4ASWC

Structure of the complex between the n-terminal dimerisation domain of sgt2 and the ubl domain of get5
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
NAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PRO
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4aswC00
4LDTD 4KZCA 3VUWA 2KDFB 2AWTA 1OEYA 4GOCA 3A9JA 4XZ4A 2Y5BB 1S1QB 1WGDA 2I1KA 4HWIB 1YQBA 4IC7B 3L10B 3H6NA 3PLVA 4FADA 1KM7A 1UZXB 3ENEA 4MGZE 4TV3A 1OTRB 2LGYA 2KKCA 3QX1A 1V2YA 4A3OA 3T8MA 3RZFA 2MBEA 3QA8A 5J2RA 1Q5WB 4HCNB 4EUTA 4A20A 2MP2B 4XC2A 4RM9A 3W1SA 3ZUNA 4ZDVA 5IA7A 5JH5C 5C23A 4W9FA 3W1SC 2C7MB 3LJ3A 2N1WA 4WAAA 4HLEA 2KXJA 3M95A 2K39A 3DVNU 2G3QB 4I6PA 4MGYE 1ZKHA 2Z0EB 2KD0A 4KDIC 4KV2A 2XEWA 1P9DU 2KLGA 4RM8A 2K6QA 2CKHB 3CMMB 3WAOA 2IZVB 3ZNZB 3K9PB 2DZKA 4W9IA 1R4MI 1T0YA 4MJSB 4TUUA 1WM2A 3ZNGC 3W1YA 4FLHA 5J17A 1TZ1A 1WR6E 4M8MA 3DBHI 3H7PA 3RZWC 4CYEA 5LXHA 4GGQA 2KO3A 2NPTB 2KTRA 1VD2A 2I1JA 3RCZA 4DWFA 2N7EA 1WX7A 2KDBA 4GB9A 2BYEA 2LGDA 1U4AA 4LJPB 4WWOA 3B1LX 2CHWA 3ZNID 5CHFA 3HHMA 4GXBA 4BVUC 5DCNA 4MSQB 3JVZX 1UGMA 3SU8X 3PGEA 4KSLC 1WGHA 2KWVB 2NBUA 2NBWB 1SE9A 2LVPA 5D6JB 3BY4B 4KSKC 3APFA 4FHJA 4E3CA 4E74A 1WXSA 1WZ0A 3VH3B 1WXMA 4NNJB 4ZRIA 2GOWA 2FIFA 3VAWA 2AEHA 2KWCA 1E7UA 1A5RA 2KWUB 3VUXA 1I35A 2CHXA 3N3KB 5LLIA 2AL6A 4IWOA 3VTWA 2JF5A 3IG3A 2UYZB 2FUHB 3NY5A 4W9CA 4DBGA 1EF5A 4W9EA 3S2AA 3ZLZA 4ANXA 2M1MA 1C3TA 3DVNV 3N32A 2C60A 2JY6A 5DPRA 4A3PA 3K9OB 1VCBA 1ZGUB 2WX0A 3KW5B 3TL5A 4EFOA 2FCNA 5AEKB 2K25A 3TBLD 4AOFA 2PEAA 1V86A 3B08A 3X23A 1OGWA 1JRUA 1Z2MA 2V4LA 2L00B 2GBJA 2ZVOA 4WJQA 1QZEA 3TIXA 3ZRFA 2R2OA 3OLMD 3KH0A 5L95C 2KQSA 3IHPC 3DBRI 1TGZB 4HK2A 4KZ0A 5E6NA 2LASA 2D3GA 3M62B 3R3MA 4MM3A 3V62A 1IP9A 3QWZB 3AU5A 2JT4B 1L7YA 2NCNA 2Z0DB 3EECA 3QARA 3L08A 2FCSA 4YL8A 2KJ6A 4NQKE 2G4DB 1H8CA 1J19A 3PT2B 1WE6A 2L7RA 2J0JA 1RLFA 3PV1A 2LXCA 4JGHB 2IBIB 4MEMA 4I6LB 1MG8A 2OOBB 2ZZPB 3A4RA 2MX2A 1WX9A 3VQIA 4RMAA 1IYFA 2KTFA 2N1VA 5D7GA 2ZNVC 3L16A 5IAAC 3AU4A 3IVFA 4NAWB 4DHZB 1L2NA 2KOXA 4K1RB 2XK5A 4PYUA 1WGGA 4TQ1A 4MH0E 3TMPB 3C0RB 2LRWA 3PHXB 4W9HA 2LVOA 1J0GA 2HD5B 5KHOA 3HK0A 1E90A 4G50A 3P2BA 4IM2A 4W9DA 5BO4B 3DBSA 4IW0A 5TR5A 2GBNA 2KJRA 1V80A 1LFDA 2MBBB 1WJNA 4FBJB 4F1SA 4FHKA 4MJSA 1F9JA 2CHZA 1Z5SB 2JXXA 2EMTA 3JSVA 3RD2A 3RULA 1KOTA 2JPHA 4IG7B 4LDTB 5DPWA 4BOSC 5E6OA 5JHAA 2O6VD 1BT0A 2ASQA 3ONSA 2MSED 2L3ZA 2KTRB 4J6IA 4GDKA 1TBEA 3SHQA 4DHZE 3V60A 1E8YA 1WGYA 4WJOA 1UBIA 3L0WB 4IWPA 4BKTA 2K1FA 3OJ3A 3JW0X 5GMVA 2RPQA 1V81A 2RSUA 2DYBA 4AJWA 1EUVB 5DPTA 3A1QA 2ZPYA 1RFAA 3ZDMC 3NZSA 3DVGX 3GOEA 2C5LC 2FAZA 4PS7A 1IPGA 2NVUI 1YX5B 3AI5A 2KDEB 4NJ7A 1UBQA 1E7VA 2KC2A 3H7SA 4HVBA 4ZYNA 2AL3A 5CHVC 5D94A 2N4FA 5DPSA 3A1QB 3HM3A 3PRPB 1I42A 1V9JA 2WWZA 2D07B 3KUCB 1GNUA 4BKSA 3M3JA 2BYFA 3NOBA 3QQ8B 3VFKA 2G45B 2L76A 4GDLA 2DAFA 4DK5A 3R7QA 2M0XA 1WF9A 2DHZA 1EF1A 2IO1B 2KDIA 3MTNB 4ANVA 4K7WA 4W9LA 3VDZA 4LCDE 1UELA 1PQSA 2D10A 1P1AA 3V6EB 3KVFB 2HTHA 2MLBA 2LD9A 1WH3A 3M63B 2N9PC 4G3XB 4K7UA 3KUDB 1GC7A 4IWQA 2PE6B 4WJNA 4F7ZA 4DDID 2KVRA 4WWNA 4MGKE 5JHBA 1E8XA 2J0KA 2WX1A 3DDCB 2FIDA 4EKUA 4F8CB 4HDQA 1NDDA 4PYZA 2RGFA 2LI5A 4B95A 1E5WA 1GC6A 1SGHA 3R66C 2AYOB 2MA9B 3ZW3A 4K7SA 1H4RA 1WMHB 2ZJDA 1CMXB 2RR9A 3WALA 4BBNC 5J18A 1D3ZA 2JRIB 4NY0A 2DYOA 2JWZA 2REXA 4KDLB 2KHWB 4PS8A 4XX5A 3PSEB 4FN2A 2N9EB 4DHJB 3JSVB 2MP2A 4ZRKA 3DOWA 2JZZA 2V1YA 1OQYA 4HXDA 5CHWA 2JUOA 3ZTCA 4ANUA 2JRHA 5HKHA 3R7RA 3RUIB 2IYDB 3CF6E 2LZ6A 3QJZA 3UIOB 4BFRA 4MGIE 3OJ4B 2L0TA 3EHVA 2K8BA 2GBMA 4PS3A 4B6WA 3WANA 2J7QB 1LXDA 4GDLB 3PVLA 2CU1A 4HDOA 1XD3B 2MW5A 5E6PA 3QK0A 4W9JA 3HM6X 4AP4C 1WX8A 2J0MA 2RD0A 2KNBA 3HIZA 4IUMB 1NBFC 4HCPB 5G2NA 1UD7A 3ML8A 1ISNA 3UINB 3UIPB 1P0RA 2GMIC 2A4ZA 3O65B 4GIVA 1WM3A 2KK8A 2R2QA 3VH4B 1KJTA 2KMCA 2C9WB 3L13A 4FULA 2KFKB 2MBQA 3NZUA 2BWES 2PJHA 2K8HA 3ML9A 3UF8A 3ZTDA 2EKEC 2OJRA 4KIKB 3SDLC 4FA6A 3WAMA 3V61A 2BKRB 1Q1OA 3GZNI 4LJOB 1WJ4A 2KLCA 5KHQA 2MQJA 2PE9A 3QHTA 2ZCBA 2JZ3B 4ICUA 2O2VB 1RRBA 4IM3A 5AZHA 4GU2A 1YD8U 2HE7A 3ECIA 5EDSA 2WYQA 1J8CA 3QCAA 3KYDD 3ZDTA 2KN5A 3PREA 2BGFA 4MDKE 3A33B 1YX6B 3DCGA 2BF8B 2NR2A 1Q0WB 2MRPA 1P3QU 3PTFC 1YJ1A 5CTRC 3CSTA 4GMVA 1NI2A 3UQBA 2LJ5A 4OVVA 2LWPA 4FJYA 2KQ7A 3QIJA 3Q3FA 4JIOU 2KMAA 4TKNA 2LRUA 2LGXA 4W9GA 2L05A 2IO0B 3CSFA 2N9XA 1GJZA 3B0AA 3X0WA 3DVGY 1SIFA 3ZKJC 3UQAA 3VHTC 1WMHA 2LXAA 2ZPNA 2KX3A 1WYWB 1XQQA 2LVQA 2DZMA 4ANWA 3RT3B 3IFWB 4NPNA 1WGRA 2XK5B 2WDTB 2KFJA 1X1MA 2D11A 3PRMB 2LUEA 4HJKA 5AZFA 3SD5A 2ZVNA 3VUYA 3ZO5B 1WR1A 2GBRA 4EZLA 4P7IA 1P98A 4NQLB 3VVWB 3KYCD 3Q3JA 2MWSB 4EZKA 1EO6A 1RAXA 2MBOA 1V5TA 3T9LA 2KJHB 2HJ8A 3PHWB 1WZ3A 2FCMA 2C7HA 2O6VA 2DENB 3OAWA 4BOZB 4TQ0A 4W9KA 4G11A 4AJYB 4ICVA 5G55A 2Z59B 2UWQA 4WQOB 4KVGB 4AWJA 4GDKB 3BINA 4FJVB 1Y8RC 2YLMA 2ZEQA 1ZW7A 2KFKA 3LDZE 3PPAA 3A9KA 4MSMB 1WXVA 2KZRA 1S3SG 5LXIB 3UGBB 2DZIA 3APDA 2M4NA 4NAWA 3EFUA 1OEYJ 2DZJA 4K81A 3H7PB 3KUZA 3H9DA 4EOYA 2MCNB 1WFYA 1WRDB 4IM0A 3ALBA 3AULA 2BPSA 2M8SA 2V3SA 4HPMB 2FCQA 4WJPA 1TTNA 3IBEA 3ZRCA 3L17A 3I3TB 2JVCA 2BWFA 3QAQA 2ZCCA 4B9KA 3U8ZA 1HE8A 5L83A 1WXAA 2A5UA 1KLVA 3DBLI 3RYTA 3ZIMA 2MBHA 2CR5A 2XBBC 1G6JA 5CX3A 3EC8A 4BKSD 2K8CA 2DX5B 1LQBA 2PPHA 3PRZA 2KX0A 2C7NB 3L54A 3H1UA 4II3B 2IY1B 1WE7A 3JYUA 4DXAB 3A9JB 2N7DA 2NBVB 2K6DB 3NHEB 2G4SA 3ZVVA 4I6NB 2IO3B 1M94A 2L8JA 4GSWA 1K8RB 3DPDA 4G0NB 3QC8B 4BBNF 4GN1A 4KIKA 3A4SC 3VTUA 1V5OA 4BKGA 1E8WA 2B3AA 3N30A 4WWPA 3VXWA 2IO2B 3ZNHB 4EEWA 3PLUA 2FNJB 4URKA 2W9NA 3PS6A 2EMSA 2L0FA 2YVCA 4MELA 3AXCA 3WA0A 3WAPA 3MJWA 4JLCA 4AUQC 4X57B 4EZJA 1FXTB 3APCA 5AZGA 3U7DA 4JL9A 2O2VA 2QHOA 3A9KB 4HPLB 3WIMA 4N9F4 1YIWA 3U30A 1V49A 4NJ6A 4E71A 1LM8B 2M17A 4ASWC 1WJUA 4II2B 2D2QA 2KC1A 2DAJA 1WIAA 5FR6A 1GG3A 3TCAA 5C1ZA 3MHSD 1V6EA 5D2MB 4OVUA 4CO7A 3D32A 5JZEB 2O6VB 4CHKA 1E8ZA 2CS4A 1AARA 1WY8A 4FJZA 1R4NI 2DYMA 2VRRB 2IY0B 4DHJD 2KANA 3VTVA 4M8NA 4ZRJA 2BKFA 3V6CB 1GUAB 3DQVA 1C1YB 1UH6A 4DDGD 2BYVE 2NS5A 3NS8A 4M0WB 2NPTA 2GBKA 2ZNVB 1WI0A 4JQWC 1XT9B 3PZDA 3TJPA 1WJ6A
chains in the Genus database with same CATH superfamily
