4RGOS

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
237
structure length
225
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 63
structure length 225
sequence length 237
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
S PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgoS02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgoS01
3MFGA 1BCPC 4RGOS 1ENFA 1LO5D 1RDPD 4L63B 1F77A 1L0YB 1TS4A 1ET9A 4DXGA 1SE3A 1YN4A 1I4GA 1SE4A 1PZKD 1FGBD 1S5ED 1TY2A 5ELBA 1RCVD 1KLGD 1PTOF 1B1ZA 5D3IB 1PTOB 1LTBD 2NTTA 2QEJC 1V1PA 2XNAC 1L0XB 1BCPD 1PYWD 4TSSA 5TSSA 1JWSD 1D5MC 1I4RA 1CT1D 1S5BD 3CHBD 1S5DD 4RH6A 4ZYSA 1HTLD 1JQYD 3BVMA 1DYQA 1SEBD 2IJ0A 1CHQD 1CK1A 1LTGD 3O13A 1M4VA 1SJED 1RF2D 1CQVA 2CHBD 1JCKB 1V1OA 1LLRD 3BZDB 1PRTF 3MC0B 1PRTB 4DXFA 1HQRD 1LTRD 1D6EC 3DWPA 4RHRA 3URYA 1PTOC 3DWAA 1AN8A 3EFXD 1FNWA 4Z9CB 1KTKA 2TSSA 5ELEA 3R8BA 1V1PB 3GP7A 1QILA 1RD9D 3KLSX 1XTCD 1DJRD 4UDUC 1FNUA 5I4DA 2RDGA 2RDHA 2AQ2B 1I4QA 2ICIA 2SEBD 1PRTC 4RHSA 3BVGA 2NTSA 3DWQA 3R2IA 4RGTA 1GOZA 1BCPF 1LT3D 4L6TB 1MD2D 2WV6D 4RGNA 1HXYD 1PZJD 4NZLB 1D5ZC 1G8ZD 1UUPA 5ELDA 4BWGB 4K6LA 5D3DA 1EEFD 2Z8LA 1STEA 1T5XD 1EWCA 1PZID 1EU4A 1SXTA 1KLUD 3SEBA 1YN5A 1AW7A 3OWEB 1FNVA 1LT4D 1TS2A 4OHJA 1LT6D 3V05A 4RFBA 3TSSA 1PTOD 1BXTA 1TY0A 5ELCA 1SE2A 2O2LD 4O1NA 1EU3A 1HA5A 1LT5D 1UNSA 2XN9C 2XRSD 1SJHD 1LTTD 1CHPD 1JWMD 1JWUD 1YN3A 1TS5A 1BCPB 2R61A 3W2DA 1ET6A 1I4XA 1EFID 5ELFA 3R2TA 5FK9C 3BYTB 3BYYB 2J4XA 1I4PA 5FKAC 2AQ3B 1PRTD 2AQ1B 1D5XC 1I4HA 2QILA 2IPKD 4RCOA 1S5CD 1EEID 1LTSD 1B44D 1ESFA 4RGMA 3EA6A 1XXGA 1LTAD 4C56C 1FD7D 1TS3A 3BVZA 1S5FD 1LTID 2XRQD 1JR0D 1PTOH 2G9HD 1SBBB
chains in the Genus database with same CATH superfamily
3OYYA 3J80i 4DHZE 1XX8A 4YWLA 2SOBA 1CUKA 1VQ9A 1ICWA 4WWOA 1L0YB 2EOTA 1Q8IA 4HCEA 4KY6A 1J19A 1KD1C 2JQRB 3A1QA 3TS0A 1AP0A 3FC4A 4WH4A 2Q5WD 3Q8AA 5ELBA 1TT2A 2VZKB 3ZRFA 4C80A 5C44H 1A70A 2MJEA 5L95C 1K0RA 3IG3A 4JV5Q 4REZA 2BS4B 2ICEC 3TEYA 1K50A 2OHFA 1HNWL 4E74A 1I50H 1TKWB 3J7AV 4RH6A 2BH2A 2MBBB 1JQYD 1PA6A 2QMTA 2X6LA 2LVOA 3SD5A 1SSNA 1VD2A 2N4FA 2RHSB 2E2JH 1ONLA 2LI5A 1LTGD 3Q8DA 4GOPC 4JYAQ 2RSOA 1RF2D 5EAYA 2CHBD 1LM0A 1V1OA 2WFWA 3K7AB 2CJOA 5CV7A 3BY4B 1VQIA 1G91A 4GSWA 4CHTB 1I50B 2L5TA 3PUYA 3QJYA 4EFOA 3A1QB 4OZCA 4XC2A 3DWPA 3G7LA 1P7EA 3V61A 4QIWB 1PFMA 4GIVA 2AKWB 2KCNA 4IUNA 1AEXA 4A3DH 2E2JB 5ELEA 3TP8A 3BK2A 4DNIA 1IYFA 2KK8A 2AL6A 2NUCA 1XF5L 2JPHA 4IWQA 3MZ5A 2E2DC 1HR0W 1GG3A 1IBLQ 1CQFA 1U0LA 2KXJA 2LUMA 3D32A 3KOJA 5LL6X 1XCQL 4FJYA 4W9FA 1P0RA 1IYUA 3I3TB 4HCNB 4IFDI 2JRHA 4A3DB 3UI2A 2AQ2B 1QOGA 2WXPA 5IWAL 1NE3A 1SR3A 2PQEA 4EEWA 2MPMA 1GUOA 2RBMA 2F0LA 3T9LA 3HOUG 2V3SA 1A2UA 4KGSA 1HXYD 1E7VA 4R4CA 4OVVA 2KDMA 4J6HA 2RVLA 2PW9A 4ULLA 3KQ4A 3PCOB 4LMQD 5CHWA 3GO5A 1QWYA 5JJLA 1VQHA 1E1TA 1VLBA 3HOVB 3GOEA 2KWUB 1BMLC 4WORA 4GN5A 2ZPYA 1VDZA 3H7PA 2I5MX 1SNMA 5CV4A 2AWTA 2LUEA 5IIFA 2G45B 2BA1A 1WE6A 1E7PB 5FO9B 4L8JA 2LMCA 3GS2A 2FINB 5AZHA 4KD4A 5I2XA 1J7CA 1G2TA 3I5JC 1HZAA 1F2RC 1AZQA 4GN1A 2R92G 3DXJC 2D5GA 3W5OA 2B2VA 1LV9A 3D0FA 3H6MA 1C76A 2CFMA 1BR9A 5BO4B 1X3FA 2JA5G 2O4XA 2NCNA 4JBJA 1XCTL 2KFKA 3NHHA 2MBQA 4H7BA 3UDGA 3VH3B 4DV4Q 1C7YA 4AYBE 3MTNB 2YTXA 1F9RA 1GNUA 2RSNA 3RULA 4WQMA 3ZTCA 1WWTA 2Z9HA 2L55A 3QX1A 2BCOA 1EEID 2UXDL 3H7PB 5BN5A 5EE0A 1LUZA 3TZUA 2KACA 1PMRA 5EBCA 2LMCB 4JE3B 4EOYA 2WDTB 5JPNC 3A7AB 3GTKH 4N9TA 3RCZA 4LUVA 3E0JA 1LO5D 3QB3A 2B39A 2LY7A 1OXTA 5FLXc 4KY7A 4NPNA 2N55A 1I4GA 5DPSA 4IWOA 2XWBB 2PW5A 2KFKB 3Q8EA 4BA2I 4LF8Q 3GTKB 1LTBD 4JC0A 5IGEA 2QEJC 4K5XA 2KCCA 3BDLA 4EQOA 3NWTA 1JICA 2EDGA 2IT1A 2KVRA 3KK7A 1LACA 1N62A 4ZHPA 2VQEQ 5FJ8G 3A74A 4NXMQ 1FL0A 2MO1A 3DPDA 1G51A 1VQAA 2KTRA 2K14A 1XD3B 4S17A 5CX3A 4OIJA 4G7ZC 4OWWB 4A3EG 4B0EA 2ACZB 2OT2A 4K5WA 5CGKA 3CC4A 4WJ3M 1WGGA 1TXYA 1K52A 2PE9A 4S3SA 4DUZL 3A55A 4WWMA 4YSZB 2JEAI 5EE1A 2V1YA 4HIDA 5DM73 1VQCA 2B2YC 2KLGA 3C0RB 3CF6E 4GKJQ 3MC9A 3HFZB 3MA2B 1N6ZA 2KFJA 4WAFA 2WACA 2IDYA 3I4NB 3M9BA 2PEAA 3ZIMA 5D65A 3GV3A 1V8CA 4A3IB 4A90A 4KJNA 1SE8A 3OTOL 3HOYB 1Q1EA 3C19A 3ZYYX 1NJIC 1LFDA 1ESRA 4C3HB 2B3AA 5HG2A 2OXPA 2HCCA 2L1AA 2B2TC 2RDHA 2C9OA 2OQKA 3CCSA 1P1AA 3CQZH 1WE7A 1WD1A 5COYA 1QUQA 2NTSA 4MGIE 3KF8A 5HGTA 5GADC 1AWDA 4IM3A 4DR4L 4FF2A 3GZNI 3S2DB 4FXKC 2IX0A 4H44C 5IT9E 1EYDA 1J6QA 1KM7A 5BMIA 2N8NA 1Q46A 5JXVA 4JG2A 1AZPA 2JXMB 3L9AX 4HJAA 4MM3A 1EWCA 3CQZB 4DUYQ 3X3NA 4C3IG 2MWSB 5JZEB 4KK7A 5EKKA 3B0AA 5D7GA 4PNYA 1KLUD 1KQSA 1KRSA 1P16A 1IBKL 2WKCA 3L7ZC 1AW7A 3E9HA 1EQTA 1WXSA 4CO7A 1EY8A 1TS2A 3BDCA 1V80A 4RFBA 1A15A 1J9OA 2D62A 3FILA 2DZJA 2LJ5A 1QUQB 2KEEA 4LTUA 2E74C 3KF8B 1LTTD 3PO2G 1RAXA 3OW2A 1RODA 1SYGA 1IBML 4LFAQ 2VQFL 3E9SA 5LXHA 3PSEB 4IOCA 4QCLA 3RT3B 2HIXA 3NPPA 5HFYA 3UINB 1MSGA 1T0RC 2EY5A 2HDEA 3BYTB 1IW7C 4MM3B 1IP9A 1LM8B 1VQPA 4J8QA 1HA6A 1QOHA 5CTRC 2IX3A 5DPRA 3ZNGC 1A62A 3SXHA 3ZKJC 1N34Q 1J5EQ 2KTFA 1EY4A 2F4VL 3EIVA 2Z1CA 1XJVA 2ZXPA 4YCWA 4AQYQ 2ZNVB 1ESFA 1VQDA 1KJTA 4K6DA 3IAYA 1QF6A 3CIRB 4X6AH 1N32Q 1HH2P 