4BKTA

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
103
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bktA00
4LDTB 2KWUB 1F9JA 4WWPA 3TBLD 3PZDA 3PLUA 4FADA 1TZ1A 1WGHA 4GDLA 1SIFA 3HHMA 3JYUA 1GC7A 2JUOA 1SGHA 1XQQA 2EKEC 3DVNV 2XBBC 2JZ3B 5D94A 4CO7A 5J18A 4BFRA 3V62A 4EZLA 2O6VB 3M62B 5L95C 2KZRA 4AUQC 2DAJA 2DYMA 1XD3B 3DQVA 3MHSD 4ZRKA 5TR5A 1V5OA 1EF5A 2OJRA 1KJTA 2KC2A 4P7IA 3VH3B 1OQYA 4FHJA 1E90A 2G4DB 3AULA 1TTNA 3CMMB 4W9IA 5CTRC 4AWJA 1GC6A 1P3QU 4GIVA 3IHPC 5C1ZA 4I6PA 4LJOB 3A4SC 3AU4A 1UD7A 3RYTA 2IY1B 2LVQA 5DPRA 3PSEB 2KMAA 2LXCA 4DBGA 1WX8A 2NR2A 1WF9A 2N1WA 2UYZB 4HVBA 2GBJA 3VUYA 4EEWA 3CSTA 2PPHA 1WXAA 3PRMB 2K25A 1P98A 1L7YA 4KDLB 3NZSA 4M8MA 4HDOA 3V6EB 4MJSA 3ENEA 1I35A 4DXAB 2R2QA 2IO2B 1V2YA 3QARA 4BOSC 3B0AA 1Y8RC 1H8CA 5JZEB 5BO4B 2I1KA 4MSQB 5AZHA 1QZEA 3WAOA 4W9JA 4WWOA 3PHXB 2BKFA 1EO6A 4HXDA 2DENB 2K8BA 4AP4C 4HLEA 2LRWA 3Q3FA 1E7VA 3PS6A 1G6JA 1LQBA 2ZCBA 3VUWA 2J0KA 2D3GA 3OLMD 2G3QB 4EUTA 2PE6B 2G4SA 2KFKB 3CSFA 3ML8A 1WJ6A 3ZNZB 4NNJB 2KJRA 2ZNVC 1WZ0A 3A9JA 1UELA 3ZTCA 2CKHB 2NPTB 3PRZA 4HWIB 1E8ZA 4LDTD 3WAPA 1WXSA 1MG8A 4GSWA 4GXBA 3PV1A 3KUCB 1V80A 2M8SA 2C5LC 2LXAA 2PEAA 3LJ3A 3R3MA 4MELA 4NY0A 5KHOA 2KDFB 2DZMA 2ZVNA 4KIKA 4BKSD 4GDKB 1PQSA 4GGQA 2FCMA 4WJPA 4EZJA 2KXJA 5KHQA 3APCA 3PPAA 2NBVB 4FULA 1V5TA 2CS4A 4OVVA 3U30A 1J19A 1UZXB 2XK5B 2O6VD 1E8YA 3H7SA 1S1QB 2KX0A 3PT2B 2J0JA 4I6LB 1ZW7A 2LI5A 1KOTA 2LWPA 2MW5A 3V60A 3HM6X 1Q5WB 2NS5A 1OGWA 1I42A 3A33B 4GMVA 5AZFA 3KUZA 2KDEB 2J7QB 2L00B 2A4ZA 2WWZA 3BINA 3UF8A 3KYDD 1E8XA 1OEYJ 3L17A 1WMHB 2LVOA 2KANA 4G50A 4PS8A 4ZRJA 2EMTA 4II3B 1ZGUB 3SDLC 1WRDB 1OEYA 4LCDE 2O2VA 4KZCA 3X23A 1WH3A 3EHVA 1NI2A 4MM3A 2KMCA 1X1MA 4NQLB 2D07B 3LDZE 5LXHA 1P0RA 2BYEA 2D2QA 5D7GA 3DVGY 4K7WA 4KSLC 3ZRCA 1WGRA 4WAAA 1A5RA 2KTRA 4W9DA 3RUIB 1YQBA 4WJNA 4IW0A 3AU5A 1WJNA 2D10A 2LGXA 4RMAA 1RFAA 4ZDVA 1LM8B 1C3TA 1VCBA 2L8JA 1H4RA 4ANVA 4DWFA 2JWZA 2N4FA 3HK0A 4A20A 2MBHA 2IZVB 1EF1A 3DOWA 4HDQA 2R2OA 2YVCA 2MQJA 5J2RA 4URKA 3B08A 4II2B 4WJQA 2MBOA 1UH6A 3K9OB 2LGYA 1WJUA 3RD2A 3L10B 4HCNB 1YD8U 4K7UA 5JHBA 3WAMA 1Z2MA 4HJKA 4F1SA 3CF6E 4MSMB 3HIZA 3DBLI 2D11A 4JLCA 4J6IA 3A1QA 4ANWA 1Z5SB 2KJHB 3R7RA 1M94A 4KDIC 4W9HA 3OJ3A 4G3XB 3ZVVA 3MJWA 4EFOA 5EDSA 2JF5A 1V81A 2Y5BB 4FJYA 3L08A 3MTNB 2FNJB 3V61A 2RR9A 2ZCCA 3PVLA 1R4MI 2WX0A 2FAZA 2BPSA 1NDDA 2FIFA 2N7DA 4MGKE 2KTFA 3VHTC 2DHZA 3DPDA 3H9DA 1RRBA 4JQWC 2DZJA 4EOYA 4BBNF 5J17A 4BKTA 3DBSA 2J0MA 1WM3A 2LASA 1TGZB 2KQ7A 4ICUA 4IM2A 3UGBB 3VTUA 5AEKB 2MCNB 3A9KB 3TCAA 1S3SG 2RD0A 2GOWA 2MBBB 2N9PC 3X0WA 4BKSA 2B3AA 2KKCA 1FXTB 3T9LA 3L16A 3M3JA 1WE7A 2V4LA 4M0WB 4BKGA 1AARA 4GU2A 4JL9A 2O6VA 2MRPA 5DPSA 1YJ1A 3NZUA 1KM7A 5CHFA 5DPWA 2MP2B 2L05A 3M63B 1WGDA 3BY4B 4GN1A 2DZKA 3VQIA 1WJ4A 2CR5A 3IBEA 4IUMB 3W1YA 5G2NA 2LGDA 2Z59B 2KVRA 2MBQA 2KDBA 1V9JA 3A9KA 1YX6B 4NAWB 1WYWB 2LD9A 1V49A 3ONSA 4JIOU 1HE8A 3TJPA 4NJ6A 4PYUA 2YLMA 4IWQA 4PYZA 1CMXB 4PS7A 3S2AA 3L0WB 4I6NB 1T0YA 3ZLZA 3HM3A 2K1FA 1E5WA 4FA6A 3QA8A 1GUAB 4G0NB 4DDGD 2MP2A 4K81A 1JRUA 4KV2A 3QK0A 4B9KA 2RSUA 3EECA 4LJPB 1UGMA 3QC8B 4NPNA 4E74A 3PLVA 3T8MA 2OOBB 2V1YA 2KLGA 4MGZE 4FLHA 5G55A 1J8CA 4YL8A 2KFKA 2KNBA 2BYVE 3VTVA 3VUXA 2K8CA 4TQ1A 2IO0B 5DPTA 1GNUA 2NPTA 3RT3B 5JHAA 2JXXA 3L54A 5AZGA 2CHXA 2QHOA 3IVFA 2BGFA 2L3ZA 3M95A 4TKNA 2CHZA 3W1SA 2M0XA 3U7DA 5D2MB 2K8HA 3UIOB 4OVUA 2LZ6A 4GDKA 3QJZA 4IC7B 1Q0WB 4X57B 2PE9A 1IPGA 2XK5A 4FBJB 1J0GA 4G11A 1VD2A 3N30A 4HPLB 2KX3A 