4RGOS

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 63
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
S PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgoS02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgoS01
1HTLD 2QEJC 2Z8LA 3DWPA 4RCOA 3R2TA 1T5XD 1LTTD 1JWMD 1SJHD 1JQYD 1MD2D 5ELCA 1PZKD 1TY2A 5FK9C 5D3DA 1BCPF 1FD7D 1EEID 5ELBA 1BCPB 1FNVA 1D5ZC 1ET6A 5FKAC 1D6EC 1QILA 4RHRA 4RFBA 1TY0A 2J4XA 1CQVA 1S5FD 1HXYD 4DXFA 1PTOC 2AQ3B 2SEBD 1JR0D 4O1NA 1KTKA 2NTTA 1AN8A 1RCVD 4DXGA 2XRSD 1LT4D 2IPKD 4K6LA 1HA5A 1FGBD 1PYWD 4RHSA 1ESFA 3BVGA 1D5MC 1XXGA 1LTBD 1DJRD 1PTOB 2XRQD 3O13A 1BXTA 1PRTC 1YN3A 1BCPD 1V1PB 5ELFA 1KLUD 1LT6D 1B1ZA 2XN9C 1KLGD 1I4RA 2CHBD 1LTID 1FNWA 1M4VA 1CHPD 1STEA 2O2LD 1SXTA 1PRTB 3DWAA 3BVZA 5ELDA 3BVMA 3R8BA 1LTAD 5D3IB 3URYA 1SBBB 1EWCA 4RGMA 1SJED 3MC0B 1L0XB 1I4PA 1FNUA 1LTSD 1JCKB 1LLRD 4L6TB 1PTOF 1TS5A 1I4HA 2WV6D 4OHJA 4RGOS 4UDUC 1S5CD 1JWSD 3GP7A 3EA6A 2AQ1B 3DWQA 3KLSX 1RF2D 3CHBD 1I4GA 1UNSA 3TSSA 4NZLB 3OWEB 1EFID 4C56C 2ICIA 1TS3A 3EFXD 4ZYSA 1PRTF 2QILA 2R61A 2G9HD 1EU4A 1SE4A 1RDPD 1UUPA 1L0YB 2RDGA 1BCPC 1CHQD 2AQ2B 1SEBD 3BYTB 1HQRD 1LT3D 1ENFA 1TS2A 4L63B 1G8ZD 1LTRD 1PTOD 1V1PA 1CT1D 1SE3A 2XNAC 3MFGA 4Z9CB 1XTCD 3V05A 1I4XA 4BWGB 4RGTA 1LT5D 1RD9D 1V1OA 2RDHA 1CK1A 5I4DA 1B44D 4RH6A 4RGNA 1GOZA 1TS4A 1YN5A 1LO5D 1D5XC 1PZID 1JWUD 5ELEA 3BZDB 1LTGD 3BYYB 1PTOH 2NTSA 1PRTD 3SEBA 1YN4A 3W2DA 1EEFD 1S5ED 2IJ0A 3R2IA 2TSSA 1EU3A 1S5DD 1F77A 1I4QA 4TSSA 1AW7A 5TSSA 1ET9A 1PZJD 1S5BD 1DYQA 1SE2A
chains in the Genus database with same CATH superfamily
4JL9A 3PV1A 1WGHA 2QKIC 2Z4HA 4OEMB 1VJKA 1PH6A 1JQYD 2F0TA 5ELCA 4B3TQ 3S15B 3NS8A 1RHPA 4JBMA 3HZXA 2NBWB 4F8MA 4WWOA 1MGSA 1UAPA 4RHRA 1E0ZA 3I4OA 1XCTL 4BY1B 1HXYD 3QJYA 3A1QB 2RSOA 5EKKA 3SU8X 1HNWL 2BA1A 3J80E 2RSNA 1EWHA 3C2PA 1WXVA 2MA9B 3MTNB 2MO1A 2IGHA 2WB1G 1IYUA 1C7YA 2V1YA 3TN2A 3MC8A 4QAYA 5LNK1 2WXOA 1IPGA 3I5JC 1Y1WH 1WFYA 2BPSA 1SMYC 3FP9A 4A3BH 2GBKA 3FPPA 4Q0FA 5IOIA 2F52A 2L32A 3PPAA 3T1YL 2DY7A 1SNMA 3PSEB 1A3UA 5HGQA 2EY6A 4RM8A 1XTDA 2M19A 4KMUC 1KOTA 3AE8B 5M5YH 1XLOA 2WXJA 3PHXB 1L1OA 3BS1A 3T1YQ 2RR9A 1R4PB 5C4XH 2UU9Q 4X3UA 2O2LD 3VYUA 4MJSA 4EE2A 3DWAA 5G5GA 3EN2A 3H3VI 3HUIA 2SDFA 4GN3B 1DM0B 2LGIA 3NBHA 2KEEA 5E7NA 2JY6A 3AU4A 2OHFA 2AUKA 4JGHB 2HIXA 5GROA 3NSWA 2KENA 2F0LA 3DBRI 1NBFC 1OEYJ 1GVPA 1VQMA 1SE9A 1PTOF 1SSNA 1IYFA 1LQBA 1OQYA 2HTME 1ZP0B 4UDUC 1WGGA 2EY1A 3DBRB 3AMZA 1EL0A 1CSPA 1X3GA 5AZFA 3BY4B 2FCMA 2JEAI 1IL8A 3H09A 2A4ZA 4JWUC 5IA7A 4EX5A 2WXGA 2ICIA 1AH9A 2WYQA 2AKWB 4XX5A 3EFCA 2QHOA 2KCMA 3NTKA 4I7AA 1NJIC 1EU4A 2FIFA 5M5XB 3K9PB 3U2SC 5MPOA 1UUPA 2K7VA 3U7DA 3R93A 4EQPA 5IT9E 2D3BA 1D4BA 1PGBA 1VQOA 3J7ZC 4L63B 1WZ3A 4WJOA 1PTOD 2M0XA 4KDLB 4XDXA 2HJ1A 4DV2L 2OQKA 2OJRA 3X3NA 3RULA 5KNBA 1VZ8A 1FCLA 3E3XA 3W1SA 1MKHA 4DV2Q 1V1QA 2UXDL 3IT4B 1E2ZA 4FXCA 4ID6A 4BA1I 4A3LH 2YTYA 4JI0L 2IO0B 4WJWA 2JA6B 4DR4L 1A3TA 2CH4A 4O2DA 1WGKA 4C4VB 2UXDQ 3AFQA 2RMMA 5GMVA 3DM3A 2KHWB 3KLRA 2JA8H 3Q22A 4DAPA 3MC9A 3N1YC 3MEFA 3R2IA 4IDIA 3CIRB 4LW1A 5KEEA 1DOYA 1AW7A 2E2HB 2MP2B 1DYQA 1HTQA 1WXSA 1CA5A 3DEOA 3L7ZC 4A20A 4HLEA 1WE7A 2BTEA 3VR4A 5C0XG 3L13A 1JT8A 3DHGC 4LAAA 4LF8L 3PIOA 5L83A 4DU9A 1WTQA 4JBKA 3H15A 1D2BA 1IGDA 2RPQA 1WTWA 3RUIB 1FXTB 4FA6A 4R9WA 2LGSA 2K5HA 5ELBA 3FKYA 4HK2A 1BCPB 2HCCA 4LF8Q 1STBA 5C4JB 1NYQA 1D6EC 2D07B 1PXUA 3QJZA 2K75A 1FXAA 4QMGA 2MJ3A 2FUG1 4C00A 4DV7Q 3N3KB 4B9WA 1CA6A 2Y0SG 1SIFA 1DOMA 1O7YA 1ZW7A 3B08A 3DQVA 2BDOA 3CKIB 3W5UB 1BMLC 3HFZB 1P16A 5LMNW 4GKJQ 4PZ8A 1HRJA 1C78A 4K81A 4UAIA 1OQQA 2MHJA 5J18A 1A3VA 4TQ0A 3HKSA 3F2DA 3NZ3A 3DBSA 4A3EB 2I38A 3J81i 2VRRB 4RWSC 1V97A 4E6IA 4GNXC 1KNEA 2FINB 1X1MA 4XXEA 1WYDA 3HOYB 1TT5B 4R4CA 3SFDB 2R2OA 3TCAA 2ON8A 1V8CA 5JJIA 1B3QA 1KLUD 4X65Q 1JWAD 3V60A 3W5VB 3RMHA 5L95C 1YQ3B 3M9BA 4OW0A 4ZRQA 1E7UA 5E6JA 4OWXB 2MUYA 4GXBA 4BBRH 1UE6A 1XLPA 3L0WB 2MBBB 3M7GA 1U5KA 1BR9A 3Q24A 3ICEA 4A3JH 2BW2A 2C5LC 2JK8A 2K5DA 2AHOB 1AWDA 4MSQB 3S2HB 5EAYA 4XE0A 1HZ9A 3I9V1 1QOHA 4LK1C 3A8IE 2LASA 3VH4B 2EXDA 2K8HA 3IXSA 3RNEC 2JSVX 1HPCA 1XMOQ 4PYZA 2Z59B 3HKZB 3CXCA 2NZHA 3G6JB 3NXWA 1Z9FA 4O42A 5JPNC 4IFDG 2WV6D 2CCZA 1AYFA 4DR6L 3H8HA 3TUOA 4ZHOA 2VUMB 2HQLA 3A0JA 1PH3A 1MJEA 2WKCA 5C3JB 1WCMB 2J42A 1VQCA 5IO9A 1SYEA 1IKLA 4KKTA 1K8RB 4DR6Q 1KF6B 3OWEB 3GV3A 1DOXA 4D2KA 4M0WB 4W9IA 2GN5A 3KYHC 2XSCA 1GKHA 4OL7A 1W2BA 2KTRB 4WJQA 3C1EA 4KY6A 1NEKB 3P4PB 4REZA 2K25A 5EQ0A 1YHQA 3PREA 2KCCA 3QK0A 2V4DA 4UP9A 4KN4C 3T13A 1VZ7A 4A3FG 2Y5BB 3DDCB 2R93G 2EQSA 3JVZX 1F9JA 4F7ZA 3VH3B 2L4NA 1VLBA 2M0AA 2INNE 1Q3LA 2PEAA 4WWMA 4APVA 3RFZB 3ERSX 5I4DA 3IKJA 3I63C 2KC2A 1BQQT 1JW9D 3HOUH 5BN3A 4RF0A 1YEZA 4XQJA 3OW2A 4CBVA 2G45B 3H0GH 3GTJB 3CCEA 3FAHA 5M3MB 2OXPA 4TQUS 5C4HA 2FAZA 1YN4A 1J5EQ 2CKHB 4MACA 1N8RC 3ZNGC 2G5DA 1GUSA 4JI8L 3S14H 1WXMA 2QJLA 4ZRIA 3KF8A 1TWCH 4GOPC 4A3MH 4A93H 1F77A 2L1BA 3IFWB 1FRDA 1S5BD 4M1UB 5A2QL 2ZXPA 3CSTA 4KHZA 3QOJA 2BH2A 1KHIA 3GTMB 1WMHB 1B9MA 