3DBRI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190gln-nedd8ala72arg)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
85
Chain Sequence
RRASVGSGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 85
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dbrI00
3L13A 4WWOA 4DHJD 2FNJB 3LDZE 3ZTDA 3R3MA 2DHZA 1ZKHA 5JH5C 4E71A 2C9WB 3ONSA 3ZW3A 4HDQA 4MH0E 3ALBA 2KWCA 3ML8A 3AI5A 3TL5A 1YIWA 2LUEA 3UQBA 2K6DB 2RR9A 3C0RB 1X1MA 3KUZA 1GNUA 2N1WA 5E6PA 2ZNVC 2G4DB 5BO4B 2ZCCA 4W9LA 2XBBC 2WDTB 2JZZA 2LWPA 2QHOA 4JL9A 3RD2A 3T9LA 3X0WA 4DBGA 5L95C 3PV1A 3L54A 1YX5B 1KM7A 2CR5A 2GBJA 1XT9B 4M8NA 1XQQA 2V1YA 2XK5A 2KDBA 3PLVA 3QJZA 4NAWB 2Y5BB 4PYUA 2CHXA 2KJRA 2DYBA 3EHVA 4FJYA 3WIMA 3AULA 2KFKA 3KVFB 1KLVA 3QQ8B 5JZEB 4YL8A 5D6JB 2KQSA 3W1SC 2KKCA 2KHWB 2PEAA 1J8CA 1S3SG 2MP2A 2BKFA 2OJRA 2AEHA 2DYOA 2LGYA 2ZPYA 3A9JB 4MJSB 2MBOA 3PPAA 3JW0X 4WWNA 1V5TA 1HE8A 4MELA 3PHWB 2L0TA 3DPDA 2IO0B 4ICUA 3P2BA 3BY4B 5CHVC 4HCNB 1WF9A 3ZDTA 2M17A 3QHTA 3H7SA 3AXCA 1Q0WB 4K7SA 2NCNA 5DPTA 4PYZA 4FLHA 2D11A 1GG3A 2KX3A 1WGHA 4WAAA 2CKHB 3CF6E 1LM8B 2LI5A 3M3JA 4ZRKA 3R7QA 4WJOA 2KVRA 4BKSD 5DPRA 1WMHB 4A3PA 5E6OA 4BKTA 3RUIB 1S1QB 2A4ZA 2C5LC 2KX0A 2KMCA 2L8JA 4ZDVA 1J0GA 3SU8X 1WE7A 4F7ZA 2JPHA 5J2RA 2R2OA 5JHAA 4B9KA 2C7MB 3CSFA 4ZYNA 1WE6A 2LXCA 3H7PB 4W9GA 2RSUA 3DVGX 4WJNA 4IWPA 2MLBA 1WXAA 4DHZE 2O2VA 1E5WA 4MGKE 1UBIA 3ZRFA 1WIAA 2N4FA 5LXHA 1M94A 1WI0A 2KLGA 1NDDA 3Q3JA 4HJKA 4CHKA 3N30A 4ZRJA 2MW5A 4W9IA 1SGHA 4II2B 4NJ6A 3PRZA 1Q1OA 3SHQA 2NBWB 2MBBB 1OGWA 2UWQA 4II3B 2O6VB 3RYTA 4W9DA 5JHBA 2MSED 1UH6A 4FBJB 4ANWA 1Y8RC 4PS8A 2NPTB 3JSVB 2DX5B 3PTFC 3PREA 4HXDA 5AZHA 3X23A 1E7UA 3VTWA 2MX2A 1WXVA 2JXXA 2Z0EB 3I3TB 4BBNC 4ANUA 2ZZPB 1IP9A 2DZMA 4KDIC 2AL3A 2HJ8A 2K25A 2JRIB 2PJHA 2PPHA 2DZKA 3QC8B 3R7RA 4KZ0A 2MBQA 1WZ0A 2MBHA 2LJ5A 4IWQA 3PT2B 3A9KA 3KW5B 3A33B 1OTRB 1R4MI 3ZNID 1P3QU 3M62B 3VVWB 3W1YA 3NHEB 3APFA 3HM3A 1I42A 1WZ3A 1TGZB 3SDLC 3PRMB 3QARA 1UD7A 1C3TA 4AWJA 4ANXA 1WJNA 2MQJA 3TMPB 3PVLA 2MRPA 5J18A 2GBMA 2LD9A 2MBEA 2NR2A 3VH3B 2N9XA 2ZJDA 2L0FA 1SE9A 2KC1A 2PE9A 3EFUA 4DWFA 1R4NI 2REXA 4B95A 5CTRC 1UGMA 2D3GA 4KSKC 3V61A 3PHXB 1LFDA 2AL6A 2JRHA 2KANA 4M8MA 3DBHI 2DYMA 5AZFA 3IVFA 4KVGB 2KDEB 3OJ4B 4K7UA 2LZ6A 1UZXB 2J7QB 3V6CB 2FIDA 4A20A 3DDCB 2CU1A 3PS6A 3VUWA 2KZRA 5J17A 2FAZA 2KK8A 3L0WB 1RLFA 3LJ3A 1V86A 2DZIA 1WX8A 1EF1A 2L76A 3U30A 2W9NA 3ZIMA 4J6IA 3A1QA 4BBNF 3R66C 3CSTA 4I6NB 2KOXA 3ML9A 5CHFA 3HK0A 2AYOB 2R2QA 1V80A 4KDLB 4JIOU 1LQBA 1FXTB 4NJ7A 2BGFA 2N9PC 2D10A 4NAWA 4WJQA 3VQIA 2LXAA 1IPGA 4GU2A 4AP4C 3PSEB 3RULA 1E8XA 1WJ4A 3ZVVA 4BFRA 1ZGUB 2BWFA 4AJWA 5CX3A 1WGDA 2HD5B 3QX1A 3QWZB 4TKNA 3TCAA 2MA9B 3M95A 3WANA 3A9JA 4MJSA 2IZVB 5C23A 4W9CA 2KJHB 1I35A 1KOTA 1WH3A 4W9HA 4GGQA 3UQAA 2BPSA 4MM3A 3UIPB 4HWIB 4BOZB 3QIJA 2KTRB 2J0KA 3ZNZB 5D2MB 5AEKB 3QCAA 3VTUA 1WRDB 1WJUA 3HM6X 2XK5B 2BYEA 2ZEQA 2KFJA 4MGZE 4FJZA 3PLUA 1GC6A 2NBVB 4FULA 1AARA 2KDFB 2KXJA 2O6VD 1GUAB 2M1MA 3DVGY 2GBNA 2VRRB 3JVZX 3M63B 2IO2B 4K1RB 4KIKB 2MP2B 3VXWA 4GDKA 2LVPA 4G11A 2BYFA 2LRUA 2L7RA 2J0MA 2KJ6A 1BT0A 1TBEA 2LVOA 2GBRA 2HTHA 2V4LA 3NZSA 3PZDA 1GC7A 4N9F4 4GIVA 5DCNA 2N7EA 2KWUB 4W9EA 2LASA 4CYEA 4I6LB 2PE6B 3ZDMC 3VAWA 2EKEC 4G3XB 5KHQA 3H1UA 3AU4A 3DBLI 1U4AA 1WGRA 3V62A 4OVVA 2B3AA 2JT4B 4LJOB 4GDLA 4NQKE 2FUHB 2O6VA 4FA6A 2DZJA 4TV3A 2N7DA 4BKSA 2DENB 2ZVNA 2NPTA 3WAOA 3QA8A 4HDOA 4HPLB 2N9EB 2IO1B 4WWPA 3B0AA 4LDTB 5AZGA 1ZW7A 2K8CA 4ICVA 3HIZA 2KWVB 1XD3B 1E8ZA 1NI2A 4BOSC 5TR5A 4DDID 4FN2A 3GZNI 1Z5SB 3S2AA 2ZVOA 4LJPB 2M8SA 1L7YA 2D2QA 2KD0A 3VDZA 2BKRB 2RPQA 2WX1A 1E8YA 4IW0A 2I1JA 2CHWA 2EMTA 3DVNV 2K6QA 3UINB 2Z59B 1UELA 1H8CA 4MDKE 1E8WA 2KQ7A 3K9PB 4W9KA 2FCSA 4DK5A 3ZRCA 5HKHA 3V60A 1UBQA 1WM2A 2HE7A 4JLCA 1Q5WB 4A3OA 4EEWA 4F8CB 3KYCD 4EFOA 3U7DA 2IYDB 5KHOA 1KJTA 3EECA 1YX6B 2G3QB 4G50A 3TBLD 4NY0A 1EUVB 3WAPA 4KV2A 3ZLZA 3ZO5B 5DPWA 3JYUA 4IM2A 1OEYJ 2JVCA 2GOWA 2BYVE 4P7IA 2K8BA 5G55A 2KN5A 1YJ1A 4IUMB 3EC8A 4GOCA 2JUOA 2KMAA 1MG8A 4G0NB 5EDSA 2RD0A 2GBKA 1OEYA 3IG3A 1P98A 2OOBB 3A9KB 4XX5A 4PS7A 4JGHB 1RFAA 5C1ZA 3DOWA 3N32A 3W1SA 1WYWB 3L16A 3HHMA 2JF5A 5GMVA 5D7GA 2L3ZA 3D32A 1WJ6A 3KUDB 1CMXB 2BF8B 1L2NA 1WR6E 2ASQA 3IHPC 4KZCA 3H9DA 3ZTCA 4W9FA 4URKA 4OVUA 3DBSA 4WJPA 4EUTA 2L05A 2N1VA 2CHZA 2NS5A 4GXBA 4E74A 3ZNHB 4MEMA 2JY6A 1V2YA 3A4SC 4ANVA 4HCPB 2I1KA 2V3SA 4K7WA 2DAFA 3NS8A 4DHZB 3KYDD 3OJ3A 1WXSA 4FHJA 2M0XA 2G4SA 3QAQA 1J19A 5D94A 3ZKJC 4I6PA 3APDA 2ZCBA 3TJPA 4FJVB 1V5OA 2BWES 2C7NB 3VUYA 1P9DU 5IA7A 3PGEA 4TUUA 4RM9A 4PS3A 4RM8A 4DXAB 3MTNB 2XEWA 2C7HA 2LVQA 3RCZA 1VCBA 1C1YB 5CHWA 3KH0A 1RRBA 3AU5A 3A1QB 4M0WB 4DHJB 2AWTA 2RGFA 2KTRA 4TQ1A 3VHTC 1QZEA 3WAMA 3SD5A 4AJYB 4CO7A 3VTVA 4WQOB 2K39A 4MSQB 2A5UA 2JZ3B 3UGBB 1IYFA 2K1FA 2IBIB 4FADA 1G6JA 3DVNU 4K81A 4B6WA 1A5RA 3V6EB 1H4RA 4ASWC 1WM3A 2KFKB 1NBFC 3ECIA 2FCNA 5IAAC 1WMHA 4JQWC 1E90A 4KIKA 3DBRI 1OQYA 3MJWA 3IFWB 3L17A 4LDTD 2NBUA 1T0YA 1TTNA 3ZNGC 4F1SA 2L00B 5LLIA 3DQVA 3RZFA 1WR1A 3B08A 1TZ1A 3H7PA 4XZ4A 1P0RA 1WY8A 4HPMB 2Z0DB 4LCDE 2IY1B 3K9OB 4GN1A 2LGXA 5L83A 1D3ZA 1WXMA 2GMIC 2KTFA 5LXIB 3CMMB 3B1LX 4BKGA 2NVUI 2FCQA 2FIFA 5G2NA 3NY5A 4IWOA 4EZJA 2DAJA 4ZRIA 2ZPNA 3ENEA 2KNBA 2WX0A 3JSVA 4IG7B 2K8HA 1EO6A 4GDKB 3GOEA 1WGYA 4IM3A 4KSLC 1LXDA 3RT3B 2UYZB 4AUQC 2KO3A 2MWSB 3OAWA 5E6NA 3DCGA 4BVUC 4RMAA 4X57B 4HLEA 1WGGA 2CS4A 2FCMA 2EMSA 4NQLB 2YLMA 1ISNA 1WX9A 3APCA 2O2VB 3U8ZA 2IO3B 2LGDA 3VFKA 3L08A 4MSMB 3ZUNA 3VH4B 4IM0A 4EKUA 3UF8A 4GDLB 2KC2A 3NOBA 4NNJB 1YQBA 1WFYA 3MHSD 1SIFA 2LRWA 1YD8U 3VUXA 2C60A 1V9JA 3L10B 3WA0A 4DDGD 3NZUA 3OLMD 1WX7A 5DPSA 4TQ0A 3WALA 3N3KB 4AOFA 1JRUA 3TIXA 3KUCB 4GSWA 1GJZA 1F9JA 1V81A 1P1AA 2MCNB 4GB9A 2JWZA 2WWZA 1PQSA 3BINA 4GMVA 3O65B 4FHKA 3QK0A 2J0JA 4HVBA 1EF5A 3IBEA 1E7VA 3RZWC 1VD2A 1V49A 1V6EA 2ZNVB 3T8MA 4XC2A 3Q3FA 3H6NA 4MGIE 4EZKA 2KLCA 4IC7B 2M4NA 3UIOB 4EZLA 2IY0B 4MGYE 4EOYA 2KDIA 2G45B 4NPNA 2D07B 2YVCA 4W9JA 2WYQA 3A4RA 4HK2A 4E3CA 5FR6A 3PRPB 1K8RB 1Z2MA 1RAXA
chains in the Genus database with same CATH superfamily
