4ASWC

Structure of the complex between the n-terminal dimerisation domain of sgt2 and the ubl domain of get5
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
NAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PRO
publication title Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4aswC00
1S1QB 3VTVA 1WM3A 4BKTA 3RYTA 4NAWB 1V81A 2IBIB 3K9PB 1ZKHA 4MSMB 2MBBB 2PE9A 5BO4B 2NBUA 3OJ4B 2K8CA 3MTNB 4ZDVA 5DPRA 1FXTB 4I6PA 3U8ZA 1LXDA 2MP2B 3PZDA 2LVQA 3ZVVA 2JRIB 3ZO5B 2N7EA 4TQ0A 3O65B 1P3QU 2BYEA 1V2YA 1Z2MA 3L08A 2L0TA 2BF8B 4ASWC 4BBNC 4BOZB 4MDKE 1SE9A 3U7DA 4K7SA 2LVPA 4HDQA 2GBKA 5AZFA 2DHZA 3ALBA 1WR6E 4FHJA 1J8CA 1GG3A 3VVWB 2Z59B 3OLMD 4MJSA 5LLIA 3RULA 4AJYB 4MGIE 1V49A 2FCNA 2GBJA 4WWPA 2NBWB 3L16A 3H6NA 2K39A 3TBLD 3ZDMC 2CHZA 3I3TB 2N1WA 3L17A 4ANUA 4AWJA 3UF8A 4MGZE 1MG8A 1T0YA 1X1MA 2M17A 3QQ8B 4W9IA 5CHWA 3ZDTA 2FAZA 5L95C 1WZ3A 4RMAA 1JRUA 3DBHI 2G4SA 2V3SA 2IY0B 1V5TA 3VUWA 2LXAA 1SIFA 2FIFA 2KDIA 1GUAB 4MGYE 1KM7A 1E8YA 4NAWA 4FA6A 4IG7B 1EUVB 1LM8B 1QZEA 1WGRA 4FJYA 2ZNVC 1Q5WB 4DHJD 1P98A 3RD2A 4IM3A 2DAFA 3VDZA 4GU2A 2CR5A 2KTFA 2HD5B 2M0XA 3DBLI 2IO2B 2MP2A 2KLGA 3EECA 2IO1B 3PPAA 2LWPA 3WANA 1G6JA 3A33B 3DVGY 3R7RA 2KZRA 1H4RA 4HVBA 3TMPB 5E6OA 2WYQA 2Z0EB 1PQSA 2FCSA 2BKRB 3H1UA 1ZGUB 4LDTD 3IVFA 3WAMA 2KFKB 2O2VB 3PLVA 2ZCBA 4ZRJA 4FULA 3KW5B 2NCNA 2LRWA 3PGEA 3QK0A 4FHKA 4GOCA 1E5WA 2KC2A 2DZMA 3ML9A 1V6EA 4DK5A 4B6WA 3SU8X 5E6PA 2LRUA 3VQIA 3WAOA 2LZ6A 1TBEA 5D7GA 4G50A 3V62A 1WX8A 1E7UA 1YJ1A 4CYEA 1I35A 4PS7A 2GBRA 2MBEA 2KO3A 2VRRB 2BGFA 3V6EB 2M1MA 3ML8A 3Q3JA 4NQLB 4PYZA 3DCGA 2KMAA 1YQBA 5IAAC 2WX0A 4WAAA 4A3PA 3UINB 1HE8A 2LI5A 3AXCA 3DVNU 3H9DA 3A9JA 4IWQA 2EMTA 4M8MA 3QHTA 4ANWA 3V60A 2RSUA 2NR2A 2IO0B 5J2RA 4JQWC 3PSEB 4HWIB 3SHQA 2J0KA 3V6CB 4II2B 1IPGA 4I6LB 1WFYA 4CO7A 4MGKE 3CF6E 1WXMA 4DDGD 4OVUA 2LASA 3QX1A 1E90A 1WF9A 1YIWA 1OQYA 4K7UA 1WMHA 2ZNVB 4GN1A 4DHJB 5DPWA 1Y8RC 3P2BA 1WIAA 5CHFA 1UH6A 4NNJB 4NJ7A 2XK5A 2NPTB 2C7MB 2RGFA 2MSED 2KC1A 3PTFC 2W9NA 2KWUB 1WY8A 2KFKA 2O2VA 2LGXA 3IBEA 4W9CA 2CS4A 5DPSA 1WXVA 2D3GA 1Q0WB 4W9DA 1OGWA 2K25A 4EKUA 3SD5A 2AYOB 2JF5A 3B1LX 2LVOA 4LDTB 4OVVA 4PS8A 3ZUNA 1EF1A 1GC6A 3APDA 3KUDB 1I42A 3W1YA 1XT9B 2C7HA 2KD0A 4EOYA 3QJZA 3H7PA 2WWZA 2DENB 3JSVB 1WE7A 1KOTA 2D2QA 3TJPA 5J18A 2JPHA 2BKFA 1GNUA 2C9WB 2KJRA 2KX0A 3KYCD 3RT3B 1ZW7A 4RM8A 4URKA 2N9XA 2KHWB 1H8CA 5DPTA 4WQOB 4EZJA 2O6VD 4TKNA 2N1VA 4WJOA 1L2NA 1IP9A 2PE6B 3TCAA 5D6JB 3DVGX 2M8SA 4GSWA 2KK8A 3KVFB 4ICVA 1BT0A 1NBFC 3D32A 4ANXA 2OOBB 3T9LA 2L05A 4BOSC 2AL6A 3R66C 4TV3A 3AU5A 2WDTB 5C23A 2FNJB 3ENEA 4DHZE 2KTRB 4II3B 4FJZA 4F1SA 4E3CA 3JW0X 1VCBA 2RD0A 3QCAA 2NPTA 4NQKE 2CHWA 3HK0A 3ZW3A 2HJ8A 3RCZA 3ZTDA 1TTNA 2BWES 3LJ3A 3SDLC 2KWVB 3QWZB 4TQ1A 4G0NB 4KIKB 4HLEA 1E8WA 4IWOA 2JT4B 2KFJA 2L76A 1WXSA 3ZRCA 2UWQA 3H7SA 2N4FA 3DDCB 4P7IA 1P1AA 4GGQA 4AP4C 2J0JA 1UBQA 2D11A 3NS8A 4IM0A 4NY0A 4W9FA 5JHBA 2GOWA 3APFA 3PS6A 4FADA 1WGDA 3M62B 3PREA 5KHOA 3X23A 3JSVA 2LGYA 1C3TA 2KQ7A 4LJOB 5G2NA 2FUHB 3TL5A 1XQQA 1WJ4A 2C7NB 1Z5SB 3QA8A 4GMVA 2HTHA 4W9HA 4MSQB 4KDLB 3RZFA 3VUXA 5CX3A 3ZNZB 3QARA 4KZCA 4W9GA 4J6IA 3QC8B 2OJRA 2ZPNA 3JVZX 2REXA 4NPNA 2A5UA 5LXIB 3HM6X 4MM3A 2PEAA 1K8RB 3L54A 2DZJA 2UYZB 1WYWB 1WM2A 3EFUA 2KVRA 3PV1A 4ZRKA 2MQJA 1WJUA 4W9LA 4ZYNA 3ZNHB 2O6VB 3PRPB 4XX5A 2NVUI 3LDZE 4JL9A 3A1QB 1NI2A 3VTUA 1ISNA 2J7QB 3UIOB 4MEMA 4WJQA 4N9F4 3MHSD 4CHKA 3JYUA 1RLFA 4K7WA 2NS5A 5FR6A 1WR1A 2LJ5A 3RZWC 3T8MA 2QHOA 3BY4B 5J17A 2FCMA 3ZNID 3L0WB 4KV2A 4LJPB 4AUQC 2FIDA 4K81A 1A5RA 4FN2A 2ZCCA 2DZKA 2KX3A 3R7QA 1C1YB 2BPSA 2JZ3B 3IHPC 3Q3FA 4HPLB 2KXJA 1V80A 2ZZPB 3ZNGC 4XZ4A 1WXAA 2ASQA 2I1KA 2JWZA 3NZUA 1VD2A 2IYDB 2KJ6A 2L7RA 3N30A 4EEWA 2KDEB 2KANA 5JZEB 2DYMA 3PLUA 5HKHA 2KMCA 5D2MB 4G11A 4IM2A 2J0MA 4GDKB 2KN5A 4IW0A 1V9JA 2MLBA 3ZTCA 4EFOA 2DX5B 2ZVNA 4BKGA 2MW5A 3IFWB 3NHEB 5TR5A 1SGHA 3PVLA 3BINA 2IO3B 2KKCA 3N32A 1EF5A 2AWTA 4BVUC 2JVCA 4W9KA 4DWFA 1J0GA 3ZIMA 2DYOA 2YLMA 4HK2A 4ZRIA 1J19A 3WAPA 2MBHA 1V5OA 3L10B 2O6VA 2BWFA 3TIXA 2ZVOA 3ZKJC 2K8BA 1KLVA 2D07B 3A1QA 2LGDA 2JZZA 3APCA 3CSFA 3GZNI 4GXBA 4KSLC 1WE6A 4F7ZA 1LFDA 5LXHA 5EDSA 3DBSA 3KUCB 1IYFA 4M0WB 3VH3B 3DBRI 4BBNF 3A9KB 2IY1B 3QIJA 1EO6A 3M95A 2A4ZA 3W1SC 1CMXB 3UGBB 4BKSD 4PYUA 4DHZB 5AZGA 1TZ1A 4E74A 2GMIC 4IWPA 1RRBA 3C0RB 4KSKC 2KQSA 1M94A 1NDDA 1P0RA 3NOBA 2B3AA 4EZLA 4WWOA 2CU1A 2EMSA 3ECIA 1E8ZA 1F9JA 3OJ3A 4B9KA 3CSTA 1L7YA 3NZSA 4ICUA 2NBVB 2AEHA 4JGHB 1GC7A 2C5LC 2KDFB 4DDID 3M63B 3R3MA 1R4MI 3EC8A 3PRMB 2R2OA 4GDKA 4NJ6A 3VUYA 4EZKA 1UD7A 1OTRB 3DPDA 4IC7B 4X57B 2JY6A 3WA0A 2I1JA 3PHXB 4WWNA 4AJWA 2ZJDA 4LCDE 5AZHA 5DCNA 3ZRFA 1E7VA 4AOFA 4W9JA 4FBJB 1RFAA 3IG3A 3VH4B 4I6NB 2IZVB 4DBGA 3KUZA 2K8HA 3S2AA 2BYFA 1KJTA 4JLCA 3L13A 2PJHA 1UGMA 5GMVA 2HE7A 4WJPA 3X0WA 5JHAA 2L00B 4DXAB 5E6NA 1D3ZA 2JRHA 2ZEQA 5AEKB 3MJWA 4PS3A 3A4SC 2MWSB 3DQVA 3GOEA 4M8NA 4KZ0A 2N7DA 4HCNB 2L0FA 1WGHA 1TGZB 1RAXA 3A9JB 5L83A 3A9KA 2G45B 4TUUA 4EUTA 3AULA 2V4LA 2G4DB 3QAQA 2DYBA 1GJZA 1WX7A 3VXWA 4GDLB 4K1RB 3ONSA 3PRZA 5C1ZA 3PHWB 5D94A 2MBQA 3UQBA 4HCPB 4G3XB 2FCQA 3OAWA 4FLHA 1WMHB 1XD3B 2N9EB 2N9PC 4YL8A 5CTRC 2MRPA 3AI5A 5JH5C 2V1YA 2XK5B 4HXDA 2KJHB 1WGYA 2R2QA 1S3SG 4HJKA 3VFKA 4BFRA 2KTRA 4HDOA 3M3JA 4FJVB 1AARA 2CHXA 2GBNA 2LUEA 2MCNB 1WJ6A 2LXCA 2ZPYA 3B08A 4ANVA 4A3OA 1UBIA 1R4NI 1WJNA 1E8XA 2C60A 3ZLZA 1V86A 2XEWA 2MX2A 3VHTC 2GBMA 3VAWA 1YX5B 1UELA 1Q1OA 2K1FA 3PT2B 3A4RA 2WX1A 1WI0A 3K9OB 4KIKA 4A20A 2DAJA 3EHVA 3KYDD 3N3KB 2MA9B 1WGGA 4E71A 1WZ0A 2KWCA 4IUMB 2DZIA 4MH0E 4W9EA 2G3QB 2JXXA 1UZXB 3H7PB 2D10A 3VTWA 2XBBC 3HIZA 3UQAA 4KDIC 4RM9A 3CMMB 4WJNA 2RR9A 3KH0A 3WALA 3HHMA 3DOWA 2KLCA 2L3ZA 2PPHA 3U30A 5CHVC 3DVNV 1U4AA 4MJSB 1P9DU 3AU4A 1YX6B 2EKEC 3NY5A 2M4NA 1WH3A 2BYVE 4GDLA 2KDBA 1OEYJ 4F8CB 2YVCA 2K6QA 3W1SA 1LQBA 5G55A 4BKSA 5IA7A 2L8JA 3B0AA 4JIOU 1WRDB 3RUIB 1WX9A 2KNBA 4GB9A 3HM3A 2K6DB 2RPQA 4MELA 3V61A 2Y5BB 5KHQA 4GIVA 2KOXA 4XC2A 4B95A 1YD8U 1OEYA 2Z0DB 2JUOA 2CKHB 3WIMA 4HPMB 2MBOA 2LD9A 2AL3A 4KVGB 3UIPB
chains in the Genus database with same CATH superfamily
