1I4XA

Staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
235
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 72
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4xA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4xA02
1TS3A 3EFXD 4DXGA 2CHBD 4RCOA 1HA5A 1BCPB 2G9HD 1LTGD 3R2IA 1LTRD 3DWAA 1XXGA 1CHPD 1JWUD 1TS5A 2QILA 3URYA 1S5FD 1QILA 1EFID 1FNWA 1V1PA 1LTAD 2SEBD 1AN8A 1JR0D 1PZJD 1S5DD 1LLRD 1DYQA 1ESFA 1LTTD 4L63B 1PTOC 4OHJA 1PRTC 1PTOH 2XRSD 4K6LA 1RDPD 1HXYD 2AQ1B 4RGOS 1YN4A 1FNVA 1JWSD 1HTLD 1LTID 1CQVA 1KTKA 1TS2A 4RGNA 2XN9C 1FD7D 1B1ZA 2R61A 1V1PB 1FNUA 5ELBA 1RCVD 1TS4A 1D6EC 1LTSD 4NZLB 1D5MC 1JWMD 1EWCA 1UNSA 1TY0A 1L0XB 5ELCA 1PRTD 1I4XA 4RGMA 3R8BA 3SEBA 3DWQA 4Z9CB 1STEA 1DJRD 1I4PA 1ET9A 1FGBD 1KLGD 1XTCD 2AQ2B 5ELEA 1SE4A 2AQ3B 1LT6D 1PZKD 1PRTF 3BZDB 5ELFA 4RH6A 1S5ED 5D3DA 2RDGA 2QEJC 5FKAC 1LO5D 3V05A 1YN3A 1BCPD 2IJ0A 4RFBA 5ELDA 2J4XA 3R2TA 5FK9C 1ET6A 1BXTA 2ICIA 2IPKD 1I4QA 4RHSA 1L0YB 1EEFD 2XRQD 1JQYD 1PYWD 3GP7A 3DWPA 1I4GA 1YN5A 1JCKB 5TSSA 1LTBD 1EU4A 2NTSA 1SJED 1RF2D 4RGTA 4TSSA 1I4RA 3BVMA 4DXFA 4L6TB 1I4HA 1F77A 1KLUD 1CHQD 1G8ZD 1SEBD 1V1OA 2NTTA 2WV6D 2Z8LA 4UDUC 3BYYB 1B44D 1CK1A 4BWGB 3OWEB 1SE3A 1AW7A 3CHBD 3MC0B 1CT1D 3BYTB 3MFGA 5I4DA 4C56C 1BCPF 1GOZA 1RD9D 1D5ZC 3KLSX 1EU3A 1PTOD 3TSSA 1LT4D 1TY2A 2RDHA 2TSSA 1UUPA 3O13A 2XNAC 4RHRA 1PRTB 1D5XC 1SBBB 1SJHD 4ZYSA 2O2LD 1LT3D 1S5BD 1HQRD 1SE2A 1SXTA 5D3IB 1PZID 1ENFA 1S5CD 4O1NA 1M4VA 3BVZA 1EEID 1T5XD 3W2DA 1LT5D 1MD2D 1PTOB 3EA6A 3BVGA 1PTOF 1BCPC
chains in the Genus database with same CATH superfamily
1AFPA 1F2YA 1N62A 4WJ4A 2HCCA 4JBMA 2ONQA 4ANUA 4KI0A 4ZHOA 3T3OA 5DLQE 2H88B 3SDZA 2Z0SA 2N7EA 4IFDH 2KKCA 1FMAD 4OO1I 3VA5A 1FPYA 2JP1A 4H0LC 1NEKB 4IM2A 3D8GA 3AFPA 4KHZA 4GNXB 2V9HA 1XPRA 1ESFA 4X65L 1TKYA 2X8XX 2RHQB 1A70A 1VQFA 1STHA 2BGFA 2DGYA 4UP8A 1X1MA 4JCVE 2LXAA 4PMCA 1NCVA 3SE0A 1SE8A 1N33L 3RCZA 5M3FH 5BN5A 3WOEA 4M1UB 3W5UB 1IYFA 5GAEC 1LABA 4LWCA 4UAIA 1P0RA 2KVMA 5M9OA 3AE6B 1P98A 3SDLC 1J0GA 3ZXRA 1Q0WB 5IP7G 3CCRA 4WFN3 1Z9FA 5HGTA 5IOIA 3J7YW 4KKUA 5IAAC 4FULA 1D5MC 1P9DU 1YJNA 1QVCA 1R4PB 5IP4D 1PMRA 1X3EA 2K8BA 3NVZA 3MHSD 3DWQA 1D1IA 2D3AA 1WXVA 2PLPA 3H7PB 3NS8A 5AEKB 2ZPYA 2J42A 4JI7L 1NMGA 1ZOYB 2I5LX 4G7OC 4WIPA 3RD2A 4F8MA 1KLGD 2AQ2B 3JSVA 4G11A 4N9PA 1JC7A 2A69D 3S15B 3DBRB 4JG2A 3Q3JA 4ICVA 4BFRA 2I07B 4POGA 3ICEA 4F7ZA 1JJ2A 2BYFA 1DM0B 1HH2P 4ZAIA 2WXNA 4BKTA 1PQSA 3M63B 1E22A 2ALYB 4KGSA 2WXIA 4IO9A 2K5QA 3JC66 1IBLL 3AE3B 2J0JA 1E8XA 1VJKA 2JA7B 4K5XA 3SK8A 1A63A 1ZXTA 2MA9B 4NP5A 3H7PA 1EEFD 3E5SA 1PH8A 1WYWB 2DYOA 4A3EG 5CX3A 2OJRA 3HZXA 3GP7A 1QZHA 4LF9L 3JVZX 3M4OH 4YTPB 4HEDA 4KKSA 4GMVA 4LDTD 2KDMA 1STBA 1OXSC 4O2DA 1EQRA 2Q2HA 2KECA 3NTKA 1RTNA 2HDLA 3Q6SA 5KYLA 4JBKA 1II3A 3TBLD 2ZTDA 4OGQC 4LFAL 4OVVA 3S1MB 5D65A 4XQQA 3VUYA 1KRHA 3SVMA 1HUNA 3RN5A 4RF1A 4URKA 3NTIA 4GKKQ 1CSPA 3E9SA 3LJ3A 1STGA 5J18A 1FCCC 3S1QB 4L2YA 1C79A 1VQDA 2F1MA 2IYDB 3HEJA 2EMTA 4MN3A 4GKJQ 2HHHQ 1P7FA 5D6JB 1FR3A 4WJWA 4A3FG 1PTOD 5EE3A 2B8GA 2LXKA 1CQFA 2K6DB 4CQNA 2HIVA 4REZA 3DUZA 4WAFA 3DBSA 3CF5A 1DOMA 2UU9L 1J7AA 2DENB 5CYUA 2QCPX 4DR3Q 3CC4A 2QDFA 4HJGE 4LNKA 4AJYB 2K5VA 1LGRA 3K0XA 1K8OA 1PTOF 2VS1A 2NWGA 1K0SA 2EXZA 4JI4Q 1YJIA 5D94A 1EY6A 4RCNA 3CMAA 2KK8A 1TXYA 3B1LX 3OTOL 1MG8A 1VMPA 2EZVA 1PYSB 2E5LL 1SROA 4ZKCB 1LXDA 3HFZB 2F0QA 1NMFA 5FLMG 4A3EB 2B2WC 4FNFA 5KEEA 2DZIA 3DHGC 1KDCA 2ZW0A 4OHJA 5IYDG 3FHWA 4DNRB 1IBMQ 1TWCH 3KDFB 2VUMH 2INDC 4B3RQ 2VRRB 4FXCA 4C00A 1Q8IA 2L05A 1LACA 2MBEA 4K8JA 4FXGC 2BE5C 3H94A 4IALA 1A62A 4W9JA 2A5UA 1EWYC 4I65A 3P1HA 4KD3A 1WGHA 2H1EA 2D0OA 3RN2A 2ASBA 2GLSA 2KTRA 2D3BA 1C76A 3SFDB 1FNUA 1EFWA 1XLNA 2F3WA 4QUCA 2L11A 1E6EB 1J8CA 4WWMA 2F0JA 4AQYQ 2LS01 4OWXB 2Q2UA 3PO3H 3VHTC 2RPQA 1Q12A 3KQ4A 1VQLA 3ZNZB 5ELCA 2IO0B 2LFIA 4W9FA 4YSXB 5M5YH 1QVGA 3I3TB 3PGEA 3HOWB 1KH0A 1KQSA 1V5TA 1SYEA 3HOUB 1BVSA 5C4ZA 1ML0D 3UDGA 2UXBQ 1QQRA 1SE4A 3FP9A 2SNSA 4POFA 2MX2A 1E7UA 3K7AH 1PUTA 5L37A 2KHJA 1L2NA 5D2MB 3K9OB 4A3FH 1ZDVA 4DXAB 1GKHA 1LO5D 3PRZA 2K28A 2M0XA 2F0WA 4DUYL 2M17A 2Y5BB 3KH0A 4KK7A 2YYZA 2FIFA 1BXTA 2GBJA 4IPDA 1HQMC 5IP9G 3A4SC 5LNK1 3AE5B 2A6HC 4C4VB 2FCQA 4PS7A 5MPOA 1PH9A 1CUKA 2L83A 4J15A 4K0KQ 4KSLC 5I6YA 3OMCA 3P42A 3ZW3A 2WXOA 2SOBA 1IW7C 1OXUA 3NEMA 1LTBD 2R92G 5IYCG 3VDZA 2A68C 4JBJA 1YJJA 2KFKB 1KDAA 4A3JH 2K5HA 2R7DA 4MSMB 1FM0D 1B9RA 4KY7A 3AFQA 3WCQA 4A3EH 4GLSC 3UQAA 1STYA 5C3EH 1SEBD 2FUG1 1M90C 4NXMQ 1X56A 2KXJA 3BYYB 3GTMH 2EYOA 1I6VC 3J9CA 1C9FA 4LFBQ 1CT1D 3G6JB 1XLQA 1B53A 1J5EQ 3MFGA 2MBOA 1GVPA 1GOZA 3QCAA 3KF8B 2BWES 2WXFA 1K8GA 4DR7Q 2XNAC 1MFWA 1V2YA 1JWAD 3F2BA 4BOZB 5K36H 3AULA 3W1YA 3UDFA 5C4XB 4DV7Q 2N7DA 1S5CD 4O1NA 1S3OA 3FILB 4LUZA 3EVQA 3KLWA 1QCBD 2CU3A 2KMAA 1VZ6A 4TQ0A 4KZCA 4DV3Q 4GKJL 4JPBW 5E6PA 2IX3A 1HZAA 1K28A 2H89B 4XDXA 2B2UC 5C44B 2UUCQ 2WXLA 2YTYA 4H44C 2PW7A 3K8AA 2DYMA 4RCOA 3BK1A 1HA5A 4WURA 2PPBC 4BBRH 2KJXA 1IBML 1WXAA 1YJ1A 3AU4A 2KWDA 1TS5A 2CKZB 2PI2E 