1FNVA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
total genus 43
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnvA02
4RGMA 1I4XA 1TS4A 1TS5A 4UDUC 1LTBD 1ENFA 1SBBB 1JR0D 1F77A 1JWSD 1DYQA 1SXTA 4O1NA 4RHSA 1D5ZC 1EFID 2RDHA 2XNAC 5FK9C 1PRTC 1B44D 3BVMA 3DWAA 2NTSA 4RH6A 1GOZA 4RFBA 1L0YB 4TSSA 1M4VA 2R61A 1BCPF 1S5DD 1LTTD 2SEBD 1BCPB 1UUPA 3DWPA 1JWMD 1ESFA 1RDPD 1JCKB 1I4HA 1LT4D 2QEJC 3TSSA 1BCPD 1CHQD 4OHJA 1RCVD 1B1ZA 1ET9A 3BVGA 2G9HD 4RGNA 5ELCA 2ICIA 1KTKA 1SE3A 1XTCD 1FNVA 1V1OA 5ELEA 1HTLD 2J4XA 1LTSD 1I4PA 2AQ1B 2O2LD 1LTID 1FD7D 3DWQA 1PRTF 1ET6A 3CHBD 1PRTB 1D5XC 1PYWD 1SJED 3EA6A 1RD9D 5TSSA 1EEFD 1MD2D 3EFXD 1PRTD 1D6EC 1EU3A 1PTOF 1BXTA 1S5BD 1PTOB 1TY2A 1YN4A 3V05A 1EU4A 2XRSD 1FNUA 1LTAD 1PZID 1KLUD 1V1PA 1I4QA 3BYYB 2RDGA 3BYTB 5I4DA 1HA5A 1JQYD 1I4RA 1PTOD 2NTTA 4L6TB 4RGTA 3GP7A 1CQVA 1S5ED 3MFGA 1FNWA 4K6LA 5ELBA 1LT6D 4DXFA 1EEID 1V1PB 4RHRA 4C56C 1G8ZD 3R8BA 3OWEB 1LO5D 4RGOS 2AQ3B 1S5FD 1LTRD 1CHPD 1PZJD 1QILA 1LLRD 1LT3D 5ELDA 4NZLB 3BZDB 4Z9CB 1FGBD 5ELFA 3KLSX 1SJHD 3O13A 1D5MC 2XRQD 1LTGD 1AN8A 2QILA 3URYA 1AW7A 1PTOH 1UNSA 2XN9C 2AQ2B 4BWGB 1JWUD 3SEBA 2WV6D 1XXGA 1HXYD 1TS2A 2IJ0A 3BVZA 1RF2D 1SE2A 1T5XD 1YN5A 3R2TA 2IPKD 1L0XB 4DXGA 1I4GA 1EWCA 1BCPC 1S5CD 1KLGD 1PZKD 1STEA 5FKAC 3MC0B 5D3DA 3R2IA 2CHBD 2TSSA 4L63B 1SE4A 1PTOC 1TY0A 4RCOA 3W2DA 1YN3A 1LT5D 1CT1D 4ZYSA 2Z8LA 1CK1A 1TS3A 1SEBD 1HQRD 1DJRD 5D3IB
chains in the Genus database with same CATH superfamily
2BDNA 4DN4M 2OWOA 1ROEA 3RFZB 3J9CA 4KKUA 1YJ1A 4OWXB 1Q81C 4YSZB 2X8XX 4DDID 3EQLC 3N1YC 3MJWA 1G291 1U4MA 1SBBB 3L17A 1JR0D 2O6VD 4M0WB 2VQEQ 5G55A 4NPSA 2RDHA 1X65A 3OW7A 3E3XA 1QKZA 5CV4A 3RZOH 2BDOA 3ZTDA 3OTOQ 2E2HB 4FXGC 3RR5A 4QUFA 2NVQB 2DLBA 3HOUH 4DAMA 3GTGB 3T1YQ 1ZP0B 3PZ8A 3VQIA 1IW7C 2WAQG 1YMHE 1RJTA 4IPHA 1E6EB 3DLLA 2H1EA 1CHQD 2OTLA 2PQAB 1KL9A 5C6AA 2EMTA 2M19A 5IIFA 1KC8C 2EY5A 2D11A 3U52E 2K6AA 3QJYA 3J81E 2F0VA 3GE3C 1H9SA 1PH1A 1ENCA 4URKA 4DV3L 1J6QA 3D31A 2V3PA 1SMYC 5BYQA 4C1NK 4NPNA 3I3CA 4KD3A 4ZQ3A 2RCNA 2KANA 3WAMA 3U9SA 4KIKB 4HKZE 2B2UC 5IP9H 1ILPA 2PI2E 2ZNVB 2REXA 2C9OA 1SIFA 3N52A 1EYDA 1DOKA 1ZEQX 3M4OB 4IWOA 4DV4Q 5HFYA 1EQQA 1LXDA 3HM6X 2Z0EB 5C3EG 2LFIA 4LK1C 1WTXA 2RPQA 2D2CC 5D6JB 2F0HA 1WWTA 4LF6Q 1SYDA 3MAQA 2B39A 3KDFB 1YN4A 4PNYA 4C80A 4DNIA 4OZAA 1EZ6A 3H09A 4X3UA 1EQRA 1C0AA 1Y8RC 2AEHA 2F0SA 2KOLA 3K6OA 2K33A 4R4CA 1A62A 3AE7B 1WVLA 4FP5D 2UYZB 3VFKA 3R7RA 3NS8A 1HZCA 2NVYB 3HOYB 4JWSC 1WGRA 1OQYA 4ILWA 2R7ZH 5LMNQ 1BT0A 2RMMA 1O7IA 3PO2G 2R92B 3CIRB 5IOCA 1TWAB 1YIJA 4POGA 1SNMA 1CQFA 2E74C 1EO6A 1FGBD 2KDEB 4DHZE 4X3KA 1NBWA 4IKGA 3A8JE 2XRQD 2BCOA 4O42A 4N9PA 4CKBA 1HRJA 4BKTA 2W54A 1K50A 1UNSA 1GM5A 2F52A 3I56A 2EXZA 3AMZA 4MGYE 2D5DA 3NWSA 5DLQE 1HXYD 2WYQA 2DZIA 4K3BA 3U4VA 1WXMA 3FDTA 3AFQA 1BBXC 4NXMQ 2QHOA 3P4SB 5FLXE 1LYLA 2A5UA 1WJUA 5AZGA 3VYUA 2PE9A 4AP4C 4WQMA 1KRSA 3I72A 4A3EB 3TBIB 2E2IB 1N34L 2D3BA 2AHOB 2B76B 2BS3B 4BVUC 3AV8A 2ID0A 1D3ZA 4YTNB 2MCNB 2BYVE 2HE7A 3AE3B 5DPSA 2R93H 2LVQA 1WCMB 4L5TA 5G3LF 2D3CA 1CT1D 2A74C 5A2QL 1A70A 4MZ9A 3PUVA 2ICEC 3PUYA 3VR5A 5GADC 3AE2B 3DHHC 3PRZA 4LNOA 4QY7A 2EE1A 3E56A 3NZ3A 3KOJA 3UE1A 2IX1A 4ZRZA 5C3XA 4IOAA 3GTOH 1Q0WB 2L52A 4FBJB 4US8A 3W3AA 4J8QA 2XIWA 5CV8A 3TRZA 2WXQA 4W9EA 1I50B 1KXLA 3H9DA 1E5WA 4AWJA 3SU8X 1SMXA 2JQOA 3Q8EA 5D94A 4LMQD 1GUWA 2LUMA 3LJ3A 3S1RH 2YYZA 4A3CH 3DWPA 1ESFA 1PH2A 2K3UA 4P71A 4HVBA 4GLAC 4OO1I 1TZ1A 1YHAA 5C4JH 2HT1A 4IUVA 2BWFA 4WWPA 1MHHE 2VH2A 5CX3A 2F0PA 2LRUA 4OXPA 1H8CA 2G9HD 5IYBH 2OQ0A 3JAME 5FJ8H 4YL8A 2MWSB 2BTEA 4AH6A 2ZCBA 2KQ3A 2K6QA 2FUHB 2X38A 5KEEA 3S1NH 3D3RA 4HEA1 1F0ZA 3Q8BA 3P7JA 4F8MA 2ZPYA 4EZJA 1KABA 3VRAB 3WALA 3NEMA 1SLJA 5LMNW 2BH2A 2IW3A 1FFUA 4IUNA 1SJED 3PUZA 4G0NB 2W55A 3G48A 2MA9B 5ELOA 1KLVA 4LF4L 2AUKA 3A5ZB 5D2MB 2QJLA 1WGKA 3VR6A 2JXTA 4R8NA 3J7ZC 3J7AV 4NJ7A 3U30A 4FVMA 1IYUA 1VCIA 5EPLA 3OAWA 1I42A 2X69A 3V05A 1XPUA 4CGYB 1WY8A 1OXTA 3SK6A 4F87A 4X6AH 4OVVA 3CCJA 3BYTB 3R3MA 4A3GB 2OF1A 1TU2B 4IM0A 3S2HH 3AI5A 3VDYA 2LWPA 3CF6E 5M3FG 4W9LA 4B9KA 4JX1C 1KRHA 4WWNA 1W2BA 3GTLB 4JYAQ 2BOSA 2E3TA 1U4AA 3ZDMC 3GZNI 2MHVA 2RCFA 1LUZA 4MHEA 2O6VA 3GD7A 3KLRA 2J53A 1ENAA 3W1SA 2EIFA 4AOFA 1LT3D 2K8CA 4DR4L 4MTNA 4IJHA 4A3JB 2FIFA 4O0AA 2WXIA 3ONAB 2L8JA 1AH9A 2PIAA 4DHJD 4IWQA 2Y0SG 5M5WB 1WGHA 3NHHA 3E9SA 3PZDA 4CDDC 2ASBA 4QIWB 2KDFB 1BBWA 4PZ8A 2IPKD 3CMMB 4X3SA 2KZRA 1PZKD 2N78A 2RBMA 1H9RA 2K22A 1WTPA 5IP4D 4GOPA 1MVKA 4HAEA 1RAXA 2Z6KC 1IYVA 5GAGC 4UP8A 3GE8C 1Q1OA 1SROA 4JBMA 3S14B 5CV5A 2RD0A 4IUQA 1H9KA 2M2LA 2F0QA 3EJIA 3TZDA 4A3LH 3N3KB 4GN3B 4DAPA 2PJHA 3J81L 2MX2A 3A9KA 4G7OC 2JZZA 2WB1G 2K03A 3APFA 3GTPB 1DYQA 3HOVH 2W3RA 1A2TA 3CW2C 3Q3JA 1EF1A 1K52A 2KFKA 1GVPA 1UGJA 1L0YB 2LD9A 4KK7A 4R3DA 4POFA 4PYUA 1FRDA 2BPSA 2QSDA 1ILQA 5IE8A 1QOAA 1IBKQ 1QOHA 2WNMA 1MI0A 3QG1A 3DUZA 1IZ6A 1Q46A 3NELA 4DV1Q 4XX5A 2K5VA 2PQEA 1Z47A 1YJWA 1QNUA 3J7A5 3VA7A 5D7GA 4WJQA 4ANVA 1MBYA 5AEKB 4BAXA 2MO0A 5KYLA 