4RGOS

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 63
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
S PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgoS02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgoS01
5ELCA 1RCVD 4UDUC 4ZYSA 1FD7D 1PTOD 1S5FD 3W2DA 1L0YB 1RD9D 5FK9C 3CHBD 1SE4A 1HTLD 1G8ZD 1XXGA 1PRTF 1PZID 1UUPA 2G9HD 1RF2D 2WV6D 3EA6A 1S5ED 1JR0D 1ENFA 1D5MC 1JWUD 3DWQA 1YN3A 1D5ZC 4O1NA 1BXTA 3BYTB 1EWCA 2RDHA 2NTSA 2Z8LA 1I4GA 3BVMA 3R2IA 4RCOA 4RGTA 1CT1D 4RHRA 4RH6A 1AW7A 1SJED 1V1OA 1FGBD 5ELEA 1EU3A 1DJRD 1SJHD 1HQRD 1LTAD 1KTKA 1LTTD 1QILA 2XN9C 1YN5A 2IJ0A 1EU4A 1B1ZA 1PTOF 1EEID 5TSSA 2TSSA 1PYWD 1I4HA 3BYYB 1B44D 5D3DA 1D5XC 3SEBA 1LTSD 2AQ2B 4DXGA 3MC0B 4RGMA 1CK1A 1LT4D 3R2TA 1GOZA 1L0XB 1LTRD 4RGNA 3URYA 2O2LD 1I4PA 1S5CD 1BCPC 1I4QA 2ICIA 1LLRD 2IPKD 1EEFD 4RGOS 4C56C 5I4DA 1M4VA 1PRTC 2QEJC 3BVZA 1S5BD 1FNUA 1ET6A 1ESFA 1JWMD 2CHBD 1TY0A 4OHJA 1JCKB 1SE3A 3DWAA 4DXFA 1DYQA 3MFGA 5D3IB 1TS4A 1HXYD 3GP7A 1JQYD 3R8BA 1I4XA 1BCPF 2J4XA 1S5DD 4NZLB 1LT5D 3EFXD 3KLSX 1SXTA 1V1PB 5ELFA 1KLGD 1LT3D 1TS3A 1PTOB 1LO5D 3DWPA 1KLUD 1EFID 1PTOC 2AQ1B 2XRQD 1TS2A 1SE2A 1UNSA 3O13A 1PZJD 1CQVA 1XTCD 2QILA 1YN4A 1F77A 4Z9CB 1MD2D 1LTBD 1BCPD 1I4RA 1HA5A 1JWSD 1CHQD 1LT6D 3BZDB 1FNVA 5ELDA 1PZKD 1SBBB 1V1PA 1FNWA 1PRTD 2NTTA 3BVGA 1PTOH 3OWEB 4L6TB 5FKAC 1T5XD 4RHSA 1SEBD 4RFBA 2XRSD 4K6LA 5ELBA 1TS5A 1PRTB 3V05A 2SEBD 2XNAC 2AQ3B 1RDPD 3TSSA 1BCPB 4BWGB 1STEA 1TY2A 1D6EC 1CHPD 1ET9A 4TSSA 1LTGD 2RDGA 2R61A 1LTID 4L63B 1AN8A
chains in the Genus database with same CATH superfamily
4WWMA 4MIUA 1QOHA 1EUJA 4PK1A 3APFA 5J18A 2QMTA 3DXJC 3MHBA 2YTXA 3KQ4A 2EJMA 3A55A 5BYQA 1XXGA 2WDRB 3VUYA 4PT5A 2AUKA 2EYLA 1K8OA 3DBHI 4FHJA 4YSZB 1GUOA 1MBYA 1VQJA 1Y8PB 4DQOC 3Q22A 1W2BA 4R4QA 4CO7A 4L23A 2N78A 2WX1A 4U68A 1C1YB 2PQAA 5LMNW 1QOFA 3NQTA 3OMGA 1IKMA 1F9JA 4B95A 1DONA 3LXFA 2M2LA 2WDQB 5H1SE 3ZRCA 1X54A 3QK0A 1BVSA 3E6ZX 4LMQD 1NEKB 4LFBL 4W9KA 3OIPA 2EIFA 1IGDA 4BFRA 3DOWA 3JAMi 5HHDG 4GXBA 2SDFA 1LM8B 1EO6A 1QJOA 2FBWB 2E2JB 5HFYA 2X38A 2MO0A 2UUAL 2Z6KA 2KD0A 2RMMA 5M5WH 2B2YC 4RWSC 3GTLB 2X8XX 2JU6X 3P2BA 2REXA 3JSVA 1XNRL 3MHSD 4MGYE 2K0PA 3HKZG 4NQKE 1QVCA 4KX6B 2QCPX 2D07B 1M4VA 1PRTC 1JORA 1V5TA 1JJGA 3BWUD 2QEJC 3BVZA 2JSVX 5HURA 3AV8A 2A74C 3AE4B 4K0KQ 1ET6A 4ZUIA 3K5LA 2F0SA 3GDEA 4N8FA 3S9WA 4WAFA 1SNDA 1DOXA 3RN2A 4EZLA 2WQYB 2WKCA 1TYGB 3I57A 4YSYB 3DHGC 3OPOA 4JOIA 4IZ8A 2UUAQ 2R7ZG 2RD0A 3A33B 3FPPA 2PIAA 4R8IA 5KHOA 2LGSA 3F1ZA 1YNTE 4LF7L 3CRLC 2BB6A 5IGEA 5I9PA 1Y1VH 1AFPA 2V3SA 4FXGC 3PV1A 1EYDA 3GTKB 2UU9L 1XT9B 4ZKCB 1HQMC 1VQ4A 4B0EA 5K36G 1GKHA 1JOKA 1X6OA 4J8QA 4ULLA 4KHPQ 1XPRA 5C4XG 1FXIA 4FO2A 3I4NB 3VDYA 3MVVA 1I4RA 2CFMA 2UXCQ 2A4ZA 1A6XA 1V80A 1FMAD 3M63B 4HXDA 4I6PA 3V60A 2BCOA 5FJ8H 1QG7A 2ZM6L 4S3SA 1A2UA 1NYQA 1YQ3B 3E0JA 1PZKD 2F0NA 3OWEB 5E4WC 5IN7A 2IZVB 4YWKA 2LKVA 3I3TB 3T16A 4AUQC 4KD3A 1CFMA 3GTQB 3TDQA 3BZKA 2D2QA 4ZRPA 1TWCH 1IYUA 4P71A 2LUMA 3ZTCA 1VQPA 4A3JB 5C0XI 2JX5A 1IW7C 4NPNA 4K5WA 4GDLB 4A3BH 3PSEB 1A2TA 2A69D 1JMLA 1U4AA 4LNKA 2EY2A 4A4IA 2ZZPB 3ML9A 2H1EA 1ET9A 4AH6A 1XLNA 3HIZA 1DOYA 2WB1E 4F7ZA 4LF4L 4ALPA 5BR8L 4IUTA 2DN8A 3I4NG 5ELCA 1TWAH 3DBLI 4MTNA 2VUMB 1PTOD 2VQFQ 4XDDA 1S40A 4JI8L 1ENAA 3DBRB 3PZDA 3ZJVA 2O5JC 2R7DA 3S24A 2ZXPA 2A1AA 1S5ED 4N9PA 2JQOA 2W3SA 2CW0C 4QF4A 3CCUA 1MJDA 3RFZB 1WCMH 5IYCH 3CXCA 2B2TC 3W5UB 3RMHA 3F2BA 4AOFA 1WOCA 5AUIA 5J1ZA 4X66L 2LMCB 2KA7A 3UF8A 3GTGB 2ES2A 2KTRA 2PMVA 1RYJA 3L4PA 3AFPA 4HJ7A 2LWPA 3GB1A 1G91A 1MHWC 4OVZA 3NWSA 1KD1C 1VQLA 2BS2B 2RDBC 5T8IA 2ZM6Q 2TMPA 1VCIA 4POFA 3QOJA 3MC0B 1CK1A 2KANA 3J81j 4GKJL 4A3GG 2YEPF 1LQBA 3WAOA 3PPAA 2MP1A 4DR1L 4MACA 2L55A 4X62Q 2N49A 3OMCA 2CJNA 3APCA 4B0MA 2EXZA 2ICIA 5EPLA 4R9WA 1Z2MA 2NS5A 1CA5A 3PRPB 1A15A 3TEWA 3EHVA 4MDKE 2VNUD 4ASWC 1VF7A 4HCSA 2ALYB 2L1BA 3VFKA 4F87A 4XWWA 2FINB 2PMZB 2MQHA 1MG8A 4OX9L 1WFQA 1SYGA 4YCWA 3TEXA 3MFGA 2ZCCA 1QUQB 1ZUD2 3A0JA 5KYLA 1NJIC 2M0AA 2C60A 3NRZA 5CV8A 1O7LA 4A93B 3EGRA 1SIFA 1V6EA 1SNOA 3C19A 1XJVA 3PCOB 2OTJA 1HR0Q 2LGYA 4WJQA 1GB4A 3M3YH 2KK8A 2IX0A 4HRSA 4PS7A 2FCSA 1SDFA 2KQ4X 1ASYA 1VQNA 1JMCA 1WGDA 1OO9B 4M0WA 1FCCC 2PLPA 1SE2A 4E6IA 4A3EG 1GAQB 3U2SC 4RKLA 1OEYA 1SMYD 5G55A 2CW0D 2J0JA 3BG3A 4IURA 3V61A 2R7ZH 3IAM1 3HOYB 2F4VQ 2HTHA 1JWSD 4MM3B 4W9CA 4GLVB 4GB9A 4MSQB 1JQ4A 1FNWA 4DHJB 2NBFA 3SXHA 4DV0L 3KOJA 2R93B 4WQOB 1YNNC 2INNE 4BBRH 3N3KB 3KLRA 4IUVA 3A8IE 3M3JA 3X0WA 2XWJB 2RVLA 3BU2A 1CTMA 2A68D 1K73C 2V1YA 4I6NB 3BIID 1YJNA 2KN4A 3T1HL 1KNEA 1STGA 3HOVG 1J0GA 4ZK9B 1EY4A 5C4HA 1Q46A 2WXJA 2PJHA 2UUCL 4LTUA 5CC4A 2BS4B 2IGDA 1N34L 2ZTEA 4R8NA 2JE6I 3W9CB 5C5MA 3GS2A 5JAVA 1H9SA 1B3AA 3K58A 2WXRA 1JE4A 2Z6BA 1RCVD 4CDCC 5M3FG 2FCQA 2KMAA 2MP2A 5EAYA 3TN2A 3MXGA 4YIJA 2D3GA 1PHJA 4A3IB 2NBWB 2ZPYA 4HJGE 1SE4A 3J9CA 2KOXA 4ZAIA 4DR6Q 5C3EH 1RF2D 3K0XA 3PIO3 4DHZE 1WIAA 2MA9B 5IT9L 5IYDH 1OXTA 2V3NA 3V62A 2F0GA 2ZW1A 1PH3A 4NJCA 4CDEC 3DBRI 4QAYA 3UIPB 4RF1A 5JH5C 