1FNVA

Structure of streptococcal pyrogenic exotoxin a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster.
pubmed rcsb
molecule tags Toxin
molecule keywords EXOTOXIN TYPE A PRECURSOR (ALLELE 1)
total genus 43
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fnvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fnvA02
1SEBD 1PRTB 1AW7A 1V1PA 4RGTA 1PZKD 1JCKB 3CHBD 1FGBD 1I4GA 1PTOF 2TSSA 1PTOC 1RCVD 1SBBB 1LTGD 5ELFA 1EU4A 1I4RA 3BVZA 1HXYD 1SE3A 1FD7D 1EFID 1LLRD 3BZDB 2G9HD 2WV6D 1JWSD 1XTCD 1B1ZA 1STEA 5D3DA 4OHJA 5TSSA 1LTID 1CQVA 2IPKD 3R8BA 1L0XB 2QILA 5ELEA 1RDPD 4ZYSA 2IJ0A 1JWMD 5FKAC 1LT6D 1KTKA 1KLGD 5D3IB 3EFXD 1EEFD 1CK1A 3O13A 1I4HA 1I4QA 1LO5D 1V1OA 3BYTB 3R2IA 4TSSA 1AN8A 1S5BD 2O2LD 1PTOH 1F77A 1BCPB 1UUPA 2J4XA 1I4PA 1V1PB 1FNVA 5ELCA 1LTRD 1G8ZD 4L63B 1JR0D 2Z8LA 1ENFA 1EWCA 4UDUC 4Z9CB 3SEBA 3BVMA 3URYA 1B44D 4DXGA 2QEJC 2XN9C 3MC0B 2NTSA 1PZJD 2AQ1B 1CHPD 1BCPC 1MD2D 3MFGA 1SJHD 5ELBA 5FK9C 3OWEB 4K6LA 2SEBD 1SJED 1FNUA 1TS3A 1LT5D 1KLUD 1S5CD 1XXGA 2AQ2B 1YN3A 1TS5A 1PRTF 1TY0A 4DXFA 2NTTA 1ET6A 3EA6A 4L6TB 2ICIA 4RHSA 1SE4A 1TY2A 5ELDA 1ESFA 1PZID 1TS4A 1EU3A 1LTTD 2RDHA 2XRQD 3R2TA 3BYYB 1LT4D 4O1NA 1ET9A 1LTAD 1PRTD 1T5XD 1BCPD 3KLSX 4BWGB 1QILA 1PTOD 1I4XA 1PYWD 1YN5A 1HA5A 2XNAC 1BCPF 1JQYD 1EEID 3GP7A 1DYQA 1M4VA 4RGMA 3BVGA 1DJRD 2R61A 1FNWA 3DWAA 4C56C 1LTBD 1S5FD 4NZLB 1D5ZC 1RF2D 3W2DA 2RDGA 2AQ3B 1HQRD 4RCOA 1SXTA 1JWUD 4RGNA 1S5DD 3TSSA 1HTLD 1BXTA 4RGOS 1CHQD 1D5XC 1SE2A 3DWQA 4RHRA 2XRSD 4RFBA 1LTSD 1D5MC 3DWPA 4RH6A 1PRTC 1YN4A 1CT1D 5I4DA 1D6EC 1RD9D 1GOZA 1S5ED 3V05A 1UNSA 1LT3D 1TS2A 2CHBD 1PTOB 1L0YB
chains in the Genus database with same CATH superfamily
2O2VA 4P75A 1BBUA 2K5NA 2OTJA 1AW7A 3V2TA 1QUQB 1FGBD 2R7FA 4MJSB 1QG7A 4YCVA 4JWSC 3GTOB 2MQJA 4DKAC 1B3AA 4JBKA 1NYQA 3FILA 2RGFA 1XYIA 1C77A 1HNZL 1XT9B 4XTCS 1P0RA 1BT0A 3Q8BA 5LXHA 1A63A 2K8CA 1VQ6A 3VR8B 4JOIC 4WWMA 3I70A 3UE1A 4B9WA 1B2TA 1TKYA 5J1ZA 3GTQH 1CI3M 2JWZA 3I63C 2F4VQ 3HOWG 3NS1A 2CJOA 2OJRA 5I2YA 1II3A 3K7AH 2N1WA 1SYGA 1A70A 2UUAL 2Y5PA 4ICVA 1QF6A 4RKBA 3STBC 1PH5A 3S1MH 3AE4B 4X3TA 3R2IA 1V1OA 2QF7A 2ZVOA 2IY0B 5EE9A 1OXSC 3TL5A 2K5DA 2DN8A 3BWUD 2YV5A 1LTRD 1ZDXA 3CU7A 1ENFA 2F3VA 4CJ0B 4K5XA 4DV2Q 4RCNA 1UZXB 2J0MA 2YYZA 3S17B 1R4PB 2KWUB 3SR1A 3T3NA 1KD1C 2YTXA 3RNUA 3U30A 3W5VB 4UHVA 1SMYD 1JOQA 2AKWB 4ID6A 4XWWA 3NZSA 3AE8B 1TWAH 1WJJA 3OTOL 4A3LG 1DD2A 2MBQA 3APFA 3MZ5A 1FNUA 2PMZB 3X0WA 5A2QL 3WWVA 2QEXA 3S1QH 5I6YA 3DHHC 1I3QB 1ZXIA 4P7IA 4KSLC 3K6OA 4DUZL 4DR2L 3CCJA 1MHXA 3DBSA 2LASA 2JZPA 3OJ3A 4XX5A 2CKZB 1C7YA 3OMCA 1EY0A 5JOBA 1ESFA 4DDID 3QB3A 3U50C 4HJ8A 1E24A 3KYHC 3J80E 1XPRA 4EZKA 3L3OC 4LJZC 2E8GA 2L55A 5L83A 3KLSX 4A3OA 2X38A 2B63H 3CF6E 2AUJD 1WJ6A 4JI4Q 5HHDG 4GB9A 3O65B 2PQAB 2PZUA 5IY0A 2F0QA 1H9SA 1Y14B 1WTVA 2WXJA 3GP7A 3K80C 2UU9L 1EM7A 1NR2A 3EFCA 3W5OA 3MXPA 3FHWA 4EQ5A 2Z6KC 1VZ6A 3H7SA 3Q3NC 4YSXB 4JI7Q 3PUXA 1DJRD 2E2HB 3GTGB 2B29A 1WFQA 1PGAA 1H9MA 4LJPB 1S4ZA 1ASYA 5E6OA 5IP4D 1I6HH 2Z6BA 4LF8Q 3NBHA 1A8VA 1I3QH 2Z1CA 5C3WA 4ICUA 3TSSA 4BY7G 5I9OA 2PW7A 4A3EH 4EGVA 4WWNA 4HEA1 2NCNA 2IT1A 4JPBW 1E2VA 2KLCA 1LTSD 4R4TA 4HK2A 3Q14C 3J80c 5GAEC 3VR5A 1I50H 4DR1Q 1WR6E 4B0EA 4AJWA 1OQYA 3EUB2 2YEPB 1C0AA 4DUYQ 4K14A 3UGBB 2WKCA 2B2UC 2NBFA 1FM0D 4L23A 2BH8A 1VQPA 2RF4A 3QR8A 2A68D 2GOWA 1PZKD 1NMGA 4R9WA 4HPPA 5C4XH 5IODA 1E9MA 1EO6A 4DR6Q 2NBVB 2L3ZA 3DPDA 2NVQH 1TIFA 4O0AA 2LXCA 2ZT9C 3OIPA 4JBWA 3L08A 3AE6B 4KD4A 3WANA 1TWHH 3ZNID 3HP3A 1HXYD 4M02A 1L6VA 2A68C 4HCPB 3Q22A 1B9MA 4BKSD 3HG9A 2LFIA 1RKNA 2OEOA 3NY5A 4IZ8A 5DPWA 2E6XA 1KABA 1R9TH 4OWTB 2IPKD 2GBKA 1G6JA 3R8BA 1O80A 4B9XA 3IFWB 4H13C 3VDYA 1KLGD 3BDLA 5IYBG 3K58A 2JA8H 1EOTA 2NZHA 1EEFD 5C3EG 3K0YA 1EUJA 1PGBA 1E5WA 5GAHC 4JI0Q 1E6EB 3DEOA 1XD3B 4GSWA 3E9HA 2A6EC 3FRPB 3NK9A 4TKNA 4KY6A 5E6PA 4N9TA 2M1MA 1WD1A 1VQMA 2VZAA 2K0PA 1IKMA 1PH7A 1JQ4A 2F0WA 2KEEA 1VQ8A 1EWHA 2DUDA 2KQ7A 1FGUA 2H4OA 2IO0B 3MP9A 2K01A 3VH3B 1BCPC 2RSNA 1ENCA 4GNXA 4DV7L 4ZOHC 2GLSA 3UQAA 3R93A 2NR2A 3H6MA 2K1BA 4OGQC 4JI1L 2JQOA 4MGIE 4LW1A 2IO2B 3N1ZC 5IOIA 1IZ6A 3UIOB 2NB0A 2CJNA 2WYQA 3G7LA 3KF6B 4DA2A 4BXXH 2UXDL 1NSNS 4HPLB 2EXDA 4DXFA 2IHEA 2A6HC 4PZ8A 4ZKCB 1WGGA 4XWTA 3KOJA 3KVFB 1VQHA 5FLXL 4P71A 2E2JH 3TP5A 1NI2A 1GG3A 1U4LA 4G4KA 3VYRA 1TTNA 2JSVX 1FEHA 4KVGB 4K1RB 1LTTD 3H09A 2V4DA 2JYOA 1X6OA 5JXVA 1C9OA 3HOXH 2VB3X 1ET9A 1L0WA 1I7HA 1L5PA 4LDTD 2I1JA 1XLPA 4GOPB 3VYTA 1H9RA 4IUTA 2AWOA 1IPGA 3B1LX 2FMMA 3CQZH 1BCPF 3HOWB 3ALBA 4I7AA 5K36G 3AB5A 2JP1A 2LZ6A 2E75C 1Q12A 4WIPA 3PGEA 2OXPA 2DWQA 2ZW1A 2KK8A 2V3PA 1SMYC 1EWIA 3U9OA 3TS0A 4LNKA 3EQLC 1Q1OA 3W2DA 4PS3A 2PQEA 2CFMA 4MTKA 4AH6A 1N9WA 2KDIA 5E1FA 5J17A 1HR0L 2XEWA 1YIWA 3RYTA 4CDCC 1NTGA 4RGOS 3CCLA 1SRUA 2QIEB 3A4RA 1JMCA 2XK5A 4LF6Q 5G5GA 1WGDA 2JYEA 1L7YA 4JCVE 1D6EC 2ASBA 2DAFA 2JXXA 3Q8CA 4MM3A 4ZHOA 1UWVA 4NMZA 2FFKB 3RPFC 3OMGA 2EY6A 2ZJPA 1Q82C 4FF2A 3I4MB 4YHHQ 3GQBA 3RN9C 3ZXVA 3WIMA 3P75A 1IYJB 2H1EA 1L6UA 1IYUA 3S1RH 1L4ZB 5BN4A 