4ASWC

Structure of the complex between the n-terminal dimerisation domain of sgt2 and the ubl domain of get5
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'NAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PRO
molecule tags Chaperone
source organism Saccharomyces cerevisiae
publication title Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins
pubmed doi rcsb
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4aswC00
1WR1A 2ZVOA 5G55A 4XX5A 4B9KA 4KZCA 3ZNHB 2DZMA 4FJYA 3GZNI 4PS3A 3A1QB 2DYOA 2MRPA 2JPHA 2LZ6A 3KUZA 2JT4B 2AL6A 5DPWA 1UZXB 2GBNA 4WWOA 3H6NA 3K9PB 5L83A 3ZNZB 1WGGA 3RT3B 3ZIMA 1A5RA 4ZRKA 2C60A 3ALBA 1WE7A 2MQJA 3DVNV 4URKA 2HJ8A 1ISNA 2NBVB 4KDIC 2J0MA 2KFKA 3WAPA 3WANA 1J8CA 2ZCBA 2FIFA 4K7WA 4KSLC 4FHKA 2KFJA 3OAWA 3TMPB 2AYOB 3VAWA 3T9LA 4ZDVA 1WXAA 5AZFA 4E74A 5FR6A 2KANA 1NI2A 2IO2B 3EC8A 3QK0A 4FJVB 4HK2A 2XEWA 2O2VA 4A3PA 3PGEA 4GDKA 3PREA 2N9EB 4IWQA 3QIJA 4FLHA 1I35A 2CHXA 4MGIE 1Z2MA 3IBEA 3D32A 3ZLZA 2L05A 1U4AA 3TL5A 2ZPNA 1WE6A 3VUWA 3TJPA 4FBJB 3EFUA 3BY4B 4GIVA 3M63B 4FHJA 5AEKB 3ZRFA 2K1FA 1I42A 2FNJB 4FULA 3AU5A 4MSQB 1Q5WB 4MDKE 3CSFA 2UYZB 4M0WB 3VH4B 4F8CB 2JF5A 3HK0A 4EZKA 3KYDD 3BINA 4AOFA 4FJZA 5CX3A 3ZNGC 2KDFB 2KLCA 3Q3FA 2MBEA 2NPTB 2G45B 4HXDA 1V5OA 1S3SG 1P0RA 4ANVA 4DDID 2KQSA 1AARA 4DHZB 2KJRA 1J0GA 2MBHA 3M95A 2DHZA 1WZ3A 3A9KB 3UQBA 3QAQA 4GXBA 3PPAA 2D10A 5C23A 4NAWB 1IYFA 3NZSA 3PRPB 2K8HA 2HD5B 2BF8B 2WX0A 2K39A 3APDA 2BKRB 3ZVVA 3A9JA 2DAFA 4N9F4 3APCA 2RGFA 4ZYNA 3AI5A 3A9JB 4HJKA 4IG7B 3WA0A 1E8YA 3PSEB 3VUXA 3PLVA 3CF6E 2LXCA 4ZRIA 2BPSA 2KTRB 4W9FA 1V81A 1JRUA 1WGHA 2DYBA 5C1ZA 4IM2A 2WX1A 2LUEA 3ZTDA 4HCPB 3VHTC 1E7VA 2BGFA 2KTFA 3ZW3A 1WYWB 3L10B 4MGKE 2AEHA 4A20A 2V4LA 4KVGB 3UIPB 2KMCA 5IA7A 5L95C 2EKEC 3S2AA 3JYUA 3DBLI 3QQ8B 1XT9B 1WM2A 4JIOU 4MELA 2DAJA 3PHWB 3PRMB 2J7QB 4ICUA 4TQ1A 1LM8B 2HE7A 1L2NA 2MA9B 3KUDB 4B6WA 3LJ3A 1WGRA 1WZ0A 2RR9A 2JWZA 4ANWA 4DHJD 2KMAA 2Z0EB 3R7RA 4II2B 2BWFA 1GG3A 1HE8A 2MW5A 3N32A 3OLMD 4NQLB 3W1SC 3ZKJC 2M4NA 3ENEA 3RCZA 1WJ6A 3OJ4B 3LDZE 4MJSA 3VQIA 4ZRJA 2Y5BB 2G4DB 3N3KB 3IVFA 3H9DA 2M1MA 4EZJA 5LLIA 3DCGA 2KVRA 1YD8U 3TCAA 2KJ6A 2M0XA 2RPQA 3HM6X 1UGMA 2GBJA 2JVCA 2N7DA 1TGZB 4EOYA 4HLEA 3HIZA 5TR5A 3AU4A 4PYZA 2JZ3B 4CO7A 4AJYB 4DWFA 5CHVC 4EUTA 3JVZX 4M8MA 1UD7A 4IM0A 1ZKHA 2LVQA 1KLVA 4M8NA 4X57B 4KZ0A 2JY6A 5JHBA 4G11A 2L8JA 4LDTD 4WWPA 2FUHB 2KX3A 2A4ZA 3H7SA 3R3MA 4FN2A 4WQOB 3WIMA 3R7QA 3L16A 4DDGD 2C9WB 3VTVA 2IY1B 2DZKA 3I3TB 4AP4C 4CYEA 2W9NA 3HHMA 3EECA 1P9DU 2LXAA 3PHXB 4LCDE 1IP9A 2CS4A 3DBRI 1R4NI 1J19A 2G4SA 1S1QB 1SE9A 2IO3B 1WM3A 2L00B 4GN1A 4TKNA 5G2NA 4BOSC 2KKCA 4LDTB 2CHWA 2MLBA 4W9HA 2MX2A 4GU2A 2JUOA 4TQ0A 4MGZE 3QCAA 3ZTCA 4GSWA 2PE6B 2NVUI 2O6VA 3PS6A 4IWPA 1OTRB 1V9JA 4YL8A 3WAMA 1MG8A 5JHAA 2NCNA 5DPRA 3RD2A 2C7MB 2G3QB 2WDTB 1Z5SB 3P2BA 4WJPA 2ZVNA 3Q3JA 3ZO5B 3OJ3A 4LJPB 4NY0A 4DK5A 1Q1OA 4PYUA 5GMVA 1SGHA 1GUAB 2KWCA 1RAXA 2EMSA 3KVFB 4KDLB 4BKSA 2ZNVC 3NOBA 1OEYJ 3RZWC 3KH0A 2KHWB 1WXSA 1P3QU 2KWVB 2UWQA 1E8ZA 4W9GA 5D94A 3A4SC 3DVNU 2NBUA 2K6DB 2IYDB 4G0NB 2O6VD 3QARA 2DZJA 1P1AA 1TTNA 1WX9A 2LRWA 1C1YB 1V2YA 2LRUA 4GB9A 5DPSA 4E71A 4F7ZA 1E7UA 2ZNVB 3MHSD 4PS8A 3U7DA 2V3SA 1FXTB 2LJ5A 2CU1A 3TBLD 2MBQA 1Y8RC 2LVPA 2L7RA 2NPTA 1WXMA 1WJ4A 3DVGY 1WH3A 4W9IA 2IO0B 1XD3B 3IFWB 4BKSD 3AULA 2JZZA 3H7PB 1WGDA 1WJNA 3L54A 4GDLB 4J6IA 4RM8A 3DQVA 4W9DA 3L08A 3KW5B 2A5UA 3W1SA 3QA8A 1E5WA 3PZDA 3VTWA 2O6VB 2RSUA 1E90A 4WJNA 2D07B 3R66C 2IZVB 2C5LC 3V61A 4ASWC 2L76A 3NS8A 1WX8A 4IUMB 2DENB 2L0FA 2ZPYA 5BO4B 3RULA 3V62A 1EUVB 3ZDMC 3IG3A 3GOEA 4TUUA 3TIXA 3AXCA 3KYCD 3EHVA 3C0RB 2N1WA 4JQWC 2I1JA 2KX0A 5D2MB 4ANUA 2LGDA 2LWPA 3DOWA 5J2RA 3O65B 2YVCA 3N30A 3RYTA 2KJHB 5EDSA 4G50A 4MM3A 1YJ1A 2D2QA 3KUCB 2DX5B 2WYQA 1WIAA 1UH6A 4GDKB 4II3B 2FAZA 4EKUA 1E8XA 2I1KA 4AUQC 1WI0A 2M17A 2C7NB 2KTRA 3SU8X 3B08A 1OGWA 2KXJA 2KQ7A 3MTNB 1IPGA 2XBBC 1RFAA 2IY0B 4HWIB 4B95A 2C7HA 4IM3A 4LJOB 4AWJA 4EFOA 2N9XA 3ZUNA 2JXXA 2J0JA 3DPDA 2LASA 1M94A 1V6EA 3WAOA 5J17A 1OEYA 2PEAA 1V49A 2IO1B 2OJRA 2NR2A 2PJHA 4HCNB 4MGYE 2B3AA 4BOZB 2REXA 3ONSA 3M3JA 2R2QA 1ZW7A 4K7UA 4MH0E 1VCBA 3L0WB 2WWZA 4NQKE 3B1LX 5DCNA 3RZFA 3X0WA 1GC7A 5E6OA 4NPNA 1LXDA 2BYFA 2FCNA 3VTUA 4NJ7A 4E3CA 3PRZA 4A3OA 3QX1A 4W9KA 3PV1A 2QHOA 2JRIB 2Z0DB 4W9LA 1F9JA 1WXVA 1RRBA 2KC1A 4I6PA 4F1SA 1CMXB 4HVBA 1YQBA 2N4FA 2MBOA 2XK5A 3QWZB 5DPTA 3VFKA 4GGQA 1RLFA 1UBQA 3APFA 5HKHA 2MCNB 2D11A 3IHPC 2Z59B 4JLCA 2NBWB 2FCQA 2J0KA 1WJUA 2PPHA 4HDOA 1H4RA 1KM7A 3UF8A 4MSMB 3U30A 2K25A 2K8CA 3A33B 5AZHA 2BYEA 2KOXA 3PTFC 4TV3A 4W9CA 4HPMB 3VH3B 2K6QA 2K8BA 2KN5A 4XZ4A 2MBBB 1PQSA 2N1VA 4NNJB 3ZNID 2MSED 1H8CA 1WFYA 2GBRA 4FA6A 3QJZA 2FCMA 2N9PC 3CSTA 2N7EA 4RMAA 1LFDA 2RD0A 1EO6A 2CKHB 3QHTA 3DBSA 3JSVA 3VVWB 4I6LB 3UQAA 4BVUC 2AWTA 3RUIB 3SHQA 4W9EA 1D3ZA 2MWSB 4WJOA 4I6NB 4RM9A 2GOWA 4DXAB 2KZRA 2M8SA 3NY5A 3VDZA 1WGYA 2KNBA 4BBNC 5JH5C 2ZCCA 3CMMB 3NHEB 5CTRC 3ZDTA 3V60A 5KHOA 4JL9A 1Q0WB 2O2VB 5E6PA 2AL3A 2V1YA 1X1MA 1BT0A 3B0AA 4ICVA 4IW0A 2L0TA 3U8ZA 3X23A 5J18A 4JGHB 2FCSA 4OVUA 4BKTA 1WF9A 3PLUA 5JZEB 1L7YA 4WAAA 3UGBB 4DHJB 2BKFA 3T8MA 5IAAC 4EEWA 1WX7A 4K7SA 4HPLB 5CHWA 1KJTA 2KFKB 2BWES 1GC6A 1QZEA 4IC7B 4KIKA 5AZGA 2DYMA 1TZ1A 1K8RB 4KIKB 1UBIA 2ASQA 4MEMA 1E8WA 1VD2A 1WR6E 2GBKA 1V86A 2KLGA 3NZUA 4BFRA 5LXHA 2KK8A 1R4MI 3ML8A 2ZZPB 4PS7A 2EMTA 4HDQA 3JSVB 4MJSB 5D6JB 1GNUA 3SD5A 2KD0A 4DHZE 3L17A 4GOCA 3A4RA 4AJWA 4BBNF 5D7GA 3DBHI 2LI5A 4G3XB 1NDDA 2BYVE 2GBMA 4K1RB 1T0YA 3SDLC 3V6EB 2VRRB 1V5TA 2LGYA 3PVLA 4DBGA 3M62B 4EZLA 3QC8B 4WJQA 2L3ZA 2LVOA 2ZJDA 1WY8A 3ML9A 4K81A 2IBIB 4W9JA 2KDEB 3VXWA 1C3TA 4CHKA 2KWUB 3H7PA 4GDLA 1YIWA 2GMIC 1YX6B 1ZGUB 1EF5A 3L13A 3VUYA 3DVGX 2PE9A 3UIOB 1XQQA 2MP2A 1KOTA 3K9OB 3ZRCA 3HM3A 4KV2A 1P98A 1LQBA 5E6NA 1WMHA 2HTHA 2OOBB 3H1UA 3UINB 2CR5A 4NAWA 4NJ6A 1V80A 1WMHB 2CHZA 3PT2B 4P7IA 2KDIA 2LD9A 3A9KA 2ZEQA 4KSKC 2YLMA 1EF1A 4BKGA 2MP2B 2D3GA 3MJWA 4XC2A 3V6CB 1G6JA 1GJZA 2R2OA 1YX5B 1UELA 5CHFA 3WALA 4FADA 5KHQA 3DDCB 2FIDA 2NS5A 2XK5B 1OQYA 2KO3A 2KC2A 4ANXA 3W1YA 2LGXA 3JW0X 1WRDB 3ECIA 1TBEA 4GMVA 4IWOA 3A1QA 2KDBA 4OVVA 1NBFC 2DZIA 1SIFA 4WWNA 5LXIB 2JRHA
chains in the Genus database with same CATH superfamily
