1FNVA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
b'QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
total genus 43
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnvA02
1FNWA 3EFXD 4TSSA 1LTSD 1SE2A 1BXTA 1TS3A 1SEBD 1FD7D 1EU4A 2J4XA 2TSSA 3MFGA 4UDUC 4ZYSA 2XRSD 1STEA 1SJED 1CHPD 1F77A 4DXGA 3R2TA 1TS2A 1I4GA 1B44D 1RD9D 2RDHA 1LTTD 3CHBD 1SXTA 1EWCA 3O13A 1LO5D 4RHSA 1LTRD 1PZJD 2SEBD 3R2IA 2XN9C 1T5XD 1TS5A 1PTOH 3OWEB 1ESFA 1BCPF 1EEFD 1AW7A 1PRTB 1KLGD 3MC0B 4L6TB 2IPKD 1JR0D 1PRTD 1PTOB 1FGBD 4BWGB 1GOZA 3DWAA 1PTOD 1JWMD 1V1PB 3DWPA 1FNVA 1DJRD 1L0XB 1I4PA 1TY2A 1HQRD 1S5DD 1G8ZD 2CHBD 2IJ0A 2QEJC 1XXGA 1LTAD 1LLRD 1PZID 4L63B 1CT1D 1I4HA 3R8BA 2QILA 3GP7A 4O1NA 1FNUA 3BVZA 4RHRA 1D5ZC 1YN3A 2RDGA 1JQYD 1KLUD 1UNSA 3SEBA 3BZDB 5D3IB 1L0YB 1PRTC 1LT6D 1UUPA 4RGTA 2WV6D 3BVMA 3KLSX 5ELBA 1PTOC 4RGMA 5FKAC 3TSSA 1CHQD 2XNAC 1ET9A 3URYA 3BVGA 1ET6A 1PRTF 2AQ2B 1V1OA 2XRQD 3EA6A 4Z9CB 4C56C 1MD2D 2R61A 2Z8LA 1S5BD 1PTOF 1TS4A 1CQVA 1RDPD 1S5FD 1SBBB 1JCKB 1B1ZA 1I4XA 2AQ1B 1LTBD 1D5XC 1QILA 4RGNA 1SE4A 1BCPB 1YN5A 1RCVD 4RH6A 1PYWD 1YN4A 1BCPD 1SJHD 1AN8A 4OHJA 1CK1A 1LT4D 4DXFA 1I4RA 1DYQA 3V05A 1D5MC 1D6EC 4RFBA 1XTCD 4RGOS 2NTTA 2G9HD 5TSSA 1ENFA 1HA5A 1PZKD 1EEID 1JWSD 1V1PA 3W2DA 1JWUD 3BYYB 4RCOA 1LT5D 1EU3A 4K6LA 5FK9C 5I4DA 2O2LD 1EFID 5ELEA 1TY0A 1BCPC 1KTKA 1HTLD 4NZLB 1I4QA 3DWQA 2ICIA 1HXYD 5D3DA 2NTSA 5ELCA 1M4VA 3BYTB 5ELDA 5ELFA 1LT3D 1LTGD 1S5ED 1SE3A 1LTID 1S5CD 1RF2D 2AQ3B
chains in the Genus database with same CATH superfamily
4LW1A 3PS6A 2CQAA 4TSSA 1G6ZA 3NVZA 1OQRA 1KDBA 1E24A 1FJGQ 3L7ZC 4LF6L 1MIUA 4DV3L 1F77A 1WH3A 5C0XG 3R2TA 3GTKH 2LXJA 4HPLB 1HZBA 1H9JA 1O7YA 2C9OA 3SD5A 4HCSA 4HR7B 4K7UA 2Q8IB 2EYJA 1EY0A 1SXTA 3O13A 1VQJA 2Z6BA 4XC2A 4ZDVA 1C1YB 4RF0A 5J39A 2MP1A 4IUMB 3BDLA 5FLXc 2G4SA 4JW0A 4CQNA 2X6LA 4A20A 2J7ZA 3M7GA 1KABA 2VUMB 4XZ4A 1PTOB 2L0FA 3BJUA 3KLWA 3CXCA 1VZ8A 2AYOB 2QHOA 1M1KC 4YSYB 5D6JB 5IP9H 3VDYA 1FNVA 4APVA 1MG8A 4X3UA 3T9LA 1I4PA 4B3ML 4YWGG 1W6JA 4DR7Q 3DEPA 2KENA 3HOWH 3QAQA 1NR4A 2JA9A 2KMCA 4ME3A 4IQZA 3L2PA 3KUZA 3D4DA 2KVRA 2K32A 3S1RH 1YNTE 2YU9B 3H15A 1AWDA 1SLJA 1YBYA 3NVWA 3IXSA 2HHHL 1GM5A 2QIEB 3PIP3 2B8FA 3CCEA 3LJ3A 3L54A 4B6WA 3VRBB 5EPJA 1U5KA 1H9SA 2K5HA 3J7A5 2Y5BB 4BBSG 2N9KA 2JQOA 3DBRB 1LT6D 3J81c 4DA2A 4HVBA 2WAQE 2IO3B 5M3MB 1PVOA 1VQLA 3EFUA 4I6NB 1E10A 1CMXB 4IUVA 2EXZA 4N8FA 3V60A 4A3LG 2BE5D 3DUZA 2AUKA 3MZ5A 1P7EA 1F2LA 4B3RQ 4GDKA 3WAPA 1TS4A 2WU2B 4BAXA 4URKA 1B1ZA 3PUWA 4JPBW 3OJ4B 1GHKA 4WURA 4TKNA 3WIMA 5J1ZA 2JRHA 4A3DH 2Z6KC 5E4XA 1V81A 2F3VA 4S17A 4DV2L 4FJVB 5F2DA 1U4RA 2B76B 2ZZPB 3VUXA 1J0GA 1YJ1A 5E4WC 2KTRA 2JYOA 1CA6A 4IW0A 1WXVA 1LABA 4LFBQ 4KI0A 4DR2Q 1YJ9A 1WGRA 3DWGC 1I3QH 1RM6C 4B9XA 5LHY1 1V5OA 2BF8B 3AEEB 2PZUA 4JC0A 2FCQA 2CVRA 4JI3L 1MHWC 4K6LA 3EGRA 2LWPA 3QX1A 4JCVE 2KOLA 2EKEC 4MH8A 1KOTA 3STBC 3M3YH 2K52A 3VA7A 3K5NA 1WRIA 4K5XA 2CWPA 1Y1WH 3GTOB 1A8VA 5M3MG 5DPSA 2INDC 3OAWA 2MHVA 2KHJA 5IWAQ 1NMGA 3V3XA 4MJSB 3AQQA 2A8VA 4J6IA 2XK5A 1PXUA 2PNRC 1Y8RC 3B9JA 2NVXB 1L1OB 1X3PA 4AH6A 4EZLA 2KCCA 4ZRZA 1G6JA 4C7YA 3NPPA 3CMAA 2PQAA 3APDA 2JA7G 1TS3A 1E22A 3SK4A 5FR6A 1RYJA 3ZDMC 4H2AA 4JV5Q 1Z7TA 3WAMA 4JBWA 3TMEA 1IHZA 4MTKA 2DYBA 3KWVA 1E2ZA 2KEDA 1IYJB 5EE1A 1X65A 1F2RI 2LVPA 3TP5A 5D14A 3T3OA 2V4IB 2HDLA 2ATWA 1DOLA 1FYCA 4JI5Q 5KNBA 1EIHA 4ZCKA 3P7JA 4YXDB 1PZJD 1DM0B 3I4MH 1WGGA 1HTOA 1HUMA 2WFWA 4JI2L 4JI8Q 3K58A 4O2DA 4JI4Q 4MZ9A 2BT6A 2L7RA 3A0JA 4DN4M 3AYHB 4BS9A 3CC2A 1Q7YC 1EUVB 1WCMB 2UUCQ 2GOWA 1QOHA 3ONSA 1V9PA 2HQLA 3H7PA 1UAPA 2KXJA 2UXCL 2NMQA 3NBIA 1Q1EA 5EPLA 3HOUH 5E7NA 4USAA 1DJRD 1TY2A 1IW7D 3I3CA 3J80L 4MH0E 3MTSA 1OTCA 4JOIC 2M17A 3OW7A 2MA9B 1CT1D 5JEAH 3ZQ4A 3GV6A 3Q22A 3A1QB 4QUFA 5BN3A 3ZJYC 1V80A 1FEHA 2INCC 2I46A 4WORA 4C2MH 4DV7L 3PHWB 5GROA 4N59A 2DNFA 3RZOB 3BDOA 4A3GG 3R7RA 3RR5A 4WJ3M 3KF8A 2D11A 1KJTA 3AMUA 3W5UB 1CFMA 1D7QA 3OPOA 3JAMc 2LVQA 3I5JC 1CHQD 1Q5WB 1N33Q 4MGKE 3HVZA 1WXSA 2AQ2B 2ZXOA 3S1MB 1NYRA 5EDSA 2NUCA 3Q8EA 4C00A 1JRUA 3W1BA 2ZJQA 1I6HB 1P7FA 2KJ6A 5JJLA 4WJOA 1YNXA 3TQYA 4DHZB 1K8RB 2EYHA 2IT1A 2DHZA 1L6UA 3NSWA 5BMIA 4R4OA 1XLNA 4EX5A 1WGHA 3HHMA 4P1BC 4RM8A 4DU9A 2JA8B 1SE4A 3TDQA 1SIFA 4M0WB 2NWGA 3ZJVA 2K5NA 1BUVT 5G5HA 1Z2MA 2R3ZA 3RD2A 1H9SB 2ZVOA 4E74A 3RI7C 1GUOA 1I4RA 2W82A 4R3DA 1WMHB 3CRLC 2I38A 1XCQL 4RFBA 1XTCD 3CCJA 3MWYW 1D2BA 1QF6A 5EE3A 4OVUA 2HJ1A 2WWZA 2E5LQ 2D3GA 2A1AA 4UHVA 2CJOA 5KNDA 5GAHC 2LXCA 2QJLA 2LUEA 3M85A 1E1OA 3I4NG 4A3KH 1K52A 4GDKB 5H8YE 4B95A 2RSNA 4B3SQ 4LTUA 4OWWB 2VQEL 2C7NB 4ANWA 4MHEA 5ELEA 2JRIB 1F0ZA 1ROEA 3FKIB 1V43A 5LLIA 4F1SA 3S2HH 4FXDA 2F3WA 1HR0Q 2Q2HA 2Z6KA 4IOIE 4A55A 1HXYD 3RZWC 2KQ7A 2KTRB 3EHVA 4GOPA 2KJHB 3P42A 4W9DA 4DR3L 4POGA 2N7JA 3OIPA 4WH4A 2GA4B 4ZRQA 1L2NA 4BXXG 4KY7A 2BA1A 1WX7A 4RF1A 1TWGB 1J5EL 2JA8G 1U4MA 4YWLA 1J6QA 4HRSA 3MAQA 1IBLL 5JJZA 2BYEA 5C23A 2L9HA 5JAVA 1SJED 3N3KB 4PK1A 4BBRG 2L0TA 3MVVA 2F0FA 4G57A 3IL8A 2PJHA 3ZTCA 4BOZB 1I4GA 