1FNVA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
b'QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
total genus 43
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnvA02
5ELCA 1JWUD 2AQ1B 1XXGA 1SBBB 1EFID 4L63B 1CHQD 3BVZA 1S5DD 1PZKD 1BXTA 1HA5A 1T5XD 1L0XB 1I4RA 1LT3D 3SEBA 1EU4A 3GP7A 1LTID 3W2DA 2NTSA 3MC0B 1TS5A 3KLSX 1PTOF 2AQ3B 1JCKB 4OHJA 1TY2A 1EEFD 1S5CD 1I4PA 1PTOD 1RDPD 1CQVA 1EU3A 1LO5D 2G9HD 3EA6A 5I4DA 1PRTF 4RGNA 4RH6A 1D5ZC 2RDHA 3BVGA 3MFGA 2QILA 1KTKA 4K6LA 1F77A 4RGOS 1LTGD 2QEJC 3BYYB 1PTOH 2O2LD 1JQYD 1EEID 5TSSA 1ET6A 2J4XA 1LT4D 3DWPA 1I4XA 2XRSD 1PZJD 2R61A 5ELFA 4ZYSA 3V05A 1S5BD 1SEBD 2NTTA 1DYQA 1LTTD 1KLGD 2WV6D 3R2IA 1SE4A 4RGTA 1SE2A 1LT5D 1LTSD 3DWAA 1MD2D 4L6TB 1PTOC 1RF2D 1EWCA 2RDGA 1HQRD 1PTOB 1LTBD 1D5XC 1QILA 1SJHD 1LTRD 1CT1D 1AW7A 1LT6D 1V1OA 5ELBA 1JWSD 2Z8LA 4RCOA 1TY0A 4BWGB 1PRTD 1S5ED 1PRTC 1V1PA 3O13A 1JR0D 3EFXD 1HTLD 4C56C 1TS4A 3TSSA 3BYTB 2ICIA 3BZDB 1ET9A 1FGBD 1G8ZD 5D3DA 4O1NA 1I4HA 1XTCD 1L0YB 1CHPD 2CHBD 1I4QA 1HXYD 1BCPF 1D6EC 1FNVA 1UNSA 4RHRA 1GOZA 3CHBD 3R2TA 1BCPD 1YN5A 1LLRD 1B44D 1V1PB 2IPKD 2XNAC 4RHSA 1UUPA 4DXGA 4RFBA 4DXFA 1D5MC 1I4GA 2TSSA 1ENFA 2IJ0A 1M4VA 5FKAC 3OWEB 1FD7D 3BVMA 1B1ZA 2XRQD 1PRTB 5FK9C 1TS3A 4RGMA 1SXTA 1TS2A 4UDUC 1PZID 1STEA 1ESFA 1FNWA 2XN9C 3URYA 1SE3A 1SJED 1YN3A 2SEBD 5D3IB 4NZLB 5ELEA 1JWMD 1LTAD 1AN8A 1YN4A 3DWQA 4TSSA 1CK1A 1KLUD 1FNUA 1RCVD 5ELDA 1RD9D 1DJRD 4Z9CB 1BCPC 1PYWD 3R8BA 1S5FD 1BCPB 2AQ2B
chains in the Genus database with same CATH superfamily
2Z9HA 1MI0A 2KFKB 1UBQA 1Z9FA 2AQ1B 3E5SA 1G2SA 3M4PA 3QOLA 2C5LC 2CHWA 3MXNA 2K1FA 2KXJA 3CSFA 5F2DA 3DBHB 4II2B 3CSTA 3PRPB 3J81j 1LACA 4GSWA 1S5DD 2BBCA 1Q12A 4LUZA 2JA6G 1FMAD 1TWAB 1QZEA 1I4RA 1C4QA 3RNGC 1QKZA 3D4WA 1BT0A 3PS6A 3RT3B 4IALA 3ZVVA 1VF5C 3RUIB 3VTVA 5D94A 4JL9A 2KKCA 3ZXRA 3QJYA 1WTWA 2MHVA 1PXUA 2EYHA 5I4DA 2HJ1A 4PS7A 1PRTF 4K6DA 2WAQB 4DPGA 3U50C 3VHTC 5NUCA 4JI3Q 3OPOA 4EOYA 1KTKA 1X9NA 1NI3A 4ODGA 1N36Q 1F77A 3IHPC 5JHBA 4AJYB 4G4KA 3KBGA 1TXYA 3I4MG 1FIQA 1DOXA 3D31A 4W9EA 3D8GA 3DWPA 3VUWA 3RI7C 2BYFA 3FILB 3E56A 3HOUG 3JAML 3AE5B 2LVPA 3NWTA 3TUOA 1NMGA 1S5BD 3U7ZA 1LTTD 4B6WA 2N1VA 1ICFB 3S1RB 1EYAA 1SYEA 1R4MI 1F2MA 4MM3A 1EWHA 1QG7A 2L76A 2BH2A 1DOLA 1YHQA 2A5UA 1GVPA 4BY7B 3P4SB 5A2QE 1WI5A 4LMQD 4E74A 4HVBA 2ES2A 3I4LA 2KCMA 4W9JA 4KIKB 2AUKA 3SK4A 4G3XB 4QY7A 4W9GA 5ELBA 4PNYA 1C76A 4ULLA 1WJNA 1TGZB 2K75A 4L2YA 1IL2A 3WALA 2E5LL 3UI3A 1HQMC 1HA6A 2R2QA 4IPDA 3EGRA 3MVVA 1HTPA 4CDEC 2KVMA 3W3AA 3I9V1 2ICIA 1UAPA 3PGZA 4I7AA 2CFMA 3B6YA 3AE7B 2EKIA 4ZRPA 1CFMA 2ZVOA 3VRAB 1UWMA 2OOBB 1WGYA 1BQQT 5C5LA 2KFJA 4C3JH 2RQXA 2JA5B 2KWDA 3F2CA 3S1NH 1Q82C 1GOZA 3CQZH 5C4HA 1B7YB 2PYKA 1LLRD 2XNAC 4KD3A 3AM9A 5GMVA 1GUTA 2K01A 1DGJA 4CKBA 1Y8RC 4EE2A 1GXDC 1EF5A 1IXRA 1QVFA 3M3YB 2TSSA 2K8CA 4ZRQA 1VQJA 1SDFA 1FM0D 3OWEB 4JBWA 1H95A 5C4ZA 5HHDG 3RZFA 3Q8DA 5KHQA 1VQDA 2KMAA 1E22A 1WTOA 1CUKA 4E3CA 2JRHA 5FK9C 1ZUD2 1XNRL 2AEHA 2VB3X 1X3QA 4LNKA 1AARA 4UY8C 4P73A 3AU4A 5AUKA 1ICWA 4KGRA 5CV6A 4DR3L 3ZRCA 1SE3A 5M5WB 2DZJA 2OXPA 4XDXA 3ND9A 1FCLA 2XGTA 3KW5B 4KKUA 1AN8A 2NN6H 1PH6A 4C80A 1K3RA 1I35A 2Z0SA 3MAQA 1PYWD 4LF9L 2M9VA 1E7ZA 5I9OA 2Q2UA 4IPCA 4PV1C 3Q69A 1IHZA 1JWUD 1ZXHA 3FKIH 4DR3Q 4ZRZA 3Q22A 3IAS1 1GC7A 1VQ4A 4H0LC 4CDDC 2RDFA 3A33B 3BVZA 2RF4A 4A3KB 4B0EA 1F2YA 4HCNB 4M01A 1CZGA 1Z2MA 3RNAC 2K5WA 5IWAQ 2QW7A 1QNUA 2DZMA 2BW2A 4KN4C 3OHXC 2RPQA 4S0RA 5J2RA 2X69A 2PKOA 1PFBA 3PSEB 3QHTA 2VNUD 4G11A 4OHJA 2HJ8A 2AYOB 4DV4L 4NQKE 2BS3B 1II3A 2DJFC 4IURA 3R93A 3FDTA 1VRAB 2EY6A 2WB1B 1K8GA 1PH9A 4RH6A 1AP0A 2HIXA 3TS0A 2Q5WD 3M7NA 1BUVT 5BMHA 2Z0DB 2BA1A 2B2VC 4IO9A 2PMVA 3PLVA 4A3IG 1FXAA 2BYTA 3K57A 1Q46A 1VD2A 4IPGA 2ZNVC 4BKGA 1V8CA 2EKEC 4WJWA 3HOWG 1JORA 3QQ8B 1KLGD 5C3WA 4B3ML 4FF4A 3NZ3A 2MLBA 2K32A 1KDAA 5CX3A 2B2TC 1TYGB 4Q5VA 2B2UC 3GD7A 2FIDA 1S72A 3N1YC 4JI1Q 5M3FB 3RN5A 1YZ6A 2HIVA 5CV8A 1LTBD 1HCZA 1ML0D 3I57A 3PO0A 2F0GA 4IOIE 4G0NB 1LTRD 2N9KA 1WMHA 1NE3A 2L1BA 1IUEA 1N62A 1SYFA 2FCNA 3KJOA 3BINA 4GN1A 4FF2A 1S5ED 3HOUH 3HOVB 3PRMB 3C46A 3D6CA 3MHSD 5JEAH 3Q3NC 3PCOB 3NJTA 4FHJA 1G8ZD 4ZKCB 2J7QB 1I4HA 1U4LA 4UAIA 3PIOA 1L0YB 2YTXA 4OZCA 2W82A 2JN4A 4XWWA 1WOCA 4DK6C 4DGZA 5FJ8G 1WR6E 2JY6A 1E24A 2Y0SG 5AZFA 4HJ9A 2BB5A 3SVMA 4XQJA 1J7BA 3AN1A 4IC7B 3CD6A 5C44B 4JGHB 2H4OA 4GNXA 2R2OA 2K9XA 1L4ZB 4KSLC 4GIVA 5CBEE 1K50A 1CQFA 4G7ZC 5C4XB 2ZW1A 4U68A 3S17B 4DHJD 2KDIA 1ENFA 3DBLI 5HI1A 4XQNA 1FRRA 2KHSA 1GNUA 4J1MA 1UZXB 3V3XA 3N6RA 2MWSB 1MG8A 2GBJA 2KWUB 3KLSA 2AX5A 1V49A 4FNFA 4B08A 2C5CA 3RLNA 2QJLA 4M8NA 3ZNGC 5D3IB 4I6NB 2F0MA 5ELEA 4PYZA 3KDFA 3JAME 1VQ8A 5BR8L 1FNUA 3W1BA 1RCVD 5GAEC 2NVTH 4GB9A 1X6OA 1KRSA 3TP5A 3GTOH 3HS0C 3EFUA 3VUYA 4YIJA 1J9OA 4KV6A 2BTEA 3H6MA 1JW9D 3BIID 3KYDD 1IBML 4EZKA 3GTMB 1WCMG 1WF9A 2L4NA 1SFOH 2F0OA 2VZKB 3UDXA 4YY3L 1WD0A 2B63H 4OX9Q 2O2VB 1T5EA 2JZZA 2VW9A 1ROEA 1LTID 1OTCA 1HZ5A 1TTNA 3CCJA 3VVWB 1BBXC 1J7AA 2PI2A 2O5IC 2KTRB 4C4VB 