3PT2B 1SJED 1AZQA 3VH4B 4DAMA 4PMBA 1HEZE 1F2RI 1J5EQ 4JIOU 5LXIB 1Y1VB 3D3RA 3NJTA 2NVYB 4YSXB 1JALA 2PW9A 1B1ZA 5TSSA 1SE8A 4C1NK 2TSSA 3NY5A 3VH3B 1RL2A 5I2XA 1VQDA 2RHQB 2JYOA 3RZDH 5D3DA 2EY1A 1D5XC 4X3KA 1Q1EA 4TQUS 3TREA 3MJ5A 3WOFA 1L1OC 4C3JH 3CSTA 2ZNVB 3AH7A 1UE6A 3W1GA 2VQFL 4GN1A 4JI5L 2IHEA 1ASZA 1P0RA 1Z9FA 2KJRA 5H92C 2MP2B 2XTIA 3H09A 4A3GB 4MSMB 2I1JA 2Z4HA 2H4OA 4ZRJA 5J39A 1U4RA 1JWBD 1AARA 2GB1A 1Q3LA 5JEAG 1SSNA 4D2KA 4PZ8A 2WXIA 1N60A 2X69A 1OXSC 1GNUA 2WWZA 4M0WB 2O2VA 3CSFA 4OO1H 2GLSA 2DJGC 2PPBC 3PRMB 1Y1VG 3K81C 1XLPA 3TBIB 2WFWA 3PTFC 4IUPA 1E10A 4RMFA 5AFWA 4A3CG 2RCNA 5L95C 2B2TA 1JJ2A 2WKDA 3R3OA 1IBMQ 1ZDVA 3RPFC 2N7DA 4GNXB 4DKAC 3K0YA 4JL9A 4GKJQ 1UBQA 2F0QA 3H3VH 5IYDG 1UEBA 3TP8A 1LO5D 4K3BA 2MW5A 4ICUA 2K50A 3FRPB 3NQIA 1JB3A 5BN5A 3KJOA 2C5LC 1EY5A 4IPDA 3OW2A 1YJ9A 2CJOA 1PZJD 4K81A 3K59A 1BOSA 4BAXA 2FCNA 2LUEA 5LMUQ 1HZ6A 3S14B 5M3FH 2HHHQ 5C2TB 3KF8B 4JI2Q 1LABA 3M4OH 3ERQA 4KI0A 3RN5A 2F4VL 1E7UA 2KUMA 1A3TA 4K8JA 1YMHE 2HHHL 3ZNHB 1SNMA 1F9PA 4HROA 2JP1A 2JSOA 3J81c 1WTOA 4GKKL 1LGRA 3KBXA 1JC7A 4OELB 5ELBA 2NB0A 2NVQB 2LGIA 2NMQA 3FILA 3KYCD 4XGAB 3Q8AA 2SEBD 4YL8A 5GMVA 1EQQA 1MGSA 1IGCA 4UAIA 2BGFA 3AMZA 3CAMA 2DY8A 3QIJA 4K5XA 1WD0A 1IYVA 3RN9C 4Q2JA 3GQBA 2GBJA 2AWNA 4OL7A 3NS8A 3SDLC 4X65Q 3LJ3A 4N9TA 2BH2A 4NKLA 2MBEA 5IAAC 5JXVA 4ZYSA 3D8GA 3ND8A 1Z5SB 3ONSA 1D4BA 4FBJB 3PS6A 4A3EH 2JWUA 5DEHA 2JYEA 4APVA 1CZGA 4L5QA 3SU8X 1FYCA 1PRTF 3ZNGC 4QCLA 2E2HB 1T0RC 1E2VA 1TQOA 5CX3A 3HGBA 3G4SA 1RLFA 3BYTB 4RGTA 1A62A 1LACA 2E2HH 2UUBL 3EC8A 1EWHA 4P74A 3I56A 4P16A 3VR8B 1D3ZA 4RAUC 2QW7A 4HEA1 1CA6A 2WP9B 2B39A 3DHIC 4DDID 2UUBQ 1B53A 5DPSA 4IQZA 1KAWA 3H1UA 1TWCB 4HCPB 5CGKA 1AZPA 4YTNB 4AWJA 1BUVT 1SMXA 2KENA 1WTXA 1LV9A 3W3AA 2DAFA 5IP9H 1QNKA 3J7YW 4A3JH 3ZLZA 4YT0B 3RZWC 3MZ5A 2E2IB 1H4RA 2QJLA 4RGMA 3R2TA 3FKIB 2K39A 1C4AA 3OOCA 1B9MA 4LW1A 1WM3A 1ESRA 1ZYRD 1PUTA 3FKIH 3JAMc 5C0XG 4JI6Q 1E7PB 4F8CB 1J9OA 1V9JA 1KRTA 3EFUA 1B4OA 2IO1B 2BDOA 4XT3B 3TMPB 3HOVB 1Q10A 3GV3A 3GTLH 4A3FH 3DEOA 2BF8B 3NELA 2KWVB 1VQEA 3GV6A 2CHBD 3ER0A 4H7BA 1G2TA 5E7NA 4JI4L 3MEHA 1NMFA 4ZYNA 3CPWA 1CKOA 4DV6L 4DXFA 4FF1A 2NYZD 1K8AC 2RSUA 3GP7A 4EX5A 3J81E 1KF6B 4DV3L 1TTNA 3B2FA 1GJXA 5EKKA 2J42A 2EVBA 2N8NA 4PYUA 2MEKA 3SHQA 1KOTA 4B9XA 2LJ5A 1BQQT 1V1PB 1WWTA 2WX0A 1GO3E 1E8YA 2L11A 2KX0A 1TS3A 4ARIA 4I7AA 4KJOA 3T3NA 4K2KA 4DR5Q 2R92H 1STYA 4LFAL 3PO2H 1YITA 2G4DB 3N1YC 5D6JB 3ZKJC 2GBKA 5IT9E 5M3MH 2N1VA 3H0GB 1MKHA 4NJ6A 1KH0A 2E75C 2A5UA 2VW9A 3CC7A 1SFOB 4Z9CB 4JWUC 5BO4B 3ZJTA 1PXUA 4HDQA 3E9IA 1FVIA 4AS1A 1MHXA 3H3VI 1SNQA 3NZ3A 4WIPA 4HMIA 1WJJA 1Y14B 2MBQA 3IFWB 3TBLD 4YWGG 3G7LA 4KZ0A 1T5XD 3IHPC 1TKGA 1M8AA 4R1JA 4RFBA 1A3UA 1H8CA 3P1HA 1RFKA 2RGFA 3ZRFA 1SLJA 4DNIA 4LUVA 3LB8C 2KQSA 4KZCA 5EE3A 4FADA 3HHMA 5JJZA 3AN1A 2D0PA 2Q2IA 2HD5B 3TSSA 3UDGA 4FVMA 3V96A 3W1BA 3QC8B 5EGTA 1QQRA 3MXNB 4A3GH 3HOXH 4GN4B 4W9JA 1TT2A 1SF0A 4L63B 1Z6HA 2OEOA 1CSPA 4C1NI 4IUQA 1H9SB 2INCC 1WMHB 3DPDA 2VS1A 1TXYA 4LF9Q 4LF6Q 1L0YB 1I50B 1X3FA 3VYSA 3A54A 5K36H 1TIFA 2OOBB 2NPTB 4KK7A 3QO2A 1VZ7A 3MC8A 2UXBL 1UEAB 1LM0A 3HOUG 2IL8A 2JUOA 3IG3A 3VR3A 3TEHB 4UP7A 3MP9A 4W9LA 1ICWA 2R7FA 2DJFC 4B3MQ 5I6WA 3HOYH 2ZT9C 4KHZA 3CCLA 1VQIA 1X65A 5C44G 2BE5D 1BDOA 2MLBA 3FHWA 1QE6A 2VL6A 4WURA 2FMCA 4NAMA 1LTTD 4MJSB 1YN5A 3OJ4B 4BY1B 1IBKL 1F9SA 2G9DA 5LXHA 1K51A 2JWZA 4DAYA 2VQEQ 4DV4Q 1FFVA 2C9WB 4OZAA 4XE0A 2CVRA 2K52A 2NPTA 3CC4A 1ZE3D 1EUVB 4IFDJ 1ZPSA 1JT8A 3I63C 1S5CD 3FKIG 1S1QB 4IUUA 3DUZA 4DR2L 5M5WB 2IPKD 4W9IA 4ZRIA 3GZNB 3PGZA 3H7SA 2Z0DB 5JHBA 4A3KH 1NSNS 3CCJA 3HUIA 1TWGB 2LHEA 1SGHA 1ML0D 3A9KA 2IGGA 2A6HD 4JG2A 2J52A 2ZVOA 5CYUA 5JJLA 5D94A 1QZEA 5A35A 1I6HH 5D3IB 3EJIA 2E2IH 3APDA 1T6BX 2ZXRA 3EROA 3VR4A 3NZUA 4DU9A 3PUZA 1C8CA 3QJYA 4R4IA 3GE3C 3ETRA 1Y8OB 3S1MH 2K8CA 5EPKA 1SROA 4WH4A 3Q23A 4MZ9A 1FJGQ 1UWMA 1L5PA 2UXCL 1ZW7A 5FO8B 5HGQA 5KRUA 1PTOC 2O5IC 3S2DH 3L17A 2K6AA 1XTCD 3D6CA 1UGJA 4X62L 2L0TA 2J0MA 2Y5BB 1WJ6A 4JLCA 2EYJA 4A3LG 4JI7Q 2QKIC 4RG1A 1BT0A 1EZ8A 1HA5A 4KKTA 3ZVVA 4CJ0B 2N9EB 3PIPA 3GTJB 3RMKC 3KK7A 1VZ6A 1FNVA 2LSSA 4L5TA 1FXAA 2J53A 2ZNVC 1WXVA 1P1AA 2IY0B 1HNWQ 4DWFA 1DXMA 3DHHC 2JT4B 1HZBA 5CORA 1Z7TA 1YEZA 4K6LA 3W1YA 1TS5A 4DFAA 2L15A 3QAQA 4ZCKA 3GZNI 3GTQH 3H7PA 1X55A 5C5LA 1RM6C 4DV3Q 3NK9A 1NYRA 2HCCA 2K75A 4A3OA 1QOAA 3D4WA 3AU5A 2FFKB 1NI3A 2PI2E 2N4FA 4RM9A 1RJTA 4WJ3M 1TY2A 2I46A 3KLSA 3KW5B 2D5DA 1GD7A 2R61A 3ZDMC 4BA2I 1CJEA 1TKYA 4GU2A 2ATWA 2MJ8A 2YV5A 2CKZB 3C8YA 2R93G 3TP5A 2NVTH 3W2DA 2QSDA 1SNPA 1E2WA 2A8VA 1RAXA 2KBNA 1C0AA 4WQMA 2B2YA 2B8GA 1PFSA 2G9HD 2F3IA 3EA6A 2F0WA 3OTOL 4DV4L 1QVGA 4K7UA 4YCUA 5GAHC 1YJWA 1SYCA 3S14H 3DBLB 3CKIB 5GXGB 4JI6L 4A3MH 2Y3AA 3E3XA 2PMZE 2KZRA 4BKSD 3U58A 3R7QA 4BOZB 1E9MA 2F03A 1WGHA 2LI5A 1N61A 4IOCA 4KIKB 3VTWA 2PQEA 2HDMA 3ND9A 4JI5Q 2XN9C 3K57A 2H5XA 3E56A 4IUMB 2OTLA 5DCNA 1V8QA 3LGJA 3VVWB 3H15A 4CHTB 3IAYA 1SFOH 3M7GA 2KDBA 1UE1A 2HDEA 5E6OA 2AQ2B 2LVOA 1WTVA 4A3DG 2QCZA 