2Y5BB

Structure of usp21 in complex with linear diubiquitin-aldehyde
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
149
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 21
publication title Polyubiquitin Binding and Cross-Reactivity in the Usp Domain Deubiquitinase Usp21.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
total genus 32
structure length 149
sequence length 151
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2y5bB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2y5bB01
4II3B 2BKFA 1WX8A 1XQQA 3M62B 3VUYA 2LRUA 4DHZB 3KYCD 5CHWA 5JHAA 3JW0X 2NS5A 4BFRA 1C1YB 1E90A 2KFJA 2LRWA 2ZPYA 4ANUA 2KFKA 4GIVA 4EFOA 3DBSA 3V6EB 2A4ZA 2AL6A 2K25A 2K8HA 3T8MA 2D3GA 3K9PB 2DAFA 2DENB 3LJ3A 3QA8A 4II2B 4ZRIA 3OJ3A 3IG3A 2NVUI 3ZNZB 4DHZE 3QHTA 2N9EB 2JRIB 2K8CA 2KDBA 2AYOB 3L13A 4G11A 2KHWB 4HLEA 2AEHA 2FIFA 4FHJA 1WIAA 5FR6A 3PVLA 2N9PC 3VH4B 1E8ZA 2FIDA 1IP9A 3U30A 3IHPC 4NJ7A 1UH6A 3RCZA 1WJNA 3VH3B 3CSTA 2KX3A 1KM7A 3ML8A 4GB9A 4I6LB 1WZ3A 2I1KA 3R3MA 4MM3A 1WGRA 3QAQA 4URKA 3I3TB 3PHXB 1NI2A 2KANA 2JZZA 4IM2A 3VTVA 1EF5A 4FHKA 2R2QA 4GDKB 4K7SA 3OLMD 3VAWA 2DHZA 4NPNA 3VFKA 2ZZPB 4IWOA 2UYZB 4AOFA 4WWOA 4AJWA 2HTHA 1GUAB 3RUIB 1Z5SB 2GBRA 4TKNA 4MSQB 3SD5A 3UQBA 2M8SA 3A9JA 4M8MA 2ASQA 4W9FA 4DXAB 2MWSB 5DPRA 4LDTB 3M63B 4ZYNA 4TV3A 1VD2A 1WF9A 3D32A 4DHJB 3PS6A 4N9F4 5CHFA 2MCNB 1MG8A 3ZDMC 4W9CA 1UZXB 4ZRKA 2RSUA 2BPSA 3A9KA 4FJYA 1WY8A 1WYWB 5E6OA 3VQIA 3DQVA 3A4RA 5KHQA 2HE7A 3PT2B 5C1ZA 4MH0E 1I42A 4WAAA 5J17A 1WGGA 2KDFB 2KJRA 1P0RA 3SHQA 2IBIB 1E5WA 1K8RB 4WJOA 4WJQA 2KK8A 3L54A 3PGEA 1XT9B 4IWPA 4LDTD 1WRDB 3U7DA 4RMAA 2L3ZA 4DHJD 3HHMA 1V5OA 4G50A 1UD7A 4HXDA 3CSFA 2DYMA 1Q0WB 2M1MA 3W1YA 1T0YA 2PEAA 3ZRCA 3V62A 3NY5A 3L0WB 1AARA 1E8WA 4GOCA 3WA0A 4W9GA 2MBQA 1ZKHA 1JRUA 5G55A 2O6VA 2BYEA 1WMHA 1ZW7A 3KW5B 3QARA 3ZKJC 2C60A 2IO3B 2MQJA 4KZCA 1H8CA 1WX9A 1ZGUB 4HK2A 5D7GA 1WGHA 1Q5WB 3ZNHB 4GN1A 2KC1A 5TR5A 3O65B 1F9JA 4OVUA 2NR2A 3R7RA 3WANA 3M3JA 3Q3JA 4KIKA 5IAAC 3PTFC 4ASWC 4W9DA 3TBLD 1OQYA 3WALA 3TL5A 4ANXA 3Q3FA 3VUXA 3UGBB 1V81A 2JVCA 3WAPA 3GOEA 4HCNB 4NAWB 4A3OA 3PSEB 1WM3A 1E7UA 2NBUA 3APCA 2MW5A 3ZNID 3GZNI 4GU2A 2FCSA 2B3AA 3NS8A 2LXAA 3CF6E 1WJ4A 4JGHB 4YL8A 5D6JB 3SDLC 4BOZB 1YX5B 5KHOA 4IM3A 3NOBA 3DVGY 3A9KB 3AU4A 1V9JA 1S1QB 3IBEA 3WAMA 3DPDA 2Y5BB 3VTWA 3VHTC 4BVUC 2CHWA 3ZTDA 1E8XA 2GMIC 3QIJA 4PS8A 2C7HA 1WFYA 2KTRA 1RLFA 3L16A 3PV1A 4FJZA 2DX5B 4CHKA 4WQOB 4TUUA 2M4NA 2KZRA 1WM2A 4F1SA 3OAWA 3UF8A 2J0JA 1YJ1A 1U4AA 4GSWA 3DVNV 2OJRA 1GJZA 2C5LC 4HPMB 2LWPA 2HJ8A 1YD8U 2IZVB 5AEKB 3NZSA 4ANVA 1V86A 4P7IA 2CHZA 2GBNA 3ZNGC 2AL3A 2G45B 2O6VB 3L10B 1UBIA 2KWCA 1WMHB 3RT3B 1EO6A 5BO4B 1IPGA 1Q1OA 3RD2A 1WI0A 2DAJA 2Z59B 3ZRFA 2MBBB 2MP2B 4XX5A 1RAXA 3BY4B 2K39A 4MGKE 2KDEB 3LDZE 4W9EA 2BGFA 4NAWA 1WR6E 2BWES 2XBBC 3H7SA 4RM8A 4KIKB 3APFA 4PS7A 2PE6B 1HE8A 4TQ1A 2J0KA 2O6VD 4EZJA 2MLBA 2QHOA 4EKUA 3APDA 1WJUA 3QCAA 3ZDTA 1WXSA 3VXWA 2KDIA 2OOBB 3KYDD 3EECA 5L95C 2JWZA 4KZ0A 3KVFB 1YX6B 3AU5A 1GC6A 4MDKE 2R2OA 2I1JA 4ZDVA 2MSED 3L08A 2G3QB 2ZVNA 3MTNB 4KVGB 4F7ZA 4FADA 1OGWA 2DZIA 5AZGA 1C3TA 4K81A 4EOYA 3NZUA 4G0NB 2LXCA 4NNJB 3V61A 2FUHB 3ZVVA 1YQBA 2L7RA 2WX0A 1P1AA 3AXCA 4TQ0A 2V1YA 2LJ5A 3PRPB 4I6PA 4KSLC 5J2RA 3UIOB 2JUOA 1BT0A 2IO1B 3UINB 3W1SC 3EFUA 2D11A 2FAZA 4GGQA 3UQAA 2PJHA 2KTRB 3AULA 3RYTA 1WGYA 2L8JA 4E74A 2ZPNA 5CHVC 4W9HA 2LGYA 2EMTA 3PLUA 1GC7A 1VCBA 1WZ0A 1XD3B 2CS4A 3R66C 4K1RB 3TJPA 4DBGA 4GDLA 2MX2A 2ZCBA 2K8BA 2N9XA 4PYZA 4M0WB 4ICVA 4HVBA 2KX0A 3HK0A 3DCGA 2CR5A 4HCPB 4B95A 1V80A 4EZLA 3VVWB 4AWJA 2N1VA 4FBJB 2L00B 2MP2A 3N3KB 4KSKC 4NQLB 2V4LA 4EUTA 1J8CA 3ONSA 3IVFA 3S2AA 2G4SA 4DDID 2O2VA 1M94A 3ZW3A 2GBMA 2NCNA 2NBWB 2M17A 2LZ6A 4AJYB 2AWTA 2D07B 2KO3A 4WWPA 3V6CB 2KVRA 3PREA 3U8ZA 3ZLZA 2ZJDA 1J0GA 4W9JA 2HD5B 5C23A 4BBNF 1WE6A 2K6QA 1GNUA 2REXA 2NBVB 3B0AA 1V2YA 2KJ6A 2WX1A 4B6WA 2G4DB 2KC2A 2K1FA 3A1QA 5DCNA 1P3QU 2JRHA 1OEYA 3DVNU 3T9LA 3CMMB 4KDIC 5LXIB 1I35A 3TMPB 1G6JA 2YLMA 4G3XB 2LD9A 2KD0A 4WJNA 4E71A 2KKCA 2MRPA 3L17A 5JH5C 2KNBA 2KWVB 2WDTB 4X57B 3HM3A 2LGXA 2W9NA 2Z0EB 4MGIE 4NY0A 1UGMA 4EZKA 4E3CA 1WGDA 2ZNVB 4IM0A 3WAOA 3PLVA 2KJHB 4NJ6A 4F8CB 2LUEA 4KDLB 5CTRC 5LXHA 1RRBA 2JXXA 3ZTCA 1V5TA 2NPTA 4MJSB 2KQ7A 3H7PA 4HDQA 1TTNA 4FA6A 2XEWA 1E7VA 1KLVA 5L83A 4BOSC 1A5RA 2LI5A 3KUDB 5J18A 1TBEA 4MGYE 1UELA 2ZVOA 3PZDA 4B9KA 4WJPA 2IO2B 2LASA 4DK5A 1SIFA 3TIXA 2N4FA 3DBHI 5G2NA 4K7WA 2FNJB 5D2MB 4PS3A 3VUWA 4AP4C 3V60A 4CYEA 2VRRB 1UBQA 4GDLB 1LM8B 4MSMB 3H1UA 5DPWA 4IC7B 2DYBA 2J0MA 3ECIA 2LGDA 2UWQA 3QC8B 3ZUNA 4DWFA 2V3SA 1TGZB 4HPLB 2M0XA 4FULA 3AI5A 4IWQA 1V49A 4MEMA 4M8NA 2N7DA 4A20A 4CO7A 1WR1A 3PPAA 3H9DA 1P9DU 4EEWA 3ML9A 1H4RA 2DZJA 4LJPB 4JQWC 1WE7A 2O2VB 2ZNVC 2MBHA 3MHSD 1J19A 2N7EA 2L76A 2IO0B 4NQKE 1YIWA 5LLIA 3RZFA 3A33B 2CU1A 3JSVB 2D2QA 5AZHA 2IYDB 1LXDA 2L05A 2KLCA 4MELA 2LVQA 1CMXB 1NBFC 3N30A 3NHEB 3IFWB 3C0RB 2BKRB 3VDZA 4ICUA 3RZWC 3A1QB 2JT4B 2RR9A 3X23A 1GG3A 4FLHA 1FXTB 1LQBA 1WX7A 5AZFA 2IY0B 2RD0A 1P98A 2JF5A 1KOTA 2KXJA 2C7NB 4ZRJA 1WXVA 4BKSD 3RULA 1L7YA 2BYVE 5E6PA 3SU8X 4BKTA 3TCAA 4MJSA 1D3ZA 2L0FA 3X0WA 1IYFA 1LFDA 3VTUA 2MBOA 5IA7A 1EF1A 2FCMA 3B1LX 4IG7B 5D94A 4ANWA 3EHVA 2DYOA 3JVZX 4GMVA 4AUQC 2JY6A 4IUMB 2KOXA 2KN5A 5CX3A 2XK5A 2PPHA 2J7QB 4LCDE 2FCQA 3QQ8B 3WIMA 4JIOU 1NDDA 2DZMA 2NPTB 3PHWB 4J6IA 4FN2A 2PE9A 5HKHA 3H7PB 3B08A 2JZ3B 2N1WA 3DBLI 4WWNA 1EUVB 3HIZA 3DBRI 2YVCA 3BINA 3KUCB 4HWIB 4OVVA 1ISNA 2C9WB 2GOWA 3N32A 1TZ1A 2KTFA 4JLCA 2KQSA 5GMVA 3DDCB 1E8YA 2BWFA 1WXMA 4W9KA 2FCNA 3JYUA 1R4MI 1OTRB 3PRZA 3W1SA 2GBJA 2LVOA 4BKGA 5JHBA 3ALBA 4IW0A 2L0TA 1SGHA 1Y8RC 5EDSA 3KH0A 4LJOB 2MBEA 2D10A 2KLGA 3ENEA 1OEYJ 2KFKB 3QJZA 4W9IA 4BKSA 1QZEA 4GXBA 4PYUA 5DPTA 2A5UA 3HM6X 5JZEB 3QX1A 3JSVA 5E6NA 1R4NI 3EC8A 1RFAA 3DVGX 3UIPB 4MGZE 4A3PA 3K9OB 1WH3A 4HDOA 2MA9B 2CHXA 1KJTA 1Z2MA 2EMSA 2ZCCA 4BBNC 2JPHA 3P2BA 4GDKA 1L2NA 1WJ6A 3KUZA 4HJKA 4W9LA 2KMAA 3OJ4B 3R7QA 3DOWA 4DDGD 2RGFA 2WYQA 4JL9A 4I6NB 3ZIMA 3PRMB 1PQSA 2C7MB 5DPSA 3M95A 3ZO5B 3QK0A 2DZKA 2CKHB 1WXAA 4K7UA 4XZ4A 2LVPA 2ZEQA 3QWZB 2BYFA 2GBKA 1SE9A 1V6EA 3MJWA 4FJVB 3A4SC 4RM9A 4XC2A 2EKEC 3A9JB 3H6NA 2RPQA 4KV2A 2BF8B 2Z0DB 2WWZA 2KMCA 2KWUB 1X1MA 2XK5B 2K6DB 1S3SG 2IY1B
chains in the Genus database with same CATH superfamily
