4EFOA

Crystal structure of the ubiquitin-like domain of human tbk1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
PLGSTSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase TBK1
publication title Crystal structure of the ubiquitin-like domain of human TBK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 23
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4efoA00
4GMVA 2KLCA 4EKUA 2OJRA 2MP2B 3L16A 4W9JA 4EEWA 3IVFA 3B1LX 3RT3B 1WGHA 3KYDD 1R4MI 3OLMD 2KNBA 3DDCB 3WAMA 5J18A 4AOFA 3VTWA 1Z5SB 1YD8U 5AZGA 1WXVA 4M0WB 2KD0A 1E8XA 3UQAA 5KHOA 2N4FA 4JL9A 1WE7A 3JYUA 4LDTB 2Z59B 3DVGX 3TCAA 4IG7B 3W1SA 2GBRA 4ANVA 3R7RA 2KHWB 1IP9A 3TJPA 3VUWA 2LXAA 3QIJA 5IAAC 1KOTA 4XC2A 2REXA 1Q5WB 1WR1A 4DDID 2KK8A 2LRWA 3N30A 4FULA 1V2YA 2KTRB 2V1YA 4GU2A 5CHWA 4F7ZA 2RGFA 2ZCBA 1WZ0A 1PQSA 2XK5A 2EMTA 4K1RB 4EOYA 4GOCA 3H9DA 3IFWB 2NR2A 3VTUA 2HJ8A 4BKTA 3V60A 3M62B 4WAAA 2FIDA 1V80A 4KZ0A 4MGIE 5LXHA 3HM3A 4NAWA 2JPHA 3ZNHB 2KVRA 2EKEC 3VH4B 4HCPB 3TL5A 4BKSA 3L13A 2MBBB 3PZDA 2MBOA 3KVFB 2M0XA 2O6VD 3M63B 3MHSD 4I6NB 4HK2A 3HHMA 4KSKC 4DXAB 4E3CA 2A5UA 2J0KA 4B9KA 1EO6A 2DAJA 4ANXA 4CYEA 2G4SA 2KWUB 2N9PC 2NPTA 2YLMA 2ZPNA 2BPSA 2PEAA 3ZUNA 1ZGUB 4NAWB 2M4NA 1GNUA 1YQBA 3NOBA 3NS8A 2N9XA 4G0NB 4DBGA 2JVCA 3EHVA 4LJPB 1Y8RC 1L2NA 4MDKE 3ZNID 1V49A 2HD5B 2MBQA 2BGFA 4P7IA 2KC1A 4W9HA 4W9KA 3H7PA 3A9JA 3NZUA 4KVGB 3ZLZA 2NCNA 3ONSA 1LFDA 1WI0A 2NPTB 1C3TA 3ZKJC 4BVUC 5LLIA 2CU1A 3AI5A 3TMPB 4FA6A 4GDKA 4XX5A 2MQJA 1RLFA 3V6EB 4AUQC 2PE9A 4ZRIA 1E8ZA 4MJSA 2MCNB 3VXWA 2CHXA 3A9KB 2JZ3B 2IY0B 3M3JA 3H7PB 2FAZA 3X0WA 4W9DA 4HVBA 2M17A 4AP4C 4GB9A 1NI2A 3LDZE 1X1MA 4FLHA 3T9LA 3TBLD 1XD3B 2KJRA 4AJYB 4IM2A 5E6OA 3ZNZB 3N3KB 3ZVVA 1UBIA 4GDKB 3WALA 2MX2A 1ZW7A 2FCQA 1V86A 3ZIMA 2BWES 4FBJB 1WR6E 3L17A 1WXSA 4FJYA 4WJPA 5D94A 3U30A 5L83A 3H1UA 3DBRI 3PPAA 1V6EA 1AARA 3O65B 2KZRA 1XT9B 2M1MA 1GG3A 3A33B 4MEMA 3HK0A 4I6LB 2LVPA 2DZIA 2NBUA 3VFKA 3RCZA 1WX8A 1R4NI 4ZRJA 3V61A 1WJUA 4DHZB 4ANUA 2JRIB 3L0WB 4IC7B 5DPRA 1P98A 2NBWB 3V6CB 5J17A 4W9CA 2L3ZA 1WXMA 3PHXB 2C7NB 1LM8B 3BINA 4KZCA 5JHAA 1Z2MA 2RSUA 4RMAA 2ZCCA 5C1ZA 2MLBA 2KN5A 4NNJB 3PGEA 2K1FA 4IWOA 3APDA 4GXBA 4IM3A 2GMIC 2HE7A 2KKCA 3OAWA 3QHTA 2KO3A 2ZNVC 1V5TA 2LGYA 4G11A 4YL8A 2KXJA 2L05A 5G2NA 2KX0A 4DWFA 3WAPA 1E7UA 1BT0A 1SGHA 2KDFB 2RR9A 3MJWA 4I6PA 3VVWB 2C5LC 3JW0X 4HXDA 4NJ7A 4KIKA 2ZJDA 3VH3B 2KTRA 2GBNA 3K9PB 1JRUA 3QARA 1LXDA 2GBKA 3H6NA 3RZFA 2RPQA 3HM6X 2K6DB 1E7VA 1OTRB 1TTNA 2KWVB 3B0AA 4RM9A 2LVQA 2LUEA 1EF1A 2N1VA 4GN1A 2HTHA 2MBHA 3P2BA 3JSVA 2IO0B 1RFAA 1U4AA 3AXCA 2JXXA 5E6PA 1MG8A 1M94A 4OVUA 1D3ZA 2DAFA 2N1WA 4KIKB 4MGYE 4TQ1A 4ASWC 5G55A 4WJOA 2KMAA 2BKFA 3UIOB 2MSED 4G3XB 1WJ6A 3MTNB 3VAWA 3DQVA 2D10A 1UZXB 1F9JA 3NY5A 4GIVA 2O2VB 5CTRC 3R3MA 2L00B 4W9LA 2AL6A 2AYOB 5LXIB 3JSVB 2KTFA 3UIPB 3V62A 4HDOA 1V9JA 2FCMA 4ZRKA 3UINB 4F1SA 1HE8A 1ZKHA 3W1YA 4DHJD 2ZPYA 2N7DA 4IM0A 2AEHA 4PS8A 3ZW3A 1SIFA 3R7QA 2ZZPB 4HJKA 5L95C 5D2MB 1UD7A 3PS6A 3RYTA 1WFYA 2KOXA 1GC6A 2AWTA 3DVNV 2V3SA 3EECA 1WM3A 1XQQA 3ZO5B 4J6IA 4CO7A 4II3B 3APFA 3HIZA 1SE9A 1WX7A 3K9OB 3SDLC 1WGDA 2FUHB 2KANA 1C1YB 2KJHB 1J0GA 4IUMB 4KV2A 3QAQA 2UYZB 3TIXA 5AEKB 2KFJA 4A20A 3A9KA 4PS7A 4M8NA 1I42A 1GUAB 1WX9A 2FNJB 4A3OA 3PRPB 4W9FA 4NQKE 2C60A 1LQBA 2CS4A 2LRUA 2YVCA 1UGMA 1WJNA 2KQ7A 3VDZA 2BYFA 2WYQA 4K7UA 3WAOA 4ZYNA 3JVZX 3ZTDA 2OOBB 4PS3A 4EZJA 2PPHA 4EUTA 2W9NA 3L10B 5CX3A 2KDEB 1YJ1A 2DZMA 3BY4B 4AJWA 4E71A 2L0FA 2DHZA 2N7EA 2MA9B 3AU5A 3GOEA 3IBEA 1EUVB 4JLCA 3Q3JA 4NPNA 2D11A 1I35A 1UH6A 3VUXA 2N9EB 3DVNU 4WJNA 3LJ3A 1WH3A 3OJ3A 1OEYJ 3DBLI 1WZ3A 3SD5A 4WWNA 1H4RA 1WF9A 1TGZB 2G3QB 2GOWA 2PE6B 3X23A 5EDSA 3L54A 2O6VB 3GZNI 4OVVA 2CHZA 3KUCB 3DOWA 2WX0A 5CHFA 3I3TB 1TZ1A 4MELA 2G45B 2FCSA 1E5WA 3PTFC 4W9IA 3ZDTA 4WWOA 4B6WA 1J8CA 4MGZE 4PYUA 3WA0A 3KYCD 2JUOA 2V4LA 3L08A 3QQ8B 3RULA 3OJ4B 2Z0DB 2KDIA 3UF8A 2KJ6A 2JY6A 3CSTA 3C0RB 4NQLB 1T0YA 1UBQA 2WWZA 5IA7A 2MBEA 2J7QB 4LDTD 1YIWA 1WM2A 2LJ5A 4MSQB 2RD0A 3DBSA 4BOZB 2DX5B 4URKA 1RAXA 2BYVE 3CMMB 5CHVC 1IPGA 3U8ZA 1Q1OA 3ZRFA 3VQIA 1G6JA 2KC2A 1UELA 2DZJA 1S3SG 2WX1A 3PVLA 3R66C 2G4DB 3KH0A 4RM8A 1YX5B 5DCNA 5AZHA 5D6JB 1WGGA 2D2QA 1KM7A 1E8WA 1L7YA 3PREA 2LGXA 4W9EA 1WGYA 1IYFA 3WIMA 3QA8A 2J0MA 4MH0E 2GBJA 4BOSC 2BF8B 3T8MA 1A5RA 2C7HA 2JWZA 4G50A 3QX1A 2GBMA 1P9DU 2R2OA 3PRZA 1P3QU 5HKHA 1Q0WB 4K7WA 3QCAA 3KW5B 1VD2A 4BKGA 3W1SC 2O2VA 4NY0A 4KSLC 5FR6A 1P1AA 1OEYA 3NHEB 1YX6B 2ZVNA 1WJ4A 3DBHI 1P0RA 2R2QA 5DPTA 1KJTA 2IO3B 3M95A 1QZEA 4GGQA 5TR5A 2M8SA 2MWSB 3DCGA 3NZSA 3ENEA 5DPSA 2IYDB 4GDLB 2CR5A 4WJQA 4BKSD 3ZNGC 2LVOA 4BBNF 3PSEB 3PLVA 1TBEA 4A3PA 4EZLA 2J0JA 4TV3A 1WYWB 3KUZA 2MRPA 4N9F4 2Y5BB 2ZNVB 4W9GA 1E90A 3IHPC 3PHWB 2DYBA 4KDIC 4MSMB 4JIOU 2K8HA 4FHJA 3UGBB 3ML8A 4NJ6A 4BBNC 2LASA 5BO4B 1GJZA 4IWPA 3ML9A 1WMHA 4HDQA 1KLVA 1WXAA 1OGWA 2KMCA 3CF6E 4ICUA 4WWPA 5JHBA 2BKRB 2NBVB 2KFKA 4TQ0A 1CMXB 2ASQA 2C9WB 4GSWA 4MM3A 3UQBA 3ZTCA 5KHQA 4K81A 2XEWA 3ALBA 4HCNB 1WY8A 3PRMB 4AWJA 1EF5A 4EFOA 3U7DA 2K25A 5E6NA 1V81A 3ZDMC 3RD2A 2L8JA 4CHKA 3VHTC 2ZVOA 1WMHB 4BFRA 2DENB 3A4RA 4TUUA 4WQOB 1H8CA 3KUDB 4B95A 2LI5A 2KFKB 2B3AA 1VCBA 4E74A 2XK5B 2IO2B 2WDTB 4FHKA 2LXCA 2BWFA 2LZ6A 1NDDA 4X57B 2I1JA 4FJVB 3QWZB 2QHOA 3AU4A 2L7RA 3AULA 3RZWC 4ZDVA 4EZKA 2KLGA 2XBBC 3ECIA 2KDBA 3EFUA 2O6VA 4F8CB 1WRDB 2LWPA 3QJZA 4II2B 2NVUI 2CHWA 2DYMA 1OQYA 2DYOA 2IO1B 1NBFC 1WE6A 3B08A 3A1QA 3EC8A 3PV1A 4LJOB 2VRRB 2AL3A 4FJZA 2BYEA 4M8MA 2D3GA 2UWQA 4DHJB 3SHQA 3DVGY 4HPMB 3H7SA 2NS5A 3N32A 2I1KA 4XZ4A 3PT2B 3QC8B 3PLUA 3IG3A 3A1QB 3A9JB 2LGDA 4ICVA 2FCNA 3WANA 5J2RA 2EMSA 1RRBA 4DK5A 3D32A 2K8CA 5AZFA 4JGHB 1WGRA 2JT4B 1FXTB 4KDLB 3QK0A 2JZZA 5GMVA 2KX3A 1S1QB 2D07B 4MJSB 2IZVB 2JF5A 3DPDA 4HWIB 3S2AA 5JH5C 5DPWA 4DDGD 2MW5A 4PYZA 3SU8X 2LD9A 2L0TA 4FN2A 4JQWC 3CSFA 2JRHA 4ANWA 4DHZE 3VUYA 2C7MB 3APCA 5C23A 4HPLB 3A4SC 2KQSA 2K8BA 4IW0A 2CKHB 2ZEQA 4IWQA 2MP2A 1GC7A 2A4ZA 1V5OA 2Z0EB 1ISNA 2L76A 4MGKE 1WIAA 5JZEB 2IY1B 1K8RB 4GDLA 4HLEA 3RUIB 2DZKA 3Q3FA 4TKNA 2K6QA 4K7SA 2IBIB 2KWCA 1J19A 2K39A 3VTVA 3ZRCA 4FADA 5D7GA 4LCDE 2FIFA 1E8YA 2PJHA
chains in the Genus database with same CATH superfamily
