3DBRI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190gln-nedd8ala72arg)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
85
Chain Sequence
RRASVGSGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
total genus 18
structure length 85
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dbrI00
5IAAC 3V60A 2Z0DB 3HIZA 4K7UA 3DBHI 2KANA 1WJUA 2C5LC 4BKSA 2ZVOA 4ANWA 3DCGA 4IG7B 3RCZA 3MTNB 2K39A 2L0FA 3DBSA 3PLUA 4NQLB 3TJPA 3JSVA 4CHKA 3ONSA 2BPSA 5CHVC 3QAQA 3D32A 3VUXA 2IYDB 3APCA 4LJOB 3I3TB 3R7QA 1S3SG 1ZKHA 2LGYA 1E8WA 1S1QB 1OTRB 2G3QB 2JY6A 3AU5A 1UBIA 5E6OA 3UIPB 2BWFA 4GB9A 4OVVA 2IBIB 3DVNV 2GBJA 4LDTD 3NHEB 1H8CA 3MHSD 2JT4B 3HK0A 2NS5A 4E3CA 3ZUNA 2ZCBA 3ZIMA 1Q5WB 2AL6A 4LJPB 2LRUA 1M94A 4BOZB 1UD7A 3PHWB 1V81A 4MGIE 1UZXB 5TR5A 4AJYB 5LXIB 1SE9A 2GMIC 1UH6A 2KWCA 2MBEA 2CKHB 3WAMA 4FADA 4IM0A 3PGEA 3ML9A 2NR2A 1R4NI 2EKEC 3EECA 3M63B 5LXHA 3N30A 2KWVB 5J18A 3C0RB 1WH3A 4MGYE 3PV1A 2KFJA 3KUCB 4WAAA 2D11A 2JUOA 4II2B 1KJTA 1U4AA 2O6VB 1WM2A 5D6JB 2DAFA 4HCPB 2ZVNA 5KHQA 3A9KB 3QJZA 3L13A 5DPRA 3WANA 2FIDA 1J19A 3ZTCA 3ZVVA 2K8BA 4NJ6A 3UF8A 2WX0A 3PTFC 3VUWA 2J0JA 1Z2MA 2MBHA 3IHPC 3T8MA 1LQBA 4DHJD 2BF8B 5KHOA 2ASQA 4NAWA 2O2VB 2OOBB 4DHZE 2JVCA 2RD0A 2KDBA 3OJ3A 2MP2B 1HE8A 2GOWA 4FHKA 3RZFA 2M0XA 3V62A 2WYQA 3ZO5B 4EFOA 1TGZB 4FHJA 4WJQA 2AEHA 2R2OA 1G6JA 3X0WA 5AZHA 3OJ4B 3VDZA 1MG8A 5JH5C 2NBWB 2MA9B 1SGHA 2L76A 3A4SC 1GJZA 1J0GA 3HM6X 2R2QA 2KQSA 3KUZA 2A4ZA 1Q0WB 3N32A 2DZJA 2DYOA 3V6EB 5JZEB 1F9JA 1V5TA 4PYUA 4KVGB 1YIWA 2N1VA 2ZPNA 4W9KA 4WWPA 3VFKA 3ZKJC 2ZNVC 4ICVA 1UGMA 1ZW7A 2PEAA 2MW5A 3PRPB 2NVUI 4KSLC 4FA6A 2EMSA 4A3OA 2LXCA 4EEWA 2GBNA 1WXMA 3O65B 4MDKE 2KQ7A 3QARA 3ZLZA 1YJ1A 5JHAA 1FXTB 4ZRIA 2KTFA 2M17A 2NPTB 1EUVB 1P0RA 3M95A 2FAZA 2JZZA 3SHQA 1WXSA 3K9OB 4KIKA 4PYZA 5EDSA 2JWZA 3A1QB 1Y8RC 1LXDA 3WAPA 4LCDE 1WM3A 4EZJA 2HD5B 3ENEA 3A9KA 5D2MB 2Z59B 3SDLC 2LGXA 3VH4B 2Y5BB 4F1SA 1H4RA 1X1MA 4MJSA 1E7UA 3CSTA 2FCMA 2KD0A 1WF9A 3NZUA 3R7RA 1KLVA 2ZNVB 2K1FA 1WMHA 1K8RB 4BOSC 4HPLB 1V2YA 4E71A 2N7EA 1WY8A 4KZ0A 4NNJB 2L00B 3VTUA 3RULA 3ZNZB 3W1YA 3PPAA 4BBNC 4ANVA 1WYWB 2CHWA 2IO3B 4MGKE 3RZWC 2M4NA 4J6IA 4BBNF 5G2NA 1WIAA 2ZPYA 4IM3A 5AEKB 4M8NA 2IY0B 3M3JA 1WZ0A 5DPWA 3B1LX 2B3AA 3QCAA 3QA8A 2GBRA 3IG3A 2MRPA 2LWPA 3VTWA 3JVZX 3X23A 2KN5A 4B6WA 3KH0A 4K7SA 2C9WB 2YVCA 4WWNA 2PPHA 4B9KA 2O6VD 2BWES 4I6NB 1XD3B 4KDIC 3VQIA 4IWOA 1VD2A 3VAWA 3V6CB 4TV3A 3KW5B 4MH0E 5GMVA 2M1MA 2LVPA 1P3QU 1E7VA 2DENB 2LRWA 1Q1OA 3UQBA 2NBVB 5HKHA 5E6PA 2BKRB 5CHWA 4JGHB 4IW0A 4IWPA 2KVRA 3GZNI 4JQWC 5DPSA 4GDKA 4YL8A 1YD8U 1WE6A 1L7YA 4KZCA 3VH3B 2LASA 3QK0A 2W9NA 3TMPB 3A9JB 2UYZB 2HE7A 3H7PB 2RPQA 2JRIB 2XK5B 4K7WA 1P1AA 4NPNA 2LD9A 1V49A 3A4RA 4MEMA 3V61A 2CHZA 1WR1A 2K25A 4NQKE 4BKGA 1WX7A 3DOWA 4HCNB 4DWFA 2N9XA 3K9PB 2MWSB 2N7DA 1E8YA 4LDTB 4W9FA 4RMAA 3PRZA 2K6QA 2RR9A 4CYEA 2JPHA 4AOFA 2MSED 2G4DB 2IZVB 3RD2A 2KOXA 3PSEB 1TBEA 1WE7A 2LGDA 2BYVE 2I1KA 4ICUA 5J17A 2KTRB 2XEWA 3L54A 3LDZE 3PZDA 1WZ3A 1WX8A 1OQYA 3RUIB 4KV2A 1XT9B 2KX0A 3VHTC 1I35A 1R4MI 1WJ6A 1E90A 3EHVA 2FCNA 3DDCB 2IO0B 3T9LA 4KIKB 1QZEA 3W1SA 4PS7A 2DZMA 4W9DA 3WA0A 3DVGY 3ZTDA 4W9CA 4ZRKA 3W1SC 3UGBB 4DDGD 1V80A 4FJYA 2XBBC 1P9DU 2HJ8A 2KDFB 3HM3A 2IO1B 3CSFA 4EKUA 2DZIA 3APFA 1V5OA 4AUQC 2KJRA 4RM9A 4MJSB 2KFKA 2RSUA 2VRRB 3OAWA 4ANXA 3JYUA 4WJNA 3QX1A 2GBMA 2NBUA 3CMMB 3BINA 2KK8A 4DDID 2RGFA 4HPMB 3APDA 2WX1A 2NCNA 3ZDTA 2V4LA 4I6LB 2HTHA 2OJRA 3TCAA 1RAXA 2KNBA 5G55A 3ZW3A 3L0WB 3L17A 2CHXA 4FBJB 4X57B 2MP2A 4W9GA 3UIOB 2N4FA 2PJHA 1BT0A 3IBEA 3QQ8B 2BGFA 4NY0A 2M8SA 1Z5SB 5CTRC 3RYTA 2AL3A 2AWTA 3NOBA 5D94A 5BO4B 4ZDVA 4K1RB 2DYBA 5DPTA 3TBLD 2C60A 2L3ZA 3CF6E 1VCBA 2JRHA 2KDEB 4JIOU 3KUDB 5DCNA 4G50A 5C1ZA 3VXWA 4JLCA 3H1UA 3HHMA 4HXDA 5E6NA 1WGGA 3PRMB 3MJWA 2ZJDA 4F8CB 2O6VA 4II3B 2J0MA 4DXAB 2AYOB 2L7RA 5CHFA 2WWZA 1JRUA 2FCSA 1D3ZA 3L08A 2REXA 1TZ1A 4I6PA 4HVBA 3LJ3A 3PLVA 2PE9A 2JZ3B 1NBFC 2NPTA 1WX9A 3H6NA 4TUUA 2JXXA 1OGWA 4NAWB 4G0NB 1WGRA 4E74A 4W9HA 3VTVA 2MBOA 5AZGA 2KO3A 1NI2A 2KJ6A 2KLCA 4HK2A 4WQOB 3PT2B 3A1QA 2DYMA 3AI5A 3QHTA 4FN2A 4DHJB 2K8HA 4EUTA 1EF1A 3ZNGC 2D2QA 2UWQA 1WJNA 2KHWB 1PQSA 4N9F4 1GC7A 3JW0X 1TTNA 4W9EA 5LLIA 2I1JA 4EZKA 2ZZPB 4PS3A 4KDLB 3U8ZA 1GNUA 3ECIA 1GUAB 3ML8A 4P7IA 3IVFA 4IC7B 2KX3A 2C7NB 2V1YA 1WI0A 1CMXB 4B95A 4GDLA 4AJWA 2FIFA 1AARA 3ZRCA 2LUEA 3A9JA 2MQJA 4KSKC 2O2VA 4M8MA 1WXVA 4MSQB 5C23A 4FULA 3UQAA 2ZCCA 4XX5A 1OEYJ 3P2BA 1WR6E 3R3MA 1EO6A 3N3KB 3M62B 3GOEA 3JSVB 3NZSA 4JL9A 4HDQA 3Q3JA 4OVUA 3SD5A 1E8ZA 1KOTA 3ZRFA 2KJHB 3AU4A 2LXAA 4URKA 1IYFA 4WJOA 2LVQA 3ALBA 4ZRJA 5AZFA 3U7DA 3WAOA 4BKSD 4BFRA 2LZ6A 1LM8B 2KMAA 3WALA 4GOCA 3A33B 4WWOA 2K6DB 2KTRA 4AP4C 3DVGX 2IO2B 4TKNA 1E8XA 4IUMB 3SU8X 2A5UA 2FUHB 2LI5A 4EZLA 5IA7A 2MBBB 2DZKA 2QHOA 4FJVB 4MELA 3ZDMC 3TL5A 2C7MB 1WFYA 1J8CA 2D3GA 4MM3A 2C7HA 1RRBA 1IPGA 2KZRA 4GN1A 4HJKA 4ASWC 3B0AA 5L95C 2DX5B 4BKTA 4HWIB 1WGYA 4DK5A 4W9LA 2CU1A 3VVWB 4WJPA 2KKCA 4W9IA 1WMHB 1NDDA 4TQ0A 1I42A 2YLMA 4GU2A 3BY4B 2DAJA 2N9PC 1RFAA 4W9JA 3DVNU 2LVOA 1UELA 5L83A 3QC8B 3QIJA 2L8JA 2N9EB 3KYDD 4GMVA 3U30A 1GC6A 1XQQA 4GGQA 1E5WA 2EMTA 3DBRI 4K81A 2KMCA 4G3XB 1YX6B 2J7QB 3Q3FA 3L10B 2MLBA 5FR6A 4GSWA 1V86A 2ZEQA 2L05A 3RT3B 3VUYA 3WIMA 3KYCD 5D7GA 1L2NA 2BYEA 2PE6B 1SIFA 2BKFA 1P98A 4PS8A 1C3TA 2GBKA 1WGDA 4A3PA 2D10A 1WJ4A 4XC2A 4TQ1A 2KDIA 3B08A 2FCQA 4G11A 4CO7A 2V3SA 3AXCA 2FNJB 1WXAA 3H7PA 3L16A 4GXBA 4HLEA 1GG3A 4MGZE 3DQVA 3DBLI 2J0KA 4FLHA 3R66C 3UINB 1WGHA 2KFKB 3NS8A 2KXJA 3AULA 3NY5A 1LFDA 2CR5A 4GDKB 3EC8A 2K8CA 3IFWB 5CX3A 2D07B 2Z0EB 2MX2A 2KLGA 2KC1A 4NJ7A 3PVLA 2DHZA 1V9JA 1YX5B 2G45B 4ZYNA 1RLFA 4F7ZA 2L0TA 2MCNB 2LJ5A 4GIVA 1KM7A 4RM8A 2XK5A 3QWZB 1A5RA 3S2AA 4MSMB 4BVUC 3PS6A 3ZNHB 1T0YA 4ANUA 1IP9A 3PREA 4AWJA 1EF5A 5J2RA 2CS4A 2BYFA 1WRDB 2MBQA 3DPDA 2JF5A 4A20A 5JHBA 1C1YB 3H9DA 2N1WA 4IWQA 4M0WB 1UBQA 3ZNID 1V6EA 2KWUB 2IY1B 3KVFB 2KC2A 3TIXA 3EFUA 3OLMD 2WDTB 4DBGA 1YQBA 4FJZA 1ISNA 4EOYA 3H7SA 4IM2A 2G4SA 4GDLB 4DHZB 3PHXB 1OEYA 4HDOA 4XZ4A 1ZGUB
chains in the Genus database with same CATH superfamily
