4RGOS

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 63
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
S PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgoS02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgoS01
3DWQA 1LT5D 2XNAC 1BCPD 1YN4A 1LT6D 1LTBD 3W2DA 1PTOC 1V1PA 2RDGA 5ELDA 4RCOA 3URYA 1STEA 1XXGA 1UUPA 3CHBD 1F77A 1DJRD 3R2IA 4RGTA 1JWUD 1TY2A 1XTCD 3BVZA 1SE4A 3SEBA 1B44D 1GOZA 1LTRD 2XRQD 1L0YB 1M4VA 2QILA 2QEJC 1I4RA 1SJHD 2AQ2B 1FGBD 1EEFD 4RGOS 1YN5A 1LT3D 1PTOD 2J4XA 4Z9CB 2XN9C 5D3IB 2IJ0A 1FNVA 4RGNA 1RDPD 1RF2D 4RHRA 2Z8LA 1D6EC 1LTAD 4ZYSA 1TY0A 1CHPD 1G8ZD 3V05A 1LTTD 1SBBB 1BXTA 3EA6A 1V1OA 2CHBD 1EFID 3O13A 1HA5A 1AN8A 3TSSA 5ELFA 1ENFA 1EWCA 4C56C 2AQ3B 1SJED 5FK9C 1TS2A 1JWMD 1BCPB 1S5DD 1KLGD 4NZLB 5I4DA 1CQVA 1T5XD 4O1NA 1JWSD 4UDUC 1PRTD 1YN3A 1ET6A 4L63B 2RDHA 3EFXD 1SE2A 4RH6A 1I4HA 1EU3A 1SXTA 1TS3A 1D5ZC 4BWGB 1FNWA 1AW7A 1JQYD 1L0XB 4DXFA 2XRSD 1I4XA 2G9HD 1D5MC 1CT1D 1ET9A 1FNUA 1D5XC 1RD9D 1LT4D 1LTSD 1SE3A 1DYQA 1JCKB 1KTKA 1LO5D 2R61A 1PZKD 1HQRD 5ELEA 1BCPF 1JR0D 5FKAC 5ELBA 2NTSA 1PTOF 1PRTB 3BZDB 1I4GA 2O2LD 1MD2D 2WV6D 3BVMA 1RCVD 2SEBD 4RFBA 1ESFA 3DWAA 2NTTA 1HTLD 1TS5A 1S5CD 3R8BA 1I4PA 3OWEB 1FD7D 1LTGD 1S5FD 1EU4A 2IPKD 4RGMA 1PRTF 1PTOB 3MFGA 4OHJA 4DXGA 1PZID 1SEBD 3R2TA 1V1PB 1PYWD 1EEID 1S5BD 3BYTB 1I4QA 2TSSA 5ELCA 3BVGA 1TS4A 1LLRD 1LTID 5D3DA 4RHSA 2AQ1B 1CK1A 1HXYD 1PTOH 3GP7A 4L6TB 1B1ZA 1PRTC 3KLSX 1PZJD 1BCPC 1UNSA 1CHQD 1QILA 1S5ED 3BYYB 4K6LA 5TSSA 3DWPA 3MC0B 1KLUD 2ICIA 4TSSA
chains in the Genus database with same CATH superfamily
2LWPA 3LDZE 5C3WA 1EY7A 2K8HA 1HUMA 3UIPB 2PMVA 2MJ8A 5C0XG 2E5LL 4AS1A 3RNEC 4FVMA 4EOYA 2INNE 3NVZA 4I7AA 5JPMC 1XCTL 3ZUNA 3E5SA 3IT4B 2VQFL 4GN5A 1K0RA 3CQZH 2PVGC 3QHTA 4NNJB 5C44G 1N34L 1WXMA 3D6WA 3Q8EA 2J7QB 1J7CA 4QGUA 5BN4A 2G5DA 4BXXG 1J5EQ 1VQDA 2E74C 1LT3D 2LVPA 1MHWC 2FIDA 3EN2A 4DV2Q 4EE2A 4A3GB 1J6QA 2VB2X 1XNQL 4HJGE 2K75A 4LNIA 2EXDA 4RGNA 4JI2Q 5EPKA 3OHXC 4C1NI 4CHTB 3IBEA 3R66C 2KNBA 3TBLD 1J5EL 4AJYB 4BBNF 1K52A 4HXDA 4MDKE 4DUZQ 3AH7A 3GD7A 1HNWQ 5E4WC 1CJEA 5BR8Q 2C60A 1GHJA 1A62A 3TZUA 3HZXA 1TZ1A 2K03A 1N8RC 3R93A 1YNND 2OQKA 3AE8B 2EYJA 2NCNA 1VS0A 4C3IH 4A9AA 3A8JE 4MGKE 2BT6A 4HIDA 4HLEA 1V9JA 1JJGA 1E2VA 2E6XA 2WKCA 3ND8A 1QZHA 1YN3A 3QR8A 1CTMA 2B2WA 4BOSC 3HOYH 1SMYC 4LFCL 2J0JA 1SRUA 3ENEA 2BDOA 1A5RA 2GOWA 1L0XB 5LXIB 1X3EA 4DA2A 4LF4L 4IALA 1ET9A 1FNUA 1CSQA 1WYGA 1WXQA 1YI2A 4Q2JA 1DYQA 4KHPQ 1WJNA 3B0AA 2NBFA 4OVUA 1QF6A 2BE5D 1WXVA 3I56A 2F0OA 2O2LD 2DUDA 2WV6D 3OOCA 5E6JA 4MZ9A 4JI8Q 2KBNA 2R93B 3HKZB 4YHHQ 1S3SG 3I5JC 2AMCB 1A3TA 1KHIA 3X23A 4XXEA 2K5VA 4J1MA 3J81i 3BK2A 4LNNA 1E2WA 1O7YA 2DZKA 4LNOA 2A5HA 2L7RA 2BKFA 2M17A 1RHPA 3QCAA 4WWNA 1SNMA 4PS7A 5C1ZA 1ILPA 4BS9A 3TZDA 1E9MA 1F2RC 2MGSA 3R2TA 1WD1A 4GGQA 2X6LA 1U4PA 1WCMG 2D2CC 2NZ1D 4A3JG 2PIAA 3T1HL 2LSSA 3AU4A 3KW5B 2R7ZB 5I9PA 1VQJA 3PUYA 2KUMA 1HUNA 3PSIA 2AQ1B 2K9XA 1ENCA 2MFIA 3M9BA 1I3QB 4A3FG 4JBKA 1R7SA 2ZNVB 1PZJD 5M3MH 1FM0D 5IYBG 5HGTA 3SR6A 3J80E 4ZRQA 4KLKA 4EUTA 2L0CA 1Q7YC 4LNFA 4TSSA 2JXTA 3OAWA 3P4QB 1R4NI 2JXMB 2Z6BA 4DR3L 1VQ5A 1YN4A 2JX5A 5H92C 5BO4B 1K8OA 3FC4A 3CF5A 4DV4L 1FRDA 2ZT9C 4HCNB 1OXSC 4CJ1B 2Q2TA 2RR9A 4KSLC 1SYFA 3RN9C 4LMQD 4A3IG 2A6EC 2QW7A 4BOZB 4ZRPA 3BVZA 1MJDA 1XD3B 3MC9A 4YWKA 3Q2AC 4BA1I 4FP5D 4GMVA 5CBEE 2DNEA 1GOZA 3QOLA 5JVG3 2FHTA 1RTOA 2ZZPB 2K5NA 3PZ7A 1GUNA 1H9MA 5LL6X 5G55A 1DCZA 4B3TL 3A9KA 2QEJC 1K51A 1OQRA 4S17A 4KY6A 2WU2B 1PLFA 4PNYA 4C2MB 3EECA 3EGRA 3D6CA 4P7IA 5BMHA 1PDXA 1YHQA 2AX5A 2E76C 2VZKB 3H09A 2K5QA 3D3RA 4KX6B 1BBWA 2Z4IA 1TWCH 4LLGM 4HDOA 2VB3X 4TQ0A 2ZPNA 2WXHA 4KDIC 4LJOB 1BXTA 5CTRC 4DUZL 2VUMG 1JE5A 2UU7A 1ASYA 4OEMB 1F1HA 3ZLZA 3J81j 5KYIA 1YBYA 2N55A 2MJEA 3DUZA 3MC8A 4M01A 4DV2L 3W1BA 3NHEB 1ZYRC 1Z47A 2CWPA 1EM7A 2EMTA 2NVQH 2FNJB 2JRIB 4O0AA 1VQ9A 2JWZA 1T5XD 3Q8AA 3HKZE 4IUVA 1E7PB 2UXDL 3AULA 1G2TA 4DF7A 4QUCA 4P16A 1A2TA 1I4HA 3KYCD 4BBRG 1ML0D 2PE6B 1ZKHA 2J0KA 4FDBA 2KDFB 4QJFA 4OWXB 3H6MA 3QG1A 3ER0A 4JI7Q 1E1TA 2HQEA 1Q1OA 1NMFA 2K5WA 5A2QL 4FF3A 1MGSA 1Y8PB 4W9KA 1EIYB 1F2ZA 1H8CA 1OGWA 4DHZB 3I4NG 2HD5B 3AEDB 1SE3A 1JCKB 2QDLA 3CCRA 4RCNA 2JA7B 5T1IA 4LW1A 4KV2A 2CFMA 2F0HA 2KCTA 3ERQA 3JC66 1QVGA 2WS3B 4FJZA 4IW0A 1FO4A 1NMGA 4DDID 2F4IA 2MHVA 4E6IA 3OTOL 2TMPA 3KK7A 1YIJA 1RAXA 2MP1A 2FCSA 3NZUA 4JOIC 4HPMB 4JX1C 5ELNA 2WB1E 2WDRB 3VA5A 4IURA 5J1ZA 3W1SA 4GLVB 1R4MI 2DX5B 3PS6A 1EOTA 2XTIA 1IGDA 1J7AA 4M0WA 2JYTA 3NS8A 1K8MA 2MCNB 2CCZA 3GOEA 3UINB 2LGDA 2WXQA 2R2QA 5M3FH 5K36H 3VR3A 3APFA 3K9OB 4P6VF 4KGTA 5IKCM 1WJJA 1A0IA 3BJUA 4A3LG 4DR6L 2F0NA 5IYDG 3D31A 1HRJA 1HEZE 1Q10A 2IO0B 3JW0X 3S1RB 3QC8B 2NB0A 2V3NA 3C0RB 1DOKA 1GO3E 4YY3L 1XMOL 2GBKA 4IOCA 2YV5A 2EYLA 4MGIE 2R92B 2KHSA 4OL7A 3UQAA 2KWVB 5F2DA 3TEXA 1LT6D 4XYQA 3TREA 2I46A 3CCVA 3RZFA 3ZTCA 4EFOA 3HOXB 2FINB 3LB8C 1TYGB 2LGIA 2OJWA 4AWJA 3PGEA 5M5XH 4RCOA 3OTOQ 2I5LX 2O6VD 2Y0SB 3T51B 5FLMH 4EZJA 4LF9Q 1XTCD 1QE6A 2M8SA 1SNOA 3AB5A 