2ICIA 5G55A 2KMMA 2DZMA 4FJYA 4RF1A 5BYQA 3GZNI 4PS3A 1VZ8A 2DYOA 2LZ6A 1SIJA 1KLGD 2AL6A 1FIQA 4WWOA 5L83A 1N5WA 3RT3B 3DHHC 1MVKA 1WE7A 2MQJA 2WHIA 4URKA 3ZJTA 1ISNA 2KFKA 1J8CA 1ENFA 2FIFA 2KFJA 3AE1B 2AYOB 4ZDVA 2BS4B 5AZFA 4E74A 1NI2A 2IO2B 4FJVB 4HK2A 2O2VA 3T3OA 1D5MC 3PREA 4MM3B 1SJED 1ZXHA 1GB4A 4MGIE 1ROEA 3HVDA 3MHZA 2JZPA 2CU3A 2JYTA 2E6XA 3BY4B 4GIVA 4FHJA 2JX5A 4HKZE 2IGDA 2RDHA 1I42A 1F52A 1FNVA 1Q5WB 4MDKE 4A9AA 3W5VB 3HK0A 4A55A 3DBRB 2QC8A 3Q3FA 2G45B 4HXDA 1V5OA 3DBLB 1S3SG 4N6EB 1P0RA 4ANVA 2KQSA 4H2AA 3MJ5A 1J0GA 2MBHA 1V1OA 3A9KB 2H88B 2W3RA 3PRPB 2K8HA 2HD5B 2WS3B 3APDA 1IGDA 3A9JA 1TYGB 4N9F4 1SEBD 2QIEB 4JX1C 3AE9B 2INNE 4ZYNA 4HJKA 1E8YA 2AQ3B 4YT0B 2WXMA 3PLVA 3RNAC 3FILA 3N1XC 3CF6E 4ZRIA 4JWUC 2DYBA 4RGTA 3Q14C 4HCPB 1E7VA 2KTFA 1WYWB 3BZDB 2AEHA 4DQOC 4KVGB 1FCLA 2EKEC 1N60A 1D5ZC 3QQ8B 1WM2A 1TS5A 3AE3B 3PHWB 3URYA 1E9MA 4LLGM 1L2NA 1WZ0A 4DHJD 1MI0A 1YJJA 3R7RA 3N32A 4NQLB 2MW5A 3OLMD 3W1SC 2V4IB 1UNSA 1WJ6A 3RCZA 1J7CA 3NVZA 4MJSA 1SSNA 3H9DA 4RGNA 3DCGA 3TCAA 2PKOA 2IPKD 2RPQA 4REZA 5JXVA 1CK1A 1TGZB 4EOYA 5TR5A 5BYRA 2JZ3B 4KGTA 4AJYB 3JVZX 1L0YB 4M8MA 3IT6B 2QILA 2RDBC 2J52A 2X38A 1IGCA 4BZAA 2JY6A 2KT7A 2KX3A 2A4ZA 3H7SA 3WIMA 2K3UA 1UWXA 3L16A 4DDGD 4AP4C 3I3TB 4LCDE 2LXAA 1IP9A 2IO3B 4DHZE 1SBBB 1VDVA 2CHWA 2MLBA 2KWDA 2MX2A 4MGZE 4GSWA 2PE6B 5JHAA 3RD2A 2C7MB 3P2BA 4WJPA 2KYWA 4NY0A 3RPFC 1Q1OA 4PYUA 4LNOA 2KWCA 1QT9A 3T3NA 3KH0A 3N1YC 1WXSA 4OW0A 1P3QU 5D94A 3A4SC 2NBUA 2IYDB 1F77A 1LGRA 2O6VD 2WXHA 1TTNA 5DPSA 2LRUA 1E7UA 3U7DA 1FXTB 4RCOA 1Y8RC 2PW9A 3PO0A 5AUKA 1XLNA 2BB5A 3H7PB 4GDLB 3L54A 1HA5A 2DBYA 2YEPF 2O6VB 4WJNA 4XWTA 1WXQA 3SR6A 1ZDXA 3DHGC 1UWMA 3V62A 3RULA 1DYQA 1KRHA 1F2RC 1FFVA 3ABVB 2D5GA 3EHVA 5D2MB 4C56C 1L6UA 5EDSA 2D2QA 2DX5B 3LXFA 1WIAA 1UH6A 4II3B 4QAYA 1SJHD 2I1KA 2M17A 2WXFA 4DXFA 4WIPA 1SE4A 1RFAA 2IY0B 1WRIA 4B95A 4KGRA 4IM3A 4AWJA 5IN7A 4A6QA 1M4VA 1FRRA 1STEA 1M94A 5J17A 1SXTA 1OEYA 4MGYE 4WH4A 1CZPA 3M3JA 1ZW7A 2FUG1 3R8BA 3B1LX 2FCNA 4A3OA 2AQ2B 2QHOA 1P7EA 2JRIB 2Z0DB 1F9JA 2PLPA 2N4FA 1RLFA 2LGSA 2LHEA 3IHPC 2NBWB 2J0KA 1ZE3D 1H4RA 1KM7A 3UF8A 3R2TA 3U30A 2K25A 2K8CA 1I4QA 4TV3A 1T6BX 4PT5A 2MBBB 2BW2A 4NNJB 4XZ4A 3ZNID 1HZ6A 3GS2A 1FNWA 4A90A 3TEYA 1HZ5A 3CSTA 2N7EA 1LFDA 3QHTA 1PDXA 3VVWB 2BS2B 1TKYA 3UQAA 3P4SB 5IP4D 5BMIA 4I6NB 3RNGC 2DNFA 3Q8CA 3CMMB 2BT6A 3NHEB 4JE3B 3B0AA 4IW0A 2L0TA 1WF9A 3PLUA 4WAAA 1OFFA 3L4PA 4K7SA 4HPLB 2D3BA 2DYMA 2MJDA 1UBIA 1E8WA 1VD2A 3W9CB 3NZUA 5LXHA 3CWIA 3OG5A 3ML8A 3JSVB 4MJSB 5D6JB 4AS1A 3L17A 3A4RA 4AJWA 2WXGA 2RMMA 5D7GA 4K1RB 1T0YA 1ZDVA 2BTEA 2ZJDA 1T0QC 1WY8A 1TKEA 4K81A 2IBIB 1XF5L 1C3TA 4L2YA 2KWUB 3H7PA 2XNAC 1YIWA 4GDLA 1MFWA 3DVGX 3E56A 2MP2A 3HM3A 1EWYC 1LQBA 2WDRB 5HHDG 2HTHA 3UINB 1MG4A 1V8CA 3W5UB 2KDIA 4KSKC 2D3GA 3DWMA 3V6CB 1N61A 3KQ4A 4WURA 2WXIA 1N63A 1QKZA 1YJIA 1FCCC 3W1YA 1I4PA 4IWOA 4WAFA 1NBFC 1SIFA 2AQ1B 1FRDA 2KAJA 2IGHA 2MRPA 2WXJA 3EGRA 3J9CA 3NVVA 2GBNA 3K9PB 1C4CA 3EUB2 1R4MB 1R4NB 1WGGA 1E7PB 4ZRKA 3Q2AC 4US8A 3WANA 2ZCBA 3TEZA 3TMPB 5IO9A 2QJLA 3C8YA 1UF0A 3EC8A 2XEWA 4A3PA 4C7YA 4GDKA 2G1EA 5EE1A 1ACCA 2Q5WD 1VLBA 1C4AA 5E6JA 1Z2MA 3V05A 3AEDB 1K51A 1RWSA 2CJNA 3E9SA 1L5PA 5EE9A 4FBJB 3M63B 2W55A 3ZRFA 2K1FA 4OZBA 2FNJB 3CSFA 2UYZB 4M0WB 3VH4B 3NG0A 4IOIE 2WDQB 2AX5A 2MBEA 2SAKA 3OWEB 1I7HA 4DHZB 1K53A 2LGIA 3M95A 4RFBA 3TEXA 3UQBA 4GXBA 3PPAA 5G5HA 2D10A 2UU7A 3IAM1 3NZSA 2WX0A 2K39A 1JROA 3ZVVA 1K52A 3APCA 2BBCA 1JALA 4IG7B 3HUIA 4EE2A 4ZHOA 5C1ZA 3ZTDA 3ZW3A 3L10B 4MGKE 3O13A 2V4LA 3UIPB 2J4XA 2KMCA 5L95C 4CQNA 4JIOU 2J7QB 1LM8B 2IJ0A 4YSXB 3LJ3A 1WGRA 4FXCA 4RH6A 2KMAA 2Z0EB 3ZKJC 2M4NA 3ENEA 5C2TB 1NYQA 1L4ZB 1VZ6A 4ZRJA 2HDEA 3UI3A 2M1MA 2KVRA 2KJ6A 1UGMA 1Q10A 3HIZA 4ZRQA 2LFIA 1NENB 1D5XC 4DWFA 4EUTA 3DBHB 1UD7A 1ZKHA 2VH2A 1L0XB 1E10A 1L4DB 2FBWB 1YN5A 2FUHB 3PZ8A 3AN1A 3R7QA 3NVYA 1SF0A 2C9WB 3PHXB 2OEDA 3DBRI 1R4NI 4A8XC 2G4SA 1S1QB 4BOSC 1WM3A 2L00B 2KKCA 4LDTB 3ZGZA 1T5XD 4C00A 4W9HA 4GU2A 3ZTCA 3PS6A 4YL8A 1JWAD 1MG8A 2NCNA 4HPPA 3ZO5B 1C4PA 2V3NA 3TSSA 5GMVA 1RAXA 3B9JA 4XGAB 2ZNVC 2L83A 3NOBA 2KHWB 1OQRA 1KF6B 1C76A 1WX9A 1G6JA 3HVZA 4E71A 3NS1A 1F2RI 4GLSC 4C7ZA 1VZ7A 2LJ5A 2CU1A 1CJEA 2LVPA 2JWUA 2NPTA 1EU4A 1WJ4A 3AEAB 1WH3A 3IFWB 4BKSD 2JZZA 3AE7B 1WJNA 1YNTE 4S17A 4JWSC 3Q6BA 3AH7A 3AB5A 5GXGB 1XEEA 2L0FA 1FXIA 3TIXA 3KYCD 5TSSA 3C0RB 2W3SA 3GE3C 1RYJA 2BQQA 1QF6A 4YTNB 3RYTA 1L0VB 4MM3A 2K9XA 2WYQA 3NJTA 4EKUA 4AUQC 4M00A 3SU8X 2WXPA 3BYTB 4PK1A 1EM7A 1PGBA 4HWIB 3P63A 1OQQA 3I9V1 2LMCA 3Q69A 2JXXA 3DHIC 5HFYA 4MT5A 4BAXA 1V6EA 3WAOA 1V49A 2OJRA 3ZJUA 2KACA 3ONSA 4WQMA 2PMVA 1KTKA 2PVOD 1MHHE 5E6OA 1LXDA 4W9KA 5BYSA 4HVBA 1YOVB 1YQBA 2XK5A 3VFKA 2E3TA 4R3DA 4JLCA 2FCQA 1WJUA 3B2FA 3GP7A 3A33B 2BYEA 2KOXA 4HPMB 2K6QA 2K8BA 2KN5A 3CIRB 2N1VA 2MSED 2FCMA 2CKHB 4RF0A 4OHJA 3MC9A 4RM9A 2M8SA 3NY5A 1WGYA 4BBNC 1SE2A 5JH5C 2ZCCA 2MJ3A 2MJEA 5CTRC 2QEJC 3ZDTA 3V60A 1Q0WB 2AL3A 2V1YA 5H8YE 4OVUA 5JZEB 3UGBB 4XE0A 4ACFA 1KJTA 2BVCA 3P4PB 2MHJA 1QOBA 4KIKB 3I63C 2ASQA 1XXGA 1VRAB 1R4MI 2K22A 2KK8A 1I4GA 2EMTA 1FXAA 1GNUA 1C78A 2L32A 2EKIA 4KGSA 1DGJA 1NDDA 2BYVE 2GBMA 3SDLC 3V6EB 1YQ4B 2VRRB 3PVLA 2NMQA 3NRZA 4DBGA 4EZLA 2L3ZA 3ML9A 3VXWA 4HJGE 1YX6B 1ZGUB 1CQVA 3W2DA 2HTME 1C79A 2W54A 2I2YA 4UDUC 1ZOYB 2WXNA 1WMHA 1V1PB 2CR5A 4NAWA 1WMHB 3PT2B 2ZEQA 1EF1A 5FK9C 2MP2B 1JRPA 1UELA 1PFDA 4HRSA 3ZXVA 1Y56A 2FIDA 2KO3A 2KC2A 4C4VA 1WRDB 2PTLA 2LJIA 3ECIA 3BVGA 4N59A 4XX5A 5MPOA 5FR3A 2INCC 2JPHA 1TS2A 3KUZA 3P4RB 5DPWA 3R2IA 3H6NA 3ZNZB 3N20C 4LNKA 3ZIMA 4MACA 2HJ8A 3Q3OC 2NBVB 4KDIC 3WAPA 4HEA1 1FFUA 4K7WA 2IGGA 4FHKA 3VAWA 3OAWA 3T9LA 1KLUD 1WXAA 2KANA 4AQ7A 3QK0A 5IKCM 2QDFA 2N9EB 2M0AA 3QIJA 1I35A 3IBEA 3D32A 3TL5A 2ZPNA 1WE6A 3TJPA 3AU5A 1PGXA 4MSQB 1UGJA 2G9HD 2JF5A 4EZKA 2WXQA 2WXOA 3KYDD 1QOAA 1N5XA 2QCZA 4FJZA 5CX3A 3ZNGC 2KDFB 3BK2A 4OZAA 3GZNB 1AARA 2KJRA 3SFEB 1A70A 1XCQL 2DHZA 1P7FA 1N6ZA 1FM0D 4NAWB 3P1MA 4NZLB 1R7SA 2BF8B 1D6EC 3AI5A 3A9JB 3ZXRA 3EFCA 2BPSA 4W9FA 4IM2A 2WX1A 2BGFA 1PYWD 2KVZA 2WU5B 2NTSA 3S2AA 3JYUA 3DBLI 2ZW0A 3RFZB 1XT9B 4MELA 2B76B 4TQ1A 3Q8FA 2HE7A 3KUDB 4ANWA 2JWZA 2BWFA 1HE8A 2ZW1A 2VZKB 3RI7C 3C19A 3LDZE 3VQIA 3NUHB 2Y5BB 4EZJA 1NEKB 1YD8U 2M0XA 3HM6X 2JVCA 2N7DA 4HLEA 3P42A 1BUIC 2LHDA 4OZCA 5CHVC 4C80A 4IM0A 1TS4A 2LVQA 4L1BA 4M8NA 4KZ0A 4G11A 4FN2A 4WQOB 3Q8BA 1WSPA 1IBXB 3VTVA 1RFKA 1YMHE 2IY1B 4CYEA 2M19A 2W9NA 1AYFA 2PIAA 3EECA 2CS4A 4RNAA 1J19A 5G2NA 2K0PA 2LEKA 3AE6B 1QLBB 3VR8B 4TMAB 1K50A 2N7JA 1NYRA 4TQ0A 1T3QA 2O6VA 3B2GA 1V9JA 3WAMA 2WP9B 5DPRA 2LUMA 2G3QB 5AUIA 2WU2B 1E0ZA 1NI3A 4P1BC 4LJPB 1GUAB 3KWVA 3KVFB 2EMSA 3RZWC 1OEYJ 2UWQA 3FC4A 1E8ZA 4W9GA 3DVNU 1ET9A 2M56B 4M0WA 3QARA 1P1AA 4GB9A 1C1YB 2ZNVB 3MHSD 2JYEA 1XLQA 4YXDB 2OHFA 1C77A 2D3CA 3DVGY 4W9IA 1XD3B 4JPSA 4Q2JA 4J6IA 4W9DA 3DQVA 3KW5B 3W1SA 3QA8A 1E5WA 3PZDA 2RSUA 4ARIA 3R66C 2IZVB 1DOIA 3V61A 4ASWC 2L76A 1LO5D 5BO4B 1EUVB 3ZDMC 1GAQB 4TUUA 3AXCA 3ZYYX 4JQWC 2I1JA 2KX0A 5H92C 2GI9A 2LGDA 2LWPA 3DOWA 1GOZA 3O65B 2KJHB 3U52E 1YJ1A 2FAZA 3Q3NC 1WI0A 2C7NB 3B08A 3V3XA 2KXJA 2KQ7A 3MTNB 1B1ZA 1SB3C 2C7HA 2R61A 1TS3A 1NVID 5EE0A 3ZUNA 2J0JA 3U7ZA 4YTPB 2PEAA 3LB8C 2PJHA 2Y5CA 2NR2A 4HCNB 1F1HA 2IDYA 1AW7A 2FE8A 5HI1A 2R2QA 4K7UA 4XDCA 4HROA 3L0WB 4OVZA 2WWZA 4NQKE 3RZFA 5DCNA 3RMKC 3X0WA 3ZJVA 2X8XX 1JWMD 2BYFA 3VTUA 1ZP0B 4E3CA 3PRZA 4C4VB 4F1SA 2KC1A 4I6PA 1CMXB 2CJOA 5DPTA 3QWZB 2L52A 4GGQA 3APFA 5HKHA 2D11A 1UUPA 4HDOA 1AN8A 1I4XA 4MSMB 4USAA 5AZHA 3RNFC 3VH3B 1PQSA 1FD6A 2WNMA 1PUTA 1H8CA 1FNUA 3NVWA 3QJZA 2N9PC 1GB1A 1E6EB 4RMAA 3BIID 2RD0A 3DBSA 3JSVA 4I6LB 4YSZB 1JCKB 4BVUC 2AWTA 3RUIB 4W9EA 2MWSB 3MFGA 4WJOA 4DXAB 2KZRA 3VDZA 4NAMA 2KNBA 4WWMA 2V3PA 4JL9A 5KHOA 5E6PA 4XWWA 3H8HA 4B0MA 1X1MA 4J3OD 4ZHPA 5J18A 5C3JB 2INPE 4BKTA 4S0RA 2BKFA 3T8MA 5IAAC 1QOGA 4EEWA 1BMLC 2BWES 1ET6A 1TZ1A 2GBKA 1WR6E 2W82A 1V86A 4BFRA 2ZZPB 3I57A 1ZXIA 5G5GA 1QQRA 2GLSA 4GOCA 3DBHI 4G3XB 2J42A 2LGYA 3M62B 2LVOA 3MC8A 3FILB 5D3IB 4TSSA 4CHKA 3L13A 