2LHDA

Gb98 solution structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GB98
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lhdA00
2JZPA 2EELA 1ZXHA 1XCTL 1GB4A 1K50A 1XCQL 2KQ4X 2PW9A 2J52A 1K52A 5BMHA 1MI0A 1D4BA 1HZ5A 1XF5L 2I2YA 1F2RI 5BMIA 2ZW0A 1P7FA 1FCCC 2KWDA 4IKGA 4MACA 2KDMA 4KGRA 2PLPA 4HKZE 2LHEA 2JWUA 2GB1A 2ONQA 2GI9A 2N9LA 4KGTA 1UWXA 3UI3A 2LGIA 2PTLA 5HG2A 1F2RC 2N7JA 4OZBA 1IBXB 2I38A 1MPEA 2N9KA 5HFYA 1MHXA 1KH0A 1PGXA 1JMLA 2LUMA 2IGHA 2QSDA 2JU6X 1K53A 1YMHE 5HI1A 1PGAA 2OEDA 2IGDA 5BMGA 2ON8A 4KGSA 4OZAA 1IGCA 2QMTA 1P7EA 2NMQA 1YNTE 4IOIE 1HZ6A 1QKZA 3FILA 1PGBA 4WH4A 1GB1A 2IGGA 2JXTA 4D2KA 1MHHE 1IGDA 3V3XA 3FILB 2ZW1A 1FD6A 3GB1A 2RMMA 1C9FA 2KACA 1Q10A 4HJGE 4OZCA 1FCLA 1HEZE 2J53A 2LHDA 2JSVX 2RPVA 1MVKA 1IBXA 5HHDG 1K51A 3MP9A 2KN4A 5JXVA 2K0PA 4GLSC 1EM7A
chains in the Genus database with same CATH superfamily
5JH5C 1WR6E 2V3SA 1EU4A 2BWES 2KVZA 3RZFA 3N32A 2WXNA 1TS5A 5D6JB 1N5WA 1VLBA 1N6ZA 1FXTB 2D3GA 1HXYD 2JQRB 4WJQA 3OG5A 2M0XA 2K39A 2L0FA 2PE6B 1UWXA 3VXWA 2K8HA 4NY0A 4NAWB 1LFDA 1DOIA 4ANWA 1WXMA 2A5UA 2O2VB 1SGHA 3RFZB 4MSMB 4W9LA 2K6DB 2DZKA 3AU4A 3PV1A 1I35A 1Q5WB 1WR1A 1PGAA 1D3ZA 2MRPA 4KGSA 3NZ3A 4LNNA 3DHIC 2BW2A 1TKYA 3ML9A 1V1PA 1IPGA 4XYCA 2O6VD 3SFDB 1RLFA 4WWPA 2ZEQA 2UU7A 2I1KA 2LMCA 1RYJA 3I5JC 2K1FA 4WAFA 2KQSA 3UQAA 4JLCA 2JXTA 1E7PB 1G6JA 3Q8AA 3RNCC 2KHWB 3L13A 1JALA 5L83A 1C9FA 4HDOA 2PJHA 4OVZA 4XE0A 3T9LA 4GDKA 1V81A 4IWOA 2NR2A 5LNK1 1OGWA 2M0AA 2L1AA 1XEEA 5EE3A 1J7BA 3NVYA 4RGOS 1C77A 2EELA 3TEWA 5G5HA 4II2B 4M00A 1VCBA 3ZXVA 3GZNB 4N6EB 3MC0B 1K52A 3I57A 5CTRC 3BY4B 4E3CA 1F2RI 3MFGA 2ZW0A 3HK0A 3BVZA 1TIFA 4IKGA 1EUVB 4BKTA 4FJYA 4FHJA 4W9KA 2HDEA 4I6NB 4N9F4 3KYCD 4HRSA 2M17A 1QOFA 3PO0A 4UDUC 1YJ1A 1FPYA 3UI3A 5D7GA 5HG2A 1NEKB 3QWZB 3QAQA 5EE9A 4RF0A 1WE6A 3KWVA 1V97A 2IY1B 1WJNA 4XC2A 2GRIA 2BGFA 1KRHA 3OLMD 2DYBA 2NBVB 3JYUA 2OEDA 2HTHA 3DBLB 3DCGA 3UF8A 1QF6A 3HIZA 1WGHA 2K8BA 3Q3NC 2Z0EB 4CQNA 1R7SA 3WAOA 1R4MB 3GZNI 1XT9B 4ZRJA 2N7DA 2C7MB 2G1EA 5AUIA 2JVCA 3AEDB 5GMVA 1C79A 4PT5A 3ABVB 4M01A 4C4VA 4MGKE 1BUIC 3APCA 4M02A 1SJHD 1D5MC 2YEPB 2OOBB 4LNIA 4CO7A 2CHWA 2WX1A 1RRBA 1XLNA 5H92C 4DHJB 2J53A 4S0RA 2WS3B 3P63A 4ANUA 3EFUA 5IAAC 3FC4A 3TUOA 1IBXA 1J0GA 2LGDA 1GOZA 2KFKB 3T8MA 2PE9A 4NQLB 3C0RB 2JZPA 3PTFC 1E8ZA 2MJ3A 5EE0A 2AL6A 2WX0A 2J52A 1VDVA 2JZ3B 3DBLI 2WXIA 1DYQA 3WAPA 5IO9A 2BBCA 2MBEA 3DHGC 1FNUA 2B76B 1LQBA 1R4MI 4HKQA 1ET6A 4KGRA 4TQ0A 1L0VB 1UBQA 2EMSA 2WDRB 1MFWA 2EMTA 3QJZA 3QA8A 3SU8X 1C78A 1DOYA 1WM3A 1WYWB 2M4NA 3L08A 1KTKA 2NS5A 4DK5A 4FLHA 1EF1A 1KJTA 2LD9A 1TZ1A 1T3QA 1T6BX 1WGRA 5LLIA 5HI1A 5BMGA 4LJOB 2W55A 3A33B 2NVUI 1H8CA 3IBEA 3RNFC 2ASQA 3BYYB 1FNWA 4I6PA 2E6XA 3R3MA 3AU5A 1JWAD 1FRRA 1FNVA 2J0KA 4BOZB 1JQ4A 1FIQA 2WXPA 4OZCA 2KKCA 5I4DA 3H7SA 4II3B 3R2TA 4NJCA 1KLVA 2JT4B 2DAFA 4HPLB 1XXGA 2CHXA 3VR9B 1VZ6A 4WJOA 3MP9A 2I1JA 2K0PA 2VZKD 1I42A 2AQ3B 2K8CA 2HJ1A 1ZUD2 2N7EA 2AYOB 3ZVVA 2VH1A 1TKGA 3M3JA 1WH3A 2KQ7A 2JPHA 3ZJUA 1JRUA 3A1QB 4HPPA 2MEKA 1P98A 2OJRA 4YTPB 3V6EB 2GI9A 4TV3A 2MW5A 2CHZA 2XK5B 2PTLA 2WU2B 2WXKA 4TMAB 1WJ6A 4FADA 3H7PB 1GNUA 1J19A 4O1NA 2KJRA 4BVUC 2NTTA 4RM8A 1P9DU 1I4RA 1E8WA 2DBYA 2HTME 2KX3A 4DHZE 4MH8A 1WRIA 1L6UA 2X8XX 4YSYB 3BVMA 5DCNA 4DXAB 4YL8A 2CJNA 3N1YC 3TEXA 3RPFC 2LRUA 4HCPB 3VFKA 4GB9A 4LNOA 1N62A 3PHWB 2FCQA 2GBKA 4RH6A 1P7EA 2K6QA 5D2MB 3AE7B 1T0YA 3FILA 3ZDTA 1WGYA 4XZ4A 1VZ8A 3NUHB 2N4FA 4KDLB 2IBIB 2WXFA 4QAYA 2Z8LA 2CU1A 2D2QA 4LJPB 1JCKB 1NDDA 2RMMA 2BPSA 3BWUD 3DQVA 1WFYA 3N30A 4ZRIA 4L2YA 2Q5WD 4WQMA 4REZA 1CZPA 2RPVA 5EDSA 2LGXA 3R7RA 3VTWA 3Q3JA 5T8IA 1J7CA 4WURA 3IT6B 5FR6A 1OFFA 1SB3C 1L4DB 3H1UA 2G4SA 4ZRQA 2C9WB 2IPKD 4ZRPA 1GB4A 3ZLZA 2RDGA 5J18A 3AB5A 4JL9A 1WGGA 1WXSA 2EKIA 1XF5L 1UZXB 3IAS1 3X0WA 4M0WA 3ZXRA 2C60A 2KAJA 3TJPA 2C7NB 1J7AA 1B1ZA 4WWOA 3AEEB 1XO3A 2H89B 2LRWA 1ZKHA 2WDVB 2TSSA 4WWMA 3NG0A 4K3BA 1MPEA 4FJVB 4EZKA 2N9KA 5HFYA 4EUTA 2M1MA 1PGXA 3Q2AC 2B3AA 1E0ZA 2ZJDA 4ZHPA 1K53A 4MGYE 2BB6A 2AEHA 2QJLA 3L54A 2L0TA 2BB5A 3S2AA 3VTVA 4AS1A 1E8XA 3JW0X 4RGMA 4IM2A 1V86A 1HA5A 5BO4B 3RT3B 3GE3C 1YNTE 2K22A 2LEKA 3Q3OC 2ACZB 1V5OA 4EZJA 3AE1B 5BYSA 4USAA 2LGSA 2G9HD 3M62B 1D5XC 3WIMA 1Q10A 4Q2JA 3QIJA 2JWZA 2DNFA 4DXGA 3VHTC 3NVWA 1AYFA 3R66C 2LHDA 1UBIA 4FULA 3ZTCA 4NAWA 5IOIA 1A5RA 1QZEA 2KANA 2QC8A 1QLBB 3V61A 1ESFA 2W9NA 3N9YC 4HWIB 2KQ4X 1AN8A 3KQ4A 2IYDB 2ZVNA 1JW9D 4P7IA 3TBLD 3HM6X 2XBBC 1I4XA 5E6JA 4ZYSA 4JX1C 2JWUA 3U30A 2LJIA 2G45B 1WRDB 3RCZA 3O65B 3AE6B 3JSVA 2JUOA 2LGIA 4C00A 4IUMB 3KW5B 1H4RA 2V3PA 4JGHB 4I6LB 1KH0A 3M95A 2FCMA 1HTQA 2LUMA 1WGDA 3IT4B 4YT0B 2DAJA 2JZZA 5TSSA 2VRRB 1EWCA 3DBSA 1ZE3D 1YMHE 3W1YA 3BK1A 1YX6B 3AEBB 3PZDA 2WLBA 3BINA 1RM6C 3DDCB 3T3NA 2JF5A 1JWBD 4MJSB 2O6VA 4S17A 3AE5B 3GE8C 1I4HA 3NHEB 2NMQA 1KF6B 2WXRA 3ML8A 1XLPA 3RNGC 1CJEA 1R4NB 3PHXB 4XWWA 1NI2A 2PMVA 4TKNA 1C4PA 3W1SC 4W9DA 3NZUA 2BVCA 1WE7A 3P42A 2NPTB 4KX6B 3MC9A 2KTRB 2X38A 4F8CB 2OHFA 2J0MA 3U52E 1YJJA 1S1QB 1PUTA 4ZHOA 2AL3A 2JRHA 2KMMA 2ZZPB 4M8NA 4GXBA 1ZPSA 5LXIB 4XGAB 3VUXA 3DWMA 2BQQA 1T5XD 3IFWB 3R8BA 3V62A 4FN2A 1Q1OA 4X57B 2M8SA 3BK2A 3J9CA 3V05A 3EFCA 