2Y5BB

Structure of usp21 in complex with linear diubiquitin-aldehyde
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
149
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polyubiquitin Binding and Cross-Reactivity in the Usp Domain Deubiquitinase Usp21.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 21
total genus 32
structure length 149
sequence length 151
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2y5bB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2y5bB01
2PE9A 3DBRI 2GOWA 2NBWB 2V1YA 3EFUA 4FADA 3PLVA 1P0RA 4AUQC 1EUVB 4RMAA 5DPSA 3SU8X 1E90A 2D11A 1WIAA 3PREA 4IUMB 1WJ6A 3VFKA 1WJ4A 3IFWB 4MDKE 4TKNA 5TR5A 3PLUA 2N9XA 2ZCCA 3JW0X 4GDKA 2A5UA 2G3QB 2KJHB 4MEMA 5D7GA 5BO4B 3WIMA 1V49A 1WGHA 1Q5WB 2KWCA 2DYOA 3ZUNA 3PRZA 1V86A 4LCDE 1YQBA 3PRPB 2IO0B 3ZDTA 3L17A 3RZWC 2R2OA 1ZKHA 2G4DB 2JT4B 4LJPB 2ZPYA 3JVZX 3VUYA 3DBSA 2AL6A 3A9KA 1P98A 2EMSA 3HM3A 3M63B 1JRUA 3WAPA 1P1AA 2J0MA 3QWZB 3TIXA 3L0WB 1V2YA 2DX5B 3TCAA 1H8CA 2ZPNA 5E6PA 3U30A 5AZHA 1LXDA 2OJRA 1ZGUB 1V5OA 1ZW7A 3QJZA 5DPWA 3ENEA 4F7ZA 2LVOA 3SHQA 1UGMA 1C1YB 3UINB 4E3CA 2D10A 1G6JA 2IY0B 2L7RA 5JZEB 5D6JB 1TZ1A 2C60A 4GGQA 4MGZE 3HM6X 3ML8A 4M8MA 2BF8B 2M4NA 1F9JA 3ZNZB 2KFJA 2MSED 2O2VA 4W9CA 1E8YA 1J19A 3B08A 2VRRB 2MBOA 2ZZPB 2IO3B 4OVUA 4OVVA 4NQLB 4E71A 2J7QB 2KX0A 1YJ1A 3A1QB 3WA0A 1RFAA 4EZJA 2KJ6A 3A9JA 3QK0A 4HDOA 3KW5B 3RCZA 2LVQA 3GOEA 3L54A 3M95A 5J2RA 2XK5B 4MJSA 2JRHA 1UBQA 3LJ3A 1AARA 3EC8A 3ZRFA 4MH0E 4ANVA 2KFKA 1TGZB 2NCNA 3NZUA 3VH4B 2Z59B 2HD5B 1LQBA 2Y5BB 2KQSA 2O6VB 1PQSA 4DBGA 4W9GA 2R2QA 2M17A 2ZVNA 1WJNA 2REXA 2LXCA 4ANUA 3IG3A 1T0YA 2JY6A 3MHSD 2LVPA 2V4LA 4ZRIA 4W9KA 5G2NA 3X23A 4GSWA 2KLGA 1HE8A 2XEWA 3W1YA 4IWPA 2ZVOA 2IBIB 3ZRCA 3W1SC 1ISNA 2FCSA 4MGIE 1YIWA 2KDFB 1V81A 1WGDA 4FLHA 2LGYA 1V9JA 3CF6E 1GG3A 4KV2A 3IBEA 4B9KA 1E8WA 5DPRA 2DZMA 3N30A 2EMTA 1WX7A 4K1RB 4KVGB 4HDQA 5J18A 4HCNB 3VUWA 3ZO5B 4ANWA 4HK2A 3VTUA 2PE6B 2FAZA 4EEWA 3O65B 4FJZA 3ALBA 2LXAA 4DDID 2GBNA 2IO2B 2KVRA 1UD7A 5D2MB 2KTRB 4II2B 3RZFA 1X1MA 2MP2A 1RAXA 4K81A 5E6OA 4MGKE 5CX3A 4FN2A 4CHKA 2JXXA 1OTRB 3PS6A 3TBLD 3VTVA 4B6WA 2KWVB 2FCQA 2AEHA 2GBMA 1WY8A 2OOBB 3M62B 3AXCA 4BOSC 3W1SA 4M0WB 3PTFC 2N7DA 4URKA 4XZ4A 2ZNVC 3WANA 2LGDA 3NOBA 5IAAC 2L0FA 3QARA 3QX1A 3DOWA 3NHEB 1UELA 2DAFA 2K8HA 2M8SA 5CTRC 4DHZE 2DZIA 2I1KA 2K6QA 1V6EA 2FNJB 4E74A 1KLVA 4IW0A 4DHJD 2ZEQA 2KD0A 1WE6A 5D94A 4BKSD 1C3TA 4ZRKA 3D32A 2AWTA 2DZJA 4W9JA 5HKHA 4NNJB 2C7MB 4K7SA 1Q1OA 3DDCB 2L05A 3H7SA 1LM8B 3U7DA 4KIKA 4HVBA 3ML9A 2JPHA 2M1MA 4ZRJA 4HXDA 4NJ7A 1GJZA 2A4ZA 3SDLC 2RPQA 4WWNA 4AOFA 1E7VA 3EHVA 4I6LB 2BPSA 1KJTA 1R4NI 4NAWA 2N4FA 2GMIC 4HJKA 4MJSB 3QIJA 4YL8A 2BKFA 3VH3B 4FA6A 1I35A 2NVUI 2LWPA 4G3XB 1RLFA 5DPTA 5CHWA 3EECA 4G11A 1WZ3A 3CSTA 2N9PC 2BWFA 3JYUA 2MW5A 2L0TA 4EFOA 4NPNA 1WGYA 4X57B 2KMAA 3CSFA 4FJVB 4BKSA 2HE7A 2JZ3B 3KYCD 3LDZE 3U8ZA 4HLEA 5JHAA 1WZ0A 4RM8A 3M3JA 2CU1A 2KANA 1KM7A 2JVCA 3UIPB 1BT0A 3Q3JA 4K7UA 2FCNA 3TMPB 2IO1B 3DVNU 3S2AA 5EDSA 2FUHB 3A33B 4DDGD 3AU4A 5KHOA 1IP9A 1TTNA 1E8ZA 3APFA 5AZGA 3RD2A 2O6VA 1WM3A 4XX5A 2UYZB 2QHOA 3KH0A 4PYUA 2IY1B 2LD9A 1VD2A 2BYEA 2L00B 3A9JB 2RGFA 5L83A 1I42A 3IHPC 4AJWA 2CHXA 2KN5A 1NI2A 2Z0DB 4PS7A 2DYMA 4TQ1A 4WQOB 1A5RA 4WAAA 1WH3A 3PPAA 1KOTA 2MWSB 4ASWC 4WJPA 2LRWA 3H7PB 3RULA 3VHTC 2YVCA 2HTHA 1EF1A 4JGHB 1IPGA 3I3TB 4JLCA 2KMCA 2L3ZA 2NBUA 2MBHA 3DPDA 3R66C 4W9FA 3ZW3A 2FCMA 3QHTA 4NAWB 2Z0EB 2G45B 3OJ3A 4IWQA 2M0XA 5CHVC 5AZFA 1IYFA 2NBVB 2KDEB 3VAWA 4FBJB 1L2NA 1YX5B 1WMHA 1NBFC 3PHXB 4HPMB 2HJ8A 4GDLB 1WXAA 4BOZB 2DYBA 1WI0A 2BYVE 2BGFA 3VXWA 4W9DA 5LXHA 4FHKA 3DBLI 4ICUA 2XBBC 3AULA 4ANXA 2ZNVB 3KVFB 2NPTA 4KSKC 4EKUA 2IYDB 4A3PA 4ICVA 1WM2A 2MLBA 2K25A 4GMVA 3PT2B 2WX0A 2C5LC 5G55A 2MA9B 4KZCA 1WXMA 4F1SA 4LDTD 3PHWB 3N32A 4IC7B 4TQ0A 2V3SA 3H9DA 2JF5A 1EF5A 1OEYA 2K6DB 2KO3A 2KQ7A 2FIDA 2N1WA 3OJ4B 1EO6A 2GBJA 1NDDA 3ZTDA 2JUOA 1GC6A 4K7WA 5J17A 2KX3A 4EZLA 3QAQA 4PYZA 4FULA 3K9PB 2LRUA 1H4RA 4KDLB 2KLCA 3ONSA 4DK5A 3A9KB 3JSVB 2N1VA 2WX1A 3OLMD 3R7RA 3OAWA 3L13A 3DVNV 4WJQA 1UZXB 2N7EA 2MX2A 4G0NB 1S1QB 1OGWA 1Y8RC 3T8MA 4IG7B 3WAMA 3A4RA 2J0JA 1WR6E 4FHJA 1E5WA 2JWZA 4MSMB 3L16A 5DCNA 1GNUA 2CR5A 3HIZA 3MTNB 4CO7A 5AEKB 2KK8A 2MRPA 2AYOB 3ZKJC 3C0RB 4NJ6A 4CYEA 1Z2MA 2LI5A 2CHWA 2MP2B 2MBEA 4IM2A 3AU5A 2MBQA 3NY5A 4IWOA 3UF8A 2ZJDA 3PV1A 4EUTA 2NPTB 2LJ5A 3VUXA 3PZDA 4KZ0A 5FR6A 2LGXA 3ZNID 3KUZA 2C7NB 3DQVA 1V5TA 4MSQB 4AJYB 3CMMB 2LASA 1CMXB 2K1FA 2L76A 4WJNA 3ZIMA 1WYWB 4NY0A 4EOYA 1WE7A 5C23A 1YX6B 4I6PA 3UQBA 2KJRA 4WWOA 4BBNF 1E8XA 5GMVA 4GOCA 5CHFA 1WX9A 1WGGA 4AP4C 2W9NA 3RYTA 1RRBA 4XC2A 4DHZB 1OQYA 1GC7A 4WWPA 2J0KA 4FJYA 4TV3A 2IZVB 2KTRA 3V6EB 2I1JA 4II3B 4I6NB 4DWFA 2B3AA 2O6VD 2GBKA 5C1ZA 4DHJB 2PPHA 2NR2A 3TJPA 3UGBB 4ZDVA 2DZKA 3K9OB 4GIVA 4GB9A 3ZTCA 2D3GA 1P9DU 2KC1A 3ZNGC 2DHZA 4AWJA 1P3QU 2K8BA 2JZZA 4G50A 2KWUB 2ZCBA 2XK5A 4JIOU 4BKTA 2K8CA 1SIFA 3ZVVA 2LZ6A 2C9WB 2O2VB 3VTWA 3WALA 1WRDB 2PJHA 2GBRA 1XT9B 1FXTB 4DXAB 3QA8A 3QCAA 2BWES 4B95A 4HWIB 1YD8U 1WFYA 5L95C 2YLMA 3PSEB 3X0WA 3N3KB 1S3SG 4LJOB 2UWQA 1WXVA 2CHZA 4A20A 4HCPB 2RR9A 1VCBA 4RM9A 3H1UA 5LLIA 1SE9A 3APCA 2AL3A 3ZNHB 4GXBA 4KIKB 3V62A 1WMHB 4GN1A 1WJUA 1Z5SB 2MCNB 4GDKB 1V80A 4EZKA 2ASQA 1SGHA 2FIFA 2D07B 2WWZA 2DAJA 3V6CB 1QZEA 2K39A 5E6NA 2D2QA 3R7QA 3UIOB 4J6IA 1LFDA 3AI5A 3P2BA 3T9LA 3QQ8B 4W9HA 4KDIC 1M94A 3JSVA 3KUCB 3DVGY 2EKEC 4M8NA 3ZLZA 2LUEA 2MQJA 3KYDD 3NS8A 3TL5A 3WAOA 3BINA 1UBIA 2L8JA 3KUDB 3R3MA 4PS3A 4BBNC 1MG8A 4ZYNA 3ZDMC 1K8RB 3NZSA 4JQWC 4MGYE 3HK0A 2N9EB 3HHMA 2G4SA 2KFKB 3QC8B 2KKCA 2KDBA 3A1QA 4KSLC 2WDTB 4BFRA 2KDIA 1WXSA 3VVWB 2BYFA 3IVFA 3UQAA 3BY4B 3A4SC 1U4AA 2DENB 2KZRA 3RUIB 1E7UA 2KNBA 3DVGX 4TUUA 3VQIA 4W9IA 5IA7A 4MM3A 3VDZA 4WJOA 2KOXA 1J8CA 1OEYJ 4W9LA 2NS5A 3Q3FA 3PVLA 4BKGA 1WX8A 2JRIB 3PGEA 3PRMB 4IM0A 2MBBB 3H6NA 4PS8A 2CKHB 5LXIB 1WF9A 4HPLB 5KHQA 4A3OA 4JL9A 3DCGA 2CS4A 2WYQA 1XD3B 3APDA 4BVUC 1D3ZA 1R4MI 4MELA 1TBEA 3SD5A 3B0AA 2KXJA 1XQQA 1L7YA 2RSUA 2RD0A 3MJWA 4LDTB 4GU2A 4IM3A 1UH6A 2KHWB 2KTFA 3V61A 1Q0WB 3B1LX 1GUAB 3GZNI 4P7IA 3V60A 1J0GA 2PEAA 3H7PA 5JH5C 4F8CB 4W9EA 3L10B 3ECIA 3RT3B 1WGRA 4NQKE 2C7HA 2BKRB 4N9F4 4GDLA 3L08A 2KC2A 5JHBA 1WR1A 3DBHI
chains in the Genus database with same CATH superfamily
