1I4XA

Staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 72
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4xA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4xA02
1F77A 1TY2A 2QILA 4L6TB 1I4QA 1FNUA 3MFGA 1TS2A 1EFID 1PRTD 5TSSA 3R8BA 1V1PB 2R61A 4BWGB 1SJED 3DWAA 3CHBD 2NTSA 3EA6A 2XN9C 3BVMA 1S5ED 1EEFD 1PYWD 1YN4A 1AN8A 1JWSD 3BVZA 1JWUD 1DYQA 1S5BD 1UUPA 4RGOS 3BYYB 5ELBA 1TY0A 1S5FD 3O13A 1ET6A 1V1OA 3TSSA 1RF2D 2ICIA 4TSSA 1SEBD 4C56C 1LO5D 1LT3D 1SE4A 1V1PA 3KLSX 1AW7A 1B44D 1TS3A 4O1NA 1FNVA 2IJ0A 2QEJC 1ENFA 3BVGA 1EEID 1PTOC 3R2IA 1PZKD 3V05A 1UNSA 2TSSA 1LT5D 5FK9C 1BCPB 1L0YB 1B1ZA 1CT1D 1JWMD 1HQRD 3GP7A 1TS4A 4Z9CB 1HTLD 1CHPD 1D5MC 1LTRD 1LTGD 1PTOD 4UDUC 1XTCD 2AQ1B 1PZID 4DXGA 1JR0D 3DWQA 1XXGA 1QILA 1EU3A 2XRSD 2WV6D 1ESFA 2XNAC 4K6LA 5D3DA 1SXTA 1PRTC 1FNWA 1I4RA 2AQ2B 1SE2A 1D6EC 1LT4D 4RGNA 1LTAD 5ELEA 1M4VA 4DXFA 2SEBD 1CHQD 1KLUD 1I4PA 5ELDA 5ELCA 1LTID 1EWCA 2RDGA 1EU4A 4RHSA 5D3IB 4RHRA 4NZLB 1I4GA 3W2DA 1HA5A 1CQVA 1LTSD 2CHBD 2G9HD 1LTBD 3SEBA 1BCPC 2J4XA 1LTTD 5I4DA 3BYTB 3R2TA 1I4HA 3DWPA 4RGTA 2RDHA 1FGBD 4L63B 2NTTA 4RCOA 1RD9D 1SBBB 1S5CD 2Z8LA 4RH6A 3BZDB 1HXYD 1MD2D 1L0XB 2O2LD 4OHJA 1RDPD 5ELFA 1D5ZC 1T5XD 4RFBA 1JCKB 1I4XA 1KLGD 1ET9A 1G8ZD 1S5DD 1BCPF 5FKAC 1PTOF 1BCPD 1YN3A 4RGMA 2XRQD 1PTOB 1STEA 3EFXD 2IPKD 1CK1A 1RCVD 1SJHD 1YN5A 3MC0B 1TS5A 3OWEB 4ZYSA 1PRTB 1DJRD 1D5XC 1LLRD 3URYA 1PRTF 1JQYD 1PTOH 1LT6D 1GOZA 2AQ3B 1KTKA 1FD7D 1BXTA 1PZJD 1SE3A
chains in the Genus database with same CATH superfamily
1WXVA 1SYGA 4M02A 5C4JB 2LWPA 4A6QA 3I4NB 4RA8A 2LMCB 2EMTA 1HZCA 3DHHC 4KIKB 1RJTA 1WTQA 2RDBC 3VTWA 1CKOA 3MEFA 4X64L 2ZT9C 1OQRA 4CKCA 1HNXL 2DZMA 1J7AA 1C4CA 4KI0A 1VQDA 5K36G 4YWKA 3PO0A 2JA7B 4GDLA 3IRBA 1J19A 3K81C 2E2JH 4A3BH 3P4RB 4IUVA 2EKEC 5IODA 4IKGA 1E7ZA 2EJMA 1IBLQ 3TEWA 4BBRB 3NBHB 4FJYA 3OTOQ 4FADA 5AUIA 4HXDA 2MX2A 3PUVA 1IZ6A 3S1MH 4KDLB 3T3OA 5LXHA 2X69A 1SN8A 4Y7NB 1NI2A 4HCPB 5AUKA 1SE4A 5J39A 4A3IG 3I4MH 4B3RQ 4N9F4 1JJ2A 3S1QB 4F1SA 5J2RA 4M01A 4JV5L 4CKEA 3HKZB 1J5EL 2IBIB 5LHY1 1EEID 4GLSC 1HZBA 3K5LA 2B76B 3K0YA 3QWNA 3IVFA 4JG2A 1QE6A 1SIFA 4LJZC 4WORA 4GNXB 5IOIA 2FNJB 4R1JA 3SK4A 4EQ5A 4X62Q 1WMHA 1Z6HA 3H0GG 4FVMA 4WJ4A 1XTCD 2INCC 2AQ1B 4FDBA 4RMFA 1L6UA 1SB3C 3CPWA 1XEEA 1YJJA 3NS8A 3UINB 1IBKL 2BYTA 1QCBD 4HLEA 1U9RA 4X65Q 2JA6B 2LI5A 5M3FB 2ZXOA 5J18A 1Q0WB 3OMGA 5CV5A 3EHVA 1ESFA 1YITA 2RKSA 4RAUC 1SXTA 4RNAA 2DNFA 1FNWA 2N49A 2RSOA 4N9TA 3C3LA 2DENB 3V62A 4AIMA 1PQSA 2HD5B 4EZJA 5CBAE 1YOVB 1CHQD 3Q8DA 1IL8A 2M0XA 5ELDA 3MHBA 3H8HA 4N6EB 4HSVA 3CIRB 5KNDA 4ANWA 4FHJA 2C5LC 1X1MA 2BKFA 3BINA 4AS1A 1FFVA 2L15A 4X3UA 1ZW7A 3ZKJC 1Q90A 2IO2B 5LL6X 3HOZG 5FR3A 3RI7C 2ZNVC 5CC4A 1I7HA 3OJ4B 5KRUA 3CCVA 1IHZA 4QL5A 2F0SA 1KC8C 3S24A 3H7PB 1H95A 2EE1A 1L4DB 4UAIA 1GJXA 3AEGB 1ML0D 2B29A 4RH6A 1LM0A 2IHEA 1ZXHA 3AI5A 1HXYD 4IUPA 3TP5A 1ZE3D 4DK5A 3ML8A 4ACFA 2NN6G 4N58A 4K5VA 2Z4IA 4MH0E 1WTOA 2V9HA 1A0IA 4ZAIA 2WDRB 4ANUA 3PHWB 2UYZB 2MBOA 2N7EA 1T0RC 3R93A 4DAVA 1TR5A 5EPJA 5H8YE 1PTOB 4QCLA 1STEA 1MG4A 4PS8A 1CK1A 5C3XA 4JYAQ 3PUYA 1Q86C 1WI0A 2QDLA 1BBWA 4KY7A 2PQEA 5L37A 5I2YA 4WJQA 4LNIA 1QT9A 4JBJA 4MTNA 3NHHA 2B2TC 2FBWB 1FD7D 3L9AX 1ENCA 1PZJD 5BYRA 3DVNU 4W9LA 2F0EA 4H44C 2EY1A 3D8GA 4YWMA 1RHPA 2R61A 2Z4HA 3P42A 3SDLC 3U8ZA 2D9UA 3C1EA 4DA2A 3ONAB 1WXQA 2MW5A 3PLVA 4GLVB 3A9KB 1RODA 3S14B 1ROEA 2HT1A 4N59A 1EEFD 2A68C 3BDLA 4K5WA 4ME5A 3HOXH 1B9NA 3HEJA 1TZOA 1S5BD 2Z0DB 3S15B 2LVOA 2JZ3B 2EY5A 2F0WA 4C7YA 3PCOB 1WZ0A 2MJ3A 4WAAA 4XWWA 5EBDA 1TKYA 2MP1A 2CH4W 3N6RA 4TSSA 2Y3AA 4YTMB 2WKCA 3H0GH 4FHKA 2LRUA 1V1PA 2KAJA 1XLNA 1Q82C 3KLSX 4O1NA 4IUQA 4KGSA 4YSZB 4DR7Q 4KKUA 3NXWA 1GG3A 3A8IE 4JQWC 1K3BC 4L5TA 2LJ5A 2H1EA 1U0LA 3AMUA 3ZXVA 3H3VH 1V5OA 4PT5A 1WIAA 2D3AA 3QHTA 3P4QB 2PNRC 1JJGA 2LGIA 4ILWA 2EY2A 3I4MG 2KYWA 4EFOA 4P72A 2DUDA 4UDUC 5FLXE 2EYHA 1WTWA 2K4KA 1PH1A 4IFDJ 2WDVB 4BBNF 2UU7A 2N4FA 3JC66 3MHZA 2K5HA 3CCJA 3GTPH 2F0MA 3DWQA 2TMPA 5GAHC 1VQPA 5IYDG 1GHKA 1E7PB 1Z2MA 2ZJDA 5GMVA 1QILA 3M85A 1XNQQ 1DCZA 1FJGQ 4LW1A 3EUB2 3JAML 3ERSX 4AQYQ 4MIUA 3M7NA 1LT4D 5K36H 1FMAD 2ZW0A 4G7ZC 3Q2AC 2Y5BB 2UUCQ 4A93G 4C3IG 3PT2B 4DXFA 2SEBD 3PPAA 3A5ZB 1H9SA 3CMMB 2FFKB 2L0CA 2R2QA 1NDDA 2M56B 1KLUD 4XTCS 4YT0B 3H94A 4R9WA 3IXSA 2JRHA 1YJ1A 5EE1A 3BWUD 3APDA 1WGDA 1SIJA 1WJ4A 3EQLC 1HA5A 2A6HC 3OG5A 4W9KA 3RNFC 1BDOA 1C7YA 3PTFC 4ZCKA 4GNXC 1DGJA 3R2TA 2RCNA 3N1YC 4A3IB 1HHVA 1TIID 5G3LF 3AU7A 1WJJA 3DLLA 1MHWC 1PXUA 3EROA 3GV6A 5CHFA 3A55A 4DV3Q 4RCOA 3ZUNA 4I65A 1A2UA 3CC4A 1ONLA 3VR3A 5EBCA 2AL6A 1WMHB 1H8CA 1IXRA 2ONQA 1R4NI 1TT5B 4P1CC 1CJEA 4HK2A 1G6PA 1M90C 1F52A 1VS0A 3A1QB 4KHZA 4MSQB 5GROA 3NSWA 2EOTA 1OO9B 4OZAA 3QWZB 3JAME 2WXKA 3IFWB 1YJNA 4OX9L 1HZ5A 5AZHA 2PW7A 1P98A 2E2IH 1HRJA 2KK8A 4BVUC 1B3QA 3PVLA 4HRSA 3M4PA 1F2ZA 1TY2A 1BXTA 4JI5L 5JHAA 3G6EA 2M1MA 5I6YA 4HKZE 3GB1A 3RYTA 1YVCA 1TS2A 4DR2L 3PO3G 1YIWA 1E10A 5TSSA 4A3KB 1MI2A 2JSOA 2GBNA 2LGDA 3T16A 2N8NA 1WX8A 2CKHB 4C3IH 