3WCQA

Crystal structure analysis of cyanidioschyzon melorae ferredoxin d58n mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVNQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the electron-transfer ability of Cyanidioschyzon merolae ferredoxin by a one-point mutation - A high resolution and Fe-SAD phasing crystal structure analysis of the Asp58Asn mutant
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 24
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3wcqA00
1XLPA 3LB8C 4P6VF 1FXAA 1EWYC 1WXQA 2KMMA 2L83A 3W5VB 1NI3A 1TKYA 2WQYB 3B9JA 3B2FA 1ROEA 1UWMA 1E0ZA 1FRDA 1T3QA 1ZP0B 3W5UB 2W3RA 1N61A 3WCQA 1RFKA 3AEGB 3SFEB 1AWDA 1NEKB 2QJLA 3ABVB 4FXCA 2E3TA 1FIQA 3AE5B 3AECB 2PKOA 2Y5CA 5G5GA 2K9XA 1J7CA 1NENB 4USAA 1FRRA 2H88B 1QOBA 1XLQA 4ITKA 5EE0A 4YTMB 1FXIA 1PFDA 2PVOD 5MPOA 3AEAB 2PVGC 3NRZA 2B76B 1JALA 3L4PA 2W55A 5C3JB 1N62A 1QF6A 2H89B 1N5WA 3FAHA 2G1EA 1DGJA 1GPXA 3KWLA 4WQMA 1E7PB 1TKEA 5H92C 1RYJA 1FO4A 1NYRA 4N59A 1VLBA 1OQRA 1L6VA 1NVID 3AE9B 3VRBB 2KAJA 2MJDA 4JWSC 1OQQA 4LTUA 2FBWB 2L52A 4ZHOA 1YJJA 5EE3A 1A70A 1ZOYB 1ZXIA 2CJNA 1N63A 3AE6B 1DOXA 1E10A 1E6EB 4US9A 5AUKA 5EE1A 1YQ4B 3RPFC 1JWBD 3VRAB 1E9MA 1L5PA 3W9CB 1FMAD 4WWMA 1JRPA 2WU2B 5AUIA 3AM9A 5G5HA 3NVVA 1WWTA 2WU5B 2WDQB 4YSXB 1JW9D 1R7SA 1JROA 1WYGA 1L0VB 3AB5A 3ZYYX 1CZPA 1L6UA 2M56B 3FC4A 2PIAA 1FFUA 1J7AA 3LXFA 1CJEA 3HVZA 1KRHA 1I7HA 2K5PA 2AX5A 3P4RB 1N60A 1QOAA 1TYGB 3NS1A 2WDRB 1VJKA 4IDIA 4YXDB 1QT9A 3AE2B 4HRSA 1XLNA 1TJEA 1YJIA 3NVZA 1J7BA 1QLBB 2MJ3A 2BS4B 4KX6B 3AEEB 4N58A 3AE3B 3SR6A 1IUEA 5EE9A 2DBYA 4JWUC 3SFDB 4C7ZA 4US8A 1F0ZA 5H8YE 1WRIA 3AN1A 4YT0B 4HROA 3DWGC 3VR9B 1YQ3B 2WP9B 3P4PB 1ZUD2 2BS2B 2QIEB 3AE7B 1KF6B 5C2TB 3DWMA 2WDVB 1PUTA 2BS3B 1SF0A 2N0SB 5GXGB 2CU3A 2CJOA 2MH7A 1RWSA 2WS3B 2W3SA 3B2GA 2JQRB 2EKIA 2Q5WD 2DWQA 1V97A 3AE1B 2JX5A 3NVWA 1KFYB 3EUB2 1VDVA 1XLOA 1SIJA 4C7YA 2MJEA 3AMZA 3P4SB 4JX1C 3NVYA 1JWAD 3PO0A 3AEFB 4A9AA 1V8CA 4YSZB 1WGKA 4YTNB 3P63A 4N6EB 3ETRA 3BIID 2LEKA 3HUIA 3P1MA 1FM0D 3AV8A 3AE4B 1DOYA 2W54A 3VR8B 3HRDD 2M19A 2WLBA 1PDXA 4C80A 1DOIA 2HTME 4ZOHC 3AE8B 1B9RA 2OHFA 1AYFA 1FFVA 1OFFA 2BT6A 1SB3C 3AEBB 1NYQA 4YSYB 3P4QB 2ACZB 1QOGA 3AH7A 1QOFA 1TKGA 1RM6C 3AEDB 4YTPB 1JQ4A 1GAQB 1XO3A 1N5XA 4ZHPA 3CIRB 2K22A 3CWIA
chains in the Genus database with same CATH superfamily
4LJOB 4K81A 4P6VF 2KQ7A 3ZDMC 2KWCA 4WJOA 2PE9A 1E8WA 1AWDA 2E3TA 1FIQA 1VR9A 3AECB 2SEBD 1YNTE 1WXMA 5EE0A 4GDLB 1FXIA 2PVGC 4B95A 5C3JB 3H1UA 1SJHD 1E7PB 2WXLA 3U8ZA 4P7IA 5AUKA 5EE1A 2WDTB 1MVKA 1VZ8A 2D3BA 4XGAB 5D6JB 5FR6A 2V1YA 2K6QA 1FPYA 3Q3FA 1IBXA 4G50A 2CKHB 1OTRB 2KOXA 3JW0X 2GRIA 3NVZA 2BS4B 3ECIA 4X57B 1SIFA 2ZCCA 3KUCB 4KKJA 4DQOC 2LHDA 2KLCA 2OEDA 2KHWB 4F8CB 4O1NA 4F7ZA 1JRUA 3URYA 1A5RA 4LDTB 1KF6B 1KOTA 2HTHA 3K9OB 1WE6A 3GE8C 3WIMA 1P7FA 2MBEA 3RNGC 3PPAA 2KFKB 4B6WA 2RR9A 4BBNC 1WZ3A 1QQRA 4KGRA 1WR6E 3P63A 4ZYNA 3T3NA 4MGKE 3AV8A 2UYZB 4MM3B 3A9JA 1C1YB 1TS5A 2Y5BB 1N6ZA 2KJ6A 4G3XB 4XDCA 4RGMA 5AZFA 1QOFA 4PYUA 1WSPA 4OVUA 5HHDG 1TTNA 2JT4B 3CWIA 1T5XD 1I4RA 2WGSA 2KMMA 2LZ6A 1C79A 1CK1A 3D32A 4G0NB 2MRPA 1TS4A 4HLEA 3VUYA 2AL6A 2PJHA 3AE5B 4OZCA 3ZJVA 3TJPA 2PVOD 4IG7B 3A9JB 1JALA 3L4PA 1C76A 2D2QA 2J53A 5J17A 3VRBB 1ZXIA 2WXKA 2RDGA 1PGXA 1OQYA 1WY8A 2LRWA 4GLSC 4F1SA 1JROA 2X38A 4DHZE 4FN2A 1L0VB 1TGZB 3Q6BA 3ZRFA 2ZNVC 2PIAA 3R66C 4B0MA 1L4DB 2JZPA 4H2AA 3DHGC 3AU5A 4JGHB 1SBBB 2VH1A 3H6NA 2KC1A 3AE2B 2INNE 1YJIA 2MLBA 4M8NA 3TIXA 2FNJB 1F0ZA 2NBWB 2M4NA 2MBQA 4D2KA 2PEAA 2PMVA 2KDEB 2CS4A 4P1CC 4LJPB 2DWQA 2MQJA 3BINA 2G45B 1JWSD 3A4RA 1V6EA 1YN3A 3NZUA 3PTFC 3P4SB 4JX1C 1R4MB 1VCBA 5IA7A 1WMHA 4N6EB 1NDDA 3L16A 3AE4B 5E6NA 3PZ8A 2NR2A 4KZ0A 3ZIMA 2KDFB 4LK0M 4A8XC 3GB1A 2Z59B 1FFVA 4YSYB 1S1QB 3O13A 2N7JA 2JWUA 2N7DA 2IY0B 1YD8U 2REXA 1E8YA 2LWPA 2V3PA 2BKRB 2L76A 5E6PA 2WQYB 4J6IA 3WA0A 4K1RB 4WWNA 5JHBA 1XT9B 1J0GA 1J7CA 2IBIB 4USAA 2H88B 2J0KA 2L7RA 2NTSA 5BYQA 2NTTA 3OG5A 2W55A 3HVDA 4WAFA 1FO4A 1L6VA 2KAJA 2MJDA 3HIZA 3L13A 3DCGA 4CO7A 1YJJA 5LNK1 1WJUA 1JWBD 3RNFC 3W9CB 3NVVA 1P98A 3E56A 4EKUA 2KDIA 4GDLA 1YJ1A 4MSMB 2QHOA 1HQRD 3AEEB 2EKEC 4ACFA 4K3CA 2DBYA 4JWUC 4ZRQA 1EO6A 2KT7A 3ZXVA 4FLHA 2Z8LA 3VVWB 4II2B 1SSNA 2IGGA 3NG0A 2QDFA 4KDLB 1T6BX 3CF6E 1KLVA 2I38A 2BS3B 3N3KB 2MH7A 2WXFA 4R3DA 1ZDXA 4N9F4 3SEBA 3LYYA 3UF8A 1S3SG 1M4VA 3RNCC 2FCNA 4XZ4A 1UF0A 3ZKJC 1V80A 4AJYB 1WX7A 4MJSA 5D3IB 2ZEQA 2JPHA 4IWOA 1R4MI 2KMAA 2KTRA 1F52A 2CHZA 2VZKB 3AEDB 2YVCA 3N1YC 4IWPA 1KLGD 4HKQA 4GU2A 2KJHB 3VTWA 2R2OA 5DPTA 3N9YC 4FJYA 1WXQA 4W9GA 1RFKA 4KSKC 3VUWA 5L83A 2WHIA 1RAXA 4DHJB 1D4BA 1VZ6A 3CSTA 3NRZA 2IO3B 1N62A 2H89B 2TSSA 4JL9A 1GPXA 3KUZA 4KV2A 2XNAC 2KDMA 4RM9A 3OAWA 1VZ7A 2GOWA 2IPKD 1JRPA 1WZ0A 4YWGG 4MGYE 2BQQA 4GXBA 1V9JA 4WJPA 5J18A 3HVZA 3H8HA 3TMPB 2KQ4X 2LVQA 2MBHA 4IDIA 2M17A 4KX6B 2MSED 3RNBC 2WXOA 3WAPA 4C7ZA 1E90A 4ARCA 2A5UA 2G9HD 1JMLA 2FIDA 1V86A 2JQRB 1JWUD 3VHTC 2M0AA 4C7YA 4FA6A 1Q0WB 4EZKA 4FULA 2L05A 3M62B 1OEYJ 2K8BA 3AEFB 3N1XC 4XC2A 1UNSA 4YSZB 3ZRCA 4RCOA 2RDHA 3NUHB 3ZXRA 4WIPA 2W54A 2AYOB 2NMQA 1B9RA 3RFZB 3AEBB 4S0RA 4JLCA 1XCTL 1X1MA 3CSFA 2K22A 1C4AA 3QA8A 3B2FA 1TS3A 1UWMA 3A9KA 3DBSA 1L0YB 3W5UB 3VTVA 4DXAB 2M8SA 4I6NB 3IXSA 1QOBA 4HCPB 5CHWA 5AZHA 1GOZA 1TKEA 4UDUC 3B0AA 2VZKD 1K52A 2AWTA 1NVID 1IGDA 2JYEA 2O6VB 1YQ4B 3J9CA 2WU2B 1JWMD 4JIOU 5AUIA 4LLGM 3CMMB 1FCCC 1R7SA 3ZQ4A 4L23A 4EFOA 3IVFA 4A6QA 1KRHA 2ICIA 4REZA 1KH0A 4YXDB 1IP9A 4NY0A 4MJSB 1QZEA 5H8YE 4KKIA 3UGBB 2LFIA 2RD0A 1MFWA 3EFCA 4EZLA 1MPEA 1TZOA 4TSSA 2HD5B 5C1ZA 