1I4XA

Staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 72
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4xA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4xA02
1PTOF 1JR0D 1KTKA 1PRTF 1I4RA 1LTID 4DXFA 2XRQD 1DJRD 1TY0A 5ELCA 1CHQD 2NTTA 1F77A 2CHBD 2AQ3B 1AN8A 1QILA 5FK9C 3BYTB 1V1OA 1MD2D 1PTOC 1PRTC 1JWMD 1BCPB 3DWAA 4K6LA 3BVZA 1PZKD 3W2DA 1S5BD 3R2IA 3R2TA 1S5DD 1EU3A 1JWSD 1I4HA 1SBBB 1LO5D 1TS3A 1D5XC 1ENFA 1T5XD 2G9HD 1SJHD 4RCOA 2WV6D 4RGOS 1RDPD 2XN9C 4RGTA 1TS4A 1G8ZD 1LTSD 1BCPD 1EWCA 3GP7A 1FGBD 1DYQA 2AQ1B 1PTOB 1SEBD 1PRTB 5D3IB 1BXTA 4C56C 1JCKB 1EEFD 5I4DA 2QILA 3BZDB 5D3DA 2J4XA 1SJED 5ELBA 1M4VA 1XXGA 2IJ0A 3V05A 1ET9A 1CQVA 1SE3A 3CHBD 1HTLD 1UNSA 1RD9D 1S5ED 4TSSA 2IPKD 1PZJD 4O1NA 4UDUC 1D5MC 1HQRD 5ELFA 1S5FD 1YN4A 4RGNA 1FNWA 3BYYB 2AQ2B 1SE2A 2TSSA 4RGMA 2RDHA 3MC0B 1SXTA 1S5CD 4RH6A 3OWEB 1SE4A 4DXGA 4RHSA 4NZLB 1LTTD 1TS5A 2XNAC 1FNVA 1L0YB 1LT3D 2QEJC 1STEA 1FNUA 3O13A 3R8BA 3EFXD 4OHJA 1RF2D 2Z8LA 1RCVD 1ESFA 3BVMA 1PZID 1FD7D 1L0XB 1YN3A 1PTOD 2O2LD 1PRTD 1EEID 1D5ZC 1LTAD 1JQYD 3BVGA 1I4XA 1LTBD 1CT1D 1EFID 1GOZA 1LT4D 3TSSA 2ICIA 3DWPA 1LT6D 1V1PB 5ELEA 1YN5A 1HA5A 3EA6A 2SEBD 4BWGB 1ET6A 4L6TB 1LTGD 4ZYSA 5ELDA 4RHRA 1B44D 5FKAC 1JWUD 1BCPF 1UUPA 4L63B 3DWQA 1I4GA 3SEBA 1KLUD 2NTSA 1TS2A 1HXYD 1PYWD 1XTCD 1LTRD 3KLSX 2R61A 1V1PA 2RDGA 1AW7A 1D6EC 1EU4A 1PTOH 1TY2A 4RFBA 1CK1A 1CHPD 5TSSA 3MFGA 4Z9CB 1B1ZA 2XRSD 3URYA 1LLRD 1LT5D 1I4PA 1I4QA 1BCPC 1KLGD
chains in the Genus database with same CATH superfamily
1LACA 1VDZA 1X32A 3F8TA 3J7AV 3MP9A 4CKEA 1IBLQ 1YX6B 2HE7A 4V0BA 3MVVA 3Q23A 2NVTH 3T53B 2EYPA 2L8JA 3RMKC 4WJ4A 3VR5A 4ZHPA 1FR3A 2C5LC 3ERSX 1PDXA 4WWOA 1A5RA 3NOBA 2KZRA 1EY8A 2ZM6Q 1STHA 3P63A 1YX5B 2FCSA 4LDTD 4XWTA 3RT3B 5FJ8G 2LJ5A 2AL6A 4BA1I 3AEEB 4DR3L 3AU4A 2I1JA 4LFAQ 2PQEA 3CXCA 1G6PA 3EC8A 1STYA 1HRJA 1DOIA 4NJCA 1KQSA 2KFKB 4IUUA 1JWSD 3KDFB 3KBGA 1Q1BA 2DAJA 2WAQE 2G9HD 3TBLD 3HOUB 4RCOA 2WV6D 3KUZA 4XGAB 4ME5A 4RNAA 4RGTA 3CCEA 2IO2B 1BVSA 1TVXA 5JPNC 3U58A 3FILB 3KH0A 4NQKE 3SU8X 5G2NA 2MBOA 5LMNW 1BCPD 1RLFA 2CR5A 2WXQA 1J9OA 1C4CA 4AIMA 1D1KA 3KUCB 2DLBA 1EUJA 4H7BA 1MGSA 4C56C 1EQVA 3IG3A 2K33A 2PI2A 4OX9Q 1AP0A 4JI7L 1IBML 2EMSA 3ZTCA 4KKIA 3IFDA 2I1KA 1H9JA 2D3CA 2EJFC 4P1BC 1M4VA 2EYFA 3E56A 5IGDA 4NJ7A 5LXIB 3MZ5A 5AZFA 4CJ0B 1M1KC 5I9PA 1ZW7A 2K39A 2KDBA 3NQTA 2QDBA 3A9JA 2KC1A 2XWJB 2D9UA 4BY7B 5IO9A 3FHWA 4HEA1 1D5MC 2WHIA 1F1HA 1M8AA 3UDXA 3NTKA 3RN5A 2QJLA 1I94L 2WXGA 3PLVA 1N32Q 4WQMA 1F9JA 4ZRIA 3FC4A 2MBEA 4WWPA 4G57A 1G6ZA 1WYDA 2X8XX 1TGZB 5EPKA 1X65A 4LK1C 4N9TA 1X1MA 3DBRB 3NZ3A 2O5IC 3OG5A 1JE4A 1T0QC 1RF2D 4S3SA 1O80A 3J81c 2CW0D 4QY7A 3NVWA 4C00A 3AYHB 2GBMA 2IO0B 2ASQA 3Q8DA 4P1CC 3FEWX 1PRTD 2PNRC 5HHDG 4ARCA 2JP1A 3ONAB 2B2VC 1FJGQ 5ELEA 2LMCB 1E2WA 1NYQA 1KF6B 2BQQA 4BBRG 1ET6A 2N49A 4XYQA 5C3EG 2ZEQA 4YIJA 5M5XB 4PMBA 1LFDA 2UYZB 2MJ3A 3A5ZB 3NELA 4FADA 4XC2A 1WMHA 4DNIA 4C3IG 5ISRA 3AFPA 1AW7A 3H9DA 1PTOH 4ZKBB 2Z0EB 2HDEA 1Q90A 1VQJA 3OW7A 1A8VA 4A3PA 3H94A 2UUAQ 2V1CC 4IFDI 2LUMA 3X0WA 4H2AA 3ZVVA 3NZSA 1IYFA 4XQJA 4JI2Q 1YJWA 1XMOL 3E0JA 5IYBG 1I4QA 2LKVA 3HKSA 3J7YW 3S14B 4K5WA 4CHTB 1ENAA 2X69A 3S1MB 4K3CA 4LDTB 4MGKE 4BOSC 3STBD 4AS1A 3C8YA 3K0XA 1C78A 2KX3A 4IJLA 1STAA 2FIFA 4DV1Q 3BY4B 1NDDA 3SXHA 4YHHL 1ZKOA 4PYZA 3KYHC 4DUYL 5M3FB 3DM1A 3FVQA 5FK9C 2BH2A 5GAGC 5IYDG 1MBYA 3J81E 3HOWG 1QT9A 3PRPB 5GAEC 2MBHA 2KECA 2JA6H 1BCPB 4FF4A 2F3VA 4HROA 2FXQA 4FNFA 1MSGA 4JV5L 2N9PC 1SBBB 3K5NA 2V4DA 1O7IA 3RN2A 3VR2A 3GE3C 1V5OA 4IALA 3VAWA 5AEKB 1VQ8A 3S1NH 1D4BA 2V4LA 2A6ED 2VZAA 4QL5A 3PV1A 2B8FA 3IBEA 1X9NA 1H9SB 3W1SC 4GOPA 5GXGB 4DQOC 1QG7A 3KQ4A 1FCLA 2FNJB 2ZZPB 5C3EB 3ML8A 3D6CA 5L37A 3NTIA 4JWUC 4K0KL 1L0VB 3R7RA 4OWTB 3G71A 3S14H 1ZKHA 3M4QA 1WGKA 3K7UC 3S1MH 2EELA 2E8GA 4X65L 2A73B 2JRIB 2RR9A 4GDKB 4RMAA 1UE7A 2EYOA 1UEBA 2F0OA 3L7ZC 3MXNA 4DN4M 4DR3Q 1ICWA 2EY2A 3OYYA 4UAIA 2HQEA 3A8KE 4E6IA 3S1RH 1V43A 4JK1C 1EO6A 2BDOA 1PH6A 1HEZE 1VS0A 1HZ9A 2DZJA 1PGAA 2KANA 3KLWA 4TQUS 5FLMH 4XZ4A 2Z4IA 3AEAB 5IY0A 1M90C 4MTKA 4MHEA 3K59A 4XYCA 4HSPA 4RGNA 4C1NI 3C1EA 2MSED 1YNTE 3QOJA 4FDBA 5C5LA 5C4ZA 5C4XH 1W6JA 1OXSC 5C3JB 3ZJUA 4JL9A 1SMYD 3HGBA 4JI7Q 3T56B 1IBMQ 4AOFA 4YWMA 2E2JH 3KDFA 1YOVB 4I6PA 5JH5C 1KNEA 2IGHA 2RDFA 2NVYH 1BDOA 3R93A 4JIOU 4XXEA 2JU6X 3RN9C 3KYCD 4DV6L 4A3CH 1GUAB 1L0XB 3M3YH 2ZJDA 1SGHA 5KHOA 1H8CA 3P42A 3RNBC 4AQYQ 1S3SG 3H0GH 1Q8IA 3AEVA 1VMCA 1ASYA 1I94Q 1V5TA 4HPLB 1HZBA 2KD0A 2NN6G 1ONLA 1X3FA 2LWPA 1VQBA 1EWHA 3GTMB 1ICFB 5M3MH 5CV7A 4WJ3M 1J8CA 5HY6A 2NVQB 1BCPF 4ZUIA 2PPBC 5IGCA 2JT4B 1NBWA 3DWQA 4A3BH 1PYWD 4RM8A 4WH4A 1HPCA 3OIPA 4B9XA 3A0JA 4OVZA 4KJNA 4DR5Q 2ICEC 4KZ0A 4DV0Q 4FVMA 1XO3A 2OWOA 3P1HA 3Q3MC 1B1ZA 3BDCA 1L7YA 3GZNI 4FXCA 1WTWA 1WR6E 2H1EA 4MSQB 4ANWA 3PUZA 4IN3A 4XYOA 3SDZA 5M5YH 3V96A 4WQOB 5GMVA 3K5LA 3DPDA 1I7HA 2F0JA 2K6DB 1YHBA 1R4QB 2XRQD 4HIDA 2B3AA 3FMCA 2MBQA 3L10B 4GS3A 3ZTDA 4HDQA 2NTTA 3PCOB 4LLGM 3PIPA 4IPGA 1WWTA 1V49A 