3DBRI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190gln-nedd8ala72arg)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
85
Chain Sequence
b'RRASVGSGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLRLRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEDD8-activating enzyme E1 regulatory subunit
molecule tags Cell cycle
source organism Homo sapiens
publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
total genus 18
structure length 85
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dbrI00
4HDOA 1M94A 2ZVOA 4W9HA 1QZEA 1TGZB 4FJYA 4NQLB 3ALBA 3K9OB 2N9EB 2AL3A 2CHZA 3TCAA 2W9NA 2BWES 5LXIB 1L2NA 2WDTB 2BYVE 2L0FA 2KXJA 2O2VA 1A5RA 2DZMA 2K39A 2KFKA 3APFA 2KMCA 1WE6A 3ZRFA 2KLGA 3O65B 1U4AA 4XC2A 3VXWA 4F1SA 1WRDB 2L00B 4CYEA 3RZFA 2C7HA 1UBQA 5CHFA 3K9PB 2BGFA 2AEHA 2KTFA 3CMMB 4HXDA 1WX7A 2DX5B 2V4LA 1XQQA 2N4FA 5D6JB 2DYOA 4BBNF 1YD8U 1E8YA 2KWUB 3R7QA 2ZVNA 1LQBA 2O6VB 5D7GA 1KM7A 2K25A 3I3TB 1KJTA 4IWQA 3JYUA 4NY0A 4BBNC 2NCNA 2PEAA 1Q1OA 3A9JB 1V6EA 2KQ7A 2KVRA 4J6IA 2LJ5A 2ZZPB 4IWPA 1H8CA 4AUQC 2RD0A 4FJZA 3L10B 2RPQA 1ZW7A 2VRRB 3T8MA 4ZRKA 3NY5A 3M62B 1E7VA 1WGHA 3DDCB 4BOZB 2IY1B 3H9DA 5L95C 4LJPB 2ZPNA 1WJ4A 2FAZA 1XT9B 2DHZA 4XZ4A 1EF5A 1UGMA 2K1FA 4HK2A 2JVCA 4HWIB 4AJYB 2JT4B 2G3QB 3DVGY 4MGKE 1XD3B 4W9CA 5JZEB 1WXMA 5JHBA 1Q0WB 3EC8A 2V3SA 2LI5A 3PS6A 4MH0E 1ISNA 4DWFA 2ZJDA 2NS5A 2DENB 5E6NA 1IP9A 3KW5B 3CSFA 3L17A 3QIJA 1EF1A 4GDKA 1YJ1A 2JRHA 2JZZA 2D10A 1UZXB 3VH3B 2MLBA 1WI0A 3A1QA 2MP2A 2XEWA 5DPRA 4PS3A 3U30A 1WZ3A 4HVBA 1WX9A 2J7QB 2GMIC 4K7UA 4NAWB 2KJRA 4II2B 4AJWA 4MGYE 3ZVVA 1OTRB 1WH3A 4FADA 5AEKB 3N30A 1UELA 2LRUA 5LXHA 2L8JA 4BVUC 1YX6B 2CU1A 3H7SA 4DDGD 3TJPA 2O6VD 2NVUI 2ZCBA 2JY6A 4FJVB 3QK0A 1L7YA 3QWZB 4HCNB 3ZTDA 2BYFA 2HTHA 3Q3FA 3VHTC 5IA7A 4EZLA 1IYFA 1P3QU 2XK5B 4ANXA 3GOEA 3R7RA 3RULA 3VTVA 2KLCA 1F9JA 3L16A 4NJ6A 3U8ZA 4MGIE 1P0RA 2GBJA 2KJHB 2M8SA 3H7PB 2N9XA 3HHMA 3B0AA 3L08A 2LVQA 1V86A 1LM8B 4KZCA 3T9LA 1I42A 3PLUA 3WA0A 1KLVA 3IVFA 5JH5C 1NBFC 4B6WA 4K7WA 4EFOA 2KWCA 2KKCA 4PS7A 3ZLZA 2MBHA 3KYCD 2MSED 3OLMD 2MA9B 2MBEA 4E3CA 3EECA 3A4SC 2O6VA 4HCPB 3HIZA 4GDKB 3N32A 2GBRA 3APDA 2KDEB 5C23A 1E8XA 3KUDB 3RYTA 4ANWA 2NPTA 5CTRC 4ZDVA 2MW5A 4RMAA 2KZRA 2MP2B 3ZRCA 3MJWA 2FCQA 4ANVA 2PPHA 3QJZA 5EDSA 3W1SC 2LXAA 1MG8A 2ZPYA 1S1QB 2PE6B 4WWNA 4K1RB 3VVWB 2LD9A 1GNUA 1Z2MA 3KH0A 2EMSA 4FULA 1RLFA 2PE9A 4W9FA 2ZNVB 3SU8X 3KUZA 2BWFA 3AU5A 2N9PC 2Z0EB 4P7IA 3B1LX 2FCNA 5E6PA 3PV1A 4KVGB 3TIXA 4HPLB 4GB9A 4G0NB 3H1UA 4KDIC 3HM3A 4NNJB 2UWQA 3RZWC 2KDFB 4GSWA 3VQIA 2BPSA 4MEMA 2LGYA 2KTRB 4LDTD 5KHOA 2CKHB 1I35A 1V2YA 1WXSA 2MBOA 2N1WA 5CX3A 2WX1A 1E5WA 3ZNGC 4G3XB 5C1ZA 4NJ7A 2EKEC 3ZO5B 2XBBC 5DPWA 2N1VA 3VUWA 3AU4A 3X23A 3AULA 2V1YA 1HE8A 2R2QA 3W1YA 2B3AA 2JPHA 2BYEA 3L0WB 2LXCA 1TZ1A 2LZ6A 3V6EB 3DBRI 4GDLB 1LXDA 2L3ZA 3SDLC 2KC2A 2FIDA 3H6NA 2KFJA 1WGDA 3DOWA 2DYBA 1TBEA 3NS8A 4TQ1A 1WE7A 2N7DA 5D94A 4CHKA 4ICUA 4FHKA 4URKA 4DHZE 2KK8A 2C7NB 3DVGX 1E90A 1Z5SB 2C9WB 4A20A 4IM3A 4PS8A 5KHQA 4MSMB 1WXVA 4WWPA 2JZ3B 1WZ0A 3L54A 4FBJB 5AZFA 2A5UA 1GC6A 4E74A 4EOYA 1NDDA 2D11A 3X0WA 2M0XA 3IFWB 4AP4C 2AWTA 5LLIA 4XX5A 4CO7A 4DHZB 3ZNID 3B08A 1LFDA 4FN2A 1OEYA 4IM2A 3UIPB 4W9GA 1UBIA 4LJOB 1S3SG 3BY4B 4MSQB 3DBLI 3PPAA 3PTFC 1WMHA 4ICVA 3M95A 4FHJA 5FR6A 3UIOB 3VH4B 1V5TA 4M8MA 1PQSA 1JRUA 2PJHA 3KUCB 3MHSD 1YQBA 4NQKE 2RGFA 3PSEB 4IG7B 4MDKE 3VFKA 2LGDA 2DZJA 3PVLA 2C60A 1P1AA 1RAXA 2A4ZA 3QC8B 2D07B 4HPMB 3PGEA 1X1MA 3DPDA 5J18A 1IPGA 1WGRA 3P2BA 2AYOB 4DXAB 2KWVB 2WWZA 2HD5B 3QHTA 2MBQA 1WJNA 4ASWC 3MTNB 3ML9A 3QARA 4HLEA 2KANA 2G45B 2JUOA 1J8CA 3UGBB 2GBNA 4IUMB 3UQAA 2KX0A 5AZGA 1CMXB 4ZRIA 4DHJB 1EO6A 2QHOA 2MCNB 1WMHB 3D32A 4OVVA 4BKSA 4PYUA 4ANUA 4G50A 4WJPA 3KYDD 4HJKA 3RUIB 3VTUA 2FUHB 2NBWB 1WYWB 3DCGA 4DHJD 4I6LB 4GOCA 4M0WB 2K6QA 3DBHI 1K8RB 2JRIB 5G55A 2JF5A 3AXCA 4X57B 3V6CB 2I1JA 3OAWA 3NHEB 1C1YB 4KSLC 1UH6A 5D2MB 1AARA 3EHVA 4DDID 5L83A 4PYZA 3A9KB 2KC1A 4W9LA 2IY0B 4JLCA 3JSVA 3JVZX 3WAPA 3BINA 2CR5A 4FA6A 3A9JA 2BF8B 3NZUA 3GZNI 2D3GA 3AI5A 2C5LC 2DZIA 4BKGA 4GDLA 3JW0X 1R4NI 2IYDB 3R3MA 2M17A 5IAAC 3SHQA 5G2NA 5E6OA 3JSVB 3WAMA 4MJSA 3ZDTA 2FIFA 3TL5A 3U7DA 2MWSB 2DZKA 3VDZA 4TQ0A 1SGHA 4ZRJA 3TMPB 3RCZA 3VTWA 3ZNZB 2CS4A 2LASA 3PRZA 3V62A 3ZDMC 1ZGUB 1OQYA 1WR6E 4IWOA 2R2OA 3WAOA 1TTNA 2KD0A 3H7PA 4F8CB 2IO3B 4GXBA 3QX1A 4MELA 1J19A 2FNJB 5DPSA 1Q5WB 3PREA 2WYQA 4W9DA 2CHXA 2K8BA 1WM3A 1RRBA 4GU2A 4WJNA 2IBIB 1J0GA 3Q3JA 1Y8RC 2IO0B 2K8CA 4EUTA 1WR1A 2RSUA 4MGZE 5CHVC 4EKUA 3LJ3A 2KN5A 1E8WA 1V81A 4IM0A 2Y5BB 3ZNHB 3DQVA 5CHWA 3ZKJC 3ECIA 3IHPC 4BKSD 1R4MI 1OGWA 2NPTB 3WALA 3A4RA 3CSTA 4I6PA 4OVUA 4AWJA 4B9KA 3IG3A 4MM3A 1GC7A 2KO3A 1BT0A 2DAJA 3L13A 4NPNA 4WQOB 4K81A 2KFKB 4KDLB 4ZYNA 2I1KA 4GIVA 4BOSC 1YX5B 3PRMB 1T0YA 4MJSB 4GN1A 3UINB 1WGYA 2KX3A 2J0JA 2LRWA 4M8NA 2M1MA 4W9JA 1V9JA 2HE7A 1ZKHA 1V5OA 3HM6X 1WX8A 3W1SA 4KV2A 3PZDA 4HDQA 4JQWC 1WM2A 4W9EA 4RM9A 3S2AA 3A9KA 2NBUA 1WXAA 1WIAA 1RFAA 4RM8A 3ONSA 2KTRA 2KDBA 3PT2B 2L7RA 2LGXA 5J2RA 2HJ8A 4G11A 3M3JA 2L05A 2C7MB 2M4NA 2DAFA 5DCNA 3KVFB 4DK5A 1KOTA 4WJQA 4WJOA 5HKHA 1E7UA 2LUEA 2IZVB 4IW0A 2GBKA 1SIFA 2L0TA 2MBBB 2YVCA 3LDZE 4DBGA 3OJ3A 2K8HA 3QA8A 3DVNV 3IBEA 4TV3A 4JIOU 1V80A 4N9F4 4KIKB 2LVPA 1P9DU 4NAWA 2ZCCA 4W9KA 2FCMA 2KJ6A 2NR2A 2WX0A 3R66C 4FLHA 2JXXA 2K6DB 3DBSA 4F7ZA 5TR5A 2KDIA 4IC7B 3VUXA 3C0RB 5JHAA 4GGQA 3A33B 4WAAA 3ZIMA 3V60A 2J0MA 3QAQA 4B95A 5J17A 4E71A 2REXA 4KIKA 4JL9A 1NI2A 2RR9A 1GG3A 2J0KA 1OEYJ 4A3PA 2G4DB 4W9IA 2N7EA 2FCSA 2CHWA 2ASQA 1EUVB 2BKRB 2NBVB 2KOXA 2ZEQA 3CF6E 2UYZB 2IO1B 3V61A 2Z59B 2D2QA 2AL6A 1G6JA 5BO4B 1C3TA 2Z0DB 3UQBA 1V49A 2ZNVC 1VCBA 4JGHB 4TKNA 2DYMA 2OOBB 1SE9A 3NOBA 5GMVA 1E8ZA 1WFYA 4EZJA 1GJZA 2MQJA 1GUAB 2KQSA 3QCAA 3M63B 3VAWA 2XK5A 3ENEA 4K7SA 3PHWB 3VUYA 4KZ0A 4GMVA 2KNBA 4AOFA 4EEWA 1WJUA 3WANA 2L76A 4TUUA 3NZSA 1YIWA 3ZUNA 2LVOA 4BKTA 2MX2A 2EMTA 1P98A 5DPTA 3UF8A 4BFRA 1WY8A 2JWZA 3A1QB 3SD5A 3WIMA 3ZW3A 1H4RA 2GOWA 1WJ6A 4EZKA 2KHWB 3PRPB 3RD2A 3TBLD 3DVNU 2OJRA 3APCA 1WF9A 1D3ZA 2GBMA 3HK0A 2BKFA 3PHXB 2YLMA 3EFUA 2IO2B 3ZTCA 3OJ4B 4I6NB 1WGGA 3PLVA 2LWPA 4YL8A 4LDTB 2KMAA 4WWOA 4KSKC 1FXTB 2O2VB 3QQ8B 4LCDE 3ML8A 3RT3B 5AZHA 2G4SA 4II3B 4A3OA 1UD7A 2MRPA 3N3KB 1VD2A
chains in the Genus database with same CATH superfamily
