4ASWC

Structure of the complex between the n-terminal dimerisation domain of sgt2 and the ubl domain of get5
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
NAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PRO
publication title Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4aswC00
2GBKA 3AU4A 1P9DU 2K6DB 4KZ0A 1I35A 1WF9A 2JRHA 4RM8A 3W1SC 3A33B 2KWUB 3IBEA 1VD2A 1V6EA 1WZ0A 3KUZA 4KDIC 2AL6A 3VVWB 4FHJA 2GBJA 4GB9A 4KVGB 2AEHA 1WX8A 1XQQA 4WJNA 2BYEA 1YJ1A 2WDTB 3K9OB 3QAQA 1R4NI 3CSFA 2L0TA 2IZVB 4EOYA 4KDLB 4WJQA 1PQSA 2ZPYA 1WR1A 3OAWA 2RSUA 2XK5B 2PE6B 5G2NA 2MBQA 5CHFA 4LCDE 2R2OA 1E7UA 3IVFA 2N9PC 1BT0A 3PLUA 3MJWA 4GDKB 1YIWA 3BY4B 4MELA 3U30A 1I42A 3X23A 3T8MA 2FCSA 4TKNA 1YX6B 3DBSA 4JGHB 4NPNA 2IO0B 5CHVC 1WYWB 2AWTA 1LXDA 3RCZA 5JZEB 2IY1B 4IM0A 3WALA 4DHJB 2IO1B 2NBUA 2BGFA 3APCA 3ENEA 3KYDD 4GMVA 4BKSD 3ALBA 3Q3JA 1UH6A 4ASWC 1WMHA 1LFDA 2RGFA 3IG3A 4HLEA 2CR5A 2D07B 4EKUA 2N9XA 2ZVNA 2BYFA 1OEYA 2HJ8A 2GMIC 3HHMA 3OJ3A 1IYFA 4IWQA 3PS6A 3H7PB 1ZGUB 1V49A 3TJPA 3L17A 4HXDA 3PT2B 4MGKE 2MLBA 3S2AA 2MX2A 3DBRI 4AOFA 4PS3A 3M3JA 2PJHA 2UYZB 3A9KB 2MSED 2KFKA 1TTNA 2O6VD 4HPMB 2L05A 3EECA 2RD0A 3N32A 3PHWB 3SU8X 4FN2A 1H4RA 1Y8RC 1RFAA 1P98A 3DQVA 5J18A 2BWES 5E6NA 4AP4C 3QJZA 3ZUNA 5IAAC 1GC6A 3M62B 1S3SG 2LVPA 3PVLA 2KTRB 3QX1A 3SHQA 4DDID 1J8CA 1WX7A 2G4DB 3A9JA 2D10A 3VXWA 1R4MI 2DYOA 3N3KB 4BKSA 2KJRA 4E71A 2N1VA 4W9JA 1E90A 2MA9B 3EC8A 3H6NA 1Z2MA 3TBLD 2FNJB 3NZUA 3UINB 1F9JA 4ZYNA 2NCNA 2NPTA 3GZNI 4HJKA 1KOTA 2EMSA 1P0RA 3W1SA 1FXTB 1EUVB 2LRWA 4MM3A 4F1SA 2LRUA 4TUUA 2WX0A 4AJYB 3L0WB 3KH0A 4MGZE 3RT3B 2KJ6A 4M8NA 5DPSA 2MBEA 3TMPB 4MGYE 3ZRFA 2HD5B 2O6VA 3PRZA 4J6IA 3PPAA 5E6PA 1NDDA 2N9EB 2NVUI 1RLFA 3ZRCA 4IG7B 3PV1A 2BKRB 4DBGA 3AXCA 4KIKA 2C7NB 2JY6A 4IM3A 3L16A 3SD5A 1G6JA 3H1UA 4JIOU 3K9PB 2L3ZA 2KC1A 2Z59B 1WM3A 5KHQA 4URKA 4PYUA 4BBNC 1WJ4A 2CHZA 2KDFB 3KUDB 1WXVA 2OJRA 4FHKA 1V2YA 4IW0A 2J7QB 1K8RB 4XX5A 2LJ5A 4ANVA 5IA7A 3ZTCA 2W9NA 1QZEA 2M17A 2EMTA 3V62A 4M0WB 2KX0A 2KMCA 4W9LA 4B6WA 1A5RA 3W1YA 4K7UA 3CSTA 4G50A 5AZFA 3A1QB 3H7PA 2Z0EB 4ICUA 3IHPC 1WE6A 2C7MB 2CHWA 2NBWB 4EZJA 3DVGY 4E3CA 2DZKA 4WWNA 1UELA 3ECIA 2N4FA 1CMXB 3B1LX 1OTRB 3CMMB 3VH3B 3KW5B 4HDQA 1V86A 4WWPA 4ZRKA 1E8WA 1NBFC 1WE7A 1WXSA 2PEAA 2R2QA 4MGIE 3RZWC 4FBJB 2LXAA 4NQKE 4GXBA 1WX9A 4BOSC 3DVGX 1IPGA 4FLHA 4LDTB 2KK8A 1GC7A 1JRUA 1D3ZA 2LI5A 1SIFA 2BYVE 3APFA 3RZFA 1M94A 2REXA 2IO2B 4IM2A 4IWPA 3ML9A 2K6QA 4MH0E 1MG8A 3HIZA 2K8HA 3VQIA 1P1AA 2LASA 4FJYA 2NR2A 2JWZA 2G3QB 1ZKHA 3ML8A 3VUWA 3DBHI 4KSKC 4HCPB 4KZCA 3QCAA 3CF6E 2C60A 3ONSA 2ZPNA 1HE8A 4FULA 1IP9A 2O2VA 2OOBB 1OEYJ 5J2RA 1V5TA 3L13A 1KJTA 2K8CA 1WGHA 4B9KA 3KYCD 2DAJA 1KM7A 2JVCA 2BPSA 1UGMA 2M4NA 4TQ0A 4GSWA 2Z0DB 1WFYA 4IWOA 4PS7A 4MSQB 3H9DA 3UIOB 3VTVA 3U7DA 2IYDB 2FUHB 3R66C 2IO3B 2KDBA 4NJ6A 3NZSA 4MSMB 2YLMA 2VRRB 1X1MA 2ZJDA 3APDA 4GU2A 4W9KA 3GOEA 3L08A 2KWVB 5L95C 1WJUA 3VAWA 2HE7A 4HPLB 4I6PA 2JUOA 4EEWA 1OGWA 2JPHA 4LJPB 2J0JA 2IBIB 1WRDB 1GUAB 2LGDA 4B95A 3MHSD 2MCNB 1RRBA 2B3AA 4N9F4 4G3XB 3UIPB 2KFJA 3DVNV 2KLCA 3R7RA 4CHKA 3QIJA 3V6EB 2KQ7A 4NY0A 1L2NA 4GDLB 4WQOB 1P3QU 2A5UA 4NQLB 3DBLI 2LWPA 2MBOA 2DENB 2N1WA 4ANUA 4F8CB 2KXJA 3ZNHB 4DHJD 2KANA 1E8YA 4F7ZA 1E5WA 1UD7A 2N7DA 2WX1A 4EUTA 2LD9A 2V4LA 4G0NB 3NS8A 5EDSA 2AL3A 3VH4B 1EO6A 5LXIB 4BVUC 5AZHA 1UBQA 3A4RA 3KUCB 1SGHA 2BF8B 3BINA 2KTFA 2MP2B 2CU1A 3WIMA 2KHWB 2LVQA 5G55A 3AU5A 3RULA 2J0MA 1GNUA 1EF1A 2ASQA 2KDEB 4W9EA 1NI2A 2KNBA 2XK5A 1LM8B 4YL8A 3QQ8B 5E6OA 4W9DA 3X0WA 4NAWB 4XC2A 4GDKA 3TCAA 4A3OA 4CO7A 5DPRA 3PZDA 1ZW7A 3RUIB 5TR5A 2MBHA 2EKEC 3VFKA 4HCNB 2ZVOA 4EFOA 3PLVA 1XT9B 2K25A 2KDIA 5D7GA 3ZLZA 2DHZA 1EF5A 4DK5A 3QC8B 4ANWA 4K1RB 2YVCA 3A4SC 3NHEB 1L7YA 2JZZA 3ZNZB 5KHOA 3TIXA 1YQBA 2LXCA 2MBBB 4BOZB 3JVZX 3SDLC 3M63B 5D2MB 5JH5C 2PE9A 2L0FA 1TGZB 1AARA 3T9LA 3VUYA 2JF5A 2ZNVC 2K1FA 3R3MA 2JXXA 4WJOA 2ZNVB 3ZIMA 1WH3A 2UWQA 1WZ3A 1UBIA 4GIVA 3VTUA 1TZ1A 2ZCCA 3B08A 3PSEB 2L00B 4GOCA 2KD0A 2MQJA 3A9KA 3HK0A 3UQBA 2I1KA 3Q3FA 2WWZA 3QWZB 2XBBC 3DDCB 1WGYA 4PS8A 4BKTA 1H8CA 3WAOA 4G11A 2RR9A 4A20A 4KV2A 5DPWA 1T0YA 2RPQA 3DOWA 2FCNA 4WWOA 3WAMA 2GOWA 2WYQA 4TV3A 1V9JA 1WIAA 2KTRA 3A9JB 4XZ4A 3WA0A 2KMAA 4GDLA 3DVNU 4HVBA 2KX3A 2JRIB 2M1MA 2KWCA 1LQBA 4BFRA 3NY5A 1Q0WB 2C5LC 2LGYA 2MWSB 2NS5A 2FCMA 2K8BA 2NPTB 4DHZB 4W9IA 4MEMA 4FJVB 3U8ZA 5DCNA 2AYOB 2L76A 2M8SA 1WR6E 4HWIB 5J17A 3QA8A 2C9WB 4ICVA 3H7SA 4IUMB 2G45B 2HTHA 4HK2A 2DAFA 3EHVA 4II3B 2DZJA 2KZRA 3ZNID 1V5OA 4DWFA 4FADA 3AI5A 2FCQA 1VCBA 4DXAB 5JHBA 2MP2A 3JSVB 2O6VB 2Y5BB 4W9FA 5D6JB 4LJOB 1WY8A 2KJHB 1ISNA 4JL9A 4K7WA 4EZKA 3OLMD 4KIKB 5AZGA 2C7HA 4FA6A 4I6LB 3C0RB 2JT4B 2G4SA 4LDTD 4NAWA 4WAAA 3QK0A 2ZEQA 4PYZA 1GJZA 3VHTC 1WGRA 2BKFA 2JZ3B 1Z5SB 3DCGA 1WJNA 2D3GA 4BKGA 2LGXA 4W9GA 1RAXA 1Q5WB 1GG3A 4FJZA 1U4AA 4JQWC 3V61A 5HKHA 1TBEA 3I3TB 4I6NB 3WAPA 3N30A 2GBRA 2GBMA 2L8JA 3NOBA 3PHXB 3VTWA 1J19A 3PREA 3M95A 3ZO5B 2ZCBA 3UGBB 3A1QA 2KO3A 4MJSB 2A4ZA 2CS4A 1E8XA 5LLIA 3PGEA 4DHZE 3TL5A 1XD3B 3UQAA 3RYTA 2KN5A 2LUEA 5CHWA 2BWFA 3UF8A 3ZDMC 4AWJA 2M0XA 5CTRC 3PTFC 2DZIA 4WJPA 5BO4B 4BBNF 5L83A 3ZNGC 4GN1A 2L7RA 3VUXA 2KOXA 4KSLC 2XEWA 3HM3A 2IY0B 3JW0X 3ZDTA 5LXHA 1E8ZA 3MTNB 3KVFB 3O65B 2KQSA 4OVUA 3ZW3A 4E74A 1OQYA 3ZKJC 1C3TA 4K81A 2D2QA 2I1JA 1S1QB 3QARA 2CHXA 1WXMA 4RM9A 4EZLA 2CKHB 4ZRIA 2ZZPB 1V80A 3L54A 2K39A 4K7SA 3VDZA 2N7EA 2KKCA 3DPDA 3EFUA 1V81A 3LJ3A 3V6CB 3OJ4B 3ZTDA 2FAZA 2FIDA 2GBNA 4GGQA 4X57B 3LDZE 2J0KA 5CX3A 4NNJB 1WI0A 2O2VB 3QHTA 1YD8U 4P7IA 2DYBA 2KC2A 3B0AA 2V1YA 3D32A 4W9HA 1Q1OA 5GMVA 2D11A 2PPHA 2DX5B 3JSVA 2KVRA 1J0GA 1WMHB 4II2B 2V3SA 3ZVVA 2MW5A 3JYUA 1WM2A 2FIFA 2QHOA 3RD2A 4ZDVA 4NJ7A 3HM6X 2MRPA 1WGGA 4AJWA 4AUQC 3IFWB 5FR6A 3AULA 1UZXB 4TQ1A 5AEKB 4HDOA 3PRMB 4M8MA 4JLCA 4MDKE 2DZMA 4OVVA 1C1YB 5D94A 3R7QA 2KFKB 1WJ6A 1YX5B 5C23A 1KLVA 4DDGD 1SE9A 4ZRJA 4ANXA 5C1ZA 1E7VA 3WANA 1WGDA 2LVOA 4W9CA 3P2BA 2LZ6A 2NBVB 3V60A 4MJSA 4A3PA 1WXAA 2KLGA 5JHAA 5DPTA 4IC7B 4RMAA 3PRPB 3L10B 2DYMA 4CYEA
chains in the Genus database with same CATH superfamily
