1LO5D

Crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
233
structure length
233
Chain Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIAIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a SEA Variant in Complex with MHC Class II Reveals the Ability of SEA to Crosslink MHC Molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 54
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lo5D01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1lo5D02
1SE2A 2QILA 3OWEB 1G8ZD 2XN9C 3O13A 1PRTD 3URYA 1JWSD 1PTOC 1PTOF 2AQ1B 1F77A 5FKAC 1LTBD 1UUPA 1LTRD 4BWGB 1XTCD 1KTKA 5TSSA 5I4DA 3MFGA 3DWAA 1BXTA 1I4PA 1D6EC 1RF2D 4NZLB 1EU4A 1FGBD 4UDUC 4TSSA 4C56C 1ET9A 1SJHD 3W2DA 1JWMD 1RD9D 4O1NA 1CQVA 1JWUD 3MC0B 3DWQA 4Z9CB 1V1PA 1JR0D 1PRTF 1PRTC 1YN3A 1YN4A 5ELCA 1I4QA 4L6TB 2IJ0A 2XRQD 1L0XB 4RGMA 2SEBD 2TSSA 2RDHA 1EU3A 1KLGD 5D3DA 1CT1D 1AN8A 1LT4D 1LTAD 1FNVA 1S5BD 2R61A 1V1PB 1D5ZC 5ELDA 4RFBA 5ELEA 5ELFA 1DYQA 3GP7A 1TY2A 1I4GA 1CHQD 1SBBB 2AQ3B 1EEFD 1LTID 1DJRD 1PZID 4OHJA 3BYTB 1AW7A 1TY0A 2AQ2B 1SJED 1MD2D 5ELBA 4DXGA 1I4HA 1TS3A 1ESFA 2QEJC 1RDPD 1TS5A 1UNSA 1JQYD 1L0YB 1S5DD 3BVZA 3CHBD 3EFXD 4K6LA 1S5CD 1V1OA 3R8BA 1EEID 1BCPB 1QILA 1I4RA 1ENFA 2RDGA 1SE3A 2J4XA 5D3IB 1HTLD 1LTSD 1PTOB 1B44D 2NTSA 1PYWD 1HA5A 2NTTA 3BZDB 1CHPD 1S5ED 2CHBD 1D5XC 1JCKB 2ICIA 1LT3D 1M4VA 1EWCA 1ET6A 3BYYB 4RHSA 1D5MC 1FD7D 1PZKD 3BVGA 4RGOS 3EA6A 1KLUD 3TSSA 1RCVD 1TS2A 1S5FD 2O2LD 3SEBA 2G9HD 1B1ZA 1TS4A 2WV6D 2IPKD 1CK1A 3DWPA 1PZJD 1SE4A 4RH6A 4L63B 2XRSD 4DXFA 1EFID 3R2TA 4ZYSA 1FNWA 3V05A 3BVMA 1PRTB 1LT5D 1LTTD 1FNUA 1BCPD 1HQRD 4RGTA 1YN5A 1PTOD 1T5XD 1HXYD 2XNAC 1PTOH 1XXGA 1GOZA 5FK9C 1LLRD 1LT6D 2Z8LA 3KLSX 1I4XA 1SXTA 1SEBD 1LTGD 1BCPC 1BCPF 4RCOA 1LO5D 1STEA 3R2IA 4RHRA 4RGNA
chains in the Genus database with same CATH superfamily
1BT0A 5I6YA 4W9IA 3DVNU 1E9MA 1WJNA 4JI8Q 1SNCA 1TKEA 2ASQA 1WCMH 4POFA 4YT0B 2ZCCA 4QQBX 3U7ZA 3I4LA 3E0JA 4KGRA 1WJJA 2JPHA 1A62A 4XX5A 4BBNF 3HOXB 1WGKA 1I94Q 3TEXA 2K5WA 2YEPB 2P5ZX 3G4SA 3WWVA 2DX5B 3K57A 2HT1A 3Q0AA 3V61A 5M3FB 4IOAA 4FYDA 2N1WA 2BDNA 3Q14C 3F2BA 5M3MG 5C3JB 4Z9CB 2KK8A 4OWWB 2QW7A 3ZKJC 3C8YA 1VQ4A 3M63B 5D7GA 4DV6Q 3N6RA 2Q2HA 4L6TB 1S1QB 2M9VA 1IBMQ 3HKSA 3JVZX 5IN7A 1KLGD 2VQFQ 4PZ7A 2MP2A 1VQIA 1AFPA 2GMIC 2B2UA 2N9EB 2RMMA 3CIRB 1SAPA 2VQFL 1FNVA 1TT2A 5T1GA 1Q86C 4K5VA 2O6VA 5E3FA 4DNTB 4HROA 3ABVB 1IBML 2HDEA 2IGHA 2FUG1 4C4VA 3PRZA 4ZK9B 2EMSA 2KA7A 3PRPB 1Y1VG 2AQ3B 1I6VC 1R4PB 3A74A 3FKIB 2KN5A 4LNKA 2CU3A 1Z6HA 4RMAA 1WR6E 3HP3A 4HCPB 4YTPB 3P42A 1STBA 2ZEQA 4IWPA 5AZGA 2IO0B 1SNDA 3PO2G 4BY1G 3HVDA 3HG9A 4LMQD 4HPMB 1NJIC 2B2TA 4P6VF 4GDLA 4B9XA 4H0LC 3J7AV 1N63A 3OW7A 2KUMA 1GO3E 3IAYA 5DM63 4R4OA 2JWUA 2FIDA 1ZW7A 2RCNA 2BOSA 2F0HA 2DLBA 2LXCA 1E8ZA 3FC4A 5C3WA 1B44D 2QEXA 4MGYE 3F2DA 3BZDB 2AUJD 2KHIA 1I5FA 2NN6I 1P7FA 1O7YA 4QL5A 1HR0W 2A1AA 1A0IA 1WTOA 2OTLA 1G2SA 2V9HA 3OAWA 4AUQC 3ZJVA 4AYBB 2G4DB 2DNCA 3S2HB 2C9WB 3AEAB 4WJNA 5J22A 2AUKA 2IO2B 3PHXB 3GTJB 1Q8IA 5HFYA 3GTOH 4RGOS 4IFDG 2LGDA 2Z59B 2LFNA 4RNAA 1F0ZA 2JA8B 2J0JA 2WXGA 3ULPA 4J1MA 3FRPB 3SEBA 2KANA 2PMVA 1J9OA 1FJGQ 4JI1L 2MUYA 2OQKA 4LK0M 3I7FA 3AECB 2FCQA 1J6QA 2JK8A 3R2TA 5I2XA 1SYCA 1FXAA 1PFBA 3ZUNA 3V05A 2WLBA 2C60A 1LT5D 1O7ZA 4KHZA 1HQRD 3SK5A 4JL9A 1T5XD 2I0QA 1ILQA 3I3TB 2L55A 3NZ3A 2BGFA 1LT6D 2MH7A 4F8CB 1HUMA 4L1BA 2ZVOA 1GUGA 1JJ2A 4HMJA 3VR6A 2D62A 4DN4M 2EDGA 5FO9B 1PV4A 3KLRA 3GTLB 2O6VD 3V3XA 4RG1A 3ZDTA 5HGQA 4JYAQ 2BYVE 4IPGA 2PCFB 2B2UC 4DR6L 4K8JA 1TWHB 4LF5L 3VFKA 1JICA 3JYUA 1PTOC 4JK1C 5I9OA 1XF5L 2UXBQ 5IY0A 4YIJA 5C5MA 3DUZA 1PUTA 2LVOA 2XWJB 2JA7G 3DWAA 4OWXB 5DPRA 1B9RA 4W9GA 4H44C 4EUTA 5J18A 3L08A 4LDTB 1EFWA 1E8XA 3ZNZB 4A3MB 1EM7A 4A3KH 3OTOL 2RCFA 1PA6A 2KBNA 1TBEA 3TL5A 5D3DA 3BJUA 1X3GA 3U9OA 3V96A 3HFZB 1ACCA 4RAUC 3Q69A 4X3KA 2MGSA 2D3BA 2RGFA 1UE6A 1C77A 3HHMA 3NVYA 1C4CA 3RNEC 4MACA 1YBYA 2VQEL 5DLQE 2UWQA 4A3FB 1TZ1A 1UF0A 2LD9A 3GE8C 4IJLA 3R66C 2CJNA 4BKTA 2EYJA 1DJRD 5M5YH 3I72A 1E7VA 1TY0A 1QJOA 2Y0SG 3ULLA 4EZLA 1VQFA 4OIJA 2OTJA 2FCNA 3A4SC 4K7WA 3K81C 5DAUA 1TS3A 3D3RA 2IYDB 1ESRA 4NXNQ 3F1ZA 4LJOB 1ZGUB 3B08A 3CHBD 3EFXD 4JI6L 1RWSA 2G3QB 3ZNHB 1RODA 2UUBL 1J19A 3E6ZX 1SIFA 2WHIA 5LMUL 1EEID 3UGBB 4BOSC 2X8XX 4A3OA 4DDGD 4AOFA 3ITPA 3UDFA 3M7GA 1D8LA 4IO9A 4TMAB 3LWEA 5AUKA 4MELA 1HZBA 3RMKC 4JI2Q 4APVA 1BDOA 1TWFB 3BIID 3NPPA 1QKZA 2D5DA 3DCGA 3K9OB 4P1CC 3Q8EA 2MLBA 2MPMA 4P71A 1P1AA 5IWAL 2EY6A 2BE5D 4KIKA 4XE0A 1WXVA 4JI3Q 1IGDA 3I2ZA 2JVCA 4YXDB 5KNDA 2LVQA 1WGGA 3I5JC 4JLCA 4BAXA 1CFMA 2DYMA 4AQ7A 1PH5A 1I7HA 4K8IA 3ZNGC 3VH4B 4A3KB 2L0CA 2R93G 3SD5A 3V6EB 1J5EL 5LHY1 3CCMA 2ZJPA 2F0WA 2R92B 1H95A 1V43A 1FPYA 2WB1G 2KZRA 2ZW1A 4A76A 3EVQA 2E2JB 5E6PA 4KGTA 3BVMA 1YQBA 3TEWA 4WRDA 1SSOA 3T4AC 2OCEA 5JEAJ 3CXCA 2QDLA 1YN5A 3U52E 1N36L 2XNAC 4N8FA 4ZAIA 3DM3A 1TYGB 2CHWA 2EE1A 3CWIA 3S1QB 1V9JA 4EZJA 4C1NI 3NOBA 3G7LA 4N58A 4AJYB 1YNXA 4DAYA 4POGA 3KW5B 1II3A 1B2TA 3L17A 5K36G 4RGNA 4YWKA 1R4MB 4DV5Q 1QVCA 3SK4A 3EROA 2YYZA 