4LNFA 2KMMA 4W9JA 4EEWA 3IVFA 3B1LX 1EWCA 3KYDD 3WAMA 2WXOA 1VZ8A 5J18A 3VTWA 2MHJA 1F77A 3BK1A 1RFKA 2N4FA 1UGJA 2W3SA 1WE7A 3JYUA 2XN9C 2BB5A 4C80A 2BB6A 2GBRA 2KHWB 1MVKA 3EA6A 2LXAA 5IAAC 4XC2A 2REXA 1Q5WB 2M19A 2WXPA 5AUKA 4F7ZA 2INNE 1WZ0A 2J4XA 2TSSA 3RN9C 1AN8A 3AE7B 1JROA 3H9DA 1FXAA 2PIAA 4AS1A 2HJ8A 3M62B 1FIQA 5IN7A 3Q8CA 3VH4B 4HCPB 3V3XA 4BKSA 1FMAD 2Y5CA 3PZDA 3MHSD 4A9AA 3HHMA 2A5UA 1R4MB 2DAJA 2QIEB 4ANXA 4CYEA 2KWUB 2NPTA 2YLMA 2YEPB 2BPSA 1SF0A 3NS8A 3ZNID 1XCTL 2HD5B 2BGFA 4YTNB 1KTKA 4KVGB 3SR6A 1KH0A 2I38A 1WI0A 2KYWA 5LLIA 2CU1A 4FA6A 2N9LA 2RMMA 4UDUC 1CQVA 3V6EB 4L23A 4MJSA 4ARCA 2B76B 2E3TA 4ZYSA 2FAZA 3X0WA 4W9DA 4HVBA 2M17A 4AP4C 1XO3A 3MC8A 4S17A 4XDCA 2FCQA 3ZIMA 5L83A 4WJPA 3H1UA 1V6EA 4IOIE 4MEMA 3U4EG 3HK0A 1HA5A 1FPYA 1SJHD 4ZRJA 1L6VA 4ANUA 4C00A 3U52E 3IT6B 2C7NB 4RMAA 5C1ZA 4TMAB 1KRHA 1TIFA 1P7FA 4ACFA 1HTQA 4LNOA 3AMZA 3NG0A 2ZNVC 4G11A 4LLGM 2KXJA 2L05A 1SGHA 1BT0A 3MJWA 4I6PA 5D3DA 2GBNA 1M4VA 2GBKA 1WXQA 2LFIA 3TEXA 2LUEA 2M0AA 3URYA 3JSVA 1U4AA 3AE8B 1MG8A 1M94A 4OVUA 4KIKB 4MGYE 4ASWC 3LYYA 2GI9A 1J7CA 4NZLB 1QOAA 3AE4B 1UZXB 1F9JA 5CTRC 1QLBB 2KTFA 1XEEA 2Q5WD 3UINB 1HE8A 1ZKHA 4DHJD 3O13A 2AEHA 4PS8A 3R7QA 1J7BA 1UD7A 3PS6A 3P4SB 3RYTA 2AWTA 3DVNV 3EECA 1SEBD 1YOVB 4J6IA 4II3B 3RMKC 4ZRPA 3K9OB 1PYWD 4MACA 3QAQA 2UYZB 4M8NA 1JCKB 1WX9A 1QKZA 4W9FA 5C3JB 2LRUA 1WJNA 2JXTA 2WYQA 4K7UA 1TY2A 4A8XC 2UU7A 4BAXA 4PS3A 5I4DA 2PPHA 3L10B 3ZXRA 1LGRA 2L0FA 4JLCA 2N7EA 4NPNA 3UQAA 4P6VF 3I63C 1UH6A 2N9EB 3DVNU 3LJ3A 3DBLI 1WZ3A 3SD5A 3P63A 4WWNA 1WF9A 1TGZB 4QAYA 3GZNI 1SE3A 3KUCB 2VZKD 3ZGZA 3I3TB 1TZ1A 2G45B 2FCSA 3PTFC 3ZDTA 4WWOA 2JUOA 2V4LA 3QQ8B 3RULA 2KDIA 3CSTA 1V1PA 1T0QC 1T0YA 1D5XC 1F0ZA 1V8CA 4RGTA 5EE0A 4LDTD 2DX5B 3AE9B 4RGOS 3VQIA 2V3PA 4HEA1 1A70A 1Q10A 1F2RI 1YX5B 5H8YE 5AZHA 2NMQA 1KF6B 2H89B 1KM7A 1D5MC 1L7YA 3N20C 1B1ZA 1DGJA 1MI0A 2GBJA 2JQRB 3T8MA 4G50A 3QX1A 1P3QU 5HKHA 1Q0WB 4K7WA 4BKGA 1GB1A 5FR6A 1P1AA 1OEYA 4JX1C 3NHEB 1YX6B 2AQ2B 2ZVNA 1I7HA 1WJ4A 2LHEA 1JWAD 5TR5A 2MJ3A 4BKSD 2KVZA 2LUMA 1TBEA 4A3PA 4EZLA 4TV3A 4HKQA 3KUZA 4RFBA 2MRPA 3BVMA 4W9GA 4KDIC 3NS1A 4JIOU 3C19A 3DHGC 3UGBB 3GS2A 4BBNC 2LASA 5BO4B 3AECB 2X8XX 1OGWA 3NRZA 2KMCA 2WXLA 2K22A 2KFKA 1CMXB 1QOGA 2ASQA 4GSWA 4OZAA 2GRIA 4YT0B 2W54A 1NEKB 1EF5A 5E6NA 1XLOA 3RD2A 2ZVOA 1WMHB 2PLPA 2V4IB 1VCBA 1ZDVA 5FKAC 1FFVA 1NDDA 4FJVB 2L7RA 3AULA 1GB4A 3ECIA 2JU6X 3QJZA 4II2B 3H8HA 1OQYA 2PMVA 1NBFC 4LJOB 3A1QA 1YJJA 1VR9A 4FJZA 1ET9A 1HEZE 3IT4B 2KT7A 2Y5PA 1UWMA 4NJCA 2AQ1B 3VRBB 1EWYC 2OEDA 4C7YA 3QC8B 1ZDXA 3A9JB 4JWSC 2LGDA 1J7AA 4YSZB 3WANA 5J2RA 1E9MA 2K8CA 4JGHB 2JT4B 4ZRQA 2E6XA 2WXMA 2INDC 1JQ4A 2QCZA 1VRAB 4HWIB 3S2AA 5DPWA 1JALA 4TSSA 1XCQL 3AH7A 2LD9A 2L0TA 3CSFA 2C7MB 3HUIA 2ZEQA 4JPSA 5HG2A 2Z0EB 2L76A 5EE9A 1WIAA 1JWUD 1L0XB 3AV8A 4KGRA 4HLEA 1AWDA 2K39A 4LNIA 3ZRCA 5D7GA 4WWMA 2PJHA 4EKUA 2KLCA 2MP2B 1WGHA 2W3RA 2KNBA 1E7PB 1I4RA 1PGBA 1N61A 1NI3A 4M0WB 5KHOA 4JL9A 2WLBA 1EM7A 2Z59B 3LXFA 4IG7B 2WDQB 1IP9A 1WR1A 2KK8A 2LRWA 2V1YA 5CHWA 2RGFA 3TSSA 3Q69A 2BW2A 2XK5A 2Y3AA 4K1RB 2GLSA 1R7SA 5FR3A 4KZ0A 4MGIE 2JPHA 3ZNHB 3GE8C 3TL5A 3ZNZB 2MBOA 3M63B 2O6VD 4KSKC 4I6NB 4PS7A 4HK2A 4E3CA 4B9KA 4H2AA 1EO6A 2WXGA 2G4SA 4YTPB 2PEAA 2BS3B 2M4NA 2N9XA 4G0NB 4DBGA 4LJPB 1TT5B 2MBQA 3AE6B 3EUB2 3ONSA 1LFDA 1YN5A 1C3TA 1HXYD 1RM6C 4AUQC 4ZRIA 4RNAA 2MCNB 2JZ3B 1XLNA 3H7PB 3RI7C 4GB9A 3LDZE 4Q2JA 1X1MA 4AJYB 1DOYA 4IM2A 3SFDB 1K52A 2WXNA 1ENFA 1ZW7A 3AM9A 3AB5A 1C4CA 2BWES 3L17A 3Q8EA 5D94A 2D5GA 1AARA 2BT6A 3O65B 1XT9B 1GG3A 3IXSA 2NBUA 1XLPA 1WX8A 3Q2AC 4DHZB 4OVZA 3L0WB 4IC7B 5DPRA 2NBWB 3V6CB 5J17A 3MC9A 4W9CA 3SFEB 1WXMA 4JWUC 1LM8B 4C56C 5JHAA 1Z2MA 3W5UB 1DOIA 3TUOA 1FNUA 4IM3A 2GMIC 4YSYB 3OAWA 2VH2A 4YL8A 1QQRA 1ACCA 4HJGE 1E7UA 2KDFB 2RDBC 2ZW0A 4KIKA 2ZJDA 3VH3B 2KTRA 2K5PA 2LHDA 3IAM1 3B0AA 4RM9A 1EF1A 3Q8AA 1N6ZA 3E9SA 3P2BA 1QF6A 3AXCA 2JXXA 3PZ8A 4REZA 2N1WA 4TQ1A 5G55A 3GP7A 4WJOA 2BKFA 4G3XB 4GIVA 2AL6A 2AYOB 3V62A 3UIPB 4HDOA 1K53A 1V9JA 2V3NA 1HTOA 4F1SA 2KDMA 4AQ7A 2ZPYA 2N7DA 4IM0A 2G1EA 3ZW3A 1SIFA 5D2MB 1VJKA 1WFYA 1DOXA 1GC6A 3HIZA 4CQNA 3AEBB 1SE9A 5HHDG 1WGDA 2FUHB 2KANA 3Q3OC 4EE2A 2WQYB 1N60A 1C1YB 2KJHB 1VZ6A 4KKIA 4KV2A 4WAFA 4IDIA 2LGSA 3A9KA 4C4VB 1GUAB 2FNJB 4NQKE 1LQBA 1IBXA 4KGSA 3DHIC 3ZTDA 3WCQA 1B9RA 4L1BA 2W9NA 2KDEB 3BY4B 2HJ1A 1VZ7A 2DHZA 2MA9B 3AU5A 3GOEA 3MP9A 2D11A 3VUXA 1WH3A 3OJ3A 1OEYJ 2W55A 3KLSX 2PE6B 2G3QB 5EDSA 3L54A 1TZOA 2N7JA 4OVVA 2CHZA 2D3BA 4YWGG 4MELA 1E5WA 1J8CA 4MGZE 4PYUA 3KYCD 4N6EB 3C0RB 5IA7A 1KLGD 5BYQA 1WM2A 4MSQB 1TS4A 1N5XA 1RAXA 3CMMB 5CHVC 1C76A 3U8ZA 1Q1OA 2DZJA 2WX1A 3R66C 3KH0A 4RM8A 5DCNA 5D6JB 3ABVB 4KKJA 1E8WA 2LGXA 4BOSC 4S0RA 2QC8A 5EE3A 3RPFC 2C7HA 2GBMA 2WU2B 3QCAA 3KW5B 3Q6BA 2O2VA 3BVGA 1ET6A 1AYFA 3AE5B 4ZHOA 2JZPA 1KJTA 3M95A 1L4DB 1D6EC 2MWSB 3NZSA 3ENEA 2W82A 4WJQA 2WHIA 4KGTA 1FNVA 3PLVA 1BUIC 1FEHA 2KWDA 4PK1A 1WYWB 2XNAC 4N9F4 4O1NA 2Y5BB 1YQ4B 1E90A 3PHWB 2K8HA 1GJZA 1TJEA 3CWIA 3HVZA 1WMHA 1KLVA 2EELA 3CF6E 2BKRB 2NBVB 2C9WB 4MM3A 4FXCA 4K3CA 1XXGA 1TYGB 1FO4A 4EFOA 1FCCC 2K25A 4A55A 1E0ZA 3ZDMC 3W9CB 2AQ3B 3VHTC 4BFRA 2J42A 4TUUA 4B95A 2DNFA 4ZOHC 5D3IB 1HZ6A 2LXCA 1SE4A 2I1JA 3QWZB 2QHOA 4IKGA 2X38A 3RZWC 2KN4A 4YTMB 3I57A 2KDBA 3EFUA 2O6VA 4F8CB 1JRPA 1LO5D 2BTEA 4XWWA 2QDFA 3HVDA 1C78A 2NVUI 2DYOA 3EC8A 3B08A 3PV1A 3AEEB 2WDRB 3NVYA 2VRRB 1XLQA 3KWVA 2UWQA 4LNKA 3H7SA 2NS5A 2BS2B 1DYQA 4XZ4A 1C77A 3PT2B 3IG3A 2L1AA 2EMSA 1I4XA 3QK0A 2BBCA 2JZZA 3B9JA 5GMVA 5LNK1 4RH6A 2KX3A 5IKCM 4MJSB 1AW7A 3DPDA 3TEZA 4FN2A 2BYTA 2JRHA 1NYRA 3APCA 4OZCA 5C23A 4IWQA 2MP2A 1GC7A 3Q3NC 2A4ZA 1V5OA 1MJDA 5JZEB 1K8RB 4GDLA 4P1BC 4WQMA 3SEBA 4ARIA 2HDEA 2D3AA 2DZKA 4M0WA 2K6QA 3T3NA 2IBIB 1J19A 1ZP0B 4FADA 4GMVA 1N62A 3NVZA 2YEPF 1D3ZA 3RT3B 1R4MI 3DDCB 4AOFA 1YD8U 1C79A 1E8XA 1VDVA 1EU3A 3DVGX 4ANVA 3R7RA 1HQRD 3TJPA 1KOTA 3N30A 4FULA 4GU2A 2ZCBA 1GPXA 4P1CC 3IFWB 2NR2A 3VTUA 4BKTA 1FCLA 4WAAA 1V80A 5LXHA 1PGAA 1C9FA 4D2KA 3L13A 4RGMA 3KVFB 2M0XA 2ZPNA 3ZUNA 1ZGUB 4NAWB 1YQBA 1ESFA 2LJIA 2JVCA 3EHVA 2ICIA 1L2NA 3MJ5A 4P7IA 2KC1A 4XWTA 4W9KA 3H7PA 2NCNA 2WXIA 3ZKJC 4BVUC 3AI5A 1CZPA 2MEKA 1RLFA 4OHJA 1ZOYB 2PE9A 3T3OA 1E8ZA 3VXWA 2CHXA 2IY0B 2JSVX 3T9LA 1XD3B 3ZVVA 1UBIA 4GDKB 3WALA 3VR8B 1V86A 1SBBB 4OW0A 4FBJB 2PKOA 2QSDA 2WGSA 2DZIA 4A90A 2MJDA 3VR9B 1T0RC 1RWSA 5H92C 1P98A 2L3ZA 3ETRA 3RNCC 2RSUA 4HROA 2FUG1 2MLBA 4NNJB 4N58A 2K1FA 4IWOA 2IGHA 2OJWA 4OZBA 2WS3B 2LEKA 1TS2A 4WURA 2KKCA 3QHTA 4DXFA 2KO3A 3NUHB 2KACA 5G2NA 5G5HA 3B2GA 3WAPA 2RR9A 4XYCA 2C5LC 4NJ7A 3K9PB 1JRUA 1FRDA 1LXDA 3RZFA 3HM6X 1NVID 1ZXHA 1E7VA 1OTRB 1SXTA 3NVVA 1SE2A 2HTHA 2N0SB 2JYEA 2IO0B 1RFAA 1TS3A 1F52A 2J53A 1WYGA 4DXGA 3TEWA 3P42A 2LMCA 3UIOB 1WJ6A 1SJED 3VAWA 3R3MA 3RNGC 3NJTA 1STEA 4PT5A 1BXTA 2FCMA 3DHHC 3N9YC 2K0PA 1PGXA 4C4VA 5L95C 4LTUA 4YXDB 1WGKA 1WM3A 1XQQA 4CO7A 3APFA 1WX7A 4RF0A 2JX5A 1J0GA 4IUMB 5FK9C 2KFJA 4A20A 1E6EB 4A3OA 2CS4A 2YVCA 2WP9B 3VDZA 2MJEA 4ZYNA 3WAOA 1FXIA 2OOBB 3L4PA 3PZ7A 4ITKA 4AJWA 1ZUD2 5E6OA 1E10A 3Q3JA 1I35A 3P4RB 4WJNA 5BYRA 5AUIA 1H4RA 1Y56A 2INPE 3DOWA 5CHFA 3DWMA 3PO0A 4R3DA 2L32A 4W9IA 1L0VB 1TKYA 4B6WA 4KX6B 3WA0A 5E6JA 3CIRB 2HTME 4NQLB 1UBQA 2WWZA 1JMLA 1JWSD 2LJ5A 4J3OD 3RNAC 2BYVE 1YN4A 1SIJA 1UELA 1T5XD 2BVCA 2K3UA 3PVLA 2PVOD 4HPPA 1K50A 1I4HA 3PREA 2QMTA 1WGYA 3WIMA 2J0MA 2R61A 4MH0E 2H88B 2BF8B 2SEBD 1P9DU 2R2OA 3PRZA 3ZJTA 3DBRB 3GB1A 2MH7A 4NY0A 2WU5B 1YJIA 1GAQB 1FD6A 1R4NB 1YQ3B 1P0RA 1OQRA 2WXJA 4B0EA 2M8SA 3DCGA 4XE0A 5DPSA 2IYDB 2CR5A 2VH1A 1UWXA 3BK2A 2J0JA 3FC4A 1XF5L 2ZNVB 3IHPC 4M02A 3DWGC 4FHJA 3ML8A 4NJ6A 4IWPA 4HDQA 2DBYA 3BWUD 3Q14C 4ICUA 5JHBA 3N1XC 1TKGA 3UQBA 5TSSA 1UF0A 3ZTCA 5KHQA 1D4BA 3ALBA 4HCNB 4US8A 3GE3C 5HFYA 3U7DA 2PW9A 3ZXVA 2L8JA 4CHKA 2DENB 1H8CA 3KUDB 2LI5A 2WXFA 2XK5B 2IO2B 2WDTB 3BVZA 2BWFA 4X57B 1FFUA 3P4QB 4ZDVA 4EZKA 2KLGA 2XBBC 5EE1A 3N1ZC 3I5JC 2CHWA 2D3CA 1GOZA 5BMHA 4XGAB 1WSPA 1T0SC 2AL3A 2L52A 4M8MA 2BYEA 2D3GA 5GXGB 4DQOC 1CK1A 4DHJB 3SHQA 2PTLA 4N59A 3DVGY 4HPMB 1I4GA 