3AU4A 2BQQA 4KZ0A 1WGKA 1OQQA 3A33B 1E9MA 1WZ0A 4KVGB 4NZLB 4WJNA 1R4NB 5HI1A 3CSFA 2L0TA 4WAFA 4KDLB 1PQSA 5IOIA 5CHFA 2GI9A 2R2OA 2N9PC 1JW9D 3SFDB 2VH1A 3BY4B 2BW2A 2WXNA 4TKNA 1I4GA 3DHGC 2IO0B 5CHVC 2HJ1A 2NBUA 5EE3A 3APCA 3H8HA 4GMVA 3Q3JA 2OHFA 2RGFA 2RPVA 4IWQA 3PS6A 2DNFA 4HXDA 3S2AA 3DBRI 2PJHA 4BZAA 2UYZB 2TSSA 3I5JC 2MSED 1T3QA 1FCCC 3NVVA 2L05A 2JYEA 3EECA 1TY0A 2J4XA 2RD0A 3P63A 1RFAA 2WXHA 1XLPA 3ZUNA 1GC6A 2J42A 2WU5B 4DDID 3PVLA 1FD6A 3VXWA 1R4MI 3BYYB 3NZUA 1F9JA 3AE5B 2NCNA 1IGDA 1P0RA 3W1SA 2LRWA 5BYRA 4AJYB 5BMGA 3P42A 2MBEA 2O6VA 1XLQA 5E6PA 3ZRCA 2BYTA 3EUB2 2C7NB 4IM3A 3SD5A 3H1UA 3AEGB 4BBNC 4IW0A 1V2YA 1K8RB 5IA7A 2LJ5A 3ZTCA 1QZEA 4M0WB 2KX0A 4ARIA 4B6WA 4A55A 3W1YA 3CSTA 5AZFA 3MC8A 1JMLA 3A1QB 3H7PA 2Z0EB 4HPPA 4LK0M 1HXYD 3IHPC 2CHWA 3DVGY 4E3CA 4WWNA 1JROA 3CMMB 1YN3A 4TMAB 1EM7A 3KW5B 4HDQA 1V86A 4ZRKA 1NENB 1WXSA 5EE1A 3RZWC 4NQKE 1WX9A 4LDTB 1JRUA 2LI5A 1TIFA 1SIFA 2BYVE 2K0PA 1M94A 2ACZB 4H2AA 2JU6X 4XDCA 2K8HA 3VQIA 1P1AA 2JWZA 3VUWA 3ML8A 1LGRA 4RF0A 3QCAA 1NI3A 2O2VA 3BIID 1OEYJ 1TYGB 3ZJUA 2K8CA 3Q3OC 3KYCD 2JVCA 3TEXA 2BPSA 1UGMA 4GSWA 2Z0DB 1FEHA 4PS7A 3H9DA 1IBXA 4XGAB 3VTVA 2IO3B 4NJ6A 3NZSA 4MSMB 3APDA 1XEEA 1K51A 3NVZA 1KFYB 2JUOA 4EEWA 2JPHA 4K3BA 3MHSD 1SEBD 3UQAA 4G3XB 4QAYA 2KFJA 2KLCA 1R4MB 4ANUA 3TSSA 3PZ8A 2KXJA 4F7ZA 1UD7A 2N7DA 2IGGA 4EUTA 4G0NB 2V4LA 2AL3A 1TS4A 2WXRA 4BVUC 5AZHA 1RWSA 3KUCB 3BK2A 1JALA 4MT5A 5IP4D 4HKZE 2LVQA 1SF0A 1I4RA 1LM8B 4YL8A 3TCAA 4CO7A 2BB6A 5H8YE 2MBHA 2J52A 1E6EB 1XT9B 4DK5A 4RCOA 1KTKA 2QMTA 4K1RB 1M4VA 2LXCA 4JWUC 4MH8A 3MP9A 1AARA 3VUYA 1CQVA 2ZNVB 1SBBB 2XN9C 4YSXB 1WH3A 2UWQA 2JX5A 3PSEB 4GOCA 2WWZA 3NZ3A 2BT6A 4PS8A 3GE3C 2MJEA 4WH4A 1XF5L 3DOWA 3WAMA 2GOWA 1V9JA 2KTRA 2E3TA 2PLPA 3ZXRA 4XE0A 3DVNU 2M1MA 2AX5A 3N1ZC 5GXGB 2NS5A 4W9IA 2V3PA 1N61A 4FJVB 1KRHA 1FPYA 2L52A 2M56B 3H7SA 2G45B 4HK2A 2KZRA 3Q8AA 4DWFA 2O6VB 5D6JB 4W9FA 2X8XX 4YSZB 1WY8A 3OLMD 4M00A 1J7CA 4FA6A 3C0RB 1I4PA 4WAAA 4PYZA 1GJZA 1YOVB 2DBYA 2JZ3B 1Z5SB 1WJNA 4W9GA 1I7HA 1U4AA 2Y5PA 3W9CB 1RM6C 4I6NB 3Q8EA 2L8JA 1VRAB 3ABVB 2CS4A 3PGEA 4DHZE 3TL5A 1IGCA 3RYTA 2WXPA 2LUEA 2BWFA 3UF8A 3ZDMC 3GS2A 1GAQB 4AS1A 5EE9A 2LMCA 1YN4A 1PUTA 4WJPA 5L83A 2JSVX 2B76B 1D5MC 2KOXA 4RF1A 3ZDTA 1E8ZA 3KVFB 3O65B 2KQSA 4OVUA 4E74A 3IXSA 1SJED 4IDIA 1WXMA 4RM9A 1V97A 4C4VA 1JQ4A 2ZZPB 1L0YB 3VRAB 3NG0A 1V81A 3OJ4B 2FAZA 2GBNA 3LDZE 2O2VB 3RNAC 4RH6A 2DYBA 2KMMA 2DX5B 1J0GA 1FFVA 2V3SA 1I4XA 3JYUA 1WM2A 2FIFA 2WDVB 2WNMA 2WHIA 1IBXB 3IAM1 4XDDA 1TS5A 1WGGA 4N59A 3BVMA 3IFWB 2INCC 4LLGM 1T0QC 1FNVA 3BYTB 4CQNA 4JLCA 2DZMA 2JXTA 3AE3B 3R7QA 3ETRA 5C23A 1F2RC 4ZRJA 1UUPA 2NBVB 4MJSA 4A3PA 3LXFA 4S0RA 3L10B 1ET6A 2IJ0A 1WF9A 3RI7C 1F52A 4RM8A 3IBEA 1NYQA 4RNAA 2AL6A 3VVWB 4FHJA 3CWIA 2AEHA 1WX8A 1TZOA 1TKEA 3AEEB 4KX6B 1YJ1A 1R4NI 4EOYA 2ZPYA 1WR1A 3Q3NC 4LCDE 1NEKB 3HUIA 1E7UA 3IVFA 3MJWA 3U30A 4MELA 3T8MA 1YX6B 3FC4A 3KWVA 4JGHB 4NPNA 1HEZE 3RCZA 1N63A 1NVID 2QDFA 2XNAC 4IM0A 4DHJB 2BGFA 3KYDD 4BKSD 1JRPA 4ASWC 1WMHA 1LFDA 2J53A 4EKUA 2ZVNA 3ZGZA 1IYFA 3OJ3A 3AH7A 1VLBA 1AN8A 3Q69A 3PT2B 1VDVA 5FK9C 2KFKA 2MJ3A 5FKAC 4HPMB 1XXGA 1Y8RC 3EGRA 5J18A 2BWES 5E6JA 4LNIA 5E6NA 2WDQB 3M62B 2KTRB 3SHQA 4DXGA 3ZJVA 1E90A 3EC8A 1Z2MA 3GE8C 4ZYNA 1FFUA 1JWMD 2EMSA 3ZXVA 4MM3A 3R2TA 4TUUA 3TUOA 1I4QA 2N9LA 3DHIC 4UDUC 1N6ZA 2HD5B 3EFCA 2FE8A 4J6IA 1NDDA 1J7BA 2KDMA 2NVUI 3U2SC 4IG7B 1BUIC 4DBGA 4KIKA 2INNE 2LGIA 1TS3A 3R8BA 5KHQA 1WM3A 4URKA 1WJ4A 1E0ZA 2CHZA 3KUDB 4FHKA 4ANVA 3T3NA 2KT7A 2W9NA 2M17A 5HHDG 4WURA 1YJJA 2LJIA 3HRDD 3W2DA 2KMCA 1F0ZA 4W9LA 1A5RA 4ZRPA 4GLSC 4K7UA 1GOZA 4C00A 3B2GA 1WE6A 2KACA 2D5GA 1VZ7A 1HQRD 2G1EA 4ZRQA 3B1LX 3DWMA 4Q2JA 1C76A 3AECB 1NBFC 1WE7A 2R2QA 4MGIE 2CJOA 2RDGA 2BVCA 1D6EC 1N60A 2KK8A 3MHZA 2KQ4X 3RZFA 1VZ8A 2REXA 1PGXA 4L23A 2IO2B 4IWPA 4C4VB 2K6QA 1Y56A 3N9YC 3DBHB 2HTME 1FRRA 1FXAA 2W3RA 4HCPB 4KZCA 4KGSA 3CF6E 4P1BC 2UU7A 3AM9A 1V5TA 3L13A 1KJTA 3DHHC 3HVDA 1WGHA 4B9KA 2DAJA 2PVOD 3LB8C 3OG5A 4IWOA 1GPXA 2IYDB 1UGJA 4KGTA 3BWUD 1QF6A 2YLMA 4W9KA 1F77A 2WXJA 3VAWA 3T3OA 4HPLB 1ZOYB 2IBIB 1WRDB 1TKGA 2MCNB 1RRBA 2B3AA 3Q8BA 3UIPB 1ENFA 3DVNV 3R7RA 4CHKA 3V6EB 2KQ7A 4NY0A 4GDLB 4F8CB 2MBOA 3N1XC 1UWMA 3U4EG 1SB3C 1FO4A 1MVKA 2FBWB 2PMVA 1EO6A 1JCKB 1EWYC 1UBQA 3P4QB 2BF8B 1ET9A 4EE2A 3VR8B 5G55A 1EWCA 3RULA 1GNUA 1EF1A 2KDEB 1NI2A 2KNBA 2XK5A 5IKCM 3Q3MC 1YQ4B 3RUIB 4B0EA 3VRBB 4EFOA 2K25A 2KDIA 2DHZA 1EF5A 1LO5D 4MACA 1L7YA 1YQBA 4FXCA 2WXQA 3M63B 5JH5C 2PE9A 1CK1A 4C7YA 2ZNVC 4ACFA 1WZ3A 4GIVA 3VTUA 4OVZA 4A9AA 4ZOHC 3B08A 2KD0A 3A9KA 3HK0A 3UQBA 3Q3FA 3Q8CA 3QWZB 3AE9B 1WGYA 3WAOA 4A20A 2QSDA 4ARCA 2RPQA 5G5HA 2K22A 4TV3A 1SJHD 1WIAA 4XZ4A 3OWEB 1MG4A 2KX3A 1LQBA 2LGYA 2K8BA 4DHZB 5BYSA 2L76A 4IUMB 2LHEA 2DZJA 1V5OA 4TSSA 4FADA 2MP2A 3JSVB 4LJOB 1SE4A 4RGNA 2KJHB 4JL9A 5HFYA 1DGJA 4KIKB 2QEJC 2JT4B 4LDTD 4NAWA 1FCLA 3VHTC 4JE3B 2IPKD 2BKFA 1AW7A 3IAS1 1Q5WB 3AV8A 4JQWC 1TBEA 3I3TB 3N30A 2GBRA 1J19A 3PREA 1P7EA 1IUEA 5CHWA 4AWJA 5CTRC 2W82A 3U52E 4BBNF 2ICIA 2D3BA 2WU2B 2IY0B 3JW0X 4LNFA 2BB5A 3N20C 3BVGA 4USAA 1C3TA 2I1JA 2WGSA 3C8YA 5C2TB 1S1QB 4EZLA 2CHXA 2WLBA 2CKHB 4ZRIA 2W3SA 1N5WA 4K7SA 3DPDA 3EFUA 3LJ3A 1B1ZA 3ZTDA 4GGQA 5TSSA 2SAKA 2KYWA 1ZXIA 3B0AA 2PVGC 3KLSX 3D32A 4W9HA 3RFZB 3AE2B 2KVRA 4II2B 2QHOA 2ZW1A 3I63C 4NJ7A 3HM6X 2MRPA 4AJWA 4AUQC 1QILA 2ON8A 4M8MA 1C1YB 4AQ7A 1YX5B 2WXLA 4YT0B 4ANXA 1E7VA 2NTSA 4LNNA 1C79A 4JWSC 1QOBA 1L6VA 1HTQA 1ZP0B 3R2IA 2DYMA 1QOAA 2PKOA 1VD2A 1V6EA 2GBJA 2WDTB 3QAQA 4B0MA 2VZKB 2XK5B 2PE6B 3AB5A 3GB1A 1YNTE 3PLUA 1YIWA 3X23A 2FCSA 1L4ZB 2WXOA 3RNCC 2AWTA 5JZEB 2IY1B 3GP7A 3WALA 4M01A 4A90A 3ENEA 3ALBA 2JYTA 5LNK1 2D07B 2N9XA 2BYFA 3HHMA 2GMIC 1C77A 3H7PB 1NYRA 3TJPA 1SXTA 1L4DB 2K5PA 4MGKE 2MLBA 2MX2A 4PS3A 3M3JA 3A9KB 2WS3B 1TTNA 2WXMA 2O6VD 3MFGA 4FN2A 3HVZA 1P98A 4AP4C 3QJZA 2M19A 1S3SG 2LVPA 3QX1A 1VZ6A 3W5VB 3U7ZA 3A9JA 1KF6B 4ITKA 3H6NA 2ONQA 1AWDA 3TBLD 4C80A 2H88B 3C19A 5AUKA 3GZNI 1KOTA 1V1OA 4F1SA 1UNSA 1FXTB 1QKZA 2Q5WD 1HZ5A 3KH0A 3RT3B 4M8NA 5DPSA 4MGYE 3ZRFA 3MJ5A 4C56C 2YEPF 1JWBD 3PPAA 4RGTA 3AMZA 3PV1A 2BKRB 2JY6A 1G6JA 1C9FA 1UF0A 4JIOU 2Z59B 2SEBD 1YJIA 1FXIA 1PYWD 3V62A 1N62A 1YMHE 4G50A 4ICUA 2C7MB 2NBWB 1UELA 3ECIA 1CMXB 4WWPA 4US8A 1OFFA 2PEAA 1C4CA 2LXAA 4BOSC 3DVGX 4FLHA 4RFBA 4JX1C 4N6EB 1HZ6A 3ML9A 4O1NA 4WIPA 1MG8A 2LASA 3RNEC 1RFKA 4FJYA 2NR2A 2G3QB 4OZAA 3DBHI 4KSKC 1K52A 2R61A 3ONSA 2ZPNA 1HE8A 4FULA 5J2RA 3AE6B 3RN9C 2D3AA 1WFYA 4WWMA 1SE2A 4OZBA 1ACCA 2PIAA 2IGHA 3U7DA 3FKYA 2FUHB 4A8XC 1MI0A 1CZPA 2N9KA 2VRRB 1X1MA 2ZJDA 3GOEA 3AN1A 4RGOS 1WJUA 3NVWA 1T6BX 4M0WA 4D2KA 2LGDA 1GUAB 3NRZA 2BTEA 4KKIA 1D5ZC 3QIJA 4OW0A 5I4DA 1L2NA 1WWTA 4KGRA 2WXFA 1P3QU 2A5UA 2N0SB 2W54A 3ZNHB 2V0GA 4DHJD 2LEKA 2KANA 3E56A 1E5WA 1EU3A 2KN4A 1T0RC 3GZNB 2WX1A 2LD9A 2INPE 5T8IA 3A4RA 1SGHA 3BINA 2KTFA 2CU1A 3BVZA 4C7ZA 1J7AA 2J0MA 2QJLA 2ASQA 3AE7B 3AEFB 3QQ8B 5E6OA 4W9DA 4XC2A 4A3OA 1L5PA 4GDKA 4P1CC 5DPRA 3PZDA 1ZW7A 1DOXA 2EKEC 4HCNB 3PLVA 4P6VF 3P1MA 4ANWA 3AE4B 2YVCA 3A4SC 3NHEB 2JZZA 3ZNZB 4BOZB 5KHOA 3TIXA 1K50A 5C3JB 3SDLC 5D2MB 3VR9B 1TT5B 3L4PA 2NMQA 1TGZB 2BBCA 3T9LA 2JF5A 2JXXA 1XLNA 1TKYA 4RGMA 2BS3B 2ZCCA 2H89B 1ESFA 2QILA 2MQJA 2KAJA 1JWSD 2WDRB 1MPEA 3DDCB 4BKTA 1H8CA 2ZW0A 2V4IB 3V3XA 2GLSA 1V1PA 2CJNA 1JWUD 1L6UA 2PTLA 4LNOA 1MHHE 1XCQL 2WYQA 3A9JB 2RDBC 3WA0A 1Q0WB 2FCMA 3ZJTA 1T0SC 4PK1A 2KWDA 5DCNA 2BS2B 1HTOA 1ZDVA 4HWIB 3QA8A 4ICVA 2HTHA 3B2FA 3EHVA 4II3B 3FAHA 2DLBA 3AI5A 1VCBA 5JHBA 2Y5BB 3URYA 3P4SB 3DWGC 2C7HA 4I6LB 4HKQA 3QK0A 5H92C 1ZPSA 2NTTA 3I57A 1WGRA 1XCTL 3DCGA 4IOIE 1VR9A 2QC8A 2D3GA 4BKGA 4HRSA 2VH2A 3TEWA 1HA5A 2LUMA 4FJZA 3FILA 1V8CA 3WAPA 2GBMA 1T5XD 3PHXB 2D3CA 3VTWA 3ZO5B 1SE3A 3IT6B 4OHJA 3UGBB 4MJSB 5LLIA 4HROA 3P4PB 4LTUA 5D3IB 1TJEA 3PTFC 2EELA 5BO4B 2AQ3B 2WP9B 1DOYA 4GN1A 2L7RA 2I38A 3SEBA 1L0XB 2XEWA 1DOIA 3HM3A 4ZYSA 3MTNB 1OQYA 2RDHA 4K81A 1FIQA 1VJKA 2D2QA 4DXFA 2WXGA 4YSYB 3QARA 2PW9A 3L54A 3VDZA 2N7EA 2KKCA 2K9XA 3W5UB 4X57B 4NNJB 1WI0A 3Q2AC 3QHTA 1YD8U 2KC2A 1Q1OA 5GMVA 2PPHA 3TEYA 1WMHB 3ZVVA 5JXVA 1DYQA 1WYGA 5FR6A 