5FK9C 2KC1A 4HK2A 4FBJB 3P4SB 2DHZA 4YSZB 4ANXA 2KDMA 2UWQA 3ZUNA 3U2SC 3NVVA 5E6NA 1R4NI 1JWMD 1RFKA 2MWSB 4JE3B 1RWSA 2JXXA 3FKYA 3PRMB 4ZDVA 1WXQA 2C5LC 4EZLA 1WX8A 2QSDA 4ARCA 1WJ4A 4MSQB 2UYZB 5TR5A 1WXAA 2N0SB 3EC8A 2D07B 3MJWA 4LCDE 3L16A 2FCSA 2KFKA 2J4XA 3UGBB 1I4GA 3C19A 2L3ZA 3L10B 2EKEC 3M63B 3VH4B 1YN3A 1HZ6A 3SDLC 3BIID 1QKZA 4G50A 2RPQA 2IO1B 1EWYC 2GBMA 4HROA 4BBNC 2RDHA 1V1PB 1GPXA 4W9GA 4JPSA 1Y8RC 2WDTB 4CYEA 1TBEA 3RNEC 4DHJD 1CK1A 1EF5A 4HJGE 2BYVE 4GDLA 1L6VA 2Y5PA 4A3PA 3QCAA 2FUG1 2DLBA 1Q0WB 3TEZA 1A70A 1C1YB 4OVVA 3AH7A 4LDTB 2M19A 4GDKB 2L8JA 3AE2B 3RZWC 2AQ2B 1TS2A 1XCQL 2ZCBA 4PYUA 3C8YA 3SD5A 2IDYA 1HZ5A 4NAMA 2L76A 1OTRB 4MELA 3WCQA 1TKEA 1P7FA 3NOBA 1LGRA 2MLBA 1E90A 5FR3A 2IY0B 1S3SG 1F9JA 3Q3MC 4KKIA 4NNJB 2K3UA 1V80A 2MQJA 1WF9A 2MP2B 4KSLC 2V3NA 4FJZA 3LDZE 3VH3B 2N1WA 4NZLB 3NZSA 3L0WB 3LJ3A 4J3OD 4LNFA 5DPRA 2KJ6A 2V4LA 1YX5B 2WXLA 1VD2A 2LWPA 2KWUB 2BYTA 2KWVB 3ZRFA 1E7UA 2G4DB 3DVGX 5EE1A 4K7SA 3KYDD 2LZ6A 2KOXA 3DWGC 3ZJVA 1GUAB 3WAMA 4W9IA 2ZNVC 4KZCA 3KWLA 1WIAA 2MBQA 2RD0A 1PDXA 1IGDA 1HE8A 3V3XA 4EEWA 2MJEA 1ZP0B 5D3IB 3Q14C 1ENFA 3NS1A 3AE3B 4KSKC 1FCLA 3P4PB 4IDIA 3W1SA 2PVGC 2WP9B 4C4VB 1ZGUB 2JSVX 3KUZA 3APFA 4ARIA 5JXVA 2BKFA 2FIDA 1U4AA 1PYWD 4AP4C 4G11A 2MH7A 1SXTA 2BYEA 4KVGB 2I2YA 3A9JA 2HE7A 3B1LX 3ZYYX 3AEAB 2W54A 4IW0A 3ZKJC 3KH0A 3IVFA 1F0ZA 1FXAA 4PS3A 2LHEA 1NBFC 3NY5A 1QILA 2J7QB 2V9HA 3RUIB 1SBBB 3RNAC 2IO0B 2BS4B 1BMLC 3H8HA 3B08A 4TUUA 1D6EC 1F2RC 1NI3A 4AOFA 3NS8A 1XLOA 1L7YA 4B0MA 1I7HA 1Z5SB 4RF1A 2KYWA 3P4RB 1T0SC 1YN4A 3LB8C 1MG8A 2DYMA 3ZO5B 1N63A 4PS7A 2WU5B 2WNMA 4GSWA 2LFIA 5AZHA 2R61A 2KLGA 2WGSA 4NJ6A 1L5PA 3PT2B 2AX5A 2D3CA 3Q8EA 1FXIA 3VTUA 3CF6E 3P2BA 3AULA 3QARA 3PREA 3PZ8A 2NBUA 4P6VF 3VUWA 4WH4A 3L4PA 2L52A 4NPNA 2GBRA 4MGZE 2BYFA 4HJKA 1YQ4B 3AE4B 1OQRA 2N9PC 2CS4A 1FD6A 1PQSA 3PRZA 3DVNU 1YIWA 2DZMA 2VZKB 5AEKB 1L4ZB 1ROEA 4J6IA 2FUHB 2DZJA 5DPWA 5C2TB 1E8YA 3ZJTA 2KVRA 2KN4A 3Q69A 4GLSC 1FFVA 1D5ZC 5IA7A 2GMIC 4C7YA 3U7ZA 4AJYB 1WI0A 3TSSA 1MJDA 2MA9B 2Z59B 5IP4D 1JROA 3V60A 4XDDA 3AV8A 3A9KA 3VRAB 4JWUC 5D94A 4GN1A 2ONQA 4B6WA 4B95A 5G5GA 1QT9A 3N3KB 4R3DA 1TY0A 4KGTA 2LVQA 3VDZA 2LXCA 4IC7B 2PIAA 3AM9A 1UNSA 2WXHA 4DHZB 4KIKA 1OQYA 3K9PB 4KZ0A 2VH2A 4FA6A 4HEA1 1FMAD 5KHQA 4TSSA 4LLGM 2IO2B 1F1HA 2PKOA 2W82A 1NENB 1QOBA 2INCC 3N1XC 2MBHA 1WSPA 2OJWA 3ETRA 1X1MA 3W9CB 4WJNA 3CSFA 4MM3B 2KO3A 1NYQA 1N61A 5G55A 3IXSA 1MHHE 2SEBD 3AEGB 1TT5B 4MDKE 3K9OB 5JHBA 1V49A 3FILB 4W9CA 1QQRA 1Z2MA 2CR5A 2L05A 3VRBB 2NCNA 2MSED 3AXCA 4OVUA 2KC2A 1Y56A 1ZW7A 3KUDB 4RMAA 3Q8BA 2FAZA 1AWDA 3QQ8B 4TQ1A 3GOEA 2MCNB 5C3JB 1UD7A 2GBJA 5IKCM 1ZXHA 3KUCB 1SE3A 1SEBD 3P1MA 2WQYB 4ICUA 2D11A 1RFAA 4YWGG 2MBBB 2QEJC 4W9JA 2QCZA 4MJSA 2PVOD 4G3XB 2K9XA 2PPHA 1UUPA 1ACCA 2O2VA 4K3CA 2KN5A 4M0WB 2WDQB 4OZBA 2LI5A 5KHOA 1C4CA 2I38A 1VRAB 3ZNGC 2MBOA 3PPAA 1KLGD 2FCNA 2HD5B 2NPTA 2L32A 3B9JA 4US8A 1GJZA 1UGJA 2IO3B 2DWQA 2LJ5A 2WXMA 4ANVA 1SIJA 2NBWB 1YQBA 3SHQA 1JWUD 2KMCA 1KFYB 2FBWB 3B0AA 2E3TA 4PK1A 1E5WA 1L2NA 3DPDA 3NVZA 4A6QA 3EGRA 5BYQA 1KLUD 3T3OA 2Y3AA 3H9DA 3TCAA 4D2KA 2BS2B 3BVGA 4ACFA 1TJEA 2V0GA 2LGYA 1WMHB 2J0JA 3VR8B 4KV2A 4EKUA 4LK0M 2Y5BB 3ZRCA 3OWEB 2ZPYA 3IAM1 5JZEB 3UIOB 3SR6A 2REXA 3FAHA 1EM7A 2D3BA 1C76A 1PFDA 4K7WA 3OJ4B 1YN5A 4ZYNA 4FXCA 2KD0A 5D3DA 5HKHA 4WWNA 1MI0A 1EO6A 1P3QU 1GC7A 2JRIB 2G3QB 1WM2A 1TYGB 4XWTA 1FCCC 2KNBA 3N20C 3W2DA 5CHVC 1K8RB 2FNJB 2GB1A 1FRDA 3ZDMC 3Q8CA 2M56B 4IM0A 2N9LA 3WALA 1OEYJ 3IG3A 2BF8B 4IWQA 4CHKA 2KJHB 3Q6BA 1EU3A 1JWSD 1F77A 2KDBA 1NYRA 1SE2A 3E56A 2KX0A 1SE4A 1UELA 3QC8B 4MGIE 4PYZA 4K7UA 4JQWC 2GBNA 3DHHC 2GLSA 3DOWA 5LXHA 3EECA 1L0YB 2KDFB 2IGHA 4IM3A 3JSVB 3OAWA 2CU3A 3CWIA 4BKSA 3CMMB 5FKAC 1WGKA 1FEHA 4OZAA 1IGCA 1XQQA 4P1BC 2BT6A 3QHTA 4DBGA 1WZ0A 1ZDVA 4IOIE 1YQ3B 4MT5A 3HVZA 2A4ZA 3HRDD 1ZXIA 2H88B 3ZW3A 2O6VB 3MC8A 2QILA 1WY8A 2V1YA 5AUKA 1SF0A 1UF0A 3U8ZA 2IZVB 3I3TB 4XX5A 1V9JA 4BKSD 1T0QC 4IG7B 4HPMB 2W3SA 4HCNB 1HEZE 2YLMA 4LDTD 1CMXB 3AE9B 1HQRD 2R2OA 2MP2A 2LVPA 1V5TA 3E9SA 5HHDG 4KKJA 3TL5A 3W5VB 3RYTA 3ZNZB 1BXTA 1ZOYB 3WA0A 1TGZB 2CKHB 1GG3A 2W3RA 1WYGA 2PW9A 3PS6A 2LUEA 5BYRA 4P1CC 1V2YA 4BBNF 2KDEB 1GC6A 1FO4A 2Z0DB 3I63C 3PSEB 2JY6A 3DVGY 3AMZA 4US9A 4ZOHC 4PS8A 1WX7A 1ET9A 5IN7A 1GAQB 1FFUA 4A3OA 3AEFB 3HVDA 2Y5CA 3VAWA 1UWMA 4MEMA 4WQOB 4DDID 4GU2A 1MHXA 3LXFA 5CHFA 2HJ8A 4DDGD 1VR9A 1N5XA 3HM3A 5DPTA 3A4SC 3APDA 5AZFA 3ZNHB 2IGDA 4HDQA 2CJOA 3O13A 4RGNA 3NJTA 4YXDB 4A20A 3R2IA 1LXDA 3AN1A 3NRZA 1UGMA 3ECIA 3UIPB 2AQ1B 3U7DA 3A4RA 4BZAA 1V1OA 2BWFA 1P1AA 2DYOA 1UH6A 4K1RB 1KM7A 1E7VA 2KZRA 4IWPA 4AQ7A 1WWTA 3CIRB 1CQVA 2RGFA 3B2GA 3W5UB 1TTNA 3ZIMA 5C1ZA 4LNKA 2KXJA 2ICIA 2L7RA 4L1BA 4GDLB 1MG4A 2ZPNA 1XCTL 3SEBA 3A1QA 1V8CA 4WIPA 1E9MA 2RSUA 4DQOC 4A8XC 1D4BA 1JRPA 2JYTA 1TZOA 4BOSC 3RI7C 3RN9C 3BZDB 2XK5A 4URKA 1IP9A 3SFEB 2KWDA 2V4IB 3H7PA 2PLPA 2YVCA 2WWZA 3B2FA 5J2RA 3X23A 1YD8U 4HLEA 3IHPC 1IBXB 3BYTB 1L0XB 5CHWA 2GOWA 4HXDA 2L00B 2DX5B 3V6CB 2QDFA 2JU6X 1ZDXA 5G2NA 3N1ZC 2K25A 1LO5D 3EUB2 4B9KA 3PLUA 2DZIA 4C80A 2D3AA 4YSXB 2QMTA 2RR9A 4FHKA 2FE8A 1WX9A 4BKGA 3ALBA 4GOCA 5JHAA 2XEWA 3DBRB 2QHOA 1PGBA 