2K8CA 4IPDA 1IXRA 2VS1A 3BG3A 4ZRKA 1WY8A 5IGBA 1QOHA 2N3SA 1VLBA 3RNBC 3J7ZC 4AQ7A 4EKUA 2L83A 2BCOA 5C23A 4B3SQ 3NQIA 1NEKB 1SSNA 1OEYA 1EEFD 1OO9B 2R7ZH 3U7ZA 5CGKA 1Z5SB 4WQOB 4C80A 3KWLA 3NEMA 1VQ8A 2WHIA 2KENA 3HVDA 5EE0A 4JBJA 3K7UC 3L2PA 3OJ4B 2XGTA 3SDZA 3M3YH 1LXDA 1RFAA 3VTUA 4TV3A 3KF6A 3V05A 2MBOA 4DR3Q 4OWWB 4FN2A 2LMCA 3AE2B 3P63A 5IP7H 4A4IA 1IBXB 3U4EG 1ICFB 2KTRA 3NJTA 3GE3C 3H7PB 4PS3A 4C56C 1G6ZA 1EYCA 1L2FA 1QOAA 2M56B 2VH2A 1JWMD 2B63G 1WMHA 3DVNU 3KWVA 2NZOA 3R3OA 3FEWX 1ZUD2 4F87A 2N9XA 3DBRI 4ID6A 1OXUA 5FR6A 1EY8A 3QAQA 1DOMA 4O1NA 3VUYA 4B9KA 4DXAB 1FIQA 3RD4A 1PDQA 1JRPA 4C3IG 3OIPA 3GTKB 1PQSA 2IY0B 1C4AA 3EFXD 3UQBA 2VQFQ 5KHOA 3BDLA 3N1XC 1UGMA 4ARIA 4HKQA 4KK7A 4AOFA 1FNWA 1IGCA 2RKSA 3S2DH 3ZNGC 1O7LA 4IUQA 2E5LQ 3HKSA 2K25A 2K5PA 1J8CA 2PI2A 1BNZA 2WB1G 1T9HA 2D5DA 3IT6B 1LM8B 4NPSA 3S1QB 5ELBA 2WU5B 3DVNV 1GUSA 2K6DB 4EGVA 5EE1A 2J42A 2BVCA 2IX0A 1K8GA 1B7YB 1STBA 3K8AA 4TKOB 5J18A 2ASQA 2RVLA 5FLXL 3HM6X 2JA8H 4YL8A 2R92G 4NQLB 2KN5A 1PH7A 5LXHA 1EU4A 3PCOB 1XLQA 4YY3Q 5DM63 4LFAQ 1YHBA 1XMQL 2KHWB 3MFGA 1GVPA 2L00B 4GLSC 4B08A 4IPHA 5M9OA 1HZCA 1SR3A 4C3JH 1Q0WB 4WJNA 5AZFA 5C0XH 5C4JB 5JEAH 4KIKB 5C2TB 4IWPA 2G1EA 1O7IA 1VDZA 4A93H 3GTJB 4XT3B 3OMCA 4GU2A 2F0LA 4HJKA 3J7YW 3OW2A 1KRHA 1WXSA 2DWQA 3I72A 1BCPC 5LHY1 4W9JA 5BN3A 5TSSA 1C4QA 2HQLA 1D8LA 3I8ZA 3BZKA 4NXNQ 3D32A 5DPTA 4CKCA 5FJ8G 4FHKA 4M8NA 4AYBE 4LF5Q 2PW7A 1V80A 3G4SA 2WAQE 2KA7A 3MTSA 2UXBL 4RG1A 3RNUA 4WWOA 3TEZA 2JJQA 4ICUA 4Y7NB 2C9OA 3JYUA 2V9HA 1NENB 4ZUIA 1ILQA 1XLOA 4KV6A 4DV4Q 5E4XA 4G50A 2RHSB 3VA7A 1HFGA 2H88B 1T0QC 5FOBB 4LTUA 2IW3A 1U5KA 3T1YL 1EY0A 3AEGB 5D7GA 2B3GA 5J22A 4CJ2C 3Q8FA 3PZ8A 1L1OB 1MBYA 3IFWB 1Q3LA 2K33A 3PQIA 1Z7TA 2IO3B 4K3BA 2JA8B 4IWOA 2QA4A 4OX9L 1I50H 4HSPA 5FO9B 1P98A 3L0WB 4B0MA 1RDPD 4C3IB 2BYEA 3T8MA 3Q8BA 4CKBA 1G8ZD 3DEOA 5HHDG 1IL8A 1K73C 3ML8A 4A3DB 1GM5A 4A93B 3AE5B 4UPAA 2YVCA 4DAYB 3W5VB 5D6JB 4XT1B 1NI3A 3ERSX 4DDGD 1EWCA 1R4QB 1UZXB 1UE5A 3C2PA 2EMSA 3DHGC 2I5HA 4FXGC 4UP7A 2EXZA 5I4DA 1BVSA 1CQVA 5LLIA 2NBWB 1EWYC 4IG7B 2KCCA 1QCBD 3QWNA 3IAS1 3H8HA 5EJWA 4G4KA 3TUOA 1ZKOA 3Q3OC 3GZNI 5EBCA 1XLPA 3TL5A 2ES2A 2NPTA 3Q22A 1Q8KA 1B70B 2A74C 2IT1A 3A0JA 1PH2A 2F0TA 3AECB 3ZNID 4WAAA 4KN7C 4BY7H 4ICVA 2BYTA 1TKWB 2KEDA 1V2YA 2EKIA 2KLGA 5D65A 2IO1B 2MA9B 4GS3A 1SYBA 3GV6A 3IKJA 1JOQA 2UYZB 2F0KA 1LYLA 4XYOA 3FPPA 3L7ZC 1HR0W 3NQTA 1ISNA 4MH8A 5H1SE 2UUCQ 1JB7A 4HPLB 4L2YA 3HOVB 2LGSA 1HZAA 1U9RA 1RTNA 4RFBA 1F2YA 3AM9A 3S16H 2N88A 2NVXB 1E8ZA 2IX3A 1N32Q 2N4FA 3FHWA 3P1MA 1HTLD 2K04A 3U52E 1PFNA 1S5CD 3CRKC 2H1EA 4B95A 1J0GA 3QB3A 2WAQB 3WAMA 1ZGUB 4BVUC 4DK1A 2L1AA 1WGKA 2LZ6A 3KYDD 3MXNA 1L4ZB 4C3HH 2MBQA 3KUZA 1AYFA 3MXNB 2Q8IB 2E2DC 3VVWB 4JI6Q 1L4DB 3CWIA 2PQEA 2JRHA 3V61A 4DV7L 4ZDVA 2HJ1A 2AHOB 2MWSB 1I6HB 1IL2A 2F0SA 3KUCB 2FCQA 1FMAD 2IGHA 3MC0B 2CW0D 2WKDA 4A76A 4DAMA 2YEPB 3S9WA 4DAVA 3CC2A 4KKUA 5GQOA 2GBRA 2DZIA 1YVCA 2FE8A 3K57A 4GNXB 2LD9A 4DUYL 1LTBD 5ISRA 3RZOH 4ILWA 3P2BA 1PTOC 4USAA 3RFZB 1TQOA 4BKGA 4OX9Q 3PLVA 3I2ZA 1TU2B 4ZAIA 5IGGA 2N9LA 2KVZA 2NPTB 5DPRA 1FCLA 4HIKA 5CYUA 1UE1A 4KY5A 2K1FA 5M3FB 2Y5BB 4OZBA 2HDMA 2WXFA 4ZKBB 2F3IA 1C76A 3GTOB 2M9VA 3H0GB 3HOUH 2PZTA 1WTVA 2AEHA 3CMMB 3GO5A 1SNQA 5E6PA 3RCZA 1PTOD 1FGUA 3JAMc 2HDLA 3TP8A 2QIEB 3Q8CA 2HDEA 5D94A 3I4OA 1D6EC 2DNCA 4G7OC 1T0YA 1EY5A 1LTTD 3LX0A 3KBXA 5C4HA 2INCC 2OF1A 4LDTD 5JJIA 3U58A 1Z9FA 2GN5A 4HIMA 3UDXA 1T0RC 3GE8C 1NE3A 1WX8A 1IP9A 4DGZA 1XT9B 3ONSA 2INDC 2EY6A 1EZ8A 1Q86C 1HZBA 1N36L 4LUOA 1ACCA 1C48A 2F0VA 1KLGD 4FNFA 3FP9A 4G7HC 2VY3A 2L15A 2CVRA 5KIXA 3UI3A 4M8MA 1X3GA 4C1NK 4HJ8A 2LJ5A 4JE3B 5JPNC 5M5YH 2OT2A 3E0JA 3H3VI 1D5ZC 2BA0A 5JEAG 4X65L 3P4RB 5IT9L 1GUTA 5EKKA 1H95A 4BY1H 2BF8B 3ZGZA 2PW5A 3AYHB 4KTAA 1HHVA 2WAQG 4HCSA 3KBGA 4N58A 1WGGA 2M1MA 4XWWA 2W3RA 1QB5D 3QJZA 4A3EG 4A3LH 1N62A 1GXDC 1BBXC 2UUBL 1M90C 3GDEA 1FCCC 2D0PA 3A8IE 1RFKA 1I4GA 2PJHA 3PMFA 2IDYA 1GJXA 1E6EB 3LWUA 5C4ZA 4YTPB 1XX8A 3D4WA 2FXQA 2Y0SE 3PREA 4JOIA 3UGBB 3V3XA 3B2GA 1TS5A 5BYSA 1VQBA 3FILA 2PMZB 4R4OA 1BUIC 4DR7Q 4K7SA 1CQFA 1WX7A 1V1QA 2NN6G 4IO9A 1PTOB 2ZEQA 3NE5B 3AV8A 4DV5Q 4BXXH 4YSYB 3NOBA 4XC2A 1BR9A 2R3ZA 2OOBB 1OQQA 5IYCG 2QDBA 1V43A 1DOLA 2KJHB 3H6NA 3SXHA 5IOIA 1B8AA 1TTNA 3HVZA 4BBRH 3I4NH 1E3PA 3L9AX 2WFWA 3MVVA 4KD4A 1W6JA 4LUZA 1EF1A 4ZRIA 2HIXA 3SHLA 4ABNA 2JZZA 3H1UA 3TBIB 3S1QH 3DWPA 4OVZA 3H0GG 4HPPA 4TVAB 3I91A 5IGCA 4CGYB 1SYDA 1XPRA 1CKMA 5C3EB 2KKCA 1EFWA 1U4AA 2UXCL 2JA7H 4YIJA 4A3GH 1Q1EA 2BB6A 3ZDMC 1WTHA 5EBDA 3RZDH 5CBAE 4M1UB 1EOVA 3J81E 1H9SA 1KQSA 1MI0A 3C46A 1BKBA 1CZPA 4IJHA 1PGAA 4B6WA 2WDQB 3MXPA 1MKHA 3A9JA 3AXCA 4RF1A 2XRQD 4C3JB 2QHOA 3TS0A 5BYRA 1K28A 2CR5A 1NBWA 2PPHA 4X66L 5C3EH 3DLLA 1IBKQ 2KWCA 2WXOA 4BY7G 4K3CA 4AQYL 4IFDG 1FXTB 1WTQA 3M4PA 3AE7B 1OXXK 2YLMA 3IG3A 1TWAH 5EAYA 2E8GA 3PHWB 4DN4M 1BOSA 2IJ0A 2SOBA 4AUQC 3FKIG 3STBC 2ASBA 4A3DH 3PPAA 1YZ6A 4K8JA 4CHKA 2ZXRA 4NXMQ 3M7GA 2RCNA 2GRIA 1JOKA 4QB4A 2ZXPA 4DR5Q 1NR4A 