2ZVOA 2WXJA 1C76A 2AL3A 2CHZA 2JYTA 3TCAA 2J42A 2BWES 2AQ2B 2O2VA 4A8XC 2DZMA 2K39A 1VR9A 2D5GA 2KLGA 1U4AA 4XC2A 3EUB2 1WRDB 2QC8A 3OG5A 2PVOD 3RZFA 2KTFA 1N6ZA 4YTMB 3BVZA 2DYOA 1MFWA 2ZVNA 2OEDA 4IWQA 3JYUA 4BBNC 1Q1OA 2D3CA 2LJ5A 1H8CA 4AUQC 2RD0A 2RPQA 1ZW7A 1E6EB 3VR9B 2JU6X 4BOZB 3H8HA 4LJPB 2ZPNA 4MGKE 3DVGY 5JZEB 1WXMA 1WXQA 1Q0WB 3AE3B 2X8XX 4AQ7A 2NS5A 2DENB 5E6NA 3KW5B 1EF1A 4GDKA 2L52A 2L1AA 1UZXB 1WI0A 3A1QA 5DPRA 3FKYA 4HVBA 2GMIC 1ZXIA 4MGYE 5AEKB 1OTRB 3W5UB 3Q6BA 3B9JA 3AE9B 3ZJVA 2NVUI 2ZCBA 1I4PA 3QK0A 3QWZB 4HCNB 2BYFA 5IA7A 2KMMA 3VHTC 2XK5B 3Q8EA 3VTVA 2QILA 1F9JA 2M8SA 2KJHB 2N9XA 4RGOS 4XYCA 4PT5A 3L08A 1E0ZA 3O13A 1I42A 3PLUA 2DWQA 3IVFA 1NBFC 3RMKC 4PS7A 2MA9B 3A4SC 1F2RI 3PO0A 2GBRA 5C23A 4NAMA 5CTRC 4ZDVA 2MW5A 2KZRA 3ZRCA 3MJWA 2FCQA 4ANVA 2PPHA 3QJZA 3W1SC 1MG8A 3BZDB 3LXFA 2I38A 5LNK1 1RLFA 4W9FA 2BT6A 2BS2B 3CIRB 2Z0EB 2FCNA 4N58A 3PV1A 1ZOYB 2KDFB 2WS3B 3VQIA 3KWVA 2KTRB 3AECB 1JCKB 2CKHB 1YJIA 2GLSA 3HVZA 1WXSA 2MBOA 5AUKA 5C1ZA 4G3XB 1JW9D 4NJ7A 1L4DB 3X23A 2D3BA 3W1YA 1TYGB 2JPHA 3L0WB 4HPPA 4S17A 2DYBA 3NS8A 2Y5CA 1XF5L 2INPE 4ICUA 2RDHA 2KK8A 2ON8A 1E90A 3NVZA 5KHQA 2WXLA 4MSMB 5AZFA 5TSSA 1T0SC 3IFWB 4L2YA 1FEHA 1LFDA 1OEYA 1T0QC 2PW9A 3UIPB 3RPFC 1UBIA 1IUEA 2BW2A 1KRHA 5BMGA 3VH4B 3Q3OC 2IGGA 5G5GA 4CQNA 3DWGC 1P1AA 1KTKA 3NJTA 1D4BA 1RAXA 2A4ZA 1X1MA 3DPDA 3P2BA 4JWUC 1TY0A 1C79A 3MTNB 2G45B 2KWDA 2SEBD 4IUMB 1TS5A 1NENB 2KX0A 4M02A 3T3OA 2MCNB 1WMHB 3D32A 4MACA 4ANUA 1F77A 2DBYA 4WJPA 3VTUA 1UF0A 2J4XA 4GOCA 4M0WB 1SIJA 2K6QA 1K8RB 5G55A 2JF5A 3AXCA 1RFKA 4WQMA 1C1YB 3EGRA 3N1XC 4PYZA 3A9KB 2KC1A 1MPEA 2JZPA 3WAPA 1FMAD 3FAHA 4FA6A 1R4MB 2K0PA 2BF8B 3NZUA 3AI5A 4MH8A 4BKGA 2N0SB 2MHJA 1JWUD 2WP9B 2M17A 4NJCA 1MVKA 2EKIA 3ZDTA 1DYQA 1SBBB 3U7DA 1SGHA 2BTEA 3VTWA 1J7BA 2CS4A 4WURA 1DOYA 2WXNA 4IWOA 1QKZA 4RH6A 4LNIA 1Q5WB 1WM3A 4WJNA 1J0GA 3GS2A 1Y8RC 2IO0B 2K8CA 5CHVC 4EKUA 4RNAA 3I57A 1FFUA 3W2DA 3DQVA 3ZKJC 2WNMA 3IHPC 4BKSD 4I6PA 1ZE3D 4MM3A 4K81A 4KDLB 1TKYA 1UNSA 3PRMB 2TSSA 2VH1A 4W9JA 1ZKHA 3HM6X 3P4QB 1IBXA 4ZRPA 2KDBA 3C8YA 2L7RA 4G11A 4C7ZA 1EU4A 4DK5A 2BS4B 1ACCA 2LUEA 2IZVB 2WXPA 2WU5B 2GBKA 2YVCA 3DHIC 1EM7A 3OJ3A 2K8HA 4M0WA 3QA8A 4JIOU 1XLQA 5EE9A 2LVPA 4NAWA 2FCMA 2NR2A 2JXXA 3DBSA 3VUXA 4GGQA 5EE1A 3N3KB 2LHDA 1B9RA 3BK1A 2E3TA 3WCQA 2MJEA 4A3PA 4DWFA 2ASQA 1BMLC 1EUVB 3V61A 2IO1B 1G6JA 2Z59B 1C3TA 2ZNVC 4JGHB 1ENFA 2DYMA 1SE9A 5EE0A 3NOBA 4HKZE 4FXCA 2KQSA 3M63B 3VAWA 2Y3AA 2K22A 4K7SA 4RF0A 1QOGA 4KZ0A 1FXAA 4K3BA 2MEKA 4C00A 1WJUA 1NYRA 1UWMA 2Q5WD 1YIWA 3ZGZA 4B0MA 1C4PA 4BFRA 4KKJA 1WY8A 2JWZA 3ZW3A 1H4RA 2GOWA 3R2IA 2RPVA 1J7AA 4N59A 4LNFA 1TS2A 3IAS1 4GLSC 3OJ4B 1WGGA 4WWOA 1I4GA 3B2GA 1L6VA 1VDVA 5AZHA 3ABVB 4II3B 1VZ8A 4A3OA 2MJ3A 2FUG1 3NUHB 4W9HA 3BVGA 1QZEA 4JE3B 4NQLB 2W9NA 5LXIB 2WDTB 2BYVE 3AM9A 2KXJA 1A5RA 2KMCA 3O65B 2L00B 4CYEA 3RNAC 1UBQA 2WHIA 3CMMB 4HXDA 2MH7A 4C56C 1AW7A 4BBNF 1N62A 2NTSA 1NEKB 3RNCC 4JX1C 5D7GA 1KM7A 3I3TB 3I9V1 4NY0A 2PEAA 2KQ7A 3TEZA 4IWPA 1DOIA 4LNNA 4RF1A 4FJZA 3AE2B 5IP4D 1L0VB 3DDCB 3VRBB 3H9DA 5L95C 2DHZA 1EF5A 1UGMA 4HWIB 2G3QB 1YN3A 5D3DA 1XXGA 2G9HD 1IP9A 3KQ4A 1JWSD 3CSFA 2JZZA 4OZBA 2XEWA 3U30A 2V3NA 4K7UA 4NAWB 3ZVVA 4FADA 1UELA 1T0RC 2L8JA 4BVUC 2HJ1A 1GPXA 3Q8AA 2WXFA 1F1HA 4KKIA 1YN5A 2O6VD 2AQ3B 1TS3A 1IYFA 1C4CA 3Q8FA 4RGMA 1T5XD 3U8ZA 1P0RA 2GBJA 3B0AA 1A70A 1V86A 4KZCA 1RWSA 5JH5C 2YEPF 1JWMD 2KWCA 4OZCA 2MBHA 3KYCD 3OLMD 2MBEA 2QSDA 1XEEA 3N1ZC 2O6VA 1E8XA 4IOIE 2V4IB 2QIEB 2KYWA 2LXAA 3RNEC 3RN9C 4WWNA 4L23A 1JALA 3KLSX 3KH0A 2EMSA 3KUZA 5E6PA 3TIXA 4GB9A 4KDIC 3H1UA 3RZWC 1LGRA 2LGYA 4LDTD 2WXOA 4OVZA 5KHOA 1V2YA 2WDVB 3TEYA 5CX3A 3W9CB 2WX1A 3P4PB 1DGJA 3ZO5B 3AU4A 4HEA1 2B3AA 1TZ1A 1FCCC 2LZ6A 3DBRI 3SDLC 1E10A 3H6NA 2KFJA 2QCZA 2N7DA 5D94A 4CHKA 2BYTA 1TKGA 2C7NB 5IOIA 2JQRB 1WXVA 4OZAA 2JZ3B 1WZ0A 1FPYA 3L54A 1T6BX 2ACZB 2D11A 2WXKA 2M0XA 3DHGC 3AEAB 2G1EA 3ZNID 4IM2A 1S3SG 3DBLI 4ITKA 3ZXRA 1JROA 4ICVA 1MG4A 2WXHA 3KUCB 1RM6C 1DOXA 2RGFA 4BAXA 4QAYA 3PSEB 4MDKE 2DZJA 1HEZE 2H88B 1HQRD 4DXAB 1FFVA 2HD5B 1WJNA 3U2SC 2CJNA 1L6UA 3UQAA 4ZRIA 4REZA 4OVVA 4BKSA 3KYDD 2NBWB 3DCGA 1C4AA 3DBHI 2PKOA 2JRIB 4X57B 3VRAB 3V6CB 2I1JA 3OAWA 3NG0A 1AARA 4DDID 3JVZX 3BINA 2C5LC 5H8YE 2DZIA 2WDQB 4GDLA 1T3QA 2SAKA 3AE4B 3JSVB 2V0GA 3HRDD 4MJSA 1GB1A 4D2KA 1PDXA 2FIFA 3RI7C 3MHZA 1XCQL 4LNOA 3SFEB 3U52E 3P1MA 1N61A 3ZDMC 4P1CC 1WR6E 1K53A 4YSZB 3WAOA 4F8CB 2WQYB 4H2AA 1UWXA 5DPSA 2L32A 3PREA 2WYQA 2CHXA 1RRBA 3J9CA 4JWSC 4ZOHC 2IBIB 2RSUA 4MGZE 1CQVA 3LJ3A 2KN5A 1YQ4B 4P6VF 5CHWA 1SSNA 5E6JA 2NPTB 2LGSA 4AWJA 1GC7A 2KO3A 4NPNA 4WQOB 4ZYNA 2BB6A 2EELA 2QJLA 3BWUD 3L4PA 4MT5A 4M8NA 2M1MA 1V9JA 1BXTA 3NVWA 2LEKA 1WM2A 1MHHE 1WIAA 2H89B 2LFIA 2KTRA 3PT2B 4RGTA 3ETRA 3BIID 2M4NA 1WYGA 5DCNA 4WJOA 1E7UA 1N5WA 2WXQA 2L0TA 2MBBB 3LDZE 3N20C 3AE5B 1SE2A 3GP7A 3FILB 3IBEA 4TV3A 3U7ZA 4KIKB 1JWBD 4W9KA 1GB4A 1C78A 1IBXB 2JYEA 2D3AA 2FBWB 3C0RB 3URYA 4WAAA 3ZIMA 4KX6B 3DBLB 1OFFA 4AS1A 5J17A 4USAA 3Q14C 4RCOA 3PZ7A 2RR9A 1N60A 4YTPB 4W9IA 3CF6E 2NBVB 2BKRB 2KOXA 2AL6A 3BYTB 3N9YC 4P1BC 4DQOC 1E8ZA 4EZJA 1GUAB 3QCAA 3I5JC 1TS4A 2KNBA 3IT4B 2L76A 4J3OD 1I4XA 2KQ4X 3NZSA 3ZUNA 2LVOA 2MX2A 2EMTA 1L0YB 3A1QB 1YN4A 3SD5A 3HUIA 2HTME 2KHWB 1CZPA 3PRPB 1D3ZA 2GBMA 3PHXB 2BKFA 4PK1A 3EFUA 1ET9A 2BVCA 1SB3C 4YL8A 4LDTB 4C4VA 4KSKC 2O2VB 4YT0B 4LCDE 2G4SA 1LO5D 2MRPA 5G5HA 1M94A 4YSXB 4OW0A 3ALBA 3K9OB 2N9EB 1L2NA 2PMVA 1FNWA 2L0FA 1RYJA 1QOAA 2M0AA 1WE6A 3VXWA 3AE7B 2C7HA 5CHFA 2NMQA 3K9PB 2BGFA 2AEHA 2V4LA 3Q8CA 2IDYA 1D5MC 1XQQA 2N4FA 2W54A 4KGRA 1YD8U 1E8YA 2KWUB 4RGNA 2O6VB 2K25A 3E56A 1PGAA 1TT5B 2NCNA 4DXFA 3A9JB 1V6EA 4J6IA 5C2TB 4P16A 4O1NA 2ZZPB 4US9A 3L10B 2ZW1A 2VRRB 2JX5A 3NY5A 4ZRKA 1WGHA 1KFYB 2IY1B 4ZYSA 3U4EG 4XZ4A 4HK2A 2K1FA 2JVCA 2JT4B 1XD3B 4W9CA 3E9SA 1XLNA 3AEFB 5JHBA 3EC8A 2V3SA 2LI5A 4A90A 4XDCA 3AEGB 4MH0E 2M56B 3L17A 3QIJA 1YJ1A 1QT9A 2JRHA 2D10A 3NVYA 3GE8C 2MLBA 2MP2A 2M19A 4PS3A 3TUOA 2KJRA 4II2B 4AJWA 3DHHC 1WH3A 4C80A 2LRUA 2RDBC 1KF6B 1V8CA 2CU1A 4DDGD 1FO4A 3TJPA 4FJVB 3ZJUA 4ARIA 1L7YA 3ZTDA 3Q3FA 3V05A 4WAFA 4YTNB 3GOEA 3R7RA 1C9FA 3DWMA 4NJ6A 1FCLA 2K3UA 4MGIE 3H7PB 1P7FA 3EA6A 3HHMA 1YJJA 2LVQA 1V1PA 3T9LA 1VRAB 3GB1A 4B6WA 1F52A 3ZLZA 1ZXHA 2JXTA 3P42A 4E3CA 3EECA 1ESFA 3V3XA 4HCPB 4GDKB 2KDEB 3RYTA 2GB1A 2NPTA 2MP2B 1PGBA 2ZPYA 1S1QB 2PE6B 1E9MA 4K1RB 3VVWB 1Z2MA 3SFDB 2ZNVB 2BWFA 3AU5A 1HZ6A 2N9PC 4P7IA 2KVZA 3B1LX 4HPLB 4G0NB 3HM3A 4GSWA 2BPSA 2WXRA 3AB5A 4LK0M 4JPSA 1I35A 2N1WA 2XBBC 2N1VA 3VUWA 3RFZB 2V1YA 3I63C 1HE8A 2BYEA 4GDLB 1LXDA 4RFBA 2L3ZA 2KC2A 2FIDA 3TSSA 1IGDA 5HHDG 4XE0A 1J7CA 2W3RA 3NS1A 4TQ1A 1WE7A 3BVMA 2NTTA 4FHKA 3HVDA 4URKA 3N1YC 4DHZE 1WRIA 3DVGX 4A20A 2C9WB 1Z5SB 2DNFA 4PS8A 3W5VB 4FBJB 2A5UA 1GC6A 4E74A 4EOYA 1NDDA 3X0WA 1MI0A 1EWCA 4NZLB 2N7JA 1YMHE 4W9GA 1ET6A 4LJOB 3PTFC 1M4VA 1AN8A 5I4DA 2MJDA 1HTQA 4TSSA 5FR6A 3UIOB 1FIQA 1V5TA 4M8MA 1YQBA 3T3NA 2BS3B 2C60A 1F2RC 3QC8B 1R7SA 1QLBB 4HPMB 3PGEA 5J18A 1IPGA 1WGRA 3AN1A 2KWVB 3AEEB 2MBQA 4ASWC 1UUPA 3QARA 3ML9A 1J8CA 4MM3B 5H92C 4YSYB 2IJ0A 4DHJB 1EO6A 3ZQ4A 5IKCM 1JQ4A 4DXGA 2FUHB 1WYWB 4I6LB 2ICIA 1XCTL 1I4QA 2PVGC 4KSLC 1UH6A 2QDFA 5D2MB 3EHVA 2WXIA 1SXTA 3R8BA 4W9LA 2VZKB 2IY0B 3DBHB 4JLCA 1YQ3B 3P4RB 1C77A 5MPOA 3OWEB 2INDC 3RNGC 1L4ZB 2BB5A 4IKGA 3R3MA 3SHQA 5IN7A 1VZ6A 1NI3A 3VDZA 2DZKA 4ZRJA 3TMPB 3RCZA 1E7PB 3ZNZB 1PFDA 1Y56A 5AUIA 1OQYA 2R2OA 1TTNA 2KD0A 3H7PA 4GXBA 2PTLA 4MELA 2FNJB 2ZW0A 1TJEA 2IPKD 1WR1A 3AH7A 1V81A 1ROEA 1BUIC 3B2FA 1HXYD 2KDMA 1TY2A 1QOBA 3ECIA 3ZJTA 1OGWA 5IO9A 4M01A 5D3IB 1L5PA 2K5PA 3CSTA 3WALA 1K50A 4OVUA 3IG3A 1BT0A 2WGSA 2I1KA 4BOSC 4A6QA 2LMCA 4US8A 1WWTA 1GAQB 1T0YA 3Q2AC 2CU3A 4GN1A 3IT6B 1WGYA 1D6EC 2J0JA 2LRWA 2KT7A 2KACA 1WX8A 3PZDA 2AX5A 1FM0D 4HDQA 4JQWC 4W9EA 2BQQA 3S2AA 3A9KA 1WXAA 1RFAA 4RM8A 3ONSA 2LGXA 2HJ8A 1I7HA 3M3JA 1QF6A 1PGXA 2DAFA 2RDGA 3KVFB 1KOTA 4WJQA 3NRZA 1I4HA 1V97A 