1FNVA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
total genus 43
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnvA02
1LTBD 1SE3A 1JWMD 1I4GA 1RCVD 2QILA 4TSSA 5I4DA 4RFBA 1BXTA 2XN9C 1UUPA 1S5DD 1GOZA 3BVZA 1S5CD 1TS2A 1PTOD 1QILA 1ET6A 1SE2A 1M4VA 5ELBA 5ELCA 1LTSD 1SJHD 1HQRD 1LLRD 4DXFA 3OWEB 1CQVA 4O1NA 1I4QA 1JWSD 1SEBD 2ICIA 1CHQD 3R2TA 2NTTA 1FD7D 5D3DA 1EWCA 5ELDA 1LTTD 3R8BA 1SE4A 1FNUA 3BYTB 1D5MC 2XRSD 1EEID 1PRTC 1TS4A 2XRQD 1TY0A 1BCPF 1S5BD 1EU4A 3CHBD 1RD9D 1AW7A 1KLGD 3KLSX 1CHPD 2J4XA 3MC0B 4K6LA 2WV6D 4BWGB 4RHSA 1DJRD 1JCKB 1XTCD 5ELFA 1PZKD 1EEFD 1FNVA 1I4HA 1T5XD 1L0YB 2O2LD 3DWAA 1RDPD 1PRTF 1S5FD 1PZJD 1TY2A 1YN5A 2G9HD 2NTSA 1I4XA 1BCPC 1LTRD 1D5ZC 5ELEA 5FKAC 1D6EC 1PRTB 4L63B 1I4RA 3V05A 1PTOF 2SEBD 1ESFA 3W2DA 1PTOH 2AQ1B 1XXGA 1LTAD 1G8ZD 3DWPA 1ENFA 4UDUC 2R61A 4OHJA 2XNAC 1CK1A 1JQYD 1LT4D 1S5ED 4ZYSA 1EFID 1CT1D 1PTOC 1KLUD 1BCPB 4RHRA 1TS3A 1HXYD 4RGTA 1LT3D 1SBBB 4RGNA 5TSSA 1HTLD 1JR0D 2AQ3B 5D3IB 1SXTA 3R2IA 1LTID 1PRTD 2RDGA 3BVGA 4RGOS 3DWQA 1SJED 3BYYB 1LT6D 4RGMA 4DXGA 1KTKA 1AN8A 2IJ0A 3MFGA 4Z9CB 1ET9A 1FGBD 2IPKD 5FK9C 2QEJC 1PTOB 1V1OA 1V1PA 1EU3A 1PYWD 2CHBD 3O13A 3TSSA 1B44D 4RH6A 3EFXD 1DYQA 1LT5D 2RDHA 1PZID 1BCPD 1STEA 1B1ZA 1MD2D 1F77A 1LO5D 4RCOA 3BZDB 1UNSA 1L0XB 2Z8LA 3GP7A 4NZLB 1HA5A 1LTGD 1YN3A 1I4PA 1FNWA 1V1PB 1JWUD 1RF2D 2TSSA 3SEBA 3URYA 1TS5A 3BVMA 4C56C 4L6TB 3EA6A 2AQ2B 1YN4A 1D5XC
chains in the Genus database with same CATH superfamily
5I4DA 2JP1A 4LDTB 1PVOA 4RFBA 2OTJA 1C77A 2WHIA 2B2YC 2L3ZA 4BKSA 1V8CA 3OW7A 3HOYG 1JRPA 1MKHA 4V0BA 3FDTA 1MJCA 3E0JA 4KD4A 3RPFC 4POFA 5CX3A 1L0WA 5E4XA 3RD4A 3L4PA 2LEKA 1JWAD 3RMKC 4UP9A 4KN4C 4MH0E 2ZVNA 1R4PB 1SEBD 1SROA 4DR1Q 2EIFA 3PGEA 1DGSA 1OXUA 1X3PA 3K6OA 5ELDA 1EWCA 1L2FA 4IUTA 4BXXH 2M1MA 1M90C 1WMHA 3DBLI 2FCSA 1SE4A 3DBRB 4ZRQA 3C19A 1E8ZA 5DPWA 3IHPC 1TGZB 2UU7A 2XRQD 2Z4HA 1EZ8A 3DBSA 5J2RA 1MJEA 1WGGA 3QK0A 1T3QA 1J7BA 3RN2A 4L2YA 2HJ1A 1N9WA 4JIOU 5JHBA 3RNUA 1XTCD 2K04A 3RNCC 1WTRA 1HNZL 2PQEA 1WMHB 1N8RC 2FNJB 4PS3A 4FXDA 1Q0WB 4WWMA 1KQSA 1R4MB 3I4NH 4IUNA 2NMQA 2WKDA 2JYOA 3PUWA 5JVH3 3AEFB 2CCZA 3X23A 2X8XX 3Q22A 2D0OA 2ES2A 2WXMA 3V62A 4LF7Q 5DAUA 3S14H 2HE7A 1H95A 3GTMB 1E8WA 1VQ5A 4HDQA 3T1HL 4N58A 3TN2A 4PYZA 1XCQL 1G8ZD 3MXPA 1EIFA 2K0PA 3TP7A 3A9KB 3H7PA 2QDLA 2KVZA 3QR8A 4REZA 2R6GA 3PHXB 2L9HA 3RZFA 3RZDH 2OCEA 4BY7B 3VRBB 3BZCA 1L5PA 1V1QA 3CPWA 4DUYL 2J0JA 3Q3NC 4QJFA 4K5XA 4RGNA 2EZVA 1L0VB 5TSSA 2YTXA 4II3B 1FVIA 4DV4L 4A3MB 4H0LC 3VQIA 4DUZQ 2F0IA 1VQ4A 1K51A 4I7AA 2KLCA 1DOMA 1N60A 1R7SA 3DHGC 2J0KA 2MP1A 4EVOA 1YHAA 1X3QA 4GKJL 1YJIA 4M1UB 2CVRA 2EJGC 3I4MH 5DLQE 3HM3A 3AE3B 4IUPA 2VZAA 1WX7A 2BS3B 1AE3A 1V1PA 3M4OH 4XGAB 3WALA 1C9FA 1WX8A 2DNEA 5JEAJ 4X65Q 4DV3L 3HOWH 4B3RL 1W6JA 1SR3A 4DK5A 2UXCL 3S1QB 4BXXG 2ZW0A 1TWCH 2INCC 3A1QA 3R3MA 1LTGD 4IQZA 4KLKA 1V1PB 2IGDA 2TSSA 3I63C 1Y1WB 4FLHA 4OONA 1GC7A 2BWES 2LVQA 2KHJA 3GTKB 2MA9B 4W9GA 4JOIC 5HGTA 2L0FA 2F0NA 2NBVB 4QB4A 2AQ2B 2UXBL 4L8JA 2EY2A 2P5ZX 3VTWA 2BYVE 1V5OA 1WJJA 1ZOYB 3RFZB 2KQ3A 2WXIA 2JRHA 4LNNA 3EIVA 4X66L 1Q82C 1S5CD 1WD0A 4NB3A 3RUIB 3JAMi 2RR9A 4OIJA 2XBBC 4KI0A 3CCJA 3D4WA 1G2TA 2UU9L 3MP9A 4B9KA 3GTPB 3ZRFA 3UI3A 1HR0Q 3P4RB 2F0PA 3NELA 5BYSA 3T1YQ 1EY9A 4AS1A 3NWSA 3R2TA 5FLXc 2Q8IB 2YTYA 3OPOA 4HSVA 2AYOB 3FAHA 1K8GA 3SGIA 1FNUA 1QNUA 1D5MC 4R8NA 4LUOA 4RM8A 2UUAL 2IHFA 1TYGB 2L12A 4ID6A 4YL8A 3UDGA 1KDCA 3HFZB 1IBMQ 4W9HA 3VTVA 1HNXL 1ZDVA 4JGHB 4TQUS 2BS2B 1J6QA 4Y52H 3HK0A 1I4HA 5IP9H 3AYHB 3VR3A 3S17H 3APDA 1RDPD 4GNXA 1NI2A 2IO1B 2ZTDA 3VR2A 2H5XA 5JJZA 3CXCA 1LTRD 4Y7NB 1VRAB 1I50B 3I4OA 3CCRA 2D3CA 4GB9A 1U4RA 4ANUA 2LGDA 1DOYA 5EE9A 4YSXB 3Q24A 1E2WA 3TZDA 3VYUA 4RMAA 3VAWA 4IKGA 4YY3L 3QG1A 1K8OA 4GNXB 1N34Q 4JI0Q 3I4MG 1BNZA 2WAQG 1XEEA 1G291 2A68C 2D2CC 4UDUC 1BF4A 1IYJB 3SXHA 1R4NB 3MVVA 2JWZA 1EFID 4LFCL 3HOWG 1SN8A 4A3BH 4WJ4A 1UBQA 1OQQA 2SAKA 3AU4A 3UDXA 4DDID 4EQOA 1X6OA 3ZRCA 3K9PB 1LQBA 4KKSA 4RGTA 1G51A 3GTQH 4AWJA 5C4XB 1J9OA 1GUTA 2BYFA 1ROEA 5D3IB 2KWCA 4YCVA 1N5WA 1LTID 3IFWB 5LMUL 1YHQA 2N7EA 2L00B 3AECB 1VCIA 4RGMA 2JA5B 5JJIA 2O6VA 4C3HH 2NYZD 1ZEQX 1RRBA 1PQSA 3T16A 1TWAH 2HJ8A 5HURA 4JV5L 2VH2A 3M62B 3RT3B 3BIID 3K9OB 3JAMc 1MBYA 3DCGA 2IX0A 5C44B 3KQ4A 3NY5A 3ULJA 2OXPA 2LI5A 1AE2A 4OX9L 2O6VB 3Q3FA 2CWAA 2N8NA 2IO2B 1M1KC 2KCNA 3JAME 2YLMA 4ZDVA 2Z8LA 2KK8A 4R3DA 2N9KA 1YD8U 2E2HH 4K3CA 1VD2A 3FRPB 3OOCA 1HFGA 2BS4B 2MRPA 1IZ6A 1WCMH 2NVQB 2RCFA 3K81C 4MH8A 2OJWA 2BCOA 2C9WB 2B2UA 3S2HH 2FUHB 2GVAA 4II2B 1RCVD 2QILA 3P42A 3NRZA 4KN7C 1QUQA 1S5DD 1YNNC 2NR2A 1K8AC 3OSOA 1ESRA 4YIJA 5CV8A 1NYRA 3FKIB 1E7VA 2MEKA 3TEYA 1SE2A 3IG3A 4XZ4A 5IP9G 4LWCA 5JVG3 1LTSD 1OXTA 3WAPA 4HJ8A 2NWGA 3CF6E 4JI3Q 2QGQA 3MTNB 2WU2B 3PGZA 3SDZA 2N9XA 3W1GA 1NAPA 3T56B 1OFFA 2LGXA 1XLPA 4DR5Q 1WE6A 2V1YA 4DV0Q 1SNMA 4A3LH 2NUCA 3N1YC 1Q12A 3I4LA 3Q0AA 1FD6A 1YJNA 4W9LA 2D3GA 1KAAA 2D3BA 3TEHB 1SE8A 1FXAA 1QZHA 1RD9D 3DHIC 1L4DB 4FBJB 4JBKA 3NOBA 4A3BG 