1GG3A 1E9MA 1MSGA 1FM0D 2EYPA 1EY8A 1E22A 1J8IA 1TQOA 1FD7D 2KLGA 4ARCA 2L83A 1WX9A 2Z6KC 4GNXA 4XYCA 2B2TC 4FADA 1KLVA 3FPUB 1D7QA 1JRUA 1TIID 1JOKA 3M4OH 1J19A 1S5FD 3Q69A 2F0WA 3M3YH 4G0NB 4YL8A 1Q0WB 1PTOC 1NE3A 2SEBD 1VQ5A 3IFDA 1QZEA 3SR1A 4DUYL 3KYCD 5TR5A 1EFWA 3PRMB 4K6LA 5KHQA 1HA5A 3P75A 1FGBD 4C2MB 4P1BC 3C8YA 1WY8A 5KIXA 1FIQA 4C1NK 1G6JA 2Q8TA 3PZ8A 2B2WC 1FJGL 4BXXH 1G6PA 3PO3B 1JROA 4HWIB 5KRUA 3KQ4A 5M5WB 3HG9A 3RZFA 4UY8C 1IBXB 4BXXG 1YN3A 4GN4B 2BWFA 4A3IB 3L9AX 1FJGQ 4DR1L 1R4MI 1HCZA 2IDYA 2RVLA 1EZ6A 3GTPH 4XGAB 4OZCA 2D5DA 2F0MA 3VR5A 2EPBA 3UE0A 3NWSA 4K5XA 1AZQA 4B3SQ 2X38A 2V1CC 3OAWA 5J17A 1PH5A 4YTPB 3ZQ4A 2UUAL 4DBGA 2KK8A 4EKUA 4KD3A 1XPOA 4DAYB 3KUCB 2O6VD 2GBMA 3SK5A 4JI1L 4EGVA 1GHJA 4A9AA 5IN7A 4BBNF 1L4ZB 4JG2A 3PS6A 1TWHH 1L0XB 4KD4A 5HKHA 4HJ5A 2DENB 3AEEB 4DHJB 3ULPA 4JI1Q 4OHJA 4BOZB 2GRIA 1Y1VG 4HROA 1WRIA 2L5TA 5IODA 4A76A 3GP7A 2E2JH 4YWLA 4HCSA 4POGA 2D62A 1VQJA 5DNFA 4R4OA 4U673 1TU2B 1EF5A 4KK7A 1Y1WB 1HE8A 1EQVA 1VQLA 3TEHB 4WAAA 3TEXA 1SROA 3P1MA 4ICUA 3CSFA 2LUEA 4N6EB 1K0RA 2D2CC 5C3EH 1KRHA 2K5WA 2NMQA 1LT3D 5M5YB 2WXFA 3TQYA 2K9XA 5IKCM 5C4XB 2HIVA 2UUBL 1R4NI 1F1HA 2ZPNA 3C1FA 4GOPA 2IY5B 3UINB 1UWXA 2A68D 3L10B 3APFA 1NTGA 1E90A 5KNDA 1I4XA 4R1JA 1QOBA 4YY3L 2KHSA 1CK1A 2UUBQ 2VZAA 4RGNA 1WE6A 2MGSA 2WACA 1R4NB 2JYTA 2EYOA 4P73A 1UEAB 2VB3X 1ZEQX 2LFNA 2X6LA 3TDQA 4B3ML 1L6UA 1NR2A 1EZ8A 3MJWA 3CMMB 2Z6KA 2B2TA 5JXVA 1S1QB 4JV5L 2I07B 3S16H 1QLBB 3AE9B 3DOWA 4G7ZC 4B3MQ 2TMPA 5DPSA 4YCWA 1OGWA 1YX6B 1EYAA 3UQAA 3K58A 2HDMA 2C5CA 1SB3C 3UE1A 4QUFA 2ZW1A 2F03A 5FJ8H 2KX0A 3AV8A 1TR5A 3DWPA 4RCOA 3PIP3 4DV3L 1SYCA 2VZKD 2MPMA 2MCNB 2ONQA 1TY2A 4BY1G 2MFIA 4IUMB 3ZVVA 1XPRA 2LMCA 2B2WA 2VQFL 2B2YC 2L52A 4HCNB 1Q46A 2NVXH 1E1OA 1CQVA 4HCPB 4LDTB 1CZWA 4NJ6A 5K36H 1QVGA 1K51A 1QKZA 5D6JB 2VQFQ 2WXNA 1SGHA 5BMGA 3OOCA 2C7NB 2F0VA 5EKLA 4FNFA 4X3SA 2ZTDA 1WTOA 1S72A 1Z6HA 2Q2TA 1C1YB 1GM5A 1Q1OA 2D11A 2IY0B 3QWZB 1HA6A 4DK3C 1ESFA 1N33L 2BF8B 3L3OC 2R92H 4N9TA 4P74A 5E1FA 3VYTA 5FOBB 1H8CA 4A3CG 1QOAA 2FHTA 4K7UA 2JA8B 4PMCA 1VQGA 5BYRA 2X6GA 3TZUA 1CKNB 3MHSD 1YJJA 3R3MA 1EOTA 1KLGD 5AJ3L 1GHKA 4OO1G 1CHPD 1VQNA 2ZTEA 1SN8A 3Q2AC 4J8QA 2K5QA 5CTRC 4A90A 3S9WA 3VYSA 1L0VB 2BYVE 3K5MA 5AJ3Q 2LD9A 3SK4A 2F4VL 1FPYA 2HD3A 3B1LX 1SBBB 1ENCA 3KF6B 2C9OA 2LRWA 2XBBC 5IYCG 5EPKA 2F4VQ 2D3CA 3V2TA 3I4NH 4GZYC 1HFNA 2KKCA 3VUWA 1IW7D 1B4OA 5IP9G 2N7DA 1I6VC 1JWSD 3ZO5B 4W9LA 1WJNA 1EY7A 4LNNA 3Q23A 2F0UA 1EYCA 3NZSA 2IT1A 1QVCA 3AQQA 1EFID 3Q8FA 3J81j 3IFTA 3GTOH 4DK6C 2BB6A 4H0LC 2HTHA 5GXGB 4N8X1 1Y69U 1XJVA 3ULJA 2JA5H 4K0KL 4HTHA 1G2SA 4CHTB 4LF9L 1NI2A 4ZUJA 3GV6A 3DLLA 3ER0A 2D0OA 1V6EA 2KMMA 3CQZH 1KIXA 3NVWA 1P7EA 4BBRB 4K0KQ 2BQQA 5DPTA 3CW2C 4LF9Q 1JMCA 2ZNVB 4YXDB 3H7PB 2A74C 4A3JB 2FCSA 4KI0A 1LT5D 4JOIC 2JA6G 3RYTA 4YSXB 2F0IA 2LXJA 3CAMA 4AYBB 2CJOA 1S40A 4MH0E 4KSLC 1I3QH 1SMXA 4R8IA 1WIAA 4TV3A 5CX3A 2RHQB 3BG3A 1PMRA 3HGBA 3E5SA 1RFKA 2KJ6A 4GKKQ 2GLSA 2K22A 2B2YA 4K5VA 1N60A 1T9HA 2Z6BA 4E71A 4J3OD 1NR4A 5HURA 3WDNA 4C3IH 5JOBA 2JJQA 3ML9A 4IJHA 3T4AC 1JOOA 5JAVA 3B6YA 1ET9A 1IXRA 5EGTA 1C76A 4F87A 2MWSB 2N4FA 2WXLA 3EHVA 2QDBA 1KAWA 2FIDA 4JI7Q 2K52A 1DXMA 2OWOA 3ITPA 1F2RC 4FJZA 1WJ6A 2N9XA 5EDSA 1GXDC 1VQHA 1ACCA 3RI7C 1KDBA 1GUGA 1QILA 4BBNC 1ZYRD 1B53A 3A5ZB 4JBJA 2G4SA 1STNA 3KOJA 4HPMB 4KV2A 4ZAIA 2BE5D 2I46A 2L00B 4CDFC 4HPLB 1L2NA 2A68C 2R6GA 1RCVD 4A3EG 1V86A 1YNXA 5IWAQ 1PDXA 2ZJQA 1LT4D 4XTCS 2NCNA 3AI5A 3PUVA 3HVZA 4P1CC 2YU9H 1TWGH 3HOUB 3HOYG 4P75A 2L3ZA 4DXAB 2L76A 3AE7B 3H0GB 1FRRA 4K3CA 2BYEA 1FGUA 2XRQD 1EO6A 4IUNA 3ND8A 5G2NA 2Q8IB 5EKIA 1XWEA 3S14B 2J0TD 3G48A 1TWCB 2CVRA 4A3MB 5KNCA 4A93B 3B2FA 1TWAH 2RDFA 2K04A 1TZOA 2JEBI 2E75C 3VR3A 3I56A 3IHPC 2K5NA 1T0SC 3OIPA 1HR0W 3KJOA 1VQ7A 1NVID 2BVCA 2MJDA 4JCVE 1A6XA 4KGSA 1N61A 2ATWA 4PT5A 5IAAC 3HKZG 1YI2A 3APCA 1M8AA 3URYA 3UDIA 1F9PA 4ZYNA 1SJED 2K3UA 3M4OB 3RNBC 2XWJB 1RKNA 1FNUA 2XTIA 3M3YB 2VUMG 3L0OA 1WR6E 1WCMG 2PI2E 4G4KA 4DPGA 3DBHI 1TS5A 1K8AC 4MH8A 1F9QA 3LNNA 2SNMA 1SNPA 5EE9A 3KUDB 2LVOA 1SRUA 4GDKA 4AUQC 4AOFA 2M17A 4HRSA 3DBHB 3CHBD 3LX0A 2V9HA 4ITKA 2OT2A 4WJ3M 4X66Q 5AZHA 4FF1A 4A3GH 3ZRFA 1I94L 4JOIA 2OTJA 2CKZB 1GUTA 2O6VA 3DPDA 4MELA 1L1OB 1Y8PB 3PRZA 2LS01 4MJSB 3JAML 1X3EA 2NN6I 1I94Q 1L0YB 1HNZQ 3PIPA 1LUZA 2UUCL 4K8IA 3KW5B 1HZAA 4KKUA 3L4PA 2WAQB 1N32L 1ESRA 4PG3A 5CORA 2KC1A 3NBHB 1G8ZD 2L0CA 5CHFA 1GB4A 2AWNA 3I4LA 1V8QA 4IQZA 3VDZA 1GO3E 1WFQA 1SE3A 5E6OA 3UI3A 4G50A 4E74A 1OTRB 1UF0A 4DN4M 3PUYA 4LF7Q 2CQOA 1SIJA 3Q6BA 1V1OA 3QG1A 5M3MG 3V6CB 2F3VA 3RNGC 3HOWH 2LVQA 1PYBA 3S1MH 1T0RC 1TS4A 3ND9A 1TWHB 2D3AA 3PTFC 5FLXL 4X6AH 4OIJA 4EZLA 3HEJA 2WU2B 3AU7A 5J1ZA 3A56A 1PTOH 2KQ3A 2H1EA 4DR2L 2F3IA 3VDYA 1JB3A 1G51A 4J15A 2E3TA 2KJHB 3ZRCA 3Q8CA 2IX3A 2W3RA 1IW7C 3LGJA 3PUWA 4DR5Q 4NMZA 4DV5L 2E2JB 1P3QU 2WXMA 3C0RB 4LNQA 1EU3A 2LWPA 4DR2Q 3KBGA 1QB5D 4MGYE 3I8ZA 4KKIA 3HOZH 5C2TB 2MW5A 5I9PA 3EFUA 1YMHE 3DHHC 4DV5Q 3RCZA 3VR8B 4G11A 1ZKOA 1SJHD 