3WCQA

Crystal structure analysis of cyanidioschyzon melorae ferredoxin d58n mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVNQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Increasing the electron-transfer ability of Cyanidioschyzon merolae ferredoxin by a one-point mutation - A high resolution and Fe-SAD phasing crystal structure analysis of the Asp58Asn mutant
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Electron transport
total genus 24
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3wcqA00
2AX5A 2PKOA 3P63A 4P6VF 1XO3A 1AYFA 1RYJA 1E6EB 1ZUD2 2M19A 2DBYA 1FFUA 2W55A 2WP9B 3AE6B 1WGKA 1N5WA 4JX1C 2BS3B 3P1MA 1QLBB 4IDIA 4WWMA 5C2TB 1J7CA 1GAQB 1RWSA 1FO4A 2MJEA 1YQ3B 3LB8C 3FC4A 3AM9A 2JX5A 1EWYC 1L5PA 1TYGB 3CWIA 4KX6B 1JWAD 4N59A 4US9A 1E0ZA 2BS4B 3AE2B 1XLPA 4C80A 1OFFA 3AMZA 3FAHA 1TKGA 5EE0A 3LXFA 3ETRA 3NVVA 5AUKA 1JW9D 1FFVA 2JQRB 3NVZA 3P4RB 1L0VB 2Y5CA 4N6EB 1I7HA 3NVYA 4ZOHC 2N0SB 1E7PB 1T3QA 3W9CB 1QOAA 2PVGC 4A9AA 1SIJA 3AEEB 3KWLA 1N60A 3SR6A 1KF6B 2ACZB 1WWTA 1XLOA 2H88B 2BS2B 1DOYA 4JWUC 1F0ZA 1JRPA 5H92C 5EE3A 4YSXB 3CIRB 1ZOYB 4YSYB 4YTPB 1NENB 1ZP0B 3AE4B 3ZYYX 1FRDA 1DGJA 5GXGB 2K22A 2WLBA 1V97A 1JROA 3HUIA 3AE3B 3B9JA 2CJNA 2LEKA 3AE7B 1ROEA 3B2FA 1QT9A 2W3SA 1JWBD 2WDRB 5C3JB 1OQRA 1CJEA 1WYGA 2WDQB 3NRZA 1QOBA 3P4PB 5G5HA 3VR9B 1TKEA 3HVZA 2KMMA 1QOFA 3AH7A 1N62A 1E10A 1N63A 1SF0A 1NVID 2PIAA 3ABVB 4USAA 1FM0D 2WU2B 4N58A 1WRIA 3AEGB 2PVOD 1NI3A 4JWSC 2CU3A 3DWGC 3DWMA 2B76B 3HRDD 1L6VA 2L83A 2Q5WD 3SFDB 4YXDB 4US8A 4FXCA 1TKYA 5AUIA 1CZPA 5EE9A 4C7ZA 1UWMA 1KRHA 1TJEA 2CJOA 2L52A 1QOGA 2K5PA 4YTNB 5G5GA 1PUTA 1WXQA 2KAJA 2BT6A 3NVWA 3AEDB 3AN1A 2EKIA 4C7YA 1R7SA 1PFDA 3W5UB 1ZXIA 2FBWB 1JALA 1N5XA 3WCQA 1YJIA 4YTMB 1DOXA 1XLNA 2WU5B 1VJKA 3VR8B 1J7BA 3W5VB 1NYQA 1VLBA 1OQQA 2OHFA 2WQYB 2WS3B 1V8CA 1QF6A 2MJ3A 3AEFB 4HROA 3L4PA 5MPOA 1SB3C 1L6UA 1IUEA 1GPXA 1KFYB 3AECB 5H8YE 1E9MA 3RPFC 3AE1B 2M56B 3EUB2 3VRBB 3AE9B 3B2GA 3AE8B 2W3RA 2G1EA 1FRRA 1B9RA 3P4QB 3AEAB 4WQMA 2WDVB 1A70A 3BIID 1NEKB 4ITKA 1FMAD 1FXIA 1NYRA 3AB5A 2HTME 1DOIA 3AEBB 1FIQA 3AV8A 3P4SB 4YT0B 4ZHOA 3PO0A 2QJLA 4LTUA 2MH7A 1YQ4B 4YSZB 1JQ4A 1YJJA 4HRSA 1N61A 5EE1A 4ZHPA 2QIEB 1AWDA 2H89B 2DWQA 2W54A 1J7AA 1RM6C 1PDXA 2MJDA 3NS1A 1FXAA 3AE5B 3VRAB 2E3TA 2K9XA 1XLQA 3SFEB 1RFKA 1VDVA
chains in the Genus database with same CATH superfamily
1ESFA 2ZCCA 1XO3A 4TUUA 5DPTA 1RYJA 3ZXVA 1QLBB 4E3CA 3DHIC 2BB5A 2L0FA 3C8YA 3ZVVA 2ZEQA 1I4XA 3LXFA 3DPDA 2RDBC 3TSSA 1R4NB 3ZDTA 1I7HA 2M0AA 2VH2A 2IO2B 2MLBA 2XK5A 2D11A 3AEEB 3KWLA 3MTNB 1TS4A 2XBBC 4JWUC 4W9KA 2G3QB 1ENFA 2LJ5A 4LNIA 3HUIA 4FN2A 3AE3B 4LNFA 1P98A 3N32A 4PS8A 4TMAB 4LNKA 4GDKA 1A5RA 4NPNA 3V6EB 1GUAB 2IDYA 4FULA 1WX8A 3ZDMC 3PT2B 1BUIC 1EF5A 2FIFA 2QSDA 3WCQA 2KJHB 2LFIA 3O65B 1SB3C 3V05A 1KFYB 2BPSA 2GBJA 2DAJA 3AE1B 3RI7C 2M56B 2QILA 3SDLC 5CTRC 2JWUA 2FIDA 2D3GA 2N9EB 1DOIA 4DXFA 1PGBA 4GU2A 1XT9B 1Z2MA 3EFCA 2IYDB 2DYMA 4DHZE 1J7AA 2K8BA 1FXAA 3TBLD 2BQQA 2YEPF 3AU4A 1V1PA 2AX5A 1WH3A 3TEXA 2WP9B 1GG3A 1YMHE 1C78A 2JYTA 2NPTB 1JWAD 2BS4B 4II2B 1SSNA 2YLMA 2FUG1 4GOCA 4M0WA 3QA8A 2PE9A 3VUXA 3H7PB 2D3CA 1YQBA 2IO0B 4URKA 2BB6A 2JF5A 4II3B 2NBUA 2C7NB 5D3DA 4KGRA 1MHXA 3GS2A 4MEMA 2KKCA 3AE7B 1YN3A 2WDRB 3NRZA 2ZPYA 2QHOA 4L2YA 4OZAA 2GOWA 2DLBA 3BZDB 2HE7A 1UGJA 3JYUA 3ZTDA 5E6JA 2LVQA 2B76B 4A55A 3IXSA 3GZNI 2WGSA 2L7RA 2LJIA 3PHXB 1D3ZA 4IWOA 1MG8A 1JALA 1FXTB 2KD0A 3U52E 1T5XD 1JWSD 2OHFA 1F2RI 2K0PA 4HROA 4C56C 2JVCA 4J3OD 4I6PA 5I4DA 4YWGG 4BBNC 2KTFA 2E6XA 4WAAA 3IAS1 3TJPA 1FRRA 1KLVA 2LHDA 3VTUA 2JRHA 4S0RA 3BIID 1FMAD 2FNJB 3MC8A 3DBHI 2W54A 1UF0A 2RD0A 3L0WB 3CSTA 2INCC 4E74A 1VDVA 2Y3AA 1AYFA 1ZUD2 1WGKA 3RZFA 2PLPA 3FKYA 2LGDA 1MFWA 3ZGZA 4A90A 2NCNA 1YOVB 2A4ZA 4DHZB 4KIKB 3ZKJC 4DK5A 5AZFA 3NVYA 4IW0A 1IGCA 4XWWA 4DHJD 2DAFA 3MP9A 2BKRB 5FR3A 2JRIB 3SR6A 1KF6B 4NY0A 2R2OA 3UINB 1X1MA 2HJ8A 3PS6A 1P7EA 2C7MB 2V9HA 1Z5SB 5T8IA 1T0RC 2NPTA 3ZRCA 2K39A 5D2MB 3TEYA 2MBBB 4LNOA 1JWBD 2LGXA 4FLHA 1WXSA 3ABVB 4I6NB 2WU2B 4NZLB 3DWMA 4BKGA 2BWFA 3WIMA 2RPQA 2V3PA 3PPAA 1XXGA 2VH1A 4GSWA 1XLNA 3HVDA 2KANA 3NZUA 3GB1A 1JMLA 4JL9A 1GPXA 1Y56A 4AQ7A 5HI1A 1JWUD 1XD3B 2KTRB 2PPHA 2G1EA 5HHDG 2ZJDA 3DBLI 1E5WA 2KWUB 2N7EA 4KVGB 2UU7A 3RFZB 4LLGM 3Q69A 3Q8AA 1R4NI 2WXKA 2JZ3B 2DHZA 2DZJA 1IYFA 1YJJA 4TQ0A 2QIEB 4KKIA 2FUHB 1ZE3D 5J2RA 3Q2AC 3VRAB 3AE5B 1UWMA 2LGYA 1Q10A 3Q14C 3U7DA 3VVWB 2D3AA 3CWIA 2ZVOA 3ZNGC 2J0KA 4IM0A 1JW9D 2JQRB 3P4RB 3A1QB 3ZJUA 2YEPB 2LXAA 2QMTA 2GI9A 2YVCA 1WGHA 5TR5A 1JRPA 5H92C 2JZPA 1UBIA 1ZP0B 1DGJA 3P42A 1RRBA 1TS3A 3HIZA 4ZRKA 1C4PA 3KW5B 3PVLA 3AI5A 3EC8A 4KIKA 3B2FA 1WIAA 1G6JA 2B3AA 2M0XA 1OQRA 2ZNVC 2LD9A 2M1MA 3LJ3A 1LO5D 2KMMA 1ZDVA 1E90A 3MJ5A 4DQOC 1Q5WB 4AWJA 1WGDA 4C00A 2CJOA 2K5PA 2ZCBA 1PUTA 4IC7B 2WXIA 3PGEA 1T0QC 3VR8B 3W5VB 3Q8CA 4OZBA 1Q0WB 2WQYB 2JY6A 5G55A 5HKHA 4ZRIA 4MGYE 2DZKA 3I9V1 4M01A 3Q3JA 2N9LA 2KFKA 4W9EA 4YL8A 4ARIA 3H1UA 1WI0A 3JSVB 1C9FA 4YT0B 1T6BX 4F1SA 4LTUA 4C4VB 2MH7A 1PGXA 2EKEC 5BMIA 4F8CB 2LZ6A 1AW7A 2H89B 4WWNA 3U2SC 4XYCA 1M94A 3NG0A 1XEEA 3MC9A 2E3TA 1L0YB 3R7QA 2IPKD 3HK0A 2IGHA 5DPSA 2DBYA 5IA7A 1J7CA 3VTVA 5FKAC 2MBOA 1EWYC 4US9A 3DVGX 5LXIB 4M02A 3V62A 3BWUD 4G0NB 3I3TB 2NTTA 2HJ1A 2J42A 2J7QB 1SIJA 2GRIA 4XDCA 2KMAA 1F0ZA 3RNBC 1NENB 2JZZA 2DZMA 1WM3A 4EZJA 2WLBA 3VDZA 2V1YA 1J0GA 3SD5A 3ZJVA 2LEKA 1MHHE 3M95A 1WSPA 3L54A 3A1QA 1E8YA 2JUOA 4CHKA 1K50A 1TKEA 3B1LX 2UYZB 3ZNZB 4USAA 5DPWA 2CU1A 1BT0A 2ZW1A 2L83A 5D7GA 1F9JA 1EU4A 2G45B 2GLSA 4RGTA 1WZ0A 4O1NA 2V4LA 