2Y5BB

Structure of usp21 in complex with linear diubiquitin-aldehyde
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
151
structure length
149
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLHMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 21
publication title Polyubiquitin Binding and Cross-Reactivity in the Usp Domain Deubiquitinase Usp21.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
total genus 32
structure length 149
sequence length 151
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2y5bB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2y5bB01
2BKRB 5J18A 3HM6X 1Q0WB 5IAAC 4FBJB 4MM3A 2QHOA 4GN1A 4FADA 4MGIE 1WJUA 2XBBC 2KMCA 4AWJA 1V5OA 3CMMB 3PRPB 2FCNA 1WYWB 2NPTB 3DCGA 3DBSA 4GXBA 4FJYA 4MGZE 4E3CA 4XX5A 5D94A 4DHJB 1H8CA 4MGYE 2G4SA 2LZ6A 4W9KA 3ML9A 4FJVB 1RRBA 2O2VB 3NZUA 4JL9A 3RULA 1FXTB 1GUAB 3RZFA 3UGBB 4EEWA 4M0WB 4A3PA 1AARA 1WM3A 2GMIC 2R2QA 2HD5B 2KQ7A 2KTRA 2VRRB 1RAXA 2LASA 3BY4B 1S3SG 1ZW7A 3ZUNA 2JF5A 2PE9A 1WRDB 4GIVA 4K7WA 2JXXA 3PVLA 1QZEA 1V86A 4HVBA 2DHZA 3S2AA 4MSQB 3W1SA 4DK5A 2HE7A 4PS8A 2KFKA 3KUDB 1E8WA 2O6VA 1GC7A 3CSFA 1WX7A 4FHKA 3L54A 3HK0A 4K7SA 1R4MI 2CHZA 4WJQA 4EZKA 4ICUA 1NDDA 2CS4A 2JT4B 3NZSA 3KVFB 3EECA 3ONSA 3V6CB 4AP4C 4AJWA 2RSUA 2KKCA 3Q3JA 2D10A 2CHWA 4IWPA 4ZYNA 3X0WA 2KXJA 3QX1A 2D07B 4HWIB 2ZPYA 1WXVA 2KWCA 4RMAA 4W9JA 4ANVA 4LCDE 2M8SA 4JGHB 3WAMA 4GDKA 3B1LX 2RGFA 2LWPA 1XQQA 2BWES 4GDLA 5TR5A 4WWOA 2FIDA 4KZ0A 2MSED 1G6JA 2NBWB 2NCNA 2I1KA 4W9IA 2UWQA 4HPMB 2YLMA 4EUTA 3GOEA 3A33B 2ZNVC 2ASQA 4BKGA 4F1SA 1V49A 4EOYA 2CR5A 3GZNI 1V5TA 2BYVE 3ZNGC 1IP9A 3D32A 4NQLB 3DDCB 2KWUB 3UF8A 2FUHB 2A4ZA 2HTHA 3OJ3A 3ZDMC 1V6EA 3A9KA 3BINA 1WMHB 2KJ6A 2DZIA 3L17A 4DHZB 2K8HA 2KDBA 3NS8A 1KOTA 3IBEA 2J0MA 4IW0A 3M62B 2BKFA 5L83A 3APDA 2FCQA 4JQWC 2IO3B 5AEKB 4DDGD 2KO3A 3AXCA 4WJOA 4NJ6A 2LVPA 3HIZA 4MJSB 2REXA 1XD3B 3PGEA 3H7SA 4IM2A 4MSMB 5AZHA 4IWOA 3ZDTA 2K39A 3VH3B 3A1QA 3WAPA 4GB9A 3R7QA 2L05A 3JW0X 5EDSA 2KANA 1IPGA 2IYDB 2XK5A 3PHWB 1IYFA 4HXDA 3ZW3A 3AU4A 3RCZA 4TQ0A 2NVUI 4EZLA 2BWFA 2OJRA 5DPRA 3ENEA 1GG3A 3N30A 4BOZB 1OGWA 3N3KB 5E6NA 3JYUA 1J19A 1WJ6A 4OVUA 1L2NA 3APCA 1RFAA 3SHQA 2KQSA 2LI5A 3C0RB 3NY5A 1WJ4A 4WQOB 5G55A 3OAWA 3PSEB 4EZJA 1GJZA 2KTRB 2L00B 3PREA 1E90A 1NBFC 1SIFA 1U4AA 4KDLB 2WX1A 1Z5SB 2IO2B 2L7RA 2N9EB 4TUUA 2RR9A 3VTVA 1GNUA 2EMTA 3PLUA 4K81A 3UIOB 3QC8B 3PS6A 1EO6A 3WANA 1UBIA 2KFKB 2KC2A 2O6VB 3DVGY 4MEMA 2DAFA 5D2MB 2W9NA 4CHKA 2N1WA 4ASWC 4A20A 2WYQA 3DBLI 4II2B 4NAWA 3UQBA 3L08A 1UD7A 3V61A 1EF5A 3EC8A 3QAQA 3T9LA 2DZMA 4KVGB 4M8MA 4DHJD 5LXIB 2JVCA 3ALBA 5LXHA 2ZVNA 2L76A 2KZRA 4B6WA 3RUIB 1WGGA 3K9OB 3TJPA 1P98A 2L0FA 3X23A 4W9GA 3O65B 2JZ3B 2V1YA 4LDTB 2FNJB 3VFKA 4I6NB 2D3GA 1EUVB 4HPLB 3TCAA 1E8XA 5KHQA 4RM9A 4HDQA 1T0YA 3P2BA 2JWZA 2NBVB 3ZNZB 2K6QA 4HK2A 4ICVA 1WR6E 4KDIC 1Y8RC 4FJZA 3PZDA 4NPNA 1WXSA 2DZKA 3NHEB 4J6IA 3R66C 2AWTA 3KYDD 5FR6A 3R3MA 2A5UA 5GMVA 4KZCA 3A9KB 4AOFA 1WXAA 4IUMB 3R7RA 4MGKE 3ZVVA 1J8CA 2G45B 4TKNA 2LJ5A 2K1FA 2KLCA 1WM2A 2C7HA 4LJOB 3Q3FA 3M3JA 1WI0A 2KMAA 2AYOB 3DPDA 4I6PA 2KJHB 3QIJA 2LXCA 3RYTA 3ZLZA 3TL5A 3ZIMA 4MDKE 2J0JA 3A9JA 1WGDA 3CF6E 2XK5B 3N32A 5E6OA 2OOBB 2WDTB 3VDZA 2MLBA 4W9EA 1XT9B 3PHXB 2KDIA 4GOCA 3TBLD 1WXMA 2KHWB 2KDFB 3H1UA 2GBKA 2NR2A 3IG3A 2K6DB 3KUZA 3PRZA 4FHJA 4HDOA 4G0NB 4PS3A 2LGDA 1V81A 2FCSA 3SD5A 3VQIA 3UIPB 1C3TA 1TBEA 3W1YA 1GC6A 1M94A 1WZ3A 1YQBA 1WIAA 2LXAA 2KK8A 2DX5B 3IFWB 2JPHA 2UYZB 3B08A 3PLVA 4IM0A 2HJ8A 3A4RA 1I35A 1LM8B 2MCNB 1MG8A 2N7EA 2K8BA 2KNBA 5CX3A 4BOSC 3V62A 4CYEA 3ZTCA 2ZPNA 1E8ZA 4NJ7A 4KV2A 1YIWA 4XZ4A 2N9PC 3KUCB 3VTUA 1YX5B 2WX0A 1P9DU 4WWPA 2FIFA 1JRUA 2KVRA 2MWSB 1OEYJ 3H6NA 3A4SC 3ZRCA 1H4RA 3KW5B 5DPSA 1WGRA 1WZ0A 2N7DA 3KH0A 3L13A 4B95A 4DXAB 4BVUC 3ML8A 2MBHA 4LJPB 4EFOA 3VUWA 3MHSD 5J17A 2K25A 2GOWA 3IVFA 3HHMA 3LDZE 3L10B 3H7PA 3QHTA 4P7IA 2LRUA 3JVZX 3RD2A 1V9JA 2KD0A 2LD9A 4BBNF 4FA6A 4WWNA 3VHTC 3ZRFA 4AUQC 2ZZPB 4GSWA 3VXWA 3PV1A 2AEHA 2LRWA 3M95A 3DQVA 1EF1A 2MX2A 3IHPC 3VVWB 2ZNVB 2M0XA 3PTFC 3V6EB 3LJ3A 2ZVOA 3HM3A 1OTRB 1UZXB 3L16A 3ZNID 2IO0B 2LVOA 1TZ1A 4X57B 3ZO5B 4XC2A 2IY1B 3RZWC 4E74A 2B3AA 2JY6A 2JZZA 2G3QB 5LLIA 2MW5A 2ZEQA 1LFDA 3PPAA 2MBOA 2AL3A 2IBIB 2PPHA 3H9DA 4LDTD 3WIMA 2JUOA 4W9LA 3JSVA 2FAZA 4II3B 1P3QU 3PRMB 1RLFA 3SDLC 4GU2A 1LQBA 2YVCA 1UGMA 1WJNA 2IO1B 4G3XB 2DAJA 4GDKB 4ZRKA 1X1MA 4PYZA 2GBJA 2Y5BB 4F7ZA 4GDLB 3DBRI 5DPTA 1UBQA 1E5WA 2EMSA 2N9XA 3VUYA 3VUXA 3MJWA 4G50A 4W9FA 4NQKE 3QA8A 4W9HA 3K9PB 3QJZA 2BYEA 5JZEB 4ANUA 4KIKA 5IA7A 1OEYA 2DZJA 3QQ8B 1P0RA 1WF9A 2CU1A 1V2YA 4BKTA 5DPWA 1SGHA 2MQJA 3TIXA 2BPSA 4ZRIA 2DYBA 4IC7B 1YD8U 5AZGA 1S1QB 2MA9B 4PYUA 4WJNA 3U30A 1J0GA 2ZCCA 2BF8B 4ANXA 5CHFA 1WR1A 4URKA 2L8JA 3PT2B 4KSKC 1D3ZA 2JRIB 3NOBA 2KDEB 2N1VA 4W9CA 3UQAA 1ZGUB 2MBEA 3OLMD 5L95C 2KFJA 2D11A 3B0AA 5D7GA 1Q1OA 3AULA 2MBBB 1WE7A 2KX0A 2IY0B 2PEAA 2J0KA 4K1RB 2LVQA 3L0WB 5C23A 4ANWA 3VAWA 4DHZE 1WX8A 2NBUA 3U7DA 5JH5C 1KLVA 4HCNB 3ZKJC 4B9KA 2N4FA 2XEWA 2C9WB 3A1QB 4OVVA 4MELA 3EFUA 4NNJB 5KHOA 1R4NI 2DYOA 2I1JA 3H7PB 1I42A 4KSLC 1WFYA 1NI2A 2C7MB 2JRHA 4A3OA 5JHBA 1E7VA 2KTFA 4WAAA 2J7QB 1K8RB 4FN2A 4N9F4 5AZFA 2KX3A 2KC1A 1WY8A 3ZNHB 2MP2A 3KYCD 4EKUA 1VD2A 2KN5A 3DBHI 3RT3B 2BGFA 4G11A 3QCAA 1BT0A 3DVNU 4E71A 4BKSD 4HLEA 1KM7A 1E8YA 2DYMA 2GBNA 3MTNB 2Z0DB 2NPTA 2KLGA 4GGQA 2Z0EB 4PS7A 1A5RA 1CMXB 2M4NA 4HJKA 1HE8A 4I6LB 4IWQA 2O2VA 4AJYB 3JSVB 1UELA 1E7UA 4NAWB 4JIOU 4TV3A 3W1SC 2M1MA 1WE6A 3V60A 5JHAA 1SE9A 2LUEA 2CKHB 5E6PA 3QARA 5BO4B 3DVNV 4DDID 2CHXA 2R2OA 1WH3A 2KOXA 4FLHA 2DENB 4K7UA 3I3TB 4NY0A 3U8ZA 1ISNA 3CSTA 3UINB 3QK0A 1WGHA 2L0TA 5G2NA 1C1YB 2PJHA 3AU5A 3VH4B 2C5LC 4KIKB 2FCMA 1OQYA 2KJRA 3ECIA 1L7YA 4HCPB 2O6VD 4DBGA 2G4DB 1YX6B 2ZJDA 4TQ1A 2RPQA 4F8CB 4MH0E 1LXDA 1V80A 4IM3A 2M17A 3EHVA 2ZCBA 4W9DA 2WWZA 2EKEC 5D6JB 3VTWA 3M63B 3DVGX 2GBRA 2MBQA 2V3SA 1TGZB 5DCNA 1ZKHA 1VCBA 2MRPA 2D2QA 4BBNC 4M8NA 3SU8X 3AI5A 4RM8A 4BKSA 2C60A 2LGYA 3DOWA 3OJ4B 5CHWA 1Q5WB 4FULA 2Z59B 2BYFA 4GMVA 2NS5A 3WA0A 4ZRJA 4IG7B 3TMPB 3A9JB 2GBMA 4JLCA 1WGYA 2IZVB 3WAOA 3ZTDA 1WMHA 4DWFA 4ZDVA 2C7NB 4BFRA 2K8CA 4CO7A 1F9JA 3QWZB 4WJPA 5C1ZA 5HKHA 2L3ZA 1TTNA 1WX9A 2RD0A 1YJ1A 2AL6A 4YL8A 3APFA 3T8MA 1Z2MA 2LGXA 1KJTA 5CHVC 5J2RA 3WALA 1P1AA 5CTRC 2PE6B 4MJSA 2KWVB 2V4LA 1UH6A 1PQSA 2MP2B
chains in the Genus database with same CATH superfamily
