1LO5D

Crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
233
structure length
233
Chain Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIAIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal Structure of a SEA Variant in Complex with MHC Class II Reveals the Ability of SEA to Crosslink MHC Molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 54
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lo5D01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1lo5D02
4RGOS 1LTID 5ELBA 2AQ1B 1PTOB 1LTSD 4RGNA 1B1ZA 2XRQD 4L63B 1I4QA 1HQRD 2O2LD 1CK1A 1RF2D 2NTSA 3DWPA 2AQ3B 3R8BA 1V1OA 3MFGA 1LLRD 4RHRA 3BVGA 1LT4D 1D5MC 1G8ZD 3R2TA 2RDGA 5FKAC 1LT3D 1EU4A 1PRTC 1I4PA 1L0XB 1V1PB 1BCPC 1TY2A 4NZLB 3W2DA 4K6LA 3V05A 5I4DA 4L6TB 1KLGD 1FNUA 1T5XD 1TS3A 4RH6A 4OHJA 3BVZA 3SEBA 4ZYSA 1EWCA 1LT6D 3CHBD 1LTBD 1CHQD 1I4XA 1PZJD 1TS4A 3DWAA 3R2IA 1LTTD 4TSSA 1AW7A 1PTOD 2IPKD 1FNVA 2IJ0A 3BYYB 1YN5A 1LTGD 2G9HD 1TS5A 4Z9CB 1PRTB 3BZDB 1SBBB 3OWEB 1ENFA 1SE2A 1L0YB 1BCPB 4BWGB 1HXYD 5ELEA 1S5CD 2R61A 1I4GA 3BVMA 1RCVD 1B44D 1DYQA 4O1NA 1FGBD 1TY0A 2RDHA 1JWUD 1PTOF 4C56C 1D6EC 1EU3A 2QEJC 1PZID 2XRSD 1S5BD 1UNSA 3EA6A 1LT5D 1D5ZC 1GOZA 5D3DA 1PTOH 1M4VA 1RDPD 1TS2A 1MD2D 2XNAC 2Z8LA 3TSSA 1FD7D 1PRTF 3GP7A 1QILA 2WV6D 1D5XC 5D3IB 1BCPF 5ELDA 1BXTA 1I4RA 1PZKD 1S5DD 5ELFA 1LTRD 1KLUD 1FNWA 1JCKB 1CT1D 1S5FD 1CQVA 2J4XA 1V1PA 1UUPA 3EFXD 3KLSX 4UDUC 1PRTD 1SE3A 3URYA 1BCPD 1I4HA 1SEBD 1LO5D 1SXTA 4RHSA 1HTLD 3O13A 4RFBA 1JWSD 4DXGA 5TSSA 2QILA 3BYTB 1AN8A 1EEFD 1PTOC 1SJHD 4RCOA 4RGTA 1JWMD 3MC0B 1SJED 2SEBD 1JQYD 1RD9D 1XXGA 5FK9C 1SE4A 1CHPD 4RGMA 2NTTA 1DJRD 1EEID 1S5ED 1XTCD 1PYWD 1LTAD 1EFID 1ESFA 2AQ2B 2CHBD 2TSSA 4DXFA 1JR0D 1ET9A 5ELCA 2ICIA 1YN4A 1ET6A 1KTKA 1F77A 1STEA 1HA5A 1YN3A 2XN9C 3DWQA
chains in the Genus database with same CATH superfamily
3HOXB 4HROA 3CMEA 2JA7G 2BS3B 3QA8A 3JYUA 3OTOL 4YWGG 2KXJA 4MGZE 2YTXA 3PQIA 2B3AA 2AHOB 5AUIA 5M5WH 1WJNA 3R8BA 1J8IA 4DR3Q 4QQBX 2WXJA 1AZQA 3GTPH 3S1QB 2LGXA 4B9WA 4P71A 1LT3D 1V1PB 2DYMA 5GAHC 4IKGA 4DV6L 3J81L 3W2DA 4K6LA 4A6QA 5IE8A 2MBHA 3PVLA 4DR6Q 5EBDA 3TZUA 4QL5A 3IAYA 4OIJA 2JQRB 1BO0A 1UWMA 4R4CA 4HR7B 3FP9A 2DAFA 2NWGA 4X64Q 2EQSA 1STAA 1VDZA 5IT9E 2JA6B 3MC8A 5IYBG 3SFEB 3TP8A 1NR4A 2D0OA 1LM8B 2KDIA 5C3JB 4GKKL 2N3SA 3PO2H 4A3DG 1CJEA 1N60A 2ZVOA 3PLVA 3X3NA 1WYWB 5EE1A 1E8XA 4JBWA 4C3JB 4BZAA 4IUVA 1KDBA 3OMGA 4XYQA 3PO2G 1YOVB 2KZRA 1WRDB 3VFKA 4KKTA 2UUBL 3M4YA 3M4PA 1FJGL 2ZXOA 2KFJA 1L0YB 5EDSA 3W5VB 3U4VA 2Z4HA 5G5GA 2RR9A 2D3AA 1JWBD 5CHWA 3K80C 3K0YA 4KLKA 4DFAA 4L1BA 3VUYA 1F9RA 3D4DA 1IL8A 1HR0W 2FAZA 3NTIA 1LT5D 3A9KA 1JOKA 5KRUA 5IT9c 4DR7Q 4AQYL 2KTRB 2RD0A 4LNOA 3U7ZA 3M4QA 1VD2A 2N9KA 3ML9A 3CSTA 2NBFA 2KD0A 1DCZA 5M3MB 2IL8A 2JE6I 4ILWA 3AB5A 4A3OA 2LHDA 4HJKA 2EDGA 1DOMA 4XZ4A 3VR8B 3APDA 2B63B 2HDEA 2KMMA 1RWSA 3GO5A 3GTGH 3KH0A 4N9TA 5JEAJ 1K8GA 2LZ6A 1SEBD 2K52A 3RZFA 2E2JH 4IFDH 4CJ1B 3RD4A 2NMQA 2F0UA 4KGTA 1D1IA 1GB4A 3A56A 3NE5B 2WXNA 4G0NB 5CC4A 1T3QA 2OJRA 4FHJA 4NQLB 2WXOA 5C4XH 3H3VI 4IFDG 2QMTA 2KAJA 2INNE 4YTMB 2YU9H 1QUQB 3UF8A 3MXNB 2N8NA 3I55A 2DNEA 4WJQA 5CV5A 2K28A 4XDXA 2HIVA 3C19A 3QJZA 4GB9A 1SYDA 3J80L 3WDNA 3S1MH 3PT2B 4RCNA 1JOOA 1NE3A 1SNPA 3QK0A 2WDQB 1JC7A 2JXMB 4M8MA 4C4VB 2I07B 1MJEA 4GKKQ 4RGMA 4ZQ3A 2HCCA 1TXYA 3OAWA 1F9QA 1WMHA 2H88B 2NVYH 4NJ7A 1B7YB 2VH2A 1DZ1A 3P20A 3P42A 1RFKA 4GSWA 3ZNZB 3M95A 1VDVA 4TRDA 3I2ZA 3HOZH 2REXA 3VXWA 4WJ4A 2LKVA 2JXTA 2MFIA 1TVXA 2CQAA 3W5OA 2GMIC 3HOZG 3CCVA 3HOVB 1P16A 1TIID 4A3GB 4GDLB 4OEMB 4Y7NH 1F0ZA 3ZTCA 4C80A 5IO9A 1HZCA 2KC2A 3HM6X 2B2WC 1S40A 3ML8A 2F0EA 3IG3A 5KHOA 3DWPA 5EKKA 5JJIA 1XT9B 4JE3B 2DENB 1NY4A 4NY0A 2QCZA 3R2TA 3Q24A 4AQYQ 2F0DA 5DEHA 1GVPA 2XIWA 3N6RA 1UE7A 3Q0AA 3U2SC 1RM6C 5G3LD 4K1RB 1CKMA 1FNUA 1TS3A 1SIJA 2F0KA 1TWGB 3GV6A 3L7ZC 2WIIB 4G7OC 1ZGUB 2RVLA 2EYOA 3AB9A 2JP1A 3QCAA 4FLHA 3ZDMC 3OIPA 3GE3C 1PZJD 4IZ8A 3FPPA 3R2IA 2KN5A 3QB3A 2X8XX 4FXDA 3EBEA 1AW7A 4K8IA 4V0BA 1MG4A 4KHVA 4A3BG 4IWQA 2WAQG 3NBHA 2VZKB 2NR2A 2KT7A 3HOWG 2NBWB 4J6IA 2WKCA 1SNDA 2SNMA 4WJPA 3KWVA 1F2LA 1Q7YC 1KM7A 4EKUA 2V1CC 3S2HH 1AE3A 1H9MA 1PRTB 3QJYA 1X9NA 1OEYJ 2GBRA 2J42A 2MRPA 2FUG1 3BVMA 2PJHA 4WAAA 3E5SA 3U30A 2VS1A 1TZ1A 2VXWA 3BG3A 4HSPA 3S16B 3D3RA 3L08A 5CHFA 4W9KA 3DEPA 2MNAA 2KN4A 3HOXH 3OW2A 5D3DA 2WXMA 1VR9A 2KWVB 2Z6KC 3AE6B 5IKCM 3M3YB 1SR3A 2ZXRA 4FXKC 4V190 1R4MB 5ELDA 2PQEA 1PH5A 1KRTA 1P1AA 3ZJVA 4NP5A 1WJJA 4CHKA 4M01A 3S1QH 4JC0A 2EPBA 5K5PA 5A2QL 3T53B 1EWIA 5A35A 2ENBA 4GN4B 2JQOA 1Y8RC 1Z47A 5L83A 1SE9A 2A68D 4JI8L 2EIFA 2HQEA 1J5EL 2MLBA 2E8GA 4LF4L 1WR1A 2E2IB 5I2YA 2V9HA 3T3NA 4O42A 2JA6H 3R66C 2NCNA 5TSSA 4G4KA 1E7VA 2PYKA 4IPHA 4QJFA 2X38A 2YLMA 1HNWL 4YCVA 1W6JA 1PTOC 4L5RC 1VQ9A 3RI7C 2Y0SE 2D07B 4CDEC 4LFBL 4FF1A 2K5PA 1E1OA 1PH2A 3J81E 4C3JH 1KRSA 2PZUA 1B4OA 3RN5A 4DK5A 1WTRA 5JVH3 2BW2A 2Q8IB 5BN3A 1TWFB 5CMDA 4C3JG 3GZNI 2VB2X 4DA2A 4H7BA 1K50A 2LXJA 1SNMA 3RN9C 4L23A 1OTRB 2MBOA 1C9FA 1BDOA 2R7FA 4DR1L 3HK0A 2F0PA 4UHVA 1AWDA 