2DAFA 3ZKJC 1K8RB 4IG7B 2GBMA 4GB9A 4A3PA 4XX5A 4EKUA 2MA9B 3QHTA 3DBRI 3UQAA 2N9XA 4IWPA 1OTRB 1D3ZA 4AJYB 2ZNVB 3O65B 3H6NA 2HTHA 1WM2A 3JSVB 4F8CB 2KWVB 3SHQA 3ZNHB 5CHVC 5D6JB 3ML9A 4NJ7A 1WMHA 2HD5B 3VTWA 3VXWA 1YIWA 1GJZA 2W9NA 2WYQA 3IG3A 4E71A 2FCNA 4DDID 2M1MA 1BT0A 2IY0B 3GOEA 3QAQA 4XC2A 2UWQA 4ZRIA 3JVZX 2ZPYA 3PTFC 3RZWC 5E6OA 2MSED 4GDLB 5IAAC 2CU1A 2JRIB 2AYOB 2FUHB 1L2NA 2AEHA 5CHWA 2KWCA 2JPHA 3ZTDA 3OJ4B 3I3TB 4DHJB 5GMVA 3ZW3A 3TL5A 3IFWB 2WDTB 4IM0A 3RZFA 4MH0E 4DHZB 2FCQA 3EC8A 3UQBA 2L7RA 2KFJA 2M17A 4F7ZA 3PGEA 4ZYNA 3DVNU 5DCNA 1WZ3A 2FCSA 1V6EA 1UBQA 3QCAA 3QWZB 4ICVA 2GMIC 3ZO5B 3APFA 1P1AA 3QQ8B 2V3SA 1WGYA 3ZNGC 1LFDA 3ZDMC 4B95A 4CYEA 2IO3B 3B1LX 5LXIB 2JT4B 5L83A 2JRHA 3JW0X 4W9EA 4ANUA 4W9LA 2L0FA 4DK5A 4EZKA 3VVWB 3RCZA 3ZRFA 3A4RA 3PRPB 4ASWC 3N3KB 4IWOA 4KZ0A 2KK8A 3W1SC 4MJSB 3SU8X 1GG3A 2KD0A 3NY5A 1EUVB 2G45B 1WIAA 2REXA 2LRUA 2MLBA 2MX2A 2XEWA 1V86A 2GBNA 2JY6A 2WX1A 3N32A 1LXDA 2KC1A 3ZDTA 4NQKE 5IA7A 1WE6A 3VFKA 2N1VA 2MBEA 2ZPNA 2HE7A 2RPQA 4FHKA 2KOXA 3P2BA 4A3OA 3D32A 5E6NA 3WALA 3A9JB 3R66C 4MDKE 2IO1B 2C7NB 2BKRB 2DZIA 1UBIA 1NBFC 2N7EA 2Z0EB 3AXCA 3DBHI 3DVGX 2DYOA 4E3CA 1U4AA 1KLVA 1WFYA 4KVGB 1ZKHA 4DHZE 4KIKB 5E6PA 2ZEQA 1WX7A 1WXVA 5LLIA 4BOZB 1WGGA 2KJ6A 2C9WB 2ZZPB 1RLFA 4RM8A 4DHJD 2C60A 2KO3A 2A5UA 1YX5B 3DCGA 2I1JA 3R7QA 3NS8A 2BF8B 4NAWA 2K6DB 2M4NA 3KVFB 3K9PB 3H7PB 2HJ8A 1P9DU 2JVCA 4WWNA 4N9F4 3TMPB 4TUUA 4FJVB 1R4NI 4FN2A 2EMSA 2NVUI 1E8WA 2Z0DB 3QX1A 4WQOB 2FIDA 3NHEB 4W9CA 4TQ0A 2C7HA 3APDA 3OAWA 3UIPB 4MEMA 2L0TA 2ZJDA 4WJOA 2VRRB 2ASQA 2MWSB 3DDCB 5C23A 3NOBA 2O2VB 1XT9B 1WI0A 4AOFA 2AL6A 2DYBA 2BWFA 4CHKA 1WR1A 2AL3A 2LJ5A 1IYFA 3QIJA 2KQSA 3KYCD 5HKHA 4W9KA 3UINB 1E7UA 2N9EB 3H7PA 2KN5A 1C1YB 2KTRB 4HCPB 3WANA 2BYFA 2KDIA 3EFUA 2K6QA 3PREA 2KHWB 1WR6E 2K39A 1TBEA 4HK2A 2ZVOA 4RM9A 4HPMB 2C7MB 4KSKC 4MGIE 3WA0A 3ZUNA 4BVUC 1IP9A 2CHWA 4K1RB 1WXMA 2AWTA 3RULA 4GOCA 4MGYE 4K7SA 1Q1OA 2IBIB 3SD5A 5JH5C 3WIMA 3ZIMA 3VDZA 2RGFA 4IM3A 2NBWB 4TV3A 2LUEA 3V6CB 3U8ZA 3TIXA 4BBNC 3ECIA 3GZNI 5CX3A 3KW5B 3KH0A 4PS3A 4AJWA 4M8NA 3Q3JA 3AI5A 2LVPA 2GBKA 2JZZA 4W9FA 2NCNA 3L13A 1WY8A 3VH4B 3ALBA 3A1QB 3PHWB 2PJHA 3VAWA 4ANXA 3KUDB 1WX9A 2GBRA 4B6WA 2IYDB 2KLCA 3JSVA 4FJZA 3ZNID 3H1UA 1ISNA 1RAXA 4XZ4A 2NBUA 5FR6A 2BWES 2DX5B 4JGHB 1SE9A 2L76A 3C0RB 4W9GA
chains in the Genus database with same CATH superfamily
1F9JA 2WS3B 4WWPA 5FK9C 3SEBA 4PK1A 1E6EB 5G5HA 1TZ1A 4ACFA 4GDLA 4N59A 3AEGB 3M62B 2KZRA 2J4XA 3MHZA 2DYMA 5TR5A 1XD3B 3RN9C 1E0ZA 4ZRKA 1EF5A 2OJRA 1KJTA 4FHJA 1TTNA 3AH7A 4GIVA 1VRAB 1QILA 2FBWB 3A4SC 2IGGA 1ESFA 3AU4A 1TKGA 1WX8A 4EEWA 1V1PA 2IGHA 3AE7B 1L7YA 1T0QC 2WXHA 1H8CA 4KGRA 2I1KA 4HKZE 3RNEC 4WWOA 3IT6B 1EO6A 4HXDA 3TEXA 2DENB 1C4PA 1G6JA 3VUWA 2D3GA 3FAHA 3AMZA 3CSFA 1WJ6A 2BB6A 2ZNVC 1F52A 1MG8A 4GSWA 4GXBA 3PV1A 3RNBC 3Q8FA 2PEAA 3LJ3A 2V0GA 2DZMA 4KIKA 2CU3A 1PQSA 3U4EG 2KXJA 4FULA 2AQ1B 4RH6A 3H7SA 2J0JA 1ZW7A 2LWPA 3GE3C 3V60A 1Q5WB 1K53A 4C4VB 2MJ3A 1OGWA 1F2RI 3HVZA 1AW7A 5AZFA 1ROEA 2WWZA 3L17A 4MACA 4PS8A 2EMTA 1JWAD 4II3B 1OEYA 3X23A 4DQOC 1WH3A 1WYGA 3ZRCA 5D7GA 4K7WA 1OQQA 1WGRA 2NTSA 1L4DB 2KTRA 4W9DA 1YQBA 1QT9A 3AU5A 4P16A 1FPYA 4RMAA 2K3UA 1C3TA 4ANVA 2YVCA 5J2RA 4URKA 3P4QB 4II2B 1T5XD 4WJQA 3Q6BA 3RD2A 1YD8U 2W3SA 1STEA 1FFUA 5JHBA 1JQ4A 4TMAB 3CF6E 2MJEA 4MSMB 2LUMA 5BMHA 4J6IA 3A1QA 1Z5SB 3R7RA 3ZVVA 2D3CA 2BQQA 2Y5BB 2D3AA 3L08A 5JXVA 2RR9A 1R4MI 1DYQA 4MGKE 4EOYA 1JROA 4BBNF 4BKTA 5AEKB 