3I55A 4WFN3 4LF6L 5LHY1 1G51A 2OQ0A 1KIXA 3URYA 2O2LD 2K5NA 5C3WA 5D2MB 5IY0A 3GOEA 3PUYA 4JBMA 3HOWG 4IOIE 4K1RB 3ZXVA 2J7QB 4DNTB 4DR5L 4Y52H 3K5NA 4KKJA 1T0SC 4CQNA 4DR6L 4XTCS 3D4RA 4PMWA 1WGRA 4C3JG 1XLOA 4TV3A 3T8MA 1IBXB 1KJTA 4N59A 2PNHA 3NSWA 1R4PB 3M9BA 3AB9A 1G6PA 2IO2B 4OHJA 3B08A 4YTPB 1GUWA 2NZOA 4EQPA 4HIKA 1WTPA 5IP4D 5CHVC 1IXRA 3I2ZA 3PO3B 2N9PC 3JSVB 3V6EB 1V2YA 4EE2A 3PHWB 4L5RC 4MH8A 4QIWB 4LCDE 4P7IA 5IGDA 4FYDA 2M00A 1L1OA 2NR2A 3P4PB 2BWES 3L0OA 3J7AF 3WA0A 4RA8A 4IWPA 3W5VB 2KMMA 2QDFA 3I91A 2JN4A 3FAHA 3QHTA 3QX1A 3W1SC 4DNRB 4C2MB 4G7OC 1L0VB 1SYFA 1TZ1A 4A3KB 1PFDA 1UBIA 4GN3B 1SYEA 2KN5A 1X3EA 3ONAB 1N36Q 2PVOD 1V9PA 3T13A 3K80C 3A56A 1Q86C 2L8JA 3RNEC 3ZTDA 4C80A 4FF3A 2L3ZA 1HTPA 3CU7A 2F0HA 2CHZA 2K4KA 1MD2D 1LTBD 1BCPD 4XYOA 2DYOA 2CWAA 2PW5A 4IWQA 4LF5Q 1WR6E 4CDDC 4DK1A 2MSED 1EFWA 2INPE 2JPHA 1J8CA 4CJ2C 5FR6A 2O2VB 1SBBB 2F0VA 2FNJB 4OXPA 1VS0A 2NWGA 4LLGM 4M00A 1BO0A 1L1OB 1EF5A 1A70A 1VDZA 5J22A 2MJEA 5BYSA 4GOPB 3PV0A 3X3MA 1FPYA 1VQ5A 1VMPA 3FP9A 1G6ZA 2FHTA 3AM9A 3X3NA 3NUCA 4M02A 1H9KA 1HFGA 3STBD 4BBRG 3AE6B 3L13A 2CR5A 2DZKA 2JA6G 4BWGB 3RULA 1KRHA 2PE9A 4US8A 4EVOA 3AXCA 2P5ZX 4XWTA 1HCZA 3OG5A 3HP3A 1I3QB 3RZOH 5CV5A 4G7HC 1YIJA 1VQKA 3S15B 3AEDB 3WDNA 3NUHB 1NCVA 1S5FD 3Q3OC 1B70B 2D5GA 1C4PA 5IYBG 2F0KA 2N9XA 4N6EB 3Q8BA 4UP9A 1VLBA 2VZKD 2N1WA 4K7SA 3BZCA 3K7AB 1G2SA 1KC8C 4C4VA 4KVGB 2JRIB 3KWLA 2XWBB 3JYUA 1KHIA 1FCLA 3ML8A 4A3BB 2WDVB 3JW0X 5FR3A 1AW7A 3RLNA 3C3LA 1FXTB 2KNBA 1ILPA 1UE5A 1EU3A 5FO7B 5HGTA 1L6VA 5LMNQ 2K05A 4KIKA 2Q2HA 4YHHQ 4G50A 3ABVB 4CBVA 4HPLB 2SOBA 4BKGA 3ERSX 3S2DB 1B44D 2GN5A 4JCVE 1OEYJ 1WXSA 2EY5A 1LTSD 2JYTA 3HVZA 1EY8A 2LXKA 1XNQL 1LT4D 3PUWA 1PH9A 3Q24A 2AWOA 2L5TA 4QUCA 2A6HC 2F0DA 4EQNA 3RUIB 1SNCA 2V9HA 1XQQA 4KV2A 3CW2C 1F9QA 2IX3A 3Q8EA 4G4KA 1I4QA 2QDBA 2RHSB 1WTQA 2ZPNA 2CU1A 4YTMB 5M3MB 2WAQE 4BZAA 5I4DA 4ABNA 4MJSA 4BVUC 1HA6A 4XQQA 3KYDD 1WH3A 4Y7NB 4K8IA 3HOZG 1XCQL 4AJWA 2F0IA 4G57A 4K6DA 2N9LA 2DNFA 1GUSA 3VRAB 2PQAB 4JI8Q 4LNOA 1VMCA 5EBDA 2PW7A 5IIFA 2NVXH 2ZTCA 2B63H 1TBEA 3ZGZA 4NNJB 2WXOA 4PYZA 1F52A 4CGYB 4BBNF 1HE8A 4A55A 3Q0AA 4X3TA 1L6UA 3I73A 2Q8TA 3Q3MC 2MH7A 1TJEA 3WWVA 3PGEA 1K50A 2N3SA 3OIQA 5ELFA 1UE7A 2KHIA 2L12A 2QF7A 1PDQA 1BMLC 4CJ1B 1F2ZA 1GUAB 4A8XC 1VQGA 5IKCM 2NZ1D 1EFID 1M94A 3SFDB 5DPWA 4PNYA 1PDXA 2AQ1B 3T1YQ 3OLMD 1F2LA 2KX3A 5BYRA 3MXNA 5AZGA 2JF5A 1NBFC 3K9OB 2MHJA 2QILA 2AEHA 5AZFA 2HQLA 1WX7A 3M4YA 5AUKA 2WXHA 1DGJA 1M1KC 3U50C 1JROA 3IL8A 4GZYC 4QIWE 3ZDTA 3D32A 1GB1A 4GLXA 1S72A 2GRIA 2NTTA 2EXDA 2X6GA 4L6TB 5C4JH 2BTEA 4KHVA 2KQ7A 3ZNZB 2KO3A 4REZA 2EMTA 4FXCA 3U9OA 3H3VC 4O2DA 4GDLA 1CM9A 5DPRA 3AEFB 1PFNA 1S4ZA 3MTSA 2JA7G 2XNAC 3H0GG 1NAPA 5G5GA 3RZOB 3KBGA 2KCCA 1UF0A 1Y1WG 4JW0A 2BA1A 4OZBA 1ZYRC 3K5OA 1IBLL 3QQ8B 2OCEA 1OQQA 3RR5A 1ILQA 2EOTA 1XPUA 1TKEA 3QWNA 4JC0A 3RLFA 4KY5A 2DNCA 1YVCA 2ENBA 2OJWA 5JHAA 5M5YB 2YLMA 3KH0A 3OSOA 1PH5A 3H8HA 3B9JA 1HNZQ 2IO0B 1JR0D 1IZ6A 3G48A 1IL2A 2W3RA 4FJVB 2E2JH 2KCTA 5AZHA 1B3QA 2VQEL 3K7UC 1FIQA 2CWPA 3IFDA 2WIIB 1XMOL 4DV2Q 1WE6A 5DPTA 1HUNA 1ZKHA 4B3SL 2B76B 2KHWB 3PLUA 4C2MH 5KNCA 1QLBB 2IBIB 1ZEQX 3QG1A 4M1UB 4P1CC 3KLWA 3MXPA 2DBYA 3TP6A 2NVUI 3DVNV 4MGKE 1IHZA 1U4LA 4L8JA 3SK8A 4G0NB 1EF1A 2IW3A 3EIVA 3MAQA 4H0LC 4GOPA 4A3IH 2LGXA 3SEBA 3VRBB 4EZKA 3KF8A 2KC2A 2KWDA 2RF4A 3JVZX 1ZOYB 2VRRB 1HNZL 3N20C 2BYTA 4NB3A 2Y0SB 1WZ3A 3A4RA 2A6EC 2N7EA 3MHZA 3KYHC 5EJWA 1RTOA 2DGYA 3L7ZC 4JI4Q 1N6ZA 4HN7A 4DPGA 3B6YA 3QB3A 1N34Q 1AH9A 1EY0A 5JJKA 3NENA 4GOPC 1E1TA 1Q0WB 1DOIA 3NTIA 1O7IA 2F0TA 1PH7A 1TY0A 1WYGA 1YNXA 3U4VA 1XPOA 4O0AA 1WMHA 4AYBG 3NEMA 2WS3B 1O7YA 1B7YB 2EDGA 2B2VA 1H9MA 2H88B 2WXNA 1SYBA 1BCPF 2J4XA 1L0WA 3RUZA 1TVXA 4FP5D 2RPVA 3PO3G 1WZ0A 1P3QU 1Q8KA 2V0GA 4DUYL 2B2UC 4ZRZA 2K9XA 2F0MA 2E76C 1UH6A 4BBSH 2RPQA 2L32A 4B3TL 4ZHOA 4XYCA 3OJ3A 1WE7A 2EJGC 2G4SA 3T4AC 1HZAA 1N33L 4M01A 1T9HA 5C3EB 3AEVA 3AEAB 3NHHA 1WYDA 3VYRA 2L00B 1UNSA 3NBHB 3J7A5 3T56B 1PH6A 1PVOA 4R4CA 2WXMA 2EE1A 5JEAJ 1BBWA 1K0SA 1BUIC 5CTRC 4GLSC 2JA8G 4Q5VA 2NN6G 2B63B 3RD2A 3I7FA 5D14A 1K8MA 4V190 1TWAB 5C4XB 3S1RB 3S2HH 1YD8U 1R4MI 2BB5A 3KUZA 1U4MA 4BA1I 5ELDA 2FJ2A 1FJGL 4TUUA 4JK1C 3BINA 4IFDH 3N1ZC 4X66Q 2VXWA 1HR0W 2QC8A 2DNEA 2KDIA 3PUVA 5EKIA 2WXPA 3NVZA 3L08A 3W5OA 2ZEQA 3HM6X 4DHJD 1F2YA 5KNDA 1B9NA 3AE7B 4KSLC 1IW7D 5T1GA 4W9FA 4XZ4A 2DX5B 1QT9A 1Y8RC 1NVID 2JXXA 2L52A 3DDCB 4IM3A 1S3SG 4DDGD 3EECA 1JRUA 4LJOB 4LK0M 1XYIA 4GLAC 2RDGA 4HSPA 3U7DA 2C5CA 5BR8Q 1RRBA 4ICVA 5G2NA 1AWDA 2SNSA 4CHKA 3ZW3A 1FD7D 3U9SA 1UGMA 4BOSC 4LJZC 1Q12A 2GOWA 3I4MG 1C48A 1I42A 2E74C 1I94L 3HM3A 4IJLA 3NBHA 1B8AA 1RODA 4HMJA 3Q2AC 3KF6A 4XDCA 2ASBA 1EM7A 1KDBA 4YY3L 2RQXA 5FLXc 5CV4A 4FJYA 5EQ0A 4K2LA 5FLMG 2L0FA 1DJRD 1L2FA 2C7HA 2JA5G 1VR9A 3NVVA 1WX8A 2LD9A 1FD6A 1I4HA 2I1KA 4J1MA 1CZWA 2UXDL 1WGKA 3WALA 4LFBQ 4A3EB 2A69C 1BKBA 3AI5A 3AE1B 4IFDG 3PZ7A 4KDLB 3F2CA 2BOSA 3QARA 2F0JA 3I4OA 4QJFA 2VY3A 3AE5B 3EVQA 4KKSA 4A3DH 1GC7A 1WF9A 4KGRA 