4P16A 1DOYA 2EZVA 4AS1A 2CHBD 3FDTA 1RM6C 4XDCA 4RH6A 3S15B 1U4PA 4CKBA 4JBWA 5G5GA 3W9CB 4XIGS 2X38A 1F2YA 5C5MA 2JYTA 4DU9A 3T56B 5BN4A 1PGAA 3RMHA 2OHFA 4JPSA 1TJEA 3P1HA 2VUMB 1PDQA 1ENFA 2OEDA 4S3SA 1D1KA 2LUMA 2LMCB 2A69D 4QUFA 1HRJA 4JE3B 1I4PA 3W1SA 4A3KB 1TYGB 4RNAA 1YNTE 1CT1D 1L4DB 3IT6B 2FUG1 4FF4A 1VF7A 2F0JA 2CU3A 2WNMA 1G8ZD 1EZ8A 3AE8B 4RWSC 1WXQA 4WQMA 5DNFA 4ULLA 5I9PA 1CFMA 4KMUC 4A9AA 2LFNA 1PTOD 3VYUA 2QEJC 4C3IG 4YSZB 3MFYA 4FXGC 4NW2A 1YN4A 1MSHA 1BMLC 1JQYD 1KDCA 2KN4A 2JX5A 5FO7B 3DXJC 3PZ7A 1VR9A 4HCEA 1HEZE 3J80E 5ELDA 4IUPA 4X3SA 1F77A 2B2YA 5IGCA 2BA0A 2D62A 2RSNA 3DWAA 1TS3A 3E6ZX 4I65A 3NP8A 2L83A 4A3JB 4B08A 3ZQ4A 4JX1C 4MACA 1JWMD 4KHVA 3HKZB 2FFKB 2EJGC 1A70A 1R7SA 1KDBA 3PO2B 1ROEA 3URYA 3A7AB 4Q0FA 3NHHA 4ITKA 3CIRB 1ILQA 2PKOA 1LTGD 1FEHA 1ZPSA 3LNNA 2F3VA 4KKIA 2WU2B 5LL6X 2M19A 1QCBD 1BXTA 3EVQA 3G7LA 1STBA 4IFDI 5JEAH 3AMUA 4HAEA 3WOEA 3AE2B 4KKTA 4A8XC 3TEYA 3SK8A 3C1FA 3W3AA 2Q8IB 4XYQA 1V8CA 1A2TA 1M8AA 4PQXA 4WH4A 2B2TC 3SK4A 1NENB 5TSSA 4XYOA 4A55A 3Q23A 4QCLA 5LNK1 3SHLA 3K6OA 1HFGA 2AUJD 1EEFD 3HUIA 2R93B 2PMZB 5HFYA 1V8QA 1QQRA 4KX6B 2LKVA 4ME5A 2TMPA 3C46A 5BYSA 2KDMA 2XN9C 1GUOA 4GZYC 1T5XD 1XYIA 1WSPA 4Z9CB 3TP8A 5I4DA 2WXOA 4DK0A 4CJ0B 3PUZA 4QB4A 1FXIA 3D6WA 3AE5B 2WS3B 4NMZA 2D5GA 3U4EG 2NYZD 4IDIA 4DF7A 2N9KA 3TUOA 3BYYB 5C3JB 1WGKA 3CQZB 5AFWA 1ZYRD 4ILWA 2EYJA 1BUVT 4US9A 2JEBI 2PW9A 1RYJA 2L55A 3Q8FA 3GP7A 4L6TB 2KA7A 3MXNA 2WACA 2NUCA 4WORA 1SYDA 1STGA 2NTTA 2MJDA 1UWXA 3X3MA 4XT1B 3FC4A 1SDFA 2F0TA 2AQ3B 3BS1A 2D2CC 5G3LF 3FPUB 4WURA 1NAPA 4IFDG 1KNAA 1TS4A 1ONLA 3EQLC 3FILA 3NSWA 1E6EB 1EYCA 2DBYA 1XF5L 4UDUC 2H88B 3BWUD 5EGTA 4Q2JA 3OMCA 1MBYA 1LTRD 2B2UA 1VZ8A 1GUWA 3BDCA 2F0HA 4TMAB 2F0QA 2VB2X 4IUVA 3T13A 2KEEA 1ZXIA 3OSOA 2K22A 2A69C 1WTXA 4H0LC 3Q8AA 3KK7A 2V3PA 3BYTB 3HS0C 4G57A 1D5ZC 5T1GA 3MXGA 5CV4A 1CA5A 1PLFA 3HOZB 1SJED 3IL8A 4OIJA 1G291 3J7AF 4CKCA 1I7HA 1FYCA 2XSCA 2WDQB 4IQZA 5FO8B 1Q3LA 3EA6A 1PXUA 2Y5PA 3I9V1 3AE6B 1CM9A 2XWJB 3O13A 1PDXA 4Y7NB 4DAYA 1K52A 3I8ZA 4U68A 2LHDA 1QNUA 2WKDA 1SE4A 2M0AA 5EKLA 4M1UB 5I6WA 1FNUA 4NDXA 1R4PB 3CRKC 5EPKA 