3N32A 2Z8LA 2I1KA 1PUTA 3PLUA 4ICVA 4ZHPA 3D32A 5AZFA 1FXTB 4K3BA 2GB1A 2D07B 3U7ZA 5JH5C 4DDGD 2WXKA 2MW5A 3SU8X 1RYJA 4DHZE 3VUYA 3A4SC 2K8BA 1F2RC 5BMGA 1SSNA 1YN3A 4M00A 3FILB 3Q3FA 4TKNA 1N5WA 3KWLA 2WNMA 4LCDE 1E8YA 2IJ0A 2OJRA 3L16A 2J52A 2VZKB 2I2YA 4A6QA 3OLMD 1Z5SB 5T8IA 5AZGA 1WXVA 2KD0A 2LGIA 1OFFA 4LDTB 1PFDA 3TCAA 3W1SA 1JWMD 3VUWA 3QIJA 4DDID 1V2YA 2KTRB 4XDDA 2RDHA 1PQSA 2DLBA 2EMTA 2BQQA 4EOYA 4GOCA 3R2TA 3V60A 2FIDA 3HM3A 4NAWA 2KVRA 2EKEC 2MBBB 1IUEA 2BS4B 4DXAB 2J0KA 3DBHB 3W5VB 3MFGA 3NVWA 4JE3B 2N9PC 2V0GA 1I4QA 1GNUA 2WXRA 3NOBA 1F1HA 4RF1A 3BYYB 1Y8RC 2RPVA 4MDKE 1VLBA 1V49A 3KQ4A 3B2FA 3BIID 4W9HA 3I9V1 1PDXA 3A9JA 3NZUA 3ZLZA 3AEGB 2NPTB 5JXVA 3TMPB 3J9CA 4GDKA 4XX5A 2MQJA 5G5GA 1YNTE 1FNWA 2KAJA 3A9KB 3M3JA 5C2TB 1IBXB 4HKZE 1NI2A 3ZJVA 4FLHA 3TBLD 1C4PA 2NTSA 2KJRA 3HRDD 3N3KB 2MX2A 1WR6E 4FJYA 1WXSA 3U30A 4P16A 3DBRI 3PPAA 4US9A 2KZRA 2M1MA 3A33B 4I6LB 2LVPA 3LB8C 3UI3A 3VFKA 3RCZA 1R4NI 3V61A 1WJUA 2JRIB 3FKYA 1MFWA 3PHXB 1JWBD 3BINA 4KZCA 2ZCCA 2OHFA 2KQ4X 2KN5A 3PGEA 4M01A 1C4AA 3APDA 4GXBA 2HE7A 1K51A 1V5TA 2LGYA 2ONQA 4MH8A 1T6BX 2KX0A 4DWFA 3V05A 3VVWB 1NENB 3JW0X 4HXDA 3QARA 3H6NA 4MT5A 2RPQA 2K6DB 1TTNA 3OWEB 2KWVB 2LVQA 4GN1A 2N1VA 4YSXB 2MBHA 2QJLA 5E6PA 3AEAB 3ZQ4A 4L2YA 2DAFA 1QOFA 3RFZB 1TKEA 1WRIA 2KMAA 2MSED 1MG4A 1HZ5A 3MTNB 3DQVA 2D10A 4GLSC 3NY5A 2O2VB 5LXIB 2L00B 4W9LA 3JSVB 1ZPSA 1FM0D 4ZRKA 3W1YA 2INCC 1CJEA 1L6UA 1L0YB 2ZZPB 4HJKA 2KOXA 2V3SA 3MC0B 3TEYA 3ZO5B 2FBWB 1V97A 3SDLC 2G9HD 4RCOA 3TIXA 5AEKB 1I42A 3PRPB 2C60A 1UGMA 4MM3B 2KQ7A 2BYFA 1MHHE 1BMLC 3JVZX 2WXQA 4EZJA 1MHXA 2ACZB 4EUTA 1SB3C 5CX3A 1ZE3D 1TS5A 1YJ1A 2DZMA 4E71A 2V9HA 1QOBA 2ON8A 3IBEA 1EUVB 2JYTA 3Q8FA 1JW9D 3RNFC 2PVGC 2GOWA 3P4PB 3X23A 2O6VB 2N9KA 3RNEC 2IPKD 4USAA 2WX0A 5BMIA 2IGGA 5IP4D 3L08A 3OJ4B 2Z0DB 3UF8A 2KJ6A 2JY6A 3W2DA 1EU4A 2MBEA 2DWQA 3VRAB 2J7QB 2WDVB 1YIWA 2RD0A 3DBSA 4BOZB 3ZJUA 4URKA 1IPGA 3ZRFA 1G6JA 2KC2A 3AE2B 1S3SG 2CJNA 1V1PB 2G4DB 1WGGA 2IGDA 2D2QA 1ROEA 3AEDB 4W9EA 1IYFA 3QA8A 1A5RA 2JWZA 4RGNA 2EKIA 1VD2A 2JWUA 3W1SC 4KSLC 3BYTB 3Q8BA 3DBHI 2R2QA 5DPTA 2IO3B 1QZEA 4GGQA 3Q3MC 4GDLB 3ZNGC 2LVOA 3BZDB 2M56B 1T3QA 4BBNF 3PSEB 1MPEA 1NYQA 3MHZA 1TY0A 4MSMB 2DYBA 2NTTA 1IGDA 1V1OA 2AX5A 1N63A 3ML9A 1I4PA 1WXAA 1L5PA 2CJOA 4WWPA 3OG5A 4TQ0A 4WIPA 3P1MA 3NZ3A 3IAS1 1FRRA 4K81A 2XEWA 1WY8A 3PRMB 4AWJA 3AN1A 1KFYB 3EFCA 2WXHA 1V81A 2QILA 1IGCA 1YMHE 3FAHA 3A4RA 4WQOB 3R2IA 2KFKB 2B3AA 2RDGA 4E74A 1P7EA 4FHKA 2QEJC 3N1YC 2LZ6A 1QILA 4HRSA 5HI1A 4BZAA 3AU4A 3AEFB 4B0MA 1OQQA 5IO9A 4LK0M 3E56A 1WRDB 1D5ZC 2LWPA 3AE3B 5IOIA 2DYMA 2IO1B 1WE6A 3U2SC 2L83A 1WWTA 4LNNA 2ZW1A 1UUPA 3RNBC 3A1QB 3AE1B 3EGRA 2FCNA 2K9XA 3R8BA 1RRBA 4DK5A 1WGRA 1KLUD 4KDLB 1L4ZB 4NAMA 1S1QB 1QT9A 1UNSA 2IZVB 2JF5A 4WH4A 3FILA 1ZXIA 4PYZA 4JQWC 4C7ZA 2FE8A 4ANWA 5BYSA 4HPLB 2KQSA 4IW0A 2CKHB 2CU3A 1ISNA 4MGKE 3DBLB 2IY1B 3ZYYX 2IDYA 3RUIB 3C8YA 5MPOA 3GZNB 4K7SA 2KWCA 2SAKA 3VTVA 2FIFA
chains in the Genus database with same CATH topology
4GMVA 2KLCA 4EKUA 2OJRA 2MP2B 3L16A 4W9JA 4EEWA 3IVFA 3B1LX 3RT3B 1WGHA 3KYDD 1R4MI 3OLMD 2KNBA 3DDCB 3WAMA 5J18A 4AOFA 3VTWA 1Z5SB 1YD8U 5AZGA 1WXVA 4M0WB 2KD0A 1E8XA 3UQAA 5KHOA 2N4FA 4JL9A 1WE7A 3JYUA 4LDTB 2Z59B 3DVGX 3TCAA 4IG7B 3W1SA 2GBRA 4ANVA 3R7RA 2KHWB 1IP9A 3TJPA 3VUWA 2LXAA 3QIJA 5IAAC 1KOTA 4XC2A 2REXA 1Q5WB 1WR1A 4DDID 2KK8A 2LRWA 3N30A 4FULA 1V2YA 2KTRB 2V1YA 4GU2A 5CHWA 4F7ZA 2RGFA 2ZCBA 1WZ0A 1PQSA 2XK5A 2EMTA 4K1RB 4EOYA 4GOCA 3H9DA 3IFWB 2NR2A 3VTUA 2HJ8A 4BKTA 3V60A 3M62B 4WAAA 2FIDA 1V80A 4KZ0A 4MGIE 5LXHA 3HM3A 4NAWA 2JPHA 3ZNHB 2KVRA 2EKEC 3VH4B 4HCPB 3TL5A 4BKSA 3L13A 2MBBB 3PZDA 2MBOA 3KVFB 2M0XA 2O6VD 3M63B 3MHSD 4I6NB 4HK2A 3HHMA 4KSKC 4DXAB 4E3CA 2A5UA 2J0KA 4B9KA 1EO6A 2DAJA 4ANXA 4CYEA 2G4SA 2KWUB 2N9PC 2NPTA 2YLMA 2ZPNA 2BPSA 2PEAA 3ZUNA 1ZGUB 4NAWB 2M4NA 1GNUA 1YQBA 3NOBA 3NS8A 2N9XA 4G0NB 4DBGA 2JVCA 3EHVA 4LJPB 1Y8RC 1L2NA 4MDKE 3ZNID 1V49A 2HD5B 2MBQA 2BGFA 4P7IA 2KC1A 4W9HA 4W9KA 3H7PA 3A9JA 3NZUA 4KVGB 3ZLZA 2NCNA 3ONSA 1LFDA 1WI0A 2NPTB 1C3TA 3ZKJC 4BVUC 5LLIA 2CU1A 3AI5A 3TMPB 4FA6A 4GDKA 4XX5A 2MQJA 1RLFA 3V6EB 4AUQC 2PE9A 4ZRIA 1E8ZA 4MJSA 2MCNB 3VXWA 2CHXA 3A9KB 2JZ3B 2IY0B 3M3JA 3H7PB 2FAZA 3X0WA 4W9DA 4HVBA 2M17A 4AP4C 4GB9A 1NI2A 3LDZE 1X1MA 4FLHA 3T9LA 3TBLD 1XD3B 2KJRA 4AJYB 4IM2A 5E6OA 3ZNZB 3N3KB 3ZVVA 1UBIA 4GDKB 3WALA 2MX2A 1ZW7A 2FCQA 1V86A 3ZIMA 2BWES 4FBJB 1WR6E 3L17A 1WXSA 4FJYA 4WJPA 5D94A 3U30A 5L83A 3H1UA 3DBRI 3PPAA 1V6EA 1AARA 3O65B 2KZRA 1XT9B 2M1MA 1GG3A 3A33B 4MEMA 3HK0A 4I6LB 2LVPA 2DZIA 2NBUA 3VFKA 3RCZA 1WX8A 1R4NI 4ZRJA 3V61A 1WJUA 4DHZB 4ANUA 2JRIB 3L0WB 4IC7B 5DPRA 1P98A 2NBWB 3V6CB 5J17A 4W9CA 2L3ZA 1WXMA 3PHXB 2C7NB 1LM8B 3BINA 4KZCA 5JHAA 1Z2MA 2RSUA 4RMAA 2ZCCA 5C1ZA 2MLBA 2KN5A 4NNJB 3PGEA 2K1FA 4IWOA 3APDA 4GXBA 4IM3A 2GMIC 2HE7A 2KKCA 3OAWA 3QHTA 2KO3A 2ZNVC 1V5TA 2LGYA 4G11A 4YL8A 2KXJA 2L05A 5G2NA 2KX0A 4DWFA 3WAPA 1E7UA 1BT0A 1SGHA 2KDFB 2RR9A 3MJWA 4I6PA 3VVWB 2C5LC 3JW0X 4HXDA 4NJ7A 4KIKA 2ZJDA 3VH3B 2KTRA 2GBNA 3K9PB 1JRUA 3QARA 1LXDA 2GBKA 3H6NA 3RZFA 2RPQA 3HM6X 2K6DB 1E7VA 1OTRB 1TTNA 2KWVB 3B0AA 4RM9A 2LVQA 2LUEA 1EF1A 2N1VA 4GN1A 2HTHA 2MBHA 3P2BA 3JSVA 2IO0B 1RFAA 1U4AA 3AXCA 2JXXA 5E6PA 1MG8A 1M94A 4OVUA 1D3ZA 2DAFA 2N1WA 4KIKB 4MGYE 4TQ1A 4ASWC 5G55A 4WJOA 2KMAA 2BKFA 3UIOB 2MSED 4G3XB 1WJ6A 3MTNB 3VAWA 3DQVA 2D10A 1UZXB 1F9JA 3NY5A 4GIVA 2O2VB 5CTRC 3R3MA 2L00B 4W9LA 2AL6A 2AYOB 5LXIB 3JSVB 2KTFA 3UIPB 3V62A 4HDOA 1V9JA 2FCMA 4ZRKA 3UINB 4F1SA 1HE8A 1ZKHA 3W1YA 4DHJD 2ZPYA 2N7DA 4IM0A 2AEHA 4PS8A 3ZW3A 1SIFA 3R7QA 2ZZPB 4HJKA 5L95C 5D2MB 1UD7A 3PS6A 3RYTA 1WFYA 2KOXA 1GC6A 2AWTA 3DVNV 2V3SA 3EECA 1WM3A 1XQQA 3ZO5B 4J6IA 4CO7A 4II3B 3APFA 3HIZA 1SE9A 1WX7A 3K9OB 3SDLC 1WGDA 2FUHB 2KANA 1C1YB 2KJHB 1J0GA 4IUMB 4KV2A 3QAQA 2UYZB 3TIXA 5AEKB 2KFJA 4A20A 3A9KA 4PS7A 4M8NA 1I42A 1GUAB 1WX9A 2FNJB 4A3OA 3PRPB 4W9FA 4NQKE 2C60A 1LQBA 2CS4A 2LRUA 2YVCA 1UGMA 1WJNA 2KQ7A 3VDZA 2BYFA 2WYQA 4K7UA 3WAOA 4ZYNA 3JVZX 3ZTDA 2OOBB 4PS3A 4EZJA 2PPHA 4EUTA 2W9NA 3L10B 5CX3A 2KDEB 1YJ1A 2DZMA 3BY4B 4AJWA 4E71A 2L0FA 2DHZA 2N7EA 2MA9B 3AU5A 3GOEA 3IBEA 1EUVB 4JLCA 3Q3JA 4NPNA 2D11A 1I35A 1UH6A 3VUXA 2N9EB 3DVNU 4WJNA 3LJ3A 1WH3A 3OJ3A 1OEYJ 3DBLI 1WZ3A 3SD5A 4WWNA 1H4RA 1WF9A 1TGZB 2G3QB 2GOWA 2PE6B 3X23A 5EDSA 3L54A 2O6VB 3GZNI 4OVVA 2CHZA 3KUCB 3DOWA 2WX0A 5CHFA 3I3TB 1TZ1A 4MELA 2G45B 2FCSA 1E5WA 3PTFC 4W9IA 3ZDTA 4WWOA 4B6WA 1J8CA 4MGZE 4PYUA 3WA0A 3KYCD 2JUOA 2V4LA 3L08A 3QQ8B 3RULA 3OJ4B 2Z0DB 2KDIA 3UF8A 2KJ6A 2JY6A 3CSTA 3C0RB 4NQLB 1T0YA 1UBQA 2WWZA 5IA7A 2MBEA 2J7QB 4LDTD 1YIWA 1WM2A 2LJ5A 4MSQB 2RD0A 3DBSA 4BOZB 2DX5B 4URKA 1RAXA 2BYVE 3CMMB 5CHVC 1IPGA 3U8ZA 1Q1OA 3ZRFA 3VQIA 1G6JA 2KC2A 1UELA 2DZJA 1S3SG 2WX1A 3PVLA 3R66C 2G4DB 3KH0A 4RM8A 1YX5B 5DCNA 5AZHA 5D6JB 1WGGA 2D2QA 1KM7A 1E8WA 1L7YA 3PREA 2LGXA 4W9EA 1WGYA 1IYFA 3WIMA 3QA8A 2J0MA 4MH0E 2GBJA 4BOSC 2BF8B 3T8MA 1A5RA 2C7HA 2JWZA 4G50A 3QX1A 2GBMA 1P9DU 2R2OA 3PRZA 1P3QU 5HKHA 1Q0WB 4K7WA 3QCAA 3KW5B 1VD2A 4BKGA 3W1SC 2O2VA 4NY0A 4KSLC 5FR6A 1P1AA 1OEYA 3NHEB 1YX6B 2ZVNA 1WJ4A 