1IW7C 2ATWA 3CMEA 5AZGA 1ZXHA 3GTMH 1WXVA 4K6LA 5CC4A 3VUWA 4AP4C 1KM7A 4A3IG 4B3ML 1XMOQ 3B0AA 1QNUA 1SYFA 5KNDA 2N3SA 1UH6A 1U4RA 2IL8A 4A3MH 3VDZA 1VQAA 3L08A 4KDLB 1A15A 3AE1B 5AJ3L 1JRUA 3TZUA 4MT5A 2E2DC 4LUZA 2R93H 1FGBD 2BA0A 3Q8AA 3H7PB 3HG9A 4ODGA 4YHHQ 1PH1A 1GXDC 5CV5A 4DUYQ 4ALPA 1WGGA 4KD3A 3TS0A 2MUYA 3RMHA 4LF5L 3TRZA 1B7YB 2AMCB 4K7SA 4HCEA 5EE9A 4OXPA 5DPTA 4XDCA 2I46A 4HXDA 5CHWA 2KCCA 1K8OA 2K05A 2KWCA 4JV5Q 3B1LX 4WJPA 1E8XA 4C2MB 2V4IB 2K7VA 1TXYA 1EFWA 1UNSA 2B29A 3GV3A 1P16A 2DJGC 1YNJD 2ZPYA 1HNZL 4LFCQ 4GKJQ 3H91A 3IAS1 5FLXc 1PGBA 1XT9B 1E0ZA 4WURA 2BB6A 4FP5D 4X62L 2XSCA 2RDHA 4A3KB 1I50H 4GKKL 2L12A 2J52A 4YCWA 5ELNA 3JSVA 5C0XG 5JPMC 4IFDH 2ZPNA 3QK0A 4RH6A 2KT7A 3SFEB 3UQAA 4DU9A 2VUMG 4AH6A 4K0KQ 2LXJA 1UELA 2HUGA 3GTJB 4L5TA 3K7AB 3DVGY 4BA2I 1AE3A 3KJOA 3QQ8B 2K5WA 4X65Q 1WTRA 1BR9A 1FL0A 4DF7A 3P4RB 4NY0A 3VHTC 1A63A 2JX5A 4G7ZC 1E0BA 3WALA 1WX8A 4B0MA 2L4NA 1O7LA 1WYGA 4BFRA 4HJ5A 1BOSA 2RQXA 4L5SA 2OHFA 3PHXB 4QUCA 1LTAD 5G3LD 3CSTA 3ZRCA 3ND9A 3I4NH 2DYMA 4DV7L 3TBIB 4TMAB 3R3OA 1UAPA 1BBWA 2LY7A 1PH4A 3K9OB 3S2DH 2BS2B 3HOYH 4C2MH 1WM3A 4DV3L 5EE0A 3U52E 5NUCA 3H6NA 4GLXA 1OQQA 1WM2A 2C35B 3A1QB 5JEAH 4GU2A 4HJ8A 1YMHE 5LMUL 2MX2A 5HGQA 3GTQB 3PGEA 3SEBA 3EFCA 4II3B 2MCNB 4B95A 1TS2A 4A3KH 1FIQA 1PH2A 1D6EC 4A93H 2GBRA 4L2YA 1SNQA 1FXTB 3NPPA 1X3EA 3NUCA 4IUTA 1YNND 2PLPA 1Q8KA 2VQEL 3L4PA 3EBEA 4BY1G 1FMAD 5EKKA 2WINB 3OJ4B 1P1AA 3TEHB 2YLMA 1CUKA 3QWNA 1R4MI 1F2RI 3CPWA 4GOCA 3WA0A 1JICA 2VUMB 1IYUA 3I9V1 4A3DB 1V86A 3TL5A 4JPBW 3VH4B 2MNAA 2JQOA 1STNA 1U5KA 3X3MA 3PREA 4OVUA 4IWPA 3EUB2 3FAHA 4FJYA 1WR1A 5DM73 2MP2A 4OZBA 2UUCL 1ZPSA 3PSEB 1VQCA 2R7ZG 4CQNA 1VLBA 2RBMA 3PMFA 1ILPA 2BCOA 2A6HC 4WJWA 1PA6A 2LXKA 3F2CA 3Q24A 3HOZH 3VRBB 3APCA 1K51A 4LTUA 4HRSA 1JOQA 5E6NA 3UDIA 3ITPA 2PMVA 2P5ZX 1EWCA 1PDQA 1E2ZA 3UE0A 2AQ1B 2F4VL 1KJTA 2LD9A 4W9CA 3RCZA 4KSLC 4LUOA 1GNUA 1STGA 5F2DA 2KMMA 3PO2G 1B2TA 1VQEA 1WCMG 3IL8A 3N3KB 3BG3A 4A3FB 1MPEA 4XDDA 1C77A 4U68A 3T51B 5IP9G 1AE2A 2KLGA 1RHPA 4EQ5A 5K5PA 1CZGA 3TZDA 2BT6A 2FUG1 4GXBA 3VTUA 1VQPA 1E2VA 1ZDXA 4G4KA 3IRBA 2HJ8A 1QOGA 3QOLA 1SFOB 3E5SA 1EYAA 5CV4A 1EOVA 5AJ3Q 3K58A 2CU3A 3I63C 3ZNID 1HQRD 3RLNA 2PE6B 1V1QA 2KUMA 4XTCS 4FF1A 4IZ8A 3I4MG 3TREA 2CH4W 2TSSA 4J8QA 4LF8L 1T0YA 1Q5WB 4BBSG 4YWLA 4RMFA 1SXTA 2GI9A 2Q5WD 1PLFA 3L2PA 2N88A 2RA4A 4P6VF 5EGTA 3PGZA 1YJ9A 3U4EG 4H13C 4LF5Q 2WS3B 2NVXB 1LM8B 3W1SA 1LTTD 2M2LA 4ZHOA 1FNVA 2R3ZA 3IFTA 1KHIA 3I70A 3RR5A 3MTNB 2NPTB 1HZ6A 4KHPL 3L0WB 2JA5H 3M85A 4O0AA 1G2SA 3HK0A 4M1UB 1QJOA 4DR6L 4RM9A 2B2WC 2HDMA 4C3HG 4DK1A 4MACA 2PW5A 1XLQA 2UXDL 3PF4A 3CRKC 1HNZQ 4A3FH 2QA4A 2HT1A 2KEEA 1XLNA 2R7DA 1PXUA 4TKNA 4BKSA 4NXML 1Y56A 1WTHA 4X62Q 1XPOA 3W3AA 4GKKQ 4CDCC 1QLBB 5JHAA 2AHOB 4O42A 1EWIA 2OEOA 2RMMA 2WXNA 4HKQA 4K7WA 3F2DA 2KWUB 5IYCH 1SFOH 2K9XA 2BPSA 3PO2B 1ILQA 4P7IA 4L63B 2EXDA 2ALYB 1J19A 1UZXB 2NS5A 2ZJRA 3NVVA 2DZMA 3PO3B 1II3A 4MGIE 4N6EB 1CK1A 4OL7A 4Z9CB 3ZNHB 2WLBA 4ANUA 3M4OH 2RKSA 4KGRA 2F52A 2LFNA 3HEJA 4I6LB 5IKCM 2IZVB 5LNK1 4DV7Q 3VTVA 3FDTA 4QJFA 5CBAE 5C44H 1V8CA 3UIOB 1UE6A 1SYBA 1GUSA 3P75A 4ANVA 1XCQL 4KV6A 1FXIA 1T3QA 4EKUA 1BKBA 4BBSB 3K5OA 4PMWA 1C4PA 1EY6A 2BOSA 1RTNA 4M8MA 4HCNB 2N9XA 4OZCA 3KOJA 3ZXVA 4DR7Q 5IT9L 4GN4B 1F77A 2WP8J 1QILA 3EIVA 2HHHQ 2KJHB 3NQIA 3UE1A 3U9SA 4A6QA 3NBHB 5C5MA 1KH0A 1UF0A 3PHWB 4LJOB 2XWBB 2L1BA 3W5VB 4EE2A 1SE9A 1WTVA 3DWMA 1UE1A 3BVZA 1QB5D 1WOCA 1OTRB 2JEAI 2KQSA 3H7SA 1GUNA 4FXDA 2VQEQ 4OO1G 3I5JC 3PS6A 2EY5A 3CD6A 2EOTA 1KDBA 2KOXA 4A55A 4NW2A 4DUZL 4HK2A 5DM63 2FCQA 4HEDA 3L9AX 3KK7A 5G3LF 3TEWA 1R4MB 1WXQA 1QF6A 2LGIA 2WKDA 2KYWA 2DZKA 3EECA 4IUPA 4NAWB 1BXTA 1GC6A 1OFFA 1VZ8A 3MJ5A 1D2BA 5D3DA 2KJXA 2WX1A 2E2HH 4LNKA 3BS1A 4ILWA 2UUCQ 4E3CA 3PO0A 5L83A 4LNQA 1QOAA 1F0ZA 3S2HH 2CU1A 1GUGA 4Q5VA 2NVUI 1WI5A 5EE3A 1C9FA 2KHSA 3FRPB 4KY7A 2NZOA 2WXLA 2F0LA 4HWIB 4EZLA 2LSSA 2F3WA 3GTOB 3HOXH 5IIFA 3L54A 1NYRA 4TV3A 1D1IA 1LABA 1H4RA 4JI5Q 3V2TA 2MFIA 1LUZA 3J80c 1WVLA 5K36G 4XQQA 3GTKB 1WJ6A 3IT6B 4KZCA 1K3BC 3DBRI 1DXMA 2LASA 4HTHA 4B3SL 1SSOA 1P7FA 3LDZE 1T6BX 1OO9B 4OEMB 1FD7D 1X54A 3NHHA 1Y1VH 3HFZB 4KHZA 4FO2A 1YVCA 1K83B 1WE6A 4CKCA 2OEDA 4MELA 1JQYD 2DJFC 4NQLB 3TJPA 3VXWA 1K28A 2NWGA 2Y5CA 3VR9B 3R66C 2BGFA 1AYFA 1WMHB 4NB3A 2RSNA 1CKNA 1LT6D 4LF8Q 5BN5A 4G3XB 1EYDA 4L23A 4HJAA 2JYTA 1FCCC 1BUIC 5MPOA 1XMQQ 3WAMA 4PS7A 1YBYA 4R4IA 3Q8EA 3GTOH 5BYRA 4KIKB 2K6AA 4KHPQ 1H9MA 2ZXOA 1PFDA 1WYWB 2VH2A 2O2VA 1TKEA 1JROA 4A9AA 4DR6Q 2DZIA 1IHZA 1TY2A 4J6IA 3AE2B 3OWFA 4MNOA 2CFMA 2ASBA 2DNFA 1QWYA 1KD1C 1VQIA 5D14A 4A3GG 1XNRL 4DHJB 4C3JB 2D2CC 2WYQA 4LF9L 1JR0D 3QWZB 4RCNA 3X23A 2KHIA 2VQFL 4HDOA 2VB2X 5FO9B 3K0YA 1DJRD 2K04A 3S16B 4DDID 1RM6C 1N6ZA 2WU5B 3VYTA 2VRRB 1QOBA 5G5GA 5GAHC 4C80A 2K5DA 3H3VI 2R92H 1SN8A 2CHBD 4V190 1WIAA 1AN8A 4CO7A 3BYTB 1V1OA 2B63H 4EOYA 2HD3A 4I7ZC 2KQ7A 1PTOC 2ZT9C 1TWGB 4R1JA 2CWAA 5T1IA 2DX5B 3RZOH 2QC8A 1IBKL 2RPQA 1IYJB 3R2IA 1MJCA 3N32A 2Z6KC 3SR1A 