5DPSA 1SJED 1TY2A 2IGGA 3RNBC 3VUYA 4C56C 4C7ZA 4KDIC 2WYQA 3CSTA 3U4EG 1VJKA 2INNE 4M8MA 4BAXA 2ZW1A 2C7HA 3MJ5A 4RFBA 3TEYA 4YTMB 1M4VA 2ZCCA 3VQIA 4OHJA 1E6EB 1C4AA 5J17A 3PGEA 2WXJA 1P0RA 2R2QA 3D32A 1V6EA 2JX5A 3P4QB 4GMVA 1SE9A 4A9AA 3Q8FA 4E71A 2KT7A 4N59A 1YOVB 5C23A 2L83A 4ITKA 3H6NA 5CX3A 3RULA 4AWJA 4RM9A 2SAKA 5BMHA 3HHMA 3DVNV 5MPOA 3QX1A 3EHVA 2QIEB 1AW7A 2LASA 3DBHB 4YTNB 4G0NB 1KOTA 1T0RC 2INPE 1STEA 2KMAA 3DBRI 1E10A 1SIFA 3MHZA 1WJUA 2D5GA 3A9JB 1LM8B 3ONSA 1RAXA 4MM3A 3EA6A 3PVLA 2BTEA 5GXGB 2PEAA 2BS3B 4ICVA 1B9RA 1BT0A 1N60A 2LXAA 1SSNA 1JMLA 1QOAA 4B0EA 4EFOA 4W9EA 3ZGZA 4K81A 3TMPB 4WJPA 2ON8A 2K5PA 3UQBA 2DENB 4W9HA 4XDCA 2WXGA 1TS4A 3MTNB 1IUEA 1YJIA 2KK8A 4JIOU 4L23A 1GB1A 1ISNA 3DBHI 4GGQA 4H2AA 3KLSX 4ASWC 1DGJA 2KWCA 3AECB 2KACA 3L17A 4EOYA 3VVWB 3QK0A 1J8CA 2ZVOA 3GS2A 3LYYA 3ZNID 1TS3A 2FIFA 1MVKA 2JYEA 4WAAA 1K51A 3RMKC 4A55A 3ZQ4A 2KLCA 2WXQA 2YEPF 4RGTA 1K50A 1IYFA 5E6OA 1HTOA 2MHJA 4ZRKA 3PLVA 5L95C 5BMIA 3HUIA 2INDC 1I4PA 3OJ3A 4NQKE 4LTUA 2WXOA 4MACA 1M94A 1WZ3A 4HKZE 4OW0A 4P16A 4DXFA 4F1SA 4AUQC 2N7JA 1VZ7A 3Q3FA 3A9KB 4MH0E 4A90A 3TIXA 2KTFA 2WHIA 1WMHA 2J42A 4GIVA 2BKRB 2KDIA 3AI5A 1F52A 1OQQA 2IJ0A 4KIKB 1XD3B 4E74A 2D10A 3URYA 3GP7A 4RNAA 3ENEA 4RCOA 2KFJA 2MJDA 3RD2A 4AJWA 3KVFB 3JVZX 3AE8B 2N9XA 3PZ7A 4W9FA 5E6PA 4HVBA 2AWTA 3I9V1 2XNAC 4EE2A 2RDBC 3WANA 1WXVA 1C3TA 3ZTDA 1XLQA 2KTRA 3PRPB 3R7QA 5H8YE 2MX2A 3GB1A 3MHSD 5AZGA 4N58A 4NJ7A 1I4QA 2LVOA 4JWSC 1FM0D 2N9EB 1AARA 2XN9C 3UINB 4BFRA 1OEYA 4F7ZA 1QOGA 1DOXA 2N1VA 1NVID 4DWFA 2ZNVB 2NTSA
chains in the Genus database with same CATH topology
1L4DB 4ZRQA 2IPKD 4ZRPA 1EU4A 1BXTA 1ZOYB 1GB4A 2RDGA 1PYWD 2W3RA 2WXNA 1WYGA 2PW9A 3AB5A 1TS5A 1N5WA 2MH7A 5BYRA 1SXTA 2EKIA 1XF5L 2I2YA 1VLBA 3IAS1 3ZYYX 1FO4A 3AEAB 2W54A 1HXYD 2JQRB 4M0WA 2KAJA 1F0ZA 1FXAA 2LHEA 3AMZA 1QILA 4US9A 4ZOHC 1J7AA 1B1ZA 1ET9A 1SBBB 1GAQB 3AEEB 1XO3A 2H89B 2BS4B 1BMLC 1FFUA 2WDVB 2TSSA 3H8HA 1UWXA 1D6EC 3AEFB 3HVDA 4WWMA 2Y5CA 1F2RC 1NI3A 1UWMA 4NAWB 1MPEA 1XLOA 2N9KA 5HFYA 4B0MA 1I7HA 1MHXA 4RF1A 3P4RB 3LXFA 1DOIA 1PGXA 1YN4A 3LB8C 1E0ZA 4ZHPA 2DYMA 1VR9A 3RFZB 1N5XA 1K53A 1N63A 2WU5B 2BB6A 2NTSA 2WNMA 2QJLA 2LFIA 1PGAA 2R61A 2BB5A 2IGDA 2CJOA 3O13A 4AS1A 4RGNA 1L5PA 4KGSA 3NZ3A 4RGMA 2AX5A 2BW2A 1TKYA 4YXDB 1HA5A 3Q8EA 1FXIA 1V1PA 1YNTE 3R2IA 3SFDB 3AN1A 3NRZA 2K22A 2LEKA 2AQ1B 3PZ8A 4P6VF 4WH4A 3L4PA 2ACZB 1V1OA 2LMCA 1RYJA 4WAFA 2L52A 2JXTA 3AE1B 1YQ4B 1E7PB 2DYOA 5BYSA 3AE4B 1OQRA 3Q8AA 4USAA 1JALA 2G9HD 1FD6A 4AQ7A 1C9FA 1WWTA 1D5XC 1Q10A 4OVZA 3CIRB 4Q2JA 2VZKB 1CQVA 1L4ZB 4XE0A 3B2GA 3W5UB 1ROEA 4DXGA 3NVWA 1AYFA 5LNK1 2LHDA 2M0AA 2ICIA 2L1AA 1XEEA 5EE3A 5C2TB 4L1BA 1J7BA 3NVYA 3ZJTA 4RGOS 2KN4A 3Q69A 4GLSC 4GDLB 1FFVA 1D5ZC 1C77A 1QLBB 2EELA 3TEWA 5G5HA 1ESFA 1XCTL 3SEBA 1V8CA 3N9YC 4C7YA 4WIPA 1E9MA 2KQ4X 1AN8A 4N6EB 3KQ4A 3U7ZA 3MC0B 4DQOC 1K52A 3I57A 3TSSA 4A8XC 1JW9D 1D4BA 1JRPA 2JYTA 1TZOA 1F2RI 3MFGA 1JROA 2ZW0A 3BZDB 3BVZA 3SFEB 1I4XA 2KWDA 4IKGA 4XDDA 3AV8A 2V4IB 5E6JA 2PLPA 4JWUC 3VRAB 4JX1C 4ZYSA 2HDEA 2JWUA 2ONQA 4HRSA 5G5GA 1QT9A 1QOFA 3PO0A 2LJIA 4R3DA 3B2FA 1TY0A 4UDUC 4KGTA 3AE6B 3UI3A 5D7GA 2LGIA 5HG2A 1IBXB 1NEKB 2V3PA 3BYTB 1L0XB 2PIAA 5EE9A 3AM9A 4RF0A 1UNSA 1KH0A 2WXHA 3KWVA 1V97A 2LUMA 3IT4B 4YT0B 5TSSA 2JU6X 1ZDXA 4HEA1 1EWCA 1ZE3D 1YMHE 2GRIA 1FMAD 1KRHA 3BK1A 3AEBB 4TSSA 2WLBA 2OEDA 4LLGM 1RM6C 1LO5D 3EUB2 2PKOA 3T3NA 1QF6A 4C80A 2W82A 1JWBD 4YSXB 2QMTA 1NENB 3AE5B 1I4HA 2FE8A 2NMQA 4CQNA 1KF6B 1QOBA 2WXRA 1R7SA 1XLPA 1WSPA 1CJEA 3ETRA 1PGBA 1SJED 3W9CB 2G1EA 5AUIA 1TY2A 2IGGA 4C56C 4XWWA 4C7ZA 4MM3B 3AEDB 1C79A 1NYQA 1N61A 2PMVA 4PT5A 3ABVB 3IXSA 3U4EG 1MHHE 1VJKA 1C4PA 2SEBD 3AEGB 2INNE 3FILB 2ZW1A 3MJ5A 1QQRA 3P42A 4KX6B 1BUIC 4RFBA 3VRBB 3TEYA 1SJHD 1D5MC 1M4VA 2YEPB 3VQIA 4OHJA 4YTMB 2X38A 1E6EB 1C4AA 1XLNA 2OHFA 1Y56A 5H92C 2WXJA 3U52E 2J53A 3Q8BA 1YJJA 2WS3B 2JX5A 3P63A 1PUTA 4ZHOA 3FC4A 2KMMA 3P4QB 3TUOA 1IBXA 1GOZA 1AWDA 4A9AA 1ZPSA 4TQ1A 3Q8FA 5C3JB 4N59A 3DWMA 2JZPA 1ZXHA 2L83A 1T5XD 1SE3A 1SEBD 3R8BA 4ITKA 2MJ3A 3P1MA 5EE0A 2WQYB 2J52A 3BK2A 1VDVA 2SAKA 5BMHA 2WXIA 3J9CA 3V05A 1DYQA 5MPOA 4YWGG 2QEJC 5FK9C 2BBCA 2QIEB 1AW7A 4YTNB 3P4SB 1FNUA 4YSZB 2B76B 2INPE 2KDMA 4HKQA 1ET6A 2PVOD 4KGRA 1STEA 3U2SC 3NVVA 2K9XA 4TQ0A 1E10A 1L0VB 3MHZA 2WDRB 1JWMD 2D5GA 1UUPA 1ACCA 1RFKA 4JE3B 1C78A 2WDQB 4OZBA 1DOYA 3EA6A 1C4CA 2BTEA 2I38A 1RWSA 1VRAB 2BS3B 5GXGB 1B9RA 1N60A 1KTKA 1KLGD 1SSNA 1JMLA 1QOAA 1WXQA 2L32A 4B0EA 2QSDA 4ARCA 1T3QA 3B9JA 4US8A 1T6BX 1UGJA 3ZGZA 2N0SB 5HI1A 2DWQA 2WXMA 5BMGA 1SIJA 2ON8A 2K5PA 4XDCA 1JWUD 2J4XA 2W55A 1I4GA 1KFYB 2FBWB 2E3TA 2WXGA 1TS4A 3NVZA 1YN3A 4A6QA 1IUEA 1HZ6A 1YJIA 3BIID 3EGRA 5BYQA 1KLUD 1QKZA 3T3OA 3BYYB 2Y3AA 4L23A 1EWYC 1GB1A 1FNWA 4HROA 2E6XA 2RDHA 1V1PB 1GPXA 4JPSA 1JWAD 1FRRA 4D2KA 1FNVA 4H2AA 2BS2B 3BVGA 3KLSX 1TJEA 2V0GA 1JQ4A 1DGJA 3AECB 2KACA 1FIQA 1CK1A 2WXPA 3VR8B 4HJGE 4OZCA 4LK0M 1L6VA 2Y5PA 5I4DA 2FUG1 2DLBA 3GS2A 3LYYA 3OWEB 3R2TA 4NJCA 1TS3A 3IAM1 1MVKA 3TEZA 1A70A 1XXGA 2JYEA 3VR9B 1VZ6A 3AH7A 3SR6A 1K51A 3FAHA 3MP9A 4A55A 3ZQ4A 2K0PA 1EM7A 2WXQA 2M19A 2YEPF 4GDKB 1C76A 3AE2B 2AQ2B 1PFDA 