2UXCL 1I4GA 1WTPA 2C5LC 1WCMB 1YHQA 1KRSA 1VS0A 2MO0A 1WTXA 1GM5A 1N32L 4KKJA 4NNJB 1HTPA 4DAVA 1K9MC 2BGFA 1VQEA 3AE5B 4WJ3M 3LXFA 1GJZA 2O6VD 2HCCA 2LS01 2C5CA 1CA6A 2VUMH 1B1ZA 5J3BA 5IGFA 2A19A 3DHQA 1IL2A 3HOYG 2IY5B 2B2WC 2ZVNA 4IOIE 4DDGD 1WM3A 1B8AA 3KF8A 1BBWA 4KTAA 1T5EA 2D3CA 2PE9A 2WB1B 1IYVA 3RZOB 1BUIC 3GTMB 3EFUA 4DK5A 3PO3H 1EIGA 2JEBI 4A6QA 2XVSA 2DLBA 4L8JA 3DBLI 5EAYA 2PZWA 2MJ3A 3CPWA 3ZDMC 1V1PB 3C46A 2UUCL 4Y7NB 3P4SB 3FC4A 1S3SG 2R2OA 2HJ1A 2LMCA 4DXGA 4REZA 2I5HA 2RCFA 3I5JC 1PZJD 1TJEA 4IM0A 5CBAE 4MSQB 1SROA 1G6ZA 1QOHA 3VTWA 1L4DB 4RAUC 1E8ZA 4FHJA 4MACA 2B2UA 1C48A 1UWXA 2KAJA 5ISRA 2KX3A 2AMCB 2LI5A 3JW0X 3I4NB 1LYLA 3AEGB 2EKEC 2AWNA 2W55A 2IX3A 3UF8A 5M3FH 2F3WA 4EKUA 2DYMA 1ZXTA 5IYCH 4X65L 2KLGA 4H0LC 1JWBD 3FEWX 4QIWB 1TY2A 3H9DA 3RZDB 2VL6A 4R8NA 1C4PA 4V190 1P9DU 2JU6X 1H95A 4DWFA 4G7HC 3A1QA 2XRQD 3G48A 2C9WB 2QCZA 1LT4D 3G4SA 2BCOA 4M0WB 3T51B 1WX9A 4Y7NH 1MG4A 1ICWA 1UWMA 1I4XA 1KHIA 1E2WA 3Q3FA 3QHTA 5EQ0A 1P7FA 2WXPA 4LJOB 4JI1Q 2N78A 3MWYW 4GKKL 2K32A 2R7DA 3OSOA 1GAQB 3QA8A 4I7ZC 1R9TB 1YBYA 4GLXA 2V3NA 2JVCA 4XYCA 4C1NK 1FCCC 2B2TC 1EIHA 4QCLA 2MX2A 4HCEA 1QOBA 5MPOA 1YX6B 2KEDA 1PXUA 5C3JB 2CW0D 1X65A 4I6LB 4GLAC 3TDQA 3S2AA 4FXDA 3SHQA 1VF5C 2EY5A 2CWAA 2L12A 1XNQL 1SFOB 2KQSA 5E4WC 4IPCA 2RR9A 3DWPA 1YN4A 3OJ4B 2W3SA 5DAUA 3DEPA 5I4DA 2JA7B 4NB3A 1VCBA 5C5LA 2JYTA 3HFZB 1LT3D 1TS2A 2CW0C 3DOWA 3KUDB 4DR7Q 2EE1A 2KANA 2Z9HA 3A55A 1KNEA 4P16A 1C4QA 4JI6L 4C3JH 2RSUA 3S1NH 5EBCA 4RGTA 3H6NA 4LWCA 4ILWA 1F2RC 2MBHA 2JUOA 2K05A 1X54A 1WM2A 3RUZA 1QNUA 4HSVA 3HOZG 1TZ1A 5M5XB 1E8WA 4BY1G 5JH5C 1JOKA 1QCBD 2VB2X 1A0IA 1M1KC 1VQ9A 4UY8C 1FR3A 2NN6H 4DAPA 4A3GG 1WYGA 3AE3B 5KEEA 4KDLB 2F0FA 5HY6A 5M3MB 4IFDJ 4IN3A 1F9RA 1RM6C 2LXKA 1VRAB 1EY7A 2WXIA 1NBFC 1LTID 1AE2A 5DCNA 5J39A 3DMUA 2QILA 1RDPD 4A3JB 3ZKJC 3TIXA 1CKMA 3CCRA 1HEZE 4ZRPA 4DR5Q 1EY9A 2E2IB 4GOCA 4DR3Q 4DR1L 1QQRA 4B3MQ 1X55A 1F2RI 2WXMA 3ZLZA 4FA6A 3TBIB 2WX1A 2WHIA 4CKCA 3S24A 3RMKC 2Y5BB 3SK6A 5IWAL 3BY4B 4EE2A 2FCNA 1PH4A 4HN7A 1ZP0B 3P2BA 1O78A 4V0BA 2F1MA 2DZJA 3MC0B 4PV1C 4DR6L 1G2TA 1RYJA 1WJUA 3L54A 1XCQL 4CQNA 3S16B 3PTFC 1U4AA 1EF1A 2G1EA 2JRIB 3M63B 1IBML 4NW2A 2MBOA 2KWDA 3QCAA 2MP1A 2JA7H 4JYAL 5JJLA 1Q81C 4OZBA 3CCMA 1Q46A 1B53A 3MEHA 4RMFA 3A74A 5G3LD 3WOEA 3DVGY 4JI0L 3AH7A 3IG3A 4K81A 1TKWB 1HNWL 4JG2A 1PYBA 2L11A 2MJEA 2FIDA 3M9BA 4HEDA 2KTRB 4FXGC 3VR6A 3QK0A 4DHJD 4IM3A 2A5UA 2JE6I 1NAPA 3TZUA 1RHPA 1HNXQ 1CA5A 3GE3C 5CYUA 3PRPB 1PTOD 4PK1A 1XMOQ 1PFNA 2WB1G 2OQ0A 4JI4L 2LUMA 4DV7Q 2MWSB 5HURA 4DFAA 4ZAIA 2K5VA 2ATWA 2INDC 4KGRA 2RHSB 2XSCA 1Q10A 3DWAA 4L1BA 2SOBA 2JZ3B 4LF5Q 5IN7A 5C0XH 1FD6A 2EPBA 3VAWA 1SXTA 2K5PA 2M0AA 2X8XX 2F0VA 1SNCA 2WWZA 2L9HA 5AZFA 2R92H 4F87A 3W1SA 4RFBA 3RD4A 4B3SL 2J7ZA 1R4MB 4J6IA 5CV8A 2KN4A 3FKIB 4L5TA 1SNQA 2IO1B 2B8FA 2WLBA 2Y0SB 1IL8A 1STHA 4DAMA 5IGBA 3LX0A 1Y1VG 3RZFA 5FLXE 2LGYA 1TWCB 2A5HA 1V1PA 4R8IA 1IHZA 2HQEA 4LFCQ 2WAQE 4DK0A 1YNJC 3UDGA 4K5VA 2C60A 2L52A 2TSSA 2EZVA 2MBBB 4NJCA 2PI2A 1FJGQ 2UXBQ 4DV2L 1CFMA 4IC7B 3RFZB 4A3EG 5FOBB 1V86A 4G11A 4BBRB 3RNFC 4C1NI 1ESRA 2JK8A 1PGXA 4X65Q 4YY3Q 2N8NA 3PO2G 3RNEC 3OOCA 3Q8DA 2EELA 5CHFA 1GKHA 3AFPA 3NWSA 3A1QB 2WXQA 2K8BA 2G3QB 3W3AA 2Y5CA 4XYQA 2KWCA 4IM2A 3VUWA 3Q8EA 5AJ3Q 1LUZA 3BJUA 4FXKC 1GC7A 3WA0A 4A9AA 1K53A 1MSGA 3IVFA 2Q2IA 3C2PA 4K8JA 1FYCA 5GAGC 4WJWA 4QGUA 1QOFA 1WX7A 2L5TA 4IOCA 5G55A 4DN4M 1LO5D 1EQRA 2PJHA 3U2SC 3ZIMA 3P63A 1BCPB 1X32A 5I2XA 3P20A 4PT5A 1S3OA 4CHTB 2Z8LA 2NVXB 3S14H 2NBWB 3PV0A 1HZBA 4BKGA 1DXMA 2WQYB 4K3CA 2K33A 4ME3A 1TWFB 5EDSA 2NTSA 1YD8U 4JBJA 2YU9B 2Q8RE 1RTNA 3PZ8A 1STYA 5C3XA 4AP4C 4KGSA 5ELBA 3ZO5B 4LFAL 1RAXA 3RD2A 2JA6B 4JI8L 4GNXC 4CDFC 4KHPL 4CO7A 3OHXC 1LT5D 4KDIC 2M9VA 2D0OA 3NVYA 3UDFA 3GO5A 2WU2B 3TS2A 1TY0A 1D7QA 2LGXA 3Q8FA 3K5NA 4BBRH 3ULPA 4DHZE 3H94A 2K1FA 1W2BA 4DNIA 2DZIA 4Q2JA 2NVUI 4MIUA 3X3NA 1JJ2A 1V5TA 3WAPA 2EMTA 1I6VC 2RSOA 2UUCQ 4NQKE 3B6YA 1NJIC 4KN4C 3SK4A 2D2CC 2D62A 2XBBC 3K7AB 3L13A 2A6HD 1XWEA 1VZ7A 1L0VB 2EDGA 5CHVC 4C3JG 3S17H 2DZKA 4FBJB 2B39A 3DBHB 1DYQA 1FVIA 1UEBA 4IUUA 1CZPA 2AYOB 1E10A 5EGTA 2KENA 4AIMA 1TBEA 2N49A 1JROA 2F0TA 2D9UA 3H8HA 2KKCA 2MUYA 3KF6A 2EYPA 4CKBA 2K75A 5BN5A 4W9GA 1K0SA 2AQ3B 1UE7A 3PHXB 4OEMB 4N59A 2WS3B 1IBXA 3DWQA 4GDLB 1UBQA 2VH1A 1MPEA 5CR3A 1F9JA 5GMVA 2JXMB 4XC2A 4IUQA 1RODA 1WCMG 4X3SA 3S1QB 4KZCA 1FXAA 3TREA 5HKHA 3PIOA 2VXWA 1SYEA 2GBJA 1QVCA 4EVOA 1R4QB 2HDLA 1C79A 2IO3B 2ZW0A 1IYFA 4B08A 4A3GB 1TGZB 2GBRA 1AFPA 3ZRCA 1P16A 4BY7H 4XQNA 2R6GA 4FF4A 2MEKA 1F1HA 2YTVA 3NVZA 4OL7A 1M94A 2YEPF 3CP0A 4B3RL 3P1HA 2F0IA 1C4CA 2DENB 2EYOA 1SE3A 2HCIA 2RHQB 4JI3L 4CJ2C 3MVVA 3M85A 1VQLA 1FFVA 1LLRD 3DCGA 1B9RA 3I9V1 4CHKA 4JBMA 1K51A 4HDQA 5HG2A 1EY4A 4LCDE 4LFBQ 4E3CA 4K0KL 2G4DB 1PA6A 2DY8A 3KQ4A 5AEKB 4JW0A 4ZQ3A 4K5WA 4FF1A 2JA7G 3HOUG 3ZQ4A 1V43A 2IJ0A 3ONSA 4OZCA 4DXAB 2I07B 3DBRI 3L17A 2FUG1 1B70B 5D3IB 4IKGA 4X64Q 4P6VF 3J7AV 2PNRC 5EPLA 2O2LD 3TEYA 1EY6A 1RRBA 2DYOA 1F77A 4RA8A 5JJKA 