2Y5BB

Structure of usp21 in complex with linear diubiquitin-aldehyde
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
149
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 21
publication title Polyubiquitin Binding and Cross-Reactivity in the Usp Domain Deubiquitinase Usp21.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 149
sequence length 151
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2y5bB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2y5bB01
3SDLC 4KV2A 3DPDA 2KTRB 3A9JB 4NJ7A 2JZ3B 4EZLA 2N9EB 1RFAA 2OOBB 3N32A 1Z5SB 3N30A 3OJ3A 4TQ0A 5J2RA 3U8ZA 4WWPA 1X1MA 2DYBA 3NS8A 1YJ1A 2YVCA 1GUAB 2L05A 2KQ7A 3DDCB 5AZGA 3JSVA 2KJHB 3WANA 4IG7B 2A4ZA 3NHEB 3PVLA 3CSTA 3APCA 4K81A 3QQ8B 4JQWC 1WE6A 4K1RB 2MCNB 1P9DU 4GGQA 4DWFA 3NZUA 4W9KA 3APFA 2UWQA 1UBQA 1NDDA 4IWPA 2MQJA 1TTNA 4B9KA 4NQKE 4W9GA 3M3JA 2KDIA 4G3XB 3H9DA 3ZW3A 4HPLB 5LXIB 3PRPB 1WMHB 3A4SC 1VCBA 2JRHA 1WXSA 1WIAA 3GZNI 4OVUA 4DDID 2LJ5A 4OVVA 2MA9B 3ECIA 1PQSA 3ZO5B 3DVGX 2JVCA 4MM3A 3TCAA 3KUZA 4KIKB 3HIZA 4KVGB 2RGFA 1WX9A 2DENB 3RYTA 2O2VB 2KWCA 3QIJA 5GMVA 3WA0A 5JZEB 3ZRCA 4DHJD 3R7RA 3EFUA 2DHZA 2QHOA 4GDKB 4PYUA 3V6CB 4TV3A 2M8SA 2M0XA 4KDLB 3TL5A 1OTRB 3ZDMC 2KTFA 2FIFA 4JGHB 2BWFA 2AWTA 3DBSA 4M8NA 4NAWB 2LRWA 3ZKJC 3VUXA 2NS5A 1E7UA 2DZKA 2K8BA 3DQVA 5BO4B 2KD0A 2NCNA 4MJSA 2NBUA 2GBJA 2DX5B 1GC6A 4MGYE 3VUWA 4K7UA 2AYOB 3HK0A 2D2QA 2D07B 2D11A 3UIPB 3ZLZA 4BKSA 2JZZA 2XK5A 4NNJB 2JUOA 1KM7A 4LJOB 2L8JA 2MLBA 3LJ3A 3CF6E 3QJZA 3WAMA 3JW0X 1WGDA 2DAFA 1A5RA 2BPSA 1TZ1A 2BGFA 3VAWA 2JWZA 2K25A 3H7SA 3M62B 2C7HA 2K6QA 1WX7A 2L0TA 3KYCD 4E3CA 2LGXA 5AZFA 2HE7A 1P0RA 3H7PB 3PGEA 4MELA 2KFKA 1KLVA 2KDEB 1GNUA 3W1YA 2REXA 4WJPA 3ML9A 1WR1A 2ZJDA 3IFWB 2KWUB 2KHWB 4AUQC 2LVPA 3NY5A 3L0WB 4XX5A 3TIXA 1FXTB 2L7RA 3UINB 1V5OA 3KUCB 4FJZA 4XC2A 1XQQA 2NR2A 3X0WA 2XEWA 3U7DA 2B3AA 1IP9A 2EKEC 5CHWA 1WH3A 1H4RA 2KANA 4IM0A 5TR5A 4KZCA 4FJYA 3W1SC 4A3PA 2NPTA 2M1MA 5G2NA 4PS8A 3SHQA 4DK5A 1WFYA 2FNJB 2ZPYA 3VHTC 4FADA 2MBQA 4HWIB 1J0GA 1UZXB 3ZTDA 3VTUA 1OGWA 3A33B 1WE7A 1XD3B 1V80A 2FUHB 2Z0DB 1I35A 2RR9A 3DBHI 2GBRA 1V49A 2IO0B 3M95A 4G0NB 4MDKE 4ANWA 4WWNA 2KJRA 5DPRA 4PS7A 3DBRI 5CTRC 3ML8A 1WM3A 1NI2A 2DZIA 1WM2A 2KKCA 5IAAC 4BOZB 4ZDVA 5G55A 4FLHA 4FULA 1D3ZA 3LDZE 2DYMA 3MJWA 1GC7A 4TQ1A 3N3KB 3B1LX 4MGKE 2MX2A 2UYZB 2IY1B 2KMAA 3A4RA 1YX6B 1Q0WB 2CHZA 2O6VB 3W1SA 3O65B 4GDLA 5CX3A 3ZRFA 4BKGA 3BINA 2ZNVB 2FCSA 1K8RB 2KXJA 3QX1A 4FHJA 4RM9A 4IM3A 4EOYA 3KH0A 5JHAA 2WDTB 3PTFC 4RMAA 5E6PA 2EMTA 4AJWA 3HHMA 4W9FA 4BBNF 1WGYA 4EEWA 3B08A 2A5UA 3MHSD 2HTHA 4MEMA 1WI0A 2KNBA 2V4LA 3UQBA 4WAAA 3VTVA 3ZDTA 4DHZB 2V3SA 2AEHA 4W9LA 4GXBA 2KX0A 4LDTB 2HD5B 2O6VD 3AU4A 1JRUA 1WF9A 3OLMD 4HCPB 5D94A 2CHWA 1WJNA 2BYVE 2RD0A 1VD2A 3AU5A 2MRPA 3OAWA 5AEKB 3ONSA 4E74A 4W9CA 2LVOA 2KTRA 3A9JA 4II2B 5DPWA 1CMXB 1EF1A 3L13A 4TUUA 3T8MA 2MP2B 3HM3A 1UELA 2EMSA 3ZNID 1I42A 2JRIB 4KDIC 2K39A 2KC2A 2IO2B 3EC8A 3PPAA 1WRDB 4I6NB 4GSWA 4HXDA 3TJPA 3R3MA 3PS6A 4W9HA 3EHVA 5C23A 3NOBA 3L16A 4ZRIA 1V81A 4MH0E 1OEYJ 1WJUA 1UBIA 4I6PA 2NBVB 3APDA 2KWVB 4JIOU 2Z59B 4LCDE 4MSQB 4ASWC 1G6JA 3QC8B 2C7MB 1E8WA 2MW5A 2JT4B 3L08A 3R7QA 4ICUA 3DOWA 5JH5C 5JHBA 4HDOA 4MSMB 2MBBB 2ZCCA 3A9KB 4CO7A 5DPSA 4WJQA 2N9PC 1SIFA 1WMHA 1WXVA 4PS3A 3SU8X 5L83A 3IVFA 1J8CA 4URKA 2N7DA 4A3OA 2BF8B 1F9JA 2G45B 1E7VA 2GBKA 2KX3A 3QHTA 3RT3B 4KIKA 3IBEA 4ICVA 1GJZA 3PHXB 3ZNZB 1RLFA 2KLGA 2PJHA 3A1QB 3K9OB 2ZVOA 2D10A 4G11A 2PE6B 2G4DB 4ANUA 2O2VA 5DCNA 3QARA 2J0JA 3WIMA 3MTNB 4B6WA 2L76A 1S3SG 2BYFA 4WJOA 3PV1A 3PHWB 1KJTA 4GDKA 2DYOA 2BKFA 1OQYA 3RD2A 2ZEQA 5EDSA 4EKUA 2ZZPB 1Z2MA 4ANXA 4KZ0A 4HCNB 4NAWA 4IW0A 1UD7A 3SD5A 4ZRKA 1KOTA 3TMPB 2KN5A 2KMCA 3TBLD 3VXWA 2D3GA 3R66C 1S1QB 3L10B 3QAQA 4NPNA 3WAOA 4FN2A 4BBNC 2L0FA 1EO6A 5HKHA 3L17A 3V60A 3T9LA 4JL9A 1ZGUB 4M0WB 2IBIB 3WAPA 4DHZE 4G50A 3V6EB 4IM2A 4HK2A 2FIDA 1Y8RC 2BKRB 2WYQA 2MSED 3PSEB 3VDZA 3ZUNA 1H8CA 3PLVA 3UIOB 2FCMA 1WX8A 4HDQA 2VRRB 1V2YA 2MBEA 4F1SA 3UF8A 1P3QU 3EECA 2YLMA 1YIWA 3WALA 1AARA 3JSVB 2AL3A 5D7GA 4X57B 3Q3JA 2ASQA 1SGHA 1YX5B 4F8CB 2KOXA 4GOCA 1WJ6A 3PZDA 4WWOA 3H7PA 2PE9A 2J7QB 4CYEA 2LGDA 2RSUA 5J17A 3RCZA 4DDGD 1WGGA 1P1AA 2N4FA 4J6IA 2FAZA 4K7WA 2LI5A 2IY0B 4EZJA 2CHXA 2Z0EB 2NVUI 1WZ3A 2ZPNA 3AI5A 4WJNA 3RZFA 3X23A 1TGZB 4I6LB 4BOSC 1LQBA 2LVQA 3PT2B 4BFRA 2MBHA 4PYZA 5DPTA 1HE8A 1UGMA 3B0AA 1R4NI 2KJ6A 3H1UA 1WYWB 2N7EA 4FHKA 3PREA 5AZHA 3P2BA 4ZRJA 1L7YA 1P98A 3CSFA 4YL8A 1OEYA 4CHKA 2ZNVC 4B95A 1SE9A 2K1FA 2MWSB 3BY4B 5L95C 5CHFA 3KVFB 3ZTCA 3AULA 4MGZE 2DZMA 2K8CA 2LUEA 3H6NA 1C1YB 2ZVNA 5D2MB 1E5WA 1ZW7A 1E8YA 1TBEA 2GBNA 2RPQA 2NBWB 2CU1A 1WR6E 3KUDB 4W9DA 3ZNHB 3NZSA 2GBMA 2ZCBA 4TKNA 2KK8A 4GMVA 3PRMB 2DAJA 4HVBA 3I3TB 2DZJA 2LASA 1ZKHA 2KZRA 2N9XA 4MJSB 4DHJB 2IYDB 1LXDA 3ZNGC 3ALBA 2KO3A 1NBFC 2O6VA 4NJ6A 3M63B 1YQBA 2GOWA 2PEAA 1XT9B 4M8MA 4LDTD 4FBJB 3UQAA 3ZIMA 2XK5B 1E8ZA 3VVWB 5LXHA 3VUYA 2M17A 3QA8A 1ISNA 4A20A 2K8HA 5LLIA 4DXAB 2PPHA 2IZVB 1Q1OA 1WJ4A 3DCGA 2KLCA 2JY6A 2BWES 2KC1A 3QWZB 3GOEA 3VTWA 1IPGA 1UH6A 4RM8A 4W9EA 2LZ6A 1T0YA 4JLCA 3Q3FA 1RRBA 4BVUC 3K9PB 2JXXA 2KDFB 2R2OA 2FCQA 2IO3B 2GMIC 2LWPA 2KFKB 3IHPC 4BKSD 4WQOB 1V9JA 1V6EA 2I1JA 4GB9A 3VFKA 2HJ8A 3DVGY 2KFJA 4MGIE 1YD8U 1Q5WB 2I1KA 2JPHA 2V1YA 4FJVB 2WX1A 3KW5B 1MG8A 2L3ZA 2KVRA 2MP2A 2L00B 3QCAA 1QZEA 2XBBC 1E90A 1C3TA 3CMMB 2G4SA 3ENEA 3UGBB 3JVZX 4XZ4A 4W9IA 3ZVVA 2NPTB 1U4AA 4AP4C 3U30A 4AOFA 2C7NB 5KHOA 3DVNU 2JF5A 1GG3A 4IWQA 2J0KA 4ANVA 2C60A 4HLEA 2LXCA 4HJKA 1E8XA 2R2QA 3A9KA 1EF5A 3RULA 3V61A 3VQIA 1WXMA 2J0MA 2Y5BB 4EFOA 5C1ZA 1M94A 2N1WA 5E6OA 4AWJA 4DBGA 2AL6A 3JYUA 2LD9A 5IA7A 2WWZA 1R4MI 2LXAA 3C0RB 1IYFA 4E71A 1EUVB 1V5TA 2BYEA 3AXCA 2G3QB 3DBLI 3PLUA 3IG3A 2CS4A 4F7ZA 4K7SA 4HPMB 2W9NA 4GN1A 2CR5A 2LGYA 4GIVA 3VH3B 2C9WB 1WXAA 3A1QA 1BT0A 2K6DB 4IUMB 4NQLB 4GDLB 2KQSA 3S2AA 4W9JA 2KDBA 2LRUA 3KYDD 1J19A 4ZYNA 2FCNA 5FR6A 3HM6X 2IO1B 3L54A 5J18A 4GU2A 1V86A 4LJPB 5KHQA 2M4NA 1WY8A 2CKHB 3D32A 4N9F4 3OJ4B 1LFDA 4EUTA 4KSKC 5D6JB 1WZ0A 4IWOA 3RUIB 1RAXA 2N1VA 5CHVC 1WGRA 3V62A 2WX0A 3PRZA 3RZWC 4AJYB 3VH4B 4EZKA 4II3B 3QK0A 2C5LC 4NY0A 1LM8B 1L2NA 1WGHA 3DVNV 4BKTA 4KSLC 5E6NA 4FA6A 4P7IA 4IC7B 2MBOA 2OJRA
chains in the Genus database with same CATH superfamily