1N5XA 2LASA 4IM2A 1SF0A 4ICUA 3VTUA 3BWUD 1VR9A 1F1HA 1QKZA 2RD0A 2B3AA 3AB5A 3ZJUA 1RYJA 2V4LA 1GB1A 4GU2A 2MRPA 4XGAB 3GE8C 2L05A 1TT5B 4GN1A 2DZKA 3TEZA 4OZBA 2KDMA 1XLNA 2KDBA 1WYWB 4NJ6A 4PYUA 2YLMA 1YNTE 2W3RA 2HTME 1T0YA 2D5GA 4FA6A 3QA8A 1GUAB 3GZNB 2MP2A 3IAS1 5EE3A 4C7YA 2QCZA 2QMTA 1J7BA 4LJPB 3QC8B 2KYWA 1D6EC 2KLGA 2V3PA 4YL8A 1HZ6A 1NVID 2K0PA 1NYRA 3VTVA 2HDEA 4TQ1A 5BYRA 5JHAA 2JXXA 3L54A 1FM0D 3M95A 2INNE 4YSYB 4OVUA 1C78A 1OFFA 2DLBA 4GDKA 4IC7B 2PE9A 1ZUD2 4FBJB 4G11A 3N30A 1P7FA 2KX3A 3ZKJC 4XWTA 1K8RB 4GB9A 4XX5A 1SE2A 3QHTA 4IWPA 4RF0A 1D3ZA 4F8CB 3O65B 2HTHA 1WM2A 3MC0B 1WMHA 4DXGA 2W9NA 2WYQA 1C76A 3IG3A 4E71A 1N6ZA 5IAAC 2FUHB 2JZPA 2KWCA 2JPHA 2RDGA 3ZTDA 5GMVA 1VDVA 4MH0E 1FXIA 1XEEA 1DGJA 2PVOD 2M17A 3PGEA 3I5JC 1Q10A 3Q2AC 2GMIC 3ZO5B 3APFA 1N5WA 2V3SA 2GB1A 1LFDA 4B95A 1FFVA 4L23A 4W9EA 4ANUA 2L0FA 4REZA 3ZRFA 3A4RA 3PRPB 2WXFA 3AM9A 3VRBB 1GG3A 3NY5A 1EUVB 2G45B 2XEWA 1V86A 2GBNA 2JY6A 3N32A 3ZDTA 1WE6A 2WDRB 4S17A 3FILB 3VFKA 3N20C 3Q14C 3MJ5A 4FHKA 1VLBA 2J52A 2INPE 5E6NA 3WALA 4M0WA 4A8XC 2BKRB 2DZIA 3DVGX 1NBFC 2M19A 2N7EA 3AXCA 1U4AA 1WFYA 1ZKHA 1GOZA 1WX7A 1TY0A 3AEDB 1I4XA 2KO3A 2A5UA 2MH7A 5BMGA 2MJDA 2M56B 1CK1A 3H7PB 2JVCA 4HPPA 5D3IB 4N9F4 1R4NI 2YEPF 1FRRA 2WHIA 4WQOB 3R8BA 2FIDA 3ABVB 3RNFC 3AE8B 3APDA 3UIPB 2INDC 4MEMA 2L0TA 1TYGB 2ASQA 1WI0A 4A90A 4CHKA 2BWFA 5GXGB 2LJ5A 2KQSA 3ZJTA 3KYCD 4LNIA 1YJIA 3NZ3A 4HCPB 4JE3B 3EA6A 1WR6E 1TBEA 3P1MA 2ZVOA 2C7MB 1IP9A 2CHWA 2AWTA 3AEAB 1Q1OA 2RGFA 4TV3A 3U8ZA 3TIXA 4BBNC 3GB1A 3KW5B 4PS3A 2GBKA 4W9FA 3L13A 2H88B 1K52A 3ALBA 2DBYA 3T3OA 1WX9A 2GBRA 4B6WA 4FJZA 3ZNID 1JMLA 2NBUA 2XN9C 2DX5B 1TKYA 3C0RB 1A70A 4LDTB 4KKJA 3PZDA 3PLUA 4ITKA 4YTNB 4XWWA 1XQQA 3TSSA 3V62A 2VH1A 2DAJA 2QEJC 2Z8LA 1N63A 2ICIA 3NRZA 5FKAC 4ARCA 3VH3B 4MT5A 1OQYA 1E90A 3AULA 4W9IA 5CTRC 3IHPC 5DPRA 2QILA 2KMAA 4HVBA 3HUIA 1FMAD 1YQ4B 2Y5CA 4MJSA 3N1YC 2IO2B 3QARA 4BOSC 1Y8RC 5EE9A 1SIJA 5BYQA 1ZXIA 5JZEB 5BO4B 4AS1A 5AZHA 3WAOA 5D3DA 3PHXB 2WXPA 4HLEA 4WIPA 3U7ZA 3PS6A 2ZCBA 2N0SB 1TS4A 2J0KA 1TS2A 3VRAB 2KJRA 2WXOA 3A9JA 4LDTD 1XCTL 4NJCA 3KUCB 1V80A 4OZAA 2C5LC 3R3MA 5KHOA 4YSXB 4BKSD 2KDFB 4XDCA 3IT4B 3PPAA 2CS4A 3U30A 1UZXB 1PDXA 1S1QB 4I6LB 1L0YB 2JWUA 2W82A 3BVGA 3LXFA 3ZYYX 2BYTA 3KWVA 5EE1A 3KYDD 1E8XA 2LVOA 4ZRJA 1IBXA 1ZGUB 2Y3AA 4LCDE 2O2VA 1I4RA 1NI2A 1V8CA 1X1MA 4NQLB 2D07B 2D2QA 3DVGY 4KSLC 3KLSX 4C4VA 1A5RA 1L5PA 2D10A 1I4PA 1RFAA 2WXLA 1LM8B 1H4RA 3HK0A 2RDHA 2MBHA 2IZVB 2LJIA 1F2RC 2R61A 3K9OB 1UH6A 4KGSA 2LGYA 4K7UA 5C3JB 2X38A 3R2TA 3WAMA 1Z2MA 2MEKA 3DBLI 2D11A 4JLCA 4FXCA 4ANWA 2KJHB 4ZHPA 5EDSA 2JF5A 1N62A 2LHDA 1D5ZC 2BPSA 2FIFA 3DPDA 3H9DA 4JQWC 2J0MA 4L1BA 1C4CA 4CQNA 2TSSA 1S3SG 2N9PC 2KKCA 3M3JA 2O6VA 4KKIA 1KM7A 3BVMA 1WGDA 3BY4B 1WJ4A 2CR5A 3W1YA 2FE8A 2KVRA 2MBQA 1BXTA 1M4VA 1QF6A 3TEYA 4IDIA 4LLGM 4O1NA 1HE8A 5FR3A 4IWQA 4PS7A 3S2AA 3HRDD 3L0WB 1E5WA 1UNSA 4K81A 3ZQ4A 4B9KA 1YN4A 4A6QA 2RSUA 3SFDB 4B0EA 4MGZE 5G55A 3AE5B 3Q8AA 2KFKA 1TS5A 2K8CA 5DPTA 2NPTA 2YEPB 4TKNA 2BGFA 4TSSA 4LK0M 2K8HA 2XK5A 1J0GA 4HPLB 1SE3A 4OHJA 4IG7B 4A3PA 4EKUA 2MA9B 4BAXA 2ZNVB 2WP9B 2WXGA 3JSVB 1PGXA 3ZNHB 4NJ7A 2OJWA 1B9RA 1JRPA 1L4ZB 1VJKA 3BIID 4DDID 1BT0A 3QAQA 3JVZX 2BBCA 2WXIA 4RF1A 4GDLB 2CU1A 1WWTA 2JRIB 2AYOB 1L2NA 2AEHA 2WXRA 3B9JA 2WXKA 3IFWB 2WDTB 4DHZB 2FCQA 1YOVB 1MHXA 1DOIA 4F7ZA 4ZYNA 1V6EA 4ICVA 3QCAA 3ZNGC 1AYFA 3RFZB 1SJHD 4NZLB 4IOIE 4W9LA 2AQ2B 2BS4B 1V1PB 3T3NA 3Q3MC 1GAQB 4C80A 3RI7C 