4RGOS

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
225
Chain Sequence
b'SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 63
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
S PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgoS02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgoS01
1LT6D 1RCVD 1V1PA 2AQ2B 1CQVA 3OWEB 1BXTA 3DWQA 4RFBA 2CHBD 3BYYB 1HXYD 5FKAC 3BVMA 1M4VA 3R8BA 2XNAC 1FNUA 2SEBD 4BWGB 4L6TB 1ET9A 5ELFA 2XN9C 1F77A 1B44D 1RD9D 1SE2A 3O13A 3BZDB 1BCPF 1XXGA 3BYTB 1SE4A 2IJ0A 2R61A 1PRTF 1ESFA 1RF2D 3DWPA 3GP7A 1CHPD 1ET6A 1SJHD 1JWMD 1I4GA 1I4PA 4RHSA 1ENFA 1YN3A 2NTSA 1PYWD 1BCPC 1LT3D 4C56C 1SBBB 1SEBD 1BCPB 1DYQA 1L0XB 1LTAD 1LTSD 1PRTC 2AQ1B 1S5FD 2QILA 4DXGA 1D5MC 3DWAA 4OHJA 1PTOF 5FK9C 1AN8A 2WV6D 1FNVA 1PZJD 1TS4A 3BVZA 2J4XA 1V1OA 5D3DA 3EA6A 1G8ZD 1D5XC 4ZYSA 1PZKD 1LTGD 2XRSD 1LTID 3CHBD 1HTLD 1PTOC 1TS2A 1TS3A 1DJRD 1PTOB 4RGNA 2QEJC 5ELCA 5I4DA 3MC0B 2AQ3B 1JCKB 1FGBD 1I4RA 1CK1A 1KLGD 1KLUD 3TSSA 1EU4A 1GOZA 1D6EC 4Z9CB 1JR0D 1YN5A 4L63B 1TY0A 4UDUC 1I4QA 1S5CD 1B1ZA 1BCPD 1PRTB 1RDPD 1XTCD 2Z8LA 5TSSA 3SEBA 3W2DA 2RDGA 3V05A 4DXFA 4RGMA 2IPKD 1D5ZC 1I4XA 1PRTD 1TS5A 1AW7A 1S5DD 1KTKA 4RHRA 1TY2A 1L0YB 5ELDA 1LTTD 1LT5D 4K6LA 2TSSA 1PZID 3R2TA 2NTTA 1LLRD 1S5ED 2ICIA 5ELBA 1SJED 1STEA 5D3IB 1JWUD 1EU3A 4NZLB 1PTOD 1EFID 1EEID 3URYA 3BVGA 1CHQD 4RGTA 2RDHA 5ELEA 1PTOH 2O2LD 3EFXD 1JWSD 1QILA 3MFGA 1HA5A 1V1PB 1EWCA 4RCOA 1CT1D 1LO5D 4TSSA 1FNWA 1HQRD 1I4HA 1EEFD 1MD2D 1UNSA 1YN4A 1SE3A 3KLSX 1FD7D 1UUPA 1JQYD 2XRQD 1LTBD 1SXTA 4RGOS 4RH6A 3R2IA 2G9HD 4O1NA 1LTRD 1S5BD 1T5XD 1LT4D
chains in the Genus database with same CATH superfamily
2KJRA 4ICUA 4F87A 2K22A 4A3GH 2FUHB 2IT1A 5GQOA 4DR1L 2RD0A 3UIPB 4DQOC 4RKBA 1HQMC 3HG9A 2O2VB 4XQQA 4IN3A 4A3MG 2PW5A 1F9RA 3V6EB 2DY7A 4QL5A 1JRUA 4DV4L 1Y1VH 4AH6A 1PMRA 1IYVA 4KD3A 3PQIA 2IZVB 3CWIA 4GGQA 1FEHA 2AHOB 1RTOA 1K0RA 4M1UB 4IUNA 3JAMc 3VHTC 3ULJA 4MELA 4NY0A 3KOJA 4R4OA 4QJFA 1N34Q 1XNRQ 5HGTA 3MC8A 3VFKA 1PRTF 5M5WB 2GOWA 1NI3A 4B3TL 1IL2A 1ENFA 4DV6Q 5C4JH 1W6KA 2B63B 1PYWD 2BWFA 2K4KA 1JORA 5D94A 1WCMB 1J7BA 2BTEA 3DM3A 5FLXL 1LM8B 4C1NK 1N5XA 4O0AA 2LGIA 1F52A 3KUDB 4PK1A 5FO7B 4L5SA 4U673 2D9UA 1KC8C 2JYTA 1QOBA 3Q14C 1VCIA 3K7AB 3S1QB 5L83A 3EBEA 3HOXB 2I38A 1U0LA 4HRSA 1NENB 3DBLB 4M0WA 4NJCA 1PYSB 4JBJA 5CYUA 5LMUQ 2HQLA 2MBOA 5M3MH 2VQFL 3VR8B 4YCWA 1KH0A 4EQOA 4F7XA 1E2VA 3H15A 1EWIA 2JRHA 5C2TB 2J0MA 2W82A 1RJTA 2KQ7A 2N7EA 1TS3A 1HUNA 1ZE3D 2J42A 5IP9H 3CMAA 2QEJC 4DDGD 5I4DA 4AS1A 3S2AA 2AQ3B 2L11A 1CK1A 3TSSA 3X23A 3A1QB 1I7HA 2A8VA 3QC8B 1X54A 3Q8BA 3TZDA 3L16A 2LMCA 1TIFA 1TVXA 1EIYB 3W1YA 3GB1A 3HKZG 4OO1G 3U4EG 3AXCA 4BKGA 4C00A 1YNND 3MWYW 3D32A 2XVSA 2EVBA 4FULA 4JVZA 3GTMB 1K8MA 4MEMA 3PIOA 4J6IA 4A3LH 4L8JA 4GOPB 3PO3B 4P1BC 5D6JB 1Q86C 1EY5A 2A6HC 1Q1BA 4NKLA 4GZYC 2FE8A 3P4SB 1VDZA 4UP8A 3KLRA 1QOAA 3E9HA 2FCQA 4E71A 4HROA 1IBXB 4J15A 2Q2IA 4A3BH 1JB7A 2WB1B 4E6IA 2EMSA 2B2TC 3B0AA 1T0SC 1VQ7A 1HNWL 1PXUA 3I56A 1EIFA 5M3MG 2CHWA 3ZVVA 4P7IA 2CW0C 1CSQA 2JK8A 4BFRA 4AQYL 1TZOA 5IT9E 1R4MI 1JICA 3G6JB 5H92C 3V3XA 2F4IA 1WVLA 4DAMA 5IP9G 1WGDA 3DBRB 4DNIA 2OOBB 3L10B 1HFNA 2GVAA 3KLSX 5BN5A 4HXDA 3I3TB 3V6CB 1A63A 4PT5A 5G3LF 1P16A 3RD2A 2BPSA 4B3ML 4DV7Q 1VQ6A 2NBVB 3ZYYX 2YTXA 2LKVA 5IP7H 4NAMA 3D6WA 2BE5C 1I6HB 1FJGL 2KK8A 3LYYA 1Y8RC 2LGDA 4PG3A 4X3KA 4HJ9A 1JMCA 4JV5L 4KIKA 3UIOB 2OQ0A 3EVQA 3TIXA 1VQDA 4YWGG 3MFYA 2R7ZH 4F8CB 2JXXA 1J5EL 5C4XB 5D7GA 3AEFB 2D0PA 2GBMA 4CGYB 2X69A 1BQQT 3CIRB 1KABA 3FRPB 2QKIC 2KVMA 3PUWA 4IW0A 2M56B 1RKNA 1QWYA 1SLJA 4LDTB 4A3BG 4IUMB 1SYDA 3AE2B 3DVGX 4CYEA 2PYKA 1M94A 3U58A 1R4NI 3N1ZC 3ETRA 4LF9Q 3QJZA 4BOZB 1XCTL 1P3QU 2PVGC 2NTSA 5CORA 2NZOA 4G57A 2GBKA 2FBWB 2JX5A 1U5KA 4POGA 1LACA 4N8FA 3HRDD 2JEAI 1C0AA 2PE9A 2R93H 5I6WA 3LX0A 3V2TA 2E2HH 5CHWA 3I55A 2RHQB 4G7HC 1ZKHA 4EZLA 1F9QA 4WH4A 2D0OA 4DXGA 1FXIA 2BDNA 3N1YC 4A20A 2GN5A 3NVZA 2F3WA 3ND9A 4FF3A 1QOGA 1TXYA 2WV6D 1J0GA 3WOEA 5IYDH 5JJKA 3OJ3A 2K5NA 3NWTA 2UU9Q 4P71A 2W3SA 3OG5A 1BKBA 1QUQA 1KXLA 2JUOA 3PSIA 4N59A 1LTID 5LMNW 1HTLD 3S14H 2GLSA 2R7ZG 2JU6X 4K0KL 2ZPYA 2RCFA 4DR6L 1E1OA 1SROA 2VQEQ 3WOFA 1WGRA 1B50A 3DVGY 2YU9H 1TTNA 2KDFB 2PCFB 2G45B 5BYRA 3K81C 1HTQA 2BWES 1MJEA 4GLSC 2N9XA 2L15A 4RG1A 4GN1A 3T51B 3SEBA 1K0SA 4IOAA 1YQ4B 2BGFA 2FMMA 3A4SC 1WY8A 3PVLA 1B8AA 1F2MA 4KGSA 2N9EB 5AUKA 3CXCA 4TMAB 2WXKA 4RHRA 4WJ4A 3I72A 1XD3B 5FO8B 3JAML 2B76B 3R2TA 1Y14B 4IWQA 4A90A 1TWGB 2MP2B 3BZKA 3EIVA 4HCEA 4O42A 5CC4A 4DDID 3UINB 1R4PB 2KA7A 4ANVA 4HJ5A 1J8CA 3ONAB 1Y1WG 4LFCQ 4DAPA 4MM3A 1K8RB 1K8GA 3OTOQ 1EF5A 4KKIA 2INNE 3KWVA 3NOBA 1IKLA 2YEPF 2KVRA 4BKSA 3MFGA 1SFOH 1EWCA 3J81E 3L13A 4S17A 5CHFA 3FKIB 1JOOA 1VS0A 4KN4C 1HQRD 1U4PA 2PMZE 3VYRA 5CHVC 3J80c 4MJSB 2A19A 1T0QC 2BT6A 4MGKE 3H9DA 4FXKC 5I6YA 1VMPA 1LTBD 1SYBA 2ZTEA 4PZ8A 3MTSA 2WU2B 4LNNA 1VQIA 5LXHA 2VNUD 2X6GA 4O1NA 3HFZB 4AUQC 1KIXA 1EY9A 2HHHL 4RCNA 4FXCA 3U30A 3EHVA 2INCC 3OMGA 3DWQA 2JYEA 2L3ZA 4OIJA 4HSPA 