4EFOA

Crystal structure of the ubiquitin-like domain of human tbk1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
PLGSTSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase TBK1
publication title Crystal structure of the ubiquitin-like domain of human TBK1.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4efoA00
1EO6A 1E90A 2L8JA 2BPSA 4PYZA 4IC7B 4KV2A 1S3SG 2BYFA 2DAFA 1V9JA 5CHFA 1WMHB 3AU5A 4DBGA 4WJPA 2L7RA 4E74A 2BF8B 4BKTA 2LGXA 2R2QA 1BT0A 4MGYE 4KVGB 4FJYA 4BBNF 3APCA 1ZW7A 3DVGY 1IPGA 2K1FA 4CHKA 1VCBA 2AL3A 4WAAA 2KOXA 3ML9A 4N9F4 2FIFA 3PLVA 3VH4B 3ECIA 4I6NB 4HPLB 5JHBA 1M94A 1KM7A 5CTRC 2BKRB 4EUTA 5JZEB 5DPTA 2C7MB 2D07B 3UF8A 2MW5A 1YJ1A 3DDCB 4WQOB 2MSED 3JW0X 1Y8RC 4EZJA 4EFOA 4BBNC 3H7PA 1UGMA 4W9EA 4TUUA 2GBMA 1Z5SB 2FNJB 2XBBC 3RULA 3JSVB 5D6JB 5AEKB 2KN5A 4MGZE 4DHJD 1WZ3A 2J0JA 3CMMB 4DXAB 4JGHB 2DAJA 1WJ6A 4IM3A 5FR6A 4BOZB 2KTFA 2JXXA 4HK2A 3SDLC 3R7RA 4ZRIA 3JYUA 3W1SA 1E8ZA 3PRPB 1L2NA 2AYOB 1ZKHA 3VH3B 3HHMA 1WGYA 4HLEA 2KO3A 3OAWA 2MBHA 2O6VB 4HWIB 3NZUA 2FCQA 2M4NA 2BWFA 4GDKA 4X57B 1P3QU 4MH0E 4WJNA 1YX6B 2C7NB 2JVCA 1Q5WB 1RLFA 2DZIA 3HK0A 4GB9A 2C9WB 2ZZPB 4ASWC 1J8CA 3A33B 2GBJA 3R66C 4K7SA 5DCNA 2JF5A 4K1RB 4IUMB 1SE9A 2AWTA 3GOEA 2Z59B 3B08A 1I35A 3QAQA 3VUXA 3QQ8B 2KLCA 1GG3A 4EZLA 2C5LC 2GOWA 3WANA 4PYUA 3V6EB 4II2B 4NQKE 4GDLA 3DVNV 2N7EA 3DVNU 4LDTD 3PHXB 4BOSC 4P7IA 2IBIB 3Q3JA 3GZNI 5AZFA 4M0WB 3PRZA 3TBLD 4GMVA 4MJSB 3PTFC 3NZSA 2EMSA 4FULA 4NJ6A 3A4RA 2KVRA 5GMVA 1V2YA 1WGRA 5CHWA 4XX5A 5D2MB 1R4NI 3IHPC 2IO1B 4GN1A 2DYMA 4FHKA 2RPQA 3C0RB 4FJVB 5D7GA 2W9NA 2CHZA 3HM3A 1WM2A 3N3KB 1S1QB 2N4FA 4W9JA 3ZLZA 4CYEA 1UELA 3V62A 1WXSA 2NBUA 3ZNHB 2D10A 2N7DA 3UGBB 2XEWA 3RT3B 2K6DB 4PS8A 1XT9B 1D3ZA 1E8XA 2WYQA 1TZ1A 3NOBA 4XZ4A 1V81A 2NVUI 1QZEA 3VUYA 5C1ZA 1RAXA 3IG3A 4MSQB 4NNJB 5L83A 2KQSA 4AJYB 1LM8B 2YLMA 2B3AA 2JPHA 4WJOA 4B95A 1LQBA 4F7ZA 1VD2A 1C3TA 2KTRA 3T9LA 1P0RA 1V6EA 3PPAA 2IY1B 4KSKC 3RUIB 1G6JA 2I1JA 4ANUA 3K9OB 4DHZB 2DX5B 3A9JA 1KJTA 2O2VB 2G4DB 2KKCA 2NR2A 4G0NB 2BYVE 3RZWC 1OTRB 3DBSA 3PRMB 2NPTA 3V6CB 3ZKJC 3UINB 4LCDE 3R7QA 3DVGX 2ZVOA 2NBVB 4IM0A 1EUVB 2D3GA 2GBNA 2LGYA 2DENB 5E6NA 1Q0WB 2LRWA 2PPHA 5J2RA 1WMHA 4W9HA 4AJWA 2PJHA 3BINA 4GXBA 2JRIB 2MLBA 4ZYNA 1C1YB 4NQLB 3DBLI 2UYZB 2CKHB 2L3ZA 3PGEA 4PS7A 3V61A 2K8HA 4BKSA 1WX9A 3L54A 2PE9A 3APFA 3HM6X 2BKFA 3ZTCA 5G2NA 2G4SA 1WF9A 1V49A 2GBRA 2ZEQA 2ZCBA 5JHAA 3VHTC 4W9IA 2AEHA 2KFJA 2PE6B 4IWPA 5BO4B 2J0MA 3OJ3A 3X23A 2JRHA 3RD2A 1EF5A 2FCSA 2AL6A 2KWVB 4ZRKA 5D94A 2Y5BB 4K7UA 4HCNB 2MQJA 2LZ6A 3JSVA 3SU8X 4W9FA 2LXAA 3N30A 2ZCCA 2QHOA 2FUHB 1NBFC 3A1QA 3CSTA 2KMCA 3EECA 3PZDA 2FAZA 3ZW3A 3B1LX 4DHJB 1LXDA 1OGWA 1T0YA 2V3SA 2LD9A 1RFAA 3ZRFA 3ZUNA 2IY0B 5IAAC 3PHWB 2CR5A 1WE6A 2FCNA 4LJOB 4KIKA 3PV1A 3WAPA 4IM2A 4WWOA 2KWUB 2KD0A 3DOWA 2M0XA 4MEMA 2V4LA 3VTUA 4NPNA 1WGDA 2PEAA 1GC7A 1Z2MA 2KC2A 4JQWC 2CHXA 3A9KB 4AP4C 3ZDTA 3M63B 1UBQA 3SD5A 2KFKB 3W1YA 2LJ5A 3H7PB 4W9KA 1PQSA 3VFKA 2XK5B 3NHEB 3B0AA 4MM3A 1NI2A 1TTNA 2MP2A 5LXIB 2DYBA 3K9PB 4GIVA 2KANA 3JVZX 2CU1A 2J0KA 3OJ4B 3UQBA 3ZTDA 1YQBA 1XQQA 4LDTB 4W9DA 3EC8A 4HDOA 3TL5A 4HCPB 4DK5A 1GUAB 3AXCA 1EF1A 2N9EB 3IBEA 3R3MA 1CMXB 3DBRI 2NS5A 4HDQA 3VAWA 4DDGD 1J19A 5AZGA 4KDLB 4FLHA 3RZFA 4FJZA 4M8NA 1R4MI 1H4RA 2KMAA 3APDA 4W9CA 3WALA 4ZDVA 4HJKA 5J18A 4BFRA 3ML8A 1HE8A 2MWSB 3UIPB 1E8YA 2JZZA 2Z0EB 5G55A 1WGGA 3DQVA 4G50A 5KHOA 1I42A 1ISNA 4BVUC 2K8CA 3KVFB 1FXTB 1WXVA 3ZNZB 4J6IA 4NY0A 2L05A 4KZ0A 3DPDA 4I6PA 4FADA 1WXAA 3TIXA 2UWQA 4GDLB 5IA7A 5L95C 2KDIA 2L0FA 3MJWA 5C23A 3EFUA 3AULA 4WWPA 2IZVB 2HE7A 2RR9A 1UZXB 4HPMB 4HXDA 3L13A 4FN2A 3V60A 2N1VA 2LASA 2FCMA 2J7QB 2C60A 2DZKA 2O2VA 2KZRA 1RRBA 4KDIC 1WI0A 1E5WA 3VUWA 4TV3A 4IWOA 5E6PA 4WJQA 2BWES 4K7WA 2KJHB 1OEYA 2KJRA 3H6NA 2KJ6A 2MBEA 2FIDA 1Q1OA 4MSMB 2KNBA 3BY4B 2MBBB 4ANVA 2GBKA 3L10B 5KHQA 3VDZA 3KUDB 4EOYA 3PVLA 5DPSA 2NCNA 3MHSD 1WJUA 5CX3A 4NAWB 2MX2A 2JY6A 4AWJA 2D2QA 1X1MA 4A3OA 3X0WA 4CO7A 4OVUA 1GNUA 2LVQA 4LJPB 3N32A 4JL9A 3LDZE 4PS3A 4EZKA 1IP9A 3PT2B 3QHTA 3PLUA 3EHVA 4B6WA 2LVPA 2KTRB 2M1MA 2N9PC 1U4AA 4BKGA 1L7YA 4FHJA 2WDTB 3MTNB 2WX1A 3ZDMC 4II3B 2KWCA 3UQAA 2NPTB 1UBIA 2N9XA 2IO3B 4E3CA 1SIFA 3TCAA 2KHWB 4B9KA 2K39A 2REXA 2LRUA 4RMAA 1E8WA 1V5OA 1WX8A 1XD3B 1K8RB 2KX3A 1P9DU 4ANWA 3CSFA 3U30A 1GC6A 3S2AA 3VVWB 3KYCD 3H7SA 3UIOB 2G45B 2K6QA 3LJ3A 1H8CA 4G3XB 3ZRCA 4BKSD 1WR1A 1JRUA 2A5UA 1WYWB 3DCGA 3M3JA 5AZHA 3Q3FA 2KK8A 5TR5A 1WR6E 2O6VA 4JLCA 2RD0A 2DHZA 2ASQA 4ZRJA 3ZNGC 3ZNID 4ANXA 5DPWA 3ZVVA 5LXHA 4E71A 4GSWA 1WRDB 2KX0A 2ZNVC 4F1SA 2LUEA 2M8SA 2C7HA 2K25A 2ZNVB 3A9KA 2ZVNA 2CHWA 2JUOA 2JWZA 2V1YA 2KFKA 1TBEA 1P1AA 1TGZB 2L0TA 2HD5B 3AU4A 3KUCB 3QX1A 3SHQA 5E6OA 4FBJB 2EMTA 2RGFA 2XK5A 3IFWB 1E7VA 3QK0A 1WY8A 3P2BA 1OEYJ 3I3TB 3PREA 3OLMD 1UH6A 2A4ZA 3D32A 4MDKE 3KYDD 2HTHA 2GMIC 4MGIE 3A1QB 4FA6A 3IVFA 2MCNB 1V80A 3TJPA 4GGQA 2MRPA 2KQ7A 3AI5A 2ZPNA 4I6LB 4TQ0A 2ZJDA 4IWQA 3VQIA 3WAMA 3W1SC 5HKHA 4MJSA 3ZIMA 4K81A 2O6VD 4KIKB 1AARA 5DPRA 1YIWA 1WJ4A 1LFDA 1WGHA 2NBWB 2I1KA 3PS6A 3WA0A 1GJZA 5J17A 3U8ZA 1P98A 4HVBA 1WJNA 5LLIA 2WX0A 1WIAA 4MGKE 3L17A 4GDKB 1WX7A 3M95A 1V5TA 4A3PA 2L76A 1E7UA 2KXJA 3KUZA 3QA8A 4KSLC 1WZ0A 2WWZA 3WAOA 2DYOA 2HJ8A 3ENEA 2M17A 4KZCA 4NJ7A 3T8MA 4TQ1A 4EEWA 4F8CB 2K8BA 3QARA 2MP2B 1WM3A 2JZ3B 3KW5B 4RM8A 2EKEC 3RCZA 4AUQC 3ALBA 3NS8A 1NDDA 3HIZA 3O65B 4GU2A 2LVOA 4TKNA 3VXWA 1F9JA 1YX5B 2KDFB 3QJZA 3H1UA 3RYTA 1UD7A 2OJRA 2R2OA 1WE7A 2LWPA 4ICVA 1V86A 3DBHI 2G3QB 4YL8A 3M62B 1WXMA 1WFYA 3CF6E 2CS4A 2OOBB 4DDID 4AOFA 3PSEB 3QC8B 4RM9A 3TMPB 3QIJA 2IO0B 2RSUA 3L16A 2YVCA 4NAWA 2MBOA 3QCAA 2JT4B 4URKA 4WWNA 2D11A 2KLGA 1OQYA 3H9DA 4M8MA 1YD8U 2LI5A 4W9GA 3L08A 4ICUA 3NY5A 4IG7B 3VTWA 4A20A 1A5RA 1J0GA 4DWFA 1KLVA 4EKUA 4JIOU 4G11A 2DZJA 1KOTA 4GOCA 2KDEB 5JH5C 2LXCA 5EDSA 1MG8A 4W9LA 4IW0A 2DZMA 3ONSA 2IYDB 3U7DA 1ZGUB 1IYFA 2KC1A 2L00B 3A4SC 2BYEA 2ZPYA 3QWZB 3ZO5B 3L0WB 2BGFA 1WH3A 2MBQA 4XC2A 3WIMA 1SGHA 2KDBA 2Z0DB 4MELA 3A9JB 3VTVA 4DHZE 2MA9B 2LGDA 2VRRB 3KH0A 2IO2B 4OVVA 2N1WA 5CHVC
chains in the Genus database with same CATH superfamily