3GOEA 5KEEA 2IY5B 1CKNA 4XGAB 3MJWA 4HJ7A 4QL5A 3TRZA 4LF7Q 3A9KA 3JVZX 4RCNA 5FR3A 5IGCA 4IPHA 3TP6A 2MH7A 2Q2TA 3M3YB 2MP2B 3AB5A 4CKCA 1DOMA 2TMPA 4HJGE 3TCAA 1FL0A 1T0QC 4IWQA 2NN6G 4PMCA 2C60A 2KD0A 1R4NB 1OEYJ 3DM1A 4C80A 3NS8A 4A3BH 3FKIG 4RNAA 3L9AX 1OXSC 4BWGB 3VR5A 4EQ5A 4QQBX 1JC7A 3NEMA 4RAUC 5I9OA 4JVZA 3VA5A 1E2VA 2WB1B 3DXJC 5FO7B 2QEJC 4A3FH 1TWAH 5CR3A 2X6GA 1A6XA 1UGMA 1B9NA 1QZGA 4LF8Q 3L16A 5H1SE 4HIKA 1QZEA 4GDLA 1U0LA 2K7VA 4LF9L 3J7AV 4F87A 3RZDH 2JN4A 1EF5A 4L23A 2REXA 1HNZQ 4BBNC 2ASQA 3RLNA 3EBEA 1B53A 4FP5D 2DY8A 4FO2A 3NBHA 4A93H 2K6AA 2DLBA 1W3SA 2QA4A 2PE6B 1XLOA 2R92B 5J22A 4DV0L 4OL7A 4RGMA 3CF5A 4DWFA 1WF9A 2KVZA 3ZO5B 2H4OA 1C4CA 3TZUA 1XPOA 1MHXA 3GTQB 2JZZA 1W6KA 1X54A 3EN2A 1PRTF 4X65Q 2KWVB 2FMCA 1K3BC 3QB3A 1MD2D 4KN7C 4IG7B 1XF5L 1Y14B 2RGFA 3N30A 1X1MA 4PZ7A 1S5FD 2JSVX 1SBBB 3HM3A 1ASYA 1PUTA 1GUGA 4KVGB 5JOBA 3CPWA 3Q8BA 2CWAA 1IL8A 1BCPB 2UUBL 2KC1A 4YT0B 2EIFA 1K0RA 3NZ3A 1NY4A 2L1BA 2WB1G 3MEFA 3ZUNA 5C4XH 3V05A 2MEKA 4X64Q 1H4RA 4FJYA 1D5MC 1D6EC 2KTFA 2WXFA 2HDEA 2MLBA 3DLLA 3ICEA 4BBNF 2KA7A 3UIOB 3I90A 4HEDA 1HUNA 1M94A 3OTOL 1WJJA 3I4OA 2JWUA 3L17A 2DZJA 2LASA 3PO0A 4FADA 2CFMA 2MRPA 4JQWC 4FXCA 4ME5A 2OJWA 1IL2A 2HIVA 2R2QA 5HGQA 4YWMA 4JG2A 1K9MC 2R92G 4OVZA 1E0BA 2EMSA 2XWJB 4WWPA 4LNKA 2F0JA 3NWSA 3KF6A 2IZVB 2UXDQ 1YNND 2YLMA 1LFDA 4Q5VA 2E2IH 3LYYA 5M5XH 2QW7A 2LMCA 2K50A 2QC8A 1KLVA 1E7ZA 1VQOA 2QCPX 2LS01 4YIJA 3PIOA 2IWHA 1JMCA 3F2UA 1WJ6A 5EPKA 2BPSA 3HOXH 4DBGA 1EOTA 1EZ8A 2OQ0A 1SE2A 2KNBA 2F0WA 2C9WB 5FO9B 5EE9A 3IVFA 3LWEA 5M3FG 3ER0A 2I5MX 1STYA 3TL5A 4DXGA 3DBHI 4HMIA 1KDAA 2OEOA 3A8KE 4IUQA 4YCWA 3AEGB 3L08A 3PZ8A 1L2FA 1QJOA 4K3BA 2OCEA 1QVFA 1FRRA 1MJDA 2FIDA 2A5HA 2DYOA 3FMCA 4KMUC 1ACCA 1EWCA 4WJPA 1VDVA 3HK0A 2QSDA 2DUDA 1HCZA 2JEAI 3T51B 3B0AA 3AE8B 2KFJA 3AXCA 1IGCA 1TS5A 1A3TA 4IJLA 4YHHL 1Y8NB 4NDXA 2ZJRA 3ZXVA 1TWFB 5DM73 3MC0B 3HKZB 4RKLA 2ZCCA 5JXVA 2NVTH 1WFQA 1PRTD 2ON8A 2BS4B 2L1AA 3G71A 2ZM6Q 3MC8A 4HPMB 4P72A 1B4OA 5JPNC 3VR3A 4A3MB 2ASBA 2HJ8A 4IM3A 4J1MA 2KN5A 5J18A 1WZ3A 1TIFA 3W3AA 4DGZA 4JI6Q 2JA5B 3Q3OC 4PV1C 4YY3L 3ZKJC 3MHZA 1PMRA 4GN4B 4E6IA 2K22A 2C7HA 4AWJA 4CO7A 1SGHA 4OW0A 1T9HA 1NR2A 4BKTA 2N9LA 2I07B 4KKSA 1YQBA 1UNSA 4DV6Q 2HDMA 4FLHA 5D3IB 2O5JC 3SFEB 1L0YB 4ITKA 4DV4Q 1ZUD2 1K51A 4IWPA 1OGWA 1TGZB 4NQLB 2X69A 1KDCA 5IOCA 4DV5Q 1HZ6A 3I70A 4NAMA 2NPTA 3X3MA 5LMUL 2B63B 1T6BX 1LQBA 1VQ7A 1C4PA 2IO2B 2A6HD 4LF4L 2F4IA 1IBXB 4PZ6A 1WR6E 2MHJA 3HOYG 5C3JB 4NY0A 1PTOF 2LJ5A 1YX6B 3DBSA 1JCKB 4JI1L 2L83A 5C0XH 5C1ZA 4A3IH 1B7YB 1HHVA 2B8GA 2IGDA 4W9IA 2A19A 3R3MA 1A2TA 4DR5L 1Q3LA 1XO3A 4TQUS 3IKJA 4R1JA 3DVGX 1WYDA 2W3SA 4KV2A 4A3EB 3S15B 2XVSA 4S0RA 3H8HA 3Q3NC 2Z0EB 3U30A 2JA5G 2K33A 4LUOA 1OTRB 2IYDB 1XPRA 1B2TA 1PZKD 2GBNA 1FXIA 3S2DH 3BYYB 2O6VA 1GJZA 1JJCB 4OX9L 3NUHB 4A76A 1MHHE 5DNFA 2EY1A 1V5TA 2KX0A 1K83H 4G50A 3IAS1 4AJYB 3PVLA 3FEWX 2IHFA 2KLGA 2M0XA 3R93A 3CSFA 5G5GA 3ZVVA 2VQFL 2Y5CA 4LDTD 3KW5B 4DR4L 3PO2G 2B63G 4G0NB 3L0OA 1N36L 3DBLI 3KJPA 4DAPA 1L1OC 1M4VA 2KJXA 5FLXE 2KHWB 3NRZA 3TMPB 2BW2A 3KUDB 1MSGA 4JX1C 4BBSH 3JW0X 4C4VA 5DLQE 3O65B 1FNWA 2XGTA 1LXDA 4YWKA 4UDUC 4L5RC 4GKKQ 1SMXA 4C3IB 1BOSA 5AJ3Q 1G91A 5JJIA 2I2YA 1XJVA 4GNXB 1CHPD 3EROA 3PLUA 4A3LH 3PMFA 2P5ZX 3A7AB 2ZW1A 3H0GB 2QDLA 5GAGC 3K57A 4A3EG 4FF3A 2LHEA 3NQIA 2XIWA 4EZKA 2K1FA 2VNUD 2CU1A 1UF0A 2WYQA 3MXNA 2R93G 2BYVE 1QOFA 2LMCB 2O2VB 1WE6A 1F2ZA 4KKJA 1EUJA 2VUMH 1PTOH 4B9WA 4KGTA 3ZIMA 4ILWA 4ODGA 4B3TL 4KHPQ 2F4VQ 5EE0A 4X62Q 2OEDA 3A54A 1B3QA 1GOZA 4DUZL 4PS7A 1XLPA 1PTOD 3D31A 5L95C 3RNEC 2BH8A 3FAHA 1N5XA 2MX2A 5HI1A 4EE2A 2ES2A 2AL3A 3S1NB 2YU9H 2QKIC 2KFKB 4WIPA 2KDFB 1PZID 4JI0L 2PVGC 4L63B 4UP8A 4XDDA 4BZAA 1CQFA 2D0PA 3HUIA 2KMMA 1EM7A 1R7SA 3BVZA 4JYAQ 2WLBA 3AU4A 2LVOA 2LXAA 2A73B 1VQNA 5IT9E 2E2DC 1Q90A 1RFAA 5DEHA 5M3MH 3WA0A 3X0WA 4K7WA 1H95A 4LNIA 1QQRA 4L5SA 1L5PA 3I63C 4A3JB 2L5TA 1VZ6A 1PH9A 2DGYA 1WVLA 2K05A 4ULLA 2FE8A 2PPBC 4A6QA 3NZSA 1ET6A 4YTPB 4IZ8A 3L4PA 2D62A 3UDIA 4US8A 2FCSA 1TT5B 4BKSA 1C9FA 3V96A 1P1AA 3UQBA 2AQ1B 1PH8A 1RTNA 4NP5A 3ND9A 3IT6B 3D6WA 4XX5A 3R66C 2JX5A 2A74C 4FHKA 5BN4A 3I9V1 5CX3A 4DUYQ 4I6LB 3N6RA 5LMNL 4LFAL 4M01A 2E74C 3H94A 2YEPB 1Q86C 3B2GA 3M3JA 1VMPA 1XT9B 1ILPA 4JI7L 1G6PA 1EFWA 1E2WA 2Z4IA 1E7VA 2BE5C 2NPTB 4KY5A 4GKJL 4ID6A 4DQOC 3GTPB 4HK2A 1FCLA 3T8MA 2ENBA 1EQRA 4HCEA 2MJ8A 1JWSD 4CHTB 1YJIA 3BWUD 3UGBB 1H8CA 1BT0A 2WIIB 1PYSB 4OGQC 3GTOH 3ZNHB 2WDVB 1B8AA 3SXHA 2N7DA 4A75A 2K0PA 4IKGA 2EOTA 1XNRL 3PZDA 5FLMH 3C8YA 1I94Q 4A3JG 1HTLD 2OWOA 1A5RA 4DR6Q 1NBFC 4AUQC 3U7ZA 4JIOU 3P1MA 2DN8A 2NVXH 4FA6A 3VXWA 5CV6A 2K8CA 4C3JB 2F0DA 3BYTB 2WXOA 4LNFA 3NENA 2JZPA 1XNQQ 2LGDA 2GMIC 2E2HB 2BYTA 2VS1A 2WB1E 1ZXHA 1QKZA 2N88A 2OHFA 4K6DA 1ZKOA 4BY1B 1UE6A 1GUSA 1VQHA 4ARIA 2FNJB 5M9OA 3RYTA 3P4RB 1HTPA 2BVCA 3UDFA 5DPWA 2KOXA 1EWYC 4PYZA 5IP7G 2KWUB 4ACFA 5CV8A 1ZXIA 1WX8A 3MFYA 4AQYQ 3QK0A 2JYTA 1WTXA 1BVSA 4RHSA 4R4TA 3CCSA 1EY6A 1FJGL 2ONQA 2NS5A 1WCMH 2QGQA 