1I4XA

Staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
235
Chain Sequence
b'ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 72
structure length 235
sequence length 239
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4xA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4xA02
3DWQA 1MD2D 3BZDB 1JCKB 1PRTD 1S5BD 1LT6D 4RCOA 1EEFD 1AN8A 4RHSA 1V1OA 1SXTA 1TS3A 2QILA 3R8BA 1LTGD 4K6LA 2CHBD 1AW7A 3EFXD 3EA6A 4DXGA 2XRSD 1RCVD 1TS5A 5D3IB 5FK9C 1JWMD 2AQ2B 3BVGA 1PRTF 1I4HA 1LT3D 1LT4D 1YN4A 1I4RA 2Z8LA 1YN3A 5D3DA 3O13A 4RGTA 4RH6A 1S5DD 5I4DA 1TY2A 1FNVA 1TS2A 4RGMA 1UNSA 1M4VA 1YN5A 3CHBD 1PZKD 3MFGA 3BYYB 2TSSA 5ELCA 1L0YB 1PTOH 2NTTA 1XXGA 1XTCD 1ET9A 1BCPD 4DXFA 1S5CD 1ENFA 3SEBA 1FGBD 1SEBD 2AQ1B 1KLGD 1EU3A 4OHJA 2SEBD 1EWCA 4TSSA 1SE4A 1JQYD 1PTOD 1LTAD 2NTSA 5ELBA 1LO5D 1PRTB 5FKAC 1PYWD 1CK1A 1CT1D 1BXTA 1HQRD 4RHRA 3BVZA 1BCPF 5ELEA 1EFID 2RDGA 3W2DA 1HXYD 4C56C 2XNAC 1FNWA 4RFBA 3V05A 2WV6D 3GP7A 1FD7D 1PTOF 1FNUA 1SE3A 1I4QA 1QILA 3R2IA 1TS4A 2J4XA 4O1NA 3URYA 4L6TB 1RD9D 1LTID 1EEID 1F77A 1S5FD 1SBBB 2ICIA 1D6EC 2RDHA 3TSSA 1LTRD 1KLUD 1JWUD 1V1PB 1RDPD 1T5XD 2IPKD 1LLRD 3KLSX 3BYTB 1G8ZD 1ET6A 1LTSD 1PZJD 1RF2D 3OWEB 4RGNA 4ZYSA 3BVMA 5ELDA 1I4PA 2XN9C 1GOZA 2XRQD 5ELFA 1BCPB 3R2TA 1L0XB 2G9HD 4UDUC 1LTTD 1D5ZC 1TY0A 4NZLB 1B44D 1LTBD 4RGOS 1UUPA 1S5ED 4L63B 5TSSA 1DYQA 3MC0B 1PTOB 1DJRD 1PRTC 2IJ0A 1JR0D 1SE2A 1SJED 1HTLD 1CQVA 1SJHD 1I4GA 1BCPC 1JWSD 1KTKA 3DWAA 1CHQD 4Z9CB 1CHPD 1PZID 2R61A 4BWGB 3DWPA 1I4XA 2QEJC 2AQ3B 1HA5A 1V1PA 1B1ZA 1EU4A 1PTOC 1LT5D 2O2LD 1D5MC 1D5XC 1ESFA 1STEA
chains in the Genus database with same CATH superfamily
3U50C 4QCLA 2A8VA 4BBSB 2PEAA 3B2FA 3TZUA 1A3UA 4ZKCB 3ZLZA 1LTGD 1YHAA 2L83A 4UAIA 2D10A 4PYUA 1IBXA 3WIMA 2AKWB 1GB1A 3I4NH 4EEWA 2BCOA 2CQOA 2KMAA 3PUVA 1JWMD 3BJUA 2PE6B 2I07B 2K25A 4XYCA 4FF3A 4M00A 1U4LA 5JJIA 3O13A 2LXCA 1HR0Q 2F0SA 4LMQD 2BBCA 3DDCB 4W9GA 1SN8A 4A90A 1C4CA 2IYDB 5I4DA 2PYKA 3VRBB 2JSOA 1HNWQ 3TEZA 4A3EH 4GN4B 4DR1Q 4RM9A 3P20A 5IWAQ 4HKQA 1FIQA 4JIOU 4JI1L 3PZ7A 2IZVB 3UI2A 3V96A 5JVG3 3VA5A 2IX0A 3DUZA 1TWFH 3R3MA 4HDOA 4ME3A 1JOKA 4NDXA 2LGDA 2NTTA 5GMVA 2LGYA 1N32L 2LEKA 2BA0A 5FLMG 2M0XA 4X3KA 1I6HB 5M9OA 1JOQA 4NKLA 4N9F4 5CYUA 3QAQA 4WJNA 1EIFA 3BINA 1E7ZA 3QQ8B 5AZFA 1I94L 1JQYD 2AHOB 1SNOA 3BZCA 5HKHA 2PPHA 2EQSA 3H94A 3LX0A 3OHXC 4BBSH 4A3BG 1JRUA 3BK1A 4AQ7A 2N1VA 3L2PA 1VQGA 2PVOD 5L83A 5K36H 1KFYB 1T0QC 3NS8A 3R7RA 3TBLD 4GDLA 4JV5L 1T0SC 1Q1OA 1PDQA 5CHFA 4ZOHC 4HVBA 2K33A 4A3GB 1S3SG 4L8JA 4R3DA 4N6EB 3PCOB 5JEAH 4EZKA 5C23A 1Z6HA 4JWSC 2RDHA 4IJHA 3TDQA 4NXMQ 2N4FA 3V6EB 2D2CC 4YCWA 4OVZA 5I9PA 1T5XD 2QGQA 1SYDA 4JI0Q 5KEEA 3P2BA 4HPLB 4ZYSA 4RGNA 4OVVA 4HJ5A 4M01A 4KGRA 5D2MB 2FHTA 2PLPA 3DPDA 2DY8A 3R2TA 4DR2Q 1XNQQ 4FF1A 3MAQA 4HPMB 5IN7A 4DV5Q 4YIJA 1Y1VH 1LTBD 2CH4W 3AB5A 2J7QB 3AU5A 3DBLI 1OXTA 3PO3G 3Q2AC 1ONLA 4ZLTF 1I6HH 1MI0A 1Q8IA 3KF8A 4S3SA 1AZQA 1WYGA 3TL5A 1L7YA 2JYOA 2LUEA 1OXSC 3W1BA 1TGZB 1VQ4A 2A69C 1DONA 4REZA 1JWSD 3L0WB 1PYBA 2CWPA 1WTQA 1R4MB 4EE2A 2D5DA 2L12A 5EE0A 4GOPC 2YYZA 4KY5A 3FDTA 1EQRA 2VQEL 2XK5B 5ELOA 1EF1A 1Y1WB 3ERSX 4A93G 2L00B 4MGKE 4APVA 5BR8Q 2WP9B 3PTFC 4C7ZA 2UXBQ 1HZBA 3TS2A 4RHSA 4HAEA 3A9KB 4A3PA 1TS3A 5GAGC 4A3GH 1CSPA 3SDLC 2UU9Q 4LK0M 1XLOA 4GNXC 2WXGA 2KKCA 3ML9A 2EVBA 2MBEA 3TP5A 2V3PA 2MFIA 2KDMA 4KZ0A 3EGRA 3TIXA 1C4AA 2UXCL 1IPGA 1I4HA 3SHQA 4HSPA 2ID0A 5C4ZA 1NBWA 4DKAC 2BKRB 4DHJB 1FYCA 4JI8L 2K50A 1H9KA 4A3LH 4LW1A 3IHPC 4DFAA 1Y8PB 1N61A 1MHHE 5LXIB 1TS2A 4FNFA 1PA6A 4NXNQ 3CHBD 3AECB 3A8JE 3DEOA 4WIPA 2WX1A 3UDGA 1ICFB 1K50A 2KQ7A 4KV2A 1FRDA 3Q8EA 3DM1A 4LF5L 2IHEA 3BDCA 4CJ2C 3AEBB 1YNXA 1M8AA 3N3KB 3A7LA 1UELA 3SEBA 1FGBD 3K7AB 2AL6A 4DUZQ 4YL8A 3KDFB 1FCLA 4TSSA 3A74A 3VDZA 2PMVA 4Y7NB 4MACA 3ECIA 2Q2TA 4KMUC 2I38A 3KYCD 1K3RA 1Y1WH 4XE0A 4H13C 4JVZA 2G4DB 2M1MA 2MWSB 1DOLA 3NZ3A 1RRBA 5G5GA 4LF8Q 1WGKA 3DBRB 3NS1A 4GOPB 2N0SB 4N58A 1STBA 2LJ5A 3ND9A 3M4QA 1RTOA 1PXUA 1YD8U 2UYZB 3Q0AA 4GN5A 2Z4HA 4OO1G 1WJNA 1WRIA 1UWVA 1JE4A 4R8IA 3H3VC 4KX6B 2GA4B 2F0JA 3GTOB 1UBIA 1WH3A 1MIUA 1VCIA 1VZ8A 4JI3Q 1WJ6A 1D6EC 1F9SA 1JMCA 1V49A 3K6OA 3TSSA 4IM2A 4PYZA 2RPVA 1JB7A 3MTNB 1QZGA 3G4SA 5CV7A 3NG0A 3KLSX 5E6OA 1KOTA 1G8ZD 1ET6A 3U4ZA 1KRSA 1F2YA 3OWEB 4DR1L 2G1EA 1QQRA 2N9KA 3C8YA 3Q3JA 4JQWC 1PH2A 2K32A 2BQQA 1BCPB 3GE3C 4C2MB 4OZCA 4YHHQ 2R92B 1PGXA 2DN8A 1K8GA 4OO1I 3F8TA 4WURA 3D0FA 4KDLB 1GUOA 1UD7A 5C4XB 2PO4A 4BBRG 2ONQA 3K7AH 2HCCA 2DBYA 3NWSA 4LJPB 1T0YA 2G5DA 2C35B 4Y7NH 1W6KA 1SYBA 1X9NA 3VTUA 2BYTA 1XNRQ 2O5IC 5IGDA 4GDKA 1SSOA 1PFSA 2DNEA 4HJ9A 4B9KA 5HG2A 2VZAA 3W3AA 4LFBL 4OXPA 3RUZA 1C4QA 2RQXA 4JBKA 4YTNB 1F2ZA 4GKJL 1IW7D 1C9OA 1WCMG 1D1IA 2EYLA 1K9MC 2EJGC 2UUBQ 4TKOB 1HUNA 3NZSA 5L95C 2B76B 5DM73 1WXQA 1WOCA 3DWQA 1MD2D 4DV3Q 1S5BD 4OIJA 3IVFA 1AN8A 1WTXA 3M3JA 1GO3E 1SXTA 3FEWX 1WI5A 3ZW3A 3GTOH 4XTCS 1H8CA 5IGCA 1O7IA 5COYA 4A3KG 2PZTA 5C5LA 2ZW0A 3PGEA 4KKIA 1ZOYB 2RDBC 3KJPA 4DAMA 1HRJA 1BUVT 2WXOA 2IY0B 2L4NA 4GZYC 