4WJNA 3V3XA 4K7UA 3R7RA 5J2RA 1WGKA 5AZGA 3ETRA 1ZXHA 1HZ5A 3BYTB 1AW7A 3HK0A 4TKNA 4EE2A 2LJIA 4C4VB 3QIJA 4L2YA 4RM8A 2WX1A 2W9NA 1BMLC 3QC8B 3PRMB 2INDC 3T8MA 1HE8A 2BWFA 4FXCA 2MBOA 3R7QA 3B1LX 2KKCA 4A3OA 4WQOB 1E0ZA 3ZW3A 2LMCA 4OVVA 4PK1A 3KWVA 2W3RA 5LLIA 3AEGB 3SFEB 3ZNZB 4GN1A 3ZUNA 3L54A 1MHHE 2K9XA 4YTMB 2NBVB 4OZAA 3SDLC 2WXNA 4NQKE 3RZFA 4KIKB 1XEEA 3BVZA 5FKAC 1ESFA 3NHEB 3U2SC 3Q8EA 4US9A 2WWZA 2GBNA 2D5GA 2I1KA 4LNIA 2MBBB 4W9IA 3EHVA 3WAMA 4K3BA 2IO1B 2AL3A 4DWFA 2G4DB 2XN9C 3DHIC 4RH6A 4EZJA 1BT0A 1J7BA 1D3ZA 1XF5L 4BBNF 3GOEA 4US8A 3PZDA 1YQ3B 1YQBA 1ZE3D 2GBKA 3UI3A 3PHXB 1P3QU 3DWMA 1UGMA 4HPPA 2FIFA 2BYTA 2IY1B 2C9WB 4RF1A 2JU6X 4AWJA 1SIJA 2I1JA 2MJEA 3Q3NC 1YX5B 3AMZA 3KW5B 3EECA 3OLMD 5BYRA 1I4HA 1UH6A 3R2IA 3BIID 3P1MA 2N9KA 2WNMA 5EDSA 2KMCA 2WXMA 3VUXA 3MHSD 3OJ3A 2BT6A 1EU4A 1WF9A 2XK5A 4BKGA 1I4XA 3DBHB 1XO3A 1HEZE 4PYZA 3AI5A 2L83A 3B9JA 1ZW7A 1N61A 1BXTA 1FXTB 2MA9B 3VH3B 4CQNA 2PKOA 5G5GA 3DDCB 4GSWA 4W9CA 2OOBB 4DHZB 2K0PA 5BMGA 1WGRA 2O2VB 4G11A 4W9DA 4C4VA 2LGYA 3I3TB 5L95C 2KWDA 3AE9B 1H8CA 1F2RC 2KC2A 1DOXA 1WM3A 2CJNA 4WWOA 1CMXB 3RPFC 2KX3A 2JSVX 4M00A 1P7EA 2MHJA 3VFKA 2LGDA 2X8XX 3TEZA 1DYQA 3QAQA 3WAOA 2M56B 3FKYA 4KDIC 4JQWC 4HCNB 1I7HA 1F1HA 3ZO5B 1WMHB 1I35A 2Z0EB 4E3CA 2INPE 4I6LB 1Q10A 4MDKE 3MC8A 4ICUA 2DLBA 1SEBD 1Q1OA 3NS8A 2N0SB 1HTOA 2AQ1B 3DVGX 4KZCA 4ZRPA 3Q8AA 3SHQA 4A55A 2QSDA 4LCDE 3A9KB 1C9FA 4I6PA 3BK1A 2JRIB 3QQ8B 5AEKB 1JWAD 1SE2A 2A4ZA 4LDTD 1YMHE 2GBMA 4MGIE 4NZLB 5CHFA 1XCQL 1CQVA 3NOBA 1ACCA 3I57A 4C80A 4ZDVA 3AE8B 1AYFA 2RMMA 3PS6A 5CX3A 2BB6A 4J3OD 3PT2B 5MPOA 2KVRA 1EF5A 3E9SA 1KTKA 1EWCA 2L0TA 3EFUA 2DYOA 3DBHI 1G6JA 1IBXB 3N20C 1XLQA 2RDBC 2PE6B 1D6EC 3DBRB 1MG8A 2C7HA 2LXCA 3DVGY 2NVUI 2LD9A 4P1BC 1DGJA 1MHXA 3KWLA 3T3OA 2L3ZA 2NPTB 1VLBA 4K7WA 1YX6B 1WXSA 2L52A 3ZVVA 4XWTA 3H7PB 2DNFA 3QARA 2KK8A 3NJTA 3V6CB 2RGFA 1JW9D 2V4IB 2DZKA 3QHTA 1J7AA 2YEPB 2MX2A 2CHWA 2K5PA 3ZDTA 3P4RB 1QOAA 3W1YA 3RD2A 1V1PB 3PRZA 1VJKA 2L00B 2LUMA 1TJEA 2DYBA 2QEJC 2ZPNA 3SR6A 4KGSA 4ZRIA 3NZSA 5G55A 3QJZA 3KLSX 2JXXA 2AQ2B 3MC9A 5TSSA 2BS2B 3PLUA 1SE3A 2K25A 1XXGA 2D3AA 5E6OA 1Z2MA 2ZZPB 2V0GA 2KYWA 2JXTA 1L2NA 1RWSA 2WS3B 2EKIA 2K6DB 3ZNHB 2D10A 1F2RI 3AE1B 1V5TA 1WX8A 3UIPB 4MACA 2C60A 3QCAA 4A20A 3NVYA 3GE3C 2EMSA 4AQ7A 4M02A 4PS7A 3U7ZA 2KVZA 1NI2A 3BZDB 3P4QB 1TKGA 3PVLA 1PYWD 2OJRA 1V81A 2L1AA 5DPSA 2KFKA 3W5VB 1Z5SB 2LVPA 1ZP0B 2K1FA 1WYWB 2Y5CA 2RPQA 4RFBA 4XX5A 3UIOB 3N1ZC 2D11A 3A1QA 1GB4A 4C00A 5IAAC 3X23A 1B1ZA 5EE3A 2YEPF 1J8CA 3VRAB 3RCZA 2MWSB 4IUMB 2BYEA 1WYGA 1RRBA 1XQQA 3ZYYX 3EGRA 3FC4A 1T0RC 1VD2A 3A33B 1R4NI 3BVMA 3TL5A 1SE9A 2B3AA 4MELA 2K3UA 3WANA 1WR1A 1MI0A 2MJ3A 2ASQA 2UU7A 1WRIA 4YT0B 1UBIA 2QIEB 2J0JA 1SXTA 2IDYA 1PUTA 3R8BA 1SF0A 2L32A 2CU3A 2CJOA 2N4FA 5JZEB 1T0YA 3EUB2 1LXDA 1E7VA 4S17A 4ANVA 5GMVA 4XWWA 1ZKHA 4URKA 3TUOA 1FNWA 4LNOA 5JHAA 1RFAA 1WXVA 4JPSA 2Z0DB 2MW5A 4NAWB 4AS1A 1OFFA 1SB3C 3SU8X 3L10B 3VAWA 2KLGA 3DQVA 3K9PB 2WXJA 4NNJB 2BYFA 1MJDA 1AARA 3LB8C 4GDKB 3WCQA 5LXHA 2C5LC 2EMTA 3BVGA 5FR3A 2V4LA 2BPSA 1E5WA 3L08A 4ITKA 1WJ4A 3RNAC 3W1SA 2HE7A 2CU1A 3MHZA 2VH2A 4NAWA 1RYJA 3TSSA 3DBLB 4CHKA 4LTUA 1K51A 4ZHOA 2I2YA 1E10A 2KDBA 1FMAD 2N1VA 3DOWA 3W2DA 4ZRKA 4FADA 2JVCA 4HJGE 1L6UA 2DHZA 2KANA 1CJEA 1K50A 1FNVA 2ZVNA 2K8HA 3A1QB 2NBUA 4YL8A 1QLBB 4TMAB 1K53A 4N58A 4KIKA 2R61A 3H7SA 4ARIA 5EE9A 4C56C 3IFWB 2NPTA 1R4NB 3DWGC 2IZVB 5BMIA 2GB1A 3P4PB 3H7PA 1UWXA 2IO0B 3V60A 4MH8A 2KWVB 2WDVB 2R2QA 5GXGB 3I63C 2W3SA 2JY6A 4HDQA 2QCZA 4HPMB 2JX5A 2MP2A 3BWUD 4TQ0A 1FD6A 3HM3A 2EELA 3PLVA 2ZVOA 4GIVA 5JH5C 3Q69A 4HDOA 4RNAA 1V8CA 2K8CA 2ZJDA 4FJVB 3VR8B 2KACA 3HRDD 3JYUA 2WLBA 1DOIA 2HTME 2BB5A 3GZNI 4M0WA 4MGZE 4A90A 3PGEA 2KQSA 1JQ4A 3DVNV 3IG3A 3OJ4B 1J19A 2IYDB 2O6VD 1IPGA 3PSEB 2MEKA 4DDGD 5HFYA 3O65B 2CHXA 3ZNID 4DXGA 4ICVA 3MJWA 2AQ3B 2KN5A 2WXGA 2DAFA 1FCLA 3ML9A 3MJ5A 3TEWA 3M95A 4FHJA 5D3DA 3U7DA 4XDDA 5H92C 2XK5B 4N59A 2C7NB 3GZNB 3ZTDA 2K39A 2KFJA 3KYDD 1PQSA 2GLSA 1E9MA 1L5PA 1ZGUB 3C19A 1HXYD 3Q2AC 4KGTA 4GGQA 2SAKA 4PS8A 4W9EA 2JF5A 3ZJTA 4DHJD 3Q14C 1UD7A 3KH0A 1C4CA 2N9XA 1UZXB 1XLNA 5CTRC 3AE3B 1IUEA 3Q3MC 2KD0A 2GBJA 1LGRA 2LVOA 4BAXA 5D94A 2LHEA 2WYQA 5C2TB 3DBRI 3VQIA 1TIFA 3B2GA 4M8MA 3NVWA 2WX0A 2PW9A 4NPNA 4ZRJA 1VDVA 2J0MA 2J7QB 3FILA 2RPVA 2PLPA 3WALA 5D2MB 2GMIC 2QILA 1I4QA 1V5OA 3GS2A 4XYCA 4AJWA 3APCA 1ET6A 2FCSA 4BOZB 1NBFC 5KHQA 1Y56A 2D3GA 1Y8RC 2ACZB 2BBCA 1RM6C 1KJTA 3CIRB 3VDZA 2FUG1 1C78A 3ABVB 2QJLA 3DVNU 1SE4A 3KUDB 2KNBA 1HA5A 1NENB 4PT5A 1XD3B 1FRRA 1YIWA 2B76B 4II3B 5LXIB 1PGBA 1E8ZA 3RUIB 1LQBA 3TEYA 1TS2A 1WE7A 4JWSC 1GJZA 1UELA 1TY0A 3LDZE 2M1MA 1A70A 3T9LA 1TZ1A 3HM6X 2J52A 2INCC 2OJWA 4WWMA 1STEA 4B0EA 3AM9A 2WU5B 4YSXB 3UINB 4MSQB 4E74A 3MP9A 4GOCA 1CZPA 4BKTA 1FFUA 5KHOA 2DX5B 4HK2A 5CHVC 2AX5A 3EC8A 1GB1A 3RMKC 4EUTA 1QT9A 1F9JA 2IJ0A 3ZNGC 1WGYA 1RLFA 1P1AA 4HROA 4DXFA 3KVFB 2WP9B 1ZUD2 3AU4A 2J4XA 2G3QB 4NQLB 1EF1A 3V6EB 2XBBC 4ANXA 4MT5A 3AXCA 2PPHA 3EA6A 4GDKA 3ZTCA 4HVBA 4EEWA 1AN8A 1HTQA 2G4SA 4FJZA 1WH3A 1WJNA 3A4SC 4YTNB 3RYTA 4BFRA 3HUIA 2D07B 3ZGZA 2ZPYA 4QAYA 1QILA 3IT6B 1EU3A 3NZ3A 1PDXA 2NS5A 4LNFA 4M01A 3W1SC 3P42A 4W9JA 1C3TA 2FAZA 3L0WB 2KJRA 3P2BA 4YTPB 1WRDB 5T8IA 1PGAA 1FRDA 2ZCBA 2ONQA 1WM2A 4OW0A 4AP4C 2N9PC 3KYCD 4RF0A 1PFDA 2M0XA 1V1PA 4IKGA 1D5MC 4HJKA 4Q2JA 1N5WA 5E6JA 3I9V1 2LUEA 4M0WB 2JWZA 1OQRA 2JYTA 3Q3JA 2FBWB 1N63A 5IKCM 3I5JC 1V2YA 3LJ3A 3V62A 2WXQA 5HKHA 3AULA 2IGDA 1WFYA 1FNUA 2MP2B 3B08A 4ANUA 4BZAA 3VH4B 3SD5A 1QKZA 2N1WA 4IM3A 5IOIA 