1UZXB 5AEKB 1K53A 3IT4B 4OVVA 3MC9A 5D94A 4L2YA 2KFKB 4P16A 1KLVA 3WANA 1RYJA 4W9CA 3P4RB 1PGAA 3N1YC 3P2BA 3V60A 2KLGA 1KLUD 5DPTA 4IC7B 3RNGC 5AUIA 4RMAA 4CYEA 2GBKA 2LFIA 1P9DU 2K6DB 1WRIA 1I35A 2JRHA 3W1SC 1FM0D 2KWUB 2LHDA 2FUG1 4MM3B 3BZDB 3KUZA 4KDIC 3PO0A 2QCZA 4GB9A 4YTPB 1XQQA 1SSNA 2BYEA 3K9OB 2IZVB 3AE8B 4WJQA 1GB4A 3OAWA 2RSUA 2M0AA 3KQ4A 5G2NA 2MBQA 1BT0A 1QOFA 4GDKB 1I42A 4R3DA 1TS2A 2IGDA 3DBSA 2RMMA 1WYWB 2WXIA 1LXDA 2IO1B 4DQOC 3RPFC 2MJDA 2K3UA 1UH6A 4JPSA 3IG3A 4HLEA 5G5GA 2CR5A 1FMAD 1KLGD 1OEYA 2HJ8A 4KKJA 4A6QA 3UI3A 1ZGUB 1V49A 3L17A 3DBRB 4AOFA 3NUHB 2G9HD 1D4BA 3N32A 3SU8X 3PHWB 1H4RA 3RNFC 3DQVA 1XLOA 3AEDB 1V1PB 3BK1A 4HJGE 5IAAC 2JQRB 1J8CA 1WX7A 2G4DB 2D10A 2DYOA 3N3KB 4BKSA 2KJRA 4E71A 3SFEB 2N1VA 4W9JA 2MA9B 2L83A 2FNJB 3UINB 2NPTA 4ZHOA 4HJKA 4IKGA 1EUVB 2LRUA 2MHJA 2WX0A 4N58A 3L0WB 4MGZE 1BMLC 2JZPA 4REZA 2KJ6A 1ZXHA 3TMPB 4PT5A 2QIEB 1R7SA 3PRZA 3CIRB 2N9EB 1RLFA 3AXCA 3RNBC 3L16A 1PFDA 3K9PB 2KC1A 2L3ZA 4PYUA 2KDFB 1WXVA 2OJRA 4XX5A 2J7QB 3FILB 3Q6BA 2EMTA 1YQ3B 4NJCA 2W55A 3SR6A 2CU3A 3I9V1 4EZJA 5IO9A 2DZKA 2N4FA 1OTRB 1ZUD2 3VH3B 5BMHA 1E8WA 2INDC 4FBJB 4M02A 4GXBA 1D5XC 1IPGA 1GC7A 1D3ZA 3APFA 1C4PA 4IM2A 3KWLA 2KVZA 1XO3A 2LGSA 1Q10A 4MH0E 4OZCA 3HIZA 1WXQA 2AQ2B 3Q8FA 2Y5CA 4YXDB 1ZKHA 1MHXA 1C78A 3Q14C 2C60A 1IP9A 2OOBB 1E10A 1KM7A 2M4NA 1OQRA 4TQ0A 2Y3AA 4MSQB 3UIOB 3TEZA 3R66C 4HEA1 2KDBA 4GU2A 1YN5A 3L08A 2KWVB 5L95C 1FRDA 2VZKD 1FNWA 2HE7A 4I6PA 1OGWA 4LJPB 2J0JA 1FNUA 4B95A 4N9F4 1CJEA 1F1HA 4WQOB 4NQLB 2V3NA 2LWPA 2N1WA 2DENB 3DBLI 4XWTA 1E8YA 4WQMA 3NS8A 5EDSA 5HG2A 3VH4B 5LXIB 3EA6A 3WIMA 2MP2B 2KHWB 5BYQA 2EKIA 3AU5A 4W9EA 4XWWA 1KH0A 3X0WA 1GB1A 4NAWB 1TY2A 2AQ1B 5TR5A 3VFKA 2DWQA 2ZVOA 5D7GA 3ZLZA 3QC8B 2JWUA 3AEBB 2OEDA 1L0VB 2MBBB 2Z8LA 1QT9A 4LNKA 3JVZX 2L0FA 3ZYYX 2K1FA 3R3MA 4WJOA 3ZIMA 1UBIA 3PZ7A 1TZ1A 2L00B 1STEA 2I1KA 1JWAD 2WQYB 2XBBC 4L1BA 5EE0A 1F2RI 4ZHPA 2E6XA 4G11A 2RR9A 3J9CA 4KV2A 5DPWA 1T0YA 4YTNB 4WWOA 2FCNA 3RMKC 4K3CA 2YEPB 3B9JA 3MC0B 2KMAA 4GDLA 4HVBA 2L32A 2JRIB 5FR3A 2KWCA 4BFRA 3NY5A 2C5LC 2MWSB 2NPTB 4MEMA 2OJWA 3U8ZA 5MPOA 2AYOB 1I4HA 2M8SA 1WR6E 1QLBB 1UWXA 5J17A 2C9WB 1QQRA 2DAFA 3ZNID 2X38A 2IDYA 4S17A 2FCQA 3LYYA 4DXAB 5BMIA 1ISNA 4K7WA 1N5XA 4EZKA 5AZGA 2G4SA 3V05A 2ZEQA 2BS4B 3AEAB 4YTMB 2LGXA 1RAXA 1GG3A 2GRIA 3V61A 3WCQA 5HKHA 1MFWA 2V9HA 1BXTA 3NOBA 3M95A 4YWGG 4NAMA 1EU4A 2ZCBA 3A1QA 2KO3A 2A4ZA 1E8XA 5D3DA 1PDXA 1WSPA 1XD3B 2GB1A 2KN5A 3DBLB 2M0XA 2N7JA 3E9SA 2DZIA 3O13A 3NVYA 3ZNGC 3NS1A 3VUXA 4KSLC 5LXHA 3ZW3A 3ZKJC 1ZE3D 3ZQ4A 1AYFA 3AE1B 1E7PB 1PGBA 1ZDXA 1V80A 2K39A 2MEKA 3V6CB 2FIDA 1C4AA 2J0KA 5CX3A 1MJDA 1B9RA 1P7FA 4P7IA 2HDEA 2V1YA 2D11A 4J3OD 3JSVA 1ROEA 1A70A 2MW5A 3RD2A 4ZDVA 3AULA 4TQ1A 4HDOA 3PRMB 4MDKE 2WXKA 1QOGA 1SIJA 1WJ6A 4US9A 4DDGD 4XYCA 1SE9A 2I2YA 5C1ZA 2L1AA 5IN7A 1WGDA 4BAXA 2LVOA 2LZ6A 3NJTA 1WXAA 5JHAA 2MH7A 3PRPB
chains in the Genus database with same CATH topology
2GBKA 3AU4A 1P9DU 2K6DB 4KZ0A 1I35A 1WF9A 2JRHA 4RM8A 3W1SC 3A33B 2KWUB 3IBEA 1VD2A 1V6EA 1WZ0A 3KUZA 4KDIC 2AL6A 3VVWB 4FHJA 2GBJA 4GB9A 4KVGB 2AEHA 1WX8A 1XQQA 4WJNA 2BYEA 1YJ1A 2WDTB 3K9OB 3QAQA 1R4NI 3CSFA 2L0TA 2IZVB 4EOYA 4KDLB 4WJQA 1PQSA 2ZPYA 1WR1A 3OAWA 2RSUA 2XK5B 2PE6B 5G2NA 2MBQA 5CHFA 4LCDE 2R2OA 1E7UA 3IVFA 2N9PC 1BT0A 3PLUA 3MJWA 4GDKB 1YIWA 3BY4B 4MELA 3U30A 1I42A 3X23A 3T8MA 2FCSA 4TKNA 1YX6B 3DBSA 4JGHB 4NPNA 2IO0B 5CHVC 1WYWB 2AWTA 1LXDA 3RCZA 5JZEB 2IY1B 4IM0A 3WALA 4DHJB 2IO1B 2NBUA 2BGFA 3APCA 3ENEA 3KYDD 4GMVA 4BKSD 3ALBA 3Q3JA 1UH6A 4ASWC 1WMHA 1LFDA 2RGFA 3IG3A 4HLEA 2CR5A 2D07B 4EKUA 2N9XA 2ZVNA 2BYFA 1OEYA 2HJ8A 2GMIC 3HHMA 3OJ3A 1IYFA 4IWQA 3PS6A 3H7PB 1ZGUB 1V49A 3TJPA 3L17A 4HXDA 3PT2B 4MGKE 2MLBA 3S2AA 2MX2A 3DBRI 4AOFA 4PS3A 3M3JA 2PJHA 2UYZB 3A9KB 2MSED 2KFKA 1TTNA 2O6VD 4HPMB 2L05A 3EECA 2RD0A 3N32A 3PHWB 3SU8X 4FN2A 1H4RA 1Y8RC 1RFAA 1P98A 3DQVA 5J18A 2BWES 5E6NA 4AP4C 3QJZA 3ZUNA 5IAAC 1GC6A 3M62B 1S3SG 2LVPA 3PVLA 2KTRB 3QX1A 3SHQA 4DDID 1J8CA 1WX7A 2G4DB 3A9JA 2D10A 3VXWA 1R4MI 2DYOA 3N3KB 4BKSA 2KJRA 4E71A 2N1VA 4W9JA 1E90A 2MA9B 3EC8A 3H6NA 1Z2MA 3TBLD 2FNJB 3NZUA 3UINB 1F9JA 4ZYNA 2NCNA 2NPTA 3GZNI 4HJKA 1KOTA 2EMSA 1P0RA 3W1SA 1FXTB 1EUVB 2LRWA 4MM3A 4F1SA 2LRUA 4TUUA 2WX0A 4AJYB 3L0WB 3KH0A 4MGZE 3RT3B 2KJ6A 4M8NA 5DPSA 2MBEA 3TMPB 4MGYE 3ZRFA 2HD5B 2O6VA 3PRZA 4J6IA 3PPAA 5E6PA 1NDDA 2N9EB 2NVUI 1RLFA 3ZRCA 4IG7B 3PV1A 2BKRB 4DBGA 3AXCA 4KIKA 2C7NB 2JY6A 4IM3A 3L16A 3SD5A 1G6JA 3H1UA 4JIOU 3K9PB 2L3ZA 2KC1A 2Z59B 1WM3A 5KHQA 4URKA 4PYUA 4BBNC 1WJ4A 2CHZA 2KDFB 3KUDB 1WXVA 2OJRA 4FHKA 1V2YA 4IW0A 2J7QB 1K8RB 4XX5A 2LJ5A 4ANVA 5IA7A 3ZTCA 2W9NA 1QZEA 2M17A 2EMTA 3V62A 4M0WB 2KX0A 2KMCA 4W9LA 4B6WA 1A5RA 3W1YA 4K7UA 3CSTA 4G50A 5AZFA 3A1QB 3H7PA 2Z0EB 4ICUA 3IHPC 1WE6A 2C7MB 2CHWA 2NBWB 4EZJA 3DVGY 4E3CA 2DZKA 4WWNA 1UELA 3ECIA 2N4FA 1CMXB 3B1LX 1OTRB 3CMMB 3VH3B 3KW5B 4HDQA 1V86A 4WWPA 4ZRKA 1E8WA 1NBFC 1WE7A 1WXSA 2PEAA 2R2QA 4MGIE 3RZWC 4FBJB 2LXAA 4NQKE 4GXBA 1WX9A 4BOSC 3DVGX 1IPGA 4FLHA 4LDTB 2KK8A 1GC7A 1JRUA 1D3ZA 2LI5A 1SIFA 2BYVE 3APFA 3RZFA 1M94A 2REXA 2IO2B 4IM2A 4IWPA 3ML9A 2K6QA 4MH0E 1MG8A 3HIZA 2K8HA 3VQIA 1P1AA 2LASA 4FJYA 2NR2A 2JWZA 2G3QB 1ZKHA 3ML8A 3VUWA 3DBHI 4KSKC 4HCPB 4KZCA 3QCAA 3CF6E 2C60A 3ONSA 2ZPNA 1HE8A 4FULA 1IP9A 2O2VA 2OOBB 1OEYJ 5J2RA 1V5TA 3L13A 1KJTA 2K8CA 1WGHA 4B9KA 3KYCD 2DAJA 1KM7A 2JVCA 2BPSA 1UGMA 2M4NA 4TQ0A 4GSWA 2Z0DB 1WFYA 4IWOA 4PS7A 4MSQB 3H9DA 3UIOB 3VTVA 3U7DA 2IYDB 2FUHB 3R66C 2IO3B 2KDBA 4NJ6A 3NZSA 4MSMB 2YLMA 2VRRB 1X1MA 2ZJDA 3APDA 4GU2A 4W9KA 3GOEA 3L08A 2KWVB 5L95C 1WJUA 3VAWA 2HE7A 4HPLB 4I6PA 2JUOA 4EEWA 1OGWA 2JPHA 4LJPB 2J0JA 2IBIB 1WRDB 1GUAB 2LGDA 4B95A 3MHSD 2MCNB 1RRBA 2B3AA 4N9F4 4G3XB 3UIPB 2KFJA 3DVNV 2KLCA 3R7RA 4CHKA 3QIJA 3V6EB 2KQ7A 4NY0A 1L2NA 4GDLB 4WQOB 1P3QU 2A5UA 4NQLB 3DBLI 2LWPA 2MBOA 2DENB 2N1WA 4ANUA 4F8CB 2KXJA 3ZNHB 4DHJD 2KANA 1E8YA 4F7ZA 1E5WA 1UD7A 2N7DA 2WX1A 4EUTA 2LD9A 2V4LA 4G0NB 3NS8A 5EDSA 2AL3A 3VH4B 1EO6A 5LXIB 4BVUC 5AZHA 1UBQA 3A4RA 3KUCB 1SGHA 2BF8B 3BINA 2KTFA 2MP2B 2CU1A 3WIMA 2KHWB 2LVQA 5G55A 3AU5A 3RULA 2J0MA 1GNUA 1EF1A 2ASQA 2KDEB 4W9EA 1NI2A 2KNBA 2XK5A 1LM8B 4YL8A 3QQ8B 5E6OA 4W9DA 3X0WA 4NAWB 4XC2A 4GDKA 3TCAA 4A3OA 4CO7A 5DPRA 3PZDA 1ZW7A 3RUIB 5TR5A 2MBHA 2EKEC 3VFKA 4HCNB 2ZVOA 4EFOA 3PLVA 1XT9B 2K25A 2KDIA 5D7GA 3ZLZA 2DHZA 1EF5A 4DK5A 3QC8B 4ANWA 4K1RB 2YVCA 3A4SC 3NHEB 1L7YA 2JZZA 3ZNZB 5KHOA 3TIXA 1YQBA 2LXCA 2MBBB 4BOZB 3JVZX 3SDLC 3M63B 5D2MB 5JH5C 2PE9A 2L0FA 1TGZB 1AARA 3T9LA 3VUYA 2JF5A 2ZNVC 2K1FA 3R3MA 2JXXA 4WJOA 2ZNVB 3ZIMA 1WH3A 2UWQA 1WZ3A 1UBIA 4GIVA 3VTUA 1TZ1A 2ZCCA 3B08A 3PSEB 2L00B 4GOCA 2KD0A 2MQJA 3A9KA 3HK0A 3UQBA 2I1KA 3Q3FA 2WWZA 3QWZB 2XBBC 3DDCB 1WGYA 4PS8A 4BKTA 1H8CA 3WAOA 4G11A 2RR9A 4A20A 4KV2A 5DPWA 1T0YA 2RPQA 3DOWA 2FCNA 4WWOA 3WAMA 2GOWA 2WYQA 4TV3A 1V9JA 1WIAA 2KTRA 3A9JB 4XZ4A 3WA0A 2KMAA 4GDLA 3DVNU 4HVBA 2KX3A 2JRIB 2M1MA 2KWCA 1LQBA 4BFRA 3NY5A 1Q0WB 2C5LC 2LGYA 2MWSB 2NS5A 2FCMA 2K8BA 2NPTB 4DHZB 4W9IA 4MEMA 4FJVB 3U8ZA 5DCNA 2AYOB 2L76A 2M8SA 1WR6E 4HWIB 5J17A 3QA8A 2C9WB 4ICVA 