3M62B 3VUYA 2LRUA 2IGDA 5CHWA 3SFEB 1TYGB 5JHAA 2NS5A 2JU6X 4M00A 3DBSA 3V6EB 1I4XA 3DHHC 2K25A 2J52A 2WXJA 3LJ3A 2DAFA 3I9V1 3QHTA 3E9SA 4HEA1 3N20C 2K8CA 1RWSA 4G11A 2PIAA 1FFVA 2FIFA 3AN1A 3P63A 5EE1A 4FHJA 3U30A 3IHPC 4NJ7A 1WJNA 4GB9A 4MM3A 1FRDA 3BIID 4URKA 3I3TB 3PHXB 2KDMA 1R7SA 1MJDA 3MHZA 1DOIA 1B9RA 4FHKA 3DBRB 3VAWA 2DHZA 2LEKA 3RNGC 4LNOA 3RUIB 1A70A 4R3DA 4TKNA 4MSQB 3UQBA 3Q6BA 3A9JA 1PFDA 2ASQA 4W9FA 4LDTB 3M63B 4DHJB 3PS6A 4N9F4 5CHFA 4W9CA 5BYRA 1VZ8A 5E6OA 3VQIA 3DQVA 3A4RA 5KHQA 3WCQA 3PT2B 2QILA 1VRAB 2OJWA 4WAAA 2KDFB 1KRHA 2KJRA 3Q3OC 2IBIB 4WJQA 3PGEA 1XT9B 1AW7A 3O13A 3HHMA 1VDVA 2H89B 2DYMA 3RNCC 4FXCA 2BB6A 3C19A 2Z8LA 3WA0A 4ARIA 1JWSD 2MBQA 1ZKHA 2E6XA 1N6ZA 3KW5B 1ZW7A 2C60A 2IO3B 4KZCA 4HK2A 5D7GA 1WGHA 5TR5A 4RFBA 1F9JA 4C4VB 4LK0M 3WALA 2VH2A 2KT7A 1VZ7A 2JYEA 3GOEA 4HCNB 1CZPA 1SXTA 2NBUA 3MFGA 4H2AA 2SAKA 1WGKA 3CF6E 4JGHB 4YL8A 5D6JB 1L0YB 3RNBC 3NVYA 1WYGA 1T6BX 3IBEA 3Q8EA 1MPEA 2Y5BB 2GLSA 2GI9A 2CHWA 2GMIC 2C7HA 3L16A 1RLFA 4RF0A 1UUPA 4CHKA 4WQOB 2M4NA 4N6EB 2INDC 4GSWA 3I63C 2JXTA 4HPMB 3P4PB 2IZVB 4WQMA 4ANVA 3HVDA 3ZNGC 2AL3A 3L10B 2QSDA 1UBIA 2KWCA 5HFYA 3AE4B 3W5UB 4LNKA 4AS1A 1IPGA 2AQ2B 2MP2B 2NTTA 3LDZE 4W9EA 4ZOHC 3TEWA 2XBBC 4KIKB 4OZBA 4WH4A 2INCC 4ZYSA 4EZJA 4XYCA 1XLPA 1WJUA 2E3TA 1JRPA 2QIEB 1YX6B 3AU5A 2WXNA 2MSED 4KVGB 1OGWA 3GS2A 2I38A 1NI3A 1C3TA 2OEDA 2MH7A 3V61A 4G0NB 1FMAD 3AXCA 2V1YA 2LJ5A 4L2YA 2JUOA 2IO1B 3EFUA 4GGQA 5CHVC 1VCBA 3TJPA 1SIJA 4ICVA 3BVMA 1I4QA 1L5PA 2N1VA 2L00B 3HRDD 2V4LA 4DDID 2ACZB 3BK1A 2GBMA 2NCNA 3ZGZA 3NZ3A 2LZ6A 2AWTA 3U4EG 5EE3A 1UWXA 3AV8A 5IP4D 4W9JA 2NBVB 1QOAA 3DVNU 4A6QA 1N62A 4G3XB 4XDCA 1J7CA 1K53A 2MRPA 4X57B 3HM3A 2LGIA 2LGXA 4MGIE 1XO3A 3GB1A 5HG2A 4A55A 3Q3NC 3NUHB 3NVWA 2LUEA 3ZTCA 3EA6A 4MJSB 3E56A 1L6VA 2ZW0A 5L83A 3KUDB 4WJPA 1YN4A 2IO2B 4XWWA 1V97A 2N4FA 5G2NA 2LFIA 4M01A 3VUWA 3V60A 4GDLB 4MSMB 3AEGB 2DYBA 4RCOA 1JWBD 1EU3A 4WAFA 1TGZB 2M0XA 3KLSX 5BMGA 3ML9A 2DZJA 3EFCA 2PVGC 2O2VB 3MHSD 2L76A 3KWVA 2IO0B 3PZ8A 1SB3C 1YIWA 2D2QA 5AZHA 2IYDB 2KLCA 4WIPA 2I2YA 3C0RB 4ICUA 2HJ1A 3A1QB 2JT4B 2KQ4X 1GG3A 4FLHA 4HJGE 1KOTA 1T0SC 1WXVA 2BYVE 4YXDB 4PT5A 1ESFA 2L1AA 4BKTA 1MG4A 1TKYA 3DHIC 1IYFA 1EF1A 4P1CC 4IG7B 2X38A 5GXGB 2JY6A 4IUMB 2XK5A 1IBXA 2NTSA 1PUTA 2DZMA 4J6IA 2HTME 3DBLI 4WWNA 1EUVB 3KUCB 3Q69A 1FCCC 3LYYA 3BYTB 4JLCA 3N32A 2KTFA 1FEHA 3AE2B 4W9KA 2WDQB 1R4MI 3FKYA 3VRAB 2LVOA 4EE2A 1J7BA 2L0TA 3P4QB 4W9IA 1EWCA 1QZEA 2Y5CA 5EE9A 4PK1A 3HM6X 3JSVA 3DVGX 2MA9B 2CHXA 1KJTA 3N1YC 4BBNC 4C56C 2JPHA 1F2RI 2K22A 2WXPA 3KUZA 3MC0B 4LNNA 3DOWA 3KQ4A 4I6NB 2DNFA 4KGSA 2JX5A 2DZKA 3DHGC 2CKHB 3P42A 4K7UA 4HRSA 2LVPA 2ZEQA 1TIFA 1SE9A 4RM9A 2WXGA 4XC2A 2EKEC 3MJ5A 2IY1B 4KKJA 1KFYB 3IXSA 3JW0X 1NENB 2KFJA 2LRWA 1XCTL 4ANUA 4GIVA 4EFOA 2RDBC 2KWDA 2WP9B 3ZJTA 2TSSA 2J42A 3T8MA 2D3GA 3QA8A 4ZRIA 5HI1A 3IG3A 2N9EB 3AE5B 2WDRB 2KHWB 1SSNA 2WS3B 2N9PC 5IKCM 1YJIA 4C4VA 1E8ZA 3Q3MC 1IP9A 2UU7A 3AMZA 3J9CA 4L1BA 3RCZA 4LNIA 3ML8A 3R3MA 1WGRA 3QAQA 1ROEA 1NI2A 5AUIA 3DBLB 3VTVA 1EF5A 1ZOYB 1ZDVA 4GDKB 1XXGA 3OLMD 3VFKA 4IWOA 3SEBA 1L0VB 1Z5SB 4C7ZA 3SD5A 1R4MB 5DPRA 1NYQA 4ZYNA 4TV3A 1F0ZA 1WF9A 1LO5D 3EUB2 2BPSA 2N7JA 2HE7A 3C8YA 5C1ZA 4RF1A 1P0RA 2GRIA 5LNK1 1ZPSA 1E5WA 3GE8C 3NS1A 4WJOA 4IWPA 4LDTD 4RMAA 4DHJD 3LB8C 4G50A 3UI3A 4HXDA 1PDXA 1YOVB 2M1MA 1L4DB 1RM6C 1AARA 4W9GA 1JRUA 5G55A 3ZKJC 3QARA 2MQJA 2WQYB 1WX9A 2MHJA 1T0QC 1Q5WB 3AECB 3O65B 4YSYB 2MJDA 3Q3JA 4KIKA 4K3BA 5H8YE 1SF0A 3TL5A 4ANXA 2CJOA 2IDYA 3VUXA 4KGTA 2J4XA 1E10A 2JVCA 4A3OA 4NAWB 2WGSA 1BXTA 2WXMA 3APCA 3GZNI 1OQQA 4GU2A 4ZHPA 3CIRB 2DWQA 1QLBB 3NOBA 1RFKA 3VTWA 3VHTC 1AWDA 2D5GA 5E6JA 1XEEA 2PVOD 2DX5B 4TUUA 2KZRA 1MHXA 3OAWA 3UF8A 2J0JA 3DVNV 4MACA 2LWPA 1V86A 2GBNA 2G45B 4KGRA 1EO6A 3HVZA 1Q1OA 3RD2A 1V1OA 1L4ZB 4XX5A 1RAXA 3BY4B 2KDEB 4C80A 3H7SA 4UDUC 4PS7A 1KF6B 1FXAA 4JX1C 2J0KA 3U2SC 2MEKA 1C4PA 2EELA 1XLNA 1WXSA 2KDIA 5L95C 3KYDD 2JWZA 4KZ0A 2ICIA 4MDKE 1KH0A 4OVZA 2I1JA 4ZDVA 3L08A 2ZVNA 3MTNB 5BYQA 3VR8B 4NAMA 4EOYA 2LXCA 3ZVVA 1YQBA 4TQ0A 4KSLC 3Q8BA 3UIOB 3MC8A 4OW0A 4KKIA 5IN7A 3UINB 3W1SC 2D11A 3AULA 2KTRB 3BWUD 3RYTA 3W2DA 5FK9C 2V3PA 1WGYA 2ZPNA 3R66C 1GC7A 2QC8A 4GDLA 2K8BA 4M0WB 1AYFA 2KX0A 3DCGA 4EZLA 1V80A 1SEBD 3AEAB 4FBJB 2D3BA 3N3KB 5C2TB 3GZNB 4EUTA 3ONSA 3IVFA 2BVCA 2G4SA 2O2VA 1HXYD 1M94A 2FUG1 1D4BA 3ZQ4A 2KO3A 4WWPA 3V6CB 2KVRA 3U8ZA 1J0GA 2HD5B 1GNUA 2REXA 2G4DB 2KC2A 2K1FA 3A1QA 3TMPB 1G6JA 2YLMA 1IGCA 2BB5A 2RDGA 4E71A 5JH5C 3R2IA 1WWTA 2KNBA 2KWVB 2WDTB 2Z0EB 2MJ3A 1WGDA 2ZNVB 1JW9D 2J53A 3WAOA 2KJHB 4O1NA 4KDLB 4CQNA 4BAXA 1RRBA 2JXXA 3RN9C 4C7YA 1TJEA 4HDQA 3B2GA 4LLGM 2XEWA 1E7VA 1A5RA 1TBEA 2LASA 1SJHD 4M02A 3TUOA 3DBHI 3AE7B 4PS3A 4AP4C 2VRRB 5DPWA 4IC7B 2UWQA 3ZUNA 2H88B 4M8NA 4MEMA 5LXHA 4CO7A 2N7DA 3PPAA 1P9DU 4DQOC 4YT0B 4LJPB 4JQWC 1WE7A 1E7PB 1J19A 2W3RA 4NQKE 3N9YC 5LLIA 3RZFA 3A33B 2M19A 4MELA 4HROA 1NBFC 5G5GA 2BS2B 3X23A 1KLUD 1FXTB 5AZFA 4WURA 2RD0A 1P98A 4BKSD 2JQRB 4XDDA 2L0FA 4XWTA 2LJIA 1LFDA 2KVZA 2WU2B 2MBOA 3VTUA 3JVZX 3ZJVA 4AUQC 2KOXA 3ETRA 5CX3A 4LCDE 2FCQA 3W9CB 2NPTB 3B08A 1GAQB 2ON8A 5BYSA 3DDCB 1E8YA 3JYUA 2N9LA 2VZKB 3AEEB 1TY2A 2IJ0A 4ACFA 4GXBA 5DPTA 3FAHA 2A5UA 5JZEB 2L52A 3MP9A 3EC8A 2PTLA 4A3PA 1Z2MA 2EMSA 2XNAC 4DXFA 4GDKA 1E9MA 1WJ6A 5TSSA 2DBYA 1F1HA 3OJ4B 3R7QA 4DDGD 1JALA 2WYQA 3DBHB 4HKQA 3ZIMA 3PRMB 3IT4B 1TT5B 3QK0A 2BT6A 2JYTA 1F2RC 1YMHE 4S17A 3QWZB 1C4AA 1SBBB 3A4SC 2QCZA 3A9JB 2RPQA 4KV2A 2Z0DB 2WU5B 2K6DB 1VR9A 1S3SG 4II3B 2BKFA 1XQQA 3KYCD 1QT9A 2AQ3B 3ZXVA 4BFRA 2YEPB 1C1YB 1MVKA 1E90A 2ZPYA 2KFKA 1RYJA 1BUIC 1QILA 5JXVA 2AL6A 3Q8CA 1EU4A 1E6EB 4JWUC 2K8HA 1J7AA 4II2B 3K9PB 2DENB 2V4IB 1V1PA 1GOZA 3ZNZB 2NVUI 1DGJA 1I7HA 2JRIB 2AYOB 2LHDA 3KWLA 2AEHA 2KN4A 5FR6A 3TSSA 1UH6A 2WXLA 2EKIA 3CSTA 1KM7A 2I1KA 2KANA 2R2QA 2IGHA 2ZZPB 4AJWA 3AE9B 4M8MA 4DXAB 1C9FA 2MCNB 1MG8A 3NJTA 1UZXB 2MJEA 3Q14C 4FJYA 2BW2A 1T3QA 4OZCA 4K3CA 2LMCA 1YQ4B 3R8BA 5G5HA 2JWUA 3W1YA 3ZRCA 3R2TA 3V62A 3NY5A 1PGAA 1E8WA 4GOCA 4WWMA 1XLOA 2NMQA 2BYEA 3NVVA 3HUIA 3B9JA 1H8CA 1ZGUB 1SE2A 3FILB 3ZNHB 4GN1A 2KC1A 2NR2A 3SFDB 4ZRPA 3AEBB 5EE0A 4W9DA 1M4VA 1OQYA 3TBLD 2AX5A 1WRIA 3Q3FA 1QKZA 3T3OA 1UWMA 3OWEB 1P7EA 3RI7C 2W54A 3PSEB 1WM3A 2WXRA 3PZ7A 1E7UA 4P6VF 1FXIA 4YTMB 2B3AA 3NS8A 1P7FA 2LXAA 1YX5B 5C3JB 3AB5A 1JWMD 4IM3A 5KHOA 3A9KB 1S1QB 2CJNA 1TS2A 3BVGA 2Q5WD 4BVUC 2WNMA 3ZTDA 1E8XA 1EWYC 3QIJA 2DLBA 2KTRA 1WFYA 3PV1A 2WLBA 1N63A 2FE8A 1DOYA 3PO0A 3IT6B 3Q2AC 1WM2A 1I4RA 4F1SA 4M0WA 1U4AA 5HHDG 1D5MC 5AEKB 3NZSA 3DWMA 4P7IA 1KLGD 3NRZA 2O6VB 1WMHB 1CQVA 2G9HD 2BTEA 3P4SB 1WI0A 4Q2JA 1K51A 3LXFA 2K39A 4MGKE 2BGFA 1WR6E 2PKOA 1Q10A 2BWES 3CWIA 4RH6A 4RM8A 3APFA 1HE8A 2QHOA 3AEDB 3ZDTA 4YTPB 1YN3A 3VXWA 2OOBB 3AH7A 1YJJA 1GC6A 2K0PA 2R2OA 4ZRQA 4F7ZA 1FPYA 2G1EA 5AZGA 2XN9C 4K81A 3VR9B 2L7RA 2WX0A 1HEZE 5J2RA 5MPOA 1BT0A 2M56B 2FAZA 1ET6A 2GB1A 4E74A 4W9HA 2PLPA 2EMTA 3PLUA 2CS4A 1WZ0A 4K1RB 1MHHE 4ITKA 2MX2A 2ZCBA 3U7ZA 4HVBA 3EGRA 2QJLA 2CR5A 3VVWB 3TEYA 4N58A 2MP2A 1I4PA 4US9A 4NQLB 1FM0D 1ET9A 3ZYYX 2M17A 2KAJA 4XGAB 3ZLZA 3PREA 1I4HA 1WE6A 3B0AA 1V2YA 2KJ6A 1XF5L 2D3AA 2WX1A 1FNVA 2JSVX 5LXIB 2LD9A 2KD0A 4WJNA 2B76B 3L17A 4A9AA 4IOIE 2W9NA 4EZKA 4E3CA 1NYRA 4IM0A 3PLVA 4NJ6A 4F8CB 2NPTA 3MC9A 1TTNA 1HTQA 1KLVA 4BOSC 2LI5A 5J18A 2V0GA 4B9KA 1SIFA 3TIXA 2R61A 4QAYA 4CYEA 3Q8AA 1LM8B 1MI0A 2J0MA 5H92C 2HDEA 4DWFA 4FULA 4A90A 3AI5A 1C76A 1WR1A 3H9DA 1NVID 4EEWA 5IO9A 1HA5A 5FKAC 2MBHA 4JWSC 1KTKA 1GPXA 3JSVB 1D6EC 2L05A 2LVQA 1GB4A 4BZAA 1Y56A 3IFWB 3VDZA 2BKRB 3RZWC 2RR9A 4OHJA 1UF0A 1WX7A 1LQBA 2YEPF 2IY0B 3BK2A 2JF5A 3AE3B 2C7NB 4N59A 5E6PA 4MJSA 1D3ZA 3T3NA 3B1LX 5D94A 4ANWA 3EHVA 4GMVA 2KN5A 2L32A 3H8HA 2WXFA 3QQ8B 3WIMA 2PE9A 2WXOA 3H7PB 4LNFA 5HKHA 2JZ3B 4HWIB 3BINA 2CU3A 1R4NB 4OVVA 1ISNA 2QEJC 5GMVA 1IGDA 2IGGA 2N9KA 3PRZA 3W1SA 2GBJA 4BKGA 3ALBA 4IW0A 5EDSA 4LJOB 4GLSC 2MBEA 3AE8B 2KLGA 1PGXA 3QJZA 1QOBA 