1FNVA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
total genus 43
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnvA02
1SBBB 5ELFA 1SE3A 4L6TB 2NTSA 1S5CD 3BYTB 1CT1D 1TY0A 4RGOS 1ET6A 1FNWA 5ELBA 1GOZA 1D5ZC 1ENFA 1HXYD 1PTOD 1CQVA 1STEA 1UUPA 1PTOH 2IPKD 1LTRD 5D3IB 5D3DA 1D5MC 1F77A 3DWAA 1JWSD 1V1PB 4RGTA 1I4QA 1S5FD 2AQ2B 1LTID 2RDGA 3BYYB 3EA6A 3EFXD 1AW7A 1D6EC 1XTCD 1B1ZA 1YN5A 4K6LA 1LT4D 1SEBD 1PRTB 1QILA 3TSSA 1KLUD 1LT5D 1PRTC 1D5XC 1I4GA 1I4RA 3URYA 1BCPD 2RDHA 5TSSA 5I4DA 2G9HD 1KLGD 1SXTA 2TSSA 1I4PA 3CHBD 2NTTA 2AQ1B 1EU4A 1DJRD 1EWCA 1AN8A 3R2TA 4RGMA 1G8ZD 3BVMA 1FNVA 1LLRD 4NZLB 5ELEA 1TS4A 1SE2A 1JWUD 4O1NA 4ZYSA 3DWQA 1FGBD 1BCPB 3O13A 4C56C 1ESFA 1LTSD 2QEJC 1L0YB 1UNSA 1ET9A 1HTLD 4DXFA 3R8BA 4DXGA 1HA5A 1LTAD 3R2IA 1PRTD 2O2LD 4TSSA 5ELDA 2XN9C 4Z9CB 2J4XA 4OHJA 1LTGD 1CHPD 2Z8LA 1BCPF 1PTOB 1JCKB 1BCPC 4RH6A 1EFID 1TS5A 1CHQD 1V1OA 1S5ED 4UDUC 1LTBD 1RDPD 3BVZA 1I4HA 1MD2D 1TS2A 2XRSD 1FD7D 4L63B 1B44D 1RD9D 1TS3A 1RCVD 3MFGA 4RHRA 3SEBA 1T5XD 1LTTD 4RFBA 1JR0D 1BXTA 1YN3A 1KTKA 1V1PA 4RCOA 3KLSX 1PZKD 3GP7A 1EEFD 1XXGA 4RGNA 2AQ3B 1M4VA 2XRQD 1L0XB 1LO5D 1JWMD 1I4XA 1SJED 3DWPA 4RHSA 3W2DA 5FKAC 1PTOC 1PTOF 1EEID 1HQRD 2R61A 4BWGB 1PRTF 1PYWD 1EU3A 3BZDB 2SEBD 1SJHD 2IJ0A 1PZJD 1YN4A 2ICIA 2CHBD 1LT6D 3BVGA 1FNUA 1CK1A 2XNAC 3OWEB 5FK9C 1TY2A 2WV6D 1RF2D 3V05A 1DYQA 1LT3D 1SE4A 1JQYD 1PZID 1S5DD 1S5BD 3MC0B 5ELCA 2QILA
chains in the Genus database with same CATH superfamily
3AEBB 5ELFA 1PFNA 3P1HA 4ZQ3A 3EIVA 4L6TB 5EAYA 3OW2A 3RMKC 2RF4A 3AI5A 3KOJA 2F0JA 1WJ6A 1JMCA 1SE8A 1GOZA 4YCWA 1KFYB 4OONA 2PO4A 2NR2A 1STEA 1LV9A 3IFTA 2XBBC 1FCCC 3EECA 5FLXL 1P7FA 3DHHC 4LTUA 1JWSD 2EYFA 1XJVA 2R92G 2EOTA 5DPTA 3FPPA 4P74A 3ZNID 4P2CB 2JA7H 4W9HA 1XT9B 5IE8A 4DR3L 4KDLB 2Q2HA 3CU7A 4DK6C 5M3MB 4LFAL 2NUCA 2PI2A 5I2YA 1WJUA 2HTME 2EVBA 4IWOA 1O7LA 1QILA 1HR0W 1Q7YC 1P1AA 4FNFA 1SNCA 2F1MA 2WB1E 5FO7B 1N60A 2DHZA 3AE6B 3V2TA 1QJOA 1L1OB 1V9PA 2LS01 1CKNA 4C3IB 5LMNW 3GTMH 2K33A 4BY7B 4A3BH 1UELA 4JWUC 5ELOA 4GB9A 3KBGA 3AEAB 1C4QA 1MPEA 2MBBB 4KKJA 1A2UA 5D7GA 2D62A 3BU2A 2LRWA 4H2AA 4JE3B 1G51A 3NWSA 4DAYB 5C44H 4BKGA 3HOWH 3RZOB 3A1QA 1HZ9A 5IWAQ 2N7DA 3K80C 3GTKH 4DK3C 3L13A 2IX3A 1YNND 1WGDA 2KTRB 1SROA 3E0EA 2L0FA 3M4OH 2WHIA 4WURA 1E3PA 3CQZB 1PRTD 5AFWA 2R93G 2R2OA 3IG3A 2M0XA 5A2QL 2F0SA 3OHXC 3QOLA 1RODA 1N5WA 1QZEA 1E22A 1E9MA 1V2YA 3H94A 1QKZA 1KJTA 2KT7A 4GGQA 4J3OD 2PQAB 1L2NA 1TS2A 2JJQA 1K53A 3NENA 2PVGC 5JPMC 2JA7G 3L08A 1FL0A 2YTVA 1B44D 1TQOA 2B2WC 4IPGA 3RNUA 1YZ6A 1UWXA 1J8IA 1E2VA 3A7AB 2IY0B 3VUYA 1B4OA 2KDMA 2N49A 4XGAB 1J8CA 2A68C 4A3MB 4U673 2M4NA 1XNQQ 1JR0D 1J5EL 1UGJA 1GHJA 3GS2A 3I91A 3P63A 4WJOA 1BF4A 1I35A 2MX2A 1CFMA 2PMVA 5EE3A 3UI3A 1SYGA 5EKKA 1UD7A 2E8GA 2JA5B 4KSKC 5C0XH 3ITPA 2EIFA 4KN4C 1MIUA 5HURA 4JL9A 5D65A 2V4LA 4YIJA 2QCPX 2MBOA 4OO1G 4NAMA 2K5WA 1IYUA 3NHHA 4WH4A 4GLSC 3TBLD 2KOLA 5IT9E 3AULA 2CHBD 2OCEA 3H7PA 4QIWB 3UDFA 4DV1L 5EJWA 3M4PA 5AZFA 1EY6A 4IG7B 2EYMA 4DUZQ 4MJSA 4PZ7A 3FP9A 2K1BA 2I2YA 1V9JA 4F7ZA 1EY5A 1S5BD 3S1NB 2IWHA 2WXJA 2F0OA 1H9JA 3GTGB 4GKJL 1EWYC 2QGQA 3GTJB 2LGIA 3IAYA 2BTEA 5L37A 1C4CA 3I4MG 4BBSG 1J9OA 2ZJRA 2K6AA 2G45B 1M90C 2HDMA 2DNFA 5CORA 3SK6A 2K6DB 3J7A5 3FILB 4PMCA 3DLLA 1L2FA 3FAHA 2WXNA 2BH2A 4KZ0A 1R4MI 3IFDA 2LMCB 1Y1VB 4B3ML 2YEPF 1ZW7A 1D5MC 2WXOA 4GKKL 3QJYA 3EROA 1T0YA 2E5LQ 1S4ZA 1TKEA 4NAWB 2AQ2B 4C4VB 3I4NH 2LXCA 1AW7A 3HOYB 1B1ZA 4L5SA 3P1MA 4ZKCB 4K6LA 5C6AA 2HJ1A 4Q0FA 2QDFA 2BPSA 4IUPA 1K83H 1RTOA 4HMIA 4A3EH 1AH9A 4NJCA 2BWFA 1DOXA 1LM0A 3M63B 1TIFA 1MI2A 1B9RA 4WJ4A 1QB5D 4KV2A 3NELA 2XTIA 2FNJB 2R93H 1FMAD 1BUVT 2H89B 4L23A 1OXSC 3DBRI 3DMUA 2KCCA 3T1YQ 3V61A 4K5VA 1Q1EA 1JWBD 1J6QA 1K51A 2IZVB 1A5RA 2MW5A 2UUBQ 1WI0A 3GTOH 3PV1A 3RLNA 4M02A 4LJZC 5ELEA 2IYDB 1KF6B 3W5UB 1CZWA 1JMLA 2PTLA 1FGBD 4QF4A 3M3YB 1Y8OB 3RNGC 4JVZA 2M19A 4DV4L 3U2SC 1I6HH 3J80E 3SK8A 2KVRA 3UDGA 1FJGL 2JRIB 3I55A 4G7OC 3ZDTA 2KCNA 2K5PA 2GBNA 3KF6A 4JBMA 3M4OB 3GTPB 1WXAA 3DBLI 4LK0M 2SAKA 2RDFA 4PT5A 4XWTA 4YSYB 1YJJA 1ZP0B 5BMGA 2Z0DB 3K9PB 5T1GA 4OO1I 3BVZA 4ZDVA 5LMUQ 1U5KA 2BH8A 2NYZD 3M9BA 4XIGS 2M17A 2ASQA 4QIWE 2PEAA 1RHPA 1OXXK 4P16A 4HCEA 4LF6L 3PUZA 5EBDA 4LF8Q 4C80A 5JJLA 3T13A 4LNQA 3J80L 1RIPA 1YX5B 3K58A 4JPSA 3W3AA 4DBGA 4QB4A 1F9RA 2A6EC 3J7YW 4H13C 4FA6A 4W9CA 3VUXA 4DV2Q 4N9PA 3HRZC 1N61A 2JP1A 4KHZA 3GP7A 4RGNA 4BKTA 1L0XB 2XWJB 2CKHB 2LHDA 1YHAA 2JA6G 1PVOA 3GOEA 5JZEB 2E2DC 3I3CA 1VS0A 3CCVA 1WXQA 4HJKA 1SGHA 3ONAB 1WSPA 3AE8B 3U4EG 1PRTF 3UIPB 2Z6KC 2MBEA 4EZJA 4UP7A 1TT2A 1FVIA 4IJLA 4P71A 3PIO3 1AZQA 3HOYH 4C4VA 4DR2L 1J7BA 3GZNI 1VMPA 4A3LG 1N63A 2JF5A 4M8MA 2F0EA 1R4MB 4HJ9A 1NDDA 4H0LC 3TP5A 1G6JA 1G91A 3RN2A 1I3QH 1PZID 1MVKA 2DYMA 2VB3X 2LJIA 1SRUA 3U4VA 1JRUA 3M3YH 5C0XI 1GUGA 3HOXH 2R6GA 3I56A 1GUWA 2MJEA 3K5LA 5K36H 3NJTA 5M5YH 1KOTA 3GTOB 1T0QC 1Y1VH 2GRIA 3Q69A 5IGGA 5M3MG 4HN7A 2CCZA 4ICUA 3X0WA 2EJMA 2M1MA 3AE3B 2A73B 3GE3C 4LF5L 1DONA 2NVYB 3RNEC 