3EBEA 5EE9A 2N49A 2KDBA 3VR4A 1NNXA 3KLWA 1R7SA 2HD5B 2G9HD 1TKWB 1ONLA 5AFWA 4XYQA 1F2RI 2M2LA 2N9LA 4JI2Q 1I94L 2CH4W 1J6QA 2R7ZG 2EY5A 2DYMA 2IGHA 4JCVE 2O6VD 2VH1A 1NAPA 2VQFL 4JOIC 3Q6BA 1K28A 1BF4A 5AJ3Q 1C48A 3PIO3 3KFUA 4X64L 1NYQA 3ENEA 3DLLA 3BDLA 3FC4A 4KVGB 3I70A 2LI5A 4K3BA 4MGZE 1ET6A 2FINB 2J0TD 1UD7A 2BDOA 5LMNL 4LAAA 1VQ9A 3S1QH 3PUXA 4P1CC 3APCA 2F0HA 5J1ZA 5KYIA 5CYUA 3S2AA 1F9RA 3ZRFA 3P63A 1L5PA 3NENA 1PH1A 4JPSA 4RGTA 4WJ3M 3RPFC 4JG2A 1HUNA 4DHZB 2X38A 3DVGX 1WYDA 3DWAA 1YNXA 2SOBA 4PS3A 5IODA 1FRDA 1L2FA 1E7UA 4HROA 2EMTA 3X0WA 5LMNQ 1WGKA 2L83A 1JOKA 4B3TL 1FEHA 4OELB 1U4MA 3TIXA 1EOTA 4AH6A 4DV3L 1NY4A 4A3IH 2F03A 1UF0A 4JQWC 1PRTD 1PRTC 2OF1A 2Q2HA 4R9WA 2LXCA 1MJCA 2D5GA 1R4NI 2Z4HA 3R7QA 3HOZH 2O4XA 3HOWH 1PFDA 3OMGA 2XK5A 3N20C 1FGBD 2HDMA 4IUPA 4YTMB 1T0YA 4EZLA 2Y0SE 4DBGA 1N61A 3CCUA 4JC0A 1N8RC 2NBUA 3P42A 2NCNA 3VYUA 3OG5A 4DUYL 1IKLA 4MEMA 4H13C 1ISNA 2W3SA 2L52A 2N78A 1WD1A 2MQHA 1EIGA 1QE6A 3U9SA 2IPKD 1IZ6A 1V8QA 4RHSA 5HURA 5KGUA 4X57B 5HKHA 1NBWA 4A76A 3W1GA 1D1KA 1I4GA 1PFSA 3S2HH 1MPEA 5T1IA 2LUMA 5DPRA 3UGBB 4L8JA 2ASBA 2JP1A 4D2KA 4R3DA 2O5JC 4DUYQ 2K1BA 1VCBA 4ME5A 4AQ7A 1B1ZA 4QUCA 4C3JB 2B39A 3GDEA 5EKKA 3S1NB 1SXTA 3RNBC 3ZNHB 2AHOB 3CQZB 1SGHA 2KHIA 2WACA 1QUQB 4NKLA 4OIKA 2V9HA 2XTIA 2PQAB 2KQ7A 4REZA 3SU8X 3QIAA 3EHVA 2E2JH 2ZVNA 1LTAD 2RMMA 4A3DH 5KYLA 1CK1A 1D1IA 3I8ZA 4YHHQ 4A3MG 2NVQH 5M9OA 3F2UA 2SNSA 3R8BA 3S9WA 2ZJRA 4F7XA 2OTLA 3Q3FA 3NXWA 5IP7G 1PDQA 4US8A 3UE1A 4R8IA 2IY0B 3BK2A 4P75A 5JVG3 2NVYH 4NAWA 4ZHPA 1RFAA 2VQEL 2EOTA 3HIZA 2Z4IA 3NE5B 2R92H 1ZDVA 2HQLA 4IUVA 2ASQA 1YHAA 2KCTA 3P1HA 1HNZQ 3AH7A 4NY0A 3P7JA 3A4RA 4RKLA 2LKVA 1J5EL 2WXHA 2IO0B 4QUFA 4JI0L 3GZNI 4ACFA 4PS8A 3AMUA 4X66L 3MEFA 3RULA 4AYBG 1QCBD 1EUVB 2DBYA 3FKIB 1PFMA 1F2LA 3NZSA 4DV2L 1VQGA 1BBWA 2D0PA 3U9OA 3E9SA 2KJHB 3B08A 1JICA 4RGNA 2AWTA 3T1HL 3J81L 5IP9G 2KO3A 4W9LA 2F0EA 3PQIA 1G6JA 2M19A 3B2GA 1TIFA 1IYUA 1D7QA 2F3VA 2OQ0A 4K14A 3KUZA 5EAYA 3DVNU 1HNXL 4ZOHC 1ZYRD 1AEXA 2R61A 1ZYRC 1VQNA 2C60A 4JWUC 2E2HH 1VQIA 3OWFA 4XXEA 2KMMA 1WTXA 4JE3B 3R2IA 4GKJQ 2I5LX 3QOJA 3RNCC 2R7ZH 4K2KA 3U7DA 3IKJA 3MWYW 1WGGA 4L6TB 3J7ZC 3GO5A 2XBBC 1Y1WB 2RCNA 1HPCA 2BB6A 2PMZB 3UDGA 2GI9A 3VXWA 3WOFA 2K8BA 2EQSA 2A73B 4EQPA 4DV5Q 3H0GG 2GB1A 3TEZA 2Y5BB 4BBRB 2M56B 3PMFA 4I6PA 3H15A 2BGFA 3SE0A 3CMEA 1YJNA 4ZRIA 3NBHA 4GLVB 3P20A 1HEZE 3ZJVA 1SYBA 2K5VA 2ZZPB 3PUZA 3N52A 4F87A 3LB8C 3I90A 1FCCC 3A1QA 1XTCD 3C8YA 3DWMA 3QARA 1C9FA 4YCVA 5IGGA 2QA4A 2Y5PA 2MCNB 1I4QA 2F0TA 3VUXA 2I1KA 4YWLA 4MGKE 1JALA 1LM0A 1ZGUB 2A74C 2B2WC 2EYJA 1DGSA 2D2CC 1AE2A 1V6EA 2JZ3B 3TBIB 1A3VA 4B3SL 5IYBG 3VR9B 2PW5A 2YTVA 3HOUB 2JVCA 1EQRA 2K5NA 3AXCA 4GDLB 5JOBA 2A68D 2EYLA 1EIYB 4C7ZA 4P16A 1WGRA 1HE8A 4A20A 2JA8G 1WFQA 3VR3A 2IX1A 2KBNA 5M3MG 1MVKA 4X65L 4US9A 2VUMG 2VY3A 4OWWB 4AWJA 4KHVA 1EQQA 1CKNA 1Y8PB 4MJSB 1WE6A 1TS3A 2KVZA 4GGQA 4AIMA 4FVMA 1PZID 2PJHA 1FD6A 1ESFA 3CCLA 1M90C 2DAFA 2B2VA 4DK3C 4JI4Q 4M0WA 1I6HH 1O7LA 1GHKA 4HPLB 1CKMA 2RD0A 1AWDA 4IW0A 3KH0A 1SNPA 2UUAL 4A75A 4PZ7A 4S17A 4BKSA 3Q8EA 2R93G 1P16A 2JXMB 3I3TB 1O7ZA 4KHZA 4PMWA 4N9PA 2WQYB 4A3BG 2IO2B 3EIVA 1K0RA 3I73A 4L63B 2FNJB 1ZKOA 2KJ6A 2WHIA 4JI6L 2OEOA 2PPHA 3C0RB 4A93G 2KC2A 3DBRB 3BU2A 3AULA 1PVOA 4MH0E 3K7UC 2IY5B 5BN5A 2ALYB 2WX0A 1UGJA 2NVTB 1GJZA 3KK7A 4AYBE 3GTOB 4A3MH 5DCNA 1E10A 2R6GA 2UYZB 1HR0L 1WX7A 3AEBB 5BYRA 1U0LA 4P7IA 3TZDA 4PMCA 3K9OB 2CU1A 2LASA 1NTGA 1D4BA 4XDCA 1C4PA 3EA6A 3M7GA 3EROA 3D6WA 1I5FA 2Q8TA 1SFOB 3RFZB 1YNTE 1F2ZA 1HH2P 2B63B 2YVCA 1B53A 1TZ1A 3F8TA 5E7NA 2QEJC 4YL8A 1HR0Q 2QKIC 1VQ5A 5LLIA 3ITPA 3KBXA 3OIQA 1VR9A 1WTHA 2KVRA 4CDCC 3CRLC 1NJIC 3OW2A 4J3OD 4WJOA 4RM8A 2MHJA 5CV9A 4AS1A 4LUOA 3V2TA 5LXIB 2F52A 1SIJA 2BWFA 2FFKB 1JMLA 1O78A 1SNQA 2PNHA 4MELA 3RNEC 1STAA 2Y3AA 2RVLA 4DU9A 3H3VI 2F3IA 3WA0A 4MN3A 3GOEA 3R3MA 1E8ZA 4OWXB 4KD4A 3A4SC 3TBLD 4F8CB 3F1ZA 3S1QB 1K8MA 1TT5B 4A3GG 4FP5D 2A8VA 3V96A 1A8VA 1AZPA 4CGYB 3BZDB 2K22A 2ZCBA 3M3JA 2JWUA 4ANVA 4WFN3 4OO1G 4A3PA 4K7WA 2J0KA 5LHY1 4WJQA 4O2DA 1KC8C 2WXLA 3A7AB 3Q3OC 3DMUA 1XCTL 2K4KA 2R7DA 2H1EA 1TWFH 3CHBD 3R2TA 2EPBA 1FFVA 4O42A 4DV7L 2NYZD 3AEVA 5ELOA 3LWEA 4L23A 4DXFA 4K5VA 3HOZB 3HOWB 1RLFA 2V0GA 3L13A 4P72A 2IJ0A 1J0GA 3RZWC 1X3GA 3NRZA 1DOMA 4ITKA 4C2MH 2JA7G 4DK0A 4DR7L 3TL5A 3J81E 4LJZC 4GZYC 3DDCB 4B3RL 2ENBA 4GDKA 4L5QA 2NVXH 3F2DA 1XD3B 3W5UB 4CO7A 2L11A 4OO1I 1SNMA 2JEAI 3EJIA 1GG3A 3HK0A 4A3EG 1CZPA 2WXFA 3M63B 3Q8AA 1X65A 2K6AA 1EZ8A 4DR4L 1MI2A 4TQUS 4KHPL 3S2HB 3I4OA 2J52A 5ELDA 5HGQA 5IA7A 1C78A 3Q23A 3ONSA 4R4QA 1Y1VH 1S5FD 1KABA 3D4DA 2LMCB 5IYDG 1WXSA 5M3MH 2K0PA 2JSOA 3A9JB 2RHQB 5JJKA 2IGDA 4KDIC 3NK9A 4KGSA 5CV7A 2UUCL 4RAUC 2LS01 2Y0SB 3GTGH 1DOIA 4DR2L 4KZCA 4DHJB 1PMRA 4KI0A 1CJEA 2OJRA 1ENAA 4KIKA 2KWVB 4XYCA 4LF8L 1NSNS 2J0JA 1NDDA 1T5XD 2E2JB 1GD7A 4A3DB 2EZVA 2E3TA 2D11A 2NVQB 3MC0B 4DR1Q 1MBYA 3AU7A 4BY1G 4XDDA 2WXIA 4P2CB 2AQ3B 4NPSA 4IFDJ 4ASWC 1LYLA 1LXDA 3H94A 4DKAC 2SAKA 4KDLB 4DV0Q 