3K5NA 1GXDC 4R1JA 1B2TA 2W82A 2JVCA 4HDQA 3HG9A 1JC7A 1G91A 3C46A 2K5QA 2EVBA 2JA8B 4A3MG 2M9VA 1R4NB 4K81A 3HOZB 5J1ZA 5C5MA 2J4XA 3TEHB 2AQ1B 4KN4C 1XCTL 4XDDA 3DWQA 4L8JA 1SE8A 3CHBD 2QIEB 3I9V1 4A3KG 2VZKB 3P4PB 3VYRA 5IAAC 3ENEA 1QNKA 1N36L 3I2ZA 4MN3A 3S1MH 3FC4A 4BY1B 3PT2B 4A90A 2K04A 3RLFA 5EE0A 3TREA 1WXVA 2AMCB 1GUTA 2JT4B 5AUKA 2BVCA 1OGWA 1XLQA 4DV7L 1T5EA 4H02A 2FXQA 3KJPA 1PZID 3WOFA 1Q5WB 2I38A 2KXJA 2UU7A 1FL0A 4OVUA 2RDGA 2L5TA 2JSVX 2NTTA 1QZEA 1PFMA 3X23A 4I7AA 3KVFB 4RA8A 5C44B 4DXFA 5CC4A 5FLXL 2CKHB 1CKMA 2LGXA 1G8ZD 3N1XC 1TR5A 3V96A 3KYHC 3LWUA 1F9PA 3STBD 4F88A 2KVRA 4QGUA 4PQXA 4DR7Q 1C4CA 2BWES 1PZJD 3L0WB 3ZXVA 1EYGA 4PS3A 4KHPL 1AE3A 1GB1A 2LASA 1SE9A 4M00A 3S16B 4OZCA 4OZBA 2KUMA 3L2PA 3T1HL 4QAYA 5LNK1 2ALYB 1JOKA 1V81A 5I9PA 2QILA 2KHJA 2Q2IA 2UUAL 2VS1A 4KJNA 4DF7A 1E24A 4H13C 5IYCH 1HZ5A 1WGDA 4KDIC 4UP9A 3L10B 1RKNA 3D4WA 3KJOA 2XSCA 3A7LA 3KF8A 4DA2A 3ZO5B 2Z0DB 3LB8C 3F1ZA 4JI8Q 3UGBB 4HSVA 3N30A 2B8FA 1UEAB 1PYBA 1VF5C 3WWVA 1Q7YC 4OEMB 4Y52H 4E6IA 4BBNF 3GTKB 4NNJB 3G6JB 1TKGA 5JVG3 3W2DA 2JYEA 2R7DA 3I5JC 5E4WC 2Z8LA 1BMLC 2RDBC 1V1PA 4B3ML 4JQWC 2VQFL 1QF6A 2E76C 2QA4A 3CU7A 1P7FA 3BS1A 4KY7A 1D7QA 2CWAA 3MP9A 3LWEA 3JAML 4OIJA 2W9NA 3AE4B 3K9PB 4GZYC 1YD8U 3FKIG 1NAPA 3OJ3A 3Q8CA 3QX1A 1SDFA 3OPOA 5M5YH 4W9GA 4E71A 4JI0Q 4R4QA 1MHWC 1J7BA 2GBRA 2H88B 4ANWA 1E7UA 4J15A 3HOXB 4GGQA 1U4LA 2E6XA 1J9OA 1L5PA 1JE4A 1J5EL 2JXXA 1E8WA 4XYCA 3T1HQ 3OWFA 2FMMA 3CPFA 2A19A 5I2XA 1RDPD 2J7QB 4DV5L 2F0NA 2F4VL 1VDVA 3QB3A 4LF5L 1VQ6A 4OO1G 2Q2HA 2LHEA 3A1QB 4HCPB 1BCPD 1HHVA 1VQOA 2UXDL 4C1NI 4KKJA 1A63A 1CZGA 1MJDA 1CA6A 1ZDVA 1B1ZA 1XMQL 1K8GA 2KJHB 5ELCA 4DAYA 3KBGA 5M3FH 3OMCA 2CFMA 3OOCA 2A6ED 3PCOB 4OONA 1HPCA 4E74A 1E2VA 5IT9E 5BMHA 2NVUI 3Q3NC 3T9LA 2DJFC 4DU9A 5E6NA 1RFAA 4KY6A 2KTRA 2LXCA 2LJ5A 3VR2A 1K51A 2VUMB 2DAJA 1V5TA 4HXDA 1JMLA 2GN5A 3PSIA 3CXCA 4KN7C 2N4FA 5JPMC 4N9F4 1EQVA 1EEFD 2FINB 5C4XB 2NPTB 3J80i 2BB6A 2SDFA 3IFWB 2WXMA 3EFXD 2K1FA 3P1HA 2K28A 2N49A 4JCVE 4FDBA 2J42A 4K0KQ 4JI4Q 4GN1A 1TWCB 1N63A 1BNZA 3TP6A 2WKDA 5CORA 3TEYA 3QC8B 2BE5D 3MXPA 4KDLB 3ABVB 2YV5A 3EC8A 5CYUA 2E8GA 1OXXK 2PNHA 2Y5BB 3N32A 1MIUA 5FLXc 1K0SA 4QIWE 1NEKB 3A8IE 1WJ6A 2OEDA 1CM9A 1L6UA 3PUWA 4LF7L 4B3TQ 4IUUA 3C1FA 1E2ZA 2W3SA 1H9SB 2NB0A 4ID6A 4IJLA 4LF5Q 1GHJA 4FYDA 1GC6A 4M01A 1WX7A 2NZ1D 4JG2A 2KCCA 2FCMA 1EFWA 2IGHA 2WDRB 4HPPA 3NG0A 1LLRD 1DCZA 5JJIA 2EQSA 1E1TA 4FJYA 2D3GA 2VW9A 1RRBA 4A3IG 2WU2B 4YCVA 2ZT9C 2XWJB 5IYDH 5HI1A 1AN8A 4KD4A 1FPYA 4R8IA 3AB9A 2AQ2B 4BWGB 4X65L 1XYIA 1PDXA 4WWOA 4OIKA 2WV6D 2K75A 1V5OA 1E2WA 3K7AH 3KUDB 5BMIA 3BVZA 4BXXG 2CHWA 4K5XA 4RF1A 4M8MA 2GB1A 2KQ4X 2UUBL 3RUZA 4R9WA 3FAHA 3K80C 4A8XC 3CCSA 1VDZA 1AZQA 3PO3G 1FGUA 1O7YA 2LZ6A 1F2LA 2LJIA 1L2FA 2QCPX 5EAYA 3SDLC 1I6HB 1KNAA 1I3QB 2ZVOA 1RTOA 3AXCA 4M8NA 1E22A 2KKCA 2F03A 1IL8A 3DHGC 4DR5L 4KX6B 1L4DB 2HCCA 1F2MA 1X54A 2KCNA 2K5DA 3SXHA 1YIWA 3STBC 4HJKA 4FADA 3I4NG 2CQOA 2CU1A 1N9WA 4A3MH 3DBSA 3MTSA 4UDUC 2B63B 1FMAD 4LF8L 4LF7Q 2NVTH 2DN8A 1F77A 3TMEA 4ZK9B 2G4DB 1EY9A 2V3SA 3BVMA 3UDXA 5GAHC 4A3KH 3VUXA 1HR0L 4RH6A 1DZ1A 1EYAA 4TSSA 4DV2L 3C0RB 3Q3MC 1I94Q 1M4VA 4MM3A 4CHKA 3CRLC 4AQYQ 1VQ5A 3Q8FA 2CH4W 2Q8TA 4YCUA 4RM8A 1A8VA 1P8LA 2A1AA 2XK5A 3GZNB 1RHPA 4KLKA 4C7YA 1VQ8A 2Z0SA 1RFKA 3DVGX 4X65Q 2X6LA 4OHJA 1TWFB 2LY7A 4KZCA 1NYQA 2B2TC 3RN9C 4JK1C 2LEKA 4KV6A 2JA6G 4OWTB 2UUBQ 2N7EA 4F8CB 3HEJA 3VR8B 1PGXA 3UQAA 1AWDA 4LFBL 1FXTB 2MEKA 1JMCA 2GI9A 4B3SQ 1I4PA 2VH1A 1XJVA 4C3HB 3I70A 4G4KA 1FD7D 4ZLTF 4R4TA 5M3MB 4K7UA 2PTLA 3F2UA 1SYBA 2BKFA 1Y1WB 2LXKA 4A3DB 1H9JA 1C76A 2RVLA 4DR5Q 4RCNA 4HK2A 3AM9A 4KJOA 4KMUC 3MXNB 3L3OC 3SVMA 1S5BD 1L6VA 1X32A 2B2YC 3PV0A 2R7FA 1KRTA 5JEAH 4DK0A 1HNWL 5IP7G 5HGQA 4GIVA 5DPRA 5FOBB 2KOXA 2Y3AA 4GSWA 1KNEA 2HDEA 3I4MH 3RNGC 2NN6G 2Q2UA 1JQYD 2B2WA 4L6TB 1ONLA 4DR3Q 1HR0Q 5E6OA 1S5ED 1LACA 3MFGA 2N1VA 4B08A 3B9JA 4B95A 4C00A 2INNE 4PG3A 4US9A 5BN5A 4I7ZC 5E7NA 3W9CB 2E5LL 1AYFA 3BWUD 3GS2A 1R9TH 1MG4A 1R4NI 2DYMA 3PV1A 3H0GB 4IOIE 2EOTA 2M56B 5GXGB 1SNOA 1PFSA 2A6EC 3DWGC 2HHHL 4NZLB 4DR6L 4LFAL 1GUSA 5DM63 4X62L 2ZJQA 2IY0B 4H2AA 1FCLA 3SDZA 2JF5A 2WXFA 1WTOA 3I7FA 3RNBC 3FKIH 2K5HA 1AW7A 3NY5A 2PLPA 2GLSA 3DVGY 1QVGA 4B6WA 1Q8IA 4LFCL 1TS2A 3Q6SA 4NB3A 2EPBA 5IGBA 1HUNA 1N32Q 1CI3M 3GDEA 4DXGA 5C0XI 4IFDH 4HR7B 1QOGA 3V6EB 3MC0B 4FF2A 5CV7A 3HOUB 5M5XH 4JL9A 3CCLA 4L5SA 5IGGA 3JYUA 5CHVC 1YNJD 4J6IA 4L63B 1D1IA 2UXCQ 2MJ8A 2R2QA 1G6PA 3HOYG 3TIXA 4BKGA 2CU3A 4W9FA 4DDGD 1EIGA 3H3VC 2DENB 2R92G 1B70B 1NENB 4HWIB 3ZW3A 2V0GA 2KHIA 4MIUA 4S3SA 5BYSA 2O6VB 1UE7A 5EJWA 3J81i 2KDIA 4EVOA 4X64Q 1OEYA 5IA7A 2KYWA 1XMOL 3H94A 2I5HA 3UDIA 1X3GA 3PLUA 4DV0Q 1B53A 2K32A 5IT9L 1XLNA 3SFDB 2BYTA 3S9WA 4PMCA 3SD5A 3WA0A 3M3YH 1OTCA 2DUDA 3BJUA 3SHLA 4RFBA 2BW2A 3AU5A 2OT2A 2HHHQ 2PYKA 4MSMB 1RODA 4LFAQ 3BU2A 2L55A 4GN4B 4X62Q 3HOWB 4LUVA 2OXPA 1ZXIA 2KNBA 2YEPB 1GJZA 2GRIA 1ACCA 3UF8A 5EDSA 4C3IH 2OTJA 1NVID 4RNAA 1STGA 1GB4A 1HUMA 