2XIWA 3I5JC 4WWMA 2NBFA 1IGDA 4DWFA 4K5XA 1K52A 4DF7A 1A3TA 5EQ0A 1E0BA 1QB5D 5BR8L 2XK5A 4KN7C 3RLNA 2HD3A 4DU9A 1XMOQ 1ZDXA 3VVWB 1E8ZA 1XNRL 1DOKA 4LFAQ 3AE5B 2IYDB 1NCVA 4J15A 3P20A 3WWVA 4JBWA 4XYCA 4HEDA 1F0ZA 3CQZB 3A33B 5M5WH 4UP7A 2BVCA 1X9NA 3MFYA 4FYDA 1C9FA 4DN4M 1QQRA 1V8CA 1I6HB 3E9IA 3KF6B 1WXSA 2X6LA 3MTNB 3M3YH 3BJUA 3B2FA 3UGBB 1LYLA 2ON8A 4JOIC 3I72A 2Z6BA 2INNE 4TQ1A 4HIDA 4RWSC 5GADC 4M8NA 1K0SA 2L00B 2F0OA 3U4ZA 2E74C 4B9WA 1BCPB 2EVBA 5LNK1 1AWDA 2WXHA 3JSVA 3V3XA 3ICEA 4NMZA 4C3HG 2KWDA 2UUCL 2EY6A 3SHLA 1P1AA 3D4WA 1VLBA 2EQSA 1PTOD 2EIFA 4LTUA 5C1ZA 1NMGA 3TBLD 3WAMA 2V3SA 3QX1A 3CCRA 3FDTA 5LMNQ 1U5KA 1JT8A 3OLMD 1SYFA 2FCQA 5C3EH 2HJ8A 3ZJVA 1EL0A 3K0XA 2BGFA 4K6LA 4OIJA 3PMFA 3UDGA 2D0OA 3CU7A 1Y69U 1XYIA 3S1RH 2JWUA 2VH1A 4CJ0B 1N32L 5AEKB 2QW7A 4RGNA 1RFKA 4LDTD 2KDMA 3KUPA 3J80E 4X65L 5BR8Q 2BH8A 5JXVA 5KYLA 1B4OA 4KTAA 4JL9A 1NTGA 4WURA 3WCQA 2GVAA 3KDFB 4DK3C 4DR1Q 4RHSA 1EWCA 4OELB 2WINB 2WNMA 3AV8A 3LYYA 3DBSA 3CWIA 3J81j 3X3NA 4IN3A 4IFDI 1KM7A 4LF5Q 3W1SA 2R93G 1UF0A 2KQ4X 1WX9A 2J0KA 2N7DA 5C44G 3PHXB 2DJGC 1VQNA 2EDGA 1FYCA 1GUGA 4HPPA 4JI1Q 1HE8A 4CHKA 4KV2A 1J7CA 3CSFA 4IW0A 2G3QB 1L0XB 3NZ3A 2BE5C 3D6CA 1E22A 1ET9A 1CM9A 4DQOC 3I4MB 1WFYA 4ZUJA 1UGJA 1JWBD 3U7DA 4EVOA 1EWYC 1TZ1A 4DDID 3FEWX 3HOVH 1OTRB 5LMNL 1EYGA 1TJEA 4NAWA 3R3MA 3TN2A 1YN5A 5DCNA 3OWEB 4II2B 3QA8A 3N30A 2SNSA 1SDFA 1VQ7A 1PTOH 1KRTA 1PGXA 1YIJA 1KTKA 3MAQA 3HOZH 4HVBA 5IT9L 4LF9L 2IY1B 3L16A 1WE7A 3HOWB 2J42A 2FUG1 3MFGA 4FULA 4P6VF 1ENAA 4LF8Q 4GN3B 2G4DB 2N9XA 4KK7A 4YHHQ 1XWEA 2IX1A 4DV4Q 2RPQA 3AEVA 4KIKA 1F2LA 1YEZA 5I9OA 1SMXA 1WF9A 1C4PA 4C3JG 4KJOA 5IGEA 3EA6A 4RCNA 2L4NA 1Y8RC 3MJWA 1Q1EA 2K8HA 4PS7A 1AE2A 2VW9A 4FBJB 3IL8A 1XTDA 1NAPA 2XWJB 1WJNA 2NPTA 1AN8A 4QUCA 1GD7A 1T9HA 2BPSA 3DOWA 3OMCA 3ML9A 5IO9A 3AFQA 1X3FA 2QHOA 3NTHA 4KZ0A 4R4IA 3CF5A 1ET6A 3GQBA 2G5DA 5NUCA 4OVUA 3QK0A 1B50A 2BWFA 4B0MA 1WCMB 3QC8B 1VZ6A 3KYDD 4N9PA 2WDTB 4LJPB 2KDBA 4AWJA 2Q2IA 3UE0A 3GO5A 4A3FB 3S2HB 1BT0A 4L8JA 1NYQA 5IP7G 2F1MA 2R7ZH 3GTOB 4B3SL 2M4NA 4DBGA 2IJ0A 1ZXIA 1L1OA 5C4XB 1IBMQ 4MEMA 1G91A 3RULA 2MCNB 5C2TB 3E3XA 1AE3A 1PZKD 2F0FA 2KVZA 3N32A 2FJ2A 3QCAA 3Q8FA 5DPSA 1LT5D 4EE2A 4M00A 1X65A 4RF1A 5HG2A 1L0YB 3AQQA 1VQAA 1K50A 4DK0A 4A3CG 3PUXA 3L13A 2HDLA 4WAFA 1CHPD 2N0SB 4W9JA 1FJGL 2CWPA 1L5PA 3S2DH 2ASQA 2DYMA 3HIZA 4PMBA 4HAEA 5M5XH 3DQVA 1X6OA 1JR0D 1L0WA 2KACA 1W2BA 3AMZA 4PS3A 3V60A 3Q3FA 4X57B 1AFPA 3PRZA 3ZNID 3KBXA 3DVNV 1WGHA 4DV1L 2HUGA 2IGGA 1I3QH 4YCUA 4DXAB 1NY4A 1I4RA 2YV5A 2JA7G 1FPYA 1LTAD 3APFA 2CQOA 4IFDH 3KK7A 3JW0X 3AEEB 2SOBA 4JK1C 2PO4A 5M5WB 2K04A 1VQ4A 4EQPA 1WR6E 1YNJD 3SGIA 3MA2B 1PFDA 2ZCBA 4KD4A 1AZQA 3ZJYC 4DV0L 1N33L 2GMIC 4HPMB 2UU9Q 2BW2A 3BZCA 1GUOA 1SNCA 2KWUB 1BBXC 2B2VC 1O80A 1S3OA 1Y8PB 4B9KA 4LF6L 2WQYB 5HI1A 2EELA 4GDKA 2MEKA 3CRKC 3KJOA 2YEPB 2RGFA 3OWFA 5IOCA 1O7IA 4GS3A 3I70A 2Z6KC 4HMIA 3QJZA 3BZDB 3HM3A 1IP9A 1SSOA 3TP8A 2WXOA 1GXDC 3MXNA 3CCLA 1GUWA 3R7QA 3VDYA 3UI3A 1I4XA 3H0GB 1ACCA 1FFUA 3HVZA 2KLGA 4EUTA 5M3MG 2Z6KA 1EQQA 1VJKA 5FO8B 3VR2A 1KQSA 5DNFA 4BXXH 5K5PA 2NB0A 3WAPA 3TUOA 1I3QB 2JA6G 1SRUA 3M3YB 2NVQH 1VQ8A 4QF4A 4XIGS 3ND9A 5CBEE 2JA5H 1JOQA 1EWHA 3PRPB 2K14A 3E5SA 4TMAB 4KMUC 4MACA 1J6QA 1LQBA 1FRRA 3CQZH 1CZWA 2X6GA 5KEEA 3B1LX 1PYSB 2WACA 2I0QA 4RM9A 2ZM6Q 3MZ5A 2BH2A 5DLQE 4DAYB 3Q8EA 1N34Q 5A35A 4JCVE 4DV2Q 1YI2A 1V9PA 4P75A 3TZUA 1SJED 4DV6Q 3DWAA 2ZZPB 2CFMA 1I50B 2R92H 2CU1A 3Q3NC 4DR7L 3CAMA 2B63B 3AE6B 4FA6A 1TVXA 2ZJPA 4BBSH 2E2HB 3VR4A 2L55A 4YWLA 1JWSD 1UEBA 3BVZA 4NKLA 1UUPA 4BY7B 3SDZA 1NUCA 1EUJA 2OT2A 5IT9E 3IT4B 5E6OA 3AXCA 4NXMQ 1C78A 2I46A 3UDFA 4GKKQ 3I63C 2ICIA 3NBHA 1WCMH 5CYUA 3TS0A 1HNWL 1WE6A 2JA8H 2KX0A 3KW5B 1HNZL 5IYCG 4GIVA 2J7QB 2PMVA 2YVCA 3L08A 2B2WA 5I9PA 1C3TA 3DM3A 3NUCA 3AB5A 3KLWA 1F9JA 1B9RA 3GTQB 1B9MA 3BVGA 1X32A 5C0XG 1E7VA 1O7YA 1VQ6A 1YNTE 1LACA 4POFA 3U50C 2EYFA 3KF8A 1MJCA 1EM7A 3MP9A 1DOYA 1IBXA 1OXTA 1HTLD 2DJFC 3P1MA 4IALA 1JB3A 4PZ6A 1JMCA 5BYQA 3S1RB 1C0AA 1UE6A 1ESRA 1N32Q 2D2CC 2PE6B 4GKJQ 5G5GA 4DXGA 3MEHA 2ZM6L 1IYJB 4FF2A 3J81L 3P7JA 5C3EB 3F2CA 1T3QA 3HOYB 4U68A 1TYGB 2WV6D 1EY4A 2UU9L 2BE5D 2ZPNA 3HOVB 4CDFC 1XNQL 1AH9A 3SD5A 1AP0A 2RSUA 1PMRA 2J0JA 4DV3L 2GI9A 2CW0C 4PV1C 1L0VB 1FL0A 1LTID 1VQCA 2RDGA 3OTOL 4ZUIA 4K0KL 2GBJA 1J7BA 1U4MA 1OXSC 2K6AA 1LTSD 2UXCL 2LASA 1JE5A 1TTNA 3TRZA 2KBNA 4HSPA 2J4XA 4X3TA 2I5MX 1K83B 2K1BA 3V2TA 2L0FA 5D6JB 5I2XA 3F1ZA 1Q46A 4O0AA 2KANA 3HOXB 3B08A 3L0OA 4IPDA 3GZNI 2VXWA 4A3GH 2D3GA 4EZLA 3IAS1 4E74A 4ZKBB 3R66C 2IT1A 3QR8A 4E6IA 1WGYA 3Q24A 1P8LA 2F0TA 2NVYB 4W9IA 1Y8NB 2K01A 3J81c 4A3EB 4NQKE 2RHQB 5CHVC 3RNCC 5J17A 2GOWA 4JX1C 5CX3A 5BMHA 1CZPA 3NK9A 4C2MH 2CCZA 3TQYA 5JJZA 1SR3A 3OOCA 5LXIB 1IBKQ 4A3LH 5JPNC 4BFRA 4JI3Q 3KF8B 2WKDA 2AWTA 5E6NA 1PRTB 1XMOL 3HOYH 2MJEA 3PZ7A 4G3XB 1E2VA 1PRTF 2DZJA 3BDOA 2F0IA 3SR1A 5DEHA 1K73C 3GE3C 1I6VC 2KEDA 5COYA 4CO7A 4IURA 3CD6A 4C3IB 3SHQA 3NJTA 2K8CA 2HHHQ 3B0AA 3RNAC 2HDMA 