2LHDA

Gb98 solution structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords GB98
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lhdA00
1XCTL 2JZPA 5HI1A 1GB1A 2PW9A 2QMTA 1IBXB 1K52A 4WH4A 2NMQA 2J52A 5BMGA 3V3XA 2JSVX 1IGCA 1IGDA 4OZAA 2IGHA 4OZCA 2ZW1A 2QSDA 5HFYA 1K50A 3FILA 2J53A 1XF5L 2ONQA 1C9FA 1K51A 1F2RC 2IGDA 1XCQL 1KH0A 4KGSA 2RMMA 5HG2A 2GI9A 2GB1A 1IBXA 1MVKA 1GB4A 2N9LA 2K0PA 4OZBA 1FD6A 2KWDA 3UI3A 1QKZA 2LGIA 1PGAA 4IOIE 4MACA 4HKZE 1PGBA 2N7JA 1EM7A 1HZ6A 5HHDG 1P7EA 1HZ5A 2I2YA 1Q10A 2JU6X 2LUMA 5BMHA 1MPEA 2KACA 3MP9A 2ZW0A 1MHHE 2KDMA 2JWUA 2PLPA 2OEDA 2ON8A 1UWXA 1ZXHA 2LHDA 2N9KA 4GLSC 1P7FA 5BMIA 1K53A 4KGRA 4HJGE 2I38A 2RPVA 1D4BA 1FCLA 1F2RI 2EELA 2KQ4X 1PGXA 2PTLA 1MI0A 2JXTA 2KN4A 3FILB 3GB1A 1HEZE 4KGTA 2LHEA 4IKGA 1MHXA 1YNTE 1FCCC 1JMLA 4D2KA 1YMHE 5JXVA 2IGGA
chains in the Genus database with same CATH superfamily
4DBGA 2J0KA 3S2AA 1M4VA 2KFKB 2WXIA 5CHVC 2G1EA 4W9CA 2MJ3A 1TS2A 3MJ5A 2WXJA 4HPMB 2LWPA 3B08A 2FBWB 2L32A 2WDQB 3PGEA 1I4HA 5BO4B 2ZW1A 1Y56A 1ESFA 2GBMA 1QF6A 1N60A 1TS5A 2ASQA 2LXCA 5HFYA 3L16A 2J42A 1BXTA 4GDLA 3K9OB 2DAJA 2PEAA 3DWMA 5LLIA 1C79A 4BZAA 4NPNA 3U7ZA 1D3ZA 1FEHA 3RUIB 1SIJA 2KD0A 3MHSD 1EF1A 2WWZA 4HJKA 2LFIA 4I6NB 1WMHA 4NNJB 3P4RB 5AUIA 3Q6BA 2K0PA 4G11A 4ITKA 3AULA 2I1JA 2BWES 2XN9C 1PGBA 2QJLA 1I35A 3ZQ4A 2K6DB 2VZKB 1NBFC 4FJZA 1JALA 2ZCBA 4TV3A 5IA7A 3T3OA 4DXAB 4DDID 1HE8A 3BWUD 3I63C 4DXFA 2G4SA 3EGRA 1WGDA 1ZXHA 1F77A 3R8BA 2G45B 4EKUA 3NG0A 4GLSC 2K1FA 3M62B 3QWZB 3VFKA 2IY0B 2QDFA 1F2RI 1XLNA 5CTRC 3R7RA 3B2GA 1QILA 3VHTC 1RLFA 3RNFC 1WE7A 1D5XC 4EZJA 2JQRB 3VH3B 3VAWA 3L17A 2XBBC 3ETRA 1RAXA 1UBIA 1FD6A 1UNSA 1RWSA 2CKHB 1TBEA 4ZOHC 3AEAB 1K52A 4WQMA 1H8CA 4KVGB 2WXPA 4URKA 1XQQA 2LJ5A 2FE8A 1L0VB 3NVVA 2LGYA 1WRDB 3AEGB 4YSYB 3HIZA 4MEMA 2LMCA 4ANWA 2D5GA 2RGFA 1KH0A 1WYWB 3AEBB 3ZYYX 2GI9A 5IO9A 5C1ZA 1PFDA 1T0SC 2PVOD 1N61A 2KFJA 3KLSX 4NAWA 4MJSA 1ROEA 2BVCA 2VZKD 3PO0A 1FO4A 2INDC 4MACA 1V8CA 3V6EB 3N30A 1T0YA 1GOZA 2DX5B 1UZXB 5DPWA 2KX0A 1HTOA 2O2VA 2M0AA 2YEPB 1YX6B 4TQ0A 2KTFA 2JWUA 4ANUA 4K7SA 1NENB 3PT2B 5FR6A 4KDIC 2GBJA 1V49A 2GLSA 5E6JA 4QAYA 3DVGY 1D4BA 2L1AA 4PT5A 1WGKA 1TYGB 3DWGC 2XEWA 1MI0A 5JZEB 2JXTA 4WWOA 4RH6A 3VRAB 2BKFA 2MHJA 5JH5C 3AM9A 4FXCA 1Q1OA 4AP4C 1JMLA 2O6VB 1R4MI 1V9JA 1XCTL 3PRMB 1QLBB 2WXHA 4GN1A 3APFA 3V60A 2Z8LA 4AWJA 4KDLB 4C7ZA 1ET6A 2M17A 1V6EA 2K8BA 2KJHB 4N9F4 2KWCA 2TSSA 4BKTA 3BIID 2WXQA 3A9JA 3TEWA 2WX1A 3PPAA 1NDDA 2ONQA 4XX5A 3OG5A 2IGDA 5EE1A 1V1PA 4W9GA 3L10B 2JVCA 2KFKA 3UIOB 2DNFA 3AI5A 3AE1B 3H7SA 1ZW7A 2IYDB 5FKAC 5D2MB 3VVWB 1JWSD 4DHZE 3ZDMC 3BK2A 4NQKE 1VCBA 2N7DA 2L52A 2K5PA 5T8IA 2MWSB 1GJZA 2GOWA 4LK0M 3QK0A 2RDBC 3T9LA 2W9NA 2FCSA 4AQ7A 2FNJB 2L76A 4WQOB 1T0RC 3V61A 1YJIA 4WIPA 2M4NA 1SF0A 2O6VD 1R4NI 1FNUA 1FXIA 1TTNA 3U30A 2KHWB 1YNTE 4TSSA 3RNEC 1YMHE 2B3AA 3P4PB 1SIFA 2HJ8A 3Q3FA 2KX3A 1GB1A 1EU3A 3RNBC 3W5VB 3OWEB 1MG8A 1IBXB 5IKCM 1L0XB 3BY4B 2I1KA 3V3XA 2PKOA 2KAJA 2W54A 4DHZB 2KJ6A 2LJIA 4M0WA 2WU5B 1GNUA 2V3PA 4K3CA 1V80A 4OW0A 2IJ0A 5IOIA 4KIKA 4BOZB 1LQBA 4A9AA 3H6NA 2FUG1 4NAMA 2L00B 2C7NB 3ZDTA 4W9IA 3QX1A 4HKQA 3SU8X 1GB4A 1ZUD2 3RNCC 1F52A 1UUPA 2AL3A 4W9HA 3R3MA 4A3PA 1OQQA 1AN8A 2BB6A 1SXTA 3PLVA 2LUEA 2V9HA 4BKSA 3BINA 4JWUC 1EF5A 4L23A 5AZGA 5LXHA 2MH7A 3WIMA 3MP9A 3P4QB 1L2NA 3JYUA 3IVFA 1PQSA 2CHZA 1UWXA 2LHDA 1I42A 3ZO5B 2IO2B 2YLMA 1J7AA 1C4PA 2HTHA 3BVGA 4YSZB 3DBRB 1WJ6A 1ZXIA 1ENFA 3FAHA 1DYQA 3RNAC 4MSMB 2JT4B 3W1SA 3QJZA 1E7UA 4A20A 4W9EA 3NJTA 1SJED 2GBRA 3A9KB 4FHKA 1YN5A 3PV1A 3RFZB 3SR6A 4K81A 2NMQA 3VTVA 1LGRA 2J52A 4MM3A 3OJ4B 2J7QB 3B0AA 2N9XA 2NPTA 1V81A 1FM0D 5MPOA 4B6WA 1WXMA 2H88B 4ASWC 1XXGA 2MRPA 1BT0A 3JSVB 1C9FA 3OLMD 3AE6B 2WXOA 1H4RA 4WWMA 2M19A 3JW0X 5G55A 3AEDB 4JIOU 2KZRA 1YD8U 2MBHA 3DDCB 4B95A 1C77A 4JQWC 3VXWA 2BB5A 4OZBA 1I4RA 1UH6A 5D6JB 2V1YA 1F0ZA 2DBYA 4WJQA 4C00A 1UGJA 3NZUA 3AE7B 5EE0A 1SSNA 1AARA 5C2TB 4C4VB 2K8HA 5D3IB 1FXAA 2JWZA 2KDMA 3TBLD 3NVZA 2AQ1B 3V6CB 3B2FA 1I7HA 1RYJA 1P7FA 4HK2A 1K53A 3DVNV 1WR1A 3ZUNA 3V05A 2BT6A 4XC2A 1JWMD 1FIQA 4LDTB 2ZVOA 5HKHA 3TEYA 4F8CB 1SE4A 3Q8CA 1E7VA 3EECA 3KUCB 2IGGA 4W9JA 2W3SA 2DYMA 3TL5A 4XDDA 4WH4A 4IC7B 1L0YB 1RRBA 1ZPSA 4RM8A 2JSVX 1IGDA 5CHWA 2KTRA 4KSKC 3K9PB 1EUVB 2DYBA 2EKEC 2HJ1A 2AQ2B 3A4RA 1WJ4A 2JYEA 1XO3A 2D3GA 3SHQA 5EE3A 3LDZE 3T3NA 3GE3C 2MBEA 3VR8B 1IBXA 3IFWB 1WGHA 4RNAA 2E3TA 4B0MA 4EZKA 4NJ6A 4ZRPA 1OEYA 3KWLA 2LGSA 1WI0A 2AX5A 2V3NA 5JHAA 4JE3B 3ECIA 1XLPA 3KVFB 2YVCA 3DBLB 4ICVA 1MHHE 2D2QA 2BF8B 3TCAA 2LVQA 1BMLC 4HXDA 2BYEA 2AYOB 1SJHD 4FN2A 3Q3JA 2VH2A 2RPVA 2BS4B 3M63B 4LDTD 5DPRA 3ZNZB 2MW5A 2OHFA 2PTLA 3DPDA 2KN4A 4WJNA 2MP2B 4F7ZA 2WXMA 2FCNA 3DBHB 4HLEA 1DOYA 1AWDA 1TT5B 5C23A 2K3UA 2Z0EB 4USAA 3CMMB 5I4DA 4FJVB 1VD2A 3A1QA 1WJUA 1E8WA 1VDVA 2KC1A 4N6EB 1Q0WB 3DVGX 2XK5B 2LASA 1D6EC 3VUXA 1YIWA 3KH0A 1UD7A 2ZCCA 3IT4B 1C76A 2IGHA 2N4FA 4RGNA 4GXBA 4S0RA 3N1ZC 2CR5A 3BK1A 4G3XB 4NJ7A 4XWTA 4C56C 2UYZB 3NS8A 3J9CA 3RYTA 1NI3A 4H2AA 2BS3B 2KK8A 3ML9A 2CHXA 4I6LB 2D10A 4E74A 3N3KB 1WH3A 4K7WA 1E90A 1QOFA 3N1XC 3VUWA 3DOWA 4OVUA 1V86A 3A9KA 2DHZA 4XDCA 2DZIA 3Q3MC 3AN1A 4HKZE 