1I4XA

Staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
total genus 72
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4xA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4xA02
3DWQA 2XN9C 3EA6A 1B44D 1BCPD 1LO5D 1PYWD 1FNUA 1RCVD 2RDHA 5D3IB 4DXGA 3V05A 1TY2A 1YN3A 3R8BA 1ENFA 4NZLB 1JCKB 1UNSA 1DYQA 1G8ZD 1KLGD 1JQYD 1UUPA 1I4QA 1BCPF 1JR0D 1PZJD 2Z8LA 1D6EC 1LT6D 2XRSD 4RGMA 1XTCD 1FNWA 3GP7A 1TY0A 1KTKA 3CHBD 2G9HD 1LTRD 3DWAA 5ELBA 1SJED 2ICIA 1CK1A 1JWUD 4L63B 2AQ2B 1CT1D 1CHPD 1LT5D 3EFXD 1JWMD 1S5FD 3SEBA 1PRTF 1F77A 1SE4A 1I4GA 1TS4A 2NTSA 1GOZA 1PZKD 2WV6D 1L0XB 3BYTB 1JWSD 3BVZA 2TSSA 4Z9CB 3MFGA 1PTOB 1BXTA 1HQRD 1EWCA 1V1OA 1LT4D 1SJHD 1BCPC 1S5ED 1SEBD 3DWPA 4K6LA 1PTOH 1V1PB 1XXGA 3R2TA 1EFID 1LTAD 2QILA 1EU4A 1PRTD 1B1ZA 4O1NA 1LTBD 1RD9D 1EU3A 1AW7A 1ET6A 1L0YB 1MD2D 5ELFA 3URYA 1PZID 1TS2A 1KLUD 4BWGB 1S5CD 3BZDB 5I4DA 1QILA 1CHQD 4RFBA 1PRTC 3KLSX 3MC0B 1RF2D 2IPKD 4RGOS 1I4RA 1SBBB 4RCOA 1V1PA 1EEFD 5FK9C 1SE3A 4RGNA 1YN5A 2QEJC 3R2IA 1TS3A 1EEID 2O2LD 1HXYD 2RDGA 5D3DA 1T5XD 3O13A 1PTOF 4OHJA 1D5ZC 2CHBD 1I4PA 4RHSA 1SE2A 5ELCA 4C56C 2J4XA 1FGBD 1LTID 1AN8A 2XRQD 1BCPB 1ESFA 3W2DA 1LLRD 4RHRA 1HTLD 4DXFA 2IJ0A 1ET9A 4RGTA 5FKAC 2XNAC 1LTSD 1S5DD 3BVGA 1I4XA 1DJRD 1SXTA 1YN4A 1PTOD 2AQ3B 2R61A 1PRTB 5TSSA 3OWEB 1D5MC 1RDPD 1STEA 3BYYB 4RH6A 3TSSA 1M4VA 1LTTD 5ELEA 4ZYSA 4L6TB 2AQ1B 1FNVA 1FD7D 2SEBD 4TSSA 1TS5A 1D5XC 1HA5A 1S5BD 1I4HA 1PTOC 4UDUC 1CQVA 3BVMA 5ELDA 1LT3D 1LTGD 2NTTA
chains in the Genus database with same CATH superfamily
5T1IA 3DUZA 2F0TA 3GZNI 3PUVA 1YEZA 3N52A 4KDLB 1E2ZA 1IYVA 2N9KA 2NBUA 4C3IG 3RNBC 4N8FA 1TXYA 5JJZA 3JVZX 3RNFC 2KVMA 4NPSA 2CH4W 3TZUA 2EMTA 1MHXA 5D6JB 1LT6D 4PZ7A 2EJFC 5DM63 4DR5L 4BXXH 4QGUA 3SDZA 1LTRD 4JLCA 4LLGM 5HGQA 4L2YA 4KKSA 1J7AA 1TIFA 1WTPA 2BDOA 3DPDA 1YITA 2Z4IA 2UUBQ 1JWMD 2IO3B 5EQ0A 2A69C 1WCMH 3JSVA 5DAUA 3WAMA 1I42A 1C9OA 4YY3Q 3ZNID 1JB7A 3BYTB 1CZWA 2F4IA 3KYDD 3GTLB 3PO2G 1WMHB 3NJTA 5JPMC 1B9NA 2RQXA 4M8AA 3NTIA 4K5WA 3ZYYX 2MFIA 1OEYA 2VH1A 3KWLA 1YD8U 4GDLA 4J6HA 1UGMA 2FAZA 3B0AA 3GZNB 4K81A 1YJJA 5D65A 4GKJL 3SHLA 2KDBA 2RD0A 3NUHB 4NXMQ 1I50B 3VRBB 3MXNA 2REXA 2D5GA 1TWAB 1XMOL 2C5CA 4C80A 2B3GA 1A70A 4FO2A 1ZGUB 4ZQ3A 4A4IA 4IG7B 1AE2A 3T9LA 2JZZA 2SNMA 4R3DA 2IY1B 4RFBA 4A3IB 3C2PA 4JI2Q 2HCIA 2B63H 2K5DA 2JK8A 2R2QA 2WDTB 2WNMA 5AZGA 1N32L 2E2DC 4J6IA 2MJ3A 4K1RB 2BKFA 2ES2A 3HG9A 4DHZE 4C3HH 1XYIA 1T3QA 4HPLB 4RCOA 1OQYA 2V3NA 1N33L 3PZ8A 1H9SA 2BOSA 4MACA 3QIAA 4YCVA 4H13C 2QCZA 1KRSA 2LKVA 2QEJC 1KDBA 1JWBD 1L4DB 1I5FA 3PRPB 1VQJA 1Q86C 3H9DA 3ITPA 1NDDA 1H4RA 4KKUA 2HUGA 3ONSA 1SNQA 5L95C 4L23A 1QB5D 1WXQA 3IAS1 1D5ZC 1WOCA 1TQOA 4ILWA 4PZ8A 2ICEC 4X3UA 4C2MH 5ELCA 1NI3A 4IURA 2HD3A 2IYDB 2WXRA 4LUZA 2QDFA 3DBLI 3DHHC 4BFRA 2BYFA 4I7ZC 2I07B 1UE6A 1JT8A 5IGBA 3H0GG 2NVYB 4OL7A 3KF8B 4PZ6A 1ZYRC 2AEHA 2KJRA 2MRPA 3NOBA 4RF0A 4WFN3 1DOXA 1X32A 2F3IA 4LFAQ 3MHZA 3PQIA 5K36G 2WQYB 1NENB 3OWEB 2K01A 1Q90A 3G6EA 2MUYA 2OCEA 5C44B 5IYDH 3NS1A 4M0WB 5C2TB 3R3MA 3NQTA 1JJGA 3HRDD 2NVTB 4ZRKA 1WJNA 4PMWA 1SRUA 1N34Q 2L15A 3PO0A 1KAAA 4DNIA 3FHWA 4LF9Q 4BBSH 3ZDTA 3T3OA 2EQSA 5H1SE 4W9FA 5AUKA 3FC4A 1N60A 2JEBI 4CBVA 3T3NA 5IT9L 1I94L 5IYBG 2C9OA 5D3IB 5IWAQ 3S24A 3M3YH 3WANA 4OVVA 4I65A 4LNIA 1ENFA 3KLRA 4DV1L 4L5QA 3DBLB 3MTSA 5BN4A 3PF5A 3PCOB 1PZJD 5C0XH 1QOGA 1OXXK 2NN6H 3STBC 1XNQL 1FJGQ 3Q69A 1FGUA 4YCUA 4DAMA 3DM1A 2M0AA 1FNWA 2CW0D 2JA7G 2PJHA 3K8AA 3EBEA 2EVBA 3NENA 1UWVA 1SF0A 2V1YA 3FKIB 5F2DA 4HCNB 1SJED 1TT2A 4EQOA 4NXNQ 4AJWA 1VZ7A 4TQUS 3V60A 4CJ1B 2A4ZA 5CMDA 2RR9A 1WTXA 1PRTF 5J39A 4JBJA 2N55A 2KDFB 2EYPA 4DNTB 4HDOA 1WTWA 1RWSA 3VUYA 3S1RH 2PVOD 3K7AB 2OT2A 3S14B 1PZKD 5IP7G 2HDLA 3PIPA 5M3MG 3N20C 4MT5A 1C4AA 1BQQT 1TWHB 2WGSA 1JE4A 4ZRJA 5LMNQ 2BQQA 2KWCA 1QOHA 2MBQA 2Y3AA 5J17A 3GDEA 5JPNC 5LMUL 2N9XA 4MGIE 2WX0A 1WR1A 3PHWB 3PZ7A 3S1QH 1YBYA 5A2QL 1V1PB 4IJHA 3GTJH 4A3DH 1XNRL 4BY7H 4A3GH 4KSKC 4AYBG 1V2YA 1YIWA 1PYBA 2HJ1A 1K0SA 3SFDB 3L2PA 1IXRA 2D11A 4KHPL 2X38A 2EJMA 1QOAA 1O7LA 3MP9A 3GTQB 1OGWA 4A3MH 1XLOA 1PH1A 2LD9A 2V3SA 2O6VB 5JJLA 2PVGC 1E5WA 4DBGA 1RF2D 1FFVA 1UE5A 1ZDVA 4IOAA 3G7LA 4RGOS 4DN4M 1P8LA 4DK1A 2KC1A 3Q3OC 1QVGA 5IGDA 3QA8A 3B6YA 5KNDA 1WIAA 4I6NB 2KLGA 3L0OA 2R7DA 3D0FA 1TWFH 1F52A 1WY8A 2CVRA 3FILB 4WAFA 1FL0A 2FINB 3FMCA 1NNXA 3C1FA 4DR3Q 5I6WA 4A3EG 1O7ZA 3CMEA 2OWOA 1WYGA 3M4PA 1XLQA 1HFNA 4LFBQ 2F4VL 1DONA 5GXGB 4R4TA 5D7GA 3I2ZA 2C35B 2MX2A 4RAUC 1SYCA 3Q23A 2IGDA 3VYUA 3DLLA 4NQLB 1PMRA 1WVLA 3PIO3 5GADC 3JAML 4JV5L 1PH9A 2MBHA 2BVCA 3QO2A 4A3FB 2JQOA 4F88A 3H3VI 1YOVB 2ZJRA 3H7SA 4LK0M 1B3AA 1XF5L 3A5ZB 1P98A 1HFGA 2KCCA 4IUTA 1WX8A 5ELOA 3S9WA 4FF2A 1T9HA 4PMCA 2AUJD 3RCZA 1IBKQ 4ZYSA 1CMXB 4OIKA 2ZNVB 3UDFA 4W9HA 3GTGH 1J8IA 4EZKA 2AKWB 2B63G 3U7ZA 3BZKA 4PS8A 2JWZA 4WJNA 1QWYA 1KC8C 2X8XX 5ELDA 3TEHB 4UP8A 4YWLA 4LJOB 3UQBA 2V9HA 2X6LA 1TKGA 3V05A 3I3CA 3J7AV 2KTFA 2K39A 4FHJA 4RF1A 2YU9H 3JSVB 1IW7D 1WJ6A 2JRHA 3QIJA 2ZVOA 4RKBA 2KT7A 