2J53A 4IW0A 3BYYB 4DBGA 2PLPA 5BYQA 2XNAC 1V80A 4N9F4 1P9DU 2ZCCA 4TMAB 1VLBA 2KJ6A 4FLHA 3R66C 2K6DB 2KDIA 1ZDXA 5JHAA 3EFCA 5BYRA 4B95A 1JMLA 1JRPA 1GG3A 2J0KA 1OEYJ 3VR8B 2FCSA 2CHWA 2ZEQA 2LUMA 2INCC 1VJKA 5BO4B 2Z0DB 1V49A 1VCBA 2OOBB 2JSVX 1KH0A 2WU2B 5GMVA 4C4VB 1TKEA 1GJZA 1L0XB 2INNE 3VUYA 4WH4A 4AOFA 1FXIA 4EEWA 1ZDVA 5DPTA 3P63A 2RMMA 3TEXA 5BMHA 1SF0A 4XWWA 4EZKA 3RD2A 3TBLD 3DVNU 2L83A 2VH2A 2YLMA 2IO2B 2OHFA 4I6NB 4LNKA 2KMAA 4HRSA 2B76B 3RT3B 3SEBA 1SJHD 4HDOA 4KGTA 2W3SA 1TGZB 4FJYA 4ZRQA 2HDEA 2KFKA 3APFA 1K52A 3ZRFA 1OQQA 4F1SA 4K3CA 1WX7A 2DX5B 5D6JB 3R7QA 1UGJA 1LQBA 4IDIA 3NZ3A 1KJTA 2J52A 3AMZA 2KVRA 2R61A 1K51A 3MC0B 2LGIA 3T8MA 3M62B 1E7VA 1FD6A 1IGCA 1WJ4A 2FAZA 1XT9B 1V1OA 4LLGM 4AJYB 1SE4A 2WDRB 1MJDA 3MC9A 1NYQA 3PS6A 1ISNA 2ZJDA 4HROA 4XWTA 1CK1A 3VH3B 1VZ7A 1WZ3A 1QOFA 1WX9A 2J7QB 1HA5A 4XDDA 5HFYA 3PZ8A 2W82A 3N30A 5LXHA 1YX6B 3IAM1 3H7SA 3AE8B 4R3DA 2JY6A 1FRDA 5T8IA 2HTHA 4EZLA 1P3QU 3ZYYX 4ANXA 3RULA 2KLCA 3Q3MC 3L16A 4EE2A 2XN9C 1STEA 1KLVA 1LM8B 3WA0A 2JWUA 4K7WA 4EFOA 2V3PA 2KKCA 2Y5PA 2MSED 1ZP0B 3HIZA 3N32A 3APDA 3KUDB 2CJOA 4ANWA 3P4SB 4RMAA 5EE3A 5EDSA 3AEDB 2LD9A 1GNUA 4FULA 2PE9A 3SU8X 5HG2A 3AEBB 2KN4A 4KVGB 4NNJB 2UWQA 4MEMA 1XLOA 2UU7A 5HI1A 1E5WA 3ZNGC 2EKEC 5DPWA 3AULA 2R2QA 2K9XA 1FRRA 2LXCA 3V6EB 4ARCA 2LHEA 1TIFA 1WGDA 3DOWA 2GRIA 1TBEA 1SEBD 3UI3A 3MJ5A 4IM3A 4WWPA 4N6EB 1B1ZA 2E6XA 3CWIA 4AP4C 2AWTA 5LLIA 4XX5A 1N5XA 4CO7A 4DHZB 3B08A 4FN2A 1Q10A 1V1PB 3BY4B 4MSQB 4A9AA 3PPAA 1WMHA 1D5ZC 1I4RA 4A55A 1PYWD 3M95A 2FE8A 4FHJA 4ZHOA 3C19A 1PQSA 1JRUA 3TEWA 2PJHA 3MHSD 5C3JB 4NQKE 5JXVA 4IG7B 4Q2JA 3VFKA 2LGDA 3PVLA 1WGKA 2D07B 2AYOB 4S0RA 2WWZA 3QHTA 4OHJA 4ACFA 4HLEA 2KANA 2JUOA 2KAJA 3UGBB 2GBNA 5AZGA 1CMXB 2QHOA 1SE3A 4PYUA 4G50A 2N9LA 4HJKA 3RUIB 4DHJD 3FILA 5BMIA 3NHEB 5L83A 2OJWA 3R2TA 3JSVA 2CR5A 3A9JA 4WWMA 3GZNI 2D3GA 5FR3A 3SR6A 1F0ZA 1D5XC 3FC4A 1EWYC 3JW0X 1R4NI 2IYDB 2WLBA 5IAAC 4L1BA 5G2NA 5E6OA 3WAMA 3IXSA 3TL5A 4TQ0A 2MWSB 3Q69A 2LASA 4KGSA 3PRZA 3V62A 1ZGUB 3KWLA 2IO3B 3QX1A 1J19A 4W9DA 2K8BA 2BBCA 3MC8A 4GU2A 3RNFC 1SJED 3Q3JA 4EUTA 1NVID 4BZAA 1R4NB 4XGAB 1E8WA 4IM0A 1YOVB 2Y5BB 3ZNHB 1CJEA 3GZNB 1OQRA 4HJGE 1R4MI 3A4RA 2YEPB 2N9KA 4B9KA 4ZHPA 2AQ1B 3AE1B 2IGHA 2DAJA 3L13A 1N63A 2KFKB 2WXGA 4GIVA 1YX5B 1AYFA 4MJSB 3UINB 3Q3NC 1HTOA 2KX3A 1JWAD 1XO3A 3GE3C 2HE7A 1V5OA 1FNVA 3W1SA 4KV2A 2I2YA 1EU3A 3LYYA 4RM9A 2V9HA 2NBUA 1HZ5A 1QQRA 1WSPA 5J2RA 2QEJC 2ONQA 2L05A 2C7MB 3Q8BA 5FK9C 5HKHA 4M00A 1SIFA 1FNUA 1AWDA 2X38A 3DVNV 2GI9A 2WX0A 4F7ZA 2LJIA 4IC7B 5TR5A 3AV8A 3MFGA 3A33B 3NVVA 3V60A 2J0MA 3QAQA 1KLGD 4E71A 2REXA 4KIKA 4JL9A 1NI2A 4HKQA 3MP9A 1QILA 2G4DB 2N7EA 5BYSA 4UDUC 2UYZB 2D2QA 3BK2A 3UQBA 4TKNA 5GXGB 2IGDA 3LB8C 4B0EA 4C7YA 1WFYA 5FKAC 2MQJA 1P7EA 3RNBC 1ZUD2 2XK5A 3DBRB 3ENEA 3PHWB 2DLBA 4GMVA 3WANA 4TUUA 4BKTA 3UF8A 1P98A 1KLUD 2WXMA 4YWGG 2VZKD 1ZPSA 3WIMA 2Z8LA 1WJ6A 4YXDB 2OJRA 3APCA 1WF9A 2PIAA 1XLPA 3HK0A 2W55A 3ZTCA 1GOZA 3PLVA 2LWPA 1FXTB 4LTUA 3AE6B 3QQ8B 3ZXVA 3ML8A 1MHXA 1TZOA 2QMTA 1UD7A 1YNTE 4WIPA 1PUTA 1VD2A
chains in the Genus database with same CATH topology
4HDOA 1M94A 2ZVOA 4W9HA 1QZEA 1TGZB 4FJYA 4NQLB 3ALBA 3K9OB 2N9EB 2AL3A 2CHZA 3TCAA 2W9NA 2BWES 5LXIB 1L2NA 2WDTB 2BYVE 2L0FA 2KXJA 2O2VA 1A5RA 2DZMA 2K39A 2KFKA 3APFA 2KMCA 1WE6A 3ZRFA 2KLGA 3O65B 1U4AA 4XC2A 3VXWA 4F1SA 1WRDB 2L00B 4CYEA 3RZFA 2C7HA 1UBQA 5CHFA 3K9PB 2BGFA 2AEHA 2KTFA 3CMMB 4HXDA 1WX7A 2DX5B 2V4LA 1XQQA 2N4FA 5D6JB 2DYOA 4BBNF 1YD8U 1E8YA 2KWUB 3R7QA 2ZVNA 1LQBA 2O6VB 5D7GA 1KM7A 2K25A 3I3TB 1KJTA 4IWQA 3JYUA 4NY0A 4BBNC 2NCNA 2PEAA 1Q1OA 3A9JB 1V6EA 2KQ7A 2KVRA 4J6IA 2LJ5A 2ZZPB 4IWPA 1H8CA 4AUQC 2RD0A 4FJZA 3L10B 2RPQA 1ZW7A 2VRRB 3T8MA 4ZRKA 3NY5A 3M62B 1E7VA 1WGHA 3DDCB 4BOZB 2IY1B 3H9DA 5L95C 4LJPB 2ZPNA 1WJ4A 2FAZA 1XT9B 2DHZA 4XZ4A 1EF5A 1UGMA 2K1FA 4HK2A 2JVCA 4HWIB 4AJYB 2JT4B 2G3QB 3DVGY 4MGKE 1XD3B 4W9CA 5JZEB 1WXMA 5JHBA 1Q0WB 3EC8A 2V3SA 2LI5A 3PS6A 4MH0E 1ISNA 4DWFA 2ZJDA 2NS5A 2DENB 5E6NA 1IP9A 3KW5B 3CSFA 3L17A 3QIJA 1EF1A 4GDKA 1YJ1A 2JRHA 2JZZA 2D10A 1UZXB 3VH3B 2MLBA 1WI0A 3A1QA 2MP2A 2XEWA 5DPRA 4PS3A 3U30A 1WZ3A 4HVBA 1WX9A 2J7QB 2GMIC 4K7UA 4NAWB 2KJRA 4II2B 4AJWA 4MGYE 3ZVVA 1OTRB 1WH3A 4FADA 5AEKB 3N30A 1UELA 2LRUA 5LXHA 2L8JA 4BVUC 1YX6B 2CU1A 3H7SA 4DDGD 3TJPA 2O6VD 2NVUI 2ZCBA 2JY6A 4FJVB 3QK0A 1L7YA 3QWZB 4HCNB 3ZTDA 2BYFA 2HTHA 3Q3FA 3VHTC 5IA7A 4EZLA 1IYFA 1P3QU 2XK5B 4ANXA 3GOEA 3R7RA 3RULA 3VTVA 2KLCA 1F9JA 3L16A 4NJ6A 3U8ZA 4MGIE 1P0RA 2GBJA 2KJHB 2M8SA 3H7PB 2N9XA 3HHMA 3B0AA 3L08A 2LVQA 1V86A 1LM8B 4KZCA 3T9LA 1I42A 3PLUA 3WA0A 1KLVA 3IVFA 5JH5C 1NBFC 4B6WA 4K7WA 4EFOA 2KWCA 2KKCA 4PS7A 3ZLZA 2MBHA 3KYCD 2MSED 3OLMD 2MA9B 2MBEA 4E3CA 3EECA 3A4SC 2O6VA 4HCPB 3HIZA 4GDKB 3N32A 2GBRA 3APDA 2KDEB 5C23A 1E8XA 3KUDB 3RYTA 4ANWA 2NPTA 5CTRC 4ZDVA 2MW5A 4RMAA 2KZRA 2MP2B 3ZRCA 3MJWA 2FCQA 4ANVA 2PPHA 3QJZA 5EDSA 3W1SC 2LXAA 1MG8A 2ZPYA 1S1QB 2PE6B 4WWNA 4K1RB 3VVWB 2LD9A 1GNUA 1Z2MA 3KH0A 2EMSA 4FULA 1RLFA 2PE9A 4W9FA 2ZNVB 3SU8X 3KUZA 2BWFA 3AU5A 2N9PC 2Z0EB 4P7IA 3B1LX 2FCNA 5E6PA 3PV1A 4KVGB 3TIXA 4HPLB 4GB9A 4G0NB 3H1UA 4KDIC 3HM3A 4NNJB 2UWQA 3RZWC 2KDFB 4GSWA 3VQIA 2BPSA 4MEMA 2LGYA 2KTRB 4LDTD 5KHOA 2CKHB 1I35A 1V2YA 1WXSA 2MBOA 2N1WA 5CX3A 2WX1A 1E5WA 3ZNGC 4G3XB 5C1ZA 4NJ7A 2EKEC 3ZO5B 2XBBC 5DPWA 2N1VA 3VUWA 3AU4A 3X23A 3AULA 2V1YA 1HE8A 2R2QA 3W1YA 2B3AA 2JPHA 2BYEA 3L0WB 2LXCA 1TZ1A 2LZ6A 3V6EB 3DBRI 4GDLB 1LXDA 2L3ZA 3SDLC 2KC2A 2FIDA 3H6NA 2KFJA 1WGDA 3DOWA 2DYBA 1TBEA 3NS8A 4TQ1A 1WE7A 2N7DA 5D94A 4CHKA 4ICUA 4FHKA 4URKA 4DHZE 2KK8A 2C7NB 3DVGX 1E90A 1Z5SB 2C9WB 4A20A 4IM3A 4PS8A 5KHQA 4MSMB 1WXVA 4WWPA 2JZ3B 1WZ0A 3L54A 4FBJB 5AZFA 2A5UA 1GC6A 4E74A 4EOYA 1NDDA 2D11A 3X0WA 2M0XA 3IFWB 4AP4C 2AWTA 5LLIA 4XX5A 4CO7A 4DHZB 3ZNID 3B08A 1LFDA 4FN2A 1OEYA 4IM2A 3UIPB 4W9GA 1UBIA 4LJOB 1S3SG 3BY4B 4MSQB 3DBLI 3PPAA 3PTFC 1WMHA 4ICVA 3M95A 4FHJA 5FR6A 3UIOB 3VH4B 1V5TA 4M8MA 1PQSA 1JRUA 2PJHA 3KUCB 3MHSD 1YQBA 4NQKE 2RGFA 3PSEB 4IG7B 4MDKE 3VFKA 2LGDA 2DZJA 3PVLA 2C60A 1P1AA 1RAXA 2A4ZA 3QC8B 2D07B 4HPMB 3PGEA 1X1MA 3DPDA 5J18A 1IPGA 1WGRA 3P2BA 2AYOB 4DXAB 2KWVB 2WWZA 2HD5B 3QHTA 2MBQA 1WJNA 4ASWC 3MTNB 3ML9A 3QARA 4HLEA 2KANA 2G45B 2JUOA 1J8CA 3UGBB 2GBNA 4IUMB 3UQAA 2KX0A 5AZGA 1CMXB 4ZRIA 4DHJB 1EO6A 2QHOA 2MCNB 1WMHB 3D32A 4OVVA 4BKSA 4PYUA 4ANUA 4G50A 4WJPA 3KYDD 4HJKA 3RUIB 3VTUA 2FUHB 2NBWB 1WYWB 3DCGA 4DHJD 4I6LB 4GOCA 4M0WB 2K6QA 3DBHI 1K8RB 2JRIB 5G55A 2JF5A 3AXCA 4X57B 3V6CB 2I1JA 3OAWA 3NHEB 1C1YB 4KSLC 1UH6A 5D2MB 1AARA 3EHVA 4DDID 5L83A 4PYZA 3A9KB 2KC1A 4W9LA 2IY0B 4JLCA 3JSVA 3JVZX 3WAPA 3BINA 2CR5A 4FA6A 3A9JA 2BF8B 3NZUA 3GZNI 2D3GA 3AI5A 2C5LC 2DZIA 4BKGA 4GDLA 3JW0X 1R4NI 2IYDB 3R3MA 2M17A 5IAAC 3SHQA 5G2NA 5E6OA 3JSVB 3WAMA 4MJSA 3ZDTA 2FIFA 3TL5A 3U7DA 2MWSB 2DZKA 3VDZA 4TQ0A 1SGHA 4ZRJA 3TMPB 3RCZA 3VTWA 3ZNZB 2CS4A 2LASA 3PRZA 3V62A 3ZDMC 1ZGUB 1OQYA 1WR6E 4IWOA 2R2OA 3WAOA 1TTNA 2KD0A 3H7PA 4F8CB 2IO3B 4GXBA 3QX1A 4MELA 1J19A 2FNJB 5DPSA 1Q5WB 3PREA 2WYQA 4W9DA 2CHXA 2K8BA 1WM3A 1RRBA 4GU2A 4WJNA 2IBIB 1J0GA 3Q3JA 1Y8RC 2IO0B 2K8CA 4EUTA 1WR1A 2RSUA 4MGZE 