2Y5PA 2RPVA 1V9JA 4MJSB 3PLUA 3P2BA 1NYQA 3ZO5B 2GBRA 4FHJA 4ZYSA 2ZPNA 3N9YC 3QCAA 1V81A 2WXRA 3DVNU 1HQRD 4NAWB 1XQQA 2KDEB 1FNUA 4R3DA 1EF1A 1YX5B 1LFDA 3PO0A 4AJYB 2CR5A 2MQJA 4TSSA 3U8ZA 4P16A 2FCNA 3R3MA 4WQOB 4RF0A 1XF5L 3UQBA 4LDTD 1U4AA 1E6EB 3R8BA 4KDIC 1WJUA 2LGIA 3RMKC 4WWMA 3ALBA 1RWSA 3PHWB 1RLFA 1YD8U 1WX7A 3FC4A 2JX5A 1L5PA 4C4VA 5EDSA 4N59A 2ZZPB 3AE2B 5IP4D 2D5GA 1UNSA 1WR1A 3MC0B 5JHAA 2N4FA 3I5JC 4IWPA 2PVGC 3KQ4A 1UGMA 4OZCA 2ACZB 3QK0A 3GOEA 5EE3A 1HTOA 3ZTCA 3BINA 3L16A 4M8MA 2BGFA 5GXGB 2KVRA 1JROA 4NJ7A 3ZRFA 4EFOA 4JGHB 2KC1A 3A9JB 2KZRA 1N62A 2AQ3B 4ANVA 3AEGB 1L6VA 3NOBA 1XCQL 3HHMA 5CHWA 3RNAC 4XGAB 2N9PC 1LQBA 4FADA 1NDDA 3AEDB 3PRZA 1N5XA 4MSMB 4EKUA 3W1SA 4ANWA 1SEBD 1VLBA 1OQQA 2WS3B 1V6EA 3TMPB 3L17A 5H8YE 2WX1A 3ZQ4A 4S17A 3JVZX 4XE0A 4A3OA 4PK1A 4ACFA 3N1XC 2QC8A 2KDBA 4MJSA 5BYRA 4YSZB 2V0GA 1K51A 2BVCA 2RDHA 4HKZE 1WE7A 1F1HA 1RAXA 3QJZA 1WXVA 2ZNVB 3TEZA 2K9XA 2K6QA 1FNVA 3ETRA 2SEBD 3ZNID 1JCKB 2O6VA 2DX5B 1D5ZC 2MP2B 3AM9A 4EZLA 4RFBA 3T3OA 4P1BC 3BVZA 1FNWA 2BYVE 3QIJA 4MM3B 4HPMB 1L0VB 4ASWC 1I35A 1UZXB 2O2VB 2KX3A 2L3ZA 2O6VD 1PQSA 1VZ7A 3B0AA 3ZIMA 2AEHA 4B0EA 2KXJA 4KDLB 1IBXA 4K81A 2AWTA 1SXTA 2L76A 2Z8LA 4A6QA 1I4RA 2LUEA 1V86A 3C19A 3Q8EA 2MWSB 3A4RA 5HG2A 2W9NA 2WDTB 1TTNA 3P4PB 3HVZA 2ZW0A 2PIAA 4E71A 2DYBA 2PEAA 4JWSC 2Z0DB 4HEA1 4YXDB 1TKYA 4RGMA 4FJYA 1HXYD 4XC2A 1V8CA 1QF6A 5C23A 3CSFA 2MW5A 1Y8RC 2MBQA 2CHWA 3B2GA 3GE8C 4RGOS 1GB4A 3Q3FA 3TUOA 3APCA 2INPE 1VRAB 2RMMA 1FXIA 2A5UA 2C9WB 4IM2A 4IUMB 2QJLA 4ZRJA 4XDDA 1N61A 2N1WA 1TIFA 2DWQA 4B95A 2DENB 2Z0EB 1H4RA 1R4MB 3NS8A 5BMGA 3JW0X 1WRDB 2M19A 5G5HA 3M62B 5C2TB 1BXTA 4G3XB 1P3QU 1WYWB 2I1JA 2LVOA 2MRPA 3DBSA 2INNE 3PZ7A 2JSVX 5EE0A 5AUKA 4WH4A 3NVZA 1HTQA 1IP9A 1FD6A 3X0WA 1F2RC 5LLIA 1ZDXA 3BY4B 3TCAA 4KGTA 3RNGC 2AL3A 3I57A 1V5TA 3EECA 3VAWA 1TT5B 3NUHB 2MP2A 2L0TA 2KDMA 4BBNF 3W1SC 1SJHD 5IO9A 4MH0E 1WMHB 2WWZA 4OVVA 2EMSA 5C3JB 1WYGA 2K8CA 3Q3NC 1KTKA 3T8MA 2O2VA 5CHFA 1SF0A 1FM0D 3NJTA 1NI3A 2CU3A 1P7FA 1I4GA 4FXCA 2NMQA 2LASA 4W9HA 2LVPA 5CX3A 5EE9A 1GJZA 4HPLB 1ZGUB 4OHJA 3O13A 2WXNA 4MELA 1TY0A 1V2YA 2CKHB 4JIOU 2V3SA 1L7YA 3BVMA 4IG7B 2KNBA 2L00B 2Z59B 4WJNA 2GBMA 2K1FA 1EO6A 3W2DA 3H7PA 1IUEA 1WZ3A 1RFAA 1TY2A 1IGDA 2INDC 3DHGC 1HZ6A 3EA6A 4Q2JA 1NEKB 2CS4A 1C79A 1ZKHA 3AEBB 1QZEA 4HJGE 4ZHOA 1MVKA 3PSEB 4HKQA 4MGKE 3GP7A 1AWDA 1HA5A 2XNAC 4RGNA 2LWPA 1QQRA 3N1YC 2PJHA 3EHVA 2BWES 1QKZA 2JXXA 2XN9C 2BBCA 3H8HA 1P1AA 3ECIA 1HZ5A 4HK2A 1XLPA 1OFFA 3FAHA 2KC2A 3ZUNA 3A9KB 3SHQA 2EMTA 1GC6A 3U4EG 3MFGA 4GB9A 4ZRQA 4W9FA 1ZOYB 4W9DA 2MBEA 2KK8A 1LXDA 2KQSA 3M3JA 3UGBB 2TSSA 2IO3B 3N20C 4LJOB 3T3NA 4GMVA 4B6WA 3TEWA 4MACA 1SE2A 1NVID 1DYQA 3BVGA 3SFDB 2FCSA 3HM3A 3DCGA 2AQ2B 2D10A 3PRPB 4CYEA 5JXVA 1PGAA 1WMHA 4M00A 2KJ6A 3R66C 1J7BA 2HD5B 2IY0B 4K3CA 1OEYJ 3ZXRA 2WHIA 2AQ1B 4WIPA 3RULA 3MJWA 2QEJC 3AE8B 2KWVB 3QHTA 1K53A 3DHHC 4GXBA 2RDGA 1I4HA 2MSED 4NQKE 4WJPA 2M17A 4WWPA 1VZ6A 1EWCA 3UIOB 1JWMD 2VRRB 5GMVA 4JLCA 3RNEC 2CHZA 2N9KA 3D32A 2MJEA 2RGFA 3LB8C 4EZKA 1YJ1A 2AYOB 3N30A 5J18A 4WAFA 1E0ZA 5JHBA 4BKSA 3SU8X 4FHKA 1C4AA 2KVZA 2ASQA 3I63C 1N60A 5J17A 2KTRA 2H88B 2KDIA 4LCDE 2I2YA 5AZHA 3U7ZA 3VH4B 3WAOA 2HTHA 1ET9A 2KLCA 2WXQA 3M63B 1KLUD 4BKSD 3WALA 1WE6A 2IJ0A 3A9KA 4BOZB 4IKGA 1UH6A 4P7IA 4WJQA 2JT4B 1V80A 2LRUA 5BYSA 5JZEB 4KV2A 1MPEA 3GZNB 3LYYA 1P0RA 2BT6A 1DOXA 3VUWA 2KYWA 1CMXB 3KWVA 4RM9A 1GOZA 1L6UA 2GMIC 2K6DB 1B9RA 1OEYA 3S2AA 4DXGA 2NBWB 4WQMA 3RNFC 1EUVB 2GBKA 2N1VA 2SAKA 1SIFA 2OJWA 3Q8BA 2FCMA 3GE3C 1UBQA 4GDKB 4ZHPA 4EOYA 4JQWC 4BOSC 1PDXA 3W1YA 4W9LA 3NS1A 4ZDVA 3QX1A 1XLQA 4X57B 1RFKA 4EE2A 3V6CB 3P63A 4BZAA 2BKFA 4KGSA 4RCOA 3H9DA 2W55A 2BS3B 3P1MA 3Q8FA 1IPGA 1KLGD 2V3NA 1YQ3B 4BFRA 2IY1B 1YN4A 1ZW7A 1TYGB 2KACA 3TIXA 1J19A 4K7WA 4N6EB 3VH3B 3ZW3A 3WAPA 1VD2A 1XCTL 4A9AA 1YN5A 2LHEA 3QARA 1MI0A 2J53A 2FCQA 3NHEB 2M8SA 3JSVA 4BVUC 1N6ZA 4XZ4A 3RCZA 4W9GA 3IT6B 4OW0A 1E10A 1QOFA 1N63A 1WGYA 1V1PB 2Q5WD 3K9OB 1T0SC 5CHVC 1F77A 4KZCA 4DDGD 2OJRA 3BYTB 3AN1A 1MG4A 2RR9A 1YX6B 1SGHA 1YJIA 2G4SA 3ONSA 2WXHA 4M0WB 3RNCC 2MJ3A 1YIWA 2N7DA 1I42A 3AECB 4L1BA 3BK1A 3V3XA 2LI5A 2BYEA 3EUB2 4FBJB 1ET6A 4DXAB 1WY8A 3AE9B 3AULA 2I1KA 5IOIA 2KN5A 1A70A 5L83A 2R61A 4KKJA 2J0JA 4W9IA 3DBLB 2HTME 5E6PA 4WWOA 5AZGA 4TQ1A 4HCNB 2IGGA 4PYUA 5D94A 2BYFA 3T9LA 3K9PB 2LGSA 2KO3A 1ISNA 3NZSA 1SE4A 1C76A 4ZRPA 3UIPB 4JX1C 1FFUA 3AE6B 1N5WA 2WXOA 1YNTE 2ICIA 1GAQB 3ZNHB 1D5MC 1SE3A 4ARCA 3OJ4B 2KWDA 2Y5CA 5BO4B 2QCZA 3V60A 1C77A 1CK1A 3MHSD 1FCLA 1WWTA 2BS2B 2KQ7A 2W82A 4XWTA 4NAWA 1FCCC 3TL5A 3UI3A 5FK9C 3BYYB 1QILA 1FRDA 3DBRB 5G2NA 3N3KB 4B0MA 1ROEA 3DVGY 2RSUA 2N9XA 1C3TA 2WXJA 3OAWA 4MGZE 2KN4A 4N58A 4EUTA 4DHJB 4XX5A 3HRDD 2KJRA 3KUDB 4ICVA 2PMVA 2WNMA 1WX9A 4HLEA 3BK2A 5E6NA 1ZXHA 4WURA 2FBWB 3DVNV 2MCNB 2KWCA 3A33B 4OVZA 2BW2A 1V1OA 4H2AA 1KM7A 2BTEA 2KOXA 2ONQA 4BKTA 3PLVA 1WGGA 2KX0A 3AEAB 4IOIE 2CHXA 4DDID 1V49A 1WJ4A 3VUYA 2KQ4X 1JQ4A 1YQ4B 3A9JA 1M4VA 4GDLB 1WXMA 2D3BA 2MJDA 2KDFB 1OQYA 3CIRB 2KLGA 1H8CA 4RMAA 3VQIA 2JWZA 4GLSC 4IDIA 3H7SA 1D5XC 3NZ3A 3AMZA 4NJCA 2AL6A 2QDFA 1FFVA 2L1AA 3IVFA 3H6NA 1FPYA 4NJ6A 3W9CB 4AS1A 4RF1A 1WM2A 4AOFA 2C7HA 4HCPB 4YSYB 3OG5A 3IHPC 2X8XX 1UUPA 3ZYYX 1C4CA 2HDEA 3E9SA 2X38A 1V97A 3QQ8B 4CQNA 2D2QA 4MSQB 3KYCD 3AXCA 1TS2A 4HWIB 3RD2A 2XEWA 2DYOA 3DWGC 4LJPB 4ANUA 1T0YA 3OWEB 4C7ZA 3QAQA 5KHOA 5KHQA 2MA9B 2KAJA 3NVWA 2EKIA 3IG3A 4C7YA 5BMHA 2MHJA 1J8CA 1E7VA 3IBEA 4J6IA 4MM3A 1V5OA 3PREA 4ICUA 5MPOA 3L4PA 2JU6X 3ENEA 2FE8A 4HPPA 4D2KA 2R2QA 3RYTA 2C60A 