4A3EG 2QEJC 1F9JA 1WX8A 2L32A 1EIHA 3L54A 5E3FA 4IG7B 4GOPB 1WCMG 2JA5B 1L4ZB 3IBEA 1HZAA 3Q2AC 4W9HA 4NQLB 2OEOA 3W1GA 4XE0A 1HR0W 1VQCA 2NBUA 3P42A 3PRMB 2ZJRA 3VYSA 2EKEC 1VQ4A 4A9AA 1KJTA 1STAA 3RNUA 3WDNA 1KFYB 1Q90A 3A9KB 5CHWA 2IT1A 5GROA 4KVGB 5EE9A 2L12A 3J81j 2D2QA 3A55A 3RNFC 1X6OA 4A3IH 1VZ7A 4CDCC 1ZKOA 1FJGL 3GTQH 1ZUD2 1TIID 3H1UA 4TUUA 2KFKB 1GG3A 1AEXA 1RYJA 2C60A 2MW5A 3I4LA 3GOEA 2L9HA 4GMVA 3PTFC 3H91A 5EKLA 1C9FA 4I6LB 3DM3A 4BXXH 2F0WA 2WKCA 4NMZA 2O2VA 1WTWA 3AEGB 1IGCA 2CVRA 5C2TB 4ZDVA 2IDYA 1JQ4A 1BR9A 4WJ4A 3FVQA 1VLBA 2KLCA 3PO3H 2QC8A 1M90C 1PA6A 1SIJA 1S5FD 3OG5A 2K5PA 5EKKA 2I07B 4NP5A 4A3BG 3QAQA 2NVXH 2PNRC 4GNXA 1F2YA 4RKBA 1K9MC 5CR3A 1VQIA 2YU9H 3RULA 1ICWA 2D0OA 4G11A 1PMRA 1V6EA 2V4LA 1F2ZA 1Y8OB 5ELFA 5FO8B 1CJEA 1Z2MA 1PFBA 2JWUA 3J80L 5HGTA 3DEPA 1WZ3A 1WD0A 4TKNA 4WJOA 3A54A 2I1KA 1WFQA 2WXPA 3VHTC 2N88A 3B0AA 3BDLA 5HHDG 3S1QH 3MJ5A 1EWCA 4A3GG 1KQSA 2ZXOA 2DZMA 2MBBB 2ZXPA 3H7SA 3S1RB 2V4IB 4PMBA 3M4YA 1SNPA 3WAOA 3QK0A 4WAAA 5H8YE 4GKJL 4JI1L 1BBUA 4LUZA 1PHJA 1S4ZA 3TMPB 3PS6A 5C4JB 3X3NA 3KYDD 3ND9A 4NDXA 2PE6B 4QUCA 3EN2A 1R4MB 4H44C 1CK1A 1W3SA 2JA6H 1EWYC 5DAUA 2L11A 4AQ7A 2EY2A 3JAMi 1RM6C 3TUOA 5FR3A 1Z9FA 4DV3Q 4A3JG 4P6VF 2CWPA 5H1SE 2N7DA 3S1NB 4K1RB 5IT9c 1U0LA 2D07B 2HDLA 1ZXTA 4RHSA 3TN2A 2VB2X 3NP8A 2MFIA 3M62B 1SB3C 4W9JA 2K25A 4HIDA 2YEPF 3GV6A 4GDLA 3KF8B 2NWGA 2UUCL 3NPPA 3GTGH 1QG7A 1L0WA 3GTMB 4N9TA 2HD5B 5BN3A 5IGFA 2ZJPA 3Q23A 5KHQA 3Q8DA 1B9NA 3MHBA 1PV4A 5C0XJ 2NN6H 4G50A 5FO7B 1BUVT 2J0MA 1ET9A 3BVGA 4AYBB 1I6VC 2EXDA 3HKZB 4ULLA 2A68D 3S2HB 1TBEA 1HFGA 1NNXA 1ZOYB 1Y69U 3G7LA 1HNXL 1ASZA 4KY5A 3KK7A 1OQRA 1TJEA 1IBML 3AE6B 4FLHA 3VTVA 4EQPA 2PW9A 4A75A 4BY7H 2EJMA 2DBYA 1A6XA 3QOLA 4RAUC 1V97A 3NUCA 4IZ8A 2HJ8A 2LFNA 3PVLA 3RNAC 1GO3E 2MPMA 2IWHA 4Q0FA 2M17A 4EZKA 4ZRIA 4B0MA 2HIXA 4XYOA 1SYCA 1G2SA 1NSNS 4A93B 2UXBL 3A5UA 1E8YA 2IBIB 3E9IA 4A6QA 2QF7A 2DY8A 3K0XA 4DV6L 4JI6L 2A69D 1XLPA 5JJKA 3CCMA 2JRHA 1KF6B 1ASYA 3SE0A 1F9RA 1GC7A 1MPEA 4BBSH 3OIPA 3M7NA 4TKOB 1JROA 1K83H 3QIJA 3KF6A 2LGYA 3ERQA 2WAQB 1N34Q 2F3IA 1MG8A 1Y14B 3NVVA 4DAYB 4RGOS 1QVFA 5IWAL 1WX9A 2JA8G 3BIID 2HUGA 1WM3A 4Y7NB 1FR3A 3HOZG 2INPE 4DKAC 3HOYH 1XX8A 1PH4A 3L08A 2JE6I 1E90A 5IN7A 1PLFA 4A3FB 2L3ZA 4DHJB 3D4DA 3W1SC 2LXJA 3HRZC 4FXDA 3J80c 3HS0C 1TWGB 1VQPA 2KTRB 3U4EG 2MQHA 1A3VA 1UWXA 2GMIC 2WIIB 2WXLA 4LUOA 4BY1G 1G6ZA 3FMCA 3UIOB 1C4PA 4JIOU 3FEWX 3M7GA 2XBBC 3D8GA 3J7AF 2ON8A 1OEYJ 3DVNV 3HOVB 3L4PA 3TQYA 1YVCA 1KH0A 2JEAI 3Q3OC 5BYRA 4FULA 3SK4A 1WGGA 2BGFA 2AKWB 4CO7A 1X1MA 3NQTA 5C44G 3R2IA 3U50C 1S3SG 3W5UB 3K7UC 4EOYA 2PKOA 3AEVA 2RGFA 1VQAA 2P5ZX 4GS3A 3RT3B 4GOPC 4JI2L 3LYYA 4BBRG 2JUOA 5J17A 1N33L 1CZPA 4C4VB 2Z1CA 5D3IB 2FBWB 2C5LC 1IYFA 3AN1A 3WAPA 4M02A 2KJ6A 3LGJA 3PF5A 3CC2A 4I6PA 3A8KE 3QWNA 4LWCA 3K5MA 4JI7L 3MTNB 3A4RA 2EZVA 1B4OA 5EKIA 2IX0A 3ZRFA 1DXMA 3HVDA 5IWAQ 2WINB 4N58A 5LXIB 1C78A 1IUEA 4LNIA 3P4QB 4F7XA 1C4AA 3S15B 3U4ZA 3B2GA 1QVCA 4LF4Q 3VR4A 3CP0A 3S1MB 1LTTD 2KDMA 4WURA 1TVXA 1XPOA 2N55A 2LRWA 1UE1A 5LL6S 5C3WA 2BS2B 5IGEA 1E9MA 1WTVA 4YHHL 4JWUC 1RCVD 1YNTE 5EPKA 5CMDA 4YXDB 3KLSA 1WF9A 5JZEB 2MP1A 4BA2I 1WD1A 1EWHA 4JPBW 1P7EA 4IPGA 2L0CA 4EE2A 1HNZL 1C3TA 1STHA 4K2LA 2KJRA 5EBCA 3NUHB 3IL8A 1O80A 1Y8PB 1Q82C 1DGJA 1GUAB 1Y1VB 2IY1B 4A3BH 3VUWA 2KJXA 4JI2Q 3U9OA 1TKWB 3EA6A 3SHQA 1D1KA 5C3EH 3PIOA 1RIPA 4DR4Q 1YQ4B 3IXSA 4RMAA 3HVZA 4FA6A 3HOXG 1KDAA 2BBCA 4MGKE 3RD4A 4NJ6A 4L2YA 3TL5A 2AL3A 1VZ8A 2BB5A 3S17H 4DR1L 1PRTD 4MM3B 4HRSA 1MKHA 4IC7B 2KWUB 1X9NA 4JI7Q 1IXRA 1SYGA 4PMWA 3NWTA 5M9OA 3V61A 2XRSD 2XK5B 1B7YB 4L5QA 4BA1I 3CPWA 3NVWA 3V60A 1D2BA 1NR4A 1TKYA 2ACZB 3O65B 3PREA 3F8TA 1CTMA 2MQJA 3HFZB 2Z4HA 3AQQA 2LVPA 2YVCA 1BF4A 3HM3A 3OWEB 1T0QC 1LO5D 1FRRA 3QIAA 3PO2H 3DQVA 3QJZA 1JJCB 2N1WA 3L13A 2EYLA 3J7YW 1LGRA 1ZW7A 5JEAJ 2EELA 2Z59B 4W9CA 2JA7B 1WRIA 3VXWA 1U4RA 1QILA 3L7ZC 5D65A 2VUMG 5AFWA 2PVGC 4DXAB 4XWWA 5FLMG 2V1CC 4DK1A 2L83A 3AEAB 3ZLZA 1EY4A 1NTGA 4EEWA 2KACA 4B9WA 5C4XG 4M8AA 2L05A 4ARCA 1HNZQ 2KHSA 5C5LA 1DOMA 1UE6A 1KD1C 5KIXA 4G3XB 5M5WH 5M5YB 2KWDA 4GXBA 3S24A 5I9OA 1YQBA 1IL2A 1SGHA 1C79A 1P3QU 4HMIA 2D0PA 3GV3A 1S5CD 3GTJB 3CWIA 4N6EB 2A69C 2JP1A 1RWSA 1QUQA 2KMAA 3PGEA 5AJ3L 4GN5A 4IQZA 2J7ZA 4NAMA 3U7DA 1AP0A 2XEWA 4FF1A 2LSSA 1TY0A 3M85A 1J0GA 4W9DA 3V2TA 1EIFA 5K36G 2BA1A 2N9KA 5IODA 4LJOB 1VMPA 3RZDH 4GOCA 4KKIA 1QWYA 1V43A 1Y56A 1HQRD 5J3BA 5CBEE 1HH2P 4APVA 3DBLB 4P16A 4IFDJ 4AYBE 4HPLB 4EFOA 3HKZE 3VVWB 1Y8NB 3NTIA 1WR6E 2KWCA 1J7AA 4ALPA 1B44D 2WXOA 4HKQA 1PH5A 2MNAA 1JOQA 5DM73 4MJSA 5LMUL 1N36Q 1P16A 3T56B 1XQQA 3RUIB 1X3EA 4EZLA 1S5DD 4QJFA 1BCPB 2SNMA 1H4RA 5DNFA 3APCA 4HIOA 1GD7A 1OXUA 3RN5A 2Y5CA 4DV7Q 2VZKD 2Y0SB 1Q10A 1V80A 1VCBA 2KVZA 1K53A 1KAAA 3KUCB 1K28A 1M1KC 3H7PA 4H0LC 4XC2A 3KQ4A 2G9DA 3I57A 4CKEA 3J81c 3NJTA 3CAMA 1R4MI 2A4ZA 2BS4B 4KKTA 2J0KA 3M95A 2EYFA 1N61A 2G1EA 3AECB 1J8IA 4PZ7A 1FNVA 2K01A 5AJ3Q 4G7HC 2JX5A 1A5RA 3HOZH 4U673 1T0YA 1E3PA 