1JOOA 3I4NH 2JY6A 1N9WA 3AE3B 3EVQA 4NAWB 2K5NA 3F2BA 3CCMA 1J0GA 4IM2A 4OW0A 2JF5A 2Z59B 3A4SC 2EYPA 4NAMA 2Z0SA 2B3AA 4DV4L 3W5VB 2EMSA 3VR5A 1KH0A 1IW7D 1DOIA 4MT5A 1RYJA 1XNRQ 1JRUA 2K5VA 1DD2A 1IYFA 3U4EG 3CRLC 3CPFA 4DV1Q 3FKIH 1XCQL 4GOCA 3C0RB 1VQGA 1AW7A 2FIDA 4FF4A 2IY5B 3CP0A 4LK1C 4HJGE 3GTGH 3UQAA 2O2VA 3HG9A 4K1RB 3K9OB 3RNBC 4A3MH 1SGHA 2WB1B 3HRZC 4DNRB 5C0XH 4KHPL 2W9NA 4KGRA 5M3MB 2XK5B 5DPTA 3V6EB 3VUXA 1L4ZB 3M3JA 4DHZE 5TR5A 4HJ9A 1VQFA 1JB7A 3HOUG 2A74C 4XGAB 3AEAB 3OIQA 2QJLA 2MP2A 1LTRD 3PV0A 2JA8G 3CW2C 2JQRB 3GZNB 1P9DU 1KDCA 2JP1A 4K0KQ 3PZ8A 4ZRQA 2LXAA 2QDFA 5H1SE 3GTJH 5BN4A 5D65A 1V49A 2MBBB 4WJPA 2E2IB 3ZNHB 1M1KC 2AEHA 5EJWA 3T1YL 2B2YA 2AL3A 2E5LL 4IUMB 1FVIA 4CDDC 2F4VQ 4GDKB 1WOCA 2FHTA 4DPGA 2OHFA 3PREA 1MPEA 4US9A 1M8AA 3ECIA 4NNJB 2JEBI 3FAHA 2KDEB 3FP9A 3VH4B 1JWAD 3E9HA 4S3SA 4MN3A 1NEKB 4OIKA 5ELCA 2OQKA 4GOPA 2LXJA 1IUEA 4DR3Q 2KVMA 2NBWB 3VXWA 2K5QA 5JJIA 3BK1A 2PI2E 3PO2B 4WJOA 4UPAA 3K7AH 3K59A 2C9WB 2K6DB 2XGTA 1PV4A 3BK2A 2JA5G 1KJTA 3RFZB 2JZZA 3M62B 1LXDA 2Q2HA 4RGTA 3DWPA 2UUAQ 5BO4B 4A3BB 2E2JB 2N88A 2FMMA 1VQ5A 2KJ6A 2ZVOA 2C7NB 1SNDA 1IBXB 2EYOA 1Q8IA 3IBEA 3OPOA 2O2LD 2LD9A 1RIPA 1QOHA 1VQ9A 4YY3Q 1DXMA 1PDQA 2WHIA 4N8X1 1TKGA 1U4RA 2KQSA 1NYRA 1R4PB 1S5DD 2GBRA 2X8XX 1G2SA 1PTOF 4AJWA 3MXPA 1VQJA 3PSIA 3Q6BA 1N60A 2DN8A 4NQLB 5JH5C 5FLMH 1LV9A 4DV2L 4XT3B 1WD1A 2DBYA 3V61A 1D5XC 3S1QH 1YZ6A 2NVTB 1V97A 3P63A 1JQYD 1UWVA 2F0QA 3T1YQ 1FM0D 4Y7NH 4HROA 4CJ1B 3F2DA 2GRIA 4II3B 3TS2A 1I4QA 3P75A 2D62A 1J5EQ 1ZUD2 2ZEQA 4GB9A 1BO0A 4DDGD 4K2LA 3EGRA 1TWAB 2R7FA 4X3SA 4DGZA 4QGUA 4DV5L 1GUNA 1X55A 3CHBD 4HMJA 3KFUA 2RDFA 1STGA 2WXFA 4JVZA 3I8ZA 3TJPA 1TWFB 4OXPA 3K5NA 3UI2A 2WAQG 2LZ6A 4QAYA 4JBKA 5HY6A 3U4VA 1HNZQ 1WGGA 3KUCB 3RPFC 1JWUD 2N78A 2SNMA 1QZEA 1STYA 2W54A 3ND8A 3GTOH 2WU5B 2WYQA 2ZW1A 3NP8A 4ZQ3A 3VR6A 4LNOA 3VRBB 2X38A 1DM0B 4HEA1 1RF2D 3J7AV 3H09A 2EJGC 3I7FA 2AHOB 3MXGA 3NOBA 4I6PA 1KLVA 1PFBA 3NELA 5FLXL 2OCEA 2JJQA 4FNFA 2ATWA 1NR2A 2XVSA 1SYEA 1V6EA 2LGYA 4W9GA 3EN2A 4PK1A 1S40A 1KOTA 1FNVA 5BMIA 1NI3A 1DOXA 3DBRI 3I3TB 3NBIA 5CMDA 1MIUA 1H9RA 1RLFA 3K7UC 3NENA 3R2IA 4OO1I 1B53A 3P4PB 3UIOB 3HHMA 1VCIA 4DR4L 2KHWB 5T1IA 2VB2X 4JLCA 3UF8A 2ZTCA 3GV3A 2R7ZG 5LL6S 2K32A 1BOSA 3FKIG 4ARIA 1H9SB 1LFDA 4HR7B 3L0WB 1PGAA 2L9HA 1CFMA 3VTVA 3NRZA 1Q12A 1RTOA 5I6WA 2WU2B 1ZYRD 1VMCA 4JI7L 1BQQT 3TEHB 3FILB 3RD2A 3C1FA 4DV7L 1FXAA 4YIJA 1XLOA 1GKHA 3IFTA 2BKRB 2IO1B 3GTMH 1HFGA 2C9OA 2YTVA 1UWMA 4C3JH 1QWYA 4D2KA 1X56A 2EZVA 1I4PA 3HKSA 3DVGY 4L1BA 5LMNW 3VQIA 1TWHH 4NZLB 1EU4A 2KA7A 2KLCA 1N36L 1KD1C 3DEPA 2B2YC 1A15A 4LF4Q 3P4SB 1LTBD 4ANVA 2DGYA 3C2PA 1BCPC 1LGRA 3DWMA 3VDZA 2UXBQ 5D7GA 2JPHA 4C4VB 2RCFA 2IY0B 5IGDA 3W3AA 3T1HQ 4B3TL 4A3LG 3ZTCA 5AJ3Q 1Y1WG 1ZP0B 1QOGA 2LVQA 2PJHA 5AZGA 2V4LA 3BIID 2HJ1A 1UELA 4FF1A 2H5XA 2PEAA 1SBBB 3QJYA 4EZKA 4DUZL 1WZ3A 3D32A 2GVBA 4XYOA 5GAEC 2OEOA 2NN6I 4QJFA 3ONSA 2RA4A 3U7ZA 3GTJB 4GMVA 4MGYE 4HCEA 3AN1A 1NSNS 2VQEQ 1BCPF 3AE2B 1UD7A 5IGCA 2Y0SG 1OXUA 4A3GG 3M4QA 2DY7A 4IWOA 4C7ZA 2UWQA 1ISNA 2KEEA 5CV8A 1EYAA 4ZYSA 2R93H 3SXHA 1QVCA 3HZXA 3A9JA 1VQMA 1TWCB 4US8A 4ZRKA 2BDNA 2C5CA 3NVZA 2K0PA 3W1YA 4HIMA 5C3WA 1HQMC 1SE9A 5C23A 2XEWA 2DLBA 3PRMB 3VUWA 1MI0A 1OEYA 4X62L 4YXDB 1I5FA 4R4CA 2PPBC 2AUJD 3SE0A 4JI6Q 4KGTA 2LJIA 4O2DA 1ZKOA 3T4AC 2G45B 3DM1A 3GTLH 1WJUA 3ZRFA 2KECA 5E7NA 4RGOS 5M5YB 2MJ8A 2F0UA 1GM5A 1RFAA 2LVPA 1V1OA 2VNUD 4DHZB 1MSGA 1HR0Q 2ALYB 1YHBA 4DUYL 4KHPQ 2OQ0A 5IP4D 3MTSA 4JPSA 5T8IA 3A9JB 1PLFA 4JBMA 4W9HA 1YBYA 4C3HH 1ILPA 3VTUA 2Q8IB 4KLKA 3PF5A 4I6NB 3OW7A 4IO9A 3L4PA 4B3ML 4G0NB 2D3BA 2B8GA 1WRDB 2KTRB 5E4WC 4JI5Q 3K8AA 4ZK9B 4DV7Q 1WM3A 1Y14B 3FC4A 1CA5A 1TWCH 3OIPA 2HQLA 1G2TA 1LUZA 1YNNC 4OGQC 4JGHB 4XE0A 3QIJA 2LS01 2A8VA 4XYQA 2L5TA 3K5MA 2E5LQ 2K33A 2NBVB 3A1QA 3K7AB 1YJIA 2F0DA 1EY0A 1GB4A 3JSVB 1PFSA 1F9SA 1F1HA 3U30A 3NPPA 2FAZA 4MTKA 2NVXH 3LJ3A 1KABA 3NEMA 3K5OA 4CKBA 4ZRJA 3EFCA 2YTYA 2A73B 2DNEA 1F2MA 2XNAC 4QUFA 3GTKB 2BWES 2QGQA 1ASZA 3UDIA 3RZDB 5IT9c 3NUHB 3RMKC 2CVRA 2DAFA 3DBLB 5C4HA 2WXPA 2M17A 4KDIC 4JYAL 3SR6A 3R7RA 4MSMB 2ZVNA 4JI4Q 1WY8A 2D07B 2R92G 1T5EA 2J0TD 1HUNA 4WJNA 5CTRC 4ZHPA 4DKAC 3AEBB 2PYKA 1BNZA 1FO4A 1MKHA 1E3PA 2NZHA 1PHJA 1A3UA 2OTJA 1D3ZA 1I4GA 1YQBA 3ABVB 2MNAA 3VYRA 1WTHA 1RWSA 2K8BA 4C3HB 1G291 4BY7H 4WH4A 4WFN3 2WGSA 2JXMB 4MNOA 2JA6H 2NZ1D 5DPWA 2KOXA 1VQBA 1IBML 4GZYC 4R8IA 1K8AC 1K8GA 3LXFA 3HGBA 5JHBA 1L1OB 1MD2D 1QG7A 1HCZA 2R7ZB 3J7YW 3WOEA 1KLGD 3Q3JA 1VF5C 4I6LB 4NPNA 3KYHC 5JJLA 3RZFA 3C19A 1CKNB 3FKIB 1A62A 3W9CB 5FLXc 2KMMA 4CDCC 1I6HH 3HFZB 2IPKD 4LFAL 3J81E 5JAVA 4K2KA 4G50A 1KRHA 2VY3A 4P2CB 1QLBB 4GSWA 2B2VA 2QF7A 3E56A 2D5GA 4W9EA 2IDYA 4RKBA 4V190 2JXTA 2F0VA 2QILA 2DZIA 5T1GA 1JJCB 2IL8A 2R93B 3S1NH 3K9PB 4BKGA 3R8BA 1YJWA 1H9KA 4DUYQ 1V1PB 1QVFA 2AUKA 4H0LC 2HHHL 2SDFA 4LF5L 1T6BX 2W55A 1OTCA 4WWOA 4MH8A 4A93H 1PH3A 5J3BA 3JVZX 4NJ6A 4IFDG 3KBGA 1A2TA 1S5ED 1BR9A 1RRBA 1C76A 2VB3X 2F0GA 3WDNA 4RMAA 