5CHFA 1EZ6A 3AEGB 3S2AA 1WCMB 1SN8A 3RZOH 3GTGH 3NHHA 4LF5Q 2K8HA 4M8NA 2BA0A 1CJEA 4HRSA 4IUTA 2BS4B 3NK9A 1BR9A 1JR0D 4WJNA 1YNTE 1E90A 1K83H 1LTTD 1MSHA 1W6KA 4R4CA 5EPLA 3GTOH 1PTOH 1JRPA 1ROEA 4K6LA 3K58A 2KQSA 1U4LA 5DCNA 2NVYH 1FNVA 4LLGM 3DWGC 2JXXA 1UE6A 2WAQG 3TBIB 1WI0A 2G1EA 2D62A 4LJOB 1N32Q 3GDEA 1UELA 1ZYRC 3Q22A 3C19A 2MRPA 2CH4W 2UXBL 5C4XH 2BS3B 2YEPB 1UD7A 5EBDA 4IFDG 1LTSD 4QL5A 3J80i 1C4PA 1Y8NB 2K01A 2IY1B 3HVDA 4HJKA 2RR9A 5C1ZA 1E24A 1LM0A 2AUJD 3S14H 2FIDA 2XK5A 2JYEA 2BVCA 3N20C 2R2QA 2MP2B 3RI7C 2JF5A 1KD1C 4JI6Q 4A93B 1CTMA 3V62A 4K81A 1GB4A 1GC7A 1K50A 2E6XA 3R7QA 4C3HG 1ET9A 4CBVA 1WYDA 3CAMA 5A35A 4V0BA 3TP8A 2VH2A 3HOXH 1WTOA 4MELA 3NS1A 3FKIH 4BBSH 2WXPA 3TMPB 4QIWB 5J17A 1T9HA 4NB3A 1QG7A 2ZXOA 3IFDA 5C0XG 2QSDA 3DBLI 2K33A 1C7YA 1QZEA 2SAKA 3QARA 4CO7A 4CJ1B 3QJYA 2IO1B 1RHPA 3RNBC 3ZTDA 4DPGA 1FEHA 1WMHB 3QQ8B 3VTVA 3U9OA 4JLCA 2HD3A 5C4JH 2PZTA 3OMGA 2BA1A 2NVUI 1SAPA 2V4IB 1X55A 2XRQD 2BKFA 1WWTA 1BO0A 2YU9H 1GG3A 3QIJA 5I2XA 5IGBA 5TSSA 1V1QA 5DPSA 2JYOA 1X54A 2E2DC 1QUQA 4XTCS 2VQFL 3A54A 3S2HH 2KFJA 1G291 1K73C 1JJCB 3JAMc 3TZDA 3MFYA 2WHIA 4JGHB 3OWFA 5CV6A 1I4HA 3ZDMC 2D07B 2NUCA 3MXGA 4NJCA 1NJIC 1ESRA 2G3QB 3A1QA 4BWGB 3PSEB 4GSWA 1CMXB 2CQAA 4M8AA 2NVYB 3MC0B 2VZAA 1EF1A 1WD1A 3GE3C 5KNBA 4KY6A 3RFZB 2HDMA 4P6VF 5I4DA 3TDQA 4BKGA 4QY7A 2KDBA 2Q8RE 1XLPA 4KDLB 5CV9A 5F2DA 4A3GG 1HNXQ 3ZNID 3TP6A 4A20A 1ZDXA 2N1VA 2D10A 5JHAA 3H0GG 1SMXA 1WX7A 2JA8H 4A3DB 1ENFA 4NKLA 2Z6BA 3W3AA 2R6GA 1HTQA 4AYBB 2JXMB 2O6VA 3UIOB 3ZNHB 2GBNA 3LWUA 2J52A 2B3GA 1XMOQ 2DZKA 1F2LA 3S1RB 2A69C 2GI9A 3VYTA 3ZJYC 5H1SE 4BA1I 3NE5B 1EYCA 1WR1A 1NUCA 4A3CH 4BY1H 2IGHA 2LJ5A 3Q8EA 1LTRD 4U673 1QOBA 1IYJB 4MTKA 4LAAA 2V4LA 3N1XC 3Q3FA 5AFWA 4AH6A 1PFDA 2JA6H 2UUAL 3RMHA 3EFUA 3CPWA 4A3LG 1WF9A 3VUWA 2KANA 2L76A 3OW7A 4RGOS 4R4IA 1IUEA 2PVGC 2W55A 1SFOB 5J22A 2QEXA 4A3DG 1NR2A 2JA8G 1AE3A 5C4XG 2MO1A 2MPMA 2MLBA 2F3IA 3MHZA 2BWFA 3KDFA 2EJMA 1FYCA 3KBGA 4K6DA 5EE1A 3QC8B 2N1WA 2QDBA 3WAPA 3UINB 2HHHL 4LFCL 1KABA 2PZWA 3D4RA 4A3KB 2HQEA 1WRIA 3Q69A 4DHJD 1TWHB 1VQ7A 4EOYA 3DBRI 1TQOA 1VCBA 3NOBA 3P4PB 5LMNW 2ZW1A 3W1SA 3AM9A 1IKLA 2PQAA 1PH7A 1C3TA 1FXIA 3CCEA 4F87A 5H8YE 3AB5A 3DLLA 2PQAB 2KLGA 3L16A 3OAWA 1HJPA 2LVPA 2JRHA 1F9QA 5C3JB 4IFDI 4E3CA 1S1QB 2RSNA 5IWAQ 1VQEA 3NWSA 2FCSA 2LGXA 1WX8A 4BBNF 1RTOA 3FRPB 1R4QB 2X69A 4IWPA 4IZ8A 3L10B 3RT3B 2ICIA 1EIHA 1C77A 1VZ8A 1E9MA 2AKWB 5LMUQ 1X3GA 2PQEA 1X3FA 3I4OA 4IUVA 1JQYD 1NI3A 4TRDA 1DCZA 2GRIA 1U5KA 3J80E 2DN8A 3HG9A 1BT0A 1PGBA 3AQQA 2VQEQ 3F1ZA 4OIJA 4ZDVA 4XWWA 4A3MB 4EGVA 4P73A 2P5ZX 4W9GA 5M3MH 1GUWA 4DV2Q 4KJNA 4IJHA 4ABNA 2LGDA 3BS1A 4R3DA 3H0GB 3GTJB 4DV4L 3PT2B 3Q3NC 3SFEB 5KRUA 3AE2B 2Z8LA 1CK1A 4KKTA 1VQPA 2PW9A 4DR1L 4EFOA 4DV1L 1E2ZA 5ELOA 1FJGQ 3KUDB 3TL5A 2L52A 3DM3A 4P1BC 2EYJA 2KTFA 3APDA 3HUIA 4LF8Q 3BYTB 2CFMA 2NPTB 2VNUD 4YSZB 2RDHA 5JJLA 3NELA 2KOXA 2UYZB 3IRBA 4HJ8A 4FHKA 1EL0A 5CV4A 4XT3B 4OVUA 2B3AA 1JE5A 5KIXA 5LHY1 1WY8A 4AUQC 1YEZA 2WXRA 2B2VA 1UZXB 3M9BA 3AE9B 4AQYL 5AZHA 2O2VB 3UGBB 4FHJA 1C4QA 2EKEC 2F3VA 2B2YA 2NS5A 2AHOB 5FO8B 1BCPC 1JW9D 4X64Q 4DXGA 2X6GA 1GUAB 4K5VA 2JSVX 4A3MH 4EEWA 4WH4A 1A5RA 1MI2A 1KAWA 3R2IA 3MC9A 3QHTA 1E1OA 2L5TA 4NZLB 4A76A 1Q1EA 3J80c 1GUGA 2A19A 1VQ4A 5LL6S 2DY7A 2CHWA 4P2CB 1C48A 3B2GA 3OSOA 4KKJA 3HOVG 1E3PA 4EQ5A 3WOFA 2FAZA 2XRSD 4IFDJ 1Q10A 1RDPD 1KOTA 2UUCL 4CKBA 5K36G 2Z0DB 1WTRA 1BF4A 1O78A 1QOAA 1YD8U 4OIKA 4MTNA 2A68D 2F0MA 1EWIA 3S1RH 2R61A 2R3ZA 1N8RC 1VRAB 3D4WA 4DFAA 4DK3C 1OQQA 1RCVD 2N3SA 4IUPA 4C7YA 1EIGA 4IJLA 3ZXVA 4LF6Q 2JK8A 5EE9A 4JOIA 2IO2B 2EYFA 2L1BA 2WXHA 4R4TA 4DBGA 1F52A 1TIID 4GDLA 1WZ0A 2I46A 3CD6A 2A6ED 2O2VA 2WAQE 4DGZA 3CCQA 3U7DA 4GDKA 4JV5Q 1I4PA 1FGBD 3J80L 1XYIA 2R92H 2RPVA 3C8YA 1K53A 1Y8PB 3DXJC 3UE1A 3PO2G 2LJIA 1Y1VH 3A8KE 2IX1A 1NENB 3CCVA 4FJZA 3NUCA 4BOSC 1WE6A 3BZDB 4TV3A 2IL8A 5LMUL 2VUMB 1GAQB 2PIAA 3GV6A 2FHTA 1TWAH 3IVFA 2K4KA 3I2ZA 5CBEE 1NE3A 1OQYA 1WGDA 2K1FA 5JHBA 3I90A 5E4WC 4FADA 1Y1WH 1L0YB 3RNEC 1O7IA 1B3AA 4ANXA 2M2LA 2WB1G 4KMUC 2F0IA 2K5NA 1N9WA 2MFIA 2PMZB 4LUOA 1A15A 1TGZB 2NN6I 2A5HA 1CZGA 1QKZA 1L2FA 2PI2A 2Q2TA 2MP1A 3NTHA 4JI5L 5DPTA 3OJ4B 2L8JA 2Q8IB 5JAVA 4LFBL 3H3VI 4OL7A 1MSGA 2QA4A 1FO4A 3V61A 1ZW7A 2QIEB 2KDFB 4P7IA 1WXSA 3E0JA 5AZGA 4JYAQ 2ACZB 1V81A 1CKNB 1AW7A 3ULJA 1Q1BA 2JA6G 3BZKA 3NENA 1E7PB 5EDSA 4A3KH 1NNXA 1YJ9A 1BCPF 2XGTA 2NN6G 3TSSA 3FILA 1TY2A 1J9OA 4EZLA 5BYQA 2IY5B 2IZVB 1KFYB 1NYRA 1LT3D 3Q8DA 3ZYYX 5DEHA 2ES2A 4K5WA 4DK0A 2KCCA 3L2PA 2MW5A 1QZGA 1MD2D 3K7UC 1MHWC 1HZ6A 5JJZA 1SIFA 3ABVB 1WTQA 4PYUA 2BB6A 2MJ3A 1CZWA 3V2TA 1BCPB 2M1MA 1T5EA 4W9HA 2F4IA 1WJ4A 3APCA 2C7MB 1ENCA 5FLXc 5GAHC 1B2TA 1DGSA 1J8IA 1F9PA 1B9MA 3L0OA 1K52A 4FF1A 2J0MA 2KQ7A 1R9TH 2XEWA 4TMAB 3I4MB 4YL8A 4HLEA 1ACCA 1DOYA 3GTMB 2JA7H 2PPHA 1LLRD 4K3BA 4L63B 3VYSA 1SSNA 2GOWA 2OOBB 2BYTA 3WAOA 3M7GA 2TMPA 3DHQA 4GOPB 1E7VA 5JPMC 4IUQA 4DNIA 2INNE 4B0EA 3N9YC 3EC8A 3GOEA 1W6JA 1MI0A 2KVRA 1YBYA 1IGCA 3BIID 3DEPA 