1AWDA 1V1PB 2KTRB 1JWUD 4NJ7A 3I63C 4KKJA 3N32A 5J2RA 1T5XD 4J3OD 1STEA 2KJHB 4KGRA 3AE4B 3MJ5A 4KGTA 2NMQA 3CSTA 2MCNB 1P9DU 3EA6A 4DWFA 3NZUA 4W9KA 2UWQA 1NDDA 1QOAA 2MQJA 4NQKE 2KDIA 2JX5A 3ZW3A 3PRPB 1WXSA 3GZNI 2LJ5A 2MA9B 3C19A 3DVGX 2JVCA 2IGHA 3KUZA 4KIKB 2DENB 3VR9B 1JWMD 3WA0A 5JZEB 3R7RA 1BUIC 2QHOA 1YN5A 4TV3A 4M8NA 2QCZA 2JSVX 2WDQB 3VUXA 3W5UB 1N62A 1DOIA 2MHJA 2OHFA 2KD0A 1FCCC 1CQVA 5HFYA 2WXLA 2DX5B 3MP9A 2AYOB 2D2QA 3ZLZA 5TSSA 2WXGA 2XK5A 1K52A 1NI3A 1TT5B 3BWUD 2JWUA 3CF6E 1JQ4A 2DAFA 4IOIE 1TZ1A 2K25A 2C7HA 2L0TA 1YJIA 1YQ3B 3H7PB 4MELA 3W1YA 2REXA 2PW9A 1FXTB 3KUCB 2INDC 2NR2A 3X0WA 1AN8A 5BYRA 2EKEC 5CHWA 1ET9A 2KANA 4KZCA 3W1SC 2N9KA 2M1MA 2WLBA 3SHQA 3VHTC 1T0RC 1OGWA 1WE7A 2YEPB 1I35A 3BK2A 3M95A 4WWNA 4JPSA 5DPRA 5GXGB 3ML8A 1WM3A 1NI2A 4C4VB 1WM2A 1D3ZA 1GC7A 4MGKE 4N59A 4AQ7A 4YTNB 1Q0WB 2CHZA 2O6VB 3FILA 3ZJTA 3O65B 1N5XA 2ZNVB 1PFDA 1TS2A 4RM9A 4EOYA 3KH0A 2WDTB 3GB1A 2EMTA 5E6PA 4AJWA 2CJOA 1N6ZA 3HHMA 4W9FA 4EEWA 3B9JA 1SEBD 1XXGA 4MEMA 2KNBA 2DNFA 2K0PA 1ROEA 1XF5L 2KX0A 4OHJA 2HD5B 2O6VD 2WU5B 4KGSA 2RD0A 1VD2A 3AU5A 2MRPA 2ONQA 5AEKB 1V1PA 2KDMA 2KTRA 1J7AA 4P16A 2MJ3A 3LYYA 3FKYA 1SE3A 2ACZB 3DBLB 3ZNID 1XLOA 2K39A 3BVMA 1WRDB 2DWQA 4NAMA 4W9HA 3EHVA 5C23A 3L16A 4ZRIA 4PK1A 1CZPA 4XDCA 4I6PA 4ASWC 2Z59B 4LCDE 1E8WA 3GS2A 1VRAB 5JH5C 3RNFC 2BQQA 2MBBB 4MSMB 2ZCCA 3A9KB 2N9PC 1WXVA 5L83A 2BF8B 1E7VA 4BZAA 3P4PB 4KIKA 2QDFA 1FCLA 1GJZA 1RM6C 3K9OB 2G4DB 3QARA 2J0JA 3MTNB 4B6WA 1S3SG 2BYFA 3RNEC 2BKFA 1OQYA 4EKUA 4RNAA 2ZZPB 1UWMA 1FNVA 4HCNB 4WH4A 2BBCA 4HJGE 5BMGA 5IOIA 3VXWA 4NPNA 2QSDA 2M19A 3Q14C 1SSNA 3WAPA 2QILA 2BKRB 2WYQA 3VDZA 4KX6B 1H8CA 5EE9A 4HDQA 4C7ZA 2VRRB 1C9FA 2K9XA 2MBEA 4F1SA 3CIRB 1AARA 2AL3A 5D7GA 1SGHA 1T6BX 4GOCA 2LMCA 2WHIA 3H7PA 2PE9A 5JXVA 2LGDA 2RSUA 2GLSA 3NZ3A 4L23A 2D3BA 3RCZA 2ZPNA 3AEFB 3SFEB 1DGJA 1N60A 1JWBD 1LQBA 2KT7A 3PT2B 4MM3B 2MBHA 5DPTA 3H1UA 1I4RA 3P2BA 4YL8A 4CHKA 1SE9A 3CWIA 1IGCA 4MGZE 3H6NA 2K8CA 2LUEA 2INNE 1KLGD 3U52E 3LB8C 1FFUA 3P4SB 2K5PA 4C4VA 3PRMB 4RF1A 2DZJA 2LASA 1ZKHA 2KZRA 4MT5A 4DHJB 3P4QB 2O6VA 3M63B 2GOWA 1XT9B 1TS4A 1YMHE 1I4HA 3VUYA 1L5PA 4LTUA 3VTWA 1T0YA 2JXXA 1V97A 2LWPA 3IHPC 1V6EA 2HJ8A 2V3PA 1YD8U 2CJNA 3DBRB 1FIQA 3KW5B 3QCAA 1L6UA 2WS3B 2G4SA 1F52A 3Q6BA 1U4AA 4AOFA 5KHOA 1R7SA 2JF5A 1GG3A 1MPEA 1VR9A 5G5GA 4HLEA 3DWMA 3WCQA 3A9KA 3V61A 1WXMA 1QF6A 3JYUA 2WWZA 1L0YB 1HZ5A 2BYEA 2SEBD 3DBLI 4K7SA 4HPMB 2W9NA 1VZ7A 5EE3A 2WU2B 1VJKA 4IUMB 1TS5A 4GDLB 3S2AA 4W9JA 4ZYNA 3P1MA 5FR6A 1JRPA 1D6EC 3L54A 4GU2A 1V86A 2I2YA 4LJPB 4LNOA 5KHQA 1LFDA 4DXFA 2GB1A 5D6JB 4IWOA 4AJYB 1IGDA 1T3QA 4BKTA 2MJEA 3P63A 2LGIA 4KV2A 2JZ3B 4EZLA 1NENB 3IT6B 1C4CA 4WAFA 1RFAA 3OJ3A 1ZDXA 5AZGA 4OZCA 4XWWA 3B2GA 2BB6A 3EUB2 3U2SC 1XLQA 4YT0B 4K81A 4K1RB 2W54A 4REZA 1MI0A 3APFA 1TTNA 4YTMB 1TJEA 4G3XB 3DHIC 2PIAA 3NUHB 1WIAA 4OVUA 3VR8B 1ZDVA 3ZO5B 3NVWA 2IGGA 4MM3A 1ZXIA 4XWTA 4PT5A 3BIID 3AE5B 2RGFA 4ARCA 1QILA 1QLBB 5GMVA 2RDHA 2DHZA 4GDKB 3V6CB 3R8BA 4K3BA 2M0XA 3TL5A 4JGHB 4NAWB 4CQNA 4XDDA 1K53A 5H8YE 3ZKJC 3ZQ4A 3ETRA 2DZKA 2K8BA 3DQVA 5BO4B 1C79A 2NCNA 1PGAA 1JW9D 1ZE3D 3VUWA 1D5ZC 2D11A 2KVZA 3DWGC 4NNJB 3U7ZA 1IUEA 2MLBA 1BMLC 4US8A 3LJ3A 3QJZA 2M0AA 2BPSA 2KAJA 3GE3C 3VAWA 2NTSA 3M62B 2WXJA 3NVYA 2LGSA 1P0RA 3PGEA 2DBYA 2QIEB 1F2RC 1KLVA 3ML9A 1Y56A 2OEDA 2KWUB 2Y5PA 4AUQC 3TEZA 3NY5A 3L0WB 2L7RA 4XC2A 4ZYSA 1VLBA 1XQQA 1P7FA 4QAYA 1T0SC 1TKYA 5HHDG 2B3AA 3I57A 1WH3A 1N5WA 4A3PA 1HTOA 1J7CA 4FADA 2MBQA 4WQMA 3ZXVA 4LNIA 5BYQA 2FUG1 1V80A 2FUHB 4YSYB 2WXKA 5E6JA 2IO0B 1T0QC 2R61A 3DBRI 3RNGC 4BOZB 5IAAC 5G55A 4FLHA 1GB1A 4YSZB 3TEYA 3MJWA 4TQ1A 3N3KB 3A4RA 1YX6B 3W1SA 4ZHPA 4GDLA 2MH7A 4BKGA 1FXIA 4OZBA 2KXJA 3QX1A 3IAM1 2ICIA 4RGOS 1JWAD 5JHAA 3FAHA 4BBNF 1WGYA 1I4GA 3MHSD 2HTHA 2V4LA 3VTVA 2WXQA 2V3SA 2AEHA 3AEGB 4W9LA 2D5GA 1UWXA 3AE3B 1WF9A 1TS3A 5D94A 2JU6X 3EGRA 2AX5A 3UI3A 4ARIA 4W9CA 2LVOA 4II2B 1CMXB 3L13A 4TUUA 3T8MA 2MP2B 3HM3A 2EMSA 3Q3NC 3PPAA 4HXDA 3AE2B 2N9LA 2KWVB 3N1YC 4MSQB 3Q3MC 4JWUC 2C7MB 1D5XC 2JT4B 3L08A 1FFVA 3R7QA 4CO7A 4WJQA 1SIFA 3SU8X 4A3OA 1F9JA 2KX3A 1MG4A 2WXIA 2PJHA 2KLGA 2L1AA 2D3AA 4G11A 4P1CC 2WDVB 1SJED 5DCNA 1K51A 4WJOA 4GDKA 2DYOA 1SE2A 4ANXA 4NAWA 3SFDB 2W3SA 1OQQA 1UD7A 4BBNC 1EO6A 3V60A 3T9LA 1ZGUB 5BMHA 2FIDA 2KACA 3PSEB 3PLVA 1XO3A 1P3QU 3EECA 2YLMA 2PVOD 1YIWA 3AE6B 3WALA 3JSVB 4X57B 3O13A 4F8CB 1I4QA 3PZDA 2J7QB 2W3RA 4K3CA 1OQRA 4J6IA 4K7WA 3U4EG 2CHXA 5FKAC 2Z0EB 4DXGA 3X23A 3HVZA 5D3DA 1EU3A 2LVQA 3T3NA 1NEKB 2BS4B 1UGMA 4LNKA 1WYWB 4FHKA 2HDEA 3N9YC 1OEYA 2K1FA 5L95C 3J9CA 2WNMA 1NYQA 2ZVNA 1E8YA 3H8HA 1TKEA 1HTQA 2RPQA 1WR6E 3KUDB 1ACCA 3ZNHB 2JYEA 3HRDD 2KK8A 3RN9C 2DAJA 1JALA 1SIJA 4MJSB 1LXDA 3ALBA 4HROA 2KO3A 1YQBA 3ZIMA 1I7HA 2M17A 1ISNA 4A20A 5LLIA 4DXAB 5IKCM 2IZVB 3AH7A 1Q1OA 3Q69A 3ZGZA 3DCGA 2BT6A 1WWTA 2KC1A 3GOEA 1TYGB 1IPGA 3AE7B 1WYGA 2XNAC 4JLCA 3Q3FA 4BVUC 3K9PB 3NVVA 4JX1C 3ABVB 2FCQA 3SR6A 1ZUD2 2KFKB 4BKSD 2D3CA 1C4AA 1V9JA 2G1EA 3T3OA 4UDUC 2QEJC 1A70A 2I1KA 2V1YA 3PZ8A 2L3ZA 2KVRA 2MP2A 2L00B 4NZLB 1L0VB 1C3TA 2BW2A 3CMMB 3JVZX 4XZ4A 3U30A 2C7NB 5HG2A 3TEWA 3Q8FA 2J0KA 4ANVA 3AM9A 2LXCA 2V9HA 2R2QA 2GRIA 4EFOA 5C1ZA 2LHEA 2NTTA 1DYQA 3RNBC 2V0GA 2AL6A 2LD9A 5IA7A 1IYFA 2LXAA 4E71A 1FD6A 2G3QB 4TSSA 1L4DB 4GN1A 3VH3B 1JCKB 4A6QA 2K6DB 4NQLB 2KQSA 1D5MC 1J19A 2FCNA 1WXQA 3KWVA 3PO0A 1E6EB 2CKHB 1P7EA 3BVZA 1WZ0A 3RUIB 5FK9C 2N1VA 5CHVC 2MJDA 1WGKA 3PRZA 2EELA 4EZKA 2ZW1A 4II3B 3QK0A 2C5LC 4N6EB 4NY0A 4ACFA 3DVNV 1MHHE 1HA5A 4P7IA 3EFCA 2MBOA 4KDIC 2OJRA 4H2AA 5FR3A 3MC9A 2N9EB 3N30A 3U8ZA 4WWPA 1X1MA 2DYBA 3AV8A 1QOGA 3NS8A 2YVCA 2KQ7A 2PMVA 3JSVA 3WANA 2A4ZA 3APCA 1WRIA 3Q8BA 3QQ8B 1WE6A 4KKIA 4WURA 4B9KA 4IWPA 1GPXA 3M3JA 5IP4D 3H9DA 4NJCA 3VRAB 1WMHB 3A4SC 3BZDB 2K3UA 2IPKD 3ECIA 1PQSA 2HJ1A 3HIZA 4C56C 4L1BA 3AE8B 3QIJA 1FRRA 2LJIA 3ZRCA 4DHJD 3EFUA 3B2FA 1B9RA 1OTRB 3ZDMC 2KTFA 2BWFA 2LRWA 1KRHA 2NS5A 1E7UA 4MJSA 2NBUA 4HEA1 2L32A 2QJLA 1GC6A 4K7UA 3UIPB 4BKSA 2Y5CA 2JUOA 1CK1A 4EE2A 4LJOB 2L8JA 3IT4B 3WAMA 2WP9B 1WGDA 1A5RA 2JWZA 1FNUA 3H7SA 1WX7A 2LGXA 5AZFA 2HE7A 3BVGA 1I4XA 2KFKA 1GNUA 4WJPA 1EU4A 3IFWB 2LVPA 2KN4A 3AEEB 1TKGA 3UINB 5T8IA 3OG5A 4YSXB 3I5JC 3IAS1 1IP9A 1RYJA 1H4RA 4AS1A 4IM0A 4GLSC 2XN9C 4FJYA 4HKZE 4DK5A 4PS8A 2FNJB 1FEHA 3BYTB 4HWIB 1UZXB 3ZTDA 2VH2A 2BVCA 1B1ZA 2RR9A 1RFKA 2GBRA 1V49A 4MDKE 4ANWA 1FO4A 3I9V1 3IXSA 1C4PA 1DOXA 4FULA 2X8XX 3Q8EA 3B1LX 2MX2A 5CX3A 3ZRFA 1SJHD 1LO5D 3ZJUA 2VZKB 4IM3A 3ZJVA 1F2RI 3PTFC 2BYTA 2L83A 1WI0A 1YQ4B 3W5VB 3UQBA 3TSSA 4DHZB 4LDTB 4YWGG 3AU4A 1EM7A 3OLMD 2BYVE 2Y3AA 3SEBA 3P42A 2BS3B 3OAWA 4E74A 2H89B 4HRSA 1UELA 1I42A 2JRIB 2X38A 2IO2B 1ZP0B 3EC8A 4GSWA 3R3MA 4MH0E 1OEYJ 1YN3A 3Q8AA 1UBIA 4JIOU 2PVGC 1G6JA 4RGTA 3QC8B 2MW5A 3E9SA 4ICUA 3DOWA 5JHBA 3N20C 4HDOA 1L6VA 3RI7C 1WMHA 4PS3A 3IVFA 2INCC 1J8CA 4URKA 3AECB 1JWSD 2G45B 2GBKA 3NVZA 3L4PA 3RT3B 5BYSA 4ICVA 3PHXB 1MHXA 2ZVOA 4OW0A 4B0EA 2L76A 3PHWB 5EDSA 3RD2A 1KLUD 1ZOYB 1Z2MA 4KZ0A 1AYFA 4P6VF 1KOTA 2BB5A 1WSPA 1NVID 2D3GA 3R66C 1S1QB 3L10B 2W82A 1IBXB 4USAA 3WAOA 2L0FA 5HKHA 3L17A 2DLBA 4M0WB 2IBIB 3AMZA 2ON8A 2J52A 4DHZE 1SB3C 3ZUNA 1GOZA 4BAXA 2FCMA 4LNNA 1V2YA 3UF8A 3MFGA 1ET6A 3AEAB 2L52A 2J4XA 1N63A 1YX5B 2KOXA 3RMKC 2INPE 4WWOA 2KWDA 1XLPA 1YNTE 4HKQA 2FE8A 1P1AA 2N4FA 2KMMA 2LI5A 2IY0B 1N61A 2NVUI 3AI5A 1FXAA 4WJNA 1TGZB 1UNSA 4BOSC 2JXTA 2WXRA 4PYZA 3B0AA 2KJ6A 2N7EA 1I4PA 2AQ3B 3PREA 5AZHA 1PYWD 1QT9A 3BY4B 4IKGA 3ZTCA 1TY2A 1E5WA 1ZW7A 1EWCA 1TBEA 2GBNA 4O1NA 1VZ6A 2CU1A 1GAQB 1QOFA 4W9DA 3NZSA 2GBMA 4TKNA 1MFWA 5LNK1 2E6XA 1ENFA 1TIFA 2IYDB 1XCTL 1NBFC 4M8MA 4FBJB 1E8ZA 2WXOA 5LXHA 4TMAB 1PDXA 1M4VA 1F0ZA 1MVKA 3AE1B 4JWSC 2KLCA 3QWZB 2BWES 1FNWA 4W9EA 4ZRQA 2LZ6A 2ZW0A 1E10A 3BYYB 1RRBA 3MC8A 2KDFB 2GMIC 1PUTA 1XEEA 3DBHB 4GB9A 4MH8A 2KFJA 1Q5WB 2JPHA 4FJVB 2WX1A 1FM0D 1MG8A 1QZEA 2XBBC 3UGBB 1KTKA 4W9IA 3ZVVA 3RPFC 2IDYA 2NPTB 4AP4C 1YN4A 2C60A 1E8XA 1F1HA 1EF5A 2Y5BB 2J0MA 