3EFUA 5DPSA 1WJ6A 1FPYA 4MDKE 1EWCA 4ZHOA 3JW0X 2WGSA 5AUKA 3WIMA 3GZNB 1WGHA 2JYEA 1GB4A 4LCDE 1ZDXA 2G4DB 2JT4B 1F52A 2WLBA 3DBSA 1EM7A 3FC4A 3M63B 3WAPA 3TIXA 2NTTA 1FCLA 2ZPNA 5E6PA 4OHJA 1LXDA 3LYYA 1C78A 2L7RA 4MGZE 3ML8A 1C4AA 4WQMA 2JQRB 3ZNZB 4W9CA 2MSED 1T0RC 4LNIA 4E71A 4JWSC 5LNK1 4HDOA 3QK0A 2LVQA 3ZGZA 1UBQA 1AARA 4ANVA 2KFKA 4W9GA 2R2QA 2M17A 2LXCA 4W9KA 4YTMB 3X23A 2IDYA 4GSWA 1HE8A 3ZRCA 2MHJA 1YIWA 1V81A 1WGDA 3Q2AC 4FLHA 2DLBA 4US9A 2QEJC 3AEAB 4KV2A 1ESFA 3AE1B 2MH7A 1QT9A 1L6UA 2PE6B 3H8HA 3O65B 4HKZE 4YSZB 4II2B 1X1MA 1FCCC 1AYFA 4FN2A 1JWAD 4CHKA 4B6WA 2AEHA 3M62B 3N9YC 1TY0A 2VZKB 1N6ZA 2N7DA 3WANA 2LGDA 3NOBA 1NYRA 3QX1A 3DOWA 1UELA 4IKGA 2M8SA 2I38A 3Q8CA 5CTRC 4E74A 1V6EA 1KLVA 4IW0A 4DHJD 1WE6A 4XGAB 4ZRKA 2AWTA 1KLGD 2C7MB 2WU2B 2L05A 4HROA 4HVBA 3ML9A 1E0ZA 2L32A 4TMAB 5BYSA 1FMAD 2RDBC 4YL8A 3VH3B 1FEHA 2AQ3B 4G11A 2MW5A 2J52A 1HZ6A 4X57B 1JALA 2BS4B 4BKSA 3Q8AA 3VRAB 2G9HD 1RM6C 3GE3C 1FXIA 2JVCA 1BT0A 4K7UA 4ZRPA 3UIPB 1V1PB 2FCNA 4XE0A 1OQQA 3RI7C 2FUHB 3A33B 2B76B 3AU4A 5IN7A 2V3NA 4RFBA 3APFA 3RD2A 2L52A 4XX5A 4PYUA 1I42A 1GOZA 3IHPC 2BTEA 1PDXA 1KLUD 1SSNA 3PPAA 2K3UA 1FM0D 3RNGC 3I3TB 3DPDA 3R66C 4W9FA 1TYGB 1FXAA 2FCMA 3QHTA 2G45B 3OJ3A 5CHVC 1IBXA 2KDEB 4FBJB 4KKJA 1NBFC 3N1ZC 3PHXB 4GDLB 1WXAA 4BOZB 2BGFA 3VXWA 5LXHA 3DBLI 4ANXA 3U52E 1UUPA 1WXQA 3PZ7A 2CJNA 4EKUA 3SEBA 2IYDB 2LHEA 1TJEA 3E9SA 4GMVA 3I63C 2W3SA 3PHWB 1SB3C 1JCKB 2N1WA 3OJ4B 4K7WA 2KX3A 4B0EA 3K9PB 2KLCA 3A9KB 3TEWA 3SR6A 2N1VA 3OLMD 2YEPB 2H88B 3AE8B 1F77A 2IPKD 4N59A 4IG7B 3WAMA 1E5WA 2JWZA 1K51A 4MSMB 3L16A 5IOIA 2INDC 1J7AA 3I9V1 1MHXA 1B1ZA 1Z2MA 3W5UB 4IWOA 2MBQA 3PV1A 2LJ5A 3VUXA 3PZDA 5FR6A 3T3OA 1YQ3B 2LGXA 3RNCC 3KUZA 4XYCA 3TEXA 1E10A 1CMXB 2K1FA 2L76A 3VRBB 1VDVA 1C76A 1SIJA 2KJRA 4GOCA 1AWDA 4IOIE 4YTPB 3NVZA 3RYTA 4DHZB 1GC7A 2J0KA 4FJYA 2IZVB 4KX6B 2NTSA 2KTRA 2LGSA 4N6EB 4DHJB 2LFIA 3UGBB 3Q8FA 1ZUD2 1IGDA 5C2TB 2KC1A 3ZNGC 3RPFC 2KWUB 3ZVVA 5BMHA 2GBRA 1FXTB 3QA8A 3ZJVA 3AE6B 1YD8U 1WFYA 5L95C 4A20A 4HCPB 1SJHD 4YWGG 2PW9A 2Y5PA 3N1XC 3ZNHB 1RWSA 1VR9A 3V62A 1WMHB 4GDKB 3U7ZA 2ASQA 1SGHA 2D07B 2DAJA 2JWUA 2D2QA 3R7QA 3UIOB 3T9LA 2VH2A 5G5GA 3KUCB 4M8NA 2JSVX 1XLNA 2HTME 3BINA 1UBIA 3R3MA 4BBNC 1MG8A 3ZDMC 2G4SA 3QC8B 2KKCA 3WCQA 2BYFA 2DENB 1DOYA 3RUIB 4TUUA 4P6VF 3VQIA 4MM3A 3VDZA 1J8CA 1QOGA 4HKQA 4C7ZA 4B0MA 2JRIB 2LUMA 4IM0A 3PRMB 2MBBB 2MJEA 2VZKD 5LXIB 1C4CA 1WF9A 1WYGA 4WAFA 5KHQA 4A3OA 3DCGA 3MC0B 3OWEB 1D5MC 1R4MI 4MELA 1TBEA 2N7JA 3B0AA 2FUG1 3RFZB 4IM3A 3ZJUA 2AQ1B 1HTOA 1UF0A 1DYQA 4F8CB 3NVVA 4W9EA 3KWVA 3ECIA 4C80A 2C7HA 2BKRB 3Q69A 2WXGA 5I4DA 1ZOYB 3U4EG 1WR1A 4DQOC 2V1YA 4IDIA 4FADA 3C8YA 4AUQC 1YNTE 1CJEA 3Q3NC 1V8CA 1E90A 2D11A 3VFKA 1WJ4A 3IFWB 2WDRB 1WRIA 3PLUA 5TR5A 2JZPA 2N9XA 2ZCCA 4R3DA 4MEMA 2K0PA 2LGIA 5BO4B 2ONQA 1Q5WB 1D4BA 3PRPB 2IO0B 3R8BA 3L17A 5BYQA 3AEGB 2R2OA 2KDMA 2RDHA 4ACFA 3ZYYX 3A9KA 5IKCM 2EMSA 1P1AA 3QWZB 3L0WB 2DX5B 3TCAA 2WXHA 4REZA 5AZHA 2OJRA 1ZGUB 1XEEA 2V0GA 4E3CA 2D10A 4YSXB 2IY0B 5D6JB 3NVYA 1WSPA 3HM6X 3LXFA 1JQ4A 2INPE 2MJDA 3GS2A 2VRRB 2MBOA 2ZZPB 2IO3B 1P7FA 2N0SB 4OVVA 4NQLB 1SE4A 2PTLA 3P42A 2SEBD 2WXLA 1RFAA 2KJ6A 3A9JA 3KW5B 4MJSA 1AW7A 1F2RI 2VH1A 2JRHA 3LJ3A 1JWBD 3ZRFA 5HG2A 4MH0E 1VZ7A 2NCNA 3VH4B 2Z59B 1FNVA 1WJNA 4YT0B 1MJDA 3IG3A 1T0YA 1OFFA 1UGJA 2LVPA 2V4LA 2KLGA 4QAYA 4IWPA 2ZVOA 1ISNA 3FAHA 4KGTA 1E8WA 2DZMA 1WX7A 5J18A 4LK0M 4HCNB 3VUWA 4RF1A 2FAZA 3UI3A 1YJJA 4EEWA 4L1BA 4DDID 2GBNA 1QILA 1RFKA 2KVRA 1UD7A 3RZFA 4K81A 2JXXA 1SXTA 1STEA 5FKAC 3HVZA 3RNAC 3MFGA 4RGOS 3W1SA 1Y56A 1C79A 1TS5A 3PTFC 4URKA 4XZ4A 2ZNVC 1TKYA 2DAFA 2WXOA 4DHZE 1BUIC 2K6QA 2I1KA 2LEKA 2PVOD 1ZE3D 4A8XC 1C3TA 1ZP0B 2EELA 1DGJA 3H7SA 3DDCB 1JWSD 4MM3B 3HUIA 1F2RC 4KIKA 2ZW0A 1LO5D 2BT6A 1NI3A 4LTUA 4HXDA 2A4ZA 2RPQA 4LNOA 2M19A 4NAWA 1KJTA 1R4NI 2GMIC 2N4FA 1MPEA 4M01A 3DWGC 1UWXA 1HQRD 2GB1A 3EECA 1WZ3A 2L0TA 4AQ7A 4NPNA 1WGYA 4A90A 3CIRB 2HE7A 2JZ3B 3M3JA 2KANA 1P7EA 2WQYB 1M4VA 2MEKA 3DVNU 1C77A 2N9KA 4DDGD 1IP9A 3NUHB 2UYZB 1BMLC 2IY1B 5C3JB 3A9JB 2BYEA 5L83A 3V3XA 2CHXA 1NI2A 2KN5A 4WQOB 2DBYA 4S0RA 3IAM1 2RDGA 1UWMA 4ASWC 1CQVA 3H7PB 2YVCA 1EF1A 1SJED 1FRRA 1IPGA 1XLQA 2L3ZA 5FR3A 2Z0EB 4IWQA 5JXVA 5AZFA 2NBVB 1L2NA 4HPMB 4HJGE 1JROA 2DYBA 4YXDB 1L4ZB 3AULA 4US8A 3KVFB 1I4RA 1HEZE 1FO4A 1N61A 1WM2A 1D5XC 2MLBA 2WX0A 3VR8B 2C5LC 5G55A 4LDTD 2JX5A 1FRDA 4TQ0A 3AEEB 3H9DA 2NMQA 2KQ7A 2KO3A 2FIDA 2GBJA 5EE3A 5J17A 4PYZA 1GPXA 2BB6A 3ONSA 4DK5A 1D6EC 3MJ5A 3DVNV 4MH8A 1N60A 2ACZB 2AQ2B 2BVCA 1OGWA 3BVGA 1T6BX 1WR6E 4FHJA 2WXFA 5EE1A 3MTNB 4ITKA 1SE3A 2KK8A 2MRPA 4PK1A 1K53A 3C0RB 5IO9A 1VZ8A 2MBEA 4O1NA 1ROEA 3UF8A 1R7SA 2J42A 2NPTB 4KZ0A 3NZ3A 2PVGC 3DQVA 4WJNA 1QF6A 1WYWB 4EOYA 2V4IB 4OZBA 5C23A 2KT7A 5BMIA 1JW9D 1E8XA 2YEPF 1VRAB 1WGGA 3B2GA 2W9NA 2KQ4X 1RRBA 2IJ0A 3P1MA 1OQYA 1PGAA 4WWPA 2G1EA 3V6EB 2I1JA 4DWFA 3BYTB 5C1ZA 2NR2A 4ZDVA 4GB9A 3ZTCA 4OZCA 1P3QU 2QILA 3BVMA 2ZCBA 1SIFA 1V1OA 2O2VB 3WALA 1TIFA 1ZPSA 3FILB 4B95A 1JWMD 3GP7A 2YLMA 1TS3A 1ACCA 3PSEB 3X0WA 2UWQA 1WXVA 2RR9A 4TSSA 3H1UA 4WH4A 4UDUC 1B9RA 3APCA 2AL3A 3RNFC 4GXBA 2BBCA 4GN1A 1WJUA 2MCNB 1FIQA 1V80A 1L5PA 4EZKA 3V6CB 3BVZA 1QZEA 4J6IA 2GRIA 1DOIA 4W9HA 4KDIC 1M94A 3DVGY 1I7HA 2LUEA 3WAOA 3NG0A 1XO3A 4L2YA 2L8JA 1PFDA 4ZYNA 1EWYC 3NZSA 4MGYE 3HK0A 2N9EB 3HHMA 2KDBA 2WDTB 4RCOA 4BFRA 1WXSA 1ZXIA 2WXIA 1NYQA 1GB1A 3DVGX 4W9IA 5IA7A 2KOXA 1AN8A 1QOFA 3NS1A 2TSSA 2OHFA 3H6NA 1D5ZC 4HPLB 3B9JA 3APDA 2KXJA 1XQQA 2RSUA 4LDTB 2KTFA 1Q0WB 4P7IA 3GZNI 3RNEC 3H7PA 3P4SB 1IGCA 4RGNA 3R2TA 2GLSA 3RT3B 1WGRA 4NQKE 4LNFA 1T3QA 2WHIA 1WGKA 3AE9B 4PT5A 2PE9A 3AMZA 3AN1A 1L6VA 3J9CA 3SU8X 4IUMB 1WIAA 3I5JC 3I57A 4TKNA 4XDDA 1CZPA 2A5UA 3NRZA 5D7GA 1V49A 2KWCA 2DYOA 1V86A 1UNSA 3RZWC 2BQQA 2E3TA 1DOXA 2AL6A 1Q10A 1P98A 3RMKC 3HM3A 2WP9B 3T3NA 1C9FA 1QOAA 2V3PA 2Z8LA 3AH7A 4HEA1 3QJZA 3ENEA 4F7ZA 3SHQA 1UGMA 1C1YB 3UINB 3AE4B 1G6JA 4GGQA 2C60A 2ZW1A 2BF8B 2M4NA 1F9JA 3FKYA 3VR9B 3HVDA 1E8YA 1J19A 4OVUA 4MT5A 2J7QB 2KX0A 1YJ1A 3A1QB 3WA0A 5E6JA 3RCZA 1SE2A 2HJ1A 3GOEA 2XK5B 2N9LA 2OJWA 3EFCA 3EC8A 3FILA 3NZUA 2HD5B 1LQBA 2Y5BB 2KQSA 2O6VB 1JRPA 1PQSA 3AECB 1IBXB 2REXA 4ANUA 2Q5WD 3DWMA 2JY6A 4JX1C 4LNNA 3MC8A 3ZJTA 2XEWA 3W1YA 2IBIB 3W1SC 2FCSA 4MGIE 2LGYA 1V9JA 3CF6E 3IBEA 4B9KA 2Y3AA 3KQ4A 1SEBD 4KVGB 3ZO5B 4ANWA 3VTUA 4D2KA 4FJZA 3ALBA 4HRSA 2LXAA 3RNBC 3Q3OC 2KTRB 2IGDA 5E6OA 4MGKE 3Q3MC 2JXTA 1OTRB 2KMMA 4L23A 5H8YE 1WY8A 2OOBB 2WDQB 4P1BC 3AEBB 3ZXRA 2K8HA 2ON8A 3IT6B 1QLBB 2WXPA 1MFWA 2DZIA 2QDFA 2PMVA 5D94A 2DZJA 4W9JA 1WWTA 1CK1A 4NNJB 4K7SA 1Q1OA 1KTKA 1LM8B 3U7DA 2JPHA 2WXMA 1GJZA 4USAA 1XLPA 2L1AA 2OEDA 1I4QA 4NAMA 4I6LB 4AOFA 4DXFA 2BPSA 2PLPA 5EE9A 3QIJA 2BKFA 4FA6A 4FXCA 2NVUI 2LWPA 4C00A 1RLFA 5DPTA 3AEDB 1YOVB 2D3CA 3CSTA 2BWFA 4ZRQA 4BZAA 4EFOA 2WS3B 3CSFA 2BB5A 2WXJA 3U8ZA 4HLEA 2QJLA 1WZ0A 4RF0A 2CU1A 1VLBA 3DBHB 1ENFA 3SFEB 1KM7A 3TEYA 3Q3JA 1LGRA 4RNAA 3TMPB 4K3BA 2INCC 2IO1B 4JWUC 2K22A 4XDCA 1I4HA 4WIPA 3U2SC 3V05A 5KHOA 1TTNA 1E8ZA 3BIID 5AZGA 2O6VA 1WM3A 3KH0A 2L00B 1MG4A 5EE0A 2RGFA 4AJWA 2DYMA 1FNUA 1KOTA 2MWSB 2LRWA 2HTHA 3E56A 1K52A 2QIEB 4BAXA 2KMCA 2NBUA 2MBHA 3ZW3A 3MC9A 4MACA 3EUB2 1IYFA 3VAWA 1WMHA 3ETRA 1YN3A 1WI0A 2JYTA 4W9DA 4ARCA 4ICUA 1XXGA 2XBBC 2ZNVB 3W2DA 4A3PA 4ICVA 2D5GA 3PT2B 2FE8A 3CWIA 3N32A 4IC7B 1FD6A 2V3SA 2K6DB 3ZTDA 2JUOA 1XCTL 1XLOA 4NJCA 4EZLA 3QAQA 4FULA 1PGXA 4KDLB 1KFYB 3JSVB 3B2FA 3R7RA 4WJQA 1UZXB 2BS2B 2KACA 5BYRA 1S1QB 4WURA 1TKGA 1Y8RC 3A4RA 4P1CC 5DCNA 1GNUA 3HIZA 5AEKB 2AYOB 3ZKJC 2CHWA 4IM2A 3AU5A 2W55A 2ZJDA 3DHIC 3TSSA 2C7NB 1FNWA 1V5TA 4MSQB 3ZIMA 3EA6A 1A70A 4I6PA 1SF0A 4WWOA 5GMVA 2W82A 4J3OD 4AP4C 1R4MB 4XC2A 3P4QB 4TV3A 4XWWA 4II3B 2B3AA 3BZDB 2PPHA 3TJPA 2DNFA 3K9OB 2D3GA 4G50A 2K8BA 2INNE 4CQNA 2LZ6A 2C9WB 2PJHA 4DXAB 2BWES 2I2YA 3N3KB 1S3SG 2LMCA 2CHZA 1VCBA 2H89B 2WWZA 5E6NA 3L4PA 4HPPA 3AI5A 4A6QA 2J53A 3ZLZA 3PZ8A 2BYTA 4M0WA 3KUDB 4PS3A 1K8RB 1T5XD 5HHDG 