3H7SA 4IUMB 2G45B 2HTHA 4HK2A 2DAFA 3EHVA 4II3B 2DZJA 2KZRA 3ZNID 1V5OA 4DWFA 4FADA 3AI5A 2FCQA 1VCBA 4DXAB 5JHBA 2MP2A 3JSVB 2O6VB 2Y5BB 4W9FA 5D6JB 4LJOB 1WY8A 2KJHB 1ISNA 4JL9A 4K7WA 4EZKA 3OLMD 4KIKB 5AZGA 2C7HA 4FA6A 4I6LB 3C0RB 2JT4B 2G4SA 4LDTD 4NAWA 4WAAA 3QK0A 2ZEQA 4PYZA 1GJZA 3VHTC 1WGRA 2BKFA 2JZ3B 1Z5SB 3DCGA 1WJNA 2D3GA 4BKGA 2LGXA 4W9GA 1RAXA 1Q5WB 1GG3A 4FJZA 1U4AA 4JQWC 3V61A 5HKHA 1TBEA 3I3TB 4I6NB 3WAPA 3N30A 2GBRA 2GBMA 2L8JA 3NOBA 3PHXB 3VTWA 1J19A 3PREA 3M95A 3ZO5B 2ZCBA 3UGBB 3A1QA 2KO3A 4MJSB 2A4ZA 2CS4A 1E8XA 5LLIA 3PGEA 4DHZE 3TL5A 1XD3B 3UQAA 3RYTA 2KN5A 2LUEA 5CHWA 2BWFA 3UF8A 3ZDMC 4AWJA 2M0XA 5CTRC 3PTFC 2DZIA 4WJPA 5BO4B 4BBNF 5L83A 3ZNGC 4GN1A 2L7RA 3VUXA 2KOXA 4KSLC 2XEWA 3HM3A 2IY0B 3JW0X 3ZDTA 5LXHA 1E8ZA 3MTNB 3KVFB 3O65B 2KQSA 4OVUA 3ZW3A 4E74A 1OQYA 3ZKJC 1C3TA 4K81A 2D2QA 2I1JA 1S1QB 3QARA 2CHXA 1WXMA 4RM9A 4EZLA 2CKHB 4ZRIA 2ZZPB 1V80A 3L54A 2K39A 4K7SA 3VDZA 2N7EA 2KKCA 3DPDA 3EFUA 1V81A 3LJ3A 3V6CB 3OJ4B 3ZTDA 2FAZA 2FIDA 2GBNA 4GGQA 4X57B 3LDZE 2J0KA 5CX3A 4NNJB 1WI0A 2O2VB 3QHTA 1YD8U 4P7IA 2DYBA 2KC2A 3B0AA 2V1YA 3D32A 4W9HA 1Q1OA 5GMVA 2D11A 2PPHA 2DX5B 3JSVA 2KVRA 1J0GA 1WMHB 4II2B 2V3SA 3ZVVA 2MW5A 3JYUA 1WM2A 2FIFA 2QHOA 3RD2A 4ZDVA 4NJ7A 3HM6X 2MRPA 1WGGA 4AJWA 4AUQC 3IFWB 5FR6A 3AULA 1UZXB 4TQ1A 5AEKB 4HDOA 3PRMB 4M8MA 4JLCA 4MDKE 2DZMA 4OVVA 1C1YB 5D94A 3R7QA 2KFKB 1WJ6A 1YX5B 5C23A 1KLVA 4DDGD 1SE9A 4ZRJA 4ANXA 5C1ZA 1E7VA 3WANA 1WGDA 2LVOA 4W9CA 3P2BA 2LZ6A 2NBVB 3V60A 4MJSA 4A3PA 1WXAA 2KLGA 5JHAA 5DPTA 4IC7B 4RMAA 3PRPB 3L10B 2DYMA 4CYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBK A;  3AU4 A;  1P9D U;  2K6D B;  4KZ0 A;  1I35 A;  1WF9 A;  2JRH A;  4RM8 A;  3W1S C;  3A33 B;  2KWU B;  3IBE A;  1VD2 A;  1V6E A;  1WZ0 A;  3KUZ A;  4KDI C;  2AL6 A;  3VVW B;  4FHJ A;  2GBJ A;  4GB9 A;  4KVG B;  2AEH A;  1WX8 A;  1XQQ A;  4WJN A;  2BYE A;  1YJ1 A;  2WDT B;  3K9O B;  3QAQ A;  1R4N I;  3CSF A;  2L0T A;  2IZV B;  4EOY A;  4KDL B;  4WJQ A;  1PQS A;  2ZPY A;  1WR1 A;  3OAW A;  2RSU A;  2XK5 B;  2PE6 B;  5G2N A;  2MBQ A;  5CHF A;  4LCD E;  2R2O A;  1E7U A;  3IVF A;  2N9P C;  1BT0 A;  3PLU A;  3MJW A;  4GDK B;  1YIW A;  3BY4 B;  4MEL A;  3U30 A;  1I42 A;  3X23 A;  3T8M A;  2FCS A;  4TKN A;  1YX6 B;  3DBS A;  4JGH B;  4NPN A;  2IO0 B;  5CHV C;  1WYW B;  2AWT A;  1LXD A;  3RCZ A;  5JZE B;  2IY1 B;  4IM0 A;  3WAL A;  4DHJ B;  2IO1 B;  2NBU A;  2BGF A;  3APC A;  3ENE A;  3KYD D;  4GMV A;  4BKS D;  3ALB A;  3Q3J A;  1UH6 A;  4ASW C;  1WMH A;  1LFD A;  2RGF A;  3IG3 A;  4HLE A;  2CR5 A;  2D07 B;  4EKU A;  2N9X A;  2ZVN A;  2BYF A;  1OEY A;  2HJ8 A;  2GMI C;  3HHM A;  3OJ3 A;  1IYF A;  4IWQ A;  3PS6 A;  3H7P B;  1ZGU B;  1V49 A;  3TJP A;  3L17 A;  4HXD A;  3PT2 B;  4MGK E;  2MLB A;  3S2A A;  2MX2 A;  3DBR I;  4AOF A;  4PS3 A;  3M3J A;  2PJH A;  2UYZ B;  3A9K B;  2MSE D;  2KFK A;  1TTN A;  2O6V D;  4HPM B;  2L05 A;  3EEC A;  2RD0 A;  3N32 A;  3PHW B;  3SU8 X;  4FN2 A;  1H4R A;  1Y8R C;  1RFA A;  1P98 A;  3DQV A;  5J18 A;  2BWE S;  5E6N A;  4AP4 C;  3QJZ A;  3ZUN A;  5IAA C;  1GC6 A;  3M62 B;  1S3S G;  2LVP A;  3PVL A;  2KTR B;  3QX1 A;  3SHQ A;  4DDI D;  1J8C A;  1WX7 A;  2G4D B;  3A9J A;  2D10 A;  3VXW A;  1R4M I;  2DYO A;  3N3K B;  4BKS A;  2KJR A;  4E71 A;  2N1V A;  4W9J A;  1E90 A;  2MA9 B;  3EC8 A;  3H6N A;  1Z2M A;  3TBL D;  2FNJ B;  3NZU A;  3UIN B;  1F9J A;  4ZYN A;  2NCN A;  2NPT A;  3GZN I;  4HJK A;  1KOT A;  2EMS A;  1P0R A;  3W1S A;  1FXT B;  1EUV B;  2LRW A;  4MM3 A;  4F1S A;  2LRU A;  4TUU A;  2WX0 A;  4AJY B;  3L0W B;  3KH0 A;  4MGZ E;  3RT3 B;  2KJ6 A;  4M8N A;  5DPS A;  2MBE A;  3TMP B;  4MGY E;  3ZRF A;  2HD5 B;  2O6V A;  3PRZ A;  4J6I A;  3PPA A;  5E6P A;  1NDD A;  2N9E B;  2NVU I;  1RLF A;  3ZRC A;  4IG7 B;  3PV1 A;  2BKR B;  4DBG A;  3AXC A;  4KIK A;  2C7N B;  2JY6 A;  4IM3 A;  3L16 A;  3SD5 A;  1G6J A;  3H1U A;  4JIO U;  3K9P B;  2L3Z A;  2KC1 A;  2Z59 B;  1WM3 A;  5KHQ A;  4URK A;  4PYU A;  4BBN C;  1WJ4 A;  2CHZ A;  2KDF B;  3KUD B;  1WXV A;  2OJR A;  4FHK A;  1V2Y A;  4IW0 A;  2J7Q B;  1K8R B;  4XX5 A;  2LJ5 A;  4ANV A;  5IA7 A;  3ZTC A;  2W9N A;  1QZE A;  2M17 A;  2EMT A;  3V62 A;  4M0W B;  2KX0 A;  2KMC A;  4W9L A;  4B6W A;  1A5R A;  3W1Y A;  4K7U A;  3CST A;  4G50 A;  5AZF A;  3A1Q B;  3H7P A;  2Z0E B;  4ICU A;  3IHP C;  1WE6 A;  2C7M B;  2CHW A;  2NBW B;  4EZJ A;  3DVG Y;  4E3C A;  2DZK A;  4WWN A;  1UEL A;  3ECI A;  2N4F A;  1CMX B;  3B1L X;  1OTR B;  3CMM B;  3VH3 B;  3KW5 B;  4HDQ A;  1V86 A;  4WWP A;  4ZRK A;  1E8W A;  1NBF C;  1WE7 A;  1WXS A;  2PEA A;  2R2Q A;  4MGI E;  3RZW C;  4FBJ B;  2LXA A;  4NQK E;  4GXB A;  1WX9 A;  4BOS C;  3DVG X;  1IPG A;  4FLH A;  4LDT B;  2KK8 A;  1GC7 A;  1JRU A;  1D3Z A;  2LI5 A;  1SIF A;  2BYV E;  3APF A;  3RZF A;  1M94 A;  2REX A;  2IO2 B;  4IM2 A;  4IWP A;  3ML9 A;  2K6Q A;  4MH0 E;  1MG8 A;  3HIZ A;  2K8H A;  3VQI A;  1P1A A;  2LAS A;  4FJY A;  2NR2 A;  2JWZ A;  2G3Q B;  1ZKH A;  3ML8 A;  3VUW A;  3DBH I;  4KSK C;  4HCP B;  4KZC A;  3QCA A;  3CF6 E;  2C60 A;  3ONS A;  2ZPN A;  1HE8 A;  4FUL A;  1IP9 A;  2O2V A;  2OOB B;  1OEY J;  5J2R A;  1V5T A;  3L13 A;  1KJT A;  2K8C A;  1WGH A;  4B9K A;  3KYC D;  2DAJ A;  1KM7 A;  2JVC A;  2BPS A;  1UGM A;  2M4N A;  4TQ0 A;  4GSW A;  2Z0D B;  1WFY A;  4IWO A;  4PS7 A;  4MSQ B;  3H9D A;  3UIO B;  3VTV A;  3U7D A;  2IYD B;  2FUH B;  3R66 C;  2IO3 B;  2KDB A;  4NJ6 A;  3NZS A;  4MSM B;  2YLM A;  2VRR B;  1X1M A;  2ZJD A;  3APD A;  4GU2 A;  4W9K A;  3GOE A;  3L08 A;  2KWV B;  5L95 C;  1WJU A;  3VAW A;  2HE7 A;  4HPL B;  4I6P A;  2JUO A;  4EEW A;  1OGW A;  2JPH A;  4LJP B;  2J0J A;  2IBI B;  1WRD B;  1GUA B;  2LGD A;  4B95 A;  3MHS D;  2MCN B;  1RRB A;  2B3A A;  4N9F 4;  4G3X B;  3UIP B;  2KFJ A;  3DVN V;  2KLC A;  3R7R A;  4CHK A;  3QIJ A;  3V6E B;  2KQ7 A;  4NY0 A;  1L2N A;  4GDL B;  4WQO B;  1P3Q U;  2A5U A;  4NQL B;  3DBL I;  2LWP A;  2MBO A;  2DEN B;  2N1W A;  4ANU A;  4F8C B;  2KXJ A;  3ZNH B;  4DHJ D;  2KAN A;  1E8Y A;  4F7Z A;  1E5W A;  1UD7 A;  2N7D A;  2WX1 A;  4EUT A;  2LD9 A;  2V4L A;  4G0N B;  3NS8 A;  5EDS A;  2AL3 A;  3VH4 B;  1EO6 A;  5LXI B;  4BVU C;  5AZH A;  1UBQ A;  3A4R A;  3KUC B;  1SGH A;  2BF8 B;  3BIN A;  2KTF A;  2MP2 B;  2CU1 A;  3WIM A;  2KHW B;  2LVQ A;  5G55 A;  3AU5 A;  3RUL A;  2J0M A;  1GNU A;  1EF1 A;  2ASQ A;  2KDE B;  4W9E A;  1NI2 A;  2KNB A;  2XK5 A;  1LM8 B;  4YL8 A;  3QQ8 B;  5E6O A;  4W9D A;  3X0W A;  4NAW B;  4XC2 A;  4GDK A;  3TCA A;  4A3O A;  4CO7 A;  5DPR A;  3PZD A;  1ZW7 A;  3RUI B;  5TR5 A;  2MBH A;  2EKE C;  3VFK A;  4HCN B;  2ZVO A;  4EFO A;  3PLV A;  1XT9 B;  2K25 A;  2KDI A;  5D7G A;  3ZLZ A;  2DHZ A;  1EF5 A;  4DK5 A;  3QC8 B;  4ANW A;  4K1R B;  2YVC A;  3A4S C;  3NHE B;  1L7Y A;  2JZZ A;  3ZNZ B;  5KHO A;  3TIX A;  1YQB A;  2LXC A;  2MBB B;  4BOZ B;  3JVZ X;  3SDL C;  3M63 B;  5D2M B;  5JH5 C;  2PE9 A;  2L0F A;  1TGZ B;  1AAR A;  3T9L A;  3VUY A;  2JF5 A;  2ZNV C;  2K1F A;  3R3M A;  2JXX A;  4WJO A;  2ZNV B;  3ZIM A;  1WH3 A;  2UWQ A;  1WZ3 A;  1UBI A;  