1NDDA 2BPSA 2MJ8A 1G8ZD 1N34L 3AU4A 5C44B 2KFJA 4BZAA 1RWSA 2QSDA 4LF5L 2KCMA 4NXMQ 2UXCQ 1VJKA 4GKJL 4ZYNA 4HAEA 4FF3A 3NZUA 1JB3A 4MT5A 5IGCA 5EE1A 5IT9L 5IYBH 2JA8G 2PZTA 2J42A 2BKRB 1L2FA 2GMIC 3OWEB 4K6LA 5KRUA 2NVYH 4NXNQ 3PO3G 1FFUA 1NENB 2Q8IB 5J18A 1ZPSA 2LRWA 1CSPA 3W1GA 1SN8A 2B2VC 4POGA 3E5SA 2VUMB 1HZAA 1J7AA 2INCC 4F88A 1WFYA 1NBWA 2L15A 3MC9A 3TMPB 4IUMB 1TU2B 3I4MH 4L6TB 1TKGA 5ELDA 3IL8A 3QOLA 4A93G 3I72A 1KJTA 5CGKA 3H3VC 4DR3L 1GHKA 2KDFB 4EUTA 3I4NG 1SYBA 1OTCA 5JPMC 2EJFC 4ANVA 2WAQB 2JA5H 1R4NB 5C3EB 1A6XA 4HCNB 2YU9H 1EIFA 1C4AA 2N7EA 1WOCA 1Y1WG 3NUHB 3UQBA 3GTQB 3B2GA 4JV5L 4IPGA 2R93B 1VZ8A 1WXSA 4XQQA 3D0FA 2BE5C 4HMIA 1Y8NB 3EROA 2WXHA 3ERQA 2FE8A 3L7ZC 4DQOC 4RCOA 2PMVA 1JWUD 1QJOA 5JJIA 2PKOA 1U4RA 4IO9A 2Y3AA 5M5YH 3AE2B 3E3XA 3D8GA 1VD2A 5D7GA 1D5MC 4DK1A 1RFKA 1P8LA 1WXMA 2NN6I 3BK1A 3F2BA 2QCPX 1HNXL 2KQ3A 5JEAH 1FXIA 1PTOB 1LV9A 1D3ZA 2AUKA 1ZYRC 1L1OC 1L0YB 2AHOB 1PH8A 2D07B 4NY0A 2DZMA 1N36L 1DCZA 3KBXA 2AL6A 4H2AA 4DNTB 5I6WA 3A9JB 4TQ0A 5HFYA 1FIQA 4A76A 2B3GA 3F8TA 4FN2A 4A3DG 5KHOA 1IUEA 5KYIA 1K83B 4ANUA 1NCVA 1DOXA 2DGYA 3D4WA 4BY1B 1PDXA 1A5RA 1I4RA 1ZYRD 5CBEE 4OO1H 2K28A 4GN3B 5C23A 1HZ6A 2WV6D 4UP7A 2JX5A 2KQ4X 1J6QA 4EEWA 1XTCD 2RD0A 2F52A 4F7ZA 2J53A 2EY1A 5C6AA 3Q2AC 3TP6A 3SGIA 2BQQA 2N9LA 4DV5Q 1YJ1A 1MIUA 2G4SA 4MEMA 3U9SA 4YSYB 4KKTA 2AL3A 2NS5A 5E6NA 4IUVA 3AN1A 2EY2A 4A55A 3VXWA 1XJVA 3ZTCA 2ENBA 2LEKA 3NBIA 4ZRZA 1XLOA 5NUCA 4WQMA 3CQZB 4A3MH 3LNNA 1EWYC 3BYTB 4R4OA 4R4IA 3D32A 2I46A 4GIVA 3AQQA 1S5BD 3KUZA 1XNQQ 1E1OA 3UDXA 2MFIA 1OQQA 1WH3A 2KZRA 2WACA 3GOEA 1OTRB 2XN9C 2WFWA 3GTJH 4US8A 4IJHA 4KI0A 4XDDA 2AQ1B 3NJTA 3JAME 4DUZQ 4DR2Q 2ZJDA 3V6EB 4DGZA 2RBMA 3PLVA 2JF5A 2INNE 4AS1A 3GTPH 5I9PA 3DVNU 3RNGC 4B3SQ 3J81j 4DK6C 1OEYA 2PVGC 2B76B 1TS3A 3NHEB 1IBMQ 3A9JA 1JB7A 1S5CD 4IUPA 1K83H 4PMBA 3RI7C 1W3SA 5FO7B 4ARCA 2VY3A 4PNYA 3TEZA 3HOUB 1N61A 3R7RA 4POFA 1TT5B 3A33B 4URKA 2L05A 2CH4W 1B4OA 2ICIA 3N6RA 4BBSH 5TR5A 3VFKA 4CJ1B 1H9KA 1PZID 2MP2A 1GO3E 5FO9B 5C4ZA 4LF7L 2N3SA 5IGEA 1V9JA 2A69C 5T1IA 1WCMH 3PUWA 2BWES 1KOTA 3VDZA 1MBYA 2C35B 4L5SA 2N9KA 4FADA 4RF0A 2TMPA 3NEMA 4DR5L 1HRJA 1YNNC 2I1KA 2J0TD 3MXGA 3A8IE 1JQYD 4C2MH 2NZ1D 3JAMc 5JHAA 4TQUS 4KY5A 2WDQB 4MH0E 4A8XC 3KBGA 1AARA 5BYSA 4HIMA 4N9PA 4IFDH 4NAWA 5J2RA 5EKIA 2B2YC 4MGKE 3AECB 3GTMH 4I6PA 1PMRA 3SK8A 3BU2A 3T3OA 2AWTA 1T0QC 1DM0B 3B0AA 1YITA 4JE3B 2PYKA 4X64L 2V4IB 2MQHA 4DPGA 1WTQA 2REXA 5FO8B 2D11A 4ZKBB 1DOYA 4H02A 2IY1B 3RLOA 1AZQA 4W9IA 1SF0A 1I42A 1LXDA 1HCZA 4BKSA 1GUTA 1N8RC 1XNRL 2E2JB 3HKZG 3T1YL 4C00A 3DHIC 3BIID 3C3LA 4IG7B 2BDNA 2MO1A 3EGRA 1K73C 4GN5A 4MHEA 1MG8A 3KW5B 3I90A 3SU8X 1V6EA 4II3B 4KV2A 2A4ZA 2IL8A 2ZCBA 4AQYL 4TMAB 3PVLA 3VTVA 2BKFA 1SAPA 2GRIA 3S15B 2QDFA 2WXFA 4DV4Q 1FRRA 1Q1EA 2B2TA 4GOPA 3Q24A 2J0JA 4GXBA 1N5WA 4WWPA 1TWAB 2NVYB 3BK2A 1ZE3D 1HQMC 2Z59B 3HUIA 1O7YA 3PUVA 3LYYA 1KC8C 4BA2I 5IP7G 4A3FH 2LXAA 3FDTA 2LJ5A 1W6KA 3RULA 1E1TA 1L0XB 1Q8KA 5C0XI 4PMWA 1EY8A 2P5ZX 5IE8A 3PCOB 3F1ZA 2ZEQA 4BXXG 3P42A 4JVZA 4TVAB 1CUKA 2EXZA 2HD3A 3ITPA 3PV1A 3Q69A 4NP5A 3CMMB 2KVRA 5GROA 4C3IG 1S40A 1QT9A 2W54A 4US9A 3E56A 1UE5A 3F2CA 1PFDA 3OAWA 1K8AC 4YTMB 5ELCA 4DU9A 1UUPA 2K9XA 4DV0Q 3P1MA 4IW0A 1EWCA 4JV5Q 4B3RQ 4JI7L 3URYA 3RT3B 3HVDA 2H88B 4GNXB 4S3SA 1TQOA 3JVZX 4YWKA 1R7SA 3BG3A 4XT3B 3GTOH 4HIOA 2IGHA 4C7ZA 1TIID 3MFGA 1JMLA 1TWHB 4WAFA 2ZXOA 5FK9C 1V1QA 3UI3A 4HTHA 4I65A 2VRRB 3LDZE 3HOVH 3WAMA 5LNK1 2Y0SE 1K8RB 3IT4B 1MFWA 5LMUQ 3ERSX 3IFTA 4MTNA 3EJIA 3C0RB 2F0NA 2A6ED 2K4KA 1IP9A 3VVWB 4KZ0A 3ZXRA 5C4XB 1TS4A 3H0GG 3N52A 1EQQA 1TZOA 5GXGB 2L7RA 3PO2B 1Q3LA 3VUYA 4B6WA 2F0MA 2R2QA 3T13A 1EOVA 3BYYB 5IO9A 2M19A 2WINB 5E7NA 2JA6G 4K8IA 4KHZA 2B3AA 2NWGA 4WJQA 2F0PA 3K9PB 1PYWD 1WWTA 4F7XA 4UPAA 1PYSB 2G5DA 2Z4HA 2N88A 1K0RA 5M9OA 3KFUA 4QF4A 2PPBC 4GKJQ 5JHBA 3PREA 2KTFA 3S16H 1JC7A 3ZNZB 1Y1VB 5FLMH 5AUKA 1H9JA 2N7DA 3CPFA 4ACFA 1GPXA 1VQNA 1WY8A 1HNWQ 3HVZA 3DDCB 1K52A 3HIZA 3A8KE 3V3XA 2C7MB 3AEVA 4EFOA 3N32A 1N33L 3NS8A 3P4PB 2OCEA 1UE1A 2RA4A 3IKJA 5CHWA 4YHHL 1KH0A 3WOFA 2XRSD 4R1JA 3S2HH 4JL9A 2B63G 5LL6S 4XE0A 3ZVVA 1BF4A 2E2IH 3S14B 1SB3C 2N7JA 3ECIA 2IGDA 2PI2E 1RD9D 1VQ7A 1MI0A 2QC8A 2ZXRA 2CS4A 3GV6A 5DLQE 2KN5A 2DJGC 4MGYE 4A3BG 2WGSA 4MH8A 5DEHA 2QGQA 1TXYA 2JPHA 1IKLA 3ZTDA 5LMNL 3V62A 4PQXA 3RN2A 2JA5B 1HR0Q 1ML0D 1H9SB 4A3IG 1KQSA 2MLBA 1VQDA 4HJ9A 1RJTA 3ZNGC 3R3OA 4C3IB 3I91A 1V49A 4KLKA 1KRTA 4Y52H 1JALA 1EFID 1OXVA 4X3UA 2LVOA 4GN1A 2KCNA 2SDFA 4XIGS 1TVXA 2EVBA 5EKLA 4BBSB 1HUNA 4FJZA 3Q6BA 4N9F4 1C3TA 1KAAA 3TJPA 1SYFA 1M8AA 5KNBA 5KNCA 2F0GA 2WX0A 3CKIB 2JSOA 4ALPA 2UUAQ 4NAWB 1XCTL 4M8NA 4ZYSA 1YIJA 2BTEA 3APDA 1B7YB 2K25A 3IBEA 2KOLA 3K8AA 1Y56A 4FJYA 3EFXD 1E8YA 3K5OA 3IRBA 3CSFA 1F2LA 2JZZA 1MVKA 1I4QA 4DK3C 2K5HA 2PW9A 3T9LA 2VNUD 1SE8A 2IHFA 4PS8A 5DPRA 1SFOH 4BOZB 1HE8A 2H5XA 3FPPA 2KO3A 1EIYB 3N1XC 3BVMA 3GTGH 1ZUD2 4J1MA 2OOBB 1KL9A 3CCUA 1NY4A 1N63A 3PGZA 5JAVA 1SNMA 1EYDA 4X62Q 3HOWH 4DR4Q 1G2SA 2MP2B 5EBDA 4GU2A 