1WR6E 1UELA 1TBEA 3A4SC 4HVBA 4NNJB 2I38A 2WXMA 4G50A 3OJ3A 3AB5A 3EFUA 1FIQA 1S1QB 3AV8A 2GB1A 4EEWA 3VXWA 4GGQA 3IT4B 4LK0M 1NI2A 2BF8B 3RT3B 4M8NA 1RM6C 1Q1OA 2J4XA 2PKOA 4FA6A 1CQVA 1UD7A 2BYTA 1STEA 3CMMB 1FO4A 2V4IB 1E8ZA 4PYZA 5DPRA 4G11A 4C80A 1P9DU 2JPHA 3NVVA 3UQAA 1FEHA 4REZA 4ZOHC 4GDLA 2N0SB 1E7PB 1T3QA 3DOWA 1E8XA 2NR2A 3KVFB 1UWXA 3R2TA 1EM7A 2OOBB 3LDZE 4JPSA 4HDOA 4L23A 4YSXB 3X23A 1WGRA 5C1ZA 2DNFA 3IAM1 2KFKB 4KSKC 1SBBB 3PTFC 3B9JA 2CJNA 2K8HA 4RNAA 4GIVA 1KH0A 3ML9A 2G4DB 1VCBA 3VFKA 4ZYNA 1WRIA 4WJOA 5L95C 3EGRA 4OVUA 1PYWD 2C5LC 2VZKB 1HEZE 1KRHA 3KLSX 4IWQA 4YTNB 3MHZA 3VHTC 4F7ZA 4UDUC 1WXAA 4A20A 1ZXIA 3E56A 4NQLB 4K7UA 3V61A 4MT5A 1EU3A 1AN8A 1TS5A 4FJZA 1C1YB 2WX0A 3AEFB 4PS3A 1ACCA 2NS5A 1E9MA 4CO7A 4FJVB 3RZWC 2W3RA 3WANA 3PRMB 2EELA 3WAMA 2L05A 1L4ZB 2WXLA 1NYRA 3APFA 3L10B 2K25A 3L08A 2PE6B 4KSLC 4AJWA 2J0MA 4QAYA 3NY5A 2PTLA 4MGIE 2G9HD 3Q3MC 4DBGA 3FILB 2LXCA 4P6VF 3DBRI 3SEBA 5TSSA 4HDQA 1B1ZA 4W9JA 1I4QA 4KX6B 4HXDA 3HM6X 1WJ6A 2Y5BB 1ZPSA 1TKGA 1L4DB 3KUZA 3PZDA 3DQVA 2K3UA 4MDKE 3RN9C 1DOYA 4P1CC 1E7UA 4ANXA 4LDTB 2IGDA 3AE4B 2ON8A 3ZLZA 5IN7A 2L8JA 2K22A 2IZVB 4PT5A 2LRWA 1QT9A 1D6EC 1SE9A 4K3BA 4LNNA 3QC8B 1QOBA 3VR9B 5D3IB 4W9CA 3Q3OC 2JYEA 2PVOD 4NAMA 3Q6BA 2KFJA 1AARA 1I4PA 4US8A 4RM8A 1CZPA 3DDCB 4JE3B 1NBFC 1TJEA 2WXFA 2NTSA 4HJKA 2UWQA 1QOGA 5G5GA 3QWZB 5IKCM 3URYA 2GBNA 5DCNA 3R2IA 4YTMB 3APDA 4IM3A 1VJKA 4AP4C 1TZ1A 4BAXA 1OGWA 4DWFA 3L13A 4K7SA 4AUQC 3RPFC 3PZ8A 2ZVNA 3VRBB 1K8RB 3P4QB 1GB1A 2WYQA 3WA0A 2FAZA 1L2NA 1L0XB 4ITKA 3C0RB 3P4SB 3KYDD 4A3PA 2MBHA 1JRUA 1R4MI 1VR9A 2J52A 5AEKB 3KUCB 2M4NA 2OEDA 2XK5B 2VZKD 1LGRA 2L32A 3IFWB 2KT7A 4TV3A 5IAAC 2MX2A 2MEKA 1F52A 3CF6E 5D6JB 5JH5C 2NBVB 2LUMA 3FILA 1GNUA 2DZIA 3OLMD 1QOAA 1TGZB 3B08A 3DBHB 1XLOA 4K1RB 4RH6A 3UF8A 4YTPB 4PS7A 1E8WA 2REXA 3VTWA 2NVUI 1TZOA 2W3SA 3RUIB 2WDQB 1CJEA 4MH8A 3KH0A 1HE8A 1BMLC 2PW9A 3AH7A 5LNK1 1MJDA 3J9CA 1SJED 5E6OA 2IO1B 1OTRB 4B9KA 3U30A 2LMCA 5AUIA 5BYQA 1WJNA 4TKNA 2O6VB 2L52A 2JXTA 1WXQA 3ML8A 2N7JA 1WFYA 1R7SA 2D07B 1LM8B 1PFDA 2KMCA 3W5UB 2WU5B 1S3SG 3AU5A 1KJTA 1GC7A 3N1ZC 2IBIB 4N9F4 5FR6A 4KZ0A 3PV1A 1D4BA 5LXHA 4A8XC 1WF9A 2WDVB 3R7RA 1IBXB 1K52A 4GN1A 5HFYA 2KHWB 4I6LB 1KOTA 4HRSA 2WXPA 5EE1A 1VZ8A 3ZJTA 2WXGA 3SFEB
chains in the Genus database with same CATH topology
2IPKD 1ESFA 1XO3A 3VQIA 1RYJA 1QKZA 2IGHA 2DBYA 1QLBB 2XN9C 4GLSC 4IDIA 1J7CA 2BBCA 2BB5A 3H8HA 5FKAC 1D5XC 3C8YA 1EWYC 3NZ3A 4US9A 1HZ5A 1I4XA 1XLPA 1OFFA 3AMZA 3FAHA 3LXFA 3BWUD 4NJCA 1FFVA 3TSSA 1I7HA 2M0AA 2L1AA 2NTTA 3U4EG 2J42A 3MFGA 3W9CB 1SIJA 3AEEB 3KWLA 4AS1A 4RF1A 1TS4A 2GRIA 4XDCA 4JWUC 1F0ZA 4ZRQA 1ZOYB 4YSYB 1NENB 1UUPA 3ZYYX 1C4CA 2HDEA 1ENFA 2WLBA 2X38A 3E9SA 1V97A 3HUIA 3AE3B 3ZJVA 2LEKA 4CQNA 2TSSA 1MHHE 1WSPA 4TMAB 1TS2A 1K50A 3T3NA 3TEWA 1TKEA 4MACA 1SE2A 1NVID 1DYQA 3BVGA 4USAA 2DYOA 3DWGC 2ZW1A 2L83A 3SFDB 5D7GA 2IDYA 1EU4A 3OWEB 4C7ZA 2AQ2B 4RGTA 5JXVA 1BUIC 2KAJA 3NVWA 1PGAA 2EKIA 2QSDA 4C7YA 4O1NA 5BMHA 3WCQA 2Y5PA 2LFIA 2RPVA 1J7BA 1NYQA 5MPOA 3L4PA 2AQ1B 1SB3C 2JU6X 4WIPA 3V05A 4ZYSA 2FE8A 1KFYB 4D2KA 3N9YC 3AE1B 2WXRA 2M56B 2QEJC 2QILA 3AE8B 1HQRD 1K53A 2JWUA 4NAWB 2I38A 2WXMA 1FNUA 2RDGA 3AB5A 4R3DA 1DOIA 1FIQA 3AV8A 4DXFA 2GB1A 1I4HA 1PGBA 3PO0A 3IT4B 4LK0M 2DYMA 1VZ6A 1EWCA 4TSSA 1J7AA 1RM6C 1JWMD 4P16A 1FXAA 2J4XA 2YEPF 1V1PA 4RF0A 2AX5A 2PKOA 1XF5L 1CQVA 3TEXA 2BYTA 1E6EB 2WP9B 3R8BA 1STEA 1YMHE 2LGIA 4WWMA 1RWSA 1C78A 2N9KA 1FO4A 2MJEA 3LB8C 2V4IB 3FC4A 2JX5A 2JYTA 1L5PA 1JWAD 4N59A 4WAFA 1E0ZA 2BS4B 3AE2B 4C80A 2D5GA 1SSNA 1UNSA 3MC0B 2FUG1 3NVVA 1FEHA 4M0WA 4REZA 4ZOHC 1C4AA 2N0SB 1E7PB 1T3QA 2PVGC 1UWXA 1N60A 3R2TA 3KQ4A 1EM7A 4OZCA 2ACZB 2BB6A 4JPSA 2H88B 2I2YA 4L23A 3U7ZA 4YSXB 5EE3A 3IAM1 1ET9A 5D3DA 5GXGB 1SBBB 4KGRA 1MHXA 2WXQA 1JROA 1KLUD 3B9JA 3GS2A 2CJNA 4RNAA 3AE7B 2IJ0A 1YN3A 1KH0A 2WDRB 3NRZA 4IKGA 4L2YA 4OZAA 2DLBA 3BZDB 1N62A 2AQ3B 1UGJA 1WRIA 3AEGB 5E6JA 3EGRA 2B76B 1L6VA 4A55A 3IXSA 1PYWD 5BYSA 1XCQL 2VZKB 1HEZE 1KRHA 2LJIA 1MPEA 3KLSX 3LYYA 4YTNB 3MHZA 4UDUC 2BT6A 3AEDB 1ZXIA 1JALA 1N5XA 3E56A 1DOXA 3W1SA 4MT5A 1EU3A 1AN8A 3KWVA 1TS5A 1SEBD 1VLBA 3U52E 1JWSD 1OQQA 1T5XD 1F2RI 1GOZA 2K0PA 2OHFA 2WS3B 3AEFB 4HROA 4C56C 1L6UA 1ACCA 4J3OD 5H8YE 1E9MA 5I4DA 4YWGG 3ZQ4A 2E6XA 3IAS1 2W3RA 1FRRA 1B9RA 2EELA 4XE0A 2LHDA 4DXGA 4WQMA 1L4ZB 3BIID 2WXLA 1FMAD 2SAKA 1NYRA 3Q8BA 5BYRA 4YSZB 2V0GA 1K51A 2RDHA 4GDKB 4HKZE 4ZHPA 2W54A 2PTLA 1PDXA 2G9HD 3NS1A 3TEZA 3FILB 2K9XA 1XLQA 1RFKA 1VDVA 1FNVA 3ETRA 4EE2A 2SEBD 3P63A 4P6VF 2Y3AA 4KGSA 4RCOA 3SEBA 1AYFA 1JCKB 1ZUD2 5TSSA 2W55A 1B1ZA 1WGKA 2PLPA 1D5ZC 2BS3B 3P1MA 1I4QA 3Q8FA 1KLGD 2V3NA 1YQ3B 3AM9A 3ZGZA 1YN4A 2KACA 1TYGB 4KX6B 4RFBA 4A90A 3T3OA 1ZPSA 3BVZA 1TKGA 1FNWA 4MM3B 1L4DB 4N6EB 1L0VB 3NVYA 1IGCA 4XWWA 1XCTL 3MP9A 4A9AA 1YN5A 2K3UA 5FR3A 3SR6A 1KF6B 2LHEA 1DOYA 1VZ7A 1MI0A 2J53A 1P7EA 4B0EA 2IGDA 1IBXA 3AE4B 5T8IA 2ON8A 2K22A 1SXTA 2Z8LA 4PT5A 3TEYA 4A6QA 1I4RA 3Q8EA 1QT9A 1D6EC 1JWBD 5HG2A 1QOBA 3P4PB 3IT6B 3VR9B 5D3IB 4OW0A 3HVZA 1E10A 1QOFA 1N63A 2ZW0A 2PIAA 3ABVB 2WU2B 4NZLB 2JYEA 2PVOD 4NAMA 1V1PB 4JWSC 4HEA1 3DWMA 2Q5WD 4YXDB 1I4PA 4US8A 1F77A 1TKYA 1CZPA 4JE3B 1TJEA 2WXFA 2NTSA 2V3PA 4RGMA 1QOGA 5G5GA 3URYA 1XXGA 3BYTB 3AN1A 3R2IA 4YTMB 1YJIA 1XLNA 3HVDA 1VJKA 1HXYD 3GB1A 2WXHA 1JMLA 1V8CA 1QF6A 2MJ3A 1GPXA 3AECB 4L1BA 1Y56A 3BK1A 3RPFC 3V3XA 3EUB2 3PZ8A 1ET6A 3VRBB 4AQ7A 5HI1A 1JWUD 3AE9B 3B2GA 2G1EA 4RGOS 5HHDG 3P4QB 1GB4A 1GB1A 3TUOA 1A70A 2INPE 1VRAB 1L0XB 2R61A 4ITKA 2RMMA 1FXIA 4KKJA 4LLGM 3Q69A 3RFZB 