3BU2A 2KYWA 3KH0A 3Q6BA 1GJZA 3T1YQ 1EWYC 4IW0A 4IOIE 4GDLB 2M4NA 4IFDH 4R8NA 2JA7B 4K3BA 2N49A 1IBMQ 1M8AA 4C3JH 1L1OC 1O7YA 2PTLA 4P1CC 3K0YA 4M8MA 1E22A 4FJZA 3I90A 5D94A 1SNOA 1EY0A 2NTSA 4KMUC 5IYCH 4K7UA 2KQ4X 3KUDB 4D2KA 5EPKA 3MVVA 3AE8B 2YEPB 4K2KA 2LFIA 4ZK9B 2AL6A 4A90A 1GB1A 2Z0EB 3EQLC 5JJKA 3I91A 3MFGA 1O7IA 3SFEB 2ATWA 2B8GA 1A62A 4G7OC 5JOBA 4TQ1A 1RRBA 4WORA 5CC4A 2R92H 2BA1A 1LACA 4DR6L 1QLBB 4IUMB 2VL6A 4WQMA 1NUCA 2AYOB 1IL8A 4K6LA 4ID6A 4JI5Q 3JW0X 4EFOA 3U9SA 3ERSX 4EQ5A 3S16H 3U7DA 1H9SB 4DNRB 1VQFA 1EU4A 2R3ZA 1Q7YC 4NQKE 4ACFA 1QVCA 2KENA 4DR1L 5H92C 5JVH3 2M00A 5DM73 4WJWA 5C4HA 2B76B 1QG7A 3CD6A 1E1TA 1F9SA 2Z0DB 2K52A 2W82A 3RNGC 1XJVA 4H2AA 2O5JC 3Q2AC 2NYZD 2WWZA 1N61A 5IGGA 4RA8A 2WXIA 3CWIA 3AB5A 2HHHL 1MHHE 3IFTA 2LXAA 5IOIA 1XPOA 2JYTA 2K7VA 2NWGA 1WE7A 4CHKA 4BAXA 1QUQB 4B08A 3M4OB 5D3DA 2WYQA 5C3EH 1CZGA 4L8JA 4R8IA 2L32A 1U5KA 2B3AA 2J4XA 1S40A 1K73C 1L1OA 1DCZA 1P1AA 2Y0SB 1L6UA 2VQFL 4YHHL 2UXDL 3HZXA 3J80L 2JWUA 1LLRD 1IYUA 2XVSA 4FNFA 1L2FA 3E9HA 4EX5A 1VQ9A 3HRZC 2QHOA 2UXBQ 5KGUA 1V8QA 5E4WC 2L5TA 4N9F4 4A3KG 5J1ZA 4DK6C 3RZWC 2AWTA 2PNRC 2JU6X 3V61A 2MQJA 5TSSA 5FO7B 1D5MC 1NBWA 1Q1EA 2WB1B 4IUPA 1TJEA 1C76A 2D07B 1U4RA 3LWEA 1SGHA 3E3XA 3ER0A 1YQBA 2KO3A 5GMVA 4HLEA 2UXCQ 3W3AA 3EJIA 1N62A 1QZGA 1F9PA 4PQXA 4POFA 4GNXC 5LNK1 2CQAA 1LTGD 4QY7A 3FPPA 4B9XA 4X62L 4EQNA 3PLUA 2XN9C 1X3FA 3MEHA 2RDHA 3OTOL 3N3KB 3IFWB 2X69A 4OGQC 1WE6A 2C9WB 4C7ZA 2PZUA 5BYRA 1UZXB 3N30A 4WJQA 3ZJUA 1SNDA 3FRPB 1TT5B 3HP3A 4NJCA 3J7YW 4DDGD 5DNFA 1KJTA 1TGZB 1PUTA 2IW3A 1XTCD 3HOYH 4AH6A 3VYRA 2PW5A 2GBRA 3V96A 4KY5A 4LF5L 1B2TA 1CKMA 4JWUC 5E3FA 3S2DH 3AECB 4A55A 2NBVB 5EGTA 2JA5G 2D10A 4ZOHC 1JJ2A 1PGBA 5M5WB 3EUB2 3SE0A 3T4AC 4C1NI 4OX9L 2WU5B 3P1MA 1I4GA 3JYUA 4BBRG 4NJ6A 3ZDMC 3RUIB 2I1KA 3TS0A 2MNAA 3K9OB 4NW2A 1LQBA 3KLWA 2HCCA 4B3TL 2WXNA 3TBLD 3WAPA 1UE7A 4Z9CB 2LUEA 2LRWA 3WWVA 4DHJB 1X3EA 1MHWC 3E9IA 1ZPSA 3VVWB 1EWCA 1RODA 2SAKA 1NJIC 2R93G 3UE0A 1YNJC 5EBDA 4R1JA 5T1GA 5DCNA 1JORA 4KHVA 5FO9B 4OEMB 3B9JA 2LJIA 3VR6A 2ZW1A 4JK1C 1HZAA 2DNEA 4WWNA 3H1UA 5E6OA 1L0YB 4JI7Q 4XT3B 3ZTCA 4URKA 1TS2A 2IWHA 5EE1A 1KH0A 3TCAA 1OO9B 1SSNA 4AYBE 5IE8A 1TR5A 4GNXA 1JJCB 1RL2A 2NZOA 2Q5WD 1O80A 4OO1H 3Q3NC 4FN2A 1MKHA 1E10A 4JI0Q 2LRUA 1DOKA 3CCJA 1WD0A 3M95A 1GD7A 4B9WA 1K8OA 3H94A 1SNCA 2LFNA 2NZ1D 4GIVA 2RHQB 1EEID 2EELA 3A0JA 1T0QC 1YNNC 3P1HA 2N1VA 4IUQA 1VQ5A 1UH6A 1UEBA 4W9CA 5CV8A 4IWQA 2JA6B 1PFNA 3HOXB 1N33Q 5C44H 3I56A 4KV6A 4ABNA 4GB9A 1HZBA 4LF7L 2XRQD 2QSDA 2FUHB 3PSEB 5JEAH 4X66L 1U4LA 2QDBA 1W3SA 2WXHA 2DY8A 5EE3A 3KUCB 2PPHA 3Q8AA 5BMIA 3J81j 2R92G 1UBQA 2Y0SE 4DV3L 4AQYQ 1VQMA 2K28A 2MLBA 1ET9A 3BDLA 5FKAC 3KFUA 3I57A 1LTSD 1EYGA 2L11A 1TKEA 3K5OA 2DENB 2RDBC 3ZRCA 3TMPB 2EYMA 1PH4A 1TKYA 3AMUA 2WXPA 3AEGB 2I5LX 4A3KB 1NR2A 5CR3A 4C3IH 3TDQA 1SE8A 4A3BG 1WJ4A 2V4LA 4H7BA 3KBGA 2HTME 4V0BA 1WR6E 2BKRB 4YSYB 4RWSC 3DMUA 4JC0A 2KMCA 1PGXA 1STBA 2K6AA 1AE3A 3E0EA 3PV0A 3J9CA 4DV6L 4CKEA 3VH3B 2A5HA 4KJOA 4ZRZA 4JE3B 4B95A 4OXPA 4A3LG 2F3VA 2IDYA 3Q22A 2IBIB 4XGAB 2LXCA 1BUIC 3AI5A 1SNMA 1W6JA 1UUPA 1JR0D 4C7YA 1I94Q 3L16A 4IZ8A 5C5LA 3J81L 3PO2H 1BBUA 1GNUA 1PDQA 2A69D 1WTHA 1KTKA 4HCEA 3HK0A 1SN8A 4X64Q 4WWMA 5IGEA 4DV1Q 2BYEA 5G3LD 2QDLA 3GOEA 2KWDA 3CCUA 3QAQA 4YL8A 4YSXB 1K83B 1D4BA 3NXWA 3ICEA 1VF5C 1FFUA 3I4MB 3JC66 1JE5A 4P2CB 3TP7A 1GOZA 5C5MA 1L0XB 2LMCB 1CQFA 1EY5A 3I73A 4JBMA 1WX9A 2QJLA 2QMTA 1R4MI 1WTQA 1EQQA 2WHIA 4LW1A 4YTNB 1N8RC 3BG3A 2VW9A 5I9OA 3TN2A 4BKTA 3F1ZA 3U52E 3DWPA 1GUAB 4TMAB 4FA6A 2C60A 2XTIA 1KAWA 4GN3B 2QILA 4HMIA 2V3PA 4O1NA 1UEAB 4AIMA 1LTBD 4L5RC 1CTMA 1SLJA 3KOJA 5IP9H 5C0XJ 5LMNW 4GKKQ 1S3OA 1P3QU 4FXDA 1VMCA 4X57B 1FIQA 2JSVX 3DOWA 5C4XB 1PZID 1HR0W 1K9MC 5FLXL 2RPQA 3BZDB 3ECIA 1KRHA 5CV7A 4JI6L 5BN5A 1WRDB 5FO8B 2K8BA 2MWSB 2CJNA 4GN4B 1PRTC 1YNTE 5AFWA 1XNRQ 1E3PA 3RLNA 1JMCA 1X3QA 1WGDA 3LB8C 1L1OB 1DOIA 2D3BA 1PFMA 2NVXH 4HJ9A 1TWCH 5C4ZA 1GUSA 4IPCA 3KUPA 2JPHA 3H0GH 3V2TA 3CSFA 2KQ7A 2FMCA 4TRDA 2MGSA 4KJNA 3Q24A 3HOWB 5HGTA 1TZOA 2ZTEA 4ZKBB 3GS2A 2K6DB 2C7NB 4OIJA 1R4MB 4XDDA 5IGFA 4FBJB 2O2VA 2MJ8A 1RHPA 2BS3B 3PHXB 2E2HH 1JW9D 5K36H 4G11A 3B1LX 2ZCCA 4XIGS 1RYJA 4A3IG 1BMLC 3VR4A 1WGHA 2DZKA 4B0EA 2ZXRA 3D3RA 4RHRA 2FCMA 2R7ZB 3AE6B 4KN7C 1X65A 1CZPA 4JWSC 4ZHOA 1F2LA 1XT9B 1VQLA 4MJSA 1DJRD 2INPE 1MPEA 3BK2A 4P1BC 3CCRA 3SXHA 3GTOB 2KN5A 2F52A 1XX8A 3PT2B 4JV5Q 4DHJD 2GBJA 4DV7L 1STEA 4B9KA 4C4VA 2DYMA 3TEWA 1GJXA 2OJWA 2SDFA 5M5YB 2J7ZA 4KGTA 1FYCA 2XGTA 1OQRA 3RZFA 1B7YB 1GUOA 4JX1C 4JG2A 1VR9A 1PH6A 3P2BA 3TEXA 1NCVA 4DXAB 3GO5A 1SYGA 3RULA 2GVAA 2Z9HA 3HKZB 3NTKA 2UUAL 2JA7H 3S1MB 3QARA 1WF9A 1IZ6A 1EFWA 3WAOA 2NMQA 4B3ML 3FAHA 4HJKA 1QOBA 2PW7A 3CPFA 5H8YE 5M5XB 1WYDA 1ZEQX 2KA7A 4Y7NB 3I4NB 1JCKB 3TREA 1DYQA 1TWGB 1EY9A 2JXTA 2XEWA 3QCAA 3CCEA 3NZUA 1AEXA 5IP7H 2V4IB 1II3A 2K8HA 3LXFA 4CDDC 5M3MH 2HQEA 1N36L 3MJ5A 3L54A 2EYJA 5ISRA 4LF6Q 3ONAB 2DHZA 4K8IA 1HRJA 2J42A 3PS6A 1WXSA 3QK0A 2LY7A 3VXWA 