5CC4A 3RR5A 2LD9A 3I3CA 3HKZB 3ER0A 4QUFA 1Q86C 2PLPA 4A3CG 4W9JA 4W9KA 1D2BA 3OW7A 4IWOA 4G7ZC 2K6DB 2LJIA 5JPNC 1Q7YC 4L5QA 2F0OA 4ODGA 1UGMA 1EZ6A 4X62L 4DR4L 4IFDG 4EX5A 2LUEA 5IYDH 4B9KA 4KY7A 2HHHL 4XXEA 1ZXHA 4JK1C 4WURA 3MFYA 2PTLA 2CHXA 3VA5A 2ASQA 5D94A 3T4AC 3A8JE 2MHJA 1ENAA 1WJ4A 1XLNA 3A5UA 5CV5A 1D1KA 2E2DC 1EU3A 1T0YA 2FIFA 4I6NB 4D2KA 5LHY1 1WD0A 4W9LA 2B2YA 1WX8A 5T8IA 5IP9H 4KKIA 2QDBA 3VTUA 3AFQA 3R66C 2FINB 1BBXC 3TRZA 2CU3A 2BYTA 4BBNF 2BB6A 4BY7B 1M90C 1OXUA 2WDRB 2XNAC 5BR8L 1KDCA 5KGUA 3KDFA 4FVMA 2DJFC 1QUQA 3MEFA 1PH3A 3CMAA 3V6CB 1E0ZA 3KJOA 2MNAA 3I55A 4N6EB 1BNZA 3GTKB 2XTIA 1XQQA 2UXBL 1PHJA 3MJ5A 3L4PA 3H91A 1LTBD 3ZGZA 3JAML 4LAAA 4KMUC 1E3PA 2KVZA 3VQIA 1VQ5A 1PQSA 1Z5SB 4RGNA 2WDTB 2RMMA 3PZ7A 4KJOA 1EZ8A 1HTLD 3DBHI 4UP8A 3APCA 1D5XC 2NYZD 5A2QE 3H7PB 5FJ8H 1V81A 4QIWE 1SLJA 3VYSA 4RH6A 5BR8Q 2D5DA 4QUCA 2KTRA 1CT1D 2C9OA 4HIDA 1VQOA 4W9DA 4YIJA 1GOZA 1S5ED 4G50A 3CRLC 1Y1WH 1YQBA 3VHTC 1LFDA 1GXDC 1A2UA 1X3FA 5AJ3L 3F2UA 4NPSA 3H3VI 2E5LL 5E3FA 2A74C 1N33Q 1JJGA 1F0ZA 5JVG3 4OIKA 2IDYA 2ZTCA 3OIQA 3UINB 1BOSA 2FMCA 1MJCA 3CC7A 1N62A 3L0OA 2LKVA 4GS3A 2WNMA 3UIPB 1YMHE 2BB5A 3K9OB 3RLFA 1K8OA 2QHOA 5DPTA 3PT2B 3T53B 1FD7D 3TEXA 2Z6KA 2KJXA 3MA2B 2PPHA 3CXCA 1O7IA 3DLLA 1WXAA 2XWBB 4B3ML 1P1AA 3SVMA 2UXDQ 3TCAA 1WYDA 2G9DA 4LUOA 1XNRQ 4MNOA 1IBLQ 4HKZE 2Z0SA 1I35A 4QQBX 2LWPA 1MI2A 2ZJQA 1LT6D 4HKQA 2I38A 4A3LH 2J0KA 2MSED 1ACCA 1J5EQ 3ENEA 4TUUA 2KUMA 5D6JB 2NPTA 1SNOA 3PIO3 3ZJYC 5FR3A 3PPAA 1YJJA 2ZTDA 3ML8A 2K3UA 3SEBA 4WJNA 1HFNA 4UAIA 3IAYA 4HRSA 2L0CA 4XDCA 1X3PA 2HJ8A 3M7NA 4KIKA 1VMCA 4AQYQ 1ILPA 3AEBB 3HM3A 4R3DA 1WE6A 3BINA 3W5UB 4MDKE 2KMMA 3NOBA 1L1OA 3SE0A 2R92B 1JE5A 2R93H 3W9CB 4BS9A 1I94Q 2PW5A 1XMQL 3D6WA 1XMOL 4FYDA 2SAKA 4NPNA 4IURA 1YJWA 1E7ZA 2KOXA 3K81C 1YN3A 2Z0DB 3JSVB 3FPUB 1K8GA 4PYUA 4PMCA 4GMVA 3ZJVA 4KX6B 1SYCA 1UBIA 2R92G 4YTPB 5JZEB 3ZNHB 2ZZPB 3EA6A 3S2HB 1EYGA 4IPDA 1DGJA 5LMUL 1Z9FA 4RKLA 4FO2A 3IXSA 4PZ6A 1ASZA 2E5LQ 3VR2A 2GI9A 4A3MB 3B2FA 4X66L 1C8CA 4KD3A 1YX5B 5IA7A 4O1NA 3S1NB 3SK5A 1BCPD 4DF7A 2A8VA 4HDOA 2CWPA 3PMFA 1WSPA 4BBNC 3P7JA 1D8LA 2F0SA 3PSEB 3I73A 1IXRA 4JOIA 2CQAA 4BAXA 3AEFB 5CORA 2JXTA 1M4VA 3KYCD 3GTLB 2LGDA 4G0NB 4RM9A 3AV8A 1HZ5A 2KDEB 1V80A 3HK0A 2BS3B 3L9AX 1XX8A 3R7QA 5IGDA 4A3IH 1FRDA 3DBLB 1Q1BA 4OX9L 1H8CA 1FO4A 2SNMA 3AB9A 4N8X1 1DOMA 2MA9B 4WRDA 1IW7C 2BT6A 4G3XB 2E74C 1YHAA 3A5ZB 4GZYC 4M0WA 4JPSA 4J15A 2L0FA 1P98A 4CBVA 4JI6Q 4X3KA 2OWOA 3VUXA 3DWGC 4ARIA 3TZDA 3RN5A 3AE7B 3PO3B 1X3GA 1PRTC 2F0DA 2N9XA 4LFAQ 5CMDA 1YJIA 1Q90A 3G6EA 3A4SC 2K52A 1XTDA 4CDDC 4TRDA 4JWUC 5T1GA 4A3JG 2D3BA 3P4QB 4DV6Q 2VS1A 3QJYA 4QAYA 1U9RA 1KXLA 1BUVT 2MJDA 2OEDA 4KGTA 1A3TA 2R7ZG 2OTLA 2LVQA 2KCTA 1AEXA 1UH6A 2PIAA 1JT8A 1KFYB 3AI5A 4DAYA 2ZJRA 4HJKA 5C3EH 3M4QA 2BW2A 4IPHA 1RCVD 3CC2A 3C19A 1F9SA 4GDLA 4EOYA 1FL0A 1IBXB 1ZW7A 1ZGUB 4A3KH 1IGDA 2KACA 3BZKA 3N3KB 3V60A 1K3BC 4K7SA 2K5WA 3PIP3 1GUGA 2F3IA 1BKBA 1SDFA 1Q0WB 1J8IA 2KHSA 2LMCB 1SNDA 5D3DA 1OFFA 4OHJA 3TP7A 2CVRA 1CQVA 3I7FA 2RPQA 3NZ3A 3QQ8B 4BBRG 1PLFA 1E22A 4A3EB 3MC8A 4AUQC 5FKAC 4DNRB 2IX0A 1KTKA 4A3IB 1YQ3B 4QB4A 3N1YC 2RPVA 3HZXA 5JJZA 1Y69U 1G291 1PH1A 5M5WB 3O13A 4AJYB 1WI5A 1RFAA 1X9NA 1OQRA 1VQ4A 3AU5A 4TSSA 3HOZH 1AN8A 1YNTE 2KX0A 1DGSA 3RNAC 4A3BB 1XEEA 4DV1Q 2NN6G 4A3GH 1ISNA 2H89B 4P2CB 1I50B 1V5OA 4DHJB 1B44D 1D1IA 3NTKA 1HHVA 2QEJC 3ND8A 4GKKQ 3S15H 4OELB 1WXQA 1CHPD 3PS6A 1GC6A 3VR9B 2PVOD 3PRZA 1T0RC 3R3MA 1WTHA 2GN5A 2K04A 3FP9A 4RMAA 3N9YC 1BO0A 1MGSA 1WZ0A 1A15A 1IBLL 1VR9A 2O6VA 4OONA 4X66Q 1V8QA 3SR6A 1GB1A 3AE9B 5M5YB 2DYBA 5H1SE 4FDBA 1AWDA 1UAPA 3I4LA 1VLBA 2KDMA 1CZWA 2F0JA 4FXCA 4WH4A 3RNBC 3X3MA 5HI1A 3PIPA 3NTIA 2EYFA 2Q2TA 3HKSA 3A7AB 2XK5B 1WGRA 3GE8C 2LFNA 4OWXB 1JJCB 2BA1A 5M5XH 1B3QA 1C1YB 2DAJA 4C3JB 4JX1C 1STNA 2N1VA 3CC4A 4S17A 1GHJA 3U8ZA 3NXWA 2G45B 3M3YB 3M4OH 5C4XG 3IT6B 4OW0A 3HOVG 2JEAI 2IBIB 1AE3A 2LVPA 4GDKA 3J7AF 3PZDA 1VDZA 1WZ3A 4HJGE 4XGAB 4Q0FA 3RCZA 5CX3A 1ZEQX 5EPJA 4GOPC 3KLRA 1WGHA 2K22A 5G2NA 4C56C 3J7ZC 2BOSA 1KM7A 1Y8PB 3UI2A 1HTQA 5AFWA 1RF2D 3HOVB 4OXPA 2BDOA 1OEYJ 2EQSA 3KLSA 4H44C 3D4RA 1SE2A 2JA6H 1PFSA 4HMJA 4N8FA 2JQRB 3S2DH 1ILQA 3EBEA 2EJMA 1VQAA 1NYRA 2M0XA 4LUZA 3S1MB 2W82A 4OO1I 3A56A 2KHIA 2ON8A 1TWFH 3QOJA 1UNSA 3NP8A 3KLWA 3HRDD 4YCWA 4ANWA 5FLMG 1UGJA 2ES2A 2N4FA 3MXNA 2NVXH 3Q0AA 1PRTB 1YOVB 2YLMA 3I3TB 3HOYB 3TBLD 3VH4B 2F0LA 3MHSD 1GUOA 3WALA 3CHBD 4HJ7A 2GB1A 2L00B 3AEDB 1RIPA 1UE6A 3VRAB 1Q5WB 3HM6X 2R3ZA 1LTGD 5ELFA 1LABA 1AYFA 1MHHE 2AEHA 1NR4A 2BS2B 2JT4B 2INPE 2KJ6A 3ZUNA 5CV9A 3GTKH 2J7QB 3ZYYX 3BDOA 4YWLA 5TSSA 3ZDTA 2RQXA 5C0XJ 3J80i 2EMSA 1Y1VH 2W9NA 4K2KA 1XF5L 3EECA 3MTNB 1FPYA 2BS4B 3QC8B 4ZRJA 3L10B 2IX1A 3H3VH 1G91A 2VZKB 1J7CA 5IKCM 2ZXPA 4PYZA 3GDEA 2WP8J 2IWHA 3Q23A 3NQIA 1QB5D 4YY3L 1PTOH 3CAMA 2VQEL 2EYLA 5M3FG 3LWEA 2J4XA 3VR3A 1VQKA 3MTSA 4LF7Q 4G57A 1LQBA 4YWGG 1JR0D 1K3RA 1V9PA 3ULLA 3CF5A 2OF1A 4C3HG 1DOLA 3M4OB 3EC8A 1GD7A 2JN4A 3H0GB 1U5KA 4ME5A 4IWPA 5H8YE 1X3EA 