4GIV A;  3VTU A;  1TZ1 A;  2ZCC A;  3B08 A;  3PSE B;  2L00 B;  4GOC A;  2KD0 A;  2MQJ A;  3A9K A;  3HK0 A;  3UQB A;  2I1K A;  3Q3F A;  2WWZ A;  3QWZ B;  2XBB C;  3DDC B;  1WGY A;  4PS8 A;  4BKT A;  1H8C A;  3WAO A;  4G11 A;  2RR9 A;  4A20 A;  4KV2 A;  5DPW A;  1T0Y A;  2RPQ A;  3DOW A;  2FCN A;  4WWO A;  3WAM A;  2GOW A;  2WYQ A;  4TV3 A;  1V9J A;  1WIA A;  2KTR A;  3A9J B;  4XZ4 A;  3WA0 A;  2KMA A;  4GDL A;  3DVN U;  4HVB A;  2KX3 A;  2JRI B;  2M1M A;  2KWC A;  1LQB A;  4BFR A;  3NY5 A;  1Q0W B;  2C5L C;  2LGY A;  2MWS B;  2NS5 A;  2FCM A;  2K8B A;  2NPT B;  4DHZ B;  4W9I A;  4MEM A;  4FJV B;  3U8Z A;  5DCN A;  2AYO B;  2L76 A;  2M8S A;  1WR6 E;  4HWI B;  5J17 A;  3QA8 A;  2C9W B;  4ICV A;  3H7S A;  4IUM B;  2G45 B;  2HTH A;  4HK2 A;  2DAF A;  3EHV A;  4II3 B;  2DZJ A;  2KZR A;  3ZNI D;  1V5O A;  4DWF A;  4FAD A;  3AI5 A;  2FCQ A;  1VCB A;  4DXA B;  5JHB A;  2MP2 A;  3JSV B;  2O6V B;  2Y5B B;  4W9F A;  5D6J B;  4LJO B;  1WY8 A;  2KJH B;  1ISN A;  4JL9 A;  4K7W A;  4EZK A;  3OLM D;  4KIK B;  5AZG A;  2C7H A;  4FA6 A;  4I6L B;  3C0R B;  2JT4 B;  2G4S A;  4LDT D;  4NAW A;  4WAA A;  3QK0 A;  2ZEQ A;  4PYZ A;  1GJZ A;  3VHT C;  1WGR A;  2BKF A;  2JZ3 B;  1Z5S B;  3DCG A;  1WJN A;  2D3G A;  4BKG A;  2LGX A;  4W9G A;  1RAX A;  1Q5W B;  1GG3 A;  4FJZ A;  1U4A A;  4JQW C;  3V61 A;  5HKH A;  1TBE A;  3I3T B;  4I6N B;  3WAP A;  3N30 A;  2GBR A;  2GBM A;  2L8J A;  3NOB A;  3PHX B;  3VTW A;  1J19 A;  3PRE A;  3M95 A;  3ZO5 B;  2ZCB A;  3UGB B;  3A1Q A;  2KO3 A;  4MJS B;  2A4Z A;  2CS4 A;  1E8X A;  5LLI A;  3PGE A;  4DHZ E;  3TL5 A;  1XD3 B;  3UQA A;  3RYT A;  2KN5 A;  2LUE A;  5CHW A;  2BWF A;  3UF8 A;  3ZDM C;  4AWJ A;  2M0X A;  5CTR C;  3PTF C;  2DZI A;  4WJP A;  5BO4 B;  4BBN F;  5L83 A;  3ZNG C;  4GN1 A;  2L7R A;  3VUX A;  2KOX A;  4KSL C;  2XEW A;  3HM3 A;  2IY0 B;  3JW0 X;  3ZDT A;  5LXH A;  1E8Z A;  3MTN B;  3KVF B;  3O65 B;  2KQS A;  4OVU A;  3ZW3 A;  4E74 A;  1OQY A;  3ZKJ C;  1C3T A;  4K81 A;  2D2Q A;  2I1J A;  1S1Q B;  3QAR A;  2CHX A;  1WXM A;  4RM9 A;  4EZL A;  2CKH B;  4ZRI A;  2ZZP B;  1V80 A;  3L54 A;  2K39 A;  4K7S A;  3VDZ A;  2N7E A;  2KKC A;  3DPD A;  3EFU A;  1V81 A;  3LJ3 A;  3V6C B;  3OJ4 B;  3ZTD A;  2FAZ A;  2FID A;  2GBN A;  4GGQ A;  4X57 B;  3LDZ E;  2J0K A;  5CX3 A;  4NNJ B;  1WI0 A;  2O2V B;  3QHT A;  1YD8 U;  4P7I A;  2DYB A;  2KC2 A;  3B0A A;  2V1Y A;  3D32 A;  4W9H A;  1Q1O A;  5GMV A;  2D11 A;  2PPH A;  2DX5 B;  3JSV A;  2KVR A;  1J0G A;  1WMH B;  4II2 B;  2V3S A;  3ZVV A;  2MW5 A;  3JYU A;  1WM2 A;  2FIF A;  2QHO A;  3RD2 A;  4ZDV A;  4NJ7 A;  3HM6 X;  2MRP A;  1WGG A;  4AJW A;  4AUQ C;  3IFW B;  5FR6 A;  3AUL A;  1UZX B;  4TQ1 A;  5AEK B;  4HDO A;  3PRM B;  4M8M A;  4JLC A;  4MDK E;  2DZM A;  4OVV A;  1C1Y B;  5D94 A;  3R7Q A;  2KFK B;  1WJ6 A;  1YX5 B;  5C23 A;  1KLV A;  4DDG D;  1SE9 A;  4ZRJ A;  4ANX A;  5C1Z A;  1E7V A;  3WAN A;  1WGD A;  2LVO A;  4W9C A;  3P2B A;  2LZ6 A;  2NBV B;  3V60 A;  4MJS A;  4A3P A;  1WXA A;  2KLG A;  5JHA A;  5DPT A;  4IC7 B;  4RMA A;  3PRP B;  3L10 B;  2DYM A;  4CYE A; 
#chains in the Genus database with same CATH topology
 3AU4 A;  2BQQ A;  4KZ0 A;  1WGK A;  1OQQ A;  3A33 B;  1E9M A;  1WZ0 A;  4KVG B;  4NZL B;  4WJN A;  1R4N B;  5HI1 A;  3CSF A;  2L0T A;  4WAF A;  4KDL B;  1PQS A;  5IOI A;  5CHF A;  2GI9 A;  2R2O A;  2N9P C;  1JW9 D;  3SFD B;  2VH1 A;  3BY4 B;  2BW2 A;  2WXN A;  4TKN A;  1I4G A;  3DHG C;  2IO0 B;  5CHV C;  2HJ1 A;  2NBU A;  5EE3 A;  3APC A;  3H8H A;  4GMV A;  3Q3J A;  2OHF A;  2RGF A;  2RPV A;  4IWQ A;  3PS6 A;  2DNF A;  4HXD A;  3S2A A;  3DBR I;  2PJH A;  4BZA A;  2UYZ B;  2TSS A;  3I5J C;  2MSE D;  1T3Q A;  1FCC C;  3NVV A;  2L05 A;  2JYE A;  3EEC A;  1TY0 A;  2J4X A;  2RD0 A;  3P63 A;  1RFA A;  2WXH A;  1XLP A;  3ZUN A;  1GC6 A;  2J42 A;  2WU5 B;  4DDI D;  3PVL A;  1FD6 A;  3VXW A;  1R4M I;  3BYY B;  3NZU A;  1F9J A;  3AE5 B;  2NCN A;  1IGD A;  1P0R A;  3W1S A;  2LRW A;  5BYR A;  4AJY B;  5BMG A;  3P42 A;  2MBE A;  2O6V A;  1XLQ A;  5E6P A;  3ZRC A;  2BYT A;  3EUB 2;  2C7N B;  4IM3 A;  3SD5 A;  3H1U A;  3AEG B;  4BBN C;  4IW0 A;  1V2Y A;  1K8R B;  5IA7 A;  2LJ5 A;  3ZTC A;  1QZE A;  4M0W B;  2KX0 A;  4ARI A;  4B6W A;  4A55 A;  3W1Y A;  3CST A;  5AZF A;  3MC8 A;  1JML A;  3A1Q B;  3H7P A;  2Z0E B;  4HPP A;  4LK0 M;  1HXY D;  3IHP C;  2CHW A;  3DVG Y;  4E3C A;  4WWN A;  1JRO A;  3CMM B;  1YN3 A;  4TMA B;  1EM7 A;  3KW5 B;  4HDQ A;  1V86 A;  4ZRK A;  1NEN B;  1WXS A;  5EE1 A;  3RZW C;  4NQK E;  1WX9 A;  4LDT B;  1JRU A;  2LI5 A;  1TIF A;  1SIF A;  2BYV E;  2K0P A;  1M94 A;  2ACZ B;  4H2A A;  2JU6 X;  4XDC A;  2K8H A;  3VQI A;  1P1A A;  2JWZ A;  3VUW A;  3ML8 A;  1LGR A;  4RF0 A;  3QCA A;  1NI3 A;  2O2V A;  3BII D;  1OEY J;  1TYG B;  3ZJU A;  2K8C A;  3Q3O C;  3KYC D;  2JVC A;  3TEX A;  2BPS A;  1UGM A;  4GSW A;  2Z0D B;  1FEH A;  4PS7 A;  3H9D A;  1IBX A;  4XGA B;  3VTV A;  2IO3 B;  4NJ6 A;  3NZS A;  4MSM B;  3APD A;  1XEE A;  1K51 A;  3NVZ A;  1KFY B;  2JUO A;  4EEW A;  2JPH A;  4K3B A;  3MHS D;  1SEB D;  3UQA A;  4G3X B;  4QAY A;  2KFJ A;  2KLC A;  1R4M B;  4ANU A;  3TSS A;  3PZ8 A;  2KXJ A;  4F7Z A;  1UD7 A;  2N7D A;  2IGG A;  4EUT A;  4G0N B;  2V4L A;  2AL3 A;  1TS4 A;  2WXR A;  4BVU C;  5AZH A;  1RWS A;  3KUC B;  3BK2 A;  1JAL A;  4MT5 A;  5IP4 D;  4HKZ E;  2LVQ A;  1SF0 A;  1I4R A;  1LM8 B;  4YL8 A;  3TCA A;  4CO7 A;  2BB6 A;  5H8Y E;  2MBH A;  2J52 A;  1E6E B;  1XT9 B;  4DK5 A;  4RCO A;  1KTK A;  2QMT A;  4K1R B;  1M4V A;  2LXC A;  4JWU C;  4MH8 A;  3MP9 A;  1AAR A;  3VUY A;  1CQV A;  2ZNV B;  1SBB B;  2XN9 C;  4YSX B;  1WH3 A;  2UWQ A;  2JX5 A;  3PSE B;  4GOC A;  2WWZ A;  3NZ3 A;  2BT6 A;  4PS8 A;  3GE3 C;  2MJE A;  4WH4 A;  1XF5 L;  3DOW A;  3WAM A;  2GOW A;  1V9J A;  2KTR A;  2E3T A;  2PLP A;  3ZXR A;  4XE0 A;  3DVN U;  2M1M A;  2AX5 A;  3N1Z C;  5GXG B;  2NS5 A;  4W9I A;  2V3P A;  1N61 A;  4FJV B;  1KRH A;  1FPY A;  2L52 A;  2M56 B;  3H7S A;  2G45 B;  4HK2 A;  2KZR A;  3Q8A A;  4DWF A;  2O6V B;  5D6J B;  4W9F A;  2X8X X;  4YSZ B;  1WY8 A;  3OLM D;  4M00 A;  1J7C A;  4FA6 A;  3C0R B;  1I4P A;  4WAA A;  4PYZ A;  1GJZ A;  1YOV B;  2DBY A;  2JZ3 B;  1Z5S B;  1WJN A;  4W9G A;  1I7H A;  1U4A A;  2Y5P A;  3W9C B;  1RM6 C;  4I6N B;  3Q8E A;  2L8J A;  1VRA B;  3ABV B;  2CS4 A;  3PGE A;  4DHZ E;  3TL5 A;  1IGC A;  3RYT A;  2WXP A;  2LUE A;  2BWF A;  3UF8 A;  3ZDM C;  3GS2 A;  1GAQ B;  4AS1 A;  5EE9 A;  2LMC A;  1YN4 A;  1PUT A;  4WJP A;  5L83 A;  2JSV X;  2B76 B;  1D5M C;  2KOX A;  4RF1 A;  3ZDT A;  1E8Z A;  3KVF B;  3O65 B;  2KQS A;  4OVU A;  4E74 A;  3IXS A;  1SJE D;  4IDI A;  1WXM A;  4RM9 A;  1V97 A;  4C4V A;  1JQ4 A;  2ZZP B;  1L0Y B;  3VRA B;  3NG0 A;  1V81 A;  3OJ4 B;  2FAZ A;  2GBN A;  3LDZ E;  2O2V B;  3RNA C;  4RH6 A;  2DYB A;  2KMM A;  2DX5 B;  1J0G A;  1FFV A;  2V3S A;  1I4X A;  3JYU A;  1WM2 A;  2FIF A;  2WDV B;  2WNM A;  2WHI A;  1IBX B;  3IAM 1;  4XDD A;  1TS5 A;  1WGG A;  4N59 A;  3BVM A;  3IFW B;  2INC C;  4LLG M;  1T0Q C;  1FNV A;  3BYT B;  4CQN A;  4JLC A;  