2MHJA 5KHOA 2LRWA 4A3IH 1WZ3A 2F0DA 2V9HA 4BOSC 2ZZPB 2XN9C 3K8AA 4MTKA 3OYYA 4XWTA 2PIAA 4GU2A 3T8MA 1HZ6A 1WD0A 3HOUG 1VZ7A 2BYFA 4DNTB 3VDZA 3BDLA 2F1MA 1BCPF 1YD8U 3GTLH 1XXGA 1WM2A 1MHWC 1R7SA 4XXEA 3AYHB 4HJ8A 2Q5WD 2R61A 4ZKCB 2E6XA 3VR9B 1P9DU 1XQQA 2Z0DB 4A3CH 1L4DB 3M4QA 4XQJA 1MHHE 1YIWA 2LJ5A 1X3PA 3MXNA 4C56C 2BB6A 2D3AA 4BA2I 3Q3OC 1NSNS 1WFYA 4AJYB 3DUZA 2ZW1A 3CF6E 2B63H 3H8HA 4FVMA 4GDKA 1I6VC 2I5LX 4KVGB 4PMWA 1WCMH 1AZQA 1JWAD 4K3CA 4P72A 3O65B 4ZHPA 1PZJD 4MSMB 3H3VC 2MUYA 4R9WA 1WZ0A 3DPDA 1I94L 2HIVA 2F52A 2MQHA 4JI6L 3NUCA 2MH7A 3M7NA 3K6OA 3A54A 3S1QH 1SSOA 3HOXH 1MG8A 3CHBD 1PTOC 3VR6A 5DEHA 2PKOA 4YL8A 2LASA 4A3IG 1KRHA 1X65A 3N52A 4KGTA 1DXMA 2WS3B 3RZOH 5IE8A 3VDYA 3HKZE 1WFQA 2BCOA 2WXIA 1WSPA 1G51A 2NPTA 4PQXA 4RF1A 3RZFA 3SFDB 3S1MH 4NQKE 4I6NB 1XNQQ 1T9HA 1HZ9A 2WLBA 3RULA 4NMZA 5GAEC 4ODGA 5TSSA 1EQQA 4ZCKA 4LFAQ 4B3SQ 1O78A 1LUZA 3Q0AA 3Q3FA 5I9PA 1PRTD 4A3OA 3HUIA 2IHEA 1N6ZA 2KUMA 2H89B 3KVFB 3T3NA 2DNCA 4QF4A 4X64L 1I5FA 1N9WA 1G2SA 4G50A 1SMXA 2I1KA 2PNRC 5C3WA 3GTMH 4M00A 2B63G 4LF7Q 4G4KA 3ZXRA 4JI0L 1WGGA 3CC2A 3PO3H 1WCMG 1GUGA 3HOVB 1E8XA 1KAWA 3GTOH 4RM9A 1NMFA 3A5UA 2UUAL 2KXJA 3EGRA 2RDHA 2ZJRA 1E9MA 2KFKB 1LGRA 2W3RA 3HOXG 3U4ZA 3C2PA 3KYDD 2HTHA 3MXUA 3AE6B 3KUPA 2IX0A 2Q8RE 1NE3A 3AU4A 1WF9A 4I6PA 3K0XA 1UNSA 3PZDA 3F2BA 2BKFA 1F2ZA 2ON8A 1SE3A 2KKCA 3A9JA 4K7UA 1DOLA 1MJCA 2NVYH 2F0PA 1NYRA 4WJPA 3VAWA 1RM6C 1HEZE 1WJJA 1S5BD 4N8X1 4I7ZC 4AJWA 1C78A 4F7ZA 4XE0A 3MEFA 5C5MA 4KZ0A 1RCVD 2Q2TA 3VTUA 2WKCA 2CHBD 1MIUA 2LJIA 4KY6A 2WDRB 2LS01 3FPPA 1PH6A 1FR3A 3TUOA 4RWSC 4A3KB 4KDIC 3UDGA 1NR4A 4E74A 3MHBA 1PFSA 3BZDB 3H6MA 4LF5Q 4NXNQ 3M9BA 2F3IA 4TKNA 3A5ZB 3BYTB 2OXPA 5C4XH 3PO3G 4XQNA 4MH8A 2L00B 1EUJA 3TDQA 2JXMB 2B3AA 4H2AA 2FJ2A 5EBCA 4WAAA 3M3YB 5J2RA 2KJXA 5E6PA 1K51A 4LFBL 4C3IB 2C35B 2IHFA 2SNSA 4QGUA 3TP5A 2DNFA 2WB1G 1BR9A 1LT3D 2JSVX 2ONQA 1MSGA 4DF7A 1NCVA 2ACZB 3CC4A 4IOIE 4P2CB 1ASZA 2Q2UA 1PFDA 4H0LC 3DVNU 2I5HA 4URKA 4LJPB 2EQSA 1HR0Q 4LF6L 1PH4A 2RSOA 1AFPA 4OHJA 2DUDA 1OQQA 1S3OA 5G3LD 2VH1A 5BMHA 2GI9A 4HMIA 1Q8KA 1K3RA 1SNCA 4NDXA 1SNPA 4HLEA 3J81i 3QK0A 4S3SA 3J80L 1QNUA 5IODA 4RMAA 3A55A 1RHPA 1VQHA 2PNHA 3Q6SA 5FR3A 2L4NA 2WP8J 4IPGA 1X3QA 2LHEA 3MC0B 1WTXA 2KDEB 2EJMA 4P16A 4OXPA 5KNCA 2HD5B 4B6WA 2ZCCA 2AL3A 5DPRA 1SRUA 2MHVA 4UDUC 3PSEB 5C1ZA 2F0UA 3X3NA 1T5EA 5C4XG 3BDCA 2JA5B 4DV5L 2WAQB 2PLPA 4CJ2C 1YHBA 2KECA 1G6PA 3Q3JA 4QUFA 1NI2A 2REXA 3NJTA 1E0BA 1D5ZC 4JGHB 3TL5A 3JC66 3TEZA 4II3B 4CDFC 4KJNA 3HM6X 2WXGA 2N9KA 3I7FA 3FVQA 4K6LA 4OWWB 2G9DA 3SK5A 1STAA 4JBWA 4L5TA 4EQ5A 4DUYL 2WXLA 2KHWB 5C0XH 1C48A 3OJ4B 2LI5A 4QUCA 2BYVE 3IAS1 3Q69A 1S72A 2GVBA 1WTRA 4GNXC 1WMHA 1H9SB 3A7AB 4GDLA 2L1AA 1ISNA 3ZUNA 1LABA 4M01A 3FMCA 3NS1A 4A3PA 4GKJL 4HN7A 4JW0A 1IBMQ 1FPYA 5JVG3 2WXRA 3F8TA 3KF6A 1WRIA 4DR2Q 1TWGH 1Q46A 2JVCA 4MACA 1XCQL 4IALA 3GZNI 3R7RA 4W9DA 1TKWB 5J22A 2XWJB 4QY7A 2OTJA 2MO0A 4JOIC 1L6UA 2M8SA 2YTYA 1TKEA 3RPFC 4J1MA 3MXGA 3DBLI 2JYOA 1UWMA 2KX3A 2IO3B 1PFMA 2KBNA 1GAQB 2JY6A 2K8CA 1F9JA 4ZRKA 4BVUC 2FCMA 1TWFB 1N33L 3GV6A 2XRQD 1XWEA 2L7RA 1ASYA 2SOBA 3R2IA 2RBMA 4A3FH 3KK7A 3FKIH 4DKAC 3QARA 2B2UC 1ZUD2 3NEMA 1GUAB 4HWIB 2UXCL 4LF8Q 3I4MB 1OGWA 4DAYA 3NZ3A 2EYPA 2PI2A 2KDBA 1BXTA 1DOXA 2PI2E 1II3A 2OQKA 5E1FA 2LVOA 1OXUA 1HZBA 3FILA 5GAGC 3AMUA 2KMMA 4IFDH 3F2UA 2XNAC 1Q90A 2DNEA 4DFAA 2KWVB 3Q2AC 5LLIA 5EPLA 4CDDC 5C0XG 1YQ3B 4Y52H 3RLOA 3DBHB 2IY0B 4DXAB 3QR8A 2QF7A 2DYMA 5E4XA 2K5PA 1VQFA 3KBGA 5JJIA 3MTNB 3CRLC 1YN3A 3D3RA 1EZ8A 2JRIB 1D1IA 3BJUA 5KEEA 4IUVA 2RA4A 3PIO3 1CZGA 1ZPSA 1JW9D 4P6VF 3JVZX 4N58A 4JOIA 3CCVA 1G2TA 2MQJA 4GMVA 3L9AX 2V3SA 3QWNA 3VYUA 3QIJA 5EE3A 1FL0A 5CMDA 4PS3A 4OGQC 1PH3A 4GOCA 3ZTDA 1YJ1A 3FKIG 4H44C 3S17B 5EAYA 3MP9A 4IM3A 2L52A 4GIVA 4DA2A 2PO4A 1N8RC 2D5GA 3S2HH 1KLVA 3E9SA 4YCVA 4DU9A 1HNZQ 3IFDA 2B2UA 2IBIB 3OIPA 3PRPB 2QJLA 2L1BA 1V2YA 4UPAA 2KTRB 4F1SA 2O2VA 2HCCA 4Y7NH 4FF1A 2DJFC 4S0RA 1RYJA 1JQ4A 2HD3A 4R4QA 2RSNA 3T9LA 2DLBA 3LWUA 2F0SA 5E6NA 4NNJB 1PV4A 1YHAA 3P2BA 4HK2A 2BH8A 4IM0A 2LXCA 3VR5A 2RF4A 1A15A 1S5CD 1BCPD 1RDPD 2F0JA 2KWUB 3ZNHB 4ZRPA 2D3GA 3W2DA 3Q8CA 2E75C 1E10A 1FRDA 3GTGH 2JZZA 1KHIA 4NXML 3DHIC 1ICFB 5EJWA 4GOPC 3A8IE 2W9NA 3D4WA 3OPOA 1AW7A 4JI5Q 4HTHA 1TT5B 3NSWA 1D2BA 1WI0A 3NTKA 4EOYA 5AJ3Q 4TQ1A 1V5TA 5GADC 3RN9C 1ZDXA 2K1FA 4WWOA 2B8FA 3AFPA 1GUSA 2F0EA 2UUCL 3DOWA 4ZRJA 1NDDA 1ZDVA 1B2TA 4C3JB 4DV1Q 2JPHA 4X65Q 2QDFA 2CQOA 4JBMA 3N20C 3K9PB 1FYCA 3S1NH 4JE3B 1UEBA 3TCAA 1K3BC 4A3EB 4LUVA 4WQOB 1OTRB 4HKZE 3IXSA 2L55A 1SIFA 4X6AH 4BBNC 3HOVH 1PA6A 1XMQQ 2WXFA 3TP7A 5KHQA 1MD2D 4JI4Q 3BY4B 3GTPB 2CFMA 1ZEQX 3E5SA 4TRDA 3KLSA 2F0MA 4RH6A 3F2CA 3A1QA 1DGSA 3F2DA 4JWSC 1MPEA 3MA2B 1FXAA 1JRPA 1KQSA 2BKRB 3SK6A 1LT4D 1GPXA 4A6QA 2L83A 2K50A 4IO9A 1XMOQ 1WJ4A 5IYBH 3L08A 3JAME 3KF8B 4GNXB 3S1RB 3NRZA 5EE0A 1R4QB 2K5DA 1GG3A 1TGZB 3TZUA 1YBYA 1ZGUB 1N32L 4GOPA 3WAOA 3HVDA 4JBKA 5KYLA 3SXHA 1CZPA 2KENA 4X62L 3VR2A 1FIQA 1IBXA 3QO2A 4DK1A 4JI8L 1NAPA 4L1BA 