4EKUA 1H8CA 1SRUA 2NVYB 2K6DB 1SMYD 4A3BH 4LF8Q 1SMYC 4RMFA 1J7CA 2LUEA 2EVBA 4HSVA 1YMHE 3K7AH 2R92B 1GC6A 3L54A 1GB4A 4MTKA 4PMBA 1WE7A 3IL8A 2KHWB 4Y7NH 2L55A 3QG1A 4RCNA 4C3IH 1XX8A 1E3PA 1WSPA 1PDXA 4LW1A 1SAPA 2KECA 5IP4D 2MX2A 4NXNQ 5EPKA 5M5YH 2D9UA 1F52A 1TKYA 4A3LH 3AB5A 2XRSD 3C3LA 1G6PA 3HRDD 3ZDMC 4LTUA 2PLPA 3L3OC 3L2PA 4JI3L 1F1HA 3FKYA 4GOCA 2WV6D 1N36L 1N33Q 2VL6A 2N9XA 2I0QA 3DUZA 3FPUB 2J53A 3HOXG 1PGAA 4HIMA 2PO4A 1KNEA 2UUBQ 1UELA 1HRJA 1NENB 2W9NA 1NUCA 1HQRD 4NJ7A 4WJ4A 3PRZA 2EYFA 1DXMA 2WP8J 3IFTA 2FCMA 3H7PB 1HHVA 3RNFC 4JI5Q 1IKMA 3AE9B 3I56A 2WFWA 4HJ5A 3DHQA 5AUIA 2O6VB 5IKCM 2FMCA 1V1PA 2Z6KC 2E2HB 2NZHA 1EOVA 2F0FA 4L5TA 2L12A 1JMCA 2UXDQ 5IGBA 4OIJA 2B3AA 3IFWB 2KDEB 1YJ1A 1OXXK 4FXDA 4NJCA 3FHWA 2MQJA 5D3DA 2K14A 2R7ZB 3TEYA 1EYCA 4QCLA 2I46A 1L7YA 4BOZB 1P3QU 5C0XG 3A8JE 4HAEA 1F0ZA 4JV5Q 1E9MA 2KZRA 3SFDB 3WCQA 4RHRA 5J18A 3U4EG 3UQAA 1KLVA 4XTCS 5IYCH 2ZJDA 3NUCA 2FXQA 1CM9A 1YNND 2KX0A 1STGA 4A3GH 1MHXA 4WIPA 1KDCA 5C1ZA 2K5QA 2DHZA 2NB0A 4PZ8A 1FD7D 1HZAA 2IYDB 1T3QA 2LGDA 4OO1H 1PRTB 1MIUA 1E1OA 3K5NA 1TS2A 4XIGS 4JW0A 4UDUC 1A2TA 1X32A 2FHTA 4C1NK 2GVBA 1FPYA 2PI2E 4LDTB 4OW0A 1U9RA 3PO2G 2INDC 5C0XI 3GTKH 1VQMA 2PW9A 3A8IE 4J15A 4NZLB 3HVZA 4TKNA 2F0DA 2V4LA 4LJPB 2DN8A 3HEJA 4U673 1N5XA 3RR5A 1WXMA 5L95C 2ZXPA 3PREA 3K8AA 1OTRB 1KDBA 4UPAA 1UEBA 2JA7H 3QR8A 4YWGG 5CORA 4QB4A 1VQ6A 2G45B 3UINB 2KACA 4RF0A 2LFNA 3NVYA 3DM3A 3SK5A 1I6HB 3T4AC 3ULJA 4A3JH 4R4IA 3SK8A 3J80L 1XNQQ 4JPBW 1VCIA 3CMAA 3CKIB 3GP7A 1UWVA 4H44C 4RG1A 3WWVA 1C4AA 1YQ4B 2B76B 1VDZA 2NTSA 2XVSA 2MUYA 1E2VA 2BPSA 4DDGD 2L00B 2B2YA 3PV0A 3CF6E 1EEFD 2ZTEA 1KFYB 5IYDH 5DEHA 1PTOD 1ZPSA 1I3QH 1LO5D 2IHFA 3ML8A 3TEXA 2V3SA 2JXXA 1U5KA 5IWAL 3CCEA 2N9EB 3IG3A 3W5VB 2UU9Q 4MT5A 1I7HA 2PZTA 4YXDB 4MGIE 4ICUA 1Q10A 3KWLA 4G7OC 4K5WA 1P98A 2WGSA 2A6HD 1AFPA 2IT1A 2A6HC 4A3MB 3CC4A 3I4NG 2J4XA 2IX0A 3RYTA 1V5OA 1LT4D 4BY1H 2FCSA 1L2NA 2R7FA 3RZDH 1U4PA 1RJTA 2KC1A 2KA7A 4WRDA 5IAAC 2AWOA 2VS1A 1DYQA 5T8IA 5DM73 2K39A 3RD2A 1CTMA 3HG9A 2PZUA 4KKSA 4DFAA 2HHHQ 2KQ3A 3T3OA 4O0AA 3E3XA 1K52A 3ONAB 2PW7A 2FIFA 2L9HA 1JOOA 3H09A 2E75C 4IFDG 1I50H 1P9DU 3EFCA 3NHEB 1XLQA 4IJLA 2JA6H 2MBHA 3G4SA 3TS2A 4IUNA 2L7RA 5E6NA 1HTLD 4DHZE 4IQZA 4FJZA 4IUMB 4NAMA 1A5RA 1NMFA 1VMCA 4JI1L 1OFFA 3CAMA 1S40A 4NXML 3L10B 1YIWA 3FEWX 4XT3B 4HR7B 3CXCA 4HMIA 3BJUA 2N7DA 2BOSA 2HE7A 2UWQA 2F4IA 4DAMA 3HKZG 4FYDA 1PHJA 1K0SA 3ABVB 1JQ4A 2E8GA 2WDVB 2N8NA 3T16A 4DAPA 2LSSA 4LNOA 3TREA 2AL3A 4OGQC 4FXCA 1SROA 4JI7Q 4NXMQ 4DR6Q 4IFDI 4IM3A 1E8YA 3G6JB 3I3CA 5HGTA 3I4MH 2BS4B 4DV1Q 1F9QA 2BE5D 4IM2A 4Q2JA 4Q0FA 3IVFA 2Q2TA 1O7YA 2IO1B 5EJWA 1VMPA 3GTJH 4BBSG 1L1OA 2NZ1D 1VQKA 4K5XA 1QJOA 1TWFB 1I6VC 2A5HA 4A3FG 3DHIC 1CSQA 4FLHA 1LABA 2K50A 3T9LA 2SEBD 3A9KB 1IYFA 4LWCA 2A69D 2KN5A 4X3UA 2PE6B 2A69C 4S3SA 3PTFC 2RA4A 5CV5A 3WANA 1V9PA 4P74A 2LGIA 5BMIA 3TEWA 2FE8A 4Y52H 4EQ5A 1V81A 1L6VA 4HJ7A 3ZGZA 1EZ6A 2KCCA 1FXTB 4C2MB 3MTNB 1F9JA 5G55A 2M4NA 2EXDA 4K3CA 4PQXA 3T1YQ 3GTLH 2NVXB 4V0BA 4JI8Q 4CJ1B 2SNMA 2D5DA 2AKWB 1O80A 1BKBA 4JVZA 2V4IB 2J0MA 3BWUD 3DBSA 3ZLZA 1KQSA 3PO2H 2CH4A 3Q8CA 4R1JA 3QO2A 5JJZA 2TMPA 2ZM6Q 3OAWA 5E1FA 4XC2A 3ULPA 5IOIA 3JAMc 2F0JA 1Y1VB 4QMGA 2JU6X 2QIEB 5M3MB 4QL5A 4IWPA 2ZJPA 3VR8B 4QAYA 1JROA 1MGSA 1EU3A 1KM7A 3MP9A 4OX9L 3LNNA 4RM9A 3GTGB 4OVVA 1HNWQ 3W1SC 1D3ZA 3PUVA 4ICVA 3BVGA 5H8YE 2RR9A 2LWPA 4IUTA 3TRZA 1C9OA 4A9AA 1PTOH 3CP0A 4FADA 4F88A 1S3OA 2G9DA 4ZK9B 3BK1A 1F2RC 4OVZA 4ANWA 1ZDXA 1XLOA 1SNDA 4YSZB 2M17A 3DQVA 3U4ZA 4JI2L 3GTQH 2C7HA 1DCZA 1A63A 3PSIA 3NHHA 4HEDA 3N1XC 1B3AA 1VZ7A 2DAJA 1SEBD 4A3BB 3NS1A 2LRWA 5HFYA 5AJ3L 1VQOA 3L4PA 5I6WA 3K7AB 2FUG1 1YEZA 2JQOA 4HEA1 3RMHA 4KN7C 2GVAA 4Y7NB 1B3QA 4C3IB 1QUQA 2F0NA 4FULA 3NBIA 4M02A 1X54A 3LWUA 5IT9c 2GOWA 4LFAL 1SJHD 2I38A 5M5YB 1Q90A 4BBNF 2BA0A 1LT6D 2WKCA 1B2TA 5GQOA 3UDFA 3I63C 4MACA 2DZKA 2PE9A 2IX3A 1VS0A 4LF5Q 2NR2A 2XWBB 2NBVB 3JSVA 5FLXL 1N9WA 1TS4A 4X62Q 5BN4A 2WAQG 1HTOA 3VRBB 3GTPH 1XEEA 3A5ZB 4LFAQ 1CHPD 1F9SA 2CHBD 2GA4B 1C77A 3HKZE 3NEMA 4M8AA 3J80E 3FPPA 1T9HA 2K05A 3MXGA 3KUCB 4UP9A 1QLBB 1WMHB 1JB3A 3EUB2 1W2BA 4ARIA 4GS3A 3JVZX 3LX0A 3RLOA 1PGXA 4IFDH 2MJEA 2N0SB 5IE8A 1WXVA 1SYDA 3VDYA 1D5MC 3NOBA 1JJ2A 3BZCA 4GKKL 2V1CC 1QOAA 1PA6A 2OWOA 3KF8A 5C4JH 2DY7A 4DA2A 5JJIA 1V2YA 2XRQD 4BY7G 2E2DC 3VQIA 4HIKA 1WM2A 4QF4A 4RGMA 4LDTD 3GS2A 3RD4A 4GNXB 2WU5B 4FXKC 2QGQA 3TDQA 2F0UA 1STHA 4CKCA 4DN4M 5I2YA 1HZ6A 1YN3A 2D07B 4LF4Q 4GKKQ 3NVVA 4L5RC 4A3GB 2D3GA 2DJGC 4TSSA 1SF0A 3AI5A 3OMCA 3UIOB 4NMZA 1ZOYB 4KKTA 3CPWA 4M00A 2NPTA 1LV9A 4RA8A 2DNEA 3KJPA 3ND8A 1FJGQ 4DR5Q 4A3OA 1SE9A 1EIHA 1VLBA 2K25A 3Q3JA 4BBSH 1PUTA 2RDBC 4IWQA 3H7SA 2LHEA 5IO9A 4YSYB 2K33A 4YHHL 4IG7B 3LXFA 3STBD 5EKLA 3KDFB 1HA5A 1R4QB 2MO1A 3STBC 4A3FH 3GTKB 2ONQA 5KNCA 5E6JA 3SEBA 3TP6A 2WKDA 3NP8A 5FJ8H 2EMSA 2GBRA 5BN3A 3VFKA 3KLSX 2K3UA 1RYJA 2EY2A 1TWGH 1Z47A 4KMUC 2INNE 2UXBQ 2JA7B 5HY6A 4TRDA 1EY4A 2RGFA 4LNFA 2J42A 4GOPB 5IGDA 1EY8A 