1Q90A 1PTOH 3HOZG 3FILB 3HUIA 5KHQA 2V9HA 3QQ8B 3T56B 5E1FA 4A3GB 1XNRL 3VR9B 1WYDA 3T4AC 1EIGA 1HNXL 1HPCA 2INNE 3BIID 1NVID 1XMOL 1OXXK 1YNND 1YN4A 4P74A 3MXUA 1E24A 1PZKD 3A5UA 2KJXA 2MH7A 2WDQB 4JI3Q 3SDLC 1R4NI 1PTOB 2F3WA 1B4OA 3IAS1 1FCLA 1SNQA 4EGVA 1P8LA 3ZW3A 1FD6A 2M9VA 1PH7A 1KIXA 1B3AA 2I0QA 3RI7C 2IO0B 1C8CA 3VR3A 1HTLD 2INDC 3NTHA 3ONSA 1SEBD 4UP8A 3I55A 2A68C 3U2SC 3FPUB 1ASZA 4B9WA 3Q6BA 4F8MA 1EM7A 2WQYB 2EVBA 3KW5B 4W9KA 2NWGA 4HIOA 2NZOA 1AFPA 4FHJA 4JI1L 5A35A 1XT9B 2QCPX 4TVAB 1HQRD 2A5HA 2J53A 5JOBA 2RDFA 4GU2A 4ZCKA 1UGJA 2JA7H 4DK6C 3K0YA 2C9WB 3ZDMC 1FO4A 3B1LX 3RD2A 2F0IA 1QILA 1GHKA 4KKJA 1Q10A 4RF0A 4IZ8A 1IZ6A 3D4WA 1O7IA 3PIOA 2DAFA 5C4JH 4XQNA 1FRRA 1EQVA 1HUNA 4CJ2C 1PH6A 3EHVA 4YHHL 3V6EB 1E10A 3K8AA 3L3OC 4NP5A 1MJEA 4IUTA 4HDQA 5E7NA 4ICUA 1DCZA 2OEOA 5EGTA 1JC7A 1ILQA 5F2DA 3PF4A 3K9PB 3VFKA 1VQMA 2YEPF 5M3FB 4RGNA 1HNWQ 2L00B 3L10B 4NAMA 1C1YB 3Q8CA 5KIXA 2KUMA 1STHA 3NEMA 4M8MA 4FNFA 4PZ6A 4W9JA 4MEMA 2A5UA 1K51A 1T5XD 2Q8RE 1JE5A 4IQZA 2KWDA 2DJFC 1H4RA 4CJ1B 4R4TA 2ZCCA 4ME3A 2XK5A 5E6JA 3OJ3A 4I6PA 1VCIA 4R9WA 1L4ZB 4A93H 3AE2B 3H3VH 4O1NA 4ZUIA 4DNRB 3RZOB 5HY6A 1QOFA 1T0YA 1FR3A 2IY1B 2KKCA 1Q81C 4TV3A 4OXPA 3FDTA 2Q2HA 1V8QA 2XRSD 2JN4A 4ANUA 1KL9A 2O6VA 1M1KC 3F2DA 2F0PA 3AM9A 2P5ZX 3V3XA 1YBYA 4G7HC 4A93B 1H9RA 3VUXA 2H89B 4AWJA 2MSED 4L1BA 2IL8A 3R2TA 1GB4A 1DOXA 3ONAB 1X9NA 2RF4A 1EIHA 3S2AA 1U5KA 2AQ3B 3C1EA 5C0XI 3S15H 5C23A 5IWAQ 5CV5A 2QILA 1I3QH 2XK5B 3AE5B 2LRUA 3VTVA 3A7LA 1F0ZA 5E6NA 2CHZA 2XRQD 1U4LA 4DV3Q 3LXFA 4KGTA 3STBC 4BZAA 2GA4B 2B2WA 1KNAA 3VYTA 4JV5L 2K1BA 3JAME 1YQ4B 3HHMA 4ID6A 5D6JB 2BE5D 4RGOS 4X65Q 1I3QB 2MHVA 3W1GA 4ODGA 1IBXA 4AYBG 4WRDA 4IJHA 1I6HH 1QOBA 4HIKA 1FXTB 3AFQA 4X3UA 3AU4A 3NY5A 4HCSA 1VQ7A 4LUZA 4BY7H 4JYAL 3ML9A 2VB2X 3AE9B 5D2MB 3GTPH 2C5LC 3T3NA 3ND8A 4NKLA 1N61A 3NBIA 4TSSA 5DM63 1GD7A 1CA5A 3KWVA 4NXNQ 1I4RA 1TR5A 1I6HB 3NP8A 4M00A 3I3CA 3SR1A 4O42A 5IP9G 3A33B 2D3BA 4C2MB 3I4NG 1WM3A 4RF1A 1VQFA 1PFSA 2RPVA 3GTPB 4A3JG 4HKZE 4XWTA 4ARIA 1SAPA 3RNUA 2L3ZA 1ILPA 2B3GA 5CHVC 2FAZA 1IBXB 1STNA 1IBLL 1W6JA 5GMVA 2L12A 2UXDQ 5M5WH 5I6WA 2DY8A 3W1YA 1L6UA 3U30A 3EFXD 1WD0A 1SFOH 4Z9CB 4ZHOA 4XDXA 1WCMH 1KNEA 3X23A 3T13A 4RAUC 4BBRG 1F2MA 3NZ3A 3GP7A 5JHAA 3AEDB 1RRBA 1NEKB 2W55A 1G2SA 2VH1A 5C4XH 2J7QB 2ES2A 5EDSA 2D9UA 3NS1A 5M5WB 4L5TA 5M5XH 2L52A 1O7ZA 3U4ZA 1SFOB 3NVVA 4C7ZA 3Q14C 2NS5A 4US8A 5LMNL 1I4QA 4QMGA 3VH4B 3NRZA 4NJCA 4JOIC 2EMSA 4ITKA 1ZW7A 3QOLA 3L13A 3QR8A 5C4XB 4L6TB 1VF5C 3S14B 2PIAA 4RM9A 1SIJA 5M5XB 1NBWA 2KDFB 1G8ZD 1SGHA 2CS4A 1FJGQ 4IFDG 3MEFA 3RPFC 5D3DA 2M56B 2F1MA 1STEA 2REXA 1ZXTA 3PHXB 1PV4A 3WALA 3N1XC 4YCVA 4I7AA 2NZ1D 3ALBA 1WGDA 3EFUA 1WX8A 4G7OC 3OWEB 1OEYA 4XQJA 3J81i 4DUZQ 3RNAC 2GI9A 1A8VA 4KIKA 3PGZA 1SE2A 4DV4L 4FXDA 2K9XA 2MP2A 2WDVB 2BOSA 4X62Q 4LNNA 3M62B 4GOPA 1WOCA 1K53A 4FN2A 1YJ9A 2KN5A 3HRZC 1JWUD 4WFN3 1YN3A 2IY0B 4M0WA 5IOIA 4HLEA 3M3YH 2YTYA 3OTOQ 4II3B 3OAWA 4MNOA 4LJOB 2D0OA 1EFID 2LFNA 3KUPA 4AH6A 3QJZA 5C1ZA 2GBKA 3ZXVA 1HHVA 1VQBA 2E75C 4A3GG 2UYZB 1W3SA 2PNRC 1RTOA 3PZ8A 4YWGG 2PNHA 2VY3A 3VYRA 3GTJH 2CVRA 2QA4A 1N36L 3PVLA 3P7JA 4KKTA 4C56C 1MG4A 1V86A 2JWZA 4PT5A 3VRAB 2NN6I 3UIOB 3KUZA 3AXCA 1VQGA 3HK0A 4HJ8A 4A76A 1WI5A 1S4ZA 2KO3A 3M4OH 2KDEB 4GOPB 2A6ED 5IP7H 2EYHA 2KLCA 3RUZA 4M0WB 2VQEL 3NQTA 1WYGA 4NXML 2HJ1A 1OFFA 4C1NK 3GTJB 4IUVA 1ZGUB 3BINA 4F1SA 1XEEA 1EYCA 1F1HA 5J22A 4GLVB 3Q3OC 2VUMH 1D8LA 3WANA 3I91A 1J8IA 1V1QA 4G57A 2YLMA 2NVUI 4ASWC 1JWSD 1A3UA 2FCNA 2KHJA 4MGZE 4FJZA 4JI0L 5DCNA 4ZYSA 3BVMA 3MHZA 3P4PB 1BBWA 2VQFQ 1XLOA 4EQNA 5IGBA 4MT5A 1ML0D 5J17A 4HJ9A 4EE2A 4GKJL 2VUMB 1XTDA 4DDID 4F7XA 2KHSA 2L4NA 2MRPA 2ZW1A 3TBIB 2WAQB 3JW0X 1Q82C 4BBSG 2CHWA 2QF7A 3WCQA 3BZDB 2M4NA 4KTAA 5M5YH 3TS2A 3TN2A 4KSLC 1N33L 4DXFA 1YNJD 4X3SA 1HRJA 3DWAA 2JA5H 1XYIA 3GD7A 4A3KG 4LW1A 2LGIA 2MCNB 4Y52H 2EY1A 4GB9A 3H6NA 3BU2A 2N1VA 2VZKD 3RZDH 2A6HC 4XQQA 3AEAB 3H8HA 2R93G 4KKUA 3ZJUA 2R3ZA 1DOYA 1WRDB 2L9HA 4B3RQ 3TIXA 2KC1A 1Y8NB 4P2CB 2A1AA 3JAML 3JYUA 4YT0B 4DUYL 2D3GA 1TJEA 5KGUA 3HP3A 2JA6G 2R7ZH 4C4VA 2WNMA 2KECA 1YMHE 3PLUA 3RZDB 5CC4A 4LF4L 2JSOA 3PIP3 4XYOA 4M1UB 1VQKA 1UEBA 1E8YA 2G1EA 2ON8A 2R2QA 4DGZA 1LQBA 1VR9A 1WX9A 3W3AA 1R4PB 3TQYA 3KDFA 4RKLA 4KD3A 1WI0A 1B9NA 1A63A 2R7ZB 2C60A 1SXTA 3QOJA 4EZLA 5D94A 1YNNC 5FJ8H 1BO0A 2RQXA 1LT4D 2BYFA 2B2UC 2GRIA 1TZOA 1X32A 1U4PA 3S1NH 2EJGC 2MP1A 1MI0A 3HKZE 2LXCA 2E5LL 5HGQA 2KQSA 1UE6A 4JWUC 1Z7TA 1J5EL 4XWWA 3ITPA 1SJHD 3AV8A 2XTIA 4C4VB 3HOXH 2KMAA 4IKGA 4P1CC 1X56A 2JT4B 1WXMA 3TP5A 1QB5D 4QJFA 2LHEA 4OVZA 4RM8A 2BKFA 4X57B 3ICEA 4YHHQ 2NVTH 1FRDA 5LMUQ 3K5MA 4DR7Q 1N32L 3Q22A 1DD2A 1D3ZA 5FKAC 2YVCA 2B2YA 4K8JA 3ZRCA 1EOVA 1RFKA 1Y8PB 5C5MA 5IGFA 3O65B 3CMEA 2EYJA 1S5CD 4RCOA 4WJWA 5T1GA 4X3KA 1Q5WB 3Q69A 2GVBA 1LTAD 3TDQA 1KABA 1TS3A 3BVZA 3DUZA 2EPBA 3M4YA 2FNJB 3RLFA 5CV8A 2MFIA 3LWEA 4LUOA 4TKNA 2SNMA 2LWPA 3U58A 4FA6A 1A3VA 2B2TA 4DF7A 5G3LD 1ZOYB 4EUTA 1RTNA 3DMUA 5H92C 1TWCH 1F2YA 2CW0D 2BS3B 