2ZCCA 3AU4A 1TWCB 3N9YC 1H4RA 1JWBD 2ZNVC 3A7AB 2N3SA 1KDBA 1ZGUB 2MBBB 1QZHA 1XNQL 3GTGB 1N34Q 4C2MH 1OQRA 2R92H 4DXAB 3KH0A 4DV5L 2CU3A 3CC2A 2LMCA 3ZRFA 4BKTA 5T1GA 2LRWA 3HGBA 5C4XH 5GXGB 1KRHA 2ZPNA 3PUXA 3L10B 5CV4A 2I5MX 1E3PA 4V0BA 4CDFC 4A20A 3L7ZC 1HNZQ 1WXVA 1BR9A 4KN4C 1CZWA 3T1HQ 3J80i 4HR7B 3L0OA 1J19A 2B2UC 4KHPQ 1MPEA 4JWUC 2OTJA 3T4AC 4P1BC 1YNJD 4DR3Q 3WANA 1VQJA 2MNAA 3X3MA 5C0XG 4NAMA 3CCMA 3ABVB 2ATWA 4IWPA 5AJ3Q 1HH2P 4F7XA 1YIWA 2Z0EB 1AEXA 1E2VA 3GZNB 2UXBL 3J81L 3L9AX 1QT9A 2OEDA 2WGSA 2XNAC 5EPLA 1V8QA 2V1YA 2WXPA 5E6NA 4PZ7A 2L55A 4DR6Q 4ZUJA 2Y0SE 2WV6D 2MP2A 3DOWA 1G91A 2RR9A 1FD7D 3LYYA 1GB4A 4MM3B 2RSOA 5D14A 1C8CA 3PRPB 3RFZB 1GAQB 1PH4A 3ER0A 5BN4A 3M7GA 3M3YB 4P73A 1G6JA 1EWYC 5IT9L 1TWCH 3VR3A 5C0XI 3CCRA 2IX3A 1GJZA 2K5PA 5EJWA 4IUQA 3GTGH 2AUKA 4MJSB 2WXFA 3MXNA 2IT1A 3D31A 3HKSA 3KLWA 2WXHA 5EBDA 4JGHB 2XRQD 1VJKA 3RCZA 4BBSG 2KLCA 3ZNID 3CWIA 2SAKA 3T51B 3B2GA 2ZNVB 1GM5A 1VQ5A 2K05A 5K36G 3UI3A 2ZM6Q 2CCZA 3J80E 2KFKB 1PRTC 4KKSA 3HKZE 2NBUA 1JR0D 1Y8OB 3E9IA 4HJ8A 4KSLC 4OWXB 5JEAG 3NBHB 1EWHA 1YI2A 1S3OA 4DV2L 4LK1C 3MC9A 4XIGS 5HY6A 4PS7A 3STBD 3VVWB 4AJYB 4ZRIA 4ZAIA 3H7PA 4J8QA 2KMMA 3MHBA 3VR4A 2V4DA 4M0WA 4X65L 1D5XC 3G7LA 1JJGA 3OG5A 5A2QE 1LT6D 4KI0A 3FHWA 2K1FA 2DZIA 4JI5Q 4IFDH 3PSEB 1IL8A 2NVYB 2VXWA 2FCSA 4RKBA 3A9JA 2B39A 3NBIA 2K8BA 3M3YH 3DWGC 1SYCA 4JI3L 1UBQA 4L23A 2UWQA 4IN3A 4RG1A 1OXUA 4FA6A 3T1YQ 1T0RC 2OJWA 2RPQA 4B6WA 3BK2A 2UXDQ 4ANXA 1TKWB 4DV4L 4IPHA 4HDQA 1JC7A 1WTRA 2VUMG 3S1NB 3QIJA 1DGSA 3NTKA 3VAWA 3L16A 1AARA 4RH6A 3NWTA 3AE3B 1MI2A 2JVCA 3ZNHB 2FIDA 1QVFA 3UQAA 1V43A 2F0IA 1JMLA 4MGYE 3J7YW 3U4EG 1KM7A 2KDBA 3CIRB 4FXKC 3MFGA 1IBKQ 1L0YB 2R6GA 2KYWA 1DOXA 2JU6X 4A3GG 1N36Q 3PHWB 5DPRA 3AXCA 1S5CD 3IKJA 1ENFA 2O2VA 2AUJD 3NTIA 3AE9B 4H0LC 1YJ9A 1XNRL 4JI2L 4XT1B 2JA8B 4L1BA 4M02A 1KJTA 1IKMA 3ND8A 4W9CA 1Z9FA 3BDOA 2PNRC 1PTOD 2NTSA 4H02A 1PRTB 2Z1CA 3AB9A 1H9SB 1CK1A 1HZ5A 3H0GB 2YTXA 2MBHA 3T9LA 2O5JC 3BVZA 2WB1B 5H8YE 4EQOA 5J22A 2YV5A 4DV3L 5IYDH 1N60A 1DXMA 3L3OC 1YJWA 1YX6B 4M8NA 3U8ZA 3SGIA 5E7NA 3KQ4A 2LKVA 2NYZD 3E0EA 2N7DA 1B70B 1IW7C 2NVYH 2B63G 4JYAL 3EC8A 4K6DA 1Q90A 1I35A 1WE6A 4LF4L 3ENEA 3HOXB 2KQ3A 4GLVB 2JN4A 4JI7Q 4EFOA 2IDYA 3HP3A 2K01A 5IODA 3L17A 1NYRA 2W3SA 4B3RQ 3V3XA 2HQEA 1KIXA 3B1LX 4DF7A 3S1NH 1K0SA 4J3OD 4C1NK 3FPPA 2RMMA 1YNND 1J7BA 3W1SA 1M90C 3NVYA 1SSNA 2MP1A 4XYOA 3DBHI 4WJ3M 1LTSD 4BY1G 4AYBG 4B08A 1L6UA 1BBXC 2INNE 2F0LA 1B3QA 4K7UA 2XN9C 3AFQA 1M94A 2MJEA 3VR8B 2NN6I 1VLBA 4R4QA 1A15A 1TY0A 3DCGA 2J53A 1TKEA 2N7EA 1WMHB 1WTOA 3RLOA 3L13A 4L5SA 2WHIA 1HNZL 2L15A 1DYQA 2QHOA 3DHGC 2NZ1D 2JA8H 1CQVA 2PTLA 1JORA 4DR3L 2D3BA 2OHFA 2XWJB 2BS4B 4X3UA 3RUIB 3NTHA 1ZP0B 4YY3L 1PZID 3PIO3 3H0GH 2K5DA 2K52A 4RF1A 4BWGB 5HGTA 5MPOA 2N9XA 4FN2A 1Z47A 2QEJC 2R7DA 5AJ3L 2QEXA 2DNFA 1SE9A 4IG7B 3T56B 3AULA 1W6JA 3HOVB 1GC7A 4KGSA 1CI3M 3NHHA 4FADA 1OEYA 2GBNA 2LY7A 1ESFA 3TEWA 4EGVA 2VY3A 4LF9L 2E2HB 3HOXH 3S9WA 1ROEA 5L37A 1V5TA 1XCTL 2VB2X 5LMNW 4E6IA 2YTYA 4IM0A 5AEKB 1IKLA 4ABNA 1L2FA 1U9RA 3TP8A 5CMDA 5HGQA 3HOZB 1JRPA 2KN4A 1PDXA 2KZRA 4FXDA 2K28A 2LFNA 2ZXOA 1NAPA 4K3CA 4P6VF 1RCVD 5EPJA 5D3IB 3IAYA 4C4VA 1NMGA 1MJCA 3MEHA 5JOBA 3GV3A 1HNXQ 4IUNA 2NS5A 5HFYA 3H91A 4WWOA 4CJ0B 4RGTA 3W1YA 4N9PA 1HEZE 5LL6S 5EE1A 2F0VA 1TY2A 4B3TQ 4WWPA 1ASZA 1M4VA 4KDIC 1WZ0A 5HI1A 2F0HA 1A70A 4CHTB 2WDTB 2KVZA 3VQIA 1EL0A 5IIFA 2PW5A 5ELCA 1F9JA 2NPTB 3U2SC 2C5LC 2FE8A 5J17A 1HJPA 2WDRB 5BYSA 3PGZA 4JC0A 1FL0A 1ET9A 4BS9A 2DY7A 2A6HD 1E0BA 2A68D 3IG3A 1EY0A 1IUEA 3U52E 2F0WA 3PLVA 5GADC 2PIAA 4EZJA 2JPHA 5C44G 1YQBA 1BVSA 1VQ9A 2D3GA 2JA6G 1NBFC 1TQOA 1KAWA 5ELBA 3OMGA 3DBRI 1VZ7A 3HOVH 1E0ZA 2ZJDA 3D3RA 3HUIA 2VH2A 1WWTA 1Y8NB 2WU2B 2E2HH 4KIKA 2JYTA 2ASBA 2M4NA 4BAXA 4BKSA 2J52A 2D3AA 3M9BA 1A2TA 4P74A 1C7YA 2MSED 2KJXA 4CO7A 4FHJA 3HOZH 5C4XG 4KKJA 2UU7A 1T5EA 4L5QA 2O6VA 2KMCA 3TUOA 3SVMA 2KCTA 1EIYB 1TKGA 2QCPX 4DHZE 4IDIA 3MP9A 3T1YL 1LTID 1YITA 2JZ3B 2LI5A 2LVQA 5G55A 2ICIA 2HHHQ 2WX0A 4HLEA 3C19A 2GLSA 4BBNC 3CCLA 4GS3A 3WOEA 3BYTB 1PZJD 2RCNA 4RKLA 5IP9H 3R93A 3RN9C 1I4PA 3NE5B 4HEDA 3SK6A 3RD4A 4NB3A 3H6MA 1YJIA 2KC2A 3I3TB 4NZLB 1N36L 4J15A 3ML8A 1PLFA 2L5TA 4DBGA 2RGFA 3CP0A 3KFUA 1N33Q 1JB3A 3MC0B 1AWDA 1SE2A 1STAA 2JA9A 2K8CA 4PS3A 1ZPSA 1CKNB 2JY6A 4F88A 3U9OA 3UDXA 2A74C 3GB1A 1FRRA 5FLXL 1K8AC 4QF4A 4IOCA 2MCNB 1BOSA 1JROA 2SNSA 2D2QA 3U7ZA 1OEYJ 1PTOC 4R1JA 3ZUNA 4OWTB 3RMHA 4WJOA 3CCEA 2WXNA 2RBMA 2LXAA 3V6CB 1HZAA 4OGQC 4JI7L 3PF4A 3OTOQ 1X1MA 4JE3B 4DAYB 3HM3A 2F0OA 3MA2B 1TR5A 1G2TA 3N32A 3JAMi 3R7QA 1VZ6A 3M62B 1MKHA 2DZKA 3OAWA 3TEHB 4JI6L 1N5XA 5JJLA 5G2NA 3VH3B 3K8AA 3V60A 4JX1C 2PVGC 3OJ3A 4C00A 4LDTD 4FJYA 3T53B 3OW2A 4PMCA 1FR3A 1YNNC 1MVKA 3NUCA 1OTRB 1QOGA 4ZHOA 2PZWA 3IRBA 3AE5B 1U5KA 4AQYL 3RD2A 4AH6A 4BBNF 1XMQL 2N88A 3GTLB 4DHZB 3ONSA 4IFDG 2Y5BB 2HDMA 5EE9A 4IUMB 3D32A 1GHKA 1TWHB 4LFCQ 3HOWB 1RIPA 3P1HA 4YSYB 5CHWA 4IW0A 4IPGA 1EWCA 1VQIA 2KLGA 5IOCA 5LL6X 1DGJA 3AEFB 1J7CA 2KQ4X 