3P4RB 3NUCA 1UAPA 4G4KA 4HAEA 1L6UA 4RKBA 3OIQA 3URYA 2MBHA 2K8HA 1CSQA 4LWCA 3I4NH 1UUPA 5JPMC 2X69A 1XTCD 4CHTB 1JMLA 3WOEA 3FKYA 2Q8TA 2PLPA 2RPQA 3A8IE 2W3RA 3FILB 3FPPA 1UWXA 4TRDA 1IBLQ 4JI0L 4GOCA 3VRBB 2F0PA 3H91A 3CPWA 3W2DA 1HCZA 1IYUA 1RD9D 4MH8A 4YWLA 2JXMB 3Q6BA 1PRTF 2K3UA 4L23A 2LFIA 4ZOHC 1J7CA 4KHPQ 1DOIA 2G45B 3S9WA 4A3DG 2MX2A 5E4WC 1VQEA 1CT1D 2BYFA 2XK5A 2ZTEA 4EZKA 4P74A 1H9SB 2WFWA 4A3LH 1LTAD 1EOTA 3J7YW 1BMLC 1GNUA 1JW9D 3ZTDA 1AEXA 4X65Q 4LCDE 1WFQA 1MBYA 4X3SA 1YJWA 5CV5A 3HM6X 3N9YC 1MSGA 4OVZA 4A3CG 3TQYA 4M8NA 3RR5A 1LTID 1TWGB 3A0JA 1CZPA 2HTME 1WI5A 4MIUA 1L0WA 2WX0A 4CDEC 4OX9L 4DK1A 4DV0L 1A15A 1ENAA 1FFVA 2NBWB 2L3ZA 1XYIA 2LJ5A 1DXMA 4C3JB 4O42A 4LF8Q 3SK8A 2K5VA 3X23A 3CCJA 2MHVA 2KMAA 4W9LA 3VQIA 1STGA 5M5WH 1SMXA 4P2CB 2F0QA 2V0GA 3JAME 4KHPL 1FM0D 3GTMH 4G3XB 4TKOB 3I56A 2QSDA 3A7LA 2JEAI 2PO4A 4JE3B 3K7AB 1VQKA 1PYWD 1Z47A 3S15H 1S5ED 1EOVA 3NQTA 4DR3Q 1PDQA 5BN5A 4KZ0A 1E2WA 1FRDA 3IAM1 4BY7H 5IGEA 3NS1A 4C80A 1Y1VH 1K52A 4MHEA 3BDOA 2JYOA 1WTWA 3PZDA 2BB5A 3RNUA 1WRDB 2NN6H 4WJWA 4OZBA 4H02A 4IPCA 4BZAA 3HRZC 1QZGA 4IM2A 2UXDL 1E0BA 5F2DA 1U4AA 1WH3A 3AEEB 3QOLA 4HJ7A 3C0RB 1EZ8A 4A93G 3K6OA 4S3SA 4QF4A 1TWFH 4B0MA 4HIDA 3UQAA 2E75C 3WIMA 3QOJA 5CX3A 2ZM6Q 5JJIA 3L16A 4W9KA 1TKWB 4OVVA 1MG8A 3QJZA 4DDID 3D4RA 4KTAA 2REXA 3IFDA 1I4XA 5CV4A 3WAPA 2Q2IA 4RCOA 5G2NA 3K5LA 4OIKA 1K3BC 2IX3A 1DOKA 3MHBA 5CC4A 3TRZA 4L8JA 1GD7A 1H9MA 2H1EA 3A9JB 1QUQB 4RCNA 2XN9C 2EKIA 4MSMB 1KQSA 3D8GA 3WOFA 1QCBD 5JJZA 2CKHB 1E2ZA 4HR7B 5BYQA 4CQNA 4I6NB 3IKJA 2R7FA 4YSZB 4DR5Q 4PMWA 1WTPA 1X6OA 2JSOA 2FJ2A 2Q2TA 3GDEA 2VH2A 3KUZA 1FFUA 2A19A 2WP8J 2UXCL 4EQNA 4A3FH 1K3RA 2FAZA 3L10B 3A1QB 2QF7A 3S14H 3HOYB 1IXRA 3PIOA 1HR0Q 3AU4A 2A68D 3JAML 4F7XA 3EHVA 3K7UC 2HHHQ 1YN3A 1Y1WG 4HJKA 3AE9B 1NEKB 2MP2B 1JB7A 2FXQA 4KK7A 1L4DB 2JZPA 1ASZA 4G0NB 2PNHA 4GN4B 1Q81C 5IA7A 3EJIA 1E90A 1LT4D 1ZEQX 2PPBC 3S1NB 2V1YA 4XXEA 3HOZG 2K5NA 3PO3B 2KWCA 1T6BX 3H0GB 4FF4A 2ZXPA 2L00B 1HTOA 1M8AA 4BOZB 3NENA 2K8BA 2NPTA 5FJ8H 3NUHB 2XTIA 1AP0A 1L1OA 2KEEA 1VCIA 4JV5Q 3MTSA 3K80C 3HOUB 1CHQD 4UP8A 1E7ZA 1HTPA 3PO0A 4FN2A 3J7AF 3A5ZB 3PRMB 3QARA 4ULLA 4A75A 1AW7A 3D4WA 2QDFA 1MD2D 4L5RC 3S2AA 2VB2X 5IO9A 5HY6A 3MC8A 4WAAA 1XJVA 2IGDA 3M4OB 4DUYQ 4DUZL 5J1ZA 1EY9A 3BS1A 3EGRA 2BT6A 5L83A 2K32A 4CGYB 4QMGA 1K8OA 4DR1Q 1JB3A 2JXXA 3GOEA 4R3DA 3DHQA 1L6VA 1R4NB 1XTDA 4R8NA 2JA5G 4CYEA 2HHHL 4UY8C 4GOPB 4WURA 2QHOA 1WR1A 2VH1A 1YOVB 1MHHE 2NBFA 1ZDVA 4AH6A 4PYUA 2I38A 4Y7NH 5AJ3Q 3CC7A 2Q5WD 3U7DA 1HJPA 3AV8A 4WWNA 5BO4B 3PUVA 3TJPA 1UD7A 3VDYA 2KCCA 3MAQA 2JWZA 4QAYA 3VUXA 4A3GG 1E10A 1ZKOA 3DEOA 1WWTA 1P3QU 4K3BA 4F87A 4FHJA 4WIPA 3VTWA 3K8AA 4JVZA 1IYFA 3GV3A 1JE5A 4LFAL 4LAAA 3N1XC 1XX8A 4PMBA 3GTPB 3W1SC 1KLUD 3TSSA 3L7ZC 3V6CB 2WDTB 3VR8B 3GTOB 3U4VA 2OJRA 2WV6D 2L32A 2NVUI 2W3SA 4WWMA 4U68A 1A63A 3R7RA 3J9CA 2PVOD 1EY0A 3WALA 4NAWB 3OOCA 3I4MB 3DOWA 2PTLA 4LNIA 4M0WA 3LNNA 3PF5A 1F2MA 4M1UB 5C0XI 3OW2A 2KQ7A 2ZNVB 2Q8IB 2A6EC 3DWMA 4REZA 3R93A 3KYDD 1QOAA 1Y8OB 4CBVA 1OO9B 5FK9C 3MC9A 4MNOA 2WXIA 5M3MB 5EBDA 2B2VA 4KKJA 2J53A 3FHWA 2WAQG 2LSSA 1SEBD 2PZTA 1VQDA 2DYOA 2L76A 1EY7A 2R2OA 1VS0A 2UXDQ 2KCNA 2RBMA 2L11A 3A8KE 1NMFA 2N7DA 2Z9HA 3CMEA 2H4OA 1BO0A 4MZ9A 3QWZB 3KJPA 2VRRB 3GE3C 3VHTC 2YTVA 1F9QA 4J15A 3I4NB 4BXXH 3UQBA 2HDMA 2KHSA 2V4DA 2WNMA 4G57A 2LUEA 4G11A 1K8RB 3N3KB 4GMVA 4ITKA 2KJXA 2EY2A 3I63C 3GD7A 4N8X1 4KV2A 4A20A 2UU9L 2J7ZA 3MEHA 4KV6A 3S17B 1XLNA 4KIKB 5LLIA 5DPWA 5EPLA 1FGUA 2JP1A 1ZOYB 3DHGC 2Y5BB 1P7EA 5IYDG 4TSSA 1ET9A 2OWOA 4IW0A 3CRKC 1CQVA 4BKSD 3MHZA 1V6EA 3DVGY 1TGZB 4QUFA 3TEHB 2KMCA 3EFUA 2IJ0A 5CHWA 5FR3A 2TSSA 2DNEA 1LABA 5T8IA 1EU3A 4HSPA 1S3SG 3B2FA 3PGEA 2KAJA 4LF8L 1V1PB 3NTKA 3S1NH 2KFKA 2I5LX 1PGAA 1P16A 3NSWA 3JAMi 1JALA 3OMCA 2F4VL 2N7JA 1PDXA 3HK0A 4LJZC 2F0LA 1MGSA 1NAPA 4DV7Q 1EWHA 4QIWE 1PH1A 1V80A 3KOJA 5CGKA 3HOXH 4OO1G 4OZAA 3KDFA 2AL3A 2F4IA 1ZP0B 2ASBA 3DXJC 3VDZA 1WCMB 1YNTE 3AE4B 4IG7B 4YSXB 4HJGE 3VYRA 4E74A 4P73A 1YD8U 1IBXA 4QJFA 1C7YA 3AE1B 2EQSA 5KNBA 4XIGS 2A6HC 3H1UA 4EQOA 4DV6L 3CW2C 1ENCA 3MXGA 5CHFA 2K50A 2ZJQA 4X6AH 4YTMB 2K5DA 2F0NA 2J4XA 1RIPA 4C3HB 4FDBA 1LTSD 1Z7TA 2D11A 2D2QA 5EPJA 5C23A 5DEHA 2NTTA 1WX9A 1GUSA 1TT5B 2WDQB 1IBLL 2D0OA 4JI0Q 2H5XA 5C44H 1C78A 1D5XC 2I1JA 2FNJB 3CQZH 1F2LA 3CF6E 4X66L 2E8GA 4B3SQ 2NVQB 1EWCA 4GLXA 1E24A 1I94L 3QB3A 2X38A 3AN1A 1FR3A 2G1EA 1K73C 4F88A 5EDSA 1N32Q 3HOVG 2BKRB 4IUQA 2BH2A 3SK6A 1KIXA 4X57B 3WAOA 5JHAA 1WM3A 3NRZA 3RCZA 1CKMA 2ACZB 5G5GA 4GDKB 2CVRA 2MEKA 4NW2A 2L8JA 3WA0A 3D31A 3CCRA 1M90C 1K50A 1A2TA 1O80A 1PZJD 4CJ0B 5FOBB 5JJLA 2L83A 2D9UA 3TP6A 3LDZE 4BKGA 1L1OB 2BA1A 2WXQA 2H89B 3V2TA 4NJCA 1K8MA 1U4MA 4IUNA 5KIXA 2KWDA 2BWFA 3AXCA 4A3MH 3RLNA 4ZRIA 2WXPA 1AZQA 3VTUA 1Z9FA 3K5OA 1BNZA 1M94A 3PLVA 3P75A 4JOIC 1HFGA 2B2WA 1T0SC 4CKEA 2N1VA 3GZNB 2PKOA 2FCSA 1VQ5A 1KHIA 5GAEC 3Q8BA 4UAIA 5EJWA 4HCNB 1X3QA 4JI3L 1NSNS 3PIO3 1H9KA 1Q12A 1PTOF 1IL8A 1G6JA 1RJTA 1J8CA 2DZKA 3B1LX 1A70A 3VA5A 4EX5A 2DHZA 4AQYQ 