3NS1A 3ALBA 1L7YA 2IGHA 4HRSA 2W82A 1WGGA 3Q8FA 3APFA 1OGWA 5D7GA 2XEWA 3NY5A 1WI0A 5IN7A 3PRPB 4E71A 4KSLC 4WH4A 2GI9A 4TUUA 1V49A 2LGSA 2RSUA 4DDID 1YOVB 2L8JA 1ENFA 3L17A 2O2VA 3RN9C 3U30A 1EM7A 1WGDA 3ONSA 1N5XA 4ZOHC 4JE3B 3TEXA 4BOSC 1T3QA 3H9DA 1MG4A 2JZ3B 1LFDA 4NJCA 2N9EB 1H4RA 2WXRA 4PS3A 5C23A 5IP4D 4L1BA 4MM3A 2LASA 2UWQA 3AEAB 4W9LA 4WJQA 2G1EA 1GG3A 2FUHB 2MCNB 2KTRB 2LGXA 2GBRA 3AE6B 1I4PA 5JXVA 1GUAB 4RGOS 2CR5A 5G5HA 1M94A 2JRHA 2FCMA 3FILB 3BY4B 3JSVA 2V3NA 5HI1A 1D5ZC 1N60A 1TYGB 2KZRA 2WXIA 3TBLD 5HG2A 2HDEA 2V9HA 3MFGA 4BKSD 4HPLB 2BWES 3AN1A 2PTLA 2DAJA 4LNKA 3Q8BA 2QMTA 3DHHC 3U52E 2QC8A 1OEYA 4WURA 3BK2A 3RULA 4K7SA 4HWIB 2ZNVB 3QK0A 2Q5WD 1V97A 1KFYB 2AEHA 1ET9A 1UGJA 2DZIA 1YN4A 1JCKB 2E6XA 3PO0A 2ZW1A 3Q3OC 4HXDA 3C0RB 1FM0D 3QX1A 1UBQA 1TBEA 2DYMA 1GC6A 2M19A 1T0SC 2KX0A 1ZPSA 3R2TA 1VRAB 1E8XA 4A3PA 4GMVA 1QOGA 4OVZA 3GP7A 1K8RB 4IOIE 5BO4B 3PREA 4LNNA 1P9DU 1FXAA 1EWYC 1NI3A 1TKYA 1ROEA 4P16A 2BVCA 2BYVE 1NEKB 1F77A 1C4PA 3MTNB 3JSVB 5DPWA 4HKZE 1TY2A 1L4ZB 1T0QC 2KXJA 1UUPA 2LXAA 4EOYA 1TT5B 1I4GA 3VTUA 1P0RA 3RNEC 3FAHA 3UQBA 3DBLI 4WWPA 4WQMA 1NYRA 3IT4B 3S2AA 4IC7B 1KM7A 5BMHA 1OQQA 2KO3A 4RGNA 5TR5A 1WIAA 1D5XC 3BYYB 2J42A 2FCQA 5DCNA 1WWTA 4IM0A 2WDQB 2LRUA 1ISNA 1SJED 3AB5A 3Q8CA 3JVZX 5I4DA 2DZMA 3IHPC 4GB9A 2WDRB 3KQ4A 3ZJUA 4NJ6A 1GNUA 2LJ5A 3SFDB 3VXWA 2V3SA 4DBGA 1ZDVA 4W9KA 2BF8B 1Q5WB 1IYFA 3V61A 4ANWA 3VR9B 4FHKA 3IAS1 1KLUD 3APDA 3TCAA 3DPDA 4AOFA 4NAMA 4WAAA 2BGFA 2C7MB 4NJ7A 3N32A 1V1OA 3C8YA 2L0FA 3IAM1 4HEA1 4MH0E 3R3MA 4A9AA 3M63B 3PZ7A 5G2NA 3ENEA 1DOYA 5FK9C 2Y5PA 3N30A 4TQ1A 2N9LA 4MEMA 2OHFA 4AUQC 1EUVB 1YN5A 3IBEA 3AH7A 2HJ1A 1GAQB 3OWEB 4ZHPA 4OHJA 2VRRB 1XLPA 2DZJA 3ZLZA 4BVUC 4XE0A 1LM8B 4KVGB 2KN4A 4BKSA 2ON8A 4IW0A 3UQAA 3M3JA 5BYSA 2ZW0A 1QF6A 1BUIC 1FEHA 2BKFA 2HJ8A 3PV1A 3U4EG 1ZOYB 4W9FA 1E6EB 2FE8A 4CYEA 5DPRA 3ML8A 2LI5A 2JZZA 1IGCA 2KTFA 2DENB 4W9HA 2YLMA 3LXFA 1E7UA 3RI7C 3HHMA 1U4AA 1L0XB 1WX9A 4TV3A 1HZ6A 1WXAA 2O6VA 2JUOA 3AE7B 4OZBA 4IM2A 3X0WA 4RGTA 2BTEA 2LGIA 2D3CA 4IWQA 2NCNA 1XLOA 1WGHA 4DK5A 4ASWC 2WXPA 3MC0B 3PHWB 2BW2A 5IO9A 2LEKA 2Y3AA 3RZWC 4RMAA 4FBJB 1SGHA 4ZYSA 2IO2B 3QWZB 1NYQA 1C77A 3V05A 2KWUB 1GC7A 4B9KA 3RT3B 1LO5D 1I42A 2N7EA 2WXHA 1WJ6A
chains in the Genus database with same CATH topology
4P6VF 1C4AA 3W5VB 3B2FA 1TS3A 1UWMA 1FRDA 1L0YB 1ZP0B 2ONQA 3W5UB 1AWDA 2E3TA 1FIQA 1VR9A 4OW0A 3AECB 2SEBD 1YNTE 2Y5CA 4RFBA 3IXSA 1QOBA 5EE0A 4GDLB 4RF0A 1FXIA 1PFDA 1V1PA 2PVGC 4IKGA 1GB4A 1GOZA 1D5MC 5C3JB 4Q2JA 1N5WA 5E6JA 3I9V1 1SJHD 1E7PB 1TKEA 4UDUC 2VZKD 1K52A 2WXLA 1OQRA 2JYTA 1NVID 1IGDA 1B1ZA 2FBWB 2JYEA 5EE3A 2YEPF 1N63A 5AUKA 5EE1A 1YQ4B 3VRAB 1MVKA 1VZ8A 3J9CA 2WU2B 2WXQA 1JWMD 5AUIA 4LLGM 1FCCC 1R7SA 2IGDA 1WYGA 1FNUA 3ZQ4A 3ZYYX 4L23A 3EGRA 3FC4A 4A6QA 1KRHA 1QKZA 1IBXA 2ICIA 3BVMA 4REZA 3NS1A 2K3UA 2IGHA 1KH0A 4YXDB 4HRSA 2GRIA 1MI0A 3NVZA 2MJ3A 2BS4B 2W82A 5H8YE 1WRIA 4KKJA 4YT0B 4DQOC 2LHDA 3Q8FA 4KKIA 2LFIA 2OEDA 4O1NA 3URYA 1MPEA 2QIEB 1TZOA 1KF6B 5D7GA 1SXTA 2IDYA 4TSSA 1PUTA 3R8BA 1SF0A 2L32A 2CU3A 1P7FA 2CJOA 3EUB2 3V3XA 4WH4A 4XWWA 2GI9A 3TUOA 1FNWA 1QQRA 1WGKA 4KGRA 3P63A 3T3NA 3ETRA 3AV8A 1ZXHA 4MM3B 1ENFA 1HZ5A 1TS5A 1AW7A 3BYTB 4JPSA 4EE2A 2LJIA 4L2YA 4NAWB 4AS1A 1OFFA 1BMLC 1SB3C 4XDCA 1EM7A 4RGMA 1QOFA 1WSPA 5HHDG 2WXJA 1N5XA 4FXCA 4ZOHC 3CWIA 1T5XD 4JE3B 1I4RA 3LB8C 3TEXA 2KMMA 1E0ZA 2LMCA 3KWVA 4GDKB 1T3QA 2W3RA 3WCQA 1C79A 1CK1A 3AEGB 3SFEB 4NJCA 1TS4A 3BVGA 5FR3A 2WXRA 3AE5B 4OZCA 1MHHE 2K9XA 4ITKA 4YTMB 4L1BA 4OZAA 3ZJVA 2PVOD 3AEAB 3W1SA 1JALA 3L4PA 1C76A 2WXNA 2G1EA 3MHZA 1XEEA 1RYJA 3BVZA 5FKAC 2J53A 3TSSA 3VRBB 1ESFA 4LTUA 3U2SC 1K51A 4ZHOA 2I2YA 1ZXIA 3Q8EA 1E10A 3AE6B 2WXKA 4US9A 1I4PA 5JXVA 2RDGA 1PGXA 2D5GA 1FMAD 3W2DA 4RGOS 5G5HA 4GLSC 1JROA 2X38A 1L0VB 4HJGE 1L6UA 2PIAA 3FILB 1CJEA 1L4DB 1K50A 4B0MA 5HI1A 2V3NA 2JZPA 4H2AA 1D5ZC 1N60A 2XN9C 1FNVA 4RH6A 1TYGB 2WXIA 1SBBB 5HG2A 3AE2B 2HDEA 1YJIA 2INNE 3MFGA 1J7BA 1QLBB 4TMAB 1K53A 4N58A 1XF5L 2R61A 4ARIA 5EE9A 4US8A 4C56C 1F0ZA 3AN1A 3DWGC 2PTLA 1YQ3B 5BMIA 1ZE3D 2GB1A 3P4PB 1UWXA 3Q8BA 2QMTA 4MH8A 3U52E 3UI3A 4D2KA 3DWMA 2PMVA 2WDVB 3BK2A 4WURA 2BYTA 5GXGB 2W3SA 2Q5WD 4RF1A 2DWQA 1V97A 2JU6X 2JX5A 1KFYB 3BWUD 4TQ0A 1FD6A 1JWSD 2EELA 1ET9A 1UGJA 1SIJA 1YN3A 3Q69A 2MJEA 3AMZA 3P4SB 4JX1C 1YN4A 1JCKB 2E6XA 3PO0A 4RNAA 2ZW1A 5BYRA 1V8CA 1I4HA 4N6EB 3R2IA 3BIID 3P1MA 1FM0D 2N9KA 3AE4B 3VR8B 2KACA 2WNMA 2DYMA 3HRDD 3PZ8A 2M19A 2WLBA 2WXMA 4LK0M 4A8XC 1DOIA 2HTME 2BB5A 1ZPSA 3R2TA 3GB1A 1VRAB 2BT6A 1EU4A 1FFVA 4YSYB 3O13A 4M0WA 2N7JA 4A90A 2JWUA 1QOGA 4OVZA 1I4XA 1JQ4A 3GP7A 1XO3A 4IOIE 2V3PA 1HEZE 1FXAA 1EWYC 2L83A 2MEKA 1NI3A 1TKYA 2WQYB 3B9JA 1ROEA 4P16A 5HFYA 1N61A 1BXTA 1NEKB 1F77A 1C4PA 4DXGA 4CQNA 2AQ3B 2PKOA 5G5GA 1J7CA 2WXGA 4HKZE 1TY2A 4USAA 1L4ZB 2H88B 2NTSA 1FCLA 3MJ5A 1UUPA 3TEWA 2K0PA 5BYQA 5BMGA 1I4GA 2NTTA 2W55A 5D3DA 3FAHA 4XDDA 3HVDA 4WAFA 4WQMA 5H92C 1FO4A 1NYRA 3IT4B 4N59A 2KWDA 1L6VA 3AE9B 5BMHA 1F2RC 2KAJA 2MJDA 1OQQA 1YJJA 1DOXA 2CJNA 4RGNA 5LNK1 3RPFC 1JWBD 1E9MA 1L5PA 3W9CB 1D5XC 3BYYB 1HXYD 2JSVX 4KGTA 2J42A 3NVVA 1WWTA 1P7EA 2SAKA 2WDQB 3TEZA 1DYQA 1SJED 3AB5A 3Q8CA 2M56B 3E56A 5I4DA 3ZJTA 1I7HA 1C4CA 2WDRB 3KQ4A 3ZJUA 1XLNA 1HQRD 2INPE 3AEEB 3AE3B 1IUEA 2DBYA 4JWUC 4ZRQA 3SFDB 1ZDVA 2Z8LA 3VR9B 1Q10A 2LHEA 3IAS1 2DLBA 1KLUD 1SEBD 1SSNA 2IGGA 5C2TB 1T6BX 2I38A 2BS3B 4NAMA 2N0SB 2MH7A 3VQIA 2AQ1B 3B2GA 2WXFA 4ZRPA 3NVWA 3Q8AA 2PW9A 4R3DA 4A55A 1VDVA 1ZDXA 2QSDA 3FILA 2RPVA 3SEBA 4HEA1 1V1OA 3C8YA 1C9FA 2PLPA 3IAM1 3LYYA 