3HVZA 1SB3C 3AB5A 1V9JA 5CHFA 2R2QA 4PT5A 1WYGA 3AV8A 1C79A 4FJYA 4BBNF 3DVGY 1IPGA 2K1FA 1VCBA 1F77A 2AL3A 2WXJA 3Q3NC 4N9F4 2FIFA 1D5ZC 1M94A 5CTRC 5DPTA 1A70A 1XLQA 3P42A 1AYFA 4EFOA 1FCCC 4JWUC 1L4ZB 3AE6B 3CWIA 1Z5SB 5D6JB 2J0JA 5FR6A 5IKCM 2JXXA 3R7RA 4LNFA 1HXYD 1R4NB 1FRRA 1YOVB 3PRPB 4AQ7A 1I4XA 2AYOB 3DBHB 3VH3B 3I63C 4HLEA 5BMGA 3RNFC 2FCQA 2BWFA 1P3QU 1YX6B 1RLFA 3T3OA 2WXPA 3HK0A 4ASWC 3MC8A 1ZDVA 3EGRA 3R66C 1B1ZA 2JF5A 4K1RB 2AWTA 2INDC 3GOEA 2Z59B 4N58A 3QQ8B 2HTME 4EZLA 1RWSA 2C5LC 2GOWA 4GDLA 2N7EA 4BOSC 5AZFA 3GZNI 2W54A 4M0WB 2CJNA 1HTOA 2DNFA 1WGRA 1R4NI 4GN1A 2LHDA 1AWDA 1JCKB 2N4FA 4W9JA 3RT3B 4PS8A 1FM0D 1V81A 4OZCA 5D3IB 4JPSA 3VUYA 1L4DB 5L83A 4RNAA 1UWXA 4JX1C 4WJOA 4B95A 5MPOA 4JWSC 3NUHB 1P0RA 3GB1A 4DHZB 3K9OB 1C78A 2KKCA 3ZKJC 2E6XA 4LCDE 2LHEA 1I4RA 3DVGX 4CQNA 2WQYB 2NBVB 1EUVB 2N9LA 5E6NA 2PPHA 5J2RA 4W9HA 4WWMA 2WDQB 1VJKA 5AUKA 1C1YB 4NQLB 3PGEA 2K8HA 1CQVA 2ICIA 2JWUA 2K9XA 3L54A 3HM6X 2BKFA 1D5XC 1WF9A 3DWGC 1V49A 2ZEQA 5JHAA 2PE6B 4KGSA 2JRHA 1EF5A 1J7AA 5D94A 4ZRKA 2MJ3A 2D3BA 3JSVA 3N30A 4C56C 3EECA 1NEKB 1T0YA 4YWGG 3AE3B 2V9HA 3AEBB 2LD9A 1IGCA 3ZRFA 3ZUNA 4BAXA 1PYWD 2PVOD 2JZPA 4LJOB 4WWOA 2KWUB 3AEGB 4LK0M 1I4HA 3DHIC 4NPNA 5H92C 3RN9C 2CHXA 3SD5A 3VFKA 2XK5B 3NHEB 4MM3A 3OWEB 2J0KA 1Q10A 2K22A 3P4RB 2TSSA 4DK5A 3GP7A 3IBEA 3I57A 2WDVB 4HDQA 4KDLB 4FJZA 1H4RA 4W9CA 3FC4A 3ML8A 2IDYA 1L0VB 1WGGA 3DQVA 4G50A 4KGTA 1EU4A 4I6PA 1GPXA 1B9RA 4NJCA 3W5UB 5C23A 4WWPA 3AULA 2C60A 2O2VA 3VUWA 1YJJA 4WJQA 2BWES 2KJHB 1L0YB 5HG2A 1JWBD 3BVMA 4ANVA 4B0MA 1AW7A 5DPSA 4XGAB 3MHSD 3X0WA 4CO7A 5C2TB 4OVUA 2RDHA 2LVQA 3LDZE 4PS3A 4EZKA 2FE8A 2QSDA 3QHTA 3AN1A 1SE3A 2QJLA 3KLSX 3ZDMC 1SXTA 2W3RA 1V97A 2N9XA 2IO3B 2WXGA 2KHWB 4S17A 4B9KA 2REXA 2PTLA 1WX8A 4M02A 2RDGA 3CIRB 3BK1A 4ANWA 1FNUA 1GC6A 1V1PA 3NRZA 1GB1A 2G45B 4R3DA 1TY2A 1WR1A 2A5UA 5AZHA 1WYWB 3N20C 1HQRD 1WR6E 4E71A 4ZRPA 2WP9B 3A9KA 2ZVNA 5E6PA 3QX1A 1TBEA 4OVZA 1TGZB 3AU4A 2HD5B 3V05A 1XO3A 5BYSA 2X38A 1VZ7A 1QF6A 1ACCA 3D32A 2HTHA 2MJEA 3LB8C 5BYRA 4I6LB 4C4VA 3W1SC 4MJSA 2MHJA 2O6VD 4KIKB 5IO9A 1AARA 5DPRA 1YIWA 1LFDA 1WGHA 3C19A 4HVBA 5LLIA 4HPPA 4A8XC 4XYCA 2L76A 1E7UA 2IGDA 3AE1B 1YMHE 3QA8A 2WWZA 3MP9A 2DYOA 4NJ7A 3I9V1 2VH1A 2RMMA 3L4PA 1T6BX 3RNEC 3VR9B 1WWTA 3EUB2 4TKNA 3VXWA 2HJ1A 3QJZA 3H1UA 2G3QB 2L32A 3CF6E 3EFCA 4AOFA 3QC8B 1HEZE 2MBOA 4RH6A 4HRSA 3QCAA 3P4SB 1OQYA 3H9DA 4M8MA 1YD8U 3BWUD 3L08A 3NY5A 3IAM1 4EKUA 1L0XB 2E3TA 1KOTA 1SJHD 3UI3A 2LXCA 3Q14C 4RF1A 1IUEA 1IYFA 2IYDB 2KC1A 2L00B 3A4SC 1WXQA 1QOFA 2W55A 3BZDB 1MG4A 3QWZB 3ZO5B 4USAA 4XC2A 2NMQA 1SGHA 4MELA 2YEPF 5BMIA 4DHZE 3IT4B 2LEKA 1T3QA 1YQ4B 3KH0A 4C7ZA 4C80A 1EO6A 2J4XA 4N59A 1SIJA 2MEKA 2AQ1B 1HZ6A 2DAFA 2N0SB 4WQMA 1TS2A 3APCA 1K53A 2YEPB 2QCZA 4OZBA 3BK2A 3ML9A 5JHBA 1C4CA 3MHZA 3P63A 1YJIA 3UF8A 5BMHA 2MW5A 2INCC 4WQOB 3VR8B 3MC9A 4BBNC 1UNSA 4TUUA 2GBMA 4DHJD 3SEBA 2KTFA 3BIID 1P7EA 4ZRIA 3W1SA 1RYJA 1L2NA 1ZKHA 3HHMA 2VZKD 2D3AA 2M0AA 4YSZB 4HWIB 2KVZA 2O6VB 4LTUA 4MH0E 1M4VA 2BQQA 4GB9A 2C9WB 2ZZPB 2PIAA 2M19A 4S0RA 2WXMA 1PGAA 3B08A 3VUXA 4MT5A 2DBYA 4PYUA 4WIPA 1R7SA 3DVNV 4LDTD 4P7IA 2IBIB 3AE5B 3PRZA 2XN9C 2EMSA 3A4RA 3U2SC 2IO1B 4OZAA 4FJVB 5D7GA 3SFDB 2CHZA 1S1QB 1ZXIA 3V62A 1FXIA 2NBUA 3ZNHB 2N7DA 2K6DB 1E8XA 5D3DA 4A55A 4XZ4A 2HDEA 3C8YA 5G5HA 2WXFA 1N62A 4MSQB 4NNJB 2KQSA 4AJYB 2YLMA 1I4GA 4YTPB 1YQ3B 1SSNA 2KTRA 3AEFB 3T9LA 3ZXVA 1V6EA 2ACZB 1ZPSA 2DX5B 3A9JA 3N1ZC 1KJTA 2NR2A 3RZWC 4G0NB 2BYVE 2AQ2B 2G1EA 4H2AA 3U7ZA 3Q2AC 2JX5A 2GBNA 2D3GA 2WNMA 3AE7B 2LRWA 3BINA 4GXBA 2JRIB 4YT0B 4ZYNA 3DBLI 4AS1A 4RGTA 3RMKC 2FUG1 1FRDA 1JROA 3WCQA 1DGJA 2WHIA 2GBRA 2ZCBA 3GE3C 1FPYA 1JW9D 3VHTC 4W9IA 2KFJA 4IWPA 5BO4B 4XDDA 3OJ3A 3RD2A 1JMLA 2FCSA 5G5GA 2W82A 1RM6C 4HCNB 3R8BA 2LZ6A 3SU8X 2IGHA 2ZCCA 2QHOA 2FUHB 3A1QA 3CSTA 2KMCA 2FAZA 3B1LX 3GZNB 4DHJB 1TKEA 2V3SA 3T3NA 2CR5A 1WE6A 2VZKB 4M01A 2B76B 2WXLA 1IBXB 2M0XA 1QOBA 3VTUA 1WGDA 2WXQA 2BW2A 1C4PA 3M63B 1UBQA 4WURA 1L6VA 1N5WA 4REZA 1ZUD2 3B0AA 1NI2A 3PO0A 2MP2A 2DYBA 2CU1A 3UQBA 2ZW1A 3ZTDA 1YQBA 1XQQA 4LDTB 3B2FA 3R3MA 1GUAB 1FXAA 3DBRI 1F2RI 1YN5A 2WXNA 1J19A 4IDIA 2MJDA 5BYQA 4M8NA 1F1HA 3APDA 1NYQA 2QC8A 1JALA 2BBCA 5I4DA 2BTEA 3HRDD 1I42A 2M56B 1ISNA 4M00A 1FXTB 1WXVA 1V1OA 4IOIE 1XEEA 2L05A 4KKIA 2BS3B 4KZ0A 3TIXA 4GDLB 4ANUA 2RR9A 2HE7A 1UZXB 1T0SC 4HPMB 4ARCA 2LASA 2WXIA 2DZKA 1KLGD 2KZRA 1RRBA 4TV3A 1Q1OA 4MSMB 2KNBA 3BY4B 4HEA1 4L23A 2MBBB 3FAHA 3ZJUA 1E9MA 3L10B 5KHQA 2LFIA 1WJUA 4NAWB 2JY6A 2D2QA 2BS4B 3LXFA 4LJPB 1L5PA 3PLUA 4D2KA 1U4AA 2WX1A 1C4AA 2ONQA 1YNTE 2KMMA 1MHHE 1FMAD 1MFWA 1SIFA 2JU6X 2KACA 3Q69A 3TCAA 4LNOA 5GXGB 1E8WA 3W2DA 1XXGA 4WAFA 2RPVA 1P9DU 3CSFA 1ZDXA 3S2AA 3H7SA 2KDMA 2K6QA 3LJ3A 2PW9A 4BKSD 1K51A 1JRUA 5TR5A 3Q3FA 2RD0A 2ASQA 4TSSA 3ZNID 4ANXA 3ZVVA 5LXHA 4GSWA 4ZYSA 2KX0A 1QILA 4YTNB 2LUEA 2M8SA 2ZNVB 4KKJA 2JWZA 2JUOA 3SHQA 1P1AA 4FBJB 2EMTA 2JYEA 2XK5A 3IFWB 1EWYC 1E7VA 2L52A 3P2BA 3PREA 3J9CA 3OLMD 4MDKE 1WRIA 4FA6A 3IVFA 2MCNB 1V80A 4US8A 4GGQA 4ZOHC 5AUIA 2KQ7A 1LO5D 4P6VF 2ZJDA 4IWQA 2WXRA 2CU3A 1WJ4A 1ESFA 3WA0A 5C3JB 1P98A 1OQQA 2WX0A 1WIAA 4MGKE 4GDKB 1KRHA 3Q6BA 3OG5A 2NTSA 1WZ0A 1SE2A 3VRBB 2HJ8A 2M17A 4F8CB 3QARA 4MM3B 4ARIA 4US9A 3RCZA 4AUQC 3ALBA 3P4QB 3ZXRA 1XCQL 2LVOA 1T5XD 1F9JA 2KDFB 4YSXB 3B2GA 2Y5PA 2R2OA 1WE7A 1YN4A 2LWPA 4ICVA 5EE9A 4YL8A 1WXMA 1WSPA 3BVGA 4LNNA 3PSEB 2IO0B 3L16A 1N6ZA 2JT4B 4WWNA 3RI7C 1F52A 4JIOU 3AEEB 2KDEB 5JH5C 5EDSA 1MG8A 3ONSA 4LNIA 4FXCA 4YXDB 3ZJVA 2BYEA 1N5XA 1PFDA 2WXHA 3L0WB 2JSVX 1NYRA 2KDBA 4RGMA 4HKZE 2Z0DB 1J7BA 2MA9B 1C9FA 1GB4A 1E6EB 4HJGE 2IO2B 1P7FA 4OVVA 5CHVC 1C77A 1ENFA 1E90A 2L8JA 3B9JA 2BPSA 4L1BA 3U52E 2GI9A 1ET6A 2Y5CA 3IXSA 3Q3MC 4KV2A 3E9SA 4DBGA 1WMHB 2PKOA 2L7RA 4WJPA 4E74A 2BF8B 3TEWA 1QLBB 4DQOC 1BT0A 4KVGB 3ETRA 1FEHA 4WAAA 3PLVA 3ECIA 4I6NB 1KM7A 2BKRB 5JZEB 1FO4A 2D07B 1YJ1A 2WS3B 1MI0A 3DDCB 2MSED 4EZJA 3H7PA 1UGMA 2GLSA 4W9EA 3RULA 2EELA 3AECB 2KN5A 4MGZE 4OW0A 4JGHB 4IM3A 4HK2A 4K3CA 1VR9A 3JYUA 4P1BC 1BUIC 2KO3A 4ZHPA 2C7NB 3NG0A 1Q5WB 2DZIA 1J8CA 3A33B 3GS2A 2GBJA 4K7SA 5DCNA 1TZOA 4IUMB 4ACFA 1I35A 3QAQA 1JWMD 1FD6A 2KLCA 1GG3A 1C76A 3BYYB 4A90A 3DVNU 4C4VB 3PHXB 3Q3JA 1DOXA 3TBLD 1ZP0B 4GMVA 4MJSB 3PTFC 4FULA 5GMVA 4XX5A 3IHPC 2DYMA 1CK1A 3HM3A 1I4PA 1QT9A 3ZLZA 4CYEA 1UWMA 3VRAB 2PLPA 3Q8CA 1WXSA 2D10A 1KTKA 2XEWA 1D3ZA 2WYQA 3NZ3A 3NOBA 2NVUI 3TSSA 5TSSA 5C1ZA 1RAXA 4RGNA 2L1AA 4F7ZA 4HKQA 1C3TA 4QAYA 2QIEB 2IY1B 4KSKC 3RUIB 4UDUC 2G4DB 1DYQA 1OTRB 3DBSA 2N7JA 2NPTA 4MACA 3R7QA 2ZVOA 1TS4A 2LGYA 2DENB 1Q0WB 2OJWA 2WXKA 2PJHA 1VDVA 1GAQB 2UYZB 2KQ4X 2L3ZA 4PS7A 1WX9A 3RNAC 5G2NA 2G4SA 1CJEA 1OFFA 4OHJA 2OEDA 4P16A 1T0RC 2J0MA 1FCLA 3X23A 2GB1A 2I38A 1XF5L 4K7UA 3R2IA 2LXAA 4Q2JA 3PZDA 1K50A 3ZW3A 5FR3A 1RFAA 4XWTA 4XDCA 1R4MB 3PHWB 3PV1A 1KF6B 4MEMA 3SR6A 4TMAB 1Z2MA 2ON8A 4AP4C 3ZDTA 5JXVA 2KFKB 4MH8A 4W9KA 3ZJTA 1TTNA 5LXIB 3AH7A 3K9PB 4GIVA 1ZXHA 2KANA 3OJ4B 2H88B 4W9DA 2WDRB 4HDOA 3TL5A 4HCPB 2QILA 3AXCA 4A9AA 1EF1A 5FKAC 3VAWA 4DDGD 4FLHA 3RNCC 1R4MI 1XLNA 2KMAA 3WALA 4HJKA 5J18A 4BFRA 3MC0B 1DOYA 3NVWA 1N60A 1E8YA 2JZZA 5G55A 4XWWA 4BVUC 2K8CA 3KVFB 4JE3B 3DBLB 4J6IA 4NY0A 1ZOYB 2NTTA 3FILB 4GLSC 1WXAA 5IA7A 2KDIA 2L0FA 2IZVB 1XLPA 3L13A 2N1VA 2J7QB 3AE8B 4KDIC 3Q8AA 1E5WA 4K7WA 2KJRA 1OEYA 3H6NA 2MBEA 2GBKA 3VDZA 1PUTA 3KUDB 3TUOA 4EOYA 3PVLA 1TYGB 4XE0A 4AWJA 1X1MA 5E6JA 2Y3AA 1GNUA 3N32A 3SFEB 4JL9A 1JQ4A 1TKGA 3FKYA 3EHVA 4RGOS 4B6WA 2KTRB 2N9PC 1TY0A 1L7YA 4FHJA 1VRAB 2IPKD 2WDTB 2Q5WD 4II3B 2KWCA 1QQRA 3UQAA 3AE4B 1K52A 3P1MA 3AEDB 1UBIA 2PMVA 1E10A 2LRUA 1V5OA 1XD3B 1K8RB 2KX3A 3P4PB 3U30A 4L2YA 3DBRB 4G3XB 3ZRCA 3DCGA 2KK8A 1TS5A 3Q3OC 1IBXA 5DPWA 2KN4A 3ZNGC 2DHZA 4ZRJA 2INNE 1WRDB 2ZNVC 4F1SA 4BZAA 2C7HA 2K25A 3PT2B 2V1YA 3KUCB 4N6EB 1KFYB 3UIPB 4PK1A 3RNGC 5E6OA 3TEXA 2JYTA 1WY8A 1OEYJ 3I3TB 1AN8A 1UH6A 2A4ZA 3KYDD 1TIFA 2GMIC 4MGIE 3A1QB 5LNK1 1DOIA 3NVYA 3TJPA 2MRPA 3AI5A 2SEBD 2ZPNA 2UU7A 4TQ0A 3WAMA 4M0WA 3Q8EA 5HKHA 1BMLC 2I1KA 1OQRA 1PDXA 5J17A 4O1NA 1V5TA 4A3PA 3Q8FA 2QDFA 1D4BA 2KXJA 2X8XX 2ZW0A 5HI1A 