4DHJD 3LDZE 2DHZA 1ZKHA 1FXIA 2MJDA 2IGHA 2MHJA 1FNVA 4MH0E 3AECB 3ML8A 1F52A 2BBCA 4NZLB 1YIWA 3EGRA 2K6DB 1JROA 2KVZA 1A70A 1GNUA 2K22A 5E6PA 2G4DB 3HVZA 3SEBA 2XBBC 4Q2JA 2LWPA 1I4GA 3CWIA 3X0WA 4C56C 5L95C 1IUEA 3EA6A 3PV1A 3L54A 1XT9B 4HJGE 2KDBA 3ZXVA 3QJZA 1ESFA 2Y5BB 4JX1C 2CHXA 1N63A 4M02A 3W1SC 2KQSA 2KHWB 2PEAA 3HUIA 3AE2B 2OJRA 2BKFA 2LGYA 2MBOA 1HE8A 4MELA 2L0TA 1J7BA 4HCNB 1WF9A 1FEHA 3QHTA 1RM6C 3LYYA 4XYCA 4UDUC 3CF6E 1LM8B 3R7QA 1GPXA 1IGCA 4CQNA 4BKTA 3HRDD 1S1QB 2L8JA 2OJWA 1T0RC 1WXAA 1E5WA 1M94A 1PDXA 4HJKA 4CHKA 3Q8EA 3P4RB 4II2B 4OHJA 1Q1OA 2NBWB 1JWUD 2UWQA 2O6VB 3RYTA 1AN8A 2MSED 4HXDA 3VTWA 5BMHA 2MX2A 1MVKA 1PGAA 4LTUA 4L1BA 4N59A 2PJHA 2PPHA 1HZ6A 1WZ0A 2MBHA 4IWQA 4ZHOA 3A33B 1R4MI 2WU5B 2GRIA 3Q3MC 1WZ3A 1XCQL 3PRMB 3HVDA 1UD7A 3TMPB 3PVLA 2LD9A 3W5UB 2N9XA 2PE9A 3EFUA 4B95A 1UGMA 2D3GA 4P16A 3PHXB 1MPEA 2AL6A 3I63C 5HFYA 4ARCA 4M8MA 3DBHI 3N20C 4KVGB 3OJ4B 4K7UA 1N5XA 1UZXB 2RPVA 2J7QB 3DDCB 3PS6A 1E9MA 1UGJA 3LJ3A 1WX8A 4BBNF 2L1AA 3R66C 4HEA1 4I6NB 2KOXA 5CHFA 4KDLB 5H8YE 5MPOA 1FXTB 4NJ7A 2D10A 4WJQA 1VJKA 4HRSA 1ZUD2 1UWXA 3ZVVA 1K52A 2BWFA 3MFGA 5CX3A 4A9AA 2DNFA 3SR6A 2WDQB 2HD5B 1R4NB 2JWUA 2XNAC 3M95A 1WYGA 4MJSA 4W9CA 1TKYA 1I35A 4W9HA 2BPSA 4RGMA 4KKIA 4P1CC 3ZNZB 5AEKB 3VTUA 1WRDB 1WJUA 3HM6X 1HEZE 2KFJA 1R7SA 1TKGA 1GC6A 4RCOA 1GUAB 3DVGY 3LB8C 2VRRB 4EE2A 2LMCA 1JALA 2MP2B 1F77A 5EE0A 1V1PA 1XCTL 4A6QA 1TBEA 2YEPB 3Q8BA 1RYJA 2HTHA 1DOYA 1KLGD 2KWUB 2GLSA 3U2SC 3ZDMC 4G3XB 2CU3A 3NVYA 5KHQA 1WGRA 4NQKE 1FRDA 2DZJA 4TV3A 2ZW1A 3ZJTA 2DENB 2NPTA 3WAOA 2N9EB 4ICVA 4BOSC 5TR5A 1QOFA 1YJIA 3RNCC 1L4ZB 1Z5SB 3GZNI 3S2AA 2ZVOA 2RPQA 2WX1A 4IW0A 2Y5PA 2CHWA 3RNEC 1H8CA 2KMMA 2EKIA 3KYCD 3EECA 2N7JA 1EUVB 4WIPA 2BYVE 4P7IA 2BTEA 1N60A 3EC8A 4GOCA 2JUOA 4OW0A 4G0NB 3DBLB 3IG3A 5C1ZA 1FPYA 1YJJA 2WXGA 4LNFA 1I4RA 4WH4A 1PFDA 1WJ6A 2BF8B 2WS3B 2ASQA 3T3NA 4L23A 3DBSA 5HG2A 5LNK1 1NENB 3ZNHB 3IXSA 3AE3B 4HCPB 2PLPA 1JWMD 4K7WA 1T6BX 1WXSA 4FHJA 2M0XA 2G4SA 3ZKJC 5D94A 1BMLC 3ZJUA 3AV8A 4XE0A 4FJVB 4RFBA 5I4DA 3VUYA 1P9DU 1C76A 1TS2A 3PGEA 4YSZB 4JE3B 3N1ZC 5C2TB 1TJEA 4RM8A 4DXAB 2XEWA 2KAJA 3FC4A 3MP9A 1RRBA 2K3UA 3A1QB 4LNOA 2AWTA 1SXTA 2KTRA 1L0YB 1ZXIA 2RDGA 3VHTC 2VZKD 3SD5A 1TYGB 3UGBB 2PVOD 1FFVA 2K1FA 1NVID 4FADA 3DVNU 4K81A 2KYWA 3C8YA 1H4RA 3P4SB 1NBFC 2MH7A 1E90A 3MJWA 3IFWB 2NBUA 3NJTA 1HZ5A 1TTNA 3ZNGC 3TEWA 4F1SA 3N9YC 1HTOA 1KLUD 1TZ1A 4HPMB 2Z0DB 2IY1B 4GN1A 4YXDB 5L83A 1F2RC 2QEJC 5AUKA 4LK0M 2FCQA 1JWBD 5EE1A 4IWOA 4EZJA 3ENEA 2KNBA 3U4EG 1UWMA 4GDKB 1WGYA 1EU3A 2KO3A 1ET9A 2KN4A 3APCA 1T0SC 3VH4B 4US8A 5JXVA 1WFYA 2W55A 3MHSD 2LRWA 1V9JA 2BQQA 3L10B 5DPSA 1I4XA 1Q10A 3N3KB 2IPKD 4GSWA 5H92C 2JWZA 3BINA 2J0JA 1EF5A 4YTPB 5HI1A 1N62A 4XC2A 3BK1A 3Q3FA 3H6NA 3P63A 3U7ZA 4EZKA 4EZLA 2KDIA 4ITKA 3V3XA 2YVCA 4W9JA 1SSNA 4HK2A 2DWQA 5FR6A 4E3CA 1K8RB 1RAXA 3L13A 2FNJB 5JH5C 2C9WB 3IAS1 4HDQA 2H89B 1I7HA 2KWCA 3TL5A 3AI5A 3UQBA 2RR9A 2W54A 5D3DA 2N1WA 1HTQA 2ZNVC 4N58A 1OQRA 1NI3A 2JZZA 2QHOA 3TEXA 4JL9A 1QLBB 1R4MB 4YSYB 2CR5A 1KM7A 4M8NA 2GBJA 3NVWA 2V1YA 3PLVA 3WIMA 3AULA 3LXFA 5GXGB 1KLVA 2BS4B 1ET6A 2MP2A 3BVMA 2AEHA 2ZPYA 4MJSB 4XWWA 3PPAA 4WWNA 1EU4A 3DBHB 3PHWB 2IGDA 3ZDTA 3DHHC 2M17A 2XN9C 4KKJA 3H7SA 3AXCA 4K7SA 2LHDA 5DPTA 4A90A 4PYZA 2D11A 1GG3A 2KX3A 2LI5A 4DXGA 4ZRKA 2KVRA 1L5PA 1QKZA 2KMCA 1WE7A 3I5JC 4ZYNA 1WE6A 2LXCA 4W9GA 2RSUA 1TY2A 4IWPA 5LXHA 4XDDA 1SGHA 3Q8FA 1FXAA 3SHQA 1UH6A 2KWDA 1MFWA 5AZHA 1FNUA 2NPTB 2DX5B 3JSVB 3AEBB 1E7UA 2ZW0A 4ANUA 1WXVA 1ZDXA 4ZRQA 1I4HA 2DZMA 4KDIC 2K25A 1BUIC 3RNBC 3PT2B 3KW5B 1OTRB 3B9JA 3ZNID 4IOIE 3M62B 3NHEB 3APFA 1C77A 1TGZB 4ANXA 1WGKA 1WJNA 4DQOC 2MRPA 3EUB2 1SE9A 1K51A 2KC1A 4DWFA 2QSDA 4LLGM 1LFDA 2QCZA 2LJIA 3BK2A 2LZ6A 3I57A 1L6VA 5BMIA 2WDRB 3V6CB 2L52A 3VUWA 4JWUC 5J17A 2KK8A 4TSSA 1VLBA 2B76B 3GZNB 1V86A 2DZIA 1YMHE 1EF1A 4C7YA 5TSSA 2M0AA 3A1QA 4YTMB 3CSTA 3HK0A 2AYOB 1LQBA 4ARIA 2BGFA 2N9PC 4S0RA 4NAWA 4AP4C 3RULA 1J7CA 4ZRPA 2G9HD 1FO4A 1CJEA 1WGDA 4MACA 5EE9A 3RFZB 3QX1A 4TKNA 2MA9B 3WANA 3A9JA 2IZVB 2IGGA 1KOTA 4ZOHC 3BVZA 3UQAA 1T0QC 2KTRB 4OZCA 1KFYB 4MGZE 3PLUA 2LEKA 2PVGC 4FULA 2KDFB 2KXJA 3V05A 2M1MA 3JVZX 4H2AA 3RNFC 4K1RB 2DLBA 4GDKA 2L7RA 2LRUA 1BT0A 2LVOA 3NZSA 3AE4B 3PZDA 1MJDA 2N7EA 4CYEA 4W9EA 3VAWA 4HPPA 4C4VB 3H1UA 3AU4A 1U4AA 3FILA 3V62A 4OVVA 3AEDB 1SJED 4NJCA 3KWLA 1SE4A 2ONQA 1YN4A 4FA6A 4BKSA 2INNE 2ZVNA 4HDOA 3B0AA 1JWAD 2GI9A 4LDTB 2WDVB 3HIZA 1NI2A 3NUHB 2QMTA 2EELA 4LJPB 1F0ZA 1L7YA 2KD0A 3NS1A 3RI7C 3EFCA 2J4XA 2I1JA 2EMTA 4W9KA 4DK5A 2FCSA 4EEWA 4JLCA 1UUPA 1E0ZA 1MG4A 3AEGB 3ZO5B 1E7PB 2D3BA 4G50A 4NY0A 4S17A 3TBLD 4KV2A 1OEYJ 2GOWA 5G55A 2K8BA 1GAQB 2GBKA 1OEYA 1P98A 2OOBB 3A9KB 4XX5A 1I4QA 1RFAA 3TEYA 3N32A 1QILA 2L3ZA 3D32A 1ENFA 5FKAC 1L2NA 1WR6E 3ZTCA 3H9DA 3Q14C 4OVUA 4EUTA 5G5GA 3A4SC 4ANVA 2I1KA 5IP4D 5IKCM 1IBXA 3NS8A 4B0EA 3KYDD 3NVZA 2LGIA 3W9CB 2X8XX 1JRPA 3URYA 1V5OA 1J7AA 2BWES 2C7NB 5IA7A 4RM9A 4PS3A 4AS1A 3MTNB 1BXTA 2LVQA 5T8IA 1VCBA 4K3BA 1C1YB 4DHJB 3E56A 5C3JB 1M4VA 1Y56A 4TQ1A 2I2YA 1QZEA 3WAMA 1IYFA 2WXJA 4MSQB 4P1BC 4JPSA 1G6JA 2Y3AA 1KF6B 4B6WA 4ASWC 3NRZA 4A55A 3ECIA 3Q2AC 4RGOS 4BAXA 4KIKA 3DBRI 3GE3C 1T0YA 3RNAC 4JWSC 5LLIA 1TS3A 3DQVA 3RZFA 1WR1A 1P0RA 1WY8A 2LGSA 3K9OB 2LGXA 1WXMA 3CMMB 4BKGA 1D5XC 3UI3A 3ETRA 3NY5A 3SFEB 2DAJA 4ZRIA 2ZPNA 1D5MC 3JSVA 4IG7B 2K8HA 3VR9B 1UF0A 4IM3A 1V1OA 1LXDA 2QJLA 4AUQC 2MJEA 4X57B 2CS4A 1V8CA 2YLMA 1ISNA 1ZP0B 2WP9B 2NTSA 3VFKA 3ZUNA 1QT9A 4WQMA 3N1YC 1YQBA 2MJ3A 1SIFA 1KTKA 1SEBD 3WA0A 1JRUA 2UU7A 4K3CA 1F9JA 2JXTA 3L4PA 1P1AA 4C80A 4GB9A 1F2RI 4IDIA 2WWZA 4GMVA 3O65B 3QK0A 4HVBA 3TEZA 2ON8A 3P4PB 2N9KA 1V6EA 1XEEA 4IKGA 4REZA 2W3SA 1EM7A 1DYQA 2KLCA 4IC7B 2M4NA 1WSPA 2J52A 2G45B 1QOBA 3FKYA 2WYQA 2OEDA 1FCLA 3PRPB 1PYWD 1FM0D 4WWOA 2WGSA 1CQVA 3ZTDA 3MHZA 3R3MA 3KQ4A 3ONSA 3ZW3A 3ALBA 2V3PA 5D3IB 2INCC 2WHIA 1FMAD 2N9LA 2AQ3B 2ZCCA 1JQ4A 1E6EB 1FD6A 1C78A 2QDFA 4ZHPA 1DOIA 1XQQA 4NAWB 3ZYYX 2DYBA 3ZGZA 3QQ8B 5JZEB 4RH6A 5D6JB 2KKCA 1J8CA 3A9JB 1CK1A 2HDEA 3JW0X 1V5TA 2TSSA 4ICUA 2IO0B 5CHVC 2BB6A 1XLPA 1FIQA 4C4VA 2NCNA 2WXMA 4FLHA 3E9SA 1SB3C 1VR9A 4WJOA 5DPRA 1WMHB 4A3PA 2A4ZA 3SU8X 5J2RA 2R2OA 2INPE 2C7MB 1RWSA 3C19A 3AE6B 3H7PB 3DVGX 4WJNA 2PKOA 2MLBA 4DHZE 2O2VA 3ZRFA 4MGKE 1WIAA 3Q3NC 3R8BA 2KLGA 3FILB 3Q3JA 4D2KA 2AQ1B 3N30A 2MW5A 5FR3A 4NJ6A 3PRZA 2V9HA 4HKQA 1OGWA 4II3B 4KGSA 4FBJB 1Y8RC 2BVCA 2WU2B 2Z0EB 4RGTA 2JXXA 3I3TB 1QOGA 2ZZPB 1IP9A 2QIEB 1C4PA 2AL3A 3ABVB 2ICIA 3QC8B 3VR8B 2DZKA 2J42A 3PO0A 2MBQA 3A9KA 1UNSA 3VVWB 3GB1A 3W1YA 1L0XB 3QARA 3AN1A 1TZOA 2GBMA 2MBEA 3AE9B 3VH3B 2ZJDA 2L0FA 4KGRA 1R4NI 2REXA 5CTRC 3V61A 4M01A 2DYMA 2WXRA 3IVFA 2KDEB 2WQYB 1STEA 3OG5A 2FIDA 4A20A 3Q69A 2WXFA 3TUOA 2FAZA 1JW9D 1NYRA 1RLFA 1AW7A 2L76A 3U30A 4J6IA 1N6ZA 2LHEA 2KT7A 3ML9A 1IBXB 2R2QA 4RNAA 3AB5A 1WRIA 3VQIA 1IPGA 2WNMA 1WJ4A 2L32A 2N0SB 1N61A 4AJWA 3Q8CA 3QWZB 2V0GA 2CJNA 4GGQA 4MM3A 2M56B 3BVGA 1TS5A 2J0KA 5D2MB 3QCAA 3NVVA 2XK5B 2ZEQA 1ZXHA 1D6EC 2NBVB 2O6VD 1TT5B 2GBNA 3M63B 2IO2B 4KIKB 3VXWA 1JCKB 2LVPA 4G11A 2BYFA 2J0MA 1OFFA 2KJ6A 1GC7A 4GIVA 3BYTB 3FAHA 2PE6B 2EKEC 3MC9A 3B2FA 2VZKB 3DBLI 2W3RA 2BT6A 2B3AA 2JT4B 3KWVA 4LJOB 2D3AA 2BYTA 3MC8A 1C4AA 3DHGC 5IN7A 2N7DA 3QA8A 4WWPA 4YSXB 3BYYB 5AZGA 1ZW7A 4C7ZA 1N5WA 1NYQA 4FN2A 2KACA 5BYSA 3VDZA 3Q8AA 1E8YA 2LFIA 3KLSX 3UINB 2K6QA 2Z59B 4MDKE 5G5HA 2KQ7A 3K9PB 5HKHA 3V60A 1WM2A 3DBRB 4A3OA 4F8CB 1Q5WB 4EFOA 3U7DA 2G3QB 4A8XC 3ZLZA 5DPWA 3JYUA 4WAFA 2BS2B 2KN5A 4IUMB 3NG0A 2KMAA 4USAA 2RDBC 1TIFA 2JYTA 3W1SA 3HHMA 2RDHA 2JF5A 3AEAB 5GMVA 2RMMA 3KUDB 4R3DA 4KZCA 4W9FA 4URKA 4WJPA 2N1VA 2CHZA 2NS5A 4E74A 2PIAA 3NZ3A 2I38A 2JY6A 1I4PA 1ZE3D 1QF6A 1LO5D 4I6PA 1B9RA 2ZCBA 1ZDVA 4TUUA 2HJ1A 2C7HA 4WURA 1SE2A 5CHWA 3KH0A 3AU5A 4M0WB 2RGFA 2PW9A 4YT0B 2Y5CA 4WQOB 3MC0B 2KDMA 2IBIB 3R2IA 1A5RA 4C00A 1WM3A 1SIJA 5IAAC 1WMHA 1TS4A 2IDYA 1XLQA 1OQYA 3L17A 4XDCA 3R2TA 2L00B 1K50A 3B08A 1P7EA 4XGAB 3H7PA 1SE3A 4LCDE 1D3ZA 2KTFA 3B1LX 2NVUI 4N6EB 1EO6A 4KX6B 5E6NA 3OAWA 3RMKC 4HLEA 4RMAA 1WGGA 2R61A 2FCMA 4NQLB 1WX9A 2D5GA 2O2VB 2LGDA 3L08A 3Q3OC 4MSMB 5E6JA 4IM0A 