3DBHI 1P0RA 2R2QA 5DPTA 1KJTA 2IO3B 3M95A 1QZEA 4GGQA 5TR5A 2M8SA 2MWSB 3DCGA 3NZSA 3ENEA 5DPSA 2IYDB 4GDLB 2CR5A 4WJQA 4BKSD 3ZNGC 2LVOA 4BBNF 3PSEB 3PLVA 1TBEA 4A3PA 4EZLA 2J0JA 4TV3A 1WYWB 3KUZA 2MRPA 4N9F4 2Y5BB 2ZNVB 4W9GA 1E90A 3IHPC 3PHWB 2DYBA 4KDIC 4MSMB 4JIOU 2K8HA 4FHJA 3UGBB 3ML8A 4NJ6A 4BBNC 2LASA 5BO4B 1GJZA 4IWPA 3ML9A 1WMHA 4HDQA 1KLVA 1WXAA 1OGWA 2KMCA 3CF6E 4ICUA 4WWPA 5JHBA 2BKRB 2NBVB 2KFKA 4TQ0A 1CMXB 2ASQA 2C9WB 4GSWA 4MM3A 3UQBA 3ZTCA 5KHQA 4K81A 2XEWA 3ALBA 4HCNB 1WY8A 3PRMB 4AWJA 1EF5A 4EFOA 3U7DA 2K25A 5E6NA 1V81A 3ZDMC 3RD2A 2L8JA 4CHKA 3VHTC 2ZVOA 1WMHB 4BFRA 2DENB 3A4RA 4TUUA 4WQOB 1H8CA 3KUDB 4B95A 2LI5A 2KFKB 2B3AA 1VCBA 4E74A 2XK5B 2IO2B 2WDTB 4FHKA 2LXCA 2BWFA 2LZ6A 1NDDA 4X57B 2I1JA 4FJVB 3QWZB 2QHOA 3AU4A 2L7RA 3AULA 3RZWC 4ZDVA 4EZKA 2KLGA 2XBBC 3ECIA 2KDBA 3EFUA 2O6VA 4F8CB 1WRDB 2LWPA 3QJZA 4II2B 2NVUI 2CHWA 2DYMA 1OQYA 2DYOA 2IO1B 1NBFC 1WE6A 3B08A 3A1QA 3EC8A 3PV1A 4LJOB 2VRRB 2AL3A 4FJZA 2BYEA 4M8MA 2D3GA 2UWQA 4DHJB 3SHQA 3DVGY 4HPMB 3H7SA 2NS5A 3N32A 2I1KA 4XZ4A 3PT2B 3QC8B 3PLUA 3IG3A 3A1QB 3A9JB 2LGDA 4ICVA 2FCNA 3WANA 5J2RA 2EMSA 1RRBA 4DK5A 3D32A 2K8CA 5AZFA 4JGHB 1WGRA 2JT4B 1FXTB 4KDLB 3QK0A 2JZZA 5GMVA 2KX3A 1S1QB 2D07B 4MJSB 2IZVB 2JF5A 3DPDA 4HWIB 3S2AA 5JH5C 5DPWA 4DDGD 2MW5A 4PYZA 3SU8X 2LD9A 2L0TA 4FN2A 4JQWC 3CSFA 2JRHA 4ANWA 4DHZE 3VUYA 2C7MB 3APCA 5C23A 4HPLB 3A4SC 2KQSA 2K8BA 4IW0A 2CKHB 2ZEQA 4IWQA 2MP2A 1GC7A 2A4ZA 1V5OA 2Z0EB 1ISNA 2L76A 4MGKE 1WIAA 5JZEB 2IY1B 1K8RB 4GDLA 4HLEA 3RUIB 2DZKA 3Q3FA 4TKNA 2K6QA 4K7SA 2IBIB 2KWCA 1J19A 2K39A 3VTVA 3ZRCA 4FADA 5D7GA 4LCDE 2FIFA 1E8YA 2PJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMV A;  2KLC A;  4EKU A;  2OJR A;  2MP2 B;  3L16 A;  4W9J A;  4EEW A;  3IVF A;  3B1L X;  3RT3 B;  1WGH A;  3KYD D;  1R4M I;  3OLM D;  2KNB A;  3DDC B;  3WAM A;  5J18 A;  4AOF A;  3VTW A;  1Z5S B;  1YD8 U;  5AZG A;  1WXV A;  4M0W B;  2KD0 A;  1E8X A;  3UQA A;  5KHO A;  2N4F A;  4JL9 A;  1WE7 A;  3JYU A;  4LDT B;  2Z59 B;  3DVG X;  3TCA A;  4IG7 B;  3W1S A;  2GBR A;  4ANV A;  3R7R A;  2KHW B;  1IP9 A;  3TJP A;  3VUW A;  2LXA A;  3QIJ A;  5IAA C;  1KOT A;  4XC2 A;  2REX A;  1Q5W B;  1WR1 A;  4DDI D;  2KK8 A;  2LRW A;  3N30 A;  4FUL A;  1V2Y A;  2KTR B;  2V1Y A;  4GU2 A;  5CHW A;  4F7Z A;  2RGF A;  2ZCB A;  1WZ0 A;  1PQS A;  2XK5 A;  2EMT A;  4K1R B;  4EOY A;  4GOC A;  3H9D A;  3IFW B;  2NR2 A;  3VTU A;  2HJ8 A;  4BKT A;  3V60 A;  3M62 B;  4WAA A;  2FID A;  1V80 A;  4KZ0 A;  4MGI E;  5LXH A;  3HM3 A;  4NAW A;  2JPH A;  3ZNH B;  2KVR A;  2EKE C;  3VH4 B;  4HCP B;  3TL5 A;  4BKS A;  3L13 A;  2MBB B;  3PZD A;  2MBO A;  3KVF B;  2M0X A;  2O6V D;  3M63 B;  3MHS D;  4I6N B;  4HK2 A;  3HHM A;  4KSK C;  4DXA B;  4E3C A;  2A5U A;  2J0K A;  4B9K A;  1EO6 A;  2DAJ A;  4ANX A;  4CYE A;  2G4S A;  2KWU B;  2N9P C;  2NPT A;  2YLM A;  2ZPN A;  2BPS A;  2PEA A;  3ZUN A;  1ZGU B;  4NAW B;  2M4N A;  1GNU A;  1YQB A;  3NOB A;  3NS8 A;  2N9X A;  4G0N B;  4DBG A;  2JVC A;  3EHV A;  4LJP B;  1Y8R C;  1L2N A;  4MDK E;  3ZNI D;  1V49 A;  2HD5 B;  2MBQ A;  2BGF A;  4P7I A;  2KC1 A;  4W9H A;  4W9K A;  3H7P A;  3A9J A;  3NZU A;  4KVG B;  3ZLZ A;  2NCN A;  3ONS A;  1LFD A;  1WI0 A;  2NPT B;  1C3T A;  3ZKJ C;  4BVU C;  5LLI A;  2CU1 A;  3AI5 A;  3TMP B;  4FA6 A;  4GDK A;  4XX5 A;  2MQJ A;  1RLF A;  3V6E B;  4AUQ C;  2PE9 A;  4ZRI A;  1E8Z A;  4MJS A;  2MCN B;  3VXW A;  2CHX A;  3A9K B;  2JZ3 B;  2IY0 B;  3M3J A;  3H7P B;  2FAZ A;  3X0W A;  4W9D A;  4HVB A;  2M17 A;  4AP4 C;  4GB9 A;  1NI2 A;  3LDZ E;  1X1M A;  4FLH A;  3T9L A;  3TBL D;  1XD3 B;  2KJR A;  4AJY B;  4IM2 A;  5E6O A;  3ZNZ B;  3N3K B;  3ZVV A;  1UBI A;  4GDK B;  3WAL A;  2MX2 A;  1ZW7 A;  2FCQ A;  1V86 A;  3ZIM A;  2BWE S;  4FBJ B;  1WR6 E;  3L17 A;  1WXS A;  4FJY A;  4WJP A;  5D94 A;  3U30 A;  5L83 A;  3H1U A;  3DBR I;  3PPA A;  1V6E A;  1AAR A;  3O65 B;  2KZR A;  1XT9 B;  2M1M A;  1GG3 A;  3A33 B;  4MEM A;  3HK0 A;  4I6L B;  2LVP A;  2DZI A;  2NBU A;  3VFK A;  3RCZ A;  1WX8 A;  1R4N I;  4ZRJ A;  3V61 A;  1WJU A;  4DHZ B;  4ANU A;  2JRI B;  3L0W B;  4IC7 B;  5DPR A;  1P98 A;  2NBW B;  3V6C B;  5J17 A;  4W9C A;  2L3Z A;  1WXM A;  3PHX B;  2C7N B;  1LM8 B;  3BIN A;  4KZC A;  5JHA A;  1Z2M A;  2RSU A;  4RMA A;  2ZCC A;  5C1Z A;  2MLB A;  2KN5 A;  4NNJ B;  3PGE A;  2K1F A;  4IWO A;  3APD A;  4GXB A;  4IM3 A;  2GMI C;  2HE7 A;  2KKC A;  3OAW A;  3QHT A;  2KO3 A;  2ZNV C;  1V5T A;  2LGY A;  4G11 A;  4YL8 A;  2KXJ A;  2L05 A;  5G2N A;  2KX0 A;  4DWF A;  3WAP A;  1E7U A;  1BT0 A;  1SGH A;  2KDF B;  2RR9 A;  3MJW A;  4I6P A;  3VVW B;  2C5L C;  3JW0 X;  4HXD A;  4NJ7 A;  4KIK A;  2ZJD A;  3VH3 B;  2KTR A;  2GBN A;  3K9P B;  1JRU A;  3QAR A;  1LXD A;  2GBK A;  3H6N A;  3RZF A;  2RPQ A;  3HM6 X;  2K6D B;  1E7V A;  1OTR B;  1TTN A;  2KWV B;  3B0A A;  4RM9 A;  2LVQ A;  2LUE A;  1EF1 A;  2N1V A;  4GN1 A;  2HTH A;  2MBH A;  3P2B A;  3JSV A;  2IO0 B;  1RFA A;  1U4A A;  3AXC A;  2JXX A;  5E6P A;  1MG8 A;  1M94 A;  4OVU A;  1D3Z A;  2DAF A;  2N1W A;  4KIK B;  4MGY E;  4TQ1 A;  4ASW C;  5G55 A;  4WJO A;  2KMA A;  2BKF A;  3UIO B;  2MSE D;  4G3X B;  1WJ6 A;  3MTN B;  3VAW A;  3DQV A;  2D10 A;  1UZX B;  1F9J A;  3NY5 A;  4GIV A;  2O2V B;  5CTR C;  3R3M A;  2L00 B;  4W9L A;  2AL6 A;  2AYO B;  5LXI B;  3JSV B;  2KTF A;  3UIP B;  3V62 A;  4HDO A;  1V9J A;  2FCM A;  4ZRK A;  3UIN B;  4F1S A;  1HE8 A;  1ZKH A;  3W1Y A;  4DHJ D;  2ZPY A;  2N7D A;  4IM0 A;  2AEH A;  4PS8 A;  3ZW3 A;  1SIF A;  3R7Q A;  2ZZP B;  4HJK A;  5L95 C;  5D2M B;  1UD7 A;  3PS6 A;  3RYT A;  1WFY A;  2KOX A;  1GC6 A;  2AWT A;  3DVN V;  2V3S A;  3EEC A;  1WM3 A;  1XQQ A;  3ZO5 B;  4J6I A;  4CO7 A;  4II3 B;  3APF A;  3HIZ A;  1SE9 A;  1WX7 A;  3K9O B;  3SDL C;  1WGD A;  2FUH B;  2KAN A;  1C1Y B;  2KJH B;  1J0G A;  4IUM B;  4KV2 A;  3QAQ A;  2UYZ B;  3TIX A;  5AEK B;  2KFJ A;  4A20 A;  3A9K A;  4PS7 A;  4M8N A;  1I42 A;  1GUA B;  1WX9 A;  2FNJ B;  4A3O A;  3PRP B;  4W9F A;  4NQK E;  2C60 A;  1LQB A;  2CS4 A;  2LRU A;  2YVC A;  1UGM A;  1WJN A;  2KQ7 A;  3VDZ A;  2BYF A;  2WYQ A;  4K7U A;  3WAO A;  4ZYN A;  3JVZ X;  3ZTD A;  2OOB B;  4PS3 A;  4EZJ A;  2PPH A;  4EUT A;  2W9N A;  3L10 B;  5CX3 A;  2KDE B;  1YJ1 A;  2DZM A;  3BY4 B;  4AJW A;  4E71 A;  2L0F A;  2DHZ A;  2N7E A;  2MA9 B;  3AU5 A;  3GOE A;  3IBE A;  1EUV B;  4JLC A;  3Q3J A;  4NPN A;  2D11 A;  1I35 A;  1UH6 A;  3VUX A;  2N9E B;  3DVN U;  4WJN A;  3LJ3 A;  1WH3 A;  3OJ3 A;  1OEY J;  3DBL I;  1WZ3 A;  3SD5 A;  4WWN A;  1H4R A;  1WF9 A;  1TGZ B;  2G3Q B;  2GOW A;  2PE6 B;  3X23 A;  5EDS A;  3L54 A;  2O6V B;  3GZN I;  4OVV A;  2CHZ A;  3KUC B;  3DOW A;  2WX0 A;  5CHF A;  3I3T B;  1TZ1 A;  4MEL A;  2G45 B;  2FCS A;  1E5W A;  3PTF C;  4W9I A;  3ZDT A;  4WWO A;  4B6W A;  1J8C A;  4MGZ E;  4PYU A;  3WA0 A;  3KYC D;  2JUO A;  2V4L A;  3L08 A;  3QQ8 B;  3RUL A;  3OJ4 B;  2Z0D B;  2KDI A;  3UF8 A;  2KJ6 A;  2JY6 A;  3CST A;  3C0R B;  4NQL B;  1T0Y A;  1UBQ A;  2WWZ A;  5IA7 A;  2MBE A;  2J7Q B;  4LDT D;  1YIW A;  1WM2 A;  2LJ5 A;  4MSQ B;  2RD0 A;  3DBS