1A5RA 1HZCA 1BQQT 1WYWB 3LWEA 1EEFD 4KY6A 4GDKB 4JG2A 5C3JB 1B7YB 4A3FH 1EY8A 1C4PA 1EQTA 4JI4Q 4IOIE 1AFPA 3VVWB 1HZ9A 4YTNB 2KJHB 4M01A 4IFDJ 3BU2A 4V190 2JEAI 3DDCB 3PIPA 1XLNA 1Q1BA 2C5CA 1JWBD 2DN8A 1CKMA 1PH9A 3RMHA 4LJOB 5M5XB 4C3HG 4DR2L 2DUDA 2Z6BA 4AIMA 4A3CH 2VNUD 3PUVA 4IPHA 5BR8Q 1GJZA 3FKYA 5CV4A 1HJPA 1WSPA 2LGIA 3M95A 3RCZA 1HNZQ 2L1AA 1NSNS 2MJEA 1B9NA 4GOPA 4JI8Q 3QJZA 3Q6SA 4K8JA 2E8GA 4PS7A 2MH7A 3Q8BA 2R2QA 4P71A 3IAS1 1KLUD 3DVNV 1BCPB 4DWFA 3MHZA 2MFIA 2PE6B 4A3PA 1ASYA 1IHZA 1STBA 1F9RA 3SFEB 4LMQD 3A8IE 4IZ8A 4F1SA 1FYCA 1WCMG 3M4YA 2LXCA 4GOPB 1E7PB 2VZKB 1BUVT 2K33A 2F3IA 3DWQA 3CC2A 1E8XA 2BGFA 3NZSA 2HTHA 2LY7A 1HUMA 1HZ5A 4ANXA 1FJGL 1IXRA 1H9MA 2N7JA 1SMYC 4JI2Q 2JA6H 4P73A 5FK9C 4N9F4 4DV6L 2L1BA 1HA6A 2BT6A 3SU8X 1PTOB 4HVBA 3CP0A 4DUYQ 3VDYA 5J22A 2DY8A 1F1HA 3ENEA 4E6IA 2B2TA 3EFXD 1DYQA 2ONQA 4ICVA 2IY0B 1ZW7A 3M3YH 2JA7H 4DV4Q 2DAFA 1A3VA 2JVCA 3BZDB 2EYPA 1WGKA 1AARA 4M00A 4DHJD 1K83B 2NVUI 4A3LG 1RODA 1K53A 1TR5A 1I4PA 2X6GA 4GKJQ 2M00A 5C5MA 1N36L 4HEA1 2EY5A 1PUTA 4FXGC 1WM2A 3OTOL 1BKBA 4XQNA 2VRRB 5KNCA 1VF7A 1TKWB 4XYOA 3HIZA 3UIPB 4DV3Q 1QF6A 4B3RQ 4AH6A 5M3FB 4A3FG 4IUMB 3PIOA 4KSKC 1HQRD 4CGYB 2UXCQ 5BN5A 2BVCA 2B2YA 2K4KA 1WTPA 1SNOA 1NNXA 1YX5B 3F2DA 4JBMA 1F0ZA 3STBC 1TWFH 2B2VC 2A69D 3H0GH 1XMQL 5KYLA 1KL9A 4A3EH 3HRDD 3WAOA 1YMHE 4ZQ3A 4F7XA 3QX1A 3ER0A 1JROA 5H8YE 2UXBQ 2SDFA 1Q90A 4A3CG 2LMCA 4J6IA 5CHWA 2YU9B 3RNAC 2EYHA 2I5HA 5EKLA 4DR1L 1HQMC 1K0RA 1PRTC 3D4DA 2CHZA 1Q1EA 1GUAB 4PZ7A 1BCPF 4FO2A 2PJHA 1VCBA 4R4IA 1JCKB 4DAPA 2RHQB 2GBRA 2NN6H 4J6HA 1PH4A 2I1KA 2KT7A 4LJZC 2RF4A 4G7OC 3FP9A 3M9BA 1L0YB 2IX1A 4BA2I 1BO0A 5IGBA 3GTLB 1II3A 1NI3A 4YWGG 2YTVA 1VMPA 3PV1A 3A8KE 5EE0A 1ZXHA 3A5UA 4ZLTF 2W55A 3VR8B 1PH3A 4M0WB 1J19A 2A4ZA 3OMGA 1PTOF 2DX5B 3ZNGC 4RF1A 1F2LA 3NQIA 3I73A 4KY5A 4B3ML 1HNXQ 1KNEA 2QKIC 3EN2A 2JA6G 1KLVA 3KF8A 3PO0A 4P1BC 1SYGA 2KCCA 1OQRA 3QB3A 3CRKC 1EY0A 5I9OA 3M7NA 4NMZA 3G4SA 1YI2A 5DCNA 2HHHL 2JA7G 1D8LA 3SHLA 5FLMH 1NYQA 4ZYNA 3U7ZA 4OWWB 1UWXA 1VQMA 1IBXA 1LT3D 2JZPA 3I70A 4ASWC 4P74A 3ETRA 4XWWA 1QWYA 2UUBL 4FYDA 4CJ1B 4JVZA 4YY3Q 1FMAD 5TR5A 4C3IH 4K81A 1RIPA 1SJED 3X3NA 1NR2A 1O7IA 2PMVA 2CHWA 3AE1B 1B4OA 4DKAC 5A2QE 5FJ8H 3C0RB 1KC8C 2D9UA 2IJ0A 5FOBB 1D2BA 2EYFA 3RZOB 5IWAL 4KDIC 2NN6I 5EGTA 1C4AA 4LFCQ 1X65A 1J8CA 3J7A5 1GUWA 2BA1A 2XIWA 4E71A 3CMAA 1DONA 3RNGC 2REXA 3E6ZX 3PMFA 1B44D 3SVMA 1L7YA 3M3JA 2XGTA 1VQLA 1STEA 3NUCA 1F2RI 2JZ3B 4IOAA 1N33L 2K8CA 3T9LA 3AMZA 3H0GG 1I5FA 2KHWB 4A3EG 1UNSA 3MAQA 5I9PA 5LMUQ 2LGYA 5G5HA 3D8GA 1K50A 3I57A 1SYCA 1E0ZA 3OG5A 5CR3A 5H92C 2PEAA 3Q8DA 5AZGA 2E2IH 2MO0A 4B6WA 2BH8A 1XCTL 3BVMA 1T0SC 2N9LA 4JV5Q 1QVGA 3D6CA 3VR5A 4A3GB 1XLOA 5G2NA 1C7YA 2K5DA 2KWVB 3U4VA 4TRDA 2NVYB 1QOBA 2DYMA 2MW5A 4A3KH 1GOZA 4CKEA 4LK1C 2NN6G 4JOIA 4OX9Q 3H6MA 5FLXL 3LYYA 1CM9A 5ELBA 3CPFA 5EKKA 3QIJA 3ND8A 4HPMB 2NZOA 5JHAA 1GC6A 1RKNA 3D3RA 3KYCD 2RKSA 4C7YA 4ALPA 4WORA 3AE9B 5JEAH 3HOZH 2SNSA 1ILQA 4EQPA 4K7WA 5JZEB 3OMCA 1J5EQ 1OXSC 5I6WA 1JB7A 1ACCA 2DENB 2XRSD 4EQNA 5CV6A 3VR4A 2QEXA 4LUVA 2F52A 2K3UA 4CYEA 1YJ1A 4DV2Q 3U2SC 2K25A 2JE6I 3CHBD 3PRZA 4LF6Q 5JH5C 2EOTA 1ENAA 2J4XA 1WJ6A 1YZ6A 2WV6D 3B0AA 3PT2B 1C4CA 1CMXB 4DV5Q 2BH2A 5FLMG 1FNVA 3M85A 3PUYA 5EJWA 4N6EB 1KAWA 1WVLA 2KBNA 1IBML 4BBRH 3GZNI 1KDAA 1PZJD 5HGQA 3ALBA 4JK1C 3V61A 5GQOA 1I4XA 2FIDA 1WXAA 2RSNA 2NBUA 4A55A 3AU7A 3E0EA 4C3IG 2DLBA 2GBKA 3C1FA 2WDQB 2ZVOA 4FA6A 3I55A 3JSVA 4NJ7A 3MWYW 4UP8A 1M94A 4PZ8A 5EE3A 5BN4A 1JW9D 4J1MA 4K0KL 3U4ZA 1IL8A 4P2CB 5G3LD 5FJ8G 2KLGA 5AUKA 4FJYA 4DV7L 1D3ZA 2V4IB 1UD7A 4BBNC 1ENFA 1GUSA 1MG8A 2BE5C 3J80i 2R7ZH 1JOKA 3AH7A 3JSVB 1IBLQ 2AWTA 3KYDD 3PO3B 2KYWA 3CQZH 2HT1A 1IYFA 1GM5A 3IT4B 3L13A 2FXQA 2QF7A 1KDBA 1SBBB 3KBXA 3AE7B 2ZXOA 3SFDB 2B8GA 3HOYB 5EQ0A 1WI0A 3GV3A 4DR2Q 5KEEA 3HKSA 4M8NA 3R2IA 1S72A 3JAML 4HTHA 2IY1B 1EZ6A 2X69A 2HD5B 2KC1A 3NSWA 2F0EA 1UEAB 3AXCA 1EOTA 4R4TA 5BYRA 5H1SE 4OZAA 1NCVA 5ELOA 5IGGA 4A3KG 4HXDA 4Z9CB 3H91A 4MGZE 1FGBD 1L1OB 3FPUB 1MHHE 4DBGA 4CDFC 1VQHA 1XWEA 4US9A 2KO3A 3P63A 3TEXA 2KQSA 4I65A 2CHXA 2WAQE 2K7VA 1S1QB 3PVLA 1JQ4A 1HZAA 3AEDB 2Z0SA 4JI5Q 5JXVA 4KHPQ 5JEAG 1EQRA 3NWTA 3HOZG 2PI2E 3BK2A 4JI7L 2Z1CA 1X1MA 5J18A 4J8QA 3BG3A 3K57A 3L10B 4CKCA 5LXIB 1HTOA 2KECA 4IUUA 1LM8B 1BBUA 5COYA 2WXKA 1WZ0A 1O78A 5C0XH 3AN1A 1D5XC 4C1NI 4P6VF 4DV6Q 2NVTB 5K5PA 1E7UA 4K7SA 2Q8TA 1YNJD 2XN9C 1Z9FA 3B2GA 1VDZA 1OGWA 4HAEA 2WWZA 2ASBA 3L3OC 3HOUH 2G5DA 1DOLA 1MGSA 5E3FA 2ZCCA 1E3PA 2INNE 3T8MA 1QG7A 2LD9A 4BBRG 4WJPA 2BQQA 3H3VC 2QW7A 3DBLB 3OWEB 4DXAB 3EFUA 1STNA 3CCQA 2O2VB 5G3LF 2JZZA 4JI3L 5DPSA 4LF4Q 2GRIA 4A3DH 4YCUA 2E2JB 2WXRA 5CORA 3T51B 3OTOQ 1EYAA 2BKFA 1WJ4A 4DV0L 2DAJA 3EECA 4LDTD 3H94A 3M4PA 1SNPA 2R7ZG 3VYTA 1J7AA 1G91A 2QIEB 1YOVB 3WOFA 1Z2MA 2HQLA 3EJIA 3JVZX 1PZKD 2N1VA 3J80E 2PO4A 2M56B 3AE5B 1ZYRC 2PVGC 1XMQQ 1EL0A 3TMPB 1YN5A 2K5PA 4UP7A 1IBKQ 2G9HD 4MJSA 4YHHQ 3VXWA 2I38A 3N52A 1KM7A 3UGBB 4GZYC 4BKSD 5IKCM 5J3BA 