3WCQA

Crystal structure analysis of cyanidioschyzon melorae ferredoxin d58n mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVNQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title Increasing the electron-transfer ability of Cyanidioschyzon merolae ferredoxin by a one-point mutation - A high resolution and Fe-SAD phasing crystal structure analysis of the Asp58Asn mutant
pubmed doi rcsb
source organism Cyanidioschyzon merolae
total genus 24
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3wcqA00
4FXCA 2DBYA 1DOYA 3AB5A 1TKEA 5H8YE 1E10A 4YSXB 1JW9D 2HTME 3AH7A 1N61A 1FFUA 3AE8B 1FRRA 4HRSA 3SFEB 1JALA 3AEDB 3EUB2 1F0ZA 1NYRA 1FXAA 1YJJA 1FM0D 1L6UA 4C80A 1PFDA 2MH7A 1XLQA 1IUEA 2QIEB 3NRZA 3AE5B 1ZOYB 2G1EA 1SF0A 5AUIA 1PUTA 3ZYYX 2WU5B 2WP9B 1WXQA 1QT9A 3AECB 1J7CA 4C7YA 4YTMB 1TKGA 2L52A 2WDVB 1VDVA 2QJLA 1N5WA 3PO0A 2WQYB 2WLBA 1V97A 1WYGA 5EE3A 2EKIA 3SR6A 3AMZA 1NVID 1NEKB 1QOFA 2KAJA 2E3TA 3NVWA 3AE9B 4JWSC 4WQMA 2WS3B 2K5PA 5EE9A 4USAA 1XLPA 2BS2B 1FIQA 1N63A 1JWAD 4HROA 4ZOHC 5MPOA 1GPXA 1L6VA 3FAHA 2BS4B 3HRDD 1L0VB 2H89B 1SIJA 2MJ3A 3NVVA 1DGJA 3W9CB 1B9RA 3W5VB 2FBWB 3AE7B 1RWSA 4N59A 4YSYB 3AE2B 4P6VF 3VRAB 4JWUC 1KF6B 1UWMA 3P4SB 2W3RA 3BIID 1VJKA 1TKYA 1AYFA 4N6EB 4YSZB 1QF6A 1N5XA 2PIAA 2MJEA 3B2GA 2PVGC 1JQ4A 1FRDA 1L5PA 1RM6C 2K9XA 1OFFA 3NVYA 1J7BA 1JRPA 3DWGC 3AE4B 3AM9A 3VRBB 5H92C 2H88B 3CIRB 4C7ZA 5C2TB 1GAQB 2JX5A 1WWTA 4ZHOA 2CJNA 3KWLA 3RPFC 1E0ZA 5G5GA 2MJDA 1CJEA 1KRHA 4KX6B 1NYQA 4YXDB 2CU3A 4IDIA 4YTPB 3AEBB 1NENB 1YQ3B 2LEKA 1ROEA 3W5UB 1QLBB 3AEFB 3AE1B 3AV8A 4ZHPA 1XLOA 2Y5CA 1N60A 1YQ4B 2M19A 1AWDA 2CJOA 3B2FA 1I7HA 2W55A 3NVZA 4US9A 3NS1A 3AN1A 1JWBD 3P4PB 5GXGB 4US8A 1N62A 1VLBA 3LB8C 3ABVB 1ZXIA 3P1MA 5EE1A 1OQRA 2K22A 1PDXA 1TJEA 1T3QA 2DWQA 1E9MA 4WWMA 5G5HA 3SFDB 1JROA 1FXIA 3AEAB 3HVZA 3P63A 4JX1C 2N0SB 3CWIA 3WCQA 4ITKA 2B76B 1DOXA 2AX5A 2BS3B 2W54A 3AE3B 3DWMA 4YT0B 1TYGB 1R7SA 2WU2B 1RYJA 2KMMA 1E6EB 3L4PA 5C3JB 1DOIA 1XLNA 2OHFA 1J7AA 3AE6B 2L83A 1ZUD2 2Q5WD 1EWYC 1KFYB 2BT6A 3P4RB 1WGKA 5AUKA 3ETRA 1A70A 2M56B 2W3SA 3VR8B 1QOAA 1V8CA 1QOBA 3VR9B 5EE0A 1XO3A 3B9JA 1FFVA 2WDRB 4N58A 1CZPA 3P4QB 1RFKA 4YTNB 1OQQA 3AEGB 2WDQB 1QOGA 2PKOA 2PVOD 3LXFA 1NI3A 4LTUA 3HUIA 2ACZB 1ZP0B 1E7PB 1FMAD 1FO4A 1SB3C 1WRIA 2JQRB 4A9AA 3FC4A 3AEEB 1YJIA
chains in the Genus database with same CATH superfamily
2AWTA 5H8YE 3FILA 4HRSA 5CTRC 3LYYA 1FM0D 2KQ4X 3Q3NC 3T8MA 2LASA 2MH7A 1C76A 1UGMA 2C9WB 3Q8FA 3AE5B 2NBWB 1PUTA 2EELA 5JXVA 3MC9A 2NPTB 2RR9A 1SE9A 4OVZA 4XC2A 2LVQA 2Z0EB 4XWWA 2VZKD 2W82A 4W9CA 3UINB 2QCZA 2PLPA 4G3XB 4MACA 2NMQA 3AE7B 3ML8A 4LNNA 4BKSD 4A20A 2JU6X 1V81A 1QF6A 1AYFA 2PPHA 4LDTD 4GU2A 4W9KA 2OOBB 3RUIB 2NS5A 4FJVB 2GOWA 2YEPB 3DBHB 4MGKE 1YMHE 3L13A 2BWES 4LK0M 4REZA 1WX8A 1XLOA 1N60A 2IGGA 3NS1A 2C7NB 5D3DA 4MGYE 2X38A 3PTFC 3NS8A 2WU2B 3K9OB 3MFGA 2GI9A 1K50A 4WIPA 3CMMB 4DWFA 3T3NA 3N9YC 3SD5A 2W3SA 1XO3A 4PT5A 2WDRB 2BB5A 1IYFA 2YVCA 2JF5A 1NI3A 1WIAA 2DHZA 3VXWA 1FO4A 2D3GA 4D2KA 2BTEA 4CO7A 4RGNA 2C5LC 3GOEA 4BKTA 2MW5A 4K1RB 2B3AA 1KOTA 1V86A 3EFUA 1SF0A 2XEWA 3TEZA 3KYDD 1KH0A 5DPTA 5IP4D 3BVZA 4ZRQA 3QK0A 3AMZA 2QDFA 3ZQ4A 2KAJA 2E3TA 4JWSC 2LGSA 3VQIA 2KJRA 1FIQA 1K52A 2MBBB 2AEHA 1Q0WB 3M62B 1RLFA 1AARA 3BWUD 4YSYB 5HHDG 2ZPNA 2KLGA 2DYOA 3OWEB 4AOFA 4EKUA 3TBLD 3M3JA 1MG4A 5DPRA 2H88B 1V6EA 3OJ4B 1WSPA 1MHHE 3AEBB 2MRPA 2IPKD 1KM7A 3ZXVA 3ZW3A 1Q5WB 3DHIC 2KJHB 1YIWA 1I4HA 1QKZA 3LDZE 2ICIA 2WXFA 5IOIA 4HCNB 3N1XC 2IO2B 3P63A 4ITKA 4UDUC 3OLMD 1V80A 1WX7A 4DXFA 1FPYA 2ASQA 4E3CA 3Q3JA 3ETRA 3VR8B 1C4CA 4LNOA 1E7VA 3B9JA 2QMTA 4YTNB 2KX3A 1ISNA 1WXMA 2BWFA 2KHWB 5TSSA 1HE8A 2J0JA 2N9KA 2DZJA 4JGHB 1YJIA 3IAM1 5BMHA 1KTKA 1E10A 2A4ZA 2KMCA 1T0YA 3Q3FA 3UIOB 3ZDMC 4BAXA 2O6VD 2WU5B 2GBMA 4W9HA 3DCGA 4WWNA 3C19A 3ZUNA 3CSFA 3TL5A 2G45B 2K3UA 3PSEB 2KT7A 2GBJA 3VVWB 2L3ZA 3ZDTA 2J0KA 1JWAD 1L0VB 3W9CB 1DGJA 4XE0A 3QAQA 2FBWB 3DDCB 1WJ6A 2INCC 3DHHC 1I42A 1SJED 2PIAA 2KLCA 2AQ1B 2PTLA 2R2OA 1WX9A 3VDZA 4W9EA 4NNJB 2PW9A 3Q8BA 4BKSA 2RDBC 3P42A 4ZHOA 4MSMB 2KWCA 1WZ0A 5G5GA 1KRHA 1J0GA 1EUVB 3QQ8B 1ROEA 2WXHA 3OG5A 1YQBA 2LGYA 4AS1A 2MA9B 3B2FA 4US9A 1IGCA 3TUOA 2D10A 1ZXIA 3IT6B 4Q2JA 3SFDB 3A9JA 4NAMA 1I4GA 3U7ZA 3AU4A 1C78A 2QEJC 2ZW1A 4YT0B 4FADA 2OHFA 4FA6A 3I63C 1AW7A 2M4NA 5E6PA 2KX0A 3RMKC 2N9XA 5FKAC 2KKCA 2MBEA 4W9DA 4A8XC 1SB3C 1Z5SB 1SGHA 1PGBA 4XYCA 2DBYA 3W1SC 4E74A 1I4RA 1MG8A 1FFUA 1F2RI 3BVMA 2EMTA 4FULA 2D5GA 4HKZE 2NBVB 4WWPA 2AL6A 1I4QA 2PE9A 1GB1A 1UBQA 4IG7B 4BKGA 1TTNA 1WM3A 1VDVA 1N5WA 3BZDB 1Q10A 2LGDA 3KQ4A 2KN5A 4OVUA 1EWCA 2WS3B 3E9SA 3AXCA 1ZW7A 1GPXA 4EZLA 2LUMA 1LGRA 1GC7A 3SEBA 1V1PA 3AE2B 4A90A 1KF6B 4ANVA 4YSZB 1MHXA 4G0NB 2K9XA 4P7IA 2JZ3B 3ZNID 2K6DB 2JX5A 4TQ0A 1ZKHA 2CJNA 5JZEB 4NQLB 3IG3A 3ZXRA 1XT9B 2HE7A 2JYEA 5GMVA 4A55A 2G4DB 3KWVA 4HPMB 2CHWA 2W55A 3EA6A 2KANA 5GXGB 1UNSA 2AL3A 2IY0B 2VZKB 2D3CA 3ONSA 2W54A 3RCZA 1U4AA 2KMMA 4IOIE 2LJ5A 4FJYA 5AZFA 1QILA 1YX6B 2JPHA 2Q5WD 4OZBA 4GMVA 2KQ7A 3ALBA 3QIJA 2N9EB 2CKHB 2XN9C 4LDTB 1L2NA 4IKGA 1SIFA 1VR9A 1ZXHA 3PRPB 2JQRB 4S17A 1TKEA 1OGWA 4MJSA 2HTME 4E71A 1JALA 4C80A 3VUWA 5J17A 4WAAA 1T6BX 2LD9A 4RM9A 2KDIA 2FCSA 1L4DB 4XZ4A 1J7CA 4KSLC 2J42A 4BOSC 3ZRFA 5JHAA 5CHWA 5EE3A 2IO3B 1WJUA 1Y56A 2FCQA 3GB1A 2LZ6A 4H2AA 2O6VA 5FR6A 2WYQA 4TUUA 3QWZB 1TBEA 2HTHA 2GB1A 2BS4B 2FNJB 5JHBA 2MJ3A 1Y8RC 4NPNA 3L16A 3R2TA 5CHVC 1TKYA 1WGRA 3IBEA 3OAWA 4ICUA 4II3B 2X8XX 1TY2A 4WQOB 2KWUB 4LNFA 1UELA 2MWSB 3B0AA 2LEKA 3VUXA 1VCBA 2M19A 2JRIB 3H7SA 1PDXA 1V1PB 1ZGUB 4HEA1 