4KSLC 1XCQL 2KDIA 1MHHE 3VVWB 1J7BA 3UQAA 3BY4B 1U4AA 1YMHE 4P16A 1L0XB 1E7UA 2KNBA 3N20C 1F1HA 2MJ3A 1ET9A 1FFVA 4WWMA 2NS5A 3PVLA 4BKGA 1WX8A 2D3BA 3PGEA 3MP9A 1PGBA 1TY2A 4PS8A 1KRHA 4C7YA 4JE3B 2CS4A 2WYQA 3LB8C 3BK1A 4ARIA 2RD0A 4GU2A 1UH6A 3B1LX 3OG5A 4EE2A 1J0GA 2W3RA 2PEAA 4C4VB 1I4XA 3AM9A 2BS3B 3L10B 1F0ZA 1NEKB 5MPOA 4GDLA 3L08A 3NHEB 2KC2A 1PUTA 5JHBA 3DBRI 2GOWA 2NBWB 2CJOA 1IUEA 3PLVA 1P0RA 1EUVB 4RMAA 1YQ4B 3PREA 2XNAC 4GLSC 2QCZA 4GDKA 2G3QB 2KJHB 1YN5A 3Q14C 2IGGA 3ZUNA 3PRZA 4M00A 1YQBA 2KWDA 1KF6B 3ZDTA 1ZKHA 4LJPB 3VUYA 2ZPYA 3JVZX 1R4NB 1JRUA 2J0MA 1V2YA 2M56B 1H8CA 3AEFB 3U30A 1V5OA 1ZW7A 4OZAA 5DPWA 1ZXHA 2LVOA 3KLSX 1FFUA 5JZEB 1TZ1A 1NVID 4M8MA 2X38A 2UU7A 2KFJA 2O2VA 3B08A 4OW0A 3BWUD 2QMTA 2WXNA 5T8IA 1QKZA 4EZJA 3M95A 3L54A 5J2RA 1TGZB 1BXTA 5HFYA 2K9XA 4C4VA 4DBGA 2ZVNA 3BYYB 3MHSD 1VJKA 5G5HA 4ZRIA 5G2NA 3P4RB 4M02A 1EU3A 2ICIA 2LHDA 3Q8BA 4RGMA 2KDFB 2DWQA 1GG3A 1YN4A 5DPRA 3N30A 4K1RB 2EMTA 4HDQA 2KAJA 4HK2A 2QC8A 5D3DA 3AB5A 1QQRA 3Q8EA 4N58A 2IO2B 5D2MB 2MP2A 1RAXA 2R61A 5CX3A 3PS6A 3TBLD 3VTVA 2KWVB 2FCQA 2GBMA 3AXCA 4BOSC 1N5WA 3AE2B 4M0WB 4DXGA 1V97A 3IXSA 3O13A 5IAAC 2L0FA 4A9AA 3QARA 4XWTA 2W54A 3AE3B 3GB1A 2FNJB 4A55A 3C19A 2ZEQA 2KD0A 5TSSA 4BKSD 3D32A 5HKHA 3IT4B 1I4GA 2XN9C 5GXGB 4ZRJA 2M1MA 4NJ7A 1VZ6A 2E6XA 2KVZA 2PKOA 3GE8C 3SDLC 4WWNA 1E7VA 3EHVA 4HJKA 2JU6X 4MJSB 2RMMA 1I35A 4G3XB 2K5PA 5CHWA 1E6EB 2N9PC 3JYUA 2KMAA 4FJVB 3PO0A 3KYCD 3LDZE 5BMGA 5JHAA 4RM8A 1MI0A 2V9HA 1T0SC 1TS2A 2KYWA 3S2AA 2FBWB 5EDSA 3ABVB 1E9MA 3MHZA 3HRDD 1GAQB 3DHGC 2QHOA 2WU5B 2LD9A 1VD2A 2X8XX 1TKEA 4LLGM 2J4XA 4KGRA 4TQ1A 1L0VB 2Z0DB 4PS7A 3TUOA 2M0AA 1A5RA 4WAAA 1WH3A 2Y5CA 3NVWA 4WJPA 1C4PA 3RULA 3VHTC 5AUIA 3URYA 4JGHB 4C56C 2AX5A 4JLCA 4NAWB 1T0QC 2M0XA 4YTNB 1YX5B 2HJ8A 2BYVE 4FHKA 1N63A 2NPTA 2BW2A 3P63A 4KSKC 1OQRA 5H92C 2K25A 2MA9B 4KZCA 3R2IA 1WXMA 4F1SA 2JF5A 1EF5A 1OEYA 1EO6A 1NDDA 3AV8A 1GC6A 1JMLA 3AE7B 3DBRB 2LRUA 1H4RA 5FK9C 3DBLB 2WX1A 3OAWA 3L13A 1TZOA 2N7EA 2MX2A 1MVKA 4G0NB 3SFDB 3T8MA 1L4DB 2J0JA 2KN4A 2QSDA 2CR5A 4CO7A 3TEZA 4NJ6A 4CYEA 1QOBA 2LI5A 3RN9C 2MP2B 3NY5A 4ZYSA 4EUTA 2D3AA 3ZNID 4JPSA 1I4PA 4AJYB 3CMMB 2LASA 1N5XA 4NY0A 4Q2JA 2SAKA 1WE7A 2LJIA 1YX6B 3W9CB 3UQBA 4BBNF 5CHFA 1WX9A 3IAS1 1HA5A 3N1YC 2HDEA 1RYJA 3AE5B 4I6NB 4S17A 1TT5B 2O6VD 2GBKA 1NENB 3NJTA 2DZKA 4GIVA 1P9DU 4AWJA 2DHZA 1YJIA 2JZZA 1N62A 4JIOU 2XK5A 4BKTA 2K8CA 3VTWA 2WNMA 1WRDB 1XT9B 3QCAA 4HWIB 1KH0A 4LJOB 1J7CA 4RM9A 2WXQA 2WXRA 4ZOHC 5LLIA 1SE9A 4KIKB 5IP4D 1Z5SB 2FIFA 3W5VB 2K39A 4OVZA 4K3CA 1LFDA 3P2BA 3QQ8B 3JSVA 2EKEC 3KWLA 2WDVB 2MQJA 3KYDD 3NS8A 3TL5A 4RH6A 4KGSA 4KKIA 1HXYD 4JQWC 1EU4A 1K50A 4LNKA 2KFKB 3A1QA 3ZXVA 3IVFA 1E7PB 3A4SC 2WXKA 2KZRA 4AS1A 4RGTA 4WJOA 1L0YB 1HZ5A 1OEYJ 5D3IB 4W9LA 3Q3FA 1HTQA 4NZLB 3DHHC 1SBBB 4ZHPA 2CKHB 1TS4A 4JL9A 5HI1A 2EKIA 1PYWD 1XD3B 3BK2A 4BVUC 1D3ZA 4YSYB 3SD5A 3P4PB 1L7YA 3MJWA 3V61A 2KHWB 3V60A 1GUAB 2PIAA 3ZQ4A 5JH5C 1V1PA 2L83A 2CU3A 3EGRA 2IGHA 1ET6A 1XF5L 3Q6BA 1JWUD 1ZDVA 2RPVA 4H2AA 4N9F4 2GI9A 3DBHI
chains in the Genus database with same CATH topology
2PE9A 3DBRI 2GOWA 2NBWB 2V1YA 3EFUA 4FADA 3PLVA 1P0RA 4AUQC 1EUVB 4RMAA 5DPSA 3SU8X 1E90A 2D11A 1WIAA 3PREA 4IUMB 1WJ6A 3VFKA 1WJ4A 3IFWB 4MDKE 4TKNA 5TR5A 3PLUA 2N9XA 2ZCCA 3JW0X 4GDKA 2A5UA 2G3QB 2KJHB 4MEMA 5D7GA 5BO4B 3WIMA 1V49A 1WGHA 1Q5WB 2KWCA 2DYOA 3ZUNA 3PRZA 1V86A 4LCDE 1YQBA 3PRPB 2IO0B 3ZDTA 3L17A 3RZWC 2R2OA 1ZKHA 2G4DB 2JT4B 4LJPB 2ZPYA 3JVZX 3VUYA 3DBSA 2AL6A 3A9KA 1P98A 2EMSA 3HM3A 3M63B 1JRUA 3WAPA 1P1AA 2J0MA 3QWZB 3TIXA 3L0WB 1V2YA 2DX5B 3TCAA 1H8CA 2ZPNA 5E6PA 3U30A 5AZHA 1LXDA 2OJRA 1ZGUB 1V5OA 1ZW7A 3QJZA 5DPWA 3ENEA 4F7ZA 2LVOA 3SHQA 1UGMA 1C1YB 3UINB 4E3CA 2D10A 1G6JA 2IY0B 2L7RA 5JZEB 5D6JB 1TZ1A 2C60A 4GGQA 4MGZE 3HM6X 3ML8A 4M8MA 2BF8B 2M4NA 1F9JA 3ZNZB 2KFJA 2MSED 2O2VA 4W9CA 1E8YA 1J19A 3B08A 2VRRB 2MBOA 2ZZPB 2IO3B 4OVUA 4OVVA 4NQLB 4E71A 2J7QB 2KX0A 1YJ1A 3A1QB 3WA0A 1RFAA 4EZJA 2KJ6A 3A9JA 3QK0A 4HDOA 3KW5B 3RCZA 2LVQA 3GOEA 3L54A 3M95A 5J2RA 2XK5B 4MJSA 2JRHA 1UBQA 3LJ3A 1AARA 3EC8A 3ZRFA 4MH0E 4ANVA 2KFKA 1TGZB 2NCNA 3NZUA 3VH4B 2Z59B 2HD5B 1LQBA 2Y5BB 2KQSA 2O6VB 1PQSA 4DBGA 4W9GA 2R2QA 2M17A 2ZVNA 1WJNA 2REXA 2LXCA 4ANUA 3IG3A 1T0YA 2JY6A 3MHSD 2LVPA 2V4LA 4ZRIA 4W9KA 5G2NA 3X23A 4GSWA 2KLGA 1HE8A 2XEWA 3W1YA 4IWPA 2ZVOA 2IBIB 3ZRCA 3W1SC 1ISNA 2FCSA 4MGIE 1YIWA 2KDFB 1V81A 1WGDA 4FLHA 2LGYA 1V9JA 3CF6E 1GG3A 4KV2A 3IBEA 4B9KA 1E8WA 5DPRA 2DZMA 3N30A 2EMTA 1WX7A 4K1RB 4KVGB 4HDQA 5J18A 4HCNB 3VUWA 3ZO5B 4ANWA 4HK2A 3VTUA 2PE6B 2FAZA 4EEWA 3O65B 4FJZA 3ALBA 2LXAA 4DDID 2GBNA 2IO2B 2KVRA 1UD7A 5D2MB 2KTRB 4II2B 3RZFA 1X1MA 2MP2A 1RAXA 4K81A 5E6OA 4MGKE 5CX3A 4FN2A 4CHKA 2JXXA 1OTRB 3PS6A 3TBLD 3VTVA 4B6WA 2KWVB 2FCQA 2AEHA 2GBMA 1WY8A 2OOBB 3M62B 3AXCA 4BOSC 3W1SA 4M0WB 3PTFC 2N7DA 4URKA 4XZ4A 2ZNVC 3WANA 2LGDA 3NOBA 5IAAC 2L0FA 3QARA 3QX1A 3DOWA 3NHEB 1UELA 2DAFA 2K8HA 2M8SA 5CTRC 4DHZE 2DZIA 2I1KA 2K6QA 1V6EA 2FNJB 4E74A 1KLVA 4IW0A 4DHJD 2ZEQA 2KD0A 1WE6A 5D94A 4BKSD 1C3TA 4ZRKA 3D32A 2AWTA 2DZJA 4W9JA 5HKHA 4NNJB 2C7MB 4K7SA 1Q1OA 3DDCB 2L05A 3H7SA 1LM8B 3U7DA 4KIKA 4HVBA 3ML9A 2JPHA 2M1MA 4ZRJA 4HXDA 4NJ7A 1GJZA 2A4ZA 3SDLC 2RPQA 4WWNA 4AOFA 1E7VA 3EHVA 4I6LB 2BPSA 1KJTA 1R4NI 4NAWA 2N4FA 2GMIC 4HJKA 4MJSB 3QIJA 4YL8A 2BKFA 3VH3B 4FA6A 1I35A 2NVUI 2LWPA 4G3XB 1RLFA 5DPTA 5CHWA 3EECA 4G11A 1WZ3A 3CSTA 2N9PC 2BWFA 3JYUA 2MW5A 2L0TA 4EFOA 4NPNA 1WGYA 4X57B 2KMAA 3CSFA 4FJVB 4BKSA 2HE7A 2JZ3B 3KYCD 3LDZE 3U8ZA 4HLEA 5JHAA 1WZ0A 4RM8A 3M3JA 2CU1A 2KANA 1KM7A 2JVCA 3UIPB 1BT0A 3Q3JA 4K7UA 2FCNA 3TMPB 2IO1B 3DVNU 3S2AA 5EDSA 2FUHB 3A33B 4DDGD 3AU4A 5KHOA 1IP9A 1TTNA 1E8ZA 3APFA 5AZGA 3RD2A 2O6VA 1WM3A 4XX5A 2UYZB 2QHOA 3KH0A 4PYUA 2IY1B 2LD9A 1VD2A 2BYEA 2L00B 3A9JB 2RGFA 5L83A 1I42A 3IHPC 4AJWA 2CHXA 2KN5A 1NI2A 2Z0DB 4PS7A 2DYMA 4TQ1A 4WQOB 1A5RA 4WAAA 1WH3A 3PPAA 1KOTA 2MWSB 4ASWC 4WJPA 2LRWA 3H7PB 3RULA 3VHTC 2YVCA 2HTHA 1EF1A 4JGHB 1IPGA 3I3TB 4JLCA 2KMCA 2L3ZA 2NBUA 2MBHA 3DPDA 3R66C 4W9FA 3ZW3A 2FCMA 3QHTA 4NAWB 2Z0EB 2G45B 3OJ3A 4IWQA 2M0XA 5CHVC 5AZFA 1IYFA 2NBVB 2KDEB 3VAWA 4FBJB 1L2NA 1YX5B 1WMHA 1NBFC 3PHXB 4HPMB 2HJ8A 4GDLB 1WXAA 4BOZB 2DYBA 1WI0A 2BYVE 2BGFA 3VXWA 4W9DA 5LXHA 4FHKA 3DBLI 4ICUA 2XBBC 3AULA 4ANXA 2ZNVB 3KVFB 2NPTA 4KSKC 4EKUA 2IYDB 4A3PA 4ICVA 1WM2A 2MLBA 2K25A 4GMVA 3PT2B 2WX0A 2C5LC 5G55A 2MA9B 4KZCA 1WXMA 4F1SA 4LDTD 3PHWB 3N32A 4IC7B 4TQ0A 2V3SA 3H9DA 2JF5A 1EF5A 1OEYA 2K6DB 2KO3A 2KQ7A 2FIDA 2N1WA 3OJ4B 1EO6A 2GBJA 1NDDA 3ZTDA 2JUOA 1GC6A 4K7WA 5J17A 2KX3A 4EZLA 3QAQA 4PYZA 4FULA 3K9PB 2LRUA 1H4RA 4KDLB 2KLCA 3ONSA 4DK5A 3A9KB 3JSVB 2N1VA 2WX1A 3OLMD 3R7RA 3OAWA 3L13A 3DVNV 4WJQA 1UZXB 2N7EA 2MX2A 4G0NB 1S1QB 1OGWA 1Y8RC 3T8MA 4IG7B 3WAMA 3A4RA 2J0JA 1WR6E 4FHJA 1E5WA 2JWZA 4MSMB 3L16A 5DCNA 1GNUA 2CR5A 3HIZA 3MTNB 4CO7A 5AEKB 2KK8A 2MRPA 2AYOB 3ZKJC 3C0RB 4NJ6A 4CYEA 1Z2MA 2LI5A 2CHWA 2MP2B 2MBEA 4IM2A 3AU5A 2MBQA 3NY5A 4IWOA 3UF8A 2ZJDA 3PV1A 4EUTA 2NPTB 2LJ5A 3VUXA 3PZDA 4KZ0A 5FR6A 2LGXA 3ZNID 3KUZA 2C7NB 3DQVA 1V5TA 4MSQB 4AJYB 3CMMB 2LASA 1CMXB 2K1FA 2L76A 4WJNA 3ZIMA 1WYWB 4NY0A 