3GTJH 1FR3A 4LUVA 2D3BA 1HA5A 4R3DA 3CCJA 4HDQA 2D10A 1PYBA 4RKLA 1HR0Q 3HRZC 3I3CA 3CC7A 4GKKL 4LF8L 1GG3A 2OQ0A 3B2FA 4BA2I 1SJED 2WYQA 1VQ7A 5L95C 2IL8A 2LI5A 1QQRA 4HROA 1BCPB 3MTNB 1CKNA 5CR3A 3J7AV 1WR6E 3S2DB 3Q6BA 2JA6G 4IN3A 2L4NA 5IGDA 4YSXB 4RKBA 2XSCA 1RM6C 3AE3B 1TKYA 5E6OA 3S2HH 2NR2A 2J53A 5IN7A 3J80i 2Z0SA 3JVZX 1GD7A 2KQ3A 1HNXL 2RPQA 2Z0DB 2F1MA 1NDDA 1X3FA 2BYFA 1GAQB 3SU8X 4UHVA 1I5FA 1ZXIA 3WWVA 2KFJA 1I4XA 1D5MC 1TWGH 1KAAA 3PUZA 2K5HA 4DQOC 1L0WA 2HTME 1LTSD 4A93G 2KQSA 4WAFA 1YQ4B 3D8GA 1Y1WB 2MQHA 5FKAC 2V4DA 2G4SA 3KF8A 4G57A 4ASWC 3K0YA 3Q3JA 3BZDB 4HRSA 1YJNA 5C4XB 4DR5L 4QQBX 2ON8A 3N32A 3OJ3A 4C00A 4YTMB 1HQMC 2BOSA 3AMUA 4LF9L 1V6EA 1YX6B 1GPXA 2W3SA 1MJEA 3PGZA 3RI7C 1VMPA 4OGQC 3AE6B 1CUKA 5C5MA 4GOCA 5DLQE 4DK3C 3ZTDA 2I1JA 1V9PA 3H3VH 1I3QH 1ICWA 2IPKD 2Q8RE 4R4TA 3PO3H 1NY4A 1JB3A 1JRUA 4NMZA 4KSKC 1VQPA 5EE9A 5E1FA 1S5BD 2L32A 4WJQA 2VW9A 2HIVA 3VR4A 3BVGA 2WXMA 4CDDC 1Y8NB 5IT9E 4M0WB 2KJRA 3NTKA 4A6QA 1CK1A 4L6TB 3MJWA 4J6IA 3I90A 4ZHPA 3DOWA 3A8KE 3PO0A 2ZW1A 2YU9B 4A3GG 4OO1I 4NY0A 1SN8A 1AZQA 3KQ4A 4EQ5A 1FEHA 5BR8L 2A68D 2LJIA 2ICIA 2PI2E 4WORA 2WX0A 5LMUQ 1KD1C 1B9NA 2R93H 4D2KA 3TQYA 1TWGB 4R8NA 3DDCB 3HRDD 4B3ML 1AWDA 2A5UA 4DHZE 3EJIA 2EOTA 3URYA 5EKLA 3S1NB 3CHBD 5CV8A 1N34Q 4MEMA 1V5OA 3G6JB 2XWJB 4NDXA 3D4RA 2E3TA 3MA2B 4L8JA 2L05A 3W5UB 1X3PA 4UP8A 3ZO5B 1BO0A 2DY7A 5LL6S 4DK6C 4EX5A 4HKZE 4IKGA 3I63C 5CX3A 1ZPSA 1ASZA 4A90A 1NR2A 1BT0A 4ZK9B 4X66Q 2I0QA 2AQ2B 1V8QA 4NP5A 1TR5A 4AQYQ 2XVSA 1H9KA 2J4XA 3AEEB 2L11A 4JI4L 1BUVT 3GB1A 4MTNA 4G11A 4YT0B 3NELA 4TMAB 5AFWA 1Y1VH 2KO3A 3TCAA 2E2IB 1Y69U 1K9MC 4QCLA 4XQNA 1FFVA 1EFID 1O78A 4JWSC 1CSPA 5TR5A 3PVLA 3F2DA 4LJZC 2X38A 1ROEA 2V1YA 1N9WA 1WRIA 3EVQA 1STYA 4NJ7A 5JHAA 5FK9C 1UWXA 2R93G 4GKJQ 1S5DD 3K81C 5EGTA 1RIPA 5C5LA 3U9OA 3PO3B 1ZDVA 4A3CH 2L8JA 3SK5A 1WR1A 1JWSD 1L1OA 5IP7G 4HWIB 3A9KB 4MJSA 1ET6A 4JGHB 1NVID 1EY9A 2YTYA 2GI9A 1FXAA 2A6HD 4HMIA 4ZCKA 1XO3A 2V3SA 1FJGQ 4REZA 2F3WA 4U68A 1VR9A 2LASA 5KRUA 1AW7A 2FMMA 4QIWE 1K50A 1KNAA 4DXFA 5C4XH 4HIOA 1H9SB 1Q82C 3Q6SA 3J7A5 2WGSA 3NVVA 3PTFC 5HKHA 2G9HD 1P0RA 1IBML 5GROA 4S0RA 2QCZA 3JAML 3U50C 3G7LA 1QKZA 3VR5A 2JSVX 2Y5PA 4GOPB 3IHPC 1Q46A 5IYDH 4A3FB 2IY1B 3M62B 1LO5D 1F9JA 1GC7A 4HJ9A 1A63A 1HCZA 4LDTB 3SDLC 5IA7A 2Z6KC 4JI5Q 4DR4Q 1X9NA 3RNCC 2WXRA 3DWAA 2MQJA 3Q3MC 5FR3A 5KEEA 4PMWA 2X6GA 1HNZL 3K59A 2MRPA 4IM2A 4FA6A 1RL2A 3NY5A 1QNKA 1BDOA 3MEHA 1XNRQ 2NS5A 4GLAC 1PH1A 5H8YE 3R8BA 4IZ8A 3S1MB 1NYQA 3S1RH 3VTWA 2L3ZA 2IWHA 4IFDJ 3N9YC 1E90A 2JA5B 4B9WA 4DXGA 5GADC 3I7FA 2M19A 4L23A 3SD5A 3L3OC 2NVTB 4UP9A 2WDTB 3AE1B 4P72A 4K6DA 4RMAA 4RA8A 1LLRD 4EQNA 3V6EB 1IBLQ 2PNRC 2RBMA 3DBRB 1K8AC 1T3QA 4FJYA 4A3EB 1YJIA 2AL6A 4WJ4A 3FILB 4A3KH 1XMOQ 1VCBA 4XTCS 3IXSA 2F0EA 1QILA 3BYYB 1ZE3D 3M3JA 4K0KL 3MP9A 3A1QB 2AL3A 1LT5D 1QWYA 2F0IA 3VYUA 1WZ0A 5KYLA 2VUMB 1QZGA 2DYOA 2SAKA 1YJ1A 3KVFB 1VD2A 4EVOA 2EDGA 4DHJD 1STEA 3NP8A 1ZYRD 4HEDA 2ZVNA 3GS2A 4YHHL 3A7LA 5GAEC 2MLBA 4V0BA 3EFCA 1SIFA 3ITPA 3FKYA 4GIVA 1E7VA 1JALA 2D5GA 1S72A 3P4SB 5KGUA 1E1OA 1K83B 1M4VA 4H0LC 3C8YA 4KN4C 4XDXA 5EKIA 4A3BG 2PNHA 4IPCA 2IHEA 5C44H 2E2JB 3L0OA 2B8GA 2JPHA 4ME3A 2LGXA 4KGRA 4B3RQ 3MXUA 1RF2D 3CP0A 3P4PB 4KZ0A 2KHJA 1EQRA 2BW2A 4IUMB 4MACA 2ATWA 5IODA 3DEPA 4XE0A 5AEKB 1ZXTA 2CHBD 3A5UA 3I4NB 4LAAA 2WIIB 3IVFA 2JA7G 5C3EG 3A4RA 3KF6B 1AN8A 3U9SA 2Q2HA 5GAGC 5IGFA 3I55A 1A6XA 2MBBB 1QUQA 3WAPA 1WTWA 2PMZE 3M4YA 2MNAA 2C9WB 2H5XA 1XEEA 3K5OA 2X8XX 3ZIMA 1V97A 4NZLB 1PH4A 3CCLA 3C1EA 2MBEA 2GA4B 4C3JG 1S4ZA 5G2NA 1KIXA 4A3CG 1HNWL 1TIFA 2CJOA 1C78A 4JCVE 1Y8RC 2ACZB 3A55A 4BY7B 2FCNA 4NAMA 3NSWA 5DNFA 3HOUB 4US8A 1R4PB 3VDYA 4BWGB 4P2CB 4RNAA 2VQEQ 1JJCB 1GB1A 2FFKB 3T13A 5GAHC 5JJKA 1P3QU 3BINA 4A3BH 4W9IA 1EIGA 3MXGA 2N7EA 2F03A 4HCPB 2JA5G 2NN6H 1Z2MA 3ZNZB 4DU9A 2RPVA 2WXIA 4K8IA 4CKEA 5C3JB 3Q14C 2DY8A 3T3OA 3VYSA 3PIO3 3K58A 2DNFA 3TEWA 4P1CC 1TZOA 4JI5L 4DV3Q 1P16A 4DR4L 1EO6A 5JAVA 1TT2A 2NVUI 3K5NA 2EYFA 3E6ZX 1A70A 3V60A 1SMXA 4I7ZC 2K50A 1DM0B 3CCMA 3I4LA 1OTCA 4N9F4 3K5LA 2WLBA 2CQAA 3H94A 2PW9A 3P1HA 2B2YC 1QVCA 4YWGG 4DR2L 3NWTA 2PTLA 2LUEA 1AEXA 1EZ6A 4PT5A 2BWFA 5D2MB 5LMNL 4AP4C 2VZKD 2ZJRA 1NYRA 2A19A 4A3KG 2WP8J 5AJ3Q 2WINB 3ECIA 2EYOA 1Q90A 3AQQA 1JWBD 3S1NH 1UD7A 2CHZA 1A3UA 4XIGS 4JV5Q 4ZLTF 3NXWA 1Y1WG 4KZCA 1SYGA 3D4DA 4NXNL 2KMCA 4MSMB 1X55A 3PUVA 1L1OC 3SK4A 4A3FH 3AI5A 1YEZA 3KDFA 1E7UA 1WYWB 3C19A 1BCPD 2EJMA 2PZUA 1FVIA 1B53A 4Y7NH 2N0SB 1VQAA 4XX5A 3WOEA 3HOVH 3VQIA 2A6ED 2BS2B 1L6VA 1HFNA 2M4NA 1WCMB 1IYUA 4DWFA 2BBCA 3ETRA 1PMRA 1SMYD 2R7ZG 1XYIA 1HPCA 1UAPA 2Z9HA 3AEVA 1E8YA 1T0SC 4RGTA 2YTXA 3Q3FA 1TY2A 4K5VA 2B63B 3OG5A 4C7ZA 2QC8A 2LFIA 4GDKB 4F1SA 5EQ0A 3TRZA 2YEPF 4LF6L 2L76A 1SROA 3NZ3A 4DHJB 5MPOA 4MHEA 3JSVB 5G3LD 1IBLL 1CZWA 1FFUA 1I4RA 3M4QA 1C7YA 1MSHA 1NTGA 2XN9C 5D3IB 2OCEA 4FULA 4DNRB 2IX1A 2MSED 3EIVA 2D2QA 3A4SC 4A3IB 2J0MA 1I6HH 2CKZB 2NN6I 2V1CC 1PUTA 1ESRA 1DOIA 4DAYA 3EA6A 3UDFA 5HY6A 2WB1B 2QMTA 2ENBA 