2JA8B 4GB9A 1LO5D 5BMHA 1CZWA 1NNXA 2CKHB 4RG1A 2LI5A 3P1MA 4R4OA 4M01A 1QNKA 1VQ4A 1IUEA 1ASZA 3MXNB 1N62A 2I38A 3GTLB 1DD2A 5A35A 3EROA 3W5UB 1ZYRD 3P4PB 1WGYA 1V8QA 1V2YA 4J3OD 3ZJTA 1KDCA 1BQQT 3A74A 5IWAQ 4E71A 1HFNA 1Z47A 2KJRA 2L0CA 4B0EA 4A3LG 3VR6A 3VYRA 1IYVA 3I56A 3JAML 4QGUA 4M0WA 3OTOL 2KDIA 3EGRA 2SNMA 3NVYA 3ZGZA 4GNXC 2H5XA 3E0EA 1HNXQ 1KC8C 4BKGA 3KW5B 2BTEA 1K0SA 1VQLA 1S5ED 1IGDA 2BW2A 1TZ1A 1I3QB 4DUZQ 2D3GA 4KD4A 4DK6C 2UUBL 2L7RA 4ZCKA 1YN4A 2WXRA 2QCPX 4A76A 3NBHA 1EF5A 3T9LA 3JAMi 2PCFB 3PQIA 1ZDVA 2C9OA 2JN4A 3OPOA 3H15A 2L83A 3RD2A 4DA2A 1A6XA 2K75A 2J7QB 2M19A 4X66L 3BK1A 2E74C 3HM3A 3M7NA 5C2TB 2Q8RE 3RNGC 1JORA 1TS5A 2JVCA 2XNAC 5GQOA 2R2OA 1DONA 1F2MA 3AH7A 3UIPB 2ZNVB 2JA9A 2MHVA 1L6VA 2RD0A 4PQXA 2EKIA 3VYSA 3P4SB 2KBNA 1SROA 4YCVA 3U4VA 1C79A 2B2UA 1PUTA 2D5GA 2KWDA 1L2FA 3S1QB 3DBLB 1C9OA 2MLBA 2X6LA 4HMJA 3BZCA 2K14A 1GHKA 4NAWA 5DPWA 5JXVA 1WXSA 4F88A 3KYDD 2A5UA 4JC0A 3BDLA 1B4OA 3G7LA 4ZK9B 1PH5A 4GSWA 2JA6G 3TMPB 2OTLA 1SYDA 1YEZA 4BWGB 2K0PA 1QZHA 1J7CA 4B3TQ 3WOFA 2QHOA 3MC8A 3ZDMC 1ZEQX 4OELB 4YTPB 3HOUH 1U0LA 4K14A 4HJKA 4B3SQ 5I6YA 1C8CA 1BMLC 2L9HA 1KLUD 2CS4A 1EQTA 1P9DU 5C0XJ 4G7OC 4A75A 2Q2TA 1SNDA 1SF0A 4UPAA 3AB9A 2BS4B 5E4WC 4R8NA 3C0RB 5CMDA 1Q12A 1EYGA 2K28A 5FR3A 1HR0W 4FJVB 1SNCA 4BBNF 3W9CB 2YU9B 1YJJA 2C7MB 2K22A 1ZE3D 2KMAA 1OQYA 4GN1A 1LTID 1GG3A 2K8BA 2F0FA 2F0KA 3S1QH 2KDMA 1V80A 1CHQD 3M3JA 4BY7H 1Q81C 3L0OA 2NMQA 1HCZA 3TIXA 1GKHA 2FIDA 3FKIG 3I8ZA 5A2QL 1PRTC 2RF4A 3I73A 1XWEA 4QF4A 2LHDA 5C4XG 1VF5C 3TQYA 3P4QB 2A19A 2KCNA 4BAXA 2YYZA 3UQBA 2JE6I 4K5XA 1XNRQ 3D32A 5JJLA 1ENFA 2R2QA 3APFA 1SJHD 4LF9Q 1JC7A 1D8LA 1F2YA 3LJ3A 4KIKA 1JOKA 3RZDB 1PYSB 2VQFQ 2MA9B 4POGA 1G8ZD 3PLUA 2KX0A 1KNAA 5AFWA 1GD7A 3HS0C 2FFKB 2EKEC 4JI0L 3RNFC 5CR3A 4F1SA 4A3CG 4REZA 3CC7A 1NE3A 1QVGA 1TWAB 3KJPA 1YJ1A 1EEFD 3EJIA 2CQAA 4I65A 4KY5A 3QHTA 4YY3Q 3GOEA 1SNOA 3JSVB 2ZTDA 1IBKQ 2WQYB 3KUPA 2RSOA 1SE3A 3Q6BA 5M3MG 2K52A 2E5LL 3SK4A 5M5XH 4JGHB 1E90A 5EDSA 3STBC 3Q3FA 4E74A 5ELOA 4R4CA 3RLOA 2D11A 4A3BG 1TWCB 3N20C 1WJJA 4JI8L 1N36L 1MJDA 5CORA 5E6PA 2HTME 3A56A 2L76A 4BBRB 1V97A 1UEAB 4IURA 1K8AC 2NBUA 4EZKA 4N58A 4ZUJA 5BR8L 3NBIA 1B9NA 4ME3A 5BYQA 3DDCB 1RJTA 3FKIB 3R8BA 3RPFC 4C3IB 1VQMA 2LRUA 4P75A 3J7A5 3KF6A 2NBVB 4MTNA 1VQOA 3ENEA 3MHBA 1TWAH 1K53A 1HH2P 3VR3A 2LZ6A 3AFQA 3H3VH 2A6EC 3ECIA 3ZKJC 2NUCA 4FYDA 1WF9A 5M3FH 1STBA 2XVSA 2UUBQ 1L6UA 2XK5B 2KVZA 4BKSD 2JY6A 2F0TA 1N63A 5JVG3 4L6TB 5GADC 1LYLA 4X66Q 1WH3A 3VH3B 3OLMD 1VQHA 1SRUA 2C7NB 3DQVA 4KKJA 4R9WA 3ALBA 1JWUD 1CSQA 4QAYA 3S2AA 3HOVG 2KHWB 4JPSA 1X6OA 3HOWB 2KHJA 1EQRA 4YTNB 3KFUA 1LTLA 1KIXA 3BK2A 2PQAA 2R93G 4RFBA 1XD3B 2L5TA 1VF7A 2K25A 1WSPA 5C3EH 1ESRA 4MIUA 3PRMB 3AEBB 2Z4HA 3URYA 1B3QA 3I3CA 5E4XA 2PZWA 2MGSA 3UDFA 4DAPA 4WIPA 2Y0SG 5CV8A 1C1YB 1SMYC 2MP2B 5M5WB 2OTJA 2WDQB 4QCLA 5EPJA 1E24A 1YJNA 3V60A 2MRPA 2PTLA 2MJDA 5C4HA 2VXWA 1OQRA 2RGFA 5CHVC 1K52A 5KNCA 3D8GA 4W9FA 4IWQA 4JI4L 3EFUA 4CGYB 4YSXB 2EYHA 3D4WA 4UP8A 1JWMD 4KDIC 1HHVA 2IX1A 2SNSA 2VB3X 4IC7B 4B3RL 4KVGB 1DOMA 1EU3A 3I2ZA 2QGQA 3D3RA 3F2BA 4KY6A 2Z9HA 3ZJYC 1WI0A 3DVNU 1J5EL 2Y5BB 2PI2E 5I9OA 5JAVA 4IUVA 1RIPA 2AWTA 2EIFA 4HIOA 2BDNA 4JOIA 1SB3C 3RULA 4PZ6A 1DYQA 3AB5A 3DVGX 2B8GA 3Q0AA 3CCLA 2PIAA 5EAYA 3Q3NC 3AMUA 4W9HA 3Q22A 1VQ5A 2AWNA 1J7BA 2W3SA 3I4NG 1JJGA 4DBGA 1PHJA 4DKAC 4ID6A 2J4XA 4PS3A 3ZYYX 2XEWA 1E9MA 2BKFA 1IL8A 1TKGA 1ET9A 2A69D 1WJ4A 1IW7D 2Z0SA 3CHBD 3AQQA 2JSVX 1HE8A 5EKLA 2F0MA 2WDTB 3I7FA 1ZXIA 1B53A 2DAFA 1C4QA 1RD9D 2NVQH 5DPSA 3DHGC 2W54A 3V6EB 4HJ7A 4GLAC 1TTNA 1CA5A 4XT1B 4IOAA 1L4DB 3RFZB 2BE5C 2GBJA 2OJRA 4JI0Q 3MC0B 4A93G 3K8AA 1WFQA 4F7XA 1WTOA 1DOLA 4AYBG 2IX0A 4J6HA 5J17A 2C9WB 1NBFC 1CKMA 3EN2A 1EWYC 2CHXA 4DXGA 1K9MC 2HQLA 2OCEA 4BXXH 4M00A 4LAAA 1H95A 2RSUA 1V9PA 4IWOA 2RHQB 4DR1L 3AE4B 4AWJA 3MXPA 4OHJA 2Z8LA 2RPVA 4CJ1B 5EE1A 3A8JE 2UXCL 3C3LA 4OWXB 4BS9A 2PE9A 2CKZB 2D3BA 4H0LC 2O2LD 1BNZA 2KQ4X 4F8MA 4X3TA 1QZEA 3BVGA 4GNXA 3PT2B 2I2YA 4B9WA 3AMZA 1N36Q 4HSVA 2KA7A 1ZUD2 2L3ZA 2VZKB 3QX1A 2VL6A 2M00A 3NY5A 5HURA 2MPMA 1NCVA 3NENA 4PV1C 1U4PA 2XTIA 3MXGA 3L17A 1Z9FA 5AUKA 1XQQA 4I7AA 2KOLA 5BR8Q 1Q1OA 5IP7G 4N59A 3HOZG 5G55A 2LJIA 1WZ0A 2AKWB 1A70A 1WX9A 5D94A 1IP9A 5BN3A 2NYZD 2WDVB 1MSHA 3ULJA 2GMIC 3KLSX 1NI3A 2GOWA 1V1PA 3ZDTA 3Q8FA 4CHKA 5BYSA 1YNJC 1KABA 3CCSA 2KC2A 3HZXA 3SHQA 4DAMA 4DV4L 4DAVA 4A3IB 3ZRFA 3TUOA 3N6RA 3IKJA 2XRSD 3A7AB 1TIFA 1A2TA 1EZ6A 3N9YC 3V61A 1Y14B 4MEMA 4Y52H 2D3AA 3SE0A 4F7ZA 2H4OA 1FM0D 3PF5A 4AYBB 3WOEA 2L0TA 1N9WA 4YSZB 1Y69U 4TUUA 2QKIC 2N9EB 1U4MA 1YHQA 3MEHA 2AQ3B 5LL6S 3RZWC 2DYOA 3UF8A 2VNUD 1KAWA 4WFN3 3I4LA 4A20A 2IO1B 1MD2D 2XK5A 3KLRA 1EIHA 4JI3L 1DGSA 1PH8A 1B50A 4K6DA 1WXMA 1GUWA 2A1AA 2AX5A 4DV6Q 1WGHA 2INCC 2QDFA 3BDOA 5LMNL 2ZW1A 4NPNA 3VVWB 1NMGA 3GTJH 2A8VA 3K7AH 2MJ8A 1RFKA 1EIGA 2K6QA 4UY8C 1T5XD 2B3GA 2R6GA 2INDC 4YCUA 1GUTA 3MEFA 3K80C 4ABNA 3NS1A 1IL2A 1A62A 2HIVA 1LTSD 2JA5G 2NZHA 1PFBA 3CMAA 4DHZB 1X56A 