3TEYA 4LJPB 3U52E 2J7QB 1B1ZA 2J52A 3NUHB 3U30A 3DWMA 1E6EB 3I9V1 1LO5D 1MI0A 3HM6X 5D6JB 4W9GA 3NJTA 3DHGC 2N1WA 1V8CA 1K53A 3PZDA 4HK2A 1FFVA 4HCPB 5CX3A 1N6ZA 4M02A 2GBKA 1JWUD 1SXTA 2DENB 1WRIA 1WH3A 4RNAA 1YX5B 4EZJA 3ZJTA 4NAWA 3NZSA 3RULA 1JCKB 1YJJA 2JY6A 1C3TA 1WGGA 4ARCA 3SU8X 4QAYA 3E56A 5BYRA 1WXQA 2FUG1 3V6EB 3EFCA 2BKRB 4AWJA 1R4MB 2D11A 4MM3B 2CHZA 2EMSA 1I35A 1IBXA 2IDYA 2K5PA 2BS2B 3RNFC 3A9KB 3QARA 3EHVA 2LJIA 5EDSA 3FKYA 4BBNF 3CSTA 4N9F4 4ANUA 2Y3AA 3DVNV 4BBNC 2L32A 2ZNVC 1WWTA 3RNBC 4BOZB 2ZZPB 4YXDB 4FBJB 2WHIA 2UU7A 1ET9A 1LQBA 4B6WA 4XDCA 3A1QB 3ZLZA 4IWOA 1VRAB 3NVZA 5EE1A 1GG3A 4WJOA 1VZ7A 4JX1C 1JWMD 2RGFA 4ZRPA 1YOVB 2J0MA 1R7SA 3W1SA 3L4PA 2GMIC 3DVGY 1FXTB 1ZE3D 5D3IB 2CU1A 5L83A 2NTSA 2KDMA 3H8HA 1T0QC 3ZTCA 3TIXA 2CS4A 4C00A 4LTUA 1JWSD 3A4RA 2KVZA 1MJDA 1B9RA 1GOZA 5HFYA 1TIFA 2M8SA 2G4SA 1J19A 1WI0A 1GNUA 1ZOYB 5LLIA 3TSSA 2VH2A 2KD0A 1WE7A 2WQYB 4WJNA 2EKIA 4A3PA 1D5ZC 1NEKB 5BYSA 2VH1A 3NVWA 2DYBA 3RNGC 2V3SA 1C4AA 1L6VA 1WGYA 1YNTE 5IN7A 4DXAB 3R2IA 3VRAB 3VTWA 2KN4A 2LXAA 1WMHA 3DVGX 4FHKA 2KJ6A 2LI5A 4M0WB 5BYQA 3I5JC 5LXIB 3N1ZC 2RSUA 1WZ3A 3VH4B 3RN9C 1GAQB 4KZCA 3KWLA 2MJDA 2IO0B 2JRHA 2N4FA 2KDEB 3N1YC 1KLVA 1T0RC 3FILB 3Q2AC 3L10B 2K1FA 4ACFA 4GDKA 1ACCA 2ZW0A 3SR6A 2MHJA 3IAS1 4A3OA 3HVZA 1YN4A 4CHKA 3ECIA 2AX5A 1ZDVA 4I6PA 2BW2A 2V1YA 2JXTA 4KGRA 3Q8EA 4URKA 3VR9B 3V61A 2DLBA 1J8CA 4WH4A 4N58A 3P4QB 4K7SA 4MH8A 1E8ZA 3DPDA 4GDLA 3VFKA 4CQNA 3Q3OC 3R7QA 4G11A 1EM7A 2BBCA 1EF1A 4KVGB 1F9JA 4TQ1A 4RM8A 3R66C 2YEPF 3WIMA 3PRMB 2INDC 3AECB 2BGFA 4AUQC 3DBRB 3S2AA 2BF8B 4AQ7A 3KLSX 3JSVA 2I1KA 2I1JA 2D07B 3UF8A 4GGQA 2WXJA 1QOFA 3AE9B 1F77A 1HZ5A 2LRWA 1E8WA 2H89B 2WXNA 3UGBB 1EU4A 2UWQA 3Q14C 3C8YA 2JXXA 2KYWA 4GOCA 1SE3A 1S3SG 1R4MI 1V1OA 3MHSD 2W3RA 4N6EB 3RYTA 4DHJD 1OTRB 2WXPA 4LLGM 1L5PA 1L0YB 2PMVA 4AP4C 4KGSA 3ZJVA 2KTRA 4ANWA 2SAKA 4HVBA 1L7YA 4C7ZA 3KUDB 3J9CA 4WAFA 1VZ6A 1H8CA 1V5TA 1K8RB 4PK1A 4RCOA 3X0WA 1MPEA 1YQ3B 3RZFA 2WGSA 1QLBB 3AULA 3EC8A 3N3KB 2Y5CA 4K81A 5J2RA 2MSED 1I7HA 2JWZA 1JWBD 2WXIA 4LNIA 4MH0E 4HXDA 1T3QA 2FAZA 2MLBA 2QHOA 3PREA 1WMHB 3AE3B 4YSXB 1RFAA 3ZNZB 3TCAA 1J7AA 3AE6B 1ET6A 1TS5A 1X1MA 1A70A 4W9IA 3ZVVA 4II2B 5E6OA 1RRBA 3IXSA 2SEBD 2K25A 3LXFA 3MJWA 4A9AA 2V3PA 2NBUA 2INPE 4GDKB 1FXAA 3ZGZA 2N7EA 3TEXA 1PFDA 1XLQA 3WAMA 4YTMB 2ON8A 4IWQA 2WLBA 5DPSA 3PHXB 1E90A 3B1LX 2KO3A 2PEAA 1N63A 2Y5BB 5IO9A 4NZLB 3ZNGC 4JLCA 1SIJA 4M8MA 3EGRA 4GLSC 4HLEA 5JH5C 1T0SC 3P4SB 1I4PA 4MEMA 4BVUC 4HPPA 2MJEA 2PVGC 3IVFA 2QC8A 2KDFB 3NVYA 1PYWD 3QCAA 4L2YA 2QSDA 2L8JA 2KQSA 3U7DA 3UI3A 3NHEB 4ASWC 2R2QA 1DYQA 4C4VA 3L08A 4KX6B 4IDIA 2G9HD 4FN2A 4OVVA 4GIVA 4WWOA 4B0EA 3BK2A 5T8IA 4EE2A 3JVZX 2L7RA 2KK8A 4NJ7A 3I57A 2MBHA 2WXRA 1SBBB 4US8A 4L1BA 2O2VA 3CWIA 1LFDA 4KZ0A 4HKQA 1RYJA 2OEDA 1FNUA 2KFKA 4ZRIA 1M4VA 4C56C 1WR1A 1HTQA 3NG0A 1OQYA 2BKFA 1WY8A 2C7HA 2ONQA 1ZP0B 1UH6A 2N7JA 1E7PB 1FMAD 5HI1A 4G50A 3PPAA 4HPLB 2HJ1A 4P1CC 3AH7A 3NOBA 3SFEB 4X57B 5DPWA 1WJNA 5BMGA 3JYUA 2G1EA 3KW5B 1C9FA 1WFYA 4C7YA 2LHEA 1SJHD 2WXOA 3Q3MC 3VAWA 5BO4B 3D32A 4FJZA 4B95A 1D3ZA 4IC7B 2AQ3B 2DNFA 3OJ3A 1YJ1A 4HROA 4JPSA 4ZOHC 5MPOA 2KTFA 2DZIA 3A9JB 1IPGA 4IWPA 3IT4B 3NY5A 2JSVX 3TEWA 1WGDA 3DBRI 2LHDA 1VJKA 2N9PC 3B2GA 1PQSA 4J6IA 3N30A 3Q69A 2LVPA 3ZIMA 4NQKE 3C0RB 2RPQA 2NPTA 2V0GA 4YTPB 1NENB 3KYCD 4OZCA 3TJPA 1XCTL 5C1ZA 3WAOA 4ANXA 3PGEA 1GUAB 3L0WB 2BS3B 3T3OA 1XCQL 3P2BA 2L83A 4R3DA 2BPSA 3P4RB 1WE6A 3Q6BA 4W9LA 1QOBA 4PS8A 4S0RA 2HD5B 2A5UA 1CZPA 1UUPA 3I3TB 2ACZB 1E8XA 1CMXB 5D2MB 4MT5A 1E5WA 4K7UA 2KZRA 2M0XA 2J53A 2MP2A 3ZTDA 1P7FA 2L00B 2O2VB 2QIEB 3R3MA 1C4PA 5AUIA 3HK0A 5FK9C 2LGXA 2WDVB 4XDDA 4P16A 2VRRB 3V62A 4USAA 1XLPA 1V9JA 2IBIB 2REXA 3FAHA 2ZEQA 5KHOA 4AJYB 3O13A 1SE2A 2CR5A 2XK5A 3ML9A 4HJKA 1P98A 3BIID 4RGOS 4JE3B 5IKCM 1N5XA 2N9LA 1BUIC 2DZMA 4MSQB 2JVCA 1TZ1A 2L76A 3PZ8A 1STEA 3U8ZA 1EU3A 2BYTA 3SHQA 4HDQA 2CU3A 4WJPA 4EFOA 3EECA 2LGIA 3W5UB 1V5OA 3AE1B 3AV8A 4TMAB 2WWZA 2FUHB 3BVGA 4MJSB 5C23A 4OW0A 2DZKA 3H1UA 2NTTA 3B08A 2XNAC 1XQQA 3QX1A 2RD0A 3GE3C 4MELA 1SE4A 2KC2A 4XWTA 3VTVA 1YD8U 2INNE 2JUOA 4M00A 4TV3A 5AZGA 2O6VB 2KWVB 1P1AA 4DHJB 3AEGB 1L4ZB 2N1VA 2LFIA 2M0AA 1RAXA 2DYMA 3AB5A 4TSSA 1Q1OA 2WXGA 4OHJA 4BZAA 4GXBA 3APDA 2LUEA 4DDGD 1L6UA 3PVLA 2WNMA 3IFWB 5E6JA 1SSNA 2JYTA 1TKGA 2L52A 2QJLA 1UGJA 4XGAB 3PHWB 3APCA 4DXGA 4J3OD 3VTUA 3BYTB 1TS3A 2MEKA 1XD3B 5D94A 4B9KA 2KOXA 1MFWA 1TGZB 2GBNA 1RWSA 2ZPYA 4RF1A 1WYWB 2Z8LA 4P6VF 2MX2A 2AQ2B 3VUYA 2L1AA 2MP2B 4DHZB 3PLVA 1J7BA 1D5MC 3WALA 4MGIE 2MBOA 3V3XA 5I4DA 1LXDA 3DQVA 3ZJUA 1EF5A 2KC1A 1WM2A 4FLHA 3GZNB 2BVCA 1A5RA 2LRUA 1WXAA 3QHTA 2ZJDA 5LNK1 4NAWB 3V6CB 4F8CB 3RNEC 1NI2A 4W9FA 1N62A 2C60A 5AUKA 2XK5B 1OQRA 3APFA 2DWQA 1HZ6A 1E9MA 4P1BC 3JW0X 1D4BA 3TMPB 2TSSA 4M01A 3VH3B 1C77A 1BXTA 2JT4B 3RD2A 1EWYC 4IUMB 3DVNU 1IBXB 2V4LA 1V2YA 4WJQA 3RNCC 4KKIA 3R7RA 1QOGA 1P9DU 2PE6B 3A4SC 1VD2A 3FC4A 2JZZA 2FCNA 1FRRA 1BMLC 2WX0A 2V4IB 1EO6A 2KXJA 5HKHA 3DBLI 4DK5A 2KFJA 3GE8C 2K6QA 2OJWA 2FIFA 4F1SA 5G55A 1V97A 4IM2A 5AEKB 1TY0A 3H7PA 3MJ5A 1CQVA 1HTOA 2V3NA 3DBSA 2FCMA 4O1NA 2D2QA 1UZXB 3MC0B 4HDOA 5CHFA 1XF5L 2LXCA 5TR5A 4ZYSA 3WANA 1UWMA 2WXQA 2ZCBA 2DAFA 4RF0A 1KJTA 5KHQA 1FRDA 1P3QU 1R4NB 4EUTA 1F52A 1OFFA 2BYVE 1NDDA 3AE4B 4IW0A 2WXMA 1S1QB 4K3CA 1FCCC 4M8NA 3RPFC 4JIOU 1E0ZA 2ZVOA 1Z2MA 4KDIC 2M17A 2LWPA 4B0MA 3BINA 5FR3A 2RDHA 4KV2A 1TT5B 1L0XB 1VLBA 3P1MA 4W9JA 1TJEA 1F2RC 1JROA 4F7ZA 1HA5A 2W9NA 3GP7A 4I6NB 3PRZA 3PT2B 1WJ4A 2YLMA 3RT3B 3ZNHB 2BYEA 4ZYNA 3LJ3A 4PS7A 3KUZA 4FHJA 