2Z0DB 4BKSA 1SE2A 5BYRA 1FIQA 1OQQA 2R61A 3JSVA 2WXQA 4A55A 3APCA 3I3TB 2LGYA 2J42A 1OTRB 4XWWA 3UIPB 1JW9D 3DVNV 4LDTD 3NHEB 2E3TA 1BUIC 2RMMA 3PHWB 3NVWA 4MGIE 1UZXB 2GMIC 1UH6A 2MJDA 1XCQL 2CKHB 3WAMA 1D5ZC 1MFWA 4BZAA 3NRZA 2BTEA 2EKEC 3M63B 4Q2JA 2CJNA 2H89B 4MGYE 1YMHE 4WAAA 2JUOA 1KJTA 1JRPA 5D6JB 3NZ3A 1MG4A 2HJ1A 3QJZA 4JPSA 5DPRA 2NTSA 2FIDA 3ZVVA 1FEHA 2WDQB 1DOYA 2J0JA 1UWMA 2ASQA 2O2VB 2OOBB 2JVCA 2MP2B 2GOWA 3ZO5B 3V62A 1JWBD 1TGZB 4FHJA 1G6JA 5C3JB 3L4PA 3OJ4B 3W5VB 2JU6X 2L76A 3HM6X 4REZA 2R2QA 2CU3A 2K5PA 5G5GA 5JZEB 1FRDA 1YIWA 2N1VA 4PK1A 1XLOA 4KSLC 1VLBA 2PEAA 1BMLC 4ZRPA 4YWGG 3P63A 2GBNA 1WXMA 1IBXB 3H8HA 1ET6A 4YSYB 4ZRIA 2KTFA 2M17A 1P0RA 3M95A 2JZZA 4US8A 3WAPA 1WM3A 1ZDVA 1K51A 3A9KA 4LNFA 1H4RA 5GXGB 4MJSA 3RNEC 3CSTA 1B1ZA 2FCMA 3NZUA 1RM6C 2ZNVB 1K8RB 3URYA 4BOSC 1V2YA 3LYYA 4KZ0A 4NNJB 3C19A 4ZHPA 2LHDA 3AE8B 2JYTA 5E6JA 3RZWC 4D2KA 4KGTA 4M8NA 1ZUD2 1TIFA 3B1LX 3QCAA 1V1OA 2KN5A 3Q8AA 2VH2A 4WWNA 4B9KA 4KDIC 1VD2A 4TV3A 4MH0E 2M1MA 2LVPA 1E7VA 4H2AA 4NAMA 1DYQA 5IP4D 2BKRB 1ZE3D 3EUB2 5D3IB 1YD8U 4MM3B 3VH3B 2W3RA 4OW0A 3RNFC 1XO3A 3LB8C 3V61A 5IOIA 3N1ZC 3NVYA 4BKGA 4DWFA 3K9PB 4LDTB 4W9FA 2ONQA 4USAA 4HJGE 3RD2A 3R2TA 3PSEB 1ZXHA 1SBBB 2LGDA 3LDZE 3PZDA 4ARCA 1MHHE 3I9V1 1XT9B 3VHTC 1I35A 1WJ6A 3EHVA 2OHFA 3TEZA 2IO0B 4XDDA 1QZEA 4PS7A 3ZTDA 3DVGY 2KT7A 3W1SC 1V80A 2LJIA 5AUIA 3NS1A 4WIPA 3CSFA 3BVGA 1V5OA 2KFKA 2RSUA 2BW2A 3TEWA 3V3XA 1YOVB 3QX1A 3CMMB 4HPMB 2BB5A 3ZDTA 3ZXVA 2IGGA 2OEDA 3TCAA 1RAXA 1L4DB 2QDFA 3AEFB 2MP2A 1ENFA 2V0GA 2PJHA 1BT0A 4NY0A 5BO4B 4DXFA 1HXYD 2DYBA 5DPTA 3TBLD 5DCNA 1TZOA 1VCBA 2JRHA 5C1ZA 4JIOU 3KUDB 1ZDXA 5E6NA 2DBYA 2BBCA 1WXQA 5CHFA 1JRUA 2REXA 1TZ1A 3BYTB 4HVBA 2PE9A 2JZ3B 3H6NA 2JXXA 1OGWA 4G0NB 4J3OD 3VTVA 2WXIA 2MBOA 4K3BA 5AZGA 1I4PA 4WQMA 3QHTA 2DYMA 3AI5A 4OZCA 2D2QA 1HTOA 4N9F4 3JW0X 2DNFA 1TTNA 2WGSA 2I1JA 4EZKA 1YJJA 2BQQA 3P4PB 3AB5A 4XYCA 1WI0A 4UDUC 1L0VB 4GDLA 4P16A 1J7CA 1AARA 4TMAB 2LUEA 4MSQB 3W9CB 2MJ3A 3P2BA 2WLBA 1D6EC 1QF6A 1EO6A 1C76A 4HDQA 1E8ZA 1YN3A 1I4QA 2AQ3B 2KJHB 4HEA1 5EE9A 2LVQA 3WAOA 1LM8B 1FFUA 4GOCA 3GZNB 2K6DB 1VJKA 1PGBA 4AP4C 3FILA 1E8XA 3SU8X 2FUHB 2LI5A 1HZ6A 4EZLA 2MBBB 2DZKA 2WQYB 2C7MB 2D3GA 4MM3A 1WGKA 3GB1A 2KZRA 4GN1A 4ASWC 2UU7A 3MC9A 2ZW0A 3AH7A 1AYFA 4WJPA 4W9IA 1WMHB 3MP9A 2DAJA 2N9PC 4W9JA 4JX1C 1VZ8A 3QIJA 1UGJA 1WRIA 2L8JA 4GMVA 2SEBD 1TS4A 3AN1A 2KMCA 4G3XB 3MJ5A 5FR6A 1V86A 2ZEQA 3WIMA 5D7GA 4PS8A 2KQ4X 2V3NA 4TQ1A 2FCQA 3BVMA 2FNJB 3L16A 2L32A 3DBLI 3UINB 3RI7C 3NS8A 3DBLB 2KXJA 3VR9B 1IGDA 3IFWB 2K8CA 1QLBB 1L0XB 1YX5B 1JWSD 4B0MA 4F7ZA 2L0TA 2MCNB 1KM7A 5H92C 1A5RA 4BVUC 4A90A 3PS6A 3FC4A 1T0YA 1DOXA 4AWJA 2GI9A 5G5HA 2MBQA 3H9DA 2N1WA 1UBQA 2K3UA 3ZNID 2KWUB 3OLMD 1N6ZA 3AE1B 1ISNA 1EU4A 3H7SA 1HEZE 4IM2A 2G4SA 4GDLB 4JWUC 3AEBB 2PMVA 1Y8RC 3V60A 3DBHI 1C77A 1C9FA 2C5LC 4DQOC 2L0FA 3PLUA 4OZAA 5EE0A 3D32A 3VUXA 4K3CA 2JQRB 2IYDB 1TS2A 4LJOB 3R7QA 1S1QB 2EELA 2G3QB 4OVVA 4RGOS 2WXRA 4IOIE 2ZCBA 2QIEB 1Q5WB 1ROEA 4LJPB 4EE2A 2LUMA 5TR5A 4AJYB 2W55A 1SE9A 4FADA 1KLGD 4IM0A 2KWDA 5BMGA 2GLSA 3AEEB 1MHXA 3C0RB 1E10A 1WH3A 1TYGB 3KUCB 4II2B 2BS2B 2SAKA 2O6VB 2N0SB 1SSNA 2ZVNA 2VH1A 1MPEA 3WANA 1J19A 2L1AA 2WX0A 3VUWA 3T8MA 2QC8A 2BF8B 5KHOA 1C78A 3OJ3A 3DHIC 3O13A 4WJQA 2R2OA 5HG2A 3RMKC 3VDZA 5FR3A 1MG8A 5JH5C 2MA9B 2PW9A 3AM9A 2KQSA 1Q0WB 2DZJA 4KVGB 2MW5A 4EEWA 2V4IB 1YN4A 2M19A 5JHAA 1FM0D 1FXTB 2NPTB 2FAZA 1QOBA 4PYZA 4C4VA 3W2DA 5EDSA 1FD6A 3P4QB 3ENEA 3FILB 1X1MA 2KD0A 1F2RI 3R7RA 1V1PA 1L6UA 3MHZA 2L00B 1JQ4A 3VTUA 3RULA 3ZNZB 4P1BC 1OQRA 1QOAA 4YTMB 3PPAA 1WYWB 2W54A 3HRDD 1WIAA 2WXNA 3M3JA 1WZ0A 5DPWA 2WXLA 3MC0B 3TEYA 3X23A 3JVZX 4P1CC 1D4BA 4K7SA 1E9MA 2YVCA 1NI3A 2PPHA 3I57A 4I6NB 3VQIA 3V6CB 1DOIA 5GMVA 2BT6A 1Q1OA 4OVZA 1YQ4B 5E6PA 3B9JA 2LHEA 3TEXA 3GZNI 3BZDB 3GE8C 3QK0A 2W9NA 3TMPB 3RNGC 3A9JB 2UYZB 2XK5B 3BIID 1P1AA 4NPNA 2IGHA 4MEMA 3ZYYX 2ON8A 2K25A 4NQKE 3P4RB 2D3CA 2MWSB 1T5XD 2JX5A 1QOGA 2K6QA 3VRBB 2RR9A 1XXGA 2MSED 2G4DB 2IZVB 1IUEA 1WE7A 4ICUA 5J17A 2KTRB 3L54A 3Q8EA 3RUIB 4KV2A 4YSZB 1E90A 3T9LA 3DDCB 3W1SA 4W9DA 2PKOA 4ZRKA 1TS3A 4DDGD 2W3SA 4FJYA 2XBBC 3HM3A 2IO1B 4EKUA 2DZIA 1RYJA 2KJRA 4RM9A 2GB1A 1L0YB 4TSSA 4LNIA 1SIJA 2GBMA 4US9A 3ZJVA 2NCNA 2V4LA 1SE3A 1XLQA 2HTHA 2OJRA 1FXIA 5G55A 3ZW3A 4FBJB 2PLPA 4YT0B 2NMQA 3Q8CA 3QQ8B 3B2GA 1JWMD 4ACFA 2M8SA 1Z5SB 5CTRC 2AWTA 2W82A 1JWUD 2L52A 3HVDA 3HHMA 3MC8A 1D5XC 3PRMB 1L5PA 2WDVB 5LNK1 2WWZA 3L08A 2CJOA 3PLVA 1NBFC 2JSVX 2D3BA 4TUUA 3ABVB 5HI1A 4C00A 3KWLA 3AE6B 2KJ6A 5IKCM 4DHJB 4FN2A 2K8HA 4MT5A 1FCCC 1WJNA 1PQSA 2MEKA 4W9EA 3N1YC 3U8ZA 3ECIA 3IVFA 1CZPA 2KX3A 3Q3NC 4L23A 1CMXB 1FRRA 3A9JA 5MPOA 1OEYJ 2X8XX 4C7ZA 3M62B 3NZSA 2IJ0A 3U7ZA 1E7PB 1KOTA 3DBHB 3AU4A 4URKA 3R8BA 2Y3AA 1D5MC 4WJOA 1CQVA 4ZRJA 1JROA 1CJEA 5AZFA 1ET9A 2RDGA 1WYGA 1GAQB 1XLNA 2KTRA 2IO2B 2A5UA 2D3AA 4XWTA 5IA7A 2QHOA 4BAXA 1J8CA 4WH4A 1WFYA 1IPGA 5L95C 4BKTA 1R7SA 2CU1A 2KKCA 1I42A 3BY4B 1RFAA 3DVNU 1I7HA 5L83A 1VDVA 4LNKA 1KTKA 4RCOA 1UF0A 4L1BA 3P4SB 1YX6B 1R4MB 2J7QB 4GSWA 4ITKA 4KKJA 1L2NA 2PE6B 2BKFA 4A3PA 4LNOA 1WJ4A 4YSXB 3B08A 4G11A 1A70A 2Y5CA 4CO7A 3DHHC 1WXAA 3H7PA 4M02A 4GXBA 1FCLA 2AX5A 1GG3A 4HKZE 3AE9B 2J0KA 2HDEA 5TSSA 4GDKB 2Z0EB 1T6BX 1FXAA 1F2RC 3AE2B 4ANUA 2PIAA 1EF5A 1WRDB 4M0WB 3GS2A 2JYEA 2KC2A 3AMZA 3TIXA 3BK2A 4A8XC 1F77A 1YQBA 3DWMA 3PHXB 2UWQA 4HDOA 4XZ4A 1SF0A 3I63C 2JXTA 1UWXA 2BS3B 3DCGA 4IG7B 3RCZA 3DBSA 3ZJUA 4CHKA 3ONSA 1SEBD 2WXFA 2WS3B 1S3SG 1TY2A 1E8WA 4QAYA 1KRHA 1UBIA 1XCTL 2IBIB 1ZXIA 3MHSD 3HK0A 1XF5L 2H88B 3AEAB 3ZUNA 4E3CA 4LLGM 2AL6A 4BOZB 3NG0A 1KFYB 1V81A 3CWIA 1GOZA 1ZPSA 2KWCA 2MBEA 5T8IA 3ZQ4A 3KLSX 3PGEA 2WXKA 2WU5B 1FMAD 2XNAC 3KWVA 1WSPA 4A6QA 1U4AA 3BYYB 2DAFA 1I4HA 5KHQA 3A9KB 1UUPA 3ZTCA 3PO0A 2K8BA 1V8CA 3UF8A 2WXGA 2BYTA 3P42A 1FPYA 4DHZE 4NAWA 2LEKA 3GE3C 2RD0A 4P6VF 3TSSA 4FHKA 3RZFA 2M0XA 2WYQA 1YNTE 4N58A 1MJDA 2AEHA 3X0WA 1QKZA 3Q3MC 5AZHA 2I2YA 1SGHA 3A4SC 1GJZA 3I5JC 3N32A 1SJHD 4HRSA 2WXOA 1V5TA 4W9KA 3W5UB 4ICVA 4FA6A 2NVUI 2EMSA 3RNCC 1ZP0B 4A3OA 2LXCA 4MDKE 2B76B 2KQ7A 3IXSA 3ZLZA 3FKYA 3EA6A 3SHQA 1WXSA 4KIKA 3IT6B 2AQ2B 3A1QB 1LXDA 4O1NA 4EZJA 2HD5B 4YTNB 2Z59B 3VRAB 5H8YE 2Y5BB 3U52E 1WF9A 3N1XC 1KLVA 2K1FA 1WMHA 3Q8BA 4HPLB 1WY8A 3J9CA 1C4AA 1MI0A 2M56B 4BBNC 4ANVA 2IO3B 1NYRA 4HROA 4A9AA 2M4NA 4NJCA 2WXMA 4IM3A 2J52A 2B3AA 5BMHA 3QA8A 2GBRA 3VTWA 2LWPA 3KH0A 4C7YA 4R3DA 2O6VD 1XD3B 4N59A 5HHDG 3KW5B 1JWAD 2BVCA 1P3QU 1T0SC 2DENB 5I4DA 2NBVB 2Q5WD 5CHWA 4JGHB 1GB1A 3AECB 1J7BA 4IW0A 3RPFC 4YL8A 1WE6A 3BK1A 4XDCA 2LASA 2HE7A 2RPQA 2JRIB 4K7WA 4M0WA 2LD9A 1V49A 2XN9C 1TKYA 2IDYA 4HCNB 1V1PB 3GP7A 4IKGA 2TSSA 1E8YA 1PYWD 2JPHA 4AOFA 4MH8A 2BYVE 1I4GA 1WZ3A 1PUTA 1NYQA 3IAS1 1R4MI 4KIKB 2DZMA 4W9CA 3UGBB 2WNMA 2G1EA 2KDFB 3NVZA 2KAJA 4AUQC 4MJSB 3OAWA 2OJWA 4WJNA 1AWDA 2KK8A 3ZXRA 3APDA 2WX1A 1EU3A 1P7EA 4I6LB 3L0WB 3L17A 2CHXA 3UIOB 2N4FA 3IBEA 1JMLA 2HTME 2BGFA 1FO4A 4WURA 4HKQA 2AL3A 4ZDVA 2RPVA 3KQ4A 5AUKA 2L3ZA 2KDEB 2D5GA 4G50A 2E6XA 1M4VA 3H1UA 3Q3OC 1WGGA 1F1HA 3MJWA 2ZJDA 4F8CB 2O6VA 2J0MA 1YN5A 2J53A 5BYQA 2FCSA 1IBXA 1KF6B 2N9LA 4FXCA 4WWMA 2VZKB 3E9SA 2NPTA 1WX9A 4E74A 4W9HA 1NI2A 2KLCA 4HK2A 5LLIA 5C2TB 1RWSA 3ML8A 4P7IA 4IC7B 2V1YA 1PGAA 4AJWA 3OWEB 2FIFA 3ZRCA 4KSKC 4M8MA 1WXVA 4FULA 3UQAA 4RH6A 3DHGC 1WR6E 3R3MA 3N3KB 4C56C 3JSVB 4JL9A 3Q3JA 4OVUA 4LK0M 1EM7A 1N63A 1ESFA 2KN4A 2PTLA 1IYFA 2LXAA 2BB6A 4BFRA 2YEPF 2LZ6A 3WALA 3A33B 3PZ7A 1QOFA 5BYSA 3ZGZA 3MFGA 1VR9A 2MJEA 4FJVB 4MELA 3ZDMC 2C7HA 1RRBA 4HJKA 3U4EG 1WGYA 5EE3A 3Q2AC 4TQ0A 1PGXA 3SR6A 4AQ7A 2YLMA 2FUG1 1UELA 3QC8B 1OFFA 4RGMA 3KYDD 1Q10A 1GC6A 1XQQA 1SXTA 1E5WA 2EMTA 1PFDA 3DBRI 1K53A 5FKAC 3Q3FA 3L10B 2MLBA 2PVGC 2L05A 1EWYC 3VUYA 2BYEA 2JZPA 1P98A 1T0QC 1C3TA 1WGDA 2WP9B 1L4ZB 4XC2A 1F0ZA 2V3SA 2DLBA 3AXCA 4HLEA 4MACA 3T3NA 4FLHA 1TY0A 1WGHA 1LFDA 2CR5A 5CX3A 2KLGA 2KC1A 2ACZB 3PVLA 2DHZA 2LFIA 2K9XA 1LGRA 1R4NB 4GIVA 1I4RA 2XK5A 2WXHA 3ZNHB 3BVZA 1IP9A 2KMMA 4YTPB 2CS4A 2BYFA 3DPDA 1YJIA 2JF5A 2N9KA 4ZOHC 1AW7A 4IWQA 2WXPA 1N5XA 2WXJA 4DBGA 4ARIA 4EOYA 1ZOYB 1TKEA 4DHZB 