5HHDG 4FBJB 2Y3AA 1HA5A 3EUB2 4GN1A 2KMCA 1V5OA 3CMMB 3AN1A 4E3CA 4MGZE 3NG0A 1F2RC 4W9KA 3ML9A 3AMZA 1RRBA 3RZFA 1TIFA 1YN3A 1N60A 2D3CA 2JF5A 1WRDB 4GIVA 4BZAA 2IGDA 2K22A 3PVLA 1QZEA 4HVBA 3DHGC 2HE7A 2KFKA 1J7AA 1WX7A 4HJGE 4K7SA 4WJQA 4ICUA 3FAHA 4YT0B 2D10A 1FNUA 2WS3B 4JGHB 3B1LX 4M00A 4WWOA 2FIDA 1G6JA 2NBWB 1SBBB 2W3SA 4HPMB 3N1YC 1V49A 5IP4D 3ZNGC 2XN9C 2VZKB 1L0XB 3N1XC 2VH1A 2FUHB 2A4ZA 3OJ3A 1JALA 3A9KA 1WMHB 2KJ6A 1PGXA 1NENB 2KDBA 1GAQB 1N5XA 4IW0A 5C3JB 3M62B 2WXNA 2IDYA 2OHFA 3TUOA 1ESFA 2IO3B 3AXCA 4NJ6A 2REXA 3NJTA 2K39A 3A1QA 3WAPA 2L05A 5EE3A 2KANA 5EDSA 3RCZA 2ACZB 3Q6BA 4BOZB 1OGWA 1J19A 4ZHOA 3SHQA 2KQSA 3PSEB 2KTRB 4HEA1 1NBFC 2BVCA 4TUUA 3PLUA 1C4PA 4OZCA 1UBIA 3BVZA 2O6VB 2QC8A 5D2MB 1GB1A 2W9NA 2N1WA 4NAWA 2GLSA 3V61A 1EF5A 3T9LA 5LXIB 4KVGB 4M8MA 2HJ1A 3AH7A 3ALBA 5LXHA 4MACA 2QILA 2W82A 1V1PB 4B6WA 3RUIB 3TJPA 3RNEC 2CJOA 4W9GA 2H88B 2D3GA 4HPLB 4RM9A 1PYWD 1T0YA 3P2BA 4KDIC 3AE1B 4FJZA 4NPNA 2AWTA 3P42A 2WXHA 4IUMB 4MGKE 1J8CA 2G45B 1KTKA 2KLCA 1FFVA 3I9V1 3Q3FA 3M3JA 1WI0A 2ZW1A 3QIJA 2DWQA 3DWGC 4M01A 1NVID 3P4SB 2DBYA 2XK5B 3N32A 5E6OA 2OOBB 3SEBA 3VDZA 2LUMA 3LXFA 3PHXB 4ACFA 1WXMA 2KDFB 3H1UA 3PRZA 1L4ZB 2NR2A 4FHJA 4PS3A 2J4XA 4G0NB 3UIPB 1TZOA 2PW9A 1AYFA 1GC6A 1M94A 1YQBA 3IFWB 1IBXB 3B08A 1F77A 2HJ8A 3A4RA 1I35A 1IUEA 2K9XA 4WAFA 5CX3A 2K8BA 2MHJA 4BOSC 3ZTCA 2ZPNA 4NJ7A 4XZ4A 2N9PC 3KUCB 4O1NA 4FXCA 2KYWA 2KVRA 2WXRA 1UGJA 4MH8A 1CQVA 3H6NA 3KW5B 2N7DA 4B95A 4BVUC 3ML8A 1DYQA 5J17A 2GOWA 3IVFA 3RN9C 4YTMB 4LNKA 3VHTC 1NYRA 1FD6A 3PV1A 3M95A 3DQVA 1EF1A 1HXYD 1AWDA 2ZNVB 2ZVOA 2PTLA 3HM3A 3TEWA 1V97A 2JY6A 2G3QB 5LLIA 2MBOA 2BB6A 1CK1A 2BS4B 3H9DA 3WIMA 2M56B 4II3B 4YTNB 4HRSA 1RLFA 4GU2A 4GDKB 1X1MA 3Q8AA 2K5PA 1AN8A 2MJDA 4GDLB 2D5GA 3DBRI 1E5WA 1HZ6A 2OEDA 4G50A 1OQRA 4NQKE 4W9HA 4AQ7A 3QQ8B 2GI9A 1SGHA 2INPE 3TIXA 2EELA 4KKJA 2DYBA 4IC7B 1YD8U 5AZGA 2UU7A 2MA9B 4PYUA 1WXQA 1TT5B 1C76A 1XLOA 2LGIA 1C9FA 5CHFA 1TKYA 2WDRB 2JRIB 1T6BX 2W55A 2N1VA 1KH0A 5L95C 2KFJA 1K53A 3B0AA 2I38A 3L0WB 1DOYA 4ANWA 1EWYC 2CU3A 4J3OD 4DHZE 4HCNB 2BYTA 2N4FA 4OVVA 3AV8A 2WXQA 2I1JA 1Q10A 1I42A 3AM9A 4KSLC 1WFYA 1NI2A 2C7MB 1LO5D 2G9HD 1MFWA 4RCOA 1WY8A 3ZNHB 1MHHE 1OFFA 2MP2A 2WXFA 3KYCD 4EKUA 1VD2A 3B2GA 2LEKA 4G11A 3QCAA 4HLEA 3VR9B 1E8YA 3MTNB 2KLGA 4GGQA 1SE2A 1FXAA 1CMXB 2M4NA 4I6LB 1R7SA 4KGSA 1FXIA 4C4VB 1L0YB 4XE0A 4JIOU 4M0WA 1C79A 1YJIA 1WE6A 2NTTA 3URYA 1SJHD 5E6PA 2CKHB 3QARA 1PGBA 3DVNV 2R2OA 1WH3A 3I3TB 1WGHA 2N9LA 3TEYA 1YN5A 3GB1A 4OZAA 2FCMA 2KJRA 4RGNA 1L7YA 4C7YA 4DBGA 5C2TB 2FE8A 1SEBD 1QQRA 2RPQA 1FNWA 3EHVA 5IOIA 2KACA 3KQ4A 3M63B 2MBQA 1ZKHA 2MEKA 1YN4A 3RNGC 3SU8X 3GP7A 2LGYA 3DOWA 4A55A 1YNTE 3AB5A 4FULA 4RF1A 3TMPB 2GBMA 1WGYA 3VRAB 2IZVB 4DWFA 2C7NB 1SJED 3NVVA 1F9JA 1D5XC 1CZPA 5HKHA 1M4VA 2L3ZA 1YJ1A 2LGXA 5CHVC 3WALA 1P1AA 2WLBA 2YVCA 2EKIA 1DOIA 5J18A 3HM6X 1Q0WB 5IAAC 4FADA 3BZDB 1I4XA 3B9JA 3TEXA 4AWJA 2NPTB 4FJYA 1R4MB 4DHJB 1H8CA 2WU2B 4FJVB 3AE6B 1J7BA 3NZUA 3RULA 4EEWA 4XWTA 2N9KA 2R2QA 2HD5B 2KQ7A 2WXJA 3BY4B 1S3SG 1ZW7A 4MSQB 1ZPSA 3U4EG 3L54A 3HK0A 3Q8CA 2CHZA 2CS4A 2JT4B 1IYFA 3KVFB 4AJWA 3Q8BA 2PMVA 2CHWA 4IWPA 4ZYNA 2KT7A 3X0WA 3KLSX 4HWIB 2ZPYA 4ANVA 3WAMA 4GDKA 3T3NA 2LWPA 1JWUD 2KVZA 1XQQA 4GDLA 4DXFA 2MJ3A 3SFDB 2I1KA 3MHZA 1TYGB 4EUTA 2ZNVC 2ASQA 3GZNI 3PZ8A 2B76B 2D3BA 4P1CC 3D32A 4NQLB 3ZDMC 2DZIA 4DHZB 1UNSA 1KOTA 2BKFA 2ICIA 2PVGC 5AUIA 1SF0A 4WJOA 1HTOA 2LVPA 4MJSB 1EWCA 4XGAB 3H7SA 3TEZA 1EU3A 5AZHA 3ZDTA 3AEFB 5BMIA 4GB9A 3BK2A 3PHWB 4HXDA 4WH4A 2OJRA 1GG3A 3NVZA 4L1BA 4OVUA 2WDVB 1RFAA 2H89B 1E7PB 4L2YA 5G55A 4A9AA 5G5GA 1SB3C 2L00B 3P63A 3PREA 1E90A 1SIFA 1U4AA 1AW7A 4RGMA 3V05A 5JXVA 3VTVA 1GNUA 4K81A 1ZDVA 3NVWA 3QC8B 2KC2A 3OG5A 2DAFA 1ZUD2 1BXTA 4ASWC 2GRIA 2WYQA 3DBLI 3NRZA 1UD7A 1I7HA 2JVCA 3O13A 4A6QA 2PLPA 3K9OB 1L4DB 2L0FA 4L23A 5HI1A 2FNJB 3RNFC 4HKQA 2LHDA 2JWZA 2NBVB 3ZNZB 4HK2A 1WR6E 1E0ZA 1WXSA 2DZKA 2WNMA 3NHEB 4J6IA 3R66C 4C00A 3KYDD 3P1MA 4JX1C 4AOFA 1ET9A 5D3IB 3EGRA 1MVKA 2AYOB 1TY2A 2KJHB 2LXCA 3TL5A 2J0JA 1WGDA 3CF6E 3KWLA 3MC8A 2WDTB 1SXTA 2K3UA 3TBLD 4XYCA 5IO9A 2GBKA 3IG3A 4HPPA 2K6DB 3SD5A 1TBEA 3W1YA 1WZ3A 1XLQA 2LXAA 2V4IB 2BT6A 2DX5B 1WSPA 4RGTA 3PLVA 4IM0A 1MG8A 3V62A 1FRRA 1SSNA 2HTME 1BUIC 2WX0A 2AQ2B 3MP9A 1JRUA 2N7JA 3MC0B 5DPSA 3Q8FA 1WZ0A 2W3RA 3ZJVA 1UUPA 4LJPB 1F2RI 1GOZA 3Q8EA 3AEAB 5IKCM 3JVZX 4BBNF 2KD0A 2LD9A 4FA6A 1WRIA 4WWNA 4TSSA 4ZRQA 2AQ1B 4P16A 2ZZPB 4GSWA 2TSSA 2AX5A 2M0XA 3V6EB 3LJ3A 1MJDA 2RPVA 3PZ7A 1QOAA 3Q3MC 2IO0B 4X57B 4E74A 2JZZA 2MW5A 3BVGA 1LFDA 3IT4B 1Y56A 4LDTD 4MT5A 2FAZA 1P3QU 3PRMB 4G3XB 4ZRKA 4PYZA 1I4PA 5BMGA 1UBQA 2YEPF 3VUYA 3VUXA 4W9FA 3QA8A 3K9PB 1DOXA 2MH7A 1JWMD 2BYEA 3QJZA 3U52E 2V0GA 1MHXA 1F52A 1TS5A 1VR9A 4USAA 1V2YA 4OVZA 5DPWA 1XLPA 1YOVB 2ZCCA 1R4NB 3R8BA 4KSKC 1L0VB 3R2TA 2KDEB 1JWSD 1XLNA 4W9CA 1ZGUB 1VJKA 2MBBB 1WE7A 4K1RB 2IPKD 3RI7C 3DHIC 1KLVA 1WX8A 2NBUA 3ZKJC 3FILB 3DBHB 2C9WB 5EE1A 4MELA 3DWMA 3EFUA 1E6EB 3H7PB 1I4GA 1HZ5A 2QSDA 1T3QA 4NJCA 4A3OA 1E7VA 2KC1A 4JPSA 1QOBA 3RT3B 1ACCA 5BYQA 4NZLB 4US8A 1P7EA 2GBNA 2INDC 4PS7A 1IGCA 2Z0EB 4RH6A 5IN7A 4LLGM 1I4RA 2BS3B 3Q3OC 4P1BC 1RYJA 3JSVB 1E7UA 2QEJC 3ZQ4A 3W1SC 2WGSA 2M1MA 3V60A 5JHAA 2KOXA 4FLHA 3UINB 1WWTA 1KF6B 2ONQA 4NAMA 1C78A 1JW9D 1FMAD 3RFZB 2PJHA 1PUTA 4KIKB 2E3TA 1TJEA 2G4DB 1YX6B 4TQ1A 4YSXB 4IM3A 4IKGA 4W9DA 2MJEA 2WWZA 1N6ZA 4RGOS 3EA6A 5D6JB 1K51A 3DVGX 3RMKC 2DLBA 1TGZB 2MRPA 3W2DA 3OJ4B 2BYFA 4GMVA 5BYRA 1ZP0B 2NS5A 4ZRJA 3A9JB 1WMHA 4ZDVA 4BFRA 2JQRB 1TS3A 4S0RA 3QWZB 4WJPA 3WCQA 1V1OA 4YL8A 2AL6A 3APFA 1JQ4A 4ZRPA 4YSZB 2LJIA 5CTRC 2PE6B 1I4QA 4ZHPA 1PQSA 4BKSA 2BKRB 3ZJUA 2KAJA 4MGIE 3PRPB 3DCGA 3DBSA 4GXBA 4XX5A 3AE8B 5D94A 1BMLC 4MGYE 1B1ZA 2O2VB 1UWXA 3FKYA 1ENFA 1FXTB 1GUAB 4JL9A 1AARA 2GMIC 2QCZA 2VRRB 2KTRA 3ZUNA 2JZPA 2PE9A 2XNAC 1D5ZC 3AE7B 1XF5L 1E8WA 2O6VA 3CSFA 4FHKA 5HFYA 3NZSA 3V6CB 4AP4C 2Y5CA 3ONSA 1TY0A 3Q3JA 4YXDB 2FUG1 3QX1A 4XDDA 2D07B 1CJEA 3P4QB 2KWCA 1QKZA 4W9JA 2R61A 2JYTA 4LCDE 2M8SA 1V1PA 3AE9B 2BWES 4UDUC 4KZ0A 2MSED 2NCNA 1FFUA 4W9IA 2UWQA 3GOEA 3A33B 4N59A 1MPEA 1V8CA 1FEHA 4WIPA 1IP9A 3DDCB 2KWUB 2YEPB 3UF8A 3BINA 2RDGA 3IBEA 2ON8A 5L83A 4JQWC 5AEKB 4DDGD 1NI3A 4IM2A 4MSMB 3SR6A 5FR3A 4IWOA 1FCLA 4C56C 1QF6A 3R7QA 1IGDA 3JW0X 4OHJA 1IPGA 2XK5A 4TMAB 4TQ0A 4EZLA 2BWFA 4DQOC 3W5UB 1XCTL 3N3KB 3IAS1 1WJ6A 3J9CA 3ZXVA 3APCA 3L4PA 4EZJA 3LYYA 4WQOB 1IBXA 1GJZA 1GB4A 4KDLB 2WX1A 2RDBC 3UIOB 2EMTA 1A70A 3HVZA 5T8IA 1EO6A 3WANA 2KFKB 3DVGY 1QLBB 4LNIA 1I4HA 4CHKA 4GLSC 1F1HA 3ZYYX 1DGJA 3QAQA 4LNNA 2DZMA 1D4BA 3N9YC 2BB5A 2ZVNA 1P98A 4K3BA 3X23A 3ZXRA 1QILA 3B2FA 3VFKA 1PFDA 3ZJTA 2K0PA 5KHQA 3E9SA 4ICVA 3PZDA 1SE4A 5FR6A 3R3MA 2A5UA 5GMVA 4KZCA 3U7ZA 3A9KB 1WXAA 1J7CA 3R7RA 3EFCA 2WXOA 3ZVVA 2LJ5A 1WM2A 2KMMA 2QJLA 2C7HA 4KKIA 2KMAA 2WXIA 3ZIMA 3AEDB 3A9JA 5EE9A 2VZKD 2J52A 4RFBA 2V9HA 2WU5B 4HDOA 1PGAA 1V81A 2FCSA 2LGDA 3VQIA 1C3TA 2N0SB 2VH2A 2KK8A 3HRDD 2JPHA 4H2AA 3GS2A 1T5XD 4AS1A 2MCNB 2N7EA 2J42A 5BYSA 1E8ZA 5H92C 3VTUA 1YX5B 2IGGA 1T0QC 4IOIE 2FIFA 4WWPA 2JU6X 2LMCA 2RDHA 1H4RA 4BAXA 4DXAB 1ZOYB 3OWEB 4EFOA 3MHSD 4MM3B 1STEA 3RNCC 4M02A 2K25A 4P7IA 1UF0A 3ZRFA 4A90A 2KWDA 4AUQC 2AEHA 3Q2AC 3IHPC 1OTRB 1UZXB 3L16A 1FRDA 3ZO5B 4XC2A 2IY1B 3RZWC 2B3AA 2JXTA 3PPAA 2W54A 4W9LA 4C4VA 3W9CB 2PKOA 1FPYA 3SDLC 3AECB 4IDIA 2IO1B 2DAJA 3AE3B 4OW0A 4N6EB 3MFGA 2N9XA 3MJWA 1N5WA 1L6UA 5IA7A 2CU1A 1E10A 4BKTA 1L5PA 2QDFA 2L1AA 2MQJA 1JMLA 4YSYB 1ZXHA 4KGRA 1S1QB 1FM0D 4LK0M 1B9RA 4ANXA 2L8JA 3PT2B 1D3ZA 5HG2A 3NOBA 1N62A 4ZOHC 3T3OA 3AE5B 2MBEA 1Q1OA 3AULA 2KX0A 1PDXA 3CIRB 2LVQA 3VAWA 3U7DA 5JH5C 1OQQA 4NNJB 3AEEB 2DYOA 3P4RB 5BMHA 2JRHA 5JHBA 2KTFA 3E56A 3I5JC 5AZFA 2LHEA 4KGTA 2GB1A 2BGFA 1BT0A 4E71A 1FO4A 2Z0DB 2NPTA 2V3NA 1RM6C 2QIEB 5E6JA 4AJYB 5FK9C 1UELA 1D6EC 1SE9A 5BO4B 4ITKA 4LNOA 3U8ZA 2DENB 2BQQA 3QK0A 2L0TA 2WXGA 5G2NA 