4EOYA 1WE7A 5C23A 1YX6B 4I6PA 3UQBA 2KJRA 4WWOA 4BBNF 1E8XA 5GMVA 4GOCA 5CHFA 1WX9A 1WGGA 4AP4C 2W9NA 3RYTA 1RRBA 4XC2A 4DHZB 1OQYA 1GC7A 4WWPA 2J0KA 4FJYA 4TV3A 2IZVB 2KTRA 3V6EB 2I1JA 4II3B 4I6NB 4DWFA 2B3AA 2O6VD 2GBKA 5C1ZA 4DHJB 2PPHA 2NR2A 3TJPA 3UGBB 4ZDVA 2DZKA 3K9OB 4GIVA 4GB9A 3ZTCA 2D3GA 1P9DU 2KC1A 3ZNGC 2DHZA 4AWJA 1P3QU 2K8BA 2JZZA 4G50A 2KWUB 2ZCBA 2XK5A 4JIOU 4BKTA 2K8CA 1SIFA 3ZVVA 2LZ6A 2C9WB 2O2VB 3VTWA 3WALA 1WRDB 2PJHA 2GBRA 1XT9B 1FXTB 4DXAB 3QA8A 3QCAA 2BWES 4B95A 4HWIB 1YD8U 1WFYA 5L95C 2YLMA 3PSEB 3X0WA 3N3KB 1S3SG 4LJOB 2UWQA 1WXVA 2CHZA 4A20A 4HCPB 2RR9A 1VCBA 4RM9A 3H1UA 5LLIA 1SE9A 3APCA 2AL3A 3ZNHB 4GXBA 4KIKB 3V62A 1WMHB 4GN1A 1WJUA 1Z5SB 2MCNB 4GDKB 1V80A 4EZKA 2ASQA 1SGHA 2FIFA 2D07B 2WWZA 2DAJA 3V6CB 1QZEA 2K39A 5E6NA 2D2QA 3R7QA 3UIOB 4J6IA 1LFDA 3AI5A 3P2BA 3T9LA 3QQ8B 4W9HA 4KDIC 1M94A 3JSVA 3KUCB 3DVGY 2EKEC 4M8NA 3ZLZA 2LUEA 2MQJA 3KYDD 3NS8A 3TL5A 3WAOA 3BINA 1UBIA 2L8JA 3KUDB 3R3MA 4PS3A 4BBNC 1MG8A 4ZYNA 3ZDMC 1K8RB 3NZSA 4JQWC 4MGYE 3HK0A 2N9EB 3HHMA 2G4SA 2KFKB 3QC8B 2KKCA 2KDBA 3A1QA 4KSLC 2WDTB 4BFRA 2KDIA 1WXSA 3VVWB 2BYFA 3IVFA 3UQAA 3BY4B 3A4SC 1U4AA 2DENB 2KZRA 3RUIB 1E7UA 2KNBA 3DVGX 4TUUA 3VQIA 4W9IA 5IA7A 4MM3A 3VDZA 4WJOA 2KOXA 1J8CA 1OEYJ 4W9LA 2NS5A 3Q3FA 3PVLA 4BKGA 1WX8A 2JRIB 3PGEA 3PRMB 4IM0A 2MBBB 3H6NA 4PS8A 2CKHB 5LXIB 1WF9A 4HPLB 5KHQA 4A3OA 4JL9A 3DCGA 2CS4A 2WYQA 1XD3B 3APDA 4BVUC 1D3ZA 1R4MI 4MELA 1TBEA 3SD5A 3B0AA 2KXJA 1XQQA 1L7YA 2RSUA 2RD0A 3MJWA 4LDTB 4GU2A 4IM3A 1UH6A 2KHWB 2KTFA 3V61A 1Q0WB 3B1LX 1GUAB 3GZNI 4P7IA 3V60A 1J0GA 2PEAA 3H7PA 5JH5C 4F8CB 4W9EA 3L10B 3ECIA 3RT3B 1WGRA 4NQKE 2C7HA 2BKRB 4N9F4 4GDLA 3L08A 2KC2A 5JHBA 1WR1A 3DBHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PE9 A;  3DBR I;  2GOW A;  2NBW B;  2V1Y A;  3EFU A;  4FAD A;  3PLV A;  1P0R A;  4AUQ C;  1EUV B;  4RMA A;  5DPS A;  3SU8 X;  1E90 A;  2D11 A;  1WIA A;  3PRE A;  4IUM B;  1WJ6 A;  3VFK A;  1WJ4 A;  3IFW B;  4MDK E;  4TKN A;  5TR5 A;  3PLU A;  2N9X A;  2ZCC A;  3JW0 X;  4GDK A;  2A5U A;  2G3Q B;  2KJH B;  4MEM A;  5D7G A;  5BO4 B;  3WIM A;  1V49 A;  1WGH A;  1Q5W B;  2KWC A;  2DYO A;  3ZUN A;  3PRZ A;  1V86 A;  4LCD E;  1YQB A;  3PRP B;  2IO0 B;  3ZDT A;  3L17 A;  3RZW C;  2R2O A;  1ZKH A;  2G4D B;  2JT4 B;  4LJP B;  2ZPY A;  3JVZ X;  3VUY A;  3DBS A;  2AL6 A;  3A9K A;  1P98 A;  2EMS A;  3HM3 A;  3M63 B;  1JRU A;  3WAP A;  1P1A A;  2J0M A;  3QWZ B;  3TIX A;  3L0W B;  1V2Y A;  2DX5 B;  3TCA A;  1H8C A;  2ZPN A;  5E6P A;  3U30 A;  5AZH A;  1LXD A;  2OJR A;  1ZGU B;  1V5O A;  1ZW7 A;  3QJZ A;  5DPW A;  3ENE A;  4F7Z A;  2LVO A;  3SHQ A;  1UGM A;  1C1Y B;  3UIN B;  4E3C A;  2D10 A;  1G6J A;  2IY0 B;  2L7R A;  5JZE B;  5D6J B;  1TZ1 A;  2C60 A;  4GGQ A;  4MGZ E;  3HM6 X;  3ML8 A;  4M8M A;  2BF8 B;  2M4N A;  1F9J A;  3ZNZ B;  2KFJ A;  2MSE D;  2O2V A;  4W9C A;  1E8Y A;  1J19 A;  3B08 A;  2VRR B;  2MBO A;  2ZZP B;  2IO3 B;  4OVU A;  4OVV A;  4NQL B;  4E71 A;  2J7Q B;  2KX0 A;  1YJ1 A;  3A1Q B;  3WA0 A;  1RFA A;  4EZJ A;  2KJ6 A;  3A9J A;  3QK0 A;  4HDO A;  3KW5 B;  3RCZ A;  2LVQ A;  3GOE A;  3L54 A;  3M95 A;  5J2R A;  2XK5 B;  4MJS A;  2JRH A;  1UBQ A;  3LJ3 A;  1AAR A;  3EC8 A;  3ZRF A;  4MH0 E;  4ANV A;  2KFK A;  1TGZ B;  2NCN A;  3NZU A;  3VH4 B;  2Z59 B;  2HD5 B;  1LQB A;  2Y5B B;  2KQS A;  2O6V B;  1PQS A;  4DBG A;  4W9G A;  2R2Q A;  2M17 A;  2ZVN A;  1WJN A;  2REX A;  2LXC A;  4ANU A;  3IG3 A;  1T0Y A;  2JY6 A;  3MHS D;  2LVP A;  2V4L A;  4ZRI A;  4W9K A;  5G2N A;  3X23 A;  4GSW A;  2KLG A;  1HE8 A;  2XEW A;  3W1Y A;  4IWP A;  2ZVO A;  2IBI B;  3ZRC A;  3W1S C;  1ISN A;  2FCS A;  4MGI E;  1YIW A;  2KDF B;  1V81 A;  1WGD A;  4FLH A;  2LGY A;  1V9J A;  3CF6 E;  1GG3 A;  4KV2 A;  3IBE A;  4B9K A;  1E8W A;  5DPR A;  2DZM A;  3N30 A;  2EMT A;  1WX7 A;  4K1R B;  4KVG B;  4HDQ A;  5J18 A;  4HCN B;  3VUW A;  3ZO5 B;  4ANW A;  4HK2 A;  3VTU A;  2PE6 B;  2FAZ A;  4EEW A;  3O65 B;  4FJZ A;  3ALB A;  2LXA A;  4DDI D;  2GBN A;  2IO2 B;  2KVR A;  1UD7 A;  5D2M B;  2KTR B;  4II2 B;  3RZF A;  1X1M A;  2MP2 A;  1RAX A;  4K81 A;  5E6O A;  4MGK E;  5CX3 A;  4FN2 A;  4CHK A;  2JXX A;  1OTR B;  3PS6 A;  3TBL D;  3VTV A;  4B6W A;  2KWV B;  2FCQ A;  2AEH A;  2GBM A;  1WY8 A;  2OOB B;  3M62 B;  3AXC A;  4BOS C;  3W1S A;  4M0W B;  3PTF C;  2N7D A;  4URK A;  4XZ4 A;  2ZNV C;  3WAN A;  2LGD A;  3NOB A;  5IAA C;  2L0F A;  3QAR A;  3QX1 A;  3DOW A;  3NHE B;  1UEL A;  2DAF A;  2K8H A;  2M8S A;  5CTR C;  4DHZ E;  2DZI A;  2I1K A;  2K6Q A;  1V6E A;  2FNJ B;  4E74 A;  1KLV A;  4IW0 A;  4DHJ D;  2ZEQ A;  2KD0 A;  1WE6 A;  5D94 A;  4BKS D;  1C3T A;  4ZRK A;  3D32 A;  2AWT A;  2DZJ A;  4W9J A;  5HKH A;  4NNJ B;  2C7M B;  4K7S A;  1Q1O A;  3DDC B;  2L05 A;  3H7S A;  1LM8 B;  3U7D A;  4KIK A;  4HVB A;  3ML9 A;  2JPH A;  2M1M A;  4ZRJ A;  4HXD A;  4NJ7 A;  1GJZ A;  2A4Z A;  3SDL C;  2RPQ A;  4WWN A;  4AOF A;  1E7V A;  3EHV A;  4I6L B;  2BPS A;  1KJT A;  1R4N I;  4NAW A;  2N4F A;  2GMI C;  4HJK A;  4MJS B;  3QIJ A;  4YL8 A;  2BKF A;  3VH3 B;  4FA6 A;  1I35 A;  2NVU I;  2LWP A;  4G3X B;  1RLF A;  5DPT A;  5CHW A;  3EEC A;  4G11 A;  1WZ3 A;  3CST A;  2N9P C;  2BWF A;  3JYU A;  2MW5 A;  2L0T A;  4EFO A;  4NPN A;  1WGY A;  4X57 B;  2KMA A;  3CSF A;  4FJV B;  4BKS A;  2HE7 A;  2JZ3 B;  3KYC D;  3LDZ E;  3U8Z A;  4HLE A;  5JHA A;  1WZ0 A;  4RM8 A;  3M3J A;  2CU1 A;  2KAN A;  1KM7 A;  2JVC A;  3UIP B;  1BT0 A;  3Q3J A;  4K7U A;  2FCN A;  3TMP B;  2IO1 B;  3DVN U;  3S2A A;  5EDS A;  2FUH B;  3A33 B;  4DDG D;  3AU4 A;  5KHO A;  1IP9 A;  1TTN A;  1E8Z A;  3APF A;  5AZG A;  3RD2 A;  2O6V A;  1WM3 A;  4XX5 A;  2UYZ B;  2QHO A;  3KH0 A;  4PYU A;  2IY1 B;  2LD9 A;  1VD2 A;  2BYE A;  2L00 B;  3A9J B;  2RGF A;  5L83 A;  1I42 A;  3IHP C;  4AJW A;  2CHX A;  2KN5 A;  1NI2 A;  2Z0D B;  4PS7 A;  2DYM A;  4TQ1 A;  4WQO B;  1A5R A;  4WAA A;  1WH3 A;  3PPA A;  1KOT A;  2MWS B;  4ASW C;  4WJP A;  2LRW A;  3H7P B;  3RUL A;  3VHT C;  2YVC A;  2HTH A;  1EF1 A;  4JGH B;  1IPG A;  3I3T B;  4JLC A;  2KMC A;  2L3Z A;  2NBU A;  2MBH A;  3DPD A;  3R66 C;  4W9F A;  3ZW3 A;  2FCM A;  3QHT A;  4NAW B;  2Z0E B;  2G45 B;  3OJ3 A;  4IWQ A;  2M0X A;  5CHV C;  5AZF A;  1IYF A;  2NBV B;  2KDE B;  3VAW A;  4FBJ B;  1L2N A;  1YX5 B;  1WMH A;  1NBF C;  3PHX B;  4HPM B;  2HJ8 A;  4GDL B;  1WXA A;  4BOZ B;  2DYB A;  1WI0 A;  2BYV E;  2BGF A;  3VXW A;  4W9D A;  5LXH A;  4FHK A;  3DBL I;  4ICU A;  2XBB C;  3AUL A;  4ANX A;  2ZNV B;  3KVF B;  2NPT A;  4KSK C;  4EKU A;  2IYD B;  4A3P A;  4ICV A;  1WM2 A;  2MLB A;  2K25 A;  4GMV A;  3PT2 B;  2WX0 A;  2C5L C;  5G55 A;  2MA9 B;  4KZC A;  1WXM A;  4F1S A;  4LDT D;  3PHW B;  3N32 A;  4IC7 B;  4TQ0 A;  2V3S A;  3H9D A;  2JF5 A;  1EF5 A;  1OEY A;  2K6D B;  2KO3 A;  2KQ7 A;  2FID A;  2N1W A;  3OJ4 B;  1EO6 A;  2GBJ A;  1NDD A;  3ZTD A;  2JUO A;  1GC6 A;  4K7W A;  5J17 A;  2KX3 A;  4EZL A;  3QAQ A;  4PYZ A;  4FUL A;  3K9P B;  2LRU A;  1H4R A;  4KDL B;  2KLC A;  3ONS A;  4DK5 A;  3A9K B;  3JSV B;  2N1V A;  2WX1 A;  3OLM D;  3R7R A;  3OAW A;  3L13 A;  3DVN V;  4WJQ A;  