5ELNA 2XBBC 1LM8B 1V9JA 4WORA 1JE4A 4YWLA 1NY4A 2L3ZA 4P71A 5LXHA 1YNNC 3AEEB 2JWZA 4MJSA 1D6EC 3NPPA 2KZRA 3AEAB 4MM3B 2IX0A 3NP8A 1UBIA 1KDBA 1JOKA 2VH1A 3ZQ4A 1EWCA 3PHWB 3RNUA 3K80C 1SF0A 3F2UA 3ZUNA 3FPUB 1PFNA 4J8QA 1M94A 2XWBB 2D0PA 1VQ5A 1PRTD 4LF4L 1UH6A 2LWPA 4PS8A 3A4RA 1EUVB 2K32A 4KHVA 3Q0AA 2M0AA 3Q3OC 2EOTA 5C3EB 3HOZB 1VDVA 3U2SC 5C0XI 2WP9B 1RFKA 3QG1A 1DJRD 1N33Q 4A3PA 4ZCKA 3AU7A 1PH1A 4WRDA 2Y0SG 3I4MH 1E8WA 3OW2A 1STAA 4J3OD 3G71A 2WYQA 4C3JB 1GD7A 1PRTF 3CC7A 1WXQA 1KJTA 1S5ED 3X3MA 2I2YA 4WWOA 4CKEA 4TKNA 3J81E 2J4XA 5IT9c 1MKHA 4C7ZA 3A55A 1DOKA 3L08A 2KN4A 1V97A 2LEKA 3A0JA 1J19A 1WFYA 2CHXA 2KEDA 1PXUA 3AXCA 1VQ6A 3ERSX 3DWPA 1I4GA 2JA5G 4ZRZA 2G4SA 3CSFA 3L9AX 2N0SB 3CCMA 4HJ5A 4WJ3M 2V1YA 2JEAI 4OO1G 3CMEA 3I5JC 1I6HB 3KVFB 3ZDTA 4TSSA 5HG2A 3OHXC 4EZKA 4HXDA 1I4RA 3K0YA 1N6ZA 4A93H 1MHXA 2WKCA 1CKNA 4DQOC 5K5PA 3GE8C 3GTPH 1FVIA 5CV7A 4WJOA 4R8NA 4JI3Q 4UDUC 4GU2A 1B44D 1N36L 2IDYA 3K5OA 4MACA 4YTMB 2RGFA 4JI4L 2KJHB 3MVVA 4LFAQ 2FMCA 3CIRB 3K9PB 2WNMA 1H9SB 2D3GA 4C56C 1PFMA 1K51A 3Q14C 1LT4D 1UUPA 1X3QA 4EE2A 3RZDB 2IBIB 4W9KA 2N9XA 3AN1A 5E6OA 2CWAA 3ULLA 3J7A5 1WVLA 1WTXA 4DV2L 2BT6A 4FA6A 1JORA 4YHHQ 2GBMA 2DX5B 2JX5A 2V3SA 2RHSB 3CCSA 4NAWB 3DEOA 5CTRC 1JMLA 1SNOA 2NZHA 3OIQA 2XK5B 3MXNB 1H95A 2KMMA 4MH0E 4E71A 2JQRB 1LTGD 5DNFA 2WAQB 1YJWA 2QILA 1G2TA 1A2UA 1D1KA 4DAMA 1R4MI 2UXCQ 3J81c 3HHMA 3HOXB 4GDKB 4MIUA 2C5LC 4IUNA 2O6VD 3P63A 4GB9A 1F1HA 4S0RA 1RKNA 4DAYB 2KD0A 1LTID 4ILWA 1CQVA 5BYRA 2WXKA 1DD2A 3N32A 4A3JG 2MBQA 2C60A 2YTVA 5JJKA 2MGSA 4M02A 2KHWB 1H9MA 4MNOA 1VF5C 2LFNA 5FR3A 1A2TA 3L7ZC 3W1GA 3RMKC 5HHDG 1I35A 4XX5A 4B3SQ 4EZJA 3CP0A 2C9OA 3FPPA 1X65A 4GN4B 5IP9H 1KM7A 1Z2MA 4N58A 1N61A 4G57A 1CKOA 1TY0A 4A3BH 1ZPSA 1NI2A 3BY4B 1N5XA 2EYLA 4I6LB 2E8GA 4LMQD 4LK1C 1K83B 2EXDA 3PV0A 5I2YA 4GKKL 3ZJVA 4PZ6A 4XC2A 3R93A 3WAMA 4PZ7A 2L00B 2A73B 4K2LA 5EAYA 2DAFA 3LXFA 4MGYE 1XX8A 1T6BX 1A3VA 5DAUA 4DK1A 5D3DA 1LFDA 3VR2A 4CJ0B 1VR9A 1BCPD 4X64L 3S2DH 1IPGA 1GPXA 1I42A 2IGGA 3W5VB 2F0SA 1NBFC 4AJWA 5DPRA 2HD5B 4KD4A 1PH6A 2K3UA 2E2JH 2LRUA 4FLHA 2HE7A 2F0EA 1XJVA 3GS2A 4LF7Q 3F8TA 2KT7A 3U8ZA 1WJNA 3JAML 4GNXA 1U4MA 4HIMA 1SJED 2MJ8A 2PNHA 3Q8FA 5CR3A 3TEXA 2MH7A 4B08A 4LF8L 2PMVA 3C1EA 1U4RA 4YWMA 2EYHA 5AJ3Q 1KLUD 2AEHA 4DV6L 1EY4A 4X62Q 1TKEA 3IFTA 3SHLA 3HKZB 4H13C 2QGQA 3DVNV 2NR2A 2N9LA 2PZUA 3PSIA 2BF8B 2IHFA 1D8LA 2AMCB 2UUBQ 2DJGC 2HJ1A 3KLSX 1ISNA 1TKGA 4KLKA 3HOVH 4RM9A 2KA7A 1X6OA 1S5BD 4KTAA 2Z59B 1VQOA 2RA4A 2PW5A 3I72A 4M0WB 1JMCA 4N9TA 2B76B 5GMVA 3RR5A 3K5NA 1HR0L 4A55A 1PFBA 5J2RA 3MXNA 1TWCB 2MSED 1D3ZA 2B29A 4KIKB 4KV6A 3AH7A 5C3WA 1TS3A 3EFXD 5IO9A 3SHQA 2BYEA 1WCMG 1QB5D 3ZGZA 5CV8A 4K7SA 5D14A 1JWUD 2Y3AA 4OZAA 1AARA 1PLFA 1SDFA 1FNWA 4A75A 2AX5A 3SGIA 4A3BG 1AN8A 4W9LA 2QDLA 3RN9C 3VR5A 1VQ8A 4RWSC 2MBBB 3RYTA 4KY5A 4EQOA 3ENEA 1HXYD 4DR3L 1WTVA 2D3CA 4HJ7A 5C3XA 1ICFB 4LF5L 1A8VA 4A3DH 2DAJA 3NVYA 4M01A 1ILQA 5DM63 4OZBA 1NSNS 2Z9HA 2MHVA 3VR3A 3KJOA 3CC2A 3NWTA 1HHVA 2JXTA 4A6QA 1MGSA 1VQBA 2ID0A 1V1PB 3ERQA 5CHVC 1JICA 3ZTCA 4CKCA 3EQLC 1Y1VB 2DZJA 3S16B 1HNWL 3MXUA 4FBJB 3G6EA 1JWMD 4YHHL 2DUDA 5JVH3 2BH2A 4DR5L 4LCDE 1TKWB 4Y7NH 4HPMB 3ZKJC 2CVRA 1WD0A 4RGMA 1CA6A 2G5DA 2I5HA 1FJGL 1XT9B 2D11A 4XT1B 4FJVB 1XWEA 2UXDQ 3AB9A 4LF6L 4QUFA 2HTME 3ML8A 3ZVVA 3MP9A 4UPAA 3H1UA 3PLVA 2OJWA 2JA8B 2J0TD 3S17B 2AYOB 3Q8AA 4JWSC 1LYLA 1GJXA 3VQIA 3BG3A 3OIPA 5ELFA 1A0IA 2NCNA 2REXA 1CKMA 4G4KA 4JI8L 3F2CA 3HOVB 2L1AA 1F2ZA 1EY5A 2B39A 4RFBA 4H02A 3VRBB 4BA2I 4ZRIA 3R2TA 4KIKA 4EX5A 4F7XA 1A6XA 3L13A 1OO9B 4NJ7A 3PIP3 5BMGA 4AWJA 1I4QA 4UP7A 4OW0A 1XNQQ 3AE8B 5FO7B 2OQ0A 4OEMB 3D32A 3LDZE 3QWZB 1ENAA 3K5LA 1RRBA 3PZ7A 3T51B 4IOCA 3Q2AC 5G5HA 2OHFA 3S1QH 2F0FA 3HOUG 3NUHB 5JJIA 4E74A 3UIPB 2H5XA 2NTSA 2YEPF 2JQOA 3S9WA 5C44G 3PTFC 4MJSB 4II3B 4P72A 5G3LD 4A93G 2KWUB 1V8QA 4C1NK 2I1KA 1EYAA 3HKZE 2J7QB 1PH5A 3ZRCA 1Z7TA 4YCUA 2WIIB 1JJGA 2RSOA 4DV6Q 2B63H 2KVZA 3I3CA 3T4AC 4E6IA 3D4DA 3PO2B 3CPFA 3P1MA 1YZ6A 2PCFB 1QOGA 1R4NB 1EY8A 3KFUA 1HFGA 1V8CA 2AL6A 2F0VA 5JXVA 1G6ZA 5BR8L 5J1ZA 4HJ9A 5G3LF 1PV4A 1N36Q 1L7YA 1QUQB 3U30A 4GLXA 3S24A 1V6EA 3LWEA 2YU9B 1KLVA 1SBBB 4ZYSA 1SJHD 5NUCA 4HCEA 4A8XC 4W9IA 3S15H 1Q3LA 4GLAC 3RNFC 3UQBA 4FP5D 1K8AC 4MGKE 2HJ8A 3P7JA 4JX1C 3P4SB 1XCTL 1G6JA 3IFWB 1LT5D 1TWGH 4A3KG 1YI2A 1QJOA 4QCLA 4PT5A 1FCLA 1T0YA 3FEWX 2AWNA 1JROA 2G45B 4FJYA 2CHBD 3ONAB 1JT8A 2IWHA 1Z6HA 3CSTA 3OLMD 4ZRJA 1NBWA 1LTAD 4YCWA 1YOVB 2ZXRA 5TR5A 2INCC 1EOVA 3PUWA 1XQQA 1DYQA 1PTOC 2ZJDA 3SU8X 4QQBX 1QLBB 1JWSD 2W3SA 3KLSA 4DUZL 4RGNA 4C3IH 1ICWA 4DV3L 1XCQL 3B6YA 1G51A 2JRIB 2GN5A 4LK0M 4L5RC 4XWTA 3D6WA 2Z0EB 2A8VA 4C1NI 3R3MA 4K7UA 3PUYA 4RM8A 1D4BA 3GTQB 1K8MA 2EY6A 2LGIA 2PEAA 1JB3A 2WGSA 2PO4A 3SXHA 4DF7A 5ELBA 1SMYD 4PG3A 1T3QA 2AL3A 3U52E 5L95C 4OWWB 1XD3B 1S3SG 4ZLTF 1WR6E 3PV1A 3E3XA 1BMLC 4Q2JA 1ZP0B 1GM5A 3UI2A 2B2WA 1UNSA 2JZPA 3CQZH 2C5CA 1Y1VG 2N9EB 5H92C 2AWOA 4GNXC 2DNEA 4DAYA 3DMUA 1YHQA 1B70B 2KENA 3SK6A 2ZM6Q 