3RUZA 3IXSA 3OLMD 2AWNA 1T9HA 4JI4L 5C0XI 3PUZA 4LUZA 4MHEA 1VZ7A 2ASQA 4C3JH 3IBEA 4KTAA 3W2DA 1BOSA 3L2PA 2AKWB 1JMLA 2MLBA 1V97A 1N32Q 4MJSB 4JI1L 2KENA 2VQFL 1WGHA 2FIFA 2R61A 1UE6A 2ZTEA 1F2RC 2XNAC 5BR8L 2GMIC 1CQFA 2N7DA 3H1UA 5DM63 1YJ9A 3I3TB 1OTRB 2MBEA 5EPJA 4Q2JA 1IW7C 3ZUNA 5E6PA 1X3FA 4JI8L 1CSQA 2K5VA 5CHVC 3KK7A 1FO4A 3A9KA 2Q2IA 2PYKA 3MXGA 2ZNVC 2DNCA 1XX8A 4NP5A 2V3PA 4O2DA 3A5ZB 2EELA 3DVNU 3TIXA 3D0FA 4B3MQ 1E2ZA 3CSFA 3BYYB 4WJOA 4X57B 1LT6D 5C0XG 1WX9A 4F87A 3K7AH 4YTPB 3PREA 1N61A 4HIOA 2PMZE 4TUUA 4K14A 3S14B 4NJ6A 4AP4C 3HOUG 3V2TA 3KUDB 4RNAA 1QOFA 2HHHQ 2R7FA 1U4LA 1UE5A 2N1WA 4KHZA 4GLVB 3ND9A 4JI2L 1UGJA 4BBSG 5D6JB 1B9RA 1V49A 4G7ZC 5IGFA 5CYUA 2UUBQ 1O80A 4AYBE 1CSPA 2JYEA 3RZDB 4A3DG 2Q2TA 1PGAA 3ZJUA 4IPCA 1Y56A 1JJ2A 1RF2D 2FUG1 3ZJTA 3K0XA 4GN5A 3TUOA 5IWAQ 4L6TB 1VZ8A 1EYGA 4FP5D 4F8MA 1EOVA 1JWMD 2A6EC 4RWSC 5DEHA 4ZKCB 1XD3B 2KANA 4KKJA 2MJ3A 3QJYA 2JXTA 5G55A 2IHEA 2IT1A 3VA5A 5EPKA 1QILA 2V1CC 3I8ZA 2PI2A 2R93H 2LVOA 1MFWA 1N33Q 3AQQA 3LX0A 3M7GA 1WTOA 1JOOA 2KDEB 4FF2A 3I4MB 5GXGB 4X3UA 3KBGA 2WAQB 3EGRA 2A6HD 2KEDA 3BDOA 4HIDA 2AL3A 3QARA 3MXNA 4U68A 2DZMA 2WXJA 3M4OB 3NHEB 3PZ8A 5C2TB 1SYEA 5CBEE 1JJGA 1K9MC 1DOIA 3ERSX 4UAIA 2K8BA 1ASZA 3N20C 4KZCA 1ZKOA 3KLWA 1H4RA 3HOWB 3L0OA 4C3JG 2CH4A 3J7ZC 2KDMA 4ODGA 4IM3A 4LNKA 4QGUA 3G6EA 4PZ6A 1QZEA 2B2VA 2K03A 3ZNHB 1TWCB 3P2BA 4LNOA 4YWLA 1YQBA 2ZEQA 3WIMA 4RM9A 3MXNB 4WJQA 4C2MH 3AE4B 1CHPD 2RSOA 1YBYA 1DD2A 1P9DU 3R93A 3J81E 3S1QH 1DJRD 2MNAA 3TCAA 1GXDC 1TBEA 2C7NB 1OXVA 2WP8J 5GROA 2ZXRA 5T1GA 1X32A 2UXDL 2EVBA 2K1BA 3MZ5A 3I4NG 4FDBA 2LJ5A 1VJKA 2V4LA 2MBOA 3DHHC 3M4QA 4L5SA 4YXDB 3AE6B 4FN2A 5BYQA 1SNDA 1JT8A 4TQ1A 3CD6A 2B2WC 2EYOA 2CW0D 1KRTA 3BK1A 1CKOA 2Y0SE 1TIID 4NDXA 1WXVA 1PRTB 2ZJPA 1WFQA 2FJ2A 3ONAB 4IN3A 2LRUA 3N32A 4B9XA 4IC7B 4NXNQ 2R92H 1E6EB 1LTAD 3QOJA 2KA7A 3DWPA 3OIPA 4ILWA 3Q23A 2G4DB 3A54A 5ISRA 3P4PB 4EFOA 5M5WH 4OO1H 3VH4B 2PW7A 1CZWA 3UQAA 3CW2C 1GKHA 3IFDA 5J39A 3VDZA 1NUCA 2MBHA 3MJWA 4OW0A 1HFNA 4PYUA 4MEMA 4R1JA 1I42A 2KNBA 1KFYB 5I6YA 1NR4A 1Q8KA 2HCIA 4K0KQ 2XWJB 2PLPA 2JXMB 2KX3A 4CHTB 4GKKQ 3S17B 4DV7Q 2M0AA 2N88A 2IX3A 3AE2B 3UF8A 3NK9A 3KJPA 1BVSA 3KDFA 2J7QB 4KD3A 1BBXC 2Y5BB 2KZRA 4DXGA 3U4EG 1KXLA 1PHJA 4LLGM 1X54A 5HHDG 1S4ZA 1NE3A 2CQAA 1CUKA 5J1ZA 3ZJYC 2J52A 4N8FA 2K5WA 3VUYA 1XO3A 4AQ7A 2R93G 4X6AH 3NHHA 2NVXH 1WTWA 2TMPA 3RNFC 3E56A 3KDFB 1L1OC 4IALA 4LF5L 5M3MH 3S2DH 2OF1A 4PMCA 4BKTA 1GB1A 2LJIA 4RCOA 4HWIB 1L0XB 2CH4W 2H88B 1B50A 2EYMA 4A3BB 3NS8A 3D4RA 4L5QA 3E9HA 3KUPA 3QA8A 2JEBI 1YEZA 1FNWA 2WINB 5IA7A 3SEBA 2MSED 3TREA 4B95A 3F2BA 3GTQB 2G9DA 1WRIA 4OO1I 2JRIB 3VH3B 2PMZB 1TT5B 1N62A 1AZPA 2WQYB 4K3BA 1EO6A 3VTUA 2BYEA 1P3QU 1TWGH 3BVZA 5CMDA 5C3EH 3JC66 4BFRA 5E6NA 3NZUA 4Q5VA 1FRDA 2F0JA 1ET6A 3IFTA 1H9SA 4HRSA 3NTIA 4P1CC 4C3HB 5LL6S 2A73B 2L32A 2N4FA 2EJMA 3T4AC 4XYQA 2O6VD 1CQVA 1TWAB 1PFSA 2HD3A 3OJ4B 2LS01 4IPDA 3K59A 4DR3Q 1EWIA 4JI7Q 2I5LX 2QHOA 3J7YW 2BF8B 2D5GA 5FR3A 3VYSA 1H9SB 2KFKA 1T0QC 1EF1A 3FPPA 1QOAA 2R92G 5C6AA 2EY6A 2BTEA 2A74C 3X3MA 3DBHI 2BYTA 2EPBA 3KJOA 3HVZA 4OO1G 4FHJA 1GPXA 5JOBA 1STGA 3KOJA 1PLFA 3KLSX 1J5EL 1TTNA 1HZBA 3P75A 2E75C 5IAAC 1SMXA 1WCMB 4ZKBB 1JRUA 1XTDA 2G4SA 3G7LA 2KFKB 3N1ZC 4DV2L 3ZGZA 2MJDA 2QMTA 2RHSB 3S2HB 3QC8B 4LF6L 1NMFA 1R9TH 4LTUA 1TWHH 1JICA 4A3OA 1C79A 4JYAL 1TJEA 1RWSA 3P7JA 4DV5L 1V8QA 3GO5A 2G45B 3S1RH 2ICEC 5T1IA 3L08A 4TQ0A 3W1SC 2B76B 3G48A 2KX0A 3CC7A 1GG3A 5KHQA 5IGEA 1HZ6A 5FKAC 2GA4B 1D6EC 3U58A 5K36H 3QQ8B 2EDGA 1B3AA 4GDKA 3VUXA 4W9KA 4RA8A 4I6LB 4LF9Q 2FAZA 1GUGA 3OW2A 4U673 2WXHA 4HN7A 2IWHA 1OEYA 2FMMA 1KIXA 2V9HA 4XQQA 2K39A 4HLEA 2PCFB 3S1NH 1E90A 1JQYD 4ABNA 1P0RA 1VQ6A 5AEKB 1S5ED 3RD2A 5M3MG 4BY1H 1CT1D 1E22A 1RTOA 2KDBA 1P8LA 2VXWA 5AUIA 4AJYB 1P16A 2ZJQA 1AWDA 1QNKA 1IBLL 4ZRKA 1HH2P 1PH2A 3PRMB 4LJPB 3Q14C 5IT9E 1G6PA 4A3FB 2WNMA 1T0RC 1SYFA 2WDTB 2GOWA 1LFDA 4JI1Q 2VQFQ 3NTKA 1B8AA 4C7ZA 4IM0A 4W9FA 5C3EG 1A2UA 1MG4A 4GS3A 5JJKA 2KKCA 2E76C 5IYBH 4AYBG 5AFWA 4A3JH 4AOFA 1WYGA 3RZWC 4MSMB 2M9VA 1F52A 3UIOB 3I3CA 3GB1A 4EZLA 1DXMA 5IOIA 2WACA 3Q69A 3IL8A 4KKIA 1KRSA 1BCPD 1PZID 4WQMA 2F0MA 1RM6C 4JQWC 2WXNA 2YVCA 1U4MA 3VR9B 2XK5A 4DR4Q 4OZBA 4K5WA 2WB1E 3KLRA 4R4OA 2VZKD 4JI5L 4X62Q 4JL9A 4W9EA 2NBWB 4IJLA 2B3AA 4KHPL 1TS5A 1BBWA 1IGCA 4AUQC 1VMCA 3WDNA 2K6AA 2BW2A 1FPYA 1WH3A 2MX2A 1DM0B 3WOEA 3NXWA 2ZM6L 2XK5B 2B39A 1PTOD 4HCPB 4NW2A 3NJTA 4DU9A 3B08A 1M4VA 1HEZE 4GSWA 1PFBA 5FO7B 3U9OA 2NS5A 4FHKA 4H44C 2JA6B 4J3OD 3GTJH 5EPLA 4M8AA 5M9OA 1PH8A 4DN4M 3J80L 3NTHA 2XVSA 1CHQD 2Z0EB 5K36G 3L54A 2KCMA 5D3DA 1C0AA 3M3YB 1UEBA 2JA7B 1FFVA 2WX0A 3DOWA 1B3QA 3R8BA 4LF4L 3A8JE 4G4KA 1RYJA 1P98A 1CKNA 4GLSC 1CZPA 1QLBB 1WTVA 3H7SA 1SGHA 2KHIA 1KLGD 2QDFA 1A6XA 4P7IA 2G3QB 1C1YB 4BY1G 1K83H 2K5NA 3KFUA 5CC4A 2ID0A 5ELFA 2K5HA 1XF5L 1Q46A 1Z6HA 3DXJC 4HPLB 2WXOA 1STAA 1FCCC 5BN3A 2Y0SG 1VLBA 4BBNF 3O65B 4HEDA 3PO2H 5F2DA 2JSVX 1CKNB 3VA7A 3EC8A 2LXAA 2DJGC 5D14A 2WU5B 