4DKAC 4DR4Q 2C9OA 4MTKA 3T53B 3EVQA 4HDOA 2X6GA 1S5FD 4EE2A 3SR1A 3IXSA 3A5ZB 3MXNB 2K05A 4JI4L 3K57A 3IAS1 5DPSA 4F88A 1VQ6A 2KHWB 2LVOA 1Y1WG 1GAQB 1L0VB 2WXIA 3ALBA 1G2SA 1QZHA 3N32A 1MHXA 5L83A 3S1MH 2A5HA 4DV0Q 3CCRA 4ICVA 3K7AB 1AP0A 3EHVA 5H92C 2MP2A 2RDHA 4O0AA 2K5DA 4PMWA 1O7YA 1C76A 1QOGA 1DOYA 4R8IA 2JQOA 1ZEQX 3HKZE 2TSSA 4HJGE 5KHOA 3UI2A 2NTTA 3STBD 1CZGA 1EWCA 4RGMA 4G4KA 5D14A 3I72A 2LZ6A 3RZWC 2JSOA 4LFBQ 1WGKA 2YEPB 2CFMA 1Q10A 4HR7B 4RWSC 4WFN3 3SU8X 2YTXA 4N8FA 4A3DB 3A5UA 4ZK9B 1WXVA 2MJDA 2QJLA 4P73A 2CHXA 3DHIC 4PYZA 2DX5B 3BZCA 3D8GA 4LMQD 3ZW3A 3AB9A 5GROA 4JBKA 1B70B 1XWEA 4E74A 5K36G 2RSUA 3ZXVA 1YITA 2NPTB 4KHPQ 4K2KA 1S40A 4K2LA 3T4AC 3I4MB 4BBSB 2ES2A 3T16A 2WX0A 4C3HG 1XPRA 5KNCA 3HOYG 4L5QA 4KJOA 1VF7A 1K8RB 2JY6A 1TU2B 2M8SA 4LAAA 2G1EA 3A9JB 3W1BA 1PH2A 1UE6A 2IW3A 2KDBA 2FAZA 2JA9A 2EXDA 4B3RL 2Q2TA 2N7EA 3R66C 4DGZA 5BMHA 5L95C 4WJNA 2GA4B 3HG9A 4HVBA 2EMTA 3H1UA 3TEYA 1MG8A 1JE5A 4HRSA 2MGSA 4ZKBB 1CA6A 3H91A 4GDLA 1CM9A 5C0XG 4LFCL 2ZTEA 2Q8TA 1GUNA 1HNZQ 2HIXA 2L7RA 1P9DU 1YHQA 2QMTA 1L7YA 3CCJA 3P7JA 4EQPA 1LFDA 2LGXA 3AEGB 1LM8B 3BWUD 1SN8A 2IO1B 4JI3L 2H1EA 1Z2MA 1WR1A 4A3MH 3L16A 5IOCA 1YN4A 3V3XA 2CJNA 2D3AA 3KW5B 1ZKHA 3NHEB 1WE6A 3ICEA 1ZPSA 1VD2A 2I1KA 1EIHA 5BYQA 4IUMB 4RKBA 4AYBB 1RF2D 4F8MA 3J81E 2B2UA 2PPBC 3S14H 4IC7B 2KHJA 4GMVA 1EY0A 2K28A 3L2PA 1CKOA 1V6EA 3MAQA 2XSCA 1C1YB 2F4VL 3CRKC 1E5WA 2Y5CA 4DDGD 2NZOA 3KLRA 1KDAA 4G7HC 4KHPL 1OXVA 2LD9A 4GDLB 5KGUA 2MO1A 5EPLA 1ZXTA 3GTQB 3ZRFA 1QQRA 5GXGB 2UUAQ 1RKNA 1PFMA 3PLVA 4QMGA 1WTVA 1YIJA 1L6UA 2L15A 4A90A 4A8XC 2ZZPB 3D3RA 2BQQA 1JOKA 2UU9Q 2UXCQ 4LUVA 2GOWA 1ONLA 3NZ3A 1N6ZA 2E2JB 1ENAA 4JLCA 4FADA 4JOIA 1LT4D 2M00A 3T56B 3QX1A 3RNBC 3E9HA 5C44G 2F4IA 1ML0D 3MXUA 1FXTB 2VZKB 2WXLA 1SMXA 2ZJDA 2KKCA 3P4PB 3PUXA 3IT6B 2Z9HA 1WJNA 4DWFA 3IL8A 4WWNA 2A69C 3CIRB 2FUHB 3LWEA 2K8BA 4S0RA 5CBEE 5E6JA 5I9PA 4GOPB 3C46A 4LF9L 5JVG3 4PQXA 1Z47A 4NY0A 1MBYA 3DVGX 2KUMA 5CV5A 4B9WA 2K39A 5C3JB 1TT5B 4YWGG 5BN5A 1FNVA 2XWBB 3CMAA 4KGTA 4L8JA 1JICA 3VTWA 4O1NA 3KH0A 1N5XA 3DWQA 1NI3A 3MFYA 2W3RA 2ZNVC 3Q3MC 4ZRKA 1AE2A 1LTSD 1DGSA 4GN5A 1PV4A 2WLBA 4W9DA 4B0EA 1U4AA 1STGA 3HOZH 4LF5Q 3RI7C 5JJIA 4MHEA 3NE5B 4DR1L 3Q3OC 1SNDA 4PZ8A 1SAPA 5BN3A 1CA5A 2AL6A 4EX5A 2V3PA 3DHGC 3AN1A 3IHPC 4C1NI 4JI8Q 2WXPA 4PS8A 1T0SC 2KHIA 4LF7Q 5FLXE 4KD4A 5IYDG 1OTCA 2IGDA 3PZ8A 4AQ7A 2Y0SG 5C4JB 1CKNB 2LGDA 1STNA 5T1IA 3U9SA 2H5XA 4ULLA 1TWHB 1YIWA 3EFUA 1P7EA 4AUQC 1VCIA 3P4SB 5C4HA 3GTQH 1VQLA 5JJKA 2JK8A 4A3GH 2B3AA 3BIID 2SOBA 4A3FG 5M5XH 4QJFA 3W5VB 4P7IA 2K22A 4BY1H 4HK2A 4MTNA 2RPVA 1GB1A 4EZKA 4NW2A 3VDZA 1B53A 1LTTD 3R7QA 4DR6L 4LF4L 4X66L 4K81A 2LKVA 2KDIA 1VDZA 2Q2IA 4NPNA 1SYBA 2B63G 3N1ZC 2KACA 1TWFH 2L0CA 2LXJA 2INDC 1JB7A 2NVTB 1U4PA 1V81A 4K14A 4RKLA 3RMHA 4OWTB 4MM3A 4MN3A 2INNE 2E2JH 3X3MA 4MGZE 3RFZB 3FHWA 4KTAA 4XQJA 3HIZA 3V62A 1B9NA 2DWQA 2F0DA 4NPSA 4RA8A 3KJPA 1N36L 5C3EG 4Y52H 2OEDA 4KGSA 4LLGM 5EQ0A 5DM73 2F3IA 4YTPB 2DYBA 4PYUA 1SNOA 5JVH3 5H8YE 4K3CA 4E71A 2ZW0A 1B3AA 1C7YA 2KLGA 5KYIA 3U58A 4DR7Q 3MEHA 1PH6A 2MA9B 1K8MA 1WTHA 3E9IA 4X65L 3OJ3A 5HGQA 1EIGA 1CT1D 4PV1C 1HCZA 5J3BA 3S2DH 1CQVA 4GZYC 1H9KA 3HOVG 1Q8IA 2IPKD 1ZUD2 1YHBA 4OIKA 3ULLA 3FEWX 4ME5A 2Q5WD 2XK5A 1TWAB 1WX7A 3CF6E 3H9DA 2KNBA 1PH7A 1K8OA 3E0JA 3KLSA 3FMCA 2KWUB 1CKMA 4BZAA 4BXXG 1I7HA 3ZXRA 2XGTA 1WTOA 2UUBL 3ZDMC 2F0HA 4WJPA 1SR3A 4A76A 2L05A 3TRZA 2W55A 1LT5D 3F2UA 5FO9B 3CCQA 1EYDA 1OXUA 3ZGZA 3S1QH 2MBQA 5CV9A 1F2RI 2LUMA 3DBHB 3K8AA 1WE7A 3QQ8B 1XMQQ 5IODA 5LHY1 4ABNA 3QIAA 2YV5A 3SGIA 1YJ9A 3SXHA 2I5HA 4IQZA 4IUUA 2KMAA 3VR3A 5IYDH 4HIDA 1L4ZB 1STHA 3H0GB 2JXMB 3GTPH 1WD1A 1F9QA 1Q0WB 2OJRA 3LDZE 1WTXA 4A3BB 2PKOA 2KVZA 1SYEA 3K5NA 3Q24A 2JA8H 5IOIA 3FKIG 2JSVX 4US8A 1H9MA 2FUG1 4GKKQ 3RUIB 4CJ1B 3JVZX 2K9XA 4B3MQ 2DN8A 3DHQA 4X3UA 1JW9D 4J1MA 1MSHA 1K73C 5E6NA 4FBJB 3KUCB 4QGUA 4JCVE 3ZJYC 4TSSA 1CMXB 2FCSA 1C4AA 2N9PC 1PDXA 3ER0A 2UUCL 3NWTA 1N33L 1PTOB 1JCKB 3WAPA 1CHQD 1V5OA 3L0OA 4CHKA 5IIFA 3T51B 1RDPD 3STBC 1I4HA 4GKJQ 1GPXA 3ULPA 1BO0A 2LY7A 1IBML 1PFDA 3F2BA 2KC2A 2EY5A 2NVTH 1E2ZA 1S72A 1K52A 4FF4A 4N59A 2D5GA 1T6BX 2CKZB 1JJCB 3TZUA 2WXGA 1O7ZA 5G2NA 1R7SA 4JX1C 3NVYA 2JU6X 1KHIA 2WFWA 4OXPA 4JI2L 1OXTA 2I5MX 2EYLA 1GNUA 4RCOA 3CAMA 2BDOA 3U9OA 2KJHB 2WAQG 1KDBA 3DCGA 4M01A 3ZRCA 3OOCA 1ICFB 3W2DA 4N8X1 2X6LA 5FKAC 4C3HB 2AL3A 1RYJA 2LASA 3N1YC 3EGRA 1HQRD 2KQ3A 2R61A 4L5RC 1OGWA 2FIDA 4MACA 2EE1A 4JI2Q 3HOUH 3AU4A 4A3JH 2HCCA 3DBSA 4HKQA 4OZAA 4I6LB 3WWVA 1R9TB 2KMMA 2XNAC 4X3KA 3TP7A 2GLSA 2A19A 2KJRA 2R92B 3S1NH 1TY2A 4RAUC 4JBWA 3V05A 4DAMA 2JA8B 2BWES 2ONQA 4KDIC 1DOMA 3EC8A 3QOJA 2FE8A 1SBBB 1VQEA 1GXDC 1EWHA 4K5XA 1OTRB 3IT4B 1Q12A 1Y14B 2ZXPA 1K8GA 2N9KA 2NBWB 4DR5L 3RLOA 3AEFB 3RNAC 5BMIA 1BBUA 2MHVA 4HCNB 1PTOD 5IT9L 5IGBA 2KANA 5LMNL 3OJ4B 3H3VH 2HQEA 1EIYB 3S1QB 1A70A 2BW2A 2K25A 1QLBB 2YU9B 2CW0D 4KN7C 4JC0A 2W9NA 1EL0A 2L52A 3I70A 2D07B 4NJ6A 4OL7A 1N9WA 4QCLA 2EKEC 1WWTA 1I4QA 