3BK1A 1M4VA 2QILA 1I4QA 1JWAD 4A9AA 3PZ7A 3GS2A 1SE2A 1YMHE 4NZLB 1DOYA 1ET6A 5FK9C 2Y5PA 5D3IB 1XCQL 1CQVA 1ACCA 3I57A 4TQ1A 4C80A 2N9LA 3AE8B 2OHFA 1AYFA 1Y56A 1YN5A 2ACZB 2BBCA 2RMMA 2VZKB 3AEDB 1RM6C 3AH7A 2BB6A 4J3OD 1GAQB 1KLGD 4HKQA 3OWEB 4ZHPA 3CIRB 5MPOA 4OHJA 3N9YC 1XLPA 2FUG1 1C78A 1WXQA 4XE0A 1RFKA 2KN4A 3E9SA 1KTKA 1EWCA 3ABVB 2QJLA 1SE4A 2DYOA 1HA5A 1IBXB 2ON8A 1NENB 4PT5A 1FRRA 1XLQA 1D4BA 1VZ6A 1D6EC 5BYSA 3NRZA 2ZW0A 2B76B 1QF6A 1BUIC 1N62A 1FEHA 2H89B 2TSSA 1PGBA 1DGJA 1GPXA 1MHXA 3KWLA 3T3OA 2XNAC 3U4EG 3TEYA 1VLBA 1TS2A 4JWSC 2KDMA 1TY0A 2L52A 1A70A 1ZOYB 1VZ7A 4XWTA 1E6EB 2FE8A 2J52A 2IPKD 4WWMA 1JRPA 1STEA 4B0EA 3AM9A 4YWGG 2WU5B 4YSXB 1IGCA 1JW9D 2V4IB 3MP9A 1CZPA 1FFUA 1J7AA 2YEPB 3LXFA 3HVZA 3H8HA 2K5PA 2AX5A 3P4RB 1QOAA 1GB1A 2KQ4X 1V1PB 1VJKA 2LUMA 4IDIA 1QT9A 1TJEA 2QEJC 4KX6B 3SR6A 1L0XB 2IJ0A 2WXOA 4KGSA 4C7ZA 1HZ6A 3KLSX 4HROA 2AQ2B 4ARCA 4DXFA 2WP9B 1ZUD2 5TSSA 2BS2B 1SE3A 2G9HD 3AE7B 2J4XA 1XXGA 4OZBA 2V0GA 1JMLA 2JXTA 1RWSA 2WS3B 4RGTA 2JQRB 2EKIA 2BTEA 4MT5A 2LGIA 1F2RI 3AE1B 1JWUD 3EA6A 1XLOA 2M0AA 4C7YA 4MACA 1AN8A 2WXPA 3MC0B 3NVYA 3AEFB 1UNSA 4YSZB 4YTNB 4AQ7A 4RCOA 2RDHA 2BW2A 3HUIA 2LEKA 3NUHB 2Y3AA 4WIPA 3ZGZA 2W54A 1QILA 3IT6B 1EU3A 3NZ3A 3U7ZA 1PDXA 2NMQA 1B9RA 4ZYSA 3P42A 3RFZB 3BZDB 3AEBB 1NYQA 1C77A 3P4QB 3V05A 1TKGA 1XCTL 4YTPB 1LO5D 1PYWD 2WXHA 5T8IA 1PGAA 2K22A 2L1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLP A;  3LB8 C;  4P6V F;  1FXA A;  1EWY C;  1WXQ A;  2KMM A;  2L83 A;  3W5V B;  1NI3 A;  1TKY A;  2WQY B;  3B9J A;  3B2F A;  1ROE A;  1UWM A;  1E0Z A;  1FRD A;  1T3Q A;  1ZP0 B;  3W5U B;  2W3R A;  1N61 A;  3WCQ A;  1RFK A;  3AEG B;  3SFE B;  1AWD A;  1NEK B;  2QJL A;  3ABV B;  4FXC A;  2E3T A;  1FIQ A;  3AE5 B;  3AEC B;  2PKO A;  2Y5C A;  5G5G A;  2K9X A;  1J7C A;  1NEN B;  4USA A;  1FRR A;  2H88 B;  1QOB A;  1XLQ A;  4ITK A;  5EE0 A;  4YTM B;  1FXI A;  1PFD A;  2PVO D;  5MPO A;  3AEA B;  2PVG C;  3NRZ A;  2B76 B;  1JAL A;  3L4P A;  2W55 A;  5C3J B;  1N62 A;  1QF6 A;  2H89 B;  1N5W A;  3FAH A;  2G1E A;  1DGJ A;  1GPX A;  3KWL A;  4WQM A;  1E7P B;  1TKE A;  5H92 C;  1RYJ A;  1FO4 A;  1NYR A;  4N59 A;  1VLB A;  1OQR A;  1L6V A;  1NVI D;  3AE9 B;  3VRB B;  2KAJ A;  2MJD A;  4JWS C;  1OQQ A;  4LTU A;  2FBW B;  2L52 A;  4ZHO A;  1YJJ A;  5EE3 A;  1A70 A;  1ZOY B;  1ZXI A;  2CJN A;  1N63 A;  3AE6 B;  1DOX A;  1E10 A;  1E6E B;  4US9 A;  5AUK A;  5EE1 A;  1YQ4 B;  3RPF C;  1JWB D;  3VRA B;  1E9M A;  1L5P A;  3W9C B;  1FMA D;  4WWM A;  1JRP A;  2WU2 B;  5AUI A;  3AM9 A;  5G5H A;  3NVV A;  1WWT A;  2WU5 B;  2WDQ B;  4YSX B;  1JW9 D;  1R7S A;  1JRO A;  1WYG A;  1L0V B;  3AB5 A;  3ZYY X;  1CZP A;  1L6U A;  2M56 B;  3FC4 A;  2PIA A;  1FFU A;  1J7A A;  3LXF A;  1CJE A;  3HVZ A;  1KRH A;  1I7H A;  2K5P A;  2AX5 A;  3P4R B;  1N60 A;  1QOA A;  1TYG B;  3NS1 A;  2WDR B;  1VJK A;  4IDI A;  4YXD B;  1QT9 A;  3AE2 B;  4HRS A;  1XLN A;  1TJE A;  1YJI A;  3NVZ A;  1J7B A;  1QLB B;  2MJ3 A;  2BS4 B;  4KX6 B;  3AEE B;  4N58 A;  3AE3 B;  3SR6 A;  1IUE A;  5EE9 A;  2DBY A;  4JWU C;  3SFD B;  4C7Z A;  4US8 A;  1F0Z A;  5H8Y E;  1WRI A;  3AN1 A;  4YT0 B;  4HRO A;  3DWG C;  3VR9 B;  1YQ3 B;  2WP9 B;  3P4P B;  1ZUD 2;  2BS2 B;  2QIE B;  3AE7 B;  1KF6 B;  5C2T B;  3DWM A;  2WDV B;  1PUT A;  2BS3 B;  1SF0 A;  2N0S B;  5GXG B;  2CU3 A;  2CJO A;  2MH7 A;  1RWS A;  2WS3 B;  2W3S A;  3B2G A;  2JQR B;  2EKI A;  2Q5W D;  2DWQ A;  1V97 A;  3AE1 B;  2JX5 A;  3NVW A;  1KFY B;  3EUB 2;  1VDV A;  1XLO A;  1SIJ A;  4C7Y A;  2MJE A;  3AMZ A;  3P4S B;  4JX1 C;  3NVY A;  1JWA D;  3PO0 A;  3AEF B;  4A9A A;  1V8C A;  4YSZ B;  1WGK A;  4YTN B;  3P63 A;  4N6E B;  3ETR A;  3BII D;  2LEK A;  3HUI A;  3P1M A;  1FM0 D;  3AV8 A;  3AE4 B;  1DOY A;  2W54 A;  3VR8 B;  3HRD D;  2M19 A;  2WLB A;  1PDX A;  4C80 A;  1DOI A;  2HTM E;  4ZOH C;  3AE8 B;  1B9R A;  2OHF A;  1AYF A;  1FFV A;  1OFF A;  2BT6 A;  1SB3 C;  3AEB B;  1NYQ A;  4YSY B;  3P4Q B;  2ACZ B;  1QOG A;  3AH7 A;  1QOF A;  1TKG A;  1RM6 C;  3AED B;  4YTP B;  1JQ4 A;  1GAQ B;  1XO3 A;  1N5X A;  4ZHP A;  3CIR B;  2K22 A;  3CWI A; 
#chains in the Genus database with same CATH topology
 4LJO B;  4K81 A;  4P6V F;  2KQ7 A;  3ZDM C;  2KWC A;  4WJO A;  2PE9 A;  1E8W A;  1AWD A;  2E3T A;  1FIQ A;  1VR9 A;  3AEC B;  2SEB D;  1YNT E;  1WXM A;  5EE0 A;  4GDL B;  1FXI A;  2PVG C;  4B95 A;  5C3J B;  3H1U A;  1SJH D;  1E7P B;  2WXL A;  3U8Z A;  4P7I A;  5AUK A;  5EE1 A;  2WDT B;  1MVK A;  1VZ8 A;  2D3B A;  4XGA B;  5D6J B;  5FR6 A;  2V1Y A;  2K6Q A;  1FPY A;  3Q3F A;  1IBX A;  4G50 A;  2CKH B;  1OTR B;  2KOX A;  3JW0 X;  2GRI A;  3NVZ A;  2BS4 B;  3ECI A;  4X57 B;  1SIF A;  2ZCC A;  3KUC B;  4KKJ A;  4DQO C;  2LHD A;  2KLC A;  2OED A;  2KHW B;  4F8C B;  4O1N A;  4F7Z A;  1JRU A;  3URY A;  1A5R A;  4LDT B;  1KF6 B;  1KOT A;  2HTH A;  3K9O B;  1WE6 A;  3GE8 C;  3WIM A;  1P7F A;  2MBE A;  3RNG C;  3PPA A;  2KFK B;  4B6W A;  2RR9 A;  4BBN C;  1WZ3 A;  1QQR A;  4KGR A;  1WR6 E;  3P63 A;  4ZYN A;  3T3N A;  4MGK E;  3AV8 A;  2UYZ B;  4MM3 B;  3A9J A;  1C1Y B;  1TS5 A;  2Y5B B;  1N6Z A;  2KJ6 A;  4G3X B;  4XDC A;  4RGM A;  5AZF A;  1QOF A;  4PYU A;  1WSP A;  4OVU A;  5HHD G;  1TTN A;  2JT4 B;  3CWI A;  1T5X D;  1I4R A;  2WGS A;  2KMM A;  2LZ6 A;  1C79 A;  1CK1 A;  3D32 A;  4G0N B;  2MRP A;  1TS4 A;  4HLE A;  3VUY A;  2AL6 A;  2PJH A;  3AE5 B;  4OZC A;  3ZJV A;  3TJP A;  2PVO D;  4IG7 B;  3A9J B;  1JAL A;  3L4P A;  1C76 A;  2D2Q A;  2J53 A;  5J17 A;  3VRB B;  1ZXI A;  2WXK A;  