4P1CC 2M8SA 2PO4A 2JY6A 4KSKC 4MELA 1KRHA 2C7NB 1RTOA 1STGA 4LNNA 4DV3L 3NG0A 3NELA 4LF9L 1IW7D 5E4XA 4DHZB 4HVBA 2FNJB 1J7BA 3HRZC 2W3RA 3W1BA 5AZHA 3STBD 1SYDA 2VH2A 2I2YA 1N34Q 3SFDB 2NTTA 1EQVA 1AH9A 3SDLC 3CW2C 2RDBC 1B50A 4L5RC 1CMXB 2GVAA 5M3MH 2HHHQ 3AMUA 2FCQA 1OXTA 1J5EL 1BDOA 3GD7A 3CCVA 1JRPA 4WJ4A 2UU7A 1STBA 4P72A 4F8CB 1NUCA 4NXNL 1KLVA 3C8YA 1XLQA 3OTOQ 5FR6A 3X23A 3K7UC 2WXGA 3KUPA 3NBHB 4DV5L 2O5IC 4ZCKA 5C2TB 4FNFA 5M5WH 4C80A 3CWIA 3D4DA 1Y8OB 5IYDG 2CKHB 1EEID 2SNSA 3QO2A 1CQFA 4HJAA 4LLGM 4A3DH 1VMPA 2JA9A 1YQ4B 3AU7A 4USAA 4IFDI 3DUZA 2KFKB 3ULJA 2Y0SG 2DY7A 3DQVA 1KNAA 4ANXA 1N5XA 2PQAA 3NVWA 1AZPA 5EJWA 3FKYA 1XO3A 5EKKA 5D65A 5A35A 2WXRA 3GTPB 2WB1E 2FCMA 4TV3A 2DNCA 3QIJA 3E9SA 3C1FA 3OW2A 5C44H 1D4BA 1QLBB 5AUIA 3AMZA 4A3MG 4JLCA 3GTJB 3NWTA 2L83A 4BKTA 3BS1A 4HR7B 1SIFA 4A4IA 2DNEA 2KMAA 3V61A 1SEBD 1WTRA 3LJ3A 3PQIA 3U52E 2HIVA 4LF6L 3DXJC 2LGSA 1JCKB 4PS7A 3NENA 4LF8L 1JWAD 3NQTA 3AULA 5CV6A 1JE4A 1PTOF 4U68A 4EQOA 3S9WA 4JGHB 3HOXB 3H1UA 4QMGA 3TEHB 1EU4A 3BVZA 3QIAA 1CTMA 4LNFA 2EYMA 4ZRQA 4GLSC 2HE7A 1KDAA 3D31A 1WXVA 4DUYL 1EYCA 4LTUA 4ZK9B 3NPPA 3T56B 2ICEC 3I56A 1F9QA 1B9NA 2QDLA 3CD6A 5ELEA 4JI5L 1PFMA 2ID0A 2WAQG 1N60A 2M4NA 4OVVA 1HH2P 1TYGB 3AXCA 2Z4IA 5LLIA 3RZDH 4NJ7A 1NI3A 1Z7TA 4LMQD 1PFBA 2FXQA 4CDEC 2IGGA 1CSQA 3FKIH 2JRHA 1FCLA 1S72A 3GV3A 5BO4B 4XYOA 3MJWA 1I4PA 3AYHB 2NVTB 2K14A 2M2LA 2EKIA 4A93B 4KKUA 3N20C 2KWVB 1TWGB 1BMLC 3J9CA 3RUIB 4HLEA 1WRIA 5H92C 4F1SA 1VQFA 4LDTB 1NMFA 2VUMG 2FJ2A 5LMNW 2E76C 2B8GA 3HOYH 3IAS1 1Y8RC 1LM0A 3I8ZA 1U4MA 4EQPA 5C5MA 3H15A 3BDCA 1EF5A 4LNQA 4MJSA 5G5HA 4IDIA 2OT2A 4B3TQ 3K0XA 2KBNA 3F2DA 2O2VB 1E7PB 2OQKA 4C7YA 5BYRA 1CKNA 2X6LA 4HWIB 4RG1A 1PH2A 4NXML 2L8JA 4WFN3 2N9PC 5BYQA 2WKDA 4NKLA 2BF8B 3M3JA 3K57A 1KIXA 3KWLA 2MHVA 1MSHA 1HA6A 1F2YA 4KJNA 5JEAJ 4DV1L 5C0XG 3TUOA 5EPKA 1VQIA 5ELOA 3U7ZA 5BMIA 2V9HA 2V0GA 1E2ZA 2N55A 2AX5A 2KECA 5G3LF 2ACZB 1VQJA 3T8MA 1R4MI 4HXDA 2DNFA 2WXNA 2RCNA 4A90A 3AM9A 1HA5A 4J6HA 3MHBA 5BN3A 2NVQB 1MJEA 4X6AH 3DHGC 4AWJA 4MZ9A 3T1YQ 4K6DA 4CYEA 4X57B 1LTLA 2UUBL 4BY1H 4ZDVA 4JI3Q 4K7WA 3KF8B 2R61A 3B08A 1A3UA 1FXTB 3GZNI 3TP8A 3J80L 5BMHA 1NVID 3JSVA 2KC1A 3I4NH 3HEJA 4KN7C 3JYUA 3OLMD 1XPOA 4HROA 2K8HA 2UUBQ 3E6ZX 5DM73 1KF6B 3QWZB 1ZOYB 3SXHA 3OWFA 3PF5A 2V4LA 1CHQD 4K7UA 1L1OB 2CHWA 1Z2MA 4WAAA 4IALA 2PCFB 4IJLA 3GS2A 3M62B 4O42A 1HJPA 1IBKQ 1GNUA 3V05A 2M17A 4KIKB 1GVPA 4FHKA 4B95A 1STAA 2PNHA 3E9IA 3L16A 1G51A 4OWWB 1RLFA 1DZ1A 3A0JA 3QG1A 4PG3A 1SSOA 3G71A 1XPUA 2KFKA 2K03A 4KKSA 2ZNVC 2Q2HA 1E90A 1NNXA 4ZLTF 4MM3B 2WU5B 3J81E 1FMAD 4W9FA 4R4QA 3W1YA 3NHHA 3I57A 1HNZQ 4IWQA 4EQNA 4LFCL 1SBBB 2BH2A 4WORA 4K2LA 5DNFA 2O5JC 1ROEA 2I5LX 3ONAB 5IGGA 1FJGL 2BYVE 2D5GA 4BFRA 3ZJUA 3FMCA 4YL8A 3PO0A 3J7YW 4ABNA 1JWSD 2L1BA 3BZCA 1L2NA 1STEA 4LNOA 2QMTA 2F03A 2F0UA 4YCUA 3DVNV 1QE6A 2MW5A 1VQGA 1A3VA 1SMXA 1VCIA 4AYBB 4UP9A 1XMQQ 1P7EA 2GBNA 2WXOA 2O4XA 1ICFB 2Q2UA 2MBEA 4TQ1A 1QVFA 2B2WA 1MJDA 3EN2A 4ZUJA 4JQWC 1PH9A 3M3YH 4IQZA 1I4HA 2M00A 2WIIB 1PH6A 2BWFA 2D0PA 4A3DB 1CM9A 2KMCA 1CZGA 1FNVA 1F2MA 5IIFA 3J81c 4W9CA 4APVA 4BVUC 3Q8AA 3QX1A 4RWSC 1F9PA 5HGTA 3C1EA 1Z6HA 3OPOA 3T16A 3AEEB 3I4MG 1LGRA 1WE7A 2HDMA 2L0TA 2MRPA 3NE5B 3FAHA 3M95A 4GGQA 3SHLA 4Q5VA 5C4JH 3U58A 1QVGA 1NEKB 3L0WB 3H7PA 5L95C 2BVCA 3RLNA 1P3QU 3HOXG 3ML9A 5EE0A 3M7GA 4E74A 4IOAA 4WQOB 1XXGA 2AQ2B 1VQBA 5IT9c 4ZHPA 2WXKA 1NE3A 2Q5WD 2BE5D 1Q8IA 2ONQA 3KWVA 4S0RA 1ET6A 2FBWB 3Q6SA 4JI2L 4KV6A 2LXJA 5K36H 4ASWC 3AE1B 1SE4A 2NMQA 5IOCA 2JA8B 4KHVA 2BYEA 3KDFB 2EJGC 5KIXA 1K8MA 1DONA 2RKSA 2K7VA 3ETRA 4K3BA 3WCQA 3B9JA 4BA1I 1SR3A 2HTHA 1Y1WB 2RDHA 2D2QA 3SDZA 4KK7A 3KJPA 5C44G 5E6JA 4NDXA 1V2YA 4A3BH 2MCNB 2FHTA 1N36Q 2A1AA 2Z0EB 1YEZA 2CR5A 3NVVA 4JYAQ 2RDFA 2K6AA 2QKIC 5D14A 1C76A 4JIOU 5DM63 3MAQA 2PEAA 3M4PA 1QZEA 4RGMA 4ZRIA 5C4JB 1WI0A 1HZ9A 3CCQA 2FAZA 1X56A 2GA4B 3MXNB 1FNWA 3PUYA 4BBSG 1A2TA 1G6PA 3EIVA 2BA0A 1JW9D 4NZLB 3NSWA 5IT9E 2ALYB 3IFDA 2QJLA 4OVUA 5LMNQ 4A3FB 1HQRD 3RNCC 4C4VB 1QNKA 5IWAQ 1S5DD 2JWUA 1W6JA 3CCEA 1Z47A 3VRBB 1K28A 5M3FB 4PZ7A 1VF7A 2VQEQ 1BXTA 1V8CA 2JA5G 1O7ZA 2HDEA 2V1YA 3E0JA 2NVTH 1ZDVA 4XZ4A 2HIXA 3NTHA 1WVLA 1JRUA 4EZJA 1YNJD 4GLVB 2VZKD 1QOGA 2FCSA 1HTOA 1WTOA 2B2VA 4RF1A 4WJOA 2A73B 2KXJA 2UYZB 2QW7A 4MSMB 1WIAA 2D3GA 5JVH3 1I94L 4WWOA 4EZLA 1SNPA 3W1SC 2N0SB 1H4RA 2J52A 1HPCA 2CH4A 3FKIG 4XQJA 1WR1A 2OJWA 2V3SA 1IGCA 2I5MX 2ZPNA 3EVQA 2B63B 4FULA 1EL0A 4DV4L 2GBMA 1X3QA 2ZPYA 4GDKB 4H7BA 3SD5A 2L1AA 1JOOA 2EOTA 1AP0A 2CU1A 4P1BC 4B0MA 2F4IA 2BYFA 2LGIA 5CV4A 1EY5A 2ZNVB 1E7UA 4NAMA 1GUAB 1JORA 3BZDB 2G9HD 4IUNA 3DM1A 2VW9A 4OIJA 4NJ6A 3M4YA 2OHFA 2F4VL 2YVCA 2EIFA 4WJPA 4CKEA 1KAWA 4C3HB 4DV6L 4NQLB 2MPMA 4QY7A 2KNBA 2UWQA 4HPMB 1JWMD 5LL6X 2ZM6Q 3IAM1 3A9KA 2CCZA 4AOFA 1DOKA 3S2DB 1E7VA 2EYHA 3Q3MC 1SSNA 1YNXA 4YT0B 4AYBE 1CK1A 1WJNA 3NUCA 3U4VA 4AQ7A 2K6QA 1QKZA 1V97A 3A9KB 2O6VB 4LF4L 3I2ZA 1YJNA 3KUCB 2KD0A 1GJXA 5EE3A 4RM8A 2CQOA 3CMEA 1TWCH 3MXUA 5KYLA 2DBYA 1K50A 3DWMA 