1RM6C 2IO3B 3PCOB 2MO0A 4LDTB 5C4JB 2E74C 2R93B 4IURA 1SFOH 5DM73 1WGGA 2HT1A 1B9NA 2DHZA 2MP2A 1ASYA 4PNYA 4LFCQ 2LGSA 5IA7A 3NQTA 2NMQA 1XNRL 5ISRA 4CDCC 1BDOA 2KBNA 2N55A 2QMTA 2VZKB 3NZ3A 4IM3A 4W9EA 4XYQA 5AUKA 3S14B 2VB3X 1YN3A 1TYGB 4QB4A 4DV0L 2WDVB 2EPBA 2UU7A 4MH8A 2V0GA 4JOIC 2ZPNA 1F9SA 3BDLA 5E1FA 1N32L 3Q3MC 1VLBA 2ENBA 3KLRA 4JVZA 5IGFA 3DBHI 4GDLB 2E2IH 1TWGB 2OCEA 3E0EA 4JW0A 2M8SA 2WXMA 3VTWA 4ULLA 2NBVB 1TT5B 3U58A 3EIVA 5E7NA 3VYRA 1S4ZA 4S3SA 4NY0A 2R93G 3LGJA 2KAJA 1OXTA 3KF8A 5E3FA 1HNZL 3J7AV 2C9WB 4RGTA 3TUOA 5HKHA 3AMUA 5EKLA 1ZGUB 4MSQB 4FVMA 3EFCA 1L0WA 2E2HH 4A3IG 5J3BA 4WQMA 1K3RA 3TJPA 2XSCA 2K75A 3I91A 4C3HB 5C44H 1GUNA 1ZE3D 2AUKA 1NAPA 3ND8A 1K9MC 3FMCA 4OWTB 3HKZG 2CJOA 3I56A 4L1BA 1CA5A 4IUMB 3PGZA 5CBAE 3K6OA 1WTPA 2EELA 5LMNL 3L17A 1H9RA 2O2LD 2CU1A 3DDCB 1EO6A 3K7AB 3O65B 3PF5A 3N30A 4IKGA 3GTKB 3GTLB 4NAMA 3LNNA 1UWMA 4W9DA 3TCAA 3I57A 1UAPA 3TMEA 1R4NI 3EUB2 1OXXK 3CQZB 1KRTA 2K39A 4HK2A 2EYMA 2OTLA 2KQ4X 4R1JA 4X66L 2F0PA 4L5SA 2BW2A 1VCIA 5LXIB 3CW2C 4CHKA 3G7LA 2EVBA 1UF0A 2XWJB 1CHPD 4PS3A 3URYA 3N52A 5JEAG 4DV5L 1EFID 1L6VA 2M9VA 4FF3A 1WM3A 1VQIA 3VVWB 4ARIA 5M3MG 5JH5C 3Q23A 2XVSA 3C0RB 1HR0Q 3CRLC 3OTOQ 3B08A 4BVUC 3TEWA 2I0QA 1Y1WB 2MJEA 2LUMA 4K14A 2HUGA 1C9OA 5D7GA 1QNKA 3RLNA 4JI0Q 4DR4Q 3VTUA 1AE2A 1G91A 1YX5B 1WRDB 2BB5A 3VDYA 2OEOA 3L54A 3GZNI 1HNXL 1ZUD2 3RUIB 1B1ZA 2NN6H 4MM3A 4NMZA 5C3EG 5I9PA 4FF2A 4HDOA 4B9XA 1TZ1A 1WJJA 1A3TA 1ZEQX 1O80A 1PH3A 1YMHE 3ETRA 1Q7YC 1FIQA 5IYCH 4D2KA 1P8LA 4HIKA 3X0WA 4BZAA 3LB8C 4R4OA 1BBWA 1J6QA 3J81L 1WH3A 3RZWC 3MJ5A 3M7NA 2V4DA 2GB1A 2MUYA 4OELB 4A3MG 4HPLB 2C35B 4RKLA 4UP9A 2LRWA 2OWOA 4NW2A 4QIWE 1ZKHA 2Q5WD 2K52A 2AQ3B 5A2QE 1C1YB 4LW1A 1SE9A 5JOBA 1PA6A 2DZMA 2KWCA 2PTLA 3QR8A 2LUEA 3SD5A 3AU5A 1WTHA 3V05A 3RNCC 1WCMH 3IL8A 3TEZA 1SR3A 5M3MB 1WE7A 2I1JA 3S1NH 2WQYB 1B7YB 2KTRB 4HROA 4BAXA 1YITA 1X9NA 3C3LA 2IT1A 3VA7A 3K5MA 4Q5VA 2OF1A 4ITKA 1WI5A 3KJPA 2WXQA 4TUUA 1NTGA 3PQIA 3OG5A 4JI0L 3L0WB 5FLXE 2NVXH 4RKBA 1MBYA 3RLOA 3NJTA 3A7AB 2R93H 4AIMA 1ILPA 1V80A 5FOBB 3KW5B 3M85A 1RF2D 1Y14B 3GD7A 2ATWA 1HTOA 4RNAA 1BUIC 4L6TB 4H2AA 1D7QA 2F0KA 2K50A 2KO3A 3VAWA 1FXAA 1OEYJ 1G8ZD 2WV6D 4ZHPA 2LGYA 1Q82C 4QF4A 4A3CG 1EY0A 1VF7A 1FFVA 2LVOA 1O7YA 3K59A 1SNPA 4DK6C 1VQ9A 1WJUA 2Z4HA 1BQQT 4B3TL 1Y8RC 1Q46A 1SLJA 1EU3A 1XMQL 4DR2Q 5FR6A 1SNDA 4JI5Q 2FUHB 2Z6KA 1EIYB 3D0FA 2XTIA 4UHVA 3QAQA 4F1SA 3ZJTA 2BTEA 1IZ6A 1P7EA 1Z5SB 3H0GH 1SE2A 3GTJH 2WDQB 3BDCA 3N3KB 3WIMA 2DNCA 3Q24A 3HK0A 5EPJA 2WS3B 1HNWQ 3HOZH 1I6HH 2JPHA 1E2VA 1VZ7A 3PREA 1E8ZA 2D2QA 4HPPA 3TREA 1IP9A 5AZFA 3U4VA 2M56B 4HR7B 4HVBA 2AWTA 4HWIB 2E2HB 2O6VB 4B9WA 1XXGA 2B2TC 4F88A 1S5FD 5IGCA 1QILA 4IM0A 2I5MX 4YIJA 5EE0A 2RVLA 3IT4B 2F0LA 2KCMA 1U9RA 1C4AA 2M19A 2JA7G 4GN1A 4C3JG 2KC2A 2PE9A 3U9SA 3A33B 2E2IB 4DUYQ 3M4YA 4JK1C 2NB0A 2EKIA 1Z47A 2Q8TA 2O5JC 5GADC 3PMFA 2V3PA 2ICEC 3P20A 3A1QB 2L55A 3KOJA 1YNXA 2KLCA 1YHAA 4WQOB 4PZ8A 1TJEA 4FF4A 3W9CB 4A3OA 1IBLQ 2EE1A 3VRAB 5EKIA 4JPSA 3KUPA 5IODA 1TR5A 2KUMA 2VXWA 5C5LA 1WX9A 2A6HD 2RD0A 4AQ7A 1RWSA 2ASQA 3KYCD 3E6ZX 1HA6A 2LASA 1HTPA 2PE6B 4ACFA 3ZLZA 3H09A 4DR6Q 2B2VC 1TWAB 1PYBA 3JSVB 4RAUC 4DR1Q 3A5UA 2H4OA 5HI1A 1HCZA 4K7WA 2WACA 4DDID 3K57A 2WFWA 4BY7H 2UUBL 3I4NH 2R7ZG 4NPSA 1YIJA 3ULPA 2QJLA 2FINB 3AEVA 4EVOA 2W3RA 1VQHA 2SDFA 1HE8A 1J7CA 2OEDA 5FJ8G 1LT6D 2V1CC 3RLFA 3JAME 2QEJC 3HVZA 2IY0B 1F2RC 2NBFA 2KWVB 3BK2A 5BMHA 3CU7A 4IN3A 5COYA 4A9AA 4HN7A 4DKAC 3A8IE 1TTNA 2QHOA 2ZCCA 1HZCA 1UE1A 1UGMA 1IL8A 1YN5A 4FXDA 2WXJA 2IGDA 5BYSA 2BS2B 3KF6A 1F9RA 1QOHA 2K6QA 3GTOB 1SGHA 4FDBA 4XYOA 2RQXA 2NPTA 3AV8A 4N6EB 3V60A 2KMCA 4QAYA 3BVMA 3X23A 4KKIA 3TIXA 3CCUA 3KUZA 1SIJA 4EUTA 2N9PC 2K14A 2N8NA 3ZIMA 1G2SA 4MDKE 1TBEA 5T1IA 2ZM6L 2WXGA 4C3IG 1SE3A 3QA8A 4AS1A 1NYQA 1H9KA 1YVCA 1EQTA 5CC4A 5KYIA 1H8CA 3TZUA 1SB3C 4R9WA 1VQGA 1VQCA 1I5FA 2CS4A 3WALA 3O13A 3IAM1 1PRTB 4QMGA 5AJ3L 1JOOA 3ECIA 2JA5H 2GVBA 4TVAB 4JYAL 4GN5A 3GQBA 1PZID 2FJ2A 3I63C 3UDIA 3PO0A 2IW3A 1CM9A 1EEID 2N49A 5BR8Q 2K05A 3W2DA 2PMZE 1FFUA 1WYGA 1ZYRD 2K22A 2BKRB 3RZFA 4ASWC 3HOXG 5C5MA 3BVGA 4ZYNA 2RF4A 4CJ2C 1QOFA 5IYBH 1XPOA 2OQKA 3NY5A 1KIXA 4BY7G 2L7RA 1SRUA 2JT4B 3A9KA 2BQQA 4X65Q 1GXDC 4H7BA 2MHJA 2K25A 4NXNL 1EOTA 3M62B 1XTDA 2WP8J 3GTQH 2VW9A 3T1HL 1PFSA 3PF4A 4HSVA 5BN3A 2F0DA 3S2DB 3NHEB 2VY3A 1STNA 1SSOA 5KGUA 1YNJD 4HCPB 1QE6A 3RULA 4ALPA 2NBWB 1PRTC 2Y0SE 3PS6A 1E7ZA 1H9SA 1AP0A 1YNJC 5KNCA 1UGJA 3OJ3A 3STBC 4HAEA 1TS2A 4X6AH 3FC4A 4GN3B 1AWDA 4BBRB 1B50A 1L4ZB 4HKQA 5C4HA 1M1KC 1FD7D 2WB1E 4CHTB 1Q90A 1UE7A 2L0TA 3GO5A 3TEHB 4DHZE 4R8IA 4RG1A 1P16A 3EHVA 2KACA 1DOXA 2EY5A 2R7ZB 3TRZA 1TVXA 4JI8Q 2K7VA 3M3YH 3H6MA 2ZTCA 1CZPA 3MJWA 1AYFA 4U68A 2F4VL 1L0XB 4MGIE 1UWXA 4WJPA 2JA9A 2DYBA 3DM1A 3SEBA 4P75A 3J7AF 3TS0A 4FXKC 4ID6A 1VMCA 3PIO3 3QJZA 2WDTB 2RSUA 3VR4A 1O7LA 1I3QB 1AZPA 2KN5A 1HUMA 3AEDB 4GIVA 3CCLA 1MJCA 3PLUA 3PO2H 3UI3A 3S1MH 5C0XJ 3J81i 2WWZA 1B8AA 5T1GA 1JALA 5FKAC 1DZ1A 4WAAA 2Z1CA 5EBCA 3S16H 