4IALA 2B63G 2I0QA 2WAQE 4K14A 3T3OA 3VTWA 1YNND 4PS8A 1M8AA 1VR9A 4GLSC 2JY6A 3W1BA 4KHPQ 4MACA 1PYWD 4HJ9A 2K52A 4JV5L 2YTVA 2L7RA 5AZFA 5JHAA 2RHQB 4P72A 1WYDA 4EX5A 4DR2L 2KQSA 3ULPA 1UELA 2UUAQ 2ZEQA 3NBHA 5EBDA 2NYZD 4NKLA 1WMHB 2N9EB 3DEOA 1MJEA 4XIGS 3AEEB 2PO4A 2WQYB 5E1FA 4HN7A 5HKHA 2L15A 2KD0A 3AULA 4P73A 3FPPA 1PTOD 2WP8J 3L16A 3PSEB 1JRPA 1XNQL 2GBJA 1CSPA 1PQSA 1E7ZA 1YJIA 3P75A 5C44H 3H6MA 4KZ0A 2CHZA 3UQBA 4B9XA 4HJAA 2Z4IA 3UI3A 4BBRH 2AYOB 4CJ1B 2WP9B 5J18A 4P1CC 2OCEA 1YHQA 2F3VA 2MUYA 2M8SA 3KW5B 4C3HG 2F0EA 4B3MQ 2VQFQ 1KIXA 4IURA 1DOYA 5CV9A 2Y5PA 3MWYW 4GDLB 1Y1WG 3S16H 4A3DG 1LTGD 3CSFA 4OW0A 2EY1A 4ZCKA 1Q12A 1PTOH 2XN9C 1XNRL 3PRPB 3P1MA 2WWZA 3Q69A 4ASWC 1X3FA 4NAWA 4DUYL 5E6JA 1AFPA 1F9SA 4LNNA 2J0TD 2AWNA 1GUGA 3QQ8B 1TWHH 4YSXB 1OO9B 1J5EQ 2JXMB 4F7ZA 2O2VB 2M00A 1AZPA 2LMCA 3ZGZA 1NBFC 1VQLA 3SGIA 4DV5Q 2F4VQ 2B3AA 2H5XA 3BDCA 2UXDQ 1KDBA 2FAZA 3WOEA 3WANA 1LT5D 2PZUA 5L37A 1XMQQ 2WXJA 3NZUA 5E6PA 1FXIA 1L0VB 2WU5B 1ZKHA 2BA0A 2BQQA 1IHZA 2FFKB 1PVOA 2DJGC 3HUIA 4GNXB 1I4XA 1TS5A 3EUB2 2KN4A 4P7IA 3G4SA 1SYEA 3VYTA 1VZ6A 1I5FA 1L1OA 2WHIA 2NBVB 2KEDA 4JC0A 1NMFA 4C2MH 1D5ZC 4XDXA 3A74A 2A8VA 4ZHOA 2F4IA 3W1YA 3MC8A 4I65A 1PH9A 3ER0A 2BH8A 1UF0A 3TJPA 4NXNL 1QQRA 2IGDA 4QCLA 3CQZB 4GKKL 1BKBA 1BCPF 2JSOA 3EVQA 1VQ9A 3KBXA 5HG2A 2SEBD 1DOXA 3T53B 1SFOH 4FF3A 5IGCA 1HTPA 1LV9A 2L0TA 3HOUG 1EUVB 4K7SA 2OQKA 1LT4D 1YZ6A 2HQLA 1WSPA 3NQIA 2EYMA 2OHFA 4LCDE 1YJNA 2C9WB 3I4MB 1Q3LA 2RPVA 4MT5A 4YSYB 1U5KA 5J39A 3TCAA 3JAMc 5GMVA 2F0MA 4DNTB 4DUZL 1NJIC 2A6HD 1XTCD 2UU9L 5E4XA 1V1OA 3I4OA 5J22A 4WH4A 3V6CB 2VXWA 1P98A 1R9TB 2F0OA 4EQOA 2MBHA 2O2LD 3PUXA 2RKSA 2WXKA 2K5NA 4EQNA 4A76A 2WXRA 1BVSA 1NMGA 2WFWA 4JI5L 2A5HA 2QEXA 2IY5B 3B6YA 5IP9G 1TZOA 4BOZB 4AJYB 2DX5B 4ZRJA 2LGSA 2K8HA 3GB1A 5C4XH 2AL6A 3HOWG 1VQJA 4FF4A 2DNFA 1G51A 3FKIB 3DBRB 3EFUA 2CJNA 3I8ZA 3TZUA 1HCZA 1TY2A 1S40A 2XVSA 2E2JH 1F9QA 4B3RL 4KKSA 4X66L 3D32A 1VS0A 1JWBD 4C3JB 2C7HA 1IW7D 2K8BA 3IT4B 1HA5A 2FE8A 4ICVA 2F0GA 2JA5G 5EE3A 2KT7A 1PUTA 2B2WC 1E8XA 3LDZE 3NTHA 3QARA 1L2NA 2ZTCA 3V62A 4WQOB 1E7PB 5LHY1 1JB3A 3UE0A 4LF9L 2R2OA 3A33B 1D8LA 4NY0A 4DK6C 5G2NA 1IP9A 1CKNA 1JW9D 2Q8IB 2JPHA 2HTHA 1SMYD 3CC4A 3NE5B 4JVZA 4ZUJA 1B3AA 2K05A 1WI0A 3CD6A 2V3NA 3TP7A 4LDTD 1YNNC 5JXVA 3URYA 2GBKA 4LF8Q 2EYHA 4LAAA 4IOCA 1IBLL 3HZXA 3MHZA 3T13A 4GB9A 4WJPA 3NBIA 5DPWA 4ZKBB 2V9HA 4MTKA 1QLBB 1V9JA 2M4NA 3AU7A 1WXAA 4DV2Q 3M3YB 2K7VA 1YN5A 4GDKA 2IGGA 2RSNA 4OX9L 2I5MX 1BCPC 2AWOA 4JI5Q 1HJPA 2ZCCA 5K5PA 1Q1BA 1X3PA 3OSOA 2J52A 3DPDA 3IVFA 4C3IB 4ZRKA 1PTOC 4K8JA 1I6HH 4J3OD 3T16A 1DD2A 1YN3A 1R4QB 2Y0SE 1E7VA 4X66Q 3EGRA 3P20A 3A7AB 4AIMA 1V86A 5F2DA 3EIVA 1YBYA 4LTUA 1IYJB 2MSED 4RWSC 4UHVA 4CKCA 2DGYA 4LFBQ 2B63H 4R4IA 3NZSA 3N1ZC 2PW7A 1EFID 3AU4A 2XNAC 1R7SA 4KHVA 1AE2A 1KHIA 5HURA 3RZOB 2MJ3A 4KGSA 1WZ0A 1S1QB 3KFUA 1IPGA 2MJDA 3HP3A 1UEBA 2BE5C 4OO1H 2K0PA 3A4SC 4HROA 1KOTA 2WACA 4HTHA 4IDIA 2Q8RE 4MNOA 1HNWQ 3SR6A 1KDCA 2KCTA 5AZHA 4IWPA 4M1UB 4B0EA 2HCIA 1JE5A 1K3BC 1C48A 4K7WA 4KTAA 1BO0A 2DAFA 1W6KA 3C8YA 1S72A 1PGBA 4JBWA 1SE3A 4OGQC 5IYBG 3DBLI 2KO3A 4WJNA 2L1AA 1QZGA 3HRDD 2E5LQ 4FO2A 2F0UA 4PS7A 3JC66 2JN4A 4N8X1 1OQQA 2JU6X 4LJPB 5GAEC 4WWMA 2PEAA 2VQEL 3OW2A 3QWZB 1YJ9A 1LTID 1WFYA 2NVXB 1WXQA 1SNQA 2VRRB 3K8AA 1CMXB 2JA9A 4DR6Q 4WORA 3B1LX 4WIPA 4A3OA 2YU9B 3OTOL 4JGHB 2CHXA 1N62A 2NCNA 3T1YL 3ZJYC 5FR6A 1XD3B 1D6EC 2GVBA 3M4QA 2FNJB 5JH5C 2IO1B 2D3AA 2BT6A 2QCZA 3I55A 1WGYA 1XT9B 4WFN3 4LFCQ 3E9HA 2B3GA 2RF4A 3PHWB 3M3JA 4MELA 4HIMA 3GP7A 3FPUB 2D5GA 4OVZA 3S1QB 2PPBC 3AH7A 4PV1C 1LT6D 4R4OA 2EJGC 3L0OA 2FJ2A 3HKZG 1VQBA 2KC1A 2PMZB 4TQ1A 1GPXA 3DHIC 4FHJA 3AE8B 4N59A 2R7ZB 1LTRD 4IN3A 1JRUA 2C5CA 2DWQA 2WDQB 2A6HC 1FIQA 4Z9CB 3LX0A 1X56A 3Q0AA 3ERSX 4GNXC 3PHXB 3H8HA 4W9KA 3NRZA 3SR1A 2EYPA 1VQNA 1XMOQ 2HJ1A 1M94A 4A93G 4UAIA 3MA2B 1X55A 1P1AA 4LF6L 1QOBA 1A15A 3RLOA 3S2DH 1ML0D 1XXGA 2BF8B 2KMCA 4ZYNA 1JORA 3X0WA 2F0DA 5T1IA 1SE2A 1IGDA 2PMVA 1HZBA 5JJZA 2NPTA 4J6HA 2Q5WD 1OFFA 3P4RB 3H3VI 1STNA 2EMSA 4YWLA 1STEA 5JPNC 1DOIA 2MP2A 1UGMA 2CHBD 2I5LX 2KECA 2IZVB 3M4PA 1W6JA 1KAWA 2HQEA 2PCFB 2R93B 1OTRB 2ZPNA 4ANUA 4KHZA 2RDFA 3AYHB 5LMNL 1JT8A 4QQBX 4TV3A 2M0AA 2INDC 3I4NH 3NHEB 4A3FG 4QB4A 1SNDA 3QCAA 1JICA 1K3RA 4IPCA 3IT6B 5G3LD 1PXUA 2FIDA 2GBMA 3ZKJC 2KFJA 4XTCS 2WXHA 3GTOB 1WR1A 1PDQA 1PFDA 4A3LG 3KWVA 2F0IA 4BY7B 1S3OA 2KN5A 1XTDA 4XT3B 3MC9A 5DCNA 5L95C 3G6EA 3DWAA 4G57A 3HOVG 4NXML 4K2KA 2KA7A 1FJGQ 1EM7A 1DM0B 2IHEA 1VQKA 3HOWH 2ES2A 1V49A 3UINB 1JWMD 3CCEA 4HDOA 1QUQB 3ITPA 1VQMA 4HCNB 2MHJA 2H89B 1FEHA 4L1BA 5IKCM 4WJ3M 2V1YA 4YWGG 5I2YA 4RGNA 2JA5H 4BBSB 1WJ4A 2OJWA 2QW7A 2PI2A 2DY7A 2KBNA 1PH3A 1K83B 1KTKA 1ZPSA 4DWFA 5GQOA 5KRUA 1GJXA 2MBOA 4EKUA 5ELEA 2B2UA 2QGQA 1N8RC 2WX0A 1H95A 1YHBA 1EL0A 4BKSD 4UP7A 2FMCA 1WTRA 1XCQL 1D5XC 3E0EA 2N7JA 2E2HH 3UDFA 1HZ9A 2NVQH 3E5SA 4A4IA 2K6DB 3FKYA 1A0IA 4ME3A 1C9OA 3DBHB 1SAPA 5IGDA 2SAKA 1H9MA 4MJSB 3WIMA 5CTRC 5IP7H 1WTQA 