1ZKOA 3S1RB 4C2MB 1YJ9A 5IYCG 5IP7H 3TN2A 5D2MB 2LHEA 5LXIB 3PRMB 4ITKA 1SJHD 1JICA 2M56B 2E2HH 2DX5B 1F52A 2KA7A 3MHZA 1SJED 3DBRB 4JI5Q 2X69A 4RNAA 1BQQT 1J19A 2VQFQ 3T1HQ 4K0KQ 3K5LA 4BOSC 1QZHA 1BVSA 3LWUA 4AYBG 4A3KB 2KYWA 4FLHA 4A3PA 2HT1A 3PLUA 4ULLA 2GVBA 5FJ8G 2ZTEA 2C7HA 1CJEA 4XDXA 2KHWB 1PV4A 4G7OC 2LHDA 1YI2A 3RMHA 1BR9A 4OX9Q 4QL5A 1I5FA 2WP9B 3R2TA 3HGBA 1PDQA 5L37A 1UD7A 1KDBA 2K50A 2KCCA 1MHWC 1PRTD 3ICEA 1SIJA 4C4VA 3PSIA 2V1CC 1S1QB 2L4NA 3ABVB 1YHBA 2QA4A 1LACA 1YVCA 4DAYB 3ZW3A 1GB4A 3J81i 3HKZE 2KT7A 4LK0M 3QAQA 1J8CA 4HSPA 4A3CH 3LGJA 5M3MG 1UF0A 5K5PA 2PMZE 1TWGH 1D5ZC 3H0GH 4YXDB 2RDGA 2KHJA 3OG5A 4B3TL 3HOZB 2WDVB 3HOUH 1R4NI 4RHRA 4HIKA 3FILB 3RZWC 1TT2A 2HD5B 4YWMA 2HTME 5KNDA 3D3RA 1WRDB 2IW3A 1E0BA 4R4CA 4E71A 4JC0A 2F0HA 4E6IA 3J7A5 1YNND 4GN4B 3TMEA 4XT1B 3Q3OC 4CGYB 4JI8Q 4KHPQ 4P74A 1C78A 3EHVA 1HR0W 4YTNB 4A20A 1TKEA 5CV7A 1DOIA 2A69D 5C4HA 5CTRC 1O7LA 5COYA 4QJFA 2MH7A 2LRUA 1OGWA 3DVGX 1PTOC 3N30A 3K59A 1EFWA 3L2PA 3PUZA 3JAMi 3WAOA 4J3OD 2JJQA 2I0QA 1CKOA 2RVLA 3DM3A 2LY7A 1WMHA 2KVMA 5BMGA 2XWJB 2R7ZB 2YTYA 1U4PA 1LM8B 2KJHB 2XIWA 3SFEB 1C9FA 1F2ZA 2L32A 3UDIA 3CRKC 4M8AA 5C1ZA 2F0EA 1RL2A 4M1UB 3KK7A 1GUWA 3J81L 1N6ZA 3AEAB 3GB1A 3FVQA 5J22A 4LFBL 2WXLA 3KH0A 4DV0L 4P73A 2D10A 2LSSA 3GZNB 3GTLH 3CSTA 1EQTA 1PUTA 3ZJTA 1ONLA 4YSZB 1ZKHA 1YZ6A 3IHPC 4LUVA 4LNIA 4L63B 4U673 4UDUC 1T9HA 4Z9CB 4A3FG 1WGKA 2N9EB 4ZRKA 1SE9A 2BBCA 1J9OA 2VQFL 3T1HL 3K5MA 5HGQA 1I6HB 4FJVB 3JC66 2ZM6L 1MD2D 2Q8TA 2NZOA 4A75A 3A7LA 1GUNA 4DBGA 4C3IH 1QOAA 3D6CA 2UU9Q 2L76A 4O2DA 3V96A 2SEBD 2MGSA 2EYJA 4M8MA 3Q3JA 3CIRB 3HS0C 1KLUD 2CHZA 4OVZA 1IBKL 2NPTB 1J0GA 4HCSA 2DHZA 1TS5A 1PRTF 1X1MA 4L2YA 3QWNA 5DPSA 3UE0A 4C3HH 1HUMA 1MKHA 2XGTA 2FUHB 3TQYA 4LK1C 1EUVB 3VYUA 2KC2A 2X6GA 3RZOH 3U7DA 4TKOB 4RHSA 4LF4Q 2F0KA 1HFGA 2PE6B 1T3QA 3KYDD 4FP5D 1TR5A 1WF9A 1VDVA 1SGHA 4M01A 3ND9A 5KHQA 4JI2Q 1WTWA 3U4EG 3G6JB 5JEAG 1T0SC 4W9HA 4A3JH 4DR7L 3ZRFA 1LTAD 1T5XD 5GQOA 1PVOA 3LB8C 3OYYA 4MGZE 1WGYA 3QARA 3VA7A 2NUCA 5FLXc 4BWGB 1QILA 1YN5A 5IAAC 4MN3A 2E3TA 2HQLA 2R7ZH 4N58A 5ELNA 1E8XA 3PHWB 5GADC 1OO9B 1QWYA 1A62A 1OXXK 3BVGA 4F8MA 4A3KG 4OO1G 2R93G 2IZVB 4M00A 3QJZA 2D3AA 2KDBA 2K39A 1S5FD 1U0LA 3TEWA 3WDNA 4J8QA 1HZCA 3HHMA 1N32Q 1WMHB 3PF4A 3VR4A 1UELA 3I4OA 5IP9G 2IYDB 1GUSA 2KJRA 2HUGA 1EYAA 1QZGA 4OZAA 3E0EA 3P4RB 2ZCCA 4LF9Q 1T6BX 2NBUA 4ZUIA 3U4ZA 4A93H 4HJ5A 3CCSA 1VQCA 4W9EA 4II2B 5F2DA 1UEAB 2K5QA 3A54A 3PO2H 4DV3Q 1WYWB 1CKNB 3NRZA 5AZGA 2CHBD
chains in the Genus database with same CATH topology
1AW7A 3V2TA 1FGBD 1QG7A 4JWSC 3GTOB 1B3AA 1NYQA 3FILA 1XYIA 1C77A 4XTCS 3Q8BA 3VR8B 4WWMA 3I70A 4B9WA 1B2TA 1TKYA 5J1ZA 1CI3M 3NS1A 2CJOA 5I2YA 1II3A 2Y5PA 1QF6A 1SYGA 1A70A 4RKBA 3AE4B 4X3TA 3R2IA 1V1OA 2QF7A 5EE9A 1OXSC 2K5DA 2DN8A 3BWUD 1LTRD 1ZDXA 3CU7A 1ENFA 2F3VA 4CJ0B 4K5XA 4RCNA 2YYZA 3S17B 1R4PB 3SR1A 3T3NA 3W5VB 1SMYD 1JOQA 4ID6A 4XWWA 3AE8B 1DD2A 3MZ5A 1FNUA 2PMZB 5A2QL 5I6YA 1I3QB 1ZXIA 3K6OA 1MHXA 2JZPA 3OMCA 1EY0A 5JOBA 1ESFA 3QB3A 3J80E 3L3OC 4LJZC 2L55A 3KLSX 2X38A 2AUJD 5HHDG 2PZUA 2F0QA 1H9SA 1WTVA 2WXJA 3GP7A 1EM7A 1NR2A 3MXPA 1VZ6A 4YSXB 3PUXA 1DJRD 2E2HB 3GTGB 1PGAA 1H9MA 1S4ZA 3NBHA 2Z1CA 5C3WA 3TSSA 5I9OA 2PW7A 4EGVA 4HEA1 2IT1A 1E2VA 1LTSD 3VR5A 4B0EA 3EUB2 2YEPB 4K14A 2WKCA 2B2UC 2NBFA 1FM0D 4L23A 2A68D 1PZKD 4R9WA 5IODA 1E9MA 2ZT9C 3OIPA 4JBWA 3AE6B 4KD4A 3HP3A 1HXYD 1L6VA 2A68C 3Q22A 1B9MA 3HG9A 2LFIA 1RKNA 2OEOA 4IZ8A 2E6XA 1KABA 2IPKD 3R8BA 1O80A 4B9XA 4H13C 1KLGD 3BDLA 3K58A 1EOTA 1EEFD 3K0YA 1PGBA 1E6EB 3DEOA 3FRPB 2A6EC 3NK9A 4KY6A 4N9TA 1WD1A 2K0PA 1IKMA 1JQ4A 2F0WA 2KEEA 1EWHA 2H4OA 3MP9A 2K01A 1BCPC 2RSNA 1ENCA 4ZOHC 3R93A 3H6MA 2K1BA 4OGQC 2NB0A 2CJNA 3G7LA 4DA2A 1NSNS 4DXFA 2A6HC 4ZKCB 4XWTA 5FLXL 3TP5A 1U4LA 4G4KA 3VYRA 2JSVX 1FEHA 1LTTD 3H09A 2V4DA 2JYOA 5JXVA 2VB3X 1ET9A 1I7HA 1L5PA 1XLPA 3VYTA 1H9RA 4IUTA 2AWOA 2FMMA 1BCPF 3HOWB 5K36G 3AB5A 2JP1A 2E75C 1Q12A 4WIPA 2OXPA 2DWQA 2ZW1A 2V3PA 1SMYC 3U9OA 3EQLC 3W2DA 2PQEA 5E1FA 4RGOS 2QIEB 5G5GA 2JYEA 1D6EC 4ZHOA 3Q8CA 4NMZA 2FFKB 3RPFC 3OMGA 2EY6A 4FF2A 3I4MB 3GQBA 3P75A 2H1EA 1L6UA 1IYUA 1L4ZB 5BN4A 1I4GA 1WTPA 1WCMB 1WTXA 4KKJA 1HTPA 4DAVA 3AE5B 3LXFA 2HCCA 2LS01 2C5CA 1CA6A 1B1ZA 5IGFA 3DHQA 2B2WC 4IOIE 3KF8A 4KTAA 1T5EA 2WB1B 1IYVA 3RZOB 1BUIC 3GTMB 1EIGA 2JEBI 4A6QA 2XVSA 2DLBA 4L8JA 2PZWA 2MJ3A 1V1PB 3C46A 4Y7NB 3P4SB 3FC4A 2LMCA 4DXGA 4REZA 1PZJD 1TJEA 5CBAE 1G6ZA 1QOHA 1L4DB 4RAUC 4MACA 2B2UA 1C48A 1UWXA 2KAJA 5ISRA 3I4NB 3AEGB 2AWNA 2W55A 2IX3A 2F3WA 2DYMA 1ZXTA 4H0LC 1JWBD 3FEWX 4QIWB 1TY2A 3RZDB 4R8NA 1C4PA 4V190 2JU6X 4G7HC 2XRQD 1LT4D 2BCOA 3T51B 1ICWA 1UWMA 1I4XA 1E2WA 5EQ0A 1P7FA 2WXPA 3MWYW 2K32A 1GAQB 3OSOA 4I7ZC 1R9TB 2V3NA 4C1NK 1FCCC 2B2TC 1EIHA 4QCLA 4HCEA 1QOBA 5MPOA 2KEDA 1PXUA 5C3JB 2CW0D 3TDQA 4FXDA 1VF5C 2EY5A 2L12A 1SFOB 5E4WC 3DWPA 1YN4A 2W3SA 5DAUA 3DEPA 5I4DA 2JA7B 5C5LA 2JYTA 1LT3D 1TS2A 2CW0C 2EE1A 3A55A 1KNEA 4P16A 1C4QA 5EBCA 4RGTA 4ILWA 1F2RC 2K05A 3RUZA 1QNUA 4HSVA 5M5XB 