3RPFC 4BKSA 4S0RA 3QX1A 1N60A 2QDFA 1QOGA 4KX6B 3ZXRA 1RFAA 4MH8A 4MGZE 1WH3A 2VZKD 4TMAB 3URYA 2M0AA 2WDVB 1VLBA 1GB1A 1XCQL 2OHFA 4W9LA 4IDIA 2KMAA 3NVZA 2SEBD 1PQSA 2C7MB 3M95A 1C79A 1WXAA 4YWGG 4XZ4A 1SE4A 2BYFA 3MJWA 4FJVB 1F52A 2V9HA 2Y5PA 3AM9A 4RGTA 2WWZA 2KMCA 1X1MA 3RNAC 3DWGC 2V3NA 1WX8A 2LHEA 4B0MA 4DHZB 4P1BC 3VRBB 1PGBA 4RGMA 2A4ZA 3GP7A 4C00A 1J8CA 4DHZE 3OJ3A 3I57A 3BYYB 2KDBA 3L13A 4HLEA 1WIAA 3FILA 3PVLA 1QOFA 3VH4B 4RNAA 1DYQA 2FIDA 3VH3B 2KX3A 1K52A 4I6LB 1WZ3A 1FNWA 4IM2A 2JZZA 2IPKD 1NEKB 4K7SA 4OZAA 4NPNA 3TEXA 4AOFA 2UYZB 1QF6A 4WWOA 2HTHA 1GUAB 2GBRA 2M8SA 4XE0A 2MWSB 1FRRA 4JE3B 1VD2A 3D32A 3ZDMC 2BBCA 2WXHA 4ZRKA 2RSUA 3A9KA 1WY8A 1WYWB 2N0SB 4MH0E 1I42A 1UNSA 3AEFB 5J17A 1WGGA 1FCLA 3SHQA 1WXQA 1K8RB 2KK8A 3L54A 4LTUA 1TZOA 1WRDB 3U7DA 2L3ZA 1V5OA 1UD7A 1CK1A 3CSFA 1FO4A 1Q0WB 1T0YA 2PEAA 3L0WB 1C78A 1JWUD 1C4CA 2BS4B 2VH1A 2O6VA 1WMHA 2KYWA 1D5XC 2K5PA 1YNTE 4HKZE 1JCKB 4OVUA 3R7RA 3WANA 3M3JA 5IAAC 3PTFC 3P4RB 4ASWC 4MM3B 2FBWB 3UGBB 1V81A 3WAPA 1DOXA 4IKGA 2WHIA 2MW5A 3GE3C 3ZNID 1TS5A 2FCSA 1ZXHA 1WJ4A 3SDLC 1STEA 3IAM1 4BOZB 3DVGY 3AU4A 1V9JA 2RMMA 2K9XA 3WAMA 3DPDA 4ZHOA 1N5XA 1ZUD2 5IOIA 4PS8A 1FIQA 4ARCA 1AN8A 5BMHA 4FJZA 1F77A 3B2FA 1FNUA 1HZ5A 1SJED 1SE3A 1YJ1A 2OJRA 1GJZA 2C5LC 2HJ8A 1VZ6A 3ZJUA 1VJKA 1YD8U 1TS3A 2W3SA 2INNE 2CHZA 3W5VB 3RT3B 5BO4B 2W82A 2DAJA 3AE6B 2Z59B 3ZRFA 2MBBB 3TEZA 3N1XC 4NAWA 1QQRA 2PE6B 1N5WA 1V8CA 4TQ1A 2O6VD 4HPPA 2MLBA 4EKUA 3APDA 5FR3A 3QCAA 4DXGA 3EECA 3RMKC 3KVFB 1TY0A 4REZA 4B0EA 3L4PA 1HTOA 2G3QB 3Q8FA 4FADA 2ZW1A 2DZIA 1TKEA 3NZUA 4NNJB 4P16A 2FUHB 2ONQA 4YSXB 2D3CA 1P1AA 3OG5A 2BS3B 3PRPB 4I6PA 5T8IA 4A8XC 2X8XX 4L23A 3UQAA 2PJHA 1OFFA 1YQ3B 2L8JA 2LGYA 1XD3B 4DBGA 4PYZA 2N9XA 5AUKA 3HK0A 1FD6A 4HCPB 4B95A 4AWJA 1K50A 3ABVB 4KSKC 5D3DA 3I5JC 3S2AA 1JQ4A 1ZDXA 3ZW3A 1B1ZA 2NBWB 4AJYB 2D07B 3BZDB 1UGJA 2ZJDA 2L83A 5C23A 4BBNF 2K6QA 1ZXIA 4B6WA 1T5XD 5DCNA 2AQ1B 1P3QU 2JRHA 1OEYA 3T9LA 3CMMB 4KDIC 1I35A 3N1ZC 1YN5A 3V05A 2KKCA 1WSPA 4NY0A 1UGMA 2JZPA 1L0XB 4US8A 2WXQA 1ZE3D 5CTRC 2INPE 2BQQA 1V5TA 2KQ7A 3H7PA 4J3OD 4FA6A 1ZP0B 1T0RC 4MGYE 1UELA 2ZVOA 3PZDA 4YSZB 1PYWD 4DK5A 3RFZB 4K7WA 2FNJB 5D2MB 4AQ7A 2WXIA 1UBQA 3H1UA 3FC4A 5BMIA 3ECIA 2LGDA 3QC8B 1JWAD 3RNEC 2V3SA 1LGRA 4HPLB 4IWQA 4A20A 1C77A 1V49A 1JROA 2LUMA 3SR6A 1H4RA 2ZNVC 2QMTA 4NZLB 2N7EA 1XLQA 4JPSA 1TKGA 3BVZA 2BYTA 2CU1A 2KMMA 3IAS1 1LXDA 1CMXB 2LGSA 3N30A 3NHEB 1L6UA 5I4DA 4D2KA 3RNFC 2KXJA 5D3IB 4ZRJA 3RULA 1L7YA 4MT5A 3SU8X 3TCAA 4YTNB 3X0WA 1ENFA 5IA7A 1OQRA 2FCMA 2DYOA 1E0ZA 2PPHA 2J7QB 4JIOU 1NDDA 3PHWB 4FN2A 2N1WA 3HIZA 3DBRI 2YVCA 1ACCA 3P1MA 1FFUA 2C9WB 2GOWA 1CJEA 1TZ1A 2KQSA 4RGNA 2BWFA 1WXMA 2KACA 3V3XA 2FCNA 4RGOS 1OTRB 1TS4A 1HQRD 2Y3AA 5JHBA 1SGHA 1Y8RC 1EM7A 3KH0A 2D10A 3ENEA 1OEYJ 2KFKB 1HZ6A 2PW9A 2RPVA 4PYUA 5E6NA 1R4NI 1V1PB 1BMLC 3UIPB 1N61A 3K9OB 4HDOA 2ZCCA 1JMLA 3P2BA 1L2NA 4HJKA 3AE1B 2W55A 3U52E 2K3UA 2RGFA 1D5ZC 4JL9A 4TSSA 1IUEA 5DPSA 3ZO5B 2GBKA 1V6EA 2PMVA 1I4GA 3H6NA 2RDHA 3NG0A 2BF8B 4NJCA 2KWUB 2XK5B 2WXKA 1MFWA 4USAA 1IBXB
chains in the Genus database with same CATH topology
4II3B 2BKFA 1WX8A 1XQQA 3M62B 3VUYA 2LRUA 4DHZB 3KYCD 5CHWA 5JHAA 3JW0X 2NS5A 4BFRA 1C1YB 1E90A 2KFJA 2LRWA 2ZPYA 4ANUA 2KFKA 4GIVA 4EFOA 3DBSA 3V6EB 2A4ZA 2AL6A 2K25A 2K8HA 3T8MA 2D3GA 3K9PB 2DAFA 2DENB 3LJ3A 3QA8A 4II2B 4ZRIA 3OJ3A 3IG3A 2NVUI 3ZNZB 4DHZE 3QHTA 2N9EB 2JRIB 2K8CA 2KDBA 2AYOB 3L13A 4G11A 2KHWB 4HLEA 2AEHA 2FIFA 4FHJA 1WIAA 5FR6A 3PVLA 2N9PC 3VH4B 1E8ZA 2FIDA 1IP9A 3U30A 3IHPC 4NJ7A 1UH6A 3RCZA 1WJNA 3VH3B 3CSTA 2KX3A 1KM7A 3ML8A 4GB9A 4I6LB 1WZ3A 2I1KA 3R3MA 4MM3A 1WGRA 3QAQA 4URKA 3I3TB 3PHXB 1NI2A 2KANA 2JZZA 4IM2A 3VTVA 1EF5A 4FHKA 2R2QA 4GDKB 4K7SA 3OLMD 3VAWA 2DHZA 4NPNA 3VFKA 2ZZPB 4IWOA 2UYZB 4AOFA 4WWOA 4AJWA 2HTHA 1GUAB 3RUIB 1Z5SB 2GBRA 4TKNA 4MSQB 3SD5A 3UQBA 2M8SA 3A9JA 4M8MA 2ASQA 4W9FA 4DXAB 2MWSB 5DPRA 4LDTB 3M63B 4ZYNA 4TV3A 1VD2A 1WF9A 3D32A 4DHJB 3PS6A 4N9F4 5CHFA 2MCNB 1MG8A 3ZDMC 4W9CA 1UZXB 4ZRKA 2RSUA 2BPSA 3A9KA 4FJYA 1WY8A 1WYWB 5E6OA 3VQIA 3DQVA 3A4RA 5KHQA 2HE7A 3PT2B 5C1ZA 4MH0E 1I42A 4WAAA 5J17A 1WGGA 2KDFB 2KJRA 1P0RA 3SHQA 2IBIB 1E5WA 1K8RB 4WJOA 4WJQA 2KK8A 3L54A 3PGEA 1XT9B 4IWPA 4LDTD 1WRDB 3U7DA 4RMAA 2L3ZA 4DHJD 3HHMA 1V5OA 4G50A 1UD7A 4HXDA 3CSFA 2DYMA 1Q0WB 2M1MA 3W1YA 1T0YA 2PEAA 3ZRCA 3V62A 3NY5A 3L0WB 1AARA 1E8WA 4GOCA 3WA0A 4W9GA 2MBQA 1ZKHA 1JRUA 5G55A 2O6VA 2BYEA 1WMHA 1ZW7A 3KW5B 3QARA 3ZKJC 2C60A 2IO3B 2MQJA 4KZCA 1H8CA 1WX9A 1ZGUB 4HK2A 5D7GA 1WGHA 1Q5WB 3ZNHB 4GN1A 2KC1A 5TR5A 3O65B 1F9JA 4OVUA 2NR2A 3R7RA 3WANA 3M3JA 3Q3JA 4KIKA 5IAAC 3PTFC 4ASWC 4W9DA 3TBLD 1OQYA 3WALA 3TL5A 4ANXA 3Q3FA 3VUXA 3UGBB 1V81A 2JVCA 3WAPA 3GOEA 4HCNB 4NAWB 4A3OA 3PSEB 1WM3A 1E7UA 2NBUA 3APCA 2MW5A 3ZNID 3GZNI 4GU2A 2FCSA 2B3AA 3NS8A 2LXAA 3CF6E 1WJ4A 4JGHB 4YL8A 5D6JB 3SDLC 4BOZB 1YX5B 5KHOA 4IM3A 3NOBA 3DVGY 3A9KB 3AU4A 1V9JA 1S1QB 3IBEA 3WAMA 3DPDA 2Y5BB 3VTWA 3VHTC 4BVUC 2CHWA 3ZTDA 1E8XA 2GMIC 3QIJA 4PS8A 2C7HA 1WFYA 2KTRA 1RLFA 3L16A 3PV1A 4FJZA 2DX5B 4CHKA 4WQOB 4TUUA 2M4NA 2KZRA 1WM2A 4F1SA 3OAWA 3UF8A 2J0JA 1YJ1A 1U4AA 4GSWA 3DVNV 2OJRA 1GJZA 2C5LC 4HPMB 2LWPA 2HJ8A 1YD8U 2IZVB 5AEKB 3NZSA 4ANVA 1V86A 4P7IA 2CHZA 2GBNA 3ZNGC 2AL3A 2G45B 2O6VB 3L10B 1UBIA 2KWCA 1WMHB 3RT3B 1EO6A 5BO4B 1IPGA 1Q1OA 3RD2A 1WI0A 2DAJA 2Z59B 3ZRFA 2MBBB 2MP2B 4XX5A 1RAXA 3BY4B 2K39A 4MGKE 2KDEB 3LDZE 4W9EA 2BGFA 4NAWA 1WR6E 2BWES 2XBBC 3H7SA 4RM8A 4KIKB 3APFA 4PS7A 2PE6B 1HE8A 4TQ1A 2J0KA 2O6VD 4EZJA 2MLBA 2QHOA 4EKUA 3APDA 1WJUA 3QCAA 3ZDTA 1WXSA 3VXWA 2KDIA 2OOBB 3KYDD 3EECA 5L95C 2JWZA 4KZ0A 3KVFB 1YX6B 3AU5A 1GC6A 4MDKE 2R2OA 2I1JA 4ZDVA 2MSED 3L08A 2G3QB 2ZVNA 3MTNB 4KVGB 4F7ZA 4FADA 1OGWA 2DZIA 5AZGA 1C3TA 4K81A 4EOYA 3NZUA 4G0NB 2LXCA 4NNJB 3V61A 2FUHB 3ZVVA 1YQBA 2L7RA 2WX0A 1P1AA 3AXCA 4TQ0A 2V1YA 2LJ5A 3PRPB 4I6PA 4KSLC 5J2RA 3UIOB 2JUOA 1BT0A 2IO1B 3UINB 3W1SC 3EFUA 2D11A 2FAZA 4GGQA 3UQAA 2PJHA 2KTRB 3AULA 3RYTA 1WGYA 2L8JA 4E74A 2ZPNA 5CHVC 4W9HA 2LGYA 2EMTA 3PLUA 1GC7A 1VCBA 1WZ0A 1XD3B 2CS4A 3R66C 4K1RB 3TJPA 4DBGA 4GDLA 2MX2A 2ZCBA 2K8BA 2N9XA 4PYZA 4M0WB 4ICVA 4HVBA 2KX0A 3HK0A 3DCGA 2CR5A 4HCPB 4B95A 1V80A 4EZLA 3VVWB 4AWJA 2N1VA 4FBJB 2L00B 2MP2A 3N3KB 4KSKC 4NQLB 2V4LA 4EUTA 1J8CA 3ONSA 3IVFA 3S2AA 2G4SA 4DDID 2O2VA 1M94A 3ZW3A 2GBMA 2NCNA 2NBWB 2M17A 2LZ6A 4AJYB 2AWTA 2D07B 2KO3A 4WWPA 3V6CB 2KVRA 3PREA 3U8ZA 3ZLZA 2ZJDA 1J0GA 4W9JA 2HD5B 5C23A 4BBNF 1WE6A 2K6QA 1GNUA 2REXA 2NBVB 3B0AA 1V2YA 2KJ6A 2WX1A 4B6WA 2G4DB 2KC2A 2K1FA 3A1QA 5DCNA 1P3QU 2JRHA 1OEYA 3DVNU 3T9LA 3CMMB 4KDIC 5LXIB 1I35A 3TMPB 1G6JA 2YLMA 4G3XB 2LD9A 2KD0A 4WJNA 4E71A 2KKCA 2MRPA 3L17A 5JH5C 2KNBA 2KWVB 2WDTB 4X57B 3HM3A 2LGXA 2W9NA 2Z0EB 4MGIE 4NY0A 1UGMA 4EZKA 4E3CA 1WGDA 2ZNVB 4IM0A 3WAOA 3PLVA 2KJHB 4NJ6A 4F8CB 2LUEA 4KDLB 5CTRC 5LXHA 1RRBA 2JXXA 3ZTCA 1V5TA 2NPTA 4MJSB 2KQ7A 3H7PA 4HDQA 1TTNA 4FA6A 2XEWA 1E7VA 1KLVA 5L83A 4BOSC 1A5RA 2LI5A 3KUDB 5J18A 1TBEA 4MGYE 1UELA 2ZVOA 3PZDA 4B9KA 4WJPA 2IO2B 2LASA 4DK5A 1SIFA 3TIXA 2N4FA 3DBHI 5G2NA 4K7WA 2FNJB 5D2MB 4PS3A 3VUWA 4AP4C 3V60A 4CYEA 2VRRB 1UBQA 4GDLB 1LM8B 4MSMB 