3VUYA 2PE9A 2DLBA 2BYTA 3K9OB 3N1ZC 3ZRCA 3IXSA 4KKIA 1J7AA 4NJ6A 1V80A 2N9KA 2XN9C 2N0SB 3A9KA 4MH8A 1QILA 2WDVB 1YX5B 5CHFA 3AM9A 1I4HA 5KHQA 2SEBD 3DDCB 2NS5A 2XK5B 4XDDA 4ANXA 2LGXA 1PGAA 3KLSX 1TBEA 3SEBA 2JRHA 4WWNA 2N9LA 5LXIB 1WR1A 2ZVOA 4B9KA 2L1AA 4KZCA 5BMGA 3ZNHB 4KX6B 3A1QB 2JT4B 4B0EA 1UZXB 1IUEA 3IAS1 1A5RA 2C60A 3ALBA 3DVNV 2J0MA 1JWSD 1IBXA 3RNCC 4KSLC 1BXTA 2WGSA 1C9FA 3MC0B 1SE3A 5FR6A 3PGEA 3ZQ4A 1F0ZA 4IWQA 4FLHA 4LK0M 3FAHA 2CHXA 1WYGA 3ZLZA 2L05A 1RM6C 1U4AA 3EA6A 3VUWA 3AE4B 3EFUA 1HXYD 5AEKB 4ARCA 2BB6A 2Y5PA 4FULA 3U2SC 4F8CB 1TY2A 3BINA 1WWTA 4AOFA 2KLCA 3VRAB 2V0GA 3LYYA 2NPTB 4KKJA 2Z8LA 3TEWA 1YN3A 4DDID 1MJDA 4ZRPA 4YWGG 1WZ3A 1TT5B 5D3DA 3QAQA 4P16A 5C23A 1IYFA 2WXLA 5I4DA 2BKRB 4LNNA 1JWBD 2DAFA 2RGFA 3WA0A 3PSEB 3VUXA 1QOFA 1T0SC 2KN4A 1AWDA 2MEKA 2LXCA 2KTRB 2YEPB 1V81A 1JRUA 1WGHA 1KH0A 1EU3A 2LUEA 2WLBA 4N58A 4IDIA 3VHTC 4M02A 4A20A 5IA7A 1HTQA 1JW9D 2DAJA 1L6VA 1T0RC 3PRMB 4ICUA 2HJ1A 3RNBC 1ZPSA 3BVZA 2MA9B 4B6WA 2RR9A 4II2B 1GG3A 3OJ4B 2JQRB 2G4DB 3P4QB 3N3KB 2GRIA 3IVFA 3TUOA 3BK1A 5LLIA 5BMHA 3RN9C 2INDC 2GBJA 4RGOS 1JMLA 3FKYA 1JQ4A 3AU4A 4PYZA 4YTMB 4CO7A 1J7BA 1HEZE 4YSYB 4LNIA 1DOXA 1KLVA 3VR9B 4X57B 2OJWA 1V1PA 5JHBA 2L8JA 4LDTD 4WWPA 3ETRA 3R3MA 3AECB 2KDMA 2RPVA 2DZKA 2RDGA 3AV8A 3HHMA 1P9DU 2DWQA 3GB1A 1D4BA 4GN1A 1SE9A 4TKNA 4ZYSA 2JUOA 3QCAA 2H89B 3AEEB 2NVUI 4IWPA 1OTRB 3Q3MC 1B9RA 1N62A 2WDTB 1Z5SB 3I5JC 2ZVNA 3Q3JA 3OJ3A 3U4EG 1MPEA 4DK5A 1SGHA 5FKAC 4D2KA 4KDLB 4BKSA 2MH7A 2KWVB 1VJKA 2K6DB 4G0NB 4LNFA 2DZJA 2LRWA 1V2YA 2I38A 4F7ZA 2V9HA 4PS8A 2V3SA 2JSVX 3TBLD 4IKGA 2MBQA 1HTOA 2L7RA 4O1NA 1WXMA 3VRBB 2IO0B 3WCQA 3AULA 3MP9A 1WGDA 4RM8A 1GPXA 3AEBB 3L08A 2A5UA 1ZUD2 2GB1A 3VTWA 1E90A 2D07B 2BS3B 2C5LC 1TKGA 1V97A 4NJCA 1YQ3B 2ACZB 3NS8A 1WX8A 4IUMB 2DENB 2ZPYA 3BWUD 3IG3A 3SFDB 3GOEA 2N1WA 3BVMA 1I4RA 4P6VF 1TY0A 4ANUA 1EWCA 5J2RA 2YVCA 1FPYA 3N30A 2ONQA 3AEFB 4G50A 4LTUA 3KUCB 3DWGC 3AE2B 4GDKB 1E8XA 3Q8EA 1VR9A 2KTRA 2VH1A 1OGWA 2WXKA 5EE3A 1IPGA 2XBBC 5T8IA 4K3CA 4LJOB 3AE8B 1XCTL 2N9XA 4EFOA 1DOYA 2J53A 3DPDA 2LASA 4ZOHC 2IO1B 2B3AA 4BOZB 1KFYB 2REXA 3HRDD 4MH0E 4HKQA 2K5PA 1VCBA 2ON8A 1GC7A 4NPNA 1TZOA 4NJ7A 1XLPA 3QX1A 3PV1A 4W9LA 1WXVA 1RRBA 1XO3A 1TIFA 2MBOA 4XYCA 1UBQA 1YN4A 2MCNB 2D3AA 3AMZA 2PPHA 1JWUD 2KQ4X 3PTFC 1FMAD 4W9CA 3BYYB 2NTTA 1WFYA 2JXTA 2GBRA 4FA6A 1FEHA 4ITKA 1EO6A 5IOIA 3Q8AA 3SHQA 1XLOA 1D3ZA 2GOWA 1FO4A 3AE5B 2O2VB 3IT4B 4ICVA 3U8ZA 1BT0A 3X23A 4JGHB 2JU6X 2FCSA 1ESFA 1L7YA 4DHJB 1MHXA 1WX7A 5CHWA 3GE8C 2KFKB 1GC6A 1QZEA 4IC7B 4KIKA 5AZGA 3N9YC 4K3BA 1K8RB 4MEMA 3NZ3A 2KLGA 1TJEA 4PS7A 2WQYB 4HDQA 3SD5A 2KD0A 4BBNF 3PZ7A 2LI5A 2Y3AA 4DXGA 4L23A 1V5TA 2PVGC 2TSSA 3QC8B 4WJQA 4W9JA 2VZKD 4RGMA 2KDEB 2WXRA 3RNEC 2GMIC 3AEGB 1EF5A 3UIOB 1XQQA 1KOTA 4US9A 4KV2A 1P98A 5E6NA 4M01A 2OOBB 3H1UA 2CHZA 5LNK1 4P7IA 2LD9A 2YLMA 4BKGA 3MJWA 4XC2A 1GJZA 2EELA 1HQRD 2R2OA 5HG2A 3WALA 4FADA 1OQYA 2QSDA 3JW0X 4P1CC 4GMVA 3A1QA 1WGKA 2KDBA 4OVVA 3KWLA 2DZIA 2Z59B 2QMTA
chains in the Genus database with same CATH topology
1WR1A 2ZVOA 5G55A 4XX5A 4B9KA 4KZCA 3ZNHB 2DZMA 4FJYA 3GZNI 4PS3A 3A1QB 2DYOA 2MRPA 2JPHA 2LZ6A 3KUZA 2JT4B 2AL6A 5DPWA 1UZXB 2GBNA 4WWOA 3H6NA 3K9PB 5L83A 3ZNZB 1WGGA 3RT3B 3ZIMA 1A5RA 4ZRKA 2C60A 3ALBA 1WE7A 2MQJA 3DVNV 4URKA 2HJ8A 1ISNA 2NBVB 4KDIC 2J0MA 2KFKA 3WAPA 3WANA 1J8CA 2ZCBA 2FIFA 4K7WA 4KSLC 4FHKA 2KFJA 3OAWA 3TMPB 2AYOB 3VAWA 3T9LA 4ZDVA 1WXAA 5AZFA 4E74A 5FR6A 2KANA 1NI2A 2IO2B 3EC8A 3QK0A 4FJVB 4HK2A 2XEWA 2O2VA 4A3PA 3PGEA 4GDKA 3PREA 2N9EB 4IWQA 3QIJA 4FLHA 1I35A 2CHXA 4MGIE 1Z2MA 3IBEA 3D32A 3ZLZA 2L05A 1U4AA 3TL5A 2ZPNA 1WE6A 3VUWA 3TJPA 4FBJB 3EFUA 3BY4B 4GIVA 3M63B 4FHJA 5AEKB 3ZRFA 2K1FA 1I42A 2FNJB 4FULA 3AU5A 4MSQB 1Q5WB 4MDKE 3CSFA 2UYZB 4M0WB 3VH4B 4F8CB 2JF5A 3HK0A 4EZKA 3KYDD 3BINA 4AOFA 4FJZA 5CX3A 3ZNGC 2KDFB 2KLCA 3Q3FA 2MBEA 2NPTB 2G45B 4HXDA 1V5OA 1S3SG 1P0RA 4ANVA 4DDID 2KQSA 1AARA 4DHZB 2KJRA 1J0GA 2MBHA 3M95A 2DHZA 1WZ3A 3A9KB 3UQBA 3QAQA 4GXBA 3PPAA 2D10A 5C23A 4NAWB 1IYFA 3NZSA 3PRPB 2K8HA 2HD5B 2BF8B 2WX0A 2K39A 3APDA 2BKRB 3ZVVA 3A9JA 2DAFA 4N9F4 3APCA 2RGFA 4ZYNA 3AI5A 3A9JB 4HJKA 4IG7B 3WA0A 1E8YA 3PSEB 3VUXA 3PLVA 3CF6E 2LXCA 4ZRIA 2BPSA 2KTRB 4W9FA 1V81A 1JRUA 1WGHA 2DYBA 5C1ZA 4IM2A 2WX1A 2LUEA 3ZTDA 4HCPB 3VHTC 1E7VA 2BGFA 2KTFA 3ZW3A 1WYWB 3L10B 4MGKE 2AEHA 4A20A 2V4LA 4KVGB 3UIPB 2KMCA 5IA7A 5L95C 2EKEC 3S2AA 3JYUA 3DBLI 3QQ8B 1XT9B 1WM2A 4JIOU 4MELA 2DAJA 3PHWB 3PRMB 2J7QB 4ICUA 4TQ1A 1LM8B 2HE7A 1L2NA 2MA9B 3KUDB 4B6WA 3LJ3A 1WGRA 1WZ0A 2RR9A 2JWZA 4ANWA 4DHJD 2KMAA 2Z0EB 3R7RA 4II2B 2BWFA 1GG3A 1HE8A 2MW5A 3N32A 3OLMD 4NQLB 3W1SC 3ZKJC 2M4NA 3ENEA 3RCZA 1WJ6A 3OJ4B 3LDZE 4MJSA 3VQIA 4ZRJA 2Y5BB 2G4DB 3N3KB 3IVFA 3H9DA 2M1MA 4EZJA 5LLIA 3DCGA 2KVRA 1YD8U 3TCAA 2KJ6A 2M0XA 2RPQA 3HM6X 1UGMA 2GBJA 2JVCA 2N7DA 1TGZB 4EOYA 4HLEA 3HIZA 5TR5A 3AU4A 4PYZA 2JZ3B 4CO7A 4AJYB 4DWFA 5CHVC 4EUTA 3JVZX 4M8MA 1UD7A 4IM0A 1ZKHA 2LVQA 1KLVA 4M8NA 4X57B 4KZ0A 2JY6A 5JHBA 4G11A 2L8JA 4LDTD 4WWPA 2FUHB 2KX3A 2A4ZA 3H7SA 3R3MA 4FN2A 4WQOB 3WIMA 3R7QA 3L16A 4DDGD 2C9WB 3VTVA 2IY1B 2DZKA 3I3TB 4AP4C 4CYEA 2W9NA 3HHMA 3EECA 1P9DU 2LXAA 3PHXB 4LCDE 1IP9A 2CS4A 3DBRI 1R4NI 1J19A 2G4SA 1S1QB 1SE9A 2IO3B 1WM3A 2L00B 4GN1A 4TKNA 5G2NA 4BOSC 2KKCA 4LDTB 2CHWA 2MLBA 4W9HA 2MX2A 4GU2A 2JUOA 4TQ0A 4MGZE 3QCAA 3ZTCA 4GSWA 2PE6B 2NVUI 2O6VA 3PS6A 4IWPA 1OTRB 1V9JA 4YL8A 3WAMA 1MG8A 5JHAA 2NCNA 5DPRA 3RD2A 2C7MB 2G3QB 2WDTB 1Z5SB 3P2BA 4WJPA 2ZVNA 3Q3JA 3ZO5B 3OJ3A 4LJPB 4NY0A 4DK5A 1Q1OA 4PYUA 5GMVA 1SGHA 1GUAB 2KWCA 1RAXA 2EMSA 3KVFB 4KDLB 4BKSA 2ZNVC 3NOBA 1OEYJ 3RZWC 3KH0A 2KHWB 1WXSA 1P3QU 2KWVB 2UWQA 1E8ZA 4W9GA 5D94A 3A4SC 3DVNU 2NBUA 2K6DB 2IYDB 4G0NB 2O6VD 3QARA 2DZJA 1P1AA 1TTNA 1WX9A 2LRWA 1C1YB 1V2YA 2LRUA 4GB9A 5DPSA 4E71A 4F7ZA 1E7UA 2ZNVB 3MHSD 4PS8A 3U7DA 2V3SA 1FXTB 2LJ5A 2CU1A 3TBLD 2MBQA 1Y8RC 2LVPA 2L7RA 2NPTA 1WXMA 1WJ4A 3DVGY 1WH3A 4W9IA 2IO0B 1XD3B 3IFWB 4BKSD 3AULA 2JZZA 3H7PB 1WGDA 1WJNA 3L54A 4GDLB 4J6IA 4RM8A 3DQVA 4W9DA 3L08A 3KW5B 2A5UA 3W1SA 3QA8A 1E5WA 3PZDA 3VTWA 2O6VB 2RSUA 1E90A 4WJNA 2D07B 3R66C 2IZVB 2C5LC 3V61A 4ASWC 2L76A 3NS8A 1WX8A 4IUMB 2DENB 2L0FA 2ZPYA 5BO4B 3RULA 3V62A 1EUVB 3ZDMC 3IG3A 3GOEA 4TUUA 3TIXA 3AXCA 3KYCD 3EHVA 3C0RB 2N1WA 4JQWC 2I1JA 2KX0A 5D2MB 4ANUA 2LGDA 2LWPA 3DOWA 5J2RA 3O65B 2YVCA 3N30A 3RYTA 2KJHB 5EDSA 4G50A 4MM3A 1YJ1A 2D2QA 3KUCB 2DX5B 2WYQA 1WIAA 1UH6A 4GDKB 4II3B 2FAZA 4EKUA 1E8XA 2I1KA 4AUQC 1WI0A 2M17A 2C7NB 2KTRA 3SU8X 3B08A 1OGWA 2KXJA 2KQ7A 3MTNB 1IPGA 2XBBC 1RFAA 2IY0B 4HWIB 4B95A 2C7HA 4IM3A 4LJOB 4AWJA 4EFOA 2N9XA 3ZUNA 2JXXA 2J0JA 3DPDA 2LASA 1M94A 1V6EA 3WAOA 5J17A 1OEYA 2PEAA 1V49A 2IO1B 2OJRA 2NR2A 2PJHA 4HCNB 4MGYE 2B3AA 4BOZB 2REXA 3ONSA 3M3JA 2R2QA 1ZW7A 4K7UA 4MH0E 1VCBA 3L0WB 2WWZA 4NQKE 3B1LX 5DCNA 3RZFA 3X0WA 1GC7A 5E6OA 4NPNA 1LXDA 2BYFA 2FCNA 3VTUA 4NJ7A 4E3CA 3PRZA 4A3OA 3QX1A 4W9KA 3PV1A 2QHOA 2JRIB 2Z0DB 4W9LA 1F9JA 1WXVA 1RRBA 2KC1A 4I6PA 4F1SA 1CMXB 4HVBA 1YQBA 2N4FA 2MBOA 2XK5A 3QWZB 5DPTA 3VFKA 4GGQA 1RLFA 1UBQA 3APFA 5HKHA 2MCNB 2D11A 3IHPC 2Z59B 4JLCA 2NBWB 2FCQA 2J0KA 1WJUA 