4LDTD 1K51A 5JXVA 4KZCA 1JWUD 2Y5BB 3NVWA 1Y56A 3GP7A 1KM7A 3ZQ4A 1OTRB 2V4IB 2LGYA 2KKCA 3QX1A 5GXGB 1V2YA 4A3OA 3T8MA 4RNAA 3RZFA 4HCNB 2CU3A 1ESFA 4XC2A 5IA7A 2HJ1A 3ZUNA 5C23A 4W9FA 3W1SC 2C7MB 4WAAA 4HLEA 1FO4A 2K39A 3TUOA 1KH0A 2K6QA 3DBHB 2DLBA 2DZKA 1T0YA 1NVID 2BB6A 5FK9C 1WM2A 1B1ZA 3W1YA 4YXDB 3RFZB 3H7PA 3RZWC 4CYEA 3AE6B 2NPTB 2WGSA 2RDBC 1WX7A 2KDBA 1I4RA 2J52A 2LGDA 1U4AA 4LJPB 1JRPA 3DHGC 2CHWA 3AECB 2PMVA 4BVUC 3SU8X 1UGMA 2W3RA 1L4DB 2KWVB 2NBUA 4Q2JA 2ZW0A 5D6JB 5HI1A 4E3CA 2RDHA 1WXSA 4JE3B 3P42A 1WXMA 4E74A 3VAWA 2AEHA 2KWCA 3N3KB 1N5WA 3VTWA 4HPPA 1FIQA 4W9CA 2SAKA 4DBGA 2JSVX 4W9EA 3S2AA 4RF0A 1QKZA 5DPRA 2C60A 3RNAC 4EFOA 2FCNA 5EE9A 5AUIA 2PEAA 3B08A 2ICIA 2VH2A 3X23A 1JRUA 1TZOA 1Z2MA 2MEKA 2L00B 2GBJA 3SFEB 2MHJA 3CIRB 1FMAD 4PT5A 1CZPA 2D3GA 3V62A 4C7YA 4A6QA 3EA6A 3EECA 2WDVB 3BYTB 2FCSA 4S17A 3PT2B 1WE6A 1C9FA 4WH4A 1GPXA 3RNEC 1MI0A 3BWUD 4JGHB 4I6LB 3A4RA 4GLSC 3VQIA 3Q8FA 5D7GA 2DWQA 3IVFA 3ZYYX 4NAWB 4L1BA 4DHZB 2X38A 1HXYD 1HQRD 2LVOA 4C80A 2HD5B 2M19A 4G50A 4W9DA 4IW0A 2QMTA 1LFDA 2MBBB 1WJNA 2VZKD 4FBJB 4YTMB 3RD2A 1Z5SB 1SE3A 1V1OA 1KOTA 2OEDA 1DOYA 1FM0D 1VZ6A 3P4PB 4XWTA 3T3NA 2MJ3A 4M01A 3V60A 2KWDA 3AH7A 5GMVA 1XEEA 2DYBA 1FFVA 4AJWA 2WXNA 2ZPYA 3ZDMC 1JWBD 3DVGX 2NVUI 1TIFA 4NJ7A 3LXFA 1UBQA 1FXAA 5D94A 3RNGC 5DPSA 4YTNB 1N63A 2VZKB 2D07B 1MG4A 2BT6A 2WXHA 4WIPA 3M3JA 2G45B 1MFWA 1VDVA 2L76A 1WF9A 2DHZA 3KQ4A 3W5VB 4W9LA 2BS2B 1PQSA 2D10A 4RF1A 2MLBA 3EGRA 1WH3A 1NI3A 5BMIA 1GC7A 1DGJA 1VZ7A 4IWQA 4WJNA 4DDID 4CQNA 2I38A 4WWNA 5JHBA 3DDCB 4EKUA 4F8CB 1T5XD 2LI5A 1GC6A 4NAMA 2RR9A 3FAHA 3GE8C 5BMGA 5J18A 2KN4A 1D3ZA 4NY0A 4PS8A 2KHWB 1JWMD 1E10A 1IBXB 5FKAC 1F0ZA 1SJED 1B9RA 3DOWA 3ZTCA 2JRHA 5HKHA 3BK2A 3R7RA 3CF6E 2LZ6A 3NZ3A 2IGGA 4XWWA 2GBMA 4B6WA 4DXGA 2KACA 2M56B 2NTSA 2WXOA 4HDOA 5E6PA 4MACA 4W9JA 3HM6X 4C00A 4AP4C 1C76A 2RD0A 2J0MA 2KNBA 3SFDB 1UD7A 1VR9A 2GMIC 2INNE 2INPE 4RGOS 2A4ZA 3O65B 2Z8LA 1KJTA 2KMCA 4ARCA 2K8HA 2QDFA 3UF8A 1JROA 4M02A 3WAMA 2BKRB 1Q1OA 1XXGA 4LTUA 3BVGA 4LJOB 2MQJA 1PFDA 1RYJA 3TSSA 1WSPA 2PE9A 5H92C 2ZCBA 4LK0M 4ICUA 4P1BC 3B9JA 2GI9A 1GAQB 1J8CA 2KN5A 3DCGA 1YX6B 1YJ1A 4GMVA 5I4DA 4OVVA 2KQ7A 2KMAA 1QOAA 2LGXA 1SEBD 2L05A 2L32A 2IO0B 1GJZA 3X0WA 2IJ0A 3ZGZA 1SIFA 2WXJA 2LXAA 2DZMA 1TT5B 1WGRA 3U2SC 4LNNA 2KFJA 1E9MA 1M4VA 3AV8A 2IGHA 1FNVA 1ET6A 2GBRA 4P7IA 1P98A 3VVWB 2MWSB 4O1NA 1RAXA 3AN1A 3ZJVA 1V5TA 3T9LA 1C79A 5LNK1 2FCMA 4G11A 4ICVA 5G55A 3BINA 1T0SC 1ZW7A 2KFKA 3A9KA 4JX1C 2KZRA 1S3SG 4H2AA 2DZIA 2DZJA 1J7CA 2MCNB 4TSSA 1WFYA 2L52A 3ZRCA 2FCQA 3I3TB 3QAQA 1JQ4A 1ZDVA 4XE0A 3U8ZA 1SBBB 1KLVA 3RYTA 3ZIMA 2MBHA 3BVZA 1G6JA 3NJTA 2X8XX 3BZDB 1HTQA 1FRRA 1V1PB 1WE7A 2NBVB 3KLSX 3NHEB 2HTME 4B0EA 1Q10A 1SIJA 4BKGA 3ZNHB 3P1MA 3CWIA 2YVCA 1QF6A 3AXCA 3P4SB 4X57B 1TYGB 4KGRA 4XYCA 2ONQA 4ITKA 2KC1A 2DAJA 5FR6A 3TCAA 3I5JC 2RDGA 4ZOHC 1V6EA 3D32A 5JZEB 2O6VB 1E8ZA 4FJZA 2IY0B 4ZRJA 2V3PA 4M0WB 2BW2A 1KTKA 4ACFA 1DOIA 1WJ6A 4A9AA 1STEA 4US9A 4GOCA 3A9JA 1TKGA 1L0VB 1I4GA 2IPKD 2I1KA 3TEZA 4HWIB 1CJEA 3W2DA 1LGRA 3H6NA 3PLVA 1UZXB 4MGZE 2QILA 4N59A 2MBEA 3QA8A 4EUTA 3W1SA 1F2RI 1RFKA 3LJ3A 2N1WA 4JPSA 4I6PA 3SR6A 4KDIC 2IGDA 2KD0A 2Z0EB 3C19A 4KV2A 4RM8A 2KLGA 2IZVB 3K9PB 3DWGC 4TUUA 4FLHA 1N61A 1WR6E 1KF6B 3FKYA 2KQ4X 4GGQA 3TEYA 2N7EA 4GB9A 2BYEA 1IUEA 3B1LX 3ZXVA 3E56A 1C4CA 4GXBA 4MSQB 3JVZX 2WXRA 2D5GA 1WGHA 4P16A 1SE4A 3BY4B 4FHJA 1A70A 2GOWA 2FIFA 1A5RA 2LFIA 1I35A 1XLNA 2LUMA 4L2YA 2QC8A 4KKJA 1QILA 2M1MA 1C3TA 2JY6A 1VCBA 2WX0A 3RNFC 4XDDA 4FXCA 4AOFA 1V86A 4WJQA 3AMZA 2R2OA 3IHPC 1PDXA 2PLPA 1TGZB 3HUIA 4YSYB 3MFGA 2LASA 2IDYA 1TJEA 3M62B 1PUTA 3R3MA 4MM3A 1DYQA 3VR8B 3QWZB 3AU5A 2Z0DB 3DBRB 2Q5WD 2WXFA 2LEKA 2G4DB 1F77A 1J19A 2L7RA 1RLFA 3PV1A 3Q14C 1TY2A 2BS3B 1MG8A 2OOBB 1IYFA 2KTFA 5G5HA 3C8YA 4QAYA 3FILB 1JALA 2KT7A 1MHHE 4K1RB 2XK5A 4PYUA 1WGGA 2LRWA 4IDIA 5KHOA 2E6XA 2L83A 1E90A 1E0ZA 5BO4B 2KJRA 1V8CA 1I4PA 1C77A 2PW9A 3JSVA 1F9JA 2JXXA 5IP4D 4USAA 5FR3A 1MVKA 5DPWA 4BOSC 1NYRA 2WU5B 5T8IA 5JHAA 2O6VD 4KGTA 4LLGM 1TBEA 3SHQA 3J9CA 4DHZE 1E8YA 1WGYA 1UBIA 3L0WB 4IWPA 1EUVB 3A1QA 4HJGE 3NZSA 2C5LC 2FAZA 4PS7A 1CQVA 1E7VA 3Q8CA 2UU7A 5CHVC 1I42A 4K3CA 2WXLA 4BKSA 3NOBA 2RMMA 1F2RC 2DAFA 3R7QA 3RI7C 2M0XA 3AM9A 3MTNB 3NUHB 4K7WA 4LCDE 1HTOA 2LD9A 3M63B 1EWYC 1PGXA 4K7UA 2PE6B 4F7ZA 4N6EB 2J4XA 4NZLB 2WX1A 3WCQA 2W82A 1N6ZA 4B95A 1SGHA 2AYOB 2K9XA 5IKCM 3WALA 4BBNC 3TEXA 2JRIB 2DYOA 2JWZA 4YT0B 2N9EB 2MP2A 2QSDA 2V1YA 2Y5CA 5CHWA 5C2TB 3RUIB 4BFRA 4MGIE 3OJ4B 2K8BA 3WANA 2J7QB 5HG2A 1ZE3D 3PVLA 2CU1A 2R61A 2MW5A 3QK0A 3AE2B 2Y5PA 5G2NA 4HCPB 4GIVA 3VH4B 2R2QA 2I2YA 1XLQA 3NZUA 3PO0A 2EKEC 4KIKB 2JYEA 2B76B 3GZNI 1RRBA 4IM3A 2G9HD 4GU2A 5EDSA 1IBXA 2WYQA 3QCAA 2AX5A 3ZDTA 2BGFA 1YN3A 3N20C 2BF8B 2NR2A 3PTFC 5CTRC 1R4NB 2LJ5A 4FJYA 3QIJA 1PGAA 4JWSC 2LRUA 2LHEA 2W55A 3AE4B 1ACCA 1I7HA 2N9XA 3HRDD 3UQAA 3VHTC 1XQQA 1PYWD 2PTLA 3RT3B 3IFWB 2XNAC 1YJIA 1X1MA 3PRMB 4HJKA 3ZO5B 3KYCD 4RH6A 2JXTA 1QLBB 4EZKA 2M0AA 3L4PA 3PHWB 2HJ8A 1WZ3A 3MHZA 3OAWA 4TQ0A 1FCCC 4W9KA 2Z59B 4AWJA 3Q2AC 4GDKB 1QOGA 1RWSA 1D5XC 1Y8RC 3P4QB 1KFYB 1R4MB 1AYFA 3PPAA 2PIAA 4MH8A 3Q8BA 2M4NA 4NAWA 1TKEA 3KUZA 3AE8B 1WRDB 4IM0A 1T0RC 1KLGD 4WJPA 1TTNA 3L17A 2JVCA 1WYGA 2ZCCA 3NVZA 5EE3A 2A5UA 1MPEA 3DBLI 2CR5A 2DX5B 4OZCA 4JWUC 3L54A 3ZJUA 2IY1B 2GB1A 3JYUA 2ON8A 3IXSA 3AEDB 2K6DB 1FEHA 3IT4B 3NG0A 1M94A 1OFFA 3DPDA 3QC8B 4GN1A 4KIKA 1D5MC 3A4SC 2INCC 1E8WA 3N30A 4WWPA 2IO2B 2LMCA 2W9NA 4MELA 3WAPA 4WURA 3WA0A 1SE2A 3MJWA 4C56C 1FXTB 3APCA 5AZGA 4JL9A 2QHOA 3A9KB 4HPLB 4XGAB 1YIWA 1UF0A 4E71A 1LM8B 4ZRPA 2D2QA 2DNFA 1WIAA 1GG3A 3ABVB 5BYRA 4CO7A 4CHKA 2CS4A 1AARA 5G5GA 3DWMA 3T3OA 3VTVA 4N58A 1GUAB 1I4QA 2LHDA 5D3DA 2BYVE 2FUG1 3B2GA 4JQWC 4TMAB 3BYYB 1TS5A 4DHJB 3TJPA 2WXKA 2WDRB 3VUWA 2K5PA 2AWTA 2KDFB 2WQYB 2WXGA 3PZ8A 1GB4A 3RNBC 4IC7B 3L10B 4FADA 4DQOC 3ENEA 4RGTA 2NTTA 1UWMA 3P63A 4A20A 4RM9A 2KXJA 3M95A 3AEEB 4MGYE 2XEWA 1P9DU 2CKHB 3CMMB 4MM3B 1XF5L 3ZNZB 4W9IA 1R4MI 5C3JB 2JU6X 1QQRA 3ZNGC 1PGBA 5J17A 1TZ1A 3DBHI 4HROA 2EKIA 2KO3A 2KTRA 1VD2A 4A8XC 1ENFA 2LJIA 2LGSA 4WWOA 3FILA 3ZNID 2N7JA 4C4VB 4ZYSA 1FCLA 3HHMA 5EE0A 4LNOA 5DCNA 2W54A 4KSLC 3V05A 1SE9A 4KSKC 3GS2A 3W5UB 1WZ0A 3VH3B 4YWGG 1E7UA 2JYTA 2KWUB 3VUXA 2CHXA 3MP9A 4UDUC 2AL6A 4IWOA 2JQRB 1HZ6A 2ZW1A 3IG3A 4J3OD 1FPYA 3NY5A 2FUHB 1EF5A 5BYQA 3IAS1 3ZLZA 4ANXA 2JZPA 3N1YC 3DVNV 3N32A 4A3PA 3K9OB 3LYYA 3KW5B 3TL5A 1QT9A 4BAXA 1OGWA 2WXIA 3PZ7A 4A55A 2VH1A 2ZVOA 1E7PB 3TIXA 3OLMD 5L95C 1D6EC 1JW9D 3EUB2 4HK2A 5E6NA 3Q3NC 1HZ5A 3Q3MC 2JT4B 1L7YA 2NCNA 3QARA 1KLUD 1VJKA 2KJ6A 4NQKE 1ZP0B 2LXCA 2IBIB 4MEMA 2ZZPB 1WX9A 4RMAA 2N1VA 3AB5A 5IAAC 2WS3B 1XCTL 2CJOA 1C4AA 2WXQA 1L2NA 4TQ1A 3TMPB 1ZXHA 3C0RB 1VLBA 2QEJC 4ZHOA 1D4BA 2N9KA 4US8A 3HK0A 3P2BA 4IM2A 3DBSA 5TR5A 2GBNA 1EU3A 1FFUA 2XN9C 3RULA 2JPHA 1YOVB 4IG7B 3SEBA 1ZXIA 3ZJTA 3AE7B 1BT0A 4KGSA 1NYQA 2MSED 5BYSA 2L3ZA 2KTRB 3FC4A 4WJOA 1GB1A 2D3CA 4BKTA 2K1FA 3OJ3A 3JW0X 1V81A 2E3TA 5DPTA 1L6UA 1FRDA 4LNFA 2KYWA 2BQQA 1IPGA 1YX5B 4A90A 2H88B 2KDEB 1YNTE 4IKGA 2HDEA 3H7SA 4ZYNA 2AL3A 3Q6BA 2N4FA 3HM3A 3PRPB 2MH7A 3AEBB 1GNUA 2BYFA 3QQ8B 1V1PA 4GDLA 4DK5A 3R8BA 1FD6A 2KDIA 4ANVA 4BZAA 1UELA 1P1AA 3KWVA 3V6EB 4S0RA 1XLPA 2HTHA 2N9PC 2PKOA 4MGKE 2J0KA 4DXFA 1UGJA 4PYZA 2AQ1B 2RGFA 3R66C 2MA9B 3ZW3A 1CMXB 4P1CC 2REXA 4XX5A 3PSEB 4FN2A 3JSVB 4ZRKA 2JZZA 3EFCA 4WWMA 4HXDA 2JUOA 1T0QC 2J53A 2IYDB 3QJZA 2WXMA 3EHVA 4PS3A 3W9CB 3GE3C 4GDLB 1EU4A 4M0WA 2K22A 1XD3B 3B2FA 3NS1A 5MPOA 4IUMB 1NENB 1NBFC 3ML8A 1ISNA 2W3SA 1AW7A 1P7FA 2KK8A 2C9WB 3L13A 4FULA 2KMMA 3ML9A 1L4ZB 1YQ4B 1T6BX 4FA6A 3SDLC 3V61A 2KVZA 3NVVA 2KLCA 3U4EG 5KHQA 2WHIA 3QHTA 2O2VB 1ROEA 1T3QA 5AZHA 5HFYA 3ECIA 3GZNB 2OHFA 2WP9B 3A33B 1TS4A 1Q0WB 2D3BA 4L23A 1NI2A 1RM6C 2LWPA 4JIOU 3Q3FA 3BK1A 4WQMA 1L6VA 4W9GA 4ZRQA 1I4XA 1QOFA 3DVGY 3ZKJC 1YJJA 1WMHA 2ZPNA 1WYWB 2LVQA 4ANWA 2D11A 5AZFA 1WR1A 4EZLA 3Q3JA 2BVCA 4WAFA 2KJHB 2TSSA 2C7HA 2DENB 4BOZB 4ARIA 1TS3A 2UWQA 4WQOB 1CK1A 4KVGB 4RGNA 2YLMA 1UUPA 1P7EA 3RN9C 1TY0A 3LDZE 4MSMB 1UWXA 1MJDA 3UGBB 2BYTA 1OEYJ 1E6EB 3H9DA 3AULA 2M8SA 