5CHVC 4EKUA 3LJ3A 2KN5A 1E8WA 1V81A 4IM0A 2Y5BB 3ZNHB 3DQVA 5CHWA 3ZKJC 3ECIA 3IHPC 4BKSD 1R4MI 1OGWA 2NPTB 3WALA 3A4RA 3CSTA 4I6PA 4OVUA 4AWJA 4B9KA 3IG3A 4MM3A 1GC7A 2KO3A 1BT0A 2DAJA 3L13A 4NPNA 4WQOB 4K81A 2KFKB 4KDLB 4ZYNA 2I1KA 4GIVA 4BOSC 1YX5B 3PRMB 1T0YA 4MJSB 4GN1A 3UINB 1WGYA 2KX3A 2J0JA 2LRWA 4M8NA 2M1MA 4W9JA 1V9JA 2HE7A 1ZKHA 1V5OA 3HM6X 1WX8A 3W1SA 4KV2A 3PZDA 4HDQA 4JQWC 1WM2A 4W9EA 4RM9A 3S2AA 3A9KA 2NBUA 1WXAA 1WIAA 1RFAA 4RM8A 3ONSA 2KTRA 2KDBA 3PT2B 2L7RA 2LGXA 5J2RA 2HJ8A 4G11A 3M3JA 2L05A 2C7MB 2M4NA 2DAFA 5DCNA 3KVFB 4DK5A 1KOTA 4WJQA 4WJOA 5HKHA 1E7UA 2LUEA 2IZVB 4IW0A 2GBKA 1SIFA 2L0TA 2MBBB 2YVCA 3LDZE 4DBGA 3OJ3A 2K8HA 3QA8A 3DVNV 3IBEA 4TV3A 4JIOU 1V80A 4N9F4 4KIKB 2LVPA 1P9DU 4NAWA 2ZCCA 4W9KA 2FCMA 2KJ6A 2NR2A 2WX0A 3R66C 4FLHA 2JXXA 2K6DB 3DBSA 4F7ZA 5TR5A 2KDIA 4IC7B 3VUXA 3C0RB 5JHAA 4GGQA 3A33B 4WAAA 3ZIMA 3V60A 2J0MA 3QAQA 4B95A 5J17A 4E71A 2REXA 4KIKA 4JL9A 1NI2A 2RR9A 1GG3A 2J0KA 1OEYJ 4A3PA 2G4DB 4W9IA 2N7EA 2FCSA 2CHWA 2ASQA 1EUVB 2BKRB 2NBVB 2KOXA 2ZEQA 3CF6E 2UYZB 2IO1B 3V61A 2Z59B 2D2QA 2AL6A 1G6JA 5BO4B 1C3TA 2Z0DB 3UQBA 1V49A 2ZNVC 1VCBA 4JGHB 4TKNA 2DYMA 2OOBB 1SE9A 3NOBA 5GMVA 1E8ZA 1WFYA 4EZJA 1GJZA 2MQJA 1GUAB 2KQSA 3QCAA 3M63B 3VAWA 2XK5A 3ENEA 4K7SA 3PHWB 3VUYA 4KZ0A 4GMVA 2KNBA 4AOFA 4EEWA 1WJUA 3WANA 2L76A 4TUUA 3NZSA 1YIWA 3ZUNA 2LVOA 4BKTA 2MX2A 2EMTA 1P98A 5DPTA 3UF8A 4BFRA 1WY8A 2JWZA 3A1QB 3SD5A 3WIMA 3ZW3A 1H4RA 2GOWA 1WJ6A 4EZKA 2KHWB 3PRPB 3RD2A 3TBLD 3DVNU 2OJRA 3APCA 1WF9A 1D3ZA 2GBMA 3HK0A 2BKFA 3PHXB 2YLMA 3EFUA 2IO2B 3ZTCA 3OJ4B 4I6NB 1WGGA 3PLVA 2LWPA 4YL8A 4LDTB 2KMAA 4WWOA 4KSKC 1FXTB 2O2VB 3QQ8B 4LCDE 3ML8A 3RT3B 5AZHA 2G4SA 4II3B 4A3OA 1UD7A 2MRPA 3N3KB 1VD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDO A;  1M94 A;  2ZVO A;  4W9H A;  1QZE A;  1TGZ B;  4FJY A;  4NQL B;  3ALB A;  3K9O B;  2N9E B;  2AL3 A;  2CHZ A;  3TCA A;  2W9N A;  2BWE S;  5LXI B;  1L2N A;  2WDT B;  2BYV E;  2L0F A;  2KXJ A;  2O2V A;  1A5R A;  2DZM A;  2K39 A;  2KFK A;  3APF A;  2KMC A;  1WE6 A;  3ZRF A;  2KLG A;  3O65 B;  1U4A A;  4XC2 A;  3VXW A;  4F1S A;  1WRD B;  2L00 B;  4CYE A;  3RZF A;  2C7H A;  1UBQ A;  5CHF A;  3K9P B;  2BGF A;  2AEH A;  2KTF A;  3CMM B;  4HXD A;  1WX7 A;  2DX5 B;  2V4L A;  1XQQ A;  2N4F A;  5D6J B;  2DYO A;  4BBN F;  1YD8 U;  1E8Y A;  2KWU B;  3R7Q A;  2ZVN A;  1LQB A;  2O6V B;  5D7G A;  1KM7 A;  2K25 A;  3I3T B;  1KJT A;  4IWQ A;  3JYU A;  4NY0 A;  4BBN C;  2NCN A;  2PEA A;  1Q1O A;  3A9J B;  1V6E A;  2KQ7 A;  2KVR A;  4J6I A;  2LJ5 A;  2ZZP B;  4IWP A;  1H8C A;  4AUQ C;  2RD0 A;  4FJZ A;  3L10 B;  2RPQ A;  1ZW7 A;  2VRR B;  3T8M A;  4ZRK A;  3NY5 A;  3M62 B;  1E7V A;  1WGH A;  3DDC B;  4BOZ B;  2IY1 B;  3H9D A;  5L95 C;  4LJP B;  2ZPN A;  1WJ4 A;  2FAZ A;  1XT9 B;  2DHZ A;  4XZ4 A;  1EF5 A;  1UGM A;  2K1F A;  4HK2 A;  2JVC A;  4HWI B;  4AJY B;  2JT4 B;  2G3Q B;  3DVG Y;  4MGK E;  1XD3 B;  4W9C A;  5JZE B;  1WXM A;  5JHB A;  1Q0W B;  3EC8 A;  2V3S A;  2LI5 A;  3PS6 A;  4MH0 E;  1ISN A;  4DWF A;  2ZJD A;  2NS5 A;  2DEN B;  5E6N A;  1IP9 A;  3KW5 B;  3CSF A;  3L17 A;  3QIJ A;  1EF1 A;  4GDK A;  1YJ1 A;  2JRH A;  2JZZ A;  2D10 A;  1UZX B;  3VH3 B;  2MLB A;  1WI0 A;  3A1Q A;  2MP2 A;  2XEW A;  5DPR A;  4PS3 A;  3U30 A;  1WZ3 A;  4HVB A;  1WX9 A;  2J7Q B;  2GMI C;  4K7U A;  4NAW B;  2KJR A;  4II2 B;  4AJW A;  4MGY E;  3ZVV A;  1OTR B;  1WH3 A;  4FAD A;  5AEK B;  3N30 A;  1UEL A;  2LRU A;  5LXH A;  2L8J A;  4BVU C;  1YX6 B;  2CU1 A;  3H7S A;  4DDG D;  3TJP A;  2O6V D;  2NVU I;  2ZCB A;  2JY6 A;  4FJV B;  3QK0 A;  1L7Y A;  3QWZ B;  4HCN B;  3ZTD A;  2BYF A;  2HTH A;  3Q3F A;  3VHT C;  5IA7 A;  4EZL A;  1IYF A;  1P3Q U;  2XK5 B;  4ANX A;  3GOE A;  3R7R A;  3RUL A;  3VTV A;  2KLC A;  1F9J A;  3L16 A;  4NJ6 A;  3U8Z A;  4MGI E;  1P0R A;  2GBJ A;  2KJH B;  2M8S A;  3H7P B;  2N9X A;  3HHM A;  3B0A A;  3L08 A;  2LVQ A;  1V86 A;  1LM8 B;  4KZC A;  3T9L A;  1I42 A;  3PLU A;  3WA0 A;  1KLV A;  3IVF A;  5JH5 C;  1NBF C;  4B6W A;  4K7W A;  4EFO A;  2KWC A;  2KKC A;  4PS7 A;  3ZLZ A;  2MBH A;  3KYC D;  2MSE D;  3OLM D;  2MA9 B;  2MBE A;  4E3C A;  3EEC A;  3A4S C;  2O6V A;  4HCP B;  3HIZ A;  4GDK B;  3N32 A;  2GBR A;  3APD A;  2KDE B;  5C23 A;  1E8X A;  3KUD B;  3RYT A;  4ANW A;  2NPT A;  5CTR C;  4ZDV A;  2MW5 A;  4RMA A;  2KZR A;  2MP2 B;  3ZRC A;  3MJW A;  2FCQ A;  4ANV A;  2PPH A;  3QJZ A;  5EDS A;  3W1S C;  2LXA A;  1MG8 A;  2ZPY A;  1S1Q B;  2PE6 B;  4WWN A;  4K1R B;  3VVW B;  2LD9 A;  1GNU A;  1Z2M A;  3KH0 A;  2EMS A;  4FUL A;  1RLF A;  2PE9 A;  4W9F A;  2ZNV B;  3SU8 X;  3KUZ A;  2BWF A;  3AU5 A;  2N9P C;  2Z0E B;  4P7I A;  3B1L X;  2FCN A;  5E6P A;  3PV1 A;  4KVG B;  3TIX A;  4HPL B;  4GB9 A;  4G0N B;  3H1U A;  4KDI C;  3HM3 A;  4NNJ B;  2UWQ A;  3RZW C;  2KDF B;  4GSW A;  3VQI A;  2BPS A;  4MEM A;  2LGY A;  2KTR B;  4LDT D;  5KHO A;  2CKH B;  1I35 A;  1V2Y A;  1WXS A;  2MBO A;  2N1W A;  5CX3 A;  2WX1 A;  1E5W A;  3ZNG C;  4G3X B;  5C1Z A;  4NJ7 A;  2EKE C;  3ZO5 B;  2XBB C;  5DPW A;  2N1V A;  3VUW A;  3AU4 A;  3X23 A;  3AUL A;  2V1Y A;  1HE8 A;  2R2Q A;  3W1Y A;  2B3A A;  2JPH A;  2BYE A;  3L0W B;  2LXC A;  1TZ1 A;  2LZ6 A;  3V6E B;  3DBR I;  4GDL B;  1LXD A;  2L3Z A;  3SDL C;  2KC2 A;  2FID A;  3H6N A;  2KFJ A;  1WGD A;  3DOW A;  2DYB A;  1TBE A;  3NS8 A;  4TQ1 A;  1WE7 A;  2N7D A;  5D94 A;  4CHK A;  4ICU A;  4FHK A;  4URK A;  4DHZ E;  2KK8 A;  2C7N B;  3DVG X;  1E90 A;  1Z5S B;  2C9W B;  4A20 A;  4IM3 A;  4PS8 A;  5KHQ A;  4MSM B;  1WXV A;  4WWP A;  2JZ3 B;  1WZ0 A;  3L54 A;  4FBJ B;  5AZF A;  2A5U A;  1GC6 A;  4E74 A;  4EOY A;  1NDD A;  2D11 A;  3X0W A;  2M0X A;  3IFW B;  4AP4 C;  2AWT A;  5LLI A;  4XX5 A;  4CO7 A;  4DHZ B;  3ZNI D;  3B08 A;  1LFD A;  4FN2 A;  1OEY A;  4IM2 A;  3UIP B;  4W9G A;  1UBI A;  4LJO B;  1S3S G;  3BY4 B;  4MSQ B;  3DBL I;  3PPA A;  3PTF C;  1WMH A;  4ICV A;  3M95 A;  4FHJ A;  5FR6 A;  3UIO B;  3VH4 B;  1V5T A;  4M8M A;  1PQS A;  1JRU A;  2PJH A;  3KUC B;  3MHS D;  1YQB A;  4NQK E;  2RGF A;  3PSE B;  4IG7 B;  4MDK E;  3VFK A;  2LGD A;  2DZJ A;  3PVL A;  2C60 A;  1P1A A;  1RAX A;  2A4Z A;  3QC8 B;  2D07 B;  4HPM B;  3PGE A;  1X1M A;  3DPD A;  5J18 A;  1IPG A;  1WGR A;  3P2B A;  2AYO B;  4DXA B;  2KWV B;  2WWZ A;  2HD5 B;  3QHT A;  2MBQ A;  1WJN A;  4ASW C;  3MTN B;  3ML9 A;  3QAR A;  4HLE A;  2KAN A;  2G45 B;  2JUO A;  1J8C A;  3UGB B;  2GBN A;  4IUM B;  3UQA A;  2KX0 A;  5AZG A;  1CMX B;  4ZRI A;  4DHJ B;  1EO6 A;  2QHO A;  2MCN B;  1WMH B;  3D32 A;  4OVV A;  4BKS A;  4PYU A;  4ANU A;  4G50 A;  4WJP A;  3KYD D;  4HJK A;  3RUI B;  3VTU A;  2FUH B;  2NBW B;  1WYW B;  3DCG A;  4DHJ D;  4I6L B;  4GOC A;  4M0W B;  2K6Q A;  3DBH I;  1K8R B;  2JRI B;  5G55 A;  2JF5 A;  3AXC A;  4X57 B;  3V6C B;  2I1J A;  3OAW A;  3NHE B;  1C1Y B;  4KSL C;  1UH6 A;  5D2M B;  1AAR A;  3EHV A;  4DDI D;  5L83 A;  4PYZ A;  3A9K B;  2KC1 A;  4W9L A;  2IY0 B;  4JLC A;  3JSV A;  3JVZ X;  3WAP A;  3BIN A;  2CR5 A;  4FA6 A;  3A9J A;  2BF8 B;  3NZU A;  3GZN I;  2D3G A;  3AI5 A;  2C5L C;  2DZI A;  4BKG A;  4GDL A;  3JW0 