2LZ6A 4I7ZC 3ZDTA 1VQ6A 1AE2A 2B2YC 4QUCA 2RSOA 3CPFA 1EEFD 3JAME 2RPVA 4KDLB 3U7DA 2IPKD 1SNDA 1ENAA 5GADC 1PHJA 5KHQA 4PNYA 2WACA 1C76A 2PEAA 3Q0AA 3NZUA 4PG3A 3TBLD 2CJNA 3HOZB 4H13C 2K01A 4KHVA 4EVOA 1K8AC 4BBSB 5E6JA 1JOQA 1LTAD 1PLFA 3RNCC 2KHIA 4C3JG 5JJKA 2EJGC 2VZAA 4DPGA 3K7UC 1HNWQ 2DYMA 1RWSA 3CMEA 3KUCB 5KNCA 3CCQA 4HLEA 3RZOH 4KD4A 2WDRB 2LFNA 3RLOA 1SNOA 2VW9A 1WZ0A 3PRZA 4DHJB 1BMLC 4BY1G 4YTNB 4GXBA 1L4ZB 4DR7L 2AWOA 2ZJDA 4WRDA 1U4PA 1SYEA 4MTNA 3ND8A 4JK1C 2B2VA 1UUPA 1TZOA 5ELBA 2EQSA 2F0NA 3GTMB 2IBIB 3S1MH 2LGIA 3RCZA 1CTMA 1OXUA 1I6HH 1GVPA 1IW7C 4HJAA 3Q8CA 3SK8A 2J0KA 3OJ3A 1EIFA 3RMKC 4ANXA 3NVYA 2Q8TA 3TEWA 5I6YA 1WTPA 4FF1A 2R61A 3VR8B 3NG0A 2JA8H 2WX1A 1BUIC 3DBRI 2ZVNA 3ABVB 4DV1Q 3RT3B 2V1YA 2V3NA 2EELA 3AE7B 2M00A 4HJ8A 3T4AC 3KH0A 4HWIB 1STBA 1WM2A 2RKSA 3PREA 4AQ7A 4KKUA 4DV3Q 1AN8A 3NXWA 3PUZA 3QJZA 1WTHA 1YOVB 4L1BA 3A4SC 4B3RL 3QG1A 3HOZG 2WDTB 2ICEC 2UUAQ 3QHTA 5BYRA 4F7XA 2NVYB 2N55A 4GS3A 1E8ZA 2G9HD 3ECIA 3M4QA 2H88B 2J0JA 1HEZE 1HA5A 4NQKE 4ZRKA 2C5LC 2WP8J 2LUMA 3FKIH 2MFIA 3RUZA 2BS3B 4LFBL 4IO9A 4DR2L 1YJNA 5DCNA 4P6VF 4Q0FA 2JZ3B 2JA7B 1KF6B 4W9JA 5CMDA 1MJEA 3Q3MC 1KL9A 3HKZE 1BBUA 1SNMA 2B2WC 3VYTA 1HFGA 4B3MQ 3J81L 2N78A 2NTSA 5ELCA 4LNOA 1TU2B 1ICWA 4JBMA 3E9IA 1TWGH 5ELFA 5IT9c 2QDFA 4GU2A 2PI2E 1V97A 1SSOA 4KGRA 1XMQQ 2K8BA 1QOGA 3S24A 5HGTA 2L32A 2KQ4X 2RQXA 1CUKA 3PO3B 2XBBC 3K59A 4ANVA 3C0RB 2HUGA 1ZDVA 4ZRIA 4MIUA 3AB9A 4ZYSA 1O78A 1QNKA 5E6NA 2D3BA 1EO6A 4W9EA 5IN7A 5JHAA 2EY5A 3ZXRA 1STHA 3D6CA 1H9KA 4HIOA 2VB3X 1A15A 2FHTA 5G55A 4GMVA 1LO5D 4PS3A 3DEOA 1QUQA 2KK8A 2JJQA 2DY7A 3NTKA 2Z59B 4ZKCB 1SMYD 3JC66 4DF7A 2EYMA 2HT1A 2B2TC 3TS2A 1SNPA 4FJZA 1K0SA 3U4VA 4KIKA 2EJFC 4IFDI 1S40A 3ZLZA 5IP4D 3VQIA 5IGBA 3QJYA 1QB5D 1I6VC 1HTQA 1EOVA 1F9PA 4FVMA 4DV2Q 4B9KA 1DZ1A 2PZWA 4IFDJ 1WIAA 1D4BA 1V1PB 1J7BA 2K14A 3FRPB 1UE5A 1VQFA 2QDBA 4A3GB 2L0CA 2LKVA 4JI8L 4JI4L 2ZEQA 3VHTC 1R4QB 5E3FA 4WAAA 2EYLA 3M4OB 1R4PB 4P73A 2NVQB 1D3ZA 2QILA 2UUCL 1Q8KA 1FNUA 1E1TA 3AE3B 2KECA 2RHSB 2EPBA 2NZOA 1XPUA 2R92H 3PO3G 3W1SA 4J8QA 5MPOA 3NTIA 3SDZA 2AWTA 4E71A 4QMGA 1GC6A 1Q1BA 3AEVA 3GTQH 2XSCA 2JA6G 2KAJA 2AL6A 3TSSA 4C3HB 1WRDB 2K3UA 1AARA 1L6VA 2K4KA 1I42A 2DNEA 5EKLA 1OEYA 5ELNA 2INNE 3DCGA 1V8CA 3MHSD 3K0XA 3A9JA 5H92C 5AUKA 4W9KA 5BYSA 4MM3A 4F88A 3TEHB 3KJOA 4IM2A 1TWHB 3B6YA 4CDEC 2DX5B 1H9RA 4GOCA 3TEXA 3MTNB 3SR6A 3GV3A 1BR9A 4E3CA 1JWAD 1NI2A 1BCPD 1R4MI 5JH5C 2M0AA 1SROA 3I4NB 1DOXA 1WTWA 2VH2A 2VRRB 3CCMA 4CKEA 2JP1A 4QY7A 3AE6B 1O80A 3WWVA 5C3WA 4K8JA 5K36G 1IGDA 1S3OA 2R7FA 1X56A 1N34Q 2ALYB 1CI3M 1B9MA 3BZCA 3PF4A 5CV4A 5CV9A 2BWES 4KZ0A 1Y56A 1SNQA 1XMOQ 1QT9A 3KBGA 1VD2A 4JI2Q 3QC8B 3K5LA 1A70A 2UU9Q 1VR9A 4YCUA 1C48A 5A2QE 5CHWA 1UE1A 4XTCS 4DK0A 3FC4A 3VUYA 2E5LL 4C3HG 3GTLB 1ZDXA 1SF0A 2PNHA 4WAFA 2BCOA 5C4ZA 5IAAC 3JAML 4BBRB 1CZPA 4WJNA 4B3SL 4OELB 3ERQA 3NWTA 1KFYB 2HTME 2LGXA 1S5CD 5KIXA 1A0IA 4NPSA 5EKIA 4N58A 3FP9A 1I5FA 3AULA 1IYFA 3GO5A 1F9JA 1QCBD 3W2DA 1EU4A 3M4PA 4DV7Q 1HR0L 3QOLA 2XRSD 2DBYA 3VTVA 4ARCA 5IIFA 4HN7A 1IBKQ 1VQEA 2CW0D 5NUCA 5M5WB 1B44D 1CM9A 2BB5A 1YNNC 5GQOA 3AH7A 4W9HA 2B3GA 1N62A 3EECA 1C9OA 1DGSA 2JXMB 3HKSA 4F8CB 1L0VB 4OZAA 5EBDA 1LTRD 1TWFH 2B2WA 4IUUA 2X38A 4XE0A 4AJWA 3CCVA 1GAQB 5LL6S 2FXQA 1AFPA 1KRSA 1B3AA 1HQMC 1UEAB 4XYQA 1WTVA 3N1YC 3W9CB 4A9AA 4A3MH 1JE5A 1FGBD 1IKLA 3J80i 2R7ZB 4LF7L 2JA5H 2RSUA 2F3IA 4BA2I 1JWBD 5BR8L 2Q5WD 4X3TA 2R2OA 4AYBB 3RNUA 2F0KA 1IYUA 3PTFC 1LLRD 4K2LA 4PT5A 1EYGA 3VAWA 1LM0A 3IAYA 3ML9A 4KY6A 2IX1A 2J42A 2YTXA 2RDGA 5CV7A 2F0SA 1FGUA 1KH0A 1HH2P 4KIKB 2XK5B 2VQEQ 1HZAA 1SYDA 1JOOA 3CU7A 4MEMA 1PRTC 4WWOA 4BOSC 1GUAB 1SSNA 3FPUB 2B63H 2GVBA 4ANUA 1G51A 2D9UA 3QARA 2MWSB 2PQAB 2RR9A 2XNAC 3AEBB 4CYEA 4DDGD 1HNZL 3F8TA 1YIJA 1WE7A 1S4ZA 4FXKC 3E56A 4FN2A 2LXKA 4OONA 3CQZB 2JF5A 4C7ZA 2NYZD 3HZXA 5BYQA 3VYRA 1E9MA 2LHDA 3M63B 4LJPB 4IUNA 1RDPD 2ZTCA 4KKIA 1SE9A 3K6OA 2FAZA 2ZPNA 3UF8A 4HSVA 2PE9A 3UE0A 4X66Q 3WDNA 4A3EH 2R7ZG 5FO8B 4X65L 3S15H 4MNOA 1FR3A 4OHJA 1WJNA 2PO4A 4KJOA 1WXMA 4PQXA 4PS8A 1LT4D 4DXFA 4A3OA 1RL2A 4AYBG 3TP8A 3I8ZA 4ZHOA 3C46A 3E0JA 1UWVA 1YHBA 1VJKA 3K0YA 3N32A 2A6HC 4W9FA 4OO1H 3H7PB 3E0EA 2YTVA 3V6CB 3M95A 3MXGA 4A8XC 2FJ2A 4R4CA 5FJ8G 4IC7B 2MJEA 3A9JB 4QAYA 4X64L 1TWCB 1TY0A 5JEAJ 4M8AA 4JOIA 2GRIA 5HKHA 2WX0A 1WM3A 2ZPYA 1O7LA 2KQ3A 4S3SA 2AEHA 3SU8X 3MXPA 2NZ1D 1TR5A 1STAA 3CC7A 5M3FB 1WXQA 1T0RC 1YNJD 1EQTA 1S5ED 4OIKA 5HURA 3KF8B 3H7SA 1WOCA 2F0MA 4C3IH 2JPHA 4J6HA 2SEBD 2KWCA 3HFZB 4WQOB 4GB9A 2CH4W 4WWNA 2YEPF 1P8LA 2RA4A 1IBMQ 4G7OC 1NYQA 2L00B 3Q3JA 4XYCA 3H0GH 3I73A 3T1YQ 2M19A 5AZFA 4FBJB 4YSXB 2RCFA 2HD3A 2EMTA 3EJIA 2IY0B 3BZKA 4CDDC 3PIPA 3DVNU 1RD9D 4F8MA 4K2KA 5AZHA 3RN9C 2DZKA 3AE2B 1TKYA 1LTLA 1KHIA 3WOEA 3I56A 1RLFA 3QO2A 4XXEA 3BS1A 3S14B 3M7NA 3N52A 2D3CA 3L13A 2KDIA 1K8MA 4DAYA 1KM7A 4K3CA 1I35A 2L11A 1Y1VB 3TBIB 2W55A 3NOBA 1P16A 2BQQA 5CTRC 4IPCA 1II3A 3JSVA 2BWFA 2UUBQ 1L7YA 3RPFC 1MVKA 1FIQA 3S1NH 4WWMA 4M8MA 