4EX5A 3U4EG 2GBNA 1K3BC 1TY2A 2F0GA 4KSKC 3FKYA 2F0EA 3RR5A 4PQXA 4IUMB 4MH8A 1KLGD 4YSXB 3BZCA 2HD3A 4KDIC 4N9F4 3Q23A 3G6JB 2K5DA 1QVCA 4C3IH 3AMUA 5J1ZA 1TGZB 2MQJA 2JA9A 4FF4A 4XDDA 1SMXA 2IGHA 2KWCA 2N78A 4QF4A 5EPJA 4DXAB 4W9CA 3I63C 4JK1C 2VZAA 3HVZA 3RNEC 4IFDJ 1JQ4A 2AHOB 4M8NA 1ASYA 1JCKB 2WXNA 1WTRA 4A3BG 4FJVB 2I2YA 4LNFA 2A74C 1ZYRD 4R3DA 2LASA 2Z0EB 1VQ5A 1QCBD 4CJ0B 2LGXA 2PYKA 5AJ3Q 1KC8C 3NXWA 3S17H 4I65A 4TQ1A 3CCQA 4DPGA 1RKNA 1YHAA 1YJNA 1HQMC 5G3LF 4B6WA 3GTMH 4P71A 4LFCL 4WURA 2F0UA 2IWHA 3I4MG 3OMGA 3KH0A 5C44B 3HOZH 5J2RA 1PVOA 4HCPB 1L6VA 4W9GA 2AWOA 2DNCA 2JQOA 1CKOA 3EBEA 4B3TQ 2ALYB 3RMKC 2JJQA 5LHY1 2K1FA 3J80E 2EY6A 4AJYB 3UIPB 3RN2A 3SU8X 1QVFA 1V9PA 4QUCA 4GNXC 1EYGA 1GUSA 1BBXC 3F1ZA 4N8X1 2EKEC 2Q8IB 2VRRB 3B2GA 5IGGA 1NNXA 3HOWG 1STAA 1CFMA 1H9JA 5CMDA 2DBYA 5M3MH 3M3JA 4CDFC 1MHHE 3UDFA 1WTVA 2AX5A 1RLFA 2ATWA 3DOWA 1HA5A 1LT5D 1SYDA 4LFBQ 1CSPA 3M7GA 4JI5Q 1JOQA 3DVGX 4XZ4A 2SNSA 3KFUA 4AQ7A 1BF4A 3VUWA 4A3CG 3M63B 4H2AA 2OOBB 2KQ4X 1U9RA 1H9MA 5EKLA 1LYLA 3DDCB 3T3OA 4DR5Q 1GPXA 5M3MB 3MXPA 3VR4A 3DM3A 4DV3L 1S72A 4GZYC 2G3QB 1SF0A 2C35B 5LMNQ 3OWFA 1PRTD 1SMYD 2FHTA 3CKIB 1BOSA 5E4WC 4X65L 1JJ2A 1UH6A 1T6BX 2EELA 3WOEA 2CKHB 3ZLZA 2BWES 3OG5A 3AB9A 3KLRA 1B44D 3SGIA 1C0AA 4V190 4PYUA 1VMCA 1IKLA 1V2YA 5EE3A 5AZFA 4A55A 5MPOA 1Q0WB 2NB0A 4MDKE 5C0XG 5IT9c 3NHEB 4FADA 3QC8B 1UELA 4YTPB 4NXNL 5C3JB 4MZ9A 2LS01 4E6IA 1B3QA 4UAIA 4IOAA 2PJHA 4ZK9B 1JB7A 3OLMD 1PH8A 2G9DA 1WM2A 1K28A 1DM0B 1RCVD 4H0LC 3G6EA 3A4SC 3U7DA 3TEZA 1YITA 5CHFA 3RUIB 1ROEA 3PPAA 3SK8A 2EKIA 3WWVA 1V1PA 3H9DA 3S9WA 2A4ZA 3KLSA 5JAVA 2KZRA 1EIYB 2B63G 1CT1D 1HTPA 3NBHA 4ALPA 4WWNA 2IO1B 2WB1B 3C1FA 1SYFA 1GHJA 3Q24A 1JW9D 1F9SA 1II3A 5ELNA 1VDVA 4XYQA 4EQ5A 2RMMA 1SJED 5GAHC 2JA8H 2ZW0A 3IHPC 2XVSA 3PO3G 5EBDA 1PRTF 2ZVOA 3HEJA 2PVGC 2V4DA 2IX1A 1A0IA 4JI4L 1N36Q 2W9NA 3UGBB 1TU2B 4CKBA 4GN4B 3R8BA 1Y1VH 3RN5A 1C78A 2JA8B 1V1PB 4OX9L 2CKZB 2ZT9C 2NR2A 2WP9B 1SYCA 3FKIG 2MHJA 4DDGD 4JPBW 2A69D 1O7YA 3NBHB 2JYOA 4O0AA 5A2QL 4OONA 1WR1A 3L17A 4IG7B 1EFWA 1GO3E 3PUXA 1L1OC 1FJGL 2CU1A 4K2KA 5IP4D 1JT8A 3A0JA 1Y1VB 2ICIA 4A3FH 4A3LH 5EE9A 2WXGA 3J9CA 4N9PA 1S40A 1X65A 4BY1H 1PH3A 4IUUA 3J7A5 4JI2L 1SN8A 4JI0Q 4AS1A 5IAAC 3AE1B 1VJKA 4G11A 1UUPA 3DHGC 1E2ZA 1EUJA 1SDFA 4PG3A 3QWNA 5ELOA 1DOLA 1TWHH 3E9IA 5L37A 4UP9A 3V62A 4X62L 1N60A 2A6EC 3V60A 1N8RC 4UPAA 3AFPA 3QK0A 2GN5A 2WU5B 4UP7A 3T51B 4BY1B 5DPTA 3NVZA 1SYEA 2PPBC 3PTFC 2K5QA 4YWKA 1N33Q 4BXXG 3WDNA 2WXRA 2KTRB 1ZUD2 1C9OA 2V0GA 1CTMA 3MXGA 1J0GA 1EU3A 1M8AA 3ZO5B 1T0SC 4L5QA 4ARCA 4EZJA 4U68A 3C8YA 4U673 1PFNA 2K8CA 4MJSA 1DGJA 4KHPQ 2MO0A 2KQ7A 2R61A 5J39A 3W2DA 4W9IA 3RZWC 1XLNA 3FP9A 4L5RC 3H3VI 3LYYA 1TWFH 2Q8TA 1JRUA 5JEAH 2JP1A 4I6LB 5ISRA 4L2YA 4L23A 5G2NA 3I8ZA 1SNPA 2W82A 1D5XC 1HZ9A 3K59A 2F0JA 3K6OA 2IPKD 3HKZG 5E4XA 5BR8Q 2W3SA 3Q8BA 4ZYNA 4RGMA 1C3TA 4LF4Q 4X66L 2MLBA 1QG7A 2FXQA 4A3MG 3VHTC 3CC2A 2FBWB 2WXHA 3K81C 4XGAB 1WF9A 2F0OA 3PQIA 4MN3A 1BCPC 1Y1WG 3BWUD 4NQLB 3HS0C 4C3JG 4L63B 2DWQA 1EYAA 2D5DA 2PI2A 4JOIA 2MQHA 4AIMA 2UU9L 4UY8C 3M7NA 1NR2A 2HDLA 2E2HH 2WS3B 4MJSB 2QW7A 1O80A 1UAPA 1G6JA 4RMAA 3J80L 1FGBD 1TYGB 3DBLI 1F9JA 5IGDA 1O7LA 2Z4HA 2MGSA 2CQAA 2O5IC 4NDXA 1MKHA 4H13C 1KDAA 1N63A 2KVZA 2LRWA 1C9FA 4XE0A 5E3FA 3BS1A 2HJ8A 3B6YA 4X64Q 5TSSA 1HZCA 2JEBI 2VW9A 2E5LQ 5AUIA 1D5MC 2X6GA 4ACFA 1EQRA 4DV6Q 3IFTA 1WXVA 2N49A 4ZDVA 2GB1A 3H0GH 2F3IA 1CZPA 4TUUA 1MHWC 2E76C 2K5NA 1JOOA 1WJ6A 4OZBA 3O13A 2DNEA 3DHQA 3SK5A 3DVGY 3S1RH 2M0XA 1ZE3D 1E9MA 2BTEA 2WX0A 3WAMA 2WDRB 1JALA 1YNTE 2BKRB 3A56A 5C3WA 1MBYA 1O78A 1ZDVA 2DYBA 4LDTD 5EQ0A 3QA8A 4NAWA 2F52A 2TSSA 4B3RL 3LB8C 4N58A 4JI8L 3FRPB 3RNFC 1HNZL 4FBJB 3PUVA 2IHFA 3S1RB 1FCCC 1YHBA 3Q6SA 4M01A 1VMPA 1X6OA 2LXKA 2NYZD 2PMVA 1NSNS 1WTHA 3JAMc 1ACCA 3CXCA 1OEYJ 2K6AA 1P98A 4P7IA 1QNUA 2KEDA 1H9SA 5HKHA 3BJUA 3NELA 4KN7C 1TQOA 1PDXA 4DN4M 1VQ4A 4ABNA 4H02A 4RGTA 1T5EA 4JW0A 1LT3D 4GLXA 2F4IA 2BYTA 2WV6D 4XYCA 2F03A 4Y7NH 4NZLB 4A3DG 3SDZA 2DJGC 2I5LX 1BQQT 4OWTB 1WFQA 2EIFA 4F87A 3H15A 2ASBA 2UXBL 1EUVB 4NAWB 2DYMA 5GXGB 4GOCA 4LF7L 4NMZA 3HGBA 4JIOU 5C0XJ 3G71A 1VQ8A 1GXDC 2UUAQ 3GTLH 2UUCQ 4Y7NB 4WIPA 1PGAA 2FFKB 1LT6D 5BYSA 1H9SB 1TY0A 3MHBA 5LMUL 4DR7L 3HOVG 5BYRA 3MTSA 2LZ6A 2JA7B 2I07B 5KYIA 4DR6L 4KHZA 3LWUA 1E5WA 2PW7A 4IALA 2OEDA 3NG0A 3D31A 1E7UA 2YU9H 4DFAA 1TS5A 1WJUA 2F0HA 5C4JB 3PIPA 3LDZE 3RLOA 1JE4A 4LFCQ 1SRUA 2LFIA 2KQ3A 3P75A 2D0PA 4B3ML 1BUVT 1ZKOA 1D2BA 4YTMB 4APVA 3DQVA 1D1IA 4ZRIA 1CZGA 1EWIA 5EKIA 1U4AA 4HIMA 1HCZA 1ICFB 1PYSB 1IL2A 2EMTA 5G55A 5JJZA 2EYPA 1L0VB 1PQSA 2R93H 4OZAA 4MHEA 2WINB 4XXEA 4K7SA 2WKDA 4CKEA 2I5HA 3UQAA 1Z47A 4M8AA 2GVAA 3NSWA 5C4ZA 4DR1Q 2JA6H 2WXKA 2H4OA 3D4RA 4ZRKA 4AUQC 1F2LA 2HHHL 4BBNF 2JU6X 2KYWA 1GAQB 3E56A 1FPYA 2JYEA 1FXIA 2PCFB 5D3IB 2JE6I 1YI2A 2AWNA 1EF1A 3M4PA 1L0XB 2K04A 2M00A 2XIWA 2BGFA 3U7ZA 3E5SA 3CF5A 3S1MH 2A73B 1PFDA 1SROA 2VB3X 3V2TA 1S5BD 5IYCG 1Y69U 4OO1H 4F88A 1OQRA 2FCQA 3AE3B 4M02A 1QOAA 1CHQD 1HUMA 1KRTA 