2X38A 1ET6A 3OYYA 1E8YA 2IPKD 3HOWH 3GTPB 4DNTB 2LZ6A 2QF7A 1D2BA 3FKIG 1PYWD 4A4IA 5HGQA 3VYUA 4Y7NB 4BBSG 3D3RA 3SK4A 3FKIB 4BBSB 3M3YB 1JCKB 2JY6A 4X57B 4XQNA 4K3CA 4C3HH 3A8JE 4IWQA 3HOWG 4G3XB 1DGJA 1XPUA 2LXCA 3NG0A 2MWSB 1TWFB 3T9LA 4WWNA 3PZDA 4PQXA 5FLMH 3RZDH 3SR6A 5L83A 3EGRA 3QWNA 3AECB 2F0OA 2D5DA 1S72A 3KK7A 2CW0C 3I8ZA 5GXGB 3UE0A 4BKSA 1KRSA 1CHQD 3P4QB 4DR7L 3A9KB 2KX0A 4DWFA 1I3QH 2EYPA 2PVOD 4ARCA 3JAMi 2BOSA 5C6AA 1O7ZA 2RKSA 2PJHA 3P2BA 4CYEA 1HZ9A 4C3IB 3C2PA 4A3GB 4B3MQ 4JE3B 2MJDA 1RD9D 1TWHH 4HTHA 5KNDA 2ZJPA 2UWQA 4RHRA 2TSSA 1NR4A 2NZ1D 2ZVOA 4KSKC 3MXPA 1HQRD 2F0TA 1CSQA 1CFMA 4LUVA 4CGYB 3C46A 2FCNA 1UEBA 2L4NA 1M4VA 1WGRA 1Y1WG 5C2TB 3T3NA 2F52A 1C4CA 1PTOB 1LV9A 3I55A 2C7HA 1WMHA 2HTHA 2Q2IA 2M4NA 3CMMB 3VR9B 3ND9A 4B6WA 1YIWA 2JU6X 4YCVA 5M5WH 2G9HD 3AMZA 4JI1L 4O0AA 4BBRG 2VQEL 1L0VB 1V86A 4HIOA 3B0AA 2NYZD 2BBCA 1IBXA 3DWMA 4GXBA 3E9HA 4R4QA 3PIOA 2D2CC 4YTNB 3ML9A 4EKUA 2L32A 3KYHC 2NVQB 2KCNA 2ZCBA 3KF6B 3HGBA 1VD2A 4IOIE 1V49A 5IGDA 3ZJUA 2KDIA 1WGKA 1L4DB 4RF0A 4L5QA 2L15A 3KUCB 2K1BA 3PRPB 1KTKA 1GHKA 4BY1B 4LNQA 2CR5A 1XMOL 3J81j 3ZNGC 2Z6KC 2N78A 2O4XA 1PH2A 4KN4C 4IC7B 3NBHA 4OX9L 2K5PA 1SNCA 1X32A 1YHBA 2Y5PA 1EQVA 4DDGD 1XF5L 3DBHB 4JI2L 4X3KA 5IYBG 1MG4A 1Y69U 1IBXB 3APFA 4Y52H 3FVQA 3GTLH 1RFAA 2OTJA 4YY3Q 1XMQQ 4M8MA 4AYBG 1T0QC 1ONLA 2DY8A 3QOJA 4HDQA 1TZOA 3FKYA 2K03A 5HFYA 4TQ1A 2FFKB 5LMNQ 5M5WB 1EIFA 4PMBA 4ZUIA 5KHQA 1QVFA 3T1YL 2K6AA 2KJ6A 3DVGY 3M4QA 4G50A 4YXDB 3BDOA 3I7FA 4APVA 4IOAA 3IKJA 4ZRKA 3HP3A 2ZNVB 5CORA 4DR6L 2X6LA 2JA5B 4DAVA 2FNJB 3DOWA 4XIGS 1OGWA 1U4AA 1ZKOA 1BBXC 4DR4L 3GB1A 2YV5A 1HFNA 3RPFC 2JZ3B 1IBKL 2G4DB 3HM3A 3PZ8A 4B9KA 4HEA1 2RDGA 1Q86C 2A4ZA 2KEEA 4LF7L 3VR6A 5IP7H 4LJZC 1HR0W 3IBEA 1WXMA 5J39A 3MEHA 4X3UA 4P74A 3FDTA 3B9JA 5GAGC 3RNGC 5IT9E 1UWVA 5M3FG 4RHSA 5GROA 2LD9A 2ON8A 2ZNVC 5IIFA 2Y5CA 4US8A 4MHEA 5CGKA 4GOPC 2JZZA 3A9JA 4KDIC 2KQ3A 3DPDA 1PHJA 2QCZA 2YLMA 3DBLB 4A3IH 3P4RB 5E6NA 4OO1H 2ZZPB 4NNJB 1ZXHA 1EU4A 2ZXPA 3V3XA 4Q0FA 1XEEA 5A2QL 1P3QU 1LQBA 3H3VH 1Y56A 2BPSA 1F77A 4YWKA 1HPCA 2LI5A 4JI3L 1KHIA 2I38A 1TU2B 2CH4A 2L12A 4XQJA 4GLVB 3CWIA 2C7NB 1VQKA 1GHJA 1L1OB 3NBIA 2R7ZH 3I4NG 5M5YB 5EKKA 3MTSA 3W5OA 2DJFC 1EY9A 4JI7Q 1RODA 2WU2B 3CKIB 3HM6X 2A1AA 2OT2A 4MT5A 3T8MA 3W1BA 4KN7C 1Y8OB 4PMWA 5FLXL 4DV7L 4B3SL 1KF6B 4NJ6A 1JOQA 1SXTA 2F03A 1SYCA 5D3IB 4V190 2INPE 2HIXA 5JEAJ 5LL6X 1IW7D 3BZCA 1VQAA 2WINB 4XDCA 3NZUA 1OTCA 3A7LA 3DQVA 4NQLB 1H9JA 3D31A 3EA6A 3AE1B 1V9PA 1R7SA 1SYGA 4ODGA 1WJ6A 1RL2A 2CWPA 2HCIA 4LJPB 1W3SA 2FBWB 2LMCA 3Q8BA 3BJUA 5C23A 5IN7A 4B3RL 2G9DA 4IG7B 3NXWA 5I9OA 3S17H 2PKOA 2IHEA 4FO2A 3CXCA 2W9NA 2VQFQ 3EECA 4NXML 4PV1C 2B63B 3V6CB 2LHEA 4US9A 4PYZA 3CRKC 4K8IA 3PO3B 5G2NA 2EQSA 3R66C 1Q1OA 1V1PA 4TQUS 1BKBA 4ME3A 2WB1B 3JYUA 1U0LA 4BBNC 2A6EC 2KOLA 1PZJD 2KX3A 3BWUD 4S17A 3UF8A 2BCOA 4N8FA 2PNRC 1WGYA 4F8CB 2CCZA 2AQ1B 3NRZA 4USAA 3VXWA 4BXXG 2Y0SB 2MNAA 3AEFB 4KV2A 2XN9C 2CKHB 1OQRA 2NVTB 4G0NB 1IHZA 2ZJRA 3PUZA 2A74C 1WIAA 4LNFA 1LTLA 2MQHA 3I4NB 3PUVA 3JW0X 3DHHC 1K3BC 1HZ5A 3RUZA 1F2RI 1JWBD 1P1AA 3HOZG 1EYDA 2FE8A 1I7HA 3DVGX 2M00A 3H91A 2L9HA 3R3OA 2VZKD 1N34Q 3AE4B 4C2MH 3OOCA 4Z9CB 2WLBA 2F0NA 2SNMA 5C0XH 1DONA 3M95A 5AUIA 3RNAC 3WANA 3HS0C 3L4PA 2JJQA 1STEA 3VR8B 4B0MA 1E2WA 1U4PA 1E1TA 1KNEA 4NQKE 1B3QA 4A3JB 5ELEA 4LF4Q 2E3TA 1BOSA 4CDDC 2D9UA 3AI5A 4JC0A 2EY2A 4GOCA 4ZRQA 1HRJA 4II2B 2HQLA 1W2BA 4BY1G 1VQJA 3U50C 4FN2A 2EDGA 1I94Q 2KC1A 1PVOA 5JPNC 2J53A 2LMCB 3U7ZA 3F2DA 4KX6B 4DN4M 5FK9C 3HRDD 1EUJA 5EQ0A 3PPAA 1S40A 4JBWA 4XE0A 1C78A 2RCFA 3H15A 2KYWA 2EIFA 2R92B 1OXVA 5DPWA 3NQIA 3C1FA 2DBYA 2DNFA 4AP4C 4DU9A 1ZXIA 4IPCA 3E56A 3PIPA 3ZO5B 4IPGA 1GNUA 3N1YC 2VL6A 2B63G 3EJIA 2GBRA 3IAS1 4A90A 3A56A 1V5OA 1TT2A 1UE5A 3MWYW 1IKMA 2HDEA 1WFQA 4I7ZC 2RDFA 3T56B 4L5TA 2FMMA 3QIAA 3AYHB 1VQMA 4C3JH 5KHOA 5HURA 2NBUA 1E0ZA 5IOCA 3HOUH 2MCNB 2QKIC 1Q5WB 3M4OB 4X3SA 5IE8A 2KCTA 4BXXH 1K8RB 2KNBA 2MQJA 2LY7A 5CHWA 3OPOA 4HCSA 1X3PA 1L5PA 4A3FB 1D5ZC 2CHZA 1TIFA 4XGAB 3EBEA 4B3TQ 1QF6A 2OXPA 4L23A 1D5XC 4XDDA 1MPEA 1EZ8A 4GS3A 3SK5A 3TEYA 2LKVA 3A9JB 4A3IB 4WJQA 1JB7A 4DR5Q 4HMJA 1FXTB 4RMFA 3G4SA 3BVZA 5IT9L 1QNUA 5IY0A 3ITPA 2ZT9C 3MEFA 1YX6B 3PHXB 2GMIC 4JWUC 1L1OA 3E9IA 4N8X1 4UY8C 4C80A 2UXCL 3I9V1 4XXEA 1K0RA 1VDZA 2BDNA 5CMDA 4HJAA 1YQ4B 2JYTA 2V3NA 3DWAA 1IXRA 2R2OA 4OVZA 3ALBA 2B8FA 2FXQA 1JRUA 4ZRPA 3QK0A 2W54A 4K0KL 1QWYA 4LNNA 3CCJA 3HOYG 2SEBD 4J6HA 3S1NB 3KYDD 3ONSA 3VH3B 4DV5Q 1HEZE 4JV5L 2WKDA 2WDRB 5EPKA 3K81C 4N59A 1YN4A 4IWOA 1HTLD 4X66Q 4LF9Q 2XIWA 4YSYB 1SYBA 2KDEB 3IHPC 1XLOA 4JQWC 4G7HC 3GTKH 5FO9B 1V43A 1L6UA 1T0RC 3DVNU 5E6JA 3D6CA 3T16A 3NSWA 4DR2L 1EF5A 4LNIA 3P75A 3M4PA 1KNAA 4ZK9B 1MJEA 1FRRA 1NVID 1FRDA 3B2FA 4YWGG 4J1MA 3WWVA 1VQNA 2DLBA 4OX9Q 3NBHB 2N88A 3MAQA 1YQBA 2ZVNA 3VFKA 2E2JB 2JVCA 4HCNB 1N63A 4MEMA 1WM2A 1I4XA 3IT6B 3MC8A 3GV3A 4X3TA 2LSSA 4YT0B 4ZQ3A 4NAWA 2GBKA 4HMIA 2LVQA 4CDEC 2L0CA 2GVAA 2EMSA 1M8AA 2KHIA 3GTGB 1AEXA 5E4XA 