1MG4A 3T53B 3QR8A 2NBUA 1PDXA 1L0XB 4DNIA 4CGYB 1E6EB 5IYDG 3K9PB 1TJEA 1JW9D 3VH3B 3I4MG 4JL9A 4N8X1 3OTOQ 3GP7A 1MFWA 2LFIA 2NR2A 1VQ9A 4P71A 2BH2A 3AECB 2ZM6L 2ZJPA 4A3JH 2K9XA 2ZXPA 3HOYB 3SEBA 3CD6A 3BZDB 4GOPB 3AEDB 4EUTA 5DAUA 4JI6L 2K28A 4RGTA 3BVMA 1JT8A 5IYCG 1PTOC 3B2FA 2JQRB 4NXMQ 1LYLA 4ALPA 5IYBG 3URYA 4P16A 1VRAB 2IO1B 3QA8A 5AEKB 4BY7B 1GD7A 4Z9CB 5JEAG 1ZGUB 2MJDA 4M00A 4PYUA 4KTAA 3LB8C 4DV4L 2JK8A 3Q24A 1Y1VG 1Q82C 4CBVA 1PH4A 4II2B 3FVQA 1CKNB 2LSSA 4DV5L 3C3LA 3PHXB 3IFWB 4XQNA 5IP7H 4KGSA 3A9KB 4W9CA 1SN8A 1J9OA 4WJ4A 2EE1A 4KN4C 2LY7A 1AZPA 4NKLA 1RAXA 1UGJA 4YSZB 2M8SA 2OJRA 1VQ5A 3GTPH 2F0EA 2UWQA 2UXBQ 2V4LA 5I9PA 3DBHB 4HDOA 1I50B 1WX9A 1JE4A 2E8GA 5I2XA 2MQHA 4XWWA 2K5DA 3CF6E 2E6XA 2KDMA 2NZHA 5IO9A 3PO2B 1KRHA 2INPE 3AV8A 2H1EA 2N49A 4IJHA 4GN3B 1VQBA 4YHHQ 1EU3A 4GN1A 3OG5A 2L52A 1YX5B 4NAWA 5C44B 1Y69U 4BKGA 4LF5Q 2K6QA 3FILA 4GSWA 3ZGZA 5IOIA 4GDLB 1ICFB 4L5TA 3APCA 1PFNA 2D5GA 4H44C 4I7AA 4C3JH 3DWQA 2AMCB 1TQOA 3W1GA 1ML0D 3IRBA 5HG2A 2E2HH 1JJGA 1DXMA 3NBHB 4BY7G 2K8HA 5ELDA 2HQEA 2IY1B 4YY3Q 1T3QA 1LTID 3QIJA 4BY1H 4LK1C 4R9WA 4A3KG 3C19A 2EJMA 1N5WA 4M02A 3GB1A 3MP9A 1B9RA 3A7LA 1NNXA 3DHGC 4REZA 4ZYNA 2MBHA 3H3VH 2R93B 3G48A 3DOWA 2CQOA 2KO3A 1SB3C 1IYVA 2K03A 2A5UA 3T1HL 2LRUA 4HDQA 2Z4HA 3DM3A 3SR1A 4ZHPA 2A6ED 1S72A 2BKRB 4HSPA 4NJ7A 5LMUQ 3SK6A 4TKOB 1KAAA 4XT3B 2AKWB 4GKKL 1FD6A 1MI0A 3R2IA 3SHLA 5AJ3L 2MO0A 2X8XX 5BN5A 1FM0D 3SHQA 2SNSA 1A3VA 3RD4A 3H91A 1AW7A 1YITA 2KWDA 1JALA 1STGA 1IZ6A 5C44G 1J19A 1OFFA 2WXKA 3D32A 3E9SA 3HOZH 3Q69A 3S9WA 1PH1A 1QLBB 3DWAA 3MJ5A 4DR5Q 1EQQA 1ZEQX 1K3RA 1VQGA 4FDBA 3DWPA 3CWIA 2L76A 1E7UA 3QWZB 3VRAB 2DJFC 1FCCC 4O42A 1C0AA 1EZ6A 4CJ1B 1E90A 4KHPL 3ZTDA 2PW7A 2K5VA 4ZRPA 1YJWA 4X62L 1WI5A 3F2DA 1QVCA 3KF6B 3S2AA 5C3EB 4GIVA 3PSEB 2PW9A 3GZNI 1PFMA 3KOJA 4DAYB 2O5IC 3GTMH 3HRDD 5IKCM 4DHJD 4LNNA 2RDFA 1G2TA 1V49A 2V1CC 4FYDA 4K5VA 3MEHA 4JWSC 3JSVB 5G2NA 4EQOA 4HMJA 2JT4B 2QMTA 5FKAC 4L5QA 4QIWB 3L3OC 3OMGA 5A35A 4A3FG 3HM6X 4DHZE 3F2BA 4JYAL 2KEEA 2I5LX 4K0KQ 2NCNA 2FINB 2XRQD 1UBIA 1IKMA 5KHOA 1YD8U 3DBLB 3W5VB 2JXXA 4NJCA 4G3XB 3AE4B 3QQ8B 2Z8LA 4WQMA 4PMBA 2FUHB 1P98A 2XTIA 2JE6I 1N61A 4OXPA 4LAAA 4KSLC 3S1QB 1NI3A 1WSPA 2J52A 4RH6A 2M4NA 3J7ZC 3PF5A 1ONLA 2WXMA 2NVYH 2F0TA 1LV9A 4GLAC 3EC8A 3ENEA 4DK1A 4FF2A 4N9TA 4HTHA 1PYBA 4XQQA 3UDXA 5J2RA 4DKAC 1NEKB 1WWTA 4US9A 3LDZE 3G6EA 4H7BA 1X3QA 3OHXC 1EEID 4DUYL 2Z0SA 3A8JE 1JJ2A 1BQQT 5C3EG 4RWSC 2K75A 1LT5D 4IURA 3Q8DA 5I4DA 2JA7H 3CKIB 4TRDA 4J15A 3RNGC 4HJ9A 1VQAA 4WFN3 3U8ZA 2MJ3A 4DUZQ 1L4DB 1I4QA 5E6PA 2JY6A 3A4RA 2V3SA 1IP9A 1NAPA 1VF7A 3GDEA 3LGJA 3I57A 3CSTA 4X3KA 2B2UC 5IGEA 1RTOA 2Y5PA 2W54A 5D65A 3PO3H 1BKBA 1X6OA 1SNCA 2JEBI 3P75A 1BBXC 3DQVA 5KGUA 1RF2D 3TP7A 1HNXQ 5J3BA 4AS1A 4AYBE 1I94L 1FXTB 2PCFB 5JZEB 4Q2JA 4EQNA 2E75C 4DR6L 1F52A 2TSSA 3EUB2 1JB7A 2GVAA 4H0LC 2N7EA 4XQJA 2MNAA 2PYKA 4KDIC 5C0XI 3AI5A 3NTHA 1EIGA 5JVH3 2K39A 4NAWB 2GN5A 4IALA 1TS2A 4P75A 4LFCL 1XNQL 1MPEA 2M9VA 2OT2A 2RDHA 3UIPB 5EQ0A 5GMVA 4D2KA 5DM63 1PH2A 3B1LX 1AYFA 4JLCA 3H6NA 2MBOA 1J8IA 4ZUIA 2SAKA 2KCMA 3CIRB 1GNUA 3VUWA 2KZRA 1GKHA 3HOXG 1VLBA 2XEWA 4OIJA 4GLXA 3EVQA 2JSOA 3K5OA 1D8LA 4K5WA 2J0TD 1HE8A 3SK5A 2VB2X 2PIAA 4RM9A 4L6TB 5C5LA 4OZCA 3V6EB 1X9NA 4W9GA 4QGUA 3OW2A 4A3GH 2K6DB 4DNRB 5K36H 5C6AA 2MUYA 2M1MA 4IOCA 2NVQH 3M4OH 2WQYB 1F1HA 2AHOB 2V9HA 1S5DD 2O6VB 1K28A 1XXGA 4HJKA 3I72A 3J80E 4JBJA 1N32Q 2PPHA 3PRPB 4QB4A 2SDFA 3D4WA 4NW2A 2WXPA 1Q12A 4NXNL 4X6AH 1CZGA 3DWMA 1SMYC 4RHRA 1DGJA 3K81C 3IFTA 2IHEA 4II3B 3GTJB 1ZOYB 3QIAA 4MJSA 3VTWA 4U673 5IY0A 3X3NA 1JOKA 2BA0A 4C3HH 1VQCA 2YV5A 1XNRQ 1L1OA 4PMWA 3DHHC 1M90C 1HNWL 2GBJA 2N9PC 1QVGA 1F9RA 3QOJA 4C4VB 2FFKB 4P7IA 3E6ZX 2IGGA 3X23A 2I1KA 1PGXA 3L10B 4N9F4 4DR1Q 3KDFA 3EA6A 1T0SC 3ZRFA 3S17B 5C4JB 2JUOA 2KLCA 1EY8A 1TWHH 3HOVB 3V2TA 1UBQA 3A5UA 2EY6A 3AFPA 3I4NH 1V6EA 3K7AB 1XYIA 1UELA 3MXNB 1N9WA 1BF4A 1HPCA 1CK1A 4TMAB 1HZ9A 3MXUA 1TZ1A 2F52A 1PFBA 3C1FA 1T5EA 4IM0A 5TSSA 1ENFA 4X3SA 3RLFA 3Q14C 4LMQD 3A8IE 1PA6A 4BXXH 1N63A 3DHQA 2WXNA 2RHQB 5M5YB 2KX3A 2WU5B 1VMCA 4A3IG 3M4YA 1GHJA 2UUAL 5C4HA 5GAEC 3GTLH 3S16B 1SDFA 2LD9A 1XLQA 1BCPC 1KRTA 1MGSA 3A1QA 4XIGS 4BBRH 2PVOD 1NUCA 3VYSA 2EYPA 1OXTA 5D7GA 5FLXL 4TVAB 1G291 4LF6Q 1XQQA 5AFWA 4CDCC 5JHBA 1S1QB 3PLVA 2PW5A 4NB3A 3ZRCA 1SE3A 1TTNA 1ZKHA 3FKYA 3HOVG 3RNBC 5EJWA 3UI3A 1GUWA 1Q10A 1LTSD 2NN6H 1SEBD 2DNCA 4PZ8A 5M5WH 1C7YA 3H1UA 1SE8A 2A68D 2QEXA 4G7ZC 3CMMB 4R4QA 1XMQL 3APFA 1CA5A 3NE5B 1KNAA 4HPPA 2D0OA 2SNMA 2IW3A 4KK7A 4M0WA 5AUIA 1PH5A 1HRJA 3N9YC 4JE3B 3VR6A 1FO4A 1EY5A 3DVGY 1JORA 1ZE3D 2BOSA 1PDQA 1WMHA 5L83A 2B2UA 4LNQA 2R7ZH 2RCNA 2G5DA 1BCPF 1KLGD 3CP0A 1QWYA 3TUOA 4N6EB 2N0SB 4DAMA 1C4AA 1LM8B 3BU2A 3CCRA 2HHHQ 1EY9A 3SE0A 4KHZA 3TJPA 1PFSA 1SYGA 2CW0C 3T16A 3PIO3 5IWAL 2L3ZA 3H9DA 3ZNID 1PH6A 1XEEA 1RODA 3ZYYX 4A3CG 2VL6A 4G4KA 5FJ8H 2G1EA 3ERSX 2JA6B 2DZMA 1I4HA 2R6GA 2KCTA 1K8OA 1OXVA 2CHZA 4EOYA 2VUMG 4IOAA 4R8IA 4TV3A 1D5ZC 