4NJ7A 1KDBA 4ILWA 1QLBB 5AJ3L 3C3LA 3CMMB 4J3OD 3HIZA 4DV7L 2B2UA 1VQNA 3AEFB 3IRBA 4KKIA 3GE3C 2L0FA 2ZM6L 2KOLA 1Y14B 3S15B 1WH3A 3RZFA 1MSHA 4K81A 3S1MB 4EZKA 2O6VB 1LTRD 3HG9A 4PS8A 3OMCA 4MSQB 1AN8A 1D1KA 1GUNA 4BKSA 5IT9L 2C7HA 3JC66 3DBLB 3APDA 2FJ2A 4G4KA 3R93A 2QSDA 1IYJB 3LX0A 2JXTA 2NZHA 2H1EA 3EVQA 2Y0SE 2ZXRA 1WTPA 3AMZA 3T1HQ 3IFWB 2K50A 5IY0A 4B3TL 2UWQA 5G5HA 1PH1A 2RR9A 2A19A 4K5VA 1VRAB 2DLBA 2MJ3A 1HZBA 4BY7B 4US9A 1CKNA 5C3XA 1VQJA 3AULA 2SEBD 1PRTC 5EJWA 3S2HH 1F9QA 4A3IG 2FE8A 3W1SC 5JHBA 2X38A 4DBGA 5C3EH 3DWMA 2LD9A 1GOZA 3HOYG 5DEHA 1F2RI 4TQ0A 4DV0Q 4C3HG 1WTXA 2ASQA 4WJQA 1PZJD 1GC7A 1JJGA 2RD0A 3E3XA 4JL9A 1DZ1A 2OJRA 3N1YC 5FR6A 3QARA 4X3TA 3IAM1 4E71A 1YNXA 4HJKA 2KX0A 4LFBL 2BA0A 5J3BA 2XEWA 4JI5L 3J7ZC 3RNBC 2FUHB 3TEWA 1R4MI 5C6AA 3DVNV 4P73A 3A4RA 3AB5A 1UE1A 3OSOA 2DZIA 1NR4A 1DOMA 3AE6B 1ENCA 2KT7A 2F0SA 4DR5L 5JJKA 3ECIA 3FVQA 1S3OA 3EUB2 2RHQB 2IHEA 3SFDB 4JI4Q 1XMQL 2KCTA 2KDBA 3NOBA 4R1JA 3NZSA 2RCNA 1WCMB 2Y0SB 1V81A 2XN9C 1TT5B 1HTQA 4OX9Q 3TRZA 5G5GA 3OJ4B 4A3BH 2G4DB 2EYFA 1UZXB 3LNNA 4LJPB 2QEXA 3A9JA 5CV6A 2QDLA 3J7YW 1VS0A 1Q12A 1H95A 4BOSC 2UUBQ 1CA6A 3WAPA 4JI6Q 1B2TA 1B7YB 3VDYA 2EYOA 2MX2A 2WXFA 2DGYA 1K0SA 3E6ZX 3AEGB 5FOBB 2N1WA 3KJPA 1UGMA 4KVGB 4JI2Q 2N88A 3NVYA 3NTIA 1F52A 2MJDA 1JR0D 3CAMA 1RM6C 5KHOA 4K0KL 1BNZA 2BQQA 1PLFA 4WJPA 4O2DA 4PS3A 1VQEA 1SE4A 2JK8A 2VL6A 4KLKA 2X8XX 3A9JB 1VZ8A 4ZKBB 3TP7A 5NUCA 2F0QA 5CV9A 5T1IA 1B1ZA 3QCAA 3MWYW 3T1YQ 3Q8FA 5IKCM 2DZKA 2NTTA 5KRUA 2TMPA 5I9PA 3SFEB 3DM1A 2ZTEA 2J0KA 4GNXA 4II2B 3NVWA 5LXIB 2WAQE 5IOCA 4B9KA 3K5OA 3M3YB 1NMGA 2N7JA 4PYZA 2FMMA 4KIKB 1EY7A 1GM5A 2UXCL 1STBA 2CH4W 3ERQA 1YJWA 2JZ3B 1Z2MA 1CQVA 2MP2B 3J81E 2Y5BB 3NZUA 4GMVA 1R4QB 4POGA 2PLPA 4XTCS 3MC0B 1GC6A 4F8CB 5DNFA 1L2NA 4G3XB 4A3CH 4A3OA 2XSCA 5C5LA 5HURA 3HOUH 3S16H 5KYLA 3CSTA 3ZUNA 3ZNHB 2ID0A 2J7ZA 2KAJA 1R9TH 4X66Q 1KTKA 1EZ6A 1JRPA 2L76A 2WYQA 4QQBX 3ML8A 1S1QB 1WR6E 5JH5C 4DR3Q 4A3PA 3M4OB 1MPEA 2RPQA 4YXDB 4GNXB 2NBFA 4L5SA 1HZ5A 1NYQA 4FXGC 1XTCD 1B53A 3HOUB 2UU9Q 4AJWA 4KN4C 2ZTCA 3TMEA 1MJDA 2RCFA 3ZTDA 1TWGH 1R9TB 4F7ZA 4AOFA 2OQ0A 2Z6KA 3OHXC 1W6KA 4ZLTF 3CMAA 1I94Q 3VA5A 3SVMA 4ME5A 1AE2A 2Y5PA 2R92H 4BA1I 1MD2D 2DUDA 5BYQA 2XBBC 4J15A 3NQIA 3I2ZA 4KZ0A 4JPSA 1W2BA 4LWCA 4LCDE 2WX1A 1B9RA 1EEFD 3VA7A 2DY7A 4LF9Q 2GBMA 3U8ZA 1X55A 2QJLA 4FYDA 1NBFC 3K80C 1NUCA 2ZJQA 5M3FG 3EN2A 4PS7A 2B63H 2R92B 4KHPL 5M5YB 2NVQH 1WMHA 1FNVA 3I4OA 3F2CA 2LVPA 3P2BA 4LAAA 2PZTA 4K3CA 2K5VA 2JA5B 2K01A 4ZKCB 5I9OA 1MVKA 2INPE 3VQIA 1M94A 1UNSA 4JI8Q 1WX7A 2N9KA 3VR6A 3Q3NC 1HNZQ 3EQLC 3PO3H 4KJOA 5JVG3 3K5NA 5BR8L 1WGKA 2NVQB 2DAJA 3WA0A 4FO2A 4K3BA 4QL5A 1I4XA 3D4DA 4GGQA 4TKOB 3ER0A 3TREA 4Q2JA 3GV6A 5ELFA 3CCJA 4JBMA 5DAUA 2EXDA 2KCMA 2V1CC 3DLLA 1OTCA 1OXUA 4N59A 4DAVA 4IOIE 3PIO3 1R4MB 4A93G 1HJPA 1RHPA 1JMCA 2NBUA 3GTQH 1WMHB 1K83H 1I5FA 1MGSA 1XPOA 1NDDA 3L0WB 3UE1A 4FLHA 4A9AA 3NK9A 3TEHB 2UU7A 2KENA 1UE5A 2K22A 3QAQA 1LTID 1IW7D 3G48A 4A3EH 2UXBQ 1L1OA 3J80c 4X64L 4LF7Q 4P6VF 1FVIA 3OIPA 4ZQ3A 5C2TB 5CBAE 4DV6L 1SE3A 4KZCA 1YIWA 2E6XA 2K0PA 2K6DB 1BBUA 2EXZA 3S1NB 1J7AA 4A3EB 3KDFB 2LGSA 2PMZB 2XNAC 4DR6Q 2Y3AA 4KX6B 2LSSA 4IO9A 1KAWA 3HOXB 1WGHA 5IYBG 2BYVE 1MG8A 2LXAA 4OIKA 4BXXH 1TVXA 4DK3C 3CU7A 4RMFA 1NI2A 1EY9A 2NVTB 1C4AA 2MW5A 5KNCA 5IODA 2QGQA 1L1OB 4B3MQ 1GUWA 1KRHA 1B50A 3T8MA 2H88B 2KWVB 4OWXB 4BBNC 1NI3A 1UD7A 2M8SA 3AE7B 1D6EC 3KF6A 4RHRA 1XNQL 3CSFA 1EL0A 2L11A 2A68D 2E8GA 2MEKA 3AYHB 4GLAC 3MP9A 2RA4A 3DBHI 1J8CA 4R8NA 4TRDA 3DHIC 1EQQA 4CHKA 2KNBA 2JX5A 1WY8A 2NVYH 2EJFC 3KLSX 4ICVA 1T9HA 1WRIA 2KJRA 2ZVNA 3LJ3A 1HEZE 2JXXA 1TWCB 2HHHQ 3PV1A 1WGYA 3AECB 3KBXA 4EQPA 2ZJPA 1YVCA 3KUDB 4HPMB 4ZUJA 4OGQC 3DWQA 1Y1WH 4DR2Q 3RN9C 4BOZB 2NVYB 1MI2A 4C3IB 3L08A 1GJZA 4CGYB 2UUAL 2UUCL 3PO2H 3J81j 2FIDA 2E2IH 3K9OB 2ENBA 3NUCA 2Y0SG 2F0VA 5KEEA 4GDLA 5FR3A 1IHZA 5TR5A 4LF6Q 3IT4B 4DV7Q 3VTWA 5C4XG 1EU4A 2ZM6Q 4B3SQ 1ZEQX 1YN5A 4DV2L 3BK1A 4K8IA 3PO2B 4W9HA 4ANWA 4JCVE 3U9OA 1LGRA 3X3MA 1YJJA 2Z0DB 2B29A 4IM0A 4C7YA 4FF3A 3S17B 3Q2AC 3J81L 3PV0A 2I1JA 1V5TA 3AH7A 1JWMD 1IGDA 4BKGA 3PSIA 2V3NA 3AE4B 2F0MA 4NW2A 1BCPB 1UEAB 3H09A 3S24A 3UE0A 5IGCA 1YX5B 3GTMB 4P16A 4G0NB 3L2PA 3K58A 4GDLB 4DAYA 5FK9C 1VQ6A 1EF5A 1WXAA 2K8HA 1HFGA 3TBLD 4JBKA 1EY5A 3K7AH 3HOZB 2BE5C 2DENB 1T0QC 5HHDG 1I4HA 1FM0D 4DR1L 4DK0A 3MJWA 4HJGE 4W9LA 4DHJB 2DZMA 2WXQA 2IO3B 2B8FA 2CH4A 3PF5A 1GB1A 2XWJB 3D8GA 4K1RB 1NAPA 3ULJA 5CBEE 2OF1A 5K36G 1S5FD 1ZPSA 2JZZA 2ONQA 2QIEB 3VR2A 2G9HD 2JSVX 3MFGA 4GXBA 3L0OA 2XGTA 1UE7A 1K8MA 1RDPD 5C4HA 3MXNA 1Q86C 2KANA 1F77A 2HCIA 3L54A 4I6NB 2CWPA 5IYDG 3K57A 1Y56A 4DHZB 1GUTA 2BB6A 3ZGZA 1V6EA 1E7ZA 4DAYB 3GE8C 2KVMA 4JBWA 1TKGA 3STBD 1LABA 1XMQQ 5LMNW 1E8XA 1NENB 1N5XA 3H7SA 2WB1E 1D4BA 3J7AF 1V5OA 1CSQA 4I7ZC 5CYUA 3I56A 4KY5A 1HR0Q 1WZ3A 1C4PA 1Y8RC 2GMIC 2NMQA 2WHIA 1G6ZA 3U50C 1FXAA 5E6OA 2Z6KC 2BVCA 1MJCA 1TWAH 2AEHA 4CKCA 3HOVH 1E6EB 5IP7G 1VCBA 2JRIB 3IXSA 3P1HA 4N8FA 4XT3B 4NPSA 4LNKA 3MXNB 1XWEA 1WYWB 