3DBRI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190gln-nedd8ala72arg)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
85
Chain Sequence
b'RRASVGSGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLRLRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 18
structure length 85
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dbrI00
3T8MA 4BVUC 4F1SA 4N9F4 4RM8A 3V6CB 5E6PA 3WAMA 3UQBA 3APFA 3A9KA 3QQ8B 2BGFA 5CHVC 5D6JB 3A4SC 5JZEB 3JYUA 3RULA 4G11A 3ZNHB 3AXCA 1SIFA 2ZCBA 1WIAA 3H9DA 4P7IA 4RM9A 2LI5A 2PE6B 3GZNI 2N4FA 4BKGA 1PQSA 4BOZB 2KLCA 3UQAA 2LVOA 4IC7B 1F9JA 1KM7A 5D94A 2IY1B 2LWPA 1FXTB 3DOWA 2IO3B 2LD9A 2UWQA 3H7SA 1WZ0A 2D11A 3ZKJC 4AJYB 4TQ1A 2L7RA 4RMAA 3EC8A 3ZO5B 4E74A 1P3QU 1H4RA 2FCQA 1I35A 1Q1OA 2PE9A 1EF5A 2KTRA 4GXBA 3WANA 1E8YA 1XQQA 3VTUA 2OJRA 3ALBA 2QHOA 3PREA 1YJ1A 3HM3A 1T0YA 4KZCA 4XC2A 4K1RB 4K7WA 3S2AA 1J8CA 1WM3A 5IA7A 4X57B 1WGRA 4XZ4A 2G45B 5DPSA 3B0AA 2MBOA 1P98A 4EKUA 1UD7A 2NR2A 1V6EA 3NOBA 2ZVOA 4K81A 3QC8B 1NDDA 3LDZE 4I6NB 1V5OA 2UYZB 4MJSB 2LZ6A 2L76A 4W9EA 5C23A 2B3AA 3PPAA 3R7QA 2PJHA 2LXAA 2PPHA 3NZSA 4W9HA 5AZFA 1L7YA 1Q5WB 4IWOA 4LJOB 5TR5A 1K8RB 1RRBA 3N30A 2JZZA 4MELA 4OVVA 2NBUA 4K7SA 3V62A 1WY8A 3PRPB 3CF6E 2LGDA 3PVLA 4DXAB 2L0TA 2DX5B 1IPGA 5JHAA 2CS4A 2IO2B 2MRPA 2N1WA 2A4ZA 4W9GA 4KSLC 4JIOU 3KYCD 4LCDE 1WE6A 3M62B 4W9KA 3AULA 2CHXA 1E90A 4F7ZA 4KZ0A 3H7PB 3TCAA 2K6DB 2REXA 3W1YA 4GMVA 4IG7B 2Z59B 4HVBA 2CU1A 2JVCA 4IWPA 5J18A 1WX7A 4EEWA 1WGHA 1WXMA 3R7RA 3PT2B 3PSEB 2KTFA 1RFAA 4EZJA 2O6VD 4MJSA 5E6NA 4W9CA 4FA6A 3PLUA 2KDIA 4ANWA 3VXWA 3U7DA 3L0WB 2G3QB 2RSUA 2XBBC 3DBSA 2J0JA 3O65B 2LGXA 2KC1A 3EHVA 1J0GA 2NVUI 1Z5SB 2WWZA 4JGHB 3X0WA 1UBIA 1YIWA 1IP9A 4PS3A 2ZCCA 2GOWA 2WX1A 1EO6A 4IWQA 3PS6A 4CHKA 1GC7A 3PLVA 1ZKHA 2OOBB 3UINB 3SD5A 2C5LC 2KQSA 1J19A 2KDEB 2JWZA 3H7PA 3SHQA 1TZ1A 3N3KB 2NS5A 1EF1A 4ANXA 2ZEQA 4KSKC 3TBLD 2BF8B 2GBRA 3CSTA 2BKFA 1OEYJ 3VDZA 2KTRB 2NBVB 3OAWA 4OVUA 3OLMD 3RCZA 3Q3JA 2KFKB 2LJ5A 4HXDA 2KX0A 4LDTB 4KV2A 4WJOA 2M1MA 4MM3A 1M94A 4CO7A 3ZIMA 3AI5A 2K8CA 4TUUA 4YL8A 3PHWB 4EZLA 4HLEA 1LXDA 1WR6E 2ZZPB 2KWCA 2EKEC 3EECA 5LXHA 1XD3B 3DVNU 4WAAA 5LXIB 2D2QA 1OTRB 4GU2A 5J2RA 4AJWA 2KVRA 2C7NB 2CR5A 3SU8X 2K39A 3UIPB 4HPLB 4J6IA 4G0NB 5JH5C 2MA9B 3ZVVA 2FAZA 2LASA 2FCNA 2DYMA 1WJNA 2BWES 4AUQC 2KWVB 2MWSB 2BYEA 1WXAA 3KVFB 3NY5A 1R4NI 2N7DA 2C9WB 3HK0A 3IG3A 1TBEA 4WQOB 2MQJA 2XEWA 2N9EB 3MJWA 3DBRI 2KDFB 1AARA 3PRMB 3V61A 1WXVA 2ZNVB 4HK2A 4WJNA 3WA0A 2MX2A 2KFKA 5AEKB 1WX9A 2IBIB 4PYZA 5L95C 2C60A 2KLGA 1SE9A 3ZRCA 3ONSA 3R66C 2BWFA 4NQKE 5CTRC 4BFRA 3BINA 3A33B 1VCBA 3KYDD 3DBLI 3N32A 1E8ZA 4FADA 1GG3A 3ML8A 3D32A 2D07B 3RZFA 2O2VA 1Q0WB 2V1YA 2FIDA 3PRZA 1WH3A 4TQ0A 3PV1A 4W9IA 2R2QA 1ZW7A 1YX6B 3GOEA 3DDCB 2LVPA 2YVCA 2R2OA 2JRHA 4MGKE 5BO4B 3Q3FA 4HWIB 2DYOA 2BYVE 4NY0A 3QWZB 4HCPB 4EOYA 5DPRA 1WGGA 4XX5A 2IYDB 3ECIA 3ZDMC 3QA8A 3B1LX 1SGHA 4DHZB 3TJPA 2RPQA 3L08A 2KFJA 4MGYE 4AP4C 4EUTA 2DYBA 2KJHB 2V4LA 2ASQA 2YLMA 1GJZA 2KWUB 1YX5B 3VQIA 4BBNC 2N9XA 1OEYA 3ZUNA 2MBBB 2RR9A 2KK8A 2ZPYA 3NHEB 4NAWB 5KHOA 2IZVB 2M4NA 2AL6A 2KOXA 2IO1B 1WX8A 2J0MA 3TMPB 4W9LA 2O6VB 4HDQA 3KUZA 3KW5B 4GOCA 1GNUA 1EUVB 2Z0DB 2MBEA 3ZRFA 4HDOA 2AWTA 2FNJB 4JQWC 3ZW3A 2LXCA 5DPTA 4WWPA 1WMHA 1WRDB 3P2BA 4BKTA 2DZIA 2I1JA 4GDLA 3VTWA 2NPTB 1WI0A 2KDBA 1G6JA 3RD2A 1IYFA 3MHSD 2L05A 5GMVA 2KANA 1R4MI 4MGIE 4FBJB 2K1FA 2I1KA 3HHMA 1WR1A 2DZMA 2DHZA 5AZHA 3ENEA 3HM6X 4NJ7A 2KKCA 1WXSA 3RZWC 4NPNA 3H1UA 1WFYA 4FHKA 3PHXB 5KHQA 4A20A 1WJUA 2KQ7A 3L13A 1L2NA 1S1QB 2BKRB 2LGYA 3APDA 5D2MB 4ICVA 3APCA 1A5RA 4IM3A 1C1YB 2K6QA 2KC2A 2ZNVC 3VFKA 2G4SA 1E8XA 2ZVNA 4NAWA 4WJQA 3ZLZA 3PGEA 4DK5A 2HD5B 2MP2B 2A5UA 3WAOA 4FN2A 3M63B 3TIXA 4E71A 2O6VA 5JHBA 1WGDA 4ZRIA 3B08A 1RLFA 3DCGA 3LJ3A 2N7EA 4MEMA 2XK5B 3UIOB 2C7MB 3QCAA 4BKSD 2G4DB 2M8SA 2LVQA 3ZDTA 4TKNA 3NS8A 2AYOB 4KIKA 5L83A 2BYFA 4MSQB 2L3ZA 2NPTA 3DVGY 2BPSA 4PYUA 2GMIC 1NI2A 4B95A 3JSVB 1CMXB 3VUXA 4DHZE 2JZ3B 4NJ6A 4TV3A 1VD2A 4B9KA 2MBHA 2O2VB 4IUMB 3TL5A 2MW5A 4JL9A 1V2YA 1XT9B 2JY6A 4DWFA 1MG8A 4GDKA 1WJ4A 4DDGD 2Y5BB 4DDID 2K25A 2KJ6A 3X23A 3VH4B 3A9JB 2N1VA 1ISNA 4GGQA 2N9PC 3QJZA 1KLVA 5LLIA 2KZRA 2RD0A 4I6PA 1I42A 1WGYA 3OJ4B 3I3TB 2GBKA 2L0FA 1V81A 3JW0X 5E6OA 2MP2A 4JLCA 3QHTA 1WF9A 1HE8A 4KDIC 4GN1A 3DBHI 2JT4B 2XK5A 3QAQA 4G3XB 4K7UA 4ASWC 4DHJD 3ML9A 2AEHA 5DCNA 1V49A 2Z0EB 2NCNA 3QK0A 3IBEA 3V60A 1UBQA 2VRRB 3SDLC 3VUWA 2GBMA 5AZGA 3JSVA 1TTNA 2KJRA 4EFOA 3BY4B 2CHZA 2L00B 3DQVA 4II3B 3OJ3A 2DZKA 3DVNV 3U8ZA 2J7QB 1WM2A 3RYTA 2DAFA 2GBJA 1U4AA 4AOFA 2JF5A 1RAXA 1WMHB 3UF8A 4A3PA 1V5TA 1Z2MA 3ZNZB 2LUEA 2J0KA 4GDLB 4AWJA 3PTFC 3A9JA 1E7UA 5CHWA 1P0RA 2M17A 4WWNA 3R3MA 4KVGB 3H6NA 5D7GA 3WIMA 2MLBA 3A1QB 2EMTA 4ZRKA 2KN5A 2GBNA 2NBWB 3K9OB 1E5WA 2HTHA 1BT0A 4FJVB 4WJPA 3A4RA 3DPDA 3T9LA 1ZGUB 4GIVA 5J17A 3RUIB 1GUAB 2LRWA 1TGZB 3CSFA 4W9JA 1GC6A 3VUYA 4URKA 5HKHA 3KUDB 2KD0A 3QX1A 1UH6A 5DPWA 3M3JA 5CHFA 3L54A 1UELA 1WZ3A 4M8NA 2K8HA 3WALA 1E8WA 2LRUA 1LQBA 1WYWB 4KIKB 4W9DA 2RGFA 2CKHB 3IFWB 4IM2A 2KXJA 3IVFA 1UGMA 2KMCA 4CYEA 4EZKA 2WX0A 3QIJA 1UZXB 1P9DU 2L8JA 3CMMB 3PZDA 4NNJB 3U30A 3VAWA 4FLHA 3L16A 3M95A 1V86A 1D3ZA 5G2NA 4FULA 3VHTC 2FCMA 2PEAA 4ZRJA 2EMSA 3IHPC 3EFUA 5CX3A 4ANVA 1WE7A 3A1QA 4MH0E 3WAPA 1LFDA 4GSWA 4GDKB 2D3GA 2WYQA 4I6LB 2K8BA 4IM0A 4ZDVA 2M0XA 3ZTDA 5C1ZA 1C3TA 1Y8RC 2FIFA 3HIZA 4MGZE 2W9NA 2DENB 3MTNB 4G50A 3W1SA 1WJ6A 4ANUA 4ICUA 2AL3A 4GB9A 4MDKE 2KO3A 3ZTCA 3RT3B 3VVWB 1E7VA 1YD8U 2FUHB 4PS8A 1V80A 5IAAC 4BOSC 1OGWA 4A3OA 4M0WB 3V6EB 3ZNID 4NQLB 4M8MA 2KMAA 4IW0A 4FJYA 3A9KB 1YQBA 3VH3B 2D10A 1V9JA 3NZUA 5FR6A 2ZPNA 3L10B 3AU4A 4HJKA 4II2B 5EDSA 2V3SA 3KUCB 3ZNGC 3JVZX 4FJZA 1KJTA 1QZEA 1JRUA 2JRIB 5G55A 4E3CA 4WWOA 2IY0B 3AU5A 3UGBB 3QARA 2JUOA 1P1AA 2FCSA 2ZJDA 2MCNB 3L17A 3K9PB 4W9FA 4FHJA 2HE7A 1H8CA 4DBGA 2DAJA 4PS7A 3DVGX 1LM8B 2KX3A 1NBFC 2MSED 2C7HA 4F8CB 4KDLB 2HJ8A 2CHWA 4HPMB 2KNBA 2KHWB 4HCNB 1KOTA 4LJPB 2IO0B 3KH0A 1S3SG 2MBQA 2WDTB 1OQYA 3C0RB 2JPHA 2JXXA 4ZYNA 3W1SC 4MSMB 2DZJA 4BBNF 3VTVA 4B6WA 1X1MA 4BKSA 4DHJB 4LDTD
chains in the Genus database with same CATH superfamily