3PV0A 1NUCA 2PMZE 2GI9A 3EUB2 3Q6SA 2HIVA 2EKEC 4DNIA 2RQXA 2LWPA 1K83B 4KSLC 3UIPB 1MI0A 2Y0SB 1XPRA 1RHPA 4MGZE 4KHVA 5C3EB 3QAQA 3H7PA 5GXGB 1V1PA 1IBXB 1V5TA 4EQ5A 2GRIA 1TR5A 5K36H 2Z4HA 2SEBD 2EJGC 4C3IB 3RZDB 1OXSC 4XQNA 5GADC 3DBHI 2JEBI 3Q3OC 2IZVB 4IDIA 1AN8A 4NXNL 3GTJH 2NZHA 1SNPA 4LNNA 2MSED 3ZW3A 3S2DB 1A3VA 1PYBA 1JT8A 3ICEA 3N1ZC 4JI7Q 1U4PA 1OXVA 2B63H 4RFBA 5ELEA 1MKHA 1SROA 3S1MH 3LYYA 2CS4A 4FXCA 3PUXA 2V3PA 1I35A 1E0ZA 4C3IH 1TY2A 1X55A 3P1HA 2K9XA 1WE7A 3BDCA 4KKUA 2IO1B 3B9JA 4HPPA 2XWBB 2YU9H 4A3IG 3RULA 2YTXA 3QHTA 2KC1A 3AU5A 3A56A 1WXMA 3GS2A 4GS3A 1YNJC 4FJVB 1UNSA 2KVZA 4W9CA 1XMQL 4R8IA 4K6LA 3MJ5A 3M4PA 4A3KG 2PQEA 5IT9c 3NTHA 2A8VA 4XYCA 3RN9C 5CR3A 2H88B 4XYOA 2RF4A 3EN2A 4FA6A 1N9WA 3J80L 1C8CA 2E2IB 1Y8RC 1YX6B 4WWOA 1D4BA 2OEOA 4EVOA 2GBJA 5CTRC 1A8VA 1PTOB 3FKIH 3PGZA 4DR7Q 2O5JC 1IUEA 3OG5A 4HEDA 2B63G 2JE6I 1FVIA 1EWYC 1PFSA 4AQYL 1GAQB 2RD0A 3NVZA 1BUVT 3EIVA 2K5HA 1VLBA 5EAYA 2INDC 4MGIE 3RZFA 2I1KA 4YWMA 2GN5A 1FD7D 4LF5Q 1H9SA 2IX1A 3OJ3A 3QQ8B 2N88A 3A8JE 1TS2A 1KDAA 4KY5A 1BKBA 2L15A 1JE4A 3F8TA 1ZE3D 4LNFA 1E1OA 1B1ZA 2R7ZG 1V8QA 2IPKD 2VY3A 1EQVA 2KEDA 3FDTA 5FLXE 4FF1A 4DK6C 2CHZA 3PTFC 1GJZA 2F0IA 4MSQB 3VR9B 4BFRA 1MHWC 2G9DA 3H8HA 1VZ7A 3GQBA 3NHHA 1AE2A 1FNWA 2EIFA 2PYKA 3MHSD 1YX5B 2JYEA 3NY5A 4KY6A 2WQYB 2F0FA 4MJSA 2KYWA 5I2YA 2E2HH 2L0TA 2NB0A 2HIXA 3KYHC 3F2UA 3APDA 3B2GA 2PNRC 5C4XG 3I57A 4PS7A 2LHEA 4IPHA 1WSPA 1WIAA 4A3EB 3CCVA 4KSKC 3H3VH 4IFDH 1STEA 1SFOB 4RKLA 4L5SA 2YEPF 3KFUA 3OWEB 4MDKE 1N5WA 1G8ZD 1DCZA 2LMCB 4NDXA 2A69D 5A35A 3IFWB 4ARCA 1GUOA 1J7BA 5DCNA 3ZLZA 2ZPYA 2BKFA 4IC7B 5C0XH 2HD5B 2XGTA 2QMTA 4BBRG 1FXTB 3VR4A 2N55A 1LXDA 2UUAQ 2VUMG 2KTRB 3ECIA 5IP4D 3Q24A 4BBSB 2Z6KA 1NY4A 5G3LF 1VQLA 4K6DA 1NTGA 1CA5A 2EOTA 3RNCC 3NWTA 4DV2L 2XSCA 3OJ4B 5J3BA 3CD6A 5J17A 2EYHA 3OYYA 4BY7G 3W1YA 2RHSB 1VQPA 5L95C 3X0WA 5M5YB 4OW0A 3PUYA 1VQ9A 1UGJA 4XQJA 4C7ZA 2L9HA 4GNXB 1J7AA 2F4VQ 4R9WA 3J80i 1U9RA 4DXAB 4A3EH 4GN1A 3PVLA 3I70A 3TREA 4LF9L 1JOKA 3IRBA 1U5KA 2F0VA 1IKLA 3N20C 1JRUA 2NBVB 3A9KA 2C35B 3S24A 3U4ZA 1PH4A 4IUUA 1PFNA 2IX0A 4ZQ3A 4KJNA 4DV7L 2EYPA 3PIPA 1KAWA 3PREA 3U2SC 5KHQA 1HZ5A 3ZIMA 1VQCA 2F0DA 1X9NA 3GTGH 3I9V1 5IOIA 2DYBA 4B3RQ 1WGHA 1OTRB 2NYZD 2PMZB 3S15B 1UWVA 2LY7A 1EQRA 2AEHA 3QC8B 5M5XH 1F2RI 4ZYNA 4EE2A 1SDFA 3KF8B 4HN7A 1FCCC 3TIXA 4B3MQ 3RN5A 1SE8A 5JZEB 1XO3A 3BZCA 4ME5A 1IGCA 1EYDA 3AEDB 1ZYRC 4YSYB 1XPOA 2CH4W 3PZ8A 4G50A 4C2MB 4FXGC 4KD3A 2B76B 3SR6A 2LVPA 1MHXA 3A4RA 3I91A 3L13A 3ND8A 5M3MH 2K0PA 1WJ6A 4HMIA 3P7JA 4J6HA 2F03A 1C9FA 2WACA 2KECA 4N9PA 2CJOA 1PH6A 4V190 1SYFA 1GUAB 2LRWA 4ZRZA 3D32A 2F0MA 2Z0DB 2ZZPB 4K3CA 3HS0C 1SF0A 3UE1A 3CCQA 2G9HD 2JQOA 1FMAD 3NS8A 2A74C 2VW9A 1YIJA 1WTVA 1VQJA 1AWDA 1UEAB 2SOBA 3W5VB 1EFID 4ZYSA 3IL8A 1NYQA 2JA8H 2DZIA 1HE8A 3OIPA 4GDKA 5EE3A 3HIZA 3MXUA 1CKOA 3HOYG 4PV1C 2ALYB 1XXGA 2MO0A 3D6CA 2CHXA 4DR2L 2PIAA 3IBEA 1QNUA 3NP8A 4ID6A 5AEKB 1F9JA 3H94A 3CCEA 3FPUB 5E6JA 5AJ3L 3T3NA 3I4OA 2JA6H 4IFDJ 1CI3M 4OWTB 1OQYA 4Y7NB 5CMDA 3HKZB 3VRAB 2A68C 3RPFC 3BG3A 4QGUA 3HOZB 1VQMA 4QCLA 3FEWX 4MM3B 2KDMA 1DM0B 1LYLA 5FKAC 2IY5B 3NEMA 1X56A 4AWJA 3HOUG 3P20A 4XC2A 1WX7A 4N6EB 3S1RB 1X32A 4LF6L 3M4OH 3VYTA 3M62B 1HNWL 1MVKA 3PUZA 1GG3A 3DBLI 4WQOB 4WORA 4L5TA 1VF7A 3VR2A 1R4MI 2IHEA 1JR0D 3OWFA 5IGFA 2LS01 4JBMA 1TZOA 4QIWB 1SSNA 3T13A 5EPKA 5GMVA 2MRPA 3TP8A 2XRQD 1L0XB 2WWZA 1UH6A 4LFCL 4U673 3DMUA 3T1YL 1DOXA 4G7HC 2KT7A 2M1MA 2O2VB 2KCTA 3A7AB 3H0GH 3VUWA 5CV8A 2JA5B 4ZKBB 3GTGB 4GGQA 4HPLB 4XYQA 4TQ1A 2JY6A 3DEPA 1D5ZC 4JI5L 1F1HA 1OFFA 2K5PA 4GKJQ 2N7EA 1L7YA 2VUMH 2FIFA 2C5LC 4DAYB 5JVG3 3AB5A 1I4GA 3ONAB 4MT5A 4K81A 5IYBH 4YTNB 4KKIA 4A3GB 4DR4Q 4ANVA 1PH8A 2B3GA 1SYBA 3TZDA 2IT1A 1HNWQ 1HH2P 3QWNA 3IAS1 1TWAH 4A3BH 1W3SA 2Z0EB 2BA0A 4FO2A 3MFYA 1ICWA 3DVGX 1NR2A 2KVMA 2ZTDA 5H1SE 1TTNA 2RDBC 3BK1A 5D6JB 4A3DH 1JQ4A 1I6HH 1V86A 1XCQL 4RM8A 4DFAA 5M3FG 4TV3A 3PV1A 1D7QA 1QILA 2JRIB 5HKHA 1I4RA 2KNBA 2NBUA 2F0GA 1RYJA 3S14B 2W9NA 3W9CB 1PH3A 1GHJA 1RAXA 1WZ0A 4NKLA 4FULA 2E2DC 3G6EA 2EYFA 3IVFA 2RSNA 1K8GA 4IALA 4TKNA 1X3EA 2KOLA 3KWVA 2UXCQ 3KYCD 2L7RA 5CHVC 2PQAB 2CWPA 3SR1A 4EOYA 1YJNA 1FRRA 1D5MC 3M4YA 5BMIA 2HDLA 1PZKD 4E6IA 4BY1H 4A3IH 5BN4A 1N6ZA 4I7AA 2R7DA 1B3QA 2DJFC 3AEBB 3ZYYX 1SFOH 4LJPB 3HOVH 4WJ4A 3I4NG 2D07B 2JSVX 2WU2B 2BCOA 4S17A 1TS4A 4E71A 1STAA 2PVGC 1G2TA 1GHKA 1L0VB 3AULA 2FE8A 3ZXVA 2YTYA 4B3TQ 3UI2A 5FR6A 2I46A 4G7OC 1GVPA 1PRTB 1FNUA 4RWSC 3SDZA 4G7ZC 5IYBG 3ZJUA 4P16A 4HK2A 1XPUA 3RZOH 2N49A 2PW5A 4LLGM 2Z8LA 3GV6A 3RNGC 2NR2A 2MJ8A 1BCPF 4LUZA 2UUCQ 3JC66 4FP5D 1B50A 4JCVE 1UE7A 1WMHA 1A3UA 4NAWA 4NP5A 4B3ML 5EE1A 1FL0A 3G71A 1X65A 2VZKB 1XQQA 1NI2A 4HXDA 1PRTD 4BS9A 4W9FA 2VZAA 4AYBG 4A9AA 2JA5H 2WXMA 3MP9A 4MH0E 4YCUA 3L9AX 2NVTH 1TWHH 2F0TA 1PXUA 1WGDA 5IGDA 2HTHA 3TEZA 1GXDC 2L1BA 3UE0A 2JT4B 3V60A 2JA8G 3FMCA 1JJCB 3PCOB 2CW0D 1P9DU 1BXTA 1CA6A 2JUOA 2V4IB 2N9KA 1YVCA 3Q2AC 1JROA 4KKSA 1SJHD 2LRUA 2F3IA 4LNOA 4O1NA 3KK7A 3DWQA 2HQEA 4KDIC 2K5QA 4A3JB 3RUZA 