4EKUA 3UF8A 4GDLB 2PTLA 2V4IB 2WXHA 1SF0A 2C60A 4O1NA 3IT6B 4DDGD 1WX7A 3MJ5A 4TQ0A 4AOFA 4ZYSA 3TIXA 1T3QA 1K53A 1GJZA 1V81A 3AE7B 2WXPA 4FHKA 4M00A 3AMZA 1VD2A 1VDVA 1GB1A 2ZNVB 3T8MA 1JMLA 1FCCC 3UIOB 3GS2A 4MGYE 4EOYA 2JU6X 4NPNA 2D07B 2E3TA 1Z2MA 2WLBA 1AYFA 1EWCA 4E71A 3Q6BA 1DGJA 3N1XC 2LUEA 4PT5A 1KH0A 3C0RB 1MHXA 1X1MA 3KUZA 3AH7A 2OHFA 4LNNA 4W9LA 5BO4B 2WDTB 3SFDB 3RD2A 3T9LA 4DBGA 1XXGA 4OZBA 1YX5B 4L2YA 2XK5A 4OZAA 1WXQA 1XLNA 1SBBB 4PYUA 2KJRA 3EHVA 2VH1A 4FJYA 2KFKA 3KVFB 2K5PA 1YN5A 4YL8A 3GE8C 3BIID 4LNKA 1S3SG 1ROEA 2DYOA 2IJ0A 1VZ7A 3VRAB 4MM3B 3DPDA 1YQ4B 3P2BA 3BY4B 1Q0WB 1VZ6A 3IT4B 1FNWA 4WAAA 1WGHA 2CKHB 1HXYD 3M3JA 2WXIA 4BKSD 4PK1A 1KRHA 5E6OA 1MHHE 3RUIB 2JYEA 2KX0A 1LGRA 2C5LC 1ZPSA 4ZDVA 1J0GA 2QC8A 4F7ZA 2JPHA 5JHAA 4B9KA 3CSFA 1D5ZC 4AQ7A 3GP7A 4DXFA 2SEBD 3AE8B 4YTNB 1UBIA 2N4FA 1WI0A 1NDDA 1WWTA 4ZRJA 4W9IA 4OVZA 2DBYA 3BWUD 2MBBB 5JHBA 4W9DA 1OQQA 5HHDG 4ANWA 4PS8A 2J53A 3PTFC 3PREA 3TSSA 5FK9C 3X23A 1T5XD 4KGTA 4HROA 4BBNC 1QQRA 1XF5L 2HJ8A 2JRIB 2FE8A 3R7RA 4KZ0A 2LJ5A 4RF1A 1EWYC 3P1MA 1XO3A 1P3QU 3HM3A 1I42A 3SDLC 1C3TA 4AWJA 2MQJA 2VH2A 5J18A 2NR2A 5BYRA 1PGBA 2K9XA 1YN3A 4KSKC 2JRHA 2KANA 2X38A 4FXCA 5AZFA 2BB5A 3RNGC 2CU1A 4US9A 2KZRA 2FBWB 1C9FA 1PGXA 3L0WB 4TMAB 2W9NA 3ZIMA 1C79A 1GB4A 4M0WA 4MH8A 1GOZA 2JSVX 3P42A 1V80A 4JIOU 1VZ8A 2LXAA 1NEKB 4GU2A 3PSEB 1E8XA 3RPFC 4BFRA 1TKEA 1ZGUB 2PMVA 1VRAB 2W82A 3OWEB 3TCAA 5C23A 2KJHB 3PZ7A 1WH3A 2Z8LA 3UIPB 4HWIB 3PZ8A 4BOZB 3QIJA 3IAM1 4LNIA 2FUG1 1F1HA 1L0VB 2BYEA 2KQ4X 4YWGG 3AE5B 4FJZA 2WXQA 1AARA 2NTTA 3ZXRA 2JX5A 4P6VF 2V4LA 2GBRA 4N9F4 5DCNA 2LASA 3T3OA 4I6LB 1MI0A 2WXKA 1YQ3B 4HKZE 2G1EA 5BMGA 2E6XA 4NAMA 1CZPA 3VRBB 4GDLA 2HTME 2ACZB 2FUHB 2O6VA 3AEEB 4HPLB 2IO1B 2H88B 2K8CA 2KWVB 1XD3B 1E8ZA 3B2GA 4DDID 3J9CA 2M8SA 2D2QA 2L83A 2CJOA 2BKRB 3AM9A 2QILA 4ACFA 3DVNV 4QAYA 1UELA 4J3OD 1E8WA 1ZOYB 3ZQ4A 3ZRCA 1UBQA 2HE7A 1ACCA 2MEKA 2BS3B 2IYDB 5KHOA 1KJTA 1YX6B 3CIRB 3WAPA 4IM2A 2JVCA 1YNTE 1L6UA 1YJ1A 1MG8A 5EDSA 2RD0A 1FFUA 4PS7A 1HA5A 4JGHB 3DOWA 5BYQA 3U52E 1WYWB 3L16A 2WXNA 5D7GA 2GB1A 1CMXB 3IHPC 3W2DA 2L05A 2K0PA 4GXBA 4MEMA 4BZAA 1V2YA 2JZPA 2V3SA 2DAFA 4DHZB 3OJ3A 3I9V1 3ZJVA 3QAQA 1J19A 4MT5A 2M19A 2YEPF 3APDA 3TJPA 2AQ2B 4GLSC 1XLOA 2WXLA 4RF0A 3RCZA 4B0MA 1P7FA 3O13A 1FRRA 1RFKA 4CO7A 4AJYB 2NMQA 3VTVA 2K39A 2A5UA 2JZ3B 1D4BA 2Q5WD 1SJHD 3V6EB 2KFKB 2FCNA 4JQWC 4LDTD 2V3NA 1B1ZA 4XZ4A 1PUTA 3DWMA 4WWMA 2GMIC 5LXIB 3H8HA 3BZDB 1TY0A 2BW2A 2FIFA 5G2NA 1DOXA 2WX0A 5AUIA 2INDC 3GOEA 1V1PB 4KSLC 3DWGC 3RT3B 2UYZB 2MWSB 2SAKA 3DCGA 4BVUC 2EMSA 1HQRD 3U8ZA 2IO3B 5IO9A 1IGDA 2KC2A 3NOBA 4NNJB 3VUXA 1YD8U 3WCQA 3RN9C 3NZUA 3OLMD 3W5VB 3WALA 3KUCB 3AE1B 1AWDA 3DHIC 5IOIA 2MCNB 2LUMA 1JWSD 1PQSA 1L4DB 1E10A 2D3CA 5EE3A 3IBEA 1YOVB 1E7VA 3RZWC 2WXOA 3AEFB 1V49A 1QOAA 1C4CA 4MGIE 2JQRB 2IY0B 2AX5A 1V97A 4RGNA 3P4QB 3A4RA 4XWTA
chains in the Genus database with same CATH topology
3L13A 4WWOA 4DHJD 2FNJB 3LDZE 3ZTDA 3R3MA 2DHZA 1ZKHA 5JH5C 4E71A 2C9WB 3ONSA 3ZW3A 4HDQA 4MH0E 3ALBA 2KWCA 3ML8A 3AI5A 3TL5A 1YIWA 2LUEA 3UQBA 2K6DB 2RR9A 3C0RB 1X1MA 3KUZA 1GNUA 2N1WA 5E6PA 2ZNVC 2G4DB 5BO4B 2ZCCA 4W9LA 2XBBC 2WDTB 2JZZA 2LWPA 2QHOA 4JL9A 3RD2A 3T9LA 3X0WA 4DBGA 5L95C 3PV1A 3L54A 1YX5B 1KM7A 2CR5A 2GBJA 1XT9B 4M8NA 1XQQA 2V1YA 2XK5A 2KDBA 3PLVA 3QJZA 4NAWB 2Y5BB 4PYUA 2CHXA 2KJRA 2DYBA 3EHVA 4FJYA 3WIMA 3AULA 2KFKA 3KVFB 1KLVA 3QQ8B 5JZEB 4YL8A 5D6JB 2KQSA 3W1SC 2KKCA 2KHWB 2PEAA 1J8CA 1S3SG 2MP2A 2BKFA 2OJRA 2AEHA 2DYOA 2LGYA 2ZPYA 3A9JB 4MJSB 2MBOA 3PPAA 3JW0X 4WWNA 1V5TA 1HE8A 4MELA 3PHWB 2L0TA 3DPDA 2IO0B 4ICUA 3P2BA 3BY4B 5CHVC 4HCNB 1WF9A 3ZDTA 2M17A 3QHTA 3H7SA 3AXCA 1Q0WB 4K7SA 2NCNA 5DPTA 4PYZA 4FLHA 2D11A 1GG3A 2KX3A 1WGHA 4WAAA 2CKHB 3CF6E 1LM8B 2LI5A 3M3JA 4ZRKA 3R7QA 4WJOA 2KVRA 4BKSD 5DPRA 1WMHB 4A3PA 5E6OA 4BKTA 3RUIB 1S1QB 2A4ZA 2C5LC 2KX0A 2KMCA 2L8JA 4ZDVA 1J0GA 3SU8X 1WE7A 4F7ZA 2JPHA 5J2RA 2R2OA 5JHAA 4B9KA 2C7MB 3CSFA 4ZYNA 1WE6A 2LXCA 3H7PB 4W9GA 2RSUA 3DVGX 4WJNA 4IWPA 2MLBA 1WXAA 4DHZE 2O2VA 1E5WA 4MGKE 1UBIA 3ZRFA 1WIAA 2N4FA 5LXHA 1M94A 1WI0A 2KLGA 1NDDA 3Q3JA 4HJKA 4CHKA 3N30A 4ZRJA 2MW5A 4W9IA 1SGHA 4II2B 4NJ6A 3PRZA 1Q1OA 3SHQA 2NBWB 2MBBB 1OGWA 2UWQA 4II3B 2O6VB 3RYTA 4W9DA 5JHBA 2MSED 1UH6A 4FBJB 4ANWA 1Y8RC 4PS8A 2NPTB 3JSVB 2DX5B 3PTFC 3PREA 4HXDA 5AZHA 3X23A 1E7UA 3VTWA 2MX2A 1WXVA 2JXXA 2Z0EB 3I3TB 4BBNC 4ANUA 2ZZPB 1IP9A 2DZMA 4KDIC 2AL3A 2HJ8A 2K25A 2JRIB 2PJHA 2PPHA 2DZKA 3QC8B 3R7RA 4KZ0A 2MBQA 1WZ0A 2MBHA 2LJ5A 4IWQA 3PT2B 3A9KA 3KW5B 3A33B 1OTRB 1R4MI 3ZNID 1P3QU 3M62B 3VVWB 3W1YA 3NHEB 3APFA 3HM3A 1I42A 1WZ3A 1TGZB 3SDLC 3PRMB 3QARA 1UD7A 1C3TA 4AWJA 4ANXA 1WJNA 2MQJA 3TMPB 3PVLA 2MRPA 5J18A 2GBMA 2LD9A 2MBEA 2NR2A 3VH3B 2N9XA 2ZJDA 2L0FA 1SE9A 2KC1A 2PE9A 3EFUA 4DWFA 1R4NI 2REXA 4B95A 5CTRC 1UGMA 2D3GA 4KSKC 3V61A 3PHXB 1LFDA 2AL6A 2JRHA 2KANA 4M8MA 3DBHI 2DYMA 5AZFA 3IVFA 4KVGB 2KDEB 3OJ4B 4K7UA 2LZ6A 1UZXB 2J7QB 3V6CB 2FIDA 4A20A 3DDCB 2CU1A 3PS6A 3VUWA 2KZRA 5J17A 2FAZA 2KK8A 3L0WB 1RLFA 3LJ3A 1V86A 2DZIA 1WX8A 1EF1A 2L76A 3U30A 2W9NA 3ZIMA 4J6IA 3A1QA 4BBNF 3R66C 3CSTA 4I6NB 2KOXA 3ML9A 5CHFA 3HK0A 2AYOB 2R2QA 1V80A 4KDLB 4JIOU 1LQBA 1FXTB 4NJ7A 2BGFA 2N9PC 2D10A 4NAWA 4WJQA 3VQIA 2LXAA 1IPGA 4GU2A 4AP4C 3PSEB 3RULA 1E8XA 1WJ4A 3ZVVA 4BFRA 1ZGUB 2BWFA 4AJWA 5CX3A 1WGDA 2HD5B 3QX1A 3QWZB 4TKNA 3TCAA 2MA9B 3M95A 3WANA 3A9JA 4MJSA 2IZVB 5C23A 4W9CA 2KJHB 1I35A 1KOTA 1WH3A 4W9HA 4GGQA 3UQAA 2BPSA 4MM3A 3UIPB 4HWIB 4BOZB 3QIJA 2KTRB 2J0KA 3ZNZB 5D2MB 5AEKB 3QCAA 3VTUA 1WRDB 1WJUA 3HM6X 2XK5B 2BYEA 2ZEQA 2KFJA 4MGZE 4FJZA 3PLUA 1GC6A 2NBVB 4FULA 1AARA 2KDFB 2KXJA 2O6VD 1GUAB 2M1MA 3DVGY 2GBNA 2VRRB 3JVZX 3M63B 2IO2B 4K1RB 4KIKB 2MP2B 3VXWA 4GDKA 2LVPA 4G11A 2BYFA 2LRUA 2L7RA 2J0MA 2KJ6A 1BT0A 1TBEA 2LVOA 2GBRA 2HTHA 2V4LA 3NZSA 3PZDA 1GC7A 4N9F4 4GIVA 5DCNA 2N7EA 2KWUB 4W9EA 2LASA 4CYEA 4I6LB 2PE6B 3ZDMC 3VAWA 2EKEC 4G3XB 5KHQA 3H1UA 3AU4A 3DBLI 1U4AA 1WGRA 3V62A 4OVVA 2B3AA 2JT4B 4LJOB 4GDLA 4NQKE 2FUHB 2O6VA 4FA6A 2DZJA 4TV3A 2N7DA 4BKSA 2DENB 2ZVNA 2NPTA 3WAOA 3QA8A 4HDOA 4HPLB 2N9EB 2IO1B 4WWPA 3B0AA 4LDTB 5AZGA 1ZW7A 2K8CA 4ICVA 3HIZA 2KWVB 1XD3B 1E8ZA 1NI2A 4BOSC 5TR5A 4DDID 4FN2A 3GZNI 1Z5SB 3S2AA 2ZVOA 4LJPB 2M8SA 1L7YA 2D2QA 2KD0A 3VDZA 2BKRB 2RPQA 2WX1A 1E8YA 4IW0A 2I1JA 2CHWA 2EMTA 3DVNV 2K6QA 3UINB 2Z59B 1UELA 1H8CA 4MDKE 1E8WA 2KQ7A 3K9PB 4W9KA 2FCSA 4DK5A 3ZRCA 5HKHA 3V60A 1UBQA 1WM2A 2HE7A 4JLCA 1Q5WB 4A3OA 4EEWA 4F8CB 3KYCD 4EFOA 3U7DA 2IYDB 5KHOA 1KJTA 3EECA 1YX6B 2G3QB 4G50A 3TBLD 4NY0A 1EUVB 3WAPA 4KV2A 3ZLZA 3ZO5B 5DPWA 3JYUA 4IM2A 1OEYJ 2JVCA 2GOWA 2BYVE 4P7IA 2K8BA 5G55A 2KN5A 1YJ1A 4IUMB 3EC8A 4GOCA 2JUOA 2KMAA 1MG8A 4G0NB 5EDSA 2RD0A 2GBKA 1OEYA 3IG3A 1P98A 2OOBB 3A9KB 4XX5A 4PS7A 4JGHB 1RFAA 5C1ZA 3DOWA 3N32A 3W1SA 1WYWB 3L16A 3HHMA 2JF5A 5GMVA 5D7GA 2L3ZA 3D32A 1WJ6A 3KUDB 1CMXB 2BF8B 1L2NA 1WR6E 2ASQA 3IHPC 4KZCA 3H9DA 3ZTCA 4W9FA 4URKA 4OVUA 3DBSA 4WJPA 4EUTA 2L05A 2N1VA 2CHZA 2NS5A 4GXBA 4E74A 3ZNHB 4MEMA 2JY6A 1V2YA 3A4SC 4ANVA 4HCPB 2I1KA 2V3SA 4K7WA 2DAFA 3NS8A 4DHZB 3KYDD 3OJ3A 1WXSA 4FHJA 2M0XA 