2I46A 3EFXD 3MXUA 2E5LL 5L83A 1L2NA 4A9AA 2XSCA 1SE4A 1F77A 2K1BA 4OELB 2I5HA 3GTMB 5CHVC 4R4QA 1WTOA 1VZ8A 4IWPA 1EIGA 5DPSA 1CA5A 2DJGC 2AHOB 3IKJA 1SFOH 2A74C 3BVZA 3T53B 4DV4L 1FR3A 2ZVNA 4J1MA 5AZHA 4Y52H 1YJIA 3OJ3A 4E74A 4MDKE 4GNXB 5LXIB 3M4YA 4YCWA 1E8XA 4W9LA 4WWOA 5IY0A 1FCLA 1LT4D 1F2ZA 1S5ED 2KUMA 4JPBW 2GA4B 1PH5A 2BWES 2LVOA 3LX0A 3A55A 3FKIG 3NELA 3OW7A 4C1NK 1KXLA 2F1MA 4XDXA 1A15A 2E8GA 3VR3A 4HIKA 4OWWB 1SYFA 3M4OH 2KVRA 2WP9B 4YWGG 1QF6A 2VS1A 4IFDJ 2VRRB 4PS3A 2JYOA 4A3EH 2FIDA 2G4DB 5AJ3L 2EY6A 2K8CA 5C1ZA 2EOTA 3MC0B 3C0RB 3LDZE 4DR1Q 1N9WA 2F0DA 1EO6A 3NHEB 3PVLA 1CSQA 2KX0A 4OZCA 2K25A 3KW5B 3RZOH 3UDGA 3TEYA 2GBNA 1ZUD2 4JYAQ 2PW9A 1WGYA 2ZEQA 1O78A 1SDFA 2GVBA 1E0BA 2K5VA 2EZVA 4HXDA 1GVPA 1OTRB 3MWYW 1V5OA 4KK7A 3C46A 2JA8G 2BH8A 3GD7A 5CV5A 2UU9L 4JI3L 3U50C 2NS5A 5EPJA 3GTPB 4MIUA 3ND8A 4CDEC 4CKCA 5CV6A 2J7QB 3K80C 1DOMA 3G6JB 4E3CA 4WH4A 2DGYA 1STGA 1Y1VB 2N1WA 3BK1A 2G9DA 2VQFQ 4YHHQ 5IP9G 4DV0L 1MG4A 1W6KA 3OLMD 4JI4L 4C00A 2D2QA 3Q3JA 3DHIC 2Q8IB 2ZTCA 2BTEA 4L6TB 5LHY1 1FNVA 3K9PB 5CV9A 2NVQB 1V81A 2CS4A 2A6HC 3QWNA 1VRAB 3VYSA 2N8NA 2D0PA 2PI2A 4IOCA 2B8FA 2FJ2A 3HKZE 3P20A 1EIHA 1N5XA 1Y8RC 2NBWB 5E6JA 3B2GA 1TY2A 4A3FG 3EN2A 1CFMA 2LZ6A 2WXGA 4BOSC 2HDMA 3Q8DA 2UUCQ 2OQ0A 3CQZH 4TKOB 2ZCBA 1Z47A 4KY6A 1WRIA 1BT0A 2AX5A 3QX1A 1Q1BA 2J0TD 3JAMi 1Q10A 2GI9A 1SAPA 5EE9A 4GSWA 3ZXRA 1VQEA 3OTOQ 2RA4A 3F2BA 3I3TB 3CHBD 2PIAA 2G9HD 3DWAA 3IG3A 3GV3A 3PV1A 3VUWA 1D8LA 1QCBD 5FLMG 4NAWA 5JZEB 2K0PA 1HNZL 1CHPD 4PT5A 2I2YA 3PF4A 4II2B 2VUMG 2QA4A 4J15A 1S5FD 2AUKA 1GO3E 2KNBA 5M3FB 2BPSA 5GAEC 3RT3B 1LFDA 4LF5Q 3TP8A 4A20A 3D8GA 1JWSD 4APVA 5C23A 2TSSA 4IUNA 2Z6KC 2Z1CA 1K52A 2JUOA 4BY1B 3NQIA 3IBEA 2HIVA 3RR5A 4N6EB 4S0RA 2L0TA 1PFSA 4KGSA 5J18A 2N3SA 2JQRB 2K03A 1PTOH 4GLVB 2IO0B 3OIQA 1S72A 4B3TQ 2ENBA 4B3SL 2HIXA 1EWHA 4DUZL 2KMAA 4M1UB 3IFDA 2M2LA 1C79A 4EUTA 1PFBA 1TYGB 4BBNF 1KABA 4ANWA 2DX5B 1WX7A 1E7PB 2LSSA 2O2VB 3I5JC 4QUFA 1H95A 1XEEA 3RMKC 1CSPA 1S1QB 3AFQA 2NBFA 4MNOA 4DQOC 1WYWB 2PQEA 4GLSC 3RNEC 3VUXA 1GUWA 4PYUA 2A5UA 2ZTDA 4YIJA 1MVKA 5C4JB 4M01A 4RGNA 1DGJA 2JXMB 3R2IA 4HIMA 5IAAC 1HR0Q 4K5XA 3DBHI 1EUVB 4ALPA 4MJSB 4NJ7A 3AEDB 1B53A 3TIXA 3R66C 4A3KH 1J19A 4XE0A 1E7ZA 1ESRA 5CYUA 2HJ8A 4LFCL 4C4VB 4MELA 1T0SC 2BB6A 4IJLA 3AULA 2N9LA 2JA8B 2KXJA 3GE8C 1ILQA 2BE5D 3QOJA 5IN7A 4DR4Q 4A93B 2D5DA 2TMPA 1D1IA 3M4QA 2INNE 3AE9B 3T51B 2F0HA 4PNYA 1RAXA 4DXFA 3L9AX 2WX1A 2F0MA 2AMCB 3CCVA 2XNAC 4ARCA 4LF7Q 1HNXL 1IKMA 3GQBA 4JOIC 2Z6KA 5JH5C 1PRTB 3J7ZC 3L0WB 2N4FA 1EZ6A 4RH6A 2LHDA 2KX3A 3PIP3 1SR3A 2K33A 2L83A 4NP5A 2N9PC 4GLXA 4WQOB 2Y0SG 5IT9c 2JXXA 3DBHB 4HEDA 3L13A 2QGQA 5JJIA 1DD2A 5BMHA 3TZDA 3PMFA 2JA5H 2WDRB 2E2IH 4IQZA 1U0LA 4HSVA 1YNXA 4DV6Q 1D1KA 5EKKA 4BBRH 1VQOA 5JEAJ 1VD2A 3BZCA 4M02A 2R7FA 3HGBA 2XRSD 3M85A 5DPTA 3HOZB 1G291 2QKIC 1C1YB 2PMZB 1K8AC 2WB1G 3NE5B 1HNWL 1KRTA 1VQPA 4QF4A 3RN5A 3OIPA 1M90C 3P4SB 1WZ0A 4K14A 1A3UA 3S2HB 4BZAA 1XLPA 1JRPA 5A35A 3N1YC 2R93H 4W9GA 1HCZA 3A8KE 1QOFA 2UU7A 1YIJA 5HFYA 1J5EQ 2VUMB 2I5MX 1G6PA 5KYIA 4X6AH 1PH2A 3U4VA 2IHEA 3AEAB 3I63C 3S15B 1KDCA 4ITKA 4Q0FA 2JJQA 1YNJD 2H1EA 5IT9E 2QIEB 1ASYA 2G3QB 1NEKB 3W1YA 5KHOA 1MG8A 3KJOA 4HWIB 2ZZPB 4LTUA 2L3ZA 4K5VA 2M17A 3QWZB 2PLPA 2PEAA 1HH2P 1K8RB 3EFUA 5L37A 1SJHD 3A7AB 3KJPA 4OW0A 2IY5B 2E2JB 4JOIA 4NAMA 2RF4A 4CYEA 3Q3FA 2WACA 3S17B 1AZPA 2PE6B 1KF6B 1STHA 3I72A 2WKCA 1Y1WB 1QZEA 5KEEA 2UWQA 1B9RA 4FXGC 3DXJC 1IBLL 1ROEA 1K53A 2M19A 2N9EB 4BWGB 1E8WA 1TU2B 4ME3A 3IHPC 4HJAA 4MH8A 3SDLC 3ZKJC 2KDIA 1A63A 2IX1A 2DZJA 3MXNB 2L55A 2LEKA 2Q8TA 2K50A 4HKQA 3T13A 1GB4A 2D0OA 1F0ZA 5GROA 3FP9A 1YNND 5CV4A 3HOUB 2J53A 5CHWA 4IPDA 3CC2A 1X54A 3DVNU 3R93A 4BA2I 1G6JA 3AH7A 5FK9C 3NSWA 3ZGZA 4JI6Q 3I4OA 1ILPA 4WRDA 1OXSC 1P16A 4TKNA 3A1QA 3RZDH 3DHQA 2O5IC 5BN3A 4X3KA 1PVOA 1BNZA 1H9MA 2VY3A 4XWTA 2PPBC 3C19A 1T0RC 1MJDA 1A2TA 1WD1A 4EGVA 4LUOA 3OHXC 4A3BH 2I38A 4TV3A 1JRUA 3NS8A 3BIID 4QIWB 4F8MA 1ESFA 5GAHC 2A8VA 2LS01 4RCNA 2PQAA 4TUUA 3ZUNA 3JAMc 2IZVB 3S1MH 4KTAA 1FXIA 1JMLA 1OXVA 2LWPA 3PRMB 4ZRQA 1D2BA 4BKSD 5C6AA 4WJ3M 4KV2A 3TQYA 3EVQA 1L4ZB 4K7WA 1B9MA 1EZ8A 4KY7A 3RMHA 4A3LH 1YN4A 1ENAA 2WKDA 3KVFB 2LGIA 4KKTA 3I4NH 4Y7NH 2PYKA 2WXFA 3GV6A 1KIXA 4ZHPA 3KQ4A 3OYYA 4IM3A 4IUUA 1XTDA 2JA6G 3RPFC 3HOXG 4A3JB 4TSSA 3VA5A 4R4IA 3U2SC 3UI3A 1D5XC 2L4NA 4WWPA 4WAAA 2VQEL 2IY0B 1KFYB 1I6HB 2MO1A 2NTTA 3W1BA 4NAWB 2JSOA 4DV2L 4GMVA 1B44D 1LO5D 4UAIA 4NXML 4KLKA 4BKGA 1HZCA 1MSHA 4CJ0B 4E6IA 1HUMA 2KCTA 5ELNA 2G1EA 3JAME 4O42A 3CRLC 1G8ZD 1X3GA 2UUAQ 3TS2A 4A3CG 1RTNA 3F2UA 4JI8L 1V43A 4GLAC 3W5OA 2BE5C 2A68D 1PFDA 3F2DA 5FJ8G 1V49A 4GS3A 4TVAB 4JI2L 1TY0A 2G4SA 3ALBA 2W3RA 3AV8A 1WCMB 5ELBA 4HIDA 2KTRA 2RMMA 1FXTB 3MJWA 4YTPB 1N6ZA 5M9OA 1YJ9A 1ISNA 3A9JA 4H0LC 1EY8A 2EYLA 4N9TA 5E4XA 2RSUA 3A9KA 2CU3A 3CF6E 2SOBA 1CJEA 1QE6A 2DWQA 2B39A 4BOZB 1C4QA 4HJ5A 2NVUI 4N59A 2ASBA 4KKIA 1I6VC 1STYA 3RD4A 3KF6A 2Q2UA 1E24A 4QUCA 5D14A 3W9CB 5BR8Q 5KYLA 5I2XA 1SE9A 5HHDG 