4BVUC 4M0WA 3RNFC 4N9F4 1IGDA 1OQRA 3QQ8B 3JYUA 4LNFA 1ZE3D 4P7IA 1ET9A 1PQSA 3NVVA 2KLCA 3EFCA 4IC7B 2LWPA 1FXTB 3DOWA 2IO3B 4RMAA 2J52A 1I35A 2OJRA 3ALBA 5IP4D 3HM3A 5HFYA 4A55A 1UWMA 4X57B 3B0AA 1P98A 1NDDA 3IT6B 3NVZA 2L76A 3I57A 1EWYC 2LXAA 3ZXVA 2N0SB 4OZAA 5TR5A 4XWWA 2PIAA 1RRBA 4BZAA 4K7SA 4DXAB 2LGDA 2LMCA 4KSLC 4KX6B 3H7PB 3IT4B 2BB6A 3W1YA 2JYTA 3RNCC 2Z59B 2CU1A 2JVCA 4HRSA 3PT2B 2WDVB 2O6VD 4MJSA 2OEDA 4K3BA 1MHXA 5BYRA 2G3QB 5IOIA 3NS1A 4N59A 1QILA 5GXGB 1PFDA 2Y3AA 4PS3A 1AWDA 4KGTA 4RFBA 4IWQA 4WQMA 1RYJA 1ZKHA 2IPKD 3B9JA 1NI3A 2KDEB 2JWZA 1EM7A 3BVMA 3KQ4A 3N3KB 2BF8B 4MT5A 1UGJA 3BYTB 2JU6X 3VDZA 2KTRB 2NBVB 3OAWA 3RCZA 2KFKB 2LJ5A 3ZQ4A 2KX0A 4KV2A 1M94A 4LNNA 3AI5A 4TUUA 1UF0A 3ZIMA 1BUIC 5G5GA 5E6JA 1KRHA 3EECA 4WAAA 1OTRB 2C7NB 1JRPA 2K39A 1AYFA 3AM9A 5JH5C 4OW0A 3ZVVA 2FAZA 1KH0A 3AECB 2KWVB 2BYEA 1WXAA 3HK0A 2AQ2B 1E7PB 3Q69A 1AARA 3PRMB 3ZGZA 2V4IB 3EUB2 5T8IA 1SE9A 3ZRCA 3ONSA 3P4SB 4BFRA 1BXTA 2HDEA 3D32A 3HUIA 2O2VA 2V1YA 4P1BC 3PV1A 1N5WA 3GOEA 3FAHA 2IJ0A 3N1ZC 2R2OA 2BYVE 2TSSA 4TSSA 4C80A 2L32A 3B1LX 1SGHA 4DHZB 1IGCA 3L08A 4WH4A 2V4LA 2KJHB 2ASQA 1GJZA 1YX5B 3VQIA 1ZXHA 2K0PA 2K5PA 3TMPB 4HDQA 2EELA 3KW5B 1GNUA 2MJ3A 3ZRFA 2FNJB 4JQWC 3TEZA 3C8YA 2W3SA 4MM3B 1YQ4B 3P2BA 2DZIA 4GDLA 3VTWA 4OZCA 1G6JA 3AE1B 3MHSD 2L05A 2INPE 2DZMA 4ZYSA 3BZDB 1WXSA 2W55A 1C9FA 4REZA 2BKRB 2LGYA 2IDYA 3VR8B 1XLPA 4IM3A 3VRBB 3PGEA 3BWUD 3I5JC 3TIXA 2E3TA 5JHBA 1WGDA 3MP9A 3R2IA 4RH6A 3DCGA 3LJ3A 2XK5B 3UIOB 2C7MB 3IXSA 4S0RA 2M8SA 3AE3B 2W3RA 4TKNA 2AYOB 4KIKA 1N62A 4MSQB 1UNSA 2WDRB 3R2TA 2ZW0A 3Q6BA 4XDDA 2K9XA 3DVGY 2BPSA 3AE7B 4DHZE 1T0SC 2L83A 2MW5A 1V2YA 3AE5B 2HTME 1QOBA 4GDKA 2K25A 2N1VA 4NJCA 4DQOC 2RD0A 3GB1A 1WGYA 4IOIE 1I42A 2L0FA 2ONQA 1YMHE 3P42A 1K53A 3V3XA 4KDIC 4ASWC 2JT4B 3ML9A 5DCNA 3UI3A 2Z0EB 1XCTL 4LNIA 3QK0A 2JWUA 3BYYB 3IBEA 2QC8A 4RGNA 1V1PA 3U52E 3JSVA 2KJRA 1FRDA 4II3B 2BYTA 2DZKA 2J7QB 1U4AA 3MC8A 1FNWA 2JF5A 1RAXA 4A3PA 5CHWA 3AEFB 4HKQA 1N6ZA 4KVGB 5D7GA 2B76B 3A1QB 4WURA 2NBWB 1ET6A 1JWMD 1JMLA 1BT0A 3U2SC 1I4QA 2DWQA 2WGSA 3DPDA 5J17A 5I4DA 2KYWA 3VUYA 4DXFA 1PGXA 3SEBA 2KD0A 5DPWA 3M3JA 3PO0A 4XE0A 1UELA 4US9A 1E8WA 2H89B 2XN9C 1LQBA 2Z8LA 3IFWB 1DGJA 3IVFA 1D3ZA 4FLHA 4P6VF 2V3PA 3EFUA 5CX3A 5HG2A 4MH0E 2BS4B 3ZTDA 5C1ZA 3HIZA 1KTKA 2W9NA 4G50A 3W1SA 4ANUA 4MDKE 2KO3A 2VH2A 1MI0A 2WDQB 1F1HA 1E7VA 1FMAD 5FKAC 4M0WB 3ZNID 1TJEA 4M8MA 1ZUD2 2D3AA 4FJYA 2ZW1A 1FM0D 5FR6A 2DBYA 4HJKA 3KUCB 1KJTA 5JXVA 2JRIB 4E3CA 1ENFA 2E6XA 3TEWA 1FXIA 1F52A 3MC0B 4YSYB 2KNBA 1KOTA 1MPEA 3W1SC 5H92C 2DZJA 4BBNF 1X1MA 4BKSA 4DHJB 3T8MA 1ZDXA 2PVOD 3B2GA 3Q3MC 4ZHOA 3UQBA 5D6JB 3RMKC 5JZEB 1VZ7A 3ZNHB 3AEBB 1SIFA 1HZ6A 2ZCBA 4RM9A 4BOZB 3UQAA 1F9JA 1KM7A 1IUEA 2LD9A 1N61A 2D11A 4AJYB 4E74A 1Q1OA 2PE9A 2WXRA 4GXBA 1XQQA 3VTUA 2WXNA 3FILA 4A6QA 1T0YA 2WS3B 3CIRB 4K7WA 1CQVA 3Q8FA 1WRIA 2MBOA 3RNEC 4EKUA 1UD7A 1V6EA 4K81A 4RGTA 3QC8B 1E0ZA 2K22A 4MJSB 4HPPA 4W9EA 2PJHA 2PPHA 4W9HA 1K8RB 3N30A 2KACA 2Q5WD 3CF6E 3PZ7A 1TT5B 2DX5B 1IPGA 5JHAA 2A4ZA 3AEGB 3AEAB 3M62B 3AULA 2CHXA 1E90A 4F7ZA 3Q8EA 1FNVA 3FKYA 4GMVA 1HZ5A 2CJNA 2WQYB 3BVZA 1KF6B 1TYGB 1FCCC 4WIPA 3Q3OC 2RSUA 2WXKA 2LGXA 5FK9C 2WWZA 3T3NA 1EO6A 3E56A 1GC7A 3SD5A 1F2RC 1J19A 3SHQA 3IAM1 1EF1A 4ANXA 3TBLD 2DNFA 2GBRA 4XGAB 1OEYJ 1F77A 3OLMD 2KDMA 2WNMA 2PW9A 2WXQA 1FPYA 5C3JB 3NG0A 4YL8A 4HEA1 4HLEA 1LXDA 1WR6E 2ZZPB 2J53A 2KWCA 2V0GA 1YN4A 2WU2B 3AEEB 3DVNU 5LXIB 4GU2A 4OHJA 4YSXB 3UIPB 3AN1A 4G0NB 4QAYA 2LASA 4RNAA 2DYMA 1WJNA 2BWES 3GS2A 3KVFB 1CZPA 1R4NI 1R4NB 3RNGC 2C9WB 1WGKA 2MQJA 1XLNA 1R7SA 4R3DA 4WJNA 4HK2A 5AEKB 4EE2A 1VZ6A 1WX9A 5L95C 3MFGA 2KLGA 1VJKA 4NQKE 5CTRC 1VRAB 4FADA 1GG3A 3ML8A 1VZ8A 1QF6A 1I4GA 2FIDA 1WH3A 1B1ZA 2J4XA 2ACZB 3DDCB 2LVPA 3H8HA 4PT5A 2I2YA 2DYOA 1GAQB 4EOYA 3P4PB 5D3DA 5DPRA 1WGGA 3TJPA 1UUPA 3RNAC 2YLMA 2KWUB 1DOYA 1OEYA 2XNAC 2ZPYA 1LO5D 2IZVB 2M4NA 1WX8A 3WCQA 2Z0DB 3CWIA 3ZW3A 1GPXA 2LHEA 1HA5A 3Q3NC 3AEDB 3RD2A 4Q2JA 5GMVA 2KANA 4FBJB 2K1FA 2I1KA 4MACA 2IGGA 5AZHA 2LHDA 3ENEA 3RZWC 2D5GA 1K52A 2UU7A 3PHXB 1PUTA 1RWSA 1L2NA 5D2MB 4ICVA 1A5RA 2ZNVC 2RDHA 2G4SA 4NAWA 4WJQA 3ZLZA 2HD5B 2A5UA 2JX5A 4E71A 1D5ZC 4ZRIA 3B08A 4RF0A 3ZDTA 2L3ZA 4B95A 3JSVB 4TV3A 4B9KA 4IUMB 1VLBA 3TL5A 4JL9A 2INNE 4HJGE 2DLBA 2Y5BB 3SR6A 1L6UA 2LFIA 3KWVA 2FBWB 1QOGA 3VH4B 4GGQA 2N9PC 2BB5A 1KLVA 1XF5L 2KVZA 4ZHPA 3P4QB 2GBKA 2YEPF 4JLCA 2K3UA 3QHTA 3LYYA 4B0MA 1HE8A 4GN1A 1QLBB 2GLSA 4DHJD 1Q10A 1TIFA 2AQ3B 2KT7A 4YTPB 1YJIA 2D3CA 1L0XB 3MC9A 1UBQA 3VUWA 4A8XC 1TTNA 3BY4B 2CHZA 2L00B 2KMMA 1YJJA 4JE3B 3DVNV 3U8ZA 1WM2A 2DAFA 2GBJA 3N9YC 1WMHB 4H2AA 1V5TA 4AWJA 2VZKB 4WWNA 2PMVA 3H6NA 1IBXA 3WIMA 3MJ5A 2MLBA 2EMTA 2MJDA 4ZRKA 3K9OB 1E5WA 4D2KA 4FJVB 3NJTA 3AV8A 2PTLA 3L4PA 1QKZA 3CSFA 1ZPSA 4N58A 2JZPA 4URKA 2SAKA 1QT9A 5CHFA 2CKHB 4IM2A 4CYEA 2KMCA 4EZKA 2WX0A 4NNJB 3VAWA 1RFKA 1SE4A 3M95A 1JROA 1TY0A 2PEAA 3IHPC 1SE3A 1ZP0B 4GSWA 2D3GA 2WYQA 4ITKA 4YTMB 4IM0A 1C3TA 2BS2B 3MTNB 1I4RA 1DOIA 2PLPA 1WJ6A 4ICUA 2AL3A 1SF0A 1V80A 5IAAC 3ZJUA 1OGWA 2WXGA 4IW0A 4PK1A 4ACFA 1V9JA 3NZUA 3L10B 3AU4A 3LXFA 3P63A 2LJIA 3JVZX 3R8BA 1QZEA 4WWOA 1CJEA 1MHHE 4M00A 2GRIA 3BVGA 1EWCA 2JUOA 2FCSA 2MCNB 2FE8A 3L17A 4PS7A 1LM8B 4F8CB 4CQNA 3FILB 5BMGA 2KHWB 4HCNB 3KH0A 1DYQA 1S3SG 3J9CA 1OQYA 3C0RB 2JPHA 4ZYNA 1D4BA 4MSMB 1EU4A 1T3QA 4ARIA 4KGSA 4RM8A 5E6PA 3WAMA 5CHVC 3A9KA 2BBCA 2BGFA 3E9SA 2JQRB 3A4SC 2GB1A 3VRAB 4GLSC 4G11A 3AXCA 3H9DA 1JALA 2LI5A 2PE6B 2N4FA 2LVOA 2UWQA 3U7ZA 3ZKJC 2L7RA 3ZO5B 3EC8A 2FCQA 1H4RA 1F2RI 1TKGA 1EF5A 2KTRA 5EE9A 3PREA 4XC2A 3N1YC 2INDC 4K1RB 3S2AA 1J8CA 4RF1A 1WGRA 4XZ4A 5BMIA 2G45B 2NR2A 3NOBA 4L23A 1D5MC 2LZ6A 3R7QA 4C4VA 5AZFA 1L7YA 1Q5WB 3RN9C 4P16A 3AE4B 2JZZA 3V62A 1WY8A 2VH1A 3Q2AC 4LNKA 2CS4A 2IO2B 1TS3A 2N1WA 3I9V1 4W9GA 4JIOU 3KYCD 4LCDE 4W9KA 1ZOYB 4FXCA 4KZ0A 3TCAA 3W5VB 2K6DB 2HJ1A 2JYEA 1I4XA 2PVGC 4HVBA 2NMQA 1WX7A 4EEWA 3NZ3A 1ACCA 1WGHA 1PGBA 4RCOA 3R7RA 3PSEB 3SFEB 1RFAA 4EZJA 5E6NA 4W9CA 2KDIA 2KQ4X 4JPSA 2J0JA 3EHVA 4JGHB 1SBBB 4IKGA 1P7FA 1UBIA 1YIWA 3KLSX 1J7CA 3P4RB 4RGMA 2NTSA 1SE2A 2WX1A 4LK0M 3PS6A 2C5LC 2KQSA 1TZ1A 1I7HA 2NS5A 4KSKC 1P7EA 1GB4A 2YEPB 4YXDB 1HQRD 2LEKA 4KKJA 5AUKA 3Q3JA 4LDTB 2BS3B 3V05A 3P1MA 4WJOA 4MM3A 4CO7A 2RDBC 4EZLA 2K8CA 3IAS1 3TSSA 2D2QA 4AJWA 1NEKB 2X8XX 4J6IA 3N1XC 4YSZB 2JSVX 4AUQC 5BMHA 4J3OD 2N7DA 3IG3A 2XEWA 2RDGA 2N9EB 3DBRI 3DBRB 1L4DB 1WXVA 2ZNVB 2MX2A 1L4ZB 2IBIB 3RFZB 4PYZA 4LLGM 2QEJC 2FUG1 3I63C 2BWFA 3BINA 5EE3A 1YN5A 3A33B 3DBLI 3N32A 3DBLB 3RZFA 2W82A 1Q0WB 1MFWA 4TQ0A 2R2QA 2JRHA 4MGKE 3Q3FA 4NY0A 1TS4A 4ARCA 3QWZB 4HCPB 4WWMA 2VZKD 4XX5A 3ECIA 3QA8A 5HHDG 1EU3A 2RPQA 1FNUA 2KFJA 4MGYE 1C4CA 2BVCA 4AP4C 4EUTA 4KGRA 1MJDA 2N9XA 4O1NA 3ZUNA 2MBBB 2KK8A 3NHEB 4NAWB 5KHOA 3RNBC 2KOXA 2IO1B 2KWDA 2J0MA 4W9LA 3KUZA 2G1EA 1EUVB 4TMAB 2MBEA 2GI9A 1WWTA 2LXCA 2SEBD 4BKTA 2I1JA 4ZOHC 2KDBA 1IYFA 1SJED 3AE8B 1STEA 1R4MI 4MGIE 1R4MB 3HHMA 3HM6X 4NJ7A 2KKCA 3H1UA 1WFYA 3FC4A 4FHKA 2X38A 1JCKB 1S1QB 3APCA 1PDXA 2K6QA 2KC2A 1E8XA 4DK5A 3WAOA 1XLQA 3M63B 2O6VA 1RLFA 4MEMA 1SSNA 3DWMA 3QCAA 4BKSD 2LVQA 3NS8A 3ZJVA 5L83A 2BYFA 2NPTA 2WXPA 2WXFA 4RGOS 2JZ3B 1VD2A 2MBHA 2O2VB 4DWFA 1XT9B 2JY6A 1WJ4A 4DDGD 4DDID 1YQ3B 2MHJA 3X23A 4NZLB 1A70A 3QJZA 1SEBD 5LLIA 5MPOA 1TZOA 1IBXB 1FRRA 2WXIA 1V81A 3JW0X 5E6OA 2MP2A 2MH7A 4C7YA 1WF9A 5HI1A 3OWEB 1C77A 3QAQA 4OVZA 2AEHA 1V49A 2NCNA 1N5XA 3AE2B 2GBMA 5AZGA 4EFOA 4AQ7A 1V8CA 2N9KA 3GP7A 5EE1A 3OJ3A 4M01A 3RYTA 2JXTA 1YOVB 1C79A 4AOFA 1Z2MA 3ZNZB 4GDLB 2J0KA 5FR3A 3PTFC 3AE6B 3A9JA 2CJOA 2R61A 3R3MA 2OHFA 2LUMA 2KN5A 2Y5PA 2HTHA 3A4RA 4GIVA 3RUIB 1BMLC 3HVDA 1GUAB 2KN4A 1QOAA 2LRWA 1TGZB 1XEEA 4W9JA 2WXMA 1N60A 1GC6A 4NAMA 5HKHA 4A90A 2IGHA 3QX1A 2LGSA 1UH6A 5BYQA 5IN7A 2J42A 4M8NA 2WXOA 3WALA 2LRUA 1WYWB 4KIKB 4W9DA 1E10A 4BAXA 1P9DU 1K51A 3L16A 1V86A 4FULA 3VHTC 2FCMA 3AB5A 4ZRJA 2EMSA 3TEXA 3WAPA 1V1OA 4GDKB 2IGDA 4I6LB 3VR9B 2M0XA 1Y8RC 1F0ZA 4MGZE 2DENB 5LNK1 1OQQA 4GB9A 3ZTCA 3RT3B 1MVKA 3VVWB 2FUHB 4PS8A 4BOSC 4A3OA 4YT0B 2KMAA 2WHIA 2NTTA 3A9KB 