2EKIA 2JYTA 1M94A 2N1WA 5E6OA 4DBGA 1R4MI 3PZ7A 3PLUA 4F7ZA 2CR5A 4GIVA 2C9WB 4XGAB 2UU7A 3URYA 3KYDD 3NS1A 2KQ4X 1FRDA 1LGRA 5I4DA 2PLPA 1J7BA 4P1BC 4KSKC 1FMAD 2FBWB 2B76B 1IBXA 1L2NA 1WGHA 4KSLC 2E3TA 4Q2JA 1E9MA 4N58A 4M0WA 1KH0A 3SDLC 3DPDA 2Q5WD 3A9JB 2OOBB 1AW7A 1Z5SB 4A90A 4TQ0A 3R2IA 1YJ1A 1GUAB 2L05A 3DDCB 4IG7B 3NHEB 3PVLA 2W55A 2WXMA 4JQWC 4RFBA 2PTLA 4C00A 4GGQA 2WXNA 5AUIA 3NG0A 4XYCA 1UBQA 2IGDA 4W9GA 3MHZA 4WWMA 2H88B 2AQ2B 4HPLB 4ZRPA 3KWLA 5LXIB 1VCBA 2V4IB 2JRHA 4DDID 3FC4A 4OVVA 3Q2AC 1PGXA 3TCAA 4KVGB 1OFFA 1WX9A 3RYTA 2O2VB 2KWCA 1ESFA 3TUOA 1JROA 5D3IB 1VZ8A 4PYUA 2M8SA 4KDLB 1D4BA 3GE8C 2FIFA 1NYRA 2AWTA 3DBSA 4M01A 4M00A 4OZAA 2OJWA 5AUKA 4RGNA 1Q10A 1PGBA 1V8CA 4R3DA 1TY0A 2GBJA 4MGYE 3AEDB 3HK0A 3NJTA 2D07B 2JZZA 4C80A 3AN1A 2PKOA 1KM7A 3JW0X 2RPVA 1R4NB 3KQ4A 4JE3B 4YXDB 2BGFA 4US9A 2K6QA 3KYCD 4E3CA 2TSSA 2BTEA 2KDEB 4M02A 4WIPA 1WR1A 2ZJDA 2MEKA 2KHWB 2N7JA 4XX5A 3TIXA 1V5OA 4FJZA 1QKZA 1QOBA 2XEWA 3U7DA 1TZOA 3GP7A 5TR5A 2NPTA 5G2NA 1WFYA 2ZPYA 4LLGM 1J0GA 3VTUA 3A33B 1XD3B 2Z0DB 2G9HD 3DBHI 4G0NB 2KJRA 1CJEA 4PS7A 3R2TA 5CTRC 4OVZA 2DZIA 2KKCA 4ZDVA 3LDZE 2DYMA 2UYZB 2WQYB 2IY1B 2KMAA 3BINA 2FCSA 1K8RB 4FHJA 4ZHOA 3KLSX 4RMAA 4A9AA 3B08A 2A5UA 3W2DA 3N1XC 4IDIA 5EE1A 1E7PB 2WXPA 4WAAA 3ZDTA 4GXBA 3ZYYX 3N1ZC 3HVDA 1JRUA 4HCPB 2CHWA 1WJNA 3ONSA 3A9JA 4C7YA 5DPWA 3Q8CA 1EF1A 2N0SB 5G5HA 2KC2A 1KF6B 4LK0M 2YEPF 4I6NB 3TJPA 1ZPSA 3PS6A 3NOBA 2GI9A 1V81A 1WJUA 2VH1A 3RFZB 2NBVB 1SE4A 3APDA 4B0MA 1RWSA 1YOVB 2K22A 5DPSA 1DOYA 4RGMA 2N7DA 3QHTA 2M56B 1L4ZB 3IBEA 2CU3A 3ZNZB 1RLFA 3A1QB 5IO9A 3RNCC 2D10A 2PE6B 4MACA 4ANUA 1C76A 2O2VA 3MC0B 3WIMA 3NRZA 3PV1A 1KJTA 2JZPA 5MPOA 1BXTA 2ZEQA 3VRBB 2J42A 1VDVA 1UGJA 4DQOC 4IW0A 3SD5A 4ZRKA 3TMPB 2KN5A 2KMCA 2WGSA 3TBLD 1F77A 3QAQA 4FN2A 4JL9A 1SF0A 2QMTA 4G50A 3V6EB 4IM2A 4HK2A 5IN7A 3GZNB 1Y8RC 2MSED 4ITKA 3UIOB 3ZXRA 1WX8A 2LEKA 2LHDA 2WXHA 1UUPA 3Q3JA 2ASQA 1E0ZA 5BMIA 2J53A 1WJ6A 4CYEA 3AB5A 1ZXHA 5J17A 1SXTA 4DDGD 1WGGA 4HPPA 2FAZA 3OWEB 4EZJA 5C2TB 3BK1A 1WZ3A 3Q3OC 1HQRD 2WDRB 2RDGA 3RZFA 4I6LB 1K50A 4BFRA 2SAKA 2RDBC 1HE8A 1R4NI 4S17A 4ZRJA 1L7YA 1P98A 3CSFA 2ZNVC 1KFYB 4B95A 2MWSB 2JQRB 5CHFA 3KVFB 3AULA 2DZMA 1C1YB 1HZ6A 2QC8A 1SBBB 2Z8LA 5D2MB 4XE0A 1V1OA 2VZKD 2NBWB 2LUMA 4FXCA 2ZCBA 1JMLA 4GMVA 4HVBA 2KYWA 3I3TB 1R4MB 2N9XA 5HI1A 3ZNGC 4NJ6A 2PEAA 4RF0A 4LDTD 3UQAA 2XK5B 3VVWB 2V3NA 3QA8A 2K8HA 2WXFA 2PPHA 1HEZE 1GB4A 1WJ4A 2JY6A 1YJJA 4RM8A 1UH6A 3AE9B 3E56A 2AQ1B 1MJDA 2R2OA 3LXFA 2IO3B 2LFIA 2RMMA 1QQRA 4WQOB 2I1JA 3VFKA 1C77A 3DVGY 3C8YA 1XLNA 4MGIE 3RNAC 1L0XB 3AEBB 1E90A 1XCQL 3ENEA 5EE0A 4A55A 3W9CB 3DVNU 5C3JB 4IWQA 2BS2B 1HXYD 4HJKA 2IJ0A 3RULA 3VQIA 4S0RA 3DHGC 4A8XC 4AWJA 3TEXA 3C0RB 1EUVB 1V5TA 3AXCA 5H92C 4YTPB 3IG3A 2CS4A 2LGYA 1WXAA 3A1QA 1BT0A 3FILB 1C78A 3DHHC 4RCOA 2KDBA 2LRUA 2HTME 4RH6A 1UF0A 3V05A 1FPYA 3HM6X 4LNFA 2IO1B 5J18A 3V3XA 2M4NA 1WY8A 3D32A 4N9F4 3OJ4B 1EWYC 2I38A 3P4RB 4EUTA 4L2YA 1RAXA 1WGRA 3V62A 2WX0A 3RZWC 3VH4B 4D2KA 3HUIA 1LM8B 5E6NA 4FA6A 4IC7B 4ZOHC
chains in the Genus database with same CATH topology
3SDLC 4KV2A 3DPDA 2KTRB 3A9JB 4NJ7A 2JZ3B 4EZLA 2N9EB 1RFAA 2OOBB 3N32A 1Z5SB 3N30A 3OJ3A 4TQ0A 5J2RA 3U8ZA 4WWPA 1X1MA 2DYBA 3NS8A 1YJ1A 2YVCA 1GUAB 2L05A 2KQ7A 3DDCB 5AZGA 3JSVA 2KJHB 3WANA 4IG7B 2A4ZA 3NHEB 3PVLA 3CSTA 3APCA 4K81A 3QQ8B 4JQWC 1WE6A 4K1RB 2MCNB 1P9DU 4GGQA 4DWFA 3NZUA 4W9KA 3APFA 2UWQA 1UBQA 1NDDA 4IWPA 2MQJA 1TTNA 4B9KA 4NQKE 4W9GA 3M3JA 2KDIA 4G3XB 3H9DA 3ZW3A 4HPLB 5LXIB 3PRPB 1WMHB 3A4SC 1VCBA 2JRHA 1WXSA 1WIAA 3GZNI 4OVUA 4DDID 2LJ5A 4OVVA 2MA9B 3ECIA 1PQSA 3ZO5B 3DVGX 2JVCA 4MM3A 3TCAA 3KUZA 4KIKB 3HIZA 4KVGB 2RGFA 1WX9A 2DENB 3RYTA 2O2VB 2KWCA 3QIJA 5GMVA 3WA0A 5JZEB 3ZRCA 4DHJD 3R7RA 3EFUA 2DHZA 2QHOA 4GDKB 4PYUA 3V6CB 4TV3A 2M8SA 2M0XA 4KDLB 3TL5A 1OTRB 3ZDMC 2KTFA 2FIFA 4JGHB 2BWFA 2AWTA 3DBSA 4M8NA 4NAWB 2LRWA 3ZKJC 3VUXA 2NS5A 1E7UA 2DZKA 2K8BA 3DQVA 5BO4B 2KD0A 2NCNA 4MJSA 2NBUA 2GBJA 2DX5B 1GC6A 4MGYE 3VUWA 4K7UA 2AYOB 3HK0A 2D2QA 2D07B 2D11A 3UIPB 3ZLZA 4BKSA 2JZZA 2XK5A 4NNJB 2JUOA 1KM7A 4LJOB 2L8JA 2MLBA 3LJ3A 3CF6E 3QJZA 3WAMA 3JW0X 1WGDA 2DAFA 1A5RA 2BPSA 1TZ1A 2BGFA 3VAWA 2JWZA 2K25A 3H7SA 3M62B 2C7HA 2K6QA 1WX7A 2L0TA 3KYCD 4E3CA 2LGXA 5AZFA 2HE7A 1P0RA 3H7PB 3PGEA 4MELA 2KFKA 1KLVA 2KDEB 1GNUA 3W1YA 2REXA 4WJPA 3ML9A 1WR1A 2ZJDA 3IFWB 2KWUB 2KHWB 4AUQC 2LVPA 3NY5A 3L0WB 4XX5A 3TIXA 1FXTB 2L7RA 3UINB 1V5OA 3KUCB 4FJZA 4XC2A 1XQQA 2NR2A 3X0WA 2XEWA 3U7DA 2B3AA 1IP9A 2EKEC 5CHWA 1WH3A 1H4RA 2KANA 4IM0A 5TR5A 4KZCA 4FJYA 3W1SC 4A3PA 2NPTA 2M1MA 5G2NA 4PS8A 3SHQA 4DK5A 1WFYA 2FNJB 2ZPYA 3VHTC 4FADA 2MBQA 4HWIB 1J0GA 1UZXB 3ZTDA 3VTUA 1OGWA 3A33B 1WE7A 1XD3B 1V80A 2FUHB 2Z0DB 1I35A 2RR9A 3DBHI 2GBRA 1V49A 2IO0B 3M95A 4G0NB 4MDKE 4ANWA 4WWNA 2KJRA 5DPRA 4PS7A 3DBRI 5CTRC 3ML8A 1WM3A 1NI2A 2DZIA 1WM2A 2KKCA 5IAAC 4BOZB 4ZDVA 5G55A 4FLHA 4FULA 1D3ZA 3LDZE 2DYMA 3MJWA 1GC7A 4TQ1A 3N3KB 3B1LX 4MGKE 2MX2A 2UYZB 2IY1B 2KMAA 3A4RA 1YX6B 1Q0WB 2CHZA 2O6VB 3W1SA 3O65B 4GDLA 5CX3A 3ZRFA 4BKGA 3BINA 2ZNVB 2FCSA 1K8RB 2KXJA 3QX1A 4FHJA 4RM9A 4IM3A 4EOYA 3KH0A 5JHAA 2WDTB 3PTFC 4RMAA 5E6PA 2EMTA 4AJWA 3HHMA 4W9FA 4BBNF 1WGYA 4EEWA 3B08A 2A5UA 3MHSD 2HTHA 4MEMA 1WI0A 2KNBA 2V4LA 3UQBA 4WAAA 3VTVA 3ZDTA 4DHZB 2V3SA 2AEHA 4W9LA 4GXBA 2KX0A 4LDTB 2HD5B 2O6VD 3AU4A 1JRUA 1WF9A 3OLMD 4HCPB 5D94A 2CHWA 1WJNA 2BYVE 2RD0A 1VD2A 3AU5A 2MRPA 3OAWA 5AEKB 3ONSA 4E74A 4W9CA 2LVOA 2KTRA 3A9JA 4II2B 5DPWA 1CMXB 1EF1A 3L13A 4TUUA 3T8MA 2MP2B 3HM3A 1UELA 2EMSA 3ZNID 1I42A 2JRIB 4KDIC 2K39A 2KC2A 2IO2B 3EC8A 3PPAA 1WRDB 4I6NB 4GSWA 4HXDA 3TJPA 3R3MA 3PS6A 4W9HA 3EHVA 5C23A 3NOBA 3L16A 4ZRIA 1V81A 4MH0E 1OEYJ 1WJUA 1UBIA 4I6PA 2NBVB 3APDA 2KWVB 4JIOU 2Z59B 4LCDE 4MSQB 4ASWC 1G6JA 3QC8B 2C7MB 1E8WA 2MW5A 2JT4B 3L08A 3R7QA 4ICUA 3DOWA 5JH5C 5JHBA 4HDOA 4MSMB 2MBBB 2ZCCA 3A9KB 4CO7A 5DPSA 4WJQA 2N9PC 1SIFA 1WMHA 1WXVA 4PS3A 3SU8X 5L83A 3IVFA 1J8CA 4URKA 2N7DA 4A3OA 2BF8B 1F9JA 2G45B 1E7VA 2GBKA 2KX3A 3QHTA 3RT3B 4KIKA 3IBEA 4ICVA 1GJZA 3PHXB 3ZNZB 1RLFA 2KLGA 2PJHA 3A1QB 3K9OB 2ZVOA 2D10A 4G11A 2PE6B 2G4DB 4ANUA 2O2VA 5DCNA 3QARA 2J0JA 3WIMA 3MTNB 4B6WA 2L76A 1S3SG 2BYFA 4WJOA 3PV1A 3PHWB 1KJTA 4GDKA 2DYOA 2BKFA 1OQYA 3RD2A 2ZEQA 5EDSA 4EKUA 2ZZPB 1Z2MA 4ANXA 4KZ0A 4HCNB 4NAWA 4IW0A 1UD7A 3SD5A 4ZRKA 1KOTA 3TMPB 2KN5A 2KMCA 3TBLD 3VXWA 2D3GA 3R66C 1S1QB 3L10B 3QAQA 4NPNA 3WAOA 4FN2A 4BBNC 2L0FA 1EO6A 5HKHA 3L17A 3V60A 3T9LA 4JL9A 1ZGUB 4M0WB 2IBIB 3WAPA 4DHZE 4G50A 3V6EB 4IM2A 4HK2A 2FIDA 1Y8RC 2BKRB 2WYQA 2MSED 3PSEB 3VDZA 3ZUNA 1H8CA 3PLVA 3UIOB 2FCMA 1WX8A 4HDQA 2VRRB 1V2YA 2MBEA 4F1SA 3UF8A 1P3QU 3EECA 2YLMA 1YIWA 3WALA 1AARA 3JSVB 2AL3A 5D7GA 4X57B 3Q3JA 2ASQA 1SGHA 1YX5B 4F8CB 2KOXA 4GOCA 1WJ6A 3PZDA 4WWOA 3H7PA 2PE9A 2J7QB 4CYEA 2LGDA 2RSUA 5J17A 3RCZA 4DDGD 1WGGA 1P1AA 2N4FA 4J6IA 2FAZA 4K7WA 2LI5A 2IY0B 4EZJA 2CHXA 2Z0EB 2NVUI 1WZ3A 2ZPNA 3AI5A 4WJNA 3RZFA 3X23A 1TGZB 4I6LB 4BOSC 1LQBA 2LVQA 3PT2B 4BFRA 2MBHA 4PYZA 5DPTA 1HE8A 1UGMA 3B0AA 1R4NI 2KJ6A 3H1UA 1WYWB 2N7EA 4FHKA 3PREA 5AZHA 3P2BA 4ZRJA 1L7YA 1P98A 3CSFA 4YL8A 1OEYA 4CHKA 2ZNVC 4B95A 1SE9A 