2VB3X 1U4MA 1KM7A 4YTMB 3GTLH 4FYDA 4G0NB 2RKSA 3AQQA 3PSIA 1YMHE 3A4RA 4B3RL 4P6VF 2YV5A 3HS0C 3G71A 3HOVB 4DV4Q 4YSZB 1PRTD 4FXCA 5CX3A 4U673 1E6EB 3F8TA 1HEZE 2P5ZX 5ELFA 2ALYB 3URYA 3J81i 1PXUA 2DNFA 1I50H 1X3PA 3I4MG 2NCNA 1V5TA 2H89B 4LFAL 1KHIA 3A74A 3D6WA 1OFFA 4DR5Q 2OXPA 1TWAH 2F0JA 2ID0A 1N34L 5J2RA 4ULLA 4A3IH 2X6GA 2KEDA 2L76A 3MEFA 5COYA 3CMMB 2KDEB 1N5WA 1KL9A 1SROA 4C2MB 3P4PB 4LF8L 2HE7A 1U4PA 5IWAL 3L10B 5AEKB 2YTXA 3FVQA 4ZUJA 4OZBA 5C0XI 2NN6I 1PTOF 4KZCA 4KI0A 5C3WA 1DZ1A 1WI0A 3NUCA 4P75A 3UE1A 5C4XG 5CTRC 3DHGC 3U30A 3NTHA 3ZLZA 2NR2A 2N7EA 2GBMA 4DFAA 1FJGL 4MN3A 2NVQH 4GKJQ 3ZNGC 2E6XA 3T1HL 2Z6BA 4QIWE 3NBHA 1YI2A 1EYDA 4RGTA 3M63B 4NXNL 1XMOQ 1K8MA 4CO7A 1SXTA 2PO4A 4JI3Q 4PG3A 2NVYH 3HOWG 2PI2E 3D4RA 3V6CB 1A6XA 3I7FA 2D3GA 2W55A 1UD7A 5I6YA 4PS7A 1JC7A 5C3XA 2DYOA 4USAA 3BJUA 3P42A 1N32Q 4MGZE 5KHQA 4P73A 2IX3A 1QT9A 3IAM1 2J0KA 4Q2JA 3O65B 4HCSA 4LNNA 1BBWA 3VFKA 1HA5A 4UDUC 1I4HA 2ZPYA 1YZ6A 4JQWC 1HTPA 3UIPB 4QQBX 3EIVA 3VH4B 2PE9A 2NVTH 3H6MA 2F0FA 4MHEA 1VMPA 2R7ZG 3W1SC 1BR9A 2FCSA 1EOVA 3R8BA 2D2CC 3VA7A 5M3FH 3KBXA 1ZP0B 2M0XA 3P4RB 1QNKA 1VDZA 2Z8LA 1K3BC 2L1BA 2K05A 4F1SA 4BY1H 2KJ6A 3GP7A 2OJRA 4E71A 2LGSA 1HTQA 1EOTA 3MHBA 1G51A 4LDTD 1VS0A 2ICIA 1JWUD 4GZYC 1LXDA 1CT1D 1R4PB 4GOPC 4DDID 1LT5D 4FJVB 1PV4A 2WIIB 3HKZG 3MA2B 2WB1E 5E7NA 1SB3C 1T0YA 1XD3B 3FKIH 2XBBC 2OQKA 1ML0D 1I3QB 3W5UB 3MXGA 1TZ1A 2Q8RE 2KK8A 2F0OA 3I4NG 2EE1A 3ERQA 4YWMA 4G7ZC 3S1QB 4LFBL 4A3DB 3K7AH 4BY7B 3S14H 2IGHA 2WP8J 2LXJA 1NTGA 1J7BA 2KD0A 1Q0WB 4DGZA 3ZJVA 3FEWX 1ZDXA 1TWHH 1K3RA 1B8AA 1EFID 4HR7B 2GN5A 2LXKA 4A3MB 5E1FA 3A1QB 2K32A 1ASZA 1WFQA 2CHZA 4RM8A 4H02A 2A68C 1ZOYB 5EE0A 4XC2A 4HKZE 1K0RA 1XNQQ 2KCNA 3R7RA 1MBYA 1CM9A 4HJ8A 1R7SA 3KLSX 1Q8IA 2J0MA 4A6QA 1IBKL 2RSOA 4B3SQ 2KC2A 1LM0A 2JA8H 2KFJA 3GTQH 5E6NA 1J8CA 3AYHB 1TWFB 3W1SA 2FFKB 2PQAB 4A93H 1VCBA 1WXVA 1EEFD 2VNUD 3PLVA 4LJZC 3J7AF 1PHJA 4QAYA 2E74C 1M1KC 3NWSA 2BF8B 1CUKA 4WURA 1EY7A 2CFMA 2CWPA 4MTNA 3K58A 1BVSA 2JT4B 1CA6A 1BDOA 3O13A 3MHSD 4KGRA 3ZNZB 2E75C 2L00B 3B08A 4XWWA 3MZ5A 4RHSA 2YLMA 2KZRA 3OPOA 3MC9A 1QNUA 4IFDI 4WJPA 2Q2IA 1VJKA 4IDIA 3SHQA 4GOPA 2A19A 3T1YL 1PDXA 5LMUQ 3ZTDA 3NVZA 1GUNA 5G5HA 1P7EA 3L4PA 3ULPA 3HVZA 4ZAIA 3OJ4B 4PYZA 2WLBA 4KHPQ 1NSNS 1ONLA 5J22A 5FR6A 3DCGA 4LJPB 3ENEA 1XPUA 2BBCA 1X6OA 2A6HD 4A3FH 4G4KA 3SK6A 3OMCA 3CXCA 2WXLA 1Z7TA 1VQ8A 1V1QA 1IBXA 2WDQB 1SMXA 5ELEA 2H5XA 1WGGA 1WXAA 4JW0A 2K22A 4JPSA 1HZ6A 1ZXIA 1F1HA 3GTKB 3HOZH 1ZXHA 3V6EB 1V9PA 4QCLA 1HNXQ 3G4SA 3TRZA 4MTKA 2KHSA 1TBEA 1CQVA 1K28A 2GOWA 3T8MA 1B3QA 4HAEA 2BGFA 3TEZA 2YU9B 1F2RC 2KTRB 1A5RA 5FLMH 1EQVA 4JI5L 1HE8A 3EA6A 1L0VB 2IO2B 4DXGA 2UYZB 1IUEA 3A9JB 1JQ4A 2K14A 1V86A 1IGDA 2LHEA 3A9KB 1QQRA 2VUMH 1W2BA 4HRSA 2I1JA 2EJGC 1UNSA 1KLGD 1A3VA 5KIXA 1Y1VG 2F4VQ 1FCCC 4UP9A 4W9IA 1BCPF 3KF6B 1RM6C 3J81c 4C3JB 2B2YC 2HTHA 4NKLA 2G5DA 3G48A 4S17A 1Y56A 4AWJA 2B2UC 2JYEA 2DNCA 1LM8B 4HPPA 4LAAA 2WXKA 2JY6A 3PUXA 2YYZA 4FXKC 3HVDA 2F0IA 2FMMA 2VH2A 5JHAA 4J3OD 3NVYA 4ANXA 4EEWA 1XPRA 3RLFA 2BCOA 3IRBA 5KRUA 3H3VH 5CBEE 4R9WA 4ARIA 4K6DA 2EMSA 2MBBB 1FEHA 5J3BA 4OONA 2DY7A 3EHVA 1OTCA 3S16B 3MC8A 5CORA 3SK8A 3U4ZA 3P7JA 4X3SA 1HQRD 3D4DA 4FADA 5IO9A 2K5PA 1SEBD 3VHTC 3I55A 3OOCA 3R3OA 4G3XB 4DR2L 1M94A 3U4EG 1IGCA 3J81E 2IT1A 3UQAA 2R6GA 4FF1A 1AARA 2L7RA 4AJYB 5FLXc 4NB3A 1KLUD 2RSNA 1NVID 3OG5A 1F9RA 5M3FG 1IL2A 1KD1C 5BO4B 4US9A 2F0EA 2WU2B 4B0MA 1LTLA 4LNKA 1Q3LA 4KD3A 4A8XC 3BWUD 1XMQL 1X9NA 3PGEA 1X1MA 4IUVA 2IHFA 2UXCL 4RMFA 4BY1G 3ML8A 1E7UA 2XK5A 1LGRA 4BS9A 2L52A 3HM3A 5D2MB 1SMYC 5C3EB 1LV9A 1Q81C 1EM7A 1YN5A 1VQ4A 4LNFA 3NBHB 3MXPA 4F7XA 3NY5A 3P4QB 5HI1A 1HXYD 5AZFA 3AEEB 2KBNA 3A8IE 2MP2A 1AWDA 2B2YA 1STNA 3H6NA 3N9YC 1V8CA 2B2UA 2OF1A 3TP5A 1SE2A 1BF4A 1E8YA 4DR6Q 2N0SB 4XYOA 3CU7A 4A3JH 4AUQC 2WFWA 3WOFA 4A75A 3E6ZX 1RFAA 2OOBB 2K5NA 5IOCA 5FLXE 1YQ3B 1I6HH 2CR5A 1HZ5A 4EKUA 4MSMB 4IPGA 3BVGA 4IALA 4EVOA 4F7ZA 1QJOA 1VQDA 1C77A 1F9QA 5EPLA 3L3OC 3SR1A 1BUVT 4DK0A 1V97A 2WXOA 2MO0A 1RJTA 4RM9A 1DOLA 1RFKA 2OTLA 1PYSB 2NB0A 3H15A 4PMBA 2MJDA 4M00A 1NI2A 2AL3A 2HD5B 2L12A 1BOSA 3DDCB 2HHHQ 1LT3D 5K5PA 2O4XA 2CKHB 2MSED 3VR8B 1C4PA 4HEA1 4A93G 1S3SG 4JGHB 4DAPA 1ZKOA 2EYOA 1F2MA 4LMQD 1YN3A 1K50A 1YJNA 4IM2A 3HOYB 2KAJA 4KIKA 1TKWB 4JI7L 2VQEQ 2W3SA 1JQYD 1XO3A 4OO1I 3S2DB 4DV2Q 2AWOA 2UXDQ 1UELA 3UIOB 3DEOA 4QMGA 2VZKB 3NWTA 2JN4A 3H8HA 1OXUA 4L63B 4DWFA 3ZJTA 1YX6B 2F0NA 4DAYA 4JI0L 4KD4A 3HOVH 4JI8Q 2MH7A 1NY4A 4MEMA 4XQQA 3ZRFA 2Z59B 2PCFB 2V1CC 2JX5A 2ONQA 2RVLA 1X55A 1E90A 5M5WH 3TL5A 3RLOA 5FOBB 1AH9A 1SNPA 3OMGA 3IL8A 5CHFA 1RIPA 2K5QA 1C4CA 4N8X1 4NDXA 4KX6B 2K4KA 2F0GA 2ZM6L 2R2OA 5CGKA 1WGKA 3A4SC 3CC4A 1V1OA 3WCQA 4X62Q 3HOZG 3AE4B 1HJPA 4XTCS 3K5LA 1QVFA 1SYEA 4G50A 3NPPA 3ZNHB 1GKHA 2F0KA 2FXQA 2KHJA 4AQYL 2K6QA 1RD9D 2D62A 4X65L 1VZ6A 2DYBA 4OWTB 4O0AA 4AOFA 3UI2A 1MD2D 3SVMA 1EF1A 1V80A 3D31A 1WFYA 3VR9B 1QILA 4K2LA 2QW7A 4B3RQ 4L5TA 3TP6A 2FIFA 1X56A 1N63A 3UGBB 3K5MA 2OEOA 