3SDZA 2Q2UA 1HTOA 1EYCA 4ILWA 4IUTA 1I50H 3L9AX 3Q8AA 3ZIMA 2ZEQA 4KMUC 1RL2A 4KD3A 2LWPA 1WY8A 2OF1A 3CW2C 4ZRPA 2O5IC 1WGHA 1UE7A 5CGKA 2WINB 3MEFA 1BUIC 2GBJA 2I1JA 1KLUD 4ARIA 5D94A 5IP9G 1XTDA 5GADC 4V0BA 4BKSD 3P20A 2O6VD 3MC8A 1TWCH 1XMQL 3DXJC 4BBNC 1JQ4A 1NUCA 1BNZA 1FGUA 2HDLA 5C4XH 2L0TA 3SK5A 3WOFA 5ELNA 4E6IA 3G4SA 3BDOA 3Q23A 2EJGC 4IW0A 1L0WA 3DQVA 1B9MA 3M7GA 4EQ5A 3VA7A 5G5HA 4DK5A 1PXUA 2GN5A 1A3VA 4R4QA 4YHHQ 1EUVB 4DV7L 1EOVA 1I6HB 5HI1A 4HLEA 2WNMA 4FO2A 4GLAC 3K59A 4FYDA 2D3GA 1UNSA 3DVGY 3A56A 1WX8A 2OTLA 1X32A 2VUMH 2EXZA 3PIPA 2ZVNA 1TBEA 2DZIA 4ANVA 1X56A 2WDQB 3CCLA 1WXMA 4DUYL 3AE4B 3APCA 3HOUG 1V1OA 2B2TC 3UQBA 3A55A 4O2DA 5C3EH 1PMRA 3RZOH 3PO3G 3HOWB 1HZBA 3C1EA 2GBMA 4FVMA 2L12A 2BF8B 3QC8B 2KBNA 3A54A 4GNXA 1L4DB 1Q46A 4CDCC 3PRMB 1WCMH 3M4YA 3C0RB 3A0JA 2CWPA 3DWGC 4BOZB 1VZ6A 1N36Q 4GXBA 1Y8PB 3A9KB 3TREA 1K3RA 4FXDA 3S2HB 5CR3A 4FHJA 4TMAB 1H8CA 5CMDA 3QR8A 2Z4HA 2HCIA 4M8AA 2KX3A 3TS2A 1AWDA 1C9FA 4Q5VA 1WI5A 4LJOB 3FDTA 1IL2A 2A1AA 2M0AA 4C00A 1ZGUB 2E2HH 3ENEA 1EQRA 1LTLA 3WOEA 2MLBA 1LO5D 1NBFC 1I4XA 1V80A 4ANUA 2WXRA 5E4WC 5JEAJ 3S17H 1F9SA 2NBFA 4AQYL 3AE9B 3K5OA 5IGDA 4B3SL 2JA7B 1TWFB 3G6JB 4JI1Q 1KIXA 4BXXH 4IM0A 1NEKB 2Y5PA 4ME3A 2ICIA 1KABA 2WIIB 4C3JG 3V6EB 4LCDE 5FLMG 4BAXA 4IFDG 4DV5L 2KA7A 5DM63 4IDIA 3VR5A 3OWEB 1YNJC 2F0IA 1TWHH 2IDYA 1A2TA 2OHFA 4OW0A 2WV6D 2E2HB 2A68D 2WACA 4CJ0B 3BK1A 4K8IA 3K7AH 4C3IG 1NTGA 3CF5A 1P3QU 1YX6B 1WYGA 2KQ4X 3J7AF 1HNWL 4YCUA 2LFIA 2QILA 2B29A 2ICEC 1EIFA 4APVA 4WAAA 4KV6A 5ELBA 3VUWA 5DNFA 1IW7C 1HXYD 5GAGC 1IBKL 1ICWA 4DR1Q 3DEOA 4R4IA 1WZ3A 4K7WA 1V5TA 1MJEA 5CHVC 4X62Q 2ZTCA 2CU1A 2CR5A 4FJVB 1Q1OA 4QY7A 1VQPA 1N62A 4HWIB 2F0GA 2LSSA 4BA2I 2DLBA 2J42A 3HUIA 5IN7A 2WDRB 4N6EB 3AE7B 3Q22A 3LJ3A 2RKSA 1C78A 1XTCD 3ND8A 2ZXOA 3OYYA 4NXMQ 3NP8A 1Y8RC 2ZJPA 1IHZA 4LF9Q 1N32L 2N1WA 2LFNA 3AM9A 3SD5A 1F2LA 2V3NA 1GUOA 3DOWA 5EKIA 4CKEA 4K3BA 3PRZA 2HD3A 2CWAA 1BCPD 5I4DA 3PO3H 2G9HD 3GB1A 1HE8A 1WF9A 2I46A 4A3LH 4EGVA 4RMFA 4F7XA 1BDOA 3HOXB 3QJZA 2M9VA 4YHHL 5AUIA 1T3QA 1VQBA 1C79A 4UHVA 4IJHA 2EYHA 3AMZA 1SLJA 5CV6A 1IBLL 3NRZA 3KBXA 5JOBA 2Y0SB 4KLKA 2RHQB 1WTQA 4CKCA 1HZ6A 4W9GA 2ID0A 5COYA 4C56C 2UXCL 4A75A 3VRBB 4K0KQ 4KIKA 4QQBX 2QDLA 3KYHC 4LWCA 1NVID 4ASWC 4HDQA 1TZ1A 1HTLD 1IYJB 3SE0A 4XYQA 1WFYA 3U52E 3DM1A 5C4ZA 5IT9c 2NCNA 1J7AA 1A15A 4IOIE 1DGJA 3A4SC 1OEYA 3NZSA 2KJXA 4LDTD 1XNRQ 2EY6A 2F4VQ 5IP4D 3QG1A 2HQLA 4IFDH 2L55A 4L63B 4EVOA 2B2YC 2C5LC 3S2DB 4XE0A 1UBQA 4DNIA 1E10A 4IFDI 2HD5B 2X69A 3PIOA 4BKSA 1NYRA 2ZCCA 1UF0A 2F0QA 3OIPA 1W6JA 3HKZB 3GTLH 1TWAH 5FLXc 2GI9A 4WAFA 1IBXA 3GQBA 4ACFA 1YNNC 1Q86C 3ND9A 1EF1A 4QUFA 3U30A 1SMYC 4KK7A 4DR5Q 1XYIA 5J39A 3NVVA 3NVZA 1BBXC 1Z6HA 3Q8BA 1SJED 1YNXA 4C2MB 1HNZL 3AB5A 4N9TA 1H9SA 3Q8DA 2G4DB 2VXWA 1HNXQ 3KK7A 5DCNA 1MKHA 4BWGB 2AHOB 1HUNA 3EFCA 1V8CA 1Q90A 1LT6D 3HKZG 2A6HD 4PNYA 1RJTA 4IKGA 4XYCA 5I9OA 3PF5A 4B3RQ 1TKGA 3JAMc 4KIKB 1JC7A 4RM8A 4B08A 4DU9A 2K1FA 4ALPA 3CSTA 3VAWA 5FJ8H 4R8NA 2OJWA 2DGYA 1FXIA 1VQFA 4HMJA 1KNEA 2VB2X 4IPDA 3BDLA 5IP7G 1F1HA 2K04A 3ML9A 3A33B 5CC4A 4GNXC 1PUTA 1SSNA 4L2YA 4BS9A 1E0ZA 1D4BA 3D6CA 1PFBA 2Z4IA 1SIFA 2MNAA 4GLVB 1N34Q 4R1JA 3H09A 3SHLA 3TJPA 1VF5C 4OX9L 1F77A 2F0WA 4A93H 1BT0A 3HK0A 1IKMA 1IBMQ 5E1FA 4DAYA 4Y7NB 5D6JB 3VYRA 2C9WB 1BOSA 1BQQT 2MUYA 5M5WB 2MRPA 4K1RB 1Z7TA 1WMHA 4ANXA 4GDKA 1DCZA 5EPJA 4WRDA 2MEKA 2C7NB 1N33Q 1FFUA 3IKJA 4CHTB 2UUCQ 4BY1B 1WYWB 4HXDA 4JWSC 5EE9A 3VTVA 1PRTC 4R4CA 1HFNA 3X23A 4YSZB 2FCNA 3V6CB 3LB8C 5HKHA 2BYTA 5LL6X 4FJYA 2IHFA 2N1VA 1QF6A 3VQIA 3TZDA 2F52A 1UBIA 5TSSA 3MWYW 4AYBE 4DV0L 1X1MA 4LUZA 2WKDA 4HCPB 2FJ2A 1S3OA 3BS1A 2E76C 5E7NA 4POFA 4DNTB 3RZDH 3RD2A 1Y1VG 3VYTA 2YYZA 1GM5A 1IGDA 5C1ZA 2K5NA 3VYSA 5E3FA 1D1KA 2RGFA 2W3SA 4RMAA 4W9IA 3WDNA 1SE2A 3R3MA 4O42A 2HT1A 2ZT9C 1FM0D 3VR2A 1NJIC 5FJ8G 4DR4L 2QEJC 1XO3A 1ET9A 2UXBL 4DXFA 2WX1A 1J7CA 3RNFC 3E6ZX 1AARA 3H3VI 2KJ6A 4JYAL 1SYFA 2N78A 4KI0A 3HS0C 4JI5Q 1LGRA 3WCQA 4I7ZC 1YJWA 2CJOA 3ZTCA 3VR8B 3HZXA 5FLMH 3S16B 3D4DA 1YJ1A 2RD0A 1Q81C 3HVZA 3TL5A 1S5ED 5IYBH 3VR6A 4B3TQ 2OXPA 3I63C 1VQDA 1KM7A 4TQUS 2ZTDA 1VQOA 3DUZA 3JSVA 1EY9A 4OO1H 1CUKA 4KY6A 2MJ3A 3FC4A 3DDCB 3R7RA 1VQMA 3C3LA 3H3VC 3I4NG 1QVFA 4BY7H 1OQYA 3AV8A 3H7SA 3B9JA 4YWKA 5JXVA 1RCVD 1PQSA 4DR2Q 1RFKA 3VHTC 3PMFA 1Q1BA 2ASBA 4B9XA 1YN3A 4A3PA 2W54A 3Q6SA 3U8ZA 3CP0A 1VR9A 1PH8A 2PE9A 2SDFA 2OWOA 3OWFA 3GTMB 2KDFB 4JGHB 3KUPA 4DR7L 2K14A 1JROA 3A7LA 4RHSA 1WZ0A 2PVOD 3RZFA 4JI6Q 2FIFA 3B6YA 4EFOA 1NE3A 1E2WA 3VVWB 3TP6A 4GOCA 3UIOB 3DEPA 3AU7A 3NQIA 2RHSB 4HEA1 4FLHA 4GLXA 4C3JH 3NEMA 3OW7A 2BA1A 3ZLZA 4OIJA 3PO2B 4YXDB 3GD7A 3FKYA 3WALA 1CK1A 2LXAA 4IM3A 4K7SA 3TMEA 4LF8L 1UEAB 1QNUA 2MWSB 1YVCA 1E8ZA 3CSFA 3NOBA 5LLIA 2RCNA 1EOTA 2D2CC 4E3CA 2MSED 3J80i 4JQWC 2R93B 4JI6L 4MJSB 1QVCA 1C8CA 1HEZE 1ROEA 3KYCD 3A8JE 2OQKA 1WR6E 1AFPA 3JYUA 2F0FA 3IRBA 1V43A 4DV3L 3Q3FA 4X66Q 2B2YA 4LF4Q 1WGYA 1ET6A 1SYDA 1XCQL 2B3GA 2O5JC 5DPWA 4IPCA 3X3NA 