2G4SA 3QAQA 1J19A 5D94A 3ZKJC 4I6PA 3APDA 2ZCBA 3TJPA 4FJVB 1V5OA 2BWES 2C7NB 3VUYA 1P9DU 5IA7A 3PGEA 4TUUA 4RM9A 4PS3A 4RM8A 4DXAB 3MTNB 2XEWA 2C7HA 2LVQA 3RCZA 1VCBA 1C1YB 5CHWA 3KH0A 1RRBA 3AU5A 3A1QB 4M0WB 4DHJB 2AWTA 2RGFA 2KTRA 4TQ1A 3VHTC 1QZEA 3WAMA 3SD5A 4AJYB 4CO7A 3VTVA 4WQOB 2K39A 4MSQB 2A5UA 2JZ3B 3UGBB 1IYFA 2K1FA 2IBIB 4FADA 1G6JA 3DVNU 4K81A 4B6WA 1A5RA 3V6EB 1H4RA 4ASWC 1WM3A 2KFKB 1NBFC 3ECIA 2FCNA 5IAAC 1WMHA 4JQWC 1E90A 4KIKA 3DBRI 1OQYA 3MJWA 3IFWB 3L17A 4LDTD 2NBUA 1T0YA 1TTNA 3ZNGC 4F1SA 2L00B 5LLIA 3DQVA 3RZFA 1WR1A 3B08A 1TZ1A 3H7PA 4XZ4A 1P0RA 1WY8A 4HPMB 2Z0DB 4LCDE 2IY1B 3K9OB 4GN1A 2LGXA 5L83A 1D3ZA 1WXMA 2GMIC 2KTFA 5LXIB 3CMMB 3B1LX 4BKGA 2NVUI 2FCQA 2FIFA 5G2NA 3NY5A 4IWOA 4EZJA 2DAJA 4ZRIA 2ZPNA 3ENEA 2KNBA 2WX0A 3JSVA 4IG7B 2K8HA 1EO6A 4GDKB 3GOEA 1WGYA 4IM3A 4KSLC 1LXDA 3RT3B 2UYZB 4AUQC 2KO3A 2MWSB 3OAWA 5E6NA 3DCGA 4BVUC 4RMAA 4X57B 4HLEA 1WGGA 2CS4A 2FCMA 2EMSA 4NQLB 2YLMA 1ISNA 1WX9A 3APCA 2O2VB 3U8ZA 2IO3B 2LGDA 3VFKA 3L08A 4MSMB 3ZUNA 3VH4B 4IM0A 4EKUA 3UF8A 4GDLB 2KC2A 3NOBA 4NNJB 1YQBA 1WFYA 3MHSD 1SIFA 2LRWA 1YD8U 3VUXA 2C60A 1V9JA 3L10B 3WA0A 4DDGD 3NZUA 3OLMD 1WX7A 5DPSA 4TQ0A 3WALA 3N3KB 4AOFA 1JRUA 3TIXA 3KUCB 4GSWA 1GJZA 1F9JA 1V81A 1P1AA 2MCNB 4GB9A 2JWZA 2WWZA 1PQSA 3BINA 4GMVA 3O65B 4FHKA 3QK0A 2J0JA 4HVBA 1EF5A 3IBEA 1E7VA 3RZWC 1VD2A 1V49A 1V6EA 2ZNVB 3T8MA 4XC2A 3Q3FA 3H6NA 4MGIE 4EZKA 2KLCA 4IC7B 2M4NA 3UIOB 4EZLA 2IY0B 4MGYE 4EOYA 2KDIA 2G45B 4NPNA 2D07B 2YVCA 4W9JA 2WYQA 3A4RA 4HK2A 4E3CA 5FR6A 3PRPB 1K8RB 1Z2MA 1RAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L13 A;  4WWO A;  4DHJ D;  2FNJ B;  3LDZ E;  3ZTD A;  3R3M A;  2DHZ A;  1ZKH A;  5JH5 C;  4E71 A;  2C9W B;  3ONS A;  3ZW3 A;  4HDQ A;  4MH0 E;  3ALB A;  2KWC A;  3ML8 A;  3AI5 A;  3TL5 A;  1YIW A;  2LUE A;  3UQB A;  2K6D B;  2RR9 A;  3C0R B;  1X1M A;  3KUZ A;  1GNU A;  2N1W A;  5E6P A;  2ZNV C;  2G4D B;  5BO4 B;  2ZCC A;  4W9L A;  2XBB C;  2WDT B;  2JZZ A;  2LWP A;  2QHO A;  4JL9 A;  3RD2 A;  3T9L A;  3X0W A;  4DBG A;  5L95 C;  3PV1 A;  3L54 A;  1YX5 B;  1KM7 A;  2CR5 A;  2GBJ A;  1XT9 B;  4M8N A;  1XQQ A;  2V1Y A;  2XK5 A;  2KDB A;  3PLV A;  3QJZ A;  4NAW B;  2Y5B B;  4PYU A;  2CHX A;  2KJR A;  2DYB A;  3EHV A;  4FJY A;  3WIM A;  3AUL A;  2KFK A;  3KVF B;  1KLV A;  3QQ8 B;  5JZE B;  4YL8 A;  5D6J B;  2KQS A;  3W1S C;  2KKC A;  2KHW B;  2PEA A;  1J8C A;  1S3S G;  2MP2 A;  2BKF A;  2OJR A;  2AEH A;  2DYO A;  2LGY A;  2ZPY A;  3A9J B;  4MJS B;  2MBO A;  3PPA A;  3JW0 X;  4WWN A;  1V5T A;  1HE8 A;  4MEL A;  3PHW B;  2L0T A;  3DPD A;  2IO0 B;  4ICU A;  3P2B A;  3BY4 B;  5CHV C;  4HCN B;  1WF9 A;  3ZDT A;  2M17 A;  3QHT A;  3H7S A;  3AXC A;  1Q0W B;  4K7S A;  2NCN A;  5DPT A;  4PYZ A;  4FLH A;  2D11 A;  1GG3 A;  2KX3 A;  1WGH A;  4WAA A;  2CKH B;  3CF6 E;  1LM8 B;  2LI5 A;  3M3J A;  4ZRK A;  3R7Q A;  4WJO A;  2KVR A;  4BKS D;  5DPR A;  1WMH B;  4A3P A;  5E6O A;  4BKT A;  3RUI B;  1S1Q B;  2A4Z A;  2C5L C;  2KX0 A;  2KMC A;  2L8J A;  4ZDV A;  1J0G A;  3SU8 X;  1WE7 A;  4F7Z A;  2JPH A;  5J2R A;  2R2O A;  5JHA A;  4B9K A;  2C7M B;  3CSF A;  4ZYN A;  1WE6 A;  2LXC A;  3H7P B;  4W9G A;  2RSU A;  3DVG X;  4WJN A;  4IWP A;  2MLB A;  1WXA A;  4DHZ E;  2O2V A;  1E5W A;  4MGK E;  1UBI A;  3ZRF A;  1WIA A;  2N4F A;  5LXH A;  1M94 A;  1WI0 A;  2KLG A;  1NDD A;  3Q3J A;  4HJK A;  4CHK A;  3N30 A;  4ZRJ A;  2MW5 A;  4W9I A;  1SGH A;  4II2 B;  4NJ6 A;  3PRZ A;  1Q1O A;  3SHQ A;  2NBW B;  2MBB B;  1OGW A;  2UWQ A;  4II3 B;  2O6V B;  3RYT A;  4W9D A;  5JHB A;  2MSE D;  1UH6 A;  4FBJ B;  4ANW A;  1Y8R C;  4PS8 A;  2NPT B;  3JSV B;  2DX5 B;  3PTF C;  3PRE A;  4HXD A;  5AZH A;  3X23 A;  1E7U A;  3VTW A;  2MX2 A;  1WXV A;  2JXX A;  2Z0E B;  3I3T B;  4BBN C;  4ANU A;  2ZZP B;  1IP9 A;  2DZM A;  4KDI C;  2AL3 A;  2HJ8 A;  2K25 A;  2JRI B;  2PJH A;  2PPH A;  2DZK A;  3QC8 B;  3R7R A;  4KZ0 A;  2MBQ A;  1WZ0 A;  2MBH A;  2LJ5 A;  4IWQ A;  3PT2 B;  3A9K A;  3KW5 B;  3A33 B;  1OTR B;  1R4M I;  3ZNI D;  1P3Q U;  3M62 B;  3VVW B;  3W1Y A;  3NHE B;  3APF A;  3HM3 A;  1I42 A;  1WZ3 A;  1TGZ B;  3SDL C;  3PRM B;  3QAR A;  1UD7 A;  1C3T A;  4AWJ A;  4ANX A;  1WJN A;  2MQJ A;  3TMP B;  3PVL A;  2MRP A;  5J18 A;  2GBM A;  2LD9 A;  2MBE A;  2NR2 A;  3VH3 B;  2N9X A;  2ZJD A;  2L0F A;  1SE9 A;  2KC1 A;  2PE9 A;  3EFU A;  4DWF A;  1R4N I;  2REX A;  4B95 A;  5CTR C;  1UGM A;  2D3G A;  4KSK C;  3V61 A;  3PHX B;  1LFD A;  2AL6 A;  2JRH A;  2KAN A;  4M8M A;  3DBH I;  2DYM A;  5AZF A;  3IVF A;  4KVG B;  2KDE B;  3OJ4 B;  4K7U A;  2LZ6 A;  1UZX B;  2J7Q B;  3V6C B;  2FID A;  4A20 A;  3DDC B;  2CU1 A;  3PS6 A;  3VUW A;  2KZR A;  5J17 A;  2FAZ A;  2KK8 A;  3L0W B;  1RLF A;  3LJ3 A;  1V86 A;  2DZI A;  1WX8 A;  1EF1 A;  2L76 A;  3U30 A;  2W9N A;  3ZIM A;  4J6I A;  3A1Q A;  4BBN F;  3R66 C;  3CST A;  4I6N B;  2KOX A;  3ML9 A;  5CHF A;  3HK0 A;  2AYO B;  2R2Q A;  1V80 A;  4KDL B;  4JIO U;  1LQB A;  1FXT B;  4NJ7 A;  2BGF A;  2N9P C;  2D10 A;  4NAW A;  4WJQ A;  3VQI A;  2LXA A;  1IPG A;  4GU2 A;  4AP4 C;  3PSE B;  3RUL A;  1E8X A;  1WJ4 A;  3ZVV A;  4BFR A;  1ZGU B;  2BWF A;  4AJW A;  5CX3 A;  1WGD A;  2HD5 B;  3QX1 A;  3QWZ B;  4TKN A;  3TCA A;  2MA9 B;  3M95 A;  3WAN A;  3A9J A;  4MJS A;  2IZV B;  5C23 A;  4W9C A;  2KJH B;  1I35 A;  1KOT A;  1WH3 A;  4W9H A;  4GGQ A;  3UQA A;  2BPS A;  4MM3 A;  3UIP B;  4HWI B;  4BOZ B;  3QIJ A;  2KTR B;  2J0K A;  3ZNZ B;  5D2M B;  5AEK B;  3QCA A;  3VTU A;  1WRD B;  1WJU A;  3HM6 X;  2XK5 B;  2BYE A;  2ZEQ A;  2KFJ A;  4MGZ E;  4FJZ A;  3PLU A;  1GC6 A;  2NBV B;  4FUL A;  1AAR A;  2KDF B;  2KXJ A;  2O6V D;  1GUA B;  2M1M A;  3DVG Y;  2GBN A;  2VRR B;  3JVZ X;  3M63 B;  2IO2 B;  4K1R B;  4KIK B;  2MP2 B;  3VXW A;  4GDK A;  2LVP A;  4G11 A;  2BYF A;  2LRU A;  2L7R A;  2J0M A;  2KJ6 A;  1BT0 A;  1TBE A;  2LVO A;  2GBR A;  2HTH A;  2V4L A;  3NZS A;  3PZD A;  1GC7 A;  4N9F 4;  4GIV A;  5DCN A;  2N7E A;  2KWU B;  4W9E A;  2LAS A;  4CYE A;  4I6L B;  2PE6 B;  3ZDM C;  3VAW A;  2EKE C;  4G3X B;  5KHQ A;  3H1U A;  3AU4 A;  3DBL I;  1U4A A;  1WGR A;  3V62 A;  4OVV A;  2B3A A;  2JT4 B;  4LJO B;  4GDL A;  4NQK E;  2FUH B;  2O6V A;  4FA6 A;  2DZJ A;  4TV3 A;  2N7D A;  4BKS A;  2DEN B;  2ZVN A;  2NPT A;  3WAO A;  3QA8 A;  4HDO A;  4HPL B;  2N9E B;  2IO1 B;  4WWP A;  3B0A A;  4LDT B;  5AZG A;  1ZW7 A;  2K8C A;  4ICV A;  3HIZ A;  2KWV B;  1XD3 B;  1E8Z A;  1NI2 A;  4BOS C;  5TR5 A;  4DDI D;  4FN2 A;  3GZN I;  1Z5S B;  3S2A A;  2ZVO A;  4LJP B;  2M8S A;  1L7Y A;  2D2Q A;  2KD0 A;  3VDZ A;  2BKR B;  2RPQ A;  2WX1 A;  1E8Y A;  4IW0 A;  2I1J A;  2CHW A;  2EMT A;  3DVN V;  2K6Q A;  3UIN B;  2Z59 B;  1UEL A;  1H8C A;  4MDK E;  1E8W A;  2KQ7 A;  3K9P B;  4W9K A;  2FCS A;  4DK5 A;  3ZRC A;  5HKH A;  3V60 A;  1UBQ A;  1WM2 A;  2HE7 A;  4JLC A;  1Q5W B;  4A3O A;  4EEW A;  4F8C B;  3KYC D;  4EFO A;  3U7D A;  2IYD B;  5KHO A;  1KJT A;  3EEC A;  1YX6 B;  2G3Q B;  4G50 A;  3TBL D;  4NY0 A;  1EUV B;  3WAP A;  4KV2 A;  3ZLZ A;  3ZO5 B;  5DPW A;  3JYU A;  4IM2 A;  1OEY J;  2JVC