1YN4A 2L0FA 1HQMC 3BU2A 3DBLB 2INNE 4N59A 2F0KA 1I4QA 1IW7C 4OO1I 4DV4Q 3GTKH 4X65L 3QG1A 2HUGA 4NXMQ 1XD3B 1IYJB 4K7UA 2MP1A 3NK9A 3PIP3 4H7BA 4Q5VA 1JOOA 5EGTA 5FJ8G 4US9A 2K6AA 3F2CA 2GB1A 4GXBA 4OX9Q 1TWCB 5EKIA 1EY6A 2DJGC 4WJPA 2AKWB 5D2MB 2ENBA 1EY8A 2KTFA 3RNAC 4FHKA 3S1MB 1ZXTA 1NBFC 1K9MC 2AL6A 3QIJA 4WAFA 5IP9H 4DV2Q 3ZDMC 3BYTB 3UIOB 1G51A 3PSIA 2JF5A 3P63A 2AQ2B 1SJED 3TEYA 5ELBA 4M00A 3AYHB 4WFN3 1U0LA 3RFZB 2QEJC 1SIJA 1ML0D 3OHXC 3QO2A 1Y8NB 1ZXHA 2HE7A 3GO5A 2PPHA 2ZVNA 2KFJA 4DV4L 1S40A 3TN2A 3I90A 4K2KA 3KVFB 4DV5L 1K83H 1PMRA 5D3IB 3GTKB 2KOXA 1EIFA 1HTLD 4E3CA 4DAMA 1C9OA 5DPTA 1D3ZA 2SDFA 1LM8B 1K8AC 3QJYA 3KBXA 3E3XA 4AS1A 1VD2A 1T5EA 4DV3Q 2MQJA 2NUCA 3BYYB 1RFAA 3CKIB 2MW5A 3MA2B 1EUVB 2C9OA 1C79A 1X3PA 3ZNID 1U4LA 3HOXG 4B9KA 5KEEA 5KYLA 2RSUA 1WD1A 2E5LL 2KLCA 2JYTA 1I50H 3J7ZC 2VNUD 1S5FD 1TIID 1WVLA 4MEMA 3J81L 1HFNA 3ML8A 1CM9A 1KL9A 2DAJA 2VZKD 2JU6X 3ND9A 1K0RA 4PK1A 2PI2A 4GKKL 2IDYA 1UELA 4HWIB 2ES2A 2K01A 2QDBA 2E2JH 1B53A 1L2NA 2ZTCA 1C3TA 1HXYD 2QKIC 3KDFB 1S3OA 2GBRA 1ICFB 3ERQA 1N33Q 4X62Q 3PO3H 1STNA 4B3TL 3UI3A 4EFOA 4M8AA 1QZEA 1A5RA 1XT9B 3NHEB 4IWOA 5IYCG 1J5EQ 3SHQA 1SGHA 1LO5D 1OXTA 5FLXc 1EL0A 1FYCA 3K59A 3HOWG 1OQRA 1YI2A 2WXNA 3DBRB 3BZKA 5EBCA 5BR8Q 2KC2A 3H7PB 4W9HA 3I55A 3O13A 2IHFA 4Q2JA 1TU2B 3EBEA 2WXJA 3H3VI 4GLAC 4IFDI 1WYGA 1JWSD 4AYBE 1F9PA 3CC2A 1PGBA 2UUBQ 2J7QB 1IZ6A 3A33B 3KWLA 4HDQA 5IKCM 3AQQA 3IHPC 1JORA 3DWGC 1P98A 4BBSH 2KJ6A 5HI1A 4Q0FA 4HJ8A 1A3TA 1SNQA 3M4QA 5D14A 2F3WA 4BY1B 4A3CH 3VR5A 2K4KA 2KKCA 3R3OA 1NCVA 1TXYA 2NZ1D 1XCTL 3KF8A 5FO7B 2MBEA 2MJDA 1Y69U 3Q3NC 4C4VB 1A2UA 4BBRH 1IPGA 2KN4A 2BTEA 5A2QL 4TVAB 1JC7A 1RM6C 2QA4A 2WB1B 1N34Q 1R4NI 2L05A 1E3PA 4DAPA 1NE3A 2OJWA 2JA9A 4DAVA 1TIFA 1P0RA 3I3CA 3OLMD 4YHHQ 2ATWA 4K0KL 3CCLA 4XTCS 1HTQA 4OONA 3HOWH 2SAKA 4ABNA 4FBJB 4XGAB 4A4IA 1YNJD 1PFMA 2R61A 2DUDA 3TP5A 3AMUA 1WZ3A 3D4DA 3K5NA 4ZRPA 1OEYA 1I6HB 3SHLA 2KX0A 2WDVB 5JH5C 2JJQA 4XZ4A 4JBJA 1DOMA 1SBBB 4FJYA 2RKSA 5BN3A 4WJ3M 3AEFB 2AWNA 3L3OC 4W9DA 2KDIA 1Q1BA 2KHJA 4KI0A 4LF6Q 4II3B 3J81i 1R7SA 2MHJA 3ALBA 4FLHA 4HVBA 4KLKA 1YNNC 1T0RC 3VA7A 3VVWB 3NVVA 3VR3A 3KUPA 1FXIA 4JWUC 1EWIA 4DV1L 1S5DD 1KNAA 3HKZE 3NQIA 1CMXB 2GBKA 1S5CD 2R7ZB 1CZWA 1QOHA 1F2ZA 3IXSA 5H92C 1SYDA 2QJLA 3OTOQ 3RN2A 5ISRA 4ZRQA 4PS8A 4RM9A 1EZ6A 4C1NK 1XNQL 1F2YA 1WTQA 4ZUJA 4FVMA 2KDFB 5G5HA 1KFYB 1UBIA 2EVBA 3S17H 2E74C 1F9SA 3U50C 3RT3B 1VMCA 2IY1B 5ELNA 1BQQT 1DOLA 2FBWB 2Z0SA 1KF6B 3BWUD 4JIOU 4DHJD 1HRJA 2VS1A 1NENB 2MO1A 1ZUD2 2BS2B 1PH9A 4B95A 1WTRA 5LXIB 1UE5A 1VQBA 3S1RH 1OGWA 4F7ZA 4X3UA 5M5WB 2F0JA 2XBBC 2M00A 5E7NA 3O65B 3PZ7A 2PJHA 4JI4L 3CMMB 1SMYC 1RCVD 4YY3L 2JA7B 2YLMA 4PT5A 4C3JH 4XT3B 1E8WA 3APFA 1KXLA 3QIAA 5ELOA 3HOZH 2KX3A 4WWPA 3FVQA 2NVYH 1CTMA 4L63B 4ANUA 3RNBC 2B2YA 3KLWA 4US8A 4BBRB 4DXFA 1B9MA 4A3MG 1WYWB 2WXOA 4BBSG 1I3QH 1N32L 2O2VA 5G55A 1D1IA 3Q3JA 5KRUA 3PLUA 1YHAA 2K75A 1QNKA 5GROA 4EEWA 2VL6A 2K28A 3S2DH 2W55A 4IWQA 1QZHA 3S2HH 4R4CA 4OO1H 1YMHE 5AZHA 1YHQA 4ZRJA 1SLJA 5HURA 3TS0A 3UINB 3T8MA 3AFQA 1KDBA 1LV9A 3U4EG 4RHRA 3FP9A 1F2RC 2KJHB 1T3QA 4WH4A 4OZCA 4PYZA 2WIIB 1ONLA 3CRLC 1PH2A 4N9TA 1CKNB 1RKNA 5C3EH 2K1FA 3Q8DA 4DA2A 1KLVA 1VQGA 2AQ1B 3LGJA 1VQOA 1QVGA 5A2QE 3UF8A 5KNCA 3T1HQ 4FNFA 1KTKA 1Q46A 4K14A 2NVXH 4LF7Q 3L0OA 2LGYA 4NZLB 1RFKA 1Q8KA 3ZO5B 1QB5D 2D5GA 2WKCA 1CKNA 1O78A 2KWVB 1WMHB 2K25A 4KD4A 4A93B 3NE5B 2FCMA 2O5IC 3X3MA 3QK0A 5IP7H 3VH3B 5CBEE 1JMCA 1WXAA 2LGSA 1Y1WH 4P1BC 4HLEA 4PNYA 1DD2A 4R4QA 4GLSC 4HEA1 2FINB 3BDLA 1FIQA 1QVFA 4YWGG 1XLPA 5C4HA 1VDVA 3HOUH 1JWAD 4XWTA 1DYQA 2MJ3A 4RMFA 2CFMA 3C1EA 1C0AA 4NPSA 1Q0WB 2V3NA 4S0RA 5JHBA 4GLVB 1OQQA 2C7HA 3K5MA 1SN8A 2R92H 3GZNI 1EYAA 3MXPA 2VB3X 3W5OA 1ZDXA 1HPCA 2F1MA 3TBIB 2LZ6A 2L12A 5H8YE 1N62A 4CO7A 4LFBQ 4M01A 5M3FH 2UUAL 1IHZA 4LF7L 1I4HA 4LF9Q 1TS5A 2WS3B 1L0YB 1WJ4A 3DPDA 2PW7A 5GQOA 4ZLTF 2Z6KC 1WOCA 2A5UA 1V1OA 3Q8FA 4W9EA 2CCZA 4R4TA 1IBKL 1LGRA 5DM73 1KJTA 3JAMc 2X6LA 2I2YA 1GKHA 1ENFA 2K03A 2RDGA 1KRTA 1SE3A 1WRIA 5IODA 2ID0A 1WXQA 4MM3A 5C44B 1KM7A 2LUMA 4HIKA 1HZ9A 5FO8B 4OGQC 4DK5A 1HA5A 4ZDVA 4IUTA 5IYCH 3C2PA 2DZJA 1LACA 4BKSA 3T1HL 3PMFA 2N78A 3L54A 1ET6A 1OEYJ 1HNZL 3QCAA 4OELB 2VXWA 3EC8A 2BF8B 5JVH3 5HG2A 1YEZA 3NBIA 4JI8L 5JEAG 3HKZG 1MPEA 2INPE 4GN5A 5E1FA 1TKYA 1VQ7A 4CJ2C 2OT2A 4ODGA 3DWPA 3MXNB 5K5PA 1F52A 2JRHA 2BH8A 5IT9L 4NMZA 3M85A 4YY3Q 4RA8A 4JI4Q 5D94A 2B2YC 1XNRL 2RA4A 4LFAQ 3UDXA 2EMTA 2M0AA 2FMMA 1HHVA 4HCSA 2W82A 2R6GA 1BCPD 3Q3MC 1PTOD 5C4JH 1GOZA 2MFIA 3CMAA 1QLBB 2FHTA 1NVID 3HEJA 2NVTB 2LEKA 1UZXB 5M9OA 4A3BG 2E2HB 5JXVA 4DR7L 1GUNA 2JQRB 2A69C 3K58A 3H7SA 3H15A 1VQ6A 3ZXRA 3TMPB 1X3FA 4ICUA 1NYRA 2C7NB 4DHJB 5TR5A 2OQ0A 5AFWA 3AE7B 3FILA 1K51A 1QOBA 3BINA 4TQ0A 1NNXA 2K1BA 4EGVA 4DR1L 2DBYA 4M02A 5E6NA 4JGHB 3E5SA 1I50B 1LTRD 1QE6A 1SNOA 2D0PA 2F0EA 4X64Q 1NMGA 4GOPC 1VZ6A 4GDLB 3S16B 3H3VC 1T0YA 2LMCA 4H13C 1D6EC 1T9HA 3ER0A 3W1BA 1FGBD 3DHIC 3LJ3A 3NG0A 3PT2B 2KXJA 4ZRKA 2IW3A 4EKUA 4N9F4 3LWUA 2J0KA 3W5UB 1JWMD 3ZRFA 