3H1UA 5DPWA 4IC7B 2DYBA 2J0MA 3ECIA 2LGDA 2UWQA 3QC8B 3ZUNA 4DWFA 2V3SA 1TGZB 4HPLB 2M0XA 4FULA 3AI5A 4IWQA 1V49A 4MEMA 4M8NA 2N7DA 4A20A 4CO7A 1WR1A 3PPAA 3H9DA 1P9DU 4EEWA 3ML9A 1H4RA 2DZJA 4LJPB 4JQWC 1WE7A 2O2VB 2ZNVC 2MBHA 3MHSD 1J19A 2N7EA 2L76A 2IO0B 4NQKE 1YIWA 5LLIA 3RZFA 3A33B 2CU1A 3JSVB 2D2QA 5AZHA 2IYDB 1LXDA 2L05A 2KLCA 4MELA 2LVQA 1CMXB 1NBFC 3N30A 3NHEB 3IFWB 3C0RB 2BKRB 3VDZA 4ICUA 3RZWC 3A1QB 2JT4B 2RR9A 3X23A 1GG3A 4FLHA 1FXTB 1LQBA 1WX7A 5AZFA 2IY0B 2RD0A 1P98A 2JF5A 1KOTA 2KXJA 2C7NB 4ZRJA 1WXVA 4BKSD 3RULA 1L7YA 2BYVE 5E6PA 3SU8X 4BKTA 3TCAA 4MJSA 1D3ZA 2L0FA 3X0WA 1IYFA 1LFDA 3VTUA 2MBOA 5IA7A 1EF1A 2FCMA 3B1LX 4IG7B 5D94A 4ANWA 3EHVA 2DYOA 3JVZX 4GMVA 4AUQC 2JY6A 4IUMB 2KOXA 2KN5A 5CX3A 2XK5A 2PPHA 2J7QB 4LCDE 2FCQA 3QQ8B 3WIMA 4JIOU 1NDDA 2DZMA 2NPTB 3PHWB 4J6IA 4FN2A 2PE9A 5HKHA 3H7PB 3B08A 2JZ3B 2N1WA 3DBLI 4WWNA 1EUVB 3HIZA 3DBRI 2YVCA 3BINA 3KUCB 4HWIB 4OVVA 1ISNA 2C9WB 2GOWA 3N32A 1TZ1A 2KTFA 4JLCA 2KQSA 5GMVA 3DDCB 1E8YA 2BWFA 1WXMA 4W9KA 2FCNA 3JYUA 1R4MI 1OTRB 3PRZA 3W1SA 2GBJA 2LVOA 4BKGA 5JHBA 3ALBA 4IW0A 2L0TA 1SGHA 1Y8RC 5EDSA 3KH0A 4LJOB 2MBEA 2D10A 2KLGA 3ENEA 1OEYJ 2KFKB 3QJZA 4W9IA 4BKSA 1QZEA 4GXBA 4PYUA 5DPTA 2A5UA 3HM6X 5JZEB 3QX1A 3JSVA 5E6NA 1R4NI 3EC8A 1RFAA 3DVGX 3UIPB 4MGZE 4A3PA 3K9OB 1WH3A 4HDOA 2MA9B 2CHXA 1KJTA 1Z2MA 2EMSA 2ZCCA 4BBNC 2JPHA 3P2BA 4GDKA 1L2NA 1WJ6A 3KUZA 4HJKA 4W9LA 2KMAA 3OJ4B 3R7QA 3DOWA 4DDGD 2RGFA 2WYQA 4JL9A 4I6NB 3ZIMA 3PRMB 1PQSA 2C7MB 5DPSA 3M95A 3ZO5B 3QK0A 2DZKA 2CKHB 1WXAA 4K7UA 4XZ4A 2LVPA 2ZEQA 3QWZB 2BYFA 2GBKA 1SE9A 1V6EA 3MJWA 4FJVB 3A4SC 4RM9A 4XC2A 2EKEC 3A9JB 3H6NA 2RPQA 4KV2A 2BF8B 2Z0DB 2WWZA 2KMCA 2KWUB 1X1MA 2XK5B 2K6DB 1S3SG 2IY1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II3 B;  2BKF A;  1WX8 A;  1XQQ A;  3M62 B;  3VUY A;  2LRU A;  4DHZ B;  3KYC D;  5CHW A;  5JHA A;  3JW0 X;  2NS5 A;  4BFR A;  1C1Y B;  1E90 A;  2KFJ A;  2LRW A;  2ZPY A;  4ANU A;  2KFK A;  4GIV A;  4EFO A;  3DBS A;  3V6E B;  2A4Z A;  2AL6 A;  2K25 A;  2K8H A;  3T8M A;  2D3G A;  3K9P B;  2DAF A;  2DEN B;  3LJ3 A;  3QA8 A;  4II2 B;  4ZRI A;  3OJ3 A;  3IG3 A;  2NVU I;  3ZNZ B;  4DHZ E;  3QHT A;  2N9E B;  2JRI B;  2K8C A;  2KDB A;  2AYO B;  3L13 A;  4G11 A;  2KHW B;  4HLE A;  2AEH A;  2FIF A;  4FHJ A;  1WIA A;  5FR6 A;  3PVL A;  2N9P C;  3VH4 B;  1E8Z A;  2FID A;  1IP9 A;  3U30 A;  3IHP C;  4NJ7 A;  1UH6 A;  3RCZ A;  1WJN A;  3VH3 B;  3CST A;  2KX3 A;  1KM7 A;  3ML8 A;  4GB9 A;  4I6L B;  1WZ3 A;  2I1K A;  3R3M A;  4MM3 A;  1WGR A;  3QAQ A;  4URK A;  3I3T B;  3PHX B;  1NI2 A;  2KAN A;  2JZZ A;  4IM2 A;  3VTV A;  1EF5 A;  4FHK A;  2R2Q A;  4GDK B;  4K7S A;  3OLM D;  3VAW A;  2DHZ A;  4NPN A;  3VFK A;  2ZZP B;  4IWO A;  2UYZ B;  4AOF A;  4WWO A;  4AJW A;  2HTH A;  1GUA B;  3RUI B;  1Z5S B;  2GBR A;  4TKN A;  4MSQ B;  3SD5 A;  3UQB A;  2M8S A;  3A9J A;  4M8M A;  2ASQ A;  4W9F A;  4DXA B;  2MWS B;  5DPR A;  4LDT B;  3M63 B;  4ZYN A;  4TV3 A;  1VD2 A;  1WF9 A;  3D32 A;  4DHJ B;  3PS6 A;  4N9F 4;  5CHF A;  2MCN B;  1MG8 A;  3ZDM C;  4W9C A;  1UZX B;  4ZRK A;  2RSU A;  2BPS A;  3A9K A;  4FJY A;  1WY8 A;  1WYW B;  5E6O A;  3VQI A;  3DQV A;  3A4R A;  5KHQ A;  2HE7 A;  3PT2 B;  5C1Z A;  4MH0 E;  1I42 A;  4WAA A;  5J17 A;  1WGG A;  2KDF B;  2KJR A;  1P0R A;  3SHQ A;  2IBI B;  1E5W A;  1K8R B;  4WJO A;  4WJQ A;  2KK8 A;  3L54 A;  3PGE A;  1XT9 B;  4IWP A;  4LDT D;  1WRD B;  3U7D A;  4RMA A;  2L3Z A;  4DHJ D;  3HHM A;  1V5O A;  4G50 A;  1UD7 A;  4HXD A;  3CSF A;  2DYM A;  1Q0W B;  2M1M A;  3W1Y A;  1T0Y A;  2PEA A;  3ZRC A;  3V62 A;  3NY5 A;  3L0W B;  1AAR A;  1E8W A;  4GOC A;  3WA0 A;  4W9G A;  2MBQ A;  1ZKH A;  1JRU A;  5G55 A;  2O6V A;  2BYE A;  1WMH A;  1ZW7 A;  3KW5 B;  3QAR A;  3ZKJ C;  2C60 A;  2IO3 B;  2MQJ A;  4KZC A;  1H8C A;  1WX9 A;  1ZGU B;  4HK2 A;  5D7G A;  1WGH A;  1Q5W B;  3ZNH B;  4GN1 A;  2KC1 A;  5TR5 A;  3O65 B;  1F9J A;  4OVU A;  2NR2 A;  3R7R A;  3WAN A;  3M3J A;  3Q3J A;  4KIK A;  5IAA C;  3PTF C;  4ASW C;  4W9D A;  3TBL D;  1OQY A;  3WAL A;  3TL5 A;  4ANX A;  3Q3F A;  3VUX A;  3UGB B;  1V81 A;  2JVC A;  3WAP A;  3GOE A;  4HCN B;  4NAW B;  4A3O A;  3PSE B;  1WM3 A;  1E7U A;  2NBU A;  3APC A;  2MW5 A;  3ZNI D;  3GZN I;  4GU2 A;  2FCS A;  2B3A A;  3NS8 A;  2LXA A;  3CF6 E;  1WJ4 A;  4JGH B;  4YL8 A;  5D6J B;  3SDL C;  4BOZ B;  1YX5 B;  5KHO A;  4IM3 A;  3NOB A;  3DVG Y;  3A9K B;  3AU4 A;  1V9J A;  1S1Q B;  3IBE A;  3WAM A;  3DPD A;  2Y5B B;  3VTW A;  3VHT C;  4BVU C;  2CHW A;  3ZTD A;  1E8X A;  2GMI C;  3QIJ A;  4PS8 A;  2C7H A;  1WFY A;  2KTR A;  1RLF A;  3L16 A;  3PV1 A;  4FJZ A;  2DX5 B;  4CHK A;  4WQO B;  4TUU A;  2M4N A;  2KZR A;  1WM2 A;  4F1S A;  3OAW A;  3UF8 A;  2J0J A;  1YJ1 A;  1U4A A;  4GSW A;  3DVN V;  2OJR A;  1GJZ A;  2C5L C;  4HPM B;  2LWP A;  2HJ8 A;  1YD8 U;  2IZV B;  5AEK B;  3NZS A;  4ANV A;  1V86 A;  4P7I A;  2CHZ A;  2GBN A;  3ZNG C;  2AL3 A;  2G45 B;  2O6V B;  3L10 B;  1UBI A;  2KWC A;  1WMH B;  3RT3 B;  1EO6 A;  5BO4 B;  1IPG A;  1Q1O A;  3RD2 A;  1WI0 A;  2DAJ A;  2Z59 B;  3ZRF A;  2MBB B;  2MP2 B;  4XX5 A;  1RAX A;  3BY4 B;  2K39 A;  4MGK E;  2KDE B;  3LDZ E;  4W9E A;  2BGF A;  4NAW A;  1WR6 E;  2BWE S;  2XBB C;  3H7S A;  4RM8 A;  4KIK B;  3APF A;  4PS7 A;  2PE6 B;  1HE8 A;  4TQ1 A;  2J0K A;  2O6V D;  4EZJ A;  2MLB A;  2QHO A;  4EKU A;  3APD A;  1WJU A;  3QCA A;  3ZDT A;  1WXS A;  3VXW A;  2KDI A;  2OOB B;  3KYD D;  3EEC A;  5L95 C;  2JWZ A;  4KZ0 A;  3KVF B;  1YX6 B;  3AU5 A;  1GC6 A;  4MDK E;  2R2O A;  2I1J A;  4ZDV A;  2MSE D;  3L08 A;  2G3Q B;  2ZVN A;  3MTN B;  4KVG B;  4F7Z A;  4FAD A;  1OGW A;  2DZI A;  5AZG A;  1C3T A;  4K81 A;  4EOY A;  3NZU A;  4G0N B;  2LXC A;  4NNJ B;  3V61 A;  2FUH B;  3ZVV A;  1YQB A;  2L7R A;  2WX0 A;  1P1A A;  3AXC A;  4TQ0 A;  2V1Y A;  2LJ5 A;  3PRP B;  4I6P A;  4KSL C;  5J2R A;  3UIO B;  2JUO A;  1BT0 A;  2IO1 B;  3UIN B;  3W1S C;  3EFU A;  2D11 A;  2FAZ A;  4GGQ A;  3UQA A;  2PJH A;  2KTR B;  3AUL A;  3RYT A;  1WGY A;  2L8J A;  4E74 A;  2ZPN A;  5CHV C;  4W9H A;  2LGY A;  2EMT A;  3PLU A;  1GC7 A;  1VCB A;  1WZ0 A;  1XD3 B;  2CS4 A;  3R66 C;  4K1R B;  3TJP A;  4DBG A;  4GDL A;  2MX2 A;  2ZCB A;  2K8B A;  2N9X A;  4PYZ A;  4M0W B;  4ICV A;  4HVB A;  2KX0 A;  3HK0 A;  3DCG A;  2CR5 A;  4HCP B;  4B95 A;  1V80 A;  4EZL A;  3VVW B;  4AWJ A;  2N1V A;  4FBJ B;  2L00 B;  2MP2 A;  3N3K B;  4KSK C;  4NQL B;  2V4L A;  4EUT A;  1J8C A;  3ONS A;  3IVF A;  3S2A A;  2G4S A;  4DDI D;  2O2V A;  1M94 A;  3ZW3 A;  2GBM A;  2NCN A;  2NBW B;  2M17 A;  2LZ6 A;  4AJY B;  2AWT A;  2D07 B;  2KO3 A;  4WWP A;  3V6C B;  2KVR A;  3PRE A;  3U8Z A;  3ZLZ A;  2ZJD A;  1J0G A;  4W9J A;  2HD5 B;  5C23 A;  4BBN F;  1WE6 A;  2K6Q A;  1GNU A;  2REX A;  2NBV B;  3B0A A;  1V2Y A;  2KJ6 A;  2WX1 A;  4B6W A;  2G4D B;  2KC2 A;  2K1F A;  3A1Q A;  5DCN A;  1P3Q U;  2JRH A;  1OEY A;  3DVN U;  3T9L A;  3CMM B;  4KDI C;  5LXI B;  1I35 A;  3TMP B;  1G6J A;  2YLM A;  4G3X B;  2LD9 A;  2KD0 A;  4WJN A;  4E71 A;  2KKC A;  2MRP A;  3L17 A;  5JH5 C;  2KNB A;  2KWV B;  2WDT B;  4X57 B;  3HM3 A;  