X;  1R4N I;  2IYD B;  3R3M A;  2M17 A;  5IAA C;  3SHQ A;  5G2N A;  5E6O A;  3JSV B;  3WAM A;  4MJS A;  3ZDT A;  2FIF A;  3TL5 A;  3U7D A;  2MWS B;  2DZK A;  3VDZ A;  4TQ0 A;  1SGH A;  4ZRJ A;  3TMP B;  3RCZ A;  3VTW A;  3ZNZ B;  2CS4 A;  2LAS A;  3PRZ A;  3V62 A;  3ZDM C;  1ZGU B;  1OQY A;  1WR6 E;  4IWO A;  2R2O A;  3WAO A;  1TTN A;  2KD0 A;  3H7P A;  4F8C B;  2IO3 B;  4GXB A;  3QX1 A;  4MEL A;  1J19 A;  2FNJ B;  5DPS A;  1Q5W B;  3PRE A;  2WYQ A;  4W9D A;  2CHX A;  2K8B A;  1WM3 A;  1RRB A;  4GU2 A;  4WJN A;  2IBI B;  1J0G A;  3Q3J A;  1Y8R C;  2IO0 B;  2K8C A;  4EUT A;  1WR1 A;  2RSU A;  4MGZ E;  5CHV C;  4EKU A;  3LJ3 A;  2KN5 A;  1E8W A;  1V81 A;  4IM0 A;  2Y5B B;  3ZNH B;  3DQV A;  5CHW A;  3ZKJ C;  3ECI A;  3IHP C;  4BKS D;  1R4M I;  1OGW A;  2NPT B;  3WAL A;  3A4R A;  3CST A;  4I6P A;  4OVU A;  4AWJ A;  4B9K A;  3IG3 A;  4MM3 A;  1GC7 A;  2KO3 A;  1BT0 A;  2DAJ A;  3L13 A;  4NPN A;  4WQO B;  4K81 A;  2KFK B;  4KDL B;  4ZYN A;  2I1K A;  4GIV A;  4BOS C;  1YX5 B;  3PRM B;  1T0Y A;  4MJS B;  4GN1 A;  3UIN B;  1WGY A;  2KX3 A;  2J0J A;  2LRW A;  4M8N A;  2M1M A;  4W9J A;  1V9J A;  2HE7 A;  1ZKH A;  1V5O A;  3HM6 X;  1WX8 A;  3W1S A;  4KV2 A;  3PZD A;  4HDQ A;  4JQW C;  1WM2 A;  4W9E A;  4RM9 A;  3S2A A;  3A9K A;  2NBU A;  1WXA A;  1WIA A;  1RFA A;  4RM8 A;  3ONS A;  2KTR A;  2KDB A;  3PT2 B;  2L7R A;  2LGX A;  5J2R A;  2HJ8 A;  4G11 A;  3M3J A;  2L05 A;  2C7M B;  2M4N A;  2DAF A;  5DCN A;  3KVF B;  4DK5 A;  1KOT A;  4WJQ A;  4WJO A;  5HKH A;  1E7U A;  2LUE A;  2IZV B;  4IW0 A;  2GBK A;  1SIF A;  2L0T A;  2MBB B;  2YVC A;  3LDZ E;  4DBG A;  3OJ3 A;  2K8H A;  3QA8 A;  3DVN V;  3IBE A;  4TV3 A;  4JIO U;  1V80 A;  4N9F 4;  4KIK B;  2LVP A;  1P9D U;  4NAW A;  2ZCC A;  4W9K A;  2FCM A;  2KJ6 A;  2NR2 A;  2WX0 A;  3R66 C;  4FLH A;  2JXX A;  2K6D B;  3DBS A;  4F7Z A;  5TR5 A;  2KDI A;  4IC7 B;  3VUX A;  3C0R B;  5JHA A;  4GGQ A;  3A33 B;  4WAA A;  3ZIM A;  3V60 A;  2J0M A;  3QAQ A;  4B95 A;  5J17 A;  4E71 A;  2REX A;  4KIK A;  4JL9 A;  1NI2 A;  2RR9 A;  1GG3 A;  2J0K A;  1OEY J;  4A3P A;  2G4D B;  4W9I A;  2N7E A;  2FCS A;  2CHW A;  2ASQ A;  1EUV B;  2BKR B;  2NBV B;  2KOX A;  2ZEQ A;  3CF6 E;  2UYZ B;  2IO1 B;  3V61 A;  2Z59 B;  2D2Q A;  2AL6 A;  1G6J A;  5BO4 B;  1C3T A;  2Z0D B;  3UQB A;  1V49 A;  2ZNV C;  1VCB A;  4JGH B;  4TKN A;  2DYM A;  2OOB B;  1SE9 A;  3NOB A;  5GMV A;  1E8Z A;  1WFY A;  4EZJ A;  1GJZ A;  2MQJ A;  1GUA B;  2KQS A;  3QCA A;  3M63 B;  3VAW A;  2XK5 A;  3ENE A;  4K7S A;  3PHW B;  3VUY A;  4KZ0 A;  4GMV A;  2KNB A;  4AOF A;  4EEW A;  1WJU A;  3WAN A;  2L76 A;  4TUU A;  3NZS A;  1YIW A;  3ZUN A;  2LVO A;  4BKT A;  2MX2 A;  2EMT A;  1P98 A;  5DPT A;  3UF8 A;  4BFR A;  1WY8 A;  2JWZ A;  3A1Q B;  3SD5 A;  3WIM A;  3ZW3 A;  1H4R A;  2GOW A;  1WJ6 A;  4EZK A;  2KHW B;  3PRP B;  3RD2 A;  3TBL D;  3DVN U;  2OJR A;  3APC A;  1WF9 A;  1D3Z A;  2GBM A;  3HK0 A;  2BKF A;  3PHX B;  2YLM A;  3EFU A;  2IO2 B;  3ZTC A;  3OJ4 B;  4I6N B;  1WGG A;  3PLV A;  2LWP A;  4YL8 A;  4LDT B;  2KMA A;  4WWO A;  4KSK C;  1FXT B;  2O2V B;  3QQ8 B;  4LCD E;  3ML8 A;  3RT3 B;  5AZH A;  2G4S A;  4II3 B;  4A3O A;  1UD7 A;  2MRP A;  3N3K B;  1VD2 A; 
#chains in the Genus database with same CATH topology
 2ZVO A;  2WXJ A;  1C76 A;  2AL3 A;  2CHZ A;  2JYT A;  3TCA A;  2J42 A;  2BWE S;  2AQ2 B;  2O2V A;  4A8X C;  2DZM A;  2K39 A;  1VR9 A;  2D5G A;  2KLG A;  1U4A A;  4XC2 A;  3EUB 2;  1WRD B;  2QC8 A;  3OG5 A;  2PVO D;  3RZF A;  2KTF A;  1N6Z A;  4YTM B;  3BVZ A;  2DYO A;  1MFW A;  2ZVN A;  2OED A;  4IWQ A;  3JYU A;  4BBN C;  1Q1O A;  2D3C A;  2LJ5 A;  1H8C A;  4AUQ C;  2RD0 A;  2RPQ A;  1ZW7 A;  1E6E B;  3VR9 B;  2JU6 X;  4BOZ B;  3H8H A;  4LJP B;  2ZPN A;  4MGK E;  3DVG Y;  5JZE B;  1WXM A;  1WXQ A;  1Q0W B;  3AE3 B;  2X8X X;  4AQ7 A;  2NS5 A;  2DEN B;  5E6N A;  3KW5 B;  1EF1 A;  4GDK A;  2L52 A;  2L1A A;  1UZX B;  1WI0 A;  3A1Q A;  5DPR A;  3FKY A;  4HVB A;  2GMI C;  1ZXI A;  4MGY E;  5AEK B;  1OTR B;  3W5U B;  3Q6B A;  3B9J A;  3AE9 B;  3ZJV A;  2NVU I;  2ZCB A;  1I4P A;  3QK0 A;  3QWZ B;  4HCN B;  2BYF A;  5IA7 A;  2KMM A;  3VHT C;  2XK5 B;  3Q8E A;  3VTV A;  2QIL A;  1F9J A;  2M8S A;  2KJH B;  2N9X A;  4RGO S;  4XYC A;  4PT5 A;  3L08 A;  1E0Z A;  3O13 A;  1I42 A;  3PLU A;  2DWQ A;  3IVF A;  1NBF C;  3RMK C;  4PS7 A;  2MA9 B;  3A4S C;  1F2R I;  3PO0 A;  2GBR A;  5C23 A;  4NAM A;  5CTR C;  4ZDV A;  2MW5 A;  2KZR A;  3ZRC A;  3MJW A;  2FCQ A;  4ANV A;  2PPH A;  3QJZ A;  3W1S C;  1MG8 A;  3BZD B;  3LXF A;  2I38 A;  5LNK 1;  1RLF A;  4W9F A;  2BT6 A;  2BS2 B;  3CIR B;  2Z0E B;  2FCN A;  4N58 A;  3PV1 A;  1ZOY B;  2KDF B;  2WS3 B;  3VQI A;  3KWV A;  2KTR B;  3AEC B;  1JCK B;  2CKH B;  1YJI A;  2GLS A;  3HVZ A;  1WXS A;  2MBO A;  5AUK A;  5C1Z A;  4G3X B;  1JW9 D;  4NJ7 A;  1L4D B;  3X23 A;  2D3B A;  3W1Y A;  1TYG B;  2JPH A;  3L0W B;  4HPP A;  4S17 A;  2DYB A;  3NS8 A;  2Y5C A;  1XF5 L;  2INP E;  4ICU A;  2RDH A;  2KK8 A;  2ON8 A;  1E90 A;  3NVZ A;  5KHQ A;  2WXL A;  4MSM B;  5AZF A;  5TSS A;  1T0S C;  3IFW B;  4L2Y A;  1FEH A;  1LFD A;  1OEY A;  1T0Q C;  2PW9 A;  3UIP B;  3RPF C;  1UBI A;  1IUE A;  2BW2 A;  1KRH A;  5BMG A;  3VH4 B;  3Q3O C;  2IGG A;  5G5G A;  4CQN A;  3DWG C;  1P1A A;  1KTK A;  3NJT A;  1D4B A;  1RAX A;  2A4Z A;  1X1M A;  3DPD A;  3P2B A;  4JWU C;  1TY0 A;  1C79 A;  3MTN B;  2G45 B;  2KWD A;  2SEB D;  4IUM B;  1TS5 A;  1NEN B;  2KX0 A;  4M02 A;  3T3O A;  2MCN B;  1WMH B;  3D32 A;  4MAC A;  4ANU A;  1F77 A;  2DBY A;  4WJP A;  3VTU A;  1UF0 A;  2J4X A;  4GOC A;  4M0W B;  1SIJ A;  2K6Q A;  1K8R B;  5G55 A;  2JF5 A;  3AXC A;  1RFK A;  4WQM A;  1C1Y B;  3EGR A;  3N1X C;  4PYZ A;  3A9K B;  2KC1 A;  1MPE A;  2JZP A;  3WAP A;  1FMA D;  3FAH A;  4FA6 A;  1R4M B;  2K0P A;  2BF8 B;  3NZU A;  3AI5 A;  4MH8 A;  4BKG A;  2N0S B;  2MHJ A;  1JWU D;  2WP9 B;  2M17 A;  4NJC A;  1MVK A;  2EKI A;  3ZDT A;  1DYQ A;  1SBB B;  3U7D A;  1SGH A;  2BTE A;  3VTW A;  1J7B A;  2CS4 A;  4WUR A;  1DOY A;  2WXN A;  4IWO A;  1QKZ A;  4RH6 A;  4LNI A;  1Q5W B;  1WM3 A;  4WJN A;  1J0G A;  3GS2 A;  1Y8R C;  2IO0 B;  2K8C A;  5CHV C;  4EKU A;  4RNA A;  3I57 A;  1FFU A;  3W2D A;  3DQV A;  3ZKJ C;  2WNM A;  3IHP C;  4BKS D;  4I6P A;  1ZE3 D;  4MM3 A;  4K81 A;  4KDL B;  1TKY A;  1UNS A;  3PRM B;  2TSS A;  2VH1 A;  4W9J A;  1ZKH A;  3HM6 X;  3P4Q B;  1IBX A;  4ZRP A;  2KDB A;  3C8Y A;  2L7R A;  4G11 A;  4C7Z A;  1EU4 A;  4DK5 A;  2BS4 B;  1ACC A;  2LUE A;  2IZV B;  2WXP A;  2WU5 B;  2GBK A;  2YVC A;  3DHI C;  1EM7 A;  3OJ3 A;  2K8H A;  4M0W A;  3QA8 A;  4JIO U;  1XLQ A;  5EE9 A;  2LVP A;  4NAW A;  2FCM A;  2NR2 A;  2JXX A;  3DBS A;  3VUX A;  4GGQ A;  5EE1 A;  3N3K B;  2LHD A;  1B9R A;  3BK1 A;  2E3T A;  3WCQ A;  2MJE A;  4A3P A;  4DWF A;  2ASQ A;  1BML C;  1EUV B;  3V61 A;  2IO1 B;  1G6J A;  2Z59 B;  1C3T A;  2ZNV C;  4JGH B;  1ENF A;  2DYM A;  1SE9 A;  5EE0 A;  3NOB A;  4HKZ E;  4FXC A;  2KQS A;  3M63 B;  3VAW A;  2Y3A A;  2K22 A;  4K7S A;  4RF0 A;  1QOG A;  4KZ0 A;  1FXA A;  4K3B A;  2MEK A;  4C00 A;  1WJU A;  1NYR A;  