2K1FA 2MWSB 3BY4B 5L95C 5CHFA 3KVFB 3ZTCA 3AULA 4MGZE 2DZMA 2K8CA 2LUEA 3H6NA 1C1YB 2ZVNA 5D2MB 1E5WA 1ZW7A 1E8YA 1TBEA 2GBNA 2RPQA 2NBWB 2CU1A 1WR6E 3KUDB 4W9DA 3ZNHB 3NZSA 2GBMA 2ZCBA 4TKNA 2KK8A 4GMVA 3PRMB 2DAJA 4HVBA 3I3TB 2DZJA 2LASA 1ZKHA 2KZRA 2N9XA 4MJSB 4DHJB 2IYDB 1LXDA 3ZNGC 3ALBA 2KO3A 1NBFC 2O6VA 4NJ6A 3M63B 1YQBA 2GOWA 2PEAA 1XT9B 4M8MA 4LDTD 4FBJB 3UQAA 3ZIMA 2XK5B 1E8ZA 3VVWB 5LXHA 3VUYA 2M17A 3QA8A 1ISNA 4A20A 2K8HA 5LLIA 4DXAB 2PPHA 2IZVB 1Q1OA 1WJ4A 3DCGA 2KLCA 2JY6A 2BWES 2KC1A 3QWZB 3GOEA 3VTWA 1IPGA 1UH6A 4RM8A 4W9EA 2LZ6A 1T0YA 4JLCA 3Q3FA 1RRBA 4BVUC 3K9PB 2JXXA 2KDFB 2R2OA 2FCQA 2IO3B 2GMIC 2LWPA 2KFKB 3IHPC 4BKSD 4WQOB 1V9JA 1V6EA 2I1JA 4GB9A 3VFKA 2HJ8A 3DVGY 2KFJA 4MGIE 1YD8U 1Q5WB 2I1KA 2JPHA 2V1YA 4FJVB 2WX1A 3KW5B 1MG8A 2L3ZA 2KVRA 2MP2A 2L00B 3QCAA 1QZEA 2XBBC 1E90A 1C3TA 3CMMB 2G4SA 3ENEA 3UGBB 3JVZX 4XZ4A 4W9IA 3ZVVA 2NPTB 1U4AA 4AP4C 3U30A 4AOFA 2C7NB 5KHOA 3DVNU 2JF5A 1GG3A 4IWQA 2J0KA 4ANVA 2C60A 4HLEA 2LXCA 4HJKA 1E8XA 2R2QA 3A9KA 1EF5A 3RULA 3V61A 3VQIA 1WXMA 2J0MA 2Y5BB 4EFOA 5C1ZA 1M94A 2N1WA 5E6OA 4AWJA 4DBGA 2AL6A 3JYUA 2LD9A 5IA7A 2WWZA 1R4MI 2LXAA 3C0RB 1IYFA 4E71A 1EUVB 1V5TA 2BYEA 3AXCA 2G3QB 3DBLI 3PLUA 3IG3A 2CS4A 4F7ZA 4K7SA 4HPMB 2W9NA 4GN1A 2CR5A 2LGYA 4GIVA 3VH3B 2C9WB 1WXAA 3A1QA 1BT0A 2K6DB 4IUMB 4NQLB 4GDLB 2KQSA 3S2AA 4W9JA 2KDBA 2LRUA 3KYDD 1J19A 4ZYNA 2FCNA 5FR6A 3HM6X 2IO1B 3L54A 5J18A 4GU2A 1V86A 4LJPB 5KHQA 2M4NA 1WY8A 2CKHB 3D32A 4N9F4 3OJ4B 1LFDA 4EUTA 4KSKC 5D6JB 1WZ0A 4IWOA 3RUIB 1RAXA 2N1VA 5CHVC 1WGRA 3V62A 2WX0A 3PRZA 3RZWC 4AJYB 3VH4B 4EZKA 4II3B 3QK0A 2C5LC 4NY0A 1LM8B 1L2NA 1WGHA 3DVNV 4BKTA 4KSLC 5E6NA 4FA6A 4P7IA 4IC7B 2MBOA 2OJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDL C;  4KV2 A;  3DPD A;  2KTR B;  3A9J B;  4NJ7 A;  2JZ3 B;  4EZL A;  2N9E B;  1RFA A;  2OOB B;  3N32 A;  1Z5S B;  3N30 A;  3OJ3 A;  4TQ0 A;  5J2R A;  3U8Z A;  4WWP A;  1X1M A;  2DYB A;  3NS8 A;  1YJ1 A;  2YVC A;  1GUA B;  2L05 A;  2KQ7 A;  3DDC B;  5AZG A;  3JSV A;  2KJH B;  3WAN A;  4IG7 B;  2A4Z A;  3NHE B;  3PVL A;  3CST A;  3APC A;  4K81 A;  3QQ8 B;  4JQW C;  1WE6 A;  4K1R B;  2MCN B;  1P9D U;  4GGQ A;  4DWF A;  3NZU A;  4W9K A;  3APF A;  2UWQ A;  1UBQ A;  1NDD A;  4IWP A;  2MQJ A;  1TTN A;  4B9K A;  4NQK E;  4W9G A;  3M3J A;  2KDI A;  4G3X B;  3H9D A;  3ZW3 A;  4HPL B;  5LXI B;  3PRP B;  1WMH B;  3A4S C;  1VCB A;  2JRH A;  1WXS A;  1WIA A;  3GZN I;  4OVU A;  4DDI D;  2LJ5 A;  4OVV A;  2MA9 B;  3ECI A;  1PQS A;  3ZO5 B;  3DVG X;  2JVC A;  4MM3 A;  3TCA A;  3KUZ A;  4KIK B;  3HIZ A;  4KVG B;  2RGF A;  1WX9 A;  2DEN B;  3RYT A;  2O2V B;  2KWC A;  3QIJ A;  5GMV A;  3WA0 A;  5JZE B;  3ZRC A;  4DHJ D;  3R7R A;  3EFU A;  2DHZ A;  2QHO A;  4GDK B;  4PYU A;  3V6C B;  4TV3 A;  2M8S A;  2M0X A;  4KDL B;  3TL5 A;  1OTR B;  3ZDM C;  2KTF A;  2FIF A;  4JGH B;  2BWF A;  2AWT A;  3DBS A;  4M8N A;  4NAW B;  2LRW A;  3ZKJ C;  3VUX A;  2NS5 A;  1E7U A;  2DZK A;  2K8B A;  3DQV A;  5BO4 B;  2KD0 A;  2NCN A;  4MJS A;  2NBU A;  2GBJ A;  2DX5 B;  1GC6 A;  4MGY E;  3VUW A;  4K7U A;  2AYO B;  3HK0 A;  2D2Q A;  2D07 B;  2D11 A;  3UIP B;  3ZLZ A;  4BKS A;  2JZZ A;  2XK5 A;  4NNJ B;  2JUO A;  1KM7 A;  4LJO B;  2L8J A;  2MLB A;  3LJ3 A;  3CF6 E;  3QJZ A;  3WAM A;  3JW0 X;  1WGD A;  2DAF A;  1A5R A;  2BPS A;  1TZ1 A;  2BGF A;  3VAW A;  2JWZ A;  2K25 A;  3H7S A;  3M62 B;  2C7H A;  2K6Q A;  1WX7 A;  2L0T A;  3KYC D;  4E3C A;  2LGX A;  5AZF A;  2HE7 A;  1P0R A;  3H7P B;  3PGE A;  4MEL A;  2KFK A;  1KLV A;  2KDE B;  1GNU A;  3W1Y A;  2REX A;  4WJP A;  3ML9 A;  1WR1 A;  2ZJD A;  3IFW B;  2KWU B;  2KHW B;  4AUQ C;  2LVP A;  3NY5 A;  3L0W B;  4XX5 A;  3TIX A;  1FXT B;  2L7R A;  3UIN B;  1V5O A;  3KUC B;  4FJZ A;  4XC2 A;  1XQQ A;  2NR2 A;  3X0W A;  2XEW A;  3U7D A;  2B3A A;  1IP9 A;  2EKE C;  5CHW A;  1WH3 A;  1H4R A;  2KAN A;  4IM0 A;  5TR5 A;  4KZC A;  4FJY A;  3W1S C;  4A3P A;  2NPT A;  2M1M A;  5G2N A;  4PS8 A;  3SHQ A;  4DK5 A;  1WFY A;  2FNJ B;  2ZPY A;  3VHT C;  4FAD A;  2MBQ A;  4HWI B;  1J0G A;  1UZX B;  3ZTD A;  3VTU A;  1OGW A;  3A33 B;  1WE7 A;  1XD3 B;  1V80 A;  2FUH B;  2Z0D B;  1I35 A;  2RR9 A;  3DBH I;  2GBR A;  1V49 A;  2IO0 B;  3M95 A;  4G0N B;  4MDK E;  4ANW A;  4WWN A;  2KJR A;  5DPR A;  4PS7 A;  3DBR I;  5CTR C;  3ML8 A;  1WM3 A;  1NI2 A;  2DZI A;  1WM2 A;  2KKC A;  5IAA C;  4BOZ B;  4ZDV A;  5G55 A;  4FLH A;  4FUL A;  1D3Z A;  3LDZ E;  2DYM A;  3MJW A;  1GC7 A;  4TQ1 A;  3N3K B;  3B1L X;  4MGK E;  2MX2 A;  2UYZ B;  2IY1 B;  2KMA A;  3A4R A;  1YX6 B;  1Q0W B;  2CHZ A;  2O6V B;  3W1S A;  3O65 B;  4GDL A;  5CX3 A;  3ZRF A;  4BKG A;  3BIN A;  2ZNV B;  2FCS A;  1K8R B;  2KXJ A;  3QX1 A;  4FHJ A;  4RM9 A;  4IM3 A;  4EOY A;  3KH0 A;  5JHA A;  2WDT B;  3PTF C;  4RMA A;  5E6P A;  2EMT A;  4AJW A;  3HHM A;  4W9F A;  4BBN F;  1WGY A;  4EEW A;  3B08 A;  2A5U A;  3MHS D;  2HTH A;  4MEM A;  1WI0 A;  2KNB A;  2V4L A;  3UQB A;  4WAA A;  3VTV A;  3ZDT A;  4DHZ B;  2V3S A;  2AEH A;  4W9L A;  4GXB A;  2KX0 A;  4LDT B;  2HD5 B;  2O6V D;  3AU4 A;  1JRU A;  1WF9 A;  3OLM D;  4HCP B;  5D94 A;  2CHW A;  1WJN A;  2BYV E;  2RD0 A;  1VD2 A;  3AU5 A;  2MRP A;  3OAW A;  5AEK B;  3ONS A;  4E74 A;  4W9C A;  2LVO A;  2KTR A;  3A9J A;  4II2 B;  5DPW A;  1CMX B;  1EF1 A;  3L13 A;  4TUU A;  3T8M A;  2MP2 B;  3HM3 A;  1UEL A;  2EMS A;  3ZNI D;  1I42 A;  2JRI B;  4KDI C;  2K39 A;  2KC2 A;  2IO2 B;  3EC8 A;  3PPA A;  1WRD B;  4I6N B;  4GSW A;  4HXD A;  3TJP A;  3R3M A;  3PS6 A;  4W9H A;  3EHV A;  5C23 A;  3NOB A;  3L16 A;  4ZRI A;  1V81 A;  4MH0 E;  1OEY J;  1WJU A;  1UBI A;  4I6P A;  2NBV B;  3APD A;  2KWV B;  4JIO U;  2Z59 B;  4LCD E;  4MSQ B;  4ASW C;  1G6J A;  3QC8 B;  2C7M B;  1E8W A;  2MW5 A;  2JT4 B;  3L08 A;  3R7Q A;  4ICU A;  3DOW A;  5JH5 C;  5JHB A;  4HDO A;  4MSM B;  2MBB B;  2ZCC A;  3A9K B;  4CO7 A;  5DPS A;  4WJQ A;  2N9P C;  1SIF A;  1WMH A;  1WXV A;  4PS3 A;  3SU8 X;  5L83 A;  3IVF A;  1J8C A;  4URK A;  2N7D A;  4A3O A;  2BF8 B;  1F9J A;  2G45 B;  1E7V A;  2GBK A;  2KX3 A;  3QHT A;  3RT3 B;  4KIK A;  3IBE A;  4ICV A;  1GJZ A;  3PHX B;  3ZNZ B;  1RLF A;  2KLG A;  2PJH A;  3A1Q B;  3K9O B;  2ZVO A;  2D10 A;  4G11 A;  2PE6 B;  2G4D B;  4ANU A;  2O2V A;  5DCN A;  3QAR A;  2J0J A;  3WIM A;  3MTN B;  4B6W A;  2L76 A;  1S3S G;  2BYF A;  4WJO A;  3PV1 A;  3PHW B;  1KJT A;  4GDK A;  2DYO A;  2BKF A;  1OQY A;  3RD2 A;  2ZEQ A;  5EDS A;  4EKU A;  2ZZP B;  1Z2M A;  4ANX A;  4KZ0 A;  4HCN B;  4NAW A;  4IW0 A;  1UD7 A;  3SD5 A;  4ZRK A;  1KOT A;  3TMP B;  2KN5 A;  2KMC A;  3TBL D;  3VXW A;  2D3G A;  3R66 C;  1S1Q B;  3L10 B;  3QAQ A;  4NPN A;  3WAO A;  4FN2 A;  4BBN C;  2L0F A;  1EO6 A;  5HKH A;  3L17 A;  3V60 A;  3T9L A;  4JL9 A;  1ZGU B;  4M0W B;  2IBI B;  3WAP A;  4DHZ E;  4G50 A;  3V6E B;  4IM2 A;  4HK2 A;  2FID A;  1Y8R C;  2BKR B;  2WYQ A;  2MSE D;  3PSE B;  3VDZ A;  3ZUN A;  1H8C A;  3PLV A;  3UIO B;  2FCM A;  1WX8 A;  4HDQ A;  2VRR B;  1V2Y A;  2MBE A;  4F1S A;  3UF8 A;  1P3Q U;  3EEC A;  2YLM A;  1YIW A;  3WAL A;  1AAR A;  3JSV B;  2AL3 A;  5D7G A;  4X57 B;  