2V3SA 3IBEA 3URYA 4B9KA 5L83A 4IOIE 2INDC 1LQBA 3PRZA 2KX0A 4II3B 2N7DA 4OW0A 3Q69A 4HEA1 5AUKA 1D5ZC 4I6NB 2IO3B 3N9YC 3OWEB 4BBNF 1YN5A 4OZAA 3PS6A 5D3IB 4AUQC 4EZJA 3U7DA 1JWAD 2O2VA 3WIMA 3RNCC 3U30A 4NJ6A 2WXPA 2M17A 5C1ZA 4RFBA 3MHSD 5D2MB 1WY8A 1LO5D 1R4NI 2DYMA 1WRIA 3V6CB 3DQVA 4DDGD 3NS8A 1FNWA 2NPTA 1VZ8A 1SJHD 3IT6B 4KKIA 2MJDA 1XT9B 5BMHA 1OEYA 4XZ4A 4XDCA 1S1QB 1WGDA 2SEBD 1YQBA 1YN4A 5H8YE 4TV3A 3UI3A 3RMKC 5J2RA 1Q5WB 3ETRA 2MP2B 1N5XA 4ZDVA 5JH5C 3R2TA 3DVNU 3KWLA 2G3QB 1ZDXA 1ZKHA 2LGIA 2ACZB 1AN8A 3WAOA 4NJCA 3BIID 2QJLA 4MJSB 4R3DA 4M8MA 5LXHA 4HKQA 1I4HA 2I1JA 3RCZA 4DWFA 1FNUA 2H89B 2WU2B 3GB1A 5CHFA 1N60A 3PGEA 2NBWB 2LVPA 3APFA 3MC0B 4NNJB 4ZRIA 4EE2A 1UNSA 3I63C 5LLIA 1XO3A 2JF5A 3HVZA 2UYZB 2WLBA 4REZA 3AE5B 2FE8A 2EELA 1ZGUB 2GRIA 5IO9A 5AEKB 2K25A 4HKZE 3TBLD 5TSSA 2YEPB 1SSNA 2V4LA 1QZEA 3ZRFA 3KH0A 2KQSA 1DOXA 1TKYA 3DBRI 4AS1A 4ZHPA 2D3AA 2BS4B 4KZ0A 3AEAB 3AEFB 2KAJA 1IP9A 3L08A 4YL8A 1H8CA 4YSXB 3NVYA 2J0JA 3O13A 1K53A 2MX2A 1JCKB 3I9V1 1N62A 2ZNVC 3L16A 3AU4A 1HEZE 4OZBA 2WNMA 2KOXA 4MH0E 4W9HA 3PHXB 1J0GA 1FXIA 4OHJA 1EM7A 2K3UA 1V80A 2L1AA 1OQQA 3V3XA 4F1SA 4FHKA 4MJSA 1OQRA 2CHZA 1BMLC 1IGCA 2EMTA 1L0XB 2KDMA 4LDTB 5E6OA 2ASQA 3ONSA 2V3NA 4J6IA 4GDKA 1K50A 3U52E 3TEWA 2FBWB 4PK1A 2RPQA 2RSUA 1BUIC 1RFAA 1XLOA 3GOEA 3Q3OC 3AI5A 2NMQA 2G1EA 3LB8C 2KC2A 1XCQL 4HVBA 4YTPB 3RPFC 3A1QB 2Y3AA 5EE1A 1QOBA 1V9JA 2WWZA 1AWDA 4B0MA 4YSZB 3KUCB 1V97A 3VFKA 2QCZA 1EF1A 2IO1B 2N0SB 3VDZA 2AQ2B 3KVFB 4G3XB 3KUDB 2KVRA 1KRHA 1E8XA 1ZUD2 2FIDA 4HDQA 1NDDA 3E9SA 1E5WA 1GOZA 2OJWA 4K7SA 3U7ZA 1H4RA 1WMHB 1L0YB 2ZJDA 2MJEA 4KDLB 4C7ZA 4KX6B 3H8HA 1OQYA 4ANUA 4MT5A 4D2KA 3UIOB 2L0TA 1VRAB 1LXDA 2V9HA 2K0PA 2PVOD 1YMHE 1WX8A 1ZPSA 3N1XC 1SB3C 5E6JA 3HIZA 3UIPB 3UINB 1P0RA 2PVGC 1WM3A 3MC9A 4OVZA 2KFKB 1J7BA 2MBQA 3DHIC 2BWES 2PJHA 3R2IA 3DHHC 3ZTDA 2OJRA 2V0GA 2WDQB 1WJ4A 1F1HA 3I57A 4RCOA 2JZ3B 1WGKA 3VR9B 1YD8U 2HE7A 5HHDG 3KYDD 3PREA 1C4PA 4MDKE 3VRAB 2BTEA 2MRPA 1P3QU 3CSTA 4LNKA 3UQBA 3IAM1 4TKNA 4K3BA 1SXTA 3CSFA 3AE3B 3B0AA 2CJNA 1C78A 1JMLA 2JWUA 2AQ3B 2BB5A 2JX5A 2KX3A 4C4VA 1YQ3B 4NPNA 3Q8AA 2XK5B 2WDTB 3MJ5A 2LUEA 3VUYA 3SD5A 2ZVNA 2RPVA 4NQLB 3VRBB 1ZOYB 1HA5A 4AQ7A 3MC8A 1EO6A 3AE1B 2MBOA 3BVMA 3OG5A 2O6VA 4P6VF 4AJYB 3NRZA 4FJVB 2ZEQA 3N1ZC 1WXVA 3AEGB 5LXIB 3Q8EA 3APDA 3EFUA 1J7AA 4K81A 3H7PB 1WWTA 3DBLB 4EOYA 1ET9A 1EWCA 1SF0A 2BBCA 2J42A 3ALBA 2BPSA 4HPMB 3ZXRA 2BWFA 1HE8A 1WXAA 5IOIA 2XBBC 2GLSA 5CX3A 1MHXA 3EC8A 4BKSD 2K8CA 4LNIA 2PPHA 2C7NB 1TS2A 3H1UA 1BXTA 4DXAB 1NEKB 2DBYA 3A9JB 1WXQA 2G4SA 3ZVVA 2L8JA 4GSWA 1K8RB 3AE9B 4G0NB 3VTUA 3HVDA 1V5OA 2B3AA 3VXWA 5IN7A 4EEWA 1K52A 2FNJB 3PLUA 4URKA 2EMSA 2L0FA 4JLCA 4HRSA 1R7SA 4N9F4 4M00A 1V49A 3P4RB 4ASWC 1WJUA 4II2B 2N9LA 4OVUA 4RGMA 2QIEB 1F52A 2VRRB 4DHJD 2KANA 4M8NA 2BKFA 1JWSD 1UH6A 1C1YB 1L5PA 1IGDA 2NS5A 2YEPF 2GBKA 2ZNVB 1WI0A 3PZDA
chains in the Genus database with same CATH topology
4LDTD 4KZCA 3VUWA 2KDFB 2AWTA 1OEYA 4GOCA 3A9JA 4XZ4A 2Y5BB 1S1QB 1WGDA 2I1KA 4HWIB 1YQBA 4IC7B 3L10B 3H6NA 3PLVA 4FADA 1KM7A 1UZXB 3ENEA 4MGZE 4TV3A 1OTRB 2LGYA 2KKCA 3QX1A 1V2YA 4A3OA 3T8MA 3RZFA 2MBEA 3QA8A 5J2RA 1Q5WB 4HCNB 4EUTA 4A20A 2MP2B 4XC2A 4RM9A 3W1SA 3ZUNA 4ZDVA 5IA7A 5JH5C 5C23A 4W9FA 3W1SC 2C7MB 3LJ3A 2N1WA 4WAAA 4HLEA 2KXJA 3M95A 2K39A 3DVNU 2G3QB 4I6PA 4MGYE 1ZKHA 2Z0EB 2KD0A 4KDIC 4KV2A 2XEWA 1P9DU 2KLGA 4RM8A 2K6QA 2CKHB 3CMMB 3WAOA 2IZVB 3ZNZB 3K9PB 2DZKA 4W9IA 1R4MI 1T0YA 4MJSB 4TUUA 1WM2A 3ZNGC 3W1YA 4FLHA 5J17A 1TZ1A 1WR6E 4M8MA 3DBHI 3H7PA 3RZWC 4CYEA 5LXHA 4GGQA 2KO3A 2NPTB 2KTRA 1VD2A 2I1JA 3RCZA 4DWFA 2N7EA 1WX7A 2KDBA 4GB9A 2BYEA 2LGDA 1U4AA 4LJPB 4WWOA 3B1LX 2CHWA 3ZNID 5CHFA 3HHMA 4GXBA 4BVUC 5DCNA 4MSQB 3JVZX 1UGMA 3SU8X 3PGEA 4KSLC 1WGHA 2KWVB 2NBUA 2NBWB 1SE9A 2LVPA 5D6JB 3BY4B 4KSKC 3APFA 4FHJA 4E3CA 4E74A 1WXSA 1WZ0A 3VH3B 1WXMA 4NNJB 4ZRIA 2GOWA 2FIFA 3VAWA 2AEHA 2KWCA 1E7UA 1A5RA 2KWUB 3VUXA 1I35A 2CHXA 3N3KB 5LLIA 2AL6A 4IWOA 3VTWA 2JF5A 3IG3A 2UYZB 2FUHB 3NY5A 4W9CA 4DBGA 1EF5A 4W9EA 3S2AA 3ZLZA 4ANXA 2M1MA 1C3TA 3DVNV 3N32A 2C60A 2JY6A 5DPRA 4A3PA 3K9OB 1VCBA 1ZGUB 2WX0A 3KW5B 3TL5A 4EFOA 2FCNA 5AEKB 2K25A 3TBLD 4AOFA 2PEAA 1V86A 3B08A 3X23A 1OGWA 1JRUA 1Z2MA 2V4LA 2L00B 2GBJA 2ZVOA 4WJQA 1QZEA 3TIXA 3ZRFA 2R2OA 3OLMD 3KH0A 5L95C 2KQSA 3IHPC 3DBRI 1TGZB 4HK2A 4KZ0A 5E6NA 2LASA 2D3GA 3M62B 3R3MA 4MM3A 3V62A 1IP9A 3QWZB 3AU5A 2JT4B 1L7YA 2NCNA 2Z0DB 3EECA 3QARA 3L08A 2FCSA 4YL8A 2KJ6A 4NQKE 2G4DB 1H8CA 1J19A 3PT2B 1WE6A 2L7RA 2J0JA 1RLFA 3PV1A 2LXCA 4JGHB 2IBIB 4MEMA 4I6LB 1MG8A 2OOBB 2ZZPB 3A4RA 2MX2A 1WX9A 3VQIA 4RMAA 1IYFA 2KTFA 2N1VA 5D7GA 2ZNVC 3L16A 5IAAC 3AU4A 3IVFA 4NAWB 4DHZB 1L2NA 2KOXA 4K1RB 2XK5A 4PYUA 1WGGA 4TQ1A 4MH0E 3TMPB 3C0RB 2LRWA 3PHXB 4W9HA 2LVOA 1J0GA 2HD5B 5KHOA 3HK0A 1E90A 4G50A 3P2BA 4IM2A 4W9DA 5BO4B 3DBSA 4IW0A 5TR5A 2GBNA 2KJRA 1V80A 1LFDA 2MBBB 1WJNA 4FBJB 4F1SA 4FHKA 4MJSA 1F9JA 2CHZA 1Z5SB 2JXXA 2EMTA 3JSVA 3RD2A 3RULA 1KOTA 2JPHA 4IG7B 4LDTB 5DPWA 4BOSC 5E6OA 5JHAA 2O6VD 1BT0A 2ASQA 3ONSA 2MSED 2L3ZA 2KTRB 4J6IA 4GDKA 1TBEA 3SHQA 4DHZE 3V60A 1E8YA 1WGYA 4WJOA 1UBIA 3L0WB 4IWPA 4BKTA 2K1FA 3OJ3A 3JW0X 5GMVA 2RPQA 1V81A 2RSUA 2DYBA 4AJWA 1EUVB 5DPTA 3A1QA 2ZPYA 1RFAA 3ZDMC 3NZSA 3DVGX 3GOEA 2C5LC 2FAZA 4PS7A 1IPGA 2NVUI 1YX5B 3AI5A 2KDEB 4NJ7A 1UBQA 1E7VA 2KC2A 3H7SA 4HVBA 4ZYNA 2AL3A 5CHVC 5D94A 2N4FA 5DPSA 3A1QB 3HM3A 3PRPB 1I42A 1V9JA 2WWZA 2D07B 3KUCB 1GNUA 4BKSA 3M3JA 2BYFA 3NOBA 3QQ8B 3VFKA 2G45B 2L76A 4GDLA 2DAFA 4DK5A 3R7QA 2M0XA 1WF9A 2DHZA 1EF1A 2IO1B 2KDIA 3MTNB 4ANVA 4K7WA 4W9LA 3VDZA 4LCDE 1UELA 1PQSA 2D10A 1P1AA 3V6EB 3KVFB 2HTHA 2MLBA 2LD9A 1WH3A 3M63B 2N9PC 4G3XB 4K7UA 3KUDB 1GC7A 4IWQA 2PE6B 4WJNA 4F7ZA 4DDID 2KVRA 4WWNA 4MGKE 5JHBA 1E8XA 2J0KA 2WX1A 3DDCB 2FIDA 4EKUA 4F8CB 4HDQA 1NDDA 4PYZA 2RGFA 2LI5A 4B95A 1E5WA 1GC6A 1SGHA 3R66C 2AYOB 2MA9B 3ZW3A 4K7SA 1H4RA 1WMHB 2ZJDA 1CMXB 2RR9A 3WALA 4BBNC 5J18A 1D3ZA 2JRIB 4NY0A 2DYOA 2JWZA 2REXA 4KDLB 2KHWB 4PS8A 4XX5A 3PSEB 4FN2A 2N9EB 4DHJB 3JSVB 2MP2A 4ZRKA 3DOWA 2JZZA 2V1YA 1OQYA 4HXDA 5CHWA 2JUOA 3ZTCA 4ANUA 2JRHA 5HKHA 3R7RA 3RUIB 2IYDB 3CF6E 2LZ6A 3QJZA 3UIOB 4BFRA 4MGIE 3OJ4B 2L0TA 3EHVA 2K8BA 2GBMA 4PS3A 4B6WA 3WANA 2J7QB 1LXDA 4GDLB 3PVLA 2CU1A 4HDOA 1XD3B 2MW5A 5E6PA 3QK0A 4W9JA 3HM6X 4AP4C 1WX8A 2J0MA 2RD0A 2KNBA 3HIZA 4IUMB 1NBFC 4HCPB 5G2NA 1UD7A 3ML8A 1ISNA 3UINB 3UIPB 1P0RA 2GMIC 2A4ZA 3O65B 4GIVA 1WM3A 2KK8A 2R2QA 3VH4B 1KJTA 2KMCA 2C9WB 3L13A 4FULA 2KFKB 2MBQA 3NZUA 2BWES 2PJHA 2K8HA 3ML9A 3UF8A 3ZTDA 2EKEC 2OJRA 4KIKB 3SDLC 4FA6A 3WAMA 3V61A 2BKRB 1Q1OA 3GZNI 4LJOB 1WJ4A 2KLCA 5KHQA 2MQJA 2PE9A 3QHTA 2ZCBA 2JZ3B 4ICUA 2O2VB 1RRBA 4IM3A 5AZHA 4GU2A 1YD8U 2HE7A 3ECIA 5EDSA 2WYQA 1J8CA 3QCAA 3KYDD 3ZDTA 2KN5A 3PREA 2BGFA 4MDKE 3A33B 1YX6B 3DCGA 2BF8B 2NR2A 1Q0WB 2MRPA 1P3QU 3PTFC 1YJ1A 5CTRC 3CSTA 4GMVA 1NI2A 3UQBA 2LJ5A 4OVVA 2LWPA 4FJYA 2KQ7A 3QIJA 3Q3FA 4JIOU 2KMAA 4TKNA 2LRUA 2LGXA 4W9GA 2L05A 2IO0B 3CSFA 2N9XA 1GJZA 3B0AA 3X0WA 3DVGY 1SIFA 3ZKJC 3UQAA 3VHTC 1WMHA 2LXAA 2ZPNA 2KX3A 1WYWB 1XQQA 2LVQA 2DZMA 4ANWA 3RT3B 3IFWB 4NPNA 1WGRA 