1O78A 1ET6A 1EZ6A 5IAAC 2EKIA 1QF6A 1F2RI 4B9XA 4EE2A 3B1LX 2HIXA 2A74C 3CQZB 1BBUA 3DMUA 3EIVA 4W9CA 4AWJA 2JZPA 3LJ3A 4R3DA 3I91A 3L0OA 3Q3JA 4BOSC 4LF5L 2CS4A 2IO0B 1L6VA 2M0AA 2AQ3B 1CTMA 4IUMB 4MDKE 4YCWA 5M3MH 4OVUA 2MJEA 3P4RB 3PHXB 3M7GA 4MIUA 5BYSA 2B63H 1EIHA 3J81c 3PUVA 1QNUA 2N7EA 1SMYC 3ZTDA 1E9MA 2SNSA 1YITA 3HS0C 1B8AA 3A8KE 2B63G 2MBQA 2OHFA 1PFNA 3FC4A 4HJGE 4ZOHC 1K8MA 4JV5L 4KN7C 4YSXB 4JI0L 2AWTA 2LWPA 4LK1C 2LJ5A 2B8FA 4JI8Q 4HJ5A 3DWAA 3C3LA 3AH7A 2J7QB 4LF4Q 1LTTD 3Q6SA 2N9PC 3CCJA 3OHXC 3SR1A 2M2LA 2ONQA 3KUDB 5HGTA 5LNK1 2Z9HA 1B2TA 1LXDA 1VQKA 1NYRA 3PO3B 2EE1A 1HNWQ 2KVMA 5BO4B 3HVDA 3GV3A 3OPOA 1MI2A 1PGBA 3AEAB 2KNBA 2ZTDA 2JT4B 1L5PA 4YHHQ 3RUIB 4XWTA 1C4QA 2R61A 5C0XJ 3T1YQ 3A1QA 1G6PA 1PDQA 4HJ8A 1TWCB 1XTDA 3GTKB 1ZYRC 1EU3A 3AE4B 1YNJC 5IOCA 2EY5A 1S5BD 1X3PA 4DR5L 4QY7A 1WCMG 2KTFA 3NVVA 1GO3E 3HOVH 2KWCA 4DR1Q 3VRBB 1IUEA 1WM2A 4G7HC 4JBMA 5IGCA 2ID0A 2KX0A 3A7LA 2ZCCA 4GXBA 4XGAB 2HTHA 3CKIB 3HOVG 1S5DD 2WACA 2K14A 4HJAA 1ACCA 3A9JA 2C9OA 2KJ6A 3A8IE 4NQKE 4RA8A 5CR3A 1Q12A 4HKQA 1HZ6A 1PV4A 2FINB 4LF5Q 3Q6BA 4UDUC 3L13A 1EUJA 2HJ1A 2MEKA 1LO5D 3CMAA 2LVOA 5LMUQ 1ZKHA 2FNJB 3ZKJC 1TWGH 4E3CA 3PCOB 5KNDA 1HZ5A 3V60A 4EX5A 1NDDA 2XWBB 3D4WA 3MEHA 1PXUA 4DXGA 4IUQA 3A9KB 4LNIA 2Z1CA 2JRHA 2N7DA 4BY7B 3W5UB 1TQOA 4RCOA 1G91A 4II2B 4AYBB 4JV5Q 1VQNA 2WINB 2KVZA 2L00B 1YJ1A 3MJ5A 3A55A 1HHVA 2WQYB 2R6GA 1XXGA 2O2VA 5DPSA 3SFDB 2MJDA 2RSOA 3NZ3A 2PEAA 4B3MQ 2FIFA 4QMGA 1EFID 2F0JA 2R93G 5C3EG 1PVOA 2A6HD 3QHTA 3SR6A 4PK1A 4GN3B 2LVPA 2B76B 1N6ZA 2IGDA 3S16H 1W3SA 4S17A 3TN2A 5J18A 2NZHA 2B2UC 4QIWE 1ZXTA 1Y1WB 2WYQA 2I1KA 4MACA 2I1JA 2Z59B 3HGBA 1QOAA 3I7FA 2R2OA 4YWKA 2NN6H 3DVGY 2I2YA 1UEBA 2Y3AA 1SYFA 1EF1A 1STNA 3M3YH 1Z5SB 4EEWA 3MFYA 3N9YC 4KN4C 3BY4B 1E0ZA 3ZIMA 3JAMi 3J7ZC 2NN6G 4DR5Q 3UQAA 1RJTA 3OIQA 5I6YA 2X6GA 4RHRA 3MJWA 4W9JA 4DR2L 4FXGC 3NZSA 1P3QU 1JOQA 1WMHB 5COYA 4YTPB 5TR5A 4TV3A 3PIO3 3P7JA 4K7WA 3ZNGC 5DM63 1FMAD 2BF8B 3HP3A 5AZFA 4OL7A 4RAUC 2E2IH 3RLOA 2LMCA 4OHJA 3CCQA 3NG0A 4PZ8A 3M62B 3BVZA 1R7SA 1IP9A 1A8VA 3IXSA 3ZLZA 4IO9A 1QVGA 2C5CA 2N9XA 3CHBD 4X66Q 2ZPNA 4MM3A 2E3TA 2OF1A 1AFPA 3X3MA 3I57A 5A2QE 4B6WA 4PS3A 1UBIA 3CU7A 4IN3A 4C3IB 1YN5A 3NWTA 1U9RA 2NBVB 3U4ZA 4YSYB 1VCIA 3TEHB 5CHVC 3V6EB 4A93G 2HCIA 2K3UA 4KKUA 1GUWA 4BAXA 1TWFH 4KIKA 4JPSA 1I50B 4DUYL 2Q8RE 3BDLA 4JVZA 1SE2A 1QNKA 4BWGB 1WOCA 3FKIB 4A20A 4BKSD 1S3SG 1RCVD 1VQ4A 2RCNA 1TZOA 2ZEQA 2N0SB 1YEZA 3IFDA 4HRSA 1MJDA 3NXWA 4C56C 2Z0EB 3AE3B 4DV2L 2QEJC 2HD3A 4N6EB 4G57A 3CQZH 1X55A 2K5QA 2UUCL 2Q2TA 4K7SA 1PH9A 4KKJA 4YWLA 3KDFB 2WB1E 3GDEA 4LWCA 5GAGC 5C44B 1WTOA 3D8GA 3NBHB 2WP9B 3BS1A 5D3IB 3NVWA 1QILA 1U4LA 3ENEA 3RN2A 2I38A 2JRIB 5ELNA 2ZCBA 2PI2E 1VRAB 1GUNA 1OGWA 5I2XA 1V86A 1WZ0A 3QX1A 5C1ZA 3LX0A 1HPCA 3PMFA 1YJNA 1IBMQ 1G51A 2M00A 3CCUA 1F52A 1RODA 4HPLB 2DJFC 1MVKA 5AZGA 2DZMA 1Q1BA 4XTCS 1WJ4A 1IYJB 4ZYNA 2WS3B 2Q2IA 1SYGA 5T1IA 5IP7H 4DR2Q 4LNNA 4LF7L 5AJ3L 2MW5A 4IM0A 3T8MA 3UIPB 1WSPA 1ZW7A 2YTYA 1MFWA 5IP7G 3W1SA 5HKHA 2F0GA 1ASZA 1HTQA 4BY1H 3BIID 3DVNV 4ZKCB 3KF8A 4X62L 2L7RA 5IWAL 4GGQA 2OEOA 1A5RA 3PO3H 3AEDB 2B2YC 2NVXB 3I4OA 2A69D 4NKLA 1D2BA 5BYRA 3S17B 3QOJA 1XEEA 4BY1G 2MCNB 5J2RA 2EJFC 3PO3G 1KRHA 4KV2A 2W3SA 4C7ZA 1LTAD 3ZJUA 2CHBD 2BYFA 2VNUD 1UE1A 2H4OA 2PZWA 4DKAC 1SROA 1TWCH 1J19A 3GTKH 1ET9A 5ELCA 4LFCQ 4ABNA 4BXXH 1XQQA 1SN8A 4HPPA 1E0BA 2JSVX 1DOIA 1Z7TA 2LXAA 2DUDA 3GTQB 3PREA 2DGYA 2CCZA 5JOBA 1C4AA 4KKSA 4A3DB 2INCC 3PV1A 2RDFA 4X3KA 5JJZA 3K58A 4HCEA 4DV2Q 4DDGD 1LABA 4CKBA 2FMCA 2QC8A 4NMZA 1RF2D 4U68A 1E2VA 3E3XA 4EFOA 1LT4D 1G8ZD 3MVVA 2D0PA 2RDGA 3PF4A 1WGHA 1L0XB 1XWEA 4LAAA 4ZRQA 1K3RA 3B9JA 2WFWA 1EWHA 4DAMA 5LXHA 1P8LA 2WU5B 3ND9A 3S1NB 3CP0A 3GD7A 3Q69A 4ZHOA 3EGRA 2H89B 3RYTA 4BY7H 3J81i 2IWHA 1NI2A 4W9HA 3ZXRA 4WFN3 3NRZA 1BF4A 1ILPA 1VQOA 2KK8A 1MG8A 1SE8A 4HVBA 1ENCA 2Z6KA 2EJMA 4JI4Q 4WAFA 1Q1EA 1VQBA 2IY1B 1XNQL 4DHZB 4B3RL 1D1KA 3LXFA 1C1YB 1JRUA 1O7ZA 4CHTB 1C9OA 4F87A 3TS2A 1UGJA 3ERSX 3C0RB 2JN4A 4KHZA 4K2LA 4X62Q 2HUGA 3SK4A 5IWAQ 4A3FH 2DYOA 1JORA 1BCPB 4K5VA 4NAWA 2YVCA 1UGMA 1XLQA 2MGSA 1R9TB 3L9AX 1OEYA 1DYQA 1VQAA 2K03A 1FGBD 1TY0A 4A3FG 4MEMA 1Y1WH 1BVSA 1PTOF 1H9SA 4ANVA 1HFGA 4OX9L 2KUMA 2RSNA 3I8ZA 2A6EC 5IOIA 1X3FA 3G71A 4LF9L 2V3NA 3APFA 2R7DA 5JHAA 1V9PA 3K59A 5JVG3 4A3JB 5IGBA 1ZOYB 2UU7A 1SYEA 1TBEA 3RULA 1BUVT 1FD7D 1PRTF 2HQLA 3KLWA 1YNTE 1D5XC 4G11A 1LTRD 1HCZA 3DVNU 3ERQA 3UE0A 1IKLA 1CQVA 3BZKA 1JICA 2MQJA 3Q23A 1EQRA 2J0MA 1UUPA 3K9PB 3A1QB 3NTHA 4OZBA 4BKGA 3H94A 4KMUC 3MAQA 1SE3A 2L9HA 3T16A 2FFKB 2FCNA 1CMXB 1YNND 3O13A 2X6LA 2FBWB 1A3TA 2V0GA 2GB1A 3QQ8B 4FNFA 4ZLTF 4WWOA 3GZNB 4IPDA 4XIGS 4RGTA 5KNCA 1JWMD 2FUHB 1XMQL 4DR3L 1JMLA 4I7AA 2HTME 5DCNA 5KHQA 3TDQA 4C3IH 4TMAB 3A9JB 2K1FA 1JQYD 3TEWA 3F2DA 1RD9D 3AE2B 3UINB 2ICEC 1CHPD 2VZAA 1EYCA 4KI0A 3NVYA 4WIPA 3I4MB 5IN7A 4BBRB 1I50H 1L7YA 5FLXE 4DK0A 1EYGA 1QKZA 1VQEA 1QT9A 3HIZA 4YT0B 4P74A 2TSSA 3FKIH 1F2MA 2C5LC 1XNQQ 4KHPQ 1L2FA 4X64L 3A33B 1VF7A 3EN2A 1WX8A 1JR0D 