2D3CA 4L1BA 4A3IG 4A3GB 1FJGQ 1X65A 2Z6KA 3HFZB 2BYVE 3MZ5A 3I4MH 4BBSH 3O65B 1VQCA 3VR9B 3RULA 2O6VB 4IM2A 1ZXHA 2I5LX 4D2KA 4PK1A 4NQLB 2KOXA 3HGBA 2KFKB 2LEKA 4B3TL 1VQAA 4DF7A 3V60A 3CCEA 3PS6A 1YN5A 2RSOA 2CH4A 4IUVA 4LF7L 3PREA 4JI8L 4JI5L 1H4RA 2F03A 4EKUA 3TEWA 3J9CA 1NNXA 2F0UA 4IZ8A 1G6ZA 2LVPA 1E1TA 1JB3A 1WX9A 4YWMA 2UXBQ 1I6VC 2JXTA 2EKIA 2I38A 2EDGA 4XT3B 1OQQA 4UAIA 1WXSA 1U4LA 3NTKA 5MPOA 5IYCG 4B9KA 4CKBA 2AQ1B 3D0FA 2IHEA 3R2TA 2DNCA 4QL5A 1SF0A 3KYDD 3WAOA 1HPCA 2EYJA 3BVMA 3HOWG 1F2ZA 1YJNA 1B3QA 1STAA 4LNKA 3HOUB 4DK0A 4KZCA 3CC7A 4F1SA 2XK5B 3MXGA 2E5LL 3D4RA 1VQ5A 3SFEB 1M8AA 2WU5B 5GAEC 4HCSA 1G2TA 1L5PA 1WCMG 2KZRA 4DXGA 1P98A 4XC2A 4WWOA 1CSQA 2I0QA 3NTIA 1YEZA 2B8GA 2QW7A 2KTFA 4NNJB 3H0GG 2JYEA 1K0RA 3PQIA 3F8TA 3S1RB 4OWXB 1MGSA 1OQRA 3BZKA 1WRIA 2ZW1A 4DHZE 1V1QA 1FFVA 4DAPA 2OT2A 1I5FA 3JAMi 2RPQA 1SIJA 1QG7A 2V0GA 2J7ZA 2NVXB 2WXFA 4J8QA 2VZAA 2UXDQ 3Q0AA 1RRBA 4KSLC 1RD9D 1N34L 1ILPA 3N9YC 2UUAL 4M8NA 1PYSB 4U68A 3E3XA 2B63B 2PW9A 4BVUC 3AYHB 1HFGA 4P72A 3NTHA 4RFBA 4RCNA 2F0LA 1R4NB 1UZXB 4WQMA 1VQJA 2L11A 1ZYRC 3HOZG 2DZMA 4OZBA 4XXEA 1E90A 5AJ3Q 3C8YA 1X3FA 2DYOA 3AE5B 3ZNHB 2B2WA 2LJ5A 1ZKOA 3MXPA 3NK9A 1PH5A 1M94A 1PTOC 1EO6A 3S2AA 4XQQA 1K3BC 2RCFA 3H15A 4L5TA 2G5DA 3PLUA 3NS1A 3F2CA 3EUB2 3I90A 4X57B 1KXLA 2MO0A 2FBWB 5H1SE 5KHQA 3PGEA 2KC1A 4N58A 2FMCA 4ZUJA 4PMBA 2NBVB 2PE6B 2WKCA 3BK2A 2INPE 4A3KH 2A74C 1LABA 2E74C 3QB3A 3PVLA 2L5TA 1ZXIA 4UPAA 3HHMA 4IWPA 2B39A 3I7FA 1JQYD 1S5DD 1QZGA 4JV5L 5C4XB 2JRHA 1EY8A 2O2VA 5IY0A 1WGRA 4LFCQ 1VQNA 3AH7A 4IWQA 2Y3AA 1BR9A 4HKZE 1HJPA 3C1FA 1YNTE 4EZLA 2ZPYA 5J17A 3NPPA 2HUGA 3SVMA 1HRJA 3WANA 1C48A 4TQ0A 4JG2A 2VNUD 5IYCH 3OG5A 4A6QA 2F3WA 5C2TB 1IZ6A 4HPMB 2GBKA 5IWAL 2EYOA 5M3MH 1TYGB 1K8AC 2R7DA 3U4ZA 2UWQA 3BYYB 3EA6A 2CS4A 1HA6A 1WM3A 4WJQA 3AU5A 1ACCA 4ITKA 1XNRL 4DK1A 4YL8A 4FF1A 5C44B 4S17A 1UEBA 1EWIA 4NJ7A 2AWTA 5DAUA 1WTWA 3DVNV 4W9KA 4FJZA 1I4RA 1LACA 1PH9A 5I2XA 3HM3A 2VL6A 3I57A 5BN4A 4A3JB 3RPFC 4EQOA 1GUTA 4UP9A 2QIEB 4H02A 1I4PA 4GOPC 2GVAA 3Q3JA 3M95A 1RAXA 3TBIB 2R92H 3HOVH 4TV3A 4LFBL 3BJUA 3ML8A 4NZLB 2EPBA 4R4OA 3RUZA 2N55A 1ASYA 2N9LA 5HG2A 2NMQA 5BR8Q 3VFKA 2QCZA 2AKWB 1EZ6A 2N7JA 2MQJA 1LTAD 1SNMA 2K8HA 2K32A 1DXMA 2QEXA 3NXWA 1ZYRD 5ELDA 2QC8A 5G55A 1FEHA 2KVMA 1ISNA 1N32Q 2DZJA 3TS0A 1IXRA 2JN4A 3R93A 4G3XB 1U0LA 4KKIA 3TDQA 4CDDC 4NXML 2K7VA 3OTOQ 4PS7A 2JA6B 1ASZA 1X54A 4MZ9A 3TP8A 2WS3B 3UE0A 2CHZA 2KXJA 1KRSA 3J80c 3MHSD 3OSOA 1WM2A 3GTGH 4X62L 2O2VB 5IP9H 3PO0A 4NP5A 2NS5A 4XDCA 2QA4A 2JPHA 3MFGA 1HR0L 3OAWA 1U4RA 3FKIH 4FHKA 2JZ3B 2L1BA 4A3KG 2IO3B 3DPDA 3KDFA 1VJKA 1TGZB 5M3FG 5DPRA 4FXGC 2JA6H 1NYQA 3Q14C 4ZRQA 2N3SA 1IYVA 5LXIB 1HNWQ 4FULA 1JWMD 5C3XA 1XX8A 1IW7D 3UF8A 4V190 5IGFA 3W1GA 2WXKA 3AEEB 1VDVA 1UWVA 3BZDB 1JWAD 2CHWA 4DHJD 2WU2B 2JEAI 4DV5Q 2Q8IB 2AWNA 1X3QA 1WJJA 2CW0C 3JAML 4X3SA 4A3DG 3AEDB 2RA4A 5C23A 2DJGC 5AEKB 1FNUA 3FPUB 1PDQA 1CJEA 2WGSA 4JI1L 3G71A 3TIXA 4B3SQ 2YTYA 4NQKE 4GNXB 2WP9B 4ID6A 4X3TA 3QO2A 4AQYQ 1H9SB 5AZHA 3ONSA 3MA2B 4GDKB 3I2ZA 2AWOA 1GD7A 3W1YA 2KO3A 3SFDB 4IN3A 5C5LA 3FILA 4KJNA 1K0SA 1K50A 1GJXA 2PNRC 4A4IA 4DV2L 4WIPA 1QOHA 3T1HQ 3PO2H 1TY0A 1WYDA 1O78A 2EYPA 4M0WB 1D5ZC 3JAME 5AUKA 2YLMA 1Z9FA 2K4KA 1D2BA 3S24A 2PQAA 1PA6A 1PTOH 1MJCA 4LF6Q 1IBXB 3DVNU 1LTRD 4A3FB 2LVQA 3OMGA 5JAVA 2ZPNA 1QUQA 1KRTA 2L1AA 3V96A 1MFWA 2CH4W 4C1NK 1GC6A 5LMUL 2KX0A 1XPUA 2D10A 3AFQA 2D9UA 1XCTL 2KN5A 3H0GH 3APDA 2RDGA 4ZRIA 1EZ8A 2IO2B 3UDXA 1D6EC 3C2PA 5AZGA 4LNFA 4DUYQ 4G57A 3VH3B 1TVXA 2V1CC 2PMZE 1OEYJ 1PYBA 2SNMA 3ERQA 4A3KB 1L6VA 3T9LA 1WIAA 4I65A 1F52A 3KWVA 4DV4Q 2F0KA 1Y1WH 2IY1B 5EKLA 1NY4A 4HJ5A 1SXTA 3KF8B 5C3WA 2KYWA 5CYUA 2Z0EB 3QA8A 5CHFA 4LNIA 4ZYNA 4DV7Q 5C0XJ 4ZLTF 3TUOA 2BS4B 1G8ZD 3BG3A 5FOBB 1FRDA 3S14B 4RM9A 1M1KC 2JWZA 1J0GA 4ZYSA 1GG3A 4W9JA 1D8LA 1JOOA 5KEEA 3VXWA 3Q8CA 2J0JA 5T8IA 1W6KA 1GVPA 1FIQA 1C9OA 2N8NA 4TQ1A 2AMCB 1KL9A 3QWNA 1X6OA 4G0NB 2L83A 2ZM6L 1BCPF 2RMMA 1E7ZA 4ZCKA 1X3GA 1JE4A 1VMCA 1JJGA 1BMLC 2A4ZA 3LX0A 3CXCA 3F1ZA 4NKLA 1XLOA 3KJOA 4A3DH 3SHQA 2K03A 2C5CA 5C4XG 1IP9A 4GN3B 1SFOB 1Q3LA 4IUNA 1I50B 1X3EA 1X9NA 2A5UA 2WB1B 1TIID 2BVCA 3FKIB 4PG3A 2F0MA 3KF6B 5C5MA 4YWLA 3G7LA 1JORA 3NUCA 5LMNQ 5CV4A 5BYSA 2IX0A 3AQQA 3KQ4A 3PT2B 2F0VA 3OIQA 1DOIA 3QCAA 5E6OA 3M62B 4AWJA 1ZDXA 2DY7A 1N8RC 5LNK1 3A9JA 1CSPA 3PRPB 2Y0SE 3IVFA 4JBJA 2J0MA 2BT6A 5GQOA 2J0TD 1FCLA 5GMVA 2WDVB 1PTOF 2PZTA 3S1MB 2BCOA 3APFA 1RWSA 4Y7NH 3IAM1 3OPOA 2SEBD 1SJHD 3NBIA 1V97A 2B63H 2H4OA 1PZJD 4DV1Q 3T3NA 4I6NB 3J7AV 3MJ5A 2O6VA 1I3QB 1HUMA 1PGAA 3K0XA 5FK9C 1CZPA 3M3JA 1WOCA 4IPHA 2QKIC 2HHHL 2RVLA 4FF3A 2NVQB 2KWDA 4HPPA 5JEAG 3TEXA 4JOIC 1SE4A 3LXFA 2GB1A 2PCFB 3MC0B 2AUKA 5M5XB 1TKYA 5K5PA 2WDTB 3S1RH 3VH4B 3H7PB 1KAAA 1NSNS 1SE3A 2PPHA 2NTSA 2BB5A 4AYBG 3RT3B 1S5CD 2EQSA 2DNEA 3BYTB 1U4MA 3CMMB 5NUCA 1ENCA 1FNWA 1ENFA 2B2VC 4DV6L 3N6RA 5JJZA 4HSVA 1PH4A 1YMHE 3ECIA 1WCMB 3JC66 4AP4C 2A8VA 2WXMA 5D3IB 1WJ4A 2LI5A 2MCNB 3ZKJC 