5EE0A 2PIAA 3AEGB 4XDCA 3AU5A 1QOFA 2C5LC 4P6VF 1OQYA 1SE3A 3ECIA 4HCPB 2ZJDA 1T0RC 2I2YA 4MH0E 1V80A 2WP9B 2M17A 2ZCBA 2AQ3B 2EKEC 3VTWA 3I57A 5DCNA 1VCBA 3BK1A 1KLUD 1C77A 4RM8A 3BWUD 5CHWA 1WYGA 2Z59B 1HEZE 3BVMA 1K50A 3WA0A 4IG7B 4JLCA 3WAOA 3ZTDA 3VRBB 2K8CA 1HQRD 1JROA 4CO7A 1GPXA 1TTNA 1WX9A 2RD0A 2INNE 1MI0A 1JWBD 1Z2MA 3ZGZA 4MJSA 2KWVB 2V4LA 3HVDA 2MP2B 2NMQA 4MM3A 2SEBD 2V3PA 2DNFA 2QHOA 1WJUA 2XBBC 1VRAB 2WQYB 2FCNA 1WYWB 1XEEA 4JWUC 2LFIA 1N61A 2G4SA 2LZ6A 4QAYA 3UGBB 3MJ5A 4M0WB 4A3PA 1WM3A 2L32A 1RAXA 1ROEA 2LASA 4YTPB 4K7WA 2WXMA 2JXXA 1VZ6A 1V86A 3Q69A 2DHZA 2Z8LA 3S2AA 3W1SA 4DK5A 4PS8A 3KUDB 1YQ4B 1GC7A 3FC4A 1R4MI 4EZKA 3P4PB 1EM7A 1NDDA 4S17A 3EECA 2RSUA 2KKCA 3GZNB 2KXJA 3BYTB 2JWUA 2WHIA 3AE2B 4RMAA 1WXVA 3MC9A 2BS2B 2RGFA 5TR5A 1XO3A 1D5MC 5I4DA 2L83A 2YLMA 5LNK1 4BKGA 1C4AA 4F1SA 4EOYA 2CR5A 1NYQA 3DHHC 1V5TA 2BYVE 4N58A 4KX6B 1QOGA 2HTHA 5TSSA 3RNAC 1V6EA 3L17A 1KLGD 2K8HA 3NS8A 2J0MA 2NTSA 3VR8B 3APDA 2FCQA 1JWAD 2KO3A 3RPFC 2Y5PA 4WWMA 4LTUA 3HIZA 1TKEA 1XD3B 3PGEA 1VLBA 5G5HA 3VH3B 2G1EA 3NZ3A 2IYDB 3ZW3A 3AU4A 2NVUI 5DPRA 3ENEA 3N30A 1UWMA 5E6NA 3JYUA 1L2NA 3DBLB 2LI5A 3C0RB 3NY5A 1WJ4A 3OAWA 1Z5SB 2IO2B 2L7RA 2N9EB 4XWWA 2RR9A 5GXGB 3PS6A 2BW2A 4MEMA 2SAKA 4A20A 4II2B 3UQBA 3L08A 3EC8A 4DHJD 3GE8C 1RFKA 2L76A 2KZRA 1WGGA 3O65B 2JZ3B 2V1YA 4LDTB 4I6NB 1EUVB 3GE3C 3TCAA 1E8XA 4HDQA 5D3DA 2K6QA 3N1ZC 1JCKB 1RWSA 1Y8RC 2JYEA 1ET6A 3AE4B 4TKNA 2K1FA 4LJOB 2X38A 2E6XA 1TKGA 4B0EA 3DPDA 4I6PA 3ZLZA 3RYTA 2IJ0A 4MDKE 3NVYA 4ARCA 3CWIA 1EU4A 1XXGA 2BBCA 3BIID 2MLBA 4W9EA 1XT9B 2KDIA 4GOCA 2LGSA 2KHWB 3KUZA 4D2KA 3NS1A 1MG4A 2RMMA 1WIAA 1F0ZA 2UYZB 4K3CA 1TS4A 2KQ4X 4DXGA 3U2SC 1LM8B 2KNBA 1N63A 4CYEA 4KV2A 1YIWA 5AUKA 2WXKA 3AEBB 1P9DU 2JX5A 2MWSB 1OEYJ 4OZBA 3A4SC 3ZRCA 1WGRA 2ZW0A 3KH0A 3L13A 3FILA 2MBHA 3VUWA 2KN4A 2FBWB 3BYYB 1FNVA 3HHMA 3LDZE 3L10B 3H7PA 3QHTA 2BTEA 2LRUA 3RD2A 1V9JA 2INCC 3Q3NC 2Q5WD 3TSSA 3VXWA 2LRWA 3SFEB 2MX2A 3C8YA 3VVWB 5H8YE 3PTFC 3IT6B 3I63C 3ZNID 2LVOA 1TZ1A 1NEKB 4JE3B 2ZEQA 2AL3A 2IBIB 2PPHA 3C19A 2JUOA 4ARIA 3JSVA 1YMHE 2PVOD 4JWSC 3NUHB 1LQBA 1UGMA 1WJNA 1TS2A 2GBJA 4YWGG 3W5VB 2Y5BB 4F7ZA 5DPTA 2EMSA 5JZEB 1C4CA 4ANUA 4KIKA 4WQMA 1OEYA 2DZJA 1P0RA 1WF9A 2X8XX 2L52A 2BPSA 4ZRIA 3Q14C 4PT5A 4WURA 2JSVX 4WJNA 3U30A 1J0GA 1L6VA 2BF8B 2OJWA 1ZXIA 1WR1A 4URKA 4RNAA 2WXPA 3UQAA 3OLMD 2D11A 5D7GA 5C23A 4HROA 2IY0B 2PEAA 2J0KA 1ZE3D 4B9KA 1E9MA 2XEWA 2KDMA 3A1QB 3H8HA 5KHOA 1R4NI 3PO0A 3N20C 3UI3A 1FIQA 2IGHA 4C7ZA 1FCCC 4WAAA 2J7QB 1K8RB 4FN2A 4N9F4 2KX3A 1ZDXA 2QMTA 4HKZE 2KN5A 3DBHI 3RNBC 1KFYB 4ZYSA 3DVNU 4BKSD 4A8XC 1KM7A 4US9A 3HUIA 2DYMA 1A5RA 4R3DA 3V3XA 4HJKA 1HE8A 4RF0A 1YJJA 4IWQA 4REZA 2O2VA 4NAWB 4TV3A 1XCQL 4EE2A 2LUEA 4DDID 4LNFA 2WXLA 1K52A 2CHXA 4K7UA 4NY0A 1ISNA 3CSTA 1VDVA 3IXSA 1C1YB 2M0AA 3VH4B 3KWVA 4CQNA 2J53A 4C80A 1QT9A 2WDQB 2O6VD 4Q2JA 4B0MA 1LGRA 4F8CB 3ETRA 1VZ7A 1LXDA 1KRHA 1WGKA 3DBRB 2GBRA 2V3SA 5FKAC 2D2QA 4BBNC 4M8NA 3AI5A 2C60A 1P7FA 1Q5WB 1SIJA 1HTQA 3ABVB 2M19A 3R2IA 4PK1A 3IAM1 1YQ3B 5C1ZA 3LB8C 2HDEA 3T8MA 2D3AA 1JRPA 1KJTA 1T0SC 5MPOA 5J2RA 1VZ8A 1UH6A 2CJNA
chains in the Genus database with same CATH topology
2BKRB 5J18A 3HM6X 1Q0WB 5IAAC 4FBJB 4MM3A 2QHOA 4GN1A 4FADA 4MGIE 1WJUA 2XBBC 2KMCA 4AWJA 1V5OA 3CMMB 3PRPB 2FCNA 1WYWB 2NPTB 3DCGA 3DBSA 4GXBA 4FJYA 4MGZE 4E3CA 4XX5A 5D94A 4DHJB 1H8CA 4MGYE 2G4SA 2LZ6A 4W9KA 3ML9A 4FJVB 1RRBA 2O2VB 3NZUA 4JL9A 3RULA 1FXTB 1GUAB 3RZFA 3UGBB 4EEWA 4M0WB 4A3PA 1AARA 1WM3A 2GMIC 2R2QA 2HD5B 2KQ7A 2KTRA 2VRRB 1RAXA 2LASA 3BY4B 1S3SG 1ZW7A 3ZUNA 2JF5A 2PE9A 1WRDB 4GIVA 4K7WA 2JXXA 3PVLA 1QZEA 1V86A 4HVBA 2DHZA 3S2AA 4MSQB 3W1SA 4DK5A 2HE7A 4PS8A 2KFKA 3KUDB 1E8WA 2O6VA 1GC7A 3CSFA 1WX7A 4FHKA 3L54A 3HK0A 4K7SA 1R4MI 2CHZA 4WJQA 4EZKA 4ICUA 1NDDA 2CS4A 2JT4B 3NZSA 3KVFB 3EECA 3ONSA 3V6CB 4AP4C 4AJWA 2RSUA 2KKCA 3Q3JA 2D10A 2CHWA 4IWPA 4ZYNA 3X0WA 2KXJA 3QX1A 2D07B 4HWIB 2ZPYA 1WXVA 2KWCA 4RMAA 4W9JA 4ANVA 4LCDE 2M8SA 4JGHB 3WAMA 4GDKA 3B1LX 2RGFA 2LWPA 1XQQA 2BWES 4GDLA 5TR5A 4WWOA 2FIDA 4KZ0A 2MSED 1G6JA 2NBWB 2NCNA 2I1KA 4W9IA 2UWQA 4HPMB 2YLMA 4EUTA 3GOEA 3A33B 2ZNVC 2ASQA 4BKGA 4F1SA 1V49A 4EOYA 2CR5A 3GZNI 1V5TA 2BYVE 3ZNGC 1IP9A 3D32A 4NQLB 3DDCB 2KWUB 3UF8A 2FUHB 2A4ZA 2HTHA 3OJ3A 3ZDMC 1V6EA 3A9KA 3BINA 1WMHB 2KJ6A 2DZIA 3L17A 4DHZB 2K8HA 2KDBA 3NS8A 1KOTA 3IBEA 2J0MA 4IW0A 3M62B 2BKFA 5L83A 3APDA 2FCQA 4JQWC 2IO3B 5AEKB 4DDGD 2KO3A 3AXCA 4WJOA 4NJ6A 2LVPA 3HIZA 4MJSB 2REXA 1XD3B 3PGEA 3H7SA 4IM2A 4MSMB 5AZHA 4IWOA 3ZDTA 2K39A 3VH3B 3A1QA 3WAPA 4GB9A 3R7QA 2L05A 3JW0X 5EDSA 2KANA 1IPGA 2IYDB 2XK5A 3PHWB 1IYFA 4HXDA 3ZW3A 3AU4A 3RCZA 4TQ0A 2NVUI 4EZLA 2BWFA 2OJRA 5DPRA 3ENEA 1GG3A 3N30A 4BOZB 1OGWA 3N3KB 5E6NA 3JYUA 1J19A 1WJ6A 4OVUA 1L2NA 3APCA 1RFAA 3SHQA 2KQSA 2LI5A 3C0RB 3NY5A 1WJ4A 4WQOB 5G55A 3OAWA 3PSEB 4EZJA 1GJZA 2KTRB 2L00B 3PREA 1E90A 1NBFC 1SIFA 1U4AA 4KDLB 2WX1A 1Z5SB 2IO2B 2L7RA 2N9EB 4TUUA 2RR9A 3VTVA 1GNUA 2EMTA 3PLUA 4K81A 3UIOB 3QC8B 3PS6A 1EO6A 3WANA 1UBIA 2KFKB 2KC2A 2O6VB 3DVGY 4MEMA 2DAFA 5D2MB 2W9NA 4CHKA 2N1WA 4ASWC 4A20A 2WYQA 3DBLI 4II2B 4NAWA 3UQBA 3L08A 1UD7A 3V61A 1EF5A 3EC8A 3QAQA 3T9LA 2DZMA 4KVGB 4M8MA 4DHJD 5LXIB 2JVCA 3ALBA 5LXHA 2ZVNA 2L76A 2KZRA 4B6WA 3RUIB 1WGGA 3K9OB 3TJPA 1P98A 2L0FA 3X23A 4W9GA 3O65B 2JZ3B 2V1YA 4LDTB 2FNJB 3VFKA 4I6NB 2D3GA 1EUVB 4HPLB 3TCAA 1E8XA 5KHQA 4RM9A 4HDQA 1T0YA 3P2BA 2JWZA 2NBVB 3ZNZB 2K6QA 4HK2A 4ICVA 1WR6E 4KDIC 1Y8RC 4FJZA 3PZDA 4NPNA 1WXSA 2DZKA 3NHEB 4J6IA 3R66C 2AWTA 3KYDD 5FR6A 3R3MA 2A5UA 5GMVA 4KZCA 3A9KB 4AOFA 1WXAA 4IUMB 3R7RA 4MGKE 3ZVVA 1J8CA 2G45B 4TKNA 2LJ5A 2K1FA 2KLCA 1WM2A 2C7HA 4LJOB 3Q3FA 3M3JA 1WI0A 2KMAA 2AYOB 3DPDA 4I6PA 2KJHB 3QIJA 2LXCA 3RYTA 3ZLZA 3TL5A 3ZIMA 4MDKE 2J0JA 3A9JA 1WGDA 3CF6E 2XK5B 3N32A 5E6OA 2OOBB 2WDTB 3VDZA 2MLBA 4W9EA 1XT9B 3PHXB 2KDIA 4GOCA 3TBLD 1WXMA 2KHWB 2KDFB 3H1UA 2GBKA 2NR2A 3IG3A 2K6DB 3KUZA 3PRZA 4FHJA 4HDOA 4G0NB 4PS3A 2LGDA 1V81A 2FCSA 3SD5A 3VQIA 3UIPB 1C3TA 1TBEA 3W1YA 1GC6A 1M94A 1WZ3A 1YQBA 1WIAA 2LXAA 2KK8A 2DX5B 3IFWB 2JPHA 2UYZB 3B08A 3PLVA 4IM0A 2HJ8A 3A4RA 1I35A 1LM8B 2MCNB 1MG8A 2N7EA 2K8BA 2KNBA 5CX3A 4BOSC 3V62A 4CYEA 3ZTCA 2ZPNA 1E8ZA 4NJ7A 4KV2A 1YIWA 4XZ4A 2N9PC 3KUCB 3VTUA 1YX5B 2WX0A 1P9DU 4WWPA 2FIFA 1JRUA 2KVRA 2MWSB 1OEYJ 3H6NA 3A4SC 3ZRCA 1H4RA 3KW5B 5DPSA 1WGRA 1WZ0A 2N7DA 3KH0A 3L13A 4B95A 4DXAB 4BVUC 3ML8A 2MBHA 4LJPB 4EFOA 3VUWA 3MHSD 5J17A 2K25A 2GOWA 3IVFA 3HHMA 3LDZE 3L10B 3H7PA 3QHTA 4P7IA 2LRUA 3JVZX 3RD2A 1V9JA 2KD0A 2LD9A 4BBNF 4FA6A 4WWNA 3VHTC 3ZRFA 4AUQC 2ZZPB 4GSWA 3VXWA 3PV1A 2AEHA 2LRWA 3M95A 3DQVA 1EF1A 2MX2A 3IHPC 3VVWB 2ZNVB 2M0XA 3PTFC 3V6EB 3LJ3A 2ZVOA 3HM3A 1OTRB 1UZXB 3L16A 3ZNID 2IO0B 2LVOA 1TZ1A 4X57B 3ZO5B 4XC2A 2IY1B 3RZWC 4E74A 2B3AA 2JY6A 2JZZA 2G3QB 5LLIA 2MW5A 2ZEQA 1LFDA 3PPAA 2MBOA 2AL3A 2IBIB 2PPHA 3H9DA 4LDTD 3WIMA 2JUOA 4W9LA 3JSVA 2FAZA 4II3B 1P3QU 3PRMB 1RLFA 3SDLC 4GU2A 1LQBA 2YVCA 1UGMA 1WJNA 2IO1B 4G3XB 2DAJA 4GDKB 4ZRKA 1X1MA 4PYZA 2GBJA 2Y5BB 4F7ZA 4GDLB 3DBRI 5DPTA 1UBQA 1E5WA 2EMSA 2N9XA 3VUYA 3VUXA 3MJWA 4G50A 4W9FA 4NQKE 3QA8A 4W9HA 3K9PB 3QJZA 2BYEA 5JZEB 4ANUA 4KIKA 