2IO2B 2EYMA 1HQMC 2CWPA 2G9DA 2M1MA 4IW0A 4N59A 1NENB 5JZEB 3FKIG 2LHEA 1E2WA 2CHXA 3TQYA 1STEA 2QCPX 4TQ1A 5GROA 2XN9C 3DWQA 1L0WA 4R8NA 2CKHB 3WCQA 3VA7A 1CSPA 3AFQA 4A3BB 5C44H 1GAQB 2WAQB 4J1MA 3CCLA 4YSZB 4R1JA 2L1AA 1CQFA 3CW2C 1JW9D 3HOWB 2K4KA 2NBUA 1SAPA 3D6CA 1I4QA 4PMWA 4OX9Q 4B3TQ 2KMCA 2V4LA 1X3GA 4LLGM 5C44G 2K25A 3PGZA 4LF9Q 3T56B 5C23A 3RPFC 3H3VH 1WGGA 2BBCA 4DAPA 3LB8C 5E7NA 3AE5B 4FXCA 3KW5B 2CKZB 3P4QB 1J7CA 5DPWA 1NR2A 3FMCA 5JAVA 1PA6A 5FLXc 4TVAB 3Q8CA 2NS5A 3KQ4A 4KX6B 1DONA 3S2AA 1K83B 3K81C 4DDID 1FIQA 4A3CH 3C1EA 4JI6L 3C2PA 1SYCA 1E8YA 2LXKA 4QUCA 3RMKC 2LS01 5E3FA 1LTBD 4C3HB 3F2CA 2F0HA 3N32A 1QZGA 2V4DA 4A3CG 4JGHB 4MH0E 3TZDA 4ZKBB 2VB3X 2RMMA 2NVXH 4FN2A 1SGHA 4OZAA 1Y8PB 4IUPA 5IGFA 1JT8A 3S17H 3H8HA 1GPXA 1EY0A 3HOYG 1WE6A 2NZ1D 3EJIA 4LFAL 2KLCA 4CO7A 3VYRA 1XMQQ 1UBQA 2L0CA 4NJCA 4POGA 4IDIA 1VZ7A 1T9HA 2PKOA 1ICFB 2LMCB 3ULJA 4TUUA 1SF0A 1WE7A 1NTGA 3KFUA 1L1OB 1QZHA 1V80A 3DWGC 3S2DB 4HAEA 3NY5A 4REZA 4USAA 5IYBH 1PH4A 3GTQH 1SIFA 4NW2A 2DNFA 2IHFA 5BMIA 3V2TA 1GJZA 2I5HA 4A3DH 4US9A 1M4VA 1CKNA 2K05A 4ME3A 2O5JC 4R4QA 1N33L 1K3BC 1WGYA 1WX9A 1HNXL 3RNEC 2WV6D 1WZ3A 4J3OD 3PSIA 1RAXA 1BXTA 3SE0A 4OO1G 2OTLA 3STBC 2EY2A 2W55A 2KHJA 4XT3B 2N88A 1E22A 3RZOB 4FP5D 3TCAA 1XCTL 3KK7A 3BK2A 4LUVA 3QAQA 3T51B 1DOXA 3NVZA 2L0FA 3S1NH 4M00A 1AE2A 3H6MA 3D4RA 4XQJA 2B2UA 2IY5B 2CJNA 2F3WA 4HSVA 1ZXHA 1VQIA 4L5TA 2KMAA 1VQFA 1A6XA 1YJWA 1MHWC 4K81A 4L2YA 3W1YA 4QCLA 3T9LA 4AH6A 2IX0A 4JI6Q 1QVFA 2CHWA 5FR3A 4YY3Q 1PH1A 1IW7C 3KUCB 2R7ZB 4BVUC 4WWMA 2PQAA 3T13A 1LV9A 2OEDA 4R8IA 2KDFB 3JAME 4B0EA 1JRPA 4BKSA 3TEZA 3CIRB 1R9TH 4LFAQ 3IT6B 1IYFA 1JE4A 1W6KA 3VYTA 5IGGA 2ZM6Q 1Y69U 3BZCA 1NJIC 1YN4A 3MTNB 1SRUA 4ZRPA 1SNCA 3QWZB 3Q2AC 3TEXA 1EY5A 4M0WA 4A3KG 1ZKOA 4B3SL 2BB6A 3J7YW 3PPAA 3Q8DA 1T0SC 3FDTA 5CBAE 3WAMA 1FCCC 4I65A 3KF8B 4A3JH 3IRBA 2XTIA 1PLFA 1F1HA 3AEEB 4W9DA 4BBSG 3OSOA 1MJCA 4FO2A 2K8CA 2Y5BB 4A3JG 3ZW3A 3LNNA 1AH9A 3DLLA 1RLFA 2WDTB 3CCRA 1N33Q 2DZKA 1HNXQ 2B2VA 1BQQT 4DV7Q 2VH1A 4HIOA 3DXJC 4JOIC 4DPGA 1DGSA 1TYGB 1GD7A 3DCGA 3VVWB 5J17A 3JAMc 1WCMB 4MGKE 2HHHL 4IOAA 3V62A 3WWVA 4HIDA 2IYDB 4ASWC 1GHJA 4K5WA 1WD1A 1NVID 5IP9G 2N7JA 3MA2B 4TQUS 2V3PA 2M56B 3I72A 2JYOA 3SK8A 5JJLA 4HEA1 4QGUA 2IJ0A 1LTGD 1EOVA 3J7A5 3I73A 2IBIB 2KFKB 5LLIA 3I4MH 2G9HD 3VAWA 3WA0A 1EL0A 4BBRH 1U4AA 3DQVA 2KOLA 4MN3A 4Z9CB 2DY8A 2EMTA 3CAMA 4NNJB 5LXIB 1J0GA 3I4MG 3KYHC 3IAM1 4BBRG 4OO1I 3ONAB 1WJ6A 4LJOB 4X3SA 1IL2A 3PUWA 1UWXA 5I9OA 2MO0A 1EF5A 2BDOA 4OW0A 2JA8B 2KJRA 3DBHB 5HFYA 4WH4A 5C5LA 4A3BH 3QOLA 4Q0FA 1G2SA 1U4PA 2Z8LA 3HOWH 1GHKA 4XT1B 4ARIA 4FF4A 3P4PB 1YHBA 4B3SQ 1RTNA 2RBMA 4WRDA 3F2BA 5D6JB 4ACFA 1VQGA 1GB1A 2QJLA 5IY0A 1JB7A 4EQNA 2DYBA 4ZCKA 2R93B 5C3EB 3RZDB 4NDXA 2H1EA 1WTXA 2BE5C 1D8LA 1U0LA 5IYDH 4KSKC 1X65A 1L2NA 1IKMA 3AM9A 4HCNB 4MTNA 4W9FA 5LL6S 3U58A 2L76A 1I4HA 4GIVA 3VUXA 1H9SB 3B6YA 5IYDG 4R4TA 1K83H 4J15A 4K5XA 2XWJB 2QILA 5C5MA 4GZYC 4C3HH 2JF5A 3V96A 4DHJD 2QSDA 3FAHA 1WFYA 4IWOA 4UP9A 3H7PA 1GC7A 4CDFC 2OXPA 2UXBQ 4NXNQ 4HJ7A 1T5EA 2HHHQ 2F4VL 4DV1Q 4C3HG 3BINA 2SEBD 1YX6B 3ONSA 1XMOQ 1IBXA 1FVIA 4P6VF 3TBIB 1TTNA 1S1QB 1K8OA 2BKRB 3QR8A 3ABVB 4EQOA 3T4AC 2JEAI 2C7MB 2L1BA 2BYEA 3FPUB 2CJOA 4OXPA 2WXQA 4AYBE 4HN7A 3WAPA 1A70A 4ZHPA 4ZUIA 1DOKA 1ZDXA 4YIJA 2J0JA 2WXKA 4AJYB 3PZDA 4PG3A 1IXRA 3S2DH 2BCOA 2FXQA 2KJHB 3KUPA 3CC4A 2XK5A 3E0EA 5E1FA 3Q3MC 2JYEA 4IUUA 4X6AH 4HPMB 4AOFA 1ZPSA 2RGFA 3K7AB 2WP8J 4QUFA 4L63B 2KENA 4KJOA 1IGDA 1PGAA 2KHWB 4A93B 3MP9A 5EE3A 2CH4A 2KCNA 1ROEA 3V61A 2VQEL 4YHHL 1C4CA 1WI5A 3T1YL 5AUKA 1SB3C 1GUGA 1KDCA 1LTLA 1PRTC 5EGTA 3RZOH 1UZXB 2K5DA 2QA4A 2DHZA 3C8YA 3G6JB 3OW7A 2DJGC 3P63A 4ICUA 3A74A 3PRZA 2EVBA 4HMIA 4L6TB 3BU2A 1F2ZA 1BNZA 4GDKA 1T5XD 4OELB 2IO1B 3WAOA 3FKYA 3AULA 1TS4A 3F1ZA 5HHDG 5L95C 3PUXA 2KHIA 1T0RC 3HKZG 4JCVE 1PTOD 3T1HL 3KVFB 4CQNA 2DAJA 3AEFB 1XPRA 2R7ZH 1ICWA 3UDFA 5IIFA 4LF8L 3FILB 3JW0X 1EY6A 1KQSA 2AMCB 1P0RA 4JWSC 4EOYA 2CU1A 2R92B 4WWPA 1WR6E 2F4VQ 3MHBA 5LMUL 4KGSA 2R7ZG 1DGJA 3I9V1 3ZUNA 1I4GA 3U7DA 5JEAH 2EZVA 3D6WA 3UGBB 4GLAC 2PMVA 3S14B 2FIDA 3EHVA 1X3EA 2F0FA 4N9PA 2ALYB 2K22A 4MNOA 4US8A 1VQLA 5JEAG 2KDEB 4BKTA 2ZNVB 4TQ0A 1HZBA 2WXRA 4XC2A 2A1AA 3MWYW 3ALBA 1CUKA 1TS2A 2EKEC 4IPGA 3GOEA 2KOXA 2KQ3A 4BY1B 5EPKA 1BCPF 1LUZA 4B3ML 2RDBC 4IOCA 2EYJA 3OYYA 1YQ4B 3QG1A 3R3MA 1H9RA 1S5FD 2L05A 4HLEA 1OFFA 4C2MB 4MH8A 4KTAA 1JROA 1FXAA 1STBA 2BH2A 3AEBB 2VQEQ 1EO6A 4PYZA 1E7PB 1YQBA 3GE8C 1SMYD 2PW9A 1WCMH 4AS1A 4Q5VA 1JALA 2IO3B 1CZPA 1JWSD 1SFOB 5IA7A 1V97A 4L8JA 2CWAA 4XQQA 3J80E 4GOPA 1CKNB 3I4NH 4A3MG 2UXCL 1BUIC 2J52A 1YZ6A 2INDC 3PZ7A 4BOZB 1VQJA 3VTUA 2B2TC 5KEEA 1GJXA 3I4NG 2F0MA 4NJ6A 3UDIA 4J8QA 4A3EG 4ZAIA 4WORA 2LRUA 3BDOA 3N52A 3T1HQ 5FR6A 2BWFA 2E74C 4LF8Q 3UI3A 3E0JA 3V3XA 1SSOA 2KCCA 1QWYA 5CV7A 4X66L 1WJUA 4WJNA 1XLOA 1Z9FA 2K33A 2PNHA 1FXIA 2JA8H 1D3ZA 2R3ZA 1K28A 3H0GB 4WJWA 1ZYRD 2HDLA 3PO0A 2JXXA 4N8FA 3MTSA 1K0SA 1YNJD 4P75A 3K5LA 2JA8G 4RGNA 4A3IG 3MHZA 1TT5B 1ASYA 1TKWB 3J80c 3TIXA 3VH3B 