2LGX A;  2W9N A;  2Z0E B;  4MGI E;  4NY0 A;  1UGM A;  4EZK A;  4E3C A;  1WGD A;  2ZNV B;  4IM0 A;  3WAO A;  3PLV A;  2KJH B;  4NJ6 A;  4F8C B;  2LUE A;  4KDL B;  5CTR C;  5LXH A;  1RRB A;  2JXX A;  3ZTC A;  1V5T A;  2NPT A;  4MJS B;  2KQ7 A;  3H7P A;  4HDQ A;  1TTN A;  4FA6 A;  2XEW A;  1E7V A;  1KLV A;  5L83 A;  4BOS C;  1A5R A;  2LI5 A;  3KUD B;  5J18 A;  1TBE A;  4MGY E;  1UEL A;  2ZVO A;  3PZD A;  4B9K A;  4WJP A;  2IO2 B;  2LAS A;  4DK5 A;  1SIF A;  3TIX A;  2N4F A;  3DBH I;  5G2N A;  4K7W A;  2FNJ B;  5D2M B;  4PS3 A;  3VUW A;  4AP4 C;  3V60 A;  4CYE A;  2VRR B;  1UBQ A;  4GDL B;  1LM8 B;  4MSM B;  3H1U A;  5DPW A;  4IC7 B;  2DYB A;  2J0M A;  3ECI A;  2LGD A;  2UWQ A;  3QC8 B;  3ZUN A;  4DWF A;  2V3S A;  1TGZ B;  4HPL B;  2M0X A;  4FUL A;  3AI5 A;  4IWQ A;  1V49 A;  4MEM A;  4M8N A;  2N7D A;  4A20 A;  4CO7 A;  1WR1 A;  3PPA A;  3H9D A;  1P9D U;  4EEW A;  3ML9 A;  1H4R A;  2DZJ A;  4LJP B;  4JQW C;  1WE7 A;  2O2V B;  2ZNV C;  2MBH A;  3MHS D;  1J19 A;  2N7E A;  2L76 A;  2IO0 B;  4NQK E;  1YIW A;  5LLI A;  3RZF A;  3A33 B;  2CU1 A;  3JSV B;  2D2Q A;  5AZH A;  2IYD B;  1LXD A;  2L05 A;  2KLC A;  4MEL A;  2LVQ A;  1CMX B;  1NBF C;  3N30 A;  3NHE B;  3IFW B;  3C0R B;  2BKR B;  3VDZ A;  4ICU A;  3RZW C;  3A1Q B;  2JT4 B;  2RR9 A;  3X23 A;  1GG3 A;  4FLH A;  1FXT B;  1LQB A;  1WX7 A;  5AZF A;  2IY0 B;  2RD0 A;  1P98 A;  2JF5 A;  1KOT A;  2KXJ A;  2C7N B;  4ZRJ A;  1WXV A;  4BKS D;  3RUL A;  1L7Y A;  2BYV E;  5E6P A;  3SU8 X;  4BKT A;  3TCA A;  4MJS A;  1D3Z A;  2L0F A;  3X0W A;  1IYF A;  1LFD A;  3VTU A;  2MBO A;  5IA7 A;  1EF1 A;  2FCM A;  3B1L X;  4IG7 B;  5D94 A;  4ANW A;  3EHV A;  2DYO A;  3JVZ X;  4GMV A;  4AUQ C;  2JY6 A;  4IUM B;  2KOX A;  2KN5 A;  5CX3 A;  2XK5 A;  2PPH A;  2J7Q B;  4LCD E;  2FCQ A;  3QQ8 B;  3WIM A;  4JIO U;  1NDD A;  2DZM A;  2NPT B;  3PHW B;  4J6I A;  4FN2 A;  2PE9 A;  5HKH A;  3H7P B;  3B08 A;  2JZ3 B;  2N1W A;  3DBL I;  4WWN A;  1EUV B;  3HIZ A;  3DBR I;  2YVC A;  3BIN A;  3KUC B;  4HWI B;  4OVV A;  1ISN A;  2C9W B;  2GOW A;  3N32 A;  1TZ1 A;  2KTF A;  4JLC A;  2KQS A;  5GMV A;  3DDC B;  1E8Y A;  2BWF A;  1WXM A;  4W9K A;  2FCN A;  3JYU A;  1R4M I;  1OTR B;  3PRZ A;  3W1S A;  2GBJ A;  2LVO A;  4BKG A;  5JHB A;  3ALB A;  4IW0 A;  2L0T A;  1SGH A;  1Y8R C;  5EDS A;  3KH0 A;  4LJO B;  2MBE A;  2D10 A;  2KLG A;  3ENE A;  1OEY J;  2KFK B;  3QJZ A;  4W9I A;  4BKS A;  1QZE A;  4GXB A;  4PYU A;  5DPT A;  2A5U A;  3HM6 X;  5JZE B;  3QX1 A;  3JSV A;  5E6N A;  1R4N I;  3EC8 A;  1RFA A;  3DVG X;  3UIP B;  4MGZ E;  4A3P A;  3K9O B;  1WH3 A;  4HDO A;  2MA9 B;  2CHX A;  1KJT A;  1Z2M A;  2EMS A;  2ZCC A;  4BBN C;  2JPH A;  3P2B A;  4GDK A;  1L2N A;  1WJ6 A;  3KUZ A;  4HJK A;  4W9L A;  2KMA A;  3OJ4 B;  3R7Q A;  3DOW A;  4DDG D;  2RGF A;  2WYQ A;  4JL9 A;  4I6N B;  3ZIM A;  3PRM B;  1PQS A;  2C7M B;  5DPS A;  3M95 A;  3ZO5 B;  3QK0 A;  2DZK A;  2CKH B;  1WXA A;  4K7U A;  4XZ4 A;  2LVP A;  2ZEQ A;  3QWZ B;  2BYF A;  2GBK A;  1SE9 A;  1V6E A;  3MJW A;  4FJV B;  3A4S C;  4RM9 A;  4XC2 A;  2EKE C;  3A9J B;  3H6N A;  2RPQ A;  4KV2 A;  2BF8 B;  2Z0D B;  2WWZ A;  2KMC A;  2KWU B;  1X1M A;  2XK5 B;  2K6D B;  1S3S G;  2IY1 B; 
#chains in the Genus database with same CATH topology
 3M62 B;  3VUY A;  2LRU A;  2IGD A;  5CHW A;  3SFE B;  1TYG B;  5JHA A;  2NS5 A;  2JU6 X;  4M00 A;  3DBS A;  3V6E B;  1I4X A;  3DHH C;  2K25 A;  2J52 A;  2WXJ A;  3LJ3 A;  2DAF A;  3I9V 1;  3QHT A;  3E9S A;  4HEA 1;  3N20 C;  2K8C A;  1RWS A;  4G11 A;  2PIA A;  1FFV A;  2FIF A;  3AN1 A;  3P63 A;  5EE1 A;  4FHJ A;  3U30 A;  3IHP C;  4NJ7 A;  1WJN A;  4GB9 A;  4MM3 A;  1FRD A;  3BII D;  4URK A;  3I3T B;  3PHX B;  2KDM A;  1R7S A;  1MJD A;  3MHZ A;  1DOI A;  1B9R A;  4FHK A;  3DBR B;  3VAW A;  2DHZ A;  2LEK A;  3RNG C;  4LNO A;  3RUI B;  1A70 A;  4R3D A;  4TKN A;  4MSQ B;  3UQB A;  3Q6B A;  3A9J A;  1PFD A;  2ASQ A;  4W9F A;  4LDT B;  3M63 B;  4DHJ B;  3PS6 A;  4N9F 4;  5CHF A;  4W9C A;  5BYR A;  1VZ8 A;  5E6O A;  3VQI A;  3DQV A;  3A4R A;  5KHQ A;  3WCQ A;  3PT2 B;  2QIL A;  1VRA B;  2OJW A;  4WAA A;  2KDF B;  1KRH A;  2KJR A;  3Q3O C;  2IBI B;  4WJQ A;  3PGE A;  1XT9 B;  1AW7 A;  3O13 A;  3HHM A;  1VDV A;  2H89 B;  2DYM A;  3RNC C;  4FXC A;  2BB6 A;  3C19 A;  2Z8L A;  3WA0 A;  4ARI A;  1JWS D;  2MBQ A;  1ZKH A;  2E6X A;  1N6Z A;  3KW5 B;  1ZW7 A;  2C60 A;  2IO3 B;  4KZC A;  4HK2 A;  5D7G A;  1WGH A;  5TR5 A;  4RFB A;  1F9J A;  4C4V B;  4LK0 M;  3WAL A;  2VH2 A;  2KT7 A;  1VZ7 A;  2JYE A;  3GOE A;  4HCN B;  1CZP A;  1SXT A;  2NBU A;  3MFG A;  4H2A A;  2SAK A;  1WGK A;  3CF6 E;  4JGH B;  4YL8 A;  5D6J B;  1L0Y B;  3RNB C;  3NVY A;  1WYG A;  1T6B X;  3IBE A;  3Q8E A;  1MPE A;  2Y5B B;  2GLS A;  2GI9 A;  2CHW A;  2GMI C;  2C7H A;  3L16 A;  1RLF A;  4RF0 A;  1UUP A;  4CHK A;  4WQO B;  2M4N A;  4N6E B;  2IND C;  4GSW A;  3I63 C;  2JXT A;  4HPM B;  3P4P B;  2IZV B;  4WQM A;  4ANV A;  3HVD A;  3ZNG C;  2AL3 A;  3L10 B;  2QSD A;  1UBI A;  2KWC A;  5HFY A;  3AE4 B;  3W5U B;  4LNK A;  4AS1 A;  1IPG A;  2AQ2 B;  2MP2 B;  2NTT A;  3LDZ E;  4W9E A;  4ZOH C;  3TEW A;  2XBB C;  4KIK B;  4OZB A;  4WH4 A;  2INC C;  4ZYS A;  4EZJ A;  4XYC A;  1XLP A;  1WJU A;  2E3T A;  1JRP A;  2QIE B;  1YX6 B;  3AU5 A;  2WXN A;  2MSE D;  4KVG B;  1OGW A;  3GS2 A;  2I38 A;  1NI3 A;  1C3T A;  2OED A;  2MH7 A;  3V61 A;  4G0N B;  1FMA D;  3AXC A;  2V1Y A;  2LJ5 A;  4L2Y A;  2JUO A;  2IO1 B;  3EFU A;  4GGQ A;  5CHV C;  1VCB A;  3TJP A;  1SIJ A;  4ICV A;  3BVM A;  1I4Q A;  1L5P A;  2N1V A;  2L00 B;  3HRD D;  2V4L A;  4DDI D;  2ACZ B;  3BK1 A;  2GBM A;  2NCN A;  3ZGZ A;  3NZ3 A;  2LZ6 A;  2AWT A;  3U4E G;  5EE3 A;  1UWX A;  3AV8 A;  5IP4 D;  4W9J A;  2NBV B;  1QOA A;  3DVN U;  4A6Q A;  1N62 A;  4G3X B;  4XDC A;  1J7C A;  1K53 A;  2MRP A;  4X57 B;  3HM3 A;  2LGI A;  2LGX A;  4MGI E;  1XO3 A;  3GB1 A;  5HG2 A;  4A55 A;  3Q3N C;  3NUH B;  3NVW A;  2LUE A;  3ZTC A;  3EA6 A;  4MJS B;  3E56 A;  1L6V A;  2ZW0 A;  5L83 A;  3KUD B;  4WJP A;  1YN4 A;  2IO2 B;  4XWW A;  1V97 A;  2N4F A;  5G2N A;  2LFI A;  4M01 A;  3VUW A;  3V60 A;  4GDL B;  4MSM B;  3AEG B;  2DYB A;  4RCO A;  1JWB D;  1EU3 A;  4WAF A;  1TGZ B;  2M0X A;  3KLS X;  5BMG A;  3ML9 A;  2DZJ A;  3EFC A;  2PVG C;  2O2V B;  3MHS D;  2L76 A;  3KWV A;  2IO0 B;  3PZ8 A;  1SB3 C;  1YIW A;  2D2Q A;  5AZH A;  2IYD B;  2KLC A;  4WIP A;  2I2Y A;  3C0R B;  4ICU A;  2HJ1 A;  3A1Q B;  2JT4 B;  2KQ4 X;  1GG3 A;  4FLH A;  4HJG E;  1KOT A;  1T0S C;  1WXV A;  2BYV E;  4YXD B;  4PT5 A;  1ESF A;  2L1A A;  4BKT A;  1MG4 A;  1TKY A;  3DHI C;  1IYF A;  1EF1 A;  4P1C C;  4IG7 B;  2X38 A;  5GXG B;  2JY6 A;  4IUM B;  2XK5 A;  1IBX A;  2NTS A;  1PUT A;  2DZM A;  4J6I A;  2HTM E;  3DBL I;  4WWN A;  1EUV B;  3KUC B;  3Q69 A;  1FCC C;  3LYY A;  3BYT B;  4JLC A;  3N32 A;  2KTF A;  1FEH A;  3AE2 B;  4W9K A;  2WDQ B;  1R4M I;  3FKY A;  3VRA B;  2LVO A;  4EE2 A;  1J7B A;  2L0T A;  3P4Q B;  4W9I A;  1EWC A;  1QZE A;  2Y5C A;  5EE9 A;  4PK1 A;  3HM6 X;  3JSV A;  3DVG X;  2MA9 B;  2CHX A;  1KJT A;  3N1Y C;  4BBN C;  4C56 C;  