1WJUA 4PS8A 3BK1A 5IP7H 3PF4A 1ZKOA 1D2BA 2UU9Q 4FXKC 3WCQA 2AX5A 5IGGA 4IUNA 3M7NA 3I5JC 3MXUA 2KVMA 3DWMA 4A6QA 3L9AX 3FMCA 4JI3Q 1JOQA 1E7ZA 1RWSA 4JYAQ 3VYUA 1SE3A 2QIEB 1GXDC 3RLOA 1PH1A 4DUZL 5CMDA 3QA8A 3RNCC 5IOIA 4E3CA 4BY7G 4ME3A 1KL9A 1STHA 3KLSX 4WRDA 1L2NA 2L05A 1GHKA 2SAKA 4CKBA 3HOWB 3BDLA 4QB4A 5G3LF 3KJPA 4BXXH 3KDFA 1LT3D 2KDFB 1FO4A 3VDZA 1PTOB 2Q5WD 1Q81C 1WVLA 5E6PA 2XSCA 3O13A 2MGSA 4IPGA 1TS2A 4BBRB 2I5HA 2BKFA 4EGVA 3HK0A 3FEWX 1U0LA 3Q8DA 4USAA 4XYQA 3MJWA 1E22A 2HDLA 2KFKA 4XX5A 1X9NA 1WXAA 1V49A 4MEMA 1VF5C 2K5HA 2Y0SG 4A90A 3TEZA 1OQYA 4NXMQ 1XWEA 3S15H 1DD2A 3IT6B 3T1YL 5ISRA 3LYYA 3TS2A 3R7RA 1PRTD 1J6QA 3K6OA 3BVGA 5EE9A 3UQAA 1FM0D 4WJOA 4JI7L 4LFCL 3GTJH 2AL6A 2HUGA 1N36L 1SEBD 2D3BA 4IALA 4X64Q 3Q8FA 2JK8A 2B3GA 2K1BA 1AEXA 2ASQA 1TWHB 4MM3A 4N58A 4DAPA 1H9JA 2LVQA 4AQYL 3VTVA 1X3PA 2HTME 3JAML 1D1IA 1C76A 2YTYA 5IGBA 1STEA 3KUCB 4P1BC 1O7ZA 5BMIA 1HTOA 4HSVA 4AQYQ 3NPPA 4HDOA 4A3FB 2ZJRA 1MIUA 4AJYB 2KQ3A 4JYAL 1LFDA 1ZGUB 4OVUA 3P42A 1K83H 4RNAA 1QZHA 1XTDA 3KVFB 1A0IA 1IBLQ 4LFCQ 1PYSB 1IL8A 1RD9D 1OXUA 2K6QA 1HTLD 2B2WC 3EBEA 5FOBB 4HPPA 3RNFC 4L2YA 2WV6D 1KDAA 1D5ZC 4KV6A 2E8GA 3SR6A 2NTSA 4RCOA 2I5LX 2JA6B 2RSNA 5DNFA 3PSIA 3RCZA 1HHVA 4XC2A 3HOXB 3GO5A 1QZGA 1CKMA 3S1QB 1EL0A 1LTAD 2ZCBA 3R93A 3CMMB 2DUDA 4IN3A 4JV5L 4P2CB 5CHWA 3H0GH 2DZMA 5LL6X 4M8MA 2AKWB 3U30A 3M4PA 4A93H 4IW0A 4PQXA 4TMAB 2MBOA 3UINB 3CF5A 4A3DB 2MJ3A 4IPHA 1XLQA 2KYWA 1WR1A 5M5XH 4MN3A 2ZVNA 1FRRA 3S2HB 2Z59B 1EY9A 1IBXA 3K8AA 4YCVA 4F88A 3L54A 4RGNA 3SGIA 5D7GA 3CP0A 5AJ3L 1PGXA 3CMEA 4I6LB 2DENB 1LLRD 1WTHA 4HEDA 2PVGC 4LF7Q 5C44B 4HJ5A 3EN2A 3C46A 3LNNA 2KTRB 1VRAB 4WAAA 4OWXB 2MRPA 2CQOA 1HUMA 2PI2A 1E90A 5M5YH 5IT9c 1ESFA 3TMEA 3NVWA 3AU7A 3PRZA 4LNQA 1BBXC 4DR7Q 2E2DC 1U4PA 1T0QC 1ACCA 2FCMA 2G5DA 1HXYD 3CCEA 1VQ6A 4IOAA 2BE5C 4AYBB 5T1IA 5E6JA 4TRDA 4ZQ3A 4ANVA 1S3OA 4NAWA 1EQTA 4AP4C 1PFBA 2IYDB 1E8ZA 5C3JB 1HJPA 2KLGA 2F3WA 3S17H 4DK0A 3MEFA 2DZJA 5IO9A 2KVRA 2MX2A 1KLVA 1A63A 1HFNA 2M19A 1MJEA 2KJHB 2VZKB 4LF5L 5H8YE 4OEMB 2PYKA 2Z6KC 3OYYA 4AQ7A 4QL5A 2KOLA 4GNXA 3VXWA 1N32L 1YN4A 2ON8A 3RNAC 1VJKA 3P1MA 1SIJA 1TGZB 3B2GA 1JW9D 1PYBA 3ALBA 3A9JB 3IXSA 2MPMA 2LASA 1D8LA 5D65A 3CCRA 3GTMB 2N88A 3EQLC 5FKAC 2EELA 1CUKA 3QOLA 3BK2A 2GBNA 4OGQC 2XRSD 1UAPA 1GVPA 4P72A 1Q1BA 4GS3A 5CHFA 1X3GA 3ZIMA 2MNAA 4RM8A 4I65A 4JI1Q 1QVFA 4A93G 2Z1CA 5BN4A 2CU3A 1BNZA 2EY6A 1QWYA 3CCMA 1KDCA 3MA2B 1HZ9A 2PZTA 5FLXE 3G6EA 1WXMA 2AUJD 3DVGX 3NTKA 1A8VA 4KSKC 2GBMA 5IA7A 2VB2X 2K5QA 5E4XA 3CRKC 4ID6A 3A7LA 5GQOA 1R4NI 3QWZB 4W9HA 4DXGA 4WWPA 2Z0SA 4UDUC 2DYBA 5IGFA 3TEYA 2HE7A 1JB7A 1YJJA 2EJFC 3H91A 2INDC 4KY7A 1GM5A 1IKLA 1EWYC 2DZIA 2HIXA 3H6MA 2JA5H 4NW2A 3AB5A 4Q0FA 1XD3B 1R4NB 2WAQB 2L7RA 3PHXB 5C1ZA 1GC6A 1FL0A 1JWUD 4U673 2LS01 5JOBA 1YN3A 4S17A 1YQ4B 3X23A 4C3HH 1Y1WB 4BKTA 3SR1A 1CT1D 5E1FA 1WJNA 1OXXK 5EPJA 2M0XA 5AEKB 5MPOA 2NVXB 5ELEA 4O42A 1SJHD 2VUMH 4JI0L 4B9KA 3UDFA 2O4XA 1VQ8A 3N6RA 2IJ0A 1EU4A 2ACZB 3A1QB 1HNWL 1C9OA 2Z0EB 2EYFA 1WM2A 2D3AA 2WDTB 3SK6A 4JI0Q 2JRHA 3E5SA 2KJ6A 2V4LA 2JA9A 3WOEA 1AYFA 2B3AA 3CD6A 5DM73 4B9WA 4LUOA 4WJ4A 3AEEB 3UDXA 4XT1B 1EYAA 2I07B 2I2YA 4P75A 3P75A 2RA4A 1CSQA 3RZFA 3K9PB 5A2QL 3ZQ4A 4ARCA 3I9V1 3GTGH 2EKIA 3B0AA 3B1LX 4W9DA 1EEFD 4RGOS 1OXVA 4XDXA 4V0BA 1EIFA 2JZZA 2KMCA 2R2OA 4NJ7A 3WIMA 3M4OB 2E5LQ 3VA5A 4HAEA 1I35A 1FNUA 1PMRA 1SB3C 3HEJA 1NI2A 2FAZA 3DMUA 4KD4A 2O6VD 1AE3A 4DV5Q 2LRWA 4LWCA 4DV7L 2J0KA 1XO3A 3U8ZA 2C35B 2D62A 1T3QA 2G45B 3P4RB 2HD3A 2ZJDA 1IYJB 4JE3B 2JA8H 1CZPA 4HKZE 4R3DA 1C4QA 1JE5A 1SXTA 1F2RC 5HG2A 4BY7H 1QB5D 4C3HG 2K5PA 2K8BA 1K83B 3RNUA 1PH2A 1EQRA 1SN8A 2RSOA 4GMVA 1RFAA 4XQNA 1OGWA 2F52A 3M85A 1EYCA 1K53A 3C0RB 2EYHA 1BR9A 2K7VA 2R6GA 1XCTL 2OXPA 1YOVB 1CQVA 2K03A 2KEDA 1P7FA 4DR1Q 2ZJPA 3AULA 2PCFB 2H89B 3GTOH 2AYOB 4JBWA 5CV9A 1LYLA 3UDIA 5JJIA 4FHKA 1VQMA 4UHVA 3SE0A 5KIXA 2JA6H 3PO3H 1W3SA 3NE5B 1L7YA 3IAS1 4ZRQA 2G3QB 3PLVA 4ANXA 2BYEA 3TCAA 1U9RA 3BZDB 4AIMA 4B08A 5IWAL 3SDZA 1X32A 1N33Q 2UXBQ 3PVLA 1OTRB 3TP7A 3VR2A 4N8X1 1WSPA 2L83A 2BT6A 2DAJA 3NG0A 2K5VA 1FEHA 2OF1A 1WTWA 4ANUA 4OZCA 3ZYYX 2F0FA 5NUCA 4LNIA 4HPMB 3SD5A 4X65L 3GTPH 5FLMH 2WU5B 1I94Q 2UUCQ 2BVCA 2A6ED 2M56B 3NP8A 3U4EG 3HRZC 3GTPB 3P63A 1VQ9A 3ULJA 4A3IG 2FUHB 2MCNB 2Y0SE 1V43A 4II2B 3T9LA 4POGA 5CR3A 3BJUA 1NR4A 2W82A 2KXJA 2AMCB 3CHBD 3I4MH 3N1XC 4MGIE 4E74A 5LL6S 1U5KA 1Y69U 1PZID 1J8IA 3S1NH 1LXDA 2R93H 3AYHB 4DV0Q 5EE0A 1CKNB 5AJ3Q 2V4DA 3M4QA 1TWFB 5BN3A 2BS3B 1Z47A 4HJKA 3BVMA 4QGUA 3A9JA 4GOCA 3S2AA 3H9DA 2O6VB 2F0EA 2LY7A 3A5ZB 1PV4A 2UYZB 1QF6A 4A76A 1G6JA 1YQBA 1QILA 1R9TH 5HKHA 3CMAA 5J2RA 4RF0A 2XK5A 4J15A 3PIOA 1B2TA 1HNXL 4WJPA 4KKUA 3FVQA 2W54A 4HLEA 2MUYA 2RKSA 2BWFA 5KEEA 3HOWH 2JZPA 3DLLA 4ZHPA 4QQBX 2GVAA 1DOKA 1KM7A 3V3XA 5LMNL 4WJWA 4WWOA 3S16H 4C3HB 1Y1WH 3I4LA 3DM1A 1WI5A 2V1CC 1BCPC 1RIPA 2EZVA 3H6NA 2J0TD 2Q2UA 1EOTA 2NN6H 2F0PA 4A3LH 2BW2A 4LK1C 1IUEA 1D7QA 4ITKA 2CHWA 4IO9A 3NVYA 2BA0A 1EQVA 3J80E 3DWAA 