1TWGH 3STBD 4TUUA 1CKNA 4X64Q 2YU9B 4P74A 2F0NA 3TP7A 4DAPA 5IYDH 1TY0A 3LNNA 3TZDA 2HCCA 3K80C 1CZGA 2KHSA 3PO2H 4BAXA 2DYBA 4IM0A 3NTIA 4KSKC 4C56C 2E2HH 4BBSB 4XQJA 1Y1VH 4J6HA 1NBFC 3H6NA 2V3PA 4XDCA 5HGQA 2LUEA 2KFKA 1KNEA 1EYDA 1C1YB 4TQ0A 2IGDA 4KY6A 1DGSA 5FK9C 4LAAA 3RR5A 4DAYA 1JWMD 5FJ8H 2QCPX 4IUNA 5CV4A 1HR0W 1S1QB 3I4LA 3G4SA 1STAA 1R4MI 3NZUA 3RN9C 4DNTB 4K8IA 1UE7A 5KYIA 5CGKA 4HJ7A 3VR8B 3JAMi 1HA6A 2P5ZX 2WXJA 2F3IA 3ULLA 3D4RA 2DWQA 4S0RA 4KHVA 2D0PA 2V1CC 2XRSD 4YCWA 1SMYD 4EX5A 1SFOH 1UZXB 2ACZB 1BBUA 3ZVVA 1E1TA 4G7OC 4GNXA 3A54A 2RPVA 3AULA 5ELEA 5IP9H 1TKWB 3SK8A 1E7UA 2INPE 2M8SA 2I5LX 3H6MA 4EQNA 4C00A 3W5OA 1D7QA 2J0MA 4H7BA 1EF5A 3X3MA 3VUYA 5IYBG 4NXNL 1C48A 5AJ3L 2NMQA 1B70B 4NXML 4ABNA 1YHQA 3J80i 3GS2A 4NPSA 2CHZA 3NTKA 3RZDH 2GB1A 3KUDB 4W9FA 3RNEC 2CHBD 4E71A 2K1FA 1CSPA 4QB4A 3SEBA 3Q6SA 4TKOB 3RLFA 2H89B 4NP5A 5C6AA 2KN5A 3W5UB 3CC2A 2O6VD 1CTMA 4BKTA 4GN5A 3E9SA 5CHWA 1G6JA 4LF9Q 4PYUA 2NS5A 2N55A 2L83A 1FIQA 1QZGA 1Y8OB 3VA7A 3R3OA 2E2DC 2QA4A 5BYSA 4K6DA 3MVVA 2NTTA 3X23A 2VUMH 1UH6A 1RD9D 2LFNA 3S17B 3RUIB 4DNIA 3Q0AA 4M0WA 3L3OC 5DPRA 3DCGA 5EKIA 4LCDE 3DBLI 2KOLA 1PH7A 1WYWB 2D2QA 3WIMA 3RNUA 3RMHA 1PYBA 2M19A 2K5WA 3ULJA 1EY7A 1P0RA 4AJYB 2AMCB 2GN5A 2L0TA 3ULPA 4A3MB 5C44H 3A5UA 4BY1G 1T0YA 5L95C 3K58A 3EFXD 1CQFA 5KNBA 1K51A 4FXGC 1SFOB 3AEDB 1WGRA 4K8JA 4J8QA 3NWSA 4LFBL 2W3SA 1UGMA 4O42A 1GOZA 3DMUA 4C2MB 2OOBB 3APCA 4HN7A 2L1BA 3FVQA 2JE6I 4JI3L 2I07B 2JSVX 2SAKA 3GOEA 3PF4A 1EFID 4A3EH 4DV0Q 1N33Q 2EYLA 1IL2A 1QUQB 4FN2A 3CCUA 2AX5A 2YLMA 1SSNA 2VQFQ 1O7LA 2PMZB 4DK1A 2K39A 1K3RA 4A76A 1V9JA 5L83A 5IP9G 4U673 4J6IA 3KLRA 4LF6Q 4GLXA 1WXAA 4ZKCB 1PH5A 3FHWA 2F0PA 3NQTA 1E0ZA 2R2OA 4JE3B 2KCNA 2PVOD 1D1KA 5EAYA 1K83H 1FCCC 1WTXA 1P16A 1N6ZA 2QIEB 2K75A 3TREA 4JI8L 3PSEB 2EPBA 4MM3A 2L76A 3D6WA 4TQUS 4QMGA 2RHSB 4QIWB 1WYGA 2WXIA 2VS1A 5IWAQ 2F4IA 1JICA 2QMTA 3KVFB 1QOAA 2A5UA 1YX5B 4J3OD 1XCTL 2BF8B 4HPLB 1F2RC 3CMEA 1OFFA 4HJKA 4DR6L 1UBQA 2KMAA 1KNAA 2OTLA 2PE9A 2PVGC 5D94A 4BKSD 4G57A 3RZWC 1SYCA 2WIIB 2V3NA 1B1ZA 1CT1D 4AYBG 4CGYB 4BKSA 4OWTB 2NVYH 1V8QA 1Y1VG 4H2AA 4LFBQ 1BF4A 4DR1L 4FXDA 5C4JH 3H7PA 1PZID 1UWXA 4BZAA 4B3RL 4ZDVA 1X54A 1STBA 1X3GA 4WJWA 1WVLA 1JMLA 2KT7A 3NHEB 3VHTC 4B6WA 3ZJUA 2CWAA 4HDOA 4DAMA 1XPRA 5IGGA 4LFCL 4LNKA 3A0JA 1C4QA 1K53A 1QNUA 4KJNA 2AWOA 2MPMA 1SE2A 4JI2Q 2F0LA 4IDIA 2N3SA 3IFDA 2EJFC 3T56B 2B8FA 1V81A 4BOSC 1ICWA 2C7MB 4AUQC 1EYCA 1PGBA 2CHWA 5C4ZA 1YHAA 2OJWA 4MELA 3SFDB 3BZKA 2AYOB 1FGUA 1KDBA 4CQNA 4OL7A 3S2DB 2PZUA 4ZYNA 5IWAL 5I4DA 4IUUA 3H3VI 3CF6E 4XWTA 1F2YA 1HFNA 1W3SA 1QZHA 1VQHA 2IO3B 3M95A 3UDXA 1FGBD 5E6JA 1XLQA 4GN1A 3PV1A 5EDSA 3ITPA 1B2TA 1QNKA 2MRPA 4FJZA 2A69D 4KKTA 2N7JA 5H92C 4Q0FA 2J53A 1KFYB 4A3JG 1XX8A 4K81A 3Q3MC 1RDPD 4A3JH 3M7GA 3S2HH 4OX9Q 3J81i 2RSNA 2W3RA 3A7AB 2JZPA 2VL6A 5DAUA 1HJPA 1F9PA 1V1QA 1CUKA 4BS9A 4XDXA 4MM3B 4RGMA 2KFKB 4MDKE 4AOFA 3TP6A 3I56A 4KKJA 2NZOA 1PH9A 4BY7G 1SYBA 1BUIC 1LLRD 3URYA 2F0JA 2NWGA 3AB9A 4IOAA 3S1MB 4OVZA 2LGSA 1KXLA 1HTQA 2MBHA 5BN3A 4BBNC 3B6YA 3D0FA 4JI8Q 4HDQA 3GDEA 3AE4B 3GTQH 3J7AF 4XT1B 2L52A 4YTPB 1J8CA 4YHHL 4REZA 2JQOA 3M63B 1Q81C 1CKMA 3P2BA 1U4PA 2MH7A 2XN9C 2REXA 3KF6A 4MJSA 3P1HA 1E6EB 3AH7A 1VQIA 1IGCA 1TWAH 2MQHA 3NY5A 1E2ZA 2WX0A 4PQXA 2KZRA 1PFNA 2Z1CA 5ELBA 4XZ4A 1I35A 4OEMB 2K05A 1XPUA 1HZAA 3KJPA 1L2FA 3TIXA 4OZCA 5IAAC 4A90A 1K8MA 2O6VB 4KN4C 4E3CA 4R3DA 4JOIA 4IWPA 3F2UA 4IZ8A 1F9RA 4EOYA 1Q3LA 2QKIC 2BYFA 3BDCA 3Q69A 2PIAA 5GXGB 1ENFA 1YMHE 4WIPA 3SFEB 4L23A 3H7SA 3ZYYX 1Z5SB 1GPXA 3V96A 2OWOA 2PI2A 3MWYW 4BY1B 2KMCA 2VRRB 1GC6A 4P7IA 1GJZA 1HR0L 2IX3A 2N9EB 5E4XA 5JEAG 3S16H 4EEWA 2JYTA 3H1UA 3C46A 2NVQB 1A70A 1X3QA 2CH4A 2A6EC 3VYTA 1P7EA 1WM2A 3VR9B 1TU2B 3CMAA 2D11A 2ES2A 3IAYA 2WXGA 3ZNGC 5A2QL 4A3DB 1A6XA 1IYVA 1C79A 1XD3B 1QOFA 3QAQA 4K7UA 4AYBE 1X3EA 1EU3A 5D3DA 1YNXA 4R4OA 4LF7Q 3HOXG 1EQRA 4IJHA 1NJIC 1EOVA 5IGBA 1N61A 2CW0D 2INDC 4ICUA 3CCEA 1EZ8A 5HGTA 1H4RA 1SE8A 2WFWA 3T13A 1XF5L 1YD8U 2L7RA 2WS3B 4A3EG 4IWQA 1DOMA 2WB1G 3ZNZB 4I7AA 4LNNA 4M8AA 3PQIA 1CQVA 4LUVA 1HTPA 2JT4B 4LLGM 1PH8A 5EKKA 3HOUB 3NS1A 3B2GA 2MHJA 2ID0A 1VZ8A 3OW2A 4F88A 1I4HA 4UP8A 1C8CA 2JA8B 1AEXA 3QB3A 1XLPA 3L17A 4BY1H 3MHSD 3J7ZC 1QKZA 3KYCD 2A1AA 4X3KA 2L3ZA 1D2BA 1JW9D 2NN6H 1T0SC 1KL9A 4KV6A 3IHPC 4ZHOA 2WDQB 5ELFA 2Y5CA 2C7HA 4K7SA 5AFWA 4AYBB 1TGZB 2F03A 1TWFH 2B2UA 4CBVA 2I1JA 3RNGC 4BBRG 3ZDTA 1Y1VB 2F3WA 1JRPA 2VUMG 5FKAC 3I9V1 1BCPD 3I4OA 1R4QB 5ELOA 4NJ7A 3G7LA 4AQYL 3ZGZA 2PMZE 4IM3A 5JPMC 1B3AA 4K3BA 4LWCA 1ICFB 3MC0B 1GUSA 4ZLTF 3G6JB 1Q7YC 1HZ6A 1WSPA 1GC7A 1MJEA 4WWNA 5EE0A 5IKCM 1FCLA 1I42A 3DHIC 2KUMA 2BQQA 5JOBA 1VQLA 1FXTB 2KN4A 3HKZG 3NVVA 1A8VA 2DNCA 2PNHA 5BN5A 1K0RA 4IOIE 3H91A 2K03A 2KCCA 5IYBH 3HRDD 2J7ZA 4PNYA 1NVID 1CA6A 4NB3A 4J1MA 4PZ7A 2QSDA 2A6HD 2IGHA 4LK0M 1VF7A 2WX1A 3VAWA 1ZXTA 2NTSA 4KSLC 4OZBA 3BVMA 4GKJL 1HZ9A 5EE9A 3TDQA 3OHXC 1WH3A 5G5HA 1YN4A 2PQAB 2AWNA 1V5TA 3KLSA 1DYQA 4HTHA 4JIOU 3RLOA 