3ZVVA 5EBCA 4CGYB 5C3EB 4KKSA 1NENB 2DBYA 2PQEA 3I9V1 3L4PA 2MBHA 3K5MA 1AYFA 3DM3A 2IGHA 4K7UA 3PTFC 1SFOH 2V4DA 2L8JA 2KD0A 2WXHA 3PHWB 4M00A 2JT4B 1WD0A 1R4PB 3MVVA 2V4IB 1H9RA 2GMIC 2JQRB 1TWGH 5EE0A 4A3IH 3ZNZB 1LUZA 1ZE3D 3T3OA 2HJ8A 2M2LA 1PLFA 1MSGA 4TUUA 3HEJA 1UWMA 2KCTA 4UY8C 2ZNVB 1QWYA 4BFRA 1IUEA 2R2QA 1J19A 1VZ7A 4K8JA 1CI3M 3TEHB 1KDCA 2AUJD 3I4LA 1F9JA 1UH6A 2X38A 3RNCC 2F0PA 2VS1A 1OO9B 4CBVA 4A9AA 1JWUD 5FO8B 5IP7H 4HPLB 4DN4M 4A3CG 1BCPB 3O13A 1VQHA 1ESFA 2VQEL 3MC9A 1SSOA 4JPBW 3CC4A 1BVSA 5LXHA 4BBRG 1II3A 4A93G 1W3SA 3DWMA 2E2IB 1VLBA 2J53A 4YTNB 2O2LD 4QUCA 3E5SA 4XDXA 1XQQA 3N3KB 3PCOB 1F2MA 2CQAA 3VA5A 4OHJA 1S1QB 2EELA 2JZZA 2L76A 5EE1A 4R4TA 1V49A 4FN2A 4NXNQ 1A3TA 1TS5A 3RD4A 3VR4A 1B50A 1YOVB 4DR3Q 1LTBD 1MD2D 1QOBA 2B2TA 4DDID 2PLPA 2XRSD 5M9OA 3ULJA 1HTPA 3L3OC 2BE5C 4RNAA 1KQSA 3PPAA 4J6IA 4BY1G 4IALA 3LNNA 1EF5A 1MG4A 3EQLC 1XF5L 1EQQA 4DA2A 4RHRA 2J52A 1Q8KA 4JK1C 4OEMB 3PO2G 3DBRB 5M3FH 3TEZA 1P16A 4BOSC 4S3SA 3J81i 1F2YA 3KLSX 5JEAH 4X65Q 1VQKA 2MHJA 1EQVA 1VQIA 3D32A 1EEFD 1YQ4B 2K8CA 2AQ3B 4A3MG 1EFWA 1I94Q 1NR2A 3PUVA 4XT1B 1AZPA 4RF0A 2F0TA 1WVLA 4FF2A 1KNAA 2I07B 4MSQB 1GKHA 1PYWD 3E56A 1VQ7A 3U7ZA 3TN2A 4MGYE 3J81j 1LYLA 1HR0Q 3S16H 5DLQE 3H6NA 1T0RC 1Q82C 1KD1C 5DEHA 3S15B 4ZHPA 3KFUA 3HP3A 1H95A 1XLPA 1A62A 1EYGA 2NVUI 2D0PA 4IURA 1WTPA 3PO3B 1MHHE 2K5QA 1PH1A 4AJWA 3ZJVA 2DENB 2F0NA 4H7BA 3OTOL 2IY5B 2ENBA 4AJYB 3A74A 5LL6S 3CMEA 3BY4B 1BBWA 4DR6Q 1LQBA 2P5ZX 3H8HA 3L0WB 3U7DA 2N9XA 5IA7A 4TRDA 3K0YA 2B2VA 4BBRB 2F3VA 3A1QB 1DZ1A 1X55A 2EY1A 5BR8L 2R7ZB 2JVCA 1XEEA 3I5JC 1PFSA 1V1PB 1C3TA 1D7QA 3L54A 4LJPB 4HJ8A 3JW0X 2KN4A 4HSPA 3EFXD 5A2QE 3UGBB 1ILQA 4A3CH 1S3SG 3QIJA 5KYLA 3W1SA 1IKLA 1XPOA 4P1BC 2E6XA 4YY3L 3URYA 4YSXB 3NQTA 1E7VA 3C19A 2VUMG 1UE5A 1XMOQ 4II2B 4A93B 3J7ZC 2KMCA 3NS8A 2R7ZH 4LNNA 4YT0B 1FXAA 3MHZA 3CHBD 2N4FA 1RLFA 1V8QA 2G9DA 1RTNA 3W9CB 4HTHA 2BE5D 3LWUA 1OFFA 2L00B 3T8MA 1KAWA 2IT1A 1AEXA 2G4SA 2WYQA 2R3ZA 1QVGA 4OVVA 4CYEA 2NVYH 3AECB 3FRPB 2DJFC 1L0YB 3PSIA 4W9EA 4RF1A 2Z0SA 4GIVA 2WWZA 5M5YB 1VQGA 3R2IA 1XLNA 3GTLB 4AH6A 2WXQA 4ARCA 4RG1A 2Z1CA 1PGXA 3Q6BA 1Y8NB 2OOBB 1G6PA 1CHPD 3KLWA 5M3FB 1AE3A 3EN2A 3ZJTA 1BCPC 2BDNA 4HAEA 2IGGA 2VY3A 1E6EB 1E7PB 4A3FH 2FCMA 1FO4A 2ZJQA 4US9A 4JV5Q 4OWWB 2ON8A 1TWCB 4URKA 3A9KA 1Y1WB 1E24A 3S9WA 2UU9L 4M1UB 1CQFA 2UU7A 3MP9A 2KCMA 2K0PA 2LHEA 5J2RA 4ZRZA 2NWGA 5E6PA 2OEOA 2NN6H 4KY5A 2LRUA 1Y56A 4MH8A 4LW1A 3HOXG 1V1PA 4F87A 4DQOC 2VW9A 3ETRA 4C2MH 1PZKD 2PZWA 1TJEA 2PIAA 1E8XA 1M4VA 3DWPA 1EY7A 5HGTA 4J15A 2KQSA 3RYTA 5AJ3L 1TTNA 4IOAA 4HIOA 3ZO5B 1SB3C 4R3DA 4KKUA 3NG0A 5IYBG 1XD3B 1SDFA 3B1LX 2JYTA 2QDBA 3D31A 1F0ZA 3IBEA 4CQNA 1DM0B 4JI3Q 2BKRB 1CTMA 1EQTA 4DHZB 2UXDL 2GBRA 5HFYA 2VH1A 2SNSA 2BBCA 3AMUA 4KX6B 4CO7A 2N88A 4C3HH 4MNOA 2HE7A 2IL8A 2L32A 4F8CB 2JA5G 1NI2A 1UGMA 1NBWA 4EOYA 4ZOHC 3I3TB 1HHVA 2JUOA 2A69D 1L1OC 2NB0A 2Q8RE 2V1YA 4G50A 4K6DA 3HRDD 4LUOA 1WMHB 2RBMA 5BO4B 2REXA 1JRPA 2HTHA 2C7MB 4ZRJA 1U9RA 4RGTA 4A3BG 3VRAB 3NBHA 4MH0E 4GN4B 1LTID 4JI7Q 4POGA 2K75A 4HJAA 4REZA 1EUJA 1SEBD 2KTRA 4FP5D 3G48A 4FXKC 3TSSA 4BY7G 3L10B 4W9FA 4CDEC 4FDBA 2FMMA 3K6OA 1IL8A 1GUSA 1K9MC 5J18A 3P4RB 4YCVA 2C60A 5KNDA 1K83B 4A3EB 2HDEA 3A8KE 5ISRA 1KLGD 5BYRA 3TCAA 2MJ8A 4KGRA 3PSEB 4WWPA 4B0MA 1SNPA 4XQNA 1DJRD 3KVFB 2RQXA 2VH2A 4ZHOA 2OTJA 2PJHA 3WIMA 4IUQA 1KH0A 2JXXA 2DZKA 1IPGA 5I6WA 1SNQA 4GS3A 4BBRH 1E8WA 3A4RA 3AE1B 1O80A 3B2GA 1V86A 1JOQA 2Z59B 1E8YA 1HZAA 3J81c 2DUDA 1XLQA 4OELB 1NMGA 3NBHB 4NMZA 4M0WA 2CVRA 2KEDA 2FCQA 3D4WA 2TMPA 2EJFC 5EPKA 2VQFL 2J0KA 4Z9CB 2NVQH 2UYZB 2J4XA 4MGKE 1P8LA 2IX1A 3HOZB 1EM7A 1LTGD 2Z8LA 1E7UA 1NR4A 1EY4A 2YVCA 4DV3Q 3P42A 4JI4Q 3M4QA 5G5GA 4GSWA 3R3OA 2FINB 4AIMA 4ODGA 4LK1C 4ANWA 1P0RA 1NCVA 1GHKA 1FD7D 2KFKA 3MHBA 3PZDA 2EMSA 2VRRB 4UP8A 5CX3A 1I42A 2L4NA 3KF8A 3AEVA 3M7NA 4G11A 4NDXA 2D2QA 2LGSA 2VUMB 4C3JB 1F2RC 4TVAB 3UDIA 4CDFC 1JALA 2PW5A 2RR9A 3I4OA 3RN9C 3ABVB 3HOVB 1T5XD 3I8ZA 3RN5A 3M85A 3CPWA 4MEMA 2K3UA 3IFWB 2MFIA 1GJZA 2K5HA 3VDYA 4CJ2C 3U50C 3N20C 3NSWA 1YQBA 4KHVA 4B6WA 2XRQD 1K28A 1FD6A 1EYAA 3EBEA 3SDLC 1FYCA 4YTMB 1EEID 2N9EB 4GOPA 3MTSA 1JJ2A 2BS3B 3S2HH 3CCMA 1HZCA 2BS2B 4JI0L 4JI0Q 1E1OA 3TQYA 3ZYYX 4KY7A 1KRHA 4I7AA 2Y5BB 1VRAB 5FR3A 3AFPA 4TKOB 3CRLC 2BGFA 2ALYB 2PNHA 4HROA 2ZCBA 1LT3D 4MGIE 4I6PA 2A6ED 3PUYA 1WFQA 3W5OA 5KIXA 4HEDA 1A3UA 1BKBA 1KLVA 1YBYA 1FRRA 5HHDG 2D3BA 3B08A 4NXNL 5JHAA 1QCBD 3DBHI 4RGOS 3CQZH 1ZDVA 2G3QB 3K81C 5A35A 2YU9H 4JYAQ 4LNOA 4IO9A 4A3JG 1F9PA 4A3EG 3D6WA 3CCSA 3BINA 1IYFA 2NZ1D 5EDSA 4NAWA 5D3DA 1LXDA 3RLFA 4W9LA 2VQEQ 1C77A 2GVBA 3RR5A 2XEWA 1A63A 1WGGA 2LMCA 4R9WA 3ZQ4A 3VYUA 3JSVB 4NB3A 4B95A 4A55A 3B2FA 2KEEA 2BB6A 2B2UC 2K6QA 4AS1A 3CC2A 4DHJB 2W82A 2BYFA 1A0IA 4KKTA 3Q2AC 2VQFQ 3NZUA 1I4GA 2C35B 4G7ZC 1RFAA 4FXCA 4Q2JA 1GO3E 4DPGA 1HQMC 5J1ZA 2DY8A 2V9HA 3GDEA 3G6EA 4IOCA 5KNBA 3N1XC 4OVZA 4DXAB 1EU4A 3P75A 1YI2A 4A20A 1AN8A 2XVSA 1WTRA 2B8FA 3PUWA 2HIVA 4WQOB 3QARA 