3Q8AA 2HTME 3P4SB 2WXKA 4TQ1A 2QJLA 2IGGA 1YJJA 4XDDA 4TQ0A 1N61A 2QIEB 4KKIA 1VR9A 2DWQA 2J52A 1ZE3D 1SE4A 2OEDA 1C76A 3AE5B 3VRAB 4ZRPA 1UWMA 2VZKD 5BMGA 2L32A 1Q10A 2M19A 4JX1C 1FFUA 5G5HA 3AE6B 1N5WA 2WXOA 1YNTE 5C2TB 1BXTA 2ICIA 1GAQB 2MEKA 3CWIA 1D5MC 2INNE 3PZ7A 2JSVX 1SE3A 5EE0A 5AUKA 1JW9D 2JQRB 3NVZA 3P4RB 4WH4A 4ARCA 2KWDA 2Y5CA 3ZJUA 1FD6A 1F2RC 2LUMA 3FILA 1C77A 2YEPB 1CK1A 1ZDXA 1QOAA 2QMTA 4KGTA 1FCLA 2GI9A 1WWTA 1XLOA 2BS2B 4RH6A 1JRPA 2W82A 3I57A 5H92C 4XWTA 4YTPB 1FCCC 2JZPA 3UI3A 5FK9C 3NUHB 3BYYB 1ZP0B 1QILA 2KDMA 1FRDA 1DGJA 3P42A 1TS3A 1SJHD 1C4PA 4B0MA 1ROEA 3B2FA 1TZOA 2W3SA 5C3JB 1OQRA 1CJEA 1WYGA 2WDQB 4MH8A 1KTKA 2WXJA 1LO5D 1BMLC 2KMMA 2PW9A 3AH7A 5LNK1 1SF0A 3J9CA 1SJED 2KN4A 1FM0D 4N58A 1ZDVA 1NI3A 2CU3A 1P7FA 3HRDD 3MJ5A 1I4GA 2LMCA 4DQOC 4FXCA 2NMQA 5AUIA 5BYQA 5EE9A 2PMVA 4OHJA 2CJOA 2WNMA 2L52A 3O13A 2K5PA 2JXTA 2WXNA 1PUTA 1WXQA 2WXIA 1TY0A 3BK2A 1ZXHA 2N7JA 1R7SA 1PFDA 3W5UB 4WURA 2FBWB 3BVMA 2WU5B 3VR8B 3W5VB 3Q8CA 4OZBA 4OVZA 2WQYB 2BW2A 3W2DA 1V1OA 1IUEA 4H2AA 2BTEA 1TY2A 1IGDA 2ONQA 1D4BA 3I9V1 3AEAB 1HZ6A 3EA6A 4A8XC 2WDVB 4Q2JA 2N9LA 1IBXB 4IOIE 1NEKB 1K52A 4ARIA 5HFYA 1C79A 3AEBB 1C9FA 4HJGE 4YT0B 1T6BX 4ZHOA 2KQ4X 1MVKA 4LTUA 2MH7A 1YQ4B 1PGXA 4HKQA 1JQ4A 5BMIA 3GP7A 4HRSA 2WXPA 5EE1A 1AWDA 1AW7A 1HA5A 2H89B 2XNAC 1VZ8A 1M4VA 4RGNA 3ZJTA 4GDLB 2WXGA 2MJDA 3U2SC 1QQRA 1XEEA 2E3TA 3CIRB 3SFEB 1L0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AX5 A;  2PKO A;  3P63 A;  4P6V F;  1XO3 A;  1AYF A;  1RYJ A;  1E6E B;  1ZUD 2;  2M19 A;  2DBY A;  1FFU A;  2W55 A;  2WP9 B;  3AE6 B;  1WGK A;  1N5W A;  4JX1 C;  2BS3 B;  3P1M A;  1QLB B;  4IDI A;  4WWM A;  5C2T B;  1J7C A;  1GAQ B;  1RWS A;  1FO4 A;  2MJE A;  1YQ3 B;  3LB8 C;  3FC4 A;  3AM9 A;  2JX5 A;  1EWY C;  1L5P A;  1TYG B;  3CWI A;  4KX6 B;  1JWA D;  4N59 A;  4US9 A;  1E0Z A;  2BS4 B;  3AE2 B;  1XLP A;  4C80 A;  1OFF A;  3AMZ A;  3FAH A;  1TKG A;  5EE0 A;  3LXF A;  3ETR A;  3NVV A;  5AUK A;  1JW9 D;  1FFV A;  2JQR B;  3NVZ A;  3P4R B;  1L0V B;  2Y5C A;  4N6E B;  1I7H A;  3NVY A;  4ZOH C;  2N0S B;  1E7P B;  1T3Q A;  3W9C B;  1QOA A;  2PVG C;  4A9A A;  1SIJ A;  3AEE B;  3KWL A;  1N60 A;  3SR6 A;  1KF6 B;  2ACZ B;  1WWT A;  1XLO A;  2H88 B;  2BS2 B;  1DOY A;  4JWU C;  1F0Z A;  1JRP A;  5H92 C;  5EE3 A;  4YSX B;  3CIR B;  1ZOY B;  4YSY B;  4YTP B;  1NEN B;  1ZP0 B;  3AE4 B;  3ZYY X;  1FRD A;  1DGJ A;  5GXG B;  2K22 A;  2WLB A;  1V97 A;  1JRO A;  3HUI A;  3AE3 B;  3B9J A;  2CJN A;  2LEK A;  3AE7 B;  1ROE A;  3B2F A;  1QT9 A;  2W3S A;  1JWB D;  2WDR B;  5C3J B;  1OQR A;  1CJE A;  1WYG A;  2WDQ B;  3NRZ A;  1QOB A;  3P4P B;  5G5H A;  3VR9 B;  1TKE A;  3HVZ A;  2KMM A;  1QOF A;  3AH7 A;  1N62 A;  1E10 A;  1N63 A;  1SF0 A;  1NVI D;  2PIA A;  3ABV B;  4USA A;  1FM0 D;  2WU2 B;  4N58 A;  1WRI A;  3AEG B;  2PVO D;  1NI3 A;  4JWS C;  2CU3 A;  3DWG C;  3DWM A;  2B76 B;  3HRD D;  1L6V A;  2L83 A;  2Q5W D;  3SFD B;  4YXD B;  4US8 A;  4FXC A;  1TKY A;  5AUI A;  1CZP A;  5EE9 A;  4C7Z A;  1UWM A;  1KRH A;  1TJE A;  2CJO A;  2L52 A;  1QOG A;  2K5P A;  4YTN B;  5G5G A;  1PUT A;  1WXQ A;  2KAJ A;  2BT6 A;  3NVW A;  3AED B;  3AN1 A;  2EKI A;  4C7Y A;  1R7S A;  1PFD A;  3W5U B;  1ZXI A;  2FBW B;  1JAL A;  1N5X A;  3WCQ A;  1YJI A;  4YTM B;  1DOX A;  1XLN A;  2WU5 B;  1VJK A;  3VR8 B;  1J7B A;  3W5V B;  1NYQ A;  1VLB A;  1OQQ A;  2OHF A;  2WQY B;  2WS3 B;  1V8C A;  1QF6 A;  2MJ3 A;  3AEF B;  4HRO A;  3L4P A;  5MPO A;  1SB3 C;  1L6U A;  1IUE A;  1GPX A;  1KFY B;  3AEC B;  5H8Y E;  1E9M A;  3RPF C;  3AE1 B;  2M56 B;  3EUB 2;  3VRB B;  3AE9 B;  3B2G A;  3AE8 B;  2W3R A;  2G1E A;  1FRR A;  1B9R A;  3P4Q B;  3AEA B;  4WQM A;  2WDV B;  1A70 A;  3BII D;  1NEK B;  4ITK A;  1FMA D;  1FXI A;  1NYR A;  3AB5 A;  2HTM E;  1DOI A;  3AEB B;  1FIQ A;  3AV8 A;  3P4S B;  4YT0 B;  4ZHO A;  3PO0 A;  2QJL A;  4LTU A;  2MH7 A;  1YQ4 B;  4YSZ B;  1JQ4 A;  1YJJ A;  4HRS A;  1N61 A;  5EE1 A;  4ZHP A;  2QIE B;  1AWD A;  2H89 B;  2DWQ A;  2W54 A;  1J7A A;  1RM6 C;  1PDX A;  2MJD A;  3NS1 A;  1FXA A;  3AE5 B;  3VRA B;  2E3T A;  2K9X A;  1XLQ A;  3SFE B;  1RFK A;  1VDV A; 
#chains in the Genus database with same CATH topology
 1ESF A;  2ZCC A;  1XO3 A;  4TUU A;  5DPT A;  1RYJ A;  3ZXV A;  1QLB B;  4E3C A;  3DHI C;  2BB5 A;  2L0F A;  3C8Y A;  3ZVV A;  2ZEQ A;  1I4X A;  3LXF A;  3DPD A;  2RDB C;  3TSS A;  1R4N B;  3ZDT A;  1I7H A;  2M0A A;  2VH2 A;  2IO2 B;  2MLB A;  2XK5 A;  2D11 A;  3AEE B;  3KWL A;  3MTN B;  1TS4 A;  2XBB C;  4JWU C;  4W9K A;  2G3Q B;  1ENF A;  2LJ5 A;  4LNI A;  3HUI A;  4FN2 A;  3AE3 B;  4LNF A;  1P98 A;  3N32 A;  4PS8 A;  4TMA B;  4LNK A;  4GDK A;  1A5R A;  4NPN A;  3V6E B;  1GUA B;  2IDY A;  4FUL A;  1WX8 A;  3ZDM C;  3PT2 B;  1BUI C;  1EF5 A;  2FIF A;  2QSD A;  3WCQ A;  2KJH B;  2LFI A;  3O65 B;  1SB3 C;  3V05 A;  1KFY B;  2BPS A;  2GBJ A;  2DAJ A;  3AE1 B;  3RI7 C;  2M56 B;  2QIL A;  3SDL C;  5CTR C;  2JWU A;  2FID A;  2D3G A;  2N9E B;  1DOI A;  4DXF A;  1PGB A;  4GU2 A;  1XT9 B;  1Z2M A;  3EFC A;  2IYD B;  2DYM A;  4DHZ E;  1J7A A;  2K8B A;  1FXA A;  3TBL D;  2BQQ A;  2YEP F;  3AU4 A;  1V1P A;  2AX5 A;  1WH3 A;  3TEX A;  2WP9 B;  1GG3 A;  1YMH E;  1C78 A;  2JYT A;  2NPT B;  1JWA D;  2BS4 B;  4II2 B;  1SSN A;  2YLM A;  2FUG 1;  4GOC A;  4M0W A;  3QA8 A;  2PE9 A;  3VUX A;  3H7P B;  2D3C A;  1YQB A;  2IO0 B;  4URK A;  2BB6 A;  2JF5 A;  4II3 B;  2NBU A;  2C7N B;  5D3D A;  4KGR A;  1MHX A;  3GS2 A;  4MEM A;  2KKC A;  3AE7 B;  1YN3 A;  2WDR B;  3NRZ A;  2ZPY