3I72A 3SD5A 4LWCA 3GO5A 3J80c 1BCPF 1YVCA 3FRPB 3H91A 4MHEA 4GLXA 2AYOB 5C3EB 1L7YA 4BKSD 4EQNA 4C2MH 2DZIA 1U0LA 2KDBA 1ML0D 3J7YW 3AEDB 2PMVA 3IBEA 2DLBA 4KSKC 4QJFA 1ASZA 1UBIA 2J52A 2UXBQ 2L11A 2G1EA 2QMTA 3ULLA 3PO3G 3B9JA 4TKOB 2FJ2A 1KNAA 1O78A 2E2DC 3BIID 2PI2A 4R4IA 1HQMC 1P8LA 3QWNA 3K0XA 3VTUA 2AEHA 3TP8A 4U68A 4A3IG 1ICWA 1LGRA 1N6ZA 3RLOA 2ASQA 5L37A 1Y14B 4FULA 3VQIA 4DAMA 3UDFA 1DOIA 4AIMA 3S16B 1I7HA 4IPHA 3GDEA 4CKCA 4FF2A 1YJIA 1BCPD 1FFVA 4JW0A 1V1PB 2PTLA 3K7UC 4LNOA 3BDOA 2RF4A 1WSPA 2WQYB 5GQOA 4I6NB 2IO1B 2KOXA 4KDIC 4AP4C 2LHEA 2DN8A 1MSHA 4MTNA 2JQOA 5I6WA 1DOKA 3RN5A 1W3SA 3U30A 1E6EB 4KKJA 2E8GA 3T3NA 5D3IB 4IM2A 3ECIA 4US9A 1N5XA 2PW7A 1ROEA 2NVXB 2HJ8A 1CI3M 1JWBD 1Y8RC 1DD2A 2KN4A 2DAJA 2A6ED 1ZYRC 1JCKB 3JAMi 2K5PA 3TMPB 3U8ZA 2N78A 3QB3A 3BWUD 2KN5A 2BE5C 2KECA 1S5CD 4HN7A 4RG1A 1Y1WG 1IBLL 3PLUA 1AE2A 1A5RA 2QF7A 1PFNA 4ZQ3A 4A3BG 1TTNA 2UU9L 3B0AA 4L8JA 4OELB 3OTOL 4BBSH 1PFDA 4JC0A 4QB4A 2R92B 1MPEA 2EELA 3A33B 3KLSA 3T9LA 5IT9c 1IBLQ 2FCQA 3CMEA 4PNYA 3MAQA 3OG5A 1ZDVA 4UP7A 1DONA 2IZVB 1GJZA 3CPFA 3OTOQ 2QILA 1EIFA 3JSVB 1ZDXA 2DNFA 5M3FB 5C4XG 1LABA 3J81L 3NJTA 2L0TA 2KO3A 2PNRC 1B9NA 2EYJA 2QC8A 3P1HA 2ASBA 1NYRA 4GN1A 1H9KA 5KHOA 1A2TA 1KJTA 3RNUA 2DJGC 4DDID 3U9SA 2QCZA 3L17A 4CHKA 2VW9A 5D14A 1BO0A 4DUZQ 4C3JH 1YN5A 3W9CB 3L2PA 3S1NH 2Y5CA 5ELEA 3BZDB 2EMTA 1E8ZA 2A1AA 1F9SA 1CKOA 5T1IA 3I4NB 1TXYA 3W2DA 4W9KA 1C4AA 4W9DA 1UEBA 4ZKBB 3ZNHB 1G291 4I6PA 2F0PA 1QCBD 3NVYA 5IGEA 3Q3FA 2E76C 1OXTA 3BU2A 5EBCA 5EPLA 1RLFA 3A5UA 3PO2H 1LM0A 4IJLA 4GDLB 4H44C 1HH2P 3GTOB 3U58A 1UGMA 2NYZD 4KN7C 4ZUIA 2MLBA 1K3RA 4XWTA 4DNRB 4JIOU 4W9JA 2DX5B 2JA5B 3MA2B 3W1GA 1EIGA 3EVQA 5EE1A 3IT6B 2GVBA 4JI4Q 3KLWA 3NWTA 3I90A 4ULLA 5FO9B 2DYBA 3CQZB 5D7GA 3VR9B 3ZJTA 4DXFA 2QIEB 1I50H 3B2GA 4L5TA 5CV5A 1ICFB 2B2VC 4A3LG 4R4QA 3S17B 1XNRL 3NK9A 2J7ZA 2Q5WD 1RL2A 1I3QB 2JA8G 1IHZA 1XXGA 5HHDG 1J8CA 1XNRQ 3H1UA 4OX9Q 5IYDH 1VQBA 2YTXA 3KH0A 2UXCQ 1PA6A 1F2ZA 3H6NA 2O2VA 4NP5A 2PPBC 2BWES 1BNZA 3GZNI 2C7MB 1WTRA 4C3IB 2XK5A 3AM9A 3R66C 1YJWA 1FMAD 3FVQA 4DV7L 1B2TA 2N7EA 4K7SA 4KY7A 3SVMA 2M00A 1C4CA 4YWKA 3GZNB 4KGRA 2IX0A 4WAFA 4GKJL 1FR3A 3CCJA 1O7ZA 2PE6B 1PH2A 2ZJRA 1NCVA 5JH5C 2Q8RE 2N49A 3ZNZB 4HVBA 4H13C 4FHJA 3NS1A 4K14A 4LUZA 5C5LA 1GC7A 4DV4L 3HRZC 3K81C 1YX5B 3FDTA 3OMCA 4X65L 3EGRA 4X57B 2JP1A 2K14A 4WFN3 2OOBB 4G3XB 2KWCA 1LV9A 5CV9A 4Q5VA 3DM1A 1QQRA 2ACZB 4L23A 2YLMA 3M4QA 1KAAA 3K5LA 1TWGB 4DV4Q 2YU9B 4FF3A 1RWSA 4IZ8A 3QIAA 2JZ3B 4IG7B 3NELA 1MHHE 5CYUA 3PMFA 4V0BA 1H9RA 4I65A 4MN3A 1RM6C 2F0HA 1ILPA 4TKNA 3TEZA 3HOXH 4HKQA 1ISNA 1N63A 3U4ZA 1BDOA 4S0RA 1JRPA 2INCC 1RDPD 4BBRG 4KZCA 4KJNA 4MM3B 1D1KA 2HHHQ 1BCPC 1XMOL 1TWAB 1S4ZA 2NZOA 1SEBD 4A3JG 2WIIB 4Q2JA 3PV0A 3LB8C 1JE4A 4P6VF 2YYZA 1Q12A 3JC66 4AYBG 5A2QE 4BY7H 4G57A 1EWYC 4LF4L 1CT1D 3NQIA 2B2UC 2NPTA 2A6HD 5C5MA 1E8YA 1V43A 2RDHA 3S24A 3IRBA 4RH6A 4LF4Q 1L6VA 1A63A 4AQ7A 3P7JA 1EQRA 2LGDA 2LJ5A 2W9NA 4LFAQ 2DZJA 2IO3B 4IWQA 1LTGD 2A6EC 4JK1C 1SR3A 2N1VA 3QC8B 2BS4B 3K57A 2WDQB 4JBWA 3AFPA 2K50A 4J6IA 4N9F4 2JA7H 2F0DA 2D0PA 2CH4W 4LNIA 1H9JA 2Q2HA 3J80i 4HDOA 5C4ZA 1S5DD 2ZVOA 4AWJA 1B70B 5CC4A 2B2VA 2N55A 2LSSA 4C56C 5IOCA 1WJUA 2EMSA 5NUCA 3CCQA 4A3GB 3AB9A 2JZZA 1WGDA 1T5XD 1OQRA 3N20C 4ICVA 1PH8A 1NMFA 3BDLA 2N8NA 2DZKA 4M02A 4GOPB 1RODA 1FNVA 2F0SA 4ZCKA 2RGFA 3Q8EA 4EOYA 2L9HA 1J5EL 3TS2A 2F4IA 2CU1A 5IYBH 2K1BA 1L4DB 4XYQA 2XEWA 3HOUG 4DGZA 4B0EA 2NUCA 1KTKA 1EY4A 2BOSA 2NTTA 1NENB 3H0GG 3IAM1 3HOWB 3K0YA 1I6HH 2JYEA 4IUUA 1LFDA 3S1MB 2FE8A 2GBNA 1PYWD 3ZW3A 3AE3B 3IG3A 4I6LB 2JYOA 1MI0A 1V80A 4A3MG 4A93G 1PTOB 2NVTH 2OQ0A 3CPWA 4M8AA 2JXXA 4NAWA 4RF1A 1HTOA 1NAPA 5CHVC 2EJGC 4BKSA 1LXDA 5ELFA 3D4DA 1LT6D 2HQEA 4OWWB 3Q3NC 1GB1A 4QIWE 1SAPA 2IGDA 2VH1A 1VQ6A 4C4VA 2R3ZA 1K83H 3HOZB 3AEVA 1KD1C 3RNAC 1LTID 1HUNA 1B8AA 1STEA 5BN5A 1WGRA 3CCVA 1HJPA 3CD6A 1E1TA 4KHPL 5ELDA 2F0GA 2OTLA 5LXHA 1CMXB 1E5WA 3VA7A 3IAS1 4BKGA 4KHPQ 3E0EA 4ZRJA 4L6TB 4PS3A 5C23A 5DPRA 3ZNID 1KRTA 5H1SE 4IUQA 2KANA 4B3SL 2O4XA 1JJ2A 4XDDA 2B2UA 4N59A 2IBIB 3VAWA 1TGZB 2KDFB 5GAGC 3RT3B 3BDCA 5AZGA 2PYKA 1PRTF 2NN6H 2WAQG 2L7RA 4US8A 5GAEC 1Q8IA 1R4MB 3I7FA 3QHTA 1VDZA 1CKMA 1TYGB 3J7AF 1C4QA 2VS1A 4XYOA 1EF1A 1UBQA 1IL2A 4W9CA 3BZKA 2V4IB 4IFDJ 2BDNA 3NVZA 4NPNA 3V6EB 4KY5A 4Z9CB 1BBWA 1RD9D 5D2MB 3RLNA 2JQRB 1EOVA 3SR6A 2K6QA 2RBMA 3A74A 2HUGA 3HIZA 3MXGA 1K8GA 2EE1A 3I73A 4ALPA 1PFBA 1PZID 2JN4A 2Z4IA 3TBLD 2KX3A 4JI6L 2F0OA 2IYDB 1LACA 1PRTD 1QE6A 5CR3A 5HGTA 1FEHA 3AEGB 3RN9C 5F2DA 5IY0A 3VUXA 3A9KA 3OJ3A 1N9WA 4R3DA 4IWPA 2B8FA 3ZTDA 2KJXA 1GNUA 4JI6Q 1TKWB 3AN1A 2KWDA 1VS0A 2CWAA 4TSSA 4BBSB 3DUZA 1O80A 1EWIA 2IY1B 1TIFA 1QOFA 2WXPA 2LY7A 1OTCA 3KUPA 5C3EG 1Q82C 1GUNA 4XQNA 2YEPF 3GTGH 1PZKD 4FXGC 3HS0C 4M0WA 3W1YA 3WA0A 2R7DA 3TIXA 4FJVB 4LUVA 5JZEB 2MJ8A 2KTRA 1J0GA 3CMAA 4GMVA 1EQQA 2MNAA 1E2WA 2J53A 4K8JA 4O1NA 4KGTA 3L54A 4F8CB 4DFAA 3MP9A 2A6HC 2QDFA 4PS8A 4ILWA 2GOWA 2WLBA 4WH4A 3UQBA 1WTVA 4FYDA 2JZPA 1PFMA 