2G4SA 3KUPA 1SYFA 3PIP3 1FJGQ 1CT1D 2VQFL 3RZDB 1YIJA 4N8FA 4NP5A 2KK8A 2K14A 2D11A 2E6XA 1G6PA 1EFID 2MW5A 4IFDI 4EKUA 3SK8A 2QA4A 2Y5CA 4ANWA 1L4DB 3JAME 3D8GA 3GP7A 4BA1I 3ZVVA 5KIXA 1PTOF 1LXDA 5JXVA 2F3IA 3A54A 3AEEB 1Y1VB 4WQOB 3GTJB 1NJIC 3KLRA 3I8ZA 3ZJYC 2FUHB 4R4OA 2KDFB 2DWQA 2E3TA 2Z9HA 3F2CA 3N30A 1NSNS 2OF1A 1HNXL 1F77A 1RJTA 4A3OA 1KAAA 4XWWA 1S5FD 4J1MA 3DLLA 4CYEA 1XPOA 1PH1A 2RD0A 4ASWC 5DAUA 1R4NB 1SGHA 4ANVA 1Z5SB 1EUJA 1A8VA 4WWMA 3SK4A 3ZDMC 3OJ4B 2F4VQ 4K8JA 4DUYL 1HR0W 4A3JG 4GLAC 3GTLH 1E90A 1FM0D 1XF5L 3JYUA 1BDOA 1HZCA 3WAPA 4AYBE 2BYFA 1IHZA 1H9JA 3N6RA 1TWHH 4RGOS 5IYBH 3CC4A 3HOWH 3K59A 3B08A 3Q3MC 1MHXA 1SB3C 3NEMA 2W54A 4XDXA 2EOTA 4XC2A 1EY9A 3NVZA 1WI0A 4DDGD 3I2ZA 1TYGB 5CV6A 1ZEQX 2A68C 3RZDH 2ZTEA 1PH3A 2F0KA 4R4IA 1CQFA 1VQLA 4JBJA 4X3TA 1V86A 1PH5A 1N62A 1NYQA 3A33B 4MNOA 2LVOA 2B2VA 3CD6A 2O2LD 3MC8A 1STEA 2C9OA 4LWCA 3RZFA 2RVLA 2WXJA 2JZPA 3WAMA 1B2TA 5LNK1 2OQKA 3GTJH 2L0TA 2GI9A 1QOFA 3WA0A 1UE7A 1PFBA 4L5TA 4A3CH 5H1SE 1XWEA 4XWTA 3OIQA 5FO9B 4W9LA 5JPNC 3K9PB 1Q86C 4WAAA 1WTWA 2YU9B 2VW9A 3M95A 4DK0A 5EBCA 1F1HA 3N1XC 4FJZA 4AWJA 3AE7B 2F0TA 4ZUIA 3BU2A 2E2DC 3TZDA 4IO9A 2AX5A 4LF7L 2AYOB 2C7NB 2DAFA 2WB1G 1EOVA 2B2TA 3NVVA 5E6PA 2I1KA 1CSQA 2HIVA 1STHA 4OX9Q 2K9XA 3HOXG 4A3FG 1Y69U 2N8NA 4DU9A 3HRZC 3NPPA 4CJ1B 4ZRKA 3TCAA 4YTMB 4BY7B 1TXYA 3BY4B 3CW2C 1XD3B 1QNUA 3NHEB 2K7VA 4PMBA 2LWPA 1MHWC 1B4OA 1SMYC 4HXDA 2WXKA 2WINB 1YZ6A 3UINB 1E1TA 3I3CA 1Q7YC 2BGFA 4GKKL 1LGRA 1VMPA 1WX8A 2EY5A 4KSKC 5M3FB 2QDBA 1WGDA 1GUAB 2RHSB 1PV4A 1ICWA 4EQPA 1GG3A 1WX9A 1V97A 2KAJA 2X69A 2LD9A 2MJ3A 1VMCA 4W9IA 3IT6B 3DVNU 1XPRA 1VQAA 3P4RB 4PQXA 3K7UC 5I2XA 1HXYD 3Q6SA 1QCBD 2E76C 2X38A 1WXMA 1TKYA 4O0AA 3U58A 1QKZA 4MGZE 1SE8A 1PH7A 4GLXA 2WAQG 3VYRA 1KDCA 1SE3A 4WJ4A 1R7SA 4OVUA 5D65A 5IA7A 2ALYB 2HJ1A 2YU9H 4DR4L 3UIPB 1SFOB 1V6EA 4OW0A 2YLMA 2PQAB 2BOSA 3HOYB 2V3SA 2PCFB 2FBWB 3E3XA 4K2LA 1RAXA 5D7GA 3WCQA 2R7ZG 2WKCA 4TRDA 4HMIA 2N49A 5K5PA 1WJ4A 3ZNGC 2CKZB 3SDZA 1KL9A 1WTPA 2BPSA 1OXVA 4OL7A 2YEPF 4YT0B 2YEPB 5C0XJ 4P16A 2CVRA 2LUMA 3R3OA 2C9WB 2B2YA 2C7MB 1F9PA 2G9HD 3ZYYX 4BY7H 1ILPA 1QOAA 3Q8AA 4ARCA 4R8NA 3HOZG 1XO3A 3A5ZB 3GTKB 2LFIA 1K8RB 1K8MA 2C60A 2C5CA 3DM3A 5CR3A 1VD2A 2HE7A 4HIKA 4C3JB 2WACA 3NY5A 4B3MQ 2L05A 5M3FH 4LUOA 4ZKBB 3AMZA 4XQJA 1F2RC 2B3AA 1B8AA 3DWAA 2EJFC 1L4ZB 4B9WA 1VQCA 1Y8RC 1HR0L 2P5ZX 1XMOQ 3D6WA 1VF5C 1I4XA 2A5HA 1TBEA 3DWMA 4FXCA 1H95A 2LMCB 3J80c 3PIOA 4UY8C 4GNXB 1RWSA 2NBWB 5IP9G 1HNWL 4XXEA 3Q3FA 5IWAL 3D4WA 2INCC 2V4IB 1G51A 2Z8LA 3E0JA 5LLIA 1II3A 1CMXB 2XK5A 3BZDB 1ENCA 3Q3NC 3VUYA 4RCOA 4K5VA 1Q1BA 4C3HB 1IP9A 3GTMB 1G6ZA 1STYA 3AM9A 4BKSD 2A1AA 2F0QA 2R7FA 3R8BA 2NVXB 3ZNZB 1TVXA 1SFOH 1FXTB 3A9KA 3Q3OC 3HOYH 2HD3A 1V80A 1GVPA 1VQMA 2O6VD 2Y3AA 1B9MA 2VL6A 1ENAA 1KQSA 5JHBA 1QF6A 1C9FA 1VS0A 5BYRA 5KHQA 2KD0A 3W5OA 1FO4A 1SRUA 5JEAJ 2L0FA 1LM0A 2HDLA 4YWKA 2DX5B 2NCNA 5GAEC 3OIPA 2KT7A 4F8CB 4RAUC 3CCSA 3GDEA 1NR4A 3H8HA 4I6NB 5IP4D 1UNSA 4X3SA 2K1BA 2MP2B 4CKEA 3AE1B 3GTKH 5LMUQ 2L3ZA 3K0YA 4EOYA 5F2DA 3E56A 3H1UA 4C3JH 1SNPA 3P63A 2BWFA 4X64Q 2BYVE 1NNXA 1WF9A 3M4PA 2KDIA 4H2AA 3PSIA 4LTUA 1F9QA 4WWNA 2IW3A 2NVQB 4NXML 1K3BC 2SEBD 3H09A 2PQEA 2HT1A 5DNFA 2ZW1A 3KDFA 3HFZB 3I55A 3F2BA 1LTAD 1NEKB 2I46A 3LGJA 1LO5D 4JI0L 2RDFA 3CCUA 1YNTE 3RI7C 2EKIA 4AJWA 3LDZE 3DHQA 5ELEA 4DR2L 3TN2A 1PGBA 4GSWA 2C7HA 1E7UA 4C3HH 4IALA 3GTMH 2Q5WD 5D6JB 1FGUA 5E3FA 3FILA 3O65B 2NVXH 4HRSA 3V05A 4X6AH 1EUVB 2G45B 4CHKA 4LNKA 2F0DA 4DQOC 2A19A 1EY7A 3QARA 3SD5A 1EYGA 3F1ZA 3I4NG 1EEID 1Y14B 4JL9A 5CBAE 3K5NA 3H7PB 2PI2A 3K0XA 4LJOB 4US8A 1QZEA 3K81C 2BB5A 3PRZA 3KUDB 4ZHPA 4W9FA 3RNAC 3G6EA 3I91A 2FUG1 3LB8C 3H15A 4GIVA 1LM8B 1K73C 5BR8L 2KWVB 4QAYA 4A3EG 4DAPA 2WDQB 1E10A 3W1SC 5BO4B 3OYYA 4DGZA 4DK6C 2SOBA 3ERQA 4XQNA 1FD6A 5TSSA 2UU9L 4G7ZC 1GUNA 2JP1A 1J9OA 5T1IA 2GN5A 2NVQH 1NCVA 2M2LA 2UUAQ 1X3QA 2MO1A 2LRUA 3EECA 3I5JC 4CDCC 1IYVA 1O7YA 3H3VH 3D4DA 4FLHA 1ZDVA 4ITKA 2XEWA 3IAM1 5FJ8H 1EF5A 2ZJPA 4MEMA 3ZQ4A 2MA9B 3J7AF 4W9HA 3SFDB 4A3IB 3CKIB 4IUVA 1IL2A 1GC6A 1B1ZA 5BN3A 4X66Q 4IJLA 2K8HA 2OEOA 2NBFA 1D3ZA 2JEBI 4NXNL 2BS3B 4ME5A 2M9VA 3KWVA 4ZDVA 1EYAA 2KCMA 3C0RB 4GGQA 1TT2A 2KQSA 1EEFD 1QVGA 3QIAA 2Z4IA 4POGA 2H5XA 2O2VB 5EQ0A 3NK9A 5C3EB 2N78A 1P98A 2Y5PA 3CSFA 4ZRPA 1HHVA 1L1OA 4KKTA 1Z2MA 4DXGA 3RNBC 3RNFC 4YXDB 4R4TA 3KOJA 4DUZL 3M4OB 5KNCA 3DMUA 4L5RC 3I4MB 3EJIA 3FAHA 3RNEC 1MG4A 2AWNA 3BVGA 4CKCA 2NBVB 2N9PC 1VQKA 3J7AV 4IUUA 1LACA 3I7FA 2K39A 2IY5B 2D9UA 4LF8L 1C79A 1FNVA 4IZ8A 3A4SC 2HIXA 1IYJB 3I73A 4OEMB 4YTPB 1QWYA 1TU2B 1Y1VG 4JK1C 1KABA 5G3LD 4XYQA 2KEEA 2E2IB 3U7DA 1XXGA 1YQ4B 3KF6A 1A62A 4TMAB 4A3CG 5IP7H 3VTWA 2AQ1B 1ZYRD 3NVWA 5C6AA 3K57A 4EQNA 5BN5A 1OTCA 1P7EA 3HHMA 4G0NB 4I65A 4NPNA 4B0MA 4N59A 1RLFA 3NSWA 1RFAA 2WXIA 4A3IH 4DR5Q 5IT9c 1X3GA 2M56B 3UDFA 5CV5A 2F03A 2ES2A 2G9DA 4B3SQ 1RTNA 4OONA 4RHRA 2E5LQ 1Q0WB 1WX7A 3APFA 3F2UA 2Y0SB 3CRKC 4YHHL 2VZKD 2DYBA 5FOBB 4A3BB 3GTQB 4RFBA 4F8MA 5C3EH 1QLBB 3TEXA 3OMCA 