3MFGA 4NAWB 1V81A 3I9V1 2G9HD 2MBBB 5BO4B 5DPRA 1FXTB 1LXDA 1ZP0B 3IXSA 3PZDA 2JRIB 2QEJC 2L0TA 3I57A 2AQ3B 3U7DA 1AN8A 2INCC 5AZFA 3ALBA 1R4MB 4MJSA 4PT5A 1PUTA 3H6NA 2K39A 2CHZA 4C7YA 4AWJA 2E3TA 3P63A 4YSZB 2FAZA 2GB1A 5IP4D 1DOYA 2LXAA 2VZKD 1VJKA 2KDIA 1AYFA 1KM7A 1EUVB 1LM8B 1WGRA 4YWGG 1C4PA 3B9JA 3VDZA 2HD5B 2LMCA 3DBLI 3NS1A 2MP2A 3EECA 1E10A 3AEBB 1H4RA 2BB5A 3URYA 3IVFA 3WAMA 3R2IA 2M0AA 2WP9B 2DZMA 2LJIA 2K9XA 1YJ1A 4CYEA 2BGFA 2PMVA 2KN4A 3V6EB 3Q3JA 2RDHA 3P4QB 2WXRA 1I4HA 3UINB 1HE8A 1I4QA 3P4RB 3AXCA 3A9JA 4ANWA 2IO0B 4JQWC 1L6UA 4I6LB 4KKJA 2KAJA 4OVUA 1E90A 1K51A 5C2TB 1YIWA 4K7UA 1JROA 2QJLA 2ZNVB 4GN1A 5DPWA 3VR9B 3E56A 3P2BA 4NNJB 5MPOA 2NPTB 2C7MB 1J7CA 1HZ6A 1L4DB 4RCOA 4W9CA 5DPSA 5IN7A 2CS4A 1YQ3B 1Q0WB 1QOAA 1OGWA 1GB1A 3RNCC 4MACA 2K25A 4LDTB 4OVVA 4PS8A 3ZUNA 2KYWA 3MJ5A 1EF1A 3APDA 3KUDB 1HA5A 1XT9B 2C7HA 3AH7A 2KD0A 4P16A 4EOYA 2RDBC 3JSVB 3IT4B 1KOTA 3TJPA 2V9HA 2KJRA 1NYRA 1ESFA 2WXOA 2KHWB 4MH8A 1UWXA 4WQOB 2O6VD 2N1VA 4MM3B 1L2NA 1SE2A 4OHJA 2BW2A 4ICVA 3KVFB 1NBFC 1CQVA 3T9LA 5C23A 3Q8CA 4DHZE 3Q3NC 3TEXA 4E3CA 3JW0X 1VCBA 2IJ0A 2RD0A 1N62A 2CHWA 3HK0A 2N9KA 2ACZB 3RCZA 4ZOHC 1TTNA 3R2TA 3BIID 1FMAD 1T0SC 2WU2B 3ZRCA 1OQRA 2UWQA 2BBCA 2QILA 4W9FA 3NS8A 1DYQA 3SEBA 5KHOA 1J7AA 4ITKA 1C3TA 2DLBA 3TL5A 1XQQA 2C7NB 4KDLB 3N9YC 1VZ8A 2REXA 4NPNA 2A5UA 5LXIB 4C00A 3AE5B 1UF0A 2UYZB 4N6EB 1WYWB 4LNFA 1WJUA 1ZE3D 4W9LA 3LDZE 3VTUA 1ISNA 3RI7C 4MEMA 4WJQA 2LJ5A 3T8MA 3MC8A 1RYJA 3L0WB 4ZHPA 4AUQC 2LHEA 1KFYB 4K81A 1A5RA 1N5WA 2ZCCA 4TSSA 4C80A 2DZKA 3U7ZA 2KX3A 2BPSA 2JZ3B 4XZ4A 1WXAA 2JWZA 5BMGA 2IYDB 2KJ6A 4KX6B 3KWVA 4GDKB 1ZDXA 1V9JA 2DX5B 4FXCA 2MW5A 4P1BC 3PVLA 2IO3B 2KKCA 2PKOA 4DWFA 1SB3C 1V5OA 4M00A 3TIXA 2L32A 2HDEA 3DHHC 1KLVA 3BK1A 3A1QA 2LGDA 2JZZA 2JXTA 3CSFA 4GXBA 4F7ZA 1UWMA 5EDSA 3W1SC 4C4VA 2A4ZA 1CMXB 3UGBB 4BKSD 4DHZB 5AZGA 1RM6C 4DXFA 1M94A 2JYTA 2IDYA 3NZSA 1L7YA 1FNUA 3M63B 1R4MI 4NJ6A 4IDIA 2RDGA 3RNBC 3PHXB 4AJWA 2N9LA 1NVID 5HHDG 2KVZA 2SAKA 3HUIA 2PJHA 1UGMA 5JHAA 1T6BX 4XDDA 1IGCA 4M8NA 4KZ0A 1WGHA 1JWMD 3GS2A 4H2AA 1XLPA 4YSYB 3AULA 2V4LA 3AN1A 1TY0A 1WX7A 4YTPB 5C1ZA 3PHWB 3V3XA 2N9EB 5JXVA 3I5JC 4YL8A 5CTRC 1YJIA 5JH5C 2XK5B 2KJHB 2LFIA 4HDOA 1AARA 2ZPYA 4DQOC 1UBIA 1R4NI 4QAYA 1E8XA 3ZLZA 1ZOYB 2MX2A 1YMHE 2GBMA 3VHTC 1YX5B 3CWIA 5H8YE 1Q1OA 1WI0A 4Q2JA 1WGGA 4TMAB 4IUMB 2KWCA 4MH0E 2G3QB 4HKZE 2MJ3A 1KLUD 1WXQA 3CMMB 2BTEA 2L3ZA 1OFFA 2W3RA 1U4AA 4MJSB 2EKEC 3ZJUA 2KDBA 2YVCA 1EU4A 4RFBA 2HJ1A 4REZA 3R8BA 1YNTE 2L8JA 3B0AA 1WRDB 5FKAC 2KWDA 2KNBA 2GI9A 4GB9A 3RUIB 3NVVA 3HM3A 2KOXA 1OEYA 2Z0DB 5I4DA 2CKHB 2MBOA 5AUKA 3U4EG 1S1QB 4BKTA 5IO9A 3RYTA 4XGAB 1MHHE 1ZKHA 2PE9A 2V3NA 1TKYA 2NBUA 4HKQA 3DWMA 4ZDVA 2E6XA 3U8ZA 4I6PA 3BZDB 2MP2B 3VRAB 1TT5B 1C9FA 2X8XX 3ZO5B 3O65B 2BYEA 1Z2MA 3VR8B 4BOZB 4BBNC 1SE4A 1SE9A 3W5UB 2L83A 4ZRQA 4FHJA 2BYTA 1XCTL 5LLIA 2DNFA 2GBJA 1AWDA 4WWPA 2NBWB 1N60A 3L16A 3P4PB 3I3TB 1KTKA 2WU5B 4MGZE 4RMAA 3RN9C 2G4SA 1DGJA 3BK2A 4WQMA 1SIFA 4MGYE 1GUAB 1HZ5A 4FA6A 1QZEA 1Q5WB 1PFDA 1C77A 3P4SB 4GU2A 2WGSA 4BAXA 1SEBD 2KLGA 2WXMA 1G6JA 2LWPA 3AE6B 3TMPB 4LNIA 1I4PA 2WYQA 2Z0EB 1TYGB 1FRDA 3H1UA 1ZGUB 4LDTD 2W55A 4ZRJA 3N20C 1UGJA 3KW5B 2LRWA 2BB6A 4B6WA 2WXNA 2BS3B 2LZ6A 5D7GA 4G50A 1I35A 3ZJVA 2GBRA 1IGDA 2VRRB 2WXGA 3DCGA 2EKIA 4HPPA 4WAAA 4YTMB 5FR3A 1FNWA 2WNMA 3DVNU 4IWQA 4OW0A 2EMTA 3P42A 3QHTA 4OZBA 2NR2A 3PSEB 3V6CB 1WFYA 4CO7A 3CF6E 1SJHD 1OQYA 3SFDB 1Y8RC 1BMLC 1WIAA 5CHFA 2XK5A 3WCQA 2RGFA 2MSED 2KC1A 3PTFC 1WY8A 2KFKA 2D5GA 2LGXA 1WXVA 2G1EA 2AYOB 3LXFA 1D4BA 2LVOA 1GC6A 3FILB 2YEPB 3ABVB 4ARIA 2CU3A 3QJZA 1FPYA 1TIFA 5J18A 2JPHA 2BKFA 1GNUA 3KYCD 1CZPA 1ZW7A 4RM8A 4C56C 1EWYC 2N9XA 1JWBD 5DPTA 4ZHOA 2PE6B 3DVGX 2GLSA 1PDXA 2QCZA 3BVGA 4JWUC 1SF0A 2AL6A 4TV3A 1ZXIA 2WDTB 2FNJB 3ENEA 3RNGC 4II3B 3ETRA 4F1SA 3RNEC 3FAHA 4NQKE 1JWAD 1P7FA 2HJ8A 1V1PB 1CK1A 3ZTDA 3LJ3A 3W5VB 2KWVB 3QWZB 4KKIA 2M19A 2ICIA 4GGQA 4AP4C 2J0JA 1UBQA 2D11A 4NY0A 2GOWA 1PGXA 2WXFA 2WS3B 4LJOB 5G2NA 3RZFA 3QA8A 3NZ3A 3VUXA 5CX3A 1TKGA 3QARA 4W9GA 3QC8B 1JALA 4LNKA 4HJGE 1K8RB 1QKZA 1FM0D 2K3UA 4WWMA 1MI0A 1Q10A 3EFUA 3HVDA 3NVZA 3AEAB 2JX5A 1R4NB 3PRPB 4XX5A 1FXIA 4L23A 2WDVB 2I38A 3A1QB 1NI2A 3UIOB 4N9F4 1IBXA 2NS5A 5J17A 2FCMA 4C4VB 1EWCA 4LJPB 1YN4A 2LEKA 3R7QA 1C1YB 3IHPC 4HPLB 4MT5A 2KXJA 2ZZPB 2W54A 2I1KA 1FEHA 2JU6X 4EEWA 5JZEB 2DYMA 3PLUA 3AE8B 5HI1A 4IM2A 2KN5A 4HRSA 1VZ6A 4EFOA 3EA6A 4M02A 4P6VF 2AX5A 2ZVNA 3PZ7A 3N1ZC 5TR5A 1SGHA 1FCLA 2VH2A 4BVUC 4W9KA 2DYOA 3E9SA 2YLMA 4HK2A 4L1BA 2K8BA 2BS4B 4P1CC 4A55A 1IYFA 3DBRI 4N58A 1EO6A 4S0RA 2IGDA 3DHGC 1RRBA 1NDDA 3H8HA 2B3AA 4EZLA 4WWOA 2CU1A 3OJ3A 4B9KA 3Q8FA 4ICUA 2DWQA 4JGHB 2AEHA 2KDFB 5BYRA 3R3MA 5EE1A 3PRMB 3VUYA 1UD7A 1FO4A 2WXHA 4X57B 3WA0A 5IKCM 1XO3A 4LCDE 5DCNA 1RFAA 1TS5A 2IZVB 2WDRB 2K8HA 1KJTA 4JLCA 1E6EB 2HE7A 4WJPA 1SBBB 3X0WA 1F77A 2L00B 3FILA 2JRHA 1ET9A 4B0MA 1N5XA 4PS3A 2N7DA 1F2RI 1TGZB 1SXTA 1TS3A 2CJOA 5BMIA 2G4DB 2DYBA 1GJZA 1K50A 1I4GA 3PRZA 5D94A 3EGRA 3OAWA 4FLHA 3MC0B 1TS4A 4XDCA 2WXQA 3NUHB 1VLBA 2Y3AA 2V1YA 4HXDA 2KQ4X 4HJKA 1XEEA 1FNVA 1L5PA 3M3JA 3NVWA 2MCNB 2GBNA 2LUEA 2J4XA 1BUIC 4A3OA 5EE9A 5E6JA 1V1PA 2WX1A 3KYDD 4E71A 1A70A 1KLGD 3Q8BA 2XBBC 3HIZA 3UQAA 4KDIC 4RM9A 4YSXB 3NJTA 3KH0A 3U2SC 3HHMA 1UUPA 2KLCA 1ROEA 3DVNV 1GAQB 3AU4A 2M4NA 1WH3A 2BYVE 4GDLA 5T8IA 4RGTA 4F8CB 3W1SA 2TSSA 2K22A 5G55A 3L4PA 4JIOU 2LGIA 4JPSA 5KHQA 4B95A 1YD8U 4OZAA 1JCKB 4HPMB 3A33B 2LD9A 4A8XC 3UIPB 1XLQA 3BVMA 3VTVA 2FBWB 2IBIB 2GRIA 3RNAC 3AEGB 3OJ4B 4K3BA 3MTNB 5GXGB 1PYWD 2LVQA 4TQ0A 2N7EA 3SR6A 1P3QU 1V2YA 1OQQA 3N1XC 2IGGA 1WR6E 1MPEA 1GG3A 2WXJA 2CJNA 4AJYB 4MGIE 1V49A 2FCNA 2INNE 1T0RC 3W9CB 3ZDMC 2N1WA 2QC8A 3TEWA 3L17A 4ANUA 3LB8C 3B2FA 3UF8A 4M01A 3U52E 1D6EC 1MG8A 1T0YA 1X1MA 2M17A 3QQ8B 4W9IA 4US9A 3ZDTA 1SIJA 4HEA1 1UNSA 3ZXRA 1WZ3A 1JRUA 2WXLA 3OWEB 2FIFA 1VRAB 4JE3B 2ZNVC 1P98A 2DAFA 2KTFA 2M0XA 2MHJA 2IO1B 3WANA 4ZYSA 1WSPA 2KZRA 2FUG1 4YTNB 5E6OA 1PQSA 2FCSA 2KFKB 1SSNA 4FULA 4XWTA 3QK0A 2NCNA 4FHKA 1F0ZA 4KGRA 3ML9A 1V6EA 4DK5A 2WQYB 3BWUD 5E6PA 3Q3OC 3VQIA 2W82A 1E7UA 1V97A 2PW9A 4PS7A 1FCCC 2KO3A 2M1MA 4NQLB 4PYZA 4HROA 4GLSC 1GPXA 5IAAC 4A3PA 2LI5A 3DWGC 1MHXA 1ACCA 2RSUA 3V60A 3V05A 5J2RA 3SHQA 4HWIB 1IPGA 1WF9A 1QQRA 2PTLA 3TUOA 4DHJB 2J42A 1F1HA 3CIRB 5EE0A 1UH6A 1YJJA 3MP9A 2KWUB 2O2VA 3FKYA 1TKEA 2D3GA 4W9DA 2XN9C 2ZW1A 2JZPA 1RFKA 3DBRB 3W1YA 1GB4A 1PGAA 2NMQA 2WWZA 2DENB 1D5ZC 1STEA 1WE7A 1NENB 2D2QA 1C78A 2C9WB 1QOFA 2KX0A 3RT3B 4URKA 3AE3B 2M56B 1H8CA 4EZJA 4TKNA 4WJOA 3TCAA 3W2DA 5D6JB 2M8SA 2WXKA 3NG0A 2KK8A 2N7JA 1T0QC 2OHFA 1C79A 3D32A 4ANXA 3AU5A 2KTRB 1IBXB 4FJZA 4WAFA 1L0VB 3QCAA 4L2YA 1C4AA 3ZW3A 4TQ1A 4OZCA 4KIKB 3DBHB 2KFJA 1DOXA 2L76A 1WXSA 3HVZA 1P1AA 5BMHA 4EE2A 3PS6A 4FADA 3M62B 3PREA 3X23A 2EELA 2KQ7A 2FUHB 1WJ4A 4W9HA 4GMVA 2HTHA 3BYTB 4MSQB 2MEKA 3ZNZB 4KZCA 4J6IA 3Q8EA 1L4ZB 3JVZX 4D2KA 3HM6X 3L54A 4WH4A 1WM2A 1BXTA 4ZRKA 3PV1A 4ZYNA 2WXIA 1IUEA 2AQ2B 2J7QB 1XXGA 3MHSD 4K7WA 4RNAA 5FR6A 3RZWC 1QLBB 2QHOA 1ENFA 3BY4B 1N63A 4JX1C 2QDFA 2Q5WD 2KDMA 4FN2A 2LGSA 3Q3FA 1V80A 2ASQA 2DBYA 3NZUA 1E7PB 3AE7B 1FRRA 1B9RA 5HKHA 2KMCA 4G11A 3MHZA 1ZUD2 3ZYYX 4IW0A 3C8YA 3Q69A 3AM9A 4BKGA 3IFWB 3NHEB 3NVYA 1ZXHA 1TJEA 4PK1A 1EF5A 3OG5A 1J0GA 3AEEB 4A90A 3ZIMA 4ZRIA 1J19A 2O6VA 2BWFA 3ZKJC 2ZVOA 5LNK1 2D07B 3GZNI 4KSLC 3P1MA 1YN3A 5LXHA 1EU3A 1WWTA 3DBSA 3KUCB 3VH3B 4BBNF 3QIJA 2UU7A 1T5XD 1WRIA 2PLPA 4IWPA 3FC4A 2KQSA 1P0RA 4YT0B 2JQRB 3ECIA 3CSTA 1HTQA 1GC7A 1Y56A 4C7ZA 4WIPA 3RNFC 3EC8A 2R2OA 4EZKA 1YQ4B 5TSSA 3PO0A 2OEDA 4LTUA 3DPDA 4RGNA 4IC7B 2N0SB 2I1JA 4AOFA 4IKGA 5G5HA 3GE8C 4DBGA 3AEDB 3KUZA 3S2AA 2BYFA 3TEZA 1D5MC 1D5XC 1E9MA 1D3ZA 5E6NA 2ZEQA 5AEKB 1HTOA 2QMTA 2MWSB 3DQVA 3GOEA 1V8CA 2L0FA 2BS2B 4M0WA 5H92C 5L83A 3A9KA 2G45B 4TUUA 4EUTA 1LO5D 4GDLB 3ONSA 3UQBA 2ONQA 2FCQA 1WMHB 1ZPSA 2H89B 2MJDA 3SFEB 1WGYA 4BFRA 2KTRA 4FJVB 2CHXA 1WJ6A 2LXCA 4ANVA 5C3JB 3RFZB 2Y5CA 2X38A 1WJNA 2C60A 3DHIC 2XEWA 3AMZA 3VAWA 3Q3MC 1UELA 2D3BA 3PT2B 2K1FA 1FIQA 3K9OB 4KIKA 2DAJA 3N3KB 1WZ0A 2DZIA 2JXXA 1UZXB 3H7PB 1YOVB 3AE4B 3VTWA 