1SYEA 1B3AA 2K7VA 3T16A 3NUHB 1O7ZA 1G2TA 3V96A 2IGHA 2WQYB 3X3NA 4R9WA 3HVDA 1IW7C 4HRSA 3QB3A 4LAAA 2N88A 2KACA 4HROA 2B2YC 1PTOF 4FF2A 1ZUD2 2DNEA 2EELA 1LO5D 1WYGA 5FOBB 1ESFA 2INNE 1JOOA 2WU5B 2MUYA 4ZKBB 1OFFA 1NUCA 5DM73 1AW7A 1JMLA 3PMFA 2DY8A 3S16B 3HP3A 4HMJA 2KHSA 4RFBA 2J42A 1RDPD 1K53A 1GHJA 4LK0M 5C3WA 1PMRA 3JAML 1I6HB 2WXJA 2IX0A 1YQ3B 4DFAA 1RODA 3VR3A 2KMMA 2RSOA 2RDFA 3GTMB 3KBGA 1B50A 2SOBA 4ZOHC 2FHTA 4IFDH 1ILPA 1S5BD 3WCQA 4XQJA 3E0JA 1D6EC 3IFTA 3PZ8A 1Q90A 4ID6A 1STYA 1QE6A 2K6AA 3FPPA 4A3EB 2F4IA 5H8YE 3P4SB 3D4DA 2K0PA 2NVTB 5D7GA 1CHQD 4HR7B 2JSOA 1WTOA 5AUIA 2LS01 3T3NA 2KCNA 2Z8LA 2J7ZA 3H6MA 3T53B 4OO1I 1VDVA 3E9SA 1SE2A 4PT5A 2AUKA 4RGOS 3SK6A 3Q22A 1ZYRC 2TSSA 2CJOA 1RCVD 1SMYD 1CQVA 5J22A 1KH0A 2PCFB 2QJLA 2DYMA 2F0LA 1W6KA 1CTMA 1YN3A 5EE1A 2OXPA 1EYDA 1CZGA 3VQIA 4WJWA 1NYQA 2YYZA 2B2WA 1JALA 5EJWA 2PLPA 1H9SB 4QUCA 1KDAA 4KJNA 2JZPA 1FNWA 2M00A 3ERQA 2YEPF 1L6UA 4NAWB 3E56A 5M5YB 1E0BA 3NZ3A 1XXGA 4B0MA 2JWUA 1VMPA 3DEOA 3IT4B 2K04A 5KIXA 4AQ7A 1TKEA 3I73A 2WXFA 3HOXB 2X69A 3CWIA 3A54A 5JVH3 1QOBA 1GXDC 3MXPA 2MGSA 5C6AA 1RWSA 2IGGA 1Q10A 1BDOA 2RKSA 2B2UC 1BCPB 1PUTA 1TIID 3S17B 5KYIA 1OXTA 4CHTB 1EZ6A 1TWHB 1VZ6A 1D2BA 4ZHOA 4N58A 2EPBA 4RAUC 2IWHA 2NTSA 4HCSA 5ISRA 3M85A 4OW0A 1OQQA 2KAJA 4WWMA 4KY5A 1QG7A 2F0SA 3U2SC 1PRTB 4H44C 2MJ3A 2BOSA 1JQ4A 2JYEA 3NVZA 1Y8PB 1SJHD 3RD4A 4QMGA 4KY7A 4C80A 1BQQT 3ZJUA 3GTOB 3AN1A 4V190 3KBXA 3RZOB 3RUZA 1DONA 4DNTB 2ZW1A 3M3YB 3L4PA 1MI0A 2VZKD 2PZWA 3MWYW 2WB1B 2PMVA 3TP7A 4FXDA 1FRDA 4ARIA 3OHXC 1JB3A 2ONQA 1A6XA 2L12A 3LWEA 1QKZA 3B2FA 4DAVA 1FIQA 2L32A 5JAVA 1P7FA 4HSPA 3I72A 3EFXD 3L9AX 2RMMA 2SAKA 1NR4A 5C0XJ 2VB3X 3H0GB 1N60A 1L0XB 1KFYB 4QF4A 4CJ2C 3AEBB 1F2MA 4MHEA 4KKSA 2A73B 1N5WA 3BVMA 4BY1B 1QOAA 1LTSD 1CK1A 2F0MA 1DCZA 1G6ZA 3VRAB 1PFNA 4IKGA 1A2UA 1WCMB 5ELCA 2IX3A 2K5PA 1NVID 1STHA 1IGCA 1QWYA 2NVQB 3P4QB 2J53A 1MD2D 1I50B 5IGEA 2I2YA 5EBDA 1MI2A 2WP8J 2INPE 5ELEA 5BMHA 4TRDA 1T5EA 5KNCA 4L23A 4ZUIA 4HMIA 1PGBA 1A3TA 5CYUA 2PNRC 3EJIA 4XQQA 1C8CA 3BDLA 5BN5A 2C5CA 1AZQA 2K28A 3MHZA 4X3TA 3CU7A 1EY8A 4C3HB 2XNAC 2A6HD 4LLGM 1I4GA 3IAS1