2WB1E 4A3KH 3NVVA 4KX6B 1T6BX 2KZRA 5HGQA 1I4PA 3HM3A 3A33B 4RF0A 4Q2JA 2EJFC 2WXJA 2V4LA 4D2KA 2JA8B 1YNNC 5BYSA 1SEBD 1HTPA 1EWYC 4HJ7A 1BCPB 1UELA 3NBIA 1TBEA 2F0LA 2WFWA 3HOVG 3PREA 3U8ZA 3CCQA 3M3YH 2AQ1B 2LZ6A 3GE3C 4HCNB 4DV3L 4C3IH 2D62A 1C8CA 1M8AA 5IWAL 1Y69U 4R8NA 1XPOA 5FR6A 3HP3A 2WX1A 3IAM1 3NTHA 3AE8B 1YX5B 3CF5A 1E2ZA 2PZUA 1WTPA 1STBA 4TV3A 2EKEC 2WX0A 1KL9A 3GV3A 3EA6A 4OO1H 5IYBG 1LTGD 1NNXA 3AU7A 3ICEA 1WM3A 1UGJA 4HCSA 3RNEC 5JHAA 2A74C 2O5JC 1AARA 4IG7B 4XGAB 3I63C 1SDFA 1VQBA 4IFDI 2ICEC 2EYFA 3NQTA 3PUVA 2R2OA 1FGBD 3D4DA 1BF4A 4ULLA 5DPTA 4RNAA 5NUCA 4FJZA 4MSQB 1SE8A 4OZCA 3I70A 1I4QA 3NELA 1CFMA 2MBEA 1T0RC 1JE5A 2Z8LA 1MKHA 2BH2A 2BDOA 5EKIA 4A3KG 1KD1C 3MAQA 3T16A 4DAVA 1ZP0B 3V96A 1PGXA 4KY7A 4GKKL 3AN1A 4HEA1 4R3DA 2DZIA 2AX5A 2KX0A 1S5DD 2AWTA 3VQIA 1MFWA 1PGBA 3NVYA 4ZOHC 4PV1C 1A70A 2KAJA 2ZJDA 3PV1A 1TQOA 4ARCA 4DR1Q 3I91A 1QE6A 3DHQA 2R6GA 4JI3L 3C0RB 3IKJA 5JXVA 5J39A 4C3IG 5JEAG 2WIIB 3STBD 2ICIA 2PPBC 4FJYA 1TWAB 2AMCB 5BYQA 5DPSA 3AEEB 1TR5A 3RLNA 4DV4Q 3C1FA 3J7YW 1WH3A 3H3VH 3FC4A 1CKNB 4ANWA 1FGUA 3A4RA 2Z0SA 2E2IB 1C76A 4JYAL 3W1SC 4BY7B 4O2DA 2YVCA 2VXWA 5ELEA 1PTOH 4OVVA 2NBUA 4PYZA 3VH4B 2PW7A 1YI2A 1C77A 2LRUA 4HKQA 1J7CA 1KRTA 2X6LA 1BT0A 3I90A 2OEDA 4B3TQ 2NR2A 3WAMA 2JQOA 3SR6A 4CQNA 4IURA 1YN4A 4WWPA 1ONLA 4YWLA 4LJZC 1JROA 4LK0M 1VQGA 1WJUA 1WWTA 1OO9B 3P4QB 2ZTDA 1V9PA 1LV9A 3U50C 4KHPL 4HIDA 4IOCA 1VF5C 5IA7A 3NPPA 1LT6D 1E7PB 3CCMA 1EY8A 4DV7L 2AWNA 1X9NA 4RFBA 1EY7A 2G3QB 1F2YA 4DV0L 2VQFQ 5J1ZA 3K58A 1IW7D 2JA5G 1WRDB 4FO2A 4Q5VA 2NVQB 1CKOA 4BWGB 2WAQG 5ELFA 2JEBI 3I4MH 1XJVA 5CR3A 4A4IA 2QEXA 2ZVOA 3O13A 5JPMC 3VVWB 2NVTH 4XYOA 1H4RA 3H7SA 5EKLA 3OAWA 4AIMA 2MP2A 3PUXA 2Z6KC 2CVRA 2B2VC 5JH5C 4B9XA 4W9FA 4TQUS 2DYOA 4H02A 3L3OC 1QZGA 3ZRCA 1S4ZA 5CV9A 4B3RL 4LNQA 2FNJB 2Z59B 4NPNA 1TT2A 2L0CA 1AEXA 3E56A 2NN6G 4XTCS 1F1HA 2BVCA 3PZ8A 1H9RA 4JI7L 3A8JE 1EWHA 3APCA 1TIID 1YVCA 2K8HA 3TEXA 2HDLA 1PLFA 1YJIA 4EUTA 2EXZA 2QILA 4K1RB 3Q8AA 1HHVA 1SF0A 4MJSA 4CHKA 2G1EA 5JEAJ 2JWUA 2F4VL 2WU5B 3TS2A 4MT5A 1YNJD 4JK1C 4E3CA 2SNMA 3LDZE 2Z4IA 1IYUA 1JE4A 3CQZB 1XEEA 4P73A 1HNWQ 3MC9A 1TS2A 4I65A 5EBDA 3PIP3 2B2TA 3OIQA 4LWCA 1QLBB 3AE4B 3CAMA 4AQYQ 3M4OH 2NVXB 5AUIA 3I4MG 1L5PA 3W5UB 1L2NA 3PS6A 4DR3L 2K6QA 2FFKB 5C3EB 1NBFC 1PDXA 4CJ1B 1VQKA 1A3UA 3BG3A 4ZRZA 4B08A 2EY1A 3CD6A 1QJOA 1R9TH 1SYCA 3RZDH 3AB5A 3JAMi 4B3MQ 1WX8A 1XTDA 1IYJB 4K7WA 4RGMA 4UAIA 4P75A 5DNFA 2G4DB 1A5RA 3GS2A 1Y1WH 4UP9A 3KUZA 3FP9A 1FJGQ 3HZXA 4WQMA 4YY3Q 4ALPA 5ELDA 4JV5Q 4KLKA 1LTTD 4U68A 4WJWA 1SB3C 3TBLD 2OJRA 2JP1A 3B2FA 2RDFA 2CCZA 3AULA 4ZDVA 3TS0A 2KMCA 3U2SC 2E2JH 1KOTA 2IO2B 1J5EQ 4KHZA 4OWXB 1OTCA 3A0JA 4EZKA 4JC0A 3C19A 2E5LL 3N30A 1Z2MA 4LNKA 1XO3A 4V0BA 4B0EA 2K5QA 3AM9A 3J80E 3L4PA 3NZUA 4IM2A 4OVUA 1VQ4A 5AZHA 1EY4A 3URYA 1BMLC 4RMFA 2C5LC 5FLMH 1QILA 4L5QA 4MH0E 4N6EB 3S15B 1K83B 3H09A 1D3ZA 1K28A 4ZUJA 4OO1I 3ZNZB 2KQ3A 2G5DA 2HJ1A 2L76A 4KKTA 1NEKB 5T1IA 3AEDB 3ZGZA 1S1QB 2C7HA 3CMMB 5M3FB 3J81j 2UXDL 2VS1A 3S9WA 4X3UA 2I0QA 2ZJQA 3HOUH 1HTOA 1GHJA 2Z1CA 2FXQA 1T3QA 2NCNA 2A73B 1EF1A 2FIDA 4LF4L 2JA6B 3RN2A 4R4TA 5C4HA 1GJXA 5LL6S 2VZAA 2H1EA 2Y0SB 3CKIB 1HUMA 1ET9A 3VRAB 2DENB 2IY1B 2QCZA 4W9GA 3V62A 2WXOA 4A8XC 4CO7A 1NY4A 3S1RH 4K0KQ 1H8CA 1JJGA 3KJOA 5IGDA 1WXVA 4DR6Q 4I6LB 4KV2A 5J17A 2MX2A 1V80A 4DR4L 2LXKA 1WXMA 1KNEA 1RF2D 1ESFA 3ZNGC 3GP7A 2KHJA 1ET6A 2V1CC 1GXDC 1OXSC 3ND8A 2LVQA 2QDLA 5C4ZA 4ICVA 5FLMG 2EY2A 3PPAA 1J19A 4FJVB 2MFIA 4MZ9A 4IUUA 1NTGA 4C3JG 1QVFA 2KFKA 2KMAA 1LTAD 3M3JA 1L1OB 1PRTC 3QAQA 1Z6HA 4H7BA 5G5GA 5CV5A 4AWJA 1U4MA 3PRZA 4FNFA 1NVID 4A3EG 5EKKA 1HFGA 5AZFA 4YTNB 5K5PA 4DV2L 2JA8H 3UF8A 1VQEA 1J9OA 5FK9C 4IUQA 2KJ6A 1D4BA 1YIJA 2XEWA 1FNVA 3WANA 2K0PA 3DM1A 3BVZA 2L12A 1PH7A 1V6EA 4USAA 5IAAC 3SK4A 2MLBA 1CI3M 3IT6B 1BUVT 2XK5B 1CA6A 4KSKC 4G3XB 4MN3A 2PZWA 3CW2C 5HURA 2M0XA 2OHFA 2NS5A 4LLGM 1Q3LA 2F03A 4BBSB 2LUEA 4IKGA 3QG1A 1YN5A 5M5WH 3VUXA 1A8VA 2KDIA 3QOJA 1WYDA 5E3FA 3SR1A 1IGCA 3Q8EA 2DY8A 3D0FA 5KIXA 3SVMA 3VRBB 2WDQB 2WDTB 3RMHA 2WXQA 4FN2A 5G5HA 1NBWA 2BS3B 4ILWA 5IY0A 2UUBL 1PFNA 4CDCC 4OL7A 2HHHQ 3DBHI 1VF7A 1AP0A 3GE8C 2IWHA 2K9XA 2V0GA 3K7AH 2BB5A 2LY7A 2LGXA 3AE7B 4GXBA 3TREA 4CKEA 1STEA 4F8MA 5D3IB 1OEYJ 2JA8G 3VTVA 3CCRA 1PH8A 4MHEA 3QX1A 4BAXA 1NMGA 2ZM6L 3P4RB 2F0IA 2A69D 4N9F4 4IZ8A 1I50B 4P1CC 1EFID 4C2MB 2JF5A 1EOTA 2ZXPA 1Q1EA 3GQBA 2LGYA 4DR7L 1TWAH 3KQ4A 1LXDA 5COYA 1K52A 1LO5D 2ZVNA 4JI1L 4A3DB 1ZOYB 2ZXOA 1EQRA 2A6ED 2E2IH 4ZQ3A 2M4NA 3L7ZC 2BOSA 1UUPA 3GTJB 2RDBC 4ID6A 4GN4B 1YITA 2PE6B 2G9HD 4UHVA 3NE5B 4FF2A 2AYOB 4IPCA 1XF5L 2RR9A 3NHHA 4OW0A 3I4OA 4WJ3M 5CV7A 4N9TA 1V49A 3OWEB 4FXGC 2BYTA 3I8ZA 1GHKA 2WAQE 4R1JA 2EELA 1A3VA 4NB3A 2J7QB 2BBCA 2DZJA 1I94Q 5EE1A 3HOZB 3GTQB 1R4MB 3PHXB 4KI0A 3AECB 1KJTA 2SEBD 4JI6Q 4HEDA 3U9OA 1E1TA 2D07B 1GD7A 4HJGE 3IG3A 3HOYB 2DWQA 1N36L 3Q3NC 3PO2B 2ZTCA 4KV6A 5IGBA 5CV4A 2ES2A 3GOEA 2IJ0A 2O6VD 2PVOD 1UE7A 5IOIA 1L0WA 4ANUA 2NVQH 1H9SA 3DLLA 1WD1A 3DBSA 