A;  2GOW A;  2BYV E;  4P7I A;  2K8B A;  5G55 A;  2KN5 A;  1YJ1 A;  4IUM B;  3EC8 A;  4GOC A;  2JUO A;  2KMA A;  1MG8 A;  4G0N B;  5EDS A;  2RD0 A;  2GBK A;  1OEY A;  3IG3 A;  1P98 A;  2OOB B;  3A9K B;  4XX5 A;  4PS7 A;  4JGH B;  1RFA A;  5C1Z A;  3DOW A;  3N32 A;  3W1S A;  1WYW B;  3L16 A;  3HHM A;  2JF5 A;  5GMV A;  5D7G A;  2L3Z A;  3D32 A;  1WJ6 A;  3KUD B;  1CMX B;  2BF8 B;  1L2N A;  1WR6 E;  2ASQ A;  3IHP C;  4KZC A;  3H9D A;  3ZTC A;  4W9F A;  4URK A;  4OVU A;  3DBS A;  4WJP A;  4EUT A;  2L05 A;  2N1V A;  2CHZ A;  2NS5 A;  4GXB A;  4E74 A;  3ZNH B;  4MEM A;  2JY6 A;  1V2Y A;  3A4S C;  4ANV A;  4HCP B;  2I1K A;  2V3S A;  4K7W A;  2DAF A;  3NS8 A;  4DHZ B;  3KYD D;  3OJ3 A;  1WXS A;  4FHJ A;  2M0X A;  2G4S A;  3QAQ A;  1J19 A;  5D94 A;  3ZKJ C;  4I6P A;  3APD A;  2ZCB A;  3TJP A;  4FJV B;  1V5O A;  2BWE S;  2C7N B;  3VUY A;  1P9D U;  5IA7 A;  3PGE A;  4TUU A;  4RM9 A;  4PS3 A;  4RM8 A;  4DXA B;  3MTN B;  2XEW A;  2C7H A;  2LVQ A;  3RCZ A;  1VCB A;  1C1Y B;  5CHW A;  3KH0 A;  1RRB A;  3AU5 A;  3A1Q B;  4M0W B;  4DHJ B;  2AWT A;  2RGF A;  2KTR A;  4TQ1 A;  3VHT C;  1QZE A;  3WAM A;  3SD5 A;  4AJY B;  4CO7 A;  3VTV A;  4WQO B;  2K39 A;  4MSQ B;  2A5U A;  2JZ3 B;  3UGB B;  1IYF A;  2K1F A;  2IBI B;  4FAD A;  1G6J A;  3DVN U;  4K81 A;  4B6W A;  1A5R A;  3V6E B;  1H4R A;  4ASW C;  1WM3 A;  2KFK B;  1NBF C;  3ECI A;  2FCN A;  5IAA C;  1WMH A;  4JQW C;  1E90 A;  4KIK A;  3DBR I;  1OQY A;  3MJW A;  3IFW B;  3L17 A;  4LDT D;  2NBU A;  1T0Y A;  1TTN A;  3ZNG C;  4F1S A;  2L00 B;  5LLI A;  3DQV A;  3RZF A;  1WR1 A;  3B08 A;  1TZ1 A;  3H7P A;  4XZ4 A;  1P0R A;  1WY8 A;  4HPM B;  2Z0D B;  4LCD E;  2IY1 B;  3K9O B;  4GN1 A;  2LGX A;  5L83 A;  1D3Z A;  1WXM A;  2GMI C;  2KTF A;  5LXI B;  3CMM B;  3B1L X;  4BKG A;  2NVU I;  2FCQ A;  2FIF A;  5G2N A;  3NY5 A;  4IWO A;  4EZJ A;  2DAJ A;  4ZRI A;  2ZPN A;  3ENE A;  2KNB A;  2WX0 A;  3JSV A;  4IG7 B;  2K8H A;  1EO6 A;  4GDK B;  3GOE A;  1WGY A;  4IM3 A;  4KSL C;  1LXD A;  3RT3 B;  2UYZ B;  4AUQ C;  2KO3 A;  2MWS B;  3OAW A;  5E6N A;  3DCG A;  4BVU C;  4RMA A;  4X57 B;  4HLE A;  1WGG A;  2CS4 A;  2FCM A;  2EMS A;  4NQL B;  2YLM A;  1ISN A;  1WX9 A;  3APC A;  2O2V B;  3U8Z A;  2IO3 B;  2LGD A;  3VFK A;  3L08 A;  4MSM B;  3ZUN A;  3VH4 B;  4IM0 A;  4EKU A;  3UF8 A;  4GDL B;  2KC2 A;  3NOB A;  4NNJ B;  1YQB A;  1WFY A;  3MHS D;  1SIF A;  2LRW A;  1YD8 U;  3VUX A;  2C60 A;  1V9J A;  3L10 B;  3WA0 A;  4DDG D;  3NZU A;  3OLM D;  1WX7 A;  5DPS A;  4TQ0 A;  3WAL A;  3N3K B;  4AOF A;  1JRU A;  3TIX A;  3KUC B;  4GSW A;  1GJZ A;  1F9J A;  1V81 A;  1P1A A;  2MCN B;  4GB9 A;  2JWZ A;  2WWZ A;  1PQS A;  3BIN A;  4GMV A;  3O65 B;  4FHK A;  3QK0 A;  2J0J A;  4HVB A;  1EF5 A;  3IBE A;  1E7V A;  3RZW C;  1VD2 A;  1V49 A;  1V6E A;  2ZNV B;  3T8M A;  4XC2 A;  3Q3F A;  3H6N A;  4MGI E;  4EZK A;  2KLC A;  4IC7 B;  2M4N A;  3UIO B;  4EZL A;  2IY0 B;  4MGY E;  4EOY A;  2KDI A;  2G45 B;  4NPN A;  2D07 B;  2YVC A;  4W9J A;  2WYQ A;  3A4R A;  4HK2 A;  4E3C A;  5FR6 A;  3PRP B;  1K8R B;  1Z2M A;  1RAX A; 
#chains in the Genus database with same CATH topology
 4DHJ D;  3LDZ E;  2DHZ A;  1ZKH A;  1FXI A;  2MJD A;  2IGH A;  2MHJ A;  1FNV A;  4MH0 E;  3AEC B;  3ML8 A;  1F52 A;  2BBC A;  4NZL B;  1YIW A;  3EGR A;  2K6D B;  1JRO A;  2KVZ A;  1A70 A;  1GNU A;  2K22 A;  5E6P A;  2G4D B;  3HVZ A;  3SEB A;  2XBB C;  4Q2J A;  2LWP A;  1I4G A;  3CWI A;  3X0W A;  4C56 C;  5L95 C;  1IUE A;  3EA6 A;  3PV1 A;  3L54 A;  1XT9 B;  4HJG E;  2KDB A;  3ZXV A;  3QJZ A;  1ESF A;  2Y5B B;  4JX1 C;  2CHX A;  1N63 A;  4M02 A;  3W1S C;  2KQS A;  2KHW B;  2PEA A;  3HUI A;  3AE2 B;  2OJR A;  2BKF A;  2LGY A;  2MBO A;  1HE8 A;  4MEL A;  2L0T A;  1J7B A;  4HCN B;  1WF9 A;  1FEH A;  3QHT A;  1RM6 C;  3LYY A;  4XYC A;  4UDU C;  3CF6 E;  1LM8 B;  3R7Q A;  1GPX A;  1IGC A;  4CQN A;  4BKT A;  3HRD D;  1S1Q B;  2L8J A;  2OJW A;  1T0R C;  1WXA A;  1E5W A;  1M94 A;  1PDX A;  4HJK A;  4CHK A;  3Q8E A;  3P4R B;  4II2 B;  4OHJ A;  1Q1O A;  2NBW B;  1JWU D;  2UWQ A;  2O6V B;  3RYT A;  1AN8 A;  2MSE D;  4HXD A;  3VTW A;  5BMH A;  2MX2 A;  1MVK A;  1PGA A;  4LTU A;  4L1B A;  4N59 A;  2PJH A;  2PPH A;  1HZ6 A;  1WZ0 A;  2MBH A;  4IWQ A;  4ZHO A;  3A33 B;  1R4M I;  2WU5 B;  2GRI A;  3Q3M C;  1WZ3 A;  1XCQ L;  3PRM B;  3HVD A;  1UD7 A;  3TMP B;  3PVL A;  2LD9 A;  3W5U B;  2N9X A;  2PE9 A;  3EFU A;  4B95 A;  1UGM A;  2D3G A;  4P16 A;  3PHX B;  1MPE A;  2AL6 A;  3I63 C;  5HFY A;  4ARC A;  4M8M A;  3DBH I;  3N20 C;  4KVG B;  3OJ4 B;  4K7U A;  1N5X A;  1UZX B;  2RPV A;  2J7Q B;  3DDC B;  3PS6 A;  1E9M A;  1UGJ A;  3LJ3 A;  1WX8 A;  4BBN F;  2L1A A;  3R66 C;  4HEA 1;  4I6N B;  2KOX A;  5CHF A;  4KDL B;  5H8Y E;  5MPO A;  1FXT B;  4NJ7 A;  2D10 A;  4WJQ A;  1VJK A;  4HRS A;  1ZUD 2;  1UWX A;  3ZVV A;  1K52 A;  2BWF A;  3MFG A;  5CX3 A;  4A9A A;  2DNF A;  3SR6 A;  2WDQ B;  2HD5 B;  1R4N B;  2JWU A;  2XNA C;  3M95 A;  1WYG A;  4MJS A;  4W9C A;  1TKY A;  1I35 A;  4W9H A;  2BPS A;  4RGM A;  4KKI A;  4P1C C;  3ZNZ B;  5AEK B;  3VTU A;  1WRD B;  1WJU A;  3HM6 X;  1HEZ E;  2KFJ A;  1R7S A;  1TKG A;  1GC6 A;  4RCO A;  1GUA B;  3DVG Y;  3LB8 C;  2VRR B;  4EE2 A;  2LMC A;  1JAL A;  2MP2 B;  1F77 A;  5EE0 A;  1V1P A;  1XCT L;  4A6Q A;  1TBE A;  2YEP B;  3Q8B A;  1RYJ A;  2HTH A;  1DOY A;  1KLG D;  2KWU B;  2GLS A;  3U2S C;  3ZDM C;  4G3X B;  2CU3 A;  3NVY A;  5KHQ A;  1WGR A;  4NQK E;  1FRD A;  2DZJ A;  4TV3 A;  2ZW1 A;  3ZJT A;  2DEN B;  2NPT A;  3WAO A;  2N9E B;  4ICV A;  4BOS C;  5TR5 A;  1QOF A;  1YJI A;  3RNC C;  1L4Z B;  1Z5S B;  3GZN I;  3S2A A;  2ZVO A;  2RPQ A;  2WX1 A;  4IW0 A;  2Y5P A;  2CHW A;  3RNE C;  1H8C A;  2KMM A;  2EKI A;  3KYC D;  3EEC A;  2N7J A;  1EUV B;  4WIP A;  2BYV E;  4P7I A;  2BTE A;  1N60 A;  3EC8 A;  4GOC A;  2JUO A;  4OW0 A;  4G0N B;  3DBL B;  3IG3 A;  5C1Z A;  1FPY A;  1YJJ A;  2WXG A;  4LNF A;  1I4R A;  4WH4 A;  1PFD A;  1WJ6 A;  2BF8 B;  2WS3 B;  2ASQ A;  3T3N A;  4L23 A;  3DBS A;  5HG2 A;  5LNK 1;  1NEN B;  3ZNH B;  3IXS A;  3AE3 B;  4HCP B;  2PLP A;  1JWM D;  4K7W A;  1T6B X;  1WXS A;  4FHJ A;  2M0X A;  2G4S A;  3ZKJ C;  5D94 A;  1BML C;  3ZJU A;  3AV8 A;  4XE0 A;  4FJV B;  4RFB A;  5I4D A;  3VUY A;  1P9D U;  1C76 A;  1TS2 A;  3PGE A;  4YSZ B;  4JE3 B;  3N1Z C;  5C2T B;  1TJE A;  4RM8 A;  4DXA B;  2XEW A;  2KAJ A;  3FC4 A;  3MP9 A;  1RRB A;  2K3U A;  3A1Q B;  4LNO A;  2AWT A;  1SXT A;  2KTR A;  1L0Y B;  1ZXI A;  2RDG A;  3VHT C;  2VZK D;  3SD5 A;  1TYG B;  3UGB B;  2PVO D;  1FFV A;  2K1F A;  1NVI D;  4FAD A;  3DVN U;  4K81 A;  2KYW A;  3C8Y A;  1H4R A;  3P4S B;  1NBF C;  2MH7 A;  1E90 A;  3MJW A;  3IFW B;  2NBU A;  3NJT A;  1HZ5 A;  1TTN A;  3ZNG C;  3TEW A;  4F1S A;  3N9Y C;  1HTO A;  1KLU D;  1TZ1 A;  4HPM B;  2Z0D B;  2IY1 B;  4GN1 A;  4YXD B;  5L83 A;  1F2R C;  2QEJ C;  5AUK A;  4LK0 M;  2FCQ A;  1JWB D;  5EE1 A;  4IWO A;  4EZJ A;  3ENE A;  2KNB A;  3U4E G;  1UWM A;  4GDK B;  1WGY A;  1EU3 A;  2KO3 A;  1ET9 A;  2KN4 A;  3APC A;  1T0S C;  3VH4 B;  4US8 A;  5JXV A;  