2DZM A;  2JXT A;  3AE3 B;  3R7Q A;  3ETR A;  5C23 A;  1F2R C;  4ZRJ A;  1UUP A;  2NBV B;  4MJS A;  4A3P A;  3LXF A;  4S0R A;  3L10 B;  1ET6 A;  2IJ0 A;  1WF9 A;  3RI7 C;  1F52 A;  4RM8 A;  3IBE A;  1NYQ A;  4RNA A;  2AL6 A;  3VVW B;  4FHJ A;  3CWI A;  2AEH A;  1WX8 A;  1TZO A;  1TKE A;  3AEE B;  4KX6 B;  1YJ1 A;  1R4N I;  4EOY A;  2ZPY A;  1WR1 A;  3Q3N C;  4LCD E;  1NEK B;  3HUI A;  1E7U A;  3IVF A;  3MJW A;  3U30 A;  4MEL A;  3T8M A;  1YX6 B;  3FC4 A;  3KWV A;  4JGH B;  4NPN A;  1HEZ E;  3RCZ A;  1N63 A;  1NVI D;  2QDF A;  2XNA C;  4IM0 A;  4DHJ B;  2BGF A;  3KYD D;  4BKS D;  1JRP A;  4ASW C;  1WMH A;  1LFD A;  2J53 A;  4EKU A;  2ZVN A;  3ZGZ A;  1IYF A;  3OJ3 A;  3AH7 A;  1VLB A;  1AN8 A;  3Q69 A;  3PT2 B;  1VDV A;  5FK9 C;  2KFK A;  2MJ3 A;  5FKA C;  4HPM B;  1XXG A;  1Y8R C;  3EGR A;  5J18 A;  2BWE S;  5E6J A;  4LNI A;  5E6N A;  2WDQ B;  3M62 B;  2KTR B;  3SHQ A;  4DXG A;  3ZJV A;  1E90 A;  3EC8 A;  1Z2M A;  3GE8 C;  4ZYN A;  1FFU A;  1JWM D;  2EMS A;  3ZXV A;  4MM3 A;  3R2T A;  4TUU A;  3TUO A;  1I4Q A;  2N9L A;  3DHI C;  4UDU C;  1N6Z A;  2HD5 B;  3EFC A;  2FE8 A;  4J6I A;  1NDD A;  1J7B A;  2KDM A;  2NVU I;  3U2S C;  4IG7 B;  1BUI C;  4DBG A;  4KIK A;  2INN E;  2LGI A;  1TS3 A;  3R8B A;  5KHQ A;  1WM3 A;  4URK A;  1WJ4 A;  1E0Z A;  2CHZ A;  3KUD B;  4FHK A;  4ANV A;  3T3N A;  2KT7 A;  2W9N A;  2M17 A;  5HHD G;  4WUR A;  1YJJ A;  2LJI A;  3HRD D;  3W2D A;  2KMC A;  1F0Z A;  4W9L A;  1A5R A;  4ZRP A;  4GLS C;  4K7U A;  1GOZ A;  4C00 A;  3B2G A;  1WE6 A;  2KAC A;  2D5G A;  1VZ7 A;  1HQR D;  2G1E A;  4ZRQ A;  3B1L X;  3DWM A;  4Q2J A;  1C76 A;  3AEC B;  1NBF C;  1WE7 A;  2R2Q A;  4MGI E;  2CJO A;  2RDG A;  2BVC A;  1D6E C;  1N60 A;  2KK8 A;  3MHZ A;  2KQ4 X;  3RZF A;  1VZ8 A;  2REX A;  1PGX A;  4L23 A;  2IO2 B;  4IWP A;  4C4V B;  2K6Q A;  1Y56 A;  3N9Y C;  3DBH B;  2HTM E;  1FRR A;  1FXA A;  2W3R A;  4HCP B;  4KZC A;  4KGS A;  3CF6 E;  4P1B C;  2UU7 A;  3AM9 A;  1V5T A;  3L13 A;  1KJT A;  3DHH C;  3HVD A;  1WGH A;  4B9K A;  2DAJ A;  2PVO D;  3LB8 C;  3OG5 A;  4IWO A;  1GPX A;  2IYD B;  1UGJ A;  4KGT A;  3BWU D;  1QF6 A;  2YLM A;  4W9K A;  1F77 A;  2WXJ A;  3VAW A;  3T3O A;  4HPL B;  1ZOY B;  2IBI B;  1WRD B;  1TKG A;  2MCN B;  1RRB A;  2B3A A;  3Q8B A;  3UIP B;  1ENF A;  3DVN V;  3R7R A;  4CHK A;  3V6E B;  2KQ7 A;  4NY0 A;  4GDL B;  4F8C B;  2MBO A;  3N1X C;  1UWM A;  3U4E G;  1SB3 C;  1FO4 A;  1MVK A;  2FBW B;  2PMV A;  1EO6 A;  1JCK B;  1EWY C;  1UBQ A;  3P4Q B;  2BF8 B;  1ET9 A;  4EE2 A;  3VR8 B;  5G55 A;  1EWC A;  3RUL A;  1GNU A;  1EF1 A;  2KDE B;  1NI2 A;  2KNB A;  2XK5 A;  5IKC M;  3Q3M C;  1YQ4 B;  3RUI B;  4B0E A;  3VRB B;  4EFO A;  2K25 A;  2KDI A;  2DHZ A;  1EF5 A;  1LO5 D;  4MAC A;  1L7Y A;  1YQB A;  4FXC A;  2WXQ A;  3M63 B;  5JH5 C;  2PE9 A;  1CK1 A;  4C7Y A;  2ZNV C;  4ACF A;  1WZ3 A;  4GIV A;  3VTU A;  4OVZ A;  4A9A A;  4ZOH C;  3B08 A;  2KD0 A;  3A9K A;  3HK0 A;  3UQB A;  3Q3F A;  3Q8C A;  3QWZ B;  3AE9 B;  1WGY A;  3WAO A;  4A20 A;  2QSD A;  4ARC A;  2RPQ A;  5G5H A;  2K22 A;  4TV3 A;  1SJH D;  1WIA A;  4XZ4 A;  3OWE B;  1MG4 A;  2KX3 A;  1LQB A;  2LGY A;  2K8B A;  4DHZ B;  5BYS A;  2L76 A;  4IUM B;  2LHE A;  2DZJ A;  1V5O A;  4TSS A;  4FAD A;  2MP2 A;  3JSV B;  4LJO B;  1SE4 A;  4RGN A;  2KJH B;  4JL9 A;  5HFY A;  1DGJ A;  4KIK B;  2QEJ C;  2JT4 B;  4LDT D;  4NAW A;  1FCL A;  3VHT C;  4JE3 B;  2IPK D;  2BKF A;  1AW7 A;  3IAS 1;  1Q5W B;  3AV8 A;  4JQW C;  1TBE A;  3I3T B;  3N30 A;  2GBR A;  1J19 A;  3PRE A;  1P7E A;  1IUE A;  5CHW A;  4AWJ A;  5CTR C;  2W82 A;  3U52 E;  4BBN F;  2ICI A;  2D3B A;  2WU2 B;  2IY0 B;  3JW0 X;  4LNF A;  2BB5 A;  3N20 C;  3BVG A;  4USA A;  1C3T A;  2I1J A;  2WGS A;  3C8Y A;  5C2T B;  1S1Q B;  4EZL A;  2CHX A;  2WLB A;  2CKH B;  4ZRI A;  2W3S A;  1N5W A;  4K7S A;  3DPD A;  3EFU A;  3LJ3 A;  1B1Z A;  3ZTD A;  4GGQ A;  5TSS A;  2SAK A;  2KYW A;  1ZXI A;  3B0A A;  2PVG C;  3KLS X;  3D32 A;  4W9H A;  3RFZ B;  3AE2 B;  2KVR A;  4II2 B;  2QHO A;  2ZW1 A;  3I63 C;  4NJ7 A;  3HM6 X;  2MRP A;  4AJW A;  4AUQ C;  1QIL A;  2ON8 A;  4M8M A;  1C1Y B;  4AQ7 A;  1YX5 B;  2WXL A;  4YT0 B;  4ANX A;  1E7V A;  2NTS A;  4LNN A;  1C79 A;  4JWS C;  1QOB A;  1L6V A;  1HTQ A;  1ZP0 B;  3R2I A;  2DYM A;  1QOA A;  2PKO A;  1VD2 A;  1V6E A;  2GBJ A;  2WDT B;  3QAQ A;  4B0M A;  2VZK B;  2XK5 B;  2PE6 B;  3AB5 A;  3GB1 A;  1YNT E;  3PLU A;  1YIW A;  3X23 A;  2FCS A;  1L4Z B;  2WXO A;  3RNC C;  2AWT A;  5JZE B;  2IY1 B;  3GP7 A;  3WAL A;  4M01 A;  4A90 A;  3ENE A;  3ALB A;  2JYT A;  5LNK 1;  2D07 B;  2N9X A;  2BYF A;  3HHM A;  2GMI C;  1C77 A;  3H7P B;  1NYR A;  3TJP A;  1SXT A;  1L4D B;  2K5P A;  4MGK E;  2MLB A;  2MX2 A;  4PS3 A;  3M3J A;  3A9K B;  2WS3 B;  1TTN A;  2WXM A;  2O6V D;  3MFG A;  4FN2 A;  3HVZ A;  1P98 A;  4AP4 C;  3QJZ A;  2M19 A;  1S3S G;  2LVP A;  3QX1 A;  1VZ6 A;  3W5V B;  3U7Z A;  3A9J A;  1KF6 B;  4ITK A;  3H6N A;  2ONQ A;  1AWD A;  3TBL D;  4C80 A;  2H88 B;  3C19 A;  5AUK A;  3GZN I;  1KOT A;  1V1O A;  4F1S A;  1UNS A;  1FXT B;  1QKZ A;  2Q5W D;  1HZ5 A;  3KH0 A;  3RT3 B;  4M8N A;  5DPS A;  4MGY E;  3ZRF A;  3MJ5 A;  4C56 C;  2YEP F;  1JWB D;  3PPA A;  4RGT A;  3AMZ A;  3PV1 A;  2BKR B;  2JY6 A;  1G6J A;  1C9F A;  1UF0 A;  4JIO U;  2Z59 B;  2SEB D;  1YJI A;  1FXI A;  1PYW D;  3V62 A;  1N62 A;  1YMH E;  4G50 A;  4ICU A;  2C7M B;  2NBW B;  1UEL A;  3ECI A;  1CMX B;  4WWP A;  4US8 A;  1OFF A;  2PEA A;  1C4C A;  2LXA A;  4BOS C;  3DVG X;  4FLH A;  4RFB A;  4JX1 C;  4N6E B;  1HZ6 A;  3ML9 A;  4O1N A;  4WIP A;  1MG8 A;  2LAS A;  3RNE C;  1RFK A;  4FJY A;  2NR2 A;  2G3Q B;  4OZA A;  3DBH I;  4KSK C;  1K52 A;  2R61 A;  3ONS A;  2ZPN A;  1HE8 A;  4FUL A;  5J2R A;  3AE6 B;  3RN9 C;  2D3A A;  1WFY A;  4WWM A;  1SE2 A;  4OZB A;  1ACC A;  2PIA A;  2IGH A;  3U7D A;  3FKY A;  2FUH B;  4A8X C;  1MI0 A;  1CZP A;  2N9K A;  2VRR B;  1X1M A;  2ZJD A;  3GOE A;  3AN1 A;  4RGO S;  1WJU A;  3NVW A;  1T6B X;  4M0W A;  4D2K A;  2LGD A;  1GUA B;  3NRZ A;  2BTE A;  4KKI A;  1D5Z C;  3QIJ A;  4OW0 A;  5I4D A;  1L2N A;  1WWT A;  4KGR A;  2WXF A;  1P3Q U;  2A5U A;  2N0S B;  2W54 A;  3ZNH B;  2V0G A;  4DHJ D;  2LEK A;  2KAN A;  3E56 A;  1E5W A;  1EU3 A;  2KN4 A;  1T0R C;  3GZN B;  2WX1 A;  2LD9 A;  2INP E;  5T8I A;  3A4R A;  1SGH A;  3BIN A;  2KTF A;  2CU1 A;  3BVZ A;  4C7Z A;  1J7A A;  2J0M A;  2QJL A;  2ASQ A;  3AE7 B;  3AEF B;  3QQ8 B;  5E6O A;  4W9D A;  4XC2 A;  4A3O A;  1L5P A;  4GDK A;  4P1C C;  5DPR A;  3PZD A;  1ZW7 A;  1DOX A;  2EKE C;  4HCN B;  3PLV A;  4P6V F;  3P1M A;  4ANW A;  3AE4 B;  2YVC A;  3A4S C;  3NHE B;  2JZZ A;  3ZNZ B;  4BOZ B;  5KHO A;  3TIX A;  1K50 A;  5C3J B;  3SDL C;  5D2M B;  3VR9 B;  1TT5 B;  3L4P A;  2NMQ A;  1TGZ B;  2BBC A;  3T9L A;  2JF5 A;  2JXX A;  1XLN A;  1TKY A;  4RGM A;  2BS3 B;  2ZCC A;  2H89 B;  1ESF A;  2QIL A;  2MQJ A;  2KAJ A;  1JWS D;  2WDR B;  1MPE A;  3DDC B;  4BKT A;  1H8C A;  2ZW0 A;  2V4I B;  3V3X A;  2GLS A;  1V1P A;  2CJN A;  1JWU D;  1L6U A;  2PTL A;  4LNO A;  1MHH E;  1XCQ L;  2WYQ A;  3A9J