1CMXB 2BW2A 3TJPA 3U52E 2L7RA 1TIID 4HJ5A 3CC7A 3T1HL 3ZNID 2AUJD 3RLNA 1UWVA 2MNAA 1M90C 2VUMG 1TBEA 4C1NI 4IWPA 3ZNZB 2CJNA 1FNWA 3UQBA 1X3EA 1TWAB 4FVMA 2WAQG 4B08A 1SNOA 5FLMG 2GOWA 4DAMA 3AEBB 4TQUS 4PK1A 3I4LA 1C48A 2F0WA 4K0KQ 1EWYC 3SE0A 4DV0L 1NTGA 1Z6HA 2ZCBA 2B8GA 3VVWB 2L15A 5K5PA 4J6IA 2SDFA 3H91A 2N9EB 3ETRA 2FMCA 4YIJA 2WU2B 3A8KE 1BUIC 1WFYA 3EC8A 1E0ZA 3Q0AA 4RG1A 3AN1A 2BYEA 1G291 1AH9A 1NYRA 2IBIB 3NENA 3CRLC 3GB1A 3B9JA 1EOTA 1SYBA 4BWGB 5BN4A 2I46A 1ZXHA 4WQOB 5LL6S 2Z8LA 3TUOA 5D14A 1G6PA 1WJNA 5IA7A 1QVGA 3DBSA 1OTRB 4IPDA 3DBHB 2EQSA 2UXCQ 1A6XA 3UDIA 1OQYA 2V4IB 1FEHA 2NBVB 2WXOA 2PO4A 4HKQA 3SEBA 3QHTA 3AEEB 1E22A 3HRDD 5IYCH 4MACA 4OHJA 3KYCD 4K7WA 2K5WA 1PTOD 1BXTA 1L2FA 3U9SA 1WIAA 2VH2A 3M4QA 2UUBL 2K39A 2L32A 2IGDA 4XX5A 4PMWA 1RL2A 4JI6L 1E8ZA 2YV5A 1C4QA 2R7ZG 4R8IA 2VNUD 1CM9A 3ZJYC 2R2OA 3GTGH 4NNJB 1OO9B 1V9JA 1UBQA 5JVH3 2OJWA 3MJ5A 2D07B 4MELA 3H1UA 5AZGA 2VS1A 3WAOA 2Z0SA 4OL7A 1NMFA 4HVBA 4A3FB 1V49A 2PZWA 1V97A 2AQ1B 1DOIA 1JJCB 2R7DA 2LGDA 3IVFA 1XLQA 1E3PA 3N32A 1V43A 1JROA 4AYBB 1EO6A 1WTOA 3EA6A 3GTGB 2KJHB 2M1MA 3ZJVA 1IXRA 1GJXA 4ZRQA 5IP9H 4JWSC 2QDBA 3I4NH 3T1YL 1TWHB 4IUPA 2JZPA 1STYA 4KMUC 3IFDA 2HQLA 3HOXG 1CKMA 3ERSX 4A3IH 4A3JH 1ENFA 4PMBA 3HOYH 2LKVA 3W1SA 5EPKA 1K8AC 4C3HH 1WZ0A 2D2CC 4IW0A 1S5ED 4GKKQ 2F0KA 4RCNA 3FPPA 5EPLA 1PGBA 2L8JA 1DGSA 1TTNA 1I42A 1PTOF 1PYBA 4PMCA 3CCLA 3MC8A 2QCZA 4A4IA 4BBRH 1PYWD 4A3JB 3PT2B 1OGWA 2M17A 2K52A 3OIQA 1U4MA 3S2DH 1PUTA 1VZ7A 3L4PA 3ULLA 2O2VA 3CHBD 1HTOA 2KA7A 2ZEQA 4WJNA 3ZDTA 1YNJC 4LNOA 2BH8A 3F2UA 2PI2E 4DV5Q 4MGKE 1DOKA 1TWFB 3N3KB 2A8VA 1Q3LA 2D2QA 4DR3L 4BBRB 3RMHA 1AARA 2WXMA 1PRTB 4OO1I 2N9XA 4BKTA 2I1KA 3PRZA 1JOKA 4JI7Q 3URYA 3E0EA 1R7SA 2NN6G 5LLIA 4QB4A 4IFDH 2HIVA 4WJ4A 2PVOD 2LHDA 1WJ4A 4HTHA 2WXIA 1I94L 4JLCA 4PZ7A 1MFWA 1K9MC 4CDDC 2B76B 3CRKC 1TZ1A 1BDOA 4RWSC 2C7MB 3HKSA 2F0TA 2O2VB 1Q1BA 5BMGA 5IO9A 1TKEA 2IZVB 5DLQE 2E2HB 2CU3A 4B0MA 3CPWA 4DQOC 2VXWA 4KI0A 4LF9L 3FMCA 2C7NB 3CCEA 1TIFA 2HTHA 2WLBA 1X3GA 1X3QA 1KLVA 3D6CA 5IE8A 1QJOA 2JUOA 2A6HD 4A75A 2K6QA 3H0GB 2DYOA 4K6LA 4NJ6A 5C44G 3A54A 5FLXE 2JWUA 1QNKA 4A3GH 2BBCA 4IUQA 3DHHC 2O6VD 4YL8A 3ZVVA 1KH0A 3IBEA 1Q1OA 4WAAA 3I9V1 3MEHA 1UWMA 2Z6BA 3I70A 3APCA 4R4OA 3V05A 4R4IA 1XNQQ 3PS6A 2R7FA 5GAGC 2M2LA 5CR3A 4B9XA 3GTOH 2PE6B 5H1SE 4XT1B 3C2PA 2I38A 2PZUA 4MIUA 5BN3A 2V4LA 3RYTA 3SHQA 2CQOA 1K3RA 1T3QA 2ZPNA 3ABVB 4YSYB 3AEVA 1IUEA 5I2YA 3IT6B 2EZVA 1F9PA 3GTOB 4HR7B 3BYYB 5FO7B 4RA8A 4LF5Q 1OXSC 4YY3Q 2AMCB 1RJTA 3VR5A 1VQLA 1E2VA 1WSPA 3KYDD 4LJZC 2IY5B 1K8OA 3P42A 1YQ3B 4BKSD 1KDCA 5M3MG 2CW0C 1XPUA 3CD6A 4FXCA 3EJIA 2HDMA 5CORA 3FHWA 4NY0A 1JWAD 3R66C 4P1BC 3BG3A 4YCUA 4WJOA 3L16A 3QWZB 3TL5A 1B8AA 1IPGA 1FFUA 1C4CA 1XLPA 2DHZA 2M19A 3HVDA 1NY4A 2Q2TA 2LGYA 2K75A 2MBOA 4BBSH 4HROA 1TS4A 1QZGA 2PQAA 3N9YC 1N9WA 4DV2Q 3GTLB 1JWBD 2GLSA 4OVUA 2ZXOA 2LEKA 3SHLA 3DBRI 4DV1L 5FO8B 1CI3M 2PKOA 3FAHA 1JORA 3KWLA 2J0TD 4KKSA 4A3KH 1PGXA 2BB5A 3W5VB 2OCEA 2M0AA 5M3FH 2QKIC 4BBSB 4IDIA 2YU9B 4HAEA 1ZYRC 1Z9FA 3F2BA 1GUAB 1WXQA 2NBWB 3EGRA 3GDEA 2BDOA 3KUCB 2QHOA 2LVQA 2WXLA 4IPGA 4MTKA 2KD0A 1M4VA 2B2VC 3V96A 3Q3JA 5JPMC 1IL8A 1ZDXA 4A3KB 2OTLA 1E1OA 2FUG1 1JB3A 1LLRD 4IPCA 2PQAB 2WB1G 2HT1A 3Q3FA 3ZJTA 3N6RA 3C46A 1SB3C 4QY7A 2MBHA 1P9DU 2WGSA 3RZOH 1WVLA 2R93B 3MHSD 1PXUA 1X3PA 3P4SB 2R6GA 3WOFA 1PH9A 2H5XA 2L05A 4OELB 1HFNA 4DR2L 1VZ6A 2MJ8A 3PHWB 3V6CB 3KYHC 1RFAA 2JA6B 1QQRA 4JGHB 3SR6A 3JAMi 1DJRD 1EIFA 2WIIB 4UDUC 2IYDB 5I4DA 2KC2A 2EY2A 2RDGA 3DEPA 2JA8G 3M95A 4LF6L 4OEMB 4MGYE 2Y5CA 1X54A 5I6YA 2DN8A 4S0RA 4B3SL 4BVUC 3GQBA 4UHVA 2N7DA 1D7QA 1E90A 3GZNB 3N30A 3VR8B 5DPWA 2SAKA 2KDIA 4YWMA 1D5ZC 1S3SG 1KOTA 4QAYA 1Y1VG 4Q5VA 3VYSA 2F3VA 3P20A 1U4RA 3QG1A 4KGRA 4GLSC 3KJOA 2NVXH 1EY6A 4MTNA 4N6EB 1PZID 4CBVA 2JVCA 3NUHB 2L1BA 2FCSA 4PV1C 4G50A 4KHVA 4OW0A 1SNCA 3J81c 1EZ8A 3PUWA 1QZEA 3D6WA 3EROA 4V0BA 5JJIA 2RDBC 4FULA 1STGA 2EYMA 2G5DA 5IYBH 3PMFA 4A3FG 1IGCA 4A3LG 4RKBA 3W9CB 4PZ8A 3N52A 4P72A 4LDTB 2NVXB 3D3RA 4HSPA 2HTME 1SMYC 4BY1G 5E6PA 3BZKA 1J7BA 3JSVA 1PH4A 1PH5A 4POFA 2YEPB 1ZKHA 4HK2A 4C2MH 2NPTA 3PREA 4ANVA 3AE8B 5GQOA 3PLVA 4A8XC 2DNFA 3FEWX 1KXLA 1SIFA 1RWSA 2J4XA 2Z4IA 4HSVA 4FHKA 1YIJA 3S2HB 1HE8A 3RNCC 2LJIA 4ANXA 1GKHA 5C3EB 1SNDA 2KHIA 4BS9A 2K25A 3CCMA 2KBNA 2HD5B 2N3SA 1PHJA 2AYOB 2K28A 2YYZA 1FD7D 3S1QH 3P1MA 1LTLA 1CKNB 1SBBB 3R7QA 4ZRPA 3QIJA 3JSVB 1HR0L 2ZZPB 4IC7B 2O5JC 4IJLA 2J0JA 1VQOA 3HM3A 4DXGA 3TEXA 2L0CA 3IL8A 2NPTB 2WP8J 3MVVA 2Q2UA 2AL3A 3S1QB 5JEAG 1WJJA 4XIGS 1KHIA 2IW3A 1R4NB 3P63A 2G4SA 1H8CA 3RNGC 5FLXL 4CDCC 2KOXA 4DK5A 2ZNVC 3DVNU 2X69A 4WWPA 3VTUA 3B2FA 2KMMA 3S14H 3AU5A 3K5LA 3OOCA 4A20A 1F2ZA 4KV6A 4A3BB 1C77A 1KAAA 2JF5A 4JVZA 3APFA 3CWIA 3JVZX 2IJ0A 4QGUA 1DXMA 1CK1A 3TZDA 2HQEA 4FP5D 3I4MH 3AQQA 1FMAD 1GUGA 2KN4A 2RKSA 4DHJD 1MIUA 3UI3A 1ZP0B 4DAPA 2D10A 3MAQA 3H94A 2A69C 1VF7A 1P3QU 4HEA1 3SK4A 1IKMA 1I6VC 1PTOC 3T16A 3B08A 1FFVA 4K2LA 1FGUA 4GS3A 3I4MB 4XDCA 4BFRA 2GBRA 3ZQ4A 3W1BA 3DBRB 