5IT9L 4GOPC 2VZKB 2ACZB 4JV5L 1F2MA 1EIYB 1JRPA 2I1JA 2WXLA 3Q3FA 3ZW3A 3TEYA 4ICUA 4K81A 2JU6X 3DDCB 3NJTA 1EL0A 3TS0A 3CQZH 5ISRA 2IO0B 3LXFA 1UH6A 1TT2A 1ZYRD 1AEXA 3U58A 1HZ5A 1RHPA 3OIQA 4IPDA 2F0QA 3PUVA 4JI5L 4C56C 1QZHA 2WKDA 2AUJD 1FPYA 2KMAA 3RZFA 3NVVA 3U2SC 3ZJTA 1X3FA 4C1NK 3J9CA 1E8YA 5IGDA 4DK5A 2WDQB 2G9DA 4RGNA 4POFA 3GD7A 3GS2A 1V1QA 2F1MA 1WGKA 1VQIA 1PYWD 2K5QA 1YN4A 2DENB 3N20C 2MP2A 4RMAA 4HIDA 2GB1A 1O7IA 2I5HA 4JI3Q 1E8WA 1EYDA 3ZNGC 1EF1A 3HP3A 3EQLC 2CCZA 1L0WA 2B2YA 4MDKE 4R8NA 2WGSA 1N60A 3GTGB 1SAPA 4Y7NB 3NP8A 2GBRA 3T3NA 4ZKBB 2BS2B 3KDFB 4B0MA 1TWCH 3CAMA 1Z47A 3PSIA 1DOIA 1G2SA 2XWBB 4O0AA 4FNFA 5I6WA 5LXIB 5IODA 1YQ3B 1X55A 1JB3A 2O2LD 3CW2C 2MBEA 3J81i 2E76C 5JPMC 1U4LA 3Q23A 5JVG3 4CKBA 3J80c 5M3FH 1N34L 2E2JB 4GZYC 2C35B 4WJWA 5IYDH 3TIXA 3Q8AA 2RVLA 1WR1A 2ZXRA 1V86A 1NJIC 1XMOL 3E3XA 1N33L 2KQSA 2NVUI 3IG3A 4DDID 3IAM1 2OXPA 4FULA 2KC2A 1C78A 2JVCA 1LTGD 3BK2A 2UU9L 2J53A 3J81j 1NDDA 3RNFC 1YVCA 2F0OA 4MSMB 2WXGA 1K8GA 1PV4A 2MPMA 2D07B 4KKTA 1GG3A 1SFOB 2J4XA 5IGGA 2RF4A 1FD7D 3U4EG 2K25A 5IYCH 2PMZB 1ZW7A 1JQ4A 5FLMG 3ULLA 2NBWB 1KXLA 1STEA 4DAVA 1WYWB 5IYBH 1NCVA 4LCDE 4BA1I 3P4PB 5T8IA 2KJRA 3S14H 5CHFA 3CHBD 1LGRA 4DK6C 2O4XA 5T1IA 3GTKB 3OOCA 2UXCQ 1Y1VH 1YNJC 2DAJA 5J17A 2QF7A 4QIWE 1PGAA 1AZQA 2NN6I 2Y0SB 2A4ZA 1K53A 2W9NA 2C7MB 3ONAB 2YVCA 1Q46A 2IX0A 1IBKL 1BBWA 1ENCA 3OWEB 4MN3A 4IFDG 2BBCA 5KRUA 5COYA 4NNJB 3GE3C 3A33B 3GQBA 4GNXC 1R4MB 4GLSC 2PZTA 2ZNVB 1FVIA 1HQRD 1OQQA 2IJ0A 4FXGC 2UYZB 5IE8A 4JPSA 1ISNA 4IN3A 1YJJA 2B3AA 2PKOA 1XCTL 3R8BA 2L8JA 1WCMG 3IHPC 3FPPA 3HOYH 2GLSA 1HJPA 3HOWB 3RUIB 2DWQA 1YN3A 1PH3A 2MO1A 2NBFA 3SFDB 1SRUA 2F03A 5CHVC 1JQYD 4LUZA 1P0RA 5ELOA 3KYDD 3S1RB 1N8RC 4EFOA 1TKEA 3P20A 3D8GA 1C8CA 2EZVA 4V190 4BY7H 3I2ZA 1DOKA 4LUVA 1ZPSA 4W9LA 5D2MB 1E8XA 3UE1A 2B29A 1ET9A 3AM9A 5BMGA 3N1XC 4XWTA 1CZWA 1LUZA 2EYOA 1VQ8A 4K8IA 1VCBA 1FFUA 1RFKA 1WFYA 1F9SA 1VZ7A 2Y0SG 2KDBA 2AX5A 1C3TA 1R4NI 3I3TB 3Q8FA 3VH4B 3R3OA 2Z9HA 3AFQA 5GXGB 3P4SB 3NQTA 1UD7A 1HA6A 1P9DU 3DVNV 4L2YA 2KKCA 3HEJA 3STBD 1QUQB 5HFYA 1CJEA 4GLVB 1I50H 5LMNW 4A3DB 4ZOHC 4EQPA 1FXAA 1HFNA 1NBWA 3HIZA 1NE3A 2B2TA 4EKUA 3PO2H 1WXAA 2RD0A 5IP9G 4LF8L 3I4LA 3N1ZC 1RKNA 2F0GA 4HEA1 3J7YW 2PI2A 3HOWG 1W2BA 4X66L 5C44H 1EYCA 1Q8IA 1GUTA 4XDXA 3F1ZA 1FRDA 1I3QB 1VQDA 4DR3Q 3P1HA 3PGZA 2HCIA 1NTGA 1WY8A 2KT7A 2LGSA 2PQEA 4IUPA 3IT4B 1X3GA 2N9EB 5LL6X 3Q6BA 3JAMi 4DFAA 4Y52H 1ASZA 3BK1A 4HXDA 4KX6B 4P74A 1J5EQ 3NY5A 2K1BA 5BR8Q 1IBLQ 1R9TH 2AWNA 1Y1WB 4JGHB 1TKGA 3SDLC 1OO9B 1LT3D 2OQKA 2YTYA 1U4AA 2CHXA 4ZK9B 2R93H 3I7FA 5CGKA 1GB4A 4UP9A 1WJUA 2RMMA 3MFGA 3PCOB 3DHIC 4RA8A 1EYAA 3OWFA 1VQPA 1IBXA 2OF1A 4MT5A 2EVBA 3G7LA 3AE9B 1B50A 1BO0A 4A3DG 5LNK1 4KJNA 3AE5B 1EY4A 1SIJA 1WJ4A 2WXRA 4MM3B 4P1CC 2W3RA 1NMFA 1IBML 2FCNA 2ZCBA 3AEFB 3NS1A 4DNTB 3T1YL 1SYCA 5T1GA 1Q0WB 3A5ZB 4QF4A 3FDTA 5C5MA 3TZDA 4ZLTF 4HKZE 2N9XA 1ESFA 2K5PA 5CBAE 3I4MB 3KUPA 1LACA 1J7AA 4LF9Q 4MGYE 2HTHA 1WGDA 2MCNB 1ESRA 1UZXB 3ZJUA 4A4IA 4C1NI 4UAIA 3M9BA 3RN5A 2UXDL 2FMMA 2A6EC 1NENB 1Z9FA 5C2TB 1OXXK 1G8ZD 1VDZA 3H3VC 4XDCA 4OZBA 2CKHB 2WNMA 1Y1WG 4YTMB 3A55A 3HOUB 1UEBA 5C3EH 3UDGA 3FHWA 4DV0Q 1Q1OA 2EKIA 3H6MA 3KQ4A 4B08A 1VQKA 5DPTA 3A74A 5K5PA 2IGHA 5G3LF 4HCPB 1E3PA 2IDYA 1XTDA 3G6JB 1PH7A 2KCNA 5KYLA 3RFZB 4RKBA 4ZUJA 3D4RA 3PRMB 4R4IA 2WHIA 2G3QB 4ZRJA 4C2MB 1Q81C 1XD3B 1CKOA 1PFDA 3I55A 4KSKC 4ABNA 1GPXA 2WS3B 1TBEA 3MHBA 2J7QB 2ZTEA 4MGIE 1V2YA 4L8JA 1M8AA 4GNXA 1PQSA 4WJQA 4LWCA 2BGFA 1S5BD 3S1QH 3IFDA 1A63A 4MGZE 2WKCA 1D5XC 1QILA 4NXML 1WD1A 2RDBC 1T0YA 1CSQA 2D2CC 1YQ4B 4LK0M 5C3XA 2O2VA 3P63A 2N1VA 2HIXA 3W1YA 2D5DA 1DYQA 1QG7A 3KFUA 2DJGC 1K73C 4FF4A 4AP4C 1YMHE 3NELA 2VXWA 4EGVA 3HOUG 1BNZA 3V62A 3PQIA 1J8CA 2KDEB 3K9OB 4I6PA 3VR4A 5IGFA 1JWUD 2WAQB 4KD3A 3E5SA 5CBEE 4DV6L 2JYEA 2OTLA 2KANA 1KD1C 2KFKA 2F0PA 3RNAC 3TEZA 3P4QB 1Z5SB 1EFID 5A2QL 2UXBL 1SYFA 1VS0A 2N3SA 1TYGB 4JWUC 4KZCA 1MSHA 3K5MA 4A3KB 2G4DB 2LGYA 1KTKA 4K1RB 4OWTB 2EXDA 2F0LA 4HROA 3WCQA 3D0FA 1QOAA 4GGQA 2MGSA 2V4DA 3CCUA 3OMCA 2CU3A 1MI2A 3JYUA 3S2HB 1P3QU 2CHWA 2WXIA 4TUUA 2M2LA 2BDOA 1EY7A 3TREA 4CJ0B 2NBVB 1ILQA 4LF5L 4A90A 2H5XA 4NMZA 1VF5C 2AQ3B 1JICA 2RBMA 1N6ZA 3EFXD 1XX8A 4OWXB 2D3AA 1MBYA 3NK9A 3ITPA 1GO3E 4V0BA 1AE3A 5EBCA 1Z6HA 4AOFA 1MKHA 2B39A 1AH9A 1RJTA 1CKMA 1V9JA 5G3LD 2RPQA 3HGBA 1JMLA 4EEWA 1GB1A 5I2YA 3KLSA 2XN9C 4OO1I 4F7ZA 4NPNA 4TQ1A 3ALBA 2WAQG 5L37A 1TVXA 1C79A 1KNEA 3C1EA 3PUXA 2D10A 3KBXA 2F0UA 2HCCA 4ZAIA 1H9MA 1Y8OB 3VYUA 4CJ2C 1R9TB 1X3EA 1SR3A 2LI5A 3U9OA 2LJIA 3OSOA 3U9SA 1E5WA 4ICVA 1JWMD 2K5WA 3ML8A 4A3BB 3UQAA 2CHBD 1A62A 2YYZA 3F2CA 4QCLA 3UINB 2LEKA 1FFVA 2O6VD 1KC8C 3GE8C 4G11A 1GJXA 3GTJH 3HKZG 1C77A 4A3FB 1TWAB 2R7DA 5AZGA 4X57B 1JROA 3EIVA 3OYYA 1YHQA 4LF4Q 1KLUD 2V3PA 5CC4A 4A3MG 4K7SA 3PV1A 3RZDB 3HS0C 1EWIA 1WGYA 2HD5B 2J0MA 2ZW0A 1TIID 1WYGA 4HIMA 3DPDA 4JI1Q 4LJOB 2WV6D 4A93B 1YI2A 1WTQA 1IPGA 3NHEB 3HVDA 3S17H 3L0WB 5C4JH 5HHDG 2MSED 5HY6A 3HOVH 3KYCD 3A56A 