A;  4BOZ B;  2DX5 B;  4URK A;  1RAX A;  2BYV E;  3CMM B;  5CHV C;  1IPG A;  3U8Z A;  1Q1O A;  3ZRF A;  3VQI A;  1G6J A;  2KC2 A;  1UEL A;  2DZJ A;  1S3S G;  2WX1 A;  3PVL A;  3R66 C;  2G4D B;  3KH0 A;  4RM8 A;  1YX5 B;  5DCN A;  5AZH A;  5D6J B;  1WGG A;  2D2Q A;  1KM7 A;  1E8W A;  1L7Y A;  3PRE A;  2LGX A;  4W9E A;  1WGY A;  1IYF A;  3WIM A;  3QA8 A;  2J0M A;  4MH0 E;  2GBJ A;  4BOS C;  2BF8 B;  3T8M A;  1A5R A;  2C7H A;  2JWZ A;  4G50 A;  3QX1 A;  2GBM A;  1P9D U;  2R2O A;  3PRZ A;  1P3Q U;  5HKH A;  1Q0W B;  4K7W A;  3QCA A;  3KW5 B;  1VD2 A;  4BKG A;  3W1S C;  2O2V A;  4NY0 A;  4KSL C;  5FR6 A;  1P1A A;  1OEY A;  3NHE B;  1YX6 B;  2ZVN A;  1WJ4 A;  3DBH I;  1P0R A;  2R2Q A;  5DPT A;  1KJT A;  2IO3 B;  3M95 A;  1QZE A;  4GGQ A;  5TR5 A;  2M8S A;  2MWS B;  3DCG A;  3NZS A;  3ENE A;  5DPS A;  2IYD B;  4GDL B;  2CR5 A;  4WJQ A;  4BKS D;  3ZNG C;  2LVO A;  4BBN F;  3PSE B;  3PLV A;  1TBE A;  4A3P A;  4EZL A;  2J0J A;  4TV3 A;  1WYW B;  3KUZ A;  2MRP A;  4N9F 4;  2Y5B B;  2ZNV B;  4W9G A;  1E90 A;  3IHP C;  3PHW B;  2DYB A;  4KDI C;  4MSM B;  4JIO U;  2K8H A;  4FHJ A;  3UGB B;  3ML8 A;  4NJ6 A;  4BBN C;  2LAS A;  5BO4 B;  1GJZ A;  4IWP A;  3ML9 A;  1WMH A;  4HDQ A;  1KLV A;  1WXA A;  1OGW A;  2KMC A;  3CF6 E;  4ICU A;  4WWP A;  5JHB A;  2BKR B;  2NBV B;  2KFK A;  4TQ0 A;  1CMX B;  2ASQ A;  2C9W B;  4GSW A;  4MM3 A;  3UQB A;  3ZTC A;  5KHQ A;  4K81 A;  2XEW A;  3ALB A;  4HCN B;  1WY8 A;  3PRM B;  4AWJ A;  1EF5 A;  4EFO A;  3U7D A;  2K25 A;  5E6N A;  1V81 A;  3ZDM C;  3RD2 A;  2L8J A;  4CHK A;  3VHT C;  2ZVO A;  1WMH B;  4BFR A;  2DEN B;  3A4R A;  4TUU A;  4WQO B;  1H8C A;  3KUD B;  4B95 A;  2LI5 A;  2KFK B;  2B3A A;  1VCB A;  4E74 A;  2XK5 B;  2IO2 B;  2WDT B;  4FHK A;  2LXC A;  2BWF A;  2LZ6 A;  1NDD A;  4X57 B;  2I1J A;  4FJV B;  3QWZ B;  2QHO A;  3AU4 A;  2L7R A;  3AUL A;  3RZW C;  4ZDV A;  4EZK A;  2KLG A;  2XBB C;  3ECI A;  2KDB A;  3EFU A;  2O6V A;  4F8C B;  1WRD B;  2LWP A;  3QJZ A;  4II2 B;  2NVU I;  2CHW A;  2DYM A;  1OQY A;  2DYO A;  2IO1 B;  1NBF C;  1WE6 A;  3B08 A;  3A1Q A;  3EC8 A;  3PV1 A;  4LJO B;  2VRR B;  2AL3 A;  4FJZ A;  2BYE A;  4M8M A;  2D3G A;  2UWQ A;  4DHJ B;  3SHQ A;  3DVG Y;  4HPM B;  3H7S A;  2NS5 A;  3N32 A;  2I1K A;  4XZ4 A;  3PT2 B;  3QC8 B;  3PLU A;  3IG3 A;  3A1Q B;  3A9J B;  2LGD A;  4ICV A;  2FCN A;  3WAN A;  5J2R A;  2EMS A;  1RRB A;  4DK5 A;  3D32 A;  2K8C A;  5AZF A;  4JGH B;  1WGR A;  2JT4 B;  1FXT B;  4KDL B;  3QK0 A;  2JZZ A;  5GMV A;  2KX3 A;  1S1Q B;  2D07 B;  4MJS B;  2IZV B;  2JF5 A;  3DPD A;  4HWI B;  3S2A A;  5JH5 C;  5DPW A;  4DDG D;  2MW5 A;  4PYZ A;  3SU8 X;  2LD9 A;  2L0T A;  4FN2 A;  4JQW C;  3CSF A;  2JRH A;  4ANW A;  4DHZ E;  3VUY A;  2C7M B;  3APC A;  5C23 A;  4HPL B;  3A4S C;  2KQS A;  2K8B A;  4IW0 A;  2CKH B;  2ZEQ A;  4IWQ A;  2MP2 A;  1GC7 A;  2A4Z A;  1V5O A;  2Z0E B;  1ISN A;  2L76 A;  4MGK E;  1WIA A;  5JZE B;  2IY1 B;  1K8R B;  4GDL A;  4HLE A;  3RUI B;  2DZK A;  3Q3F A;  4TKN A;  2K6Q A;  4K7S A;  2IBI B;  2KWC A;  1J19 A;  2K39 A;  3VTV A;  3ZRC A;  4FAD A;  5D7G A;  4LCD E;  2FIF A;  1E8Y A;  2PJH A; 
#chains in the Genus database with same CATH topology
 4LNF A;  2KMM A;  4W9J A;  4EEW A;  3IVF A;  3B1L X;  1EWC A;  3KYD D;  3WAM A;  2WXO A;  1VZ8 A;  5J18 A;  3VTW A;  2MHJ A;  1F77 A;  3BK1 A;  1RFK A;  2N4F A;  1UGJ A;  2W3S A;  1WE7 A;  3JYU A;  2XN9 C;  2BB5 A;  4C80 A;  2BB6 A;  2GBR A;  2KHW B;  1MVK A;  3EA6 A;  2LXA A;  5IAA C;  4XC2 A;  2REX A;  1Q5W B;  2M19 A;  2WXP A;  5AUK A;  4F7Z A;  2INN E;  1WZ0 A;  2J4X A;  2TSS A;  3RN9 C;  1AN8 A;  3AE7 B;  1JRO A;  3H9D A;  1FXA A;  2PIA A;  4AS1 A;  2HJ8 A;  3M62 B;  1FIQ A;  5IN7 A;  3Q8C A;  3VH4 B;  4HCP B;  3V3X A;  4BKS A;  1FMA D;  2Y5C A;  3PZD A;  3MHS D;  4A9A A;  3HHM A;  2A5U A;  1R4M B;  2DAJ A;  2QIE B;  4ANX A;  4CYE A;  2KWU B;  2NPT A;  2YLM A;  2YEP B;  2BPS A;  1SF0 A;  3NS8 A;  3ZNI D;  1XCT L;  2HD5 B;  2BGF A;  4YTN B;  1KTK A;  4KVG B;  3SR6 A;  1KH0 A;  2I38 A;  1WI0 A;  2KYW A;  5LLI A;  2CU1 A;  4FA6 A;  2N9L A;  2RMM A;  4UDU C;  1CQV A;  3V6E B;  4L23 A;  4MJS A;  4ARC A;  2B76 B;  2E3T A;  4ZYS A;  2FAZ A;  3X0W A;  4W9D A;  4HVB A;  2M17 A;  4AP4 C;  1XO3 A;  3MC8 A;  4S17 A;  4XDC A;  2FCQ A;  3ZIM A;  5L83 A;  4WJP A;  3H1U A;  1V6E A;  4IOI E;  4MEM A;  3U4E G;  3HK0 A;  1HA5 A;  1FPY A;  1SJH D;  4ZRJ A;  1L6V A;  4ANU A;  4C00 A;  3U52 E;  3IT6 B;  2C7N B;  4RMA A;  5C1Z A;  4TMA B;  1KRH A;  1TIF A;  1P7F A;  4ACF A;  1HTQ A;  4LNO A;  3AMZ A;  3NG0 A;  2ZNV C;  4G11 A;  4LLG M;  2KXJ A;  2L05 A;  1SGH A;  1BT0 A;  3MJW A;  4I6P A;  5D3D A;  2GBN A;  1M4V A;  2GBK A;  1WXQ A;  2LFI A;  3TEX A;  2LUE A;  2M0A A;  3URY A;  3JSV A;  1U4A A;  3AE8 B;  1MG8 A;  1M94 A;  4OVU A;  4KIK B;  4MGY E;  4ASW C;  3LYY A;  2GI9 A;  1J7C A;  4NZL B;  1QOA A;  3AE4 B;  1UZX B;  1F9J A;  5CTR C;  1QLB B;  2KTF A;  1XEE A;  2Q5W D;  3UIN B;  1HE8 A;  1ZKH A;  4DHJ D;  3O13 A;  2AEH A;  4PS8 A;  3R7Q A;  1J7B A;  1UD7 A;  3PS6 A;  3P4S B;  3RYT A;  2AWT A;  3DVN V;  3EEC A;  1SEB D;  1YOV B;  4J6I A;  4II3 B;  3RMK C;  4ZRP A;  3K9O B;  1PYW D;  4MAC A;  3QAQ A;  2UYZ B;  4M8N A;  1JCK B;  1WX9 A;  1QKZ A;  4W9F A;  5C3J B;  2LRU A;  1WJN A;  2JXT A;  2WYQ A;  4K7U A;  1TY2 A;  4A8X C;  2UU7 A;  4BAX A;  4PS3 A;  5I4D A;  2PPH A;  3L10 B;  3ZXR A;  1LGR A;  2L0F A;  4JLC A;  2N7E A;  4NPN A;  3UQA A;  4P6V F;  3I63 C;  1UH6 A;  2N9E B;  3DVN U;  3LJ3 A;  3DBL I;  1WZ3 A;  3SD5 A;  3P63 A;  4WWN A;  1WF9 A;  1TGZ B;  4QAY A;  3GZN I;  1SE3 A;  3KUC B;  2VZK D;  3ZGZ A;  3I3T B;  1TZ1 A;  2G45 B;  2FCS A;  3PTF C;  3ZDT A;  4WWO A;  2JUO A;  2V4L A;  3QQ8 B;  3RUL A;  2KDI A;  3CST A;  1V1P A;  1T0Q C;  1T0Y A;  1D5X C;  1F0Z A;  1V8C A;  4RGT A;  5EE0 A;  4LDT D;  2DX5 B;  3AE9 B;  4RGO S;  3VQI A;  2V3P A;  4HEA 1;  1A70 A;  1Q10 A;  1F2R I;  1YX5 B;  5H8Y E;  5AZH A;  2NMQ A;  1KF6 B;  2H89 B;  1KM7 A;  1D5M C;  1L7Y A;  3N20 C;  1B1Z A;  1DGJ A;  1MI0 A;  2GBJ A;  2JQR B;  3T8M A;  4G50 A;  3QX1 A;  1P3Q U;  5HKH A;  1Q0W B;  4K7W A;  4BKG A;  1GB1 A;  5FR6 A;  1P1A A;  1OEY A;  4JX1 C;  3NHE B;  1YX6 B;  2AQ2 B;  2ZVN A;  1I7H A;  1WJ4 A;  2LHE A;  1JWA D;  5TR5 A;  2MJ3 A;  4BKS D;  2KVZ A;  2LUM A;  1TBE A;  4A3P A;  4EZL A;  4TV3 A;  4HKQ A;  3KUZ A;  4RFB A;  2MRP A;  3BVM A;  4W9G A;  4KDI C;  3NS1 A;  4JIO U;  3C19 A;  3DHG C;  3UGB B;  3GS2 A;  4BBN C;  2LAS A;  5BO4 B;  3AEC B;  2X8X X;  1OGW A;  3NRZ A;  2KMC A;  2WXL A;  2K22 A;  2KFK A;  1CMX B;  1QOG A;  2ASQ A;  4GSW A;  4OZA A;  2GRI A;  4YT0 B;  2W54 A;  1NEK B;  1EF5 A;  5E6N A;  1XLO A;  3RD2 A;  2ZVO A;  1WMH B;  2PLP A;  2V4I B;  1VCB A;  1ZDV A;  5FKA C;  1FFV A;  1NDD A;  4FJV B;  2L7R A;  3AUL A;  1GB4 A;  3ECI A;  2JU6 X;  3QJZ A;  4II2 B;  3H8H A;  1OQY A;  2PMV A;  1NBF C;  4LJO B;  3A1Q A;  1YJJ A;  1VR9 A;  4FJZ A;  1ET9 A;  1HEZ E;  3IT4 B;  2KT7 A;  2Y5P A;  1UWM A;  4NJC A;  2AQ1 B;  3VRB B;  1EWY C;  2OED A;  4C7Y A;  3QC8 B;  1ZDX A;  3A9J