2VZKD 1TS2A 1YN5A 4RGTA 1K50A 1XCQL 2AQ3B 1ZUD2 4FXCA 5D3DA 3C8YA 1MI0A 2IDYA 1TKGA 1HZ5A 4NAMA 3ZJUA 5BMIA 3HUIA 3WCQA 1TKEA 1P7FA 1I4PA 1TYGB 4XWTA 1FCCC 2MEKA 4LTUA 2WXOA 3W2DA 4MACA 4YTPB 4HKZE 5FR3A 4OW0A 2GB1A 4P16A 1FRDA 4DXFA 3Q8CA 2GI9A 2M56B 2N9LA 4KKIA 2K3UA 2PTLA 2N7JA 2WU2B 1VZ7A 2WXKA 1EU3A 1JWSD 1F77A 1NYRA 1SE2A 3E56A 4TMAB 1SE4A 4O1NA 2V3NA 2NTTA 4A90A 2J42A 4NZLB 1I4RA 1L0YB 2HTME 2DBYA 2IGHA 4J3OD 4MH8A 1WRIA 1L6UA 2WXLA 4YSYB 3BVMA 2CU3A 2BYTA 2CJNA 1OQQA 2IJ0A 3CWIA 5FKAC 1WGKA 3TEXA 3RPFC 3URYA 1FEHA 4OZAA 3GP7A 4RNAA 5EE1A 1IGCA 1N62A 4RCOA 4RH6A 2MJDA 1P7EA 2BT6A 1ZDVA 4IOIE 3AE8B 3AE7B 3PZ7A 1YQ3B 4MT5A 3DWGC 3HVZA 3FILA 3ZJVA 3HRDD 1ZXIA 3I9V1 2XNAC 4EE2A 2H88B 1VZ8A 1XLQA 3KWLA 3NUHB 2QILA 2WXFA 1PDXA 1IGDA 5AUKA 1SF0A 2Z8LA 3V3XA 5H8YE 1JCKB 2MJEA 3GB1A 2RMMA 1ZP0B 5D3IB 4N58A 3BWUD 1I4QA 1ENFA 4JWSC 1FM0D 2XN9C 3NS1A 3AE3B 2W3SA 1FCLA 1HEZE 3P4PB 4L2YA 4IDIA 2Q5WD 3W1SA 2PVGC 2WP9B 3AE9B 4WQMA 2JSVX 1CZPA 1HQRD 1QOGA 2RPVA 4REZA 1DOXA 1NVID 5T8IA 1J7CA 4WURA 3E9SA 3IT6B 5HHDG 4KKJA 3W5VB 4ARIA 5JXVA 1OFFA 1SB3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZP A;  2EEL A;  1ZXH A;  1XCT L;  1GB4 A;  1K50 A;  1XCQ L;  2KQ4 X;  2PW9 A;  2J52 A;  1K52 A;  5BMH A;  1MI0 A;  1D4B A;  1HZ5 A;  1XF5 L;  2I2Y A;  1F2R I;  5BMI A;  2ZW0 A;  1P7F A;  1FCC C;  2KWD A;  4IKG A;  4MAC A;  2KDM A;  4KGR A;  2PLP A;  4HKZ E;  2LHE A;  2JWU A;  2GB1 A;  2ONQ A;  2GI9 A;  2N9L A;  4KGT A;  1UWX A;  3UI3 A;  2LGI A;  2PTL A;  5HG2 A;  1F2R C;  2N7J A;  4OZB A;  1IBX B;  2I38 A;  1MPE A;  2N9K A;  5HFY A;  1MHX A;  1KH0 A;  1PGX A;  1JML A;  2LUM A;  2IGH A;  2QSD A;  2JU6 X;  1K53 A;  1YMH E;  5HI1 A;  1PGA A;  2OED A;  2IGD A;  5BMG A;  2ON8 A;  4KGS A;  4OZA A;  1IGC A;  2QMT A;  1P7E A;  2NMQ A;  1YNT E;  4IOI E;  1HZ6 A;  1QKZ A;  3FIL A;  1PGB A;  4WH4 A;  1GB1 A;  2IGG A;  2JXT A;  4D2K A;  1MHH E;  1IGD A;  3V3X A;  3FIL B;  2ZW1 A;  1FD6 A;  3GB1 A;  2RMM A;  1C9F A;  2KAC A;  1Q10 A;  4HJG E;  4OZC A;  1FCL A;  1HEZ E;  2J53 A;  2LHD A;  2JSV X;  2RPV A;  1MVK A;  1IBX A;  5HHD G;  1K51 A;  3MP9 A;  2KN4 A;  5JXV A;  2K0P A;  4GLS C;  1EM7 A; 
#chains in the Genus database with same CATH topology
 5JH5 C;  1WR6 E;  2V3S A;  1EU4 A;  2BWE S;  2KVZ A;  3RZF A;  3N32 A;  2WXN A;  1TS5 A;  5D6J B;  1N5W A;  1VLB A;  1N6Z A;  1FXT B;  2D3G A;  1HXY D;  2JQR B;  4WJQ A;  3OG5 A;  2M0X A;  2K39 A;  2L0F A;  2PE6 B;  1UWX A;  3VXW A;  2K8H A;  4NY0 A;  4NAW B;  1LFD A;  1DOI A;  4ANW A;  1WXM A;  2A5U A;  2O2V B;  1SGH A;  3RFZ B;  4MSM B;  4W9L A;  2K6D B;  2DZK A;  3AU4 A;  3PV1 A;  1I35 A;  1Q5W B;  1WR1 A;  1PGA A;  1D3Z A;  2MRP A;  4KGS A;  3NZ3 A;  4LNN A;  3DHI C;  2BW2 A;  1TKY A;  3ML9 A;  1V1P A;  1IPG A;  4XYC A;  2O6V D;  3SFD B;  1RLF A;  4WWP A;  2ZEQ A;  2UU7 A;  2I1K A;  2LMC A;  1RYJ A;  3I5J C;  2K1F A;  4WAF A;  2KQS A;  3UQA A;  4JLC A;  2JXT A;  1E7P B;  1G6J A;  3Q8A A;  3RNC C;  2KHW B;  3L13 A;  1JAL A;  5L83 A;  1C9F A;  4HDO A;  2PJH A;  4OVZ A;  4XE0 A;  3T9L A;  4GDK A;  1V81 A;  4IWO A;  2NR2 A;  5LNK 1;  1OGW A;  2M0A A;  2L1A A;  1XEE A;  5EE3 A;  1J7B A;  3NVY A;  4RGO S;  1C77 A;  2EEL A;  3TEW A;  5G5H A;  4II2 B;  4M00 A;  1VCB A;  3ZXV A;  3GZN B;  4N6E B;  3MC0 B;  1K52 A;  3I57 A;  5CTR C;  3BY4 B;  4E3C A;  1F2R I;  3MFG A;  2ZW0 A;  3HK0 A;  3BVZ A;  1TIF A;  4IKG A;  1EUV B;  4BKT A;  4FJY A;  4FHJ A;  4W9K A;  2HDE A;  4I6N B;  4N9F 4;  3KYC D;  4HRS A;  2M17 A;  1QOF A;  3PO0 A;  4UDU C;  1YJ1 A;  1FPY A;  3UI3 A;  5D7G A;  5HG2 A;  1NEK B;  3QWZ B;  3QAQ A;  5EE9 A;  4RF0 A;  1WE6 A;  3KWV A;  1V97 A;  2IY1 B;  1WJN A;  4XC2 A;  2GRI A;  2BGF A;  1KRH A;  3OLM D;  2DYB A;  2NBV B;  3JYU A;  2OED A;  2HTH A;  3DBL B;  3DCG A;  3UF8 A;  1QF6 A;  3HIZ A;  1WGH A;  2K8B A;  3Q3N C;  2Z0E B;  4CQN A;  1R7S A;  3WAO A;  1R4M B;  3GZN I;  1XT9 B;  4ZRJ A;  2N7D A;  2C7M B;  2G1E A;  5AUI A;  2JVC A;  3AED B;  5GMV A;  1C79 A;  4PT5 A;  3ABV B;  4M01 A;  4C4V A;  4MGK E;  1BUI C;  3APC A;  4M02 A;  1SJH D;  1D5M C;  2YEP B;  2OOB B;  4LNI A;  4CO7 A;  2CHW A;  2WX1 A;  1RRB A;  1XLN A;  5H92 C;  4DHJ B;  2J53 A;  4S0R A;  2WS3 B;  3P63 A;  4ANU A;  3EFU A;  5IAA C;  3FC4 A;  3TUO A;  1IBX A;  1J0G A;  2LGD A;  1GOZ A;  2KFK B;  3T8M A;  2PE9 A;  4NQL B;  3C0R B;  2JZP A;  3PTF C;  1E8Z A;  2MJ3 A;  5EE0 A;  2AL6 A;  2WX0 A;  2J52 A;  1VDV A;  2JZ3 B;  3DBL I;  2WXI A;  1DYQ A;  3WAP A;  5IO9 A;  2BBC A;  2MBE A;  3DHG C;  1FNU A;  2B76 B;  1LQB A;  1R4M I;  4HKQ A;  1ET6 A;  4KGR A;  4TQ0 A;  1L0V B;  1UBQ A;  2EMS A;  2WDR B;  1MFW A;  2EMT A;  3QJZ A;  3QA8 A;  3SU8 X;  1C78 A;  1DOY A;  1WM3 A;  1WYW B;  2M4N A;  3L08 A;  1KTK A;  2NS5 A;  4DK5 A;  4FLH A;  1EF1 A;  1KJT A;  2LD9 A;  1TZ1 A;  1T3Q A;  1T6B X;  1WGR A;  5LLI A;  5HI1 A;  5BMG A;  4LJO B;  2W55 A;  3A33 B;  2NVU I;  1H8C A;  3IBE A;  3RNF C;  2ASQ A;  3BYY B;  1FNW A;  4I6P A;  2E6X A;  3R3M A;  3AU5 A;  1JWA D;  1FRR A;  1FNV A;  2J0K A;  4BOZ B;  1JQ4 A;  1FIQ A;  2WXP A;  4OZC A;  2KKC A;  5I4D A;  3H7S A;  4II3 B;  3R2T A;  