3T8MA 3H8HA 2MP2B 1WM3A 2BT6A 3KW5B 2EKEC 2PVGC 3HIZA 4GU2A 1YX5B 1UD7A 1NI3A 2LUMA 3DBHI 1D5MC 2G9HD 3M62B 2Z8LA 1WFYA 4KGRA 2CS4A 2OOBB 1HA5A 1IGDA 1CZPA 4LLGM 2RSUA 2YVCA 4NAWA 1EWCA 2KLGA 1FFVA 1J0GA 2CJOA 2WGSA 4J3OD 4G11A 2DZJA 3N1XC 4C00A 1RFKA 2DZMA 1L6UA 2MBQA 3WIMA 4A6QA 3VTVA 2LGDA 2N1WA 4ZRQA 3U7DA 1J7CA 1MHXA 1E0ZA 2K3UA 1V8CA 1FNWA 1SEBD 4PYZA 4IC7B 2W3SA 1XLOA 1S3SG 2BYFA 3AU5A 1JWUD 2FBWB 2LGXA 3I5JC 4BKTA 1FIQA 4MGYE 1ZW7A 4CHKA 2I2YA 5H8YE 2KOXA 1GOZA 3VH4B 4HPLB 4EUTA 2WLBA 2C7MB 2SAKA 1VZ8A 3R2TA 5T8IA 3JW0X 1Y8RC 4RCOA 1F0ZA 3MFGA 4K3BA 2FNJB 2XBBC 3U4EG 3JSVB 5AEKB 1WZ3A 3CMMB 4DXAB 2DAJA 1WJ6A 4BOZB 3SDLC 1E8ZA 1WGYA 3Q8BA 3OAWA 2MBHA 4HROA 3NZUA 2M4NA 4GDKA 4X57B 4WJNA 2JVCA 1UF0A 1FFUA 1I7HA 1MVKA 3ZQ4A 1SE9A 4LNKA 2J42A 2KAJA 3NVVA 3ZYYX 5EE0A 3WANA 3KWVA 3V6EB 4II2B 3RFZB 4NQKE 4RF0A 1JRPA 3PZ7A 3NZSA 4NJ6A 4DXGA 1SE4A 2KVRA 1V2YA 5CHWA 5D2MB 1ZE3D 1JWAD 4FHKA 2RPQA 3C0RB 2W9NA 3N3KB 1WM2A 1UELA 1UUPA 1QOAA 1XT9B 2D5GA 1TZ1A 3DHHC 1MPEA 1QZEA 3IG3A 3RPFC 1LM8B 2B3AA 2JPHA 3IAS1 5HFYA 1LQBA 2AQ3B 2WU5B 1TT5B 1VD2A 4YSYB 3PPAA 1G6JA 2I1JA 2V0GA 2O2VB 3PRMB 3V6CB 1VZ6A 5IP4D 3UINB 3O13A 2QEJC 4IM0A 2RDBC 1WMHA 4AJWA 3TEZA 2MLBA 2CKHB 2V4IB 3V61A 2WXOA 4BKSA 2LGSA 2KT7A 2N9KA 2PE9A 3APFA 3DWMA 1KH0A 3ZTCA 4IKGA 2AEHA 4NZLB 2BB6A 2QMTA 2AL6A 2KWVB 2Y5BB 2D3CA 1ET9A 2MQJA 4ITKA 4W9FA 1EM7A 1NBFC 2WU2B 1WGKA 1LXDA 1OGWA 1V1PB 3AE2B 2IY0B 2AX5A 5IAAC 4ZHOA 2DWQA 2FCNA 4KIKA 3AMZA 1YN3A 3WAPA 4IM2A 3ZGZA 1PGBA 2KD0A 3DOWA 2V4LA 3PZ8A 2PEAA 1GC7A 1N63A 2KC2A 4JQWC 2VH2A 3A9KB 3W1YA 2LJ5A 3H7PB 1PQSA 1SJED 3JVZX 2MH7A 3HUIA 3EC8A 2N9EB 1PGXA 1CMXB 2NS5A 1HZ5A 4C7YA 5AZGA 2KWDA 1I4QA 4P1CC 3RZFA 3URYA 4B0EA 4ZDVA 1HE8A 2MWSB 2Z0EB 3BVZA 2H89B 4DXFA 5KHOA 2EKIA 2IGGA 3ZNZB 1QKZA 3DPDA 4FADA 2UWQA 5L95C 3MJWA 2DLBA 3EFUA 1SBBB 3AEAB 4YTMB 4HXDA 3V60A 4FN2A 2FCMA 5EE1A 1WI0A 4KX6B 4IWOA 2V3PA 3NS1A 2KJ6A 2FIDA 1LGRA 3HVDA 1MJDA 1D6EC 1SF0A 2OHFA 2NCNA 5CX3A 1EU3A 2MX2A 5HHDG 4A3OA 2BB5A 2JXTA 2KYWA 3N9YC 2BS2B 1IP9A 1HTQA 2LVPA 2M1MA 3MJ5A 4BKGA 3MTNB 4RFBA 2NPTB 4E3CA 1FNVA 2L83A 3TEYA 5EE3A 2BYTA 2K39A 4RMAA 2R61A 2XNAC 1TJEA 1STEA 3VVWB 3AE9B 1UGJA 3KYCD 1F2RC 3UIOB 2LGIA 1H8CA 1KLUD 3M3JA 1ROEA 3AM9A 2O6VA 3ABVB 4JLCA 4WH4A 1E7PB 5IN7A 2CHWA 5FK9C 2KFKA 2L0TA 2RGFA 3QK0A 1NENB 2BVCA 1BXTA 3BYTB 3RNBC 3VQIA 3E56A 1XCTL 3ZIMA 4K81A 1Y56A 1QOGA 2NBWB 3PS6A 1GJZA 3GE8C 3U8ZA 3KWLA 1WJNA 3L17A 3V3XA 1WX7A 3M95A 5IOIA 3W5VB 2LMCA 3KUZA 4KSLC 3DHGC 3WAOA 2GRIA 3ENEA 3FILA 4KZCA 4EEWA 4TQ1A 2K8BA 1N61A 3EA6A 2JZ3B 4RM8A 2K5PA 3NS8A 1NDDA 3O65B 2INPE 3KQ4A 1NVID 2IJ0A 3RYTA 2OJRA 1V86A 1T0QC 2LJIA 4DDID 1VLBA 2JQRB 4RM9A 3N1YC 3TMPB 3QIJA 3IT6B 1TKYA 4URKA 2D11A 2LI5A 4W9GA 4ICUA 3VTWA 4IG7B 4A20A 1A5RA 1KLVA 4DWFA 3NVZA 2J52A 3NJTA 4GOCA 4NAMA 4EE2A 4W9LA 4IW0A 1ZGUB 3LYYA 2J53A 2ZPYA 2BGFA 1WH3A 3W9CB 1JWSD 3A9JB 1TS3A 2K0PA 2VRRB 2V3NA 3UGBB
chains in the Genus database with same CATH topology
1EO6A 1E90A 2L8JA 2BPSA 4PYZA 4IC7B 4KV2A 1S3SG 2BYFA 2DAFA 1V9JA 5CHFA 1WMHB 3AU5A 4DBGA 4WJPA 2L7RA 4E74A 2BF8B 4BKTA 2LGXA 2R2QA 1BT0A 4MGYE 4KVGB 4FJYA 4BBNF 3APCA 1ZW7A 3DVGY 1IPGA 2K1FA 4CHKA 1VCBA 2AL3A 4WAAA 2KOXA 3ML9A 4N9F4 2FIFA 3PLVA 3VH4B 3ECIA 4I6NB 4HPLB 5JHBA 1M94A 1KM7A 5CTRC 2BKRB 4EUTA 5JZEB 5DPTA 2C7MB 2D07B 3UF8A 2MW5A 1YJ1A 3DDCB 4WQOB 2MSED 3JW0X 1Y8RC 4EZJA 4EFOA 4BBNC 3H7PA 1UGMA 4W9EA 4TUUA 2GBMA 1Z5SB 2FNJB 2XBBC 3RULA 3JSVB 5D6JB 5AEKB 2KN5A 4MGZE 4DHJD 1WZ3A 2J0JA 3CMMB 4DXAB 4JGHB 2DAJA 1WJ6A 4IM3A 5FR6A 4BOZB 2KTFA 2JXXA 4HK2A 3SDLC 3R7RA 4ZRIA 3JYUA 3W1SA 1E8ZA 3PRPB 1L2NA 2AYOB 1ZKHA 3VH3B 3HHMA 1WGYA 4HLEA 2KO3A 3OAWA 2MBHA 2O6VB 4HWIB 3NZUA 2FCQA 2M4NA 2BWFA 4GDKA 4X57B 1P3QU 4MH0E 4WJNA 1YX6B 2C7NB 2JVCA 1Q5WB 1RLFA 2DZIA 3HK0A 4GB9A 2C9WB 2ZZPB 4ASWC 1J8CA 3A33B 2GBJA 3R66C 4K7SA 5DCNA 2JF5A 4K1RB 4IUMB 1SE9A 2AWTA 3GOEA 2Z59B 3B08A 1I35A 3QAQA 3VUXA 3QQ8B 2KLCA 1GG3A 4EZLA 2C5LC 2GOWA 3WANA 4PYUA 3V6EB 4II2B 4NQKE 4GDLA 3DVNV 2N7EA 3DVNU 4LDTD 3PHXB 4BOSC 4P7IA 2IBIB 3Q3JA 3GZNI 5AZFA 4M0WB 3PRZA 3TBLD 4GMVA 4MJSB 3PTFC 3NZSA 2EMSA 4FULA 4NJ6A 3A4RA 2KVRA 5GMVA 1V2YA 1WGRA 5CHWA 4XX5A 5D2MB 1R4NI 3IHPC 2IO1B 4GN1A 2DYMA 4FHKA 2RPQA 3C0RB 4FJVB 5D7GA 2W9NA 2CHZA 3HM3A 1WM2A 3N3KB 1S1QB 2N4FA 4W9JA 3ZLZA 4CYEA 1UELA 3V62A 1WXSA 2NBUA 3ZNHB 2D10A 2N7DA 3UGBB 2XEWA 3RT3B 2K6DB 4PS8A 1XT9B 1D3ZA 1E8XA 2WYQA 1TZ1A 3NOBA 4XZ4A 1V81A 2NVUI 1QZEA 3VUYA 5C1ZA 1RAXA 3IG3A 4MSQB 4NNJB 5L83A 2KQSA 4AJYB 1LM8B 2YLMA 2B3AA 2JPHA 4WJOA 4B95A 1LQBA 4F7ZA 1VD2A 1C3TA 2KTRA 3T9LA 1P0RA 1V6EA 3PPAA 2IY1B 4KSKC 3RUIB 1G6JA 2I1JA 4ANUA 3K9OB 4DHZB 2DX5B 3A9JA 1KJTA 2O2VB 2G4DB 2KKCA 2NR2A 4G0NB 2BYVE 3RZWC 1OTRB 3DBSA 3PRMB 2NPTA 3V6CB 3ZKJC 3UINB 4LCDE 3R7QA 3DVGX 2ZVOA 2NBVB 4IM0A 1EUVB 2D3GA 2GBNA 2LGYA 2DENB 5E6NA 1Q0WB 2LRWA 2PPHA 5J2RA 1WMHA 4W9HA 4AJWA 2PJHA 3BINA 4GXBA 2JRIB 2MLBA 4ZYNA 1C1YB 4NQLB 3DBLI 2UYZB 2CKHB 2L3ZA 3PGEA 4PS7A 3V61A 2K8HA 4BKSA 1WX9A 3L54A 2PE9A 3APFA 3HM6X 2BKFA 3ZTCA 5G2NA 2G4SA 1WF9A 1V49A 2GBRA 2ZEQA 2ZCBA 5JHAA 3VHTC 4W9IA 2AEHA 2KFJA 2PE6B 4IWPA 5BO4B 2J0MA 3OJ3A 3X23A 2JRHA 3RD2A 1EF5A 2FCSA 2AL6A 2KWVB 4ZRKA 5D94A 2Y5BB 4K7UA 4HCNB 2MQJA 2LZ6A 3JSVA 3SU8X 4W9FA 2LXAA 3N30A 2ZCCA 2QHOA 2FUHB 1NBFC 3A1QA 3CSTA 2KMCA 3EECA 3PZDA 2FAZA 3ZW3A 3B1LX 4DHJB 1LXDA 1OGWA 1T0YA 2V3SA 2LD9A 1RFAA 3ZRFA 3ZUNA 2IY0B 5IAAC 3PHWB 2CR5A 1WE6A 2FCNA 4LJOB 4KIKA 3PV1A 3WAPA 4IM2A 4WWOA 2KWUB 2KD0A 3DOWA 2M0XA 4MEMA 2V4LA 3VTUA 4NPNA 1WGDA 2PEAA 1GC7A 1Z2MA 2KC2A 4JQWC 2CHXA 3A9KB 4AP4C 3ZDTA 3M63B 1UBQA 3SD5A 2KFKB 3W1YA 2LJ5A 3H7PB 4W9KA 1PQSA 3VFKA 2XK5B 3NHEB 3B0AA 4MM3A 1NI2A 1TTNA 2MP2A 5LXIB 2DYBA 3K9PB 4GIVA 2KANA 3JVZX 2CU1A 2J0KA 3OJ4B 3UQBA 3ZTDA 1YQBA 1XQQA 4LDTB 4W9DA 3EC8A 4HDOA 3TL5A 4HCPB 4DK5A 1GUAB 3AXCA 1EF1A 2N9EB 3IBEA 3R3MA 1CMXB 3DBRI 2NS5A 4HDQA 3VAWA 4DDGD 1J19A 5AZGA 4KDLB 4FLHA 3RZFA 4FJZA 4M8NA 1R4MI 1H4RA 2KMAA 3APDA 4W9CA 3WALA 4ZDVA 4HJKA 5J18A 4BFRA 3ML8A 1HE8A 2MWSB 3UIPB 1E8YA 2JZZA 2Z0EB 5G55A 1WGGA 3DQVA 4G50A 5KHOA 1I42A 1ISNA 4BVUC 2K8CA 3KVFB 1FXTB 1WXVA 3ZNZB 4J6IA 4NY0A 2L05A 4KZ0A 3DPDA 4I6PA 4FADA 1WXAA 3TIXA 2UWQA 4GDLB 5IA7A 5L95C 2KDIA 2L0FA 3MJWA 5C23A 3EFUA 3AULA 4WWPA 2IZVB 2HE7A 2RR9A 1UZXB 4HPMB 4HXDA 3L13A 4FN2A 3V60A 2N1VA 2LASA 2FCMA 2J7QB 2C60A 2DZKA 2O2VA 2KZRA 1RRBA 4KDIC 1WI0A 1E5WA 3VUWA 4TV3A 4IWOA 5E6PA 4WJQA 2BWES 4K7WA 2KJHB 1OEYA 2KJRA 3H6NA 2KJ6A 2MBEA 2FIDA 1Q1OA 4MSMB 2KNBA 3BY4B 2MBBB 4ANVA 2GBKA 3L10B 5KHQA 3VDZA 3KUDB 4EOYA 3PVLA 5DPSA 2NCNA 3MHSD 1WJUA 5CX3A 4NAWB 2MX2A 2JY6A 4AWJA 2D2QA 1X1MA 4A3OA 3X0WA 4CO7A 4OVUA 1GNUA 2LVQA 4LJPB 3N32A 4JL9A 3LDZE 4PS3A 4EZKA 1IP9A 3PT2B 3QHTA 3PLUA 3EHVA 4B6WA 2LVPA 2KTRB 2M1MA 2N9PC 1U4AA 4BKGA 1L7YA 4FHJA 2WDTB 3MTNB 2WX1A 3ZDMC 4II3B 2KWCA 3UQAA 2NPTB 1UBIA 2N9XA 2IO3B 4E3CA 1SIFA 3TCAA 2KHWB 4B9KA 2K39A 2REXA 2LRUA 4RMAA 1E8WA 1V5OA 1WX8A 1XD3B 1K8RB 2KX3A 1P9DU 4ANWA 3CSFA 3U30A 1GC6A 3S2AA 3VVWB 3KYCD 3H7SA 3UIOB 2G45B 2K6QA 3LJ3A 1H8CA 4G3XB 3ZRCA 4BKSD 1WR1A 1JRUA 2A5UA 1WYWB 3DCGA 3M3JA 5AZHA 3Q3FA 