3BINA 3IT6B 2KCMA 1VQIA 4N58A 2LVQA 4GOPB 4WIPA 1QUQA 4DUYL 3AMZA 3V3XA 1Z9FA 2PZTA 5HG2A 3QC8B 1Y8NB 2PKOA 3N32A 3NEMA 4YT0B 4OX9Q 2M1MA 2RBMA 1TS3A 2MA9B 5DLQE 4OVUA 1UBIA 1EQTA 4JBKA 3F2CA 1P9DU 4K0KL 1Y1WG 3CW2C 1EF5A 2EYFA 3EECA 1LUZA 1H9RA 2FHTA 5I2YA 4FDBA 2KJHB 1KLVA 4JI1L 4RMAA 1IBXB 1LTID 1AN8A 2WAQB 2JA6H 5BYSA 4LF8Q 3HOXH 2MHVA 4IPHA 2A6EC 4X64L 2E76C 3IAYA 1NBFC 3HOUG 1WH3A 3X3NA 3S1NB 3AEFB 4FJYA 4C3IB 5AUIA 1U9RA 1WJJA 1HTOA 2XWBB 3DQVA 4A76A 1CKOA 1TVXA 2CHWA 3D32A 4UPAA 3VQIA 2KECA 3PUWA 3EFCA 1VQ7A 3MTNB 1VQBA 3TSSA 3T1HQ 3PRZA 4W9EA 3X23A 2KKCA 3PO3G 4A3CH 1EY6A 1YX5B 5JHBA 2SEBD 5TR5A 2QCPX 4CDCC 2M8SA 4DR7L 3APCA 1PTOC 1F2YA 1H9JA 5FJ8H 2WXJA 4ICVA 1PLFA 4F8CB 3UF8A 3A54A 2HQLA 1F2RI 3DWQA 4LK1C 1HQMC 1DM0B 2RGFA 3DEPA 4KVGB 1BCPD 1PYWD 1GAQB 4IN3A 1J9OA 1FRRA 3PO2B 1BO0A 1JROA 1IP9A 4GDKA 2BDNA 2RCNA 3PGZA 4GKKL 1I3QH 2MQHA 4MZ9A 3NP8A 4DK3C 1EUJA 3DWMA 3IT4B 5G5GA 4TQ0A 4AP4C 4P16A 4ZRPA 1STAA 4HJ7A 1E7VA 4RGMA 4X66Q 3PIOA 4HTHA 2F0LA 3FKYA 3VR5A 1BKBA 1B50A 2C7HA 3ZQ4A 5IGCA 4DV3Q 4A3JG 1SIFA 2OEDA 3K59A 5IA7A 3VR2A 3APDA 4DK5A 5C3JB 4J8QA 4ME5A 1V9JA 4IWOA 4JL9A 4LF4L 1FM0D 1Z6HA 3DVNV 1KNEA 3M7GA 1GC7A 5E6PA 2ZXOA 2F0WA 2KDMA 1NMFA 3KWVA 3ZVVA 3ND9A 3TMEA 1K83H 4G7HC 1ACCA 4GN5A 4OWXB 2ZJPA 3ZJYC 3MAQA 3CF5A 4ICUA 3I4MH 4BXXG 1FRDA 2NPTA 2VB2X 4ZKCB 4LNOA 1BXTA 2KHWB 2B2VC 4DV5L 4YWKA 3Q8FA 4XX5A 4EE2A 5KNBA 2KWVB 1NAPA 3J80i 3WA0A 1HHVA 3AN1A 1G2SA 3LWUA 1R9TB 5KNCA 1VQ6A 2RCFA 1WCMG 5EAYA 3ULLA 3R2TA 4FF4A 2XK5B 1JICA 3A7LA 3UDIA 1OXTA 3HUIA 1B1ZA 1YVCA 2KEEA 2M9VA 1R4NI 3NZSA 4OZAA 3A33B 3KYCD 2MP1A 3RNCC 1AW7A 1ET6A 5I4DA 2D3AA 1D7QA 1VQHA 2MP2B 3NG0A 4L5SA 1YHQA 1G91A 1GM5A 4KZ0A 1I35A 2GB1A 3QR8A 4EZLA 1WM3A 2CJOA 2NVXB 3Q6SA 1PA6A 1TWCB 1U4AA 4B6WA 1KQSA 1PQSA 2LGYA 3W1GA 3E9SA 5C4XH 1OQQA 1GUGA 1MJCA 3H0GB 4POGA 2JZPA 4KDIC 2HT1A 1C9FA 2ZW0A 1Z2MA 2W9NA 2BS2B 3PUYA 3AE5B 2KLCA 3BY4B 2ZJQA 5DPRA 2E2HB 2O2LD 4BA1I 2YEPF 3L17A 3HOVG 1SYBA 2B2TC 4AQ7A 3N1XC 3W5VB 3C1EA 3CAMA 4P74A 3VAWA 1T5XD 1F9JA 1YHAA 3LJ3A 3Q3MC 4OHJA 2M56B 3KUZA 1H9KA 2QF7A 2VZKD 4ZLTF 3HOWH 1EY4A 1UF0A 3E56A 3Q8CA 3Q8BA 3Q0AA 4I6PA 2JA9A 2VXWA 2YVCA 4C3HG 2LGXA 3GTKH 1Q82C 2J52A 3RFZB 2WXMA 3VTWA 3KYHC 4RKLA 4LF6L 4H44C 1HTLD 1MGSA 1L7YA 1R4NB 2WAQE 4FP5D 2IJ0A 3CP0A 1WXMA 3HHMA 4HK2A 2YTVA 2R7ZH 2ASQA 2F0SA 3NK9A 2AQ3B 2R61A 4RG1A 1P0RA 2K3UA 2B2VA 1B70B 4LDTB 1D3ZA 4KHZA 1RDPD 3ULJA 2CHXA 2LJ5A 3M3JA 3A8JE 2MJEA 3QHTA 4KIKB 5HURA 2WXQA 4NPNA 3RD2A 3U8ZA 3KDFA 1A3TA 3GTOH 3OSOA 4KN4C 1T5EA 3PO3B 2H88B 1WM2A 1ZKHA 5A2QE 1Y14B 3K0XA 2KOXA 3P63A 3TBIB 4XYQA 5M5YH 3AE7B 1SSOA 5BYQA 3RNUA 5G3LF 2MBEA 1NYQA 3T56B 4DAYB 2K5WA 1FNUA 3SK5A 5M3MB 4ODGA 5IYDG 2KACA 1ZW7A 2Y5BB 2G45B 4G57A 4R4OA 3I4LA 2DBYA 2UUBL 2MBOA 2FNJB 5M5XH 1JB3A 4BBSG 1ZE3D 4PV1C 2F0QA 2B2WC 2BS4B 3TUOA 4YY3L 1A2UA 2IL8A 5LXHA 2Z0SA 1TWGH 3I8ZA 3H91A 3H09A 1CK1A 4AYBB 1GHJA 4CKBA 2GBKA 4MGKE 2B2TA 2LMCA 2D9UA 5GAGC 1SFOB 2CKZB 4GOCA 3NVVA 1UWXA 2CW0C 3AEVA 2V4DA 1C48A 3OW2A 1QZHA 4ZCKA 1EIFA 4JYAL 3M9BA 4DV7Q 1Q5WB 5C0XG 1XCQL 3FDTA 2NN6G 4S3SA 2IO1B 2PMVA 5JXVA 5EJWA 2EY5A 1C3TA 2CH4A 3GTMH 3MFYA 3KLSA 4XXEA 1FVIA 2FE8A 1C0AA 1BBXC 1CI3M 2E3TA 1BCPC 3NVWA 3R7QA 2KHIA 4B3MQ 4GU2A 4DKAC 1LTAD 1E1OA 1VDVA 3K7UC 3M62B 4A3EB 4LUVA 2SNSA 3A56A 1VF7A 3CC7A 2PMZE 1PH8A 2DJFC 1S5CD 1V6EA 3N1ZC 2WS3B 4ZRIA 1YHBA 1N36Q 3NRZA 4P7IA 4DR2Q 3RZOB 1L5PA 1AFPA 2OHFA 3PZDA 4JCVE 4CHTB 3IVFA 2MCNB 1OEYJ 3ML9A 1Y8PB 2IPKD 3NHHA 1XLNA 1MI0A 4A3PA 4A3DG 2A73B 3T16A 4A3GG 2L0FA 4BY7G 3HIZA 2E5LQ 3DBSA 3AU7A 1SYDA 2D3CA 4A3OA 3K81C 2GLSA 1DXMA 2EDGA 5IP4D 4EQPA 2L1AA 5T8IA 1UWMA 4KKJA 3RI7C 4MSQB 5GQOA 1PH3A 1TIID 1Q12A 1XMQQ 4A3MG 2DAFA 1GUTA 2KVZA 2B2WA 1VQAA 3ZW3A 2UUCL 1ICWA 1JOOA 2B63B 1XWEA 1CKNA 3N6RA 4LWCA 3DVGX 1WWTA 2LGDA 3SGIA 4C3HB 3CCSA 4I7AA 3RYTA 3X0WA 2Y5PA 3QG1A 1UAPA 2NZHA 2L0CA 2O6VD 3K5NA 2C7MB 3CMAA 1TTNA 3APFA 4FLHA 1L6VA 2Z4HA 4LF9L 3GTPH 4CGYB 1Q46A 2EXZA 3B2FA 4XDCA 2ON8A 1HZ9A 1EWIA 3AB9A 5IODA 4GDKB 2KJXA 3HEJA 5AJ3Q 1HA6A 1E8ZA 2I0QA 1EL0A 1YQ4B 2LVPA 3H7PA 2JVCA 3L08A 1YJWA 1MFWA 4HROA 2KFKA 1Y1VH 2ACZB 1FD7D 2EKIA 4GGQA 3UINB 1J7CA 4REZA 3QB3A 1TS5A 1AZQA 1MSGA 3PUZA 4QB4A 1VQNA 3VTUA 3RUZA 1RTOA 1IYJB 3EROA 4W9KA 3CQZB 2OTJA 2EXDA 1C7YA 1RCVD 2DUDA 4NMZA 3J80c 4L1BA 3WDNA 4JIOU 2PNHA 3WALA 5JAVA 2LUMA 2RPVA 3EGRA 1ENCA 2N88A 2BT6A 4I6LB 3QJYA 2MHJA 2UU9Q 2JF5A 3SD5A 3NZ3A 1VCIA 3E5SA 2GMIC 2NPTB 3CCMA 4BBSB 1Q8KA 1G2TA 2C5LC 4MM3A 1IW7C 4YXDB 3CIRB 3K6OA 2VZAA 5HKHA 1NE3A 4XQJA 1WTRA 2L9HA 4GXBA 4W9DA 4WJOA 1DOYA 3M3YB 2EY2A 5LMNL 3SEBA 3OWFA 5IIFA 5JVG3 3SR6A 2QC8A 3DVGY 4DV0Q 2EY1A 1HR0L 5G55A 2HDEA 2A1AA 1R4QB 2H4OA 4HN7A 2WV6D 2QEXA 4JI4Q 4U68A 5HY6A 4F87A 4BVUC 3ZO5B 1A8VA 4IKGA 1PTOB 4IFDG 2F0PA 5BMGA 3J80E 4ZDVA 4UHVA 2DN8A 3U58A 4C3JG 1IPGA 2ZJDA 5EKLA 4M8NA 2V0GA 2BB5A 1H8CA 3I9V1 5FR3A 5LL6X 4DR4L 1UE1A 2RDFA 4HJGE 5IYCG 3CCQA 1EU3A 4XT1B 4ASWC 2WINB 4V190 3AFPA 1G6ZA 3S1RB 2ZM6Q 2K04A 1UGJA 1WMHA 3NBIA 3OAWA 