1HNZL 3RNUA 4AOFA 2ZT9C 1SE8A 3AEAB 3TMEA 4LF6Q 3HGBA 2DGYA 3FRPB 3T3NA 2RDHA 2CR5A 1YHBA 4LK0M 4A3JB 4LNIA 1JJGA 4LK1C 2WXPA 5EKIA 3TZUA 2RHSB 4B95A 4POFA 1C1YB 2LFIA 1LTGD 4TVAB 4A4IA 1CA6A 5KEEA 2CWPA 1A6XA 4DUZQ 3J7AF 3PPAA 2GN5A 1KH0A 4FF3A 2BYVE 3BS1A 1PZJD 1WGDA 2N7JA 3H91A 1I3QB 4ZYSA 1WTQA 2KT7A 3N32A 1GUOA 3A74A 3HFZB 1XMQQ 1GUSA 2KENA 4MJSA 2EXZA 2FCQA 4A3KG 3SR6A 1B8AA 2IY1B 1UE7A 1LUZA 1A0IA 2X6LA 4HMJA 3Q14C 2L3ZA 3TQYA 3SD5A 3OTOQ 1N34Q 4JIOU 2IBIB 4DV6L 1XPUA 2D10A 3E6ZX 4EQNA 1V80A 1KL9A 3CCQA 4HIOA 1J19A 2MP2A 2DX5B 1KOTA 1PLFA 1WCMH 3MEHA 1MFWA 1V1OA 4ID6A 2KTFA 1QT9A 3RZDB 5H92C 4GKJL 1EM7A 2LJIA 1CZWA 4C56C 2L05A 3WAMA 1NR2A 3TJPA 3BYTB 5I9PA 3V60A 2WB1G 1VZ8A 4DV6Q 5JJLA 2JSVX 3T51B 1XWEA 1C0AA 3P2BA 2C9OA 5C3EG 1EYDA 3L7ZC 3DPDA 4DV5L 2MBQA 1HXYD 2N4FA 1PYBA 4NJ6A 3KUDB 1I50B 3K9PB 5I2XA 5AEKB 4MH8A 3CF5A 1VQPA 2JA6B 2GMIC 4JBMA 2ZW0A 5FR3A 3IBEA 2JPHA 2WXOA 2XK5B 1A3UA 5IN7A 4KJOA 3FVQA 3CCRA 5BMGA 4KX6B 2KDFB 1UH6A 2UXCQ 3FMCA 1R4MB 4JLCA 3HVDA 2YU9H 1Y8NB 3IFDA 4JYAQ 5M3FG 2RPVA 1WIAA 3A8KE 1IBXA 2WXMA 4K2LA 1STEA 5J22A 2LJ5A 4W9IA 3J7A5 3A7LA 1PH5A 1DD2A 4YCWA 4L5SA 3H8HA 3CMMB 3U52E 2L1AA 4W9DA 3N3KB 5HG2A 3M4OH 4JBKA 3I4MB 1K73C 3ZXVA 1DJRD 1VQEA 1QOGA 4HRSA 1EY9A 1E1TA 2ZTCA 3S1RH 3B9JA 1EY6A 1BOSA 1Z7TA 4V190 1WJ4A 1HZBA 4JI4L 3GTJB 2QCPX 2A68C 1E8WA 3Q0AA 1QQRA 4LFCL 5H1SE 4I7ZC 1WFYA 5C44G 1Q3LA 5ISRA 4C7YA 3BDCA 4XE0A 1DM0B 4USAA 2MP1A 3DOWA 5G2NA 4B0MA 5BO4B 5FLXE 1G91A 5JHAA 1PTOF 4KY6A 2PZWA 4R4CA 3TP7A 3GB1A 2WX1A 2W54A 1FYCA 1SR3A 3KLRA 1M94A 4AUQC 1EWYC 1YBYA 4LFCQ 2KQSA 3PGEA 2I07B 4RWSC 3GTLB 4NAWB 4NP5A 1YIJA 4HIDA 1OQYA 4W9HA 2KHJA 3CU7A 1HZ9A 3N1ZC 4KV2A 1B9RA 5EBDA 2JJQA 3PVLA 1XLNA 1G2TA 1G6ZA 2JWZA 2PTLA 3OYYA 2QILA 1GM5A 3PO2B 1YVCA 3S15H 1GUWA 5TR5A 5EQ0A 3AMZA 3CPFA 4N6EB 1W6JA 2B2TA 2L5TA 4ZDVA 1PGBA 2B2UA 3CW2C 5COYA 1MJDA 1H9MA 4GLAC 5EDSA 3GE3C 5ELFA 4PYUA 2C7NB 3AE3B 2DENB 3A5UA 4AQYQ 1NVID 1IGCA 1RKNA 2NMQA 2WU2B 3IT4B 1QNKA 3OIPA 2NWGA 4ANUA 1WTVA 5JPMC 3WAPA 2XIWA 1EY7A 2IHEA 3VR6A 3KF6B 4WWMA 4ZHOA 3I5JC 1MD2D 1KJTA 2BDNA 4ZUIA 4XYOA 5LL6S 5IP7H 5J39A 2KD0A 4P1BC 1PTOB 3S2DH 2E76C 2KDMA 2KWCA 1QZGA 5DNFA 3GTQB 5C0XJ 2LMCA 1NCVA 1C8CA 4OL7A 1WX8A 3A9JA 2M1MA 4H02A 3ZNID 1Y69U 1IBLQ 3U8ZA 5LL6X 2N88A 4C3HG 4DK1A 4MNOA 4IWOA 4CQNA 5E4XA 1V9JA 2KJRA 3D3RA 2YLMA 3WAOA 2KYWA 2EELA 4I65A 5KNDA 1SYCA 1BCPD 4PT5A 4KKJA 2EIFA 1EFWA 1UUPA 1WTPA 5IP9H 3ZKJC 3NBHB 3VYSA 1G291 5JEAJ 1SNCA 4MDKE 1K8OA 4OXPA 1SN8A 3A1QB 4DK5A 2BYEA 3GV6A 4N58A 4WJPA 3GTPB 3WDNA 1T0QC 3NQIA 3BVMA 2L0TA 3NY5A 1A2UA 3DCGA 4BBNC 5C3EH 5D14A 5DM63 2WLBA 2KFKA 1HTQA 3NQTA 4DAYB 2ZJQA 2F4VL 1N63A 1R9TH 4GNXC 4WQOB 2N9PC 4WQMA 1FR3A 1PQSA 4GN3B 3S1MH 1JWMD 1EYGA 4A3CG 3CCMA 5FO8B 2INPE 1OGWA 4A3IB 3AYHB 3M62B 3AE6B 5C4JB 3H0GH 2Z0EB 4NPNA 2AQ2B 5E6OA 5ELCA 2F4VQ 2ZEQA 1C3TA 2MO0A 3LDZE 2MRPA 1EWIA 4X3KA 1IYJB 2F3WA 1IBKQ 4BS9A 3J81c 2JQRB 4M0WB 1N60A 3JAMi 3HKZB 3H7PA 4NNJB 1XYIA 1WRIA 3TMPB 3T53B 3W1YA 2O6VA 4JOIA 2G5DA 5BYQA 5E4WC 3Q3MC 4FJYA 1KAAA 1GO3E 2JA9A 1QOBA 3DBLB 5ELNA 1Q1OA 2OT2A 1WGHA 5IYBH 3RN2A 1TWCH 4EGVA 4GLSC 4LF7Q 4C3JG 4GOPC 3DEOA 3FILA 1TQOA 4GLXA 4BBSB 1H9SB 3UDIA 1L0WA 2WP9B 1X3FA 4KZ0A 2JA8H 4A3FB 3S24A 4DR1L 3V61A 4NDXA 5EGTA 2VUMH 4RGOS 3VR5A 2BKRB 1QVGA 2LVQA 4BVUC 3PO3G 4DV0L 3AB9A 1YNJD 3TP8A 1KRHA 1YNJC 4N8FA 3U58A 1TWGB 2MPMA 1Q81C 1JWAD 2WDRB 3V6CB 2IW3A 1GPXA 1SSNA 2HCIA 3RN9C 2E74C 2N1WA 1SE4A 4M1UB 4ZLTF 2R93H 3EC8A 4WWNA 1K8AC 4MSMB 2D3CA 3OLMD 3PZDA 2K8HA 1LT5D 1LTSD 5FO7B 4NXNL 3LGJA 1HFGA 3EQLC 1MHWC 4CHKA 2MJ8A 2IDYA 1UE1A 2NN6G 3QAQA 1KIXA 2K03A 5FLMG 2LY7A 4A93H 2JYOA 4RCOA 5GAGC 5CGKA 1N33L 2C35B 3KYCD 2CQOA 4MTNA 3O13A 3FKIG 3IXSA 1JR0D 2LXAA 4BXXG 5JPNC 4P6VF 2UUBL 1DOYA 2MNAA 1N5WA 1ET9A 3AE4B 3E0EA 3S16H 4GN4B 5CV4A 2W55A 4HJGE 3SDLC 3A54A 3VYTA 4G7HC 4JI5L 2A1AA 2D3BA 3ERSX 4K0KQ 2JF5A 5EE3A 3ICEA 4EEWA 4IOCA 1UNSA 3H3VH 2BWES 1WCMB 2UXDL 3UQBA 1YN5A 4DXGA 3UE0A 5G5HA 3X23A 2NN6I 3L08A 1YX6B 2B8GA 4WWOA 2L15A 2MEKA 4KK7A 4ALPA 4HCEA 4JV5L 1P1AA 1E7VA 3KUPA 1RRBA 3NWSA 5L83A 2QSDA 1EUJA 1MG4A 2WXKA 2LXJA 2Z6BA 4C3HH 3QJZA 4I6LB 1Y1WG 3J7YW 3FAHA 3ULLA 1C79A 1GKHA 3D0FA 1Q5WB 1LQBA 1UWXA 1FNWA 4NQLB 4FF1A 3VH4B 4BBRG 1KD1C 1Y8OB 3MC8A 4HK2A 3L16A 1VQFA 1XT9B 4QJFA 1VQAA 3V62A 1KF6B 1S4ZA 1J8IA 2WWZA 1LFDA 1R4NB 5IGEA 4DNRB 1JWBD 4BA2I 1WVLA 2PVOD 3OSOA 1YNNC 2YU9B 2MW5A 3VA7A 4GDKB 2BVCA 1ENCA 1SBBB 3AEFB 4E71A 1EFID 4FXGC 1ASYA 3BG3A 5DPSA 2CQAA 5MPOA 1PH7A 2RSNA 2K6QA 2V1YA 1WX9A 1PZKD 1RFKA 2ATWA 3RLFA 3QCAA 4YSXB 2ZPYA 1RIPA 1L0XB 1EF1A 5JEAG 5AZGA 3M4OB 2RBMA 1ASZA 4A3CH 2HCCA 1WJ6A 3HRZC 4HSPA 2LZ6A 3EECA 4BAXA 3ZJUA 5FR6A 3Q6SA 4BOSC 1BR9A 1WTRA 1PYSB 3MC9A 2J7ZA 3SXHA 1XNQL 4TMAB 2RSUA 1KAWA 5D7GA 1TBEA 4JX1C 3F2BA 4JWSC 3HOYG 1XLPA 3NPPA 3QC8B 2REXA 1YOVB 5JH5C 2AUJD 5LMNW 1K9MC 4FJVB 4FO2A 4RNAA 2WXGA 5LMUL 2BF8B 2XEWA 1K51A 3NS8A 4XGAB 3MXUA 1ZP0B 1JRPA 1FVIA 4A3EH 5C23A 2KMCA 2VH2A 2UU9L 1E0BA 2QDBA 2QCZA 1XF5L 