2JPH A;  1F2R I;  2K22 A;  2WXP A;  3KUZ A;  3MC0 B;  4LNN A;  3DOW A;  3KQ4 A;  4I6N B;  2DNF A;  4KGS A;  2JX5 A;  2DZK A;  3DHG C;  2CKH B;  3P42 A;  4K7U A;  4HRS A;  2LVP A;  2ZEQ A;  1TIF A;  1SE9 A;  4RM9 A;  2WXG A;  4XC2 A;  2EKE C;  3MJ5 A;  2IY1 B;  4KKJ A;  1KFY B;  3IXS A;  3JW0 X;  1NEN B;  2KFJ A;  2LRW A;  1XCT L;  4ANU A;  4GIV A;  4EFO A;  2RDB C;  2KWD A;  2WP9 B;  3ZJT A;  2TSS A;  2J42 A;  3T8M A;  2D3G A;  3QA8 A;  4ZRI A;  5HI1 A;  3IG3 A;  2N9E B;  3AE5 B;  2WDR B;  2KHW B;  1SSN A;  2WS3 B;  2N9P C;  5IKC M;  1YJI A;  4C4V A;  1E8Z A;  3Q3M C;  1IP9 A;  2UU7 A;  3AMZ A;  3J9C A;  4L1B A;  3RCZ A;  4LNI A;  3ML8 A;  3R3M A;  1WGR A;  3QAQ A;  1ROE A;  1NI2 A;  5AUI A;  3DBL B;  3VTV A;  1EF5 A;  1ZOY B;  1ZDV A;  4GDK B;  1XXG A;  3OLM D;  3VFK A;  4IWO A;  3SEB A;  1L0V B;  1Z5S B;  4C7Z A;  3SD5 A;  1R4M B;  5DPR A;  1NYQ A;  4ZYN A;  4TV3 A;  1F0Z A;  1WF9 A;  1LO5 D;  3EUB 2;  2BPS A;  2N7J A;  2HE7 A;  3C8Y A;  5C1Z A;  4RF1 A;  1P0R A;  2GRI A;  5LNK 1;  1ZPS A;  1E5W A;  3GE8 C;  3NS1 A;  4WJO A;  4IWP A;  4LDT D;  4RMA A;  4DHJ D;  3LB8 C;  4G50 A;  3UI3 A;  4HXD A;  1PDX A;  1YOV B;  2M1M A;  1L4D B;  1RM6 C;  1AAR A;  4W9G A;  1JRU A;  5G55 A;  3ZKJ C;  3QAR A;  2MQJ A;  2WQY B;  1WX9 A;  2MHJ A;  1T0Q C;  1Q5W B;  3AEC B;  3O65 B;  4YSY B;  2MJD A;  3Q3J A;  4KIK A;  4K3B A;  5H8Y E;  1SF0 A;  3TL5 A;  4ANX A;  2CJO A;  2IDY A;  3VUX A;  4KGT A;  2J4X A;  1E10 A;  2JVC A;  4A3O A;  4NAW B;  2WGS A;  1BXT A;  2WXM A;  3APC A;  3GZN I;  1OQQ A;  4GU2 A;  4ZHP A;  3CIR B;  2DWQ A;  1QLB B;  3NOB A;  1RFK A;  3VTW A;  3VHT C;  1AWD A;  2D5G A;  5E6J A;  1XEE A;  2PVO D;  2DX5 B;  4TUU A;  2KZR A;  1MHX A;  3OAW A;  3UF8 A;  2J0J A;  3DVN V;  4MAC A;  2LWP A;  1V86 A;  2GBN A;  2G45 B;  4KGR A;  1EO6 A;  3HVZ A;  1Q1O A;  3RD2 A;  1V1O A;  1L4Z B;  4XX5 A;  1RAX A;  3BY4 B;  2KDE B;  4C80 A;  3H7S A;  4UDU C;  4PS7 A;  1KF6 B;  1FXA A;  4JX1 C;  2J0K A;  3U2S C;  2MEK A;  1C4P A;  2EEL A;  1XLN A;  1WXS A;  2KDI A;  5L95 C;  3KYD D;  2JWZ A;  4KZ0 A;  2ICI A;  4MDK E;  1KH0 A;  4OVZ A;  2I1J A;  4ZDV A;  3L08 A;  2ZVN A;  3MTN B;  5BYQ A;  3VR8 B;  4NAM A;  4EOY A;  2LXC A;  3ZVV A;  1YQB A;  4TQ0 A;  4KSL C;  3Q8B A;  3UIO B;  3MC8 A;  4OW0 A;  4KKI A;  5IN7 A;  3UIN B;  3W1S C;  2D11 A;  3AUL A;  2KTR B;  3BWU D;  3RYT A;  3W2D A;  5FK9 C;  2V3P A;  1WGY A;  2ZPN A;  3R66 C;  1GC7 A;  2QC8 A;  4GDL A;  2K8B A;  4M0W B;  1AYF A;  2KX0 A;  3DCG A;  4EZL A;  1V80 A;  1SEB D;  3AEA B;  4FBJ B;  2D3B A;  3N3K B;  5C2T B;  3GZN B;  4EUT A;  3ONS A;  3IVF A;  2BVC A;  2G4S A;  2O2V A;  1HXY D;  1M94 A;  2FUG 1;  1D4B A;  3ZQ4 A;  2KO3 A;  4WWP A;  3V6C B;  2KVR A;  3U8Z A;  1J0G A;  2HD5 B;  1GNU A;  2REX A;  2G4D B;  2KC2 A;  2K1F A;  3A1Q A;  3TMP B;  1G6J A;  2YLM A;  1IGC A;  2BB5 A;  2RDG A;  4E71 A;  5JH5 C;  3R2I A;  1WWT A;  2KNB A;  2KWV B;  2WDT B;  2Z0E B;  2MJ3 A;  1WGD A;  2ZNV B;  1JW9 D;  2J53 A;  3WAO A;  2KJH B;  4O1N A;  4KDL B;  4CQN A;  4BAX A;  1RRB A;  2JXX A;  3RN9 C;  4C7Y A;  1TJE A;  4HDQ A;  3B2G A;  4LLG M;  2XEW A;  1E7V A;  1A5R A;  1TBE A;  2LAS A;  1SJH D;  4M02 A;  3TUO A;  3DBH I;  3AE7 B;  4PS3 A;  4AP4 C;  2VRR B;  5DPW A;  4IC7 B;  2UWQ A;  3ZUN A;  2H88 B;  4M8N A;  4MEM A;  5LXH A;  4CO7 A;  2N7D A;  3PPA A;  1P9D U;  4DQO C;  4YT0 B;  4LJP B;  4JQW C;  1WE7 A;  1E7P B;  1J19 A;  2W3R A;  4NQK E;  3N9Y C;  5LLI A;  3RZF A;  3A33 B;  2M19 A;  4MEL A;  4HRO A;  1NBF C;  5G5G A;  2BS2 B;  3X23 A;  1KLU D;  1FXT B;  5AZF A;  4WUR A;  2RD0 A;  1P98 A;  4BKS D;  2JQR B;  4XDD A;  2L0F A;  4XWT A;  2LJI A;  1LFD A;  2KVZ A;  2WU2 B;  2MBO A;  3VTU A;  3JVZ X;  3ZJV A;  4AUQ C;  2KOX A;  3ETR A;  5CX3 A;  4LCD E;  2FCQ A;  3W9C B;  2NPT B;  3B08 A;  1GAQ B;  2ON8 A;  5BYS A;  3DDC B;  1E8Y A;  3JYU A;  2N9L A;  2VZK B;  3AEE B;  1TY2 A;  2IJ0 A;  4ACF A;  4GXB A;  5DPT A;  3FAH A;  2A5U A;  5JZE B;  2L52 A;  3MP9 A;  3EC8 A;  2PTL A;  4A3P A;  1Z2M A;  2EMS A;  2XNA C;  4DXF A;  4GDK A;  1E9M A;  1WJ6 A;  5TSS A;  2DBY A;  1F1H A;  3OJ4 B;  3R7Q A;  4DDG D;  1JAL A;  2WYQ A;  3DBH B;  4HKQ A;  3ZIM A;  3PRM B;  3IT4 B;  1TT5 B;  3QK0 A;  2BT6 A;  2JYT A;  1F2R C;  1YMH E;  4S17 A;  3QWZ B;  1C4A A;  1SBB B;  3A4S C;  2QCZ A;  3A9J B;  2RPQ A;  4KV2 A;  2Z0D B;  2WU5 B;  2K6D B;  1VR9 A;  1S3S G;  4II3 B;  2BKF A;  1XQQ A;  3KYC D;  1QT9 A;  2AQ3 B;  3ZXV A;  4BFR A;  2YEP B;  1C1Y B;  1MVK A;  1E90 A;  2ZPY A;  2KFK A;  1RYJ A;  1BUI C;  1QIL A;  5JXV A;  2AL6 A;  3Q8C A;  1EU4 A;  1E6E B;  4JWU C;  2K8H A;  1J7A A;  4II2 B;  3K9P B;  2DEN B;  2V4I B;  1V1P A;  1GOZ A;  3ZNZ B;  2NVU I;  1DGJ A;  1I7H A;  2JRI B;  2AYO B;  2LHD A;  3KWL A;  2AEH A;  2KN4 A;  5FR6 A;  3TSS A;  1UH6 A;  2WXL A;  2EKI A;  3CST A;  1KM7 A;  2I1K A;  2KAN A;  2R2Q A;  2IGH A;  2ZZP B;  4AJW A;  3AE9 B;  4M8M A;  4DXA B;  1C9F A;  2MCN B;  1MG8 A;  3NJT A;  1UZX B;  2MJE A;  3Q14 C;  4FJY A;  2BW2 A;  1T3Q A;  4OZC A;  4K3C A;  2LMC A;  1YQ4 B;  3R8B A;  5G5H A;  2JWU A;  3W1Y A;  3ZRC A;  3R2T A;  3V62 A;  3NY5 A;  1PGA A;  1E8W A;  4GOC A;  4WWM A;  1XLO A;  2NMQ A;  2BYE A;  3NVV A;  3HUI A;  3B9J A;  1H8C A;  1ZGU B;  1SE2 A;  3FIL B;  3ZNH B;  4GN1 A;  2KC1 A;  2NR2 A;  3SFD B;  4ZRP A;  3AEB B;  5EE0 A;  4W9D A;  1M4V A;  1OQY A;  3TBL D;  2AX5 A;  1WRI A;  3Q3F A;  1QKZ A;  3T3O A;  1UWM A;  3OWE B;  1P7E A;  3RI7 C;  2W54 A;  3PSE B;  1WM3 A;  2WXR A;  3PZ7 A;  1E7U A;  4P6V F;  1FXI A;  4YTM B;  2B3A A;  3NS8 A;  1P7F A;  2LXA A;  1YX5 B;  5C3J B;  3AB5 A;  1JWM D;  4IM3 A;  5KHO A;  3A9K B;  1S1Q B;  2CJN A;  1TS2 A;  3BVG A;  2Q5W D;  4BVU C;  2WNM A;  3ZTD A;  1E8X A;  1EWY C;  3QIJ A;  2DLB A;  2KTR A;  1WFY A;  3PV1 A;  2WLB A;  1N63 A;  2FE8 A;  1DOY A;  3PO0 A;  3IT6 B;  3Q2A C;  1WM2 A;  1I4R A;  4F1S A;  4M0W A;  1U4A A;  5HHD G;  1D5M C;  5AEK B;  3NZS A;  3DWM A;  4P7I A;  1KLG D;  3NRZ A;  2O6V B;  1WMH B;  1CQV A;  2G9H D;  2BTE A;  3P4S B;  1WI0 A;  4Q2J A;  1K51 A;  3LXF A;  2K39 A;  4MGK E;  2BGF A;  1WR6 E;  2PKO A;  1Q10 A;  2BWE S;  3CWI A;  4RH6 A;  4RM8 A;  3APF A;  1HE8 A;  2QHO A;  3AED B;  3ZDT A;  4YTP B;  1YN3 A;  3VXW A;  2OOB B;  3AH7 A;  1YJJ A;  1GC6 A;  2K0P A;  2R2O A;  4ZRQ A;  4F7Z A;  1FPY A;  2G1E A;  5AZG A;  2XN9 C;  4K81 A;  3VR9 B;  2L7R A;  2WX0 A;  1HEZ E;  5J2R A;  5MPO A;  1BT0 A;  2M56 B;  2FAZ A;  1ET6 A;  2GB1 A;  4E74 A;  4W9H A;  2PLP A;  2EMT A;  3PLU A;  2CS4 A;  1WZ0 A;  4K1R B;  1MHH E;  4ITK A;  2MX2 A;  2ZCB A;  3U7Z A;  4HVB A;  3EGR A;  2QJL A;  2CR5 A;  3VVW B;  3TEY A;  4N58 A;  2MP2 A;  1I4P A;  4US9 A;  4NQL B;  1FM0 D;  1ET9 A;  3ZYY X;  2M17 A;  2KAJ A;  4XGA B;  3ZLZ A;  3PRE A;  1I4H A;  1WE6 A;  3B0A A;  1V2Y A;  2KJ6 A;  1XF5 L;  2D3A A;  2WX1 A;  1FNV A;  2JSV X;  5LXI B;  2LD9 A;  2KD0 A;  4WJN A;  2B76 B;  3L17 A;  4A9A A;  4IOI E;  2W9N A;  4EZK A;  4E3C A;  1NYR A;  4IM0 A;  3PLV A;  4NJ6 A;  4F8C B;  2NPT A;  3MC9 A;  1TTN A;  1HTQ A;  1KLV A;  4BOS C;  2LI5 A;  5J18 