2B29A 2L05A 1CHQD 1SMYD 3K57A 3C8YA 4QJFA 4FF3A 1L0WA 3VTVA 3WIMA 4X65Q 1A0IA 4UP7A 4DR3L 1Q1OA 5EDSA 1HNZQ 2LI5A 1I4RA 1GXDC 1SBBB 2K5HA 1MJEA 3AE1B 2KOLA 4ZUIA 2LASA 3CRKC 1KOTA 1LABA 3GTJB 4A3GB 3S1NH 2FCQA 3UDXA 3V62A 4K3CA 4LNQA 2DLBA 1EQRA 1NR4A 3BS1A 4XYCA 5C4JH 1C78A 4DUYQ 4FULA 2K75A 4W9JA 2CHBD 1NYRA 3E0JA 4XQNA 2BH2A 2GRIA 2MEKA 2YTYA 3ABVB 1RKNA 4C56C 2F03A 3Q8EA 4N9PA 3KDFB 4HCPB 4P71A 2JRIB 3FPUB 1WGRA 3L7ZC 3J7A5 4K0KQ 1XCTL 1ZXTA 1YJ1A 3HFZB 3QQ8B 3QOLA 1EYAA 4KSLC 1IYFA 4DU9A 4DUZQ 2BW2A 4JI1Q 1MI2A 1I4XA 3P75A 1T6BX 1DGSA 5C3EG 4WJ4A 3U9OA 2Q2HA 2DAJA 3PPAA 1J5EL 3AXCA 2INCC 3A5UA 1MIUA 1HUNA 3ETRA 3S2AA 5IKCM 2J0JA 3BYYB 2KANA 1E2WA 4GN1A 1RLFA 2AQ1B 4DA2A 4DPGA 1WJUA 3LGJA 4MGYE 2JA5B 1GG3A 3BDCA 3BVMA 2E2IB 3CPWA 4K7SA 5LL6S 4P72A 4IO9A 3KF8A 4BBRB 2CWAA 4BBNC 1XQQA 2BYTA 3ZIMA 2XIWA 4FVMA 3VRAB 1Z5SB 4IM0A 2W54A 1GHKA 4EOYA 1P7FA 3DBRI 2PZWA 4NZLB 4DR7Q 1IBML 1JALA 1GC6A 1QKZA 4M0WA 3RN9C 1VQCA 4LFCQ 1VQGA 4ANUA 4JVZA 1I4QA 3PREA 1VQKA 1D6EC 3X3MA 2JP1A 4FHKA 2N78A 4EZJA 1S4ZA 3BDOA 4PK1A 2R93B 3GTGB 3AU4A 4NNJB 3Q14C 1I7HA 2F3WA 3HM6X 3IXSA 4HPMB 2AQ2B 1VLBA 1R9TH 2MPMA 2FUG1 3LNNA 4ZYNA 3I70A 2K9XA 1E0ZA 3HKSA 3C3LA 1TS4A 4CDFC 1PGAA 4IC7B 4XZ4A 1NMGA 3SU8X 3S2HH 4HIOA 1HPCA 3AE2B 4NY0A 3DWGC 5EKIA 4O2DA 2XWJB 3D6CA 4X3TA 3AU5A 4HSPA 1KDAA 2EKEC 3HOYG 5LLIA 3AM9A 3GB1A 2MW5A 2N7JA 1EYCA 1J0GA 1ICFB 4LF4Q 3S15H 2Y5CA 5NUCA 2CQOA 1K51A 4Q5VA 4R4CA 1JWAD 4JBWA 3CKIB 1XXGA 4BKSA 3D4WA 1E9MA 1WSPA 2JZ3B 3DBRB 4MH0E 1FXAA 5G2NA 2AWNA 3VDZA 4DV5Q 4HMJA 1ZYRD 2E2JH 5MPOA 4ANVA 3S17H 2CCZA 1Y1WH 2N7DA 1Y69U 2FCNA 4DHZB 1IHZA 2ZT9C 3CSTA 2L8JA 3VDYA 3CCLA 2EPBA 1HNWQ 1AYFA 2R92B 1CKNB 4OVZA 5DEHA 3RZDB 2ZNVC 5IYBH 1V1PA 3AE3B 3QJZA 1AP0A 3ZXVA 1SE3A 4DF7A 1FPYA 3DM3A 1EIYB 2F0VA 3HOUH 1LYLA 2RDGA 5EBCA 4A3BB 3TJPA 1WZ3A 2CU1A 4QL5A 5CBAE 2WDVB 2FBWB 1PH7A 2RHSB 2ZPNA 2BYVE 4RNAA 2A6ED 1I4PA 2DZMA 1JOKA 2UXBL 4OO1G 2O6VA 2IX0A 3H7PB 3M7NA 1FGBD 1JOQA 4AS1A 3KK7A 2KFKB 1BCPB 4US8A 3PO3H 3STBD 3GE3C 3SK4A 3RN2A 3W2DA 1J6QA 1Y8OB 4K8JA 4UY8C 2K1FA 5DPWA 1KNAA 1IKLA 2DZIA 1IBLQ 3VYTA 1S5DD 3H3VC 2NUCA 3FILA 2IGGA 4HDQA 4II3B 1GPXA 1K8GA 1B4OA 1PTOD 3LYYA 5C44G 1FMAD 3RNAC 2BA0A 4HVBA 4CQNA 2Q2TA 2ZXPA 1FO4A 2F0UA 3WOEA 1M4VA 4DAVA 2KQSA 3PTFC 1LTTD 4LCDE 5JEAG 2JEAI 1FD6A 3AEBB 5I9PA 1WTVA 5BR8L 2EYHA 2BWFA 1C8CA 2KN4A 1S5BD 2KMMA 2KWUB 3EC8A 2INDC 4CJ2C 2KQ3A 1WI5A 2EIFA 1SIJA 1E2VA 4MM3B 2JE6I 2WAQG
chains in the Genus database with same CATH topology
5T1IA 3DUZA 2F0TA 3PUVA 3N52A 1E2ZA 1IYVA 2N9KA 4C3IG 5JJZA 2KVMA 3TZUA 1MHXA 1LT6D 2EJFC 5DM63 3SDZA 1LTRD 4LLGM 4L2YA 4KKSA 1J7AA 1WTPA 2BDOA 2Z4IA 1JWMD 5EQ0A 2A69C 5DAUA 3BYTB 1CZWA 2F4IA 3GTLB 5JPMC 1B9NA 2RQXA 4M8AA 3NTIA 4K5WA 3ZYYX 3KWLA 4J6HA 1YJJA 5D65A 3NUHB 3SHLA 1I50B 3VRBB 3MXNA 2D5GA 1TWAB 2C5CA 4C80A 1A70A 4FO2A 4ZQ3A 2SNMA 4R3DA 4RFBA 4A3IB 3C2PA 2HCIA 2K5DA 2WNMA 2E2DC 2MJ3A 3HG9A 1XYIA 1T3QA 4RCOA 2V3NA 3PZ8A 1H9SA 2BOSA 4MACA 3QIAA 4H13C 2QEJC 2LKVA 1JWBD 1KDBA 1L4DB 3ITPA 4KKUA 2HUGA 1SNQA 4L23A 1QB5D 1WXQA 3IAS1 1D5ZC 4X3UA 1TQOA 4ILWA 2ICEC 5ELCA 1NI3A 4IURA 2WXRA 4I7ZC 2I07B 5IGBA 2NVYB 4OL7A 1ZYRC 4RF0A 4WFN3 1DOXA 1X32A 3MHZA 5K36G 2WQYB 1NENB 3OWEB 2K01A 1Q90A 3NS1A 2MUYA 5C44B 5C2TB 3NQTA 3HRDD 2NVTB 4PMWA 3PO0A 1KAAA 3T3OA 5AUKA 3FC4A 1N60A 2JEBI 4CBVA 3T3NA 5IT9L 2C9OA 5D3IB 4I65A 1ENFA 3KLRA 3MTSA 5BN4A 1PZJD 5C0XH 1QOGA 1OXXK 2NN6H 3Q69A 3DM1A 2M0AA 1FNWA 2CW0D 1SF0A 2EVBA 3FKIB 5F2DA 1SJED 1TT2A 4EQOA 1VZ7A 4TQUS 4CJ1B 5CMDA 1WTXA 1PRTF 5J39A 2N55A 2EYPA 4DNTB 1WTWA 1RWSA 2PVOD 3K7AB 2OT2A 3S14B 1PZKD 2HDLA 4MT5A 1C4AA 1BQQT 1TWHB 1JE4A 1QOHA 2Y3AA 5JPNC 3PZ7A 4HKQA 5A2QL 1V1PB 3SFDB 2X38A 2EJMA 1QOAA 1O7LA 3MP9A 3GTQB 1XLOA 2PVGC 1RF2D 1FFVA 1ZDVA 3G7LA 4RGOS 4DN4M 4DK1A 5IGDA 5KNDA 2CVRA 3FILB 4WAFA 2FINB 3FMCA 3C1FA 5I6WA 1O7ZA 1WYGA 1XLQA 1HFNA 1DONA 5GXGB 5D7GA 4RAUC 1SYCA 3Q23A 2IGDA 3VYUA 1PMRA 1WVLA 3PIO3 3JAML 3QO2A 4A3FB 4F88A 4LK0M 1B3AA 1XF5L 1HFGA 2KCCA 4IUTA 3S9WA 4FF2A 4PMCA 2AUJD 4ZYSA 4OIKA 1J8IA 3U7ZA 1QWYA 5ELDA 2X6LA 1TKGA 3V05A 3I3CA 3J7AV 4RF1A 1IW7D 4RKBA 1EWYC 4IOIE 4GDLB 4IFDH 4R8NA 2JA7B 1M8AA 1O7YA 2PTLA 3K0YA 3I90A 1SNOA 1EY0A 2NTSA 4KMUC 2KQ4X 4D2KA 5EPKA 3MVVA 3AE8B 2YEPB 4K2KA 2LFIA 4ZK9B 1GB1A 4A90A 3EQLC 3I91A 3MFGA 3SFEB 2B8GA 4TQ1A 4G7OC 5JOBA 4WORA 5CC4A 2BA1A 1LACA 1QLBB 4WQMA 1NUCA 1IL8A 4K6LA 4ID6A 3U9SA 1H9SB 4DNRB 1EU4A 2R3ZA 5H92C 5JVH3 2M00A 5DM73 4WJWA 5C4HA 2B76B 1QG7A 1F9SA 2W82A 4H2AA 2O5JC 2NYZD 1N61A 5IGGA 4RA8A 2WXIA 3CWIA 3AB5A 1MHHE 3IFTA 2JYTA 2K7VA 2NWGA 4B08A 3M4OB 5D3DA 1CZGA 4L8JA 4R8IA 2L32A 2J4XA 1DCZA 2Y0SB 1L6UA 3HZXA 3J80L 2JWUA 1LLRD 1IYUA 2XVSA 4FNFA 3HRZC 5KGUA 1V8QA 5E4WC 2L5TA 5J1ZA 2PNRC 2JU6X 5TSSA 5FO7B 1D5MC 1Q1EA 2WB1B 4IUPA 1TJEA 1C76A 1U4RA 3LWEA 5BYSA 3W3AA 3EJIA 1N62A 1F9PA 4PQXA 5LNK1 2CQAA 1LTGD 3FPPA 4B9XA 4EQNA 2XN9C 3MEHA 2RDHA 2X69A 4OGQC 4C7ZA 2PZUA 5BYRA 3ZJUA 1SNDA 3FRPB 4NJCA 3HP3A 3J7YW 5DNFA 1PUTA 2IW3A 1XTCD 3VYRA 