1YJIA 2GBNA 3LB8C 4WWNA 1YHAA 2B2VA 3N52A 4S17A 3D4RA 2F0PA 2F0WA 2QEXA 3I3TB 4MDKE 1SDFA 3W1GA 1R4NB 1V81A 2D0PA 4FN2A 2A5HA 4ASWC 4P73A 2EXZA 4C7YA 3T13A 1WGRA 5C1ZA 2HCIA 3TMEA 2N55A 4MM3B 1Y1WG 2DNEA 5G5HA 2N7JA 4B3RQ 3TP7A 4XT3B 1E7PB 5D65A 1F2LA 3CMMB 4QIWE 4K1RB 5IYCG 1TBEA 1VRAB 3I57A 4F8CB 3U9OA 2QMTA 1J5EQ 1PZJD 1U4AA 3AU7A 3C46A 3GTQH 4DR2L 4IUMB 4JCVE 3GTGB 1SE2A 4RGMA 3NZUA 3WDNA 4MZ9A 1E7VA 2LGXA 1JQ4A 2KN4A 4EX5A 3O65B 2ZTEA 2W9NA 3NEMA 1NMFA 4LMQD 2LGDA 1P8LA 5KIXA 4EFOA 1XEEA 2FMCA 5C44G 1VQKA 3VTWA 3W1YA 1CKNB 4ZAIA 1IZ6A 1N60A 4UHVA 1L5PA 3AI5A 3IVFA 3AE6B 4B6WA 4YWKA 1YITA 2VUMH 4B3MQ 4NMZA 2IW3A 3K57A 1VQ9A 4A3DH 1IGCA 2D2QA 2KLCA 3AECB 4ZRKA 3VFKA 3G48A 4EZJA 4BY1B 1IBXB 3PZDA 4RWSC 2KXJA 5EPLA 1CZPA 1OEYJ 1TYGB 2ICIA 2O2VB 1WTQA 2FCMA 2OXPA 5KNBA 4UP7A 2N78A 2F1MA 1I5FA 3U4ZA 3J81i 4ZRQA 1U4LA 3N1XC 3MWYW 1LM0A 2MP1A 3NK9A 1RRBA 3GB1A 1NVID 2IHFA 1PQSA 2JWZA 2KKCA 4KX6B 2MO1A 2FBWB 4PZ8A 1F2RC 2UXCQ 3QC8B 2BWES 4KK7A 3OIQA 4FF2A 1A2UA 2BYVE 2R7ZB 2PW9A 1HNWL 1HTPA 3P20A 4DAYB 3J7AF 2Y3AA 2O6VB 3MAQA 1EY5A 1Q7YC 1YNXA 4A3EG 4PK1A 4R3DA 1SNMA 1FGUA 2LS01 3TP8A 4FULA 4EQPA 2BKRB 3FPUB 4IDIA 2KTFA 2KCTA 1B70B 1J6QA 4KN4C 1BUVT 5ELCA 4CDEC 4PS8A 3S9WA 3AE5B 2PYKA 4LF6L 5IE8A 1WCMB 1R4PB 5BO4B 3HOXG 3V3XA 2PZTA 2HIXA 2JQRB 4HIKA 4IG7B 1E1OA 5DPRA 1N34L 3JVZX 4K81A 2NVXH 4ITKA 2KMCA 3GTPB 1A3TA 1HFGA 1VQ6A 2LRWA 3CQZB 1R9TB 2ZCCA 4HKZE 3I4MB 5JJIA 2R7ZH 4DV3Q 4ICVA 4M0WB 1NR2A 1UE5A 5T8IA 5IOCA 4HAEA 1WD0A 5A2QE 1FEHA 3CU7A 1IKMA 2JJQA 2ON8A 4JW0A 4C4VA 1F2ZA 5I2YA 4BZAA 1EYCA 5IA7A 4W9IA 5I4DA 3SHLA 1ML0D 3BZDB 5LMUQ 2WWZA 4JI3Q 1FFVA 4YWGG 2ZTCA 4DHJD 4ANXA 3AULA 1SJED 4LW1A 3Q2AC 1B8AA 5FOBB 4KTAA 5LMNQ 3AE7B 3PSIA 2EJGC 1JT8A 2MEKA 2OOBB 4NNJB 1QVFA 2A68D 4C3HB 4L5RC 3PO2H 1BF4A 1NEKB 1UWXA 2HD5B 3A8IE 4O1NA 1WCMH 4TSSA 1BT0A 3DHHC 2EVBA 2BYTA 1DCZA 4DK0A 1PVOA 4OGQC 1L1OC 3PO3H 3J7ZC 2JA7G 2ACZB 2KACA 2V1YA 2BB5A 3B6YA 2EZVA 3DOWA 3A5UA 2JXTA 3A33B 1YI2A 3OWEB 3ML9A 2WXMA 2FE8A 3D0FA 3T8MA 1S1QB 3BINA 3M9BA 2QEJC 3VDYA 3A7LA 1YZ6A 1JB7A 2ZM6L 4Y7NB 3I4MH 1E5WA 2N1WA 1WZ3A 4LJPB 5CHFA 4GDLB 2JYOA 1HZCA 3CAMA 4BBSH 2NR2A 1WTPA 4XX5A 3BU2A 2WXKA 3MJWA 5GROA 5C3WA 1BO0A 3RUZA 1D5ZC 1HA6A 5DAUA 1PFNA 2R92G 2WGSA 3DBLI 5CX3A 1CA6A 3ZNGC 4DR2Q 3HRZC 4GOPC 3QARA 1VQDA 3N1YC 1E7UA 2AEHA 4FBJB 2OQKA 2QCZA 2F4VQ 4A3JG 3DEOA 2WB1G 4MM3A 1C3TA 2K1BA 1Y8NB 4TQ1A 2YV5A 4RHRA 3KWLA 3A9KA 3DWGC 1GHJA 1AEXA 1HTQA 4ZDVA 2F0UA 1H9RA 2K3UA 1K8RB 3NSWA 3UI3A 4DPGA 1TWHB 1SLJA 5JHBA 1WRDB 1A3UA 4P72A 2Z59B 3Q14C 4B9KA 4K8IA 4MJSA 3GD7A 5J39A 2O5JC 4HR7B 4WRDA 2EDGA 2C5CA 4RA8A 1XLOA 2K8CA 3DVNV 1I6HB 3SFDB 1EOTA 3QB3A 1C0AA 1DM0B 2BBCA 4USAA 4RF1A 1N32L 2W3RA 4JBWA 1OXVA 1E10A 1WY8A 4G50A 2V3NA 3E6ZX 3NWSA 4JG2A 2VH1A 2G1EA 5M9OA 2A4ZA 3DHQA 1Q10A 2MQHA 1F9QA 3RI7C 1WE7A 3NJTA 1PYBA 1IBXA 1Q1EA 3IXSA 4EUTA 2DY7A 3QIAA 3RNCC 1HNWQ 5JOBA 3SGIA 2F03A 2WKCA 4PNYA 1MHHE 1S5DD 2UXDQ 3GTKH 2M0XA 1XCTL 3LNNA 4LWCA 1AZPA 4OWWB 1RDPD 2XN9C 1RFAA 4NXMQ 1A3VA 4KKSA 1TWHH 3K6OA 2JZZA 4GIVA 1XX8A 2J7ZA 1QZGA 3QJZA 5JZEB 1XF5L 2OF1A 1SYCA 5IOIA 4ZKCB 1K83H 2AL3A 2DHZA 4DAYA 4LF6Q 2WXHA 1EF1A 2O6VA 2WIIB 1BBUA 2BVCA 4ARIA 2X6GA 1Q82C 2UU9L 4OIKA 3NS8A 2JSOA 1KXLA 4K7UA 2E3TA 2F0IA 4EEWA 2B2YC 3VR4A 1N34Q 4HCPB 2FAZA 1MG4A 3FPPA 2B39A 5J1ZA 3AE3B 1B9MA 3DXJC 1VZ6A 1GC7A 1WXAA 3HOUG 3Q3JA 5CV9A 3QG1A 4H44C 2AQ2B 4ZQ3A 4IFDJ 3KF6B 1YD8U 5FLXL 1P7EA 3CCRA 3DMUA 1T0SC 1CSPA 3G6EA 3BJUA 1NSNS 3A54A 4APVA 1SE4A 1NAPA 3MTSA 1LGRA 4C3JH 3LWUA 4J1MA 1YQBA 3AEDB 4MGZE 1C48A 1SYGA 1WRIA 3QA8A 2WX0A 3RD4A 3T3NA 4QIWB 3QR8A 2E2IB 2BWFA 3PZ7A 1UBIA 3PIOA 3S16H 4W9EA 3A4SC 1SYEA 1YN3A 5K36H 1MFWA 1Y8PB 3WCQA 4BY7G 1LTBD 2IDYA 2EMTA 3CW2C 4A3GB 2JK8A 1ISNA 1GOZA 1Z2MA 5LL6X 1E6EB 3CWIA 1JMLA 1TWGH 1ZYRC 2KENA 1S4ZA 1YN5A 2PO4A 1ZOYB 2PQAB 2DWQA 2IY0B 1AFPA 2JYEA 2M8SA 4OVVA 2JZPA 3RNUA 5JEAJ 4POFA 4ZYSA 1LV9A 3NWTA 2JA8H 1E8WA 2GBKA 2F0SA 2M0AA 4NAMA 3PIP3 2IYDB 2J53A 1NJIC 1VJKA 3DHIC 1WX7A 1XTCD 1T5EA 4W9DA 1XJVA 1ROEA 1PH7A 1VQGA 2RDGA 1KRSA 3TP5A 3GTLH 2JPHA 5TSSA 3QJYA 3H3VC 1NY4A 4DV2L 1EY7A 2ZXRA 3AV8A 3R3MA 4X3KA 3M4PA 1SIFA 1LLRD 1LT5D 1I4PA 4NPSA 1BCPC 5CYUA 3DBSA 3RLFA 3ZXRA 4OONA 2PJHA 1GUOA 2D07B 1G291 2DN8A 2E2IH 2HJ1A 4GDLA 1TT2A 3C1FA 4M8NA 5IGEA 4JI1L 4S0RA 4XWWA 5JVH3 4XIGS 1I3QH 4AYBE 4A3GH 5BMIA 1QCBD 3ERQA 2KTRA 1HUMA 3U2SC 1EY9A 4JLCA 5BMGA 2SDFA 3L13A 4URKA 2O4XA 4MSMB 1LXDA 2EY6A 1OGWA 5TR5A 3RYTA 4CJ2C 4BOZB 5COYA 4DNTB 4JQWC 3CC4A 4AQYL 2B2WA 5E6OA 2EYMA 5EBDA 2G45B 1TS4A 4CDFC 1N61A 3V62A 4KLKA 4WAFA 3GP7A 2X38A 1PTOB 1JWBD 2OJWA 4LNIA 4DHZE 3CCUA 5M3FG 5FLMG 3AE8B 2QILA 1A0IA 2CW0C 1L4ZB 3CPFA 3CCJA 1K8GA 1XXGA 2WU2B 3U8ZA 2XBBC 1FYCA 3DUZA 3K5MA 4DR5L 3F1ZA 3T1HL 4DV0L 4EGVA 3QIJA 3UDGA 1X3PA 5E1FA 2KWVB 1KOTA 4B08A 3GV6A 4US9A 2MHJA 3DCGA 2IPKD 3PPAA 1UWMA 4A3LH 2V9HA 3NTHA 5ELFA 3P2BA 5FR6A 3OMCA 5KHQA 3IAYA 1GB4A 5FJ8H 2JA6B 2NN6I 1L0WA 1EUVB 4X64L 2PVGC 1FPYA 1SSNA 2UU7A 1MJEA 1X3GA 2K4KA 