3SU8X 2KD0A 2REXA 2LRUA 5IKCM 5IA7A 2JXTA 2N1VA 3FKYA 3AE2B 1JWSD 4RGTA 2LFIA 2KOXA 3P2BA 3D32A 1BUIC 4MDKE 1XCQL 2C7NB 4P1CC 4AQ7A 2Z0EB 2BVCA 3RMKC 2BB5A 3TEWA 4DHZE 3BZDB 4KIKB 1WXQA 4BOZB 1WGGA 2KJ6A 3AEBB 1QOBA 1L0VB 3R7QA 3Q8BA 1EWYC 4NAWA 2K6DB 1FO4A 4TUUA 4FJVB 1OQRA 1XLQA 1QOAA 2Z0DB 2DWQA 4W9CA 4TQ0A 2C7HA 2LGSA 1T0SC 3NOBA 1XT9B 4AOFA 5TSSA 1IYFA 2PKOA 1CZPA 4W9KA 3ETRA 3H7PA 2KN5A 2KTRB 2Y5PA 1MHHE 4PT5A 1UF0A 2K39A 4HK2A 3ZUNA 2FUG1 1SEBD 2WU5B 4K1RB 1WXMA 3RULA 2ZW1A 3ECIA 3GZNI 3KH0A 4M8NA 3Q3JA 3AI5A 2N7JA 1FD6A 1WY8A 3A1QB 3N1XC 1RM6C 3VAWA 4ANXA 3P63A 2IYDB 1ISNA 2WQYB 1RAXA 2ON8A 2BWES 4JGHB 2RDBC 2WXNA 2QDFA 1FCCC 5HI1A 1TY2A 4FADA 1NENB 4RNAA 1SIFA 3HHMA 3JYUA 1SGHA 3Q69A 2EKEC 3DVNV 2JZ3B 1C79A 1K50A 1UUPA 4AUQC 3DQVA 4K3CA 3MHSD 2KC2A 2BTEA 4P7IA 3CMMB 3ZXVA 4AWJA 3PO0A 1AWDA 5C1ZA 4I6PA 2LMCA 3RYTA 4DBGA 1WF9A 2NMQA 3TUOA 1WXAA 3PRMB 2RMMA 1P98A 4HDOA 3V6EB 1YMHE 2LHEA 4DXAB 2R2QA 1V2YA 3B0AA 1D5XC 1UWMA 1QZEA 2BW2A 2BKFA 1FXAA 2PMVA 3Q3FA 1E7VA 5IN7A 1EM7A 3OLMD 2G4SA 2IDYA 4NNJB 2G9HD 2V4IB 1UELA 2CKHB 3PRZA 4HWIB 3WAPA 1XF5L 2JU6X 3DHGC 2LXAA 4MELA 2X8XX 3Q8CA 1E10A 4GDKB 4WJPA 2FCMA 2PTLA 4EZJA 2IGDA 1FNWA 3BK1A 4OVVA 2E3TA 1J19A 1ET6A 2KX0A 2WU2B 1F77A 2PLPA 2PW9A 2WNMA 1KOTA 2MW5A 3HM6X 3P4PB 2L83A 1I42A 1RFKA 3A33B 2KDEB 2WXMA 2A4ZA 1HXYD 3BINA 3C19A 3UF8A 1OEYJ 1WMHB 5IO9A 2KANA 2ONQA 3ZGZA 3SDLC 1FNUA 1QLBB 1WRDB 1PGAA 2LGIA 2K5PA 3EHVA 4MM3A 3E9SA 2BT6A 2JSVX 3LDZE 2BYEA 2QIEB 4XYCA 4HEA1 5H8YE 1KFYB 2KQ4X 2NTTA 4ZDVA 1VCBA 3P4RB 2L8JA 1XXGA 4N58A 3H8HA 3AV8A 3DOWA 1SXTA 3B08A 3RNAC 2MBOA 3NVVA 4HRSA 2E6XA 3DBHB 3SR6A 1KH0A 4HJKA 4F1SA 3W5VB 4YT0B 3AE6B 4W9HA 3OJ3A 4G3XB 5EE0A 2JX5A 1V81A 4FJYA 3UI3A 3V61A 2ZCCA 4A9AA 3PVLA 3W9CB 2FAZA 1ACCA 3I57A 1NDDA 2KTFA 3VHTC 1WSPA 2DHZA 5J17A 1RRBA 3AE4B 3DBSA 2KQ7A 2MCNB 3A9KB 1J7AA 3X0WA 3GP7A 3AEFB 3T9LA 1WE7A 3RNGC 4M0WB 4BKGA 1AARA 4JL9A 4WQMA 1XLOA 2WXJA 5DPSA 1YJ1A 3NZUA 1MFWA 1T0RC 5CHFA 5DPWA 2GI9A 4ZRPA 1HTOA 3M63B 4YSZB 3VQIA 3AE3B 3IBEA 3NVYA 4IUMB 2VH2A 1ZXHA 2Z59B 3RPFC 3DBRB 1V9JA 4US8A 1YX6B 2K9XA 1NEKB 1V49A 3ONSA 4JIOU 3TJPA 1CMXB 4I6NB 1ZP0B 4HKQA 4G0NB 2KMMA 3QK0A 4KV2A 5E6JA 2N9KA 3PLVA 3R2IA 2OOBB 2V1YA 5G5GA 4FLHA 1J8CA 4M00A 4ZYSA 2KNBA 3VUXA 1AN8A 2IO0B 1ZE3D 3RT3B 5AZGA 2CHXA 2L3ZA 3W1SA 1FRDA 4B0MA 1SJED 3MC9A 1YN3A 2IJ0A 2LZ6A 2V3NA 3BYYB 2M0AA 1IPGA 3BK2A 1VD2A 4P1BC 2UU7A 1JALA 4GLSC 4BZAA 4WWMA 1EU3A 3DBRI 2N9XA 4AJYB 3H6NA 1YJJA 4YWGG 3SHQA 5D6JB 3VTWA 1YIWA 1GJZA 3NVZA 2FCNA 3Q3OC 3HVDA 4M02A 2IY0B 4ZRIA 4XC2A 2UWQA 2ZPYA 1T3QA 3OJ4B 3ZXRA 4DHJB 3ZW3A 2D3BA 3TL5A 5IP4D 3UQBA 2KFJA 2FCSA 3QWZB 1P1AA 3QQ8B 1L6UA 3N1ZC 4NAMA 2JT4B 5L83A 2JRHA 5MPOA 4DK5A 4EZKA 3EFCA 3VR9B 1KF6B 4ASWC 2WGSA 3N3KB 4IWOA 4KZ0A 1I7HA 3W1SC 4MJSB 1PUTA 3KWLA 4LNNA 1SE4A 2MLBA 2KC1A 4NQKE 2W54A 1TZOA 2WXQA 3A9JB 1CQVA 4JPSA 1V1OA 4E3CA 3AEEB 2KWDA 2LEKA 4JX1C 3Q8EA 3OG5A 1WXVA 5LLIA 2C9WB 2ZZPB 1RLFA 4JWUC 4RM8A 4DHJD 2C60A 2W55A 4RGOS 1YX5B 3DCGA 1KTKA 4LNKA 3RNCC 3NS8A 3MP9A 2BF8B 1I4GA 2M4NA 3K9PB 4WWNA 3TMPB 5HHDG 4HROA 4N6EB 2N9LA 1E8WA 4JWSC 3NHEB 2PIAA 4C56C 3OAWA 1L6VA 1IBXB 2MWSB 3DDCB 5C23A 2O2VB 2AL6A 1V97A 3B2FA 3AE1B 3QIJA 2AX5A 5HKHA 3UINB 1BMLC 2N9EB 5AUIA 1C1YB 1HEZE 1R4MB 2KDIA 3EFUA 2K6QA 3PREA 1FCLA 1I4HA 2KAJA 2KHWB 4RM9A 3WA0A 4HPMB 4WAFA 4C00A 1Y56A 4USAA 4BVUC 1DOYA 3B2GA 1T6BX 3MC8A 1F0ZA 1JWUD 4RGNA 3NJTA 2V9HA 3WIMA 1CJEA 3ZIMA 3VDZA 4IM3A 2NBWB 2WDVB 5CX3A 2LVPA 2ZW0A 