3CMEA 2KHWB 3P7JA 1YJ1A 3T16A 2JA5B 4DV0Q 2PMZE 1E8XA 1FMAD 3M4OH 1T3QA 3JSVB 2KX0A 4EQ5A 4WQMA 3I4MH 1R4NI 2MJ8A 4KV6A 2O4XA 2WAQE 2FJ2A 3OLMD 1Z7TA 2KENA 3WDNA 1S72A 3PREA 3KJOA 4US9A 2Q8RE 3ALBA 3CXCA 2R93B 3NP8A 2UUBL 4TUUA 1RF2D 1OQYA 4HJGE 2NVTB 1XX8A 3C2PA 4A3LG 4MJSA 1B7YB 4IWQA 5LMUL 4YWMA 1B50A 1ZKOA 1STNA 2E2IH 1Q10A 4X64L 3LXFA 2G3QB 3HKZB 1TWAB 3UF8A 3MXPA 2BTEA 3RNUA 3I56A 1SYEA 3PO3B 3MEFA 1VDVA 2NZHA 2LSSA 2XTIA 1RKNA 2KNBA 4I7ZC 3TS0A 2KFKA 1ZE3D 1NR2A 1F2LA 4WJWA 3QCAA 1NUCA 2I5HA 4UHVA 3W1GA 4DPGA 3LWEA 3K9OB 4ICVA 4HIMA 3HVDA 2JT4B 1IZ6A 1Y1WG 1N34L 3AE2B 5IGGA 2RA4A 1SMXA 1KD1C 3J81i 4XDDA 4A3BH 3GTQH 1C1YB 5DPTA 5C2TB 2CQAA 1IGDA 2M0AA 3CMMB 4A93B 4BY7G 4GMVA 3BDLA 3IBEA 3M7NA 1XEEA 4LNIA 1WIAA 1HZ6A 1C77A 2JA5H 2JRIB 2LVPA 3Q69A 2EYMA 3D4RA 4RF0A 4XZ4A 1XCQL 1LABA 2KHJA 4JI4Q 1JALA 3BG3A 1MSGA 1WFQA 4UP7A 3RR5A 5KYLA 3T1HL 2OWOA 1R4MI 1G291 4KHPL 4KVGB 1X3EA 5JHAA 3QB3A 1BF4A 2IWHA 3EHVA 3PLUA 2R93H 1JE5A 5CV9A 4KIKB 5D3DA 2B2WA 2NVTH 4II2B 2BA1A 1ISNA 2QW7A 3SU8X 3BIID 3RPFC 1BQQT 4GB9A 1VQOA 1F52A 3F2DA 1WY8A 1YNJC 2OQ0A 2XSCA 3EROA 5LXHA 2BH8A 2JA7B 4HIDA 4K3BA 1XYIA 1TWAH 4UP9A 3E9SA 2NZOA 4DR6L 4K0KQ 3BYYB 2KECA 1RM6C 3PO3H 2D3CA 4RM8A 4TQUS 3MVVA 2E8GA 4NAWA 3A8IE 2A73B 1KXLA 4U68A 2IX1A 2CFMA 4OIKA 3HOYG 3GTPB 1SROA 1WGHA 3APDA 4LFAQ 2EIFA 4P7IA 2F0FA 2IO1B 3EUB2 4W9JA 3ZJVA 3HG9A 2JWZA 1OGWA 3ZXRA 4FF4A 2CHWA 4KY6A 2KJ6A 4OWWB 3J9CA 3Q8FA 3VUXA 3J81E 1SAPA 4W9DA 4MH0E 1VQBA 2A4ZA 4A93H 2ZEQA 1KC8C 5DPWA 4FULA 3ZXVA 2LXKA 4NW2A 2EY2A 3BWUD 4LCDE 4JI1Q 1FNWA 3DXJC 1LTLA 2RF4A 4A6QA 2PPBC 4C3JG 3DVGX 5J18A 4EVOA 2ZM6L 1C78A 1WXAA 2DYMA 2H4OA 2BB6A 3FC4A 4A4IA 2X6LA 3J81j 2DZJA 5IT9E 2M8SA 1VQHA 4IFDJ 4IQZA 1N32Q 1B9NA 4LUVA 1YX5B 3VYTA 1WM2A 4ID6A 3VXWA 3NOBA 1DOYA 2CS4A 2PNHA 4QMGA 1GUGA 3R66C 1XQQA 4RWSC 4F87A 2XVSA 4KD3A 1E22A 3JAMc 1I94Q 4Y52H 1X56A 2WLBA 1CA5A 4YCVA 3RLNA 4WAFA 2JA7H 3PPAA 1PUTA 4NNJB 1WVLA 3K5MA 4C3HG 3VYUA 2R92G 3STBC 5EKLA 1J6QA 2OCEA 1LTTD 4DHJD 4I7AA 4JI5L 3PO0A 4CQNA 3NELA 4FO2A 1SNQA 3GTPH 1WJUA 2PE9A 3W9CB 2L1BA 3A55A 2F4IA 4IOIE 4Q2JA 1NVID 4TQ0A 1Q12A 4DAVA 4JV5Q 2IO0B 1BKBA 4KKUA 4BBRB 2K22A 1FPYA 4FVMA 5EGTA 1QUQA 2V3NA 2LGSA 4MT5A 3ZTCA 4TVAB 1MJEA 2JX5A 2UXDL 3TMEA 2MPMA 2PZUA 4DR5L 4Z9CB 2QKIC 1M1KC 2DUDA 1EY6A 2XGTA 1BUIC 3DWPA 2CR5A 4NPSA 3J7ZC 1DZ1A 3W5VB 3I57A 1UE1A 4C3IB 2EYFA 3RNCC 1LV9A 4F7ZA 3SFEB 5BMHA 2EYPA 4ACFA 4MHEA 3WWVA 1TT5B 4B9XA 5M5YB 3QG1A 1HFNA 1EM7A 1V9PA 3PZ8A 1IBKL 4DNRB 2PW9A 1NY4A 2A69D 4QY7A 1UWMA 2WDVB 4OO1H 4LAAA 4DV0L 2HTME 3S16B 2ACZB 3I9V1 3U30A 1IBXB 5CX3A 3EIVA 2B2VC 2B8FA 3EFXD 4XQQA 4MZ9A 3M63B 2XRSD 3FPUB 4NJ6A 3QOJA 3QJZA 1U4PA 1VF7A 4IPDA 4ULLA 2XWBB 2R3ZA 4A3KB 4KD4A 1VQPA 4HTHA 5I9OA 3AE4B 2EDGA 1AFPA 3U4VA 5FJ8G 4KLKA 4ZQ3A 4NQLB 4LUZA 2B8GA 2EE1A 4GN1A 4X57B 1V2YA 3Q22A 1MBYA 3AN1A 4G3XB 1SDFA 1U4MA 1IBMQ 3HVZA 4Q0FA 2WXQA 1YN5A 4DV6Q 2JUOA 2F0MA 3KWLA 1DM0B 2KHSA 1YBYA 4E74A 2B2TC 1EFWA 4BBRH 5KNBA 3Q8BA 4G4KA 1BCPD 5HURA 3ZRCA 4DK5A 3ZJTA 1F0ZA 4MH8A 4B3RL 4OELB 4P2CB 2GB1A 3ZO5B 3H3VI 2BE5D 5DM63 3Q23A 2K5HA 3Q24A 3RN5A 1J8CA 1RL2A 1NDDA 2L52A 2UXCQ 1U4RA 1NMFA 1VQDA 4C3IH 1A6XA 1V5OA 5FKAC 3IL8A 2EMSA 4W9KA 2FAZA 5FO8B 5G3LF 1MGSA 5M5YH 3GO5A 2KVMA 4ZRZA 2L9HA 3MWYW 3QWZB 1STGA 1WM3A 1B53A 2JQRB 3Q14C 1FXAA 4PG3A 3AQQA 2EKEC 3S16H 1E7PB 1QB5D 4GDLB 3EQLC 4MELA 2CHZA 4FP5D 5IGBA 4JI4L 2KX3A 1F2MA 5KNDA 4A3KH 2TMPA 2J42A 3LNNA 5C5MA 3S24A 4BFRA 1CZGA 5CHVC 1JJ2A 1XPUA 2KA7A 2KWUB 4MSMB 4BOSC 2K3UA 4KGTA 1LTRD 2M00A 2Z6KA 1JWUD 4K14A 4YWLA 3L4PA 4RMFA 3GZNI 2NB0A 2RCFA 3I90A 3UE1A 5D94A 4H7BA 1SNDA 5FLXc 4GU2A 3PRMB 3DHHC 1K52A 2BWES 4K0KL 2E74C 1UF0A 3I4OA 3S2HB 1XLNA 1GKHA 1YJJA 4K81A 3TQYA 3DVGY 3KYDD 4K7WA 5DPSA 2F0EA 3EFUA 3RULA 5C3EG 3CC7A 3I70A 3KF8B 1S5ED 3A1QA 3AFPA 4J6IA 4NJCA 4USAA 4LFAL 1EQVA 1PTOB 3ZIMA 2IJ0A 3VA7A 2KTRA 4QUFA 1HTLD 3I4MG 2F1MA 4HEA1 2B2YC 1YMHE 2FCMA 3VR5A 2DJGC 4A3DB 1ZDXA 3CAMA 4U673 1LQBA 1CKNA 2GOWA 2EYOA 1Q3LA 1EWIA 3HK0A 5M3MB 5C0XH 3RZWC 3KBXA 3DHIC 1RODA 5CTRC 1H9RA 1YJNA 2DJFC 3SR1A 1A3VA 1V1PA 1UGMA 4K1RB 4B3TL 1LT5D 3G71A 2HD5B 1CZPA 5IYDG 1EO6A 4TQ1A 3PO2B 1T6BX 2K6QA 2KTFA 5EKKA 1EZ8A 2SNMA 2RHQB 4K6LA 5J39A 4DAYA 4EZLA 3P4QB 2LXJA 2J0KA 3KW5B 1EYDA 1FFUA 1TS5A 4WORA 3AMUA 4O42A 2IO3B 1ZUD2 4IPCA 2H89B 3IAS1 4HCSA 3BZKA 2KVRA 2KHIA 1E7VA 2K5VA 2Z0SA 2A6HC 2KN5A 2ZTDA 3AU7A 1W2BA 2JXMB 4XT3B 1YHQA 1PHJA 4LFBQ 2VUMB 3CCJA 2L1AA 2L11A 2XBBC 1A2UA 2Y0SG 1VQEA 4GKJQ 2BH2A 1X3FA 4R4CA 1JT8A 3DBSA 3S2HH 2WYQA 3RMKC 2RKSA 3TREA 3CF5A 4LF6Q 2AMCB 4Q5VA 4QJFA 2IHFA 3X3NA 2A6ED 4KTAA 2CKHB 1ZXTA 4ZK9B 2PW7A 2JA5G 1IXRA 2LHDA 1PTOH 5J1ZA 4GXBA 2RSUA 2ASQA 3PVLA 1I3QB 1CFMA 2KOLA 2IO2B 4A76A 1OQQA 4A3DH 2D07B 1SEBD 2JA8G 3QR8A 4FYDA 1E1OA 1ASYA 4EX5A 2HHHL 2W82A 1XLPA 5KGUA 5M3MH 1E8YA 4LNQA 2R93G 3EN2A 2WXRA 2EYJA 5HHDG 5G5HA 1SNCA 3QK0A 3H0GG 3ITPA 5I6WA 3IXSA 2JK8A 3K80C 1B3AA 2H1EA 3PO2H 3OWFA 3DBHB 4G7HC 3CQZB 3W2DA 1HCZA 1A63A 3HKZG 3BS1A 2KXJA 2Q2UA 3SK5A 4QUCA 