1WGGA 2KWUB 1P9DU 5EDSA 4MDKE 2L0TA 2GMIC 1VRAB 1RFAA 2JU6X 5BMHA 1KM7A 2R2OA 2WDRB 2NBVB 3JSVA 3N1YC 4RF0A 1TZ1A 3TMPB 2Y5BB 1B9RA 3PZDA 4CYEA 5BMIA 4BBNF 4PS7A 2QHOA 4RF1A 4W9KA 1TS3A 4GB9A 1N63A 3CSFA 1WF9A 1X1MA 4M8NA 3NHEB 1F1HA 2WXNA 1QOGA 2ZEQA 1JW9D 2JXXA 4ZHPA 1PYWD 1L6UA 3AECB 1U4AA 3X0WA 1E10A 3ZJUA 4KV2A 4EUTA 3DBRI 1WXVA 4FLHA 1L4ZB 2KXJA 1UBQA 2PE6B 1UF0A 2KMMA 4ZDVA 3AE9B 3AU5A 4OZAA 3UGBB 1VZ7A 2DYOA 3H7PB 2KMAA 3RZWC 3V62A 4W9FA 4LNIA 3U4EG 1OQRA 1OFFA 3QHTA 1XF5L 2GBKA 3NZ3A 4ZYSA 4PYUA 1KOTA 4REZA 3U52E 1TKGA 2C7HA 4JGHB 2W82A 3PHWB 4W9DA 2W3RA 3CSTA 2MJEA 2N9LA 5IAAC 4IM2A 1T3QA 4GDKB 1L6VA 2KKCA 4A3OA 4ZHOA 2OOBB 5EE9A 2K22A 5FK9C 2L8JA 2KDEB 3IXSA 3PVLA 4US9A 3AE2B 3DHHC 3MTNB 4XE0A 1CJEA 4TKNA 2BS2B 4KZ0A 3R66C 4YL8A 1GUAB 2HE7A 1QZEA 3ZGZA 3B9JA 2G4DB 2NVUI 1QOBA 1J7BA 3O65B 4RGTA 3PHXB 1YOVB 4BAXA 1V5OA 3NRZA 2JUOA 4C80A 3RN9C 1I4XA 5LNK1 4RGOS 1CZPA 4EZLA 3C0RB 1DOXA 3GZNB 2X38A 3X23A 2ZNVC 3PRPB 2DZJA 4JWSC 4C7YA 4AS1A 5H92C 2QSDA 2Y5PA 3AEEB 3EA6A 1J8CA 1DOIA 1TJEA 3L08A 1WFYA 2Y5CA 1V1OA 2J53A 3HVDA 2DZKA 3RI7C 2N1VA 2V3SA 2WLBA 2W55A 5AEKB 2SAKA 4X57B 2ZNVB 3OJ3A 1S3SG 2RSUA 5G5GA 3IAM1 3ZXVA 3GP7A 2E6XA 2XK5A 2N0SB 4JLCA 4PS3A 1GG3A 5BYRA 5D7GA 4IDIA 2AQ3B 1FRDA 2MLBA 4HWIB 2ZVNA 2CS4A 3EUB2 3RULA 5KHQA 1P0RA 4K3BA 1L4DB 3H8HA 1YX5B 3NOBA 4GDLB 2MBBB 2WXKA 4HDQA 1LFDA 1IPGA 1E8ZA 2PE9A 3ZJTA 4US8A 2ON8A 3QC8B 4ANVA 3TIXA 4O1NA 3ZNGC 3MHZA 2ACZB 1JWUD 2K25A 1WMHB 1CQVA 1E8XA 3FC4A 1PGXA 1EO6A 3R2TA 4PYZA 1OGWA 3OAWA 3BYYB 3FILB 3HRDD 4KGTA 3DBLI 3AB5A 4IKGA 3ZJVA 4LTUA 4F1SA 2K39A 2WX0A 2DAFA 2WYQA 3VRBB 2WU2B 1I4GA 3RNGC 1KF6B 5HI1A 2PW9A 2KYWA 3ZIMA 3U8ZA 2RR9A 4WWNA 3C8YA 3RMKC 5BMGA 3Q14C 1XEEA 2JRHA 1OEYJ 2IBIB 2KOXA 2RDGA 3DBHI 4JX1C 1Q5WB 4ZRJA 2IO3B 5D94A 3P63A 3URYA 4IWOA 4BVUC 4OHJA 3EHVA 2EKIA 4LCDE 5HG2A 3UIPB 2SEBD 1WM3A 2KQSA 3GE8C 2Z59B 1F9JA 2LGIA 4IOIE 4E71A 2BGFA 2ICIA 1JQ4A 1ZP0B 3E56A 4KX6B 1N5WA 2MX2A 2O6VA 2BPSA 2JZZA 1WXSA 3QARA 3BVZA 2C9WB 3AEFB 4P7IA 4YTPB 2G9HD 2WNMA 2BKRB 1B1ZA 3ZKJC 2WXGA 1WGRA 1DGJA 3PS6A 3AV8A 2L83A 1KLUD 1ISNA 1TZOA 1SE9A 2FAZA 3SFDB 4NAWB 4KKIA 1HEZE 4RM9A 2BQQA 1P98A 3AXCA 4BBNC 3ZTCA 4ARIA 2NBWB 1TIFA 3TJPA 4HVBA 1MHXA 1NEKB 4JPSA 3N9YC 4HPLB 2O2VB 4ZRKA 4A8XC 1VZ8A 4MGKE 4EFOA 2B76B 4P6VF 2HDEA 5L83A 1FNVA 2C60A 2MEKA 3ENEA 4BFRA 3UINB 4GSWA 3VR9B 2OJRA 3A33B 3IHPC 4OZCA 1C3TA 3LXFA 1KFYB 2X8XX 5FR3A 3ABVB 2IZVB 1GC7A 2LXAA 2J0MA 1L5PA 2NR2A 4FBJB 2QIEB 1K8RB 4MGZE 5TR5A 2BBCA 3FKYA 1I4QA 4WAAA 2M1MA 3SEBA 2N7EA 2D3CA 3AH7A 2IPKD 3P1MA 1A70A 1R7SA 4IM0A 4IWQA 1WJNA 3BYTB 3W5UB 1R4NB 1MVKA 2KC2A 4E3CA 1FRRA 1EWCA 1JRUA 4OVZA 2D11A 2Z0DB 1XT9B 4LJOB 1WY8A 2KWDA 3MJWA 2KO3A 3UI3A 1QKZA 1JCKB 2V4LA 1C1YB 1SEBD 1ZE3D 3ZXRA 2G3QB 4KSLC 1JRPA 1LO5D 1HZ5A 2NCNA 3LB8C 4EOYA 3P2BA 3ZNID 1KLVA 1MFWA 2BYTA 2ZW0A 5J17A 4AJWA 4P16A 3HM6X 2M8SA 3VQIA 4XGAB 3IT6B 2PVGC 3Q8BA 1AW7A 3WA0A 1AYFA 1XLOA 2UU7A 1ZKHA 2C7MB 1WYGA 1ZOYB 2WHIA 2LEKA 1HTQA 4ARCA 2NBUA 2LHEA 1FNWA 4HDOA 1V5TA 2KMCA 4L1BA 2BW2A 3DQVA 5H8YE 1STEA 3I9V1 5J2RA 4W9LA 4IW0A 1J19A 1HXYD 2A4ZA 3E9SA 3IAS1 2L05A 4HCPB 2FIDA 4II3B 3ZNHB 4EEWA 1YJJA 1TGZB 1Z2MA 2LGDA 3APCA 1M94A 1FPYA 2H89B 4IG7B 1KJTA 4WAFA 4XWWA 3QAQA 1K50A 3HM3A 4ACFA 3FILA 1V97A 3RD2A 2KDFB 3WAMA 4HRSA 1XD3B 4P1CC 3GZNI 2HTME 2HD5B 1YQ3B 2C5LC 2MA9B 5L95C 1OTRB 2RMMA 4I6PA 4FA6A 3VDZA 3SDLC 2L3ZA 2ZPYA 2PPHA 4M01A 2FIFA 2KVZA 1P3QU 2J4XA 3BVMA 4RFBA 4NJCA 4GIVA 3N20C 1WSPA 1QT9A 4FADA 4M0WB 2I2YA 1NVID 5AZFA 3UF8A 2LUMA 1VZ6A 1MPEA 4IWPA 2XNAC 3MC0B 2KN5A 4KIKB 5LXIB 3I5JC 1D5MC 1EWYC 2PLPA 1E8YA 4B9KA 1MJDA 1WE6A 3NS1A 1ZDVA 3MFGA 2N9KA 4BOSC 2JX5A 3HUIA 4KGRA 1QQRA 5KHOA 4LNFA 2K9XA 4EE2A 1NI2A 2KQ4X 4LNKA 5DPTA 3C19A 2KVRA 2R2QA 2WDTB 1MG4A 4MSQB 3Q69A 2V4IB 3AE3B 3NY5A 2DLBA 1FCCC 2QCZA 3KWVA 4M02A 1E6EB 3RPFC 2KLGA 4B0EA 2N9PC 5DCNA 3UQAA 3AU4A 1JROA 4PS8A 2NTTA 2MBQA 3W1SC 4GGQA 5TSSA 5BYQA 1QOAA 2PJHA 3KW5B 3O13A 4J3OD 1IGCA 3T8MA 2CHWA 3ZLZA 5D3DA 1IP9A 1C4CA 3PSEB 3PTFC 2IO1B 2LRWA 3H1UA 2RDHA 4YTMB 3B1LX 5AUKA 5C3JB 4C4VA 1TKYA 4YTNB 2N9EB 2LD9A 4YT0B 1XCQL 4NZLB 3WAPA 2BTEA 3AMZA 4KGSA 2INPE 4WWPA 5AZHA 1JWBD 5G2NA 2K8CA 1KRHA 3EFUA 2R61A 3SD5A 2KJRA 3L4PA 5CX3A 1PUTA 1FXTB 1WX7A 3VUYA 1ET9A 4HROA 2ZZPB 3ALBA 2INNE 1J7CA 4MM3B 3ONSA 3PREA 2JYTA 2N7JA 1EM7A 2NPTB 1HZ6A 1OQYA 4M00A 1Q10A 3AE8B 4MH8A 4LNNA 3NUHB 2KT7A 2KACA 1SE2A 3EFCA 1L7YA 1UELA 1N5XA 4G0NB 3Q3NC 1V2YA 2RPQA 2KQ7A 4A6QA 4TMAB 4N59A 3I3TB 1FFUA 3PZ8A 4YWGG 5BYSA 2GBNA 1YQ4B 3W9CB 3L13A 1LM8B 3PZ7A 2WQYB 4BKSD 1GAQB 2KDBA 1IYFA 2WXLA 2NS5A 2KANA 2M0XA 1WRIA 1WX9A 2L0FA 5JXVA 3Q8FA 4N58A 4ZYNA 1NYQA 2CJNA 3CF6E 1PDXA 1T6BX 2K6QA 2JRIB 4MELA 3QIJA 5IP4D 4HCNB 2N1WA 3NVYA 5E6NA 2WP9B 2VH1A 2JY6A 3NZSA 2EMTA 4CQNA 4S17A 4A90A 1LXDA 2QILA 2MQJA 2DENB 4LNOA 2NTSA 2LGXA 4J6IA 3EC8A 4K1RB 3WAOA 3RZFA 3NVWA 3M95A 1F2RC 2IY1B 4YXDB 3WCQA 2MSED 3ZRFA 1YJ1A 2EMSA 1WZ3A 3QA8A 2JPHA 4DQOC 1SE3A 4BKGA 3KUZA 4DXGA 3BZDB 2AEHA 3L54A 1PGAA 2MP2A 3DBSA 2WGSA 2KWVB 2KTRB 1WX8A 3IBEA 4UDUC 4ZRQA 5HHDG 1G6JA 2LI5A 1NYRA 1TY0A 4WJOA 5GMVA 2CJOA 4II2B 3KYCD 4DHJB 1YN4A 1ZDXA 3KQ4A 4MGIE 3TEZA 2DWQA 