5IA7A 1OEYA 2DZJA 3QQ8B 1P0RA 1WF9A 2CU1A 1V2YA 4BKTA 5DPWA 1SGHA 2MQJA 3TIXA 2BPSA 4ZRIA 2DYBA 4IC7B 1YD8U 5AZGA 1S1QB 2MA9B 4PYUA 4WJNA 3U30A 1J0GA 2ZCCA 2BF8B 4ANXA 5CHFA 1WR1A 4URKA 2L8JA 3PT2B 4KSKC 1D3ZA 2JRIB 3NOBA 2KDEB 2N1VA 4W9CA 3UQAA 1ZGUB 2MBEA 3OLMD 5L95C 2KFJA 2D11A 3B0AA 5D7GA 1Q1OA 3AULA 2MBBB 1WE7A 2KX0A 2IY0B 2PEAA 2J0KA 4K1RB 2LVQA 3L0WB 5C23A 4ANWA 3VAWA 4DHZE 1WX8A 2NBUA 3U7DA 5JH5C 1KLVA 4HCNB 3ZKJC 4B9KA 2N4FA 2XEWA 2C9WB 3A1QB 4OVVA 4MELA 3EFUA 4NNJB 5KHOA 1R4NI 2DYOA 2I1JA 3H7PB 1I42A 4KSLC 1WFYA 1NI2A 2C7MB 2JRHA 4A3OA 5JHBA 1E7VA 2KTFA 4WAAA 2J7QB 1K8RB 4FN2A 4N9F4 5AZFA 2KX3A 2KC1A 1WY8A 3ZNHB 2MP2A 3KYCD 4EKUA 1VD2A 2KN5A 3DBHI 3RT3B 2BGFA 4G11A 3QCAA 1BT0A 3DVNU 4E71A 4BKSD 4HLEA 1KM7A 1E8YA 2DYMA 2GBNA 3MTNB 2Z0DB 2NPTA 2KLGA 4GGQA 2Z0EB 4PS7A 1A5RA 1CMXB 2M4NA 4HJKA 1HE8A 4I6LB 4IWQA 2O2VA 4AJYB 3JSVB 1UELA 1E7UA 4NAWB 4JIOU 4TV3A 3W1SC 2M1MA 1WE6A 3V60A 5JHAA 1SE9A 2LUEA 2CKHB 5E6PA 3QARA 5BO4B 3DVNV 4DDID 2CHXA 2R2OA 1WH3A 2KOXA 4FLHA 2DENB 4K7UA 3I3TB 4NY0A 3U8ZA 1ISNA 3CSTA 3UINB 3QK0A 1WGHA 2L0TA 5G2NA 1C1YB 2PJHA 3AU5A 3VH4B 2C5LC 4KIKB 2FCMA 1OQYA 2KJRA 3ECIA 1L7YA 4HCPB 2O6VD 4DBGA 2G4DB 1YX6B 2ZJDA 4TQ1A 2RPQA 4F8CB 4MH0E 1LXDA 1V80A 4IM3A 2M17A 3EHVA 2ZCBA 4W9DA 2WWZA 2EKEC 5D6JB 3VTWA 3M63B 3DVGX 2GBRA 2MBQA 2V3SA 1TGZB 5DCNA 1ZKHA 1VCBA 2MRPA 2D2QA 4BBNC 4M8NA 3SU8X 3AI5A 4RM8A 4BKSA 2C60A 2LGYA 3DOWA 3OJ4B 5CHWA 1Q5WB 4FULA 2Z59B 2BYFA 4GMVA 2NS5A 3WA0A 4ZRJA 4IG7B 3TMPB 3A9JB 2GBMA 4JLCA 1WGYA 2IZVB 3WAOA 3ZTDA 1WMHA 4DWFA 4ZDVA 2C7NB 4BFRA 2K8CA 4CO7A 1F9JA 3QWZB 4WJPA 5C1ZA 5HKHA 2L3ZA 1TTNA 1WX9A 2RD0A 1YJ1A 2AL6A 4YL8A 3APFA 3T8MA 1Z2MA 2LGXA 1KJTA 5CHVC 5J2RA 3WALA 1P1AA 5CTRC 2PE6B 4MJSA 2KWVB 2V4LA 1UH6A 1PQSA 2MP2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKR B;  5J18 A;  3HM6 X;  1Q0W B;  5IAA C;  4FBJ B;  4MM3 A;  2QHO A;  4GN1 A;  4FAD A;  4MGI E;  1WJU A;  2XBB C;  2KMC A;  4AWJ A;  1V5O A;  3CMM B;  3PRP B;  2FCN A;  1WYW B;  2NPT B;  3DCG A;  3DBS A;  4GXB A;  4FJY A;  4MGZ E;  4E3C A;  4XX5 A;  5D94 A;  4DHJ B;  1H8C A;  4MGY E;  2G4S A;  2LZ6 A;  4W9K A;  3ML9 A;  4FJV B;  1RRB A;  2O2V B;  3NZU A;  4JL9 A;  3RUL A;  1FXT B;  1GUA B;  3RZF A;  3UGB B;  4EEW A;  4M0W B;  4A3P A;  1AAR A;  1WM3 A;  2GMI C;  2R2Q A;  2HD5 B;  2KQ7 A;  2KTR A;  2VRR B;  1RAX A;  2LAS A;  3BY4 B;  1S3S G;  1ZW7 A;  3ZUN A;  2JF5 A;  2PE9 A;  1WRD B;  4GIV A;  4K7W A;  2JXX A;  3PVL A;  1QZE A;  1V86 A;  4HVB A;  2DHZ A;  3S2A A;  4MSQ B;  3W1S A;  4DK5 A;  2HE7 A;  4PS8 A;  2KFK A;  3KUD B;  1E8W A;  2O6V A;  1GC7 A;  3CSF A;  1WX7 A;  4FHK A;  3L54 A;  3HK0 A;  4K7S A;  1R4M I;  2CHZ A;  4WJQ A;  4EZK A;  4ICU A;  1NDD A;  2CS4 A;  2JT4 B;  3NZS A;  3KVF B;  3EEC A;  3ONS A;  3V6C B;  4AP4 C;  4AJW A;  2RSU A;  2KKC A;  3Q3J A;  2D10 A;  2CHW A;  4IWP A;  4ZYN A;  3X0W A;  2KXJ A;  3QX1 A;  2D07 B;  4HWI B;  2ZPY A;  1WXV A;  2KWC A;  4RMA A;  4W9J A;  4ANV A;  4LCD E;  2M8S A;  4JGH B;  3WAM A;  4GDK A;  3B1L X;  2RGF A;  2LWP A;  1XQQ A;  2BWE S;  4GDL A;  5TR5 A;  4WWO A;  2FID A;  4KZ0 A;  2MSE D;  1G6J A;  2NBW B;  2NCN A;  2I1K A;  4W9I A;  2UWQ A;  4HPM B;  2YLM A;  4EUT A;  3GOE A;  3A33 B;  2ZNV C;  2ASQ A;  4BKG A;  4F1S A;  1V49 A;  4EOY A;  2CR5 A;  3GZN I;  1V5T A;  2BYV E;  3ZNG C;  1IP9 A;  3D32 A;  4NQL B;  3DDC B;  2KWU B;  3UF8 A;  2FUH B;  2A4Z A;  2HTH A;  3OJ3 A;  3ZDM C;  1V6E A;  3A9K A;  3BIN A;  1WMH B;  2KJ6 A;  2DZI A;  3L17 A;  4DHZ B;  2K8H A;  2KDB A;  3NS8 A;  1KOT A;  3IBE A;  2J0M A;  4IW0 A;  3M62 B;  2BKF A;  5L83 A;  3APD A;  2FCQ A;  4JQW C;  2IO3 B;  5AEK B;  4DDG D;  2KO3 A;  3AXC A;  4WJO A;  4NJ6 A;  2LVP A;  3HIZ A;  4MJS B;  2REX A;  1XD3 B;  3PGE A;  3H7S A;  4IM2 A;  4MSM B;  5AZH A;  4IWO A;  3ZDT A;  2K39 A;  3VH3 B;  3A1Q A;  3WAP A;  4GB9 A;  3R7Q A;  2L05 A;  3JW0 X;  5EDS A;  2KAN A;  1IPG A;  2IYD B;  2XK5 A;  3PHW B;  1IYF A;  4HXD A;  3ZW3 A;  3AU4 A;  3RCZ A;  4TQ0 A;  2NVU I;  4EZL A;  2BWF A;  2OJR A;  5DPR A;  3ENE A;  1GG3 A;  3N30 A;  4BOZ B;  1OGW A;  3N3K B;  5E6N A;  3JYU A;  1J19 A;  1WJ6 A;  4OVU A;  1L2N A;  3APC A;  1RFA A;  3SHQ A;  2KQS A;  2LI5 A;  3C0R B;  3NY5 A;  1WJ4 A;  4WQO B;  5G55 A;  3OAW A;  3PSE B;  4EZJ A;  1GJZ A;  2KTR B;  2L00 B;  3PRE A;  1E90 A;  1NBF C;  1SIF A;  1U4A A;  4KDL B;  2WX1 A;  1Z5S B;  2IO2 B;  2L7R A;  2N9E B;  4TUU A;  2RR9 A;  3VTV A;  1GNU A;  2EMT A;  3PLU A;  4K81 A;  3UIO B;  3QC8 B;  3PS6 A;  1EO6 A;  3WAN A;  1UBI A;  2KFK B;  2KC2 A;  2O6V B;  3DVG Y;  4MEM A;  2DAF A;  5D2M B;  2W9N A;  4CHK A;  2N1W A;  4ASW C;  4A20 A;  2WYQ A;  3DBL I;  4II2 B;  4NAW A;  3UQB A;  3L08 A;  1UD7 A;  3V61 A;  1EF5 A;  3EC8 A;  3QAQ A;  3T9L A;  2DZM A;  4KVG B;  4M8M A;  4DHJ D;  5LXI B;  2JVC A;  3ALB A;  5LXH A;  2ZVN A;  2L76 A;  2KZR A;  4B6W A;  3RUI B;  1WGG A;  3K9O B;  3TJP A;  1P98 A;  2L0F A;  3X23 A;  4W9G A;  3O65 B;  2JZ3 B;  2V1Y A;  4LDT B;  2FNJ B;  3VFK A;  4I6N B;  2D3G A;  1EUV B;  4HPL B;  3TCA A;  1E8X A;  5KHQ A;  4RM9 A;  4HDQ A;  1T0Y A;  3P2B A;  2JWZ A;  2NBV B;  3ZNZ B;  2K6Q A;  4HK2 A;  4ICV A;  1WR6 E;  4KDI C;  1Y8R C;  4FJZ A;  3PZD A;  4NPN A;  1WXS A;  2DZK A;  3NHE B;  4J6I A;  3R66 C;  2AWT A;  3KYD D;  5FR6 A;  3R3M A;  2A5U A;  5GMV A;  4KZC A;  3A9K B;  4AOF A;  1WXA A;  4IUM B;  3R7R A;  4MGK E;  3ZVV A;  1J8C A;  2G45 B;  4TKN A;  2LJ5 A;  2K1F A;  2KLC A;  1WM2 A;  2C7H A;  4LJO B;  3Q3F A;  3M3J A;  1WI0 A;  2KMA A;  2AYO B;  3DPD A;  4I6P A;  2KJH B;  3QIJ A;  2LXC A;  3RYT A;  3ZLZ A;  3TL5 A;  3ZIM A;  4MDK E;  2J0J A;  3A9J A;  1WGD A;  3CF6 E;  2XK5 B;  3N32 A;  5E6O A;  2OOB B;  2WDT B;  3VDZ A;  2MLB A;  4W9E A;  1XT9 B;  3PHX B;  2KDI A;  4GOC A;  3TBL D;  1WXM A;  2KHW B;  2KDF B;  3H1U A;  2GBK A;  2NR2 A;  3IG3 A;  2K6D B;  3KUZ A;  3PRZ A;  4FHJ A;  4HDO A;  4G0N B;  4PS3 A;  2LGD A;  1V81 A;  2FCS A;  3SD5 A;  3VQI A;  3UIP B;  1C3T A;  1TBE A;  3W1Y A;  1GC6 A;  1M94 A;  1WZ3 A;  1YQB A;  1WIA A;  2LXA A;  2KK8 A;  2DX5 B;  3IFW B;  2JPH A;  2UYZ B;  3B08 A;  3PLV A;  4IM0 A;  2HJ8 A;  3A4R A;  1I35 A;  1LM8 B;  2MCN B;  1MG8 A;  2N7E A;  2K8B A;  2KNB A;  5CX3 A;  4BOS C;  3V62 A;  4CYE A;  3ZTC A;  2ZPN A;  1E8Z A;  4NJ7 A;  4KV2 A;  1YIW A;  4XZ4 A;  2N9P C;  3KUC B;  3VTU A;  1YX5 B;  2WX0 A;  1P9D U;  4WWP A;  2FIF A;  1JRU A;  2KVR A;  2MWS B;  1OEY J;  3H6N A;  3A4S C;  3ZRC A;  1H4R A;  3KW5 B;  5DPS A;  1WGR A;  1WZ0 A;  2N7D A;  3KH0 A;  3L13 A;  4B95 A;  4DXA B;  4BVU C;  3ML8 A;  2MBH A;  4LJP B;  4EFO A;  3VUW A;  3MHS D;  5J17 A;  2K25 A;  2GOW A;  3IVF A;  3HHM A;  3LDZ E;  3L10 B;  3H7P A;  3QHT A;  4P7I A;  2LRU A;  3JVZ X;  3RD2 A;  1V9J A;  2KD0 A;  2LD9 A;  4BBN F;  4FA6 A;  4WWN A;  3VHT C;  3ZRF A;  4AUQ C;  2ZZP B;  4GSW A;  3VXW A;  3PV1 A;  2AEH A;  2LRW A;  3M95 A;  3DQV A;  1EF1 A;  2MX2 A;  3IHP C;  3VVW B;  2ZNV B;  2M0X A;  3PTF C;  3V6E B;  3LJ3 A;  2ZVO A;  3HM3 A;  1OTR B;  1UZX B;  3L16 A;  3ZNI D;  2IO0 B;  2LVO A;  1TZ1 A;  4X57 B;  3ZO5 B;  4XC2 A;  