3E9HA 5D94A 3KK7A 4JBKA 3UI2A 2F0HA 4G7HC 3DMUA 4K14A 1DONA 1F2YA 1O7ZA 3K7AH 4U68A 1J7CA 3WOFA 2EYFA 3D3RA 5EGTA 4MELA 4A3PA 4BVUC 2F4VL 1YN5A 1E0ZA 3HRZC 2C5CA 5FOBB 3ULPA 3KYHC 4K0KL 2Q2UA 2A69C 2WXHA 3T1HQ 4XT1B 2FBWB 1KQSA 4OX9Q 3AE1B 4A3BG 5KYIA 2PMZE 3PPAA 1WTRA 2JWZA 4MSQB 5IA7A 4RGOS 3LX0A 5M5YH 2Y3AA 4ASWC 2NTTA 4AIMA 5C4XB 5CYUA 4IUTA 1S3SG 2VQFQ 2LRWA 2L15A 1TXYA 3BG3A 4HJ5A 4DR4Q 1I7HA 3S16H 4CDFC 1N36Q 4ZQ3A 2PLPA 2BDNA 2DAFA 4GN5A 4RCOA 2FIFA 3BY4B 1IUEA 1VQMA 2WINB 3LWUA 2DZIA 3Q2AC 3HG9A 2Z0DB 4B0EA 2Y0SE 4M1UB 3WAOA 1E7PB 4A3CH 1F9QA 2D2QA 2IL8A 4A93G 3G4SA 2N8NA 2M56B 2KHSA 4HKQA 4KV6A 4H02A 3VTUA 3VR9B 2EDGA 3PUYA 3BDCA 3ETRA 3J81E 4OO1G 1QE6A 2B2VC 1UWMA 2PTLA 2V0GA 4RMFA 2H89B 4DK3C 3LNNA 1F2RC 3OLMD 3VR2A 5EAYA 2E2IB 5M5XB 3AEAB 3KVFB 2UU7A 5BMHA 1GXDC 3TN2A 3RN2A 5DPRA 2ZT9C 2ID0A 1BXTA 3BIID 3KWLA 1MJCA 3U50C 3R7QA 1HR0W 5EKKA 2FCMA 2N4FA 2VH1A 3HOXB 2MBBB 3GZNB 2K04A 4IDIA 4LLGM 2KN4A 2BTEA 3WANA 2L05A 4B3TQ 1D1IA 3M62B 1A3UA 1LTTD 1HNXL 1ZXTA 2Q8RE 3PGEA 4J3OD 4BKSD 3T13A 2GI9A 3VVWB 3H09A 1WD0A 2BB6A 5C4XG 4I65A 1GC7A 4C3IG 2OTJA 3K80C 4FHJA 4OEMB 1WI0A 2EY2A 1KAWA 1T5XD 1QOBA 4JI0Q 3H0GG 1PRTB 1PGBA 4NJ6A 3QWNA 1JR0D 1TKWB 3B08A 4M8NA 3Q6SA 1HZCA 2PMVA 2A68C 3MC9A 2KYWA 2ZNVC 1U9RA 4QJFA 4HAEA 4EZJA 1SYBA 4KLKA 1WTOA 1FMAD 2CR5A 2CS4A 4YCVA 2GBKA 2JA6H 2NVTB 1X32A 4DXAB 2SOBA 2G45B 1Y8PB 1CSPA 2MBQA 3FILB 4MACA 1D1KA 1VCIA 2FUG1 3BINA 4O1NA 3U4ZA 1BDOA 2L55A 5C0XJ 5TR5A 5LXHA 2JXTA 3PT2B 3P2BA 3C2PA 2CKZB 3T56B 2WP9B 2WXQA 3J7AF 1YZ6A 1DCZA 3K8AA 1UE7A 2VY3A 2MQJA 2VZKD 3PZ7A 1EQVA 4XYOA 1YHAA 2KBNA 3H3VI 1N32L 3RULA 4IPGA 4RG1A 1C4QA 3KLSX 4LJZC 5E6OA 2E3TA 1XWEA 1ZP0B 3V61A 3VFKA 1K50A 1VQ4A 3CCLA 2Q2IA 3AMZA 3BVGA 4AQYL 2WXJA 1RIPA 4UP7A 2BKFA 1V1OA 4LFAQ 5LMNQ 4TQ0A 5BO4B 4OVVA 1YIWA 1A2UA 4BFRA 1CQVA 3U52E 2Z1CA 4JI7Q 2KACA 1I4XA 1LTBD 4CHKA 3RMHA 4GKJQ 2KVMA 1STNA 1GUNA 1RCVD 3NHHA 2IX3A 4DR1L 3KLRA 1SJHD 3EFCA 3AU7A 1DD2A 4A3IB 3QCAA 4LFCQ 3AU5A 4N9PA 3MA2B 3GTGH 2NB0A 4Y7NH 1RRBA 2BYFA 2HE7A 4HCNB 1ZYRC 1QNUA 1YEZA 2A69D 2L4NA 3SVMA 1EWHA 1AP0A 3ULJA 2L12A 1NVID 5E1FA 1IXRA 4IFDH 1OQYA 1V1PA 4IWOA 5CV5A 2E2JH 5FK9C 2KUMA 2CH4A 2MW5A 1DOYA 1NSNS 2N1WA 2I0QA 3PV0A 4UPAA 3AN1A 1V8QA 3NUCA 1KIXA 3S2DB 3IBEA 3W1SC 2QCZA 3SGIA 4LDTB 3CRKC 3ZNZB 4NZLB 3I91A 1B70B 2ICIA 4YL8A 2GBMA 1K83B 5D3DA 2F0VA 3VDZA 2ZTDA 4P2CB 5CORA 3W5OA 4UY8C 3CC4A 2F0IA 1SFOH 1UWXA 3WALA 4DV1L 4NXNQ 2OOBB
chains in the Genus database with same CATH topology
2CQAA 4TSSA 1G6ZA 3NVZA 1OQRA 1KDBA 3L7ZC 1F77A 5C0XG 3R2TA 1H9JA 1O7YA 2C9OA 4HCSA 4HR7B 2Q8IB 2EYJA 1EY0A 1SXTA 3O13A 4RF0A 5J39A 2MP1A 3BDLA 4CQNA 2X6LA 2J7ZA 3M7GA 1KABA 2VUMB 1PTOB 1VZ8A 4YSYB 1FNVA 4X3UA 1I4PA 4YWGG 1W6JA 3DEPA 1NR4A 4IQZA 3D4DA 2K32A 1YNTE 2YU9B 1AWDA 3NVWA 3IXSA 2QIEB 3PIP3 2B8FA 3VRBB 5EPJA 1H9SA 2N9KA 1LT6D 4DA2A 5M3MB 1E10A 4IUVA 2EXZA 2BE5D 3DUZA 2AUKA 3MZ5A 1P7EA 1F2LA 1TS4A 2WU2B 1B1ZA 3PUWA 1GHKA 4WURA 5J1ZA 5E4XA 2F3VA 5F2DA 1U4RA 2B76B 5E4WC 2JYOA 1CA6A 1LABA 4KI0A 3DWGC 1RM6C 4B9XA 5LHY1 3AEEB 2PZUA 2CVRA 4K6LA 3EGRA 2KOLA 4MH8A 3VA7A 3K5NA 1WRIA 4K5XA 3GTOB 2MHVA 3V3XA 1PXUA 2PNRC 3B9JA 2NVXB 1X3PA 2KCCA 4ZRZA 4C7YA 3NPPA 1TS3A 3SK4A 1RYJA 4H2AA 1Z7TA 4JBWA 3TMEA 1IHZA 3KWVA 1E2ZA 2KEDA 5EE1A 1F2RI 3TP5A 5D14A 3T3OA 2V4IB 2HDLA 1DOLA 1FYCA 5KNBA 1EIHA 3P7JA 4YXDB 1PZJD 1DM0B 1HUMA 3K58A 2BT6A 4DN4M 4BS9A 1WCMB 1QOHA 1UAPA 2NMQA 3NBIA 1Q1EA 5EPLA 4USAA 1DJRD 1TY2A 1IW7D 3I3CA 3J80L 3MTSA 3OW7A 1CT1D 5JEAH 3ZQ4A 3GV6A 3Q22A 4QUFA 5BN3A 1FEHA 2I46A 4WORA 4N59A 3RZOB 3BDOA 3KF8A 3W5UB 3AMUA 1CFMA 3OPOA 1CHQD 3HVZA 2AQ2B 2ZXOA 3S1MB 1NYRA 2NUCA 3Q8EA 1I6HB 1P7FA 2EYHA 2IT1A 1L6UA 3NSWA 5BMIA 1XLNA 4DU9A 2JA8B 1SE4A 3TDQA 2NWGA 3ZJVA 1BUVT 5G5HA 2R3ZA 1H9SB 1GUOA 1I4RA 2W82A 4R3DA 3CRLC 2I38A 1XCQL 4RFBA 1XTCD 3MWYW 1D2BA 1QF6A 5EE3A 2CJOA 5KNDA 2QJLA 3M85A 1K52A 5H8YE 4GDKB 2RSNA 4LTUA 4MHEA 5ELEA 1F0ZA 1ROEA 3FKIB 1V43A 4FXDA 2F3WA 4IOIE 4A55A 1HXYD 3P42A 4ZRQA 4WH4A 2N7JA 3OIPA 2GA4B 4KY7A 2BA1A 4RF1A 1TWGB 1U4MA 4HRSA 3MAQA 5JJZA 2L9HA 5JAVA 1SJED 3MVVA 2F0FA 4G57A 3IL8A 1I4GA 5KEEA 5FR3A 4RCNA 5IGCA 3TP6A 2MH7A 3AB5A 3M3YB 4HJGE 4CKCA 1DOMA 2TMPA 2NN6G 4PMCA 3DM1A 4C80A 4RNAA 3L9AX 1OXSC 4BWGB 3VR5A 1JC7A 5I9OA 4RAUC 3VA5A 1E2VA 2WB1B 3DXJC 5FO7B 2QEJC 5CR3A 2X6GA 1A6XA 1B9NA 2K7VA 4L23A 3J7AV 4F87A 1B53A 4FP5D 2DY8A 4FO2A 3NBHA 2DLBA 2K6AA 1XLOA 2R92B 5J22A 4OL7A 4RGMA 2H4OA 1C4CA 3TZUA 1MHXA 3GTQB 1W6KA 1PRTF 2FMCA 4KN7C 3QB3A 1MD2D 1XF5L 1S5FD 2JSVX 1SBBB 1PUTA 1GUGA 5JOBA 3Q8BA 1IL8A 1BCPB 4YT0B 3NZ3A 2L1BA 3V05A 2MEKA 1D5MC 1D6EC 2WXFA 2HDEA 2KA7A 3I90A 4HEDA 1HUNA 2JWUA 3PO0A 4FXCA 4ME5A 4OVZA 1E0BA 2XWJB 2F0JA 3NWSA 1YNND 4Q5VA 3LYYA 2LMCA 2QCPX 2LS01 4YIJA 2IWHA 3F2UA 5EPKA 1EOTA 1EZ8A 1SE2A 2F0WA 5FO9B 5EE9A 3LWEA 1STYA 4DXGA 4HMIA 1KDAA 2OEOA 3A8KE 4IUQA 3AEGB 3PZ8A 1QJOA 1FRRA 2A5HA 2DYOA 3FMCA 4KMUC 1ACCA 1EWCA 1VDVA 2QSDA 2JEAI 1HCZA 3T51B 3AE8B 1IGCA 1TS5A 1A3TA 1Y8NB 4NDXA 5DM73 