2KAJA 2Q2HA 3G6JB 4GNXB 4NZLB 2UU9Q 2KVRA 3H0GG 4HMIA 3S1NB 2L0FA 3IT4B 3E9HA 2K8HA 2YU9H 1QOHA 2JXMB 2PMZB 1NR4A 1ESFA 4RF0A 1PZID 3ZUNA 1ZXTA 1EZ8A 2UWQA 4WJQA 3SK6A 1VD2A 4LNFA 2ZJQA 4MGYE 1XTDA 4YSYB 2A74C 3PZ8A 2FCNA 3HUIA 4W9LA 4NDXA 1V1PB 3A4RA 2WNMA 3RZFA 1PMRA 5FO8B 3S1RB 3DEPA 3PVLA 1D3ZA 1QUQB 1O78A 1EQQA 1L1OA 5IAAC 4KJOA 5FKAC 2REXA 3HHMA 2LVQA 2K5VA 2M1MA 1L2NA 1I4GA 3RZDH 5HFYA 1HXYD 1F52A 3CC2A 1LTRD 1TKWB 1KFYB 2D0OA 2RVLA 2IWHA 3OTOQ 4ACFA 4G7HC 2KEDA 1EU4A 1TWFB 4KSKC 2RCNA 4PYUA 5C4XB 3MFGA 2Z1CA 3U30A 1ACCA 2RDBC 3ER0A 2LFIA 1HQMC 4U673 2E2JB 2FJ2A 4X57B 2WFWA 3MFYA 1PTOF 4LFCL 4GKJL 4ZRJA 1KTKA 5FO7B 2G4SA 2NVYB 5H92C 3HKZG 4FXGC 5IT9c 1C76A 2WXFA 4KKUA 3M3YB 5J22A 4GN5A 1TIID 2Q2IA 4XQNA 3KVFB 3H0GB 2F0DA 4A3MG 3H6MA 2G9DA 1TWCH 4K2LA 5KYLA 4K2KA 2Q8TA 2Y5PA 2Z0DB 2DBYA 2VZKD 4HPPA 3M95A 4DV2Q 3SR6A 2WXPA 4BBRH 1IKLA 3LWEA 4DR4L 4NKLA 2J0JA 3SDLC 4KV2A 5M3MB 4NXNL 1I4HA 4CKBA 3VYUA 1TS3A 3IAM1 3KF8B 4K5VA 1PH9A 2K5PA 3Q8BA 1EY0A 4BXXG 1EIFA 3TEZA 3FKIH 4A3BB 4C1NK 4KGSA 5DCNA 2K32A 4C3IH 1TWFH 5C4JB 4JBKA 3U7DA 2W55A 3KBXA 3CCMA 3U50C 1PRTB 1OTCA 4JI1Q 5C0XI 5D3IB 3GE8C 2ZVOA 3KWVA 2I5MX 1G91A 2KFKA 1K0RA 4PT5A 3LYYA 1O7YA 4BVUC 1R4NI 5IYBH 3TCAA 4LNOA 3E9IA 1VCIA 5M5YB 5D7GA 4A4IA 3FILA 4H02A 4EQOA 2MBBB 1HUNA 1E7ZA 2EE1A 4X3UA 1GJXA 4DV5L 1OXTA 2IY1B 1CQVA 2KVMA 2AWOA 3FKYA 4DGZA 3MC9A 4JX1C 1C4AA 4IFDG 2F3IA 1XNQL 2KQ3A 1T0RC 2L1AA 3LXFA 4LCDE 2I5HA 2NB0A 4IOCA 1PFMA 1QVCA 2ENBA 4AUQC 4N8X1 2Z6BA 5E3FA 3HOWH 5IYDH 1O7ZA 4YXDB 5E6JA 1S5FD 5IT9E 2IGGA 1CQFA 4FA6A 4P71A 2J0TD 3BYYB 1WTXA 4RKBA 1QE6A 3HKZB 1FXAA 2DENB 2CWPA 1TU2B 2KO3A 3CIRB 1W3SA 2F0QA 2G5DA 4KI0A 1S72A 1OEYA 1WGDA 2YEPB 1CM9A 2YTVA 2GA4B 4D2KA 2B76B 3VRAB 2EQSA 4RHSA 4IQZA 4A3MB 1L0YB 2JRHA 3HOVB 1STEA 3J80L 1FNUA 1KRHA 2Q8IB 5C4JH 2E6XA 2QDLA 5M5WH 3HOYG 5LHY1 3T1HQ 1CJEA 5LLIA 2R93B 1E22A 2J0MA 1DOXA 2C60A 2WAQG 3GO5A 1K3RA 1RODA 2HDLA 1JE5A 5KYIA 3U7ZA 1PH3A 2N0SB 2B2YA 4QQBX 5JEAG 1CT1D 4ZRPA 1EFID 5J18A 1LT4D 1NTGA 2SOBA 2Z6KA 3D31A 3J80i 1FRRA 2Y0SB 2LHEA 4X64Q 4A3KG 5IODA 5J2RA 2GRIA 3TEXA 3T3OA 1E8YA 2SEBD 1JJCB 2BA1A 1UGMA 2BE5D 2AYOB 2QSDA 3NRZA 1OXUA 3C2PA 4YT0B 2YTYA 2PKOA 1UUPA 2A69C 2D5DA 2IHEA 2BF8B 1Y8RC 4IM2A 3OHXC 5C3XA 1HZ5A 2KN5A 4EQNA 4LF4L 4L5QA 1FO4A 3G4SA 1MG8A 3Q3OC 2LMCA 3QAQA 1I50B 1VQFA 5CV6A 1FVIA 2WXIA 3HVZA 3JYUA 4DDGD 3HRDD 4HJGE 4R8IA 2UXBL 5JJZA 2M56B 2CH4A 2E5LQ 1DGJA 3D6WA 1UD7A 4II2B 4KGTA 3HOVH 3WANA 3OW2A 4G11A 4G0NB 3I4OA 1CI3M 3DM3A 1GM5A 1EIYB 4X6AH 1PRTF 2QIEB 3CF6E 2VW9A 2J0KA 4JI8Q 3TDQA 3AU5A 1U9RA 2K5QA 2QW7A 2RCFA 5JJKA 2L32A 4DXFA 3IHPC 3WAPA 1VR9A 1UBQA 3CF5A 3EHVA 3J9CA 2F0NA 3MHSD 2KK8A 3TS2A 1MI2A 2OT2A 4ZYNA 4HJ9A 3I4NB 1YIWA 2NN6H 3S2DB 4P2CB 3HOYB 3J81j 1BBXC 1PGXA 4KKTA 1RWSA 1PZKD 2WP9B 1P98A 1KRTA 2WAQB 4JI6L 1ENCA 4OW0A 4C4VB 1QUQA 1XPRA 2PVOD 1X3QA 1B9RA 2XIWA 1D5XC 2K03A 2OQ0A 4TQ0A 2F4IA 4KN7C 4RAUC 1JOOA 3NXWA 4HN7A 3CP0A 2YEPF 1M94A 2F0EA 2IO3B 3Q6SA 2IT1A 2ZXPA 4A93B 1SE8A 5KGUA 1TT5B 1SEBD 3IFWB 4W9KA 2LXCA 3SVMA 2WB1E 4DNRB 4A3DG 2MH7A 1PFSA 2KDFB 3KLSA 2O6VD 4CYEA 2N8NA 3JAMc 1EY4A 4GN3B 3NG0A 1K8MA 3E3XA 3AXCA 2BYEA 1I42A 1YIJA 2INPE 2PZUA 3ETRA 1AARA 4DR4Q 1H9SA 2BYFA 4NXNQ 3BZKA 1TKYA 5LXHA 4BKTA 1J0GA 1GPXA 2SAKA 2PPHA 1F9SA 2EY1A 4K8JA 5HGTA 2E76C 1S40A 2M9VA 2F0HA 3D4DA 3TP6A 2V3SA 4GLSC 4GDKA 1K73C 2JF5A 2LGYA 3H09A 3NP8A 4A3IH 3KUDB 3ICEA 3S15B 3L3OC 4DR7L 4JWSC 1NENB 3HOZB 2V3PA 3NVZA 1LT3D 4GLVB 2HHHL 3KF8A 4A3FG 4JI4Q 2H88B 1J8IA 4JE3B 5D6JB 1W6KA 2GN5A 3T1YL 2G4DB 4DV5Q 1MVKA 2F0VA 2EJMA 4IJHA 1YNNC 2B2TC 3ZJVA 1XNQQ 2YVCA 1SMXA 2MWSB 3BWUD 4WWMA 4IM0A 1Y8OB 4LF7L 5FLXE 1VDVA 3A9KB 1EEID 5H8YE 4A8XC 3OSOA 3VR8B 2E75C 4PG3A 1Z6HA 2BS3B 2KFJA 2I0QA 5HI1A 2A6HD 3DWPA 2JEBI 4A90A 3QO2A 4OIJA 3EA6A 4FF3A 3Q69A 1W2BA 4MJSB 1JALA 2WACA 2JXXA 4LNNA 2TMPA 5ELDA 1B3AA 3JAME 1B44D 2G3QB 2INNE 3L16A 2JWUA 1PV4A 2HTHA 1KDAA 2HCCA 4CBVA 2LVOA 3MXUA 1G2TA 4K3BA 1N33L 2R61A 1E8ZA 1QKZA 4DFAA 1HR0L 5C0XH 3S15H 5EKIA 5HKHA 3EVQA 3GZNB 5IP7H 3J81L 4OO1I 4AQ7A 4L8JA 2I07B 2JZ3B 5CTRC 2CQOA 1G6JA 3ZQ4A 3AN1A 3AM9A 2KNBA 4KMUC 4ULLA 4JBMA 2RHSB 1ZGUB 2IX3A 1SIJA 3M63B 3HM6X 3WAOA 4N9PA 2JA5B 4YTMB 3H8HA 3M62B 1TY0A 3ZNZB 4A3OA 4JI5L 2WDRB 1MKHA 1C7YA 1GB1A 1N5XA 2NBWB 2MQJA 5L95C 2CHWA 4XDXA 4M02A 2N7DA 3DBHI 3QCAA 4US8A 4LF4Q 3NHEB 3MA2B 4WAAA 5C6AA 4DR1Q 3GTGH 4HVBA 2B2UC 3PO3G 3CCVA 3PIO3 3UINB 1Y1WB 2MJEA 4TRDA 5EBCA 2UXBQ 1E3PA 1HJPA 3W2DA 1S5BD 3I72A 2J42A 3V6CB 3C19A 3AEFB 1DZ1A 1CTMA 5J3BA 1XLPA 4LK0M 1F9PA 1TZOA 3EQLC 2N1VA 4RGOS 3PRZA 4I6NB 2C7HA 3AE9B 4DK5A 2AUKA 2F0GA 2NZ1D 2KDEB 2IBIB 2XGTA 4IKGA 3ZLZA 4DWFA 2KJ6A 3GDEA 3VUYA 1FRDA 4GMVA 4DXAB 1RAXA 3UI2A 1LQBA 2MW5A 3M4OB 2NCNA 2ES2A 1JCKB 1XMQL 1V9JA 3VUXA 4PMCA 1ZP0B 4O2DA 4BY1H 1N8RC 2FUHB 2DGYA 3WWVA 5KEEA 2LXAA 4LUVA 5C44B 3I90A 2L55A 1EL0A 2VS1A 1N5WA 1R7SA 2IJ0A 4TVAB 3V05A 4ICUA 3PV0A 4PZ7A 4JI6Q 3H1UA 3Q8CA 1JB3A 4JYAL 1E1TA 3H7PA 1UGJA 5E7NA 4DV4Q 1JRPA 2K01A 4MN3A 1I6VC 