2J0KA 1I4GA 3SFEB 4EQPA 2VRRB 1K8OA 2ZNVB 2K05A 1DOIA 1SBBB 4A76A 5BR8L 3FHWA 1EY6A 1X3EA 1V8CA 2N1VA 3TEWA 2MJEA 1IBKL 2FIFA 3T3OA 3EROA 2DAJA 2HJ8A 3QQ8B 2BA1A 4BY7G 3P20A 1I6HH 2RGFA 1Z7TA 4X64Q 1Z47A 1PHJA 5C3XA 3J80i 3EQLC 1PH2A 5LMNL 2L0TA 2PMVA 1IGDA 2VZKD 2RVLA 1PQSA 3ML9A 4JI0Q 1R4NB 1QQRA 5J18A 2WXNA 5LHY1 2G4SA 1CMXB 4W9CA 1Q10A 1HA6A 1WR1A 4YWMA 1HPCA 2UUAQ 1SGHA 1FCLA 4GLXA 2WKDA 3NS8A 3PLUA 4KSLC 1VQLA 2NWGA 2A1AA 3ULLA 2X38A 3Q8DA 3CQZH 1D6EC 1C4CA 1GC6A 1XLOA 3M63B 5MPOA 4NP5A 2SDFA 4W9JA 4YIJA 2A4ZA 4ME5A 5M5XB 1PRTB 3P1HA 1VQMA 1DGJA 2OTLA 2NVXH 1C4PA 3V05A 1N63A 4K3BA 2XGTA 1XX8A 5KRUA 3KYCD 2FUG1 4A3GB 1TY2A 3V60A 2W55A 5IYCH 3RNAC 2WXHA 4BBRB 4WJOA 1PZID 2E2DC 4DK6C 1O7ZA 2PQAB 1VQJA 3UQAA 1I35A 2JA7B 2L8JA 1Y1VB 4DHJD 4X3TA 3T1HL 4C3HB 1WTQA 1O7IA 2LWPA 4HR7B 4MGIE 4FBJB 2PEAA 2PW9A 3P75A 2V3NA 2Y5BB 5E6JA 2PTLA 2EYOA 2Z4HA 1G6JA 2QDBA 2R3ZA 4OIKA 2O6VB 4EZJA 2C7MB 3B9JA 4FA6A 4RAUC 2F0HA 4LFBQ 5C4JB 2KCTA 2N7JA 1FM0D 4YTPB 3MXPA 3T53B 1TU2B 1PGAA 2C7NB 2KTRA 3H7PB 5KYIA 1P8LA 5IN7A 4XYQA 3FPUB 2NBFA 1L4ZB 1FD7D 2LFNA 2VB2X 1GUTA 3H91A 4GS3A 5TR5A 4R8IA 1Y8OB 1CQFA 3I3CA 1CUKA 4LF6Q 3J7ZC 2MWSB 4JWUC 1TKGA 1I3QB 2AQ2B 1YHQA 5M3FH 4HMJA 1OEYA 4LW1A 5C3EG 3QJYA 1H9JA 4CBVA 3B2GA 2VUMB 4REZA 3N3KB 2D5DA 2KCNA 1STYA 5IYCG 4HJKA 5FJ8G 2DBYA 1Q81C 2I1JA 4XZ4A 2IY5B 3KDFB 1F77A 2VH2A 2CH4W 2DZMA 3OOCA 3P7JA 2YLMA 3KH0A 1HZ5A 5DAUA 2KCMA 2K6AA 5DM73 3Q23A 5JPNC 1IBLL 1V86A 1SJHD 5IO9A 1QNKA 2K5HA 4GLAC 1U4LA 3ZDMC 3ENEA 4EKUA 5A2QL 1QOFA 5BN4A 1X32A 4DV5Q 1BCPC 3T1YL 4DUZL 3VA5A 3WWVA 3OW7A 2R7DA 1LTLA 2Q8IB 1DYQA 5HY6A 2QMTA 3W5OA 3S24A 3RT3B 1J8IA 1V8QA 4K2LA 4G7ZC 4YTMB 4TKOB 1ZYRD 2N78A 2KEEA 4ZUIA 4YSYB 5LXIB 3KFUA 3ZQ4A 2WNMA 1D5MC 3I4NB 2UYZB 3CCJA 4DUYQ 1SMYD 3AFQA 2ID0A 4HVBA 3AE1B 2KN5A 2QW7A 4BA1I 4JI2L 2N9PC 2OT2A 3A56A 4ZYNA 1D5XC 2F0FA 5M3FG 3G48A 4GKJQ 4YHHL 4FADA 2YV5A 3PTFC 4GNXA 3KF8A 2LUMA 2WXMA 4X66L 4QAYA 1E8WA 1SE9A 3ZO5B 3CSTA 1KRSA 1ENAA 1IHZA 2KHIA 5ELNA 5HHDG 4Z9CB 3MVVA 2JA6G 2ATWA 4US8A 5IKCM 4L63B 3BDOA 1ILQA 3TEHB 3N1XC 1VQ8A 1XLPA 1SNDA 1IYFA 4XWWA 4OX9L 3D4RA 2Y0SG 1N33Q 1L2FA 5FOBB 3CCEA 5CTRC 4BBSH 1JT8A 2L05A 2MJDA 3NY5A 3UDIA 2DAFA 1JC7A 3WAPA 3RI7C 1E7UA 1XYIA 1H9MA 5K36G 1E24A 1ZKOA 3IFTA 1A2UA 2UXCQ 1WOCA 2CJNA 4MGYE 1X3FA 3I4LA 3DBRI 2TSSA 5DM63 3N6RA 5I9OA 3UI2A 1S5ED 3IT4B 1PYBA 1HH2P 3RNBC 4IUTA 1YZ6A 3TQYA 3EJIA 1LQBA 3NZSA 1BNZA 3CCSA 2CJOA 1NR2A 2MRPA 3DXJC 3S16B 5JHBA 1VR9A 1VD2A 3HKSA 2NBWB 2K8BA 1JWSD 3M4YA 4IJHA 2EXDA 1PH1A 1HNXL 1QG7A 2UXBL 4G0NB 2Y5PA 1I50H 1UBQA 4LJOB 2K39A 2WACA 3EN2A 4C2MH 1KM7A 4IDIA 1EEFD 3LJ3A 3J7AF 3VTWA 1F2RI 2KNBA 4WAFA 4A3JB 2I07B 4XT1B 4AYBB 5I2XA 2R93B 2E2HB 1EO6A 1DOMA 2K52A 1L7YA 1GO3E 1ESRA 2XIWA 5T8IA 1LTRD 2N88A 2HT1A 1CJEA 1ROEA 4BBSG 4PNYA 3TJPA 4TVAB 3GTJH 1A6XA 1VQ9A 2FHTA 4J6HA 3A7LA 2RQXA 2GBRA 3FDTA 2KTFA 1E0ZA 2PQEA 2F0OA 4HIKA 3HOWB 1BVSA 2RKSA 3R8BA 2Y5CA 2Q8TA 2M9VA 1WXSA 3ZNID 1B9RA 3S14B 1M90C 2R92B 3VA7A 3IFWB 2MJ3A 1RD9D 3IVFA 3RNGC 4FP5D 1VQNA 4GLVB 5ISRA 4JPBW 2YU9B 4BY1B 1UE6A 3GTQH 1KF6B 1D7QA 4FHKA 3L17A 1GJZA 5CV8A 2D11A 4DR5L 1SYFA 2AL6A 2Z9HA 2HCIA 1CKNA 2R7FA 3AU5A 3E9IA 3PO2H 2HIXA 1JJ2A 2YEPB 1RTNA 4DK0A 1XPUA 2IX1A 1SR3A 3OWFA 4M8MA 2V4DA 4ARIA 4EGVA 4NXMQ 1EYCA 1V5OA 3RNCC 4C80A 4L5RC 2KD0A 1SNQA 1VQPA 2HTME 4ME3A 2EIFA 2MCNB 4RM8A 4DN4M 1HCZA 3NHEB 2MGSA 1GM5A 3VR3A 3AEGB 3ML8A 4JIOU 3VXWA 2MBHA 3STBC 3H0GB 2LEKA 4A3DG 3JSVB 4IUPA 4MIUA 1K8AC 2UUCQ 4AP4C 4J8QA 3I5JC 5C0XI 1VQOA 1EL0A 3SK8A 4ZYSA 1SNOA 1HZAA 1TWHB 3C46A 3U52E 1OXVA 4C1NI 2FMCA 1RODA 1ML0D 2KC2A 3ZLZA 1SFOB 2WDVB 3BZCA 5EQ0A 1N34L 1XNRL 3PHWB 1EU4A 5BO4B 2F0NA 3K5LA 4XC2A 5M9OA 1G6ZA 1KFYB 3KWLA 5GXGB 5BN3A 4C4VB 1WYGA 4DV6L 3HOZG 5JEAH 4XIGS 4NJ6A 3TEYA 1B1ZA 3E0JA 4BZAA 4PS8A 3HOYG 4QQBX 1V81A 4ACFA 3ONSA 2XBBC 3PO2G 3P63A 2KHSA 1QZHA 3S2DB 1L0YB 3NBHB 5M5XH 5L37A 1M1KC 1Q8IA 4JX1C 4N9PA 2JT4B 1C1YB 4IQZA 1A0IA 1KDAA 5LMUL 3ERQA 5HKHA 1IW7C 2KYWA 4YCUA 1F2LA 1N32Q 2ENBA 1MBYA 1WX7A 4W9EA 4K5XA 4JCVE 4BBRH 1HZCA 2MW5A 4NZLB 5D2MB 3GTLB 4LUZA 1WTOA 1EEID 3GO5A 3SU8X 3X0WA 4QIWB 4X62Q 2ZW0A 2NUCA 2A68D 2IGDA 3GD7A 1FO4A 3DEOA 2JA7H 4A55A 4JI8Q 3RCZA 3AH7A 4C3HH 3VUYA 1B4OA 2BS4B 1KNAA 2KO3A 2AEHA 4TSSA 2HDEA 2KQ4X 2EJGC 3DCGA 4K81A 2EE1A 4US9A 2F3VA 3U9SA 4M02A 2JA5H 3ZJUA 5M5YB 1SXTA 1E8ZA 1K53A 4DV3Q 1S40A 1U4RA 5IWAQ 3P42A 1NUCA 2QGQA 4HJAA 2YTVA 1EQVA 1BO0A 2E74C 4NAWB 3K80C 2GA4B 3T13A 3ERSX 3GTKB 1C3TA 3GZNB 1FCCC 3VYTA 5EPJA 2IW3A 1M4VA 2GMIC 1YNJC 1X55A 3P4PB 4L2YA 3D31A 4L6TB 3AI5A 1ZW7A 2NN6H 4RKLA 1I3QH 1SYEA 1F9PA 3CPFA 1A62A 4IWOA 5IGGA 2LD9A 5AFWA 4BXXG 1N60A 3RZOB 1VDVA 2VUMH 4A3GG 1WTVA 2ALYB 2J52A 1E6EB 3R3MA 5IIFA 4BBRG 3S1MB 2F0QA 4LDTD 4HIOA 1LYLA 2IGHA 1BBWA 2RSUA 2KJHB 1UZXB 4II2B 4DK5A 2N3SA 2JA7G 3PLVA 1DCZA 1Y1VG 2JWZA 1CSPA 4C3HG 3DDCB 5HG2A 1L1OC 4FF4A 1DM0B 2EMTA 4XT3B 1TWFH 2XSCA 3G7LA 4GKKQ 2K7VA 3A9KB 3HHMA 3MHZA 3NG0A 1AE2A 3M85A 1FRRA 3W5VB 1OXTA 1AYFA 2CU3A 3X3MA 4OONA 3JW0X 1W2BA 