4PT5A 1KH0A 1QOGA 2HQEA 1IBKL 1RHPA 3OYYA 4YHHL 1RLFA 4PG3A 4P72A 3HOXH 2KMAA 2LUMA 3ZJVA 2N9PC 5IY0A 2F0HA 4OVVA 3V60A 2CKZB 1TWFB 3NBIA 3H0GB 1TQOA 1WOCA 4A3EB 2D11A 4JPSA 4ARCA 5IYBG 4A3JG 4KK7A 2JJQA 4W9JA 2UXDQ 3P20A 4DR7L 3IAM1 5C4JH 4IDIA 2RA4A 1F2MA 4UY8C 3NQTA 1FRRA 1WGDA 3EHVA 4M0WA 1N32L 1GVPA 1GUOA 2Z6KC 4ZYSA 3LWUA 4LFAQ 2MQHA 4FF3A 4IURA 1V9JA 1Y8OB 2EE1A 4PMWA 2YU9H 4NAWA 2HDLA 3K7UC 1LGRA 5G5GA 3ZW3A 4K2LA 1X3GA 1Z47A 1E7ZA 1ZXTA 1EIYB 3B2FA 4MGYE 3IVFA 3C2PA 2INPE 2M4NA 3PLVA 2ZT9C 4QUFA 1K73C 4LNFA 2FBWB 3AM9A 2K9XA 5DM73 4OWXB 3IKJA 1F9PA 4K6DA 1V2YA 4A93B 3AI5A 2F3VA 5LMNW 3TP5A 4C1NK 4NAWB 4EE2A 3GTLH 2B63H 3AEVA 4JE3B 1ONLA 3PV0A 2HCCA 4G0NB 3GTOH 2QEJC 5EBDA 1WZ3A 1PXUA 1V1OA 3RI7C 1PYWD 4ARIA 1S3SG 3TSSA 1Q3LA 3AEEB 3N9YC 3ZO5B 4H7BA 4US8A 1T6BX 3H15A 1RFKA 2F0QA 1C8CA 5AZFA 1MD2D 4JPBW 3H6NA 1VQAA 5M5YH 3U8ZA 4R4CA 3HOVH 1TKYA 2ZNVB 4NKLA 2M17A 3U52E 4K1RB 4XWTA 1UWVA 4WFN3 2CQOA 1P1AA 5HI1A 1NMGA 3NENA 4CJ0B 2IO3B 3NVYA 4HPPA 4C56C 2QA4A 1WR1A 1BUIC 3NE5B 3NUHB 5LXHA 3I9V1 1JMCA 2AEHA 4C3IB 1UUPA 2KACA 3ML8A 4LF5Q 4DAVA 1H9RA 5GAGC 2JX5A 4XXEA 3PO2G 2LRWA 3HS0C 4WWOA 1FFUA 2F0KA 3AMUA 2JQOA 3PZDA 1L4ZB 2X6LA 1F2YA 1JWSD 1I6HH 1GO3E 1TU2B 2ZCBA 3HOXG 1EF5A 2R3ZA 4HKQA 2M2LA 2DBYA 4S3SA 1U4PA 2MPMA 2F0FA 3HKZG 3SE0A 1LM0A 2I2YA 2AX5A 2JT4B 2N55A 3TS0A 4A6QA 1FCLA 3GZNB 3HEJA 5JJLA 3C46A 1FR3A 4HCEA 5E1FA 5FO9B 2ON8A 2E2IB 4A3IH 4DNTB 4BVUC 2F4VQ 2D5DA 2Q2UA 1ZXIA 4I6PA 2N78A 2HIXA 1T5XD 4KVGB 3DUZA 2VB2X 3BINA 1T5EA 2KMCA 5C1ZA 4A3KB 1WGYA 4A75A 2Y5PA 1EWHA 1PFMA 2J42A 3J9CA 1BMLC 5HY6A 2Z0DB 2EYLA 3A7LA 1YIJA 3WANA 1SAPA 5L83A 3T3OA 1W6KA 1Y8RC 4F88A 3MC9A 2FE8A 3V05A 5FR6A 2XWBB 1C4QA 3GQBA 4DPGA 2JSOA 2CS4A 1XQQA 3TDQA 2KAJA 1V43A 3CU7A 4R4QA 1PH7A 2MBQA 1PMRA 2MWSB 2B2WA 2E74C 2B63G 1AP0A 5IE8A 5KNBA 1YQ3B 1X56A 1FEHA 2AWOA 2ENBA 3HOZB 4OIKA 3W1BA 3NBHB 3BDCA 4NXNL 4DQOC 4NXMQ 1VQIA 1D1IA 1LT4D 1SLJA 4JYAQ 4L1BA 2ACZB 4R9WA 1C48A 3RNEC 5IN7A 1SYBA 3F1ZA 2HDEA 3HOVG 1WR6E 3I72A 1PH6A 1MHWC 4ZRZA 2O5IC 3I56A 3KWVA 3JYUA 3ML9A 2K50A 2B3GA 2AQ3B 3T53B 1IBXB 1CTMA 1WE7A 2L52A 4KDLB 4BBRB 4TV3A 1OO9B 4WH4A 3EQLC 2UWQA 4FJZA 2KTRB 1OEYJ 2CJNA 3APFA 2MO1A 1PGXA 2RDFA 4YT0B 1KTKA 4JW0A 3W1YA 1LTLA 4GKKL 4D2KA 1AH9A 1ET9A 3PLUA 4RAUC 4CKBA 4K2KA 3LNNA 3L7ZC 1Y1VH 4GOCA 2F0TA 1PFDA 2CR5A 2GBNA 4IG7B 4M8MA 2JA8H 4RH6A 2WB1G 2C7MB 1XPOA 5HG2A 3BZKA 4N9TA 2WDRB 2R7ZB 3ONSA 4IOCA 3SHQA 3ZNID 2V0GA 3MHBA 2DYBA 2QC8A 2BA0A 1L1OA 4BS9A 5JAVA 2L05A 3SR6A 3CQZB 2VUMH 4GU2A 3V6CB 5D94A 4ANVA 3W5UB 2UUCQ 2A68D 2DGYA 5CV5A 2LXJA 1T0YA 3K5LA 1PA6A 1LTBD 3UI2A 2RCNA 1QE6A 4JI6L 3CSTA 2FMCA 2PNRC 4A3IG 2IGHA 4L23A 3QAQA 5C23A 2L5TA 2KFJA 3PF5A 3LGJA 1WY8A 4KHVA 5D2MB 1ZDXA 3QOLA 2NZHA 4WIPA 2KVRA 3S1MH 3V6EB 4USAA 3S16H 3DM1A 3K80C 1JC7A 2JF5A 1I4QA 3I90A 1FXTB 2L8JA 3ZLZA 1G6ZA 1XLQA 4DV1L 2I0QA 1K8RB 2KTFA 5EE1A 3D32A 4GLAC 4WRDA 4DR3L 2PPBC 2LFNA 3RULA 4A20A 1QJOA 4MNOA 2IL8A 3N30A 4DHZE 2ZM6Q 2PPHA 4CDEC 1E5WA 4KY7A 5E4WC 1EU4A 1EUJA 3AEGB 2VQEL 2O2VA 3KF6B 4DAYA 5C4HA 2MHVA 3CCSA 4XYCA 3DWMA 2INDC 2QCPX 3RYTA 2F0VA 1SFOH 1XNQQ 2FCNA 2KWDA 3V3XA 3HOUB 1B9MA 5E6JA 3ZKJC 3CRLC 1JALA 3Q3MC 1C76A 1VQ8A 4DAYB 2MGSA 1Q5WB 4BBSB 1VQ7A 1WF9A 5FO8B 1I4RA 1Y8NB 5LHY1 1WFYA 1F9JA 2CU3A 2GBMA 1L6VA 2AQ1B 1EFWA 1I3QH 5IT9L 1YNND 2HIVA 3L0WB 4NJCA 4OVUA 4WQOB 1K28A 4J15A 1PYSB 1X3EA 3J80c 1Y1VG 1K3RA 4A3DB 3S15H 3CKIB 1CJEA 3TJPA 1WYDA 1B53A 3GTGH 3A55A 2YYZA 4LF9L 5IP7H 4MIUA 2JA8G 1Q10A 2LFIA 4A8XC 3FC4A 3MEHA 1XPUA 1HE8A 1W3SA 3DM3A 1FM0D 2M8SA 2FCMA 2KWUB 1M8AA 3DPDA 1HXYD 2C35B 2Y3AA 3DHQA 2CKHB 2BKRB 2K32A 2VUMG 1XYIA 4MDKE 4APVA 3KYHC 3N1XC 2Z9HA 2RDGA 2IDYA 2A69C 2PQAA 4C00A 3AFQA 2Z59B 4HJGE 2VL6A 4DR7Q 2LHDA 1Y14B 3OJ3A 1AN8A 2E6XA 3KVFB 4EQ5A 4CDCC 3K0YA 1VQKA 4C4VB 3J81i 4B0MA 3B1LX 1Z7TA 5DPTA 5LL6X 3ZDTA 5EBCA 3V96A 4XE0A 2PZWA 4C3JB 2NCNA 3PIP3 3P4QB 4QAYA 4BOSC 2PQAB 4PNYA 4C80A 1UE7A 4PK1A 4ZOHC 4EOYA 4QF4A 1PV4A 1B1ZA 5LNK1 1VF5C 3TL5A 3U7DA 2I07B 2MQJA 1C9OA 2F03A 3CF5A 1UBIA 4FF4A 2AL6A 1WTHA 4RMFA 2D0PA 4FADA 1WXQA 2WKCA 3K58A 3ZTDA 1R4QB 3I4NB 3LDZE 4NPNA 5CTRC 4WWPA 3S2AA 1N6ZA 4UHVA 1UE1A 4DR4L 3EA6A 4IFDH 4LW1A 1HPCA 4UPAA 1NDDA 4X62L 4TSSA 1B2TA 1O7YA 1YJJA 5LLIA 4RKBA 3PS6A 2D3AA 3K7AB 2MBBB 3VRAB 1NBWA 3SK6A 2F4IA 1K0SA 1VQNA 1LLRD 2ZPNA 4S0RA 1E2VA 4HR7B 3GTMH 3AB9A 1KHIA 4DNIA 1UF0A 3QCAA 4BAXA 5AJ3L 1V9PA 3W3AA 4ZAIA 2GLSA 2A19A 3HG9A 4EZKA 2DZIA 3SK8A 3ZQ4A 3MEFA 1V86A 2NPTA 3TRZA 3CMEA 3HZXA 2LVPA 3WCQA 1MSGA 1SMYD 1TVXA 3A7AB 3DEPA 1S40A 3NS1A 4P16A 4IW0A 4BY7H 2VS1A 3ZXRA 5GMVA 2KOXA 1S5BD 1U9RA 4EZJA 1F9SA 2OWOA 5IP7G 4PV1C 4BWGB 4MELA 1IGDA 3SDLC 2NPTB 1RL2A 2C5LC 1KABA 2YV5A 2F0LA 3DBRI 4A3MH 2RGFA 2SNMA 2UYZB 2OQKA 1EY5A 3A74A 4IPGA 1TY2A 2MUYA 1EQQA 1WJNA 2GB1A 4P75A 1Q81C 1UELA 1MI0A 2N0SB 3DQVA 3H7PB 4IJHA 2R93B 1EUVB 4B3TL 5A35A 3X0WA 3SR1A 2IY5B 1XNRL 2J7ZA 4E3CA 1STHA 4MZ9A 1D5ZC 5BMIA 3VUWA 2I5MX 4IFDI 4KKTA 3OHXC 3EUB2 2KCTA 2Q8RE 5BMGA 4ZRIA 