2PW5A 3V96A 4KY5A 1B2TA 4JWUC 5E3FA 3AECB 4A55A 5EGTA 4ZOHC 1PGBA 5M5WB 3EUB2 3SE0A 3T4AC 4C1NI 3P1MA 2WU5B 1I4GA 4NW2A 2HCCA 2WXNA 4Z9CB 1ZPSA 1EWCA 1RODA 2SAKA 1YNJC 5EBDA 5T1GA 1JORA 4KHVA 5FO9B 3B9JA 2LJIA 3VR6A 2ZW1A 4JK1C 2DNEA 1L0YB 4XT3B 1TS2A 2IWHA 5EE1A 1KH0A 1OO9B 1SSNA 1TR5A 2Q5WD 1O80A 4OO1H 1E10A 1DOKA 1WD0A 4B9WA 1K8OA 3H94A 1SNCA 2LFNA 2NZ1D 1EEID 2EELA 1YNNC 3P1HA 4IUQA 5CV8A 2JA6B 1PFNA 3HOXB 4KV6A 4ABNA 2XRQD 2QSDA 5JEAH 1U4LA 2QDBA 2WXHA 5EE3A 2DY8A 3Q8AA 5BMIA 2K28A 1ET9A 3BDLA 5FKAC 3I57A 1LTSD 2L11A 1TKEA 3K5OA 2EYMA 1TKYA 3AEGB 3AMUA 4A3KB 1NR2A 5CR3A 3TDQA 4H7BA 3KBGA 2HTME 4V0BA 4YSYB 4RWSC 3DMUA 1PGXA 1STBA 2K6AA 3PV0A 3J9CA 4CKEA 2A5HA 4KJOA 4ZRZA 2F3VA 2IDYA 3Q22A 1BUIC 1SNMA 1W6JA 1UUPA 1JR0D 4C7YA 4IZ8A 5C5LA 3J81L 1PDQA 2A69D 4HCEA 1KTKA 4WWMA 5IGEA 5G3LD 4YSXB 2KWDA 1D4BA 1K83B 3NXWA 1VF5C 1FFUA 3I4MB 4P2CB 3TP7A 1GOZA 5C5MA 1L0XB 2LMCB 1CQFA 1EY5A 3I73A 2QJLA 2QMTA 1WTQA 4YTNB 3BG3A 5I9OA 3TN2A 3U52E 3DWPA 4TMAB 2QILA 4HMIA 2V3PA 4O1NA 1UEAB 1LTBD 1CTMA 2WXPA 5C0XJ 4FXDA 1VMCA 1FIQA 2JSVX 5C4XB 1PZID 5FLXL 3BZDB 1KRHA 5CV7A 5BN5A 5FO8B 2CJNA 1PRTC 1YNTE 5AFWA 1X3QA 3LB8C 1DOIA 1PFMA 5C4ZA 1GUSA 3KUPA 3V2TA 2FMCA 4TRDA 2MGSA 4KJNA 3Q24A 3HOWB 5HGTA 1TZOA 4ZKBB 3GS2A 4OIJA 4XDDA 5IGFA 2MJ8A 1RHPA 2BS3B 1JW9D 5K36H 4XIGS 1RYJA 1BMLC 3VR4A 4B0EA 2ZXRA 3D3RA 4RHRA 2R7ZB 3AE6B 4KN7C 1CZPA 4JWSC 4ZHOA 1F2LA 1DJRD 2INPE 1MPEA 3BK2A 3SXHA 3GTOB 1XX8A 1STEA 2DYMA 3TEWA 1GJXA 2SDFA 5M5YB 2J7ZA 4KGTA 1FYCA 1OQRA 3TEXA 1GUOA 4JX1C 1VR9A 1NCVA 3GO5A 1SYGA 3NTKA 3HKZB 3S1MB 2NMQA 3FAHA 1QOBA 2PW7A 5H8YE 5M5XB 1ZEQX 2KA7A 4Y7NB 3I4NB 1JCKB 1DYQA 1TWGB 1EY9A 2JXTA 1AEXA 2V4IB 1II3A 3LXFA 2HQEA 3MJ5A 2EYJA 5ISRA 3ONAB 4K8IA 1HRJA 2J42A 2LY7A 2I46A 3EFXD 3MXUA 4A9AA 2XSCA 1SE4A 1F77A 2K1BA 3GTMB 1WTOA 1VZ8A 1EIGA 1CA5A 3IKJA 2A74C 3BVZA 3T53B 1FR3A 4J1MA 1YJIA 3M4YA 1FCLA 1LT4D 1F2ZA 1S5ED 2KUMA 2GA4B 3LX0A 3A55A 3OW7A 4C1NK 2F1MA 4XDXA 1A15A 3VR3A 1SYFA 2WP9B 4YWGG 1QF6A 4IFDJ 2JYOA 2EY6A 2EOTA 3MC0B 2F0DA 4OZCA 3TEYA 1ZUD2 2PW9A 1O78A 1SDFA 1E0BA 2EZVA 3MWYW 4KK7A 3C46A 5CV5A 3GD7A 5EPJA 3GTPB 4MIUA 3ND8A 4CKCA 5CV6A 1DOMA 3G6JB 4WH4A 1STGA 1Y1VB 3BK1A 2G9DA 1W6KA 2BTEA 2Q8IB 4L6TB 5LHY1 1FNVA 5CV9A 2NVQB 2A6HC 3QWNA 1VRAB 3VYSA 2B8FA 2FJ2A 1N5XA 3P20A 1EIHA 5E6JA 3B2GA 1TY2A 1CFMA 2WXGA 2HDMA 4TKOB 1Z47A 4KY6A 1WRIA 2AX5A 1Q1BA 2J0TD 1Q10A 2GI9A 1SAPA 5EE9A 2RA4A 3CHBD 2PIAA 2G9HD 3DWAA 3GV3A 1QCBD 2K0PA 1CHPD 4PT5A 2I2YA 1S5FD 2AUKA 5M3FB 3TP8A 3D8GA 1JWSD 2TSSA 4IUNA 2Z1CA 1K52A 4BY1B 3NQIA 4N6EB 4KGSA 2JQRB 2K03A 1PTOH 3OIQA 2ENBA 1EWHA 4M1UB 3IFDA 2M2LA 1C79A 1PFBA 1TYGB 1KABA 1E7PB 4QUFA 1XEEA 2NBFA 4DQOC 2PQEA 4GLSC 1GUWA 4YIJA 1MVKA 5C4JB 4RGNA 1DGJA 2JXMB 3R2IA 4K5XA 3AEDB 1B53A 4XE0A 1ESRA 5CYUA 2BB6A 2N9LA 2JA8B 1ILQA 2BE5D 3QOJA 4A93B 2D5DA 2TMPA 1D1IA 2INNE 3AE9B 3T51B 2F0HA 4PNYA 4DXFA 3L9AX 2F0MA 2XNAC 4ARCA 1IKMA 3GQBA 1PRTB 1EZ6A 4RH6A 2LHDA 3PIP3 2K33A 2L83A 4NP5A 4HEDA 1DD2A 5BMHA 3TZDA 3PMFA 2WDRB 4IQZA 4HSVA 1D1KA 5EKKA 5JEAJ 3HGBA 2XRSD 3M85A 3HOZB 1G291 2QKIC 2PMZB 3NE5B 4QF4A 3OIPA 3P4SB 4K14A 1A3UA 3S2HB 1XLPA 1JRPA 5A35A 1HCZA 3A8KE 1QOFA 5HFYA 2VUMB 5KYIA 3AEAB 3S15B 1KDCA 4ITKA 4Q0FA 1YNJD 2H1EA 5IT9E 2QIEB 1NEKB 4LTUA 4K5VA 2PLPA 1SJHD 3A7AB 4OW0A 2E2JB 4NAMA 2WACA 3S17B 1AZPA 1KF6B 1STHA 3I72A 2WKCA 1Y1WB 1B9RA 5KEEA 4FXGC 3DXJC 1ROEA 2M19A 1K53A 4BWGB 4MH8A 1TU2B 2IX1A 2L55A 2LEKA 2Q8TA 3T13A 1GB4A 1F0ZA 1YNND 5CV4A 3HOUB 2J53A 3R93A 4BA2I 3AH7A 5FK9C 3NSWA 3ZGZA 1ILPA 4WRDA 1OXSC 3DHQA 2O5IC 5BN3A 4X3KA 1BNZA 1H9MA 4XWTA 2PPBC 1A2TA 1WD1A 4EGVA 3OHXC 2I38A 3BIID 4QIWB 4F8MA 1ESFA 2LS01 4RCNA 4KTAA 1FXIA 1JMLA 1OXVA 4ZRQA 1D2BA 5C6AA 1L4ZB 3EVQA 1B9MA 1EZ8A 4KY7A 3RMHA 1YN4A 1ENAA 2WKDA 2LGIA 4KKTA 2PYKA 2WXFA 3GV6A 4ZHPA 3KQ4A 4IUUA 3RPFC 4A3JB 4TSSA 3VA5A 3U2SC 3UI3A 1D5XC 2L4NA 1KFYB 1I6HB 2NTTA 4NAWB 2JSOA 1B44D 1LO5D 4UAIA 1MSHA 4CJ0B 4E6IA 1HUMA 2G1EA 3JAME 4O42A 3CRLC 1G8ZD 1RTNA 3F2UA 1V43A 2BE5C 2A68D 1PFDA 1TY0A 2W3RA 3AV8A 1WCMB 5ELBA 2RMMA 4YTPB 5M9OA 4H0LC 1EY8A 2EYLA 4N9TA 5E4XA 2CU3A 2SOBA 1CJEA 1QE6A 2DWQA 2B39A 1C4QA 4N59A 4KKIA 1I6VC 1STYA 3RD4A 4QUCA 5D14A 3W9CB 5KYLA 5I2XA 5HHDG 2VB3X 1U4MA 4YTMB 4FYDA 2RKSA 1YMHE 4P6VF 3HS0C 3HOVB 4YSZB 1PRTD 4FXCA 4U673 1E6EB 1HEZE 5ELFA 3URYA 1PXUA 1X3PA 2H89B 3D6WA 1OFFA 2OXPA 2F0JA 2ID0A 4ULLA 2X6GA 2KEDA 5COYA 1N5WA 4C2MB 3P4PB 1U4PA 3FVQA 4ZUJA 4OZBA 5C0XI 2NN6I 1PTOF 4KI0A 5C3WA 1DZ1A 3NUCA 3NTHA 4DFAA 4MN3A 2E6XA 3NBHA 1EYDA 4RGTA 1K8MA 1SXTA 2PO4A 3D4RA 1A6XA 2W55A 4USAA 5I6YA 1JC7A 5C3XA 2DYOA 3P42A 2IX3A 1QT9A 3IAM1 4Q2JA 4HCSA 1HA5A 4UDUC 1I4HA 1HTPA 3H6MA 2F0FA 4MHEA 1VMPA 1BR9A 3R8BA 2D2CC 3VA7A 3KBXA 1ZP0B 3P4RB 1QNKA 1VDZA 2Z8LA 2L1BA 2K05A 3GP7A 1EOTA 3MHBA 2ICIA 1JWUD 4GZYC 1CT1D 1R4PB 1LT5D 1SB3C 2WIIB 3MA2B 1ML0D 1I3QB 3W5UB 3MXGA 2Q8RE 2F0OA 2EE1A 3ERQA 4G7ZC 3S1QB 4A3DB 2IGHA 4JE3B 4BY7B 2WP8J 1J7BA 4DGZA 3ZJVA 3FEWX 1ZDXA 4HR7B 1EFID 4A3MB 5E1FA 2K32A 2A68C 1ZOYB 