2EYOA 5GAGC 2HQEA 4DV5L 1C7YA 2JJQA 4URKA 1V97A 1TS4A 4BBSG 1N9WA 4KGTA 2JZ3B 1P7EA 4NZLB 3P4QB 2WYQA 4TVAB 1TWHH 1UZXB 4IM2A 2XVSA 1DM0B 4HCEA 4F8MA 1CI3M 3PZ8A 2M9VA 2JA5B 1VQBA 4Y7NH 2I38A 2YVCA 1DOLA 4ZOHC 2KDEB 2F3VA 3A1QA 3RNGC 2MFIA 3K7AH 3J7AV 3A9KB 1PH4A 4G7ZC 2BDNA 3F8TA 4EQOA 3JAME 4NAWB 1IYFA 4X64L 5LNK1 1Q5WB 2B2WA 3IKJA 4C3IG 4GNXC 2WU2B 2JEBI 1XNQQ 1K0RA 1Y56A 1C77A 3P20A 1MI2A 1VZ8A 5JZEB 5C0XJ 2MWSB 3OTOQ 1V1PA 2K5WA 3TZDA 1OTCA 1N32Q 2IY5B 2WINB 1YZ6A 4CDFC 2KDMA 2N9KA 1KAAA 1JRPA 1BBUA 2GBRA 4RHSA 2E3TA 2CH4W 2CKHB 3Q69A 2KEEA 4A3MB 1SRUA 1R4MB 4OIKA 4DV7Q 1WRIA 4FULA 4JPSA 3V05A 4YWMA 3I8ZA 4MT5A 1XEEA 2ZJQA 4B3ML 3CIRB 1II3A 5CV7A 3D0FA 2C9OA 3HVDA 4FF4A 3AECB 2BBCA 5COYA 4ME5A 4DV1L 1E0BA 3T1HQ 1SYDA 4TSSA 4DUYQ 4HKQA 3N30A 1WI0A 1WY8A 1P9DU 3EFCA 3AQQA 3NHEB 4HJ8A 2Y5PA 4CKCA 1Q90A 1J7AA 2BKRB 4KTAA 2GA4B 2NUCA 2RR9A 2W9NA 4C3IH 3DQVA 4LJPB 2X6LA 1W6KA 3CCQA 1WFYA 1HPCA 3AE2B 3AEGB 2OWOA 5C23A 2ZXOA 1STBA 1E7VA 3ITPA 1WGGA 4LNFA 4HWIB 4JGHB 1QOBA 2NBVB 4KGSA 3CQZB 4M8NA 4HK2A 2NVQH 4EEWA 3J80L 4FJZA 4BXXG 1HZ5A 4RHRA 4RH6A 2JEAI 4DR2Q 2JXMB 2K5DA 4R4OA 2HJ1A 4IWOA 3GTMH 4YWLA 3VA7A 2PKOA 1ONLA 1JJCB 2NZHA 1PTOF 1PH8A 1OQRA 1K3RA 4MHEA 2ONQA 1PYWD 3NWTA 3BDCA 4GSWA 2Q2TA 2RDFA 2XK5B 2RCFA 2DLBA 1J5EL 3S1QH 4KHPL 2D0OA 1IBML 3CC2A 4GDKB 2N7JA 1FR3A 2D2CC 4OONA 3VQIA 3S17B 1I4PA 2Z4IA 2M4NA 1ZP0B 3L0WB 4DA2A 3FC4A 3L2PA 3I90A 5M5XB 1GG3A 4B3RQ 2PZWA 3U7ZA 1NNXA 4PZ7A 1KXLA 3E9HA 1MHHE 2EMSA 2EYMA 1KFYB 5GADC 1S5BD 2CHXA 4GGQA 5CV6A 1EWIA 1V5OA 2EYPA 1JWMD 3DEPA 4LF8Q 2BYFA 2GI9A 3NBIA 4EQ5A 1BF4A 2BYVE 3SK4A 5C4ZA 2PTLA 4YXDB 5KYIA 2L0CA 3QIAA 3QR8A 4KN4C 5C44H 4DV6Q 3SVMA 2R7ZB 1YIWA 2LXAA 3J7ZC 4EZJA 2K8HA 4LF8L 4PZ6A 3R66C 4NQLB 3RD4A 2KCNA 2DY7A 1OFFA 2KFKB 3HOUH 1ZDXA 2PEAA 3R3MA 3T53B 1HNXQ 3TUOA 2E6XA 1E6EB 3KWVA 2WP8J 3H94A 3A4SC 2I0QA 3OAWA 1NY4A 3S1NB 3DWPA 4R4TA 2KHJA 4X6AH 3RI7C 2HCIA 3I4MB 3NTHA 3KDFB 3HOZH 3CCVA 4HIOA 1C79A 4C7YA 4LDTB 4H2AA 2WXFA 4IPCA 3OHXC 1QNUA 2FE8A 1N8RC 2ID0A 4IJHA 5EBCA 4ZLTF 5C0XH 3GE8C 5CBAE 5TR5A 1CHQD 3KF6B 4OIJA 2DWQA 3J80c 2D9UA 3PIP3 1CQFA 3D4DA 4DK3C 4X3SA 1I6HB 2K14A 2ZW0A 4NY0A 3PO0A 4A3JG 5IP9G 1H95A 3I70A 3OWFA 1UD7A 1PRTB 2WAQG 3ECIA 1IPGA 3Q14C 1EIYB 2F4IA 3GD7A 5E6NA 1X3QA 4LF4Q 1GUTA 1H9RA 5IP7G 5L83A 3STBC 3VR6A 5G3LD 3TJPA 5FJ8G 1RDPD 3VUXA 4EOYA 3S1MB 2LEKA 3TS0A 1K52A 4W9EA 3LX0A 4DBGA 3GTKH 4LDTD 1EYGA 1JWAD 2JA8B 3HZXA 5C4XH 1ROEA 3C1FA 4LAAA 3PREA 5IOCA 4RKBA 2L9HA 1C3TA 4JOIC 3ULLA 2KHSA 4QUFA 2R92G 3PO2G 1I5FA 4JI1L 1V81A 4M8AA 3LWEA 5IYBH 5JPMC 1G8ZD 4HCNB 3LWUA 4JX1C 3P7JA 3MC9A 5GAEC 2C7MB 1YJ1A 3DWQA 4ILWA 3GTOB 4KY6A 1MFWA 3WAMA 1VQOA 2KKCA 4C3JB 1EWCA 2Z8LA 1V86A 1VQ7A 2AL3A 2DYMA 2XBBC 1J19A 4OWWB 1UELA 2W55A 2VH2A 1HH2P 3I72A 5GROA 1E8WA 2L1AA 4MELA 3UIOB 1NTGA 1V1OA 4DK5A 3BDOA 2JA7B 5DAUA 4L1BA 4IDIA 1NDDA 1EY6A 3M62B 3AU4A 2K33A 1DCZA 1UWXA 4HJ9A 1Y8NB 4S0RA 4AYBE 1WX9A 1EEID 1EIGA 4C3IB 5J17A 3UI2A 3BYYB 1Q8IA 4G3XB 4IM0A 2Z9HA 4J6HA 4RCNA 3L10B 4UP8A 4BKSA 3IBEA 2FUG1 4JV5Q 4BY7B 3CF6E 4NDXA 1GOZA 1STAA 2MQJA 5FO9B 3UI3A 2K1FA 4XXEA 1KABA 4JQWC 1X56A 3FDTA 2KC1A 2LHDA 1C78A 1ZXHA 4LF9L 1LUZA 4OX9Q 1YNND 4KLKA 4C56C 1SR3A 2OT2A 2JVCA 1QOGA 4X57B 1M90C 1GUGA 3AE3B 1C9FA 1DZ1A 4C00A 4IFDI 4HTHA 3DWGC 3W1SA 4BS9A 1PLFA 2IT1A 1EOVA 1E24A 3CCSA 1JCKB 3HOUB 4HIDA 2PO4A 4ZRKA 3ZO5B 1XNRQ 5DM63 1SMYC 4ACFA 2VUMG 5C4JB 5M3FB 3HKSA 5IODA 2F1MA 1T0YA 1LT5D 2I5MX 3EFXD 2B2VC 3DBHB 2Q8RE 1P8LA 3PUXA 4NP5A 5HY6A 1K8GA 4FF2A 2K6DB 2YYZA 3DHQA 1EY7A 2MHVA 4JBJA 4WJNA 1MI0A 2D11A 4I7ZC 5M9OA 1EZ6A 1TWGH 4DR3L 4OO1G 1F0ZA 4A9AA 3AFQA 1YX6B 5IWAQ 1KLUD 1VD2A 3J81L 3VUWA 3CQZH 3Q6SA 1E0ZA 2K32A 1E1OA 4L5SA 2V4IB 3N32A 3TQYA 5EDSA 2HIVA 1F77A 2PZUA 5KNBA 3PMFA 4DAYB 3H7PB 1RTNA 3A7AB 2L76A 2UU7A 2QHOA 1ICFB 1P16A 3G71A 1HZCA 1PTOH 2KWUB 1D1KA 4GN5A 2C7NB 2K22A 2KTFA 2G1EA 1FFUA 4CKEA 5BMGA 5I9OA 2B8FA 3MFYA 1PGBA 2KLCA 4H13C 1TWFH 3OW7A 3ULPA 3BY4B 4E71A 2KT7A 3L3OC 3C2PA 3ZXRA 4QMGA 4B3SQ 1TKWB 1YI2A 5EE1A 2CS4A 3E0EA 2LRUA 1CKNA 5KGUA 1N5XA 1NE3A 3VR5A 2K28A 4FXDA 3Q3NC 4G11A 4X3UA 1WJ4A 2QDLA 4ZDVA 3G6JB 2O6VA 3WANA 2CCZA 1LTGD 5EKLA 4DV1Q 4JBKA 1YJIA 3ZNID 3JC66 5C6AA 1L4ZB 4A3MG 4MNOA 5I6YA 1YHAA 4MGZE 1V1QA 2NN6I 1WCMB 4DK6C 1K9MC 2ICEC 1TZOA 4PMCA 5FK9C 3NZSA 2PNRC 3S16B 1O80A 3A74A 1UUPA 1XF5L 2IGHA 2WGSA 1D5MC 4O1NA 4KKIA 4TKNA 2KAJA 2HJ8A 1E2ZA 4TQ0A 1YHQA 3R2IA 3O65B 1I4GA 4B3RL 4NPSA 1GHJA 1WXQA 2L4NA 1NBWA 5C3XA 2XEWA 1FGUA 4LUZA 4FNFA 1QCBD 3HOVH 1TIID 2R3ZA 3UE0A 2NVTB 1CMXB 2PE6B 1YNJC 3RZDB 5JEAH 2B63G 1ZXIA 1W6JA 1ENCA 1VQHA 4OWTB 2K3UA 3D31A 4EKUA 4P73A 1LTLA 4GIVA 4KN7C 2OHFA 4ZUJA 1G291 3FILB 4K14A 3A8JE 4NXNL 2KFJA 3D6WA 4J3OD 3UQBA 4UY8C 4BBSB 1JICA 1I3QH 3I3CA 2YU9B 1J7CA 1MJCA 3AE8B 3N9YC 5G5HA 3M95A 3F2UA 3KUDB 2LXCA 1K3BC 1R4QB 2JA7H 4FN2A 4DHZB 5A2QE 3PO2B 2R92B 3E9SA 2A19A 4JI3L 1HR0L 1VDVA 2F0UA 3FPUB 2LXJA 1XMQQ 3ICEA 4WWNA 2N55A 1DGSA 3K5MA 4ODGA 2LZ6A 4DXAB 4QY7A 1DYQA 3ZJUA 3HFZB 1TT5B 