1ISNA 1XMOL 1R4MI 4DR6L 1KNAA 2OQ0A 3AULA 2YEPB 4G50A 3PIO3 1E0BA 1ICFB 3J81c 1GHKA 1TIFA 4DHZB 3RNBC 1WJUA 4MTNA 5JPMC 3TS2A 2VH1A 1QOHA 1OXXK 2EXDA 2CJOA 4QUCA 5KYIA 1VDVA 3CCMA 3PSIA 4Q0FA 3NVVA 3I2ZA 1FL0A 2JK8A 5IYCH 4NQKE 5CGKA 1QVFA 1U0LA 3STBD 4K7UA 4MN3A 4L5RC 2EY1A 1WRDB 4C2MB 1Y1WH 2EXZA 4RHRA 3TBIB 3GTKH 1V81A 3HRZC 3ZXVA 2RMMA 4LFAL 2Z6KA 3EVQA 1VS0A 3WAMA 1HCZA 2BPSA 2IO0B 2KD0A 1SXTA 4G57A 3W5OA 1PRTD 2EKEC 3DMUA 2H89B 2K22A 1NEKB 4N59A 1IL2A 5DPRA 4IFDG 4OEMB 5I2YA 2R2OA 4HIMA 1SIFA 3OWFA 2W54A 3PSEB 1K8MA 3A1QB 4KV6A 2KQ7A 1A0IA 1I6VC 3TMEA 2K52A 3GTPH 1MJDA 4MM3A 2R92B 5A2QL 5MPOA 4TKOB 2EYJA 3P1HA 3EROA 2JUOA 2IBIB 3ULPA 1A3UA 5EDSA 1F77A 5M5WB 3TZUA 3L9AX 3ZYYX 3GP7A 4M02A 1A15A 2I46A 5LMNQ 4NQLB 4GGQA 1LABA 1XJVA 4MM3B 1LYLA 2EKIA 1Q1OA 3HM6X 1WXSA 3Q8EA 2K01A 2H1EA 3FVQA 4ZK9B 1N5XA 4ZRPA 4BY7G 4DDGD 3HP3A 2DYOA 4O0AA 5C5LA 5FLXE 2JY6A 4KSLC 4EUTA 2E5LQ 1NTGA 3ECIA 1GUNA 1BXTA 2C9OA 1J8IA 4RF0A 1Z5SB 4HMJA 2F0DA 1TS2A 4LF8L 2D10A 1ICWA 4A3MG 4EGVA 4EKUA 4Y7NH 2ZTCA 1I50H 3AV8A 3G71A 4LFBQ 2F3WA 1KOTA 2FHTA 1LV9A 3DBHB 1WWTA 4CQNA 2YEPF 2NVXB 3MHSD 2WXQA 3VHTC 2D2QA 1JJCB 1A70A 1O7LA 3J7AV 2K8HA 2AMCB 3S2DB 3Q3OC 5M3MB 4XT1B 5IIFA 2LHEA 4X64Q 1EY6A 1Y8PB 1B70B 1VQPA 1KD1C 4XDXA 4OELB 2R7DA 3PCOB 4JI6Q 1GAQB 2NBFA 1SIJA 4MSQB 1EY4A 1HRJA 4WWNA 1WD1A 3W9CB 1SE9A 2J0TD 3HGBA 1A62A 1E10A 1SSNA 3APCA 2NB0A 2PNHA 2QSDA 2WDVB 1JB3A 3PTFC 5IYCG 4G7HC 3ITPA 3VYRA 4ULLA 3RLNA 5C4XH 4F7ZA 1EYDA 1UGMA 4B3SL 2EMSA 1I35A 1Y1WG 1WIAA 4KGTA 1WI5A 3DWAA 4A90A 4K8IA 1PRTF 4DV1Q 3HHMA 1TWGB 5C3EB 3DEOA 3RN5A 2F4VL 1EWYC 1FXIA 1DGJA 3E3XA 2JA5H 2HDMA 2RVLA 3CCEA 4AYBB 1PH5A 4YWKA 5C0XJ 1TZOA 4JCVE 4O42A 3G6JB 3IAYA 5ELEA 3E9SA 1DOXA 1GB4A 4KZ0A 5L95C 5D65A 2L76A 1ESFA 2PW9A 2VQEQ 1ENCA 1XXGA 5C44H 2N3SA 4H2AA 3MTSA 5CHFA 5ELNA 2E2HB 1WXMA 3TEZA 2J53A 2NZ1D 3HKZE 1YNJC 2J0MA 4XDDA 1WTXA 5BMHA 4QY7A 2KHSA 2AUKA 1H8CA 2KN5A 2K5QA 2LWPA 1YNXA 1HNWQ 2L0TA 2DHZA 2RQXA 2NVQH 4XQJA 1TS3A 1QB5D 3RLOA 4NXML 1QQRA 1QKZA 2KMMA 2CU1A 2F0SA 5KGUA 5AZHA 3HUIA 4POGA 1PYBA 1R4NI 1D4BA 1HTLD 4DF7A 4DK1A 3DVGY 1R9TB 2BB6A 5KHOA 1TWHB 4FVMA 5L37A 5IGDA 3BVGA 4RGOS 3TP8A 1I94Q 1OTCA 4IWPA 4KJOA 1NENB 2PIAA 1HUNA 3P1MA 3FKIH 3BS1A 2WLBA 4JWUC 4HSPA 3S1RB 2D62A 2RBMA 2LASA 2RPVA 3CIRB 5GAHC 4ZHPA 1E8YA 1YJWA 4NPSA 5GAEC 1MI2A 2WXFA 2KVMA 2CHBD 3R66C 1YQ4B 3AE8B 3IRBA 2LKVA 2WFWA 3L16A 4DA2A 5IT9c 4QQBX 5C3XA 1LO5D 2BWFA 4CJ2C 3S1NB 4EX5A 1QUQB 1EY7A 1SNQA 4NY0A 2A1AA 4BY1B 2E2DC 2VY3A 3C3LA 1PGBA 3NVWA 2L4NA 2KQ4X 3Q3JA 1E1TA 2Y0SB 3I7FA 5C4ZA 1KRHA 3NPPA 2BE5D 1L6UA 1PDXA 3ZVVA 3DVGX 5E7NA 1RTNA 1SE3A 3ZDMC 4YTMB 1EIGA 2W3SA 2UUCL 4XIGS 4LNQA 1LXDA 4ANWA 4HK2A 5C4XG 2MCNB 2WYQA 2BDOA 2H4OA 4WAFA 2KC2A 1TZ1A 5C3WA 1EM7A 4HJKA 5KNDA 1GJXA 3KUCB 4IWOA 1G6JA 2JA5G 4A3JB 5M5XH 1SYDA 1DCZA 4O1NA 4LK0M 1NBFC 1FIQA 2LSSA 2ICIA 2BOSA 4HJ9A 1Y69U 3B6YA 3K8AA 2AHOB 2NTTA 2KJRA 2KXJA 1HHVA 4HROA 2W9NA 3KW5B 2OJRA 5C44G 2O5JC 2O4XA 3BYTB 2QJLA 1EEID 2WXPA 3L17A 4GN4B 3CCUA 1NJIC 4FF1A 2HUGA 4TVAB 1AW7A 2G1EA 2FINB 2Q2HA 4AQYL 3A0JA 3VR6A 3LXFA 5AJ3Q 2MJ8A 4RCNA 5IGCA 3PZ7A 2O2LD 4YWMA 1FGUA 2A5UA 2IW3A 3GDEA 2L7RA 1N63A 1IUEA 2NTSA 2JYTA 3QIAA 5IO9A 1X55A 4MACA 3T1HQ 4FXKC 4GLXA 4BKGA 2F0UA 1XNQL 1MVKA 3GD7A 4YSZB 2PZTA 3E9IA 4AJWA 4X3TA 3FKIG 3H09A 1C3TA 2PW5A 5KRUA 3GTJB 1SF0A 1PTOH 4GN1A 4A9AA 4HJ7A 2Q5WD 1DOKA 2WS3B 3AEAB 1K3BC 3DWGC 2OEDA 2L55A 1Q86C 3GOEA 1G2SA 2GN5A 3ZNZB 4URKA 1RFAA 1VQDA 2VW9A 2L11A 2ZW1A 2KJ6A 2W3RA 1CK1A 2F0WA 2JN4A 4MGKE 5KIXA 1C78A 1VQEA 4ZHOA 4PMBA 2LUEA 2OTLA 1U5KA 4B3TQ 1SDFA 3AB5A 1XNRQ 4TKNA 2XSCA 4KJNA 2X38A 1RAXA 4NAMA 4DHJB 1XMOQ 4FJVB 3Q8AA 1JR0D 4DR6Q 2A6HC 1UWMA 1VZ6A 1ZE3D 4KV2A 4OWTB 3GE8C 5BO4B 3H3VH 3M63B 3PO2B 2HTME 4OZCA 5M3FH 4QIWE 2BB5A 1GD7A 4ZCKA 2ZJRA 4CBVA 1KF6B 4QMGA 3GE3C 3HOXB 3BDLA 1ZYRD 2GI9A 1EU3A 3O13A 3HKZB 3Q6BA 4HJAA 4H13C 1V5TA 4JLCA 3FILA 1A8VA 1X9NA 2LZ6A 1HTQA 1SB3C 5C4JB 1SNCA 4MTKA 4HCNB 1S3OA 4BA1I 2OHFA 3OAWA 4OVZA 4GMVA 4GDLA 2WGSA 3A33B 3B9JA 3TEWA 2K1FA 1U4AA 1IYUA 5EAYA 1UH6A 3T3NA 2CW0C 2JPHA 5DNFA 4JBJA 3ULLA 5GADC 3FILB 4E74A 1HR0W 4X66Q 1GNUA 3NG0A 4B08A 2KEEA 2A8VA 3F2CA 4GDLB 4GN3B 3WWVA 2K05A 4FNFA 1H9JA 3KUZA 4OL7A 2LMCB 1IW7D 2UU9Q 3ICEA 1AEXA 1PH1A 1NY4A 5ELCA 1SJHD 1PFNA 1YHBA 4RG1A 3H9DA 3KWLA 2EJFC 2B8FA 2B63B 4S17A 1E24A 1HTPA 4A93H 3GTOB 3H3VI 4A76A 2FFKB 5D7GA 4I7ZC 2ZPYA 4KGRA 1E9MA 2KJXA 4KX6B 4CHKA 4B9WA 3A4RA 1CFMA 2UUAQ 1FD7D 3U9SA 3UE0A 2JXXA 1CZGA 1QCBD 1VQGA 2SOBA 4IUVA 1E1OA 1LTTD 4HIKA 4LF7L 4IWQA 5M5YB 3HOVB 3C8YA 3P4SB 3TBLD 3R7QA 2GBJA 2CFMA 4ZUIA 1TS4A 5T8IA 1BT0A 3MJ5A 1TY0A 1SRUA 4LF8Q 3R7RA 3W1SA 2L15A 4JWSC 4GNXC 2QDBA 3OIQA 1O7ZA 4K6LA 4PQXA 4RHSA 4DGZA 2PE9A 4DK0A 3QWZB 1JOQA 4LAAA 3I91A 2L83A 3W5VB 3QWNA 2KOLA 1S5FD 4HJ5A 3J81L 1AYFA 2PVOD 3A56A 2OOBB 3LJ3A 3KF8B 3A4SC 2WXLA 4RKLA 2LGSA 1EQVA 1YITA 2VB3X 4W9CA 3MA2B 3RZOH 5IYDH 1RJTA 2C7HA 4XDCA 4HCSA 4L63B 2DWQA 1VQJA 2WB1B 3EBEA 3NEMA 2F0OA 2SEBD 5M3FG 