4HDOA 3N1ZC 2N7EA 3ENEA 3NE5B 1YHQA 3HM6X 1I7HA 3H0GG 3IKJA 2KX3A 3I57A 1E8WA 2CR5A 2RGFA 4LK0M 4TMAB 3HOWH 1E2WA 2QDFA 3OW7A 4IURA 5K36H 4IPHA 1MHXA 1RYJA 4MSMB 4RHSA 1E0BA 4CQNA 4HMIA 2RSUA 2Z59B 1QT9A 3BVGA 5AFWA 5AUKA 1A5RA 4NB3A 4IN3A 1LXDA 3P4RB 5LNK1 3EECA 3Q3MC 4EKUA 1RIPA 3A8JE 1Z5SB 5IYDH 5ELDA 3HOWB 2PPHA 2BF8B 4W9EA 4B95A 1UF0A 1SSOA 2EE1A 3F8TA 3CCUA 1C79A 1UWXA 2IGGA 2WXJA 3QO2A 1YEZA 3TMPB 4HN7A 2K32A 1UBIA 2KHWB 3NS8A 4DR4Q 2F0DA 4DA2A 2K03A 2OTJA 1YJ1A 2W54A 4LLGM 4BAXA 3S16B 3NJTA 4HEDA 2Q2IA 4D2KA 4LF8L 3P4QB 5ELCA 2K33A 2CWAA 4DK1A 5H8YE 5HI1A 1AE3A 3X0WA 5C0XH 1FYCA 3R3OA 2MA9B 3PUZA 1CHPD 2AUKA 4HMJA 2V3PA 1IBKQ 3EFCA 3ZXRA 2OWOA 4KDLB 3CP0A 1B70B 3SK6A 1NCVA 1ET6A 4P75A 5J18A 4KV2A 2JA7G 2BDNA 3OPOA 2IO2B 2N0SB 1TWGB 3AI5A 3CPFA 3T53B 1QE6A 5FLMH 3VAWA 3K7UC 4FF1A 2JYTA 4E3CA 3BDOA 1SE9A 2K4KA 3HZXA 1IBMQ 3ULPA 1XXGA 1X1MA 3I90A 4GKKL 2J52A 4RNAA 4CYEA 3G4SA 4GN3B 1JMLA 3U4VA 2YTVA 1K73C 2L0TA 1YOVB 3QIAA 3VRBB 1I35A 2F4VQ 1P7FA 1XPRA 2D3CA 1ET9A 2B63B 4NQKE 3H3VC 4USAA 1EWHA 2C5CA 2PMZE 5GROA 2BWFA 4YTNB 1WTQA 5KNDA 1L4DB 3A5ZB 1QZHA 2EJMA 4DV5L 2CCZA 2INCC 1SLJA 4JQWC 4LNIA 1CJEA 3VXWA 1ENAA 2BT6A 3UDXA 4HXDA 1BCPD 2J42A 3I72A 1XNRQ 3TP6A 3I7FA 1HNXQ 4HPLB 3PO3B 1K8GA 2JY6A 2K5PA 1S5DD 1XMOQ 3FKIH 1XO3A 1DYQA 1Y8OB 4JI7L 1OXVA 2KJ6A 4LK1C 4W9DA 1GVPA 2K7VA 1YX6B 2K3UA 4DNTB 1DONA 3RFZB 4DWFA 5BMHA 3MFYA 4ZRJA 2DX5B 1ZXIA 3DEOA 3CCVA 3DCGA 1EY0A 3RD4A 1CZWA 3A8IE 3PO0A 3KBGA 3FKIB 4CDEC 3I73A 1BKBA 3ND9A 1K83B 3GTQB 2K8BA 3WIMA 5KNBA 3N20C 4HRSA 1YJIA 1FIQA 3A9KA 4HWIB 4JX1C 3PZDA 3K0XA 1Q7YC 5L83A 4Q0FA 1RD9D 4OO1G 2FCMA 4JI1Q 1QKZA 4LFAL 2F0NA 4DKAC 1YQBA 2W3RA 5T8IA 1YZ6A 1FNUA 2B2WC 1WGRA 1BT0A 2PTLA 2CHXA 2QC8A 4R4QA 1AYFA 1N34L 1PFBA 4DV1Q 4LNQA 3NTKA 3R2IA 2HE7A 1BCPF 2K5HA 4AQYL 1L0WA 4ZOHC 3PRPB 4J1MA 2E3TA 2ZJRA 5AEKB 1XQQA 3PZ7A 3CW2C 4C00A 4BY7G 2MBEA 2F0FA 2BS2B 3R3MA 2BPSA 4DU9A 3A9KB 4QUFA 1OQQA 1N5WA 3CCRA 5GAEC 3KLWA 1TKYA 1K8RB 2GBJA 1PH2A 3DWGC 4ZAIA 1A3TA 5A2QE 4ZRZA 3PRMB 1B9MA 2FIFA 3VDZA 2J0MA 4MH0E 3W5UB 1KF6B 4URKA 4JI3L 2N9PC 2D3AA 4GDKA 3TSSA 2D11A 1L5PA 3PGEA 2O2LD 3M85A 4A3MH 5C3EG 4YY3L 2MUYA 4LF5L 2EYLA 2LXJA 1ISNA 5JEAJ 4A6QA 2L83A 1L7YA 3LGJA 4K14A 1WTWA 3AU7A 4C3JH 3UF8A 2N9LA 5IN7A 3HKZB 1H9KA 1PDQA 3KF6B 4EVOA 2KMCA 1A2TA 2ZTDA 1WCMG 2NN6H 4K7UA 3R7RA 4A3MB 1BVSA 1I4PA 2K05A 2ZJDA 1KFYB 4IM2A 4AP4C 1Q8KA 3NWSA 2HUGA 1HZ6A 5M9OA 4HPPA 3VUYA 1Y1WB 3TCAA 4C3JB 1IYVA 1YD8U 1LTSD 4GDKB 3VYUA 2E2IB 3KVFB 4HJ7A 2WWZA 4FDBA 4QIWE
chains in the Genus database with same CATH topology
1XX8A 2SOBA 1ICWA 1L0YB 2EOTA 1Q8IA 4HCEA 4KY6A 2JQRB 1AP0A 3FC4A 4WH4A 2Q5WD 3Q8AA 5ELBA 1TT2A 2VZKB 4C80A 1A70A 2MJEA 4REZA 2BS4B 2ICEC 3TEYA 1K50A 2OHFA 1TKWB 3J7AV 4RH6A 1JQYD 2QMTA 2X6LA 1SSNA 1ONLA 1LTGD 2RSOA 1RF2D 2CHBD 1V1OA 3K7AB 2CJOA 5CV7A 1G91A 4CHTB 1I50B 2L5TA 3PUYA 3QJYA 4OZCA 3DWPA 3G7LA 1P7EA 4QIWB 1PFMA 2KCNA 4IUNA 1AEXA 2E2JB 5ELEA 3TP8A 3BK2A 2NUCA 1XF5L 3MZ5A 2E2DC 1CQFA 2LUMA 5LL6X 1XCQL 1IYUA 4IFDI 4A3DB 3UI2A 2AQ2B 1QOGA 2WXPA 2PQEA 2MPMA 1GUOA 2RBMA 2F0LA 1A2UA 4KGSA 1HXYD 2KDMA 4J6HA 2RVLA 2PW9A 4ULLA 3KQ4A 4LMQD 3GO5A 1QWYA 1VLBA 3HOVB 1BMLC 4WORA 1VDZA 5CV4A 1SNMA 5IIFA 2BA1A 1E7PB 5FO9B 4L8JA 2LMCA 3GS2A 2FINB 4KD4A 5I2XA 1J7CA 1G2TA 1F2RC 1AZQA 3DXJC 2D5GA 2B2VA 1LV9A 3H6MA 1C76A 1BR9A 2O4XA 1XCTL 3NHHA 4H7BA 1F9RA 2RSNA 4WQMA 1WWTA 2L55A 2BCOA 1EEID 5BN5A 5EE0A 3TZUA 2KACA 1PMRA 5EBCA 2LMCB 4JE3B 5JPNC 3A7AB 4N9TA 3E0JA 1LO5D 3QB3A 2B39A 2LY7A 1OXTA 4KY7A 2N55A 1I4GA 2XWBB 2PW5A 3Q8EA 4BA2I 3GTKB 1LTBD 5IGEA 2QEJC 4K5XA 2KCCA 3BDLA 4EQOA 3NWTA 1JICA 2EDGA 2IT1A 3KK7A 1LACA 1N62A 4ZHPA 4OIJA 4G7ZC 4B0EA 2ACZB 2OT2A 4K5WA 5CGKA 1K52A 4S3SA 3A55A 4WWMA 4YSZB 2JEAI 5EE1A 5DM73 2B2YC 3MA2B 4WAFA 2WACA 2IDYA 3I4NB 5D65A 3GV3A 1V8CA 4A3IB 4A90A 4KJNA 3HOYB 1Q1EA 3ZYYX 1ESRA 4C3HB 5HG2A 2OXPA 2HCCA 2L1AA 2B2TC 2RDHA 2C9OA 1WD1A 5COYA 2NTSA 3KF8A 5HGTA 1AWDA 4FF2A 3S2DB 4FXKC 2IX0A 4H44C 5IT9E 1EYDA 5BMIA 5JXVA 1AZPA 2JXMB 3L9AX 1EWCA 3CQZB 3X3NA 4C3IG 4KK7A 5EKKA 5D7GA 4PNYA 1KLUD 2WKCA 3L7ZC 1AW7A 1EQTA 1EY8A 1TS2A 3BDCA 4RFBA 1A15A 1J9OA 2D62A 3FILA 2KEEA 4LTUA 2E74C 1LTTD 1RODA 1SYGA 3E9SA 4QCLA 3NPPA 5HFYA 1MSGA 2EY5A 2HDEA 3BYTB 1IW7C 4MM3B 1HA6A 4J8QA 1QOHA 2IX3A 3SXHA 1EY4A 2Z1CA 2ZXPA 1ESFA 4K6DA 3IAYA 1QF6A 3CIRB 3HUIA 1Q90A 1PTOH 3FILB 3T56B 5E1FA 4A3GB 3VR9B 3T4AC 1EIGA 2INNE 1HPCA 3BIID 1NVID 1OXXK 1YNND 1YN4A 3MXUA 1PZKD 2KJXA 2MH7A 2WDQB 1PTOB 2F3WA 1B4OA 3IAS1 1FCLA 1SNQA 4EGVA 1FD6A 2M9VA 1B3AA 1C8CA 3VR3A 1HTLD 3NTHA 1SEBD 2A68C 3U2SC 3FPUB 4B9WA 4F8MA 1EM7A 2WQYB 2EVBA 2NWGA 1AFPA 5A35A 2QCPX 1HQRD 2A5HA 2J53A 5JOBA 2RDFA 1UGJA 3K0YA 1FO4A 2F0IA 1QILA 1GHKA 4KKJA 1Q10A 4RF0A 4IZ8A 3D4WA 4XQNA 1FRRA 1EQVA 1HUNA 4CJ2C 1E10A 3L3OC 4NP5A 4IUTA 1DCZA 2OEOA 5EGTA 1JC7A 1ILQA 5F2DA 2YEPF 5M3FB 4RGNA 4NAMA 3Q8CA 5KIXA 2KUMA 1STHA 4FNFA 1K51A 1T5XD 2Q8RE 4IQZA 2KWDA 4CJ1B 5E6JA 1VCIA 4R9WA 1L4ZB 3AE2B 4O1NA 4ZUIA 4DNRB 3RZOB 1QOFA 1FR3A 3FDTA 2XRSD 