B;  2RDB C;  3WA0 A;  1Q0W B;  2FCM A;  3ZJT A;  1T0S C;  4PK1 A;  2KWD A;  5DCN A;  2BS2 B;  1HTO A;  1ZDV A;  4HWI B;  3QA8 A;  4ICV A;  2HTH A;  3B2F A;  3EHV A;  4II3 B;  3FAH A;  2DLB A;  3AI5 A;  1VCB A;  5JHB A;  2Y5B B;  3URY A;  3P4S B;  3DWG C;  2C7H A;  4I6L B;  4HKQ A;  3QK0 A;  5H92 C;  1ZPS A;  2NTT A;  3I57 A;  1WGR A;  1XCT L;  3DCG A;  4IOI E;  1VR9 A;  2QC8 A;  2D3G A;  4BKG A;  4HRS A;  2VH2 A;  3TEW A;  1HA5 A;  2LUM A;  4FJZ A;  3FIL A;  1V8C A;  3WAP A;  2GBM A;  1T5X D;  3PHX B;  2D3C A;  3VTW A;  3ZO5 B;  1SE3 A;  3IT6 B;  4OHJ A;  3UGB B;  4MJS B;  5LLI A;  4HRO A;  3P4P B;  4LTU A;  5D3I B;  1TJE A;  3PTF C;  2EEL A;  5BO4 B;  2AQ3 B;  2WP9 B;  1DOY A;  4GN1 A;  2L7R A;  2I38 A;  3SEB A;  1L0X B;  2XEW A;  1DOI A;  3HM3 A;  4ZYS A;  3MTN B;  1OQY A;  2RDH A;  4K81 A;  1FIQ A;  1VJK A;  2D2Q A;  4DXF A;  2WXG A;  4YSY B;  3QAR A;  2PW9 A;  3L54 A;  3VDZ A;  2N7E A;  2KKC A;  2K9X A;  3W5U B;  4X57 B;  4NNJ B;  1WI0 A;  3Q2A C;  3QHT A;  1YD8 U;  2KC2 A;  1Q1O A;  5GMV A;  2PPH A;  3TEY A;  1WMH B;  3ZVV A;  5JXV A;  1DYQ A;  1WYG A;  5FR6 A;  1UZX B;  5AEK B;  1K53 A;  3IT4 B;  4OVV A;  3MC9 A;  5D94 A;  4L2Y A;  2KFK B;  4P16 A;  1KLV A;  3WAN A;  1RYJ A;  4W9C A;  3P4R B;  1PGA A;  3N1Y C;  3P2B A;  3V60 A;  2KLG A;  1KLU D;  5DPT A;  4IC7 B;  3RNG C;  5AUI A;  4RMA A;  4CYE A;  2GBK A;  2LFI A;  1P9D U;  2K6D B;  1WRI A;  1I35 A;  2JRH A;  3W1S C;  1FM0 D;  2KWU B;  2LHD A;  2FUG 1;  4MM3 B;  3BZD B;  3KUZ A;  4KDI C;  3PO0 A;  2QCZ A;  4GB9 A;  4YTP B;  1XQQ A;  1SSN A;  2BYE A;  3K9O B;  2IZV B;  3AE8 B;  4WJQ A;  1GB4 A;  3OAW A;  2RSU A;  2M0A A;  3KQ4 A;  5G2N A;  2MBQ A;  1BT0 A;  1QOF A;  4GDK B;  1I42 A;  4R3D A;  1TS2 A;  2IGD A;  3DBS A;  2RMM A;  1WYW B;  2WXI A;  1LXD A;  2IO1 B;  4DQO C;  3RPF C;  2MJD A;  2K3U A;  1UH6 A;  4JPS A;  3IG3 A;  4HLE A;  5G5G A;  2CR5 A;  1FMA D;  1KLG D;  1OEY A;  2HJ8 A;  4KKJ A;  4A6Q A;  3UI3 A;  1ZGU B;  1V49 A;  3L17 A;  3DBR B;  4AOF A;  3NUH B;  2G9H D;  1D4B A;  3N32 A;  3SU8 X;  3PHW B;  1H4R A;  3RNF C;  3DQV A;  1XLO A;  3AED B;  1V1P B;  3BK1 A;  4HJG E;  5IAA C;  2JQR B;  1J8C A;  1WX7 A;  2G4D B;  2D10 A;  2DYO A;  3N3K B;  4BKS A;  2KJR A;  4E71 A;  3SFE B;  2N1V A;  4W9J A;  2MA9 B;  2L83 A;  2FNJ B;  3UIN B;  2NPT A;  4ZHO A;  4HJK A;  4IKG A;  1EUV B;  2LRU A;  2MHJ A;  2WX0 A;  4N58 A;  3L0W B;  4MGZ E;  1BML C;  2JZP A;  4REZ A;  2KJ6 A;  1ZXH A;  3TMP B;  4PT5 A;  2QIE B;  1R7S A;  3PRZ A;  3CIR B;  2N9E B;  1RLF A;  3AXC A;  3RNB C;  3L16 A;  1PFD A;  3K9P B;  2KC1 A;  2L3Z A;  4PYU A;  2KDF B;  1WXV A;  2OJR A;  4XX5 A;  2J7Q B;  3FIL B;  3Q6B A;  2EMT A;  1YQ3 B;  4NJC A;  2W55 A;  3SR6 A;  2CU3 A;  3I9V 1;  4EZJ A;  5IO9 A;  2DZK A;  2N4F A;  1OTR B;  1ZUD 2;  3VH3 B;  5BMH A;  1E8W A;  2IND C;  4FBJ B;  4M02 A;  4GXB A;  1D5X C;  1IPG A;  1GC7 A;  1D3Z A;  3APF A;  1C4P A;  4IM2 A;  3KWL A;  2KVZ A;  1XO3 A;  2LGS A;  1Q10 A;  4MH0 E;  4OZC A;  3HIZ A;  1WXQ A;  2AQ2 B;  3Q8F A;  2Y5C A;  4YXD B;  1ZKH A;  1MHX A;  1C78 A;  3Q14 C;  2C60 A;  1IP9 A;  2OOB B;  1E10 A;  1KM7 A;  2M4N A;  1OQR A;  4TQ0 A;  2Y3A A;  4MSQ B;  3UIO B;  3TEZ A;  3R66 C;  4HEA 1;  2KDB A;  4GU2 A;  1YN5 A;  3L08 A;  2KWV B;  5L95 C;  1FRD A;  2VZK D;  1FNW A;  2HE7 A;  4I6P A;  1OGW A;  4LJP B;  2J0J A;  1FNU A;  4B95 A;  4N9F 4;  1CJE A;  1F1H A;  4WQO B;  4NQL B;  2V3N A;  2LWP A;  2N1W A;  2DEN B;  3DBL I;  4XWT A;  1E8Y A;  4WQM A;  3NS8 A;  5EDS A;  5HG2 A;  3VH4 B;  5LXI B;  3EA6 A;  3WIM A;  2MP2 B;  2KHW B;  5BYQ A;  2EKI A;  3AU5 A;  4W9E A;  4XWW A;  1KH0 A;  3X0W A;  1GB1 A;  4NAW B;  1TY2 A;  2AQ1 B;  5TR5 A;  3VFK A;  2DWQ A;  2ZVO A;  5D7G A;  3ZLZ A;  3QC8 B;  2JWU A;  3AEB B;  2OED A;  1L0V B;  2MBB B;  2Z8L A;  1QT9 A;  4LNK A;  3JVZ X;  2L0F A;  3ZYY X;  2K1F A;  3R3M A;  4WJO A;  3ZIM A;  1UBI A;  3PZ7 A;  1TZ1 A;  2L00 B;  1STE A;  2I1K A;  1JWA D;  2WQY B;  2XBB C;  4L1B A;  5EE0 A;  1F2R I;  4ZHP A;  2E6X A;  4G11 A;  2RR9 A;  3J9C A;  4KV2 A;  5DPW A;  1T0Y A;  4YTN B;  4WWO A;  2FCN A;  3RMK C;  4K3C A;  2YEP B;  3B9J A;  3MC0 B;  2KMA A;  4GDL A;  4HVB A;  2L32 A;  2JRI B;  5FR3 A;  2KWC A;  4BFR A;  3NY5 A;  2C5L C;  2MWS B;  2NPT B;  4MEM A;  2OJW A;  3U8Z A;  5MPO A;  2AYO B;  1I4H A;  2M8S A;  1WR6 E;  1QLB B;  1UWX A;  5J17 A;  2C9W B;  1QQR A;  2DAF A;  3ZNI D;  2X38 A;  2IDY A;  4S17 A;  2FCQ A;  3LYY A;  4DXA B;  5BMI A;  1ISN A;  4K7W A;  1N5X A;  4EZK A;  5AZG A;  2G4S A;  3V05 A;  2ZEQ A;  2BS4 B;  3AEA B;  4YTM B;  2LGX A;  1RAX A;  1GG3 A;  2GRI A;  3V61 A;  3WCQ A;  5HKH A;  1MFW A;  2V9H A;  1BXT A;  3NOB A;  3M95 A;  4YWG G;  4NAM A;  1EU4 A;  2ZCB A;  3A1Q A;  2KO3 A;  2A4Z A;  1E8X A;  5D3D A;  1PDX A;  1WSP A;  1XD3 B;  2GB1 A;  2KN5 A;  3DBL B;  2M0X A;  2N7J A;  3E9S A;  2DZI A;  3O13 A;  3NVY A;  3ZNG C;  3NS1 A;  3VUX A;  4KSL C;  5LXH A;  3ZW3 A;  3ZKJ C;  1ZE3 D;  3ZQ4 A;  1AYF A;  3AE1 B;  1E7P B;  1PGB A;  1ZDX A;  1V80 A;  2K39 A;  2MEK A;  3V6C B;  2FID A;  1C4A A;  2J0K A;  5CX3 A;  1MJD A;  1B9R A;  1P7F A;  4P7I A;  2HDE A;  2V1Y A;  2D11 A;  4J3O D;  3JSV A;  1ROE A;  1A70 A;  2MW5 A;  3RD2 A;  4ZDV A;  3AUL A;  4TQ1 A;  4HDO A;  3PRM B;  4MDK E;  2WXK A;  1QOG A;  1SIJ A;  1WJ6 A;  4US9 A;  4DDG D;  4XYC A;  1SE9 A;  2I2Y A;  5C1Z A;  2L1A A;  5IN7 A;  1WGD A;  4BAX A;  2LVO A;  2LZ6 A;  3NJT A;  1WXA A;  5JHA A;  2MH7 A;  3PRP B; 
#chains in the Genus database with same CATH homology
 2GBK A;  3AU4 A;  1P9D U;  2K6D B;  4KZ0 A;  1I35 A;  1WF9 A;  2JRH A;  4RM8 A;  3W1S C;  3A33 B;  2KWU B;  3IBE A;  1VD2 A;  1V6E A;  1WZ0 A;  3KUZ A;  4KDI C;  2AL6 A;  3VVW B;  4FHJ A;  2GBJ A;  4GB9 A;  4KVG B;  2AEH A;  1WX8 A;  1XQQ A;  4WJN A;  2BYE A;  1YJ1 A;  2WDT B;  3K9O B;  3QAQ A;  1R4N I;  3CSF A;  2L0T A;  2IZV B;  4EOY A;  4KDL B;  4WJQ A;  1PQS A;  2ZPY A;  1WR1 A;  3OAW A;  2RSU A;  2XK5 B;  2PE6 B;  5G2N A;  2MBQ A;  5CHF A;  4LCD E;  2R2O A;  1E7U A;  3IVF A;  2N9P C;  1BT0 A;  3PLU A;  3MJW A;  4GDK B;  1YIW A;  3BY4 B;  4MEL A;  3U30 A;  1I42 A;  3X23 A;  3T8M A;  2FCS A;  4TKN A;  1YX6 B;  3DBS A;  4JGH B;  4NPN A;  2IO0 B;  5CHV C;  1WYW B;  2AWT A;  1LXD A;  3RCZ A;  5JZE B;  2IY1 B;  4IM0 A;  3WAL A;  4DHJ B;  2IO1 B;  2NBU A;  2BGF A;  3APC A;  3ENE A;  3KYD D;  4GMV A;  4BKS D;  3ALB A;  3Q3J A;  1UH6 A;  4ASW C;  1WMH A;  1LFD A;  2RGF A;  3IG3 A;  4HLE A;  2CR5 A;  2D07 B;  4EKU A;  2N9X A;  2ZVN A;  2BYF A;  1OEY A;  2HJ8 A;  2GMI C;  3HHM A;  3OJ3 A;  1IYF A;  4IWQ A;  3PS6 A;  3H7P B;  1ZGU B;  1V49 A;  3TJP A;  3L17 A;  4HXD A;  3PT2 B;  4MGK E;  2MLB A;  3S2A A;  2MX2 A;  3DBR I;  4AOF A;  4PS3 A;  3M3J A;  2PJH A;  2UYZ B;  3A9K B;  2MSE D;  2KFK A;  1TTN A;  2O6V D;  4HPM B;  2L05 A;  3EEC A;  2RD0 A;  3N32 A;  3PHW B;  3SU8 X;  4FN2 A;  1H4R A;  1Y8R C;  1RFA A;  1P98 A;  3DQV A;  5J18 A;  2BWE S;  5E6N A;  4AP4 C;  3QJZ A;  3ZUN A;  5IAA C;  1GC6 A;  3M62 B;  1S3S G;  2LVP A;  3PVL A;  2KTR B;  3QX1 