4C3JB 1WVLA 4DR7L 3EUB2 3S1NB 1ZUD2 3K5NA 3WAMA 2MQHA 2WB1E 1GUAB 1VD2A 5DAUA 3AE4B 4DV1L 4DHZE 4XIGS 5CGKA 2PZWA 5FJ8G 4DR7Q 2VB2X 1P9DU 4NPSA 4KV6A 2RHSB 1H9SA 3A9JB 2I2YA 1D8LA 4JYAL 1A70A 4OZAA 1B1ZA 1SE8A 3TEYA 3G71A 4DV1Q 2NBUA 2K33A 1JJGA 3PO2B 5I2YA 4OVZA 3CP0A 1HHVA 2MH7A 4A3PA 1C3TA 2C60A 3NPPA 1M4VA 4JYAQ 2MHVA 2PVOD 4ZDVA 2KWVB 2JXMB 2B3AA 2JT4B 1PLFA 5K36G 5EJWA 4K3BA 2B63H 3W1BA 1EY9A 1H9MA 2G3QB 5KYLA 3FKIH 1EWCA 2K6AA 2WHIA 4ZOHC 2KMAA 1TWFH 2C35B 3M4PA 4IALA 1LTSD 3MTSA 1I50B 3R3OA 1R9TH 1CUKA 3AXCA 3KVFB 1I4HA 2R92G 2N0SB 1O7IA 3QOLA 5LL6X 3ZJUA 3V62A 1FYCA 5M3FH 3U4VA 1ASYA 1T0YA 4USAA 5BN4A 3U50C 3QA8A 2KDEB 4CDDC 2W54A 4IN3A 3F2CA 1PH1A 2K39A 4HJ8A 2DYMA 2OEDA 4BKTA 4A55A 1PV4A 2M4NA 3HP3A 2ZM6Q 3ZXRA 5KGUA 3D6WA 4W9GA 4YTNB 2MBHA 3WAOA 1XQQA 2VNUD 3EQLC 4CDEC 1M94A 2Y3AA 3K6OA 1GUOA 2LXKA 4RMFA 4TVAB 4EQOA 1VDVA 2DUDA 2WP9B 3MFGA 5EE0A 4ASWC 4PK1A 4A3OA 3D8GA 1NY4A 3I4NG 4NJCA 4K5WA 4MSMB 1LO5D 2BT6A 4RKBA 4GDKB 3S1RH 4ODGA 1JORA 1C9OA 1X55A 4NQLB 1HUMA 2NBFA 4PZ6A 2UWQA 4PV1C 3SFEB 1S5ED 4N9PA 4HAEA 4NXNQ 2EKIA 2NB0A 2QA4A 4P71A 4FDBA 1SFOB 1N34Q 1Q86C 3IAYA 5TSSA 1BKBA 1WX8A 1VQFA 2PQAA 2JA5G 3N1ZC 1I5FA 4DNIA 5GAHC 4RNAA 3HOXB 4GB9A 3ZDMC 4NW2A 3ZKJC 2B76B 3ENEA 2PW5A 2LI5A 1FO4A 1YOVB 3S17H 5C44H 3I4MH 1JE5A 4RCNA 1F2RI 4TUUA 1AZPA 4GKKL 1K8OA 4X64Q 1YZ6A 2ZW0A 3H7SA 4HEA1 2WX0A 2XIWA 5C3WA 5BR8Q 5DM63 1YNND 5E4WC 4BY7B 2KVZA 3CC4A 5HG2A 3C46A 3Q3OC 5BYQA 4LLGM 2RKSA 4PMBA 1TBEA 2BS2B 1L2FA 1W6JA 4DF7A 1MJDA 4TQ1A 2Y0SE 1K52A 1WJ4A 4OXPA 4HJ7A 1WI0A 1Z2MA 3LWUA 4JI7L 1SYBA 3LJ3A 5C1ZA 1D5MC 4CYEA 1MG8A 1PYSB 4C3IG 3TJPA 5J39A 4IFDI 1Q81C 2HD5B 2MO0A 2DJFC 3APDA 2K8CA 2JA7B 1PRTC 1WTPA 4H7BA 2EJFC 1R7SA 2H4OA 2MRPA 3X3MA 5E6NA 2CQAA 1PQSA 3A7LA 3U9OA 1G91A 1CFMA 2DGYA 2IHFA 1IKMA 5IWAL 2PIAA 3U52E 2MX2A 4HSVA 3AE2B 2VQEQ 4KIKA 3BVZA 3VVWB 4EFOA 5IP4D 2IX1A 5C6AA 3JAME 4RGMA 3S1QH 3UI2A 4GN5A 1K3BC 2K05A 1IBMQ 3LYYA 2KNBA 4YT0B 2PE9A 4FO2A 4DDGD 1QNUA 4DK5A 4IPDA 3NEMA 3RNFC 3A8KE 3KDFA 2REXA 3FHWA 2O5JC 3CC2A 1I6HB 2AL6A 4OGQC 2EYLA 2ZXRA 3NBIA 3F8TA 4NZLB 3DEPA 2I5HA 4IUTA 5FLXE 1UWVA 1SNDA 3ZUNA 2NVTB 1ZOYB 5JVG3 4IURA 3E9IA 3NHHA 2V3PA 3T53B 4W9HA 2MP1A 1SE4A 3RZDH 2NZ1D 3OIQA 2NVQH 1OO9B 1H4RA 2R2QA 1GPXA 2V3SA 3TP6A 1CHQD 3MVVA 1XO3A 1K83B 4ZLTF 1VMPA 3P4SB 1KABA 1P7FA 1EY0A 1C4PA 2ZXOA 1CKNA 3NZUA 4YIJA 2L8JA 3VXWA 1SYGA 3UDGA 2GVAA 4X66L 4JPSA 4IKGA 2FCNA 2OCEA 4X3KA 4KLKA 1KFYB 3DHQA 2MBOA 4HIOA 1MFWA 4L2YA 3UGBB 1WR1A 4V190 3I57A 5C3XA 1WX7A 3BYYB 3BZCA 2Y5PA 1S3OA 1HNZL 2V3NA 3HM6X 2H5XA 2B29A 4A3GG 5LL6S 4DQOC 2L12A 1HZCA 2L1AA 4AQYL 4B3RL 5DPWA 1XYIA 3OJ4B 1VQDA 2LZ6A 4BVUC 2CR5A 1BOSA 1JJCB 4B6WA 1HTLD 2QEJC 4LF7L 1I42A 4AQYQ 3NUCA 3R2TA 4B3RQ 3Q14C 2B3GA 1V5OA 4MNOA 5BO4B 1X9NA 2LUMA 1WZ0A 2GA4B 1ENAA 4C1NI 5CBEE 2FNJB 4F7XA 3M62B 5HFYA 1YQBA 2CU3A 1YHBA 3LDZE 3DXJC 3HOWG 4HCEA 1DGSA 3ZIMA 4DR5L 1QJOA 1XLQA 1JR0D 2MQJA 2MEKA 2B8GA 1V5TA 2NBVB 3FILA 4NQKE 3V3XA 3CF5A 3A4RA 3OPOA 4CKEA 2Z0SA 4LMQD 3RZOH 2A8VA 3S2DB 4MDKE 3WWVA 3HK0A 1CTMA 3MZ5A 3NVVA 3ZLZA 3CRKC 4YHHQ 2PMZE 2R7ZB 1DJRD 1IUEA 1C48A 2K28A 1CZGA 3HOZG 4L1BA 5H8YE 2DZMA 3A7AB 2D9UA 3PUZA 1KQSA 4N58A 2W55A 1MHWC 5IP7H 1X54A 1KDCA 4B08A 4A3DH 3Q3JA 2AUJD 3H9DA 2BKRB 4JI3L 5LHY1 4LFCQ 2JE6I 3MXPA 2UXBL 3E6ZX 4HJAA 2CHZA 4J6HA 3CWIA 4B0MA 3K80C 5BMIA 4C3HH 1IYVA 1SNCA 4Y52H 2MSED 4A3KH 2A5HA 3GTGB 4C7ZA 4KHVA 5AUIA 3SDLC 3SE0A 1MIUA 2VL6A 3LWEA 4ME5A 1JICA 4JI3Q 4IOIE 2D5GA 3J81E 2D10A 1IBKQ 2AMCB 4R8NA 5H92C 2EYHA 4FLHA 3M95A 3P42A 2PQEA 5J22A 2HDEA 3HHMA 1TT2A 1YNNC 4LFBQ 4YTMB 5FLMH 4X62Q 1EIHA 4WURA 1EM7A 2KHJA 4P7IA 1X56A 4URKA 3BJUA 4WRDA 2I0QA 5AFWA 1BUVT 2BYTA 5JEAH 4LF6L 1RAXA 3I3TB 4LF5Q 2J0KA 2ZVNA 4WWNA 3VR6A 3KUZA 2EYFA 1K9MC 3NE5B 1BVSA 3Q8BA 4LF6Q 2PVGC 3C19A 2EYMA 3HVDA 4MTKA 1JALA 3D4RA 2CW0D 1A8VA 2CHXA 3NTHA 2CHWA 4ANUA 3N52A 3WOEA 2F0JA 1XPUA 3D31A 1ENFA 1WI5A 2KOLA 1XD3B 2CJNA 4XDCA 2QCPX 3W1SC 1WD1A 1NUCA 3CCMA 3QQ8B 4DV0L 3K8AA 1X32A 2RA4A 3WCQA 4RGTA 3H94A 4A75A 5JPMC 2B63B 1WOCA 1J9OA 2FUHB 3FKIB 1E3PA 2BS3B 1TWFB 4DV0Q 2BGFA 4PYUA 1BUIC 1R9TB 1QT9A 2A69D 2ZT9C 5CV6A 2NTSA 4ZRZA 5IGGA 4BBSG 4POFA 4IC7B 1CJEA 1JC7A 1F0ZA 2IJ0A 4AS1A 1EYDA 1HNWQ 5LMNL 2IHEA 1XLNA 1T5EA 2WXKA 1N36L 1T0QC 3E56A 4ZHPA 4ZRPA 2KQ4X 4H02A 2WXHA 4QY7A 2F0EA 5LMNQ 3ALBA 4M8MA 3VYRA 4GS3A 1QUQA 2GMIC 3DVNU 2K4KA 4DUZL 1N36Q 1MG4A 2INDC 2LGYA 1VQ9A 3PGEA 4NJ7A 1QZGA 3N1XC 2RD0A 1MJCA 2RCNA 2NPTB 1F2LA 4RFBA 4Y7NH 4OO1I 1MI2A 3T1HL 4C3JG 3T16A 5ELNA 2AWOA 4EZKA 1FVIA 5IGFA 1VQPA 2H88B 3T1HQ 3L08A 1CQFA 1RTNA 3PCOB 1Y56A 2QEXA 4CJ1B 3S1RB 1K50A 3AE6B 4C7YA 2QSDA 2KFKA 4MZ9A 3MHZA 1NNXA 1JQ4A 3MFYA 3RNCC 3PO2G 5D94A 2KQ7A 3FC4A 1RRBA 2C9WB 2KBNA 4JI4L 3ZDTA 4FN2A 2HCIA 1M1KC 1WWTA 5BMHA 1V49A 4UHVA 3H6MA 4OVVA 4XT3B 4ABNA 1C77A 3ZTCA 3CCLA 4LUOA 3H3VC 3J80L 5JEAJ 2LRUA 2KAJA 2AX5A 5LMUL 2ID0A 5CBAE 2KJRA 4K7WA 4XWWA 1VRAB 2FXQA 2XVSA 1LTAD 5C44B 1EY5A 3K59A 3RN2A 3AMUA 3I4MB 4AH6A 4HJ9A 1B50A 3GOEA 5G3LF 