1I4XA

Staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 72
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4xA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4xA02
1PYWD 1UNSA 2R61A 2J4XA 1CHQD 4OHJA 3BYYB 1YN4A 1LTSD 1S5BD 5ELDA 2NTSA 1LT3D 1HA5A 1TS3A 2XRQD 5ELBA 5FK9C 1EFID 1EWCA 1AN8A 1EU3A 1D5ZC 1BCPB 3DWAA 3EFXD 1QILA 1LT5D 1TS2A 5D3IB 3R2TA 4NZLB 1D6EC 2XRSD 3URYA 1V1PA 1STEA 5FKAC 3V05A 1MD2D 1CT1D 2G9HD 1V1PB 3TSSA 3CHBD 1RCVD 1PZID 1LTGD 3DWPA 3O13A 4DXGA 1LTRD 4K6LA 1FNUA 1L0YB 3R8BA 1JWMD 4BWGB 1SJHD 1GOZA 2Z8LA 1EU4A 1JWUD 1M4VA 4DXFA 1SJED 4L6TB 1TY2A 1I4GA 1ET6A 1I4QA 1S5FD 1LO5D 1TY0A 4O1NA 1EEID 1LLRD 1S5DD 3BYTB 3EA6A 1V1OA 2CHBD 1KTKA 1BXTA 5ELCA 1PTOF 3MFGA 4L63B 1HTLD 1FNWA 1LTID 1TS4A 2XN9C 3KLSX 3OWEB 3R2IA 2QILA 1PTOD 1PZJD 1CHPD 1B44D 1PRTD 1ET9A 4UDUC 1SEBD 3SEBA 4C56C 1BCPD 1CQVA 2RDGA 1FNVA 1PTOH 1SBBB 4RGTA 1SE3A 2QEJC 1LT4D 4RGOS 1AW7A 1I4HA 1LTTD 1PZKD 1I4XA 2WV6D 5D3DA 4RHRA 1DJRD 1PTOC 1S5CD 1PRTC 1RDPD 1EEFD 1KLGD 1TS5A 1XXGA 4ZYSA 5TSSA 2IJ0A 2AQ3B 1JR0D 1XTCD 4RH6A 5ELEA 3DWQA 1FD7D 1FGBD 1ENFA 1CK1A 4RHSA 1PRTF 1D5XC 1LTAD 2IPKD 2RDHA 4RFBA 5I4DA 1BCPF 1SE2A 3BVZA 1F77A 1HQRD 3BVMA 1B1ZA 1JCKB 4Z9CB 1UUPA 1G8ZD 3GP7A 1D5MC 1LTBD 4RGNA 1YN3A 5ELFA 1JQYD 1SXTA 1PTOB 2XNAC 4RGMA 3W2DA 1KLUD 3MC0B 4TSSA 1PRTB 1RD9D 1T5XD 1BCPC 1DYQA 1I4RA 1ESFA 1JWSD 2AQ1B 3BZDB 2TSSA 1YN5A 2O2LD 1L0XB 2AQ2B 1LT6D 2ICIA 1HXYD 1S5ED 3BVGA 1RF2D 2NTTA 4RCOA 1I4PA 2SEBD 1SE4A
chains in the Genus database with same CATH superfamily
4GNXB 2MP2B 2RMMA 2FUG1 4M02A 3ZGZA 4PZ7A 3VHTC 1CHQD 3W5VB 3I4NG 2BCOA 1FIQA 1K51A 3QC8B 3NPPA 1LTSD 1PFSA 3R93A 2G45B 1HZ9A 4DUYQ 2MBQA 4HDQA 2PE6B 4ZCKA 2BYVE 3D3RA 2HJ8A 2NR2A 2CKHB 2BA0A 3DHGC 1X3PA 1TWHB 2VB3X 3V62A 4ILWA 1MJCA 2O4XA 3EROA 5M3FH 3TRZA 1PQSA 4REZA 1WTOA 2C9OA 3TL5A 3HOUB 4MNOA 2ZXRA 1FCLA 2MX2A 2CWAA 1WMHA 2MRPA 3J80i 3QJYA 3T16A 1PZID 1BVSA 4W9JA 2OJWA 4BOSC 3PTFC 2MO0A 4CJ2C 3PZDA 3A8JE 1G2SA 2JWUA 1HTQA 1Y8PB 3SXHA 3H91A 5JJIA 2GVBA 3IFWB 4EEWA 2KWDA 4JI8L 1K8RB 2IBIB 1ZGUB 3NP8A 3BYTB 5IO9A 1V1OA 4YTNB 2E6XA 3OPOA 2J53A 3N1YC 4YHHQ 4B0EA 5M3MH 4DGZA 4GGQA 2XSCA 2P5ZX 2FCMA 4JI0L 1PTOD 2A19A 1OQRA 4II2B 2M8SA 3VUYA 1Q86C 2KFKB 4C56C 2CQOA 3Q0AA 2LFNA 1YD8U 3KLWA 4RGTA 4OX9L 2FXQA 4BBSH 3WAOA 4MSMB 1A6XA 2WV6D 1HPCA 4JK1C 4QL5A 1S5CD 4RHRA 1QOBA 1EF1A 2DYMA 2JVCA 3VYTA 3UQAA 1PRTC 2F0NA 4J1MA 3F2CA 1YQBA 4ZYNA 1TWGH 1GHKA 3UQBA 2SNMA 1E6EB 1QWYA 3A5UA 3GTGB 5IAAC 3BDCA 1VQMA 4GSWA 1FGBD 2VZAA 4RHSA 4JI4Q 1YQ4B 1LTAD 1FJGQ 2IPKD 4NKLA 1KJTA 5AFWA 3KDFA 3AU4A 2GA4B 2ZEQA 5G2NA 5M3MB 3S1QH 1U5KA 1J7AA 3SGIA 4N6EB 1ESRA 4Z9CB 4PMWA 3VR6A 1DONA 1XPUA 2LVPA 3BWUD 1ROEA 1ILPA 1YN3A 2XK5B 2B2TC 3ALBA 3FILB 1Z47A 1WD0A 2L0CA 2KVRA 3DHHC 5CHWA 3AE6B 1Z7TA 1RL2A 4A3FH 4BBSB 3RD4A 2C9WB 4R8NA 2CHZA 3FP9A 3RYTA 4KD3A 4LFAQ 3M4OH 4X6AH 1VRAB 1I4RA 1MVKA 3IFDA 1P8LA 1WRIA 2KDFB 1SYDA 3PRPB 5EE1A 4GOCA 1TWGB 4MTKA 5JJZA 1L6UA 2B76B 3ZJUA 4FLHA 1U0LA 4OONA 2DZMA 2KQ7A 5FLMH 5D65A 1QF6A 1U9RA 2K5DA 3CRKC 3NVYA 1TU2B 4MJSB 4HWIB 1XCQL 2AX5A 2K8BA 4W9DA 3WA0A 3U2SC 2MW5A 3PT2B 1EQTA 4K5WA 1FXAA 2KTRA 2OWOA 1E24A 2HTHA 4ZHOA 2D2CC 2JYTA 5G3LF 4YL8A 2ZCBA 3S1QB 3FMCA 1ZOYB 4ZDVA 2NZHA 2ON8A 2WQYB 1CSQA 3PHXB 3HOYB 2JT4B 3O65B 4YCVA 5ELBA 4MGZE 4RG1A 1E2VA 2J52A 5BN3A 3LWUA 3DWAA 3L2PA 1IBMQ 1NEKB 5K5PA 1JT8A 5D3IB 2LD9A 4G3XB 3U8ZA 3KF6A 4WWOA 2NVTH 4A3FB 2RD0A 1KAAA 4K3CA 2FFKB 1G91A 2OF1A 1QCBD 1NYQA 3PUXA 3IT6B 2ASQA 4PK1A 4HJ7A 3ICEA 2LRWA 4GN1A 4IOAA 3AE7B 4DDID 4DAYA 1K83H 3C3LA 2BDOA 2Y0SB 4II3B 4EZKA 3ZNID 1S1QB 3PUYA 4KI0A 1B50A 3L0OA 1IP9A 2ZTCA 4MHEA 1EOTA 1KF6B 4RWSC 4ZHPA 5M5WH 2F4VQ 4ARCA 4GXBA 3H6MA 4DWFA 1WZ0A 1PV4A 3RLNA 1KTKA 1HUMA 1B7YB 1GC7A 1XMQL 4HMIA 1J7BA 2K01A 4X62Q 3U4VA 1UE1A 1GO3E 4ULLA 5C0XJ 5LMNW 1OEYA 3M3YH 1EY5A 2NVTB 2AKWB 3K81C 4DK0A 2XTIA 3Q3MC 4JX1C 2KECA 2KDEB 2MJDA 1VCIA 4AH6A 4A3DH 3T51B 3K7AB 5AZHA 5ELNA 4C3HH 2IDYA 4X66L 3OTOQ 4XQNA 3OMCA 1WE7A 1AE3A 1BMLC 2N9EB 4W9CA 1PTOC 3K59A 1ZPSA 1JC7A 4DR2Q 2LMCA 1RDPD 1EWYC 1STYA 4YCWA 4CDCC 5FLXL 4LF6L 3Q8DA 1C4QA 1WR1A 3Q8BA 4DV0Q 1VQ6A 1GHJA 2PO4A 2C5LC 4P16A 1M94A 4RMAA 3CKIB 4LMQD 3V61A 4LF8L 3UINB 5ELEA 5M5WB 1S3OA 3J7A5 3PLUA 1EYGA 1UEAB 4CHKA 3K0XA 1ZKHA 5E6NA 1E0BA 4A3KG 2D3GA 3KUPA 3Q8FA 3QO2A 1VQEA 4PQXA 3OIQA 1PMRA 5JEAG 3NZ3A 3GB1A 2AL3A 4GNXC 3LB8C 1EY6A 5JOBA 2PQAB 4A3MB 2O5JC 3UDXA 2O6VB 5GADC 1I94L 1SN8A 4QUFA 1P7EA 3HOZH 1Y1VB 3Q3JA 3TREA 1UEBA 3TP5A 5G5HA 4H02A 1EL0A 4A3DB 4F7XA 1SIFA 4APVA 4GDKB 4ACFA 1RFAA 4JBMA 1T5XD 5IGDA 2K8CA 5C44G 3NENA 1Y69U 1EQQA 1PHJA 3H3VI 1GUAB 2JPHA 1WGDA 2MBBB 2RDBC 4JG2A 4B9WA 4BY7B 1MGSA 1I50B 2XVSA 5IYBH 1YNNC 5HY6A 5C2TB 4FXGC 3NTHA 2AWTA 3I72A 1A63A 4W9LA 2A69C 1WWTA 3S2AA 5JVH3 3PF4A 4B9KA 3E9IA 3PO2H 4K3BA 2BYTA 4EQ5A 3MHZA 3FKIG 3VXWA 4OIKA 1O7IA 2KHSA 4XC2A 5I2XA 1I42A 2K05A 2WINB 2RA4A 2F0JA 2NCNA 1WJ4A 4LF4Q 3P2BA 1B70B 4UP9A 5IA7A 2J7QB 4LUOA 1TT2A 2F0TA 2KKCA 1D5ZC 1VQBA 3EFXD 2PMZB 5AJ3L 