2PPHA 4HDOA 1H4RA 1KM7A 3UF8A 4MSMB 3U30A 2K25A 2K8CA 3A33B 5AZHA 2BYEA 2KOXA 3PTFC 4TV3A 4W9CA 4HPMB 3VH3B 2K6QA 2K8BA 2KN5A 4XZ4A 2MBBB 1PQSA 2N1VA 4NNJB 3ZNID 2MSED 1H8CA 1WFYA 2GBRA 4FA6A 3QJZA 2FCMA 2N9PC 3CSTA 2N7EA 4RMAA 1LFDA 2RD0A 1EO6A 2CKHB 3QHTA 3DBSA 3JSVA 3VVWB 4I6LB 3UQAA 4BVUC 2AWTA 3RUIB 3SHQA 4W9EA 1D3ZA 2MWSB 4WJOA 4I6NB 4RM9A 2GOWA 4DXAB 2KZRA 2M8SA 3NY5A 3VDZA 1WGYA 2KNBA 4BBNC 5JH5C 2ZCCA 3CMMB 3NHEB 5CTRC 3ZDTA 3V60A 5KHOA 4JL9A 1Q0WB 2O2VB 5E6PA 2AL3A 2V1YA 1X1MA 1BT0A 3B0AA 4ICVA 4IW0A 2L0TA 3U8ZA 3X23A 5J18A 4JGHB 2FCSA 4OVUA 4BKTA 1WF9A 3PLUA 5JZEB 1L7YA 4WAAA 3UGBB 4DHJB 2BKFA 3T8MA 5IAAC 4EEWA 1WX7A 4K7SA 4HPLB 5CHWA 1KJTA 2KFKB 2BWES 1GC6A 1QZEA 4IC7B 4KIKA 5AZGA 2DYMA 1TZ1A 1K8RB 4KIKB 1UBIA 2ASQA 4MEMA 1E8WA 1VD2A 1WR6E 2GBKA 1V86A 2KLGA 3NZUA 4BFRA 5LXHA 2KK8A 1R4MI 3ML8A 2ZZPB 4PS7A 2EMTA 4HDQA 3JSVB 4MJSB 5D6JB 1GNUA 3SD5A 2KD0A 4DHZE 3L17A 4GOCA 3A4RA 4AJWA 4BBNF 5D7GA 3DBHI 2LI5A 4G3XB 1NDDA 2BYVE 2GBMA 4K1RB 1T0YA 3SDLC 3V6EB 2VRRB 1V5TA 2LGYA 3PVLA 4DBGA 3M62B 4EZLA 3QC8B 4WJQA 2L3ZA 2LVOA 2ZJDA 1WY8A 3ML9A 4K81A 2IBIB 4W9JA 2KDEB 3VXWA 1C3TA 4CHKA 2KWUB 3H7PA 4GDLA 1YIWA 2GMIC 1YX6B 1ZGUB 1EF5A 3L13A 3VUYA 3DVGX 2PE9A 3UIOB 1XQQA 2MP2A 1KOTA 3K9OB 3ZRCA 3HM3A 4KV2A 1P98A 1LQBA 5E6NA 1WMHA 2HTHA 2OOBB 3H1UA 3UINB 2CR5A 4NAWA 4NJ6A 1V80A 1WMHB 2CHZA 3PT2B 4P7IA 2KDIA 2LD9A 3A9KA 2ZEQA 4KSKC 2YLMA 1EF1A 4BKGA 2MP2B 2D3GA 3MJWA 4XC2A 3V6CB 1G6JA 1GJZA 2R2OA 1YX5B 1UELA 5CHFA 3WALA 4FADA 5KHQA 3DDCB 2FIDA 2NS5A 2XK5B 1OQYA 2KO3A 2KC2A 4ANXA 3W1YA 2LGXA 3JW0X 1WRDB 3ECIA 1TBEA 4GMVA 4IWOA 3A1QA 2KDBA 4OVVA 1NBFC 2DZIA 1SIFA 4WWNA 5LXIB 2JRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR1 A;  2ZVO A;  5G55 A;  4XX5 A;  4B9K A;  4KZC A;  3ZNH B;  2DZM A;  4FJY A;  3GZN I;  4PS3 A;  3A1Q B;  2DYO A;  2MRP A;  2JPH A;  2LZ6 A;  3KUZ A;  2JT4 B;  2AL6 A;  5DPW A;  1UZX B;  2GBN A;  4WWO A;  3H6N A;  3K9P B;  5L83 A;  3ZNZ B;  1WGG A;  3RT3 B;  3ZIM A;  1A5R A;  4ZRK A;  2C60 A;  3ALB A;  1WE7 A;  2MQJ A;  3DVN V;  4URK A;  2HJ8 A;  1ISN A;  2NBV B;  4KDI C;  2J0M A;  2KFK A;  3WAP A;  3WAN A;  1J8C A;  2ZCB A;  2FIF A;  4K7W A;  4KSL C;  4FHK A;  2KFJ A;  3OAW A;  3TMP B;  2AYO B;  3VAW A;  3T9L A;  4ZDV A;  1WXA A;  5AZF A;  4E74 A;  5FR6 A;  2KAN A;  1NI2 A;  2IO2 B;  3EC8 A;  3QK0 A;  4FJV B;  4HK2 A;  2XEW A;  2O2V A;  4A3P A;  3PGE A;  4GDK A;  3PRE A;  2N9E B;  4IWQ A;  3QIJ A;  4FLH A;  1I35 A;  2CHX A;  4MGI E;  1Z2M A;  3IBE A;  3D32 A;  3ZLZ A;  2L05 A;  1U4A A;  3TL5 A;  2ZPN A;  1WE6 A;  3VUW A;  3TJP A;  4FBJ B;  3EFU A;  3BY4 B;  4GIV A;  3M63 B;  4FHJ A;  5AEK B;  3ZRF A;  2K1F A;  1I42 A;  2FNJ B;  4FUL A;  3AU5 A;  4MSQ B;  1Q5W B;  4MDK E;  3CSF A;  2UYZ B;  4M0W B;  3VH4 B;  4F8C B;  2JF5 A;  3HK0 A;  4EZK A;  3KYD D;  3BIN A;  4AOF A;  4FJZ A;  5CX3 A;  3ZNG C;  2KDF B;  2KLC A;  3Q3F A;  2MBE A;  2NPT B;  2G45 B;  4HXD A;  1V5O A;  1S3S G;  1P0R A;  4ANV A;  4DDI D;  2KQS A;  1AAR A;  4DHZ B;  2KJR A;  1J0G A;  2MBH A;  3M95 A;  2DHZ A;  1WZ3 A;  3A9K B;  3UQB A;  3QAQ A;  4GXB A;  3PPA A;  2D10 A;  5C23 A;  4NAW B;  1IYF A;  3NZS A;  3PRP B;  2K8H A;  2HD5 B;  2BF8 B;  2WX0 A;  2K39 A;  3APD A;  2BKR B;  3ZVV A;  3A9J A;  2DAF A;  4N9F 4;  3APC A;  2RGF A;  4ZYN A;  3AI5 A;  3A9J B;  4HJK A;  4IG7 B;  3WA0 A;  1E8Y A;  3PSE B;  3VUX A;  3PLV A;  3CF6 E;  2LXC A;  4ZRI A;  2BPS A;  2KTR B;  4W9F A;  1V81 A;  1JRU A;  1WGH A;  2DYB A;  5C1Z A;  4IM2 A;  2WX1 A;  2LUE A;  3ZTD A;  4HCP B;  3VHT C;  1E7V A;  2BGF A;  2KTF A;  3ZW3 A;  1WYW B;  3L10 B;  4MGK E;  2AEH A;  4A20 A;  2V4L A;  4KVG B;  3UIP B;  2KMC A;  5IA7 A;  5L95 C;  2EKE C;  3S2A A;  3JYU A;  3DBL I;  3QQ8 B;  1XT9 B;  1WM2 A;  4JIO U;  4MEL A;  2DAJ A;  3PHW B;  3PRM B;  2J7Q B;  4ICU A;  4TQ1 A;  1LM8 B;  2HE7 A;  1L2N A;  2MA9 B;  3KUD B;  4B6W A;  3LJ3 A;  1WGR A;  1WZ0 A;  2RR9 A;  2JWZ A;  4ANW A;  4DHJ D;  2KMA A;  2Z0E B;  3R7R A;  4II2 B;  2BWF A;  1GG3 A;  1HE8 A;  2MW5 A;  3N32 A;  3OLM D;  4NQL B;  3W1S C;  3ZKJ C;  2M4N A;  3ENE A;  3RCZ A;  1WJ6 A;  3OJ4 B;  3LDZ E;  4MJS A;  3VQI A;  4ZRJ A;  2Y5B B;  2G4D B;  3N3K B;  3IVF A;  3H9D A;  2M1M A;  4EZJ A;  5LLI A;  3DCG A;  2KVR A;  1YD8 U;  3TCA A;  2KJ6 A;  2M0X A;  2RPQ A;  3HM6 X;  1UGM A;  2GBJ A;  2JVC A;  2N7D A;  1TGZ B;  4EOY A;  4HLE A;  3HIZ A;  5TR5 A;  3AU4 A;  4PYZ A;  2JZ3 B;  4CO7 A;  4AJY B;  4DWF A;  5CHV C;  4EUT A;  3JVZ X;  4M8M A;  1UD7 A;  4IM0 A;  1ZKH A;  2LVQ A;  1KLV A;  4M8N A;  4X57 B;  4KZ0 A;  2JY6 A;  5JHB A;  4G11 A;  2L8J A;  4LDT D;  4WWP A;  2FUH B;  2KX3 A;  2A4Z A;  3H7S A;  3R3M A;  4FN2 A;  4WQO B;  3WIM A;  3R7Q A;  3L16 A;  4DDG D;  2C9W B;  3VTV A;  2IY1 B;  2DZK A;  3I3T B;  4AP4 C;  4CYE A;  2W9N A;  3HHM A;  3EEC A;  1P9D U;  2LXA A;  3PHX B;  4LCD E;  1IP9 A;  2CS4 A;  3DBR I;  1R4N I;  1J19 A;  2G4S A;  1S1Q B;  1SE9 A;  2IO3 B;  1WM3 A;  2L00 B;  4GN1 A;  4TKN A;  5G2N A;  4BOS C;  2KKC A;  4LDT B;  2CHW A;  2MLB A;  4W9H A;  2MX2 A;  4GU2 A;  2JUO A;  4TQ0 A;  4MGZ E;  3QCA A;  3ZTC A;  4GSW A;  2PE6 B;  2NVU I;  2O6V A;  3PS6 A;  4IWP A;  1OTR B;  1V9J A;  4YL8 A;  3WAM A;  1MG8 A;  5JHA A;  2NCN A;  5DPR A;  3RD2 A;  2C7M B;  2G3Q B;  2WDT B;  1Z5S B;  3P2B A;  4WJP A;  2ZVN A;  3Q3J A;  3ZO5 B;  3OJ3 A;  4LJP B;  4NY0 A;  4DK5 A;  1Q1O A;  4PYU A;  5GMV A;  1SGH A;  1GUA B;  2KWC A;  1RAX A;  2EMS A;  3KVF B;  4KDL B;  4BKS A;  2ZNV C;  3NOB A;  1OEY J;  3RZW C;  3KH0 A;  2KHW B;  1WXS A;  1P3Q U;  2KWV B;  2UWQ A;  1E8Z A;  4W9G A;  5D94 A;  3A4S C;  3DVN U;  2NBU A;  2K6D B;  2IYD B;  4G0N B;  2O6V D;  3QAR A;  2DZJ A;  1P1A A;  1TTN A;  1WX9 A;  2LRW A;  1C1Y B;  1V2Y A;  2LRU A;  4GB9 A;  5DPS A;  4E71 A;  4F7Z A;  1E7U A;  2ZNV B;  3MHS D;  4PS8 A;  3U7D A;  2V3S A;  1FXT B;  2LJ5 A;  2CU1 A;  3TBL D;  2MBQ A;  1Y8R C;  2LVP A;  2L7R A;  2NPT A;  1WXM A;  1WJ4 A;  3DVG Y;  1WH3 A;  4W9I A;  2IO0 B;  1XD3 B;  3IFW B;  4BKS D;  3AUL A;  2JZZ A;  3H7P B;  1WGD A;  1WJN A;  3L54 A;  4GDL B;  4J6I A;  4RM8 A;  3DQV A;  4W9D A;  3L08 A;  3KW5 B;  2A5U A;  3W1S A;  3QA8 A;  1E5W A;  3PZD A;  3VTW A;  2O6V B;  2RSU A;  1E90 A;  4WJN A;  2D07 B;  3R66 C;  2IZV B;  2C5L C;  3V61 A;  4ASW C;  2L76 A;  3NS8 A;  1WX8 A;  4IUM B;  2DEN B;  2L0F A;  2ZPY A;  5BO4 B;  3RUL A;  3V62 A;  1EUV B;  3ZDM C;  3IG3 A;  3GOE A;  4TUU A;  3TIX A;  3AXC A;  3KYC D;  3EHV A;  3C0R B;  2N1W A;  4JQW C;  2I1J A;  2KX0 A;  5D2M B;  4ANU A;  2LGD A;  2LWP A;  3DOW A;  5J2R A;  3O65 B;  2YVC A;  3N30 A;  3RYT A;  2KJH B;  5EDS A;  4G50 A;  4MM3 A;  1YJ1 A;  2D2Q A;  3KUC B;  2DX5 B;  2WYQ A;  1WIA A;  1UH6 A;  4GDK B;  4II3 B;  2FAZ A;  4EKU A;  1E8X A;  2I1K A;  4AUQ C;  1WI0 A;  2M17 A;  2C7N B;  2KTR A;  3SU8 X;  3B08 A;  1OGW A;  2KXJ A;  2KQ7 A;  3MTN B;  1IPG A;  2XBB C;  1RFA A;  2IY0 B;  4HWI B;  4B95 A;  2C7H A;  4IM3 A;  4LJO B;  4AWJ A;  4EFO A;  2N9X A;  3ZUN A;  2JXX A;  2J0J A;  3DPD A;  2LAS A;  1M94 A;  1V6E A;  3WAO A;  5J17 A;  1OEY A;  2PEA