4WWPA 4I6NB 2B2YC 5BN4A 1C0AA 1WOCA 4X62L 1JQ4A 3MA2B 4JI1Q 2NVTH 2E76C 4BS9A 4ICUA 2PYKA 1SYDA 4KZ0A 2RCNA 5ELDA 3TQYA 4ANWA 3QB3A 5JVG3 4K1RB 2N4FA 3PO3G 4OONA 5T8IA 1ASZA 3N1ZC 2L0FA 4KGTA 4M00A 4A3BB 2MBHA 2K9XA 4OXPA 3A74A 1WSPA 4ZKBB 3J7ZC 4HSPA 1KC8C 5IKCM 4IW0A 4C2MB 4DAPA 3ZRFA 3I4LA 1L1OC 5G5GA 3N6RA 3H6NA 2JSOA 5M3FB 1KAAA 4O42A 1IBKQ 4QGUA 4RMAA 1BUVT 1MHHE 1XNRQ 2YTXA 1QT9A 2ZTEA 1RJTA 4DXFA 4P16A 1RAXA 1EYGA 1DXMA 3LYYA 4DV1Q 2EY1A 1V1OA 2NTTA 2VUMG 2FCMA 3QX1A 1FD6A 5IYDH 1GUSA 2WX1A 5M5XH 1KL9A 1RLFA 2LXJA 5IGGA 2EJGC 1AH9A 2DWQA 3KBXA 1RIPA 2F4VQ 3TS2A 3IXSA 2JWUA 4KGRA 5EGTA 5JEAH 3KWLA 3WDNA 3DHIC 4XZ4A 3BINA 4JIOU 4DK5A 2WX0A 4RA8A 5IGEA 1F0ZA 1E5WA 4LTUA 2N7JA 2JEBI 3IG3A 2CQOA 4PK1A 4BKSD 4KHPL 4I7AA 3H3VC 1XNQL 1T5XD 2F0UA 3FAHA 1N60A 2E75C 1XO3A 2YVCA 3ER0A 3LX0A 5EJWA 2R7FA 3H8HA 1OTRB 3T53B 3H9DA 5BO4B 2E5LQ 3H7SA 1HNZQ 5BMIA 3RD4A 3EN2A 2J0KA 1OEYA 1PDXA 1GUTA 2RMMA 4IDIA 1TWFH 4I6PA 2UUAQ 1WTWA 4N9F4 2BH8A 1Q8KA 4MGZE 3PVLA 1Q81C 4NXNQ 3W1SC 1IL2A 2ZEQA 1BNZA 1S5DD 3KWVA 2KHSA 5CV5A 3HRZC 2UXDL 1GC6A 1FL0A 3TP5A 2CJNA 3EROA 5G55A 2GA4B 2J7ZA 1LUZA 1PGXA 3V96A 3QOLA 3M3JA 2UU9Q 1DOIA 2QC8A 1EWHA 4GOPA 1N5WA 4AYBE 2NVXB 3STBD 3V6EB 4NDXA 4IPHA 1GUOA 1PGAA 4A3LH 1IYVA 3RZOB 4W9CA 2N9KA 5LLIA 1PDQA 2W82A 3BU2A 4KJOA 3TN2A 4JI6L 1BBUA 1TS4A 2KFKA 1SNQA 1DOLA 1GB1A 4GZYC 2JN4A 1A3UA 2JE6I 2K04A 3QO2A 3T13A 2K5WA 2WU5B 3I70A 3S2HB 4FYDA 1F9JA 2RDBC 1WZ3A 4B95A 3HOYH 3Q8CA 3GZNB 4L8JA 3R8BA 3WA0A 3L3OC 1IGDA 4C4VA 1CI3M 1I50H 3PUXA 4DHJB 2ZJQA 1MVKA 2B2UA 5M5XB 1J5EL 3SR1A 2VB2X 4QJFA 1PH4A 2JA6B 1XTCD 1YQ3B 2BYVE 4GGQA 3T1HQ 1J7BA 4JL9A 4J6IA 3NVVA 3DCGA 1YNND 2Z4IA 2NVQH 4HKZE 4A3GH 1FGUA 4EQNA 1PZKD 1KXLA 3G48A 3MHBA 4RH6A 1EY7A 2JUOA 2F0HA 4IUUA 3CF6E 4ANVA 2K8CA 2IJ0A 2KJRA 1IYUA 2QW7A 5HY6A 4ZOHC 3U4EG 1SMYC 4DV0Q 3I73A 2LHDA 3AEBB 1MJDA 5JZEB 4EQPA 4ZUJA 1EQQA 4MZ9A 3IAYA 3HIZA 3NVWA 3MZ5A 2RBMA 4KHPQ 3MTNB 2K0PA 2EJFC 2B2TA 3X3NA 1T0SC 4IQZA 3VH4B 3VUXA 4HIDA 3HKSA 4DHZB 5I6WA 3AE7B 4BY7B 1HZBA 4G7ZC 3T1YQ 4CDFC 5IWAL 1SNMA 1EM7A 2BE5D 4DA2A 1E10A 1VS0A 2BDOA 2D5GA 1I94L 1GJZA 2K5DA 2F0GA 1I50B 1E0BA 1MIUA 1NDDA 2CW0D 1C8CA 3Q6BA 4YY3L 2O5IC 1B4OA 3OWEB 4KVGB 4OZCA 3CHBD 3TP7A 4JI2Q 1SYFA 1R9TB 1OFFA 4P1CC 1UBQA 4B3ML 3U4ZA 5FJ8H 4M0WA 4XYCA 3UDXA 1N34L 3R7RA 4DUZQ 4TKOB 4AOFA 4K2KA 3PRMB 1GO3E 1UEAB 1F2MA 3A5ZB 1R4MB 1AZQA 1RYJA 3NZSA 1G6PA 4NPNA 4DV4Q 2NZOA 4LNOA 3I4MG 2MEKA 5GQOA 1H4RA 4ME5A 3HOYB
chains in the Genus database with same CATH topology
1AFPA 1F2YA 1N62A 2HCCA 2ONQA 4KI0A 4ZHOA 3T3OA 2H88B 3SDZA 4IFDH 1FMAD 4OO1I 3VA5A 2JP1A 4H0LC 1NEKB 3D8GA 4KHZA 1ESFA 1TKYA 1A70A 1STHA 4PMCA 1NCVA 3SE0A 5BN5A 3WOEA 4M1UB 3W5UB 1LABA 4UAIA 3AE6B 2KVMA 5M9OA 4WFN3 5HGTA 3J7YW 4KKUA 1D5MC 1R4PB 1PMRA 3NVZA 3DWQA 1D1IA 2PLPA 2J42A 1ZOYB 4G7OC 4WIPA 4F8MA 1KLGD 2AQ2B 4N9PA 1JC7A 2A69D 3S15B 2I07B 1DM0B 2WXNA 4ZAIA 4KGSA 2WXIA 2K5QA 3AE3B 1VJKA 2JA7B 4K5XA 3SK8A 1ZXTA 4NP5A 1EEFD 3E5SA 2DYOA 3HZXA 3GP7A 4YTPB 4HEDA 4KKSA 2KDMA 1STBA 1OXSC 2KECA 3NTKA 1RTNA 2HDLA 3Q6SA 5KYLA 1II3A 4OGQC 3S1MB 5D65A 4XQQA 1KRHA 3SVMA 1HUNA 4RF1A 3NTIA 3E9SA 1STGA 1FCCC 3S1QB 4L2YA 1C79A 2F1MA 3HEJA 4MN3A 1P7FA 1FR3A 4WJWA 1PTOD 5EE3A 2B8GA 1CQFA 4CQNA 4REZA 3DUZA 4WAFA 1DOMA 1J7AA 5CYUA 2QCPX 4HJGE 1K8OA 1PTOF 2NWGA 2EXZA 1YJIA 1EY6A 4RCNA 1VMPA 2EZVA 4ZKCB 2F0QA 4A3EB 2B2WC 4FNFA 5KEEA 1KDCA 2ZW0A 4OHJA 4DNRB 4FXCA 1Q8IA 1LACA 4K8JA 4FXGC 2BE5C 3H94A 4IALA 1EWYC 4I65A 3P1HA 4KD3A 2H1EA 1C76A 3SFDB 1FNUA 1XLNA 2F3WA 4QUCA 2L11A 1E6EB 4WWMA 2F0JA 2LS01 1Q12A 3KQ4A 5ELCA 2LFIA 4YSXB 3HOWB 1KH0A 1SYEA 3HOUB 5C4ZA 1QQRA 1ML0D 1SE4A 2SNSA 1PUTA 1ZDVA 1LO5D 2K28A 2F0WA 4KK7A 2YYZA 1BXTA 1HQMC 5LNK1 3AE5B 2A6HC 5MPOA 2L83A 5I6YA 3OMCA 3P42A 2WXOA 2SOBA 1IW7C 1OXUA 1LTBD 2A68C 1YJJA 1KDAA 1FM0D 1B9RA 4KY7A 3WCQA 4GLSC 1STYA 1SEBD 2FUG1 3BYYB 2EYOA 1I6VC 3J9CA 1C9FA 1CT1D 3G6JB 1XLQA 1B53A 3MFGA 1GOZA 2WXFA 2XNAC 1JWAD 5K36H 5C4XB 1S5CD 4O1NA 3FILB 4TQ0A 3EVQA 1QCBD 2CU3A 1VZ6A 2IX3A 2H89B 4XDXA 2B2UC 5C44B 2WXLA 4H44C 2DYMA 2PW7A 4RCOA 3BK1A 1HA5A 4WURA 2PPBC 2KJXA 2KWDA 1TS5A 1EZ6A 3AEGB 1WCMB 3NHHA 2BA0A 1CJEA 4HRSA 4IUTA 2BS4B 3NK9A 1BR9A 1JR0D 1YNTE 1LTTD 1W6KA 1MSHA 5EPLA 1JRPA 1PTOH 1ROEA 4K6LA 3K58A 1U4LA 1FNVA 4LLGM 3DWGC 3TBIB 2G1EA 2D62A 1ZYRC 3Q22A 2BS3B 2YEPB 5EBDA 4IFDG 1LTSD 1C4PA 3HVDA 1Y8NB 2K01A 2AUJD 2JYEA 4A93B 1CTMA 1GB4A 1K50A 2E6XA 4C3HG 1ET9A 4CBVA 5A35A 4V0BA 3TP8A 1WTOA 3NS1A 2WXPA 4QIWB 2ZXOA 1QG7A 5C0XG 3IFDA 2QSDA 2K33A 2SAKA 4CJ1B 3QJYA 1RHPA 1FEHA 3U9OA 2PZTA 3OMGA 2BA1A 1SAPA 2V4IB 2XRQD 1WWTA 1BO0A 5I2XA 5IGBA 5TSSA 2JYOA 2E2DC 4XTCS 3A54A 1G291 3TZDA 3MFYA 3OWFA 5CV6A 1I4HA 2NUCA 3MXGA 4NJCA 1ESRA 4BWGB 2CQAA 2NVYB 3MC0B 4M8AA 3RFZB 1WD1A 5KNBA 4KY6A 2HDMA 4P6VF 5I4DA 3TDQA 2Q8RE 1XLPA 5CV9A 5F2DA 3TP6A 1ZDXA 4A3DB 1ENFA 4NKLA 3W3AA 2R6GA 4AYBB 2JXMB 2J52A 3LWUA 3S1RB 1F2LA 2A69C 2GI9A 3VYTA 4BA1I 3NE5B 1EYCA 1NUCA 2IGHA 3Q8EA 1LTRD 4U673 1QOBA 4LAAA 5AFWA 1PFDA 3RMHA 