1MIUA 1MHXA 2LGSA 2N7EA 2I5LX 1HZAA 4QMGA 4UDUC 4FLHA 4ZLTF 3SK8A 2LVPA 3I55A 4JBJA 1Y1WH 2K5NA 3RUIB 2H89B 2FHTA 1YQ4B 1S5CD 1P0RA 1OXXK 2NBFA 5D2MB 3CKIB 1Y1VG 4QUFA 1VMPA 4GZYC 1Z7TA 1S3OA 2CJOA 2GVAA 4M8AA 4FXKC 3PUWA 3ABVB 3O13A 3EFXD 3W5OA 4FHKA 3F2UA 2N9KA 1RCVD 3OAWA 1IXRA 2PNHA 4FJZA 5T1GA 2N4FA 2PMZE 3ND8A 1P3QU 2GB1A 1Z5SB 4LFBL 4ZOHC 1I4XA 3LX0A 2IGDA 1FFUA 4A3EB 5CGKA 2E2HB 1AZQA 4IUNA 1NUCA 2GLSA 3SK5A 5IP9H 1HA5A 4WJNA 1JJ2A 1UWVA 1IBLL 1MI0A 1WJUA 2L52A 4WORA 1MHWC 2CCZA 2N9LA 3S2HB 2ZVNA 4LJZC 4P16A 3GTPH 5IWAL 3W1BA 3N1ZC 3CQZH 2L15A 3T1YQ 1R9TH 3S17B 2CJNA 2ONQA 2PEAA 3UGBB 3HOXB 4IM3A 4IPCA 2A68C 4CDDC 3CSFA 1QOFA 4HIMA 1Q3LA 3PUVA 4IPHA 1JMCA 4N8FA 4LF7Q 3B2FA 1DOYA 1HNXL 4LFAL 1RL2A 3NE5B 1RYJA 1DOKA 1G51A 5EJWA 3A1QA 3HIZA 4C7ZA 3T4AC 5BN4A 2KTRB 3RNEC 2B63G 4QB4A 1XPUA 1JWAD 3GQBA 1JW9D 3B08A 4OZAA 1I4RA 3HP3A 3NUHB 3K81C 3A9JB 2JUOA 3A55A 5EQ0A 4UP9A 1Q86C 5KRUA 1Q0WB 1GAQB 2K5HA 1Y1VB 3BIID 4L1BA 4C3HH 3B9JA 3HVDA 1YQ3B 4A3EH 5IGGA 5DEHA 5I6WA 4OX9L 1EM7A 2LEKA 3PTFC 4YL8A 1FD6A 2CVRA 3MHZA 1N33Q 5AUIA 2WXJA 2D10A 1HR0Q 1VQ7A 1TJEA 3DWAA 3ULLA 1K50A 4JVZA 3CCQA 2DYBA 4DK3C 4BBNC 1TR5A 2PW7A 1IPGA 2WXOA 3R7QA 1KLVA 3VA7A 2DUDA 2DNCA 3R2TA 2CHZA 2L05A 3CRLC 3VA5A 5C23A 3S17H 1KAAA 2FMMA 1RTOA 3PUYA 4P74A 4C3JG 5IGBA 1CMXB 4Y7NH 2M17A 2EYJA 3DLLA 4R4QA 2ZW0A 1XYIA 4IPDA 2ZJPA 2JA7B 5HG2A 3ZIMA 4TKOB 3ZW3A 1SR3A 2ZCBA 5IN7A 4X3SA 4B3TL 3B2GA 1AH9A 2W82A 1VZ7A 4MH8A 3OOCA 3DBHB 1GJZA 2FINB 4FHJA 4IOIE 5DLQE 4IW0A 5IP4D 5ELBA 1F9RA 1CKOA 1SNPA 3LGJA 1WD1A 1WJNA 3T16A 1RKNA 1Q46A 2JA8G 1HTLD 4HPMB 2BH8A 4HCSA 3K9PB 2ZNVC 2R92B 2EPBA 4AJYB 5I2XA 3P7JA 1HTOA 2B63B 5DNFA 1KL9A 4N9F4 4W9GA 2QF7A 4XE0A 1FNWA 1FJGL 1D7QA 3SD5A 4A3JB 3TEYA 3RZOB 2EYLA 2WB1B 2M4NA 3I91A 3TN2A 4IO9A 4MH0E 3HKZE 4OO1H 3GS2A 1SAPA 1I6HH 1TQOA 1I35A 4J15A 3APDA 2L00B 1CFMA 2JA7H 1VCBA 2VY3A 2K1FA 3BVMA 2D62A 4JYAQ 1WFYA 2ID0A 5H1SE 2NVTB 1L1OB 2AUJD 1PTOD 4EVOA 2DY8A 2UUAL 3E9SA 5AZHA 4AJWA 2L11A 2K50A 3JC66 4JOIC 5CBEE 4JI2L 2LUEA 3RNAC 3OMGA 2GVBA 3OJ3A 4HLEA 2NPTA 3TSSA 1X55A 3FP9A 3J80E 4Q0FA 4Q2JA 4W9JA 1GO3E 3ONSA 2YTXA 4KHVA 2Y0SE 1LTGD 3S24A 5IGFA 4WJOA 1J7AA 3ZO5B 4DV1L 4ZRZA 4F87A 3M7GA 4R4TA 4RKLA 1VQNA 2R7FA 3N30A 2KCMA 3PUXA 3X3NA 2Q2UA 3AEGB 2IY5B 1H9KA 4IUQA 2NTSA 3ULPA 1NI2A 3M4YA 3WIMA 2MO0A 4YY3L 4GOPB 4A3JH 1V6EA 2V0GA 3JW0X 1CHPD 1AWDA 4NP5A 4NJ6A 4GGQA 4LFBQ 2B2TA 1GVPA 1T9HA 3VQIA 1KLGD 1QQRA
chains in the Genus database with same CATH topology
1LACA 1VDZA 1X32A 3J7AV 3MP9A 4CKEA 4V0BA 3MVVA 3Q23A 3T53B 2EYPA 3VR5A 4ZHPA 1FR3A 1PDXA 1EY8A 1STHA 3P63A 4XWTA 3AEEB 4BA1I 2PQEA 1STYA 1HRJA 1DOIA 4NJCA 4IUUA 1JWSD 3KBGA 1Q1BA 2G9HD 3HOUB 4RCOA 2WV6D 4ME5A 4RNAA 4RGTA 1TVXA 3FILB 5JPNC 1BCPD 2WXQA 1J9OA 1C4CA 1D1KA 2DLBA 4H7BA 1MGSA 4C56C 1EQVA 2K33A 1AP0A 4KKIA 3IFDA 1H9JA 2EJFC 1M4VA 2EYFA 3E56A 5IGDA 3MZ5A 4CJ0B 5I9PA 3NQTA 2QDBA 2XWJB 2D9UA 4BY7B 4HEA1 1D5MC 2QJLA 1M8AA 3NTKA 2WXGA 4WQMA 3FC4A 4G57A 1G6ZA 5EPKA 4LK1C 4N9TA 3NZ3A 2O5IC 1JE4A 1RF2D 4S3SA 1O80A 2CW0D 3NVWA 3FEWX 1PRTD 2PNRC 5HHDG 4ARCA 2JP1A 3ONAB 2B2VC 5ELEA 2LMCB 1E2WA 1NYQA 1KF6B 1ET6A 4XYQA 4YIJA 5M5XB 4PMBA 2MJ3A 4C3IG 5ISRA 1AW7A 1PTOH 4ZKBB 2HDEA 1Q90A 3OW7A 3H94A 2LUMA 4IFDI 4H2AA 4XQJA 3E0JA 1I4QA 2LKVA 3J7YW 3S14B 4K5WA 4CHTB 1ENAA 2X69A 3S1MB 4AS1A 3C8YA 1C78A 1STAA 3SXHA 1ZKOA 5M3FB 3DM1A 3FVQA 5FK9C 1QT9A 3J81E 1MBYA 2KECA 4HROA 1BCPB 4FF4A 2F3VA 4FNFA 1MSGA 1SBBB 3K5NA 2V4DA 3VR2A 4IALA 1D4BA 2A6ED 2B8FA 1H9SB 4DQOC 5GXGB 1QG7A 3KQ4A 1FCLA 5C3EB 3D6CA 3NTIA 4JWUC 1L0VB 1WGKA 2EELA 2A73B 4GDKB 2EYOA 2F0OA 3L7ZC 3MXNA 4DN4M 1ICWA 2EY2A 4UAIA 4E6IA 2HQEA 3A8KE 4LLGM 1V43A 4JK1C 2BDOA 1HEZE 1PGAA 4TQUS 2Z4IA 3AEAB 4MHEA 3K59A 4HSPA 4RGNA 4C1NI 3C1EA 1YNTE 3QOJA 5C5LA 5C4ZA 1W6JA 1OXSC 5C3JB 3ZJUA 1SMYD 3HGBA 3T56B 1KNEA 2IGHA 2RDFA 1BDOA 3R93A 4XXEA 2JU6X 1L0XB 3P42A 1Q8IA 1VMCA 2NN6G 1ONLA 1EWHA 3GTMB 5CV7A 2NVQB 1BCPF 4ZUIA 2PPBC 5IGCA 3DWQA 1PYWD 4WH4A 1HPCA 3OIPA 4B9XA 4OVZA 4KJNA 2ICEC 4FVMA 1XO3A 3P1HA 1B1ZA 3BDCA 4FXCA 1WTWA 2H1EA 3PUZA 4IN3A 4XYOA 3SDZA 3V96A 3K5LA 1I7HA 2F0JA 1R4QB 2XRQD 3FMCA 2NTTA 1WWTA 1IW7C 1ZXHA 4K6LA 5CC4A 1QNUA 1SYFA 5KNDA 1U4RA 2IL8A 1A15A 3AE1B 3TZUA 4MT5A 2E2DC 3Q8AA 1FGBD 2BA0A 3HG9A 4ODGA 1GXDC 5CV5A 4KD3A 2MUYA 3RMHA 5EE9A 4HCEA 4XDCA 2I46A 2KCCA 1K8OA 2K05A 4C2MB 2V4IB 2K7VA 1UNSA 3GV3A 1YNJD 3IAS1 3H91A 1PGBA 1E0ZA 4WURA 2BB6A 4FP5D 2XSCA 2RDHA 4A3KB 2J52A 2L12A 5C0XG 5JPMC 4IFDH 4RH6A 3SFEB 4DU9A 2HUGA 3GTJB 3K7AB 4BA2I 2K5WA 1WTRA 1BR9A 4DF7A 3P4RB 2JX5A 4G7ZC 1E0BA 4B0MA 2L4NA 1O7LA 1WYGA 1BOSA 2RQXA 2OHFA 4QUCA 1LTAD 5G3LD 3ND9A 2DYMA 3TBIB 4TMAB 3R3OA 1UAPA 2LY7A 2BS2B 5EE0A 3U52E 5NUCA 1OQQA 5JEAH 1YMHE 3GTQB 3SEBA 1TS2A 1FIQA 1D6EC 4L2YA 1SNQA 3NPPA 4IUTA 3NUCA 1YNND 2PLPA 3L4PA 1FMAD 5EKKA 2WINB 3QWNA 1F2RI 1JICA 2VUMB 1IYUA 3I9V1 4A3DB 1STNA 3X3MA 3EUB2 5DM73 4OZBA 4CQNA 1ZPSA 1VLBA 2RBMA 3PMFA 1ILPA 2BCOA 2A6HC 4WJWA 3Q24A 3VRBB 1K51A 4LTUA 4HRSA 1JOQA 