4XIGS 2LHEA 2KDBA 3BJUA 3B1LX 2AYOB 1TIFA 4NJ6A 3S16H 2YYZA 3S2HB 2VH1A 1XLNA 1VQAA 4CYEA 4XYQA 2NVYB 2B29A 3U7ZA 2M17A 3U52E 2B2VC 4CDDC 3TQYA 1JQ4A 3OSOA 3A55A 1M4VA 1YVCA 1D8LA 4L6TB 3HOUG 4JOIC 2OTLA 4FJYA 4Q2JA 4N8FA 4A3CG 1VZ7A 1X54A 2J0MA 1DOYA 1LO5D 5JPMC 3J81E 4B3RQ 4LF7Q 2KD0A 3WAMA 5EBCA 3ECIA 3EA6A 2KN5A 3L7ZC 3VR2A 4DNIA 2UUBQ 3QAQA 4OL7A 2Z0DB 2O6VD 5M5YB 1E1TA 1SMXA 1XLQA 5L83A 2K39A 1TT5B 4KIKA 3U9SA 1YI2A 3I5JC 4WJ3M 4DQOC 3S17B 1RRBA 3NWTA 1Y8OB 1VQIA 4WJQA 3S16B 1KH0A 3GOEA 4AJWA 3Q69A 4E3CA 4FJVB 1AE2A 3ZLZA 1XPRA 1GD7A 4FXCA 1VZ6A 4IUUA 1WYDA 1EM7A 1NI2A 1HZBA 4GLVB 3HVDA 3QQ8B 2N9XA 5EE0A 1KNAA 3R66C 2GLSA 3H3VC 2Q2UA 3DBHI 3UDFA 4K14A 1IHZA 1VR9A 4OXPA 2ONQA 1ASZA 4EQPA 2UXCQ 2D3AA 2VZKB 1A3VA 3N20C 1FD7D 3AV8A 5BO4B 1ENFA 1CK1A 1QVFA 2MHJA 1LABA 3OMGA 2V3SA 2JK8A 2XGTA 1FPYA 3EBEA 2HD3A 3KWVA 1PFNA 3I3CA 3SVMA 3J7ZC 3F2BA 2MNAA 1N9WA 2HT1A 1LXDA 3DWMA 3S1MH 2N7JA 5H92C 3A0JA 5BYSA 2H1EA 3E9SA 3JC66 1O78A 1I6HH 1PUTA 4XE0A 4X64L 5C4HA 1PFDA 2K04A 3DCGA 3NQIA 2WP9B 2YEPB 3PZ7A 1QOHA 4BFRA 4XZ4A 5IP4D 5M3MG 4A3EH 3KK7A 1XX8A 1T9HA 4US9A 1WSPA 3RPFC 3KYHC 5CR3A 2JE6I 5JAVA 4C80A 3ND8A 4P75A 3BZDB 2VXWA 4DR5L 1Y1WB 1I7HA 4DBGA 3I4NH 1D7QA 2PVGC 3IVFA 4OVVA 4C4VA 2LI5A 2LUMA 5FO7B 2XWBB 2ACZB 1H9JA 2CCZA 2L15A 3S15B 4LWCA 1VQFA 3RNUA 1B8AA 3PO0A 1E8XA 3JSVB 4WJOA 1MJDA 1RF2D 2L1BA 3AN1A 1I4PA 2J0JA 2N78A 2OHFA 2NS5A 5E7NA 2CHXA 3KLSA 2DNFA 4DHZE 4O0AA 5C4JH 4OHJA 3R7RA 4V190 4AOFA 1MSGA 5BN5A 1F9RA 4PMCA 4CKEA 2R7ZH 3D0FA 4LFCL 1YN4A 1WGKA 3EFUA 4J3OD 5E4WC 1QOAA 2BKRB 2HQEA 3NEMA 2D9UA 3DXJC 4A3EB 4EQOA 1GUSA 4MELA 4NZLB 2PKOA 1IYUA 4IDIA 1QZEA 3HOYG 3AULA 1V1PA 1PYSB 1STEA 1XF5L 1Q1OA 3C8YA 3VA7A 3VTWA 4WWPA 3L54A 2O5IC 1W6JA 4ME3A 2UUCL 4FULA 4A3FG 1PH6A 1LTGD 2C60A 4KVGB 3AE4B 5EAYA 4K6LA 3A5ZB 4GKJL 1SB3C 1N5XA 3V3XA 3W9CB 2WKDA 3K5LA 2WU5B 1GUTA 3BY4B 5J1ZA 5KYIA 4IJHA 5CV9A 1YJNA 3J9CA 1SJED 2KTFA 4TUUA 1ET6A 2F0SA 3TS2A 2MLBA 4O1NA 2Y0SG 3Q8CA 2K5WA 2DZIA 3GTJB 2R7ZB 2B2YA 1CI3M 4EX5A 1HNWQ 4N58A 3VAWA 1VQKA 1NMFA 2ZPNA 2HD5B 3H6NA 4POGA 1SLJA 5A2QL 1UBQA 2JSVX 2M56B 2B39A 1HE8A 4A93H 3WDNA 2F3WA 1IBLL 4LF5L 1V8CA 4JIOU 2PCFB 3D4RA 5IT9L 3G7LA 1VQHA 2M2LA 4IZ8A 1AFPA 2RVLA 3SR6A 4K8JA 3SK4A 3HOVB 3CCQA 4CDEC 1L5PA 2L83A 2MA9B 5C0XG 5M5XH 3DMUA 4IOIE 5DPRA 1N62A 4G50A 1EIHA 3HRDD 2WAQE 2NBUA 1XPOA 1E5WA 4IN3A 3MJWA 2OXPA 3CCVA 2JF5A 4M0WB 1EIGA 1RWSA 5IKCM 1CA5A 4RF0A 2H89B 2RPQA 1VLBA 1U4MA 2NVQH 5DAUA 1D1KA 4CGYB 5C3WA 2MJEA 2HIVA 4HK2A 2RCFA 3QOLA 4ID6A 2LKVA 1ACCA 2B2TA 1K8GA 4DV7L 3A4SC 1CKOA 3FPPA 4XX5A 2RPVA 1T5EA 1QVCA 4C2MH 5CYUA 2OT2A 4HIKA 1EO6A 4A93B 5BYRA 1MHWC 1JQYD 1KLVA 1L4DB 1GNUA 1UZXB 2ZPYA 3CC4A 2FHTA 4WRDA 3J80c 1SYEA 2Z4HA 2B8FA 5F2DA 1ENCA 3OW2A 4A3MG 2F0HA 3NY5A 1WE6A 2RSOA 3QR8A 4ZOHC 1BR9A 5M5XB 4LJPB 3QWNA 1Y1VG 3RZOH 2ZNVB 1L0XB 2E5LL 1MPEA 1LT6D 1MKHA 4A3DG 2NB0A 3OJ3A 1UWVA 4DNRB 2Z0EB 2D3CA 3TN2A 4LFBQ 1VCBA 3K9OB 3TZDA 3PRZA 4WIPA 5JHBA 2AHOB 4KN4C 1XEEA 4R4OA 2NVUI 3E0EA 5BR8L 3IRBA 1EUJA 4BY7G 2NVQB 3N1XC 4G11A 4QGUA 2UUAQ 5LMNL 1KRHA 1T0SC 3RLOA 1CKMA 1H4RA 4A3OA 1L1OB 3ML9A 2JA6B 2GBNA 1HR0W 3TUOA 2IHEA 4F1SA 2IO3B 2Z6KA 4NXNQ 2WXLA 4HPPA 1BCPB 4IFDJ 3D8GA 3UIOB 3BK1A 2K14A 4AQYQ 2G1EA 1SGHA 5J3BA 3IAM1 4JI2L 1FFUA 2QA4A 2NPTA 2WGSA 4BKSD 3RZOB 1UD7A 2PZUA 3DBRI 3N30A 3SFDB 3RCZA 2AUKA 3TSSA 2EY2A 2JWZA 2IL8A 3I9V1 3PO3H 4GMVA 4ANWA 1HTOA 4NB3A 2J0KA 2UU9L 2O2VB 3LDZE 1FNUA 1RTOA 1L6VA 1TVXA 4BY1G 3Q2AC 1FL0A 2RHSB 3JAML 3NZSA 4X3SA 1E7UA 4YWMA 1SNMA 2F0FA 4B3MQ 2R93H 1N60A 2EPBA 1V86A 2FAZA 3K8AA 2MH7A 1WXAA 2EOTA 4KY5A 4X65L 1WXVA 2LVOA 3PPAA 3DQVA 5CX3A 4XXEA 2N7EA 4MDKE 2MO1A 2X6GA 4Y52H 3RN9C 1L0WA 3APDA 4K7SA 1I94Q 2KLGA 2VQEQ 5H8YE 3I4OA 3AE3B 3NOBA 1PZJD 3GV6A 4IUVA 4HCNB 2KEEA 5DM73 1J6QA 1HZAA 4X3KA 2D11A 4PG3A 3ZDTA 1O7ZA 2PTLA 2HQLA 2A73B 3LXFA 4MM3B 5CHFA 1IBKQ 3GS2A 3AMZA 3PO3B 3H7SA 4A3KH 2MJ3A 3DLLA 1G291 5JEAH 3AFPA 2R93B 4DR1L 3K58A 1UBIA 3RUZA 1DOIA 4BKTA 4QAYA 3SU8X 3NRZA 1V81A 1SE8A 3PS6A 2EQSA 1V97A 2A4ZA 2DYOA 1BNZA 2I5LX 5KHOA 2IY1B 1C48A 3AB9A 2JN4A 4I7AA 1E90A 2IGDA 2K4KA 4JBWA 4HCEA 3H0GH 3UE1A 3GTPH 1KXLA 4GKKL 1N32Q 3T53B 4KKJA 1Q90A 5ELFA 1I35A 1E1OA 4RGMA 5G3LD 3W2DA 1G6PA 2DAJA 1GVPA 3M3JA 2YTYA 4L23A 1RD9D 2ZVOA 1WM2A 4PYZA 3PCOB 1TKYA 4FF1A 3VFKA 2A6HD 2ZXPA 1H95A 2WXGA 2Y5BB 2K5PA 4NPNA 3EIVA 1KRTA 3RZWC 3DBSA 3FKIH 3W1GA 4NW2A 3U9OA 4DK5A 2AQ2B 4KV6A 5IIFA 4F88A 2BWFA 3TEYA 1FVIA 2BA1A 1YJIA 2K1FA 3MA2B 3FKYA 2N8NA 1GAQB 4ALPA 4LNOA 1Y1WG 2KX3A 4TQ1A 3ZDMC 2KCCA 2R3ZA 2SEBD 1PH7A 1QZGA 1XNQL 1HNZQ 2K5HA 5LMUL 1UNSA 2ZM6L 2PPHA 4IPGA 3VDYA 1WJJA 3HOWH 1QLBB 3BYYB 3H0GB 1HA6A 4IW0A 3J81L 1EZ6A 2F0DA 1MG4A 4ITKA 1TYGB 2NTSA 2KDIA 4UY8C 2XRQD 4ZUJA 1UELA 5EDSA 3X0WA 5FO8B 4GLAC 4A76A 5C1ZA 4AIMA 3A8KE 2I5MX 1C79A 2EYJA 1VDVA 4DR6L 3HOUH 3ZYYX 3CSFA 1WR6E 3K5OA 2IZVB 1RFKA 4IFDI 4A3CH 2B2WC 1A3TA 2QEXA 1KC8C 3MXNA 4OEMB 2XWJB 2W54A 2F0KA 4IJLA 3O13A 4DR4L 2F0PA 1ONLA 1MJEA 4DV6L 4IOCA 5EKKA 2ZCCA 