1UZX B;  2N7E A;  2MX2 A;  4G0N B;  1S1Q B;  1OGW A;  1Y8R C;  3T8M A;  4IG7 B;  3WAM A;  3A4R A;  2J0J A;  1WR6 E;  4FHJ A;  1E5W A;  2JWZ A;  4MSM B;  3L16 A;  5DCN A;  1GNU A;  2CR5 A;  3HIZ A;  3MTN B;  4CO7 A;  5AEK B;  2KK8 A;  2MRP A;  2AYO B;  3ZKJ C;  3C0R B;  4NJ6 A;  4CYE A;  1Z2M A;  2LI5 A;  2CHW A;  2MP2 B;  2MBE A;  4IM2 A;  3AU5 A;  2MBQ A;  3NY5 A;  4IWO A;  3UF8 A;  2ZJD A;  3PV1 A;  4EUT A;  2NPT B;  2LJ5 A;  3VUX A;  3PZD A;  4KZ0 A;  5FR6 A;  2LGX A;  3ZNI D;  3KUZ A;  2C7N B;  3DQV A;  1V5T A;  4MSQ B;  4AJY B;  3CMM B;  2LAS A;  1CMX B;  2K1F A;  2L76 A;  4WJN A;  3ZIM A;  1WYW B;  4NY0 A;  4EOY A;  1WE7 A;  5C23 A;  1YX6 B;  4I6P A;  3UQB A;  2KJR A;  4WWO A;  4BBN F;  1E8X A;  5GMV A;  4GOC A;  5CHF A;  1WX9 A;  1WGG A;  4AP4 C;  2W9N A;  3RYT A;  1RRB A;  4XC2 A;  4DHZ B;  1OQY A;  1GC7 A;  4WWP A;  2J0K A;  4FJY A;  4TV3 A;  2IZV B;  2KTR A;  3V6E B;  2I1J A;  4II3 B;  4I6N B;  4DWF A;  2B3A A;  2O6V D;  2GBK A;  5C1Z A;  4DHJ B;  2PPH A;  2NR2 A;  3TJP A;  3UGB B;  4ZDV A;  2DZK A;  3K9O B;  4GIV A;  4GB9 A;  3ZTC A;  2D3G A;  1P9D U;  2KC1 A;  3ZNG C;  2DHZ A;  4AWJ A;  1P3Q U;  2K8B A;  2JZZ A;  4G50 A;  2KWU B;  2ZCB A;  2XK5 A;  4JIO U;  4BKT A;  2K8C A;  1SIF A;  3ZVV A;  2LZ6 A;  2C9W B;  2O2V B;  3VTW A;  3WAL A;  1WRD B;  2PJH A;  2GBR A;  1XT9 B;  1FXT B;  4DXA B;  3QA8 A;  3QCA A;  2BWE S;  4B95 A;  4HWI B;  1YD8 U;  1WFY A;  5L95 C;  2YLM A;  3PSE B;  3X0W A;  3N3K B;  1S3S G;  4LJO B;  2UWQ A;  1WXV A;  2CHZ A;  4A20 A;  4HCP B;  2RR9 A;  1VCB A;  4RM9 A;  3H1U A;  5LLI A;  1SE9 A;  3APC A;  2AL3 A;  3ZNH B;  4GXB A;  4KIK B;  3V62 A;  1WMH B;  4GN1 A;  1WJU A;  1Z5S B;  2MCN B;  4GDK B;  1V80 A;  4EZK A;  2ASQ A;  1SGH A;  2FIF A;  2D07 B;  2WWZ A;  2DAJ A;  3V6C B;  1QZE A;  2K39 A;  5E6N A;  2D2Q A;  3R7Q A;  3UIO B;  4J6I A;  1LFD A;  3AI5 A;  3P2B A;  3T9L A;  3QQ8 B;  4W9H A;  4KDI C;  1M94 A;  3JSV A;  3KUC B;  3DVG Y;  2EKE C;  4M8N A;  3ZLZ A;  2LUE A;  2MQJ A;  3KYD D;  3NS8 A;  3TL5 A;  3WAO A;  3BIN A;  1UBI A;  2L8J A;  3KUD B;  3R3M A;  4PS3 A;  4BBN C;  1MG8 A;  4ZYN A;  3ZDM C;  1K8R B;  3NZS A;  4JQW C;  4MGY E;  3HK0 A;  2N9E B;  3HHM A;  2G4S A;  2KFK B;  3QC8 B;  2KKC A;  2KDB A;  3A1Q A;  4KSL C;  2WDT B;  4BFR A;  2KDI A;  1WXS A;  3VVW B;  2BYF A;  3IVF A;  3UQA A;  3BY4 B;  3A4S C;  1U4A A;  2DEN B;  2KZR A;  3RUI B;  1E7U A;  2KNB A;  3DVG X;  4TUU A;  3VQI A;  4W9I A;  5IA7 A;  4MM3 A;  3VDZ A;  4WJO A;  2KOX A;  1J8C A;  1OEY J;  4W9L A;  2NS5 A;  3Q3F A;  3PVL A;  4BKG A;  1WX8 A;  2JRI B;  3PGE A;  3PRM B;  4IM0 A;  2MBB B;  3H6N A;  4PS8 A;  2CKH B;  5LXI B;  1WF9 A;  4HPL B;  5KHQ A;  4A3O A;  4JL9 A;  3DCG A;  2CS4 A;  2WYQ A;  1XD3 B;  3APD A;  4BVU C;  1D3Z A;  1R4M I;  4MEL A;  1TBE A;  3SD5 A;  3B0A A;  2KXJ A;  1XQQ A;  1L7Y A;  2RSU A;  2RD0 A;  3MJW A;  4LDT B;  4GU2 A;  4IM3 A;  1UH6 A;  2KHW B;  2KTF A;  3V61 A;  1Q0W B;  3B1L X;  1GUA B;  3GZN I;  4P7I A;  3V60 A;  1J0G A;  2PEA A;  3H7P A;  5JH5 C;  4F8C B;  4W9E A;  3L10 B;  3ECI A;  3RT3 B;  1WGR A;  4NQK E;  2C7H A;  2BKR B;  4N9F 4;  4GDL A;  3L08 A;  2KC2 A;  5JHB A;  1WR1 A;  3DBH I; 
#chains in the Genus database with same CATH topology
 3EFU A;  5DPS A;  1WJ6 A;  1FPY A;  4MDK E;  1EWC A;  4ZHO A;  3JW0 X;  2WGS A;  5AUK A;  3WIM A;  3GZN B;  1WGH A;  2JYE A;  1GB4 A;  4LCD E;  1ZDX A;  2G4D B;  2JT4 B;  1F52 A;  2WLB A;  3DBS A;  1EM7 A;  3FC4 A;  3M63 B;  3WAP A;  3TIX A;  2NTT A;  1FCL A;  2ZPN A;  5E6P A;  4OHJ A;  1LXD A;  3LYY A;  1C78 A;  2L7R A;  4MGZ E;  3ML8 A;  1C4A A;  4WQM A;  2JQR B;  3ZNZ B;  4W9C A;  2MSE D;  1T0R C;  4LNI A;  4E71 A;  4JWS C;  5LNK 1;  4HDO A;  3QK0 A;  2LVQ A;  3ZGZ A;  1UBQ A;  1AAR A;  4ANV A;  2KFK A;  4W9G A;  2R2Q A;  2M17 A;  2LXC A;  4W9K A;  4YTM B;  3X23 A;  2IDY A;  4GSW A;  1HE8 A;  3ZRC A;  2MHJ A;  1YIW A;  1V81 A;  1WGD A;  3Q2A C;  4FLH A;  2DLB A;  4US9 A;  2QEJ C;  3AEA B;  4KV2 A;  1ESF A;  3AE1 B;  2MH7 A;  1QT9 A;  1L6U A;  2PE6 B;  3H8H A;  3O65 B;  4HKZ E;  4YSZ B;  4II2 B;  1X1M A;  1FCC C;  1AYF A;  4FN2 A;  1JWA D;  4CHK A;  4B6W A;  2AEH A;  3M62 B;  3N9Y C;  1TY0 A;  2VZK B;  1N6Z A;  2N7D A;  3WAN A;  2LGD A;  3NOB A;  1NYR A;  3QX1 A;  3DOW A;  1UEL A;  4IKG A;  2M8S A;  2I38 A;  3Q8C A;  5CTR C;  4E74 A;  1V6E A;  1KLV A;  4IW0 A;  4DHJ D;  1WE6 A;  4XGA B;  4ZRK A;  2AWT A;  1KLG D;  2C7M B;  2WU2 B;  2L05 A;  4HRO A;  4HVB A;  3ML9 A;  1E0Z A;  2L32 A;  4TMA B;  5BYS A;  1FMA D;  2RDB C;  4YL8 A;  3VH3 B;  1FEH A;  2AQ3 B;  4G11 A;  2MW5 A;  2J52 A;  1HZ6 A;  4X57 B;  1JAL A;  2BS4 B;  4BKS A;  3Q8A A;  3VRA B;  2G9H D;  1RM6 C;  3GE3 C;  1FXI A;  2JVC A;  1BT0 A;  4K7U A;  4ZRP A;  3UIP B;  1V1P B;  2FCN A;  4XE0 A;  1OQQ A;  3RI7 C;  2FUH B;  3A33 B;  2B76 B;  3AU4 A;  5IN7 A;  2V3N A;  4RFB A;  3APF A;  3RD2 A;  2L52 A;  4XX5 A;  4PYU A;  1I42 A;  1GOZ A;  3IHP C;  2BTE A;  1PDX A;  1KLU D;  1SSN A;  3PPA A;  2K3U A;  1FM0 D;  3RNG C;  3I3T B;  3DPD A;  3R66 C;  4W9F A;  1TYG B;  1FXA A;  2FCM A;  3QHT A;  2G45 B;  3OJ3 A;  5CHV C;  1IBX A;  2KDE B;  4FBJ B;  4KKJ A;  1NBF C;  3N1Z C;  3PHX B;  4GDL B;  1WXA A;  4BOZ B;  2BGF A;  3VXW A;  5LXH A;  3DBL I;  4ANX A;  3U52 E;  1UUP A;  1WXQ A;  3PZ7 A;  2CJN A;  4EKU A;  3SEB A;  2IYD B;  2LHE A;  1TJE A;  3E9S A;  4GMV A;  3I63 C;  2W3S A;  3PHW B;  1SB3 C;  1JCK B;  2N1W A;  3OJ4 B;  4K7W A;  2KX3 A;  4B0E A;  3K9P B;  2KLC A;  3A9K B;  3TEW A;  3SR6 A;  2N1V A;  3OLM D;  2YEP B;  2H88 B;  3AE8 B;  1F77 A;  2IPK D;  4N59 A;  4IG7 B;  3WAM A;  1E5W A;  2JWZ A;  1K51 A;  4MSM B;  3L16 A;  5IOI A;  2IND C;  1J7A A;  3I9V 1;  1MHX A;  1B1Z A;  1Z2M A;  3W5U B;  4IWO A;  2MBQ A;  3PV1 A;  2LJ5 A;  3VUX A;  3PZD A;  5FR6 A;  3T3O A;  1YQ3 B;  2LGX A;  3RNC C;  3KUZ A;  4XYC A;  3TEX A;  1E10 A;  1CMX B;  2K1F A;  2L76 A;  3VRB B;  1VDV A;  1C76 A;  1SIJ A;  2KJR A;  4GOC A;  1AWD A;  4IOI E;  4YTP B;  3NVZ A;  3RYT A;  4DHZ B;  1GC7 A;  2J0K A;  4FJY A;  2IZV B;  4KX6 B;  2NTS A;  2KTR A;  2LGS A;  4N6E B;  4DHJ B;  2LFI A;  3UGB B;  3Q8F A;  1ZUD 2;  1IGD A;  5C2T B;  2KC1 A;  3ZNG C;  3RPF C;  2KWU B;  3ZVV A;  5BMH A;  2GBR A;  1FXT B;  3QA8 A;  3ZJV A;  3AE6 B;  1YD8 U;  1WFY A;  5L95 C;  4A20 A;  4HCP B;  1SJH D;  4YWG G;  2PW9 A;  2Y5P A;  3N1X C;  3ZNH B;  1RWS A;  1VR9 A;  3V62 A;  1WMH B;  4GDK B;  3U7Z A;  2ASQ A;  1SGH A;  2D07 B;  2DAJ A;  2JWU A;  2D2Q A;  3R7Q A;  3UIO B;  3T9L A;  2VH2 A;  5G5G A;  3KUC B;  4M8N A;  2JSV X;  1XLN A;  2HTM E;  3BIN A;  1UBI A;  3R3M A;  4BBN C;  1MG8 A;  3ZDM C;  2G4S A;  3QC8 B;  2KKC A;  3WCQ A;  2BYF A;  2DEN B;  1DOY A;  3RUI B;  4TUU A;  4P6V F;  3VQI A;  4MM3 A;  3VDZ A;  1J8C A;  1QOG A;  4HKQ A;  4C7Z A;  4B0M A;  2JRI B;  2LUM A;  4IM0 A;  3PRM B;  2MBB B;  2MJE A;  2VZK D;  5LXI B;  1C4C A;  1WF9 A;  1WYG A;  4WAF A;  5KHQ A;  4A3O A;  3DCG A;  3MC0 B;  3OWE B;  1D5M C;  1R4M I;  4MEL A;  1TBE A;  2N7J A;  3B0A A;  2FUG 1;  3RFZ B;  4IM3 A;  3ZJU A;  2AQ1 B;  1HTO A;  