4NJC A;  1KLV A;  2JT4 B;  2DAF A;  4HPL B;  1XXG A;  2CHX A;  3VR9 B;  1VZ6 A;  4WJO A;  3MP9 A;  2I1J A;  2K0P A;  2VZK D;  1I42 A;  2AQ3 B;  2K8C A;  2HJ1 A;  1ZUD 2;  2N7E A;  2AYO B;  3ZVV A;  2VH1 A;  1TKG A;  3M3J A;  1WH3 A;  2KQ7 A;  2JPH A;  3ZJU A;  1JRU A;  3A1Q B;  4HPP A;  2MEK A;  1P98 A;  2OJR A;  4YTP B;  3V6E B;  2GI9 A;  4TV3 A;  2MW5 A;  2CHZ A;  2XK5 B;  2PTL A;  2WU2 B;  2WXK A;  4TMA B;  1WJ6 A;  4FAD A;  3H7P B;  1GNU A;  1J19 A;  4O1N A;  2KJR A;  4BVU C;  2NTT A;  4RM8 A;  1P9D U;  1I4R A;  1E8W A;  2DBY A;  2HTM E;  2KX3 A;  4DHZ E;  4MH8 A;  1WRI A;  1L6U A;  2X8X X;  4YSY B;  3BVM A;  5DCN A;  4DXA B;  4YL8 A;  2CJN A;  3N1Y C;  3TEX A;  3RPF C;  2LRU A;  4HCP B;  3VFK A;  4GB9 A;  4LNO A;  1N62 A;  3PHW B;  2FCQ A;  2GBK A;  4RH6 A;  1P7E A;  2K6Q A;  5D2M B;  3AE7 B;  1T0Y A;  3FIL A;  3ZDT A;  1WGY A;  4XZ4 A;  1VZ8 A;  3NUH B;  2N4F A;  4KDL B;  2IBI B;  2WXF A;  4QAY A;  2Z8L A;  2CU1 A;  2D2Q A;  4LJP B;  1JCK B;  1NDD A;  2RMM A;  2BPS A;  3BWU D;  3DQV A;  1WFY A;  3N30 A;  4ZRI A;  4L2Y A;  2Q5W D;  4WQM A;  4REZ A;  1CZP A;  2RPV A;  5EDS A;  2LGX A;  3R7R A;  3VTW A;  3Q3J A;  5T8I A;  1J7C A;  4WUR A;  3IT6 B;  5FR6 A;  1OFF A;  1SB3 C;  1L4D B;  3H1U A;  2G4S A;  4ZRQ A;  2C9W B;  2IPK D;  4ZRP A;  1GB4 A;  3ZLZ A;  2RDG A;  5J18 A;  3AB5 A;  4JL9 A;  1WGG A;  1WXS A;  2EKI A;  1XF5 L;  1UZX B;  3IAS 1;  3X0W A;  4M0W A;  3ZXR A;  2C60 A;  2KAJ A;  3TJP A;  2C7N B;  1J7A A;  1B1Z A;  4WWO A;  3AEE B;  1XO3 A;  2H89 B;  2LRW A;  1ZKH A;  2WDV B;  2TSS A;  4WWM A;  3NG0 A;  4K3B A;  1MPE A;  4FJV B;  4EZK A;  2N9K A;  5HFY A;  4EUT A;  2M1M A;  1PGX A;  3Q2A C;  2B3A A;  1E0Z A;  2ZJD A;  4ZHP A;  1K53 A;  4MGY E;  2BB6 A;  2AEH A;  2QJL A;  3L54 A;  2L0T A;  2BB5 A;  3S2A A;  3VTV A;  4AS1 A;  1E8X A;  3JW0 X;  4RGM A;  4IM2 A;  1V86 A;  1HA5 A;  5BO4 B;  3RT3 B;  3GE3 C;  1YNT E;  2K22 A;  2LEK A;  3Q3O C;  2ACZ B;  1V5O A;  4EZJ A;  3AE1 B;  5BYS A;  4USA A;  2LGS A;  2G9H D;  3M62 B;  1D5X C;  3WIM A;  1Q10 A;  4Q2J A;  3QIJ A;  2JWZ A;  2DNF A;  4DXG A;  3VHT C;  3NVW A;  1AYF A;  3R66 C;  2LHD A;  1UBI A;  4FUL A;  3ZTC A;  4NAW A;  5IOI A;  1A5R A;  1QZE A;  2KAN A;  2QC8 A;  1QLB B;  3V61 A;  1ESF A;  2W9N A;  3N9Y C;  4HWI B;  2KQ4 X;  1AN8 A;  3KQ4 A;  2IYD B;  2ZVN A;  1JW9 D;  4P7I A;  3TBL D;  3HM6 X;  2XBB C;  1I4X A;  5E6J A;  4ZYS A;  4JX1 C;  2JWU A;  3U30 A;  2LJI A;  2G45 B;  1WRD B;  3RCZ A;  3O65 B;  3AE6 B;  3JSV A;  2JUO A;  2LGI A;  4C00 A;  4IUM B;  3KW5 B;  1H4R A;  2V3P A;  4JGH B;  4I6L B;  1KH0 A;  3M95 A;  2FCM A;  1HTQ A;  2LUM A;  1WGD A;  3IT4 B;  4YT0 B;  2DAJ A;  2JZZ A;  5TSS A;  2VRR B;  1EWC A;  3DBS A;  1ZE3 D;  1YMH E;  3W1Y A;  3BK1 A;  1YX6 B;  3AEB B;  3PZD A;  2WLB A;  3BIN A;  1RM6 C;  3DDC B;  3T3N A;  2JF5 A;  1JWB D;  4MJS B;  2O6V A;  4S17 A;  3AE5 B;  3GE8 C;  1I4H A;  3NHE B;  2NMQ A;  1KF6 B;  2WXR A;  3ML8 A;  1XLP A;  3RNG C;  1CJE A;  1R4N B;  3PHX B;  4XWW A;  1NI2 A;  2PMV A;  4TKN A;  1C4P A;  3W1S C;  4W9D A;  3NZU A;  2BVC A;  1WE7 A;  3P42 A;  2NPT B;  4KX6 B;  3MC9 A;  2KTR B;  2X38 A;  4F8C B;  2OHF A;  2J0M A;  3U52 E;  1YJJ A;  1S1Q B;  1PUT A;  4ZHO A;  2AL3 A;  2JRH A;  2KMM A;  2ZZP B;  4M8N A;  4GXB A;  1ZPS A;  5LXI B;  4XGA B;  3VUX A;  3DWM A;  2BQQ A;  1T5X D;  3IFW B;  3R8B A;  3V62 A;  4FN2 A;  1Q1O A;  4X57 B;  2M8S A;  3BK2 A;  3J9C A;  3V05 A;  3EFC A;  5FK9 C;  2KC1 A;  4HK2 A;  4FBJ B;  3P4S B;  2DHZ A;  4YSZ B;  4ANX A;  2KDM A;  2UWQ A;  3ZUN A;  3U2S C;  3NVV A;  5E6N A;  1R4N I;  1JWM D;  1RFK A;  2MWS B;  4JE3 B;  1RWS A;  2JXX A;  3FKY A;  3PRM B;  4ZDV A;  1WXQ A;  2C5L C;  4EZL A;  1WX8 A;  2QSD A;  4ARC A;  1WJ4 A;  4MSQ B;  2UYZ B;  5TR5 A;  1WXA A;  2N0S B;  3EC8 A;  2D07 B;  3MJW A;  4LCD E;  3L16 A;  2FCS A;  2KFK A;  2J4X A;  3UGB B;  1I4G A;  3C19 A;  2L3Z A;  3L10 B;  2EKE C;  3M63 B;  3VH4 B;  1YN3 A;  1HZ6 A;  3SDL C;  3BII D;  1QKZ A;  4G50 A;  2RPQ A;  2IO1 B;  1EWY C;  2GBM A;  4HRO A;  4BBN C;  2RDH A;  1V1P B;  1GPX A;  4W9G A;  4JPS A;  1Y8R C;  2WDT B;  4CYE A;  1TBE A;  3RNE C;  4DHJ D;  1CK1 A;  1EF5 A;  4HJG E;  2BYV E;  4GDL A;  1L6V A;  2Y5P A;  4A3P A;  3QCA A;  2FUG 1;  2DLB A;  1Q0W B;  3TEZ A;  1A70 A;  1C1Y B;  4OVV A;  3AH7 A;  4LDT B;  2M19 A;  4GDK B;  2L8J A;  3AE2 B;  3RZW C;  2AQ2 B;  1TS2 A;  1XCQ L;  2ZCB A;  4PYU A;  3C8Y A;  3SD5 A;  2IDY A;  1HZ5 A;  4NAM A;  2L76 A;  1OTR B;  4MEL A;  3WCQ A;  1TKE A;  1P7F A;  3NOB A;  1LGR A;  2MLB A;  1E90 A;  5FR3 A;  2IY0 B;  1S3S G;  1F9J A;  3Q3M C;  4KKI A;  4NNJ B;  2K3U A;  1V80 A;  2MQJ A;  1WF9 A;  2MP2 B;  4KSL C;  2V3N A;  4FJZ A;  3LDZ E;  3VH3 B;  2N1W A;  4NZL B;  3NZS A;  3L0W B;  3LJ3 A;  4J3O D;  4LNF A;  5DPR A;  2KJ6 A;  2V4L A;  1YX5 B;  2WXL A;  1VD2 A;  2LWP A;  2KWU B;  2BYT A;  2KWV B;  3ZRF A;  1E7U A;  2G4D B;  3DVG X;  5EE1 A;  4K7S A;  3KYD D;  2LZ6 A;  2KOX A;  3DWG C;  3ZJV A;  1GUA B;  3WAM A;  4W9I A;  2ZNV C;  4KZC A;  3KWL A;  1WIA A;  2MBQ A;  2RD0 A;  1PDX A;  1IGD A;  1HE8 A;  3V3X A;  4EEW A;  2MJE A;  1ZP0 