3G71A 3ZRFA 2OEOA 4OZAA 3RD2A 2A8VA 1VQIA 4DR7L 3HOWH 2KLCA 2LGYA 5T8IA 4TKNA 2QGQA 1C0AA 3E0EA 4JK1C 3X3NA 2N1VA 3GTQH 4B3RL 3PO2G 3UE1A 1DGJA 1TGZB 2D3AA 4H44C 4KD3A 3N3KB 1TWFH 4P73A 4DV1Q 5G3LF 3RN2A 3PHXB 3VXWA 2D07B 2DZMA 3T53B 4N6EB 2I2YA 2FBWB 1X32A 2XIWA 4WURA 3ZXRA 1R4NB 2I5MX 2MO0A 1JQYD 5J2RA 2RA4A 4L5TA 3DHIC 1B3QA 1CM9A 3RYTA 4X3UA 2AWNA 2CU3A 4AYBG 2DENB 4DV7Q 4UY8C 4YCWA 2ZJPA 4JI3L 1N6ZA 3TN2A 5BYQA 3TP7A 1FRRA 2OWOA 1KRSA 3H9DA 5A35A 2R61A 1ZP0B 4N59A 1RODA 5ELEA 1EQQA 4A3MH 1PTOF 3PRZA 4JBMA 2K5DA 4EZLA 1C1YB 2PVOD 5IAAC 4IFDH 1T5EA 4BBRB 4DK0A 2IY5B 2H89B 2HCIA 1MIUA 2OXPA 4H2AA 1TIID 4DV0L 3AEBB 3HEJA 3Q23A 3IRBA 4XYCA 1LTLA 3J81L 1WGYA 2BYVE 2B29A 2Z4HA 2F52A 1HTOA 4LFBQ 4R1JA 4X3TA 4X62Q 2D62A 2AWTA 2FMCA 2F0PA 3RMHA 2EYHA 3PSEB 3VH3B 2JEAI 1Z6HA 4DNTB 3T16A 4CO7A 4BKSD 3HOZB 2PYKA 1GHKA 1HXYD 1YNXA 3KUDB 1NCVA 2NYZD 3RZDB 3ND9A 5KNDA 4GN4B 3T1YQ 4W9EA 3KLSX 2MP2B 4IDIA 4DKAC 3S17B 3AFQA 3X3MA 5IOCA 2K6QA 2F0MA 1CA5A 4QUFA 1DD2A 4FF4A 4FXKC 2VUMH 1WJ4A 1XCQL 4GXBA 3PT2B 4KKIA 4NAWA 2OTJA 1I94L 3S16B 2K8BA 1SAPA 2JK8A 1MG4A 3P20A 1KDBA 2WXGA 1EYAA 4DR6Q 4PYUA 3SFEB 2EY2A 4QAYA 1P9DU 4IFDI 4CBVA 3DBLI 1F77A 3WA0A 2JYOA 2N49A 1SNDA 4JQWC 3CRLC 2BWES 3ZVVA 1VQOA 1SE4A 3UF8A 5LMNW 5IWAL 4APVA 5JVH3 3QQ8B 3RNGC 1LTRD 4LNQA 2GBMA 2K0PA 2Q5WD 2NWGA 2VZAA 1M1KC 5FO7B 1QJOA 2RMMA 3PRPB 4I6NB 1D4BA 3NENA 4Q5VA 2B2VC 4K81A 1TBEA 4RM8A 3KFUA 1WTXA 1SJHD 2K32A 2WDVB 3PO2B 2KJ6A 1P1AA 1AH9A 4NB3A 1EWIA 3SR1A 4PV1C 5G5GA 4A20A 1MJCA 2J52A 1UF0A 2CS4A 4N8FA 1AFPA 2L12A 1TY0A 4DFAA 4XQJA 2EPBA 1WE7A 3UDGA 4K7UA 2KJXA 5JH5C 1IBXA 4WJPA 2A69D 2UUBQ 3HHMA 4P74A 2HD3A 3U8ZA 4XDDA 5ELFA 3J9CA 3T3NA 2UU9L 1TVXA 4BKTA 4ZQ3A 1QT9A 1F9SA 5KNBA 4KY7A 1VRAB 4QMGA 1V81A 3U7DA 1KM7A 5FJ8H 2MPMA 4NKLA 5C0XI 3W1YA 4KHZA 3H3VC 2ZXOA 3AEFB 2UXBQ 3RZWC 1YNNC 2NBVB 3KLWA 4UDUC 1PRTD 4JPBW 2EYMA 3CCUA 1VQKA 3K5MA 1KXLA 1H4RA 2MBHA 1IYFA 1JMCA 4ACFA 4OONA 5I6WA 3UI2A 1SE2A 4FO2A 2IGDA 3HKZG 1TS3A 4A3BB 1RJTA 2WX1A 4IC7B 1WFQA 3TEYA 1SYCA 1RLFA 4BKSA 4ZOHC 2B3AA 4K2KA 1LUZA 3E3XA 3M95A 4J8QA 2O5JC 1PH5A 4DPGA 1VCIA 3HK0A 1MFWA 3VTVA 3R7QA 1KTKA 1G6JA 4A3JB 2VRRB 4X64L 3NZSA 3K7AB 1STHA 2PCFB 2F0GA 3PV1A 4JPSA 2BE5C 2B2UA 4GKJL 5CV7A 1E5WA 3Q69A 4CJ0B 4W9LA 4HTHA 3PIP3 3CMEA 3GQBA 1P7EA 2PZWA 3BU2A 1FD7D 1WOCA 2INPE 2MO1A 3B9JA 3UE0A 3U4ZA 1EIHA 4BBNC 3MHZA 2X69A 1NI2A 4FXCA 1N60A 4KKSA 1AP0A 1V1PB 1LFDA 1EEID 4X62L 2L55A 2EQSA 2PQAB 2KEEA 1SFOH 2BPSA 3VDZA 4MM3A 1PRTC 1JOOA 5CV4A 1HNXQ 4DV6L 5DPWA 1EY6A 1IKMA 4PS8A 1JQ4A 2OHFA 1E8XA 2Y3AA 3HUIA 1V8CA 3F2UA 4IUUA 4DUYQ 3VH4B 4PZ6A 1AE3A 3KYHC 2I1KA 1KDCA 1WGHA 3NPPA 4A3PA 2WWZA 2R6GA 2ZW0A 1DZ1A 4JI0Q 5CHWA 4X64Q 4YXDB 1GB4A 4KKJA 1KOTA 2A6HC 5DEHA 4ZYNA 4LF8Q 4MNOA 1UE7A 1UBQA 1TWAB 1XXGA 3I3TB 3R2IA 3U2SC 3PO2H 1JWUD 4GDLA 4MT5A 3WCQA 4DK5A 1WYDA 3M4OH 1S1QB 4JI1Q 2HJ8A 4K5WA 2D0OA 1VQNA 1WWTA 3EHVA 3W9CB 2LEKA 1VQGA 2GBJA 4IOAA 2ZCBA 1AARA 1VQFA 2C5LC 4LCDE 4AH6A 4XGAB 2K6AA 1L0VB 2N7DA 2KOXA 4IUTA 2H4OA 1LABA 2O4XA 3FDTA 3K6OA 3IAYA 2OJRA 2HTHA 3WANA 1WJ6A 4ZYSA 1B4OA 4JI8L 5IT9c 1JJ2A 5D14A 1YNJD 2UXDQ 1HR0L 2KAJA 3P42A 4WIPA 3R7RA 4YSZB 3J7AF 2UU9Q 1QVFA 1WVLA 3E9SA 2B2WC 2QCPX 2K28A 3NBIA 2F0QA 3TMEA 1NNXA 1TWHB 5CV9A 3HOWG 2F0FA 2JA9A 1TKEA 2KK8A 2OEDA 1X56A 2PKOA 1U0LA 3CU7A 2JP1A 2J0TD 1S40A 1I7HA 4X65Q 1D2BA 3L54A 5LNK1 3VHTC 3DCGA 3ONAB 3VR6A 1IHZA 1HNZQ 3PF4A 5IP4D 4L63B 3VRBB 1E24A 4JI4Q 1SB3C 2N9EB 1YNJC 2ZJQA 4MM3B 4A75A 4B9XA 4NW2A 5CORA 3QO2A 2R7DA 3GV3A 4HEA1 3DWGC 2B2TC 1PGBA 5KHQA 3N52A 2EIFA 1XTDA 1EQTA 2PQAA 2DHZA 2IZVB 2JVCA 1BF4A 3M4OB 1FD6A 1Y1WH 1BBUA 1J9OA 3GTMB 4FXDA 1P8LA 2K3UA 1T6BX 4IUPA 4K14A 3BWUD 2CKHB 1KNEA 4GZYC 1C79A 2RF4A 2GB1A 1JR0D 3OIQA 4A55A 2JUOA 2NTSA 1PRTB 3RZOB 2P5ZX 3W1SC 1C3TA 1CZGA 4OIKA 3VUWA 2YTVA 3ALBA 4ZHOA 2SNMA 3B1LX 3TJPA 3WDNA 1N61A 4X3SA 1XPUA 2BS4B 2L0FA 4A3MG 3EC8A 1WXAA 5HURA 1D7QA 1YQBA 2BB5A 2CHWA 1WZ3A 3OWEB 5NUCA 2KFKB 1S5FD 2M00A 5E6NA 4GDLB 4BBSB 4LF4Q 3S14H 2KMMA 4ITKA 2W82A 3DBLB 3RNAC 1HZ9A 3HP3A 1WD0A 4U673 1CKOA 2F3VA 1TWFB 3B6YA 3LGJA 1I4QA 1ONLA 5ELCA 1KRTA 5LMNQ 1JMLA 3L08A 1L2NA 1GUOA 3HOVG 5BMIA 2Y0SG 1L5PA 3KLRA 1KDAA 2ZM6L 4Q0FA 2UUAQ 3C1FA 1F9RA 1D3ZA 4JW0A 3CCEA 3RN5A 3PZDA 4R4CA 4LF5L 2AKWB 4N8X1 1KJTA 2KDIA 2KQ4X 1TWCB 2IO2B 5DM73 1PHJA 4LWCA 2ZCCA 4GLXA 2ZJDA 3AMZA 3OPOA 1FYCA 2UXCQ 2XNAC 3VYRA 2KC1A 2MW5A 1WRDB 2K4KA 1PH3A 3K7AH 1WIAA 4EQPA 3R3MA 4MN3A 3W2DA 1V1PA 5ELDA 2N9PC 1MSGA 1JT8A 2EKEC 4ZKCB 1UUPA 1U4RA 2BDNA 1EUVB 1SE9A 4OWTB 3Q8DA 1PVOA 2KVMA 3IFTA 5JJZA 1WI0A 3ZJYC 5I2YA 2VQEL 2JA6B 4Y52H 2MH7A 2D3GA 1UWMA 1EUJA 3RT3B 1B2TA 4ODGA 4F88A 3E56A 1EIFA 2QILA 3CQZB 1LM0A 4E3CA 1WTRA 3BY4B 3QOJA 1YN5A 2EJFC 2RHQB 3CMAA 2Q2UA 1SGHA 4NJ6A 2JT4B 2KTFA 3SK6A 1D1IA 4DR2Q 1UELA 3A33B 3NS1A 3H7PA 4RHRA 2RGFA 2KTRB 3A9JB 3N1YC 4W9DA 2O5IC 1LTAD 1CHPD 3DM3A 2ALYB 1U4MA 2LMCB 2K52A 3F1ZA 3O13A 4J15A 5KNCA 3H15A 4ANXA 2KC2A 2WXKA 3KJOA 3G6EA 1LV9A 1OTRB 2JSOA 1F0ZA 1SSOA 4II3B 4K2LA 