1JWBD 1FD6A 2D10A 1NYQA 2ZPNA 3ETRA 5EDSA 2V3SA 2RPVA 4FJZA 1V1PB 2IY0B 3AU5A 3UGBB 3T3OA 2ZJDA 3K9PB 2HE7A 1T6BX 4DBGA 3Q8AA 3NVYA 3DVGX 2KX3A 1WYGA 2MSED 2KAJA 4KDLB 2EKIA 2HJ8A 4AS1A 1TS2A 2IO0B 4LJPB 2JXXA 1TKYA 4LDTD 3U4EG 1SB3C 4F1SA 3V6CB 4HROA 3APFA 1V97A 3RULA 1NYRA 4JWSC 2L1AA 4C4VB 4K3CA 1GOZA 1WIAA 2QDFA 3GZNI 4BKGA 3GZNB 5D94A 2IY1B 1C76A 3H7SA 1WZ0A 4TQ1A 4P1CC 1P3QU 3WANA 1E8YA 4WAFA 4YTNB 1C4AA 2QHOA 1YJ1A 4DXGA 4KZCA 2RMMA 1WM3A 3DHIC 1SJHD 5IA7A 4UDUC 1HTOA 5DPSA 5G5HA 2ZVOA 3LDZE 4I6NB 1V5OA 2UYZB 4ZRQA 5C23A 2B3AA 3PPAA 1YN3A 3NZSA 1VR9A 4IWOA 2W54A 4LJOB 5H8YE 4MELA 4OVVA 2NBUA 3PRPB 3PVLA 2L0TA 2MRPA 3SFDB 1WE6A 1QOFA 2REXA 4IG7B 1FFVA 4IWPA 2G9HD 5J18A 1WXMA 3C19A 2KTFA 2I38A 4A9AA 2LGIA 4FA6A 3PLUA 4ANWA 3Q14C 3GE3C 2OJWA 3VXWA 3U7DA 3L0WB 2XBBC 3DBSA 3RPFC 3O65B 2KC1A 1J0GA 2NVUI 1Z5SB 3LB8C 3X0WA 2BTEA 1IP9A 2ZCCA 2GOWA 3ZXRA 4CHKA 3PLVA 2OOBB 3UINB 3RI7C 3Q8CA 2AX5A 3H7PA 2V9HA 5C2TB 2ZEQA 3CSTA 2BKFA 2AQ1B 3PZ8A 1TY2A 4OVUA 4HXDA 2WXJA 3BK1A 2M56B 2M1MA 2WLBA 1JWUD 3PHWB 1T0QC 3AH7A 1XCQL 2EKEC 1FXAA 2QCZA 1L6VA 5LXHA 1XD3B 2WP9B 5J2RA 2KVRA 2CR5A 3SU8X 4MH8A 4HPLB 1NVID 2MA9B 4OZBA 1T0RC 2FCNA 4USAA 2BT6A 1WXQA 2WXLA 1ESFA 2MWSB 1I4HA 3NY5A 1FIQA 3DHGC 1UWXA 1TBEA 4WQOB 1B9RA 1K50A 3MJWA 2KDFB 3NVWA 3V61A 3WA0A 1ROEA 2KFKA 1RM6C 3ABVB 2C60A 3R66C 1WSPA 1VCBA 3KYDD 1AN8A 1E8ZA 4JX1C 2D07B 1VDVA 3BIID 3PRZA 4W9IA 1ZW7A 1YX6B 2YVCA 5BO4B 4HWIB 1LGRA 1C4PA 4C00A 1GB1A 2IYDB 3ZDMC 1HEZE 2DYBA 2Y5CA 4BBNC 1PGAA 2RR9A 1TKEA 1JW9D 1L0VB 2V3NA 4C56C 2AL6A 3Q8BA 2O6VB 4GOCA 5IKCM 4LTUA 4HDOA 2AWTA 5IO9A 5DPTA 4WWPA 1I4PA 1WMHA 1WRDB 1XO3A 1WI0A 2NPTB 1HTQA 3URYA 2BW2A 2MJEA 1WR1A 2DHZA 4XYCA 3B2FA 2CU3A 4NPNA 1N63A 4L1BA 4JWUC 5KHQA 4A20A 1L0YB 1WJUA 2KQ7A 1NENB 1HXYD 3L13A 2QILA 3APDA 4LNOA 1ZXIA 1C1YB 3TUOA 3VFKA 2ZVNA 3KWLA 2MP2B 4FN2A 4YWGG 2PKOA 3BK2A 4HKZE 2N7EA 1C78A 4C7ZA 2G4DB 3O13A 1TS5A 3MHZA 4PYUA 2M0AA 5AUIA 1D5XC 1Y56A 1NI2A 2GMIC 1CMXB 2QJLA 1JWAD 3VUXA 4NJ6A 1FO4A 4M02A 1M4VA 1MG8A 2KJ6A 3N20C 3A9JB 1E6EB 1ISNA 2KZRA 5EE0A 4I6PA 3OJ4B 3I3TB 2QMTA 1SIJA 2BQQA 1L5PA 3DWGC 1MG4A 1KFYB 2WXHA 3DBHI 4G3XB 2XK5A 4K7UA 1JQ4A 3DBHB 4US8A 2INCC 1D6EC 1XXGA 1PYWD 3V60A 2VRRB 3SDLC 1FEHA 5TSSA 3HVZA 3DQVA 5D3IB 4ZRPA 3UF8A 1FFUA 2LUEA 1YNTE 2ICIA 1KLUD 4B0EA 1OFFA 1E7UA 3NUHB 1P0RA 2M17A 2N7JA 4XWTA 1DOXA 2GBNA 3AE9B 4WJPA 3EA6A 2QIEB 3T9LA 1ZGUB 3TEYA 3NRZA 2WU5B 1J7BA 3OG5A 3KUDB 1FCLA 4L2YA 4IDIA 3L54A 1CK1A 1KLGD 2M19A 1JWSD 1WZ3A 2K8HA 1XLOA 2D3BA 2RGFA 2KXJA 3DHHC 1UGMA 3W2DA 3QIJA 1UZXB 2L8JA 3CMMB 3PZDA 3U30A 5G2NA 2QSDA 1E9MA 3GE8C 1WE7A 3A1QA 4ANVA 1LFDA 4N6EB 4XDCA 4KKIA 2K8BA 4ZDVA 2FIFA 1YD8U 3ZYYX 3W5UB 3ZJTA 3V6EB 4NQLB 3EGRA 1YQBA 3VH3B 1SXTA 1QQRA 1AW7A 3W9CB 2H88B 4II2B 3ZNGC 1JRUA 2ON8A 5G55A 4S17A 3QARA 1P1AA 4W9FA 4FHJA 1H8CA 1T5XD 2DAJA 2N9LA 3AMZA 1NBFC 2C7HA 1J7AA 3HRDD 4HPMB 2CHWA 2L52A 2MBQA 2WDTB 2MEKA 3VTVA 4B6WA 1ZDVA 5BYSA
chains in the Genus database with same CATH topology
3T8MA 4BVUC 4F1SA 4N9F4 4RM8A 3V6CB 5E6PA 3WAMA 3UQBA 3APFA 3A9KA 3QQ8B 2BGFA 5CHVC 5D6JB 3A4SC 5JZEB 3JYUA 3RULA 4G11A 3ZNHB 3AXCA 1SIFA 2ZCBA 1WIAA 3H9DA 4P7IA 4RM9A 2LI5A 2PE6B 3GZNI 2N4FA 4BKGA 1PQSA 4BOZB 2KLCA 3UQAA 2LVOA 4IC7B 1F9JA 1KM7A 5D94A 2IY1B 2LWPA 1FXTB 3DOWA 2IO3B 2LD9A 2UWQA 3H7SA 1WZ0A 2D11A 3ZKJC 4AJYB 4TQ1A 2L7RA 4RMAA 3EC8A 3ZO5B 4E74A 1P3QU 1H4RA 2FCQA 1I35A 1Q1OA 2PE9A 1EF5A 2KTRA 4GXBA 3WANA 1E8YA 1XQQA 3VTUA 2OJRA 3ALBA 2QHOA 3PREA 1YJ1A 3HM3A 1T0YA 4KZCA 4XC2A 4K1RB 4K7WA 3S2AA 1J8CA 1WM3A 5IA7A 4X57B 1WGRA 4XZ4A 2G45B 5DPSA 3B0AA 2MBOA 1P98A 4EKUA 1UD7A 2NR2A 1V6EA 3NOBA 2ZVOA 4K81A 3QC8B 1NDDA 3LDZE 4I6NB 1V5OA 2UYZB 4MJSB 2LZ6A 2L76A 4W9EA 5C23A 2B3AA 3PPAA 3R7QA 2PJHA 2LXAA 2PPHA 3NZSA 4W9HA 5AZFA 1L7YA 1Q5WB 4IWOA 4LJOB 5TR5A 1K8RB 1RRBA 3N30A 2JZZA 4MELA 4OVVA 2NBUA 4K7SA 3V62A 1WY8A 3PRPB 3CF6E 2LGDA 3PVLA 4DXAB 2L0TA 2DX5B 1IPGA 5JHAA 2CS4A 2IO2B 2MRPA 2N1WA 2A4ZA 4W9GA 4KSLC 4JIOU 3KYCD 4LCDE 1WE6A 3M62B 4W9KA 3AULA 2CHXA 1E90A 4F7ZA 4KZ0A 3H7PB 3TCAA 2K6DB 2REXA 3W1YA 4GMVA 4IG7B 2Z59B 4HVBA 2CU1A 2JVCA 4IWPA 5J18A 1WX7A 4EEWA 1WGHA 1WXMA 3R7RA 3PT2B 3PSEB 2KTFA 1RFAA 4EZJA 2O6VD 4MJSA 5E6NA 4W9CA 4FA6A 3PLUA 2KDIA 4ANWA 3VXWA 3U7DA 3L0WB 2G3QB 2RSUA 2XBBC 3DBSA 2J0JA 3O65B 2LGXA 2KC1A 3EHVA 1J0GA 2NVUI 1Z5SB 2WWZA 4JGHB 3X0WA 1UBIA 1YIWA 1IP9A 4PS3A 2ZCCA 2GOWA 2WX1A 1EO6A 4IWQA 3PS6A 4CHKA 1GC7A 3PLVA 1ZKHA 2OOBB 3UINB 3SD5A 2C5LC 2KQSA 1J19A 2KDEB 2JWZA 3H7PA 3SHQA 1TZ1A 3N3KB 2NS5A 1EF1A 4ANXA 2ZEQA 4KSKC 3TBLD 2BF8B 2GBRA 3CSTA 2BKFA 1OEYJ 3VDZA 2KTRB 2NBVB 3OAWA 4OVUA 3OLMD 3RCZA 3Q3JA 2KFKB 2LJ5A 4HXDA 2KX0A 4LDTB 4KV2A 4WJOA 2M1MA 4MM3A 1M94A 4CO7A 3ZIMA 3AI5A 2K8CA 4TUUA 4YL8A 3PHWB 4EZLA 4HLEA 1LXDA 1WR6E 2ZZPB 2KWCA 2EKEC 3EECA 5LXHA 1XD3B 3DVNU 4WAAA 5LXIB 2D2QA 1OTRB 4GU2A 5J2RA 4AJWA 2KVRA 2C7NB 2CR5A 3SU8X 2K39A 3UIPB 4HPLB 4J6IA 4G0NB 5JH5C 2MA9B 3ZVVA 2FAZA 2LASA 2FCNA 2DYMA 1WJNA 2BWES 4AUQC 2KWVB 2MWSB 2BYEA 1WXAA 3KVFB 3NY5A 1R4NI 2N7DA 2C9WB 3HK0A 3IG3A 1TBEA 4WQOB 2MQJA 2XEWA 2N9EB 3MJWA 3DBRI 2KDFB 1AARA 3PRMB 3V61A 1WXVA 2ZNVB 4HK2A 4WJNA 3WA0A 2MX2A 2KFKA 5AEKB 1WX9A 2IBIB 4PYZA 5L95C 2C60A 2KLGA 1SE9A 3ZRCA 3ONSA 3R66C 2BWFA 4NQKE 5CTRC 4BFRA 3BINA 3A33B 1VCBA 3KYDD 3DBLI 3N32A 1E8ZA 4FADA 1GG3A 3ML8A 3D32A 2D07B 3RZFA 2O2VA 1Q0WB 2V1YA 2FIDA 3PRZA 1WH3A 4TQ0A 3PV1A 4W9IA 2R2QA 1ZW7A 1YX6B 3GOEA 3DDCB 2LVPA 2YVCA 2R2OA 2JRHA 4MGKE 5BO4B 3Q3FA 4HWIB 2DYOA 2BYVE 4NY0A 3QWZB 4HCPB 4EOYA 5DPRA 1WGGA 4XX5A 2IYDB 3ECIA 3ZDMC 3QA8A 3B1LX 1SGHA 4DHZB 3TJPA 2RPQA 3L08A 2KFJA 4MGYE 4AP4C 4EUTA 2DYBA 2KJHB 2V4LA 2ASQA 2YLMA 1GJZA 2KWUB 1YX5B 3VQIA 4BBNC 2N9XA 1OEYA 3ZUNA 2MBBB 2RR9A 2KK8A 2ZPYA 3NHEB 4NAWB 5KHOA 2IZVB 2M4NA 2AL6A 2KOXA 2IO1B 1WX8A 2J0MA 3TMPB 4W9LA 2O6VB 4HDQA 3KUZA 3KW5B 4GOCA 1GNUA 1EUVB 2Z0DB 2MBEA 3ZRFA 4HDOA 2AWTA 2FNJB 4JQWC 3ZW3A 2LXCA 5DPTA 4WWPA 1WMHA 1WRDB 3P2BA 4BKTA 2DZIA 2I1JA 4GDLA 3VTWA 2NPTB 1WI0A 2KDBA 1G6JA 3RD2A 1IYFA 3MHSD 2L05A 5GMVA 2KANA 1R4MI 4MGIE 4FBJB 2K1FA 2I1KA 3HHMA 1WR1A 2DZMA 2DHZA 5AZHA 3ENEA 3HM6X 4NJ7A 2KKCA 1WXSA 3RZWC 4NPNA 3H1UA 1WFYA 4FHKA 3PHXB 5KHQA 4A20A 1WJUA 2KQ7A 3L13A 1L2NA 1S1QB 2BKRB 2LGYA 3APDA 5D2MB 4ICVA 3APCA 1A5RA 4IM3A 1C1YB 2K6QA 2KC2A 2ZNVC 3VFKA 2G4SA 1E8XA 2ZVNA 4NAWA 4WJQA 3ZLZA 3PGEA 4DK5A 2HD5B 2MP2B 2A5UA 3WAOA 4FN2A 3M63B 3TIXA 4E71A 2O6VA 5JHBA 1WGDA 4ZRIA 3B08A 1RLFA 3DCGA 3LJ3A 2N7EA 4MEMA 2XK5B 3UIOB 2C7MB 3QCAA 4BKSD 2G4DB 2M8SA 2LVQA 3ZDTA 4TKNA 3NS8A 2AYOB 4KIKA 5L83A 2BYFA 4MSQB 2L3ZA 2NPTA 3DVGY 2BPSA 4PYUA 2GMIC 1NI2A 4B95A 3JSVB 1CMXB 3VUXA 4DHZE 2JZ3B 4NJ6A 4TV3A 1VD2A 4B9KA 2MBHA 2O2VB 4IUMB 3TL5A 2MW5A 4JL9A 1V2YA 1XT9B 2JY6A 4DWFA 1MG8A 4GDKA 1WJ4A 4DDGD 2Y5BB 4DDID 2K25A 2KJ6A 3X23A 3VH4B 3A9JB 2N1VA 1ISNA 4GGQA 2N9PC 3QJZA 1KLVA 5LLIA 2KZRA 2RD0A 4I6PA 1I42A 1WGYA 3OJ4B 3I3TB 2GBKA 2L0FA 1V81A 3JW0X 5E6OA 2MP2A 4JLCA 3QHTA 1WF9A 1HE8A 4KDIC 4GN1A 3DBHI 2JT4B 2XK5A 3QAQA 4G3XB 4K7UA 4ASWC 4DHJD 3ML9A 2AEHA 5DCNA 1V49A 2Z0EB 2NCNA 3QK0A 3IBEA 3V60A 1UBQA 2VRRB 3SDLC 3VUWA 2GBMA 5AZGA 3JSVA 