2DAJA 1ZUD2 1KFYB 2BT6A 4HJGE 5IAAC 1LM8B 2M56B 1QOAA 4IM0A 5EE0A 4AJWA 3T9LA 4A6QA 3RZWC 3HM3A 2WDQB 1QQRA 2PKOA 2PVOD 1MVKA 1GB4A 1V49A 5DCNA 2M1MA 4EZKA 2RMMA 3BYYB 1DOYA 2WDTB 1ZPSA 3IHPC 3AE8B 3M95A 1FNWA 3AEDB 1TS4A 3MC8A 1XEEA 3QJZA 2QILA 2BB6A 2G3QB 2HJ8A 5E6NA 1QT9A 1FNVA 3PO0A 4K7WA 4RGMA 2PJHA 3DOWA 2NCNA 2IGDA 2WXKA 4WQMA 4JQWC 1ESFA 4LJOB 2RPVA 3H9DA 2V9HA 4K3BA 2IGHA 3HRDD 3NVVA 3QA8A 4DHZE 3ENEA 4N59A 4JWUC 1OEYJ 1AN8A 3MTNB 4DQOC 1TS2A 5AZHA 1GC6A 1JRPA 1H4RA 3DBHI 3V60A 2KVRA 5C2TB 5LXHA 3PV1A 3Q8CA 1ZDXA 1NYQA 2ZCCA 2EKEC 4DBGA 3MP9A 3H7PB 4TKNA 5G2NA 4ZHPA 4GDLB 2KACA 3KH0A 1YQ4B 3AN1A 4ARIA 3ABVB 2HDEA 4WWMA 2K22A 3W1YA 2D3BA 3UQAA 1WXVA 2LVOA 1WF9A 3BY4B 3GZNI 1TYGB 2K0PA 3R8BA 2JZPA 1XLNA 3ZRCA 4LNKA 3JSVB 1WGKA 3RI7C 4ZDVA 1WGHA 3MHZA 1FEHA 3PZ7A 1WRDB 4ZRJA 3L17A 4EOYA 2UYZB 3HUIA 4PYZA 1SEBD 1PGXA 3ZKJC 1C79A 1P0RA 1JW9D 1N61A 3WA0A 1NYRA 4CYEA 1IUEA 2KTRB 3NRZA 1D5XC 3W2DA 4DDID 5D7GA 4JL9A 3Q8AA 4NJCA 4XX5A 2IYDB 1WYGA 2MBQA 3QC8B 1T5XD 2Z0DB 1NVID 3GS2A 4OZAA 1FCLA 1YN5A 4WURA 4RH6A 4GN1A 3VHTC 1QZEA 3H6NA 4YWGG 2FIDA 2KNBA 4GSWA 4KGTA 4KIKA 1FD6A 1RM6C 4PYUA 3UQBA 1JMLA 2NR2A 3AM9A 2L05A 3VRBB 5H92C 4RFBA 2I38A 3NZUA 1CJEA 4MM3A 2DX5B 2JWUA 4MDKE 1R4NI 2IZVB 1AWDA 2CJOA 3RNAC 4GB9A 3U2SC 3U4EG 3P4PB 1I4XA 1NBFC 3LB8C 3A9KA 1CK1A 1M94A 1FXIA 1WXSA 1KLGD 2B76B 2KWDA 1DOXA 4YL8A 5C3JB 5HG2A 1KLUD 3AI5A 1TZOA 2KMAA 1XXGA 2BYFA 4NJ6A 2K39A 1RFKA 1HEZE 1OQQA 2ZNVB 2MCNB 2NVUI 5J18A 4MGZE 2K8HA 1F1HA 3HVDA 4PS3A 3PS6A 4BFRA 3AEEB 2Z59B 4FXCA 1UBIA 3A1QA 3O65B 2Y5PA 3L54A 3EUB2 2C7MB 3HHMA 4ICVA 1JRUA 2BQQA 3UIPB 3ZYYX 3NZ3A 2WP9B 4C4VB 2LMCA 1YN3A 3M63B 2RDGA 3DBLB 3K9PB 3AU5A 2CHXA 3KVFB 4I6LB 2IY1B 2L0TA 2WX1A 2ZVNA 2XBBC 4ZRKA 4LCDE 4KDLB 4RGTA 5EE9A 1P7EA 1ENFA 2IJ0A 3W5VB 3V05A 1UD7A 1IGDA 2L0FA 3RFZB 2K8CA 2D3AA 3HIZA 1JQ4A 2KFKB 3N20C 1GJZA 1K51A 1UWXA 2OJRA 1PGAA 3DWGC 4EEWA 2I2YA 2WXLA 4KSKC 3CIRB 4RMAA 2AYOB 1UF0A 3N32A 1E8YA 3A33B 4NY0A 2IO1B 3AEFB 1HQRD 3BK1A 3X23A 3SDLC 2GRIA 2R61A 2J4XA 1F0ZA 5G5HA 1G6JA 1C1YB 3AEAB 1BT0A 2MQJA 2N0SB 3WCQA 4IM3A 4KIKB 2N7DA 2E6XA 3CF6E 4KKJA 1DOIA 1E7UA 3KUCB 2FE8A 2GLSA 1D6EC 4M0WA 5L95C 4HWIB 3PLUA 2GBRA 3WAPA 2KDBA 5IA7A 1IP9A 4L23A 5BMIA 3URYA 3ZO5B 2K8BA 1WR6E 1HXYD 1OEYA 1VZ8A
chains in the Genus database with same CATH topology
5H8YE 1TKEA 2V3PA 3FILA 2HTME 4HRSA 2INPE 1FRRA 1JALA 4GDKB 1FXAA 3LYYA 1BMLC 1FM0D 2KQ4X 3ZGZA 3TEXA 4C80A 1PFDA 2MH7A 1XLQA 2V4IB 1C76A 3Q8FA 3AE5B 1T6BX 1PUTA 2EELA 5JXVA 1L4DB 4YTMB 1J7CA 2ON8A 2J42A 2WLBA 1V97A 4OVZA 5EE3A 4XWWA 1TY0A 1Y56A 3MJ5A 1CQVA 3GB1A 4H2AA 2VZKD 2W82A 2V3NA 1N63A 2GB1A 4NZLB 2BS4B 2PLPA 4O1NA 1SIJA 2MJ3A 3MC0B 4MACA 1XF5L 2NMQA 4ZYSA 3EGRA 4GLSC 3R2TA 3AE7B 1UWMA 1I4PA 2WXQA 3P4SB 2JU6X 1QF6A 1TKYA 1AYFA 4RF0A 2MJEA 2PVGC 1FRDA 1OFFA 3NVYA 1PYWD 3AE4B 1TY2A 4L2YA 2QSDA 2WXMA 3UI3A 1FCCC 3RPFC 1DYQA 1E0ZA 2YEPB 4KX6B 4IDIA 2G9HD 4B0EA 1YMHE 3BK2A 2LEKA 5T8IA 4EE2A 4LK0M 4REZA 1XLOA 4B0MA 1N60A 2M19A 3I57A 2IGGA 3NS1A 5FR3A 2WXRA 2RDHA 1SBBB 1L0XB 4US8A 1VLBA 3P1MA 4L1BA 5D3DA 1PDXA 1TJEA 1V1PB 1F2RC 1JROA 4HEA1 3TEYA 3U52E 2X38A 3CWIA 1B1ZA 2J52A 1HA5A 3NUHB 3DWMA 3GP7A 2WU2B 4HKQA 1RYJA 1E6EB 3I9V1 1LO5D 1MI0A 2GI9A 2OEDA 3MFGA 1FNUA 1K50A 4WIPA 1ZUD2 3T3NA 3N9YC 1KFYB 2BT6A 4HJGE 2M56B 2W3SA 1QOAA 1V8CA 1M4VA 4C56C 1K53A 5EE0A 1XO3A 1FFVA 4PT5A 2WDRB 2BB5A 4A6QA 2WDQB 1QQRA 2PKOA 2PVOD 1NI3A 1MVKA 1GB4A 2ONQA 1ZP0B 1JWUD 2N7JA 1E7PB 1FMAD 1SXTA 5HI1A 1WRIA 1FO4A 4D2KA 4RNAA 2BTEA 2RMMA 3BYYB 1DOYA 1ZPSA 3ZJTA 3AH7A 4RGNA 3AE8B 3SFEB 1FNWA 3AEDB 1JCKB 1YJJA 5BMGA 1TS4A 4ARCA 2G1EA 1C9FA 1XEEA 1SF0A 2QILA 2BB6A 3TEZA 3E56A 5BYRA 1WXQA 1QT9A 1KH0A 2FUG1 4C7YA 2LHEA 1SJHD 2WXOA 1FNVA 3PO0A 4MM3B 4RGMA 3BVZA 4ZRQA 2IGDA 3AMZA 1IBXA 2WXKA 3ZQ4A 2KAJA 2E3TA 4JWSC 3VQIA 4WQMA 2AQ3B 2IDYA 2K5PA 1ESFA 2RPVA 2BS2B 1FIQA 1K52A 4HROA 4JPSA 4ZOHC 2IGHA 5MPOA 3HRDD 3NVVA 3IT4B 3TEWA 2JSVX 4N59A 3BWUD 4YSYB 5HHDG 4JWUC 2LHDA 1VJKA 1AN8A 2DYOA 2LJIA 3B2GA 3OWEB 4DQOC 1TS2A 3Q69A 1JRPA 2Y3AA 2H88B 2L32A 5C2TB 1WWTA 2V0GA 3Q8CA 1ZDXA 1NYQA 4YXDB 1WSPA 1MHHE 4YTPB 3AEBB 1NENB 3MP9A 2IPKD 4OZCA 1ET9A 4ZHPA 4GDLB 2KACA 4XDCA 1YQ4B 1XCTL 1I4HA 1QKZA 1VRAB 3NVZA 2ICIA 2WXFA 3AN1A 4ARIA 5EE1A 3ABVB 2HDEA 4WWMA 2K22A 1VZ7A 3P63A 4JX1C 1JWMD 4ITKA 4UDUC 4ZRPA 2BS3B 3T3OA 1XCQL 1TYGB 1R7SA 2K0PA 3R8BA 3L4PA 3W1SA 2JZPA 1XLNA 4DXFA 2L83A 4R3DA 1ZE3D 5D3IB 3P4RB 1WGKA 3ETRA 3VR8B 1QOBA 2NTSA 1C4CA 2KDMA 3H8HA 3MHZA 1FEHA 3PZ7A 3B9JA 1CZPA 2QMTA 4YTNB 1UUPA 4LTUA 3HUIA 5TSSA 2ACZB 1SEBD 1PGXA 1JWSD 2N9KA 1C79A 1YJIA 3IAM1 4MT5A 5BMHA 1KTKA 1E10A 1JW9D 1B9RA 1N61A 1GOZA 5HFYA 2J53A 1NYRA 1P7FA 1IUEA 2QIEB 3NRZA 1D5XC 1ZOYB 3W2DA 1C4PA 5AUIA 3TSSA 5FK9C 2WU5B 5D7GA 3Q8AA 4NJCA 2WDVB 2WQYB 1WYGA 2EKIA 1D5ZC 2K3UA 1T5XD 4XDDA 1NVID 1NEKB 5BYSA 3GS2A 4P16A 3NVWA 4USAA 1XLPA 4OZAA 1FCLA 1JWAD 1C4AA 1L6VA 1YN5A 1YNTE 3FAHA 1L0VB 4RH6A 4WURA 3W9CB 3O13A 1DGJA 4XE0A 1SE2A 3R2IA 2FBWB 3VRAB 4YWGG 2KN4A 1SJED 3BIID 4KGTA 1FD6A 4RGOS 4JE3B 1N5XA 2N9LA 1BUIC 2PIAA 5BYQA 2AQ1B 2PTLA 1RM6C 3PZ8A 1STEA 1JMLA 3AM9A 2PW9A 3VRBB 5H92C 3Q8BA 1GAQB 1EU3A 3P42A 4ZHOA 4RFBA 3KWLA 2BYTA 2I38A 5G5GA 2MJDA 1CJEA 1KRHA 2CU3A 2LGIA 2JWUA 1ROEA 3W5UB 2WXHA 3AE1B 3AV8A 4TMAB 4AS1A 3FILB 3BVGA 1AWDA 2CJOA 3B2FA 4US9A 1IGCA 3U2SC 3TUOA 3U4EG 3P4PB 1I4XA 4OW0A 3LB8C 3IT6B 1ZXIA 1ACCA 2ZW0A 3SR6A 4Q2JA 3IAS1 3SFDB 1CK1A 4NAMA 1FXIA 3HVZA 2NTTA 1KLGD 1YN4A 2B76B 1I4GA 2KWDA 2XNAC 3U7ZA 1DOXA 2AX5A 1ZDVA 1C78A 2QEJC 2ZW1A 4YT0B 5C3JB 5HG2A 2OHFA 2BW2A 