1XNQQ 2E3TA 3I4MG 4I6LB 1J8IA 3I8ZA 5C4JB 1WGYA 3MWYW 5LXHA 2CU1A 3U8ZA 3NBHA 3L2PA 1WGRA 4HKZE 1WM2A 5CV6A 2DZMA 4V0BA 1XMOL 4MJSB 5FLMG 3JSVB 1E5WA 1WX8A 1WY8A 1S5BD 3EQLC 2Q8RE 2KVRA 4YHHL 1CSPA 1C4AA 1MSHA 5ELDA 4CKCA 1YJ1A 1UEBA 3RI7C 2HD3A 1YITA 4JPSA 3C19A 2D10A 3RYTA 4ARIA 4PQXA 4HKQA 1EEFD 1UBQA 4DF7A 1HNXL 3Q8CA 1PZID 4OHJA 5CV9A 1ROEA 4Y52H 4PG3A 4TQUS 1BF4A 2QCZA 3AE2B 3U30A 5IAAC 1B7YB 3A55A 2YV5A 1QG7A 3SE0A 3U58A 1ESFA 4GU2A 2PQAA 2KDEB 3N32A 3N30A 1JQYD 2E76C 4BA1I 3I4MH 4WQMA 2BYEA 2F0SA 2FUHB 3R8BA 2GBNA 1B8AA 3V62A 2D3AA 4IUMB 1MJDA 1N34L 2B39A 2ZPNA 1NBWA 4XWWA 1SYEA 4QUCA 2KCMA 3GTPH 2NTSA 2QGQA 1OXUA 3UDGA 5AUIA 1N60A 3GTQH 1HZAA 2JZ3B 4W9JA 2DGYA 1Q3LA 4DGZA 3TDQA 3ETRA 2WB1E 4A3JH 4DKAC 1YJJA 4P72A 4MN3A 2OEDA 1M4VA 5CYUA 1Y14B 1N33L 3TUOA 2A4ZA 1L2FA 2GOWA 2J42A 3AM9A 3HM3A 1KH0A 4GB9A 2F3VA 5C4ZA 2NN6G 1EIYB 1EIHA 1STHA 2KTRA 3AE8B 1VJKA 5C1ZA 2L5TA 3VUYA 2BS4B 3VYSA 4AIMA 5BR8L 4NB3A 2KWUB 2DN8A 3RZWC 5JAVA 4A93H 1BBUA 1W6JA 4HJ5A 3P1MA 5NUCA 1SE4A 3RMHA 4JOIA 2E5LQ 1AYFA 3D6WA 3T56B 1Y1WB 4X62L 1SRUA 3OSOA 1JJGA 3EECA 4KX6B 3PHWB 3DM1A 4IURA 2QIEB 4RGTA 2IL8A 4P75A 1KDCA 1S4ZA 1PTOH 4USAA 2CH4A 3KLSX 4GKKQ 2KMMA 3ZVVA 4DR3L 2ZXRA 4A3JG 4JC0A 2MWSB 1STYA 4C3HG 3E0EA 5GAHC 1BCPC 2LXAA 3NZSA 3PO3G 1VR9A 1WJUA 1FCLA 4K5WA 2NMQA 1CJEA 2KO3A 4IM0A 2WXFA 1Q10A 2JA6B 3SVMA 3J80c 1ZXIA 2DY7A 3J80E 3IFTA 2IGGA 1P8LA 1V49A 3ZJTA 4CHKA 4DK3C 4DK0A 3HOVB 2BPSA 4BBNC 1IP9A 2IO3B 5EKKA 3AEVA 3QX1A 1AH9A 1CUKA 4KN7C 5TSSA 4X66Q 4DV3L 3MFGA 1M1KC 4A3PA 4FADA 4UHVA 2SNSA 3VYUA 3NXWA 3Q8AA 1PFDA 4RF1A 3H09A 2KQ3A 1V2YA 1TVXA 1H4RA 2PE9A 1H9JA 5EKLA 4NPNA 1IBKQ 3J81c 5ELCA 3KUDB 3KBGA 1Q1EA 4HJ9A 5C3XA 4C3HH 5JEAH 1VQHA 3MEFA 4HTHA 3J81E 2RR9A 3L4PA 5KHOA 3WCQA 3U9SA 5FLXL 1N5XA 1OTCA 2ZJRA 2Q2UA 2NVYB 4LFBL 3MJWA 3AMZA 4DHZE 1SB3C 1QWYA 2BB6A 3CSTA 4R1JA 2JA7H 1AARA 2MQHA 3GP7A 5IGCA 1LQBA 4IOIE 4CDCC 5IGBA 5EQ0A 3KH0A 4KDLB 4GSWA 4FXDA 4ME3A 3G6JB 2K22A 1HZ6A 2Z4IA 1PVOA 1L5PA 1I42A 2QC8A 4ANWA 5IE8A 4DXGA 5BYRA 3T53B 2ZJDA 2G5DA 2C5CA 4HRSA 1HUNA 1VQNA 1ILPA 3SDLC 3BVZA 5MPOA 2GBMA 1ZPSA 3RUIB 1D1KA 2LGXA 3MXNA 4ICVA 1MIUA 1BCPB 2HCIA 5C3EG 3AB9A 3K0XA 1U4RA 2R93H 1KRHA 1X1MA 3FAHA 4OL7A 1E1TA 4O2DA 4QB4A 4BA2I 4GZYC 4IKGA 4OXPA 4ZCKA 2WAQB 2WP9B 3T9LA 4NY0A 4HJAA 4K1RB 4C3IG 4ILWA 1RL2A 3HZXA 2IWHA 3K7AH 3AE6B 1KD1C 2ICIA 1Y1VB 1TQOA 2LXJA 2ZT9C 1BBWA 3FKIG 2UU9Q 1WXSA 1KRSA 3IG3A 3P4QB 3R7QA 1DOYA 1PQSA 5T1IA 5JPNC 1LTLA 2EXZA 3HOWB 1KOTA 5IOCA 3K9PB 2A73B 5I6WA 3PO2B 2RVLA 2R2QA 4QY7A 5LL6S 3RLOA 1K28A 1ZYRD 2K8CA 4A3IB 1PHJA 3ONSA 4A8XC 2BE5C 3Q3FA 4HDOA 4K2LA 1LFDA 4K7SA 4IZ8A 4ZKCB 1HEZE 2KFKB 5C0XJ 4LF4L 1YJIA 4JBWA 3CCUA 4NQKE 2HCCA 3TP7A 4B08A 2B29A 1Q1OA 4XDCA 2D3CA 5IWAQ 4L5QA 2A5HA 2K05A 1GUWA 1LM0A 2AMCB 5C5LA 2LKVA 1C76A 3GB1A 2YU9B 1KABA 1MJEA 4JI2L 1FD6A 3G48A 2C7MB 2IY0B 1JOQA 4J3OD 3NBHB 4MGKE 4HSVA 1E8YA 3L0WB 2BVCA 3CAMA 1E2VA 3W1GA 3DVNV 2QILA 5C6AA 2B63B 2ZW0A 3APCA 1XLOA 4LTUA 2INCC 2MBOA 5LMUQ 2CW0C 4YCWA 1NR4A 2M2LA 1YQ3B 3K0YA 2WXHA 3KQ4A 3E9SA 4JX1C 3RD2A 1F77A 4I7ZC 4UP7A 3J81j 3HVZA 4RF0A 4FF2A 1UWMA 3WANA 4BWGB 4PZ8A 1WCMG 3M9BA 2MNAA 4DUYL 4DUZQ 3MVVA 2UYZB 5BMHA 1WYDA 1YHBA 1EYGA 1I4PA 1RF2D 2R3ZA 4BVUC 2AX5A 2WAQE 2WINB 2V3SA 3ERSX 1IW7D 3DBRI 3IT4B 3SFEB 3DBHB 4FJZA 4R4IA 1E22A 4F1SA 2CQOA 5IGGA 3SXHA 3MC0B 1JWUD 2KLGA 2N4FA 4JV5L 4IUVA 2WXKA 1W6KA 4ANXA 4RGMA 4KY7A 2RDHA 2BDOA 1G6PA 4DV1Q 2MBBB 1SYGA 1YNND 1AZPA 5C4XB 1VQ8A 1JWBD 2AWTA 2XEWA 3T1YQ 2OXPA 4A3EG 1PH7A 1PGXA 4WJOA 2PZUA 1WTXA 2DWQA 5ELFA 3SFDB 2N9PC 2MBQA 4DHZB 1V8CA 3X3NA 4L2YA 2DENB 1HR0L 3A54A 1FEHA 2XK5B 3S1QH 2E2IH 5C4XH 2AYOB 2WXRA 3OMGA 2XIWA 1O7IA 2BS3B 1EO6A 1K0SA 2UU7A 1QOFA 2QCPX 3SU8X 1Q82C 4NQLB 4YL8A 1KAAA 2RHQB 1E6EB 4DR5L 3PS6A 2NVXB 4K0KQ 3H6MA 4IQZA 4DR6Q 1WE6A 1YIWA 3EFCA 3AE5B 1EF1A 1RRBA 2HJ1A 3PQIA 4JYAL 2ZCBA 4P7IA 1SMYD 5FLMH 1IL2A 3HUIA 3PF4A 4FXKC 3H6NA 5AZFA 4A3FG 2KACA 5HGTA 1JCKB 2ON8A 1QT9A 2KHWB 2KQSA 1VDZA 1TWCH 1XWEA 4DR2Q 5J2RA 1GPXA 1RLFA 1EQTA 4LUVA 3CQZB 4H2AA 4KJOA 1GC6A 1UE1A 1V5OA 2JX5A 3E9IA 4NJ7A 3CC4A 2JZZA 1V9PA 4LF4Q 1C4PA 3EA6A 1I3QB 3RZDH 1EIGA 1G91A 1XLQA 3H9DA 3P4PB 2BBCA 2EXDA 4JW0A 5CORA 1IYVA 1LUZA 1GJXA 3ZTCA 2F0OA 1Z2MA 5C0XG 2L4NA 2ICEC 3N1YC 4IM3A 3STBC 5KYIA 1MI2A 3CF5A 4XT1B 2GLSA 5LMNW 2OHFA 3LXFA 2WX1A 1ISNA 1VQAA 2RSOA 1G6ZA 1L1OC 5BMGA 4IUPA 3OPOA 5GAGC 1V81A 3MTNB 2ZM6L 4PMCA 3A9KB 3CSFA 2K39A 4NNJB 1MG4A 2GVBA 1VRAB 1QOGA 4DU9A 1G291 1RTNA 1SXTA 1SE9A 3P4SB 1LTGD 4ZHPA 3VAWA 5M5XB 2RPVA 4GNXA 3PO2H 3S16H 2K6DB 1SE2A 2KENA 2M17A 2RDFA 4XDDA 2WKDA 2ZXOA 5EE0A 2N8NA 1DGSA 1R9TH 3D0FA 4GN3B 2R93B 4A6QA 1GC7A 1BBXC 1LTBD 3W3AA 4CDFC 4IJHA 2R92G 5I9PA 2R7ZH 1TJEA 2PE6B 5I4DA 1GM5A 1BOSA 2CWAA 4HIOA 3KJOA 1TKGA 3NVWA 2LJIA 5DPSA 3ZGZA 3ZJYC 2X6GA 3A9JA 4DV0Q 3M7NA 4F8MA 4UDUC 1B70B 3CPFA 1R9TB 3AH7A 1BVSA 2L1AA 1GUTA 1PRTC 4IPDA 3RZOB 1EYCA 4AJWA 4D2KA 3GTLH 4XDXA 4LUOA 2EZVA 3AU7A 3PSEB 2EYMA 3B0AA 2N9XA 3KF6B 2K7VA 1ASYA 1E7UA 3PUWA 2GA4B 5CV7A 3E9HA 1C4QA 