4OX9L 5LMUQ 3VR2A 2UXCL 2ALYB 3C3LA 2LXCA 3MXNA 2ICEC 3KF8B 3QAQA 3R7QA 4A4IA 3AEBB 2XWBB 4XT1B 3Q8AA 1Q8KA 2LVPA 2JRIB 5IYDG 1BT0A 4C80A 5IGBA 4NAWB 3DWQA 1FL0A 2ZTCA 3DWGC 4BAXA 1YIJA 1QG7A 2M56B 4MT5A 3Q6SA 2Z0DB 2I5LX 1CM9A 2LGXA 3EFXD 2HE7A 4GNXB 2KEDA 1KH0A 2EOTA 4CJ2C 3RLFA 1FCCC 4HJGE 4JI0Q 4DR4Q 1UE5A 1NMGA 3PGZA 3GQBA 2LKVA 5G3LD 5C0XH 1UH6A 4PMWA 4A6QA 3T3OA 4XZ4A 2OJWA 3VFKA 1V1PA 2F3WA 3PRPB 3GTKH 4FXKC 2PPHA 4LJPB 2WP8J 1PHJA 2AWTA 1XTCD 2J0JA 3HOVB 1ZXHA 4NDXA 5CV7A 2DWQA 1B44D 2FMMA 4J1MA 1SF0A 2DYOA 2JF5A 3A1QA 5CHWA 1UE7A 3S1QB 2WGSA 1SFOH 3OLMD 4BS9A 2H89B 1ZGUB 4HMJA 1VQKA 3I55A 4WJPA 2I5MX 2K01A 3ZGZA 2HHHL 4YSYB 4HIDA 4WJNA 4HSPA 2CWPA 4HXDA 4WIPA 3HOXG 1IYJB 5IT9L 2DNEA 2ENBA 5E4XA 3RPFC 1PZJD 1EUVB 2XN9C 1U9RA 1SE2A 1MHXA 4DHJD 3BINA 2Z8LA 1I35A 1AARA 3BK2A 1JWMD 4ANVA 1Z47A 1M90C 1J7BA 3RZDB 4BY7G 3QCAA 2ES2A 2CW0C 1H95A 2NVQB 2M1MA 4JX1C 2HDLA 4LFAL 1D5ZC 3D32A 2C7HA 1OXSC 1TY0A 2J4XA 3JSVA 4MGIE 4RM9A 4HKZE 2B39A 2KACA 4R4TA 1KXLA 4YCVA 2ZCBA 1G6ZA 3P2BA 3U4EG 1WXQA 3TP5A 4M8NA 3V61A 1K73C 4GLAC 4DV6L 2JA7G 4IFDH 1DZ1A 1J7AA 1N62A 3A9KB 4W9FA 1STAA 1C9FA 1E2VA 1F2YA 2K0PA 1LTBD 1WD0A 5FR6A 4OZBA 3O13A 2P5ZX 2A69C 4DV6Q 4F88A 1Q7YC 1HTPA 4NKLA 2LEKA 1B7YB 3I70A 1HNXL 2DY8A 2I1KA 4K1RB 5DCNA 4MIUA 2M9VA 3ML8A 3ONSA 4XQQA 3NUHB 4MEMA 3WIMA 1SNOA 1E7ZA 4QIWB 4YWGG 1UELA 1HNXQ 1I4RA 1FNWA 1VQ4A 4UP8A 1WYWB 1XEEA 2N9LA 3AB5A 2WINB 4K2LA 1F52A 2I1JA 1LYLA 2WDTB 3NOBA 5IYBG 2JX5A 1U4LA 4GDLA 4OVUA 4A3FH 2R93H 3NRZA 1Y8OB 2PZUA 4EEWA 4B9XA 3EROA 3CCUA 3T8MA 4JI5L 1I4PA 1K8MA 4IW0A 3HKZE 1Q90A 4JVZA 5JJZA 2KWUB 3N32A 5C0XJ 1TKYA 4JQWC 3M4YA 4JI5Q 3U7ZA 4ANXA 3TREA 3EA6A 1OFFA 3RZOB 1RF2D 2RDBC 1I4GA 1AE3A 1UNSA 5JHBA 4DR3L 2SNSA 1H9SB 1GD7A 5IE8A 1ZE3D 2WNMA 4LDTD 3M63B 3DVNV 1EQTA 2LMCB 1U4PA 3AU5A 2R61A 1Y8NB 2ZPYA 5ISRA 4DR3Q 2X8XX 4TMAB 5EPJA 2MP2A 2BBCA 4JE3B 4II2B 2ZEQA 4A3DB 1Z5SB 2RPVA 3AULA 1YIWA 3PZ7A 4JI8Q 3J9CA 2DNCA 3A4SC 2JU6X 4LJOB 4QGUA 3MXUA 2J7QB 4C3HB 4NAMA 1BF4A 3GB1A 4A3KB 1QVFA 4P16A 1J7CA 2NVYH 3W3AA 3GE8C 1FXIA 3IVFA 2J0MA 4CGYB 4RA8A 1YJ1A 3UDXA 1GOZA 3K5OA 3I3CA 1U4RA 3K7AB 1P0RA 2JA9A 3O65B 1JWUD 2KFJA 1ZKHA 1FFUA 4X3TA 3CC7A 3N9YC 4S17A 4GU2A 2N9EB 5JJLA 4DA2A 1MBYA 3F2UA 2KVRA 2NN6G 4DUYQ 3VUYA 1YHAA 3STBD 3AH7A 4HMIA 4BZAA 2RQXA 2L0FA 4KZ0A 1NBWA 2L55A 1LTTD 1W6KA 3X0WA 4JLCA 3CU7A 2JWUA 4BA2I 1UZXB 3FMCA 3GTQH 3GS2A 3UIPB 5FO8B 4EZJA 2DAFA 1EEID 1K0SA 3DVGY 3P4RB 5J3BA 3S2DH 3KJPA 1Q5WB 1KRSA 3R7RA 3NQTA 4K6DA 5JVH3 3ZJVA 5EE3A 3OWFA 1PH7A 3TRZA 4DR1Q 2E6XA 4EQ5A 1K53A 1IZ6A 2ZJDA 4MM3A 2Q2UA 2R7ZH 2KMCA 4OIKA 2E2IH 4WQMA 3VRAB 3AEAB 1RYJA 5I6YA 4IPGA 1KM7A 2R7ZG 1X6OA 3PO0A 3SXHA 4LCDE 4HR7B 1DCZA 5CV8A 3UIOB 2UUAQ 5I2XA 4JPBW 2O5IC 1E8XA 1Y1VH 2D3GA 2MJEA 1EYGA 4KTAA 3TZDA 5CMDA 1PFSA 2PZTA 2WB1B 1BXTA 4ZK9B 1GC6A 1WXAA 4B95A 2PQAB 1YBYA 4H2AA 4HPPA 4DHZB 1F2MA 1WTHA 2BYFA 2GB1A 1D1IA 3DVGX 3K9OB 3P63A 1CZPA 1QZHA 4ANWA 4S3SA 3TBIB 2K1FA 4RAUC 1SYDA 4A3BB 3CRLC 1SXTA 2INPE 1E8WA 3HM3A 4CO7A 2WKDA 1C8CA 3T51B 2NR2A 1E24A 1Q1BA 2A19A 3BVMA 4KX6B 1KC8C 3DWMA 3R8BA 2N88A 2K03A 3AEFB 2F0FA 4IPCA 2GBRA 4Y7NB 3RD2A 4IUVA 3GTLH 2F0QA 4NNJB 1LM8B 3ZXVA 2L15A 4DNTB 1Q10A 1XF5L 5DLQE 5LLIA 3DBLI 2N7JA 2IGGA 3AE5B 4MGZE 2BKFA 4FBJB 1VCBA 4E3CA 2AQ1B 2GBJA 3PVLA 4GIVA 1X3PA 3ZYYX 3TSSA 1WM2A 3HRDD 4GLSC 1UD7A 4YY3Q 3DBLB 5K5PA 1V81A 2IO2B 3Q3MC 5FR3A 4RKLA 1L5PA 2EXZA 3EIVA 1RTOA 3UF8A 1UGJA 2GI9A 3KK7A 5I9OA 1TZ1A 3ONAB 2A73B 3EBEA 3TP7A 1A0IA 3GE3C 3S15H 1PDQA 2CFMA 2RDGA 4EUTA 5EBDA 2W3SA 1WJJA 4JV5Q 1VF5C 1TKGA 1WMHA 4KIKB 2OF1A 5FO7B 2W82A 2WXQA 3P20A 4IOCA 2B63G 1TS2A 4BY1H 1VQEA 2MBEA 3FKIG 4WQOB 1OEYA 4QL5A 2K5VA 1C0AA 2JRHA 5IIFA 1XCQL 4K2KA 1E10A 4CKBA 5M9OA 4DV3Q 2R7FA 2YV5A 3F2BA 1HZ6A 2JXTA 3VRBB 1SDFA 3KDFB 1V2YA 1WYGA 3KYDD 3WANA 2KYWA 5M3FG 4FJYA 2M8SA 1XT9B 1U4MA 2PLPA 3OW7A 3SHLA 2KT7A 1EUJA 1ZXTA 2JPHA 2ZM6L 1EEFD 1G2TA 3I2ZA 3MWYW 4BFRA 3F1ZA 2BCOA 3NP8A 3J7A5 2G9DA 2TSSA 3TS0A 4A3CH 2L05A 4L5QA 1I4QA 2N1WA 1YNTE 1VQAA 1AP0A 5HI1A 1VQ8A 1GUWA 2KTFA 1IBXA 4O0AA 5C0XI 1UWMA 1NI3A 1SYFA 1N33Q 4IM0A 3QX1A 3NHEB 4WORA 4CJ0B 4OO1H 1PGXA 2IL8A 2WXRA 1F9RA 4KKSA 5GADC 1XX8A 2JSOA 1XMQL 3H3VH 4ARIA 4NXNL 1HR0L 3GTKB 4DAYA 2AQ3B 3N6RA 2AL3A 4A8XC 4DWFA 1N34L 4IOAA 4B9KA 4GSWA 1II3A 2NVUI 2XRSD 4YWMA 2IPKD 5IYCH 1XMQQ 3M7NA 2WWZA 3DCGA 1O7LA 1ZXIA 1VQIA 1HR0Q 2D2QA 4YCUA 1YJ9A 1YITA 4LK0M 2Y0SB 2O6VB 4BOSC 2WX1A 1KL9A 1P98A 3E9HA 5KYIA 5IP9H 1SSOA 1YQ4B 3VTWA 3VHTC 1YD8U 3QR8A 1RJTA 2Z1CA 3E0JA 1J6QA 1VMCA 4X64L 1QWYA 3W5OA 5M5XH 1PH9A 1WGYA 2LXAA 3PHWB 5BR8L 2F1MA 4G7OC 1P1AA 1WF9A 3ZJYC 4PZ7A 3JAMc 1UE1A 2CHBD 1SLJA 3PSIA 5C44G 3I4MG 2QGQA 3STBC 2YVCA 1YNJD 1PRTB 4IWOA 1TJEA 4CDCC 2MBQA 2EVBA 3SK6A 4HIKA 1QOGA 3I91A 2BA0A 4IO9A 3WOFA 3NG0A 1VCIA 1A62A 1AFPA 2CS4A 4KVGB 3FILB 4IUPA 2A5UA 5J2RA 5JHAA 1LLRD 2JA6H 3PQIA 2PCFB 2SOBA 2BH8A 2ZZPB 3GD7A 4AJYB 2IWHA 5FLXc 1YJNA 2WS3B 4UPAA 3G4SA 2PO4A 1TVXA 1RFAA 3EJIA 2PJHA 3T56B 3M3JA 4YSZB 4DK1A 4G7HC 