2NTSA 4F7XA 5DLQE 2ZJQA 1VCBA 2R93H 5C3EH 3WALA 3AE8B 3RZDH 2GA4B 4B95A 1J8CA 1M1KC 3KYCD 3QIAA 4A3FB 3D0FA 4D2KA 3AU7A 1E3PA 3CRKC 4XYCA 2DLBA 4S0RA 2WXIA 4CJ2C 1G6ZA 4ANWA 1VJKA 2D2CC 1TT2A 1YIJA 4OWWB 2VUMG 4A8XC 4ZDVA 1KLVA 3NUCA 1KNAA 4FYDA 1WVLA 1FPYA 2LUMA 1BBXC 2A73B 3NS8A 1I3QH 5EKLA 1IBML 1QOHA 3UI2A 1WXAA 5G55A 2CQOA 1II3A 2UXCQ 2WWZA 4MTKA 4ODGA 1N63A 1OXSC 1TS5A 4OGQC 2K0PA 2LGDA 3BZDB 1X3QA 3KF6A 4DK6C 1LM0A 2MQHA 1GUAB 2K6DB 4FADA 1YJ9A 2ZW1A 1LQBA 3SHQA 3PS6A 5EE0A 4PZ6A 4HTHA 1I6VC 4QB4A 1E90A 4OONA 4DHZE 2LJIA 3AV8A 1A62A 2FCSA 4DGZA 4I6NB 3EA6A 1RYJA 1D5ZC 5FLMG 1MSHA 1RDPD 1VQHA 5M5XB 2JA5G 1N36L 1YBYA 3K7AH 1P98A 3TSSA 4JI7L 1L0VB 2D10A 3CPFA 1H9KA 3G7LA 1NMGA 4A93H 3L17A 1IGCA 5E6PA 2E6XA 2QDLA 1JCKB 2WDVB 4FDBA 2LVQA 2WX0A 3S24A 4A75A 4LFCL 2ZPYA 1F2YA 2KVRA 2NUCA 1V1PA 1U4RA 2MP1A 2N49A 3KLSX 2MSED 2N9LA 4E74A 2K39A 1CA5A 3URYA 4DV3L 4MGIE 5GAEC 2KWDA 1V5OA 1Q82C 1HTLD 2WKDA 4LNQA 1EM7A 1MPEA 2KDMA 1HNZL 3CC2A 2LXCA 3NHHA 3CMMB 4II3B 4ME5A 1PGXA 3JC66 4DUZL 4QAYA 2BYVE 2FMMA 1Q3LA 3CCEA 1H8CA 2HT1A 3L2PA 3MC9A 3M4OB 3OLMD 5BMHA 1JMCA 1Q0WB 2L12A 1G2TA 5BN5A 3W1GA 1D7QA 1OQYA 1EQQA 1J7AA 4FF2A 1M94A 1UH6A 1WGRA 3MXPA 2R92H 2DZJA 4FJZA 4IUTA 3U50C 2RPQA 4FBJB 4KV6A 3DBHI 1PYWD 2AQ2B 2JEBI 4DAVA 4KY6A 3EUB2 4AUQC 2R92G 2FCMA 3PIPA 2IY0B 3S14H 4ALPA 4XYOA 2BB5A 1AZPA 2FE8A 1P7EA 2O6VD 2Q5WD 1JJGA 1NCVA 1ZP0B 2PPHA 4YL8A 4JI4L 3H7PB 3DPDA 2BGFA 1WXSA 2PPBC 4ARCA 4GKJL 1LTSD 1Y1VB 4HIKA 3HOYB 1B1ZA 3ZDTA 3A7AB 2KTRA 5G3LF 3HZXA 4K3CA 2AKWB 3ZJYC 2CFMA 2B2WA 3ICEA 2F0WA 1QOFA 2C60A 2EMSA 3LDZE 3BVGA 1ONLA 1N36Q 1N32L 4MJSA 4C2MH 1IYVA 2XVSA 3S9WA 4JI7Q 1BT0A 3RNAC 1HH2P 2WAQE 2Z0SA 3G48A 4IALA 5C0XH 4ZRJA 2PZTA 3NPPA 2KDBA 3P2BA 4RH6A 4JYAL 2XK5B 1K8RB 1SFOH 5C0XG 2IDYA 4LDTB 2OJWA 1C7YA 4FA6A 1TKYA 4P1BC 4DV3Q 1I4XA 1YI2A 2WU2B 3Q8EA 2A4ZA 3N3KB 4EUTA 1HNZQ 1PYSB 5IT9L 4A76A 4UP7A 1V49A 3PLUA 3GTMB 2IPKD 4DUZQ 1P9DU 5KYLA 4W9IA 1EY8A 2BOSA 1TGZB 3EROA 3W9CB 1A3UA 3J9CA 2DNCA 1IHZA 1Q1OA 1Y14B 1QQRA 2E2DC 3H3VC 4C4VA 5DAUA 5CX3A 3L4PA 3K5MA 3RNCC 3EVQA 4RWSC 5ELEA 4WJOA 1SLJA 2NVQB 4GDKB 3DBLI 4B08A 3IKJA 4EQ5A 3I56A 2WGSA 1JWUD 1FGUA 2UU9L 1N9WA 3H0GH 1PDXA 3H1UA 3VRAB 2K7VA 2ASQA 1I42A 1JJ2A 1E2ZA 2OQKA 1B3QA 3H0GG 3WANA 4R9WA 1TR5A 1VS0A 2JA9A 5BR8L 4CBVA 1PZKD 3HG9A 5M5YB 1VMCA 3QC8B 4KSLC 1FNWA 1SNOA 4KHPL 4KZCA 4GKJQ 5G2NA 3VR5A 3RNFC 3UDXA 1VZ8A 3CF5A 2BPSA 2RKSA 4JW0A 1XYIA 3CD6A 3UIOB 4ANXA 4IURA 2L32A 5J1ZA 2BVCA 1N32Q 1T6BX 4A3KB 4G7ZC 2CH4W 3KBXA 1Q86C 4KZ0A 1A2UA 2E75C 1GUTA 2BH8A 3ITPA 3VYUA 4HJ9A 2WXLA 3A5ZB 1FCLA 3HOUG 4B3TL 2E2HB 4NAMA 4BBSB 4FJYA 1N61A 4JYAQ 4LDTD 4RMFA 1EY4A 5H1SE 1A15A 2G45B 2JU6X 2F3VA 2G3QB 4GNXC 1QB5D 3L3OC 3AEGB 1RHPA 5BMGA 2PW5A 5CYUA 2M0XA 4XWWA 1NBWA 2F0TA 2NB0A 3L16A 3CC7A 4EZJA 5EKIA 1NMFA 2NTTA 4R4OA 1N5WA 1NUCA 2Q2UA 5KYIA 2EY6A 1XPOA 1V8QA 2LUEA 1AYFA 1VF5C 3SXHA 2WHIA 3SK5A 1GUSA 3RCZA 1JE5A 4IFDJ 2Y0SG 4GS3A 3K57A 2JK8A 1K51A 1T0QC 4RM8A 4WURA 2K5HA 4WWNA 4EZLA 1KOTA 4GOPB 2VQFL 2KECA 3C1FA 3MC0B 3APCA 1HJPA 5M5XH 4B9KA 1DD2A 3Q8BA 3X23A 4IM3A 5E4XA 4M1UB 2PO4A 1X54A 2A6ED 4X65L 2UU9Q 3ZXVA 3DDCB 5D7GA 1E7ZA 4DV0L 5C0XI 3DBRI 4ZRZA 2O2LD 1MBYA 2KQSA 2GLSA 1I5FA 3KJPA 3EFUA 4K3BA 1D5MC 2PMZB 5FKAC 1IBKQ 2MBEA 4XX5A 2UUAL 1NNXA 4JG2A 1BCPC 2NYZD 1UELA 5BR8Q 2K6QA 1KD1C 2GBKA 2W82A 3OWFA 2KEEA 1OXXK 4KY5A 2Q2HA 4P72A 5DPRA 1K52A 3J80i 2K8HA 1GXDC 1KLGD 3F8TA 4CDDC 2L55A 5CGKA 1L4DB 3Q3NC 3M9BA 1EIGA 3VUWA 3HFZB 2LI5A 3VDZA 3NK9A 5AFWA 1C79A 3M4OH 4IOIE 2ON8A 2OOBB 2IX3A 3H9DA 1HZ9A 2PNRC 1FFUA 3BYYB 2O2VB 5H8YE 4F8CB 3A54A 2M8SA 1PHJA 2MH7A 3RD2A 3DBSA 5LMNL 1V1QA 5JPNC 2ASBA 1FM0D 2N1VA 3OWEB 3MEFA 2QIEB 5KNBA 1UE6A 3OJ4B 4BBNF 2ZXPA 2YEPB 2IT1A 3I70A 4Y52H 4IWPA 4F1SA 2LASA 4JPBW 2M19A 4YWMA 5C4ZA 2UWQA 1C0AA 3MXUA 1FYCA 3WOFA 5E4WC 4YY3L 2GBNA 4YXDB 3ZGZA 1Y1VH 1OXUA 1VQPA 1MD2D 3HRDD 4LJZC 1ZE3D 2F4IA 3HOYH 2D11A 1Q90A 3B2GA 4LNFA 1HEZE 3NWSA 3I5JC 2SOBA 2VQFQ 1Q46A 4LUOA 1I4RA 5GMVA 1EQTA 1Y1VG 1JJCB 1TWAB 1F2RC 4DN4M 1HRJA 2C9WB 3J7AV 2LFIA 3GQBA 3KF6B 1YIWA 1TWHB 4X65Q 4FJVB 2ZM6L 3U52E 1VQ6A 3TEYA 4H2AA 4DV0Q 3V6CB 1A3VA 5CTRC 1X32A 1MGSA 5CORA 4FF3A 3SU8X 1WD0A 1WYGA 2PCFB 2ZJDA 5C3WA 2F52A 4DV4L 1VQDA 2J53A 4JBJA 2LY7A 1PH8A 2UUAQ 4IM2A 2L15A 2QEXA 1WTQA 4FHKA 5LHY1 3J81j 3L0WB 1PFMA 2MO1A 3I90A 2O4XA 4XXEA 1U5KA 1C8CA 4R4IA 2M4NA 5BN4A 4MM3B 3ETRA 1QVCA 1J7BA 2MBBB 3A4SC 4OO1H 2YV5A 3FEWX 5E6JA 3ULPA 2J0KA 3GTMH 1UD7A 1XNRL 2QDBA 1SJED 3DWMA 3S1RB 3AXCA 1E8ZA 1VLBA 1EIFA 2JYTA 5IGDA 2KKCA 4W9GA 3QO2A 4DV7L 3SD5A 3OJ3A 3MHSD 2IX1A 4BA2I 2LGYA 1UAPA 3H6NA 4KIKB 4WJ3M 4JK1C 2I5MX 1DJRD 2KA7A 4PNYA 1S5ED 1LGRA 1XLNA 2QDFA 4EGVA 2HJ8A 2NVQH 3SGIA 4H44C 1WM3A 4GU2A 3T3OA 2BT6A 2DBYA 3VR2A 5LMNQ 5NUCA 2ICIA 4DWFA 2K8BA 3D31A 4IJLA 4IUNA 1F77A 3I3CA 4CYEA 4NB3A 1ZUD2 4LW1A 4RM9A 1I35A 4JI1Q 3HKZB 1OQRA 1YNXA 2AQ1B 3NQTA 5JXVA 1G6JA 3A0JA 1YJIA 1AP0A 1RKNA 4B0MA 1P7FA 4IJHA 2WXPA 3N1XC 5M5YH 4P73A 4J6HA 1MKHA 3AEVA 3MFGA 3I63C 2K5NA 4PMBA 4AIMA 1OTCA 4E71A 