1PVOA 4KJOA 4JOIA 1FVIA 5A35A 2B63B 4XDCA 3ZDTA 2WKDA 3M4YA 4MSQB 4LNOA 4NJ7A 1N33L 5C3XA 2CW0D 2JEAI 1X55A 4QGUA 1GD7A 1I5FA 4KN7C 1SR3A 4L6TB 1RD9D 3GD7A 1Q8KA 4H44C 1L0WA 1UE5A 3RZOB 1E6EB 3QHTA 3TBIB 2VUMH 3VFKA 2B29A 2PI2E 2N9LA 4FXGC 4A75A 2LJIA 3MXUA 4IKGA 4FHKA 1GJXA 1XJVA 1HTQA 1EOTA 3GQBA 3PUZA 3EVQA 4S0RA 4KK7A 2DNCA 4AYBB 1IBML 2JQOA 3CRLC 4DV6L 4BY1B 3AEDB 3KUZA 1P3QU 3VDYA 2FINB 2IBIB 1JW9D 1D5ZC 3OTOL 4ANUA 1I3QH 3ETRA 1O7ZA 2I2YA 4M8AA 2ENBA 4LNFA 1JWAD 2A5UA 2GVAA 1E2WA 4F1SA 5JJZA 1EY5A 1UAPA 4E3CA 2ZVOA 1A3TA 5FLXE 4RMAA 4RA8A 4GDKB 2OXPA 2F0NA 3PZDA 1O7LA 1BCPC 2ZJRA 2FMCA 1CA6A 3J80L 1KTKA 1CHQD 2XIWA 2F0GA 1L0VB 4JLCA 1CHPD 1HTPA 1K28A 2BE5C 5BMGA 3X23A 2LGIA 4HIOA 1VDZA 3HOVG 1V81A 1AE3A 5EAYA 3CQZH 5EKIA 2JA7G 3MHZA 3VR9B 1WGGA 1I42A 2AL3A 4AOFA 2B63H 2K04A 4WH4A 1JCKB 1PRTD 3SXHA 2NN6H 1S40A 1WD0A 2QCZA 1DCZA 3KBGA 2UUCQ 3FVQA 5KRUA 2QIEB 3HRDD 1QOHA 1HZ9A 4LFCL 4LNNA 5A2QL 3VR2A 1NI2A 3RT3B 3PS6A 3RZOH 3TP6A 2BVCA 4NY0A 2J0JA 1C3TA 1OXXK 2HCIA 3HS0C 1NTGA 1R4QB 4QB4A 2VRRB 1BBWA 2JSVX 4CDDC 5T8IA 4PV1C 2EY1A 4PZ6A 4DV2Q 2DAJA 1LT3D 2K6DB 3AYHB 1YN3A 3NUHB 1FJGL 2JRHA 2N55A 2KFJA 4BY1H 4K2KA 2D0PA 1IGCA 1L1OC 1RHPA 2HUGA 2KCCA 3PV0A 2KDEB 2R2OA 1EY4A 5J2RA 1U0LA 1GNUA 3FILB 4HMJA 4X65Q 5ISRA 3J7A5 4HN7A 2CHXA 2PJHA 4M8MA 2IY1B 2EXZA 4FF2A 1TWGB 2MBQA 1WR1A 3NZUA 4BXXH 4A9AA 2DGYA 1ZXIA 4PK1A 1P7FA 2NUCA 2JWUA 1SNMA 1B9RA 3MJWA 1YVCA 1JQ4A 3B6YA 1NENB 1DD2A 5FO7B 3HOUB 2Z6BA 4MN3A 1KLGD 1WD1A 5IYCH 1GHJA 1FXIA 4OHJA 3HM6X 3PT2B 4HROA 4C80A 2L32A 3CF6E 4HPPA 4R9WA 2LHEA 2EXDA 1I6VC 1SE4A 4MIUA 5C44B 3IFWB 4DV4Q 2JZZA 2JA6B 1J0GA 4G57A 1K0RA 2INDC 1C0AA 1PYWD 1BXTA 3WOFA 2F4VL 1BCPF 4L2YA 4MGIE 2Q8IB 4ZRJA 3WALA 1PFNA 3UE0A 4CDEC 1EZ6A 3RN2A 4KHVA 3APCA 5NUCA 1AP0A 3P1MA 1NI3A 5CBEE 5BYQA 4A55A 2NWGA 4DNTB 5M5WB 1Q5WB 2GMIC 2LGXA 4KZCA 2BYEA 2ICEC 2ZTCA 2LASA 4JPBW 3A5UA 4ALPA 4DK1A 3R2IA 1TS4A 2J4XA 4O1NA 4A3MB 2DZMA 2ZVNA 3URYA 1CM9A 1ZW7A 3B0AA 3MHSD 4HCNB 4LDTB 3QC8B 2V4LA 2VS1A 4JI2Q 4W9EA 3FKIB 3I63C 2PQAA 1FFVA 3MXNB 1MG8A 4C3IG 2L7RA 2KANA 4K5WA 3AH7A 3S14B 3NJTA 3VUWA 1OO9B 1N6ZA 2OOBB 2V1CC 4LF6L 2BS2B 4ODGA 2JJQA 2CJOA 2BDNA 4WRDA 1TWGH 1JOOA 2K75A 4QQBX 1HTOA 3V61A 2E75C 1U4AA 1VQ6A 5EDSA 1UZXB 1ACCA 4JW0A 1ML0D 4JYAQ 2GBKA 3JC66 1VQNA 1UUPA 1L1OB 4I6LB 4LF4Q 4G50A 1PH6A 3ZGZA 4GOPA 2F0PA 1KNEA 2A6EC 3E5SA 3HOUH 2EPBA 4DV7Q 5GAHC 1WSPA 2DENB 4AS1A 1I50B 4IUTA 4FJVB 1EIGA 1HQMC 4P75A 5E1FA 5EE3A 4MDKE 1Q81C 1UEAB 1X6OA 5C44H 3FP9A 2JA6H 2I1JA 2M17A 5AUKA 5E4XA 3PMFA 1TZ1A 1F9RA 2DYOA 2MX2A 4M0WB 3TJPA 2MH7A 3HEJA 4P72A 3NQIA 1S1QB 4URKA 4ILWA 3ZJUA 2IGHA 5ELNA 1GPXA 3N52A 2J7ZA 5GQOA 2YVCA 4BKGA 4OX9L 2E2JB 4GNXA 1Q46A 5M5WH 1WTVA 4O2DA 3KF6B 3A9JB 5AZHA 2ZXPA 2MHJA 3I72A 4A3MH 4PZ8A 4OZAA 2QILA 3S2DB 5FR6A 1PH9A 4X62Q 3KK7A 1D2BA 5C4JB 2VNUD 2KWDA 1X32A 2J0MA 3T8MA 2QJLA 1QOBA 3FKIH 5C4HA 5FK9C 3CCQA 2CW0C 1WJJA 1Q82C 3MTSA 2JYEA 2KO3A 3HIZA 3QA8A 1WTHA 4YY3Q 3S14H 3P4PB 2Z59B 2FMMA 3IFDA 3OPOA 2HTHA 1GUSA 3QWNA 2EZVA 5CC4A 1S5DD 2WP8J 1YEZA 1VCBA 2Q2IA 2KUMA 3UGBB 1E9MA 4HJAA 4G7OC 3P42A 3CPWA 4LF9Q 1PZKD 1C76A 1K83B 1X54A 2B2WC 2I0QA 5IYBG 3HOWG 1E8WA 1I50H 5M5XB 2L8JA 1ILQA 2MHVA 4DXFA 2BF8B 2KCNA 1AH9A 1HE8A 1DOKA 2WQYB 1WR6E 1J5EQ 4OZBA 1PYSB 5DEHA 2MGSA 5CV8A 3FMCA 5E4WC 3G48A 3ZTDA 2FCQA 4IWOA 4DV1Q 2QMTA 2D0OA 4IUPA 1TZOA 1VR9A 3H6NA 1T9HA 2Q8TA 3ICEA 1JJCB 1LUZA 4BA2I 3OOCA 5JJKA 2D5GA 4FDBA 3NRZA 1XTDA 2E2JH 1KH0A 3L54A 3MFYA 1P0RA 4G11A 1YHBA 4TKNA 5CGKA 4N9TA 2UUCL 1KRTA 1C4PA 1XLQA 1PFMA 2WB1E 3SR6A 4DWFA 2VB3X 3P75A 3S2DH 3S1MB 1KHIA 5C4JH 4B0EA 1GUWA 2W55A 3J81c 2N7JA 1I4QA 4B3ML 2GBRA 4HJKA 4HK2A 4ZCKA 3MXGA 4DNIA 1EIHA 2GBJA 1GXDC 4B95A 4A3DG 3VR6A 2OJRA 3N20C 5AZGA 3HZXA 3EBEA 4C1NI 4CGYB 3LJ3A 5C3WA 5M3MG 2WFWA 2JE6I 1D1KA 1KLUD 4YCUA 1CTMA 1XMOL 4IOAA 3DEPA 1LLRD 2MLBA 2CU1A 5KYIA 5DCNA 1EYCA 1PFDA 5IOIA 1YOVB 5ELFA 3E6ZX 3PO2G 3PIPA 4PT5A 2EYHA 1K83H 2R2QA 5FR3A 4A3JB 2GRIA 1UE6A 5IE8A 5JH5C 1JICA 3GS2A 1B44D 5M5XH 4II3B 4N8X1 4KY7A 4K5XA 1L5PA 3PV1A 1PH8A 3KUCB 2CWAA 2V0GA 3PUWA 2FNJB 3DBLB 4UPAA 2DHZA 2V9HA 1RYJA 3I4LA 2HJ8A 4MM3A 3B9JA 2KOXA 1IYUA 5J3BA 4I6PA 3AEAB 1SIJA 1A0IA 2EMTA 5AUIA 2ZXRA 1ZKHA 2PKOA 2MQJA 2W9NA 4P71A 1HFGA 3L08A 4HCPB 2AQ3B 2AWOA 2AEHA 2DLBA 3H7SA 2YTVA 3D6CA 2QDLA 1EU4A 2IGDA 1BBUA 1PQSA 4XX5A 3S1MH 2QC8A 3AE8B 1VRAB 1VQFA 2N1WA 4NAWB 1IBLQ 2H88B 1MJDA 1YQ3B 3H9DA 3ZKJC 5EPKA 1KLVA 5E6JA 5CORA 2Z0DB 1HA6A 1TIFA 2W3RA 5LHY1 1OFFA 3NENA 2QF7A 3CSTA 4C4VB 3VRAB 3Q8DA 3T13A 5FLMH 1KDAA 1EQQA 4HJ7A 2K6AA 1I7HA 1D8LA 3LWUA 2ZT9C 2F3WA 1PRTF 1UGJA 1TIID 1KNAA 1LT4D 3C3LA 5JZEB 3NBHA 2L0CA 2NMQA 4LJZC 1VQ8A 2FCNA 1AE2A 1X65A 1QVCA 4A3JH 1SYGA 1Q1EA 4DA2A 2KEDA 1N5WA 1UWXA 2OT2A 5I6YA 4FBJB 2K0PA 2F3VA 4RGMA 2L76A 2GBMA 4RNAA 4HKZE 2B2UA 2MO0A 2NN6G 4IURA 4DR7Q 4A3FB 4WJQA 1BMLC 2BDOA 4DV7L 3ULJA 4HWIB 5BMIA 4KJNA 2KJRA 4YSXB 4M1UB 1CKMA 1PMRA 2D62A 3CMAA 4JI6Q 1QG7A 3C1EA 1V8CA 1P9DU 5M3FG 1DOMA 1G2SA 1AYFA 4QIWE 5KHOA 3UDIA 1HPCA 