A;  1V49 A;  2IO1 B;  2OJR A;  2NR2 A;  2PJH A;  4HCN B;  4MGY E;  2B3A A;  4BOZ B;  2REX A;  3ONS A;  3M3J A;  2R2Q A;  1ZW7 A;  4K7U A;  4MH0 E;  1VCB A;  3L0W B;  2WWZ A;  4NQK E;  3B1L X;  5DCN A;  3RZF A;  3X0W A;  1GC7 A;  5E6O A;  4NPN A;  1LXD A;  2BYF A;  2FCN A;  3VTU A;  4NJ7 A;  4E3C A;  3PRZ A;  4A3O A;  3QX1 A;  4W9K A;  3PV1 A;  2QHO A;  2JRI B;  2Z0D B;  4W9L A;  1F9J A;  1WXV A;  1RRB A;  2KC1 A;  4I6P A;  4F1S A;  1CMX B;  4HVB A;  1YQB A;  2N4F A;  2MBO A;  2XK5 A;  3QWZ B;  5DPT A;  3VFK A;  4GGQ A;  1RLF A;  1UBQ A;  3APF A;  5HKH A;  2MCN B;  2D11 A;  3IHP C;  2Z59 B;  4JLC A;  2NBW B;  2FCQ A;  2J0K A;  1WJU A;  2PPH A;  4HDO A;  1H4R A;  1KM7 A;  3UF8 A;  4MSM B;  3U30 A;  2K25 A;  2K8C A;  3A33 B;  5AZH A;  2BYE A;  2KOX A;  3PTF C;  4TV3 A;  4W9C A;  4HPM B;  3VH3 B;  2K6Q A;  2K8B A;  2KN5 A;  4XZ4 A;  2MBB B;  1PQS A;  2N1V A;  4NNJ B;  3ZNI D;  2MSE D;  1H8C A;  1WFY A;  2GBR A;  4FA6 A;  3QJZ A;  2FCM A;  2N9P C;  3CST A;  2N7E A;  4RMA A;  1LFD A;  2RD0 A;  1EO6 A;  2CKH B;  3QHT A;  3DBS A;  3JSV A;  3VVW B;  4I6L B;  3UQA A;  4BVU C;  2AWT A;  3RUI B;  3SHQ A;  4W9E A;  1D3Z A;  2MWS B;  4WJO A;  4I6N B;  4RM9 A;  2GOW A;  4DXA B;  2KZR A;  2M8S A;  3NY5 A;  3VDZ A;  1WGY A;  2KNB A;  4BBN C;  5JH5 C;  2ZCC A;  3CMM B;  3NHE B;  5CTR C;  3ZDT A;  3V60 A;  5KHO A;  4JL9 A;  1Q0W B;  2O2V B;  5E6P A;  2AL3 A;  2V1Y A;  1X1M A;  1BT0 A;  3B0A A;  4ICV A;  4IW0 A;  2L0T A;  3U8Z A;  3X23 A;  5J18 A;  4JGH B;  2FCS A;  4OVU A;  4BKT A;  1WF9 A;  3PLU A;  5JZE B;  1L7Y A;  4WAA A;  3UGB B;  4DHJ B;  2BKF A;  3T8M A;  5IAA C;  4EEW A;  1WX7 A;  4K7S A;  4HPL B;  5CHW A;  1KJT A;  2KFK B;  2BWE S;  1GC6 A;  1QZE A;  4IC7 B;  4KIK A;  5AZG A;  2DYM A;  1TZ1 A;  1K8R B;  4KIK B;  1UBI A;  2ASQ A;  4MEM A;  1E8W A;  1VD2 A;  1WR6 E;  2GBK A;  1V86 A;  2KLG A;  3NZU A;  4BFR A;  5LXH A;  2KK8 A;  1R4M I;  3ML8 A;  2ZZP B;  4PS7 A;  2EMT A;  4HDQ A;  3JSV B;  4MJS B;  5D6J B;  1GNU A;  3SD5 A;  2KD0 A;  4DHZ E;  3L17 A;  4GOC A;  3A4R A;  4AJW A;  4BBN F;  5D7G A;  3DBH I;  2LI5 A;  4G3X B;  1NDD A;  2BYV E;  2GBM A;  4K1R B;  1T0Y A;  3SDL C;  3V6E B;  2VRR B;  1V5T A;  2LGY A;  3PVL A;  4DBG A;  3M62 B;  4EZL A;  3QC8 B;  4WJQ A;  2L3Z A;  2LVO A;  2ZJD A;  1WY8 A;  3ML9 A;  4K81 A;  2IBI B;  4W9J A;  2KDE B;  3VXW A;  1C3T A;  4CHK A;  2KWU B;  3H7P A;  4GDL A;  1YIW A;  2GMI C;  1YX6 B;  1ZGU B;  1EF5 A;  3L13 A;  3VUY A;  3DVG X;  2PE9 A;  3UIO B;  1XQQ A;  2MP2 A;  1KOT A;  3K9O B;  3ZRC A;  3HM3 A;  4KV2 A;  1P98 A;  1LQB A;  5E6N A;  1WMH A;  2HTH A;  2OOB B;  3H1U A;  3UIN B;  2CR5 A;  4NAW A;  4NJ6 A;  1V80 A;  1WMH B;  2CHZ A;  3PT2 B;  4P7I A;  2KDI A;  2LD9 A;  3A9K A;  2ZEQ A;  4KSK C;  2YLM A;  1EF1 A;  4BKG A;  2MP2 B;  2D3G A;  3MJW A;  4XC2 A;  3V6C B;  1G6J A;  1GJZ A;  2R2O A;  1YX5 B;  1UEL A;  5CHF A;  3WAL A;  4FAD A;  5KHQ A;  3DDC B;  2FID A;  2NS5 A;  2XK5 B;  1OQY A;  2KO3 A;  2KC2 A;  4ANX A;  3W1Y A;  2LGX A;  3JW0 X;  1WRD B;  3ECI A;  1TBE A;  4GMV A;  4IWO A;  3A1Q A;  2KDB A;  4OVV A;  1NBF C;  2DZI A;  1SIF A;  4WWN A;  5LXI B;  2JRH A; 
#chains in the Genus database with same CATH topology
 2ICI A;  5G55 A;  2KMM A;  2DZM A;  4FJY A;  4RF1 A;  5BYQ A;  3GZN I;  4PS3 A;  1VZ8 A;  2DYO A;  2LZ6 A;  1SIJ A;  1KLG D;  2AL6 A;  1FIQ A;  4WWO A;  5L83 A;  1N5W A;  3RT3 B;  3DHH C;  1MVK A;  1WE7 A;  2MQJ A;  2WHI A;  4URK A;  3ZJT A;  1ISN A;  2KFK A;  1J8C A;  1ENF A;  2FIF A;  2KFJ A;  3AE1 B;  2AYO B;  4ZDV A;  2BS4 B;  5AZF A;  4E74 A;  1NI2 A;  2IO2 B;  4FJV B;  4HK2 A;  2O2V A;  3T3O A;  1D5M C;  3PRE A;  4MM3 B;  1SJE D;  1ZXH A;  1GB4 A;  4MGI E;  1ROE A;  3HVD A;  3MHZ A;  2JZP A;  2CU3 A;  2JYT A;  2E6X A;  3BY4 B;  4GIV A;  4FHJ A;  2JX5 A;  4HKZ E;  2IGD A;  2RDH A;  1I42 A;  1F52 A;  1FNV A;  1Q5W B;  4MDK E;  4A9A A;  3W5V B;  3HK0 A;  4A55 A;  3DBR B;  2QC8 A;  3Q3F A;  2G45 B;  4HXD A;  1V5O A;  3DBL B;  1S3S G;  4N6E B;  1P0R A;  4ANV A;  2KQS A;  4H2A A;  3MJ5 A;  1J0G A;  2MBH A;  1V1O A;  3A9K B;  2H88 B;  2W3R A;  3PRP B;  2K8H A;  2HD5 B;  2WS3 B;  3APD A;  1IGD A;  3A9J A;  1TYG B;  4N9F 4;  1SEB D;  2QIE B;  4JX1 C;  3AE9 B;  2INN E;  4ZYN A;  4HJK A;  1E8Y A;  2AQ3 B;  4YT0 B;  2WXM A;  3PLV A;  3RNA C;  3FIL A;  3N1X C;  3CF6 E;  4ZRI A;  4JWU C;  2DYB A;  4RGT A;  3Q14 C;  4HCP B;  1E7V A;  2KTF A;  1WYW B;  3BZD B;  2AEH A;  4DQO C;  4KVG B;  1FCL A;  2EKE C;  1N60 A;  1D5Z C;  3QQ8 B;  1WM2 A;  1TS5 A;  3AE3 B;  3PHW B;  3URY A;  1E9M A;  4LLG M;  1L2N A;  1WZ0 A;  4DHJ D;  1MI0 A;  1YJJ A;  3R7R A;  3N32 A;  4NQL B;  2MW5 A;  3OLM D;  3W1S C;  2V4I B;  1UNS A;  1WJ6 A;  3RCZ A;  1J7C A;  3NVZ A;  4MJS A;  1SSN A;  3H9D A;  4RGN A;  3DCG A;  3TCA A;  2PKO A;  2IPK D;  2RPQ A;  4REZ A;  5JXV A;  1CK1 A;  1TGZ B;  4EOY A;  5TR5 A;  5BYR A;  2JZ3 B;  4KGT A;  4AJY B;  3JVZ X;  1L0Y B;  4M8M A;  3IT6 B;  2QIL A;  2RDB C;  2J52 A;  2X38 A;  1IGC A;  4BZA A;  2JY6 A;  2KT7 A;  2KX3 A;  2A4Z A;  3H7S A;  3WIM A;  2K3U A;  1UWX A;  3L16 A;  4DDG D;  4AP4 C;  3I3T B;  4LCD E;  2LXA A;  1IP9 A;  2IO3 B;  4DHZ E;  1SBB B;  1VDV A;  2CHW A;  2MLB A;  2KWD A;  2MX2 A;  4MGZ E;  4GSW A;  2PE6 B;  5JHA A;  3RD2 A;  2C7M B;  3P2B A;  4WJP A;  2KYW A;  4NY0 A;  3RPF C;  1Q1O A;  4PYU A;  4LNO A;  2KWC A;  1QT9 A;  3T3N A;  3KH0 A;  3N1Y C;  1WXS A;  4OW0 A;  1P3Q U;  5D94 A;  3A4S C;  2NBU A;  2IYD B;  1F77 A;  1LGR A;  2O6V D;  2WXH A;  1TTN A;  5DPS A;  2LRU A;  1E7U A;  3U7D A;  1FXT B;  4RCO A;  1Y8R C;  2PW9 A;  3PO0 A;  5AUK A;  1XLN A;  2BB5 A;  3H7P B;  4GDL B;  3L54 A;  1HA5 A;  2DBY A;  2YEP F;  2O6V B;  4WJN A;  4XWT A;  1WXQ A;  3SR6 A;  1ZDX A;  3DHG C;  1UWM A;  3V62 A;  3RUL A;  1DYQ A;  1KRH A;  1F2R C;  1FFV A;  3ABV B;  2D5G A;  3EHV A;  5D2M B;  4C56 C;  1L6U A;  5EDS A;  2D2Q A;  2DX5 B;  3LXF A;  1WIA A;  1UH6 A;  4II3 B;  4QAY A;  1SJH D;  2I1K A;  2M17 A;  2WXF A;  4DXF A;  4WIP A;  1SE4 A;  1RFA A;  2IY0 B;  1WRI A;  4B95 A;  4KGR A;  4IM3 A;  4AWJ A;  5IN7 A;  4A6Q A;  1M4V A;  1FRR A;  1STE A;  1M94 A;  5J17 A;  1SXT A;  1OEY A;  4MGY E;  4WH4 A;  1CZP A;  3M3J A;  1ZW7 A;  2FUG 1;  3R8B A;  3B1L X;  2FCN A;  4A3O A;  2AQ2 B;  2QHO A;  1P7E A;  2JRI B;  2Z0D B;  1F9J A;  2PLP A;  2N4F A;  1RLF A;  2LGS A;  2LHE A;  3IHP C;  2NBW B;  2J0K A;  1ZE3 D;  1H4R A;  1KM7 A;  3UF8 A;  3R2T A;  3U30 A;  2K25 A;  2K8C A;  1I4Q A;  4TV3 A;  1T6B X;  4PT5 A;  2MBB B;  2BW2 A;  4NNJ B;  4XZ4 A;  3ZNI D;  1HZ6 A;  3GS2 A;  1FNW A;  4A90 A;  3TEY A;  1HZ5 A;  3CST A;  2N7E A;  1LFD A;  3QHT A;  1PDX A;  3VVW B;  2BS2 B;  1TKY A;  3UQA A;  3P4S B;  5IP4 D;  5BMI A;  4I6N B;  3RNG C;  2DNF A;  3Q8C A;  3CMM B;  2BT6 A;  3NHE B;  4JE3 B;  3B0A A;  4IW0 A;  2L0T A;  1WF9 A;  3PLU A;  4WAA A;  1OFF A;  3L4P A;  4K7S A;  4HPL B;  2D3B A;  2DYM A;  2MJD A;  1UBI A;  1E8W A;  1VD2 A;  3W9C B;  3NZU A;  5LXH A;  3CWI A;  3OG5 A;  3ML8 A;  3JSV B;  4MJS B;  5D6J B;  4AS1 A;  3L17 A;  3A4R A;  4AJW A;  2WXG