1TZOA 1NUCA 1UWMA 4M8NA 3RT3B 4L5SA 1X9NA 4IURA 3HUIA 1VQ7A 1N36Q 3I56A 3H8HA 2PLPA 3HOWB 4RF1A 1LACA 1VF5C 1EF5A 2QHOA 3NSWA 2Q8TA 3G4SA 1C4AA 1PGBA 2ZTEA 4E74A 2CW0D 2EY5A 2KJ6A 4IPDA 3CCEA 4KDIC 4NY0A 4ZRZA 3OHXC 5JVG3 1BO0A 1ET9A 1ZYRD 1WFQA 2R7ZG 4ZRJA 4POFA 4DV1L 2JYEA 1TXYA 3BDOA 3DEOA 2F3VA 4F8CB 1CKNB 2QEJC 1E7VA 2D62A 1NE3A 3MEHA 2KMMA 4JYAL 1B3AA 1EYDA 2MP1A 3HFZB 2Q2IA 1YIWA 1WIAA 4NP5A 1N63A 5E6JA 1WTXA 2JA9A 1D2BA 1N6ZA 3GTGH 3TZUA 2ZXOA 4KV2A 1BQQT 3AM9A 1PXUA 4LNNA 3WOFA 4ZRPA 5C3JB 2ZNVC 1BF4A 3NZUA 4C1NK 4ZRKA 5CHVC 3HOVG 2IGGA 1Q8KA 3GDEA 2N9PC 4DV2Q 2KEDA 2ZJQA 1ZW7A 4MJSA 4RA8A 4XGAB 4DV5L 4DV3L 3MZ5A 2PW9A 4K7WA 4BKGA 1SE2A 1GUWA 5CV8A 4LFCQ 4YXDB 1EY4A 2KJXA 1CZWA 4C3IH 5E1FA 5IP9G 3N32A 3T1HQ 4B6WA 3CWIA 2K6AA 1ICWA 4Q0FA 1JWBD 1WX9A 1YNJD 3F1ZA 1UUPA 2FNJB 1NCVA 5C4ZA 3BS1A 2WDQB 4KGRA 1F2RC 2L52A 1L1OC 2XIWA 4R4TA 3H3VH 3NVZA 5FR3A 4DPGA 4DUZL 2E2HH 1F2MA 2WYQA 4YWKA 1B9NA 4RCNA 4YWGG 2N49A 5ISRA 1WI0A 1A70A 1E0ZA 1BCPC 5CBEE 1TGZB 2L05A 3W1BA 1Y8RC 2UU7A 4A93G 2CJOA 3KH0A 4FA6A 1Q3LA 3FPUB 4GKJQ 1ZEQX 3Q8EA 1E8WA 4G0NB 1KIXA 3NELA 4CBVA 5J17A 2DWQA 5KYLA 4KKUA 3CF6E 5LL6X 4ICVA 5AEKB 2IX0A 2A6HC 4ODGA 4JPSA 1FXTB 2OTJA 4XQJA 3Q22A 1N8RC 3NS8A 4JC0A 3KFUA 5CMDA 3HOYH 4TMAB 4CQNA 1VQPA 5EPJA 2KBNA 4C3IB 2I46A 2KK8A 2UXBL 1CMXB 3DVGY 3JAMc 4GIVA 1Q5WB 3W1SC 1IYJB 4EVOA 4LUVA 2VNUD 1HA5A 2WXIA 3D4WA 1EWCA 3W5OA 3H9DA 3M95A 3S24A 3UIPB 2PW7A 3PV1A 1QILA 1N5WA 3MXPA 2E2HB 3ZNGC 3KUCB 3E6ZX 4QY7A 1D6EC 2JA6G 1G2TA 1HRJA 1WX8A 2WXPA 4NJCA 3VTVA 3ZW3A 2X69A 5HI1A 3RNEC 3V05A 2LASA 1K0RA 4AQ7A 4XWTA 1VD2A 2QKIC 5CV4A 4DN4M 2E3TA 3I73A 2MUYA 2BH2A 1I6VC 4IFDG 1V5OA 1WGGA 3PUZA 3R8BA 3P4PB 1BUIC 1JE5A 2E76C 1WMHB 2L32A 3ZNHB 2W9NA 3FRPB 1STBA 1WI5A 4DAMA 3CC2A 3T8MA 1XLPA 2PW5A 2BF8B 3JW0X 4A3LG 4XDXA 2L7RA 4JV5Q 5KEEA 1B2TA 3T13A 1XQQA 4OW0A 1J19A 5AUKA 3DOWA 3M85A 4A90A 2BYFA 3W1YA 4GN3B 2KWUB 4HROA 3X3MA 3TS0A 4JI1L 1OFFA 5JH5C 1PDQA 4GZYC 1GUGA 2WDTB 3KLSX 5C0XH 3P4QB 3PGEA 1XO3A 1V2YA 1EFWA 4TQ0A 1CHPD 1B44D 1X56A 2HHHQ 3VA5A 3K7AH 1FM0D 3I70A 1YNTE 1XJVA 1GC6A 2BB6A 3MHBA 2RDGA 2EMTA 3VTUA 3N6RA 4GDKA 2CW0C 3DUZA 1XMOL 1AWDA 1NDDA 3T4AC 1IUEA 2YVCA 3QCAA 3TMPB 4JI3L 3OWFA 4B0MA 4FP5D 1ZE3D 5BYQA 3ZQ4A 1CZPA 3CRLC 4MH8A 1ZYRC 1YBYA 2KCTA 1C1YB 1PGXA 1FR3A 3VR5A 1TIID 1NI3A 1NNXA 1XLOA 2Q2HA 3DPDA 3MFYA 4P7IA 1HR0L 3PO3G 4HDOA 1X3GA 4LK1C 3WWVA 1R4PB 1EY7A 3A9KA 3U7DA 1YJ9A 4GN5A 2VW9A 4AUQC 1WXSA 1J0GA 3AECB 4A3MH 1XNRQ 2R93G 4ANXA 2Y5CA 3QB3A 5ELOA 4BOZB 2LVQA 3KJOA 1Y1VH 3KDFB 3SDZA 2FIFA 4GN4B 4X3UA 3K5NA 2KO3A 2LXAA 1NR4A 4MGIE 1LTBD 3U4EG 1G51A 4R4IA 5T1GA 2EE1A 1TBEA 3APCA 2K1BA 3BG3A 1OXTA 1VQ8A 2NBWB 4NXMQ 3MC0B 2F0MA 3J81c 1P3QU 5HGTA 1STAA 2MQHA 1Q1BA 1AYFA 5LNK1 4BY7H 1I50H 3M62B 4E71A 1YN5A 2UU9Q 4DAPA 1WFYA 2L9HA 3B6YA 4TKNA 3AMUA 4B95A 5LXIB 4QQBX 1AZPA 3GTLH 4NAWA 2NTTA 4EFOA 3A9JB 1CQFA 4R4CA 2D0PA 2MJ8A 4HSVA 4WJWA 1GKHA 3EQLC 4JE3B 4YTMB 3H1UA 2MFIA 4XQQA 1TWCH 4FXKC 1H9SB 2V0GA 1K3BC 4TVAB 1WXQA 2A1AA 2E74C 2ZZPB 2BW2A 2BTEA 2JQOA 1JB3A 4KKSA 1Q46A 3ZTCA 1E7PB 1TS2A 4BY1H 2OEDA 3H0GG 4DR3L 3S2HH 1L4ZB 2EELA 3F2DA 4B3SL 3CPFA 1IZ6A 2WXRA 1Z6HA 3KF6B 2NVYH 3NVWA 4HLEA 1DGJA 1MHXA 1HQMC 2C5CA 2UXDL 2OQKA 5JJKA 5IYCG 2BB5A 2IO2B 3GTLB 1JWMD 1OGWA 2IYDB 3K80C 1JWUD 2A6ED 3STBD 2L5TA 4DAYB 2CHWA 3ONSA 1GUOA 4QF4A 2KOXA 5DPSA 4DXFA 1NJIC 3ZTDA 3J80L 1I4GA 3LGJA 2K0PA 2LWPA 3DHIC 3VR8B 3ZXRA 1I4QA 1QNUA 5IYDH 1S5FD 4WURA 1VF7A 4ZRQA 2V4IB 1K52A 4H44C 5M5YH 2JSOA 1W3SA 2K22A 1TWCB 2VL6A 2L3ZA 4W9KA 2CHBD 2EXDA 2LGDA 4N9F4 5IOIA 1PTOF 2B3GA 2CFMA 3S17H 1TS4A 3IHPC 2XN9C 1WJUA 4AS1A 3MC8A 4BY1B 3HOWG 1R7SA 1Z5SB 5GROA 4IPHA 3IAS1 3M7NA 1SBBB 2OQ0A 2K32A 5DPTA 2Q2TA 2EZVA 1WRDB 3ND9A 1A0IA 1N33Q 4DR7L 3PGZA 2LGIA 2ICEC 3RMHA 4F87A 2B2UC 3AE1B 3CSTA 4KHPL 1SDFA 5IOCA 2FBWB 2KMCA 4QUCA 1EQVA 1QUQA 4DKAC 5IGBA 3CXCA 1J7CA 4A55A 1EQRA 2WIIB 3S1RB 2LMCB 4C3JH 1MI0A 4IUNA 2MSED 4RH6A 4KY6A 5LMUQ 2MWSB 4IM0A 3QG1A 1F9QA 2ES2A 2V3PA 3RMKC 2DN8A 1XWEA 2MQJA 4IPCA 4WWMA 2DGYA 4PYUA 1B9MA 4BXXG 2BS3B 4IUMB 4LTUA 2KCNA 4P1BC 3WCQA 1H9RA 4A3BG 5T8IA 3VDZA 3C2PA 3C19A 1YZ6A 3T1YL 4U68A 1N34Q 3S14H 1F9PA 2RGFA 4DV4L 1VQNA 1KM7A 3CQZB 3PSIA 2L8JA 3V6CB 5C0XI 2RR9A 4HPLB 1T6BX 2K50A 1ZXHA 1E2WA 2F0LA 2DAFA 1SXTA 2UYZB 2JA5H 3E9HA 2F0EA 2Q8RE 4YY3L 5HFYA 1Y1WH 1ML0D 5J18A 2L0FA 5EE3A 3Q3FA 3F8TA 3U30A 3DM3A 1F2YA 3MJ5A 1ESFA 3S15H 4TQUS 2Q8IB 3GE3C 2O2LD 1L0VB 4QJFA 3M4YA 4DV6Q 4V0BA 5C23A 3H7PB 1D1IA 1V8QA 4YIJA 1Q0WB 4C3JB 2KAJA 4BBNC 3EUB2 4I6LB 5J2RA 3TDQA 1PGAA 4FJZA 2VRRB 1S4ZA 3OJ4B 4ICUA 3B9JA 4DNTB 2Z59B 1TQOA 4B3TL 3WIMA 3HKZE 1TKEA 4GLXA 5HHDG 3AEAB 5IP7H 3ZXVA 1UAPA 3OYYA 4EGVA 2Z6BA 3S14B 1IL2A 1HUNA 2BT6A 3IFTA 1EFID 5EGTA 3ZRCA 3PF5A 3RR5A 3SR1A 1PA6A 2JA5B 1P0RA 2OEOA 4C3IG 5A35A 3HVZA 3KBXA 4FBJB 2R2QA 4NPSA 2XRSD 2WACA 3ZVVA 4XT1B 1EIFA 3SHQA 3TCAA 4DUYL 1EYCA 3CHBD 2FCNA 4BZAA 4KKTA 1P1AA 1A62A 4JI8Q 3HS0C 3AEBB 4DXGA 4MH0E 1M8AA 1SJHD 1JORA 3D4DA 2WDVB 5D7GA 