2CQAA 4KKTA 1N61A 4B3RL 4YCVA 3RNFC 2JXTA 2N3SA 5C44G 2EYLA 3C1FA 4BXXG 2A6HD 2NVQH 3DHHC 2WYQA 1OXXK 4ASWC 1RTOA 3NZUA 4OVUA 2DAFA 3AEGB 3Q23A 2J0MA 1WFYA 3JSVA 4KVGB 1A6XA 4HIMA 5E6OA 2J0TD 1TWGH 1F9RA 3DDCB 2EJFC 1EY5A 4C00A 1VF5C 4IN3A 2NPTB 3IT6B 3T16A 3A1QA 4CJ1B 4JWSC 1H9RA 4NXML 2O4XA 2B3AA 4A3DB 3TMEA 2M4NA 1EQQA 4DWFA 4O0AA 2FFKB 2B8GA 1EUJA 1TWAB 3TS2A 2KD0A 4ALPA 3KLSA 4I65A 1MFWA 5L37A 5EE9A 1FO4A 5C2TB 4A3GH 2WXLA 4DBGA 1V97A 2LASA 3ULJA 3R3MA 1CHPD 4LNQA 2Y5PA 2CHBD 1L4ZB 1PLFA 2BWES 3A5UA 3RLFA 1B4OA 4NJ6A 2Y5CA 4A3BB 1SNMA 4II2B 2K6QA 4C3JG 4ACFA 5IT9E 2N0SB 2EY5A 2F52A 5LMNQ 2VUMB 2AWOA 2O2LD 1NDDA 2PW9A 2OOBB 1MJCA 4MTKA 2UUCL 2D2CC 1ZKHA 2ZNVC 1CK1A 2DY8A 5DNFA 4B9WA 1BR9A 2LI5A 3I73A 5COYA 1HA6A 4PS3A 1QUQA 4BY7B 2LGIA 3ENEA 4ZUIA 4B0EA 3MZ5A 2BYTA 1EY4A 1NI3A 2K52A 4JBKA 1N36Q 1LTTD 2PI2E 3STBD 3BY4B 4CKBA 1VMPA 5JOBA 3AI5A 2NZOA 3LB8C 1V1QA 5IYDH 5JJKA 4XQQA 2I07B 2K14A 2DNFA 3HRDD 3AE3B 3T51B 3GTMB 2EELA 4J6IA 4DNRB 4TUUA 2A6ED 3R2IA 1Q5WB 1N8RC 2MJEA 2WGSA 2CR5A 1S72A 4OEMB 5CBAE 3NJTA 1Z5SB 4GIVA 2K33A 1WF9A 2PEAA 1B9NA 3KF6A 5G3LD 4JI6Q 1BUIC 2Z6BA 1QQRA 3M95A 2K04A 3E56A 1H8CA 1PYSB 3VTVA 2FMCA 3GTQB 2EPBA 3T3OA 4A55A 1T0QC 1UGMA 2BW2A 2PZWA 3M3JA 4I6PA 5D65A 1EU4A 1O7LA 1Q90A 4UPAA 3DLLA 3CCSA 1C1YB 1J0GA 1CZGA 5IP9G 3ZRCA 3N52A 4C56C 2NCNA 4X3TA 2XVSA 5BYSA 4HCEA 2TMPA 3TBLD 3NWSA 2F0UA 1YQ4B 2V1CC 4GNXC 2N9LA 2JN4A 4JI7L 2KDBA 1K53A 2M19A 2B2TC 2G4SA 4ZHOA 1XMQQ 4UP9A 3JW0X 2I5MX 3J7A5 2W54A 2B2VC 4M8MA 2IBIB 3ML9A 1WD0A 4A90A 3HGBA 2MCNB 2O6VB 3BK2A 2CKZB 3DBSA 1SR3A 1Q7YC 1YZ6A 2LXKA 1HNXQ 5KGUA 4DR4L 1EF5A 1QF6A 3W1SA 4C2MH 1D2BA 2ONQA 2VQEQ 1VCBA 3ZQ4A 3KUCB 4GKJL 1W2BA 4LK1C 4JI5Q 3VXWA 3M3YB 4J8QA 1Y56A 2J52A 1C48A 2WDRB 2SNMA 1IKMA 2D3GA 2EY1A 5HHDG 3QR8A 2M0XA 1RDPD 1XMOQ 4URKA 4LDTD 3C46A 4IOCA 4LFCQ 1KNEA 1DONA 2I5HA 4KGSA 2WU5B 3QA8A 2EYOA 3TZUA 2Z1CA 5LL6X 1AE3A 4EQPA 3H0GG 4KN4C 4AP4C 4K5XA 2B2WC 4CDDC 5IIFA 2M8SA 1R4QB 5LNK1 2B8FA 2E6XA 1LT3D 4X64L 2Y0SE 4M0WB 1GB4A 3UDIA 1CQFA 1HZCA 4PZ6A 2Y3AA 4RHSA 1E7PB 2UXBL 2V4LA 3BVGA 3CU7A 1XNRQ 1DZ1A 2MA9B 4JG2A 4DPGA 4NAMA 1JRPA 2BQQA 2JA6G 5IP7G 2YVCA 4GOPA 4C7YA 4KZCA 3C3LA 3NELA 1VZ8A 5J39A 1FJGL 2AHOB 3M3YH 3WAMA 1X54A 1B3AA 4A3LG 4DQOC 2KQ4X 4JQWC 1WTHA 4RH6A 1XEEA 1DGJA 3DQVA 4WJQA 4B6WA 1KC8C 2XRSD 5LMNL 2KJRA 3HOYH 3Q22A 2L52A 2HJ8A 2M56B 3B6YA 3WDNA 1YJ9A 2NS5A 1HNZQ 3SGIA 3TCAA 1WI0A 2LHDA 3CP0A 4LW1A 1LLRD 3AFPA 2OF1A 4B3SL 5E4XA 3P2BA 3NTIA 3RD4A 1GB1A 2EJMA 4MTNA 2HQLA 3PPAA 4FF3A 4JI1Q 4JPBW 2GVAA 3LX0A 1Y8PB 4KMUC 2NWGA
chains in the Genus database with same CATH topology
5I6YA 1E9MA 1SNCA 1TKEA 4YT0B 3U7ZA 3I4LA 3E0JA 4KGRA 3HOXB 1WGKA 3TEXA 2K5WA 2YEPB 3K57A 3Q0AA 5M3FB 4FYDA 2BDNA 5C3JB 4Z9CB 3C8YA 5D7GA 3N6RA 4L6TB 2M9VA 1KLGD 1AFPA 3CIRB 2B2UA 2RMMA 1SAPA 1FNVA 1TT2A 5T1GA 4K5VA 4HROA 5E3FA 4DNTB 3ABVB 2HDEA 2IGHA 2FUG1 4ZK9B 2KA7A 2AQ3B 1I6VC 1R4PB 3FKIB 2CU3A 1Z6HA 3HP3A 4YTPB 3P42A 1STBA 1SNDA 3HVDA 3HG9A 4LMQD 2B2TA 4P6VF 4B9XA 4H0LC 3J7AV 1N63A 3OW7A 2KUMA 3IAYA 5DM63 2JWUA 2BOSA 2F0HA 2DLBA 3FC4A 5C3WA 1B44D 3BZDB 2AUJD 1P7FA 2NN6I 1O7YA 1WTOA 1G2SA 3ZJVA 4AYBB 2DNCA 3S2HB 3AEAB 5J22A 2AUKA 5HFYA 3GTJB 1Q8IA 4RGOS 4IFDG 4RNAA 2LFNA 1F0ZA 2JA8B 2WXGA 4J1MA 3FRPB 3SEBA 2PMVA 1J9OA 2MUYA 4LK0M 3AECB 5I2XA 3R2TA 1FXAA 1SYCA 1PFBA 3V05A 2WLBA 1LT5D 1O7ZA 4KHZA 1HQRD 3SK5A 1T5XD 1ILQA 2L55A 3NZ3A 1LT6D 2MH7A 1HUMA 4L1BA 1GUGA 4HMJA 3VR6A 2D62A 4DN4M 2EDGA 5FO9B 3KLRA 3GTLB 3V3XA 2PCFB 2B2UC 4K8JA 1TWHB 1JICA 1PTOC 5I9OA 4JK1C 1XF5L 4YIJA 5C5MA 3DUZA 1PUTA 2XWJB 3DWAA 1B9RA 4H44C 4A3MB 1EM7A 5D3DA 3U9OA 3V96A 1ACCA 4RAUC 3Q69A 4X3KA 2MGSA 1C77A 3NVYA 1C4CA 4MACA 4A3FB 2CJNA 2EYJA 1DJRD 3I72A 1TY0A 1QJOA 4OIJA 5DAUA 1TS3A 3D3RA 1ESRA 3CHBD 3EFXD 1RWSA 1RODA 3E6ZX 1EEID 3ITPA 3M7GA 4TMAB 3LWEA 5AUKA 1BDOA 1TWFB 3BIID 3NPPA 1QKZA 2D5DA 3Q8EA 2MPMA 2EY6A 2BE5D 4XE0A 1IGDA 4YXDB 5KNDA 4AQ7A 1CFMA 2DYMA 1I7HA 4K8IA 4A3KB 2L0CA 5LHY1 2F0WA 2R92B 3AE8B 1V43A 2ZW1A 3EVQA 2E2JB 4KGTA 3BVMA 3TEWA 4WRDA 1SSOA 3T4AC 5JEAJ 1YN5A 3U52E 2XNAC 4ZAIA 1TYGB 2EE1A 3CWIA 3S1QB 4C1NI 3G7LA 4N58A 4DAYA 1II3A 1B2TA 5K36G 4RGNA 3SK4A 3EROA 2YYZA 3P4RB 3NUCA 1UAPA 4G4KA 4HAEA 1L6UA 4RKBA 3OIQA 3URYA 1UUPA 5JPMC 2X69A 1XTCD 4CHTB 1JMLA 3WOEA 2Q8TA 2PLPA 3FILB 3A8IE 2W3RA 3FPPA 1UWXA 4TRDA 3VRBB 2F0PA 3H91A 3W2DA 1HCZA 1IYUA 1RD9D 4MH8A 2JXMB 4L23A 1PRTF 2K3UA 4ZOHC 2LFIA 1J7CA 1DOIA 3S9WA 5E4WC 1CT1D 1H9SB 1LTAD 1EOTA 3J7YW 1BMLC 1JW9D 1AEXA 1MBYA 4X3SA 5CV5A 3N9YC 1MSGA 4OVZA 1LTID 1TWGB 1CZPA 2HTME 4MIUA 4DK1A 1A15A 1ENAA 1FFVA 1XYIA 1DXMA 4C3JB 4O42A 3SK8A 2MHVA 3VQIA 1STGA 4P2CB 2F0QA 2V0GA 3JAME 1FM0D 4TKOB 2QSDA 3A7LA 2JEAI 2PO4A 4JE3B 3K7AB 1PYWD 1Z47A 1S5ED 3NQTA 1PDQA 5BN5A 1E2WA 1FRDA 3IAM1 5IGEA 3NS1A 4C80A 1K52A 4MHEA 3BDOA 2JYOA 1WTWA 2BB5A 2NN6H 4WJWA 4OZBA 3HRZC 1E0BA 5F2DA 3AEEB 3QOLA 1EZ8A 4B0MA 3K6OA 4S3SA 4QF4A 2E75C 3QOJA 1TKWB 3D4RA 4KTAA 3IFDA 1I4XA 5CV4A 4RCOA 3K5LA 4OIKA 2IX3A 1DOKA 3MHBA 5CC4A 4L8JA 1H9MA 2H1EA 4RCNA 