1G2SA 1ZW7A 5EDSA 4L1BA 1E8WA 1H9RA 3PUWA 2IHFA 2G3QB 4JBWA 1E10A 2DYMA 4J6HA 5I2XA 2B76B 3DWMA 5IYCH 3WAOA 4N9PA 5JOBA 2HT1A 2KD0A 2JWUA 1R9TB 1H9JA 4QF4A 1CKNB 1PH8A 4G3XB 2RDHA 1B50A 1WI5A 3I4MH 4B3MQ 3DHHC 2CW0C 2RSNA 1QG7A 4KHVA 2O2VB 5J17A 1VQCA 1GUGA 4PZ7A 1XNQQ 2XRSD 3RR5A 2RDBC 1RD9D 1D5XC 1RYJA 4BBSG 3N20C 1VZ7A 3SK8A 5BMGA 4XZ4A 3TIXA 2LFNA 1XJVA 1N63A 4JC0A 3W1GA 1X1MA 1PGXA 3VFKA 2ZVOA 4WRDA 2MEKA 2N1WA 4WFN3 1STGA 3CXCA 1MD2D 3GTGH 3NBHA 2SEBD 3GTPB 1WFYA 2DLBA 3JAMi 5DCNA 4ANWA 5EE3A 1ZXHA 3V2TA 3GTLB 2XEWA 3NUCA 4GSWA 4R4QA 2LUMA 2O6VA 2Z6KA 1UEBA 4R4IA 3FKIH 2QJLA 3NUHB 1EY4A 1J8IA 3BK1A 1E0BA 5DAUA 2Z1CA 5C6AA 1PFBA 1FXIA 3DBSA 3S2AA 4B3SL 4BAXA 2CHXA 4HCEA 4P1BC 4LF7L 1XMQQ 4LFAL 3QWZB 4OO1H 1HE8A 4HMJA 1I50B 4FHJA 2DAFA 2FUG1 3MHSD 2MJDA 1TS4A 1LTID 5D3DA 2JEBI 1TJEA 2FIFA 4C4VB 1DOYA 3NHHA 4R9WA 3Q0AA 3MFYA 2K01A 1L7YA 2FUHB 1X54A 4OIJA 3T56B 2O6VB 1Y8OB 3NVYA 3AE4B 4DAPA 3V6CB 4XWTA 1S5ED 3BS1A 2KQ7A 1PH9A 2KECA 1KLUD 4IM3A 5JXVA 3F2CA 3N6RA 5CHVC 4JYAQ 3FAHA 2WQYB 2Y5CA 2JU6X 4GNXC 2UUAL 3GTOH 2VNUD 1TXYA 3F2BA 2JZPA 3LWEA 4DV1L 3WOFA 4UAIA 5JJLA 3HOYB 3KUPA 2NMQA 2B39A 4G7ZC 1KLVA 1Y1VG 2O2VA 1OEYJ 1B44D 1CI3M 3RPFC 3NWSA 1F9PA 1QOFA 4EZKA 5FLMG 2F4VQ 2CWAA 2LHEA 1I35A 2LS01 1KABA 4RGOS 1ZEQX 1G6PA 2I07B 1YJWA 3JSVA 4JI6L 2NVTH 2GBNA 3DPDA 2VH1A 5AJ3L 4HJ5A 3M7NA 1AE2A 4NXML 3VUXA 1SLJA 2Z8LA 2KANA 1VJKA 3GTQB 4WH4A 4WJOA 5AUKA 2A68C 1WM2A 1G291 1W6KA 1SBBB 3EBEA 1SIJA 3CCQA 1C77A 3B08A 3I9V1 2MUYA 2ZTDA 4ZRJA 4DBGA 5IP9H 1YOVB 5FLXE 1OQYA 2EYPA 2N7JA 2CH4W 3DXJC 2JYEA 2RCFA 3OYYA 2G45B 2WXLA 5HGQA 3APDA 4GNXA 5IIFA 3BDOA 2KACA 4HR7B 3QK0A 2V3PA 3KDFB 1X3QA 4KGSA 2XK5A 2YYZA 3CC4A 3KOJA 3NRZA 1XWEA 1IUEA 2DGYA 2DN8A 2WXJA 3ZRCA 3ICEA 3NVWA 2EE1A 1EF5A 1V49A 1HTQA 3ML9A 3V62A 2BS3B 1C9OA 1V86A 1KL9A 1PA6A 2L9HA 5E7NA 3AE9B 2NVQB 2EY1A 2AUJD 3M63B 1PXUA 4P75A 4E71A 3MHBA 1CT1D 4WJWA 4WJ3M 1PFMA 5COYA 4KDLB 2IYDB 3ZXVA 2HE7A 4KI0A 2B2YA 3W3AA 3NTHA 1BCPF 4IJLA 4V190 4JL9A 1YMHE 4GN1A 1XQQA 4OW0A 5CHFA 1PFSA 3BVMA 5LMUL 2C5CA 4OO1G 3RUZA 4CDEC 5CV6A 2NTTA 3HOWB 2KCNA 1I6VC 1X65A 3BDCA 3L16A 1EQVA 4DV5L 2K14A 4P71A 3PF5A 1K0SA 2KCMA 3RLOA 4ALPA 4KJNA 5JEAJ 1M94A 3FRPB 3CAMA 1GC6A 5L83A 1I4PA 1N36Q 4X57B 3NG0A 4ULLA 4RGMA 1CA6A 4B3TQ 1L6UA 3CF6E 2KWUB 2RQXA 1KF6B 3HM3A 4BY1G 1UE6A 2JQOA 1JORA 3AU7A 3BYTB 4ZUJA 4ME5A 2TSSA 1VF7A 4KHPL 5JHBA 1GKHA 1TT5B 4WWMA 3RNFC 3PUXA 3SGIA 5A2QE 2Z0EB 4CYEA 4F7ZA 1UH6A 2KDMA 4FF1A 3J80c 3VRAB 3AN1A 3A74A 1HA6A 1SNCA 2Q2IA 1Q81C 5IYBH 4G0NB 4ARCA 3MJ5A 4M8AA 3DWQA 1NSNS 4W9HA 3OMGA 3GTMH 3I4MG 5FO8B 3H91A 1N32L 1B3AA 3GTPH 3GTGB 2FAZA 2WXNA 1BMLC 3A5ZB 4A3MB 2F4VL 2SNSA 5M3MB 1C8CA 1D1KA 1N5XA 4GB9A 3VR8B 1YIWA 2JA6H 2VL6A 1NBFC 1E22A 1A3VA 4S3SA 3ZYYX 4MIUA 3ULPA 1KFYB 3SVMA 2NVYB 2GVBA 2DBYA 5IGEA 1IZ6A 3VYTA 3MZ5A 4POGA 4BBSH 1IW7D 2XK5B 3MEFA 3ZDTA 1HJPA 1HH2P 1RKNA 2F0WA 4YCUA 5ELOA 3HOUG 2LRUA 2M0XA 4HJAA 2KWDA 2PO4A 1I94Q 1LACA 2GLSA 3EFUA 2BTEA 1VF5C 1TWHH 1C4CA 4NPNA 2SDFA 2AWOA 4RAUC 4MELA 3RUIB 1K8RB 4TUUA 1KC8C 2JE6I 1VDVA 3NK9A 3M3YB 1Y56A 4MGZE 1N5WA 4M02A 2N78A 1YJ9A 2GMIC 2NZHA 3ULJA 2F0DA 2KT7A 5AUIA 1IPGA 4A3OA 2AQ3B 2ID0A 4PQXA 4DV6Q 3N1ZC 4PYZA 1TS2A 2CU1A 4F7XA 1SNPA 1VZ8A 3A1QA 3RMKC 1XNRL 1CFMA 4A3JH 4JVZA 2AYOB 2L0TA 3E9IA 2PPBC 4PMBA 1P7FA 3PIPA 2C7MB 3IL8A 2Q8TA 2MJ3A 1Q1BA 4LFCQ 4WWPA 2LKVA 3HG9A 3I73A 1EU3A 1SXTA 2A69C 5IE8A 4CDCC 2JA8G 2KMAA 2L52A 1QUQB 3J80L 2B8FA 2WXPA 4RF0A 4PZ8A 1V5TA 2N8NA 1JROA 1WF9A 3PLUA 3FVQA 4HAEA 1MHXA 2LVQA 4AIMA 2J7ZA 3VR2A 2KHIA 1O7ZA 1YD8U 2KDBA 2V4IB 4TQ1A 1U4LA 5IO9A 1F52A 1IKLA 2R92H 4A3DG 1MHHE 1NJIC 2KZRA 2ZTCA 2HUGA 2A1AA 1FL0A 4PMCA 1XPOA 1STAA 1FJGL 3Q24A 4DNIA 3HOXH 2RDFA 1RCVD 4I6LB 3J81c 1Q12A 3ZQ4A 2KDEB 4A3IH 1Q8IA 3DVGX 3IAM1 4RMFA 3AB9A 3TP5A 4PG3A 2QKIC 4IOIE 4K7WA 1GUWA 1PFDA 1A2UA 5L37A 3EQLC 3M85A 1QOGA 1E2ZA 4MGYE 4C4VA 1GNUA 1JW9D 4N9TA 2KX0A 4JI0L 1ZDXA 2FCMA 3JAME 2KX3A 1RWSA 2LVOA 4GOPA 3H0GH 2Z59B 3I4MB 3ZW3A 4RWSC 3RLFA 1K3BC 4US9A 4ZRZA 2EY5A 1K3RA 1R9TH 2CJNA 2C7HA 4GN3B 2MX2A 3CKIB 4CDFC 4L5RC 1PTOH 3SE0A 2UUCL 2DYBA 1B9MA 5I9OA 3HFZB 1OXVA 3HGBA 1WH3A 1WCMH 1UNSA 1QOBA 4K6LA 5IP9G 4TQUS 3IFDA 3OWFA 3QJYA 3NBHB 3TP6A 1C4PA 1DOXA 1GJZA 3P7JA 4C7YA 4L5QA 1JWAD 4TRDA 5M5WH 1HTPA 2KVRA 2W55A 4FJVB 4ANVA 4KIKA 2ZTEA 3ULLA 2M2LA 4A8XC 3A56A 1Q5WB 1KH0A 4JI3Q 3S15B 1EYDA 3T4AC 4C3HG 5G5HA 2GVAA 2K1BA 1STNA 3E9HA 1YNTE 4W9GA 1WX9A 3U30A 2NBUA 3QIAA 2LXAA 3GTKH 3SHQA 3SEBA 3HIZA 5AZHA 2HCCA 1S3OA 3DMUA 3TEHB 1L0YB 1A15A 3Q3NC 2CH4A 1W2BA 2QSDA 3HOZH 3MWYW 4IM0A 1JC7A 4LK0M 3VR9B 4FADA 1FGBD 2A73B 3BIID 4L5SA 3AU5A 3CD6A 3CCSA 4Z9CB 4O2DA 1I42A 4DR1Q 1UWVA 1UEAB 1IW7C 3S14B 1NUCA 4JWUC 1AZPA 3L4PA 3RULA 3OW7A 1EWHA 2IGGA 2G9DA 3P75A 2NVXH 2KYWA 2K22A 4JV5L 4XDCA 3TDQA 2B2TA 2DAJA 3VAWA 3TSSA 1O80A 2K05A 2ZM6Q 1F2RI 2WACA 4QIWB 2LRWA 1WSPA 2K39A 3K80C 4R8IA 3OLMD 3HOYG 2JY6A 2KXJA 1Y1VB 2PEAA 3W5OA 3K9PB 1XLNA 5EPJA 4MJSB 4H7BA 2R2OA 2ZPYA 2DZJA 3QARA 5M3FG 5K36G 