1OEYA 3AE7B 5IAAC 3HIZA 4K7UA 2KANA 2QSDA 1WJUA 2IGDA 2ZVOA 4ANWA 1HA5A 3MTNB 2K39A 4NQLB 2INPE 3TJPA 3BWUD 2BPSA 2KACA 5CHVC 3QAQA 3NVVA 1IGCA 1ZKHA 4LTUA 2JY6A 3AU5A 5E6OA 2BWFA 4GB9A 3SFEB 2GBJA 1DGJA 1H8CA 2JT4B 4JWSC 2NS5A 3ZIMA 2L83A 3AV8A 2LRUA 1M94A 1UD7A 1HQRD 2YEPB 3PZ8A 2V9HA 5LXIB 1N5WA 3RNAC 1KH0A 2LGSA 3AE5B 3ML9A 2NR2A 3T3OA 1R4NI 3EECA 5LXHA 3N30A 2I38A 4ZYSA 2KWVB 1N60A 2KYWA 4C80A 3PV1A 2KFJA 2D11A 1WM2A 2RDHA 1GB4A 4HCPB 2Z8LA 3L13A 2IPKD 4KX6B 4NJ6A 3PTFC 2MBHA 1Z2MA 3IHPC 1LQBA 4DHJD 1C79A 1TJEA 3RFZB 1TS5A 2KDBA 5J18A 1HE8A 4EFOA 1QQRA 2KDMA 3V05A 2NBWB 4LNNA 1JCKB 1J0GA 4RF1A 3KUZA 2A4ZA 1NVID 2DYOA 4IDIA 3V6EB 1F9JA 4PYUA 3VFKA 1I4XA 2ZPNA 2X38A 4WWPA 3ZKJC 2ZNVC 2INCC 1UGMA 1ZW7A 3PRPB 4RF0A 4N6EB 3O65B 3QARA 2PVOD 1WWTA 1YJ1A 3ZJTA 2ZW1A 1C4PA 2BS4B 1EUVB 2MHJA 2QJLA 2KVZA 3K9OB 3E56A 1B9RA 2JWZA 4LCDE 3R2IA 3VH4B 5D2MB 1BXTA 3SDLC 2LGXA 4F1SA 3AEGB 1E7UA 4DXGA 5D3DA 4E71A 2N7EA 1XEEA 1K50A 3W1YA 5IO9A 2CHWA 4MGKE 1Y56A 2MH7A 4J6IA 4BBNF 5G2NA 3RNBC 2ZPYA 1SB3C 5AEKB 2IY0B 3IAM1 4OZBA 5EE1A 3IG3A 2MRPA 2AQ1B 4B6WA 2ICIA 3EFCA 4WAFA 2C9WB 1T0RC 3Q6BA 4S17A 3DWGC 4HPPA 2BWES 4IWOA 3VAWA 4NZLB 5HFYA 1VZ6A 3UQBA 2LRWA 3CIRB 5HKHA 3ETRA 1HZ5A 1NENB 3FAHA 1YQ3B 4IWPA 2KVRA 4JQWC 5DPSA 4GDKA 3RN9C 1L7YA 4KZCA 1CK1A 4KGRA 3H7PB 3A4RA 2CHZA 1WR1A 4RGTA 1WX7A 4OHJA 3DOWA 1STEA 2N9XA 2N7DA 2FE8A 4RMAA 3PRZA 4CYEA 2KOXA 1TBEA 2QMTA 2I1KA 2XEWA 2WHIA 1WX8A 1OQYA 2K22A 2KX0A 4RFBA 2FCNA 1V97A 3WA0A 2QCZA 1J7AA 1F52A 3P1MA 1P9DU 2HJ8A 1HTQA 3APFA 3OG5A 2VRRB 4ANXA 3JYUA 5FK9C 3WCQA 2LGIA 2NBUA 1C4CA 3NUHB 3BINA 1GPXA 4DDID 2RGFA 3HVZA 2V3PA 2KNBA 1FNVA 4X57B 1QT9A 4W9GA 3AE4B 5BMIA 4XE0A 1FFVA 1K52A 3RYTA 2Y5PA 3B2FA 3NOBA 5D94A 1KLUD 4K1RB 2C60A 3VXWA 3CF6E 3SFDB 3U2SC 4JLCA 4HXDA 1N62A 1T3QA 4II3B 1EWCA 4DXAB 2AYOB 4YXDB 2L7RA 1D3ZA 1FNWA 1SJED 4I6PA 3LJ3A 4ZRQA 4NAWB 1WGRA 2JWUA 2KO3A 4WQOB 3Q69A 3PT2B 3A1QA 4EUTA 1EF1A 3ZNGC 2KHWB 1GC7A 2ZZPB 4PS3A 4KDLB 1P7FA 1GNUA 1GUAB 2C7NB 4B95A 2MQJA 2O2VA 5C23A 2ZCCA 4XX5A 1MVKA 3GOEA 1ACCA 1N61A 1SE4A 3SD5A 2VZKD 3ZRFA 3LXFA 2J4XA 3SEBA 3AE3B 4CQNA 3ALBA 3IT4B 3U7DA 3UI3A 4BKSD 3AEDB 4KGSA 1TKGA 2KMAA 4WWOA 2N7JA 3DBRB 3DVGX 1VZ7A 1E6EB 4IUMB 4TKNA 1E0ZA 3VR8B 2GRIA 5IN7A 2RDBC 1UNSA 3TL5A 2INNE 4RNAA 3NJTA 3B0AA 1NEKB 2DX5B 2K0PA 2EKIA 4PT5A 1JALA 4HWIB 4DK5A 4W9LA 4C4VB 3VVWB 1XLPA 1NDDA 1TT5B 4GLSC 2WDRB 4GU2A 1VRAB 2LVOA 4S0RA 2G9HD 2N9EB 4RGNA 3U30A 4KKIA 1LO5D 1FNUA 3EGRA 4GGQA 4K81A 1QILA 3Q14C 2QILA 2QEJC 3RT3B 3KYCD 3N9YC 1SIFA 2GBKA 2D10A 2WU2B 3Q8FA 4M01A 2KDIA 2LMCA 4L2YA 4MGZE 3DQVA 4JE3B 1AN8A 3R66C 2KFKB 2NTTA 3N20C 3NY5A 2M0AA 3AULA 1L6VA 3EC8A 2D07B 2MX2A 5JXVA 4ZHOA 2INDC 4NJ7A 1V9JA 2G45B 4ZYNA 1RLFA 1PDXA 2LJ5A 4RM8A 3QWZB 4AS1A 3S2AA 4MSMB 4XGAB 3C8YA 3PREA 5J2RA 5JHBA 4A20A 1C1YB 4M00A 4B0EA 3TUOA 3HUIA 1RFKA 1V6EA 2IY1B 3KVFB 3EFUA 2WDTB 2FBWB 4FJZA 2DWQA 1ZGUB
chains in the Genus database with same CATH topology
5IAAC 3V60A 2Z0DB 3HIZA 4K7UA 3DBHI 2KANA 1WJUA 2C5LC 4BKSA 2ZVOA 4ANWA 3DCGA 4IG7B 3RCZA 3MTNB 2K39A 2L0FA 3DBSA 3PLUA 4NQLB 3TJPA 3JSVA 4CHKA 3ONSA 2BPSA 5CHVC 3QAQA 3D32A 3VUXA 2IYDB 3APCA 4LJOB 3I3TB 3R7QA 1S3SG 1ZKHA 2LGYA 1E8WA 1S1QB 1OTRB 2G3QB 2JY6A 3AU5A 1UBIA 5E6OA 3UIPB 2BWFA 4GB9A 4OVVA 2IBIB 3DVNV 2GBJA 4LDTD 3NHEB 1H8CA 3MHSD 2JT4B 3HK0A 2NS5A 4E3CA 3ZUNA 2ZCBA 3ZIMA 1Q5WB 2AL6A 4LJPB 2LRUA 1M94A 4BOZB 1UD7A 3PHWB 1V81A 4MGIE 1UZXB 5TR5A 4AJYB 5LXIB 1SE9A 2GMIC 1UH6A 2KWCA 2MBEA 2CKHB 3WAMA 4FADA 4IM0A 3PGEA 3ML9A 2NR2A 1R4NI 2EKEC 3EECA 3M63B 5LXHA 3N30A 2KWVB 5J18A 3C0RB 1WH3A 4MGYE 3PV1A 2KFJA 3KUCB 4WAAA 2D11A 2JUOA 4II2B 1KJTA 1U4AA 2O6VB 1WM2A 5D6JB 2DAFA 4HCPB 2ZVNA 5KHQA 3A9KB 3QJZA 3L13A 5DPRA 3WANA 2FIDA 1J19A 3ZTCA 3ZVVA 2K8BA 4NJ6A 3UF8A 2WX0A 3PTFC 3VUWA 2J0JA 1Z2MA 2MBHA 3IHPC 3T8MA 1LQBA 4DHJD 2BF8B 5KHOA 2ASQA 4NAWA 2O2VB 2OOBB 4DHZE 2JVCA 2RD0A 2KDBA 3OJ3A 2MP2B 1HE8A 2GOWA 4FHKA 3RZFA 2M0XA 3V62A 2WYQA 3ZO5B 4EFOA 1TGZB 4FHJA 4WJQA 2AEHA 2R2OA 1G6JA 3X0WA 5AZHA 3OJ4B 3VDZA 1MG8A 5JH5C 2NBWB 2MA9B 1SGHA 2L76A 3A4SC 1GJZA 1J0GA 3HM6X 2R2QA 2KQSA 3KUZA 2A4ZA 1Q0WB 3N32A 2DZJA 2DYOA 3V6EB 5JZEB 1F9JA 1V5TA 4PYUA 4KVGB 1YIWA 2N1VA 2ZPNA 4W9KA 4WWPA 3VFKA 3ZKJC 2ZNVC 4ICVA 1UGMA 1ZW7A 2PEAA 2MW5A 3PRPB 2NVUI 4KSLC 4FA6A 2EMSA 4A3OA 2LXCA 4EEWA 2GBNA 1WXMA 3O65B 4MDKE 2KQ7A 3QARA 3ZLZA 1YJ1A 5JHAA 1FXTB 4ZRIA 2KTFA 2M17A 2NPTB 1EUVB 1P0RA 3M95A 2FAZA 2JZZA 3SHQA 1WXSA 3K9OB 4KIKA 4PYZA 5EDSA 2JWZA 3A1QB 1Y8RC 1LXDA 3WAPA 4LCDE 1WM3A 4EZJA 2HD5B 3ENEA 3A9KA 5D2MB 2Z59B 3SDLC 2LGXA 3VH4B 2Y5BB 4F1SA 1H4RA 1X1MA 4MJSA 1E7UA 3CSTA 2FCMA 2KD0A 1WF9A 3NZUA 3R7RA 1KLVA 2ZNVB 2K1FA 1WMHA 1K8RB 4BOSC 4HPLB 1V2YA 4E71A 2N7EA 1WY8A 4KZ0A 4NNJB 2L00B 3VTUA 3RULA 3ZNZB 3W1YA 3PPAA 4BBNC 4ANVA 1WYWB 2CHWA 2IO3B 4MGKE 3RZWC 2M4NA 4J6IA 4BBNF 5G2NA 1WIAA 2ZPYA 4IM3A 5AEKB 4M8NA 2IY0B 3M3JA 1WZ0A 5DPWA 3B1LX 2B3AA 3QCAA 3QA8A 2GBRA 3IG3A 2MRPA 2LWPA 3VTWA 3JVZX 3X23A 2KN5A 4B6WA 3KH0A 4K7SA 2C9WB 2YVCA 4WWNA 2PPHA 4B9KA 2O6VD 2BWES 4I6NB 1XD3B 4KDIC 3VQIA 4IWOA 1VD2A 3VAWA 3V6CB 4TV3A 3KW5B 4MH0E 5GMVA 2M1MA 2LVPA 1P3QU 1E7VA 2DENB 2LRWA 1Q1OA 3UQBA 2NBVB 5HKHA 5E6PA 2BKRB 5CHWA 4JGHB 4IW0A 4IWPA 2KVRA 3GZNI 4JQWC 5DPSA 4GDKA 4YL8A 1YD8U 1WE6A 1L7YA 4KZCA 3VH3B 2LASA 3QK0A 2W9NA 3TMPB 3A9JB 2UYZB 2HE7A 3H7PB 2RPQA 2JRIB 2XK5B 4K7WA 1P1AA 4NPNA 2LD9A 1V49A 3A4RA 4MEMA 3V61A 2CHZA 1WR1A 2K25A 4NQKE 4BKGA 1WX7A 3DOWA 4HCNB 4DWFA 2N9XA 3K9PB 2MWSB 2N7DA 1E8YA 4LDTB 4W9FA 4RMAA 3PRZA 2K6QA 2RR9A 4CYEA 2JPHA 4AOFA 2MSED 2G4DB 2IZVB 3RD2A 2KOXA 3PSEB 1TBEA 1WE7A 2LGDA 2BYVE 2I1KA 4ICUA 5J17A 2KTRB 2XEWA 3L54A 3LDZE 3PZDA 1WZ3A 1WX8A 1OQYA 3RUIB 4KV2A 1XT9B 2KX0A 3VHTC 1I35A 1R4MI 1WJ6A 1E90A 3EHVA 2FCNA 3DDCB 2IO0B 3T9LA 4KIKB 1QZEA 3W1SA 4PS7A 2DZMA 4W9DA 3WA0A 3DVGY 3ZTDA 4W9CA 4ZRKA 3W1SC 3UGBB 4DDGD 1V80A 4FJYA 2XBBC 1P9DU 2HJ8A 2KDFB 3HM3A 2IO1B 3CSFA 4EKUA 2DZIA 3APFA 1V5OA 4AUQC 2KJRA 4RM9A 4MJSB 2KFKA 2RSUA 2VRRB 3OAWA 4ANXA 3JYUA 4WJNA 3QX1A 2GBMA 2NBUA 3CMMB 3BINA 2KK8A 4DDID 2RGFA 4HPMB 3APDA 2WX1A 2NCNA 3ZDTA 2V4LA 4I6LB 2HTHA 2OJRA 3TCAA 1RAXA 2KNBA 5G55A 3ZW3A 3L0WB 3L17A 2CHXA 4FBJB 4X57B 2MP2A 4W9GA 3UIOB 2N4FA 2PJHA 1BT0A 3IBEA 3QQ8B 2BGFA 4NY0A 2M8SA 1Z5SB 5CTRC 3RYTA 2AL3A 2AWTA 3NOBA 5D94A 5BO4B 4ZDVA 4K1RB 2DYBA 5DPTA 3TBLD 2C60A 2L3ZA 3CF6E 1VCBA 2JRHA 2KDEB 4JIOU 3KUDB 5DCNA 4G50A 5C1ZA 3VXWA 4JLCA 3H1UA 3HHMA 4HXDA 5E6NA 1WGGA 3PRMB 3MJWA 2ZJDA 4F8CB 2O6VA 4II3B 2J0MA 4DXAB 2AYOB 2L7RA 5CHFA 2WWZA 1JRUA 2FCSA 1D3ZA 3L08A 2REXA 1TZ1A 4I6PA 4HVBA 3LJ3A 3PLVA 2PE9A 2JZ3B 1NBFC 2NPTA 1WX9A 3H6NA 4TUUA 2JXXA 1OGWA 4NAWB 4G0NB 1WGRA 4E74A 4W9HA 3VTVA 2MBOA 5AZGA 2KO3A 1NI2A 2KJ6A 2KLCA 4HK2A 4WQOB 3PT2B 3A1QA 2DYMA 3AI5A 3QHTA 4FN2A 4DHJB 2K8HA 4EUTA 1EF1A 3ZNGC 2D2QA 2UWQA 1WJNA 2KHWB 1PQSA 4N9F4 1GC7A 3JW0X 1TTNA 4W9EA 5LLIA 2I1JA 4EZKA 2ZZPB 4PS3A 4KDLB 3U8ZA 1GNUA 3ECIA 1GUAB 3ML8A 4P7IA 3IVFA 4IC7B 2KX3A 2C7NB 2V1YA 1WI0A 1CMXB 4B95A 4GDLA 4AJWA 2FIFA 1AARA 3ZRCA 2LUEA 3A9JA 2MQJA 4KSKC 2O2VA 4M8MA 1WXVA 4MSQB 5C23A 4FULA 3UQAA 2ZCCA 4XX5A 