2IY1 B;  3RZW C;  4E74 A;  2B3A A;  2JY6 A;  2JZZ A;  2G3Q B;  5LLI A;  2MW5 A;  2ZEQ A;  1LFD A;  3PPA A;  2MBO A;  2AL3 A;  2IBI B;  2PPH A;  3H9D A;  4LDT D;  3WIM A;  2JUO A;  4W9L A;  3JSV A;  2FAZ A;  4II3 B;  1P3Q U;  3PRM B;  1RLF A;  3SDL C;  4GU2 A;  1LQB A;  2YVC A;  1UGM A;  1WJN A;  2IO1 B;  4G3X B;  2DAJ A;  4GDK B;  4ZRK A;  1X1M A;  4PYZ A;  2GBJ A;  2Y5B B;  4F7Z A;  4GDL B;  3DBR I;  5DPT A;  1UBQ A;  1E5W A;  2EMS A;  2N9X A;  3VUY A;  3VUX A;  3MJW A;  4G50 A;  4W9F A;  4NQK E;  3QA8 A;  4W9H A;  3K9P B;  3QJZ A;  2BYE A;  5JZE B;  4ANU A;  4KIK A;  5IA7 A;  1OEY A;  2DZJ A;  3QQ8 B;  1P0R A;  1WF9 A;  2CU1 A;  1V2Y A;  4BKT A;  5DPW A;  1SGH A;  2MQJ A;  3TIX A;  2BPS A;  4ZRI A;  2DYB A;  4IC7 B;  1YD8 U;  5AZG A;  1S1Q B;  2MA9 B;  4PYU A;  4WJN A;  3U30 A;  1J0G A;  2ZCC A;  2BF8 B;  4ANX A;  5CHF A;  1WR1 A;  4URK A;  2L8J A;  3PT2 B;  4KSK C;  1D3Z A;  2JRI B;  3NOB A;  2KDE B;  2N1V A;  4W9C A;  3UQA A;  1ZGU B;  2MBE A;  3OLM D;  5L95 C;  2KFJ A;  2D11 A;  3B0A A;  5D7G A;  1Q1O A;  3AUL A;  2MBB B;  1WE7 A;  2KX0 A;  2IY0 B;  2PEA A;  2J0K A;  4K1R B;  2LVQ A;  3L0W B;  5C23 A;  4ANW A;  3VAW A;  4DHZ E;  1WX8 A;  2NBU A;  3U7D A;  5JH5 C;  1KLV A;  4HCN B;  3ZKJ C;  4B9K A;  2N4F A;  2XEW A;  2C9W B;  3A1Q B;  4OVV A;  4MEL A;  3EFU A;  4NNJ B;  5KHO A;  1R4N I;  2DYO A;  2I1J A;  3H7P B;  1I42 A;  4KSL C;  1WFY A;  1NI2 A;  2C7M B;  2JRH A;  4A3O A;  5JHB A;  1E7V A;  2KTF A;  4WAA A;  2J7Q B;  1K8R B;  4FN2 A;  4N9F 4;  5AZF A;  2KX3 A;  2KC1 A;  1WY8 A;  3ZNH B;  2MP2 A;  3KYC D;  4EKU A;  1VD2 A;  2KN5 A;  3DBH I;  3RT3 B;  2BGF A;  4G11 A;  3QCA A;  1BT0 A;  3DVN U;  4E71 A;  4BKS D;  4HLE A;  1KM7 A;  1E8Y A;  2DYM A;  2GBN A;  3MTN B;  2Z0D B;  2NPT A;  2KLG A;  4GGQ A;  2Z0E B;  4PS7 A;  1A5R A;  1CMX B;  2M4N A;  4HJK A;  1HE8 A;  4I6L B;  4IWQ A;  2O2V A;  4AJY B;  3JSV B;  1UEL A;  1E7U A;  4NAW B;  4JIO U;  4TV3 A;  3W1S C;  2M1M A;  1WE6 A;  3V60 A;  5JHA A;  1SE9 A;  2LUE A;  2CKH B;  5E6P A;  3QAR A;  5BO4 B;  3DVN V;  4DDI D;  2CHX A;  2R2O A;  1WH3 A;  2KOX A;  4FLH A;  2DEN B;  4K7U A;  3I3T B;  4NY0 A;  3U8Z A;  1ISN A;  3CST A;  3UIN B;  3QK0 A;  1WGH A;  2L0T A;  5G2N A;  1C1Y B;  2PJH A;  3AU5 A;  3VH4 B;  2C5L C;  4KIK B;  2FCM A;  1OQY A;  2KJR A;  3ECI A;  1L7Y A;  4HCP B;  2O6V D;  4DBG A;  2G4D B;  1YX6 B;  2ZJD A;  4TQ1 A;  2RPQ A;  4F8C B;  4MH0 E;  1LXD A;  1V80 A;  4IM3 A;  2M17 A;  3EHV A;  2ZCB A;  4W9D A;  2WWZ A;  2EKE C;  5D6J B;  3VTW A;  3M63 B;  3DVG X;  2GBR A;  2MBQ A;  2V3S A;  1TGZ B;  5DCN A;  1ZKH A;  1VCB A;  2MRP A;  2D2Q A;  4BBN C;  4M8N A;  3SU8 X;  3AI5 A;  4RM8 A;  4BKS A;  2C60 A;  2LGY A;  3DOW A;  3OJ4 B;  5CHW A;  1Q5W B;  4FUL A;  2Z59 B;  2BYF A;  4GMV A;  2NS5 A;  3WA0 A;  4ZRJ A;  4IG7 B;  3TMP B;  3A9J B;  2GBM A;  4JLC A;  1WGY A;  2IZV B;  3WAO A;  3ZTD A;  1WMH A;  4DWF A;  4ZDV A;  2C7N B;  4BFR A;  2K8C A;  4CO7 A;  1F9J A;  3QWZ B;  4WJP A;  5C1Z A;  5HKH A;  2L3Z A;  1TTN A;  1WX9 A;  2RD0 A;  1YJ1 A;  2AL6 A;  4YL8 A;  3APF A;  3T8M A;  1Z2M A;  2LGX A;  1KJT A;  5CHV C;  5J2R A;  3WAL A;  1P1A A;  5CTR C;  2PE6 B;  4MJS A;  2KWV B;  2V4L A;  1UH6 A;  1PQS A;  2MP2 B; 
#chains in the Genus database with same CATH topology
 5HHD G;  4FBJ B;  2Y3A A;  1HA5 A;  3EUB 2;  4GN1 A;  2KMC A;  1V5O A;  3CMM B;  3AN1 A;  4E3C A;  4MGZ E;  3NG0 A;  1F2R C;  4W9K A;  3ML9 A;  3AMZ A;  1RRB A;  3RZF A;  1TIF A;  1YN3 A;  1N60 A;  2D3C A;  2JF5 A;  1WRD B;  4GIV A;  4BZA A;  2IGD A;  2K22 A;  3PVL A;  1QZE A;  4HVB A;  3DHG C;  2HE7 A;  2KFK A;  1J7A A;  1WX7 A;  4HJG E;  4K7S A;  4WJQ A;  4ICU A;  3FAH A;  4YT0 B;  2D10 A;  1FNU A;  2WS3 B;  4JGH B;  3B1L X;  4M00 A;  4WWO A;  2FID A;  1G6J A;  2NBW B;  1SBB B;  2W3S A;  4HPM B;  3N1Y C;  1V49 A;  5IP4 D;  3ZNG C;  2XN9 C;  2VZK B;  1L0X B;  3N1X C;  2VH1 A;  2FUH B;  2A4Z A;  3OJ3 A;  1JAL A;  3A9K A;  1WMH B;  2KJ6 A;  1PGX A;  1NEN B;  2KDB A;  1GAQ B;  1N5X A;  4IW0 A;  5C3J B;  3M62 B;  2WXN A;  2IDY A;  2OHF A;  3TUO A;  1ESF A;  2IO3 B;  3AXC A;  4NJ6 A;  2REX A;  3NJT A;  2K39 A;  3A1Q A;  3WAP A;  2L05 A;  5EE3 A;  2KAN A;  5EDS A;  3RCZ A;  2ACZ B;  3Q6B A;  4BOZ B;  1OGW A;  1J19 A;  4ZHO A;  3SHQ A;  2KQS A;  3PSE B;  2KTR B;  4HEA 1;  1NBF C;  2BVC A;  4TUU A;  3PLU A;  1C4P A;  4OZC A;  1UBI A;  3BVZ A;  2O6V B;  2QC8 A;  5D2M B;  1GB1 A;  2W9N A;  2N1W A;  4NAW A;  2GLS A;  3V61 A;  1EF5 A;  3T9L A;  5LXI B;  4KVG B;  4M8M A;  2HJ1 A;  3AH7 A;  3ALB A;  5LXH A;  4MAC A;  2QIL A;  2W82 A;  1V1P B;  4B6W A;  3RUI B;  3TJP A;  3RNE C;  2CJO A;  4W9G A;  2H88 B;  2D3G A;  4HPL B;  4RM9 A;  1PYW D;  1T0Y A;  3P2B A;  4KDI C;  3AE1 B;  4FJZ A;  4NPN A;  2AWT A;  3P42 A;  2WXH A;  4IUM B;  4MGK E;  1J8C A;  2G45 B;  1KTK A;  2KLC A;  1FFV A;  3I9V 1;  3Q3F A;  3M3J A;  1WI0 A;  2ZW1 A;  3QIJ A;  2DWQ A;  3DWG C;  4M01 A;  1NVI D;  3P4S B;  2DBY A;  2XK5 B;  3N32 A;  5E6O A;  2OOB B;  3SEB A;  3VDZ A;  2LUM A;  3LXF A;  3PHX B;  4ACF A;  1WXM A;  2KDF B;  3H1U A;  3PRZ A;  1L4Z B;  2NR2 A;  4FHJ A;  4PS3 A;  2J4X A;  4G0N B;  3UIP B;  1TZO A;  2PW9 A;  1AYF A;  1GC6 A;  1M94 A;  1YQB A;  3IFW B;  1IBX B;  3B08 A;  1F77 A;  2HJ8 A;  3A4R A;  1I35 A;  1IUE A;  2K9X A;  4WAF A;  5CX3 A;  2K8B A;  2MHJ A;  4BOS C;  3ZTC A;  2ZPN A;  4NJ7 A;  4XZ4 A;  2N9P C;  3KUC B;  4O1N A;  4FXC A;  2KYW A;  2KVR A;  2WXR A;  1UGJ A;  4MH8 A;  1CQV A;  3H6N A;  3KW5 B;  2N7D A;  4B95 A;  4BVU C;  3ML8 A;  1DYQ A;  5J17 A;  2GOW A;  3IVF A;  3RN9 C;  4YTM B;  4LNK A;  3VHT C;  1NYR A;  1FD6 A;  3PV1 A;  3M95 A;  3DQV A;  1EF1 A;  1HXY D;  1AWD A;  2ZNV B;  2ZVO A;  2PTL A;  3HM3 A;  3TEW A;  1V97 A;  2JY6 A;  2G3Q B;  5LLI A;  2MBO A;  2BB6 A;  1CK1 A;  2BS4 B;  3H9D A;  3WIM A;  2M56 B;  4II3 B;  4YTN B;  4HRS A;  1RLF A;  4GU2 A;  4GDK B;  1X1M A;  3Q8A A;  2K5P A;  1AN8 A;  2MJD A;  4GDL B;  2D5G A;  3DBR I;  1E5W A;  1HZ6 A;  2OED A;  4G50 A;  1OQR A;  4NQK E;  4W9H A;  4AQ7 A;  3QQ8 B;  2GI9 A;  1SGH A;  2INP E;  3TIX A;  2EEL A;  4KKJ A;  2DYB A;  4IC7 B;  1YD8 U;  5AZG A;  2UU7 A;  2MA9 B;  4PYU A;  1WXQ A;  1TT5 B;  1C76 A;  1XLO A;  2LGI A;  1C9F A;  5CHF A;  1TKY A;  2WDR B;  2JRI B;  1T6B X;  2W55 A;  2N1V A;  1KH0 A;  5L95 C;  2KFJ A;  1K53 A;  3B0A A;  2I38 A;  3L0W B;  1DOY A;  4ANW A;  1EWY C;  2CU3 A;  4J3O D;  4DHZ E;  4HCN B;  2BYT A;  2N4F A;  4OVV A;  3AV8 A;  2WXQ A;  2I1J A;  1Q10 A;  1I42 A;  3AM9 A;  4KSL C;  1WFY A;  1NI2 A;  2C7M B;  1LO5 D;  2G9H D;  1MFW A;  4RCO A;  1WY8 A;  3ZNH B;  1MHH E;  1OFF A;  2MP2 A;  2WXF A;  3KYC D;  4EKU A;  1VD2 A;  3B2G A;  2LEK A;  4G11 A;  3QCA A;  4HLE A;  3VR9 B;  1E8Y A;  3MTN B;  2KLG A;  4GGQ A;  1SE2 A;  1FXA A;  1CMX B;  2M4N A;  4I6L B;  1R7S A;  4KGS A;  1FXI A;  4C4V B;  1L0Y B;  4XE0 A;  4JIO U;  4M0W A;  1C79 A;  1YJI A;  1WE6 A;  2NTT A;  3URY A;  1SJH D;  5E6P A;  2CKH B;  3QAR A;  1PGB A;  3DVN V;  2R2O A;  1WH3 A;  3I3T B;  1WGH A;  2N9L A;  3TEY A;  1YN5 A;  3GB1 A;  4OZA A;  2FCM A;  