A;  2RMM A;  5D7G A;  4K1R B;  1T0Y A;  1ZDV A;  2BTE A;  2ZJD A;  1T0Q C;  1WY8 A;  1TKE A;  4K81 A;  2IBI B;  1XF5 L;  1C3T A;  4L2Y A;  2KWU B;  3H7P A;  2XNA C;  1YIW A;  4GDL A;  1MFW A;  3DVG X;  3E56 A;  2MP2 A;  3HM3 A;  1EWY C;  1LQB A;  2WDR B;  5HHD G;  2HTH A;  3UIN B;  1MG4 A;  1V8C A;  3W5U B;  2KDI A;  4KSK C;  2D3G A;  3DWM A;  3V6C B;  1N61 A;  3KQ4 A;  4WUR A;  2WXI A;  1N63 A;  1QKZ A;  1YJI A;  1FCC C;  3W1Y A;  1I4P A;  4IWO A;  4WAF A;  1NBF C;  1SIF A;  2AQ1 B;  1FRD A;  2KAJ A;  2IGH A;  2MRP A;  2WXJ A;  3EGR A;  3J9C A;  3NVV A;  2GBN A;  3K9P B;  1C4C A;  3EUB 2;  1R4M B;  1R4N B;  1WGG A;  1E7P B;  4ZRK A;  3Q2A C;  4US8 A;  3WAN A;  2ZCB A;  3TEZ A;  3TMP B;  5IO9 A;  2QJL A;  3C8Y A;  1UF0 A;  3EC8 A;  2XEW A;  4A3P A;  4C7Y A;  4GDK A;  2G1E A;  5EE1 A;  1ACC A;  2Q5W D;  1VLB A;  1C4A A;  5E6J A;  1Z2M A;  3V05 A;  3AED B;  1K51 A;  1RWS A;  2CJN A;  3E9S A;  1L5P A;  5EE9 A;  4FBJ B;  3M63 B;  2W55 A;  3ZRF A;  2K1F A;  4OZB A;  2FNJ B;  3CSF A;  2UYZ B;  4M0W B;  3VH4 B;  3NG0 A;  4IOI E;  2WDQ B;  2AX5 A;  2MBE A;  2SAK A;  3OWE B;  1I7H A;  4DHZ B;  1K53 A;  2LGI A;  3M95 A;  4RFB A;  3TEX A;  3UQB A;  4GXB A;  3PPA A;  5G5H A;  2D10 A;  2UU7 A;  3IAM 1;  3NZS A;  2WX0 A;  2K39 A;  1JRO A;  3ZVV A;  1K52 A;  3APC A;  2BBC A;  1JAL A;  4IG7 B;  3HUI A;  4EE2 A;  4ZHO A;  5C1Z A;  3ZTD A;  3ZW3 A;  3L10 B;  4MGK E;  3O13 A;  2V4L A;  3UIP B;  2J4X A;  2KMC A;  5L95 C;  4CQN A;  4JIO U;  2J7Q B;  1LM8 B;  2IJ0 A;  4YSX B;  3LJ3 A;  1WGR A;  4FXC A;  4RH6 A;  2KMA A;  2Z0E B;  3ZKJ C;  2M4N A;  3ENE A;  5C2T B;  1NYQ A;  1L4Z B;  1VZ6 A;  4ZRJ A;  2HDE A;  3UI3 A;  2M1M A;  2KVR A;  2KJ6 A;  1UGM A;  1Q10 A;  3HIZ A;  4ZRQ A;  2LFI A;  1NEN B;  1D5X C;  4DWF A;  4EUT A;  3DBH B;  1UD7 A;  1ZKH A;  2VH2 A;  1L0X B;  1E10 A;  1L4D B;  2FBW B;  1YN5 A;  2FUH B;  3PZ8 A;  3AN1 A;  3R7Q A;  3NVY A;  1SF0 A;  2C9W B;  3PHX B;  2OED A;  3DBR I;  1R4N I;  4A8X C;  2G4S A;  1S1Q B;  4BOS C;  1WM3 A;  2L00 B;  2KKC A;  4LDT B;  3ZGZ A;  1T5X D;  4C00 A;  4W9H A;  4GU2 A;  3ZTC A;  3PS6 A;  4YL8 A;  1JWA D;  1MG8 A;  2NCN A;  4HPP A;  3ZO5 B;  1C4P A;  2V3N A;  3TSS A;  5GMV A;  1RAX A;  3B9J A;  4XGA B;  2ZNV C;  2L83 A;  3NOB A;  2KHW B;  1OQR A;  1KF6 B;  1C76 A;  1WX9 A;  1G6J A;  3HVZ A;  4E71 A;  3NS1 A;  1F2R I;  4GLS C;  4C7Z A;  1VZ7 A;  2LJ5 A;  2CU1 A;  1CJE A;  2LVP A;  2JWU A;  2NPT A;  1EU4 A;  1WJ4 A;  3AEA B;  1WH3 A;  3IFW B;  4BKS D;  2JZZ A;  3AE7 B;  1WJN A;  1YNT E;  4S17 A;  4JWS C;  3Q6B A;  3AH7 A;  3AB5 A;  5GXG B;  1XEE A;  2L0F A;  1FXI A;  3TIX A;  3KYC D;  5TSS A;  3C0R B;  2W3S A;  3GE3 C;  1RYJ A;  2BQQ A;  1QF6 A;  4YTN B;  3RYT A;  1L0V B;  4MM3 A;  2K9X A;  2WYQ A;  3NJT A;  4EKU A;  4AUQ C;  4M00 A;  3SU8 X;  2WXP A;  3BYT B;  4PK1 A;  1EM7 A;  1PGB A;  4HWI B;  3P63 A;  1OQQ A;  3I9V 1;  2LMC A;  3Q69 A;  2JXX A;  3DHI C;  5HFY A;  4MT5 A;  4BAX A;  1V6E A;  3WAO A;  1V49 A;  2OJR A;  3ZJU A;  2KAC A;  3ONS A;  4WQM A;  2PMV A;  1KTK A;  2PVO D;  1MHH E;  5E6O A;  1LXD A;  4W9K A;  5BYS A;  4HVB A;  1YOV B;  1YQB A;  2XK5 A;  3VFK A;  2E3T A;  4R3D A;  4JLC A;  2FCQ A;  1WJU A;  3B2F A;  3GP7 A;  3A33 B;  2BYE A;  2KOX A;  4HPM B;  2K6Q A;  2K8B A;  2KN5 A;  3CIR B;  2N1V A;  2MSE D;  2FCM A;  2CKH B;  4RF0 A;  4OHJ A;  3MC9 A;  4RM9 A;  2M8S A;  3NY5 A;  1WGY A;  4BBN C;  1SE2 A;  5JH5 C;  2ZCC A;  2MJ3 A;  2MJE A;  5CTR C;  2QEJ C;  3ZDT A;  3V60 A;  1Q0W B;  2AL3 A;  2V1Y A;  5H8Y E;  4OVU A;  5JZE B;  3UGB B;  4XE0 A;  4ACF A;  1KJT A;  2BVC A;  3P4P B;  2MHJ A;  1QOB A;  4KIK B;  3I63 C;  2ASQ A;  1XXG A;  1VRA B;  1R4M I;  2K22 A;  2KK8 A;  1I4G A;  2EMT A;  1FXA A;  1GNU A;  1C78 A;  2L32 A;  2EKI A;  4KGS A;  1DGJ A;  1NDD A;  2BYV E;  2GBM A;  3SDL C;  3V6E B;  1YQ4 B;  2VRR B;  3PVL A;  2NMQ A;  3NRZ A;  4DBG A;  4EZL A;  2L3Z A;  3ML9 A;  3VXW A;  4HJG E;  1YX6 B;  1ZGU B;  1CQV A;  3W2D A;  2HTM E;  1C79 A;  2W54 A;  2I2Y A;  4UDU C;  1ZOY B;  2WXN A;  1WMH A;  1V1P B;  2CR5 A;  4NAW A;  1WMH B;  3PT2 B;  2ZEQ A;  1EF1 A;  5FK9 C;  2MP2 B;  1JRP A;  1UEL A;  1PFD A;  4HRS A;  3ZXV A;  1Y56 A;  2FID A;  2KO3 A;  2KC2 A;  4C4V A;  1WRD B;  2PTL A;  2LJI A;  3ECI A;  3BVG A;  4N59 A;  4XX5 A;  5MPO A;  5FR3 A;  2INC C;  2JPH A;  1TS2 A;  3KUZ A;  3P4R B;  5DPW A;  3R2I A;  3H6N A;  3ZNZ B;  3N20 C;  4LNK A;  3ZIM A;  4MAC A;  2HJ8 A;  3Q3O C;  2NBV B;  4KDI C;  3WAP A;  4HEA 1;  1FFU A;  4K7W A;  2IGG A;  4FHK A;  3VAW A;  3OAW A;  3T9L A;  1KLU D;  1WXA A;  2KAN A;  4AQ7 A;  3QK0 A;  5IKC M;  2QDF A;  2N9E B;  2M0A A;  3QIJ A;  1I35 A;  3IBE A;  3D32 A;  3TL5 A;  2ZPN A;  1WE6 A;  3TJP A;  3AU5 A;  1PGX A;  4MSQ B;  1UGJ A;  2G9H D;  2JF5 A;  4EZK A;  2WXQ A;  2WXO A;  3KYD D;  1QOA A;  1N5X A;  2QCZ A;  4FJZ A;  5CX3 A;  3ZNG C;  2KDF B;  3BK2 A;  4OZA A;  3GZN B;  1AAR A;  2KJR A;  3SFE B;  1A70 A;  1XCQ L;  2DHZ A;  1P7F A;  1N6Z A;  1FM0 D;  4NAW B;  3P1M A;  4NZL B;  1R7S A;  2BF8 B;  1D6E C;  3AI5 A;  3A9J B;  3ZXR A;  3EFC A;  2BPS A;  4W9F A;  4IM2 A;  2WX1 A;  2BGF A;  1PYW D;  2KVZ A;  2WU5 B;  2NTS A;  3S2A A;  3JYU A;  3DBL I;  2ZW0 A;  3RFZ B;  1XT9 B;  4MEL A;  2B76 B;  4TQ1 A;  3Q8F A;  2HE7 A;  3KUD B;  4ANW A;  2JWZ A;  2BWF A;  1HE8 A;  2ZW1 A;  2VZK B;  3RI7 C;  3C19 A;  3LDZ E;  3VQI A;  3NUH B;  2Y5B B;  4EZJ A;  1NEK B;  1YD8 U;  2M0X A;  3HM6 X;  2JVC A;  2N7D A;  4HLE A;  3P42 A;  1BUI C;  2LHD A;  4OZC A;  5CHV C;  4C80 A;  4IM0 A;  1TS4 A;  2LVQ A;  4L1B A;  4M8N A;  4KZ0 A;  4G11 A;  4FN2 A;  4WQO B;  3Q8B A;  1WSP A;  1IBX B;  3VTV A;  1RFK A;  1YMH E;  2IY1 B;  4CYE A;  2M19 A;  2W9N A;  1AYF A;  2PIA A;  3EEC A;  2CS4 A;  4RNA A;  1J19 A;  5G2N A;  2K0P A;  2LEK A;  3AE6 B;  1QLB B;  3VR8 B;  4TMA B;  1K50 A;  2N7J A;  1NYR A;  4TQ0 A;  1T3Q A;  2O6V A;  3B2G A;  1V9J A;  3WAM A;  2WP9 B;  5DPR A;  2LUM A;  2G3Q B;  5AUI A;  2WU2 B;  1E0Z A;  1NI3 A;  4P1B C;  4LJP B;  1GUA B;  3KWV A;  3KVF B;  2EMS A;  3RZW C;  1OEY J;  2UWQ A;  3FC4 A;  1E8Z A;  4W9G A;  3DVN U;  1ET9 A;  2M56 B;  4M0W A;  3QAR A;  1P1A A;  4GB9 A;  1C1Y B;  2ZNV B;  3MHS D;  2JYE A;  1XLQ A;  4YXD B;  2OHF A;  1C77 A;  2D3C A;  3DVG Y;  4W9I A;  1XD3 B;  4JPS A;  4Q2J A;  4J6I A;  4W9D A;  3DQV A;  3KW5 B;  3W1S A;  3QA8 A;  1E5W A;  3PZD A;  2RSU A;  4ARI A;  3R66 C;  2IZV B;  1DOI A;  3V61 A;  4ASW C;  2L76 A;  1LO5 D;  5BO4 B;  1EUV B;  3ZDM C;  1GAQ B;  4TUU A;  3AXC A;  3ZYY X;  4JQW C;  2I1J A;  2KX0 A;  5H92 C;  2GI9 A;  2LGD A;  2LWP A;  3DOW A;  1GOZ A;  3O65 B;  2KJH B;  3U52 E;  1YJ1 A;  2FAZ A;  3Q3N C;  1WI0 A;  2C7N B;  3B08 A;  3V3X A;  2KXJ A;  2KQ7 A;  3MTN B;  1B1Z A;  1SB3 C;  2C7H A;  2R61 A;  1TS3 A;  1NVI D;  5EE0 A;  3ZUN A;  2J0J A;  3U7Z A;  4YTP B;  2PEA A;  3LB8 C;  2PJH A;  2Y5C A;  2NR2 A;  4HCN B;  1F1H A;  2IDY A;  1AW7 A;  2FE8 A;  5HI1 A;  2R2Q A;  4K7U A;  4XDC A;  4HRO A;  3L0W B;  4OVZ A;  2WWZ A;  4NQK E;  3RZF A;  5DCN A;  3RMK C;  3X0W A;  3ZJV A;  2X8X X;  1JWM