5C0XJ 4BFRA 2ZNVC 1WM3A 5C4JH 2QF7A 2E2HB 1MI2A 4URKA 1RRBA 3EROA 2OTLA 1WMHB 1F9QA 1IBKL 3L17A 3O65B 2JZ3B 4QY7A 4OVVA 4MTKA 4LF6Q 1WE6A 2EELA 1WTPA 2R7FA 5CC4A 2ONQA 3X0WA 1PYSB 2UWQA 3I70A 3HOZG 2BGFA 3CIRB 2K7VA 1LT4D 3QX1A 5M5WB 2E2HH 3DM1A 1F2MA 3ZKJC 2V0GA 4GOPC 1DGSA 1X6OA 1DONA 2C7NB 4X6AH 2PE9A 1HQRD 3DBHI 1W3SA 1CMXB 4K5XA 3U4VA 1IBMQ 4NAWB 4JI1L 5EPLA 5DPSA 5T1GA 2RSUA 1SDFA 2B2UC 3L13A 4RM9A 3RLNA 3CW2C 1VQHA 3ZJUA 3H7SA 1JICA 2MP2A 2ICEC 3NTIA 2W54A 4J3OD 1QZEA 3KF8B 1WGRA 1J7BA 2IBIB 4A3EH 4YTNB 4PK1A 1MG8A 3AEAB 3PIOA 1PRTF 3TS2A 1DXMA 4OELB 1YJJA 1QNUA 3HS0C 1SEBD 4JG2A 4YCVA 1MPEA 1PYWD 4IWQA 5J3BA 2E75C 3DQVA 2KFKA 1BQQT 5JZEB 4RHSA 4IUNA 4C3HB 2EVBA 3LNNA 2QEXA 2HHHL 2V4LA 4NQKE 3ZJVA 3S1MH 1TKGA 3PRMB 1SF0A 4WQMA 4KJOA 1VQLA 3STBD 2WP9B 3UIOB 5HFYA 1CHQD 2LXJA 2JN4A 2WNMA 3T9LA 1MVKA 4OZCA 2LHDA 1KAWA 3SFDB 4HN7A 2JQRB 2RD0A 1EL0A 3CPWA 4JI7L 2F0JA 4KMUC 2M0AA 2KOLA 4NJCA 2PLPA 1K83H 1A8VA 5IWAQ 1IYVA 2RDGA 4A3KB 4IQZA 2N9KA 1VQEA 4HK2A 1DJRD 5M5YB 4H02A 3DHQA 2KN4A 2JXXA 2FJ2A 4LF7Q 4JIOU 4FF2A 3BZCA 1VMCA 5IY0A 2L5TA 2YU9H 4BY1B 1OFFA 1WGDA 3N30A 1LGRA 1FPYA 4MH0E 5AZGA 3KH0A 4LJPB 1QLBB 3ABVB 1SFOB 2BA1A 2DJFC 1JE4A 5E3FA 4XQQA 4K1RB 3TMPB 3ZNHB 1E7ZA 3PO3G 3APCA 4I65A 3QIJA 1SYEA 4DR1L 1WJUA 1FNVA 3CSFA 1VZ6A 3S17H 4H13C 2D11A 1V1OA 1G51A 3LYYA 1GUAB 5HG2A 3S24A 4K0KQ 4ANUA 5M3MG 4W9CA 4II2B 5C44B 1ENFA 2BKRB 3UDIA 1VQ6A 2LXKA 4W9FA 3FMCA 4EEWA 3K0XA 4HJ7A 2LXCA 4F8MA 2JA5H 4JI2L 1YHAA 2BQQA 5CMDA 4DV0Q 1HZ6A 3A54A 4GKKQ 4B0EA 3L10B 2AUKA 3LXFA 4QL5A 1R4MB 1UGJA 3WALA 3CSTA 4CQNA 4RH6A 2BH2A 1Y14B 2B63H 3A7AB 1YX5B 1HZ5A 1OXTA 2I38A 3KJPA 4FLHA 3OSOA 5K5PA 1EYGA 2VXWA 1N33Q 2QDFA 4GDKA 3CPFA 4YWMA 5GMVA 3QA8A 2NVYH 3FKIB 2C35B 4M00A 5HI1A 3DBHB 3D0FA 3FPUB 4FYDA 3S2HB 1SE8A 3GTLH 1VQMA 2XBBC 3WIMA 2CQOA 4OXPA 4YWLA 4DV3L 2EJGC 3MAQA 4LK1C 2A4ZA 2JF5A 4KVGB 2DJGC 2MHJA 4BZAA 3ZJTA 5M5XB 1PZKD 2D9UA 3V96A 2RSOA 2XWBB 1J19A 1ENAA 1ZOYB 4HSVA 4X3KA 1NAPA 2B2VA 3C3LA 1ESFA 5FLXc 1E0ZA 3T1HQ 4LNKA 1WTOA 3HOXG 2F0UA 2EZVA 1IYJB 1M8AA 3PV0A 4EQOA 2HHHQ 3G48A 3I57A 4HVBA 1YQ3B 4O42A 1LTGD 4IPGA 3F8TA 1F2LA 3KLSA 1YITA 4AYBB 4JYAL 1XF5L 3LJ3A 4JLCA 2NUCA 1B9RA 2BH8A 1G91A 4OHJA 5CV5A 1UBIA 4I6PA 1PZID 4KKTA 4E74A 3GZNB 5J39A 5BN5A 2E2JH 4MSQB 1PH6A 2D3CA 4C2MH 1K53A 3DVGY 2L1BA 1VQ4A 1LQBA 3EUB2 4FBJB 5I6YA 4AJWA 3GP7A 5GXGB 2LY7A 2REXA 1B1ZA 1N33L 3S15H 1PV4A 3AFPA 2E2IH 5C3XA 2W9NA 1II3A 1C9FA 2G4DB 5C4XG 4LFBL 4POFA 4F8CB
chains in the Genus database with same CATH topology
5C3WA 1EY7A 1HUMA 2PMVA 2MJ8A 5C0XG 4AS1A 4FVMA 2INNE 3NVZA 5JPMC 1XCTL 3E5SA 3IT4B 2PVGC 3D6WA 3Q8EA 1J7CA 5BN4A 2E74C 1LT3D 4EE2A 4A3GB 2VB2X 4HJGE 4RGNA 5EPKA 3OHXC 4C1NI 4CHTB 1K52A 3AH7A 3GD7A 5E4WC 1CJEA 1GHJA 3TZUA 3HZXA 2K03A 3R93A 1YNND 3AE8B 2EYJA 4A9AA 3A8JE 2BT6A 1E2VA 2E6XA 2WKCA 3ND8A 1YN3A 1CTMA 2B2WA 1SMYC 2BDOA 1L0XB 4DA2A 4IALA 1ET9A 1FNUA 1WYGA 1WXQA 4Q2JA 1DYQA 2NBFA 1QF6A 2BE5D 2F0OA 2O2LD 3OOCA 2WV6D 5E6JA 2R93B 3HKZB 1A3TA 4XXEA 4J1MA 3BK2A 1E2WA 1O7YA 2A5HA 1RHPA 1SNMA 1ILPA 4BS9A 3TZDA 1E9MA 1F2RC 2MGSA 3R2TA 1WD1A 2X6LA 1U4PA 2D2CC 2PIAA 2NZ1D 2R7ZB 5I9PA 3PUYA 2KUMA 1HUNA 2AQ1B 2K9XA 1ENCA 1I3QB 1R7SA 1PZJD 1FM0D 5HGTA 3SR6A 3J80E 4ZRQA 2L0CA 4TSSA 2JXTA 3P4QB 2JXMB 5H92C 1YN4A 2JX5A 1K8OA 3FC4A 1FRDA 2ZT9C 1OXSC 4CJ1B 1SYFA 4LMQD 2A6EC 4ZRPA 3BVZA 4BA1I 4FP5D 5CBEE 2DNEA 1GOZA 3QOLA 5JVG3 2FHTA 1RTOA 3PZ7A 1GUNA 1H9MA 5LL6X 1DCZA 2QEJC 1K51A 1OQRA 4KY6A 2WU2B 1PLFA 4PNYA 4C2MB 3EGRA 3D6CA 5BMHA 1PDXA 2AX5A 2E76C 2VZKB 3H09A 2K5QA 3D3RA 4KX6B 2Z4IA 4LLGM 2VB3X 4TQ0A 2WXHA 1BXTA 5KYIA 2N55A 2MJEA 3DUZA 1ZYRC 1Z47A 1EM7A 1T5XD 3Q8AA 4IUVA 1E7PB 1G2TA 4DF7A 4QUCA 4P16A 1A2TA 1I4HA 1ML0D 3H6MA 3QG1A 2HQEA 2K5WA 5A2QL 4FF3A 1MGSA 1Y8PB 1F2ZA 3AEDB 1SE3A 1JCKB 2JA7B 4RCNA 5T1IA 2F0HA 2WS3B 3ERQA 1FO4A 2F4IA 2MHVA 4E6IA 2TMPA 3KK7A 4JX1C 2MP1A 2WDRB 3VA5A 4IURA 5J1ZA 3W1SA 1EOTA 1IGDA 1J7AA 4M0WA 2JYTA 1K8MA 2WXQA 5K36H 3VR3A 4P6VF 4KGTA 2F0NA 1HEZE 3D31A 1HRJA 1Q10A 3S1RB 2NB0A 2V3NA 1DOKA 2EYLA 2R92B 2KHSA 4OL7A 5F2DA 3TEXA 1LT6D 4XYQA 2I46A 3HOXB 2FINB 3LB8C 1TYGB 2LGIA 4RCOA 2Y0SB 3T51B 1XTCD 1QE6A 1SNOA 3AB5A 3BG3A 5IGBA 1QOHA 1VLBA 4AQ7A 2L83A 2BCOA 3NQIA 1NEKB 1SSNA 1EEFD 1OO9B 3U7ZA 5CGKA 4C80A 3KWLA 3HVDA 5EE0A 3SDZA 3V05A 2LMCA 3AE2B 3P63A 1IBXB 3U4EG 4C56C 1G6ZA 1EYCA 1QOAA 2M56B 1JWMD 3KWVA 3R3OA 3FEWX 1ZUD2 4F87A 3U52E 4ID6A 1OXUA 1EY8A 1DOMA 4O1NA 1FIQA 3RD4A 1PDQA 1JRPA 4C3IG 3OIPA 3GTKB 1C4AA 3EFXD 4HKQA 4ARIA 3BDLA 4KK7A 1FNWA 1IGCA 2RKSA 1O7LA 4IUQA 2K5PA 1BNZA 3IT6B 2D5DA 3S1QB 5ELBA 2WU5B 1GUSA 4EGVA 5EE1A 2J42A 2IX0A 1STBA 4TKOB 2RVLA 5FLXL 1EU4A 1XLQA 5DM63 3MFGA 4GLSC 4B08A 5M9OA 5C0XH 5C4JB 5JEAH 5C2TB 2G1EA 1VDZA 3GTJB 4XT3B 3OMCA 2F0LA 3J7YW 1KRHA 2DWQA 3I72A 1BCPC 5LHY1 5BN3A 5TSSA 1C4QA 3I8ZA 4CKCA 2PW7A 2KA7A 3MTSA 3TEZA 4Y7NB 2C9OA 1NENB 4ZUIA 1ILQA 1XLOA 4KV6A 5E4XA 3VA7A 1HFGA 2H88B 5FOBB 4LTUA 2IW3A 1EY0A 3AEGB 5D7GA 5J22A 4CJ2C 3Q8FA 3PZ8A 1MBYA 1Q3LA 2K33A 