1TTNA 2KJRA 4EFOA 3BY4B 2CHZA 2L00B 3DQVA 4II3B 3OJ3A 2DZKA 3DVNV 3U8ZA 2J7QB 1WM2A 3RYTA 2DAFA 2GBJA 1U4AA 4AOFA 2JF5A 1RAXA 1WMHB 3UF8A 4A3PA 1V5TA 1Z2MA 3ZNZB 2LUEA 2J0KA 4GDLB 4AWJA 3PTFC 3A9JA 1E7UA 5CHWA 1P0RA 2M17A 4WWNA 3R3MA 4KVGB 3H6NA 5D7GA 3WIMA 2MLBA 3A1QB 2EMTA 4ZRKA 2KN5A 2GBNA 2NBWB 3K9OB 1E5WA 2HTHA 1BT0A 4FJVB 4WJPA 3A4RA 3DPDA 3T9LA 1ZGUB 4GIVA 5J17A 3RUIB 1GUAB 2LRWA 1TGZB 3CSFA 4W9JA 1GC6A 3VUYA 4URKA 5HKHA 3KUDB 2KD0A 3QX1A 1UH6A 5DPWA 3M3JA 5CHFA 3L54A 1UELA 1WZ3A 4M8NA 2K8HA 3WALA 1E8WA 2LRUA 1LQBA 1WYWB 4KIKB 4W9DA 2RGFA 2CKHB 3IFWB 4IM2A 2KXJA 3IVFA 1UGMA 2KMCA 4CYEA 4EZKA 2WX0A 3QIJA 1UZXB 1P9DU 2L8JA 3CMMB 3PZDA 4NNJB 3U30A 3VAWA 4FLHA 3L16A 3M95A 1V86A 1D3ZA 5G2NA 4FULA 3VHTC 2FCMA 2PEAA 4ZRJA 2EMSA 3IHPC 3EFUA 5CX3A 4ANVA 1WE7A 3A1QA 4MH0E 3WAPA 1LFDA 4GSWA 4GDKB 2D3GA 2WYQA 4I6LB 2K8BA 4IM0A 4ZDVA 2M0XA 3ZTDA 5C1ZA 1C3TA 1Y8RC 2FIFA 3HIZA 4MGZE 2W9NA 2DENB 3MTNB 4G50A 3W1SA 1WJ6A 4ANUA 4ICUA 2AL3A 4GB9A 4MDKE 2KO3A 3ZTCA 3RT3B 3VVWB 1E7VA 1YD8U 2FUHB 4PS8A 1V80A 5IAAC 4BOSC 1OGWA 4A3OA 4M0WB 3V6EB 3ZNID 4NQLB 4M8MA 2KMAA 4IW0A 4FJYA 3A9KB 1YQBA 3VH3B 2D10A 1V9JA 3NZUA 5FR6A 2ZPNA 3L10B 3AU4A 4HJKA 4II2B 5EDSA 2V3SA 3KUCB 3ZNGC 3JVZX 4FJZA 1KJTA 1QZEA 1JRUA 2JRIB 5G55A 4E3CA 4WWOA 2IY0B 3AU5A 3UGBB 3QARA 2JUOA 1P1AA 2FCSA 2ZJDA 2MCNB 3L17A 3K9PB 4W9FA 4FHJA 2HE7A 1H8CA 4DBGA 2DAJA 4PS7A 3DVGX 1LM8B 2KX3A 1NBFC 2MSED 2C7HA 4F8CB 4KDLB 2HJ8A 2CHWA 4HPMB 2KNBA 2KHWB 4HCNB 1KOTA 4LJPB 2IO0B 3KH0A 1S3SG 2MBQA 2WDTB 1OQYA 3C0RB 2JPHA 2JXXA 4ZYNA 3W1SC 4MSMB 2DZJA 4BBNF 3VTVA 4B6WA 1X1MA 4BKSA 4DHJB 4LDTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8M A;  4BVU C;  4F1S A;  4N9F 4;  4RM8 A;  3V6C B;  5E6P A;  3WAM A;  3UQB A;  3APF A;  3A9K A;  3QQ8 B;  2BGF A;  5CHV C;  5D6J B;  3A4S C;  5JZE B;  3JYU A;  3RUL A;  4G11 A;  3ZNH B;  3AXC A;  1SIF A;  2ZCB A;  1WIA A;  3H9D A;  4P7I A;  4RM9 A;  2LI5 A;  2PE6 B;  3GZN I;  2N4F A;  4BKG A;  1PQS A;  4BOZ B;  2KLC A;  3UQA A;  2LVO A;  4IC7 B;  1F9J A;  1KM7 A;  5D94 A;  2IY1 B;  2LWP A;  1FXT B;  3DOW A;  2IO3 B;  2LD9 A;  2UWQ A;  3H7S A;  1WZ0 A;  2D11 A;  3ZKJ C;  4AJY B;  4TQ1 A;  2L7R A;  4RMA A;  3EC8 A;  3ZO5 B;  4E74 A;  1P3Q U;  1H4R A;  2FCQ A;  1I35 A;  1Q1O A;  2PE9 A;  1EF5 A;  2KTR A;  4GXB A;  3WAN A;  1E8Y A;  1XQQ A;  3VTU A;  2OJR A;  3ALB A;  2QHO A;  3PRE A;  1YJ1 A;  3HM3 A;  1T0Y A;  4KZC A;  4XC2 A;  4K1R B;  4K7W A;  3S2A A;  1J8C A;  1WM3 A;  5IA7 A;  4X57 B;  1WGR A;  4XZ4 A;  2G45 B;  5DPS A;  3B0A A;  2MBO A;  1P98 A;  4EKU A;  1UD7 A;  2NR2 A;  1V6E A;  3NOB A;  2ZVO A;  4K81 A;  3QC8 B;  1NDD A;  3LDZ E;  4I6N B;  1V5O A;  2UYZ B;  4MJS B;  2LZ6 A;  2L76 A;  4W9E A;  5C23 A;  2B3A A;  3PPA A;  3R7Q A;  2PJH A;  2LXA A;  2PPH A;  3NZS A;  4W9H A;  5AZF A;  1L7Y A;  1Q5W B;  4IWO A;  4LJO B;  5TR5 A;  1K8R B;  1RRB A;  3N30 A;  2JZZ A;  4MEL A;  4OVV A;  2NBU A;  4K7S A;  3V62 A;  1WY8 A;  3PRP B;  3CF6 E;  2LGD A;  3PVL A;  4DXA B;  2L0T A;  2DX5 B;  1IPG A;  5JHA A;  2CS4 A;  2IO2 B;  2MRP A;  2N1W A;  2A4Z A;  4W9G A;  4KSL C;  4JIO U;  3KYC D;  4LCD E;  1WE6 A;  3M62 B;  4W9K A;  3AUL A;  2CHX A;  1E90 A;  4F7Z A;  4KZ0 A;  3H7P B;  3TCA A;  2K6D B;  2REX A;  3W1Y A;  4GMV A;  4IG7 B;  2Z59 B;  4HVB A;  2CU1 A;  2JVC A;  4IWP A;  5J18 A;  1WX7 A;  4EEW A;  1WGH A;  1WXM A;  3R7R A;  3PT2 B;  3PSE B;  2KTF A;  1RFA A;  4EZJ A;  2O6V D;  4MJS A;  5E6N A;  4W9C A;  4FA6 A;  3PLU A;  2KDI A;  4ANW A;  3VXW A;  3U7D A;  3L0W B;  2G3Q B;  2RSU A;  2XBB C;  3DBS A;  2J0J A;  3O65 B;  2LGX A;  2KC1 A;  3EHV A;  1J0G A;  2NVU I;  1Z5S B;  2WWZ A;  4JGH B;  3X0W A;  1UBI A;  1YIW A;  1IP9 A;  4PS3 A;  2ZCC A;  2GOW A;  2WX1 A;  1EO6 A;  4IWQ A;  3PS6 A;  4CHK A;  1GC7 A;  3PLV A;  1ZKH A;  2OOB B;  3UIN B;  3SD5 A;  2C5L C;  2KQS A;  1J19 A;  2KDE B;  2JWZ A;  3H7P A;  3SHQ A;  1TZ1 A;  3N3K B;  2NS5 A;  1EF1 A;  4ANX A;  2ZEQ A;  4KSK C;  3TBL D;  2BF8 B;  2GBR A;  3CST A;  2BKF A;  1OEY J;  3VDZ A;  2KTR B;  2NBV B;  3OAW A;  4OVU A;  3OLM D;  3RCZ A;  3Q3J A;  2KFK B;  2LJ5 A;  4HXD A;  2KX0 A;  4LDT B;  4KV2 A;  4WJO A;  2M1M A;  4MM3 A;  1M94 A;  4CO7 A;  3ZIM A;  3AI5 A;  2K8C A;  4TUU A;  4YL8 A;  3PHW B;  4EZL A;  4HLE A;  1LXD A;  1WR6 E;  2ZZP B;  2KWC A;  2EKE C;  3EEC A;  5LXH A;  1XD3 B;  3DVN U;  4WAA A;  5LXI B;  2D2Q A;  1OTR B;  4GU2 A;  5J2R A;  4AJW A;  2KVR A;  2C7N B;  2CR5 A;  3SU8 X;  2K39 A;  3UIP B;  4HPL B;  4J6I A;  4G0N B;  5JH5 C;  2MA9 B;  3ZVV A;  2FAZ A;  2LAS A;  2FCN A;  2DYM A;  1WJN A;  2BWE S;  4AUQ C;  2KWV B;  2MWS B;  2BYE A;  1WXA A;  3KVF B;  3NY5 A;  1R4N I;  2N7D A;  2C9W B;  3HK0 A;  3IG3 A;  1TBE A;  4WQO B;  2MQJ A;  2XEW A;  2N9E B;  3MJW A;  3DBR I;  2KDF B;  1AAR A;  3PRM B;  3V61 A;  1WXV A;  2ZNV B;  4HK2 A;  4WJN A;  3WA0 A;  2MX2 A;  2KFK A;  5AEK B;  1WX9 A;  2IBI B;  4PYZ A;  5L95 C;  2C60 A;  2KLG A;  1SE9 A;  3ZRC A;  3ONS A;  3R66 C;  2BWF A;  4NQK E;  5CTR C;  4BFR A;  3BIN A;  3A33 B;  1VCB A;  3KYD D;  3DBL I;  3N32 A;  1E8Z A;  4FAD A;  1GG3 A;  3ML8 A;  3D32 A;  2D07 B;  3RZF A;  2O2V A;  1Q0W B;  2V1Y A;  2FID A;  3PRZ A;  1WH3 A;  4TQ0 A;  3PV1 A;  4W9I A;  2R2Q A;  1ZW7 A;  1YX6 B;  3GOE A;  3DDC B;  2LVP A;  2YVC A;  2R2O A;  2JRH A;  4MGK E;  5BO4 B;  3Q3F A;  4HWI B;  2DYO A;  2BYV E;  4NY0 A;  3QWZ B;  4HCP B;  4EOY A;  5DPR A;  1WGG A;  4XX5 A;  2IYD B;  3ECI A;  3ZDM C;  3QA8 A;  3B1L X;  1SGH A;  4DHZ B;  3TJP A;  2RPQ A;  3L08 A;  2KFJ A;  4MGY E;  4AP4 C;  4EUT A;  2DYB A;  2KJH B;  2V4L A;  2ASQ A;  2YLM A;  1GJZ A;  2KWU B;  1YX5 B;  3VQI A;  4BBN C;  2N9X A;  1OEY A;  3ZUN A;  2MBB B;  2RR9 A;  2KK8 A;  2ZPY A;  3NHE B;  4NAW B;  5KHO A;  2IZV B;  2M4N A;  2AL6 A;  2KOX A;  2IO1 B;  1WX8 A;  2J0M A;  3TMP B;  4W9L A;  2O6V B;  4HDQ A;  3KUZ A;  3KW5 B;  4GOC A;  1GNU A;  1EUV B;  2Z0D B;  2MBE A;  3ZRF A;  4HDO A;  2AWT A;  2FNJ B;  4JQW C;  3ZW3 A;  2LXC A;  5DPT A;  4WWP A;  1WMH A;  1WRD B;  3P2B A;  4BKT A;  2DZI A;  2I1J A;  4GDL A;  3VTW A;  2NPT B;  1WI0 A;  2KDB A;  1G6J A;  3RD2 A;  1IYF A;  3MHS D;  2L05 A;  5GMV A;  2KAN A;  1R4M I;  4MGI E;  4FBJ B;  2K1F A;  2I1K A;  3HHM A;  1WR1 A;  2DZM A;  2DHZ A;  5AZH A;  3ENE A;  3HM6 X;  4NJ7 A;  2KKC A;  1WXS A;  3RZW C;  4NPN A;  3H1U A;  1WFY A;  4FHK A;  3PHX B;  5KHQ A;  4A20 A;  1WJU A;  2KQ7 A;  3L13 A;  1L2N A;  1S1Q B;  2BKR B;  2LGY A;  3APD A;  5D2M B;  4ICV A;  3APC A;  1A5R A;  4IM3 A;  1C1Y B;  2K6Q A;  2KC2 A;  2ZNV C;  3VFK A;  2G4S A;  1E8X A;  2ZVN A;  4NAW A;  4WJQ A;  3ZLZ A;  3PGE A;  4DK5 A;  2HD5 B;  2MP2 B;  2A5U A;  3WAO A;  4FN2 A;  3M63 B;  3TIX A;  4E71 A;  2O6V A;  5JHB A;  1WGD A;  4ZRI A;  3B08 A;  1RLF A;  3DCG A;  3LJ3 A;  2N7E A;  4MEM A;  2XK5 B;  3UIO B;  2C7M B;  3QCA A;  4BKS D;  2G4D B;  2M8S A;  2LVQ A;  3ZDT A;  4TKN A;  3NS8 A;  2AYO B;  4KIK A;  5L83 A;  2BYF A;  4MSQ B;  2L3Z A;  2NPT A;  3DVG Y;  2BPS A;  4PYU A;  2GMI C;  1NI2 A;  4B95 A;  3JSV B;  1CMX B;  3VUX A;  4DHZ E;  2JZ3 B;  