1KLUD 1SE4A 2JXTA 1TZOA 4KGRA 3Q8EA 4XWTA 1XXGA 1AW7A 3VR9B 2INNE 2DLBA 4WH4A 4N58A 5FKAC 3P4QB 1RFKA 1HEZE 1OQQA 3AEGB 1L4ZB 4MH8A 4A8XC 2LFIA 3HVDA 1SB3C 2M0AA 2DYMA 1PGBA 3AEEB 4FXCA 2DBYA 4CQNA 3AB5A 2Y5PA 2WXGA 4OHJA 4TSSA 1I4RA 1FFUA 1EM7A 1F2RI 3EUB2 3BVMA 1L6UA 2D5GA 2BBCA 2WNMA 4TQ1A 2YEPF 4HKZE 5E6JA 3ZYYX 1SSNA 1I4QA 3NZ3A 2WP9B 1GB1A 3AECB 2JYTA 1TKGA 2L52A 1YN3A 2LMCA 2RDGA 1VDVA 2QJLA 1N5WA 3BZDB 4AQ7A 3KLSX 1Q10A 1UGJA 3KQ4A 2WXJA 1QOFA 3AE9B 1EWCA 2WS3B 5EE9A 3E9SA 4RGTA 1F77A 1HZ5A 1P7EA 1ENFA 4DXGA 1GPXA 4J3OD 3BYTB 1TS3A 2H89B 2IJ0A 2MEKA 2WXNA 3W5VB 1EU4A 2LUMA 3V05A 3C8YA 3SEBA 1V1PA 1RWSA 1IGDA 1SE3A 2Z8LA 3AE2B 4P6VF 4RF1A 1KF6B 4A90A 1V1OA 3RFZB 2W3RA 4N6EB 2AQ2B 4YSZB 1MHXA 2L1AA 4LLGM 2WXPA 1JQ4A 1L5PA 1L0YB 2K9XA 1K51A 2PMVA 1J7BA 1UWXA 1D5MC 1PGAA 3DWGC 4KGSA 2I2YA 2WXLA 3V3XA 3ZJVA 5I4DA 2SAKA 3CIRB 4C7ZA 3ZJUA 3J9CA 2JX5A 4TQ0A 4WAFA 2CJNA 1VZ6A 4RCOA 1MPEA 1YQ3B 1QLBB 2JYEA 3AEFB 1HQRD 4A55A 3KWVA 2Y5CA 3BK1A 5LNK1 4NAWB 1I7HA 2W55A 3EA6A 1JWBD 5GXGB 2GRIA 2R61A 1UNSA 2WXIA 1N62A 5AUKA 1OQRA 2J4XA 1T3QA 1HZ6A 1E9MA 2DWQA 5G5HA 1F0ZA 3AEAB 2N0SB 3WCQA 2VZKB 1D4BA 2TSSA 2W54A 3AE3B 4YSXB 2KMMA 2E6XA 4KKJA 1C77A 1DOIA 4IOIE 1BXTA 4M0WA 2FE8A 1D6EC 1QILA 1J7AA 3AE6B 1ET6A 1TS5A 2Q5WD 4OZBA 1EWYC 1A70A 1IBXB 3IXSA 2XN9C 2SEBD 4IKGA 4KKIA 4L23A 5BMIA 1QOGA 3URYA 3LXFA 1VR9A 1ZXHA 2JQRB 4A9AA 1HXYD 1VZ8A 3FC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXC A;  2DBY A;  1DOY A;  3AB5 A;  1TKE A;  5H8Y E;  1E10 A;  4YSX B;  1JW9 D;  2HTM E;  3AH7 A;  1N61 A;  1FFU A;  3AE8 B;  1FRR A;  4HRS A;  3SFE B;  1JAL A;  3AED B;  3EUB 2;  1F0Z A;  1NYR A;  1FXA A;  1YJJ A;  1FM0 D;  1L6U A;  4C80 A;  1PFD A;  2MH7 A;  1XLQ A;  1IUE A;  2QIE B;  3NRZ A;  3AE5 B;  1ZOY B;  2G1E A;  1SF0 A;  5AUI A;  1PUT A;  3ZYY X;  2WU5 B;  2WP9 B;  1WXQ A;  1QT9 A;  3AEC B;  1J7C A;  4C7Y A;  4YTM B;  1TKG A;  2L52 A;  2WDV B;  1VDV A;  2QJL A;  1N5W A;  3PO0 A;  2WQY B;  2WLB A;  1V97 A;  1WYG A;  5EE3 A;  2EKI A;  3SR6 A;  3AMZ A;  1NVI D;  1NEK B;  1QOF A;  2KAJ A;  2E3T A;  3NVW A;  3AE9 B;  4JWS C;  4WQM A;  2WS3 B;  2K5P A;  5EE9 A;  4USA A;  1XLP A;  2BS2 B;  1FIQ A;  1N63 A;  1JWA D;  4HRO A;  4ZOH C;  5MPO A;  1GPX A;  1L6V A;  3FAH A;  2BS4 B;  3HRD D;  1L0V B;  2H89 B;  1SIJ A;  2MJ3 A;  3NVV A;  1DGJ A;  3W9C B;  1B9R A;  3W5V B;  2FBW B;  3AE7 B;  1RWS A;  4N59 A;  4YSY B;  3AE2 B;  4P6V F;  3VRA B;  4JWU C;  1KF6 B;  1UWM A;  3P4S B;  2W3R A;  3BII D;  1VJK A;  1TKY A;  1AYF A;  4N6E B;  4YSZ B;  1QF6 A;  1N5X A;  2PIA A;  2MJE A;  3B2G A;  2PVG C;  1JQ4 A;  1FRD A;  1L5P A;  1RM6 C;  2K9X A;  1OFF A;  3NVY A;  1J7B A;  1JRP A;  3DWG C;  3AE4 B;  3AM9 A;  3VRB B;  5H92 C;  2H88 B;  3CIR B;  4C7Z A;  5C2T B;  1GAQ B;  2JX5 A;  1WWT A;  4ZHO A;  2CJN A;  3KWL A;  3RPF C;  1E0Z A;  5G5G A;  2MJD A;  1CJE A;  1KRH A;  4KX6 B;  1NYQ A;  4YXD B;  2CU3 A;  4IDI A;  4YTP B;  3AEB B;  1NEN B;  1YQ3 B;  2LEK A;  1ROE A;  3W5U B;  1QLB B;  3AEF B;  3AE1 B;  3AV8 A;  4ZHP A;  1XLO A;  2Y5C A;  1N60 A;  1YQ4 B;  2M19 A;  1AWD A;  2CJO A;  3B2F A;  1I7H A;  2W55 A;  3NVZ A;  4US9 A;  3NS1 A;  3AN1 A;  1JWB D;  3P4P B;  5GXG B;  4US8 A;  1N62 A;  1VLB A;  3LB8 C;  3ABV B;  1ZXI A;  3P1M A;  5EE1 A;  1OQR A;  2K22 A;  1PDX A;  1TJE A;  1T3Q A;  2DWQ A;  1E9M A;  4WWM A;  5G5H A;  3SFD B;  1JRO A;  1FXI A;  3AEA B;  3HVZ A;  3P63 A;  4JX1 C;  2N0S B;  3CWI A;  3WCQ A;  4ITK A;  2B76 B;  1DOX A;  2AX5 A;  2BS3 B;  2W54 A;  3AE3 B;  3DWM A;  4YT0 B;  1TYG B;  1R7S A;  2WU2 B;  1RYJ A;  2KMM A;  1E6E B;  3L4P A;  5C3J B;  1DOI A;  1XLN A;  2OHF A;  1J7A A;  3AE6 B;  2L83 A;  1ZUD 2;  2Q5W D;  1EWY C;  1KFY B;  2BT6 A;  3P4R B;  1WGK A;  5AUK A;  3ETR A;  1A70 A;  2M56 B;  2W3S A;  3VR8 B;  1QOA A;  1V8C A;  1QOB A;  3VR9 B;  5EE0 A;  1XO3 A;  3B9J A;  1FFV A;  2WDR B;  4N58 A;  1CZP A;  3P4Q B;  1RFK A;  4YTN B;  1OQQ A;  3AEG B;  2WDQ B;  1QOG A;  2PKO A;  2PVO D;  3LXF A;  1NI3 A;  4LTU A;  3HUI A;  2ACZ B;  1ZP0 B;  1E7P B;  1FMA D;  1FO4 A;  1SB3 C;  1WRI A;  2JQR B;  4A9A A;  3FC4 A;  3AEE B;  1YJI A; 
#chains in the Genus database with same CATH topology
 2AWT A;  5H8Y E;  3FIL A;  4HRS A;  5CTR C;  3LYY A;  1FM0 D;  2KQ4 X;  3Q3N C;  3T8M A;  2LAS A;  2MH7 A;  1C76 A;  1UGM A;  2C9W B;  3Q8F A;  3AE5 B;  2NBW B;  1PUT A;  2EEL A;  5JXV A;  3MC9 A;  2NPT B;  2RR9 A;  1SE9 A;  4OVZ A;  4XC2 A;  2LVQ A;  2Z0E B;  4XWW A;  2VZK D;  2W82 A;  4W9C A;  3UIN B;  2QCZ A;  2PLP A;  4G3X B;  4MAC A;  2NMQ A;  3AE7 B;  3ML8 A;  4LNN A;  4BKS D;  4A20 A;  2JU6 X;  1V81 A;  1QF6 A;  1AYF A;  2PPH A;  4LDT D;  4GU2 A;  4W9K A;  2OOB B;  3RUI B;  2NS5 A;  4FJV B;  2GOW A;  2YEP B;  3DBH B;  4MGK E;  1YMH E;  3L13 A;  2BWE S;  4LK0 M;  4REZ A;  1WX8 A;  1XLO A;  1N60 A;  2IGG A;  3NS1 A;  2C7N B;  5D3D A;  4MGY E;  2X38 A;  3PTF C;  3NS8 A;  2WU2 B;  3K9O B;  3MFG A;  2GI9 A;  1K50 A;  4WIP A;  3CMM B;  4DWF A;  3T3N A;  3N9Y C;  3SD5 A;  2W3S A;  1XO3 A;  4PT5 A;  2WDR B;  2BB5 A;  1IYF A;  2YVC A;  2JF5 A;  1NI3 A;  1WIA A;  2DHZ A;  3VXW A;  1FO4 A;  2D3G A;  4D2K A;  2BTE A;  4CO7 A;  4RGN A;  2C5L C;  3GOE A;  4BKT A;  2MW5 A;  4K1R B;  2B3A A;  1KOT A;  1V86 A;  3EFU A;  1SF0 A;  2XEW A;  3TEZ A;  3KYD D;  1KH0 A;  5DPT A;  5IP4 D;  3BVZ A;  4ZRQ A;  3QK0 A;  3AMZ A;  2QDF A;  3ZQ4 A;  2KAJ A;  2E3T A;  4JWS C;  2LGS A;  3VQI A;  2KJR A;  1FIQ A;  1K52 A;  2MBB B;  2AEH A;  1Q0W B;  3M62 B;  1RLF A;  1AAR A;  3BWU D;  4YSY