B;  5D3I B;  3Q14 C;  1ENF A;  3NS1 A;  3AE3 B;  4KSK C;  1FCL A;  3P4P B;  4IDI A;  3W1S A;  2PVG C;  2WP9 B;  4C4V B;  1ZGU B;  2JSV X;  3KUZ A;  3APF A;  4ARI A;  5JXV A;  2BKF A;  2FID A;  1U4A A;  1PYW D;  4AP4 C;  4G11 A;  2MH7 A;  1SXT A;  2BYE A;  4KVG B;  2I2Y A;  3A9J A;  2HE7 A;  3B1L X;  3ZYY X;  3AEA B;  2W54 A;  4IW0 A;  3ZKJ C;  3KH0 A;  3IVF A;  1F0Z A;  1FXA A;  4PS3 A;  2LHE A;  1NBF C;  3NY5 A;  1QIL A;  2J7Q B;  2V9H A;  3RUI B;  1SBB B;  3RNA C;  2IO0 B;  2BS4 B;  1BML C;  3H8H A;  3B08 A;  4TUU A;  1D6E C;  1F2R C;  1NI3 A;  4AOF A;  3NS8 A;  1XLO A;  1L7Y A;  4B0M A;  1I7H A;  1Z5S B;  4RF1 A;  2KYW A;  3P4R B;  1T0S C;  1YN4 A;  3LB8 C;  1MG8 A;  2DYM A;  3ZO5 B;  1N63 A;  4PS7 A;  2WU5 B;  2WNM A;  4GSW A;  2LFI A;  5AZH A;  2R61 A;  2KLG A;  2WGS A;  4NJ6 A;  1L5P A;  3PT2 B;  2AX5 A;  2D3C A;  3Q8E A;  1FXI A;  3VTU A;  3CF6 E;  3P2B A;  3AUL A;  3QAR A;  3PRE A;  3PZ8 A;  2NBU A;  4P6V F;  3VUW A;  4WH4 A;  3L4P A;  2L52 A;  4NPN A;  2GBR A;  4MGZ E;  2BYF A;  4HJK A;  1YQ4 B;  3AE4 B;  1OQR A;  2N9P C;  2CS4 A;  1FD6 A;  1PQS A;  3PRZ A;  3DVN U;  1YIW A;  2DZM A;  2VZK B;  5AEK B;  1L4Z B;  1ROE A;  4J6I A;  2FUH B;  2DZJ A;  5DPW A;  5C2T B;  1E8Y A;  3ZJT A;  2KVR A;  2KN4 A;  3Q69 A;  4GLS C;  1FFV A;  1D5Z C;  5IA7 A;  2GMI C;  4C7Y A;  3U7Z A;  4AJY B;  1WI0 A;  3TSS A;  1MJD A;  2MA9 B;  2Z59 B;  5IP4 D;  1JRO A;  3V60 A;  4XDD A;  3AV8 A;  3A9K A;  3VRA B;  4JWU C;  5D94 A;  4GN1 A;  2ONQ A;  4B6W A;  4B95 A;  5G5G A;  1QT9 A;  3N3K B;  4R3D A;  1TY0 A;  4KGT A;  2LVQ A;  3VDZ A;  2LXC A;  4IC7 B;  2PIA A;  3AM9 A;  1UNS A;  2WXH A;  4DHZ B;  4KIK A;  1OQY A;  3K9P B;  4KZ0 A;  2VH2 A;  4FA6 A;  4HEA 1;  1FMA D;  5KHQ A;  4TSS A;  4LLG M;  2IO2 B;  1F1H A;  2PKO A;  2W82 A;  1NEN B;  1QOB A;  2INC C;  3N1X C;  2MBH A;  1WSP A;  2OJW A;  3ETR A;  1X1M A;  3W9C B;  4WJN A;  3CSF A;  4MM3 B;  2KO3 A;  1NYQ A;  1N61 A;  5G55 A;  3IXS A;  1MHH E;  2SEB D;  3AEG B;  1TT5 B;  4MDK E;  3K9O B;  5JHB A;  1V49 A;  3FIL B;  4W9C A;  1QQR A;  1Z2M A;  2CR5 A;  2L05 A;  3VRB B;  2NCN A;  2MSE D;  3AXC A;  4OVU A;  2KC2 A;  1Y56 A;  1ZW7 A;  3KUD B;  4RMA A;  3Q8B A;  2FAZ A;  1AWD A;  3QQ8 B;  4TQ1 A;  3GOE A;  2MCN B;  5C3J B;  1UD7 A;  2GBJ A;  5IKC M;  1ZXH A;  3KUC B;  1SE3 A;  1SEB D;  3P1M A;  2WQY B;  4ICU A;  2D11 A;  1RFA A;  4YWG G;  2MBB B;  2QEJ C;  4W9J A;  2QCZ A;  4MJS A;  2PVO D;  4G3X B;  2K9X A;  2PPH A;  1UUP A;  1ACC A;  2O2V A;  4K3C A;  2KN5 A;  4M0W B;  2WDQ B;  4OZB A;  2LI5 A;  5KHO A;  1C4C A;  2I38 A;  1VRA B;  3ZNG C;  2MBO A;  3PPA A;  1KLG D;  2FCN A;  2HD5 B;  2NPT A;  2L32 A;  3B9J A;  4US8 A;  1GJZ A;  1UGJ A;  2IO3 B;  2DWQ A;  2LJ5 A;  2WXM A;  4ANV A;  1SIJ A;  2NBW B;  1YQB A;  3SHQ A;  1JWU D;  2KMC A;  1KFY B;  2FBW B;  3B0A A;  2E3T A;  4PK1 A;  1E5W A;  1L2N A;  3DPD A;  3NVZ A;  4A6Q A;  3EGR A;  5BYQ A;  1KLU D;  3T3O A;  2Y3A A;  3H9D A;  3TCA A;  4D2K A;  2BS2 B;  3BVG A;  4ACF A;  1TJE A;  2V0G A;  2LGY A;  1WMH B;  2J0J A;  3VR8 B;  4KV2 A;  4EKU A;  4LK0 M;  2Y5B B;  3ZRC A;  3OWE B;  2ZPY A;  3IAM 1;  5JZE B;  3UIO B;  3SR6 A;  2REX A;  3FAH A;  1EM7 A;  2D3B A;  1C76 A;  1PFD A;  4K7W A;  3OJ4 B;  1YN5 A;  4ZYN A;  4FXC A;  2KD0 A;  5D3D A;  5HKH A;  4WWN A;  1MI0 A;  1EO6 A;  1P3Q U;  1GC7 A;  2JRI B;  2G3Q B;  1WM2 A;  1TYG B;  4XWT A;  1FCC C;  2KNB A;  3N20 C;  3W2D A;  5CHV C;  1K8R B;  2FNJ B;  2GB1 A;  1FRD A;  3ZDM C;  3Q8C A;  2M56 B;  4IM0 A;  2N9L A;  3WAL A;  1OEY J;  3IG3 A;  2BF8 B;  4IWQ A;  4CHK A;  2KJH B;  3Q6B A;  1EU3 A;  1JWS D;  1F77 A;  2KDB A;  1NYR A;  1SE2 A;  3E56 A;  2KX0 A;  1SE4 A;  1UEL A;  3QC8 B;  4MGI E;  4PYZ A;  4K7U A;  4JQW C;  2GBN A;  3DHH C;  2GLS A;  3DOW A;  5LXH A;  3EEC A;  1L0Y B;  2KDF B;  2IGH A;  4IM3 A;  3JSV B;  3OAW A;  2CU3 A;  3CWI A;  4BKS A;  3CMM B;  5FKA C;  1WGK A;  1FEH A;  4OZA A;  1IGC A;  1XQQ A;  4P1B C;  2BT6 A;  3QHT A;  4DBG A;  1WZ0 A;  1ZDV A;  4IOI E;  1YQ3 B;  4MT5 A;  3HVZ A;  2A4Z A;  3HRD D;  1ZXI A;  2H88 B;  3ZW3 A;  2O6V B;  3MC8 A;  2QIL A;  1WY8 A;  2V1Y A;  5AUK A;  1SF0 A;  1UF0 A;  3U8Z A;  2IZV B;  3I3T B;  4XX5 A;  1V9J A;  4BKS D;  1T0Q C;  4IG7 B;  4HPM B;  2W3S A;  4HCN B;  1HEZ E;  2YLM A;  4LDT D;  1CMX B;  3AE9 B;  1HQR D;  2R2O A;  2MP2 A;  2LVP A;  1V5T A;  3E9S A;  5HHD G;  4KKJ A;  3TL5 A;  3W5V B;  3RYT A;  3ZNZ B;  1BXT A;  1ZOY B;  3WA0 A;  1TGZ B;  2CKH B;  1GG3 A;  2W3R A;  1WYG A;  2PW9 A;  3PS6 A;  2LUE A;  5BYR A;  4P1C C;  1V2Y A;  4BBN F;  2KDE B;  1GC6 A;  1FO4 A;  2Z0D B;  3I63 C;  3PSE B;  2JY6 A;  3DVG Y;  3AMZ A;  4US9 A;  4ZOH C;  4PS8 A;  1WX7 A;  1ET9 A;  5IN7 A;  1GAQ B;  1FFU A;  4A3O A;  3AEF B;  3HVD A;  2Y5C A;  3VAW A;  1UWM A;  4MEM A;  4WQO B;  4DDI D;  4GU2 A;  1MHX A;  3LXF A;  5CHF A;  2HJ8 A;  4DDG D;  1VR9 A;  1N5X A;  3HM3 A;  5DPT A;  3A4S C;  3APD A;  5AZF A;  3ZNH B;  2IGD A;  4HDQ A;  2CJO A;  3O13 A;  4RGN A;  3NJT A;  4YXD B;  4A20 A;  3R2I A;  1LXD A;  3AN1 A;  3NRZ A;  1UGM A;  3ECI A;  3UIP B;  2AQ1 B;  3U7D A;  3A4R A;  4BZA A;  1V1O A;  2BWF