1I4XA 3MC9A 1L0YB 3WALA 4NZLB 2PPHA 1P7EA 1P9DU 3AE1B 5FK9C 3NY5A 2J53A 1LQBA 4BKSA 3TSSA 1WX9A 2R61A 2RPQA 2Y5BB 4GIVA 3AE9B 4XC2A 4ACFA 1F2RC 3OLMD 2AL3A 4KVGB 2ON8A 4LNNA 1WM3A 1L0XB 3C19A 3K9PB 4MSMB 4OVZA 1NEKB 2K8CA 1V1OA 2BT6A 3ZVVA 5BYSA 1JQ4A 2L1AA 4DXGA 3TEYA 1TY2A 3L08A 2BF8B 4ASWC 2KT7A 1TZOA 2V4IB 4MDKE 4K7SA 2LVPA 4HDQA 1C76A 2GBKA 2DHZA 1J8CA 2Z59B 3T3OA 1LGRA 3RULA 3BYYB 2WDQB 1RWSA 1JMLA 2BVCA 3TBLD 4ZRPA 3HRDD 1MJDA 4AS1A 3RPFC 5CHWA 1T3QA 2SEBD 3DBHI 2MJEA 2V3SA 2IY0B 1V5TA 2PVOD 3VUWA 2PVGC 3RMKC 1I7HA 2LUMA 4IOIE 3GB1A 4K3CA 1E8YA 4N59A 4NAWA 4IG7B 5AUIA 2XNAC 4FJYA 3T3NA 4DHJD 3BVZA 2LHDA 3RD2A 4IM3A 1JRPA 3UI3A 2CR5A 4XE0A 2IO2B 4KGSA 3PPAA 1K52A 3DVGY 3R7RA 4HVBA 1J7BA 1VR9A 2BKRB 2O2VB 3PLVA 2ZCBA 3IAM1 3KLSX 5D3IB 3PGEA 4GOCA 1E5WA 2KC2A 2RMMA 4KGTA 3SU8X 2LRUA 3EUB2 3WAOA 1TBEA 3V62A 1WX8A 2MBEA 3ML8A 5L95C 2B76B 1KRHA 4NAMA 2KMAA 1L6VA 1YQBA 2WX0A 4US8A 3Q2AC 3H9DA 4M8MA 2VH1A 1KH0A 1MG4A 3IAS1 2J0KA 2WXPA 4II2B 2H88B 4MGKE 2W3SA 1WXMA 5EE3A 4DDGD 2LASA 3QX1A 2VZKB 3VRBB 1WMHA 1FFVA 4NJ7A 2AQ1B 2W9NA 3IBEA 3GZNB 1HEZE 3AB5A 2KACA 3SD5A 3B1LX 2JF5A 4USAA 3B2GA 2Y5PA 3IT6B 1QOGA 1I42A 4WURA 4LLGM 3GP7A 3H7PA 1B1ZA 1K53A 1SJED 3Q8AA 2J52A 1IP9A 3AEFB 2QSDA 2PIAA 4GSWA 1FFUA 1BT0A 2OOBB 2L05A 4BOSC 3R66C 5BYQA 2I2YA 3LYYA 2NPTA 2OJWA 1F52A 2BWES 3SDLC 3O13A 4G0NB 4HLEA 1E8WA 4IWOA 2JT4B 2JSVX 4J3OD 4RF1A 3H7SA 2N4FA 1SE3A 3DDCB 4P7IA 4JWSC 4IM0A 5JHBA 3APFA 1WGDA 1XLOA 3JSVA 2LGYA 1XCQL 1Z5SB 1DOIA 3DBLB 3I63C 2OJRA 2ZPNA 4O1NA 2YEPF 4RF0A 4MM3A 2PEAA 2DZJA 1WYGA 1QOBA 4XWWA 2KVRA 3ZNHB 2MQJA 3Q6BA 2O6VB 3AECB 2NVUI 4JL9A 4NJCA 5IOIA 3ZXVA 1NYQA 2NTTA 4CHKA 3JYUA 1RLFA 1WR1A 1XF5L 3ZNID 4KV2A 2FIDA 4RH6A 1R7SA 3ZNGC 2MH7A 1QT9A 1VD2A 2L7RA 3N30A 2KDEB 2KANA 2L52A 4LK0M 1HQRD 5D2MB 2J0MA 2WLBA 3ZTCA 2MLBA 1N6ZA 1YN5A 1FXAA 1ET6A 2JYEA 3BINA 2INDC 3N32A 4BZAA 2AWTA 2JVCA 4CQNA 3WAPA 2MBHA 3L10B 1I4RA 4AQ7A 1E0ZA 2D3CA 3APCA 3AV8A 2NTSA 1WE6A 1LFDA 2WHIA 4M0WB 1CJEA 2IY1B 3A9KB 4A9AA 3M95A 3PZ8A 2ZW0A 4PYUA 1TZ1A 4E74A 1VDVA 2GMIC 2RPVA 3C0RB 4KSKC 1PGBA 3NOBA 2EMSA 1E8ZA 3NRZA 1F9JA 4RGOS 2NBVB 2C5LC 4DDID 4YXDB 4GDKA 3AE2B 1MVKA 1OTRB 2JY6A 2IPKD 4WWNA 3EFCA 3J9CA 2ZJDA 5AZHA 3ZRFA 1E7VA 4W9JA 4FBJB 3IG3A 3VH4B 2INPE 4I6NB 1C4CA 2K5PA 3L13A 1KF6B 5GMVA 4DXAB 1JWUD 1JW9D 3MJWA 3KWLA 3N1YC 3A4SC 2IGHA 4HCNB 1RAXA 3A9JB 2FE8A 2V0GA 1N61A 3QAQA 5G5GA 2QIEB 3VXWA 4B0EA 4K1RB 2MBQA 2KMMA 4HCPB 4G3XB 3ZQ4A 1GOZA 1XD3B 1NI3A 2N9PC 1QILA 2MRPA 3GE3C 3AI5A 3VFKA 2R2QA 1S3SG 2JWUA 5HFYA 3VVWB 4EKUA 1EM7A 3B08A 3KQ4A 2BQQA 3Q14C 1V86A 5HG2A 4A6QA 3A4RA 4A20A 3EHVA 2MA9B 3ZGZA 1QF6A 1VZ7A 4W9EA 2Z8LA 2D3AA 2D10A 5D3DA 4UDUC 1M4VA 4ARCA 1AW7A 3ZJTA 4R3DA 4WJNA 1FD6A 4LNOA 2RR9A 2K0PA 3DOWA 2V3PA 3U30A 2HTME 5CHVC 1ZDVA 1TS2A 1YX6B 4S17A 1JWSD 1HXYD 1OEYJ 1XLNA 2K6QA 5IA7A 2K6DB 4MELA 4RGMA 4XYCA 3V61A 1WGKA 1MFWA 2JUOA 3WIMA
chains in the Genus database with same CATH topology
1S1QB 3VTVA 1WM3A 4BKTA 3RYTA 4NAWB 1V81A 2IBIB 3K9PB 1ZKHA 4MSMB 2MBBB 2PE9A 5BO4B 2NBUA 3OJ4B 2K8CA 3MTNB 4ZDVA 5DPRA 1FXTB 4I6PA 3U8ZA 1LXDA 2MP2B 3PZDA 2LVQA 3ZVVA 2JRIB 3ZO5B 2N7EA 4TQ0A 3O65B 1P3QU 2BYEA 1V2YA 1Z2MA 3L08A 2L0TA 2BF8B 4ASWC 4BBNC 4BOZB 4MDKE 1SE9A 3U7DA 4K7SA 2LVPA 4HDQA 2GBKA 5AZFA 2DHZA 3ALBA 1WR6E 4FHJA 1J8CA 1GG3A 3VVWB 2Z59B 3OLMD 4MJSA 5LLIA 3RULA 4AJYB 4MGIE 1V49A 2FCNA 2GBJA 4WWPA 2NBWB 3L16A 3H6NA 2K39A 3TBLD 3ZDMC 2CHZA 3I3TB 2N1WA 3L17A 4ANUA 4AWJA 3UF8A 4MGZE 1MG8A 1T0YA 1X1MA 2M17A 3QQ8B 4W9IA 5CHWA 3ZDTA 2FAZA 5L95C 1WZ3A 4RMAA 1JRUA 3DBHI 2G4SA 2V3SA 2IY0B 1V5TA 3VUWA 2LXAA 1SIFA 2FIFA 2KDIA 1GUAB 4MGYE 1KM7A 1E8YA 4NAWA 4FA6A 4IG7B 1EUVB 1LM8B 1QZEA 1WGRA 4FJYA 2ZNVC 1Q5WB 4DHJD 1P98A 3RD2A 4IM3A 2DAFA 3VDZA 4GU2A 2CR5A 2KTFA 2HD5B 2M0XA 3DBLI 2IO2B 2MP2A 2KLGA 3EECA 2IO1B 3PPAA 2LWPA 3WANA 1G6JA 3A33B 3DVGY 3R7RA 2KZRA 1H4RA 4HVBA 3TMPB 5E6OA 2WYQA 2Z0EB 1PQSA 2FCSA 2BKRB 3H1UA 1ZGUB 4LDTD 3IVFA 3WAMA 2KFKB 2O2VB 3PLVA 2ZCBA 4ZRJA 4FULA 3KW5B 2NCNA 2LRWA 3PGEA 3QK0A 4FHKA 4GOCA 1E5WA 2KC2A 2DZMA 3ML9A 1V6EA 4DK5A 4B6WA 3SU8X 5E6PA 2LRUA 3VQIA 3WAOA 2LZ6A 1TBEA 5D7GA 4G50A 3V62A 1WX8A 1E7UA 1YJ1A 4CYEA 1I35A 4PS7A 2GBRA 2MBEA 2KO3A 2VRRB 2BGFA 3V6EB 2M1MA 3ML8A 3Q3JA 4NQLB 4PYZA 3DCGA 2KMAA 1YQBA 5IAAC 2WX0A 4WAAA 4A3PA 3UINB 1HE8A 2LI5A 3AXCA 3DVNU 3H9DA 3A9JA 4IWQA 2EMTA 4M8MA 3QHTA 4ANWA 3V60A 2RSUA 2NR2A 2IO0B 5J2RA 4JQWC 3PSEB 4HWIB 3SHQA 2J0KA 3V6CB 4II2B 1IPGA 4I6LB 1WFYA 4CO7A 4MGKE 3CF6E 1WXMA 4DDGD 4OVUA 2LASA 3QX1A 1E90A 1WF9A 1YIWA 1OQYA 4K7UA 1WMHA 2ZNVB 4GN1A 4DHJB 5DPWA 1Y8RC 3P2BA 1WIAA 5CHFA 1UH6A 4NNJB 4NJ7A 2XK5A 2NPTB 2C7MB 2RGFA 2MSED 2KC1A 3PTFC 2W9NA 2KWUB 1WY8A 2KFKA 2O2VA 2LGXA 3IBEA 4W9CA 2CS4A 5DPSA 1WXVA 2D3GA 1Q0WB 4W9DA 1OGWA 2K25A 4EKUA 3SD5A 2AYOB 2JF5A 3B1LX 2LVOA 4LDTB 4OVVA 4PS8A 3ZUNA 1EF1A 1GC6A 3APDA 3KUDB 1I42A 3W1YA 1XT9B 2C7HA 2KD0A 4EOYA 3QJZA 3H7PA 2WWZA 2DENB 3JSVB 1WE7A 1KOTA 2D2QA 3TJPA 5J18A 2JPHA 2BKFA 1GNUA 2C9WB 2KJRA 2KX0A 3KYCD 3RT3B 1ZW7A 4RM8A 4URKA 2N9XA 2KHWB 1H8CA 5DPTA 4WQOB 4EZJA 2O6VD 4TKNA 2N1VA 4WJOA 1L2NA 1IP9A 2PE6B 3TCAA 5D6JB 3DVGX 2M8SA 4GSWA 2KK8A 3KVFB 4ICVA 1BT0A 1NBFC 3D32A 4ANXA 2OOBB 3T9LA 2L05A 4BOSC 2AL6A 3R66C 4TV3A 3AU5A 2WDTB 5C23A 2FNJB 3ENEA 4DHZE 2KTRB 4II3B 4FJZA 4F1SA 4E3CA 3JW0X 1VCBA 2RD0A 3QCAA 2NPTA 4NQKE 2CHWA 3HK0A 3ZW3A 2HJ8A 3RCZA 3ZTDA 1TTNA 2BWES 3LJ3A 3SDLC 2KWVB 3QWZB 4TQ1A 4G0NB 4KIKB 4HLEA 1E8WA 4IWOA 2JT4B 2KFJA 2L76A 1WXSA 3ZRCA 2UWQA 3H7SA 2N4FA 3DDCB 4P7IA 1P1AA 4GGQA 4AP4C 2J0JA 1UBQA 2D11A 3NS8A 4IM0A 4NY0A 4W9FA 5JHBA 2GOWA 3APFA 3PS6A 4FADA 1WGDA 3M62B 3PREA 5KHOA 3X23A 3JSVA 2LGYA 1C3TA 2KQ7A 4LJOB 5G2NA 2FUHB 3TL5A 1XQQA 1WJ4A 2C7NB 1Z5SB 3QA8A 4GMVA 2HTHA 4W9HA 4MSQB 4KDLB 3RZFA 3VUXA 5CX3A 3ZNZB 3QARA 4KZCA 4W9GA 4J6IA 3QC8B 2OJRA 2ZPNA 3JVZX 2REXA 4NPNA 2A5UA 5LXIB 3HM6X 4MM3A 2PEAA 1K8RB 3L54A 2DZJA 2UYZB 1WYWB 1WM2A 3EFUA 2KVRA 3PV1A 4ZRKA 2MQJA 1WJUA 4W9LA 4ZYNA 3ZNHB 2O6VB 3PRPB 4XX5A 2NVUI 3LDZE 4JL9A 3A1QB 1NI2A 3VTUA 1ISNA 2J7QB 3UIOB 4MEMA 4WJQA 4N9F4 3MHSD 4CHKA 3JYUA 1RLFA 4K7WA 2NS5A 5FR6A 1WR1A 2LJ5A 3RZWC 3T8MA 2QHOA 3BY4B 5J17A 2FCMA 3ZNID 3L0WB 4KV2A 4LJPB 4AUQC 2FIDA 4K81A 1A5RA 4FN2A 2ZCCA 2DZKA 2KX3A 3R7QA 1C1YB 2BPSA 2JZ3B 3IHPC 3Q3FA 4HPLB 2KXJA 1V80A 2ZZPB 3ZNGC 4XZ4A 1WXAA 2ASQA 2I1KA 2JWZA 3NZUA 1VD2A 2IYDB 2KJ6A 2L7RA 3N30A 4EEWA 2KDEB 2KANA 5JZEB 2DYMA 3PLUA 5HKHA 2KMCA 5D2MB 4G11A 4IM2A 2J0MA 4GDKB 2KN5A 4IW0A 1V9JA 2MLBA 3ZTCA 4EFOA 2DX5B 2ZVNA 4BKGA 2MW5A 3IFWB 3NHEB 5TR5A 1SGHA 3PVLA 3BINA 2IO3B 2KKCA 3N32A 1EF5A 2AWTA 4BVUC 2JVCA 4W9KA 4DWFA 1J0GA 3ZIMA 2DYOA 2YLMA 4HK2A 4ZRIA 1J19A 3WAPA 2MBHA 1V5OA 3L10B 2O6VA 2BWFA 3TIXA 2ZVOA 3ZKJC 2K8BA 1KLVA 2D07B 3A1QA 2LGDA 2JZZA 3APCA 3CSFA 3GZNI 4GXBA 4KSLC 1WE6A 4F7ZA 1LFDA 5LXHA 5EDSA 3DBSA 3KUCB 1IYFA 4M0WB 3VH3B 3DBRI 4BBNF 3A9KB 2IY1B 3QIJA 1EO6A 3M95A 2A4ZA 3W1SC 1CMXB 3UGBB 4BKSD 4PYUA 4DHZB 5AZGA 1TZ1A 4E74A 2GMIC 4IWPA 1RRBA 3C0RB 4KSKC 2KQSA 1M94A 1NDDA 1P0RA 3NOBA 2B3AA 4EZLA 4WWOA 2CU1A 2EMSA 3ECIA 1E8ZA 1F9JA 3OJ3A 4B9KA 3CSTA 1L7YA 3NZSA 