2A6ED 2OT2A 4DUZL 2DY7A 2GVBA 1I6HB 2JA9A 5JPNC 1P7FA 4G11A 5E6OA 5HFYA 5CV9A 3MXUA 3UE1A 3NZ3A 3D31A 3T13A 4KGSA 1XPRA 3UINB 4B3SQ 4CO7A 3K5NA 1QVCA 4OHJA 2KDFB 1Q7YC 2RPQA 4G3XB 4OGQC 2CWPA 1V6EA 2N9EB 3PHWB 3SD5A 4WJNA 2V3SA 4FULA 1I7HA 3QHTA 4A4IA 5CBAE 4DK6C 4A3IB 4KKUA 4X65L 4A3GH 3ZIMA 2K6DB 4QL5A 3HVDA 2IGGA 3NBHA 4LNIA 2NVYH 1JE5A 1TKGA 2EQSA 2XEWA 5NUCA 3J7AF 1OQYA 2LXKA 3MC8A 2ZJDA 3MFGA 3SK5A 4I6NB 3EFCA 2M19A 2F0GA 3N6RA 2KDIA 2IPKD 3CMMB 2K75A 1K52A 2IYDB 1VQBA 1IPGA 4GXBA 4N8X1 2W82A 3RN9C 3K5MA 5HKHA 3FEWX 3PRPB 2WX1A 1GHJA 2PKOA 1JE4A 1LT5D 4EEWA 4A93G 2KTRA 2C60A 4LCDE 3WA0A 3SK4A 2KUMA 1MIUA 4ICUA 4NNJB 4W9IA 3AFPA 3UDFA 4NZLB 2B2UC 1YIWA 1HA5A 4B0EA 4HKZE 4DAMA 3CCVA 1YN3A 4WAAA 3BY4B 2A5HA 3URYA 1JWUD 3QO2A 3JW0X 1HR0L 3U30A 2ALYB 3T1YL 4F8CB 5LMNL 3AU5A 4BOZB 2DZJA 2XTIA 4DNRB 2Y5CA 2ZZPB 4QIWB 4IM2A 2MP2A 1I4GA 3PQIA 3CCLA 4WJWA 3ABVB 4ME3A 3LB8C 3ZTCA 2OEOA 4TMAB 4XT3B 2M0XA 4L5TA 2V4DA 4IUQA 4R8IA 4JBWA 3U50C 1WM3A 2AUJD 4OXPA 2E5LL 2WP9B 3F8TA 3Q8CA 4DXFA 4DFAA 4MT5A 2K14A 2DZKA 1P7EA 1A2TA 1LACA 2MP2B 3AEBB 3MFYA 1Y1VB 2Z4IA 1QZGA 1ZGUB 2RD0A 3A9JA 3FHWA 3Q2AC 4ZRJA 3R3OA 5IYDG 2DJFC 4LFBL 1JORA 3NP8A 2QCZA 2JA8B 4X3SA 1BR9A 3GS2A 2IZVB 1BDOA 3BWUD 3F2UA 1UAPA 3UDIA 4ZUJA 4X64L 3PO3H 1XT9B 1QT9A 3IT6B 1IKMA 4XTCS 3A9JB 1MHXA 2VUMB 3MC0B 3DLLA 1N34L 4JI0L 4X3KA 1J7CA 1VR9A 3H8HA 2JWUA 4GIVA 3HOYH 1EIHA 5EKIA 1KJTA 1ZUD2 4N9PA 4CDDC 3VFKA 5IP4D 2B29A 3E5SA 4A3GG 3RR5A 2ATWA 2D07B 3FMCA 3K5OA 2L0CA 1BCPC 1AZQA 1D7QA 3CC4A 4W9DA 3KF6A 3PF4A 1D1KA 3J81j 3S1MB 2JU6X 5J17A 2BBCA 1UZXB 3S16B 4XX5A 1LUZA 1TT2A 4ME5A 3CWIA 4GOPC 4QCLA 2PZUA 4JC0A 2BDNA 4AQYQ 2RDBC 4ACFA 4DK3C 1CA5A 3C1EA 5IODA 2FCQA 2RSUA 3BJUA 1DZ1A 2K28A 1L2NA 4WURA 1F2ZA 1IYVA 3CAMA 1MSHA 4K5VA 3N3KB 4MGIE 4HDOA 4PS8A 1PTOC 3PUXA 5IOCA 1VQ9A 2KN4A 3KH0A 4YSYB 1IP9A 1MPEA 4JX1C 1EYCA 1F9QA 4YCWA 1HNWL 1CA6A 2NVTH 1ZKHA 1PDQA 3GV6A 3S24A 3TP6A 4KMUC 1SFOB 1ILPA 3UQBA 3S9WA 4IO9A 1FJGQ 1WTQA 1ZPSA 1TKEA 3TQYA 2ZXPA 3ERQA 1VQOA 2WIIB 1A3TA 3RLFA 1TXYA 2EMTA 2B2TC 3KLSA 1I94L 1V80A 1NVID 1Q8IA 1VQCA 2JQRB 2K6QA 1WGRA 2E3TA 4H02A 4BZAA 2DNFA 4KIKA 1I3QB 2I1JA 4BBSH 2N49A 2PTLA 2RDHA 2E2JH 3D6WA 5I2XA 3S15B 1W2BA 4WJ3M 2WXGA 1YNTE 3GTGB 1CI3M 4C4VA 1N36Q 1VQFA 3NVZA 3Q8FA 1A63A 4ITKA 2MHJA 2V3NA 1H9KA 1ML0D 3PPAA 1YVCA 4XC2A 4FXCA 4KIKB 1YX6B 1IKLA 4HMIA 3I5JC 1STYA 1J0GA 2F1MA 1ZP0B 4DR5L 3PO3G 5CV7A 1SSOA 1YN4A
chains in the Genus database with same CATH topology
5I4DA 2JP1A 4RFBA 1C77A 2B2YC 1V8CA 3OW7A 1JRPA 4V0BA 3FDTA 3E0JA 4KD4A 3RPFC 5E4XA 3RD4A 3L4PA 2LEKA 1JWAD 4KN4C 1R4PB 1SEBD 1OXUA 1X3PA 3K6OA 5ELDA 1EWCA 4IUTA 1SE4A 4ZRQA 2XRQD 2Z4HA 1EZ8A 1T3QA 1J7BA 4L2YA 1XTCD 2K04A 1WTRA 2PQEA 4WWMA 4FXDA 2NMQA 4IUNA 2WKDA 2JYOA 3PUWA 5JVH3 3AEFB 3Q22A 2WXMA 5DAUA 3GTMB 4N58A 3TN2A 1XCQL 1G8ZD 3MXPA 2K0PA 3TP7A 4REZA 2R6GA 2L9HA 3VRBB 4BY7B 1L5PA 4K5XA 4RGNA 2EZVA 1L0VB 5TSSA 3VQIA 4A3MB 4H0LC 2F0IA 1K51A 1DOMA 1N60A 1R7SA 2MP1A 4EVOA 1X3QA 1YJIA 4M1UB 2CVRA 2EJGC 3AE3B 4IUPA 2BS3B 1V1PA 1C9FA 2DNEA 5JEAJ 1W6JA 3S1QB 2ZW0A 1LTGD 4IQZA 1V1PB 2IGDA 2TSSA 1Y1WB 3GTKB 5HGTA 2F0NA 4QB4A 2AQ2B 4L8JA 2EY2A 1ZOYB 3RFZB 2KQ3A 2WXIA 1S5CD 1WD0A 4OIJA 4KI0A 3D4WA 1G2TA 3MP9A 3GTPB 3UI3A 3P4RB 5BYSA 2F0PA 1EY9A 4AS1A 3NWSA 3R2TA 2Q8IB 3OPOA 4HSVA 3FAHA 1FNUA 1QNUA 1D5MC 4R8NA 1TYGB 2L12A 4ID6A 1KDCA 1ZDVA 4TQUS 2BS2B 1I4HA 3VR3A 1RDPD 3VR2A 5JJZA 1LTRD 4Y7NB 1VRAB 1I50B 1U4RA 1DOYA 5EE9A 4YSXB 3Q24A 1E2WA 3TZDA 3VYUA 4IKGA 3QG1A 1K8OA 1BNZA 1XEEA 1G291 2A68C 2D2CC 4UDUC 1BF4A 3SXHA 3MVVA 1EFID 2SAKA 1OQQA 4EQOA 4KKSA 4RGTA 5C4XB 1J9OA 1GUTA 1ROEA 5D3IB 1N5WA 1LTID 3AECB 1VCIA 4RGMA 2JA5B 2NYZD 1ZEQX 3T16A 5HURA 3BIID 1MBYA 2IX0A 5C44B 3KQ4A 2OXPA 2KCNA 3JAME 2Z8LA 4R3DA 2N9KA 3FRPB 3OOCA 1HFGA 2BS4B 2NVQB 4MH8A 2BCOA 2B2UA 1RCVD 2QILA 3P42A 3NRZA 4KN7C 1S5DD 1YNNC 3OSOA 1ESRA 4YIJA 5CV8A 1NYRA 3FKIB 2MEKA 3TEYA 1SE2A 5JVG3 1LTSD 1OXTA 2NWGA 2WU2B 3SDZA 1NAPA 3T56B 1OFFA 1XLPA 1SNMA 2NUCA 1Q12A 3I4LA 3Q0AA 1FD6A 1KAAA 1FXAA 1RD9D 1L4DB 1BQQT 3LWEA 1EEFD 4KY6A 4GDKB 5C3JB 1EY8A 1C4PA 1EQTA 4IOIE 1AFPA 4YTNB 4IFDJ 4V190 2JEAI 1XLNA 1Q1BA 2C5CA 1JWBD 2DN8A 3RMHA 5M5XB 4C3HG 2VNUD 3PUVA 5CV4A 1WSPA 2LGIA 2L1AA 1NSNS 2MJEA 1B9NA 3Q6SA 4K8JA 2MH7A 3Q8BA 3IAS1 1KLUD 1BCPB 3MHZA 1IHZA 1STBA 1F9RA 3SFEB 4LMQD 3A8IE 4IZ8A 1FYCA 3M4YA 1E7PB 2VZKB 1BUVT 2K33A 3DWQA 2LY7A 1HUMA 1HZ5A 2N7JA 1H9MA 1SMYC 5FK9C 2BT6A 2L1BA 1HA6A 1PTOB 5J22A 2DY8A 4E6IA 2B2TA 3EFXD 1DYQA 2ONQA 1A3VA 3BZDB 2EYPA 1WGKA 1K83B 1RODA 1K53A 1TR5A 1I4PA 2X6GA 2M00A 5C5MA 4HEA1 2EY5A 1PUTA 4FXGC 4XQNA 5KNCA 1VF7A 1TKWB 4XYOA 1QF6A 5M3FB 1HQRD 4CGYB 5BN5A 2B2YA 1WTPA 1SNOA 1F0ZA 2B2VC 2A69D 3HRDD 5KYLA 1YMHE 4ZQ3A 4F7XA 1JROA 5H8YE 2SDFA 1Q90A 2LMCA 2YU9B 2EYHA 5EKLA 1HQMC 1PRTC 3D4DA 1Q1EA 1BCPF 4FO2A 1JCKB 4DAPA 2NN6H 4J6HA 4LJZC 4G7OC 2IX1A 1L0YB 4BA2I 1NI3A 1BO0A 5IGBA 3GTLB 1II3A 4YWGG 1VMPA 3A8KE 5EE0A 1ZXHA 4ZLTF 2W55A 3VR8B 3OMGA 1PTOF 4RF1A 1F2LA 