1UWM A;  2Q5W D;  1YIW A;  3ZGZ A;  4B0M A;  1C4P A;  4BFR A;  4KKJ A;  1WY8 A;  2JWZ A;  3ZW3 A;  1H4R A;  2GOW A;  3R2I A;  2RPV A;  1J7A A;  4N59 A;  4LNF A;  1TS2 A;  3IAS 1;  4GLS C;  3OJ4 B;  1WGG A;  4WWO A;  1I4G A;  3B2G A;  1L6V A;  1VDV A;  5AZH A;  3ABV B;  4II3 B;  1VZ8 A;  4A3O A;  2MJ3 A;  2FUG 1;  3NUH B;  4W9H A;  3BVG A;  1QZE A;  4JE3 B;  4NQL B;  2W9N A;  5LXI B;  2WDT B;  2BYV E;  3AM9 A;  2KXJ A;  1A5R A;  2KMC A;  3O65 B;  2L00 B;  4CYE A;  3RNA C;  1UBQ A;  2WHI A;  3CMM B;  4HXD A;  2MH7 A;  4C56 C;  1AW7 A;  4BBN F;  1N62 A;  2NTS A;  1NEK B;  3RNC C;  4JX1 C;  5D7G A;  1KM7 A;  3I3T B;  3I9V 1;  4NY0 A;  2PEA A;  2KQ7 A;  3TEZ A;  4IWP A;  1DOI A;  4LNN A;  4RF1 A;  4FJZ A;  3AE2 B;  5IP4 D;  1L0V B;  3DDC B;  3VRB B;  3H9D A;  5L95 C;  2DHZ A;  1EF5 A;  1UGM A;  4HWI B;  2G3Q B;  1YN3 A;  5D3D A;  1XXG A;  2G9H D;  1IP9 A;  3KQ4 A;  1JWS D;  3CSF A;  2JZZ A;  4OZB A;  2XEW A;  3U30 A;  2V3N A;  4K7U A;  4NAW B;  3ZVV A;  4FAD A;  1UEL A;  1T0R C;  2L8J A;  4BVU C;  2HJ1 A;  1GPX A;  3Q8A A;  2WXF A;  1F1H A;  4KKI A;  1YN5 A;  2O6V D;  2AQ3 B;  1TS3 A;  1IYF A;  1C4C A;  3Q8F A;  4RGM A;  1T5X D;  3U8Z A;  1P0R A;  2GBJ A;  3B0A A;  1A70 A;  1V86 A;  4KZC A;  1RWS A;  5JH5 C;  2YEP F;  1JWM D;  2KWC A;  4OZC A;  2MBH A;  3KYC D;  3OLM D;  2MBE A;  2QSD A;  1XEE A;  3N1Z C;  2O6V A;  1E8X A;  4IOI E;  2V4I B;  2QIE B;  2KYW A;  2LXA A;  3RNE C;  3RN9 C;  4WWN A;  4L23 A;  1JAL A;  3KLS X;  3KH0 A;  2EMS A;  3KUZ A;  5E6P A;  3TIX A;  4GB9 A;  4KDI C;  3H1U A;  3RZW C;  1LGR A;  2LGY A;  4LDT D;  2WXO A;  4OVZ A;  5KHO A;  1V2Y A;  2WDV B;  3TEY A;  5CX3 A;  3W9C B;  2WX1 A;  3P4P B;  1DGJ A;  3ZO5 B;  3AU4 A;  4HEA 1;  2B3A A;  1TZ1 A;  1FCC C;  2LZ6 A;  3DBR I;  3SDL C;  1E10 A;  3H6N A;  2KFJ A;  2QCZ A;  2N7D A;  5D94 A;  4CHK A;  2BYT A;  1TKG A;  2C7N B;  5IOI A;  2JQR B;  1WXV A;  4OZA A;  2JZ3 B;  1WZ0 A;  1FPY A;  3L54 A;  1T6B X;  2ACZ B;  2D11 A;  2WXK A;  2M0X A;  3DHG C;  3AEA B;  2G1E A;  3ZNI D;  4IM2 A;  1S3S G;  3DBL I;  4ITK A;  3ZXR A;  1JRO A;  4ICV A;  1MG4 A;  2WXH A;  3KUC B;  1RM6 C;  1DOX A;  2RGF A;  4BAX A;  4QAY A;  3PSE B;  4MDK E;  2DZJ A;  1HEZ E;  2H88 B;  1HQR D;  4DXA B;  1FFV A;  2HD5 B;  1WJN A;  3U2S C;  2CJN A;  1L6U A;  3UQA A;  4ZRI A;  4REZ A;  4OVV A;  4BKS A;  3KYD D;  2NBW B;  3DCG A;  1C4A A;  3DBH I;  2PKO A;  2JRI B;  4X57 B;  3VRA B;  3V6C B;  2I1J A;  3OAW A;  3NG0 A;  1AAR A;  4DDI D;  3JVZ X;  3BIN A;  2C5L C;  5H8Y E;  2DZI A;  2WDQ B;  4GDL A;  1T3Q A;  2SAK A;  3AE4 B;  3JSV B;  2V0G A;  3HRD D;  4MJS A;  1GB1 A;  4D2K A;  1PDX A;  2FIF A;  3RI7 C;  3MHZ A;  1XCQ L;  4LNO A;  3SFE B;  3U52 E;  3P1M A;  1N61 A;  3ZDM C;  4P1C C;  1WR6 E;  1K53 A;  4YSZ B;  3WAO A;  4F8C B;  2WQY B;  4H2A A;  1UWX A;  5DPS A;  2L32 A;  3PRE A;  2WYQ A;  2CHX A;  1RRB A;  3J9C A;  4JWS C;  4ZOH C;  2IBI B;  2RSU A;  4MGZ E;  1CQV A;  3LJ3 A;  2KN5 A;  1YQ4 B;  4P6V F;  5CHW A;  1SSN A;  5E6J A;  2NPT B;  2LGS A;  4AWJ A;  1GC7 A;  2KO3 A;  4NPN A;  4WQO B;  4ZYN A;  2BB6 A;  2EEL A;  2QJL A;  3BWU D;  3L4P A;  4MT5 A;  4M8N A;  2M1M A;  1V9J A;  1BXT A;  3NVW A;  2LEK A;  1WM2 A;  1MHH E;  1WIA A;  2H89 B;  2LFI A;  2KTR A;  3PT2 B;  4RGT A;  3ETR A;  3BII D;  2M4N A;  1WYG A;  5DCN A;  4WJO A;  1E7U A;  1N5W A;  2WXQ A;  2L0T A;  2MBB B;  3LDZ E;  3N20 C;  3AE5 B;  1SE2 A;  3GP7 A;  3FIL B;  3IBE A;  4TV3 A;  3U7Z A;  4KIK B;  1JWB D;  4W9K A;  1GB4 A;  1C78 A;  1IBX B;  2JYE A;  2D3A A;  2FBW B;  3C0R B;  3URY A;  4WAA A;  3ZIM A;  4KX6 B;  3DBL B;  1OFF A;  4AS1 A;  5J17 A;  4USA A;  3Q14 C;  4RCO A;  3PZ7 A;  2RR9 A;  1N60 A;  4YTP B;  4W9I A;  3CF6 E;  2NBV B;  2BKR B;  2KOX A;  2AL6 A;  3BYT B;  3N9Y C;  4P1B C;  4DQO C;  1E8Z A;  4EZJ A;  1GUA B;  3QCA A;  3I5J C;  1TS4 A;  2KNB A;  3IT4 B;  2L76 A;  4J3O D;  1I4X A;  2KQ4 X;  3NZS A;  3ZUN A;  2LVO A;  2MX2 A;  2EMT A;  1L0Y B;  3A1Q B;  1YN4 A;  3SD5 A;  3HUI A;  2HTM E;  2KHW B;  1CZP A;  3PRP B;  1D3Z A;  2GBM A;  3PHX B;  2BKF A;  4PK1 A;  3EFU A;  1ET9 A;  2BVC A;  1SB3 C;  4YL8 A;  4LDT B;  4C4V A;  4KSK C;  2O2V B;  4YT0 B;  4LCD E;  2G4S A;  1LO5 D;  2MRP A;  5G5H A;  1M94 A;  4YSX B;  4OW0 A;  3ALB A;  3K9O B;  2N9E B;  1L2N A;  2PMV A;  1FNW A;  2L0F A;  1RYJ A;  1QOA A;  2M0A A;  1WE6 A;  3VXW A;  3AE7 B;  2C7H A;  5CHF A;  2NMQ A;  3K9P B;  2BGF A;  2AEH A;  2V4L A;  3Q8C A;  2IDY A;  1D5M C;  1XQQ A;  2N4F A;  2W54 A;  4KGR A;  1YD8 U;  1E8Y A;  2KWU B;  4RGN A;  2O6V B;  2K25 A;  3E56 A;  1PGA A;  1TT5 B;  2NCN A;  4DXF A;  3A9J B;  1V6E A;  4J6I A;  5C2T B;  4P16 A;  4O1N A;  2ZZP B;  4US9 A;  3L10 B;  2ZW1 A;  2VRR B;  2JX5 A;  3NY5 A;  4ZRK A;  1WGH A;  1KFY B;  2IY1 B;  4ZYS A;  3U4E G;  4XZ4 A;  4HK2 A;  2K1F A;  2JVC A;  2JT4 B;  1XD3 B;  4W9C A;  3E9S A;  1XLN A;  3AEF B;  5JHB A;  3EC8 A;  2V3S A;  2LI5 A;  4A90 A;  4XDC A;  3AEG B;  4MH0 E;  2M56 B;  3L17 A;  3QIJ A;  1YJ1 A;  1QT9 A;  2JRH A;  2D10 A;  3NVY A;  3GE8 C;  2MLB A;  2MP2 A;  2M19 A;  4PS3 A;  3TUO A;  2KJR A;  4II2 B;  4AJW A;  3DHH C;  1WH3 A;  4C80 A;  2LRU A;  2RDB C;  1KF6 B;  1V8C A;  2CU1 A;  4DDG D;  1FO4 A;  3TJP A;  4FJV B;  3ZJU A;  4ARI A;  1L7Y A;  3ZTD A;  3Q3F A;  3V05 A;  4WAF A;  4YTN B;  3GOE A;  3R7R A;  1C9F A;  3DWM A;  4NJ6 A;  1FCL A;  2K3U A;  4MGI E;  3H7P B;  1P7F A;  3EA6 A;  3HHM A;  1YJJ A;  2LVQ A;  1V1P A;  3T9L A;  1VRA B;  3GB1 A;  4B6W A;  1F52 A;  3ZLZ A;  1ZXH A;  2JXT A;  3P42 A;  4E3C A;  3EEC A;  1ESF A;  3V3X A;  4HCP B;  4GDK B;  2KDE B;  3RYT A;  2GB1 A;  2NPT A;  2MP2 B;  1PGB A;  2ZPY A;  1S1Q B;  2PE6 B;  1E9M A;  4K1R B;  3VVW B;  1Z2M A;  3SFD B;  2ZNV B;  2BWF A;  3AU5 A;  1HZ6 A;  2N9P C;  4P7I A;  2KVZ A;  3B1L X;  4HPL B;  4G0N B;  3HM3 A;  4GSW A;  2BPS A;  2WXR A;  3AB5 A;  4LK0 M;  4JPS A;  1I35 A;  2N1W A;  2XBB C;  2N1V A;  3VUW A;  3RFZ B;  2V1Y A;  3I63 C;  1HE8 A;  2BYE A;  4GDL B;  1LXD A;  4RFB A;  2L3Z A;  2KC2 A;  2FID A;  3TSS A;  1IGD A;  5HHD G;  4XE0 A;  1J7C A;  2W3R A;  3NS1 A;  4TQ1 A;  1WE7 A;  3BVM A;  2NTT A;  4FHK A;  3HVD A;  4URK A;  3N1Y C;  4DHZ E;  1WRI A;  3DVG X;  4A20 A;  2C9W B;  1Z5S B;  2DNF A;  4PS8 A;  3W5V B;  4FBJ B;  2A5U A;  1GC6 A;  4E74 A;  4EOY A;  1NDD A;  3X0W A;  1MI0 A;  1EWC A;  4NZL B;  2N7J A;  1YMH E;  4W9G A;  1ET6 A;  4LJO B;  3PTF C;  1M4V A;  1AN8 A;  5I4D A;  2MJD A;  1HTQ A;  4TSS A;  5FR6 A;  3UIO B;  1FIQ A;  1V5T A;  4M8M A;  1YQB A;  3T3N A;  2BS3 B;  2C60 A;  1F2R C;  3QC8 B;  1R7S A;  1QLB B;  4HPM B;  3PGE A;  5J18 A;  1IPG A;  1WGR A;  3AN1 A;  2KWV B;  3AEE B;  2MBQ A;  4ASW C;  1UUP A;  3QAR A;  3ML9 A;  1J8C A;  4MM3 B;  5H92 C;  4YSY B;  2IJ0 A;  4DHJ B;  1EO6 A;  3ZQ4 A;  5IKC M;  1JQ4 A;  4DXG A;  2FUH B;  1WYW B;  4I6L B;  2ICI A;  1XCT L;  1I4Q A;  2PVG C;  4KSL C;  1UH6 A;  2QDF A;  5D2M B;  3EHV A;  2WXI A;  1SXT A;  3R8B A;  4W9L A;  2VZK B;  2IY0 B;  3DBH B;  4JLC A;  1YQ3 B;  3P4R B;  1C77 A;  5MPO A;  3OWE B;  2IND C;  3RNG C;  1L4Z B;  2BB5 A;  