B;  5HHD G;  2ZPN A;  2KLG A;  2DYO A;  3OWE B;  4AOF A;  4EKU A;  3TBL D;  3M3J A;  1MG4 A;  5DPR A;  2H88 B;  1V6E A;  3OJ4 B;  1WSP A;  1MHH E;  3AEB B;  2MRP A;  2IPK D;  1KM7 A;  3ZXV A;  3ZW3 A;  1Q5W B;  3DHI C;  2KJH B;  1YIW A;  1I4H A;  1QKZ A;  3LDZ E;  2ICI A;  2WXF A;  5IOI A;  4HCN B;  3N1X C;  2IO2 B;  3P63 A;  4ITK A;  4UDU C;  3OLM D;  1V80 A;  1WX7 A;  4DXF A;  1FPY A;  2ASQ A;  4E3C A;  3Q3J A;  3ETR A;  3VR8 B;  1C4C A;  4LNO A;  1E7V A;  3B9J A;  2QMT A;  4YTN B;  2KX3 A;  1ISN A;  1WXM A;  2BWF A;  2KHW B;  5TSS A;  1HE8 A;  2J0J A;  2N9K A;  2DZJ A;  4JGH B;  1YJI A;  3IAM 1;  5BMH A;  1KTK A;  1E10 A;  2A4Z A;  2KMC A;  1T0Y A;  3Q3F A;  3UIO B;  3ZDM C;  4BAX A;  2O6V D;  2WU5 B;  2GBM A;  4W9H A;  3DCG A;  4WWN A;  3C19 A;  3ZUN A;  3CSF A;  3TL5 A;  2G45 B;  2K3U A;  3PSE B;  2KT7 A;  2GBJ A;  3VVW B;  2L3Z A;  3ZDT A;  2J0K A;  1JWA D;  1L0V B;  3W9C B;  1DGJ A;  4XE0 A;  3QAQ A;  2FBW B;  3DDC B;  1WJ6 A;  2INC C;  3DHH C;  1I42 A;  1SJE D;  2PIA A;  2KLC A;  2AQ1 B;  2PTL A;  2R2O A;  1WX9 A;  3VDZ A;  4W9E A;  4NNJ B;  2PW9 A;  3Q8B A;  4BKS A;  2RDB C;  3P42 A;  4ZHO A;  4MSM B;  2KWC A;  1WZ0 A;  5G5G A;  1KRH A;  1J0G A;  1EUV B;  3QQ8 B;  1ROE A;  2WXH A;  3OG5 A;  1YQB A;  2LGY A;  4AS1 A;  2MA9 B;  3B2F A;  4US9 A;  1IGC A;  3TUO A;  2D10 A;  1ZXI A;  3IT6 B;  4Q2J A;  3SFD B;  3A9J A;  4NAM A;  1I4G A;  3U7Z A;  3AU4 A;  1C78 A;  2QEJ C;  2ZW1 A;  4YT0 B;  4FAD A;  2OHF A;  4FA6 A;  3I63 C;  1AW7 A;  2M4N A;  5E6P A;  2KX0 A;  3RMK C;  2N9X A;  5FKA C;  2KKC A;  2MBE A;  4W9D A;  4A8X C;  1SB3 C;  1Z5S B;  1SGH A;  1PGB A;  4XYC A;  2DBY A;  3W1S C;  4E74 A;  1I4R A;  1MG8 A;  1FFU A;  1F2R I;  3BVM A;  2EMT A;  4FUL A;  2D5G A;  4HKZ E;  2NBV B;  4WWP A;  2AL6 A;  1I4Q A;  2PE9 A;  1GB1 A;  1UBQ A;  4IG7 B;  4BKG A;  1TTN A;  1WM3 A;  1VDV A;  1N5W A;  3BZD B;  1Q10 A;  2LGD A;  3KQ4 A;  2KN5 A;  4OVU A;  1EWC A;  2WS3 B;  3E9S A;  3AXC A;  1ZW7 A;  1GPX A;  4EZL A;  2LUM A;  1LGR A;  1GC7 A;  3SEB A;  1V1P A;  3AE2 B;  4A90 A;  1KF6 B;  4ANV A;  4YSZ B;  1MHX A;  4G0N B;  2K9X A;  4P7I A;  2JZ3 B;  3ZNI D;  2K6D B;  2JX5 A;  4TQ0 A;  1ZKH A;  2CJN A;  5JZE B;  4NQL B;  3IG3 A;  3ZXR A;  1XT9 B;  2HE7 A;  2JYE A;  5GMV A;  4A55 A;  2G4D B;  3KWV A;  4HPM B;  2CHW A;  2W55 A;  3EA6 A;  2KAN A;  5GXG B;  1UNS A;  2AL3 A;  2IY0 B;  2VZK B;  2D3C A;  3ONS A;  2W54 A;  3RCZ A;  1U4A A;  2KMM A;  4IOI E;  2LJ5 A;  4FJY A;  5AZF A;  1QIL A;  1YX6 B;  2JPH A;  2Q5W D;  4OZB A;  4GMV A;  2KQ7 A;  3ALB A;  3QIJ A;  2N9E B;  2CKH B;  2XN9 C;  4LDT B;  1L2N A;  4IKG A;  1SIF A;  1VR9 A;  1ZXH A;  3PRP B;  2JQR B;  4S17 A;  1TKE A;  1OGW A;  4MJS A;  2HTM E;  4E71 A;  1JAL A;  4C80 A;  3VUW A;  5J17 A;  4WAA A;  1T6B X;  2LD9 A;  4RM9 A;  2KDI A;  2FCS A;  1L4D B;  4XZ4 A;  1J7C A;  4KSL C;  2J42 A;  4BOS C;  3ZRF A;  5JHA A;  5CHW A;  5EE3 A;  2IO3 B;  1WJU A;  1Y56 A;  2FCQ A;  3GB1 A;  2LZ6 A;  4H2A A;  2O6V A;  5FR6 A;  2WYQ A;  4TUU A;  3QWZ B;  1TBE A;  2HTH A;  2GB1 A;  2BS4 B;  2FNJ B;  5JHB A;  2MJ3 A;  1Y8R C;  4NPN A;  3L16 A;  3R2T A;  5CHV C;  1TKY A;  1WGR A;  3IBE A;  3OAW A;  4ICU A;  4II3 B;  2X8X X;  1TY2 A;  4WQO B;  2KWU B;  4LNF A;  1UEL A;  2MWS B;  3B0A A;  2LEK A;  3VUX A;  1VCB A;  2M19 A;  2JRI B;  3H7S A;  1PDX A;  1V1P B;  1ZGU B;  4HEA 1;  3TEY A;  4LJP B;  3U52 E;  2J7Q B;  1B1Z A;  2J52 A;  3NUH B;  3U30 A;  3DWM A;  1E6E B;  3I9V 1;  1LO5 D;  1MI0 A;  3HM6 X;  5D6J B;  4W9G A;  3NJT A;  3DHG C;  2N1W A;  1V8C A;  1K53 A;  3PZD A;  4HK2 A;  1FFV A;  4HCP B;  5CX3 A;  1N6Z A;  4M02 A;  2GBK A;  1JWU D;  1SXT A;  2DEN B;  1WRI A;  1WH3 A;  4RNA A;  1YX5 B;  4EZJ A;  3ZJT A;  4NAW A;  3NZS A;  3RUL A;  1JCK B;  1YJJ A;  2JY6 A;  1C3T A;  1WGG A;  4ARC A;  3SU8 X;  4QAY A;  3E56 A;  5BYR A;  1WXQ A;  2FUG 1;  3V6E B;  3EFC A;  2BKR B;  4AWJ A;  1R4M B;  2D11 A;  4MM3 B;  2CHZ A;  2EMS A;  1I35 A;  1IBX A;  2IDY A;  2K5P A;  2BS2 B;  3RNF C;  3A9K B;  3QAR A;  3EHV A;  2LJI A;  5EDS A;  3FKY A;  4BBN F;  3CST A;  4N9F 4;  4ANU A;  2Y3A A;  3DVN V;  4BBN C;  2L32 A;  2ZNV C;  1WWT A;  3RNB C;  4BOZ B;  2ZZP B;  4YXD B;  4FBJ B;  2WHI A;  2UU7 A;  1ET9 A;  1LQB A;  4B6W A;  4XDC A;  3A1Q B;  3ZLZ A;  4IWO A;  1VRA B;  3NVZ A;  5EE1 A;  1GG3 A;  4WJO A;  1VZ7 A;  4JX1 C;  1JWM D;  2RGF A;  4ZRP A;  1YOV B;  2J0M A;  1R7S A;  3W1S A;  3L4P A;  2GMI C;  3DVG Y;  1FXT B;  1ZE3 D;  5D3I B;  2CU1 A;  5L83 A;  2NTS A;  2KDM A;  3H8H A;  1T0Q C;  3ZTC A;  3TIX A;  2CS4 A;  4C00 A;  4LTU A;  1JWS D;  3A4R A;  2KVZ A;  1MJD A;  1B9R A;  1GOZ A;  5HFY A;  1TIF A;  2M8S A;  2G4S A;  1J19 A;  1WI0 A;  1GNU A;  1ZOY B;  5LLI A;  3TSS A;  2VH2 A;  2KD0 A;  1WE7 A;  2WQY B;  4WJN A;  2EKI A;  4A3P A;  1D5Z C;  1NEK B;  5BYS A;  2VH1 A;  3NVW A;  2DYB A;  3RNG C;  2V3S A;  1C4A A;  1L6V A;  1WGY A;  1YNT E;  5IN7 A;  4DXA B;  3R2I A;  3VRA B;  3VTW A;  2KN4 A;  2LXA A;  1WMH A;  3DVG X;  4FHK A;  2KJ6 A;  2LI5 A;  4M0W B;  5BYQ A;  3I5J C;  5LXI B;  3N1Z C;  2RSU A;  1WZ3 A;  3VH4 B;  3RN9 C;  1GAQ B;  4KZC A;  3KWL A;  2MJD A;  2IO0 B;  2JRH A;  2N4F A;  2KDE B;  3N1Y C;  1KLV A;  1T0R C;  3FIL B;  3Q2A C;  3L10 B;  2K1F A;  4ACF A;  4GDK A;  1ACC A;  2ZW0 A;  3SR6 A;  2MHJ A;  3IAS 1;  4A3O A;  3HVZ A;  1YN4 A;  4CHK A;  3ECI A;  2AX5 A;  1ZDV A;  4I6P A;  2BW2 A;  2V1Y A;  2JXT A;  4KGR A;  3Q8E A;  4URK A;  3VR9 B;  3V61 A;  2DLB A;  1J8C A;  4WH4 A;  4N58 A;  3P4Q B;  4K7S