2KK8A 5TR5A 1WR6E 2O6VA 4JLCA 2RD0A 2DHZA 2ASQA 4ZRJA 3ZNGC 3ZNID 4ANXA 5DPWA 3ZVVA 5LXHA 4E71A 4GSWA 1WRDB 2KX0A 2ZNVC 4F1SA 2LUEA 2M8SA 2C7HA 2K25A 2ZNVB 3A9KA 2ZVNA 2CHWA 2JUOA 2JWZA 2V1YA 2KFKA 1TBEA 1P1AA 1TGZB 2L0TA 2HD5B 3AU4A 3KUCB 3QX1A 3SHQA 5E6OA 4FBJB 2EMTA 2RGFA 2XK5A 3IFWB 1E7VA 3QK0A 1WY8A 3P2BA 1OEYJ 3I3TB 3PREA 3OLMD 1UH6A 2A4ZA 3D32A 4MDKE 3KYDD 2HTHA 2GMIC 4MGIE 3A1QB 4FA6A 3IVFA 2MCNB 1V80A 3TJPA 4GGQA 2MRPA 2KQ7A 3AI5A 2ZPNA 4I6LB 4TQ0A 2ZJDA 4IWQA 3VQIA 3WAMA 3W1SC 5HKHA 4MJSA 3ZIMA 4K81A 2O6VD 4KIKB 1AARA 5DPRA 1YIWA 1WJ4A 1LFDA 1WGHA 2NBWB 2I1KA 3PS6A 3WA0A 1GJZA 5J17A 3U8ZA 1P98A 4HVBA 1WJNA 5LLIA 2WX0A 1WIAA 4MGKE 3L17A 4GDKB 1WX7A 3M95A 1V5TA 4A3PA 2L76A 1E7UA 2KXJA 3KUZA 3QA8A 4KSLC 1WZ0A 2WWZA 3WAOA 2DYOA 2HJ8A 3ENEA 2M17A 4KZCA 4NJ7A 3T8MA 4TQ1A 4EEWA 4F8CB 2K8BA 3QARA 2MP2B 1WM3A 2JZ3B 3KW5B 4RM8A 2EKEC 3RCZA 4AUQC 3ALBA 3NS8A 1NDDA 3HIZA 3O65B 4GU2A 2LVOA 4TKNA 3VXWA 1F9JA 1YX5B 2KDFB 3QJZA 3H1UA 3RYTA 1UD7A 2OJRA 2R2OA 1WE7A 2LWPA 4ICVA 1V86A 3DBHI 2G3QB 4YL8A 3M62B 1WXMA 1WFYA 3CF6E 2CS4A 2OOBB 4DDID 4AOFA 3PSEB 3QC8B 4RM9A 3TMPB 3QIJA 2IO0B 2RSUA 3L16A 2YVCA 4NAWA 2MBOA 3QCAA 2JT4B 4URKA 4WWNA 2D11A 2KLGA 1OQYA 3H9DA 4M8MA 1YD8U 2LI5A 4W9GA 3L08A 4ICUA 3NY5A 4IG7B 3VTWA 4A20A 1A5RA 1J0GA 4DWFA 1KLVA 4EKUA 4JIOU 4G11A 2DZJA 1KOTA 4GOCA 2KDEB 5JH5C 2LXCA 5EDSA 1MG8A 4W9LA 4IW0A 2DZMA 3ONSA 2IYDB 3U7DA 1ZGUB 1IYFA 2KC1A 2L00B 3A4SC 2BYEA 2ZPYA 3QWZB 3ZO5B 3L0WB 2BGFA 1WH3A 2MBQA 4XC2A 3WIMA 1SGHA 2KDBA 2Z0DB 4MELA 3A9JB 3VTVA 4DHZE 2MA9B 2LGDA 2VRRB 3KH0A 2IO2B 4OVVA 2N1WA 5CHVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EO6 A;  1E90 A;  2L8J A;  2BPS A;  4PYZ A;  4IC7 B;  4KV2 A;  1S3S G;  2BYF A;  2DAF A;  1V9J A;  5CHF A;  1WMH B;  3AU5 A;  4DBG A;  4WJP A;  2L7R A;  4E74 A;  2BF8 B;  4BKT A;  2LGX A;  2R2Q A;  1BT0 A;  4MGY E;  4KVG B;  4FJY A;  4BBN F;  3APC A;  1ZW7 A;  3DVG Y;  1IPG A;  2K1F A;  4CHK A;  1VCB A;  2AL3 A;  4WAA A;  2KOX A;  3ML9 A;  4N9F 4;  2FIF A;  3PLV A;  3VH4 B;  3ECI A;  4I6N B;  4HPL B;  5JHB A;  1M94 A;  1KM7 A;  5CTR C;  2BKR B;  4EUT A;  5JZE B;  5DPT A;  2C7M B;  2D07 B;  3UF8 A;  2MW5 A;  1YJ1 A;  3DDC B;  4WQO B;  2MSE D;  3JW0 X;  1Y8R C;  4EZJ A;  4EFO A;  4BBN C;  3H7P A;  1UGM A;  4W9E A;  4TUU A;  2GBM A;  1Z5S B;  2FNJ B;  2XBB C;  3RUL A;  3JSV B;  5D6J B;  5AEK B;  2KN5 A;  4MGZ E;  4DHJ D;  1WZ3 A;  2J0J A;  3CMM B;  4DXA B;  4JGH B;  2DAJ A;  1WJ6 A;  4IM3 A;  5FR6 A;  4BOZ B;  2KTF A;  2JXX A;  4HK2 A;  3SDL C;  3R7R A;  4ZRI A;  3JYU A;  3W1S A;  1E8Z A;  3PRP B;  1L2N A;  2AYO B;  1ZKH A;  3VH3 B;  3HHM A;  1WGY A;  4HLE A;  2KO3 A;  3OAW A;  2MBH A;  2O6V B;  4HWI B;  3NZU A;  2FCQ A;  2M4N A;  2BWF A;  4GDK A;  4X57 B;  1P3Q U;  4MH0 E;  4WJN A;  1YX6 B;  2C7N B;  2JVC A;  1Q5W B;  1RLF A;  2DZI A;  3HK0 A;  4GB9 A;  2C9W B;  2ZZP B;  4ASW C;  1J8C A;  3A33 B;  2GBJ A;  3R66 C;  4K7S A;  5DCN A;  2JF5 A;  4K1R B;  4IUM B;  1SE9 A;  2AWT A;  3GOE A;  2Z59 B;  3B08 A;  1I35 A;  3QAQ A;  3VUX A;  3QQ8 B;  2KLC A;  1GG3 A;  4EZL A;  2C5L C;  2GOW A;  3WAN A;  4PYU A;  3V6E B;  4II2 B;  4NQK E;  4GDL A;  3DVN V;  2N7E A;  3DVN U;  4LDT D;  3PHX B;  4BOS C;  4P7I A;  2IBI B;  3Q3J A;  3GZN I;  5AZF A;  4M0W B;  3PRZ A;  3TBL D;  4GMV A;  4MJS B;  3PTF C;  3NZS A;  2EMS A;  4FUL A;  4NJ6 A;  3A4R A;  2KVR A;  5GMV A;  1V2Y A;  1WGR A;  5CHW A;  4XX5 A;  5D2M B;  1R4N I;  3IHP C;  2IO1 B;  4GN1 A;  2DYM A;  4FHK A;  2RPQ A;  3C0R B;  4FJV B;  5D7G A;  2W9N A;  2CHZ A;  3HM3 A;  1WM2 A;  3N3K B;  1S1Q B;  2N4F A;  4W9J A;  3ZLZ A;  4CYE A;  1UEL A;  3V62 A;  1WXS A;  2NBU A;  3ZNH B;  2D10 A;  2N7D A;  3UGB B;  2XEW A;  3RT3 B;  2K6D B;  4PS8 A;  1XT9 B;  1D3Z A;  1E8X A;  2WYQ A;  1TZ1 A;  3NOB A;  4XZ4 A;  1V81 A;  2NVU I;  1QZE A;  3VUY A;  5C1Z A;  1RAX A;  3IG3 A;  4MSQ B;  4NNJ B;  5L83 A;  2KQS A;  4AJY B;  1LM8 B;  2YLM A;  2B3A A;  2JPH A;  4WJO A;  4B95 A;  1LQB A;  4F7Z A;  1VD2 A;  1C3T A;  2KTR A;  3T9L A;  1P0R A;  1V6E A;  3PPA A;  2IY1 B;  4KSK C;  3RUI B;  1G6J A;  2I1J A;  4ANU A;  3K9O B;  4DHZ B;  2DX5 B;  3A9J A;  1KJT A;  2O2V B;  2G4D B;  2KKC A;  2NR2 A;  4G0N B;  2BYV E;  3RZW C;  1OTR B;  3DBS A;  3PRM B;  2NPT A;  3V6C B;  3ZKJ C;  3UIN B;  4LCD E;  3R7Q A;  3DVG X;  2ZVO A;  2NBV B;  4IM0 A;  1EUV B;  2D3G A;  2GBN A;  2LGY A;  2DEN B;  5E6N A;  1Q0W B;  2LRW A;  2PPH A;  5J2R A;  1WMH A;  4W9H A;  4AJW A;  2PJH A;  3BIN A;  4GXB A;  2JRI B;  2MLB A;  4ZYN A;  1C1Y B;  4NQL B;  3DBL I;  2UYZ B;  2CKH B;  2L3Z A;  3PGE A;  4PS7 A;  3V61 A;  2K8H A;  4BKS A;  1WX9 A;  3L54 A;  2PE9 A;  3APF A;  3HM6 X;  2BKF A;  3ZTC A;  5G2N A;  2G4S A;  1WF9 A;  1V49 A;  2GBR A;  2ZEQ A;  2ZCB A;  5JHA A;  3VHT C;  4W9I A;  2AEH A;  2KFJ A;  2PE6 B;  4IWP A;  5BO4 B;  2J0M A;  3OJ3 A;  3X23 A;  2JRH A;  3RD2 A;  1EF5 A;  2FCS A;  2AL6 A;  2KWV B;  4ZRK A;  5D94 A;  2Y5B B;  4K7U A;  4HCN B;  2MQJ A;  2LZ6 A;  3JSV A;  3SU8 X;  4W9F A;  2LXA A;  3N30 A;  2ZCC A;  2QHO A;  2FUH B;  1NBF C;  3A1Q A;  3CST A;  2KMC A;  3EEC A;  3PZD A;  2FAZ A;  3ZW3 A;  3B1L X;  4DHJ B;  1LXD A;  1OGW A;  1T0Y A;  2V3S A;  2LD9 A;  1RFA A;  3ZRF A;  3ZUN A;  2IY0 B;  5IAA C;  3PHW B;  2CR5 A;  1WE6 A;  2FCN A;  4LJO B;  4KIK A;  3PV1 A;  3WAP A;  4IM2 A;  4WWO A;  2KWU B;  2KD0 A;  3DOW A;  2M0X A;  4MEM A;  2V4L A;  3VTU A;  4NPN A;  1WGD A;  2PEA A;  1GC7 A;  1Z2M A;  2KC2 A;  4JQW C;  2CHX A;  3A9K B;  4AP4 C;  3ZDT A;  3M63 B;  1UBQ A;  3SD5 A;  2KFK B;  3W1Y A;  2LJ5 A;  3H7P B;  4W9K A;  1PQS A;  3VFK A;  2XK5 B;  3NHE B;  3B0A A;  4MM3 A;  1NI2 A;  1TTN A;  2MP2 A;  5LXI B;  2DYB A;  3K9P B;  4GIV A;  2KAN A;  3JVZ X;  2CU1 A;  2J0K A;  3OJ4 B;  3UQB A;  3ZTD A;  1YQB A;  1XQQ A;  4LDT B;  4W9D A;  3EC8 A;  4HDO A;  3TL5 A;  4HCP B;  4DK5 A;  1GUA B;  3AXC A;  1EF1 A;  2N9E B;  3IBE A;  3R3M A;  1CMX B;  3DBR I;  2NS5 A;  4HDQ A;  3VAW A;  4DDG D;  1J19 A;  5AZG A;  4KDL B;  4FLH A;  3RZF A;  4FJZ A;  4M8N A;  1R4M I;  1H4R A;  2KMA A;  3APD A;  4W9C A;  3WAL A;  4ZDV A;  4HJK A;  5J18 A;  4BFR A;  3ML8 A;  1HE8 A;  2MWS B;  3UIP B;  1E8Y A;  2JZZ A;  2Z0E B;  5G55 A;  1WGG A;  3DQV A;  4G50 A;  5KHO A;  1I42 A;  1ISN A;  4BVU C;  2K8C A;  3KVF B;  1FXT B;  1WXV A;  3ZNZ B;  4J6I A;  4NY0 A;  2L05 A;  4KZ0 A;  3DPD A;  4I6P A;  4FAD A;  1WXA A;  3TIX A;  2UWQ A;  4GDL B;  5IA7 A;  5L95 C;  2KDI A;  2L0F A;  3MJW A;  5C23 A;  3EFU A;  3AUL A;  4WWP A;  2IZV B;  2HE7 A;  2RR9 A;  1UZX B;  4HPM B;  4HXD A;  3L13 A;  4FN2 A;  3V60 A;  2N1V A;  2LAS A;  2FCM A;  2J7Q B;  2C60 A;  2DZK A;  2O2V A;  2KZR A;  1RRB A;  4KDI C;  1WI0 A;  1E5W A;  3VUW A;  4TV3 A;  4IWO A;  5E6P A;  4WJQ A;  2BWE S;  4K7W A;  2KJH B;  1OEY A;  2KJR A;  3H6N A;  2KJ6 A;  2MBE A;  2FID A;  1Q1O A;  4MSM B;  2KNB A;  3BY4 B;  2MBB B;  4ANV A;  2GBK A;  3L10 B;  5KHQ A;  3VDZ A;  3KUD B;  4EOY A;  3PVL A;  5DPS A;  2NCN A;  3MHS D;  1WJU A;  5CX3 A;  4NAW B;  2MX2 A;  2JY6 A;  4AWJ A;  2D2Q A;  1X1M A;  4A3O