1UF0 A;  1DYQ A;  4F8C B;  3NVV A;  4W9E A;  3KWV A;  3ECI A;  4C80 A;  2C7H A;  2BKR B;  3Q69 A;  2WXG A;  5I4D A;  1ZOY B;  3U4E G;  1WR1 A;  4DQO C;  2V1Y A;  4IDI A;  4FAD A;  3C8Y A;  4AUQ C;  1YNT E;  1CJE A;  3Q3N C;  1V8C A;  1E90 A;  2D11 A;  3VFK A;  1WJ4 A;  3IFW B;  2WDR B;  1WRI A;  3PLU A;  5TR5 A;  2JZP A;  2N9X A;  2ZCC A;  4R3D A;  4MEM A;  2K0P A;  2LGI A;  5BO4 B;  2ONQ A;  1Q5W B;  1D4B A;  3PRP B;  2IO0 B;  3R8B A;  3L17 A;  5BYQ A;  3AEG B;  2R2O A;  2KDM A;  2RDH A;  4ACF A;  3ZYY X;  3A9K A;  5IKC M;  2EMS A;  1P1A A;  3QWZ B;  3L0W B;  2DX5 B;  3TCA A;  2WXH A;  4REZ A;  5AZH A;  2OJR A;  1ZGU B;  1XEE A;  2V0G A;  4E3C A;  2D10 A;  4YSX B;  2IY0 B;  5D6J B;  3NVY A;  1WSP A;  3HM6 X;  3LXF A;  1JQ4 A;  2INP E;  2MJD A;  3GS2 A;  2VRR B;  2MBO A;  2ZZP B;  2IO3 B;  1P7F A;  2N0S B;  4OVV A;  4NQL B;  1SE4 A;  2PTL A;  3P42 A;  2SEB D;  2WXL A;  1RFA A;  2KJ6 A;  3A9J A;  3KW5 B;  4MJS A;  1AW7 A;  1F2R I;  2VH1 A;  2JRH A;  3LJ3 A;  1JWB D;  3ZRF A;  5HG2 A;  4MH0 E;  1VZ7 A;  2NCN A;  3VH4 B;  2Z59 B;  1FNV A;  1WJN A;  4YT0 B;  1MJD A;  3IG3 A;  1T0Y A;  1OFF A;  1UGJ A;  2LVP A;  2V4L A;  2KLG A;  4QAY A;  4IWP A;  2ZVO A;  1ISN A;  3FAH A;  4KGT A;  1E8W A;  2DZM A;  1WX7 A;  5J18 A;  4LK0 M;  4HCN B;  3VUW A;  4RF1 A;  2FAZ A;  3UI3 A;  1YJJ A;  4EEW A;  4L1B A;  4DDI D;  2GBN A;  1QIL A;  1RFK A;  2KVR A;  1UD7 A;  3RZF A;  4K81 A;  2JXX A;  1SXT A;  1STE A;  5FKA C;  3HVZ A;  3RNA C;  3MFG A;  4RGO S;  3W1S A;  1Y56 A;  1C79 A;  1TS5 A;  3PTF C;  4URK A;  4XZ4 A;  2ZNV C;  1TKY A;  2DAF A;  2WXO A;  4DHZ E;  1BUI C;  2K6Q A;  2I1K A;  2LEK A;  2PVO D;  1ZE3 D;  4A8X C;  1C3T A;  1ZP0 B;  2EEL A;  1DGJ A;  3H7S A;  3DDC B;  1JWS D;  4MM3 B;  3HUI A;  1F2R C;  4KIK A;  2ZW0 A;  1LO5 D;  2BT6 A;  1NI3 A;  4LTU A;  4HXD A;  2A4Z A;  2RPQ A;  4LNO A;  2M19 A;  4NAW A;  1KJT A;  1R4N I;  2GMI C;  2N4F A;  1MPE A;  4M01 A;  3DWG C;  1UWX A;  1HQR D;  2GB1 A;  3EEC A;  1WZ3 A;  2L0T A;  4AQ7 A;  4NPN A;  1WGY A;  4A90 A;  3CIR B;  2HE7 A;  2JZ3 B;  3M3J A;  2KAN A;  1P7E A;  2WQY B;  1M4V A;  2MEK A;  3DVN U;  1C77 A;  2N9K A;  4DDG D;  1IP9 A;  3NUH B;  2UYZ B;  1BML C;  2IY1 B;  5C3J B;  3A9J B;  2BYE A;  5L83 A;  3V3X A;  2CHX A;  1NI2 A;  2KN5 A;  4WQO B;  2DBY A;  4S0R A;  3IAM 1;  2RDG A;  1UWM A;  4ASW C;  1CQV A;  3H7P B;  2YVC A;  1EF1 A;  1SJE D;  1FRR A;  1IPG A;  1XLQ A;  2L3Z A;  5FR3 A;  2Z0E B;  4IWQ A;  5JXV A;  5AZF A;  2NBV B;  1L2N A;  4HPM B;  4HJG E;  1JRO A;  2DYB A;  4YXD B;  1L4Z B;  3AUL A;  4US8 A;  3KVF B;  1I4R A;  1HEZ E;  1FO4 A;  1N61 A;  1WM2 A;  1D5X C;  2MLB A;  2WX0 A;  3VR8 B;  2C5L C;  5G55 A;  4LDT D;  2JX5 A;  1FRD A;  4TQ0 A;  3AEE B;  3H9D A;  2NMQ A;  2KQ7 A;  2KO3 A;  2FID A;  2GBJ A;  5EE3 A;  5J17 A;  4PYZ A;  1GPX A;  2BB6 A;  3ONS A;  4DK5 A;  1D6E C;  3MJ5 A;  3DVN V;  4MH8 A;  1N60 A;  2ACZ B;  2AQ2 B;  2BVC A;  1OGW A;  3BVG A;  1T6B X;  1WR6 E;  4FHJ A;  2WXF A;  5EE1 A;  3MTN B;  4ITK A;  1SE3 A;  2KK8 A;  2MRP A;  4PK1 A;  1K53 A;  3C0R B;  5IO9 A;  1VZ8 A;  2MBE A;  4O1N A;  1ROE A;  3UF8 A;  1R7S A;  2J42 A;  2NPT B;  4KZ0 A;  3NZ3 A;  2PVG C;  3DQV A;  4WJN A;  1QF6 A;  1WYW B;  4EOY A;  2V4I B;  4OZB A;  5C23 A;  2KT7 A;  5BMI A;  1JW9 D;  1E8X A;  2YEP F;  1VRA B;  1WGG A;  3B2G A;  2W9N A;  2KQ4 X;  1RRB A;  2IJ0 A;  3P1M A;  1OQY A;  1PGA A;  4WWP A;  2G1E A;  3V6E B;  2I1J A;  4DWF A;  3BYT B;  5C1Z A;  2NR2 A;  4ZDV A;  4GB9 A;  3ZTC A;  4OZC A;  1P3Q U;  2QIL A;  3BVM A;  2ZCB A;  1SIF A;  1V1O A;  2O2V B;  3WAL A;  1TIF A;  1ZPS A;  3FIL B;  4B95 A;  1JWM D;  3GP7 A;  2YLM A;  1TS3 A;  1ACC A;  3PSE B;  3X0W A;  2UWQ A;  1WXV A;  2RR9 A;  4TSS A;  3H1U A;  4WH4 A;  4UDU C;  1B9R A;  3APC A;  2AL3 A;  3RNF C;  4GXB A;  2BBC A;  4GN1 A;  1WJU A;  2MCN B;  1FIQ A;  1V80 A;  1L5P A;  4EZK A;  3V6C B;  3BVZ A;  1QZE A;  4J6I A;  2GRI A;  1DOI A;  4W9H A;  4KDI C;  1M94 A;  3DVG Y;  1I7H A;  2LUE A;  3WAO A;  3NG0 A;  1XO3 A;  4L2Y A;  2L8J A;  1PFD A;  4ZYN A;  1EWY C;  3NZS A;  4MGY E;  3HK0 A;  2N9E B;  3HHM A;  2KDB A;  2WDT B;  4RCO A;  4BFR A;  1WXS A;  1ZXI A;  2WXI A;  1NYQ A;  1GB1 A;  3DVG X;  4W9I A;  5IA7 A;  2KOX A;  1AN8 A;  1QOF A;  3NS1 A;  2TSS A;  2OHF A;  3H6N A;  1D5Z C;  4HPL B;  3B9J A;  3APD A;  2KXJ A;  1XQQ A;  2RSU A;  4LDT B;  2KTF A;  1Q0W B;  4P7I A;  3GZN I;  3RNE C;  3H7P A;  3P4S B;  1IGC A;  4RGN A;  3R2T A;  2GLS A;  3RT3 B;  1WGR A;  4NQK E;  4LNF A;  1T3Q A;  2WHI A;  1WGK A;  3AE9 B;  4PT5 A;  2PE9 A;  3AMZ A;  3AN1 A;  1L6V A;  3J9C A;  3SU8 X;  4IUM B;  1WIA A;  3I5J C;  3I57 A;  4TKN A;  4XDD A;  1CZP A;  2A5U A;  3NRZ A;  5D7G A;  1V49 A;  2KWC A;  2DYO A;  1V86 A;  1UNS A;  3RZW C;  2BQQ A;  2E3T A;  1DOX A;  2AL6 A;  1Q10 A;  1P98 A;  3RMK C;  3HM3 A;  2WP9 B;  3T3N A;  1C9F A;  1QOA A;  2V3P A;  2Z8L A;  3AH7 A;  4HEA 1;  3QJZ A;  3ENE A;  4F7Z A;  3SHQ A;  1UGM A;  1C1Y B;  3UIN B;  3AE4 B;  1G6J A;  4GGQ A;  2C60 A;  2ZW1 A;  2BF8 B;  2M4N A;  1F9J A;  3FKY A;  3VR9 B;  3HVD A;  1E8Y A;  1J19 A;  4OVU A;  4MT5 A;  2J7Q B;  2KX0 A;  1YJ1 A;  3A1Q B;  3WA0 A;  5E6J A;  3RCZ A;  1SE2 A;  2HJ1 A;  3GOE A;  2XK5 B;  2N9L A;  2OJW A;  3EFC A;  3EC8 A;  3FIL A;  3NZU A;  2HD5 B;  1LQB A;  2Y5B B;  2KQS A;  2O6V B;  1JRP A;  1PQS A;  3AEC B;  1IBX B;  2REX A;  4ANU A;  2Q5W D;  3DWM A;  2JY6 A;  4JX1 C;  4LNN A;  3MC8 A;  3ZJT A;  2XEW A;  3W1Y A;  2IBI B;  3W1S C;  2FCS A;  4MGI E;  2LGY A;  1V9J A;  3CF6 E;  3IBE A;  4B9K A;  2Y3A A;  3KQ4 A;  1SEB D;  4KVG B;  3ZO5 B;  4ANW A;  3VTU A;  4D2K A;  4FJZ A;  3ALB A;  4HRS A;  2LXA A;  3RNB C;  3Q3O C;  2KTR B;  2IGD A;  5E6O A;  4MGK E;  3Q3M C;  2JXT A;  1OTR B;  2KMM A;  4L23 A;  5H8Y E;  1WY8 A;  2OOB B;  2WDQ B;  4P1B C;  3AEB B;  3ZXR A;  2K8H A;  2ON8 A;  3IT6 B;  1QLB B;  2WXP A;  1MFW A;  2DZI A;  2QDF A;  2PMV A;  5D94 A;  2DZJ A;  4W9J A;  1WWT A;  1CK1 A;  4NNJ B;  4K7S A;  1Q1O A;  1KTK A;  1LM8 B;  3U7D A;  2JPH A;  2WXM A;  1GJZ A;  4USA A;  1XLP A;  2L1A A;  2OED A;  1I4Q A;  4NAM A;  4I6L B;  4AOF A;  4DXF A;  2BPS A;  2PLP A;  5EE9 A;  3QIJ A;  2BKF A;  4FA6 A;  4FXC A;  2NVU I;  2LWP A;  4C00 A;  1RLF A;  5DPT A;  3AED B;  1YOV B;  2D3C A;  3CST A;  2BWF A;  4ZRQ A;  4BZA A;  4EFO A;  2WS3 B;  3CSF A;  2BB5 A;  2WXJ A;  3U8Z A;  4HLE A;  2QJL A;  1WZ0 A;  4RF0 A;  2CU1 A;  1VLB A;  3DBH B;  1ENF A;  3SFE B;  1KM7 A;  3TEY A;  3Q3J A;  1LGR A;  4RNA A;  3TMP B;  4K3B A;  2INC C;  2IO1 B;  4JWU C;  2K22 A;  4XDC A;  1I4H A;  4WIP A;  3U2S C;  3V05 A;  5KHO A;  1TTN A;  1E8Z A;  3BII D;  5AZG A;  2O6V A;  1WM3 A;  3KH0 A;  2L00 B;  1MG4 A;  5EE0 A;  2RGF A;  4AJW A;  2DYM A;  1FNU A;  1KOT A;  2MWS B;  2LRW A;  2HTH A;  3E56 A;  1K52 A;  2QIE B;  4BAX A;  2KMC A;  2NBU A;  2MBH A;  3ZW3 A;  3MC9 A;  4MAC A;  3EUB 2;  1IYF A;  3VAW A;  1WMH A;  3ETR A;  1YN3 A;  1WI0 A;  2JYT A;  4W9D A;  4ARC A;  4ICU A;  1XXG A;  2XBB C;  2ZNV B;  3W2D A;  4A3P A;  4ICV A;  2D5G A;  3PT2 B;  2FE8 A;  3CWI A;  