3B08A 3KH0A 2KK8A 3D6WA 4GLVB 4IW0A 2OOBB 1NI3A 3APDA 4DPGA 3TS0A 2R3ZA 2C7MB 1YNJC 1I4RA 4IO9A 3CKIB 4FNFA 1V1PB 2X6GA 3H7PB 2RA4A 1QT9A 3RPFC 1LTLA 5JOBA 4GKJQ 2VNUD 4JI1Q 1WOCA 2AQ3B 3NTKA 3NK9A 1OXSC 2LXAA 2D10A 1Y1VG 2EY6A 2ZTEA 3HK0A 4ZRQA 3T8MA 1O7ZA 2WXNA 4K5VA 3CF5A 1YOVB 3RLNA 3AB5A 3VH3B 3M4OH 1ISNA 3BZDB 1LFDA 3L9AX 3TEZA 3TDQA 1DGSA 4QF4A 4ABNA 4DNRB 4DAVA 3N9YC 4GU2A 3V3XA 1C8CA 3TS2A 4TQUS 4IM3A 4NW2A 3B2FA 1WYGA 5CBAE 3MFYA 1EF5A 3VDZA 2GBNA 2JZ3B 2L4NA 1K8OA 2G5DA 3DBRI 3U2SC 1EIYB 5IYCG 2SOBA 3NBHB 3A9JA 4OELB 3VH4B 3MXNA 2PZWA 2V4DA 3VR3A 1KLGD 3NS1A 3E6ZX 1HEZE 2UUCQ 1NYRA 2GOWA 3FILA 4NQKE 2NZHA 3ZYYX 3JVZX 1PFNA 4IFDI 4XDCA 4JYAL 4F1SA 1B9RA 2NVYH 4CYEA 4ICUA 4HEDA 3VA5A 1WE6A 2R92H 3NOBA 1IBXA 2RSOA 2WDVB 1QE6A 1TWAH 3IG3A 3OIQA 5G5HA 2JA7G 1SEBD 4II2B 1DJRD 1FD6A 3U7ZA 1HNXQ 2I46A 3DMUA 5IO9A 1NCVA 3BZKA 1IBMQ 4OL7A 4PYZA 1LTBD 1ENFA 5BN4A 1HA6A 1SF0A 2KCMA 2N3SA 2DZJA 3BK2A 1WXSA 1JWSD 1VQ7A 3IRBA 4A3BB 1I35A 4BS9A 5C0XG 2CH4A 2NTSA 4N8FA 3PIPA 5C3EB 2F0FA 4H7BA 4YCWA 5BR8L 4LLGM 4NAWB 4ZHPA 1YX5B 2UXBQ 4KGTA 3R3OA 3U58A 1UUPA 1O7LA 4A3EH 2E2IH 3S17B 4LJZC 2PPHA 2WS3B 4DV6Q 4JI6Q 3GTMH 1J7CA 3CCQA 2E2DC 4HIKA 2VB3X 1EOTA 1WCMH 1BQQT 2K5WA 1E0ZA 2LMCB 1QJOA 3R7QA 2LGIA 3CC7A 5A35A 3AE9B 3Q8AA 1TTNA 1EQTA 4JLCA 3RZFA 1YJJA 3CCRA 3JSVA 2KMMA 1YITA 4CDEC 1IKLA 3IAM1 2R6GA 3C3LA 1XEEA 1T9HA 3BG3A 2EYOA 4K5WA 1HTLD 1VD2A 3PLVA 2JYTA 1LTSD 3PO2B 2CJOA 3MZ5A 2PMZE 4TRDA 2YLMA 3DWMA 1I50H 4K6DA 5FO9B 3ONSA 1ET6A 1L1OB 1PRTB 1C1YB 3N20C 3AE5B 3EROA 3VR9B 2TMPA 1PH8A 2K14A 3LXFA 4MH0E 1IBKL 4A93H 1G2TA 3DCGA 1EU3A 1PYSB 4XXEA 1BXTA 2F1MA 4DV1L 2L0FA 2AX5A 2H4OA 2L00B 2D62A 2O4XA 4KSLC 3DVNU 1QCBD 1I4QA 3ZNHB 2Q2TA 4E3CA 2KDBA 4YWMA 1N6ZA 2GVAA 5ELBA 2HTME 4HMJA 1QB5D 3DHQA 5BR8Q 2XGTA 1V1QA 1TQOA 4RG1A 3R8BA 1J19A 1WJNA 4RM9A 3ALBA 5C4HA 3ZRCA 2NR2A 1ZDXA 4ZKCB 1VRAB 4II3B 4Y7NH 3Q24A 3PMFA 1CHPD 3ZDTA 3HGBA 1N33Q 3DXJC 3BK1A 4MGIE 3PQIA 3RN2A 4A3FH 3RZDB 2LI5A 5D14A 4XT1B 1A2UA 4FHKA 4IUMB 1TWGH 1K8RB 1GUOA 4M0WA 4P75A 2EKIA 4ZAIA 3K5LA 5IYDG 1LQBA 4GLXA 1EOVA 3SFEB 3KUZA 2ATWA 1B9MA 1K0RA 4TVAB 3FHWA 2IJ0A 3PO0A 4ACFA 2VL6A 4A3GH 5HY6A 2ZNVC 3QO2A 4D2KA 3R2TA 5ELNA 1I4GA 4YY3L 1SNCA 4LNFA 3GTLH 4LNQA 1WE7A 2ZJDA 2NBFA 2Z6KA 2JK8A 2PQAA 3NVZA 1FYCA 5JAVA 1E10A 5ISRA 1UBQA 1SE4A 3CMEA 4CJ2C 2A68C 2MGSA 4YHHQ 4RCOA 2B8GA 3EBEA 2KTFA 3PPAA 3RMHA 4DR7L 4BZAA 2M0XA 4ZYSA 3K5OA 2ONQA 4BKSA 1J8CA 3K58A 1V8QA 1JALA 2MRPA 2WX1A 4A3JH 2ZW0A 1SYFA 4RGMA 4V190 4J1MA 4AJWA 2LUEA 2YTXA 4CHTB 1DOLA 1YEZA 1CKNB 4FXKC 1FXAA 4DK3C 2LHDA 4KIKA 5LXHA 5NUCA 1FFVA 4PT5A 2IYDB 2WDTB 4JE3B 1EY6A 2KWVB 5FK9C 2EDGA 5L83A 1Z6HA 1EY8A 4JI8L 3TP8A 3RCZA 3S15H 2B2VC 3FRPB 1D4BA 1X3QA 3KDFA 3CCUA 4DR1Q 5MPOA 2ASQA 2N9LA 4GDKB 3DOWA 1OXVA 1JCKB 1QZHA 3ZJUA 1I4HA 2L1BA 2KLGA 3TSSA 2CKZB 4IUTA 3AEBB 1XPRA 1HTQA 3S14H 5LLIA 3M63B 2CS4A 4Q5VA 2KX0A 5H92C 2DNCA 2NN6I 5M3FB 3TBLD 1KM7A 1TXYA 2KVMA 1EY0A 5C23A 3RD2A 4C7ZA 3WCQA 4YY3Q 1SRUA 4RKLA 3K57A 2IO3B 2M1MA 4K8IA 1NDDA 3ETRA 3K0YA 2WLBA 4A20A 4YIJA 1E0BA 3I73A 3TP5A 4CDFC 3GTPH 1UWMA 1V8CA 1Y1VH 3BDOA 1C77A 2AUJD 2B2VA 4BBRB 4JI0L 2DYOA 1PRTF 2F0KA 2FHTA 5EGTA 3D4RA 2D9UA 1EWIA 1V9PA 1HTOA 1TYGB 2JRIB 2LVOA 3OLMD 3DM1A 3W5VB 4DK5A 3MXGA 1E8ZA 1PTOB 1ZGUB 3NVYA 1MSHA 1B3QA 1YX6B 3BINA 1FNUA 4XYQA 2FCQA 4A3PA 4BFRA 1ZYRD 3RNCC 4JOIC 5JEAG 3KYCD 4JI3L 2RR9A 5BMGA 1XF5L 4K6LA 3I4MG 1TWHB 3M9BA 1EEID 2MO1A 4XQNA 2LKVA 2JA8H 1MHXA 5T8IA 2QDLA 1PGAA 2LS01 4X3TA 4XQJA 1II3A 4CBVA 2JWZA 5G5GA 1CSQA 2IX3A 1JJ2A 4ZOHC 3QA8A 1XWEA 2JA7H 2QMTA 5ELDA 4MH8A 3LNNA 4L23A 4BY1H 3KLSX 2DYBA 2K1BA 1SJHD 2ZZPB 3MXUA 3O13A 1WJJA 1P0RA 2WB1B 2ENBA 3DBHI 4JOIA 3G71A 3VAWA 1EUJA 4G7ZC 4JI4L 4K0KL 2C7NB 3I63C 3I3TB 3K7AB 4LK0M 2FUG1 4U68A 1CKOA 4C2MB 5C0XH 3DDCB 2IHFA 4S17A 4USAA 1RF2D 2MBEA 3RNEC 1GHKA 5LMUQ 3ZNZB 3C2PA 2NMQA 2SNSA 4C3JG 1T0SC 4AS1A 3GTJH 5FKAC 4HPMB 5JJLA 3ZJTA 1SFOB 4IFDG 5CHFA 1FCCC 4B3TL 2NZOA 4PZ6A 1N5WA 4HJ8A 3AE1B 1CA5A 2F0TA 5KNDA 3E0JA 1A3TA 1RL2A 5M3MG 4DFAA 1FO4A 4WAFA 1B8AA 3OHXC 3F2BA 4YTMB 1SR3A 4TQ0A 4JI3Q 3OMGA 3AMUA 2UWQA 1JJGA 4A3MB 3U8ZA 5I6WA 4IUPA 2NVTB 4KSKC 1C4QA 3Q6BA 4HLEA 4O1NA 5LL6X 1Q86C 4A3KB 1L1OC 1VJKA 4REZA 1PRTC 2F0LA 1BUIC 4KI0A 4JV5Q 4XQQA 2INCC 3UDGA 1NY4A 1VQGA 2R61A 1T0RC 4DR2Q 3H15A 1NR2A 3GTKH 1SSNA 4DQOC 3T4AC 5KYIA 3K59A 4DBGA 5DEHA 3ZXRA 5CV6A 1FVIA 4C3IG 2MP2B 2E2JB 3H0GG 1CZWA 2RQXA 2JYOA 1B50A 3S2AA 3I91A 4QL5A 3IFDA 1XNQQ 3ZIMA 1JB7A 5KNBA 4V0BA 2CW0D 4Q2JA 4NJCA 1BOSA 4CJ0B 1Q1EA 3C19A 4ZRPA 3IHPC 2F0JA 4BBNC 2CCZA 2ZXRA 1K73C 4HCSA 4C4VA 4K3CA 5KNCA 4XWTA 2F3WA 3HOXH 5JVH3 1TGZB 4ODGA 1NI2A 2ZTDA 3RZWC 1I94L 2K4KA 1RD9D 1Z7TA 4AQYL 1MD2D 3BZCA 1WIAA 4PK1A 4HJ7A 5TR5A 1PTOF 1XNRQ 4FXCA 1K8MA 2IO0B 2LGDA 2QDFA 1WTHA 1EU4A 2YTYA 1YI2A 1VQDA 4DUYQ 1LTAD 1UAPA 1KLUD 3BYYB 3QOJA 1PH6A 3N6RA 2K9XA 2N8NA 4ARIA 1UD7A 3H3VH 1WI5A 1TT5B 2G4SA 1FNWA 2E75C 4IM2A 3QR8A 1L7YA 2FCSA 4RHRA 4C56C 3Q3FA 3ZQ4A 1LM0A 2WXGA 1O78A 