1H95A 3STBD 3BDCA 3NEMA 1VMPA 1KC8C 4NXML 1L6UA 3P75A 3ZRCA 1Z6HA 1CA6A 1KNEA 2JZ3B 4A3KH 5ISRA 1L1OC 3TP5A 3BWUD 1GM5A 4XQNA 2KQ4X 2L11A 4OVZA 3IFWB 4JWUC 1VZ6A 1E10A 2BS4B 3JSVA 2E2HH 4DV4Q 4BBSH 3U8ZA 5DNFA 3IHPC 3MZ5A 4PQXA 4QF4A 2F1MA 4DR4L 3RNBC 2BYTA 4KDIC 3VDYA 2F03A 2NPTA 3AN1A 1O7IA 3DM3A 3CCMA 3OTOQ 4MJSB 3RZWC 1NAPA 4C1NK 1AARA 2R2QA 2EY1A 1IW7D 2ES2A 1XNRQ 3J7AF 5EAYA 1A0IA 4CKEA 2AYOB 3ECIA 4P2CB 5LL6X 2PLPA 1S5CD 5E6NA 4RKBA 1KXLA 5D14A 2KCTA 1B44D 2A5UA 2Z0DB 5AZHA 2KCMA 2RDHA 3M7NA 3IL8A 4DV6Q 4OIKA 2O6VA 4LNKA 3N1ZC 3TMPB 5JPMC 4A3MB 5IP9H 2UXBL 4NXNL 3SDZA 4XE0A 5D2MB 4DHJB 1D4BA 4DV1L 2BS2B 4M8AA 1YD8U 4I6PA 1XMOL 1R4QB 3EQLC 2PW7A 1WIAA 5HG2A 2E76C 2K6AA 3I4NB 5C4XG 3TL5A 4A3EB 3GP7A 1HFNA 3LWEA 3M3JA 4A3PA 3VH4B 2OTJA 3GS2A 4C7YA 2LGIA 1O7YA 3CXCA 3KYDD 3TUOA 3AYHB 3GB1A 2DZIA 3EFXD 1MHHE 2C7HA 1KL9A 2EXZA 2IGGA 4LMQD 3TS0A 1SXTA 2OCEA 3TMEA 1IBLL 2WB1G 2UUBQ 4KKIA 4DBGA 1FJGQ 1HUNA 4RFBA 3W1SC 3PSEB 2IGHA 4NXMQ 1U4MA 1PH7A 3BYTB 4A3IB 4MSMB 1B3AA 3UQBA 1C77A 1SJHD 1PYBA 3PRPB 4ZK9B 3VR6A 4BA1I 1HA6A 3PUZA 1KAAA 3NELA 1WTPA 3RNGC 3AE1B 1E7UA 1GUOA 3A8JE 5FK9C 4P16A 5DPTA 1KABA 4UAIA 1ISNA 2B2YA 3DUZA 1QE6A 4A9AA 2DN8A 4DR4Q 1EEID 1EUVB 1RRBA 1WRIA 5EQ0A 1BBWA 2KLGA 5M9OA 4NAWB 4RG1A 1M8AA 4EVOA 4I6LB 2NZOA 2QF7A 3CF6E 1WYDA 4JI3L 2VUMB 4DAYA 4LUZA 2GI9A 1FR3A 2F0IA 4HMJA 3RUZA 4TKOB 3AMZA 2JX5A 2OT2A 3SVMA 1HZAA 1PTOB 2K75A 3FHWA 2RHSB 3AFPA 3KDFA 2AWNA 1QJOA 2B3GA 2F3IA 3SK6A 1KHIA 1I3QB 5FO7B 1XCQL 3IAS1 4IG7B 5IGEA 1TWAH 3CPWA 4DQOC 1FXTB 3K6OA 2JZZA 3VHTC 2K1BA 1BR9A 1TWHH 3BJUA 2CU3A 1K8AC 2JJQA 1ENAA 4C1NI 1I4PA 2A68C 3CCSA 3HKSA 1HE8A 1V5TA 5EPLA 5H92C 1CSQA 3TRZA 5I4DA 4GLSC 1WX7A 2BE5D 1PFBA 4ID6A 1YMHE 3K5OA 1MSGA 4DNIA 1PFDA 3HVZA 1XX8A 2GN5A 2JA5B 1FD6A 3S15B 2M17A 3E56A 3EC8A 3LYYA 1G291 4AQ7A 4HKZE 3HM3A 1IBLQ 3NJTA 1TKEA 2RHQB 4TSSA 2RSUA 3HEJA 2AX5A 1KAWA 1PUTA 3HOXG 3DBLB 4RF0A 3S1RH 1GNUA 1WH3A 2GOWA 2CR5A 5IYCH 4IFDI 1XF5L 2Z4IA 1WXQA 3ER0A 2VRRB 5JHBA 2KQ7A 1J6QA 1SNQA 5KGUA 1NI3A 3WOEA 3Q8AA 4BS9A 4GLVB 5IYCG 4MHEA 3UDGA 2E5LL 4HCPB 1QLBB 2CVRA 2MHVA 2QGQA 1UF0A 2ZW0A 1IZ6A 3R7RA 3HRZC 5CV4A 4HDQA 2ZZPB 4RKLA 4NPSA 1PZID 3SHLA 2KO3A 2C35B 2ZTEA 3M63B 5I6WA 4JL9A 3C46A 3P1HA 4HXDA 4KGRA 1GC6A 1B53A 1UWVA 3KJOA 1QZEA 2RQXA 2JA6G 5T1GA 5GADC 4JI3Q 4HDOA 1YX5B 5C4JB 2BKFA 1F9PA 4JI5L 5HY6A 4GNXA 2F0OA 3PUYA 2DX5B 2VZKD 1XPUA 1AEXA 2O5IC 3PTFC 2V4IB 4JBKA 3VR4A 2J4XA 2NVTB 4A55A 4TKNA 1HUMA 3LGJA 2KWUB 2UYZB 1PRTD 2AEHA 4FULA 4HK2A 5D94A 1C4PA 2A8VA 3F2UA 3ZNHB 2XSCA 1CZWA 4GLXA 3G4SA 1FEHA 1EZ8A 4PMCA 4G3XB 1Q8KA 1EEFD 4N8X1 3D32A 1PH6A 2ZVNA 3NS1A 1R4NI 3JVZX 3L10B 5JJKA 1KJTA 2G5DA 4ICVA 2EYHA 1SE4A 2MWSB 2KBNA 1X1MA 4RNAA 3RFZB 4CKCA 2EYLA 1F9SA 3OOCA 4L5QA 2JVCA 2N55A 4DF7A 5M3MG 1ESFA 1OXTA 2IZVB 3DBRB 3DHQA 2Q8TA 3GTLB 3KUZA 1PFSA 4OWXB 1KTKA 4A3MH 2E5LQ 1OQQA 4CJ0B 3AECB 3ZO5B 2GVAA 4BBNC 2PIAA 4AP4C 1J5EQ 5M3FB 5HI1A 4GOCA 3DM1A 1I94L 4A3EH 1UE5A 2JSOA 2XRQD 4DU9A 1E5WA 1GG3A 4WQMA 3NQIA 1CK1A 2V3SA 2K9XA 2NVUI 1V1OA 3AU5A 4KD4A 1K53A 4LFBQ 4UP8A 1N5XA 1EY7A 1CKOA 2WX1A 1OXVA 4MZ9A 1XD3B 1TY2A 4JI5Q 3W1BA 4NZLB 2VW9A 1B70B 3ZRFA 1V2YA 1JB3A 2Y5PA 3WIMA 2N1WA 3KOJA 1CI3M 4A90A 4PYUA 3QWNA 3SEBA 4ITKA 4ZYSA 2ZNVC 1ML0D 4A3IH 2PI2A 3NBIA 3GTOB 2L8JA 2PVGC 4A3GH 1HR0L 1ESRA 3ULLA 1MI0A 3K8AA 4H13C 4W9EA 4EQPA 4K6DA 3PIP3 1WTWA 1HTOA 4ULLA 5C3XA 1YHAA 2FHTA 4LCDE 2K50A 4A3GG 1C3TA 3G6EA 1QG7A 1VQCA 2C7NB 5FOBB 1V81A 4F88A 5DM73 3IBEA 2PQAB 2DY7A 1KF6B 1LYLA 3NHEB 3NZUA 4JIOU 2P5ZX 3CRLC 2A6HC 3H7SA 3U4EG 1ENFA 2K04A 3I3TB 5G5HA 2BTEA 1O80A 3OMCA 5J3BA 4LTUA 2N78A 2AUKA 2XBBC 4IPCA 1L4ZB 1V43A 1WGKA 2JY6A 4NPNA 2VUMH 5GQOA 1D6EC 3HOUB 4M0WB 3JSVB 5C6AA 3GTJB 2MP2A 3FVQA 3EECA 5CBEE 2D2QA 2MX2A 1GOZA 4L5SA 5MPOA 1PTOH 4GN1A 1WF9A 2GVBA 2YTVA 1B9NA 4LF6L 2NPTB 2OWOA 4JI0Q 2W3RA 3W3AA 1QOGA 3VTVA 1S4ZA 3VQIA 2CW0C 3TP6A 3X0WA 5LMNW 3AQQA 1KLUD 2YEPF 1I94Q 1CT1D 1Q5WB 3TBLD 2N4FA 2EYPA 2BQQA 1TIFA 3RMHA 5JH5C 5J22A 3NOBA 5CV9A 2Y0SB 4XDDA 2MPMA 4H0LC 1FRRA 4K8JA 2LD9A 1EOTA 2O6VB 3IFTA 1CM9A 4E6IA 3VR9B 3KBGA 4IQZA 5FLMH 4DK1A 2JA5H 1MIUA 3S15H 1AN8A 1X6OA 5T8IA 1F9JA 2B39A 1O7LA 1XLPA 4JX1C 4KJNA 2UXDL 1H4RA 3PZ8A 1R4PB 3O65B 4KY7A 3TREA 1NSNS 1N8RC 2AUJD 5IODA 1VQ7A 1HR0Q 3ND8A 1V9JA 5HGQA 2CW0D 3PF5A 2GBMA 3VTWA 4UPAA 3RLNA 2V1YA 2LSSA 1V6EA 2G4SA 4DV5L 3K0XA 2PE9A 2WDRB 1DOYA 4DXFA 3RR5A 5AEKB 3A5UA 4X3UA 5FLXL 1PMRA 1I6HB 2LGSA 4Q2JA 2EYFA 1L1OA 4PV1C 2OQ0A 1EWYC 4DK3C 1YN3A 2L3ZA 1NBFC 2LRWA 5ELBA 3CWIA 4KD3A 5C4JH 3I4LA 1S72A 3H09A 3DEOA 5EJWA 2W54A 3P1MA 2MA9B 4N9F4 1YQ3B 2RCFA 1KH0A 3DOWA 2B2VC 2L83A 2WXGA 1WTHA 4LF6Q 2J0TD 1EU4A 2NVTH 1E24A 3AMUA 3B2FA 2W9NA 2LFNA 4O0AA 3QARA 3UE1A 2K5WA 4DAYB 1TKGA 1WXMA 2ACZB 3PHWB 4GMVA 4JOIA 2IW3A 2ZJRA 5C4HA 3DHIC 2QKIC 1ZXIA 2PMZE 3FRPB 5FO8B 2L4NA 4PS7A 1EWCA 5EBCA 3A4RA 1CHQD 2EXDA 4F8MA 4XDCA 1S3OA 2FJ2A 3VR3A 5KIXA 3RLFA 2D3CA 4F7ZA 2RF4A 2VY3A 2A69C 1IBXB 4A3LH 1ZEQX 3B0AA 4AJWA 1FNVA 1Q10A 3P4SB 2B29A 3VYSA 4PZ7A 3VA5A 1Z2MA 2F0VA 