1R9TB 3T9LA 2WB1E 1S5FD 3O13A 5M3FG 1EWIA 2CJNA 2FCNA 2G1EA 3AE1B 3DVGX 3GE8C 3ZLZA 1EIHA 1P7FA 1DZ1A 4YY3L 3L7ZC 2E76C 2I5HA 4KD3A 4DR6Q 3ZDMC 2FINB 5C5MA 1KF6B 4LNFA 1MG8A 1OXXK 1B44D 4JI2L 5FJ8G 3ZQ4A 4A3JB 2QEJC 3CCQA 2XBBC 4PZ8A 4IQZA 3K57A 1GO3E 2ZJQA 2A19A 3QOJA 2PZTA 3A74A 1UNSA 2TSSA 2HTHA 2B63H 4R8NA 1ZKHA 1Q5WB 3NG0A 4PG3A 3L54A 3QQ8B 3ZJTA 4XX5A 1PH2A 4A3IH 4HIKA 1D5MC 5DM73 4BOZB 1LTGD 1IKLA 2PCFB 4I7ZC 4NXNQ 2D3CA 2L12A 5CV6A 5KHQA 1MBYA 1V43A 1FEHA 2PW5A 2F3VA 3PUWA 3PO2G 4W9CA 4A3OA 1E8XA 2LFIA 1WTRA 4YWGG 4IOCA 3W1BA 1E24A 1SYDA 4LUZA 2IWHA 2JA5B 5FR6A 3WAOA 2MBQA 4FXCA 1U4AA 1MHXA 1E8WA 4FJVB 4A3BG 2V1YA 1K9MC 3N1ZC 1IYUA 2QC8A 4XDDA 1FXIA 3W1GA 1PH4A 3FKYA 3KDFA 2NYZD 1C4AA 3QOLA 1YNND 3GTKH 1PFMA 4WJ3M 3Q23A 2JVCA 2O2VB 4OVVA 1XO3A 4OONA 1EY5A 1ZOYB 5D3IB 5M5XB 3HVDA 4P73A 1F9QA 2F0KA 3FILA 1KAAA 2MFIA 2VH2A 1IBLL 4RF0A 5HFYA 2YU9H 4FP5D 4F8CB 1G51A 3KQ4A 1WX7A 4EKUA 1Z7TA 1XQQA 1OQQA 3OSOA 1RTNA 1UBIA 1S4ZA 1MHHE 5HHDG 4MGKE 5IE8A 2HDEA 4R4QA 1JCKB 2JRIB 3I90A 1XJVA 2UXDQ 2Q2TA 3FPPA 2F0HA 2MHVA 4M8MA 3U58A 2XRQD 5KGUA 3WALA 4MZ9A 2WAQB 4ZRIA 1SJHD 4C1NI 1WJ6A 1N63A 4A3DG 4G11A 2K5DA 2BYEA 3ZTDA 1SNMA 5IN7A 1LT6D 2LXCA 4GLAC 4HJ5A 2NPTB 1D4BA 2ZPYA 4DK6C 4PYZA 2RF4A 2JEAI 2DHZA 3AE9B 1TXYA 3KOJA 5J1ZA 1V2YA 3AE7B 3EIVA 4JI4L 3U2SC 3LX0A 4IPHA 1F2RI 2KTFA 1GVPA 1UEAB 3PGZA 1H9MA 3T3NA 5KNCA 5C3JB 3DBHI 2KJRA 1ZDVA 1PDXA 3M9BA 3IG3A 3I57A 3WA0A 2IW3A 4L5RC 4B0EA 4CDEC 3A56A 4JPBW 4LNQA 1WXMA 3BG3A 2MSED 3Q14C 1QF6A 4GOPB 2Y0SB 3TSSA 2VZKB 3J80L 1WTPA 3TEZA 2FMCA 2CKZB 4YL8A 3M4YA 1E1OA 4LF8L 1QUQA 4KX6B 1TS3A 5LMUQ 4B3SQ 3U9SA 1ILQA 4KZCA 4B95A 5EPKA 3T51B 2BT6A 3MC9A 3AEFB 4IUTA 2Y5PA 2KXJA 4OO1G 3I73A 4ULLA 4C80A 4A3MG 1E9MA 1LM8B 1DOLA 4FXKC 2VUMB 5IY0A 4XXEA 1W6JA 3HK0A 3IT6B 2BB6A 4Z9CB 1EIYB 3VYSA 3GTPB 1STNA 4JI6L 3AFPA 4DR5L 2A6ED 2Q8TA 2IZVB 4DR3L 3J7A5 4TKNA 5KHOA 1VMPA 2HIVA 1ASYA 4F7ZA 4WWPA 1C9OA 1XXGA 4M0WB 1RAXA 3I3CA 5D14A 1N62A 4LMQD 1S3SG 3B9JA 1SNOA 1Y1WB 4DUZQ 1OQYA 3A7LA 4GN4B 4ODGA 4YCVA 2Y0SE 2PTLA 1EQVA 4NY0A 4ANXA 2MBEA 3MXNB 1WRIA 1RL2A 2FUHB 1JOKA 4FO2A 3I4NG 3L2PA 3AU5A 3D4DA 1A5RA 2ENBA 3UIPB 2VZAA 3E0JA 2VQEL 2CS4A 3RZOH 2I2YA 2GA4B 4LJOB 2R6GA 1LABA 2UUBQ 4ICVA 2KD0A 2JYOA 2OF1A 2MLBA 1Q1BA 4B3MQ 3OYYA 4A3GB 3ZXRA 4XQNA 3NWTA 3S15H 2O5IC 3D3RA 3NVWA 4HKQA 2YTXA 4A3KG 2VZKD 5EPLA 3Q8BA 4WQOB 2RDHA 3MC8A 2KFJA 3OJ3A 2B3GA 3DDCB 3PZDA 2XWBB 1I94Q 2Q2UA 1WFQA 2V4DA 1NE3A 4UP9A 1II3A 1WWTA 2KWVB 2K6QA 1HPCA 3FMCA 1AZPA 5G55A 2KX3A 3V6CB 2DZKA 4X66Q 4KVGB 1WGKA 1CI3M 4A55A 1MJDA 2G9DA 2IO0B 2KC1A 1I50H 1B8AA 2OXPA 1L1OC 2R92B 5E1FA 1HNXQ 1Y1WH 2BOSA 4POGA 4A3KH 2OEDA 1UE5A 4RG1A 4DHJB 2KDIA 1VQKA 1PH6A 1JROA 2HIXA 4F8MA 1V86A 4K3CA 1EOTA 3BU2A 4F7XA 1SAPA 3JAMc 1UE1A 1F77A 5CV9A 1PVOA 4GU2A 3SK6A 1TQOA 4ITKA 1FNUA 4XC2A 4K7WA 3S16B 1PRTD 2Z9HA 3PS6A 4A8XC 3HS0C 3VRAB 2KCTA 5JEAJ 2KTRA 1K8OA 1SLJA 2WXNA 2EXDA 3DHQA 1Y56A 1ZYRC 3UE1A 1SNQA 1AARA 3S1NB 5EKLA 1CMXB 3DWGC 4LUOA 3T53B 2O4XA 2ZNVB 1PYWD 2L05A 2R3ZA 3LWUA 2JX5A 3F8TA 4OWXB 1EY8A 1L6VA 1ZPSA 1GAQB 1HNWQ 5EE3A 3VYUA 3HOWG 4XQQA 3STBC 2DY8A 4NDXA 1SNPA 1TWHB 1LO5D 3RUZA 3SK5A 3HOZB 2RMMA 1YQ3B 3ENEA 1JE4A 5C5LA 1A63A 2A4ZA 4APVA 2N1VA 1NNXA 2KHIA 1R4NB 4ZRPA 1B7YB 3X0WA 2YEPF 3Q8CA 4CYEA 2JU6X 5KIXA 4LF4L 2KCMA 4LF7L 3TEXA 1V80A 1PTOC 1TIFA 3V05A 4OO1H 4IJLA 5CR3A 1VZ7A 2KVRA 2UXBL 1EFWA 1K28A 3WOFA 4DR4Q 4ALPA 2DYOA 5MPOA 3M4OB 3G71A 4A3PA 3ZIMA 2M00A 4GKKL 5IYCH 4PMCA 3VA5A 4JI1L 3AU4A 1WCMG 2E3TA 3AE8B 2MO1A 1VQOA 1N8RC 3H3VC 2NVUI 4JWSC 5C44B 3DUZA 2LEKA 2MUYA 2JWZA 3FRPB 4A3FG 4DV6L 4JWUC 4L2YA 1E8YA 4G7HC 4JV5Q 3PIP3 2XTIA 2ZXPA 2RD0A 1HH2P 2NR2A 4JI7Q 3Q8AA 4Q2JA 1PRTC 2LUMA 4BBSG 1JALA 1R7SA 5JVG3 1VRAB 2N9PC 2E75C 1UAPA 4CJ2C 1M4VA 4FF3A 3EFUA 4H02A 2KNBA 4LFCQ 2B2WC 2BDOA 1TKEA 2CHXA 3TCAA 2WXLA 2WWZA 1SMYC 1VQEA 3H15A 2ZCCA 2NBUA 2BBCA 3N3KB 3NZSA 2I38A 2H4OA 3W2DA 2RBMA 3J80c 1WR1A 2I1KA 4HWIB 5C4XH 2PZWA 2L32A 5GQOA 1HEZE 1LTTD 2AKWB 3DXJC 3ERQA 2MP2B 2N9LA 4A3DH 3T8MA 5FLMG 4G4KA 3H9DA 3BS1A 1O7ZA 4JW0A 3MJ5A 2WAQE 1Z9FA 2C35B 1GNUA 2K25A 3AYHB 5M3MH 2L1AA 5JZEB 5D2MB 1S5CD 3A8JE 2Z8LA 2M9VA 4JI0Q 2J52A 1HUMA 4K14A 3E0EA 4A20A 2JN4A 4OHJA 3PIOA 1T5XD 2Q8RE 4YTNB 2E6XA 2ZXRA 2JA9A 4N8FA 1Z47A 2EXZA 1N5WA 3QO2A 1WD0A 1MVKA 2BS3B 3KWLA 1BUVT 1QOBA 3N1XC 1PA6A 5CORA 2GBKA 2KWCA 1D8LA 4S17A 3SU8X 4B08A 3HP3A 1E90A 3PUZA 2B2TA 2AQ3B 4A4IA 2UXDL 1EIFA 5C4XG 3EC8A 4RM8A 2F52A 4IPGA 4A75A 4P1BC 4X6AH 3A9KA 4L6TB 3D31A 5G2NA 2KQ7A 2FCMA 1WYDA 2KHJA 4BA2I 4BWGB 1LTLA 5AZFA 2WLBA 1SF0A 4MGZE 1C77A 3HM6X 3KWVA 2JA7H 4BA1I 3DPDA 1QJOA 1BKBA 4A93B 4NJCA 1RKNA 2A5HA 4IC7B 2PQAA 2O6VA 5ISRA 1EQTA 2H88B 3N20C 4OWWB 4GXBA 4A3FH 2A68D 1P3QU 1JC7A 1EO6A 5JVH3 2K28A 1Q8KA 1E5WA 2K7VA 1Q1OA 3K6OA 5G3LD 3HOUH 4A3CH 1KDAA 2JXXA 4MGIE 4YSYB 4IPCA 3PIO3 4W9DA 2B63G 3ZRCA 1MFWA 1QVGA 1IPGA 1YJ9A 1D1IA 5C0XI 1TBEA 3J9CA 4WQMA 3TMPB 2Z0EB 2ICEC 2PW9A 4Q5VA 1R4MB 2ZTEA 2IHFA 4ASWC 3I55A 4L5SA 1FR3A 1TS4A 4CHTB 