4FHJA 5E6PA 4G50A 3VTWA 2J0JA 1TY2A 2IDYA 1WR6E 4HPPA 4JL9A 1WXAA 1XLQA 2PMVA 1FCLA 3HK0A 2EELA 2OJWA 5G5HA 1CMXB 4Q2JA 1E7PB 4OVVA 5J18A 4FJYA 1VJKA 4M8MA 4R3DA 3N32A 4RMAA 2FCMA 1N62A 2MJDA 4WURA 3JVZX 1WWTA 1I4PA 1SBBB 1T5XD 3IG3A 2JZPA 2RD0A 3RT3B 1RM6C 2ZJDA 4LJPB 2WDVB 1WM2A 3QCAA 3W1YA 1WIAA 4XZ4A 1E9MA 2YEPF 2BYFA 4ZRIA 3R2IA 4L2YA 1C4AA 3APDA 3WANA 1JWAD 2MCNB 4AUQC 2PIAA 2LRUA 3WALA 1E5WA 2UWQA 1YQBA 2IO0B 3A1QB 1UWMA 4PK1A 3PRZA 4TUUA 4AOFA 3Q3OC 1E0ZA 3UQBA 1FFVA 4DHJD 1FMAD 1P7EA 4ICUA 4NY0A 2Y3AA 1UGMA 3HHMA 4MH0E 3MC9A 4MT5A 2D3BA 3TUOA 4ANXA 1KTKA 1P1AA 1CK1A 3VH4B 5DPSA 1R4MB 5GXGB 4DK5A 2WXRA 3MC8A 2AL6A 3KUDB 4A55A 3ZVVA 2A5UA 4XYCA 3CIRB 3H7PA 1RFKA 1WXQA 1EU4A 2D07B 4KZCA 2JZ3B 3KYDD 4AJYB 1A5RA 3TSSA 3SFEB 2AWTA 2KDIA 2ZPNA 3DCGA 2VRRB 2M56B 2KNBA 4GMVA 2REXA 2D3AA 1Y8RC 3LJ3A 1J0GA 4DDGD 3VTUA 3ZRCA 2QMTA 4RGMA 2L7RA 4KKJA 2V0GA 3CWIA 4DWFA 3AE4B 4NQLB 1WZ0A 4MJSB 1N6ZA 4GDKA 3RCZA 2LZ6A 2INCC 4P1BC 2DZMA 1D5ZC 3U7DA 2KLCA 4TQ1A 5E6OA 2FCQA 2JF5A 2QC8A 1YN3A 2LVPA 3AE5B 4CO7A 1WGYA 1Z5SB 2FUHB 1K51A 1HQRD 1SB3C 2BYVE 2WS3B 5IN7A 1VR9A 3Q2AC 3L0WB 3HVZA 4GOCA 3QQ8B 2GB1A 4YSXB 3GS2A 5CHFA 2QEJC 4MGYE 2BWFA 1ZGUB 3R7QA 3P4SB 2CU1A 4IM3A 2LVOA 3M3JA 3DHGC 1GC6A 5JHBA 3H9DA 3U2SC 3DVNU 1TKEA 4K7UA 3GOEA 1IUEA 2CU3A 2WXFA 1ACCA 1C78A 4HEA1 1BUIC 2OEDA 1T0QC 2GRIA 1S1QB 3Q8AA 4HJGE 3P42A 1GPXA 2MBOA 2I38A 4LLGM 3Q8EA 3I57A 4GU2A 4IUMB 3TEXA 4RCOA 3ZTDA 3W2DA 3GB1A 3A9JB 3LYYA 4CHKA 3ZW3A 3DHIC 3PLUA 4WJPA 2Q5WD 1SGHA 1VLBA 1KLGD 3ML8A 1HA5A 4D2KA 1V1PB 3D32A 3A4SC 4FULA 1TS4A
chains in the Genus database with same CATH topology
4RGOS 1CZPA 1M4VA 2WXIA 1JROA 2NTTA 1SJED 1DOXA 2G1EA 1YN5A 5TSSA 3RFZB 2X38A 3SR6A 2MJ3A 1TS2A 2NMQA 2WXJA 1QOAA 3MJ5A 2J52A 3O13A 4J3OD 5BYQA 1IGCA 2FBWB 2L32A 2WDQB 4JWSC 4C7YA 1I4HA 5D3DA 4AS1A 1C4CA 2ZW1A 5H92C 1FM0D 1Y56A 5MPOA 1ESFA 2QSDA 2RDHA 1N60A 1TS5A 2Y5PA 3AEEB 3EA6A 5HFYA 1QF6A 1DOIA 4YTMB 1TJEA 2J42A 5AUKA 2H88B 5C3JB 2Y5CA 1V1OA 1BXTA 1XXGA 2J53A 3HVDA 1TKYA 4YTNB 3DWMA 1C9FA 1C79A 2WLBA 2WXOA 3AE6B 2W55A 3U7ZA 1FEHA 4YT0B 1XCQL 4NZLB 2SAKA 4WWMA 2M19A 2BTEA 1SIJA 3AEDB 3AMZA 4KGSA 2INPE 5G5GA 1JWBD 3IAM1 2LFIA 1KRHA 1C77A 2R61A 3P4RB 5AUIA 3GP7A 3L4PA 2E6XA 1PUTA 2BB5A 2K0PA 4ITKA 4OZBA 1ET9A 2N0SB 1I4RA 4HROA 2XN9C 5BYRA 5D7GA 4IDIA 2AQ3B 1J7CA 1FRDA 2INNE 3EUB2 4MM3B 1PGBA 2QJLA 1F0ZA 2DBYA 2JYTA 2N7JA 1EM7A 2VZKB 1HZ6A 1UGJA 1JALA 3ZQ4A 3T3OA 3AE7B 1Q10A 3AE8B 1L4DB 3BWUD 3H8HA 4GDLB 4MH8A 3NUHB 5EE0A 1SSNA 2KACA 4DXFA 1SE2A 5C2TB 2WXKA 5D3IB 3EGRA 1N5XA 1FXAA 2KDMA 3NVZA 2AQ1B 3ZJTA 4US8A 2ON8A 1ZXHA 1F77A 3R8BA 3B2FA 4A6QA 4TMAB 4O1NA 1I7HA 4N59A 4GLSC 1FFUA 1RYJA 3MHZA 3PZ8A 1P7FA 4YWGG 5BYSA 2ACZB 1K53A 1JWUD 1CQVA 1YQ4B 3W9CB 1F2RI 1XLNA 3B2GA 3FC4A 1PGXA 1QILA 3V05A 3R2TA 3PZ7A 2WQYB 3BYYB 3FILB 2BT6A 1D5XC 3HRDD 4KGTA 1GAQB 1JWMD 2JQRB 3AB5A 4IKGA 4LTUA 1FIQA 3ZJVA 3TEYA 2WXLA 1SE4A 3ETRA 3Q8CA 3VRBB 1WRIA 2WU2B 1I4GA 5JXVA 3Q8FA 4N58A 1FD6A 1UNSA 2IGGA 2W3SA 1KF6B 1NYQA 5HI1A 1RWSA 2CJNA 2PW9A 1PDXA 1T6BX 2DYMA 4XDDA 4ZOHC 3AEAB 1K52A 4WH4A 1L0YB 1ZPSA 3NVYA 3C8YA 5BMGA 4WQMA 2JSVX 2WP9B 1XEEA 1IGDA 4CQNA 4A90A 2WXPA 2RDGA 2QILA 4JX1C 2FE8A 1L0VB 2NTSA 3NVVA 3AEGB 4YSYB 3NVWA 2AQ2B 2JYEA 2LMCA 3P63A 3URYA 1XO3A 1F2RC 4YXDB 2D5GA 3WCQA 4OHJA 1KH0A 3AEBB 2EKIA 5EE3A 3ZYYX 3T3NA 5HG2A 2GI9A 3VR8B 1IBXA 2SEBD 4RNAA 1PFDA 2PVOD 1N61A 2E3TA 4B0MA 4DQOC 1SE3A 3KLSX 4ZRPA 1ROEA 4DXGA 2VZKD 3PO0A 3BZDB 2LGIA 1PGAA 4IOIE 3KWLA 1FO4A 4MACA 1V8CA 2ICIA 1JQ4A 1ZP0B 3E56A 4UDUC 1GOZA 2AX5A 4KX6B 4ZRQA 5HHDG 2V3NA 1N5WA 4JE3B 1NYRA 1TY0A 1XLPA 2M0AA 2CJOA 2YEPB 3BVZA 1YN4A 3AEFB 1MHHE 4TQ0A 1ZDXA 3KQ4A 4YTPB 3TEZA 2G9HD 2JWUA 2DWQA 1NENB 1BMLC 2WNMA 1B1ZA 1TY2A 2WXGA 2IDYA 1DGJA 1SJHD 3AV8A 2L83A 1KLUD 5E6JA 1TZOA 1XLQA 2PMVA 2RPVA 1D4BA 2BS4B 1FCLA 2L1AA 3SFDB 2EELA 4PT5A 1WGKA 4NAWB 5G5HA 1TYGB 3DWGC 4KKIA 2OHFA 2PTLA 1MI0A 4Q2JA 2JXTA 2KN4A 1HEZE 1E7PB 1VJKA 4RH6A 3VRAB 2WXMA 4R3DA 4ARIA 3AM9A 4FXCA 1MHXA 1NEKB 1N62A 2MJDA 4JPSA 1JMLA 4WURA 1DOYA 3N9YC 1AWDA 1WWTA 1I4PA 1SBBB 2K3UA 1T5XD 4A8XC 1XCTL 1VZ8A 2JZPA 4USAA 5I4DA 1QLBB 2B76B 4P6VF 2HDEA 2WXHA 1RM6C 1FNVA 1VDVA 4N6EB 2MEKA 2Z8LA 1D6EC 3VR9B 2WDVB 3IT4B 4C7ZA 1ET6A 1C76A 2IGHA 4OZCA 4RGNA 3LXFA 1KFYB 2TSSA 5FR3A 1E9MA 3ABVB 2YEPF 3BIID 3BK1A 2WXQA 1L5PA 4XWTA 4C56C 2QIEB 3TEWA 3R2IA 4L2YA 3J9CA 1NI3A 4H2AA 1C4AA 2BBCA 2BS3B 2ONQA 1I4QA 1JWAD 2IGDA 5EE1A 3SEBA 2PIAA 3AH7A 2IPKD 1V1PA 3P1MA 1QOFA 1A70A 1R7SA 3BYTB 3W5UB 1MVKA 3AE1B 4XDCA 1FRRA 1EWCA 4OVZA 3AN1A 1UWMA 2KWDA 3UI3A 1QKZA 5FKAC 1JCKB 1SEBD 4HKZE 1ZE3D 1JWSD 1E0ZA 3BK2A 1FFVA 1FMAD 1JRPA 1P7EA 1LO5D 1HZ5A 3LB8C 1VRAB 2JU6X 2Y3AA 2L52A 5BMHA 2K5PA 2BYTA 2WDRB 2ZW0A 4MT5A 3TUOA 4RF0A 4P16A 5T8IA 1KTKA 1CK1A 3VQIA 1B9RA 5GXGB 3IT6B 4LK0M 2PVGC 2WXRA 3Q8BA 5BMIA 1AW7A 4RF1A 4A55A 1AYFA 1XLOA 1TS3A 3CIRB 1RFKA 1N63A 4AQ7A 1WYGA 1ZOYB 2LEKA 1WXQA 1EU4A 4ARCA 1YJIA 4WIPA 1SF0A 2LHEA 1FNWA 1FNUA 1FXIA 2WXNA 2BW2A 1QOGA 4L1BA 1YNTE 3TSSA 4TSSA 3SFEB 1JW9D 5H8YE 1YMHE 2M56B 4ZHPA 3P4PB 1STEA 1PYWD 1L6UA 3AECB 1E10A 3I9V1 1GB1A 3ZJUA 1EU3A 2QMTA 3W5VB 1HXYD 3IAS1 3E9SA 3OWEB 4KKJA 4RGMA 3CWIA 2V0GA 1IBXB 3AE4B 1L0XB 1L4ZB 3V3XA 2PKOA 2KAJA 1YJJA 2W54A 2H89B 2KMMA 3AE9B 4OZAA 2LJIA 1VZ7A 2DYOA 4WAFA 4M0WA 1D5ZC 4XWWA 2WU5B 2V3PA 1K50A 3FILA 4TQ1A 1V97A 4OW0A 2IJ0A 3U4EG 1OQRA 1OFFA 1YN3A 3AE5B 1XF5L 3NZ3A 4ZYSA 4A9AA 1K51A 4HRSA 1HQRD 1SB3C 2FUG1 4NAMA 2HTME 2WS3B 1VR9A 4REZA 1YQ3B 3HVZA 3U52E 1TKGA 2RMMA 4HKQA 2GB1A 4YSXB 2W82A 3GS2A 1GB4A 2W3RA 1ZUD2 2QEJC 2MJEA 2N9LA 1UUPA 3P4SB 1T3QA 4GDKB 1L6VA 1OQQA 1AN8A 2J4XA 3BVMA 2BB6A 4RFBA 4NJCA 4ZHOA 1SXTA 1WSPA 1QT9A 3U2SC 5EE9A 2K22A 5FK9C 4JWUC 1TKEA 2I2YA 1NVID 4L23A 2LUMA 1VZ6A 1MPEA 1IUEA 2XNAC 3IXSA 3MC0B 4US9A 2MH7A 2CU3A 2WXFA 3MP9A 3P4QB 1D5MC 3AE2B 1EWYC 1ACCA 1C78A 2PLPA 4HEA1 4XE0A 1BUIC 1CJEA 2OEDA 2BS2B 1UWXA 3NS1A 1ZDVA 2LHDA 3MFGA 2GRIA 2N9KA 2JX5A 3ZGZA 3Q8AA 3HUIA 4KGRA 4HJGE 3B9JA 3P42A 1GPXA 1J7AA 1C4PA 1QQRA 2I38A 4LLGM 3BVGA 4YSZB 2K9XA 4EE2A 2KQ4X 3I57A 3Q8EA 1QOBA 3TEXA 1J7BA 4RCOA 4RGTA 3W2DA 3GB1A 1ZXIA 3LYYA 1ENFA 3FAHA 1DYQA 3Q69A 2V4IB 3AE3B 3NRZA 2Q5WD 2DLBA 3W1SA 1FCCC 3KWVA 1VLBA 4C80A 1KLGD 4D2KA 1HA5A 1I4XA 1E6EB 5LNK1 3RPFC 1V1PB 4B0EA 1TS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCT L;  2JZP A;  5HI1 A;  1GB1 A;  2PW9 A;  2QMT A;  1IBX B;  1K52 A;  4WH4 A;  2NMQ A;  2J52 A;  5BMG A;  3V3X A;  2JSV X;  1IGC A;  1IGD A;  4OZA A;  2IGH A;  4OZC A;  2ZW1 A;  2QSD A;  5HFY A;  1K50 A;  3FIL A;  2J53 A;  1XF5 L;  2ONQ A;  1C9F A;  1K51 A;  1F2R C;  2IGD A;  1XCQ L;  1KH0 A;  4KGS A;  2RMM A;  5HG2 A;  2GI9 A;  2GB1 A;  1IBX A;  1MVK A;  1GB4 A;  2N9L A;  2K0P A;  4OZB A;  1FD6 A;  2KWD A;  3UI3 A;  1QKZ A;  2LGI A;  1PGA A;  4IOI E;  4MAC A;  4HKZ E;  1PGB A;  2N7J A;  1EM7 A;  1HZ6 A;  5HHD G;  1P7E A;  1HZ5 A;  2I2Y A;  1Q10 A;  2JU6 X;  2LUM A;  5BMH A;  1MPE A;  2KAC A;  3MP9 A;  2ZW0 A;  1MHH E;  2KDM A;  2JWU A;  2PLP A;  2OED A;  2ON8 A;  1UWX A;  1ZXH A;  2LHD A;  2N9K A;  4GLS C;  1P7F A;  5BMI A;  1K53 A;  4KGR A;  4HJG E;  2I38 A;  2RPV A;  1D4B A;  1FCL A;  1F2R I;  2EEL A;  2KQ4 X;  1PGX A;  2PTL A;  1MI0 A;  2JXT A;  2KN4 A;  3FIL B;  3GB1 A;  1HEZ E;  4KGT A;  2LHE A;  4IKG A;  1MHX A;  1YNT E;  1FCC C;  1JML A;  4D2K A;  1YMH E;  5JXV A;  2IGG A; 
#chains in the Genus database with same CATH topology
 4DBG A;  2J0K A;  3S2A A;  1M4V A;  2KFK B;  2WXI A;  5CHV C;  2G1E A;  4W9C A;  2MJ3 A;  1TS2 A;  3MJ5 A;  2WXJ A;  4HPM B;  2LWP A;  3B08 A;  2FBW B;  2L32 A;  2WDQ B;  3PGE A;  1I4H A;  5BO4 B;  2ZW1 A;  1Y56 A;  1ESF A;  2GBM A;  1QF6 A;  1N60 A;  1TS5 A;  2ASQ A;  2LXC A;  5HFY A;  3L16 A;  2J42 A;  1BXT A;  4GDL A;  3K9O B;  2DAJ A;  2PEA A;  3DWM A;  5LLI A;  1C79 A;  4BZA A;  4NPN A;  3U7Z A;  1D3Z A;  1FEH A;  3RUI B;  1SIJ A;  2KD0 A;  3MHS D;  1EF1 A;  2WWZ A;  4HJK A;  2LFI A;  4I6N B;  1WMH A;  4NNJ B;  3P4R B;  5AUI A;  3Q6B A;  2K0P A;  4G11 A;  4ITK A;  3AUL A;  2I1J A;  2BWE S;  2XN9 C;  1PGB A;  2QJL A;  1I35 A;  3ZQ4 A;  2K6D B;  2VZK B;  1NBF C;  4FJZ A;  1JAL A;  2ZCB A;  4TV3 A;  5IA7 A;  3T3O A;  4DXA B;  4DDI D;  1HE8 A;  3BWU D;  3I63 C;  4DXF A;  2G4S A;  3EGR A;  1WGD A;  1ZXH A;  1F77 A;  3R8B A;  2G45 B;  4EKU A;  3NG0 A;  4GLS C;  2K1F A;  3M62 B;  3QWZ B;  3VFK A;  2IY0 B;  2QDF A;  1F2R I;  1XLN A;  5CTR C;  3R7R A;  3B2G A;  1QIL A;  3VHT C;  1RLF A;  3RNF C;  1WE7 A;  1D5X C;  4EZJ A;  2JQR B;  3VH3 B;  3VAW A;  3L17 A;  2XBB C;  3ETR A;  1RAX A;  1UBI A;  1FD6 A;  1UNS A;  1RWS A;  2CKH B;  1TBE A;  4ZOH C;  3AEA B;  1K52 A;  4WQM A;  1H8C A;  4KVG B;  2WXP A;  4URK A;  1XQQ A;  2LJ5 A;  2FE8 A;  1L0V B;  3NVV A;  2LGY A;  1WRD B;  3AEG B;  4YSY B;  3HIZ A;  4MEM A;  2LMC A;  4ANW A;  2D5G A;  2RGF A;  1KH0 A;  1WYW B;  3AEB B;  3ZYY X;  2GI9 A;  5IO9 A;  5C1Z A;  1PFD A;  1T0S C;  2PVO D;  1N61 A;  2KFJ A;  3KLS X;  4NAW A;  4MJS A;  1ROE A;  2BVC A;  2VZK D;  3PO0 A;  1FO4 A;  2IND C;  4MAC A;  1V8C A;  3V6E B;  3N30 A;  1T0Y A;  1GOZ A;  2DX5 B;  1UZX B;  5DPW A;  2KX0 A;  1HTO A;  2O2V A;  2M0A A;  2YEP B;  1YX6 B;  4TQ0 A;  2KTF A;  2JWU A;  4ANU A;  4K7S A;  1NEN B;  3PT2 B;  5FR6 A;  4KDI C;  2GBJ A;  1V49 A;  2GLS A;  5E6J A;  4QAY A;  3DVG Y;  1D4B A;  2L1A A;  4PT5 A;  1WGK A;  1TYG B;  3DWG C;  2XEW A;  1MI0 A;  5JZE B;  2JXT A;  4WWO A;  4RH6 A;  3VRA B;  2BKF A;  2MHJ A;  5JH5 C;  3AM9 A;  4FXC A;  1Q1O A;  4AP4 C;  1JML A;  2O6V B;  1R4M I;  1V9J A;  1XCT L;  3PRM B;  1QLB B;  2WXH A;  4GN1 A;  3APF A;  3V60 A;  2Z8L A;  4AWJ A;  4KDL B;  4C7Z A;  1ET6 A;  2M17 A;  1V6E A;  2K8B A;  2KJH B;  4N9F 4;  2KWC A;  2TSS A;  4BKT A;  3BII D;  2WXQ A;  3A9J A;  3TEW A;  2WX1 A;  3PPA A;  1NDD A;  2ONQ A;  4XX5 A;  3OG5 A;  2IGD A;  5EE1 A;  1V1P A;  4W9G A;  3L10 B;  2JVC A;  2KFK A;  3UIO B;  2DNF A;  3AI5 A;  3AE1 B;  3H7S A;  1ZW7 A;  2IYD B;  5FKA C;  5D2M B;  3VVW B;  1JWS D;  4DHZ E;  3ZDM C;  3BK2 A;  4NQK E;  1VCB A;  2N7D A;  2L52 A;  2K5P A;  5T8I A;  2MWS B;  1GJZ A;  2GOW A;  4LK0 M;  3QK0 A;  2RDB C;  3T9L A;  2W9N A;  2FCS A;  4AQ7 A;  2FNJ B;  2L76 A;  4WQO B;  1T0R C;  3V61 A;  1YJI A;  4WIP A;  2M4N A;  1SF0 A;  2O6V D;  1R4N I;  1FNU A;  1FXI A;  1TTN A;  3U30 A;  2KHW