2XN9C 2EKIA 3D8GA 3WOFA 1QCBD 5JJZA 1E2ZA 4HR7B 5BYQA 4CQNA 3IKJA 4YSZB 4PMWA 1WTPA 2JSOA 2FJ2A 1FFUA 2WP8J 4EQNA 2QF7A 3HOYB 2A68D 3JAML 4F7XA 1YN3A 3AE9B 1NEKB 1L4DB 4KK7A 2JZPA 3EJIA 1LT4D 1ZEQX 2PPBC 3S1NB 4XXEA 3PO3B 1T6BX 3H0GB 4FF4A 2ZXPA 1M8AA 3NUHB 1AP0A 2KEEA 1VCIA 3MTSA 3HOUB 1CHQD 1HTPA 3PO0A 3J7AF 4ULLA 1AW7A 3D4WA 1MD2D 2VB2X 2IGDA 3M4OB 5J1ZA 1EY9A 3BS1A 3EGRA 2BT6A 2K32A 4CGYB 4QMGA 1K8OA 1JB3A 4R3DA 3DHQA 1L6VA 4R8NA 4WURA 1MHHE 2NBFA 1ZDVA 2I38A 2Q5WD 3AV8A 3PUVA 2KCCA 3MAQA 1E10A 1ZKOA 3DEOA 1WWTA 4WIPA 4F87A 3GV3A 4LAAA 1XX8A 4PMBA 3GTPB 1KLUD 3TSSA 3L7ZC 3VR8B 3GTOB 2WV6D 2L32A 2W3SA 4WWMA 4U68A 3J9CA 2PVOD 1EY0A 4NAWB 3OOCA 3I4MB 2PTLA 4M0WA 3LNNA 1F2MA 4M1UB 5C0XI 2Q8IB 2A6EC 3DWMA 4REZA 3R93A 1QOAA 1Y8OB 4CBVA 1OO9B 5FK9C 2WXIA 5M3MB 5EBDA 2B2VA 4KKJA 2J53A 2DYOA 1SEBD 2PZTA 1EY7A 2KCNA 2RBMA 2L11A 3A8KE 2H4OA 1BO0A 1F9QA 3I4NB 2HDMA 2KHSA 2V4DA 2WNMA 4G57A 4ITKA 2KJXA 2EY2A 3GD7A 2J7ZA 3MEHA 4KV6A 3S17B 1XLNA 5EPLA 2JP1A 1ZOYB 1P7EA 4TSSA 1ET9A 3CRKC 1CQVA 3MHZA 4QUFA 2IJ0A 5FR3A 2TSSA 2DNEA 1LABA 5T8IA 1EU3A 4HSPA 3B2FA 2KAJA 1V1PB 3NTKA 1PGAA 3NSWA 1JALA 2N7JA 3OMCA 1PDXA 4LJZC 2F0LA 1MGSA 1NAPA 1EWHA 5CGKA 4OZAA 4OO1G 2F4IA 1ZP0B 3DXJC 1WCMB 1YNTE 3AE4B 4YSXB 4HJGE 3VYRA 1IBXA 3AE1B 5KNBA 4XIGS 2A6HC 4EQOA 1ENCA 3MXGA 4YTMB 2K5DA 2F0NA 2J4XA 4C3HB 1LTSD 1Z7TA 5EPJA 5DEHA 2NTTA 1GUSA 2WDQB 1C78A 1D5XC 1F2LA 2NVQB 1EWCA 3QB3A 2X38A 3AN1A 1FR3A 2G1EA 4F88A 4IUQA 3SK6A 3NRZA 5G5GA 2ACZB 4GDKB 2CVRA 2MEKA 4NW2A 3D31A 1K50A 1A2TA 1O80A 1PZJD 4CJ0B 5FOBB 2L83A 2D9UA 3TP6A 2BA1A 2WXQA 2H89B 3V2TA 4NJCA 1K8MA 1U4MA 4IUNA 5KIXA 2KWDA 2WXPA 1AZQA 3K5OA 1BNZA 3P75A 1HFGA 2B2WA 4CKEA 2PKOA 3Q8BA 4UAIA 5EJWA 1X3QA 1NSNS 3PIO3 1H9KA 1Q12A 1PTOF 1IL8A 1RJTA 1A70A 3VA5A 3PV0A 1NUCA 2GI9A 3EUB2 3Q6SA 2RQXA 1K83B 1MI0A 2Y0SB 1RHPA 4KHVA 5C3EB 5GXGB 1V1PA 1IBXB 2GRIA 1TR5A 5K36H 2Z4HA 2SEBD 2EJGC 4C3IB 3RZDB 1OXSC 4XQNA 2JEBI 4IDIA 1AN8A 1SNPA 3S2DB 1A3VA 1U4PA 1OXVA 4RFBA 5ELEA 3LYYA 4FXCA 3PUXA 2V3PA 1E0ZA 1TY2A 3P1HA 2K9XA 3BDCA 4KKUA 3B9JA 2XWBB 3A56A 3GS2A 1YNJC 1UNSA 4R8IA 4K6LA 3MJ5A 2PQEA 3NTHA 5CR3A 2H88B 4XYOA 1C8CA 3J80L 2E2IB 1D4BA 2OEOA 4EVOA 1PTOB 2O5JC 1IUEA 4HEDA 2JE6I 1EWYC 1GAQB 3NVZA 1BUVT 1VLBA 1FD7D 2IX1A 1H9SA 2N88A 3A8JE 1TS2A 1KDAA 4KY5A 1JE4A 1ZE3D 1B1ZA 1V8QA 2IPKD 1EQVA 2KEDA 3FDTA 5FLXE 4FF1A 2F0IA 3VR9B 2G9DA 3H8HA 1VZ7A 3GQBA 3NHHA 1FNWA 2PYKA 2JYEA 4KY6A 2WQYB 2F0FA 5I2YA 2NB0A 3B2GA 3F2UA 2PNRC 3I57A 2LHEA 1WSPA 4A3EB 4IFDH 1STEA 1SFOB 4RKLA 2YEPF 3OWEB 1N5WA 1G8ZD 1DCZA 2LMCB 4NDXA 2A69D 5A35A 4ARCA 1GUOA 1J7BA 5C0XH 2QMTA 3VR4A 2N55A 3Q24A 4BBSB 5G3LF 4K6DA 1CA5A 2EOTA 3NWTA 2XSCA 2EYHA 5M5YB 4OW0A 3PUYA 1UGJA 4XQJA 4C7ZA 2L9HA 1J7AA 4R9WA 1U9RA 3I70A 1JOKA 2F0VA 1IKLA 4IUUA 1PFNA 2IX0A 4ZQ3A 4KJNA 2EYPA 3U2SC 1HZ5A 2F0DA 3I9V1 2NYZD 2PMZB 3S15B 2LY7A 1F2RI 4EE2A 1SDFA 4HN7A 1FCCC 1XO3A 4ME5A 1IGCA 1EYDA 3AEDB 1ZYRC 4YSYB 3PZ8A 4C2MB 4FXGC 4KD3A 2B76B 3SR6A 1MHXA 3I91A 3ND8A 2K0PA 4HMIA 3P7JA 4J6HA 2F03A 1C9FA 2WACA 2KECA 4N9PA 2CJOA 4V190 1SYFA 4ZRZA 2F0MA 3HS0C 1SF0A 2G9HD 1FMAD 2A74C 1WTVA 1AWDA 1UEAB 2SOBA 3W5VB 1EFID 4ZYSA 3IL8A 1NYQA 3OIPA 5EE3A 3MXUA 4PV1C 1XXGA 3D6CA 2PIAA 1QNUA 3NP8A 4ID6A 3H94A 3FPUB 5E6JA 3T3NA 4IFDJ 1CI3M 4Y7NB 5CMDA 3HKZB 3VRAB 2A68C 3RPFC 3BG3A 3HOZB 4QCLA 3FEWX 4MM3B 2KDMA 1DM0B 5FKAC 3P20A 4N6EB 3S1RB 1X32A 3VYTA 1MVKA 3PUZA 4WORA 1VF7A 3VR2A 1TZOA 1JR0D 3OWFA 5IGFA 2LS01 4QIWB 1SSNA 3T13A 5EPKA 3TP8A 2XRQD 1L0XB 4U673 3DMUA 1DOXA 4G7HC 3A7AB 5CV8A 2JA5B 4ZKBB 3GTGB 4XYQA 4TQ1A 3DEPA 1D5ZC 1OFFA 2K5PA 5JVG3 3AB5A 1I4GA 3ONAB 4MT5A 4YTNB 4KKIA 4A3GB 1SYBA 3TZDA 2IT1A 3QWNA 3IAS1 2BA0A 4FO2A 1ICWA 3MFYA 1NR2A 2KVMA 3BK1A 1JQ4A 1XCQL 4DFAA 1QILA 1I4RA 2F0GA 1RYJA 3S14B 3W9CB 1GHJA 4NKLA 2E2DC 2EYFA 2RSNA 4IALA 2KOLA 3KWVA 3SR1A 1FRRA 1D5MC 3M4YA 5BMIA 2HDLA 1PZKD 4E6IA 5BN4A 3AEBB 3ZYYX 2JSVX 2WU2B 2BCOA 1TS4A 1STAA 2PVGC 1G2TA 1GHKA 1L0VB 2FE8A 3UI2A 2I46A 4G7OC 1PRTB 1FNUA 4RWSC 3SDZA 4G7ZC 3ZJUA 4P16A 2PW5A 4LLGM 2Z8LA 3GV6A 2MJ8A 1BCPF 4FP5D 1B50A 1A3UA 4NP5A 5EE1A 2VZKB 1PRTD 4BS9A 4A9AA 2WXMA 3MP9A 3L9AX 2F0TA 1PXUA 5IGDA 3TEZA 1GXDC 2L1BA 3FMCA 2CW0D 1BXTA 1CA6A 2V4IB 2N9KA 1JROA 4KKSA 1SJHD 4O1NA 3KK7A 3DWQA 2HQEA 2K5QA 4A3JB 3RUZA 1YN4A 1HQMC 4N59A 2INNE 2F0KA 1I4QA 1IW7C 4OO1I 3QG1A 2HUGA 2MP1A 3NK9A 3PIP3 4H7BA 4Q5VA 1JOOA 5EGTA 4US9A 2K6AA 2GB1A 1TWCB 5EKIA 1EY6A 2ENBA 1EY8A 3S1MB 1ZXTA 4WAFA 3BYTB 3P63A 2AQ2B 1SJED 3TEYA 5ELBA 4WFN3 3RFZB 2QEJC 1SIJA 1ML0D 3OHXC 3QO2A 1Y8NB 1ZXHA 3GO5A 3TN2A 3I90A 4K2KA 1PMRA 5D3IB 3GTKB 1HTLD 2SDFA 3QJYA 3KBXA 4AS1A 1T5EA 2NUCA 3BYYB 3CKIB 3MA2B 2C9OA 1C79A 1X3PA 1U4LA 5KEEA 5KYLA 1WD1A 2JYTA 2VNUD 1S5FD 1TIID 1WVLA 3J81L 1HFNA 1CM9A 2VZKD 2JU6X 3ND9A 2IDYA 2K01A 2QDBA 1B53A 1HXYD 2QKIC 3ERQA 1STNA 3UI3A 4M8AA 1LO5D 1OXTA 1EL0A 1FYCA 3K59A 2WXNA 1OQRA 5EBCA 3O13A 4Q2JA 1TU2B 2WXJA 4IFDI 1WYGA 1JWSD 1PGBA 1F9PA 3KWLA 1JORA 3DWGC 5HI1A 4Q0FA 1A3TA 1SNQA 4BY1B 5D14A 2F3WA 3VR5A 3R3OA 1NCVA 2NZ1D 1XCTL 3KF8A 