3AE7B 2MJ8A 3EFCA 4A3LG 2UXDQ 2INPE 3E6ZX 4JLCA 4RF1A 1SBBB 5F2DA 3PV0A 4URKA 2D3BA 4PT5A 3N1YC 4ANUA 4BFRA 1Y8OB 4K0KL 3M85A 3B08A 1SDFA 3GTLH 1UEAB 4O1NA 1YJJA 4DV5Q 2SDFA 2A19A 1WI0A 2JA7B 2AWOA 4KDLB 1ILQA 1VQMA 3N20C 2AL6A 2FCQA 3ZJTA 1OO9B 3CSFA 3K7UC 2XRSD 1EY9A 5M3FH 2I0QA 4N58A 4MT5A 1EQVA 4LK0M 1QUQA 5M3FG 3MXNA 3RNUA 4JI2L 1N62A 1SMXA 5EPJA 1QCBD 2D5GA 2G1EA 4RMAA 2XEWA 4HEDA 3U9SA 1Y8NB 5M5WB 2D5DA 2GBJA 1DXMA 5CV8A 3GTPB 4KK7A 1TJEA 1LACA 2NN6I 3KWLA 5EE9A 4OZCA 1RIPA 1STHA 4POFA 3N30A 4MELA 4A4IA 1YHQA 2KJXA 1R4MI 4RHSA 4DUYQ 2F0QA 3GTOH 1I7HA 4BXXG 3KLSA 2TMPA 2L52A 1ZDVA 3RT3B 1EIYB 2PVOD 3NSWA 3DVGX 4ZRKA 2RA4A 2BWES 3AU4A 1W2BA 2Y5CA 4X3TA 3PIOA 2UUCQ 1SSNA 2KEDA 4GDLA 1IBKL 2AL3A 1H9JA 4GNXB 3PO2B 1V8CA 2LEKA 2ZTCA 1C76A 3L54A 4M8NA 5BYQA 4C00A 1DM0B 2KC1A 1A2TA 3NENA 1PQSA 2KFKA 4QIWB 2HDMA 2ZT9C 5L37A 1XTCD 2EOTA 4H02A 2Z6BA 2L0TA 1M90C 3U9OA 1FL0A 1WY8A 3NTKA 2MJ3A 2KX3A 4IC7B 2L5TA 5J39A 1KDAA 3HOUH 4MSQB 5FO9B 3JAML 1FO4A 4WQOB 3GTJH 1WFQA 2JWZA 2ZJPA 1WGDA 2I46A 2XGTA 2JUOA 4RGOS 1LTID 4LF7Q 5AJ3Q 4K0KQ 2WLBA 3Q14C 1K9MC 4BY7G 3K9OB 1QOBA 1WTVA 5C2TB 1HQRD 3E9HA 4AYBG 1E8WA 3PRMB 1LLRD 3R7QA 4OWTB 5CV6A 1C48A 4W9LA 3ZYYX 5GXGB 2F0LA 4U673 3HKZE 4HCSA 4JI2Q 4OVVA 2D9UA 1KFYB 1Y56A 1BOSA 3LWUA 4K2KA 1YNNC 3V05A 1E6EB 3TP7A 3GTGB 5K36H 1HTPA 1KIXA 2QHOA 3KLRA 1IPGA 3SDLC 4HIMA 1RFAA 1TU2B 2E2JB 1STGA 2WXHA 2K5VA 5E6OA 1K0RA 3Q3FA 5K36G 3MXGA 1Q8IA 5C4XB 1LT6D 1Y1WG 4FVMA 2HE7A 1CZGA 4KVGB 2YU9B 4K14A 2EJGC 1A63A 2HD5B 3AE9B 3ZVVA 3S1MB 1B50A 1FRDA 1JWAD 3R93A 2DWQA 2F0NA 1N34L 3QIJA 4CDCC 1HXYD 3H91A 3E9IA 2WB1B 2NVYB 1BMLC 2VL6A 3Q22A 2KANA 2WXFA 1B9MA 1I6HH 3R3OA 1GKHA 3HOZB 3IT4B 2CHZA 1J9OA 1NEKB 4UY8C 1CFMA 1UNSA 2I5LX 4GN5A 4G50A 2D3GA 2X69A 2N9EB 2M9VA 1VQ8A 2XNAC 1B9RA 4I7ZC 1SYBA 4Y7NB 1WXVA 1C78A 2GRIA 5ELFA 1T0YA 3H15A 3ZQ4A 1JQ4A 4APVA 2MUYA 1VQ5A 3Q8FA 1NYQA 5FJ8H 4HWIB 4EZKA 1E1TA 4DR6L 2MHJA 4ZUJA 4C3IG 4MGYE 3TJPA 3HUIA 4PS8A 3DHGC 2IHEA 2F0SA 1YVCA 5FJ8G 1Q81C 4B3RQ 1R4NB 4S3SA 3Q3OC 4JQWC 1BCPD 1RL2A 4JI1L 2RPVA 2BDNA 1LFDA 4M02A 1PH3A 2BA1A 2K32A 1IYUA 1DOLA 2YYZA 5I9PA 4DNRB 2MP2B 2SAKA 4ZRIA 4GOPC 1EFWA 2WNMA 4LJPB 2K01A 4YTNB 1EYAA 2H5XA 3NUHB 3BK1A 3E9SA 3NP8A 2QW7A 2PE6B 1XO3A 3DHHC 5IP4D 3ZNID 1STYA 2PTLA 4K7UA 1BKBA 1RTOA 2B2TA 1FFVA 2B8GA 3AI5A 5HURA 3IVFA 1MHXA 2EELA 3FILA 4P7IA 5D65A 3HHMA 2JPHA 3PGEA 4DNTB 1WWTA 4CGYB 3K5NA 2ATWA 2J7ZA 4YCUA 3S2HB 2KACA 4P1CC 5ELOA 1EYDA 4DXAB 2A5HA 2BA0A 3OG5A 2D62A 4X57B 2G4DB 1XJVA 2KHSA 2JA7H 1K73C 1N34Q 4DR7L 2KYWA 1X56A 1HA5A 4O2DA 2JWUA
chains in the Genus database with same CATH topology
3HOXB 4HROA 2BS3B 4YWGG 5AUIA 3R8BA 1J8IA 2WXJA 1AZQA 3S1QB 4B9WA 1LT3D 1V1PB 2DYMA 4IKGA 3J81L 3W2DA 4K6LA 4A6QA 5EBDA 3TZUA 3IAYA 4OIJA 2JQRB 1BO0A 1UWMA 4HR7B 2NWGA 5IT9E 1STAA 1VDZA 2JA6B 3SFEB 3TP8A 1NR4A 5C3JB 1N60A 1CJEA 3X3NA 5EE1A 4JBWA 4C3JB 4IUVA 1KDBA 3OMGA 4XYQA 4KKTA 3M4YA 2ZXOA 1L0YB 3W5VB 2Z4HA 5G5GA 1JWBD 3K0YA 4DFAA 4L1BA 1F9RA 3D4DA 1IL8A 3NTIA 1LT5D 1JOKA 5KRUA 3U7ZA 2N9KA 2NBFA 1DCZA 5M3MB 2IL8A 2JE6I 4ILWA 3AB5A 2LHDA 2EDGA 1DOMA 3VR8B 2B63B 2HDEA 2KMMA 1RWSA 3GO5A 4N9TA 5JEAJ 1SEBD 4IFDH 4CJ1B 3RD4A 2NMQA 2F0UA 4KGTA 1D1IA 1GB4A 3A56A 3NE5B 2WXNA 5CC4A 1T3QA 2WXOA 2QMTA 4IFDG 2KAJA 2INNE 4YTMB 2DNEA 5CV5A 2K28A 4XDXA 1SYDA 3J80L 3WDNA 4RCNA 1JOOA 1SNPA 2WDQB 1JC7A 2JXMB 2I07B 4RGMA 4ZQ3A 2HCCA 1F9QA 2H88B 1DZ1A 3P20A 3P42A 1RFKA 1VDVA 4TRDA 2LKVA 2JXTA 1TVXA 2CQAA 3HOVB 1TIID 4A3GB 4GDLB 1F0ZA 4C80A 2B2WC 2F0EA 3DWPA 5EKKA 4JE3B 3R2TA 3Q24A 2F0DA 5DEHA 2XIWA 3N6RA 3Q0AA 3U2SC 1RM6C 5G3LD 1FNUA 1TS3A 1SIJA 2F0KA 1TWGB 3GV6A 3L7ZC 2WIIB 4G7OC 2RVLA 2EYOA 3AB9A 2JP1A 3OIPA 1PZJD 4IZ8A 3FPPA 3R2IA 3QB3A 4FXDA 1AW7A 4K8IA 4V0BA 4KHVA 3NBHA 2VZKB 2WKCA 1SNDA 2SNMA 3KWVA 1F2LA 1H9MA 1PRTB 3QJYA 2J42A 2FUG1 3BVMA 3E5SA 2VXWA 3BG3A 4HSPA 3S16B 3D3RA 3DEPA 2KN4A 5D3DA 2WXMA 1VR9A 3AE6B 3M3YB 2ZXRA 4FXKC 4V190 5ELDA 2PQEA 3ZJVA 4NP5A 2EPBA 5K5PA 5A2QL 3T53B 5A35A 2ENBA 1Z47A 2A68D 2HQEA 2E2IB 5I2YA 3T3NA 4O42A 5TSSA 4G4KA 2PYKA 2X38A 1W6JA 1PTOC 4FF1A 2K5PA 3J81E 2PZUA 1B4OA 1WTRA 5JVH3 2BW2A 2Q8IB 5BN3A 1TWFB 5CMDA 4C3JG 2VB2X 4DA2A 4H7BA 1K50A 1SNMA 4L23A 1C9FA 1BDOA 2F0PA 1AWDA 1O78A 1ET6A 1EZ6A 2EKIA 1QF6A 1F2RI 4B9XA 4EE2A 3CQZB 2A74C 3DMUA 2JZPA 4R3DA 3I91A 1L6VA 2M0AA 2AQ3B 1CTMA 2MJEA 3P4RB 3M7GA 4MIUA 5BYSA 1EIHA 3PUVA 1QNUA 1SMYC 1E9MA 2SNSA 3HS0C 3A8KE 2OHFA 4HJGE 4ZOHC 1PFNA 3FC4A 1K8MA 4KN7C 4YSXB 4LK1C 2B8FA 3DWAA 3C3LA 3AH7A 1LTTD 3Q6SA 3OHXC 3SR1A 2M2LA 2ONQA 5HGTA 5LNK1 1B2TA 1NYRA 3PO3B 2EE1A 2KVMA 3HVDA 3GV3A 3OPOA 1MI2A 1PGBA 3AEAB 1L5PA 4XWTA 1C4QA 2R61A 5C0XJ 1PDQA 1TWCB 3GTKB 1ZYRC 1EU3A 3AE4B 1YNJC 5IOCA 2EY5A 1S5BD 1X3PA 3NVVA 3VRBB 1IUEA 4G7HC 5IGCA 2ID0A 3A7LA 3CKIB 1S5DD 2WACA 1ACCA 2C9OA 3A8IE 4RA8A 5CR3A 1Q12A 4HKQA 1HZ6A 2FINB 4UDUC 2MEKA 1LO5D 5KNDA 1HZ5A 4DXGA 2XWBB 3D4WA 1PXUA 3MEHA 4IUQA 2Z1CA 4BY7B 3W5UB 1TQOA 4RCOA 1G91A 4AYBB 2WINB 3MJ5A 3A55A 1HHVA 2WQYB 2R6GA 1XXGA 3SFDB 2MJDA 2RSOA 3NZ3A 4QMGA 