A;  2QHO A;  4L2Y A;  4OZA A;  2GOW A;  2DLB A;  3BZD B;  2HE7 A;  1UGJ A;  3JYU A;  3ZTD A;  5E6J A;  2LVQ A;  2B76 B;  4A55 A;  3IXS A;  3GZN I;  2WGS A;  2L7R A;  2LJI A;  3PHX B;  1D3Z A;  4IWO A;  1MG8 A;  1JAL A;  1FXT B;  2KD0 A;  3U52 E;  1T5X D;  1JWS D;  2OHF A;  1F2R I;  2K0P A;  4HRO A;  4C56 C;  2JVC A;  4J3O D;  4I6P A;  5I4D A;  4YWG G;  4BBN C;  2KTF A;  2E6X A;  4WAA A;  3IAS 1;  3TJP A;  1FRR A;  1KLV A;  2LHD A;  3VTU A;  2JRH A;  4S0R A;  3BII D;  1FMA D;  2FNJ B;  3MC8 A;  3DBH I;  2W54 A;  1UF0 A;  2RD0 A;  3L0W B;  3CST A;  2INC C;  4E74 A;  1VDV A;  2Y3A A;  1AYF A;  1ZUD 2;  1WGK A;  3RZF A;  2PLP A;  3FKY A;  2LGD A;  1MFW A;  3ZGZ A;  4A90 A;  2NCN A;  1YOV B;  2A4Z A;  4DHZ B;  4KIK B;  3ZKJ C;  4DK5 A;  5AZF A;  3NVY A;  4IW0 A;  1IGC A;  4XWW A;  4DHJ D;  2DAF A;  3MP9 A;  2BKR B;  5FR3 A;  2JRI B;  3SR6 A;  1KF6 B;  4NY0 A;  2R2O A;  3UIN B;  1X1M A;  2HJ8 A;  3PS6 A;  1P7E A;  2C7M B;  2V9H A;  1Z5S B;  5T8I A;  1T0R C;  2NPT A;  3ZRC A;  2K39 A;  5D2M B;  3TEY A;  2MBB B;  4LNO A;  1JWB D;  2LGX A;  4FLH A;  1WXS A;  3ABV B;  4I6N B;  2WU2 B;  4NZL B;  3DWM A;  4BKG A;  2BWF A;  3WIM A;  2RPQ A;  2V3P A;  3PPA A;  1XXG A;  2VH1 A;  4GSW A;  1XLN A;  3HVD A;  2KAN A;  3NZU A;  3GB1 A;  1JML A;  4JL9 A;  1GPX A;  1Y56 A;  4AQ7 A;  5HI1 A;  1JWU D;  1XD3 B;  2KTR B;  2PPH A;  2G1E A;  5HHD G;  2ZJD A;  3DBL I;  1E5W A;  2KWU B;  2N7E A;  4KVG B;  2UU7 A;  3RFZ B;  4LLG M;  3Q69 A;  3Q8A A;  1R4N I;  2WXK A;  2JZ3 B;  2DHZ A;  2DZJ A;  1IYF A;  1YJJ A;  4TQ0 A;  2QIE B;  4KKI A;  2FUH B;  1ZE3 D;  5J2R A;  3Q2A C;  3VRA B;  3AE5 B;  1UWM A;  2LGY A;  1Q10 A;  3Q14 C;  3U7D A;  3VVW B;  2D3A A;  3CWI A;  2ZVO A;  3ZNG C;  2J0K A;  4IM0 A;  1JW9 D;  2JQR B;  3P4R B;  3A1Q B;  3ZJU A;  2YEP B;  2LXA A;  2QMT A;  2GI9 A;  2YVC A;  1WGH A;  5TR5 A;  1JRP A;  5H92 C;  2JZP A;  1UBI A;  1ZP0 B;  1DGJ A;  3P42 A;  1RRB A;  1TS3 A;  3HIZ A;  4ZRK A;  1C4P A;  3KW5 B;  3PVL A;  3AI5 A;  3EC8 A;  4KIK A;  3B2F A;  1WIA A;  1G6J A;  2B3A A;  2M0X A;  1OQR A;  2ZNV C;  2LD9 A;  2M1M A;  3LJ3 A;  1LO5 D;  2KMM A;  1ZDV A;  1E90 A;  3MJ5 A;  4DQO C;  1Q5W B;  4AWJ A;  1WGD A;  4C00 A;  2CJO A;  2K5P A;  2ZCB A;  1PUT A;  4IC7 B;  2WXI A;  3PGE A;  1T0Q C;  3VR8 B;  3W5V B;  3Q8C A;  4OZB A;  1Q0W B;  2WQY B;  2JY6 A;  5G55 A;  5HKH A;  4ZRI A;  4MGY E;  2DZK A;  3I9V 1;  4M01 A;  3Q3J A;  2N9L A;  2KFK A;  4W9E A;  4YL8 A;  4ARI A;  3H1U A;  1WI0 A;  3JSV B;  1C9F A;  4YT0 B;  1T6B X;  4F1S A;  4LTU A;  4C4V B;  2MH7 A;  1PGX A;  2EKE C;  5BMI A;  4F8C B;  2LZ6 A;  1AW7 A;  2H89 B;  4WWN A;  3U2S C;  4XYC A;  1M94 A;  3NG0 A;  1XEE A;  3MC9 A;  2E3T A;  1L0Y B;  3R7Q A;  2IPK D;  3HK0 A;  2IGH A;  5DPS A;  2DBY A;  5IA7 A;  1J7C A;  3VTV A;  5FKA C;  2MBO A;  1EWY C;  4US9 A;  3DVG X;  5LXI B;  4M02 A;  3V62 A;  3BWU D;  4G0N B;  3I3T B;  2NTT A;  2HJ1 A;  2J42 A;  2J7Q B;  1SIJ A;  2GRI A;  4XDC A;  2KMA A;  1F0Z A;  3RNB C;  1NEN B;  2JZZ A;  2DZM A;  1WM3 A;  4EZJ A;  2WLB A;  3VDZ A;  2V1Y A;  1J0G A;  3SD5 A;  3ZJV A;  2LEK A;  1MHH E;  3M95 A;  1WSP A;  3L54 A;  3A1Q A;  1E8Y A;  2JUO A;  4CHK A;  1K50 A;  1TKE A;  3B1L X;  2UYZ B;  3ZNZ B;  4USA A;  5DPW A;  2CU1 A;  1BT0 A;  2ZW1 A;  2L83 A;  5D7G A;  1F9J A;  1EU4 A;  2G45 B;  2GLS A;  4RGT A;  1WZ0 A;  4O1N A;  2V4L A;  2Y5P A;  2RPV A;  1V9J A;  4MJS B;  3PLU A;  3P2B A;  1NYQ A;  3ZO5 B;  2GBR A;  4FHJ A;  4ZYS A;  2ZPN A;  3N9Y C;  3QCA A;  1V81 A;  2WXR A;  3DVN U;  1HQR D;  4NAW B;  1XQQ A;  2KDE B;  1FNU A;  4R3D A;  1EF1 A;  1YX5 B;  1LFD A;  3PO0 A;  4AJY B;  2CR5 A;  2MQJ A;  4TSS A;  3U8Z A;  4P16 A;  2FCN A;  3R3M A;  4WQO B;  4RF0 A;  1XF5 L;  3UQB A;  4LDT D;  1U4A A;  1E6E B;  3R8B A;  4KDI C;  1WJU A;  2LGI A;  3RMK C;  4WWM A;  3ALB A;  1RWS A;  3PHW B;  1RLF A;  1YD8 U;  1WX7 A;  3FC4 A;  2JX5 A;  1L5P A;  4C4V A;  5EDS A;  4N59 A;  2ZZP B;  3AE2 B;  5IP4 D;  2D5G A;  1UNS A;  1WR1 A;  3MC0 B;  5JHA A;  2N4F A;  3I5J C;  4IWP A;  2PVG C;  3KQ4 A;  1UGM A;  4OZC A;  2ACZ B;  3QK0 A;  3GOE A;  5EE3 A;  1HTO A;  3ZTC A;  3BIN A;  3L16 A;  4M8M A;  2BGF A;  5GXG B;  2KVR A;  1JRO A;  4NJ7 A;  3ZRF A;  4EFO A;  4JGH B;  2KC1 A;  3A9J B;  2KZR A;  1N62 A;  2AQ3 B;  4ANV A;  3AEG B;  1L6V A;  3NOB A;  1XCQ L;  3HHM A;  5CHW A;  3RNA C;  4XGA B;  2N9P C;  1LQB A;  4FAD A;  1NDD A;  3AED B;  3PRZ A;  1N5X A;  4MSM B;  4EKU A;  3W1S A;  4ANW A;  1SEB D;  1VLB A;  1OQQ A;  2WS3 B;  1V6E A;  3TMP B;  3L17 A;  5H8Y E;  2WX1 A;  3ZQ4 A;  4S17 A;  3JVZ X;  4XE0 A;  4A3O A;  4PK1 A;  4ACF A;  3N1X C;  2QC8 A;  2KDB A;  4MJS A;  5BYR A;  4YSZ B;  2V0G A;  1K51 A;  2BVC A;  2RDH A;  4HKZ E;  1WE7 A;  1F1H A;  1RAX A;  3QJZ A;  1WXV A;  2ZNV B;  3TEZ A;  2K9X A;  2K6Q A;  1FNV A;  3ETR A;  2SEB D;  3ZNI D;  1JCK B;  2O6V A;  2DX5 B;  1D5Z C;  2MP2 B;  3AM9 A;  4EZL A;  4RFB A;  3T3O A;  4P1B C;  3BVZ A;  1FNW A;  2BYV E;  3QIJ A;  4MM3 B;  4HPM B;  1L0V B;  4ASW C;  1I35 A;  1UZX B;  2O2V B;  2KX3 A;  2L3Z A;  2O6V D;  1PQS A;  1VZ7 A;  3B0A A;  3ZIM A;  2AEH A;  4B0E A;  2KXJ A;  4KDL B;  1IBX A;  4K81 A;  2AWT A;  1SXT A;  2L76 A;  2Z8L A;  4A6Q A;  1I4R A;  2LUE A;  1V86 A;  3C19 A;  3Q8E A;  2MWS B;  3A4R A;  5HG2 A;  2W9N A;  2WDT B;  1TTN A;  3P4P B;  3HVZ A;  2ZW0 A;  2PIA A;  4E71 A;  2DYB A;  2PEA A;  4JWS C;  2Z0D B;  4HEA 1;  4YXD B;  1TKY A;  4RGM A;  4FJY A;  1HXY D;  4XC2 A;  1V8C A;  1QF6 A;  5C23 A;  3CSF A;  2MW5 A;  1Y8R C;  