5FO7B 2MJDA 1Y69U 1A2UA 2KN4A 2BTEA 5A2QL 1JC7A 1RM6C 2WB1B 4DAPA 4DAVA 3I3CA 4XTCS 2SAKA 4ABNA 1YNJD 1PFMA 2R61A 3TP5A 3AMUA 3D4DA 3K5NA 4ZRPA 1I6HB 3SHLA 2WDVB 1DOMA 1SBBB 2RKSA 5BN3A 3AEFB 2AWNA 3L3OC 1Q1BA 4KI0A 1R7SA 1YNNC 3VA7A 3NVVA 3VR3A 3KUPA 1FXIA 4JWUC 1S5DD 1KNAA 3NQIA 1S5CD 2R7ZB 1CZWA 1QOHA 1F2ZA 3IXSA 5H92C 1SYDA 2QJLA 4ZRQA 5ISRA 1EZ6A 4C1NK 1F2YA 1WTQA 4ZUJA 4FVMA 5G5HA 1KFYB 2EVBA 2E74C 1F9SA 1VMCA 1BQQT 1DOLA 2FBWB 1KF6B 3BWUD 1HRJA 1NENB 1ZUD2 2BS2B 1WTRA 4X3UA 5M5WB 2F0JA 2M00A 3PZ7A 1SMYC 1RCVD 2JA7B 4PT5A 4XT3B 3QIAA 3FVQA 1CTMA 4L63B 2B2YA 4US8A 4BBRB 4DXFA 1B9MA 2WXOA 1D1IA 5KRUA 1QNKA 2K28A 2W55A 4OO1H 1YMHE 5HURA 1KDBA 1LV9A 3U4EG 4RHRA 1F2RC 1T3QA 4WH4A 4OZCA 2WIIB 1ONLA 3CRLC 4N9TA 1RKNA 4DA2A 2AQ1B 5A2QE 5KNCA 4FNFA 1KTKA 4K14A 4NZLB 1RFKA 1QB5D 2D5GA 2WKCA 1O78A 4KD4A 4A93B 3NE5B 2O5IC 3X3MA 5CBEE 4PNYA 1DD2A 4GLSC 4HEA1 2FINB 3BDLA 1FIQA 4YWGG 1XLPA 5C4HA 1VDVA 1JWAD 4XWTA 1DYQA 2MJ3A 3C1EA 2V3NA 1OQQA 3K5MA 1EYAA 3MXPA 2VB3X 1ZDXA 1HPCA 2F1MA 3TBIB 2L12A 5H8YE 1N62A 1IHZA 1I4HA 1TS5A 2WS3B 1L0YB 2PW7A 4ZLTF 1V1OA 3Q8FA 5DM73 2X6LA 2I2YA 1ENFA 2K03A 2RDGA 1SE3A 1WRIA 5IODA 2ID0A 1WXQA 5C44B 2LUMA 5FO8B 4OGQC 1HA5A 4IUTA 3C2PA 1LACA 3PMFA 1ET6A 2VXWA 5JVH3 5HG2A 3NBIA 5JEAG 1MPEA 2INPE 1TKYA 5E1FA 4CJ2C 2OT2A 4ODGA 3DWPA 5K5PA 5IT9L 4NMZA 3M85A 4RA8A 2B2YC 2RA4A 2M0AA 2FMMA 1HHVA 4HCSA 2W82A 2R6GA 1BCPD 1PTOD 1GOZA 1QLBB 2FHTA 1NVID 3HEJA 2NVTB 2LEKA 5M9OA 5JXVA 2E2HB 1GUNA 2JQRB 2A69C 3K58A 1NYRA 5AFWA 3AE7B 3FILA 1K51A 1QOBA 4TQ0A 2K1BA 4EGVA 2DBYA 3E5SA 1I50B 1LTRD 1QE6A 1SNOA 2F0EA 1VZ6A 4GDLB 3S16B 3H3VC 2LMCA 1D6EC 4H13C 1FGBD 2IW3A 3LWUA 3W5UB 1JWMD 2E3TA 1J8IA 3I8ZA 5C4JB 3MWYW 3NBHA 4HKZE 5CV6A 4V0BA 1S5BD 3EQLC 2Q8RE 1C4AA 1MSHA 5ELDA 4CKCA 4JPSA 4ARIA 4HKQA 4PQXA 1EEFD 4DF7A 3Q8CA 1PZID 4OHJA 5CV9A 1ROEA 4TQUS 1BF4A 3AE2B 3A55A 1QG7A 3SE0A 1ESFA 1JQYD 2E76C 4BA1I 4WQMA 2F0SA 3R8BA 2B39A 4XWWA 1SYEA 4QUCA 2NTSA 5AUIA 1OXUA 1N60A 1Q3LA 4DGZA 3TDQA 3ETRA 1YJJA 4MN3A 2OEDA 1M4VA 5CYUA 3TUOA 2J42A 3AM9A 1KH0A 2F3VA 5C4ZA 2NN6G 1EIHA 1STHA 1VJKA 2L5TA 2BS4B 3VYSA 2DN8A 5JAVA 1W6JA 3P1MA 5NUCA 1SE4A 3RMHA 1AYFA 3D6WA 3T56B 1Y1WB 4KX6B 3OSOA 3DM1A 4IURA 2QIEB 4RGTA 2IL8A 1KDCA 1S4ZA 1PTOH 4USAA 3KLSX 2KMMA 2ZXRA 1STYA 4C3HG 1BCPC 1VR9A 1FCLA 4K5WA 2NMQA 1CJEA 2WXFA 1Q10A 2JA6B 3SVMA 1ZXIA 2DY7A 3J80E 3IFTA 2IGGA 3ZJTA 3HOVB 4DK0A 5EKKA 4KN7C 5TSSA 3MFGA 2SNSA 3VYUA 3NXWA 3Q8AA 1PFDA 3H09A 2KQ3A 1TVXA 1H9JA 5EKLA 5ELCA 3KBGA 1Q1EA 3L4PA 3J81E 5C3XA 5JEAH 4HTHA 3WCQA 3U9SA 5FLXL 1N5XA 2NVYB 3AMZA 1SB3C 1QWYA 2BB6A 3GP7A 5IGCA 4IOIE 5IGBA 5EQ0A 4FXDA 3G6JB 2K22A 1HZ6A 2Z4IA 1L5PA 5BYRA 4DXGA 3T53B 2C5CA 4HRSA 1HUNA 1ILPA 5MPOA 3BVZA 1ZPSA 1D1KA 3MXNA 2HCIA 1BCPB 1KRHA 3AB9A 1U4RA 3FAHA 4OL7A 4QB4A 4BA2I 4GZYC 4IKGA 2WAQB 2WP9B 4C3IG 4ILWA 3HZXA 2IWHA 3AE6B 2ICIA 1Y1VB 1TQOA 4RF1A 2ZT9C 3P4QB 1DOYA 5T1IA 5JPNC 2EXZA 3HOWB 5IOCA 2A73B 5I6WA 3PO2B 2RVLA 5LL6S 1ZYRD 4A3IB 4A8XC 2BE5C 4K2LA 4IZ8A 4ZKCB 1HEZE 5C0XJ 1YJIA 4JBWA 2HCCA 3TP7A 4B08A 4XDCA 2A5HA 2K05A 1GUWA 5C5LA 2LKVA 1C76A 3GB1A 2YU9B 1KABA 1FD6A 1JOQA 4J3OD 4HSVA 1E2VA 2QILA 5C6AA 2B63B 2ZW0A 1XLOA 4LTUA 2CW0C 1NR4A 2M2LA 1YQ3B 3K0YA 2WXHA 3KQ4A 3E9SA 4JX1C 1F77A 4I7ZC 3HVZA 4RF0A 4FF2A 1UWMA 4BWGB 3MVVA 5BMHA 1I4PA 1RF2D 2R3ZA 2AX5A 2WINB 3SFEB 1IW7D 3IT4B 5IGGA 3SXHA 3MC0B 1JWUD 4IUVA 2WXKA 1W6KA 4RGMA 4KY7A 2RDHA 2BDOA 1SYGA 1YNND 1AZPA 5C4XB 1JWBD 2OXPA 1PGXA 2PZUA 1WTXA 2DWQA 5ELFA 3SFDB 1V8CA 3X3NA 4L2YA 3A54A 1FEHA 2WXRA 3OMGA 2XIWA 2BS3B 1QOFA 2QCPX 1KAAA 1E6EB 2NVXB 3H6MA 4IQZA 3AE5B 1SMYD 3HUIA 4FXKC 2KACA 5HGTA 1JCKB 2ON8A 1QT9A 1GPXA 1VDZA 1XWEA 1EQTA 3CQZB 4H2AA 4KJOA 2JX5A 1C4PA 3EA6A 1I3QB 1G91A 1EIGA 1XLQA 3P4PB 2BBCA 5CORA 1IYVA 1GJXA 2F0OA 5C0XG 2L4NA 2ICEC 5KYIA 1MI2A 4XT1B 2OHFA 3LXFA 2RSOA 1G6ZA 5BMGA 4IUPA 3OPOA 4PMCA 1VRAB 1QOGA 4DU9A 1G291 1RTNA 1SXTA 3P4SB 1LTGD 4ZHPA 5M5XB 2RPVA 1SE2A 2RDFA 4XDDA 2WKDA 2ZXOA 5EE0A 4A6QA 2R93B 1BBXC 1LTBD 3W3AA 1TJEA 5I9PA 5I4DA 1BOSA 1TKGA 3NVWA 2LJIA 3ZGZA 2X6GA 3M7NA 4F8MA 4UDUC 1R9TB 3AH7A 2L1AA 1GUTA 1PRTC 3RZOB 1EYCA 4D2KA 4XDXA 2EZVA 3AU7A 2EYMA 2K7VA 3PUWA 2GA4B 5CV7A 1C4QA 2CQAA 4KKTA 1N61A 2JXTA 2EYLA 3C1FA 2A6HD 1OXXK 1RTOA 3AEGB 3Q23A 1A6XA 2J0TD 1F9RA 2EJFC 1EY5A 1VF5C 4IN3A 3IT6B 3T16A 4JWSC 4CJ1B 1H9RA 2O4XA 4A3DB 3TMEA 2FFKB 2B8GA 1TWAB 3KLSA 4I65A 5EE9A 1FO4A 5C2TB 2WXLA 1V97A 1CHPD 2Y5PA 2CHBD 1L4ZB 1PLFA 3RLFA 1B4OA 2Y5CA 4A3BB 1SNMA 4C3JG 5IT9E 2N0SB 2EY5A 2VUMB 2AWOA 2O2LD 2PW9A 2D2CC 1CK1A 2DY8A 4B9WA 5DNFA 1BR9A 3I73A 5COYA 1HA6A 2LGIA 4BY7B 4ZUIA 4B0EA 3MZ5A 2BYTA 1EY4A 1NI3A 1LTTD 4CKBA 1VMPA 5JOBA 3LB8C 4XQQA 2I07B 3HRDD 3AE3B 3T51B 3GTMB 2EELA 4DNRB 2A6ED 3R2IA 2MJEA 5CBAE 2K33A 1B9NA 5G3LD 1BUIC 1QQRA 2K04A 3E56A 2FMCA 3GTQB 2EPBA 3T3OA 4A55A 2BW2A 2PZWA 5D65A 1EU4A 1O7LA 1Q90A 1CZGA 3N52A 4C56C 4X3TA 2XVSA 5BYSA 4HCEA 2TMPA 3NWSA 2F0UA 1YQ4B 2N9LA 1K53A 2M19A 2B2TC 4ZHOA 2W54A 2B2VC 1WD0A 4A90A 3HGBA 3BK2A 5KGUA 1QF6A 3W1SA 1D2BA 2ONQA 3ZQ4A 4LK1C