1JOKA 1QCBD 2VB2X 1FR3A 2NN6H 4DAPA 1WYGA 3AE3B 5KEEA 2F0FA 5M3MB 4IFDJ 4IN3A 1F9RA 1RM6C 1VRAB 1EY7A 2WXIA 1LTID 5J39A 3DMUA 2QILA 1RDPD 4A3JB 1HEZE 4ZRPA 1EY9A 2E2IB 1QQRA 2WXMA 1F2RI 3TBIB 4CKCA 3SK6A 4EE2A 4HN7A 1ZP0B 1O78A 4V0BA 2F1MA 3MC0B 4PV1C 1G2TA 1RYJA 1XCQL 4CQNA 3S16B 2G1EA 4NW2A 2KWDA 2MP1A 4OZBA 1B53A 3MEHA 5G3LD 3WOEA 3AH7A 1TKWB 2L11A 2MJEA 4HEDA 4FXGC 3VR6A 2JE6I 1NAPA 3TZUA 1RHPA 1CA5A 5CYUA 1PTOD 1PFNA 2LUMA 5HURA 4DFAA 4ZAIA 4KGRA 2XSCA 1Q10A 3DWAA 4L1BA 2SOBA 5C0XH 1FD6A 2EPBA 1SXTA 2K5PA 2M0AA 2F0VA 1SNCA 2L9HA 4F87A 3W1SA 4RFBA 3RD4A 2J7ZA 5CV8A 2KN4A 3FKIB 1SNQA 2B8FA 2WLBA 2Y0SB 1IL8A 1STHA 5IGBA 3LX0A 5FLXE 1TWCB 2A5HA 1V1PA 4R8IA 1IHZA 2HQEA 4DK0A 1YNJC 4K5VA 2L52A 2TSSA 2EZVA 4NJCA 1CFMA 3RFZB 5FOBB 4BBRB 4C1NI 1ESRA 1PGXA 3OOCA 2EELA 3NWSA 2WXQA 3W3AA 2Y5CA 4XYQA 3Q8EA 4FXKC 4A9AA 1K53A 1MSGA 3C2PA 4K8JA 1FYCA 4WJWA 1QOFA 2L5TA 4DN4M 1LO5D 3U2SC 3P63A 1BCPB 1X32A 5I2XA 3P20A 4PT5A 2NVXB 4CHTB 2Z8LA 3PV0A 1DXMA 2WQYB 2K33A 1TWFB 2NTSA 2YU9B 2Q8RE 1RTNA 3PZ8A 1STYA 5C3XA 4KGSA 5ELBA 2JA6B 3OHXC 1LT5D 2M9VA 3NVYA 3GO5A 2WU2B 1TY0A 3Q8FA 3K5NA 3H94A 4Q2JA 4MIUA 3X3NA 1I6VC 2RSOA 4KN4C 3SK4A 2D2CC 2D62A 3K7AB 2A6HD 1XWEA 1VZ7A 1L0VB 2EDGA 4C3JG 2B39A 1DYQA 4IUUA 1CZPA 1E10A 5EGTA 1JROA 2F0TA 2D9UA 3H8HA 2MUYA 5BN5A 2EYPA 4CKBA 2AQ3B 4N59A 2WS3B 1IBXA 3DWQA 4GDLB 1MPEA 5CR3A 2JXMB 4IUQA 1RODA 4X3SA 3S1QB 1FXAA 2VXWA 1SYEA 4EVOA 1R4QB 2HDLA 1C79A 2ZW0A 4B08A 4A3GB 1AFPA 4XQNA 2R6GA 4FF4A 2MEKA 3NVZA 4OL7A 2YEPF 3P1HA 2F0IA 1C4CA 2EYOA 1SE3A 2HCIA 3M85A 4CJ2C 1FFVA 3MVVA 1B9RA 1LLRD 3I9V1 1K51A 5HG2A 1EY4A 2DY8A 3KQ4A 4ZQ3A 4K5WA 4FF1A 3ZQ4A 1V43A 2IJ0A 4OZCA 2I07B 2FUG1 4IKGA 5D3IB 4P6VF 3J7AV 2PNRC 5EPLA 2O2LD 3TEYA 1EY6A 2DYOA 1F77A 4RA8A 2MJ8A 1G8ZD 5C44B 1RWSA 2QSDA 1VJKA 4HAEA 4FF3A 1JB3A 4MT5A 5IGCA 5EE1A 5IT9L 2PZTA 2J42A 3OWEB 4K6LA 5KRUA 1FFUA 1NENB 2Q8IB 1ZPSA 2B2VC 2VUMB 3E5SA 1J7AA 4F88A 1TU2B 4L6TB 1TKGA 5ELDA 3IL8A 3QOLA 3I72A 5CGKA 3H3VC 1GHKA 1SYBA 5JPMC 2EJFC 2WAQB 5C3EB 1A6XA 1C4AA 3NUHB 3GTQB 3B2GA 2R93B 1VZ8A 4XQQA 2BE5C 4HMIA 1Y8NB 3EROA 2WXHA 3ERQA 2FE8A 3L7ZC 4DQOC 4RCOA 2PMVA 1JWUD 1QJOA 1U4RA 2Y3AA 3AE2B 3D8GA 5D7GA 1D5MC 4DK1A 1RFKA 2NN6I 3BK1A 2QCPX 2KQ3A 5JEAH 1FXIA 1PTOB 1LV9A 2AUKA 1ZYRC 1L0YB 1DCZA 3KBXA 4H2AA 4DNTB 5I6WA 4TQ0A 5HFYA 1FIQA 1IUEA 5KYIA 1K83B 1NCVA 1DOXA 3D4WA 4BY1B 1PDXA 1I4RA 1ZYRD 5CBEE 4OO1H 2K28A 1HZ6A 2WV6D 2JX5A 2KQ4X 1XTCD 2J53A 2EY1A 5C6AA 3TP6A 2N9LA 4YSYB 3U9SA 4KKTA 4IUVA 3AN1A 2EY2A 4A55A 2ENBA 2LEKA 3NBIA 4ZRZA 1XLOA 5NUCA 4WQMA 3CQZB 1EWYC 3LNNA 3BYTB 2I46A 1S5BD 1OQQA 2WACA 2XN9C 4US8A 4KI0A 4XDDA 2AQ1B 3JAME 4DGZA 2RBMA 2INNE 4AS1A 5I9PA 2PVGC 2B76B 1TS3A 1S5CD 4IUPA 4PMBA 4ARCA 5FO7B 4PNYA 3TEZA 3HOUB 1N61A 2ICIA 1B4OA 3N6RA 4CJ1B 1H9KA 1PZID 5FO9B 5C4ZA 5IGEA 2A69C 5T1IA 3PUWA 1MBYA 2N9KA 4RF0A 2TMPA 1HRJA 1YNNC 2J0TD 3MXGA 3A8IE 1JQYD 2NZ1D 4TQUS 4KY5A 2WDQB 4A8XC 3KBGA 5BYSA 4N9PA 4IFDH 5EKIA 2B2YC 3AECB 1PMRA 3SK8A 3T3OA 1DM0B 4JE3B 2PYKA 2V4IB 1WTQA 5FO8B 4ZKBB 1DOYA 1AZQA 1SF0A 1HCZA 1GUTA 2E2JB 3BIID 3C3LA 2BDNA 3EGRA 4MHEA 3I90A 2IL8A 4TMAB 1SAPA 2GRIA 3S15B 2WXFA 1FRRA 1Q1EA 2B2TA 3Q24A 1N5WA 1TWAB 2NVYB 3BK2A 1ZE3D 1HQMC 3HUIA 1O7YA 3PUVA 3LYYA 4BA2I 3FDTA 1W6KA 1L0XB 5C0XI 4PMWA 1EY8A 3P42A 2EXZA 3ITPA 3Q69A 4NP5A 1QT9A 4C3IG 2W54A 4US9A 3E56A 1PFDA 4YTMB 5ELCA 4DU9A 1UUPA 2K9XA 3P1MA 1EWCA 3URYA 3HVDA 2H88B 4S3SA 1TQOA 1R7SA 3BG3A 4XT3B 2IGHA 4C7ZA 1TIID 3MFGA 1JMLA 1TWHB 4WAFA 2ZXOA 5FK9C 3UI3A 4HTHA 4I65A 5LNK1 3IT4B 3IFTA 3EJIA 2F0NA 2A6ED 5C4XB 1TS4A 3N52A 1TZOA 5GXGB 3PO2B 1Q3LA 2F0MA 3T13A 3BYYB 2M19A 2WINB 4K8IA 4KHZA 2NWGA 2F0PA 1PYWD 1WWTA 4F7XA 2Z4HA 2N88A 5M9OA 4QF4A 2PPBC 1JC7A 1Y1VB 5AUKA 1H9JA 1GPXA 3HVZA 1K52A 3A8KE 3V3XA 3P4PB 2RA4A 3IKJA 1KH0A 3WOFA 2XRSD 4XE0A 5LL6S 1BF4A 3S14B 1SB3C 2N7JA 2IGDA 1RD9D 1MI0A 2ZXRA 3GV6A 4MH8A 5DEHA 1IKLA 4PQXA 2JA5B 1ML0D 1H9SB 1RJTA 3R3OA 4C3IB 3I91A 1JALA 1EFID 1OXVA 4X3UA 2KCNA 2SDFA 4XIGS 1TVXA 2EVBA 5EKLA 4BBSB 1HUNA 1KAAA 1SYFA 1M8AA 5KNBA 5KNCA 2F0GA 3CKIB 2JSOA 4NAWB 1XCTL 4ZYSA 2BTEA 2KOLA 1Y56A 3EFXD 3K5OA 1F2LA 1MVKA 1I4QA 2PW9A 2VNUD 3FPPA 3BVMA 1ZUD2 4J1MA 1N63A 5JAVA 1SNMA 1EYDA 1G2SA 5EBDA 5CC4A 3I3CA 3HKZB 4QUFA 2PLPA 1D2BA 3OW7A 4G7ZC 2LJIA 5JPNC 3ABVB 2F0OA 4ODGA 1EZ6A 4IFDG 4KY7A 4XXEA 1ZXHA 4JK1C 4WURA 3MFYA 2PTLA 3VA5A 3T4AC 3A8JE 1ENAA 1XLNA 5CV5A 1D1KA 2E2DC 1EU3A 4D2KA 5LHY1 1WD0A 2B2YA 5T8IA 4KKIA 2QDBA 2FINB 1BBXC 2CU3A 2BYTA 2BB6A 4BY7B 1OXUA 2WDRB 2XNAC 1KDCA 5KGUA 4FVMA 1E0ZA 4N6EB 1BNZA 3GTKB 3MJ5A 3L4PA 3H91A 1LTBD 3ZGZA 3JAML 4LAAA 4KMUC 3VQIA 4RGNA 2RMMA 3PZ7A 4KJOA 1EZ8A 1HTLD 1D5XC 2NYZD 5A2QE 3VYSA 4RH6A 2D5DA 4QUCA 1CT1D 2C9OA 4YIJA 1GOZA 1S5ED 3CRLC 1GXDC 1A2UA 3F2UA 5E3FA 2A74C 1F0ZA 5JVG3 4OIKA 2IDYA 3OIQA 1BOSA 2FMCA 1N62A 2LKVA 2WNMA 1YMHE 2BB5A 3RLFA 1K8OA 3T53B 1FD7D 3TEXA 2KJXA 3MA2B 2XWBB 3SVMA 2G9DA 4HKZE 1MI2A 4HKQA 1LT6D 2I38A 1ACCA 2KUMA 1SNOA 3PIO3 5FR3A 1YJJA 2K3UA 3SEBA 1HFNA 4UAIA 3IAYA 4HRSA 2L0CA 4XDCA 1X3PA 