A;  3X0W A;  4CO7 A;  4OVU A;  1GNU A;  2LVQ A;  4LJP B;  3N32 A;  4JL9 A;  3LDZ E;  4PS3 A;  4EZK A;  1IP9 A;  3PT2 B;  3QHT A;  3PLU A;  3EHV A;  4B6W A;  2LVP A;  2KTR B;  2M1M A;  2N9P C;  1U4A A;  4BKG A;  1L7Y A;  4FHJ A;  2WDT B;  3MTN B;  2WX1 A;  3ZDM C;  4II3 B;  2KWC A;  3UQA A;  2NPT B;  1UBI A;  2N9X A;  2IO3 B;  4E3C A;  1SIF A;  3TCA A;  2KHW B;  4B9K A;  2K39 A;  2REX A;  2LRU A;  4RMA A;  1E8W A;  1V5O A;  1WX8 A;  1XD3 B;  1K8R B;  2KX3 A;  1P9D U;  4ANW A;  3CSF A;  3U30 A;  1GC6 A;  3S2A A;  3VVW B;  3KYC D;  3H7S A;  3UIO B;  2G45 B;  2K6Q A;  3LJ3 A;  1H8C A;  4G3X B;  3ZRC A;  4BKS D;  1WR1 A;  1JRU A;  2A5U A;  1WYW B;  3DCG A;  3M3J A;  5AZH A;  3Q3F A;  2KK8 A;  5TR5 A;  1WR6 E;  2O6V A;  4JLC A;  2RD0 A;  2DHZ A;  2ASQ A;  4ZRJ A;  3ZNG C;  3ZNI D;  4ANX A;  5DPW A;  3ZVV A;  5LXH A;  4E71 A;  4GSW A;  1WRD B;  2KX0 A;  2ZNV C;  4F1S A;  2LUE A;  2M8S A;  2C7H A;  2K25 A;  2ZNV B;  3A9K A;  2ZVN A;  2CHW A;  2JUO A;  2JWZ A;  2V1Y A;  2KFK A;  1TBE A;  1P1A A;  1TGZ B;  2L0T A;  2HD5 B;  3AU4 A;  3KUC B;  3QX1 A;  3SHQ A;  5E6O A;  4FBJ B;  2EMT A;  2RGF A;  2XK5 A;  3IFW B;  1E7V A;  3QK0 A;  1WY8 A;  3P2B A;  1OEY J;  3I3T B;  3PRE A;  3OLM D;  1UH6 A;  2A4Z A;  3D32 A;  4MDK E;  3KYD D;  2HTH A;  2GMI C;  4MGI E;  3A1Q B;  4FA6 A;  3IVF A;  2MCN B;  1V80 A;  3TJP A;  4GGQ A;  2MRP A;  2KQ7 A;  3AI5 A;  2ZPN A;  4I6L B;  4TQ0 A;  2ZJD A;  4IWQ A;  3VQI A;  3WAM A;  3W1S C;  5HKH A;  4MJS A;  3ZIM A;  4K81 A;  2O6V D;  4KIK B;  1AAR A;  5DPR A;  1YIW A;  1WJ4 A;  1LFD A;  1WGH A;  2NBW B;  2I1K A;  3PS6 A;  3WA0 A;  1GJZ A;  5J17 A;  3U8Z A;  1P98 A;  4HVB A;  1WJN A;  5LLI A;  2WX0 A;  1WIA A;  4MGK E;  3L17 A;  4GDK B;  1WX7 A;  3M95 A;  1V5T A;  4A3P A;  2L76 A;  1E7U A;  2KXJ A;  3KUZ A;  3QA8 A;  4KSL C;  1WZ0 A;  2WWZ A;  3WAO A;  2DYO A;  2HJ8 A;  3ENE A;  2M17 A;  4KZC A;  4NJ7 A;  3T8M A;  4TQ1 A;  4EEW A;  4F8C B;  2K8B A;  3QAR A;  2MP2 B;  1WM3 A;  2JZ3 B;  3KW5 B;  4RM8 A;  2EKE C;  3RCZ A;  4AUQ C;  3ALB A;  3NS8 A;  1NDD A;  3HIZ A;  3O65 B;  4GU2 A;  2LVO A;  4TKN A;  3VXW A;  1F9J A;  1YX5 B;  2KDF B;  3QJZ A;  3H1U A;  3RYT A;  1UD7 A;  2OJR A;  2R2O A;  1WE7 A;  2LWP A;  4ICV A;  1V86 A;  3DBH I;  2G3Q B;  4YL8 A;  3M62 B;  1WXM A;  1WFY A;  3CF6 E;  2CS4 A;  2OOB B;  4DDI D;  4AOF A;  3PSE B;  3QC8 B;  4RM9 A;  3TMP B;  3QIJ A;  2IO0 B;  2RSU A;  3L16 A;  2YVC A;  4NAW A;  2MBO A;  3QCA A;  2JT4 B;  4URK A;  4WWN A;  2D11 A;  2KLG A;  1OQY A;  3H9D A;  4M8M A;  1YD8 U;  2LI5 A;  4W9G A;  3L08 A;  4ICU A;  3NY5 A;  4IG7 B;  3VTW A;  4A20 A;  1A5R A;  1J0G A;  4DWF A;  1KLV A;  4EKU A;  4JIO U;  4G11 A;  2DZJ A;  1KOT A;  4GOC A;  2KDE B;  5JH5 C;  2LXC A;  5EDS A;  1MG8 A;  4W9L A;  4IW0 A;  2DZM A;  3ONS A;  2IYD B;  3U7D A;  1ZGU B;  1IYF A;  2KC1 A;  2L00 B;  3A4S C;  2BYE A;  2ZPY A;  3QWZ B;  3ZO5 B;  3L0W B;  2BGF A;  1WH3 A;  2MBQ A;  4XC2 A;  3WIM A;  1SGH A;  2KDB A;  2Z0D B;  4MEL A;  3A9J B;  3VTV A;  4DHZ E;  2MA9 B;  2LGD A;  2VRR B;  3KH0 A;  2IO2 B;  4OVV A;  2N1W A;  5CHV C; 
#chains in the Genus database with same CATH topology
 3HVZ A;  1SB3 C;  3AB5 A;  1V9J A;  5CHF A;  2R2Q A;  4PT5 A;  1WYG A;  3AV8 A;  1C79 A;  4FJY A;  4BBN F;  3DVG Y;  1IPG A;  2K1F A;  1VCB A;  1F77 A;  2AL3 A;  2WXJ A;  3Q3N C;  4N9F 4;  2FIF A;  1D5Z C;  1M94 A;  5CTR C;  5DPT A;  1A70 A;  1XLQ A;  3P42 A;  1AYF A;  4EFO A;  1FCC C;  4JWU C;  1L4Z B;  3AE6 B;  3CWI A;  1Z5S B;  5D6J B;  2J0J A;  5FR6 A;  5IKC M;  2JXX A;  3R7R A;  4LNF A;  1HXY D;  1R4N B;  1FRR A;  1YOV B;  3PRP B;  4AQ7 A;  1I4X A;  2AYO B;  3DBH B;  3VH3 B;  3I63 C;  4HLE A;  5BMG A;  3RNF C;  2FCQ A;  2BWF A;  1P3Q U;  1YX6 B;  1RLF A;  3T3O A;  2WXP A;  3HK0 A;  4ASW C;  3MC8 A;  1ZDV A;  3EGR A;  3R66 C;  1B1Z A;  2JF5 A;  4K1R B;  2AWT A;  2IND C;  3GOE A;  2Z59 B;  4N58 A;  3QQ8 B;  2HTM E;  4EZL A;  1RWS A;  2C5L C;  2GOW A;  4GDL A;  2N7E A;  4BOS C;  5AZF A;  3GZN I;  2W54 A;  4M0W B;  2CJN A;  1HTO A;  2DNF A;  1WGR A;  1R4N I;  4GN1 A;  2LHD A;  1AWD A;  1JCK B;  2N4F A;  4W9J A;  3RT3 B;  4PS8 A;  1FM0 D;  1V81 A;  4OZC A;  5D3I B;  4JPS A;  3VUY A;  1L4D B;  5L83 A;  4RNA A;  1UWX A;  4JX1 C;  4WJO A;  4B95 A;  5MPO A;  4JWS C;  3NUH B;  1P0R A;  3GB1 A;  4DHZ B;  3K9O B;  1C78 A;  2KKC A;  3ZKJ C;  2E6X A;  4LCD E;  2LHE A;  1I4R A;  3DVG X;  4CQN A;  2WQY B;  2NBV B;  1EUV B;  2N9L A;  5E6N A;  2PPH A;  5J2R A;  4W9H A;  4WWM A;  2WDQ B;  1VJK A;  5AUK A;  1C1Y B;  4NQL B;  3PGE A;  2K8H A;  1CQV A;  2ICI A;  2JWU A;  2K9X A;  3L54 A;  3HM6 X;  2BKF A;  1D5X C;  1WF9 A;  3DWG C;  1V49 A;  2ZEQ A;  5JHA A;  2PE6 B;  4KGS A;  2JRH A;  1EF5 A;  1J7A A;  5D94 A;  4ZRK A;  2MJ3 A;  2D3B A;  3JSV A;  3N30 A;  4C56 C;  3EEC A;  1NEK B;  1T0Y A;  4YWG G;  3AE3 B;  2V9H A;  3AEB B;  2LD9 A;  1IGC A;  3ZRF A;  3ZUN A;  4BAX A;  1PYW D;  2PVO D;  2JZP A;  4LJO B;  4WWO A;  2KWU B;  3AEG B;  4LK0 M;  1I4H A;  3DHI C;  4NPN A;  5H92 C;  3RN9 C;  2CHX A;  3SD5 A;  3VFK A;  2XK5 B;  3NHE B;  4MM3 A;  3OWE B;  2J0K A;  1Q10 A;  2K22 A;  3P4R B;  2TSS A;  4DK5 A;  3GP7 A;  3IBE A;  3I57 A;  2WDV B;  4HDQ A;  4KDL B;  4FJZ A;  1H4R A;  4W9C A;  3FC4 A;  3ML8 A;  2IDY A;  1L0V B;  1WGG A;  3DQV A;  4G50 A;  4KGT A;  1EU4 A;  4I6P A;  1GPX A;  1B9R A;  4NJC A;  3W5U B;  5C23 A;  4WWP A;  3AUL A;  2C60 A;  2O2V A;  3VUW A;  1YJJ A;  4WJQ A;  2BWE S;  2KJH B;  1L0Y B;  5HG2 A;  1JWB D;  3BVM A;  4ANV A;  4B0M A;  1AW7 A;  5DPS A;  4XGA B;  3MHS D;  3X0W A;  4CO7 A;  5C2T B;  4OVU A;  2RDH A;  2LVQ A;  3LDZ E;  4PS3 A;  4EZK A;  2FE8 A;  2QSD A;  3QHT A;  3AN1 A;  1SE3 A;  2QJL A;  3KLS X;  3ZDM C;  1SXT A;  2W3R A;  1V97 A;  2N9X A;  2IO3 B;  2WXG A;  2KHW B;  4S17 A;  4B9K A;  2REX A;  2PTL A;  1WX8 A;  4M02 A;  2RDG A;  3CIR B;  3BK1 A;  4ANW A;  1FNU A;  1GC6 A;  1V1P A;  3NRZ A;  1GB1 A;  2G45 B;  4R3D A;  1TY2 A;  1WR1 A;  2A5U A;  5AZH A;  1WYW B;  3N20 C;  1HQR D;  1WR6 E;  4E71 A;  4ZRP A;  2WP9 B;  3A9K A;  2ZVN A;  5E6P A;  3QX1 A;  1TBE A;  4OVZ A;  1TGZ B;  3AU4 A;  2HD5 B;  3V05 A;  1XO3 A;  5BYS A;  2X38 A;  1VZ7 A;  1QF6 A;  1ACC A;  3D32 A;  2HTH A;  2MJE A;  3LB8 C;  5BYR A;  4I6L B;  4C4V A;  3W1S C;  4MJS A;  2MHJ A;  2O6V D;  4KIK B;  5IO9 A;  1AAR A;  5DPR A;  1YIW A;  1LFD A;  1WGH A;  3C19 A;  4HVB A;  5LLI A;  4HPP A;  4A8X C;  4XYC A;  2L76 A;  1E7U A;  2IGD A;  3AE1 B;  1YMH E;  3QA8 A;  2WWZ A;  3MP9 A;  2DYO A;  4NJ7 A;  3I9V 1;  2VH1 A;  2RMM A;  3L4P A;  1T6B X;  3RNE C;  3VR9 B;  1WWT A;  3EUB 2;  4TKN A;  3VXW A;  2HJ1 A;  3QJZ A;  3H1U A;  2G3Q B;  2L32 A;  3CF6 E;  3EFC A;  4AOF A;  3QC8 B;  1HEZ E;  2MBO A;  4RH6 A;  4HRS A;  3QCA A;  3P4S B;  1OQY A;  3H9D A;  4M8M A;  1YD8 U;  3BWU D;  3L08 A;  3NY5 A;  3IAM 1;  4EKU A;  1L0X B;  2E3T A;  1KOT A;  1SJH D;  3UI3 A;  2LXC A;  3Q14 C;  4RF1 A;  1IUE A;  1IYF A;  2IYD B;  2KC1 A;  2L00 B;  3A4S C;  1WXQ A;  1QOF A;  2W55 A;  3BZD B;  1MG4 A;  3QWZ B;  3ZO5 B;  4USA A;  