3Q3J A;  2ASQ A;  1SGH A;  1YX5 B;  4F8C B;  2KOX A;  4GOC A;  1WJ6 A;  3PZD A;  4WWO A;  3H7P A;  2PE9 A;  2J7Q B;  4CYE A;  2LGD A;  2RSU A;  5J17 A;  3RCZ A;  4DDG D;  1WGG A;  1P1A A;  2N4F A;  4J6I A;  2FAZ A;  4K7W A;  2LI5 A;  2IY0 B;  4EZJ A;  2CHX A;  2Z0E B;  2NVU I;  1WZ3 A;  2ZPN A;  3AI5 A;  4WJN A;  3RZF A;  3X23 A;  1TGZ B;  4I6L B;  4BOS C;  1LQB A;  2LVQ A;  3PT2 B;  4BFR A;  2MBH A;  4PYZ A;  5DPT A;  1HE8 A;  1UGM A;  3B0A A;  1R4N I;  2KJ6 A;  3H1U A;  1WYW B;  2N7E A;  4FHK A;  3PRE A;  5AZH A;  3P2B A;  4ZRJ A;  1L7Y A;  1P98 A;  3CSF A;  4YL8 A;  1OEY A;  4CHK A;  2ZNV C;  4B95 A;  1SE9 A;  2K1F A;  2MWS B;  3BY4 B;  5L95 C;  5CHF A;  3KVF B;  3ZTC A;  3AUL A;  4MGZ E;  2DZM A;  2K8C A;  2LUE A;  3H6N A;  1C1Y B;  2ZVN A;  5D2M B;  1E5W A;  1ZW7 A;  1E8Y A;  1TBE A;  2GBN A;  2RPQ A;  2NBW B;  2CU1 A;  1WR6 E;  3KUD B;  4W9D A;  3ZNH B;  3NZS A;  2GBM A;  2ZCB A;  4TKN A;  2KK8 A;  4GMV A;  3PRM B;  2DAJ A;  4HVB A;  3I3T B;  2DZJ A;  2LAS A;  1ZKH A;  2KZR A;  2N9X A;  4MJS B;  4DHJ B;  2IYD B;  1LXD A;  3ZNG C;  3ALB A;  2KO3 A;  1NBF C;  2O6V A;  4NJ6 A;  3M63 B;  1YQB A;  2GOW A;  2PEA A;  1XT9 B;  4M8M A;  4LDT D;  4FBJ B;  3UQA A;  3ZIM A;  2XK5 B;  1E8Z A;  3VVW B;  5LXH A;  3VUY A;  2M17 A;  3QA8 A;  1ISN A;  4A20 A;  2K8H A;  5LLI A;  4DXA B;  2PPH A;  2IZV B;  1Q1O A;  1WJ4 A;  3DCG A;  2KLC A;  2JY6 A;  2BWE S;  2KC1 A;  3QWZ B;  3GOE A;  3VTW A;  1IPG A;  1UH6 A;  4RM8 A;  4W9E A;  2LZ6 A;  1T0Y A;  4JLC A;  3Q3F A;  1RRB A;  4BVU C;  3K9P B;  2JXX A;  2KDF B;  2R2O A;  2FCQ A;  2IO3 B;  2GMI C;  2LWP A;  2KFK B;  3IHP C;  4BKS D;  4WQO B;  1V9J A;  1V6E A;  2I1J A;  4GB9 A;  3VFK A;  2HJ8 A;  3DVG Y;  2KFJ A;  4MGI E;  1YD8 U;  1Q5W B;  2I1K A;  2JPH A;  2V1Y A;  4FJV B;  2WX1 A;  3KW5 B;  1MG8 A;  2L3Z A;  2KVR A;  2MP2 A;  2L00 B;  3QCA A;  1QZE A;  2XBB C;  1E90 A;  1C3T A;  3CMM B;  2G4S A;  3ENE A;  3UGB B;  3JVZ X;  4XZ4 A;  4W9I A;  3ZVV A;  2NPT B;  1U4A A;  4AP4 C;  3U30 A;  4AOF A;  2C7N B;  5KHO A;  3DVN U;  2JF5 A;  1GG3 A;  4IWQ A;  2J0K A;  4ANV A;  2C60 A;  4HLE A;  2LXC A;  4HJK A;  1E8X A;  2R2Q A;  3A9K A;  1EF5 A;  3RUL A;  3V61 A;  3VQI A;  1WXM A;  2J0M A;  2Y5B B;  4EFO A;  5C1Z A;  1M94 A;  2N1W A;  5E6O A;  4AWJ A;  4DBG A;  2AL6 A;  3JYU A;  2LD9 A;  5IA7 A;  2WWZ A;  1R4M I;  2LXA A;  3C0R B;  1IYF A;  4E71 A;  1EUV B;  1V5T A;  2BYE A;  3AXC A;  2G3Q B;  3DBL I;  3PLU A;  3IG3 A;  2CS4 A;  4F7Z A;  4K7S A;  4HPM B;  2W9N A;  4GN1 A;  2CR5 A;  2LGY A;  4GIV A;  3VH3 B;  2C9W B;  1WXA A;  3A1Q A;  1BT0 A;  2K6D B;  4IUM B;  4NQL B;  4GDL B;  2KQS A;  3S2A A;  4W9J A;  2KDB A;  2LRU A;  3KYD D;  1J19 A;  4ZYN A;  2FCN A;  5FR6 A;  3HM6 X;  2IO1 B;  3L54 A;  5J18 A;  4GU2 A;  1V86 A;  4LJP B;  5KHQ A;  2M4N A;  1WY8 A;  2CKH B;  3D32 A;  4N9F 4;  3OJ4 B;  1LFD A;  4EUT A;  4KSK C;  5D6J B;  1WZ0 A;  4IWO A;  3RUI B;  1RAX A;  2N1V A;  5CHV C;  1WGR A;  3V62 A;  2WX0 A;  3PRZ A;  3RZW C;  4AJY B;  3VH4 B;  4EZK A;  4II3 B;  3QK0 A;  2C5L C;  4NY0 A;  1LM8 B;  1L2N A;  1WGH A;  3DVN V;  4BKT A;  4KSL C;  5E6N A;  4FA6 A;  4P7I A;  4IC7 B;  2MBO A;  2OJR A; 
#chains in the Genus database with same CATH topology
 1AWD A;  1V1P B;  2KTR B;  1JWU D;  4NJ7 A;  3I63 C;  4KKJ A;  3N32 A;  5J2R A;  1T5X D;  4J3O D;  1STE A;  2KJH B;  4KGR A;  3AE4 B;  3MJ5 A;  4KGT A;  2NMQ A;  3CST A;  2MCN B;  1P9D U;  3EA6 A;  4DWF A;  3NZU A;  4W9K A;  2UWQ A;  1NDD A;  1QOA A;  2MQJ A;  4NQK E;  2KDI A;  2JX5 A;  3ZW3 A;  3PRP B;  1WXS A;  3GZN I;  2LJ5 A;  2MA9 B;  3C19 A;  3DVG X;  2JVC A;  2IGH A;  3KUZ A;  4KIK B;  2DEN B;  3VR9 B;  1JWM D;  3WA0 A;  5JZE B;  3R7R A;  1BUI C;  2QHO A;  1YN5 A;  4TV3 A;  4M8N A;  2QCZ A;  2JSV X;  2WDQ B;  3VUX A;  3W5U B;  1N62 A;  1DOI A;  2MHJ A;  2OHF A;  2KD0 A;  1FCC C;  1CQV A;  5HFY A;  2WXL A;  2DX5 B;  3MP9 A;  2AYO B;  2D2Q A;  3ZLZ A;  5TSS A;  2WXG A;  2XK5 A;  1K52 A;  1NI3 A;  1TT5 B;  3BWU D;  2JWU A;  3CF6 E;  1JQ4 A;  2DAF A;  4IOI E;  1TZ1 A;  2K25 A;  2C7H A;  2L0T A;  1YJI A;  1YQ3 B;  3H7P B;  4MEL A;  3W1Y A;  2REX A;  2PW9 A;  1FXT B;  3KUC B;  2IND C;  2NR2 A;  3X0W A;  1AN8 A;  5BYR A;  2EKE C;  5CHW A;  1ET9 A;  2KAN A;  4KZC A;  3W1S C;  2N9K A;  2M1M A;  2WLB A;  3SHQ A;  3VHT C;  1T0R C;  1OGW A;  1WE7 A;  2YEP B;  1I35 A;  3BK2 A;  3M95 A;  4WWN A;  4JPS A;  5DPR A;  5GXG B;  3ML8 A;  1WM3 A;  1NI2 A;  4C4V B;  1WM2 A;  1D3Z A;  1GC7 A;  4MGK E;  4N59 A;  4AQ7 A;  4YTN B;  1Q0W B;  2CHZ A;  2O6V B;  3FIL A;  3ZJT A;  3O65 B;  1N5X A;  2ZNV B;  1PFD A;  1TS2 A;  4RM9 A;  4EOY A;  3KH0 A;  2WDT B;  3GB1 A;  2EMT A;  5E6P A;  4AJW A;  2CJO A;  1N6Z A;  3HHM A;  4W9F A;  4EEW A;  3B9J A;  1SEB D;  1XXG A;  4MEM A;  2KNB A;  2DNF A;  2K0P A;  1ROE A;  1XF5 L;  2KX0 A;  4OHJ A;  2HD5 B;  2O6V D;  2WU5 B;  4KGS A;  2RD0 A;  1VD2 A;  3AU5 A;  2MRP A;  2ONQ A;  5AEK B;  1V1P A;  2KDM A;  2KTR A;  1J7A A;  4P16 A;  2MJ3 A;  3LYY A;  3FKY A;  1SE3 A;  2ACZ B;  3DBL B;  3ZNI D;  1XLO A;  2K39 A;  3BVM A;  1WRD B;  2DWQ A;  4NAM A;  4W9H A;  3EHV A;  5C23 A;  3L16 A;  4ZRI A;  4PK1 A;  1CZP A;  4XDC A;  4I6P A;  4ASW C;  2Z59 B;  4LCD E;  1E8W A;  3GS2 A;  1VRA B;  5JH5 C;  3RNF C;  2BQQ A;  2MBB B;  4MSM B;  2ZCC A;  3A9K B;  2N9P C;  1WXV A;  5L83 A;  2BF8 B;  1E7V A;  4BZA A;  3P4P B;  4KIK A;  2QDF A;  1FCL A;  1GJZ A;  1RM6 C;  3K9O B;  2G4D B;  3QAR A;  2J0J A;  3MTN B;  4B6W A;  1S3S G;  2BYF A;  3RNE C;  2BKF A;  1OQY A;  4EKU A;  4RNA A;  2ZZP B;  1UWM A;  1FNV A;  4HCN B;  4WH4 A;  2BBC A;  4HJG E;  5BMG A;  5IOI A;  3VXW A;  4NPN A;  2QSD A;  2M19 A;  3Q14 C;  1SSN A;  3WAP A;  2QIL A;  2BKR B;  2WYQ A;  3VDZ A;  4KX6 B;  1H8C A;  5EE9 A;  4HDQ A;  4C7Z A;  2VRR B;  1C9F A;  2K9X A;  2MBE A;  4F1S A;  3CIR B;  1AAR A;  2AL3 A;  5D7G A;  1SGH A;  1T6B X;  4GOC A;  2LMC A;  2WHI A;  3H7P A;  2PE9 A;  5JXV A;  2LGD A;  2RSU A;  2GLS A;  3NZ3 A;  4L23 A;  2D3B A;  3RCZ A;  2ZPN A;  3AEF B;  3SFE B;  1DGJ A;  1N60 A;  1JWB D;  1LQB A;  2KT7 A;  3PT2 B;  4MM3 B;  2MBH A;  5DPT A;  3H1U A;  1I4R A;  3P2B A;  4YL8 A;  4CHK A;  1SE9 A;  3CWI A;  1IGC A;  4MGZ E;  3H6N A;  2K8C A;  2LUE A;  2INN E;  1KLG D;  3U52 E;  3LB8 C;  1FFU A;  3P4S B;  2K5P A;  4C4V A;  3PRM B;  4RF1 A;  2DZJ A;  2LAS A;  1ZKH A;  2KZR A;  4MT5 A;  4DHJ B;  3P4Q B;  2O6V A;  3M63 B;  2GOW A;  1XT9 B;  1TS4 A;  1YMH E;  1I4H A;  3VUY A;  1L5P A;  4LTU A;  3VTW A;  1T0Y A;  2JXX A;  1V97 A;  2LWP A;  3IHP C;  1V6E A;  2HJ8 A;  2V3P A;  1YD8 U;  2CJN A;  3DBR B;  1FIQ A;  3KW5 B;  3QCA A;  1L6U A;  2WS3 B;  2G4S A;  1F52 A;  3Q6B A;  1U4A A;  4AOF A;  5KHO A;  1R7S A;  2JF5 A;  1GG3 A;  1MPE A;  1VR9 A;  5G5G A;  4HLE A;  3DWM A;  3WCQ A;  3A9K A;  3V61 A;  1WXM A;  1QF6 A;  3JYU A;  2WWZ A;  1L0Y B;  1HZ5 A;  2BYE A;  2SEB D;  3DBL I;  4K7S A;  4HPM B;  2W9N A;  1VZ7 A;  5EE3 A;  2WU2 B;  1VJK A;  4IUM B;  1TS5 A;  4GDL B;  3S2A A;  4W9J A;  4ZYN A;  3P1M A;  5FR6 A;  1JRP A;  1D6E C;  3L54 A;  4GU2 A;  1V86 