A;  4MH8 A;  1E8Z A;  3DPD A;  4GDL A;  3VFK A;  4CQN A;  3Q3O C;  3R7Q A;  4G11 A;  1EM7 A;  2BBC A;  1EF1 A;  4KVG B;  1F9J A;  4TQ1 A;  4RM8 A;  3R66 C;  2YEP F;  3WIM A;  3PRM B;  2IND C;  3AEC B;  2BGF A;  4AUQ C;  3DBR B;  3S2A A;  2BF8 B;  4AQ7 A;  3KLS X;  3JSV A;  2I1K A;  2I1J A;  2D07 B;  3UF8 A;  4GGQ A;  2WXJ A;  1QOF A;  3AE9 B;  1F77 A;  1HZ5 A;  2LRW A;  1E8W A;  2H89 B;  2WXN A;  3UGB B;  1EU4 A;  2UWQ A;  3Q14 C;  3C8Y A;  2JXX A;  2KYW A;  4GOC A;  1SE3 A;  1S3S G;  1R4M I;  1V1O A;  3MHS D;  2W3R A;  4N6E B;  3RYT A;  4DHJ D;  1OTR B;  2WXP A;  4LLG M;  1L5P A;  1L0Y B;  2PMV A;  4AP4 C;  4KGS A;  3ZJV A;  2KTR A;  4ANW A;  2SAK A;  4HVB A;  1L7Y A;  4C7Z A;  3KUD B;  3J9C A;  4WAF A;  1VZ6 A;  1H8C A;  1V5T A;  1K8R B;  4PK1 A;  4RCO A;  3X0W A;  1MPE A;  1YQ3 B;  3RZF A;  2WGS A;  1QLB B;  3AUL A;  3EC8 A;  3N3K B;  2Y5C A;  4K81 A;  5J2R A;  2MSE D;  1I7H A;  2JWZ A;  1JWB D;  2WXI A;  4LNI A;  4MH0 E;  4HXD A;  1T3Q A;  2FAZ A;  2MLB A;  2QHO A;  3PRE A;  1WMH B;  3AE3 B;  4YSX B;  1RFA A;  3ZNZ B;  3TCA A;  1J7A A;  3AE6 B;  1ET6 A;  1TS5 A;  1X1M A;  1A70 A;  4W9I A;  3ZVV A;  4II2 B;  5E6O A;  1RRB A;  3IXS A;  2SEB D;  2K25 A;  3LXF A;  3MJW A;  4A9A A;  2V3P A;  2NBU A;  2INP E;  4GDK B;  1FXA A;  3ZGZ A;  2N7E A;  3TEX A;  1PFD A;  1XLQ A;  3WAM A;  4YTM B;  2ON8 A;  4IWQ A;  2WLB A;  5DPS A;  3PHX B;  1E90 A;  3B1L X;  2KO3 A;  2PEA A;  1N63 A;  2Y5B B;  5IO9 A;  4NZL B;  3ZNG C;  4JLC A;  1SIJ A;  4M8M A;  3EGR A;  4GLS C;  4HLE A;  5JH5 C;  1T0S C;  3P4S B;  1I4P A;  4MEM A;  4BVU C;  4HPP A;  2MJE A;  2PVG C;  3IVF A;  2QC8 A;  2KDF B;  3NVY A;  1PYW D;  3QCA A;  4L2Y A;  2QSD A;  2L8J A;  2KQS A;  3U7D A;  3UI3 A;  3NHE B;  4ASW C;  2R2Q A;  1DYQ A;  4C4V A;  3L08 A;  4KX6 B;  4IDI A;  2G9H D;  4FN2 A;  4OVV A;  4GIV A;  4WWO A;  4B0E A;  3BK2 A;  5T8I A;  4EE2 A;  3JVZ X;  2L7R A;  2KK8 A;  4NJ7 A;  3I57 A;  2MBH A;  2WXR A;  1SBB B;  4US8 A;  4L1B A;  2O2V A;  3CWI A;  1LFD A;  4KZ0 A;  4HKQ A;  1RYJ A;  2OED A;  1FNU A;  2KFK A;  4ZRI A;  1M4V A;  4C56 C;  1WR1 A;  1HTQ A;  3NG0 A;  1OQY A;  2BKF A;  1WY8 A;  2C7H A;  2ONQ A;  1ZP0 B;  1UH6 A;  2N7J A;  1E7P B;  1FMA D;  5HI1 A;  4G50 A;  3PPA A;  4HPL B;  2HJ1 A;  4P1C C;  3AH7 A;  3NOB A;  3SFE B;  4X57 B;  5DPW A;  1WJN A;  5BMG A;  3JYU A;  2G1E A;  3KW5 B;  1C9F A;  1WFY A;  4C7Y A;  2LHE A;  1SJH D;  2WXO A;  3Q3M C;  3VAW A;  5BO4 B;  3D32 A;  4FJZ A;  4B95 A;  1D3Z A;  4IC7 B;  2AQ3 B;  2DNF A;  3OJ3 A;  1YJ1 A;  4HRO A;  4JPS A;  4ZOH C;  5MPO A;  2KTF A;  2DZI A;  3A9J B;  1IPG A;  4IWP A;  3IT4 B;  3NY5 A;  2JSV X;  3TEW A;  1WGD A;  3DBR I;  2LHD A;  1VJK A;  2N9P C;  3B2G A;  1PQS A;  4J6I A;  3N30 A;  3Q69 A;  2LVP A;  3ZIM A;  4NQK E;  3C0R B;  2RPQ A;  2NPT A;  2V0G A;  4YTP B;  1NEN B;  3KYC D;  4OZC A;  3TJP A;  1XCT L;  5C1Z A;  3WAO A;  4ANX A;  3PGE A;  1GUA B;  3L0W B;  2BS3 B;  3T3O A;  1XCQ L;  3P2B A;  2L83 A;  4R3D A;  2BPS A;  3P4R B;  1WE6 A;  3Q6B A;  4W9L A;  1QOB A;  4PS8 A;  4S0R A;  2HD5 B;  2A5U A;  1CZP A;  1UUP A;  3I3T B;  2ACZ B;  1E8X A;  1CMX B;  5D2M B;  4MT5 A;  1E5W A;  4K7U A;  2KZR A;  2M0X A;  2J53 A;  2MP2 A;  3ZTD A;  1P7F A;  2L00 B;  2O2V B;  2QIE B;  3R3M A;  1C4P A;  5AUI A;  3HK0 A;  5FK9 C;  2LGX A;  2WDV B;  4XDD A;  4P16 A;  2VRR B;  3V62 A;  4USA A;  1XLP A;  1V9J A;  2IBI B;  2REX A;  3FAH A;  2ZEQ A;  5KHO A;  4AJY B;  3O13 A;  1SE2 A;  2CR5 A;  2XK5 A;  3ML9 A;  4HJK A;  1P98 A;  3BII D;  4RGO S;  4JE3 B;  5IKC M;  1N5X A;  2N9L A;  1BUI C;  2DZM A;  4MSQ B;  2JVC A;  1TZ1 A;  2L76 A;  3PZ8 A;  1STE A;  3U8Z A;  1EU3 A;  2BYT A;  3SHQ A;  4HDQ A;  2CU3 A;  4WJP A;  4EFO A;  3EEC A;  2LGI A;  3W5U B;  1V5O A;  3AE1 B;  3AV8 A;  4TMA B;  2WWZ A;  2FUH B;  3BVG A;  4MJS B;  5C23 A;  4OW0 A;  2DZK A;  3H1U A;  2NTT A;  3B08 A;  2XNA C;  1XQQ A;  3QX1 A;  2RD0 A;  3GE3 C;  4MEL A;  1SE4 A;  2KC2 A;  4XWT A;  3VTV A;  1YD8 U;  2INN E;  2JUO A;  4M00 A;  4TV3 A;  5AZG A;  2O6V B;  2KWV B;  1P1A A;  4DHJ B;  3AEG B;  1L4Z B;  2N1V A;  2LFI A;  2M0A A;  1RAX A;  2DYM A;  3AB5 A;  4TSS A;  1Q1O A;  2WXG A;  4OHJ A;  4BZA A;  4GXB A;  3APD A;  2LUE A;  4DDG D;  1L6U A;  3PVL A;  2WNM A;  3IFW B;  5E6J A;  1SSN A;  2JYT A;  1TKG A;  2L52 A;  2QJL A;  1UGJ A;  4XGA B;  3PHW B;  3APC A;  4DXG A;  4J3O D;  3VTU A;  3BYT B;  1TS3 A;  2MEK A;  1XD3 B;  5D94 A;  4B9K A;  2KOX A;  1MFW A;  1TGZ B;  2GBN A;  1RWS A;  2ZPY A;  4RF1 A;  1WYW B;  2Z8L A;  4P6V F;  2MX2 A;  2AQ2 B;  3VUY A;  2L1A A;  2MP2 B;  4DHZ B;  3PLV A;  1J7B A;  1D5M C;  3WAL A;  4MGI E;  2MBO A;  3V3X A;  5I4D A;  1LXD A;  3DQV A;  3ZJU A;  1EF5 A;  2KC1 A;  1WM2 A;  4FLH A;  3GZN B;  2BVC A;  1A5R A;  2LRU A;  1WXA A;  3QHT A;  2ZJD A;  5LNK 1;  4NAW B;  3V6C B;  4F8C B;  3RNE C;  1NI2 A;  4W9F A;  1N62 A;  2C60 A;  5AUK A;  2XK5 B;  1OQR A;  3APF A;  2DWQ A;  1HZ6 A;  1E9M A;  4P1B C;  3JW0 X;  1D4B A;  3TMP B;  2TSS A;  4M01 A;  3VH3 B;  1C77 A;  1BXT A;  2JT4 B;  3RD2 A;  1EWY C;  4IUM B;  3DVN U;  1IBX B;  2V4L A;  1V2Y A;  4WJQ A;  3RNC C;  4KKI A;  3R7R A;  1QOG A;  1P9D U;  2PE6 B;  3A4S C;  1VD2 A;  3FC4 A;  2JZZ A;  2FCN A;  1FRR A;  1BML C;  2WX0 A;  2V4I B;  1EO6 A;  2KXJ A;  5HKH A;  3DBL I;  4DK5 A;  2KFJ A;  3GE8 C;  2K6Q A;  2OJW A;  2FIF A;  4F1S A;  5G55 A;  1V97 A;  4IM2 A;  5AEK B;  1TY0 A;  3H7P A;  3MJ5 A;  1CQV A;  1HTO A;  2V3N A;  3DBS A;  2FCM A;  4O1N A;  2D2Q A;  1UZX B;  3MC0 B;  4HDO A;  