1ZOYB 2JZZA 3AE9B 4RFBA 3VH4B 4OVZA 3PHWB 4XE0A 2KLCA 1PFDA 3H1UA 4Q2JA 1L0XB 3AECB 4D2KA 3BVZA 2KWUB 2OEDA 4HJGE 3TBLD 1KRHA 4US9A 3IAM1 4L2YA 5H92C 1WGHA 1VZ6A 1GC7A 1QOFA 1TKEA 2JUOA 4WH4A 4C7ZA 1UGJA 1NYQA 2XBBC 5D94A 4CO7A 5J18A 1ET9A 4BFRA 4EZLA 3O13A 1GB4A 2O6VB 1GPXA 5L95C 2QJLA 1SBBB 1V5OA 2I38A 2Q5WD 4YTMB 2G4DB 3DHIC 3CIRB 1GC6A 1P3QU 4YXDB 2INCC 4LJOB 5HFYA 1UD7A 2IY1B 2LVQA 3PSEB 2LXCA 2NR2A 4UDUC 2JYEA 2N1WA 2UYZB 2GBJA 3VUYA 3CSTA 4K3BA 2PPHA 2K25A 4KDLB 3NZSA 4M8MA 3ENEA 1I35A 1YQ3B 2CJOA 4MSQB 3U52E 3NVWA 4W9JA 3FILA 1DOXA 2K8BA 4AP4C 2LRWA 1LQBA 1HTQA 3EUB2 2G3QB 4EUTA 2PE6B 2KFKB 1N60A 3ML8A 3ZNZB 2GRIA 1WZ0A 3ZTCA 2NPTB 1E8ZA 4ARIA 1WXSA 2HJ1A 2M8SA 1LGRA 4A55A 4NY0A 4XDDA 2ZVNA 4GGQA 3W2DA 5KHQA 3APCA 1IGDA 4H2AA 2NBVB 1V5TA 1JWBD 2XK5B 2O6VD 4ZHOA 1E8YA 3PT2B 2LI5A 4ZRQA 1JWMD 2CJNA 3J9CA 2NS5A 3CWIA 2ACZB 1C4AA 4GMVA 3KUZA 1QQRA 2J7QB 2L00B 2SAKA 5LNK1 1HZ5A 1EU4A 4KZCA 2KMCA 3WCQA 5LXHA 1P0RA 3Q3NC 1FEHA 4WAAA 1UWXA 3RUIB 4WJNA 1I4QA 4IW0A 3VR8B 1WJNA 2LGXA 5AUKA 3KQ4A 4DWFA 2JWZA 1IUEA 2EKIA 2N4FA 4A20A 1EF1A 4HDQA 2R2OA 2MQJA 3NS1A 4LTUA 1WJUA 2BS3B 3DWMA 3NG0A 3L10B 1JW9D 4HCNB 5HG2A 4KX6B 3HIZA 2VZKB 1M94A 4KDIC 4EFOA 3MJWA 1NI3A 2KVZA 3MTNB 2FNJB 2WX0A 3P4SB 2N7DA 3V05A 2DZJA 1R4NB 1SSNA 1WM3A 1TGZB 3UGBB 1J7CA 3TCAA 1HQRD 4BKSA 2GOWA 2MBBB 3LYYA 1FXTB 2KACA 3L16A 1IGCA 2QC8A 3V3XA 2MP2B 1TJEA 3E56A 5G2NA 4QAYA 2LGDA 4RCOA 2PVGC 3A9KA 4NAWB 2LD9A 3ZJVA 4PYZA 3ZLZA 1MVKA 3FC4A 3HM3A 2IPKD 2K1FA 1N61A 4R3DA 4DDGD 1JRUA 2AQ3B 2MHJA 1RWSA 2VZKD 3EECA 1KLUD 1MI0A 1UGMA 2L1AA 4NPNA 4E74A 3T8MA 2G1EA 2EELA 1PGBA 2BYVE 1GNUA 2L32A 2I2YA 2WLBA 2QHOA 3IVFA 2CHZA 2M0XA 3U7DA 5D2MB 3UIOB 3QJZA 1Q0WB 3U2SC 4X57B 1VZ8A 4P6VF 3LB8C 1YN5A 2DAFA 2RPVA 2GBMA 1MJDA 3BYTB 4LNFA 3UQAA 2WDQB 1OTRB 1D4BA 2KWVB 5BYSA 5CHVC 1XLPA 3ML9A 2HD5B 3VXWA 1ENFA 4IKGA 2M1MA 2KT7A 4YTPB 3GOEA 3URYA 3RZWC 3PTFC 5E6OA 2MSED 3I9V1 2QSDA 1MPEA 3IXSA 5CHWA 4OW0A 2OHFA 3I3TB 3AN1A 3PZ7A 4IM0A 3RZFA 3EC8A 2L7RA 1QOGA 1EWCA 3DVNU 5DCNA 1WZ3A 3C8YA 1UBQA 3SFEB 1WGYA 1ZPSA 4RGMA 3ZDMC 4CYEA 2IO3B 1FNVA 3B1LX 5LXIB 2JYTA 3JW0X 3VVWB 4ZOHC 3RCZA 1D5MC 2KK8A 1FIQA 1C77A 1WIAA 3DHHC 2MX2A 4EE2A 2WX1A 1LXDA 5C2TB 1R7SA 1B1ZA 2MBEA 2DNFA 2ZPNA 2HE7A 2RPQA 1SB3C 4A3OA 2BS2B 4J3OD 3R66C 2IO1B 1UBIA 4OZCA 3DBHI 2DYOA 2KN4A 1KLVA 4KVGB 3P42A 1LO5D 5E6PA 2ZEQA 1VZ7A 2JQRB 2I1JA 3KVFB 1P7EA 2HJ8A 1P9DU 4FN2A 3N9YC 3I63C 2L52A 3MFGA 1E9MA 2EMSA 2NVUI 3QX1A 4DXFA 2GLSA 3W5UB 1ZDXA 2J42A 2ZJDA 4WJOA 2VRRB 5T8IA 3DBLB 3EGRA 2J53A 4MM3B 2DYBA 1WR1A 2AL3A 2H89B 1MG4A 2XNAC 4S0RA 1E7UA 2B76B 2K22A 1PYWD 4M01A 3WANA 2BYFA 5BMIA 4KSKC 4MGIE 5IOIA 3PZ8A 3GS2A 3DWGC 4GOCA 4MGYE 4K7SA 1XO3A 4KGTA 1ZDVA 2IBIB 3SD5A 5JH5C 1TIFA 2LUEA 3V6CB 1TS3A 2SEBD 3L4PA 4AJWA 5I4DA 4WURA 4LNOA 2NCNA 1JCKB 1WGKA 1WRIA 1E7PB 2PJHA 3KUDB 4MH8A 3JSVA 1HA5A 1K51A 3OWEB 4XZ4A 1KLGD 5FR6A 1C9FA 1SE9A 2L76A 3NUHB 4G50A 4W9GA
chains in the Genus database with same CATH topology