2KJR A;  4RGN A;  1L7Y A;  4C7Y A;  4DBG A;  5C2T B;  2FE8 A;  1SEB D;  1QQR A;  2RPQ A;  1FNW A;  3EHV A;  5IOI A;  2KAC A;  3KQ4 A;  3M63 B;  2MBQ A;  1ZKH A;  2MEK A;  1YN4 A;  3RNG C;  3SU8 X;  3GP7 A;  2LGY A;  3DOW A;  4A55 A;  1YNT E;  3AB5 A;  4FUL A;  4RF1 A;  3TMP B;  2GBM A;  1WGY A;  3VRA B;  2IZV B;  4DWF A;  2C7N B;  1SJE D;  3NVV A;  1F9J A;  1D5X C;  1CZP A;  5HKH A;  1M4V A;  2L3Z A;  1YJ1 A;  2LGX A;  5CHV C;  3WAL A;  1P1A A;  2WLB A;  2YVC A;  2EKI A;  1DOI A;  5J18 A;  3HM6 X;  1Q0W B;  5IAA C;  4FAD A;  3BZD B;  1I4X A;  3B9J A;  3TEX A;  4AWJ A;  2NPT B;  4FJY A;  1R4M B;  4DHJ B;  1H8C A;  2WU2 B;  4FJV B;  3AE6 B;  1J7B A;  3NZU A;  3RUL A;  4EEW A;  4XWT A;  2N9K A;  2R2Q A;  2HD5 B;  2KQ7 A;  2WXJ A;  3BY4 B;  1S3S G;  1ZW7 A;  4MSQ B;  1ZPS A;  3U4E G;  3L54 A;  3HK0 A;  3Q8C A;  2CHZ A;  2CS4 A;  2JT4 B;  1IYF A;  3KVF B;  4AJW A;  3Q8B A;  2PMV A;  2CHW A;  4IWP A;  4ZYN A;  2KT7 A;  3X0W A;  3KLS X;  4HWI B;  2ZPY A;  4ANV A;  3WAM A;  4GDK A;  3T3N A;  2LWP A;  1JWU D;  2KVZ A;  1XQQ A;  4GDL A;  4DXF A;  2MJ3 A;  3SFD B;  2I1K A;  3MHZ A;  1TYG B;  4EUT A;  2ZNV C;  2ASQ A;  3GZN I;  3PZ8 A;  2B76 B;  2D3B A;  4P1C C;  3D32 A;  4NQL B;  3ZDM C;  2DZI A;  4DHZ B;  1UNS A;  1KOT A;  2BKF A;  2ICI A;  2PVG C;  5AUI A;  1SF0 A;  4WJO A;  1HTO A;  2LVP A;  4MJS B;  1EWC A;  4XGA B;  3H7S A;  3TEZ A;  1EU3 A;  5AZH A;  3ZDT A;  3AEF B;  5BMI A;  4GB9 A;  3BK2 A;  3PHW B;  4HXD A;  4WH4 A;  2OJR A;  1GG3 A;  3NVZ A;  4L1B A;  4OVU A;  2WDV B;  1RFA A;  2H89 B;  1E7P B;  4L2Y A;  5G55 A;  4A9A A;  5G5G A;  1SB3 C;  2L00 B;  3P63 A;  3PRE A;  1E90 A;  1SIF A;  1U4A A;  1AW7 A;  4RGM A;  3V05 A;  5JXV A;  3VTV A;  1GNU A;  4K81 A;  1ZDV A;  3NVW A;  3QC8 B;  2KC2 A;  3OG5 A;  2DAF A;  1ZUD 2;  1BXT A;  4ASW C;  2GRI A;  2WYQ A;  3DBL I;  3NRZ A;  1UD7 A;  1I7H A;  2JVC A;  3O13 A;  4A6Q A;  2PLP A;  3K9O B;  1L4D B;  2L0F A;  4L23 A;  5HI1 A;  2FNJ B;  3RNF C;  4HKQ A;  2LHD A;  2JWZ A;  2NBV B;  3ZNZ B;  4HK2 A;  1WR6 E;  1E0Z A;  1WXS A;  2DZK A;  2WNM A;  3NHE B;  4J6I A;  3R66 C;  4C00 A;  3KYD D;  3P1M A;  4JX1 C;  4AOF A;  1ET9 A;  5D3I B;  3EGR A;  1MVK A;  2AYO B;  1TY2 A;  2KJH B;  2LXC A;  3TL5 A;  2J0J A;  1WGD A;  3CF6 E;  3KWL A;  3MC8 A;  2WDT B;  1SXT A;  2K3U A;  3TBL D;  4XYC A;  5IO9 A;  2GBK A;  3IG3 A;  4HPP A;  2K6D B;  3SD5 A;  1TBE A;  3W1Y A;  1WZ3 A;  1XLQ A;  2LXA A;  2V4I B;  2BT6 A;  2DX5 B;  1WSP A;  4RGT A;  3PLV A;  4IM0 A;  1MG8 A;  3V62 A;  1FRR A;  1SSN A;  2HTM E;  1BUI C;  2WX0 A;  2AQ2 B;  3MP9 A;  1JRU A;  2N7J A;  3MC0 B;  5DPS A;  3Q8F A;  1WZ0 A;  2W3R A;  3ZJV A;  1UUP A;  4LJP B;  1F2R I;  1GOZ A;  3Q8E A;  3AEA B;  5IKC M;  3JVZ X;  4BBN F;  2KD0 A;  2LD9 A;  4FA6 A;  1WRI A;  4WWN A;  4TSS A;  4ZRQ A;  2AQ1 B;  4P16 A;  2ZZP B;  4GSW A;  2TSS A;  2AX5 A;  2M0X A;  3V6E B;  3LJ3 A;  1MJD A;  2RPV A;  3PZ7 A;  1QOA A;  3Q3M C;  2IO0 B;  4X57 B;  4E74 A;  2JZZ A;  2MW5 A;  3BVG A;  1LFD A;  3IT4 B;  1Y56 A;  4LDT D;  4MT5 A;  2FAZ A;  1P3Q U;  3PRM B;  4G3X B;  4ZRK A;  4PYZ A;  1I4P A;  5BMG A;  1UBQ A;  2YEP F;  3VUY A;  3VUX A;  4W9F A;  3QA8 A;  3K9P B;  1DOX A;  2MH7 A;  1JWM D;  2BYE A;  3QJZ A;  3U52 E;  2V0G A;  1MHX A;  1F52 A;  1TS5 A;  1VR9 A;  4USA A;  1V2Y A;  4OVZ A;  5DPW A;  1XLP A;  1YOV B;  2ZCC A;  1R4N B;  3R8B A;  4KSK C;  1L0V B;  3R2T A;  2KDE B;  1JWS D;  1XLN A;  4W9C A;  1ZGU B;  1VJK A;  2MBB B;  1WE7 A;  4K1R B;  2IPK D;  3RI7 C;  3DHI C;  1KLV A;  1WX8 A;  2NBU A;  3ZKJ C;  3FIL B;  3DBH B;  2C9W B;  5EE1 A;  4MEL A;  3DWM A;  3EFU A;  1E6E B;  3H7P B;  1I4G A;  1HZ5 A;  2QSD A;  1T3Q A;  4NJC A;  4A3O A;  1E7V A;  2KC1 A;  4JPS A;  1QOB A;  3RT3 B;  1ACC A;  5BYQ A;  4NZL B;  4US8 A;  1P7E A;  2GBN A;  2IND C;  4PS7 A;  1IGC A;  2Z0E B;  4RH6 A;  5IN7 A;  4LLG M;  1I4R A;  2BS3 B;  3Q3O C;  4P1B C;  1RYJ A;  3JSV B;  1E7U A;  2QEJ C;  3ZQ4 A;  3W1S C;  2WGS A;  2M1M A;  3V60 A;  5JHA A;  2KOX A;  4FLH A;  3UIN B;  1WWT A;  1KF6 B;  2ONQ A;  4NAM A;  1C78 A;  1JW9 D;  1FMA D;  3RFZ B;  2PJH A;  1PUT A;  4KIK B;  2E3T A;  1TJE A;  2G4D B;  1YX6 B;  4TQ1 A;  4YSX B;  4IM3 A;  4IKG A;  4W9D A;  2MJE A;  2WWZ A;  1N6Z A;  4RGO S;  3EA6 A;  5D6J B;  1K51 A;  3DVG X;  3RMK C;  2DLB A;  1TGZ B;  2MRP A;  3W2D A;  3OJ4 B;  2BYF A;  4GMV A;  5BYR A;  1ZP0 B;  2NS5 A;  4ZRJ A;  3A9J B;  1WMH A;  4ZDV A;  4BFR A;  2JQR B;  1TS3 A;  4S0R A;  3QWZ B;  4WJP A;  3WCQ A;  1V1O A;  4YL8 A;  2AL6 A;  3APF A;  1JQ4 A;  4ZRP A;  4YSZ B;  2LJI A;  5CTR C;  2PE6 B;  1I4Q A;  4ZHP A;  1PQS A;  4BKS A;  2BKR B;  3ZJU A;  2KAJ A;  4MGI E;  3PRP B;  3DCG A;  3DBS A;  4GXB A;  4XX5 A;  3AE8 B;  5D94 A;  1BML C;  4MGY E;  1B1Z A;  2O2V B;  1UWX A;  3FKY A;  1ENF A;  1FXT B;  1GUA B;  4JL9 A;  1AAR A;  2GMI C;  2QCZ A;  2VRR B;  2KTR A;  3ZUN A;  2JZP A;  2PE9 A;  2XNA C;  1D5Z C;  3AE7 B;  1XF5 L;  1E8W A;  2O6V A;  3CSF A;  4FHK A;  5HFY A;  3NZS A;  3V6C B;  4AP4 C;  2Y5C A;  3ONS A;  1TY0 A;  3Q3J A;  4YXD B;  2FUG 1;  3QX1 A;  4XDD A;  2D07 B;  1CJE A;  3P4Q B;  2KWC A;  1QKZ A;  4W9J A;  2R61 A;  2JYT A;  4LCD E;  2M8S A;  1V1P A;  3AE9 B;  2BWE S;  4UDU C;  4KZ0 A;  2MSE D;  2NCN A;  1FFU A;  4W9I A;  2UWQ A;  3GOE A;  3A33 B;  4N59 A;  1MPE A;  1V8C A;  1FEH A;  4WIP A;  1IP9 A;  3DDC B;  2KWU B;  2YEP B;  3UF8 A;  3BIN A;  2RDG A;  3IBE A;  2ON8 A;  5L83 A;  4JQW C;  5AEK B;  4DDG D;  1NI3 A;  4IM2 A;  4MSM B;  3SR6 A;  5FR3 A;  4IWO A;  1FCL A;  4C56 C;  1QF6 A;  3R7Q A;  1IGD A;  3JW0 X;  4OHJ A;  1IPG A;  2XK5 A;  4TMA B;  4TQ0 A;  4EZL A;  2BWF A;  4DQO C;  3W5U B;  1XCT L;  3N3K B;  3IAS 1;  1WJ6 A;  3J9C A;  3ZXV A;  3APC A;  3L4P A;  4EZJ A;  3LYY A;  4WQO B;  1IBX A;  1GJZ A;  1GB4 A;  4KDL B;  2WX1 A;  2RDB C;  3UIO B;  2EMT A;  1A70 A;  3HVZ A;  5T8I A;  1EO6 A;  3WAN A;  2KFK B;  3DVG Y;  1QLB B;  4LNI A;  1I4H A;  4CHK A;  4GLS C;  1F1H A;  3ZYY X;  1DGJ A;  3QAQ A;  4LNN A;  2DZM A;  1D4B A;  3N9Y C;  2BB5 A;  2ZVN A;  1P98 A;  4K3B A;  3X23 A;  3ZXR A;  1QIL A;  3B2F A;  3VFK A;  1PFD A;  3ZJT A;  2K0P A;  5KHQ A;  3E9S A;  4ICV A;  3PZD A;  1SE4 A;  5FR6 A;  3R3M A;  2A5U A;  5GMV A;  4KZC A;  3U7Z A;  3A9K B;  1WXA A;  1J7C A;  3R7R A;  3EFC A;  2WXO A;  3ZVV A;  2LJ5 A;  1WM2 A;  2KMM A;  2QJL A;  2C7H A;  4KKI A;  2KMA A;  2WXI A;  3ZIM A;  3AED B;  3A9J A;  5EE9 A;  2VZK D;  2J52 A;  4RFB A;  2V9H A;  2WU5 B;  4HDO A;  1PGA A;  1V81 A;  2FCS A;  2LGD A;  3VQI A;  1C3T A;  2N0S B;  2VH2 A;  2KK8 A;  3HRD D;  2JPH A;  4H2A A;  3GS2 A;  1T5X D;  4AS1 A;  2MCN B;  2N7E A;  2J42 A;  5BYS A;  1E8Z A;  5H92 C;  3VTU A;  1YX5 B;  2IGG A;  1T0Q C;  4IOI E;  2FIF A;  4WWP A;  2JU6 X;  2LMC A;  2RDH A;  1H4R A;  4BAX A;  4DXA B;  1ZOY B;  3OWE B;  4EFO A;  3MHS D;  4MM3 B;  1STE A;  3RNC C;  4M02 A;  2K25 A;  4P7I A;  1UF0 A;  3ZRF A;  4A90 A;  2KWD A;  4AUQ C;  2AEH A;  3Q2A C;  3IHP C;  1OTR B;  1UZX B;  3L16 A;  1FRD A;  3ZO5 B;  4XC2 A;  2IY1 B;  3RZW C;  2B3A A;  2JXT A;  3PPA A;  2W54 A;  4W9L A;  4C4V