5IO9A 4TV3A 4IC7B 1IYFA 5JPMC 3S15B 4MTKA 3Q8CA 3PHXB 1WYWB 5IY0A 2WIIB 3K5LA 5LMNQ 3X0WA 3K5OA 1WYDA 5I2YA 2M19A 3GOEA 4AQYQ 2ZJQA 5H92C 4C56C 1XMQQ 2WS3B 3A0JA 2O6VB 2F52A 1FEHA 4D2KA 2PMZB 1DOIA 4BXXG 4X62L 3V62A 1O80A 3K58A 1FNUA 1V1QA 3U9SA 1QUQB 3CCVA 3S2AA 2WAQB 1J8IA 2WXMA 2UUAL 2QSDA 1L2NA 1HUMA 3JAML 4BOZB 5IYCG 1W3SA 1Y56A 4NMZA 2WXLA 3JSVA 3RNGC 1SBBB 1LYLA 1E5WA 3V2TA 1FCCC 4PMWA 4GN3B 1LFDA 2NR2A 2R7ZB 2BKFA 3TEYA 3OSOA 1R9TB 3A4RA 1K53A 2VQFQ 1AZPA 4X66L 1KF6B 1WGRA 3BVMA 1N8RC 3G6JB 1GOZA 4JBWA 5IGEA 1H9SA 4A3FH 1P1AA 4UDUC 3ONAB 2Z6KC 4K7SA 4YSZB 3S1RB 3N1YC 3QOLA 2I5LX 3OW7A 2WU5B 1H9MA 1NE3A 3DQVA 4DK3C 3W5UB 4JBMA 1DJRD 3KLSA 3A56A 5IGFA 1SJHD 1SJED 3M85A 1J5EL 2REXA 5IKCM 5AFWA 1I4GA 2WNMA 3E9HA 4DV1L 3IT4B 1E2ZA 4BZAA 2HDEA 3Q6BA 3C46A 5JAVA 3S15H 4GOCA 2R61A 3S1QB 2AWTA 2F0UA 1HA5A 1C48A 2EY6A 2BW2A 1D4BA 1VQ7A 4DUYQ 3VHTC 2MRPA 5C3JB 4JG2A 1EY8A 1SF0A 1X3PA 3DVNV 1D7QA 2MUYA 1K8OA 1V1OA 1N9WA 4POFA 1BO0A 2EELA 4AP4C 4BVUC 3HOUG 2CHBD 1AW7A 4HSVA 4CBVA 1QJOA 4WFN3 2GVBA 4QL5A 4QIWB 3EA6A 4RCNA 1WMHA 4P1CC 4YWGG 5IAAC 1ESRA 1E8ZA 3NXWA 4E71A 3SE0A 2R7ZH 2QDFA 1O78A 3NQTA 1A5RA 2AQ2B 2K4KA 3P4SB 1R9TH 1I4RA 1YN4A 3AV8A 2NVUI 1WRDB 1ZYRC 1K51A 3TP7A 3PF5A 4B3SL 2E5LL 2JF5A 2B3GA 4PNYA 3MJ5A 4AIMA 1WCMB 1SLJA 3ULPA 4ZYNA 2Q2HA 3S1RH 2KWCA 3VH4B 3CU7A 3T3OA 2K5WA 3KVFB 1CKOA 4V190 1P16A 2TSSA 4K8IA 4A3MG 1J7AA 1TJEA 2IGGA 2WWZA 2KJHB 1XTCD 1PGAA 2INPE 1UH6A 1QNKA 3FKIG 3TMPB 4C7YA 1EU3A 3PUYA 3EFCA 4GLSC 3S1QH 1RFKA 3IFTA 3UQBA 2MQHA 4KHZA 3GV6A 4DDID 4LF7Q 3S17B 3RYTA 3VTVA 1HQRD 1CJEA 4JPSA 4A8XC 4DN4M 2JXTA 5C1ZA 1L6VA 2VQEQ 2RDGA 1IBLL 1V9JA 2K5NA 3KYHC 1SMYD 2KBNA 5JVH3 3A1QB 3QO2A 1XT9B 3CPFA 2MBOA 1UEBA 3AEGB 2KTRB 4PS8A 3T3NA 3TRZA 3AE6B 2FXQA 1TTNA 2X6GA 1QILA 2FIFA 1BT0A 4LLGM 2NPTA 2K03A 4J6HA 3C1FA 1WZ3A 3GE8C 1P8LA 3WAOA 2K5QA 4IM3A 2X8XX 5DLQE 2ZCBA 3N1ZC 4ARIA 4JCVE 1QE6A 4HCEA 1BNZA 2MJDA 4GKKQ 3I4NB 3QX1A 2KC1A 2CH4A 4JOIC 2N9EB 3UIOB 2CJNA 1V1PB 3ULLA 1RDPD 2IPKD 3SHLA 1F2RI 1WGYA 4MTNA 2ZZPB 3AEVA 2LZ6A 5TR5A 1MFWA 1WCMH 4NQKE 4JI8Q 5ELDA 3JW0X 2J0TD 3VYSA 4DR7L 1WFYA 1L0XB 2RSNA 3FRPB 2JXXA 1EQTA 4AUQC 4A3EB 3PQIA 2IL8A 1MSHA 3RLFA 2FFKB 2VH1A 1SIFA 3FKYA 1GUTA 3QJYA 4L63B 2BT6A 1ZXHA 1TWFB 3JVZX 2MEKA 4LF5Q 3AI5A 3MZ5A 5GROA 5IP7G 4DR4Q 2LS01 2EJMA 2ZPYA 1R4PB 3S17H 1N63A 2HQLA 2ON8A 2VZKB 4CKBA 1S4ZA 4UP8A 4A3IG 1E24A 4S17A 4XGAB 2KACA 1WE7A 3A8KE 2OTLA 5LMNL 4WJPA 4ZRQA 1WXSA 1CUKA 1D5MC 4EUTA 4ICUA 2SDFA
chains in the Genus database with same CATH topology
4QCLA 4BBSB 3B2FA 3TZUA 1A3UA 4ZKCB 1LTGD 2L83A 4UAIA 1IBXA 1GB1A 2BCOA 3PUVA 1JWMD 2I07B 4FF3A 1U4LA 3O13A 2F0SA 4LMQD 2BBCA 4A90A 1C4CA 5I4DA 2PYKA 3VRBB 2JSOA 3TEZA 3P20A 4HKQA 1FIQA 3PZ7A 3UI2A 3V96A 5JVG3 3VA5A 2IX0A 3DUZA 1JOKA 4NDXA 2NTTA 2LEKA 2BA0A 4X3KA 1I6HB 5M9OA 1JOQA 4NKLA 5CYUA 1JQYD 1SNOA 3H94A 3LX0A 3OHXC 3BK1A 4AQ7A 2PVOD 5K36H 1KFYB 1PDQA 4ZOHC 2K33A 4A3GB 4R3DA 4L8JA 4N6EB 5JEAH 1Z6HA 4JWSC 2RDHA 3TDQA 2D2CC 4OVZA 5I9PA 1T5XD 1SYDA 5KEEA 4ZYSA 4RGNA 4KGRA 2FHTA 2PLPA 2DY8A 3R2TA 4FF1A 3MAQA 4YIJA 1LTBD 3AB5A 1OXTA 1ONLA 4ZLTF 1MI0A 1Q8IA 3KF8A 4S3SA 1AZQA 1WYGA 2JYOA 1OXSC 2A69C 1DONA 4REZA 1JWSD 1WTQA 4EE2A 2D5DA 2L12A 5EE0A 2YYZA 4KY5A 3FDTA 1Y1WB 2WP9B 4C7ZA 4RHSA 4HAEA 1TS3A 1XLOA 2WXGA 2EVBA 3TP5A 2V3PA 2KDMA 3EGRA 1C4AA 1I4HA 4HSPA 2ID0A 5C4ZA 1FYCA 1H9KA 4DFAA 1Y8PB 1N61A 1MHHE 1TS2A 4FNFA 3CHBD 3AECB 3A8JE 3DEOA 4WIPA 1K50A 1FRDA 3Q8EA 3DM1A 3BDCA 4CJ2C 3AEBB 1M8AA 3A7LA 3SEBA 1FGBD 3K7AB 1FCLA 4TSSA 2PMVA 4Y7NB 4MACA 4KMUC 2I38A 4XE0A 4H13C 1DOLA 3NZ3A 5G5GA 1WGKA 3NS1A 2N0SB 4N58A 1STBA 3ND9A 1RTOA 1PXUA 3Q0AA 2Z4HA 4OO1G 1WRIA 1JE4A 4R8IA 3H3VC 4KX6B 2GA4B 2F0JA 3GTOB 1VCIA 1VZ8A 1D6EC 1F9SA 3K6OA 3TSSA 2RPVA 5CV7A 3KLSX 1G8ZD 1ET6A 1F2YA 3OWEB 2G1EA 2N9KA 1QQRA 3C8YA 2K32A 1BCPB 4C2MB 4OZCA 2R92B 1PGXA 2DN8A 4OO1I 4WURA 1GUOA 5C4XB 2PO4A 2ONQA 2HCCA 2DBYA 3NWSA 1W6KA 1SYBA 2O5IC 5IGDA 1SSOA 2DNEA 5HG2A 3W3AA 3RUZA 1C4QA 2RQXA 4YTNB 1F2ZA 1IW7D 1HUNA 2EYLA 1D1IA 2EJGC 4TKOB 2B76B 5DM73 1WXQA 3DWQA 1MD2D 1S5BD 4OIJA 1AN8A 1WTXA 1SXTA 3FEWX 4XTCS 5IGCA 5COYA 2PZTA 5C5LA 2ZW0A 4KKIA 1ZOYB 1HRJA 1BUVT 2WXOA 2L4NA 4GZYC 1TWCB 3N9YC 1JWBD 3A7AB 1KDBA 3GTGB 1OQRA 2CU3A 2LMCA 5T1GA 3HGBA 5GXGB 1KRHA 3PUXA 5CV4A 4V0BA 3L7ZC 1BR9A 4KN4C 1CZWA 4HR7B 4JWUC 2B2UC 1MPEA 3T4AC 1YNJD 3X3MA 5C0XG 4NAMA 3ABVB 4F7XA 1E2VA 1AEXA 3J81L 3L9AX 1QT9A 2OEDA 4LK0M 2XNAC 5EPLA 1V8QA 2WXPA 2L55A 4ZUJA 2WV6D 1G91A 1FD7D 3LYYA 1GB4A 4MM3B 2RSOA 5D14A 1C8CA 3RFZB 1GAQB 3M3YB 5BN4A 3M7GA 1EWYC 5IT9L 3VR3A 5C0XI 2IX3A 2K5PA 5EJWA 4IUQA 2AUKA 2WXFA 3MXNA 2IT1A 3D31A 2WXHA 5EBDA 2XRQD 1VJKA 3CWIA 2SAKA 3T51B 3B2GA 5K36G 2K05A 3UI3A 3J80E 1PRTC 4KKSA 1JR0D 1Y8OB 5JEAG 1EWHA 4LK1C 4XIGS 4ZAIA 4J8QA 2KMMA 3MHBA 3VR4A 2V4DA 4M0WA 1D5XC 3G7LA 5A2QE 1LT6D 4KI0A 4IFDH 1IL8A 2NVYB 2VXWA 4RKBA 2B39A 3NBIA 3DWGC 1SYCA 4L23A 4IN3A 1OXUA 3BK2A 1TKWB 1JC7A 1WTRA 3S1NB 3NTKA 4RH6A 3NWTA 3AE3B 1MI2A 1V43A 2F0IA 1JMLA 3J7YW 