4ICUA 2NBVB 2AEHA 4JGHB 1GC7A 2C5LC 2KDFB 4DDID 3M63B 3R3MA 1R4MI 3EC8A 3PRMB 2R2OA 4GDKA 4NJ6A 3VUYA 4EZKA 1UD7A 1OTRB 3DPDA 4IC7B 4X57B 2JY6A 3WA0A 2I1JA 3PHXB 4WWNA 4AJWA 2ZJDA 4LCDE 5AZHA 5DCNA 3ZRFA 1E7VA 4AOFA 4W9JA 4FBJB 1RFAA 3IG3A 3VH4B 4I6NB 2IZVB 4DBGA 3KUZA 2K8HA 3S2AA 2BYFA 1KJTA 4JLCA 3L13A 2PJHA 1UGMA 5GMVA 2HE7A 4WJPA 3X0WA 5JHAA 2L00B 4DXAB 5E6NA 1D3ZA 2JRHA 2ZEQA 5AEKB 3MJWA 4PS3A 3A4SC 2MWSB 3DQVA 3GOEA 4M8NA 4KZ0A 2N7DA 4HCNB 2L0FA 1WGHA 1TGZB 1RAXA 3A9JB 5L83A 3A9KA 2G45B 4TUUA 4EUTA 3AULA 2V4LA 2G4DB 3QAQA 2DYBA 1GJZA 1WX7A 3VXWA 4GDLB 4K1RB 3ONSA 3PRZA 5C1ZA 3PHWB 5D94A 2MBQA 3UQBA 4HCPB 4G3XB 2FCQA 3OAWA 4FLHA 1WMHB 1XD3B 2N9EB 2N9PC 4YL8A 5CTRC 2MRPA 3AI5A 5JH5C 2V1YA 2XK5B 4HXDA 2KJHB 1WGYA 2R2QA 1S3SG 4HJKA 3VFKA 4BFRA 2KTRA 4HDOA 3M3JA 4FJVB 1AARA 2CHXA 2GBNA 2LUEA 2MCNB 1WJ6A 2LXCA 2ZPYA 3B08A 4ANVA 4A3OA 1UBIA 1R4NI 1WJNA 1E8XA 2C60A 3ZLZA 1V86A 2XEWA 2MX2A 3VHTC 2GBMA 3VAWA 1YX5B 1UELA 1Q1OA 2K1FA 3PT2B 3A4RA 2WX1A 1WI0A 3K9OB 4KIKA 4A20A 2DAJA 3EHVA 3KYDD 3N3KB 2MA9B 1WGGA 4E71A 1WZ0A 2KWCA 4IUMB 2DZIA 4MH0E 4W9EA 2G3QB 2JXXA 1UZXB 3H7PB 2D10A 3VTWA 2XBBC 3HIZA 3UQAA 4KDIC 4RM9A 3CMMB 4WJNA 2RR9A 3KH0A 3WALA 3HHMA 3DOWA 2KLCA 2L3ZA 2PPHA 3U30A 5CHVC 3DVNV 1U4AA 4MJSB 1P9DU 3AU4A 1YX6B 2EKEC 3NY5A 2M4NA 1WH3A 2BYVE 4GDLA 2KDBA 1OEYJ 4F8CB 2YVCA 2K6QA 3W1SA 1LQBA 5G55A 4BKSA 5IA7A 2L8JA 3B0AA 4JIOU 1WRDB 3RUIB 1WX9A 2KNBA 4GB9A 3HM3A 2K6DB 2RPQA 4MELA 3V61A 2Y5BB 5KHQA 4GIVA 2KOXA 4XC2A 4B95A 1YD8U 1OEYA 2Z0DB 2JUOA 2CKHB 3WIMA 4HPMB 2MBOA 2LD9A 2AL3A 4KVGB 3UIPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Q B;  3VTV A;  1WM3 A;  4BKT A;  3RYT A;  4NAW B;  1V81 A;  2IBI B;  3K9P B;  1ZKH A;  4MSM B;  2MBB B;  2PE9 A;  5BO4 B;  2NBU A;  3OJ4 B;  2K8C A;  3MTN B;  4ZDV A;  5DPR A;  1FXT B;  4I6P A;  3U8Z A;  1LXD A;  2MP2 B;  3PZD A;  2LVQ A;  3ZVV A;  2JRI B;  3ZO5 B;  2N7E A;  4TQ0 A;  3O65 B;  1P3Q U;  2BYE A;  1V2Y A;  1Z2M A;  3L08 A;  2L0T A;  2BF8 B;  4ASW C;  4BBN C;  4BOZ B;  4MDK E;  1SE9 A;  3U7D A;  4K7S A;  2LVP A;  4HDQ A;  2GBK A;  5AZF A;  2DHZ A;  3ALB A;  1WR6 E;  4FHJ A;  1J8C A;  1GG3 A;  3VVW B;  2Z59 B;  3OLM D;  4MJS A;  5LLI A;  3RUL A;  4AJY B;  4MGI E;  1V49 A;  2FCN A;  2GBJ A;  4WWP A;  2NBW B;  3L16 A;  3H6N A;  2K39 A;  3TBL D;  3ZDM C;  2CHZ A;  3I3T B;  2N1W A;  3L17 A;  4ANU A;  4AWJ A;  3UF8 A;  4MGZ E;  1MG8 A;  1T0Y A;  1X1M A;  2M17 A;  3QQ8 B;  4W9I A;  5CHW A;  3ZDT A;  2FAZ A;  5L95 C;  1WZ3 A;  4RMA A;  1JRU A;  3DBH I;  2G4S A;  2V3S A;  2IY0 B;  1V5T A;  3VUW A;  2LXA A;  1SIF A;  2FIF A;  2KDI A;  1GUA B;  4MGY E;  1KM7 A;  1E8Y A;  4NAW A;  4FA6 A;  4IG7 B;  1EUV B;  1LM8 B;  1QZE A;  1WGR A;  4FJY A;  2ZNV C;  1Q5W B;  4DHJ D;  1P98 A;  3RD2 A;  4IM3 A;  2DAF A;  3VDZ A;  4GU2 A;  2CR5 A;  2KTF A;  2HD5 B;  2M0X A;  3DBL I;  2IO2 B;  2MP2 A;  2KLG A;  3EEC A;  2IO1 B;  3PPA A;  2LWP A;  3WAN A;  1G6J A;  3A33 B;  3DVG Y;  3R7R A;  2KZR A;  1H4R A;  4HVB A;  3TMP B;  5E6O A;  2WYQ A;  2Z0E B;  1PQS A;  2FCS A;  2BKR B;  3H1U A;  1ZGU B;  4LDT D;  3IVF A;  3WAM A;  2KFK B;  2O2V B;  3PLV A;  2ZCB A;  4ZRJ A;  4FUL A;  3KW5 B;  2NCN A;  2LRW A;  3PGE A;  3QK0 A;  4FHK A;  4GOC A;  1E5W A;  2KC2 A;  2DZM A;  3ML9 A;  1V6E A;  4DK5 A;  4B6W A;  3SU8 X;  5E6P A;  2LRU A;  3VQI A;  3WAO A;  2LZ6 A;  1TBE A;  5D7G A;  4G50 A;  3V62 A;  1WX8 A;  1E7U A;  1YJ1 A;  4CYE A;  1I35 A;  4PS7 A;  2GBR A;  2MBE A;  2KO3 A;  2VRR B;  2BGF A;  3V6E B;  2M1M A;  3ML8 A;  3Q3J A;  4NQL B;  4PYZ A;  3DCG A;  2KMA A;  1YQB A;  5IAA C;  2WX0 A;  4WAA A;  4A3P A;  3UIN B;  1HE8 A;  2LI5 A;  3AXC A;  3DVN U;  3H9D A;  3A9J A;  4IWQ A;  2EMT A;  4M8M A;  3QHT A;  4ANW A;  3V60 A;  2RSU A;  2NR2 A;  2IO0 B;  5J2R A;  4JQW C;  3PSE B;  4HWI B;  3SHQ A;  2J0K A;  3V6C B;  4II2 B;  1IPG A;  4I6L B;  1WFY A;  4CO7 A;  4MGK E;  3CF6 E;  1WXM A;  4DDG D;  4OVU A;  2LAS A;  3QX1 A;  1E90 A;  1WF9 A;  1YIW A;  1OQY A;  4K7U A;  1WMH A;  2ZNV B;  4GN1 A;  4DHJ B;  5DPW A;  1Y8R C;  3P2B A;  1WIA A;  5CHF A;  1UH6 A;  4NNJ B;  4NJ7 A;  2XK5 A;  2NPT B;  2C7M B;  2RGF A;  2MSE D;  2KC1 A;  3PTF C;  2W9N A;  2KWU B;  1WY8 A;  2KFK A;  2O2V A;  2LGX A;  3IBE A;  4W9C A;  2CS4 A;  5DPS A;  1WXV A;  2D3G A;  1Q0W B;  4W9D A;  1OGW A;  2K25 A;  4EKU A;  3SD5 A;  2AYO B;  2JF5 A;  3B1L X;  2LVO A;  4LDT B;  4OVV A;  4PS8 A;  3ZUN A;  1EF1 A;  1GC6 A;  3APD A;  3KUD B;  1I42 A;  3W1Y A;  1XT9 B;  2C7H A;  2KD0 A;  4EOY A;  3QJZ A;  3H7P A;  2WWZ A;  2DEN B;  3JSV B;  1WE7 A;  1KOT A;  2D2Q A;  3TJP A;  5J18 A;  2JPH A;  2BKF A;  1GNU A;  2C9W B;  2KJR A;  2KX0 A;  3KYC D;  3RT3 B;  1ZW7 A;  4RM8 A;  4URK A;  2N9X A;  2KHW B;  1H8C A;  5DPT A;  4WQO B;  4EZJ A;  2O6V D;  4TKN A;  2N1V A;  4WJO A;  1L2N A;  1IP9 A;  2PE6 B;  3TCA A;  5D6J B;  3DVG X;  2M8S A;  4GSW A;  2KK8 A;  3KVF B;  4ICV A;  1BT0 A;  1NBF C;  3D32 A;  4ANX A;  2OOB B;  3T9L A;  2L05 A;  4BOS C;  2AL6 A;  3R66 C;  4TV3 A;  3AU5 A;  2WDT B;  5C23 A;  2FNJ B;  3ENE A;  4DHZ E;  2KTR B;  4II3 B;  4FJZ A;  4F1S A;  4E3C A;  3JW0 X;  1VCB A;  2RD0 A;  3QCA A;  2NPT A;  4NQK E;  2CHW A;  3HK0 A;  3ZW3 A;  2HJ8 A;  3RCZ A;  3ZTD A;  1TTN A;  2BWE S;  3LJ3 A;  3SDL C;  2KWV B;  3QWZ B;  4TQ1 A;  4G0N B;  4KIK B;  4HLE A;  1E8W A;  4IWO A;  2JT4 B;  2KFJ A;  2L76 A;  1WXS A;  3ZRC A;  2UWQ A;  3H7S A;  2N4F A;  3DDC B;  4P7I A;  1P1A A;  4GGQ A;  4AP4 C;  2J0J A;  1UBQ A;  2D11 A;  3NS8 A;  4IM0 A;  4NY0 A;  4W9F A;  5JHB A;  2GOW A;  3APF A;  3PS6 A;  4FAD A;  1WGD A;  3M62 B;  3PRE A;  5KHO A;  3X23 A;  3JSV A;  2LGY A;  1C3T A;  2KQ7 A;  4LJO B;  5G2N A;  2FUH B;  3TL5 A;  1XQQ A;  1WJ4 A;  2C7N B;  1Z5S B;  3QA8 A;  4GMV A;  2HTH A;  4W9H A;  4MSQ B;  4KDL B;  3RZF A;  3VUX A;  5CX3 A;  3ZNZ B;  3QAR A;  4KZC A;  4W9G A;  4J6I A;  3QC8 B;  2OJR A;  2ZPN A;  3JVZ X;  2REX A;  4NPN A;  2A5U A;  5LXI B;  3HM6 X;  4MM3 A;  2PEA A;  1K8R B;  3L54 A;  2DZJ A;  2UYZ B;  1WYW B;  1WM2 A;  3EFU A;  2KVR A;  3PV1 A;  4ZRK A;  2MQJ A;  1WJU A;  4W9L A;  4ZYN A;  3ZNH B;  2O6V B;  3PRP B;  4XX5 A;  2NVU I;  3LDZ E;  4JL9 A;  3A1Q B;  1NI2 A;  3VTU A;  1ISN A;  2J7Q B;  3UIO B;  4MEM A;  4WJQ A;  4N9F 4;  3MHS D;  4CHK A;  3JYU A;  1RLF A;  4K7W A;  2NS5 A;  5FR6 A;  1WR1 A;  2LJ5 A;  3RZW C;  3T8M A;  2QHO A;  3BY4 B;  5J17 A;  2FCM A;  3ZNI D;  3L0W B;  4KV2 A;  4LJP B;  4AUQ C;  2FID A;  4K81 A;  1A5R A;  4FN2 A;  2ZCC A;  2DZK A;  2KX3 A;  3R7Q A;  1C1Y B;  2BPS A;  2JZ3 B;  3IHP C;  3Q3F A;  4HPL B;  2KXJ A;  1V80 A;  2ZZP B;  3ZNG C;  4XZ4 A;  1WXA A;  2ASQ A;  2I1K A;  2JWZ A;  3NZU A;  1VD2 A;  2IYD B;  2KJ6 A;  2L7R A;  3N30 A;  4EEW A;  2KDE B;  2KAN A;  5JZE B;  2DYM A;  3PLU A;  5HKH A;  2KMC A;  5D2M B;  4G11 A;  4IM2 A;  2J0M A;  4GDK B;  2KN5 A;  4IW0 A;  1V9J A;  2MLB A;  3ZTC A;  4EFO A;  2DX5 B;  2ZVN A;  4BKG A;  2MW5 A;  3IFW B;  3NHE B;  5TR5 A;  1SGH A;  3PVL A;  3BIN A;  2IO3 B;  2KKC A;  3N32 A;  1EF5 A;  2AWT A;  4BVU C;  2JVC A;  4W9K A;  