4LDTB 2KWUB 1F9JA 4WWPA 3TBLD 3PZDA 3PLUA 4FADA 1TZ1A 1WGHA 4GDLA 1SIFA 3HHMA 3JYUA 1GC7A 2JUOA 1SGHA 1XQQA 2EKEC 3DVNV 2XBBC 2JZ3B 5D94A 4CO7A 5J18A 4BFRA 3V62A 4EZLA 2O6VB 3M62B 5L95C 2KZRA 4AUQC 2DAJA 2DYMA 1XD3B 3DQVA 3MHSD 4ZRKA 5TR5A 1V5OA 1EF5A 2OJRA 1KJTA 2KC2A 4P7IA 3VH3B 1OQYA 4FHJA 1E90A 2G4DB 3AULA 1TTNA 3CMMB 4W9IA 5CTRC 4AWJA 1GC6A 1P3QU 4GIVA 3IHPC 5C1ZA 4I6PA 4LJOB 3A4SC 3AU4A 1UD7A 3RYTA 2IY1B 2LVQA 5DPRA 3PSEB 2KMAA 2LXCA 4DBGA 1WX8A 2NR2A 1WF9A 2N1WA 2UYZB 4HVBA 2GBJA 3VUYA 4EEWA 3CSTA 2PPHA 1WXAA 3PRMB 2K25A 1P98A 1L7YA 4KDLB 3NZSA 4M8MA 4HDOA 3V6EB 4MJSA 3ENEA 1I35A 4DXAB 2R2QA 2IO2B 1V2YA 3QARA 4BOSC 3B0AA 1Y8RC 1H8CA 5JZEB 5BO4B 2I1KA 4MSQB 5AZHA 1QZEA 3WAOA 4W9JA 4WWOA 3PHXB 2BKFA 1EO6A 4HXDA 2DENB 2K8BA 4AP4C 4HLEA 2LRWA 3Q3FA 1E7VA 3PS6A 1G6JA 1LQBA 2ZCBA 3VUWA 2J0KA 2D3GA 3OLMD 2G3QB 4EUTA 2PE6B 2G4SA 2KFKB 3CSFA 3ML8A 1WJ6A 3ZNZB 4NNJB 2KJRA 2ZNVC 1WZ0A 3A9JA 1UELA 3ZTCA 2CKHB 2NPTB 3PRZA 4HWIB 1E8ZA 4LDTD 3WAPA 1WXSA 1MG8A 4GSWA 4GXBA 3PV1A 3KUCB 1V80A 2M8SA 2C5LC 2LXAA 2PEAA 3LJ3A 3R3MA 4MELA 4NY0A 5KHOA 2KDFB 2DZMA 2ZVNA 4KIKA 4BKSD 4GDKB 1PQSA 4GGQA 2FCMA 4WJPA 4EZJA 2KXJA 5KHQA 3APCA 3PPAA 2NBVB 4FULA 1V5TA 2CS4A 4OVVA 3U30A 1J19A 1UZXB 2XK5B 2O6VD 1E8YA 3H7SA 1S1QB 2KX0A 3PT2B 2J0JA 4I6LB 1ZW7A 2LI5A 1KOTA 2LWPA 2MW5A 3V60A 3HM6X 1Q5WB 2NS5A 1OGWA 1I42A 3A33B 4GMVA 5AZFA 3KUZA 2KDEB 2J7QB 2L00B 2A4ZA 2WWZA 3BINA 3UF8A 3KYDD 1E8XA 1OEYJ 3L17A 1WMHB 2LVOA 2KANA 4G50A 4PS8A 4ZRJA 2EMTA 4II3B 1ZGUB 3SDLC 1WRDB 1OEYA 4LCDE 2O2VA 4KZCA 3X23A 1WH3A 3EHVA 1NI2A 4MM3A 2KMCA 1X1MA 4NQLB 2D07B 3LDZE 5LXHA 1P0RA 2BYEA 2D2QA 5D7GA 3DVGY 4K7WA 4KSLC 3ZRCA 1WGRA 4WAAA 1A5RA 2KTRA 4W9DA 3RUIB 1YQBA 4WJNA 4IW0A 3AU5A 1WJNA 2D10A 2LGXA 4RMAA 1RFAA 4ZDVA 1LM8B 1C3TA 1VCBA 2L8JA 1H4RA 4ANVA 4DWFA 2JWZA 2N4FA 3HK0A 4A20A 2MBHA 2IZVB 1EF1A 3DOWA 4HDQA 2R2OA 2YVCA 2MQJA 5J2RA 4URKA 3B08A 4II2B 4WJQA 2MBOA 1UH6A 3K9OB 2LGYA 1WJUA 3RD2A 3L10B 4HCNB 1YD8U 4K7UA 5JHBA 3WAMA 1Z2MA 4HJKA 4F1SA 3CF6E 4MSMB 3HIZA 3DBLI 2D11A 4JLCA 4J6IA 3A1QA 4ANWA 1Z5SB 2KJHB 3R7RA 1M94A 4KDIC 4W9HA 3OJ3A 4G3XB 3ZVVA 3MJWA 4EFOA 5EDSA 2JF5A 1V81A 2Y5BB 4FJYA 3L08A 3MTNB 2FNJB 3V61A 2RR9A 2ZCCA 3PVLA 1R4MI 2WX0A 2FAZA 2BPSA 1NDDA 2FIFA 2N7DA 4MGKE 2KTFA 3VHTC 2DHZA 3DPDA 3H9DA 1RRBA 4JQWC 2DZJA 4EOYA 4BBNF 5J17A 4BKTA 3DBSA 2J0MA 1WM3A 2LASA 1TGZB 2KQ7A 4ICUA 4IM2A 3UGBB 3VTUA 5AEKB 2MCNB 3A9KB 3TCAA 1S3SG 2RD0A 2GOWA 2MBBB 2N9PC 3X0WA 4BKSA 2B3AA 2KKCA 1FXTB 3T9LA 3L16A 3M3JA 1WE7A 2V4LA 4M0WB 4BKGA 1AARA 4GU2A 4JL9A 2O6VA 2MRPA 5DPSA 1YJ1A 3NZUA 1KM7A 5CHFA 5DPWA 2MP2B 2L05A 3M63B 1WGDA 3BY4B 4GN1A 2DZKA 3VQIA 1WJ4A 2CR5A 3IBEA 4IUMB 3W1YA 5G2NA 2LGDA 2Z59B 2KVRA 2MBQA 2KDBA 1V9JA 3A9KA 1YX6B 4NAWB 1WYWB 2LD9A 1V49A 3ONSA 4JIOU 1HE8A 3TJPA 4NJ6A 4PYUA 2YLMA 4IWQA 4PYZA 1CMXB 4PS7A 3S2AA 3L0WB 4I6NB 1T0YA 3ZLZA 3HM3A 2K1FA 1E5WA 4FA6A 3QA8A 1GUAB 4G0NB 4DDGD 2MP2A 4K81A 1JRUA 4KV2A 3QK0A 4B9KA 2RSUA 3EECA 4LJPB 1UGMA 3QC8B 4NPNA 4E74A 3PLVA 3T8MA 2OOBB 2V1YA 2KLGA 4MGZE 4FLHA 5G55A 1J8CA 4YL8A 2KFKA 2KNBA 2BYVE 3VTVA 3VUXA 2K8CA 4TQ1A 2IO0B 5DPTA 1GNUA 2NPTA 3RT3B 5JHAA 2JXXA 3L54A 5AZGA 2CHXA 2QHOA 3IVFA 2BGFA 2L3ZA 3M95A 4TKNA 2CHZA 3W1SA 2M0XA 3U7DA 5D2MB 2K8HA 3UIOB 4OVUA 2LZ6A 4GDKA 3QJZA 4IC7B 1Q0WB 4X57B 2PE9A 1IPGA 2XK5A 4FBJB 1J0GA 4G11A 1VD2A 3N30A 4HPLB 2KX3A 2DAFA 3ZKJC 1K8RB 4IG7B 2GBMA 4GB9A 4A3PA 4XX5A 4EKUA 2MA9B 3QHTA 3DBRI 3UQAA 2N9XA 4IWPA 1OTRB 1D3ZA 4AJYB 2ZNVB 3O65B 3H6NA 2HTHA 1WM2A 3JSVB 4F8CB 2KWVB 3SHQA 3ZNHB 5CHVC 5D6JB 3ML9A 4NJ7A 1WMHA 2HD5B 3VTWA 3VXWA 1YIWA 1GJZA 2W9NA 2WYQA 3IG3A 4E71A 2FCNA 4DDID 2M1MA 1BT0A 2IY0B 3GOEA 3QAQA 4XC2A 2UWQA 4ZRIA 3JVZX 2ZPYA 3PTFC 3RZWC 5E6OA 2MSED 4GDLB 5IAAC 2CU1A 2JRIB 2AYOB 2FUHB 1L2NA 2AEHA 5CHWA 2KWCA 2JPHA 3ZTDA 3OJ4B 3I3TB 4DHJB 5GMVA 3ZW3A 3TL5A 3IFWB 2WDTB 4IM0A 3RZFA 4MH0E 4DHZB 2FCQA 3EC8A 3UQBA 2L7RA 2KFJA 2M17A 4F7ZA 3PGEA 4ZYNA 3DVNU 5DCNA 1WZ3A 2FCSA 1V6EA 1UBQA 3QCAA 3QWZB 