4WORA 1XMQL 2VH1A 1I4XA 5JVG3 4FA6A 1F2MA 3SK5A 3KFUA 4HVBA 4DAVA 1C4CA 4F1SA 3CWIA 2VZAA 1F1HA 2WACA 3S1RH 5C3EG 2J7ZA 4A3PA 3UGBB 5E3FA 1KLGD 1MSGA 1QUQA 1K28A 5IE8A 2K01A 4MH0E 2M8SA 2F0LA 3V6CB 4CYEA 3A8KE 3Q8CA 4F7XA 2AHOB 1YX5B 1YBYA 2Q8IB 1NMGA 2IWHA 4BY1H 3HKZB 4KMUC 4IG7B 4A3KG 2KVZA 4EUTA 3DM3A 3VYTA 3DVNU 2FXQA 5ELOA 2WXQA 3FKYA 1GPXA 2QEXA 2LJIA 5JPNC 1LT6D 2NBUA 5LMUL 1WD1A 2IDYA 4DR4L 3ZJYC 1IBKQ 2R2QA 3A5UA 4JI2L 1J7BA 2M17A 1ZXTA 2LVPA 2D10A 1UWVA 4UPAA 1E3PA 1Q7YC 4A3FG 4XIGS 5DLQE 3WAPA 3J81i 4PS3A 1I50H 2JQRB 5I2YA 1MVKA 3M3YB 1NR2A 4C4VB 4ANWA 1EIHA 4H44C 3J80i 4DR7L 3VTUA 4PV1C 3SHLA 5BMHA 2BH8A 1MPEA 3QCAA 5L37A 3Q3JA 1D6EC 1GJZA 2WHIA 1ISNA 1P98A 4BBNC 5LLIA 3NS1A 5IGCA 3HOYG 1LTID 4BY1G 2WXKA 2HT1A 2KECA 3IVFA 2IY1B 4J6IA 3CPFA 2JXTA 2MO1A 4MTKA 1I6VC 2LMCA 3IRBA 4XQJA 3HRDD 4TQ1A 1HTQA 2KWCA 1ENFA 4W9GA 1A3VA 3I4NH 1BXTA 2B2UA 1O78A 2NVYH 2OEDA 2RDHA 3HOXG 1TU2B 2IX1A 4IKGA 4C7ZA 1FGBD 4H02A 3VHTC 1E5WA 1Q82C 2V3PA 1B9RA 3TZUA 4A3BG 1HQRD 1DOMA 1KTKA 4YHHL 4GKKQ 1XMOQ 1AP0A 1WGYA 1KRSA 4N9F4 4OVVA 2A5HA 2F0OA 2EQSA 4FLHA 2MBHA 1VQCA 2OJRA 4LFAQ 1KNAA 2UXDQ 1R9TB 3SFEB 5KHQA 1PQSA 4K7WA 2LGDA 3Q3FA 4JWSC 2KJXA 3T51B 1K8RB 3P4SB 3PQIA 4K5VA 2A68C 5ELNA 4II3B 4OW0A 1L0XB 1LTRD 4YY3Q 3KUPA 2VB3X 3L16A 1V8CA 4FDBA 1R7SA 4PG3A 4IC7B 3RNBC 4DR3Q 2WNMA 4B3TQ 4DV2L 1I7HA 5JVH3 1MG4A 2SNMA 3Q6BA 3HOZB 3RT3B 3DBSA 4ZKBB 5HI1A 1GUNA 1SSOA 3N52A 2MBBB 4KJNA 4DF7A 3QJZA 3MTNB 1PFMA 1NENB 1F9RA 2WB1G 2QA4A 5M3MG 2LFIA 2CQAA 4K0KL 1WYWB 2XIWA 1Q1OA 2JY6A 5FLXL 3VAWA 2Y5CA 1N5WA 1RKNA 1IP9A 4HIMA 1TR5A 1N62A 1JQYD 3HS0C 3R8BA 1WCMG 5IYCG 4P6VF 2K04A 1S5DD 4TKOB 1WRDB 3AEBB 4K3CA 2E5LL 2KACA 1N63A 4EFOA 1AE2A 4NXNQ 2K25A 3NOBA 3TIXA 1VQFA 2ZTDA 3HG9A 4DR4Q 4US9A 1E8XA 1WTRA 4DN4M 1SAPA 2BQQA 1NUCA 4A75A 3PF5A 2BPSA 2MJDA 1STNA 2B29A 2FIDA 2GMIC 2XRQD 2D3CA 2QGQA 2IO3B 2PPHA 2AWTA 3EUB2 3TRZA 5J3BA 3T3OA 2YEPB 4LNNA 1PA6A 3U52E 3LDZE 4A3CH 2M1MA 2OQKA 1T5EA 2WB1B 4NXML 1XX8A 3C1EA 4B6WA 2YTVA 4RMAA 1YHBA 2EKEC 3MWYW 1SE9A 4DGZA 1FRDA 2DHZA 1MSHA 2WXGA 5K5PA 3TL5A 3DVGY 4GDKA 4NMZA 2CH4A 2FMMA 2N0SB 3UE1A 2FIFA 2WLBA 1VQAA 3U4ZA 4HJAA 3BS1A 3IT4B 4OO1I 5CBEE 4A20A 3DCGA 2RBMA 1PGAA 2KCMA 2GVBA 3F2DA 1HRJA 2A73B 2NCNA 3ZUNA 3IFTA 4JPBW 2YU9H 3RYTA 1A5RA 2AQ3B 3HKZE 3VR9B 4JVZA 1RHPA 1JOOA 2WXLA 1BCPB 1QKZA 4HR7B 1B50A 1CHPD 2IHFA 3AMUA 2UWQA 3AE9B 4KDIC 3NXWA 2XGTA 1KQSA 1YNJD 2EPBA 5F2DA 1VCBA 2LFNA 3V2TA 4DUZQ 3ENEA 1L4DB 1AN8A 1X1MA
chains in the Genus database with same CATH topology
4WWMA 4MIUA 1QOHA 2QMTA 3DXJC 3MHBA 5BYQA 3KQ4A 2EJMA 3A55A 1XXGA 2WDRB 4PT5A 2AUKA 2EYLA 1K8OA 4YSZB 1GUOA 1MBYA 1Y8PB 4DQOC 3Q22A 4L23A 4U68A 1QOFA 3NQTA 3OMGA 1IKMA 1DONA 3LXFA 2M2LA 2WDQB 3E6ZX 4LMQD 1NEKB 3OIPA 1IGDA 5HHDG 2SDFA 1QJOA 2FBWB 2E2JB 5HFYA 2X38A 2RMMA 2B2YC 4RWSC 3GTLB 2JU6X 2K0PA 4KX6B 2QCPX 1M4VA 1PRTC 1JORA 3BWUD 2QEJC 3BVZA 2JSVX 5HURA 3AV8A 2A74C 3AE4B 4ZUIA 1ET6A 3K5LA 2F0SA 3S9WA 4WAFA 1SNDA 1DOXA 2WQYB 2WKCA 1TYGB 3I57A 4YSYB 3OPOA 4IZ8A 3FPPA 2PIAA 4R8IA 1YNTE 3CRLC 2BB6A 5IGEA 5I9PA 1AFPA 4FXGC 1EYDA 3GTKB 4ZKCB 1HQMC 4B0EA 5K36G 1JOKA 4J8QA 4ULLA 1FXIA 4FO2A 3I4NB 3MVVA 1I4RA 1A6XA 1FMAD 2BCOA 1QG7A 4S3SA 1A2UA 1NYQA 1YQ3B 3E0JA 1PZKD 2F0NA 3OWEB 5E4WC 2LKVA 3T16A 4KD3A 1CFMA 3GTQB 3TDQA 4ZRPA 1IYUA 2LUMA 4A3JB 5C0XI 2JX5A 1IW7C 4K5WA 4GDLB 1A2TA 2A69D 1JMLA 2EY2A 2H1EA 1ET9A 1XLNA 1DOYA 4IUTA 2DN8A 5ELCA 2VUMB 1PTOD 4XDDA 1ENAA 3ZJVA 2O5JC 2ZXPA 1S5ED 4N9PA 2W3SA 2CW0C 4QF4A 3RFZB 3W5UB 2B2TC 3RMHA 5AUIA 5J1ZA 2LMCB 2KA7A 3GTGB 2PMVA 1RYJA 3L4PA 3GB1A 1G91A 4OVZA 3NWSA 2BS2B 5T8IA 2TMPA 1VCIA 3QOJA 3MC0B 1CK1A 2YEPF 2MP1A 4MACA 2L55A 4B0MA 3OMCA 2CJNA 2EXZA 2ICIA 5EPLA 4R9WA 1CA5A 1A15A 3TEWA 2VNUD 1VF7A 4HCSA 2L1BA 4XWWA 4F87A 2FINB 2PMZB 1SYGA 3TEXA 3MFGA 1ZUD2 5KYLA 2M0AA 3NRZA 5CV8A 1O7LA 4A93B 3EGRA 1SNOA 1GB4A 4HRSA 2IX0A 1SDFA 2KQ4X 4M0WA 1OO9B 1FCCC 2PLPA 1SE2A 4E6IA 3U2SC 1GAQB 4RKLA 1SMYD 2CW0D 3BG3A 4IURA 3IAM1 3HOYB 1JWSD 4MM3B 1JQ4A 1FNWA 2NBFA 3SXHA 2R93B 1YNNC 2INNE 3KLRA 4IUVA 3A8IE 2XWJB 2RVLA 1CTMA 2A68D 3BIID 2KN4A 1KNEA 1STGA 4ZK9B 1EY4A 5C4HA 2WXJA 4LTUA 5CC4A 2BS4B 2IGDA 4R8NA 2JE6I 3W9CB 5C5MA 3GS2A 5JAVA 1H9SA 1B3AA 3K58A 2WXRA 1JE4A 1RCVD 3TN2A 3MXGA 4YIJA 4A3IB 4HJGE 1SE4A 3J9CA 4ZAIA 1RF2D 3PIO3 5IT9L 2V3NA 1OXTA 2F0GA 2ZW1A 4NJCA 4RF1A 1SJED 1AZQA 4PMBA 1HEZE 1F2RI 1Y1VB 3D3RA 2NVYB 4YSXB 1JALA 2PW9A 1B1ZA 5TSSA 4C1NK 2TSSA 5I2XA 2JYOA 5D3DA 2EY1A 1D5XC 4X3KA 1Q1EA 4TQUS 3MJ5A 3WOFA 5H92C 3H09A 4A3GB 2Z4HA 2H4OA 5J39A 1U4RA 1JWBD 2GB1A 1Q3LA 5JEAG 1SSNA 4D2KA 2WXIA 1N60A 2X69A 1OXSC 4OO1H 2PPBC 1XLPA 3TBIB 4IUPA 1E10A 5AFWA 2B2TA 2WKDA 3R3OA 1ZDVA 3RPFC 3K0YA 2F0QA 3TP8A 1LO5D 5BN5A 1JB3A 3FRPB 3NQIA 1EY5A 2CJOA 1PZJD 3K59A 1BOSA 1HZ6A 3S14B 5C2TB 1LABA 3ERQA 4KI0A 2KUMA 1A3TA 4K8JA 1YMHE 1SNMA 1F9PA 4HROA 2JP1A 2JSOA 1WTOA 3KBXA 1JC7A 5ELBA 2NVQB 2NB0A 2LGIA 3FILA 2NMQA 3Q8AA 2SEBD 1MGSA 1IGCA 4UAIA 3AMZA 2DY8A 4K5XA 1WD0A 1IYVA 4Q2JA 3GQBA 2AWNA 4OL7A 