2RDG A;  1PGX A;  1OQY A;  1WY8 A;  2LRW A;  4GLS C;  4F1S A;  1JRO A;  2X38 A;  4DHZ E;  4FN2 A;  1L0V B;  1TGZ B;  3Q6B A;  3ZRF A;  2ZNV C;  2PIA A;  3R66 C;  4B0M A;  1L4D B;  2JZP A;  4H2A A;  3DHG C;  3AU5 A;  4JGH B;  1SBB B;  2VH1 A;  3H6N A;  2KC1 A;  3AE2 B;  2INN E;  1YJI A;  2MLB A;  4M8N A;  3TIX A;  2FNJ B;  1F0Z A;  2NBW B;  2M4N A;  2MBQ A;  4D2K A;  2PEA A;  2PMV A;  2KDE B;  2CS4 A;  4P1C C;  4LJP B;  2DWQ A;  2MQJ A;  3BIN A;  2G45 B;  1JWS D;  3A4R A;  1V6E A;  1YN3 A;  3NZU A;  3PTF C;  3P4S B;  4JX1 C;  1R4M B;  1VCB A;  5IA7 A;  1WMH A;  4N6E B;  1NDD A;  3L16 A;  3AE4 B;  5E6N A;  3PZ8 A;  2NR2 A;  4KZ0 A;  3ZIM A;  2KDF B;  4LK0 M;  4A8X C;  3GB1 A;  2Z59 B;  1FFV A;  4YSY B;  1S1Q B;  3O13 A;  2N7J A;  2JWU A;  2N7D A;  2IY0 B;  1YD8 U;  2REX A;  1E8Y A;  2LWP A;  2V3P A;  2BKR B;  2L76 A;  5E6P A;  2WQY B;  4J6I A;  3WA0 A;  4K1R B;  4WWN A;  5JHB A;  1XT9 B;  1J0G A;  1J7C A;  2IBI B;  4USA A;  2H88 B;  2J0K A;  2L7R A;  2NTS A;  5BYQ A;  2NTT A;  3OG5 A;  2W55 A;  3HVD A;  4WAF A;  1FO4 A;  1L6V A;  2KAJ A;  2MJD A;  3HIZ A;  3L13 A;  3DCG A;  4CO7 A;  1YJJ A;  5LNK 1;  1WJU A;  1JWB D;  3RNF C;  3W9C B;  3NVV A;  1P98 A;  3E56 A;  4EKU A;  2KDI A;  4GDL A;  1YJ1 A;  4MSM B;  2QHO A;  1HQR D;  3AEE B;  2EKE C;  4ACF A;  4K3C A;  2DBY A;  4JWU C;  4ZRQ A;  1EO6 A;  2KT7 A;  3ZXV A;  4FLH A;  2Z8L A;  3VVW B;  4II2 B;  1SSN A;  2IGG A;  3NG0 A;  2QDF A;  4KDL B;  1T6B X;  3CF6 E;  1KLV A;  2I38 A;  2BS3 B;  3N3K B;  2MH7 A;  2WXF A;  4R3D A;  1ZDX A;  4N9F 4;  3SEB A;  3LYY A;  3UF8 A;  1S3S G;  1M4V A;  3RNC C;  2FCN A;  4XZ4 A;  1UF0 A;  3ZKJ C;  1V80 A;  4AJY B;  1WX7 A;  4MJS A;  5D3I B;  2ZEQ A;  2JPH A;  4IWO A;  1R4M I;  2KMA A;  2KTR A;  1F52 A;  2CHZ A;  2VZK B;  3AED B;  2YVC A;  3N1Y C;  4IWP A;  1KLG D;  4HKQ A;  4GU2 A;  2KJH B;  3VTW A;  2R2O A;  5DPT A;  3N9Y C;  4FJY A;  1WXQ A;  4W9G A;  1RFK A;  4KSK C;  3VUW A;  5L83 A;  2WHI A;  1RAX A;  4DHJ B;  1D4B A;  1VZ6 A;  3CST A;  3NRZ A;  2IO3 B;  1N62 A;  2H89 B;  2TSS A;  4JL9 A;  1GPX A;  3KUZ A;  4KV2 A;  2XNA C;  2KDM A;  4RM9 A;  3OAW A;  1VZ7 A;  2GOW A;  2IPK D;  1JRP A;  1WZ0 A;  4YWG G;  4MGY E;  2BQQ A;  4GXB A;  1V9J A;  4WJP A;  5J18 A;  3HVZ A;  3H8H A;  3TMP B;  2KQ4 X;  2LVQ A;  2MBH A;  4IDI A;  2M17 A;  4KX6 B;  2MSE D;  3RNB C;  2WXO A;  3WAP A;  4C7Z A;  1E90 A;  4ARC A;  2A5U A;  2G9H D;  1JML A;  2FID A;  1V86 A;  2JQR B;  1JWU D;  3VHT C;  2M0A A;  4C7Y A;  4FA6 A;  1Q0W B;  4EZK A;  4FUL A;  2L05 A;  3M62 B;  1OEY J;  2K8B A;  3AEF B;  3N1X C;  4XC2 A;  1UNS A;  4YSZ B;  3ZRC A;  4RCO A;  2RDH A;  3NUH B;  3ZXR A;  4WIP A;  2W54 A;  2AYO B;  2NMQ A;  1B9R A;  3RFZ B;  3AEB B;  4S0R A;  4JLC A;  1XCT L;  1X1M A;  3CSF A;  2K22 A;  1C4A A;  3QA8 A;  3B2F A;  1TS3 A;  1UWM A;  3A9K A;  3DBS A;  1L0Y B;  3W5U B;  3VTV A;  4DXA B;  2M8S A;  4I6N B;  3IXS A;  1QOB A;  4HCP B;  5CHW A;  5AZH A;  1GOZ A;  1TKE A;  4UDU C;  3B0A A;  2VZK D;  1K52 A;  2AWT A;  1NVI D;  1IGD A;  2JYE A;  2O6V B;  1YQ4 B;  3J9C A;  2WU2 B;  1JWM D;  4JIO U;  5AUI A;  4LLG M;  3CMM B;  1FCC C;  1R7S A;  3ZQ4 A;  4L23 A;  4EFO A;  3IVF A;  4A6Q A;  1KRH A;  2ICI A;  4REZ A;  1KH0 A;  4YXD B;  1IP9 A;  4NY0 A;  4MJS B;  1QZE A;  5H8Y E;  4KKI A;  3UGB B;  2LFI A;  2RD0 A;  1MFW A;  3EFC A;  4EZL A;  1MPE A;  1TZO A;  4TSS A;  2HD5 B;  5C1Z A;  4WJN A;  3V3X A;  4K7U A;  3R7R A;  5J2R A;  1WGK A;  5AZG A;  3ETR A;  1ZXH A;  1HZ5 A;  3BYT B;  1AW7 A;  3HK0 A;  4TKN A;  4EE2 A;  2LJI A;  4C4V B;  3QIJ A;  4L2Y A;  4RM8 A;  2WX1 A;  2W9N A;  1BML C;  3QC8 B;  3PRM B;  2IND C;  3T8M A;  1HE8 A;  2BWF A;  4FXC A;  2MBO A;  3R7Q A;  3B1L X;  2KKC A;  4A3O A;  4WQO B;  1E0Z A;  3ZW3 A;  2LMC A;  4OVV A;  4PK1 A;  3KWV A;  2W3R A;  5LLI A;  3AEG B;  3SFE B;  3ZNZ B;  4GN1 A;  3ZUN A;  3L54 A;  1MHH E;  2K9X A;  4YTM B;  2NBV B;  4OZA A;  3SDL C;  2WXN A;  4NQK E;  3RZF A;  4KIK B;  1XEE A;  3BVZ A;  5FKA C;  1ESF A;  3NHE B;  3U2S C;  3Q8E A;  4US9 A;  2WWZ A;  2GBN A;  2D5G A;  2I1K A;  4LNI A;  2MBB B;  4W9I A;  3EHV A;  3WAM A;  4K3B A;  2IO1 B;  2AL3 A;  4DWF A;  2G4D B;  2XN9 C;  3DHI C;  4RH6 A;  4EZJ A;  1BT0 A;  1J7B A;  1D3Z A;  1XF5 L;  4BBN F;  3GOE A;  4US8 A;  3PZD A;  1YQ3 B;  1YQB A;  1ZE3 D;  2GBK A;  3UI3 A;  3PHX B;  1P3Q U;  3DWM A;  1UGM A;  4HPP A;  2FIF A;  2BYT A;  2IY1 B;  2C9W B;  4RF1 A;  2JU6 X;  4AWJ A;  1SIJ A;  2I1J A;  2MJE A;  3Q3N C;  1YX5 B;  3AMZ A;  3KW5 B;  3EEC A;  3OLM D;  5BYR A;  1I4H A;  1UH6 A;  3R2I A;  3BII D;  3P1M A;  2N9K A;  2WNM A;  5EDS A;  2KMC A;  2WXM A;  3VUX A;  3MHS D;  3OJ3 A;  2BT6 A;  1EU4 A;  1WF9 A;  2XK5 A;  4BKG A;  1I4X A;  3DBH B;  1XO3 A;  1HEZ E;  4PYZ A;  3AI5 A;  2L83 A;  3B9J A;  1ZW7 A;  1N61 A;  1BXT A;  1FXT B;  2MA9 B;  3VH3 B;  4CQN A;  2PKO A;  5G5G A;  3DDC B;  4GSW A;  4W9C A;  2OOB B;  4DHZ B;  2K0P A;  5BMG A;  1WGR A;  2O2V B;  4G11 A;  4W9D A;  4C4V A;  2LGY A;  3I3T B;  5L95 C;  2KWD A;  3AE9 B;  1H8C A;  1F2R C;  2KC2 A;  1DOX A;  1WM3 A;  2CJN A;  4WWO A;  1CMX B;  3RPF C;  2KX3 A;  2JSV X;  4M00 A;  1P7E A;  2MHJ A;  3VFK A;  2LGD A;  2X8X X;  3TEZ A;  1DYQ A;  3QAQ A;  3WAO A;  2M56 B;  3FKY A;  4KDI C;  4JQW C;  4HCN B;  1I7H A;  1F1H A;  3ZO5 B;  1WMH B;  1I35 A;  2Z0E B;  4E3C A;  2INP E;  4I6L B;  1Q10 A;  4MDK E;  3MC8 A;  4ICU A;  2DLB A;  1SEB D;  1Q1O A;  3NS8 A;  2N0S B;  1HTO A;  2AQ1 B;  3DVG X;  4KZC A;  4ZRP A;  3Q8A A;  3SHQ A;  4A55 A;  