3KWVA 4LNQA 5C3XA 1M8AA 5JXVA 2DZIA 2DNCA 1JB7A 4C00A 2E5LQ 4WORA 5IT9L 1TT2A 4TQ1A 5AZHA 3VTUA 3ZQ4A 4CJ2C 2P5ZX 3MXNB 3PV1A 1Q8KA 3S15B 1PTOC 3CC7A 5LMUQ 5LNK1 3A9KA 5EBCA 2G1EA 1QILA 1MSGA 4RF1A 1CT1D 3PO3H 1AW7A 1FL0A 3AU5A 3K80C 3GZNB 1FO4A 1OEYA 2B2WA 1RTNA 3BZKA 4KLKA 3O65B 2HHHL 2HD3A 2VZAA 3PT2B 4JK1C 5I6YA 3U4VA 3DVGY 3ZNZB 4DQOC 2WXRA 3RCZA 1SYGA 4O1NA 2BQQA 2DWQA 2B63G 4M8MA 2XSCA 1SIFA 3NVZA 2VB2X 3H1UA 5M5XH 3S2DB 1FNVA 2CKHB 1QWYA 1MKHA 3DBRI 1QOHA 2B8FA 2KNBA 4HDOA 2KEEA 4QGUA 1WWTA 1Y14B 1V1PB 1XNRQ 5FLMH 3M85A 1YQ3B 2L0CA 4IN3A 1OXVA 4K7SA 3PIPA 2CW0D 2CW0C 1EQTA 4BXXH 2KUMA 1M4VA 4IM0A 2CKZB 1VQLA 1RWSA 1KXLA 1L6UA 2PMZE 3NUHB 3ZW3A 1QZHA 4AYBB 1S1QB 3QK0A 3K59A 5EPJA 5C2TB 1S3SG 4LF9Q 4WAAA 3ER0A 2HT1A 4MM3B 5CHFA 4JI7L 4DR6L 2Y5CA 3SFEB 1JRUA 3N30A 1X56A 5G5GA 3D4RA 3HOXH 2F0VA 1P7FA 1JE4A 1SMXA 4DV1L 2C9WB 2G4SA 2PVGC 1BVSA 2L32A 4H2AA 1OXUA 3ZTDA 2O2VA 1KLUD 3VA5A 2PCFB 3A56A 4W9FA 3KOJA 4QIWE 1T0SC 2KTRA 1TKEA 4C4VA 5C3EB 4URKA 4LFBL 3M95A 2FAZA 1FXIA 4ABNA 3J7AV 1Y1WH 1DONA 1R9TB 2CWAA 4X3TA 3C2PA 2BE5C 2HDLA 3FP9A 4DV4Q 2IZVB 4IDIA 4BKSD 1FFUA 3ZUNA 3G7LA 3RMKC 4BBRH 3S1MB 4II3B 3R3OA 5C0XH 1EU4A 4HCSA 3HOZG 4LLGM 5IGCA 3E0JA 4DWFA 4JBJA 4ANXA 3CRKC 3T1YL 1BMLC 3E9HA 2K5DA 4LFBQ 3PF5A 2MJ3A 4ZRJA 1JCKB 3H0GB 2OTJA 4J8QA 1IPGA 4JI8L 2QC8A 3OJ4B 3HP3A 1I4PA 4A55A 3P4PB 2NS5A 1OXSC 4OZAA 1D8LA 2F1MA 2MBBB 4B9KA 2ZM6L 4YTNB 5DLQE 1OQQA 3IAYA 4K6LA 3ZYYX 4FN2A 3ZO5B 4B3MQ 1AYFA 2OJWA 1EO6A 2PQEA 3I72A 2PPBC 2WDTB 4OEMB 3HUIA 2EY1A 2WINB 2GBNA 1EIFA 2Q8IB 4WURA 1KNAA 1I4XA 1K3BC 1A70A 1HNWL 4WH4A 1TWCB 2D62A 1P8LA 4CBVA 4PK1A 1X1MA 2JXTA 3CIRB 3PIP3 1STNA 1SB3C 3QA8A 3NELA 2JA8B 1SE2A 3Q2AC 4KTAA 3I91A 2L0FA 3VTWA 3TN2A 2VUMB 3A55A 4BFRA 2N55A 3HOYH 1WYWB 4A3DG 3X3NA 2G4DB 2E6XA 2JZPA 2QHOA 3S14H 1WM3A 2MJDA 2WDQB 2G3QB 3AFQA 1VF7A 3K5MA 4FA6A 3PHWB 3K0XA 2V4DA 2LD9A 4BWGB 2LVOA 4HJKA 5K5PA 1CI3M 3UI2A 4EVOA 1BUIC 1U4AA 2C7MB 3TSSA 2R93B 2NVUI 2LGXA 4KSKC 3JW0X 2R92G 3ETRA 3A0JA 1ZKHA 1K8RB 2MA9B 2OHFA 3JYUA 2ZTDA 4OONA 1IW7D 2NBWB 1IW7C 2BT6A 1AH9A 1BCPF 1D6EC 4HTHA 4AP4C 2JK8A 2IWHA 4LF5L 2M8SA 2W3RA 5IY0A 3RZOH 3APFA 3I7FA 4A93B 2QMTA 1B44D 3G6EA 2LGSA 4X62L 2HQEA 4HJAA 2PQAA 2F0WA 2ICEC 1KHIA 1XO3A 2L8JA 3S16B 4GOPA 3I4NH 2AWNA 1PH8A 3K0YA 4YWMA 4ZKBB 1NBFC 5BR8Q 2I5HA 3LYYA 5G3LD 3T8MA 1RL2A 4ME3A 1WYGA 3URYA 3J80c 3PHXB 1RTOA 4GU2A 2ON8A 1TWHH 1H9KA 1N6ZA 1GHJA 1IBMQ 3AEEB 4R4TA 3DBHI 3VDZA 2YYZA 3IT6B 4ZUJA 2KANA 1YN4A 1XQQA 3MJ5A 5JVH3 1H9RA 4YY3Q 3J81i 1OEYJ 2KK8A 1F9PA 1P0RA 3HZXA 2ZCCA 1BCPB 5IT9E 3ZIMA 4C3HB 1L1OB 3T56B 1T0RC 4LF4L 4W9CA 5KIXA 3GQBA 1PH3A 1X3EA 1STYA 1WJUA 1O7IA 2KEDA 1BXTA 5C6AA 2E2IH 1UE6A 4OVUA 1I94Q 1HR0W 2MSED 4RKBA 2VQFQ 2D2QA 1FJGL 4DR5L 5DPWA 1BBUA 3WOEA 1TKGA 4X64Q 2QEXA 4ARCA 3TCAA 1S5CD 2GBMA 4POGA 2FUHB 1CQVA 2GLSA 1Q8IA 4N59A 4IUQA 3DXJC 2MBEA 3PUWA 3BY4B 1D5ZC 2LRUA 2M0AA 3AECB 3K58A 4YT0B 3X3MA 1E6EB 3VH3B 3C1FA 3MHBA 2JA5G 3L17A 3OW7A 4ZQ3A 2UXBL 4KY5A 5CC4A 1IYVA 1QOFA 2KN4A 3L9AX 5GROA 3LJ3A 5BYSA 2RCFA 4DDID 3N9YC 1TJEA 2LHDA 4HDQA 2KOXA 3NTIA 2X6GA 4LF6L 4B3TQ 3HM6X 1E2ZA 2DUDA 4CHTB 2CHZA 2YEPF 1V5TA 3P4QB 4DV3Q 1CMXB 3M4QA 1H9JA 4GN5A 1QB5D 2Z6KA 1L0VB 2ACZB 2JT4B 1V97A 3CCSA 2HUGA 1HUMA 4DUZL 1RF2D 5D65A 1KRTA 3R7RA 1W6KA 4N8X1 4TKOB 2KQ4X 2HDEA 3SHLA 1V86A 5CHWA 1XMQL 1CKOA 3I55A 4B9XA 2Z8LA 4KJNA 4A3EB 3K6OA 1TY0A 3NSWA 1K83H 3QB3A 1QVCA 2QDLA 2DYBA 1T6BX 3TEHB 3C19A 3EFXD 1TZOA 3DWGC 1PFNA 3NTHA 1GB1A 3OTOL 1N34L 3CWIA 1XMOL 1XJVA 1L4DB 4GDLA 4IKGA 1MHHE 5D6JB 3H6NA 1D2BA 2ZPNA 4X6AH 2K28A 1CSPA 4DNIA 1N32L 4MHEA 1EQVA 2B29A 1G51A 2CCZA 2V3NA 3DHGC 3P1MA 3PO3B 4KKIA 1HJPA 1V1QA 3B2FA 1NYRA 2YEPB 3W5OA 1B9MA 4ZAIA 4XZ4A 1XMOQ 2I1JA 4MIUA 3JSVB 2D3AA 4TQ0A 1ZW7A 4BY1B 3APDA 1VQHA 5FKAC 5JAVA 2I5MX 1N32Q 4LNNA 2Q8RE 2WAQE 5M5XB 2F0QA 1TU2B 2YTYA 1OXTA 4HXDA 2K5PA 2K7VA 4CJ0B 2JRIB 1RM6C 1ILQA 1NEKB 1WRDB 1Q0WB 1TWAH 1X3PA 4LUVA 2JEBI 3IAM1 1ZEQX 5CBAE 5FOBB 1SSOA 2VQEQ 2UXCL 3I2ZA 2RSOA 1B50A 3KF8B 1B4OA 1RD9D 4JYAL 1XTDA 2CJOA 1ZXTA 2PEAA 5K36G 1YJJA 1J5EQ 4TV3A 3KF6A 2PIAA 1XXGA 4G57A 3H9DA 3KQ4A 4JI0Q 2RKSA 3AV8A 4PG3A 2AL6A 4EX5A 4YWKA 3Q8FA 3KYHC 4H7BA 4X66Q 2LEKA 3ALBA 3NVWA 2EDGA 2M0XA 4DV2Q 3IRBA 3HOXB 2DY8A 1WZ0A 4XX5A 1C4CA 1Q1BA 4XWTA 1LT3D 2MH7A 1SLJA 1Y56A 4A6QA 2JX5A 4ZYNA 2MGSA 5T1GA 3T1HQ 1GUNA 4APVA 1TS5A 1IGDA 1YJWA 2NPTB 3AEGB 3VR2A 1UEAB 2BS2B 3W9CB 2I2YA 3CCVA 3AE2B 1VZ6A 1Q7YC 1STBA 1CA5A 1OQRA 2WIIB 2JYTA 2KLGA 3HOVG 3AE8B 1RDPD 3J9CA 2A19A 3GV3A 1JOQA 4N9F4 2UU7A 1HZCA 2KCNA 5CR3A 1HNXQ 4K1RB 3V6EB 3B0AA 1PH2A 4WJNA 4CKEA 4N9TA 1WI0A 1BO0A 2F0IA 3AE1B 3SHQA 3OOCA 4L1BA 4DNTB 4F8MA 4HJ8A 4A90A 1QF6A 4BY7H 2WNMA 3EVQA 4EUTA 4R8NA 3BYYB 4WWPA 1JQYD 2B2YC 1EEID 3E9IA 2CHXA 4CDFC 5A35A 4KGTA 2VRRB 2DLBA 3VAWA 1I42A 3ERQA 4UP8A 5KHOA 4YTPB 5IGFA 5GADC 5FLXc 5C4XG 2HTME 4MGYE 3V05A 2HTHA 2D0OA 2WXJA 2NTTA 4LCDE 4QIWB 1JJCB 1LTLA 4DAYA 1E90A 3R66C 3M9BA 4HKQA 1WXAA 1M1KC 1VJKA 2V3PA 3OJ3A 3ML9A 2KLCA 1EWCA 