4G4KA 2KHJA 4EQNA 3GTJH 4L1BA 3VRBB 1ASYA 4ZUIA 4JI0Q 3G71A 2AWNA 2PMVA 1CZGA 2RSNA 4LNFA 2K6QA 1B4OA 1PYBA 2EY6A 2NN6G 4UP7A 1M1KC 3NHEB 1WJ6A 1EOVA 2A6EC 4HSPA 3STBC 3BIID 3NVVA 5D6JB 1UGMA 4MTNA 4QIWE 2CKZB 2SDFA 4OX9Q 2DZJA 1V5TA 2V9HA 2QF7A 1JOKA 4AYBE 3EFCA 4IKGA 4DUZQ 3UE0A 4KD4A 2AWOA 4DK6C 2GMIC 1ZDXA 2A8VA 2FIDA 3CCUA 1LUZA 1SNDA 4KIKB 2L12A 1CQVA 4YHHL 3HOVH 5AUIA 3NXWA 3QWZB 1HZCA 1V80A 4H7BA 4QMGA 1F52A 3Q8AA 2KLCA 4L8JA 2KA7A 1W2BA 3CD6A 1GB4A 2MPMA 5IP9H 3P1HA 2EYMA 1E2ZA 4ZYSA 4P73A 5E6OA 3WAPA 2R7DA 1Z9FA 5E4XA 3JYUA 1PH1A 3D6WA 4R3DA 5GAHC 1AARA 3RZDB 3V2TA 4PT5A 3ZJTA 2WXQA 2DYBA 3PLVA 2M00A 1LGRA 2PVOD 3KYCD 4XWWA 2E2JH 3KBGA 1NBFC 4XDDA 4K2LA 5I6WA 2K28A 1F77A 1PH4A 1E9MA 2YU9H 2BQQA 1U4LA 1E22A 4ABNA 4YTPB 3NWSA 3J81j 4L5RC 3L0WB 2KX0A 2CVRA 1X55A 2EYHA 2R7FA 3GP7A 2H4OA 4JI4L 5FO9B 2BPSA 4K2KA 3G6JB 4PS8A 2MCNB 2D5GA 1NR2A 1EY9A 2RBMA 4BBRH 2J42A 4K6DA 2JU6X 5LLIA 2VB2X 1V1QA 2RQXA 1KRSA 5DM63 4WAFA 4URKA 4OGQC 5KNBA 1UWXA 1E10A 2IW3A 3VR3A 1PLFA 1HXYD 3DHQA 1QQRA 1RHPA 1NSNS 3IT4B 2MBHA 2O2VA 2DNEA 3VR4A 4HJGE 2D2QA 4C7YA 4R9WA 1GM5A 4LFAL 1D4BA 2WAQB 3VUXA 1STGA 4NMZA 2MGSA 5EPKA 2JA6H 2E2JB 1TJEA 3N9YC 3TEWA 2FINB 1YITA 3SK8A 4JI1Q 2YU9B 3W3AA 1XTDA 2INDC 2AL6A 1HFNA 3AE2B 5IGFA 5LXHA 2RSUA 2CS4A 1ZXTA 4IFDH 3Q6SA 2A74C 4ZKCB 3K9PB 3K57A 4BBRB 1P9DU 3R2TA 4CJ1B 2G3QB 4OWXB 3D31A 1QNKA 3BINA 3KOJA 4JI3Q 4E6IA 4QB4A 2BKFA 2IGHA 4BA1I 4C7ZA 5TR5A 1V43A 5HURA 4A3LH 3C0RB 2F0QA 5I9OA 4CJ0B 1V1PB 2ALYB 1IBML 2K9XA 2WS3B 1Q7YC 4OO1H 2KNBA 1IBXA 3W5UB 3KJPA 4BWGB 5IGGA 1HR0Q 2LJ5A 4KSLC 5L95C 1SMYD 2E2IB 1GG3A 1XMQQ 1VQ4A 1NY4A 3FVQA 3QHTA 3UI3A 2M9VA 4JI5L 3H15A 5AZGA 2EY1A 3ULJA 4DA2A 1P7FA 4RM9A 5HKHA 2XEWA 3CMMB 2IO1B 1DZ1A 4A20A 1WYWB 2NVXB 1BXTA 4WQOB 4IO9A 1C9FA 4L63B 4FADA 2A5UA 5C5LA 2JJQA 1FNWA 1QB5D 1A15A 2QILA 1P16A 4X66Q 1H9KA 4LNQA 3FC4A 1HNXL 1SRUA 4NQKE 2KENA 1GJZA 2MEKA 1G6ZA 2PYKA 4LF6Q 1FYCA 1F9SA 1KDAA 1LYLA 4HIDA 4HIMA 3A1QA 4US8A 1SNQA 1GXDC 1LT4D 1SSOA 2ZJRA 1CJEA 2BOSA 4LF8Q 3A74A 4FF2A 2WXJA 1AZQA 1DOMA 1KLGD 2EIFA 1VQ9A 1YJ1A 2ZJDA 1FCCC 1YJJA 4GOPB 5FLXE 4A3IB 2FCQA 3X3NA 1IKMA 1EUVB 4ZRIA 4XYOA 1ZKOA 2KQSA 4IUQA 2N1WA 2ZVNA 2C7MB 3IG3A 4MGKE 3NBHB 2I5HA 3I55A 2KOLA 1X3QA 3SK5A 3R3OA 5IE8A 2QCZA 3QX1A 4DV0L 3Q23A 2QMTA 4UPAA 3ZJVA 2HJ1A 3BVMA 4P1CC 1IGCA 4BVUC 2EYOA 4YT0B 4PZ6A 5IYDG 1RYJA 4HJ9A 3JVZX 2FCSA 3ZRFA 1KDCA 4LNKA 1K9MC 2CR5A 3ZIMA 1DOXA 1K8OA 4B3SQ 3DBLB 3KQ4A 5IODA 3C46A 3S1NB 1X3FA 2NWGA 3ULLA 2EXZA 4RMFA 4P74A 4NJ7A 3NTIA 2YV5A 5CV7A 4IM3A 1CUKA 1WZ3A 1JWSD 1CM9A 5CGKA 3U50C 3P42A 4MSQB 4M01A 4OWTB 1MI2A 4LJZC 4JCVE 1N61A 3QOJA 3GE8C 2K3UA 1CSPA 3MWYW 3ENEA 3EHVA 4MN3A 4GNXA 2QC8A 3ZUNA 2JA7B 2MP2A 4NNJB 4GU2A 1BBWA 1SE4A 1BT0A 2JXTA 2F0OA 3KUDB 3SHLA 4C3JG 1RKNA 2J4XA 2WKCA 4I7ZC 2IT1A 4HRSA 2AUJD 5AJ3Q 1FGUA 4LJOB 4HTHA 3HM3A 1C8CA 1BBXC 2I0QA 1OQYA 1SYFA 4JI6L 1R9TH 4GDLB 4L5QA 1QKZA 1TS3A 2F0VA 2VH2A 1AN8A 1EU3A 5IYCH 3P7JA 2LFIA 5J22A 2WB1B 3ZJYC 2OOBB 1C78A 3A56A 2EJFC 1SNCA 4TKOB 2X6LA 3VUWA 1PDXA 4NAMA 2V4DA 1CKNA 1DM0B 2A68D 2JEBI 2LEKA 2Q5WD 1O7LA 2G9HD 2JA5G 4J8QA 3VH3B 4PZ8A 2NPTB 5GMVA 3VYUA 3VRAB 2HCCA 1TWFH 4M1UB 1GOZA 1K8MA 1VQDA 3GTQH 4D2KA 2G5DA 2IWHA 2WLBA 4A3JH 1JB7A 3NG0A 3AB5A 1WTQA 3Q6BA 4KX6B 1MHHE 4MEMA 3AEGB 1F2RI 1F9JA 4A6QA 2Z0SA 1S5DD 2CWPA 1YJWA 1WTRA 4JL9A 2YEPF 3MAQA 1R9TB 2NBVB 4KGTA 3T3NA 5ELCA 4IC7B 3UGBB 1SMYC 4OELB 2L0TA 1Y8NB 3R2IA 3NS1A 4GS3A 4W9IA 1IYVA 3DDCB 3AYHB 2KFKA 3DVGX 4BS9A 1S72A 1FD6A 2ZTDA 3I63C 4YY3Q 4B3RL 1HHVA 4LF7L 2W3SA 5IP7G 2K7VA 2X8XX 1CFMA 2WP8J 3AFQA 2B2VA 4JBJA 2N1VA 2PNRC 2B2UA 2UUBL 1NMGA 3KF8B 1SE3A 4JOIA 2SAKA 5EJWA 2K6DB 4CKBA 3LNNA 4BXXH 2WFWA 4UHVA 2LGXA 2JA8G 4A3BH 1TWFB 3BK2A 2K25A 3GTQB 2KANA 2RHQB 4OO1I 3UDGA 4A3JB 4Q5VA 3K6OA 1JR0D 2GB1A 4TRDA 2LS01 1I3QH 5NUCA 2INPE 1VQJA 4KY7A 4LF9L 4X64Q 2HUGA 1NYRA 5C3EH 3CCRA 5I4DA 1V49A 4HJKA 4OZBA 2F1MA 2K5QA 1T0RC 4GLSC 2UXCL 2YLMA 4HEA1 3U4ZA 4CHTB 1UGJA 2XK5A 3FILA 1JCKB 3KVFB 4FN2A 3ZO5B 4DR5Q 4LDTD 3RUIB 2HIXA 2XNAC 4HJ8A 3M4QA 1E3PA 2LXCA 2K5NA 3I8ZA 1A2TA 3DBLI 2F52A 2JRHA 3CMAA 4G7HC 1T3QA 4A3BB 2LRUA 5EQ0A 4DK3C 2AEHA 4I6NB 4JGHB 2F0GA 2VUMH 3S2DH 1S5ED 1AP0A 3TEHB 4Y7NH 1C4PA 2D3BA 3NE5B 1I3QB 4RCOA 1ZDVA 5C3EB 1PH2A 2R61A 4ASWC 1C9OA 1KL9A 4FDBA 2WXHA 5C3XA 3OAWA 4JLCA 5DCNA 3NUHB 3SFEB 2REXA 4IUTA 3NTKA 3SE0A 2LJIA 2WAQG 3SDLC 5ELDA 4ARIA 1SNOA 4O2DA 5FK9C 1KHIA 3A7AB 4HEDA 2INCC 3TBLD 1DCZA 5I9PA 2LUEA 3V6EB 5JPNC 2UUCQ 1A3UA 4DFAA 1Z2MA 3LWEA 4HR7B 3URYA 2B2YC 5T1IA 2FMMA 1CT1D 2BDNA 4A3GH 2LXKA 1FRRA 4MGYE 2N9LA 4C00A 1EWHA 2VUMB 2K5VA 4BBRG 5EKIA 4K5VA 2NN6H 3S2DB 1YOVB 2CU3A 5M3FB 4HMJA 4HXDA 4Y7NB 2GI9A 2PJHA 1QT9A 2EJMA 4JVZA 3MXNB 3L3OC 2EJGC 4GB9A 4DAVA 2HCIA 5IWAL 1V6EA 3CCJA 1S3SG 2A68C 1WYGA 3DVNV 4ZKBB 3N52A 2L55A 3SK6A 1STNA 4GOPC 1EEID 5J39A 2MBOA 3AI5A 3APFA 3DVNU 2DZKA 2INNE 1IBLQ 4LF5Q 2N4FA 2KXJA 3ZKJC 3OWEB 2DUDA 4ANUA 1X65A 5G5GA 4WJPA 2SNSA 1FXIA 1MBYA 4IWOA 3ULPA 1WCMH 3X23A 5A2QE 