3U4EG 3CIRB 4FXKC 3MFGA 1L0YB 2R6GA 1DOXA 2JU6X 1S5CD 3IKJA 1ENFA 2AUJD 3NTIA 3AE9B 4H0LC 4XT1B 2JA8B 4L1BA 1IKMA 3ND8A 3BDOA 2PNRC 1PTOD 2NTSA 1PRTB 2Z1CA 3AB9A 1H9SB 1CK1A 1HZ5A 3H0GB 2O5JC 3BVZA 2WB1B 5H8YE 4EQOA 5J22A 1N60A 1DXMA 3L3OC 3KQ4A 2LKVA 2NYZD 1IW7C 4K6DA 1Q90A 3HOXB 2KQ3A 2IDYA 3HP3A 2K01A 5IODA 1NYRA 2W3SA 3V3XA 2HQEA 4DF7A 4J3OD 4C1NK 3FPPA 2RMMA 1YNND 1J7BA 3W1SA 3NVYA 1SSNA 2MP1A 4XYOA 1LTSD 4B08A 1L6UA 1BBXC 2INNE 2F0LA 2XN9C 2MJEA 3VR8B 2NN6I 1VLBA 1A15A 1TY0A 2J53A 1TKEA 1WTOA 1DYQA 2NZ1D 1CQVA 2PTLA 1JORA 2OHFA 2XWJB 2BS4B 4X3UA 3NTHA 1ZP0B 1PZID 3PIO3 4RF1A 2K5DA 4BWGB 5HGTA 5MPOA 1Z47A 2QEJC 3T56B 1W6JA 3HOVB 4KGSA 1CI3M 3NHHA 2LY7A 1ESFA 3TEWA 4EGVA 2E2HB 1XCTL 3S9WA 1ROEA 2VB2X 4E6IA 1IKLA 4ABNA 1U9RA 3TP8A 5CMDA 1JRPA 3HOZB 2KN4A 1PDXA 4FXDA 2K28A 2LFNA 2ZXOA 1NAPA 4P6VF 1RCVD 5EPJA 5D3IB 3IAYA 5JOBA 3MEHA 3GV3A 4IUNA 5HFYA 3H91A 4CJ0B 4RGTA 4N9PA 1HEZE 5LL6S 5EE1A 2F0VA 1TY2A 1M4VA 5HI1A 2F0HA 1A70A 4CHTB 3VQIA 1EL0A 5IIFA 2PW5A 5ELCA 3U2SC 2FE8A 2WDRB 5BYSA 1ET9A 4BS9A 2DY7A 2A6HD 1E0BA 2A68D 1EY0A 1IUEA 3U52E 2F0WA 2PIAA 1TQOA 5ELBA 3OMGA 1VZ7A 1E0ZA 3D3RA 3HUIA 1WWTA 1Y8NB 2WU2B 2JYTA 2J52A 1A2TA 2KJXA 4KKJA 1T5EA 3TUOA 3SVMA 1TKGA 2QCPX 4IDIA 3MP9A 1LTID 2ICIA 3WOEA 3BYTB 1PZJD 4RKLA 3R93A 1I4PA 3NE5B 4HEDA 3SK6A 3RD4A 3H6MA 1YJIA 4NZLB 1PLFA 2L5TA 1JB3A 3MC0B 1AWDA 1SE2A 1STAA 1ZPSA 4F88A 3U9OA 2A74C 3GB1A 1FRRA 5FLXL 4QF4A 1BOSA 1JROA 2SNSA 3U7ZA 1PTOC 3RMHA 2WXNA 2RBMA 4OGQC 4JE3B 2F0OA 3MA2B 1TR5A 1G2TA 1VZ6A 1N5XA 4JX1C 2PVGC 3T53B 4PMCA 1FR3A 1YNNC 1MVKA 3NUCA 1QOGA 4ZHOA 2PZWA 3AE5B 2N88A 3GTLB 5EE9A 4IFDG 2HDMA 1GHKA 1TWHB 3HOWB 3P1HA 1EWCA 5IOCA 5LL6X 1DGJA 3AEFB 1J7CA 2KQ4X 3KUPA 1SYFA 3PIP3 1CT1D 3RZDB 4NP5A 2E6XA 1EFID 4IFDI 3SK8A 2Y5CA 1L4DB 3JAME 3D8GA 3GP7A 4BA1I 5KIXA 1PTOF 5JXVA 3A54A 3AEEB 1Y1VB 3GTJB 3KLRA 3I8ZA 2DWQA 2E3TA 1NSNS 2OF1A 1F77A 1RJTA 1KAAA 4XWWA 1S5FD 4J1MA 5DAUA 4WWMA 3SK4A 4K8JA 1FM0D 1XF5L 1BDOA 1IHZA 1H9JA 3N6RA 4RGOS 3K59A 1MHXA 1SB3C 2W54A 4XDXA 2EOTA 1EY9A 3NVZA 1TYGB 5CV6A 1ZEQX 2A68C 2F0KA 1CQFA 4X3TA 1N62A 1NYQA 2B2VA 2O2LD 1STEA 2C9OA 2RVLA 2WXJA 2JZPA 1B2TA 5LNK1 2GI9A 1QOFA 1PFBA 1XWEA 4XWTA 3OIQA 5FO9B 5JPNC 1WTWA 2YU9B 4DK0A 5EBCA 3AE7B 2F0TA 4ZUIA 3TZDA 2E2DC 2AX5A 3NVVA 2B2TA 1STHA 2K9XA 1Y69U 4DU9A 3HRZC 3NPPA 4CJ1B 4YTMB 4BY7B 1QNUA 2K7VA 4PMBA 1B4OA 1SMYC 2WXKA 2WINB 3I3CA 1VMPA 2EY5A 5M3FB 2QDBA 1ICWA 4EQPA 1V97A 2KAJA 2X69A 2MJ3A 1VMCA 3IT6B 3P4RB 4PQXA 5I2XA 1HXYD 3Q6SA 1QCBD 2E76C 2X38A 1TKYA 1QKZA 3VYRA 1KDCA 1SE3A 1R7SA 5D65A 1SFOB 4OW0A 3HOYB 2BOSA 2PCFB 2FBWB 4K2LA 5D7GA 3WCQA 2WKCA 4TRDA 4HMIA 5K5PA 3SDZA 1WTPA 1OXVA 4OL7A 2YEPF 4YT0B 2YEPB 5C0XJ 4P16A 2CVRA 2LUMA 3R3OA 2B2YA 1F9PA 2G9HD 3ZYYX 1ILPA 3Q8AA 1QOAA 4ARCA 4R8NA 1XO3A 3GTKB 2LFIA 1K8MA 2C5CA 5CR3A 4C3JB 2WACA 4ZKBB 3AMZA 4XQJA 1F2RC 3DWAA 2EJFC 1L4ZB 4B9WA 4FXCA 3DWMA 3D6WA 1VF5C 1I4XA 2A5HA 2LMCB 1RWSA 4XXEA 3D4WA 2V4IB 2Z8LA 3E0JA 1II3A 3BZDB 1ENCA 4RCOA 4K5VA 1Q1BA 4C3HB 3GTMB 1G6ZA 1STYA 3AM9A 2F0QA 3R8BA 2NVXB 1TVXA 2Y3AA 1QF6A 1B9MA 1ENAA 1C9FA 5BYRA 1FO4A 5JEAJ 2HDLA 3OIPA 4RAUC 1NR4A 3H8HA 1UNSA 4X3SA 2K1BA 3AE1B 4CKEA 3K0YA 5F2DA 3E56A 3P63A 1SNPA 4H2AA 4LTUA 1F9QA 2IW3A 2NVQB 2SEBD 3H09A 2PQEA 5DNFA 2ZW1A 1LTAD 1NEKB 2I46A 1LO5D 2RDFA 1YNTE 2EKIA 3DHQA 5ELEA 3TN2A 1PGBA 4IALA 2Q5WD 5E3FA 3FILA 4HRSA 3V05A 2F0DA 4DQOC 1EY7A 1EEID 5CBAE 3K5NA 4US8A 2BB5A 4ZHPA 2FUG1 3I91A 3LB8C 4DAPA 2WDQB 1E10A 4DGZA 2SOBA 3ERQA 4XQNA 1FD6A 5TSSA 4G7ZC 1GUNA 2JP1A 1J9OA 5T1IA 1NCVA 2M2LA 1X3QA 1IYVA 1O7YA 3D4DA 4ITKA 1ZDVA 3IAM1 3ZQ4A 3J7AF 3SFDB 4A3IB 3CKIB 4IUVA 1B1ZA 5BN3A 2OEOA 2NBFA 2JEBI 2BS3B 4ME5A 2M9VA 3KWVA 1EYAA 1TT2A 1EEFD 3QIAA 2Z4IA 5EQ0A 3NK9A 5C3EB 2Y5PA 4ZRPA 1HHVA 4KKTA 4YXDB 4DXGA 3M4OB 5KNCA 3DMUA 3I4MB 3FAHA 3EJIA 2AWNA 3BVGA 4CKCA 3J7AV 4IUUA 1LACA 2D9UA 1C79A 1FNVA 4IZ8A 3I73A 4YTPB 1QWYA 1TU2B 4JK1C 5G3LD 1KABA 4XYQA 2E2IB 2KEEA 1XXGA 1YQ4B 4TMAB 2AQ1B 1ZYRD 3NVWA 5C6AA 3K57A 4EQNA 5BN5A 1P7EA 4I65A 4B0MA 4N59A 3NSWA 2WXIA 2M56B 5CV5A 2F03A 2G9DA 1RTNA 4RHRA 3F2UA 2Y0SB 3CRKC 2VZKD 5FOBB 4A3BB 3GTQB 4RFBA 4F8MA 1QLBB 3TEXA 3OMCA 3P7JA 3T16A 2JA5B 1FMAD 1T3QA 4WQMA 2MJ8A 4KV6A 2O4XA 2FJ2A 1Z7TA 3WDNA 4US9A 2Q8RE 2R93B 3NP8A 1RF2D 4HJGE 2NVTB 1XX8A 3C2PA 1B50A 1ZKOA 1STNA 1Q10A 3LXFA 3HKZB 1TWAB 2BTEA 3MXPA 1SYEA 3PO3B 1VDVA 1RKNA 4I7ZC 1ZE3D 1NR2A 1F2LA 4WJWA 1NUCA 3LWEA 3HVDA 3AE2B 5IGGA 2RA4A 4XDDA 5C2TB 2CQAA 1IGDA 2M0AA 4A93B 3BDLA 3M7NA 1XEEA 1HZ6A 1C77A 3Q69A 2EYMA 3D4RA 4RF0A 1XCQL 1LABA 1JALA 3BG3A 1MSGA 5KYLA 1G291 3QB3A 1BF4A 2IWHA 5CV9A 5D3DA 2B2WA 2BA1A 3BIID 3RPFC 1BQQT 1YNJC 2XSCA 3EROA 2JA7B 1XYIA 3E9SA 1RM6C 3BYYB 2KECA 4TQUS 3MVVA 3A8IE 2A73B 4U68A 2IX1A 4OIKA 3GTPB 2F0FA 3EUB2 3ZJVA 3HG9A 4FF4A 4KY6A 3J9CA 3Q8FA 3J81E 1SAPA 4NW2A 2EY2A 3BWUD 1FNWA 3DXJC 4A6QA 2PPBC 4C3JG 4EVOA 1C78A 3FC4A 2DYMA 2H4OA 2BB6A 2X6LA 5IT9E 4IFDJ 4IQZA 1B9NA 3VYTA 4ID6A 1DOYA 4QMGA 1GUGA 4RWSC 4F87A 2XVSA 4KD3A 2WLBA 1CA5A 4WAFA 1PUTA 1WVLA 