5EE0A 4HKZE 2KCNA 1MBYA 1CM9A 1R7SA 3KLSX 1Q8IA 4A6QA 2RSOA 3W1SA 1TWFB 2FFKB 1EEFD 2VNUD 4LJZC 3J7AF 2E74C 3NWSA 4WURA 1EY7A 3K58A 1CA6A 1BDOA 3O13A 4KGRA 2E75C 4XWWA 3MZ5A 4RHSA 3OPOA 1QNUA 4IFDI 1VJKA 4IDIA 1PDXA 3NVZA 1GUNA 5G5HA 1P7EA 3L4PA 3HVZA 4ZAIA 2WLBA 1NSNS 1ONLA 5J22A 2BBCA 2A6HD 4G4KA 3SK6A 3OMCA 2WXLA 1IBXA 1Z7TA 2WDQB 5ELEA 4JPSA 2K22A 1HZ6A 1ZXIA 3GTKB 1ZXHA 4QCLA 2KHSA 1CQVA 4HAEA 3TEZA 2YU9B 1F2RC 1EQVA 1JQ4A 3EA6A 1L0VB 4DXGA 1IUEA 1IGDA 2LHEA 1QQRA 4HRSA 2EJGC 1UNSA 1KLGD 1A3VA 5KIXA 1FCCC 1BCPF 1RM6C 4C3JB 2B2YC 4NKLA 1Y56A 2B2UC 2JYEA 2DNCA 4LAAA 2WXKA 3PUXA 2YYZA 4FXKC 3HVDA 2F0IA 2FMMA 4J3OD 3NVYA 3RLFA 2BCOA 5KRUA 5CBEE 4R9WA 4ARIA 4K6DA 1FEHA 2DY7A 3S16B 5CORA 3SK8A 3P7JA 4X3SA 1HQRD 3D4DA 2K5PA 1SEBD 3OOCA 3R3OA 3U4EG 1IGCA 3J81E 2IT1A 2R6GA 4FF1A 1KLUD 2RSNA 1NVID 1F9RA 4US9A 2F0EA 2WU2B 4B0MA 1Q3LA 4KD3A 4A8XC 3BWUD 4IUVA 4BS9A 2L52A 1SMYC 5C3EB 1LV9A 1EM7A 1YN5A 4F7XA 3MXPA 3P4QB 5HI1A 1HXYD 3AEEB 3A8IE 1AWDA 2B2YA 1STNA 3N9YC 1V8CA 2B2UA 2OF1A 3TP5A 1SE2A 1BF4A 2N0SB 4XYOA 3CU7A 3WOFA 3E6ZX 5IOCA 5FLXE 1YQ3B 1HZ5A 3BVGA 4IALA 4EVOA 1QJOA 1C77A 1F9QA 5EPLA 3L3OC 3SR1A 1BUVT 4DK0A 1V97A 2WXOA 1RJTA 1DOLA 1RFKA 2NB0A 4PMBA 2MJDA 2L12A 1BOSA 1LT3D 5K5PA 2O4XA 3VR8B 1C4PA 4HEA1 4DAPA 1ZKOA 2EYOA 1F2MA 4LMQD 1YN3A 1K50A 3HOYB 2KAJA 1TKWB 2W3SA 1JQYD 1XO3A 4OO1I 3S2DB 2AWOA 3DEOA 4QMGA 2VZKB 3NWTA 3H8HA 1OXUA 4L63B 3ZJTA 2F0NA 4DAYA 4KD4A 2MH7A 4XQQA 2PCFB 2JX5A 2ONQA 2RVLA 5FOBB 1SNPA 3OMGA 3IL8A 2K5QA 1C4CA 4KX6B 4NDXA 2F0GA 5CGKA 1WGKA 1V1OA 3WCQA 3AE4B 4XTCS 3K5LA 1SYEA 3NPPA 2F0KA 1RD9D 2D62A 1VZ6A 3UI2A 1MD2D 3SVMA 3VR9B 3D31A 1QILA 4K2LA 3TP6A 1N63A 3K5MA 2OEOA 3IT6B 4N58A 4WIPA 3AMZA 3V3XA 2PZTA 5HG2A 1Y8NB 2PKOA 4YT0B 2RBMA 1TS3A 1EQTA 2EYFA 1H9RA 2FHTA 5I2YA 1IBXB 1LTID 1AN8A 2WAQB 2MHVA 2A6EC 3IAYA 2E76C 3AEFB 3X3NA 3S1NB 4C3IB 5AUIA 1U9RA 2XWBB 1TVXA 3VQIA 2KECA 3PUWA 3TSSA 1EY6A 2SEBD 2QCPX 1PTOC 1F2YA 1H9JA 2WXJA 1PLFA 3A54A 1F2RI 3DWQA 4LK1C 1HQMC 1DM0B 3DEPA 1BCPD 1PYWD 1GAQB 4IN3A 1J9OA 1FRRA 3PO2B 1BO0A 1JROA 2BDNA 3DWMA 3NP8A 3IT4B 5G5GA 4TQ0A 4P16A 4ZRPA 1STAA 4RGMA 4HTHA 2F0LA 3VR5A 1B50A 3ZQ4A 5IGCA 2OEDA 3K59A 3VR2A 5C3JB 4J8QA 4ME5A 1FM0D 1Z6HA 1KNEA 3M7GA 2ZXOA 2F0WA 2KDMA 3KWVA 3ND9A 3TMEA 4G7HC 1ACCA 3MAQA 1FRDA 2VB2X 4ZKCB 1BXTA 2B2VC 3Q8FA 4EE2A 5KNBA 1NAPA 1HHVA 3AN1A 1G2SA 3LWUA 1R9TB 5KNCA 3HUIA 3R2TA 4FF4A 1JICA 3A7LA 1OXTA 1B1ZA 2KEEA 2M9VA 4OZAA 2MP1A 1AW7A 1ET6A 5I4DA 1G91A 2GB1A 2CJOA 2NVXB 3Q6SA 1TWCB 3E9SA 1OQQA 1GUGA 3H0GB 2JZPA 1C9FA 2ZW0A 2BS2B 3PUYA 3AE5B 2E2HB 2O2LD 4BA1I 2YEPF 4AQ7A 1SYBA 2B2TC 3W5VB 3C1EA 1T5XD 4OHJA 2M56B 1H9KA 2QF7A 2VZKD 4ZLTF 1EY4A 3E56A 3Q8CA 3Q8BA 3Q0AA 2VXWA 4C3HG 2J52A 3RFZB 2WXMA 4RKLA 4H44C 1HTLD 1MGSA 4FP5D 2IJ0A 2F0SA 3NK9A 2AQ3B 2R61A 2K3UA 2B2VA 4KHZA 1RDPD 3A8JE 2MJEA 5HURA 2WXQA 1A3TA 3OSOA 4KN4C 1T5EA 3PO3B 2H88B 5A2QE 3P63A 3TBIB 4XYQA 3AE7B 1SSOA 5BYQA 5G3LF 1NYQA 3T56B 2K5WA 1FNUA 3SK5A 5M3MB 4ODGA 2KACA 4G57A 3I4LA 2DBYA 1ZE3D 1JB3A 4PV1C 2F0QA 2B2WC 2BS4B 3TUOA 1A2UA 2IL8A 3I8ZA 3H91A 3H09A 1CK1A 4AYBB 1GHJA 4CKBA 2B2TA 2LMCA 2D9UA 1SFOB 3NVVA 1UWXA 2CW0C 2V4DA 1C48A 5C0XG 1XCQL 3FDTA 2NN6G 4S3SA 2PMVA 5JXVA 5EJWA 2EY5A 3MFYA 3KLSA 4XXEA 2FE8A 1BBXC 1CI3M 2E3TA 1BCPC 3NVWA 1LTAD 1VDVA 4A3EB 2SNSA 3A56A 1VF7A 1S5CD 2WS3B 3NRZA 3RZOB 1L5PA 1AFPA 2OHFA 4CHTB 1Y8PB 2IPKD 3NHHA 1XLNA 1MI0A 2A73B 3T16A 3AU7A 1SYDA 1DXMA 2EDGA 4EQPA 2L1AA 5T8IA 1UWMA 4KKJA 1TIID 1Q12A 1GUTA 2B2WA 1ICWA 1JOOA 2B63B 1XWEA 3N6RA 1WWTA 4C3HB 2Y5PA 3QG1A 1UAPA 2L0CA 3K5NA 1L6VA 2Z4HA 4CGYB 2EXZA 3B2FA 4XDCA 2ON8A 3AB9A 4GDKB 5IODA 2KJXA 3HEJA 1HA6A 1YQ4B 1EL0A 4HROA 2ACZB 1FD7D 2EKIA 1J7CA 4REZA 3QB3A 1TS5A 1AZQA 1MSGA 3PUZA 4QB4A 3RUZA 1RTOA 3EROA 3CQZB 1RCVD 4NMZA 4L1BA 3WDNA 5JAVA 2LUMA 2RPVA 3EGRA 1ENCA 2N88A 2BT6A 3QJYA 3NZ3A 1VCIA 3E5SA 4BBSB 1G2TA 1IW7C 4YXDB 3CIRB 3K6OA 4XQJA 1WTRA 2L9HA 1DOYA 3M3YB 2EY2A 3SEBA 3OWFA 5IIFA 5JVG3 3SR6A 2EY1A 2HDEA 2H4OA 1R4QB 4HN7A 2WV6D 4U68A 4F87A 4IKGA 1PTOB 4IFDG 2F0PA 5BMGA 3J80E 2DN8A 2V0GA 4C3JG 5EKLA 2BB5A 3I9V1 5FR3A 5LL6X 2RDFA 4HJGE 1EU3A 4XT1B 2WINB 4V190 1G6ZA 3S1RB 1UGJA 2K04A 3NBIA 1CHQD 1SMYD 3K57A 3C8YA 4FF3A 1I4RA 1GXDC 1SBBB 3AE1B 2KOLA 4ZUIA 3CRKC 1LABA 3GTJB 4A3GB 2DLBA 1NR4A 3BS1A 1C78A 2CHBD 1NYRA 3E0JA 4XQNA 2GRIA 2MEKA 3ABVB 1RKNA 4C56C 2F03A 3Q8EA 4N9PA 3FPUB 3L7ZC 1XCTL 1ZXTA 3QOLA 1EYAA 4DU9A 2BW2A 1MI2A 1I4XA 3P75A 1T6BX 3U9OA 3ETRA 1HUNA 3BYYB 1E2WA 2AQ1B 4DA2A 2JA5B 3BDCA 3BVMA 2E2IB 5LL6S 3KF8A 4BBRB 2BYTA 2XIWA 4FVMA 3VRAB 2W54A 1GHKA 1P7FA 2PZWA 4NZLB 1JALA 1QKZA 4M0WA 1I4QA 1D6EC 3X3MA 2JP1A 1S4ZA 3BDOA 2R93B 3GTGB 1I7HA 2F3WA 3IXSA 2AQ2B 1VLBA 2FUG1 2MPMA 3LNNA 3I70A 2K9XA 1E0ZA 3C3LA 1TS4A 1PGAA 3AE2B 1HPCA 3DWGC 5EKIA 2XWJB 3D6CA 4X3TA 4HSPA 1KDAA 3AM9A 3GB1A 2N7JA 1EYCA 2Y5CA 5NUCA 1K51A 4Q5VA 1JWAD 4JBWA 3CKIB 1XXGA 3D4WA 1E9MA 1WSPA 1FXAA 2AWNA 4HMJA 1ZYRD 5MPOA 1Y69U 1IHZA 2ZT9C 4OVZA 1AYFA 2EPBA 2R92B 5DEHA 3RZDB 1V1PA 3AE3B 1AP0A