A;  1P1A A;  2DYO A;  1UH6 A;  4K1R B;  1KM7 A;  1E7V A;  2KZR A;  4IWP A;  4AQ7 A;  1WWT A;  3CIR B;  1CQV A;  2RGF A;  3B2G A;  3W5U B;  1TTN A;  3ZIM A;  5C1Z A;  4LNK A;  2KXJ A;  2ICI A;  2L7R A;  4L1B A;  4GDL B;  1MG4 A;  2ZPN A;  1XCT L;  3SEB A;  3A1Q A;  1V8C A;  4WIP A;  1E9M A;  2RSU A;  4DQO C;  4A8X C;  1D4B A;  1JRP A;  2JYT A;  1TZO A;  4BOS C;  3RI7 C;  3RN9 C;  3BZD B;  2XK5 A;  4URK A;  1IP9 A;  3SFE B;  2KWD A;  2V4I B;  3H7P A;  2PLP A;  2YVC A;  2WWZ A;  3B2F A;  5J2R A;  3X23 A;  1YD8 U;  4HLE A;  3IHP C;  1IBX B;  3BYT B;  1L0X B;  5CHW A;  2GOW A;  4HXD A;  2L00 B;  2DX5 B;  3V6C B;  2QDF A;  2JU6 X;  1ZDX A;  5G2N A;  3N1Z C;  2K25 A;  1LO5 D;  3EUB 2;  4B9K A;  3PLU A;  2DZI A;  4C80 A;  2D3A A;  4YSX B;  2QMT A;  2RR9 A;  4FHK A;  2FE8 A;  1WX9 A;  4BKG A;  3ALB A;  4GOC A;  5JHA A;  2XEW A;  3DBR B;  2QHO A;  1PGB A;  5DPS A;  1SJE D;  1TY2 A;  2IGG A;  3RNB C;  3VUY A;  4C56 C;  4C7Z A;  4KDI C;  2WYQ A;  3CST A;  3U4E G;  1VJK A;  2INN E;  4M8M A;  4BAX A;  2ZW1 A;  2C7H A;  3MJ5 A;  4RFB A;  3TEY A;  4YTM B;  1M4V A;  2ZCC A;  3VQI A;  4OHJ A;  1E6E B;  1C4A A;  5J17 A;  3PGE A;  2WXJ A;  1P0R A;  2R2Q A;  3D32 A;  1V6E A;  2JX5 A;  3P4Q B;  4GMV A;  1SE9 A;  4A9A A;  3Q8F A;  4E71 A;  2KT7 A;  4N59 A;  1YOV B;  5C23 A;  2L83 A;  4ITK A;  3H6N A;  5CX3 A;  3RUL A;  4AWJ A;  4RM9 A;  2SAK A;  5BMH A;  3HHM A;  3DVN V;  5MPO A;  3QX1 A;  3EHV A;  2QIE B;  1AW7 A;  2LAS A;  3DBH B;  4YTN B;  4G0N B;  1KOT A;  1T0R C;  2INP E;  1STE A;  2KMA A;  3DBR I;  1E10 A;  1SIF A;  3MHZ A;  1WJU A;  2D5G A;  3A9J B;  1LM8 B;  3ONS A;  1RAX A;  4MM3 A;  3EA6 A;  3PVL A;  2BTE A;  5GXG B;  2PEA A;  2BS3 B;  4ICV A;  1B9R A;  1BT0 A;  1N60 A;  2LXA A;  1SSN A;  1JML A;  1QOA A;  4B0E A;  4EFO A;  4W9E A;  3ZGZ A;  4K81 A;  3TMP B;  4WJP A;  2ON8 A;  2K5P A;  3UQB A;  2DEN B;  4W9H A;  4XDC A;  2WXG A;  1TS4 A;  3MTN B;  1IUE A;  1YJI A;  2KK8 A;  4JIO U;  4L23 A;  1GB1 A;  1ISN A;  3DBH I;  4GGQ A;  4H2A A;  3KLS X;  4ASW C;  1DGJ A;  2KWC A;  3AEC B;  2KAC A;  3L17 A;  4EOY A;  3VVW B;  3QK0 A;  1J8C A;  2ZVO A;  3GS2 A;  3LYY A;  3ZNI D;  1TS3 A;  2FIF A;  1MVK A;  2JYE A;  4WAA A;  1K51 A;  3RMK C;  4A55 A;  3ZQ4 A;  2KLC A;  2WXQ A;  2YEP F;  4RGT A;  1K50 A;  1IYF A;  5E6O A;  1HTO A;  2MHJ A;  4ZRK A;  3PLV A;  5L95 C;  5BMI A;  3HUI A;  2IND C;  1I4P A;  3OJ3 A;  4NQK E;  4LTU A;  2WXO A;  4MAC A;  1M94 A;  1WZ3 A;  4HKZ E;  4OW0 A;  4P16 A;  4DXF A;  4F1S A;  4AUQ C;  2N7J A;  1VZ7 A;  3Q3F A;  3A9K B;  4MH0 E;  4A90 A;  3TIX A;  2KTF A;  2WHI A;  1WMH A;  2J42 A;  4GIV A;  2BKR B;  2KDI A;  3AI5 A;  1F52 A;  1OQQ A;  2IJ0 A;  4KIK B;  1XD3 B;  4E74 A;  2D10 A;  3URY A;  3GP7 A;  4RNA A;  3ENE A;  4RCO A;  2KFJ A;  2MJD A;  3RD2 A;  4AJW A;  3KVF B;  3JVZ X;  3AE8 B;  2N9X A;  3PZ7 A;  4W9F A;  5E6P A;  4HVB A;  2AWT A;  3I9V 1;  2XNA C;  4EE2 A;  2RDB C;  3WAN A;  1WXV A;  1C3T A;  3ZTD A;  1XLQ A;  2KTR A;  3PRP B;  3R7Q A;  5H8Y E;  2MX2 A;  3GB1 A;  3MHS D;  5AZG A;  4N58 A;  4NJ7 A;  1I4Q A;  2LVO A;  4JWS C;  1FM0 D;  2N9E B;  1AAR A;  2XN9 C;  3UIN B;  4BFR A;  1OEY A;  4F7Z A;  1QOG A;  1DOX A;  2N1V A;  1NVI D;  4DWF A;  2ZNV B;  2NTS A; 
#chains in the Genus database with same CATH homology
 1L4D B;  4ZRQ A;  2IPK D;  4ZRP A;  1EU4 A;  1BXT A;  1ZOY B;  1GB4 A;  2RDG A;  1PYW D;  2W3R A;  2WXN A;  1WYG A;  2PW9 A;  3AB5 A;  1TS5 A;  1N5W A;  2MH7 A;  5BYR A;  1SXT A;  2EKI A;  1XF5 L;  2I2Y A;  1VLB A;  3IAS 1;  3ZYY X;  1FO4 A;  3AEA B;  2W54 A;  1HXY D;  2JQR B;  4M0W A;  2KAJ A;  1F0Z A;  1FXA A;  2LHE A;  3AMZ A;  1QIL A;  4US9 A;  4ZOH C;  1J7A A;  1B1Z A;  1ET9 A;  1SBB B;  1GAQ B;  3AEE B;  1XO3 A;  2H89 B;  2BS4 B;  1BML C;  1FFU A;  2WDV B;  2TSS A;  3H8H A;  1UWX A;  1D6E C;  3AEF B;  3HVD A;  4WWM A;  2Y5C A;  1F2R C;  1NI3 A;  1UWM A;  4NAW B;  1MPE A;  1XLO A;  2N9K A;  5HFY A;  4B0M A;  1I7H A;  1MHX A;  4RF1 A;  3P4R B;  3LXF A;  1DOI A;  1PGX A;  1YN4 A;  3LB8 C;  1E0Z A;  4ZHP A;  2DYM A;  1VR9 A;  3RFZ B;  1N5X A;  1K53 A;  1N63 A;  2WU5 B;  2BB6 A;  2NTS A;  2WNM A;  2QJL A;  2LFI A;  1PGA A;  2R61 A;  2BB5 A;  2IGD A;  2CJO A;  3O13 A;  4AS1 A;  4RGN A;  1L5P A;  4KGS A;  3NZ3 A;  4RGM A;  2AX5 A;  2BW2 A;  1TKY A;  4YXD B;  1HA5 A;  3Q8E A;  1FXI A;  1V1P A;  1YNT E;  3R2I A;  3SFD B;  3AN1 A;  3NRZ A;  2K22 A;  2LEK A;  2AQ1 B;  3PZ8 A;  4P6V F;  4WH4 A;  3L4P A;  2ACZ B;  1V1O A;  2LMC A;  1RYJ A;  4WAF A;  2L52 A;  2JXT A;  3AE1 B;  1YQ4 B;  1E7P B;  2DYO A;  5BYS A;  3AE4 B;  1OQR A;  3Q8A A;  4USA A;  1JAL A;  2G9H D;  1FD6 A;  4AQ7 A;  1C9F A;  1WWT A;  1D5X C;  1Q10 A;  4OVZ A;  3CIR B;  4Q2J A;  2VZK B;  1CQV A;  1L4Z B;  4XE0 A;  3B2G A;  3W5U B;  1ROE A;  4DXG A;  3NVW A;  1AYF A;  5LNK 1;  2LHD A;  2M0A A;  2ICI A;  2L1A A;  1XEE A;  5EE3 A;  5C2T B;  4L1B A;  1J7B A;  3NVY A;  3ZJT A;  4RGO S;  2KN4 A;  3Q69 A;  4GLS C;  4GDL B;  1FFV A;  1D5Z C;  1C77 A;  1QLB B;  2EEL A;  3TEW A;  5G5H A;  1ESF A;  1XCT L;  3SEB A;  1V8C A;  3N9Y C;  4C7Y A;  4WIP A;  1E9M A;  2KQ4 X;  1AN8 A;  