3ITPA 2PMVA 1EWCA 1PDQA 1E2ZA 2AQ1B 1STGA 5F2DA 2KMMA 1B2TA 3IL8A 3BG3A 4A3FB 1MPEA 4XDDA 1C77A 4U68A 3T51B 1RHPA 5K5PA 1CZGA 3TZDA 2BT6A 2FUG1 1E2VA 1ZDXA 4G4KA 1QOGA 3QOLA 1SFOB 3E5SA 1EYAA 5CV4A 3K58A 2CU3A 1HQRD 2KUMA 4XTCS 4FF1A 4IZ8A 4J8QA 2TSSA 1SXTA 2GI9A 2Q5WD 1PLFA 2N88A 2RA4A 4P6VF 5EGTA 3U4EG 3W1SA 4H13C 2WS3B 4ZHOA 2NVXB 1LTTD 2M2LA 1FNVA 2R3ZA 3IFTA 3I70A 1HZ6A 3M85A 1G2SA 4M1UB 1QJOA 2B2WC 2HDMA 4C3HG 4DK1A 4MACA 2PW5A 1XLQA 3CRKC 2KEEA 1XLNA 1PXUA 1Y56A 3W3AA 1QLBB 4O42A 2OEOA 2RMMA 2WXNA 4HKQA 2K9XA 3PO2B 1ILQA 4L63B 3NVVA 3PO3B 1II3A 4N6EB 1CK1A 4OL7A 4Z9CB 2WLBA 2RKSA 4KGRA 5LNK1 2LFNA 3HEJA 3FDTA 1V8CA 5CBAE 3P75A 1SYBA 1GUSA 1XCQL 4KV6A 1FXIA 1T3QA 4BBSB 3K5OA 4PMWA 1C4PA 1EY6A 2BOSA 1RTNA 4OZCA 5IT9L 1F77A 2WP8J 1QILA 4A6QA 3NQIA 3U9SA 5C5MA 1KH0A 2XWBB 2L1BA 3W5VB 4EE2A 1WTVA 3DWMA 3BVZA 1QB5D 2JEAI 1GUNA 4FXDA 4OO1G 2EY5A 2EOTA 1KDBA 4A55A 4NW2A 5DM63 4HEDA 3L9AX 3KK7A 5G3LF 3TEWA 1WXQA 1QF6A 2LGIA 2WKDA 4IUPA 4NAWB 1BXTA 1OFFA 1VZ8A 3MJ5A 1D2BA 5D3DA 2KJXA 3BS1A 4ILWA 3PO0A 1F0ZA 1QOAA 1GUGA 4Q5VA 5EE3A 1C9FA 2KHSA 3FRPB 4KY7A 2WXLA 2F0LA 2F3WA 3GTOB 5IIFA 1NYRA 1D1IA 1LABA 3V2TA 1WVLA 5K36G 4XQQA 3GTKB 3IT6B 1DXMA 4HTHA 1SSOA 1P7FA 1T6BX 1OO9B 1FD7D 3NHHA 4KHZA 4FO2A 1K83B 4CKCA 2OEDA 1JQYD 2NWGA 2Y5CA 3VR9B 1AYFA 2RSNA 1LT6D 5BN5A 1EYDA 4L23A 2JYTA 1FCCC 1BUIC 5MPOA 3Q8EA 5BYRA 2K6AA 1H9MA 2ZXOA 1PFDA 1TKEA 1JROA 4A9AA 1IHZA 1TY2A 3AE2B 3OWFA 1QWYA 5D14A 4C3JB 2D2CC 1JR0D 4RCNA 2VB2X 5FO9B 3K0YA 1DJRD 2K04A 3S16B 1RM6C 2WU5B 3VYTA 1QOBA 5G5GA 4C80A 2K5DA 2CHBD 4V190 1AN8A 3BYTB 1V1OA 4I7ZC 1PTOC 2ZT9C 1TWGB 5T1IA 3R2IA 3SR1A 2JA8B 1LO5D 5BMHA 1CZWA 3P1MA 1QNKA 1IUEA 1N62A 2I38A 3GTLB 1DD2A 5A35A 3EROA 3W5UB 1ZYRD 3P4PB 4J3OD 1V8QA 3ZJTA 1KDCA 1BQQT 1HFNA 1Z47A 2L0CA 4B0EA 3VR6A 3VYRA 1IYVA 3JAML 4M0WA 3EGRA 2SNMA 3NVYA 3ZGZA 2BTEA 1S5ED 1IGDA 2BW2A 1I3QB 4KD4A 1YN4A 2WXRA 2QCPX 3NBHA 2PCFB 1ZDVA 2C9OA 3OPOA 2L83A 4DA2A 1A6XA 3BK1A 2M19A 2E74C 3M7NA 5C2TB 2Q8RE 1JORA 1TS5A 2XNAC 1DONA 1F2MA 3AH7A 2MHVA 1L6VA 4PQXA 2EKIA 3VYSA 3P4SB 1PUTA 2D5GA 2KWDA 1C79A 2B2UA 4YSXB 3S1QB 2X6LA 4HMJA 1GHKA 5JXVA 4F88A 3BDLA 1B4OA 3G7LA 4ZK9B 1SYDA 4BWGB 2K0PA 1J7CA 3WOFA 1ZEQX 4YTPB 4K14A 5I6YA 1C8CA 1BMLC 2L9HA 1KLUD 1EQTA 5C0XJ 4G7OC 1SNDA 1SF0A 3AB9A 2BS4B 5E4WC 4R8NA 5CMDA 1Q12A 2K28A 5FR3A 1SNCA 3W9CB 2YU9B 1YJJA 2K22A 1ZE3D 1LTID 2F0FA 2F0KA 2KDMA 1CHQD 2NMQA 1HCZA 3I8ZA 5A2QL 1PRTC 3I73A 1XWEA 4QF4A 2LHDA 1VF5C 3P4QB 2KCNA 2YYZA 2JE6I 4K5XA 1ENFA 1SJHD 1JC7A 1F2YA 1JOKA 3RZDB 1G8ZD 1KNAA 5AFWA 3HS0C 2FFKB 5CR3A 4REZA 1TWAB 1EEFD 3EJIA 2CQAA 4I65A 4KY5A 1SNOA 2WQYB 3KUPA 2RSOA 1SE3A 3SK4A 1TWCB 5CORA 2HTME 3A56A 4BBRB 1V97A 1UEAB 4IURA 4N58A 4ZUJA 3NBIA 1B9NA 5BYQA 1RJTA 3FKIB 3R8BA 3RPFC 4C3IB 3MHBA 1K53A 3VR3A 2A6EC 2NUCA 4FYDA 1STBA 2XVSA 1L6UA 2F0TA 1N63A 5JVG3 4L6TB 4KKJA 4R9WA 1JWUD 4JPSA 3HOWB 4YTNB 3BK2A 4RFBA 2L5TA 1VF7A 1WSPA 1ESRA 4MIUA 3AEBB 2Z4HA 3URYA 3I3CA 5E4XA 2PZWA 2MGSA 4DAPA 4WIPA 5CV8A 1SMYC 5M5WB 2WDQB 4QCLA 5EPJA 2PTLA 2MJDA 5C4HA 2VXWA 1OQRA 1K52A 5KNCA 3D8GA 4CGYB 2EYHA 3D4WA 1JWMD 1HHVA 2IX1A 2SNSA 2VB3X 1DOMA 1EU3A 3D3RA 4KY6A 5I9OA 5JAVA 4IUVA 2BDNA 1SB3C 1DYQA 3AB5A 2B8GA 3Q0AA 2PIAA 3AMUA 3Q22A 2AWNA 1J7BA 2W3SA 4ID6A 2J4XA 3ZYYX 1E9MA 1IL8A 1TKGA 1ET9A 2A69D 1IW7D 3CHBD 2JSVX 5EKLA 2F0MA 1ZXIA 1B53A 1C4QA 1RD9D 2W54A 1CA5A 4XT1B 1L4DB 3RFZB 2BE5C 3MC0B 4F7XA 1WTOA 1DOLA 2IX0A 4J6HA 1EWYC 4DXGA 4LAAA 3AE4B 3MXPA 4OHJA 2Z8LA 2RPVA 4CJ1B 5EE1A 3A8JE 3C3LA 4BS9A 4H0LC 2O2LD 1BNZA 2KQ4X 4F8MA 4X3TA 3BVGA 2I2YA 4B9WA 3AMZA 4HSVA 2KA7A 1ZUD2 2VZKB 2M00A 5HURA 2MPMA 1NCVA 4PV1C 1U4PA 3MXGA 5AUKA 2KOLA 4N59A 2LJIA 1A70A 5BN3A 2NYZD 2WDVB 1MSHA 3KLSX 1NI3A 1V1PA 3Q8FA 5BYSA 1YNJC 1KABA 3HZXA 4DAVA 4A3IB 3TUOA 3N6RA 3IKJA 2XRSD 3A7AB 1A2TA 1EZ6A 3N9YC 3SE0A 2H4OA 1FM0D 4AYBB 3WOEA 4YSZB 1Y69U 2QKIC 1U4MA 3MEHA 2AQ3B 5LL6S 2DYOA 2VNUD 4WFN3 3I4LA 1MD2D 3KLRA 1EIHA 1B50A 4K6DA 1GUWA 2AX5A 3BDOA 2ZW1A 1RFKA 2MJ8A 1EIGA 1T5XD 2R6GA 1GUTA 4ABNA 3NS1A 1LTSD 1PFBA 1YJIA 3LB8C 2B2VA 3N52A 3D4RA 2F0PA 2F0WA 1SDFA 2A5HA 2EXZA 4C7YA 3T13A 2HCIA 3TMEA 2N55A 4MM3B 5G5HA 2DNEA 2N7JA 3TP7A 4XT3B 1E7PB 5D65A 1F2LA 1VRAB 3I57A 3U9OA 2QMTA 1PZJD 3AU7A 3C46A 3GTGB 1SE2A 4RGMA 3WDNA 1JQ4A 2KN4A 4LMQD 5KIXA 1XEEA 2FMCA 4ZAIA 1N60A 1L5PA 3AE6B 4NMZA 2IW3A 3K57A 1IGCA 3AECB 4BY1B 1IBXB 4RWSC 5EPLA 1CZPA 1TYGB 2ICIA 1WTQA 2OXPA 5KNBA 2F1MA 4ZRQA 1U4LA 3MWYW 2MP1A 3NK9A 3GB1A 1NVID 4KX6B 2FBWB 1F2RC 4KK7A 3OIQA 4FF2A 1A2UA 2R7ZB 2PW9A 1HTPA 3P20A 3J7AF 2Y3AA 3MAQA 1EY5A 4R3DA 1SNMA 2LS01 3TP8A 4EQPA 3FPUB 4IDIA 5ELCA 4KN4C 1BUVT 3S9WA 3AE5B 2PYKA 1WCMB 1R4PB 3V3XA 2PZTA 2JQRB 4ITKA 3GTPB 1A3TA 1HFGA 3CQZB 1R9TB 4HKZE 3I4MB 1NR2A 5T8IA 5IOCA 4HAEA 1WD0A 5A2QE 1FEHA 3CU7A 1IKMA 2ON8A 1F2ZA 5I2YA 1EYCA 5I4DA 3SHLA 1ML0D 3BZDB 1FFVA 4YWGG 1SJED 5FOBB 4KTAA 3AE7B 2EJGC 2MEKA 2A68D 4C3HB 1NEKB 1BF4A 1UWXA 3FAHA 4TSSA 3A8IE 4O1NA 2EVBA 2BYTA 1DCZA 4DK0A 4OGQC 2ACZB 2KACA 2BB5A 2EZVA 2JXTA 