4XC2 A;  2NMQ A;  1SGH A;  4MEL A;  2YEP F;  5BMI A;  4DHZ E;  3IT4 B;  2LEK A;  1T3Q A;  1YQ4 B;  3KH0 A;  4C7Z A;  4C80 A;  1EO6 A;  2J4X A;  4N59 A;  1SIJ A;  2MEK A;  2AQ1 B;  1HZ6 A;  2DAF A;  2N0S B;  4WQM A;  1TS2 A;  3APC A;  1K53 A;  2YEP B;  2QCZ A;  4OZB A;  3BK2 A;  3ML9 A;  5JHB A;  1C4C A;  3MHZ A;  3P63 A;  1YJI A;  3UF8 A;  5BMH A;  2MW5 A;  2INC C;  4WQO B;  3VR8 B;  3MC9 A;  4BBN C;  1UNS A;  4TUU A;  2GBM A;  4DHJ D;  3SEB A;  2KTF A;  3BII D;  1P7E A;  4ZRI A;  3W1S A;  1RYJ A;  1L2N A;  1ZKH A;  3HHM A;  2VZK D;  2D3A A;  2M0A A;  4YSZ B;  4HWI B;  2KVZ A;  2O6V B;  4LTU A;  4MH0 E;  1M4V A;  2BQQ A;  4GB9 A;  2C9W B;  2ZZP B;  2PIA A;  2M19 A;  4S0R A;  2WXM A;  1PGA A;  3B08 A;  3VUX A;  4MT5 A;  2DBY A;  4PYU A;  4WIP A;  1R7S A;  3DVN V;  4LDT D;  4P7I A;  2IBI B;  3AE5 B;  3PRZ A;  2XN9 C;  2EMS A;  3A4R A;  3U2S C;  2IO1 B;  4OZA A;  4FJV B;  5D7G A;  3SFD B;  2CHZ A;  1S1Q B;  1ZXI A;  3V62 A;  1FXI A;  2NBU A;  3ZNH B;  2N7D A;  2K6D B;  1E8X A;  5D3D A;  4A55 A;  4XZ4 A;  2HDE A;  3C8Y A;  5G5H A;  2WXF A;  1N62 A;  4MSQ B;  4NNJ B;  2KQS A;  4AJY B;  2YLM A;  1I4G A;  4YTP B;  1YQ3 B;  1SSN A;  2KTR A;  3AEF B;  3T9L A;  3ZXV A;  1V6E A;  2ACZ B;  1ZPS A;  2DX5 B;  3A9J A;  3N1Z C;  1KJT A;  2NR2 A;  3RZW C;  4G0N B;  2BYV E;  2AQ2 B;  2G1E A;  4H2A A;  3U7Z A;  3Q2A C;  2JX5 A;  2GBN A;  2D3G A;  2WNM A;  3AE7 B;  2LRW A;  3BIN A;  4GXB A;  2JRI B;  4YT0 B;  4ZYN A;  3DBL I;  4AS1 A;  4RGT A;  3RMK C;  2FUG 1;  1FRD A;  1JRO A;  3WCQ A;  1DGJ A;  2WHI A;  2GBR A;  2ZCB A;  3GE3 C;  1FPY A;  1JW9 D;  3VHT C;  4W9I A;  2KFJ A;  4IWP A;  5BO4 B;  4XDD A;  3OJ3 A;  3RD2 A;  1JML A;  2FCS A;  5G5G A;  2W82 A;  1RM6 C;  4HCN B;  3R8B A;  2LZ6 A;  3SU8 X;  2IGH A;  2ZCC A;  2QHO A;  2FUH B;  3A1Q A;  3CST A;  2KMC A;  2FAZ A;  3B1L X;  3GZN B;  4DHJ B;  1TKE A;  2V3S A;  3T3N A;  2CR5 A;  1WE6 A;  2VZK B;  4M01 A;  2B76 B;  2WXL A;  1IBX B;  2M0X A;  1QOB A;  3VTU A;  1WGD A;  2WXQ A;  2BW2 A;  1C4P A;  3M63 B;  1UBQ A;  4WUR A;  1L6V A;  1N5W A;  4REZ A;  1ZUD 2;  3B0A A;  1NI2 A;  3PO0 A;  2MP2 A;  2DYB A;  2CU1 A;  3UQB A;  2ZW1 A;  3ZTD A;  1YQB A;  1XQQ A;  4LDT B;  3B2F A;  3R3M A;  1GUA B;  1FXA A;  3DBR I;  1F2R I;  1YN5 A;  2WXN A;  1J19 A;  4IDI A;  2MJD A;  5BYQ A;  4M8N A;  1F1H A;  3APD A;  1NYQ A;  2QC8 A;  1JAL A;  2BBC A;  5I4D A;  2BTE A;  3HRD D;  1I42 A;  2M56 B;  1ISN A;  4M00 A;  1FXT B;  1WXV A;  1V1O A;  4IOI E;  1XEE A;  2L05 A;  4KKI A;  2BS3 B;  4KZ0 A;  3TIX A;  4GDL B;  4ANU A;  2RR9 A;  2HE7 A;  1UZX B;  1T0S C;  4HPM B;  4ARC A;  2LAS A;  2WXI A;  2DZK A;  1KLG D;  2KZR A;  1RRB A;  4TV3 A;  1Q1O A;  4MSM B;  2KNB A;  3BY4 B;  4HEA 1;  4L23 A;  2MBB B;  3FAH A;  3ZJU A;  1E9M A;  3L10 B;  5KHQ A;  2LFI A;  1WJU A;  4NAW B;  2JY6 A;  2D2Q A;  2BS4 B;  3LXF A;  4LJP B;  1L5P A;  3PLU A;  4D2K A;  1U4A A;  2WX1 A;  1C4A A;  2ONQ A;  1YNT E;  2KMM A;  1MHH E;  1FMA D;  1MFW A;  1SIF A;  2JU6 X;  2KAC A;  3Q69 A;  3TCA A;  4LNO A;  5GXG B;  1E8W A;  3W2D A;  1XXG A;  4WAF A;  2RPV A;  1P9D U;  3CSF A;  1ZDX A;  3S2A A;  3H7S A;  2KDM A;  2K6Q A;  3LJ3 A;  2PW9 A;  4BKS D;  1K51 A;  1JRU A;  5TR5 A;  3Q3F A;  2RD0 A;  2ASQ A;  4TSS A;  3ZNI D;  4ANX A;  3ZVV A;  5LXH A;  4GSW A;  4ZYS A;  2KX0 A;  1QIL A;  4YTN B;  2LUE A;  2M8S A;  2ZNV B;  4KKJ A;  2JWZ A;  2JUO A;  3SHQ A;  1P1A A;  4FBJ B;  2EMT A;  2JYE A;  2XK5 A;  3IFW B;  1EWY C;  1E7V A;  2L52 A;  3P2B A;  3PRE A;  3J9C A;  3OLM D;  4MDK E;  1WRI A;  4FA6 A;  3IVF A;  2MCN B;  1V80 A;  4US8 A;  4GGQ A;  4ZOH C;  5AUI A;  2KQ7 A;  1LO5 D;  4P6V F;  2ZJD A;  4IWQ A;  2WXR A;  2CU3 A;  1WJ4 A;  1ESF A;  3WA0 A;  5C3J B;  1P98 A;  1OQQ A;  2WX0 A;  1WIA A;  4MGK E;  4GDK B;  1KRH A;  3Q6B A;  3OG5 A;  2NTS A;  1WZ0 A;  1SE2 A;  3VRB B;  2HJ8 A;  2M17 A;  4F8C B;  3QAR A;  4MM3 B;  4ARI A;  4US9 A;  3RCZ A;  4AUQ C;  3ALB A;  3P4Q B;  3ZXR A;  1XCQ L;  2LVO A;  1T5X D;  1F9J A;  2KDF B;  4YSX B;  3B2G A;  2Y5P A;  2R2O A;  1WE7 A;  1YN4 A;  2LWP A;  4ICV A;  5EE9 A;  4YL8 A;  1WXM A;  1WSP A;  3BVG A;  4LNN A;  3PSE B;  2IO0 B;  3L16 A;  1N6Z A;  2JT4 B;  4WWN A;  3RI7 C;  1F52 A;  4JIO U;  3AEE B;  2KDE B;  5JH5 C;  5EDS A;  1MG8 A;  3ONS A;  4LNI A;  4FXC A;  4YXD B;  3ZJV A;  2BYE A;  1N5X A;  1PFD A;  2WXH A;  3L0W B;  2JSV X;  1NYR A;  2KDB A;  4RGM A;  4HKZ E;  2Z0D B;  1J7B A;  2MA9 B;  1C9F A;  1GB4 A;  1E6E B;  4HJG E;  2IO2 B;  1P7F A;  4OVV A;  5CHV C;  1C77 A;  1ENF A;  1E90 A;  2L8J A;  3B9J A;  2BPS A;  4L1B A;  3U52 E;  2GI9 A;  1ET6 A;  2Y5C A;  3IXS A;  3Q3M C;  4KV2 A;  3E9S A;  4DBG A;  1WMH B;  2PKO A;  2L7R A;  4WJP A;  4E74 A;  2BF8 B;  3TEW A;  1QLB B;  4DQO C;  1BT0 A;  4KVG B;  3ETR A;  1FEH A;  4WAA A;  3PLV A;  3ECI A;  4I6N B;  1KM7 A;  2BKR B;  5JZE B;  1FO4 A;  2D07 B;  1YJ1 A;  2WS3 B;  1MI0 A;  3DDC B;  2MSE D;  4EZJ A;  3H7P A;  1UGM A;  2GLS A;  4W9E A;  3RUL A;  2EEL A;  3AEC B;  2KN5 A;  4MGZ E;  4OW0 A;  4JGH B;  4IM3 A;  4HK2 A;  4K3C A;  1VR9 A;  3JYU A;  4P1B C;  1BUI C;  2KO3 A;  4ZHP A;  2C7N B;  3NG0 A;  1Q5W B;  2DZI A;  1J8C A;  3A33 B;  3GS2 A;  2GBJ A;  4K7S A;  5DCN A;  1TZO A;  4IUM B;  4ACF A;  1I35 A;  3QAQ A;  1JWM D;  1FD6 A;  2KLC A;  1GG3 A;  1C76 A;  3BYY B;  4A90 A;  3DVN U;  4C4V B;  3PHX B;  3Q3J A;  1DOX A;  3TBL D;  1ZP0 B;  4GMV A;  4MJS B;  3PTF C;  4FUL A;  5GMV A;  4XX5 A;  3IHP C;  2DYM A;  1CK1 A;  3HM3 A;  1I4P A;  1QT9 A;  3ZLZ A;  4CYE A;  1UWM A;  3VRA B;  2PLP A;  3Q8C A;  1WXS A;  2D10 A;  1KTK A;  2XEW A;  1D3Z A;  2WYQ A;  3NZ3 A;  3NOB A;  2NVU I;  3TSS A;  5TSS A;  5C1Z A;  1RAX A;  4RGN A;  2L1A A;  4F7Z A;  4HKQ A;  1C3T A;  4QAY A;  2QIE B;  2IY1 B;  4KSK C;  3RUI B;  4UDU C;  2G4D B;  1DYQ A;  1OTR B;  3DBS A;  2N7J A;  2NPT A;  4MAC A;  3R7Q A;  2ZVO A;  1TS4 A;  2LGY A;  2DEN B;  1Q0W B;  2OJW A;  2WXK A;  2PJH A;  1VDV A;  1GAQ B;  2UYZ B;  2KQ4 X;  2L3Z A;  4PS7 A;  1WX9 A;  3RNA C;  5G2N A;  2G4S A;  1CJE A;  1OFF A;  4OHJ A;  2OED A;  4P16 A;  1T0R C;  2J0M A;  1FCL A;  3X23 A;  2GB1 A;  2I38 A;  1XF5 L;  4K7U A;  3R2I A;  2LXA A;  4Q2J A;  3PZD A;  1K50 A;  3ZW3 A;  5FR3 A;  1RFA A;  4XWT A;  4XDC A;  1R4M B;  3PHW B;  3PV1 A;  1KF6 B;  4MEM A;  3SR6 A;  4TMA B;  1Z2M A;  2ON8 A;  4AP4 C;  3ZDT A;  5JXV A;  2KFK B;  4MH8 A;  4W9K A;  3ZJT A;  1TTN A;  5LXI B;  3AH7 A;  3K9P B;  4GIV A;  1ZXH A;  2KAN A;  3OJ4 B;  2H88 B;  4W9D A;  2WDR B;  4HDO A;  3TL5 A;  4HCP B;  2QIL A;  3AXC A;  4A9A A;  1EF1 A;  5FKA C;  3VAW A;  4DDG D;  4FLH A;  3RNC C;  1R4M I;  1XLN A;  2KMA A;  3WAL A;  4HJK A;  5J18 A;  4BFR A;  3MC0 B;  1DOY A;  3NVW A;  1N60 A;  1E8Y A;  2JZZ A;  5G55 A;  4XWW A;  4BVU C;  2K8C A;  3KVF B;  4JE3 B;  3DBL B;  4J6I A;  4NY0 A;  1ZOY B;  2NTT A;  3FIL B;  4GLS C;  1WXA A;  5IA7 A;  2KDI A;  2L0F A;  2IZV B;  1XLP A;  3L13 A;  2N1V A;  2J7Q B;  3AE8 B;  4KDI C;  3Q8A A;  1E5W A;  4K7W A;  2KJR A;  1OEY A;  3H6N A;  2MBE A;  2GBK A;  3VDZ A;  1PUT A;  3KUD