A;  2I2Y A;  4LJP B;  4LNO A;  5KHQ A;  1LFD A;  4DXF A;  2GB1 A;  5D6J B;  4IWO A;  4AJY B;  1IGD A;  1T3Q A;  4BKT A;  2MJE A;  3P63 A;  2LGI A;  4KV2 A;  2JZ3 B;  4EZL A;  1NEN B;  3IT6 B;  1C4C A;  4WAF A;  1RFA A;  3OJ3 A;  1ZDX A;  5AZG A;  4OZC A;  4XWW A;  3B2G A;  2BB6 A;  3EUB 2;  3U2S C;  1XLQ A;  4YT0 B;  4K81 A;  4K1R B;  2W54 A;  4REZ A;  1MI0 A;  3APF A;  1TTN A;  4YTM B;  1TJE A;  4G3X B;  3DHI C;  2PIA A;  3NUH B;  1WIA A;  4OVU A;  3VR8 B;  1ZDV A;  3ZO5 B;  3NVW A;  2IGG A;  4MM3 A;  1ZXI A;  4XWT A;  4PT5 A;  3BII D;  3AE5 B;  2RGF A;  4ARC A;  1QIL A;  1QLB B;  5GMV A;  2RDH A;  2DHZ A;  4GDK B;  3V6C B;  3R8B A;  4K3B A;  2M0X A;  3TL5 A;  4JGH B;  4NAW B;  4CQN A;  4XDD A;  1K53 A;  5H8Y E;  3ZKJ C;  3ZQ4 A;  3ETR A;  2DZK A;  2K8B A;  3DQV A;  5BO4 B;  1C79 A;  2NCN A;  1PGA A;  1JW9 D;  1ZE3 D;  3VUW A;  1D5Z C;  2D11 A;  2KVZ A;  3DWG C;  4NNJ B;  3U7Z A;  1IUE A;  2MLB A;  1BML C;  4US8 A;  3LJ3 A;  3QJZ A;  2M0A A;  2BPS A;  2KAJ A;  3GE3 C;  3VAW A;  2NTS A;  3M62 B;  2WXJ A;  3NVY A;  2LGS A;  1P0R A;  3PGE A;  2DBY A;  2QIE B;  1F2R C;  1KLV A;  3ML9 A;  1Y56 A;  2OED A;  2KWU B;  2Y5P A;  4AUQ C;  3TEZ A;  3NY5 A;  3L0W B;  2L7R A;  4XC2 A;  4ZYS A;  1VLB A;  1XQQ A;  1P7F A;  4QAY A;  1T0S C;  1TKY A;  5HHD G;  2B3A A;  3I57 A;  1WH3 A;  1N5W A;  4A3P A;  1HTO A;  1J7C A;  4FAD A;  2MBQ A;  4WQM A;  3ZXV A;  4LNI A;  5BYQ A;  2FUG 1;  1V80 A;  2FUH B;  4YSY B;  2WXK A;  5E6J A;  2IO0 B;  1T0Q C;  2R61 A;  3DBR I;  3RNG C;  4BOZ B;  5IAA C;  5G55 A;  4FLH A;  1GB1 A;  4YSZ B;  3TEY A;  3MJW A;  4TQ1 A;  3N3K B;  3A4R A;  1YX6 B;  3W1S A;  4ZHP A;  4GDL A;  2MH7 A;  4BKG A;  1FXI A;  4OZB A;  2KXJ A;  3QX1 A;  3IAM 1;  2ICI A;  4RGO S;  1JWA D;  5JHA A;  3FAH A;  4BBN F;  1WGY A;  1I4G A;  3MHS D;  2HTH A;  2V4L A;  3VTV A;  2WXQ A;  2V3S A;  2AEH A;  3AEG B;  4W9L A;  2D5G A;  1UWX A;  3AE3 B;  1WF9 A;  1TS3 A;  5D94 A;  2JU6 X;  3EGR A;  2AX5 A;  3UI3 A;  4ARI A;  4W9C A;  2LVO A;  4II2 B;  1CMX B;  3L13 A;  4TUU A;  3T8M A;  2MP2 B;  3HM3 A;  2EMS A;  3Q3N C;  3PPA A;  4HXD A;  3AE2 B;  2N9L A;  2KWV B;  3N1Y C;  4MSQ B;  3Q3M C;  4JWU C;  2C7M B;  1D5X C;  2JT4 B;  3L08 A;  1FFV A;  3R7Q A;  4CO7 A;  4WJQ A;  1SIF A;  3SU8 X;  4A3O A;  1F9J A;  2KX3 A;  1MG4 A;  2WXI A;  2PJH A;  2KLG A;  2L1A A;  2D3A A;  4G11 A;  4P1C C;  2WDV B;  1SJE D;  5DCN A;  1K51 A;  4WJO A;  4GDK A;  2DYO A;  1SE2 A;  4ANX A;  4NAW A;  3SFD B;  2W3S A;  1OQQ A;  1UD7 A;  4BBN C;  1EO6 A;  3V60 A;  3T9L A;  1ZGU B;  5BMH A;  2FID A;  2KAC A;  3PSE B;  3PLV A;  1XO3 A;  1P3Q U;  3EEC A;  2YLM A;  2PVO D;  1YIW A;  3AE6 B;  3WAL A;  3JSV B;  4X57 B;  3O13 A;  4F8C B;  1I4Q A;  3PZD A;  2J7Q B;  2W3R A;  4K3C A;  1OQR A;  4J6I A;  4K7W A;  3U4E G;  2CHX A;  5FKA C;  2Z0E B;  4DXG A;  3X23 A;  3HVZ A;  5D3D A;  1EU3 A;  2LVQ A;  3T3N A;  1NEK B;  2BS4 B;  1UGM A;  4LNK A;  1WYW B;  4FHK A;  2HDE A;  3N9Y C;  1OEY A;  2K1F A;  5L95 C;  3J9C A;  2WNM A;  1NYQ A;  2ZVN A;  1E8Y A;  3H8H A;  1TKE A;  1HTQ A;  2RPQ A;  1WR6 E;  3KUD B;  1ACC A;  3ZNH B;  2JYE A;  3HRD D;  2KK8 A;  3RN9 C;  2DAJ A;  1JAL A;  1SIJ A;  4MJS B;  1LXD A;  3ALB A;  4HRO A;  2KO3 A;  1YQB A;  3ZIM A;  1I7H A;  2M17 A;  1ISN A;  4A20 A;  5LLI A;  4DXA B;  5IKC M;  2IZV B;  3AH7 A;  1Q1O A;  3Q69 A;  3ZGZ A;  3DCG A;  2BT6 A;  1WWT A;  2KC1 A;  3GOE A;  1TYG B;  1IPG A;  3AE7 B;  1WYG A;  2XNA C;  4JLC A;  3Q3F A;  4BVU C;  3K9P B;  3NVV A;  4JX1 C;  3ABV B;  2FCQ A;  3SR6 A;  1ZUD 2;  2KFK B;  4BKS D;  2D3C A;  1C4A A;  1V9J A;  2G1E A;  3T3O A;  4UDU C;  2QEJ C;  1A70 A;  2I1K A;  2V1Y A;  3PZ8 A;  2L3Z A;  2KVR A;  2MP2 A;  2L00 B;  4NZL B;  1L0V B;  1C3T A;  2BW2 A;  3CMM B;  3JVZ X;  4XZ4 A;  3U30 A;  2C7N B;  5HG2 A;  3TEW A;  3Q8F A;  2J0K A;  4ANV A;  3AM9 A;  2LXC A;  2V9H A;  2R2Q A;  2GRI A;  4EFO A;  5C1Z A;  2LHE A;  2NTT A;  1DYQ A;  3RNB C;  2V0G A;  2AL6 A;  2LD9 A;  5IA7 A;  1IYF A;  2LXA A;  4E71 A;  1FD6 A;  2G3Q B;  4TSS A;  1L4D B;  4GN1 A;  3VH3 B;  1JCK B;  4A6Q A;  2K6D B;  4NQL B;  2KQS A;  1D5M C;  1J19 A;  2FCN A;  1WXQ A;  3KWV A;  3PO0 A;  1E6E B;  2CKH B;  1P7E A;  3BVZ A;  1WZ0 A;  3RUI B;  5FK9 C;  2N1V A;  5CHV C;  2MJD A;  1WGK A;  3PRZ A;  2EEL A;  4EZK A;  2ZW1 A;  4II3 B;  3QK0 A;  2C5L C;  4N6E B;  4NY0 A;  4ACF A;  3DVN V;  1MHH E;  1HA5 A;  4P7I A;  3EFC A;  2MBO A;  4KDI C;  2OJR A;  4H2A A;  5FR3 A;  3MC9 A;  2N9E B;  3N30 A;  3U8Z A;  4WWP A;  1X1M A;  2DYB A;  3AV8 A;  1QOG A;  3NS8 A;  2YVC A;  2KQ7 A;  2PMV A;  3JSV A;  3WAN A;  2A4Z A;  3APC A;  1WRI A;  3Q8B A;  3QQ8 B;  1WE6 A;  4KKI A;  4WUR A;  4B9K A;  4IWP A;  1GPX A;  3M3J A;  5IP4 D;  3H9D A;  4NJC A;  3VRA B;  1WMH B;  3A4S C;  3BZD B;  2K3U A;  2IPK D;  3ECI A;  1PQS A;  2HJ1 A;  3HIZ A;  4C56 C;  4L1B A;  3AE8 B;  3QIJ A;  1FRR A;  2LJI A;  3ZRC A;  4DHJ D;  3EFU A;  3B2F A;  1B9R A;  1OTR B;  3ZDM C;  2KTF A;  2BWF A;  2LRW A;  1KRH A;  2NS5 A;  1E7U A;  4MJS A;  2NBU A;  4HEA 1;  2L32 A;  2QJL A;  1GC6 A;  4K7U A;  3UIP B;  4BKS A;  2Y5C A;  2JUO A;  1CK1 A;  4EE2 A;  4LJO B;  2L8J A;  3IT4 B;  3WAM A;  2WP9 B;  1WGD A;  1A5R A;  2JWZ A;  1FNU A;  3H7S A;  1WX7 A;  2LGX A;  5AZF A;  2HE7 A;  3BVG A;  1I4X A;  2KFK A;  1GNU A;  4WJP A;  1EU4 A;  3IFW B;  2LVP A;  2KN4 A;  3AEE B;  1TKG A;  3UIN B;  5T8I A;  3OG5 A;  4YSX B;  3I5J C;  3IAS 1;  1IP9 A;  1RYJ A;  1H4R A;  4AS1 A;  4IM0 A;  4GLS C;  2XN9 C;  4FJY A;  4HKZ E;  4DK5 A;  4PS8 A;  2FNJ B;  1FEH A;  3BYT B;  4HWI B;  1UZX B;  3ZTD A;  2VH2 A;  2BVC A;  1B1Z A;  2RR9 A;  1RFK A;  2GBR A;  1V49 A;  4MDK E;  4ANW A;  1FO4 A;  3I9V 1;  3IXS A;  1C4P A;  1DOX A;  4FUL A;  2X8X X;  3Q8E A;  3B1L X;  2MX2 A;  5CX3 A;  3ZRF A;  1SJH D;  1LO5 D;  3ZJU A;  2VZK B;  4IM3 A;  3ZJV A;  1F2R I;  3PTF C;  2BYT A;  2L83 A;  1WI0 A;  1YQ4 B;  3W5V B;  3UQB A;  3TSS A;  4DHZ B;  4LDT B;  4YWG G;  3AU4 A;  1EM7 A;  3OLM D;  2BYV E;  2Y3A A;  3SEB A;  3P42 A;  2BS3 B;  3OAW A;  4E74 A;  2H89 B;  4HRS A;  1UEL A;  1I42 A;  2JRI B;  2X38 A;  2IO2 B;  1ZP0 B;  3EC8 A;  4GSW A;  3R3M A;  4MH0 E;  1OEY J;  1YN3 A;  3Q8A A;  1UBI A;  4JIO U;  2PVG C;  1G6J A;  4RGT A;  3QC8 B;  2MW5 A;  3E9S A;  4ICU A;  3DOW A;  5JHB A;  3N20 C;  4HDO A;  1L6V A;  3RI7 C;  1WMH A;  4PS3 A;  3IVF A;  2INC C;  1J8C A;  4URK A;  3AEC B;  1JWS D;  2G45 B;  2GBK A;  3NVZ A;  3L4P A;  3RT3 B;  5BYS A;  4ICV A;  3PHX B;  1MHX A;  2ZVO A;  4OW0 A;  4B0E A;  2L76 A;  3PHW B;  5EDS A;  3RD2 A;  1KLU D;  1ZOY B;  1Z2M A;  4KZ0 A;  1AYF A;  4P6V F;  1KOT A;  2BB5 A;  1WSP A;  1NVI D;  2D3G A;  3R66 C;  1S1Q B;  3L10 B;  2W82 A;  1IBX B;  4USA A;  3WAO A;  2L0F A;  5HKH A;  3L17 A;  2DLB A;  4M0W B;  2IBI B;  3AMZ A;  2ON8 A;  2J52 A;  4DHZ E;  1SB3 C;  3ZUN A;  1GOZ A;  4BAX A;  2FCM A;  4LNN A;  1V2Y A;  3UF8 A;  3MFG A;  1ET6 A;  3AEA B;  2L52 A;  2J4X A;  1N63 A;  1YX5 B;  2KOX A;  3RMK C;  2INP E;  4WWO A;  2KWD A;  1XLP A;  1YNT E;  4HKQ A;  2FE8 A;  1P1A A;  2N4F A;  2KMM A;  2LI5 