1WFY A;  2W55 A;  3MHS D;  2LRW A;  1V9J A;  2BQQ A;  3L10 B;  5DPS A;  1I4X A;  1Q10 A;  3N3K B;  2IPK D;  4GSW A;  5H92 C;  2JWZ A;  3BIN A;  2J0J A;  1EF5 A;  4YTP B;  5HI1 A;  1N62 A;  4XC2 A;  3BK1 A;  3Q3F A;  3H6N A;  3P63 A;  3U7Z A;  4EZK A;  4EZL A;  2KDI A;  4ITK A;  3V3X A;  2YVC A;  4W9J A;  1SSN A;  4HK2 A;  2DWQ A;  5FR6 A;  4E3C A;  1K8R B;  1RAX A;  3L13 A;  2FNJ B;  5JH5 C;  2C9W B;  3IAS 1;  4HDQ A;  2H89 B;  1I7H A;  2KWC A;  3TL5 A;  3AI5 A;  3UQB A;  2RR9 A;  2W54 A;  5D3D A;  2N1W A;  1HTQ A;  2ZNV C;  4N58 A;  1OQR A;  1NI3 A;  2JZZ A;  2QHO A;  3TEX A;  4JL9 A;  1QLB B;  1R4M B;  4YSY B;  2CR5 A;  1KM7 A;  4M8N A;  2GBJ A;  3NVW A;  2V1Y A;  3PLV A;  3WIM A;  3AUL A;  3LXF A;  5GXG B;  1KLV A;  2BS4 B;  1ET6 A;  2MP2 A;  3BVM A;  2AEH A;  2ZPY A;  4MJS B;  4XWW A;  3PPA A;  4WWN A;  1EU4 A;  3DBH B;  3PHW B;  2IGD A;  3ZDT A;  3DHH C;  2M17 A;  2XN9 C;  4KKJ A;  3H7S A;  3AXC A;  4K7S A;  2LHD A;  5DPT A;  4A90 A;  4PYZ A;  2D11 A;  1GG3 A;  2KX3 A;  2LI5 A;  4DXG A;  4ZRK A;  2KVR A;  1L5P A;  1QKZ A;  2KMC A;  1WE7 A;  3I5J C;  4ZYN A;  1WE6 A;  2LXC A;  4W9G A;  2RSU A;  1TY2 A;  4IWP A;  5LXH A;  4XDD A;  1SGH A;  3Q8F A;  1FXA A;  3SHQ A;  1UH6 A;  2KWD A;  1MFW A;  5AZH A;  1FNU A;  2NPT B;  2DX5 B;  3JSV B;  3AEB B;  1E7U A;  2ZW0 A;  4ANU A;  1WXV A;  1ZDX A;  4ZRQ A;  1I4H A;  2DZM A;  4KDI C;  2K25 A;  1BUI C;  3RNB C;  3PT2 B;  3KW5 B;  1OTR B;  3B9J A;  3ZNI D;  4IOI E;  3M62 B;  3NHE B;  3APF A;  1C77 A;  1TGZ B;  4ANX A;  1WGK A;  1WJN A;  4DQO C;  2MRP A;  3EUB 2;  1SE9 A;  1K51 A;  2KC1 A;  4DWF A;  2QSD A;  4LLG M;  1LFD A;  2QCZ A;  2LJI A;  3BK2 A;  2LZ6 A;  3I57 A;  1L6V A;  5BMI A;  2WDR B;  3V6C B;  2L52 A;  3VUW A;  4JWU C;  5J17 A;  2KK8 A;  4TSS A;  1VLB A;  2B76 B;  3GZN B;  1V86 A;  2DZI A;  1YMH E;  1EF1 A;  4C7Y A;  5TSS A;  2M0A A;  3A1Q A;  4YTM B;  3CST A;  3HK0 A;  2AYO B;  1LQB A;  4ARI A;  2BGF A;  2N9P C;  4S0R A;  4NAW A;  4AP4 C;  3RUL A;  1J7C A;  4ZRP A;  2G9H D;  1FO4 A;  1CJE A;  1WGD A;  4MAC A;  5EE9 A;  3RFZ B;  3QX1 A;  4TKN A;  2MA9 B;  3WAN A;  3A9J A;  2IZV B;  2IGG A;  1KOT A;  4ZOH C;  3BVZ A;  3UQA A;  1T0Q C;  2KTR B;  4OZC A;  1KFY B;  4MGZ E;  3PLU A;  2LEK A;  2PVG C;  4FUL A;  2KDF B;  2KXJ A;  3V05 A;  2M1M A;  3JVZ X;  4H2A A;  3RNF C;  4K1R B;  2DLB A;  4GDK A;  2L7R A;  2LRU A;  1BT0 A;  2LVO A;  3NZS A;  3AE4 B;  3PZD A;  1MJD A;  2N7E A;  4CYE A;  4W9E A;  3VAW A;  4HPP A;  4C4V B;  3H1U A;  3AU4 A;  1U4A A;  3FIL A;  3V62 A;  4OVV A;  3AED B;  1SJE D;  4NJC A;  3KWL A;  1SE4 A;  2ONQ A;  1YN4 A;  4FA6 A;  4BKS A;  2INN E;  2ZVN A;  4HDO A;  3B0A A;  1JWA D;  2GI9 A;  4LDT B;  2WDV B;  3HIZ A;  1NI2 A;  3NUH B;  2QMT A;  2EEL A;  4LJP B;  1F0Z A;  1L7Y A;  2KD0 A;  3NS1 A;  3RI7 C;  3EFC A;  2J4X A;  2I1J A;  2EMT A;  4W9K A;  4DK5 A;  2FCS A;  4EEW A;  4JLC A;  1UUP A;  1E0Z A;  1MG4 A;  3AEG B;  3ZO5 B;  1E7P B;  2D3B A;  4G50 A;  4NY0 A;  4S17 A;  3TBL D;  4KV2 A;  1OEY J;  2GOW A;  5G55 A;  2K8B A;  1GAQ B;  2GBK A;  1OEY A;  1P98 A;  2OOB B;  3A9K B;  4XX5 A;  1I4Q A;  1RFA A;  3TEY A;  3N32 A;  1QIL A;  2L3Z A;  3D32 A;  1ENF A;  5FKA C;  1L2N A;  1WR6 E;  3ZTC A;  3H9D A;  3Q14 C;  4OVU A;  4EUT A;  5G5G A;  3A4S C;  4ANV A;  2I1K A;  5IP4 D;  5IKC M;  1IBX A;  3NS8 A;  4B0E A;  3KYD D;  3NVZ A;  2LGI A;  3W9C B;  2X8X X;  1JRP A;  3URY A;  1V5O A;  1J7A A;  2BWE S;  2C7N B;  5IA7 A;  4RM9 A;  4PS3 A;  4AS1 A;  3MTN B;  1BXT A;  2LVQ A;  5T8I A;  1VCB A;  4K3B A;  1C1Y B;  4DHJ B;  3E56 A;  5C3J B;  1M4V A;  1Y56 A;  4TQ1 A;  2I2Y A;  1QZE A;  3WAM A;  1IYF A;  2WXJ A;  4MSQ B;  4P1B C;  4JPS A;  1G6J A;  2Y3A A;  1KF6 B;  4B6W A;  4ASW C;  3NRZ A;  4A55 A;  3ECI A;  3Q2A C;  4RGO S;  4BAX A;  4KIK A;  3DBR I;  3GE3 C;  1T0Y A;  3RNA C;  4JWS C;  5LLI A;  1TS3 A;  3DQV A;  3RZF A;  1WR1 A;  1P0R A;  1WY8 A;  2LGS A;  3K9O B;  2LGX A;  1WXM A;  3CMM B;  4BKG A;  1D5X C;  3UI3 A;  3ETR A;  3NY5 A;  3SFE B;  2DAJ A;  4ZRI A;  2ZPN A;  1D5M C;  3JSV A;  4IG7 B;  2K8H A;  3VR9 B;  1UF0 A;  4IM3 A;  1V1O A;  1LXD A;  2QJL A;  4AUQ C;  2MJE A;  4X57 B;  2CS4 A;  1V8C A;  2YLM A;  1ISN A;  1ZP0 B;  2WP9 B;  2NTS A;  3VFK A;  3ZUN A;  1QT9 A;  4WQM A;  3N1Y C;  1YQB A;  2MJ3 A;  1SIF A;  1KTK A;  1SEB D;  3WA0 A;  1JRU A;  2UU7 A;  4K3C A;  1F9J A;  2JXT A;  3L4P A;  1P1A A;  4C80 A;  4GB9 A;  1F2R I;  4IDI A;  2WWZ A;  4GMV A;  3O65 B;  3QK0 A;  4HVB A;  3TEZ A;  2ON8 A;  3P4P B;  2N9K A;  1V6E A;  1XEE A;  4IKG A;  4REZ A;  2W3S A;  1EM7 A;  1DYQ A;  2KLC A;  4IC7 B;  2M4N A;  1WSP A;  2J52 A;  2G45 B;  1QOB A;  3FKY A;  2WYQ A;  2OED A;  1FCL A;  3PRP B;  1PYW D;  1FM0 D;  4WWO A;  2WGS A;  1CQV A;  3ZTD A;  3MHZ A;  3R3M A;  3KQ4 A;  3ONS A;  3ZW3 A;  3ALB A;  2V3P A;  5D3I B;  2INC C;  2WHI A;  1FMA D;  2N9L A;  2AQ3 B;  2ZCC A;  1JQ4 A;  1E6E B;  1FD6 A;  1C78 A;  2QDF A;  4ZHP A;  1DOI A;  1XQQ A;  4NAW B;  3ZYY X;  2DYB A;  3ZGZ A;  3QQ8 B;  5JZE B;  4RH6 A;  5D6J B;  2KKC A;  1J8C A;  3A9J B;  1CK1 A;  2HDE A;  3JW0 X;  1V5T A;  2TSS A;  4ICU A;  2IO0 B;  5CHV C;  2BB6 A;  1XLP A;  1FIQ A;  4C4V A;  2NCN A;  2WXM A;  4FLH A;  3E9S A;  1SB3 C;  1VR9 A;  4WJO A;  5DPR A;  1WMH B;  4A3P A;  2A4Z A;  3SU8 X;  5J2R A;  2R2O A;  2INP E;  2C7M B;  1RWS A;  3C19 A;  3AE6 B;  3H7P B;  3DVG X;  4WJN A;  2PKO A;  2MLB A;  4DHZ E;  2O2V A;  3ZRF A;  4MGK E;  1WIA A;  3Q3N C;  3R8B A;  2KLG A;  3FIL B;  3Q3J A;  4D2K A;  2AQ1 B;  3N30 A;  2MW5 A;  5FR3 A;  4NJ6 A;  3PRZ A;  2V9H A;  4HKQ A;  1OGW A;  4II3 B;  4KGS A;  4FBJ B;  1Y8R C;  2BVC A;  2WU2 B;  2Z0E B;  4RGT A;  2JXX A;  3I3T B;  1QOG A;  2ZZP B;  1IP9 A;  2QIE B;  1C4P A;  2AL3 A;  3ABV B;  2ICI A;  3QC8 B;  3VR8 B;  2DZK A;  2J42 A;  3PO0 A;  2MBQ A;  3A9K A;  1UNS A;  3VVW B;  3GB1 A;  3W1Y A;  1L0X B;  3QAR A;  3AN1 A;  1TZO A;  2GBM A;  2MBE A;  3AE9 B;  3VH3 B;  2ZJD A;  2L0F A;  4KGR A;  1R4N I;  2REX A;  5CTR C;  3V61 A;  4M01 A;  2DYM A;  2WXR A;  3IVF A;  2KDE B;  2WQY B;  1STE A;  3OG5 A;  2FID A;  4A20 A;  3Q69 A;  2WXF A;  3TUO A;  2FAZ A;  1JW9 D;  1NYR A;  1RLF A;  1AW7 A;  2L76 A;  3U30 A;  4J6I A;  1N6Z A;  2LHE A;  2KT7 A;  3ML9 A;  1IBX B;  2R2Q A;  4RNA A;  3AB5 A;  1WRI A;  3VQI A;  1IPG A;  2WNM A;  1WJ4 A;  2L32 A;  2N0S B;  1N61 A;  4AJW A;  3Q8C A;  3QWZ B;  2V0G A;  2CJN A;  4GGQ A;  4MM3 A;  2M56 B;  3BVG A;  1TS5 A;  2J0K A;  5D2M B;  3QCA A;  3NVV A;  2XK5 B;  2ZEQ A;  1ZXH A;  1D6E C;  2NBV B;  2O6V D;  1TT5 B;  2GBN A;  3M63 B;  2IO2 B;  4KIK B;  3VXW A;  1JCK B;  2LVP A;  4G11 A;  2BYF A;  2J0M A;  1OFF A;  2KJ6 A;  1GC7 A;  4GIV A;  3BYT B;  3FAH A;  2PE6 B;  2EKE C;  3MC9 A;  3B2F A;  2VZK B;  3DBL I;  2W3R A;  2BT6 A;  2B3A A;  2JT4 B;  3KWV A;  4LJO B;  2D3A A;  2BYT A;  3MC8 A;  1C4A A;  3DHG C;  5IN7 A;  2N7D A;  3QA8 A;  4WWP A;  4YSX B;  3BYY B;  5AZG A;  1ZW7 A;  4C7Z A;  1N5W A;  1NYQ A;  4FN2 A;  2KAC A;  5BYS A;  3VDZ A;  3Q8A A;  1E8Y A;  2LFI A;  3KLS X;  3UIN B;  