4N6E B;  3KQ4 A;  3U7Z A;  3MC0 B;  4DQO C;  1K52 A;  3I57 A;  3TSS A;  4A8X C;  1JW9 D;  1D4B A;  1JRP A;  2JYT A;  1TZO A;  1F2R I;  3MFG A;  1JRO A;  2ZW0 A;  3BZD B;  3BVZ A;  3SFE B;  1I4X A;  2KWD A;  4IKG A;  4XDD A;  3AV8 A;  2V4I B;  5E6J A;  2PLP A;  4JWU C;  3VRA B;  4JX1 C;  4ZYS A;  2HDE A;  2JWU A;  2ONQ A;  4HRS A;  5G5G A;  1QT9 A;  1QOF A;  3PO0 A;  2LJI A;  4R3D A;  3B2F A;  1TY0 A;  4UDU C;  4KGT A;  3AE6 B;  3UI3 A;  5D7G A;  2LGI A;  5HG2 A;  1IBX B;  1NEK B;  2V3P A;  3BYT B;  1L0X B;  2PIA A;  5EE9 A;  3AM9 A;  4RF0 A;  1UNS A;  1KH0 A;  2WXH A;  3KWV A;  1V97 A;  2LUM A;  3IT4 B;  4YT0 B;  5TSS A;  2JU6 X;  1ZDX A;  4HEA 1;  1EWC A;  1ZE3 D;  1YMH E;  2GRI A;  1FMA D;  1KRH A;  3BK1 A;  3AEB B;  4TSS A;  2WLB A;  2OED A;  4LLG M;  1RM6 C;  1LO5 D;  3EUB 2;  2PKO A;  3T3N A;  1QF6 A;  4C80 A;  2W82 A;  1JWB D;  4YSX B;  2QMT A;  1NEN B;  3AE5 B;  1I4H A;  2FE8 A;  2NMQ A;  4CQN A;  1KF6 B;  1QOB A;  2WXR A;  1R7S A;  1XLP A;  1WSP A;  1CJE A;  3ETR A;  1PGB A;  1SJE D;  3W9C B;  2G1E A;  5AUI A;  1TY2 A;  2IGG A;  4C56 C;  4XWW A;  4C7Z A;  4MM3 B;  3AED B;  1C79 A;  1NYQ A;  1N61 A;  2PMV A;  4PT5 A;  3ABV B;  3IXS A;  3U4E G;  1MHH E;  1VJK A;  1C4P A;  2SEB D;  3AEG B;  2INN E;  3FIL B;  2ZW1 A;  3MJ5 A;  1QQR A;  3P42 A;  4KX6 B;  1BUI C;  4RFB A;  3VRB B;  3TEY A;  1SJH D;  1D5M C;  1M4V A;  2YEP B;  3VQI A;  4OHJ A;  4YTM B;  2X38 A;  1E6E B;  1C4A A;  1XLN A;  2OHF A;  1Y56 A;  5H92 C;  2WXJ A;  3U52 E;  2J53 A;  3Q8B A;  1YJJ A;  2WS3 B;  2JX5 A;  3P63 A;  1PUT A;  4ZHO A;  3FC4 A;  2KMM A;  3P4Q B;  3TUO A;  1IBX A;  1GOZ A;  1AWD A;  4A9A A;  1ZPS A;  4TQ1 A;  3Q8F A;  5C3J B;  4N59 A;  3DWM A;  2JZP A;  1ZXH A;  2L83 A;  1T5X D;  1SE3 A;  1SEB D;  3R8B A;  4ITK A;  2MJ3 A;  3P1M A;  5EE0 A;  2WQY B;  2J52 A;  3BK2 A;  1VDV A;  2SAK A;  5BMH A;  2WXI A;  3J9C A;  3V05 A;  1DYQ A;  5MPO A;  4YWG G;  2QEJ C;  5FK9 C;  2BBC A;  2QIE B;  1AW7 A;  4YTN B;  3P4S B;  1FNU A;  4YSZ B;  2B76 B;  2INP E;  2KDM A;  4HKQ A;  1ET6 A;  2PVO D;  4KGR A;  1STE A;  3U2S C;  3NVV A;  2K9X A;  4TQ0 A;  1E10 A;  1L0V B;  3MHZ A;  2WDR B;  1JWM D;  2D5G A;  1UUP A;  1ACC A;  1RFK A;  4JE3 B;  1C78 A;  2WDQ B;  4OZB A;  1DOY A;  3EA6 A;  1C4C A;  2BTE A;  2I38 A;  1RWS A;  1VRA B;  2BS3 B;  5GXG B;  1B9R A;  1N60 A;  1KTK A;  1KLG D;  1SSN A;  1JML A;  1QOA A;  1WXQ A;  2L32 A;  4B0E A;  2QSD A;  4ARC A;  1T3Q A;  3B9J A;  4US8 A;  1T6B X;  1UGJ A;  3ZGZ A;  2N0S B;  5HI1 A;  2DWQ A;  2WXM A;  5BMG A;  1SIJ A;  2ON8 A;  2K5P A;  4XDC A;  1JWU D;  2J4X A;  2W55 A;  1I4G A;  1KFY B;  2FBW B;  2E3T A;  2WXG A;  1TS4 A;  3NVZ A;  1YN3 A;  4A6Q A;  1IUE A;  1HZ6 A;  1YJI A;  3BII D;  3EGR A;  5BYQ A;  1KLU D;  1QKZ A;  3T3O A;  3BYY B;  2Y3A A;  4L23 A;  1EWY C;  1GB1 A;  1FNW A;  4HRO A;  2E6X A;  2RDH A;  1V1P B;  1GPX A;  4JPS A;  1JWA D;  1FRR A;  4D2K A;  1FNV A;  4H2A A;  2BS2 B;  3BVG A;  3KLS X;  1TJE A;  2V0G A;  1JQ4 A;  1DGJ A;  3AEC B;  2KAC A;  1FIQ A;  1CK1 A;  2WXP A;  3VR8 B;  4HJG E;  4OZC A;  4LK0 M;  1L6V A;  2Y5P A;  5I4D A;  2FUG 1;  2DLB A;  3GS2 A;  3LYY A;  3OWE B;  3R2T A;  4NJC A;  1TS3 A;  3IAM 1;  1MVK A;  3TEZ A;  1A70 A;  1XXG A;  2JYE A;  3VR9 B;  1VZ6 A;  3AH7 A;  3SR6 A;  1K51 A;  3FAH A;  3MP9 A;  4A55 A;  3ZQ4 A;  2K0P A;  1EM7 A;  2WXQ A;  2M19 A;  2YEP F;  4GDK B;  1C76 A;  3AE2 B;  2AQ2 B;  1PFD A;  2VZK D;  1TS2 A;  1YN5 A;  4RGT A;  1K50 A;  1XCQ L;  2AQ3 B;  1ZUD 2;  4FXC A;  5D3D A;  3C8Y A;  1MI0 A;  2IDY A;  1TKG A;  1HZ5 A;  4NAM A;  3ZJU A;  5BMI A;  3HUI A;  3WCQ A;  1TKE A;  1P7F A;  1I4P A;  1TYG B;  4XWT A;  1FCC C;  2MEK A;  4LTU A;  2WXO A;  3W2D A;  4MAC A;  4YTP B;  4HKZ E;  5FR3 A;  4OW0 A;  2GB1 A;  4P16 A;  1FRD A;  4DXF A;  3Q8C A;  2GI9 A;  2M56 B;  2N9L A;  4KKI A;  2K3U A;  2PTL A;  2N7J A;  2WU2 B;  1VZ7 A;  2WXK A;  1EU3 A;  1JWS D;  1F77 A;  1NYR A;  1SE2 A;  3E56 A;  4TMA B;  1SE4 A;  4O1N A;  2V3N A;  2NTT A;  4A90 A;  2J42 A;  4NZL B;  1I4R A;  1L0Y B;  2HTM E;  2DBY A;  2IGH A;  4J3O D;  4MH8 A;  1WRI A;  1L6U A;  2WXL A;  4YSY B;  3BVM A;  2CU3 A;  2BYT A;  2CJN A;  1OQQ A;  2IJ0 A;  3CWI A;  5FKA C;  1WGK A;  3TEX A;  3RPF C;  3URY A;  1FEH A;  4OZA A;  3GP7 A;  4RNA A;  5EE1 A;  1IGC A;  1N62 A;  4RCO A;  4RH6 A;  2MJD A;  1P7E A;  2BT6 A;  1ZDV A;  4IOI E;  3AE8 B;  3AE7 B;  3PZ7 A;  1YQ3 B;  4MT5 A;  3DWG C;  3HVZ A;  3FIL A;  3ZJV A;  3HRD D;  1ZXI A;  3I9V 1;  2XNA C;  4EE2 A;  2H88 B;  1VZ8 A;  1XLQ A;  3KWL A;  3NUH B;  2QIL A;  2WXF A;  1PDX A;  1IGD A;  5AUK A;  1SF0 A;  2Z8L A;  3V3X A;  5H8Y E;  1JCK B;  2MJE A;  3GB1 A;  2RMM A;  1ZP0 B;  5D3I B;  4N58 A;  3BWU D;  1I4Q A;  1ENF A;  4JWS C;  1FM0 D;  2XN9 C;  3NS1 A;  3AE3 B;  2W3S A;  1FCL A;  1HEZ E;  3P4P B;  4L2Y A;  4IDI A;  2Q5W D;  3W1S A;  2PVG C;  2WP9 B;  3AE9 B;  4WQM A;  2JSV X;  1CZP A;  1HQR D;  1QOG A;  2RPV A;  4REZ A;  1DOX A;  1NVI D;  5T8I A;  1J7C A;  4WUR A;  3E9S A;  3IT6 B;  5HHD G;  4KKJ A;  3W5V B;  4ARI A;  5JXV A;  1OFF A;  1SB3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...