2XK5B 2WDTB 2KFJA 1X1MA 2D11A 3PRMB 2LUEA 4HJKA 5AZFA 3SD5A 2ZVNA 3VUYA 3ZO5B 1WR1A 2GBRA 4EZLA 4P7IA 1P98A 4NQLB 3VVWB 3KYCD 3Q3JA 2MWSB 4EZKA 1EO6A 1RAXA 2MBOA 1V5TA 3T9LA 2KJHB 2HJ8A 3PHWB 1WZ3A 2FCMA 2C7HA 2O6VA 2DENB 3OAWA 4BOZB 4TQ0A 4W9KA 4G11A 4AJYB 4ICVA 5G55A 2Z59B 2UWQA 4WQOB 4KVGB 4AWJA 4GDKB 3BINA 4FJVB 1Y8RC 2YLMA 2ZEQA 1ZW7A 2KFKA 3LDZE 3PPAA 3A9KA 4MSMB 1WXVA 2KZRA 1S3SG 5LXIB 3UGBB 2DZIA 3APDA 2M4NA 4NAWA 3EFUA 1OEYJ 2DZJA 4K81A 3H7PB 3KUZA 3H9DA 4EOYA 2MCNB 1WFYA 1WRDB 4IM0A 3ALBA 3AULA 2BPSA 2M8SA 2V3SA 4HPMB 2FCQA 4WJPA 1TTNA 3IBEA 3ZRCA 3L17A 3I3TB 2JVCA 2BWFA 3QAQA 2ZCCA 4B9KA 3U8ZA 1HE8A 5L83A 1WXAA 2A5UA 1KLVA 3DBLI 3RYTA 3ZIMA 2MBHA 2CR5A 2XBBC 1G6JA 5CX3A 3EC8A 4BKSD 2K8CA 2DX5B 1LQBA 2PPHA 3PRZA 2KX0A 2C7NB 3L54A 3H1UA 4II3B 2IY1B 1WE7A 3JYUA 4DXAB 3A9JB 2N7DA 2NBVB 2K6DB 3NHEB 2G4SA 3ZVVA 4I6NB 2IO3B 1M94A 2L8JA 4GSWA 1K8RB 3DPDA 4G0NB 3QC8B 4BBNF 4GN1A 4KIKA 3A4SC 3VTUA 1V5OA 4BKGA 1E8WA 2B3AA 3N30A 4WWPA 3VXWA 2IO2B 3ZNHB 4EEWA 3PLUA 2FNJB 4URKA 2W9NA 3PS6A 2EMSA 2L0FA 2YVCA 4MELA 3AXCA 3WA0A 3WAPA 3MJWA 4JLCA 4AUQC 4X57B 4EZJA 1FXTB 3APCA 5AZGA 3U7DA 4JL9A 2O2VA 2QHOA 3A9KB 4HPLB 3WIMA 4N9F4 1YIWA 3U30A 1V49A 4NJ6A 4E71A 1LM8B 2M17A 4ASWC 1WJUA 4II2B 2D2QA 2KC1A 2DAJA 1WIAA 5FR6A 1GG3A 3TCAA 5C1ZA 3MHSD 1V6EA 5D2MB 4OVUA 4CO7A 3D32A 5JZEB 2O6VB 4CHKA 1E8ZA 2CS4A 1AARA 1WY8A 4FJZA 1R4NI 2DYMA 2VRRB 2IY0B 4DHJD 2KANA 3VTVA 4M8NA 4ZRJA 2BKFA 3V6CB 1GUAB 3DQVA 1C1YB 1UH6A 4DDGD 2BYVE 2NS5A 3NS8A 4M0WB 2NPTA 2GBKA 2ZNVB 1WI0A 4JQWC 1XT9B 3PZDA 3TJPA 1WJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDT D;  4KZC A;  3VUW A;  2KDF B;  2AWT A;  1OEY A;  4GOC A;  3A9J A;  4XZ4 A;  2Y5B B;  1S1Q B;  1WGD A;  2I1K A;  4HWI B;  1YQB A;  4IC7 B;  3L10 B;  3H6N A;  3PLV A;  4FAD A;  1KM7 A;  1UZX B;  3ENE A;  4MGZ E;  4TV3 A;  1OTR B;  2LGY A;  2KKC A;  3QX1 A;  1V2Y A;  4A3O A;  3T8M A;  3RZF A;  2MBE A;  3QA8 A;  5J2R A;  1Q5W B;  4HCN B;  4EUT A;  4A20 A;  2MP2 B;  4XC2 A;  4RM9 A;  3W1S A;  3ZUN A;  4ZDV A;  5IA7 A;  5JH5 C;  5C23 A;  4W9F A;  3W1S C;  2C7M B;  3LJ3 A;  2N1W A;  4WAA A;  4HLE A;  2KXJ A;  3M95 A;  2K39 A;  3DVN U;  2G3Q B;  4I6P A;  4MGY E;  1ZKH A;  2Z0E B;  2KD0 A;  4KDI C;  4KV2 A;  2XEW A;  1P9D U;  2KLG A;  4RM8 A;  2K6Q A;  2CKH B;  3CMM B;  3WAO A;  2IZV B;  3ZNZ B;  3K9P B;  2DZK A;  4W9I A;  1R4M I;  1T0Y A;  4MJS B;  4TUU A;  1WM2 A;  3ZNG C;  3W1Y A;  4FLH A;  5J17 A;  1TZ1 A;  1WR6 E;  4M8M A;  3DBH I;  3H7P A;  3RZW C;  4CYE A;  5LXH A;  4GGQ A;  2KO3 A;  2NPT B;  2KTR A;  1VD2 A;  2I1J A;  3RCZ A;  4DWF A;  2N7E A;  1WX7 A;  2KDB A;  4GB9 A;  2BYE A;  2LGD A;  1U4A A;  4LJP B;  4WWO A;  3B1L X;  2CHW A;  3ZNI D;  5CHF A;  3HHM A;  4GXB A;  4BVU C;  5DCN A;  4MSQ B;  3JVZ X;  1UGM A;  3SU8 X;  3PGE A;  4KSL C;  1WGH A;  2KWV B;  2NBU A;  2NBW B;  1SE9 A;  2LVP A;  5D6J B;  3BY4 B;  4KSK C;  3APF A;  4FHJ A;  4E3C A;  4E74 A;  1WXS A;  1WZ0 A;  3VH3 B;  1WXM A;  4NNJ B;  4ZRI A;  2GOW A;  2FIF A;  3VAW A;  2AEH A;  2KWC A;  1E7U A;  1A5R A;  2KWU B;  3VUX A;  1I35 A;  2CHX A;  3N3K B;  5LLI A;  2AL6 A;  4IWO A;  3VTW A;  2JF5 A;  3IG3 A;  2UYZ B;  2FUH B;  3NY5 A;  4W9C A;  4DBG A;  1EF5 A;  4W9E A;  3S2A A;  3ZLZ A;  4ANX A;  2M1M A;  1C3T A;  3DVN V;  3N32 A;  2C60 A;  2JY6 A;  5DPR A;  4A3P A;  3K9O B;  1VCB A;  1ZGU B;  2WX0 A;  3KW5 B;  3TL5 A;  4EFO A;  2FCN A;  5AEK B;  2K25 A;  3TBL D;  4AOF A;  2PEA A;  1V86 A;  3B08 A;  3X23 A;  1OGW A;  1JRU A;  1Z2M A;  2V4L A;  2L00 B;  2GBJ A;  2ZVO A;  4WJQ A;  1QZE A;  3TIX A;  3ZRF A;  2R2O A;  3OLM D;  3KH0 A;  5L95 C;  2KQS A;  3IHP C;  3DBR I;  1TGZ B;  4HK2 A;  4KZ0 A;  5E6N A;  2LAS A;  2D3G A;  3M62 B;  3R3M A;  4MM3 A;  3V62 A;  1IP9 A;  3QWZ B;  3AU5 A;  2JT4 B;  1L7Y A;  2NCN A;  2Z0D B;  3EEC A;  3QAR A;  3L08 A;  2FCS A;  4YL8 A;  2KJ6 A;  4NQK E;  2G4D B;  1H8C A;  1J19 A;  3PT2 B;  1WE6 A;  2L7R A;  2J0J A;  1RLF A;  3PV1 A;  2LXC A;  4JGH B;  2IBI B;  4MEM A;  4I6L B;  1MG8 A;  2OOB B;  2ZZP B;  3A4R A;  2MX2 A;  1WX9 A;  3VQI A;  4RMA A;  1IYF A;  2KTF A;  2N1V A;  5D7G A;  2ZNV C;  3L16 A;  5IAA C;  3AU4 A;  3IVF A;  4NAW B;  4DHZ B;  1L2N A;  2KOX A;  4K1R B;  2XK5 A;  4PYU A;  1WGG A;  4TQ1 A;  4MH0 E;  3TMP B;  3C0R B;  2LRW A;  3PHX B;  4W9H A;  2LVO A;  1J0G A;  2HD5 B;  5KHO A;  3HK0 A;  1E90 A;  4G50 A;  3P2B A;  4IM2 A;  4W9D A;  5BO4 B;  3DBS A;  4IW0 A;  5TR5 A;  2GBN A;  2KJR A;  1V80 A;  1LFD A;  2MBB B;  1WJN A;  4FBJ B;  4F1S A;  4FHK A;  4MJS A;  1F9J A;  2CHZ A;  1Z5S B;  2JXX A;  2EMT A;  3JSV A;  3RD2 A;  3RUL A;  1KOT A;  2JPH A;  4IG7 B;  4LDT B;  5DPW A;  4BOS C;  5E6O A;  5JHA A;  2O6V D;  1BT0 A;  2ASQ A;  3ONS A;  2MSE D;  2L3Z A;  2KTR B;  4J6I A;  4GDK A;  1TBE A;  3SHQ A;  4DHZ E;  3V60 A;  1E8Y A;  1WGY A;  4WJO A;  1UBI A;  3L0W B;  4IWP A;  4BKT A;  2K1F A;  3OJ3 A;  3JW0 X;  5GMV A;  2RPQ A;  1V81 A;  2RSU A;  2DYB A;  4AJW A;  1EUV B;  5DPT A;  3A1Q A;  2ZPY A;  1RFA A;  3ZDM C;  3NZS A;  3DVG X;  3GOE A;  2C5L C;  2FAZ A;  4PS7 A;  1IPG A;  2NVU I;  1YX5 B;  3AI5 A;  2KDE B;  4NJ7 A;  1UBQ A;  1E7V A;  2KC2 A;  3H7S A;  4HVB A;  4ZYN A;  2AL3 A;  5CHV C;  5D94 A;  2N4F A;  5DPS A;  3A1Q B;  3HM3 A;  3PRP B;  1I42 A;  1V9J A;  2WWZ A;  2D07 B;  3KUC B;  1GNU A;  4BKS A;  3M3J A;  2BYF A;  3NOB A;  3QQ8 B;  3VFK A;  2G45 B;  2L76 A;  4GDL A;  2DAF A;  4DK5 A;  3R7Q A;  2M0X A;  1WF9 A;  2DHZ A;  1EF1 A;  2IO1 B;  2KDI A;  3MTN B;  4ANV A;  4K7W A;  4W9L A;  3VDZ A;  4LCD E;  1UEL A;  1PQS A;  2D10 A;  1P1A A;  3V6E B;  3KVF B;  2HTH A;  2MLB A;  2LD9 A;  1WH3 A;  3M63 B;  2N9P C;  4G3X B;  4K7U A;  3KUD B;  1GC7 A;  4IWQ A;  2PE6 B;  4WJN A;  4F7Z A;  4DDI D;  2KVR A;  4WWN A;  4MGK E;  5JHB A;  1E8X A;  2J0K A;  2WX1 A;  3DDC B;  2FID A;  4EKU A;  4F8C B;  4HDQ A;  1NDD A;  4PYZ A;  2RGF A;  2LI5 A;  4B95 A;  1E5W A;  1GC6 A;  1SGH A;  3R66 C;  2AYO B;  2MA9 B;  3ZW3 A;  4K7S A;  1H4R A;  1WMH B;  2ZJD A;  1CMX B;  2RR9 A;  3WAL A;  4BBN C;  5J18 A;  1D3Z A;  2JRI B;  4NY0 A;  2DYO A;  2JWZ A;  2REX A;  4KDL B;  2KHW B;  4PS8 A;  4XX5 A;  3PSE B;  4FN2 A;  2N9E B;  4DHJ B;  3JSV B;  2MP2 A;  4ZRK A;  3DOW A;  2JZZ A;  2V1Y A;  1OQY A;  4HXD A;  5CHW A;  2JUO A;  3ZTC A;  4ANU A;  2JRH A;  5HKH A;  3R7R A;  3RUI B;  2IYD B;  3CF6 E;  2LZ6 A;  3QJZ A;  3UIO B;  4BFR A;  4MGI E;  3OJ4 B;  2L0T A;  3EHV A;  2K8B A;  2GBM A;  4PS3 A;  4B6W A;  3WAN A;  2J7Q B;  1LXD A;  4GDL B;  3PVL A;  2CU1 A;  4HDO A;  1XD3 B;  2MW5 A;  5E6P A;  3QK0 A;  4W9J A;  3HM6 X;  4AP4 C;  1WX8 A;  2J0M A;  2RD0 A;  2KNB A;  3HIZ A;  4IUM B;  1NBF C;  4HCP B;  5G2N A;  1UD7 A;  3ML8 A;  1ISN A;  3UIN B;  3UIP B;  1P0R A;  2GMI C;  2A4Z A;  3O65 B;  4GIV A;  1WM3 A;  2KK8 A;  2R2Q A;  3VH4 B;  1KJT A;  2KMC A;  2C9W B;  3L13 A;  4FUL A;  2KFK B;  2MBQ A;  3NZU A;  2BWE S;  2PJH A;  2K8H A;  3ML9 A;  3UF8 A;  3ZTD A;  2EKE C;  2OJR A;  4KIK B;  3SDL C;  4FA6 A;  3WAM A;  3V61 A;  2BKR B;  1Q1O A;  3GZN I;  4LJO B;  1WJ4 A;  