B;  4JWS C;  2LGD A;  1J7A A;  4YSZ B;  3WAN A;  5J2R A;  1E9M A;  2K8C A;  4JGH B;  2JT4 B;  4ZRQ A;  2E6X A;  2WXM A;  2IND C;  1JQ4 A;  2QCZ A;  1VRA B;  4HWI B;  3S2A A;  5DPW A;  1JAL A;  4TSS A;  1XCQ L;  3AH7 A;  2LD9 A;  2L0T A;  3CSF A;  2C7M B;  3HUI A;  2ZEQ A;  4JPS A;  5HG2 A;  2Z0E B;  2L76 A;  5EE9 A;  1WIA A;  1JWU D;  1L0X B;  3AV8 A;  4KGR A;  4HLE A;  1AWD A;  2K39 A;  4LNI A;  3ZRC A;  5D7G A;  4WWM A;  2PJH A;  4EKU A;  2KLC A;  2MP2 B;  1WGH A;  2W3R A;  2KNB A;  1E7P B;  1I4R A;  1PGB A;  1N61 A;  1NI3 A;  4M0W B;  5KHO A;  4JL9 A;  2WLB A;  1EM7 A;  2Z59 B;  3LXF A;  4IG7 B;  2WDQ B;  1IP9 A;  1WR1 A;  2KK8 A;  2LRW A;  2V1Y A;  5CHW A;  2RGF A;  3TSS A;  3Q69 A;  2BW2 A;  2XK5 A;  2Y3A A;  4K1R B;  2GLS A;  1R7S A;  5FR3 A;  4KZ0 A;  4MGI E;  2JPH A;  3ZNH B;  3GE8 C;  3TL5 A;  3ZNZ B;  2MBO A;  3M63 B;  2O6V D;  4KSK C;  4I6N B;  4PS7 A;  4HK2 A;  4E3C A;  4B9K A;  4H2A A;  1EO6 A;  2WXG A;  2G4S A;  4YTP B;  2PEA A;  2BS3 B;  2M4N A;  2N9X A;  4G0N B;  4DBG A;  4LJP B;  1TT5 B;  2MBQ A;  3AE6 B;  3EUB 2;  3ONS A;  1LFD A;  1YN5 A;  1C3T A;  1HXY D;  1RM6 C;  4AUQ C;  4ZRI A;  4RNA A;  2MCN B;  2JZ3 B;  1XLN A;  3H7P B;  3RI7 C;  4GB9 A;  3LDZ E;  4Q2J A;  1X1M A;  4AJY B;  1DOY A;  4IM2 A;  3SFD B;  1K52 A;  2WXN A;  1ENF A;  1ZW7 A;  3AM9 A;  3AB5 A;  1C4C A;  2BWE S;  3L17 A;  3Q8E A;  5D94 A;  2D5G A;  1AAR A;  2BT6 A;  3O65 B;  1XT9 B;  1GG3 A;  3IXS A;  2NBU A;  1XLP A;  1WX8 A;  3Q2A C;  4DHZ B;  4OVZ A;  3L0W B;  4IC7 B;  5DPR A;  2NBW B;  3V6C B;  5J17 A;  3MC9 A;  4W9C A;  3SFE B;  1WXM A;  4JWU C;  1LM8 B;  4C56 C;  5JHA A;  1Z2M A;  3W5U B;  1DOI A;  3TUO A;  1FNU A;  4IM3 A;  2GMI C;  4YSY B;  3OAW A;  2VH2 A;  4YL8 A;  1QQR A;  1ACC A;  4HJG E;  1E7U A;  2KDF B;  2RDB C;  2ZW0 A;  4KIK A;  2ZJD A;  3VH3 B;  2KTR A;  2K5P A;  2LHD A;  3IAM 1;  3B0A A;  4RM9 A;  1EF1 A;  3Q8A A;  1N6Z A;  3E9S A;  3P2B A;  1QF6 A;  3AXC A;  2JXX A;  3PZ8 A;  4REZ A;  2N1W A;  4TQ1 A;  5G55 A;  3GP7 A;  4WJO A;  2BKF A;  4G3X B;  4GIV A;  2AL6 A;  2AYO B;  3V62 A;  3UIP B;  4HDO A;  1K53 A;  1V9J A;  2V3N A;  1HTO A;  4F1S A;  2KDM A;  4AQ7 A;  2ZPY A;  2N7D A;  4IM0 A;  2G1E A;  3ZW3 A;  1SIF A;  5D2M B;  1VJK A;  1WFY A;  1DOX A;  1GC6 A;  3HIZ A;  4CQN A;  3AEB B;  1SE9 A;  5HHD G;  1WGD A;  2FUH B;  2KAN A;  3Q3O C;  4EE2 A;  2WQY B;  1N60 A;  1C1Y B;  2KJH B;  1VZ6 A;  4KKI A;  4KV2 A;  4WAF A;  4IDI A;  2LGS A;  3A9K A;  4C4V B;  1GUA B;  2FNJ B;  4NQK E;  1LQB A;  1IBX A;  4KGS A;  3DHI C;  3ZTD A;  3WCQ A;  1B9R A;  4L1B A;  2W9N A;  2KDE B;  3BY4 B;  2HJ1 A;  1VZ7 A;  2DHZ A;  2MA9 B;  3AU5 A;  3GOE A;  3MP9 A;  2D11 A;  3VUX A;  1WH3 A;  3OJ3 A;  1OEY J;  2W55 A;  3KLS X;  2PE6 B;  2G3Q B;  5EDS A;  3L54 A;  1TZO A;  2N7J A;  4OVV A;  2CHZ A;  2D3B A;  4YWG G;  4MEL A;  1E5W A;  1J8C A;  4MGZ E;  4PYU A;  3KYC D;  4N6E B;  3C0R B;  5IA7 A;  1KLG D;  5BYQ A;  1WM2 A;  4MSQ B;  1TS4 A;  1N5X A;  1RAX A;  3CMM B;  5CHV C;  1C76 A;  3U8Z A;  1Q1O A;  2DZJ A;  2WX1 A;  3R66 C;  3KH0 A;  4RM8 A;  5DCN A;  5D6J B;  3ABV B;  4KKJ A;  1E8W A;  2LGX A;  4BOS C;  4S0R A;  2QC8 A;  5EE3 A;  3RPF C;  2C7H A;  2GBM A;  2WU2 B;  3QCA A;  3KW5 B;  3Q6B A;  2O2V A;  3BVG A;  1ET6 A;  1AYF A;  3AE5 B;  4ZHO A;  2JZP A;  1KJT A;  3M95 A;  1L4D B;  1D6E C;  2MWS B;  3NZS A;  3ENE A;  2W82 A;  4WJQ A;  2WHI A;  4KGT A;  1FNV A;  3PLV A;  1BUI C;  1FEH A;  2KWD A;  4PK1 A;  1WYW B;  2XNA C;  4N9F 4;  4O1N A;  2Y5B B;  1YQ4 B;  1E90 A;  3PHW B;  2K8H A;  1GJZ A;  1TJE A;  3CWI A;  3HVZ A;  1WMH A;  1KLV A;  2EEL A;  3CF6 E;  2BKR B;  2NBV B;  2C9W B;  4MM3 A;  4FXC A;  4K3C A;  1XXG A;  1TYG B;  1FO4 A;  4EFO A;  1FCC C;  2K25 A;  4A55 A;  1E0Z A;  3ZDM C;  3W9C B;  2AQ3 B;  3VHT C;  4BFR A;  2J42 A;  4TUU A;  4B95 A;  2DNF A;  4ZOH C;  5D3I B;  1HZ6 A;  2LXC A;  1SE4 A;  2I1J A;  3QWZ B;  2QHO A;  4IKG A;  2X38 A;  3RZW C;  2KN4 A;  4YTM B;  3I57 A;  2KDB A;  3EFU A;  2O6V A;  4F8C B;  1JRP A;  1LO5 D;  2BTE A;  4XWW A;  2QDF A;  3HVD A;  1C78 A;  2NVU I;  2DYO A;  3EC8 A;  3B08 A;  3PV1 A;  3AEE B;  2WDR B;  3NVY A;  2VRR B;  1XLQ A;  3KWV A;  2UWQ A;  4LNK A;  3H7S A;  2NS5 A;  2BS2 B;  1DYQ A;  4XZ4 A;  1C77 A;  3PT2 B;  3IG3 A;  2L1A A;  2EMS A;  1I4X A;  3QK0 A;  2BBC A;  2JZZ A;  3B9J A;  5GMV A;  5LNK 1;  4RH6 A;  2KX3 A;  5IKC M;  4MJS B;  1AW7 A;  3DPD A;  3TEZ A;  4FN2 A;  2BYT A;  2JRH A;  1NYR A;  3APC A;  4OZC A;  5C23 A;  4IWQ A;  2MP2 A;  1GC7 A;  3Q3N C;  2A4Z A;  1V5O A;  1MJD A;  5JZE B;  1K8R B;  4GDL A;  4P1B C;  4WQM A;  3SEB A;  4ARI A;  2HDE A;  2D3A A;  2DZK A;  4M0W A;  2K6Q A;  3T3N A;  2IBI B;  1J19 A;  1ZP0 B;  4FAD A;  4GMV A;  1N62 A;  3NVZ A;  2YEP F;  1D3Z A;  3RT3 B;  1R4M I;  3DDC B;  4AOF A;  1YD8 U;  1C79 A;  1E8X A;  1VDV A;  1EU3 A;  3DVG X;  4ANV A;  3R7R A;  1HQR D;  3TJP A;  1KOT A;  3N30 A;  4FUL A;  4GU2 A;  2ZCB A;  1GPX A;  4P1C C;  3IFW B;  2NR2 A;  3VTU A;  4BKT A;  1FCL A;  4WAA A;  1V80 A;  5LXH A;  1PGA A;  1C9F A;  4D2K A;  3L13 A;  4RGM A;  3KVF B;  2M0X A;  2ZPN A;  3ZUN A;  1ZGU B;  4NAW B;  1YQB A;  1ESF A;  2LJI A;  2JVC A;  3EHV A;  2ICI A;  1L2N A;  3MJ5 A;  4P7I A;  2KC1 A;  4XWT A;  4W9K A;  3H7P A;  2NCN A;  2WXI A;  3ZKJ C;  4BVU C;  3AI5 A;  1CZP A;  2MEK A;  1RLF A;  4OHJ A;  1ZOY B;  2PE9 A;  3T3O A;  1E8Z A;  3VXW A;  2CHX A;  2IY0 B;  2JSV X;  3T9L A;  1XD3 B;  3ZVV A;  1UBI A;  4GDK B;  3WAL A;  3VR8 B;  1V86 A;  1SBB B;  4OW0 A;  4FBJ B;  2PKO A;  2QSD A;  2WGS A;  2DZI A;  4A90 A;  2MJD A;  3VR9 B;  1T0R C;  1RWS A;  5H92 C;  1P98 A;  2L3Z A;  3ETR A;  3RNC C;  2RSU A;  4HRO A;  2FUG 1;  2MLB A;  4NNJ B;  4N58 A;  2K1F A;  4IWO A;  2IGH A;  2OJW A;  4OZB A;  2WS3 B;  2LEK A;  1TS2 A;  4WUR A;  2KKC A;  3QHT A;  4DXF A;  2KO3 A;  3NUH B;  2KAC A;  5G2N A;  5G5H A;  3B2G A;  3WAP A;  2RR9 A;  4XYC A;  2C5L C;  4NJ7 A;  3K9P B;  1JRU A;  1FRD A;  1LXD A;  3RZF A;  3HM6 X;  1NVI D;  1ZXH A;  1E7V A;  1OTR B;  1SXT A;  3NVV A;  1SE2 A;  2HTH A;  2N0S B;  2JYE A;  2IO0 B;  1RFA A;  1TS3 A;  1F52 A;  2J53 A;  1WYG A;  4DXG A;  3TEW A;  3P42 A;  2LMC A;  3UIO B;  1WJ6 A;  1SJE D;  3VAW A;  3R3M A;  3RNG C;  3NJT A;  1STE A;  4PT5 A;  1BXT A;  2FCM A;  3DHH C;  3N9Y C;  2K0P A;  1PGX A;  4C4V A;  5L95 C;  4LTU A;  4YXD B;  1WGK A;  1WM3 A;  1XQQ A;  4CO7 A;  3APF A;  1WX7 A;  4RF0 A;  2JX5 A;  1J0G A;  4IUM B;  5FK9 C;  2KFJ A;  4A20 A;  1E6E B;  4A3O A;  2CS4 A;  2YVC A;  2WP9 B;  3VDZ A;  2MJE A;  4ZYN A;  3WAO A;  1FXI A;  2OOB B;  3L4P A;  3PZ7 A;  4ITK A;  4AJW A;  1ZUD 2;  5E6O A;  1E10 A;  3Q3J A;  1I35 A;  3P4R B;  4WJN A;  5BYR A;  5AUI A;  1H4R A;  1Y56 A;  2INP E;  3DOW A;  5CHF A;  3DWM A;  3PO0 A;  4R3D A;  2L32 A;  4W9I A;  1L0V B;  1TKY A;  4B6W A;  4KX6 B;  3WA0 A;  5E6J A;  3CIR B;  2HTM E;  4NQL B;  1UBQ A;  2WWZ A;  1JML A;  1JWS D;  2LJ5 A;  4J3O D;  3RNA C;  2BYV E;  1YN4 A;  1SIJ A;  1UEL A;  1T5X D;  2BVC A;  2K3U A;  3PVL A;  2PVO D;  4HPP A;  1K50 A;  1I4H A;  3PRE A;  