B;  3TUO A;  4EOY A;  3PVL A;  1TYG B;  4XE0 A;  4AWJ A;  1X1M A;  5E6J A;  2Y3A A;  1GNU A;  3N32 A;  3SFE B;  4JL9 A;  1JQ4 A;  1TKG A;  3FKY A;  3EHV A;  4RGO S;  4B6W A;  2KTR B;  2N9P C;  1TY0 A;  1L7Y A;  4FHJ A;  1VRA B;  2IPK D;  2WDT B;  2Q5W D;  4II3 B;  2KWC A;  1QQR A;  3UQA A;  3AE4 B;  1K52 A;  3P1M A;  3AED B;  1UBI A;  2PMV A;  1E10 A;  2LRU A;  1V5O A;  1XD3 B;  1K8R B;  2KX3 A;  3P4P B;  3U30 A;  4L2Y A;  3DBR B;  4G3X B;  3ZRC A;  3DCG A;  2KK8 A;  1TS5 A;  3Q3O C;  1IBX A;  5DPW A;  2KN4 A;  3ZNG C;  2DHZ A;  4ZRJ A;  2INN E;  1WRD B;  2ZNV C;  4F1S A;  4BZA A;  2C7H A;  2K25 A;  3PT2 B;  2V1Y A;  3KUC B;  4N6E B;  1KFY B;  3UIP B;  4PK1 A;  3RNG C;  5E6O A;  3TEX A;  2JYT A;  1WY8 A;  1OEY J;  3I3T B;  1AN8 A;  1UH6 A;  2A4Z A;  3KYD D;  1TIF A;  2GMI C;  4MGI E;  3A1Q B;  5LNK 1;  1DOI A;  3NVY A;  3TJP A;  2MRP A;  3AI5 A;  2SEB D;  2ZPN A;  2UU7 A;  4TQ0 A;  3WAM A;  4M0W A;  3Q8E A;  5HKH A;  1BML C;  2I1K A;  1OQR A;  1PDX A;  5J17 A;  4O1N A;  1V5T A;  4A3P A;  3Q8F A;  2QDF A;  1D4B A;  2KXJ A;  2X8X X;  2ZW0 A;  5HI1 A;  3T8M A;  3H8H A;  2MP2 B;  1WM3 A;  2BT6 A;  3KW5 B;  2EKE C;  2PVG C;  3HIZ A;  4GU2 A;  1YX5 B;  1UD7 A;  1NI3 A;  2LUM A;  3DBH I;  1D5M C;  2G9H D;  3M62 B;  2Z8L A;  1WFY A;  4KGR A;  2CS4 A;  2OOB B;  1HA5 A;  1IGD A;  1CZP A;  4LLG M;  2RSU A;  2YVC A;  4NAW A;  1EWC A;  2KLG A;  1FFV A;  1J0G A;  2CJO A;  2WGS A;  4J3O D;  4G11 A;  2DZJ A;  3N1X C;  4C00 A;  1RFK A;  2DZM A;  1L6U A;  2MBQ A;  3WIM A;  4A6Q A;  3VTV A;  2LGD A;  2N1W A;  4ZRQ A;  3U7D A;  1J7C A;  1MHX A;  1E0Z A;  2K3U A;  1V8C A;  1FNW A;  1SEB D;  4PYZ A;  4IC7 B;  2W3S A;  1XLO A;  1S3S G;  2BYF A;  3AU5 A;  1JWU D;  2FBW B;  2LGX A;  3I5J C;  4BKT A;  1FIQ A;  4MGY E;  1ZW7 A;  4CHK A;  2I2Y A;  5H8Y E;  2KOX A;  1GOZ A;  3VH4 B;  4HPL B;  4EUT A;  2WLB A;  2C7M B;  2SAK A;  1VZ8 A;  3R2T A;  5T8I A;  3JW0 X;  1Y8R C;  4RCO A;  1F0Z A;  3MFG A;  4K3B A;  2FNJ B;  2XBB C;  3U4E G;  3JSV B;  5AEK B;  1WZ3 A;  3CMM B;  4DXA B;  2DAJ A;  1WJ6 A;  4BOZ B;  3SDL C;  1E8Z A;  1WGY A;  3Q8B A;  3OAW A;  2MBH A;  4HRO A;  3NZU A;  2M4N A;  4GDK A;  4X57 B;  4WJN A;  2JVC A;  1UF0 A;  1FFU A;  1I7H A;  1MVK A;  3ZQ4 A;  1SE9 A;  4LNK A;  2J42 A;  2KAJ A;  3NVV A;  3ZYY X;  5EE0 A;  3WAN A;  3KWV A;  3V6E B;  4II2 B;  3RFZ B;  4NQK E;  4RF0 A;  1JRP A;  3PZ7 A;  3NZS A;  4NJ6 A;  4DXG A;  1SE4 A;  2KVR A;  1V2Y A;  5CHW A;  5D2M B;  1ZE3 D;  1JWA D;  4FHK A;  2RPQ A;  3C0R B;  2W9N A;  3N3K B;  1WM2 A;  1UEL A;  1UUP A;  1QOA A;  1XT9 B;  2D5G A;  1TZ1 A;  3DHH C;  1MPE A;  1QZE A;  3IG3 A;  3RPF C;  1LM8 B;  2B3A A;  2JPH A;  3IAS 1;  5HFY A;  1LQB A;  2AQ3 B;  2WU5 B;  1TT5 B;  1VD2 A;  4YSY B;  3PPA A;  1G6J A;  2I1J A;  2V0G A;  2O2V B;  3PRM B;  3V6C B;  1VZ6 A;  5IP4 D;  3UIN B;  3O13 A;  2QEJ C;  4IM0 A;  2RDB C;  1WMH A;  4AJW A;  3TEZ A;  2MLB A;  2CKH B;  2V4I B;  3V61 A;  2WXO A;  4BKS A;  2LGS A;  2KT7 A;  2N9K A;  2PE9 A;  3APF A;  3DWM A;  1KH0 A;  3ZTC A;  4IKG A;  2AEH A;  4NZL B;  2BB6 A;  2QMT A;  2AL6 A;  2KWV B;  2Y5B B;  2D3C A;  1ET9 A;  2MQJ A;  4ITK A;  4W9F A;  1EM7 A;  1NBF C;  2WU2 B;  1WGK A;  1LXD A;  1OGW A;  1V1P B;  3AE2 B;  2IY0 B;  2AX5 A;  5IAA C;  4ZHO A;  2DWQ A;  2FCN A;  4KIK A;  3AMZ A;  1YN3 A;  3WAP A;  4IM2 A;  3ZGZ A;  1PGB A;  2KD0 A;  3DOW A;  2V4L A;  3PZ8 A;  2PEA A;  1GC7 A;  1N63 A;  2KC2 A;  4JQW C;  2VH2 A;  3A9K B;  3W1Y A;  2LJ5 A;  3H7P B;  1PQS A;  1SJE D;  3JVZ X;  2MH7 A;  3HUI A;  3EC8 A;  2N9E B;  1PGX A;  1CMX B;  2NS5 A;  1HZ5 A;  4C7Y A;  5AZG A;  2KWD A;  1I4Q A;  4P1C C;  3RZF A;  3URY A;  4B0E A;  4ZDV A;  1HE8 A;  2MWS B;  2Z0E B;  3BVZ A;  2H89 B;  4DXF A;  5KHO A;  2EKI A;  2IGG A;  3ZNZ B;  1QKZ A;  3DPD A;  4FAD A;  2UWQ A;  5L95 C;  3MJW A;  2DLB A;  3EFU A;  1SBB B;  3AEA B;  4YTM B;  4HXD A;  3V60 A;  4FN2 A;  2FCM A;  5EE1 A;  1WI0 A;  4KX6 B;  4IWO A;  2V3P A;  3NS1 A;  2KJ6 A;  2FID A;  1LGR A;  3HVD A;  1MJD A;  1D6E C;  1SF0 A;  2OHF A;  2NCN A;  5CX3 A;  1EU3 A;  2MX2 A;  5HHD G;  4A3O A;  2BB5 A;  2JXT A;  2KYW A;  3N9Y C;  2BS2 B;  1IP9 A;  1HTQ A;  2LVP A;  2M1M A;  3MJ5 A;  4BKG A;  3MTN B;  4RFB A;  2NPT B;  4E3C A;  1FNV A;  2L83 A;  3TEY A;  5EE3 A;  2BYT A;  2K39 A;  4RMA A;  2R61 A;  2XNA C;  1TJE A;  1STE A;  3VVW B;  3AE9 B;  1UGJ A;  3KYC D;  1F2R C;  3UIO B;  2LGI A;  1H8C A;  1KLU D;  3M3J A;  1ROE A;  3AM9 A;  2O6V A;  3ABV B;  4JLC A;  4WH4 A;  1E7P B;  5IN7 A;  2CHW A;  5FK9 C;  2KFK A;  2L0T A;  2RGF A;  3QK0 A;  1NEN B;  2BVC A;  1BXT A;  3BYT B;  3RNB C;  3VQI A;  3E56 A;  1XCT L;  3ZIM A;  4K81 A;  1Y56 A;  1QOG A;  2NBW B;  3PS6 A;  1GJZ A;  3GE8 C;  3U8Z A;  3KWL A;  1WJN A;  3L17 A;  3V3X A;  1WX7 A;  3M95 A;  5IOI A;  3W5V B;  2LMC A;  3KUZ A;  4KSL C;  3DHG C;  3WAO A;  2GRI A;  3ENE A;  3FIL A;  4KZC A;  4EEW A;  4TQ1 A;  2K8B A;  1N61 A;  3EA6 A;  2JZ3 B;  4RM8 A;  2K5P A;  3NS8 A;  1NDD A;  3O65 B;  2INP E;  3KQ4 A;  1NVI D;  2IJ0 A;  3RYT A;  2OJR A;  1V86 A;  1T0Q C;  2LJI A;  4DDI D;  1VLB A;  2JQR B;  4RM9 A;  3N1Y C;  3TMP B;  3QIJ A;  3IT6 B;  1TKY A;  4URK A;  2D11 A;  2LI5 A;  4W9G A;  4ICU A;  3VTW A;  4IG7 B;  4A20 A;  1A5R A;  1KLV A;  4DWF A;  3NVZ A;  2J52 A;  3NJT A;  4GOC A;  4NAM A;  4EE2 A;  4W9L A;  4IW0 A;  1ZGU B;  3LYY A;  2J53 A;  2ZPY A;  2BGF A;  1WH3 A;  3W9C B;  1JWS D;  3A9J B;  1TS3 A;  2K0P A;  2VRR B;  2V3N A;  3UGB B; 
#chains in the Genus database with same CATH homology
 1EO6 A;  1E90 A;  2L8J A;  2BPS A;  4PYZ A;  4IC7 B;  4KV2 A;  1S3S G;  2BYF A;  2DAF A;  1V9J A;  5CHF A;  1WMH B;  3AU5 A;  4DBG A;  4WJP A;  2L7R A;  4E74 A;  2BF8 B;  4BKT A;  2LGX A;  2R2Q A;  1BT0 A;  4MGY E;  4KVG B;  4FJY A;  4BBN F;  3APC A;  1ZW7 A;  3DVG Y;  1IPG A;  2K1F A;  4CHK A;  1VCB A;  2AL3 A;  4WAA A;  2KOX A;  3ML9 A;  4N9F 4;  2FIF A;  3PLV A;  3VH4 B;  3ECI A;  4I6N B;  4HPL B;  5JHB A;  1M94 A;  1KM7 A;  5CTR C;  2BKR B;  4EUT A;  5JZE B;  5DPT A;  2C7M B;  2D07 B;  3UF8 A;  2MW5 A;  1YJ1 A;  3DDC B;  4WQO B;  2MSE D;  3JW0 X;  1Y8R C;  4EZJ A;  4EFO A;  4BBN C;  3H7P A;  1UGM A;  4W9E A;  4TUU A;  2GBM A;  1Z5S B;  2FNJ B;  2XBB C;  3RUL A;  3JSV B;  5D6J B;  5AEK B;  2KN5 A;  4MGZ E;  4DHJ D;  1WZ3 A;  2J0J A;  3CMM B;  4DXA B;  4JGH B;  2DAJ A;  1WJ6 A;  4IM3 A;  5FR6 A;  4BOZ B;  2KTF A;  2JXX A;  4HK2 A;  3SDL C;  3R7R A;  4ZRI A;  3JYU A;  3W1S A;  1E8Z A;  3PRP B;  1L2N A;  2AYO B;  1ZKH A;  3VH3 B;  3HHM A;  1WGY A;  4HLE A;  2KO3 A;  3OAW A;  2MBH A;  2O6V B;  4HWI B;  3NZU A;  2FCQ A;  2M4N A;  2BWF A;  4GDK A;  4X57 B;  1P3Q U;  4MH0 E;  4WJN A;  1YX6 B;  2C7N B;  2JVC A;  1Q5W B;  1RLF A;  2DZI A;  3HK0 A;  4GB9 A;  2C9W B;  2ZZP B;  4ASW C;  1J8C A;  3A33 B;  2GBJ A;  3R66 C;  4K7S A;  5DCN A;  2JF5 A;  4K1R B;  4IUM B;  1SE9 A;  2AWT A;  3GOE A;  2Z59 B;  3B08 A;  1I35 A;  3QAQ A;  3VUX A;  3QQ8 B;  2KLC A;  1GG3 A;  4EZL A;  2C5L C;  2GOW A;  3WAN A;  4PYU A;  3V6E B;  4II2 B;  4NQK E;  4GDL A;  