2MBQ A;  2CHW A;  3B2G A;  3GE8 C;  4RGO S;  1GB4 A;  3Q3F A;  3TUO A;  3APC A;  2INP E;  1VRA B;  2RMM A;  1FXI A;  2A5U A;  2C9W B;  4IM2 A;  4IUM B;  2QJL A;  4ZRJ A;  4XDD A;  1N61 A;  2N1W A;  1TIF A;  2DWQ A;  4B95 A;  2DEN B;  2Z0E B;  1H4R A;  1R4M B;  3NS8 A;  5BMG A;  3JW0 X;  1WRD B;  2M19 A;  5G5H A;  3M62 B;  5C2T B;  1BXT A;  4G3X B;  1P3Q U;  1WYW B;  2I1J A;  2LVO A;  2MRP A;  3DBS A;  2INN E;  3PZ7 A;  2JSV X;  5EE0 A;  5AUK A;  4WH4 A;  3NVZ A;  1HTQ A;  1IP9 A;  1FD6 A;  3X0W A;  1F2R C;  5LLI A;  1ZDX A;  3BY4 B;  3TCA A;  4KGT A;  3RNG C;  2AL3 A;  3I57 A;  1V5T A;  3EEC A;  3VAW A;  1TT5 B;  3NUH B;  2MP2 A;  2L0T A;  2KDM A;  4BBN F;  3W1S C;  1SJH D;  5IO9 A;  4MH0 E;  1WMH B;  2WWZ A;  4OVV A;  2EMS A;  5C3J B;  1WYG A;  2K8C A;  3Q3N C;  1KTK A;  3T8M A;  2O2V A;  5CHF A;  1SF0 A;  1FM0 D;  3NJT A;  1NI3 A;  2CU3 A;  1P7F A;  1I4G A;  4FXC A;  2NMQ A;  2LAS A;  4W9H A;  2LVP A;  5CX3 A;  5EE9 A;  1GJZ A;  4HPL B;  1ZGU B;  4OHJ A;  3O13 A;  2WXN A;  4MEL A;  1TY0 A;  1V2Y A;  2CKH B;  4JIO U;  2V3S A;  1L7Y A;  3BVM A;  4IG7 B;  2KNB A;  2L00 B;  2Z59 B;  4WJN A;  2GBM A;  2K1F A;  1EO6 A;  3W2D A;  3H7P A;  1IUE A;  1WZ3 A;  1RFA A;  1TY2 A;  1IGD A;  2IND C;  3DHG C;  1HZ6 A;  3EA6 A;  4Q2J A;  1NEK B;  2CS4 A;  1C79 A;  1ZKH A;  3AEB B;  1QZE A;  4HJG E;  4ZHO A;  1MVK A;  3PSE B;  4HKQ A;  4MGK E;  3GP7 A;  1AWD A;  1HA5 A;  2XNA C;  4RGN A;  2LWP A;  1QQR A;  3N1Y C;  2PJH A;  3EHV A;  2BWE S;  1QKZ A;  2JXX A;  2XN9 C;  2BBC A;  3H8H A;  1P1A A;  3ECI A;  1HZ5 A;  4HK2 A;  1XLP A;  1OFF A;  3FAH A;  2KC2 A;  3ZUN A;  3A9K B;  3SHQ A;  2EMT A;  1GC6 A;  3U4E G;  3MFG A;  4GB9 A;  4ZRQ A;  4W9F A;  1ZOY B;  4W9D A;  2MBE A;  2KK8 A;  1LXD A;  2KQS A;  3M3J A;  3UGB B;  2TSS A;  2IO3 B;  3N20 C;  4LJO B;  3T3N A;  4GMV A;  4B6W A;  3TEW A;  4MAC A;  1SE2 A;  1NVI D;  1DYQ A;  3BVG A;  3SFD B;  2FCS A;  3HM3 A;  3DCG A;  2AQ2 B;  2D10 A;  3PRP B;  4CYE A;  5JXV A;  1PGA A;  1WMH A;  4M00 A;  2KJ6 A;  3R66 C;  1J7B A;  2HD5 B;  2IY0 B;  4K3C A;  1OEY J;  3ZXR A;  2WHI A;  2AQ1 B;  4WIP A;  3RUL A;  3MJW A;  2QEJ C;  3AE8 B;  2KWV B;  3QHT A;  1K53 A;  3DHH C;  4GXB A;  2RDG A;  1I4H A;  2MSE D;  4NQK E;  4WJP A;  2M17 A;  4WWP A;  1VZ6 A;  1EWC A;  3UIO B;  1JWM D;  2VRR B;  5GMV A;  4JLC A;  3RNE C;  2CHZ A;  2N9K A;  3D32 A;  2MJE A;  2RGF A;  3LB8 C;  4EZK A;  1YJ1 A;  2AYO B;  3N30 A;  5J18 A;  4WAF A;  1E0Z A;  5JHB A;  4BKS A;  3SU8 X;  4FHK A;  1C4A A;  2KVZ A;  2ASQ A;  3I63 C;  1N60 A;  5J17 A;  2KTR A;  2H88 B;  2KDI A;  4LCD E;  2I2Y A;  5AZH A;  3U7Z A;  3VH4 B;  3WAO A;  2HTH A;  1ET9 A;  2KLC A;  2WXQ A;  3M63 B;  1KLU D;  4BKS D;  3WAL A;  1WE6 A;  2IJ0 A;  3A9K A;  4BOZ B;  4IKG A;  1UH6 A;  4P7I A;  4WJQ A;  2JT4 B;  1V80 A;  2LRU A;  5BYS A;  5JZE B;  4KV2 A;  1MPE A;  3GZN B;  3LYY A;  1P0R A;  2BT6 A;  1DOX A;  3VUW A;  2KYW A;  1CMX B;  3KWV A;  4RM9 A;  1GOZ A;  1L6U A;  2GMI C;  2K6D B;  1B9R A;  1OEY A;  3S2A A;  4DXG A;  2NBW B;  4WQM A;  3RNF C;  1EUV B;  2GBK A;  2N1V A;  2SAK A;  1SIF A;  2OJW A;  3Q8B A;  2FCM A;  3GE3 C;  1UBQ A;  4GDK B;  4ZHP A;  4EOY A;  4JQW C;  4BOS C;  1PDX A;  3W1Y A;  4W9L A;  3NS1 A;  4ZDV A;  3QX1 A;  1XLQ A;  4X57 B;  1RFK A;  4EE2 A;  3V6C B;  3P63 A;  4BZA A;  2BKF A;  4KGS A;  4RCO A;  3H9D A;  2W55 A;  2BS3 B;  3P1M A;  3Q8F A;  1IPG A;  1KLG D;  2V3N A;  1YQ3 B;  4BFR A;  2IY1 B;  1YN4 A;  1ZW7 A;  1TYG B;  2KAC A;  3TIX A;  1J19 A;  4K7W A;  4N6E B;  3VH3 B;  3ZW3 A;  3WAP A;  1VD2 A;  1XCT L;  4A9A A;  1YN5 A;  2LHE A;  3QAR A;  1MI0 A;  2J53 A;  2FCQ A;  3NHE B;  2M8S A;  3JSV A;  4BVU C;  1N6Z A;  4XZ4 A;  3RCZ A;  4W9G A;  3IT6 B;  4OW0 A;  1E10 A;  1QOF A;  1N63 A;  1WGY A;  1V1P B;  2Q5W D;  3K9O B;  1T0S C;  5CHV C;  1F77 A;  4KZC A;  4DDG D;  2OJR A;  3BYT B;  3AN1 A;  1MG4 A;  2RR9 A;  1YX6 B;  1SGH A;  1YJI A;  2G4S A;  3ONS A;  2WXH A;  4M0W B;  3RNC C;  2MJ3 A;  1YIW A;  2N7D A;  1I42 A;  3AEC B;  4L1B A;  3BK1 A;  3V3X A;  2LI5 A;  2BYE A;  3EUB 2;  4FBJ B;  1ET6 A;  4DXA B;  1WY8 A;  3AE9 B;  3AUL A;  2I1K A;  5IOI A;  2KN5 A;  1A70 A;  5L83 A;  2R61 A;  4KKJ A;  2J0J A;  4W9I A;  3DBL B;  2HTM E;  5E6P A;  4WWO A;  5AZG A;  4TQ1 A;  4HCN B;  2IGG A;  4PYU A;  5D94 A;  2BYF A;  3T9L A;  3K9P B;  2LGS A;  2KO3 A;  1ISN A;  3NZS A;  1SE4 A;  1C76 A;  4ZRP A;  3UIP B;  4JX1 C;  1FFU A;  3AE6 B;  1N5W A;  2WXO A;  1YNT E;  2ICI A;  1GAQ B;  3ZNH B;  1D5M C;  1SE3 A;  4ARC A;  3OJ4 B;  2KWD A;  2Y5C A;  5BO4 B;  2QCZ A;  3V60 A;  1C77 A;  1CK1 A;  3MHS D;  1FCL A;  1WWT A;  2BS2 B;  2KQ7 A;  2W82 A;  4XWT A;  4NAW A;  1FCC C;  3TL5 A;  3UI3 A;  5FK9 C;  3BYY B;  1QIL A;  1FRD A;  3DBR B;  5G2N A;  3N3K B;  4B0M A;  1ROE A;  3DVG Y;  2RSU A;  2N9X A;  1C3T A;  2WXJ A;  3OAW A;  4MGZ E;  2KN4 A;  4N58 A;  4EUT A;  4DHJ B;  4XX5 A;  3HRD D;  2KJR A;  3KUD B;  4ICV A;  2PMV A;  2WNM A;  1WX9 A;  4HLE A;  3BK2 A;  5E6N A;  1ZXH A;  4WUR A;  2FBW B;  3DVN V;  2MCN B;  2KWC A;  3A33 B;  4OVZ A;  2BW2 A;  1V1O A;  4H2A A;  1KM7 A;  2BTE A;  2KOX A;  2ONQ A;  4BKT A;  3PLV A;  1WGG A;  2KX0 A;  3AEA B;  4IOI E;  2CHX A;  4DDI D;  1V49 A;  1WJ4 A;  3VUY A;  2KQ4 X;  1JQ4 A;  1YQ4 B;  3A9J A;  1M4V A;  4GDL B;  1WXM A;  2D3B A;  2MJD A;  2KDF B;  1OQY A;  3CIR B;  2KLG A;  1H8C A;  4RMA A;  3VQI A;  2JWZ A;  4GLS C;  4IDI A;  3H7S A;  1D5X C;  3NZ3 A;  3AMZ A;  4NJC A;  2AL6 A;  2QDF A;  1FFV A;  2L1A A;  3IVF A;  3H6N A;  1FPY