2QSD A;  4LCD E;  3A9K B;  1C9F A;  4I6P A;  3BK1 A;  2JRI B;  3QQ8 B;  5AEK B;  1JWA D;  1SE2 A;  2A4Z A;  4LDT D;  1YMH E;  2GBM A;  4MGI E;  4NZL B;  5CHF A;  1XCQ L;  1CQV A;  3NOB A;  1ACC A;  3I57 A;  4C80 A;  4ZDV A;  3AE8 B;  1AYF A;  2RMM A;  3PS6 A;  5CX3 A;  2BB6 A;  4J3O D;  3PT2 B;  5MPO A;  2KVR A;  1EF5 A;  3E9S A;  1KTK A;  1EWC A;  2L0T A;  3EFU A;  2DYO A;  3DBH I;  1G6J A;  1IBX B;  3N20 C;  1XLQ A;  2RDB C;  2PE6 B;  1D6E C;  3DBR B;  1MG8 A;  2C7H A;  2LXC A;  3DVG Y;  2NVU I;  2LD9 A;  4P1B C;  1DGJ A;  1MHX A;  3KWL A;  3T3O A;  2L3Z A;  2NPT B;  1VLB A;  4K7W A;  1YX6 B;  1WXS A;  2L52 A;  3ZVV A;  4XWT A;  3H7P B;  2DNF A;  3QAR A;  2KK8 A;  3NJT A;  3V6C B;  2RGF A;  1JW9 D;  2V4I B;  2DZK A;  3QHT A;  1J7A A;  2YEP B;  2MX2 A;  2CHW A;  2K5P A;  3ZDT A;  3P4R B;  1QOA A;  3W1Y A;  3RD2 A;  1V1P B;  3PRZ A;  1VJK A;  2L00 B;  2LUM A;  1TJE A;  2DYB A;  2QEJ C;  2ZPN A;  3SR6 A;  4KGS A;  4ZRI A;  3NZS A;  5G55 A;  3QJZ A;  3KLS X;  2JXX A;  2AQ2 B;  3MC9 A;  5TSS A;  2BS2 B;  3PLU A;  1SE3 A;  2K25 A;  1XXG A;  2D3A A;  5E6O A;  1Z2M A;  2ZZP B;  2V0G A;  2KYW A;  2JXT A;  1L2N A;  1RWS A;  2WS3 B;  2EKI A;  2K6D B;  3ZNH B;  2D10 A;  1F2R I;  3AE1 B;  1V5T A;  1WX8 A;  3UIP B;  4MAC A;  2C60 A;  3QCA A;  4A20 A;  3NVY A;  3GE3 C;  2EMS A;  4AQ7 A;  4M02 A;  4PS7 A;  3U7Z A;  2KVZ A;  1NI2 A;  3BZD B;  3P4Q B;  1TKG A;  3PVL A;  1PYW D;  2OJR A;  1V81 A;  2L1A A;  5DPS A;  2KFK A;  3W5V B;  1Z5S B;  2LVP A;  1ZP0 B;  2K1F A;  1WYW B;  2Y5C A;  2RPQ A;  4RFB A;  4XX5 A;  3UIO B;  3N1Z C;  2D11 A;  3A1Q A;  1GB4 A;  4C00 A;  5IAA C;  3X23 A;  1B1Z A;  5EE3 A;  2YEP F;  1J8C A;  3VRA B;  3RCZ A;  2MWS B;  4IUM B;  2BYE A;  1WYG A;  1RRB A;  1XQQ A;  3ZYY X;  3EGR A;  3FC4 A;  1T0R C;  1VD2 A;  3A33 B;  1R4N I;  3BVM A;  3TL5 A;  1SE9 A;  2B3A A;  4MEL A;  2K3U A;  3WAN A;  1WR1 A;  1MI0 A;  2MJ3 A;  2ASQ A;  2UU7 A;  1WRI A;  4YT0 B;  1UBI A;  2QIE B;  2J0J A;  1SXT A;  2IDY A;  1PUT A;  3R8B A;  1SF0 A;  2L32 A;  2CU3 A;  2CJO A;  2N4F A;  5JZE B;  1T0Y A;  3EUB 2;  1LXD A;  1E7V A;  4S17 A;  4ANV A;  5GMV A;  4XWW A;  1ZKH A;  4URK A;  3TUO A;  1FNW A;  4LNO A;  5JHA A;  1RFA A;  1WXV A;  4JPS A;  2Z0D B;  2MW5 A;  4NAW B;  4AS1 A;  1OFF A;  1SB3 C;  3SU8 X;  3L10 B;  3VAW A;  2KLG A;  3DQV A;  3K9P B;  2WXJ A;  4NNJ B;  2BYF A;  1MJD A;  1AAR A;  3LB8 C;  4GDK B;  3WCQ A;  5LXH A;  2C5L C;  2EMT A;  3BVG A;  5FR3 A;  2V4L A;  2BPS A;  1E5W A;  3L08 A;  4ITK A;  1WJ4 A;  3RNA C;  3W1S A;  2HE7 A;  2CU1 A;  3MHZ A;  2VH2 A;  4NAW A;  1RYJ A;  3TSS A;  3DBL B;  4CHK A;  4LTU A;  1K51 A;  4ZHO A;  2I2Y A;  1E10 A;  2KDB A;  1FMA D;  2N1V A;  3DOW A;  3W2D A;  4ZRK A;  4FAD A;  2JVC A;  4HJG E;  1L6U A;  2DHZ A;  2KAN A;  1CJE A;  1K50 A;  1FNV A;  2ZVN A;  2K8H A;  3A1Q B;  2NBU A;  4YL8 A;  1QLB B;  4TMA B;  1K53 A;  4N58 A;  4KIK A;  2R61 A;  3H7S A;  4ARI A;  5EE9 A;  4C56 C;  3IFW B;  2NPT A;  1R4N B;  3DWG C;  2IZV B;  5BMI A;  2GB1 A;  3P4P B;  3H7P A;  1UWX A;  2IO0 B;  3V60 A;  4MH8 A;  2KWV B;  2WDV B;  2R2Q A;  5GXG B;  3I63 C;  2W3S A;  2JY6 A;  4HDQ A;  2QCZ A;  4HPM B;  2JX5 A;  2MP2 A;  3BWU D;  4TQ0 A;  1FD6 A;  3HM3 A;  2EEL A;  3PLV A;  2ZVO A;  4GIV A;  5JH5 C;  3Q69 A;  4HDO A;  4RNA A;  1V8C A;  2K8C A;  2ZJD A;  4FJV B;  3VR8 B;  2KAC A;  3HRD D;  3JYU A;  2WLB A;  1DOI A;  2HTM E;  2BB5 A;  3GZN I;  4M0W A;  4MGZ E;  4A90 A;  3PGE A;  2KQS A;  1JQ4 A;  3DVN V;  3IG3 A;  3OJ4 B;  1J19 A;  2IYD B;  2O6V D;  1IPG A;  3PSE B;  2MEK A;  4DDG D;  5HFY A;  3O65 B;  2CHX A;  3ZNI D;  4DXG A;  4ICV A;  3MJW A;  2AQ3 B;  2KN5 A;  2WXG A;  2DAF A;  1FCL A;  3ML9 A;  3MJ5 A;  3TEW A;  3M95 A;  4FHJ A;  5D3D A;  3U7D A;  4XDD A;  5H92 C;  2XK5 B;  4N59 A;  2C7N B;  3GZN B;  3ZTD A;  2K39 A;  2KFJ A;  3KYD D;  1PQS A;  2GLS A;  1E9M A;  1L5P A;  1ZGU B;  3C19 A;  1HXY D;  3Q2A C;  4KGT A;  4GGQ A;  2SAK A;  4PS8 A;  4W9E A;  2JF5 A;  3ZJT A;  4DHJ D;  3Q14 C;  1UD7 A;  3KH0 A;  1C4C A;  2N9X A;  1UZX B;  1XLN A;  5CTR C;  3AE3 B;  1IUE A;  3Q3M C;  2KD0 A;  2GBJ A;  1LGR A;  2LVO A;  4BAX A;  5D94 A;  2LHE A;  2WYQ A;  5C2T B;  3DBR I;  3VQI A;  1TIF A;  3B2G A;  4M8M A;  3NVW A;  2WX0 A;  2PW9 A;  4NPN A;  4ZRJ A;  1VDV A;  2J0M A;  2J7Q B;  3FIL A;  2RPV A;  2PLP A;  3WAL A;  5D2M B;  2GMI C;  2QIL A;  1I4Q A;  1V5O A;  3GS2 A;  4XYC A;  4AJW A;  3APC A;  1ET6 A;  2FCS A;  4BOZ B;  1NBF C;  5KHQ A;  1Y56 A;  2D3G A;  1Y8R C;  2ACZ B;  2BBC A;  1RM6 C;  1KJT A;  3CIR B;  3VDZ A;  2FUG 1;  1C78 A;  3ABV B;  2QJL A;  3DVN U;  1SE4 A;  3KUD B;  2KNB A;  1HA5 A;  1NEN B;  4PT5 A;  1XD3 B;  1FRR A;  1YIW A;  2B76 B;  4II3 B;  5LXI B;  1PGB A;  1E8Z A;  3RUI B;  1LQB A;  3TEY A;  1TS2 A;  1WE7 A;  4JWS C;  1GJZ A;  1UEL A;  1TY0 A;  3LDZ E;  2M1M A;  1A70 A;  3T9L A;  1TZ1 A;  3HM6 X;  2J52 A;  2INC C;  2OJW A;  4WWM A;  1STE A;  4B0E A;  3AM9 A;  2WU5 B;  4YSX B;  3UIN B;  4MSQ B;  4E74 A;  3MP9 A;  4GOC A;  1CZP A;  4BKT A;  1FFU A;  5KHO A;  2DX5 B;  4HK2 A;  5CHV C;  2AX5 A;  3EC8 A;  1GB1 A;  3RMK C;  4EUT A;  1QT9 A;  1F9J A;  2IJ0 A;  3ZNG C;  1WGY A;  1RLF A;  1P1A A;  4HRO A;  4DXF A;  3KVF B;  2WP9 B;  1ZUD 2;  3AU4 A;  2J4X A;  2G3Q B;  4NQL B;  1EF1 A;  3V6E B;  2XBB C;  4ANX A;  4MT5 A;  3AXC A;  2PPH A;  3EA6 A;  4GDK A;  3ZTC A;  4HVB A;  4EEW A;  1AN8 A;  1HTQ A;  2G4S A;  4FJZ A;  1WH3 A;  1WJN A;  3A4S C;  4YTN B;  3RYT A;  4BFR A;  3HUI A;  2D07 B;  3ZGZ A;  2ZPY A;  