B;  1YNT E;  4TSS A;  3RNE C;  1YMH E;  2B3A A;  3P4P B;  1SIF A;  2HJ8 A;  3Q3F A;  2KX3 A;  1GB1 A;  1EU3 A;  3RNB C;  3W5V B;  3OWE B;  1MG8 A;  1IBX B;  5IKC M;  1L0X B;  3BY4 B;  2I1K A;  3V3X A;  2PKO A;  2KAJ A;  2W54 A;  4DHZ B;  2KJ6 A;  2LJI A;  4M0W A;  2WU5 B;  1GNU A;  2V3P A;  4K3C A;  1V80 A;  4OW0 A;  2IJ0 A;  5IOI A;  4KIK A;  4BOZ B;  1LQB A;  4A9A A;  3H6N A;  2FUG 1;  4NAM A;  2L00 B;  2C7N B;  3ZDT A;  4W9I A;  3QX1 A;  4HKQ A;  3SU8 X;  1GB4 A;  1ZUD 2;  3RNC C;  1F52 A;  1UUP A;  2AL3 A;  4W9H A;  3R3M A;  4A3P A;  1OQQ A;  1AN8 A;  2BB6 A;  1SXT A;  3PLV A;  2LUE A;  2V9H A;  4BKS A;  3BIN A;  4JWU C;  1EF5 A;  4L23 A;  5AZG A;  5LXH A;  2MH7 A;  3WIM A;  3MP9 A;  3P4Q B;  1L2N A;  3JYU A;  3IVF A;  1PQS A;  2CHZ A;  1UWX A;  2LHD A;  1I42 A;  3ZO5 B;  2IO2 B;  2YLM A;  1J7A A;  1C4P A;  2HTH A;  3BVG A;  4YSZ B;  3DBR B;  1WJ6 A;  1ZXI A;  1ENF A;  3FAH A;  1DYQ A;  3RNA C;  4MSM B;  2JT4 B;  3W1S A;  3QJZ A;  1E7U A;  4A20 A;  4W9E A;  3NJT A;  1SJE D;  2GBR A;  3A9K B;  4FHK A;  1YN5 A;  3PV1 A;  3RFZ B;  3SR6 A;  4K81 A;  2NMQ A;  3VTV A;  1LGR A;  2J52 A;  4MM3 A;  3OJ4 B;  2J7Q B;  3B0A A;  2N9X A;  2NPT A;  1V81 A;  1FM0 D;  5MPO A;  4B6W A;  1WXM A;  2H88 B;  4ASW C;  1XXG A;  2MRP A;  1BT0 A;  3JSV B;  1C9F A;  3OLM D;  3AE6 B;  2WXO A;  1H4R A;  4WWM A;  2M19 A;  3JW0 X;  5G55 A;  3AED B;  4JIO U;  2KZR A;  1YD8 U;  2MBH A;  3DDC B;  4B95 A;  1C77 A;  4JQW C;  3VXW A;  2BB5 A;  4OZB A;  1I4R A;  1UH6 A;  5D6J B;  2V1Y A;  1F0Z A;  2DBY A;  4WJQ A;  4C00 A;  1UGJ A;  3NZU A;  3AE7 B;  5EE0 A;  1SSN A;  1AAR A;  5C2T B;  4C4V B;  2K8H A;  5D3I B;  1FXA A;  2JWZ A;  2KDM A;  3TBL D;  3NVZ A;  2AQ1 B;  3V6C B;  3B2F A;  1I7H A;  1RYJ A;  1P7F A;  4HK2 A;  1K53 A;  3DVN V;  1WR1 A;  3ZUN A;  3V05 A;  2BT6 A;  4XC2 A;  1JWM D;  1FIQ A;  4LDT B;  2ZVO A;  5HKH A;  3TEY A;  4F8C B;  1SE4 A;  3Q8C A;  1E7V A;  3EEC A;  3KUC B;  2IGG A;  4W9J A;  2W3S A;  2DYM A;  3TL5 A;  4XDD A;  4WH4 A;  4IC7 B;  1L0Y B;  1RRB A;  1ZPS A;  4RM8 A;  2JSV X;  1IGD A;  5CHW A;  2KTR A;  4KSK C;  3K9P B;  1EUV B;  2DYB A;  2EKE C;  2HJ1 A;  2AQ2 B;  3A4R A;  1WJ4 A;  2JYE A;  1XO3 A;  2D3G A;  3SHQ A;  5EE3 A;  3LDZ E;  3T3N A;  3GE3 C;  2MBE A;  3VR8 B;  1IBX A;  3IFW B;  1WGH A;  4RNA A;  2E3T A;  4B0M A;  4EZK A;  4NJ6 A;  4ZRP A;  1OEY A;  3KWL A;  2LGS A;  1WI0 A;  2AX5 A;  2V3N A;  5JHA A;  4JE3 B;  3ECI A;  1XLP A;  3KVF B;  2YVC A;  3DBL B;  4ICV A;  1MHH E;  2D2Q A;  2BF8 B;  3TCA A;  2LVQ A;  1BML C;  4HXD A;  2BYE A;  2AYO B;  1SJH D;  4FN2 A;  3Q3J A;  2VH2 A;  2RPV A;  2BS4 B;  3M63 B;  4LDT D;  5DPR A;  3ZNZ B;  2MW5 A;  2OHF A;  2PTL A;  3DPD A;  2KN4 A;  4WJN A;  2MP2 B;  4F7Z A;  2WXM A;  2FCN A;  3DBH B;  4HLE A;  1DOY A;  1AWD A;  1TT5 B;  5C23 A;  2K3U A;  2Z0E B;  4USA A;  3CMM B;  5I4D A;  4FJV B;  1VD2 A;  3A1Q A;  1WJU A;  1E8W A;  1VDV A;  2KC1 A;  4N6E B;  1Q0W B;  3DVG X;  2XK5 B;  2LAS A;  1D6E C;  3VUX A;  1YIW A;  3KH0 A;  1UD7 A;  2ZCC A;  3IT4 B;  1C76 A;  2IGH A;  2N4F A;  4RGN A;  4GXB A;  4S0R A;  3N1Z C;  2CR5 A;  3BK1 A;  4G3X B;  4NJ7 A;  4XWT A;  4C56 C;  2UYZ B;  3NS8 A;  3J9C A;  3RYT A;  1NI3 A;  4H2A A;  2BS3 B;  2KK8 A;  3ML9 A;  2CHX A;  4I6L B;  2D10 A;  4E74 A;  3N3K B;  1WH3 A;  4K7W A;  1E90 A;  1QOF A;  3N1X C;  3VUW A;  3DOW A;  4OVU A;  1V86 A;  3A9K A;  2DHZ A;  4XDC A;  2DZI A;  3Q3M C;  3AN1 A;  4HKZ E;  1WGG A;  2KWU B;  1P9D U;  5EDS A;  4MDK E;  2L0T A;  2GMI C;  1VRA B;  1RFA A;  2JU6 X;  5BMH A;  1KM7 A;  2R2O A;  2WDR B;  2NBV B;  3JSV A;  3N1Y C;  4RF0 A;  1TZ1 A;  3TMP B;  2Y5B B;  1B9R A;  3PZD A;  4CYE A;  5BMI A;  4BBN F;  4PS7 A;  2QHO A;  4RF1 A;  4W9K A;  1TS3 A;  4GB9 A;  1N63 A;  3CSF A;  1WF9 A;  1X1M A;  4M8N A;  3NHE B;  1F1H A;  2WXN A;  1QOG A;  2ZEQ A;  1JW9 D;  2JXX A;  4ZHP A;  1PYW D;  1L6U A;  3AEC B;  1U4A A;  3X0W A;  1E10 A;  3ZJU A;  4KV2 A;  4EUT A;  3DBR I;  1WXV A;  4FLH A;  1L4Z B;  2KXJ A;  1UBQ A;  2PE6 B;  1UF0 A;  2KMM A;  4ZDV A;  3AE9 B;  3AU5 A;  4OZA A;  3UGB B;  1VZ7 A;  2DYO A;  3H7P B;  2KMA A;  3RZW C;  3V62 A;  4W9F A;  4LNI A;  3U4E G;  1OQR A;  1OFF A;  3QHT A;  1XF5 L;  2GBK A;  3NZ3 A;  4ZYS A;  4PYU A;  1KOT A;  4REZ A;  3U52 E;  1TKG A;  2C7H A;  4JGH B;  2W82 A;  3PHW B;  4W9D A;  2W3R A;  3CST A;  2MJE A;  2N9L A;  5IAA C;  4IM2 A;  1T3Q A;  4GDK B;  1L6V A;  2KKC A;  4A3O A;  4ZHO A;  2OOB B;  5EE9 A;  2K22 A;  5FK9 C;  2L8J A;  2KDE B;  3IXS A;  3PVL A;  4US9 A;  3AE2 B;  3DHH C;  3MTN B;  4XE0 A;  1CJE A;  4TKN A;  2BS2 B;  4KZ0 A;  3R66 C;  4YL8 A;  1GUA B;  2HE7 A;  1QZE A;  3ZGZ A;  3B9J A;  2G4D B;  2NVU I;  1QOB A;  1J7B A;  3O65 B;  4RGT A;  3PHX B;  1YOV B;  4BAX A;  1V5O A;  3NRZ A;  2JUO A;  4C80 A;  3RN9 C;  1I4X A;  5LNK 1;  4RGO S;  1CZP A;  4EZL A;  3C0R B;  1DOX A;  3GZN B;  2X38 A;  3X23 A;  2ZNV C;  3PRP B;  2DZJ A;  4JWS C;  4C7Y A;  4AS1 A;  5H92 C;  2QSD A;  2Y5P A;  3AEE B;  3EA6 A;  1J8C A;  1DOI A;  1TJE A;  3L08 A;  1WFY A;  2Y5C A;  1V1O A;  2J53 A;  3HVD A;  2DZK A;  3RI7 C;  2N1V A;  2V3S A;  2WLB A;  2W55 