A;  2IY0 B;  1N61 A;  2NVU I;  3AI5 A;  1FXA A;  4WJN A;  1TGZ B;  1UNS A;  4BOS C;  2JXT A;  2WXR A;  4PYZ A;  3B0A A;  2KJ6 A;  2N7E A;  1I4P A;  2AQ3 B;  3PRE A;  5AZH A;  1PYW D;  1QT9 A;  3BY4 B;  4IKG A;  3ZTC A;  1TY2 A;  1E5W A;  1ZW7 A;  1EWC A;  1TBE A;  2GBN A;  4O1N A;  1VZ6 A;  2CU1 A;  1GAQ B;  1QOF A;  4W9D A;  3NZS A;  2GBM A;  4TKN A;  1MFW A;  5LNK 1;  2E6X A;  1ENF A;  1TIF A;  2IYD B;  1XCT L;  1NBF C;  4M8M A;  4FBJ B;  1E8Z A;  2WXO A;  5LXH A;  4TMA B;  1PDX A;  1M4V A;  1F0Z A;  1MVK A;  3AE1 B;  4JWS C;  2KLC A;  3QWZ B;  2BWE S;  1FNW A;  4W9E A;  4ZRQ A;  2LZ6 A;  2ZW0 A;  1E10 A;  3BYY B;  1RRB A;  3MC8 A;  2KDF B;  2GMI C;  1PUT A;  1XEE A;  3DBH B;  4GB9 A;  4MH8 A;  2KFJ A;  1Q5W B;  2JPH A;  4FJV B;  2WX1 A;  1FM0 D;  1MG8 A;  1QZE A;  2XBB C;  3UGB B;  1KTK A;  4W9I A;  3ZVV A;  3RPF C;  2IDY A;  2NPT B;  4AP4 C;  1YN4 A;  2C60 A;  1E8X A;  1F1H A;  1EF5 A;  2Y5B B;  2J0M A;  2EKI A;  2JYT A;  1M94 A;  2N1W A;  5E6O A;  4DBG A;  1R4M I;  3PZ7 A;  3PLU A;  4F7Z A;  2CR5 A;  4GIV A;  2C9W B;  4XGA B;  2UU7 A;  3URY A;  3KYD D;  3NS1 A;  2KQ4 X;  1FRD A;  1LGR A;  5I4D A;  2PLP A;  1J7B A;  4P1B C;  4KSK C;  1FMA D;  2FBW B;  2B76 B;  1IBX A;  1L2N A;  1WGH A;  4KSL C;  2E3T A;  4Q2J A;  1E9M A;  4N58 A;  4M0W A;  1KH0 A;  3SDL C;  3DPD A;  2Q5W D;  3A9J B;  2OOB B;  1AW7 A;  1Z5S B;  4A90 A;  4TQ0 A;  3R2I A;  1YJ1 A;  1GUA B;  2L05 A;  3DDC B;  4IG7 B;  3NHE B;  3PVL A;  2W55 A;  2WXM A;  4JQW C;  4RFB A;  2PTL A;  4C00 A;  4GGQ A;  2WXN A;  5AUI A;  3NG0 A;  4XYC A;  1UBQ A;  2IGD A;  4W9G A;  3MHZ A;  4WWM A;  2H88 B;  2AQ2 B;  4HPL B;  4ZRP A;  3KWL A;  5LXI B;  1VCB A;  2V4I B;  2JRH A;  4DDI D;  3FC4 A;  4OVV A;  3Q2A C;  1PGX A;  3TCA A;  4KVG B;  1OFF A;  1WX9 A;  3RYT A;  2O2V B;  2KWC A;  1ESF A;  3TUO A;  1JRO A;  5D3I B;  1VZ8 A;  4PYU A;  2M8S A;  4KDL B;  1D4B A;  3GE8 C;  2FIF A;  1NYR A;  2AWT A;  3DBS A;  4M01 A;  4M00 A;  4OZA A;  2OJW A;  5AUK A;  4RGN A;  1Q10 A;  1PGB A;  1V8C A;  4R3D A;  1TY0 A;  2GBJ A;  4MGY E;  3AED B;  3HK0 A;  3NJT A;  2D07 B;  2JZZ A;  4C80 A;  3AN1 A;  2PKO A;  1KM7 A;  3JW0 X;  2RPV A;  1R4N B;  3KQ4 A;  4JE3 B;  4YXD B;  2BGF A;  4US9 A;  2K6Q A;  3KYC D;  4E3C A;  2TSS A;  2BTE A;  2KDE B;  4M02 A;  4WIP A;  1WR1 A;  2ZJD A;  2MEK A;  2KHW B;  2N7J A;  4XX5 A;  3TIX A;  1V5O A;  4FJZ A;  1QKZ A;  1QOB A;  2XEW A;  3U7D A;  1TZO A;  3GP7 A;  5TR5 A;  2NPT A;  5G2N A;  1WFY A;  2ZPY A;  4LLG M;  1J0G A;  3VTU A;  3A33 B;  1XD3 B;  2Z0D B;  2G9H D;  3DBH I;  4G0N B;  2KJR A;  1CJE A;  4PS7 A;  3R2T A;  5CTR C;  4OVZ A;  2DZI A;  2KKC A;  4ZDV A;  3LDZ E;  2DYM A;  2UYZ B;  2WQY B;  2IY1 B;  2KMA A;  3BIN A;  2FCS A;  1K8R B;  4FHJ A;  4ZHO A;  3KLS X;  4RMA A;  4A9A A;  3B08 A;  2A5U A;  3W2D A;  3N1X C;  4IDI A;  5EE1 A;  1E7P B;  2WXP A;  4WAA A;  3ZDT A;  4GXB A;  3ZYY X;  3N1Z C;  3HVD A;  1JRU A;  4HCP B;  2CHW A;  1WJN A;  3ONS A;  3A9J A;  4C7Y A;  5DPW A;  3Q8C A;  1EF1 A;  2N0S B;  5G5H A;  2KC2 A;  1KF6 B;  4LK0 M;  2YEP F;  4I6N B;  3TJP A;  1ZPS A;  3PS6 A;  3NOB A;  2GI9 A;  1V81 A;  1WJU A;  2VH1 A;  3RFZ B;  2NBV B;  1SE4 A;  3APD A;  4B0M A;  1RWS A;  1YOV B;  2K22 A;  5DPS A;  1DOY A;  4RGM A;  2N7D A;  3QHT A;  2M56 B;  1L4Z B;  3IBE A;  2CU3 A;  3ZNZ B;  1RLF A;  3A1Q B;  5IO9 A;  3RNC C;  2D10 A;  2PE6 B;  4MAC A;  4ANU A;  1C76 A;  2O2V A;  3MC0 B;  3WIM A;  3NRZ A;  3PV1 A;  1KJT A;  2JZP A;  5MPO A;  1BXT A;  2ZEQ A;  3VRB B;  2J42 A;  1VDV A;  1UGJ A;  4DQO C;  4IW0 A;  3SD5 A;  4ZRK A;  3TMP B;  2KN5 A;  2KMC A;  2WGS A;  3TBL D;  1F77 A;  3QAQ A;  4FN2 A;  4JL9 A;  1SF0 A;  2QMT A;  4G50 A;  3V6E B;  4IM2 A;  4HK2 A;  5IN7 A;  3GZN B;  1Y8R C;  2MSE D;  4ITK A;  3UIO B;  3ZXR A;  1WX8 A;  2LEK A;  2LHD A;  2WXH A;  1UUP A;  3Q3J A;  2ASQ A;  1E0Z A;  5BMI A;  2J53 A;  1WJ6 A;  4CYE A;  3AB5 A;  1ZXH A;  5J17 A;  1SXT A;  4DDG D;  1WGG A;  4HPP A;  2FAZ A;  3OWE B;  4EZJ A;  5C2T B;  3BK1 A;  1WZ3 A;  3Q3O C;  1HQR D;  2WDR B;  2RDG A;  3RZF A;  4I6L B;  1K50 A;  4BFR A;  2SAK A;  2RDB C;  1HE8 A;  1R4N I;  4S17 A;  4ZRJ A;  1L7Y A;  1P98 A;  3CSF A;  2ZNV C;  1KFY B;  4B95 A;  2MWS B;  2JQR B;  5CHF A;  3KVF B;  3AUL A;  2DZM A;  1C1Y B;  1HZ6 A;  2QC8 A;  1SBB B;  2Z8L A;  5D2M B;  4XE0 A;  1V1O A;  2VZK D;  2NBW B;  2LUM A;  4FXC A;  2ZCB A;  1JML A;  4GMV A;  4HVB A;  2KYW A;  3I3T B;  1R4M B;  2N9X A;  5HI1 A;  3ZNG C;  4NJ6 A;  2PEA A;  4RF0 A;  4LDT D;  3UQA A;  2XK5 B;  3VVW B;  2V3N A;  3QA8 A;  2K8H A;  2WXF A;  2PPH A;  1HEZ E;  1GB4 A;  1WJ4 A;  2JY6 A;  1YJJ A;  4RM8 A;  1UH6 A;  3AE9 B;  3E56 A;  2AQ1 B;  1MJD A;  2R2O A;  3LXF A;  2IO3 B;  2LFI A;  2RMM A;  1QQR A;  4WQO B;  2I1J A;  3VFK A;  1C77 A;  3DVG Y;  3C8Y A;  1XLN A;  4MGI E;  3RNA C;  1L0X B;  3AEB B;  1E90 A;  1XCQ L;  3ENE A;  5EE0 A;  4A55 A;  3W9C B;  3DVN U;  5C3J B;  4IWQ A;  2BS2 B;  1HXY D;  4HJK A;  2IJ0 A;  3RUL A;  3VQI A;  4S0R A;  3DHG C;  4A8X C;  4AWJ A;  3TEX A;  3C0R B;  1EUV B;  1V5T A;  3AXC A;  5H92 C;  4YTP B;  3IG3 A;  2CS4 A;  2LGY A;  1WXA A;  3A1Q A;  1BT0 A;  3FIL B;  1C78 A;  3DHH C;  4RCO A;  2KDB A;  2LRU A;  2HTM E;  4RH6 A;  1UF0 A;  3V05 A;  1FPY A;  3HM6 X;  4LNF A;  2IO1 B;  5J18 A;  3V3X A;  2M4N A;  1WY8 A;  3D32 A;  4N9F 4;  3OJ4 B;  1EWY C;  2I38 A;  3P4R B;  4EUT A;  4L2Y A;  1RAX A;  1WGR A;  3V62 A;  2WX0 A;  3RZW C;  3VH4 B;  4D2K A;  3HUI A;  1LM8 B;  5E6N A;  4FA6 A;  4IC7 B;  4ZOH C; 
#chains in the Genus database with same CATH homology
 3SDL C;  4KV2 A;  3DPD A;  2KTR B;  3A9J B;  4NJ7 A;  2JZ3 B;  4EZL A;  2N9E B;  1RFA A;  2OOB B;  3N32 A;  1Z5S B;  3N30 A;  3OJ3 A;  4TQ0 A;  5J2R A;  3U8Z A;  4WWP A;  1X1M A;  2DYB A;  3NS8 A;  1YJ1 A;  2YVC A;  1GUA B;  2L05 A;  2KQ7 A;  3DDC B;  5AZG A;  3JSV A;  2KJH B;  3WAN A;  4IG7 B;  2A4Z A;  3NHE B;  3PVL A;  3CST A;  3APC A;  4K81 A;  3QQ8 B;  4JQW C;  1WE6 A;  4K1R B;  2MCN B;  1P9D U;  4GGQ A;  4DWF A;  3NZU A;  4W9K A;  3APF A;  2UWQ A;  1UBQ A;  1NDD A;  4IWP A;  2MQJ A;  1TTN A;  4B9K A;  4NQK E;  4W9G A;  3M3J A;  2KDI A;  4G3X B;  3H9D A;  3ZW3 A;  4HPL B;  5LXI B;  3PRP B;  1WMH B;  3A4S C;  1VCB A;  2JRH A;  1WXS A;  1WIA A;  3GZN I;  4OVU A;  4DDI D;  2LJ5 A;  4OVV A;  2MA9 B;  3ECI A;  1PQS A;  3ZO5 B;  3DVG X;  2JVC A;  4MM3 A;  3TCA A;  3KUZ A;  4KIK B;  3HIZ A;  4KVG B;  2RGF A;  1WX9 A;  2DEN B;  3RYT A;  2O2V B;  2KWC A;  3QIJ A;  5GMV A;  3WA0 A;  5JZE B;  3ZRC A;  4DHJ D;  3R7R A;  3EFU A;  2DHZ A;  2QHO A;  4GDK B;  4PYU A;  3V6C B;  4TV3 A;  2M8S A;  2M0X A;  4KDL B;  3TL5 A;  1OTR B;  3ZDM C;  2KTF A;  2FIF A;  4JGH B;  2BWF A;  2AWT A;  3DBS A;  4M8N A;  4NAW B;  2LRW A;  3ZKJ C;  3VUX A;  2NS5 A;  1E7U A;  2DZK A;  2K8B A;  3DQV A;  5BO4 B;  2KD0 A;  2NCN A;  4MJS A;  2NBU A;  2GBJ A;  2DX5 B;  1GC6 A;  4MGY E;  3VUW A;  4K7U A;  2AYO B;  3HK0 A;  2D2Q A;  2D07 B;  2D11 A;  3UIP B;  3ZLZ A;  4BKS A;  2JZZ A;  2XK5 A;  4NNJ B;  2JUO A;  1KM7 A;  4LJO B;  2L8J A;  2MLB A;  3LJ3 A;  3CF6 E;  3QJZ A;  3WAM A;  3JW0 X;  1WGD A;  2DAF A;  1A5R A;  2BPS A;  1TZ1 A;  2BGF A;  3VAW A;  2JWZ A;  2K25 A;  3H7S A;  3M62 B;  2C7H A;  2K6Q A;  1WX7 A;  2L0T A;  3KYC D;  4E3C A;  2LGX A;  5AZF A;  2HE7 A;  1P0R A;  3H7P B;  3PGE A;  4MEL A;  2KFK A;  1KLV A;  2KDE B;  1GNU A;  3W1Y A;  2REX A;  4WJP A;  3ML9 A;  1WR1 A;  2ZJD A;  3IFW B;  2KWU B;  2KHW B;  4AUQ C;  2LVP A;  3NY5 A;  3L0W B;  4XX5 A;  3TIX A;  1FXT B;  2L7R A;  3UIN B;  1V5O A;  3KUC B;  4FJZ A;  4XC2 A;  1XQQ A;  2NR2 A;  3X0W A;  2XEW A;  3U7D A;  2B3A A;  1IP9 A;  2EKE C;  5CHW A;  1WH3 A;  1H4R A;  2KAN A;  4IM0 A;  5TR5 A;  4KZC A;  4FJY A;  3W1S C;  4A3P A;  2NPT A;  2M1M A;  5G2N A;  4PS8 A;  3SHQ A;  4DK5 A;  1WFY A;  2FNJ B;  2ZPY A;  3VHT C;  4FAD A;  2MBQ A;  4HWI B;  1J0G A;  1UZX B;  3ZTD A;  3VTU A;  1OGW A;  3A33 B;  1WE7 A;  1XD3 B;  1V80 A;  2FUH B;  2Z0D B;  1I35 A;  2RR9 A;  3DBH I;  2GBR A;  1V49 A;  2IO0 B;  3M95 A;  4G0N B;  4MDK E;  4ANW A;  4WWN A;  2KJR A;  5DPR A;  4PS7 A;  3DBR I;  5CTR C;  3ML8 A;  1WM3 A;  1NI2 A;  2DZI A;  1WM2 A;  2KKC A;  5IAA C;  4BOZ B;  4ZDV A;  5G55 A;  4FLH A;  4FUL A;  1D3Z A;  3LDZ E;  2DYM A;  3MJW A;  1GC7 A;  4TQ1 A;  3N3K B;  3B1L X;  4MGK E;  2MX2 A;  2UYZ B;  2IY1 B;  2KMA A;  3A4R A;  1YX6 B;  1Q0W B;  2CHZ A;  2O6V B;  3W1S A;  3O65 B;  4GDL A;  5CX3 A;  3ZRF A;  4BKG A;  3BIN A;  2ZNV B;  2FCS A;  1K8R B;  2KXJ A;  3QX1 A;  4FHJ A;  4RM9 A;  4IM3 A;  4EOY A;  3KH0 A;  5JHA A;  2WDT B;  3PTF C;  4RMA A;  5E6P A;  2EMT A;  4AJW A;  3HHM A;  4W9F A;  4BBN F;  1WGY A;  4EEW A;  3B08 A;  2A5U A;  3MHS D;  2HTH A;  4MEM A;  1WI0 A;  2KNB A;  2V4L A;  3UQB A;  4WAA A;  3VTV A;  3ZDT A;  4DHZ B;  2V3S A;  2AEH A;  4W9L A;  4GXB A;  2KX0 A;  4LDT B;  2HD5 B;  2O6V D;  3AU4 A;  1JRU A;  1WF9 A;  3OLM D;  4HCP B;  5D94 A;  2CHW A;  1WJN A;  2BYV E;  2RD0 A;  1VD2 A;  3AU5 A;  2MRP A;  3OAW A;  5AEK B;  3ONS A;  4E74 A;  4W9C A;  2LVO A;  2KTR A;  3A9J A;  4II2 B;  5DPW A;  1CMX B;  1EF1 A;  3L13 A;  4TUU A;  3T8M A;  2MP2 B;  3HM3 A;  1UEL A;  2EMS A;  3ZNI D;  1I42 A;  2JRI B;  4KDI C;  2K39 A;  2KC2 A;  2IO2 B;  3EC8 A;  3PPA A;  1WRD B;  4I6N B;  4GSW A;  4HXD A;  3TJP A;  3R3M A;  3PS6 A;  4W9H A;  3EHV A;  5C23 A;  3NOB A;  3L16 A;  4ZRI A;  1V81 A;  4MH0 E;  1OEY J;  1WJU A;  1UBI A;  4I6P A;  2NBV B;  3APD A;  2KWV B;  4JIO U;  2Z59 B;  4LCD E;  4MSQ B;  4ASW C;  1G6J A;  3QC8 B;  2C7M B;  1E8W A;  2MW5 A;  2JT4 B;  3L08 A;  3R7Q A;  4ICU A;  3DOW A;  5JH5 C;  5JHB A;  4HDO A;  4MSM B;  2MBB B;  2ZCC A;  3A9K B;  4CO7 A;  5DPS A;  4WJQ A;  2N9P C;  1SIF A;  1WMH A;  1WXV A;  4PS3 A;  3SU8 X;  5L83 A;  3IVF A;  1J8C A;  4URK A;  2N7D A;  4A3O A;  2BF8 B;  1F9J A;  2G45 B;  1E7V A;  2GBK A;  2KX3 A;  3QHT A;  3RT3 B;  4KIK A;  3IBE A;  4ICV A;  1GJZ A;  3PHX B;  3ZNZ B;  1RLF A;  2KLG A;  2PJH A;  3A1Q B;  3K9O B;  2ZVO A;  2D10 A;  4G11 A;  2PE6 B;  2G4D B;  4ANU A;  2O2V A;  5DCN A;  3QAR A;  2J0J A;  3WIM A;  3MTN B;  4B6W A;  2L76 A;  1S3S G;  2BYF A;  4WJO A;  3PV1 A;  3PHW B;  1KJT A;  4GDK A;  2DYO A;  2BKF A;  1OQY A;  3RD2 A;  2ZEQ A;  5EDS A;  4EKU A;  2ZZP B;  1Z2M A;  4ANX A;  4KZ0 A;  4HCN B;  4NAW A;  4IW0 A;  1UD7 A;  3SD5 A;  4ZRK A;  1KOT A;  3TMP B;  2KN5 A;  2KMC A;  3TBL D;  3VXW A;  2D3G A;  3R66 C;  1S1Q B;  3L10 B;  3QAQ A;  4NPN A;  3WAO A;  4FN2 A;  4BBN C;  2L0F A;  1EO6 A;  5HKH A;  3L17 A;  3V60 A;  3T9L A;  4JL9 A;  1ZGU B;  4M0W B;  2IBI B;  3WAP A;  4DHZ E;  4G50 A;  3V6E B;  4IM2 A;  4HK2 A;  2FID A;  1Y8R C;  2BKR B;  2WYQ A;  2MSE D;  3PSE B;  3VDZ A;  3ZUN A;  1H8C A;  3PLV A;  3UIO B;  2FCM A;  1WX8 A;  4HDQ A;  2VRR B;  1V2Y A;  2MBE A;  4F1S A;  3UF8 A;  1P3Q U;  3EEC A;  2YLM A;  1YIW A;  3WAL A;  1AAR A;  3JSV B;  2AL3 A;  5D7G A;  4X57 B;  3Q3J A;  2ASQ A;  1SGH A;  1YX5 B;  4F8C B;  2KOX A;  4GOC A;  1WJ6 A;  3PZD A;  4WWO A;  3H7P A;  2PE9 A;  2J7Q B;  4CYE A;  2LGD A;  2RSU A;  5J17 A;  3RCZ A;  4DDG D;  1WGG A;  1P1A A;  2N4F A;  4J6I A;  2FAZ A;  4K7W A;  2LI5 A;  2IY0 B;  4EZJ A;  2CHX A;  2Z0E B;  2NVU I;  1WZ3 A;  2ZPN A;  3AI5 A;  4WJN A;  3RZF A;  3X23 A;  1TGZ B;  4I6L B;  4BOS C;  1LQB A;  2LVQ A;  3PT2 B;  4BFR A;  2MBH A;  4PYZ A;  5DPT A;  1HE8 A;  1UGM A;  3B0A A;  1R4N I;  2KJ6 A;  3H1U A;  1WYW B;  2N7E A;  4FHK A;  3PRE A;  5AZH A;  3P2B A;  4ZRJ A;  1L7Y A;  1P98 A;  3CSF A;  4YL8 A;  1OEY A;  4CHK A;  2ZNV C;  4B95 A;  1SE9 A;  2K1F A;  2MWS B;  3BY4 B;  5L95 C;  5CHF A;  3KVF B;  3ZTC A;  3AUL A;  4MGZ E;  2DZM A;  2K8C A;  2LUE A;  3H6N A;  1C1Y B;  2ZVN A;  5D2M B;  1E5W A;  1ZW7 A;  1E8Y A;  1TBE A;  2GBN A;  2RPQ A;  2NBW B;  2CU1 A;  1WR6 E;  3KUD B;  4W9D A;  3ZNH B;  3NZS A;  2GBM A;  2ZCB A;  4TKN A;  2KK8 A;  4GMV A;  3PRM B;  2DAJ A;  4HVB A;  3I3T B;  2DZJ A;  2LAS A;  1ZKH A;  2KZR A;  2N9X A;  4MJS B;  4DHJ B;  2IYD B;  1LXD A;  3ZNG C;  3ALB A;  2KO3 A;  1NBF C;  2O6V A;  4NJ6 A;  3M63 B;  1YQB A;  2GOW A;  2PEA A;  1XT9 B;  4M8M A;  4LDT D;  4FBJ B;  3UQA A;  3ZIM A;  2XK5 B;  1E8Z A;  3VVW B;  5LXH A;  3VUY A;  2M17 A;  3QA8 A;  1ISN A;  4A20 A;  2K8H A;  5LLI A;  4DXA B;  2PPH A;  2IZV B;  1Q1O A;  1WJ4 A;  3DCG A;  2KLC A;  2JY6 A;  2BWE S;  2KC1 A;  3QWZ B;  3GOE A;  3VTW A;  1IPG A;  1UH6 A;  4RM8 A;  4W9E A;  2LZ6 A;  1T0Y A;  4JLC A;  3Q3F A;  1RRB A;  4BVU C;  3K9P B;  2JXX A;  2KDF B;  2R2O A;  2FCQ A;  2IO3 B;  2GMI C;  2LWP A;  2KFK B;  3IHP C;  4BKS D;  4WQO B;  1V9J A;  1V6E A;  2I1J A;  4GB9 A;  3VFK A;  2HJ8 A;  3DVG Y;  2KFJ A;  4MGI E;  1YD8 U;  1Q5W B;  2I1K A;  2JPH A;  2V1Y A;  4FJV B;  2WX1 A;  3KW5 B;  1MG8 A;  2L3Z A;  2KVR A;  2MP2 A;  2L00 B;  3QCA A;  1QZE A;  2XBB C;  1E90 A;  1C3T A;  3CMM B;  2G4S A;  3ENE A;  3UGB B;  3JVZ X;  4XZ4 A;  4W9I A;  3ZVV A;  2NPT B;  1U4A A;  4AP4 C;  3U30 A;  4AOF A;  2C7N B;  5KHO A;  3DVN U;  2JF5 A;  1GG3 A;  4IWQ A;  2J0K A;  4ANV A;  2C60 A;  4HLE A;  2LXC A;  4HJK A;  1E8X A;  2R2Q A;  3A9K A;  1EF5 A;  3RUL A;  3V61 A;  3VQI A;  1WXM A;  2J0M A;  2Y5B B;  4EFO A;  5C1Z A;  1M94 A;  2N1W A;  5E6O A;  4AWJ A;  4DBG A;  2AL6 A;  3JYU A;  2LD9 A;  5IA7 A;  2WWZ A;  1R4M I;  2LXA A;  3C0R B;  1IYF A;  4E71 A;  1EUV B;  1V5T A;  2BYE A;  3AXC A;  2G3Q B;  3DBL I;  3PLU A;  3IG3 A;  2CS4 A;  4F7Z A;  4K7S A;  4HPM B;  2W9N A;  4GN1 A;  2CR5 A;  2LGY A;  4GIV A;  3VH3 B;  2C9W B;  1WXA A;  3A1Q A;  1BT0 A;  2K6D B;  4IUM B;  4NQL B;  4GDL B;  2KQS A;  3S2A A;  4W9J A;  2KDB A;  2LRU A;  3KYD D;  1J19 A;  4ZYN A;  2FCN A;  5FR6 A;  3HM6 X;  2IO1 B;  3L54 A;  5J18 A;  4GU2 A;  1V86 A;  4LJP B;  5KHQ A;  2M4N A;  1WY8 A;  2CKH B;  3D32 A;  4N9F 4;  3OJ4 B;  1LFD A;  4EUT A;  4KSK C;  5D6J B;  1WZ0 A;  4IWO A;  3RUI B;  1RAX A;  2N1V A;  5CHV C;  1WGR A;  3V62 A;  2WX0 A;  3PRZ A;  3RZW C;  4AJY B;  3VH4 B;  4EZK A;  4II3 B;  3QK0 A;  2C5L C;  4NY0 A;  1LM8 B;  1L2N A;  1WGH A;  3DVN V;  4BKT A;  4KSL C;  5E6N A;  4FA6 A;  4P7I A;  4IC7 B;  2MBO A;  2OJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...