4DWF A;  1J0G A;  3ZIM A;  2DYO A;  2YLM A;  4HK2 A;  4ZRI A;  1J19 A;  3WAP A;  2MBH A;  1V5O A;  3L10 B;  2O6V A;  2BWF A;  3TIX A;  2ZVO A;  3ZKJ C;  2K8B A;  1KLV A;  2D07 B;  3A1Q A;  2LGD A;  2JZZ A;  3APC A;  3CSF A;  3GZN I;  4GXB A;  4KSL C;  1WE6 A;  4F7Z A;  1LFD A;  5LXH A;  5EDS A;  3DBS A;  3KUC B;  1IYF A;  4M0W B;  3VH3 B;  3DBR I;  4BBN F;  3A9K B;  2IY1 B;  3QIJ A;  1EO6 A;  3M95 A;  2A4Z A;  3W1S C;  1CMX B;  3UGB B;  4BKS D;  4PYU A;  4DHZ B;  5AZG A;  1TZ1 A;  4E74 A;  2GMI C;  4IWP A;  1RRB A;  3C0R B;  4KSK C;  2KQS A;  1M94 A;  1NDD A;  1P0R A;  3NOB A;  2B3A A;  4EZL A;  4WWO A;  2CU1 A;  2EMS A;  3ECI A;  1E8Z A;  1F9J A;  3OJ3 A;  4B9K A;  3CST A;  1L7Y A;  3NZS A;  4ICU A;  2NBV B;  2AEH A;  4JGH B;  1GC7 A;  2C5L C;  2KDF B;  4DDI D;  3M63 B;  3R3M A;  1R4M I;  3EC8 A;  3PRM B;  2R2O A;  4GDK A;  4NJ6 A;  3VUY A;  4EZK A;  1UD7 A;  1OTR B;  3DPD A;  4IC7 B;  4X57 B;  2JY6 A;  3WA0 A;  2I1J A;  3PHX B;  4WWN A;  4AJW A;  2ZJD A;  4LCD E;  5AZH A;  5DCN A;  3ZRF A;  1E7V A;  4AOF A;  4W9J A;  4FBJ B;  1RFA A;  3IG3 A;  3VH4 B;  4I6N B;  2IZV B;  4DBG A;  3KUZ A;  2K8H A;  3S2A A;  2BYF A;  1KJT A;  4JLC A;  3L13 A;  2PJH A;  1UGM A;  5GMV A;  2HE7 A;  4WJP A;  3X0W A;  5JHA A;  2L00 B;  4DXA B;  5E6N A;  1D3Z A;  2JRH A;  2ZEQ A;  5AEK B;  3MJW A;  4PS3 A;  3A4S C;  2MWS B;  3DQV A;  3GOE A;  4M8N A;  4KZ0 A;  2N7D A;  4HCN B;  2L0F A;  1WGH A;  1TGZ B;  1RAX A;  3A9J B;  5L83 A;  3A9K A;  2G45 B;  4TUU A;  4EUT A;  3AUL A;  2V4L A;  2G4D B;  3QAQ A;  2DYB A;  1GJZ A;  1WX7 A;  3VXW A;  4GDL B;  4K1R B;  3ONS A;  3PRZ A;  5C1Z A;  3PHW B;  5D94 A;  2MBQ A;  3UQB A;  4HCP B;  4G3X B;  2FCQ A;  3OAW A;  4FLH A;  1WMH B;  1XD3 B;  2N9E B;  2N9P C;  4YL8 A;  5CTR C;  2MRP A;  3AI5 A;  5JH5 C;  2V1Y A;  2XK5 B;  4HXD A;  2KJH B;  1WGY A;  2R2Q A;  1S3S G;  4HJK A;  3VFK A;  4BFR A;  2KTR A;  4HDO A;  3M3J A;  4FJV B;  1AAR A;  2CHX A;  2GBN A;  2LUE A;  2MCN B;  1WJ6 A;  2LXC A;  2ZPY A;  3B08 A;  4ANV A;  4A3O A;  1UBI A;  1R4N I;  1WJN A;  1E8X A;  2C60 A;  3ZLZ A;  1V86 A;  2XEW A;  2MX2 A;  3VHT C;  2GBM A;  3VAW A;  1YX5 B;  1UEL A;  1Q1O A;  2K1F A;  3PT2 B;  3A4R A;  2WX1 A;  1WI0 A;  3K9O B;  4KIK A;  4A20 A;  2DAJ A;  3EHV A;  3KYD D;  3N3K B;  2MA9 B;  1WGG A;  4E71 A;  1WZ0 A;  2KWC A;  4IUM B;  2DZI A;  4MH0 E;  4W9E A;  2G3Q B;  2JXX A;  1UZX B;  3H7P B;  2D10 A;  3VTW A;  2XBB C;  3HIZ A;  3UQA A;  4KDI C;  4RM9 A;  3CMM B;  4WJN A;  2RR9 A;  3KH0 A;  3WAL A;  3HHM A;  3DOW A;  2KLC A;  2L3Z A;  2PPH A;  3U30 A;  5CHV C;  3DVN V;  1U4A A;  4MJS B;  1P9D U;  3AU4 A;  1YX6 B;  2EKE C;  3NY5 A;  2M4N A;  1WH3 A;  2BYV E;  4GDL A;  2KDB A;  1OEY J;  4F8C B;  2YVC A;  2K6Q A;  3W1S A;  1LQB A;  5G55 A;  4BKS A;  5IA7 A;  2L8J A;  3B0A A;  4JIO U;  1WRD B;  3RUI B;  1WX9 A;  2KNB A;  4GB9 A;  3HM3 A;  2K6D B;  2RPQ A;  4MEL A;  3V61 A;  2Y5B B;  5KHQ A;  4GIV A;  2KOX A;  4XC2 A;  4B95 A;  1YD8 U;  1OEY A;  2Z0D B;  2JUO A;  2CKH B;  3WIM A;  4HPM B;  2MBO A;  2LD9 A;  2AL3 A;  4KVG B;  3UIP B; 
#chains in the Genus database with same CATH topology
 3MFG A;  4NAW B;  1V81 A;  3I9V 1;  2G9H D;  2MBB B;  5BO4 B;  5DPR A;  1FXT B;  1LXD A;  1ZP0 B;  3IXS A;  3PZD A;  2JRI B;  2QEJ C;  2L0T A;  3I57 A;  2AQ3 B;  3U7D A;  1AN8 A;  2INC C;  5AZF A;  3ALB A;  1R4M B;  4MJS A;  4PT5 A;  1PUT A;  3H6N A;  2K39 A;  2CHZ A;  4C7Y A;  4AWJ A;  2E3T A;  3P63 A;  4YSZ B;  2FAZ A;  2GB1 A;  5IP4 D;  1DOY A;  2LXA A;  2VZK D;  1VJK A;  2KDI A;  1AYF A;  1KM7 A;  1EUV B;  1LM8 B;  1WGR A;  4YWG G;  1C4P A;  3B9J A;  3VDZ A;  2HD5 B;  2LMC A;  3DBL I;  3NS1 A;  2MP2 A;  3EEC A;  1E10 A;  3AEB B;  1H4R A;  2BB5 A;  3URY A;  3IVF A;  3WAM A;  3R2I A;  2M0A A;  2WP9 B;  2DZM A;  2LJI A;  2K9X A;  1YJ1 A;  4CYE A;  2BGF A;  2PMV A;  2KN4 A;  3V6E B;  3Q3J A;  2RDH A;  3P4Q B;  2WXR A;  1I4H A;  3UIN B;  1HE8 A;  1I4Q A;  3P4R B;  3AXC A;  3A9J A;  4ANW A;  2IO0 B;  4JQW C;  1L6U A;  4I6L B;  4KKJ A;  2KAJ A;  4OVU A;  1E90 A;  1K51 A;  5C2T B;  1YIW A;  4K7U A;  1JRO A;  2QJL A;  2ZNV B;  4GN1 A;  5DPW A;  3VR9 B;  3E56 A;  3P2B A;  4NNJ B;  5MPO A;  2NPT B;  2C7M B;  1J7C A;  1HZ6 A;  1L4D B;  4RCO A;  4W9C A;  5DPS A;  5IN7 A;  2CS4 A;  1YQ3 B;  1Q0W B;  1QOA A;  1OGW A;  1GB1 A;  3RNC C;  4MAC A;  2K25 A;  4LDT B;  4OVV A;  4PS8 A;  3ZUN A;  2KYW A;  3MJ5 A;  1EF1 A;  3APD A;  3KUD B;  1HA5 A;  1XT9 B;  2C7H A;  3AH7 A;  2KD0 A;  4P16 A;  4EOY A;  2RDB C;  3JSV B;  3IT4 B;  1KOT A;  3TJP A;  2V9H A;  2KJR A;  1NYR A;  1ESF A;  2WXO A;  2KHW B;  4MH8 A;  1UWX A;  4WQO B;  2O6V D;  2N1V A;  4MM3 B;  1L2N A;  1SE2 A;  4OHJ A;  2BW2 A;  4ICV A;  3KVF B;  1NBF C;  1CQV A;  3T9L A;  5C23 A;  3Q8C A;  4DHZ E;  3Q3N C;  3TEX A;  4E3C A;  3JW0 X;  1VCB A;  2IJ0 A;  2RD0 A;  1N62 A;  2CHW A;  3HK0 A;  2N9K A;  2ACZ B;  3RCZ A;  4ZOH C;  1TTN A;  3R2T A;  3BII D;  1FMA D;  1T0S C;  2WU2 B;  3ZRC A;  1OQR A;  2UWQ A;  2BBC A;  2QIL A;  4W9F A;  3NS8 A;  1DYQ A;  3SEB A;  5KHO A;  1J7A A;  4ITK A;  1C3T A;  2DLB A;  3TL5 A;  1XQQ A;  2C7N B;  4KDL B;  3N9Y C;  1VZ8 A;  2REX A;  4NPN A;  2A5U A;  5LXI B;  4C00 A;  3AE5 B;  1UF0 A;  2UYZ B;  4N6E B;  1WYW B;  4LNF A;  1WJU A;  1ZE3 D;  4W9L A;  3LDZ E;  3VTU A;  1ISN A;  3RI7 C;  4MEM A;  4WJQ A;  2LJ5 A;  3T8M A;  3MC8 A;  1RYJ A;  3L0W B;  4ZHP A;  4AUQ C;  2LHE A;  1KFY B;  4K81 A;  1A5R A;  1N5W A;  2ZCC A;  4TSS A;  4C80 A;  2DZK A;  3U7Z A;  2KX3 A;  2BPS A;  2JZ3 B;  4XZ4 A;  1WXA A;  2JWZ A;  5BMG A;  2IYD B;  2KJ6 A;  4KX6 B;  3KWV A;  4GDK B;  1ZDX A;  1V9J A;  2DX5 B;  4FXC A;  2MW5 A;  4P1B C;  3PVL A;  2IO3 B;  2KKC A;  2PKO A;  4DWF A;  1SB3 C;  1V5O A;  4M00 A;  3TIX A;  2L32 A;  2HDE A;  3DHH C;  1KLV A;  3BK1 A;  3A1Q A;  2LGD A;  2JZZ A;  2JXT A;  3CSF A;  4GXB A;  4F7Z A;  1UWM A;  5EDS A;  3W1S C;  4C4V A;  2A4Z A;  1CMX B;  3UGB B;  4BKS D;  4DHZ B;  5AZG A;  1RM6 C;  4DXF A;  1M94 A;  2JYT A;  2IDY A;  3NZS A;  1L7Y A;  1FNU A;  3M63 B;  1R4M I;  4NJ6 A;  4IDI A;  2RDG A;  3RNB C;  3PHX B;  4AJW A;  2N9L A;  1NVI D;  5HHD G;  2KVZ A;  2SAK A;  3HUI A;  2PJH A;  1UGM A;  5JHA A;  1T6B X;  4XDD A;  1IGC A;  4M8N A;  4KZ0 A;  1WGH A;  1JWM D;  3GS2 A;  4H2A A;  1XLP A;  4YSY B;  3AUL A;  2V4L A;  3AN1 A;  1TY0 A;  1WX7 A;  4YTP B;  5C1Z A;  3PHW B;  3V3X A;  2N9E B;  5JXV A;  3I5J C;  4YL8 A;  5CTR C;  1YJI A;  5JH5 C;  2XK5 B;  2KJH B;  2LFI A;  4HDO A;  1AAR A;  2ZPY A;  4DQO C;  1UBI A;  1R4N I;  4QAY A;  1E8X A;  3ZLZ A;  1ZOY B;  2MX2 A;  1YMH E;  2GBM A;  3VHT C;  1YX5 B;  3CWI A;  5H8Y E;  1Q1O A;  1WI0 A;  4Q2J A;  1WGG A;  4TMA B;  4IUM B;  2KWC A;  4MH0 E;  2G3Q B;  4HKZ E;  2MJ3 A;  1KLU D;  1WXQ A;  3CMM B;  2BTE A;  2L3Z A;  1OFF A;  2W3R A;  1U4A A;  4MJS B;  2EKE C;  3ZJU A;  2KDB A;  2YVC A;  1EU4 A;  4RFB A;  2HJ1 A;  4REZ A;  3R8B A;  1YNT E;  2L8J A;  3B0A A;  1WRD B;  5FKA C;  2KWD A;  2KNB A;  2GI9 A;  4GB9 A;  3RUI B;  3NVV A;  3HM3 A;  2KOX A;  1OEY A;  2Z0D B;  