4N9TA 4NKLA 5JXVA 4ZYSA 3D8GA 3ND8A 1D4BA 2JYEA 2JWUA 5DEHA 1CZGA 1FYCA 1PRTF 4QCLA 2E2HB 1E2VA 1TQOA 3HGBA 3BYTB 4RGTA 1LACA 1EWHA 4P16A 3VR8B 4RAUC 4HEA1 1CA6A 2WP9B 2B39A 1B53A 4IQZA 1TWCB 5CGKA 1AZPA 4YTNB 1BUVT 1WTXA 1LV9A 3W3AA 1QNKA 3J7YW 4YT0B 3MZ5A 2E2IB 2QJLA 4RGMA 3R2TA 3FKIB 1C4AA 3OOCA 1B9MA 1ESRA 1ZYRD 1PUTA 5C0XG 1E7PB 1J9OA 1B4OA 2BDOA 4XT3B 3HOVB 1Q10A 3GV3A 3DEOA 3GV6A 2CHBD 4H7BA 1G2TA 3MEHA 4DXFA 4FF1A 2NYZD 3J81E 3GP7A 1KF6B 3B2FA 1GJXA 5EKKA 2J42A 2EVBA 2MEKA 4B9XA 1BQQT 1V1PB 1WWTA 2L11A 1TS3A 4ARIA 4KJOA 3T3NA 4K2KA 1STYA 5IT9E 3H0GB 1KH0A 2E75C 4JWUC 1SFOB 4Z9CB 3ZJTA 1PXUA 4AS1A 1MHXA 1SNQA 3NZ3A 4WIPA 4HMIA 4YWGG 3G7LA 1T5XD 1TKGA 1M8AA 4RFBA 1A3UA 3P1HA 1RFKA 3LB8C 5EE3A 5JJZA 3AN1A 3TSSA 4FVMA 3V96A 5EGTA 1QQRA 1TT2A 1SF0A 4L63B 1Z6HA 2OEOA 4C1NI 4IUQA 1H9SB 1L0YB 1I50B 3VYSA 3A54A 5K36H 4KK7A 3QO2A 1VZ7A 1UEAB 2IL8A 3VR3A 3MP9A 1ICWA 5I6WA 2ZT9C 4KHZA 2BE5D 1BDOA 1QE6A 4WURA 2FMCA 4NAMA 1LTTD 1YN5A 4BY1B 1F9SA 2G9DA 1K51A 4DAYA 1FFVA 4OZAA 4XE0A 2CVRA 1ZE3D 4IFDJ 1ZPSA 1S5CD 4IUUA 3DUZA 5M5WB 2IPKD 1NSNS 3HUIA 1TWGB 2LHEA 1ML0D 2IGGA 2A6HD 2J52A 5CYUA 5A35A 5D3IB 3EJIA 1T6BX 2ZXRA 3EROA 3VR4A 4DU9A 3PUZA 1C8CA 3QJYA 3ETRA 1Y8OB 5EPKA 4WH4A 3Q23A 1UWMA 1L5PA 5FO8B 5KRUA 1PTOC 2O5IC 2K6AA 1XTCD 3D6CA 1UGJA 2EYJA 2QKIC 1EZ8A 1HA5A 4KKTA 4CJ0B 3GTJB 3KK7A 1VZ6A 1FNVA 1FXAA 2J53A 1DXMA 5CORA 1Z7TA 4K6LA 1TS5A 4DFAA 5C5LA 1RM6C 3NK9A 1NYRA 2HCCA 1QOAA 3D4WA 2FFKB 1NI3A 1RJTA 1TY2A 2I46A 3KLSA 2D5DA 2R61A 4BA2I 1CJEA 1TKYA 2MJ8A 3C8YA 3TP5A 3W2DA 2QSDA 1SNPA 1E2WA 4WQMA 2B2YA 2B8GA 2G9HD 3EA6A 2F0WA 1SYCA 3CKIB 5GXGB 2Y3AA 1E9MA 2F03A 1N61A 2PQEA 2HDMA 3ND9A 2XN9C 3K57A 3E56A 1V8QA 4CHTB 3IAYA 3M7GA 2HDEA 2AQ2B 1WTVA 4WFN3 5LHY1 3URYA 2O2LD 5C3WA 3PUYA 4IOIE 4DNTB 3K5NA 4KKJA 4CQNA 4XTCS 3D4RA 4PMWA 4C3JG 1XLOA 1IBXB 4N59A 3NSWA 1R4PB 3AB9A 4OHJA 4YTPB 1GUWA 4EQPA 1WTPA 3PO3B 4EE2A 4MH8A 4QIWB 5IGDA 4FYDA 2M00A 3P4PB 3J7AF 4RA8A 3W5VB 2KMMA 3FAHA 3I91A 4DNRB 4C2MB 4G7OC 1L0VB 1SYFA 4A3KB 1PFDA 1SYEA 3ONAB 2PVOD 3T13A 4C80A 3A56A 4FF3A 1HTPA 3CU7A 2F0HA 1MD2D 1LTBD 1BCPD 4XYOA 2DYOA 2PW5A 4DK1A 2INPE 4CJ2C 1SBBB 2F0VA 2NWGA 4LLGM 1BO0A 1A70A 1VDZA 5J22A 2MJEA 5BYSA 3PV0A 3X3MA 1VMPA 1G6ZA 2FHTA 3AM9A 3X3NA 3NUCA 1H9KA 1HFGA 3AE6B 4BWGB 1KRHA 4US8A 4EVOA 4XWTA 1HCZA 3HP3A 1I3QB 5CV5A 4G7HC 3AEDB 3NUHB 3S15B 3WDNA 1NCVA 1S5FD 2D5GA 1C4PA 2F0KA 4N6EB 3Q8BA 1VLBA 2VZKD 3K7AB 1G2SA 3KWLA 2XWBB 1FCLA 4A3BB 2WDVB 5FR3A 1AW7A 3C3LA 1ILPA 5FO7B 1EU3A 5HGTA 1L6VA 2K05A 3ABVB 4CBVA 2SOBA 3S2DB 1B44D 2EY5A 1LTSD 2JYTA 3HVZA 1EY8A 1LT4D 3PUWA 3Q24A 2AWOA 2L5TA 4QUCA 2A6HC 2F0DA 4EQNA 1SNCA 1F9QA 2IX3A 3Q8EA 4G4KA 1I4QA 2QDBA 1WTQA 4YTMB 5M3MB 5I4DA 4ABNA 1HA6A 4XQQA 4Y7NB 4K8IA 1XCQL 2F0IA 4G57A 4K6DA 2N9LA 1GUSA 3VRAB 1VMCA 5EBDA 2PW7A 5IIFA 3ZGZA 2WXOA 4CGYB 4A55A 3Q0AA 4X3TA 1L6UA 3I73A 2Q8TA 2MH7A 1TJEA 1K50A 3OIQA 5ELFA 2QF7A 2L12A 1PDQA 1BMLC 4CJ1B 1F2ZA 4A8XC 2NZ1D 1EFID 3SFDB 4PNYA 1PDXA 2AQ1B 1F2LA 5BYRA 3MXNA 2QILA 3M4YA 5AUKA 2WXHA 1DGJA 1JROA 3IL8A 4GZYC 1GB1A 2GRIA 2NTTA 4L6TB 2X6GA 2BTEA 4KHVA 4REZA 4FXCA 3U9OA 3H3VC 1CM9A 3AEFB 1PFNA 1S4ZA 3MTSA 2XNAC 1NAPA 5G5GA 3RZOB 3KBGA 2KCCA 2BA1A 4OZBA 1ZYRC 3K5OA 1OQQA 1ILQA 2EOTA 1TKEA 3QWNA 3RLFA 4KY5A 2DNCA 2ENBA 5M5YB 3OSOA 3H8HA 3B9JA 1JR0D 2W3RA 1FIQA 3IFDA 2WIIB 1HUNA 2B76B 5KNCA 1QLBB 1ZEQX 3QG1A 4M1UB 3MXPA 2DBYA 3TP6A 1IHZA 1U4LA 4L8JA 3SK8A 2IW3A 3MAQA 4H0LC 3VRBB 3SEBA 3KF8A 2KWDA 1ZOYB 2BYTA 2Y0SB 2A6EC 3MHZA 5EJWA 1RTOA 3L7ZC 4HN7A 3QB3A 1EY0A 1DOIA 3NTIA 2F0TA 1TY0A 1WYGA 2WS3B 1O7YA 2EDGA 2WXNA 2B2VA 1H9MA 2H88B 1SYBA 1BCPF 2J4XA 3RUZA 2RPVA 1TVXA 4FP5D 2V0GA 2B2UC 4ZRZA 2K9XA 2F0MA 2E76C 4ZHOA 2L32A 2EJGC 3T4AC 3AEAB 5C3EB 3NHHA 3VYRA 1UNSA 3T56B 2WXMA 2EE1A 5JEAJ 1BUIC 4GLSC 4Q5VA 2NN6G 2B63B 5D14A 1K8MA 4V190 1TWAB 5C4XB 3S1RB 2BB5A 1U4MA 4BA1I 5ELDA 2FJ2A 4JK1C 4IFDH 2VXWA 2WXPA 2DNEA 3PUVA 5EKIA 3NVZA 1F2YA 5KNDA 1B9NA 3AE7B 1IW7D 5T1GA 1QT9A 1NVID 2L52A 4LK0M 1XYIA 2RDGA 4HSPA 2C5CA 1AWDA 2SNSA 1FD7D 3U9SA 4LJZC 1Q12A 1C48A 2E74C 3NBHA 4XDCA 1RODA 4HMJA 1EM7A 1KDBA 2RQXA 5CV4A 5EQ0A 4K2LA 1DJRD 1VR9A 3NVVA 1FD6A 1I4HA 4J1MA 1CZWA 1WGKA 4A3EB 2A69C 3AE1B 4IFDG 3PZ7A 2BOSA 2F0JA 3AE5B 3EVQA 4KKSA 4KGRA 3BK1A 1ZKOA 1D2BA 4FXKC 3WCQA 2AX5A 5IGGA 4IUNA 3M7NA 3MXUA 2KVMA 3DWMA 4A6QA 3L9AX 3FMCA 1JOQA 1RWSA 3VYUA 1SE3A 2QIEB 1GXDC 5CMDA 1STHA 3KLSX 4WRDA 2SAKA 1GHKA 4CKBA 3HOWB 3BDLA 4QB4A 5G3LF 1LT3D 1FO4A 1PTOB 2Q5WD 1WVLA 2XSCA 3O13A 2MGSA 4BBRB 1TS2A 4USAA 4EGVA 3FEWX 4XYQA 2HDLA 1VF5C 4A90A 3TEZA 1XWEA 1DD2A 3IT6B 5ISRA 3LYYA 1PRTD 3K6OA 5EE9A 3BVGA 1FM0D 2HUGA 1SEBD 4IALA 3Q8FA 2K1BA 1AEXA 1TWHB 4N58A 4DAPA 1H9JA 1X3PA 2HTME 3JAML 1D1IA 1C76A 5IGBA 1STEA 1O7ZA 5BMIA 4HSVA 3NPPA 4A3FB 2KQ3A 4RNAA 3P42A 1IL8A 1RD9D 1OXUA 1HTLD 2B2WC 5FOBB 4L2YA 2WV6D 1KDAA 1D5ZC 4KV6A 3SR6A 2NTSA 4RCOA 2JA6B 2RSNA 5DNFA 1HHVA 3HOXB 3GO5A 3S1QB 1EL0A 1LTAD 3R93A 4IN3A 4P2CB 5LL6X 4TMAB 4PQXA 4A3DB 2MJ3A 1XLQA 4MN3A 1FRRA 3S2HB 