A;  2V0G A;  4B9K A;  1SIF A;  3TIX A;  2R61 A;  4QAY A;  4CYE A;  3Q8A A;  1LM8 B;  1MI0 A;  2J0M A;  5H92 C;  2HDE A;  4DWF A;  4FUL A;  4A90 A;  3AI5 A;  1C76 A;  1WR1 A;  3H9D A;  1NVI D;  4EEW A;  5IO9 A;  1HA5 A;  5FKA C;  2MBH A;  4JWS C;  1KTK A;  1GPX A;  3JSV B;  1D6E C;  2L05 A;  2LVQ A;  1GB4 A;  4BZA A;  1Y56 A;  3IFW B;  3VDZ A;  2BKR B;  3RZW C;  2RR9 A;  4OHJ A;  1UF0 A;  1WX7 A;  1LQB A;  2YEP F;  2IY0 B;  3BK2 A;  2JF5 A;  3AE3 B;  2C7N B;  4N59 A;  5E6P A;  4MJS A;  1D3Z A;  3T3N A;  3B1L X;  5D94 A;  4ANW A;  3EHV A;  4GMV A;  2KN5 A;  2L32 A;  3H8H A;  2WXF A;  3QQ8 B;  3WIM A;  2PE9 A;  2WXO A;  3H7P B;  4LNF A;  5HKH A;  2JZ3 B;  4HWI B;  3BIN A;  2CU3 A;  1R4N B;  4OVV A;  1ISN A;  2QEJ C;  5GMV A;  1IGD A;  2IGG A;  2N9K A;  3PRZ A;  3W1S A;  2GBJ A;  4BKG A;  3ALB A;  4IW0 A;  5EDS A;  4LJO B;  4GLS C;  2MBE A;  3AE8 B;  2KLG A;  1PGX A;  3QJZ A;  1QOB A;  3RPF C;  4BKS A;  4S0R A;  3QX1 A;  1N60 A;  2QDF A;  1QOG A;  4KX6 B;  3ZXR A;  1RFA A;  4MH8 A;  4MGZ E;  1WH3 A;  2VZK D;  4TMA B;  3URY A;  2M0A A;  2WDV B;  1VLB A;  1GB1 A;  1XCQ L;  2OHF A;  4W9L A;  4IDI A;  2KMA A;  3NVZ A;  2SEB D;  1PQS A;  2C7M B;  3M95 A;  1C79 A;  1WXA A;  4YWG G;  4XZ4 A;  1SE4 A;  2BYF A;  3MJW A;  4FJV B;  1F52 A;  2V9H A;  2Y5P A;  3AM9 A;  4RGT A;  2WWZ A;  2KMC A;  1X1M A;  3RNA C;  3DWG C;  2V3N A;  1WX8 A;  2LHE A;  4B0M A;  4DHZ B;  4P1B C;  3VRB B;  1PGB A;  4RGM A;  2A4Z A;  3GP7 A;  4C00 A;  1J8C A;  4DHZ E;  3OJ3 A;  3I57 A;  3BYY B;  2KDB A;  3L13 A;  4HLE A;  1WIA A;  3FIL A;  3PVL A;  1QOF A;  3VH4 B;  4RNA A;  1DYQ A;  2FID A;  3VH3 B;  2KX3 A;  1K52 A;  4I6L B;  1WZ3 A;  1FNW A;  4IM2 A;  2JZZ A;  2IPK D;  1NEK B;  4K7S A;  4OZA A;  4NPN A;  3TEX A;  4AOF A;  2UYZ B;  1QF6 A;  4WWO A;  2HTH A;  1GUA B;  2GBR A;  2M8S A;  4XE0 A;  2MWS B;  1FRR A;  4JE3 B;  1VD2 A;  3D32 A;  3ZDM C;  2BBC A;  2WXH A;  4ZRK A;  2RSU A;  3A9K A;  1WY8 A;  1WYW B;  2N0S B;  4MH0 E;  1I42 A;  1UNS A;  3AEF B;  5J17 A;  1WGG A;  1FCL A;  3SHQ A;  1WXQ A;  1K8R B;  2KK8 A;  3L54 A;  4LTU A;  1TZO A;  1WRD B;  3U7D A;  2L3Z A;  1V5O A;  1UD7 A;  1CK1 A;  3CSF A;  1FO4 A;  1Q0W B;  1T0Y A;  2PEA A;  3L0W B;  1C78 A;  1JWU D;  1C4C A;  2BS4 B;  2VH1 A;  2O6V A;  1WMH A;  2KYW A;  1D5X C;  2K5P A;  1YNT E;  4HKZ E;  1JCK B;  4OVU A;  3R7R A;  3WAN A;  3M3J A;  5IAA C;  3PTF C;  3P4R B;  4ASW C;  4MM3 B;  2FBW B;  3UGB B;  1V81 A;  3WAP A;  1DOX A;  4IKG A;  2WHI A;  2MW5 A;  3GE3 C;  3ZNI D;  1TS5 A;  2FCS A;  1ZXH A;  1WJ4 A;  3SDL C;  1STE A;  3IAM 1;  4BOZ B;  3DVG Y;  3AU4 A;  1V9J A;  2RMM A;  2K9X A;  3WAM A;  3DPD A;  4ZHO A;  1N5X A;  1ZUD 2;  5IOI A;  4PS8 A;  1FIQ A;  4ARC A;  1AN8 A;  5BMH A;  4FJZ A;  1F77 A;  3B2F A;  1FNU A;  1HZ5 A;  1SJE D;  1SE3 A;  1YJ1 A;  2OJR A;  1GJZ A;  2C5L C;  2HJ8 A;  1VZ6 A;  3ZJU A;  1VJK A;  1YD8 U;  1TS3 A;  2W3S A;  2INN E;  2CHZ A;  3W5V B;  3RT3 B;  5BO4 B;  2W82 A;  2DAJ A;  3AE6 B;  2Z59 B;  3ZRF A;  2MBB B;  3TEZ A;  3N1X C;  4NAW A;  1QQR A;  2PE6 B;  1N5W A;  1V8C A;  4TQ1 A;  2O6V D;  4HPP A;  2MLB A;  4EKU A;  3APD A;  5FR3 A;  3QCA A;  4DXG A;  3EEC A;  3RMK C;  3KVF B;  1TY0 A;  4REZ A;  4B0E A;  3L4P A;  1HTO A;  2G3Q B;  3Q8F A;  4FAD A;  2ZW1 A;  2DZI A;  1TKE A;  3NZU A;  4NNJ B;  4P16 A;  2FUH B;  2ONQ A;  4YSX B;  2D3C A;  1P1A A;  3OG5 A;  2BS3 B;  3PRP B;  4I6P A;  5T8I A;  4A8X C;  2X8X X;  4L23 A;  3UQA A;  2PJH A;  1OFF A;  1YQ3 B;  2L8J A;  2LGY A;  1XD3 B;  4DBG A;  4PYZ A;  2N9X A;  5AUK A;  3HK0 A;  1FD6 A;  4HCP B;  4B95 A;  4AWJ A;  1K50 A;  3ABV B;  4KSK C;  5D3D A;  3I5J C;  3S2A A;  1JQ4 A;  1ZDX A;  3ZW3 A;  1B1Z A;  2NBW B;  4AJY B;  2D07 B;  3BZD B;  1UGJ A;  2ZJD A;  2L83 A;  5C23 A;  4BBN F;  2K6Q A;  1ZXI A;  4B6W A;  1T5X D;  5DCN A;  2AQ1 B;  1P3Q U;  2JRH A;  1OEY A;  3T9L A;  3CMM B;  4KDI C;  1I35 A;  3N1Z C;  1YN5 A;  3V05 A;  2KKC A;  1WSP A;  4NY0 A;  1UGM A;  2JZP A;  1L0X B;  4US8 A;  2WXQ A;  1ZE3 D;  5CTR C;  2INP E;  2BQQ A;  1V5T A;  2KQ7 A;  3H7P A;  4J3O D;  4FA6 A;  1ZP0 B;  1T0R C;  4MGY E;  1UEL A;  2ZVO A;  3PZD A;  4YSZ B;  1PYW D;  4DK5 A;  3RFZ B;  4K7W A;  2FNJ B;  5D2M B;  4AQ7 A;  2WXI A;  1UBQ A;  3H1U A;  3FC4 A;  5BMI A;  3ECI A;  2LGD A;  3QC8 B;  1JWA D;  3RNE C;  2V3S A;  1LGR A;  4HPL B;  4IWQ A;  4A20 A;  1C77 A;  1V49 A;  1JRO A;  2LUM A;  3SR6 A;  1H4R A;  2ZNV C;  2QMT A;  4NZL B;  2N7E A;  1XLQ A;  4JPS A;  1TKG A;  3BVZ A;  2BYT A;  2CU1 A;  2KMM A;  3IAS 1;  1LXD A;  1CMX B;  2LGS A;  3N30 A;  3NHE B;  1L6U A;  5I4D A;  4D2K A;  3RNF C;  2KXJ A;  5D3I B;  4ZRJ A;  3RUL A;  1L7Y A;  4MT5 A;  3SU8 X;  3TCA A;  4YTN B;  3X0W A;  1ENF A;  5IA7 A;  1OQR A;  2FCM A;  2DYO A;  1E0Z A;  2PPH A;  2J7Q B;  4JIO U;  1NDD A;  3PHW B;  4FN2 A;  2N1W A;  3HIZ A;  3DBR I;  2YVC A;  1ACC A;  3P1M A;  1FFU A;  2C9W B;  2GOW A;  1CJE A;  1TZ1 A;  2KQS A;  4RGN A;  2BWF A;  1WXM A;  2KAC A;  3V3X A;  2FCN A;  4RGO S;  1OTR B;  1TS4 A;  1HQR D;  2Y3A A;  5JHB A;  1SGH A;  1Y8R C;  1EM7 A;  3KH0 A;  2D10 A;  3ENE A;  1OEY J;  2KFK B;  1HZ6 A;  2PW9 A;  2RPV A;  4PYU A;  5E6N A;  1R4N I;  1V1P B;  1BML C;  3UIP B;  1N61 A;  3K9O B;  4HDO A;  2ZCC A;  1JML A;  3P2B A;  1L2N A;  4HJK A;  3AE1 B;  2W55 A;  3U52 E;  2K3U A;  2RGF A;  1D5Z C;  4JL9 A;  4TSS A;  1IUE A;  5DPS A;  3ZO5 B;  2GBK A;  1V6E A;  2PMV A;  1I4G A;  3H6N A;  2RDH A;  3NG0 A;  2BF8 B;  4NJC A;  2KWU B;  2XK5 B;  2WXK A;  1MFW A;  4USA A;  1IBX B; 
#chains in the Genus database with same CATH homology
 4II3 B;  2BKF A;  1WX8 A;  1XQQ A;  3M62 B;  3VUY A;  2LRU A;  4DHZ B;  3KYC D;  5CHW A;  5JHA A;  3JW0 X;  2NS5 A;  4BFR A;  1C1Y B;  1E90 A;  2KFJ A;  2LRW A;  2ZPY A;  4ANU A;  2KFK A;  4GIV A;  4EFO A;  3DBS A;  3V6E B;  2A4Z A;  2AL6 A;  2K25 A;  2K8H A;  3T8M A;  2D3G A;  3K9P B;  2DAF A;  2DEN B;  3LJ3 A;  3QA8 A;  4II2 B;  4ZRI A;  3OJ3 A;  3IG3 A;  2NVU I;  3ZNZ B;  4DHZ E;  3QHT A;  2N9E B;  2JRI B;  2K8C A;  2KDB A;  2AYO B;  3L13 A;  4G11 A;  2KHW B;  4HLE A;  2AEH A;  2FIF A;  4FHJ A;  1WIA A;  5FR6 A;  3PVL A;  2N9P C;  3VH4 B;  1E8Z A;  2FID A;  1IP9 A;  3U30 A;  3IHP C;  4NJ7 A;  1UH6 A;  3RCZ A;  1WJN A;  3VH3 B;  3CST A;  2KX3 A;  1KM7 A;  3ML8 A;  4GB9 A;  4I6L B;  1WZ3 A;  2I1K A;  3R3M A;  4MM3 A;  1WGR A;  3QAQ A;  4URK A;  3I3T B;  3PHX B;  1NI2 A;  2KAN A;  2JZZ A;  4IM2 A;  3VTV A;  1EF5 A;  4FHK A;  2R2Q A;  4GDK B;  4K7S A;  3OLM D;  3VAW A;  2DHZ A;  4NPN A;  3VFK A;  2ZZP B;  4IWO A;  2UYZ B;  4AOF A;  4WWO A;  4AJW A;  2HTH A;  1GUA B;  3RUI B;  1Z5S B;  2GBR A;  4TKN A;  4MSQ B;  3SD5 A;  3UQB A;  2M8S A;  3A9J A;  4M8M A;  2ASQ A;  4W9F A;  4DXA B;  2MWS B;  5DPR A;  4LDT B;  3M63 B;  4ZYN A;  4TV3 A;  1VD2 A;  1WF9 A;  3D32 A;  4DHJ B;  3PS6 A;  4N9F 4;  5CHF A;  2MCN B;  1MG8 A;  3ZDM C;  4W9C A;  1UZX B;  4ZRK A;  2RSU A;  2BPS A;  3A9K A;  4FJY A;  1WY8 A;  1WYW B;  5E6O A;  3VQI A;  3DQV A;  3A4R A;  5KHQ A;  2HE7 A;  3PT2 B;  5C1Z A;  4MH0 E;  1I42 A;  4WAA A;  5J17 A;  1WGG