4QAY A;  1QIL A;  3IT6 B;  1EU3 A;  3NZ3 A;  1PDX A;  2NS5 A;  4LNF A;  4M01 A;  3W1S C;  3P42 A;  4W9J A;  1C3T A;  2FAZ A;  3L0W B;  2KJR A;  3P2B A;  4YTP B;  1WRD B;  5T8I A;  1PGA A;  1FRD A;  2ZCB A;  2ONQ A;  1WM2 A;  4OW0 A;  4AP4 C;  2N9P C;  3KYC D;  4RF0 A;  1PFD A;  2M0X A;  1V1P A;  4IKG A;  1D5M C;  4HJK A;  4Q2J A;  1N5W A;  5E6J A;  3I9V 1;  2LUE A;  4M0W B;  2JWZ A;  1OQR A;  2JYT A;  3Q3J A;  2FBW B;  1N63 A;  5IKC M;  3I5J C;  1V2Y A;  3LJ3 A;  3V62 A;  2WXQ A;  5HKH A;  3AUL A;  2IGD A;  1WFY A;  1FNU A;  2MP2 B;  3B08 A;  4ANU A;  4BZA A;  3VH4 B;  3SD5 A;  1QKZ A;  2N1W A;  4IM3 A;  5IOI A;  3NS1 A;  3ALB A;  1L7Y A;  2IGH A;  4HRS A;  2W82 A;  1WGG A;  3Q8F A;  3APF A;  1OGW A;  5D7G A;  2XEW A;  3NY5 A;  1WI0 A;  5IN7 A;  3PRP B;  4E71 A;  4KSL C;  4WH4 A;  2GI9 A;  4TUU A;  1V49 A;  2LGS A;  2RSU A;  4DDI D;  1YOV B;  2L8J A;  1ENF A;  3L17 A;  2O2V A;  3RN9 C;  3U30 A;  1EM7 A;  1WGD A;  3ONS A;  1N5X A;  4ZOH C;  4JE3 B;  3TEX A;  4BOS C;  1T3Q A;  3H9D A;  1MG4 A;  2JZ3 B;  1LFD A;  4NJC A;  2N9E B;  1H4R A;  2WXR A;  4PS3 A;  5C23 A;  5IP4 D;  4L1B A;  4MM3 A;  2LAS A;  2UWQ A;  3AEA B;  4W9L A;  4WJQ A;  2G1E A;  1GG3 A;  2FUH B;  2MCN B;  2KTR B;  2LGX A;  2GBR A;  3AE6 B;  1I4P A;  5JXV A;  1GUA B;  4RGO S;  2CR5 A;  5G5H A;  1M94 A;  2JRH A;  2FCM A;  3FIL B;  3BY4 B;  3JSV A;  2V3N A;  5HI1 A;  1D5Z C;  1N60 A;  1TYG B;  2KZR A;  2WXI A;  3TBL D;  5HG2 A;  2HDE A;  2V9H A;  3MFG A;  4BKS D;  4HPL B;  2BWE S;  3AN1 A;  2PTL A;  2DAJ A;  4LNK A;  3Q8B A;  2QMT A;  3DHH C;  3U52 E;  2QC8 A;  1OEY A;  4WUR A;  3BK2 A;  3RUL A;  4K7S A;  4HWI B;  2ZNV B;  3QK0 A;  2Q5W D;  1V97 A;  1KFY B;  2AEH A;  1ET9 A;  1UGJ A;  2DZI A;  1YN4 A;  1JCK B;  2E6X A;  3PO0 A;  2ZW1 A;  3Q3O C;  4HXD A;  3C0R B;  1FM0 D;  3QX1 A;  1UBQ A;  1TBE A;  2DYM A;  1GC6 A;  2M19 A;  1T0S C;  2KX0 A;  1ZPS A;  3R2T A;  1VRA B;  1E8X A;  4A3P A;  4GMV A;  1QOG A;  4OVZ A;  3GP7 A;  1K8R B;  4IOI E;  5BO4 B;  3PRE A;  4LNN A;  1P9D U;  1FXA A;  1EWY C;  1NI3 A;  1TKY A;  1ROE A;  4P16 A;  2BVC A;  2BYV E;  1NEK B;  1F77 A;  1C4P A;  3MTN B;  3JSV B;  5DPW A;  4HKZ E;  1TY2 A;  1L4Z B;  1T0Q C;  2KXJ A;  1UUP A;  2LXA A;  4EOY A;  1TT5 B;  1I4G A;  3VTU A;  1P0R A;  3RNE C;  3FAH A;  3UQB A;  3DBL I;  4WWP A;  4WQM A;  1NYR A;  3IT4 B;  3S2A A;  4IC7 B;  1KM7 A;  5BMH A;  1OQQ A;  2KO3 A;  4RGN A;  5TR5 A;  1WIA A;  1D5X C;  3BYY B;  2J42 A;  2FCQ A;  5DCN A;  1WWT A;  4IM0 A;  2WDQ B;  2LRU A;  1ISN A;  1SJE D;  3AB5 A;  3Q8C A;  3JVZ X;  5I4D A;  2DZM A;  3IHP C;  4GB9 A;  2WDR B;  3KQ4 A;  3ZJU A;  4NJ6 A;  1GNU A;  2LJ5 A;  3SFD B;  3VXW A;  2V3S A;  4DBG A;  1ZDV A;  4W9K A;  2BF8 B;  1Q5W B;  1IYF A;  3V61 A;  4ANW A;  3VR9 B;  4FHK A;  3IAS 1;  1KLU D;  3APD A;  3TCA A;  3DPD A;  4AOF A;  4NAM A;  4WAA A;  2BGF A;  2C7M B;  4NJ7 A;  3N32 A;  1V1O A;  3C8Y A;  2L0F A;  3IAM 1;  4HEA 1;  4MH0 E;  3R3M A;  4A9A A;  3M63 B;  3PZ7 A;  5G2N A;  3ENE A;  1DOY A;  5FK9 C;  2Y5P A;  3N30 A;  4TQ1 A;  2N9L A;  4MEM A;  2OHF A;  4AUQ C;  1EUV B;  1YN5 A;  3IBE A;  3AH7 A;  2HJ1 A;  1GAQ B;  3OWE B;  4ZHP A;  4OHJ A;  2VRR B;  1XLP A;  2DZJ A;  3ZLZ A;  4BVU C;  4XE0 A;  1LM8 B;  4KVG B;  2KN4 A;  4BKS A;  2ON8 A;  4IW0 A;  3UQA A;  3M3J A;  5BYS A;  2ZW0 A;  1QF6 A;  1BUI C;  1FEH A;  2BKF A;  2HJ8 A;  3PV1 A;  3U4E G;  1ZOY B;  4W9F A;  1E6E B;  2FE8 A;  4CYE A;  5DPR A;  3ML8 A;  2LI5 A;  2JZZ A;  1IGC A;  2KTF A;  2DEN B;  4W9H A;  2YLM A;  3LXF A;  1E7U A;  3RI7 C;  3HHM A;  1U4A A;  1L0X B;  1WX9 A;  4TV3 A;  1HZ6 A;  1WXA A;  2O6V A;  2JUO A;  3AE7 B;  4OZB A;  4IM2 A;  3X0W A;  4RGT A;  2BTE A;  2LGI A;  2D3C A;  4IWQ A;  2NCN A;  1XLO A;  1WGH A;  4DK5 A;  4ASW C;  2WXP A;  3MC0 B;  3PHW B;  2BW2 A;  5IO9 A;  2LEK A;  2Y3A A;  3RZW C;  4RMA A;  4FBJ B;  1SGH A;  4ZYS A;  2IO2 B;  3QWZ B;  1NYQ A;  1C77 A;  3V05 A;  2KWU B;  1GC7 A;  4B9K A;  3RT3 B;  1LO5 D;  1I42 A;  2N7E A;  2WXH A;  1WJ6 A; 
#chains in the Genus database with same CATH homology
 4P6V F;  1C4A A;  3W5V B;  3B2F A;  1TS3 A;  1UWM A;  1FRD A;  1L0Y B;  1ZP0 B;  2ONQ A;  3W5U B;  1AWD A;  2E3T A;  1FIQ A;  1VR9 A;  4OW0 A;  3AEC B;  2SEB D;  1YNT E;  2Y5C A;  4RFB A;  3IXS A;  1QOB A;  5EE0 A;  4GDL B;  4RF0 A;  1FXI A;  1PFD A;  1V1P A;  2PVG C;  4IKG A;  1GB4 A;  1GOZ A;  1D5M C;  5C3J B;  4Q2J A;  1N5W A;  5E6J A;  3I9V 1;  1SJH D;  1E7P B;  1TKE A;  4UDU C;  2VZK D;  1K52 A;  2WXL A;  1OQR A;  2JYT A;  1NVI D;  1IGD A;  1B1Z A;  2FBW B;  2JYE A;  5EE3 A;  2YEP F;  1N63 A;  5AUK A;  5EE1 A;  1YQ4 B;  3VRA B;  1MVK A;  1VZ8 A;  3J9C A;  2WU2 B;  2WXQ A;  1JWM D;  5AUI A;  4LLG M;  1FCC C;  1R7S A;  2IGD A;  1WYG A;  1FNU A;  3ZQ4 A;  3ZYY X;  4L23 A;  3EGR A;  3FC4 A;  4A6Q A;  1KRH A;  1QKZ A;  1IBX A;  2ICI A;  3BVM A;  4REZ A;  3NS1 A;  2K3U A;  2IGH A;  1KH0 A;  4YXD B;  4HRS A;  2GRI A;  1MI0 A;  3NVZ A;  2MJ3 A;  2BS4 B;  2W82 A;  5H8Y E;  1WRI A;  4KKJ A;  4YT0 B;  4DQO C;  2LHD A;  3Q8F A;  4KKI A;  2LFI A;  2OED A;  4O1N A;  3URY A;  1MPE A;  2QIE B;  1TZO A;  1KF6 B;  5D7G A;  1SXT A;  2IDY A;  4TSS A;  1PUT A;  3R8B A;  1SF0 A;  2L32 A;  2CU3 A;  1P7F A;  2CJO A;  3EUB 2;  3V3X A;  4WH4 A;  4XWW A;  2GI9 A;  3TUO A;  1FNW A;  1QQR A;  1WGK A;  4KGR A;  3P63 A;  3T3N A;  3ETR A;  3AV8 A;  1ZXH A;  4MM3 B;  1ENF A;  1HZ5 A;  1TS5 A;  1AW7 A;  3BYT B;  4JPS A;  4EE2 A;  2LJI A;  4L2Y A;  4NAW B;  4AS1 A;  1OFF A;  1BML C;  1SB3 