2QMT A;  1WGY A;  3WIM A;  2J0M A;  2R61 A;  4MH0 E;  2H88 B;  2BF8 B;  2SEB D;  1P9D U;  2R2O A;  3PRZ A;  3ZJT A;  3DBR B;  3GB1 A;  2MH7 A;  4NY0 A;  2WU5 B;  1YJI A;  1GAQ B;  1FD6 A;  1R4N B;  1YQ3 B;  1P0R A;  1OQR A;  2WXJ A;  4B0E A;  2M8S A;  3DCG A;  4XE0 A;  5DPS A;  2IYD B;  2CR5 A;  2VH1 A;  1UWX A;  3BK2 A;  2J0J A;  3FC4 A;  1XF5 L;  2ZNV B;  3IHP C;  4M02 A;  3DWG C;  4FHJ A;  3ML8 A;  4NJ6 A;  4IWP A;  4HDQ A;  2DBY A;  3BWU D;  3Q14 C;  4ICU A;  5JHB A;  3N1X C;  1TKG A;  3UQB A;  5TSS A;  1UF0 A;  3ZTC A;  5KHQ A;  1D4B A;  3ALB A;  4HCN B;  4US8 A;  3GE3 C;  5HFY A;  3U7D A;  2PW9 A;  3ZXV A;  2L8J A;  4CHK A;  2DEN B;  1H8C A;  3KUD B;  2LI5 A;  2WXF A;  2XK5 B;  2IO2 B;  2WDT B;  3BVZ A;  2BWF A;  4X57 B;  1FFU A;  3P4Q B;  4ZDV A;  4EZK A;  2KLG A;  2XBB C;  5EE1 A;  3N1Z C;  3I5J C;  2CHW A;  2D3C A;  1GOZ A;  5BMH A;  4XGA B;  1WSP A;  1T0S C;  2AL3 A;  2L52 A;  4M8M A;  2BYE A;  2D3G A;  5GXG B;  4DQO C;  1CK1 A;  4DHJ B;  3SHQ A;  2PTL A;  4N59 A;  3DVG Y;  4HPM B;  1I4G A;  3N32 A;  2Z8L A;  2I1K A;  1PUT A;  3PLU A;  4ICV A;  4ZHP A;  3D32 A;  5AZF A;  1FXT B;  4K3B A;  2GB1 A;  2D07 B;  3U7Z A;  5JH5 C;  4DDG D;  2WXK A;  2MW5 A;  3SU8 X;  1RYJ A;  4DHZ E;  3VUY A;  3A4S C;  2K8B A;  1F2R C;  5BMG A;  1SSN A;  1YN3 A;  4M00 A;  3FIL B;  3Q3F A;  4TKN A;  1N5W A;  3KWL A;  2WNM A;  4LCD E;  1E8Y A;  2IJ0 A;  2OJR A;  3L16 A;  2J52 A;  2VZK B;  2I2Y A;  4A6Q A;  3OLM D;  1Z5S B;  5T8I A;  5AZG A;  1WXV A;  2KD0 A;  2LGI A;  1OFF A;  4LDT B;  1PFD A;  3TCA A;  3W1S A;  1JWM D;  3VUW A;  3QIJ A;  4DDI D;  1V2Y A;  2KTR B;  4XDD A;  2RDH A;  1PQS A;  2DLB A;  2EMT A;  2BQQ A;  4EOY A;  4GOC A;  3R2T A;  3V60 A;  2FID A;  3HM3 A;  4NAW A;  2KVR A;  2EKE C;  2MBB B;  1IUE A;  2BS4 B;  4DXA B;  2J0K A;  3DBH B;  3W5V B;  3MFG A;  3NVW A;  4JE3 B;  2N9P C;  2V0G A;  1I4Q A;  1GNU A;  2WXR A;  3NOB A;  1F1H A;  4RF1 A;  3BYY B;  1Y8R C;  2RPV A;  4MDK E;  1VLB A;  1V49 A;  3KQ4 A;  3B2F A;  3BII D;  4W9H A;  3I9V 1;  1PDX A;  3A9J A;  3NZU A;  3ZLZ A;  3AEG B;  2NPT B;  5JXV A;  3TMP B;  3J9C A;  4GDK A;  4XX5 A;  2MQJ A;  5G5G A;  1YNT E;  1FNW A;  2KAJ A;  3A9K B;  3M3J A;  5C2T B;  1IBX B;  4HKZ E;  1NI2 A;  3ZJV A;  4FLH A;  3TBL D;  1C4P A;  2NTS A;  2KJR A;  3HRD D;  3N3K B;  2MX2 A;  1WR6 E;  4FJY A;  1WXS A;  3U30 A;  4P16 A;  3DBR I;  3PPA A;  4US9 A;  2KZR A;  2M1M A;  3A33 B;  4I6L B;  2LVP A;  3LB8 C;  3UI3 A;  3VFK A;  3RCZ A;  1R4N I;  3V61 A;  1WJU A;  2JRI B;  3FKY A;  1MFW A;  3PHX B;  1JWB D;  3BIN A;  4KZC A;  2ZCC A;  2OHF A;  2KQ4 X;  2KN5 A;  3PGE A;  4M01 A;  1C4A A;  3APD A;  4GXB A;  2HE7 A;  1K51 A;  1V5T A;  2LGY A;  2ONQ A;  4MH8 A;  1T6B X;  2KX0 A;  4DWF A;  3V05 A;  3VVW B;  1NEN B;  3JW0 X;  4HXD A;  3QAR A;  3H6N A;  4MT5 A;  2RPQ A;  2K6D B;  1TTN A;  3OWE B;  2KWV B;  2LVQ A;  4GN1 A;  2N1V A;  4YSX B;  2MBH A;  2QJL A;  5E6P A;  3AEA B;  3ZQ4 A;  4L2Y A;  2DAF A;  1QOF A;  3RFZ B;  1TKE A;  1WRI A;  2KMA A;  2MSE D;  1MG4 A;  1HZ5 A;  3MTN B;  3DQV A;  2D10 A;  4GLS C;  3NY5 A;  2O2V B;  5LXI B;  2L00 B;  4W9L A;  3JSV B;  1ZPS A;  1FM0 D;  4ZRK A;  3W1Y A;  2INC C;  1CJE A;  1L6U A;  1L0Y B;  2ZZP B;  4HJK A;  2KOX A;  2V3S A;  3MC0 B;  3TEY A;  3ZO5 B;  2FBW B;  1V97 A;  3SDL C;  2G9H D;  4RCO A;  3TIX A;  5AEK B;  1I42 A;  3PRP B;  2C60 A;  1UGM A;  4MM3 B;  2KQ7 A;  2BYF A;  1MHH E;  1BML C;  3JVZ X;  2WXQ A;  4EZJ A;  1MHX A;  2ACZ B;  4EUT A;  1SB3 C;  5CX3 A;  1ZE3 D;  1TS5 A;  1YJ1 A;  2DZM A;  4E71 A;  2V9H A;  1QOB A;  2ON8 A;  3IBE A;  1EUV B;  2JYT A;  3Q8F A;  1JW9 D;  3RNF C;  2PVG C;  2GOW A;  3P4P B;  3X23 A;  2O6V B;  2N9K A;  3RNE C;  2IPK D;  4USA A;  2WX0 A;  5BMI A;  2IGG A;  5IP4 D;  3L08 A;  3OJ4 B;  2Z0D B;  3UF8 A;  2KJ6 A;  2JY6 A;  3W2D A;  1EU4 A;  2MBE A;  2DWQ A;  3VRA B;  2J7Q B;  2WDV B;  1YIW A;  2RD0 A;  3DBS A;  4BOZ B;  3ZJU A;  4URK A;  1IPG A;  3ZRF A;  1G6J A;  2KC2 A;  3AE2 B;  1S3S G;  2CJN A;  1V1P B;  2G4D B;  1WGG A;  2IGD A;  2D2Q A;  1ROE A;  3AED B;  4W9E A;  1IYF A;  3QA8 A;  1A5R A;  2JWZ A;  4RGN A;  2EKI A;  1VD2 A;  2JWU A;  3W1S C;  4KSL C;  3BYT B;  3Q8B A;  3DBH I;  2R2Q A;  5DPT A;  2IO3 B;  1QZE A;  4GGQ A;  3Q3M C;  4GDL B;  3ZNG C;  2LVO A;  3BZD B;  2M56 B;  1T3Q A;  4BBN F;  3PSE B;  1MPE A;  1NYQ A;  3MHZ A;  1TY0 A;  4MSM B;  2DYB A;  2NTT A;  1IGD A;  1V1O A;  2AX5 A;  1N63 A;  3ML9 A;  1I4P A;  1WXA A;  1L5P A;  2CJO A;  4WWP A;  3OG5 A;  4TQ0 A;  4WIP A;  3P1M A;  3NZ3 A;  3IAS 1;  1FRR A;  4K81 A;  2XEW A;  1WY8 A;  3PRM B;  4AWJ A;  3AN1 A;  1KFY B;  3EFC A;  2WXH A;  1V81 A;  2QIL A;  1IGC A;  1YMH E;  3FAH A;  3A4R A;  4WQO B;  3R2I A;  2KFK B;  2B3A A;  2RDG A;  4E74 A;  1P7E A;  4FHK A;  2QEJ C;  3N1Y C;  2LZ6 A;  1QIL A;  4HRS A;  5HI1 A;  4BZA A;  3AU4 A;  3AEF B;  4B0M A;  1OQQ A;  5IO9 A;  4LK0 M;  3E56 A;  1WRD B;  1D5Z C;  2LWP A;  3AE3 B;  5IOI A;  2DYM A;  2IO1 B;  1WE6 A;  3U2S C;  2L83 A;  1WWT A;  4LNN A;  2ZW1 A;  1UUP A;  3RNB C;  3A1Q B;  3AE1 B;  3EGR A;  2FCN A;  2K9X A;  3R8B A;  1RRB A;  4DK5 A;  1WGR A;  1KLU D;  4KDL B;  1L4Z B;  4NAM A;  1S1Q B;  1QT9 A;  1UNS A;  2IZV B;  2JF5 A;  4WH4 A;  3FIL A;  1ZXI A;  4PYZ A;  4JQW C;  4C7Z A;  2FE8 A;  4ANW A;  5BYS A;  4HPL B;  2KQS A;  4IW0 A;  2CKH B;  2CU3 A;  1ISN A;  4MGK E;  3DBL B;  2IY1 B;  3ZYY X;  2IDY A;  3RUI B;  3C8Y A;  5MPO A;  3GZN B;  4K7S A;  2KWC A;  2SAK A;  3VTV A;  2FIF A; 
#chains in the Genus database with same CATH homology
 4GMV A;  2KLC A;  4EKU A;  2OJR A;  2MP2 B;  3L16 A;  4W9J A;  4EEW A;  3IVF A;  3B1L X;  3RT3 B;  1WGH A;  3KYD D;  1R4M I;  3OLM D;  2KNB A;  3DDC B;  3WAM A;  5J18 A;  4AOF A;  3VTW A;  1Z5S B;  1YD8 U;  5AZG A;  1WXV A;  4M0W B;  2KD0 A;  1E8X A;  3UQA A;  5KHO A;  2N4F A;  4JL9 A;  1WE7 A;  3JYU A;  4LDT B;  2Z59 B;  3DVG X;  3TCA A;  4IG7 B;  3W1S A;  2GBR A;  4ANV A;  3R7R A;  2KHW B;  1IP9 A;  3TJP A;  3VUW A;  2LXA A;  3QIJ A;  5IAA C;  1KOT A;  4XC2 A;  2REX A;  1Q5W B;  1WR1 A;  4DDI D;  2KK8 A;  2LRW A;  3N30 A;  4FUL A;  1V2Y A;  2KTR B;  2V1Y A;  4GU2 A;  5CHW A;  4F7Z A;  2RGF A;  2ZCB A;  1WZ0 A;  1PQS A;  2XK5 A;  2EMT A;  4K1R B;  4EOY A;  4GOC A;  3H9D A;  3IFW B;  2NR2 A;  3VTU A;  2HJ8 A;  4BKT A;  3V60 A;  3M62 B;  4WAA A;  2FID A;  1V80 A;  4KZ0 A;  4MGI E;  5LXH A;  3HM3 A;  4NAW A;  2JPH A;  3ZNH B;  2KVR A;  2EKE C;  3VH4 B;  4HCP B;  3TL5 A;  4BKS A;  3L13 A;  2MBB B;  3PZD A;  2MBO A;  3KVF B;  2M0X A;  2O6V D;  3M63 B;  3MHS D;  4I6N B;  4HK2 A;  3HHM A;  4KSK C;  4DXA B;  4E3C A;  2A5U A;  2J0K A;  4B9K A;  1EO6 A;  2DAJ A;  4ANX A;  4CYE A;  2G4S A;  2KWU B;  2N9P C;  2NPT A;  2YLM A;  2ZPN A;  2BPS A;  2PEA A;  3ZUN A;  1ZGU B;  4NAW B;  2M4N A;  1GNU A;  1YQB A;  3NOB A;  3NS8 A;  2N9X A;  4G0N B;  4DBG A;  2JVC A;  3EHV A;  4LJP B;  1Y8R C;  1L2N A;  4MDK E;  3ZNI D;  1V49 A;  2HD5 B;  2MBQ A;  2BGF A;  4P7I A;  2KC1 A;  4W9H A;  4W9K A;  3H7P A;  3A9J A;  3NZU A;  4KVG B;  3ZLZ A;  2NCN A;  