2K6Q A;  2Z59 B;  4MDK E;  5G5H A;  2KQ7 A;  3K9P B;  5HKH A;  3V60 A;  1WM2 A;  3DBR B;  4A3O A;  4F8C B;  1Q5W B;  4EFO A;  3U7D A;  2G3Q B;  4A8X C;  3ZLZ A;  5DPW A;  3JYU A;  4WAF A;  2BS2 B;  2KN5 A;  4IUM B;  3NG0 A;  2KMA A;  4USA A;  2RDB C;  1TIF A;  2JYT A;  3W1S A;  3HHM A;  2RDH A;  2JF5 A;  3AEA B;  5GMV A;  2RMM A;  3KUD B;  4R3D A;  4KZC A;  4W9F A;  4URK A;  4WJP A;  2N1V A;  2CHZ A;  2NS5 A;  4E74 A;  2PIA A;  3NZ3 A;  2I38 A;  2JY6 A;  1I4P A;  1ZE3 D;  1QF6 A;  1LO5 D;  4I6P A;  1B9R A;  2ZCB A;  1ZDV A;  4TUU A;  2HJ1 A;  2C7H A;  4WUR A;  1SE2 A;  5CHW A;  3KH0 A;  3AU5 A;  4M0W B;  2RGF A;  2PW9 A;  4YT0 B;  2Y5C A;  4WQO B;  3MC0 B;  2KDM A;  2IBI B;  3R2I A;  1A5R A;  4C00 A;  1WM3 A;  1SIJ A;  5IAA C;  1WMH A;  1TS4 A;  2IDY A;  1XLQ A;  1OQY A;  3L17 A;  4XDC A;  3R2T A;  2L00 B;  1K50 A;  3B08 A;  1P7E A;  4XGA B;  3H7P A;  1SE3 A;  4LCD E;  1D3Z A;  2KTF A;  3B1L X;  2NVU I;  4N6E B;  1EO6 A;  4KX6 B;  5E6N A;  3OAW A;  3RMK C;  4HLE A;  4RMA A;  1WGG A;  2R61 A;  2FCM A;  4NQL B;  1WX9 A;  2D5G A;  2O2V B;  2LGD A;  3L08 A;  3Q3O C;  4MSM B;  5E6J A;  4IM0 A;  4EKU A;  3UF8 A;  4GDL B;  2PTL A;  2V4I B;  2WXH A;  1SF0 A;  2C60 A;  4O1N A;  3IT6 B;  4DDG D;  1WX7 A;  3MJ5 A;  4TQ0 A;  4AOF A;  4ZYS A;  3TIX A;  1T3Q A;  1K53 A;  1GJZ A;  1V81 A;  3AE7 B;  2WXP A;  4FHK A;  4M00 A;  3AMZ A;  1VD2 A;  1VDV A;  1GB1 A;  2ZNV B;  3T8M A;  1JML A;  1FCC C;  3UIO B;  3GS2 A;  4MGY E;  4EOY A;  2JU6 X;  4NPN A;  2D07 B;  2E3T A;  1Z2M A;  2WLB A;  1AYF A;  1EWC A;  4E71 A;  3Q6B A;  1DGJ A;  3N1X C;  2LUE A;  4PT5 A;  1KH0 A;  3C0R B;  1MHX A;  1X1M A;  3KUZ A;  3AH7 A;  2OHF A;  4LNN A;  4W9L A;  5BO4 B;  2WDT B;  3SFD B;  3RD2 A;  3T9L A;  4DBG A;  1XXG A;  4OZB A;  1YX5 B;  4L2Y A;  2XK5 A;  4OZA A;  1WXQ A;  1XLN A;  1SBB B;  4PYU A;  2KJR A;  3EHV A;  2VH1 A;  4FJY A;  2KFK A;  3KVF B;  2K5P A;  1YN5 A;  4YL8 A;  3GE8 C;  3BII D;  4LNK A;  1S3S G;  1ROE A;  2DYO A;  2IJ0 A;  1VZ7 A;  3VRA B;  4MM3 B;  3DPD A;  1YQ4 B;  3P2B A;  3BY4 B;  1Q0W B;  1VZ6 A;  3IT4 B;  1FNW A;  4WAA A;  1WGH A;  2CKH B;  1HXY D;  3M3J A;  2WXI A;  4BKS D;  4PK1 A;  1KRH A;  5E6O A;  1MHH E;  3RUI B;  2JYE A;  2KX0 A;  1LGR A;  2C5L C;  1ZPS A;  4ZDV A;  1J0G A;  2QC8 A;  4F7Z A;  2JPH A;  5JHA A;  4B9K A;  3CSF A;  1D5Z C;  4AQ7 A;  3GP7 A;  4DXF A;  2SEB D;  3AE8 B;  4YTN B;  1UBI A;  2N4F A;  1WI0 A;  1NDD A;  1WWT A;  4ZRJ A;  4W9I A;  4OVZ A;  2DBY A;  3BWU D;  2MBB B;  5JHB A;  4W9D A;  1OQQ A;  5HHD G;  4ANW A;  4PS8 A;  2J53 A;  3PTF C;  3PRE A;  3TSS A;  5FK9 C;  3X23 A;  1T5X D;  4KGT A;  4HRO A;  4BBN C;  1QQR A;  1XF5 L;  2HJ8 A;  2JRI B;  2FE8 A;  3R7R A;  4KZ0 A;  2LJ5 A;  4RF1 A;  1EWY C;  3P1M A;  1XO3 A;  1P3Q U;  3HM3 A;  1I42 A;  3SDL C;  1C3T A;  4AWJ A;  2MQJ A;  2VH2 A;  5J18 A;  2NR2 A;  5BYR A;  1PGB A;  2K9X A;  1YN3 A;  4KSK C;  2JRH A;  2KAN A;  2X38 A;  4FXC A;  5AZF A;  2BB5 A;  3RNG C;  2CU1 A;  4US9 A;  2KZR A;  2FBW B;  1C9F A;  1PGX A;  3L0W B;  4TMA B;  2W9N A;  3ZIM A;  1C79 A;  1GB4 A;  4M0W A;  4MH8 A;  1GOZ A;  2JSV X;  3P42 A;  1V80 A;  4JIO U;  1VZ8 A;  2LXA A;  1NEK B;  4GU2 A;  3PSE B;  1E8X A;  3RPF C;  4BFR A;  1TKE A;  1ZGU B;  2PMV A;  1VRA B;  2W82 A;  3OWE B;  3TCA A;  5C23 A;  2KJH B;  3PZ7 A;  1WH3 A;  2Z8L A;  3UIP B;  4HWI B;  3PZ8 A;  4BOZ B;  3QIJ A;  3IAM 1;  4LNI A;  2FUG 1;  1F1H A;  1L0V B;  2BYE A;  2KQ4 X;  4YWG G;  3AE5 B;  4FJZ A;  2WXQ A;  1AAR A;  2NTT A;  3ZXR A;  2JX5 A;  4P6V F;  2V4L A;  2GBR A;  4N9F 4;  5DCN A;  2LAS A;  3T3O A;  4I6L B;  1MI0 A;  2WXK A;  1YQ3 B;  4HKZ E;  2G1E A;  5BMG A;  2E6X A;  4NAM A;  1CZP A;  3VRB B;  4GDL A;  2HTM E;  2ACZ B;  2FUH B;  2O6V A;  3AEE B;  4HPL B;  2IO1 B;  2H88 B;  2K8C A;  2KWV B;  1XD3 B;  1E8Z A;  3B2G A;  4DDI D;  3J9C A;  2M8S A;  2D2Q A;  2L83 A;  2CJO A;  2BKR B;  3AM9 A;  2QIL A;  4ACF A;  3DVN V;  4QAY A;  1UEL A;  4J3O D;  1E8W A;  1ZOY B;  3ZQ4 A;  3ZRC A;  1UBQ A;  2HE7 A;  1ACC A;  2MEK A;  2BS3 B;  2IYD B;  5KHO A;  1KJT A;  1YX6 B;  3CIR B;  3WAP A;  4IM2 A;  2JVC A;  1YNT E;  1L6U A;  1YJ1 A;  1MG8 A;  5EDS A;  2RD0 A;  1FFU A;  4PS7 A;  1HA5 A;  4JGH B;  3DOW A;  5BYQ A;  3U52 E;  1WYW B;  3L16 A;  2WXN A;  5D7G A;  2GB1 A;  1CMX B;  3IHP C;  3W2D A;  2L05 A;  2K0P A;  4GXB A;  4MEM A;  4BZA A;  1V2Y A;  2JZP A;  2V3S A;  2DAF A;  4DHZ B;  3OJ3 A;  3I9V 1;  3ZJV A;  3QAQ A;  1J19 A;  4MT5 A;  2M19 A;  2YEP F;  3APD A;  3TJP A;  2AQ2 B;  4GLS C;  1XLO A;  2WXL A;  4RF0 A;  3RCZ A;  4B0M A;  1P7F A;  3O13 A;  1FRR A;  1RFK A;  4CO7 A;  4AJY B;  2NMQ A;  3VTV A;  2K39 A;  2A5U A;  2JZ3 B;  1D4B A;  2Q5W D;  1SJH D;  3V6E B;  2KFK B;  2FCN A;  4JQW C;  4LDT D;  2V3N A;  1B1Z A;  4XZ4 A;  1PUT A;  3DWM A;  4WWM A;  2GMI C;  5LXI B;  3H8H A;  3BZD B;  1TY0 A;  2BW2 A;  2FIF A;  5G2N A;  1DOX A;  2WX0 A;  5AUI A;  2IND C;  3GOE A;  1V1P B;  4KSL C;  3DWG C;  3RT3 B;  2UYZ B;  2MWS B;  2SAK A;  3DCG A;  4BVU C;  2EMS A;  1HQR D;  3U8Z A;  2IO3 B;  5IO9 A;  1IGD A;  2KC2 A;  3NOB A;  4NNJ B;  3VUX A;  1YD8 U;  3WCQ A;  3RN9 C;  3NZU A;  3OLM D;  3W5V B;  3WAL A;  3KUC B;  3AE1 B;  1AWD A;  3DHI C;  5IOI A;  2MCN B;  2LUM A;  1JWS D;  1PQS A;  1L4D B;  1E10 A;  2D3C A;  5EE3 A;  3IBE A;  1YOV B;  1E7V A;  3RZW C;  2WXO A;  3AEF B;  1V49 A;  1QOA A;  1C4C A;  4MGI E;  2JQR B;  2IY0 B;  2AX5 A;  1V97 A;  4RGN A;  3P4Q B;  3A4R A;  4XWT A; 
#chains in the Genus database with same CATH homology
 3L13 A;  4WWO A;  4DHJ D;  2FNJ B;  3LDZ E;  3ZTD A;  3R3M A;  2DHZ A;  1ZKH A;  5JH5 C;  4E71 A;  2C9W B;  3ONS A;  3ZW3 A;  4HDQ A;  4MH0 E;  3ALB A;  2KWC A;  3ML8 A;  3AI5 A;  3TL5 A;  1YIW A;  2LUE A;  3UQB A;  2K6D B;  2RR9 A;  3C0R B;  1X1M A;  3KUZ A;  1GNU A;  2N1W A;  5E6P A;  2ZNV C;  2G4D B;  5BO4 B;  2ZCC A;  4W9L A;  2XBB C;  2WDT B;  2JZZ A;  2LWP A;  2QHO A;  4JL9 A;  3RD2 A;  3T9L A;  3X0W A;  4DBG A;  5L95 C;  3PV1 A;  3L54 A;  1YX5 B;  1KM7 A;  2CR5 A;  2GBJ A;  1XT9 B;  4M8N A;  1XQQ A;  2V1Y A;  2XK5 A;  2KDB A;  3PLV A;  3QJZ A;  4NAW B;  2Y5B B;  4PYU A;  2CHX A;  2KJR A;  2DYB A;  3EHV A;  4FJY A;  3WIM A;  3AUL A;  2KFK A;  3KVF B;  1KLV A;  3QQ8 B;  5JZE B;  4YL8 A;  5D6J B;  2KQS A;  3W1S C;  2KKC A;  2KHW B;  2PEA A;  1J8C A;  1S3S G;  2MP2 A;  2BKF A;  2OJR A;  2AEH A;  2DYO A;  2LGY A;  2ZPY A;  3A9J B;  4MJS B;  2MBO A;  3PPA A;  3JW0 X;  4WWN A;  1V5T A;  1HE8 A;  4MEL A;  3PHW B;  2L0T A;  3DPD A;  2IO0 B;  4ICU A;  3P2B A;  3BY4 B;  5CHV C;  4HCN B;  1WF9 A;  3ZDT A;  2M17 A;  3QHT A;  3H7S A;  3AXC A;  1Q0W B;  4K7S A;  2NCN A;  5DPT A;  4PYZ A;  4FLH A;  2D11 A;  1GG3 A;  2KX3 A;  1WGH A;  4WAA A;  2CKH B;  3CF6 E;  1LM8 B;  2LI5 A;  3M3J A;  4ZRK A;  3R7Q A;  4WJO A;  2KVR A;  4BKS D;  5DPR A;  1WMH B;  4A3P A;  5E6O A;  4BKT A;  3RUI B;  1S1Q B;  2A4Z A;  2C5L C;  2KX0 A;  2KMC A;  2L8J A;  4ZDV A;  1J0G A;  3SU8 X;  1WE7 A;  4F7Z A;  2JPH A;  5J2R A;  2R2O A;  5JHA A;  4B9K A;  2C7M B;  3CSF A;  4ZYN