A;  5AEK B;  2SAK A;  4X57 B;  2ZNV B;  3OJ3 A;  1S3S G;  2RSU A;  5G5G A;  3IAM 1;  3ZXV A;  3GP7 A;  2E6X A;  2XK5 A;  2N0S B;  4JLC A;  4PS3 A;  1GG3 A;  5BYR A;  5D7G A;  4IDI A;  2AQ3 B;  1FRD A;  2MLB A;  4HWI B;  2ZVN A;  2CS4 A;  3EUB 2;  3RUL A;  5KHQ A;  1P0R A;  4K3B A;  1L4D B;  3H8H A;  1YX5 B;  3NOB A;  4GDL B;  2MBB B;  2WXK A;  4HDQ A;  1LFD A;  1IPG A;  1E8Z A;  2PE9 A;  3ZJT A;  4US8 A;  2ON8 A;  3QC8 B;  4ANV A;  3TIX A;  4O1N A;  3ZNG C;  3MHZ A;  2ACZ B;  1JWU D;  2K25 A;  1WMH B;  1CQV A;  1E8X A;  3FC4 A;  1PGX A;  1EO6 A;  3R2T A;  4PYZ A;  1OGW A;  3OAW A;  3BYY B;  3FIL B;  3HRD D;  4KGT A;  3DBL I;  3AB5 A;  4IKG A;  3ZJV A;  4LTU A;  4F1S A;  2K39 A;  2WX0 A;  2DAF A;  2WYQ A;  3VRB B;  2WU2 B;  1I4G A;  3RNG C;  1KF6 B;  5HI1 A;  2PW9 A;  2KYW A;  3ZIM A;  3U8Z A;  2RR9 A;  4WWN A;  3C8Y A;  3RMK C;  5BMG A;  3Q14 C;  1XEE A;  2JRH A;  1OEY J;  2IBI B;  2KOX A;  2RDG A;  3DBH I;  4JX1 C;  1Q5W B;  4ZRJ A;  2IO3 B;  5D94 A;  3P63 A;  3URY A;  4IWO A;  4BVU C;  4OHJ A;  3EHV A;  2EKI A;  4LCD E;  5HG2 A;  3UIP B;  2SEB D;  1WM3 A;  2KQS A;  3GE8 C;  2Z59 B;  1F9J A;  2LGI A;  4IOI E;  4E71 A;  2BGF A;  2ICI A;  1JQ4 A;  1ZP0 B;  3E56 A;  4KX6 B;  1N5W A;  2MX2 A;  2O6V A;  2BPS A;  2JZZ A;  1WXS A;  3QAR A;  3BVZ A;  2C9W B;  3AEF B;  4P7I A;  4YTP B;  2G9H D;  2WNM A;  2BKR B;  1B1Z A;  3ZKJ C;  2WXG A;  1WGR A;  1DGJ A;  3PS6 A;  3AV8 A;  2L83 A;  1KLU D;  1ISN A;  1TZO A;  1SE9 A;  2FAZ A;  3SFD B;  4NAW B;  4KKI A;  1HEZ E;  4RM9 A;  2BQQ A;  1P98 A;  3AXC A;  4BBN C;  3ZTC A;  4ARI A;  2NBW B;  1TIF A;  3TJP A;  4HVB A;  1MHX A;  1NEK B;  4JPS A;  3N9Y C;  4HPL B;  2O2V B;  4ZRK A;  4A8X C;  1VZ8 A;  4MGK E;  4EFO A;  2B76 B;  4P6V F;  2HDE A;  5L83 A;  1FNV A;  2C60 A;  2MEK A;  3ENE A;  4BFR A;  3UIN B;  4GSW A;  3VR9 B;  2OJR A;  3A33 B;  3IHP C;  4OZC A;  1C3T A;  3LXF A;  1KFY B;  2X8X X;  5FR3 A;  3ABV B;  2IZV B;  1GC7 A;  2LXA A;  2J0M A;  1L5P A;  2NR2 A;  4FBJ B;  2QIE B;  1K8R B;  4MGZ E;  5TR5 A;  2BBC A;  3FKY A;  1I4Q A;  4WAA A;  2M1M A;  3SEB A;  2N7E A;  2D3C A;  3AH7 A;  2IPK D;  3P1M A;  1A70 A;  1R7S A;  4IM0 A;  4IWQ A;  1WJN A;  3BYT B;  3W5U B;  1R4N B;  1MVK A;  2KC2 A;  4E3C A;  1FRR A;  1EWC A;  1JRU A;  4OVZ A;  2D11 A;  2Z0D B;  1XT9 B;  4LJO B;  1WY8 A;  2KWD A;  3MJW A;  2KO3 A;  3UI3 A;  1QKZ A;  1JCK B;  2V4L A;  1C1Y B;  1SEB D;  1ZE3 D;  3ZXR A;  2G3Q B;  4KSL C;  1JRP A;  1LO5 D;  1HZ5 A;  2NCN A;  3LB8 C;  4EOY A;  3P2B A;  3ZNI D;  1KLV A;  1MFW A;  2BYT A;  2ZW0 A;  5J17 A;  4AJW A;  4P16 A;  3HM6 X;  2M8S A;  3VQI A;  4XGA B;  3IT6 B;  2PVG C;  3Q8B A;  1AW7 A;  3WA0 A;  1AYF A;  1XLO A;  2UU7 A;  1ZKH A;  2C7M B;  1WYG A;  1ZOY B;  2WHI A;  2LEK A;  1HTQ A;  4ARC A;  2NBU A;  2LHE A;  1FNW A;  4HDO A;  1V5T A;  2KMC A;  4L1B A;  2BW2 A;  3DQV A;  5H8Y E;  1STE A;  3I9V 1;  5J2R A;  4W9L A;  4IW0 A;  1J19 A;  1HXY D;  2A4Z A;  3E9S A;  3IAS 1;  2L05 A;  4HCP B;  2FID A;  4II3 B;  3ZNH B;  4EEW A;  1YJJ A;  1TGZ B;  1Z2M A;  2LGD A;  3APC A;  1M94 A;  1FPY A;  2H89 B;  4IG7 B;  1KJT A;  4WAF A;  4XWW A;  3QAQ A;  1K50 A;  3HM3 A;  4ACF A;  3FIL A;  1V97 A;  3RD2 A;  2KDF B;  3WAM A;  4HRS A;  1XD3 B;  4P1C C;  3GZN I;  2HTM E;  2HD5 B;  1YQ3 B;  2C5L C;  2MA9 B;  5L95 C;  1OTR B;  2RMM A;  4I6P A;  4FA6 A;  3VDZ A;  3SDL C;  2L3Z A;  2ZPY A;  2PPH A;  4M01 A;  2FIF A;  2KVZ A;  1P3Q U;  2J4X A;  3BVM A;  4RFB A;  4NJC A;  4GIV A;  3N20 C;  1WSP A;  1QT9 A;  4FAD A;  4M0W B;  2I2Y A;  1NVI D;  5AZF A;  3UF8 A;  2LUM A;  1VZ6 A;  1MPE A;  4IWP A;  2XNA C;  3MC0 B;  2KN5 A;  4KIK B;  5LXI B;  3I5J C;  1D5M C;  1EWY C;  2PLP A;  1E8Y A;  4B9K A;  1MJD A;  1WE6 A;  3NS1 A;  1ZDV A;  3MFG A;  2N9K A;  4BOS C;  2JX5 A;  3HUI A;  4KGR A;  1QQR A;  5KHO A;  4LNF A;  2K9X A;  4EE2 A;  1NI2 A;  2KQ4 X;  4LNK A;  5DPT A;  3C19 A;  2KVR A;  2R2Q A;  2WDT B;  1MG4 A;  4MSQ B;  3Q69 A;  2V4I B;  3AE3 B;  3NY5 A;  2DLB A;  1FCC C;  2QCZ A;  3KWV A;  4M02 A;  1E6E B;  3RPF C;  2KLG A;  4B0E A;  2N9P C;  5DCN A;  3UQA A;  3AU4 A;  1JRO A;  4PS8 A;  2NTT A;  2MBQ A;  3W1S C;  4GGQ A;  5TSS A;  5BYQ A;  1QOA A;  2PJH A;  3KW5 B;  3O13 A;  4J3O D;  1IGC A;  3T8M A;  2CHW A;  3ZLZ A;  5D3D A;  1IP9 A;  1C4C A;  3PSE B;  3PTF C;  2IO1 B;  2LRW A;  3H1U A;  2RDH A;  4YTM B;  3B1L X;  5AUK A;  5C3J B;  4C4V A;  1TKY A;  4YTN B;  2N9E B;  2LD9 A;  4YT0 B;  1XCQ L;  4NZL B;  3WAP A;  2BTE A;  3AMZ A;  4KGS A;  2INP E;  4WWP A;  5AZH A;  1JWB D;  5G2N A;  2K8C A;  1KRH A;  3EFU A;  2R61 A;  3SD5 A;  2KJR A;  3L4P A;  5CX3 A;  1PUT A;  1FXT B;  1WX7 A;  3VUY A;  1ET9 A;  4HRO A;  2ZZP B;  3ALB A;  2INN E;  1J7C A;  4MM3 B;  3ONS A;  3PRE A;  2JYT A;  2N7J A;  1EM7 A;  2NPT B;  1HZ6 A;  1OQY A;  4M00 A;  1Q10 A;  3AE8 B;  4MH8 A;  4LNN A;  3NUH B;  2KT7 A;  2KAC A;  1SE2 A;  3EFC A;  1L7Y A;  1UEL A;  1N5X A;  4G0N B;  3Q3N C;  1V2Y A;  2RPQ A;  2KQ7 A;  4A6Q A;  4TMA B;  4N59 A;  3I3T B;  1FFU A;  3PZ8 A;  4YWG G;  5BYS A;  2GBN A;  1YQ4 B;  3W9C B;  3L13 A;  1LM8 B;  3PZ7 A;  2WQY B;  4BKS D;  1GAQ B;  