1OEYJ 3P2BA 1WR6E 3R3MA 1EO6A 3N3KB 3M62B 3GOEA 3JSVB 3NZSA 4JL9A 4HDQA 3Q3JA 4OVUA 3SD5A 1E8ZA 1KOTA 3ZRFA 2KJHB 3AU4A 2LXAA 4URKA 1IYFA 4WJOA 2LVQA 3ALBA 4ZRJA 5AZFA 3U7DA 3WAOA 4BKSD 4BFRA 2LZ6A 1LM8B 2KMAA 3WALA 4GOCA 3A33B 4WWOA 2K6DB 2KTRA 4AP4C 3DVGX 2IO2B 4TKNA 1E8XA 4IUMB 3SU8X 2A5UA 2FUHB 2LI5A 4EZLA 5IA7A 2MBBB 2DZKA 2QHOA 4FJVB 4MELA 3ZDMC 3TL5A 2C7MB 1WFYA 1J8CA 2D3GA 4MM3A 2C7HA 1RRBA 1IPGA 2KZRA 4GN1A 4HJKA 4ASWC 3B0AA 5L95C 2DX5B 4BKTA 4HWIB 1WGYA 4DK5A 4W9LA 2CU1A 3VVWB 4WJPA 2KKCA 4W9IA 1WMHB 1NDDA 4TQ0A 1I42A 2YLMA 4GU2A 3BY4B 2DAJA 2N9PC 1RFAA 4W9JA 3DVNU 2LVOA 1UELA 5L83A 3QC8B 3QIJA 2L8JA 2N9EB 3KYDD 4GMVA 3U30A 1GC6A 1XQQA 4GGQA 1E5WA 2EMTA 3DBRI 4K81A 2KMCA 4G3XB 1YX6B 2J7QB 3Q3FA 3L10B 2MLBA 5FR6A 4GSWA 1V86A 2ZEQA 2L05A 3RT3B 3VUYA 3WIMA 3KYCD 5D7GA 1L2NA 2BYEA 2PE6B 1SIFA 2BKFA 1P98A 4PS8A 1C3TA 2GBKA 1WGDA 4A3PA 2D10A 1WJ4A 4XC2A 4TQ1A 2KDIA 3B08A 2FCQA 4G11A 4CO7A 2V3SA 3AXCA 2FNJB 1WXAA 3H7PA 3L16A 4GXBA 4HLEA 1GG3A 4MGZE 3DQVA 3DBLI 2J0KA 4FLHA 3R66C 3UINB 1WGHA 2KFKB 3NS8A 2KXJA 3AULA 3NY5A 1LFDA 2CR5A 4GDKB 3EC8A 2K8CA 3IFWB 5CX3A 2D07B 2Z0EB 2MX2A 2KLGA 2KC1A 4NJ7A 3PVLA 2DHZA 1V9JA 1YX5B 2G45B 4ZYNA 1RLFA 4F7ZA 2L0TA 2MCNB 2LJ5A 4GIVA 1KM7A 4RM8A 2XK5A 3QWZB 1A5RA 3S2AA 4MSMB 4BVUC 3PS6A 3ZNHB 1T0YA 4ANUA 1IP9A 3PREA 4AWJA 1EF5A 5J2RA 2CS4A 2BYFA 1WRDB 2MBQA 3DPDA 2JF5A 4A20A 5JHBA 1C1YB 3H9DA 2N1WA 4IWQA 4M0WB 1UBQA 3ZNID 1V6EA 2KWUB 2IY1B 3KVFB 2KC2A 3TIXA 3EFUA 3OLMD 2WDTB 4DBGA 1YQBA 4FJZA 1ISNA 4EOYA 3H7SA 4IM2A 2G4SA 4GDLB 4DHZB 3PHXB 1OEYA 4HDOA 4XZ4A 1ZGUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IAA C;  3V60 A;  2Z0D B;  3HIZ A;  4K7U A;  3DBH I;  2KAN A;  1WJU A;  2C5L C;  4BKS A;  2ZVO A;  4ANW A;  3DCG A;  4IG7 B;  3RCZ A;  3MTN B;  2K39 A;  2L0F A;  3DBS A;  3PLU A;  4NQL B;  3TJP A;  3JSV A;  4CHK A;  3ONS A;  2BPS A;  5CHV C;  3QAQ A;  3D32 A;  3VUX A;  2IYD B;  3APC A;  4LJO B;  3I3T B;  3R7Q A;  1S3S G;  1ZKH A;  2LGY A;  1E8W A;  1S1Q B;  1OTR B;  2G3Q B;  2JY6 A;  3AU5 A;  1UBI A;  5E6O A;  3UIP B;  2BWF A;  4GB9 A;  4OVV A;  2IBI B;  3DVN V;  2GBJ A;  4LDT D;  3NHE B;  1H8C A;  3MHS D;  2JT4 B;  3HK0 A;  2NS5 A;  4E3C A;  3ZUN A;  2ZCB A;  3ZIM A;  1Q5W B;  2AL6 A;  4LJP B;  2LRU A;  1M94 A;  4BOZ B;  1UD7 A;  3PHW B;  1V81 A;  4MGI E;  1UZX B;  5TR5 A;  4AJY B;  5LXI B;  1SE9 A;  2GMI C;  1UH6 A;  2KWC A;  2MBE A;  2CKH B;  3WAM A;  4FAD A;  4IM0 A;  3PGE A;  3ML9 A;  2NR2 A;  1R4N I;  2EKE C;  3EEC A;  3M63 B;  5LXH A;  3N30 A;  2KWV B;  5J18 A;  3C0R B;  1WH3 A;  4MGY E;  3PV1 A;  2KFJ A;  3KUC B;  4WAA A;  2D11 A;  2JUO A;  4II2 B;  1KJT A;  1U4A A;  2O6V B;  1WM2 A;  5D6J B;  2DAF A;  4HCP B;  2ZVN A;  5KHQ A;  3A9K B;  3QJZ A;  3L13 A;  5DPR A;  3WAN A;  2FID A;  1J19 A;  3ZTC A;  3ZVV A;  2K8B A;  4NJ6 A;  3UF8 A;  2WX0 A;  3PTF C;  3VUW A;  2J0J A;  1Z2M A;  2MBH A;  3IHP C;  3T8M A;  1LQB A;  4DHJ D;  2BF8 B;  5KHO A;  2ASQ A;  4NAW A;  2O2V B;  2OOB B;  4DHZ E;  2JVC A;  2RD0 A;  2KDB A;  3OJ3 A;  2MP2 B;  1HE8 A;  2GOW A;  4FHK A;  3RZF A;  2M0X A;  3V62 A;  2WYQ A;  3ZO5 B;  4EFO A;  1TGZ B;  4FHJ A;  4WJQ A;  2AEH A;  2R2O A;  1G6J A;  3X0W A;  5AZH A;  3OJ4 B;  3VDZ A;  1MG8 A;  5JH5 C;  2NBW B;  2MA9 B;  1SGH A;  2L76 A;  3A4S C;  1GJZ A;  1J0G A;  3HM6 X;  2R2Q A;  2KQS A;  3KUZ A;  2A4Z A;  1Q0W B;  3N32 A;  2DZJ A;  2DYO A;  3V6E B;  5JZE B;  1F9J A;  1V5T A;  4PYU A;  4KVG B;  1YIW A;  2N1V A;  2ZPN A;  4W9K A;  4WWP A;  3VFK A;  3ZKJ C;  2ZNV C;  4ICV A;  1UGM A;  1ZW7 A;  2PEA A;  2MW5 A;  3PRP B;  2NVU I;  4KSL C;  4FA6 A;  2EMS A;  4A3O A;  2LXC A;  4EEW A;  2GBN A;  1WXM A;  3O65 B;  4MDK E;  2KQ7 A;  3QAR A;  3ZLZ A;  1YJ1 A;  5JHA A;  1FXT B;  4ZRI A;  2KTF A;  2M17 A;  2NPT B;  1EUV B;  1P0R A;  3M95 A;  2FAZ A;  2JZZ A;  3SHQ A;  1WXS A;  3K9O B;  4KIK A;  4PYZ A;  5EDS A;  2JWZ A;  3A1Q B;  1Y8R C;  1LXD A;  3WAP A;  4LCD E;  1WM3 A;  4EZJ A;  2HD5 B;  3ENE A;  3A9K A;  5D2M B;  2Z59 B;  3SDL C;  2LGX A;  3VH4 B;  2Y5B B;  4F1S A;  1H4R A;  1X1M A;  4MJS A;  1E7U A;  3CST A;  2FCM A;  2KD0 A;  1WF9 A;  3NZU A;  3R7R A;  1KLV A;  2ZNV B;  2K1F A;  1WMH A;  1K8R B;  4BOS C;  4HPL B;  1V2Y A;  4E71 A;  2N7E A;  1WY8 A;  4KZ0 A;  4NNJ B;  2L00 B;  3VTU A;  3RUL A;  3ZNZ B;  3W1Y A;  3PPA A;  4BBN C;  4ANV A;  1WYW B;  2CHW A;  2IO3 B;  4MGK E;  3RZW C;  2M4N A;  4J6I A;  4BBN F;  5G2N A;  1WIA A;  2ZPY A;  4IM3 A;  5AEK B;  4M8N A;  2IY0 B;  3M3J A;  1WZ0 A;  5DPW A;  3B1L X;  2B3A A;  3QCA A;  3QA8 A;  2GBR A;  3IG3 A;  2MRP A;  2LWP A;  3VTW A;  3JVZ X;  3X23 A;  2KN5 A;  4B6W A;  3KH0 A;  4K7S A;  2C9W B;  2YVC A;  4WWN A;  2PPH A;  4B9K A;  2O6V D;  2BWE S;  4I6N B;  1XD3 B;  4KDI C;  3VQI A;  4IWO A;  1VD2 A;  3VAW A;  3V6C B;  4TV3 A;  3KW5 B;  4MH0 E;  5GMV A;  2M1M A;  2LVP A;  1P3Q U;  1E7V A;  2DEN B;  2LRW A;  1Q1O A;  3UQB A;  2NBV B;  5HKH A;  5E6P A;  2BKR B;  5CHW A;  4JGH B;  4IW0 A;  4IWP A;  2KVR A;  3GZN I;  4JQW C;  5DPS A;  4GDK A;  4YL8 A;  1YD8 U;  1WE6 A;  1L7Y A;  4KZC A;  3VH3 B;  2LAS A;  3QK0 A;  2W9N A;  3TMP B;  3A9J B;  2UYZ B;  2HE7 A;  3H7P B;  2RPQ A;  2JRI B;  2XK5 B;  4K7W A;  1P1A A;  4NPN A;  2LD9 A;  1V49 A;  3A4R A;  4MEM A;  3V61 A;  2CHZ A;  1WR1 A;  2K25 A;  4NQK E;  4BKG A;  1WX7 A;  3DOW A;  4HCN B;  4DWF A;  2N9X A;  3K9P B;  2MWS B;  2N7D A;  1E8Y A;  4LDT B;  4W9F A;  4RMA A;  3PRZ A;  2K6Q A;  2RR9 A;  4CYE A;  2JPH A;  4AOF A;  2MSE D;  2G4D B;  2IZV B;  3RD2 A;  2KOX A;  3PSE B;  1TBE A;  1WE7 A;  2LGD A;  2BYV E;  2I1K A;  4ICU A;  5J17 A;  2KTR B;  2XEW A;  3L54 A;  3LDZ E;  3PZD A;  1WZ3 A;  1WX8 A;  1OQY A;  3RUI B;  4KV2 A;  1XT9 B;  2KX0 A;  3VHT C;  1I35 A;  1R4M I;  1WJ6 A;  1E90 A;  3EHV A;  2FCN A;  3DDC B;  2IO0 B;  3T9L A;  4KIK B;  1QZE A;  3W1S A;  4PS7 A;  2DZM A;  4W9D A;  3WA0 A;  3DVG Y;  3ZTD A;  4W9C A;  4ZRK A;  3W1S C;  3UGB B;  4DDG D;  1V80 A;  4FJY A;  2XBB C;  1P9D U;  2HJ8 A;  2KDF B;  3HM3 A;  2IO1 B;  3CSF A;  4EKU A;  2DZI A;  3APF A;  1V5O A;  4AUQ C;  2KJR A;  4RM9 A;  4MJS B;  2KFK A;  2RSU A;  2VRR B;  3OAW A;  4ANX A;  3JYU A;  4WJN A;  3QX1 A;  2GBM A;  2NBU A;  3CMM B;  3BIN A;  2KK8 A;  4DDI D;  2RGF A;  4HPM B;  3APD A;  2WX1 A;  2NCN A;  3ZDT A;  2V4L A;  4I6L B;  2HTH A;  2OJR A;  3TCA A;  1RAX A;  2KNB A;  5G55 A;  3ZW3 A;  3L0W B;  3L17 A;  2CHX A;  4FBJ B;  4X57 B;  2MP2 A;  4W9G A;  3UIO B;  2N4F A;  2PJH A;  1BT0 A;  3IBE A;  3QQ8 B;  2BGF A;  4NY0 A;  2M8S A;  1Z5S B;  5CTR C;  3RYT A;  2AL3 A;  2AWT A;  3NOB A;  5D94 A;  5BO4 B;  4ZDV A;  4K1R B;  2DYB A;  5DPT A;  3TBL D;  2C60 A;  2L3Z A;  3CF6 E;  1VCB A;  2JRH A;  2KDE B;  4JIO U;  3KUD B;  5DCN A;  4G50 A;  5C1Z A;  3VXW A;  4JLC A;  3H1U A;  3HHM A;  4HXD A;  5E6N A;  1WGG A;  3PRM B;  3MJW A;  2ZJD A;  4F8C B;  2O6V A;  4II3 B;  2J0M A;  4DXA B;  2AYO B;  2L7R A;  5CHF A;  2WWZ A;  1JRU A;  2FCS A;  1D3Z A;  3L08 A;  2REX A;  1TZ1 A;  4I6P A;  4HVB A;  3LJ3 A;  3PLV A;  2PE9 A;  2JZ3 B;  1NBF C;  2NPT A;  1WX9 