1EY9A 1IBXA 4F88A 4RGNA 5D7GA 1PGXA 1LLRD 4HEDA 2PVGC 5C44B 3C46A 3LNNA 1VRAB 1HUMA 1ESFA 3TMEA 3NVWA 3AU7A 1BBXC 2E2DC 1U4PA 1ACCA 1HXYD 2BE5C 4AYBB 5T1IA 5E6JA 4TRDA 4ZQ3A 1EQTA 1PFBA 5C3JB 2F3WA 4DK0A 1HFNA 2M19A 2VZKB 5H8YE 2PYKA 4AQ7A 2KOLA 1YN4A 2ON8A 1VJKA 3P1MA 1SIJA 3B2GA 1JW9D 3IXSA 2MPMA 5D65A 3GTMB 2N88A 3EQLC 5FKAC 2EELA 3QOLA 3BK2A 4OGQC 2XRSD 1UAPA 1Q1BA 4I65A 2Z1CA 5BN4A 2CU3A 1BNZA 2EY6A 1QWYA 1KDCA 3MA2B 2PZTA 5FLXE 2AUJD 3NTKA 2VB2X 2K5QA 5E4XA 3CRKC 4ID6A 3A7LA 4DXGA 4UDUC 5IGFA 3TEYA 1YJJA 2EJFC 3H91A 4KY7A 1IKLA 1EWYC 3AB5A 3H6MA 4NW2A 4Q0FA 2WAQB 1JWUD 4U673 2LS01 5JOBA 1YN3A 1YQ4B 1Y1WB 3SR1A 1CT1D 5E1FA 1OXXK 5EPJA 5MPOA 2NVXB 5ELEA 4O42A 1SJHD 2O4XA 3N6RA 2IJ0A 1EU4A 2ACZB 2EYFA 3SK6A 3E5SA 3WOEA 1AYFA 5DM73 4B9WA 3AEEB 4XT1B 1EYAA 2I07B 2I2YA 3P75A 2RA4A 5A2QL 3ZQ4A 4ARCA 3I9V1 2EKIA 1EEFD 4RGOS 1OXVA 4XDXA 4V0BA 3M4OB 3VA5A 4HAEA 1FNUA 1PMRA 1SB3C 3HEJA 3DMUA 4KD4A 1XO3A 2D62A 1T3QA 3P4RB 4JE3B 1CZPA 4HKZE 4R3DA 1C4QA 1SXTA 1F2RC 5HG2A 1QB5D 4C3HG 2K5PA 1K83B 2RSOA 4XQNA 1K53A 3M85A 1EYCA 2EYHA 1BR9A 2K7VA 2R6GA 1XCTL 2OXPA 1CQVA 2K03A 2KEDA 1P7FA 2PCFB 2H89B 4JBWA 5CV9A 3SE0A 5KIXA 3IAS1 3NE5B 4ZRQA 1U9RA 3BZDB 4B08A 3SDZA 1X32A 3TP7A 3VR2A 1WSPA 2L83A 2BT6A 1FEHA 2OF1A 1WTWA 4OZCA 3ZYYX 2F0FA 5NUCA 2WU5B 2A6ED 2M56B 3NP8A 3U4EG 3HRZC 3GTPB 3P63A 1V43A 5CR3A 2W82A 1NR4A 3CHBD 5LL6S 1Y69U 1PZID 1J8IA 5EE0A 2V4DA 1TWFB 5BN3A 2BS3B 1Z47A 3BVMA 2F0EA 2LY7A 1QF6A 1QILA 4RF0A 1B2TA 4KKUA 3FVQA 2W54A 2MUYA 2RKSA 5KEEA 2JZPA 4ZHPA 1DOKA 3V3XA 4WJWA 4C3HB 3I4LA 3DM1A 2EZVA 1BCPC 2J0TD 1EOTA 2NN6H 2F0PA 2BW2A 4LK1C 1IUEA 4ITKA 3NVYA 2BA0A 1EQVA 3J80E 3DWAA 2EYOA 2HQEA 1V97A 1TS4A 4KGTA 1P7EA 4NZLB 3P4QB 2XVSA 1DM0B 4HCEA 4F8MA 1CI3M 3PZ8A 2M9VA 2JA5B 4ZOHC 2I38A 1DOLA 2F3VA 3J7AV 4G7ZC 2BDNA 4EQOA 3JAME 4NAWB 5LNK1 2B2WA 3IKJA 4C3IG 2WU2B 2JEBI 1Y56A 1C77A 3P20A 1MI2A 1VZ8A 5C0XJ 1V1PA 2K5WA 3TZDA 3AH7A 2WINB 2N9KA 2KDMA 1KAAA 1JRPA 2E3TA 4RHSA 3Q69A 2KEEA 4A3MB 1WRIA 4OIKA 4JPSA 3V05A 3I8ZA 4MT5A 1XEEA 3CIRB 1II3A 5CV7A 3HVDA 2C9OA 4FF4A 3AECB 2BBCA 5COYA 4ME5A 1E0BA 1SYDA 4TSSA 4HKQA 2Y5PA 4CKCA 1Q90A 1J7AA 4KTAA 2GA4B 2NUCA 2X6LA 1W6KA 1HPCA 3AE2B 3AEGB 2ZXOA 1STBA 3ITPA 1QOBA 4KGSA 3CQZB 3J80L 1HZ5A 4RHRA 4RH6A 2JEAI 2JXMB 2K5DA 3VA7A 2PKOA 1ONLA 1PTOF 1OQRA 4MHEA 2ONQA 1PYWD 3NWTA 3BDCA 2RDFA 2DLBA 4GDKB 2N7JA 1FR3A 2D2CC 3VQIA 3S17B 1I4PA 2Z4IA 1ZP0B 4DA2A 3FC4A 3I90A 5M5XB 2PZWA 3U7ZA 1MHHE 2EYMA 1KFYB 1S5BD 5CV6A 2EYPA 1JWMD 3DEPA 2GI9A 3NBIA 1BF4A 3SK4A 5C4ZA 2PTLA 4YXDB 5KYIA 2L0CA 3QIAA 4KN4C 3SVMA 2R7ZB 3RD4A 2KCNA 2DY7A 1OFFA 1ZDXA 3T53B 3TUOA 2E6XA 1E6EB 3KWVA 2WP8J 3H94A 3S1NB 3DWPA 2HCIA 3I4MB 3NTHA 1C79A 4C7YA 4H2AA 2WXFA 3OHXC 1QNUA 2FE8A 2ID0A 5EBCA 4ZLTF 5C0XH 5CBAE 1CHQD 4OIJA 2DWQA 2D9UA 3PIP3 1CQFA 3D4DA 4X3SA 1I6HB 2ZW0A 3PO0A 3I70A 3OWFA 1PRTB 2F4IA 3GD7A 1X3QA 1GUTA 1H9RA 3VR6A 5G3LD 1RDPD 3S1MB 2LEKA 1K52A 3LX0A 1JWAD 2JA8B 3HZXA 1ROEA 3C1FA 4LAAA 5IOCA 4RKBA 2L9HA 2KHSA 4QUFA 4M8AA 3LWEA 5JPMC 1G8ZD 3LWUA 4JX1C 3P7JA 3DWQA 4ILWA 3GTOB 4KY6A 4C3JB 1EWCA 2Z8LA 2DYMA 2W55A 3I72A 2L1AA 1V1OA 3BDOA 2JA7B 5DAUA 4L1BA 4IDIA 1EY6A 2K33A 1DCZA 1UWXA 1Y8NB 1EEID 1EIGA 4C3IB 3UI2A 3BYYB 1Q8IA 4RCNA 4J6HA 2FUG1 4BY7B 4NDXA 1GOZA 1STAA 3UI3A 5FO9B 4XXEA 1KABA 3FDTA 2LHDA 1C78A 1ZXHA 1YNND 4C56C 2OT2A 1QOGA 3AE3B 1GUGA 1C9FA 1DZ1A 4IFDI 4HTHA 3DWGC 3W1SA 4BS9A 1PLFA 2IT1A 1JCKB 3HOUB 2PO4A 5DM63 1SMYC 5C4JB 5M3FB 5IODA 2F1MA 1LT5D 3EFXD 2B2VC 2Q8RE 3PUXA 4NP5A 4FF2A 2YYZA 3DHQA 1EY7A 2MHVA 1MI0A 4I7ZC 5M9OA 1EZ6A 4OO1G 1F0ZA 4A9AA 1KLUD 3J81L 3Q6SA 1E0ZA 2K32A 2V4IB 1F77A 2PZUA 5KNBA 3PMFA 1RTNA 3A7AB 1PTOH 1D1KA 2K22A 2G1EA 1FFUA 4CKEA 5BMGA 5I9OA 2B8FA 3MFYA 1PGBA 4H13C 3OW7A 3L3OC 3C2PA 4QMGA 1TKWB 5EE1A 5KGUA 1N5XA 3VR5A 2K28A 4FXDA 4X3UA 3G6JB 1LTGD 5EKLA 1YJIA 5C6AA 1L4ZB 5I6YA 2NN6I 1WCMB 2ICEC 1TZOA 4PMCA 5FK9C 2PNRC 3S16B 1O80A 1UUPA 1XF5L 2IGHA 1D5MC 4O1NA 4KKIA 4TQ0A 2KAJA 1E2ZA 3R2IA 1I4GA 1GHJA 1WXQA 2L4NA 5C3XA 4FNFA 1QCBD 1TIID 2R3ZA 2NVTB 1YNJC 3RZDB 5JEAH 1ZXIA 1W6JA 1ENCA 2K3UA 3D31A 4KN7C 2OHFA 4ZUJA 1G291 3FILB 4K14A 3A8JE 3D6WA 4J3OD 4BBSB 1JICA 3I3CA 2YU9B 1J7CA 5G5HA 3AE8B 3N9YC 3F2UA 1R4QB 5A2QE 3PO2B 2R92B 3E9SA 1VDVA 2F0UA 3FPUB 2N55A 3K5MA 4ODGA 1DYQA 3ZJUA 4WORA 1I4XA 5JVG3 1F2MA 3SK5A 4DAVA 1C4CA 3CWIA 2WACA 2J7ZA 5E3FA 1KLGD 1MSGA 2K01A 2F0LA 3A8KE 3Q8CA 4F7XA 2IWHA 2Q8IB 3HKZB 4KMUC 3VYTA 2WXQA 1GPXA 2LJIA 5JPNC 1LT6D 1WD1A 2IDYA 1J7BA 1ZXTA 4XIGS 2JQRB 5I2YA 1MVKA 3M3YB 1NR2A 1EIHA 4H44C 4PV1C 3SHLA 5BMHA 1MPEA 1D6EC 3NS1A 5IGCA 1LTID 2WXKA 2KECA 2JXTA 1I6VC 2LMCA 4XQJA 3HRDD 4TQ1A 1ENFA 1A3VA 1BXTA 2B2UA 1O78A 2OEDA 2RDHA 1TU2B 2IX1A 4IKGA 4C7ZA 1FGBD 2V3PA 1B9RA 3TZUA 1HQRD 1DOMA 1KTKA 1AP0A 2A5HA 2F0OA 1KNAA 3SFEB 1R9TB 4JWSC 2KJXA 3T51B 3P4SB 4K5VA 2A68C 4OW0A 1L0XB 1LTRD 3KUPA 2VB3X 1V8CA 1R7SA 2WNMA 1I7HA 5JVH3 2SNMA 3HOZB 5HI1A 4ZKBB 1GUNA 1SSOA 3N52A 4KJNA 4DF7A 1PFMA 1NENB 1F9RA 2LFIA 2CQAA 2XIWA 5FLXL 2Y5CA 1N5WA 1RKNA