2KLC A;  5KHQ A;  2MQJ A;  2PE9 A;  3QHT A;  2ZCB A;  2JZ3 B;  4ICU A;  2O2V B;  1RRB A;  4IM3 A;  5AZH A;  4GU2 A;  1YD8 U;  2HE7 A;  3ECI A;  5EDS A;  2WYQ A;  1J8C A;  3QCA A;  3KYD D;  3ZDT A;  2KN5 A;  3PRE A;  2BGF A;  4MDK E;  3A33 B;  1YX6 B;  3DCG A;  2BF8 B;  2NR2 A;  1Q0W B;  2MRP A;  1P3Q U;  3PTF C;  1YJ1 A;  5CTR C;  3CST A;  4GMV A;  1NI2 A;  3UQB A;  2LJ5 A;  4OVV A;  2LWP A;  4FJY A;  2KQ7 A;  3QIJ A;  3Q3F A;  4JIO U;  2KMA A;  4TKN A;  2LRU A;  2LGX A;  4W9G A;  2L05 A;  2IO0 B;  3CSF A;  2N9X A;  1GJZ A;  3B0A A;  3X0W A;  3DVG Y;  1SIF A;  3ZKJ C;  3UQA A;  3VHT C;  1WMH A;  2LXA A;  2ZPN A;  2KX3 A;  1WYW B;  1XQQ A;  2LVQ A;  2DZM A;  4ANW A;  3RT3 B;  3IFW B;  4NPN A;  1WGR A;  2XK5 B;  2WDT B;  2KFJ A;  1X1M A;  2D11 A;  3PRM B;  2LUE A;  4HJK A;  5AZF A;  3SD5 A;  2ZVN A;  3VUY A;  3ZO5 B;  1WR1 A;  2GBR A;  4EZL A;  4P7I A;  1P98 A;  4NQL B;  3VVW B;  3KYC D;  3Q3J A;  2MWS B;  4EZK A;  1EO6 A;  1RAX A;  2MBO A;  1V5T A;  3T9L A;  2KJH B;  2HJ8 A;  3PHW B;  1WZ3 A;  2FCM A;  2C7H A;  2O6V A;  2DEN B;  3OAW A;  4BOZ B;  4TQ0 A;  4W9K A;  4G11 A;  4AJY B;  4ICV A;  5G55 A;  2Z59 B;  2UWQ A;  4WQO B;  4KVG B;  4AWJ A;  4GDK B;  3BIN A;  4FJV B;  1Y8R C;  2YLM A;  2ZEQ A;  1ZW7 A;  2KFK A;  3LDZ E;  3PPA A;  3A9K A;  4MSM B;  1WXV A;  2KZR A;  1S3S G;  5LXI B;  3UGB B;  2DZI A;  3APD A;  2M4N A;  4NAW A;  3EFU A;  1OEY J;  2DZJ A;  4K81 A;  3H7P B;  3KUZ A;  3H9D A;  4EOY A;  2MCN B;  1WFY A;  1WRD B;  4IM0 A;  3ALB A;  3AUL A;  2BPS A;  2M8S A;  2V3S A;  4HPM B;  2FCQ A;  4WJP A;  1TTN A;  3IBE A;  3ZRC A;  3L17 A;  3I3T B;  2JVC A;  2BWF A;  3QAQ A;  2ZCC A;  4B9K A;  3U8Z A;  1HE8 A;  5L83 A;  1WXA A;  2A5U A;  1KLV A;  3DBL I;  3RYT A;  3ZIM A;  2MBH A;  2CR5 A;  2XBB C;  1G6J A;  5CX3 A;  3EC8 A;  4BKS D;  2K8C A;  2DX5 B;  1LQB A;  2PPH A;  3PRZ A;  2KX0 A;  2C7N B;  3L54 A;  3H1U A;  4II3 B;  2IY1 B;  1WE7 A;  3JYU A;  4DXA B;  3A9J B;  2N7D A;  2NBV B;  2K6D B;  3NHE B;  2G4S A;  3ZVV A;  4I6N B;  2IO3 B;  1M94 A;  2L8J A;  4GSW A;  1K8R B;  3DPD A;  4G0N B;  3QC8 B;  4BBN F;  4GN1 A;  4KIK A;  3A4S C;  3VTU A;  1V5O A;  4BKG A;  1E8W A;  2B3A A;  3N30 A;  4WWP A;  3VXW A;  2IO2 B;  3ZNH B;  4EEW A;  3PLU A;  2FNJ B;  4URK A;  2W9N A;  3PS6 A;  2EMS A;  2L0F A;  2YVC A;  4MEL A;  3AXC A;  3WA0 A;  3WAP A;  3MJW A;  4JLC A;  4AUQ C;  4X57 B;  4EZJ A;  1FXT B;  3APC A;  5AZG A;  3U7D A;  4JL9 A;  2O2V A;  2QHO A;  3A9K B;  4HPL B;  3WIM A;  4N9F 4;  1YIW A;  3U30 A;  1V49 A;  4NJ6 A;  4E71 A;  1LM8 B;  2M17 A;  4ASW C;  1WJU A;  4II2 B;  2D2Q A;  2KC1 A;  2DAJ A;  1WIA A;  5FR6 A;  1GG3 A;  3TCA A;  5C1Z A;  3MHS D;  1V6E A;  5D2M B;  4OVU A;  4CO7 A;  3D32 A;  5JZE B;  2O6V B;  4CHK A;  1E8Z A;  2CS4 A;  1AAR A;  1WY8 A;  4FJZ A;  1R4N I;  2DYM A;  2VRR B;  2IY0 B;  4DHJ D;  2KAN A;  3VTV A;  4M8N A;  4ZRJ A;  2BKF A;  3V6C B;  1GUA B;  3DQV A;  1C1Y B;  1UH6 A;  4DDG D;  2BYV E;  2NS5 A;  3NS8 A;  4M0W B;  2NPT A;  2GBK A;  2ZNV B;  1WI0 A;  4JQW C;  1XT9 B;  3PZD A;  3TJP A;  1WJ6 A; 
#chains in the Genus database with same CATH topology
 4LDT D;  1K51 A;  5JXV A;  4KZC A;  1JWU D;  2Y5B B;  3NVW A;  1Y56 A;  3GP7 A;  1KM7 A;  3ZQ4 A;  1OTR B;  2V4I B;  2LGY A;  2KKC A;  3QX1 A;  5GXG B;  1V2Y A;  4A3O A;  3T8M A;  4RNA A;  3RZF A;  4HCN B;  2CU3 A;  1ESF A;  4XC2 A;  5IA7 A;  2HJ1 A;  3ZUN A;  5C23 A;  4W9F A;  3W1S C;  2C7M B;  4WAA A;  4HLE A;  1FO4 A;  2K39 A;  3TUO A;  1KH0 A;  2K6Q A;  3DBH B;  2DLB A;  2DZK A;  1T0Y A;  1NVI D;  2BB6 A;  5FK9 C;  1WM2 A;  1B1Z A;  3W1Y A;  4YXD B;  3RFZ B;  3H7P A;  3RZW C;  4CYE A;  3AE6 B;  2NPT B;  2WGS A;  2RDB C;  1WX7 A;  2KDB A;  1I4R A;  2J52 A;  2LGD A;  1U4A A;  4LJP B;  1JRP A;  3DHG C;  2CHW A;  3AEC B;  2PMV A;  4BVU C;  3SU8 X;  1UGM A;  2W3R A;  1L4D B;  2KWV B;  2NBU A;  4Q2J A;  2ZW0 A;  5D6J B;  5HI1 A;  4E3C A;  2RDH A;  1WXS A;  4JE3 B;  3P42 A;  1WXM A;  4E74 A;  3VAW A;  2AEH A;  2KWC A;  3N3K B;  1N5W A;  3VTW A;  4HPP A;  1FIQ A;  4W9C A;  2SAK A;  4DBG A;  2JSV X;  4W9E A;  3S2A A;  4RF0 A;  1QKZ A;  5DPR A;  2C60 A;  3RNA C;  4EFO A;  2FCN A;  5EE9 A;  5AUI A;  2PEA A;  3B08 A;  2ICI A;  2VH2 A;  3X23 A;  1JRU A;  1TZO A;  1Z2M A;  2MEK A;  2L00 B;  2GBJ A;  3SFE B;  2MHJ A;  3CIR B;  1FMA D;  4PT5 A;  1CZP A;  2D3G A;  3V62 A;  4C7Y A;  4A6Q A;  3EA6 A;  3EEC A;  2WDV B;  3BYT B;  2FCS A;  4S17 A;  3PT2 B;  1WE6 A;  1C9F A;  4WH4 A;  1GPX A;  3RNE C;  1MI0 A;  3BWU D;  4JGH B;  4I6L B;  3A4R A;  4GLS C;  3VQI A;  3Q8F A;  5D7G A;  2DWQ A;  3IVF A;  3ZYY X;  4NAW B;  4L1B A;  4DHZ B;  2X38 A;  1HXY D;  1HQR D;  2LVO A;  4C80 A;  2HD5 B;  2M19 A;  4G50 A;  4W9D A;  4IW0 A;  2QMT A;  1LFD A;  2MBB B;  1WJN A;  2VZK D;  4FBJ B;  4YTM B;  3RD2 A;  1Z5S B;  1SE3 A;  1V1O A;  1KOT A;  2OED A;  1DOY A;  1FM0 D;  1VZ6 A;  3P4P B;  4XWT A;  3T3N A;  2MJ3 A;  4M01 A;  3V60 A;  2KWD A;  3AH7 A;  5GMV A;  1XEE A;  2DYB A;  1FFV A;  4AJW A;  2WXN A;  2ZPY A;  3ZDM C;  1JWB D;  3DVG X;  2NVU I;  1TIF A;  4NJ7 A;  3LXF A;  1UBQ A;  1FXA A;  5D94 A;  3RNG C;  5DPS A;  4YTN B;  1N63 A;  2VZK B;  2D07 B;  1MG4 A;  2BT6 A;  2WXH A;  4WIP A;  3M3J A;  2G45 B;  1MFW A;  1VDV A;  2L76 A;  1WF9 A;  2DHZ A;  3KQ4 A;  3W5V B;  4W9L A;  2BS2 B;  1PQS A;  2D10 A;  4RF1 A;  2MLB A;  3EGR A;  1WH3 A;  1NI3 A;  5BMI A;  1GC7 A;  1DGJ A;  1VZ7 A;  4IWQ A;  4WJN A;  4DDI D;  4CQN A;  2I38 A;  4WWN A;  5JHB A;  3DDC B;  4EKU A;  4F8C B;  1T5X D;  2LI5 A;  1GC6 A;  4NAM A;  2RR9 A;  3FAH A;  3GE8 C;  5BMG A;  5J18 A;  2KN4 A;  1D3Z A;  4NY0 A;  4PS8 A;  2KHW B;  1JWM D;  1E10 A;  1IBX B;  5FKA C;  1F0Z A;  1SJE D;  1B9R A;  3DOW A;  3ZTC A;  2JRH A;  5HKH A;  3BK2 A;  3R7R A;  3CF6 E;  2LZ6 A;  3NZ3 A;  2IGG A;  4XWW A;  2GBM A;  4B6W A;  4DXG A;  2KAC A;  2M56 B;  2NTS A;  2WXO A;  4HDO A;  5E6P A;  4MAC A;  4W9J A;  3HM6 X;  4C00 A;  4AP4 C;  1C76 A;  2RD0 A;  2J0M A;  2KNB A;  3SFD B;  1UD7 A;  1VR9 A;  2GMI C;  2INN E;  2INP E;  4RGO S;  2A4Z A;  3O65 B;  2Z8L A;  1KJT A;  2KMC A;  4ARC A;  2K8H A;  2QDF A;  3UF8 A;  1JRO A;  4M02 A;  3WAM A;  2BKR B;  1Q1O A;  1XXG A;  4LTU A;  3BVG A;  4LJO B;  2MQJ A;  1PFD A;  1RYJ A;  3TSS A;  1WSP A;  2PE9 A;  5H92 C;  2ZCB A;  4LK0 M;  4ICU A;  4P1B C;  3B9J A;  2GI9 A;  1GAQ B;  1J8C A;  2KN5 A;  3DCG A;  1YX6 B;  1YJ1 A;  4GMV A;  5I4D A;  4OVV A;  2KQ7 A;  2KMA A;  1QOA A;  2LGX A;  1SEB D;  2L05 A;  2L32 A;  2IO0 B;  1GJZ A;  3X0W A;  2IJ0 A;  3ZGZ A;  1SIF A;  2WXJ A;  2LXA A;  2DZM A;  1TT5 B;  1WGR A;  3U2S C;  4LNN A;  2KFJ A;  1E9M A;  1M4V A;  3AV8 A;  2IGH A;  1FNV A;  1ET6 A;  2GBR A;  4P7I A;  1P98 A;  3VVW B;  2MWS B;  4O1N A;  1RAX A;  3AN1 A;  3ZJV A;  1V5T A;  3T9L A;  1C79 A;  5LNK 1;  2FCM A;  4G11 A;  4ICV A;  5G55 A;  3BIN A;  1T0S C;  1ZW7 A;  2KFK A;  3A9K A;  4JX1 C;  2KZR A;  1S3S G;  4H2A A;  2DZI A;  2DZJ A;  1J7C A;  2MCN B;  4TSS A;  1WFY A;  2L52 A;  3ZRC A;  2FCQ A;  3I3T B;  3QAQ A;  1JQ4 A;  1ZDV A;  4XE0 A;  