3OW7A 4RGOS 1IUEA 2PVGC 2W55A 1SFOB 5J22A 3P4SB 1NR2A 3MHZA 2MPMA 2EJMA 1FYCA 3KBGA 4K6DA 5EE1A 2QDBA 1KABA 2PZWA 4A3KB 3D4RA 2HQEA 1WRIA 3Q69A 1TWHB 1TQOA 3P4PB 2ZW1A 3W1SA 3AM9A 1IKLA 1FXIA 4F87A 5H8YE 3AB5A 1F9QA 5C3JB 4IFDI 2RSNA 3NWSA 1RTOA 3FRPB 1R4QB 2X69A 4IZ8A 2ICIA 1EIHA 1C77A 1VZ8A 1E9MA 2PQEA 4IUVA 1JQYD 1NI3A 4TRDA 1DCZA 2GRIA 3J80E 2DN8A 3HG9A 1PGBA 4OIJA 4XWWA 4A3MB 4EGVA 1GUWA 4KJNA 4ABNA 3BS1A 4R3DA 3GTJB 3H0GB 3SFEB 5KRUA 3AE2B 2Z8LA 1CK1A 4KKTA 2PW9A 1E2ZA 2L52A 2EYJA 3HUIA 3BYTB 4YSZB 2VNUD 2RDHA 1EL0A 5CV4A 4XT3B 5KIXA 5LHY1 2WXRA 2B2VA 3AE9B 1C4QA 2F3VA 2B2YA 5FO8B 1BCPC 1JW9D 4DXGA 2X6GA 4K5VA 2JSVX 4WH4A 1MI2A 3R2IA 2L5TA 1Q1EA 1GUGA 5LL6S 2DY7A 4P2CB 1C48A 3B2GA 3OSOA 4KKJA 3WOFA 2XRSD 4IFDJ 1Q10A 1RDPD 4CKBA 5K36G 1WTRA 1BF4A 1O78A 1QOAA 4OIKA 2A68D 2F0MA 1VRAB 2R61A 2R3ZA 3D4WA 4DFAA 1OQQA 1RCVD 4IUPA 4C7YA 1EIGA 5EE9A 2EYFA 2L1BA 2WXHA 1TIID 2I46A 2A6ED 4DGZA 1I4PA 1FGBD 3J80L 1XYIA 2RPVA 3C8YA 1K53A 1Y8PB 3DXJC 2LJIA 3A8KE 2IX1A 1NENB 3NUCA 3BZDB 2IL8A 2VUMB 1GAQB 2PIAA 3GV6A 2FHTA 5CBEE 3I90A 5E4WC 1L0YB 1B3AA 2M2LA 4KMUC 2F0IA 2PMZB 1A15A 2NN6I 2A5HA 1CZGA 1QKZA 2MP1A 3NTHA 2Q8IB 5JAVA 4OL7A 1MSGA 1FO4A 2QIEB 3E0JA 2ACZB 1AW7A 1Q1BA 1E7PB 1BCPF 2NN6G 3TSSA 3FILA 1TY2A 1J9OA 5BYQA 1KFYB 1NYRA 1LT3D 3ZYYX 5DEHA 4K5WA 4DK0A 2KCCA 1MD2D 1HZ6A 5JJZA 3ABVB 1WTQA 2BB6A 2MJ3A 1CZWA 3V2TA 1BCPB 1T5EA 2F4IA 1ENCA 1B2TA 1J8IA 1F9PA 1B9MA 1K52A 4FF1A 4TMAB 1DOYA 3I4MB 1ACCA 3GTMB 1LLRD 4L63B 3VYSA 1SSNA 2BYTA 3M7GA 2TMPA 3DHQA 5JPMC 4IUQA 2INNE 4B0EA 3N9YC 1W6JA 1MI0A 1IGCA 3BIID 3DEPA 4WORA 1JE4A 1YNNC 3AEEB 1D6EC 3NPPA 3AEAB 4MM3B 2IX0A 3NP8A 3ZQ4A 1KDBA 1JOKA 1EWCA 1SF0A 3F2UA 3FPUB 1PFNA 4J8QA 2XWBB 1PRTD 2K32A 4KHVA 3Q0AA 2M0AA 3U2SC 2EOTA 5C3EB 3HOZB 1VDVA 5C0XI 2WP9B 1RFKA 3QG1A 1DJRD 3AU7A 4WRDA 1STAA 4J3OD 4C3JB 1PRTF 1WXQA 1S5ED 3X3MA 4CKEA 3J81E 2J4XA 4C7ZA 3A55A 1DOKA 2KN4A 1V97A 2LEKA 2KEDA 1PXUA 3DWPA 1I4GA 4ZRZA 3L9AX 2N0SB 2JEAI 4OO1G 1I6HB 4TSSA 5HG2A 3OHXC 1I4RA 3K0YA 1MHXA 2WKCA 4DQOC 5K5PA 5CV7A 4R8NA 4UDUC 1B44D 2IDYA 3K5OA 4MACA 4YTMB 3MVVA 2FMCA 3CIRB 2WNMA 1H9SB 4C56C 1PFMA 1K51A 1LT4D 1UUPA 1X3QA 4EE2A 3RZDB 3AN1A 2BT6A 1WVLA 1WTXA 1JORA 2JX5A 4NAWB 3DEOA 1JMLA 1SNOA 3OIQA 2KMMA 2JQRB 1LTGD 5DNFA 2WAQB 2QILA 1G2TA 1A2UA 1D1KA 3HOXB 4GDKB 4MIUA 4IUNA 3P63A 1RKNA 1LTID 4ILWA 1CQVA 5BYRA 2WXKA 1DD2A 2MGSA 1H9MA 1VF5C 2LFNA 5FR3A 1A2TA 3L7ZC 5HHDG 2C9OA 3FPPA 4N58A 1N61A 4G57A 1TY0A 1ZPSA 1N5XA 2EYLA 4LMQD 4LK1C 1K83B 3PV0A 5I2YA 3ZJVA 3R93A 2A73B 4K2LA 3LXFA 1XX8A 1T6BX 4DK1A 1A3VA 5DAUA 5D3DA 3VR2A 4CJ0B 1VR9A 1BCPD 1GPXA 2IGGA 3W5VB 2F0SA 4KD4A 2K3UA 2F0EA 3GS2A 3JAML 1U4MA 1SJED 2MJ8A 3Q8FA 3TEXA 5CR3A 2MH7A 4B08A 2PMVA 3C1EA 1U4RA 2EYHA 1KLUD 1EY4A 1TKEA 3IFTA 3SHLA 3HKZB 4H13C 2N9LA 2PZUA 3KLSX 1TKGA 2KA7A 4KTAA 1S5BD 2RA4A 2PW5A 3I72A 4N9TA 2B76B 3K5NA 4A55A 1PFBA 3MXNA 1TWCB 4KV6A 3AH7A 5C3WA 1TS3A 3EFXD 1QB5D 3ZGZA 5CV8A 5D14A 1JWUD 2Y3AA 4OZAA 1PLFA 1SDFA 1FNWA 2AX5A 1AN8A 3VR5A 4RWSC 4KY5A 4EQOA 1HXYD 1WTVA 5C3XA 1ILQA 5DM63 4OZBA 1NSNS 1HHVA 2MHVA 3VR3A 2JXTA 3NWTA 4A6QA 1MGSA 2ID0A 1V1PB 3ERQA 1JICA 4CKCA 3EQLC 1Y1VB 3S16B 3MXUA 1JWMD 5JVH3 1TKWB 2CVRA 1WD0A 4RGMA 1CA6A 4XT1B 1XWEA 3AB9A 2HTME 4QUFA 3MP9A 2JA8B 2J0TD 3S17B 3Q8AA 4JWSC 1GJXA 3VQIA 3BG3A 3OIPA 5ELFA 4G4KA 3HOVB 2L1AA 1F2ZA 1EY5A 2B39A 4RFBA 3VRBB 4BA2I 3R2TA 4F7XA 1A6XA 5BMGA 1OO9B 3PIP3 1I4QA 4OW0A 3AE8B 5FO7B 1ENAA 3K5LA 3PZ7A 3T51B 5G5HA 2OHFA 2F0FA 3NUHB 2NTSA 2YEPF 3S9WA 5G3LD 1V8QA 4C1NK 1EYAA 1Z7TA 2WIIB 2RSOA 3I3CA 3T4AC 4E6IA 3D4DA 3PO2B 3P1MA 2PCFB 1QOGA 1V8CA 1EY8A 1HFGA 2F0VA 5JXVA 1G6ZA 5J1ZA 5G3LF 3LWEA 2YU9B 1SBBB 4ZYSA 1SJHD 5NUCA 4HCEA 4A8XC 1Q3LA 4FP5D 3P7JA 4JX1C 1XCTL 1LT5D 4QCLA 4PT5A 1QJOA 1FCLA 3FEWX 2AWNA 1JROA 2CHBD 3ONAB 2IWHA 1Z6HA 1LTAD 2ZXRA 3PUWA 1DYQA 1PTOC 1QLBB 1JWSD 2W3SA 3KLSA 4RGNA 1ICWA 1XCQL 4LK0M 4XWTA 3D6WA 4C1NI 1D4BA 3PUYA 3GTQB 1K8MA 2EY6A 2LGIA 2WQYB 1JB3A 4OVZA 2PO4A 3SXHA 4DF7A 5ELBA 1SMYD 1T3QA 3U52E 4ZLTF 1BMLC 4Q2JA 1ZP0B 3UI2A 2B2WA 1UNSA 2JZPA 2C5CA 5H92C 2AWOA 2DNEA 4DAYA 3DMUA 1RM6C 3SK6A 5C4JB 2E74C 2R93B 4IURA 5DM73 1B9NA 4PNYA 3NQTA 2NMQA 2QMTA 5ISRA 2VZKB 1BDOA 2N55A 3NZ3A 4XYQA 5AUKA 3S14B 2VB3X 1YN3A 1TYGB 4QB4A 2WDVB 2EPBA 4MH8A 2V0GA 1F9SA 3BDLA 5E1FA 1VLBA 2ENBA 3KLRA 5IGFA 4GDLB 1TWGB 2WXMA 4ULLA 3VYRA 1S4ZA 4S3SA 2KAJA 1OXTA 3KF8A 5E3FA 3J7AV 4RGTA 3TUOA 3AMUA 5EKLA 4FVMA 4WQMA 2XSCA 3I91A 4C3HB 1GUNA 1ZE3D 2AUKA 1NAPA 3ND8A 3FMCA 2CJOA 4L1BA 1CA5A 5CBAE 1WTPA 3K6OA 2EELA 1H9RA 2O2LD 3K7AB 4IKGA 3GTKB 3GTLB 4NAMA 3LNNA 1UWMA 3I57A 1UAPA 3TMEA 3EUB2 1OXXK 3CQZB 2EYMA 2KQ4X 2F0PA 2BW2A 1VCIA 3G7LA 2EVBA 2XWJB 1CHPD 3URYA 3N52A 5JEAG 1EFID 1L6VA 4FF3A 2M9VA 4ARIA 3Q23A 2XVSA 3CRLC 3TEWA 1Y1WB 2MJEA 2LUMA 4K14A 2HUGA 5D7GA 1QNKA 1G91A 2BB5A 2OEOA 1ZUD2 1B1ZA 2NN6H 4NMZA 5I9PA 4FF2A 4B9XA 1A3TA 1ZEQX 1O80A 1YMHE 3ETRA 1FIQA 4D2KA 3LB8C 3J81L 3MJ5A 3M7NA 2V4DA 2GB1A 2MUYA 4RKLA 4NW2A 2Q5WD 2AQ3B 5A2QE 2PTLA 3NVYA 5JOBA 