A;  4NJ6 A;  3W9C B;  4AS1 A;  4RF1 A;  1WM2 A;  4AOF A;  2C7H A;  4HCP B;  4YSY B;  3OG5 A;  3IHP C;  2X8X X;  1UUP A;  3ZYY X;  1C4C A;  2HDE A;  3E9S A;  2X38 A;  1V97 A;  3QQ8 B;  4CQN A;  2D2Q A;  4MSQ B;  3KYC D;  3AXC A;  1TS2 A;  4HWI B;  3RD2 A;  2XEW A;  2DYO A;  3DWG C;  4LJP B;  4ANU A;  1T0Y A;  3OWE B;  4C7Z A;  3QAQ A;  5KHO A;  5KHQ A;  2MA9 B;  2KAJ A;  3NVW A;  2EKI A;  3IG3 A;  4C7Y A;  5BMH A;  2MHJ A;  1J8C A;  1E7V A;  3IBE A;  4J6I A;  4MM3 A;  1V5O A;  3PRE A;  4ICU A;  5MPO A;  3L4P A;  2JU6 X;  3ENE A;  2FE8 A;  4HPP A;  4D2K A;  2R2Q A;  3RYT A;  2C60 A;  1WR6 E;  1UEL A;  1TBE A;  3A4S C;  4HVB A;  4NNJ B;  2I38 A;  2WXM A;  4G50 A;  3OJ3 A;  3AB5 A;  3EFU A;  1FIQ A;  1S1Q B;  3AV8 A;  2GB1 A;  4EEW A;  3VXW A;  4GGQ A;  3IT4 B;  4LK0 M;  1NI2 A;  2BF8 B;  3RT3 B;  4M8N A;  1RM6 C;  1Q1O A;  2J4X A;  2PKO A;  4FA6 A;  1CQV A;  1UD7 A;  2BYT A;  1STE A;  3CMM B;  1FO4 A;  2V4I B;  1E8Z A;  4PYZ A;  5DPR A;  4G11 A;  4C80 A;  1P9D U;  2JPH A;  3NVV A;  3UQA A;  1FEH A;  4REZ A;  4ZOH C;  4GDL A;  2N0S B;  1E7P B;  1T3Q A;  3DOW A;  1E8X A;  2NR2 A;  3KVF B;  1UWX A;  3R2T A;  1EM7 A;  2OOB B;  3LDZ E;  4JPS A;  4HDO A;  4L23 A;  4YSX B;  3X23 A;  1WGR A;  5C1Z A;  2DNF A;  3IAM 1;  2KFK B;  4KSK C;  1SBB B;  3PTF C;  3B9J A;  2CJN A;  2K8H A;  4RNA A;  4GIV A;  1KH0 A;  3ML9 A;  2G4D B;  1VCB A;  3VFK A;  4ZYN A;  1WRI A;  4WJO A;  5L95 C;  3EGR A;  4OVU A;  1PYW D;  2C5L C;  2VZK B;  1HEZ E;  1KRH A;  3KLS X;  4IWQ A;  4YTN B;  3MHZ A;  3VHT C;  4F7Z A;  4UDU C;  1WXA A;  4A20 A;  1ZXI A;  3E56 A;  4NQL B;  4K7U A;  3V61 A;  4MT5 A;  1EU3 A;  1AN8 A;  1TS5 A;  4FJZ A;  1C1Y B;  2WX0 A;  3AEF B;  4PS3 A;  1ACC A;  2NS5 A;  1E9M A;  4CO7 A;  4FJV B;  3RZW C;  2W3R A;  3WAN A;  3PRM B;  2EEL A;  3WAM A;  2L05 A;  1L4Z B;  2WXL A;  1NYR A;  3APF A;  3L10 B;  2K25 A;  3L08 A;  2PE6 B;  4KSL C;  4AJW A;  2J0M A;  4QAY A;  3NY5 A;  2PTL A;  4MGI E;  2G9H D;  3Q3M C;  4DBG A;  3FIL B;  2LXC A;  4P6V F;  3DBR I;  3SEB A;  5TSS A;  4HDQ A;  1B1Z A;  4W9J A;  1I4Q A;  4KX6 B;  4HXD A;  3HM6 X;  1WJ6 A;  2Y5B B;  1ZPS A;  1TKG A;  1L4D B;  3KUZ A;  3PZD A;  3DQV A;  2K3U A;  4MDK E;  3RN9 C;  1DOY A;  4P1C C;  1E7U A;  4ANX A;  4LDT B;  2IGD A;  3AE4 B;  2ON8 A;  3ZLZ A;  5IN7 A;  2L8J A;  2K22 A;  2IZV B;  4PT5 A;  2LRW A;  1QT9 A;  1D6E C;  1SE9 A;  4K3B A;  4LNN A;  3QC8 B;  1QOB A;  3VR9 B;  5D3I B;  4W9C A;  3Q3O C;  2JYE A;  2PVO D;  4NAM A;  3Q6B A;  2KFJ A;  1AAR A;  1I4P A;  4US8 A;  4RM8 A;  1CZP A;  3DDC B;  4JE3 B;  1NBF C;  1TJE A;  2WXF A;  2NTS A;  4HJK A;  2UWQ A;  1QOG A;  5G5G A;  3QWZ B;  5IKC M;  3URY A;  2GBN A;  5DCN A;  3R2I A;  4YTM B;  3APD A;  4IM3 A;  1VJK A;  4AP4 C;  1TZ1 A;  4BAX A;  1OGW A;  4DWF A;  3L13 A;  4K7S A;  4AUQ C;  3RPF C;  3PZ8 A;  2ZVN A;  3VRB B;  1K8R B;  3P4Q B;  1GB1 A;  2WYQ A;  3WA0 A;  2FAZ A;  1L2N A;  1L0X B;  4ITK A;  3C0R B;  3P4S B;  3KYD D;  4A3P A;  2MBH A;  1JRU A;  1R4M I;  1VR9 A;  2J52 A;  5AEK B;  3KUC B;  2M4N A;  2OED A;  2XK5 B;  2VZK D;  1LGR A;  2L32 A;  3IFW B;  2KT7 A;  4TV3 A;  5IAA C;  2MX2 A;  2MEK A;  1F52 A;  3CF6 E;  5D6J B;  5JH5 C;  2NBV B;  2LUM A;  3FIL A;  1GNU A;  2DZI A;  3OLM D;  1QOA A;  1TGZ B;  3B08 A;  3DBH B;  1XLO A;  4K1R B;  4RH6 A;  3UF8 A;  4YTP B;  4PS7 A;  1E8W A;  2REX A;  3VTW A;  2NVU I;  1TZO A;  2W3S A;  3RUI B;  2WDQ B;  1CJE A;  4MH8 A;  3KH0 A;  1HE8 A;  1BML C;  2PW9 A;  3AH7 A;  5LNK 1;  1MJD A;  3J9C A;  1SJE D;  5E6O A;  2IO1 B;  1OTR B;  4B9K A;  3U30 A;  2LMC A;  5AUI A;  5BYQ A;  1WJN A;  4TKN A;  2O6V B;  2L52 A;  2JXT A;  1WXQ A;  3ML8 A;  2N7J A;  1WFY A;  1R7S A;  2D07 B;  1LM8 B;  1PFD A;  2KMC A;  3W5U B;  2WU5 B;  1S3S G;  3AU5 A;  1KJT A;  1GC7 A;  3N1Z C;  2IBI B;  4N9F 4;  5FR6 A;  4KZ0 A;  3PV1 A;  1D4B A;  5LXH A;  4A8X C;  1WF9 A;  2WDV B;  3R7R A;  1IBX B;  1K52 A;  4GN1 A;  5HFY A;  2KHW B;  4I6L B;  1KOT A;  4HRS A;  2WXP A;  5EE1 A;  1VZ8 A;  3ZJT A;  2WXG A;  3SFE B; 
#chains in the Genus database with same CATH homology
 2IPK D;  1ESF A;  1XO3 A;  3VQI A;  1RYJ A;  1QKZ A;  2IGH A;  2DBY A;  1QLB B;  2XN9 C;  4GLS C;  4IDI A;  1J7C A;  2BBC A;  2BB5 A;  3H8H A;  5FKA C;  1D5X C;  3C8Y A;  1EWY C;  3NZ3 A;  4US9 A;  1HZ5 A;  1I4X A;  1XLP A;  1OFF A;  3AMZ A;  3FAH A;  3LXF A;  3BWU D;  4NJC A;  1FFV A;  3TSS A;  1I7H A;  2M0A A;  2L1A A;  2NTT A;  3U4E G;  2J42 A;  3MFG A;  3W9C B;  1SIJ A;  3AEE B;  3KWL A;  4AS1 A;  4RF1 A;  1TS4 A;  2GRI A;  4XDC A;  4JWU C;  1F0Z A;  4ZRQ A;  1ZOY B;  4YSY B;  1NEN B;  1UUP A;  3ZYY X;  1C4C A;  2HDE A;  1ENF A;  2WLB A;  2X38 A;  3E9S A;  1V97 A;  3HUI A;  3AE3 B;  3ZJV A;  2LEK A;  4CQN A;  2TSS A;  1MHH E;  1WSP A;  4TMA B;  1TS2 A;  1K50 A;  3T3N A;  3TEW A;  1TKE A;  4MAC A;  1SE2 A;  1NVI D;  1DYQ A;  3BVG A;  4USA A;  2DYO A;  3DWG C;  2ZW1 A;  2L83 A;  3SFD B;  5D7G A;  2IDY A;  1EU4 A;  3OWE B;  4C7Z A;  2AQ2 B;  4RGT A;  5JXV A;  1BUI C;  2KAJ A;  3NVW A;  1PGA A;  2EKI A;  2QSD A;  4C7Y A;  4O1N A;  5BMH A;  3WCQ A;  2Y5P A;  2LFI A;  2RPV A;  1J7B A;  1NYQ A;  5MPO A;  3L4P A;  2AQ1 B;  1SB3 C;  2JU6 X;  4WIP A;  3V05 A;  4ZYS A;  2FE8 A;  1KFY B;  4D2K A;  3N9Y C;  3AE1 B;  2WXR A;  2M56 B;  2QEJ C;  2QIL A;  3AE8 B;  1HQR D;  1K53 A;  2JWU A;  4NAW B;  2I38 A;  2WXM A;  1FNU A;  2RDG A;  3AB5 A;  4R3D A;  1DOI A;  1FIQ A;  3AV8 A;  4DXF A;  2GB1 A;  1I4H A;  1PGB A;  3PO0 A;  3IT4 B;  4LK0 M;  2DYM A;  1VZ6 A;  1EWC A;  