2DY8A 3SEBA 3KWLA 1HNWL 2AMCB 4J6HA 2B3AA 1STHA 3PV0A 1C7YA 3HOXH 1JRUA 4A3GB 2PI2A 2HE7A 4EOYA 3PREA 5IT9E 1BUVT 1AW7A 1R4QB 1I4HA 4J15A 1DJRD 1YNND 5EE9A 2VS1A 1J9OA 3TP6A 1U4RA 2A69D 1V9PA 3RNAC 2BYEA 4JI7L 1VS0A 1JICA 3UF8A 1KABA 1Q10A 2I38A 4MACA 4MZ9A 2HDLA 1JRPA 4DV7Q 2KFJA 2IY0B 3G48A 1JOOA 1K73C 4OO1G 2DENB 3A9JA 1PRTF 3TEXA 2RDHA 2D07B 2YTVA 1YHBA 1BCPF 1Q1EA 2F3IA 2PQAA 4DK1A 4A3IG 2WXMA 1C3TA 2O6VA 3NHHA 2KC2A 5HG2A 4KK7A 1F1HA 2LZ6A 3RNFC 1MSHA 3RZFA 2EKEC 1G8ZD 3RN5A 3C1FA 3QA8A 4W9GA 4AJYB 1H9SA 4WJ4A 1WCMB 2LGSA 3B0AA 4FF4A 3RFZB 4LLGM 2E5LQ 2KCMA 2ID0A 2DHZA 2WU2B 4XYCA 3HOXB 3AE8B 2JZZA 1VJKA 3I4MH 2ZW1A 2KN4A 3HM6X 1A2UA 3L13A 1KDBA 3NK9A 1KQSA 5MPOA 1KNEA 1YIJA 4KTAA 1JWAD 1H9MA 5BR8Q 5I2YA 2Y0SE 1QVGA 2Z6KC 5C4XG 4EKUA 3ABVB 3M4OB 4NDXA 4HKZE 1K3RA 5KGUA 5LMNQ 1O7YA 4HIOA 4WJNA 5BMHA 4M00A 3VYRA 4G7ZC 2PPBC 2CJNA 1HTPA 1GJXA 2HTME 1JJCB 4JI5Q 2ASBA 3GTKH 1FRDA 3FAHA 1HEZE 2WHIA 3GTMH 4M8MA 3RNGC 3OLMD 1VDZA 5D94A 3HP3A 2GVAA 1DGSA 4LFBL 2JA7G 1EIYB 3PSEB 1WTWA 1WGYA 4JI2Q 5IY0A 2LXJA 3U58A 4K7UA 3TP7A 3J7YW 2B63H 1HNXQ 3P20A 2BS2B 4MT5A 3P4RB 5COYA 5CORA 1NTGA 4JW0A 1JW9D 1EYAA 2UUAL 3OOCA 1YNJC 2HDEA 2KVZA 3CAMA 1KD1C 2PIAA 3I91A 2KWVB 3I4MB 4PV1C 1YHAA 2JXXA 5LHY1 2UWQA 2G4DB 2PI2E 4NXNL 3RLFA 1H8CA 3RD2A 3DM1A 3LJ3A 1XCTL 4YSXB 2WB1G 4KSKC 1UH6A 1RCVD 1R4NB 4DHJB 4X65Q 4AQYL 3RI7C 3GTOH 1RODA 3VR9B 5K36H 1EU4A 2LY7A 3GTKB 3DBHB 4KJNA 1K83B 3AE9B 3GTMB 1W6KA 2KQ4X 2KTRB 3JAME 1ILQA 3AEFB 4HCPB 3I4LA 1WTVA 2BGFA 3V96A 1AH9A 2Z9HA 1WVLA 1YNXA 4OWWB 2B63B 2QJLA 2E75C 2PEAA 4B3ML 3TIXA 2F03A 1GB1A 2GBKA 3RNBC 4HN7A 4A9AA 3OIPA 1Y14B 1SIJA 2GBRA 1XT9B 1JALA 4PS3A 1FNVA 2BH8A 3GV3A 1VQLA 3M3YB 2PQEA 3TBIB 2K03A 1S40A 2RCNA 4MIUA 2VQEL 4DR1Q 1E8YA 1WGRA 4WFN3 1PZKD 3NQTA 3S1RH 2KHIA 2QGQA 3H09A 2OJRA 2ZW0A 3N1ZC 4OZAA 5JZEB 1IYFA 4OIJA 1EEFD 4C3HB 1GUNA 3GTOB 4XT3B 1E8ZA 1BDOA 1TS5A 2H5XA 2NN6I 4LW1A 5E3FA 3I7FA 4ZK9B 3CCSA 1WJNA 3HZXA 4HJAA 1C77A 2L76A 3H7PA 1A5RA 1MG8A 1IBKL 2GOWA 1XTCD 4LNIA 2HDMA 4QCLA 1A8VA 3BDLA 3FEWX 3A8IE 2GN5A 4FF3A 4GKKQ 3CF5A 4BAXA 1PFBA 2L1AA 3RULA 3EVQA 4JI6Q 1BBUA 4S3SA 1VMPA 3CCMA 3QIAA 4A3JG 1PH3A 3M7GA 3UI2A 2PE9A 3A9KB 3CQZH 1OTRB 5JHAA 1OEYJ 3E3XA 3A7LA 3A4RA 2WXFA 1ISNA 1ICFB 2PMZE 3HG9A 3PQIA 4KMUC 1WXMA 3MC9A 4P71A 3E5SA 4JBKA 4H2AA 1WM3A 3ERQA 1LM8B 4G7OC 4TSSA 3PUWA 5FJ8G 3HOZB 1HCZA 4EZLA 2MHVA 1SYGA 4LAAA 3RN2A 1ZP0B 4DHJD 1N32L 4AP4C 5DEHA 5G55A 3S9WA 3R3MA 1JE4A 3QJZA 1XNQQ 1WOCA 3JSVA 4PS7A 1YX6B 2NZ1D 2ZM6Q 2KT7A 5E6PA 4PMBA 4FVMA 4IM2A 4S17A 1OO9B 3P1MA 1KOTA 3UDIA 3Q24A 1HZ6A 3L16A 1BOSA 2Z1CA 2C7HA 3D6CA 2VQFL 2WWZA 3IXSA 4NAWB 2QIEB 2FJ2A 3PZ8A 5M9OA 4H0LC 5LL6S 1HZ5A 2LSSA 5BN4A 2A5HA 4DR6Q 3PO2B 1S5BD 4PNYA 1RM6C 5C3EG 1HNZL 3B2GA 3BZCA 1VQ5A 4K0KL 5D14A 4WORA 2GRIA 1LT5D 2NZOA 3MTNB 5HGQA 5L37A 2F0IA 4DR4Q 2BBCA 5FOBB 1PH5A 1G6JA 1QZHA 2KC1A 2C7NB 1OXUA 5IGCA 2JXMB 1F2ZA 3JAMi 5GXGB 2CQAA 1EY0A 1ENAA 3L4PA 1X32A 2ATWA 1OXVA 1YMHE 1AEXA 4FYDA 2DY7A 1SSNA 3GQBA 1VZ8A 4NQLB 4K81A 3PMFA 2K33A 2Z8LA 1HJPA 4OVUA 1R4NI 1WTPA 1IPGA 3AXCA 1P98A 4LF9Q 3I57A 3MXGA 2VUMG 2JRIB 3GZNB 4RAUC 1J5EL 1TKGA 5M3FG 4TV3A 2D5DA 5C6AA 2M0AA 3P4SB 1YHQA 2MBEA 3GD7A 1Q8IA 4DV1Q 2DJFC 3HKZB 1HTLD 2D10A 2B2WA 3PRMB 1N36L 2RF4A 2JA8H 4JYAQ 3NBIA 3FDTA 1YX5B 2ZJPA 3M9BA 2BE5D 2R92H 4UDUC 1ZUD2 4USAA 2KZRA 3VQIA 1L7YA 1DOLA 2TMPA 1WX7A 3PHWB 1DXMA 1KFYB 4HPMB 4RGOS 1UF0A 2QSDA 1WH3A 1LTTD 2KDMA 4U673 1EY8A 4CO7A 4DU9A 4W9FA 2B8GA 4P2CB 2XBBC 2QDFA 4DV5Q 4DV3Q 2I1KA 4M0WA 3MVVA 4ZAIA 4A4IA 4A3GG 2WX0A 1OQQA 1QUQB 3RZDH 1WY8A 1Q81C 1C0AA 4N9PA 3CW2C 1NBWA 3AU7A 2KJRA 3OG5A 2KJHB 4DHZB 4KLKA 4BBSG 1D5XC 3CMEA 1U4PA 4KKIA 3L9AX 1IW7D 5KIXA 3PIO3 3HK0A 3R7QA 3WALA 4EE2A 5CC4A 1HQRD 3QK0A 2RDFA 1FFVA 1B1ZA 1Q12A 3B08A 2JA8B 3LYYA 1VQGA 3M4PA 4B9XA 3NJTA 4DV2L 4KZCA 2R92B 1I5FA 1UE5A 4BBNF 1D5MC 2V1CC 3S1MB 4QIWB 1J8IA 1Y56A 3C1EA 4R1JA 4AYBB 4JQWC 4W9HA 1I6HB 5IN7A 2QDLA 3EECA 2DNCA 3T1HL 4I6PA 1HH2P 1DYQA 1PFMA 2JUOA 3WOEA 4N59A 3P63A 1SR3A 1WCMG 4A8XC 2M0XA 2QDBA 5GAGC 3DBRB 3GO5A 4H13C 2ICIA 2PNHA 3PIP3 3HOXG 4BA2I 1SE9A 1J8CA 1LV9A 5IWAQ 5DPWA 3VYSA 1X3EA 2OCEA 4I65A 4IUPA 3I4NB 2ENBA 2QCPX 2UXBQ 1NVID 2J7ZA 2FUHB 3J81i 5H1SE 2EDGA 4KJOA 1SROA 1L1OA 1Q82C 2VZKD 1PYWD 4X57B 4HCSA 2IX3A 1C4CA 3AH7A 3KUZA 4WAAA 1FJGL 1FEHA 3AU5A 3TJPA 5EPLA 1SYBA 4K5XA 1CTMA 1RLFA 1L2FA 5FLXc 1EZ8A 1X6OA 5FLMG 5C4JB 2V3NA 2SOBA 2JEAI 3TP8A 4F8MA 4N8X1 3CCLA 2DX5B 4JWUC 1K50A 1IL8A 2K75A 3PUVA 3G6EA 2WXKA 4FHJA 4KZ0A 3VVWB 3DWGC 5FKAC 3ETRA 1T0QC 2NMQA 1LTLA 3EGRA 1GPXA 4C4VB 2WX1A 1O80A 4JI7Q 2CU1A 2N3SA 2KVMA 2YTXA 4RKBA 2E2IH 3A33B 3I4MG 4F7ZA 3W1SA 3I2ZA 1DOKA 2G4SA 4YCUA 2BVCA 3KYDD 4HVBA 4KHZA 2WNMA 4YSZB 3K0YA 4GOPA 2M19A 4AWJA 2NBFA 1OTCA 1WF9A 4IWPA 2EVBA 4JPBW 1MFWA 2DJGC 1RIPA 4RKLA 2NVXH 1F0ZA 2EKIA 2V4LA 1WGHA 1LLRD 2IY5B 3GZNI 4RM8A 3NBHA 3AEEB 3J7AV 3IBEA 3MFGA 1JJGA 3FHWA 4KGSA 3V60A 1XMOQ 4RNAA 5DLQE 2C35B 2NYZD 2M1MA 4JV5L 2CH4A 1II3A 1TWAH 4MM3A 2I2YA 2EYFA 