5IP7H 2NVTH 4WRDA 3EBEA 1BMLC 1GB1A 2K52A 4R4TA 3NE5B 3TBIB 3HOWH 3HKZE 1O78A 1FD6A 2EYJA 2FXQA 5GAGC 1L7YA 5M3FH 1U4LA 4HIOA 1S72A 3M4OH 3QARA 4KKIA 4P16A 3ZW3A 3E6ZX 2ZTDA 3RZOB 4USAA 2JK8A 3U52E 1N5XA 5FOBB 1IKMA 2OJRA 4KY5A 2NCNA 2AQ2B 5J22A 2CJOA 3CXCA 4TV3A 2KJXA 2BA1A 4JC0A 3PO3B 1GUTA 1EUVB 4ZRZA 2M2LA 4UY8C 1VR9A 4EGVA 1EY9A 4C1NK 3RT3B 4RHRA 4LDTB 5IA7A 1STHA 4DHJD 3U9OA 1ZEQX 2V4IB 3BY4B 2DX5B 2HQEA 5LLIA 1XMQQ 3HOYG 5M5YH 1TT2A 2R7DA 1N36Q 2F4VL 4KKSA 2NVXB 4YSXB 3HOVG 4L63B 2YYZA 2GBMA 4BBRH 5DM63 1RM6C 5E6PA 2NUCA 3DBHB 3N52A 2JYEA 1XT9B 4RFBA 4DR2Q 2QEXA 2M0AA 2N1WA 3N9YC 2KQ3A 2MWSB 2MO0A 1XPOA 1YN3A 4ID6A 3QG1A 3S9WA 2HTME 2QCZA 3KUZA 1E2WA 5FO7B 3LDZE 1TS5A 2EKIA 1DJRD 3JYUA 2D5DA 5EGTA 4AQ7A 1FRDA 3HUIA 3Q3OC 1M94A 3QIAA 5HURA 4HJAA 2K50A 4ARCA 2FIFA 3OAWA 1OEYJ 4RKLA 1VDVA 2HCIA 2K9XA 3EECA 3GTGB 2LKVA 2WXRA 5LMUL 2D10A 4QIWE 2E8GA 3GTLB 5JJKA 3NVYA 5M9OA 3ETRA 1BVSA 3IKJA 4QY7A 2WXQA 2UUAL 1EY6A 3FPUB 3S14H 3RCZA 3PGEA 3ER0A 2B39A 1MGSA 1JORA 3MXUA 1EF1A 1YNJC 2WP9B 1XMQL 3BYYB 3UQBA 1T0QC 5C3EG 3L10B 4MJSB 1G6ZA 2BB5A 2Q5WD 1WTVA 2FE8A 1KAWA 4NW2A 2JUOA 3LWEA 3TEYA 2BTEA 5IGFA 1WI5A 5C0XJ 1OGWA 2KJHB 1CSQA 2MQJA 1SEBD 1J8IA 3W1SC 3VFKA 1LT3D 1EZ6A 3GD7A 5JEAH 1KIXA 3IAM1 2GLSA 4TVAB 2BYVE 4HCNB 2IX0A 4FLHA 1ZGUB 3PLUA 3RN2A 2UXCQ 1TWGB 3GTMB 2XSCA 4M1UB 4MHEA 4PMWA 1VCBA 4TRDA 2LXKA 1GHJA 3LGJA 4V0BA 2MJDA 3Q22A 5IIFA 1NBWA 1EIGA 2MGSA 4ME3A 1HQRD 3GP7A 1NMFA 1PUTA 2KDFB 4QQBX 3A4RA 5BMGA 2RR9A 3S17H 4URKA 4DV5Q 4F87A 3NQIA 2UUBL 2BS2B 2BCOA 2CR5A 2LHDA 3O65B 4DR5Q 1VD2A 4DFAA 2KKCA 2LRWA 2LMCA 5A2QE 3AECB 4B9XA 2KENA 1H9JA 3RD4A 4A9AA 5E3FA 1AYFA 4C4VA 4UHVA 3ALBA 1GUAB 1NR4A 1X3PA 5HKHA 3CCSA 3DHGC 5F2DA 2L11A 1KRSA 3DEOA 1VDZA 3I91A 3CKIB 1DONA 1D6EC 2CQAA 2N9KA 1YQ4B 2LSSA 2WXMA 3RN5A 4GGQA 3TL5A 3WANA 2WP8J 3VH3B 3SVMA 5ELNA 4HJ8A 2CU3A 3PO3H 4C3JB 2PPHA 3G48A 2G9HD 2FCSA 4JI0L 2LGXA 3AM9A 2VQFL 2KC2A 3BYTB 3TMEA 3T1HL 4B3TQ 2ASBA 1JQ4A 3C8YA 3DBRB 1HTOA 2BS4B 2BA0A 4BXXG 2C60A 3LB8C 2QDBA 3PIPA 2RQXA 2LHEA 3ZO5B 4AP4C 1IW7C 1SROA 2EYMA 2A69C 4ZOHC 3CC7A 4EQOA 4Y52H 2W82A 1KHIA 2O5JC 2DAJA 2G4SA 3CSTA 4H13C 3EJIA 2V0GA 1D5ZC 2B2UC 2MA9B 3I2ZA 1A3VA 1G8ZD 4HCSA 4AH6A 1K8RB 4X66L 4GOPC 1L2NA 2LY7A 4IG7B 2ZJRA 3S2AA 5FO9B 4GDLB 1NENB 1OXVA 1RCVD 4L5QA 5CV7A 2K22A 2K3UA 2K5PA 2PKOA 2HE7A 1J9OA 1I94L 2KO3A 1W6KA 2RVLA 1N34L 3A8KE 3KH0A 4P71A 1Q10A 1R9TH 2PLPA 1MSHA 2L8JA 1SE3A 1YX6B
chains in the Genus database with same CATH topology
1SYGA 5C4JB 4A6QA 3I4NB 4RA8A 2LMCB 1RJTA 1WTQA 2ZT9C 1OQRA 4CKCA 1J7AA 1C4CA 4KI0A 5K36G 3PO0A 2JA7B 3P4RB 4IUVA 5IODA 4IKGA 2EJMA 3TEWA 4BBRB 5AUIA 3PUVA 3T3OA 2X69A 4Y7NB 5AUKA 1SE4A 5J39A 3S1QB 4CKEA 3HKZB 5LHY1 1EEID 4GLSC 3K5LA 2B76B 3K0YA 3QWNA 1QE6A 4LJZC 4WORA 3SK4A 1Z6HA 4FVMA 1XTCD 2AQ1B 1L6UA 1SB3C 1XEEA 1YJJA 2BYTA 1QCBD 1U9RA 2JA6B 5M3FB 2ZXOA 3OMGA 5CV5A 4RNAA 1ESFA 2RKSA 4RAUC 1SXTA 1FNWA 2RSOA 4N9TA 3C3LA 5CBAE 1CHQD 1IL8A 3H8HA 5ELDA 3MHBA 4N6EB 4HSVA 3CIRB 5KNDA 4AS1A 1FFVA 4X3UA 1Q90A 5LL6X 5FR3A 5CC4A 1I7HA 5KRUA 1IHZA 2F0SA 2EE1A 1L4DB 4UAIA 1GJXA 3AEGB 1ML0D 1ZXHA 4RH6A 1HXYD 4IUPA 3TP5A 1ZE3D 2NN6G 4N58A 4K5VA 2Z4IA 1WTOA 4ZAIA 2WDRB 5H8YE 3R93A 4DAVA 1TR5A 5EPJA 1PTOB 4QCLA 1STEA 1CK1A 5C3XA 3PUYA 4KY7A 2PQEA 5I2YA 1QT9A 3NHHA 5BYRA 2B2TC 2FBWB 1FD7D 3L9AX 1ENCA 1PZJD 2F0EA 4H44C 2EY1A 3D8GA 1RHPA 2R61A 2Z4HA 3P42A 2D9UA 3C1EA 4DA2A 3ONAB 1WXQA 1RODA 3S14B 1ROEA 4N59A 1EEFD 2A68C 3BDLA 4K5WA 4ME5A 1B9NA 3HEJA 1TZOA 1S5BD 3S15B 2EY5A 2F0WA 4C7YA 2MJ3A 4XWWA 5EBDA 1TKYA 2MP1A 3N6RA 4TSSA 2Y3AA 4YTMB 2WKCA 1V1PA 2KAJA 1XLNA 3KLSX 4O1NA 4IUQA 4KGSA 4YSZB 4KKUA 3NXWA 3A8IE 2H1EA 3AMUA 4PT5A 3P4QB 2PNRC 2LGIA 4ILWA 2EY2A 4UDUC 5FLXE 2EYHA 1WTWA 4IFDJ 2WDVB 3MHZA 2F0MA 3DWQA 2TMPA 1GHKA 1E7PB 1QILA 3M85A 1DCZA 3EUB2 3JAML 4MIUA 3M7NA 1LT4D 5K36H 1FMAD 2ZW0A 4G7ZC 4C3IG 4DXFA 2SEBD 1H9SA 2FFKB 2L0CA 2M56B 1KLUD 4XTCS 4YT0B 3H94A 4R9WA 3IXSA 5EE1A 3BWUD 1SIJA 3EQLC 1HA5A 2A6HC 1BDOA 1DGJA 3R2TA 4A3IB 1HHVA 1TIID 5G3LF 3AU7A 1PXUA 3EROA 3GV6A 3A55A 4RCOA 4I65A 1A2UA 1ONLA 3VR3A 5EBCA 2ONQA 1CJEA 4KHZA 3NSWA 2EOTA 1OO9B 4OZAA 3JAME 2WXKA 1HZ5A 2PW7A 1HRJA 4HRSA 1F2ZA 1TY2A 1BXTA 5I6YA 4HKZE 3GB1A 1TS2A 1E10A 5TSSA 4A3KB 1MI2A 2JSOA 3T16A 4WWMA 2XIWA 2NBFA 1IGDA 4K5XA 1K52A 4DF7A 1A3TA 5EQ0A 1E0BA 1QB5D 4KN7C 4DU9A 1ZDXA 1DOKA 3AE5B 1NCVA 3P20A 4JBWA 4HEDA 1F0ZA 3CQZB 3MFYA 4FYDA 1C9FA 4DN4M 1QQRA 1V8CA 1I6HB 2X6LA 3B2FA 2ON8A 3I72A 2INNE 4TQ1A 4RWSC 2F0OA 2E74C 4B9WA 1BCPB 2EVBA 5LNK1 1AWDA 2WXHA 3V3XA 4NMZA 4C3HG 2KWDA 2EY6A 3SHLA 3D4WA 1VLBA 1PTOD 4LTUA 3FDTA 1SYFA 3ZJVA 1EL0A 4K6LA 4OIJA 3PMFA 1Y69U 3CU7A 1XYIA 2JWUA 4CJ0B 4RGNA 1RFKA 2KDMA 3KUPA 3J80E 5JXVA 5KYLA 1B4OA 4KTAA 4WURA 3WCQA 4RHSA 1EWCA 2WNMA 2WINB 3AV8A 3LYYA 3CWIA 3X3NA 4IN3A 4IFDI 3W1SA 2KQ4X 2EDGA 1FYCA 1GUGA 1J7CA 1L0XB 3NZ3A 2BE5C 3D6CA 1ET9A 1CM9A 4DQOC 3I4MB 4ZUJA 1UGJA 1JWBD 4EVOA 1EWYC 3FEWX 1TJEA 3TN2A 1YN5A 3OWEB 2SNSA 1SDFA 1PTOH 1PGXA 1KTKA 