4TSS A;  1J7A A;  1RM6 C;  1JWM D;  4P16 A;  1FXA A;  2J4X A;  2YEP F;  1V1P A;  4RF0 A;  2AX5 A;  2PKO A;  1XF5 L;  1CQV A;  3TEX A;  2BYT A;  1E6E B;  2WP9 B;  3R8B A;  1STE A;  1YMH E;  2LGI A;  4WWM A;  1RWS A;  1C78 A;  2N9K A;  1FO4 A;  2MJE A;  3LB8 C;  2V4I B;  3FC4 A;  2JX5 A;  2JYT A;  1L5P A;  1JWA D;  4N59 A;  4WAF A;  1E0Z A;  2BS4 B;  3AE2 B;  4C80 A;  2D5G A;  1SSN A;  1UNS A;  3MC0 B;  2FUG 1;  3NVV A;  1FEH A;  4M0W A;  4REZ A;  4ZOH C;  1C4A A;  2N0S B;  1E7P B;  1T3Q A;  2PVG C;  1UWX A;  1N60 A;  3R2T A;  3KQ4 A;  1EM7 A;  4OZC A;  2ACZ B;  2BB6 A;  4JPS A;  2H88 B;  2I2Y A;  4L23 A;  3U7Z A;  4YSX B;  5EE3 A;  3IAM 1;  1ET9 A;  5D3D A;  5GXG B;  1SBB B;  4KGR A;  1MHX A;  2WXQ A;  1JRO A;  1KLU D;  3B9J A;  3GS2 A;  2CJN A;  4RNA A;  3AE7 B;  2IJ0 A;  1YN3 A;  1KH0 A;  2WDR B;  3NRZ A;  4IKG A;  4L2Y A;  4OZA A;  2DLB A;  3BZD B;  1N62 A;  2AQ3 B;  1UGJ A;  1WRI A;  3AEG B;  5E6J A;  3EGR A;  2B76 B;  1L6V A;  4A55 A;  3IXS A;  1PYW D;  5BYS A;  1XCQ L;  2VZK B;  1HEZ E;  1KRH A;  2LJI A;  1MPE A;  3KLS X;  3LYY A;  4YTN B;  3MHZ A;  4UDU C;  2BT6 A;  3AED B;  1ZXI A;  1JAL A;  1N5X A;  3E56 A;  1DOX A;  3W1S A;  4MT5 A;  1EU3 A;  1AN8 A;  3KWV A;  1TS5 A;  1SEB D;  1VLB A;  3U52 E;  1JWS D;  1OQQ A;  1T5X D;  1F2R I;  1GOZ A;  2K0P A;  2OHF A;  2WS3 B;  3AEF B;  4HRO A;  4C56 C;  1L6U A;  1ACC A;  4J3O D;  5H8Y E;  1E9M A;  5I4D A;  4YWG G;  3ZQ4 A;  2E6X A;  3IAS 1;  2W3R A;  1FRR A;  1B9R A;  2EEL A;  4XE0 A;  2LHD A;  4DXG A;  4WQM A;  1L4Z B;  3BII D;  2WXL A;  1FMA D;  2SAK A;  1NYR A;  3Q8B A;  5BYR A;  4YSZ B;  2V0G A;  1K51 A;  2RDH A;  4GDK B;  4HKZ E;  4ZHP A;  2W54 A;  2PTL A;  1PDX A;  2G9H D;  3NS1 A;  3TEZ A;  3FIL B;  2K9X A;  1XLQ A;  1RFK A;  1VDV A;  1FNV A;  3ETR A;  4EE2 A;  2SEB D;  3P63 A;  4P6V F;  2Y3A A;  4KGS A;  4RCO A;  3SEB A;  1AYF A;  1JCK B;  1ZUD 2;  5TSS A;  2W55 A;  1B1Z A;  1WGK A;  2PLP A;  1D5Z C;  2BS3 B;  3P1M A;  1I4Q A;  3Q8F A;  1KLG D;  2V3N A;  1YQ3 B;  3AM9 A;  3ZGZ A;  1YN4 A;  2KAC A;  1TYG B;  4KX6 B;  4RFB A;  4A90 A;  3T3O A;  1ZPS A;  3BVZ A;  1TKG A;  1FNW A;  4MM3 B;  1L4D B;  4N6E B;  1L0V B;  3NVY A;  1IGC A;  4XWW A;  1XCT L;  3MP9 A;  4A9A A;  1YN5 A;  2K3U A;  5FR3 A;  3SR6 A;  1KF6 B;  2LHE A;  1DOY A;  1VZ7 A;  1MI0 A;  2J53 A;  1P7E A;  4B0E A;  2IGD A;  1IBX A;  3AE4 B;  5T8I A;  2ON8 A;  2K22 A;  1SXT A;  2Z8L A;  4PT5 A;  3TEY A;  4A6Q A;  1I4R A;  3Q8E A;  1QT9 A;  1D6E C;  1JWB D;  5HG2 A;  1QOB A;  3P4P B;  3IT6 B;  3VR9 B;  5D3I B;  4OW0 A;  3HVZ A;  1E10 A;  1QOF A;  1N63 A;  2ZW0 A;  2PIA A;  3ABV B;  2WU2 B;  4NZL B;  2JYE A;  2PVO D;  4NAM A;  1V1P B;  4JWS C;  4HEA 1;  3DWM A;  2Q5W D;  4YXD B;  1I4P A;  4US8 A;  1F77 A;  1TKY A;  1CZP A;  4JE3 B;  1TJE A;  2WXF A;  2NTS A;  2V3P A;  4RGM A;  1QOG A;  5G5G A;  3URY A;  1XXG A;  3BYT B;  3AN1 A;  3R2I A;  4YTM B;  1YJI A;  1XLN A;  3HVD A;  1VJK A;  1HXY D;  3GB1 A;  2WXH A;  1JML A;  1V8C A;  1QF6 A;  2MJ3 A;  1GPX A;  3AEC B;  4L1B A;  1Y56 A;  3BK1 A;  3RPF C;  3V3X A;  3EUB 2;  3PZ8 A;  1ET6 A;  3VRB B;  4AQ7 A;  5HI1 A;  1JWU D;  3AE9 B;  3B2G A;  2G1E A;  4RGO S;  5HHD G;  3P4Q B;  1GB4 A;  1GB1 A;  3TUO A;  1A70 A;  2INP E;  1VRA B;  1L0X B;  2R61 A;  4ITK A;  2RMM A;  1FXI A;  4KKJ A;  4LLG M;  3Q69 A;  3RFZ B;  3Q8A A;  2HTM E;  3P4S B;  2WXK A;  4TQ1 A;  2QJL A;  2IGG A;  1YJJ A;  4XDD A;  4TQ0 A;  1N61 A;  2QIE B;  4KKI A;  1VR9 A;  2DWQ A;  2J52 A;  1ZE3 D;  1SE4 A;  2OED A;  1C76 A;  3AE5 B;  3VRA B;  4ZRP A;  1UWM A;  2VZK D;  5BMG A;  2L32 A;  1Q10 A;  2M19 A;  4JX1 C;  1FFU A;  5G5H A;  3AE6 B;  1N5W A;  2WXO A;  1YNT E;  5C2T B;  1BXT A;  2ICI A;  1GAQ B;  2MEK A;  3CWI A;  1D5M C;  2INN E;  3PZ7 A;  2JSV X;  1SE3 A;  5EE0 A;  5AUK A;  1JW9 D;  2JQR B;  3NVZ A;  3P4R B;  4WH4 A;  4ARC A;  2KWD A;  2Y5C A;  3ZJU A;  1FD6 A;  1F2R C;  2LUM A;  3FIL A;  1C77 A;  2YEP B;  1CK1 A;  1ZDX A;  1QOA A;  2QMT A;  4KGT A;  1FCL A;  2GI9 A;  1WWT A;  1XLO A;  2BS2 B;  4RH6 A;  1JRP A;  2W82 A;  3I57 A;  5H92 C;  4XWT A;  4YTP B;  1FCC C;  2JZP A;  3UI3 A;  5FK9 C;  3NUH B;  3BYY B;  1ZP0 B;  1QIL A;  2KDM A;  1FRD A;  1DGJ A;  3P42 A;  1TS3 A;  1SJH D;  1C4P A;  4B0M A;  1ROE A;  3B2F A;  1TZO A;  2W3S A;  5C3J B;  1OQR A;  1CJE A;  1WYG A;  2WDQ B;  4MH8 A;  1KTK A;  2WXJ A;  1LO5 D;  1BML C;  2KMM A;  2PW9 A;  3AH7 A;  5LNK 1;  1SF0 A;  3J9C A;  1SJE D;  2KN4 A;  1FM0 D;  4N58 A;  1ZDV A;  1NI3 A;  2CU3 A;  1P7F A;  3HRD D;  3MJ5 A;  1I4G A;  2LMC A;  4DQO C;  4FXC A;  2NMQ A;  5AUI A;  5BYQ A;  5EE9 A;  2PMV A;  4OHJ A;  2CJO A;  2WNM A;  2L52 A;  3O13 A;  2K5P A;  2JXT A;  2WXN A;  1PUT A;  1WXQ A;  2WXI A;  1TY0 A;  3BK2 A;  1ZXH A;  2N7J A;  1R7S A;  1PFD A;  3W5U B;  4WUR A;  2FBW B;  3BVM A;  2WU5 B;  3VR8 B;  3W5V B;  3Q8C A;  4OZB A;  4OVZ A;  2WQY B;  2BW2 A;  3W2D A;  1V1O A;  1IUE A;  4H2A A;  2BTE A;  1TY2 A;  1IGD A;  2ONQ A;  1D4B A;  3I9V 1;  3AEA B;  1HZ6 A;  3EA6 A;  4A8X C;  2WDV B;  4Q2J A;  2N9L A;  1IBX B;  4IOI E;  1NEK B;  1K52 A;  4ARI A;  5HFY A;  1C79 A;  3AEB B;  1C9F A;  4HJG E;  4YT0 B;  1T6B X;  4ZHO A;  2KQ4 X;  1MVK A;  4LTU A;  2MH7 A;  1YQ4 B;  1PGX A;  4HKQ A;  1JQ4 A;  5BMI A;  3GP7 A;  4HRS A;  2WXP A;  5EE1 A;  1AWD A;  1AW7 A;  1HA5 A;  2H89 B;  2XNA C;  1VZ8 A;  1M4V A;  4RGN A;  3ZJT A;  4GDL B;  2WXG A;  2MJD A;  3U2S C;  1QQR A;  1XEE A;  2E3T A;  3CIR B;  3SFE B;  1L0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...