2RDGA 3EN2A 2JA5H 2ID0A 2R3ZA 1D5XC 1YD8U 3P4RB 1VQBA 2VXWA 4AQYL 4IZ8A 1YJ9A 3NZUA 4HPMB 4C1NI 4E6IA 1LM8B 1Y1VG 5J17A 1ZXIA 3PZ7A 1Z6HA 2MBOA 3SGIA 1XPRA 3QIJA 1X55A 1YQBA 4DF7A 4EQOA 1Z5SB 3M3YH 4B3SQ 2INCC 3U2SC 2KJXA 4YCUA 3CC2A 3HHMA 3NG0A 2EYOA 2A4ZA 4GMVA 2WS3B 3HOYB 3QX1A 1BNZA 2N3SA 4K81A 2EJFC 1A15A 1U4RA 3AQQA 3S14B 2MP2B 3B1LX 4X65Q 2DYOA 2DNFA 1WY8A 4ZRKA 4UP7A 5M5WH 2EYMA 3JC66 2QF7A 2GRIA 5FO9B 2EJGC 1IBLL 1JT8A 3Q8BA 3NTKA 2NUCA 2K5HA 2KX3A 1OO9B 2VZKD 4FBJB 1E2WA 1ILPA 1IL8A 1DZ1A 2Z59B 1H9SA 2BCOA 3AFPA 5CHVC 2WB1E 2ZXOA 2UUAQ 4C3IG 1YITA 2BH8A 3DEPA 3MA2B 3H3VC 3ZJTA 4FDBA 4A8XC 2JE6I 3RZOB 2OCEA 3C1EA 3L0WB 3MZ5A 4A3KH 4A3LG 1E8XA 3SR1A 4WAFA 2K04A 2YV5A 3L0OA 2JUOA 5A2QL 4IPHA 4JI6Q 3T13A 2CS4A 1TIID 3DWQA 3HM3A 2H88B 4HN7A 4K8IA 3GE8C 3MFYA 3I4NB 3ZDTA 3K5LA 4Z9CB 1BCPC 4K8JA 5KRUA 3PF4A 3D32A 1L1OC 3M4YA 1BDOA 1TVXA 4UHVA 1IBXB 2X8XX 5DAUA 2WXQA 3SDZA 2M00A 1CHQD 2NZOA 3MJWA 1IP9A 2IGGA 2PNRC 3QWZB 5L37A 1TWHB 4B9WA 2KAJA 3W1SA 2WYQA 1VDVA 2H89B 1Q1EA 1EL0A 4HPPA 3W2DA 4MSQB 4ILWA 3G71A 3MTSA 2B3GA 2EE1A 1B9NA 3HKSA 3PUYA 4X3SA 1YI2A 1GJXA 1XCQL 1EY5A 1B70B 1IBKL 1TY2A 1XPOA 5K36H 3DHHC 4W9KA 5GXGB 1MJEA 4XT1B 4TUUA 3PLUA 2ZXRA 1WJJA 5IYCG 5KNBA 4QQBX 2EYPA 4J6HA 4G50A 2IL8A 1CKNB 1MSHA 2NBFA 3P75A 2QDFA 3MFGA 3AEDB 2E2IB 4HCPB 3ZTCA 4EFOA 1ESRA 4P71A 1SNOA 1UBIA 1RHPA 2O2LD 5M3FH 2FBWB 2WXNA 1GUAB 4LF7L 5TSSA 4BA1I 3G48A 1C7YA 1ZE3D 5C3JB 5EE0A 1A62A 2ZNVB 1TR5A 1RAXA 5E3FA 1E0ZA 3HOVH 1PH4A 2K52A 5D2MB 4K7UA 1J8CA 2A6ED 2Q2IA 2F0SA 5C5MA 2A6EC 1A3TA 3ZJYC 2CJNA 3UF8A 4KY7A 1K53A 5GAHC 4BKTA 4NW2A 1AZQA 3K81C 3UIPB 1PV4A 1HFNA 4R4OA 4GXBA 2FJ2A 4DAVA 3QWNA 1JWSD 1R4PB 2F0LA 5C44H 1P7EA 1FGUA 1GUGA 5C4XH 4IUUA 1E7PB 5IOCA 3S17H 1DOKA 4CYEA 4DV7Q 4IJHA 1ACCA 4DXAB 2Z1CA 1YX5B 5IIFA 1UGMA 1WXQA 4HLEA 2AMCB 4A3JG 1VQ7A 4EZJA 1UE5A 3SK6A 5CMDA 2N7EA 5LXHA 5J3BA 4XQQA 3DM1A 4DR7Q 2OEDA 4HWIB 3U30A 2CU3A 4B3RQ 1AE3A 1E5WA 1K83B 2OQKA 4RFBA 3VYRA 3PZ8A 4J6IA 4PZ6A 1WR1A 1W3SA 1H4RA 4LJOB 1VQCA 4HKZE 2CVRA 3Q24A 4RMAA 5JZEB 4K0KL 1JE5A 2GBKA 4MZ9A 1WH3A 2H5XA 2XWJB 3J80i 2SDFA 2LGYA 3ECIA 4DR4Q 5G3LF 3MXPA 5E6PA 4KHPQ 1RODA 3WIMA 4AJWA 2LXKA 1WZ3A 3KVFB 1V43A 2FMMA 4OWTB 4ZCKA 2KOLA 2IO3B 2JYEA 3GTMH 2F0KA 1YJIA 2XN9C 3K5OA 3RUZA 1SJED 1NR4A 2MFIA 2BKFA 4FHKA 4OZBA 1NI2A 3MHZA 2UUCQ 1EY0A 4DR2Q 4IOAA 4NB3A 4BZAA 2F0PA 3DVNV 5EE1A 1Q86C 4F7ZA 2EJMA 3BDOA 5EPLA 1GAQB 1LGRA 5CTRC 4F1SA 1JC7A 5DPTA
chains in the Genus database with same CATH topology
1MI0A 2AQ1B 3E5SA 1G2SA 3QOLA 3MXNA 5F2DA 1LACA 1S5DD 2BBCA 1Q12A 1FMAD 1TWAB 1I4RA 1C4QA 1QKZA 3D4WA 4IALA 1VF5C 3QJYA 1WTWA 2MHVA 1PXUA 2EYHA 5I4DA 1PRTF 4K6DA 2WAQB 5NUCA 3OPOA 1KTKA 1NI3A 4ODGA 1F77A 4G4KA 3KBGA 1FIQA 1DOXA 3D31A 3D8GA 3DWPA 3FILB 3E56A 3JAML 3AE5B 3NWTA 3TUOA 1S5BD 3U7ZA 1LTTD 3S1RB 1EYAA 1SYEA 1F2MA 1EWHA 1QG7A 5HHDG 1DOLA 3P4SB 4BY7B 5A2QE 4LMQD 3I4LA 2AUKA 3SK4A 5ELBA 4PNYA 1C76A 4ULLA 4L2YA 3UI3A 1HQMC 1HA6A 3EGRA 3MVVA 1HTPA 2KVMA 3W3AA 3I9V1 2ICIA 1UAPA 4ZRPA 3AE7B 2EKIA 1CFMA 3VRAB 1UWMA 1BQQT 5C5LA 2KWDA 2JA5B 2RQXA 1GOZA 5C4HA 2PYKA 1LLRD 2XNAC 4KD3A 3AM9A 1GUTA 2K01A 1DGJA 4CKBA 4EE2A 1GXDC 3M3YB 2TSSA 4ZRQA 1FM0D 1SDFA 3OWEB 4JBWA 5C4ZA 1WTOA 5FK9C 1ZUD2 2VB3X 1X3QA 5AUKA 1ICWA 4KGRA 5CV6A 1SE3A 5M5WB 2OXPA 4XDXA 3ND9A 1FCLA 4KKUA 1AN8A 2NN6H 4C80A 3MAQA 1PYWD 2M9VA 5I9OA 4PV1C 3Q69A 1IHZA 1JWUD 1ZXHA 4ZRZA 3Q22A 3IAS1 4H0LC 2RDFA 3BVZA 4A3KB 4B0EA 1F2YA 1CZGA 2K5WA 1QNUA 2BW2A 4KN4C 3OHXC 2X69A 2PKOA 1PFBA 2VNUD 4OHJA 2BS3B 1II3A 4IURA 3R93A 1VRAB 3FDTA 2EY6A 2WB1B 4RH6A 1AP0A 2Q5WD 3M7NA 1BUVT 5BMHA 2BA1A 2B2VC 2PMVA 1FXAA 2BYTA 3K57A 1V8CA 4WJWA 1JORA 1KLGD 5C3WA 4FF4A 3NZ3A 2K32A 1KDAA 2B2TC 1TYGB 4Q5VA 2B2UC 3GD7A 5M3FB 3I57A 5CV8A 1LTBD 1HCZA 1ML0D 3PO0A 4IOIE 2F0GA 1LTRD 2N9KA 2L1BA 1IUEA 1N62A 1SYFA 4FF2A 1S5ED 3HOVB 3C46A 3D6CA 5JEAH 1G8ZD 4ZKCB 1I4HA 1U4LA 4UAIA 1L0YB 4OZCA 2W82A 4XWWA 4DGZA 2BB5A 3SVMA 4XQJA 1J7BA 3AN1A 5C44B 2H4OA 2K9XA 1L4ZB 5CBEE 1K50A 1CQFA 4G7ZC 5C4XB 2ZW1A 4U68A 3S17B 5HI1A 1ENFA 4XQNA 1FRRA 2KHSA 4J1MA 3V3XA 3N6RA 3KLSA 2AX5A 4FNFA 4B08A 2C5CA 2QJLA 5D3IB 2F0MA 5ELEA 3JAME 1FNUA 1RCVD 3TP5A 3HS0C 4YIJA 1J9OA 4KV6A 2BTEA 3H6MA 1JW9D 3BIID 3GTMB 2L4NA 2F0OA 2VZKB 1WD0A 1T5EA 1ROEA 1LTID 1HZ5A 1BBXC 1J7AA 2O5IC 5EE9A 3VR4A 1R7SA 2G9HD 1TKWB 1ONLA 5AFWA 4XYQA 1F2RI 2M2LA 2N9LA 2DYMA 2IGHA 2EY5A 1NAPA 1BF4A 1NYQA 1C48A 3PIO3 3BDLA 3FC4A 3I70A 1ET6A 2FINB 2J0TD 2BDOA 4LAAA 3PUXA 2F0HA 5J1ZA 5KYIA 5CYUA 1F9RA 3P63A 1L5PA 4JPSA 4RGTA 3RPFC 1HUNA 2X38A 3DWAA 2SOBA 5IODA 1FRDA 4HROA 1WGKA 2L83A 1JOKA 1FEHA 1U4MA 1EOTA 2F03A 1PRTD 1PRTC 2OF1A 4R9WA 2D5GA 2Z4HA 1PFDA 2O4XA 3OMGA 1FGBD 2HDMA 4IUPA 4YTMB 1N61A 3P42A 3VYUA 1IKLA 4H13C 2W3SA 2L52A 1WD1A 1EIGA 1QE6A 3U9SA 5KGUA 2IPKD 1V8QA 4RHSA 5HURA 1D1KA 1I4GA 1MPEA 4D2KA 5T1IA 2LUMA 4L8JA 2JP1A 4R3DA 2O5JC 2K1BA 4ME5A 4AQ7A 1B1ZA 4QUCA 4C3JB 2B39A 5EKKA 3S1NB 1SXTA 3CQZB 2WACA 4NKLA 4OIKA 4REZA 3QIAA 1LTAD 2RMMA 5KYLA 1CK1A 