3MAQA 5IT9L 3HOWB 2J42A 2FUG1 3MFGA 4P6VF 1ENAA 4KK7A 1XWEA 2IX1A 1F2LA 5I9OA 2GRIA 1C4PA 4C3JG 5IGEA 4KJOA 3EA6A 4RCNA 2L4NA 1Q1EA 3IL8A 1NAPA 2XWJB 4QUCA 1AN8A 3OMCA 3NTHA 1ET6A 3GQBA 5NUCA 1B50A 4B0MA 1WCMB 1VZ6A 4N9PA 4A3FB 3GO5A 1NYQA 3S2HB 4L8JA 2F1MA 3GTOB 2IJ0A 1ZXIA 5C4XB 1G91A 5C2TB 1PZKD 2F0FA 2FJ2A 3Q8FA 4EE2A 1LT5D 4RF1A 5HG2A 1L0YB 1K50A 4DK0A 3PUXA 2HDLA 4WAFA 1CHPD 2N0SB 1L5PA 2DYMA 4PMBA 4HAEA 1JR0D 2KACA 3AMZA 1AFPA 3KBXA 2HUGA 2IGGA 1I4RA 1LTAD 4IFDH 3KK7A 3AEEB 2SOBA 4JK1C 2PO4A 5M5WB 2K04A 4EQPA 1YNJD 3MA2B 1PFDA 4KD4A 1AZQA 2BW2A 1GUOA 1SNCA 1BBXC 2B2VC 1O80A 1Y8PB 2WQYB 5HI1A 2EELA 2MEKA 3CRKC 2YEPB 3OWFA 5IOCA 3I70A 4HMIA 3BZDB 1SSOA 3TP8A 2WXOA 1GXDC 3MXNA 1GUWA 3UI3A 1I4XA 3H0GB 1ACCA 1FFUA 3HVZA 1VJKA 5FO8B 3VR2A 5DNFA 5K5PA 2NB0A 3TUOA 1I3QB 3M3YB 4QF4A 4XIGS 3ND9A 5CBEE 1JOQA 1EWHA 3E5SA 4TMAB 4KMUC 4MACA 1FRRA 1CZWA 2X6GA 5KEEA 2WACA 3MZ5A 3Q8EA 5A35A 3TZUA 1SJED 3DWAA 1I50B 2B63B 3AE6B 1TVXA 2E2HB 3VR4A 2L55A 1JWSD 3BVZA 4NKLA 1UUPA 4BY7B 3SDZA 1NUCA 2OT2A 5IT9E 3IT4B 1C78A 2I46A 2ICIA 3NBHA 5CYUA 2PMVA 2B2WA 5I9PA 3NUCA 3AB5A 1B9RA 3GTQB 1B9MA 3BVGA 1X32A 5C0XG 1O7YA 1YNTE 1LACA 2EYFA 3KF8A 1EM7A 3MP9A 1DOYA 1IBXA 1OXTA 1HTLD 3P1MA 4IALA 1JB3A 5BYQA 3S1RB 1ESRA 2D2CC 5G5GA 4DXGA 3MEHA 4FF2A 3J81L 3P7JA 5C3EB 1T3QA 3HOYB 4U68A 1TYGB 2WV6D 1EY4A 2BE5D 3HOVB 1AP0A 1PMRA 2GI9A 2CW0C 4PV1C 1L0VB 1LTID 2RDGA 4ZUIA 1J7BA 1U4MA 1OXSC 2K6AA 1LTSD 4HSPA 2J4XA 4X3TA 1K83B 2K1BA 3V2TA 5I2XA 3HOXB 2VXWA 3IAS1 4ZKBB 2IT1A 4E6IA 3Q24A 2NVYB 2F0TA 1Y8NB 2K01A 4A3EB 4JX1C 5BMHA 1CZPA 3NK9A 5JJZA 3OOCA 5JPNC 2WKDA 1PRTB 2MJEA 3PZ7A 1E2VA 1PRTF 3BDOA 2F0IA 3SR1A 5DEHA 1I6VC 2KEDA 5COYA 4IURA 4C3IB 2HDMA 1JOOA 3AE3B 3EVQA 4NAWB 4OW0A 2EYPA 4NAMA 3W5VB 3VR5A 1KH0A 1IW7D 1DOIA 4MT5A 1RYJA 1DD2A 3U4EG 3CRLC 1XCQL 1AW7A 4FF4A 4LK1C 4HJGE 3HG9A 2WB1B 3HRZC 4DNRB 5C0XH 4KGRA 5M3MB 1L4ZB 2A74C 3AEAB 3OIQA 2QJLA 1LTRD 3PV0A 2JQRB 1KDCA 2JP1A 3PZ8A 4ZRQA 5BN4A 5D65A 2E2IB 5EJWA 2B2YA 4GDKB 2FHTA 2OHFA 1MPEA 4US9A 1M8AA 2JEBI 3FAHA 1JWAD 4S3SA 4MN3A 1NEKB 4OIKA 5ELCA 1IUEA 2KVMA 2K5QA 3BK1A 3PO2B 3K59A 3BK2A 3RFZB 4RGTA 3DWPA 4A3BB 2E2JB 2N88A 2FMMA 1SNDA 1IBXB 2EYOA 1Q8IA 3OPOA 2O2LD 1QOHA 1DXMA 1PDQA 1TKGA 1U4RA 1NYRA 1R4PB 1S5DD 1G2SA 1PTOF 3MXPA 1N60A 2DN8A 1LV9A 2DBYA 4XT3B 1WD1A 1D5XC 2NVTB 1V97A 3P63A 1JQYD 2F0QA 1FM0D 4HROA 4CJ1B 1I4QA 3P75A 2D62A 1ZUD2 1BO0A 4K2LA 3EGRA 1TWAB 4X3SA 4DGZA 1GUNA 3CHBD 4HMJA 2RDFA 1STGA 2WXFA 3I8ZA 1TWFB 3K5NA 3UI2A 3U7ZA 3RPFC 1JWUD 2SNMA 1STYA 2W54A 3ND8A 2WU5B 2ZW1A 3NP8A 4ZQ3A 3VR6A 3VRBB 2X38A 1DM0B 4HEA1 1RF2D 3J7AV 3H09A 2EJGC 3MXGA 1PFBA 5FLXL 3U2SC 4FNFA 1NR2A 2XVSA 1SYEA 1FNVA 5BMIA 1NI3A 1DOXA 3NBIA 5CMDA 1H9RA 3R2IA 3P4PB 4OO1I 1B53A 1VCIA 5T1IA 2VB2X 3GV3A 5LL6S 2K32A 1BOSA 4ARIA 1H9SB 4HR7B 1PGAA 2L9HA 1CFMA 3NRZA 1Q12A 1RTOA 5I6WA 2WU2B 1ZYRD 1VMCA 1BQQT 3FILB 3C1FA 1FXAA 4YIJA 1XLOA 3IFTA 1HFGA 2C9OA 1UWMA 1QWYA 4D2KA 2EZVA 1I4PA 4L1BA 3VQIA 4NZLB 1EU4A 2KA7A 3DEPA 2B2YC 1A15A 3P4SB 1LTBD 3C2PA 1BCPC 3DWMA 5D7GA 5IGDA 3W3AA 1ZP0B 1QOGA 3BIID 4FF1A 1SBBB 3QJYA 4XYOA 2OEOA 2NN6I 2RA4A 3GTJB 4HCEA 3AN1A 1NSNS 1BCPF 3AE2B 5IGCA 1OXUA 2DY7A 4C7ZA 2KEEA 5CV8A 1EYAA 4ZYSA 3SXHA 3HZXA 1TWCB 4US8A 2BDNA 2C5CA 3NVZA 2K0PA 5C3WA 1HQMC 2DLBA 1MI0A 4YXDB 2PPBC 2AUJD 3SE0A 4KGTA 2LJIA 1ZKOA 3T4AC 3DM1A 2KECA 5M5YB 4RGOS 2MJ8A 2F0UA 1V1OA 2VNUD 1MSGA 3MTSA 4JPSA 5T8IA 1PLFA 1ILPA 2Q8IB 3OW7A 3L4PA 2B8GA 5E4WC 4ZK9B 3FC4A 1CA5A 3OIPA 1G2TA 1YNNC 4OGQC 4XE0A 2LS01 4XYQA 2L5TA 3K5MA 2K33A 3K7AB 1YJIA 2F0DA 1EY0A 1GB4A 1F9SA 3NPPA 1KABA 3K5OA 4CKBA 2A73B 2DNEA 1F2MA 2XNAC 4QUFA 3GTKB 3NUHB 3RZDB 2CVRA 5C4HA 2WXPA 3SR6A 1T5EA 2J0TD 1HUNA 4ZHPA 3AEBB 2PYKA 1BNZA 1FO4A 1A3UA 1I4GA 3ABVB 3VYRA 1RWSA 4C3HB 1G291 4WH4A 4WFN3 2JXMB 2NZ1D 4GZYC 4R8IA 3LXFA 3HGBA 1MD2D 1QG7A 1HCZA 2R7ZB 3J7YW 3WOEA 1KLGD 1VF5C 3FKIB 3W9CB 2KMMA 2IPKD 3J81E 5JAVA 4K2KA 1KRHA 4P2CB 1QLBB 2B2VA 2QF7A 3E56A 2D5GA 2IDYA 4RKBA 4V190 2JXTA 2F0VA 2QILA 5T1GA 2IL8A 2R93B 3R8BA 1H9KA 1V1PB 2AUKA 4H0LC 2SDFA 1T6BX 2W55A 4MH8A 4IFDG 3KBGA 1A2TA 1S5ED 1BR9A 1C76A 2VB3X 2F0GA 3WDNA 2YU9B 2F0NA 3TP7A 4DAPA 1TY0A 3LNNA 3TZDA 2HCCA 1CZGA 2KHSA 3NTIA 4C56C 4BBSB 4XQJA 4J6HA 2V3PA 4XDCA 1KNEA 1EYDA 4TQ0A 2IGDA 4KY6A 5FK9C 4LAAA 4DAYA 1JWMD 2QCPX 4IUNA 5CV4A 3I4LA 1STAA 4DNTB 4K8IA 5KYIA 5CGKA 3VR8B 1HA6A 2WXJA 3D4RA 2DWQA 4KHVA 2ACZB 2XRSD 1SMYD 4G7OC 3A54A 2RPVA 5ELEA 1TKWB 3SK8A 2INPE 3H6MA 4EQNA 4H7BA 3X3MA 1C48A 2NMQA 4ABNA 3GS2A 3NTKA 2GB1A 2CHBD 2H89B 4QB4A 3SEBA 3Q6SA 4TKOB 3RLFA 4NP5A 5C6AA 3W5UB 1CTMA 3E9SA 2N55A 2L83A 1FIQA 1Y8OB 3VA7A 3R3OA 2E2DC 5BYSA 4K6DA 3MVVA 2NTTA 1RD9D 2LFNA 3S17B 3Q0AA 4M0WA 3L3OC 5EKIA 2KOLA 3RMHA 2M19A 2K5WA 1EY7A 4A3MB 3K58A 3EFXD 1CQFA 5KNBA 1K51A 4FXGC 1SFOB 3AEDB 4K8JA 4J8QA 3NWSA 2W3SA 4O42A 1GOZA 3DMUA 4C2MB 4HN7A 2L1BA 3FVQA 2JE6I 2JSVX 2I07B 2SAKA 1EFID 2EYLA 2AX5A 1SSNA 1O7LA 2PMZB 4DK1A 4U673 3KLRA 4ZKCB 3NQTA 2F0PA 1E0ZA 4JE3B 2KCNA 2PVOD 1D1KA 1FCCC 