5CHF A;  1XF5 L;  2LXC A;  5TR5 A;  4ZYS A;  3WAN A;  1UWM A;  2WXQ A;  2ZCB A;  2DAF A;  4RF0 A;  1KJT A;  5KHQ A;  1FRD A;  1P3Q U;  1R4N B;  4EUT A;  1F52 A;  1OFF A;  2BYV E;  1NDD A;  3AE4 B;  4IW0 A;  2WXM A;  1S1Q B;  4K3C A;  1FCC C;  4M8N A;  3RPF C;  4JIO U;  1E0Z A;  2ZVO A;  1Z2M A;  4KDI C;  2M17 A;  2LWP A;  4B0M A;  3BIN A;  5FR3 A;  2RDH A;  4KV2 A;  1TT5 B;  1L0X B;  1VLB A;  3P1M A;  4W9J A;  1TJE A;  1F2R C;  1JRO A;  4F7Z A;  1HA5 A;  2W9N A;  3GP7 A;  4I6N B;  3PRZ A;  3PT2 B;  1WJ4 A;  2YLM A;  3RT3 B;  3ZNH B;  2BYE A;  4ZYN A;  3LJ3 A;  4PS7 A;  3KUZ A;  4FHJ A;  2DAJ A;  1ZUD 2;  1KFY B;  2BT6 A;  4HJG E;  5IAA C;  1LM8 B;  2M56 B;  1QOA A;  4IM0 A;  5EE0 A;  4AJW A;  3T9L A;  4A6Q A;  3RZW C;  3HM3 A;  2WDQ B;  1QQR A;  2PKO A;  2PVO D;  1MVK A;  1GB4 A;  1V49 A;  5DCN A;  2M1M A;  4EZK A;  2RMM A;  3BYY B;  1DOY A;  2WDT B;  1ZPS A;  3IHP C;  3AE8 B;  3M95 A;  1FNW A;  3AED B;  1TS4 A;  3MC8 A;  1XEE A;  3QJZ A;  2QIL A;  2BB6 A;  2G3Q B;  2HJ8 A;  5E6N A;  1QT9 A;  1FNV A;  3PO0 A;  4K7W A;  4RGM A;  2PJH A;  3DOW A;  2NCN A;  2IGD A;  2WXK A;  4WQM A;  4JQW C;  1ESF A;  4LJO B;  2RPV A;  3H9D A;  2V9H A;  4K3B A;  2IGH A;  3HRD D;  3NVV A;  3QA8 A;  4DHZ E;  3ENE A;  4N59 A;  4JWU C;  1OEY J;  1AN8 A;  3MTN B;  4DQO C;  1TS2 A;  5AZH A;  1GC6 A;  1JRP A;  1H4R A;  3DBH I;  3V60 A;  2KVR A;  5C2T B;  5LXH A;  3PV1 A;  3Q8C A;  1ZDX A;  1NYQ A;  2ZCC A;  2EKE C;  4DBG A;  3MP9 A;  3H7P B;  4TKN A;  5G2N A;  4ZHP A;  4GDL B;  2KAC A;  3KH0 A;  1YQ4 B;  3AN1 A;  4ARI A;  3ABV B;  2HDE A;  4WWM A;  2K22 A;  3W1Y A;  2D3B A;  3UQA A;  1WXV A;  2LVO A;  1WF9 A;  3BY4 B;  3GZN I;  1TYG B;  2K0P A;  3R8B A;  2JZP A;  1XLN A;  3ZRC A;  4LNK A;  3JSV B;  1WGK A;  3RI7 C;  4ZDV A;  1WGH A;  3MHZ A;  1FEH A;  3PZ7 A;  1WRD B;  4ZRJ A;  3L17 A;  4EOY A;  2UYZ B;  3HUI A;  4PYZ A;  1SEB D;  1PGX A;  3ZKJ C;  1C79 A;  1P0R A;  1JW9 D;  1N61 A;  3WA0 A;  1NYR A;  4CYE A;  1IUE A;  2KTR B;  3NRZ A;  1D5X C;  3W2D A;  4DDI D;  5D7G A;  4JL9 A;  3Q8A A;  4NJC A;  4XX5 A;  2IYD B;  1WYG A;  2MBQ A;  3QC8 B;  1T5X D;  2Z0D B;  1NVI D;  3GS2 A;  4OZA A;  1FCL A;  1YN5 A;  4WUR A;  4RH6 A;  4GN1 A;  3VHT C;  1QZE A;  3H6N A;  4YWG G;  2FID A;  2KNB A;  4GSW A;  4KGT A;  4KIK A;  1FD6 A;  1RM6 C;  4PYU A;  3UQB A;  1JML A;  2NR2 A;  3AM9 A;  2L05 A;  3VRB B;  5H92 C;  4RFB A;  2I38 A;  3NZU A;  1CJE A;  4MM3 A;  2DX5 B;  2JWU A;  4MDK E;  1R4N I;  2IZV B;  1AWD A;  2CJO A;  3RNA C;  4GB9 A;  3U2S C;  3U4E G;  3P4P B;  1I4X A;  1NBF C;  3LB8 C;  3A9K A;  1CK1 A;  1M94 A;  1FXI A;  1WXS A;  1KLG D;  2B76 B;  2KWD A;  1DOX A;  4YL8 A;  5C3J B;  5HG2 A;  1KLU D;  3AI5 A;  1TZO A;  2KMA A;  1XXG A;  2BYF A;  4NJ6 A;  2K39 A;  1RFK A;  1HEZ E;  1OQQ A;  2ZNV B;  2MCN B;  2NVU I;  5J18 A;  4MGZ E;  2K8H A;  1F1H A;  3HVD A;  4PS3 A;  3PS6 A;  4BFR A;  3AEE B;  2Z59 B;  4FXC A;  1UBI A;  3A1Q A;  3O65 B;  2Y5P A;  3L54 A;  3EUB 2;  2C7M B;  3HHM A;  4ICV A;  1JRU A;  2BQQ A;  3UIP B;  3ZYY X;  3NZ3 A;  2WP9 B;  4C4V B;  2LMC A;  1YN3 A;  3M63 B;  2RDG A;  3DBL B;  3K9P B;  3AU5 A;  2CHX A;  3KVF B;  4I6L B;  2IY1 B;  2L0T A;  2WX1 A;  2ZVN A;  2XBB C;  4ZRK A;  4LCD E;  4KDL B;  4RGT A;  5EE9 A;  1P7E A;  1ENF A;  2IJ0 A;  3W5V B;  3V05 A;  1UD7 A;  1IGD A;  2L0F A;  3RFZ B;  2K8C A;  2D3A A;  3HIZ A;  1JQ4 A;  2KFK B;  3N20 C;  1GJZ A;  1K51 A;  1UWX A;  2OJR A;  1PGA A;  3DWG C;  4EEW A;  2I2Y A;  2WXL A;  4KSK C;  3CIR B;  4RMA A;  2AYO B;  1UF0 A;  3N32 A;  1E8Y A;  3A33 B;  4NY0 A;  2IO1 B;  3AEF B;  1HQR D;  3BK1 A;  3X23 A;  3SDL C;  2GRI A;  2R61 A;  2J4X A;  1F0Z A;  5G5H A;  1G6J A;  1C1Y B;  3AEA B;  1BT0 A;  2MQJ A;  2N0S B;  3WCQ A;  4IM3 A;  4KIK B;  2N7D A;  2E6X A;  3CF6 E;  4KKJ A;  1DOI A;  1E7U A;  3KUC B;  2FE8 A;  2GLS A;  1D6E C;  4M0W A;  5L95 C;  4HWI B;  3PLU A;  2GBR A;  3WAP A;  2KDB A;  5IA7 A;  1IP9 A;  4L23 A;  5BMI A;  3URY A;  3ZO5 B;  2K8B A;  1WR6 E;  1HXY D;  1OEY A;  1VZ8 A; 
#chains in the Genus database with same CATH homology
 5H8Y E;  1TKE A;  2V3P A;  3FIL A;  2HTM E;  4HRS A;  2INP E;  1FRR A;  1JAL A;  4GDK B;  1FXA A;  3LYY A;  1BML C;  1FM0 D;  2KQ4 X;  3ZGZ A;  3TEX A;  4C80 A;  1PFD A;  2MH7 A;  1XLQ A;  2V4I B;  1C76 A;  3Q8F A;  3AE5 B;  1T6B X;  1PUT A;  2EEL A;  5JXV A;  1L4D B;  4YTM B;  1J7C A;  2ON8 A;  2J42 A;  2WLB A;  1V97 A;  4OVZ A;  5EE3 A;  4XWW A;  1TY0 A;  1Y56 A;  3MJ5 A;  1CQV A;  3GB1 A;  4H2A A;  2VZK D;  2W82 A;  2V3N A;  1N63 A;  2GB1 A;  4NZL B;  2BS4 B;  2PLP A;  4O1N A;  1SIJ A;  2MJ3 A;  3MC0 B;  4MAC A;  1XF5 L;  2NMQ A;  4ZYS A;  3EGR A;  4GLS C;  3R2T A;  3AE7 B;  1UWM A;  1I4P A;  2WXQ A;  3P4S B;  2JU6 X;  1QF6 A;  1TKY A;  1AYF A;  4RF0 A;  2MJE A;  2PVG C;  1FRD A;  1OFF A;  3NVY A;  1PYW D;  3AE4 B;  1TY2 A;  4L2Y A;  2QSD A;  2WXM A;  3UI3 A;  1FCC C;  3RPF C;  1DYQ A;  1E0Z A;  2YEP B;  4KX6 B;  4IDI A;  2G9H D;  4B0E A;  1YMH E;  3BK2 A;  2LEK A;  5T8I A;  4EE2 A;  4LK0 M;  4REZ A;  1XLO A;  4B0M A;  1N60 A;  2M19 A;  3I57 A;  2IGG A;  3NS1 A;  5FR3 A;  2WXR A;  2RDH A;  1SBB B;  1L0X B;  4US8 A;  1VLB A;  3P1M A;  4L1B A;  5D3D A;  1PDX A;  1TJE A;  1V1P B;  1F2R C;  1JRO A;  4HEA 1;  3TEY A;  3U52 E;  2X38 A;  3CWI A;  1B1Z A;  2J52 A;  1HA5 A;  3NUH B;  3DWM A;  3GP7 A;  2WU2 B;  4HKQ A;  1RYJ A;  1E6E B;  3I9V 1;  1LO5 D;  1MI0 A;  2GI9 A;  2OED A;  3MFG A;  1FNU A;  1K50 A;  4WIP A;  1ZUD 2;  3T3N A;  3N9Y C;  1KFY B;  2BT6 A;  