1V8QA 3V3XA 2F0PA 3AM9A 4G7HC 4A93B 1H9RA 2H89B 4L1BA 2IL8A 3R2TA 1GB4A 1DOXA 3ONAB 1EIHA 3C1EA 2AQ3B 5C0XI 5CV5A 2QILA 3AE5B 3A7LA 1F0ZA 2XRQD 1U4LA 3LXFA 4KGTA 2GA4B 2B2WA 1KNAA 3VYTA 2K1BA 3JAME 1YQ4B 4ID6A 2BE5D 4RGOS 1I3QB 2MHVA 4ODGA 1IBXA 1QOBA 4WRDA 4X3UA 4HCSA 2VB2X 3AE9B 3T3NA 3ND8A 4NKLA 1N61A 3NBIA 4TSSA 5DM63 3KWVA 1CA5A 1I4RA 1TR5A 1I6HB 3NP8A 3I3CA 3SR1A 4O42A 4C2MB 4RF1A 2RPVA 3GTPB 4HKZE 4XWTA 4ARIA 1SAPA 1ILPA 1IBXB 1STNA 1W6JA 2L12A 5I6WA 2DY8A 1L6UA 3EFXD 1WD0A 4Z9CB 4ZHOA 4XDXA 1KNEA 3T13A 4RAUC 1F2MA 3NZ3A 3GP7A 3AEDB 1NEKB 2W55A 1G2SA 2D9UA 3NS1A 5M5WB 2L52A 1O7ZA 1SFOB 3NVVA 4C7ZA 4US8A 1I4QA 4QMGA 3NRZA 4NJCA 4ITKA 3QOLA 5C4XB 4L6TB 1VF5C 3S14B 2PIAA 1SIJA 5M5XB 1G8ZD 3RPFC 4IFDG 5D3DA 2M56B 2F1MA 1STEA 1ZXTA 2NZ1D 4G7OC 3OWEB 4XQJA 2GI9A 1SE2A 4FXDA 2K9XA 2WDVB 2BOSA 1K53A 3HRZC 1JWUD 4WFN3 1YN3A 4M0WA 3KUPA 1EFID 2LFNA 1HHVA 2E75C 2PNRC 1RTOA 3PZ8A 4YWGG 3VYRA 2CVRA 3P7JA 4KKTA 4C56C 3VRAB 4PT5A 2NN6I 1S4ZA 2A6ED 2EYHA 3RUZA 3NQTA 1WYGA 1OFFA 4C1NK 3GTJB 4IUVA 1XEEA 1EYCA 5J22A 3I91A 1J8IA 4G57A 1JWSD 1A3UA 4ZYSA 3BVMA 3MHZA 3P4PB 1XLOA 4EQNA 5IGBA 4MT5A 1ML0D 4EE2A 2VUMB 4F7XA 2KHSA 2L4NA 2ZW1A 3TBIB 2WAQB 2QF7A 3WCQA 3BZDB 4KTAA 3TN2A 4DXFA 1YNJD 4X3SA 1HRJA 3DWAA 1XYIA 3GD7A 2LGIA 2EY1A 2VZKD 2A6HC 4XQQA 3AEAB 3H8HA 4KKUA 3ZJUA 2R3ZA 1DOYA 2L9HA 1Y8NB 4P2CB 3JAML 4YT0B 1TJEA 5KGUA 3HP3A 2WNMA 2KECA 1YMHE 3RZDB 5CC4A 2G1EA 2JSOA 3PIP3 4XYOA 4M1UB 2ON8A 4DGZA 1VR9A 3W3AA 1R4PB 4RKLA 4KD3A 1B9NA 2R7ZB 1SXTA 3QOJA 1YNNC 1BO0A 2RQXA 1LT4D 2B2UC 2GRIA 1TZOA 1X32A 1U4PA 2EJGC 2MP1A 1MI0A 4JWUC 1Z7TA 4XWWA 3ITPA 1SJHD 3AV8A 4IKGA 2LHEA 3TP5A 1QB5D 4OVZA 1FRDA 3K5MA 3Q22A 1DD2A 5FKAC 2B2YA 4K8JA 1RFKA 1Y8PB 5C5MA 5IGFA 2EYJA 1S5CD 4RCOA 4WJWA 5T1GA 4X3KA 3Q69A 3TDQA 1LTAD 1KABA 1TS3A 3BVZA 3DUZA 2EPBA 3M4YA 3RLFA 5CV8A 3LWEA 2SNMA 1A3VA 2B2TA 4DF7A 5G3LD 1ZOYB 1RTNA 3DMUA 5H92C 1F2YA 2CW0D 2BS3B 3U4EG 1TY2A 2F0GA 2F0EA 4MH8A 4PQXA 4YSXB 1KLGD 3Q23A 3G6JB 2K5DA 3AMUA 5J1ZA 4FF4A 4XDDA 2IGHA 4QF4A 5EPJA 4JK1C 3HVZA 4IFDJ 1JQ4A 1JCKB 2WXNA 1WTRA 2I2YA 2A74C 1ZYRD 4R3DA 1QCBD 4CJ0B 2PYKA 3NXWA 4I65A 4TQ1A 1RKNA 1HQMC 5G3LF 4WURA 2F0UA 2IWHA 3OMGA 5C44B 1L6VA 2AWOA 2DNCA 5LHY1 3J80E 2EY6A 4QUCA 1GUSA 1BBXC 2Q8IB 3B2GA 5IGGA 1STAA 1CFMA 1H9JA 5CMDA 2DBYA 1MHHE 1WTVA 2AX5A 1HA5A 1LT5D 1SYDA 3M7GA 1JOQA 2SNSA 4AQ7A 1BF4A 4H2AA 2KQ4X 1U9RA 1H9MA 5EKLA 3T3OA 1GPXA 5M3MB 3MXPA 3VR4A 4GZYC 1SF0A 3OWFA 1PRTD 1SMYD 2FHTA 3CKIB 1BOSA 5E4WC 1T6BX 2EELA 3WOEA 3AB9A 3KLRA 1B44D 4V190 1VMCA 1IKLA 5EE3A 4A55A 5MPOA 2NB0A 5C0XG 4YTPB 5C3JB 2LS01 4E6IA 4UAIA 4ZK9B 2G9DA 1DM0B 1RCVD 4H0LC 3TEZA 1ROEA 3SK8A 2EKIA 1V1PA 3S9WA 3KLSA 5JAVA 1CT1D 1HTPA 3NBHA 2WB1B 3C1FA 1SYFA 1GHJA 3Q24A 1JW9D 1F9SA 1II3A 2RMMA 1VDVA 4XYQA 1SJED 2ZW0A 2XVSA 5EBDA 1PRTF 3HEJA 2PVGC 2V4DA 2IX1A 1TU2B 4CKBA 3R8BA 1C78A 2JA8B 1V1PB 2ZT9C 2WP9B 1SYCA 2A69D 1O7YA 5A2QL 2JYOA 3PUXA 4K2KA 1Y1VB 2ICIA 5EE9A 2WXGA 3J9CA 4N9PA 4IUUA 4AS1A 3AE1B 1VJKA 1UUPA 1E2ZA 1SDFA 3QWNA 1DOLA 1N60A 2A6EC 2WU5B 3T51B 4BY1B 3NVZA 1SYEA 2PPBC 2K5QA 3WDNA 2WXRA 1ZUD2 2V0GA 1CTMA 3MXGA 1EU3A 1M8AA 4ARCA 4U68A 3C8YA 4U673 1PFNA 1DGJA 2R61A 5J39A 3W2DA 1XLNA 3LYYA 2Q8TA 5JEAH 2JP1A 4L2YA 5ISRA 4L23A 3I8ZA 1SNPA 2W82A 1D5XC 3K59A 2F0JA 3K6OA 2IPKD 5E4XA 2W3SA 3Q8BA 4RGMA 1QG7A 2FBWB 2WXHA 2F0OA 4MN3A 3BWUD 1BCPC 3HS0C 4C3JG 4L63B 2DWQA 1EYAA 2D5DA 3M7NA 1NR2A 2HDLA 2WS3B 1O80A 1UAPA 3J80L 1FGBD 1TYGB 5IGDA 1O7LA 2Z4HA 2MGSA 2CQAA 2O5IC 4NDXA 4H13C 1N63A 1KDAA 1C9FA 4XE0A 5E3FA 3BS1A 5TSSA 5AUIA 2JEBI 1D5MC 2X6GA 3IFTA 2GB1A 1CZPA 2E76C 1JOOA 4OZBA 3O13A 2DNEA 3DHQA 3SK5A 1ZE3D 1E9MA 2BTEA 2WDRB 1JALA 1YNTE 3A56A 5C3WA 1MBYA 1O78A 1ZDVA 5EQ0A 2TSSA 3LB8C 4N58A 3FRPB 3PUVA 3S1RB 1FCCC 3Q6SA 1VMPA 2NYZD 2PMVA 1NSNS 1ACCA 2K6AA 1QNUA 2KEDA 1H9SA 4KN7C 1TQOA 1PDXA 4DN4M 4ABNA 4RGTA 1T5EA 1LT3D 2BYTA 2F4IA 2WV6D 2F03A 4NZLB 3SDZA 1BQQT 4F87A 4NAWB 2DYMA 5GXGB 4NMZA 3HGBA 5C0XJ 1GXDC 4Y7NB 4WIPA 1PGAA 2FFKB 1LT6D 5BYSA 1H9SB 1TY0A 3MHBA 5BYRA 3MTSA 2JA7B 2I07B 5KYIA 4KHZA 3LWUA 2PW7A 4IALA 2OEDA 3D31A 4DFAA 1TS5A 2F0HA 5C4JB 1JE4A 2LFIA 2KQ3A 3P75A 1BUVT 1ZKOA 1D2BA 4YTMB 1D1IA 1CZGA 5EKIA 1HCZA 5JJZA 2EYPA 1L0VB 4OZAA 4MHEA 2WINB 4XXEA 2WKDA 4CKEA 1Z47A 4M8AA 3NSWA 5C4ZA 2WXKA 2H4OA 3D4RA 1F2LA 2JU6X 1GAQB 3E56A 2JYEA 1FXIA 2PCFB 5D3IB 2JE6I 2AWNA 1L0XB 2K04A 2M00A 2XIWA 3U7ZA 3E5SA 2A73B 1PFDA 2VB3X 3V2TA 1Y69U 1S5BD 4OO1H 4F88A 1OQRA 3AE3B 1QOAA 1CHQD 1HUMA 1KDBA 4ILWA 1QLBB 3C3LA 4J3OD 3AEFB 2B2UA 4KKIA 2KOLA 3S15B 1MSHA 3S1MB 1LTRD 3HG9A 3OMCA 1AN8A 1D1KA 1GUNA 5IT9L 2FJ2A 4G4KA 3R93A 2QSDA 3LX0A 2JXTA 2H1EA 3EVQA 2ZXRA 1WTPA 3AMZA 5G5HA 4K5VA 2DLBA 1VRAB 2MJ3A 4BY7B 4US9A 5C3XA 2SEBD 1PRTC 5EJWA 1F9QA 2FE8A 2X38A 3DWMA 1GOZA 5DEHA 1F2RI 4TQ0A 4C3HG 1WTXA 1PZJD 1DZ1A 4X3TA 3IAM1 3TEWA 2BA0A 5C6AA 3AB5A 3OSOA 1NR4A 1DOMA 3AE6B 1ENCA 2F0SA 3FVQA 3SFDB 3EUB2 1WCMB 2Y0SB 2XN9C 5G5GA 2EYFA 3LNNA 5CV6A 3J7YW 1Q12A 1CA6A 1B2TA 2EYOA 2WXFA 3E6ZX 3AEGB 5FOBB 2N88A 3NVYA 