1EFID 2F0JA 3SR6A 2A6HD 2B76B 2IGDA 3TN2A 2B2UC 1ZXTA 1Y1WB 4MACA 3HGBA 1QOAA 2I2YA 2NN6H 2Y3AA 1SYFA 1STNA 3MFYA 3N9YC 4KN4C 1E0ZA 2NN6G 1RJTA 3OIQA 5I6YA 2X6GA 4RHRA 4FXGC 1JOQA 5COYA 4YTPB 3PIO3 3P7JA 5DM63 1FMAD 3HP3A 4OL7A 4RAUC 2LMCA 4OHJA 3BVZA 1R7SA 3IXSA 2C5CA 3CHBD 2E3TA 2OF1A 1AFPA 3X3MA 3I57A 5A2QE 3CU7A 4IN3A 4C3IB 1YN5A 3NWTA 1U9RA 4YSYB 1VCIA 2K3UA 2HCIA 4KKUA 1GUWA 4JPSA 1I50B 2Q8RE 3BDLA 1SE2A 1QNKA 4BWGB 3FKIB 1RCVD 1TZOA 2N0SB 3IFDA 4HRSA 3NXWA 4C56C 4N6EB 3AE3B 2QEJC 4G57A 2K5QA 4KKJA 5C44B 1WTOA 3D8GA 2WP9B 3BS1A 5D3IB 3NVWA 1QILA 1U4LA 2I38A 1VRAB 1GUNA 5I2XA 3LX0A 1HPCA 3PMFA 2M00A 1RODA 1MVKA 1Q1BA 4XTCS 2WS3B 5T1IA 1SYGA 1WSPA 3W1SA 2F0GA 3BIID 4ZKCB 3KF8A 2OEOA 3AEDB 2B2YC 2NVXB 1D2BA 2A69D 4NKLA 5BYRA 3S17B 3QOJA 1XEEA 2EJFC 1KRHA 2W3SA 4C7ZA 1LTAD 3ZJUA 2CHBD 2VNUD 2H4OA 2PZWA 1ET9A 5ELCA 4ABNA 1E0BA 2JSVX 1DOIA 1Z7TA 3GTQB 5JOBA 1C4AA 4KKSA 4A3DB 2RDFA 4X3KA 5JJZA 3K58A 4HCEA 1LABA 4CKBA 2FMCA 4NMZA 1RF2D 4U68A 1E2VA 1LT4D 1G8ZD 3MVVA 2RDGA 1L0XB 1XWEA 4LAAA 4ZRQA 3B9JA 1EWHA 2WU5B 3ND9A 3S1NB 3GD7A 3Q69A 4ZHOA 3EGRA 2H89B 2IWHA 4WFN3 3NRZA 1BF4A 1ILPA 1ENCA 2EJMA 4WAFA 1Q1EA 1D1KA 3LXFA 1O7ZA 4CHTB 4F87A 1UGJA 4KHZA 4K2LA 2HUGA 3SK4A 2DYOA 1JORA 1BCPB 4K5VA 1XLQA 2MGSA 1R9TB 3L9AX 1DYQA 2K03A 1FGBD 1TY0A 1PTOF 1H9SA 1HFGA 2KUMA 2RSNA 3I8ZA 2A6EC 2V3NA 3K59A 1ZOYB 5JVG3 4A3JB 5IGBA 1SYEA 1BUVT 1FD7D 1PRTF 1YNTE 1D5XC 1LTRD 1HCZA 3ERQA 1IKLA 1CQVA 1JICA 3Q23A 1UUPA 3NTHA 4OZBA 3H94A 4KMUC 3MAQA 1SE3A 2L9HA 3T16A 2FFKB 1YNND 3O13A 2X6LA 2FBWB 1A3TA 2V0GA 2GB1A 4FNFA 4ZLTF 4XIGS 4RGTA 5KNCA 1JWMD 1JMLA 2HTME 3TDQA 4TMAB 3TEWA 1JQYD 1RD9D 3AE2B 2ICEC 1CHPD 1EYCA 4KI0A 3NVYA 4WIPA 3I4MB 4BBRB 5FLXE 4DK0A 1QKZA 1QT9A 4YT0B 2TSSA 1F2MA 1VF7A 1JR0D 2EYMA 1HQMC 2G9DA 4N59A 1NENB 2LHEA 1E2WA 1STEA 2QCPX 4TQ1A 2XN9C 3DWQA 3WCQA 4R8NA 3VA7A 4A3BB 1GAQB 2WAQB 4J1MA 4YSZB 2L1AA 1CQFA 1JW9D 3HOWB 1SAPA 3D6CA 1I4QA 4PMWA 4LLGM 3T56B 3RPFC 2BBCA 4DAPA 3LB8C 3AE5B 4FXCA 3P4QB 1J7CA 1NR2A 3FMCA 5JAVA 3Q8CA 4KX6B 3KQ4A 1DONA 1K83B 1FIQA 3C1EA 3C2PA 1SYCA 4QUCA 2LS01 5E3FA 1LTBD 4C3HB 2F0HA 2V4DA 3TZDA 4ZKBB 2VB3X 2RMMA 4OZAA 1GPXA 1Y8PB 4IUPA 5IGFA 3H8HA 1EY0A 2NZ1D 3EJIA 3VYRA 4NJCA 2L0CA 4IDIA 1VZ7A 2PKOA 2LMCB 1SF0A 4REZA 3DWGC 3S2DB 4HAEA 4USAA 4NW2A 5BMIA 3V2TA 4US9A 1M4VA 2K05A 2O5JC 2WV6D 4J3OD 1BXTA 3SE0A 4OO1G 2EY2A 2W55A 4XT3B 2N88A 3RZOB 4FP5D 1XCTL 3KK7A 3BK2A 3T51B 1DOXA 3NVZA 4XQJA 3H6MA 3D4RA 2B2UA 2CJNA 2F3WA 4HSVA 1ZXHA 1A6XA 4L2YA 4QCLA 2IX0A 5FR3A 1IW7C 2R7ZB 4WWMA 3T13A 1LV9A 2OEDA 4R8IA 3JAME 4B0EA 1JRPA 3TEZA 3CIRB 3IT6B 1JE4A 1W6KA 3VYTA 5IGGA 1Y69U 4ZRPA 1YN4A 1SNCA 3TEXA 1EY5A 4M0WA 1ZKOA 2BB6A 3J7YW 3FDTA 5CBAE 1FCCC 4I65A 1PLFA 3AEEB 3OSOA 4FO2A 3LNNA 2B2VA 1BQQT 3DXJC 1TYGB 1WCMB 1GHJA 4K5WA 1WD1A 1NVID 2N7JA 3MA2B 4TQUS 2V3PA 2M56B 3I72A 2JYOA 3SK8A 4HEA1 2IJ0A 1LTGD 3I73A 2G9HD 1EL0A 2KOLA 4MN3A 4Z9CB 2DY8A 3IAM1 4OO1I 3ONAB 4X3SA 3PUWA 1UWXA 5I9OA 2BDOA 4OW0A 2JA8B 5HFYA 4WH4A 5C5LA 3QOLA 4Q0FA 1G2SA 1U4PA 2Z8LA 1GHKA 4XT1B 4ARIA 4FF4A 3P4PB 4WRDA 1RTNA 2RBMA 1GB1A 2QJLA 4EQNA 2R93B 5C3EB 3RZDB 4NDXA 2H1EA 1WTXA 2BE5C 1IKMA 3AM9A 5LL6S 1I4HA 1H9SB 4K5XA 2XWJB 2QILA 5C5MA 4GZYC 3V96A 2QSDA 3FAHA 2OXPA 1T5EA 1IBXA 4C3HG 2SEBD 4P6VF 3TBIB 1K8OA 3ABVB 4EQOA 3T4AC 2JEAI 2L1BA 3FPUB 2CJOA 2WXQA 4HN7A 1A70A 4ZHPA 4ZUIA 1DOKA 1ZDXA 4YIJA 2WXKA 2BCOA 3KUPA 5E1FA 2JYEA 4IUUA 1ZPSA 3K7AB 2WP8J 4QUFA 4L63B 4KJOA 1PGAA 1IGDA 3MP9A 4A93B 5EE3A 2KCNA 1ROEA 1C4CA 5AUKA 1SB3C 1GUGA 1KDCA 5EGTA 1PRTC 3C8YA 2K5DA 3G6JB 3OW7A 3P63A 2EVBA 4HMIA 4L6TB 1F2ZA 1BNZA 1T5XD 1TS4A 5HHDG 3PUXA 1PTOD 4CQNA 3AEFB 1ICWA 5IIFA 3FILB 1EY6A 4JWSC 2R92B 3MHBA 4KGSA 1DGJA 3I9V1 1I4GA 5JEAH 2EZVA 3D6WA 2PMVA 3S14B 2F0FA 4N9PA 4US8A 5JEAG 4TQ0A 2WXRA 3MWYW 1TS2A 2KQ3A 4BY1B 5EPKA 1BCPF 2EYJA 1YQ4B 3QG1A 1H9RA 1S5FD 1OFFA 4C2MB 4MH8A 4KTAA 1JROA 1FXAA 1STBA 3AEBB 1E7PB 1SMYD 2PW9A 4AS1A 4Q5VA 1JALA 1CZPA 1JWSD 1SFOB 1V97A 4L8JA 4XQQA 1BUIC 3J80E 1K51A 2K22A 2J52A 3PZ7A 2B2TC 5KEEA 1GJXA 2F0MA 4J8QA 4ZAIA 4WORA 3BDOA 3N52A 2E74C 3UI3A 3E0JA 3V3XA 1SSOA 2KCCA 1QWYA 5CV7A 1XLOA 2K33A 1FXIA 2R3ZA 3H0GB 4WJWA 1ZYRD 2HDLA 3PO0A 3MTSA 1YNJD 3K5LA 4RGNA 3MHZA 1TKWB 2NTSA 4F7XA 3AE8B 2GA4B 3QIAA 4A3FB 4D2KA 3AU7A 3CRKC 2DLBA 2WXIA 4CJ2C 1G6ZA 1VJKA 2D2CC 1TT2A 4A8XC 3NUCA 1KNAA 4FYDA 1WVLA 2LUMA 1BBXC 2A73B 5EKLA 1QOHA 3UI2A 1II3A 4ODGA 1N63A 1OXSC 1TS5A 4OGQC 2K0PA 3BZDB 1X3QA 2ZW1A 5EE0A 4HTHA 1I6VC 4QB4A 2LJIA 3AV8A 4DGZA 3EA6A 1RYJA 1D5ZC 1MSHA 1RDPD 5M5XB 3TSSA 1L0VB 1H9KA 3G7LA 1IGCA 2E6XA 1JCKB 2WDVB 1F2YA 2NUCA 1V1PA 1U4RA 2MP1A 2N9LA 3KLSX 1CA5A 3URYA 2KWDA 1HTLD 2WKDA 1EM7A 1MPEA 2KDMA 3NHHA 4ME5A 1PGXA 2FMMA 1Q3LA 3M4OB 5BMHA 2L12A 1G2TA 5BN5A 1J7AA 4FF2A 3MXPA 4IUTA 4KV6A 1PYWD 2AQ2B 2JEBI 4DAVA 4KY6A 3EUB2 4XYOA 2BB5A 1AZPA 2FE8A 1P7EA 2Q5WD 1NCVA 1ZP0B 2PPBC 4ARCA 1LTSD 1Y1VB 3HOYB 1B1ZA 3A7AB 5G3LF 3HZXA 2B2WA 2F0WA 1QOFA 3BVGA 1ONLA 1IYVA 2XVSA 3S9WA 4IALA 5C0XH 2PZTA 3NPPA 4RH6A 5C0XG 2IDYA 1TKYA 1I4XA 2WU2B 3Q8EA 5IT9L 