1SNQA 5D65A 2E5LL 2WDVB 1VF7A 3KLSX 4EVOA 2IW3A 4KJOA 3JW0X 2E2HH 3V96A 2VQEL 1QNKA 1T3QA 2KD0A 3MJ5A 2E5LQ 1K28A 2ZNVC 1MVKA 1B9RA 2G9HD 3CCRA 4OWTB 3A8JE 1IBML 4FF4A 3HOVH 3D6CA 2NWGA 2JWZA 3EECA 4HDQA 4CQNA 2VY3A 5A35A 3NY5A 5C4JH 3BYTB 1D3ZA 2Q2IA 3HOVG 2WU5B 3QARA 3SHQA 3FEWX 1LTRD 3M85A 3A9JA 2KVMA 1NDDA 4HEDA 3KWVA 4TRDA 2KDIA 2KUMA 2XNAC 2YEPB 3J7AV 1JMLA 2VZKB 4AYBE 4A3FB 2VH2A 3Q8DA 2R93B 3OYYA 2EY2A 2E74C 3CCSA 4IM3A 4WJ4A 2VXWA 3SK8A 3PLVA 1WM3A 4A3EH 1SMYD 4FP5D 3KFUA 5IGCA 1TKEA 4NXML 5JJKA 3HOYH 3KBXA 3PZDA 4W9EA 1R4QB 5AUKA 1STHA 3A55A 1HFGA 2NS5A 1Q1EA 4NXMQ 2KQSA 5ELOA 4M01A 3NTIA 1WRDB 2G4DB 3S2AA 1GAQB 1ZPSA 5G55A 1HZBA 3TMEA 1PH4A 1MD2D 3NENA 5IGDA 2F0KA 5FK9C 3SGIA 2JVCA 1DOLA 5D3DA 3BK1A 3WALA 1OXXK 2KZRA 4GLVB 2Z9HA 3S2HH 2Z0EB 4P2CB 5FKAC 1ET6A 4LTUA 4MGKE 5E6PA 2M2LA 1B3AA 1E0BA 5T1GA 1EIYB 3MEHA 2UU7A 2LHDA 2RCFA 1V9PA 4II3B 2EKEC 2KCTA 2UYZB 4QCLA 3KF6A 1AEXA 1AN8A 2FMCA 2NVYB 4DXGA 1WTXA 4L5RC 4QQBX 1BBUA 2K8BA 3D3RA 2VUMH 2WDRB 1WCMH 4RHSA 1KDAA 3BVGA 2N3SA 1N5WA 5CV4A 1E7PB 1JB7A 3JYUA 2PMZB 2FBWB 1IGCA 3TEWA 1STYA 2DHZA 3OMGA 3ERQA 1QUQB 1ONLA 3PIO3 4OONA 3ETRA 3PT2B 3RR5A 3J81c 4FXDA 3X23A 2KHIA 5BYSA 3AE1B 3L16A 5DEHA 3OSOA 3EC8A 2PW9A 3D4WA 2KDMA 2LFIA 3DHIC 1PVOA 3GTQB 3AECB 2HT1A 4NY0A 1XNQL 2EIFA 4PQXA 4FHKA 1A15A 2JUOA 3SDZA 4YHHL 1QF6A 4ME3A 3GTPB 2EJMA 1HEZE 1CSQA 2QDLA 2KLCA 3MC0B 5LXIB 5T8IA 3H7PA 3PF4A 1XNQQ 1FD6A 3GTJH 1JOQA 4ZRKA 1L0WA 4HIMA 2KA7A 5M3MH 2UUCQ 3RZWC 4F1SA 2E2IB 1N32Q 4QUCA 5HY6A 1PUTA 4RGOS 3QIJA 4XC2A 3VTVA 1L1OC 1VZ6A 1WH3A 1U4AA 2KFKB 4LFCL 4JWSC 5E3FA 3IL8A 2DBYA 3DMUA 3A54A 3G6EA 2ZJPA 1GJXA 2ZCCA 3RD4A 3MHBA 3CF6E 3RMKC 2EZVA 3TL5A 1Y1VB 4ACFA 1STGA 4PS7A 5IP7G 2QW7A 3AYHB 2EDGA 1TS3A 1ILQA 2LJIA 4NB3A 4A3DG 4ZYSA 5DM73 4DK0A 3GTMH 4LNKA 4M00A 1X65A 1A2UA 1IBKL 4N8FA 1VR9A 4LJZC 5AEKB 1IP9A 2PNHA 2SAKA 2X69A 4JI2L 4GGQA 1NSNS 4C3HG 2K6DB 4AJWA 2XGTA 3RUZA 4LNFA 4A3KG 2AQ2B 1PGAA 2V0GA 2WAQE 5COYA 4LFBL 3KWLA 3PF5A 4X62L 4GOCA 1HQRD 2BB5A 4JI2Q 1T6BX 3K7AH 3OHXC 4ZKCB 1S3SG 1C79A 2KXJA 4I7ZC 3VA5A 4L5SA 1YNJC 1HZ5A 3WAPA 2K32A 4P72A 1LTLA 4LF5L 3V05A 4BWGB 3MXNB 1DGJA 5G5HA 1OXVA 2PKOA 2RSUA 5FLMG 3D0FA 2F0NA 3ABVB 3LXFA 2EY5A 1EY6A 3QO2A 2WFWA 1RIPA 3GTLB 3PUXA 2O2VB 1D5XC 2OEOA 2XK5B 5JEAG 1Z7TA 2N9KA 1X3FA 4FVMA 2N9PC 3PO3H 1X3QA 2FFKB 2KCNA 3SEBA 4HJKA 5M5WH 3P4QB 4DAVA 2YTVA 3N30A 4RMAA 3Q0AA 1E7VA 2WXIA 4WWPA 1OXUA 4A3IH 2V4LA 3E9SA 1V9JA 4QF4A 4DKAC 3G7LA 1BBXC 4B3TL
chains in the Genus database with same CATH topology
2QKIC 2Z4HA 1VJKA 1JQYD 2F0TA 5ELCA 3S15B 1RHPA 3HZXA 4F8MA 1MGSA 1UAPA 4RHRA 1E0ZA 1XCTL 4BY1B 1HXYD 3QJYA 2RSOA 5EKKA 2BA1A 3J80E 2RSNA 1EWHA 3C2PA 2IGHA 1IYUA 3TN2A 5LNK1 2WXOA 1SMYC 3FPPA 4Q0FA 2L32A 2DY7A 1SNMA 1A3UA 2EY6A 2M19A 4KMUC 3AE8B 1XLOA 2WXJA 3BS1A 1R4PB 4X3UA 2O2LD 3VYUA 4EE2A 3DWAA 5G5GA 3HUIA 2SDFA 2LGIA 1DM0B 3NBHA 2KEEA 2OHFA 2AUKA 3NSWA 2F0LA 1PTOF 1SSNA 2HTME 1ZP0B 4UDUC 2EY1A 3AMZA 1EL0A 2JEAI 1IL8A 3H09A 4JWUC 2WXGA 2ICIA 3NTKA 1EU4A 5M5XB 3U2SC 5MPOA 1UUPA 2K7VA 3R93A 4EQPA 5IT9E 1D4BA 1PGBA 4L63B 1PTOD 4XDXA 3X3NA 5KNBA 1VZ8A 1FCLA 3W1SA 3IT4B 1E2ZA 4FXCA 4ID6A 4BA1I 4WJWA 2JA6B 1A3TA 1WGKA 2RMMA 3KLRA 3Q22A 3R2IA 4IDIA 3CIRB 5KEEA 1DOYA 1AW7A 2E2HB 1DYQA 1CA5A 3DEOA 3L7ZC 2BTEA 3VR4A 5C0XG 4LAAA 4DU9A 1WTQA 1D2BA 1IGDA 1WTWA 4R9WA 5ELBA 1BCPB 2HCCA 1STBA 5C4JB 1NYQA 1D6EC 1PXUA 1FXAA 4QMGA 2MJ3A 2FUG1 4B9WA 1CA6A 1DOMA 1O7YA 2BDOA 3CKIB 3W5UB 1BMLC 1HRJA 1C78A 4UAIA 1OQQA 1A3VA 4TQ0A 3NZ3A 4A3EB 2I38A 4RWSC 1V97A 4E6IA 1KNEA 2FINB 4XXEA 3HOYB 3SFDB 2ON8A 1V8CA 1JWAD 1KLUD 3W5VB 3RMHA 1YQ3B 4OW0A 4ZRQA 5E6JA 2MUYA 1XLPA 3M7GA 1BR9A 3Q24A 2BW2A 2K5DA 1AWDA 4XE0A 3S2HB 3I9V1 1QOHA 4LK1C 3A8IE 3IXSA 2JSVX 1HPCA 3HKZB 5JPNC 3G6JB 3NXWA 4O42A 4IFDG 1AYFA 2WV6D 3H8HA 3TUOA 4ZHOA 2VUMB 5C3JB 2WKCA 1WCMB 2J42A 1SYEA 1IKLA 4KKTA 1KF6B 3OWEB 3GV3A 1DOXA 4D2KA 2XSCA 4OL7A 3C1EA 4KY6A 1NEKB 3P4PB 4REZA 5EQ0A 2KCCA 2V4DA 4KN4C 3T13A 1VZ7A 2L4NA 1VLBA 2M0AA 2INNE 1Q3LA 4WWMA 3RFZB 5I4DA 3IKJA 1BQQT 1JW9D 5BN3A 4RF0A 4XQJA 4CBVA 3GTJB 3FAHA 5M3MB 2OXPA 4TQUS 5C4HA 1YN4A 4MACA 1GUSA 2QJLA 3KF8A 1F77A 2L1BA 1FRDA 1S5BD 4M1UB 5A2QL 2ZXPA 4KHZA 3QOJA 3GTMB 1B9MA 1E9MA 1MSGA 1FM0D 2EYPA 1EY8A 4ARCA 1J8IA 1TQOA 1FD7D 2L83A 2B2TC 3FPUB 1TIID 1JOKA 1S5FD 3Q69A 2F0WA 1PTOC 2SEBD 3IFDA 3SR1A 4K6LA 1HA5A 3P75A 1FGBD 4C2MB 3C8YA 5KIXA 1FIQA 4C1NK 2Q8TA 3PZ8A 2B2WC 1JROA 3PO3B 5KRUA 3KQ4A 5M5WB 3HG9A 1IBXB 1YN3A 4A3IB 3L9AX 1HCZA 2IDYA 2RVLA 1EZ6A 4OZCA 2D5DA 2F0MA 3VR5A 2EPBA 1AZQA 3NWSA 4K5XA 2X38A 4YTPB 3ZQ4A 4KD3A 3SK5A 4EGVA 4A9AA 1GHJA 1L4ZB 1L0XB 4KD4A 3AEEB 4OHJA 2GRIA 4HROA 1WRIA 2L5TA 5IODA 3GP7A 4HCSA 2D62A 5DNFA 4U673 1TU2B 4KK7A 1Y1WB 1EQVA 3TEXA 3P1MA 4N6EB 2D2CC 1KRHA 2K5WA 2NMQA 1LT3D 5M5YB 2WXFA 2K9XA 5C4XB 3C1FA 1UWXA 2A68D 5KNDA 1I4XA 1QOBA 2KHSA 1CK1A 4RGNA 2MGSA 2WACA 2JYTA 2EYOA 1UEAB 2VB3X 1ZEQX 2LFNA 2X6LA 3TDQA 1L6UA 1NR2A 1EZ8A 2B2TA 5JXVA 2I07B 3AE9B 1QLBB 4G7ZC 2TMPA 1EYAA 3K58A 2HDMA 