3U8Z A;  1SBB B;  1KLV A;  3RYT A;  3ZIM A;  2MBH A;  3BVZ A;  1G6J A;  3NJT A;  2X8X X;  3BZD B;  1HTQ A;  1FRR A;  1V1P B;  1WE7 A;  2NBV B;  3KLS X;  3NHE B;  2HTM E;  4B0E A;  1Q10 A;  1SIJ A;  4BKG A;  3ZNH B;  3P1M A;  3CWI A;  2YVC A;  1QF6 A;  3AXC A;  3P4S B;  4X57 B;  1TYG B;  4KGR A;  4XYC A;  2ONQ A;  4ITK A;  2KC1 A;  2DAJ A;  5FR6 A;  3TCA A;  3I5J C;  2RDG A;  4ZOH C;  1V6E A;  3D32 A;  5JZE B;  2O6V B;  1E8Z A;  4FJZ A;  2IY0 B;  4ZRJ A;  2V3P A;  4M0W B;  2BW2 A;  1KTK A;  4ACF A;  1DOI A;  1WJ6 A;  4A9A A;  1STE A;  4US9 A;  4GOC A;  3A9J A;  1TKG A;  1L0V B;  1I4G A;  2IPK D;  2I1K A;  3TEZ A;  4HWI B;  1CJE A;  3W2D A;  1LGR A;  3H6N A;  3PLV A;  1UZX B;  4MGZ E;  2QIL A;  4N59 A;  2MBE A;  3QA8 A;  4EUT A;  3W1S A;  1F2R I;  1RFK A;  3LJ3 A;  2N1W A;  4JPS A;  4I6P A;  3SR6 A;  4KDI C;  2IGD A;  2KD0 A;  2Z0E B;  3C19 A;  4KV2 A;  4RM8 A;  2KLG A;  2IZV B;  3K9P B;  3DWG C;  4TUU A;  4FLH A;  1N61 A;  1WR6 E;  1KF6 B;  3FKY A;  2KQ4 X;  4GGQ A;  3TEY A;  2N7E A;  4GB9 A;  2BYE A;  1IUE A;  3B1L X;  3ZXV A;  3E56 A;  1C4C A;  4GXB A;  4MSQ B;  3JVZ X;  2WXR A;  2D5G A;  1WGH A;  4P16 A;  1SE4 A;  3BY4 B;  4FHJ A;  1A70 A;  2GOW A;  2FIF A;  1A5R A;  2LFI A;  1I35 A;  1XLN A;  2LUM A;  4L2Y A;  2QC8 A;  4KKJ A;  1QIL A;  2M1M A;  1C3T A;  2JY6 A;  1VCB A;  2WX0 A;  3RNF C;  4XDD A;  4FXC A;  4AOF A;  1V86 A;  4WJQ A;  3AMZ A;  2R2O A;  3IHP C;  1PDX A;  2PLP A;  1TGZ B;  3HUI A;  4YSY B;  3MFG A;  2LAS A;  2IDY A;  1TJE A;  3M62 B;  1PUT A;  3R3M A;  4MM3 A;  1DYQ A;  3VR8 B;  3QWZ B;  3AU5 A;  2Z0D B;  3DBR B;  2Q5W D;  2WXF A;  2LEK A;  2G4D B;  1F77 A;  1J19 A;  2L7R A;  1RLF A;  3PV1 A;  3Q14 C;  1TY2 A;  2BS3 B;  1MG8 A;  2OOB B;  1IYF A;  2KTF A;  5G5H A;  3C8Y A;  4QAY A;  3FIL B;  1JAL A;  2KT7 A;  1MHH E;  4K1R B;  2XK5 A;  4PYU A;  1WGG A;  2LRW A;  4IDI A;  5KHO A;  2E6X A;  2L83 A;  1E90 A;  1E0Z A;  5BO4 B;  2KJR A;  1V8C A;  1I4P A;  1C77 A;  2PW9 A;  3JSV A;  1F9J A;  2JXX A;  5IP4 D;  4USA A;  5FR3 A;  1MVK A;  5DPW A;  4BOS C;  1NYR A;  2WU5 B;  5T8I A;  5JHA A;  2O6V D;  4KGT A;  4LLG M;  1TBE A;  3SHQ A;  3J9C A;  4DHZ E;  1E8Y A;  1WGY A;  1UBI A;  3L0W B;  4IWP A;  1EUV B;  3A1Q A;  4HJG E;  3NZS A;  2C5L C;  2FAZ A;  4PS7 A;  1CQV A;  1E7V A;  3Q8C A;  2UU7 A;  5CHV C;  1I42 A;  4K3C A;  2WXL A;  4BKS A;  3NOB A;  2RMM A;  1F2R C;  2DAF A;  3R7Q A;  3RI7 C;  2M0X A;  3AM9 A;  3MTN B;  3NUH B;  4K7W A;  4LCD E;  1HTO A;  2LD9 A;  3M63 B;  1EWY C;  1PGX A;  4K7U A;  2PE6 B;  4F7Z A;  4N6E B;  2J4X A;  4NZL B;  2WX1 A;  3WCQ A;  2W82 A;  1N6Z A;  4B95 A;  1SGH A;  2AYO B;  2K9X A;  5IKC M;  3WAL A;  4BBN C;  3TEX A;  2JRI B;  2DYO A;  2JWZ A;  4YT0 B;  2N9E B;  2MP2 A;  2QSD A;  2V1Y A;  2Y5C A;  5CHW A;  5C2T B;  3RUI B;  4BFR A;  4MGI E;  3OJ4 B;  2K8B A;  3WAN A;  2J7Q B;  5HG2 A;  1ZE3 D;  3PVL A;  2CU1 A;  2R61 A;  2MW5 A;  3QK0 A;  3AE2 B;  2Y5P A;  5G2N A;  4HCP B;  4GIV A;  3VH4 B;  2R2Q A;  2I2Y A;  1XLQ A;  3NZU A;  3PO0 A;  2EKE C;  4KIK B;  2JYE A;  2B76 B;  3GZN I;  1RRB A;  4IM3 A;  2G9H D;  4GU2 A;  5EDS A;  1IBX A;  2WYQ A;  3QCA A;  2AX5 A;  3ZDT A;  2BGF A;  1YN3 A;  3N20 C;  2BF8 B;  2NR2 A;  3PTF C;  5CTR C;  1R4N B;  2LJ5 A;  4FJY A;  3QIJ A;  1PGA A;  4JWS C;  2LRU A;  2LHE A;  2W55 A;  3AE4 B;  1ACC A;  1I7H A;  2N9X A;  3HRD D;  3UQA A;  3VHT C;  1XQQ A;  1PYW D;  2PTL A;  3RT3 B;  3IFW B;  2XNA C;  1YJI A;  1X1M A;  3PRM B;  4HJK A;  3ZO5 B;  3KYC D;  4RH6 A;  2JXT A;  1QLB B;  4EZK A;  2M0A A;  3L4P A;  3PHW B;  2HJ8 A;  1WZ3 A;  3MHZ A;  3OAW A;  4TQ0 A;  1FCC C;  4W9K A;  2Z59 B;  4AWJ A;  3Q2A C;  4GDK B;  1QOG A;  1RWS A;  1D5X C;  1Y8R C;  3P4Q B;  1KFY B;  1R4M B;  1AYF A;  3PPA A;  2PIA A;  4MH8 A;  3Q8B A;  2M4N A;  4NAW A;  1TKE A;  3KUZ A;  3AE8 B;  1WRD B;  4IM0 A;  1T0R C;  1KLG D;  4WJP A;  1TTN A;  3L17 A;  2JVC A;  1WYG A;  2ZCC A;  3NVZ A;  5EE3 A;  2A5U A;  1MPE A;  3DBL I;  2CR5 A;  2DX5 B;  4OZC A;  4JWU C;  3L54 A;  3ZJU A;  2IY1 B;  2GB1 A;  3JYU A;  2ON8 A;  3IXS A;  3AED B;  2K6D B;  1FEH A;  3IT4 B;  3NG0 A;  1M94 A;  1OFF A;  3DPD A;  3QC8 B;  4GN1 A;  4KIK A;  1D5M C;  3A4S C;  2INC C;  1E8W A;  3N30 A;  4WWP A;  2IO2 B;  2LMC A;  2W9N A;  4MEL A;  3WAP A;  4WUR A;  3WA0 A;  1SE2 A;  3MJW A;  4C56 C;  1FXT B;  3APC A;  5AZG A;  4JL9 A;  2QHO A;  3A9K B;  4HPL B;  4XGA B;  1YIW A;  1UF0 A;  4E71 A;  1LM8 B;  4ZRP A;  2D2Q A;  2DNF A;  1WIA A;  1GG3 A;  3ABV B;  5BYR A;  4CO7 A;  4CHK A;  2CS4 A;  1AAR A;  5G5G A;  3DWM A;  3T3O A;  3VTV A;  4N58 A;  1GUA B;  1I4Q A;  2LHD A;  5D3D A;  2BYV E;  2FUG 1;  3B2G A;  4JQW C;  4TMA B;  3BYY B;  1TS5 A;  4DHJ B;  3TJP A;  2WXK A;  2WDR B;  3VUW A;  2K5P A;  2AWT A;  2KDF B;  2WQY B;  2WXG A;  3PZ8 A;  1GB4 A;  3RNB C;  4IC7 B;  3L10 B;  4FAD A;  4DQO C;  3ENE A;  4RGT A;  2NTT A;  1UWM A;  3P63 A;  4A20 A;  4RM9 A;  2KXJ A;  3M95 A;  3AEE B;  4MGY E;  2XEW A;  1P9D U;  2CKH B;  3CMM B;  4MM3 B;  1XF5 L;  3ZNZ B;  4W9I A;  1R4M I;  5C3J B;  2JU6 X;  1QQR A;  3ZNG C;  1PGB A;  5J17 A;  1TZ1 A;  3DBH I;  4HRO A;  2EKI A;  2KO3 A;  2KTR A;  1VD2 A;  4A8X C;  1ENF A;  2LJI A;  2LGS A;  4WWO A;  3FIL A;  3ZNI D;  2N7J A;  4C4V B;  4ZYS A;  1FCL A;  3HHM A;  5EE0 A;  4LNO A;  5DCN A;  2W54 A;  4KSL C;  3V05 A;  1SE9 A;  4KSK C;  3GS2 A;  3W5U B;  1WZ0 A;  3VH3 B;  4YWG G;  1E7U A;  2JYT A;  2KWU B;  3VUX A;  2CHX A;  3MP9 A;  4UDU C;  2AL6 A;  4IWO A;  2JQR B;  1HZ6 A;  2ZW1 A;  3IG3 A;  4J3O D;  1FPY A;  3NY5 A;  2FUH B;  1EF5 A;  5BYQ A;  3IAS 1;  3ZLZ A;  4ANX A;  2JZP A;  3N1Y C;  3DVN V;  3N32 A;  4A3P A;  3K9O B;  3LYY A;  3KW5 B;  3TL5 A;  1QT9 A;  4BAX A;  1OGW A;  2WXI A;  3PZ7 A;  4A55 A;  2VH1 A;  2ZVO A;  1E7P B;  3TIX A;  3OLM D;  5L95 C;  1D6E C;  1JW9 D;  3EUB 2;  4HK2 A;  5E6N A;  3Q3N C;  1HZ5 A;  3Q3M C;  2JT4 B;  1L7Y A;  2NCN A;  3QAR A;  1KLU D;  1VJK A;  2KJ6 A;  4NQK E;  1ZP0 B;  2LXC A;  2IBI B;  4MEM A;  2ZZP B;  1WX9 A;  4RMA A;  2N1V A;  3AB5 A;  5IAA C;  2WS3 B;  1XCT L;  2CJO A;  1C4A A;  2WXQ A;  1L2N A;  4TQ1 A;  3TMP B;  1ZXH A;  3C0R B;  1VLB A;  2QEJ C;  4ZHO A;  1D4B A;  2N9K A;  4US8 A;  3HK0 A;  3P2B A;  4IM2 A;  3DBS A;  5TR5 A;  2GBN A;  1EU3 A;  1FFU A;  2XN9 C;  3RUL A;  2JPH A;  1YOV B;  4IG7 B;  3SEB A;  1ZXI A;  3ZJT A;  3AE7 B;  1BT0 A;  4KGS A;  1NYQ A;  2MSE D;  5BYS A;  2L3Z A;  2KTR B;  3FC4 A;  4WJO A;  1GB1 A;  2D3C A;  4BKT A;  2K1F A;  3OJ3 A;  3JW0 X;  1V81 A;  2E3T A;  5DPT A;  1L6U A;  1FRD A;  4LNF A;  2KYW A;  2BQQ A;  1IPG A;  1YX5 B;  4A90 A;  2H88 B;  2KDE B;  1YNT E;  4IKG A;  2HDE A;  3H7S A;  4ZYN A;  2AL3 A;  3Q6B A;  2N4F A;  3HM3 A;  3PRP B;  2MH7 A;  3AEB B;  1GNU A;  2BYF A;  3QQ8 B;  1V1P A;  4GDL A;  4DK5 A;  3R8B A;  1FD6 A;  2KDI A;  4ANV A;  4BZA A;  1UEL A;  1P1A A;  3KWV A;  3V6E B;  4S0R A;  1XLP A;  2HTH A;  2N9P C;  2PKO A;  4MGK E;  2J0K A;  4DXF A;  1UGJ A;  4PYZ A;  2AQ1 B;  2RGF A;  3R66 C;  2MA9 B;  3ZW3 A;  1CMX B;  4P1C C;  2REX A;  4XX5 A;  