5I4D A;  2CKH B;  2MBO A;  5AUK A;  3U4E G;  1S1Q B;  4BKT A;  5IO9 A;  3RYT A;  4XGA B;  1MHH E;  1ZKH A;  2PE9 A;  2V3N A;  1TKY A;  2NBU A;  4HKQ A;  3DWM A;  4ZDV A;  2E6X A;  3U8Z A;  4I6P A;  3BZD B;  2MP2 B;  3VRA B;  1TT5 B;  1C9F A;  2X8X X;  3ZO5 B;  3O65 B;  2BYE A;  1Z2M A;  3VR8 B;  4BOZ B;  4BBN C;  1SE4 A;  1SE9 A;  3W5U B;  2L83 A;  4ZRQ A;  4FHJ A;  2BYT A;  1XCT L;  5LLI A;  2DNF A;  2GBJ A;  1AWD A;  4WWP A;  2NBW B;  1N60 A;  3L16 A;  3P4P B;  3I3T B;  1KTK A;  2WU5 B;  4MGZ E;  4RMA A;  3RN9 C;  2G4S A;  1DGJ A;  3BK2 A;  4WQM A;  1SIF A;  4MGY E;  1GUA B;  1HZ5 A;  4FA6 A;  1QZE A;  1Q5W B;  1PFD A;  1C77 A;  3P4S B;  4GU2 A;  2WGS A;  4BAX A;  1SEB D;  2KLG A;  2WXM A;  1G6J A;  2LWP A;  3AE6 B;  3TMP B;  4LNI A;  1I4P A;  2WYQ A;  2Z0E B;  1TYG B;  1FRD A;  3H1U A;  1ZGU B;  4LDT D;  2W55 A;  4ZRJ A;  3N20 C;  1UGJ A;  3KW5 B;  2LRW A;  2BB6 A;  4B6W A;  2WXN A;  2BS3 B;  2LZ6 A;  5D7G A;  4G50 A;  1I35 A;  3ZJV A;  2GBR A;  1IGD A;  2VRR B;  2WXG A;  3DCG A;  2EKI A;  4HPP A;  4WAA A;  4YTM B;  5FR3 A;  1FNW A;  2WNM A;  3DVN U;  4IWQ A;  4OW0 A;  2EMT A;  3P42 A;  3QHT A;  4OZB A;  2NR2 A;  3PSE B;  3V6C B;  1WFY A;  4CO7 A;  3CF6 E;  1SJH D;  1OQY A;  3SFD B;  1Y8R C;  1BML C;  1WIA A;  5CHF A;  2XK5 A;  3WCQ A;  2RGF A;  2MSE D;  2KC1 A;  3PTF C;  1WY8 A;  2KFK A;  2D5G A;  2LGX A;  1WXV A;  2G1E A;  2AYO B;  3LXF A;  1D4B A;  2LVO A;  1GC6 A;  3FIL B;  2YEP B;  3ABV B;  4ARI A;  2CU3 A;  3QJZ A;  1FPY A;  1TIF A;  5J18 A;  2JPH A;  2BKF A;  1GNU A;  3KYC D;  1CZP A;  1ZW7 A;  4RM8 A;  4C56 C;  1EWY C;  2N9X A;  1JWB D;  5DPT A;  4ZHO A;  2PE6 B;  3DVG X;  2GLS A;  1PDX A;  2QCZ A;  3BVG A;  4JWU C;  1SF0 A;  2AL6 A;  4TV3 A;  1ZXI A;  2WDT B;  2FNJ B;  3ENE A;  3RNG C;  4II3 B;  3ETR A;  4F1S A;  3RNE C;  3FAH A;  4NQK E;  1JWA D;  1P7F A;  2HJ8 A;  1V1P B;  1CK1 A;  3ZTD A;  3LJ3 A;  3W5V B;  2KWV B;  3QWZ B;  4KKI A;  2M19 A;  2ICI A;  4GGQ A;  4AP4 C;  2J0J A;  1UBQ A;  2D11 A;  4NY0 A;  2GOW A;  1PGX A;  2WXF A;  2WS3 B;  4LJO B;  5G2N A;  3RZF A;  3QA8 A;  3NZ3 A;  3VUX A;  5CX3 A;  1TKG A;  3QAR A;  4W9G A;  3QC8 B;  1JAL A;  4LNK A;  4HJG E;  1K8R B;  1QKZ A;  1FM0 D;  2K3U A;  4WWM A;  1MI0 A;  1Q10 A;  3EFU A;  3HVD A;  3NVZ A;  3AEA B;  2JX5 A;  1R4N B;  3PRP B;  4XX5 A;  1FXI A;  4L23 A;  2WDV B;  2I38 A;  3A1Q B;  1NI2 A;  3UIO B;  4N9F 4;  1IBX A;  2NS5 A;  5J17 A;  2FCM A;  4C4V B;  1EWC A;  4LJP B;  1YN4 A;  2LEK A;  3R7Q A;  1C1Y B;  3IHP C;  4HPL B;  4MT5 A;  2KXJ A;  2ZZP B;  2W54 A;  2I1K A;  1FEH A;  2JU6 X;  4EEW A;  5JZE B;  2DYM A;  3PLU A;  3AE8 B;  5HI1 A;  4IM2 A;  2KN5 A;  4HRS A;  1VZ6 A;  4EFO A;  3EA6 A;  4M02 A;  4P6V F;  2AX5 A;  2ZVN A;  3PZ7 A;  3N1Z C;  5TR5 A;  1SGH A;  1FCL A;  2VH2 A;  4BVU C;  4W9K A;  2DYO A;  3E9S A;  2YLM A;  4HK2 A;  4L1B A;  2K8B A;  2BS4 B;  4P1C C;  4A55 A;  1IYF A;  3DBR I;  4N58 A;  1EO6 A;  4S0R A;  2IGD A;  3DHG C;  1RRB A;  1NDD A;  3H8H A;  2B3A A;  4EZL A;  4WWO A;  2CU1 A;  3OJ3 A;  4B9K A;  3Q8F A;  4ICU A;  2DWQ A;  4JGH B;  2AEH A;  2KDF B;  5BYR A;  3R3M A;  5EE1 A;  3PRM B;  3VUY A;  1UD7 A;  1FO4 A;  2WXH A;  4X57 B;  3WA0 A;  5IKC M;  1XO3 A;  4LCD E;  5DCN A;  1RFA A;  1TS5 A;  2IZV B;  2WDR B;  2K8H A;  1KJT A;  4JLC A;  1E6E B;  2HE7 A;  4WJP A;  1SBB B;  3X0W A;  1F77 A;  2L00 B;  3FIL A;  2JRH A;  1ET9 A;  4B0M A;  1N5X A;  4PS3 A;  2N7D A;  1F2R I;  1TGZ B;  1SXT A;  1TS3 A;  2CJO A;  5BMI A;  2G4D B;  2DYB A;  1GJZ A;  1K50 A;  1I4G A;  3PRZ A;  5D94 A;  3EGR A;  3OAW A;  4FLH A;  3MC0 B;  1TS4 A;  4XDC A;  2WXQ A;  3NUH B;  1VLB A;  2Y3A A;  2V1Y A;  4HXD A;  2KQ4 X;  4HJK A;  1XEE A;  1FNV A;  1L5P A;  3M3J A;  3NVW A;  2MCN B;  2GBN A;  2LUE A;  2J4X A;  1BUI C;  4A3O A;  5EE9 A;  5E6J A;  1V1P A;  2WX1 A;  3KYD D;  4E71 A;  1A70 A;  1KLG D;  3Q8B A;  2XBB C;  3HIZ A;  3UQA A;  4KDI C;  4RM9 A;  4YSX B;  3NJT A;  3KH0 A;  3U2S C;  3HHM A;  1UUP A;  2KLC A;  1ROE A;  3DVN V;  1GAQ B;  3AU4 A;  2M4N A;  1WH3 A;  2BYV E;  4GDL A;  5T8I A;  4RGT A;  4F8C B;  3W1S A;  2TSS A;  2K22 A;  5G55 A;  3L4P A;  4JIO U;  2LGI A;  4JPS A;  5KHQ A;  4B95 A;  1YD8 U;  4OZA A;  1JCK B;  4HPM B;  3A33 B;  2LD9 A;  4A8X C;  3UIP B;  1XLQ A;  3BVM A;  3VTV A;  2FBW B;  2IBI B;  2GRI A;  3RNA C;  3AEG B;  3OJ4 B;  4K3B A;  3MTN B;  5GXG B;  1PYW D;  2LVQ A;  4TQ0 A;  2N7E A;  3SR6 A;  1P3Q U;  1V2Y A;  1OQQ A;  3N1X C;  2IGG A;  1WR6 E;  1MPE A;  1GG3 A;  2WXJ A;  2CJN A;  4AJY B;  4MGI E;  1V49 A;  2FCN A;  2INN E;  1T0R C;  3W9C B;  3ZDM C;  2N1W A;  2QC8 A;  3TEW A;  3L17 A;  4ANU A;  3LB8 C;  3B2F A;  3UF8 A;  4M01 A;  3U52 E;  1D6E C;  1MG8 A;  1T0Y A;  1X1M A;  2M17 A;  3QQ8 B;  4W9I A;  4US9 A;  3ZDT A;  1SIJ A;  4HEA 1;  1UNS A;  3ZXR A;  1WZ3 A;  1JRU A;  2WXL A;  3OWE B;  2FIF A;  1VRA B;  4JE3 B;  2ZNV C;  1P98 A;  2DAF A;  2KTF A;  2M0X A;  2MHJ A;  2IO1 B;  3WAN A;  4ZYS A;  1WSP A;  2KZR A;  2FUG 1;  4YTN B;  5E6O A;  1PQS A;  2FCS A;  2KFK B;  1SSN A;  4FUL A;  4XWT A;  3QK0 A;  2NCN A;  4FHK A;  1F0Z A;  4KGR A;  3ML9 A;  1V6E A;  4DK5 A;  2WQY B;  3BWU D;  5E6P A;  3Q3O C;  3VQI A;  2W82 A;  1E7U A;  1V97 A;  2PW9 A;  4PS7 A;  1FCC C;  2KO3 A;  2M1M A;  4NQL B;  4PYZ A;  4HRO A;  4GLS C;  1GPX A;  5IAA C;  4A3P A;  2LI5 A;  3DWG C;  1MHX A;  1ACC A;  2RSU A;  3V60 A;  3V05 A;  5J2R A;  3SHQ A;  4HWI B;  1IPG A;  1WF9 A;  1QQR A;  2PTL A;  3TUO A;  4DHJ B;  2J42 A;  1F1H A;  3CIR B;  5EE0 A;  1UH6 A;  1YJJ A;  3MP9 A;  2KWU B;  2O2V A;  3FKY A;  1TKE A;  2D3G A;  4W9D A;  2XN9 C;  2ZW1 A;  2JZP A;  1RFK A;  3DBR B;  3W1Y A;  1GB4 A;  1PGA A;  2NMQ A;  2WWZ A;  2DEN B;  1D5Z C;  1STE A;  1WE7 A;  1NEN B;  2D2Q A;  1C78 A;  2C9W B;  1QOF A;  2KX0 A;  3RT3 B;  4URK A;  3AE3 B;  2M56 B;  1H8C A;  4EZJ A;  4TKN A;  4WJO A;  3TCA A;  3W2D A;  5D6J B;  2M8S A;  2WXK A;  3NG0 A;  2KK8 A;  2N7J A;  1T0Q C;  2OHF A;  1C79 A;  3D32 A;  4ANX A;  3AU5 A;  2KTR B;  1IBX B;  4FJZ A;  4WAF A;  1L0V B;  3QCA A;  4L2Y A;  1C4A A;  3ZW3 A;  4TQ1 A;  4OZC A;  4KIK B;  3DBH B;  2KFJ A;  1DOX A;  2L76 A;  1WXS A;  3HVZ A;  1P1A A;  5BMH A;  4EE2 A;  3PS6 A;  4FAD A;  3M62 B;  3PRE A;  3X23 A;  2EEL A;  2KQ7 A;  2FUH B;  1WJ4 A;  4W9H A;  4GMV A;  2HTH A;  3BYT B;  4MSQ B;  2MEK A;  3ZNZ B;  4KZC A;  4J6I A;  3Q8E A;  1L4Z B;  3JVZ X;  4D2K A;  3HM6 X;  3L54 A;  4WH4 A;  1WM2 A;  1BXT A;  4ZRK A;  3PV1 A;  4ZYN A;  2WXI A;  1IUE A;  2AQ2 B;  2J7Q B;  1XXG A;  3MHS D;  4K7W A;  4RNA A;  5FR6 A;  3RZW C;  1QLB B;  2QHO A;  1ENF A;  3BY4 B;  1N63 A;  4JX1 C;  2QDF A;  2Q5W D;  2KDM A;  4FN2 A;  2LGS A;  3Q3F A;  1V80 A;  2ASQ A;  2DBY A;  3NZU A;  1E7P B;  3AE7 B;  1FRR A;  1B9R A;  5HKH A;  2KMC A;  4G11 A;  3MHZ A;  1ZUD 2;  3ZYY X;  4IW0 A;  3C8Y A;  3Q69 A;  3AM9 A;  4BKG A;  3IFW B;  3NHE B;  3NVY A;  1ZXH A;  1TJE A;  4PK1 A;  1EF5 A;  3OG5 A;  1J0G A;  3AEE B;  4A90 A;  3ZIM A;  4ZRI A;  1J19 A;  2O6V A;  2BWF A;  3ZKJ C;  2ZVO A;  5LNK 1;  2D07 B;  3GZN I;  4KSL