2C5CA 1SB3C 4QUFA 2ZW1A 2F03A 3AV8A 1TR5A 3DWPA 4RCOA 3PIP3 1SYCA 2VZKD 2MPMA 2ONQA 1TY2A 2LMCA 2B2WA 2L52A 2B2YC 1CQVA 1CZWA 5K36H 1K51A 1QKZA 2WXNA 5BMGA 3OOCA 5EKLA 2F0VA 4FNFA 4X3SA 1WTOA 1Z6HA 1HA6A 1ESFA 3L3OC 4N9TA 5E1FA 3VYTA 5FOBB 1QOAA 2FHTA 2JA8B 4PMCA 5BYRA 2X6GA 3TZUA 1YJJA 1EOTA 1KLGD 1GHKA 4OO1G 1CHPD 4J8QA 2K5QA 4A90A 3S9WA 3VYSA 1L0VB 3K5MA 3SK4A 1SBBB 1ENCA 2C9OA 5EPKA 3V2TA 4GZYC 1HFNA 1IW7D 1B4OA 1I6VC 1JWSD 1EY7A 3Q23A 2F0UA 1EYCA 2IT1A 1EFID 3Q8FA 3IFTA 2BB6A 4H0LC 5GXGB 1Y69U 4HTHA 1G2SA 4CHTB 4ZUJA 3GV6A 2KMMA 3NVWA 1P7EA 4BBRB 4YXDB 2A74C 4A3JB 4KI0A 1LT5D 4YSXB 2F0IA 4AYBB 2CJOA 4R8IA 1RFKA 3BG3A 1PMRA 3HGBA 3E5SA 2K22A 2B2YA 4K5VA 1N60A 4J3OD 1NR4A 5HURA 3WDNA 5JOBA 3T4AC 1JOOA 5JAVA 1ET9A 5EGTA 1C76A 2WXLA 4F87A 2QDBA 1DXMA 3ITPA 1F2RC 1GXDC 1ACCA 1KDBA 1GUGA 1QILA 1ZYRD 1B53A 1STNA 4ZAIA 2BE5D 2I46A 2A68C 2R6GA 1RCVD 1PDXA 3HVZA 1LT4D 4XTCS 3PUVA 3HOUB 3AE7B 3H0GB 1FRRA 2XRQD 4IUNA 3ND8A 2Q8IB 5EKIA 1XWEA 3S14B 2J0TD 1TWCB 2CVRA 4A3MB 5KNCA 4A93B 3B2FA 2RDFA 2K04A 1TZOA 2JEBI 2E75C 3VR3A 3OIPA 1NVID 4KGSA 2MJDA 1A6XA 1N61A 3G7LA 4PT5A 1M8AA 3URYA 1F9PA 1SJED 2K3UA 3M4OB 2XWJB 1RKNA 1FNUA 3M3YB 4G4KA 1TS5A 4MH8A 1F9QA 3LNNA 2SNMA 1SNPA 5EE9A 4HRSA 3CHBD 3LX0A 4ITKA 2OT2A 4FF1A 1GUTA 1Y8PB 2LS01 3JAML 2NN6I 1L0YB 4K8IA 4KKUA 3L4PA 2WAQB 1ESRA 5CORA 1GB4A 1G8ZD 2L0CA 2AWNA 3I4LA 1V8QA 4IQZA 1SE3A 3UI3A 4DN4M 3PUYA 1SIJA 1V1OA 3QG1A 2F3VA 1TS4A 3ND9A 1TWHB 5FLXL 4OIJA 3HEJA 2WU2B 3AU7A 5J1ZA 3A56A 1PTOH 2KQ3A 2H1EA 1JB3A 2E3TA 2IX3A 2W3RA 1IW7C 3PUWA 2E2JB 4NMZA 2WXMA 1EU3A 3KBGA 1QB5D 3I8ZA 4KKIA 5C2TB 5I9PA 1YMHE 3VR8B 1ZKOA 1SJHD 3I72A 3GO5A 1BCPF 3FRPB 3H91A 4MHEA 5C3EB 4EQNA 1ML0D 3J7YW 3AEDB 2PMVA 2DLBA 2J52A 2L11A 2G1EA 2QMTA 3B9JA 4TKOB 2FJ2A 1KNAA 1O78A 2E2DC 3BIID 1HQMC 3QWNA 3TP8A 4U68A 1ICWA 3VQIA 1DOIA 3S16B 1I7HA 4CKCA 4FF2A 1YJIA 1BCPD 1FFVA 2PTLA 1V1PB 3BDOA 1WSPA 2WQYB 2LHEA 2DN8A 1MSHA 5I6WA 1DOKA 1E6EB 4KKJA 3T3NA 5D3IB 4US9A 1N5XA 2PW7A 1ROEA 2NVXB 1CI3M 1JWBD 2KN4A 1DD2A 2A6ED 1ZYRC 1JCKB 2K5PA 3QB3A 3BWUD 2BE5C 2KECA 1S5CD 4HN7A 2QF7A 1PFNA 4ZQ3A 4L8JA 1PFDA 2EELA 4QB4A 2R92B 1MPEA 3KLSA 4PNYA 3MAQA 1ZDVA 1DONA 2QILA 1ZDXA 5M3FB 1LABA 3J81L 2PNRC 1B9NA 2EYJA 3P1HA 1NYRA 1H9KA 1A2TA 3U9SA 5D14A 1BO0A 3W9CB 1YN5A 2Y5CA 5ELEA 3BZDB 5T1IA 1F9SA 3I4NB 3W2DA 1C4AA 4ZKBB 1G291 2F0PA 1QCBD 3NVYA 5IGEA 2E76C 1OXTA 5EBCA 5EPLA 4GDLB 4H44C 3GTOB 2NYZD 4KN7C 4ZUIA 4XWTA 4DNRB 2JA5B 3MA2B 1EIGA 3EVQA 5EE1A 3IT6B 3NWTA 3I90A 4ULLA 5FO9B 5D7GA 3CQZB 3VR9B 3ZJTA 4DXFA 2QIEB 3B2GA 5CV5A 2B2VC 3S17B 3NK9A 2J7ZA 2Q5WD 1I3QB 1IHZA 1XXGA 5HHDG 1F2ZA 4NP5A 2PPBC 1BNZA 1WTRA 4C3IB 3AM9A 1FMAD 3FVQA 1B2TA 4KY7A 3SVMA 2M00A 1C4CA 4KGRA 2IX0A 4WAFA 1FR3A 1O7ZA 1NCVA 2Q8RE 4H13C 3NS1A 4K14A 5C5LA 3HRZC 3FDTA 3OMCA 3EGRA 2JP1A 4WFN3 1LV9A 5CV9A 4Q5VA 3DM1A 1QQRA 2ACZB 4L23A 1KAAA 3K5LA 1TWGB 2YU9B 4FF3A 1RWSA 4IZ8A 3QIAA 1MHHE 5CYUA 3PMFA 4V0BA 1H9RA 4I65A 4MN3A 1RM6C 2F0HA 1ILPA 3TEZA 4HKQA 1N63A 1BDOA 1JRPA 1RDPD 4KJNA 4MM3B 1D1KA 1BCPC 1TWAB 1S4ZA 1SEBD 2WIIB 4Q2JA 3PV0A 3LB8C 1JE4A 4P6VF 2YYZA 1Q12A 5A2QE 1EWYC 4G57A 1CT1D 3NQIA 2B2UC 2A6HD 5C5MA 1V43A 2RDHA 4RH6A 1L6VA 4AQ7A 3P7JA 1LTGD 2A6EC 4JK1C 2BS4B 3K57A 2WDQB 4JBWA 2F0DA 1H9JA 5C4ZA 1S5DD 5CC4A 2B2VA 2N55A 4C56C 5IOCA 5NUCA 4A3GB 3AB9A 1T5XD 1OQRA 3BDLA 1RODA 1FNVA 2F0SA 3Q8EA 2L9HA 2F4IA 2K1BA 1L4DB 4XYQA 4DGZA 4B0EA 2NUCA 1KTKA 1EY4A 2BOSA 2NTTA 1NENB 3IAM1 3HOWB 3K0YA 2JYEA 4IUUA 3S1MB 2FE8A 1PYWD 3AE3B 2JYOA 1MI0A 1PTOB 4M8AA 4RF1A 1NAPA 2EJGC 5ELFA 3D4DA 1LT6D 2HQEA 1GB1A 2IGDA 1SAPA 2R3ZA 3HOZB 1LTID 1HUNA 1STEA 5BN5A 5ELDA 2F0GA 3VA7A 3IAS1 4L6TB 4IUQA 2O4XA 4XDDA 2B2UA 4N59A 3BDCA 2PYKA 1PRTF 2NN6H 4US8A 1Q8IA 1VDZA 1TYGB 3J7AF 1C4QA 4XYOA 2V4IB 4IFDJ 2BDNA 3NVZA 4KY5A 4Z9CB 1RD9D 2JQRB 3SR6A 2RBMA 2HUGA 3MXGA 2EE1A 3I73A 1PFBA 1PZID 2Z4IA 2F0OA 5HGTA 1LACA 1PRTD 1QE6A 5CR3A 1FEHA 3AEGB 5F2DA 4R3DA 2B8FA 2KJXA 1TKWB 3AN1A 2KWDA 4TSSA 4BBSB 3DUZA 1O80A 1QOFA 2WXPA 2LY7A 3KUPA 1GUNA 4XQNA 2YEPF 1PZKD 4FXGC 3HS0C 4M0WA 2MJ8A 1E2WA 2J53A 4K8JA 4O1NA 4KGTA 4DFAA 3MP9A 2A6HC 4ILWA 2WLBA 4WH4A 1WTVA 4FYDA 2JZPA 1PFMA 4C3JB 1WVLA 3EUB2 3S1NB 1ZUD2 3K5NA 5DAUA 3AE4B 4XIGS 5CGKA 2PZWA 2VB2X 4KV6A 1H9SA 2I2YA 1A70A 4OZAA 3TEYA 1B1ZA 2K33A 3PO2B 5I2YA 4OVZA 2MH7A 1HHVA 3NPPA 1M4VA 2MHVA 2PVOD 2JXMB 1PLFA 5K36G 5EJWA 1EY9A 1H9MA 5KYLA 1EWCA 2K6AA 4ZOHC 4IALA 1LTSD 3MTSA 1I50B 3R3OA 1I4HA 2N0SB 3QOLA 5LL6X 3ZJUA 1FYCA 4USAA 5BN4A 2W54A 4IN3A 2DYMA 2OEDA 4A55A 3HP3A 5KGUA 3D6WA 4YTNB 2VNUD 3EQLC 2Y3AA 3K6OA 1GUOA 1VDVA 2WP9B 4EQOA 3MFGA 5EE0A 3D8GA 4NJCA 4K5WA 1LO5D 2BT6A 4RKBA 4GDKB 4ODGA 1JORA 1HUMA 2NBFA 4PV1C 3SFEB 1S5ED 4N9PA 4HAEA 2EKIA 2NB0A 1SFOB 3IAYA 5TSSA 4RNAA 3HOXB 4NW2A 2B76B 2PW5A 1FO4A 4RCNA 1F2RI 1AZPA 1K8OA 4HEA1 2ZW0A 2XIWA 5C3WA 5DM63 4BY7B 1YNND 5E4WC 5HG2A 3C46A 5BYQA 4LLGM 2RKSA 4PMBA 2BS2B 1W6JA 4DF7A 4TQ1A 1K52A 3LWUA 1SYBA 1D5MC 4C3IG 5J39A 4IFDI 2JA7B 1PRTC 1WTPA 4H7BA 2EJFC 1R7SA 2H4OA 3X3MA 