D;  2BYF A;  3VTU A;  1ZP0 B;  4E3C A;  3PRZ A;  4C4V B;  4F1S A;  2KC1 A;  4I6P A;  1CMX B;  2CJO A;  5DPT A;  3QWZ B;  2L52 A;  4GGQ A;  3APF A;  5HKH A;  2D11 A;  1UUP A;  4HDO A;  1AN8 A;  1I4X A;  4MSM B;  4USA A;  5AZH A;  3RNF C;  3VH3 B;  1PQS A;  1FD6 A;  2WNM A;  1PUT A;  1H8C A;  1FNU A;  3NVW A;  3QJZ A;  2N9P C;  1GB1 A;  1E6E B;  4RMA A;  3BII D;  2RD0 A;  3DBS A;  3JSV A;  4I6L B;  4YSZ B;  1JCK B;  4BVU C;  2AWT A;  3RUI B;  4W9E A;  2MWS B;  3MFG A;  4WJO A;  4DXA B;  2KZR A;  3VDZ A;  4NAM A;  2KNB A;  4WWM A;  2V3P A;  4JL9 A;  5KHO A;  5E6P A;  4XWW A;  3H8H A;  4B0M A;  1X1M A;  4J3O D;  4ZHP A;  5J18 A;  5C3J B;  2INP E;  4BKT A;  4S0R A;  2BKF A;  3T8M A;  5IAA C;  1QOG A;  4EEW A;  1BML C;  2BWE S;  1ET6 A;  1TZ1 A;  2GBK A;  1WR6 E;  2W82 A;  1V86 A;  4BFR A;  2ZZP B;  3I57 A;  1ZXI A;  5G5G A;  1QQR A;  2GLS A;  4GOC A;  3DBH I;  4G3X B;  2J42 A;  2LGY A;  3M62 B;  2LVO A;  3MC8 A;  3FIL B;  5D3I B;  4TSS A;  4CHK A;  3L13 A;  3VUY A;  2PE9 A;  2DLB A;  2BYT A;  3K9O B;  3N1Z C;  3ZRC A;  3IXS A;  4KKI A;  1J7A A;  4NJ6 A;  1V80 A;  2N9K A;  2XN9 C;  2N0S B;  3A9K A;  4MH8 A;  1QIL A;  2WDV B;  1YX5 B;  5CHF A;  3AM9 A;  1I4H A;  5KHQ A;  2SEB D;  3DDC B;  2NS5 A;  2XK5 B;  4XDD A;  4ANX A;  2LGX A;  1PGA A;  3KLS X;  1TBE A;  3SEB A;  2JRH A;  4WWN A;  2N9L A;  5LXI B;  1WR1 A;  2ZVO A;  4B9K A;  2L1A A;  4KZC A;  5BMG A;  3ZNH B;  4KX6 B;  3A1Q B;  2JT4 B;  4B0E A;  1UZX B;  1IUE A;  3IAS 1;  1A5R A;  2C60 A;  3ALB A;  3DVN V;  2J0M A;  1JWS D;  1IBX A;  3RNC C;  4KSL C;  1BXT A;  2WGS A;  1C9F A;  3MC0 B;  1SE3 A;  5FR6 A;  3PGE A;  3ZQ4 A;  1F0Z A;  4IWQ A;  4FLH A;  4LK0 M;  3FAH A;  2CHX A;  1WYG A;  3ZLZ A;  2L05 A;  1RM6 C;  1U4A A;  3EA6 A;  3VUW A;  3AE4 B;  3EFU A;  1HXY D;  5AEK B;  4ARC A;  2BB6 A;  2Y5P A;  4FUL A;  3U2S C;  4F8C B;  1TY2 A;  3BIN A;  1WWT A;  4AOF A;  2KLC A;  3VRA B;  2V0G A;  3LYY A;  2NPT B;  4KKJ A;  2Z8L A;  3TEW A;  1YN3 A;  4DDI D;  1MJD A;  4ZRP A;  4YWG G;  1WZ3 A;  1TT5 B;  5D3D A;  3QAQ A;  4P16 A;  5C23 A;  1IYF A;  2WXL A;  5I4D A;  2BKR B;  4LNN A;  1JWB D;  2DAF A;  2RGF A;  3WA0 A;  3PSE B;  3VUX A;  1QOF A;  1T0S C;  2KN4 A;  1AWD A;  2MEK A;  2LXC A;  2KTR B;  2YEP B;  1V81 A;  1JRU A;  1WGH A;  1KH0 A;  1EU3 A;  2LUE A;  2WLB A;  4N58 A;  4IDI A;  3VHT C;  4M02 A;  4A20 A;  5IA7 A;  1HTQ A;  1JW9 D;  2DAJ A;  1L6V A;  1T0R C;  3PRM B;  4ICU A;  2HJ1 A;  3RNB C;  1ZPS A;  3BVZ A;  2MA9 B;  4B6W A;  2RR9 A;  4II2 B;  1GG3 A;  3OJ4 B;  2JQR B;  2G4D B;  3P4Q B;  3N3K B;  2GRI A;  3IVF A;  3TUO A;  3BK1 A;  5LLI A;  5BMH A;  3RN9 C;  2IND C;  2GBJ A;  4RGO S;  1JML A;  3FKY A;  1JQ4 A;  3AU4 A;  4PYZ A;  4YTM B;  4CO7 A;  1J7B A;  1HEZ E;  4YSY B;  4LNI A;  1DOX A;  1KLV A;  3VR9 B;  4X57 B;  2OJW A;  1V1P A;  5JHB A;  2L8J A;  4LDT D;  4WWP A;  3ETR A;  3R3M A;  3AEC B;  2KDM A;  2RPV A;  2DZK A;  2RDG A;  3AV8 A;  3HHM A;  1P9D U;  2DWQ A;  3GB1 A;  1D4B A;  4GN1 A;  1SE9 A;  4TKN A;  4ZYS A;  2JUO A;  3QCA A;  2H89 B;  3AEE B;  2NVU I;  4IWP A;  1OTR B;  3Q3M C;  1B9R A;  1N62 A;  2WDT B;  1Z5S B;  3I5J C;  2ZVN A;  3Q3J A;  3OJ3 A;  3U4E G;  1MPE A;  4DK5 A;  1SGH A;  5FKA C;  4D2K A;  4KDL B;  4BKS A;  2MH7 A;  2KWV B;  1VJK A;  2K6D B;  4G0N B;  4LNF A;  2DZJ A;  2LRW A;  1V2Y A;  2I38 A;  4F7Z A;  2V9H A;  4PS8 A;  2V3S A;  2JSV X;  3TBL D;  4IKG A;  2MBQ A;  1HTO A;  2L7R A;  4O1N A;  1WXM A;  3VRB B;  2IO0 B;  3WCQ A;  3AUL A;  3MP9 A;  1WGD A;  4RM8 A;  1GPX A;  3AEB B;  3L08 A;  2A5U A;  1ZUD 2;  2GB1 A;  3VTW A;  1E90 A;  2D07 B;  2BS3 B;  2C5L C;  1TKG A;  1V97 A;  4NJC A;  1YQ3 B;  2ACZ B;  3NS8 A;  1WX8 A;  4IUM B;  2DEN B;  2ZPY A;  3BWU D;  3IG3 A;  3SFD B;  3GOE A;  2N1W A;  3BVM A;  1I4R A;  4P6V F;  1TY0 A;  4ANU A;  1EWC A;  5J2R A;  2YVC A;  1FPY A;  3N30 A;  2ONQ A;  3AEF B;  4G50 A;  4LTU A;  3KUC B;  3DWG C;  3AE2 B;  4GDK B;  1E8X A;  3Q8E A;  1VR9 A;  2KTR A;  2VH1 A;  1OGW A;  2WXK A;  5EE3 A;  1IPG A;  2XBB C;  5T8I A;  4K3C A;  4LJO B;  3AE8 B;  1XCT L;  2N9X A;  4EFO A;  1DOY A;  2J53 A;  3DPD A;  2LAS A;  4ZOH C;  2IO1 B;  2B3A A;  4BOZ B;  1KFY B;  2REX A;  3HRD D;  4MH0 E;  4HKQ A;  2K5P A;  1VCB A;  2ON8 A;  1GC7 A;  4NPN A;  1TZO A;  4NJ7 A;  1XLP A;  3QX1 A;  3PV1 A;  4W9L A;  1WXV A;  1RRB A;  1XO3 A;  1TIF A;  2MBO A;  4XYC A;  1UBQ A;  1YN4 A;  2MCN B;  2D3A A;  3AMZ A;  2PPH A;  1JWU D;  2KQ4 X;  3PTF C;  1FMA D;  4W9C A;  3BYY B;  2NTT A;  1WFY A;  2JXT A;  2GBR A;  4FA6 A;  1FEH A;  4ITK A;  1EO6 A;  5IOI A;  3Q8A A;  3SHQ A;  1XLO A;  1D3Z A;  2GOW A;  1FO4 A;  3AE5 B;  2O2V B;  3IT4 B;  4ICV A;  3U8Z A;  1BT0 A;  3X23 A;  4JGH B;  2JU6 X;  2FCS A;  1ESF A;  1L7Y A;  4DHJ B;  1MHX A;  1WX7 A;  5CHW A;  3GE8 C;  2KFK B;  1GC6 A;  1QZE A;  4IC7 B;  4KIK A;  5AZG A;  3N9Y C;  4K3B A;  1K8R B;  4MEM A;  3NZ3 A;  2KLG A;  1TJE A;  4PS7 A;  2WQY B;  4HDQ A;  3SD5 A;  2KD0 A;  4BBN F;  3PZ7 A;  2LI5 A;  2Y3A A;  4DXG A;  4L23 A;  1V5T A;  2PVG C;  2TSS A;  3QC8 B;  4WJQ A;  4W9J A;  2VZK D;  4RGM A;  2KDE B;  2WXR A;  3RNE C;  2GMI C;  3AEG B;  1EF5 A;  3UIO B;  1XQQ A;  1KOT A;  4US9 A;  4KV2 A;  1P98 A;  5E6N A;  4M01 A;  2OOB B;  3H1U A;  2CHZ A;  5LNK 1;  4P7I A;  2LD9 A;  2YLM A;  4BKG A;  3MJW A;  4XC2 A;  1GJZ A;  2EEL A;  1HQR D;  2R2O A;  5HG2 A;  3WAL A;  4FAD A;  1OQY A;  2QSD A;  3JW0 X;  4P1C C;  4GMV A;  3A1Q A;  1WGK A;  2KDB A;  4OVV A;  3KWL A;  2DZI A;  2Z59 B;  2QMT A; 
#chains in the Genus database with same CATH homology
 1WR1 A;  2ZVO A;  5G55 A;  4XX5 A;  4B9K A;  4KZC A;  3ZNH B;  2DZM A;  4FJY A;  3GZN I;  4PS3 A;  3A1Q B;  2DYO A;  2MRP A;  2JPH A;  2LZ6 A;  3KUZ A;  2JT4 B;  2AL6 A;  5DPW A;  1UZX B;  2GBN A;  4WWO A;  3H6N A;  3K9P B;  5L83 A;  3ZNZ B;  1WGG A;  3RT3 B;  3ZIM A;  1A5R A;  4ZRK A;  2C60 A;  3ALB A;  1WE7 A;  2MQJ A;  3DVN V;  4URK A;  2HJ8 A;  1ISN A;  2NBV B;  4KDI C;  2J0M A;  2KFK A;  3WAP A;  3WAN A;  1J8C A;  2ZCB A;  2FIF A;  4K7W A;  4KSL C;  4FHK A;  2KFJ A;  3OAW A;  3TMP B;  2AYO B;  3VAW A;  3T9L A;  4ZDV A;  1WXA A;  5AZF A;  4E74 A;  5FR6 A;  2KAN A;  1NI2 A;  2IO2 B;  3EC8 A;  3QK0 A;  4FJV B;  4HK2 A;  2XEW A;  2O2V A;  4A3P A;  3PGE A;  4GDK A;  3PRE A;  2N9E B;  4IWQ A;  3QIJ A;  4FLH A;  1I35 A;  2CHX A;  4MGI E;  1Z2M A;  3IBE A;  3D32 A;  3ZLZ A;  2L05 A;  1U4A A;  3TL5 A;  2ZPN A;  1WE6 A;  3VUW A;  3TJP A;  4FBJ B;  3EFU A;  3BY4 B;  4GIV A;  3M63 B;  4FHJ A;  5AEK B;  3ZRF A;  2K1F A;  1I42 A;  2FNJ B;  4FUL A;  3AU5 A;  4MSQ B;  1Q5W B;  4MDK E;  3CSF A;  2UYZ B;  4M0W B;  3VH4 B;  4F8C B;  2JF5 A;  3HK0 A;  4EZK A;  3KYD D;  3BIN A;  4AOF A;  4FJZ A;  5CX3 A;  3ZNG C;  2KDF B;  2KLC A;  3Q3F A;  2MBE A;  2NPT B;  2G45 B;  4HXD A;  1V5O A;  1S3S G;  1P0R A;  4ANV A;  4DDI D;  2KQS A;  1AAR A;  4DHZ B;  2KJR A;  1J0G A;  2MBH A;  3M95 A;  2DHZ A;  1WZ3 A;  3A9K B;  3UQB A;  3QAQ A;  4GXB A;  3PPA A;  2D10 A;  5C23 A;  4NAW B;  1IYF A;  3NZS A;  3PRP B;  2K8H A;  2HD5 B;  2BF8 B;  2WX0 A;  2K39 