3A8IE 1TS4A 2WB1G 3T1YL 1QOFA 2JZPA 2WP8J 4OX9Q 2QF7A 2B76B 3E9SA 3WAMA 1VQ8A 4OVUA 2JX5A 1ESRA 1SMYD 1ZOYB 3R8BA 1HA5A 2EY2A 4XTCS 3F2DA 4MIUA 4N9F4 4DV6Q 2KWVB 1GUAB 5CHWA 2Z6BA 1T5EA 1FR3A 3PHXB 4MM3B 1WH3A 4TKNA 1EFID 3GTJH 3CWIA 2NVXH 2PYKA 3PF4A 2OQ0A 4JI7L 2RDBC 3BDCA 4MT5A 5G3LD 3QHTA 4KVGB 5IAAC 2FFKB 1R4QB 4GN1A 1UE1A 2R7FA 4II3B 4C7ZA 2DAJA 3P4QB 2HHHQ 1QUQB 1Y69U 2FHTA 2RSNA 4P75A 2A6HC 4ZUIA 3I4NB 1QOAA 2KHSA 3PV0A 2MPMA 4BA1I 3CCUA 3RZDB 3CKIB 3QAQA 3MJWA 3ZTDA 1TS3A 4ZAIA 2KK8A 2INCC 1NAPA 1MHWC 3ERSX 5EGTA 2BA0A 4K5WA 1TR5A 1HNXL 1STBA 5F2DA 5HY6A 5J22A 4EEWA 2JEBI 2D11A 4GU2A 2FXQA 3EJIA 3K7UC 1VQ4A 3KWLA 1D3ZA 1A8VA 1RM6C 3GE8C 4QAYA 2JA8G 1KC8C 2CQOA 2JE6I 4USAA 2O4XA 1EU3A 4DUZL 2N0SB 2IJ0A 4PS3A 3HKSA 2VZKD 2BKFA 3WA0A 2MP2B 1QNKA 2IO0B 2QSDA 5JHBA 1NMFA 2EZVA 1YJIA 1GC7A 2JYOA 3J81L 2KQ7A 2QHOA 2KWCA 3N30A 4P1CC 2AX5A 3MTNB 3UQAA 4H44C 3ZUNA 2BOSA 5ELCA 3GO5A 1G291 4AOFA 1WRDB 4XDDA 2KFJA 2K01A 2WAQB 2AYOB 5FR6A 5IGEA 2ZM6Q 2WQYB 1J5EQ 4IFDJ 4OZCA 1XNQL 1TKWB 1YQ3B 1VQ9A 3KUZA 4OGQC 1UUPA 2NN6I 4XWWA 4JW0A 3GTKB 2ZVOA 1PGBA 2MQHA 4K0KL 3DWAA 5CV8A 1HZ5A 2H88B 1DD2A 2M56B 3GZNB 3LYYA 3Q8EA 3NY5A 2C7HA 3KDFB 5CBAE 3CD6A 2BYEA 2K52A 3QWZB 3W1SC 3P2BA 1IBLQ 4EUTA 1DOLA 3N52A 4P6VF 5IO9A 2NZHA 3AE2B 4X6AH 2J7QB 4XYOA 4XZ4A 1PRTB 4EQNA 2R7ZG 1DOKA 3L17A 3L7ZC 3MXNA 1VZ8A 1D5XC 1TXYA 5KRUA 1QT9A 3GV6A 3SR6A 4MSMB 1T9HA 3FVQA 2PZUA 1B8AA 4A3IB 4A3GG 4HIKA 2DAFA 2KAJA 4PZ6A 2LUEA 2AEHA 1W2BA 2ACZB 3ZNGC 4BBNF 1TZOA 4MDKE 3OMCA 1PH3A 1SE9A 3PIP3 3VTUA 1R4NI 5CTRC 1LLRD 2L3ZA 2KDEB 2K50A 2E2IH 1SYCA 4DFAA 1VCBA 3Q3NC 4HJ7A 2V3SA 4C7YA 1X3PA 2K5VA 1XMOL 3QK0A 4WORA 4C3IH 3DBLB 4YY3Q 5IGCA 1MI0A 1STYA 2XN9C 2ZXRA 5I6YA 5C4JH 4HIMA 1IBKQ 1IGCA 4LDTB 5IKCM 4JIOU 1MJDA 2JWUA 2MP1A 3T1HL 5JPNC 4RH6A 4LFAQ 5D2MB 1B7YB 1TWGB 4UDUC 1HH2P 1D1IA 3ZJUA 1HTQA 1E0BA 4J6HA 2PW7A 4DNRB 2ATWA 3UINB 1L1OA 2L9HA 1C4PA 2KLCA 5JH5C 4WWMA 1YNJD 5CV7A 4WJ3M 1UAPA 2XIWA 2D5DA 2IBIB 3SEBA 5E4XA 1A6XA 3K9OB 5TR5A 1BXTA 3KUDB 1R9TH 1KTKA 2KECA 4A3OA 5M5WH 2X8XX 2WAQE 3TMPB 2KENA 1XXGA 2NPTA 2MH7A 1Q5WB 1PHJA 2D0OA 3GV3A 3Q8FA 5G3LF 3PGZA 1FPYA 2LXKA 3OLMD 2E3TA 2JA5H 4X64L 4DAVA 2LGYA 2NN6G 3UE1A 3B0AA 3I73A 2NBUA 3NUHB 2PMZB 3PZ7A 3S15H 1YD8U 3BVGA 3SK4A 4XX5A 1C0AA 1B2TA 5GAHC 1O7IA 4X64Q 3RCZA 3HVDA 1QE6A 3CPFA 3NVWA 4MELA 1DYQA 1Z5SB 2CU3A 1JT8A 3AXCA 2PI2E 3HM6X 3S17B 1I94L 2E75C 4WJWA 1GB4A 3LGJA 3H6MA
chains in the Genus database with same CATH topology
3AEBB 5ELFA 1PFNA 3P1HA 4ZQ3A 4L6TB 2F0JA 1GOZA 1KFYB 2PO4A 1STEA 1LV9A 3IFTA 1FCCC 5FLXL 1P7FA 4LTUA 1JWSD 2EYFA 2EOTA 3FPPA 4P2CB 3CU7A 5M3MB 2NUCA 5I2YA 2HTME 2EVBA 1O7LA 1QILA 4FNFA 1SNCA 2F1MA 5FO7B 1N60A 3AE6B 3V2TA 1QJOA 2LS01 4BY7B 4C3IB 4JWUC 2K33A 3KBGA 3AEAB 1C4QA 1MPEA 4KKJA 5D7GA 1A2UA 2D62A 4H2AA 4JE3B 3NWSA 3RZOB 2IX3A 1YNND 4WURA 3CQZB 1PRTD 5AFWA 5A2QL 2F0SA 3OHXC 3QOLA 1RODA 1N5WA 1E9MA 3H94A 1QKZA 4J3OD 1TS2A 1K53A 2PVGC 5JPMC 1B44D 1TQOA 2B2WC 1UWXA 1J8IA 1E2VA 3A7AB 1B4OA 2KDMA 2A68C 4A3MB 4U673 1JR0D 1UGJA 3GS2A 1GHJA 3P63A 3I91A 1BF4A 5EE3A 1CFMA 2PMVA 3UI3A 1SYGA 5EKKA 2JA5B 5C0XH 3ITPA 4KN4C 5HURA 5D65A 4YIJA 2QCPX 4OO1G 4NAMA 2K5WA 1IYUA 3NHHA 4WH4A 4GLSC 2KOLA 5IT9E 2CHBD 4QIWB 5EJWA 1EY6A 2EYMA 2K1BA 2I2YA 1EY5A 1S5BD 3S1NB 2IWHA 2WXJA 2F0OA 1H9JA 3GTGB 1EWYC 3GTJB 2LGIA 3IAYA 2BTEA 1C4CA 1J9OA 2K6AA 2HDMA 5CORA 3SK6A 3FILB 4PMCA 3FAHA 2WXNA 3IFDA 2LMCB 1Y1VB 2YEPF 1D5MC 2WXOA 3QJYA 3EROA 1S4ZA 1TKEA 4NAWB 2AQ2B 1AW7A 3HOYB 1B1ZA 3P1MA 4ZKCB 4K6LA 5C6AA 4Q0FA 4IUPA 1RTOA 4HMIA 4NJCA 1DOXA 1MI2A 1B9RA 1QB5D 1FMAD 1BUVT 2H89B 4L23A 1OXSC 3DMUA 2KCCA 4K5VA 1Q1EA 1JWBD 1K51A 4LJZC 5ELEA 1KF6B 3W5UB 1CZWA 1JMLA 2PTLA 1FGBD 4QF4A 3M3YB 1Y8OB 2M19A 3U2SC 3J80E 3SK8A 4G7OC 2KCNA 2K5PA 3M4OB 3GTPB 4LK0M 4XWTA 2SAKA 2RDFA 4PT5A 4YSYB 5BMGA 1YJJA 1ZP0B 5T1GA 4OO1I 3BVZA 2NYZD 4XIGS 1RHPA 1OXXK 4P16A 4HCEA 3PUZA 5EBDA 4C80A 3T13A 3J80L 3K58A 4JPSA 3W3AA 4QB4A 1F9RA 2A6EC 3J7YW 4H13C 4N9PA 3HRZC 1N61A 2JP1A 4KHZA 3GP7A 4RGNA 1L0XB 2XWJB 2LHDA 2E2DC 3I3CA 1WXQA 3ONAB 1WSPA 3AE8B 3U4EG 1PRTF 1TT2A 3PIO3 1AZQA 1J7BA 1VMPA 1N63A 2F0EA 4H0LC 3TP5A 1G91A 1PZID 1MVKA 2DYMA 2VB3X 2LJIA 5C0XI 1GUGA 2R6GA 1GUWA 2MJEA 3K5LA 5K36H 3GTOB 2GRIA 3Q69A 5IGGA 4HN7A 2EJMA 3AE3B 2A73B 1DONA 2NVYB 2C9OA 3T53B 3EVQA 2X6GA 1S5FD 4EE2A 3SR1A 3IXSA 2K05A 3IAS1 3K57A 4F88A 1GAQB 1L0VB 2WXIA 1G2SA 1MHXA 2A5HA 3K7AB 1AP0A 5H92C 2RDHA 2K5DA 4PMWA 1O7YA 1C76A 1QOGA 1DOYA 4R8IA 1ZEQX 2TSSA 4HJGE 3UI2A 2NTTA 1CZGA 1EWCA 4RGMA 4G4KA 5D14A 3I72A 2JSOA 1WGKA 2YEPB 1Q10A 4HR7B 4RWSC 4WFN3 4A3DB 4ZK9B 2MJDA 2QJLA 3D8GA 4LMQD 3AB9A 1XWEA 5K36G 4K2KA 4K2LA 3T4AC 3I4MB 4BBSB 3T16A 4C3HG 5KNCA 4KJOA 1VF7A 1TU2B 4LAAA 2G1EA 2IW3A 5BMHA 4DGZA 2GA4B 3HG9A 3TEYA 4HRSA 2MGSA 4ZKBB 1CA6A 3H91A 1CM9A 5C0XG 2Q8TA 1GUNA 2QMTA 3P7JA 4EQPA 3AEGB 3BWUD 2H1EA 5IOCA 1YN4A 3V3XA 2CJNA 1ZPSA 1EIHA 5BYQA 4RKBA 4AYBB 1RF2D 4F8MA 3J81E 2B2UA 2PPBC 1EY0A 2K28A 3MAQA 2XSCA 3CRKC 2Y5CA 3KLRA 