3K5MA 4C3HG 3VYUA 5EKLA 1LTTD 3PO0A 4CQNA 4FO2A 1SNQA 3W9CB 2L1BA 3A55A 2F4IA 4IOIE 4Q2JA 1NVID 4TQ0A 1Q12A 4DAVA 4KKUA 4BBRB 2K22A 4FVMA 5EGTA 2V3NA 4MT5A 2JX5A 3TMEA 2MPMA 2PZUA 4Z9CB 2QKIC 1EY6A 1BUIC 3DWPA 1DZ1A 3W5VB 3I57A 4C3IB 2EYFA 1LV9A 3SFEB 5BMHA 2EYPA 4MHEA 4B9XA 5M5YB 3QG1A 1HFNA 1EM7A 3PZ8A 4DNRB 2PW9A 2WDVB 2A69D 1UWMA 4OO1H 4LAAA 2HTME 3I9V1 3S16B 2ACZB 1IBXB 2B2VC 2B8FA 3EFXD 4XQQA 2XRSD 3FPUB 2BYTA 3QOJA 1U4PA 1VF7A 4ULLA 4A3KB 2XWBB 2R3ZA 4KD4A 4HTHA 5I9OA 3AE4B 2EDGA 1AFPA 4ZQ3A 2B8GA 2EE1A 3Q22A 1MBYA 3AN1A 1SDFA 1U4MA 3HVZA 4Q0FA 2WXQA 1YN5A 2F0MA 3KWLA 1DM0B 2KHSA 2B2TC 5KNBA 3Q8BA 4G4KA 1BCPD 5HURA 3ZJTA 1F0ZA 4MH8A 2GB1A 4P2CB 2BE5D 5DM63 3Q23A 3Q24A 2L52A 1U4RA 1A6XA 5FKAC 3IL8A 5FO8B 5G3LF 1MGSA 3GO5A 2KVMA 4ZRZA 2L9HA 3MWYW 1STGA 1B53A 2JQRB 1FXAA 1E7PB 4GDLB 1QB5D 3EQLC 4FP5D 5IGBA 1F2MA 5KNDA 2J42A 2TMPA 3LNNA 5C5MA 1CZGA 2KA7A 2K3UA 4KGTA 1LTRD 2M00A 1JWUD 4K14A 3L4PA 2NB0A 3I90A 4H7BA 1SNDA 1K52A 1YJJA 2E74C 3S2HB 1XLNA 2F0EA 3I70A 1S5ED 4NJCA 4USAA 1EQVA 1PTOB 2IJ0A 3VA7A 4QUFA 1HTLD 2F1MA 4HEA1 2B2YC 1YMHE 3VR5A 4A3DB 1ZDXA 4U673 2EYOA 1Q3LA 5M3MB 5C0XH 3KBXA 1RODA 1H9RA 3SR1A 1A3VA 1V1PA 1LT5D 1CZPA 4TQ1A 3PO2B 1T6BX 5EKKA 1EZ8A 2SNMA 4K6LA 5J39A 4DAYA 3P4QB 1EYDA 1FFUA 1TS5A 4WORA 3AMUA 4O42A 1ZUD2 2H89B 3IAS1 4HCSA 2A6HC 3AU7A 2JXMB 4XT3B 2VUMB 2L1AA 2L11A 1A2UA 2RKSA 4Q5VA 3X3NA 2A6ED 4KTAA 1ZXTA 4ZK9B 2PW7A 2LHDA 1PTOH 5J1ZA 1I3QB 1CFMA 2KOLA 1OQQA 1SEBD 4FYDA 2W82A 1XLPA 5KGUA 2WXRA 2EYJA 5HHDG 5G5HA 1SNCA 3ITPA 5I6WA 3IXSA 1B3AA 2H1EA 3OWFA 4G7HC 3CQZB 3W2DA 1HCZA 3BS1A 3SK5A 4QUCA 4KJOA 4XDCA 5A35A 2B63B 2WKDA 3M4YA 5C3XA 2CW0D 2JEAI 4KN7C 4L6TB 1RD9D 3GD7A 3RZOB 4H44C 1E6EB 3TBIB 2N9LA 4FXGC 2LJIA 3MXUA 4IKGA 1GJXA 1EOTA 3GQBA 3PUZA 3EVQA 4KK7A 2DNCA 4AYBB 4BY1B 3CRLC 3AEDB 2FINB 1JW9D 1D5ZC 3ETRA 1O7ZA 2I2YA 4M8AA 2ENBA 1JWAD 1E2WA 5JJZA 1EY5A 1UAPA 1A3TA 5FLXE 4RA8A 4GDKB 2OXPA 2F0NA 1O7LA 1BCPC 2FMCA 1CA6A 3J80L 1KTKA 1CHQD 2XIWA 2F0GA 1L0VB 1CHPD 1HTPA 2BE5C 5BMGA 2LGIA 1VDZA 3VR9B 3MHZA 5EKIA 2K04A 4WH4A 1JCKB 1PRTD 3SXHA 2NN6H 1WD0A 1DCZA 3KBGA 3FVQA 5KRUA 2QIEB 3HRDD 1QOHA 5A2QL 3VR2A 3TP6A 1OXXK 2HCIA 3HS0C 4QB4A 1R4QB 2JSVX 5T8IA 4PV1C 2EY1A 1LT3D 1YN3A 3NUHB 2N55A 4K2KA 1IGCA 3PV0A 1RHPA 2HUGA 2KCCA 1EY4A 3FILB 4HMJA 5ISRA 4HN7A 2EXZA 4FF2A 1TWGB 4A9AA 1ZXIA 1P7FA 2NUCA 2JWUA 1SNMA 1B9RA 1JQ4A 1NENB 1DD2A 5FO7B 3HOUB 4MN3A 1WD1A 1KLGD 1FXIA 1GHJA 4OHJA 4HROA 4C80A 2L32A 4R9WA 2LHEA 1I6VC 1SE4A 4MIUA 5C44B 2JA6B 4G57A 1PYWD 1BXTA 3WOFA 1BCPF 4L2YA 2Q8IB 1PFNA 1EZ6A 4KHVA 3P1MA 5NUCA 1AP0A 1NI3A 5CBEE 5BYQA 4A55A 2NWGA 4DNTB 5M5WB 2ICEC 4A3MB 4DK1A 3R2IA 1TS4A 2J4XA 4O1NA 3URYA 1CM9A 3FKIB 1FFVA 4C3IG 4K5WA 3AH7A 3S14B 1OO9B 2BS2B 4ODGA 2CJOA 2BDNA 4WRDA 1JOOA 2E75C 1ACCA 1ML0D 1UUPA 3ZGZA 2F0PA 1KNEA 2A6EC 3E5SA 4AS1A 2EPBA 1WSPA 1I50B 4IUTA 1EIGA 1HQMC 5E1FA 1UEAB 5AUKA 5E4XA 3PMFA 1F9RA 2DYOA 2MH7A 3HEJA 3NQIA 4ILWA 3ZJUA 2IGHA 1GPXA 3N52A 2J7ZA 2E2JB 1WTVA 2ZXPA 3I72A 4OZAA 2QILA 3S2DB 3KK7A 1D2BA 5C4JB 2VNUD 2KWDA 1X32A 2QJLA 1QOBA 5C4HA 5FK9C 2CW0C 3MTSA 2JYEA 3P4PB 2FMMA 3IFDA 3OPOA 1GUSA 3QWNA 2EZVA 5CC4A 1S5DD 2WP8J 2KUMA 1E9MA 4G7OC 3P42A 1PZKD 1C76A 1K83B 2B2WC 5M5XB 1ILQA 2MHVA 4DXFA 2KCNA 1DOKA 2WQYB 4OZBA 5DEHA 2MGSA 5CV8A 3FMCA 5E4WC 2QMTA 4IUPA 1TZOA 1VR9A 2Q8TA 3NRZA 4BA2I 3OOCA 2D5GA 1KH0A 3MFYA 5CGKA 4N9TA 1C4PA 1XLQA 1PFMA 3SR6A 2VB3X 3P75A 3S1MB 4B0EA 1GUWA 2W55A 2N7JA 1I4QA 1EIHA 3MXGA 1GXDC 3VR6A 3HZXA 4CGYB 4C1NI 5C3WA 2JE6I 1D1KA 1KLUD 1CTMA 3DEPA 1LLRD 5KYIA 1EYCA 1PFDA 5ELFA 3E6ZX 4PT5A 2EYHA 5FR3A 4A3JB 2GRIA 1JICA 3GS2A 1B44D 4KY7A 4K5XA 1L5PA 2V0GA 3PUWA 1RYJA 3I4LA 3B9JA 1IYUA 3AEAB 1SIJA 5AUIA 2ZXRA 2PKOA 1HFGA 2AQ3B 2AWOA 2DLBA 3D6CA 1EU4A 2IGDA 3AE8B 1VRAB 4NAWB 2H88B 1YQ3B 5EPKA 5E6JA 5CORA 1HA6A 2W3RA 5LHY1 1OFFA 2QF7A 3VRAB 3T13A 1KDAA 2K6AA 1I7HA 3LWUA 2ZT9C 2F3WA 1PRTF 1UGJA 1TIID 1KNAA 1LT4D 3C3LA 3NBHA 2L0CA 2NMQA 4LJZC 1N5WA 1SYGA 1Q1EA 4DA2A 2KEDA 1UWXA 2OT2A 5I6YA 2K0PA 2F3VA 4RGMA 4RNAA 4HKZE 2B2UA 2NN6G 4IURA 4A3FB 1BMLC 2BDOA 5BMIA 4KJNA 4YSXB 4M1UB 1PMRA 2D62A 1QG7A 3C1EA 1V8CA 1DOMA 1G2SA 1AYFA 1HPCA 5JPMC 3S15B 3Q8CA 2WIIB 3K5LA 3K5OA 5I2YA 2M19A 5H92C 4C56C 2WS3B 1FEHA 4D2KA 2PMZB 1DOIA 1O80A 3K58A 1FNUA 3U9SA 2WAQB 1J8IA 2WXMA 2QSDA 1HUMA 3JAML 1Y56A 4NMZA 2WXLA 1SBBB 1FCCC 3V2TA 4PMWA 2R7ZB 3TEYA 3OSOA 1R9TB 1K53A 1AZPA 1KF6B 3BVMA 3G6JB 1GOZA 4JBWA 5IGEA 1H9SA 4UDUC 3ONAB 4YSZB 3S1RB 3QOLA 3OW7A 2WU5B 1H9MA 3W5UB 1DJRD 3KLSA 3A56A 5IGFA 1SJHD 1SJED 3M85A 5AFWA 1I4GA 2WNMA 3IT4B 1E2ZA 2HDEA 3C46A 5JAVA 2R61A 3S1QB 2F0UA 1HA5A 1C48A 2EY6A 2BW2A 1D4BA 5C3JB 1EY8A 1SF0A 1X3PA 2MUYA 1K8OA 1V1OA 1BO0A 2EELA 2CHBD 1AW7A 4HSVA 4CBVA 1QJOA 4WFN3 4YSYB 5EE3A 4QIWB 3EA6A 4RCNA 4YWGG 1ESRA 3NXWA 3SE0A 1O78A 3NQTA 2AQ2B 3P4SB 1YN4A 1I4RA 3AV8A 1ZYRC 1K51A 3TP7A 4PNYA 3MJ5A 1WCMB 3CU7A 3T3OA 2K5WA 4V190 2TSSA 4K8IA 1J7AA 1TJEA 2IGGA 1XTCD 1PGAA 2INPE 1QNKA 4C7YA 1EU3A 3PUYA 4GLSC 1RFKA 3IFTA 4KHZA 3GV6A 3S17B 1HQRD