4OWWB 1MFWA 1N5XA 1U4PA 3ND8A 1T6BX 5IOIA 4JBJA 4YT0B 4B3SL 4JPSA 5EQ0A 3IAS1 2B29A 2VUMH 1SN8A 1R4PB 2NUCA 3GQBA 3MEHA 3UI2A 3Q22A 5FLMH 2G45B 4LDTB 4S0RA 4XZ4A 1G6JA 3CSTA 1TT2A 3W5OA 3J80E 1WYWB 1D5MC 4DGZA 1GUNA 1NUCA 1YQ3B 2I1JA 4TMAB 2KQ7A 1XLOA 1AARA 1TWCH 2FCNA 3ZTCA 1HFNA 3R93A 4FJVB 4FJZA 1MSGA 2J0JA 2C35B 4LW1A 5C4ZA 3HHMA 4FN2A 1EY7A 1PH7A 3MEFA 3PIP3 2ZW1A 3ZNGC 4DR3L 4NXNQ 3QHTA 4GKKQ 4MEMA 3VRBB 4XGAB 2IO2B 3ULLA 2JQRB 2QKIC 3ML9A 5M5XB 5D3DA 3CCVA 2ZM6L 1ZYRC 1LABA 3I90A 5K36H 1ZXHA 4I6NB 1MI2A 4HJ5A 3ZNID 2KX3A 2L76A 1UE5A 2R7ZG 4DHZB 2IL8A 1TS3A 4ME5A 3TEWA 1VF7A 3D6CA 5J2RA 1JWAD 1GKHA 2I2YA 4DUZQ 1EZ8A 3RMKC 1TS4A 2UU9Q 1VQFA 3F2DA 4CQNA 1RLFA 1F2RC 1I7HA 4MDKE 3VTUA 5COYA 1P9DU 4ITKA 2CQAA 1SXTA 3ZVVA 3EECA 4RF0A 3GO5A 3EFCA 4EQ5A 5CGKA 4LNKA 1CUKA 1GOZA 4WRDA 1N60A 1N32L 3PF4A 4WJWA 2DZKA 2G3QB 1BDOA 4YWKA 1K8AC 3SK8A 3CQZH 3MVVA 3A9JB 2O5IC 3HIZA 3FP9A 2KHWB 3AEDB 4MGZE 2MBQA 2DNEA 5C3JB 3KF6B 3VUYA 1IKMA 4HJGE 5A2QE 2B2TA 4O2DA 4B3RQ 1GAQB 2HIVA 1I3QH 2UXCL 3FILB 3OYYA 5I6YA 4AUQC 2R93G 5KGUA 2XTIA 1XO3A 3P2BA 4W9IA 4JW0A 1DONA 1IBXB 2ICIA 4HSPA 4A55A 1TIFA 3H6NA 1ESRA 3IFTA 4X64L 2DHZA 3NSWA 3KUPA 2BYFA 2K50A 2ZVNA 2ZM6Q 5IY0A 2AWTA 4ZUIA 2JZPA 5EPJA 4L5RC 2N9XA 4LF9Q 2BYEA 4HCEA 4UPAA 3ML8A 1WH3A 3K9OB 4DV0L 3BY4B 2GA4B 4BY7G 3OJ4B 3SK5A 4MSQB 3ICEA 2PW5A 2OJRA 3PIO3 3R66C 4A3IB 2MJEA 5TSSA 3GTQB 1MGSA 1NE3A 1JOOA 2KAJA 2B2YA 1LM8B 4A3CG 3CMAA 2QDBA 1HQMC 2KC2A 5BO4B 1SSOA 2KEEA 3P63A 1RTNA 1IBLQ 5DPTA 1TWFH 2A73B 2WB1E 3K81C 3S2DB 2VY3A 3JW0X 4KV2A 2XWBB 1YNXA 2O5JC 5I4DA 1UH6A 4C3JH 1Z5SB 4BOSC 3C1EA 4RGTA 4OX9Q 1HE8A 1CQVA 2HD3A 2JJQA 3MHSD 5FJ8G 1A3UA 3PO3B 4BBSG 5T1GA 1WRDB 1CFMA 3NENA 3X3MA 1F52A 4KGRA 4YTPB 3HKSA 4P2CB 1Q8KA 3JSVB 2NBWB 1EYCA 4IPDA 3T51B 5EE1A 5AUIA 1E1OA 3RYTA 4C3HH 1U9RA 5M3MH 2HDMA 1F2RI 2CW0C 1TKEA 3ECIA 4ANXA 3Q14C 2EJFC 4QMGA 1Y1WH 4JBKA 4A3DH 2NS5A 3I4NB 3T3NA 2EYJA 2CR5A 1UWVA 2MH7A 3D0FA 4EGVA 4X57B 2KENA 2PZTA 3NXWA 2N0SB 3UIPB 1JWUD 3SEBA 1GNUA 1QOFA 3F2CA 3RI7C 2MLBA 3AFPA 2PVOD 1T5XD 3PGZA 3PZ7A 3KWLA 4AYBG 1T3QA 1FM0D 3A56A 1HZ6A 1L0XB 3ZJVA 1ICFB 1STBA 1C7YA 1UBIA 5C1ZA 1WMHA 3A1QA 3ZUNA 5KHOA 3ULJA 4P1BC 1V2YA 1EY5A 2TSSA 1VQEA 3EHVA 1VMCA 1F1HA 3IAYA 2N9PC 4UY8C 4RMFA 3H0GH 3KLWA 3IKJA 4P74A 2BKRB 3AEFB 4EUTA 3CRKC 2RHSB 5JHBA 2JEBI 1MJCA 1STYA 3A0JA 2JA6B 1UZXB 2WGSA 2VZAA 2RSUA 4DV4L 2Z9HA 3TEXA 1VQHA 1WM2A 2K39A 1ZE3D 2Z6BA
chains in the Genus database with same CATH topology
2BDNA 4DN4M 1ROEA 3RFZB 3J9CA 4KKUA 4YSZB 3EQLC 1G291 1U4MA 1SBBB 1JR0D 2RDHA 3OW7A 1QKZA 5CV4A 2BDOA 2E2HB 4FXGC 4QUFA 2NVQB 2DLBA 3GTGB 1ZP0B 3PZ8A 3VQIA 1IW7C 1YMHE 1RJTA 1E6EB 2H1EA 1CHQD 5C6AA 2M19A 5IIFA 2EY5A 3U52E 2K6AA 3QJYA 3J81E 2F0VA 1H9SA 1ENCA 3D31A 2V3PA 1SMYC 5BYQA 4C1NK 3I3CA 4KD3A 4ZQ3A 3U9SA 4HKZE 2B2UC 1ILPA 2C9OA 3N52A 1EYDA 1DOKA 1ZEQX 3M4OB 5HFYA 2LFIA 4LK1C 1WTXA 2D2CC 2F0HA 1WWTA 1SYDA 3MAQA 2B39A 1YN4A 4C80A 4PNYA 4OZAA 1EZ6A 3H09A 4X3UA 2F0SA 2KOLA 3K6OA 2K33A 3AE7B 1WVLA 4FP5D 2NVYB 3HOYB 4JWSC 4ILWA 2RMMA 3CIRB 2R92B 5IOCA 1TWAB 1SNMA 1CQFA 2E74C 1FGBD 4X3KA 4IKGA 3A8JE 2XRQD 2BCOA 4O42A 4N9PA 4CKBA 1HRJA 2W54A 1K50A 1UNSA 2EXZA 3AMZA 2D5DA 3NWSA 1HXYD 3FDTA 1BBXC 3P4SB 5FLXE 3VYUA 4WQMA 3I72A 4A3EB 3TBIB 2E2IB 2B76B 2BS3B 3AV8A 2ID0A 4YTNB 3AE3B 1WCMB 5G3LF 1CT1D 2A74C 5A2QL 1A70A 3PUVA 2ICEC 3PUYA 3VR5A 2EE1A 3E56A 3NZ3A 2IX1A 4ZRZA 5C3XA 2L52A 4US8A 3W3AA 4J8QA 2XIWA 5CV8A 2WXQA 1I50B 3Q8EA 4LMQD 1GUWA 2LUMA 2YYZA 3DWPA 1ESFA 2K3UA 4OO1I 4IUVA 1MHHE 2F0PA 2G9HD 3JAME 2BTEA 2KQ3A 2X38A 5KEEA 3D3RA 4HEA1 1F0ZA 3Q8BA 3P7JA 4F8MA 1KABA 3VRAB 2IW3A 1FFUA 4IUNA 1SJED 3PUZA 2W55A 2AUKA 2QJLA 1WGKA 3VR6A 2JXTA 4R8NA 3J7AV 4FVMA 1IYUA 1VCIA 5EPLA 2X69A 3V05A 4CGYB 1OXTA 3SK6A 4F87A 3BYTB 4A3GB 2OF1A 1TU2B 4JX1C 1KRHA 3GTLB 2BOSA 2E3TA 2MHVA 4MHEA 3W1SA 3GD7A 3KLRA 2J53A 1ENAA 1LT3D 4A3JB 2WXIA 3ONAB 2PIAA 5M5WB 3NHHA 3E9SA 4QIWB 2IPKD 4X3SA 1PZKD 2RBMA 1H9RA 2K22A 1WTPA 1MVKA 4HAEA 1IYVA 3S14B 5CV5A 4IUQA 1H9KA 2M2LA 2F0QA 3EJIA 3TZDA 4DAPA 3J81L 4G7OC 2K03A 3GTPB 1DYQA 2W3RA 1A2TA 1K52A 1UGJA 1L0YB 4KK7A 4R3DA 1FRDA 2QSDA 1ILQA 1QOAA 1QOHA 2WNMA 1MI0A 3QG1A 3DUZA 2PQEA 1Z47A 1QNUA 3VA7A 5D7GA 1MBYA 5KYLA 3K5NA 1GXDC 1B2TA 2W82A 3HG9A 1JC7A 1G91A 3C46A 2K5QA 2EVBA 2JA8B 2M9VA 3HOZB 5J1ZA 5C5MA 2J4XA 1XCTL 2AQ1B 4KN4C 4XDDA 3DWQA 4L8JA 3I9V1 3CHBD 2QIEB 3P4PB 2VZKB 3VYRA 1QNKA 4MN3A 3FC4A 4BY1B 4A90A 2K04A 3RLFA 5EE0A 1GUTA 5AUKA 1XLQA 1T5EA 1PZID 3WOFA 2I38A 2RDGA 2L5TA 2JSVX 2NTTA 1PFMA 4RA8A 5C44B 4DXFA 5CC4A 5FLXL 1G8ZD 1TR5A 3V96A 3LWUA 1F9PA 4F88A 4PQXA 1C4CA 1PZJD 1GB1A 3S16B 4OZCA 4OZBA 2KUMA 5LNK1 1JOKA 5I9PA 2QILA 4KJNA 1HZ5A 4DF7A 4H13C 1RKNA 3D4WA 2XSCA 3A7LA 3KF8A 4DA2A 3LB8C 4HSVA 2B8FA 1UEAB 1VF5C 4E6IA 3GTKB 3G6JB 1TKGA 5JVG3 3W2DA 2JYEA 5E4WC 2Z8LA 1BMLC 1V1PA 1QF6A 2E76C 1P7FA 3CU7A 3BS1A 4KY7A 3MP9A 3LWEA 3JAML 4OIJA 3AE4B 4GZYC 3Q8CA 1NAPA 1SDFA 3OPOA 2H88B 1J7BA 3HOXB 1U4LA 2E6XA 1J9OA 1L5PA 1JE4A 3OWFA 