A;  3W9C B;  2PKO A;  1FPY A;  3SDL C;  3AEC B;  4IDI A;  2IO1 B;  2DAJ A;  3AE3 B;  4OW0 A;  4N6E B;  3MFG A;  2N9X A;  3MJW A;  1N5W A;  1L6U A;  5IA7 A;  2CU1 A;  1E10 A;  4BKT A;  1L5P A;  2QDF A;  2L1A A;  2MQJ A;  1JML A;  4YSY B;  1ZXH A;  4KGR A;  1S1Q B;  1FM0 D;  4LK0 M;  1B9R A;  4ANX A;  2L8J A;  3PT2 B;  1D3Z A;  5HG2 A;  3NOB A;  1N62 A;  4ZOH C;  3T3O A;  3AE5 B;  2MBE A;  1Q1O A;  3AUL A;  2KX0 A;  1PDX A;  3CIR B;  2LVQ A;  3VAW A;  3U7D A;  5JH5 C;  1OQQ A;  4NNJ B;  3AEE B;  2DYO A;  3P4R B;  5BMH A;  2JRH A;  5JHB A;  2KTF A;  3E56 A;  3I5J C;  5AZF A;  2LHE A;  4KGT A;  2GB1 A;  2BGF A;  1BT0 A;  4E71 A;  1FO4 A;  2Z0D B;  2NPT A;  2V3N A;  1RM6 C;  2QIE B;  5E6J A;  4AJY B;  5FK9 C;  1UEL A;  1D6E C;  1SE9 A;  5BO4 B;  4ITK A;  4LNO A;  3U8Z A;  2DEN B;  2BQQ A;  3QK0 A;  2L0T A;  2WXG A;  5G2N A;  5EE0 A;  2PIA A;  3AEG B;  4XDC A;  3AU5 A;  1QOF A;  2C5L C;  4P6V F;  1OQY A;  1SE3 A;  3ECI A;  4HCP B;  2ZJD A;  1T0R C;  2I2Y A;  4MH0 E;  1V80 A;  2WP9 B;  2M17 A;  2ZCB A;  2AQ3 B;  2EKE C;  3VTW A;  3I57 A;  5DCN A;  1VCB A;  3BK1 A;  1KLU D;  1C77 A;  4RM8 A;  3BWU D;  5CHW A;  1WYG A;  2Z59 B;  1HEZ E;  3BVM A;  1K50 A;  3WA0 A;  4IG7 B;  4JLC A;  3WAO A;  3ZTD A;  3VRB B;  2K8C A;  1HQR D;  1JRO A;  4CO7 A;  1GPX A;  1TTN A;  1WX9 A;  2RD0 A;  2INN E;  1MI0 A;  1JWB D;  1Z2M A;  3ZGZ A;  4MJS A;  2KWV B;  2V4L A;  3HVD A;  2MP2 B;  2NMQ A;  4MM3 A;  2SEB D;  2V3P A;  2DNF A;  2QHO A;  1WJU A;  2XBB C;  1VRA B;  2WQY B;  2FCN A;  1WYW B;  1XEE A;  4JWU C;  2LFI A;  1N61 A;  2G4S A;  2LZ6 A;  4QAY A;  3UGB B;  3MJ5 A;  4M0W B;  4A3P A;  1WM3 A;  2L32 A;  1RAX A;  1ROE A;  2LAS A;  4YTP B;  4K7W A;  2WXM A;  2JXX A;  1VZ6 A;  1V86 A;  3Q69 A;  2DHZ A;  2Z8L A;  3S2A A;  3W1S A;  4DK5 A;  4PS8 A;  3KUD B;  1YQ4 B;  1GC7 A;  3FC4 A;  1R4M I;  4EZK A;  3P4P B;  1EM7 A;  1NDD A;  4S17 A;  3EEC A;  2RSU A;  2KKC A;  3GZN B;  2KXJ A;  3BYT B;  2JWU A;  2WHI A;  3AE2 B;  4RMA A;  1WXV A;  3MC9 A;  2BS2 B;  2RGF A;  5TR5 A;  1XO3 A;  1D5M C;  5I4D A;  2L83 A;  2YLM A;  5LNK 1;  4BKG A;  1C4A A;  4F1S A;  4EOY A;  2CR5 A;  1NYQ A;  3DHH C;  1V5T A;  2BYV E;  4N58 A;  4KX6 B;  1QOG A;  2HTH A;  5TSS A;  3RNA C;  1V6E A;  3L17 A;  1KLG D;  2K8H A;  3NS8 A;  2J0M A;  2NTS A;  3VR8 B;  3APD A;  2FCQ A;  1JWA D;  2KO3 A;  3RPF C;  2Y5P A;  4WWM A;  4LTU A;  3HIZ A;  1TKE A;  1XD3 B;  3PGE A;  1VLB A;  5G5H A;  3VH3 B;  2G1E A;  3NZ3 A;  2IYD B;  3ZW3 A;  3AU4 A;  2NVU I;  5DPR A;  3ENE A;  3N30 A;  1UWM A;  5E6N A;  3JYU A;  1L2N A;  3DBL B;  2LI5 A;  3C0R B;  3NY5 A;  1WJ4 A;  3OAW A;  1Z5S B;  2IO2 B;  2L7R A;  2N9E B;  4XWW A;  2RR9 A;  5GXG B;  3PS6 A;  2BW2 A;  4MEM A;  2SAK A;  4A20 A;  4II2 B;  3UQB A;  3L08 A;  3EC8 A;  4DHJ D;  3GE8 C;  1RFK A;  2L76 A;  2KZR A;  1WGG A;  3O65 B;  2JZ3 B;  2V1Y A;  4LDT B;  4I6N B;  1EUV B;  3GE3 C;  3TCA A;  1E8X A;  4HDQ A;  5D3D A;  2K6Q A;  3N1Z C;  1JCK B;  1RWS A;  1Y8R C;  2JYE A;  1ET6 A;  3AE4 B;  4TKN A;  2K1F A;  4LJO B;  2X38 A;  2E6X A;  1TKG A;  4B0E A;  3DPD A;  4I6P A;  3ZLZ A;  3RYT A;  2IJ0 A;  4MDK E;  3NVY A;  4ARC A;  3CWI A;  1EU4 A;  1XXG A;  2BBC A;  3BII D;  2MLB A;  4W9E A;  1XT9 B;  2KDI A;  4GOC A;  2LGS A;  2KHW B;  3KUZ A;  4D2K A;  3NS1 A;  1MG4 A;  2RMM A;  1WIA A;  1F0Z A;  2UYZ B;  4K3C A;  1TS4 A;  2KQ4 X;  4DXG A;  3U2S C;  1LM8 B;  2KNB A;  1N63 A;  4CYE A;  4KV2 A;  1YIW A;  5AUK A;  2WXK A;  3AEB B;  1P9D U;  2JX5 A;  2MWS B;  1OEY J;  4OZB A;  3A4S C;  3ZRC A;  1WGR A;  2ZW0 A;  3KH0 A;  3L13 A;  3FIL A;  2MBH A;  3VUW A;  2KN4 A;  2FBW B;  3BYY B;  1FNV A;  3HHM A;  3LDZ E;  3L10 B;  3H7P A;  3QHT A;  2BTE A;  2LRU A;  3RD2 A;  1V9J A;  2INC C;  3Q3N C;  2Q5W D;  3TSS A;  3VXW A;  2LRW A;  3SFE B;  2MX2 A;  3C8Y A;  3VVW B;  5H8Y E;  3PTF C;  3IT6 B;  3I63 C;  3ZNI D;  2LVO A;  1TZ1 A;  1NEK B;  4JE3 B;  2ZEQ A;  2AL3 A;  2IBI B;  2PPH A;  3C19 A;  2JUO A;  4ARI A;  3JSV A;  1YMH E;  2PVO D;  4JWS C;  3NUH B;  1LQB A;  1UGM A;  1WJN A;  1TS2 A;  2GBJ A;  4YWG G;  3W5V B;  2Y5B B;  4F7Z A;  5DPT A;  2EMS A;  5JZE B;  1C4C A;  4ANU A;  4KIK A;  4WQM A;  1OEY A;  2DZJ A;  1P0R A;  1WF9 A;  2X8X X;  2L52 A;  2BPS A;  4ZRI A;  3Q14 C;  4PT5 A;  4WUR A;  2JSV X;  4WJN A;  3U30 A;  1J0G A;  1L6V A;  2BF8 B;  2OJW A;  1ZXI A;  1WR1 A;  4URK A;  4RNA A;  2WXP A;  3UQA A;  3OLM D;  2D11 A;  5D7G A;  5C23 A;  4HRO A;  2IY0 B;  2PEA A;  2J0K A;  1ZE3 D;  4B9K A;  1E9M A;  2XEW A;  2KDM A;  3A1Q B;  3H8H A;  5KHO A;  1R4N I;  3PO0 A;  3N20 C;  3UI3 A;  1FIQ A;  2IGH A;  4C7Z A;  1FCC C;  4WAA A;  2J7Q B;  1K8R B;  4FN2 A;  4N9F 4;  2KX3 A;  1ZDX A;  2QMT A;  4HKZ E;  2KN5 A;  3DBH I;  3RNB C;  1KFY B;  4ZYS A;  3DVN U;  4BKS D;  4A8X C;  1KM7 A;  4US9 A;  3HUI A;  2DYM A;  1A5R A;  4R3D A;  3V3X A;  4HJK A;  1HE8 A;  4RF0 A;  1YJJ A;  4IWQ A;  4REZ A;  2O2V A;  4NAW B;  4TV3 A;  1XCQ L;  4EE2 A;  2LUE A;  4DDI D;  4LNF A;  2WXL A;  1K52 A;  2CHX A;  4K7U A;  4NY0 A;  1ISN A;  3CST A;  1VDV A;  3IXS A;  1C1Y B;  2M0A A;  3VH4 B;  3KWV A;  4CQN A;  2J53 A;  4C80 A;  1QT9 A;  2WDQ B;  2O6V D;  4Q2J A;  4B0M A;  1LGR A;  4F8C B;  3ETR A;  1VZ7 A;  1LXD A;  1KRH A;  1WGK A;  3DBR B;  2GBR A;  2V3S A;  5FKA C;  2D2Q A;  4BBN C;  4M8N A;  3AI5 A;  2C60 A;  1P7F A;  1Q5W B;  1SIJ A;  1HTQ A;  3ABV B;  2M19 A;  3R2I A;  4PK1 A;  3IAM 1;  1YQ3 B;  5C1Z A;  3LB8 C;  2HDE A;  3T8M A;  2D3A A;  1JRP A;  1KJT A;  1T0S C;  5MPO A;  5J2R A;  1VZ8 A;  1UH6 A;  2CJN A; 
#chains in the Genus database with same CATH homology
 2BKR B;  5J18 A;  3HM6 X;  1Q0W B;  5IAA C;  4FBJ B;  4MM3 A;  2QHO A;  4GN1 A;  4FAD A;  4MGI E;  1WJU A;  2XBB C;  2KMC A;  4AWJ A;  1V5O A;  3CMM B;  3PRP B;  2FCN A;  1WYW B;  2NPT B;  3DCG A;  3DBS A;  4GXB A;  4FJY A;  4MGZ E;  4E3C A;  4XX5 A;  5D94 A;  4DHJ B;  1H8C A;  4MGY E;  2G4S A;  2LZ6 A;  4W9K A;  3ML9 A;  4FJV B;  1RRB A;  2O2V B;  3NZU A;  4JL9 A;  3RUL A;  1FXT B;  1GUA B;  3RZF A;  3UGB B;  4EEW A;  4M0W B;  4A3P A;  1AAR A;  1WM3 A;  2GMI C;  2R2Q A;  2HD5 B;  2KQ7 A;  2KTR A;  2VRR B;  1RAX A;  2LAS A;  3BY4 B;  1S3S G;  1ZW7 A;  3ZUN A;  2JF5 A;  2PE9 A;  1WRD B;  4GIV A;  4K7W A;  2JXX A;  3PVL A;  1QZE A;  1V86 A;  4HVB A;  2DHZ A;  3S2A A;  4MSQ B;  3W1S A;  4DK5 A;  2HE7 A;  4PS8 A;  2KFK A;  3KUD B;  1E8W A;  2O6V A;  1GC7 A;  3CSF A;  1WX7 A;  4FHK A;  3L54 A;  3HK0 A;  4K7S A;  1R4M I;  2CHZ A;  4WJQ A;  4EZK A;  4ICU A;  1NDD A;  2CS4 A;  2JT4 B;  3NZS A;  3KVF B;  3EEC A;  3ONS A;  3V6C B;  4AP4 C;  4AJW A;  2RSU A;  2KKC A;  3Q3J A;  2D10 A;  2CHW A;  4IWP A;  4ZYN A;  3X0W A;  2KXJ A;  3QX1 A;  2D07 B;  4HWI B;  2ZPY A;  1WXV A;  2KWC A;  4RMA A;  4W9J A;  4ANV A;  4LCD E;  2M8S A;  4JGH B;  3WAM A;  4GDK A;  3B1L X;  2RGF A;  2LWP A;  1XQQ A;  2BWE S;  4GDL A;  5TR5 A;  4WWO A;  2FID A;  4KZ0 A;  2MSE D;  1G6J A;  2NBW B;  2NCN A;  2I1K A;  4W9I A;  2UWQ A;  4HPM B;  2YLM A;  4EUT A;  3GOE A;  3A33 B;  2ZNV C;  2ASQ A;  4BKG A;  4F1S A;  1V49 A;  4EOY A;  2CR5 A;  3GZN