C;  3P1M A;  1YN3 A;  5LXH A;  1EU3 A;  1WWT A;  3DBS A;  3KUC B;  3VH3 B;  4BBN F;  3QIJ A;  2UU7 A;  1T5X D;  1WRI A;  2PLP A;  4IWP A;  3FC4 A;  2KQS A;  1P0R A;  4YT0 B;  2JQR B;  3ECI A;  3CST A;  1HTQ A;  1GC7 A;  1Y56 A;  4C7Z A;  4WIP A;  3RNF C;  3EC8 A;  2R2O A;  4EZK A;  1YQ4 B;  5TSS A;  3PO0 A;  2OED A;  4LTU A;  3DPD A;  4RGN A;  4IC7 B;  2N0S B;  2I1J A;  4AOF A;  4IKG A;  5G5H A;  3GE8 C;  4DBG A;  3AED B;  3KUZ A;  3S2A A;  2BYF A;  3TEZ A;  1D5M C;  1D5X C;  1E9M A;  1D3Z A;  5E6N A;  2ZEQ A;  5AEK B;  1HTO A;  2QMT A;  2MWS B;  3DQV A;  3GOE A;  1V8C A;  2L0F A;  2BS2 B;  4M0W A;  5H92 C;  5L83 A;  3A9K A;  2G45 B;  4TUU A;  4EUT A;  1LO5 D;  4GDL B;  3ONS A;  3UQB A;  2ONQ A;  2FCQ A;  1WMH B;  1ZPS A;  2H89 B;  2MJD A;  3SFE B;  1WGY A;  4BFR A;  2KTR A;  4FJV B;  2CHX A;  1WJ6 A;  2LXC A;  4ANV A;  5C3J B;  3RFZ B;  2Y5C A;  2X38 A;  1WJN A;  2C60 A;  3DHI C;  2XEW A;  3AMZ A;  3VAW A;  3Q3M C;  1UEL A;  2D3B A;  3PT2 B;  2K1F A;  1FIQ A;  3K9O B;  4KIK A;  2DAJ A;  3N3K B;  1WZ0 A;  2DZI A;  2JXX A;  1UZX B;  3H7P B;  1YOV B;  3AE4 B;  3VTW A;  1I4X A;  3MC9 A;  1L0Y B;  3WAL A;  4NZL B;  2PPH A;  1P7E A;  1P9D U;  3AE1 B;  5FK9 C;  3NY5 A;  2J53 A;  1LQB A;  4BKS A;  3TSS A;  1WX9 A;  2R61 A;  2RPQ A;  2Y5B B;  4GIV A;  3AE9 B;  4XC2 A;  4ACF A;  1F2R C;  3OLM D;  2AL3 A;  4KVG B;  2ON8 A;  4LNN A;  1WM3 A;  1L0X B;  3C19 A;  3K9P B;  4MSM B;  4OVZ A;  1NEK B;  2K8C A;  1V1O A;  2BT6 A;  3ZVV A;  5BYS A;  1JQ4 A;  2L1A A;  4DXG A;  3TEY A;  1TY2 A;  3L08 A;  2BF8 B;  4ASW C;  2KT7 A;  1TZO A;  2V4I B;  4MDK E;  4K7S A;  2LVP A;  4HDQ A;  1C76 A;  2GBK A;  2DHZ A;  1J8C A;  2Z59 B;  3T3O A;  1LGR A;  3RUL A;  3BYY B;  2WDQ B;  1RWS A;  1JML A;  2BVC A;  3TBL D;  4ZRP A;  3HRD D;  1MJD A;  4AS1 A;  3RPF C;  5CHW A;  1T3Q A;  2SEB D;  3DBH I;  2MJE A;  2V3S A;  2IY0 B;  1V5T A;  2PVO D;  3VUW A;  2PVG C;  3RMK C;  1I7H A;  2LUM A;  4IOI E;  3GB1 A;  4K3C A;  1E8Y A;  4N59 A;  4NAW A;  4IG7 B;  5AUI A;  2XNA C;  4FJY A;  3T3N A;  4DHJ D;  3BVZ A;  2LHD A;  3RD2 A;  4IM3 A;  1JRP A;  3UI3 A;  2CR5 A;  4XE0 A;  2IO2 B;  4KGS A;  3PPA A;  1K52 A;  3DVG Y;  3R7R A;  4HVB A;  1J7B A;  1VR9 A;  2BKR B;  2O2V B;  3PLV A;  2ZCB A;  3IAM 1;  3KLS X;  5D3I B;  3PGE A;  4GOC A;  1E5W A;  2KC2 A;  2RMM A;  4KGT A;  3SU8 X;  2LRU A;  3EUB 2;  3WAO A;  1TBE A;  3V62 A;  1WX8 A;  2MBE A;  3ML8 A;  5L95 C;  2B76 B;  1KRH A;  4NAM A;  2KMA A;  1L6V A;  1YQB A;  2WX0 A;  4US8 A;  3Q2A C;  3H9D A;  4M8M A;  2VH1 A;  1KH0 A;  1MG4 A;  3IAS 1;  2J0K A;  2WXP A;  4II2 B;  2H88 B;  4MGK E;  2W3S A;  1WXM A;  5EE3 A;  4DDG D;  2LAS A;  3QX1 A;  2VZK B;  3VRB B;  1WMH A;  1FFV A;  4NJ7 A;  2AQ1 B;  2W9N A;  3IBE A;  3GZN B;  1HEZ E;  3AB5 A;  2KAC A;  3SD5 A;  3B1L X;  2JF5 A;  4USA A;  3B2G A;  2Y5P A;  3IT6 B;  1QOG A;  1I42 A;  4WUR A;  4LLG M;  3GP7 A;  3H7P A;  1B1Z A;  1K53 A;  1SJE D;  3Q8A A;  2J52 A;  1IP9 A;  3AEF B;  2QSD A;  2PIA A;  4GSW A;  1FFU A;  1BT0 A;  2OOB B;  2L05 A;  4BOS C;  3R66 C;  5BYQ A;  2I2Y A;  3LYY A;  2NPT A;  2OJW A;  1F52 A;  2BWE S;  3SDL C;  3O13 A;  4G0N B;  4HLE A;  1E8W A;  4IWO A;  2JT4 B;  2JSV X;  4J3O D;  4RF1 A;  3H7S A;  2N4F A;  1SE3 A;  3DDC B;  4P7I A;  4JWS C;  4IM0 A;  5JHB A;  3APF A;  1WGD A;  1XLO A;  3JSV A;  2LGY A;  1XCQ L;  1Z5S B;  1DOI A;  3DBL B;  3I63 C;  2OJR A;  2ZPN A;  4O1N A;  2YEP F;  4RF0 A;  4MM3 A;  2PEA A;  2DZJ A;  1WYG A;  1QOB A;  4XWW A;  2KVR A;  3ZNH B;  2MQJ A;  3Q6B A;  2O6V B;  3AEC B;  2NVU I;  4JL9 A;  4NJC A;  5IOI A;  3ZXV A;  1NYQ A;  2NTT A;  4CHK A;  3JYU A;  1RLF A;  1WR1 A;  1XF5 L;  3ZNI D;  4KV2 A;  2FID A;  4RH6 A;  1R7S A;  3ZNG C;  2MH7 A;  1QT9 A;  1VD2 A;  2L7R A;  3N30 A;  2KDE B;  2KAN A;  2L52 A;  4LK0 M;  1HQR D;  5D2M B;  2J0M A;  2WLB A;  3ZTC A;  2MLB A;  1N6Z A;  1YN5 A;  1FXA A;  1ET6 A;  2JYE A;  3BIN A;  2IND C;  3N32 A;  4BZA A;  2AWT A;  2JVC A;  4CQN A;  3WAP A;  2MBH A;  3L10 B;  1I4R A;  4AQ7 A;  1E0Z A;  2D3C A;  3APC A;  3AV8 A;  2NTS A;  1WE6 A;  1LFD A;  2WHI A;  4M0W B;  1CJE A;  2IY1 B;  3A9K B;  4A9A A;  3M95 A;  3PZ8 A;  2ZW0 A;  4PYU A;  1TZ1 A;  4E74 A;  1VDV A;  2GMI C;  2RPV A;  3C0R B;  4KSK C;  1PGB A;  3NOB A;  2EMS A;  1E8Z A;  3NRZ A;  1F9J A;  4RGO S;  2NBV B;  2C5L C;  4DDI D;  4YXD B;  4GDK A;  3AE2 B;  1MVK A;  1OTR B;  2JY6 A;  2IPK D;  4WWN A;  3EFC A;  3J9C A;  2ZJD A;  5AZH A;  3ZRF A;  1E7V A;  4W9J A;  4FBJ B;  3IG3 A;  3VH4 B;  2INP E;  4I6N B;  1C4C A;  2K5P A;  3L13 A;  1KF6 B;  5GMV A;  4DXA B;  1JWU D;  1JW9 D;  3MJW A;  3KWL A;  3N1Y C;  3A4S C;  2IGH A;  4HCN B;  1RAX A;  3A9J B;  2FE8 A;  2V0G A;  1N61 A;  3QAQ A;  5G5G A;  2QIE B;  3VXW A;  4B0E A;  4K1R B;  2MBQ A;  2KMM A;  4HCP B;  4G3X B;  3ZQ4 A;  1GOZ A;  1XD3 B;  1NI3 A;  2N9P C;  1QIL A;  2MRP A;  3GE3 C;  3AI5 A;  3VFK A;  2R2Q A;  1S3S G;  2JWU A;  5HFY A;  3VVW B;  4EKU A;  1EM7 A;  3B08 A;  3KQ4 A;  2BQQ A;  3Q14 C;  1V86 A;  5HG2 A;  4A6Q A;  3A4R A;  4A20 A;  3EHV A;  2MA9 B;  3ZGZ A;  1QF6 A;  1VZ7 A;  4W9E A;  2Z8L A;  2D3A A;  2D10 A;  5D3D A;  4UDU C;  1M4V A;  4ARC A;  1AW7 A;  3ZJT A;  4R3D A;  4WJN A;  1FD6 A;  4LNO A;  2RR9 A;  2K0P A;  3DOW A;  2V3P A;  3U30 A;  2HTM E;  5CHV C;  1ZDV A;  1TS2 A;  1YX6 B;  4S17 A;  1JWS D;  1HXY D;  1OEY J;  1XLN A;  2K6Q A;  5IA7 A;  2K6D B;  4MEL A;  4RGM A;  4XYC A;  3V61 A;  1WGK A;  1MFW A;  2JUO A;  3WIM A; 
#chains in the Genus database with same CATH homology
 1S1Q B;  3VTV A;  1WM3 A;  4BKT A;  3RYT A;  4NAW B;  1V81 A;  2IBI B;  3K9P B;  1ZKH A;  4MSM B;  2MBB B;  2PE9 A;  5BO4 B;  2NBU A;  3OJ4 B;  2K8C A;  3MTN B;  4ZDV A;  5DPR A;  1FXT B;  4I6P A;  3U8Z A;  1LXD A;  2MP2 B;  3PZD A;  2LVQ A;  3ZVV A;  2JRI B;  3ZO5 B;  2N7E A;  4TQ0 A;  3O65 B;  1P3Q U;  2BYE A;  1V2Y A;  1Z2M A;  3L08 A;  2L0T A;  2BF8 B;  4ASW C;  4BBN C;  4BOZ B;  4MDK E;  1SE9 A;  3U7D A;  4K7S A;  2LVP A;  4HDQ A;  2GBK A;  5AZF A;  2DHZ A;  3ALB A;  1WR6 E;  4FHJ A;  1J8C A;  1GG3 A;  3VVW B;  2Z59 B;  3OLM D;  4MJS A;  5LLI A;  3RUL A;  4AJY B;  4MGI E;  1V49 A;  2FCN A;  2GBJ A;  4WWP A;  2NBW B;  3L16 A;  3H6N A;  2K39 A;  3TBL D;  3ZDM C;  2CHZ A;  3I3T B;  2N1W A;  3L17 A;  4ANU A;  4AWJ A;  3UF8 A;  4MGZ E;  1MG8 A;  1T0Y A;  1X1M A;  2M17 A;  3QQ8 B;  4W9I A;  5CHW A;  3ZDT A;  2FAZ A;  5L95 C;  1WZ3 A;  4RMA A;  1JRU A;  3DBH I;  2G4S A;  2V3S A;  2IY0 B;  1V5T A;  3VUW A;  2LXA A;  1SIF A;  2FIF A;  2KDI A;  1GUA B;  4MGY E;  1KM7 A;  1E8Y A;  4NAW A;  4FA6 A;  4IG7 B;  1EUV B;  1LM8 B;  1QZE A;  1WGR A;  4FJY A;  2ZNV C;  1Q5W B;  4DHJ D;  1P98 A;  3RD2 A;  4IM3 A;  2DAF A;  3VDZ A;  4GU2 A;  2CR5 A;  2KTF A;  2HD5 B;  2M0X A;  3DBL I;  2IO2 B;  2MP2 A;  2KLG A;  3EEC A;  2IO1 B;  3PPA A;  2LWP A;  3WAN A;  1G6J A;  3A33 B;  3DVG Y;  3R7R A;  2KZR A;  1H4R A;  4HVB A;  3TMP B;  5E6O A;  2WYQ A;  2Z0E B;  1PQS A;  2FCS A;  2BKR B;  3H1U A;  1ZGU B;  4LDT D;  3IVF A;  3WAM A;  2KFK B;  2O2V B;  3PLV A;  2ZCB