3MEFA 4HAEA 2B63G 2Y3AA 4YSYB 2EYLA 4JWSC 2N0SB 3Q3NC 4IALA 3PIOA 4FO2A 2JY6A 5D3DA 2Z4IA 5GAEC 2HHHL 3IL8A 1B53A 4A3IH 2BE5C 3L10B 1HFGA 1XYIA 5IGEA 1TKWB 3CC7A 5FR6A 3TEZA 1IXRA 1VQCA 2L11A 5DNFA 3ER0A 3B2FA 2F0UA 3E0JA 2R2OA 3KLRA 2GBJA 4C3HG 1WD1A 5K36G 3T3OA 3L08A 2WXOA 4P6VF 2F0WA 2F4VL 1E7ZA 1B9RA 2FMCA 2R6GA 2K52A 3F2UA 4M8AA 4OZCA 5C4XH 3PIPA 1SAPA 2JYOA 4GDLA 1TWAB 3S1NH 4X62L 2F4IA 3T56B 2DLBA 1IW7C 1OXSC 4XTCS 1XNRL 1V9JA 2N9KA 1KLUD 4C2MB 1R4MB 5KHQA 1PRTB 4IQZA 2BWES 4WWNA 5CBAE 2I1JA 3D32A 2D0OA 1MIUA 1TZ1A 2M4NA 2WDRB 2KMAA 2X38A 2AQ1B 2IX1A 2KACA 1F2LA 2TSSA 5CV5A 1K0SA 2N55A 1KAWA 1NAPA 3MTSA 5KNCA 3OTOL 3QARA 3DEPA 3BU2A 2IHFA 4NXML 2JA7H 4LUZA 1JROA 2EYPA 4DR2L 4EZJA 3HOZG 3BVGA 4FNFA 2KYWA 4S0RA 3A54A 2KHWB 1JMLA 1QG7A 5BMIA 4OVZA 4KHVA 2PZWA 1NENB 3I90A 1K8AC 4IWQA 4DR3Q 4LK0M 5C4XB 3BZKA 1QJOA 5IYBG 4DXAB 5JXVA 3AEVA 4FXDA 1LT3D 3PVLA 2W55A 1FMAD 1JOQA 1X1MA 3T9LA 3K5MA 3KW5B 1OXXK 2UXDQ 2E2DC 4ANVA 2G9DA 2WXNA 2L4NA 2H88B 2N7DA 3PO2G 4A3PA 4FHKA 1PVOA 1RJTA 4J6IA 1TR5A 1FO4A 3CIRB 1MD2D 4DF7A 1ZXIA 4ME5A 3KF8A 4P72A 3CP0A 3EN2A 3EC8A 3DWPA 1RTNA 1LTRD 1UE7A 2CH4W 4UAIA 1L0YB 3ERSX 5C5MA 1T0YA 2W82A 3RNCC 1L2NA 3VH4B 1SF0A 4WQMA 3ONAB 4XDCA 1IBXB 3M63B 4ZQ3A 1TY2A 3OW7A 2JZPA 1TY0A 1SYCA 3J80E 5KRUA 4KDLB 1TTNA 1B3QA 3MXUA 1PH8A 1D3ZA 3CPWA 1EWIA 4DDGD 2KUMA 1DD2A 1LTID 4LDTB 3SD5A 3ZNZB 4N9TA 3K7UC 1SFOH 4B08A 4DR7Q 1XD3B 2KQ3A 2LGYA 4K1RB 4LF4L 1PRTD 4KHPQ 1IKLA 2KWCA 1SNPA 2VY3A 5C44H 3MHSD 1SEBD 4W9EA 3IKJA 1BCPD 3HKZG 1U4AA 2JX5A 2V1YA 1LFDA 1PTOH 3MP9A 1WTHA 2WB1E 3I3TB 3Q3OC 4CKCA 1C76A 3E56A 2L00B 4HKQA 3TMEA 2N88A 1I4XA 3A1QB 4ZLTF 2EMSA 2E8GA 2NUCA 2PZTA 3L17A 4HJ5A 1BKBA 1JMCA 1XXGA 2IO0B 4A3KB 3J7AF 4EUTA 4KN7C 5JEAJ 5TSSA 2ZT9C 1LM0A 2IJ0A 2AQ3B 3WANA 2W3RA 1N33L 2VQFQ 3T1YQ 3QIJA 4L5TA 1UE6A 3EJIA 3DWQA 2FE8A 1LQBA 4O42A 4DV4Q 2JQRB 3LX0A 1CA6A 2I07B 4CDFC 1JJ2A 4R8IA 3AE5B 4L2YA 4RFBA 1QOFA 5FJ8H 1M90C 1VQOA 2LHDA 3BVZA 3CU7A 4YWLA 5I6YA 4A75A 1QOGA 2K8HA 1SFOB 4LCDE 4K0KQ 3HGBA 3AQQA 2GBMA 3N3KB 4RGNA 1QE6A 5EBDA 1IGDA 3HEJA 5C44B 4K8IA 2RKSA 3GTPB 1PTOB 1RAXA 3Q14C 4BKSA 3HRZC 4G57A 5GQOA 4C1NI 1TWHH 3IAYA 2BS4B 4R4QA 5D2MB 5BMGA 3HKSA 2DBYA 1N34L 2R92G 1YQ3B 3NUCA 1R4MI 3ML8A 4IG7B 2JP1A 3P75A 4AYBG 5CTRC 2Y5PA 1K53A 3HIZA 4B3TQ 1K28A 5AZFA 1PH9A 3H94A 5EKLA 3HHMA 5KNDA 3ITPA 2QW7A 4WH4A 3FKIB 1VMCA 4X3TA 5CV6A 3AEDB 1J5EQ 4A3EG 1YEZA 2J0TD 2JZ3B 4UP8A 5JJLA 5IT9c
chains in the Genus database with same CATH topology
2RMMA 2FUG1 3ZGZA 1CHQD 3W5VB 2BCOA 1FIQA 1K51A 3NPPA 1LTSD 3R93A 3D3RA 2BA0A 1X3PA 1TWHB 2VB3X 4ILWA 2O4XA 3EROA 4REZA 1WTOA 2C9OA 3HOUB 2ZXRA 1FCLA 3QJYA 3T16A 1PZID 4CJ2C 3A8JE 1G2SA 2JWUA 1Y8PB 3SXHA 3H91A 2KWDA 3NP8A 3BYTB 1V1OA 4YTNB 2E6XA 3OPOA 2J53A 4B0EA 4DGZA 2XSCA 1PTOD 1OQRA 4C56C 3Q0AA 2LFNA 4RGTA 1A6XA 2WV6D 1HPCA 4JK1C 4RHRA 1S5CD 1QOBA 2DYMA 3VYTA 1PRTC 2F0NA 4J1MA 1GHKA 2SNMA 1E6EB 1QWYA 3GTGB 3BDCA 1FGBD 4RHSA 1YQ4B 1LTAD 2IPKD 4NKLA 5AFWA 2GA4B 5M3MB 1J7AA 4N6EB 1ESRA 4Z9CB 4PMWA 3VR6A 1DONA 3BWUD 1ROEA 1ILPA 1YN3A 3FILB 2B2TC 1Z47A 1WD0A 2L0CA 1Z7TA 4BBSB 3RD4A 4R8NA 4KD3A 1VRAB 1I4RA 1MVKA 3IFDA 1WRIA 5EE1A 1SYDA 1TWGB 5JJZA 1L6UA 2B76B 3ZJUA 5D65A 1QF6A 1U9RA 2K5DA 3CRKC 3NVYA 1TU2B 1XCQL 2AX5A 3U2SC 1EQTA 4K5WA 1FXAA 4ZHOA 2D2CC 2JYTA 5G3LF 3S1QB 3FMCA 1ZOYB 2ON8A 2WQYB 3HOYB 5ELBA 1E2VA 2J52A 5BN3A 3LWUA 3DWAA 1NEKB 5K5PA 5D3IB 4A3FB 1KAAA 2FFKB 1G91A 2OF1A 1QCBD 1NYQA 3PUXA 3IT6B 3AE7B 4DAYA 3C3LA 2BDOA 2Y0SB 3PUYA 4KI0A 1B50A 4MHEA 1EOTA 1KF6B 4RWSC 4ZHPA 4ARCA 3H6MA 1KTKA 1HUMA 1J7BA 4HMIA 2K01A 4ULLA 5C0XJ 1EY5A 2NVTB 4DK0A 4JX1C 2KECA 2MJDA 1VCIA 3T51B 3K7AB 2IDYA 4XQNA 3OMCA 1BMLC 1PTOC 3K59A 1ZPSA 1JC7A 2LMCA 1RDPD 1EWYC 1STYA 5FLXL 1C4QA 3Q8BA 1GHJA 2PO4A 4P16A 3CKIB 4LMQD 5ELEA 5M5WB 1UEAB 1E0BA 3KUPA 3Q8FA 3QO2A 4PQXA 3OIQA 1PMRA 5JEAG 3NZ3A 3GB1A 3LB8C 1EY6A 5JOBA 4A3MB 2O5JC 4QUFA 1P7EA 1Y1VB 3TP5A 5G5HA 4GDKB 1EL0A 4A3DB 4F7XA 1T5XD 5IGDA 1Y69U 4B9WA 4BY7B 1MGSA 1I50B 2XVSA 1YNNC 5C2TB 4FXGC 3NTHA 3I72A 2A69C 1WWTA 5JVH3 2BYTA 3MHZA 4OIKA 2KHSA 5I2XA 2K05A 2WINB 2RA4A 2F0JA 1TT2A 2F0TA 1D5ZC 3EFXD 2PMZB 4XIGS 2LHEA 2YYZA 3S2HB 1XLNA 4XYQA 2NVYB 3U7ZA 3U52E 2B2VC 1JQ4A 3OSOA 3A55A 1M4VA 4L6TB 4Q2JA 1VZ7A 1DOYA 1LO5D 5JPMC 3J81E 5EBCA 3EA6A 3L7ZC 3VR2A 4OL7A 5M5YB 1XLQA 3U9SA 4DQOC 3S17B 3NWTA 1Y8OB 3S16B 1KH0A 3Q69A 4FXCA 1VZ6A 4IUUA 3HVDA 1EM7A 5EE0A 1KNAA 3H3VC 4K14A 1IHZA 1VR9A 2ONQA 4EQPA 2VZKB 1A3VA 1FD7D 3AV8A 1ENFA 1CK1A 1LABA 3OMGA 3KWVA 1PFNA 3I3CA 3SVMA 3DWMA 2N7JA 5H92C 5BYSA 2H1EA 3E9SA 1O78A 4XE0A 1PFDA 5C4HA 3PZ7A 2K04A 3NQIA 2WP9B 2YEPB 1QOHA 3KK7A 1XX8A 4US9A 1WSPA 3RPFC 5CR3A 2JE6I 5JAVA 4C80A 3ND8A 3BZDB 2VXWA 1Y1WB 1I7HA 2PVGC 2LUMA 5FO7B 2XWBB 2ACZB 1H9JA 3S15B 3PO0A 1RF2D 2L1BA 3AN1A 1I4PA 2OHFA 3KLSA 4OHJA 4V190 1MSGA 5BN5A 1F9RA 4PMCA 4CKEA 1YN4A 1WGKA 4J3OD 5E4WC 1QOAA 2HQEA 2D9UA 3DXJC 4A3EB 4EQOA 1GUSA 4NZLB 2PKOA 1IYUA 4IDIA 1V1PA 1STEA 1XF5L 3C8YA 3VA7A 2O5IC 1W6JA 1LTGD 