1P7FA 2CKHB 4JLCA 4KZCA 5HI1A 1PTOF 1JOQA 1RL2A 1C9OA 4JI3Q 5C6AA 4MNOA 2KVZA 4PMBA 2CWAA 2J4XA 1BOSA 1AZPA 1WR6E 4KDLB 1D1KA 1FMAD 1VMCA 2KLCA 2EDGA 2WINB 3CCLA 3I4NH 3GTOB 1P7EA 1PZKD 2RPVA 3BK1A 2PJHA 3HVZA 2H5XA 4POFA 4JYAQ 4EQNA 3LWEA 2YYZA 3W9CB 1GB4A 4DHZB 1N5WA 1KAAA 4JQWC 5IGEA 5JZEB 2EPBA 2LXJA 4J3OD 1KLGD 1GVPA 2CKZB 2Y0SE 2MPMA 3C1EA 3L2PA 1DONA 2Q2HA 4LF9L 1IPGA 3W1SA 1TY0A 1YNXA 3ZIMA 1YJJA 2VUMG 3TMEA 2ZXRA 3QWZB 2NVYB 3HGBA 1QCBD 3ER0A 5BMIA 3RMKC 3TN2A 5IOCA 1PH9A 4DXFA 1I4XA 4MDKE 3K0YA 2QC8A 3NUHB 4KHPQ 2WWZA 4B9KA 2INPE 4LNOA 4XDXA 1V43A 1STHA 1LT5D 1XT9B 3N32A 3AEBB 4DGZA 2K5VA 1YJ9A 1UE5A 1BBXC 2IO1B 2ASBA 4DV0Q 1L1OA 1SJED 4OZBA 3S17H 4YY3L 4G11A 2UU9L 2ZT9C 2B39A 2LHDA 2TMPA 3FKYA 1E5WA 4K5WA 3CMEA 4KGRA 3QIAA 2EY5A 4A3LG 1XLQA 4ZK9B 1FFUA 2VQEL 2N1WA 2O2LD 3EFXD 2C5CA 1KDCA 4EX5A 3I4NG 2KANA 3L54A 1J7AA 3RUIB 1BBUA 3AB9A 3UDXA 4UY8C 2XK5A 5AZGA 3UE0A 1RFAA 2Z6KA 3K5OA 1CTMA 4B3RQ 2B2VA 2LGSA 3S16H 2CHZA 1Q7YC 2GB1A 4Q0FA 4XX5A 4M0WB 4JI7Q 2M00A 1BDOA 2WGSA 4K14A 4KKSA 3E3XA 3RYTA 4B9WA 3IL8A 5IT9c 1SSNA 1YQBA 3LGJA 3AE5B 4LNFA 4YT0B 3A8KE 1Y8NB 2H4OA 4WORA 1AH9A 1OQYA 3QA8A 4A3JH 4KKUA 2KWCA 1HR0W 1CQVA 2B3GA 2A6HD 2F4VQ 3PUYA 4KJOA 4WURA 2IYDB 4I7AA 4NQLB 1IZ6A 1DZ1A 4H13C 5CX3A 5EDSA 3PCOB 3ZKJC 4PYUA 2MP1A 3RNFC 1T0YA 2HDMA 1UH6A 3DWMA 2LMCB 1SE2A 4C3JH 5IP7G 4LFCL 4LNIA 4ZRQA 2VY3A 1WJ6A 1VQAA 2D2CC 4HSVA 3HOWH 3OTOL 3B08A 1EFWA 3MZ5A 1PDQA 2CW0D 4NW2A 3M7GA 4A3EH 4FHJA 2KOLA 4IJLA 4CDEC 2R92H 2KN4A 5C3JB 4KN7C 1UE1A 2K01A 1EUVB 4DR3Q 2ZNVC 1YJNA 1P98A 3UDFA 4RHSA 2CQAA 3R93A 2WQYB 3Q8FA 4KKJA 4BY1H 4B95A 3HK0A 3ULPA 2WYQA 3GTPH 4ZAIA 3C3LA 2HUGA 2CU1A 1LTSD 2N55A 3IAYA 4K8IA 1S5FD 1SNMA 2O4XA 2BE5D 1GUOA 4KK7A 2M0AA 1EYGA 1UF0A 2VW9A 4JG2A 1TJEA 4WRDA 2F0VA 1QVGA 5KNBA 4IPDA 4R4IA 1TS4A 1OQRA 4HCPB 2DYBA 2MA9B 5D3DA 5JOBA 2E5LQ 4A3JG 1X6OA 1QT9A 2FCNA 2NZHA 4AYBG 4LTUA 2A69C 2R93G 3H3VI 1YX6B 2L5TA 1G91A 3H0GH 3BINA 5AEKB 2C9OA 1ICWA 1C9FA 5JJZA 1SN8A 2D3CA 1I4RA 3RLFA 1B3QA 2QCPX 4K6DA 1WTWA 1C7YA 1GOZA 5IYDG 1TWHH 1L0VB 2J53A 2NN6I 3HOWG 1YNTE 2X8XX 2A6EC 2AUKA 1QVCA 4KIKB 5GAHC 5A2QE 1K50A 1VZ8A 3K5NA 2B2YC 1CZWA 4ZKBB 2R92G 3MJ5A 3U7DA 4A3FB 3ZJVA 2UXDQ 3ZXVA 1S3SG 3G4SA 1FFVA 1Z5SB 3L0OA 3KUCB 3BU2A 2KOXA 4HAEA 3EFCA 4YSZB 4BY1G 2EYJA 3ZJYC 4LF4Q 1F0ZA 1WXQA 1B9MA 3ALBA 2D3BA 1DOYA 1WTHA 3B6YA 1A2TA 4BKSD 2DHZA 1YMHE 3EECA 1EYDA 5ELBA 1PUTA 2ASQA 3I57A 4XDCA 4FLHA 2MBBB 3KYHC 2L32A 2KT7A 3S2DH 5H8YE 2XWBB 5JVH3 1JWUD 5EGTA 1EU3A 4ZHOA 5C23A 3CCUA 2N4FA 4MGZE 4C7ZA 4DR4Q 2W54A 4V190 1UAPA 3M62B 3KW5B 1VQ5A 4ZRIA 2D2QA 1JB3A 3LXFA 3OLMD 3H0GG 4XDDA 2PZTA 1XNQL 1UWXA 2KDMA 3RZWC 2D10A 1X56A 1JWBD 5ELOA 1MSHA 1EZ6A 3W3AA 1NJIC 4LFAL 3EFUA 2F0KA 4B3SL 2KLGA 2MSED 3J81c 3CRKC 2LVPA 4K2KA 2AWOA 1QUQB 4DV2Q 1O80A 3Q22A 1SAPA 1V1PA 4BS9A 5M5YH 1DOKA 4LAAA 2LFIA 1NYQA 3P1MA 2C60A 2B2YA 1VJKA 2B29A 2C9WB 3KBXA 1ZXTA 3S2HB 2LXAA 3PO0A 5LL6X 1MI2A 1EY0A 1FNUA 2M2LA 4LF7L 1ZXHA 5BMGA 3WIMA 1B3AA 1A3TA 1O7LA 1Q5WB 1B9NA 1DD2A 1JJCB 3GTKH 2RPQA 2V1YA 3TMPB 4Y7NB 4JPSA 4ANXA 5D65A 2BQQA 1RRBA 1SE4A 2PQAA 5E4WC 2OCEA 4F88A 4KHVA 1JALA 1V97A 1GB1A 4BY7H 1Q12A 2E3TA 1E3PA 2EYHA 3HIZA 1I42A 2WHIA 1KDBA 2CWPA 5JAVA 2PPHA 2JSOA 1Y56A 1P1AA 3APDA 3GTGB 2EY6A 1B53A 2O6VA 1L0XB 3ECIA 1Z9FA 4OEMB 4DK3C 4G7OC 1RLFA 3VYSA 4OVZA 5L95C 3PF5A 3BK2A 2UUBQ 1WGKA 2XTIA 3H7PA 1K73C 4A3CG 4NJ7A 5C44B 1RAXA 1AN8A 3RD4A 4CHTB 4MM3B 3TP8A 3F1ZA 1V1OA 1WYWB 2DX5B 5G55A 1B7YB 4QB4A 2ZM6Q 1FVIA 4QCLA 3S1NB 3DMUA 4QMGA 2PMZB 1EIGA 4A93B 2VL6A 2EZVA 3AEAB 3K57A 1MGSA 2JN4A 4NXNL 4LF5L 4M8NA 2E76C 3UE1A 1EQTA 2VB3X 1MJDA 3MJWA 3WCQA 5IP4D 4DR7Q 5IT9L 1UBIA 3MEHA 4OELB 1GUWA 2WP9B 1VZ6A 2RCNA 3NTIA 3KDFA 2CHXA 3BS1A 2K28A 4JI1Q 3PIPA 3AV8A 3JYUA 4A3MB 2EYLA 4IWPA 2K03A 1ACCA 4ITKA 4DBGA 1O7YA 1UWVA 4HIMA 1XTCD 3DQVA 5CV6A 4A9AA 1EM7A 4YSXB 4P74A 1Q1OA 4LK1C 2N7DA 2DJGC 1TS5A 2K6DB 2NYZD 1MVKA 1WGYA 1KTKA 1FXTB 4AQ7A 3NP8A 1PH5A 1K9MC 1HR0L 2KQSA 3OHXC 3E0EA 3ITPA 5T1GA 2N0SB 1Y8PB 2EKIA 5KNDA 3SE0A 2KC1A 1ILPA 2MO1A 1GC7A 2JJQA 1E7ZA 4OZAA 3V61A 4ASWC 1OXXK 4EFOA 1TWCB 4BBNF 1LFDA 5CBAE 1N36Q 1G291 4K5VA 1PTOD 2HQEA 1WGHA 3SD5A 3MXNB 2GBNA 5FO9B 3NXWA 1BUIC 3PT2B 3EC8A 2JZPA 2JE6I 3QB3A 1HA5A 1V1PB 2ZPNA 3QOLA 1CT1D 1JMLA 3NWSA 2IDYA 3R3OA 2JA9A 2QA4A 1EOVA 1HJPA 4IC7B 1YOVB 5C3EH 4GDKB 3PF4A 3K7UC 3DWGC 3LNNA 1QOHA 5BR8Q 1IKMA 2K14A 1EIHA 3PRMB 1JQYD 4ABNA 5FJ8H 4IPHA 1ENCA 4RGOS 2Y3AA 3G71A 2F0WA 1IBKQ 3DHGC 2IL8A 1ZYRC 3D6CA 4GB9A 1E22A 1RWSA 3VH3B 1T5XD 1J6QA 5DCNA 4NPSA 2Z0EB 1SMYC 2F0TA 5LMNQ 1VCBA 3BYYB 1WXAA 1HXYD 2OEOA 3BVMA 2M1MA 1V1QA 3HKZB 1C4AA 4HPPA 5IGFA 3PZ7A 2NPTB 1U4AA 3NVWA 4CJ0B 1B44D 2CH4A 1IBML 1WE6A 3BWUD 2UU7A 5DLQE 4DR2L 4LUOA 5IGCA 3SHLA 1LM0A 2K5WA 1E90A 3H1UA 1AWDA 1FD6A 1MG4A 1IP9A 3DWPA 5F2DA 1CHPD 1N61A 3U7ZA 3S15H 1K83H 3APFA 2EYMA 2QIEB 3CC7A 4X57B 4PS7A 4PZ6A 5LNK1 3OW2A 2F0GA 1QZEA 1QKZA 4UP7A 5M3MB 3UGBB 2OJWA 3AE3B 4TUUA 2VZKB 1U9RA 4LF8L 3PGZA 1RFKA 4AYBE 4ZLTF 5FLXE 2P5ZX 1VQCA 