A;  1WE6 A;  2LXC A;  3H7P B;  4W9G A;  2RSU A;  3DVG X;  4WJN A;  4IWP A;  2MLB A;  1WXA A;  4DHZ E;  2O2V A;  1E5W A;  4MGK E;  1UBI A;  3ZRF A;  1WIA A;  2N4F A;  5LXH A;  1M94 A;  1WI0 A;  2KLG A;  1NDD A;  3Q3J A;  4HJK A;  4CHK A;  3N30 A;  4ZRJ A;  2MW5 A;  4W9I A;  1SGH A;  4II2 B;  4NJ6 A;  3PRZ A;  1Q1O A;  3SHQ A;  2NBW B;  2MBB B;  1OGW A;  2UWQ A;  4II3 B;  2O6V B;  3RYT A;  4W9D A;  5JHB A;  2MSE D;  1UH6 A;  4FBJ B;  4ANW A;  1Y8R C;  4PS8 A;  2NPT B;  3JSV B;  2DX5 B;  3PTF C;  3PRE A;  4HXD A;  5AZH A;  3X23 A;  1E7U A;  3VTW A;  2MX2 A;  1WXV A;  2JXX A;  2Z0E B;  3I3T B;  4BBN C;  4ANU A;  2ZZP B;  1IP9 A;  2DZM A;  4KDI C;  2AL3 A;  2HJ8 A;  2K25 A;  2JRI B;  2PJH A;  2PPH A;  2DZK A;  3QC8 B;  3R7R A;  4KZ0 A;  2MBQ A;  1WZ0 A;  2MBH A;  2LJ5 A;  4IWQ A;  3PT2 B;  3A9K A;  3KW5 B;  3A33 B;  1OTR B;  1R4M I;  3ZNI D;  1P3Q U;  3M62 B;  3VVW B;  3W1Y A;  3NHE B;  3APF A;  3HM3 A;  1I42 A;  1WZ3 A;  1TGZ B;  3SDL C;  3PRM B;  3QAR A;  1UD7 A;  1C3T A;  4AWJ A;  4ANX A;  1WJN A;  2MQJ A;  3TMP B;  3PVL A;  2MRP A;  5J18 A;  2GBM A;  2LD9 A;  2MBE A;  2NR2 A;  3VH3 B;  2N9X A;  2ZJD A;  2L0F A;  1SE9 A;  2KC1 A;  2PE9 A;  3EFU A;  4DWF A;  1R4N I;  2REX A;  4B95 A;  5CTR C;  1UGM A;  2D3G A;  4KSK C;  3V61 A;  3PHX B;  1LFD A;  2AL6 A;  2JRH A;  2KAN A;  4M8M A;  3DBH I;  2DYM A;  5AZF A;  3IVF A;  4KVG B;  2KDE B;  3OJ4 B;  4K7U A;  2LZ6 A;  1UZX B;  2J7Q B;  3V6C B;  2FID A;  4A20 A;  3DDC B;  2CU1 A;  3PS6 A;  3VUW A;  2KZR A;  5J17 A;  2FAZ A;  2KK8 A;  3L0W B;  1RLF A;  3LJ3 A;  1V86 A;  2DZI A;  1WX8 A;  1EF1 A;  2L76 A;  3U30 A;  2W9N A;  3ZIM A;  4J6I A;  3A1Q A;  4BBN F;  3R66 C;  3CST A;  4I6N B;  2KOX A;  3ML9 A;  5CHF A;  3HK0 A;  2AYO B;  2R2Q A;  1V80 A;  4KDL B;  4JIO U;  1LQB A;  1FXT B;  4NJ7 A;  2BGF A;  2N9P C;  2D10 A;  4NAW A;  4WJQ A;  3VQI A;  2LXA A;  1IPG A;  4GU2 A;  4AP4 C;  3PSE B;  3RUL A;  1E8X A;  1WJ4 A;  3ZVV A;  4BFR A;  1ZGU B;  2BWF A;  4AJW A;  5CX3 A;  1WGD A;  2HD5 B;  3QX1 A;  3QWZ B;  4TKN A;  3TCA A;  2MA9 B;  3M95 A;  3WAN A;  3A9J A;  4MJS A;  2IZV B;  5C23 A;  4W9C A;  2KJH B;  1I35 A;  1KOT A;  1WH3 A;  4W9H A;  4GGQ A;  3UQA A;  2BPS A;  4MM3 A;  3UIP B;  4HWI B;  4BOZ B;  3QIJ A;  2KTR B;  2J0K A;  3ZNZ B;  5D2M B;  5AEK B;  3QCA A;  3VTU A;  1WRD B;  1WJU A;  3HM6 X;  2XK5 B;  2BYE A;  2ZEQ A;  2KFJ A;  4MGZ E;  4FJZ A;  3PLU A;  1GC6 A;  2NBV B;  4FUL A;  1AAR A;  2KDF B;  2KXJ A;  2O6V D;  1GUA B;  2M1M A;  3DVG Y;  2GBN A;  2VRR B;  3JVZ X;  3M63 B;  2IO2 B;  4K1R B;  4KIK B;  2MP2 B;  3VXW A;  4GDK A;  2LVP A;  4G11 A;  2BYF A;  2LRU A;  2L7R A;  2J0M A;  2KJ6 A;  1BT0 A;  1TBE A;  2LVO A;  2GBR A;  2HTH A;  2V4L A;  3NZS A;  3PZD A;  1GC7 A;  4N9F 4;  4GIV A;  5DCN A;  2N7E A;  2KWU B;  4W9E A;  2LAS A;  4CYE A;  4I6L B;  2PE6 B;  3ZDM C;  3VAW A;  2EKE C;  4G3X B;  5KHQ A;  3H1U A;  3AU4 A;  3DBL I;  1U4A A;  1WGR A;  3V62 A;  4OVV A;  2B3A A;  2JT4 B;  4LJO B;  4GDL A;  4NQK E;  2FUH B;  2O6V A;  4FA6 A;  2DZJ A;  4TV3 A;  2N7D A;  4BKS A;  2DEN B;  2ZVN A;  2NPT A;  3WAO A;  3QA8 A;  4HDO A;  4HPL B;  2N9E B;  2IO1 B;  4WWP A;  3B0A A;  4LDT B;  5AZG A;  1ZW7 A;  2K8C A;  4ICV A;  3HIZ A;  2KWV B;  1XD3 B;  1E8Z A;  1NI2 A;  4BOS C;  5TR5 A;  4DDI D;  4FN2 A;  3GZN I;  1Z5S B;  3S2A A;  2ZVO A;  4LJP B;  2M8S A;  1L7Y A;  2D2Q A;  2KD0 A;  3VDZ A;  2BKR B;  2RPQ A;  2WX1 A;  1E8Y A;  4IW0 A;  2I1J A;  2CHW A;  2EMT A;  3DVN V;  2K6Q A;  3UIN B;  2Z59 B;  1UEL A;  1H8C A;  4MDK E;  1E8W A;  2KQ7 A;  3K9P B;  4W9K A;  2FCS A;  4DK5 A;  3ZRC A;  5HKH A;  3V60 A;  1UBQ A;  1WM2 A;  2HE7 A;  4JLC A;  1Q5W B;  4A3O A;  4EEW A;  4F8C B;  3KYC D;  4EFO A;  3U7D A;  2IYD B;  5KHO A;  1KJT A;  3EEC A;  1YX6 B;  2G3Q B;  4G50 A;  3TBL D;  4NY0 A;  1EUV B;  3WAP A;  4KV2 A;  3ZLZ A;  3ZO5 B;  5DPW A;  3JYU A;  4IM2 A;  1OEY J;  2JVC A;  2GOW A;  2BYV E;  4P7I A;  2K8B A;  5G55 A;  2KN5 A;  1YJ1 A;  4IUM B;  3EC8 A;  4GOC A;  2JUO A;  2KMA A;  1MG8 A;  4G0N B;  5EDS A;  2RD0 A;  2GBK A;  1OEY A;  3IG3 A;  1P98 A;  2OOB B;  3A9K B;  4XX5 A;  4PS7 A;  4JGH B;  1RFA A;  5C1Z A;  3DOW A;  3N32 A;  3W1S A;  1WYW B;  3L16 A;  3HHM A;  2JF5 A;  5GMV A;  5D7G A;  2L3Z A;  3D32 A;  1WJ6 A;  3KUD B;  1CMX B;  2BF8 B;  1L2N A;  1WR6 E;  2ASQ A;  3IHP C;  4KZC A;  3H9D A;  3ZTC A;  4W9F A;  4URK A;  4OVU A;  3DBS A;  4WJP A;  4EUT A;  2L05 A;  2N1V A;  2CHZ A;  2NS5 A;  4GXB A;  4E74 A;  3ZNH B;  4MEM A;  2JY6 A;  1V2Y A;  3A4S C;  4ANV A;  4HCP B;  2I1K A;  2V3S A;  4K7W A;  2DAF A;  3NS8 A;  4DHZ B;  3KYD D;  3OJ3 A;  1WXS A;  4FHJ A;  2M0X A;  2G4S A;  3QAQ A;  1J19 A;  5D94 A;  3ZKJ C;  4I6P A;  3APD A;  2ZCB A;  3TJP A;  4FJV B;  1V5O A;  2BWE S;  2C7N B;  3VUY A;  1P9D U;  5IA7 A;  3PGE A;  4TUU A;  4RM9 A;  4PS3 A;  4RM8 A;  4DXA B;  3MTN B;  2XEW A;  2C7H A;  2LVQ A;  3RCZ A;  1VCB A;  1C1Y B;  5CHW A;  3KH0 A;  1RRB A;  3AU5 A;  3A1Q B;  4M0W B;  4DHJ B;  2AWT A;  2RGF A;  2KTR A;  4TQ1 A;  3VHT C;  1QZE A;  3WAM A;  3SD5 A;  4AJY B;  4CO7 A;  3VTV A;  4WQO B;  2K39 A;  4MSQ B;  2A5U A;  2JZ3 B;  3UGB B;  1IYF A;  2K1F A;  2IBI B;  4FAD A;  1G6J A;  3DVN U;  4K81 A;  4B6W A;  1A5R A;  3V6E B;  1H4R A;  4ASW C;  1WM3 A;  2KFK B;  1NBF C;  3ECI A;  2FCN A;  5IAA C;  1WMH A;  4JQW C;  1E90 A;  4KIK A;  3DBR I;  1OQY A;  3MJW A;  3IFW B;  3L17 A;  4LDT D;  2NBU A;  1T0Y A;  1TTN A;  3ZNG C;  4F1S A;  2L00 B;  5LLI A;  3DQV A;  3RZF A;  1WR1 A;  3B08 A;  1TZ1 A;  3H7P A;  4XZ4 A;  1P0R A;  1WY8 A;  4HPM B;  2Z0D B;  4LCD E;  2IY1 B;  3K9O B;  4GN1 A;  2LGX A;  5L83 A;  1D3Z A;  1WXM A;  2GMI C;  2KTF A;  5LXI B;  3CMM B;  3B1L X;  4BKG A;  2NVU I;  2FCQ A;  2FIF A;  5G2N A;  3NY5 A;  4IWO A;  4EZJ A;  2DAJ A;  4ZRI A;  2ZPN A;  3ENE A;  2KNB A;  2WX0 A;  3JSV A;  4IG7 B;  2K8H A;  1EO6 A;  4GDK B;  3GOE A;  1WGY A;  4IM3 A;  4KSL C;  1LXD A;  3RT3 B;  2UYZ B;  4AUQ C;  2KO3 A;  2MWS B;  3OAW A;  5E6N A;  3DCG A;  4BVU C;  4RMA A;  4X57 B;  4HLE A;  1WGG A;  2CS4 A;  2FCM A;  2EMS A;  4NQL B;  2YLM A;  1ISN A;  1WX9 A;  3APC A;  2O2V B;  3U8Z A;  2IO3 B;  2LGD A;  3VFK A;  3L08 A;  4MSM B;  3ZUN A;  3VH4 B;  4IM0 A;  4EKU A;  3UF8 A;  4GDL B;  2KC2 A;  3NOB A;  4NNJ B;  1YQB A;  1WFY A;  3MHS D;  1SIF A;  2LRW A;  1YD8 U;  3VUX A;  2C60 A;  1V9J A;  3L10 B;  3WA0 A;  4DDG D;  3NZU A;  3OLM D;  1WX7 A;  5DPS A;  4TQ0 A;  3WAL A;  3N3K B;  4AOF A;  1JRU A;  3TIX A;  3KUC B;  4GSW A;  1GJZ A;  1F9J A;  1V81 A;  1P1A A;  2MCN B;  4GB9 A;  2JWZ A;  2WWZ A;  1PQS A;  3BIN A;  4GMV A;  3O65 B;  4FHK A;  3QK0 A;  2J0J A;  4HVB A;  1EF5 A;  3IBE A;  1E7V A;  3RZW C;  1VD2 A;  1V49 A;  1V6E A;  2ZNV B;  3T8M A;  4XC2 A;  3Q3F A;  3H6N A;  4MGI E;  4EZK A;  2KLC A;  4IC7 B;  2M4N A;  3UIO B;  4EZL A;  2IY0 B;  4MGY E;  4EOY A;  2KDI A;  2G45 B;  4NPN A;  2D07 B;  2YVC A;  4W9J A;  2WYQ A;  3A4R A;  4HK2 A;  4E3C A;  5FR6 A;  3PRP B;  1K8R B;  1Z2M A;  1RAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...