3AE4B 3V3XA 4K6LA 1SB3C 1N5XA 3W9CB 2WKDA 3K5LA 2WU5B 1GUTA 5J1ZA 5KYIA 5CV9A 3J9CA 1SJED 1ET6A 2F0SA 4O1NA 3Q8CA 2K5WA 3GTJB 2R7ZB 2B2YA 1CI3M 4N58A 5A2QL 2JSVX 2M56B 2B39A 3WDNA 2F3WA 1V8CA 2PCFB 3D4RA 5IT9L 3G7LA 4IZ8A 2M2LA 1AFPA 2RVLA 3SR6A 4K8JA 3SK4A 3HOVB 1L5PA 2L83A 4IOIE 5C0XG 3DMUA 1N62A 1EIHA 3HRDD 4IN3A 2OXPA 1EIGA 1RWSA 1CA5A 4RF0A 2H89B 1VLBA 1U4MA 5DAUA 1D1KA 4CGYB 5C3WA 2MJEA 3QOLA 4ID6A 2LKVA 1ACCA 2B2TA 3FPPA 2RPVA 1T5EA 5CYUA 2OT2A 5BYRA 4A93B 1JQYD 1L4DB 2FHTA 4WRDA 1SYEA 2Z4HA 2B8FA 5F2DA 1ENCA 2F0HA 2RSOA 4ZOHC 1BR9A 5M5XB 3QWNA 1L0XB 1MPEA 1LT6D 2NB0A 4DNRB 3TN2A 4WIPA 3TZDA 4KN4C 1XEEA 2NVQB 1KRHA 2JA6B 3TUOA 2WXLA 1BCPB 4IFDJ 3D8GA 3BK1A 2G1EA 3IAM1 1FFUA 3RZOB 2PZUA 3SFDB 2AUKA 3TSSA 2EY2A 3I9V1 2IL8A 1FNUA 1RTOA 1L6VA 1TVXA 3JAML 4X3SA 1SNMA 2F0FA 2EPBA 2MH7A 2EOTA 4KY5A 4XXEA 2X6GA 5H8YE 3AE3B 1PZJD 3GV6A 4IUVA 2KEEA 5DM73 4X3KA 1O7ZA 2PTLA 2A73B 3LXFA 4MM3B 3GS2A 3AMZA 3PO3B 2MJ3A 1G291 5JEAH 2R93B 3K58A 3RUZA 1DOIA 3NRZA 1V97A 2DYOA 1BNZA 1C48A 3AB9A 2IGDA 4JBWA 4HCEA 3T53B 4KKJA 1Q90A 5ELFA 4RGMA 5G3LD 3W2DA 4L23A 1RD9D 1TKYA 4FF1A 2A6HD 2ZXPA 2WXGA 2K5PA 4NW2A 3U9OA 2AQ2B 4KV6A 5IIFA 4F88A 3TEYA 2BA1A 1YJIA 3MA2B 1GAQB 4TQ1A 2KCCA 2R3ZA 2SEBD 1UNSA 1QLBB 3BYYB 3H0GB 1HA6A 3J81L 1EZ6A 2F0DA 4ITKA 1TYGB 2NTSA 2XRQD 4ZUJA 5FO8B 3A8KE 1C79A 2EYJA 1VDVA 3ZYYX 3K5OA 1RFKA 4IFDI 2B2WC 1A3TA 3MXNA 2XWJB 2W54A 2F0KA 3O13A 2F0PA 1ONLA 5EKKA 1TZOA 1NUCA 1UWMA 4IURA 3HUIA 3H8HA 2PLPA 3HOWB 4RF1A 1LACA 1VF5C 3NSWA 2Q8TA 1C4AA 1PGBA 2CW0D 2EY5A 4ZRZA 3OHXC 5JVG3 1BO0A 1ET9A 1ZYRD 2JYEA 3BDOA 2F3VA 3DEOA 2QEJC 2D62A 3MEHA 2KMMA 1B3AA 1EYDA 2MP1A 4NP5A 1N63A 5E6JA 1WTXA 1D2BA 3TZUA 2ZXOA 1BQQT 3AM9A 1PXUA 3WOFA 4ZRPA 5C3JB 1BF4A 4C1NK 2IGGA 2KEDA 4RA8A 3MZ5A 2PW9A 1SE2A 1GUWA 5CV8A 4YXDB 1EY4A 2KJXA 1CZWA 5E1FA 3CWIA 2K6AA 1ICWA 4Q0FA 1JWBD 1YNJD 1UUPA 1NCVA 5C4ZA 3BS1A 2WDQB 4KGRA 1F2RC 2L52A 2XIWA 5FR3A 3NVZA 1F2MA 1B9NA 4RCNA 4YWGG 5ISRA 1A70A 1E0ZA 1BCPC 5CBEE 2CJOA 1Q3LA 3FPUB 1ZEQX 3Q8EA 4CBVA 2DWQA 5KYLA 4KKUA 5LL6X 2IX0A 2A6HC 4ODGA 4JPSA 4XQJA 3Q22A 5CMDA 4TMAB 4CQNA 5EPJA 4C3IB 2I46A 4EVOA 2VNUD 1HA5A 2WXIA 3D4WA 1EWCA 2PW7A 1QILA 1N5WA 3MXPA 2E2HB 4NJCA 3E6ZX 2WXPA 1D6EC 1G2TA 1HRJA 2X69A 5HI1A 3V05A 4AQ7A 4XWTA 2QKIC 5CV4A 4DN4M 2E3TA 3I73A 2MUYA 4IFDG 1I6VC 3PUZA 3R8BA 3P4PB 1BUIC 2E76C 2L32A 3FRPB 1STBA 1XLPA 2PW5A 4XDXA 5KEEA 1B2TA 3T13A 4OW0A 5AUKA 4A90A 3M85A 4HROA 3X3MA 1OFFA 1PDQA 4GZYC 1GUGA 3KLSX 5C0XH 3P4QB 1XO3A 4TQ0A 1CHPD 1B44D 3VA5A 1FM0D 3I70A 1YNTE 2BB6A 3MHBA 2RDGA 3N6RA 2CW0C 3DUZA 1AWDA 3T4AC 1IUEA 3OWFA 4B0MA 4FP5D 1ZE3D 5BYQA 3ZQ4A 1CZPA 3CRLC 4MH8A 1ZYRC 1PGXA 1FR3A 3VR5A 1TIID 1NI3A 1XLOA 3MFYA 4LK1C 1R4PB 1EY7A 3AECB 2Y5CA 3QB3A 3SDZA 4X3UA 3K5NA 1NR4A 1LTBD 3U4EG 5T1GA 2EE1A 2K1BA 3BG3A 1OXTA 3MC0B 2F0MA 5HGTA 1STAA 1Q1BA 1AYFA 5LNK1 1YN5A 4DAPA 2L9HA 3AMUA 1AZPA 2NTTA 1CQFA 2MJ8A 4HSVA 4WJWA 3EQLC 4JE3B 4YTMB 4XQQA 4FXKC 1H9SB 2V0GA 1WXQA 2E74C 2BTEA 2BW2A 4KKSA 1JB3A 1E7PB 1TS2A 2OEDA 1L4ZB 2EELA 2WXRA 1Z6HA 3NVWA 1DGJA 1MHXA 1HQMC 2C5CA 2BB5A 3GTLB 1JWMD 1JWUD 2A6ED 2L5TA 1GUOA 4QF4A 4DXFA 3J80L 1I4GA 2K0PA 3VR8B 1I4QA 1QNUA 4WURA 1S5FD 4ZRQA 1VF7A 2V4IB 1K52A 4H44C 2K22A 2JSOA 1TWCB 2CHBD 1PTOF 1TS4A 2XN9C 4BY1B 1R7SA 3IAS1 3M7NA 1SBBB 2K32A 2EZVA 3ND9A 2LGIA 2ICEC 3RMHA 4F87A 2B2UC 3AE1B 1SDFA 5IOCA 2FBWB 4QUCA 1EQVA 5IGBA 4A55A 1J7CA 2WIIB 3S1RB 2LMCB 1MI0A 4IUNA 4RH6A 4KY6A 3QG1A 1F9QA 2V3PA 2DN8A 1XWEA 4WWMA 1B9MA 2BS3B 4LTUA 2KCNA 3WCQA 1H9RA 5T8IA 3C2PA 4U68A 1F9PA 3CQZB 5C0XI 1T6BX 1ZXHA 1E2WA 2F0LA 1SXTA 2F0EA 2Q8RE 1ML0D 5EE3A 1F2YA 3MJ5A 1ESFA 4TQUS 2Q8IB 2O2LD 1L0VB 3M4YA 4V0BA 1D1IA 1V8QA 4YIJA 2KAJA 4C3JB 3EUB2 3TDQA 1PGAA 1S4ZA 3B9JA 4DNTB 1TQOA 1TKEA 5HHDG 3AEAB 1UAPA 4EGVA 3S14B 1HUNA 2BT6A 3IFTA 1EFID 5EGTA 3SR1A 2JA5B 3HVZA 2OEOA 4C3IG 5A35A 3KBXA 2XRSD 2WACA 4XT1B 1EYCA 3CHBD 4KKTA 3HS0C 3AEBB 4DXGA 1M8AA 1SJHD 1JORA 3D4DA 2WDVB 5D7GA 4G4KA 4EQNA 4L1BA 3VRBB 4ZUIA 2AWNA 2PMVA 1CZGA 2RSNA 1B4OA 2EY6A 2NN6G 2A6EC 4HSPA 3BIID 3NVVA 3AE6B 5HFYA 2SDFA 2QF7A 1JOKA 4IKGA 4KD4A 2AWOA 1ZDXA 1SNDA 2L12A 1CQVA 5AUIA 3NXWA 4H7BA 4QMGA 3Q8AA 4L8JA 2KA7A 1GB4A 2MPMA 3P1HA 2EYMA 1E2ZA 4ZYSA 5E4XA 3D6WA 4R3DA 3RZDB 3V2TA 4PT5A 3ZJTA 2WXQA 2M00A 4XWWA 2PVOD 3KBGA 4XDDA 4K2LA 5I6WA 2K28A 1F77A 1E9MA 1U4LA 4ABNA 4YTPB 3NWSA 2CVRA 2EYHA 3GP7A 2H4OA 5FO9B 4K2KA 3G6JB 2D5GA 1NR2A 1EY9A 2RBMA 2J42A 4K6DA 2JU6X 2VB2X 2RQXA 5DM63 4WAFA 4OGQC 5KNBA 1UWXA 1E10A 2IW3A 3VR3A 1PLFA 1HXYD 3DHQA 1QQRA 1RHPA 1NSNS 3IT4B 4HJGE 2DNEA 3VR4A 4C7YA 4R9WA 1D4BA 2WAQB 1STGA 4NMZA 2MGSA 5EPKA 2E2JB 1TJEA 3N9YC 3TEWA 2FINB 3SK8A 2YU9B 3W3AA 1HFNA 3AE2B 5IGFA 1ZXTA 4IFDH 3Q6SA 2A74C 4ZKCB 3K57A 4BBRB 3R2TA 4CJ1B 3D31A 1QNKA 4E6IA 4QB4A 4C7ZA 2IGHA 4BA1I 1V43A 5HURA 2F0QA 5I9OA 4CJ0B 1V1PB 2K9XA 2WS3B 4OO1H 1IBXA 3W5UB 4BWGB 5IGGA 1SMYD 2E2IB 3FVQA 3UI3A 2M9VA 2EY1A 4DA2A 1P7FA 1DZ1A 2NVXB 1BXTA 1C9FA 4L63B 5C5LA 1FNWA 1QB5D 1A15A 2QILA 3FC4A 1H9KA 2MEKA 1G6ZA 