1Z7TA 2JA8B 4HSPA 5FO9B 4B0MA 1RDPD 4C3IB 3Q8BA 4CKBA 1G8ZD 3DEOA 5HHDG 1IL8A 4A3DB 4A93B 3AE5B 3W5VB 4XT1B 1NI3A 1EWCA 1R4QB 3C2PA 4FXGC 2EXZA 5I4DA 1CQVA 1EWYC 2KCCA 1QCBD 3QWNA 3IAS1 3H8HA 5EJWA 4G4KA 3TUOA 1ZKOA 5EBCA 1XLPA 3Q22A 2IT1A 2A74C 3AECB 2F0TA 4KN7C 2BYTA 1TKWB 2KEDA 2EKIA 5D65A 3GV6A 1SYBA 3IKJA 1JOQA 2F0KA 4XYOA 3FPPA 3L7ZC 3NQTA 4MH8A 4L2YA 3HOVB 1U9RA 1RTNA 4RFBA 1F2YA 3AM9A 2N88A 2NVXB 2IX3A 3P1MA 1HTLD 2K04A 1PFNA 1S5CD 3CRKC 2H1EA 3QB3A 2WAQB 4DK1A 2L1AA 1WGKA 3MXNA 1L4ZB 1AYFA 2Q8IB 2E2DC 1L4DB 3CWIA 2PQEA 1I6HB 2F0SA 1FMAD 2IGHA 3MC0B 2CW0D 2WKDA 2YEPB 3S9WA 4DAVA 4KKUA 2FE8A 3K57A 1LTBD 5ISRA 3RFZB 4ILWA 4USAA 1PTOC 1TQOA 1TU2B 4ZAIA 5IGGA 2N9LA 1FCLA 5CYUA 4KY5A 5M3FB 4OZBA 2HDMA 2WXFA 4ZKBB 1C76A 3GTOB 2M9VA 3H0GB 2PZTA 1WTVA 3GO5A 1SNQA 1PTOD 2HDLA 3TP8A 2QIEB 3Q8CA 2HDEA 1D6EC 2DNCA 4G7OC 1EY5A 1LTTD 3KBXA 3LX0A 5C4HA 2OF1A 4DGZA 2EY6A 1EZ8A 1ACCA 1C48A 2F0VA 1KLGD 4FNFA 4G7HC 2CVRA 5KIXA 3UI3A 4C1NK 4JE3B 5JPNC 2OT2A 3E0JA 1D5ZC 2BA0A 5JEAG 3P4RB 5IT9L 1GUTA 5EKKA 3ZGZA 2PW5A 4KTAA 1HHVA 4N58A 4HCSA 3KBGA 4XWWA 2W3RA 1QB5D 1N62A 1GXDC 1BBXC 1FCCC 3A8IE 1RFKA 1I4GA 3PMFA 2IDYA 1GJXA 1E6EB 3LWUA 5C4ZA 4YTPB 1XX8A 3D4WA 3V3XA 3B2GA 1TS5A 5BYSA 3FILA 2PMZB 1BUIC 1CQFA 2NN6G 3AV8A 1PTOB 3NE5B 4YSYB 1BR9A 2R3ZA 1OQQA 2QDBA 1V43A 1DOLA 3SXHA 3HVZA 3L9AX 3MVVA 4KD4A 1W6JA 3SHLA 4ABNA 3TBIB 3DWPA 4OVZA 3I91A 5IGCA 4CGYB 1SYDA 5C3EB 4YIJA 1Q1EA 2BB6A 5EBDA 5CBAE 4M1UB 3J81E 1H9SA 1MI0A 3C46A 1CZPA 1PGAA 2WDQB 3MXPA 4RF1A 2XRQD 4C3JB 5BYRA 2WXOA 4IFDG 1WTQA 3AE7B 1OXXK 4DN4M 1BOSA 2IJ0A 2SOBA 4K8JA 2ZXRA 3M7GA 2GRIA 1JOKA 4QB4A 2ZXPA 1NR4A 1FR3A 1HA5A 4R3DA 4RKLA 3HRZC 3I3CA 3B2FA 4BA2I 1SJED 2IL8A 4HROA 1QQRA 1BCPB 5CR3A 3J7AV 3S2DB 4IN3A 2L4NA 5IGDA 4YSXB 4RKBA 2XSCA 1RM6C 3AE3B 1TKYA 2J53A 2KQ3A 2F1MA 1GAQB 1ZXIA 1I4XA 1D5MC 1KAAA 3PUZA 4DQOC 2HTME 1LTSD 4WAFA 1YQ4B 3D8GA 1Y1WB 5FKAC 2V4DA 3KF8A 4G57A 3K0YA 3BZDB 4HRSA 5C4XB 2ON8A 4YTMB 1GPXA 1HQMC 2BOSA 3AMUA 2W3SA 1VMPA 4OGQC 3AE6B 5C5MA 1ICWA 2IPKD 2Q8RE 1JB3A 4NMZA 5EE9A 5E1FA 1S5BD 2L32A 3VR4A 3BVGA 2WXMA 1Y8NB 5IT9E 3NTKA 4A6QA 1CK1A 4L6TB 3I90A 4ZHPA 3A8KE 3PO0A 2ZW1A 2YU9B 4OO1I 1AZQA 3KQ4A 1FEHA 2A68D 2LJIA 2ICIA 4WORA 1B9NA 4D2KA 1TWGB 4R8NA 3HRDD 1AWDA 3EJIA 2EOTA 3URYA 5EKLA 3S1NB 3CHBD 5CV8A 3G6JB 2XWJB 4NDXA 3D4RA 2E3TA 3MA2B 4L8JA 3W5UB 1X3PA 1BO0A 2DY7A 5LL6S 4HKZE 4IKGA 1ZPSA 4A90A 1NR2A 4ZK9B 2AQ2B 1V8QA 4NP5A 1TR5A 2XVSA 1H9KA 2J4XA 3AEEB 2L11A 1BUVT 3GB1A 4YT0B 4TMAB 5AFWA 2E2IB 1Y69U 4QCLA 4XQNA 1FFVA 1EFID 1O78A 4JWSC 4LJZC 2X38A 1ROEA 1WRIA 3EVQA 1STYA 5FK9C 1UWXA 3U9OA 1S5DD 5EGTA 5C5LA 3PO3B 1ZDVA 3SK5A 1JWSD 1ET6A 1NVID 1EY9A 2GI9A 1FXAA 2A6HD 4HMIA 1XO3A 4REZA 2F3WA 4U68A 1VR9A 5KRUA 1AW7A 2FMMA 1K50A 1KNAA 4DXFA 1H9SB 3NVVA 3Q6SA 2G9HD 3JAML 2Y5PA 3G7LA 1QKZA 3VR5A 2JSVX 4A3FB 1LO5D 1HCZA 2WXRA 3DWAA 5FR3A 5KEEA 4PMWA 2X6GA 3K59A 1QNKA 1BDOA 3MEHA 5H8YE 3R8BA 4IZ8A 3S1MB 1NYQA 2IWHA 4IFDJ 3N9YC 2JA5B 4B9WA 4DXGA 2M19A 4L23A 3L3OC 2NVTB 3AE1B 4K6DA 4RA8A 1LLRD 4EQNA 2PNRC 2RBMA 1T3QA 4A3EB 1YJIA 3FILB 3IXSA 4XTCS 2F0EA 1QILA 3BYYB 1ZE3D 3MP9A 1LT5D 1QWYA 2F0IA 3VYUA 5KYLA 2VUMB 2DYOA 2SAKA 4EVOA 2EDGA 1STEA 3NP8A 1ZYRD 4HEDA 3GS2A 3A7LA 4V0BA 3ITPA 1JALA 2D5GA 3P4SB 5KGUA 1M4VA 1K83B 4H0LC 3C8YA 4KN4C 4XDXA 5EKIA 2E2JB 2B8GA 4KGRA 3MXUA 1RF2D 3P4PB 4MACA 2BW2A 5IODA 3DEPA 4XE0A 1ZXTA 2CHBD 3I4NB 4LAAA 2WIIB 1AN8A 3U9SA 5IGFA 1A6XA 1WTWA 3M4YA 1XEEA 3K5OA 1V97A 4NZLB 3C1EA 2GA4B 4C3JG 1S4ZA 2CJOA 1C78A 2ACZB 3A55A 4BY7B 4NAMA 3NSWA 5DNFA 3HOUB 4US8A 1R4PB 4RNAA 4BWGB 4P2CB 1GB1A 2FFKB 3T13A 1EIGA 3MXGA 2F03A 2NN6H 4DU9A 2RPVA 2WXIA 4K8IA 4CKEA 5C3JB 2DY8A 3T3OA 3VYSA 3PIO3 3K58A 3TEWA 1TZOA 5JAVA 1TT2A 3K5NA 2EYFA 3E6ZX 1A70A 4I7ZC 1DM0B 3I4LA 3K5LA 2WLBA 2CQAA 3H94A 2PW9A 3P1HA 2B2YC 4YWGG 3NWTA 2PTLA 1AEXA 1EZ6A 4PT5A 2VZKD 1NYRA 2WP8J 2WINB 2EYOA 1Q90A 1JWBD 1A3UA 4XIGS 4ZLTF 3NXWA 1SYGA 3D4DA 3PUVA 3SK4A 1BCPD 2EJMA 2PZUA 1B53A 2N0SB 3WOEA 3VQIA 2A6ED 2BS2B 1L6VA 1HFNA 1WCMB 1IYUA 2BBCA 3ETRA 1PMRA 1SMYD 1XYIA 1HPCA 1UAPA 4RGTA 1TY2A 4K5VA 2B63B 2LFIA 4GDKB 5EQ0A 2YEPF 3NZ3A 5MPOA 4MHEA 5G3LD 1CZWA 1FFUA 1I4RA 1MSHA 2XN9C 5D3IB 4DNRB 2IX1A 4A3IB 1PUTA 2NN6I 1ESRA 1DOIA 4DAYA 3EA6A 2WB1B 2QMTA 2ENBA 2OEOA 4OZAA 5T8IA 4JK1C 3X3NA 1DGJA 4H44C 4KD3A 5G3LF 3T53B 4N6EB 2I2YA 2FBWB 1X32A 2XIWA 4WURA 1JQYD 2RA4A 1CM9A 4X3UA 2AWNA 2CU3A 5BYQA 3TN2A 3TP7A 1FRRA 5A35A 2R61A 1ZP0B 4N59A 1RODA 5ELEA 1PTOF 2K5DA 2PVOD 4IFDH 1T5EA 4BBRB 4DK0A 2H89B 2HCIA 4H2AA 2OXPA 1TIID 3AEBB 3HEJA 3Q23A 3J81L 2Z4HA 4X3TA 2D62A 2FMCA 2F0PA 3RMHA 2EYHA 2JEAI 1Z6HA 4DNTB 3T16A 3HOZB 2PYKA 1GHKA 1HXYD 1NCVA 2NYZD 3RZDB 3ND9A 5KNDA 3KLSX 4IDIA 3S17B 3X3MA 5IOCA 2F0MA 1CA5A 4QUFA 1DD2A 4FF4A 4FXKC 1XCQL 4KKIA 3S16B 1SAPA 3P20A 1KDBA 2WXGA 1EYAA 3SFEB 2EY2A 4IFDI 4CBVA 1F77A 2JYOA 1SNDA 3CRLC 1SE4A 5JVH3 1LTRD 2K0PA 2Q5WD 2NWGA 5FO7B 1QJOA 2RMMA 1D4BA 4Q5VA 2B2VC 1WTXA 1SJHD 2K32A 2WDVB 3PO2B 3SR1A 4PV1C 5G5GA 2J52A 1AFPA 2L12A 