3N32 A;  4IC7 B;  1FD6 A;  2V3S A;  2K6D B;  3ZTD A;  2JUO A;  1XCT L;  1XLO A;  4NJC A;  4EZL A;  3QAQ A;  4FUL A;  1PGX A;  4KDL B;  1KFY B;  3JSV B;  3B2F A;  3R7R A;  4WJQ A;  1UZX B;  2BS2 B;  2KAC A;  5BYR A;  1S1Q B;  4WUR A;  1TKG A;  1Y8R C;  3A4R A;  4P1C C;  5DCN A;  1GNU A;  3HIZ A;  5AEK B;  2AYO B;  3ZKJ C;  2CHW A;  4IM2 A;  3AU5 A;  2W55 A;  2ZJD A;  3DHI C;  3TSS A;  2C7N B;  1FNW A;  1V5T A;  4MSQ B;  3ZIM A;  3EA6 A;  1A70 A;  4I6P A;  1SF0 A;  4WWO A;  5GMV A;  2W82 A;  4J3O D;  4AP4 C;  1R4M B;  4XC2 A;  3P4Q B;  4TV3 A;  4XWW A;  4II3 B;  2B3A A;  3BZD B;  2PPH A;  3TJP A;  2DNF A;  3K9O B;  2D3G A;  4G50 A;  2K8B A;  2INN E;  4CQN A;  2LZ6 A;  2C9W B;  2PJH A;  4DXA B;  2BWE S;  2I2Y A;  3N3K B;  1S3S G;  2LMC A;  2CHZ A;  1VCB A;  2H89 B;  2WWZ A;  5E6N A;  3L4P A;  4HPP A;  3AI5 A;  4A6Q A;  2J53 A;  3ZLZ A;  3PZ8 A;  2BYT A;  4M0W A;  3KUD B;  4PS3 A;  1K8R B;  1T5X D;  5HHD G;  4KSL C;  1XCQ L;  2KDI A;  1MHH E;  3VVW B;  1J7B A;  3UQA A;  3BY4 B;  1U4A A;  1YMH E;  4P16 A;  1L0X B;  1E7U A;  2KNB A;  3N20 C;  1F1H A;  2MJ3 A;  1ET9 A;  1FFV A;  4WWM A;  2NS5 A;  3PVL A;  4BKG A;  1WX8 A;  2D3B A;  3PGE A;  3MP9 A;  1PGB A;  1TY2 A;  4PS8 A;  1KRH A;  4C7Y A;  4JE3 B;  2CS4 A;  2WYQ A;  3LB8 C;  3BK1 A;  4ARI A;  2RD0 A;  4GU2 A;  1UH6 A;  3B1L X;  3OG5 A;  4EE2 A;  1J0G A;  2W3R A;  2PEA A;  4C4V B;  1I4X A;  3AM9 A;  2BS3 B;  3L10 B;  1F0Z A;  1NEK B;  5MPO A;  4GDL A;  3L08 A;  3NHE B;  2KC2 A;  1PUT A;  5JHB A;  3DBR I;  2GOW A;  2NBW B;  2CJO A;  1IUE A;  3PLV A;  1P0R A;  1EUV B;  4RMA A;  1YQ4 B;  3PRE A;  2XNA C;  4GLS C;  2QCZ A;  4GDK A;  2G3Q B;  2KJH B;  1YN5 A;  3Q14 C;  2IGG A;  3ZUN A;  3PRZ A;  4M00 A;  1YQB A;  2KWD A;  1KF6 B;  3ZDT A;  1ZKH A;  4LJP B;  3VUY A;  2ZPY A;  3JVZ X;  1R4N B;  1JRU A;  2J0M A;  1V2Y A;  2M56 B;  1H8C A;  3AEF B;  3U30 A;  1V5O A;  1ZW7 A;  4OZA A;  5DPW A;  1ZXH A;  2LVO A;  3KLS X;  1FFU A;  5JZE B;  1TZ1 A;  1NVI D;  4M8M A;  2X38 A;  2UU7 A;  2KFJ A;  2O2V A;  3B08 A;  4OW0 A;  3BWU D;  2QMT A;  2WXN A;  5T8I A;  1QKZ A;  4EZJ A;  3M95 A;  3L54 A;  5J2R A;  1TGZ B;  1BXT A;  5HFY A;  2K9X A;  4C4V A;  4DBG A;  2ZVN A;  3BYY B;  3MHS D;  1VJK A;  5G5H A;  4ZRI A;  5G2N A;  3P4R B;  4M02 A;  1EU3 A;  2ICI A;  2LHD A;  3Q8B A;  4RGM A;  2KDF B;  2DWQ A;  1GG3 A;  1YN4 A;  5DPR A;  3N30 A;  4K1R B;  2EMT A;  4HDQ A;  2KAJ A;  4HK2 A;  2QC8 A;  5D3D A;  3AB5 A;  1QQR A;  3Q8E A;  4N58 A;  2IO2 B;  5D2M B;  2MP2 A;  1RAX A;  2R61 A;  5CX3 A;  3PS6 A;  3TBL D;  3VTV A;  2KWV B;  2FCQ A;  2GBM A;  3AXC A;  4BOS C;  1N5W A;  3AE2 B;  4M0W B;  4DXG A;  1V97 A;  3IXS A;  3O13 A;  5IAA C;  2L0F A;  4A9A A;  3QAR A;  4XWT A;  2W54 A;  3AE3 B;  3GB1 A;  2FNJ B;  4A55 A;  3C19 A;  2ZEQ A;  2KD0 A;  5TSS A;  4BKS D;  3D32 A;  5HKH A;  3IT4 B;  1I4G A;  2XN9 C;  5GXG B;  4ZRJ A;  2M1M A;  4NJ7 A;  1VZ6 A;  2E6X A;  2KVZ A;  2PKO A;  3GE8 C;  3SDL C;  4WWN A;  1E7V A;  3EHV A;  4HJK A;  2JU6 X;  4MJS B;  2RMM A;  1I35 A;  4G3X B;  2K5P A;  5CHW A;  1E6E B;  2N9P C;  3JYU A;  2KMA A;  4FJV B;  3PO0 A;  3KYC D;  3LDZ E;  5BMG A;  5JHA A;  4RM8 A;  1MI0 A;  2V9H A;  1T0S C;  1TS2 A;  2KYW A;  3S2A A;  2FBW B;  5EDS A;  3ABV B;  1E9M A;  3MHZ A;  3HRD D;  1GAQ B;  3DHG C;  2QHO A;  2WU5 B;  2LD9 A;  1VD2 A;  2X8X X;  1TKE A;  4LLG M;  2J4X A;  4KGR A;  4TQ1 A;  1L0V B;  2Z0D B;  4PS7 A;  3TUO A;  2M0A A;  1A5R A;  4WAA A;  1WH3 A;  2Y5C A;  3NVW A;  4WJP A;  1C4P A;  3RUL A;  3VHT C;  5AUI A;  3URY A;  4JGH B;  4C56 C;  2AX5 A;  4JLC A;  4NAW B;  1T0Q C;  2M0X A;  4YTN B;  1YX5 B;  2HJ8 A;  2BYV E;  4FHK A;  1N63 A;  2NPT A;  2BW2 A;  3P63 A;  4KSK C;  1OQR A;  5H92 C;  2K25 A;  2MA9 B;  4KZC A;  3R2I A;  1WXM A;  4F1S A;  2JF5 A;  1EF5 A;  1OEY A;  1EO6 A;  1NDD A;  3AV8 A;  1GC6 A;  1JML A;  3AE7 B;  3DBR B;  2LRU A;  1H4R A;  5FK9 C;  3DBL B;  2WX1 A;  3OAW A;  3L13 A;  1TZO A;  2N7E A;  2MX2 A;  1MVK A;  4G0N B;  3SFD B;  3T8M A;  1L4D B;  2J0J A;  2KN4 A;  2QSD A;  2CR5 A;  4CO7 A;  3TEZ A;  4NJ6 A;  4CYE A;  1QOB A;  2LI5 A;  3RN9 C;  2MP2 B;  3NY5 A;  4ZYS A;  4EUT A;  2D3A A;  3ZNI D;  4JPS A;  1I4P A;  4AJY B;  3CMM B;  2LAS A;  1N5X A;  4NY0 A;  4Q2J A;  2SAK A;  1WE7 A;  2LJI A;  1YX6 B;  3W9C B;  3UQB A;  4BBN F;  5CHF A;  1WX9 A;  3IAS 1;  1HA5 A;  3N1Y C;  2HDE A;  1RYJ A;  3AE5 B;  4I6N B;  4S17 A;  1TT5 B;  2O6V D;  2GBK A;  1NEN B;  3NJT A;  2DZK A;  4GIV A;  1P9D U;  4AWJ A;  2DHZ A;  1YJI A;  2JZZ A;  1N62 A;  4JIO U;  2XK5 A;  4BKT A;  2K8C A;  3VTW A;  2WNM A;  1WRD B;  1XT9 B;  3QCA A;  4HWI B;  1KH0 A;  4LJO B;  1J7C A;  4RM9 A;  2WXQ A;  2WXR A;  4ZOH C;  5LLI A;  1SE9 A;  4KIK B;  5IP4 D;  1Z5S B;  2FIF A;  3W5V B;  2K39 A;  4OVZ A;  4K3C A;  1LFD A;  3P2B A;  3QQ8 B;  3JSV A;  2EKE C;  3KWL A;  2WDV B;  2MQJ A;  3KYD D;  3NS8 A;  3TL5 A;  4RH6 A;  4KGS A;  4KKI A;  1HXY D;  4JQW C;  1EU4 A;  1K50 A;  4LNK A;  2KFK B;  3A1Q A;  3ZXV A;  3IVF A;  1E7P B;  3A4S C;  2WXK A;  2KZR A;  4AS1 A;  4RGT A;  4WJO A;  1L0Y B;  1HZ5 A;  1OEY J;  5D3I B;  4W9L A;  3Q3F A;  1HTQ A;  4NZL B;  3DHH C;  1SBB B;  4ZHP A;  2CKH B;  1TS4 A;  4JL9 A;  5HI1 A;  2EKI A;  1PYW D;  1XD3 B;  3BK2 A;  4BVU C;  1D3Z A;  4YSY B;  3SD5 A;  3P4P B;  1L7Y A;  3MJW A;  3V61 A;  2KHW B;  3V60 A;  1GUA B;  2PIA A;  3ZQ4 A;  5JH5 C;  1V1P A;  2L83 A;  2CU3 A;  3EGR A;  2IGH A;  1ET6 A;  1XF5 L;  3Q6B A;  1JWU D;  1ZDV A;  2RPV A;  4H2A A;  4N9F 4;  2GI9 A;  3DBH I; 
#chains in the Genus database with same CATH homology
 2PE9 A;  3DBR I;  2GOW A;  2NBW B;  2V1Y A;  3EFU A;  4FAD A;  3PLV A;  1P0R A;  4AUQ C;  1EUV B;  4RMA A;  5DPS A;  3SU8 X;  1E90 A;  2D11 A;  1WIA A;  3PRE A;  4IUM B;  1WJ6 A;  3VFK A;  1WJ4 A;  3IFW B;  4MDK E;  4TKN A;  5TR5 A;  3PLU A;  2N9X A;  2ZCC A;  3JW0 X;  4GDK A;  2A5U A;  2G3Q B;  2KJH B;  4MEM A;  5D7G A;  5BO4 B;  3WIM A;  1V49 A;  1WGH A;  1Q5W B;  2KWC A;  2DYO A;  3ZUN A;  3PRZ A;  1V86 A;  4LCD E;  1YQB A;  3PRP B;  2IO0 B;  3ZDT A;  3L17 A;  3RZW C;  2R2O A;  1ZKH A;  2G4D B;  2JT4 B;  4LJP B;  2ZPY A;  3JVZ X;  3VUY A;  3DBS A;  2AL6 A;  3A9K A;  1P98 A;  2EMS A;  3HM3 A;  3M63 B;  1JRU A;  3WAP A;  1P1A A;  2J0M A;  3QWZ B;  3TIX A;  3L0W B;  1V2Y A;  2DX5 B;  3TCA A;  1H8C A;  2ZPN A;  5E6P A;  3U30 A;  5AZH A;  1LXD A;  2OJR A;  1ZGU B;  1V5O A;  1ZW7 A;  3QJZ A;  5DPW A;  3ENE A;  4F7Z A;  2LVO A;  3SHQ A;  1UGM A;  1C1Y B;  3UIN B;  4E3C A;  2D10 A;  1G6J A;  2IY0 B;  2L7R A;  5JZE B;  5D6J B;  1TZ1 A;  2C60 A;  4GGQ A;  4MGZ E;  3HM6 X;  3ML8 A;  4M8M A;  2BF8 B;  2M4N A;  1F9J A;  3ZNZ B;  2KFJ A;  2MSE D;  2O2V A;  4W9C A;  1E8Y A;  1J19 A;  3B08 A;  2VRR B;  2MBO A;  2ZZP B;  2IO3 B;  4OVU A;  4OVV A;  4NQL B;  4E71 A;  2J7Q B;  2KX0 A;  1YJ1 A;  3A1Q B;  3WA0 A;  1RFA A;  4EZJ A;  2KJ6 A;  3A9J A;  3QK0 A;  4HDO A;  3KW5 B;  3RCZ A;  2LVQ A;  3GOE A;  3L54 A;  3M95 A;  5J2R A;  2XK5 B;  4MJS A;  2JRH A;  1UBQ A;  3LJ3 A;  1AAR A;  3EC8 A;  3ZRF A;  4MH0 E;  4ANV A;  2KFK A;  1TGZ B;  2NCN A;  3NZU A;  3VH4 B;  2Z59 B;  2HD5 B;  1LQB A;  2Y5B B;  2KQS A;  2O6V B;  1PQS A;  4DBG A;  4W9G A;  2R2Q A;  2M17 A;  2ZVN A;  1WJN A;  2REX A;  2LXC A;  4ANU A;  3IG3 A;  1T0Y A;  2JY6 A;  3MHS D;  2LVP A;  2V4L A;  4ZRI A;  4W9K A;  5G2N A;  3X23 A;  4GSW A;  2KLG A;  1HE8 A;  2XEW A;  3W1Y A;  4IWP A;  2ZVO A;  2IBI B;  3ZRC A;  3W1S C;  1ISN A;  2FCS A;  4MGI E;  1YIW A;  2KDF B;  1V81 A;  1WGD A;  4FLH A;  2LGY A;  1V9J A;  3CF6 E;  1GG3 A;  4KV2 A;  3IBE A;  4B9K A;  1E8W A;  5DPR A;  2DZM A;  3N30 A;  2EMT A;  1WX7 A;  4K1R B;  4KVG B;  4HDQ A;  5J18 A;  4HCN B;  3VUW A;  3ZO5 B;  4ANW A;  4HK2 A;  3VTU A;  2PE6 B;  2FAZ A;  4EEW A;  3O65 B;  4FJZ A;  3ALB A;  2LXA A;  4DDI D;  2GBN A;  2IO2 B;  2KVR A;  1UD7 A;  5D2M B;  2KTR B;  4II2 B;  3RZF A;  1X1M A;  2MP2 A;  1RAX A;  4K81 A;  5E6O A;  4MGK E;  5CX3 A;  4FN2 A;  4CHK A;  2JXX A;  1OTR B;  3PS6 A;  3TBL D;  3VTV A;  4B6W A;  2KWV B;  2FCQ A;  2AEH A;  2GBM A;  1WY8 A;  2OOB B;  3M62 B;  3AXC A;  4BOS C;  3W1S A;  4M0W B;  3PTF C;  2N7D A;  4URK A;  4XZ4 A;  2ZNV C;  3WAN A;  2LGD A;  3NOB A;  5IAA C;  2L0F A;  3QAR A;  3QX1 A;  3DOW A;  3NHE B;  1UEL A;  2DAF A;  2K8H A;  2M8S A;  5CTR C;  4DHZ E;  2DZI A;  2I1K A;  2K6Q A;  1V6E A;  2FNJ B;  4E74 A;  1KLV A;  4IW0 A;  4DHJ D;  2ZEQ A;  2KD0 A;  1WE6 A;  5D94 A;  4BKS D;  1C3T A;  4ZRK A;  3D32 A;  2AWT A;  2DZJ A;  4W9J A;  5HKH A;  4NNJ B;  2C7M B;  4K7S A;  1Q1O A;  3DDC B;  2L05 A;  3H7S A;  1LM8 B;  3U7D A;  4KIK A;  4HVB A;  3ML9 A;  2JPH A;  2M1M A;  4ZRJ A;  4HXD A;  4NJ7 A;  1GJZ A;  2A4Z A;  3SDL C;  2RPQ A;  4WWN A;  4AOF A;  1E7V A;  3EHV A;  4I6L B;  2BPS A;  1KJT A;  1R4N I;  4NAW A;  2N4F A;  2GMI C;  4HJK A;  4MJS B;  3QIJ A;  4YL8 A;  2BKF A;  3VH3 B;  4FA6 A;  1I35 A;  2NVU I;  2LWP A;  4G3X B;  1RLF A;  5DPT A;  5CHW A;  3EEC A;  4G11 A;  1WZ3 A;  3CST A;  2N9P C;  2BWF A;  3JYU A;  2MW5 A;  2L0T A;  4EFO A;  4NPN A;  1WGY A;  4X57 B;  2KMA A;  3CSF A;  4FJV B;  4BKS A;  2HE7 A;  2JZ3 B;  3KYC D;  3LDZ E;  3U8Z A;  4HLE A;  5JHA A;  1WZ0 A;  4RM8 A;  3M3J A;  2CU1 A;  2KAN A;  1KM7 A;  2JVC A;  3UIP B;  1BT0 A;  3Q3J A;  4K7U A;  2FCN A;  3TMP B;  2IO1 B;  3DVN U;  3S2A A;  5EDS A;  2FUH B;  3A33 B;  4DDG D;  3AU4 A;  5KHO A;  1IP9 A;  1TTN A;  1E8Z A;  3APF A;  5AZG A;  3RD2 A;  2O6V A;  1WM3 A;  4XX5 A;  2UYZ B;  2QHO A;  3KH0 A;  4PYU A;  2IY1 B;  2LD9 A;  1VD2 A;  2BYE A;  2L00 B;  3A9J B;  2RGF A;  5L83 A;  1I42 A;  3IHP C;  4AJW A;  2CHX A;  2KN5 A;  1NI2 A;  2Z0D B;  4PS7 A;  2DYM A;  4TQ1 A;  4WQO B;  1A5R A;  4WAA A;  1WH3 A;  3PPA A;  1KOT A;  2MWS B;  4ASW C;  4WJP A;  2LRW A;  3H7P B;  3RUL A;  3VHT C;  2YVC A;  2HTH A;  1EF1 A;  4JGH B;  1IPG A;  3I3T B;  4JLC A;  2KMC A;  2L3Z A;  2NBU A;  2MBH A;  3DPD A;  3R66 C;  4W9F A;  3ZW3 A;  2FCM A;  3QHT A;  4NAW B;  2Z0E B;  2G45 B;  3OJ3 A;  4IWQ A;  2M0X A;  5CHV C;  5AZF A;  1IYF A;  2NBV B;  2KDE B;  3VAW A;  4FBJ B;  1L2N A;  1YX5 B;  1WMH A;  1NBF C;  3PHX B;  4HPM B;  2HJ8 A;  4GDL B;  1WXA A;  4BOZ B;  2DYB A;  1WI0 A;  2BYV E;  2BGF A;  3VXW A;  4W9D A;  5LXH A;  4FHK A;  3DBL I;  4ICU A;  2XBB C;  3AUL A;  4ANX A;  2ZNV B;  3KVF B;  2NPT A;  4KSK C;  4EKU A;  2IYD B;  4A3P A;  4ICV A;  1WM2 A;  2MLB A;  2K25 A;  4GMV A;  3PT2 B;  2WX0 A;  2C5L C;  5G55 A;  2MA9 B;  4KZC A;  1WXM A;  4F1S A;  4LDT D;  3PHW B;  3N32 A;  4IC7 B;  4TQ0 A;  2V3S A;  3H9D A;  2JF5 A;  1EF5 A;  1OEY A;  2K6D B;  2KO3 A;  2KQ7 A;  2FID A;  2N1W A;  3OJ4 B;  1EO6 A;  2GBJ A;  1NDD A;  3ZTD A;  2JUO A;  1GC6 A;  4K7W A;  5J17 A;  2KX3 A;  4EZL A;  3QAQ A;  4PYZ A;  4FUL A;  3K9P B;  2LRU A;  1H4R A;  4KDL B;  2KLC A;  3ONS A;  4DK5 A;  3A9K B;  3JSV B;  2N1V A;  2WX1 A;  3OLM D;  3R7R A;  3OAW A;  3L13 A;  3DVN V;  4WJQ A;  1UZX B;  2N7E A;  2MX2 A;  4G0N B;  1S1Q B;  1OGW A;  1Y8R C;  3T8M A;  4IG7 B;  3WAM A;  3A4R A;  2J0J A;  1WR6 E;  4FHJ A;  1E5W A;  2JWZ A;  4MSM B;  3L16 A;  5DCN A;  1GNU A;  2CR5 A;  3HIZ A;  3MTN B;  4CO7 A;  5AEK B;  2KK8 A;  2MRP A;  2AYO B;  3ZKJ C;  3C0R B;  4NJ6 A;  4CYE A;  1Z2M A;  2LI5 A;  2CHW A;  2MP2 B;  2MBE A;  4IM2 A;  3AU5 A;  2MBQ A;  3NY5 A;  4IWO A;  3UF8 A;  2ZJD A;  3PV1 A;  4EUT A;  2NPT B;  2LJ5 A;  3VUX A;  3PZD A;  4KZ0 A;  5FR6 A;  2LGX A;  3ZNI D;  3KUZ A;  2C7N B;  3DQV A;  1V5T A;  4MSQ B;  4AJY B;  3CMM B;  2LAS A;  1CMX B;  2K1F A;  2L76 A;  4WJN A;  3ZIM A;  1WYW B;  4NY0 A;  4EOY A;  1WE7 A;  5C23 A;  1YX6 B;  4I6P A;  3UQB A;  2KJR A;  4WWO A;  4BBN F;  1E8X A;  5GMV A;  4GOC A;  5CHF A;  1WX9 A;  1WGG A;  4AP4 C;  2W9N A;  3RYT A;  1RRB A;  4XC2 A;  4DHZ B;  1OQY A;  1GC7 A;  4WWP A;  2J0K A;  4FJY A;  4TV3 A;  2IZV B;  2KTR A;  3V6E B;  2I1J A;  4II3 B;  4I6N B;  4DWF A;  2B3A A;  2O6V D;  2GBK A;  5C1Z A;  4DHJ B;  2PPH A;  2NR2 A;  3TJP A;  3UGB B;  4ZDV A;  2DZK A;  3K9O B;  4GIV A;  4GB9 A;  3ZTC A;  2D3G A;  1P9D U;  2KC1 A;  3ZNG C;  2DHZ A;  4AWJ A;  1P3Q U;  2K8B A;  2JZZ A;  4G50 A;  2KWU B;  2ZCB A;  2XK5 A;  4JIO U;  4BKT A;  2K8C A;  1SIF A;  3ZVV A;  2LZ6 A;  2C9W B;  2O2V B;  3VTW A;  3WAL A;  1WRD B;  2PJH A;  2GBR A;  1XT9 B;  1FXT B;  4DXA B;  3QA8 A;  3QCA A;  2BWE S;  4B95 A;  4HWI B;  1YD8 U;  1WFY A;  5L95 C;  2YLM A;  3PSE B;  3X0W A;  3N3K B;  1S3S G;  4LJO B;  2UWQ A;  1WXV A;  2CHZ A;  4A20 A;  4HCP B;  2RR9 A;  1VCB A;  4RM9 A;  3H1U A;  5LLI A;  1SE9 A;  3APC A;  2AL3 A;  3ZNH B;  4GXB A;  4KIK B;  3V62 A;  1WMH B;  4GN1 A;  1WJU A;  1Z5S B;  2MCN B;  4GDK B;  1V80 A;  4EZK A;  2ASQ A;  1SGH A;  2FIF A;  2D07 B;  2WWZ A;  2DAJ A;  3V6C B;  1QZE A;  2K39 A;  5E6N A;  2D2Q A;  3R7Q A;  3UIO B;  4J6I A;  1LFD A;  3AI5 A;  3P2B A;  3T9L A;  3QQ8 B;  4W9H A;  4KDI C;  1M94 A;  3JSV A;  3KUC B;  3DVG Y;  2EKE C;  4M8N A;  3ZLZ A;  2LUE A;  2MQJ A;  3KYD D;  3NS8 A;  3TL5 A;  3WAO A;  3BIN A;  1UBI A;  2L8J A;  3KUD B;  3R3M A;  4PS3 A;  4BBN C;  1MG8 A;  4ZYN A;  3ZDM C;  1K8R B;  3NZS A;  4JQW C;  4MGY E;  3HK0 A;  2N9E B;  3HHM A;  2G4S A;  2KFK B;  3QC8 B;  2KKC A;  2KDB A;  3A1Q A;  4KSL C;  2WDT B;  4BFR A;  2KDI A;  1WXS A;  3VVW B;  2BYF A;  3IVF A;  3UQA A;  3BY4 B;  3A4S C;  1U4A A;  2DEN B;  2KZR A;  3RUI B;  1E7U A;  2KNB A;  3DVG X;  4TUU A;  3VQI A;  4W9I A;  5IA7 A;  4MM3 A;  3VDZ A;  4WJO A;  2KOX A;  1J8C A;  1OEY J;  4W9L A;  2NS5 A;  3Q3F A;  3PVL A;  4BKG A;  1WX8 A;  2JRI B;  3PGE A;  3PRM B;  4IM0 A;  2MBB B;  3H6N A;  4PS8 A;  2CKH B;  5LXI B;  1WF9 A;  4HPL B;  5KHQ A;  4A3O A;  4JL9 A;  3DCG A;  2CS4 A;  2WYQ A;  1XD3 B;  3APD A;  4BVU C;  1D3Z A;  1R4M I;  4MEL A;  1TBE A;  3SD5 A;  3B0A A;  2KXJ A;  1XQQ A;  1L7Y A;  2RSU A;  2RD0 A;  3MJW A;  4LDT B;  4GU2 A;  4IM3 A;  1UH6 A;  2KHW B;  2KTF A;  3V61 A;  1Q0W B;  3B1L X;  1GUA B;  3GZN I;  4P7I A;  3V60 A;  1J0G A;  2PEA A;  3H7P A;  5JH5 C;  4F8C B;  4W9E A;  3L10 B;  3ECI A;  3RT3 B;  1WGR A;  4NQK E;  2C7H A;  2BKR B;  4N9F 4;  4GDL A;  3L08 A;  2KC2 A;  5JHB A;  1WR1 A;  3DBH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...