1CA5A 2JA6H 4KTAA 1TZ1A 5E6OA 3RR5A 1W6JA 3NQIA 2QHOA 4W9HA 2INDC 4CKBA 2BF8B 3T1HQ 5I2YA 1G8ZD 2JZ3B 2XRSD 3M95A 2KACA 4B0MA 2EOTA 3WDNA 1Q82C 1PTOB 4RGNA 5ELCA 3KJPA 3TBIB 3A9JB 3AE9B 1JOKA 3ZDTA 1JCKB 3J81L 1KLUD 5K36H 1JR0D 2JQRB 3IBEA 2DN8A 1D8LA 1CKMA 4LMQD 2OWOA 4LCDE 4HPLB 4APVA 2N8NA 4K8JA 3CSFA 4GN3B 1V9JA 3SDZA 2BS2B 2RDGA 2DGYA 3DEPA 3FEWX 3QHTA 1B70B 2IPKD 4A3BB 3ABVB 2KCCA 3VR4A 3ZJTA 1PFBA 3AEVA 4W9KA 3Q24A 4XYCA 4YXDB 1UEAB 4DHJB 2FINB 3PMFA 2N9LA 1QB5D 1SYGA 1C4QA 4M8AA 3W1GA 3AQQA 2K25A 2I2YA 1WIAA 5FLXc 3CPWA 3I2ZA 1HNZL 2RHSB 2NVTB 1IXRA 3T4AC 1C79A 3J9CA 3BVGA 1CHQD 1X1MA 3E6ZX 2NVUI 2MJ8A 1HRJA 3JSVA 2J0TD 4WJQA 3HEJA 3I9V1 3RFZB 5A35A 4RCOA 1IBLQ 2B2WC 2FCSA 3AMZA 1XLNA 2BYEA 2K75A 3EUB2 1W3SA 2V3PA 4OWTB 2B8GA 4R4CA 1FNWA 1I4HA 5E7NA 1L6VA 4W9IA 4EE2A 3T1YQ 3UQBA 4WJNA 2ZJPA 4DUZQ 1WX9A 2R2QA 4CKCA 3CP0A 1Q0WB 2IO0B 1GNUA 1UD7A 2R7ZB 1WJNA 1XPRA 4JI5L 4C4VA 1CM9A 4TQ0A 3NENA 3SDLC 2AUJD 4EVOA 1QF6A 1WE7A 1P0RA 5D14A 3OSOA 1E2WA 5FKAC 5GROA 5AJ3L 3RN5A 2DZKA 3RNUA 1MHXA 1ZXIA 1UGMA 4KD4A 2O5IC 4RA8A 2K33A 4JI2Q 3DVNV 2MNAA 1GKHA 2KEDA 1IUEA 3RUZA 4DV1L 3QCAA 3NBHA 4A3FG 4YHHQ 3R66C 4X65L 4WIPA 3M4PA 1AE3A 3J7A5 4WWMA 1PVOA 4X66Q 2GRIA 4GN5A 3N9YC 3M4OB 1H95A 2K32A 5H1SE 1VRAB 4HPMB 2NZ1D 3SHQA 5J3BA 2GBJA 3A74A 2BA0A 3HRZC 2K04A 3T56B 1TYGB 1JWMD 4IFDG 4KY5A 1XMQL 2MBQA 3ZRFA 2RMMA 2L9HA 1R9TB 2MEKA 4HDOA 1STGA 4JI4L 2SAKA 4JL9A 3RZDB 4OX9Q 4A3DH 4QIWE 2ZCBA 2IGGA 3C8YA 4K7SA 1Y1WB 3D8GA 4PZ7A 4FXDA 3KLWA 2A5UA 1WMHB 2H88B 4GDLB 2B2WA 2K1BA 5EPKA 5CGKA 4EEWA 3DWAA 3HS0C 3FAHA 3KF6B 1MI0A 2E2JB 1XMOL 1E7VA 1OFFA 2IX3A 4A75A 3Q3MC 2CS4A 2J7ZA 2WXPA 3ZW3A 4DPGA 4MTNA 3GDEA 3HOZH 2NMQA 2L0FA 2M19A 5C44H 2E8GA 2UWQA 1YJWA 5JJLA 4NAWA 4AOFA 3HOYH 1WI5A 3TP6A 3NK9A 1DJRD 2A68C 3CU7A 4X3SA 3SGIA 3W1BA 3UI3A 5DPWA 3I73A 2N49A 5C0XJ 2NB0A 3LB8C 3K5MA 1HNXQ 3G6EA 3TRZA 2UXBQ 1GUNA 1X3GA 2J0JA 2JXTA 4A93H 5EE9A 3PV0A 2V4IB 1N62A 4WWNA 2ZEQA 3MHSD 4DAYB 1E8YA 5G2NA 2LSSA 3HOUB 3FILB 4BKTA 1SIJA 4L23A 3B1LX 3PGEA 4A3MH 4C7YA 3DHHC 3K9OB 4W9LA 1RIPA 4PMCA 2KFJA 2NTTA 2BW2A 1LLRD 4WFN3 3K59A 1EYAA 3A9KA 3ZTCA 5CBEE 2A5HA 3WALA 2I5MX 1STNA 1YEZA 3BIID 1H9KA 2I46A 3IHPC 2K3UA 3Q6BA 1IL8A 4FYDA 4KMUC 3PUZA 3H94A 4DNRB 5KGUA 3OMCA 4RGTA 4HDQA 4FDBA 1VLBA 2HE7A 3L0WB 1F2RC 2M17A 2FAZA 2QSDA 5C44G 4IFDJ 1TWCH 4DR5Q 5C5LA 4YWKA 2CR5A 4DWFA 5HFYA 2KWDA 3H6NA 1TKYA 3WA0A 3U4VA 3VUWA 4DHZE 2OF1A 3IRBA 1HE8A 3J7AV 3R7QA 4A93G 4GSWA 1F9SA 2Z6BA 5GMVA 2AKWB 4A3IB 4BXXH
chains in the Genus database with same CATH topology
4F87A 2K22A 4DQOC 2IT1A 4RKBA 1HQMC 3HG9A 4XQQA 4IN3A 2PW5A 1F9RA 2DY7A 1PMRA 1IYVA 4KD3A 3CWIA 1FEHA 1RTOA 4M1UB 4IUNA 5HGTA 1PRTF 5M5WB 1NI3A 1ENFA 2B63B 1W6KA 1PYWD 1JORA 1WCMB 1J7BA 2BTEA 5FLXL 4C1NK 1N5XA 2LGIA 5FO7B 4U673 2D9UA 2JYTA 1QOBA 1VCIA 3K7AB 3S1QB 3HOXB 2I38A 4HRSA 1NENB 4M0WA 4NJCA 5CYUA 3VR8B 1KH0A 4EQOA 4F7XA 1E2VA 5C2TB 2W82A 1RJTA 1TS3A 1HUNA 1ZE3D 2J42A 2QEJC 5I4DA 4AS1A 2AQ3B 2L11A 1CK1A 3TSSA 1I7HA 3Q8BA 3TZDA 2LMCA 1TVXA 3GB1A 4OO1G 3U4EG 1YNND 3MWYW 2XVSA 2EVBA 3GTMB 1K8MA 4L8JA 3PO3B 1EY5A 2A6HC 1Q1BA 4NKLA 4GZYC 2FE8A 3P4SB 1VDZA 1QOAA 3KLRA 4HROA 1IBXB 2WB1B 4E6IA 2B2TC 1PXUA 2CW0C 1TZOA 5IT9E 1JICA 3G6JB 5H92C 3V3XA 2F4IA 1WVLA 1HFNA 3KLSX 5BN5A 4PT5A 5G3LF 3ZYYX 2LKVA 4NAMA 3D6WA 2BE5C 1I6HB 3LYYA 4X3KA 3EVQA 4YWGG 3MFYA 5D7GA 5C4XB 3AEFB 4CGYB 2X69A 1BQQT 3CIRB 1KABA 3FRPB 2QKIC 2KVMA 3PUWA 2M56B 1RKNA 1QWYA 1SYDA 3AE2B 2PYKA 3ETRA 1XCTL 2PVGC 2NTSA 5CORA 4G57A 2FBWB 2JX5A 3HRDD 1LACA 2JEAI 5I6WA 3LX0A 3V2TA 4G7HC 1F9QA 4WH4A 4DXGA 1FXIA 2BDNA 3NVZA 2F3WA 3ND9A 4FF3A 1QOGA 2WV6D 3WOEA 3NWTA 2W3SA 4N59A 1LTID 1HTLD 2JU6X 3WOFA 1B50A 2PCFB 5BYRA 4GLSC 3T51B 3SEBA 1YQ4B 2FMMA 1F2MA 4KGSA 5AUKA 4TMAB 2WXKA 4RHRA 3I72A 5FO8B 3JAML 2B76B 3R2TA 4A90A 1TWGB 4HCEA 5CC4A 4O42A 1R4PB 2KA7A 3ONAB 4DAPA 4KKIA 2INNE 3KWVA 1IKLA 2YEPF 3MFGA 1EWCA 3J81E 3FKIB 1JOOA 4KN4C 1HQRD 1U4PA 3VYRA 2BT6A 4FXKC 5I6YA 1VMPA 1LTBD 1SYBA 2WU2B 3MTSA 2VNUD 2X6GA 4O1NA 1EY9A 4RCNA 4FXCA 3OMGA 3DWQA 2JYEA 4OIJA 4HSPA 2F0DA 2XN9C 4XWTA 2PIAA 1HZ6A 1WD0A 1VZ7A 4DNTB 3BDLA 2F1MA 1BCPF 1XXGA 1R7SA 4XXEA 2Q5WD 2R61A 4ZKCB 2E6XA 3VR9B 1L4DB 4XQJA 1MHHE 1X3PA 3MXNA 4C56C 2BB6A 4BA2I 1NSNS 3DUZA 2ZW1A 3H8HA 4FVMA 1I6VC 4PMWA 1AZQA 1JWAD 4ZHPA 1PZJD 3H3VC 2MUYA 4R9WA 3NUCA 2MH7A 3M7NA 3K6OA 3A54A 1SSOA 3CHBD 1PTOC 3VR6A 5DEHA 2PKOA 1KRHA 3N52A 4KGTA 1DXMA 2WS3B 2BCOA 2WXIA 1WSPA 4PQXA 4RF1A 3SFDB 2WLBA 4NMZA 4ODGA 5TSSA 1O78A 3Q0AA 5I9PA 1PRTD 3HUIA 2KUMA 2H89B 3T3NA 2DNCA 4QF4A 1G2SA 2PNRC 5C3WA 4G4KA 1GUGA 3HOVB 3EGRA 2RDHA 1E9MA 2W3RA 3C2PA 3MXUA 3AE6B 3KUPA 2IX0A 2Q8RE 1UNSA 2ON8A 1F2ZA 1SE3A 1DOLA 2F0PA 1NYRA 1RM6C 1HEZE 1S5BD 4I7ZC 1C78A 4XE0A 5C5MA 1RCVD 2WKCA 2CHBD 2LJIA 4KY6A 2WDRB 2LS01 3FPPA 1FR3A 3TUOA 4RWSC 4A3KB 1NR4A 3MHBA 3BZDB 3H6MA 3BYTB 2OXPA 4XQNA 4MH8A 3TDQA 2JXMB 4H2AA 2FJ2A 5EBCA 3M3YB 2KJXA 1K51A 4C3IB 2SNSA 3TP5A 1BR9A 1LT3D 2JSVX 2ONQA 1MSGA 4DF7A 1NCVA 2ACZB 4IOIE 4P2CB 