1WTXA 2QIEB 2EPBA 3D6WA 4TQUS 4QMGA 4QIWB 1WYGA 2WXIA 2F4IA 1JICA 2QMTA 1QOAA 4J3OD 1XCTL 1F2RC 1OFFA 2PVGC 1KNAA 4G57A 1SYCA 2WIIB 2V3NA 1B1ZA 1CT1D 4CGYB 1V8QA 4H2AA 1BF4A 4FXDA 1PZID 1UWXA 1STBA 4WJWA 1JMLA 1WVLA 3ZJUA 5IGGA 1C4QA 1K53A 1QNUA 4KJNA 2AWOA 2MPMA 1SE2A 2F0LA 4IDIA 3IFDA 2EJFC 3T56B 2B8FA 1ICWA 1EYCA 1PGBA 5C4ZA 3SFDB 1KDBA 4CQNA 4OL7A 3S2DB 2PZUA 5I4DA 4IUUA 4XWTA 1F2YA 1HFNA 1FGBD 5E6JA 1XLQA 3ITPA 1B2TA 1QNKA 2A69D 4KKTA 2N7JA 5H92C 4Q0FA 2J53A 1KFYB 1XX8A 1RDPD 3M7GA 2RSNA 2W3RA 3A7AB 2JZPA 5DAUA 1F9PA 4BS9A 4XDXA 4MM3B 4RGMA 3TP6A 4KKJA 1SYBA 1BUIC 3URYA 1LLRD 2F0JA 2NWGA 3AB9A 3S1MB 4OVZA 5BN3A 3AE4B 4YTPB 3J7AF 4XT1B 2L52A 4REZA 1U4PA 2MH7A 2XN9C 3P1HA 1E6EB 3AH7A 1IGCA 1E2ZA 4PQXA 1PFNA 2Z1CA 5ELBA 2K05A 4OZCA 4A90A 1K8MA 4KN4C 4R3DA 3F2UA 4IZ8A 1F9RA 1Q3LA 2QKIC 3BDCA 3Q69A 2PIAA 1ENFA 1YMHE 4WIPA 3SFEB 4L23A 3ZYYX 1GPXA 3V96A 4BY1B 3MWYW 2IX3A 5E4XA 5JEAG 2JYTA 3C46A 2NVQB 1A70A 1X3QA 3VYTA 2A6EC 1P7EA 3VR9B 1TU2B 3IAYA 2WXGA 5A2QL 4A3DB 1A6XA 1IYVA 1C79A 1QOFA 1EU3A 5D3DA 5IGBA 1N61A 2CW0D 1EZ8A 5HGTA 3T13A 1XF5L 2WS3B 1DOMA 4M8AA 1CQVA 1HTPA 4LLGM 5EKKA 3HOUB 3NS1A 3B2GA 2ID0A 1VZ8A 4F88A 1I4HA 2JA8B 1C8CA 1AEXA 3QB3A 1XLPA 1QKZA 4X3KA 1D2BA 1JW9D 2NN6H 4ZHOA 4KV6A 2WDQB 5ELFA 2Y5CA 5AFWA 4AYBB 2F03A 2B2UA 4CBVA 1Y1VB 2F3WA 1JRPA 3I9V1 5FKAC 5GXGB 1BCPD 1R4QB 3G7LA 3ZGZA 5JPMC 1B3AA 3MC0B 1GUSA 4ZLTF 3G6JB 1HZ6A 1WSPA 5EE0A 1FCLA 2KUMA 5JOBA 2KN4A 3NVVA 2DNCA 5BN5A 4IOIE 3H91A 2K03A 2KCCA 3HRDD 2J7ZA 4PNYA 1NVID 1CA6A 4J1MA 2QSDA 2A6HD 2IGHA 4LK0M 1VF7A 1ZXTA 2NTSA 4OZBA 3BVMA 5EE9A 3TDQA 3OHXC 5G5HA 1YN4A 2AWNA 3KLSA 1DYQA 4HTHA 1R9TB 1S5FD 3O13A 2CJNA 2G1EA 3AE1B 1EIHA 1P7FA 1DZ1A 3L7ZC 2E76C 4KD3A 2FINB 5C5MA 1KF6B 1OXXK 1B44D 3ZQ4A 4A3JB 2QEJC 4IQZA 3K57A 3QOJA 2PZTA 1UNSA 2TSSA 4R8NA 3ZJTA 1D5MC 5DM73 1LTGD 1IKLA 2PCFB 4I7ZC 2L12A 5CV6A 1MBYA 1V43A 1FEHA 2PW5A 2F3VA 3PUWA 2LFIA 1WTRA 4YWGG 2IWHA 1SYDA 2JA5B 4FXCA 1MHXA 1IYUA 4XDDA 1FXIA 2NYZD 1C4AA 3QOLA 1YNND 1PFMA 3Q23A 1XO3A 1EY5A 1ZOYB 5D3IB 5M5XB 3HVDA 1F9QA 2F0KA 3FILA 1KAAA 4RF0A 5HFYA 4FP5D 3KQ4A 1Z7TA 1OQQA 3OSOA 1RTNA 1S4ZA 1MHHE 5HHDG 2HDEA 1JCKB 3I90A 3FPPA 2F0HA 2MHVA 2XRQD 5KGUA 2WAQB 1SJHD 4C1NI 1N63A 2K5DA 1SNMA 1LT6D 1D4BA 2JEAI 3AE9B 5J1ZA 3AE7B 3LX0A 1F2RI 1UEAB 1H9MA 3T3NA 5KNCA 5C3JB 1ZDVA 1PDXA 3I57A 2IW3A 4B0EA 3A56A 3BG3A 1QF6A 2Y0SB 3TSSA 2VZKB 3J80L 1WTPA 3TEZA 2FMCA 3M4YA 4KX6B 1TS3A 3U9SA 1ILQA 5EPKA 3T51B 2BT6A 3AEFB 4IUTA 2Y5PA 4OO1G 3I73A 4ULLA 4C80A 1E9MA 1DOLA 4FXKC 2VUMB 4XXEA 1W6JA 3IT6B 2BB6A 4Z9CB 3VYSA 3GTPB 1STNA 2A6ED 2Q8TA 1VMPA 1XXGA 3I3CA 5D14A 1N62A 4LMQD 3B9JA 1SNOA 1Y1WB 3A7LA 2PTLA 4ODGA 1EQVA 1WRIA 1JOKA 4FO2A 3D4DA 2ENBA 3E0JA 2I2YA 2GA4B 2R6GA 1LABA 2JYOA 2OF1A 1Q1BA 4A3GB 4XQNA 3NWTA 2O5IC 3D3RA 3NVWA 4HKQA 2VZKD 5EPLA 3Q8BA 2RDHA 2XWBB 2V4DA 1II3A 1WWTA 1HPCA 3FMCA 1AZPA 1WGKA 1CI3M 4A55A 2G9DA 2R92B 2OXPA 5E1FA 2BOSA 2OEDA 1JROA 4F8MA 1EOTA 4F7XA 1SAPA 1F77A 5CV9A 3SK6A 1TQOA 4ITKA 1FNUA 3S16B 1PRTD 4A8XC 3HS0C 3VRAB 5JEAJ 1K8OA 2WXNA 3DHQA 1Y56A 1ZYRC 1SNQA 3S1NB 5EKLA 3DWGC 3T53B 2O4XA 1PYWD 2R3ZA 3LWUA 2JX5A 1EY8A 1L6VA 1ZPSA 1GAQB 5EE3A 3VYUA 4XQQA 2DY8A 4NDXA 1SNPA 1TWHB 1LO5D 3RUZA 3SK5A 3HOZB 2RMMA 1YQ3B 1JE4A 5C5LA 4ZRPA 2YEPF 3Q8CA 2JU6X 5KIXA 3TEXA 1PTOC 3V05A 4OO1H 5CR3A 1VZ7A 3WOFA 2DYOA 5MPOA 3M4OB 2M00A 4PMCA 3VA5A 2E3TA 3AE8B 4JWSC 3H3VC 5C44B 3DUZA 2LEKA 2MUYA 4JWUC 3FRPB 4L2YA 4G7HC 3PIP3 2ZXPA 3Q8AA 4Q2JA 1PRTC 2LUMA 1JALA 1R7SA 5JVG3 1VRAB 2E75C 1UAPA 4CJ2C 1M4VA 4FF3A 2B2WC 2BDOA 1TKEA 2WXLA 1SMYC 2BBCA 2I38A 2H4OA 3W2DA 2RBMA 2PZWA 2L32A 1HEZE 1LTTD 3DXJC 3ERQA 2N9LA 4G4KA 3BS1A 1O7ZA 3MJ5A 2L1AA 1S5CD 3A8JE 2Z8LA 2M9VA 2J52A 1HUMA 4K14A 4OHJA 1T5XD 2Q8RE 4YTNB 2E6XA 2ZXRA 1Z47A 2EXZA 1N5WA 3QO2A 1WD0A 1MVKA 2BS3B 3KWLA 1BUVT 1QOBA 5CORA 4B08A 3HP3A 3PUZA 2B2TA 2AQ3B 4L6TB 3D31A 4BA2I 4BWGB 2WLBA 1SF0A 1C77A 3KWVA 4BA1I 1QJOA 4A93B 4NJCA 1RKNA 2A5HA 5ISRA 1EQTA 2H88B 2A68D 1JC7A 5JVH3 2K28A 2K7VA 3K6OA 5G3LD 1KDAA 4YSYB 3PIO3 3J9CA 4WQMA 1D1IA 5C0XI 2ICEC 2PW9A 4Q5VA 1FR3A 1TS4A 4CHTB 4WRDA 1BMLC 1GB1A 3NE5B 3TBIB 1O78A 1FD6A 2EYJA 4P16A 1U4LA 4KKIA 3E6ZX 3RZOB 4USAA 3U52E 1N5XA 5FOBB 1IKMA 4KY5A 2AQ2B 5J22A 2CJOA 2KJXA 2BA1A 3PO3B 1GUTA 4ZRZA 2M2LA 1VR9A 4EGVA 1EY9A 4C1NK 4RHRA 1STHA 3U9OA 1ZEQX 2V4IB 2HQEA 1TT2A 4KKSA 2NVXB 4YSXB 4L63B 2YYZA 5DM63 1RM6C 2NUCA 3N52A 2JYEA 4RFBA 2M0AA 3N9YC 2KQ3A 1YN3A 4ID6A 3QG1A 3S9WA 2HTME 1E2WA 5FO7B 1TS5A 2EKIA 1DJRD 2D5DA 5EGTA 4AQ7A 1FRDA 3HUIA 3QIAA 5HURA 4ARCA 4RKLA 1VDVA 2HCIA 2K9XA 3GTGB 2LKVA 2WXRA 3NVYA 3GTLB 5M9OA 3ETRA 3IKJA 2WXQA 1EY6A 3FPUB 2B39A 1MGSA 1JORA 3MXUA 1YNJC 2WP9B 3BYYB 1G6ZA 2BB5A 2Q5WD 1WTVA 2FE8A 4NW2A 3TEYA 3LWEA 2BTEA 5IGFA 5C0XJ 1SEBD 1J8IA 1LT3D 1EZ6A 3GD7A 5JEAH 3IAM1 2IX0A 1TWGB 3GTMB 2XSCA 4M1UB 4MHEA 4PMWA 4TRDA 1GHJA 4V0BA 2MJDA 3Q22A 5IIFA 1PUTA 1EIGA 2MGSA 3GP7A 1HQRD 5BMGA 4F87A 3NQIA 2BS2B 2LHDA 2BCOA 4DFAA 2LMCA 5A2QE 3AECB 4B9XA 1H9JA 3RD4A 4A9AA 5E3FA