3ONS A;  1LFD A;  1WI0 A;  2NPT B;  1C3T A;  3ZKJ C;  4BVU C;  5LLI A;  2CU1 A;  3AI5 A;  3TMP B;  4FA6 A;  4GDK A;  4XX5 A;  2MQJ A;  1RLF A;  3V6E B;  4AUQ C;  2PE9 A;  4ZRI A;  1E8Z A;  4MJS A;  2MCN B;  3VXW A;  2CHX A;  3A9K B;  2JZ3 B;  2IY0 B;  3M3J A;  3H7P B;  2FAZ A;  3X0W A;  4W9D A;  4HVB A;  2M17 A;  4AP4 C;  4GB9 A;  1NI2 A;  3LDZ E;  1X1M A;  4FLH A;  3T9L A;  3TBL D;  1XD3 B;  2KJR A;  4AJY B;  4IM2 A;  5E6O A;  3ZNZ B;  3N3K B;  3ZVV A;  1UBI A;  4GDK B;  3WAL A;  2MX2 A;  1ZW7 A;  2FCQ A;  1V86 A;  3ZIM A;  2BWE S;  4FBJ B;  1WR6 E;  3L17 A;  1WXS A;  4FJY A;  4WJP A;  5D94 A;  3U30 A;  5L83 A;  3H1U A;  3DBR I;  3PPA A;  1V6E A;  1AAR A;  3O65 B;  2KZR A;  1XT9 B;  2M1M A;  1GG3 A;  3A33 B;  4MEM A;  3HK0 A;  4I6L B;  2LVP A;  2DZI A;  2NBU A;  3VFK A;  3RCZ A;  1WX8 A;  1R4N I;  4ZRJ A;  3V61 A;  1WJU A;  4DHZ B;  4ANU A;  2JRI B;  3L0W B;  4IC7 B;  5DPR A;  1P98 A;  2NBW B;  3V6C B;  5J17 A;  4W9C A;  2L3Z A;  1WXM A;  3PHX B;  2C7N B;  1LM8 B;  3BIN A;  4KZC A;  5JHA A;  1Z2M A;  2RSU A;  4RMA A;  2ZCC A;  5C1Z A;  2MLB A;  2KN5 A;  4NNJ B;  3PGE A;  2K1F A;  4IWO A;  3APD A;  4GXB A;  4IM3 A;  2GMI C;  2HE7 A;  2KKC A;  3OAW A;  3QHT A;  2KO3 A;  2ZNV C;  1V5T A;  2LGY A;  4G11 A;  4YL8 A;  2KXJ A;  2L05 A;  5G2N A;  2KX0 A;  4DWF A;  3WAP A;  1E7U A;  1BT0 A;  1SGH A;  2KDF B;  2RR9 A;  3MJW A;  4I6P A;  3VVW B;  2C5L C;  3JW0 X;  4HXD A;  4NJ7 A;  4KIK A;  2ZJD A;  3VH3 B;  2KTR A;  2GBN A;  3K9P B;  1JRU A;  3QAR A;  1LXD A;  2GBK A;  3H6N A;  3RZF A;  2RPQ A;  3HM6 X;  2K6D B;  1E7V A;  1OTR B;  1TTN A;  2KWV B;  3B0A A;  4RM9 A;  2LVQ A;  2LUE A;  1EF1 A;  2N1V A;  4GN1 A;  2HTH A;  2MBH A;  3P2B A;  3JSV A;  2IO0 B;  1RFA A;  1U4A A;  3AXC A;  2JXX A;  5E6P A;  1MG8 A;  1M94 A;  4OVU A;  1D3Z A;  2DAF A;  2N1W A;  4KIK B;  4MGY E;  4TQ1 A;  4ASW C;  5G55 A;  4WJO A;  2KMA A;  2BKF A;  3UIO B;  2MSE D;  4G3X B;  1WJ6 A;  3MTN B;  3VAW A;  3DQV A;  2D10 A;  1UZX B;  1F9J A;  3NY5 A;  4GIV A;  2O2V B;  5CTR C;  3R3M A;  2L00 B;  4W9L A;  2AL6 A;  2AYO B;  5LXI B;  3JSV B;  2KTF A;  3UIP B;  3V62 A;  4HDO A;  1V9J A;  2FCM A;  4ZRK A;  3UIN B;  4F1S A;  1HE8 A;  1ZKH A;  3W1Y A;  4DHJ D;  2ZPY A;  2N7D A;  4IM0 A;  2AEH A;  4PS8 A;  3ZW3 A;  1SIF A;  3R7Q A;  2ZZP B;  4HJK A;  5L95 C;  5D2M B;  1UD7 A;  3PS6 A;  3RYT A;  1WFY A;  2KOX A;  1GC6 A;  2AWT A;  3DVN V;  2V3S A;  3EEC A;  1WM3 A;  1XQQ A;  3ZO5 B;  4J6I A;  4CO7 A;  4II3 B;  3APF A;  3HIZ A;  1SE9 A;  1WX7 A;  3K9O B;  3SDL C;  1WGD A;  2FUH B;  2KAN A;  1C1Y B;  2KJH B;  1J0G A;  4IUM B;  4KV2 A;  3QAQ A;  2UYZ B;  3TIX A;  5AEK B;  2KFJ A;  4A20 A;  3A9K A;  4PS7 A;  4M8N A;  1I42 A;  1GUA B;  1WX9 A;  2FNJ B;  4A3O A;  3PRP B;  4W9F A;  4NQK E;  2C60 A;  1LQB A;  2CS4 A;  2LRU A;  2YVC A;  1UGM A;  1WJN A;  2KQ7 A;  3VDZ A;  2BYF A;  2WYQ A;  4K7U A;  3WAO A;  4ZYN A;  3JVZ X;  3ZTD A;  2OOB B;  4PS3 A;  4EZJ A;  2PPH A;  4EUT A;  2W9N A;  3L10 B;  5CX3 A;  2KDE B;  1YJ1 A;  2DZM A;  3BY4 B;  4AJW A;  4E71 A;  2L0F A;  2DHZ A;  2N7E A;  2MA9 B;  3AU5 A;  3GOE A;  3IBE A;  1EUV B;  4JLC A;  3Q3J A;  4NPN A;  2D11 A;  1I35 A;  1UH6 A;  3VUX A;  2N9E B;  3DVN U;  4WJN A;  3LJ3 A;  1WH3 A;  3OJ3 A;  1OEY J;  3DBL I;  1WZ3 A;  3SD5 A;  4WWN A;  1H4R A;  1WF9 A;  1TGZ B;  2G3Q B;  2GOW A;  2PE6 B;  3X23 A;  5EDS A;  3L54 A;  2O6V B;  3GZN I;  4OVV A;  2CHZ A;  3KUC B;  3DOW A;  2WX0 A;  5CHF A;  3I3T B;  1TZ1 A;  4MEL A;  2G45 B;  2FCS A;  1E5W A;  3PTF C;  4W9I A;  3ZDT A;  4WWO A;  4B6W A;  1J8C A;  4MGZ E;  4PYU A;  3WA0 A;  3KYC D;  2JUO A;  2V4L A;  3L08 A;  3QQ8 B;  3RUL A;  3OJ4 B;  2Z0D B;  2KDI A;  3UF8 A;  2KJ6 A;  2JY6 A;  3CST A;  3C0R B;  4NQL B;  1T0Y A;  1UBQ A;  2WWZ A;  5IA7 A;  2MBE A;  2J7Q B;  4LDT D;  1YIW A;  1WM2 A;  2LJ5 A;  4MSQ B;  2RD0 A;  3DBS A;  4BOZ B;  2DX5 B;  4URK A;  1RAX A;  2BYV E;  3CMM B;  5CHV C;  1IPG A;  3U8Z A;  1Q1O A;  3ZRF A;  3VQI A;  1G6J A;  2KC2 A;  1UEL A;  2DZJ A;  1S3S G;  2WX1 A;  3PVL A;  3R66 C;  2G4D B;  3KH0 A;  4RM8 A;  1YX5 B;  5DCN A;  5AZH A;  5D6J B;  1WGG A;  2D2Q A;  1KM7 A;  1E8W A;  1L7Y A;  3PRE A;  2LGX A;  4W9E A;  1WGY A;  1IYF A;  3WIM A;  3QA8 A;  2J0M A;  4MH0 E;  2GBJ A;  4BOS C;  2BF8 B;  3T8M A;  1A5R A;  2C7H A;  2JWZ A;  4G50 A;  3QX1 A;  2GBM A;  1P9D U;  2R2O A;  3PRZ A;  1P3Q U;  5HKH A;  1Q0W B;  4K7W A;  3QCA A;  3KW5 B;  1VD2 A;  4BKG A;  3W1S C;  2O2V A;  4NY0 A;  4KSL C;  5FR6 A;  1P1A A;  1OEY A;  3NHE B;  1YX6 B;  2ZVN A;  1WJ4 A;  3DBH I;  1P0R A;  2R2Q A;  5DPT A;  1KJT A;  2IO3 B;  3M95 A;  1QZE A;  4GGQ A;  5TR5 A;  2M8S A;  2MWS B;  3DCG A;  3NZS A;  3ENE A;  5DPS A;  2IYD B;  4GDL B;  2CR5 A;  4WJQ A;  4BKS D;  3ZNG C;  2LVO A;  4BBN F;  3PSE B;  3PLV A;  1TBE A;  4A3P A;  4EZL A;  2J0J A;  4TV3 A;  1WYW B;  3KUZ A;  2MRP A;  4N9F 4;  2Y5B B;  2ZNV B;  4W9G A;  1E90 A;  3IHP C;  3PHW B;  2DYB A;  4KDI C;  4MSM B;  4JIO U;  2K8H A;  4FHJ A;  3UGB B;  3ML8 A;  4NJ6 A;  4BBN C;  2LAS A;  5BO4 B;  1GJZ A;  4IWP A;  3ML9 A;  1WMH A;  4HDQ A;  1KLV A;  1WXA A;  1OGW A;  2KMC A;  3CF6 E;  4ICU A;  4WWP A;  5JHB A;  2BKR B;  2NBV B;  2KFK A;  4TQ0 A;  1CMX B;  2ASQ A;  2C9W B;  4GSW A;  4MM3 A;  3UQB A;  3ZTC A;  5KHQ A;  4K81 A;  2XEW A;  3ALB A;  4HCN B;  1WY8 A;  3PRM B;  4AWJ A;  1EF5 A;  4EFO A;  3U7D A;  2K25 A;  5E6N A;  1V81 A;  3ZDM C;  3RD2 A;  2L8J A;  4CHK A;  3VHT C;  2ZVO A;  1WMH B;  4BFR A;  2DEN B;  3A4R A;  4TUU A;  4WQO B;  1H8C A;  3KUD B;  4B95 A;  2LI5 A;  2KFK B;  2B3A A;  1VCB A;  4E74 A;  2XK5 B;  2IO2 B;  2WDT B;  4FHK A;  2LXC A;  2BWF A;  2LZ6 A;  1NDD A;  4X57 B;  2I1J A;  4FJV B;  3QWZ B;  2QHO A;  3AU4 A;  2L7R A;  3AUL A;  3RZW C;  4ZDV A;  4EZK A;  2KLG A;  2XBB C;  3ECI A;  2KDB A;  3EFU A;  2O6V A;  4F8C B;  1WRD B;  2LWP A;  3QJZ A;  4II2 B;  2NVU I;  2CHW A;  2DYM A;  1OQY A;  2DYO A;  2IO1 B;  1NBF C;  1WE6 A;  3B08 A;  3A1Q A;  3EC8 A;  3PV1 A;  4LJO B;  2VRR B;  2AL3 A;  4FJZ A;  2BYE A;  4M8M A;  2D3G A;  2UWQ A;  4DHJ B;  3SHQ A;  3DVG Y;  4HPM B;  3H7S A;  2NS5 A;  3N32 A;  2I1K A;  4XZ4 A;  3PT2 B;  3QC8 B;  3PLU A;  3IG3 A;  3A1Q B;  3A9J B;  2LGD A;  4ICV A;  2FCN A;  3WAN A;  5J2R A;  2EMS A;  1RRB A;  4DK5 A;  3D32 A;  2K8C A;  5AZF A;  4JGH B;  1WGR A;  2JT4 B;  1FXT B;  4KDL B;  3QK0 A;  2JZZ A;  5GMV A;  2KX3 A;  1S1Q B;  2D07 B;  4MJS B;  2IZV B;  2JF5 A;  3DPD A;  4HWI B;  3S2A A;  5JH5 C;  5DPW A;  4DDG D;  2MW5 A;  4PYZ A;  3SU8 X;  2LD9 A;  2L0T A;  4FN2 A;  4JQW C;  3CSF A;  2JRH A;  4ANW A;  4DHZ E;  3VUY A;  2C7M B;  3APC A;  5C23 A;  4HPL B;  3A4S C;  2KQS A;  2K8B A;  4IW0 A;  2CKH B;  2ZEQ A;  4IWQ A;  2MP2 A;  1GC7 A;  2A4Z A;  1V5O A;  2Z0E B;  1ISN A;  2L76 A;  4MGK E;  1WIA A;  5JZE B;  2IY1 B;  1K8R B;  4GDL A;  4HLE A;  3RUI B;  2DZK A;  3Q3F A;  4TKN A;  2K6Q A;  4K7S A;  2IBI B;  2KWC A;  1J19 A;  2K39 A;  3VTV A;  3ZRC A;  4FAD A;  5D7G A;  4LCD E;  2FIF A;  1E8Y A;  2PJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...