3PSE B;  4FN2 A;  3JSV B;  4ZRK A;  2JZZ A;  3EFC A;  4WWM A;  4HXD A;  2JUO A;  1T0Q C;  2J53 A;  2IYD B;  3QJZ A;  2WXM A;  3EHV A;  4PS3 A;  3W9C B;  3GE3 C;  4GDL B;  1EU4 A;  4M0W A;  2K22 A;  1XD3 B;  3B2F A;  3NS1 A;  5MPO A;  4IUM B;  1NEN B;  1NBF C;  3ML8 A;  1ISN A;  2W3S A;  1AW7 A;  1P7F A;  2KK8 A;  2C9W B;  3L13 A;  4FUL A;  2KMM A;  3ML9 A;  1L4Z B;  1YQ4 B;  1T6B X;  4FA6 A;  3SDL C;  3V61 A;  2KVZ A;  3NVV A;  2KLC A;  3U4E G;  5KHQ A;  2WHI A;  3QHT A;  2O2V B;  1ROE A;  1T3Q A;  5AZH A;  5HFY A;  3ECI A;  3GZN B;  2OHF A;  2WP9 B;  3A33 B;  1TS4 A;  1Q0W B;  2D3B A;  4L23 A;  1NI2 A;  1RM6 C;  2LWP A;  4JIO U;  3Q3F A;  3BK1 A;  4WQM A;  1L6V A;  4W9G A;  4ZRQ A;  1I4X A;  1QOF A;  3DVG Y;  3ZKJ C;  1YJJ A;  1WMH A;  2ZPN A;  1WYW B;  2LVQ A;  4ANW A;  2D11 A;  5AZF A;  1WR1 A;  4EZL A;  3Q3J A;  2BVC A;  4WAF A;  2KJH B;  2TSS A;  2C7H A;  2DEN B;  4BOZ B;  4ARI A;  1TS3 A;  2UWQ A;  4WQO B;  1CK1 A;  4KVG B;  4RGN A;  2YLM A;  1UUP A;  1P7E A;  3RN9 C;  1TY0 A;  3LDZ E;  4MSM B;  1UWX A;  1MJD A;  3UGB B;  2BYT A;  1OEY J;  1E6E B;  3H9D A;  3AUL A;  2M8S A;  2V3S A;  3IBE A;  3URY A;  4B9K A;  5L83 A;  4IOI E;  2IND C;  1LQB A;  3PRZ A;  2KX0 A;  4II3 B;  2N7D A;  4OW0 A;  3Q69 A;  4HEA 1;  5AUK A;  1D5Z C;  4I6N B;  2IO3 B;  3N9Y C;  3OWE B;  4BBN F;  1YN5 A;  4OZA A;  3PS6 A;  5D3I B;  4AUQ C;  4EZJ A;  3U7D A;  1JWA D;  2O2V A;  3WIM A;  3RNC C;  3U30 A;  4NJ6 A;  2WXP A;  2M17 A;  5C1Z A;  4RFB A;  3MHS D;  5D2M B;  1WY8 A;  1LO5 D;  1R4N I;  2DYM A;  1WRI A;  3V6C B;  3DQV A;  4DDG D;  3NS8 A;  1FNW A;  2NPT A;  1VZ8 A;  1SJH D;  3IT6 B;  4KKI A;  2MJD A;  1XT9 B;  5BMH A;  1OEY A;  4XZ4 A;  4XDC A;  1S1Q B;  1WGD A;  2SEB D;  1YQB A;  1YN4 A;  5H8Y E;  4TV3 A;  3UI3 A;  3RMK C;  5J2R A;  1Q5W B;  3ETR A;  2MP2 B;  1N5X A;  4ZDV A;  5JH5 C;  3R2T A;  3DVN U;  3KWL A;  2G3Q B;  1ZDX A;  1ZKH A;  2LGI A;  2ACZ B;  1AN8 A;  3WAO A;  4NJC A;  3BII D;  2QJL A;  4MJS B;  4R3D A;  4M8M A;  5LXH A;  4HKQ A;  1I4H A;  2I1J A;  3RCZ A;  4DWF A;  1FNU A;  2H89 B;  2WU2 B;  3GB1 A;  5CHF A;  1N60 A;  3PGE A;  2NBW B;  2LVP A;  3APF A;  3MC0 B;  4NNJ B;  4ZRI A;  4EE2 A;  1UNS A;  3I63 C;  5LLI A;  1XO3 A;  2JF5 A;  3HVZ A;  2UYZ B;  2WLB A;  4REZ A;  3AE5 B;  2FE8 A;  2EEL A;  1ZGU B;  2GRI A;  5IO9 A;  5AEK B;  2K25 A;  4HKZ E;  3TBL D;  5TSS A;  2YEP B;  1SSN A;  2V4L A;  1QZE A;  3ZRF A;  3KH0 A;  2KQS A;  1DOX A;  1TKY A;  3DBR I;  4AS1 A;  4ZHP A;  2D3A A;  2BS4 B;  4KZ0 A;  3AEA B;  3AEF B;  2KAJ A;  1IP9 A;  3L08 A;  4YL8 A;  1H8C A;  4YSX B;  3NVY A;  2J0J A;  3O13 A;  1K53 A;  2MX2 A;  1JCK B;  3I9V 1;  1N62 A;  2ZNV C;  3L16 A;  3AU4 A;  1HEZ E;  4OZB A;  2WNM A;  2KOX A;  4MH0 E;  4W9H A;  3PHX B;  1J0G A;  1FXI A;  4OHJ A;  1EM7 A;  2K3U A;  1V80 A;  2L1A A;  1OQQ A;  3V3X A;  4F1S A;  4FHK A;  4MJS A;  1OQR A;  2CHZ A;  1BML C;  1IGC A;  2EMT A;  1L0X B;  2KDM A;  4LDT B;  5E6O A;  2ASQ A;  3ONS A;  2V3N A;  4J6I A;  4GDK A;  1K50 A;  3U52 E;  3TEW A;  2FBW B;  4PK1 A;  2RPQ A;  2RSU A;  1BUI C;  1RFA A;  1XLO A;  3GOE A;  3Q3O C;  3AI5 A;  2NMQ A;  2G1E A;  3LB8 C;  2KC2 A;  1XCQ L;  4HVB A;  4YTP B;  3RPF C;  3A1Q B;  2Y3A A;  5EE1 A;  1QOB A;  1V9J A;  2WWZ A;  1AWD A;  4B0M A;  4YSZ B;  3KUC B;  1V97 A;  3VFK A;  2QCZ A;  1EF1 A;  2IO1 B;  2N0S B;  3VDZ A;  2AQ2 B;  3KVF B;  4G3X B;  3KUD B;  2KVR A;  1KRH A;  1E8X A;  1ZUD 2;  2FID A;  4HDQ A;  1NDD A;  3E9S A;  1E5W A;  1GOZ A;  2OJW A;  4K7S A;  3U7Z A;  1H4R A;  1WMH B;  1L0Y B;  2ZJD A;  2MJE A;  4KDL B;  4C7Z A;  4KX6 B;  3H8H A;  1OQY A;  4ANU A;  4MT5 A;  4D2K A;  3UIO B;  2L0T A;  1VRA B;  1LXD A;  2V9H A;  2K0P A;  2PVO D;  1YMH E;  1WX8 A;  1ZPS A;  3N1X C;  1SB3 C;  5E6J A;  3HIZ A;  3UIP B;  3UIN B;  1P0R A;  2PVG C;  1WM3 A;  3MC9 A;  4OVZ A;  2KFK B;  1J7B A;  2MBQ A;  3DHI C;  2BWE S;  2PJH A;  3R2I A;  3DHH C;  3ZTD A;  2OJR A;  2V0G A;  2WDQ B;  1WJ4 A;  1F1H A;  3I57 A;  4RCO A;  2JZ3 B;  1WGK A;  3VR9 B;  1YD8 U;  2HE7 A;  5HHD G;  3KYD D;  3PRE A;  1C4P A;  4MDK E;  3VRA B;  2BTE A;  2MRP A;  1P3Q U;  3CST A;  4LNK A;  3UQB A;  3IAM 1;  4TKN A;  4K3B A;  1SXT A;  3CSF A;  3AE3 B;  3B0A A;  2CJN A;  1C78 A;  1JML A;  2JWU A;  2AQ3 B;  2BB5 A;  2JX5 A;  2KX3 A;  4C4V A;  1YQ3 B;  4NPN A;  3Q8A A;  2XK5 B;  2WDT B;  3MJ5 A;  2LUE A;  3VUY A;  3SD5 A;  2ZVN A;  2RPV A;  4NQL B;  3VRB B;  1ZOY B;  1HA5 A;  4AQ7 A;  3MC8 A;  1EO6 A;  3AE1 B;  2MBO A;  3BVM A;  3OG5 A;  2O6V A;  4P6V F;  4AJY B;  3NRZ A;  4FJV B;  2ZEQ A;  3N1Z C;  1WXV A;  3AEG B;  5LXI B;  3Q8E A;  3APD A;  3EFU A;  1J7A A;  4K81 A;  3H7P B;  1WWT A;  3DBL B;  4EOY A;  1ET9 A;  1EWC A;  1SF0 A;  2BBC A;  2J42 A;  3ALB A;  2BPS A;  4HPM B;  3ZXR A;  2BWF A;  1HE8 A;  1WXA A;  5IOI A;  2XBB C;  2GLS A;  5CX3 A;  1MHX A;  3EC8 A;  4BKS D;  2K8C A;  4LNI A;  2PPH A;  2C7N B;  1TS2 A;  3H1U A;  1BXT A;  4DXA B;  1NEK B;  2DBY A;  3A9J B;  1WXQ A;  2G4S A;  3ZVV A;  2L8J A;  4GSW A;  1K8R B;  3AE9 B;  4G0N B;  3VTU A;  3HVD A;  1V5O A;  2B3A A;  3VXW A;  5IN7 A;  4EEW A;  1K52 A;  2FNJ B;  3PLU A;  4URK A;  2EMS A;  2L0F A;  4JLC A;  4HRS A;  1R7S A;  4N9F 4;  4M00 A;  1V49 A;  3P4R B;  4ASW C;  1WJU A;  4II2 B;  2N9L A;  4OVU A;  4RGM A;  2QIE B;  1F52 A;  2VRR B;  4DHJ D;  2KAN A;  4M8N A;  2BKF A;  1JWS D;  1UH6 A;  1C1Y B;  1L5P A;  1IGD A;  2NS5 A;  2YEP F;  2GBK A;  2ZNV B;  1WI0 A;  3PZD A; 
#chains in the Genus database with same CATH homology
 4LDT D;  4KZC A;  3VUW A;  2KDF B;  2AWT A;  1OEY A;  4GOC A;  3A9J A;  4XZ4 A;  2Y5B B;  1S1Q B;  1WGD A;  2I1K A;  4HWI B;  1YQB A;  4IC7 B;  3L10 B;  3H6N A;  3PLV A;  4FAD A;  1KM7 A;  1UZX B;  3ENE A;  4MGZ E;  4TV3 A;  1OTR B;  2LGY A;  2KKC A;  3QX1 A;  1V2Y A;  4A3O A;  3T8M A;  3RZF A;  2MBE A;  3QA8 A;  5J2R A;  1Q5W B;  4HCN B;  4EUT A;  4A20 A;  2MP2 B;  4XC2 A;  4RM9 A;  3W1S A;  3ZUN A;  4ZDV A;  5IA7 A;  5JH5 C;  5C23 A;  4W9F A;  3W1S C;  2C7M B;  3LJ3 A;  2N1W A;  4WAA A;  4HLE A;  2KXJ A;  3M95 A;  2K39 A;  3DVN U;  2G3Q B;  4I6P A;  4MGY E;  1ZKH A;  2Z0E B;  2KD0 A;  4KDI C;  4KV2 A;  2XEW A;  1P9D U;  2KLG A;  4RM8 A;  2K6Q A;  2CKH B;  3CMM B;  3WAO A;  2IZV B;  3ZNZ B;  3K9P B;  2DZK A;  4W9I A;  1R4M I;  1T0Y A;  4MJS B;  4TUU A;  1WM2 A;  3ZNG C;  3W1Y A;  4FLH A;  5J17 A;  1TZ1 A;  1WR6 E;  4M8M A;  3DBH I;  3H7P A;  3RZW C;  4CYE A;  5LXH A;  4GGQ A;  2KO3 A;  2NPT B;  2KTR A;  1VD2 A;  2I1J A;  3RCZ A;  4DWF A;  2N7E A;  1WX7 A;  2KDB A;  4GB9 A;  2BYE A;  2LGD A;  1U4A A;  4LJP B;  4WWO A;  3B1L X;  2CHW A;  3ZNI D;  5CHF A;  3HHM A;  4GXB A;  4BVU C;  5DCN A;  4MSQ B;  3JVZ X;  1UGM A;  3SU8 X;  3PGE A;  4KSL C;  1WGH A;  2KWV B;  2NBU A;  2NBW B;  1SE9 A;  2LVP A;  5D6J B;  3BY4 B;  4KSK C;  3APF A;  4FHJ A;  4E3C A;  4E74 A;  1WXS A;  1WZ0 A;  3VH3 B;  1WXM A;  4NNJ B;  4ZRI A;  2GOW A;  2FIF A;  3VAW A;  2AEH A;  2KWC A;  1E7U A;  1A5R A;  2KWU B;  3VUX A;  1I35 A;  2CHX A;  3N3K B;  5LLI A;  2AL6 A;  4IWO