2KDB A;  1IYF A;  2WXL A;  2NS5 A;  2KAN A;  2M0X A;  1WRI A;  1WX9 A;  2L0F A;  5JXV A;  3Q8F A;  4N58 A;  4ZYN A;  1NYQ A;  2CJN A;  3CF6 E;  1PDX A;  1T6B X;  2K6Q A;  2JRI B;  4MEL A;  3QIJ A;  5IP4 D;  4HCN B;  2N1W A;  3NVY A;  5E6N A;  2WP9 B;  2VH1 A;  2JY6 A;  3NZS A;  2EMT A;  4CQN A;  4S17 A;  4A90 A;  1LXD A;  2QIL A;  2MQJ A;  2DEN B;  4LNO A;  2NTS A;  2LGX A;  4J6I A;  3EC8 A;  4K1R B;  3WAO A;  3RZF A;  3NVW A;  3M95 A;  1F2R C;  2IY1 B;  4YXD B;  3WCQ A;  2MSE D;  3ZRF A;  1YJ1 A;  2EMS A;  1WZ3 A;  3QA8 A;  2JPH A;  4DQO C;  1SE3 A;  4BKG A;  3KUZ A;  4DXG A;  3BZD B;  2AEH A;  3L54 A;  1PGA A;  2MP2 A;  3DBS A;  2WGS A;  2KWV B;  2KTR B;  1WX8 A;  3IBE A;  4UDU C;  4ZRQ A;  5HHD G;  1G6J A;  2LI5 A;  1NYR A;  1TY0 A;  4WJO A;  5GMV A;  2CJO A;  4II2 B;  3KYC D;  4DHJ B;  1YN4 A;  1ZDX A;  3KQ4 A;  4MGI E;  3TEZ A;  2DWQ A;  4FHJ A;  5E6P A;  4G50 A;  3VTW A;  2J0J A;  1TY2 A;  2IDY A;  1WR6 E;  4HPP A;  4JL9 A;  1WXA A;  1XLQ A;  2PMV A;  1FCL A;  3HK0 A;  2EEL A;  2OJW A;  5G5H A;  1CMX B;  4Q2J A;  1E7P B;  4OVV A;  5J18 A;  4FJY A;  1VJK A;  4M8M A;  4R3D A;  3N32 A;  4RMA A;  2FCM A;  1N62 A;  2MJD A;  4WUR A;  3JVZ X;  1WWT A;  1I4P A;  1SBB B;  1T5X D;  3IG3 A;  2JZP A;  2RD0 A;  3RT3 B;  1RM6 C;  2ZJD A;  4LJP B;  2WDV B;  1WM2 A;  3QCA A;  3W1Y A;  1WIA A;  4XZ4 A;  1E9M A;  2YEP F;  2BYF A;  4ZRI A;  3R2I A;  4L2Y A;  1C4A A;  3APD A;  3WAN A;  1JWA D;  2MCN B;  4AUQ C;  2PIA A;  2LRU A;  3WAL A;  1E5W A;  2UWQ A;  1YQB A;  2IO0 B;  3A1Q B;  1UWM A;  4PK1 A;  3PRZ A;  4TUU A;  4AOF A;  3Q3O C;  1E0Z A;  3UQB A;  1FFV A;  4DHJ D;  1FMA D;  1P7E A;  4ICU A;  4NY0 A;  2Y3A A;  1UGM A;  3HHM A;  4MH0 E;  3MC9 A;  4MT5 A;  2D3B A;  3TUO A;  4ANX A;  1KTK A;  1P1A A;  1CK1 A;  3VH4 B;  5DPS A;  1R4M B;  5GXG B;  4DK5 A;  2WXR A;  3MC8 A;  2AL6 A;  3KUD B;  4A55 A;  3ZVV A;  2A5U A;  4XYC A;  3CIR B;  3H7P A;  1RFK A;  1WXQ A;  1EU4 A;  2D07 B;  4KZC A;  2JZ3 B;  3KYD D;  4AJY B;  1A5R A;  3TSS A;  3SFE B;  2AWT A;  2KDI A;  2ZPN A;  3DCG A;  2VRR B;  2M56 B;  2KNB A;  4GMV A;  2REX A;  2D3A A;  1Y8R C;  3LJ3 A;  1J0G A;  4DDG D;  3VTU A;  3ZRC A;  2QMT A;  4RGM A;  2L7R A;  4KKJ A;  2V0G A;  3CWI A;  4DWF A;  3AE4 B;  4NQL B;  1WZ0 A;  4MJS B;  1N6Z A;  4GDK A;  3RCZ A;  2LZ6 A;  2INC C;  4P1B C;  2DZM A;  1D5Z C;  3U7D A;  2KLC A;  4TQ1 A;  5E6O A;  2FCQ A;  2JF5 A;  2QC8 A;  1YN3 A;  2LVP A;  3AE5 B;  4CO7 A;  1WGY A;  1Z5S B;  2FUH B;  1K51 A;  1HQR D;  1SB3 C;  2BYV E;  2WS3 B;  5IN7 A;  1VR9 A;  3Q2A C;  3L0W B;  3HVZ A;  4GOC A;  3QQ8 B;  2GB1 A;  4YSX B;  3GS2 A;  5CHF A;  2QEJ C;  4MGY E;  2BWF A;  1ZGU B;  3R7Q A;  3P4S B;  2CU1 A;  4IM3 A;  2LVO A;  3M3J A;  3DHG C;  1GC6 A;  5JHB A;  3H9D A;  3U2S C;  3DVN U;  1TKE A;  4K7U A;  3GOE A;  1IUE A;  2CU3 A;  2WXF A;  1ACC A;  1C78 A;  4HEA 1;  1BUI C;  2OED A;  1T0Q C;  2GRI A;  1S1Q B;  3Q8A A;  4HJG E;  3P42 A;  1GPX A;  2MBO A;  2I38 A;  4LLG M;  3Q8E A;  3I57 A;  4GU2 A;  4IUM B;  3TEX A;  4RCO A;  3ZTD A;  3W2D A;  3GB1 A;  3A9J B;  3LYY A;  4CHK A;  3ZW3 A;  3DHI C;  3PLU A;  4WJP A;  2Q5W D;  1SGH A;  1VLB A;  1KLG D;  3ML8 A;  1HA5 A;  4D2K A;  1V1P B;  3D32 A;  3A4S C;  4FUL A;  1TS4 A; 
#chains in the Genus database with same CATH homology
 4RGO S;  1CZP A;  1M4V A;  2WXI A;  1JRO A;  2NTT A;  1SJE D;  1DOX A;  2G1E A;  1YN5 A;  5TSS A;  3RFZ B;  2X38 A;  3SR6 A;  2MJ3 A;  1TS2 A;  2NMQ A;  2WXJ A;  1QOA A;  3MJ5 A;  2J52 A;  3O13 A;  4J3O D;  5BYQ A;  1IGC A;  2FBW B;  2L32 A;  2WDQ B;  4JWS C;  4C7Y A;  1I4H A;  5D3D A;  4AS1 A;  1C4C A;  2ZW1 A;  5H92 C;  1FM0 D;  1Y56 A;  5MPO A;  1ESF A;  2QSD A;  2RDH A;  1N60 A;  1TS5 A;  2Y5P A;  3AEE B;  3EA6 A;  5HFY A;  1QF6 A;  1DOI A;  4YTM B;  1TJE A;  2J42 A;  5AUK A;  2H88 B;  5C3J B;  2Y5C A;  1V1O A;  1BXT A;  1XXG A;  2J53 A;  3HVD A;  1TKY A;  4YTN B;  3DWM A;  1C9F A;  1C79 A;  2WLB A;  2WXO A;  3AE6 B;  2W55 A;  3U7Z A;  1FEH A;  4YT0 B;  1XCQ L;  4NZL B;  2SAK A;  4WWM A;  2M19 A;  2BTE A;  1SIJ A;  3AED B;  3AMZ A;  4KGS A;  2INP E;  5G5G A;  1JWB D;  3IAM 1;  2LFI A;  1KRH A;  1C77 A;  2R61 A;  3P4R B;  5AUI A;  3GP7 A;  3L4P A;  2E6X A;  1PUT A;  2BB5 A;  2K0P A;  4ITK A;  4OZB A;  1ET9 A;  2N0S B;  1I4R A;  4HRO A;  2XN9 C;  5BYR A;  5D7G A;  4IDI A;  2AQ3 B;  1J7C A;  1FRD A;  2INN E;  3EUB 2;  4MM3 B;  1PGB A;  2QJL A;  1F0Z A;  2DBY A;  2JYT A;  2N7J A;  1EM7 A;  2VZK B;  1HZ6 A;  1UGJ A;  1JAL A;  3ZQ4 A;  3T3O A;  3AE7 B;  1Q10 A;  3AE8 B;  1L4D B;  3BWU D;  3H8H A;  4GDL B;  4MH8 A;  3NUH B;  5EE0 A;  1SSN A;  2KAC A;  4DXF A;  1SE2 A;  5C2T B;  2WXK A;  5D3I B;  3EGR A;  1N5X A;  1FXA A;  2KDM A;  3NVZ A;  2AQ1 B;  3ZJT A;  4US8 A;  2ON8 A;  1ZXH A;  1F77 A;  3R8B A;  3B2F A;  4A6Q A;  4TMA B;  4O1N A;  1I7H A;  4N59 A;  4GLS C;  1FFU A;  1RYJ A;  3MHZ A;  3PZ8 A;  1P7F A;  4YWG G;  5BYS A;  2ACZ B;  1K53 A;  1JWU D;  1CQV A;  1YQ4 B;  3W9C B;  1F2R I;  1XLN A;  3B2G A;  3FC4 A;  1PGX A;  1QIL A;  3V05 A;  3R2T A;  3PZ7 A;  2WQY B;  3BYY B;  3FIL B;  2BT6 A;  1D5X C;  3HRD D;  4KGT A;  1GAQ B;  1JWM D;  2JQR B;  3AB5 A;  4IKG A;  4LTU A;  1FIQ A;  3ZJV A;  3TEY A;  2WXL A;  1SE4 A;  3ETR A;  3Q8C A;  3VRB B;  1WRI A;  2WU2 B;  1I4G A;  5JXV A;  3Q8F A;  4N58 A;  1FD6 A;  1UNS A;  2IGG A;  2W3S A;  1KF6 B;  1NYQ A;  5HI1 A;  1RWS A;  2CJN A;  2PW9 A;  1PDX A;  1T6B X;  2DYM A;  4XDD A;  4ZOH C;  3AEA B;  1K52 A;  4WH4 A;  1L0Y B;  1ZPS A;  3NVY A;  3C8Y A;  5BMG A;  4WQM A;  2JSV X;  2WP9 B;  1XEE A;  1IGD A;  4CQN A;  4A90 A;  2WXP A;  2RDG A;  2QIL A;  4JX1 C;  2FE8 A;  1L0V B;  2NTS A;  3NVV A;  3AEG B;  4YSY B;  3NVW A;  2AQ2 B;  2JYE A;  2LMC A;  3P63 A;  3URY A;  1XO3 A;  1F2R C;  4YXD B;  2D5G A;  3WCQ A;  4OHJ A;  1KH0 A;  3AEB B;  2EKI A;  5EE3 A;  3ZYY X;  3T3N A;  5HG2 A;  2GI9 A;  3VR8 B;  1IBX A;  2SEB D;  4RNA A;  1PFD A;  2PVO D;  1N61 A;  2E3T A;  4B0M A;  4DQO C;  1SE3 A;  3KLS X;  4ZRP A;  1ROE A;  4DXG A;  2VZK D;  3PO0 A;  3BZD B;  2LGI A;  1PGA A;  4IOI E;  3KWL A;  1FO4 A;  4MAC A;  1V8C A;  2ICI A;  1JQ4 A;  1ZP0 B;  3E56 A;  4UDU C;  1GOZ A;  2AX5 A;  4KX6 B;  4ZRQ A;  5HHD G;  2V3N A;  1N5W A;  4JE3 B;  1NYR A;  1TY0 A;  1XLP A;  2M0A A;  2CJO A;  2YEP B;  3BVZ A;  1YN4 A;  3AEF B;  1MHH E;  4TQ0 A;  1ZDX A;  3KQ4 A;  4YTP B;  3TEZ A;  2G9H D;  2JWU A;  2DWQ A;  1NEN B;  1BML C;  2WNM A;  1B1Z A;  1TY2 A;  2WXG A;  2IDY A;  1DGJ A;  1SJH D;  3AV8 A;  2L83 A;  1KLU D;  5E6J A;  1TZO A;  1XLQ A;  2PMV A;  2RPV A;  1D4B A;  2BS4 B;  1FCL A;  2L1A A;  3SFD B;  2EEL A;  4PT5 A;  1WGK A;  4NAW B;  5G5H A;  1TYG B;  3DWG C;  4KKI A;  2OHF A;  2PTL A;  1MI0 A;  4Q2J A;  2JXT A;  2KN4 A;  1HEZ E;  1E7P B;  1VJK A;  4RH6 A;  3VRA B;  2WXM A;  4R3D A;  4ARI A;  3AM9 A;  4FXC A;  1MHX A;  1NEK B;  1N62 A;  2MJD A;  4JPS A;  1JML A;  4WUR A;  1DOY A;  3N9Y C;  1AWD A;  1WWT A;  1I4P A;  1SBB B;  2K3U A;  1T5X D;  4A8X C;  1XCT L;  1VZ8 A;  2JZP A;  4USA A;  5I4D A;  1QLB B;  2B76 B;  4P6V F;  2HDE A;  2WXH A;  1RM6 C;  1FNV A;  1VDV A;  4N6E B;  2MEK A;  2Z8L A;  1D6E C;  3VR9 B;  2WDV B;  3IT4 B;  4C7Z A;  1ET6 A;  1C76 A;  2IGH A;  4OZC A;  4RGN A;  3LXF A;  1KFY B;  2TSS A;  5FR3 A;  1E9M A;  3ABV B;  2YEP F;  3BII D;  3BK1 A;  2WXQ A;  1L5P A;  4XWT A;  4C56 C;  2QIE B;  3TEW A;  3R2I A;  4L2Y A;  3J9C A;  1NI3 A;  4H2A A;  1C4A A;  2BBC A;  2BS3 B;  2ONQ A;  1I4Q A;  1JWA D;  2IGD A;  5EE1 A;  3SEB A;  2PIA A;  3AH7 A;  2IPK D;  1V1P A;  3P1M A;  1QOF A;  1A70 A;  1R7S A;  3BYT B;  3W5U B;  1MVK A;  3AE1 B;  4XDC A;  1FRR A;  1EWC A;  4OVZ A;  3AN1 A;  1UWM A;  2KWD A;  3UI3 A;  1QKZ A;  5FKA C;  1JCK B;  1SEB D;  4HKZ E;  1ZE3 D;  1JWS D;  1E0Z A;  3BK2 A;  1FFV A;  1FMA D;  1JRP A;  1P7E A;  1LO5 D;  1HZ5 A;  3LB8 C;  1VRA B;  2JU6 X;  2Y3A A;  2L52 A;  5BMH A;  2K5P A;  2BYT A;  2WDR B;  2ZW0 A;  4MT5 A;  3TUO A;  4RF0 A;  4P16 A;  5T8I A;  1KTK A;  1CK1 A;  3VQI A;  1B9R A;  5GXG B;  3IT6 B;  4LK0 M;  2PVG C;  2WXR A;  3Q8B A;  5BMI A;  1AW7 A;  4RF1 A;  4A55 A;  1AYF A;  1XLO A;  1TS3 A;  3CIR B;  1RFK A;  1N63 A;  4AQ7 A;  1WYG A;  1ZOY B;  2LEK A;  1WXQ A;  1EU4 A;  4ARC A;  1YJI A;  4WIP A;  1SF0 A;  2LHE A;  1FNW A;  1FNU A;  1FXI A;  2WXN A;  2BW2 A;  1QOG A;  4L1B A;  1YNT E;  3TSS A;  4TSS A;  3SFE B;  1JW9 D;  5H8Y E;  1YMH E;  2M56 B;  4ZHP A;  3P4P B;  1STE A;  1PYW D;  1L6U A;  3AEC B;  1E10 A;  3I9V 1;  1GB1 A;  3ZJU A;  1EU3 A;  2QMT A;  3W5V B;  1HXY D;  3IAS 1;  3E9S A;  3OWE B;  4KKJ A;  4RGM A;  3CWI A;  2V0G A;  1IBX B;  3AE4 B;  1L0X B;  1L4Z B;  3V3X A;  2PKO A;  2KAJ A;  1YJJ A;  2W54 A;  2H89 B;  2KMM A;  3AE9 B;  4OZA A;  2LJI A;  1VZ7 A;  2DYO A;  4WAF A;  4M0W A;  1D5Z C;  4XWW A;  2WU5 B;  2V3P A;  1K50 A;  3FIL A;  4TQ1 A;  1V97 A;  4OW0 A;  2IJ0 A;  3U4E G;  1OQR A;  1OFF A;  1YN3 A;  3AE5 B;  1XF5 L;  3NZ3 A;  4ZYS A;  4A9A A;  1K51 A;  4HRS A;  1HQR D;  1SB3 C;  2FUG 1;  4NAM A;  2HTM E;  2WS3 B;  1VR9 A;  4REZ A;  1YQ3 B;  3HVZ A;  3U52 E;  1TKG A;  2RMM A;  4HKQ A;  2GB1 A;  4YSX B;  2W82 A;  3GS2 A;  1GB4 A;  2W3R A;  1ZUD 2;  2QEJ C;  2MJE A;  2N9L A;  1UUP A;  3P4S B;  1T3Q A;  4GDK B;  1L6V A;  1OQQ A;  1AN8 A;  2J4X A;  3BVM A;  2BB6 A;  4RFB A;  4NJC A;  4ZHO A;  1SXT A;  1WSP A;  1QT9 A;  3U2S C;  5EE9 A;  2K22 A;  5FK9 C;  4JWU C;  1TKE A;  2I2Y A;  1NVI D;  4L23 A;  2LUM A;  1VZ6 A;  1MPE A;  1IUE A;  2XNA C;  3IXS A;  3MC0 B;  4US9 A;  2MH7 A;  2CU3 A;  2WXF A;  3MP9 A;  3P4Q B;  1D5M C;  3AE2 B;  1EWY C;  1ACC A;  1C78 A;  2PLP A;  4HEA 1;  4XE0 A;  1BUI C;  1CJE A;  2OED A;  2BS2 B;  1UWX A;  3NS1 A;  1ZDV A;  2LHD A;  3MFG A;  2GRI A;  2N9K A;  2JX5 A;  3ZGZ A;  3Q8A A;  3HUI A;  4KGR A;  4HJG E;  3B9J A;  3P42 A;  1GPX A;  1J7A A;  1C4P A;  1QQR A;  2I38 A;  4LLG M;  3BVG A;  4YSZ B;  2K9X A;  4EE2 A;  2KQ4 X;  3I57 A;  3Q8E A;  1QOB A;  3TEX A;  1J7B A;  4RCO A;  4RGT A;  3W2D A;  3GB1 A;  1ZXI A;  3LYY A;  1ENF A;  3FAH A;  1DYQ A;  3Q69 A;  2V4I B;  3AE3 B;  3NRZ A;  2Q5W D;  2DLB A;  3W1S A;  1FCC C;  3KWV A;  1VLB A;  4C80 A;  1KLG D;  4D2K A;  1HA5 A;  1I4X A;  1E6E B;  5LNK 1;  3RPF C;  1V1P B;  4B0E A;  1TS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...