A;  2KDF B;  2KJR A;  1P0R A;  3SHQ A;  2IBI B;  1E5W A;  1K8R B;  4WJO A;  4WJQ A;  2KK8 A;  3L54 A;  3PGE A;  1XT9 B;  4IWP A;  4LDT D;  1WRD B;  3U7D A;  4RMA A;  2L3Z A;  4DHJ D;  3HHM A;  1V5O A;  4G50 A;  1UD7 A;  4HXD A;  3CSF A;  2DYM A;  1Q0W B;  2M1M A;  3W1Y A;  1T0Y A;  2PEA A;  3ZRC A;  3V62 A;  3NY5 A;  3L0W B;  1AAR A;  1E8W A;  4GOC A;  3WA0 A;  4W9G A;  2MBQ A;  1ZKH A;  1JRU A;  5G55 A;  2O6V A;  2BYE A;  1WMH A;  1ZW7 A;  3KW5 B;  3QAR A;  3ZKJ C;  2C60 A;  2IO3 B;  2MQJ A;  4KZC A;  1H8C A;  1WX9 A;  1ZGU B;  4HK2 A;  5D7G A;  1WGH A;  1Q5W B;  3ZNH B;  4GN1 A;  2KC1 A;  5TR5 A;  3O65 B;  1F9J A;  4OVU A;  2NR2 A;  3R7R A;  3WAN A;  3M3J A;  3Q3J A;  4KIK A;  5IAA C;  3PTF C;  4ASW C;  4W9D A;  3TBL D;  1OQY A;  3WAL A;  3TL5 A;  4ANX A;  3Q3F A;  3VUX A;  3UGB B;  1V81 A;  2JVC A;  3WAP A;  3GOE A;  4HCN B;  4NAW B;  4A3O A;  3PSE B;  1WM3 A;  1E7U A;  2NBU A;  3APC A;  2MW5 A;  3ZNI D;  3GZN I;  4GU2 A;  2FCS A;  2B3A A;  3NS8 A;  2LXA A;  3CF6 E;  1WJ4 A;  4JGH B;  4YL8 A;  5D6J B;  3SDL C;  4BOZ B;  1YX5 B;  5KHO A;  4IM3 A;  3NOB A;  3DVG Y;  3A9K B;  3AU4 A;  1V9J A;  1S1Q B;  3IBE A;  3WAM A;  3DPD A;  2Y5B B;  3VTW A;  3VHT C;  4BVU C;  2CHW A;  3ZTD A;  1E8X A;  2GMI C;  3QIJ A;  4PS8 A;  2C7H A;  1WFY A;  2KTR A;  1RLF A;  3L16 A;  3PV1 A;  4FJZ A;  2DX5 B;  4CHK A;  4WQO B;  4TUU A;  2M4N A;  2KZR A;  1WM2 A;  4F1S A;  3OAW A;  3UF8 A;  2J0J A;  1YJ1 A;  1U4A A;  4GSW A;  3DVN V;  2OJR A;  1GJZ A;  2C5L C;  4HPM B;  2LWP A;  2HJ8 A;  1YD8 U;  2IZV B;  5AEK B;  3NZS A;  4ANV A;  1V86 A;  4P7I A;  2CHZ A;  2GBN A;  3ZNG C;  2AL3 A;  2G45 B;  2O6V B;  3L10 B;  1UBI A;  2KWC A;  1WMH B;  3RT3 B;  1EO6 A;  5BO4 B;  1IPG A;  1Q1O A;  3RD2 A;  1WI0 A;  2DAJ A;  2Z59 B;  3ZRF A;  2MBB B;  2MP2 B;  4XX5 A;  1RAX A;  3BY4 B;  2K39 A;  4MGK E;  2KDE B;  3LDZ E;  4W9E A;  2BGF A;  4NAW A;  1WR6 E;  2BWE S;  2XBB C;  3H7S A;  4RM8 A;  4KIK B;  3APF A;  4PS7 A;  2PE6 B;  1HE8 A;  4TQ1 A;  2J0K A;  2O6V D;  4EZJ A;  2MLB A;  2QHO A;  4EKU A;  3APD A;  1WJU A;  3QCA A;  3ZDT A;  1WXS A;  3VXW A;  2KDI A;  2OOB B;  3KYD D;  3EEC A;  5L95 C;  2JWZ A;  4KZ0 A;  3KVF B;  1YX6 B;  3AU5 A;  1GC6 A;  4MDK E;  2R2O A;  2I1J A;  4ZDV A;  2MSE D;  3L08 A;  2G3Q B;  2ZVN A;  3MTN B;  4KVG B;  4F7Z A;  4FAD A;  1OGW A;  2DZI A;  5AZG A;  1C3T A;  4K81 A;  4EOY A;  3NZU A;  4G0N B;  2LXC A;  4NNJ B;  3V61 A;  2FUH B;  3ZVV A;  1YQB A;  2L7R A;  2WX0 A;  1P1A A;  3AXC A;  4TQ0 A;  2V1Y A;  2LJ5 A;  3PRP B;  4I6P A;  4KSL C;  5J2R A;  3UIO B;  2JUO A;  1BT0 A;  2IO1 B;  3UIN B;  3W1S C;  3EFU A;  2D11 A;  2FAZ A;  4GGQ A;  3UQA A;  2PJH A;  2KTR B;  3AUL A;  3RYT A;  1WGY A;  2L8J A;  4E74 A;  2ZPN A;  5CHV C;  4W9H A;  2LGY A;  2EMT A;  3PLU A;  1GC7 A;  1VCB A;  1WZ0 A;  1XD3 B;  2CS4 A;  3R66 C;  4K1R B;  3TJP A;  4DBG A;  4GDL A;  2MX2 A;  2ZCB A;  2K8B A;  2N9X A;  4PYZ A;  4M0W B;  4ICV A;  4HVB A;  2KX0 A;  3HK0 A;  3DCG A;  2CR5 A;  4HCP B;  4B95 A;  1V80 A;  4EZL A;  3VVW B;  4AWJ A;  2N1V A;  4FBJ B;  2L00 B;  2MP2 A;  3N3K B;  4KSK C;  4NQL B;  2V4L A;  4EUT A;  1J8C A;  3ONS A;  3IVF A;  3S2A A;  2G4S A;  4DDI D;  2O2V A;  1M94 A;  3ZW3 A;  2GBM A;  2NCN A;  2NBW B;  2M17 A;  2LZ6 A;  4AJY B;  2AWT A;  2D07 B;  2KO3 A;  4WWP A;  3V6C B;  2KVR A;  3PRE A;  3U8Z A;  3ZLZ A;  2ZJD A;  1J0G A;  4W9J A;  2HD5 B;  5C23 A;  4BBN F;  1WE6 A;  2K6Q A;  1GNU A;  2REX A;  2NBV B;  3B0A A;  1V2Y A;  2KJ6 A;  2WX1 A;  4B6W A;  2G4D B;  2KC2 A;  2K1F A;  3A1Q A;  5DCN A;  1P3Q U;  2JRH A;  1OEY A;  3DVN U;  3T9L A;  3CMM B;  4KDI C;  5LXI B;  1I35 A;  3TMP B;  1G6J A;  2YLM A;  4G3X B;  2LD9 A;  2KD0 A;  4WJN A;  4E71 A;  2KKC A;  2MRP A;  3L17 A;  5JH5 C;  2KNB A;  2KWV B;  2WDT B;  4X57 B;  3HM3 A;  2LGX A;  2W9N A;  2Z0E B;  4MGI E;  4NY0 A;  1UGM A;  4EZK A;  4E3C A;  1WGD A;  2ZNV B;  4IM0 A;  3WAO A;  3PLV A;  2KJH B;  4NJ6 A;  4F8C B;  2LUE A;  4KDL B;  5CTR C;  5LXH A;  1RRB A;  2JXX A;  3ZTC A;  1V5T A;  2NPT A;  4MJS B;  2KQ7 A;  3H7P A;  4HDQ A;  1TTN A;  4FA6 A;  2XEW A;  1E7V A;  1KLV A;  5L83 A;  4BOS C;  1A5R A;  2LI5 A;  3KUD B;  5J18 A;  1TBE A;  4MGY E;  1UEL A;  2ZVO A;  3PZD A;  4B9K A;  4WJP A;  2IO2 B;  2LAS A;  4DK5 A;  1SIF A;  3TIX A;  2N4F A;  3DBH I;  5G2N A;  4K7W A;  2FNJ B;  5D2M B;  4PS3 A;  3VUW A;  4AP4 C;  3V60 A;  4CYE A;  2VRR B;  1UBQ A;  4GDL B;  1LM8 B;  4MSM B;  3H1U A;  5DPW A;  4IC7 B;  2DYB A;  2J0M A;  3ECI A;  2LGD A;  2UWQ A;  3QC8 B;  3ZUN A;  4DWF A;  2V3S A;  1TGZ B;  4HPL B;  2M0X A;  4FUL A;  3AI5 A;  4IWQ A;  1V49 A;  4MEM A;  4M8N A;  2N7D A;  4A20 A;  4CO7 A;  1WR1 A;  3PPA A;  3H9D A;  1P9D U;  4EEW A;  3ML9 A;  1H4R A;  2DZJ A;  4LJP B;  4JQW C;  1WE7 A;  2O2V B;  2ZNV C;  2MBH A;  3MHS D;  1J19 A;  2N7E A;  2L76 A;  2IO0 B;  4NQK E;  1YIW A;  5LLI A;  3RZF A;  3A33 B;  2CU1 A;  3JSV B;  2D2Q A;  5AZH A;  2IYD B;  1LXD A;  2L05 A;  2KLC A;  4MEL A;  2LVQ A;  1CMX B;  1NBF C;  3N30 A;  3NHE B;  3IFW B;  3C0R B;  2BKR B;  3VDZ A;  4ICU A;  3RZW C;  3A1Q B;  2JT4 B;  2RR9 A;  3X23 A;  1GG3 A;  4FLH A;  1FXT B;  1LQB A;  1WX7 A;  5AZF A;  2IY0 B;  2RD0 A;  1P98 A;  2JF5 A;  1KOT A;  2KXJ A;  2C7N B;  4ZRJ A;  1WXV A;  4BKS D;  3RUL A;  1L7Y A;  2BYV E;  5E6P A;  3SU8 X;  4BKT A;  3TCA A;  4MJS A;  1D3Z A;  2L0F A;  3X0W A;  1IYF A;  1LFD A;  3VTU A;  2MBO A;  5IA7 A;  1EF1 A;  2FCM A;  3B1L X;  4IG7 B;  5D94 A;  4ANW A;  3EHV A;  2DYO A;  3JVZ X;  4GMV A;  4AUQ C;  2JY6 A;  4IUM B;  2KOX A;  2KN5 A;  5CX3 A;  2XK5 A;  2PPH A;  2J7Q B;  4LCD E;  2FCQ A;  3QQ8 B;  3WIM A;  4JIO U;  1NDD A;  2DZM A;  2NPT B;  3PHW B;  4J6I A;  4FN2 A;  2PE9 A;  5HKH A;  3H7P B;  3B08 A;  2JZ3 B;  2N1W A;  3DBL I;  4WWN A;  1EUV B;  3HIZ A;  3DBR I;  2YVC A;  3BIN A;  3KUC B;  4HWI B;  4OVV A;  1ISN A;  2C9W B;  2GOW A;  3N32 A;  1TZ1 A;  2KTF A;  4JLC A;  2KQS A;  5GMV A;  3DDC B;  1E8Y A;  2BWF A;  1WXM A;  4W9K A;  2FCN A;  3JYU A;  1R4M I;  1OTR B;  3PRZ A;  3W1S A;  2GBJ A;  2LVO A;  4BKG A;  5JHB A;  3ALB A;  4IW0 A;  2L0T A;  1SGH A;  1Y8R C;  5EDS A;  3KH0 A;  4LJO B;  2MBE A;  2D10 A;  2KLG A;  3ENE A;  1OEY J;  2KFK B;  3QJZ A;  4W9I A;  4BKS A;  1QZE A;  4GXB A;  4PYU A;  5DPT A;  2A5U A;  3HM6 X;  5JZE B;  3QX1 A;  3JSV A;  5E6N A;  1R4N I;  3EC8 A;  1RFA A;  3DVG X;  3UIP B;  4MGZ E;  4A3P A;  3K9O B;  1WH3 A;  4HDO A;  2MA9 B;  2CHX A;  1KJT A;  1Z2M A;  2EMS A;  2ZCC A;  4BBN C;  2JPH A;  3P2B A;  4GDK A;  1L2N A;  1WJ6 A;  3KUZ A;  4HJK A;  4W9L A;  2KMA A;  3OJ4 B;  3R7Q A;  3DOW A;  4DDG D;  2RGF A;  2WYQ A;  4JL9 A;  4I6N B;  3ZIM A;  3PRM B;  1PQS A;  2C7M B;  5DPS A;  3M95 A;  3ZO5 B;  3QK0 A;  2DZK A;  2CKH B;  1WXA A;  4K7U A;  4XZ4 A;  2LVP A;  2ZEQ A;  3QWZ B;  2BYF A;  2GBK A;  1SE9 A;  1V6E A;  3MJW A;  4FJV B;  3A4S C;  4RM9 A;  4XC2 A;  2EKE C;  3A9J B;  3H6N A;  2RPQ A;  4KV2 A;  2BF8 B;  2Z0D B;  2WWZ A;  2KMC A;  2KWU B;  1X1M A;  2XK5 B;  2K6D B;  1S3S G;  2IY1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...