3V05A 3IL8A 3TEZA 5M3MB 4HROA 3C3LA 2IT1A 3VA7A 3K5MA 4Q5VA 2OF1A 4ITKA 2WXQA 5FLXE 4RKBA 1MBYA 3A7AB 1ILPA 5FOBB 3M85A 1RF2D 3GD7A 4RNAA 1BUIC 4L6TB 4H2AA 2F0KA 1FXAA 1G8ZD 2WV6D 4ZHPA 4QF4A 1EY0A 1VF7A 1FFVA 1O7YA 3K59A 1SNPA 2Z4HA 1BQQT 1EU3A 1SNDA 2BTEA 3ZJTA 1P7EA 2WDQB 1SE2A 3BDCA 2DNCA 3Q24A 5EPJA 2WS3B 1E2VA 1VZ7A 2M56B 4HR7B 2E2HB 4B9WA 1XXGA 2B2TC 4F88A 1S5FD 5IGCA 1QILA 4YIJA 5EE0A 2RVLA 3IT4B 2F0LA 1C4AA 1U9RA 2M19A 4C3JG 3U9SA 2E2IB 3M4YA 4JK1C 2NB0A 2EKIA 1Z47A 2Q8TA 2O5JC 3PMFA 2V3PA 2ICEC 3P20A 2L55A 1TJEA 4FF4A 3W9CB 2EE1A 3VRAB 5EKIA 4JPSA 3KUPA 5IODA 1TR5A 2KUMA 2VXWA 5C5LA 2A6HD 4AQ7A 1RWSA 3E6ZX 1HA6A 1HTPA 3H09A 2B2VC 1TWAB 4RAUC 2H4OA 5HI1A 1HCZA 2WACA 3K57A 2QJLA 2FINB 4EVOA 2W3RA 2SDFA 1J7CA 2OEDA 1LT6D 3RLFA 3JAME 2QEJC 3HVZA 1F2RC 2NBFA 3BK2A 5BMHA 3CU7A 4IN3A 5COYA 4A9AA 4HN7A 3A8IE 1IL8A 1YN5A 4FXDA 2WXJA 2IGDA 5BYSA 2BS2B 1F9RA 1QOHA 3GTOB 4N6EB 4XYOA 2RQXA 3AV8A 3BVMA 4KKIA 1SIJA 1G2SA 5T1IA 2WXGA 4C3IG 1SE3A 4AS1A 1NYQA 1H9KA 1EQTA 5CC4A 5KYIA 3TZUA 1SB3C 4R9WA 3O13A 3IAM1 1PRTB 4QMGA 1JOOA 3GQBA 1PZID 2FJ2A 3PO0A 2IW3A 1CM9A 1EEID 1WYGA 2K22A 2K05A 3W2DA 1FFUA 1ZYRD 5C5MA 3BVGA 4CJ2C 1QOFA 1GXDC 4H7BA 1EOTA 2WP8J 3S2DB 4HSVA 5BN3A 2F0DA 1STNA 1SSOA 5KGUA 1YNJD 1QE6A 1PRTC 1H9SA 1AP0A 1YNJC 5KNCA 1UGJA 4HAEA 1TS2A 3FC4A 1AWDA 4BBRB 1B50A 1L4ZB 4HKQA 5C4HA 1FD7D 4CHTB 1Q90A 3GO5A 4R8IA 2KACA 1DOXA 2EY5A 2R7ZB 1TVXA 2K7VA 3H6MA 1CZPA 1AYFA 4U68A 1L0XB 1UWXA 3DM1A 3SEBA 3J7AF 4FXKC 4ID6A 1VMCA 3PIO3 3VR4A 1O7LA 1I3QB 1AZPA 3AEDB 1HUMA 3UI3A 5C0XJ 5T1GA 1JALA 5FKAC 1DZ1A 2Z1CA 5EBCA 2X38A 1ET6A 2IPKD 3GTPB 4DNTB 2QF7A 1D2BA 1PYWD 3VYUA 4Y7NB 3D3RA 3SK4A 3FKIB 4BBSB 3M3YB 1JCKB 4XQNA 3A8JE 1DGJA 1TWFB 4PQXA 3SR6A 3EGRA 3QWNA 3AECB 2F0OA 2D5DA 5GXGB 2CW0C 3KK7A 3I8ZA 3P4QB 1CHQD 2EYPA 2PVOD 4ARCA 2BOSA 5C6AA 1O7ZA 2RKSA 4C3IB 3C2PA 4A3GB 4JE3B 2MJDA 1RD9D 4HTHA 5KNDA 4RHRA 2TSSA 1NR4A 2NZ1D 3MXPA 1HQRD 2F0TA 1CFMA 4CGYB 3C46A 2L4NA 1M4VA 5C2TB 3T3NA 1C4CA 1PTOB 1LV9A 3VR9B 3ND9A 2JU6X 2G9HD 3AMZA 1L0VB 2NYZD 2BBCA 1IBXA 3DWMA 2D2CC 4YTNB 2L32A 2NVQB 2KCNA 3HGBA 4IOIE 5IGDA 3ZJUA 1WGKA 1L4DB 4RF0A 2K1BA 1KTKA 1GHKA 4BY1B 2O4XA 4KN4C 3NBHA 2K5PA 1SNCA 1X32A 2Y5PA 1EQVA 1XF5L 4X3KA 1Y69U 1IBXB 3FVQA 1ONLA 2DY8A 3QOJA 1TZOA 2K03A 5HFYA 4TQ1A 2FFKB 5M5WB 4PMBA 4ZUIA 2K6AA 4YXDB 3BDOA 3IKJA 3HP3A 5CORA 2X6LA 2JA5B 4DAVA 4XIGS 3GB1A 1ZKOA 1BBXC 3RPFC 1HFNA 3PZ8A 4HEA1 2RDGA 2KEEA 3VR6A 4LJZC 5J39A 3MEHA 4X3UA 3FDTA 3B9JA 5IT9E 2ON8A 4RHSA 5IIFA 2Y5CA 4US8A 4MHEA 5CGKA 2KQ3A 3P4RB 4OO1H 1ZXHA 1EU4A 2ZXPA 3V3XA 4Q0FA 1XEEA 5A2QL 1Y56A 1F77A 1HPCA 2I38A 1TU2B 2L12A 4XQJA 3CWIA 1GHJA 3NBIA 5M5YB 5EKKA 3MTSA 1EY9A 1RODA 2WU2B 3CKIB 2OT2A 4MT5A 4KN7C 1Y8OB 4PMWA 5FLXL 1KF6B 1JOQA 1SXTA 2F03A 1SYCA 5D3IB 4V190 2INPE 5JEAJ 5LL6X 1IW7D 2WINB 4XDCA 3A7LA 1H9JA 3D31A 3EA6A 3AE1B 1R7SA 1SYGA 4ODGA 2HCIA 2LMCA 2FBWB 3Q8BA 2G9DA 3NXWA 5I9OA 2I2YA 2PKOA 4FO2A 4PV1C 2B63B 2LHEA 4US9A 3CRKC 4K8IA 3PO3B 1V1PA 4TQUS 2WB1B 2A6EC 2KOLA 1PZJD 3BWUD 2BCOA 2PNRC 2AQ1B 3NRZA 4USAA 2Y0SB 3AEFB 2XN9C 1OQRA 2NVTB 1IHZA 3PUZA 2A74C 3I4NB 3PUVA 1HZ5A 3RUZA 1F2RI 1JWBD 1EYDA 2FE8A 1I7HA 2M00A 3H91A 2L9HA 3R3OA 2VZKD 3AE4B 3OOCA 4Z9CB 2WLBA 2F0NA 2SNMA 5C0XH 1DONA 5AUIA 3HS0C 3L4PA 1STEA 3VR8B 4B0MA 1U4PA 1E2WA 1KNEA 4A3JB 5ELEA 2E3TA 1BOSA 2D9UA 2EY2A 4ZRQA 1HRJA 2EDGA 5JPNC 2J53A 2LMCB 3U7ZA 4KX6B 4DN4M 5FK9C 3HRDD 5EQ0A 4JBWA 4XE0A 1C78A 2R92B 1OXVA 3NQIA 3C1FA 2DBYA 4DU9A 1ZXIA 3E56A 3EJIA 3IAS1 4A90A 3A56A 1TT2A 3MWYW 1IKMA 2HDEA 4I7ZC 2RDFA 3T56B 2FMMA 3QIAA 5HURA 1E0ZA 5IOCA 2QKIC 3M4OB 4X3SA 2LY7A 3OPOA 4HCSA 1X3PA 1L5PA 4A3FB 1D5ZC 1QF6A 2OXPA 4L23A 1D5XC 4XDDA 1MPEA 1EZ8A 3SK5A 3TEYA 2LKVA 4A3IB 4HMJA 3BVZA 5IT9L 1QNUA 3ITPA 2ZT9C 4JWUC 4C80A 3I9V1 4XXEA 1VDZA 2BDNA 5CMDA 1YQ4B 2JYTA 2V3NA 3DWAA 2B8FA 4ZRPA 2W54A 1QWYA 2SEBD 4J6HA 3S1NB 1HEZE 2WKDA 2WDRB 5EPKA 4N59A 1YN4A 1HTLD 2XIWA 4YSYB 1SYBA 1XLOA 4G7HC 5FO9B 1V43A 1L6UA 5E6JA 3D6CA 3T16A 3NSWA 3P75A 1FRRA 1KNAA 4ZK9B 1NVID 1FRDA 3B2FA 4YWGG 4J1MA 2DLBA 2N88A 3MAQA 2E2JB 1N63A 1I4XA 3IT6B 4YT0B 3GV3A 4X3TA 4ZQ3A 4HMIA 2L0CA 1M8AA 3GTGB 1AEXA 5E4XA 2B2YC 5BN4A 1JQ4A 3MA2B 4BS9A 2E76C 2PYKA 1SYDA 5ELDA 3QB3A 5JVG3 4KGTA 4A3BB 2K9XA 1WSPA 4ZKBB 4HSPA 4C2MB 4DAPA 3I4LA 5G5GA 3N6RA 2JSOA 5M3FB 1KAAA 4O42A 1BUVT 1MHHE 1QT9A 1RJTA 4DXFA 4P16A 1DXMA 3LYYA 2EY1A 1V1OA 2NTTA 1FD6A 1GUSA 5IGGA 2EJGC 2DWQA 3KBXA 3IXSA 2JWUA 4KGRA 5EGTA 5JEAH 3KWLA 3WDNA 4RA8A 5IGEA 1F0ZA 4LTUA 2N7JA 2JEBI 3H3VC 1T5XD 2F0UA 3FAHA 1N60A 2E75C 1XO3A 3LX0A 5EJWA 3H8HA 3T53B 5BMIA 3RD4A 2RMMA 1PDXA 1GUTA 4IDIA 1WTWA 1BNZA 1S5DD 3KWVA 2KHSA 5CV5A 3HRZC 3TP5A 2CJNA 3EROA 2GA4B 2J7ZA 1PGXA 3V96A 3QOLA 1DOIA 1EWHA 1N5WA 2NVXB 4NDXA 1GUOA 1PGAA 1IYVA 3RZOB 2N9KA 1PDQA 2W82A 3TN2A 4KJOA 1TS4A 1SNQA 1DOLA 1GB1A 4GZYC 2K04A 1A3UA 2JE6I 3QO2A 3T13A 2WU5B 2K5WA 4NZLB 3I70A 3S2HB 4FYDA 5T8IA 3Q8CA 4L8JA 3R8BA 3L3OC 1IGDA 1CI3M 3PUXA 1MVKA 2B2UA 5M5XB 3SR1A 2VB2X 1YQ3B 2JA6B 1XTCD 1J7BA 3NVVA