1TWFB 3MC0B 3HKZB 4RKLA 5JXVA 1PRTD 2ON8A 2BS4B 2L1AA 1B4OA 5JPNC 3VR3A 4A3MB 4J1MA 3W3AA 4DGZA 2JA5B 4PV1C 3MHZA 1PMRA 4E6IA 2K22A 4OW0A 1NR2A 2N9LA 2I07B 4KKSA 1UNSA 2HDMA 5D3IB 2O5JC 3SFEB 1L0YB 4ITKA 1ZUD2 1K51A 2X69A 1KDCA 5IOCA 1HZ6A 4NAMA 3I70A 3X3MA 2B63B 1T6BX 1C4PA 2A6HD 2F4IA 1IBXB 5C3JB 1PTOF 1JCKB 2L83A 5C0XH 1HHVA 2B8GA 2IGDA 1A2TA 1Q3LA 1XO3A 4TQUS 3IKJA 2W3SA 4A3EB 3S15B 2XVSA 3H8HA 2K33A 1B2TA 1PZKD 1FXIA 3BYYB 3NUHB 1MHHE 5DNFA 2EY1A 3IAS1 3FEWX 3R93A 5G5GA 2Y5CA 4DAPA 5FLXE 1M4VA 2KJXA 3NRZA 2BW2A 1MSGA 4JX1C 1FNWA 4UDUC 4C3IB 1BOSA 1G91A 2I2YA 1CHPD 3EROA 3PMFA 3A7AB 2ZW1A 3H0GB 3K57A 4FF3A 2LHEA 3NQIA 2XIWA 2VNUD 3MXNA 1QOFA 2LMCB 1F2ZA 4KKJA 1PTOH 4B9WA 4KGTA 4ILWA 4ODGA 5EE0A 2OEDA 3A54A 1GOZA 1XLPA 1PTOD 3D31A 3FAHA 1N5XA 5HI1A 4EE2A 3S1NB 2QKIC 4WIPA 2PVGC 1PZID 4L63B 4XDDA 1CQFA 3HUIA 2KMMA 1EM7A 1R7SA 3BVZA 2WLBA 2A73B 5IT9E 2E2DC 1Q90A 5DEHA 1QQRA 1L5PA 4A3JB 2L5TA 1VZ6A 1WVLA 2K05A 4ULLA 2FE8A 2PPBC 4A6QA 1ET6A 4YTPB 4IZ8A 3L4PA 2D62A 4US8A 1C9FA 3V96A 2AQ1B 1RTNA 4NP5A 3ND9A 3IT6B 3D6WA 2JX5A 2A74C 5BN4A 3I9V1 3N6RA 2E74C 3H94A 2YEPB 3B2GA 1VMPA 1ILPA 1E2WA 2Z4IA 2BE5C 4KY5A 4ID6A 4DQOC 3GTPB 1FCLA 2ENBA 4HCEA 2MJ8A 1JWSD 4CHTB 1YJIA 3BWUD 2WIIB 4OGQC 2WDVB 3SXHA 2K0PA 4IKGA 2EOTA 3C8YA 1HTLD 3U7ZA 3P1MA 2DN8A 5CV6A 4C3JB 2F0DA 3BYTB 2WXOA 2JZPA 2E2HB 2BYTA 1ZXHA 1QKZA 2N88A 2OHFA 4K6DA 1ZKOA 4BY1B 1GUSA 4ARIA 5M9OA 3P4RB 1HTPA 1EWYC 5CV8A 1ZXIA 3MFYA 2JYTA 1WTXA 4RHSA 1EY6A 2ONQA 4I7ZC 2B2YC 4QUCA 2RSOA 3JAME 1EEFD 2RPVA 2IPKD 1SNDA 1ENAA 4PNYA 2WACA 1C76A 3Q0AA 2CJNA 3HOZB 4EVOA 2K01A 4H13C 4KHVA 4BBSB 5E6JA 1JOQA 1LTAD 1PLFA 4C3JG 2EJGC 2DYMA 1RWSA 5KNCA 4KD4A 2WDRB 2LFNA 1SNOA 1BMLC 1L4ZB 2AWOA 4WRDA 1U4PA 1SYEA 3ND8A 4JK1C 2B2VA 1UUPA 1TZOA 5ELBA 2F0NA 3GTMB 2LGIA 1CTMA 1OXUA 1IW7C 3Q8CA 3SK8A 3NVYA 2Q8TA 3TEWA 5I6YA 1WTPA 4FF1A 2R61A 3VR8B 1BUIC 3ABVB 2V3NA 2EELA 3AE7B 2M00A 3T4AC 1STBA 2RKSA 4KKUA 1AN8A 3NXWA 3PUZA 4L1BA 3QG1A 2ICEC 5BYRA 4F7XA 2NVYB 2N55A 2G9HD 1HEZE 1HA5A 2WP8J 2LUMA 3RUZA 2BS3B 4P6VF 4Q0FA 2JA7B 1KF6B 5CMDA 2B2WC 1SNMA 3VYTA 1HFGA 3J81L 2NTSA 5ELCA 1TU2B 1ICWA 5ELFA 4YTNB 1V97A 4KGRA 1SSOA 1QOGA 5HGTA 2L32A 2KQ4X 2RQXA 3PO3B 3K59A 2HUGA 1ZDVA 4MIUA 3AB9A 4ZYSA 1O78A 1QNKA 2EY5A 1STHA 3D6CA 1H9KA 2VB3X 1A15A 2FHTA 1LO5D 3DEOA 2DY7A 3NTKA 4ZKCB 1SMYD 4DF7A 2EYMA 2B2TC 1SNPA 2EJFC 4IFDI 3VQIA 5IGBA 3QJYA 1QB5D 1I6VC 1F9PA 4FVMA 1DZ1A 2PZWA 4IFDJ 1D4BA 1V1PB 1J7BA 3FRPB 2QDBA 4A3GB 2L0CA 2LKVA 1R4QB 5E3FA 2EYLA 3M4OB 1R4PB 2NVQB 2QILA 1FNUA 3AE3B 2KECA 2EPBA 3W1SA 5MPOA 4J8QA 3NTIA 3SDZA 4QMGA 1Q1BA 2XSCA 2KAJA 3TSSA 4C3HB 2K3UA 1L6VA 2DNEA 5EKLA 2INNE 1V8CA 5H92C 5AUKA 5BYSA 4F88A 1TWHB 3TEXA 1H9RA 3SR6A 3GV3A 1BR9A 1JWAD 1BCPD 2M0AA 3I4NB 1DOXA 1WTWA 4CKEA 2JP1A 3AE6B 1O80A 5C3WA 5K36G 4K8JA 1IGDA 1CI3M 1B9MA 5CV4A 5CV9A 1Y56A 1SNQA 1QT9A 3KBGA 3K5LA 1A70A 1VR9A 1C48A 5A2QE 4XTCS 4DK0A 3FC4A 4C3HG 3GTLB 1ZDXA 1SF0A 4WAFA 2BCOA 5C4ZA 3JAML 4BBRB 1CZPA 2HTME 1KFYB 3ERQA 3NWTA 1S5CD 5KIXA 4N58A 5EKIA 3GO5A 1QCBD 3W2DA 1EU4A 3QOLA 2XRSD 2DBYA 4ARCA 5IIFA 4HN7A 2CW0D 5NUCA 5M5WB 1B44D 1CM9A 2BB5A 1YNNC 3AH7A 1N62A 2JXMB 1L0VB 4OZAA 5EBDA 1LTRD 2B2WA 4IUUA 2X38A 4XE0A 1GAQB 5LL6S 1AFPA 4XYQA 1B3AA 1HQMC 1UEAB 1WTVA 3W9CB 4A9AA 1FGBD 1IKLA 2R7ZB 4BA2I 1JWBD 2Q5WD 4X3TA 4AYBB 2F0KA 1IYUA 1LLRD 4K2LA 4PT5A 3IAYA 4KY6A 2IX1A 2J42A 2RDGA 5CV7A 2F0SA 1KH0A 1SYDA 3CU7A 1JOOA 1PRTC 1SSNA 3FPUB 2D9UA 2XNAC 3AEBB 1S4ZA 4FXKC 3E56A 3CQZB 4C7ZA 2NYZD 3HZXA 5BYQA 3VYRA 1E9MA 2LHDA 4IUNA 1RDPD 4KKIA 3K6OA 4HSVA 3WDNA 5FO8B 1FR3A 4OHJA 2PO4A 4KJOA 4PQXA 1LT4D 4DXFA 3TP8A 3I8ZA 4ZHOA 3C46A 3E0JA 1VJKA 3K0YA 2A6HC 4OO1H 3MXGA 4A8XC 2FJ2A 2MJEA 1TWCB 1TY0A 5JEAJ 4M8AA 2GRIA 1O7LA 2KQ3A 4S3SA 3MXPA 2NZ1D 1TR5A 1STAA 5M3FB 1WXQA 1YNJD 1EQTA 1S5ED 4OIKA 5HURA 2F0MA 4J6HA 2SEBD 2YEPF 2RA4A 4G7OC 1NYQA 3I73A 4YSXB 2M19A 3EJIA 1RD9D 4F8MA 4K2KA 3AE2B 1TKYA 3WOEA 3QO2A 4XXEA 3BS1A 3S14B 3M7NA 3N52A 1K8MA 4DAYA 2L11A 1Y1VB 3TBIB 2W55A 1II3A 3RPFC 1MVKA 1FIQA 4WWMA 3T53B 1PDXA 1L0XB 4CGYB 1E6EB 1TJEA 1JW9D 3GP7A 2LFIA 3AECB 2K9XA 2ZXPA 3HOYB 3SEBA 3BZDB 3AEDB 5DAUA 2K28A 4RGTA 3BVMA 1PTOC 3B2FA 2JQRB 3URYA 4P16A 1VRAB 4BY7B 4Z9CB 5JEAG 2MJDA 4KTAA 3LB8C 3Q24A 4CBVA 3FVQA 3C3LA 4XQNA 4KGSA 1J9OA 2EE1A 4KN4C 2LY7A 1AZPA 4NKLA 1UGJA 4YSZB 2F0EA 5I9PA 1I50B 1JE4A 5I2XA 4XWWA 2K5DA 2E6XA 2KDMA 3PO2B 1KRHA 2INPE 3AV8A 2H1EA 1EU3A 2L52A 5C44B 1Y69U 3FILA 3ZGZA 4GDLB 1PFNA 2D5GA 4H44C 3DWQA 1TQOA 1ML0D 5HG2A 1DXMA 5ELDA 2HQEA 1T3QA 1LTID 4LK1C 4R9WA 2EJMA 1N5WA 1B9RA 3GB1A 3MP9A 3A7LA 4REZA 2R93B 1SB3C 1IYVA 2K03A 2Z4HA 3SR1A 4ZHPA 2A6ED 4HSPA 3SK6A 4TKOB 1KAAA 4XT3B 1FD6A 1MI0A 3R2IA 3SHLA 5BN5A 1FM0D 2SNSA 1A3VA 3RD4A 3H91A 1AW7A 2KWDA 2WXKA 1JALA 1STGA 1OFFA 3E9SA 3Q69A 3S9WA 1QLBB 3DWAA 3MJ5A 3CWIA 1ZEQX 3DWPA 3VRAB 1FCCC 4O42A 1EZ6A 4CJ1B 2PW7A 4ZRPA 5C3EB 2PW9A 1PFMA 3HRDD 2O5IC 2RDFA 1G2TA 4FYDA 4K5VA 3MEHA 4JWSC 4EQOA 4HMJA 2QMTA 5FKAC 4QIWB 3L3OC 3OMGA 5A35A 2KEEA 