A;  3SHQ A;  4DDI D;  1J8C A;  1WX7 A;  2G4D B;  3A9J A;  2D10 A;  3VXW A;  1R4M I;  2DYO A;  3N3K B;  4BKS A;  2KJR A;  4E71 A;  2N1V A;  4W9J A;  1E90 A;  2MA9 B;  3EC8 A;  3H6N A;  1Z2M A;  3TBL D;  2FNJ B;  3NZU A;  3UIN B;  1F9J A;  4ZYN A;  2NCN A;  2NPT A;  3GZN I;  4HJK A;  1KOT A;  2EMS A;  1P0R A;  3W1S A;  1FXT B;  1EUV B;  2LRW A;  4MM3 A;  4F1S A;  2LRU A;  4TUU A;  2WX0 A;  4AJY B;  3L0W B;  3KH0 A;  4MGZ E;  3RT3 B;  2KJ6 A;  4M8N A;  5DPS A;  2MBE A;  3TMP B;  4MGY E;  3ZRF A;  2HD5 B;  2O6V A;  3PRZ A;  4J6I A;  3PPA A;  5E6P A;  1NDD A;  2N9E B;  2NVU I;  1RLF A;  3ZRC A;  4IG7 B;  3PV1 A;  2BKR B;  4DBG A;  3AXC A;  4KIK A;  2C7N B;  2JY6 A;  4IM3 A;  3L16 A;  3SD5 A;  1G6J A;  3H1U A;  4JIO U;  3K9P B;  2L3Z A;  2KC1 A;  2Z59 B;  1WM3 A;  5KHQ A;  4URK A;  4PYU A;  4BBN C;  1WJ4 A;  2CHZ A;  2KDF B;  3KUD B;  1WXV A;  2OJR A;  4FHK A;  1V2Y A;  4IW0 A;  2J7Q B;  1K8R B;  4XX5 A;  2LJ5 A;  4ANV A;  5IA7 A;  3ZTC A;  2W9N A;  1QZE A;  2M17 A;  2EMT A;  3V62 A;  4M0W B;  2KX0 A;  2KMC A;  4W9L A;  4B6W A;  1A5R A;  3W1Y A;  4K7U A;  3CST A;  4G50 A;  5AZF A;  3A1Q B;  3H7P A;  2Z0E B;  4ICU A;  3IHP C;  1WE6 A;  2C7M B;  2CHW A;  2NBW B;  4EZJ A;  3DVG Y;  4E3C A;  2DZK A;  4WWN A;  1UEL A;  3ECI A;  2N4F A;  1CMX B;  3B1L X;  1OTR B;  3CMM B;  3VH3 B;  3KW5 B;  4HDQ A;  1V86 A;  4WWP A;  4ZRK A;  1E8W A;  1NBF C;  1WE7 A;  1WXS A;  2PEA A;  2R2Q A;  4MGI E;  3RZW C;  4FBJ B;  2LXA A;  4NQK E;  4GXB A;  1WX9 A;  4BOS C;  3DVG X;  1IPG A;  4FLH A;  4LDT B;  2KK8 A;  1GC7 A;  1JRU A;  1D3Z A;  2LI5 A;  1SIF A;  2BYV E;  3APF A;  3RZF A;  1M94 A;  2REX A;  2IO2 B;  4IM2 A;  4IWP A;  3ML9 A;  2K6Q A;  4MH0 E;  1MG8 A;  3HIZ A;  2K8H A;  3VQI A;  1P1A A;  2LAS A;  4FJY A;  2NR2 A;  2JWZ A;  2G3Q B;  1ZKH A;  3ML8 A;  3VUW A;  3DBH I;  4KSK C;  4HCP B;  4KZC A;  3QCA A;  3CF6 E;  2C60 A;  3ONS A;  2ZPN A;  1HE8 A;  4FUL A;  1IP9 A;  2O2V A;  2OOB B;  1OEY J;  5J2R A;  1V5T A;  3L13 A;  1KJT A;  2K8C A;  1WGH A;  4B9K A;  3KYC D;  2DAJ A;  1KM7 A;  2JVC A;  2BPS A;  1UGM A;  2M4N A;  4TQ0 A;  4GSW A;  2Z0D B;  1WFY A;  4IWO A;  4PS7 A;  4MSQ B;  3H9D A;  3UIO B;  3VTV A;  3U7D A;  2IYD B;  2FUH B;  3R66 C;  2IO3 B;  2KDB A;  4NJ6 A;  3NZS A;  4MSM B;  2YLM A;  2VRR B;  1X1M A;  2ZJD A;  3APD A;  4GU2 A;  4W9K A;  3GOE A;  3L08 A;  2KWV B;  5L95 C;  1WJU A;  3VAW A;  2HE7 A;  4HPL B;  4I6P A;  2JUO A;  4EEW A;  1OGW A;  2JPH A;  4LJP B;  2J0J A;  2IBI B;  1WRD B;  1GUA B;  2LGD A;  4B95 A;  3MHS D;  2MCN B;  1RRB A;  2B3A A;  4N9F 4;  4G3X B;  3UIP B;  2KFJ A;  3DVN V;  2KLC A;  3R7R A;  4CHK A;  3QIJ A;  3V6E B;  2KQ7 A;  4NY0 A;  1L2N A;  4GDL B;  4WQO B;  1P3Q U;  2A5U A;  4NQL B;  3DBL I;  2LWP A;  2MBO A;  2DEN B;  2N1W A;  4ANU A;  4F8C B;  2KXJ A;  3ZNH B;  4DHJ D;  2KAN A;  1E8Y A;  4F7Z A;  1E5W A;  1UD7 A;  2N7D A;  2WX1 A;  4EUT A;  2LD9 A;  2V4L A;  4G0N B;  3NS8 A;  5EDS A;  2AL3 A;  3VH4 B;  1EO6 A;  5LXI B;  4BVU C;  5AZH A;  1UBQ A;  3A4R A;  3KUC B;  1SGH A;  2BF8 B;  3BIN A;  2KTF A;  2MP2 B;  2CU1 A;  3WIM A;  2KHW B;  2LVQ A;  5G55 A;  3AU5 A;  3RUL A;  2J0M A;  1GNU A;  1EF1 A;  2ASQ A;  2KDE B;  4W9E A;  1NI2 A;  2KNB A;  2XK5 A;  1LM8 B;  4YL8 A;  3QQ8 B;  5E6O A;  4W9D A;  3X0W A;  4NAW B;  4XC2 A;  4GDK A;  3TCA A;  4A3O A;  4CO7 A;  5DPR A;  3PZD A;  1ZW7 A;  3RUI B;  5TR5 A;  2MBH A;  2EKE C;  3VFK A;  4HCN B;  2ZVO A;  4EFO A;  3PLV A;  1XT9 B;  2K25 A;  2KDI A;  5D7G A;  3ZLZ A;  2DHZ A;  1EF5 A;  4DK5 A;  3QC8 B;  4ANW A;  4K1R B;  2YVC A;  3A4S C;  3NHE B;  1L7Y A;  2JZZ A;  3ZNZ B;  5KHO A;  3TIX A;  1YQB A;  2LXC A;  2MBB B;  4BOZ B;  3JVZ X;  3SDL C;  3M63 B;  5D2M B;  5JH5 C;  2PE9 A;  2L0F A;  1TGZ B;  1AAR A;  3T9L A;  3VUY A;  2JF5 A;  2ZNV C;  2K1F A;  3R3M A;  2JXX A;  4WJO A;  2ZNV B;  3ZIM A;  1WH3 A;  2UWQ A;  1WZ3 A;  1UBI A;  4GIV A;  3VTU A;  1TZ1 A;  2ZCC A;  3B08 A;  3PSE B;  2L00 B;  4GOC A;  2KD0 A;  2MQJ A;  3A9K A;  3HK0 A;  3UQB A;  2I1K A;  3Q3F A;  2WWZ A;  3QWZ B;  2XBB C;  3DDC B;  1WGY A;  4PS8 A;  4BKT A;  1H8C A;  3WAO A;  4G11 A;  2RR9 A;  4A20 A;  4KV2 A;  5DPW A;  1T0Y A;  2RPQ A;  3DOW A;  2FCN A;  4WWO A;  3WAM A;  2GOW A;  2WYQ A;  4TV3 A;  1V9J A;  1WIA A;  2KTR A;  3A9J B;  4XZ4 A;  3WA0 A;  2KMA A;  4GDL A;  3DVN U;  4HVB A;  2KX3 A;  2JRI B;  2M1M A;  2KWC A;  1LQB A;  4BFR A;  3NY5 A;  1Q0W B;  2C5L C;  2LGY A;  2MWS B;  2NS5 A;  2FCM A;  2K8B A;  2NPT B;  4DHZ B;  4W9I A;  4MEM A;  4FJV B;  3U8Z A;  5DCN A;  2AYO B;  2L76 A;  2M8S A;  1WR6 E;  4HWI B;  5J17 A;  3QA8 A;  2C9W B;  4ICV A;  3H7S A;  4IUM B;  2G45 B;  2HTH A;  4HK2 A;  2DAF A;  3EHV A;  4II3 B;  2DZJ A;  2KZR A;  3ZNI D;  1V5O A;  4DWF A;  4FAD A;  3AI5 A;  2FCQ A;  1VCB A;  4DXA B;  5JHB A;  2MP2 A;  3JSV B;  2O6V B;  2Y5B B;  4W9F A;  5D6J B;  4LJO B;  1WY8 A;  2KJH B;  1ISN A;  4JL9 A;  4K7W A;  4EZK A;  3OLM D;  4KIK B;  5AZG A;  2C7H A;  4FA6 A;  4I6L B;  3C0R B;  2JT4 B;  2G4S A;  4LDT D;  4NAW A;  4WAA A;  3QK0 A;  2ZEQ A;  4PYZ A;  1GJZ A;  3VHT C;  1WGR A;  2BKF A;  2JZ3 B;  1Z5S B;  3DCG A;  1WJN A;  2D3G A;  4BKG A;  2LGX A;  4W9G A;  1RAX A;  1Q5W B;  1GG3 A;  4FJZ A;  1U4A A;  4JQW C;  3V61 A;  5HKH A;  1TBE A;  3I3T B;  4I6N B;  3WAP A;  3N30 A;  2GBR A;  2GBM A;  2L8J A;  3NOB A;  3PHX B;  3VTW A;  1J19 A;  3PRE A;  3M95 A;  3ZO5 B;  2ZCB A;  3UGB B;  3A1Q A;  2KO3 A;  4MJS B;  2A4Z A;  2CS4 A;  1E8X A;  5LLI A;  3PGE A;  4DHZ E;  3TL5 A;  1XD3 B;  3UQA A;  3RYT A;  2KN5 A;  2LUE A;  5CHW A;  2BWF A;  3UF8 A;  3ZDM C;  4AWJ A;  2M0X A;  5CTR C;  3PTF C;  2DZI A;  4WJP A;  5BO4 B;  4BBN F;  5L83 A;  3ZNG C;  4GN1 A;  2L7R A;  3VUX A;  2KOX A;  4KSL C;  2XEW A;  3HM3 A;  2IY0 B;  3JW0 X;  3ZDT A;  5LXH A;  1E8Z A;  3MTN B;  3KVF B;  3O65 B;  2KQS A;  4OVU A;  3ZW3 A;  4E74 A;  1OQY A;  3ZKJ C;  1C3T A;  4K81 A;  2D2Q A;  2I1J A;  1S1Q B;  3QAR A;  2CHX A;  1WXM A;  4RM9 A;  4EZL A;  2CKH B;  4ZRI A;  2ZZP B;  1V80 A;  3L54 A;  2K39 A;  4K7S A;  3VDZ A;  2N7E A;  2KKC A;  3DPD A;  3EFU A;  1V81 A;  3LJ3 A;  3V6C B;  3OJ4 B;  3ZTD A;  2FAZ A;  2FID A;  2GBN A;  4GGQ A;  4X57 B;  3LDZ E;  2J0K A;  5CX3 A;  4NNJ B;  1WI0 A;  2O2V B;  3QHT A;  1YD8 U;  4P7I A;  2DYB A;  2KC2 A;  3B0A A;  2V1Y A;  3D32 A;  4W9H A;  1Q1O A;  5GMV A;  2D11 A;  2PPH A;  2DX5 B;  3JSV A;  2KVR A;  1J0G A;  1WMH B;  4II2 B;  2V3S A;  3ZVV A;  2MW5 A;  3JYU A;  1WM2 A;  2FIF A;  2QHO A;  3RD2 A;  4ZDV A;  4NJ7 A;  3HM6 X;  2MRP A;  1WGG A;  4AJW A;  4AUQ C;  3IFW B;  5FR6 A;  3AUL A;  1UZX B;  4TQ1 A;  5AEK B;  4HDO A;  3PRM B;  4M8M A;  4JLC A;  4MDK E;  2DZM A;  4OVV A;  1C1Y B;  5D94 A;  3R7Q A;  2KFK B;  1WJ6 A;  1YX5 B;  5C23 A;  1KLV A;  4DDG D;  1SE9 A;  4ZRJ A;  4ANX A;  5C1Z A;  1E7V A;  3WAN A;  1WGD A;  2LVO A;  4W9C A;  3P2B A;  2LZ6 A;  2NBV B;  3V60 A;  4MJS A;  4A3P A;  1WXA A;  2KLG A;  5JHA A;  5DPT A;  4IC7 B;  4RMA A;  3PRP B;  3L10 B;  2DYM A;  4CYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...