3M7NA 1VMCA 3AEBB 1ILPA 4R3DA 3W5UB 2KMMA 3SE0A 2R92B 3W9CB 4BS9A 2PW5A 3D6WA 4FYDA 2SAKA 4IURA 1YN3A 3FPUB 4PMCA 3ZJVA 4KX6B 1SYCA 4YTPB 3EA6A 3S2HB 1DGJA 3IXSA 4RKLA 4FO2A 3VR2A 2GI9A 4A3MB 3B2FA 1C8CA 4KD3A 4O1NA 3S1NB 3SK5A 1BCPD 4DF7A 3PMFA 1WSPA 3P7JA 2F0SA 3I73A 2CQAA 3AEFB 5CORA 2JXTA 1M4VA 3GTLB 3AV8A 1HZ5A 2BS3B 3L9AX 1XX8A 5IGDA 1FRDA 1Q1BA 1FO4A 2SNMA 3AB9A 1DOMA 4WRDA 1IW7C 2BT6A 4JPSA 2E74C 4GZYC 4M0WA 4CBVA 4X3KA 3DWGC 4ARIA 3TZDA 3AE7B 3PO3B 2F0DA 1PRTC 5CMDA 1YJIA 1Q90A 4JWUC 4TRDA 5T1GA 3P4QB 3QJYA 1U9RA 1BUVT 2MJDA 2OEDA 4KGTA 1A3TA 1AEXA 2PIAA 1KFYB 4DAYA 2BW2A 1RCVD 1F9SA 1IBXB 1IGDA 2KACA 2K5WA 3PIP3 1GUGA 1SDFA 1J8IA 2KHSA 2LMCB 1SNDA 5D3DA 1OFFA 4OHJA 3TP7A 2CVRA 1CQVA 3NZ3A 1PLFA 4A3EB 5FKAC 4DNRB 2IX0A 1KTKA 4A3IB 1YQ3B 4QB4A 2RPVA 5JJZA 3HZXA 1Y69U 1G291 5M5WB 3O13A 1OQRA 4TSSA 1YNTE 1AN8A 4A3BB 1XEEA 2NN6G 2H89B 4P2CB 1I50B 1B44D 1D1IA 3NTKA 1HHVA 2QEJC 3ND8A 1WXQA 1CHPD 3VR9B 2PVOD 2K04A 3N9YC 1BO0A 1MGSA 1A15A 1VR9A 1V8QA 3SR6A 1GB1A 3AE9B 5M5YB 1AWDA 1UAPA 3I4LA 1VLBA 2KDMA 1CZWA 2F0JA 4FXCA 4WH4A 3X3MA 5HI1A 3NTIA 2EYFA 3A7AB 2LFNA 2BA1A 4C3JB 4JX1C 1STNA 1GHJA 3NXWA 3IT6B 3M3YB 4OW0A 2JEAI 3J7AF 1VDZA 4HJGE 4Q0FA 1ZEQX 5EPJA 3KLRA 2K22A 4C56C 2BOSA 1Y8PB 3UI2A 5AFWA 1RF2D 3HOVB 2BDOA 3KLSA 4H44C 3D4RA 1SE2A 4HMJA 2JQRB 1ILQA 2EJMA 1NYRA 2W82A 3S1MB 4OO1I 3A56A 2ON8A 3QOJA 1UNSA 3NP8A 3HRDD 1UGJA 3MXNA 3Q0AA 1PRTB 3HOYB 2F0LA 1GUOA 3CHBD 2GB1A 3AEDB 3VRAB 2R3ZA 1LTGD 5ELFA 1LABA 1AYFA 1MHHE 1NR4A 2BS2B 2INPE 5CV9A 3ZYYX 3BDOA 5TSSA 2RQXA 5C0XJ 4K2KA 1XF5L 2BS4B 2IX1A 1G91A 2VZKB 1J7CA 2ZXPA 2WP8J 2IWHA 3Q23A 3NQIA 1QB5D 1PTOH 2EYLA 3LWEA 2J4XA 3VR3A 3MTSA 4G57A 4YWGG 1JR0D 2OF1A 4C3HG 1DOLA 3M4OB 3H0GB 4ME5A 5H8YE 2PO4A 1KRHA 1RTOA 1STGA 1IW7D 5E4XA 1J7BA 3HRZC 2W3RA 1SYDA 2I2YA 3SFDB 2NTTA 1EQVA 1B50A 3AMUA 1OXTA 1BDOA 3GD7A 1JRPA 1STBA 1NUCA 3C8YA 1XLQA 2WXGA 3KUPA 2O5IC 5C2TB 4FNFA 4C80A 3CWIA 3D4DA 1Y8OB 1EEID 2SNSA 3QO2A 1CQFA 4LLGM 1VMPA 1YQ4B 3AU7A 4USAA 4IFDI 3DUZA 2DY7A 1KNAA 1N5XA 3NVWA 1AZPA 5EJWA 1XO3A 5EKKA 5D65A 5A35A 2WXRA 3GTPB 2DNCA 3E9SA 3C1FA 1D4BA 1QLBB 5AUIA 3AMZA 3GTJB 3NWTA 2L83A 3BS1A 4HR7B 2DNEA 1SEBD 1WTRA 3U52E 3DXJC 1JCKB 1JWAD 3NQTA 5CV6A 1JE4A 1PTOF 4U68A 4EQOA 3S9WA 3HOXB 4QMGA 1EU4A 3BVZA 3QIAA 1CTMA 4ZRQA 2EYMA 4GLSC 1KDAA 3D31A 1EYCA 4LTUA 4ZK9B 3NPPA 3T56B 2ICEC 1F9QA 1B9NA 5ELEA 1PFMA 2ID0A 1N60A 1TYGB 2Z4IA 1NI3A 1Z7TA 4LMQD 1PFBA 2IGGA 1FCLA 3GV3A 4XYOA 1I4PA 2NVTB 2M2LA 2EKIA 4A93B 4KKUA 1TWGB 1BMLC 3J9CA 1WRIA 5H92C 2FJ2A 2E76C 2B8GA 3IAS1 3I8ZA 1U4MA 4EQPA 5C5MA 3BDCA 5G5HA 4IDIA 2OT2A 1E7PB 4C7YA 5BYRA 2X6LA 5BYQA 4WFN3 2WKDA 4NKLA 3K57A 3KWLA 2MHVA 1MSHA 1HA6A 1F2YA 4KJNA 5JEAJ 5C0XG 3TUOA 5EPKA 3U7ZA 5BMIA 2V0GA 1E2ZA 2N55A 2AX5A 2KECA 5G3LF 2ACZB 2WXNA 4A90A 3AM9A 1HA5A 4J6HA 3MHBA 5BN3A 2NVQB 4K6DA 2R61A 1A3UA 3TP8A 3J80L 5BMHA 1NVID 3HEJA 4KN7C 4HROA 3E6ZX 5DM73 1KF6B 1ZOYB 3SXHA 3OWFA 1CHQD 4IALA 2PCFB 3GS2A 4O42A 3V05A 1STAA 1DZ1A 3QG1A 1SSOA 2K03A 4KKSA 4ZLTF 4MM3B 2WU5B 3J81E 1FMAD 3NHHA 3I57A 4EQNA 1SBBB 4WORA 4K2LA 5DNFA 2O5JC 1ROEA 3ONAB 5IGGA 3ZJUA 2D5GA 3FMCA 3PO0A 3J7YW 4ABNA 1JWSD 2L1BA 1STEA 2QMTA 2F03A 2F0UA 1QE6A 4AYBB 1A3VA 1VCIA 2WXOA 1P7EA 2O4XA 4TQ1A 2B2WA 4ZUJA 4IQZA 1I4HA 2M00A 2WIIB 4A3DB 1CM9A 1CZGA 1FNVA 1F2MA 5IIFA 3Q8AA 4RWSC 1F9PA 5HGTA 3C1EA 1Z6HA 3OPOA 3T16A 3AEEB 2HDMA 3NE5B 3FAHA 3SHLA 4Q5VA 1NEKB 5EE0A 3M7GA 1XXGA 2AQ2B 4ZHPA 2WXKA 2Q5WD 2BE5D 1Q8IA 2ONQA 3KWVA 1ET6A 2FBWB 3Q6SA 4KV6A 5K36H 3AE1B 1SE4A 2NMQA 5IOCA 2JA8B 4KHVA 2PKOA 2EJGC 5KIXA 1K8MA 1DONA 2RKSA 2K7VA 3ETRA 3WCQA 3B9JA 4BA1I 1Y1WB 2RDHA 3SDZA 4KK7A 5E6JA 4NDXA 2FHTA 3NVVA 2RDFA 2K6AA 2QKIC 5D14A 1C76A 5DM63 3MAQA 4RGMA 5C4JB 3PUYA 2GA4B 1FNWA 1A2TA 1JW9D 2BA0A 4NZLB 3NSWA 5IT9E 3IFDA 2QJLA 4A3FB 1HQRD 1QNKA 1S5DD 2JWUA 1W6JA 1Z47A 3VRBB 5M3FB 1VF7A 1V8CA 1BXTA 2HDEA 1O7ZA 3E0JA 1ZDVA 1WVLA 3NTHA 1YNJD 2VZKD 1QOGA 1WTOA 2B2VA 4RF1A 2A73B 5JVH3 1SNPA 2N0SB 2J52A 1HPCA 4XQJA 1IGCA 3EVQA 2B63B 1EL0A 1X3QA 4GDKB 4H7BA 2L1AA 1JOOA 2EOTA 1AP0A 4B0MA 2F4IA 2LGIA 5CV4A 1EY5A 4NAMA 1JORA 3BZDB 2G9HD 4IUNA 3DM1A 4OIJA 3M4YA 2OHFA 4CKEA 4C3HB 2MPMA 1JWMD 5LL6X 3IAM1 1DOKA 3S2DB 2EYHA 1SSNA 4YT0B 1CK1A 4AQ7A 3NUCA 1QKZA 1V97A 1GJXA 5EE3A 3MXUA 5KYLA 2DBYA 1K50A 3DWMA 1ZKOA 3S1RB 4C2MB 3TN2A 2LHEA 4ITKA 1SJHD 1JICA 2M56B 2KA7A 3MHZA 1SJED 2X69A 4RNAA 1BQQT 3K5LA 3LWUA 4A3KB 4ULLA 1CJEA 4XDXA 4G7OC 2LHDA 3RMHA 1BR9A 2WP9B 3HGBA 3R2TA 1PDQA 1KDBA 2KCCA 1PRTD 1SIJA 2L4NA 1LACA 1GB4A 4LK0M 4HSPA 5K5PA 1D5ZC 4YXDB 2RDGA 3HOZB 2WDVB 4RHRA 3FILB 1TT2A 2HTME 5KNDA 3D3RA 2IW3A 1E0BA 2F0HA 4E6IA 1YNND 3TMEA 4XT1B 4CGYB 1C78A 4YTNB 1TKEA 5CV7A 1DOIA 2A69D 5C4HA 1O7LA 5COYA 2MH7A 1PTOC 3K59A 3PUZA 4J3OD 2RVLA 2LY7A 2KVMA 5BMGA 2XWJB 2R7ZB 1U4PA 2XIWA 3SFEB 1C9FA 1F2ZA 2L32A 3CRKC 4M8AA 2F0EA 1GUWA 4M1UB 3KK7A 3AEAB 3J81L 3GB1A 3FVQA 5J22A 2WXLA 1EQTA 1PUTA 3ZJTA 1ONLA 4YSZB 4L63B 4U673 4UDUC 4Z9CB 1WGKA 2BBCA 1J9OA 3K5MA 1I6HB 1MD2D 2Q8TA 3A7LA 1GUNA 1QOAA