4G7HC 1KDAA 1OXVA 4GDLB 5KGUA 5EPLA 1ZXTA 3GTQB 1QQRA 5GXGB 1RKNA 1PFMA 4A90A 4QMGA 1WTVA 1L6UA 4A8XC 3D3RA 1JOKA 1ONLA 3NZ3A 2E2JB 1ENAA 1LT4D 2M00A 3T56B 2F4IA 1ML0D 3MXUA 2VZKB 2WXLA 3P4PB 3PUXA 3IT6B 3IL8A 2A69C 3CIRB 3LWEA 5CBEE 5E6JA 5I9PA 3C46A 5JVG3 4PQXA 1Z47A 1MBYA 2KUMA 5CV5A 4B9WA 5C3JB 4YWGG 5BN5A 1FNVA 2XWBB 4KGTA 4L8JA 1JICA 4O1NA 1N5XA 3DWQA 1NI3A 3MFYA 2W3RA 1LTSD 2WLBA 4B0EA 1STGA 4MHEA 3NE5B 5BN3A 1SNDA 1SAPA 1CA5A 2V3PA 3AN1A 4C1NI 2WXPA 2IGDA 4AQ7A 5FLXE 4KD4A 3PZ8A 5C4JB 1STNA 5T1IA 3U9SA 4ULLA 1TWHB 1P7EA 1VCIA 3P4SB 5C4HA 3BIID 2SOBA 3W5VB 2K22A 2RPVA 1GB1A 4NW2A 1B53A 1LTTD 2LKVA 1VDZA 1SYBA 2KACA 2L0CA 2NVTB 1U4PA 4K14A 4RKLA 3RMHA 4MN3A 2INNE 3X3MA 4KTAA 4XQJA 1B9NA 2DWQA 2F0DA 4RA8A 4LLGM 4KGSA 2OEDA 5EQ0A 5DM73 4YTPB 1SNOA 5JVH3 5H8YE 2ZW0A 1B3AA 5KYIA 3MEHA 1K8MA 1EIGA 1CT1D 4PV1C 1HCZA 1CQVA 4GZYC 1H9KA 1Q8IA 2IPKD 1ZUD2 4OIKA 2Q5WD 3FEWX 4ME5A 1TWAB 1K8OA 3E0JA 3KLSA 3FMCA 1I7HA 1WTOA 2F0HA 2W55A 1LT5D 3F2UA 5FO9B 3ZGZA 1EYDA 1OXUA 5CV9A 1F2RI 2LUMA 5IODA 5LHY1 4ABNA 3QIAA 3SXHA 4IQZA 4IUUA 3VR3A 1L4ZB 1STHA 3H0GB 2JXMB 1WD1A 1F9QA 1WTXA 4A3BB 2PKOA 1SYEA 3K5NA 3Q24A 2JSVX 4US8A 1H9MA 2FUG1 4CJ1B 2K9XA 2DN8A 3DHQA 4X3UA 1JW9D 4J1MA 1MSHA 4TSSA 1C4AA 1PDXA 3NWTA 1PTOB 1JCKB 1CHQD 5IIFA 3T51B 1RDPD 1I4HA 1GPXA 1BO0A 2LY7A 1PFDA 2EY5A 1E2ZA 1K52A 4N59A 4FF4A 2D5GA 1T6BX 3TZUA 2WXGA 1O7ZA 1R7SA 4JX1C 3NVYA 2JU6X 1OXTA 2EYLA 4RCOA 2BDOA 3U9OA 1KDBA 3OOCA 3W2DA 2X6LA 5FKAC 4C3HB 1RYJA 3EGRA 1HQRD 2KQ3A 2R61A 4MACA 2EE1A 2HCCA 4HKQA 4OZAA 1R9TB 2KMMA 2XNAC 4X3KA 3TP7A 2R92B 1TY2A 4RAUC 4JBWA 3V05A 2JA8B 2ONQA 1DOMA 3QOJA 2FE8A 1SBBB 1GXDC 1EWHA 4K5XA 3IT4B 1Q12A 2ZXPA 2N9KA 3AEFB 5BMIA 2MHVA 1PTOD 5IT9L 5IGBA 2HQEA 1A70A 3S1QB 2BW2A 1QLBB 2YU9B 2CW0D 4KN7C 1EL0A 2L52A 3I70A 4OL7A 4QCLA 1WWTA 1I4QA 3SDZA 1EYCA 4ILWA 4IUTA 3Q8AA 3L9AX 4KMUC 4KD3A 2OF1A 4ZRPA 2O5IC 5CGKA 2WINB 1BUIC 1KLUD 4ARIA 4V0BA 3P20A 3DXJC 1JQ4A 1NUCA 1BNZA 2HDLA 3SK5A 3WOFA 4E6IA 3BDOA 3Q23A 2EJGC 1B9MA 3M7GA 3VA7A 1PXUA 1A3VA 5HI1A 1I6HB 2WNMA 4FO2A 3K59A 4FYDA 1UNSA 3A56A 1X32A 2EXZA 2WDQB 3AE4B 1V1OA 2B2TC 3A55A 1PMRA 3HOWB 3C1EA 4FVMA 2L12A 1L4DB 3A54A 3M4YA 3DWGC 1VZ6A 1Y8PB 4FXDA 3S2HB 4TMAB 5CR3A 5CMDA 2Z4HA 2HCIA 4M8AA 1AWDA 1C9FA 4Q5VA 3FDTA 2M0AA 3WOEA 1LO5D 1I4XA 2WXRA 5E4WC 5JEAJ 1F9SA 2NBFA 3AE9B 3K5OA 5IGDA 2JA7B 1TWFB 3G6JB 1NEKB 2Y5PA 2ICIA 1KABA 2WIIB 4C3JG 4IFDG 2KA7A 5DM63 4IDIA 3VR5A 1YNJC 3OWEB 2F0IA 2OHFA 2IDYA 1A2TA 4OW0A 2WV6D 2E2HB 2A68D 2WACA 4CJ0B 3BK1A 4K8IA 4C3IG 1WYGA 2KQ4X 3J7AF 2LFIA 2QILA 2ICEC 4KV6A 5ELBA 5DNFA 1IW7C 1HXYD 1ICWA 3DEOA 1N62A 2F0GA 4BA2I 2DLBA 2J42A 3HUIA 2WDRB 4N6EB 3AE7B 3Q22A 2RKSA 1C78A 1XTCD 3ND8A 2ZXOA 3NP8A 1IHZA 2LFNA 3AM9A 1F2LA 2V3NA 1GUOA 5EKIA 4CKEA 1BCPD 5I4DA 2G9HD 3GB1A 2I46A 4EGVA 4F7XA 1BDOA 3HOXB 2M9VA 5AUIA 1T3QA 1C79A 2EYHA 3AMZA 5CV6A 3NRZA 3KBXA 5JOBA 2Y0SB 1WTQA 4CKCA 1HZ6A 2ID0A 5COYA 4C56C 3VRBB 1NVID 1HTLD 3SE0A 4XYQA 3U52E 3DM1A 5C4ZA 1J7AA 1A15A 4IOIE 1DGJA 2KJXA 2EY6A 3QG1A 4IFDH 2L55A 4L63B 4EVOA 2B2YC 3S2DB 4XE0A 1E10A 4IFDI 2X69A 1NYRA 2F0QA 3OIPA 1W6JA 3HKZB 2GI9A 4WAFA 1IBXA 3GQBA 1YNNC 3ND9A 4QUFA 1SMYC 4KK7A 1XYIA 5J39A 3NVVA 3NVZA 1BBXC 1Z6HA 3Q8BA 1SJED 4C2MB 3AB5A 1H9SA 4N9TA 2VXWA 3KK7A 4BWGB 1HUNA 1V8CA 1Q90A 1LT6D 2A6HD 4PNYA 1RJTA 4IKGA 5I9OA 1TKGA 1JC7A 4DU9A 4R8NA 1FXIA 4HMJA 1KNEA 2VB2X 3BDLA 2K04A 5CC4A 1SSNA 1PUTA 4L2YA 4BS9A 1E0ZA 1D4BA 3D6CA 1PFBA 2Z4IA 3SHLA 3H09A 1VF5C 1F77A 2F0WA 1IKMA 5E1FA 4DAYA 4Y7NB 3VYRA 1BOSA 1BQQT 2MUYA 5M5WB 1Z7TA 1DCZA 5EPJA 4WRDA 2MEKA 1FFUA 3IKJA 4CHTB 4BY1B 4JWSC 4YSZB 5EE9A 1PRTC 1HFNA 2BYTA 3LB8C 5LL6X 1QF6A 3VQIA 3TZDA 5TSSA 3MWYW 2WKDA 2FJ2A 3BS1A 2E76C 4DNTB 3VYTA 2YYZA 1IGDA 3VYSA 5E3FA 1D1KA 2W3SA 3WDNA 1SE2A 4O42A 2ZT9C 1FM0D 3VR2A 2QEJC 1XO3A 1ET9A 4DXFA 1J7CA 3E6ZX 1SYFA 4KI0A 3HS0C 3WCQA 4I7ZC 2CJOA 3VR8B 3HZXA 3S16B 3D4DA 3HVZA 1S5ED 3VR6A 2OXPA 4TQUS 3DUZA 1EY9A 4OO1H 4KY6A 2MJ3A 3FC4A 3C3LA 3H3VC 3AV8A 3B9JA 5JXVA 1RCVD 1RFKA 3PMFA 1Q1BA 4B9XA 1YN3A 2W54A 3Q6SA 1VR9A 2SDFA 3OWFA 3GTMB 3KUPA 1JROA 3A7LA 4RHSA 1E2WA 3TP6A 3DEPA 3AU7A 3NQIA 4HEA1 3OW7A 2BA1A 4OIJA 3PO2B 4YXDB 3GD7A 1CK1A 3TMEA 1UEAB 1QNUA 1EOTA 2D2CC 2R93B 1C8CA 1HEZE 1ROEA 3A8JE 1AFPA 2F0FA 1V43A 2B2YA 1ET6A 1SYDA 1XCQL 2O5JC 3X3NA 4L1BA 4A3GB 3MZ5A 3VR9B 1ZXHA 4D2KA 3HGBA 2LEKA 4DF7A 1YN5A 2RSOA 4IUVA 2F03A 3TEWA 3J9CA 2F0UA 4IZ8A 1G6ZA 1JB3A 1I6VC 2JXTA 2EKIA 2I38A 2EDGA 4XT3B 1OQQA 4UAIA 1U4LA 3NTKA 5MPOA 4CKBA 2AQ1B 3R2TA 2DNCA 1SF0A 1HPCA 2EYJA 3BVMA 1F2ZA 1STAA 3HOUB 4DK0A 3MXGA 3D4RA 3SFEB 1M8AA 2WU5B 4HCSA 1G2TA 1L5PA 4DXGA 3NTIA 2B8GA 2JYEA 3S1RB 1OQRA 1MGSA 1WRIA 2ZW1A 1FFVA 4DAPA 2OT2A 1SIJA 1QG7A 2V0GA 2J7ZA 2NVXB 2WXFA 4J8QA 3Q0AA 1RD9D 1ILPA 3N9YC 4U68A 2PW9A 2B63B 1HFGA 3NTHA 4RFBA 4RCNA 2F0LA 4WQMA 2L11A 1ZYRC 4OZBA 4XXEA 3C8YA 2DYOA 3AE5B 2B2WA 1ZKOA 3MXPA 3NK9A 1PTOC 4XQQA 3NS1A 3EUB2 3I90A 2FBWB 4N58A 2FMCA 4ZUJA 4PMBA 3BK2A 2WKCA 2INPE 2A74C 1LABA 2E74C 3QB3A 