3DVN V;  2N7E A;  3DVN U;  4LDT D;  3PHX B;  4BOS C;  4P7I A;  2IBI B;  3Q3J A;  3GZN I;  5AZF A;  4M0W B;  3PRZ A;  3TBL D;  4GMV A;  4MJS B;  3PTF C;  3NZS A;  2EMS A;  4FUL A;  4NJ6 A;  3A4R A;  2KVR A;  5GMV A;  1V2Y A;  1WGR A;  5CHW A;  4XX5 A;  5D2M B;  1R4N I;  3IHP C;  2IO1 B;  4GN1 A;  2DYM A;  4FHK A;  2RPQ A;  3C0R B;  4FJV B;  5D7G A;  2W9N A;  2CHZ A;  3HM3 A;  1WM2 A;  3N3K B;  1S1Q B;  2N4F A;  4W9J A;  3ZLZ A;  4CYE A;  1UEL A;  3V62 A;  1WXS A;  2NBU A;  3ZNH B;  2D10 A;  2N7D A;  3UGB B;  2XEW A;  3RT3 B;  2K6D B;  4PS8 A;  1XT9 B;  1D3Z A;  1E8X A;  2WYQ A;  1TZ1 A;  3NOB A;  4XZ4 A;  1V81 A;  2NVU I;  1QZE A;  3VUY A;  5C1Z A;  1RAX A;  3IG3 A;  4MSQ B;  4NNJ B;  5L83 A;  2KQS A;  4AJY B;  1LM8 B;  2YLM A;  2B3A A;  2JPH A;  4WJO A;  4B95 A;  1LQB A;  4F7Z A;  1VD2 A;  1C3T A;  2KTR A;  3T9L A;  1P0R A;  1V6E A;  3PPA A;  2IY1 B;  4KSK C;  3RUI B;  1G6J A;  2I1J A;  4ANU A;  3K9O B;  4DHZ B;  2DX5 B;  3A9J A;  1KJT A;  2O2V B;  2G4D B;  2KKC A;  2NR2 A;  4G0N B;  2BYV E;  3RZW C;  1OTR B;  3DBS A;  3PRM B;  2NPT A;  3V6C B;  3ZKJ C;  3UIN B;  4LCD E;  3R7Q A;  3DVG X;  2ZVO A;  2NBV B;  4IM0 A;  1EUV B;  2D3G A;  2GBN A;  2LGY A;  2DEN B;  5E6N A;  1Q0W B;  2LRW A;  2PPH A;  5J2R A;  1WMH A;  4W9H A;  4AJW A;  2PJH A;  3BIN A;  4GXB A;  2JRI B;  2MLB A;  4ZYN A;  1C1Y B;  4NQL B;  3DBL I;  2UYZ B;  2CKH B;  2L3Z A;  3PGE A;  4PS7 A;  3V61 A;  2K8H A;  4BKS A;  1WX9 A;  3L54 A;  2PE9 A;  3APF A;  3HM6 X;  2BKF A;  3ZTC A;  5G2N A;  2G4S A;  1WF9 A;  1V49 A;  2GBR A;  2ZEQ A;  2ZCB A;  5JHA A;  3VHT C;  4W9I A;  2AEH A;  2KFJ A;  2PE6 B;  4IWP A;  5BO4 B;  2J0M A;  3OJ3 A;  3X23 A;  2JRH A;  3RD2 A;  1EF5 A;  2FCS A;  2AL6 A;  2KWV B;  4ZRK A;  5D94 A;  2Y5B B;  4K7U A;  4HCN B;  2MQJ A;  2LZ6 A;  3JSV A;  3SU8 X;  4W9F A;  2LXA A;  3N30 A;  2ZCC A;  2QHO A;  2FUH B;  1NBF C;  3A1Q A;  3CST A;  2KMC A;  3EEC A;  3PZD A;  2FAZ A;  3ZW3 A;  3B1L X;  4DHJ B;  1LXD A;  1OGW A;  1T0Y A;  2V3S A;  2LD9 A;  1RFA A;  3ZRF A;  3ZUN A;  2IY0 B;  5IAA C;  3PHW B;  2CR5 A;  1WE6 A;  2FCN A;  4LJO B;  4KIK A;  3PV1 A;  3WAP A;  4IM2 A;  4WWO A;  2KWU B;  2KD0 A;  3DOW A;  2M0X A;  4MEM A;  2V4L A;  3VTU A;  4NPN A;  1WGD A;  2PEA A;  1GC7 A;  1Z2M A;  2KC2 A;  4JQW C;  2CHX A;  3A9K B;  4AP4 C;  3ZDT A;  3M63 B;  1UBQ A;  3SD5 A;  2KFK B;  3W1Y A;  2LJ5 A;  3H7P B;  4W9K A;  1PQS A;  3VFK A;  2XK5 B;  3NHE B;  3B0A A;  4MM3 A;  1NI2 A;  1TTN A;  2MP2 A;  5LXI B;  2DYB A;  3K9P B;  4GIV A;  2KAN A;  3JVZ X;  2CU1 A;  2J0K A;  3OJ4 B;  3UQB A;  3ZTD A;  1YQB A;  1XQQ A;  4LDT B;  4W9D A;  3EC8 A;  4HDO A;  3TL5 A;  4HCP B;  4DK5 A;  1GUA B;  3AXC A;  1EF1 A;  2N9E B;  3IBE A;  3R3M A;  1CMX B;  3DBR I;  2NS5 A;  4HDQ A;  3VAW A;  4DDG D;  1J19 A;  5AZG A;  4KDL B;  4FLH A;  3RZF A;  4FJZ A;  4M8N A;  1R4M I;  1H4R A;  2KMA A;  3APD A;  4W9C A;  3WAL A;  4ZDV A;  4HJK A;  5J18 A;  4BFR A;  3ML8 A;  1HE8 A;  2MWS B;  3UIP B;  1E8Y A;  2JZZ A;  2Z0E B;  5G55 A;  1WGG A;  3DQV A;  4G50 A;  5KHO A;  1I42 A;  1ISN A;  4BVU C;  2K8C A;  3KVF B;  1FXT B;  1WXV A;  3ZNZ B;  4J6I A;  4NY0 A;  2L05 A;  4KZ0 A;  3DPD A;  4I6P A;  4FAD A;  1WXA A;  3TIX A;  2UWQ A;  4GDL B;  5IA7 A;  5L95 C;  2KDI A;  2L0F A;  3MJW A;  5C23 A;  3EFU A;  3AUL A;  4WWP A;  2IZV B;  2HE7 A;  2RR9 A;  1UZX B;  4HPM B;  4HXD A;  3L13 A;  4FN2 A;  3V60 A;  2N1V A;  2LAS A;  2FCM A;  2J7Q B;  2C60 A;  2DZK A;  2O2V A;  2KZR A;  1RRB A;  4KDI C;  1WI0 A;  1E5W A;  3VUW A;  4TV3 A;  4IWO A;  5E6P A;  4WJQ A;  2BWE S;  4K7W A;  2KJH B;  1OEY A;  2KJR A;  3H6N A;  2KJ6 A;  2MBE A;  2FID A;  1Q1O A;  4MSM B;  2KNB A;  3BY4 B;  2MBB B;  4ANV A;  2GBK A;  3L10 B;  5KHQ A;  3VDZ A;  3KUD B;  4EOY A;  3PVL A;  5DPS A;  2NCN A;  3MHS D;  1WJU A;  5CX3 A;  4NAW B;  2MX2 A;  2JY6 A;  4AWJ A;  2D2Q A;  1X1M A;  4A3O A;  3X0W A;  4CO7 A;  4OVU A;  1GNU A;  2LVQ A;  4LJP B;  3N32 A;  4JL9 A;  3LDZ E;  4PS3 A;  4EZK A;  1IP9 A;  3PT2 B;  3QHT A;  3PLU A;  3EHV A;  4B6W A;  2LVP A;  2KTR B;  2M1M A;  2N9P C;  1U4A A;  4BKG A;  1L7Y A;  4FHJ A;  2WDT B;  3MTN B;  2WX1 A;  3ZDM C;  4II3 B;  2KWC A;  3UQA A;  2NPT B;  1UBI A;  2N9X A;  2IO3 B;  4E3C A;  1SIF A;  3TCA A;  2KHW B;  4B9K A;  2K39 A;  2REX A;  2LRU A;  4RMA A;  1E8W A;  1V5O A;  1WX8 A;  1XD3 B;  1K8R B;  2KX3 A;  1P9D U;  4ANW A;  3CSF A;  3U30 A;  1GC6 A;  3S2A A;  3VVW B;  3KYC D;  3H7S A;  3UIO B;  2G45 B;  2K6Q A;  3LJ3 A;  1H8C A;  4G3X B;  3ZRC A;  4BKS D;  1WR1 A;  1JRU A;  2A5U A;  1WYW B;  3DCG A;  3M3J A;  5AZH A;  3Q3F A;  2KK8 A;  5TR5 A;  1WR6 E;  2O6V A;  4JLC A;  2RD0 A;  2DHZ A;  2ASQ A;  4ZRJ A;  3ZNG C;  3ZNI D;  4ANX A;  5DPW A;  3ZVV A;  5LXH A;  4E71 A;  4GSW A;  1WRD B;  2KX0 A;  2ZNV C;  4F1S A;  2LUE A;  2M8S A;  2C7H A;  2K25 A;  2ZNV B;  3A9K A;  2ZVN A;  2CHW A;  2JUO A;  2JWZ A;  2V1Y A;  2KFK A;  1TBE A;  1P1A A;  1TGZ B;  2L0T A;  2HD5 B;  3AU4 A;  3KUC B;  3QX1 A;  3SHQ A;  5E6O A;  4FBJ B;  2EMT A;  2RGF A;  2XK5 A;  3IFW B;  1E7V A;  3QK0 A;  1WY8 A;  3P2B A;  1OEY J;  3I3T B;  3PRE A;  3OLM D;  1UH6 A;  2A4Z A;  3D32 A;  4MDK E;  3KYD D;  2HTH A;  2GMI C;  4MGI E;  3A1Q B;  4FA6 A;  3IVF A;  2MCN B;  1V80 A;  3TJP A;  4GGQ A;  2MRP A;  2KQ7 A;  3AI5 A;  2ZPN A;  4I6L B;  4TQ0 A;  2ZJD A;  4IWQ A;  3VQI A;  3WAM A;  3W1S C;  5HKH A;  4MJS A;  3ZIM A;  4K81 A;  2O6V D;  4KIK B;  1AAR A;  5DPR A;  1YIW A;  1WJ4 A;  1LFD A;  1WGH A;  2NBW B;  2I1K A;  3PS6 A;  3WA0 A;  1GJZ A;  5J17 A;  3U8Z A;  1P98 A;  4HVB A;  1WJN A;  5LLI A;  2WX0 A;  1WIA A;  4MGK E;  3L17 A;  4GDK B;  1WX7 A;  3M95 A;  1V5T A;  4A3P A;  2L76 A;  1E7U A;  2KXJ A;  3KUZ A;  3QA8 A;  4KSL C;  1WZ0 A;  2WWZ A;  3WAO A;  2DYO A;  2HJ8 A;  3ENE A;  2M17 A;  4KZC A;  4NJ7 A;  3T8M A;  4TQ1 A;  4EEW A;  4F8C B;  2K8B A;  3QAR A;  2MP2 B;  1WM3 A;  2JZ3 B;  3KW5 B;  4RM8 A;  2EKE C;  3RCZ A;  4AUQ C;  3ALB A;  3NS8 A;  1NDD A;  3HIZ A;  3O65 B;  4GU2 A;  2LVO A;  4TKN A;  3VXW A;  1F9J A;  1YX5 B;  2KDF B;  3QJZ A;  3H1U A;  3RYT A;  1UD7 A;  2OJR A;  2R2O A;  1WE7 A;  2LWP A;  4ICV A;  1V86 A;  3DBH I;  2G3Q B;  4YL8 A;  3M62 B;  1WXM A;  1WFY A;  3CF6 E;  2CS4 A;  2OOB B;  4DDI D;  4AOF A;  3PSE B;  3QC8 B;  4RM9 A;  3TMP B;  3QIJ A;  2IO0 B;  2RSU A;  3L16 A;  2YVC A;  4NAW A;  2MBO A;  3QCA A;  2JT4 B;  4URK A;  4WWN A;  2D11 A;  2KLG A;  1OQY A;  3H9D A;  4M8M A;  1YD8 U;  2LI5 A;  4W9G A;  3L08 A;  4ICU A;  3NY5 A;  4IG7 B;  3VTW A;  4A20 A;  1A5R A;  1J0G A;  4DWF A;  1KLV A;  4EKU A;  4JIO U;  4G11 A;  2DZJ A;  1KOT A;  4GOC A;  2KDE B;  5JH5 C;  2LXC A;  5EDS A;  1MG8 A;  4W9L A;  4IW0 A;  2DZM A;  3ONS A;  2IYD B;  3U7D A;  1ZGU B;  1IYF A;  2KC1 A;  2L00 B;  3A4S C;  2BYE A;  2ZPY A;  3QWZ B;  3ZO5 B;  3L0W B;  2BGF A;  1WH3 A;  2MBQ A;  4XC2 A;  3WIM A;  1SGH A;  2KDB A;  2Z0D B;  4MEL A;  3A9J B;  3VTV A;  4DHZ E;  2MA9 B;  2LGD A;  2VRR B;  3KH0 A;  2IO2 B;  4OVV A;  2N1W A;  5CHV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...