3NQIA 3I73A 4KY5A 1KNEA 2QKIC 3KF8A 3PO0A 1SYGA 2KCCA 1OQRA 3QB3A 3CRKC 1EY0A 5I9OA 3M7NA 4NMZA 3SHLA 1NYQA 3U7ZA 1UWXA 1IBXA 1LT3D 2JZPA 3I70A 3ETRA 4XWWA 1QWYA 4FYDA 4CJ1B 1FMAD 1SJED 3X3NA 1NR2A 2PMVA 3AE1B 1B4OA 5A2QE 2D9UA 2IJ0A 5FOBB 1D2BA 2EYFA 3RZOB 1IBXB 2NN6I 5EGTA 1C4AA 1GUWA 2BA1A 2XIWA 1DONA 3E6ZX 3PMFA 1B44D 3SVMA 1F2RI 1STEA 3NUCA 3AMZA 1UNSA 3MAQA 5I9PA 5G5HA 3D8GA 1K50A 3I57A 1SYCA 1E0ZA 5CR3A 5H92C 1XCTL 3BVMA 2N9LA 3D6CA 3VR5A 4A3GB 1XLOA 2K5DA 4TRDA 2NVYB 1QOBA 2DYMA 1GOZA 4CKEA 4LK1C 2NN6G 3H6MA 5FLXL 3LYYA 1CM9A 5ELBA 5EKKA 3ND8A 1RKNA 3D3RA 2RKSA 4C7YA 4WORA 3AE9B 5JEAH 2SNSA 1ILQA 4EQPA 3OMCA 1OXSC 5I6WA 1ACCA 2XRSD 4EQNA 5CV6A 3VR4A 2K3UA 3U2SC 2JE6I 3CHBD 2EOTA 1ENAA 2J4XA 2WV6D 1C4CA 1FNVA 3M85A 3PUYA 5EJWA 4N6EB 1WVLA 1KDAA 1PZJD 4JK1C 1I4XA 2RSNA 4A55A 3AU7A 4C3IG 2DLBA 2WDQB 3C1FA 3MWYW 5EE3A 5BN4A 1JW9D 4J1MA 1IL8A 4P2CB 5G3LD 5AUKA 2V4IB 1ENFA 1GUSA 2BE5C 1JOKA 3AH7A 3PO3B 3IT4B 2QF7A 1KDBA 1SBBB 3KBXA 3AE7B 2ZXOA 3SFDB 2B8GA 3HOYB 5EQ0A 3GV3A 5KEEA 3R2IA 3JAML 4HTHA 1EZ6A 2X69A 3NSWA 2F0EA 1UEAB 5BYRA 1EOTA 4OZAA 1NCVA 5IGGA 4Z9CB 3H91A 1FGBD 3FPUB 1MHHE 1XWEA 4US9A 3P63A 3TEXA 4I65A 1JQ4A 2K7VA 3AEDB 5JXVA 5JEAG 3NWTA 3BK2A 2Z1CA 4J8QA 3BG3A 3K57A 4CKCA 2KECA 4IUUA 5COYA 2WXKA 1O78A 5C0XH 3AN1A 1D5XC 4C1NI 4P6VF 2NVTB 5K5PA 2Q8TA 1YNJD 2XN9C 3B2GA 1VDZA 4HAEA 3L3OC 1DOLA 1MGSA 5E3FA 2INNE 1QG7A 3H3VC 3OWEB 1STNA 5G3LF 2GRIA 2E2JB 2WXRA 5CORA 3T51B 1EYAA 3H94A 1SNPA 3VYTA 1J7AA 1G91A 2QIEB 3WOFA 3EJIA 1PZKD 3J80E 2PO4A 2M56B 3AE5B 1ZYRC 2PVGC 1EL0A 1YN5A 2K5PA 2G9HD 2I38A 3N52A 4GZYC 3RUZA 3IXSA 2AWNA 5C0XI 3PUZA 1VZ7A 4MHEA 4KTAA 3W2DA 1BOSA 1JMLA 1V97A 2R61A 1F2RC 2XNAC 1CQFA 5DM63 5EPJA 4Q2JA 1IW7C 1FO4A 3KK7A 2PYKA 3MXGA 2DNCA 1XX8A 4NP5A 2V3PA 2EELA 1E2ZA 3BYYB 1LT6D 5C0XG 4F87A 4YTPB 1N61A 4K14A 3S14B 3V2TA 4RNAA 1QOFA 1U4LA 4KHZA 3ND9A 1UGJA 1B9RA 4G7ZC 5IGFA 5CYUA 1O80A 2JYEA 3RZDB 1PGAA 3ZJUA 1Y56A 1RF2D 2FUG1 3ZJTA 3TUOA 4L6TB 1VZ8A 4FP5D 4F8MA 1JWMD 2A6EC 4RWSC 5DEHA 4ZKCB 4KKJA 2MJ3A 3QJYA 2JXTA 2IT1A 3VA5A 5EPKA 1QILA 3I8ZA 3LX0A 3M7GA 1WTOA 1JOOA 4FF2A 3I4MB 5GXGB 4X3UA 3KBGA 2WAQB 3EGRA 2A6HD 2KEDA 3BDOA 3MXNA 4U68A 2WXJA 3M4OB 5C2TB 3PZ8A 1SYEA 5CBEE 1DOIA 4RF0A 4UAIA 1ZKOA 3HOWB 4C3JG 2KDMA 4ODGA 2B2VA 2K03A 1TWCB 3AE4B 1CHPD 2RSOA 1DD2A 3R93A 3J81E 1DJRD 1GXDC 1OXVA 2WP8J 2ZXRA 5T1GA 1X32A 2EVBA 2K1BA 3MZ5A 1VJKA 4YXDB 3AE6B 5BYQA 1SNDA 4TQ1A 2B2WC 2EYOA 2CW0D 3BK1A 1TIID 4NDXA 1PRTB 4IN3A 2FJ2A 3ONAB 4B9XA 1E6EB 1LTAD 3QOJA 2KA7A 3DWPA 3OIPA 4ILWA 3Q23A 3A54A 5ISRA 3P4PB 4OO1H 2PW7A 1CZWA 3IFDA 5J39A 1NUCA 4OW0A 1HFNA 1KFYB 5I6YA 1NR4A 2HCIA 2PLPA 2XWJB 2JXMB 4CHTB 3S17B 2M0AA 2N88A 2IX3A 3AE2B 3NK9A 4KD3A 1BBXC 4DXGA 3U4EG 4LLGM 5HHDG 1S4ZA 2CQAA 5J1ZA 2J52A 4AQ7A 2K5WA 1XO3A 3NHHA 1WTWA 2TMPA 3E56A 4IALA 2OF1A 4PMCA 1GB1A 2LJIA 4RCOA 1L0XB 2H88B 1B50A 2EYMA 4A3BB 3D4RA 3KUPA 2JEBI 2WINB 1FNWA 3SEBA 3GTQB 2G9DA 1WRIA 4OO1I 2PMZB 2WQYB 1N62A 1AZPA 3BVZA 5CMDA 4Q5VA 1FRDA 2F0JA 1ET6A 3IFTA 1H9SA 4HRSA 3NTIA 4C3HB 5LL6S 2A73B 2L32A 2EJMA 3T4AC 4XYQA 1CQVA 1TWAB 2LS01 3K59A 3J7YW 2D5GA 5FR3A 3VYSA 1H9SB 3FPPA 1QOAA 5C6AA 2EY6A 2BTEA 2A74C 3X3MA 2BYTA 2EPBA 3HVZA 4OO1G 1GPXA 5JOBA 1STGA 1PLFA 3KLSX 3P75A 2E75C 1WCMB 4ZKBB 3G7LA 3ZGZA 2MJDA 2QMTA 3S2HB 4LTUA 1JICA 1C79A 1TJEA 1RWSA 3P7JA 1V8QA 3GO5A 4TQ0A 2ICEC 5T1IA 2B76B 5IGEA 1HZ6A 5FKAC 2GA4B 1D6EC 5K36H 2EDGA 1B3AA 4RA8A 1GUGA 4U673 2WXHA 4HN7A 2IWHA 2FMMA 4XQQA 2PCFB 1JQYD 4ABNA 1S5ED 1CT1D 1RTOA 5AUIA 2VXWA 1AWDA 1QNKA 5IT9E 4A3FB 2WNMA 1SYFA 3NTKA 4C7ZA 1A2UA 2E76C 5AFWA 1WYGA 2M9VA 3I3CA 3GB1A 1DXMA 2WACA 3Q69A 3IL8A 4KKIA 1PZID 1BCPD 4WQMA 2F0MA 1RM6C 2WXNA 1U4MA 3VR9B 4OZBA 4K5WA 3KLRA 2VZKD 1TS5A 1IGCA 1VMCA 3WDNA 2K6AA 2BW2A 1DM0B 3WOEA 3NXWA 2B39A 1PTOD 4NW2A 4DU9A 1M4VA 1HEZE 1PFBA 5FO7B 3U9OA 4H44C 2JA6B 4J3OD 5EPLA 4M8AA 5M9OA 4DN4M 3J80L 3NTHA 2XVSA 1CHQD 5K36G 5D3DA 3M3YB 2JA7B 1FFVA 3R8BA 3A8JE 4G4KA 1RYJA 4GLSC 1CZPA 1QLBB 1WTVA 1KLGD 1A6XA 1XF5L 5CC4A 2ID0A 5ELFA 1Z6HA 3DXJC 2WXOA 1STAA 1FCCC 5BN3A 1VLBA 4HEDA 2JSVX 5F2DA 3VA7A 5D14A 2WU5B 4PT5A 1KH0A 1QOGA 2HQEA 1RHPA 3ZJVA 2LUMA 2F0HA 1TWFB 3NBIA 3H0GB 1TQOA 4A3EB 4JPSA 4ARCA 4KK7A 3P20A 3IAM1 4IDIA 2RA4A 1F2MA 3NQTA 1FRRA 4M0WA 1GUOA 4ZYSA 3LWUA 4FF3A 4IURA 1Y8OB 2EE1A 4PMWA 2HDLA 5G5GA 4K2LA 1ZXTA 1Z47A 3B2FA 3C2PA 2INPE 2ZT9C 4QUFA 2FBWB 3AM9A 2K9XA 5DM73 3IKJA 1F9PA 4K6DA 4A93B 2F3VA 3TP5A 4C1NK 4NAWB 4EE2A 4JE3B 1ONLA 3PV0A 2HCCA 2QEJC 5EBDA 1PXUA 1V1OA 1PYWD 4ARIA 3TSSA 1Q3LA 3AEEB 3N9YC 4H7BA 4US8A 1T6BX 1RFKA 2F0QA 1C8CA 1MD2D 1TKYA 4NKLA 3U52E 4XWTA 4WFN3 5HI1A 4CJ0B 3NVYA 4C56C 1BUIC 3NE5B 3NUHB 3I9V1 2KACA 4C3IB 1UUPA 4DAVA 1H9RA 2JX5A 4XXEA 3HS0C 1FFUA 2F0KA 3AMUA 1L4ZB 2X6LA 1F2YA 1JWSD 1TU2B 4HKQA 2R3ZA 2M2LA 2DBYA 4S3SA 1U4PA 2MPMA 2F0FA 3SE0A 2I2YA 2AX5A 1FCLA 2N55A 4A6QA 3HEJA 3C46A 1FR3A 4HCEA 5E1FA 5FO9B 2ON8A 2E2IB 4DNTB 2D5DA 1ZXIA 1T5XD 3DUZA 2VB2X 1T5EA 4A3KB 2Y5PA 1EWHA 1PFMA 2J42A 3J9CA 