1PFDA 4H0LC 2RSOA 1AFPA 4OHJA 1OQQA 5G3LD 5BMHA 2GI9A 4HMIA 4NDXA 1SNCA 1SNPA 4S3SA 3J80L 1QNUA 5IODA 3A55A 1RHPA 3Q6SA 5FR3A 2L4NA 2WP8J 1X3QA 2LHEA 3MC0B 1WTXA 2EJMA 4P16A 5KNCA 2MHVA 4UDUC 2F0UA 3X3NA 1T5EA 3BDCA 2JA5B 2WAQB 2PLPA 4CJ2C 2KECA 4QUFA 1E0BA 1D5ZC 3TEZA 4KJNA 2WXGA 2N9KA 3FVQA 4K6LA 2G9DA 3SK5A 1STAA 4JBWA 2WXLA 5C0XH 1C48A 4QUCA 3Q69A 3IAS1 1WTRA 1H9SB 3A7AB 2L1AA 1LABA 3FMCA 3NS1A 4HN7A 5JVG3 2WXRA 1WRIA 4MACA 1XCQL 4IALA 1TKWB 5J22A 2XWJB 1L6UA 1TKEA 3RPFC 4J1MA 3MXGA 2JYOA 1UWMA 1PFMA 1GAQB 1TWFB 3GV6A 2XRQD 1XWEA 2SOBA 3R2IA 2RBMA 3KK7A 2B2UC 1ZUD2 3I4MB 4DAYA 3NZ3A 2EYPA 1BXTA 1DOXA 1II3A 5E1FA 1OXUA 3FILA 3AMUA 2KMMA 4IFDH 3F2UA 2XNAC 1Q90A 2DNEA 4DFAA 5EPLA 5C0XG 1YQ3B 2QF7A 2DYMA 5E4XA 2K5PA 3KBGA 3CRLC 1YN3A 3D3RA 1EZ8A 1D1IA 5KEEA 4IUVA 2RA4A 3PIO3 1CZGA 1ZPSA 1JW9D 4P6VF 4N58A 1G2TA 3L9AX 3QWNA 3VYUA 5EE3A 5CMDA 4OGQC 4H44C 3S17B 3MP9A 2L52A 4DA2A 2PO4A 2D5GA 3E9SA 4DU9A 3IFDA 2B2UA 3OIPA 2QJLA 2L1BA 2HCCA 4FF1A 1RYJA 1JQ4A 2RSNA 2DLBA 3LWUA 2F0SA 3VR5A 1A15A 1S5CD 1BCPD 1RDPD 2F0JA 4ZRPA 3Q8CA 3W2DA 2E75C 1E10A 1FRDA 5EJWA 3A8IE 3D4WA 3OPOA 1AW7A 4HTHA 3NSWA 1D2BA 3NTKA 4TQ1A 1ZDXA 2B8FA 1GUSA 2F0EA 1ZDVA 1B2TA 4C3JB 1FYCA 4JE3B 4A3EB 4HKZE 3IXSA 2L55A 2WXFA 3TP7A 1MD2D 3GTPB 1ZEQX 3E5SA 4TRDA 3KLSA 2F0MA 4RH6A 4JWSC 1MPEA 3MA2B 1FXAA 1JRPA 3SK6A 1LT4D 1GPXA 4A6QA 2L83A 5EE0A 3JAME 3S1RB 3NRZA 1R4QB 2K5DA 3TZUA 3HVDA 5KYLA 3SXHA 1CZPA 3VR2A 1FIQA 1IBXA 3QO2A 4DK1A 1NAPA 4L1BA 4KX6B 3NVVA 1T6BX 1I4PA 4RF0A 4Q2JA 2EJFC 2WXJA 4D2KA 2JA8B 1YNNC 5BYSA 1SEBD 1HTPA 1EWYC 1BCPB 3NBIA 2F0LA 2AQ1B 2D62A 1C8CA 1M8AA 1Y69U 4R8NA 3HP3A 3IAM1 3NTHA 3AE8B 1E2ZA 2PZUA 1WTPA 1STBA 3GV3A 3EA6A 4OO1H 1LTGD 3AU7A 1UGJA 4HCSA 2A74C 2O5JC 1SDFA 4IFDI 2ICEC 2EYFA 3NQTA 3PUVA 1FGBD 3D4DA 1BF4A 4ULLA 4RNAA 5NUCA 4OZCA 3I70A 1I4QA 1CFMA 2Z8LA 2BDOA 5EKIA 3MAQA 3T16A 4DAVA 1ZP0B 3V96A 1PGXA 4KY7A 3AN1A 4HEA1 4R3DA 2AX5A 1S5DD 3VQIA 3NVYA 1PGBA 4ZOHC 4PV1C 1A70A 2KAJA 1TQOA 4ARCA 3I91A 1QE6A 3DHQA 2R6GA 5JXVA 3IKJA 5J39A 4C3IG 5JEAG 2WIIB 2ICIA 2PPBC 1TWAB 5BYQA 3AEEB 1TR5A 3C1FA 3J7YW 3FC4A 2E2IB 1C76A 4BY7B 2VXWA 5ELEA 1PTOH 2PW7A 1C77A 4HKQA 1J7CA 2X6LA 3I90A 2OEDA 3SR6A 4CQNA 4IURA 1YN4A 1ONLA 4LJZC 1JROA 4LK0M 1WWTA 1OO9B 3P4QB 1LV9A 1VF5C 3NPPA 1LT6D 1E7PB 1EY8A 2AWNA 4RFBA 1EY7A 1F2YA 5J1ZA 3K58A 1IW7D 4FO2A 4Q5VA 2NVQB 4BWGB 5ELFA 2JEBI 5CR3A 3O13A 5JPMC 4XYOA 5EKLA 3PUXA 2CVRA 2B2VC 4B9XA 4TQUS 2DYOA 3L3OC 1S4ZA 5CV9A 1TT2A 2L0CA 1AEXA 3E56A 2NN6G 4XTCS 3PZ8A 1H9RA 3A8JE 1EWHA 1TIID 3TEXA 2HDLA 1PLFA 1YJIA 2EXZA 2QILA 3Q8AA 1HHVA 1SF0A 2G1EA 5JEAJ 2JWUA 2WU5B 4MT5A 1YNJD 4JK1C 2SNMA 2Z4IA 1IYUA 1JE4A 3CQZB 1XEEA 1TS2A 4I65A 5EBDA 3PIP3 2B2TA 3OIQA 3AE4B 1QLBB 5AUIA 2NVXB 1L5PA 3W5UB 2FFKB 5C3EB 1PDXA 4CJ1B 1A3UA 3BG3A 4ZRZA 4B08A 2EY1A 1QJOA 1SYCA 3AB5A 4RGMA 4UAIA 5DNFA 3GS2A 3HZXA 4WQMA 5ELDA 4U68A 1LTTD 1SB3C 4WJWA 2JP1A 3B2FA 2RDFA 3U2SC 4KHZA 1XO3A 4V0BA 4B0EA 2K5QA 3AM9A 3J80E 3L4PA 1EY4A 3URYA 1BMLC 1QILA 4N6EB 3S15B 1K83B 3H09A 4ZUJA 4OO1I 2KQ3A 3AEDB 4KKTA 1NEKB 5T1IA 3ZGZA 5M3FB 3S9WA 4X3UA 1GHJA 2Z1CA 1T3QA 2A73B 2JA6B 5C4HA 1GJXA 5LL6S 2H1EA 2Y0SB 3CKIB 1HUMA 1ET9A 3VRAB 4A8XC 2WXOA 5IGDA 1KNEA 1RF2D 1ESFA 3GP7A 1ET6A 1GXDC 1OXSC 3ND8A 5C4ZA 2EY2A 4C3JG 4IUUA 1LTAD 1PRTC 1Z6HA 4H7BA 5G5GA 5CV5A 1U4MA 4FNFA 1NVID 5EKKA 1HFGA 4YTNB 5K5PA 5FK9C 1J9OA 4IUQA 1D4BA 1FNVA 2K0PA 3DM1A 3BVZA 2L12A 4USAA 3SK4A 1CI3M 3IT6B 1BUVT 1CA6A 4MN3A 5HURA 2PZWA 2OHFA 4LLGM 1Q3LA 2F03A 4BBSB 4IKGA 3QG1A 1YN5A 3QOJA 5E3FA 3SR1A 1IGCA 3Q8EA 2DY8A 5KIXA 3SVMA 3VRBB 2WDQB 2WXQA 3RMHA 5G5HA 2BS3B 4ILWA 1PFNA 4OL7A 1VF7A 1AP0A 2IWHA 2K9XA 2V0GA 2BB5A 2LY7A 3AE7B 4CKEA 1STEA 4F8MA 5D3IB 4MHEA 3P4RB 2F0IA 2A69D 4IZ8A 1I50B 1EFID 4C2MB 1EOTA 2ZXPA 1Q1EA 3GQBA 3KQ4A 5COYA 1K52A 1LO5D 4A3DB 1ZOYB 2ZXOA 2A6ED 4ZQ3A 3L7ZC 2BOSA 1UUPA 3GTJB 4ID6A 2G9HD 3NE5B 4FF2A 1XF5L 4OW0A 3NHHA 5CV7A 4N9TA 2BYTA 3OWEB 4FXGC 3I8ZA 1GHKA 2EELA 1A3VA 2BBCA 5EE1A 3HOZB 3GTQB 4KI0A 3AECB 2SEBD 4HEDA 3U9OA 4HJGE 3HOYB 2DWQA 3PO2B 4KV6A 5IGBA 5CV4A 2IJ0A 2PVOD 1H9SA 1WD1A 1I4GA 3SFEB 4EQPA 1K8OA 2K05A 1DOIA 1SBBB 1V8CA 1EY6A 3TEWA 2MJEA 3T3OA 3EROA 2BA1A 3P20A 1Z7TA 1Z47A 5C3XA 3EQLC 2PMVA 1IGDA 2VZKD 2RVLA 1QQRA 2WXNA 5LHY1 1Q10A 1HA6A 1HPCA 1FCLA 2WKDA 2NWGA 2X38A 1D6EC 1C4CA 1XLOA 5MPOA 4NP5A 2SDFA 4YIJA 4ME5A 5M5XB 1PRTB 3P1HA 1DGJA 1C4PA 3V05A 1N63A 1XX8A 5KRUA 2FUG1 4A3GB 1TY2A 2W55A 2WXHA 4BBRB 1PZID 2E2DC 1O7ZA 2JA7B 1Y1VB 4X3TA 4C3HB 1WTQA 4HR7B 2PW9A 3P75A 2V3NA 5E6JA 2PTLA 2EYOA 2Z4HA 2QDBA 2R3ZA 4OIKA 3B9JA 4RAUC 2F0HA 2N7JA 5C4JB 4YTPB 1FM0D 3MXPA 3T53B 1TU2B 1PGAA 5KYIA 4XYQA 3FPUB 2NBFA 1L4ZB 1FD7D 2LFNA 2VB2X 1GUTA 3H91A 4R8IA 1Y8OB 1CQFA 3I3CA 4JWUC 1TKGA 1I3QB 2AQ2B 4HMJA 3QJYA 1H9JA 4CBVA 3B2GA 2VUMB 4REZA 2D5DA 2KCNA 1STYA 2DBYA 1F77A 3OOCA 3P7JA 1HZ5A 5DAUA 2K6AA 5DM73 3Q23A 5JPNC 1SJHD 1QNKA 1U4LA 5A2QL 1QOFA 5BN4A 1X32A 1BCPC 3VA5A 3OW7A 2Q8IB 1DYQA 2QMTA 1J8IA 1V8QA 4K2LA 4G7ZC 4YTMB 4TKOB 1ZYRD 4YSYB 2KEEA 4ZUIA 