A;  3H6N A;  4TUU A;  2JXX A;  1OGW A;  4NAW B;  4G0N B;  1WGR A;  4E74 A;  4W9H A;  3VTV A;  2MBO A;  5AZG A;  2KO3 A;  1NI2 A;  2KJ6 A;  2KLC A;  4HK2 A;  4WQO B;  3PT2 B;  3A1Q A;  2DYM A;  3AI5 A;  3QHT A;  4FN2 A;  4DHJ B;  2K8H A;  4EUT A;  1EF1 A;  3ZNG C;  2D2Q A;  2UWQ A;  1WJN A;  2KHW B;  1PQS A;  4N9F 4;  1GC7 A;  3JW0 X;  1TTN A;  4W9E A;  5LLI A;  2I1J A;  4EZK A;  2ZZP B;  4PS3 A;  4KDL B;  3U8Z A;  1GNU A;  3ECI A;  1GUA B;  3ML8 A;  4P7I A;  3IVF A;  4IC7 B;  2KX3 A;  2C7N B;  2V1Y A;  1WI0 A;  1CMX B;  4B95 A;  4GDL A;  4AJW A;  2FIF A;  1AAR A;  3ZRC A;  2LUE A;  3A9J A;  2MQJ A;  4KSK C;  2O2V A;  4M8M A;  1WXV A;  4MSQ B;  5C23 A;  4FUL A;  3UQA A;  2ZCC A;  4XX5 A;  1OEY J;  3P2B A;  1WR6 E;  3R3M A;  1EO6 A;  3N3K B;  3M62 B;  3GOE A;  3JSV B;  3NZS A;  4JL9 A;  4HDQ A;  3Q3J A;  4OVU A;  3SD5 A;  1E8Z A;  1KOT A;  3ZRF A;  2KJH B;  3AU4 A;  2LXA A;  4URK A;  1IYF A;  4WJO A;  2LVQ A;  3ALB A;  4ZRJ A;  5AZF A;  3U7D A;  3WAO A;  4BKS D;  4BFR A;  2LZ6 A;  1LM8 B;  2KMA A;  3WAL A;  4GOC A;  3A33 B;  4WWO A;  2K6D B;  2KTR A;  4AP4 C;  3DVG X;  2IO2 B;  4TKN A;  1E8X A;  4IUM B;  3SU8 X;  2A5U A;  2FUH B;  2LI5 A;  4EZL A;  5IA7 A;  2MBB B;  2DZK A;  2QHO A;  4FJV B;  4MEL A;  3ZDM C;  3TL5 A;  2C7M B;  1WFY A;  1J8C A;  2D3G A;  4MM3 A;  2C7H A;  1RRB A;  1IPG A;  2KZR A;  4GN1 A;  4HJK A;  4ASW C;  3B0A A;  5L95 C;  2DX5 B;  4BKT A;  4HWI B;  1WGY A;  4DK5 A;  4W9L A;  2CU1 A;  3VVW B;  4WJP A;  2KKC A;  4W9I A;  1WMH B;  1NDD A;  4TQ0 A;  1I42 A;  2YLM A;  4GU2 A;  3BY4 B;  2DAJ A;  2N9P C;  1RFA A;  4W9J A;  3DVN U;  2LVO A;  1UEL A;  5L83 A;  3QC8 B;  3QIJ A;  2L8J A;  2N9E B;  3KYD D;  4GMV A;  3U30 A;  1GC6 A;  1XQQ A;  4GGQ A;  1E5W A;  2EMT A;  3DBR I;  4K81 A;  2KMC A;  4G3X B;  1YX6 B;  2J7Q B;  3Q3F A;  3L10 B;  2MLB A;  5FR6 A;  4GSW A;  1V86 A;  2ZEQ A;  2L05 A;  3RT3 B;  3VUY A;  3WIM A;  3KYC D;  5D7G A;  1L2N A;  2BYE A;  2PE6 B;  1SIF A;  2BKF A;  1P98 A;  4PS8 A;  1C3T A;  2GBK A;  1WGD A;  4A3P A;  2D10 A;  1WJ4 A;  4XC2 A;  4TQ1 A;  2KDI A;  3B08 A;  2FCQ A;  4G11 A;  4CO7 A;  2V3S A;  3AXC A;  2FNJ B;  1WXA A;  3H7P A;  3L16 A;  4GXB A;  4HLE A;  1GG3 A;  4MGZ E;  3DQV A;  3DBL I;  2J0K A;  4FLH A;  3R66 C;  3UIN B;  1WGH A;  2KFK B;  3NS8 A;  2KXJ A;  3AUL A;  3NY5 A;  1LFD A;  2CR5 A;  4GDK B;  3EC8 A;  2K8C A;  3IFW B;  5CX3 A;  2D07 B;  2Z0E B;  2MX2 A;  2KLG A;  2KC1 A;  4NJ7 A;  3PVL A;  2DHZ A;  1V9J A;  1YX5 B;  2G45 B;  4ZYN A;  1RLF A;  4F7Z A;  2L0T A;  2MCN B;  2LJ5 A;  4GIV A;  1KM7 A;  4RM8 A;  2XK5 A;  3QWZ B;  1A5R A;  3S2A A;  4MSM B;  4BVU C;  3PS6 A;  3ZNH B;  1T0Y A;  4ANU A;  1IP9 A;  3PRE A;  4AWJ A;  1EF5 A;  5J2R A;  2CS4 A;  2BYF A;  1WRD B;  2MBQ A;  3DPD A;  2JF5 A;  4A20 A;  5JHB A;  1C1Y B;  3H9D A;  2N1W A;  4IWQ A;  4M0W B;  1UBQ A;  3ZNI D;  1V6E A;  2KWU B;  2IY1 B;  3KVF B;  2KC2 A;  3TIX A;  3EFU A;  3OLM D;  2WDT B;  4DBG A;  1YQB A;  4FJZ A;  1ISN A;  4EOY A;  3H7S A;  4IM2 A;  2G4S A;  4GDL B;  4DHZ B;  3PHX B;  1OEY A;  4HDO A;  4XZ4 A;  1ZGU B; 
#chains in the Genus database with same CATH topology
 2Z0D B;  4BKS A;  1SE2 A;  5BYR A;  1FIQ A;  1OQQ A;  2R61 A;  3JSV A;  2WXQ A;  4A55 A;  3APC A;  3I3T B;  2LGY A;  2J42 A;  1OTR B;  4XWW A;  3UIP B;  1JW9 D;  3DVN V;  4LDT D;  3NHE B;  2E3T A;  1BUI C;  2RMM A;  3PHW B;  3NVW A;  4MGI E;  1UZX B;  2GMI C;  1UH6 A;  2MJD A;  1XCQ L;  2CKH B;  3WAM A;  1D5Z C;  1MFW A;  4BZA A;  3NRZ A;  2BTE A;  2EKE C;  3M63 B;  4Q2J A;  2CJN A;  2H89 B;  4MGY E;  1YMH E;  4WAA A;  2JUO A;  1KJT A;  1JRP A;  5D6J B;  3NZ3 A;  1MG4 A;  2HJ1 A;  3QJZ A;  4JPS A;  5DPR A;  2NTS A;  2FID A;  3ZVV A;  1FEH A;  2WDQ B;  1DOY A;  2J0J A;  1UWM A;  2ASQ A;  2O2V B;  2OOB B;  2JVC A;  2MP2 B;  2GOW A;  3ZO5 B;  3V62 A;  1JWB D;  1TGZ B;  4FHJ A;  1G6J A;  5C3J B;  3L4P A;  3OJ4 B;  3W5V B;  2JU6 X;  2L76 A;  3HM6 X;  4REZ A;  2R2Q A;  2CU3 A;  2K5P A;  5G5G A;  5JZE B;  1FRD A;  1YIW A;  2N1V A;  4PK1 A;  1XLO A;  4KSL C;  1VLB A;  2PEA A;  1BML C;  4ZRP A;  4YWG G;  3P63 A;  2GBN A;  1WXM A;  1IBX B;  3H8H A;  1ET6 A;  4YSY B;  4ZRI A;  2KTF A;  2M17 A;  1P0R A;  3M95 A;  2JZZ A;  4US8 A;  3WAP A;  1WM3 A;  1ZDV A;  1K51 A;  3A9K A;  4LNF A;  1H4R A;  5GXG B;  4MJS A;  3RNE C;  3CST A;  1B1Z A;  2FCM A;  3NZU A;  1RM6 C;  2ZNV B;  1K8R B;  3URY A;  4BOS C;  1V2Y A;  3LYY A;  4KZ0 A;  4NNJ B;  3C19 A;  4ZHP A;  2LHD A;  3AE8 B;  2JYT A;  5E6J A;  3RZW C;  4D2K A;  4KGT A;  4M8N A;  1ZUD 2;  1TIF A;  3B1L X;  3QCA A;  1V1O A;  2KN5 A;  3Q8A A;  2VH2 A;  4WWN A;  4B9K A;  4KDI C;  1VD2 A;  4TV3 A;  4MH0 E;  2M1M A;  2LVP A;  1E7V A;  4H2A A;  4NAM A;  1DYQ A;  5IP4 D;  2BKR B;  1ZE3 D;  3EUB 2;  5D3I B;  1YD8 U;  4MM3 B;  3VH3 B;  2W3R A;  4OW0 A;  3RNF C;  1XO3 A;  3LB8 C;  3V61 A;  5IOI A;  3N1Z C;  3NVY A;  4BKG A;  4DWF A;  3K9P B;  4LDT B;  4W9F A;  2ONQ A;  4USA A;  4HJG E;  3RD2 A;  3R2T A;  3PSE B;  1ZXH A;  1SBB B;  2LGD A;  3LDZ E;  3PZD A;  4ARC A;  1MHH E;  3I9V 1;  1XT9 B;  3VHT C;  1I35 A;  1WJ6 A;  3EHV A;  2OHF A;  3TEZ A;  2IO0 B;  4XDD A;  1QZE A;  4PS7 A;  3ZTD A;  3DVG Y;  2KT7 A;  3W1S C;  1V80 A;  2LJI A;  5AUI A;  3NS1 A;  4WIP A;  3CSF A;  3BVG A;  1V5O A;  2KFK A;  2RSU A;  2BW2 A;  3TEW A;  3V3X A;  1YOV B;  3QX1 A;  3CMM B;  4HPM B;  2BB5 A;  3ZDT A;  3ZXV A;  2IGG A;  2OED A;  3TCA A;  1RAX A;  1L4D B;  2QDF A;  3AEF B;  2MP2 A;  1ENF A;  2V0G A;  2PJH A;  1BT0 A;  4NY0 A;  5BO4 B;  4DXF A;  1HXY D;  2DYB A;  5DPT A;  3TBL D;  5DCN A;  1TZO A;  1VCB A;  2JRH A;  5C1Z A;  4JIO U;  3KUD B;  1ZDX A;  5E6N A;  2DBY A;  2BBC A;  1WXQ A;  5CHF A;  1JRU A;  2REX A;  1TZ1 A;  3BYT B;  4HVB A;  2PE9 A;  2JZ3 B;  3H6N A;  2JXX A;  1OGW A;  4G0N B;  4J3O D;  3VTV A;  2WXI A;  2MBO A;  4K3B A;  5AZG A;  1I4P A;  4WQM A;  3QHT A;  2DYM A;  3AI5 A;  4OZC A;  2D2Q A;  1HTO A;  4N9F 4;  3JW0 X;  2DNF A;  1TTN A;  2WGS A;  2I1J A;  4EZK A;  1YJJ A;  2BQQ A;  3P4P B;  3AB5 A;  4XYC A;  1WI0 A;  4UDU C;  1L0V B;  4GDL A;  4P16 A;  1J7C A;  1AAR A;  4TMA B;  2LUE A;  4MSQ B;  3W9C B;  2MJ3 A;  3P2B A;  2WLB A;  1D6E C;  1QF6 A;  1EO6 A;  1C76 A;  4HDQ A;  1E8Z A;  1YN3 A;  1I4Q A;  2AQ3 B;  2KJH B;  4HEA 1;  5EE9 A;  2LVQ A;  3WAO A;  1LM8 B;  1FFU A;  4GOC A;  3GZN B;  2K6D B;  1VJK A;  1PGB A;  4AP4 C;  3FIL A;  1E8X A;  3SU8 X;  2FUH B;  2LI5 A;  1HZ6 A;  4EZL A;  2MBB B;  2DZK A;  2WQY B;  2C7M B;  2D3G A;  4MM3 A;  1WGK A;  3GB1 A;  2KZR A;  4GN1 A;  4ASW C;  2UU7 A;  3MC9 A;  2ZW0 A;  3AH7 A;  1AYF A;  4WJP A;  4W9I A;  1WMH B;  3MP9 A;  2DAJ A;  2N9P C;  4W9J A;  4JX1 C;  1VZ8 A;  3QIJ A;  1UGJ A;  1WRI A;  2L8J A;  4GMV A;  2SEB D;  1TS4 A;  3AN1 A;  2KMC A;  4G3X B;  3MJ5 A;  5FR6 A;  1V86 A;  2ZEQ A;  3WIM A;  5D7G A;  4PS8 A;  2KQ4 X;  2V3N A;  4TQ1 A;  2FCQ A;  3BVM A;  2FNJ B;  3L16 A;  2L32 A;  3DBL I;  3UIN B;  3RI7 C;  3NS8 A;  3DBL B;  2KXJ A;  3VR9 B;  1IGD A;  3IFW B;  2K8C A;  1QLB B;  1L0X B;  1YX5 B;  1JWS D;  4B0M A;  