2PYKA 1FYCA 1F9SA 1KDAA 4US8A 1SNQA 1GXDC 1LT4D 1SSOA 1CJEA 2BOSA 4FF2A 2WXJA 1AZQA 1DOMA 1KLGD 1FCCC 1YJJA 4A3IB 5FLXE 3X3NA 1IKMA 4XYOA 1ZKOA 4IUQA 2KOLA 1X3QA 3SK5A 3R3OA 2QMTA 3Q23A 3ZJVA 3BVMA 1IGCA 2EYOA 4YT0B 1RYJA 1KDCA 1DOXA 1K8OA 3KQ4A 5IODA 3C46A 3S1NB 2NWGA 2EXZA 3NTIA 5CV7A 1JWSD 1CM9A 5CGKA 3P42A 1MI2A 4LJZC 1N61A 3QOJA 2K3UA 3MWYW 4MN3A 2JA7B 1SE4A 2JXTA 2F0OA 4HRSA 3SHLA 4C3JG 1RKNA 2J4XA 2WKCA 4I7ZC 2IT1A 2AUJD 4HTHA 1C8CA 1BBXC 1SYFA 4GDLB 1QKZA 1TS3A 2F0VA 1AN8A 1EU3A 3P7JA 2LFIA 5J22A 2WB1B 1C78A 3A56A 2EJFC 1SNCA 4TKOB 2X6LA 1PDXA 4NAMA 2V4DA 2A68D 1DM0B 2JEBI 2LEKA 2Q5WD 1O7LA 2G9HD 4J8QA 3VYUA 3VRAB 2HCCA 4M1UB 1GOZA 1K8MA 4D2KA 2IWHA 2WLBA 3AB5A 1WTQA 4KX6B 1MHHE 3AEGB 1F2RI 4A6QA 1S5DD 1WTRA 2YEPF 3MAQA 1R9TB 4KGTA 3T3NA 5ELCA 1SMYC 3NS1A 1Y8NB 3R2IA 1IYVA 4BS9A 1FD6A 1HHVA 2W3SA 2K7VA 1CFMA 2WP8J 2B2VA 2PNRC 2B2UA 1SE3A 2SAKA 5EJWA 4CKBA 3LNNA 1TWFB 3BK2A 3GTQB 4OO1I 4A3JB 4Q5VA 3K6OA 1JR0D 2GB1A 4TRDA 2LS01 5NUCA 2INPE 4KY7A 1NYRA 2HUGA 5I4DA 4OZBA 2F1MA 2K5QA 4GLSC 4HEA1 4CHTB 1UGJA 3FILA 1JCKB 2XNAC 3I8ZA 1A2TA 4G7HC 1T3QA 4A3BB 5EQ0A 2F0GA 1S5ED 1AP0A 1C4PA 3NE5B 1I3QB 4RCOA 1ZDVA 5C3EB 2R61A 2WXHA 5C3XA 3NUHB 3SFEB 4IUTA 3NTKA 3SE0A 2LJIA 5ELDA 4ARIA 1SNOA 5FK9C 3A7AB 4HEDA 1DCZA 5I9PA 5JPNC 1A3UA 4DFAA 3LWEA 4HR7B 3URYA 2B2YC 5T1IA 2FMMA 1CT1D 2BDNA 1FRRA 2N9LA 4AS1A 1EWHA 2VUMB 5EKIA 4K5VA 2NN6H 3S2DB 2CU3A 5M3FB 4HMJA 4Y7NB 2GI9A 1QT9A 2EJMA 3L3OC 2EJGC 4DAVA 2HCIA 2A68C 1WYGA 4ZKBB 3N52A 3SK6A 2L55A 1STNA 1EEID 5J39A 2INNE 3OWEB 5G5GA 2SNSA 1FXIA 1MBYA 5A2QE 2DY8A 3SEBA 3KWLA 4J6HA 1STHA 3PV0A 4A3GB 5IT9E 1BUVT 1AW7A 1R4QB 1I4HA 1DJRD 1YNND 5EE9A 1J9OA 3TP6A 1U4RA 2A69D 1JICA 1KABA 1Q10A 2I38A 4MACA 2HDLA 1JRPA 1JOOA 4OO1G 3TEXA 1PRTF 2RDHA 4DK1A 1BCPF 1Q1EA 2WXMA 5HG2A 3NHHA 4KK7A 1MSHA 1G8ZD 3C1FA 1H9SA 1WCMB 4FF4A 3RFZB 4LLGM 2ID0A 2WU2B 3HOXB 3AE8B 1VJKA 2ZW1A 2KN4A 1A2UA 1KDBA 3NK9A 5MPOA 1KNEA 1JWAD 4KTAA 1PUTA 1H9MA 5I2YA 3ABVB 3M4OB 4NDXA 4HKZE 5KGUA 1O7YA 5BMHA 3VYRA 4G7ZC 2PPBC 2CJNA 1HTPA 1GJXA 2HTME 1FRDA 3FAHA 1HEZE 1VDZA 3HP3A 1WTWA 3TP7A 3J7YW 3P20A 2BS2B 4MT5A 3P4RB 5COYA 5CORA 1JW9D 1EYAA 3OOCA 1YNJC 2HDEA 2PIAA 3I91A 3I4MB 4PV1C 5LHY1 3RLFA 3DM1A 4YSXB 1XCTL 1RCVD 1RODA 3VR9B 5K36H 1EU4A 2LY7A 3GTKB 4KJNA 1K83B 3AE9B 3GTMB 1W6KA 2KQ4X 3JAME 1ILQA 3AEFB 3I4LA 1WTVA 3V96A 1WVLA 2B63B 2QJLA 2E75C 2F03A 1GB1A 4HN7A 4A9AA 3OIPA 1SIJA 1JALA 1FNVA 3GV3A 3M3YB 2PQEA 3TBIB 2K03A 4MIUA 4WFN3 1PZKD 3NQTA 4OZAA 3H09A 2ZW0A 4OIJA 1EEFD 4C3HB 1GUNA 3GTOB 4XT3B 1N60A 1BDOA 1TS5A 2NN6I 5E3FA 4ZK9B 3HZXA 1C77A 1XTCD 2HDMA 4QCLA 3BDLA 3FEWX 3A8IE 4FF3A 1PFBA 2L1AA 3EVQA 4S3SA 1VMPA 3QIAA 3M7GA 3UI2A 3A7LA 2WXFA 3HG9A 4KMUC 3E5SA 4H2AA 3ERQA 4G7OC 4TSSA 3PUWA 3HOZB 1HCZA 2MHVA 1SYGA 4LAAA 1ZP0B 5DEHA 3S9WA 1JE4A 2NZ1D 4PMBA 4FVMA 1OO9B 3P1MA 3Q24A 1HZ6A 1BOSA 2Z1CA 3D6CA 3IXSA 4NAWB 2QIEB 2FJ2A 3PZ8A 5M9OA 4H0LC 5LL6S 1HZ5A 5BN4A 2A5HA 3PO2B 1S5BD 4PNYA 1RM6C 3B2GA 5D14A 4WORA 2GRIA 1LT5D 2F0IA 2BBCA 5FOBB 1OXUA 5IGCA 2JXMB 1F2ZA 5GXGB 2CQAA 1EY0A 1ENAA 3L4PA 1X32A 1OXVA 1YMHE 1AEXA 4FYDA 2DY7A 1SSNA 3GQBA 1VZ8A 3PMFA 2K33A 2Z8LA 1WTPA 3I57A 3MXGA 4RAUC 1TKGA 2D5DA 5C6AA 2M0AA 3P4SB 3GD7A 1Q8IA 3HKZB 1HTLD 2B2WA 3NBIA 3FDTA 1ZUD2 2BE5D 4UDUC 4USAA 3VQIA 1DOLA 2TMPA 1DXMA 1KFYB 4RGOS 2QSDA 2KDMA 1LTTD 4U673 1EY8A 4DU9A 2B8GA 4P2CB 4M0WA 3MVVA 4ZAIA 1OQQA 4N9PA 3AU7A 1D5XC 1U4PA 4KKIA 3L9AX 1IW7D 5KIXA 3PIO3 4EE2A 5CC4A 1HQRD 2RDFA 1FFVA 1B1ZA 1Q12A 2JA8B 3LYYA 4B9XA 2R92B 1D5MC 3S1MB 1J8IA 4QIWB 1Y56A 3C1EA 4AYBB 1I6HB 2DNCA 1DYQA 1PFMA 3WOEA 4N59A 3P63A 4A8XC 2QDBA 3GO5A 4H13C 2ICIA 3PIP3 4BA2I 1LV9A 3VYSA 4IUPA 4I65A 3I4NB 1NVID 2ENBA 2QCPX 2J7ZA 2EDGA 4KJOA 2VZKD 1PYWD 4HCSA 2IX3A 1C4CA 3AH7A 1FEHA 5EPLA 1SYBA 4K5XA 1CTMA 5C4JB 1EZ8A 2V3NA 2SOBA 2JEAI 3TP8A 4F8MA 4JWUC 1K50A 1IL8A 3PUVA 2WXKA 3DWGC 5FKAC 3ETRA 2NMQA 3EGRA 1GPXA 1O80A 2KVMA 4RKBA 3W1SA 1DOKA 4KHZA 2WNMA 4YSZB 3K0YA 2M19A 2NBFA 2EVBA 4RKLA 1F0ZA 2EKIA 1LLRD 3NBHA 3AEEB 3J7AV 4KGSA 3MFGA 4RNAA 2NYZD 1II3A 2I2YA 2EYFA 4YSYB 4HAEA 2Y3AA 2EYLA 4JWSC 2N0SB 4IALA 4FO2A 5D3DA 2Z4IA 3IL8A 1B53A 2BE5C 1HFGA 1XYIA 5IGEA 1TKWB 3TEZA 2L11A 5DNFA 3B2FA 2F0UA 3E0JA 3KLRA 4C3HG 1WD1A 5K36G 3T3OA 2WXOA 4P6VF 2F0WA 1B9RA 2FMCA 2R6GA 3F2UA 4M8AA 4OZCA 1SAPA 2JYOA 1TWAB 2F4IA 3T56B 2DLBA 1IW7C 1OXSC 4XTCS 2N9KA 1KLUD 4C2MB 1PRTB 4IQZA 5CBAE 2WDRB 2X38A 2AQ1B 2IX1A 2KACA 1F2LA 2TSSA 5CV5A 2N55A 3MTSA 1NAPA 5KNCA 3DEPA 1JROA 2EYPA 3BVGA 4FNFA 3A54A 1JMLA 1QG7A 5BMIA 4OVZA 4KHVA 2PZWA 1NENB 3I90A 4LK0M 5C4XB 1QJOA 5JXVA 4FXDA 1LT3D 2W55A 1FMAD 1JOQA 3K5MA 1OXXK 2E2DC 2G9DA 2WXNA 2L4NA 2H88B 1RJTA 1TR5A 1FO4A 3CIRB 1MD2D 4DF7A 1ZXIA 4ME5A 3KF8A 3DWPA 1RTNA 1LTRD 4UAIA 5C5MA 1L0YB 2W82A 1SF0A 4WQMA 3ONAB 4XDCA 1IBXB 4ZQ3A 1TY2A 3OW7A 2JZPA 1TY0A 1SYCA 3J80E 5KRUA 3MXUA 2KUMA 1DD2A 1LTID 4N9TA 4B08A 2KQ3A 1PRTD 1IKLA 1SNPA 1SEBD 3IKJA 1BCPD 2JX5A 1PTOH 3MP9A 4CKCA 1C76A 3E56A 4HKQA 3TMEA 2N88A 1I4XA 4ZLTF 2NUCA