2FMMA 5I2XA 1RDPD 2F0NA 1VDVA 3QB3A 4OO1G 2LHEA 1BCPD 1HHVA 4KKJA 4C1NI 1CZGA 1CA6A 1ZDVA 1B1ZA 5ELCA 4DAYA 3KBGA 3OMCA 3OOCA 2A6ED 1HPCA 1E2VA 5IT9E 5BMHA 4DU9A 4KY6A 3VR2A 1K51A 2VUMB 1JMLA 4KN7C 5JPMC 1EQVA 1EEFD 2FINB 5C4XB 2BB6A 2SDFA 2WXMA 3EFXD 3P1HA 2K28A 2J42A 1TWCB 1N63A 1BNZA 3TP6A 2WKDA 5CORA 3TEYA 2BE5D 3MXPA 3ABVB 5CYUA 1OXXK 1NEKB 3A8IE 2OEDA 1CM9A 1L6UA 3PUWA 4IUUA 3C1FA 1E2ZA 2W3SA 1H9SB 2NB0A 4ID6A 4FYDA 1GHJA 2WDRB 2NZ1D 2IGHA 2KCCA 1LLRD 1DCZA 2WU2B 2ZT9C 2XWJB 5HI1A 1AN8A 4KD4A 4R8IA 3AB9A 2AQ2B 4BWGB 1XYIA 1PDXA 4OIKA 2WV6D 1E2WA 5BMIA 3BVZA 4K5XA 4RF1A 2GB1A 2KQ4X 3RUZA 4R9WA 3FAHA 4A8XC 1VDZA 1AZQA 1O7YA 1F2LA 2LJIA 2QCPX 1I6HB 1KNAA 1I3QB 1RTOA 2F03A 1IL8A 4KX6B 1L4DB 3SXHA 2HCCA 2KCNA 1F2MA 2K5DA 3MTSA 4UDUC 2B63B 1FMAD 2DN8A 1F77A 3TMEA 4ZK9B 1EY9A 3BVMA 4RH6A 1DZ1A 1EYAA 4TSSA 1M4VA 3CRLC 3Q8FA 2Q8TA 1RHPA 4C7YA 1RFKA 2X6LA 4OHJA 1TWFB 2LY7A 1NYQA 2B2TC 4JK1C 2LEKA 4KV6A 3HEJA 3VR8B 1PGXA 1AWDA 2MEKA 2GI9A 1I4PA 4C3HB 3I70A 4G4KA 1FD7D 4ZLTF 5M3MB 2PTLA 3F2UA 1SYBA 1Y1WB 4A3DB 1C76A 1H9JA 2RVLA 4RCNA 3AM9A 4KJOA 4KMUC 3L3OC 3SVMA 1S5BD 1L6VA 1X32A 2B2YC 3PV0A 5JEAH 4DK0A 5FOBB 2Y3AA 1KNEA 2HDEA 2NN6G 1JQYD 2B2WA 4L6TB 1ONLA 1S5ED 1LACA 3MFGA 3B9JA 4B08A 2INNE 4US9A 5BN5A 4I7ZC 3W9CB 1AYFA 3BWUD 3GS2A 2DYMA 3H0GB 4IOIE 2EOTA 2M56B 5GXGB 1SNOA 2A6EC 3DWGC 4NZLB 1GUSA 5DM63 4H2AA 1FCLA 3SDZA 2WXFA 1WTOA 1AW7A 2PLPA 1Q8IA 1TS2A 3Q6SA 2EPBA 5IGBA 1HUNA 1CI3M 4DXGA 5C0XI 4IFDH 4HR7B 1QOGA 3MC0B 4FF2A 5CV7A 3HOUB 5IGGA 1YNJD 4L63B 1D1IA 2MJ8A 2CU3A 1EIGA 3H3VC 1NENB 2V0GA 4MIUA 4S3SA 5BYSA 5EJWA 4EVOA 3H94A 3SFDB 1B53A 2K32A 5IT9L 1XLNA 2BYTA 3S9WA 4PMCA 3SHLA 4RFBA 2BW2A 2OT2A 2PYKA 1RODA 3HOWB 2L55A 2YEPB 1ZXIA 2OXPA 2GRIA 1ACCA 1NVID 4RNAA 1STGA 1GB4A 1HUMA 2QEJC 2L32A 1EIHA 5E3FA 2JA5B 1L4ZB 2OEOA 4XE0A 3P42A 3VYSA 4A9AA 1STAA 1KFYB 3WDNA 1Q90A 2IT1A 5EE9A 2L12A 3A55A 1VZ7A 1ZKOA 1ZUD2 1TIID 1AEXA 1RYJA 3I4LA 2L9HA 3H91A 5EKLA 1C9FA 2F0WA 2WKCA 4NMZA 1WTWA 3AEGB 1IGCA 2CVRA 5C2TB 2IDYA 1JQ4A 1BR9A 3FVQA 1VLBA 1SIJA 1S5FD 2K5PA 5EKKA 2I07B 4NP5A 2PNRC 1F2YA 4RKBA 5CR3A 1ICWA 1PMRA 1F2ZA 5FO8B 1Y8OB 5ELFA 1CJEA 2JWUA 1PFBA 3J80L 5HGTA 3DEPA 1WD0A 3A54A 2WXPA 2N88A 3BDLA 5HHDG 3MJ5A 1EWCA 2ZXOA 2ZXPA 3S1RB 2V4IB 4PMBA 3M4YA 1SNPA 5H8YE 1S4ZA 5C4JB 3X3NA 3ND9A 4NDXA 4QUCA 4H44C 1CK1A 1EWYC 5DAUA 2L11A 4AQ7A 2EY2A 1RM6C 3TUOA 5FR3A 4P6VF 3S1NB 2HDLA 1ZXTA 4RHSA 3TN2A 2VB2X 3NP8A 1SB3C 2YEPF 3GV6A 2NWGA 3NPPA 1QG7A 3GTMB 4N9TA 5BN3A 5IGFA 3Q23A 1B9NA 3MHBA 5C0XJ 2NN6H 5FO7B 1BUVT 1ET9A 3BVGA 4AYBB 1I6VC 3HKZB 4ULLA 2A68D 3S2HB 1HFGA 1ZOYB 1Y69U 3G7LA 4KY5A 3KK7A 1OQRA 1TJEA 3AE6B 4EQPA 2PW9A 2EJMA 2DBYA 1A6XA 3QOLA 4RAUC 1V97A 3NUCA 4IZ8A 2LFNA 2MPMA 2IWHA 4Q0FA 4B0MA 4XYOA 1SYCA 1G2SA 1NSNS 4A93B 4A6QA 2QF7A 2DY8A 2A69D 1XLPA 1KF6B 3SE0A 1F9RA 1MPEA 3OIPA 3M7NA 4TKOB 1JROA 3ERQA 2WAQB 3NVVA 4RGOS 3BIID 2HUGA 4Y7NB 1FR3A 2INPE 1XX8A 2JE6I 1PLFA 4A3FB 3D4DA 3HRZC 4FXDA 3HS0C 1TWGB 3U4EG 1A3VA 1UWXA 2WXLA 2WIIB 1G6ZA 3FMCA 1C4PA 3FEWX 3M7GA 3D8GA 3J7AF 2ON8A 3HOVB 3L4PA 1KH0A 2JEAI 5BYRA 3SK4A 3NQTA 3R2IA 3W5UB 2PKOA 3LYYA 1CZPA 2Z1CA 5D3IB 2FBWB 3AN1A 3A8KE 3QWNA 3K5MA 2EZVA 1B4OA 5EKIA 2IX0A 1DXMA 3HVDA 2WINB 4N58A 1C78A 1IUEA 3P4QB 4F7XA 1C4AA 3S15B 3B2GA 3VR4A 3S1MB 1LTTD 2KDMA 4WURA 1TVXA 2N55A 5C3WA 5LL6S 2BS2B 5IGEA 1E9MA 1WTVA 4JWUC 1RCVD 1YNTE 5EPKA 5CMDA 4YXDB 3KLSA 2MP1A 4BA2I 1WD1A 1EWHA 1P7EA 2L0CA 4EE2A 1STHA 4K2LA 5EBCA 3NUHB 3IL8A 1O80A 1Y8PB 1DGJA 1Y1VB 2KJXA 3U9OA 1TKWB 3EA6A 1D1KA 1YQ4B 3IXSA 3HVZA 1KDAA 2BBCA 3RD4A 4L2YA 2BB5A 1VZ8A 1PRTD 4MM3B 4HRSA 1SYGA 4PMWA 3NWTA 5M9OA 2XRSD 4BA1I 3NVWA 1D2BA 1NR4A 1TKYA 2ACZB 1CTMA 2Z4HA 1BF4A 3OWEB 1LO5D 1FRRA 3QIAA 2EYLA 3J7YW 5JEAJ 2EELA 2JA7B 1WRIA 1U4RA 1QILA 3L7ZC 5D65A 2PVGC 5AFWA 4XWWA 4DK1A 2L83A 3AEAB 1EY4A 2KACA 4B9WA 4M8AA 4ARCA 2KHSA 5C5LA 1DOMA 5KIXA 5M5YB 2KWDA 5I9OA 1C79A 4HMIA 3GV3A 1S5CD 3GTJB 3CWIA 4N6EB 2A69C 2JP1A 1RWSA 4IQZA 2J7ZA 4NAMA 1AP0A 4FF1A 1TY0A 3M85A 3V2TA 5K36G 2BA1A 2N9KA 5IODA 1VMPA 4KKIA 1QWYA 1V43A 1Y56A 1HQRD 5CBEE 4P16A 4IFDJ 1Y8NB 3NTIA 1J7AA 1B44D 2WXOA 4HKQA 1JOQA 5DM73 3T56B 1S5DD 1BCPB 2SNMA 5DNFA 1OXUA 2Y5CA 2VZKD 2Y0SB 1Q10A 1K53A 1KAAA 4H0LC 3KQ4A 2G9DA 3I57A 4CKEA 2BS4B 4KKTA 2EYFA 1N61A 2G1EA 3AECB 1J8IA 1FNVA 2K01A 4G7HC 2JX5A 4U673 4IALA 4K14A 3T3OA 1YNND 1M8AA 1VR9A 4GLSC 4MACA 1PYWD 3NBHA 5EBDA 2NYZD 4NKLA 3DEOA 4XIGS 3AEEB 2PO4A 2WQYB 5E1FA 4HN7A 3FPPA 1PTOD 2WP8J 1JRPA 1YJIA 3P75A 3H6MA 4B9XA 3UI3A 2Z4IA 4CJ1B 2WP9B 2F3VA 2MUYA 4C3HG 2F0EA 4IURA 1DOYA 5CV9A 2Y5PA 3MWYW 1LTGD 4OW0A 2EY1A 1Q12A 1PTOH 2XN9C 3P1MA 3Q69A 5E6JA 1AFPA 1F9SA 2J0TD 2AWNA 1GUGA 4YSXB 1OO9B 2JXMB 2M00A 1AZPA 2LMCA 3ZGZA 3BDCA 1KDBA 3WOEA 1LT5D 2PZUA 2WXJA 1FXIA 1L0VB 2WU5B 2BA0A 1IHZA 2FFKB 3HUIA 1I4XA 1TS5A 3EUB2 2KN4A 1SYEA 3VYTA 1VZ6A 2KEDA 1D5ZC 4XDXA 4ZHOA 2F4IA 4I65A 1QQRA 2IGDA 4QCLA 3CQZB 1BCPF 2JSOA 3EVQA 5HG2A 3KBXA 1DOXA 2SEBD 3T53B 4FF3A 5IGCA 1HTPA 1LV9A 1LT4D 1WSPA 