4IKG A;  3R3M A;  3SHQ A;  5IN7 A;  1VZ6 A;  1NI3 A;  3VDZ A;  2DZK A;  4ZRJ A;  3TMP B;  3RCZ A;  1E7P B;  3ZNZ B;  1PFD A;  1Y56 A;  5AUI A;  1OQY A;  2R2O A;  1TTN A;  2KD0 A;  3H7P A;  4GXB A;  2PTL A;  4MEL A;  2FNJ B;  2ZW0 A;  1TJE A;  2IPK D;  1WR1 A;  3AH7 A;  1V81 A;  1ROE A;  1BUI C;  3B2F A;  1HXY D;  2KDM A;  1TY2 A;  1QOB A;  3ECI A;  3ZJT A;  1OGW A;  5IO9 A;  4M01 A;  5D3I B;  1L5P A;  2K5P A;  3CST A;  3WAL A;  1K50 A;  4OVU A;  3IG3 A;  1BT0 A;  2WGS A;  2I1K A;  4BOS C;  4A6Q A;  2LMC A;  4US8 A;  1WWT A;  1GAQ B;  1T0Y A;  3Q2A C;  2CU3 A;  4GN1 A;  3IT6 B;  1WGY A;  1D6E C;  2J0J A;  2LRW A;  2KT7 A;  2KAC A;  1WX8 A;  3PZD A;  2AX5 A;  1FM0 D;  4HDQ A;  4JQW C;  4W9E A;  2BQQ A;  3S2A A;  3A9K A;  1WXA A;  1RFA A;  4RM8 A;  3ONS A;  2LGX A;  2HJ8 A;  1I7H A;  3M3J A;  1QF6 A;  1PGX A;  2DAF A;  2RDG A;  3KVF B;  1KOT A;  4WJQ A;  3NRZ A;  1I4H A;  1V97 A;  2J53 A;  4IW0 A;  3BYY B;  4DBG A;  2PLP A;  5BYQ A;  2XNA C;  1V80 A;  4N9F 4;  1P9D U;  2ZCC A;  4TMA B;  1VLB A;  2KJ6 A;  4FLH A;  3R66 C;  2K6D B;  2KDI A;  1ZDX A;  5JHA A;  3EFC A;  5BYR A;  4B95 A;  1JML A;  1JRP A;  1GG3 A;  2J0K A;  1OEY J;  3VR8 B;  2FCS A;  2CHW A;  2ZEQ A;  2LUM A;  2INC C;  1VJK A;  5BO4 B;  2Z0D B;  1V49 A;  1VCB A;  2OOB B;  2JSV X;  1KH0 A;  2WU2 B;  5GMV A;  4C4V B;  1TKE A;  1GJZ A;  1L0X B;  2INN E;  3VUY A;  4WH4 A;  4AOF A;  1FXI A;  4EEW A;  1ZDV A;  5DPT A;  3P63 A;  2RMM A;  3TEX A;  5BMH A;  1SF0 A;  4XWW A;  4EZK A;  3RD2 A;  3TBL D;  3DVN U;  2L83 A;  2VH2 A;  2YLM A;  2IO2 B;  2OHF A;  4I6N B;  4LNK A;  2KMA A;  4HRS A;  2B76 B;  3RT3 B;  3SEB A;  1SJH D;  4HDO A;  4KGT A;  2W3S A;  1TGZ B;  4FJY A;  4ZRQ A;  2HDE A;  2KFK A;  3APF A;  1K52 A;  3ZRF A;  1OQQ A;  4F1S A;  4K3C A;  1WX7 A;  2DX5 B;  5D6J B;  3R7Q A;  1UGJ A;  1LQB A;  4IDI A;  3NZ3 A;  1KJT A;  2J52 A;  3AMZ A;  2KVR A;  2R61 A;  1K51 A;  3MC0 B;  2LGI A;  3T8M A;  3M62 B;  1E7V A;  1FD6 A;  1IGC A;  1WJ4 A;  2FAZ A;  1XT9 B;  1V1O A;  4LLG M;  4AJY B;  1SE4 A;  2WDR B;  1MJD A;  3MC9 A;  1NYQ A;  3PS6 A;  1ISN A;  2ZJD A;  4HRO A;  4XWT A;  1CK1 A;  3VH3 B;  1VZ7 A;  1WZ3 A;  1QOF A;  1WX9 A;  2J7Q B;  1HA5 A;  4XDD A;  5HFY A;  3PZ8 A;  2W82 A;  3N30 A;  5LXH A;  1YX6 B;  3IAM 1;  3H7S A;  3AE8 B;  4R3D A;  2JY6 A;  1FRD A;  5T8I A;  2HTH A;  4EZL A;  1P3Q U;  3ZYY X;  4ANX A;  3RUL A;  2KLC A;  3Q3M C;  3L16 A;  4EE2 A;  2XN9 C;  1STE A;  1KLV A;  1LM8 B;  3WA0 A;  2JWU A;  4K7W A;  4EFO A;  2V3P A;  2KKC A;  2Y5P A;  2MSE D;  1ZP0 B;  3HIZ A;  3N32 A;  3APD A;  3KUD B;  2CJO A;  4ANW A;  3P4S B;  4RMA A;  5EE3 A;  5EDS A;  3AED B;  2LD9 A;  1GNU A;  4FUL A;  2PE9 A;  3SU8 X;  5HG2 A;  3AEB B;  2KN4 A;  4KVG B;  4NNJ B;  2UWQ A;  4MEM A;  1XLO A;  2UU7 A;  5HI1 A;  1E5W A;  3ZNG C;  2EKE C;  5DPW A;  3AUL A;  2R2Q A;  2K9X A;  1FRR A;  2LXC A;  3V6E B;  4ARC A;  2LHE A;  1TIF A;  1WGD A;  3DOW A;  2GRI A;  1TBE A;  1SEB D;  3UI3 A;  3MJ5 A;  4IM3 A;  4WWP A;  4N6E B;  1B1Z A;  2E6X A;  3CWI A;  4AP4 C;  2AWT A;  5LLI A;  4XX5 A;  1N5X A;  4CO7 A;  4DHZ B;  3B08 A;  4FN2 A;  1Q10 A;  1V1P B;  3BY4 B;  4MSQ B;  4A9A A;  3PPA A;  1WMH A;  1D5Z C;  1I4R A;  4A55 A;  1PYW D;  3M95 A;  2FE8 A;  4FHJ A;  4ZHO A;  3C19 A;  1PQS A;  1JRU A;  3TEW A;  2PJH A;  3MHS D;  5C3J B;  4NQK E;  5JXV A;  4IG7 B;  4Q2J A;  3VFK A;  2LGD A;  3PVL A;  1WGK A;  2D07 B;  2AYO B;  4S0R A;  2WWZ A;  3QHT A;  4OHJ A;  4ACF A;  4HLE A;  2KAN A;  2JUO A;  2KAJ A;  3UGB B;  2GBN A;  5AZG A;  1CMX B;  2QHO A;  1SE3 A;  4PYU A;  4G50 A;  2N9L A;  4HJK A;  3RUI B;  4DHJ D;  3FIL A;  5BMI A;  3NHE B;  5L83 A;  2OJW A;  3R2T A;  3JSV A;  2CR5 A;  3A9J A;  4WWM A;  3GZN I;  2D3G A;  5FR3 A;  3SR6 A;  1F0Z A;  1D5X C;  3FC4 A;  1EWY C;  3JW0 X;  1R4N I;  2IYD B;  2WLB A;  5IAA C;  4L1B A;  5G2N A;  5E6O A;  3WAM A;  3IXS A;  3TL5 A;  4TQ0 A;  2MWS B;  3Q69 A;  2LAS A;  4KGS A;  3PRZ A;  3V62 A;  1ZGU B;  3KWL A;  2IO3 B;  3QX1 A;  1J19 A;  4W9D A;  2K8B A;  2BBC A;  3MC8 A;  4GU2 A;  3RNF C;  1SJE D;  3Q3J A;  4EUT A;  1NVI D;  4BZA A;  1R4N B;  4XGA B;  1E8W A;  4IM0 A;  1YOV B;  2Y5B B;  3ZNH B;  1CJE A;  3GZN B;  1OQR A;  4HJG E;  1R4M I;  3A4R A;  2YEP B;  2N9K A;  4B9K A;  4ZHP A;  2AQ1 B;  3AE1 B;  2IGH A;  2DAJ A;  3L13 A;  1N63 A;  2KFK B;  2WXG A;  4GIV A;  1YX5 B;  1AYF A;  4MJS B;  3UIN B;  3Q3N C;  1HTO A;  2KX3 A;  1JWA D;  1XO3 A;  3GE3 C;  2HE7 A;  1V5O A;  1FNV A;  3W1S A;  4KV2 A;  2I2Y A;  1EU3 A;  3LYY A;  4RM9 A;  2V9H A;  2NBU A;  1HZ5 A;  1QQR A;  1WSP A;  5J2R A;  2QEJ C;  2ONQ A;  2L05 A;  2C7M B;  3Q8B A;  5FK9 C;  5HKH A;  4M00 A;  1SIF A;  1FNU A;  1AWD A;  2X38 A;  3DVN V;  2GI9 A;  2WX0 A;  4F7Z A;  2LJI A;  4IC7 B;  5TR5 A;  3AV8 A;  3MFG A;  3A33 B;  3NVV A;  3V60 A;  2J0M A;  3QAQ A;  1KLG D;  4E71 A;  2REX A;  4KIK A;  4JL9 A;  1NI2 A;  4HKQ A;  3MP9 A;  1QIL A;  2G4D B;  2N7E A;  5BYS A;  4UDU C;  2UYZ B;  2D2Q A;  3BK2 A;  3UQB A;  4TKN A;  5GXG B;  2IGD A;  3LB8 C;  4B0E A;  4C7Y A;  1WFY A;  5FKA C;  2MQJ A;  1P7E A;  3RNB C;  1ZUD 2;  2XK5 A;  3DBR B;  3ENE A;  3PHW B;  2DLB A;  4GMV A;  3WAN A;  4TUU A;  4BKT A;  3UF8 A;  1P98 A;  1KLU D;  2WXM A;  4YWG G;  2VZK D;  1ZPS A;  3WIM A;  2Z8L A;  1WJ6 A;  4YXD B;  2OJR A;  3APC A;  1WF9 A;  2PIA A;  1XLP A;  3HK0 A;  2W55 A;  3ZTC A;  1GOZ A;  3PLV A;  2LWP A;  1FXT B;  4LTU A;  3AE6 B;  3QQ8 B;  3ZXV A;  3ML8 A;  1MHX A;  1TZO A;  2QMT A;  1UD7 A;  1YNT E;  4WIP A;  1PUT A;  1VD2 A; 
#chains in the Genus database with same CATH homology
 4HDO A;  1M94 A;  2ZVO A;  4W9H A;  1QZE A;  1TGZ B;  4FJY A;  4NQL B;  3ALB A;  3K9O B;  2N9E B;  2AL3 A;  2CHZ A;  3TCA A;  2W9N A;  2BWE S;  5LXI B;  1L2N A;  2WDT B;  2BYV E;  2L0F A;  2KXJ A;  2O2V A;  1A5R A;  2DZM A;  2K39 A;  2KFK A;  3APF A;  2KMC A;  1WE6 A;  3ZRF A;  2KLG A;  3O65 B;  1U4A A;  4XC2 A;  3VXW A;  4F1S A;  1WRD B;  2L00 B;  4CYE A;  3RZF A;  2C7H A;  1UBQ A;  5CHF A;  3K9P B;  2BGF A;  2AEH A;  2KTF A;  3CMM B;  4HXD A;  1WX7 A;  2DX5 B;  2V4L A;  1XQQ A;  2N4F A;  5D6J B;  2DYO A;  4BBN F;  1YD8 U;  1E8Y A;  2KWU B;  3R7Q A;  2ZVN A;  1LQB A;  2O6V B;  5D7G A;  1KM7 A;  2K25 A;  3I3T B;  1KJT A;  4IWQ A;  3JYU A;  4NY0 A;  4BBN C;  2NCN A;  2PEA A;  1Q1O A;  3A9J B;  1V6E A;  2KQ7 A;  2KVR A;  4J6I A;  2LJ5 A;  2ZZP B;  4IWP A;  1H8C A;  4AUQ C;  2RD0 A;  4FJZ A;  3L10 B;  2RPQ A;  1ZW7 A;  2VRR B;  3T8M A;  4ZRK A;  3NY5 A;  3M62 B;  1E7V A;  1WGH A;  3DDC B;  4BOZ B;  2IY1 B;  3H9D A;  5L95 C;  4LJP B;  2ZPN A;  1WJ4 A;  2FAZ A;  1XT9 B;  2DHZ A;  4XZ4 A;  1EF5 A;  1UGM A;  2K1F A;  4HK2 A;  2JVC A;  4HWI B;  4AJY B;  2JT4 B;  2G3Q B;  3DVG Y;  4MGK E;  1XD3 B;  4W9C A;  5JZE B;  1WXM A;  5JHB A;  1Q0W B;  3EC8 A;  2V3S A;  2LI5 A;  3PS6 A;  4MH0 E;  1ISN A;  4DWF A;  2ZJD A;  2NS5 A;  2DEN B;  5E6N A;  1IP9 A;  3KW5 B;  3CSF A;  3L17 A;  3QIJ A;  1EF1 A;  4GDK A;  1YJ1 A;  2JRH A;  2JZZ A;  2D10 A;  1UZX B;  3VH3 B;  2MLB A;  1WI0 A;  3A1Q A;  2MP2 A;  2XEW A;  5DPR A;  4PS3 A;  3U30 