4HJG E;  2M56 B;  2W3S A;  1QOA A;  1V8C A;  1M4V A;  4C56 C;  1K53 A;  5EE0 A;  1XO3 A;  1FFV A;  4PT5 A;  2WDR B;  2BB5 A;  4A6Q A;  2WDQ B;  1QQR A;  2PKO A;  2PVO D;  1NI3 A;  1MVK A;  1GB4 A;  2ONQ A;  1ZP0 B;  1JWU D;  2N7J A;  1E7P B;  1FMA D;  1SXT A;  5HI1 A;  1WRI A;  1FO4 A;  4D2K A;  4RNA A;  2BTE A;  2RMM A;  3BYY B;  1DOY A;  1ZPS A;  3ZJT A;  3AH7 A;  4RGN A;  3AE8 B;  3SFE B;  1FNW A;  3AED B;  1JCK B;  1YJJ A;  5BMG A;  1TS4 A;  4ARC A;  2G1E A;  1C9F A;  1XEE A;  1SF0 A;  2QIL A;  2BB6 A;  3TEZ A;  3E56 A;  5BYR A;  1WXQ A;  1QT9 A;  1KH0 A;  2FUG 1;  4C7Y A;  2LHE A;  1SJH D;  2WXO A;  1FNV A;  3PO0 A;  4MM3 B;  4RGM A;  3BVZ A;  4ZRQ A;  2IGD A;  3AMZ A;  1IBX A;  2WXK A;  3ZQ4 A;  2KAJ A;  2E3T A;  4JWS C;  3VQI A;  4WQM A;  2AQ3 B;  2IDY A;  2K5P A;  1ESF A;  2RPV A;  2BS2 B;  1FIQ A;  1K52 A;  4HRO A;  4JPS A;  4ZOH C;  2IGH A;  5MPO A;  3HRD D;  3NVV A;  3IT4 B;  3TEW A;  2JSV X;  4N59 A;  3BWU D;  4YSY B;  5HHD G;  4JWU C;  2LHD A;  1VJK A;  1AN8 A;  2DYO A;  2LJI A;  3B2G A;  3OWE B;  4DQO C;  1TS2 A;  3Q69 A;  1JRP A;  2Y3A A;  2H88 B;  2L32 A;  5C2T B;  1WWT A;  2V0G A;  3Q8C A;  1ZDX A;  1NYQ A;  4YXD B;  1WSP A;  1MHH E;  4YTP B;  3AEB B;  1NEN B;  3MP9 A;  2IPK D;  4OZC A;  1ET9 A;  4ZHP A;  4GDL B;  2KAC A;  4XDC A;  1YQ4 B;  1XCT L;  1I4H A;  1QKZ A;  1VRA B;  3NVZ A;  2ICI A;  2WXF A;  3AN1 A;  4ARI A;  5EE1 A;  3ABV B;  2HDE A;  4WWM A;  2K22 A;  1VZ7 A;  3P63 A;  4JX1 C;  1JWM D;  4ITK A;  4UDU C;  4ZRP A;  2BS3 B;  3T3O A;  1XCQ L;  1TYG B;  1R7S A;  2K0P A;  3R8B A;  3L4P A;  3W1S A;  2JZP A;  1XLN A;  4DXF A;  2L83 A;  4R3D A;  1ZE3 D;  5D3I B;  3P4R B;  1WGK A;  3ETR A;  3VR8 B;  1QOB A;  2NTS A;  1C4C A;  2KDM A;  3H8H A;  3MHZ A;  1FEH A;  3PZ7 A;  3B9J A;  1CZP A;  2QMT A;  4YTN B;  1UUP A;  4LTU A;  3HUI A;  5TSS A;  2ACZ B;  1SEB D;  1PGX A;  1JWS D;  2N9K A;  1C79 A;  1YJI A;  3IAM 1;  4MT5 A;  5BMH A;  1KTK A;  1E10 A;  1JW9 D;  1B9R A;  1N61 A;  1GOZ A;  5HFY A;  2J53 A;  1NYR A;  1P7F A;  1IUE A;  2QIE B;  3NRZ A;  1D5X C;  1ZOY B;  3W2D A;  1C4P A;  5AUI A;  3TSS A;  5FK9 C;  2WU5 B;  5D7G A;  3Q8A A;  4NJC A;  2WDV B;  2WQY B;  1WYG A;  2EKI A;  1D5Z C;  2K3U A;  1T5X D;  4XDD A;  1NVI D;  1NEK B;  5BYS A;  3GS2 A;  4P16 A;  3NVW A;  4USA A;  1XLP A;  4OZA A;  1FCL A;  1JWA D;  1C4A A;  1L6V A;  1YN5 A;  1YNT E;  3FAH A;  1L0V B;  4RH6 A;  4WUR A;  3W9C B;  3O13 A;  1DGJ A;  4XE0 A;  1SE2 A;  3R2I A;  2FBW B;  3VRA B;  4YWG G;  2KN4 A;  1SJE D;  3BII D;  4KGT A;  1FD6 A;  4RGO S;  4JE3 B;  1N5X A;  2N9L A;  1BUI C;  2PIA A;  5BYQ A;  2AQ1 B;  2PTL A;  1RM6 C;  3PZ8 A;  1STE A;  1JML A;  3AM9 A;  2PW9 A;  3VRB B;  5H92 C;  3Q8B A;  1GAQ B;  1EU3 A;  3P42 A;  4ZHO A;  4RFB A;  3KWL A;  2BYT A;  2I38 A;  5G5G A;  2MJD A;  1CJE A;  1KRH A;  2CU3 A;  2LGI A;  2JWU A;  1ROE A;  3W5U B;  2WXH A;  3AE1 B;  3AV8 A;  4TMA B;  4AS1 A;  3FIL B;  3BVG A;  1AWD A;  2CJO A;  3B2F A;  4US9 A;  1IGC A;  3U2S C;  3TUO A;  3U4E G;  3P4P B;  1I4X A;  4OW0 A;  3LB8 C;  3IT6 B;  1ZXI A;  1ACC A;  2ZW0 A;  3SR6 A;  4Q2J A;  3IAS 1;  3SFD B;  1CK1 A;  4NAM A;  1FXI A;  3HVZ A;  2NTT A;  1KLG D;  1YN4 A;  2B76 B;  1I4G A;  2KWD A;  2XNA C;  3U7Z A;  1DOX A;  2AX5 A;  1ZDV A;  1C78 A;  2QEJ C;  2ZW1 A;  4YT0 B;  5C3J B;  5HG2 A;  2OHF A;  2BW2 A;  1KLU D;  1SE4 A;  2JXT A;  1TZO A;  4KGR A;  3Q8E A;  4XWT A;  1XXG A;  1AW7 A;  3VR9 B;  2INN E;  2DLB A;  4WH4 A;  4N58 A;  5FKA C;  3P4Q B;  1RFK A;  1HEZ E;  1OQQ A;  3AEG B;  1L4Z B;  4MH8 A;  4A8X C;  2LFI A;  3HVD A;  1SB3 C;  2M0A A;  2DYM A;  1PGB A;  3AEE B;  4FXC A;  2DBY A;  4CQN A;  3AB5 A;  2Y5P A;  2WXG A;  4OHJ A;  4TSS A;  1I4R A;  1FFU A;  1EM7 A;  1F2R I;  3EUB 2;  3BVM A;  1L6U A;  2D5G A;  2BBC A;  2WNM A;  4TQ1 A;  2YEP F;  4HKZ E;  5E6J A;  3ZYY X;  1SSN A;  1I4Q A;  3NZ3 A;  2WP9 B;  1GB1 A;  3AEC B;  2JYT A;  1TKG A;  2L52 A;  1YN3 A;  2LMC A;  2RDG A;  1VDV A;  2QJL A;  1N5W A;  3BZD B;  4AQ7 A;  3KLS X;  1Q10 A;  1UGJ A;  3KQ4 A;  2WXJ A;  1QOF A;  3AE9 B;  1EWC A;  2WS3 B;  5EE9 A;  3E9S A;  4RGT A;  1F77 A;  1HZ5 A;  1P7E A;  1ENF A;  4DXG A;  1GPX A;  4J3O D;  3BYT B;  1TS3 A;  2H89 B;  2IJ0 A;  2MEK A;  2WXN A;  3W5V B;  1EU4 A;  2LUM A;  3V05 A;  3C8Y A;  3SEB A;  1V1P A;  1RWS A;  1IGD A;  1SE3 A;  2Z8L A;  3AE2 B;  4P6V F;  4RF1 A;  1KF6 B;  4A90 A;  1V1O A;  3RFZ B;  2W3R A;  4N6E B;  2AQ2 B;  4YSZ B;  1MHX A;  2L1A A;  4LLG M;  2WXP A;  1JQ4 A;  1L5P A;  1L0Y B;  2K9X A;  1K51 A;  2PMV A;  1J7B A;  1UWX A;  1D5M C;  1PGA A;  3DWG C;  4KGS A;  2I2Y A;  2WXL A;  3V3X A;  3ZJV A;  5I4D A;  2SAK A;  3CIR B;  4C7Z A;  3ZJU A;  3J9C A;  2JX5 A;  4TQ0 A;  4WAF A;  2CJN A;  1VZ6 A;  4RCO A;  1MPE A;  1YQ3 B;  1QLB B;  2JYE A;  3AEF B;  1HQR D;  4A55 A;  3KWV A;  2Y5C A;  3BK1 A;  5LNK 1;  4NAW B;  1I7H A;  2W55 A;  3EA6 A;  1JWB D;  5GXG B;  2GRI A;  2R61 A;  1UNS A;  2WXI A;  1N62 A;  5AUK A;  1OQR A;  2J4X A;  1T3Q A;  1HZ6 A;  1E9M A;  2DWQ A;  5G5H A;  1F0Z A;  3AEA B;  2N0S B;  3WCQ A;  2VZK B;  1D4B A;  2TSS A;  2W54 A;  3AE3 B;  4YSX B;  2KMM A;  2E6X A;  4KKJ A;  1C77 A;  1DOI A;  4IOI E;  1BXT A;  4M0W A;  2FE8 A;  1D6E C;  1QIL A;  1J7A A;  3AE6 B;  1ET6 A;  1TS5 A;  2Q5W D;  4OZB A;  1EWY C;  1A70 A;  1IBX B;  3IXS A;  2XN9 C;  2SEB D;  4IKG A;  4KKI A;  4L23 A;  5BMI A;  1QOG A;  3URY A;  3LXF A;  1VR9 A;  1ZXH A;  2JQR B;  4A9A A;  1HXY D;  1VZ8 A;  3FC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...