C;  4XDC A;  1EM7 A;  4RGM A;  1QOF A;  1WSP A;  5HHD G;  2WXJ A;  1N5X A;  4FXC A;  4ZOH C;  3CWI A;  1T5X D;  4JE3 B;  1I4R A;  3LB8 C;  3TEX A;  2KMM A;  1E0Z A;  2LMC A;  3KWV A;  4GDK B;  1T3Q A;  2W3R A;  3WCQ A;  1C79 A;  1CK1 A;  3AEG B;  3SFE B;  4NJC A;  1TS4 A;  3BVG A;  5FR3 A;  2WXR A;  3AE5 B;  4OZC A;  1MHH E;  2K9X A;  4ITK A;  4YTM B;  4L1B A;  4OZA A;  3ZJV A;  2PVO D;  3AEA B;  3W1S A;  1JAL A;  3L4P A;  1C76 A;  2WXN A;  2G1E A;  3MHZ A;  1XEE A;  1RYJ A;  3BVZ A;  5FKA C;  2J53 A;  3TSS A;  3VRB B;  1ESF A;  4LTU A;  3U2S C;  1K51 A;  4ZHO A;  2I2Y A;  1ZXI A;  3Q8E A;  1E10 A;  3AE6 B;  2WXK A;  4US9 A;  1I4P A;  5JXV A;  2RDG A;  1PGX A;  2D5G A;  1FMA D;  3W2D A;  4RGO S;  5G5H A;  4GLS C;  1JRO A;  2X38 A;  1L0V B;  4HJG E;  1L6U A;  2PIA A;  3FIL B;  1CJE A;  1L4D B;  1K50 A;  4B0M A;  5HI1 A;  2V3N A;  2JZP A;  4H2A A;  1D5Z C;  1N60 A;  2XN9 C;  1FNV A;  4RH6 A;  1TYG B;  2WXI A;  1SBB B;  5HG2 A;  3AE2 B;  2HDE A;  1YJI A;  2INN E;  3MFG A;  1J7B A;  1QLB B;  4TMA B;  1K53 A;  4N58 A;  1XF5 L;  2R61 A;  4ARI A;  5EE9 A;  4US8 A;  4C56 C;  1F0Z A;  3AN1 A;  3DWG C;  2PTL A;  1YQ3 B;  5BMI A;  1ZE3 D;  2GB1 A;  3P4P B;  1UWX A;  3Q8B A;  2QMT A;  4MH8 A;  3U52 E;  3UI3 A;  4D2K A;  3DWM A;  2PMV A;  2WDV B;  3BK2 A;  4WUR A;  2BYT A;  5GXG B;  2W3S A;  2Q5W D;  4RF1 A;  2DWQ A;  1V97 A;  2JU6 X;  2JX5 A;  1KFY B;  3BWU D;  4TQ0 A;  1FD6 A;  1JWS D;  2EEL A;  1ET9 A;  1UGJ A;  1SIJ A;  1YN3 A;  3Q69 A;  2MJE A;  3AMZ A;  3P4S B;  4JX1 C;  1YN4 A;  1JCK B;  2E6X A;  3PO0 A;  4RNA A;  2ZW1 A;  5BYR A;  1V8C A;  1I4H A;  4N6E B;  3R2I A;  3BII D;  3P1M A;  1FM0 D;  2N9K A;  3AE4 B;  3VR8 B;  2KAC A;  2WNM A;  2DYM A;  3HRD D;  3PZ8 A;  2M19 A;  2WLB A;  2WXM A;  4LK0 M;  4A8X C;  1DOI A;  2HTM E;  2BB5 A;  1ZPS A;  3R2T A;  3GB1 A;  1VRA B;  2BT6 A;  1EU4 A;  1FFV A;  4YSY B;  3O13 A;  4M0W A;  2N7J A;  4A90 A;  2JWU A;  1QOG A;  4OVZ A;  1I4X A;  1JQ4 A;  3GP7 A;  1XO3 A;  4IOI E;  2V3P A;  1HEZ E;  1FXA A;  1EWY C;  2L83 A;  2MEK A;  1NI3 A;  1TKY A;  2WQY B;  3B9J A;  1ROE A;  4P16 A;  5HFY A;  1N61 A;  1BXT A;  1NEK B;  1F77 A;  1C4P A;  4DXG A;  4CQN A;  2AQ3 B;  2PKO A;  5G5G A;  1J7C A;  2WXG A;  4HKZ E;  1TY2 A;  4USA A;  1L4Z B;  2H88 B;  2NTS A;  1FCL A;  3MJ5 A;  1UUP A;  3TEW A;  2K0P A;  5BYQ A;  5BMG A;  1I4G A;  2NTT A;  2W55 A;  5D3D A;  3FAH A;  4XDD A;  3HVD A;  4WAF A;  4WQM A;  5H92 C;  1FO4 A;  1NYR A;  3IT4 B;  4N59 A;  2KWD A;  1L6V A;  3AE9 B;  5BMH A;  1F2R C;  2KAJ A;  2MJD A;  1OQQ A;  1YJJ A;  1DOX A;  2CJN A;  4RGN A;  5LNK 1;  3RPF C;  1JWB D;  1E9M A;  1L5P A;  3W9C B;  1D5X C;  3BYY B;  1HXY D;  2JSV X;  4KGT A;  2J42 A;  3NVV A;  1WWT A;  1P7E A;  2SAK A;  2WDQ B;  3TEZ A;  1DYQ A;  1SJE D;  3AB5 A;  3Q8C A;  2M56 B;  3E56 A;  5I4D A;  3ZJT A;  1I7H A;  1C4C A;  2WDR B;  3KQ4 A;  3ZJU A;  1XLN A;  1HQR D;  2INP E;  3AEE B;  3AE3 B;  1IUE A;  2DBY A;  4JWU C;  4ZRQ A;  3SFD B;  1ZDV A;  2Z8L A;  3VR9 B;  1Q10 A;  2LHE A;  3IAS 1;  2DLB A;  1KLU D;  1SEB D;  1SSN A;  2IGG A;  5C2T B;  1T6B X;  2I38 A;  2BS3 B;  4NAM A;  2N0S B;  2MH7 A;  3VQI A;  2AQ1 B;  3B2G A;  2WXF A;  4ZRP A;  3NVW A;  3Q8A A;  2PW9 A;  4R3D A;  4A55 A;  1VDV A;  1ZDX A;  2QSD A;  3FIL A;  2RPV A;  3SEB A;  4HEA 1;  1V1O A;  3C8Y A;  1C9F A;  2PLP A;  3IAM 1;  3LYY A;  3BK1 A;  1M4V A;  2QIL A;  1I4Q A;  1JWA D;  4A9A A;  3PZ7 A;  3GS2 A;  1SE2 A;  1YMH E;  4NZL B;  1DOY A;  1ET6 A;  5FK9 C;  2Y5P A;  5D3I B;  1XCQ L;  1CQV A;  1ACC A;  3I57 A;  4TQ1 A;  4C80 A;  2N9L A;  3AE8 B;  2OHF A;  1AYF A;  1Y56 A;  1YN5 A;  2ACZ B;  2BBC A;  2RMM A;  2VZK B;  3AED B;  1RM6 C;  3AH7 A;  2BB6 A;  4J3O D;  1GAQ B;  1KLG D;  4HKQ A;  3OWE B;  4ZHP A;  3CIR B;  5MPO A;  4OHJ A;  3N9Y C;  1XLP A;  2FUG 1;  1C78 A;  1WXQ A;  4XE0 A;  1RFK A;  2KN4 A;  3E9S A;  1KTK A;  1EWC A;  3ABV B;  2QJL A;  1SE4 A;  2DYO A;  1HA5 A;  1IBX B;  2ON8 A;  1NEN B;  4PT5 A;  1FRR A;  1XLQ A;  1D4B A;  1VZ6 A;  1D6E C;  5BYS A;  3NRZ A;  2ZW0 A;  2B76 B;  1QF6 A;  1BUI C;  1N62 A;  1FEH A;  2H89 B;  2TSS A;  1PGB A;  1DGJ A;  1GPX A;  1MHX A;  3KWL A;  3T3O A;  2XNA C;  3U4E G;  3TEY A;  1VLB A;  1TS2 A;  4JWS C;  2KDM A;  1TY0 A;  2L52 A;  1A70 A;  1ZOY B;  1VZ7 A;  4XWT A;  1E6E B;  2FE8 A;  2J52 A;  2IPK D;  4WWM A;  1JRP A;  1STE A;  4B0E A;  3AM9 A;  4YWG G;  2WU5 B;  4YSX B;  1IGC A;  1JW9 D;  2V4I B;  3MP9 A;  1CZP A;  1FFU A;  1J7A A;  2YEP B;  3LXF A;  3HVZ A;  3H8H A;  2K5P A;  2AX5 A;  3P4R B;  1QOA A;  1GB1 A;  2KQ4 X;  1V1P B;  1VJK A;  2LUM A;  4IDI A;  1QT9 A;  1TJE A;  2QEJ C;  4KX6 B;  3SR6 A;  1L0X B;  2IJ0 A;  2WXO A;  4KGS A;  4C7Z A;  1HZ6 A;  3KLS X;  4HRO A;  2AQ2 B;  4ARC A;  4DXF A;  2WP9 B;  1ZUD 2;  5TSS A;  2BS2 B;  1SE3 A;  2G9H D;  3AE7 B;  2J4X A;  1XXG A;  4OZB A;  2V0G A;  1JML A;  2JXT A;  1RWS A;  2WS3 B;  4RGT A;  2JQR B;  2EKI A;  2BTE A;  4MT5 A;  2LGI A;  1F2R I;  3AE1 B;  1JWU D;  3EA6 A;  1XLO A;  2M0A A;  4C7Y A;  4MAC A;  1AN8 A;  2WXP A;  3MC0 B;  3NVY A;  3AEF B;  1UNS A;  4YSZ B;  4YTN B;  4AQ7 A;  4RCO A;  2RDH A;  2BW2 A;  3HUI A;  2LEK A;  3NUH B;  2Y3A A;  4WIP A;  3ZGZ A;  2W54 A;  1QIL A;  3IT6 B;  1EU3 A;  3NZ3 A;  3U7Z A;  1PDX A;  2NMQ A;  1B9R A;  4ZYS A;  3P42 A;  3RFZ B;  3BZD B;  3AEB B;  1NYQ A;  1C77 A;  3P4Q B;  3V05 A;  1TKG A;  1XCT L;  4YTP B;  1LO5 D;  1PYW D;  2WXH A;  5T8I A;  1PGA A;  2K22 A;  2L1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...