1TY0A 4DFAA 4XQJA 2EPBA 2KJXA 1IBXA 2A69D 4XDDA 5ELFA 3J9CA 3T3NA 1TVXA 4ZQ3A 1QT9A 1F9SA 5KNBA 4KY7A 1VRAB 4QMGA 2MPMA 4NKLA 5C0XI 4KHZA 3H3VC 2ZXOA 3AEFB 1YNNC 4UDUC 1PRTD 2EYMA 3K5MA 5I6WA 3UI2A 1SE2A 4FO2A 2IGDA 1TS3A 4A3BB 1RJTA 3TEYA 1SYCA 4ZOHC 4K2KA 4J8QA 2O5JC 1VCIA 1KTKA 4A3JB 3K7AB 1STHA 2PCFB 2F0GA 4JPSA 2BE5C 2B2UA 5CV7A 3Q69A 4CJ0B 4HTHA 3PIP3 3GQBA 1P7EA 2PZWA 1FD7D 2INPE 3B9JA 1EIHA 3MHZA 2X69A 4FXCA 1N60A 4KKSA 1AP0A 1V1PB 1EEID 2L55A 2KEEA 1PRTC 1JOOA 5CV4A 1EY6A 1IKMA 1JQ4A 2OHFA 2Y3AA 3HUIA 1V8CA 3F2UA 4IUUA 1KDCA 3NPPA 2ZW0A 2R6GA 1DZ1A 4YXDB 1GB4A 4KKJA 2A6HC 5DEHA 1TWAB 1XXGA 3R2IA 3U2SC 1JWUD 4MT5A 3WCQA 4K5WA 1WWTA 3W9CB 2LEKA 2K6AA 1L0VB 4IUTA 2H4OA 1LABA 3IAYA 2O4XA 3FDTA 3K6OA 4ZYSA 1B4OA 5D14A 1YNJD 2KAJA 4WIPA 3P42A 4YSZB 3J7AF 1WVLA 3E9SA 2B2WC 2QCPX 2K28A 3NBIA 2F0QA 3TMEA 1TWHB 5CV9A 2F0FA 1TKEA 2OEDA 2PKOA 3CU7A 2JP1A 2J0TD 1I7HA 5LNK1 1D2BA 3ONAB 3VR6A 1IHZA 4L63B 3VRBB 1SB3C 1YNJC 4MM3B 4B9XA 4NW2A 5CORA 3QO2A 3GV3A 4HEA1 3DWGC 2B2TC 1PGBA 3N52A 1EQTA 1BF4A 3M4OB 1FD6A 1J9OA 3GTMB 4FXDA 2K3UA 1T6BX 4IUPA 4K14A 3BWUD 1KNEA 4GZYC 1C79A 2GB1A 1JR0D 3OIQA 4A55A 2NTSA 1PRTB 3RZOB 1CZGA 4OIKA 4ZHOA 2SNMA 3WDNA 1N61A 4X3SA 2BS4B 5HURA 2BB5A 3OWEB 5NUCA 1S5FD 2M00A 4GDLB 4BBSB 2KMMA 4ITKA 2W82A 3HP3A 1WD0A 4U673 2F3VA 1TWFB 1JMLA 1I4QA 1ONLA 5ELCA 1GUOA 5BMIA 1L5PA 3KLRA 1KDAA 4Q0FA 3C1FA 1F9RA 2KQ4X 1TWCB 5DM73 3AMZA 3OPOA 1FYCA 2XNAC 3VYRA 4EQPA 4MN3A 3W2DA 1V1PA 5ELDA 1MSGA 4ZKCB 1UUPA 1U4RA 2BDNA 2KVMA 3IFTA 5JJZA 5I2YA 2JA6B 2MH7A 1UWMA 1B2TA 4ODGA 4F88A 3E56A 2QILA 3CQZB 1WTRA 3QOJA 1YN5A 2EJFC 3SK6A 1D1IA 3NS1A 4RHRA 2O5IC 1LTAD 1CHPD 1U4MA 2LMCB 3O13A 5KNCA 2WXKA 1LV9A 2JSOA 1F0ZA 1SSOA 4K2LA 1G2SA 4L1BA 1H9RA 3PUWA 1E10A 4JBWA 2DYMA 4J6HA 5I2XA 2B76B 3DWMA 4N9PA 5JOBA 2JWUA 1R9TB 1H9JA 4QF4A 2RDHA 1B50A 2CW0C 2RSNA 1QG7A 4KHVA 1GUGA 2XRSD 1RD9D 1D5XC 1RYJA 1VZ7A 3SK8A 5BMGA 2LFNA 1N63A 1PGXA 4WRDA 2MEKA 4WFN3 1STGA 3GTPB 1MD2D 3NBHA 2SEBD 2DLBA 5EE3A 1ZXHA 3V2TA 3GTLB 3NUCA 2LUMA 3NUHB 2QJLA 1EY4A 1J8IA 3BK1A 1E0BA 5DAUA 2Z1CA 5C6AA 1PFBA 1FXIA 4HCEA 4OO1H 4HMJA 1I50B 2FUG1 2MJDA 1TS4A 1LTID 5D3DA 2JEBI 1TJEA 1DOYA 3NHHA 4R9WA 3Q0AA 3MFYA 2K01A 3NVYA 4OIJA 3T56B 1Y8OB 3AE4B 4DAPA 4XWTA 1S5ED 3BS1A 2KECA 1KLUD 5JXVA 3N6RA 3FAHA 2WQYB 2Y5CA 2JU6X 2VNUD 2JZPA 3LWEA 3WOFA 4UAIA 3HOYB 3KUPA 2NMQA 2B39A 4G7ZC 1B44D 1CI3M 3RPFC 3NWSA 1F9PA 1QOFA 2LHEA 2LS01 1KABA 4RGOS 1ZEQX 2I07B 3M7NA 2Z8LA 1VJKA 3GTQB 4WH4A 5AUKA 2A68C 1G291 1W6KA 1SBBB 1SIJA 1C77A 3I9V1 2MUYA 5FLXE 2EYPA 2N7JA 3DXJC 2JYEA 2WXLA 5IIFA 3BDOA 2KACA 4HR7B 2V3PA 1X3QA 4KGSA 2YYZA 3NRZA 1XWEA 1IUEA 2WXJA 2DN8A 3NVWA 2EE1A 2BS3B 2L9HA 3AE9B 2NVQB 2EY1A 2AUJD 1PXUA 3MHBA 1CT1D 4WJWA 1PFMA 5COYA 4KI0A 2B2YA 3W3AA 3NTHA 1BCPF 4V190 4OW0A 1YMHE 3BVMA 2C5CA 4OO1G 3RUZA 5CV6A 2NTTA 3HOWB 2KCNA 1I6VC 3BDCA 1EQVA 4KJNA 5JEAJ 3FRPB 1I4PA 4ULLA 4RGMA 1CA6A 1L6UA 2RQXA 1KF6B 1JORA 3AU7A 3BYTB 4ZUJA 2TSSA 4ME5A 1VF7A 4WWMA 3PUXA 5A2QE 2KDMA 4FF1A 3VRAB 3AN1A 1HA6A 1SNCA 4ARCA 3MJ5A 4M8AA 3DWQA 1NSNS 3OMGA 5FO8B 3H91A 1B3AA 3GTGB 2WXNA 1BMLC 4A3MB 2SNSA 5M3MB 1C8CA 1D1KA 1N5XA 3VR8B 1A3VA 4S3SA 3ZYYX 4MIUA 1KFYB 3SVMA 2NVYB 2DBYA 5IGEA 3VYTA 3MZ5A 1IW7D 2F0WA 1RKNA 2KWDA 2PO4A 1LACA 2BTEA 1VF5C 1C4CA 2SDFA 2AWOA 4RAUC 2JE6I 1VDVA 3NK9A 3M3YB 1Y56A 1N5WA 2F0DA 5AUIA 2AQ3B 2ID0A 4PQXA 1TS2A 4F7XA 1SNPA 1VZ8A 1CFMA 2PPBC 4PMBA 1P7FA 2MJ3A 3IL8A 2Q8TA 1Q1BA 2LKVA 3HG9A 3I73A 1EU3A 1SXTA 2A69C 2L52A 3J80L 2B8FA 2WXPA 4RF0A 1JROA 3FVQA 4HAEA 1MHXA 2J7ZA 3VR2A 4TQ1A 1O7ZA 2V4IB 1U4LA 1MHHE 1IKLA 2HUGA 4PMCA 1STAA 3Q24A 2RDFA 1RCVD 1Q12A 3ZQ4A 1Q8IA 3IAM1 3AB9A 3TP5A 2QKIC 4IOIE 1GUWA 1PFDA 1A2UA 3EQLC 3M85A 1QOGA 1E2ZA 1JW9D 4N9TA 1ZDXA 3JAME 1RWSA 3I4MB 4RWSC 3RLFA 4US9A 4ZRZA 2EY5A 2CJNA 3CKIB 1PTOH 3SE0A 1B9MA 5I9OA 1OXVA 3HGBA 1UNSA 1QOBA 4K6LA 4TQUS 3IFDA 3OWFA 3QJYA 1C4PA 3TP6A 1DOXA 3P7JA 4C7YA 1JWAD 4TRDA 1HTPA 2W55A 2M2LA 4A8XC 3A56A 1KH0A 3S15B 1EYDA 3T4AC 4C3HG 5G5HA 2K1BA 1STNA 1YNTE 3QIAA 3SEBA 2HCCA 3DMUA 1L0YB 1A15A 2QSDA 3MWYW 4LK0M 1JC7A 3VR9B 1FGBD 2A73B 3BIID 4Z9CB 1UEAB 1IW7C 3S14B 1NUCA 4JWUC 1AZPA 3L4PA 3OW7A 1EWHA 2IGGA 2G9DA 3P75A 2K22A 4XDCA 3TDQA 2B2TA 3TSSA 1O80A 2K05A 1F2RI 2WACA 4QIWB 1WSPA 4R8IA 1Y1VB 1XLNA 5EPJA 4H7BA 5K36G 5C0XJ 2QF7A 2E2HB 1MI2A 3EROA 1F9QA 2EELA 2ONQA 1WTPA 5CC4A 3I70A 3CIRB 2K7VA 1LT4D 5M5WB 3DM1A 1F2MA 2V0GA 1DONA 1HQRD 4K5XA 4NAWB 5EPLA 5T1GA 1SDFA 2B2UC 3ZJUA 1JICA 2ICEC 3NTIA 2W54A 4J3OD 1J7BA 4YTNB 3AEAB 1PRTF 1DXMA 1YJJA 1QNUA 3HS0C 1SEBD 1MPEA 1PYWD 2E75C 1BQQT 4RHSA 4C3HB 4IUNA 2EVBA 3LNNA 3ZJVA 1TKGA 1SF0A 4WQMA 4KJOA 2WP9B 5HFYA 1CHQD 2WNMA 1MVKA 4OZCA 2LHDA 3SFDB 4HN7A 2JQRB 1EL0A 2F0JA 4KMUC 2M0AA 2KOLA 4NJCA 2PLPA 1IYVA 2RDGA 4A3KB 4IQZA 2N9KA 1DJRD 5M5YB 3DHQA 2KN4A 2FJ2A 4FF2A 1VMCA 4BY1B 2L5TA 1OFFA 1QLBB 3ABVB 1SFOB 2BA1A 1JE4A 5E3FA 4XQQA 4I65A 1SYEA 1FNVA 1VZ6A 4H13C 3LYYA 1V1OA 5HG2A 5C44B 1ENFA 3FMCA 4F8MA 5CMDA 1HZ6A 3A54A 4B0EA 2AUKA 3LXFA 1UGJA