1BMLC 2EYLA 3A7LA 3T3OA 1SAPA 1W6KA 4F88A 2FE8A 3V05A 2XWBB 1C4QA 3GQBA 2JSOA 3TDQA 2KAJA 1V43A 3CU7A 1PMRA 2B2WA 2E74C 1AP0A 1YQ3B 5KNBA 1FEHA 2AWOA 2ENBA 3HOZB 4OIKA 3BDCA 4DQOC 1D1IA 1LT4D 4L1BA 2ACZB 4R9WA 1C48A 1SYBA 2HDEA 3I72A 2O5IC 4ZRZA 3KWVA 2AQ3B 3T53B 1CTMA 2L52A 4BBRB 4WH4A 1OO9B 3EQLC 2CJNA 1PGXA 2RDFA 4YT0B 1KTKA 4D2KA 1ET9A 4RAUC 4CKBA 4K2KA 3LNNA 3L7ZC 2F0TA 1PFDA 4RH6A 5HG2A 4N9TA 2WDRB 2R7ZB 2V0GA 3MHBA 2BA0A 4BS9A 5JAVA 3SR6A 3CQZB 3W5UB 2A68D 5CV5A 3K5LA 1LTBD 3UI2A 1QE6A 2FMCA 2PNRC 2IGHA 4L23A 2L5TA 4KHVA 1ZDXA 3QOLA 4WIPA 4USAA 3DM1A 1JC7A 1I4QA 3I90A 1G6ZA 1XLQA 5EE1A 4WRDA 2PPBC 2LFNA 1QJOA 2IL8A 4KY7A 5E4WC 1EU4A 3AEGB 4DAYA 5C4HA 2MHVA 3DWMA 2QCPX 2F0VA 2KWDA 3V3XA 3HOUB 1B9MA 5E6JA 3CRLC 1JALA 1C76A 2MGSA 4BBSB 5FO8B 1I4RA 1Y8NB 5LHY1 2CU3A 1L6VA 2AQ1B 5IT9L 4NJCA 1YNND 3W1SA 4A3DB 3CKIB 1CJEA 1B53A 3A55A 2YYZA 4MIUA 1Q10A 2LFIA 4A8XC 3FC4A 3MEHA 1FM0D 1M8AA 1HXYD 2Y3AA 3DHQA 2K32A 1XYIA 2RDGA 2IDYA 2A69C 4HJGE 2LHDA 1AN8A 2E6XA 3K0YA 4B0MA 1Z7TA 5LL6X 5EBCA 3V96A 4XE0A 2PZWA 4C3JB 3PIP3 3P4QB 4PNYA 4C80A 4ZOHC 4QF4A 1B1ZA 5LNK1 1VF5C 2I07B 2F03A 4FF4A 1WXQA 2WKCA 3K58A 1R4QB 3I4NB 3EA6A 4IFDH 1HPCA 4TSSA 1B2TA 1O7YA 1YJJA 4RKBA 3K7AB 3VRAB 3SK6A 2F4IA 1LLRD 1E2VA 4HR7B 3AB9A 3W3AA 4ZAIA 3HG9A 3SK8A 3ZQ4A 3HZXA 3WCQA 1MSGA 1SMYD 1TVXA 3A7AB 3DEPA 3NS1A 4P16A 1S5BD 1U9RA 1F9SA 4PV1C 4BWGB 1IGDA 1KABA 2F0LA 2SNMA 1EY5A 1TY2A 2MUYA 2GB1A 1MI0A 2N0SB 2R93B 5A35A 3SR1A 2J7ZA 1STHA 5BMIA 1D5ZC 4IFDI 4KKTA 3OHXC 3EUB2 2Q8RE 5BMGA 1KNAA 2YEPB 3PIO3 1E0BA 1GHKA 5JPMC 1QOHA 1OXXK 2CJOA 4QUCA 5KYIA 1VDVA 4Q0FA 3NVVA 5CGKA 4MN3A 2EY1A 4C2MB 2EXZA 4RHRA 3TBIB 3HRZC 2RMMA 3EVQA 1HCZA 1SXTA 4G57A 1PRTD 3DMUA 2H89B 2K22A 1NEKB 4N59A 4IFDG 5I2YA 3OWFA 2W54A 1K8MA 4KV6A 1I6VC 3TMEA 2R92B 5A2QL 5MPOA 4TKOB 2EYJA 3P1HA 3EROA 1A3UA 1F77A 5M5WB 3TZUA 3L9AX 3ZYYX 3GP7A 1A15A 2I46A 1LABA 4MM3B 2EKIA 3Q8EA 2K01A 2H1EA 3FVQA 4ZK9B 1N5XA 4ZRPA 3HP3A 2DYOA 5C5LA 5FLXE 1GUNA 1BXTA 2C9OA 1J8IA 4HMJA 2F0DA 1TS2A 1ICWA 4EGVA 3AV8A 2F3WA 2FHTA 1LV9A 1WWTA 4CQNA 2YEPF 2NVXB 2WXQA 1A70A 1O7LA 3J7AV 3S2DB 5M3MB 4XT1B 5IIFA 2LHEA 1EY6A 1Y8PB 1GAQB 4XDXA 1SIJA 2NBFA 1EY4A 1HRJA 3W9CB 1WD1A 2J0TD 3HGBA 1E10A 1SSNA 2NB0A 2WDVB 2QSDA 1JB3A 4G7HC 3ITPA 3VYRA 4ULLA 1EYDA 4KGTA 3DWAA 4A90A 4K8IA 1PRTF 1TWGB 5C3EB 3DEOA 1EWYC 1FXIA 1DGJA 2HDMA 2RVLA 4AYBB 5C0XJ 1TZOA 4O42A 3G6JB 3IAYA 5ELEA 3E9SA 1DOXA 1GB4A 5D65A 1ESFA 2PW9A 1ENCA 1XXGA 4H2AA 3MTSA 2E2HB 3TEZA 2J53A 2NZ1D 1YNJC 4XDDA 1WTXA 5BMHA 2KHSA 2AUKA 2K5QA 2RQXA 4XQJA 1TS3A 1QB5D 1QQRA 1QKZA 2KMMA 2F0SA 5KGUA 1D4BA 3HUIA 1HTLD 4DF7A 4DK1A 1R9TB 2BB6A 1TWHB 4FVMA 5IGDA 3BVGA 4RGOS 3TP8A 4KJOA 1NENB 2PIAA 1HUNA 3P1MA 3BS1A 2WLBA 4JWUC 4HSPA 3S1RB 2D62A 2RBMA 2RPVA 3CIRB 4ZHPA 1MI2A 2WXFA 2KVMA 2CHBD 1YQ4B 3AE8B 2LKVA 4DA2A 5C3XA 1LO5D 4CJ2C 3S1NB 1EY7A 1SNQA 4BY1B 2E2DC 1PGBA 3C3LA 3NVWA 2L4NA 2KQ4X 2Y0SB 1KRHA 3NPPA 2BE5D 1L6UA 1PDXA 1RTNA 1SE3A 4YTMB 1EIGA 2W3SA 4XIGS 2BDOA 2H4OA 4WAFA 5C3WA 1EM7A 5KNDA 1GJXA 4A3JB 1SYDA 1DCZA 4O1NA 4LK0M 1FIQA 2ICIA 2BOSA 1Y69U 2NTTA 4HROA 1HHVA 2O5JC 2O4XA 3BYTB 2QJLA 1EEID 2WXPA 4FF1A 2HUGA 1AW7A 2G1EA 2FINB 3VR6A 3LXFA 2MJ8A 4RCNA 5IGCA 3PZ7A 2O2LD 2IW3A 1N63A 1IUEA 2NTSA 2JYTA 3QIAA 4MACA 4FXKC 2F0UA 1MVKA 3GD7A 4YSZB 2PZTA 4X3TA 3H09A 2PW5A 5KRUA 3GTJB 1SF0A 1PTOH 4A9AA 2WS3B 2Q5WD 1DOKA 3AEAB 3DWGC 2OEDA 2L55A 1G2SA 2L11A 2ZW1A 2W3RA 1CK1A 2F0WA 5KIXA 1C78A 4ZHOA 4PMBA 1SDFA 3AB5A 2XSCA 4KJNA 2X38A 4NAMA 3Q8AA 1JR0D 2A6HC 1UWMA 1VZ6A 1ZE3D 3PO2B 2HTME 4OZCA 2BB5A 4CBVA 1KF6B 4QMGA 3HOXB 3BDLA 1ZYRD 2GI9A 1EU3A 3O13A 3HKZB 4H13C 3FILA 1SB3C 5C4JB 1SNCA 4BA1I 2OHFA 4OVZA 3B9JA 3TEWA 3T3NA 1IYUA 2CW0C 5DNFA 3FILB 4B08A 2KEEA 4GDLB 2K05A 1H9JA 4FNFA 4OL7A 2LMCB 1IW7D 1AEXA 5ELCA 1SJHD 1PFNA 3KWLA 2EJFC 2B8FA 2B63B 1HTPA 3GTOB 2FFKB 5D7GA 4I7ZC 4KGRA 1E9MA 2KJXA 4KX6B 4B9WA 1CFMA 1FD7D 3U9SA 1CZGA 1QCBD 2SOBA 4IUVA 1LTTD 5M5YB 3HOVB 3C8YA 3P4SB 5T8IA 4ZUIA 1TS4A 3MJ5A 1TY0A 4JWSC 2QDBA 3OIQA 1O7ZA 4K6LA 4PQXA 4RHSA 4DGZA 4DK0A 1JOQA 4LAAA 3I91A 2L83A 3W5VB 3QWNA 2KOLA 1S5FD 3J81L 1AYFA 2PVOD 3A56A 2WXLA 4RKLA 1EQVA 2VB3X 3MA2B 1RJTA 4XDCA 4L63B 4HCSA 2DWQA 2WB1B 2F0OA 2SEBD 2A6ED 2OT2A 2DY7A 1I6HB 5JPNC 1P7FA 5HFYA 5CV9A 3MXUA 3NZ3A 4KGSA 3D31A 3T13A 3K5NA 4OHJA 4OGQC 1I7HA 5CBAE 4A3IB 4KKUA 3HVDA 2IGGA 3NBHA 1TKGA 5NUCA 3J7AF 3SK5A 3MFGA 2M19A 2F0GA 3N6RA 2IPKD 1K52A 2W82A 3K5MA 3FEWX 1GHJA 2PKOA 1JE4A 1LT5D 3SK4A 2KUMA 4NZLB 2B2UC 4B0EA 1HA5A 4HKZE 1YN3A 2A5HA 3URYA 1JWUD 3QO2A 4DNRB 2Y5CA 4QIWB 3LB8C 1I4GA 4WJWA 3ABVB 2OEOA 4TMAB 4XT3B 2V4DA 4IUQA 4R8IA 4JBWA 2AUJD 2WP9B 3Q8CA 4DXFA 4DFAA 4MT5A 1P7EA 1A2TA 1LACA 3AEBB 3MFYA 1Y1VB 2Z4IA 3R3OA 1JORA 3NP8A 2JA8B 4X3SA 1BR9A 3GS2A 1BDOA 3BWUD 3F2UA 1UAPA 4ZUJA 1QT9A 3IT6B 1IKMA 4XTCS 1MHXA 2VUMB 3MC0B 3H8HA 1VR9A 4X3KA 1J7CA 2JWUA 1EIHA 5EKIA 1ZUD2 4N9PA 3E5SA 3FMCA 3K5OA 2L0CA 1BCPC 1AZQA 1D1KA 3S1MB 2JU6X 2BBCA 3S16B 1TT2A 4ME5A 3CWIA 4QCLA 2PZUA 2BDNA