3NTIA 2MJDA 1JR0D 1RM6C 1BNZA 1PLFA 1SE4A 1VZ8A 4ZKBB 3TP7A 5NUCA 2F0QA 5CV9A 5T1IA 1B1ZA 3MWYW 3Q8FA 2NTTA 5KRUA 2TMPA 5I9PA 3SFEB 3DM1A 3NVWA 5IOCA 3K5OA 3M3YB 2N7JA 2FMMA 1EY7A 1STBA 3ERQA 1CQVA 3J81E 1R4QB 2PLPA 4XTCS 3MC0B 5DNFA 2XSCA 5C5LA 5HURA 5KYLA 2ID0A 2J7ZA 2KAJA 1KTKA 1EZ6A 1JRPA 3M4OB 1MPEA 4YXDB 2NBFA 1HZ5A 1NYQA 4FXGC 1XTCD 1B53A 3HOUB 4KN4C 3TMEA 1R9TB 4ZLTF 3OHXC 1W6KA 3VA5A 3SVMA 4ME5A 2Y5PA 4BA1I 1MD2D 5BYQA 3NQIA 4JPSA 1B9RA 1EEFD 3VA7A 2DY7A 2QJLA 4FYDA 1NUCA 2R92B 5M5YB 1FNVA 4LAAA 2PZTA 2JA5B 2K01A 4ZKCB 5I9OA 1MVKA 2INPE 3VQIA 1UNSA 2N9KA 3VR6A 3EQLC 4KJOA 5JVG3 3K5NA 1WGKA 2NVQB 4FO2A 1I4XA 3D4DA 4TKOB 4Q2JA 3GV6A 5ELFA 5DAUA 4N59A 1OXUA 4DAVA 4IOIE 3PIO3 1RHPA 1MGSA 4A9AA 3NK9A 2K22A 1LTID 1IW7D 4P6VF 3OIPA 4ZQ3A 5C2TB 5CBAE 1SE3A 2E6XA 2K0PA 2EXZA 3S1NB 1J7AA 4A3EB 2PMZB 2XNAC 2Y3AA 4KX6B 3HOXB 4OIKA 1TVXA 3CU7A 1EY9A 2NVTB 1C4AA 5KNCA 5IODA 1GUWA 1KRHA 1B50A 2H88B 1NI3A 3AE7B 1D6EC 4RHRA 1EL0A 2L11A 2A68D 2MEKA 3MP9A 2RA4A 4R8NA 4TRDA 2JX5A 2EJFC 3KLSX 1WRIA 1HEZE 1TWCB 3AECB 3KBXA 4EQPA 4ZUJA 4OGQC 3DWQA 2NVYB 1MI2A 4C3IB 4CGYB 2ENBA 3NUCA 2F0VA 5KEEA 5FR3A 1IHZA 3IT4B 1EU4A 1ZEQX 1YN5A 3BK1A 4K8IA 3PO2B 3U9OA 3X3MA 1YJJA 4C7YA 4FF3A 3S17B 3J81L 3PV0A 3AH7A 1JWMD 1IGDA 2V3NA 3AE4B 2F0MA 4NW2A 1BCPB 1UEAB 3H09A 5IGCA 3GTMB 4P16A 3K58A 4GDLB 4DAYA 5FK9C 1HFGA 1EY5A 3HOZB 2BE5C 5HHDG 1I4HA 1FM0D 4DK0A 4HJGE 2WXQA 2B8FA 1GB1A 2XWJB 3D8GA 1NAPA 5CBEE 1ZPSA 2OF1A 5K36G 1S5FD 2ONQA 2QIEB 3VR2A 2G9HD 2JSVX 3MFGA 5C4HA 1K8MA 1RDPD 3MXNA 1F77A 2HCIA 3K57A 1Y56A 1GUTA 2BB6A 3ZGZA 2KVMA 4JBWA 1TKGA 1LABA 1NENB 1N5XA 1D4BA 3J7AF 4I7ZC 5CYUA 4KY5A 1C4PA 2NMQA 1G6ZA 1FXAA 4CKCA 1E6EB 3IXSA 3P1HA 4XT3B 1XWEA 2BW2A 3U52E 1TIID 2AUJD 4C1NI 2CJNA 1FNWA 1TWAB 4FVMA 4B08A 1SNOA 3AEBB 4TQUS 3I4LA 1C48A 2F0WA 1EWYC 3SE0A 1Z6HA 2B8GA 5K5PA 2SDFA 3H91A 3ETRA 2FMCA 4YIJA 2WU2B 3A8KE 1BUIC 1E0ZA 3Q0AA 3AN1A 1G291 1NYRA 3CRLC 3GB1A 3B9JA 1EOTA 1SYBA 4BWGB 5BN4A 2I46A 1ZXHA 3TUOA 5LL6S 2Z8LA 5D14A 1A6XA 2V4IB 1FEHA 2WXOA 2PO4A 4HKQA 3SEBA 4MACA 3AEEB 3HRDD 4OHJA 2K5WA 1PTOD 1BXTA 3U9SA 2L32A 2IGDA 4PMWA 1C4QA 4R8IA 2VNUD 1CM9A 1OO9B 3MJ5A 5JVH3 4OL7A 4A3FB 1V97A 2PZWA 2AQ1B 1DOIA 1XLQA 1V43A 1JROA 4AYBB 1WTOA 3EA6A 3GTGB 3ZJVA 1GJXA 4ZRQA 4JWSC 2QDBA 1TWHB 4IUPA 2JZPA 1STYA 4KMUC 3IFDA 1ENFA 4PMBA 2LKVA 3W1SA 5EPKA 2D2CC 1S5ED 2F0KA 4RCNA 3FPPA 5EPLA 1PGBA 1PTOF 4PMCA 1PYWD 4A3JB 3OIQA 1PUTA 1U4MA 3L4PA 1VZ7A 3CHBD 2KA7A 1YNJC 3F2UA 1DOKA 1TWFB 1Q3LA 4BBRB 3RMHA 2WXMA 1PRTB 4OO1I 1JOKA 3URYA 1R7SA 2NN6G 4QB4A 4IFDH 2PVOD 2WXIA 2LHDA 4HTHA 2B76B 3CRKC 1BDOA 4RWSC 2F0TA 1Q1BA 5BMGA 1TKEA 2E2HB 4B0MA 2CU3A 4DQOC 2VXWA 4KI0A 3FMCA 2WLBA 1X3QA 3D6CA 1QJOA 2A6HD 3H0GB 2DYOA 4K6LA 3A54A 5FLXE 2JWUA 1QNKA 2BBCA 4IUQA 1KH0A 3I9V1 3MEHA 1UWMA 3I70A 3V05A 2M2LA 5CR3A 4B9XA 4XT1B 3C2PA 2I38A 2PZUA 4MIUA 5BN3A 1T3QA 4YSYB 3ABVB 1IUEA 5I2YA 3IT6B 2EZVA 1F9PA 3GTOB 4HR7B 3BYYB 5FO7B 4RA8A 1OXSC 1RJTA 3VR5A 1WSPA 1E2VA 4LJZC 1K8OA 3P42A 1YQ3B 1KDCA 4FXCA 2CW0C 3EJIA 2HDMA 5CORA 1JWAD 3BG3A 1FFUA 1C4CA 1XLPA 3HVDA 2M19A 4HROA 1TS4A 3N9YC 3GTLB 1JWBD 2ZXOA 2LEKA 3SHLA 2PKOA 5FO8B 1CI3M 3FAHA 3KWLA 1JORA 2J0TD 4KKSA 1PGXA 3W5VB 2BB5A 2M0AA 2QKIC 4BBSB 4IDIA 2YU9B 4HAEA 1ZYRC 3EGRA 1WXQA 2BDOA 2WXLA 1M4VA 2B2VC 3V96A 5JPMC 1IL8A 1ZDXA 4A3KB 2FUG1 1JB3A 1LLRD 3ZJTA 3N6RA 3C46A 1SB3C 1WVLA 2R93B 3P4SB 1PXUA 1X3PA 2R6GA 3WOFA 1HFNA 1VZ6A 2MJ8A 2JA6B 1QQRA 3SR6A 1DJRD 2WIIB 4UDUC 5I4DA 2EY2A 2RDGA 3DEPA 2Y5CA 5I6YA 2DN8A 3GQBA 3VR8B 2SAKA 1D5ZC 4Q5VA 3VYSA 2F3VA 3P20A 1U4RA 3QG1A 4KGRA 4GLSC 1EY6A 4N6EB 1PZID 4CBVA 3NUHB 2L1BA 4PV1C 4KHVA 4OW0A 1SNCA 1EZ8A 3PUWA 3D6WA 3EROA 4V0BA 1STGA 2EYMA 3PMFA 1IGCA 3W9CB 4RKBA 3N52A 2NVXB 3D3RA 4HSPA 2HTME 1SMYC 1J7BA 2YEPB 3AE8B 4A8XC 3FEWX 1RWSA 2J4XA 2Z4IA 4HSVA 3S2HB 2LJIA 5C3EB 1SNDA 4BS9A 2K28A 2YYZA 1FD7D 3P1MA 1SBBB 4ZRPA 2O5JC 3TEXA 4DXGA 2L0CA 3IL8A 2WP8J 3MVVA 3S1QB 5JEAG 4XIGS 2IW3A 3P63A 5FLXL 2X69A 3B2FA 2KMMA 3K5LA 3OOCA 1F2ZA 4KV6A 4A3BB 1C77A 1KAAA 3CWIA 2IJ0A 1DXMA 1CK1A 3TZDA 2HQEA 4FP5D 1FMAD 1GUGA 2KN4A 2RKSA 3UI3A 1ZP0B 4DAPA 3MAQA 3H94A 2A69C 1VF7A 4HEA1 3SK4A 1IKMA 1I6VC 1PTOC 3T16A 1FFVA 4K2LA 3I4MB 4XDCA 3ZQ4A 3NE5B 1I7HA 3IKJA 3I57A 4TMAB 4LK0M 1E2WA 3OW7A 4IURA 5K36H 1MHXA 1RYJA 4CQNA 4RHSA 1E0BA 4HMIA 1QT9A 3BVGA 5AFWA 5AUKA 4IN3A 3P4RB 5LNK1 3A8JE 5ELDA 3HOWB 1UWXA 1SSOA 2EE1A 1C79A 2IGGA 2WXJA 3QO2A 4HN7A 2K32A 2F0DA 4DA2A 2K03A 2W54A 4LLGM 3S16B 4D2KA 4HEDA 3P4QB 5ELCA 2K33A 4DK1A 5H8YE 5HI1A 5C0XH 1FYCA 3R3OA 3PUZA 1CHPD 2AUKA 4HMJA 2V3PA 3SK6A 1NCVA 1ET6A 2BDNA 3OPOA 2N0SB 1TWGB 3T53B 1QE6A 4FF1A 2JYTA 3BDOA 3HZXA 1XXGA 3I90A 2J52A 4RNAA 1JMLA 3QIAA 3VRBB 1P7FA 1ET9A 2B63B 4USAA 3H3VC 1EWHA 2C5CA 4YTNB 1WTQA 5KNDA 1L4DB 2EJMA 1CJEA 1ENAA 2BT6A 1BCPD 2J42A 3I72A 3TP6A 3PO3B 2K5PA 1S5DD 1XO3A 1DYQA 1Y8OB 1OXVA 4LK1C 2K7VA 2K3UA 4DNTB 1DONA 3RFZB 5BMHA 3MFYA 1ZXIA 3DEOA 1EY0A 3RD4A 1CZWA 3A8IE 3PO0A 3KBGA 3FKIB 3I73A 3ND9A 3GTQB 1K83B 5KNBA 4HRSA 1YJIA 1FIQA 4JX1C