2CQAA 3A7LA 3U9OA 1G91A 1CFMA 2PIAA 1IKMA 3U52E 4HSVA 3AE2B 3BVZA 2IX1A 5C6AA 3JAME 4RGMA 3UI2A 2K05A 3LYYA 4YT0B 4FO2A 1QNUA 3A8KE 2O5JC 1I6HB 4OGQC 2EYLA 2ZXRA 3NBIA 4NZLB 3DEPA 4IUTA 5FLXE 1SNDA 2NVTB 1ZOYB 5JVG3 4IURA 3NHHA 2V3PA 3T53B 2MP1A 1SE4A 2NZ1D 3OIQA 1OO9B 1GPXA 3TP6A 1CHQD 3MVVA 1XO3A 1K83B 4ZLTF 1VMPA 3P4SB 1KABA 1P7FA 1EY0A 1C4PA 2ZXOA 4YIJA 1SYGA 4JPSA 4IKGA 4X3KA 1KFYB 3DHQA 4L2YA 4V190 3I57A 5C3XA 3BYYB 2Y5PA 2V3NA 5LL6S 4DQOC 2L12A 2L1AA 1XYIA 1BOSA 1HTLD 2QEJC 3NUCA 3R2TA 2LUMA 2GA4B 1ENAA 4C1NI 5CBEE 4F7XA 5HFYA 2CU3A 3DXJC 4HCEA 1QJOA 1XLQA 1JR0D 2MEKA 2B8GA 3FILA 3V3XA 3OPOA 4CKEA 4LMQD 3S2DB 1CTMA 3MZ5A 3NVVA 3CRKC 2R7ZB 1DJRD 1IUEA 1C48A 2K28A 1CZGA 4L1BA 5H8YE 3A7AB 2D9UA 3PUZA 4N58A 2W55A 1KDCA 4B08A 2AUJD 3AEAB 5LHY1 2JE6I 3MXPA 4B0MA 3E6ZX 3CWIA 4J6HA 5BMIA 1IYVA 1SNCA 2A5HA 3GTGB 4C7ZA 4KHVA 5AUIA 3SE0A 4IOIE 3LWEA 4ME5A 1JICA 2D5GA 3J81E 4R8NA 5H92C 2EYHA 3P42A 2PQEA 5J22A 2HDEA 1TT2A 1YNNC 4YTMB 1EIHA 4WURA 1EM7A 4WRDA 5AFWA 1BUVT 2BYTA 5JEAH 3VR6A 2EYFA 3NE5B 3Q8BA 2PVGC 2EYMA 3HVDA 1JALA 3D4RA 2CW0D 3NTHA 3N52A 3WOEA 2F0JA 3D31A 1ENFA 2KOLA 2CJNA 4XDCA 2QCPX 1WD1A 1NUCA 3WCQA 1X32A 2RA4A 4RGTA 3H94A 2B63B 5JPMC 1J9OA 3FKIB 2BS3B 1TWFB 1BUIC 1R9TB 1QT9A 2A69D 2ZT9C 5CV6A 2NTSA 4ZRZA 5IGGA 1CJEA 1JC7A 1F0ZA 2IJ0A 4AS1A 1EYDA 1XLNA 1T5EA 2WXKA 3E56A 4ZHPA 4ZRPA 2KQ4X 2WXHA 2F0EA 3VYRA 1F2LA 4RFBA 4OO1I 1MI2A 4C3JG 3T16A 2AWOA 5IGFA 2H88B 1CQFA 1RTNA 1Y56A 4CJ1B 3S1RB 1K50A 3AE6B 4C7YA 2QSDA 3MHZA 1JQ4A 3MFYA 3FC4A 2HCIA 1WWTA 5BMHA 3H6MA 4XT3B 4ABNA 1C77A 3H3VC 3J80L 5JEAJ 2KAJA 2AX5A 2ID0A 5CBAE 4XWWA 1VRAB 2XVSA 1LTAD 5C44B 1EY5A 3K59A 3AMUA 3I4MB 1B50A 5G3LF 3VR2A 3C3LA 3MXNA 2ICEC 3AEBB 2XWBB 4XT1B 3Q8AA 4C80A 5IGBA 4NAWB 3DWQA 3DWGC 1QG7A 2M56B 4MT5A 3Q6SA 1CM9A 3EFXD 2KEDA 1KH0A 2EOTA 4CJ2C 3RLFA 1FCCC 4HJGE 3GQBA 2LKVA 5G3LD 5C0XH 4PMWA 4A6QA 3T3OA 1V1PA 2F3WA 4FXKC 2WP8J 1XTCD 3HOVB 1ZXHA 4NDXA 5CV7A 2DWQA 1B44D 2FMMA 4J1MA 1SF0A 2DYOA 3S1QB 4BS9A 2H89B 4HMJA 2K01A 3ZGZA 4YSYB 4HSPA 4WIPA 5IT9L 2DNEA 2ENBA 5E4XA 3RPFC 1PZJD 2XN9C 1U9RA 1SE2A 1MHXA 2Z8LA 3BK2A 1JWMD 1Z47A 1J7BA 3RZDB 2CW0C 2NVQB 4JX1C 2HDLA 1D5ZC 1OXSC 1TY0A 2J4XA 4HKZE 2B39A 2KACA 1G6ZA 3U4EG 1WXQA 3TP5A 1DZ1A 1N62A 1J7AA 4IFDH 1C9FA 1STAA 1E2VA 1F2YA 2K0PA 1LTBD 1WD0A 4OZBA 3O13A 2A69C 2LEKA 4F88A 1HTPA 4NKLA 3I70A 2DY8A 4MIUA 2M9VA 4XQQA 3NUHB 1SNOA 4QIWB 4YWGG 1I4RA 1FNWA 1XEEA 2N9LA 3AB5A 2WINB 4K2LA 2JX5A 1U4LA 3NRZA 1Y8OB 2PZUA 4B9XA 3EROA 1I4PA 1K8MA 1Q90A 5JJZA 5C0XJ 1TKYA 3M4YA 3U7ZA 3EA6A 1OFFA 3RZOB 1RF2D 1I4GA 1UNSA 2SNSA 1H9SB 1ZE3D 2WNMA 1EQTA 2LMCB 1U4PA 2R61A 1Y8NB 5ISRA 4TMAB 5EPJA 4JE3B 2BBCA 4A3DB 2RPVA 3PZ7A 3J9CA 2DNCA 2JU6X 3MXUA 4C3HB 4NAMA 1BF4A 3GB1A 4A3KB 4P16A 1J7CA 3W3AA 1FXIA 4CGYB 4RA8A 1GOZA 3K5OA 3I3CA 1U4RA 3K7AB 1JWUD 1FFUA 4X3TA 3N9YC 4DA2A 1MBYA 3F2UA 2NN6G 3AH7A 4HMIA 2RQXA 2L55A 1LTTD 1W6KA 3CU7A 2JWUA 4BA2I 3GS2A 3FMCA 5FO8B 1EEID 3P4RB 3NQTA 4K6DA 5JVH3 3ZJVA 5EE3A 3OWFA 2E6XA 1K53A 4OIKA 3VRAB 4WQMA 1RYJA 5I6YA 3PO0A 3SXHA 4HR7B 1DCZA 5CV8A 5I2XA 2O5IC 2MJEA 4KTAA 3TZDA 5CMDA 2PZTA 2WB1B 1BXTA 4ZK9B 4H2AA 1F2MA 2GB1A 1D1IA 3P63A 1CZPA 4S3SA 3TBIB 4RAUC 1SYDA 4A3BB 3CRLC 1SXTA 2INPE 2WKDA 1C8CA 3T51B 3BVMA 1Q1BA 4KX6B 3DWMA 3R8BA 2N88A 2K03A 3AEFB 2F0FA 4Y7NB 4IUVA 2F0QA 4DNTB 1Q10A 1XF5L 2N7JA 2IGGA 3AE5B 2AQ1B 1X3PA 3ZYYX 3TSSA 3HRDD 4GLSC 5K5PA 5FR3A 4RKLA 1L5PA 2EXZA 1RTOA 1UGJA 2GI9A 3KK7A 5I9OA 3ONAB 2A73B 3TP7A 1PDQA 2RDGA 5EBDA 2W3SA 1VF5C 1TKGA 2OF1A 5FO7B 2W82A 2WXQA 3P20A 1TS2A 1E10A 5IIFA 1XCQL 4K2KA 4CKBA 5M9OA 1HZ6A 2JXTA 3VRBB 1SDFA 1WYGA 1U4MA 2PLPA 3OW7A 3SHLA 1ZXTA 1EEFD 1G2TA 3MWYW 2BCOA 3NP8A 2G9DA 2TSSA 1I4QA 1YNTE 1AP0A 5HI1A 1GUWA 1IBXA 5C0XI 1UWMA 1NI3A 1SYFA 4WORA 4CJ0B 4OO1H 1PGXA 2IL8A 2WXRA 1F9RA 4KKSA 1XX8A 2JSOA 4ARIA 3GTKB 4DAYA 2AQ3B 3N6RA 4A8XC 1II3A 2XRSD 3M7NA 2IPKD 1O7LA 1ZXIA 4LK0M 2Y0SB 5KYIA 1SSOA 1YQ4B 1RJTA 2Z1CA 3E0JA 1VMCA 1QWYA 2F1MA 4G7OC 2CHBD 1YNJD 1PRTB 1TJEA 2EVBA 3SK6A 1QOGA 3I91A 2BA0A 3WOFA 1VCIA 1AFPA 3FILB 4IUPA 1LLRD 2PCFB 2SOBA 3GD7A 2IWHA 2WS3B 2PO4A 1TVXA 3EJIA 3T56B 4YSZB 4DK1A 4G7HC 1SNQA 5D65A 2WDVB 1VF7A 3KLSX 4EVOA 2IW3A 4KJOA 3V96A 1QNKA 1T3QA 3MJ5A 1MVKA 1B9RA 2G9HD 3A8JE 4FF4A 3D6CA 2NWGA 4CQNA 5A35A 3BYTB 2WU5B 3FEWX 1LTRD 3M85A 2KVMA 3KWVA 4HEDA 4TRDA 2KUMA 2XNAC 2YEPB 3J7AV 1JMLA 2VZKB 4A3FB 2R93B 2EY2A 2E74C 2VXWA 3SK8A 1SMYD 4FP5D 5IGCA 1TKEA 3KBXA 1R4QB 5AUKA 1STHA 3A55A 1HFGA 1Q1EA 3NTIA 1GAQB 1ZPSA 3TMEA 1MD2D 5IGDA 2F0KA 5FK9C 1DOLA 5D3DA 3BK1A 1OXXK 4P2CB 5FKAC 1ET6A 4LTUA 2M2LA 1B3AA 1E0BA 5T1GA 3MEHA 2LHDA 4QCLA 1AEXA 1AN8A 2FMCA 2NVYB 4DXGA 1WTXA 3D3RA 2WDRB 4RHSA 1KDAA 3BVGA 1N5WA 5CV4A 1E7PB 2PMZB 2FBWB 1IGCA 3TEWA 1STYA 3OMGA 3ERQA 1ONLA 3PIO3 3ETRA 5BYSA 4FXDA 3AE1B 5DEHA 3OSOA 2PW9A 3D4WA 2KDMA 2LFIA 3GTQB 3AECB 4PQXA 1A15A 3SDZA 1QF6A 3GTPB 2EJMA 1HEZE 3MC0B 5T8IA 1FD6A 1JOQA 2KA7A 2E2IB 4QUCA 1PUTA 4RGOS 1VZ6A 4JWSC 5E3FA 3IL8A 2DBYA 3DMUA 3A54A 1GJXA 3RD4A 3MHBA