1D1IA 3I8ZA 5M9OA 3F2UA 2SNSA 3R8BA 3S9WA 4F7XA 3NXWA 4US8A 1PDQA 4R8IA 3BK2A 5JVG3 4ZHPA 2EOTA 2Z4IA 3NE5B 1ZDVA 4IUVA 3AH7A 3P1HA 3P7JA 4RKLA 2LKVA 2WXHA 4QUFA 3AMUA 1QCBD 2DBYA 3FKIB 1PFMA 1F2LA 3U9OA 3E9SA 1JICA 4RGNA 3J81L 2F0EA 2M19A 3B2GA 1IYUA 2F3VA 4K14A 4ZOHC 1ZYRD 1AEXA 2R61A 1ZYRC 4JWUC 3OWFA 4XXEA 2KMMA 1WTXA 4JE3B 3R2IA 3QOJA 4K2KA 3IKJA 3MWYW 4L6TB 3GO5A 1Y1WB 1HPCA 2BB6A 2PMZB 2GI9A 3WOFA 2A73B 4EQPA 2GB1A 3TEZA 4BBRB 2M56B 3PMFA 3SE0A 3NBHA 3P20A 1HEZE 3ZJVA 1SYBA 3PUZA 3N52A 4F87A 3LB8C 3I90A 1FCCC 1XTCD 3C8YA 3DWMA 1C9FA 5IGGA 2Y5PA 1I4QA 2F0TA 1JALA 2A74C 2B2WC 2EYJA 2D2CC 3TBIB 1A3VA 3VR9B 2PW5A 3HOUB 4GDLB 5JOBA 2A68D 2EYLA 4C7ZA 4P16A 2IX1A 3VR3A 1MVKA 4US9A 4KHVA 1Y8PB 1TS3A 4FVMA 1PZID 1FD6A 1ESFA 2B2VA 4M0WA 1O7LA 1GHKA 1AWDA 1SNPA 3Q8EA 2JXMB 1O7ZA 4KHZA 4PMWA 4N9PA 2WQYB 3I73A 4L63B 1ZKOA 2OEOA 5BN5A 1UGJA 2NVTB 3KK7A 3GTOB 1E10A 2R6GA 3AEBB 5BYRA 3TZDA 4PMCA 1D4BA 4XDCA 1C4PA 3EA6A 3M7GA 3EROA 3D6WA 2Q8TA 1SFOB 3RFZB 1YNTE 1F2ZA 2B63B 1B53A 2QEJC 2QKIC 3ITPA 3KBXA 3OIQA 1VR9A 3CRLC 4J3OD 4AS1A 5CV9A 3V2TA 1SIJA 2FFKB 1JMLA 1O78A 1SNQA 1STAA 2Y3AA 2RVLA 4DU9A 4MN3A 4KD4A 3S1QB 1K8MA 4FP5D 3V96A 1AZPA 4CGYB 3BZDB 2K22A 2JWUA 4WFN3 4OO1G 5LHY1 2WXLA 3A7AB 3DMUA 1XCTL 2H1EA 3CHBD 3R2TA 2EPBA 1FFVA 4O42A 2NYZD 3LWEA 4L23A 4DXFA 4K5VA 3HOZB 3HOWB 2V0GA 2IJ0A 3NRZA 1DOMA 4ITKA 4DK0A 3J81E 4LJZC 4GZYC 2ENBA 3W5UB 2L11A 4OO1I 1SNMA 2JEAI 3EJIA 3Q8AA 1CZPA 2WXFA 2K6AA 1EZ8A 1MI2A 4TQUS 3S2HB 2J52A 5ELDA 1C78A 3Q23A 2LMCB 1S5FD 1KABA 3D4DA 2K0PA 2JSOA 2IGDA 3NK9A 4KGSA 5CV7A 4RAUC 2LS01 2Y0SB 1DOIA 1PMRA 4KI0A 1CJEA 1ENAA 1NSNS 1T5XD 2E2JB 4A3DB 2EZVA 2E3TA 2NVQB 3MC0B 1MBYA 3AU7A 4XDDA 2WXIA 4P2CB 2AQ3B 4IFDJ 3H94A 2SAKA 2NVYB 1SMYD 1SMYC 1J7CA 2EVBA 4HSVA 1YMHE 2R92B 1GB4A 4PMBA 3IL8A 2L55A 3QG1A 4RCNA 1XX8A 1WSPA 1PDXA 1SAPA 2KECA 5EPKA 2D9UA 1TKYA 3AB5A 2XRSD 3C3LA 3HRDD 4LTUA 2PLPA 3L3OC 2WV6D 3DUZA 3FPUB 2J53A 1PGAA 2PO4A 1KNEA 1HRJA 1NENB 1NUCA 1HQRD 2EYFA 1DXMA 2WP8J 3IFTA 1HHVA 1IKMA 3AE9B 3DHQA 5AUIA 2FMCA 1V1PA 2E2HB 2F0FA 2L12A 5IGBA 4OIJA 1OXXK 4FXDA 4NJCA 5D3DA 2R7ZB 3TEYA 1EYCA 4QCLA 2I46A 5C0XG 3A8JE 4HAEA 1F0ZA 1E9MA 3WCQA 3SFDB 4RHRA 3U4EG 4XTCS 3NUCA 1CM9A 1YNND 1STGA 1MHXA 4WIPA 1KDCA 2K5QA 2NB0A 1FD7D 1T3QA 4OO1H 1PRTB 3K5NA 1TS2A 4XIGS 4UDUC 4C1NK 1A2TA 1X32A 2FHTA 4OW0A 1U9RA 5C0XI 2PW9A 3A8IE 4NZLB 3HVZA 2F0DA 2DN8A 3HEJA 4U673 1N5XA 2ZXPA 1KDBA 4YWGG 5CORA 4QB4A 2KACA 4RF0A 2LFNA 3NVYA 3SK5A 1I6HB 3T4AC 3SK8A 3J80L 1VCIA 3CKIB 3GP7A 4H44C 2B76B 1C4AA 1YQ4B 1VDZA 2NTSA 2XVSA 2MUYA 1E2VA 2B2YA 3PV0A 1EEFD 1KFYB 5DEHA 1PTOD 1ZPSA 1LO5D 3TEXA 3W5VB 4MT5A 1I7HA 2PZTA 4YXDB 1Q10A 3KWLA 4G7OC 4K5WA 2A6HD 1AFPA 2IT1A 2A6HC 4A3MB 2J4XA 2IX0A 1LT4D 1U4PA 1RJTA 2KA7A 4WRDA 2AWOA 1DYQA 5T8IA 5DM73 1CTMA 3HG9A 2PZUA 4KKSA 4DFAA 3T3OA 2KQ3A 1K52A 3ONAB 2PW7A 2L9HA 1JOOA 3H09A 2E75C 4IFDG 1XLQA 4IUNA 1HTLD 4IQZA 4NAMA 1VMCA 1OFFA 3FEWX 4XT3B 4HR7B 4HMIA 2BOSA 2F4IA 4FYDA 3ABVB 1JQ4A 2WDVB 3T16A 4DAPA 4FXCA 4OGQC 4IFDI 3G6JB 3I3CA 5HGTA 2BS4B 4Q2JA 1F9QA 2BE5D 4Q0FA 1O7YA 5EJWA 1VMPA 2NZ1D 4K5XA 1QJOA 1TWFB 1I6VC 2A5HA 1LABA 2SEBD 2A69D 4X3UA 2A69C 4S3SA 2RA4A 5CV5A 2LGIA 5BMIA 3TEWA 2FE8A 3ZGZA 1L6VA 1EZ6A 2KCCA 4C2MB 4PQXA 2NVXB 4V0BA 4CJ1B 2SNMA 2D5DA 1O80A 2V4IB 3BWUD 3Q8CA 3QO2A 5JJZA 2TMPA 5E1FA 2F0JA 1Y1VB 4QMGA 2JU6X 2QIEB 5M3MB 3VR8B 1JROA 1MGSA 1EU3A 3MP9A 3LNNA 3GTGB 3PUVA 5H8YE 3BVGA 4IUTA 4A9AA 1PTOH 4F88A 2G9DA 4ZK9B 3BK1A 4OVZA 1F2RC 1ZDXA 1XLOA 1SNDA 4YSZB 1DCZA 3NHHA 4HEDA 5HFYA 1B3AA 1VZ7A 3NS1A 1SEBD 4A3BB 3L4PA 5I6WA 3K7AB 2FUG1 4HEA1 3RMHA 4KN7C 4Y7NB 4C3IB 2F0NA 3NBIA 3LWUA 1SJHD 2I38A 5M5YB 1Q90A 2BA0A 1LT6D 2WKCA 1B2TA 4MACA 2IX3A 2XWBB 5FLXL 1TS4A 5BN4A 3VRBB 1XEEA 1CHPD 1F9SA 2CHBD 2GA4B 1C77A 4M8AA 3J80E 3FPPA 3MXGA 2K05A 1QLBB 1JB3A 3EUB2 4ARIA 3LX0A 1PGXA 4IFDH 2MJEA 2N0SB 1SYDA 1D5MC 1QOAA 3KF8A 2DY7A 4DA2A 2XRQD 2E2DC 3VQIA 4QF4A 4RGMA 3GS2A 3RD4A 2WU5B 4FXKC 3TDQA 5I2YA 4DN4M 1STHA 2F0UA 4CKCA 1HZ6A 1YN3A 3NVVA 4A3GB 1SF0A 4TSSA 3OMCA 4NMZA 1ZOYB 4KKTA 1LV9A 4RA8A 2DNEA 3ND8A 1VLBA 1EIHA 1PUTA 2LHEA 4YSYB 2K33A 3LXFA 5EKLA 3GTKB 1HA5A 1R4QB 2ONQA 5E6JA 5KNCA 3SEBA 3TP6A 2WKDA 3NP8A 5BN3A 3KLSX 2K3UA 1RYJA 2EY2A 1Z47A 2INNE 4KMUC 2JA7B 4TRDA 1EY4A 2J42A 5IGDA 1EY8A 2ZT9C 3AEAB 3TMEA 3HGBA 3FRPB 3T3NA 2RDHA 4LK0M 4A3JB 4LK1C 2WXPA 5EKIA 3TZUA 2LFIA 1LTGD 1CA6A 5KEEA 1A6XA 3J7AF 1KH0A 4FF3A 3BS1A 1PZJD 2N7JA 3H91A 1I3QB 4ZYSA 1WTQA 1GUOA 1GUSA 2EXZA 3SR6A 2X6LA 4HMJA 3E6ZX 4EQNA 1PLFA 3MEHA 1V1OA 4ID6A 1QT9A 3RZDB 5H92C 1EM7A 2LJIA 1CZWA 4C56C 1NR2A 3BYTB 5I9PA 1VZ8A 2JSVX 3T51B 1XWEA 2C9OA 1EYDA 3L7ZC 1HXYD 1I50B 5I2XA 4MH8A 2JA6B 2ZW0A 5FR3A 2WXOA 1A3UA 4KJOA 3FVQA 5BMGA 4KX6B 3FMCA 3HVDA 1Y8NB 3IFDA 2RPVA 3A8KE 1IBXA 2WXMA 4K2LA 1STEA 5J22A 3A7LA 1DD2A 3H8HA 3U52E 2L1AA 5HG2A 3I4MB 1DJRD 4HRSA 1QOGA 1EY9A 3B9JA 1EY6A 1BOSA 1Z7TA 4V190 3GTJB 2QCPX 2A68C 3Q0AA 1QQRA 4I7ZC 1Q3LA 5ISRA 4C7YA 3BDCA 4XE0A 1DM0B 4USAA 2MP1A 4B0MA 5FLXE 