3OWEB 2WXMA 2FE8A 2QEJC 3A7LA 4Y7NB 4GDLB 2JYOA 1WTPA 2WXKA 5C3WA 1BO0A 3RUZA 1D5ZC 1HA6A 5DAUA 1PFNA 1CA6A 3HRZC 3DEOA 2K1BA 1Y8NB 4TQ1A 4RHRA 3KWLA 3DWGC 1GHJA 1AEXA 2F0UA 1H9RA 2K3UA 3NSWA 3UI3A 1TWHB 1A3UA 4K8IA 3GD7A 5J39A 2O5JC 4HR7B 4WRDA 2EDGA 2C5CA 4RA8A 1XLOA 1I6HB 3SFDB 1EOTA 3QB3A 1DM0B 2BBCA 4USAA 4RF1A 2W3RA 4JBWA 1OXVA 1E10A 2V3NA 3E6ZX 3NWSA 2G1EA 5M9OA 3DHQA 1Q10A 1F9QA 1IBXA 1Q1EA 3IXSA 2DY7A 3QIAA 5JOBA 2F03A 2WKCA 4PNYA 1MHHE 1S5DD 1XCTL 3LNNA 1AZPA 1RDPD 2XN9C 1A3VA 4KKSA 3K6OA 1XX8A 2J7ZA 1XF5L 2OF1A 1SYCA 4ZKCB 4DAYA 2WXHA 2WIIB 4ARIA 2X6GA 4OIKA 2JSOA 2E3TA 2F0IA 2B2YC 3VR4A 3FPPA 2B39A 5J1ZA 3AE3B 1B9MA 3DXJC 1VZ6A 5CV9A 3QG1A 4H44C 2AQ2B 4ZQ3A 4IFDJ 5FLXL 1P7EA 3DMUA 1NSNS 3A54A 1SE4A 1NAPA 3MTSA 3LWUA 4J1MA 3AEDB 1C48A 1SYGA 1WRIA 3RD4A 3T3NA 4QIWB 2E2IB 3PZ7A 1SYEA 1YN3A 5K36H 1Y8PB 3WCQA 1LTBD 2IDYA 4A3GB 1GOZA 5LL6X 1E6EB 3CWIA 1JMLA 1ZYRC 1S4ZA 1YN5A 2PO4A 1ZOYB 2DWQA 1AFPA 2JYEA 2JZPA 5JEAJ 4ZYSA 1LV9A 3NWTA 2F0SA 2M0AA 4NAMA 3PIP3 2J53A 1VJKA 1XTCD 1T5EA 1ROEA 2RDGA 3TP5A 5TSSA 3QJYA 3H3VC 1EY7A 2ZXRA 3AV8A 4X3KA 1LLRD 1LT5D 1I4PA 1BCPC 5CYUA 3RLFA 1GUOA 1G291 2DN8A 1TT2A 3C1FA 5IGEA 4XWWA 5JVH3 4XIGS 5BMIA 1QCBD 3ERQA 1HUMA 3U2SC 1EY9A 5BMGA 2SDFA 2O4XA 2EY6A 4CJ2C 5COYA 4DNTB 2B2WA 2EYMA 5EBDA 1TS4A 1N61A 4WAFA 3GP7A 2X38A 1PTOB 1JWBD 3AE8B 2QILA 2CW0C 1L4ZB 1XXGA 2WU2B 1FYCA 3DUZA 3K5MA 4EGVA 1X3PA 5E1FA 4B08A 3GV6A 4US9A 2IPKD 1UWMA 3NTHA 5ELFA 3OMCA 3IAYA 1GB4A 2JA6B 2NN6I 2PVGC 1SSNA 2KAJA 3G6JB 4NZLB 4HMIA 3S1NB 3IT4B 1QOHA 2JXMB 2PMZB 1NR4A 1ESFA 4RF0A 1PZID 1ZXTA 1EZ8A 3SK6A 4YSYB 2A74C 3PZ8A 3HUIA 4NDXA 1V1PB 2WNMA 1PMRA 5FO8B 3S1RB 3DEPA 1O78A 4KJOA 5FKAC 1I4GA 5HFYA 1HXYD 1LTRD 1TKWB 1KFYB 2RVLA 2IWHA 4G7HC 2KEDA 1EU4A 1TWFB 5C4XB 3MFGA 2Z1CA 1ACCA 2LFIA 1HQMC 4U673 2E2JB 2FJ2A 3MFYA 1PTOF 1KTKA 5FO7B 2NVYB 5H92C 4FXGC 1C76A 2WXFA 4KKUA 3M3YB 5J22A 1TIID 4XQNA 3H0GB 2F0DA 3H6MA 2G9DA 4K2LA 5KYLA 4K2KA 2Q8TA 2Y5PA 2DBYA 2VZKD 3SR6A 2WXPA 1IKLA 3LWEA 4NKLA 5M3MB 1I4HA 4CKBA 3VYUA 1TS3A 3IAM1 4K5VA 2K5PA 3Q8BA 1EY0A 3TEZA 4KGSA 4A3BB 4C1NK 2K32A 5C4JB 2W55A 3KBXA 1PRTB 5C0XI 5D3IB 3KWVA 4PT5A 1G91A 3LYYA 1O7YA 1VCIA 5M5YB 5D7GA 3FILA 4EQOA 1HUNA 2EE1A 4X3UA 1GJXA 1OXTA 1CQVA 2KVMA 2AWOA 4JX1C 4DGZA 1C4AA 4IFDG 3LXFA 2KQ3A 2L1AA 2NB0A 1PFMA 2ENBA 5E3FA 1O7ZA 4YXDB 5E6JA 1S5FD 5IT9E 2IGGA 1CQFA 2J0TD 3BYYB 1WTXA 4RKBA 1QE6A 3HKZB 1FXAA 1TU2B 3CIRB 2F0QA 4KI0A 2YEPB 1CM9A 2GA4B 4D2KA 2B76B 3VRAB 4RHSA 4IQZA 4A3MB 1L0YB 3HOVB 1STEA 3J80L 1FNUA 1KRHA 2Q8IB 2E6XA 5LHY1 1CJEA 2R93B 1DOXA 3GO5A 3U7ZA 1RODA 2HDLA 5KYIA 2N0SB 2B2YA 5JEAG 1CT1D 4ZRPA 1EFID 1LT4D 2SOBA 3D31A 1FRRA 2Y0SB 2LHEA 5IODA 3T3OA 2GRIA 3TEXA 2SEBD 2BA1A 2BE5D 2QSDA 3NRZA 1OXUA 3C2PA 4YT0B 2PKOA 1UUPA 2A69C 2D5DA 3OHXC 5C3XA 1HZ5A 4EQNA 1FO4A 2LMCA 1I50B 5CV6A 2WXIA 3HVZA 3HRDD 4HJGE 4R8IA 5JJZA 2M56B 1DGJA 3D6WA 4KGTA 1CI3M 3Q8CA 1PRTF 2QIEB 3TDQA 1U9RA 2K5QA 2L32A 4DXFA 1VR9A 3J9CA 2F0NA 1MI2A 2OT2A 3I4NB 2NN6H 3S2DB 4P2CB 3HOYB 1BBXC 1PGXA 4KKTA 1RWSA 1PZKD 2WP9B 2WAQB 1ENCA 4OW0A 2PVOD 1X3QA 1B9RA 2XIWA 1D5XC 2K03A 4TQ0A 2F4IA 4KN7C 4RAUC 1JOOA 3NXWA 4HN7A 2YEPF 2F0EA 3Q6SA 2IT1A 2ZXPA 4A93B 5KGUA 1SEBD 3SVMA 4DNRB 2MH7A 3KLSA 1EY4A 1K8MA 2INPE 2PZUA 3ETRA 1H9SA 1TKYA 1GPXA 2SAKA 1F9SA 2EY1A 4K8JA 5HGTA 2E76C 2M9VA 2F0HA 3D4DA 3TP6A 4GLSC 3H09A 3NP8A 3S15B 3L3OC 4JWSC 1NENB 3HOZB 2V3PA 3NVZA 1LT3D 3KF8A 4JE3B 2H88B 1J8IA 1W6KA 1MVKA 2F0VA 2EJMA 3ZJVA 1YNNC 2B2TC 3BWUD 4WWMA 1Y8OB 5FLXE 1VDVA 4A8XC 1EEID 5H8YE 3OSOA 3VR8B 2E75C 1Z6HA 2BS3B 5HI1A 2A6HD 3DWPA 2JEBI 4A90A 3QO2A 4OIJA 3EA6A 4FF3A 3Q69A 1JALA 2WACA 2TMPA 5ELDA 1B3AA 3JAME 1B44D 2INNE 2JWUA 1KDAA 2HCCA 4CBVA 3MXUA 1G2TA 1QKZA 2R61A 4DFAA 5C0XH 5EKIA 3EVQA 3J81L 4OO1I 4AQ7A 4L8JA 2I07B 3ZQ4A 3AN1A 3AM9A 4KMUC 4ULLA 2IX3A 1SIJA 4N9PA 2JA5B 4YTMB 3H8HA 1TY0A 2WDRB 1GB1A 1N5XA 4XDXA 4US8A 3MA2B 5C6AA 2B2UC 3PIO3 1Y1WB 2MJEA 4TRDA 5EBCA 2J42A 3W2DA 1S5BD 3I72A 3AEFB 1DZ1A 1CTMA 1XLPA 4LK0M 1F9PA 1TZOA 3EQLC 4RGOS 3AE9B 2AUKA 2F0GA 2NZ1D 4IKGA 1FRDA 3UI2A 3M4OB 1JCKB 4PMCA 1ZP0B 5KEEA 5C44B 3I90A 2L55A 1EL0A 1N5WA 1R7SA 2IJ0A 3V05A 3PV0A 1JB3A 1UGJA 1JRPA 2K01A 4MN3A 1I6VC 1MHXA 4QMGA 4UDUC 4ZLTF 3SK8A 2H89B 2FHTA 1YQ4B 1S5CD 1OXXK 2NBFA 3CKIB 4QUFA 1VMPA 4GZYC 1Z7TA 2CJOA 4M8AA 4FXKC 3PUWA 3ABVB 3O13A 3EFXD 3F2UA 2N9KA 1RCVD 5T1GA 3ND8A 2GB1A 4ZOHC 1I4XA 3LX0A 2IGDA 1FFUA 4A3EB 5CGKA 2E2HB 1AZQA 4IUNA 1NUCA 3SK5A 1HA5A 1MI0A 2L52A 4WORA 2N9LA 3S2HB 4LJZC 4P16A 3S17B 2CJNA 2ONQA 3HOXB 2A68C 1QOFA 1Q3LA 3PUVA 3B2FA 1DOYA 3NE5B 1RYJA 1DOKA 5EJWA 4C7ZA 3T4AC 5BN4A 4QB4A 1JWAD 3GQBA 1JW9D 4OZAA 1I4RA 3HP3A 3NUHB 3A55A 5EQ0A 3BIID 5KRUA 1GAQB 1Y1VB 4L1BA 3B9JA 3HVDA 1YQ3B 5IGGA 5DEHA 5I6WA 2LEKA 1EM7A 1FD6A 2CVRA 3MHZA 5AUIA 2WXJA 1TJEA 3DWAA 1K50A 1TR5A 2PW7A 2WXOA 3VA7A 2DNCA 3R2TA 3CRLC 3VA5A 1KAAA 2FMMA 1RTOA 3PUYA 4C3JG 5IGBA 2EYJA 2ZW0A 1XYIA 2JA7B 5HG2A 4TKOB 4X3SA 3B2GA 2W82A 1VZ7A 4MH8A 3OOCA 2FINB 4IOIE 5ELBA 1F9RA 1SNPA