4NJ6 A;  4TV3 A;  1VD2 A;  4B9K A;  2MBH A;  2O2V B;  4IUM B;  3TL5 A;  2MW5 A;  4JL9 A;  1V2Y A;  1XT9 B;  2JY6 A;  4DWF A;  1MG8 A;  4GDK A;  1WJ4 A;  4DDG D;  2Y5B B;  4DDI D;  2K25 A;  2KJ6 A;  3X23 A;  3VH4 B;  3A9J B;  2N1V A;  1ISN A;  4GGQ A;  2N9P C;  3QJZ A;  1KLV A;  5LLI A;  2KZR A;  2RD0 A;  4I6P A;  1I42 A;  1WGY A;  3OJ4 B;  3I3T B;  2GBK A;  2L0F A;  1V81 A;  3JW0 X;  5E6O A;  2MP2 A;  4JLC A;  3QHT A;  1WF9 A;  1HE8 A;  4KDI C;  4GN1 A;  3DBH I;  2JT4 B;  2XK5 A;  3QAQ A;  4G3X B;  4K7U A;  4ASW C;  4DHJ D;  3ML9 A;  2AEH A;  5DCN A;  1V49 A;  2Z0E B;  2NCN A;  3QK0 A;  3IBE A;  3V60 A;  1UBQ A;  2VRR B;  3SDL C;  3VUW A;  2GBM A;  5AZG A;  3JSV A;  1TTN A;  2KJR A;  4EFO A;  3BY4 B;  2CHZ A;  2L00 B;  3DQV A;  4II3 B;  3OJ3 A;  2DZK A;  3DVN V;  3U8Z A;  2J7Q B;  1WM2 A;  3RYT A;  2DAF A;  2GBJ A;  1U4A A;  4AOF A;  2JF5 A;  1RAX A;  1WMH B;  3UF8 A;  4A3P A;  1V5T A;  1Z2M A;  3ZNZ B;  2LUE A;  2J0K A;  4GDL B;  4AWJ A;  3PTF C;  3A9J A;  1E7U A;  5CHW A;  1P0R A;  2M17 A;  4WWN A;  3R3M A;  4KVG B;  3H6N A;  5D7G A;  3WIM A;  2MLB A;  3A1Q B;  2EMT A;  4ZRK A;  2KN5 A;  2GBN A;  2NBW B;  3K9O B;  1E5W A;  2HTH A;  1BT0 A;  4FJV B;  4WJP A;  3A4R A;  3DPD A;  3T9L A;  1ZGU B;  4GIV A;  5J17 A;  3RUI B;  1GUA B;  2LRW A;  1TGZ B;  3CSF A;  4W9J A;  1GC6 A;  3VUY A;  4URK A;  5HKH A;  3KUD B;  2KD0 A;  3QX1 A;  1UH6 A;  5DPW A;  3M3J A;  5CHF A;  3L54 A;  1UEL A;  1WZ3 A;  4M8N A;  2K8H A;  3WAL A;  1E8W A;  2LRU A;  1LQB A;  1WYW B;  4KIK B;  4W9D A;  2RGF A;  2CKH B;  3IFW B;  4IM2 A;  2KXJ A;  3IVF A;  1UGM A;  2KMC A;  4CYE A;  4EZK A;  2WX0 A;  3QIJ A;  1UZX B;  1P9D U;  2L8J A;  3CMM B;  3PZD A;  4NNJ B;  3U30 A;  3VAW A;  4FLH A;  3L16 A;  3M95 A;  1V86 A;  1D3Z A;  5G2N A;  4FUL A;  3VHT C;  2FCM A;  2PEA A;  4ZRJ A;  2EMS A;  3IHP C;  3EFU A;  5CX3 A;  4ANV A;  1WE7 A;  3A1Q A;  4MH0 E;  3WAP A;  1LFD A;  4GSW A;  4GDK B;  2D3G A;  2WYQ A;  4I6L B;  2K8B A;  4IM0 A;  4ZDV A;  2M0X A;  3ZTD A;  5C1Z A;  1C3T A;  1Y8R C;  2FIF A;  3HIZ A;  4MGZ E;  2W9N A;  2DEN B;  3MTN B;  4G50 A;  3W1S A;  1WJ6 A;  4ANU A;  4ICU A;  2AL3 A;  4GB9 A;  4MDK E;  2KO3 A;  3ZTC A;  3RT3 B;  3VVW B;  1E7V A;  1YD8 U;  2FUH B;  4PS8 A;  1V80 A;  5IAA C;  4BOS C;  1OGW A;  4A3O A;  4M0W B;  3V6E B;  3ZNI D;  4NQL B;  4M8M A;  2KMA A;  4IW0 A;  4FJY A;  3A9K B;  1YQB A;  3VH3 B;  2D10 A;  1V9J A;  3NZU A;  5FR6 A;  2ZPN A;  3L10 B;  3AU4 A;  4HJK A;  4II2 B;  5EDS A;  2V3S A;  3KUC B;  3ZNG C;  3JVZ X;  4FJZ A;  1KJT A;  1QZE A;  1JRU A;  2JRI B;  5G55 A;  4E3C A;  4WWO A;  2IY0 B;  3AU5 A;  3UGB B;  3QAR A;  2JUO A;  1P1A A;  2FCS A;  2ZJD A;  2MCN B;  3L17 A;  3K9P B;  4W9F A;  4FHJ A;  2HE7 A;  1H8C A;  4DBG A;  2DAJ A;  4PS7 A;  3DVG X;  1LM8 B;  2KX3 A;  1NBF C;  2MSE D;  2C7H A;  4F8C B;  4KDL B;  2HJ8 A;  2CHW A;  4HPM B;  2KNB A;  2KHW B;  4HCN B;  1KOT A;  4LJP B;  2IO0 B;  3KH0 A;  1S3S G;  2MBQ A;  2WDT B;  1OQY A;  3C0R B;  2JPH A;  2JXX A;  4ZYN A;  3W1S C;  4MSM B;  2DZJ A;  4BBN F;  3VTV A;  4B6W A;  1X1M A;  4BKS A;  4DHJ B;  4LDT D; 
#chains in the Genus database with same CATH topology
 4BVU C;  4M0W A;  3RNF C;  4N9F 4;  1IGD A;  1OQR A;  3QQ8 B;  3JYU A;  4LNF A;  1ZE3 D;  4P7I A;  1ET9 A;  1PQS A;  3NVV A;  2KLC A;  3EFC A;  4IC7 B;  2LWP A;  1FXT B;  3DOW A;  2IO3 B;  4RMA A;  2J52 A;  1I35 A;  2OJR A;  3ALB A;  5IP4 D;  3HM3 A;  5HFY A;  4A55 A;  1UWM A;  4X57 B;  3B0A A;  1P98 A;  1NDD A;  3IT6 B;  3NVZ A;  2L76 A;  3I57 A;  1EWY C;  2LXA A;  3ZXV A;  2N0S B;  4OZA A;  5TR5 A;  4XWW A;  2PIA A;  1RRB A;  4BZA A;  4K7S A;  4DXA B;  2LGD A;  2LMC A;  4KSL C;  4KX6 B;  3H7P B;  3IT4 B;  2BB6 A;  3W1Y A;  2JYT A;  3RNC C;  2Z59 B;  2CU1 A;  2JVC A;  4HRS A;  3PT2 B;  2WDV B;  2O6V D;  4MJS A;  2OED A;  4K3B A;  1MHX A;  5BYR A;  2G3Q B;  5IOI A;  3NS1 A;  4N59 A;  1QIL A;  5GXG B;  1PFD A;  2Y3A A;  4PS3 A;  1AWD A;  4KGT A;  4RFB A;  4IWQ A;  4WQM A;  1RYJ A;  1ZKH A;  2IPK D;  3B9J A;  1NI3 A;  2KDE B;  2JWZ A;  1EM7 A;  3BVM A;  3KQ4 A;  3N3K B;  2BF8 B;  4MT5 A;  1UGJ A;  3BYT B;  2JU6 X;  3VDZ A;  2KTR B;  2NBV B;  3OAW A;  3RCZ A;  2KFK B;  2LJ5 A;  3ZQ4 A;  2KX0 A;  4KV2 A;  1M94 A;  4LNN A;  3AI5 A;  4TUU A;  1UF0 A;  3ZIM A;  1BUI C;  5G5G A;  5E6J A;  1KRH A;  3EEC A;  4WAA A;  1OTR B;  2C7N B;  1JRP A;  2K39 A;  1AYF A;  3AM9 A;  5JH5 C;  4OW0 A;  3ZVV A;  2FAZ A;  1KH0 A;  3AEC B;  2KWV B;  2BYE A;  1WXA A;  3HK0 A;  2AQ2 B;  1E7P B;  3Q69 A;  1AAR A;  3PRM B;  3ZGZ A;  2V4I B;  3EUB 2;  5T8I A;  1SE9 A;  3ZRC A;  3ONS A;  3P4S B;  4BFR A;  1BXT A;  2HDE A;  3D32 A;  3HUI A;  2O2V A;  2V1Y A;  4P1B C;  3PV1 A;  1N5W A;  3GOE A;  3FAH A;  2IJ0 A;  3N1Z C;  2R2O A;  2BYV E;  2TSS A;  4TSS A;  4C80 A;  2L32 A;  3B1L X;  1SGH A;  4DHZ B;  1IGC A;  3L08 A;  4WH4 A;  2V4L A;  2KJH B;  2ASQ A;  1GJZ A;  1YX5 B;  3VQI A;  1ZXH A;  2K0P A;  2K5P A;  3TMP B;  4HDQ A;  2EEL A;  3KW5 B;  1GNU A;  2MJ3 A;  3ZRF A;  2FNJ B;  4JQW C;  3TEZ A;  3C8Y A;  2W3S A;  4MM3 B;  1YQ4 B;  3P2B A;  2DZI A;  4GDL A;  3VTW A;  4OZC A;  1G6J A;  3AE1 B;  3MHS D;  2L05 A;  2INP E;  2DZM A;  4ZYS A;  3BZD B;  1WXS A;  2W55 A;  1C9F A;  4REZ A;  2BKR B;  2LGY A;  2IDY A;  3VR8 B;  1XLP A;  4IM3 A;  3VRB B;  3PGE A;  3BWU D;  3I5J C;  3TIX A;  2E3T A;  5JHB A;  1WGD A;  3MP9 A;  3R2I A;  4RH6 A;  3DCG A;  3LJ3 A;  2XK5 B;  3UIO B;  2C7M B;  3IXS A;  4S0R A;  2M8S A;  3AE3 B;  2W3R A;  4TKN A;  2AYO B;  4KIK A;  1N62 A;  4MSQ B;  1UNS A;  2WDR B;  3R2T A;  2ZW0 A;  3Q6B A;  4XDD A;  2K9X A;  3DVG Y;  2BPS A;  3AE7 B;  4DHZ E;  1T0S C;  2L83 A;  2MW5 A;  1V2Y A;  3AE5 B;  2HTM E;  1QOB A;  4GDK A;  2K25 A;  2N1V A;  4NJC A;  4DQO C;  2RD0 A;  3GB1 A;  1WGY A;  4IOI E;  1I42 A;  2L0F A;  2ONQ A;  1YMH E;  3P42 A;  1K53 A;  3V3X A;  4KDI C;  4ASW C;  2JT4 B;  3ML9 A;  5DCN A;  3UI3 A;  2Z0E B;  1XCT L;  4LNI A;  3QK0 A;  2JWU A;  3BYY B;  3IBE A;  2QC8 A;  4RGN A;  1V1P A;  3U52 E;  3JSV A;  2KJR A;  1FRD A;  4II3 B;  2BYT A;  2DZK A;  2J7Q B;  1U4A A;  3MC8 A;  1FNW A;  2JF5 A;  1RAX A;  4A3P A;  5CHW A;  3AEF B;  4HKQ A;  1N6Z A;  4KVG B;  5D7G A;  2B76 B;  3A1Q B;  4WUR A;  2NBW B;  1ET6 A;  1JWM D;  1JML A;  1BT0 A;  3U2S C;  1I4Q A;  2DWQ A;  2WGS A;  3DPD A;  5J17 A;  5I4D A;  2KYW A;  3VUY A;  4DXF A;  1PGX A;  3SEB A;  2KD0 A;  5DPW A;  3M3J A;  3PO0 A;  4XE0 A;  1UEL A;  4US9 A;  1E8W A;  2H89 B;  2XN9 C;  1LQB A;  2Z8L A;  3IFW B;  1DGJ A;  3IVF A;  1D3Z A;  4FLH A;  4P6V F;  2V3P A;  3EFU A;  5CX3 A;  5HG2 A;  4MH0 E;  2BS4 B;  3ZTD A;  5C1Z A;  3HIZ A;  1KTK A;  2W9N A;  4G50 A;  3W1S A;  4ANU A;  4MDK E;  2KO3 A;  2VH2 A;  1MI0 A;  2WDQ B;  1F1H A;  1E7V A;  1FMA D;  5FKA C;  4M0W B;  3ZNI D;  1TJE A;  4M8M A;  1ZUD 2;  2D3A A;  4FJY A;  2ZW1 A;  1FM0 D;  5FR6 A;  2DBY A;  4HJK A;  3KUC B;  1KJT A;  5JXV A;  2JRI B;  4E3C A;  1ENF A;  2E6X A;  3TEW A;  1FXI A;  1F52 A;  3MC0 B;  4YSY B;  2KNB A;  1KOT A;  1MPE A;  3W1S C;  5H92 C;  2DZJ A;  4BBN F;  