3NQIA 2EYMA 2OHFA 4MT5A 3I4MB 1Q3LA 2RPVA 4YSYB 5J39A 2F0MA 4DNTB 2A6HD 1XTCD 5E4XA 1V1OA 5J22A 4WH4A 2VXWA 1R9TB 2F0OA 4EQOA 2O2LD 3PUXA 2RKSA 2WXKA 4EQNA 2WXRA 2A5HA 1TZOA 3GB1A 4FF4A 3FKIB 3TEZA 3V3XA 2CJNA 3TZUA 3I8ZA 1HCZA 1TY2A 4GDLB 2XVSA 1F9QA 4KKSA 1JWBD 4C3JB 1IW7D 3IT4B 1HA5A 2FE8A 2F0GA 5EE3A 1PUTA 2B2WC 3NTHA 1E7PB 5LHY1 1JB3A 1JW9D 2Q8IB 1SMYD 3NE5B 4ZUJA 1B3AA 2K05A 2V3NA 3TP7A 1YNNC 5JXVA 3URYA 2EYHA 4LAAA 3MHZA 3HZXA 3T13A 3NBIA 4ZKBB 1QLBB 3AU7A 3M3YB 2K7VA 1YN5A 2IGGA 2RSNA 1BCPC 2AWOA 5K5PA 1Q1BA 1X3PA 3OSOA 2J52A 4C3IB 1PTOC 4K8JA 4J3OD 1DD2A 1YN3A 1R4QB 3EGRA 3P20A 3A7AB 5F2DA 4LTUA 4RWSC 4CKCA 2PW7A 1EFID 2XNAC 1R7SA 4KHVA 5HURA 3RZOB 2MJ3A 4KGSA 2MJDA 3HP3A 2BE5C 4OO1H 2K0PA 4HROA 2WACA 4HTHA 4IDIA 2Q8RE 3SR6A 1KDCA 4M1UB 4B0EA 2HCIA 1C48A 4KTAA 1BO0A 1W6KA 3C8YA 1PGBA 4JBWA 1SE3A 4OGQC 2L1AA 3HRDD 4FO2A 2F0UA 1OQQA 2JU6X 4WWMA 1LTID 2NVXB 1WXQA 1SNQA 4WORA 4WIPA 2YU9B 1N62A 1D6EC 2BT6A 4WFN3 3GP7A 3FPUB 2D5GA 4OVZA 3S1QB 2PPBC 3AH7A 4PV1C 1LT6D 2EJGC 2FJ2A 2PMZB 4TQ1A 1GPXA 3AE8B 4N59A 2R7ZB 1LTRD 4IN3A 2C5CA 2DWQA 2WDQB 2A6HC 1FIQA 4Z9CB 3LX0A 3Q0AA 3H8HA 3NRZA 3SR1A 2EYPA 4UAIA 3MA2B 1QOBA 1A15A 1ML0D 1XXGA 1JORA 2F0DA 5T1IA 1SE2A 1IGDA 2PMVA 5JJZA 4J6HA 2Q5WD 1OFFA 3P4RB 1STNA 1STEA 5JPNC 1DOIA 2CHBD 2KECA 1W6JA 2HQEA 2PCFB 2R93B 4KHZA 2RDFA 2M0AA 4QB4A 1SNDA 1JICA 3IT6B 5G3LD 1PXUA 2WXHA 4XTCS 3GTOB 1PDQA 1PFDA 3KWVA 2F0IA 4BY7B 4XT3B 3DWAA 4G57A 4K2KA 2KA7A 1EM7A 1DM0B 1JWMD 3ITPA 2H89B 1FEHA 4L1BA 4YWGG 5I2YA 4RGNA 4BBSB 2DY7A 1ZPSA 1K83B 1KTKA 5KRUA 1GJXA 5ELEA 2B2UA 1EL0A 2FMCA 1WTRA 1XCQL 1D5XC 2N7JA 3E5SA 1SAPA 5IGDA 2SAKA 1H9MA 1WTQA 3D6WA 1NI3A 2R3ZA 1YNJC 1I4RA 3CKIB 4FNFA 1V1PB 2X6GA 2RA4A 1QT9A 3RPFC 5JOBA 2VNUD 3NTKA 2AQ3B 3NK9A 1OXSC 2EY6A 4ZRQA 1O7ZA 2WXNA 4K5VA 3AB5A 3BZDB 3L9AX 3TDQA 4QF4A 4ABNA 4DNRB 4DAVA 3N9YC 1C8CA 4TQUS 4NW2A 3B2FA 1WYGA 5CBAE 3MFYA 2L4NA 1K8OA 3U2SC 2SOBA 3MXNA 2PZWA 2V4DA 3VR3A 1KLGD 3NS1A 3E6ZX 1HEZE 1NYRA 3FILA 3ZYYX 1PFNA 4IFDI 4XDCA 1B9RA 4HEDA 3VA5A 1IBXA 2RSOA 2WDVB 1QE6A 3OIQA 5G5HA 1SEBD 1DJRD 1FD6A 3U7ZA 2I46A 3DMUA 1NCVA 4OL7A 1LTBD 1ENFA 5BN4A 1HA6A 1SF0A 3BK2A 1JWSD 4A3BB 4BS9A 5C0XG 2NTSA 5C3EB 2F0FA 4H7BA 4LLGM 4NAWB 4ZHPA 4KGTA 3R3OA 1UUPA 1O7LA 3S17B 4LJZC 2WS3B 1J7CA 2E2DC 2VB3X 1EOTA 2K5WA 1BQQT 1E0ZA 2LMCB 1QJOA 2LGIA 5A35A 3AE9B 3Q8AA 1EQTA 1YJJA 2KMMA 1IKLA 3IAM1 2R6GA 3C3LA 1XEEA 3BG3A 2EYOA 4K5WA 1HTLD 2JYTA 1LTSD 3PO2B 2CJOA 3MZ5A 4TRDA 3DWMA 4K6DA 5FO9B 1ET6A 1PRTB 3AE5B 3EROA 3VR9B 2TMPA 3LXFA 1G2TA 1EU3A 4XXEA 1BXTA 2F1MA 2AX5A 2H4OA 2D62A 2O4XA 1QCBD 1I4QA 5ELBA 2HTME 4HMJA 1QB5D 3DHQA 1TQOA 3R8BA 5C4HA 1ZDXA 4ZKCB 1VRAB 3Q24A 3PMFA 1CHPD 3HGBA 3BK1A 3DXJC 3RZDB 5D14A 4XT1B 1A2UA 1GUOA 4M0WA 2EKIA 4ZAIA 3K5LA 3SFEB 1B9MA 2IJ0A 3PO0A 3QO2A 4D2KA 3R2TA 1I4GA 1SNCA 2NBFA 1E10A 3NVZA 1FYCA 5JAVA 5ISRA 1SE4A 4CJ2C 2A68C 2MGSA 4RCOA 2B8GA 3RMHA 4ZYSA 3K5OA 2ONQA 3K58A 1V8QA 1JALA 2ZW0A 1SYFA 4RGMA 4V190 4J1MA 4CHTB 1DOLA 2LHDA 4FXKC 1FXAA 5NUCA 1FFVA 4PT5A 4JE3B 1EY6A 5FK9C 2EDGA 1Z6HA 1EY8A 3TP8A 2B2VC 3FRPB 1D4BA 1X3QA 5MPOA 2N9LA 4GDKB 1OXVA 1JCKB 3ZJUA 1I4HA 2L1BA 3TSSA 4IUTA 3AEBB 4Q5VA 5H92C 2DNCA 2NN6I 5M3FB 2KVMA 1EY0A 4C7ZA 3WCQA 3K57A 4RKLA 4K8IA 3ETRA 3K0YA 2WLBA 4YIJA 1E0BA 3I73A 3TP5A 1UWMA 1V8CA 3BDOA 1C77A 2AUJD 2B2VA 4BBRB 2DYOA 1PRTF 2F0KA 2FHTA 5EGTA 3D4RA 2D9UA 3W5VB 1TYGB 3DM1A 3MXGA 1PTOB 3NVYA 1MSHA 1FNUA 4XYQA 1ZYRD 5JEAG 5BMGA 1XF5L 4K6LA 1TWHB 1EEID 4XQNA 2LKVA 1MHXA 5T8IA 1PGAA 2LS01 4X3TA 4XQJA 1II3A 4CBVA 5G5GA 2IX3A 4ZOHC 1XWEA 2QMTA 5ELDA 4MH8A 3LNNA 4L23A 3KLSX 2K1BA 1SJHD 3MXUA 3O13A 2WB1B 2ENBA 4G7ZC 4LK0M 3K7AB 2FUG1 4U68A 4C2MB 5C0XH 4USAA 1RF2D 1GHKA 3C2PA 2NMQA 2SNSA 4C3JG 4AS1A 5FKAC 3ZJTA 1SFOB 4IFDG 1FCCC 1N5WA 3AE1B 1CA5A 2F0TA 5KNDA 3E0JA 1A3TA 1FO4A 4DFAA 4WAFA 3OHXC 4YTMB 4TQ0A 3OMGA 3AMUA 4A3MB 5I6WA 4IUPA 2NVTB 1C4QA 4O1NA 5LL6X 4A3KB 4REZA 1VJKA 1PRTC 2F0LA 1BUIC 4KI0A 4XQQA 2R61A 1NR2A 1SSNA 4DQOC 3T4AC 5KYIA 3K59A 5DEHA 5CV6A 4C3IG 2E2JB 1CZWA 2RQXA 2JYOA 1B50A 3I91A 3IFDA 5KNBA 4V0BA 2CW0D 4Q2JA 4NJCA 1BOSA 4CJ0B 1Q1EA 4ZRPA 2F0JA 2ZXRA 4HCSA 5KNCA 4XWTA 2F3WA 5JVH3 4ODGA 1RD9D 1Z7TA 1MD2D 1PTOF 4FXCA 1K8MA 1EU4A 2K9XA 1LTAD 1UAPA 1KLUD 3BYYB 3QOJA 3N6RA 4ARIA 1FNWA 2E75C 4RHRA 4C56C 3ZQ4A 2WXGA 1O78A 1N5XA 1U4PA 3ND8A 1T6BX 4YT0B 4JPSA 5EQ0A 3IAS1 1R4PB 2NUCA 3GQBA 3MEHA 3UI2A 3Q22A 1TT2A 3J80E 1D5MC 4DGZA 1GUNA 1NUCA 1YQ3B 4TMAB 1XLOA 1HFNA 3R93A 1MSGA 5C4ZA 1EY7A 3PIP3 2ZW1A 3VRBB 2JQRB 2QKIC 5M5XB 5D3DA 1ZYRC 1LABA 3I90A 5K36H 1ZXHA 1MI2A 2IL8A 1TS3A 4ME5A 3TEWA 1VF7A 3D6CA 1JWAD 2I2YA 1EZ8A 1TS4A 4CQNA 1F2RC 1I7HA 5COYA 4ITKA 2CQAA 1SXTA 4RF0A 3GO5A 5CGKA 1GOZA 4WRDA 1N60A 4WJWA 1BDOA 3SK8A 3MVVA 2O5IC 3AEDB 2DNEA 5C3JB 1IKMA 4HJGE 5A2QE 2B2TA 1GAQB 3FILB 5I6YA 5KGUA 1XO3A 1DONA 1IBXB 2ICIA 4HSPA 4A55A 1ESRA 3IFTA 3NSWA 3KUPA 2JZPA 4ZUIA 5EPJA 4HCEA 2GA4B 3SK5A 2PW5A 3PIO3 4A3IB 2MJEA 5TSSA 3GTQB 1MGSA 1JOOA 2KAJA 2B2YA 2QDBA 1HQMC 1SSOA