2L5TA 1ZXIA 2B39A 5C4XB 1JQYD 1S5DD 1EY8A 3AH7A 2Y3AA 1BR9A 4HKZE 3C1FA 1YNTE 3NPPA 2HUGA 3SVMA 1HRJA 1C48A 4TQ0A 2VNUD 4A6QA 2F3WA 5C2TB 2EYOA 1TYGB 3BYYB 3EA6A 1HA6A 1ACCA 4ITKA 4DK1A 4FF1A 5C44B 5DAUA 1WTWA 1I4RA 1LACA 5I2XA 3RPFC 3I57A 5BN4A 4A3JB 4EQOA 1GUTA 2QIEB 1I4PA 3TBIB 4NZLB 2EPBA 2N9LA 3RUZA 2N55A 5HG2A 2NMQA 1EZ6A 2N7JA 1LTAD 1SNMA 2K32A 1DXMA 3NXWA 1ZYRD 5ELDA 1FEHA 2KVMA 3R93A 4KKIA 3TDQA 2K7VA 2JA6B 3TP8A 2WS3B 3OSOA 3PO0A 4NP5A 4XDCA 3MFGA 1U4RA 2L1BA 1VJKA 4FXGC 1NYQA 4ZRQA 1IYVA 1JWMD 5C3XA 1XX8A 1IW7D 4V190 5IGFA 2WXKA 3AEEB 1VDVA 3BZDB 1JWAD 2WU2B 2JEAI 2Q8IB 2AWNA 1X3QA 3JAML 2CW0C 4X3SA 3AEDB 2RA4A 1FNUA 3FPUB 1PDQA 1CJEA 2WP9B 4ID6A 4X3TA 3QO2A 1H9SB 3MA2B 4GDKB 2AWOA 3SFDB 4IN3A 5C5LA 3FILA 4KJNA 1K50A 1GJXA 2PNRC 4WIPA 1QOHA 1TY0A 1O78A 2EYPA 1D5ZC 3JAME 5AUKA 1D2BA 1PTOH 1IBXB 1LTRD 4A3FB 3OMGA 5JAVA 2L1AA 3V96A 4C1NK 1XCTL 2D9UA 2RDGA 1EZ8A 1D6EC 3C2PA 4G57A 1TVXA 2SNMA 3ERQA 4A3KB 1L6VA 4I65A 3KWVA 2F0KA 5EKLA 1SXTA 5C3WA 5CYUA 5C0XJ 4ZLTF 3TUOA 2BS4B 1G8ZD 3BG3A 5FOBB 1FRDA 3S14B 4ZYSA 1JOOA 5KEEA 3Q8CA 5T8IA 1W6KA 1FIQA 4TQ1A 3QWNA 2L83A 2RMMA 1BCPF 1JE4A 1VMCA 1BMLC 3LX0A 4NKLA 1XLOA 2K03A 2C5CA 1SFOB 1Q3LA 4IUNA 1I50B 2WB1B 1TIID 3FKIB 2F0MA 5C5MA 3G7LA 1JORA 3NUCA 5CV4A 5BYSA 2IX0A 3KQ4A 2F0VA 3OIQA 1DOIA 1ZDXA 2DY7A 5LNK1 2BT6A 2J0TD 1FCLA 2WDVB 1PTOF 2PZTA 3S1MB 2BCOA 1RWSA 3IAM1 3OPOA 2SEBD 1SJHD 3NBIA 1V97A 2H4OA 1PZJD 3T3NA 3J7AV 3MJ5A 1I3QB 1HUMA 1PGAA 5FK9C 1CZPA 2QKIC 4FF3A 2RVLA 2NVQB 2KWDA 3TEXA 5JEAG 1SE4A 3LXFA 2GB1A 2PCFB 3MC0B 5M5XB 2AUKA 1TKYA 5K5PA 1KAAA 1NSNS 1SE3A 2NTSA 2BB5A 1S5CD 2DNEA 3BYTB 1U4MA 5NUCA 1ENCA 1FNWA 1ENFA 2B2VC 3N6RA 5JJZA 4HSVA 1YMHE 1WCMB 2WXMA 5D3IB 5EBCA 4CGYB 5C3EB 4KKSA 1NENB 2DBYA 2PQEA 3I9V1 3L4PA 3K5MA 1AYFA 2IGHA 2V4DA 2WXHA 1WD0A 1R4PB 3MVVA 2V4IB 1H9RA 2JQRB 5EE0A 3T3OA 1ZE3D 2M2LA 1PLFA 1MSGA 3HEJA 1UWMA 1QWYA 1IUEA 1VZ7A 4K8JA 1CI3M 1KDCA 2AUJD 3I4LA 2X38A 2F0PA 1OO9B 4CBVA 4A9AA 5FO8B 1JWUD 4DN4M 1BCPB 3O13A 1ESFA 1SSOA 1II3A 3DWMA 2E2IB 1VLBA 2J53A 4YTNB 4XDXA 2O2LD 4QUCA 3E5SA 3VA5A 1F2MA 2CQAA 5EE1A 4OHJA 2EELA 1A3TA 1TS5A 3RD4A 3VR4A 1B50A 1LTBD 1MD2D 1QOBA 2B2TA 2PLPA 2XRSD 5M9OA 1HTPA 3L3OC 2BE5C 4RNAA 4IALA 3LNNA 3EQLC 1XF5L 2J52A 4DA2A 4RHRA 4JK1C 3TEZA 4S3SA 1F2YA 3KLSX 5JEAH 1EQVA 1EEFD 1YQ4B 2AQ3B 1NR2A 3PUVA 4XT1B 1AZPA 4RF0A 2F0TA 1WVLA 4FF2A 1KNAA 2I07B 1PYWD 3E56A 3U7ZA 3TN2A 5DEHA 3S15B 4ZHPA 3HP3A 1XLPA 4IURA 1WTPA 3PO3B 1MHHE 2K5QA 3ZJVA 2F0NA 4H7BA 2ENBA 5LL6S 3H8HA 4TRDA 3K0YA 2B2VA 4BBRB 2F3VA 1DZ1A 2EY1A 2R7ZB 1XEEA 1V1PB 2KN4A 4HSPA 3EFXD 5A2QE 1ILQA 5KYLA 3W1SA 1IKLA 2E6XA 3URYA 4YSXB 3NQTA 4A93B 4YT0B 1FXAA 3MHZA 3CHBD 1V8QA 2G9DA 1RTNA 3W9CB 4HTHA 2BE5D 3LWUA 1OFFA 2IT1A 1AEXA 2R3ZA 3AECB 3FRPB 1L0YB 4RF1A 5M5YB 3R2IA 1XLNA 3GTLB 2WXQA 4ARCA 2Z1CA 1PGXA 1Y8NB 1CHPD 5M3FB 3ZJTA 1BCPC 2BDNA 4HAEA 2IGGA 1E6EB 1E7PB 1FO4A 4US9A 2ON8A 1TWCB 1Y1WB 3S9WA 4M1UB 1CQFA 3MP9A 2K0PA 2LHEA 4ZRZA 2NWGA 2OEOA 2NN6H 4KY5A 1Y56A 4MH8A 1V1PA 4F87A 4DQOC 3ETRA 1PZKD 2PZWA 1TJEA 2PIAA 1M4VA 3DWPA 1EY7A 5HGTA 1SB3C 4R3DA 4KKUA 1SDFA 1F0ZA 2JYTA 2QDBA 3D31A 4CQNA 1DM0B 1CTMA 1EQTA 5HFYA 2SNSA 2BBCA 3AMUA 4KX6B 2N88A 2IL8A 2L32A 4ZOHC 1HHVA 2A69D 2NB0A 2Q8RE 4K6DA 3HRDD 2RBMA 1JRPA 1U9RA 4RGTA 3VRAB 3NBHA 1LTID 4REZA 1SEBD 4FP5D 4FXKC 3TSSA 2FMMA 3K6OA 1IL8A 1GUSA 3P4RB 5KNDA 1K83B 4A3EB 2HDEA 3A8KE 5ISRA 1KLGD 5BYRA 2MJ8A 4KGRA 4B0MA 1SNPA 4XQNA 1DJRD 4ZHOA 2RQXA 4IUQA 1KH0A 5I6WA 1SNQA 3AE1B 1O80A 3B2GA 1JOQA 1XLQA 4NMZA 4M0WA 2CVRA 2KEDA 5G5HA 5EPKA 2TMPA 2EJFC 3D4WA 3RFZB 4Z9CB 2J4XA 2IX1A 3HOZB 1EM7A 1LTGD 2Z8LA 1NR4A 1EY4A 3P42A 5G5GA 3R3OA 2FINB 4ODGA 4LK1C 1NCVA 1GHKA 1FD7D 3MHBA 2L4NA 3KF8A 3M7NA 4NDXA 2PVOD 2VUMB 4C3JB 1F2RC 1JALA 2PW5A 3ABVB 3HOVB 1T5XD 3I8ZA 3M85A 2K3UA 4CJ2C 3NSWA 4KHVA 2XRQD 1FD6A 1EYAA 1FYCA 4YTMB 1EEID 3MTSA 2BS3B 2BS2B 3ZYYX 4KY7A 1KRHA 5FR3A 1VRAB 4TKOB 3CRLC 4HROA 1LT3D 2A6ED 3PUYA 5KIXA 4HEDA 1A3UA 1FRRA 5HHDG 1QCBD 4RGOS 1ZDVA 5A35A 1F9PA 3D6WA 2NZ1D 5D3DA 3RLFA 1C77A 2LMCA 4R9WA 3ZQ4A 3VYUA 4A55A 3B2FA 2KEEA 2BB6A 2B2UC 4AS1A 2W82A 4KKTA 1I4GA 4G7ZC 4FXCA 4Q2JA 1HQMC 5J1ZA 2DY8A 5KNBA 4OVZA 1EU4A 3P75A 1AN8A 2XVSA 1WTRA 2B8FA 3PUWA 3A8IE 1TS4A 1QOFA 2JZPA 2WP8J 2QF7A 2B76B 3E9SA 2JX5A 1ESRA 1SMYD 1ZOYB 3R8BA 1HA5A 2EY2A 4XTCS 4MIUA 1T5EA 1FR3A 4MM3B 1EFID 3CWIA 2PYKA 4MT5A 3BDCA 5G3LD 2FFKB 1R4QB 4C7ZA 3P4QB 3I4NB 1Y69U 2FHTA 2RSNA 1QOAA 2A6HC 4ZUIA 2KHSA 3PV0A 2MPMA 4BA1I 3RZDB 3CKIB 1TS3A 4ZAIA 1NAPA 5EGTA 2BA0A 4K5WA 1TR5A 1STBA 5F2DA 5J22A 2JEBI 3EJIA 3KWLA 1RM6C 2JE6I 4USAA 2O4XA 1EU3A 2N0SB 2IJ0A 2VZKD 1QNKA 2QSDA 2EZVA 1YJIA 2JYOA 3J81L 2AX5A 4H44C 2BOSA 5ELCA 3GO5A 1G291 4XDDA 2K01A 2WAQB 5IGEA 2WQYB 4IFDJ 4OZCA 1TKWB 1YQ3B 4OGQC 1UUPA 2NN6I 4XWWA 3GTKB 1PGBA 2H88B 3DWAA 5CV8A 1HZ5A 2M56B 1DD2A 3LYYA 3Q8EA 5CBAE 1DOLA 3N52A 4P6VF 3AE2B 4XYOA 1PRTB 4EQNA 1DOKA 3L7ZC 3MXNA 1VZ8A 1D5XC 1QT9A 5KRUA 3GV6A 3SR6A 3FVQA 2PZUA 4A3IB 2KAJA 2ACZB 1TZOA 3OMCA