1X1M A;  4BKS A;  4DHJ B;  3T8M A;  1ZDX A;  2PVO D;  3B2G A;  3Q3M C;  4ZHO A;  3UQB A;  5D6J B;  3RMK C;  5JZE B;  1VZ7 A;  3ZNH B;  3AEB B;  1SIF A;  1HZ6 A;  2ZCB A;  4RM9 A;  4BOZ B;  3UQA A;  1F9J A;  1KM7 A;  1IUE A;  2LD9 A;  1N61 A;  2D11 A;  4AJY B;  4E74 A;  1Q1O A;  2PE9 A;  2WXR A;  4GXB A;  1XQQ A;  3VTU A;  2WXN A;  3FIL A;  4A6Q A;  1T0Y A;  2WS3 B;  3CIR B;  4K7W A;  1CQV A;  3Q8F A;  1WRI A;  2MBO A;  3RNE C;  4EKU A;  1UD7 A;  1V6E A;  4K81 A;  4RGT A;  3QC8 B;  1E0Z A;  2K22 A;  4MJS B;  4HPP A;  4W9E A;  2PJH A;  2PPH A;  4W9H A;  1K8R B;  3N30 A;  2KAC A;  2Q5W D;  3CF6 E;  3PZ7 A;  1TT5 B;  2DX5 B;  1IPG A;  5JHA A;  2A4Z A;  3AEG B;  3AEA B;  3M62 B;  3AUL A;  2CHX A;  1E90 A;  4F7Z A;  3Q8E A;  1FNV A;  3FKY A;  4GMV A;  1HZ5 A;  2CJN A;  2WQY B;  3BVZ A;  1KF6 B;  1TYG B;  1FCC C;  4WIP A;  3Q3O C;  2RSU A;  2WXK A;  2LGX A;  5FK9 C;  2WWZ A;  3T3N A;  1EO6 A;  3E56 A;  1GC7 A;  3SD5 A;  1F2R C;  1J19 A;  3SHQ A;  3IAM 1;  1EF1 A;  4ANX A;  3TBL D;  2DNF A;  2GBR A;  4XGA B;  1OEY J;  1F77 A;  3OLM D;  2KDM A;  2WNM A;  2PW9 A;  2WXQ A;  1FPY A;  5C3J B;  3NG0 A;  4YL8 A;  4HEA 1;  4HLE A;  1LXD A;  1WR6 E;  2ZZP B;  2J53 A;  2KWC A;  2V0G A;  1YN4 A;  2WU2 B;  3AEE B;  3DVN U;  5LXI B;  4GU2 A;  4OHJ A;  4YSX B;  3UIP B;  3AN1 A;  4G0N B;  4QAY A;  2LAS A;  4RNA A;  2DYM A;  1WJN A;  2BWE S;  3GS2 A;  3KVF B;  1CZP A;  1R4N I;  1R4N B;  3RNG C;  2C9W B;  1WGK A;  2MQJ A;  1XLN A;  1R7S A;  4R3D A;  4WJN A;  4HK2 A;  5AEK B;  4EE2 A;  1VZ6 A;  1WX9 A;  5L95 C;  3MFG A;  2KLG A;  1VJK A;  4NQK E;  5CTR C;  1VRA B;  4FAD A;  1GG3 A;  3ML8 A;  1VZ8 A;  1QF6 A;  1I4G A;  2FID A;  1WH3 A;  1B1Z A;  2J4X A;  2ACZ B;  3DDC B;  2LVP A;  3H8H A;  4PT5 A;  2I2Y A;  2DYO A;  1GAQ B;  4EOY A;  3P4P B;  5D3D A;  5DPR A;  1WGG A;  3TJP A;  1UUP A;  3RNA C;  2YLM A;  2KWU B;  1DOY A;  1OEY A;  2XNA C;  2ZPY A;  1LO5 D;  2IZV B;  2M4N A;  1WX8 A;  3WCQ A;  2Z0D B;  3CWI A;  3ZW3 A;  1GPX A;  2LHE A;  1HA5 A;  3Q3N C;  3AED B;  3RD2 A;  4Q2J A;  5GMV A;  2KAN A;  4FBJ B;  2K1F A;  2I1K A;  4MAC A;  2IGG A;  5AZH A;  2LHD A;  3ENE A;  3RZW C;  2D5G A;  1K52 A;  2UU7 A;  3PHX B;  1PUT A;  1RWS A;  1L2N A;  5D2M B;  4ICV A;  1A5R A;  2ZNV C;  2RDH A;  2G4S A;  4NAW A;  4WJQ A;  3ZLZ A;  2HD5 B;  2A5U A;  2JX5 A;  4E71 A;  1D5Z C;  4ZRI A;  3B08 A;  4RF0 A;  3ZDT A;  2L3Z A;  4B95 A;  3JSV B;  4TV3 A;  4B9K A;  4IUM B;  1VLB A;  3TL5 A;  4JL9 A;  2INN E;  4HJG E;  2DLB A;  2Y5B B;  3SR6 A;  1L6U A;  2LFI A;  3KWV A;  2FBW B;  1QOG A;  3VH4 B;  4GGQ A;  2N9P C;  2BB5 A;  1KLV A;  1XF5 L;  2KVZ A;  4ZHP A;  3P4Q B;  2GBK A;  2YEP F;  4JLC A;  2K3U A;  3QHT A;  3LYY A;  4B0M A;  1HE8 A;  4GN1 A;  1QLB B;  2GLS A;  4DHJ D;  1Q10 A;  1TIF A;  2AQ3 B;  2KT7 A;  4YTP B;  1YJI A;  2D3C A;  1L0X B;  3MC9 A;  1UBQ A;  3VUW A;  4A8X C;  1TTN A;  3BY4 B;  2CHZ A;  2L00 B;  2KMM A;  1YJJ A;  4JE3 B;  3DVN V;  3U8Z A;  1WM2 A;  2DAF A;  2GBJ A;  3N9Y C;  1WMH B;  4H2A A;  1V5T A;  4AWJ A;  2VZK B;  4WWN A;  2PMV A;  3H6N A;  1IBX A;  3WIM A;  3MJ5 A;  2MLB A;  2EMT A;  2MJD A;  4ZRK A;  3K9O B;  1E5W A;  4D2K A;  4FJV B;  3NJT A;  3AV8 A;  2PTL A;  3L4P A;  1QKZ A;  3CSF A;  1ZPS A;  4N58 A;  2JZP A;  4URK A;  2SAK A;  1QT9 A;  5CHF A;  2CKH B;  4IM2 A;  4CYE A;  2KMC A;  4EZK A;  2WX0 A;  4NNJ B;  3VAW A;  1RFK A;  1SE4 A;  3M95 A;  1JRO A;  1TY0 A;  2PEA A;  3IHP C;  1SE3 A;  1ZP0 B;  4GSW A;  2D3G A;  2WYQ A;  4ITK A;  4YTM B;  4IM0 A;  1C3T A;  2BS2 B;  3MTN B;  1I4R A;  1DOI A;  2PLP A;  1WJ6 A;  4ICU A;  2AL3 A;  1SF0 A;  1V80 A;  5IAA C;  3ZJU A;  1OGW A;  2WXG A;  4IW0 A;  4PK1 A;  4ACF A;  1V9J A;  3NZU A;  3L10 B;  3AU4 A;  3LXF A;  3P63 A;  2LJI A;  3JVZ X;  3R8B A;  1QZE A;  4WWO A;  1CJE A;  1MHH E;  4M00 A;  2GRI A;  3BVG A;  1EWC A;  2JUO A;  2FCS A;  2MCN B;  2FE8 A;  3L17 A;  4PS7 A;  1LM8 B;  4F8C B;  4CQN A;  3FIL B;  5BMG A;  2KHW B;  4HCN B;  3KH0 A;  1DYQ A;  1S3S G;  3J9C A;  1OQY A;  3C0R B;  2JPH A;  4ZYN A;  1D4B A;  4MSM B;  1EU4 A;  1T3Q A;  4ARI A;  4KGS A;  4RM8 A;  5E6P A;  3WAM A;  5CHV C;  3A9K A;  2BBC A;  2BGF A;  3E9S A;  2JQR B;  3A4S C;  2GB1 A;  3VRA B;  4GLS C;  4G11 A;  3AXC A;  3H9D A;  1JAL A;  2LI5 A;  2PE6 B;  2N4F A;  2LVO A;  2UWQ A;  3U7Z A;  3ZKJ C;  2L7R A;  3ZO5 B;  3EC8 A;  2FCQ A;  1H4R A;  1F2R I;  1TKG A;  1EF5 A;  2KTR A;  5EE9 A;  3PRE A;  4XC2 A;  3N1Y C;  2IND C;  4K1R B;  3S2A A;  1J8C A;  4RF1 A;  1WGR A;  4XZ4 A;  5BMI A;  2G45 B;  2NR2 A;  3NOB A;  4L23 A;  1D5M C;  2LZ6 A;  3R7Q A;  4C4V A;  5AZF A;  1L7Y A;  1Q5W B;  3RN9 C;  4P16 A;  3AE4 B;  2JZZ A;  3V62 A;  1WY8 A;  2VH1 A;  3Q2A C;  4LNK A;  2CS4 A;  2IO2 B;  1TS3 A;  2N1W A;  3I9V 1;  4W9G A;  4JIO U;  3KYC D;  4LCD E;  4W9K A;  1ZOY B;  4FXC A;  4KZ0 A;  3TCA A;  3W5V B;  2K6D B;  2HJ1 A;  2JYE A;  1I4X A;  2PVG C;  4HVB A;  2NMQ A;  1WX7 A;  4EEW A;  3NZ3 A;  1ACC A;  1WGH A;  1PGB A;  4RCO A;  3R7R A;  3PSE B;  3SFE B;  1RFA A;  4EZJ A;  5E6N A;  4W9C A;  2KDI A;  2KQ4 X;  4JPS A;  2J0J A;  3EHV A;  4JGH B;  1SBB B;  4IKG A;  1P7F A;  1UBI A;  1YIW A;  3KLS X;  1J7C A;  3P4R B;  4RGM A;  2NTS A;  1SE2 A;  2WX1 A;  4LK0 M;  3PS6 A;  2C5L C;  2KQS A;  1TZ1 A;  1I7H A;  2NS5 A;  4KSK C;  1P7E A;  1GB4 A;  2YEP B;  4YXD B;  1HQR D;  2LEK A;  4KKJ A;  5AUK A;  3Q3J A;  4LDT B;  2BS3 B;  3V05 A;  3P1M A;  4WJO A;  4MM3 A;  4CO7 A;  2RDB C;  4EZL A;  2K8C A;  3IAS 1;  3TSS A;  2D2Q A;  4AJW A;  1NEK B;  2X8X X;  4J6I A;  3N1X C;  4YSZ B;  2JSV X;  4AUQ C;  5BMH A;  4J3O D;  2N7D A;  3IG3 A;  2XEW A;  2RDG A;  2N9E B;  3DBR I;  3DBR B;  1L4D B;  1WXV A;  2ZNV B;  2MX2 A;  1L4Z B;  2IBI B;  3RFZ B;  4PYZ A;  4LLG M;  2QEJ C;  2FUG 1;  3I63 C;  2BWF A;  3BIN A;  5EE3 A;  1YN5 A;  3A33 B;  3DBL I;  3N32 A;  3DBL B;  3RZF A;  2W82 A;  1Q0W B;  1MFW A;  4TQ0 A;  2R2Q A;  2JRH A;  4MGK E;  3Q3F A;  4NY0 A;  1TS4 A;  4ARC A;  3QWZ B;  4HCP B;  4WWM A;  2VZK D;  4XX5 A;  3ECI A;  3QA8 A;  5HHD G;  1EU3 A;  2RPQ A;  1FNU A;  2KFJ A;  4MGY E;  1C4C A;  2BVC A;  4AP4 C;  4EUT A;  4KGR A;  1MJD A;  2N9X A;  4O1N A;  3ZUN A;  2MBB B;  2KK8 A;  3NHE B;  4NAW B;  5KHO A;  3RNB C;  2KOX A;  2IO1 B;  2KWD A;  2J0M A;  4W9L A;  3KUZ A;  2G1E A;  1EUV B;  4TMA B;  2MBE A;  2GI9 A;  1WWT A;  2LXC A;  2SEB D;  4BKT A;  2I1J A;  4ZOH C;  2KDB A;  1IYF A;  1SJE D;  3AE8 B;  1STE A;  1R4M I;  4MGI E;  1R4M B;  3HHM A;  3HM6 X;  4NJ7 A;  2KKC A;  3H1U A;  1WFY A;  3FC4 A;  4FHK A;  2X38 A;  1JCK B;  1S1Q B;  3APC A;  1PDX A;  2K6Q A;  2KC2 A;  1E8X A;  4DK5 A;  3WAO A;  1XLQ A;  3M63 B;  2O6V A;  1RLF A;  4MEM A;  1SSN A;  3DWM A;  3QCA A;  4BKS D;  2LVQ A;  3NS8 A;  3ZJV A;  5L83 A;  2BYF A;  2NPT A;  2WXP A;  2WXF A;  4RGO S;  2JZ3 B;  1VD2 A;  2MBH A;  2O2V B;  4DWF A;  1XT9 B;  2JY6 A;  1WJ4 A;  4DDG D;  4DDI D;  1YQ3 B;  2MHJ A;  3X23 A;  4NZL B;  1A70 A;  3QJZ A;  1SEB D;  5LLI A;  5MPO A;  1TZO A;  1IBX B;  1FRR A;  2WXI A;  1V81 A;  3JW0 X;  5E6O A;  2MP2 A;  2MH7 A;  4C7Y A;  1WF9 A;  5HI1 A;  3OWE B;  1C77 A;  3QAQ A;  4OVZ A;  2AEH A;  1V49 A;  2NCN A;  1N5X A;  3AE2 B;  2GBM A;  5AZG A;  4EFO A;  4AQ7 A;  1V8C A;  2N9K A;  3GP7 A;  5EE1 A;  3OJ3 A;  4M01 A;  3RYT A;  2JXT A;  1YOV B;  1C79 A;  4AOF A;  1Z2M A;  3ZNZ B;  4GDL B;  2J0K A;  5FR3 A;  3PTF C;  3AE6 B;  3A9J A;  2CJO A;  2R61 A;  3R3M A;  2OHF A;  2LUM A;  2KN5 A;  2Y5P A;  2HTH A;  3A4R A;  4GIV A;  3RUI B;  1BML C;  3HVD A;  1GUA B;  2KN4 A;  1QOA A;  2LRW A;  1TGZ B;  1XEE A;  4W9J A;  2WXM A;  1N60 A;  1GC6 A;  4NAM A;  5HKH A;  4A90 A;  2IGH A;  3QX1 A;  2LGS A;  1UH6 A;  5BYQ A;  5IN7 A;  2J42 A;  4M8N A;  2WXO A;  3WAL A;  2LRU A;  1WYW B;  4KIK B;  4W9D A;  1E10 A;  4BAX A;  1P9D U;  1K51 A;  3L16 A;  1V86 A;  4FUL A;  3VHT C;  2FCM A;  3AB5 A;  4ZRJ A;  2EMS A;  3TEX A;  3WAP A;  1V1O A;  4GDK B;  2IGD A;  4I6L B;  3VR9 B;  2M0X A;  1Y8R C;  1F0Z A;  4MGZ E;  2DEN B;  5LNK 1;  1OQQ A;  4GB9 A;  3ZTC A;  3RT3 B;  1MVK A;  3VVW B;  2FUH B;  4PS8 A;  4BOS C;  4A3O A;  4YT0 B;  2KMA A;  2WHI A;  2NTT A;  3A9K B;  1JWB D;  1FD6 A;  2D10 A;  1NYQ A;  2ZPN A;  3ETR A;  5EDS A;  2V3S A;  2RPV A;  4FJZ A;  1V1P B;  2IY0 B;  3AU5 A;  3UGB B;  3T3O A;  2ZJD A;  3K9P B;  2HE7 A;  1T6B X;  4DBG A;  3Q8A A;  3NVY A;  3DVG X;  2KX3 A;  1WYG A;  2MSE D;  2KAJ A;  4KDL B;  2EKI A;  2HJ8 A;  4AS1 A;  1TS2 A;  2IO0 B;  4LJP B;  2JXX A;  1TKY A;  4LDT D;  3U4E G;  1SB3 C;  4F1S A;  3V6C B;  4HRO A;  3APF A;  1V97 A;  3RUL A;  1NYR A;  4JWS C;  2L1A A;  4C4V B;  4K3C A;  1GOZ A;  1WIA A;  2QDF A;  3GZN I;  4BKG A;  3GZN B;  5D94 A;  2IY1 B;  1C76 A;  3H7S A;  1WZ0 A;  4TQ1 A;  4P1C C;  1P3Q U;  3WAN A;  1E8Y A;  4WAF A;  4YTN B;  1C4A A;  2QHO A;  1YJ1 A;  4DXG A;  4KZC A;  2RMM A;  1WM3 A;  3DHI C;  1SJH D;  5IA7 A;  4UDU C;  1HTO A;  5DPS A;  5G5H A;  2ZVO A;  3LDZ E;  4I6N B;  1V5O A;  2UYZ B;  4ZRQ A;  5C23 A;  2B3A A;  3PPA A;  1YN3 A;  3NZS A;  1VR9 A;  4IWO A;  2W54 A;  4LJO B;  5H8Y E;  4MEL A;  4OVV A;  2NBU A;  3PRP B;  3PVL A;  2L0T A;  2MRP A;  3SFD B;  1WE6 A;  1QOF A;  2REX A;  4IG7 B;  1FFV A;  4IWP A;  2G9H D;  5J18 A;  1WXM A;  3C19 A;  2KTF A;  2I38 A;  4A9A A;  2LGI A;  4FA6 A;  3PLU A;  4ANW A;  3Q14 C;  3GE3 C;  2OJW A;  3VXW A;  3U7D A;  3L0W B;  2XBB C;  3DBS A;  3RPF C;  3O65 B;  2KC1 A;  1J0G A;  2NVU I;  1Z5S B;  3LB8 C;  3X0W A;  2BTE A;  1IP9 A;  2ZCC A;  2GOW A;  3ZXR A;  4CHK A;  3PLV A;  2OOB B;  3UIN B;  3RI7 C;  3Q8C A;  2AX5 A;  3H7P A;  2V9H A;  5C2T B;  2ZEQ A;  3CST A;  2BKF A;  2AQ1 B;  3PZ8 A;  1TY2 A;  4OVU A;  4HXD A;  2WXJ A;  3BK1 A;  2M56 B;  2M1M A;  2WLB A;  1JWU D;  3PHW B;  1T0Q C;  3AH7 A;  1XCQ L;  2EKE C;  1FXA A;  2QCZ A;  1L6V A;  5LXH A;  1XD3 B;  2WP9 B;  5J2R A;  2KVR A;  2CR5 A;  3SU8 X;  4MH8 A;  4HPL B;  1NVI D;  2MA9 B;  4OZB A;  1T0R C;  2FCN A;  4USA A;  2BT6 A;  1WXQ A;  2WXL A;  1ESF A;  2MWS B;  1I4H A;  3NY5 A;  1FIQ A;  3DHG C;  1UWX A;  1TBE A;  4WQO B;  1B9R A;  1K50 A;  3MJW A;  2KDF B;  3NVW A;  3V61 A;  3WA0 A;  1ROE A;  2KFK A;  1RM6 C;  3ABV B;  2C60 A;  3R66 C;  1WSP A;  1VCB A;  3KYD D;  1AN8 A;  1E8Z A;  4JX1 C;  2D07 B;  1VDV A;  3BII D;  3PRZ A;  4W9I A;  1ZW7 A;  1YX6 B;  2YVC A;  5BO4 B;  4HWI B;  1LGR A;  1C4P A;  4C00 A;  1GB1 A;  2IYD B;  3ZDM C;  1HEZ E;  2DYB A;  2Y5C A;  4BBN C;  1PGA A;  2RR9 A;  1TKE A;  1JW9 D;  1L0V B;  2V3N A;  4C56 C;  2AL6 A;  3Q8B A;  2O6V B;  4GOC A;  5IKC M;  4LTU A;  4HDO A;  2AWT A;  5IO9 A;  5DPT A;  4WWP A;  1I4P A;  1WMH A;  1WRD B;  1XO3 A;  1WI0 A;  2NPT B;  1HTQ A;  3URY A;  2BW2 A;  2MJE A;  1WR1 A;  2DHZ A;  4XYC A;  3B2F A;  2CU3 A;  4NPN A;  1N63 A;  4L1B A;  4JWU C;  5KHQ A;  4A20 A;  1L0Y B;  1WJU A;  2KQ7 A;  1NEN B;  1HXY D;  3L13 A;  2QIL A;  3APD A;  4LNO A;  1ZXI A;  1C1Y B;  3TUO A;  3VFK A;  2ZVN A;  3KWL A;  2MP2 B;  4FN2 A;  4YWG G;  2PKO A;  3BK2 A;  4HKZ E;  2N7E A;  1C78 A;  4C7Z A;  2G4D B;  3O13 A;  1TS5 A;  3MHZ A;  4PYU A;  2M0A A;  5AUI A;  1D5X C;  1Y56 A;  1NI2 A;  2GMI C;  1CMX B;  2QJL A;  1JWA D;  3VUX A;  4NJ6 A;  1FO4 A;  4M02 A;  1M4V A;  1MG8 A;  2KJ6 A;  3N20 C;  3A9J B;  1E6E B;  1ISN A;  2KZR A;  5EE0 A;  4I6P A;  3OJ4 B;  3I3T B;  2QMT A;  1SIJ A;  2BQQ A;  1L5P A;  3DWG C;  1MG4 A;  1KFY B;  2WXH A;  3DBH I;  4G3X B;  2XK5 A;  4K7U A;  1JQ4 A;  3DBH B;  4US8 A;  2INC C;  1D6E C;  1XXG A;  1PYW D;  3V60 A;  2VRR B;  3SDL C;  1FEH A;  5TSS A;  3HVZ A;  3DQV A;  5D3I B;  4ZRP A;  3UF8 A;  1FFU A;  2LUE A;  1YNT E;  2ICI A;  1KLU D;  4B0E A;  1OFF A;  1E7U A;  3NUH B;  1P0R A;  2M17 A;  2N7J A;  4XWT A;  1DOX A;  2GBN A;  3AE9 B;  4WJP A;  3EA6 A;  2QIE B;  3T9L A;  1ZGU B;  3TEY A;  3NRZ A;  2WU5 B;  1J7B A;  3OG5 A;  3KUD B;  1FCL A;  4L2Y A;  4IDI A;  3L54 A;  1CK1 A;  1KLG D;  2M19 A;  1JWS D;  1WZ3 A;  2K8H A;  1XLO A;  2D3B A;  2RGF A;  2KXJ A;  3DHH C;  1UGM A;  3W2D A;  3QIJ A;  1UZX B;  2L8J A;  3CMM B;  3PZD A;  3U30 A;  5G2N A;  2QSD A;  1E9M A;  3GE8 C;  1WE7 A;  3A1Q A;  4ANV A;  1LFD A;  4N6E B;  4XDC A;  4KKI A;  2K8B A;  4ZDV A;  2FIF A;  1YD8 U;  3ZYY X;  3W5U B;  3ZJT A;  3V6E B;  4NQL B;  3EGR A;  1YQB A;  3VH3 B;  1SXT A;  1QQR A;  1AW7 A;  3W9C B;  2H88 B;  4II2 B;  3ZNG C;  1JRU A;  2ON8 A;  5G55 A;  4S17 A;  3QAR A;  1P1A A;  4W9F A;  4FHJ A;  1H8C A;  1T5X D;  2DAJ A;  2N9L A;  3AMZ A;  1NBF C;  2C7H A;  1J7A A;  3HRD D;  4HPM B;  2CHW A;  2L52 A;  2MBQ A;  2WDT B;  2MEK A;  3VTV A;  4B6W A;  1ZDV A;  5BYS A; 
#chains in the Genus database with same CATH homology
 3T8M A;  4BVU C;  4F1S A;  4N9F 4;  4RM8 A;  3V6C B;  5E6P A;  3WAM A;  3UQB A;  3APF A;  3A9K A;  3QQ8 B;  2BGF A;  5CHV C;  5D6J B;  3A4S C;  5JZE B;  3JYU A;  3RUL A;  4G11 A;  3ZNH B;  3AXC A;  1SIF A;  2ZCB A;  1WIA A;  3H9D A;  4P7I A;  4RM9 A;  2LI5 A;  2PE6 B;  3GZN I;  2N4F A;  4BKG A;  1PQS A;  4BOZ B;  2KLC A;  3UQA A;  2LVO A;  4IC7 B;  1F9J A;  1KM7 A;  5D94 A;  2IY1 B;  2LWP A;  1FXT B;  3DOW A;  2IO3 B;  2LD9 A;  2UWQ A;  3H7S A;  1WZ0 A;  2D11 A;  3ZKJ C;  4AJY B;  4TQ1 A;  2L7R A;  4RMA A;  3EC8 A;  3ZO5 B;  4E74 A;  1P3Q U;  1H4R A;  2FCQ A;  1I35 A;  1Q1O A;  2PE9 A;  1EF5 A;  2KTR A;  4GXB A;  3WAN A;  1E8Y A;  1XQQ A;  3VTU A;  2OJR A;  3ALB A;  2QHO A;  3PRE A;  1YJ1 A;  3HM3 A;  1T0Y A;  4KZC A;  4XC2 A;  4K1R B;  4K7W A;  3S2A A;  1J8C A;  1WM3 A;  5IA7 A;  4X57 B;  1WGR A;  4XZ4 A;  2G45 B;  5DPS A;  3B0A A;  2MBO A;  1P98 A;  4EKU A;  1UD7 A;  2NR2 A;  1V6E A;  3NOB A;  2ZVO A;  4K81 A;  3QC8 B;  1NDD A;  3LDZ E;  4I6N B;  1V5O A;  2UYZ B;  4MJS B;  2LZ6 A;  2L76 A;  4W9E A;  5C23 A;  2B3A A;  3PPA A;  3R7Q A;  2PJH A;  2LXA A;  2PPH A;  3NZS A;  4W9H A;  5AZF A;  1L7Y A;  1Q5W B;  4IWO A;  4LJO B;  5TR5 A;  1K8R B;  1RRB A;  3N30 A;  2JZZ A;  4MEL A;  4OVV A;  2NBU A;  4K7S A;  3V62 A;  1WY8 A;  3PRP B;  3CF6 E;  2LGD A;  3PVL A;  4DXA B;  2L0T A;  2DX5 B;  1IPG A;  5JHA A;  2CS4 A;  2IO2 B;  2MRP A;  2N1W A;  2A4Z A;  4W9G A;  4KSL C;  4JIO U;  3KYC D;  4LCD E;  1WE6 A;  3M62 B;  4W9K A;  3AUL A;  2CHX