3ZQ4A 2WNMA 1D5MC 3I4NB 1SMYD 2ID0A 3AE1B 4BA1I 2OT2A 3A56A 1D5XC 2F0FA 2WXMA 3KF8A 2LUMA 1IHZA 1ENAA 5HHDG 4Z9CB 3MVVA 4US8A 4L63B 3BDOA 1ILQA 1XLPA 1SNDA 4XWWA 3D4RA 5FOBB 2MJDA 1JC7A 1XYIA 1H9MA 5K36G 1ZKOA 3IFTA 1A2UA 2CJNA 3I4LA 2TSSA 5DM63 3N6RA 5I9OA 3UI2A 1S5ED 3IT4B 4IUTA 3EJIA 1BNZA 2CJOA 1NR2A 3DXJC 3S16B 1VR9A 1JWSD 3M4YA 1QG7A 2Y5PA 2WACA 4IDIA 1EEFD 3J7AF 1F2RI 4WAFA 4A3JB 2I07B 4XT1B 4AYBB 5I2XA 2R93B 2E2HB 1DOMA 1ESRA 2XIWA 5T8IA 1LTRD 2N88A 1CJEA 1ROEA 4PNYA 1A6XA 2FHTA 4J6HA 3A7LA 2RQXA 1E0ZA 3FDTA 2PQEA 2F0OA 3HOWB 2RKSA 3R8BA 2Y5CA 2Q8TA 2M9VA 1B9RA 3S14B 2R92B 3VA7A 2MJ3A 1RD9D 4FP5D 5ISRA 4BY1B 2YU9B 1KF6B 5CV8A 1SYFA 2HCIA 2YEPB 1RTNA 4DK0A 2IX1A 3OWFA 2V4DA 4ARIA 4EGVA 1EYCA 4C80A 1SNQA 2HTME 4DN4M 1HCZA 2MGSA 3VR3A 3AEGB 3H0GB 2LEKA 4IUPA 4MIUA 4J8QA 5C0XI 1EL0A 3SK8A 4ZYSA 1SNOA 1TWHB 3C46A 3U52E 1OXVA 4C1NI 2FMCA 1RODA 1ML0D 1SFOB 2WDVB 5EQ0A 1EU4A 2F0NA 3K5LA 5GXGB 5M9OA 1G6ZA 1KFYB 3KWLA 5BN3A 1WYGA 5JEAH 4XIGS 3TEYA 1B1ZA 3E0JA 3P63A 2KHSA 3S2DB 1L0YB 1Q8IA 4JX1C 4N9PA 4IQZA 1KDAA 3ERQA 1IW7C 1F2LA 2ENBA 1MBYA 4K5XA 4NZLB 3GTLB 1WTOA 1EEID 3GO5A 4QIWB 2ZW0A 2NUCA 2A68D 2IGDA 3GD7A 1FO4A 3DEOA 4A55A 3AH7A 1B4OA 2BS4B 1KNAA 4TSSA 2HDEA 2KQ4X 2EJGC 4US9A 2EE1A 2F3VA 3U9SA 3ZJUA 5M5YB 1SXTA 1K53A 1U4RA 3P42A 1NUCA 1EQVA 1BO0A 2E74C 4NAWB 2GA4B 3T13A 3GTKB 1FCCC 3VYTA 5EPJA 2IW3A 1M4VA 1YNJC 3P4PB 4L2YA 3D31A 4L6TB 2NN6H 4RKLA 1SYEA 1F9PA 5IGGA 5AFWA 1N60A 3RZOB 1VDVA 1WTVA 2J52A 1E6EB 5IIFA 3S1MB 2F0QA 2IGHA 1DCZA 4C3HG 5HG2A 4FF4A 1DM0B 4XT3B 2XSCA 3G7LA 2K7VA 3MHZA 3M85A 1FRRA 3W5VB 1OXTA 1AYFA 2CU3A 3X3MA 1P7FA 5HI1A 1PTOF 1JOQA 5C6AA 4PMBA 2J4XA 1BOSA 1AZPA 1D1KA 1FMAD 1VMCA 2EDGA 2WINB 3GTOB 2RPVA 1P7EA 1PZKD 3BK1A 3HVZA 4EQNA 3LWEA 2YYZA 3W9CB 1GB4A 1N5WA 1KAAA 5IGEA 2EPBA 4J3OD 1KLGD 3C1EA 1DONA 2MPMA 3W1SA 1TY0A 1YJJA 3TMEA 2ZXRA 2NVYB 3HGBA 1QCBD 5BMIA 3TN2A 5IOCA 4DXFA 1I4XA 3K0YA 3NUHB 2INPE 4XDXA 1V43A 1STHA 1LT5D 3AEBB 4DGZA 1BBXC 1SJED 4OZBA 2ZT9C 2B39A 2LHDA 2TMPA 4K5WA 4KGRA 3QIAA 2EY5A 1XLQA 4ZK9B 1FFUA 2O2LD 3EFXD 2C5CA 1KDCA 1J7AA 3AB9A 3K5OA 1CTMA 2B2VA 2GB1A 4Q0FA 2M00A 1BDOA 4K14A 4KKSA 4B9WA 3IL8A 1SSNA 3AE5B 4YT0B 3A8KE 1Y8NB 2H4OA 4WORA 4KKUA 1CQVA 2A6HD 3PUYA 4KJOA 4WURA 1DZ1A 4H13C 2MP1A 2HDMA 3DWMA 2LMCB 1SE2A 4ZRQA 2D2CC 4HSVA 3MZ5A 1PDQA 2CW0D 4NW2A 3M7GA 2KOLA 5C3JB 2KN4A 4KN7C 2K01A 4RHSA 2CQAA 3R93A 2WQYB 3Q8FA 4KKJA 4ZAIA 3C3LA 2HUGA 1LTSD 2N55A 3IAYA 4K8IA 1S5FD 1SNMA 2O4XA 2BE5D 1GUOA 4KK7A 2M0AA 1TJEA 4WRDA 2F0VA 5KNBA 1TS4A 1OQRA 5D3DA 5JOBA 1QT9A 4LTUA 2A69C 2L5TA 1G91A 2C9OA 1ICWA 1C9FA 5JJZA 1I4RA 3RLFA 2QCPX 2J53A 4K6DA 1WTWA 1GOZA 1L0VB 2NN6I 1YNTE 2A6EC 2AUKA 5A2QE 1K50A 1VZ8A 3K5NA 2B2YC 1CZWA 4ZKBB 3MJ5A 4A3FB 3ZJVA 1FFVA 4HAEA 4YSZB 2EYJA 1F0ZA 1WXQA 1B9MA 1DOYA 1A2TA 1YMHE 1EYDA 5ELBA 1PUTA 3I57A 4XDCA 2L32A 5H8YE 2XWBB 5JVH3 1JWUD 5EGTA 1EU3A 4ZHOA 4C7ZA 2W54A 4V190 1UAPA 1JB3A 3LXFA 4XDDA 2PZTA 1UWXA 2KDMA 1JWBD 1MSHA 1EZ6A 3W3AA 2F0KA 3CRKC 4K2KA 2AWOA 1O80A 3Q22A 1SAPA 1V1PA 4BS9A 1DOKA 4LAAA 2LFIA 1NYQA 3P1MA 2B2YA 1VJKA 3KBXA 1ZXTA 3S2HB 3PO0A 5LL6X 1MI2A 1EY0A 1FNUA 2M2LA 1ZXHA 5BMGA 1B3AA 1A3TA 1O7LA 1B9NA 1DD2A 4Y7NB 4JPSA 5D65A 1SE4A 5E4WC 4F88A 1JALA 4KHVA 1V97A 1GB1A 1Q12A 2E3TA 2EYHA 1KDBA 5JAVA 2JSOA 1Y56A 3GTGB 2EY6A 1B53A 1L0XB 4G7OC 3VYSA 4OVZA 3BK2A 1WGKA 5C44B 1AN8A 3RD4A 4CHTB 4MM3B 3TP8A 1V1OA 4QB4A 4QCLA 3S1NB 3DMUA 4QMGA 2PMZB 1EIGA 4A93B 2EZVA 3AEAB 3K57A 1MGSA 3WCQA 2E76C 1EQTA 2VB3X 5IT9L 3MEHA 1GUWA 2WP9B 1VZ6A 3NTIA 3AV8A 3BS1A 2K28A 4A3MB 2EYLA 2K03A 1ACCA 4ITKA 1O7YA 1XTCD 4A9AA 5CV6A 1EM7A 4YSXB 4LK1C 1TS5A 2NYZD 1MVKA 1KTKA 4AQ7A 3NP8A 3OHXC 3ITPA 2N0SB 5T1GA 1Y8PB 2EKIA 5KNDA 3SE0A 1ILPA 4OZAA 1OXXK 1TWCB 5CBAE 1G291 4K5VA 1PTOD 2HQEA 5FO9B 3NXWA 1BUIC 2JZPA 2JE6I 3QB3A 1HA5A 1V1PB 3QOLA 1CT1D 1JMLA 3NWSA 2IDYA 3R3OA 4GDKB 3DWGC 3LNNA 1QOHA 1IKMA 1EIHA 1JQYD 4ABNA 4RGOS 1ENCA 2Y3AA 2F0WA 2IL8A 1ZYRC 3D6CA 1RWSA 1T5XD 1SMYC 2F0TA 3BYYB 1HXYD 2OEOA 3BVMA 3HKZB 1C4AA 5IGFA 3PZ7A 3NVWA 4CJ0B 1B44D 3BWUD 5IGCA 3SHLA 2K5WA 1AWDA 1FD6A 3DWPA 5F2DA 1CHPD 1N61A 3U7ZA 2EYMA 2QIEB 5LNK1 2F0GA 1QKZA 5M3MB 3AE3B 2VZKB 1U9RA 1RFKA 4ZLTF 5FLXE 1CA5A 4KTAA 1W6JA 3NQIA 4CKBA 5I2YA 1G8ZD 2XRSD 2KACA 4B0MA 2EOTA 3WDNA 1PTOB 4RGNA 5ELCA 3AE9B 3TBIB 1JOKA 1JCKB 3J81L 1KLUD 5K36H 1JR0D 2JQRB 2DN8A 4LMQD 4K8JA 3SDZA 2BS2B 2RDGA 3DEPA 3FEWX 2IPKD 4A3BB 3ABVB 2KCCA 3VR4A 3ZJTA 1PFBA 3Q24A 4YXDB 1UEAB 2FINB 3PMFA 2N9LA 1QB5D 1SYGA 1C4QA 4M8AA 2I2YA 2NVTB 3T4AC 1C79A 3J9CA 3BVGA 1CHQD 3E6ZX 2MJ8A 1HRJA 2J0TD 3HEJA 3I9V1 3RFZB 5A35A 4RCOA 2B2WC 3AMZA 1XLNA 3EUB2 2V3PA 2B8GA 1L6VA 1FNWA 1I4HA 4EE2A 4CKCA 2R7ZB 1CM9A 4TQ0A 2AUJD 4EVOA 1QF6A 5D14A 3OSOA 1E2WA 5FKAC 1MHXA 1ZXIA 4KD4A 2O5IC 4RA8A 2K33A 2KEDA 1IUEA 3RUZA 3NBHA 4WIPA 4WWMA 2GRIA 3N9YC 3M4OB 2K32A 1VRAB 2NZ1D 3T56B 2BA0A 2K04A 3HRZC 1TYGB 1JWMD 4IFDG 4KY5A 2RMMA 2L9HA 1R9TB 2MEKA 1STGA 2SAKA 3RZDB 3C8YA 2IGGA 1Y1WB 3D8GA 4FXDA 2H88B 4GDLB 2B2WA 2K1BA 5EPKA 5CGKA 3DWAA