4F7Z A;  2L0T A;  2MCN B;  1KM7 A;  5H92 C;  1A5R A;  4BVU C;  4A90 A;  3PS6 A;  3FC4 A;  1T0Y A;  1DOX A;  4AWJ A;  2GI9 A;  5G5H A;  2MBQ A;  3H9D A;  2N1W A;  1UBQ A;  2K3U A;  3ZNI D;  2KWU B;  3OLM D;  1N6Z A;  3AE1 B;  1ISN A;  1EU4 A;  3H7S A;  1HEZ E;  4IM2 A;  2G4S A;  4GDL B;  4JWU C;  3AEB B;  2PMV A;  1Y8R C;  3V60 A;  3DBH I;  1C77 A;  1C9F A;  2C5L C;  4DQO C;  2L0F A;  3PLU A;  4OZA A;  5EE0 A;  3D32 A;  3VUX A;  4K3C A;  2JQR B;  2IYD B;  1TS2 A;  4LJO B;  3R7Q A;  1S1Q B;  2EEL A;  2G3Q B;  4OVV A;  4RGO S;  2WXR A;  4IOI E;  2ZCB A;  2QIE B;  1Q5W B;  1ROE A;  4LJP B;  4EE2 A;  2LUM A;  5TR5 A;  4AJY B;  2W55 A;  1SE9 A;  4FAD A;  1KLG D;  4IM0 A;  2KWD A;  5BMG A;  2GLS A;  3AEE B;  1MHX A;  3C0R B;  1E10 A;  1WH3 A;  1TYG B;  3KUC B;  4II2 B;  2BS2 B;  2SAK A;  2O6V B;  2N0S B;  1SSN A;  2ZVN A;  2VH1 A;  1MPE A;  3WAN A;  1J19 A;  2L1A A;  2WX0 A;  3VUW A;  3T8M A;  2QC8 A;  2BF8 B;  5KHO A;  1C78 A;  3OJ3 A;  3DHI C;  3O13 A;  4WJQ A;  2R2O A;  5HG2 A;  3RMK C;  3VDZ A;  5FR3 A;  1MG8 A;  5JH5 C;  2MA9 B;  2PW9 A;  3AM9 A;  2KQS A;  1Q0W B;  2DZJ A;  4KVG B;  2MW5 A;  4EEW A;  2V4I B;  1YN4 A;  2M19 A;  5JHA A;  1FM0 D;  1FXT B;  2NPT B;  2FAZ A;  1QOB A;  4PYZ A;  4C4V A;  3W2D A;  5EDS A;  1FD6 A;  3P4Q B;  3ENE A;  3FIL B;  1X1M A;  2KD0 A;  1F2R I;  3R7R A;  1V1P A;  1L6U A;  3MHZ A;  2L00 B;  1JQ4 A;  3VTU A;  3RUL A;  3ZNZ B;  4P1B C;  1OQR A;  1QOA A;  4YTM B;  3PPA A;  1WYW B;  2W54 A;  3HRD D;  1WIA A;  2WXN A;  3M3J A;  1WZ0 A;  5DPW A;  2WXL A;  3MC0 B;  3TEY A;  3X23 A;  3JVZ X;  4P1C C;  1D4B A;  4K7S A;  1E9M A;  2YVC A;  1NI3 A;  2PPH A;  3I57 A;  4I6N B;  3VQI A;  3V6C B;  1DOI A;  5GMV A;  2BT6 A;  1Q1O A;  4OVZ A;  1YQ4 B;  5E6P A;  3B9J A;  2LHE A;  3TEX A;  3GZN I;  3BZD B;  3GE8 C;  3QK0 A;  2W9N A;  3TMP B;  3RNG C;  3A9J B;  2UYZ B;  2XK5 B;  3BII D;  1P1A A;  4NPN A;  2IGH A;  4MEM A;  3ZYY X;  2ON8 A;  2K25 A;  4NQK E;  3P4R B;  2D3C A;  2MWS B;  1T5X D;  2JX5 A;  1QOG A;  2K6Q A;  3VRB B;  2RR9 A;  1XXG A;  2MSE D;  2G4D B;  2IZV B;  1IUE A;  1WE7 A;  4ICU A;  5J17 A;  2KTR B;  3L54 A;  3Q8E A;  3RUI B;  4KV2 A;  4YSZ B;  1E90 A;  3T9L A;  3DDC B;  3W1S A;  4W9D A;  2PKO A;  4ZRK A;  1TS3 A;  4DDG D;  2W3S A;  4FJY A;  2XBB C;  3HM3 A;  2IO1 B;  4EKU A;  2DZI A;  1RYJ A;  2KJR A;  4RM9 A;  2GB1 A;  1L0Y B;  4TSS A;  4LNI A;  1SIJ A;  2GBM A;  4US9 A;  3ZJV A;  2NCN A;  2V4L A;  1SE3 A;  1XLQ A;  2HTH A;  2OJR A;  1FXI A;  5G55 A;  3ZW3 A;  4FBJ B;  2PLP A;  4YT0 B;  2NMQ A;  3Q8C A;  3QQ8 B;  3B2G A;  1JWM D;  4ACF A;  2M8S A;  1Z5S B;  5CTR C;  2AWT A;  2W82 A;  1JWU D;  2L52 A;  3HVD A;  3HHM A;  3MC8 A;  1D5X C;  3PRM B;  1L5P A;  2WDV B;  5LNK 1;  2WWZ A;  3L08 A;  2CJO A;  3PLV A;  1NBF C;  2JSV X;  2D3B A;  4TUU A;  3ABV B;  5HI1 A;  4C00 A;  3KWL A;  3AE6 B;  2KJ6 A;  5IKC M;  4DHJ B;  4FN2 A;  2K8H A;  4MT5 A;  1FCC C;  1WJN A;  1PQS A;  2MEK A;  4W9E A;  3N1Y C;  3U8Z A;  3ECI A;  3IVF A;  1CZP A;  2KX3 A;  3Q3N C;  4L23 A;  1CMX B;  1FRR A;  3A9J A;  5MPO A;  1OEY J;  2X8X X;  4C7Z A;  3M62 B;  3NZS A;  2IJ0 A;  3U7Z A;  1E7P B;  1KOT A;  3DBH B;  3AU4 A;  4URK A;  3R8B A;  2Y3A A;  1D5M C;  4WJO A;  1CQV A;  4ZRJ A;  1JRO A;  1CJE A;  5AZF A;  1ET9 A;  2RDG A;  1WYG A;  1GAQ B;  1XLN A;  2KTR A;  2IO2 B;  2A5U A;  2D3A A;  4XWT A;  5IA7 A;  2QHO A;  4BAX A;  1J8C A;  4WH4 A;  1WFY A;  1IPG A;  5L95 C;  4BKT A;  1R7S A;  2CU1 A;  2KKC A;  1I42 A;  3BY4 B;  1RFA A;  3DVN U;  1I7H A;  5L83 A;  1VDV A;  4LNK A;  1KTK A;  4RCO A;  1UF0 A;  4L1B A;  3P4S B;  1YX6 B;  1R4M B;  2J7Q B;  4GSW A;  4ITK A;  4KKJ A;  1L2N A;  2PE6 B;  2BKF A;  4A3P A;  4LNO A;  1WJ4 A;  4YSX B;  3B08 A;  4G11 A;  1A70 A;  2Y5C A;  4CO7 A;  3DHH C;  1WXA A;  3H7P A;  4M02 A;  4GXB A;  1FCL A;  2AX5 A;  1GG3 A;  4HKZ E;  3AE9 B;  2J0K A;  2HDE A;  5TSS A;  4GDK B;  2Z0E B;  1T6B X;  1FXA A;  1F2R C;  3AE2 B;  4ANU A;  2PIA A;  1EF5 A;  1WRD B;  4M0W B;  3GS2 A;  2JYE A;  2KC2 A;  3AMZ A;  3TIX A;  3BK2 A;  4A8X C;  1F77 A;  1YQB A;  3DWM A;  3PHX B;  2UWQ A;  4HDO A;  4XZ4 A;  1SF0 A;  3I63 C;  2JXT A;  1UWX A;  2BS3 B;  3DCG A;  4IG7 B;  3RCZ A;  3DBS A;  3ZJU A;  4CHK A;  3ONS A;  1SEB D;  2WXF A;  2WS3 B;  1S3S G;  1TY2 A;  1E8W A;  4QAY A;  1KRH A;  1UBI A;  1XCT L;  2IBI B;  1ZXI A;  3MHS D;  3HK0 A;  1XF5 L;  2H88 B;  3AEA B;  3ZUN A;  4E3C A;  4LLG M;  2AL6 A;  4BOZ B;  3NG0 A;  1KFY B;  1V81 A;  3CWI A;  1GOZ A;  1ZPS A;  2KWC A;  2MBE A;  5T8I A;  3ZQ4 A;  3KLS X;  3PGE A;  2WXK A;  2WU5 B;  1FMA D;  2XNA C;  3KWV A;  1WSP A;  4A6Q A;  1U4A A;  3BYY B;  2DAF A;  1I4H A;  5KHQ A;  3A9K B;  1UUP A;  3ZTC A;  3PO0 A;  2K8B A;  1V8C A;  3UF8 A;  2WXG A;  2BYT A;  3P42 A;  1FPY A;  4DHZ E;  4NAW A;  2LEK A;  3GE3 C;  2RD0 A;  4P6V F;  3TSS A;  4FHK A;  3RZF A;  2M0X A;  2WYQ A;  1YNT E;  4N58 A;  1MJD A;  2AEH A;  3X0W A;  1QKZ A;  3Q3M C;  5AZH A;  2I2Y A;  1SGH A;  3A4S C;  1GJZ A;  3I5J C;  3N32 A;  1SJH D;  4HRS A;  2WXO A;  1V5T A;  4W9K A;  3W5U B;  4ICV A;  4FA6 A;  2NVU I;  2EMS A;  3RNC C;  1ZP0 B;  4A3O A;  2LXC A;  4MDK E;  2B76 B;  2KQ7 A;  3IXS A;  3ZLZ A;  3FKY A;  3EA6 A;  3SHQ A;  1WXS A;  4KIK A;  3IT6 B;  2AQ2 B;  3A1Q B;  1LXD A;  4O1N A;  4EZJ A;  2HD5 B;  4YTN B;  2Z59 B;  3VRA B;  5H8Y E;  2Y5B B;  3U52 E;  1WF9 A;  3N1X C;  1KLV A;  2K1F A;  1WMH A;  3Q8B A;  4HPL B;  1WY8 A;  3J9C A;  1C4A A;  1MI0 A;  2M56 B;  4BBN C;  4ANV A;  2IO3 B;  1NYR A;  4HRO A;  4A9A A;  2M4N A;  4NJC A;  2WXM A;  4IM3 A;  2J52 A;  2B3A A;  5BMH A;  3QA8 A;  2GBR A;  3VTW A;  2LWP A;  3KH0 A;  4C7Y A;  4R3D A;  2O6V D;  1XD3 B;  4N59 A;  5HHD G;  3KW5 B;  1JWA D;  2BVC A;  1P3Q U;  1T0S C;  2DEN B;  5I4D A;  2NBV B;  2Q5W D;  5CHW A;  4JGH B;  1GB1 A;  3AEC B;  1J7B A;  4IW0 A;  3RPF C;  4YL8 A;  1WE6 A;  3BK1 A;  4XDC A;  2LAS A;  2HE7 A;  2RPQ A;  2JRI B;  4K7W A;  4M0W A;  2LD9 A;  1V49 A;  2XN9 C;  1TKY A;  2IDY A;  4HCN B;  1V1P B;  3GP7 A;  4IKG A;  2TSS A;  1E8Y A;  1PYW D;  2JPH A;  4AOF A;  4MH8 A;  2BYV E;  1I4G A;  1WZ3 A;  1PUT A;  1NYQ A;  3IAS 1;  1R4M I;  4KIK B;  2DZM A;  4W9C A;  3UGB B;  2WNM A;  2G1E A;  2KDF B;  3NVZ A;  2KAJ A;  4AUQ C;  4MJS B;  3OAW A;  2OJW A;  4WJN A;  1AWD A;  2KK8 A;  3ZXR A;  3APD A;  2WX1 A;  1EU3 A;  1P7E A;  4I6L B;  3L0W B;  3L17 A;  2CHX A;  3UIO B;  2N4F A;  3IBE A;  1JML A;  2HTM E;  2BGF A;  1FO4 A;  4WUR A;  4HKQ A;  2AL3 A;  4ZDV A;  2RPV A;  3KQ4 A;  5AUK A;  2L3Z A;  2KDE B;  2D5G A;  4G50 A;  2E6X A;  1M4V A;  3H1U A;  3Q3O C;  1WGG A;  1F1H A;  3MJW A;  2ZJD A;  4F8C B;  2O6V A;  2J0M A;  1YN5 A;  2J53 A;  5BYQ A;  2FCS A;  1IBX A;  1KF6 B;  2N9L A;  4FXC A;  4WWM A;  2VZK B;  3E9S A;  2NPT A;  1WX9 A;  4E74 A;  4W9H A;  1NI2 A;  2KLC A;  4HK2 A;  5LLI A;  5C2T B;  1RWS A;  3ML8 A;  4P7I A;  4IC7 B;  2V1Y A;  1PGA A;  4AJW A;  3OWE B;  2FIF A;  3ZRC A;  4KSK C;  4M8M A;  1WXV A;  4FUL A;  3UQA A;  4RH6 A;  3DHG C;  1WR6 E;  3R3M A;  3N3K B;  4C56 C;  3JSV B;  4JL9 A;  3Q3J A;  4OVU A;  4LK0 M;  1EM7 A;  1N63 A;  1ESF A;  2KN4 A;  2PTL A;  1IYF A;  2LXA A;  2BB6 A;  4BFR A;  2YEP F;  2LZ6 A;  3WAL A;  3A33 B;  3PZ7 A;  1QOF A;  5BYS A;  3ZGZ A;  3MFG A;  1VR9 A;  2MJE A;  4FJV B;  4MEL A;  3ZDM C;  2C7H A;  1RRB A;  4HJK A;  3U4E G;  1WGY A;  5EE3 A;  3Q2A C;  4TQ0 A;  1PGX A;  3SR6 A;  4AQ7 A;  2YLM A;  2FUG 1;  1UEL A;  3QC8 B;  1OFF A;  4RGM A;  3KYD D;  1Q10 A;  1GC6 A;  1XQQ A;  1SXT A;  1E5W A;  2EMT A;  1PFD A;  3DBR I;  1K53 A;  5FKA C;  3Q3F A;  3L10 B;  2MLB A;  2PVG C;  2L05 A;  1EWY C;  3VUY A;  2BYE A;  2JZP A;  1P98 A;  1T0Q C;  1C3T A;  1WGD A;  2WP9 B;  1L4Z B;  4XC2 A;  1F0Z A;  2V3S A;  2DLB A;  3AXC A;  4HLE A;  4MAC A;  3T3N A;  4FLH A;  1TY0 A;  1WGH A;  1LFD A;  2CR5 A;  5CX3 A;  2KLG A;  2KC1 A;  2ACZ B;  3PVL A;  2DHZ A;  2LFI A;  2K9X A;  1LGR A;  1R4N B;  4GIV A;  1I4R A;  2XK5 A;  2WXH A;  3ZNH B;  3BVZ A;  1IP9 A;  2KMM A;  4YTP B;  2CS4 A;  2BYF A;  3DPD A;  1YJI A;  2JF5 A;  2N9K A;  4ZOH C;  1AW7 A;  4IWQ A;  2WXP A;  1N5X A;  2WXJ A;  4DBG A;  4ARI A;  4EOY A;  1ZOY B;  1TKE A;  4DHZ B;  1OEY A;  3AE7 B;  5IAA C;  3HIZ A;  4K7U A;  2KAN A;  2QSD A;  1WJU A;  2IGD A;  2ZVO A;  4ANW A;  1HA5 A;  3MTN B;  2K39 A;  4NQL B;  2INP E;  3TJP A;  3BWU D;  2BPS A;  2KAC A;  5CHV C;  3QAQ A;  3NVV A;  1IGC A;  1ZKH A;  4LTU A;  2JY6 A;  3AU5 A;  5E6O A;  2BWF A;  4GB9 A;  3SFE B;  2GBJ A;  1DGJ A;  1H8C A;  2JT4 B;  4JWS C;  2NS5 A;  3ZIM A;  2L83 A;  3AV8 A;  2LRU A;  1M94 A;  1UD7 A;  1HQR D;  2YEP B;  3PZ8 A;  2V9H A;  5LXI B;  1N5W A;  3RNA C;  1KH0 A;  2LGS A;  3AE5 B;  3ML9 A;  2NR2 A;  3T3O A;  1R4N I;  3EEC A;  5LXH A;  3N30 A;  2I38 A;  4ZYS A;  2KWV B;  1N60 A;  2KYW A;  4C80 A;  3PV1 A;  2KFJ A;  2D11 A;  1WM2 A;  2RDH A;  1GB4 A;  4HCP B;  2Z8L A;  3L13 A;  2IPK D;  4KX6 B;  4NJ6 A;  3PTF C;  2MBH A;  1Z2M A;  3IHP C;  1LQB A;  4DHJ D;  1C79 A;  1TJE A;  3RFZ B;  1TS5 A;  2KDB A;  5J18 A;  1HE8 A;  4EFO A;  1QQR A;  2KDM A;  3V05 A;  2NBW B;  4LNN A;  1JCK B;  1J0G A;  4RF1 A;  3KUZ A;  2A4Z A;  1NVI D;  2DYO A;  4IDI A;  3V6E B;  1F9J A;  4PYU A;  3VFK A;  1I4X A;  2ZPN A;  2X38 A;  4WWP A;  3ZKJ C;  2ZNV C;  2INC C;  1UGM A;  1ZW7 A;  3PRP B;  4RF0 A;  4N6E B;  3O65 B;  3QAR A;  2PVO D;  1WWT A;  1YJ1 A;  3ZJT A;  2ZW1 A;  1C4P A;  2BS4 B;  1EUV B;  2MHJ A;  2QJL A;  2KVZ A;  3K9O B;  3E56 A;  1B9R A;  2JWZ A;  4LCD E;  3R2I A;  3VH4 B;  5D2M B;  1BXT A;  3SDL C;  2LGX A;  4F1S A;  3AEG B;  1E7U A;  4DXG A;  5D3D A;  4E71 A;  2N7E A;  1XEE A;  1K50 A;  3W1Y A;  5IO9 A;  2CHW A;  4MGK E;  1Y56 A;  2MH7 A;  4J6I A;  4BBN F;  5G2N A;  3RNB C;  2ZPY A;  1SB3 C;  5AEK B;  2IY0 B;  3IAM 1;  4OZB A;  5EE1 A;  3IG3 A;  2MRP A;  2AQ1 B;  4B6W A;  2ICI A;  3EFC A;  4WAF A;  2C9W B;  1T0R C;  3Q6B A;  4S17 A;  3DWG C;  4HPP A;  2BWE S;  4IWO A;  3VAW A;  4NZL B;  5HFY A;  1VZ6 A;  3UQB A;  2LRW A;  3CIR B;  5HKH A;  3ETR A;  1HZ5 A;  1NEN B;  3FAH A;  1YQ3 B;  4IWP A;  2KVR A;  4JQW C;  5DPS A;  4GDK A;  3RN9 C;  1L7Y A;  4KZC A;  1CK1 A;  4KGR A;  3H7P B;  3A4R A;  2CHZ A;  1WR1 A;  4RGT A;  1WX7 A;  4OHJ A;  3DOW A;  1STE A;  2N9X A;  2N7D A;  2FE8 A;  4RMA A;  3PRZ A;  4CYE A;  2KOX A;  1TBE A;  2QMT A;  2I1K A;  2XEW A;  2WHI A;  1WX8 A;  1OQY A;  2K22 A;  2KX0 A;  4RFB A;  2FCN A;  1V97 A;  3WA0 A;  2QCZ A;  1J7A A;  1F52 A;  3P1M A;  1P9D U;  2HJ8 A;  1HTQ A;  3APF A;  3OG5 A;  2VRR B;  4ANX A;  3JYU A;  5FK9 C;  3WCQ A;  2LGI A;  2NBU A;  1C4C A;  3NUH B;  3BIN A;  1GPX A;  4DDI D;  2RGF A;  3HVZ A;  2V3P A;  2KNB A;  1FNV A;  4X57 B;  1QT9 A;  4W9G A;  3AE4 B;  5BMI A;  4XE0 A;  1FFV A;  1K52 A;  3RYT A;  2Y5P A;  3B2F A;  3NOB A;  5D94 A;  1KLU D;  4K1R B;  2C60 A;  3VXW A;  3CF6 E;  3SFD B;  3U2S C;  4JLC A;  4HXD A;  1N62 A;  1T3Q A;  4II3 B;  1EWC A;  4DXA B;  2AYO B;  4YXD B;  2L7R A;  1D3Z A;  1FNW A;  1SJE D;  4I6P A;  3LJ3 A;  4ZRQ A;  4NAW B;  1WGR A;  2JWU A;  2KO3 A;  4WQO B;  3Q69 A;  3PT2 B;  3A1Q A;  4EUT A;  1EF1 A;  3ZNG C;  2KHW B;  1GC7 A;  2ZZP B;  4PS3 A;  4KDL B;  1P7F A;  1GNU A;  1GUA B;  2C7N B;  4B95 A;  2MQJ A;  2O2V A;  5C23 A;  2ZCC A;  4XX5 A;  1MVK A;  3GOE A;  1ACC A;  1N61 A;  1SE4 A;  3SD5 A;  2VZK D;  3ZRF A;  3LXF A;  2J4X A;  3SEB A;  3AE3 B;  4CQN A;  3ALB A;  3IT4 B;  3U7D A;  3UI3 A;  4BKS D;  3AED B;  4KGS A;  1TKG A;  2KMA A;  4WWO A;  2N7J A;  3DBR B;  3DVG X;  1VZ7 A;  1E6E B;  4IUM B;  4TKN A;  1E0Z A;  3VR8 B;  2GRI A;  5IN7 A;  2RDB C;  1UNS A;  3TL5 A;  2INN E;  4RNA A;  3NJT A;  3B0A A;  1NEK B;  2DX5 B;  2K0P A;  2EKI A;  4PT5 A;  1JAL A;  4HWI B;  4DK5 A;  4W9L A;  4C4V B;  3VVW B;  1XLP A;  1NDD A;  1TT5 B;  4GLS C;  2WDR B;  4GU2 A;  1VRA B;  2LVO A;  4S0R A;  2G9H D;  2N9E B;  4RGN A;  3U30 A;  4KKI A;  1LO5 D;  1FNU A;  3EGR A;  4GGQ A;  4K81 A;  1QIL A;  3Q14 C;  2QIL A;  2QEJ C;  3RT3 B;  3KYC D;  3N9Y C;  1SIF A;  2GBK A;  2D10 A;  2WU2 B;  3Q8F A;  4M01 A;  2KDI A;  2LMC A;  4L2Y A;  4MGZ E;  3DQV A;  4JE3 B;  1AN8 A;  3R66 C;  2KFK B;  2NTT A;  3N20 C;  3NY5 A;  2M0A A;  3AUL A;  1L6V A;  3EC8 A;  2D07 B;  2MX2 A;  5JXV A;  4ZHO A;  2IND C;  4NJ7 A;  1V9J A;  2G45 B;  4ZYN A;  1RLF A;  1PDX A;  2LJ5 A;  4RM8 A;  3QWZ B;  4AS1 A;  3S2A A;  4MSM B;  4XGA B;  3C8Y A;  3PRE A;  5J2R A;  5JHB A;  4A20 A;  1C1Y B;  4M00 A;  4B0E A;  3TUO A;  3HUI A;  1RFK A;  1V6E A;  2IY1 B;  3KVF B;  3EFU A;  2WDT B;  2FBW B;  4FJZ A;  2DWQ A;  1ZGU B; 
#chains in the Genus database with same CATH homology
 5IAA C;  3V60 A;  2Z0D B;  3HIZ A;  4K7U A;  3DBH I;  2KAN A;  1WJU A;  2C5L C;  4BKS A;  2ZVO A;  4ANW A;  3DCG A;  4IG7 B;  3RCZ A;  3MTN B;  2K39 A;  2L0F A;  3DBS A;  3PLU A;  4NQL B;  3TJP A;  3JSV A;  4CHK A;  3ONS A;  2BPS A;  5CHV C;  3QAQ A;  3D32 A;  3VUX A;  2IYD B;  3APC A;  4LJO B;  3I3T B;  3R7Q A;  1S3S G;  1ZKH A;  2LGY A;  1E8W A;  1S1Q B;  1OTR B;  2G3Q B;  2JY6 A;  3AU5 A;  1UBI A;  5E6O A;  3UIP B;  2BWF A;  4GB9 A;  4OVV A;  2IBI B;  3DVN V;  2GBJ A;  4LDT D;  3NHE B;  1H8C A;  3MHS D;  2JT4 B;  3HK0 A;  2NS5 A;  4E3C A;  3ZUN A;  2ZCB A;  3ZIM A;  1Q5W B;  2AL6 A;  4LJP B;  2LRU A;  1M94 A;  4BOZ B;  1UD7 A;  3PHW B;  1V81 A;  4MGI E;  1UZX B;  5TR5 A;  4AJY B;  5LXI B;  1SE9 A;  2GMI C;  1UH6 A;  2KWC A;  2MBE A;  2CKH B;  3WAM A;  4FAD A;  4IM0 A;  3PGE A;  3ML9 A;  2NR2 A;  1R4N I;  2EKE C;  3EEC A;  3M63 B;  5LXH A;  3N30 A;  2KWV B;  5J18 A;  3C0R B;  1WH3 A;  4MGY E;  3PV1 A;  2KFJ A;  3KUC B;  4WAA A;  2D11 A;  2JUO A;  4II2 B;  1KJT A;  1U4A A;  2O6V B;  1WM2 A;  5D6J B;  2DAF A;  4HCP B;  2ZVN A;  5KHQ A;  3A9K B;  3QJZ A;  3L13 A;  5DPR A;  3WAN A;  2FID A;  1J19 A;  3ZTC A;  3ZVV A;  2K8B A;  4NJ6 A;  3UF8 A;  2WX0 A;  3PTF C;  3VUW A;  2J0J A;  1Z2M A;  2MBH A;  3IHP C;  3T8M A;  1LQB A;  4DHJ D;  2BF8 B;  5KHO A;  2ASQ A;  4NAW A;  2O2V B;  2OOB B;  4DHZ E;  2JVC A;  2RD0 A;  2KDB A;  3OJ3 A;  2MP2 B;  1HE8 A;  2GOW A;  4FHK A;  3RZF A;  2M0X A;  3V62 A;  2WYQ A;  3ZO5 B;  4EFO A;  1TGZ B;  4FHJ A;  4WJQ A;  2AEH A;  2R2O A;  1G6J A;  3X0W A;  5AZH A;  3OJ4 B;  3VDZ A;  1MG8 A;  5JH5 C;  2NBW B;  2MA9 B;  1SGH A;  2L76 A;  3A4S C;  1GJZ A;  1J0G A;  3HM6 X;  2R2Q A;  2KQS A;  3KUZ A;  2A4Z A;  1Q0W B;  3N32 A;  2DZJ A;  2DYO A;  3V6E B;  5JZE B;  1F9J A;  1V5T A;  4PYU A;  4KVG B;  1YIW A;  2N1V A;  2ZPN A;  4W9K A;  4WWP A;  3VFK A;  3ZKJ C;  2ZNV C;  4ICV A;  1UGM A;  1ZW7 A;  2PEA A;  2MW5 A;  3PRP B;  2NVU I;  4KSL C;  4FA6 A;  2EMS A;  4A3O A;  2LXC A;  4EEW A;  2GBN A;  1WXM A;  3O65 B;  4MDK E;  2KQ7 A;  3QAR A;  3ZLZ A;  1YJ1 A;  5JHA A;  1FXT B;  4ZRI A;  2KTF A;  2M17 A;  2NPT B;  1EUV B;  1P0R A;  3M95 A;  2FAZ A;  2JZZ A;  3SHQ A;  1WXS A;  3K9O B;  4KIK A;  4PYZ A;  5EDS A;  2JWZ A;  3A1Q B;  1Y8R C;  1LXD A;  3WAP A;  4LCD E;  1WM3 A;  4EZJ A;  2HD5 B;  3ENE A;  3A9K A;  5D2M B;  2Z59 B;  3SDL C;  2LGX A;  3VH4 B;  2Y5B B;  4F1S A;  1H4R A;  1X1M A;  4MJS A;  1E7U A;  3CST A;  2FCM A;  2KD0 A;  1WF9 A;  3NZU A;  3R7R A;  1KLV A;  2ZNV B;  2K1F A;  1WMH A;  1K8R B;  4BOS C;  4HPL B;  1V2Y A;  4E71 A;  2N7E A;  1WY8 A;  4KZ0 A;  4NNJ B;  2L00 B;  3VTU A;  3RUL A;  3ZNZ B;  3W1Y A;  3PPA A;  4BBN C;  4ANV A;  1WYW B;  2CHW A;  2IO3 B;  4MGK E;  3RZW C;  2M4N A;  4J6I A;  4BBN F;  5G2N A;  1WIA A;  2ZPY A;  4IM3 A;  5AEK B;  4M8N A;  2IY0 B;  3M3J A;  1WZ0 A;  5DPW A;  3B1L X;  2B3A A;  3QCA A;  3QA8 A;  2GBR A;  3IG3 A;  2MRP A;  2LWP A;  3VTW A;  3JVZ X;  3X23 A;  2KN5 A;  4B6W A;  3KH0 A;  4K7S A;  2C9W B;  2YVC A;  4WWN A;  2PPH A;  4B9K A;  2O6V D;  2BWE S;  4I6N B;  1XD3 B;  4KDI C;  3VQI A;  4IWO A;  1VD2 A;  3VAW A;  3V6C B;  4TV3 A;  3KW5 B;  4MH0 E;  5GMV A;  2M1M A;  2LVP A;  1P3Q U;  1E7V A;  2DEN B;  2LRW A;  1Q1O A;  3UQB A;  2NBV B;  5HKH A;  5E6P A;  2BKR B;  5CHW A;  4JGH B;  4IW0 A;  4IWP A;  2KVR A;  3GZN I;  4JQW C;  5DPS A;  4GDK A;  4YL8 A;  1YD8 U;  1WE6 A;  1L7Y A;  4KZC A;  3VH3 B;  2LAS A;  3QK0 A;  2W9N A;  3TMP B;  3A9J B;  2UYZ B;  2HE7 A;  3H7P B;  2RPQ A;  2JRI B;  2XK5 B;  4K7W A;  1P1A A;  4NPN A;  2LD9 A;  1V49 A;  3A4R A;  4MEM A;  3V61 A;  2CHZ A;  1WR1 A;  2K25 A;  4NQK E;  4BKG A;  1WX7 A;  3DOW A;  4HCN B;  4DWF A;  2N9X A;  3K9P B;  2MWS B;  2N7D A;  1E8Y A;  4LDT B;  4W9F A;  4RMA A;  3PRZ A;  2K6Q A;  2RR9 A;  4CYE A;  2JPH A;  4AOF A;  2MSE D;  2G4D B;  2IZV B;  3RD2 A;  2KOX A;  3PSE B;  1TBE A;  1WE7 A;  2LGD A;  2BYV E;  2I1K A;  4ICU A;  5J17 A;  2KTR B;  2XEW A;  3L54 A;  3LDZ E;  3PZD A;  1WZ3 A;  1WX8 A;  1OQY A;  3RUI B;  4KV2 A;  1XT9 B;  2KX0 A;  3VHT C;  1I35 A;  1R4M I;  1WJ6 A;  1E90 A;  3EHV A;  2FCN A;  3DDC B;  2IO0 B;  3T9L A;  4KIK B;  1QZE A;  3W1S A;  4PS7 A;  2DZM A;  4W9D A;  3WA0 A;  3DVG Y;  3ZTD A;  4W9C A;  4ZRK A;  3W1S C;  3UGB B;  4DDG D;  1V80 A;  4FJY A;  2XBB C;  1P9D U;  2HJ8 A;  2KDF B;  3HM3 A;  2IO1 B;  3CSF A;  4EKU A;  2DZI A;  3APF A;  1V5O A;  4AUQ C;  2KJR A;  4RM9 A;  4MJS B;  2KFK A;  2RSU A;  2VRR B;  3OAW A;  4ANX A;  3JYU A;  4WJN A;  3QX1 A;  2GBM A;  2NBU A;  3CMM B;  3BIN A;  2KK8 A;  4DDI D;  2RGF A;  4HPM B;  3APD A;  2WX1 A;  2NCN A;  3ZDT A;  2V4L A;  4I6L B;  2HTH A;  2OJR A;  3TCA A;  1RAX A;  2KNB A;  5G55 A;  3ZW3 A;  3L0W B;  3L17 A;  2CHX A;  4FBJ B;  4X57 B;  2MP2 A;  4W9G A;  3UIO B;  2N4F A;  2PJH A;  1BT0 A;  3IBE A;  3QQ8 B;  2BGF A;  4NY0 A;  2M8S A;  1Z5S B;  5CTR C;  3RYT A;  2AL3 A;  2AWT A;  3NOB A;  5D94 A;  5BO4 B;  4ZDV A;  4K1R B;  2DYB A;  5DPT A;  3TBL D;  2C60 A;  2L3Z A;  3CF6 E;  1VCB A;  2JRH A;  2KDE B;  4JIO U;  3KUD B;  5DCN A;  4G50 A;  5C1Z A;  3VXW A;  4JLC A;  3H1U A;  3HHM A;  4HXD A;  5E6N A;  1WGG A;  3PRM B;  3MJW A;  2ZJD A;  4F8C B;  2O6V A;  4II3 B;  2J0M A;  4DXA B;  2AYO B;  2L7R A;  5CHF A;  2WWZ A;  1JRU A;  2FCS A;  1D3Z A;  3L08 A;  2REX A;  1TZ1 A;  4I6P A;  4HVB A;  3LJ3 A;  3PLV A;  2PE9 A;  2JZ3 B;  1NBF C;  2NPT A;  1WX9 A;  3H6N A;  4TUU A;  2JXX A;  1OGW A;  4NAW B;  4G0N B;  1WGR A;  4E74 A;  4W9H A;  3VTV A;  2MBO A;  5AZG A;  2KO3 A;  1NI2 A;  2KJ6 A;  2KLC A;  4HK2 A;  4WQO B;  3PT2 B;  3A1Q A;  2DYM A;  3AI5 A;  3QHT A;  4FN2 A;  4DHJ B;  2K8H A;  4EUT A;  1EF1 A;  3ZNG C;  2D2Q A;  2UWQ A;  1WJN A;  2KHW B;  1PQS A;  4N9F 4;  1GC7 A;  3JW0 X;  1TTN A;  4W9E A;  5LLI A;  2I1J A;  4EZK A;  2ZZP B;  4PS3 A;  4KDL B;  3U8Z A;  1GNU A;  3ECI A;  1GUA B;  3ML8 A;  4P7I A;  3IVF A;  4IC7 B;  2KX3 A;  2C7N B;  2V1Y A;  1WI0 A;  1CMX B;  4B95 A;  4GDL A;  4AJW A;  2FIF A;  1AAR A;  3ZRC A;  2LUE A;  3A9J A;  2MQJ A;  4KSK C;  2O2V A;  4M8M A;  1WXV A;  4MSQ B;  5C23 A;  4FUL A;  3UQA A;  2ZCC A;  4XX5 A;  1OEY J;  3P2B A;  1WR6 E;  3R3M A;  1EO6 A;  3N3K B;  3M62 B;  3GOE A;  3JSV B;  3NZS A;  4JL9 A;  4HDQ A;  3Q3J A;  4OVU A;  3SD5 A;  1E8Z A;  1KOT A;  3ZRF A;  2KJH B;  3AU4 A;  2LXA A;  4URK A;  1IYF A;  4WJO A;  2LVQ A;  3ALB A;  4ZRJ A;  5AZF A;  3U7D A;  3WAO A;  4BKS D;  4BFR A;  2LZ6 A;  1LM8 B;  2KMA A;  3WAL A;  4GOC A;  3A33 B;  4WWO A;  2K6D B;  2KTR A;  4AP4 C;  3DVG X;  2IO2 B;  4TKN A;  1E8X A;  4IUM B;  3SU8 X;  2A5U A;  2FUH B;  2LI5 A;  4EZL A;  5IA7 A;  2MBB B;  2DZK A;  2QHO A;  4FJV B;  4MEL A;  3ZDM C;  3TL5 A;  2C7M B;  1WFY A;  1J8C A;  2D3G A;  4MM3 A;  2C7H A;  1RRB A;  1IPG A;  2KZR A;  4GN1 A;  4HJK A;  4ASW C;  3B0A A;  5L95 C;  2DX5 B;  4BKT A;  4HWI B;  1WGY A;  4DK5 A;  4W9L A;  2CU1 A;  3VVW B;  4WJP A;  2KKC A;  4W9I A;  1WMH B;  1NDD A;  4TQ0 A;  1I42 A;  2YLM A;  4GU2 A;  3BY4 B;  2DAJ A;  2N9P C;  1RFA A;  4W9J A;  3DVN U;  2LVO A;  1UEL A;  5L83 A;  3QC8 B;  3QIJ A;  2L8J A;  2N9E B;  3KYD D;  4GMV A;  3U30 A;  1GC6 A;  1XQQ A;  4GGQ A;  1E5W A;  2EMT A;  3DBR I;  4K81 A;  2KMC A;  4G3X B;  1YX6 B;  2J7Q B;  3Q3F A;  3L10 B;  2MLB A;  5FR6 A;  4GSW A;  1V86 A;  2ZEQ A;  2L05 A;  3RT3 B;  3VUY A;  3WIM A;  3KYC D;  5D7G A;  1L2N A;  2BYE A;  2PE6 B;  1SIF A;  2BKF A;  1P98 A;  4PS8 A;  1C3T A;  2GBK A;  1WGD A;  4A3P A;  2D10 A;  1WJ4 A;  4XC2 A;  4TQ1 A;  2KDI A;  3B08 A;  2FCQ A;  4G11 A;  4CO7 A;  2V3S A;  3AXC A;  2FNJ B;  1WXA A;  3H7P A;  3L16 A;  4GXB A;  4HLE A;  1GG3 A;  4MGZ E;  3DQV A;  3DBL I;  2J0K A;  4FLH A;  3R66 C;  3UIN B;  1WGH A;  2KFK B;  3NS8 A;  2KXJ A;  3AUL A;  3NY5 A;  1LFD A;  2CR5 A;  4GDK B;  3EC8 A;  2K8C A;  3IFW B;  5CX3 A;  2D07 B;  2Z0E B;  2MX2 A;  2KLG A;  2KC1 A;  4NJ7 A;  3PVL A;  2DHZ A;  1V9J A;  1YX5 B;  2G45 B;  4ZYN A;  1RLF A;  4F7Z A;  2L0T A;  2MCN B;  2LJ5 A;  4GIV A;  1KM7 A;  4RM8 A;  2XK5 A;  3QWZ B;  1A5R A;  3S2A A;  4MSM B;  4BVU C;  3PS6 A;  3ZNH B;  1T0Y A;  4ANU A;  1IP9 A;  3PRE A;  4AWJ A;  1EF5 A;  5J2R A;  2CS4 A;  2BYF A;  1WRD B;  2MBQ A;  3DPD A;  2JF5 A;  4A20 A;  5JHB A;  1C1Y B;  3H9D A;  2N1W A;  4IWQ A;  4M0W B;  1UBQ A;  3ZNI D;  1V6E A;  2KWU B;  2IY1 B;  3KVF B;  2KC2 A;  3TIX A;  3EFU A;  3OLM D;  2WDT B;  4DBG A;  1YQB A;  4FJZ A;  1ISN A;  4EOY A;  3H7S A;  4IM2 A;  2G4S A;  4GDL B;  4DHZ B;  3PHX B;  1OEY A;  4HDO A;  4XZ4 A;  1ZGU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...