1G91A 1PTOF 4KY6A 2PZWA 3TP7A 3GB1A 2W54A 1FYCA 3KLRA 1EWYC 2I07B 4RWSC 3GTLB 4NAWB 4NP5A 3CU7A 1B9RA 5EBDA 1XLNA 1G2TA 1G6ZA 2PTLA 2QILA 3PO2B 1GUWA 5EQ0A 3AMZA 4N6EB 1W6JA 2B2TA 2L5TA 1PGBA 2B2UA 5COYA 1H9MA 5ELFA 3AE3B 1NVID 2NMQA 1IGCA 1RKNA 2WU2B 3IT4B 1QNKA 3OIPA 2NWGA 1WTVA 5JPMC 2XIWA 1EY7A 3VR6A 4WWMA 4ZHOA 1MD2D 2BDNA 4ZUIA 4XYOA 5LL6S 5J39A 1PTOB 2E76C 2KDMA 5DNFA 3GTQB 5C0XJ 2LMCA 1NCVA 1C8CA 4OL7A 1Y69U 5LL6X 2N88A 4C3HG 4DK1A 4CQNA 5E4XA 3D3RA 2EELA 4I65A 5KNDA 1SYCA 1BCPD 4PT5A 4KKJA 1UUPA 1WTPA 3VYSA 1G291 5JEAJ 1SNCA 1K8OA 3GV6A 4N58A 3GTPB 3WDNA 3NQIA 3BVMA 1A2UA 5D14A 5DM63 2WLBA 3NQTA 1N63A 4WQMA 1FR3A 1JWMD 5FO8B 2INPE 4A3IB 3AE6B 5C4JB 2AQ2B 5ELCA 4X3KA 2F3WA 4BS9A 2JQRB 1N60A 3HKZB 1XYIA 1WRIA 3T53B 5BYQA 5E4WC 1KAAA 1QOBA 2OT2A 4EGVA 4GLSC 3FILA 4C3JG 3DEOA 1TQOA 4BBSB 1H9SB 2WP9B 4A3FB 4NDXA 5EGTA 4RGOS 3VR5A 3AB9A 1YNJD 3TP8A 1KRHA 1YNJC 1TWGB 2MPMA 1JWAD 2WDRB 2IW3A 1GPXA 1SSNA 2HCIA 2E74C 1SE4A 4M1UB 4ZLTF 1LT5D 1LTSD 5FO7B 1HFGA 3EQLC 2MJ8A 2IDYA 2NN6G 2K03A 2LY7A 2JYOA 4RCOA 5CGKA 3IXSA 3O13A 1JR0D 5JPNC 4P6VF 1DOYA 1N5WA 1ET9A 3AE4B 5CV4A 2W55A 4HJGE 3A54A 3VYTA 4G7HC 5EE3A 1UNSA 1WCMB 1YN5A 4DXGA 5G5HA 2NN6I 2B8GA 2MEKA 4KK7A 4HCEA 3KUPA 3NWSA 2QSDA 2WXKA 3J7YW 3FAHA 1C79A 1UWXA 1FNWA 4FF1A 1Y8OB 1KF6B 1S4ZA 1J8IA 5IGEA 4DNRB 1JWBD 4BA2I 1WVLA 2PVOD 3OSOA 1YNNC 2YU9B 4GDKB 3VA7A 1ENCA 1SBBB 3AEFB 1EFID 4FXGC 3BG3A 2CQAA 5MPOA 2RSNA 1PZKD 1RFKA 3RLFA 4YSXB 1L0XB 5JEAG 3M4OB 2RBMA 3ZJUA 2HCCA 3HRZC 4HSPA 3Q6SA 1BR9A 1WTRA 2J7ZA 3SXHA 4TMAB 5D7GA 4JX1C 4JWSC 1XLPA 3NPPA 2AUJD 4FO2A 4RNAA 2WXGA 1K51A 3MXUA 1ZP0B 1JRPA 1E0BA 2QDBA 1XF5L 3KWVA 5C3XA 1M8AA 5JXVA 2DNCA 4TQ1A 4WORA 5IT9L 1TT2A 3ZQ4A 4CJ2C 3S15B 1PTOC 5LNK1 5EBCA 2G1EA 1QILA 1MSGA 4RF1A 1CT1D 1AW7A 1FO4A 2B2WA 1RTNA 4JK1C 5I6YA 4DQOC 2WXRA 1SYGA 4O1NA 2DWQA 2XSCA 3NVZA 2VB2X 3S2DB 1FNVA 1QWYA 1QOHA 2B8FA 2KEEA 1WWTA 1V1PB 3M85A 1YQ3B 2L0CA 4IN3A 1OXVA 2CW0D 2CW0C 1EQTA 2KUMA 1M4VA 1RWSA 1L6UA 3NUHB 4AYBB 3K59A 5EPJA 5C2TB 4MM3B 2Y5CA 3SFEB 5G5GA 3D4RA 2F0VA 1P7FA 1JE4A 2PVGC 2L32A 4H2AA 1OXUA 1KLUD 3VA5A 2PCFB 3A56A 1TKEA 5C3EB 1FXIA 4ABNA 3J7AV 1DONA 1R9TB 4X3TA 3C2PA 2BE5C 2HDLA 4IDIA 1FFUA 3G7LA 3S1MB 3R3OA 5C0XH 1EU4A 4HCSA 4LLGM 5IGCA 3E0JA 3CRKC 1BMLC 2K5DA 2MJ3A 1JCKB 3H0GB 4J8QA 3HP3A 1I4PA 4A55A 3P4PB 4OZAA 1OXSC 2F1MA 4YTNB 1OQQA 3IAYA 4K6LA 3ZYYX 1AYFA 2PQEA 3I72A 2PPBC 3HUIA 2EY1A 2WINB 2Q8IB 4WURA 1KNAA 1I4XA 1A70A 4WH4A 1TWCB 2D62A 4CBVA 2JXTA 3CIRB 3PIP3 1STNA 1SB3C 2JA8B 1SE2A 4KTAA 3I91A 3TN2A 2VUMB 3A55A 2N55A 3X3NA 2JZPA 2E6XA 2MJDA 2WDQB 1VF7A 3K5MA 2V4DA 4BWGB 5K5PA 1CI3M 3UI2A 4EVOA 1BUIC 3TSSA 2R93B 3ETRA 2OHFA 1IW7D 1IW7C 2BT6A 1BCPF 1D6EC 4HTHA 2IWHA 2W3RA 4A93B 2QMTA 1B44D 2HQEA 2F0WA 2ICEC 1XO3A 3S16B 2AWNA 3K0YA 4ZKBB 3LYYA 5G3LD 1WYGA 3URYA 1RTOA 2ON8A 3AEEB 1H9KA 1GHJA 2YYZA 3IT6B 4ZUJA 1YN4A 3MJ5A 5JVH3 1H9RA 1F9PA 3HZXA 1BCPB 5IT9E 4C3HB 3T56B 5KIXA 3GQBA 1STYA 2KEDA 1BXTA 5C6AA 4RKBA 3WOEA 1TKGA 4ARCA 1S5CD 1CQVA 4N59A 1Q8IA 4IUQA 3DXJC 3PUWA 1D5ZC 3AECB 2M0AA 4YT0B 3K58A 3X3MA 1E6EB 3C1FA 3MHBA 3OW7A 4ZQ3A 4KY5A 5CC4A 1IYVA 1QOFA 2KN4A 3L9AX 5BYSA 3N9YC 1TJEA 2LHDA 3NTIA 2X6GA 3P4QB 1E2ZA 4CHTB 2YEPF 1H9JA 1QB5D 1L0VB 2ACZB 1V97A 2HUGA 1HUMA 1RF2D 5D65A 1W6KA 4TKOB 2KQ4X 2HDEA 3SHLA 4B9XA 2Z8LA 4KJNA 4A3EB 3K6OA 1TY0A 3NSWA 3QB3A 1T6BX 3EFXD 1TZOA 3DWGC 1PFNA 3NTHA 1GB1A 3CWIA 4IKGA 1L4DB 1MHHE 1D2BA 2K28A 4MHEA 1EQVA 2V3NA 3P1MA 3PO3B 4KKIA 3B2FA 1NYRA 2YEPB 1B9MA 4ZAIA 4MIUA 4TQ0A 4BY1B 5FKAC 5JAVA 2Q8RE 5M5XB 2F0QA 1TU2B 1OXTA 2K5PA 2K7VA 4CJ0B 1RM6C 1ILQA 1NEKB 1X3PA 2JEBI 3IAM1 1ZEQX 5CBAE 5FOBB 1SSOA 2RSOA 1B50A 1B4OA 1RD9D 2CJOA 1ZXTA 5K36G 1YJJA 2PIAA 1XXGA 4G57A 3KQ4A 2RKSA 3AV8A 3Q8FA 4H7BA 3NVWA 2LEKA 2EDGA 3HOXB 2DY8A 1C4CA 1Q1BA 4XWTA 1LT3D 2MH7A 4A6QA 1Y56A 2JX5A 2MGSA 5T1GA 1GUNA 1TS5A 1IGDA 3AEGB 3VR2A 1UEAB 2BS2B 3W9CB 2I2YA 3AE2B 1VZ6A 1STBA 1CA5A 1OQRA 2WIIB 2JYTA 3AE8B 3J9CA 1RDPD 3GV3A 1JOQA 2KCNA 5CR3A 4CKEA 4N9TA 3AE1B 1BO0A 2F0IA 3OOCA 4L1BA 4DNTB 4F8MA 4A90A 1QF6A 2WNMA 3EVQA 4R8NA 3BYYB 1JQYD 2B2YC 1EEID 5A35A 4KGTA 2DLBA 3ERQA 4YTPB 5IGFA 2HTME 3V05A 2WXJA 2NTTA 4QIWB 4DAYA 4HKQA 1VJKA 2V3PA 1EWCA 2RDGA 2ID0A 2R3ZA 1D5XC 3P4RB 2VXWA 4IZ8A 4C1NI 4E6IA 1ZXIA 3PZ7A 1Z6HA 4DF7A 4EQOA 3U2SC 2KJXA 2EYOA 2WS3B 3HOYB 1BNZA 2EJFC 1A15A 1U4RA 3S14B 2DYOA 2EYMA 2QF7A 2GRIA 5FO9B 2EJGC 3Q8BA 3NTKA 2NUCA 1OO9B 2VZKD 1E2WA 1ILPA 1IL8A 1DZ1A 1H9SA 2BCOA 2ZXOA 4C3IG 3DEPA 3MA2B 3H3VC 3ZJTA 4A8XC 2JE6I 3RZOB 3C1EA 3MZ5A 3SR1A 4WAFA 2K04A 5A2QL 3T13A 1TIID 3DWQA 2H88B 4HN7A 4K8IA 3MFYA 3I4NB 3K5LA 4Z9CB 1BCPC 4K8JA 5KRUA 3M4YA 1BDOA 1TVXA 1IBXB 5DAUA 2WXQA 3SDZA 2M00A 1CHQD 2IGGA 2PNRC 1TWHB 4B9WA 2KAJA 3W1SA 1VDVA 2H89B 1Q1EA 1EL0A 3W2DA 4ILWA 3MTSA 2EE1A 1B9NA 3PUYA 1GJXA 4X3SA 1XCQL 1EY5A 5GXGB 1TY2A 5K36H 4XT1B 2ZXRA 5KNBA 2EYPA 4J6HA 2IL8A 1MSHA 2NBFA 3P75A 3AEDB 3MFGA 2E2IB 1ESRA 1SNOA 1RHPA 2O2LD 2FBWB 2WXNA 5TSSA 4BA1I 1ZE3D 5C3JB 5EE0A 1E0ZA 1TR5A 5E3F