3GTMB 2IPKD 5KYLA 1EY8A 2BOSA 3EROA 3W9CB 1A3UA 3J9CA 2DNCA 1IHZA 1QQRA 2E2DC 3H3VC 5DAUA 3L4PA 3K5MA 3EVQA 4RWSC 5ELEA 2NVQB 4GDKB 4B08A 3IKJA 1JWUD 1PDXA 3VRAB 2K7VA 1E2ZA 4R9WA 1TR5A 4CBVA 1PZKD 3HG9A 5M5YB 1VMCA 1FNWA 1SNOA 3VR5A 1VZ8A 2RKSA 1XYIA 4IURA 2L32A 5J1ZA 1T6BX 4A3KB 4G7ZC 3KBXA 1A2UA 2E75C 1GUTA 3ITPA 3VYUA 2WXLA 1FCLA 2E2HB 4NAMA 4BBSB 1N61A 1EY4A 1A15A 2JU6X 2F3VA 1QB5D 3L3OC 3AEGB 1RHPA 5BMGA 2PW5A 5CYUA 4XWWA 2F0TA 2NB0A 5EKIA 2NTTA 1N5WA 1NUCA 5KYIA 2EY6A 1V8QA 1AYFA 1VF5C 3SXHA 3SK5A 1GUSA 4IFDJ 3K57A 4WURA 2KECA 3C1FA 3MC0B 1DD2A 3Q8BA 5E4XA 4M1UB 2PO4A 2A6ED 5D7GA 5C0XI 4ZRZA 2O2LD 1MBYA 1D5MC 2PMZB 5FKAC 1BCPC 2NYZD 2W82A 3OWFA 2KEEA 1OXXK 4KY5A 1K52A 1GXDC 1KLGD 2L55A 5CGKA 1L4DB 1EIGA 3NK9A 5AFWA 1C79A 4IOIE 2ON8A 2IX3A 5H8YE 1FFUA 2PNRC 3BYYB 3A54A 2MH7A 1FM0D 5JPNC 3OWEB 2QIEB 5KNBA 2ZXPA 2YEPB 2IT1A 3I70A 2M19A 5C4ZA 3MXUA 1FYCA 3WOFA 5E4WC 4YXDB 3ZGZA 1OXUA 3HRDD 1MD2D 4LJZC 1ZE3D 2F4IA 3B2GA 1Q90A 1HEZE 3NWSA 2SOBA 1I4RA 1EQTA 1TWAB 1F2RC 4DN4M 1HRJA 3J7AV 2LFIA 3GQBA 3U52E 1TWHB 3TEYA 4H2AA 1A3VA 1X32A 1MGSA 5CORA 4FF3A 1WD0A 1WYGA 2PCFB 5C3WA 2J53A 2LY7A 1WTQA 5LHY1 1PFMA 3I90A 2O4XA 4XXEA 4MM3B 1C8CA 5BN4A 3ETRA 1J7BA 4OO1H 3FEWX 5E6JA 2QDBA 1SJED 3DWMA 3S1RB 1VLBA 2JYTA 5IGDA 3QO2A 2IX1A 4BA2I 1UAPA 4JK1C 4PNYA 1DJRD 2KA7A 1XLNA 1S5ED 4EGVA 4H44C 3T3OA 2BT6A 2DBYA 3VR2A 5NUCA 2ICIA 3D31A 4IUNA 1F77A 3I3CA 1ZUD2 3HKZB 1OQRA 2AQ1B 3NQTA 5JXVA 1YJIA 1AP0A 1RKNA 4B0MA 1P7FA 2WXPA 4J6HA 3MFGA 4PMBA 3BDCA 1VMPA 1L6UA 3P75A 1Z6HA 1CA6A 1KNEA 5ISRA 3TP5A 3BWUD 4XQNA 2KQ4X 2L11A 4OVZA 4JWUC 1E10A 1VZ6A 2BS4B 5DNFA 3MZ5A 4PQXA 4QF4A 2F1MA 2BYTA 2F03A 3AN1A 1NAPA 4C1NK 2EY1A 1IW7D 3J7AF 4CKEA 4P2CB 5LL6X 2PLPA 1S5CD 4RKBA 5D14A 1B44D 2RDHA 3M7NA 3IL8A 4OIKA 5JPMC 4A3MB 4XE0A 3SDZA 1D4BA 2BS2B 4M8AA 1R4QB 3EQLC 2PW7A 5HG2A 2E76C 2K6AA 3I4NB 4A3EB 3GP7A 1HFNA 3LWEA 3GS2A 4C7YA 2LGIA 1O7YA 3TUOA 3GB1A 3EFXD 1MHHE 2EXZA 2IGGA 4LMQD 1SXTA 3TMEA 4KKIA 1HUNA 4RFBA 2IGHA 1U4MA 3BYTB 4A3IB 1B3AA 1C77A 1SJHD 4ZK9B 3VR6A 4BA1I 1HA6A 3PUZA 1KAAA 1WTPA 3AE1B 1GUOA 3A8JE 5FK9C 4P16A 1KABA 4UAIA 2B2YA 3DUZA 1QE6A 4A9AA 2DN8A 1EEID 1WRIA 5EQ0A 5M9OA 4NAWB 1M8AA 4EVOA 2QF7A 2VUMB 4DAYA 2GI9A 1FR3A 4HMJA 2F0IA 3RUZA 4TKOB 3AMZA 2JX5A 2OT2A 3SVMA 1PTOB 2AWNA 1QJOA 3SK6A 1I3QB 5FO7B 1XCQL 3IAS1 5IGEA 4DQOC 3K6OA 2K1BA 1BR9A 2CU3A 1ENAA 4C1NI 1I4PA 2A68C 5EPLA 5H92C 4GLSC 5I4DA 2BE5D 1PFBA 4ID6A 1YMHE 3K5OA 1MSGA 1PFDA 3HVZA 1XX8A 1FD6A 2JA5B 3S15B 3E56A 3LYYA 1G291 4AQ7A 4HKZE 1TKEA 4TSSA 3HEJA 2AX5A 1PUTA 4RF0A 4IFDI 1XF5L 2Z4IA 1WXQA 3Q8AA 1SNQA 5KGUA 1NI3A 3WOEA 4BS9A 4MHEA 1QLBB 2CVRA 2MHVA 2ZW0A 3HRZC 5CV4A 4RKLA 3SHLA 1PZID 5I6WA 3C46A 3P1HA 4KGRA 1B53A 2RQXA 5T1GA 5C4JB 1F9PA 2F0OA 3PUYA 2VZKD 1AEXA 2O5IC 2V4IB 3VR4A 2J4XA 2NVTB 4A55A 1HUMA 1PRTD 1C4PA 3F2UA 2XSCA 1CZWA 1FEHA 1EZ8A 4PMCA 1EEFD 3NS1A 2EYHA 1SE4A 4RNAA 3RFZB 4CKCA 2EYLA 1F9SA 3OOCA 2N55A 4DF7A 1ESFA 1OXTA 3DHQA 2Q8TA 3GTLB 1KTKA 3AECB 1OQQA 4CJ0B 2PIAA 5M3FB 5HI1A 3DM1A 2JSOA 4DU9A 2XRQD 4WQMA 3NQIA 1CK1A 2K9XA 1V1OA 4KD4A 1K53A 1N5XA 1EY7A 1OXVA 1TY2A 4NZLB 1JB3A 2Y5PA 1CI3M 4A90A 3QWNA 3SEBA 4ITKA 4ZYSA 1ML0D 3NBIA 3GTOB 2PVGC 1ESRA 1MI0A 4H13C 4EQPA 4K6DA 3PIP3 1WTWA 4ULLA 5C3XA 2FHTA 1QG7A 5FOBB 4F88A 5DM73 2DY7A 1KF6B 3CRLC 2A6HC 3U4EG 1ENFA 2K04A 5G5HA 2BTEA 1O80A 3OMCA 4LTUA 2AUKA 1L4ZB 1V43A 1WGKA 1D6EC 3HOUB 5C6AA 3GTJB 3FVQA 5CBEE 1GOZA 5MPOA 1PTOH 1B9NA 2W3RA 3W3AA 1QOGA 1S4ZA 3VQIA 2CW0C 3TP6A 1KLUD 2YEPF 1CT1D 2EYPA 3RMHA 5J22A 5CV9A 2Y0SB 4XDDA 2MPMA 4H0LC 1FRRA 4K8JA 1EOTA 3IFTA 1CM9A 4E6IA 3VR9B 3KBGA 4IQZA 4DK1A 1AN8A 5T8IA 2B39A 1O7LA 1XLPA 4JX1C 4KJNA 3PZ8A 1R4PB 4KY7A 1NSNS 2AUJD 5IODA 3ND8A 2CW0D 2WDRB 1DOYA 4DXFA 4X3UA 5FLXL 1PMRA 1I6HB 4Q2JA 2EYFA 4PV1C 1EWYC 1YN3A 5ELBA 3CWIA 4KD3A 3I4LA 2W54A 3H09A 3DEOA 5EJWA 3P1MA 1YQ3B 1KH0A 2B2VC 2L83A 2WXGA 2J0TD 1EU4A 3AMUA 3B2FA 2LFNA 2K5WA 1TKGA 2ACZB 2IW3A 5C4HA 2QKIC 1ZXIA 3FRPB 5FO8B 2L4NA 1EWCA 5EBCA 1CHQD 4F8MA 4XDCA 2FJ2A 3VR3A 5KIXA 3RLFA 2A69C 1IBXB 1ZEQX 1FNVA 1Q10A 3P4SB 3VYSA 3VA5A 3AE7B 2F0VA 2MJ8A 2INPE 3E6ZX 4RF1A 1SBBB 5F2DA 3PV0A 4PT5A 1Y8OB 3M85A 1SDFA 1UEAB 4O1NA 1YJJA 2SDFA 2JA7B 2AWOA 1ILQA 3ZJTA 1OO9B 2XRSD 1EY9A 4N58A 4MT5A 1EQVA 4LK0M 2G1EA 3MXNA 1N62A 5EPJA 2D5GA 1QCBD 4HEDA 3U9SA 1Y8NB 5M5WB 2D5DA 1DXMA 5CV8A 3GTPB 4KK7A 1TJEA 1LACA 2NN6I 3KWLA 5EE9A 4OZCA 1STHA 2KJXA 4RHSA 2F0QA 1I7HA 3KLSA 2TMPA 2L52A 1ZDVA 2PVOD 3NSWA 2RA4A 2Y5CA 4X3TA 1SSNA 2KEDA 1H9JA 3PO2B 1V8CA 2LEKA 1C76A 5BYQA 1DM0B 1A2TA 4QIWB 2HDMA 2ZT9C 1XTCD 2EOTA 3U9OA 2MJ3A 3NTKA 2L5TA 5J39A 1KDAA 5FO9B 3JAML 1FO4A 2I46A 4RGOS 1LTID 2WLBA 1QOBA 1WTVA 5C2TB 1HQRD 1LLRD 5CV6A 1C48A 5GXGB 3ZYYX 2F0LA 4U673 4HCSA 2D9UA 1KFYB 1Y56A 1BOSA 3LWUA 4K2KA 1YNNC 3V05A 1E6EB 3TP7A 3GTGB 5K36H 1HTPA 3KLRA 1TU2B 2E2JB 1STGA 2WXHA 5K36G 3MXGA 1Q8IA 5C4XB 1LT6D 4FVMA 1CZGA 2YU9B 4K14A 2EJGC 3AE9B 3S1MB 1B50A 1FRDA 1JWAD 3R93A 2DWQA 2F0NA 1HXYD 3H91A 2WB1B 2NVYB 1BMLC 3Q22A 2WXFA 1B9MA 3R3OA 3HOZB 3IT4B 1J9OA