A;  1E90 A;  4F7Z A;  4KZ0 A;  3H7P B;  3TCA A;  2K6D B;  2REX A;  3W1Y A;  4GMV A;  4IG7 B;  2Z59 B;  4HVB A;  2CU1 A;  2JVC A;  4IWP A;  5J18 A;  1WX7 A;  4EEW A;  1WGH A;  1WXM A;  3R7R A;  3PT2 B;  3PSE B;  2KTF A;  1RFA A;  4EZJ A;  2O6V D;  4MJS A;  5E6N A;  4W9C A;  4FA6 A;  3PLU A;  2KDI A;  4ANW A;  3VXW A;  3U7D A;  3L0W B;  2G3Q B;  2RSU A;  2XBB C;  3DBS A;  2J0J A;  3O65 B;  2LGX A;  2KC1 A;  3EHV A;  1J0G A;  2NVU I;  1Z5S B;  2WWZ A;  4JGH B;  3X0W A;  1UBI A;  1YIW A;  1IP9 A;  4PS3 A;  2ZCC A;  2GOW A;  2WX1 A;  1EO6 A;  4IWQ A;  3PS6 A;  4CHK A;  1GC7 A;  3PLV A;  1ZKH A;  2OOB B;  3UIN B;  3SD5 A;  2C5L C;  2KQS A;  1J19 A;  2KDE B;  2JWZ A;  3H7P A;  3SHQ A;  1TZ1 A;  3N3K B;  2NS5 A;  1EF1 A;  4ANX A;  2ZEQ A;  4KSK C;  3TBL D;  2BF8 B;  2GBR A;  3CST A;  2BKF A;  1OEY J;  3VDZ A;  2KTR B;  2NBV B;  3OAW A;  4OVU A;  3OLM D;  3RCZ A;  3Q3J A;  2KFK B;  2LJ5 A;  4HXD A;  2KX0 A;  4LDT B;  4KV2 A;  4WJO A;  2M1M A;  4MM3 A;  1M94 A;  4CO7 A;  3ZIM A;  3AI5 A;  2K8C A;  4TUU A;  4YL8 A;  3PHW B;  4EZL A;  4HLE A;  1LXD A;  1WR6 E;  2ZZP B;  2KWC A;  2EKE C;  3EEC A;  5LXH A;  1XD3 B;  3DVN U;  4WAA A;  5LXI B;  2D2Q A;  1OTR B;  4GU2 A;  5J2R A;  4AJW A;  2KVR A;  2C7N B;  2CR5 A;  3SU8 X;  2K39 A;  3UIP B;  4HPL B;  4J6I A;  4G0N B;  5JH5 C;  2MA9 B;  3ZVV A;  2FAZ A;  2LAS A;  2FCN A;  2DYM A;  1WJN A;  2BWE S;  4AUQ C;  2KWV B;  2MWS B;  2BYE A;  1WXA A;  3KVF B;  3NY5 A;  1R4N I;  2N7D A;  2C9W B;  3HK0 A;  3IG3 A;  1TBE A;  4WQO B;  2MQJ A;  2XEW A;  2N9E B;  3MJW A;  3DBR I;  2KDF B;  1AAR A;  3PRM B;  3V61 A;  1WXV A;  2ZNV B;  4HK2 A;  4WJN A;  3WA0 A;  2MX2 A;  2KFK A;  5AEK B;  1WX9 A;  2IBI B;  4PYZ A;  5L95 C;  2C60 A;  2KLG A;  1SE9 A;  3ZRC A;  3ONS A;  3R66 C;  2BWF A;  4NQK E;  5CTR C;  4BFR A;  3BIN A;  3A33 B;  1VCB A;  3KYD D;  3DBL I;  3N32 A;  1E8Z A;  4FAD A;  1GG3 A;  3ML8 A;  3D32 A;  2D07 B;  3RZF A;  2O2V A;  1Q0W B;  2V1Y A;  2FID A;  3PRZ A;  1WH3 A;  4TQ0 A;  3PV1 A;  4W9I A;  2R2Q A;  1ZW7 A;  1YX6 B;  3GOE A;  3DDC B;  2LVP A;  2YVC A;  2R2O A;  2JRH A;  4MGK E;  5BO4 B;  3Q3F A;  4HWI B;  2DYO A;  2BYV E;  4NY0 A;  3QWZ B;  4HCP B;  4EOY A;  5DPR A;  1WGG A;  4XX5 A;  2IYD B;  3ECI A;  3ZDM C;  3QA8 A;  3B1L X;  1SGH A;  4DHZ B;  3TJP A;  2RPQ A;  3L08 A;  2KFJ A;  4MGY E;  4AP4 C;  4EUT A;  2DYB A;  2KJH B;  2V4L A;  2ASQ A;  2YLM A;  1GJZ A;  2KWU B;  1YX5 B;  3VQI A;  4BBN C;  2N9X A;  1OEY A;  3ZUN A;  2MBB B;  2RR9 A;  2KK8 A;  2ZPY A;  3NHE B;  4NAW B;  5KHO A;  2IZV B;  2M4N A;  2AL6 A;  2KOX A;  2IO1 B;  1WX8 A;  2J0M A;  3TMP B;  4W9L A;  2O6V B;  4HDQ A;  3KUZ A;  3KW5 B;  4GOC A;  1GNU A;  1EUV B;  2Z0D B;  2MBE A;  3ZRF A;  4HDO A;  2AWT A;  2FNJ B;  4JQW C;  3ZW3 A;  2LXC A;  5DPT A;  4WWP A;  1WMH A;  1WRD B;  3P2B A;  4BKT A;  2DZI A;  2I1J A;  4GDL A;  3VTW A;  2NPT B;  1WI0 A;  2KDB A;  1G6J A;  3RD2 A;  1IYF A;  3MHS D;  2L05 A;  5GMV A;  2KAN A;  1R4M I;  4MGI E;  4FBJ B;  2K1F A;  2I1K A;  3HHM A;  1WR1 A;  2DZM A;  2DHZ A;  5AZH A;  3ENE A;  3HM6 X;  4NJ7 A;  2KKC A;  1WXS A;  3RZW C;  4NPN A;  3H1U A;  1WFY A;  4FHK A;  3PHX B;  5KHQ A;  4A20 A;  1WJU A;  2KQ7 A;  3L13 A;  1L2N A;  1S1Q B;  2BKR B;  2LGY A;  3APD A;  5D2M B;  4ICV A;  3APC A;  1A5R A;  4IM3 A;  1C1Y B;  2K6Q A;  2KC2 A;  2ZNV C;  3VFK A;  2G4S A;  1E8X A;  2ZVN A;  4NAW A;  4WJQ A;  3ZLZ A;  3PGE A;  4DK5 A;  2HD5 B;  2MP2 B;  2A5U A;  3WAO A;  4FN2 A;  3M63 B;  3TIX A;  4E71 A;  2O6V A;  5JHB A;  1WGD A;  4ZRI A;  3B08 A;  1RLF A;  3DCG A;  3LJ3 A;  2N7E A;  4MEM A;  2XK5 B;  3UIO B;  2C7M B;  3QCA A;  4BKS D;  2G4D B;  2M8S A;  2LVQ A;  3ZDT A;  4TKN A;  3NS8 A;  2AYO B;  4KIK A;  5L83 A;  2BYF A;  4MSQ B;  2L3Z A;  2NPT A;  3DVG Y;  2BPS A;  4PYU A;  2GMI C;  1NI2 A;  4B95 A;  3JSV B;  1CMX B;  3VUX A;  4DHZ E;  2JZ3 B;  4NJ6 A;  4TV3 A;  1VD2 A;  4B9K A;  2MBH A;  2O2V B;  4IUM B;  3TL5 A;  2MW5 A;  4JL9 A;  1V2Y A;  1XT9 B;  2JY6 A;  4DWF A;  1MG8 A;  4GDK A;  1WJ4 A;  4DDG D;  2Y5B B;  4DDI D;  2K25 A;  2KJ6 A;  3X23 A;  3VH4 B;  3A9J B;  2N1V A;  1ISN A;  4GGQ A;  2N9P C;  3QJZ A;  1KLV A;  5LLI A;  2KZR A;  2RD0 A;  4I6P A;  1I42 A;  1WGY A;  3OJ4 B;  3I3T B;  2GBK A;  2L0F A;  1V81 A;  3JW0 X;  5E6O A;  2MP2 A;  4JLC A;  3QHT A;  1WF9 A;  1HE8 A;  4KDI C;  4GN1 A;  3DBH I;  2JT4 B;  2XK5 A;  3QAQ A;  4G3X B;  4K7U A;  4ASW C;  4DHJ D;  3ML9 A;  2AEH A;  5DCN A;  1V49 A;  2Z0E B;  2NCN A;  3QK0 A;  3IBE A;  3V60 A;  1UBQ A;  2VRR B;  3SDL C;  3VUW A;  2GBM A;  5AZG A;  3JSV A;  1TTN A;  2KJR A;  4EFO A;  3BY4 B;  2CHZ A;  2L00 B;  3DQV A;  4II3 B;  3OJ3 A;  2DZK A;  3DVN V;  3U8Z A;  2J7Q B;  1WM2 A;  3RYT A;  2DAF A;  2GBJ A;  1U4A A;  4AOF A;  2JF5 A;  1RAX A;  1WMH B;  3UF8 A;  4A3P A;  1V5T A;  1Z2M A;  3ZNZ B;  2LUE A;  2J0K A;  4GDL B;  4AWJ A;  3PTF C;  3A9J A;  1E7U A;  5CHW A;  1P0R A;  2M17 A;  4WWN A;  3R3M A;  4KVG B;  3H6N A;  5D7G A;  3WIM A;  2MLB A;  3A1Q B;  2EMT A;  4ZRK A;  2KN5 A;  2GBN A;  2NBW B;  3K9O B;  1E5W A;  2HTH A;  1BT0 A;  4FJV B;  4WJP A;  3A4R A;  3DPD A;  3T9L A;  1ZGU B;  4GIV A;  5J17 A;  3RUI B;  1GUA B;  2LRW A;  1TGZ B;  3CSF A;  4W9J A;  1GC6 A;  3VUY A;  4URK A;  5HKH A;  3KUD B;  2KD0 A;  3QX1 A;  1UH6 A;  5DPW A;  3M3J A;  5CHF A;  3L54 A;  1UEL A;  1WZ3 A;  4M8N A;  2K8H A;  3WAL A;  1E8W A;  2LRU A;  1LQB A;  1WYW B;  4KIK B;  4W9D A;  2RGF A;  2CKH B;  3IFW B;  4IM2 A;  2KXJ A;  3IVF A;  1UGM A;  2KMC A;  4CYE A;  4EZK A;  2WX0 A;  3QIJ A;  1UZX B;  1P9D U;  2L8J A;  3CMM B;  3PZD A;  4NNJ B;  3U30 A;  3VAW A;  4FLH A;  3L16 A;  3M95 A;  1V86 A;  1D3Z A;  5G2N A;  4FUL A;  3VHT C;  2FCM A;  2PEA A;  4ZRJ A;  2EMS A;  3IHP C;  3EFU A;  5CX3 A;  4ANV A;  1WE7 A;  3A1Q A;  4MH0 E;  3WAP A;  1LFD A;  4GSW A;  4GDK B;  2D3G A;  2WYQ A;  4I6L B;  2K8B A;  4IM0 A;  4ZDV A;  2M0X A;  3ZTD A;  5C1Z A;  1C3T A;  1Y8R C;  2FIF A;  3HIZ A;  4MGZ E;  2W9N A;  2DEN B;  3MTN B;  4G50 A;  3W1S A;  1WJ6 A;  4ANU A;  4ICU A;  2AL3 A;  4GB9 A;  4MDK E;  2KO3 A;  3ZTC A;  3RT3 B;  3VVW B;  1E7V A;  1YD8 U;  2FUH B;  4PS8 A;  1V80 A;  5IAA C;  4BOS C;  1OGW A;  4A3O A;  4M0W B;  3V6E B;  3ZNI D;  4NQL B;  4M8M A;  2KMA A;  4IW0 A;  4FJY A;  3A9K B;  1YQB A;  3VH3 B;  2D10 A;  1V9J A;  3NZU A;  5FR6 A;  2ZPN A;  3L10 B;  3AU4 A;  4HJK A;  4II2 B;  5EDS A;  2V3S A;  3KUC B;  3ZNG C;  3JVZ X;  4FJZ A;  1KJT A;  1QZE A;  1JRU A;  2JRI B;  5G55 A;  4E3C A;  4WWO A;  2IY0 B;  3AU5 A;  3UGB B;  3QAR A;  2JUO A;  1P1A A;  2FCS A;  2ZJD A;  2MCN B;  3L17 A;  3K9P B;  4W9F A;  4FHJ A;  2HE7 A;  1H8C A;  4DBG A;  2DAJ A;  4PS7 A;  3DVG X;  1LM8 B;  2KX3 A;  1NBF C;  2MSE D;  2C7H A;  4F8C B;  4KDL B;  2HJ8 A;  2CHW A;  4HPM B;  2KNB A;  2KHW B;  4HCN B;  1KOT A;  4LJP B;  2IO0 B;  3KH0 A;  1S3S G;  2MBQ A;  2WDT B;  1OQY A;  3C0R B;  2JPH A;  2JXX A;  4ZYN A;  3W1S C;  4MSM B;  2DZJ A;  4BBN F;  3VTV A;  4B6W A;  1X1M A;  4BKS A;  4DHJ B;  4LDT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...