I;  1V5T A;  2BYV E;  3ZNG C;  1IP9 A;  3D32 A;  4NQL B;  3DDC B;  2KWU B;  3UF8 A;  2FUH B;  2A4Z A;  2HTH A;  3OJ3 A;  3ZDM C;  1V6E A;  3A9K A;  3BIN A;  1WMH B;  2KJ6 A;  2DZI A;  3L17 A;  4DHZ B;  2K8H A;  2KDB A;  3NS8 A;  1KOT A;  3IBE A;  2J0M A;  4IW0 A;  3M62 B;  2BKF A;  5L83 A;  3APD A;  2FCQ A;  4JQW C;  2IO3 B;  5AEK B;  4DDG D;  2KO3 A;  3AXC A;  4WJO A;  4NJ6 A;  2LVP A;  3HIZ A;  4MJS B;  2REX A;  1XD3 B;  3PGE A;  3H7S A;  4IM2 A;  4MSM B;  5AZH A;  4IWO A;  3ZDT A;  2K39 A;  3VH3 B;  3A1Q A;  3WAP A;  4GB9 A;  3R7Q A;  2L05 A;  3JW0 X;  5EDS A;  2KAN A;  1IPG A;  2IYD B;  2XK5 A;  3PHW B;  1IYF A;  4HXD A;  3ZW3 A;  3AU4 A;  3RCZ A;  4TQ0 A;  2NVU I;  4EZL A;  2BWF A;  2OJR A;  5DPR A;  3ENE A;  1GG3 A;  3N30 A;  4BOZ B;  1OGW A;  3N3K B;  5E6N A;  3JYU A;  1J19 A;  1WJ6 A;  4OVU A;  1L2N A;  3APC A;  1RFA A;  3SHQ A;  2KQS A;  2LI5 A;  3C0R B;  3NY5 A;  1WJ4 A;  4WQO B;  5G55 A;  3OAW A;  3PSE B;  4EZJ A;  1GJZ A;  2KTR B;  2L00 B;  3PRE A;  1E90 A;  1NBF C;  1SIF A;  1U4A A;  4KDL B;  2WX1 A;  1Z5S B;  2IO2 B;  2L7R A;  2N9E B;  4TUU A;  2RR9 A;  3VTV A;  1GNU A;  2EMT A;  3PLU A;  4K81 A;  3UIO B;  3QC8 B;  3PS6 A;  1EO6 A;  3WAN A;  1UBI A;  2KFK B;  2KC2 A;  2O6V B;  3DVG Y;  4MEM A;  2DAF A;  5D2M B;  2W9N A;  4CHK A;  2N1W A;  4ASW C;  4A20 A;  2WYQ A;  3DBL I;  4II2 B;  4NAW A;  3UQB A;  3L08 A;  1UD7 A;  3V61 A;  1EF5 A;  3EC8 A;  3QAQ A;  3T9L A;  2DZM A;  4KVG B;  4M8M A;  4DHJ D;  5LXI B;  2JVC A;  3ALB A;  5LXH A;  2ZVN A;  2L76 A;  2KZR A;  4B6W A;  3RUI B;  1WGG A;  3K9O B;  3TJP A;  1P98 A;  2L0F A;  3X23 A;  4W9G A;  3O65 B;  2JZ3 B;  2V1Y A;  4LDT B;  2FNJ B;  3VFK A;  4I6N B;  2D3G A;  1EUV B;  4HPL B;  3TCA A;  1E8X A;  5KHQ A;  4RM9 A;  4HDQ A;  1T0Y A;  3P2B A;  2JWZ A;  2NBV B;  3ZNZ B;  2K6Q A;  4HK2 A;  4ICV A;  1WR6 E;  4KDI C;  1Y8R C;  4FJZ A;  3PZD A;  4NPN A;  1WXS A;  2DZK A;  3NHE B;  4J6I A;  3R66 C;  2AWT A;  3KYD D;  5FR6 A;  3R3M A;  2A5U A;  5GMV A;  4KZC A;  3A9K B;  4AOF A;  1WXA A;  4IUM B;  3R7R A;  4MGK E;  3ZVV A;  1J8C A;  2G45 B;  4TKN A;  2LJ5 A;  2K1F A;  2KLC A;  1WM2 A;  2C7H A;  4LJO B;  3Q3F A;  3M3J A;  1WI0 A;  2KMA A;  2AYO B;  3DPD A;  4I6P A;  2KJH B;  3QIJ A;  2LXC A;  3RYT A;  3ZLZ A;  3TL5 A;  3ZIM A;  4MDK E;  2J0J A;  3A9J A;  1WGD A;  3CF6 E;  2XK5 B;  3N32 A;  5E6O A;  2OOB B;  2WDT B;  3VDZ A;  2MLB A;  4W9E A;  1XT9 B;  3PHX B;  2KDI A;  4GOC A;  3TBL D;  1WXM A;  2KHW B;  2KDF B;  3H1U A;  2GBK A;  2NR2 A;  3IG3 A;  2K6D B;  3KUZ A;  3PRZ A;  4FHJ A;  4HDO A;  4G0N B;  4PS3 A;  2LGD A;  1V81 A;  2FCS A;  3SD5 A;  3VQI A;  3UIP B;  1C3T A;  1TBE A;  3W1Y A;  1GC6 A;  1M94 A;  1WZ3 A;  1YQB A;  1WIA A;  2LXA A;  2KK8 A;  2DX5 B;  3IFW B;  2JPH A;  2UYZ B;  3B08 A;  3PLV A;  4IM0 A;  2HJ8 A;  3A4R A;  1I35 A;  1LM8 B;  2MCN B;  1MG8 A;  2N7E A;  2K8B A;  2KNB A;  5CX3 A;  4BOS C;  3V62 A;  4CYE A;  3ZTC A;  2ZPN A;  1E8Z A;  4NJ7 A;  4KV2 A;  1YIW A;  4XZ4 A;  2N9P C;  3KUC B;  3VTU A;  1YX5 B;  2WX0 A;  1P9D U;  4WWP A;  2FIF A;  1JRU A;  2KVR A;  2MWS B;  1OEY J;  3H6N A;  3A4S C;  3ZRC A;  1H4R A;  3KW5 B;  5DPS A;  1WGR A;  1WZ0 A;  2N7D A;  3KH0 A;  3L13 A;  4B95 A;  4DXA B;  4BVU C;  3ML8 A;  2MBH A;  4LJP B;  4EFO A;  3VUW A;  3MHS D;  5J17 A;  2K25 A;  2GOW A;  3IVF A;  3HHM A;  3LDZ E;  3L10 B;  3H7P A;  3QHT A;  4P7I A;  2LRU A;  3JVZ X;  3RD2 A;  1V9J A;  2KD0 A;  2LD9 A;  4BBN F;  4FA6 A;  4WWN A;  3VHT C;  3ZRF A;  4AUQ C;  2ZZP B;  4GSW A;  3VXW A;  3PV1 A;  2AEH A;  2LRW A;  3M95 A;  3DQV A;  1EF1 A;  2MX2 A;  3IHP C;  3VVW B;  2ZNV B;  2M0X A;  3PTF C;  3V6E B;  3LJ3 A;  2ZVO A;  3HM3 A;  1OTR B;  1UZX B;  3L16 A;  3ZNI D;  2IO0 B;  2LVO A;  1TZ1 A;  4X57 B;  3ZO5 B;  4XC2 A;  2IY1 B;  3RZW C;  4E74 A;  2B3A A;  2JY6 A;  2JZZ A;  2G3Q B;  5LLI A;  2MW5 A;  2ZEQ A;  1LFD A;  3PPA A;  2MBO A;  2AL3 A;  2IBI B;  2PPH A;  3H9D A;  4LDT D;  3WIM A;  2JUO A;  4W9L A;  3JSV A;  2FAZ A;  4II3 B;  1P3Q U;  3PRM B;  1RLF A;  3SDL C;  4GU2 A;  1LQB A;  2YVC A;  1UGM A;  1WJN A;  2IO1 B;  4G3X B;  2DAJ A;  4GDK B;  4ZRK A;  1X1M A;  4PYZ A;  2GBJ A;  2Y5B B;  4F7Z A;  4GDL B;  3DBR I;  5DPT A;  1UBQ A;  1E5W A;  2EMS A;  2N9X A;  3VUY A;  3VUX A;  3MJW A;  4G50 A;  4W9F A;  4NQK E;  3QA8 A;  4W9H A;  3K9P B;  3QJZ A;  2BYE A;  5JZE B;  4ANU A;  4KIK A;  5IA7 A;  1OEY A;  2DZJ A;  3QQ8 B;  1P0R A;  1WF9 A;  2CU1 A;  1V2Y A;  4BKT A;  5DPW A;  1SGH A;  2MQJ A;  3TIX A;  2BPS A;  4ZRI A;  2DYB A;  4IC7 B;  1YD8 U;  5AZG A;  1S1Q B;  2MA9 B;  4PYU A;  4WJN A;  3U30 A;  1J0G A;  2ZCC A;  2BF8 B;  4ANX A;  5CHF A;  1WR1 A;  4URK A;  2L8J A;  3PT2 B;  4KSK C;  1D3Z A;  2JRI B;  3NOB A;  2KDE B;  2N1V A;  4W9C A;  3UQA A;  1ZGU B;  2MBE A;  3OLM D;  5L95 C;  2KFJ A;  2D11 A;  3B0A A;  5D7G A;  1Q1O A;  3AUL A;  2MBB B;  1WE7 A;  2KX0 A;  2IY0 B;  2PEA A;  2J0K A;  4K1R B;  2LVQ A;  3L0W B;  5C23 A;  4ANW A;  3VAW A;  4DHZ E;  1WX8 A;  2NBU A;  3U7D A;  5JH5 C;  1KLV A;  4HCN B;  3ZKJ C;  4B9K A;  2N4F A;  2XEW A;  2C9W B;  3A1Q B;  4OVV A;  4MEL A;  3EFU A;  4NNJ B;  5KHO A;  1R4N I;  2DYO A;  2I1J A;  3H7P B;  1I42 A;  4KSL C;  1WFY A;  1NI2 A;  2C7M B;  2JRH A;  4A3O A;  5JHB A;  1E7V A;  2KTF A;  4WAA A;  2J7Q B;  1K8R B;  4FN2 A;  4N9F 4;  5AZF A;  2KX3 A;  2KC1 A;  1WY8 A;  3ZNH B;  2MP2 A;  3KYC D;  4EKU A;  1VD2 A;  2KN5 A;  3DBH I;  3RT3 B;  2BGF A;  4G11 A;  3QCA A;  1BT0 A;  3DVN U;  4E71 A;  4BKS D;  4HLE A;  1KM7 A;  1E8Y A;  2DYM A;  2GBN A;  3MTN B;  2Z0D B;  2NPT A;  2KLG A;  4GGQ A;  2Z0E B;  4PS7 A;  1A5R A;  1CMX B;  2M4N A;  4HJK A;  1HE8 A;  4I6L B;  4IWQ A;  2O2V A;  4AJY B;  3JSV B;  1UEL A;  1E7U A;  4NAW B;  4JIO U;  4TV3 A;  3W1S C;  2M1M A;  1WE6 A;  3V60 A;  5JHA A;  1SE9 A;  2LUE A;  2CKH B;  5E6P A;  3QAR A;  5BO4 B;  3DVN V;  4DDI D;  2CHX A;  2R2O A;  1WH3 A;  2KOX A;  4FLH A;  2DEN B;  4K7U A;  3I3T B;  4NY0 A;  3U8Z A;  1ISN A;  3CST A;  3UIN B;  3QK0 A;  1WGH A;  2L0T A;  5G2N A;  1C1Y B;  2PJH A;  3AU5 A;  3VH4 B;  2C5L C;  4KIK B;  2FCM A;  1OQY A;  2KJR A;  3ECI A;  1L7Y A;  4HCP B;  2O6V D;  4DBG A;  2G4D B;  1YX6 B;  2ZJD A;  4TQ1 A;  2RPQ A;  4F8C B;  4MH0 E;  1LXD A;  1V80 A;  4IM3 A;  2M17 A;  3EHV A;  2ZCB A;  4W9D A;  2WWZ A;  2EKE C;  5D6J B;  3VTW A;  3M63 B;  3DVG X;  2GBR A;  2MBQ A;  2V3S A;  1TGZ B;  5DCN A;  1ZKH A;  1VCB A;  2MRP A;  2D2Q A;  4BBN C;  4M8N A;  3SU8 X;  3AI5 A;  4RM8 A;  4BKS A;  2C60 A;  2LGY A;  3DOW A;  3OJ4 B;  5CHW A;  1Q5W B;  4FUL A;  2Z59 B;  2BYF A;  4GMV A;  2NS5 A;  3WA0 A;  4ZRJ A;  4IG7 B;  3TMP B;  3A9J B;  2GBM A;  4JLC A;  1WGY A;  2IZV B;  3WAO A;  3ZTD A;  1WMH A;  4DWF A;  4ZDV A;  2C7N B;  4BFR A;  2K8C A;  4CO7 A;  1F9J A;  3QWZ B;  4WJP A;  5C1Z A;  5HKH A;  2L3Z A;  1TTN A;  1WX9 A;  2RD0 A;  1YJ1 A;  2AL6 A;  4YL8 A;  3APF A;  3T8M A;  1Z2M A;  2LGX A;  1KJT A;  5CHV C;  5J2R A;  3WAL A;  1P1A A;  5CTR C;  2PE6 B;  4MJS A;  2KWV B;  2V4L A;  1UH6 A;  1PQS A;  2MP2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...