A;  1WZ3 A;  4HVB A;  1WX9 A;  2J7Q B;  2GMI C;  4K7U A;  4NAW B;  2KJR A;  4II2 B;  4AJW A;  4MGY E;  3ZVV A;  1OTR B;  1WH3 A;  4FAD A;  5AEK B;  3N30 A;  1UEL A;  2LRU A;  5LXH A;  2L8J A;  4BVU C;  1YX6 B;  2CU1 A;  3H7S A;  4DDG D;  3TJP A;  2O6V D;  2NVU I;  2ZCB A;  2JY6 A;  4FJV B;  3QK0 A;  1L7Y A;  3QWZ B;  4HCN B;  3ZTD A;  2BYF A;  2HTH A;  3Q3F A;  3VHT C;  5IA7 A;  4EZL A;  1IYF A;  1P3Q U;  2XK5 B;  4ANX A;  3GOE A;  3R7R A;  3RUL A;  3VTV A;  2KLC A;  1F9J A;  3L16 A;  4NJ6 A;  3U8Z A;  4MGI E;  1P0R A;  2GBJ A;  2KJH B;  2M8S A;  3H7P B;  2N9X A;  3HHM A;  3B0A A;  3L08 A;  2LVQ A;  1V86 A;  1LM8 B;  4KZC A;  3T9L A;  1I42 A;  3PLU A;  3WA0 A;  1KLV A;  3IVF A;  5JH5 C;  1NBF C;  4B6W A;  4K7W A;  4EFO A;  2KWC A;  2KKC A;  4PS7 A;  3ZLZ A;  2MBH A;  3KYC D;  2MSE D;  3OLM D;  2MA9 B;  2MBE A;  4E3C A;  3EEC A;  3A4S C;  2O6V A;  4HCP B;  3HIZ A;  4GDK B;  3N32 A;  2GBR A;  3APD A;  2KDE B;  5C23 A;  1E8X A;  3KUD B;  3RYT A;  4ANW A;  2NPT A;  5CTR C;  4ZDV A;  2MW5 A;  4RMA A;  2KZR A;  2MP2 B;  3ZRC A;  3MJW A;  2FCQ A;  4ANV A;  2PPH A;  3QJZ A;  5EDS A;  3W1S C;  2LXA A;  1MG8 A;  2ZPY A;  1S1Q B;  2PE6 B;  4WWN A;  4K1R B;  3VVW B;  2LD9 A;  1GNU A;  1Z2M A;  3KH0 A;  2EMS A;  4FUL A;  1RLF A;  2PE9 A;  4W9F A;  2ZNV B;  3SU8 X;  3KUZ A;  2BWF A;  3AU5 A;  2N9P C;  2Z0E B;  4P7I A;  3B1L X;  2FCN A;  5E6P A;  3PV1 A;  4KVG B;  3TIX A;  4HPL B;  4GB9 A;  4G0N B;  3H1U A;  4KDI C;  3HM3 A;  4NNJ B;  2UWQ A;  3RZW C;  2KDF B;  4GSW A;  3VQI A;  2BPS A;  4MEM A;  2LGY A;  2KTR B;  4LDT D;  5KHO A;  2CKH B;  1I35 A;  1V2Y A;  1WXS A;  2MBO A;  2N1W A;  5CX3 A;  2WX1 A;  1E5W A;  3ZNG C;  4G3X B;  5C1Z A;  4NJ7 A;  2EKE C;  3ZO5 B;  2XBB C;  5DPW A;  2N1V A;  3VUW A;  3AU4 A;  3X23 A;  3AUL A;  2V1Y A;  1HE8 A;  2R2Q A;  3W1Y A;  2B3A A;  2JPH A;  2BYE A;  3L0W B;  2LXC A;  1TZ1 A;  2LZ6 A;  3V6E B;  3DBR I;  4GDL B;  1LXD A;  2L3Z A;  3SDL C;  2KC2 A;  2FID A;  3H6N A;  2KFJ A;  1WGD A;  3DOW A;  2DYB A;  1TBE A;  3NS8 A;  4TQ1 A;  1WE7 A;  2N7D A;  5D94 A;  4CHK A;  4ICU A;  4FHK A;  4URK A;  4DHZ E;  2KK8 A;  2C7N B;  3DVG X;  1E90 A;  1Z5S B;  2C9W B;  4A20 A;  4IM3 A;  4PS8 A;  5KHQ A;  4MSM B;  1WXV A;  4WWP A;  2JZ3 B;  1WZ0 A;  3L54 A;  4FBJ B;  5AZF A;  2A5U A;  1GC6 A;  4E74 A;  4EOY A;  1NDD A;  2D11 A;  3X0W A;  2M0X A;  3IFW B;  4AP4 C;  2AWT A;  5LLI A;  4XX5 A;  4CO7 A;  4DHZ B;  3ZNI D;  3B08 A;  1LFD A;  4FN2 A;  1OEY A;  4IM2 A;  3UIP B;  4W9G A;  1UBI A;  4LJO B;  1S3S G;  3BY4 B;  4MSQ B;  3DBL I;  3PPA A;  3PTF C;  1WMH A;  4ICV A;  3M95 A;  4FHJ A;  5FR6 A;  3UIO B;  3VH4 B;  1V5T A;  4M8M A;  1PQS A;  1JRU A;  2PJH A;  3KUC B;  3MHS D;  1YQB A;  4NQK E;  2RGF A;  3PSE B;  4IG7 B;  4MDK E;  3VFK A;  2LGD A;  2DZJ A;  3PVL A;  2C60 A;  1P1A A;  1RAX A;  2A4Z A;  3QC8 B;  2D07 B;  4HPM B;  3PGE A;  1X1M A;  3DPD A;  5J18 A;  1IPG A;  1WGR A;  3P2B A;  2AYO B;  4DXA B;  2KWV B;  2WWZ A;  2HD5 B;  3QHT A;  2MBQ A;  1WJN A;  4ASW C;  3MTN B;  3ML9 A;  3QAR A;  4HLE A;  2KAN A;  2G45 B;  2JUO A;  1J8C A;  3UGB B;  2GBN A;  4IUM B;  3UQA A;  2KX0 A;  5AZG A;  1CMX B;  4ZRI A;  4DHJ B;  1EO6 A;  2QHO A;  2MCN B;  1WMH B;  3D32 A;  4OVV A;  4BKS A;  4PYU A;  4ANU A;  4G50 A;  4WJP A;  3KYD D;  4HJK A;  3RUI B;  3VTU A;  2FUH B;  2NBW B;  1WYW B;  3DCG A;  4DHJ D;  4I6L B;  4GOC A;  4M0W B;  2K6Q A;  3DBH I;  1K8R B;  2JRI B;  5G55 A;  2JF5 A;  3AXC A;  4X57 B;  3V6C B;  2I1J A;  3OAW A;  3NHE B;  1C1Y B;  4KSL C;  1UH6 A;  5D2M B;  1AAR A;  3EHV A;  4DDI D;  5L83 A;  4PYZ A;  3A9K B;  2KC1 A;  4W9L A;  2IY0 B;  4JLC A;  3JSV A;  3JVZ X;  3WAP A;  3BIN A;  2CR5 A;  4FA6 A;  3A9J A;  2BF8 B;  3NZU A;  3GZN I;  2D3G A;  3AI5 A;  2C5L C;  2DZI A;  4BKG A;  4GDL A;  3JW0 X;  1R4N I;  2IYD B;  3R3M A;  2M17 A;  5IAA C;  3SHQ A;  5G2N A;  5E6O A;  3JSV B;  3WAM A;  4MJS A;  3ZDT A;  2FIF A;  3TL5 A;  3U7D A;  2MWS B;  2DZK A;  3VDZ A;  4TQ0 A;  1SGH A;  4ZRJ A;  3TMP B;  3RCZ A;  3VTW A;  3ZNZ B;  2CS4 A;  2LAS A;  3PRZ A;  3V62 A;  3ZDM C;  1ZGU B;  1OQY A;  1WR6 E;  4IWO A;  2R2O A;  3WAO A;  1TTN A;  2KD0 A;  3H7P A;  4F8C B;  2IO3 B;  4GXB A;  3QX1 A;  4MEL A;  1J19 A;  2FNJ B;  5DPS A;  1Q5W B;  3PRE A;  2WYQ A;  4W9D A;  2CHX A;  2K8B A;  1WM3 A;  1RRB A;  4GU2 A;  4WJN A;  2IBI B;  1J0G A;  3Q3J A;  1Y8R C;  2IO0 B;  2K8C A;  4EUT A;  1WR1 A;  2RSU A;  4MGZ E;  5CHV C;  4EKU A;  3LJ3 A;  2KN5 A;  1E8W A;  1V81 A;  4IM0 A;  2Y5B B;  3ZNH B;  3DQV A;  5CHW A;  3ZKJ C;  3ECI A;  3IHP C;  4BKS D;  1R4M I;  1OGW A;  2NPT B;  3WAL A;  3A4R A;  3CST A;  4I6P A;  4OVU A;  4AWJ A;  4B9K A;  3IG3 A;  4MM3 A;  1GC7 A;  2KO3 A;  1BT0 A;  2DAJ A;  3L13 A;  4NPN A;  4WQO B;  4K81 A;  2KFK B;  4KDL B;  4ZYN A;  2I1K A;  4GIV A;  4BOS C;  1YX5 B;  3PRM B;  1T0Y A;  4MJS B;  4GN1 A;  3UIN B;  1WGY A;  2KX3 A;  2J0J A;  2LRW A;  4M8N A;  2M1M A;  4W9J A;  1V9J A;  2HE7 A;  1ZKH A;  1V5O A;  3HM6 X;  1WX8 A;  3W1S A;  4KV2 A;  3PZD A;  4HDQ A;  4JQW C;  1WM2 A;  4W9E A;  4RM9 A;  3S2A A;  3A9K A;  2NBU A;  1WXA A;  1WIA A;  1RFA A;  4RM8 A;  3ONS A;  2KTR A;  2KDB A;  3PT2 B;  2L7R A;  2LGX A;  5J2R A;  2HJ8 A;  4G11 A;  3M3J A;  2L05 A;  2C7M B;  2M4N A;  2DAF A;  5DCN A;  3KVF B;  4DK5 A;  1KOT A;  4WJQ A;  4WJO A;  5HKH A;  1E7U A;  2LUE A;  2IZV B;  4IW0 A;  2GBK A;  1SIF A;  2L0T A;  2MBB B;  2YVC A;  3LDZ E;  4DBG A;  3OJ3 A;  2K8H A;  3QA8 A;  3DVN V;  3IBE A;  4TV3 A;  4JIO U;  1V80 A;  4N9F 4;  4KIK B;  2LVP A;  1P9D U;  4NAW A;  2ZCC A;  4W9K A;  2FCM A;  2KJ6 A;  2NR2 A;  2WX0 A;  3R66 C;  4FLH A;  2JXX A;  2K6D B;  3DBS A;  4F7Z A;  5TR5 A;  2KDI A;  4IC7 B;  3VUX A;  3C0R B;  5JHA A;  4GGQ A;  3A33 B;  4WAA A;  3ZIM A;  3V60 A;  2J0M A;  3QAQ A;  4B95 A;  5J17 A;  4E71 A;  2REX A;  4KIK A;  4JL9 A;  1NI2 A;  2RR9 A;  1GG3 A;  2J0K A;  1OEY J;  4A3P A;  2G4D B;  4W9I A;  2N7E A;  2FCS A;  2CHW A;  2ASQ A;  1EUV B;  2BKR B;  2NBV B;  2KOX A;  2ZEQ A;  3CF6 E;  2UYZ B;  2IO1 B;  3V61 A;  2Z59 B;  2D2Q A;  2AL6 A;  1G6J A;  5BO4 B;  1C3T A;  2Z0D B;  3UQB A;  1V49 A;  2ZNV C;  1VCB A;  4JGH B;  4TKN A;  2DYM A;  2OOB B;  1SE9 A;  3NOB A;  5GMV A;  1E8Z A;  1WFY A;  4EZJ A;  1GJZ A;  2MQJ A;  1GUA B;  2KQS A;  3QCA A;  3M63 B;  3VAW A;  2XK5 A;  3ENE A;  4K7S A;  3PHW B;  3VUY A;  4KZ0 A;  4GMV A;  2KNB A;  4AOF A;  4EEW A;  1WJU A;  3WAN A;  2L76 A;  4TUU A;  3NZS A;  1YIW A;  3ZUN A;  2LVO A;  4BKT A;  2MX2 A;  2EMT A;  1P98 A;  5DPT A;  3UF8 A;  4BFR A;  1WY8 A;  2JWZ A;  3A1Q B;  3SD5 A;  3WIM A;  3ZW3 A;  1H4R A;  2GOW A;  1WJ6 A;  4EZK A;  2KHW B;  3PRP B;  3RD2 A;  3TBL D;  3DVN U;  2OJR A;  3APC A;  1WF9 A;  1D3Z A;  2GBM A;  3HK0 A;  2BKF A;  3PHX B;  2YLM A;  3EFU A;  2IO2 B;  3ZTC A;  3OJ4 B;  4I6N B;  1WGG A;  3PLV A;  2LWP A;  4YL8 A;  4LDT B;  2KMA A;  4WWO A;  4KSK C;  1FXT B;  2O2V B;  3QQ8 B;  4LCD E;  3ML8 A;  3RT3 B;  5AZH A;  2G4S A;  4II3 B;  4A3O A;  1UD7 A;  2MRP A;  3N3K B;  1VD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...