A;  3VTW A;  2JF5 A;  3IG3 A;  2UYZ B;  2FUH B;  3NY5 A;  4W9C A;  4DBG A;  1EF5 A;  4W9E A;  3S2A A;  3ZLZ A;  4ANX A;  2M1M A;  1C3T A;  3DVN V;  3N32 A;  2C60 A;  2JY6 A;  5DPR A;  4A3P A;  3K9O B;  1VCB A;  1ZGU B;  2WX0 A;  3KW5 B;  3TL5 A;  4EFO A;  2FCN A;  5AEK B;  2K25 A;  3TBL D;  4AOF A;  2PEA A;  1V86 A;  3B08 A;  3X23 A;  1OGW A;  1JRU A;  1Z2M A;  2V4L A;  2L00 B;  2GBJ A;  2ZVO A;  4WJQ A;  1QZE A;  3TIX A;  3ZRF A;  2R2O A;  3OLM D;  3KH0 A;  5L95 C;  2KQS A;  3IHP C;  3DBR I;  1TGZ B;  4HK2 A;  4KZ0 A;  5E6N A;  2LAS A;  2D3G A;  3M62 B;  3R3M A;  4MM3 A;  3V62 A;  1IP9 A;  3QWZ B;  3AU5 A;  2JT4 B;  1L7Y A;  2NCN A;  2Z0D B;  3EEC A;  3QAR A;  3L08 A;  2FCS A;  4YL8 A;  2KJ6 A;  4NQK E;  2G4D B;  1H8C A;  1J19 A;  3PT2 B;  1WE6 A;  2L7R A;  2J0J A;  1RLF A;  3PV1 A;  2LXC A;  4JGH B;  2IBI B;  4MEM A;  4I6L B;  1MG8 A;  2OOB B;  2ZZP B;  3A4R A;  2MX2 A;  1WX9 A;  3VQI A;  4RMA A;  1IYF A;  2KTF A;  2N1V A;  5D7G A;  2ZNV C;  3L16 A;  5IAA C;  3AU4 A;  3IVF A;  4NAW B;  4DHZ B;  1L2N A;  2KOX A;  4K1R B;  2XK5 A;  4PYU A;  1WGG A;  4TQ1 A;  4MH0 E;  3TMP B;  3C0R B;  2LRW A;  3PHX B;  4W9H A;  2LVO A;  1J0G A;  2HD5 B;  5KHO A;  3HK0 A;  1E90 A;  4G50 A;  3P2B A;  4IM2 A;  4W9D A;  5BO4 B;  3DBS A;  4IW0 A;  5TR5 A;  2GBN A;  2KJR A;  1V80 A;  1LFD A;  2MBB B;  1WJN A;  4FBJ B;  4F1S A;  4FHK A;  4MJS A;  1F9J A;  2CHZ A;  1Z5S B;  2JXX A;  2EMT A;  3JSV A;  3RD2 A;  3RUL A;  1KOT A;  2JPH A;  4IG7 B;  4LDT B;  5DPW A;  4BOS C;  5E6O A;  5JHA A;  2O6V D;  1BT0 A;  2ASQ A;  3ONS A;  2MSE D;  2L3Z A;  2KTR B;  4J6I A;  4GDK A;  1TBE A;  3SHQ A;  4DHZ E;  3V60 A;  1E8Y A;  1WGY A;  4WJO A;  1UBI A;  3L0W B;  4IWP A;  4BKT A;  2K1F A;  3OJ3 A;  3JW0 X;  5GMV A;  2RPQ A;  1V81 A;  2RSU A;  2DYB A;  4AJW A;  1EUV B;  5DPT A;  3A1Q A;  2ZPY A;  1RFA A;  3ZDM C;  3NZS A;  3DVG X;  3GOE A;  2C5L C;  2FAZ A;  4PS7 A;  1IPG A;  2NVU I;  1YX5 B;  3AI5 A;  2KDE B;  4NJ7 A;  1UBQ A;  1E7V A;  2KC2 A;  3H7S A;  4HVB A;  4ZYN A;  2AL3 A;  5CHV C;  5D94 A;  2N4F A;  5DPS A;  3A1Q B;  3HM3 A;  3PRP B;  1I42 A;  1V9J A;  2WWZ A;  2D07 B;  3KUC B;  1GNU A;  4BKS A;  3M3J A;  2BYF A;  3NOB A;  3QQ8 B;  3VFK A;  2G45 B;  2L76 A;  4GDL A;  2DAF A;  4DK5 A;  3R7Q A;  2M0X A;  1WF9 A;  2DHZ A;  1EF1 A;  2IO1 B;  2KDI A;  3MTN B;  4ANV A;  4K7W A;  4W9L A;  3VDZ A;  4LCD E;  1UEL A;  1PQS A;  2D10 A;  1P1A A;  3V6E B;  3KVF B;  2HTH A;  2MLB A;  2LD9 A;  1WH3 A;  3M63 B;  2N9P C;  4G3X B;  4K7U A;  3KUD B;  1GC7 A;  4IWQ A;  2PE6 B;  4WJN A;  4F7Z A;  4DDI D;  2KVR A;  4WWN A;  4MGK E;  5JHB A;  1E8X A;  2J0K A;  2WX1 A;  3DDC B;  2FID A;  4EKU A;  4F8C B;  4HDQ A;  1NDD A;  4PYZ A;  2RGF A;  2LI5 A;  4B95 A;  1E5W A;  1GC6 A;  1SGH A;  3R66 C;  2AYO B;  2MA9 B;  3ZW3 A;  4K7S A;  1H4R A;  1WMH B;  2ZJD A;  1CMX B;  2RR9 A;  3WAL A;  4BBN C;  5J18 A;  1D3Z A;  2JRI B;  4NY0 A;  2DYO A;  2JWZ A;  2REX A;  4KDL B;  2KHW B;  4PS8 A;  4XX5 A;  3PSE B;  4FN2 A;  2N9E B;  4DHJ B;  3JSV B;  2MP2 A;  4ZRK A;  3DOW A;  2JZZ A;  2V1Y A;  1OQY A;  4HXD A;  5CHW A;  2JUO A;  3ZTC A;  4ANU A;  2JRH A;  5HKH A;  3R7R A;  3RUI B;  2IYD B;  3CF6 E;  2LZ6 A;  3QJZ A;  3UIO B;  4BFR A;  4MGI E;  3OJ4 B;  2L0T A;  3EHV A;  2K8B A;  2GBM A;  4PS3 A;  4B6W A;  3WAN A;  2J7Q B;  1LXD A;  4GDL B;  3PVL A;  2CU1 A;  4HDO A;  1XD3 B;  2MW5 A;  5E6P A;  3QK0 A;  4W9J A;  3HM6 X;  4AP4 C;  1WX8 A;  2J0M A;  2RD0 A;  2KNB A;  3HIZ A;  4IUM B;  1NBF C;  4HCP B;  5G2N A;  1UD7 A;  3ML8 A;  1ISN A;  3UIN B;  3UIP B;  1P0R A;  2GMI C;  2A4Z A;  3O65 B;  4GIV A;  1WM3 A;  2KK8 A;  2R2Q A;  3VH4 B;  1KJT A;  2KMC A;  2C9W B;  3L13 A;  4FUL A;  2KFK B;  2MBQ A;  3NZU A;  2BWE S;  2PJH A;  2K8H A;  3ML9 A;  3UF8 A;  3ZTD A;  2EKE C;  2OJR A;  4KIK B;  3SDL C;  4FA6 A;  3WAM A;  3V61 A;  2BKR B;  1Q1O A;  3GZN I;  4LJO B;  1WJ4 A;  2KLC A;  5KHQ A;  2MQJ A;  2PE9 A;  3QHT A;  2ZCB A;  2JZ3 B;  4ICU A;  2O2V B;  1RRB A;  4IM3 A;  5AZH A;  4GU2 A;  1YD8 U;  2HE7 A;  3ECI A;  5EDS A;  2WYQ A;  1J8C A;  3QCA A;  3KYD D;  3ZDT A;  2KN5 A;  3PRE A;  2BGF A;  4MDK E;  3A33 B;  1YX6 B;  3DCG A;  2BF8 B;  2NR2 A;  1Q0W B;  2MRP A;  1P3Q U;  3PTF C;  1YJ1 A;  5CTR C;  3CST A;  4GMV A;  1NI2 A;  3UQB A;  2LJ5 A;  4OVV A;  2LWP A;  4FJY A;  2KQ7 A;  3QIJ A;  3Q3F A;  4JIO U;  2KMA A;  4TKN A;  2LRU A;  2LGX A;  4W9G A;  2L05 A;  2IO0 B;  3CSF A;  2N9X A;  1GJZ A;  3B0A A;  3X0W A;  3DVG Y;  1SIF A;  3ZKJ C;  3UQA A;  3VHT C;  1WMH A;  2LXA A;  2ZPN A;  2KX3 A;  1WYW B;  1XQQ A;  2LVQ A;  2DZM A;  4ANW A;  3RT3 B;  3IFW B;  4NPN A;  1WGR A;  2XK5 B;  2WDT B;  2KFJ A;  1X1M A;  2D11 A;  3PRM B;  2LUE A;  4HJK A;  5AZF A;  3SD5 A;  2ZVN A;  3VUY A;  3ZO5 B;  1WR1 A;  2GBR A;  4EZL A;  4P7I A;  1P98 A;  4NQL B;  3VVW B;  3KYC D;  3Q3J A;  2MWS B;  4EZK A;  1EO6 A;  1RAX A;  2MBO A;  1V5T A;  3T9L A;  2KJH B;  2HJ8 A;  3PHW B;  1WZ3 A;  2FCM A;  2C7H A;  2O6V A;  2DEN B;  3OAW A;  4BOZ B;  4TQ0 A;  4W9K A;  4G11 A;  4AJY B;  4ICV A;  5G55 A;  2Z59 B;  2UWQ A;  4WQO B;  4KVG B;  4AWJ A;  4GDK B;  3BIN A;  4FJV B;  1Y8R C;  2YLM A;  2ZEQ A;  1ZW7 A;  2KFK A;  3LDZ E;  3PPA A;  3A9K A;  4MSM B;  1WXV A;  2KZR A;  1S3S G;  5LXI B;  3UGB B;  2DZI A;  3APD A;  2M4N A;  4NAW A;  3EFU A;  1OEY J;  2DZJ A;  4K81 A;  3H7P B;  3KUZ A;  3H9D A;  4EOY A;  2MCN B;  1WFY A;  1WRD B;  4IM0 A;  3ALB A;  3AUL A;  2BPS A;  2M8S A;  2V3S A;  4HPM B;  2FCQ A;  4WJP A;  1TTN A;  3IBE A;  3ZRC A;  3L17 A;  3I3T B;  2JVC A;  2BWF A;  3QAQ A;  2ZCC A;  4B9K A;  3U8Z A;  1HE8 A;  5L83 A;  1WXA A;  2A5U A;  1KLV A;  3DBL I;  3RYT A;  3ZIM A;  2MBH A;  2CR5 A;  2XBB C;  1G6J A;  5CX3 A;  3EC8 A;  4BKS D;  2K8C A;  2DX5 B;  1LQB A;  2PPH A;  3PRZ A;  2KX0 A;  2C7N B;  3L54 A;  3H1U A;  4II3 B;  2IY1 B;  1WE7 A;  3JYU A;  4DXA B;  3A9J B;  2N7D A;  2NBV B;  2K6D B;  3NHE B;  2G4S A;  3ZVV A;  4I6N B;  2IO3 B;  1M94 A;  2L8J A;  4GSW A;  1K8R B;  3DPD A;  4G0N B;  3QC8 B;  4BBN F;  4GN1 A;  4KIK A;  3A4S C;  3VTU A;  1V5O A;  4BKG A;  1E8W A;  2B3A A;  3N30 A;  4WWP A;  3VXW A;  2IO2 B;  3ZNH B;  4EEW A;  3PLU A;  2FNJ B;  4URK A;  2W9N A;  3PS6 A;  2EMS A;  2L0F A;  2YVC A;  4MEL A;  3AXC A;  3WA0 A;  3WAP A;  3MJW A;  4JLC A;  4AUQ C;  4X57 B;  4EZJ A;  1FXT B;  3APC A;  5AZG A;  3U7D A;  4JL9 A;  2O2V A;  2QHO A;  3A9K B;  4HPL B;  3WIM A;  4N9F 4;  1YIW A;  3U30 A;  1V49 A;  4NJ6 A;  4E71 A;  1LM8 B;  2M17 A;  4ASW C;  1WJU A;  4II2 B;  2D2Q A;  2KC1 A;  2DAJ A;  1WIA A;  5FR6 A;  1GG3 A;  3TCA A;  5C1Z A;  3MHS D;  1V6E A;  5D2M B;  4OVU A;  4CO7 A;  3D32 A;  5JZE B;  2O6V B;  4CHK A;  1E8Z A;  2CS4 A;  1AAR A;  1WY8 A;  4FJZ A;  1R4N I;  2DYM A;  2VRR B;  2IY0 B;  4DHJ D;  2KAN A;  3VTV A;  4M8N A;  4ZRJ A;  2BKF A;  3V6C B;  1GUA B;  3DQV A;  1C1Y B;  1UH6 A;  4DDG D;  2BYV E;  2NS5 A;  3NS8 A;  4M0W B;  2NPT A;  2GBK A;  2ZNV B;  1WI0 A;  4JQW C;  1XT9 B;  3PZD A;  3TJP A;  1WJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...