2FINB 2XRQD 1IKMA 3W5VB 4NJCA 3AE4B 2Z8LA 4WQMA 4PMBA 2JE6I 1N61A 4LAAA 3S1QB 1NI3A 1WSPA 2J52A 4RH6A 1ONLA 2WXMA 2F0TA 1LV9A 4DK1A 4FF2A 4N9TA 4HTHA 4XQQA 1WWTA 1NEKB 4US9A 4H7BA 1X3QA 3OHXC 1EEID 3A8JE 1BQQT 4RWSC 1LT5D 4IURA 5I4DA 3CKIB 4TRDA 4WFN3 2MJ3A 1L4DB 1I4QA 1NAPA 1VF7A 3I57A 4X3KA 2B2UC 5IGEA 1RTOA 2Y5PA 2W54A 5D65A 1SNCA 2JEBI 3P75A 1BBXC 5KGUA 1RF2D 3TP7A 4AS1A 2PCFB 4Q2JA 4EQNA 2E75C 2TSSA 3EUB2 4H0LC 4XQJA 2PYKA 5C0XI 3NTHA 1EIGA 5JVH3 4NAWB 4IALA 1TS2A 1MPEA 4D2KA 2M9VA 2OT2A 2RDHA 5EQ0A 5DM63 1AYFA 1J8IA 4ZUIA 2SAKA 3CIRB 1VLBA 4OIJA 3EVQA 2JSOA 3K5OA 4K5WA 2J0TD 3SK5A 2VB2X 2PIAA 5C5LA 4L6TB 4OZCA 4DNRB 5K36H 5C6AA 2MUYA 2WQYB 1S5DD 1XXGA 3I72A 3J80E 4QB4A 2SDFA 3D4WA 4NW2A 2WXPA 1Q12A 1CZGA 3DWMA 1SMYC 4RHRA 1DGJA 3IFTA 3GTJB 1ZOYB 3QIAA 4U673 3X3NA 1JOKA 2BA0A 4PMWA 1F9RA 3QOJA 2FFKB 3E6ZX 2IGGA 1PGXA 3EA6A 3S17B 5C4JB 1EY8A 3HOVB 3V2TA 2EY6A 3K7AB 1XYIA 1BF4A 1HPCA 1CK1A 4TMAB 3MXUA 1PFBA 3C1FA 1T5EA 5TSSA 1ENFA 4X3SA 3RLFA 4LMQD 3A8IE 1N63A 3DHQA 2WXNA 5M5YB 2WU5B 1VMCA 3M4YA 1GHJA 5C4HA 3S16B 1SDFA 1XLQA 1BCPC 1MGSA 4XIGS 2PVOD 1NUCA 3VYSA 2EYPA 1OXTA 5D7GA 5FLXL 1G291 5AFWA 2PW5A 1SE3A 5EJWA 3UI3A 1GUWA 1Q10A 1LTSD 2NN6H 1SEBD 2DNCA 2A68D 4G7ZC 1CA5A 3NE5B 1KNAA 2SNMA 2IW3A 4KK7A 4M0WA 5AUIA 1HRJA 3N9YC 4JE3B 3VR6A 1FO4A 1EY5A 1JORA 1ZE3D 2BOSA 1PDQA 2B2UA 1BCPF 1KLGD 1QWYA 3TUOA 4N6EB 2N0SB 1C4AA 1EY9A 3SE0A 4KHZA 3PIO3 1SYGA 2CW0C 3T16A 1XEEA 1RODA 3ZYYX 4G4KA 2G1EA 2JA6B 1I4HA 2R6GA 1K8OA 1OXVA 4R8IA 1D5ZC 5IT9L 2VZKB 2ACZB 1F2MA 1JRPA 2WXLA 3TEYA 2JU6X 1EL0A 5ISRA 3LXFA 1TT2A 1ZYRD 1AEXA 1HZ5A 1RHPA 3OIQA 2F0QA 3PUVA 4C56C 2WKDA 2AUJD 3NVVA 3U2SC 3ZJTA 4C1NK 3J9CA 5IGDA 2WDQB 2G9DA 4RGNA 3GD7A 3GS2A 2F1MA 1WGKA 1PYWD 2K5QA 1YN4A 2GB1A 1EYDA 3HP3A 3EQLC 2B2YA 4R8NA 1N60A 3GTGB 1SAPA 4Y7NB 3NP8A 3T3NA 4ZKBB 2BS2B 4B0MA 1Z47A 1DOIA 1G2SA 2XWBB 4FNFA 5I6WA 5IODA 1YQ3B 1JB3A 2O2LD 2E76C 5JPMC 1U4LA 3Q23A 5JVG3 4CKBA 2E2JB 4GZYC 4WJWA 3Q8AA 2RVLA 2ZXRA 3IAM1 2OXPA 1C78A 1LTGD 3BK2A 2J53A 2F0OA 2WXGA 2MPMA 4KKTA 1SFOB 2J4XA 5IGGA 1FD7D 3U4EG 2PMZB 1JQ4A 1STEA 4DAVA 1NCVA 4BA1I 3P4PB 5T8IA 3CHBD 3GTKB 2O4XA 5T1IA 3OOCA 1YNJC 2QF7A 1PGAA 1AZQA 2NN6I 2Y0SB 1K53A 3ONAB 2IX0A 1ENCA 3OWEB 4MN3A 4IFDG 2BBCA 5KRUA 5COYA 3GQBA 4GLSC 2PZTA 1HQRD 1OQQA 2IJ0A 4FXGC 4JPSA 4IN3A 1YJJA 2PKOA 1XCTL 3R8BA 3FPPA 3HOWB 2DWQA 1YN3A 2NBFA 3SFDB 2F03A 1JQYD 3S1RB 1TKEA 3P20A 3D8GA 1C8CA 2EZVA 4V190 1DOKA 1ZPSA 1ET9A 3AM9A 5BMGA 4XWTA 1CZWA 2EYOA 4K8IA 1FFUA 1RFKA 1F9SA 1VZ7A 2AX5A 3Q8FA 3R3OA 5GXGB 3P4SB 3NQTA 4L2YA 1HA6A 3HEJA 5HFYA 1CJEA 4A3DB 4ZOHC 4EQPA 1FXAA 1HFNA 2B2TA 3I4LA 1RKNA 2F0GA 4HEA1 3J7YW 1EYCA 1Q8IA 1GUTA 4XDXA 1FRDA 1I3QB 3P1HA 2HCIA 2PQEA 4IUPA 3IT4B 5LL6X 4DFAA 3BK1A 4KX6B 2K1BA 2AWNA 1Y1WB 1TKGA 1OO9B 1LT3D 4ZK9B 5CGKA 1GB4A 2RMMA 3MFGA 4RA8A 1EYAA 3OWFA 1IBXA 2OF1A 4MT5A 2EVBA 3G7LA 3AE9B 1B50A 1BO0A 5LNK1 4KJNA 3AE5B 1EY4A 1SIJA 2WXRA 4MM3B 2W3RA 3AEFB 3NS1A 4DNTB 1SYCA 5T1GA 4QF4A 3FDTA 5C5MA 3TZDA 4ZLTF 4HKZE 1ESFA 2K5PA 5CBAE 3I4MB 3KUPA 1LACA 1J7AA 3ZJUA 1ESRA 4C1NI 4UAIA 2FMMA 2A6EC 1NENB 5C2TB 1OXXK 1G8ZD 1VDZA 3H3VC 4XDCA 4OZBA 4YTMB 2WNMA 3A55A 3HOUB 2EKIA 3KQ4A 3H6MA 4B08A 5K5PA 2IGHA 5G3LF 2IDYA 3G6JB 2KCNA 5KYLA 3RFZB 4RKBA 4ZUJA 3D4RA 4C2MB 1PFDA 1GPXA 4ABNA 2WS3B 3MHBA 4L8JA 1M8AA 1S5BD 3IFDA 2WKCA 1D5XC 1QILA 1WD1A 2D2CC 1YQ4B 4LK0M 5C3XA 3P63A 2D5DA 1DYQA 1QG7A 4FF4A 1YMHE 2VXWA 4EGVA 1BNZA 3VR4A 5IGFA 1JWUD 2WAQB 4KD3A 3E5SA 5CBEE 2JYEA 2F0PA 3TEZA 3P4QB 1EFID 5A2QL 1SYFA 4JWUC 1TYGB 1MSHA 3K5MA 4A3KB 1KTKA 3WCQA 4HROA 2F0LA 1QOAA 2MGSA 2V4DA 3OMCA 2CU3A 1MI2A 3S2HB 2WXIA 2M2LA 2BDOA 1EY7A 4CJ0B 1ILQA 4A90A 4NMZA 1VF5C 2AQ3B 1JICA 2RBMA 3EFXD 1XX8A 1MBYA 3NK9A 3ITPA 4V0BA 5EBCA 1Z6HA 2B39A 1RJTA 5G3LD 3HGBA 1JMLA 1GB1A 5I2YA 3KLSA 2XN9C 4OO1I 4TQ1A 1TVXA 1C79A 1KNEA 3C1EA 3PUXA 3KBXA 2F0UA 2HCCA 4ZAIA 1H9MA 1Y8OB 3VYUA 4CJ2C 1R9TB 2LJIA 3U9OA 3OSOA 3U9SA 1JWMD 2K5WA 4A3BB 2CHBD 2YYZA 4QCLA 2LEKA 1FFVA 1GJXA 1C77A 4A3FB 1TWAB 1JROA 1KLUD 2V3PA 5CC4A 3RZDB 3HS0C 2ZW0A 1TIID 1WYGA 2WV6D 4A93B 1WTQA 3HVDA 5HHDG 3A56A 3KK7A 3UI2A 2F0HA 4G7HC 3DMUA 4K14A 1DONA 1F2YA 1O7ZA 2H88B 4U68A 1J7CA 3WOFA 2EYFA 3D3RA 5EGTA 1YN5A 1E0ZA 3HRZC 2C5CA 5FOBB 2A69C 2WXHA 4XT1B 2FBWB 3AE1B 5KYIA 1WTRA 4RGOS 3LX0A 2Y3AA 2NTTA 5C4XB 5CYUA 4IUTA 3BG3A 1I7HA 4ZQ3A 2PLPA 2BDNA 4RCOA 1IUEA 2WINB 3LWUA 3HG9A 4B0EA 4M1UB 1E7PB 2M56B 1F9QA 2IL8A 4HKQA 2KHSA 4KV6A 3VR9B 2EDGA 3PUYA 3BDCA 3ETRA 3J81E 4OO1G 1QE6A 2B2VC 1UWMA 2PTLA 2V0GA 2H89B 3LNNA 1F2RC 3VR2A 2E2IB 5M5XB 3AEAB 5BMHA 1GXDC 3TN2A 2ZT9C 2ID0A 1BXTA 3BIID 3KWLA 5EKKA 3HOXB 4IDIA 2K04A 4LLGM 2KN4A 2BTEA 1D1IA 1A3UA 1LTTD 1ZXTA 2Q8RE 4J3OD 3T13A 2GI9A 3H09A 1WD0A 2BB6A 4I65A 4C3IG 2EY2A 1T5XD 1QOBA 1PRTB 1PGBA 3QWNA 1JR0D 1TKWB 3Q6SA 2PMVA 2A68C 1U9RA 4HAEA 1SYBA 1WTOA 1FMAD 2NVTB 1X32A 2SOBA 1Y8PB 3FILB 4MACA 1D1KA 1VCIA 2FUG1 4O1NA 1BDOA 2L55A 5C0XJ 2JXTA 3C2PA 2WP9B 3T56B 2WXQA 3J7AF 1DCZA 3PZ7A 2VZKD 1EQVA 4XYOA 1C4QA 3KLS