A;  4ZRJ A;  4FUL A;  3KW5 B;  2NCN A;  2LRW A;  3PGE A;  3QK0 A;  4FHK A;  4GOC A;  1E5W A;  2KC2 A;  2DZM A;  3ML9 A;  1V6E A;  4DK5 A;  4B6W A;  3SU8 X;  5E6P A;  2LRU A;  3VQI A;  3WAO A;  2LZ6 A;  1TBE A;  5D7G A;  4G50 A;  3V62 A;  1WX8 A;  1E7U A;  1YJ1 A;  4CYE A;  1I35 A;  4PS7 A;  2GBR A;  2MBE A;  2KO3 A;  2VRR B;  2BGF A;  3V6E B;  2M1M A;  3ML8 A;  3Q3J A;  4NQL B;  4PYZ A;  3DCG A;  2KMA A;  1YQB A;  5IAA C;  2WX0 A;  4WAA A;  4A3P A;  3UIN B;  1HE8 A;  2LI5 A;  3AXC A;  3DVN U;  3H9D A;  3A9J A;  4IWQ A;  2EMT A;  4M8M A;  3QHT A;  4ANW A;  3V60 A;  2RSU A;  2NR2 A;  2IO0 B;  5J2R A;  4JQW C;  3PSE B;  4HWI B;  3SHQ A;  2J0K A;  3V6C B;  4II2 B;  1IPG A;  4I6L B;  1WFY A;  4CO7 A;  4MGK E;  3CF6 E;  1WXM A;  4DDG D;  4OVU A;  2LAS A;  3QX1 A;  1E90 A;  1WF9 A;  1YIW A;  1OQY A;  4K7U A;  1WMH A;  2ZNV B;  4GN1 A;  4DHJ B;  5DPW A;  1Y8R C;  3P2B A;  1WIA A;  5CHF A;  1UH6 A;  4NNJ B;  4NJ7 A;  2XK5 A;  2NPT B;  2C7M B;  2RGF A;  2MSE D;  2KC1 A;  3PTF C;  2W9N A;  2KWU B;  1WY8 A;  2KFK A;  2O2V A;  2LGX A;  3IBE A;  4W9C A;  2CS4 A;  5DPS A;  1WXV A;  2D3G A;  1Q0W B;  4W9D A;  1OGW A;  2K25 A;  4EKU A;  3SD5 A;  2AYO B;  2JF5 A;  3B1L X;  2LVO A;  4LDT B;  4OVV A;  4PS8 A;  3ZUN A;  1EF1 A;  1GC6 A;  3APD A;  3KUD B;  1I42 A;  3W1Y A;  1XT9 B;  2C7H A;  2KD0 A;  4EOY A;  3QJZ A;  3H7P A;  2WWZ A;  2DEN B;  3JSV B;  1WE7 A;  1KOT A;  2D2Q A;  3TJP A;  5J18 A;  2JPH A;  2BKF A;  1GNU A;  2C9W B;  2KJR A;  2KX0 A;  3KYC D;  3RT3 B;  1ZW7 A;  4RM8 A;  4URK A;  2N9X A;  2KHW B;  1H8C A;  5DPT A;  4WQO B;  4EZJ A;  2O6V D;  4TKN A;  2N1V A;  4WJO A;  1L2N A;  1IP9 A;  2PE6 B;  3TCA A;  5D6J B;  3DVG X;  2M8S A;  4GSW A;  2KK8 A;  3KVF B;  4ICV A;  1BT0 A;  1NBF C;  3D32 A;  4ANX A;  2OOB B;  3T9L A;  2L05 A;  4BOS C;  2AL6 A;  3R66 C;  4TV3 A;  3AU5 A;  2WDT B;  5C23 A;  2FNJ B;  3ENE A;  4DHZ E;  2KTR B;  4II3 B;  4FJZ A;  4F1S A;  4E3C A;  3JW0 X;  1VCB A;  2RD0 A;  3QCA A;  2NPT A;  4NQK E;  2CHW A;  3HK0 A;  3ZW3 A;  2HJ8 A;  3RCZ A;  3ZTD A;  1TTN A;  2BWE S;  3LJ3 A;  3SDL C;  2KWV B;  3QWZ B;  4TQ1 A;  4G0N B;  4KIK B;  4HLE A;  1E8W A;  4IWO A;  2JT4 B;  2KFJ A;  2L76 A;  1WXS A;  3ZRC A;  2UWQ A;  3H7S A;  2N4F A;  3DDC B;  4P7I A;  1P1A A;  4GGQ A;  4AP4 C;  2J0J A;  1UBQ A;  2D11 A;  3NS8 A;  4IM0 A;  4NY0 A;  4W9F A;  5JHB A;  2GOW A;  3APF A;  3PS6 A;  4FAD A;  1WGD A;  3M62 B;  3PRE A;  5KHO A;  3X23 A;  3JSV A;  2LGY A;  1C3T A;  2KQ7 A;  4LJO B;  5G2N A;  2FUH B;  3TL5 A;  1XQQ A;  1WJ4 A;  2C7N B;  1Z5S B;  3QA8 A;  4GMV A;  2HTH A;  4W9H A;  4MSQ B;  4KDL B;  3RZF A;  3VUX A;  5CX3 A;  3ZNZ B;  3QAR A;  4KZC A;  4W9G A;  4J6I A;  3QC8 B;  2OJR A;  2ZPN A;  3JVZ X;  2REX A;  4NPN A;  2A5U A;  5LXI B;  3HM6 X;  4MM3 A;  2PEA A;  1K8R B;  3L54 A;  2DZJ A;  2UYZ B;  1WYW B;  1WM2 A;  3EFU A;  2KVR A;  3PV1 A;  4ZRK A;  2MQJ A;  1WJU A;  4W9L A;  4ZYN A;  3ZNH B;  2O6V B;  3PRP B;  4XX5 A;  2NVU I;  3LDZ E;  4JL9 A;  3A1Q B;  1NI2 A;  3VTU A;  1ISN A;  2J7Q B;  3UIO B;  4MEM A;  4WJQ A;  4N9F 4;  3MHS D;  4CHK A;  3JYU A;  1RLF A;  4K7W A;  2NS5 A;  5FR6 A;  1WR1 A;  2LJ5 A;  3RZW C;  3T8M A;  2QHO A;  3BY4 B;  5J17 A;  2FCM A;  3ZNI D;  3L0W B;  4KV2 A;  4LJP B;  4AUQ C;  2FID A;  4K81 A;  1A5R A;  4FN2 A;  2ZCC A;  2DZK A;  2KX3 A;  3R7Q A;  1C1Y B;  2BPS A;  2JZ3 B;  3IHP C;  3Q3F A;  4HPL B;  2KXJ A;  1V80 A;  2ZZP B;  3ZNG C;  4XZ4 A;  1WXA A;  2ASQ A;  2I1K A;  2JWZ A;  3NZU A;  1VD2 A;  2IYD B;  2KJ6 A;  2L7R A;  3N30 A;  4EEW A;  2KDE B;  2KAN A;  5JZE B;  2DYM A;  3PLU A;  5HKH A;  2KMC A;  5D2M B;  4G11 A;  4IM2 A;  2J0M A;  4GDK B;  2KN5 A;  4IW0 A;  1V9J A;  2MLB A;  3ZTC A;  4EFO A;  2DX5 B;  2ZVN A;  4BKG A;  2MW5 A;  3IFW B;  3NHE B;  5TR5 A;  1SGH A;  3PVL A;  3BIN A;  2IO3 B;  2KKC A;  3N32 A;  1EF5 A;  2AWT A;  4BVU C;  2JVC A;  4W9K A;  4DWF A;  1J0G A;  3ZIM A;  2DYO A;  2YLM A;  4HK2 A;  4ZRI A;  1J19 A;  3WAP A;  2MBH A;  1V5O A;  3L10 B;  2O6V A;  2BWF A;  3TIX A;  2ZVO A;  3ZKJ C;  2K8B A;  1KLV A;  2D07 B;  3A1Q A;  2LGD A;  2JZZ A;  3APC A;  3CSF A;  3GZN I;  4GXB A;  4KSL C;  1WE6 A;  4F7Z A;  1LFD A;  5LXH A;  5EDS A;  3DBS A;  3KUC B;  1IYF A;  4M0W B;  3VH3 B;  3DBR I;  4BBN F;  3A9K B;  2IY1 B;  3QIJ A;  1EO6 A;  3M95 A;  2A4Z A;  3W1S C;  1CMX B;  3UGB B;  4BKS D;  4PYU A;  4DHZ B;  5AZG A;  1TZ1 A;  4E74 A;  2GMI C;  4IWP A;  1RRB A;  3C0R B;  4KSK C;  2KQS A;  1M94 A;  1NDD A;  1P0R A;  3NOB A;  2B3A A;  4EZL A;  4WWO A;  2CU1 A;  2EMS A;  3ECI A;  1E8Z A;  1F9J A;  3OJ3 A;  4B9K A;  3CST A;  1L7Y A;  3NZS A;  4ICU A;  2NBV B;  2AEH A;  4JGH B;  1GC7 A;  2C5L C;  2KDF B;  4DDI D;  3M63 B;  3R3M A;  1R4M I;  3EC8 A;  3PRM B;  2R2O A;  4GDK A;  4NJ6 A;  3VUY A;  4EZK A;  1UD7 A;  1OTR B;  3DPD A;  4IC7 B;  4X57 B;  2JY6 A;  3WA0 A;  2I1J A;  3PHX B;  4WWN A;  4AJW A;  2ZJD A;  4LCD E;  5AZH A;  5DCN A;  3ZRF A;  1E7V A;  4AOF A;  4W9J A;  4FBJ B;  1RFA A;  3IG3 A;  3VH4 B;  4I6N B;  2IZV B;  4DBG A;  3KUZ A;  2K8H A;  3S2A A;  2BYF A;  1KJT A;  4JLC A;  3L13 A;  2PJH A;  1UGM A;  5GMV A;  2HE7 A;  4WJP A;  3X0W A;  5JHA A;  2L00 B;  4DXA B;  5E6N A;  1D3Z A;  2JRH A;  2ZEQ A;  5AEK B;  3MJW A;  4PS3 A;  3A4S C;  2MWS B;  3DQV A;  3GOE A;  4M8N A;  4KZ0 A;  2N7D A;  4HCN B;  2L0F A;  1WGH A;  1TGZ B;  1RAX A;  3A9J B;  5L83 A;  3A9K A;  2G45 B;  4TUU A;  4EUT A;  3AUL A;  2V4L A;  2G4D B;  3QAQ A;  2DYB A;  1GJZ A;  1WX7 A;  3VXW A;  4GDL B;  4K1R B;  3ONS A;  3PRZ A;  5C1Z A;  3PHW B;  5D94 A;  2MBQ A;  3UQB A;  4HCP B;  4G3X B;  2FCQ A;  3OAW A;  4FLH A;  1WMH B;  1XD3 B;  2N9E B;  2N9P C;  4YL8 A;  5CTR C;  2MRP A;  3AI5 A;  5JH5 C;  2V1Y A;  2XK5 B;  4HXD A;  2KJH B;  1WGY A;  2R2Q A;  1S3S G;  4HJK A;  3VFK A;  4BFR A;  2KTR A;  4HDO A;  3M3J A;  4FJV B;  1AAR A;  2CHX A;  2GBN A;  2LUE A;  2MCN B;  1WJ6 A;  2LXC A;  2ZPY A;  3B08 A;  4ANV A;  4A3O A;  1UBI A;  1R4N I;  1WJN A;  1E8X A;  2C60 A;  3ZLZ A;  1V86 A;  2XEW A;  2MX2 A;  3VHT C;  2GBM A;  3VAW A;  1YX5 B;  1UEL A;  1Q1O A;  2K1F A;  3PT2 B;  3A4R A;  2WX1 A;  1WI0 A;  3K9O B;  4KIK A;  4A20 A;  2DAJ A;  3EHV A;  3KYD D;  3N3K B;  2MA9 B;  1WGG A;  4E71 A;  1WZ0 A;  2KWC A;  4IUM B;  2DZI A;  4MH0 E;  4W9E A;  2G3Q B;  2JXX A;  1UZX B;  3H7P B;  2D10 A;  3VTW A;  2XBB C;  3HIZ A;  3UQA A;  4KDI C;  4RM9 A;  3CMM B;  4WJN A;  2RR9 A;  3KH0 A;  3WAL A;  3HHM A;  3DOW A;  2KLC A;  2L3Z A;  2PPH A;  3U30 A;  5CHV C;  3DVN V;  1U4A A;  4MJS B;  1P9D U;  3AU4 A;  1YX6 B;  2EKE C;  3NY5 A;  2M4N A;  1WH3 A;  2BYV E;  4GDL A;  2KDB A;  1OEY J;  4F8C B;  2YVC A;  2K6Q A;  3W1S A;  1LQB A;  5G55 A;  4BKS A;  5IA7 A;  2L8J A;  3B0A A;  4JIO U;  1WRD B;  3RUI B;  1WX9 A;  2KNB A;  4GB9 A;  3HM3 A;  2K6D B;  2RPQ A;  4MEL A;  3V61 A;  2Y5B B;  5KHQ A;  4GIV A;  2KOX A;  4XC2 A;  4B95 A;  1YD8 U;  1OEY A;  2Z0D B;  2JUO A;  2CKH B;  3WIM A;  4HPM B;  2MBO A;  2LD9 A;  2AL3 A;  4KVG B;  3UIP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...