A;  3APD A;  2BKR B;  3ZVV A;  3A9J A;  2DAF A;  4N9F 4;  3APC A;  2RGF A;  4ZYN A;  3AI5 A;  3A9J B;  4HJK A;  4IG7 B;  3WA0 A;  1E8Y A;  3PSE B;  3VUX A;  3PLV A;  3CF6 E;  2LXC A;  4ZRI A;  2BPS A;  2KTR B;  4W9F A;  1V81 A;  1JRU A;  1WGH A;  2DYB A;  5C1Z A;  4IM2 A;  2WX1 A;  2LUE A;  3ZTD A;  4HCP B;  3VHT C;  1E7V A;  2BGF A;  2KTF A;  3ZW3 A;  1WYW B;  3L10 B;  4MGK E;  2AEH A;  4A20 A;  2V4L A;  4KVG B;  3UIP B;  2KMC A;  5IA7 A;  5L95 C;  2EKE C;  3S2A A;  3JYU A;  3DBL I;  3QQ8 B;  1XT9 B;  1WM2 A;  4JIO U;  4MEL A;  2DAJ A;  3PHW B;  3PRM B;  2J7Q B;  4ICU A;  4TQ1 A;  1LM8 B;  2HE7 A;  1L2N A;  2MA9 B;  3KUD B;  4B6W A;  3LJ3 A;  1WGR A;  1WZ0 A;  2RR9 A;  2JWZ A;  4ANW A;  4DHJ D;  2KMA A;  2Z0E B;  3R7R A;  4II2 B;  2BWF A;  1GG3 A;  1HE8 A;  2MW5 A;  3N32 A;  3OLM D;  4NQL B;  3W1S C;  3ZKJ C;  2M4N A;  3ENE A;  3RCZ A;  1WJ6 A;  3OJ4 B;  3LDZ E;  4MJS A;  3VQI A;  4ZRJ A;  2Y5B B;  2G4D B;  3N3K B;  3IVF A;  3H9D A;  2M1M A;  4EZJ A;  5LLI A;  3DCG A;  2KVR A;  1YD8 U;  3TCA A;  2KJ6 A;  2M0X A;  2RPQ A;  3HM6 X;  1UGM A;  2GBJ A;  2JVC A;  2N7D A;  1TGZ B;  4EOY A;  4HLE A;  3HIZ A;  5TR5 A;  3AU4 A;  4PYZ A;  2JZ3 B;  4CO7 A;  4AJY B;  4DWF A;  5CHV C;  4EUT A;  3JVZ X;  4M8M A;  1UD7 A;  4IM0 A;  1ZKH A;  2LVQ A;  1KLV A;  4M8N A;  4X57 B;  4KZ0 A;  2JY6 A;  5JHB A;  4G11 A;  2L8J A;  4LDT D;  4WWP A;  2FUH B;  2KX3 A;  2A4Z A;  3H7S A;  3R3M A;  4FN2 A;  4WQO B;  3WIM A;  3R7Q A;  3L16 A;  4DDG D;  2C9W B;  3VTV A;  2IY1 B;  2DZK A;  3I3T B;  4AP4 C;  4CYE A;  2W9N A;  3HHM A;  3EEC A;  1P9D U;  2LXA A;  3PHX B;  4LCD E;  1IP9 A;  2CS4 A;  3DBR I;  1R4N I;  1J19 A;  2G4S A;  1S1Q B;  1SE9 A;  2IO3 B;  1WM3 A;  2L00 B;  4GN1 A;  4TKN A;  5G2N A;  4BOS C;  2KKC A;  4LDT B;  2CHW A;  2MLB A;  4W9H A;  2MX2 A;  4GU2 A;  2JUO A;  4TQ0 A;  4MGZ E;  3QCA A;  3ZTC A;  4GSW A;  2PE6 B;  2NVU I;  2O6V A;  3PS6 A;  4IWP A;  1OTR B;  1V9J A;  4YL8 A;  3WAM A;  1MG8 A;  5JHA A;  2NCN A;  5DPR A;  3RD2 A;  2C7M B;  2G3Q B;  2WDT B;  1Z5S B;  3P2B A;  4WJP A;  2ZVN A;  3Q3J A;  3ZO5 B;  3OJ3 A;  4LJP B;  4NY0 A;  4DK5 A;  1Q1O A;  4PYU A;  5GMV A;  1SGH A;  1GUA B;  2KWC A;  1RAX A;  2EMS A;  3KVF B;  4KDL B;  4BKS A;  2ZNV C;  3NOB A;  1OEY J;  3RZW C;  3KH0 A;  2KHW B;  1WXS A;  1P3Q U;  2KWV B;  2UWQ A;  1E8Z A;  4W9G A;  5D94 A;  3A4S C;  3DVN U;  2NBU A;  2K6D B;  2IYD B;  4G0N B;  2O6V D;  3QAR A;  2DZJ A;  1P1A A;  1TTN A;  1WX9 A;  2LRW A;  1C1Y B;  1V2Y A;  2LRU A;  4GB9 A;  5DPS A;  4E71 A;  4F7Z A;  1E7U A;  2ZNV B;  3MHS D;  4PS8 A;  3U7D A;  2V3S A;  1FXT B;  2LJ5 A;  2CU1 A;  3TBL D;  2MBQ A;  1Y8R C;  2LVP A;  2L7R A;  2NPT A;  1WXM A;  1WJ4 A;  3DVG Y;  1WH3 A;  4W9I A;  2IO0 B;  1XD3 B;  3IFW B;  4BKS D;  3AUL A;  2JZZ A;  3H7P B;  1WGD A;  1WJN A;  3L54 A;  4GDL B;  4J6I A;  4RM8 A;  3DQV A;  4W9D A;  3L08 A;  3KW5 B;  2A5U A;  3W1S A;  3QA8 A;  1E5W A;  3PZD A;  3VTW A;  2O6V B;  2RSU A;  1E90 A;  4WJN A;  2D07 B;  3R66 C;  2IZV B;  2C5L C;  3V61 A;  4ASW C;  2L76 A;  3NS8 A;  1WX8 A;  4IUM B;  2DEN B;  2L0F A;  2ZPY A;  5BO4 B;  3RUL A;  3V62 A;  1EUV B;  3ZDM C;  3IG3 A;  3GOE A;  4TUU A;  3TIX A;  3AXC A;  3KYC D;  3EHV A;  3C0R B;  2N1W A;  4JQW C;  2I1J A;  2KX0 A;  5D2M B;  4ANU A;  2LGD A;  2LWP A;  3DOW A;  5J2R A;  3O65 B;  2YVC A;  3N30 A;  3RYT A;  2KJH B;  5EDS A;  4G50 A;  4MM3 A;  1YJ1 A;  2D2Q A;  3KUC B;  2DX5 B;  2WYQ A;  1WIA A;  1UH6 A;  4GDK B;  4II3 B;  2FAZ A;  4EKU A;  1E8X A;  2I1K A;  4AUQ C;  1WI0 A;  2M17 A;  2C7N B;  2KTR A;  3SU8 X;  3B08 A;  1OGW A;  2KXJ A;  2KQ7 A;  3MTN B;  1IPG A;  2XBB C;  1RFA A;  2IY0 B;  4HWI B;  4B95 A;  2C7H A;  4IM3 A;  4LJO B;  4AWJ A;  4EFO A;  2N9X A;  3ZUN A;  2JXX A;  2J0J A;  3DPD A;  2LAS A;  1M94 A;  1V6E A;  3WAO A;  5J17 A;  1OEY A;  2PEA A;  1V49 A;  2IO1 B;  2OJR A;  2NR2 A;  2PJH A;  4HCN B;  4MGY E;  2B3A A;  4BOZ B;  2REX A;  3ONS A;  3M3J A;  2R2Q A;  1ZW7 A;  4K7U A;  4MH0 E;  1VCB A;  3L0W B;  2WWZ A;  4NQK E;  3B1L X;  5DCN A;  3RZF A;  3X0W A;  1GC7 A;  5E6O A;  4NPN A;  1LXD A;  2BYF A;  2FCN A;  3VTU A;  4NJ7 A;  4E3C A;  3PRZ A;  4A3O A;  3QX1 A;  4W9K A;  3PV1 A;  2QHO A;  2JRI B;  2Z0D B;  4W9L A;  1F9J A;  1WXV A;  1RRB A;  2KC1 A;  4I6P A;  4F1S A;  1CMX B;  4HVB A;  1YQB A;  2N4F A;  2MBO A;  2XK5 A;  3QWZ B;  5DPT A;  3VFK A;  4GGQ A;  1RLF A;  1UBQ A;  3APF A;  5HKH A;  2MCN B;  2D11 A;  3IHP C;  2Z59 B;  4JLC A;  2NBW B;  2FCQ A;  2J0K A;  1WJU A;  2PPH A;  4HDO A;  1H4R A;  1KM7 A;  3UF8 A;  4MSM B;  3U30 A;  2K25 A;  2K8C A;  3A33 B;  5AZH A;  2BYE A;  2KOX A;  3PTF C;  4TV3 A;  4W9C A;  4HPM B;  3VH3 B;  2K6Q A;  2K8B A;  2KN5 A;  4XZ4 A;  2MBB B;  1PQS A;  2N1V A;  4NNJ B;  3ZNI D;  2MSE D;  1H8C A;  1WFY A;  2GBR A;  4FA6 A;  3QJZ A;  2FCM A;  2N9P C;  3CST A;  2N7E A;  4RMA A;  1LFD A;  2RD0 A;  1EO6 A;  2CKH B;  3QHT A;  3DBS A;  3JSV A;  3VVW B;  4I6L B;  3UQA A;  4BVU C;  2AWT A;  3RUI B;  3SHQ A;  4W9E A;  1D3Z A;  2MWS B;  4WJO A;  4I6N B;  4RM9 A;  2GOW A;  4DXA B;  2KZR A;  2M8S A;  3NY5 A;  3VDZ A;  1WGY A;  2KNB A;  4BBN C;  5JH5 C;  2ZCC A;  3CMM B;  3NHE B;  5CTR C;  3ZDT A;  3V60 A;  5KHO A;  4JL9 A;  1Q0W B;  2O2V B;  5E6P A;  2AL3 A;  2V1Y A;  1X1M A;  1BT0 A;  3B0A A;  4ICV A;  4IW0 A;  2L0T A;  3U8Z A;  3X23 A;  5J18 A;  4JGH B;  2FCS A;  4OVU A;  4BKT A;  1WF9 A;  3PLU A;  5JZE B;  1L7Y A;  4WAA A;  3UGB B;  4DHJ B;  2BKF A;  3T8M A;  5IAA C;  4EEW A;  1WX7 A;  4K7S A;  4HPL B;  5CHW A;  1KJT A;  2KFK B;  2BWE S;  1GC6 A;  1QZE A;  4IC7 B;  4KIK A;  5AZG A;  2DYM A;  1TZ1 A;  1K8R B;  4KIK B;  1UBI A;  2ASQ A;  4MEM A;  1E8W A;  1VD2 A;  1WR6 E;  2GBK A;  1V86 A;  2KLG A;  3NZU A;  4BFR A;  5LXH A;  2KK8 A;  1R4M I;  3ML8 A;  2ZZP B;  4PS7 A;  2EMT A;  4HDQ A;  3JSV B;  4MJS B;  5D6J B;  1GNU A;  3SD5 A;  2KD0 A;  4DHZ E;  3L17 A;  4GOC A;  3A4R A;  4AJW A;  4BBN F;  5D7G A;  3DBH I;  2LI5 A;  4G3X B;  1NDD A;  2BYV E;  2GBM A;  4K1R B;  1T0Y A;  3SDL C;  3V6E B;  2VRR B;  1V5T A;  2LGY A;  3PVL A;  4DBG A;  3M62 B;  4EZL A;  3QC8 B;  4WJQ A;  2L3Z A;  2LVO A;  2ZJD A;  1WY8 A;  3ML9 A;  4K81 A;  2IBI B;  4W9J A;  2KDE B;  3VXW A;  1C3T A;  4CHK A;  2KWU B;  3H7P A;  4GDL A;  1YIW A;  2GMI C;  1YX6 B;  1ZGU B;  1EF5 A;  3L13 A;  3VUY A;  3DVG X;  2PE9 A;  3UIO B;  1XQQ A;  2MP2 A;  1KOT A;  3K9O B;  3ZRC A;  3HM3 A;  4KV2 A;  1P98 A;  1LQB A;  5E6N A;  1WMH A;  2HTH A;  2OOB B;  3H1U A;  3UIN B;  2CR5 A;  4NAW A;  4NJ6 A;  1V80 A;  1WMH B;  2CHZ A;  3PT2 B;  4P7I A;  2KDI A;  2LD9 A;  3A9K A;  2ZEQ A;  4KSK C;  2YLM A;  1EF1 A;  4BKG A;  2MP2 B;  2D3G A;  3MJW A;  4XC2 A;  3V6C B;  1G6J A;  1GJZ A;  2R2O A;  1YX5 B;  1UEL A;  5CHF A;  3WAL A;  4FAD A;  5KHQ A;  3DDC B;  2FID A;  2NS5 A;  2XK5 B;  1OQY A;  2KO3 A;  2KC2 A;  4ANX A;  3W1Y A;  2LGX A;  3JW0 X;  1WRD B;  3ECI A;  1TBE A;  4GMV A;  4IWO A;  3A1Q A;  2KDB A;  4OVV A;  1NBF C;  2DZI A;  1SIF A;  4WWN A;  5LXI B;  2JRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...