4ICVA 2GMIC 3ZO5B 3APFA 1P1AA 3QQ8B 2V3SA 1WGYA 3ZNGC 1LFDA 3ZDMC 4B95A 4CYEA 2IO3B 3B1LX 5LXIB 2JT4B 5L83A 2JRHA 3JW0X 4W9EA 4ANUA 4W9LA 2L0FA 4DK5A 4EZKA 3VVWB 3RCZA 3ZRFA 3A4RA 3PRPB 4ASWC 3N3KB 4IWOA 4KZ0A 2KK8A 3W1SC 4MJSB 3SU8X 1GG3A 2KD0A 3NY5A 1EUVB 2G45B 1WIAA 2REXA 2LRUA 2MLBA 2MX2A 2XEWA 1V86A 2GBNA 2JY6A 2WX1A 3N32A 1LXDA 2KC1A 3ZDTA 4NQKE 5IA7A 1WE6A 3VFKA 2N1VA 2MBEA 2ZPNA 2HE7A 2RPQA 4FHKA 2KOXA 3P2BA 4A3OA 3D32A 5E6NA 3WALA 3A9JB 3R66C 4MDKE 2IO1B 2C7NB 2BKRB 2DZIA 1UBIA 1NBFC 2N7EA 2Z0EB 3AXCA 3DBHI 3DVGX 2DYOA 4E3CA 1U4AA 1KLVA 1WFYA 4KVGB 1ZKHA 4DHZE 4KIKB 5E6PA 2ZEQA 1WX7A 1WXVA 5LLIA 4BOZB 1WGGA 2KJ6A 2C9WB 2ZZPB 1RLFA 4RM8A 4DHJD 2C60A 2KO3A 2A5UA 1YX5B 3DCGA 2I1JA 3R7QA 3NS8A 2BF8B 4NAWA 2K6DB 2M4NA 3KVFB 3K9PB 3H7PB 2HJ8A 1P9DU 2JVCA 4WWNA 4N9F4 3TMPB 4TUUA 4FJVB 1R4NI 4FN2A 2EMSA 2NVUI 1E8WA 2Z0DB 3QX1A 4WQOB 2FIDA 3NHEB 4W9CA 4TQ0A 2C7HA 3APDA 3OAWA 3UIPB 4MEMA 2L0TA 2ZJDA 4WJOA 2VRRB 2ASQA 2MWSB 3DDCB 5C23A 3NOBA 2O2VB 1XT9B 1WI0A 4AOFA 2AL6A 2DYBA 2BWFA 4CHKA 1WR1A 2AL3A 2LJ5A 1IYFA 3QIJA 2KQSA 3KYCD 5HKHA 4W9KA 3UINB 1E7UA 2N9EB 3H7PA 2KN5A 1C1YB 2KTRB 4HCPB 3WANA 2BYFA 2KDIA 3EFUA 2K6QA 3PREA 2KHWB 1WR6E 2K39A 1TBEA 4HK2A 2ZVOA 4RM9A 4HPMB 2C7MB 4KSKC 4MGIE 3WA0A 3ZUNA 4BVUC 1IP9A 2CHWA 4K1RB 1WXMA 2AWTA 3RULA 4GOCA 4MGYE 4K7SA 1Q1OA 2IBIB 3SD5A 5JH5C 3WIMA 3ZIMA 3VDZA 2RGFA 4IM3A 2NBWB 4TV3A 2LUEA 3V6CB 3U8ZA 3TIXA 4BBNC 3ECIA 3GZNI 5CX3A 3KW5B 3KH0A 4PS3A 4AJWA 4M8NA 3Q3JA 3AI5A 2LVPA 2GBKA 2JZZA 4W9FA 2NCNA 3L13A 1WY8A 3VH4B 3ALBA 3A1QB 3PHWB 2PJHA 3VAWA 4ANXA 3KUDB 1WX9A 2GBRA 4B6WA 2IYDB 2KLCA 3JSVA 4FJZA 3ZNID 3H1UA 1ISNA 1RAXA 4XZ4A 2NBUA 5FR6A 2BWES 2DX5B 4JGHB 1SE9A 2L76A 3C0RB 4W9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDT B;  2KWU B;  1F9J A;  4WWP A;  3TBL D;  3PZD A;  3PLU A;  4FAD A;  1TZ1 A;  1WGH A;  4GDL A;  1SIF A;  3HHM A;  3JYU A;  1GC7 A;  2JUO A;  1SGH A;  1XQQ A;  2EKE C;  3DVN V;  2XBB C;  2JZ3 B;  5D94 A;  4CO7 A;  5J18 A;  4BFR A;  3V62 A;  4EZL A;  2O6V B;  3M62 B;  5L95 C;  2KZR A;  4AUQ C;  2DAJ A;  2DYM A;  1XD3 B;  3DQV A;  3MHS D;  4ZRK A;  5TR5 A;  1V5O A;  1EF5 A;  2OJR A;  1KJT A;  2KC2 A;  4P7I A;  3VH3 B;  1OQY A;  4FHJ A;  1E90 A;  2G4D B;  3AUL A;  1TTN A;  3CMM B;  4W9I A;  5CTR C;  4AWJ A;  1GC6 A;  1P3Q U;  4GIV A;  3IHP C;  5C1Z A;  4I6P A;  4LJO B;  3A4S C;  3AU4 A;  1UD7 A;  3RYT A;  2IY1 B;  2LVQ A;  5DPR A;  3PSE B;  2KMA A;  2LXC A;  4DBG A;  1WX8 A;  2NR2 A;  1WF9 A;  2N1W A;  2UYZ B;  4HVB A;  2GBJ A;  3VUY A;  4EEW A;  3CST A;  2PPH A;  1WXA A;  3PRM B;  2K25 A;  1P98 A;  1L7Y A;  4KDL B;  3NZS A;  4M8M A;  4HDO A;  3V6E B;  4MJS A;  3ENE A;  1I35 A;  4DXA B;  2R2Q A;  2IO2 B;  1V2Y A;  3QAR A;  4BOS C;  3B0A A;  1Y8R C;  1H8C A;  5JZE B;  5BO4 B;  2I1K A;  4MSQ B;  5AZH A;  1QZE A;  3WAO A;  4W9J A;  4WWO A;  3PHX B;  2BKF A;  1EO6 A;  4HXD A;  2DEN B;  2K8B A;  4AP4 C;  4HLE A;  2LRW A;  3Q3F A;  1E7V A;  3PS6 A;  1G6J A;  1LQB A;  2ZCB A;  3VUW A;  2J0K A;  2D3G A;  3OLM D;  2G3Q B;  4EUT A;  2PE6 B;  2G4S A;  2KFK B;  3CSF A;  3ML8 A;  1WJ6 A;  3ZNZ B;  4NNJ B;  2KJR A;  2ZNV C;  1WZ0 A;  3A9J A;  1UEL A;  3ZTC A;  2CKH B;  2NPT B;  3PRZ A;  4HWI B;  1E8Z A;  4LDT D;  3WAP A;  1WXS A;  1MG8 A;  4GSW A;  4GXB A;  3PV1 A;  3KUC B;  1V80 A;  2M8S A;  2C5L C;  2LXA A;  2PEA A;  3LJ3 A;  3R3M A;  4MEL A;  4NY0 A;  5KHO A;  2KDF B;  2DZM A;  2ZVN A;  4KIK A;  4BKS D;  4GDK B;  1PQS A;  4GGQ A;  2FCM A;  4WJP A;  4EZJ A;  2KXJ A;  5KHQ A;  3APC A;  3PPA A;  2NBV B;  4FUL A;  1V5T A;  2CS4 A;  4OVV A;  3U30 A;  1J19 A;  1UZX B;  2XK5 B;  2O6V D;  1E8Y A;  3H7S A;  1S1Q B;  2KX0 A;  3PT2 B;  2J0J A;  4I6L B;  1ZW7 A;  2LI5 A;  1KOT A;  2LWP A;  2MW5 A;  3V60 A;  3HM6 X;  1Q5W B;  2NS5 A;  1OGW A;  1I42 A;  3A33 B;  4GMV A;  5AZF A;  3KUZ A;  2KDE B;  2J7Q B;  2L00 B;  2A4Z A;  2WWZ A;  3BIN A;  3UF8 A;  3KYD D;  1E8X A;  1OEY J;  3L17 A;  1WMH B;  2LVO A;  2KAN A;  4G50 A;  4PS8 A;  4ZRJ A;  2EMT A;  4II3 B;  1ZGU B;  3SDL C;  1WRD B;  1OEY A;  4LCD E;  2O2V A;  4KZC A;  3X23 A;  1WH3 A;  3EHV A;  1NI2 A;  4MM3 A;  2KMC A;  1X1M A;  4NQL B;  2D07 B;  3LDZ E;  5LXH A;  1P0R A;  2BYE A;  2D2Q A;  5D7G A;  3DVG Y;  4K7W A;  4KSL C;  3ZRC A;  1WGR A;  4WAA A;  1A5R A;  2KTR A;  4W9D A;  3RUI B;  1YQB A;  4WJN A;  4IW0 A;  3AU5 A;  1WJN A;  2D10 A;  2LGX A;  4RMA A;  1RFA A;  4ZDV A;  1LM8 B;  1C3T A;  1VCB A;  2L8J A;  1H4R A;  4ANV A;  4DWF A;  2JWZ A;  2N4F A;  3HK0 A;  4A20 A;  2MBH A;  2IZV B;  1EF1 A;  3DOW A;  4HDQ A;  2R2O A;  2YVC A;  2MQJ A;  5J2R A;  4URK A;  3B08 A;  4II2 B;  4WJQ A;  2MBO A;  1UH6 A;  3K9O B;  2LGY A;  1WJU A;  3RD2 A;  3L10 B;  4HCN B;  1YD8 U;  4K7U A;  5JHB A;  3WAM A;  1Z2M A;  4HJK A;  4F1S A;  3CF6 E;  4MSM B;  3HIZ A;  3DBL I;  2D11 A;  4JLC A;  4J6I A;  3A1Q A;  4ANW A;  1Z5S B;  2KJH B;  3R7R A;  1M94 A;  4KDI C;  4W9H A;  3OJ3 A;  4G3X B;  3ZVV A;  3MJW A;  4EFO A;  5EDS A;  2JF5 A;  1V81 A;  2Y5B B;  4FJY A;  3L08 A;  3MTN B;  2FNJ B;  3V61 A;  2RR9 A;  2ZCC A;  3PVL A;  1R4M I;  2WX0 A;  2FAZ A;  2BPS A;  1NDD A;  2FIF A;  2N7D A;  4MGK E;  2KTF A;  3VHT C;  2DHZ A;  3DPD A;  3H9D A;  1RRB A;  4JQW C;  2DZJ A;  4EOY A;  4BBN F;  5J17 A;  4BKT A;  3DBS A;  2J0M A;  1WM3 A;  2LAS A;  1TGZ B;  2KQ7 A;  4ICU A;  4IM2 A;  3UGB B;  3VTU A;  5AEK B;  2MCN B;  3A9K B;  3TCA A;  1S3S G;  2RD0 A;  2GOW A;  2MBB B;  2N9P C;  3X0W A;  4BKS A;  2B3A A;  2KKC A;  1FXT B;  3T9L A;  3L16 A;  3M3J A;  1WE7 A;  2V4L A;  4M0W B;  4BKG A;  1AAR A;  4GU2 A;  4JL9 A;  2O6V A;  2MRP A;  5DPS A;  1YJ1 A;  3NZU A;  1KM7 A;  5CHF A;  5DPW A;  2MP2 B;  2L05 A;  3M63 B;  1WGD A;  3BY4 B;  4GN1 A;  2DZK A;  3VQI A;  1WJ4 A;  2CR5 A;  3IBE A;  4IUM B;  3W1Y A;  5G2N A;  2LGD A;  2Z59 B;  2KVR A;  2MBQ A;  2KDB A;  1V9J A;  3A9K A;  1YX6 B;  4NAW B;  1WYW B;  2LD9 A;  1V49 A;  3ONS A;  4JIO U;  1HE8 A;  3TJP A;  4NJ6 A;  4PYU A;  2YLM A;  4IWQ A;  4PYZ A;  1CMX B;  4PS7 A;  3S2A A;  3L0W B;  4I6N B;  1T0Y A;  3ZLZ A;  3HM3 A;  2K1F A;  1E5W A;  4FA6 A;  3QA8 A;  1GUA B;  4G0N B;  4DDG D;  2MP2 A;  4K81 A;  1JRU A;  4KV2 A;  3QK0 A;  4B9K A;  2RSU A;  3EEC A;  4LJP B;  1UGM A;  3QC8 B;  4NPN A;  4E74 A;  3PLV A;  3T8M A;  2OOB B;  2V1Y A;  2KLG A;  4MGZ E;  4FLH A;  5G55 A;  1J8C A;  4YL8 A;  2KFK A;  2KNB A;  2BYV E;  3VTV A;  3VUX A;  2K8C A;  4TQ1 A;  2IO0 B;  5DPT A;  1GNU A;  2NPT A;  3RT3 B;  5JHA A;  2JXX A;  3L54 A;  5AZG A;  2CHX A;  2QHO A;  3IVF A;  2BGF A;  2L3Z A;  3M95 A;  4TKN A;  2CHZ A;  3W1S A;  2M0X A;  3U7D A;  5D2M B;  2K8H A;  3UIO B;  4OVU A;  2LZ6 A;  4GDK A;  3QJZ A;  4IC7 B;  1Q0W B;  4X57 B;  2PE9 A;  1IPG A;  2XK5 A;  4FBJ B;  1J0G A;  4G11 A;  1VD2 A;  3N30 A;  4HPL B;  2KX3 A;  2DAF A;  3ZKJ C;  1K8R B;  4IG7 B;  2GBM A;  4GB9 A;  4A3P A;  4XX5 A;  4EKU A;  2MA9 B;  3QHT A;  3DBR I;  3UQA A;  2N9X A;  4IWP A;  1OTR B;  1D3Z A;  4AJY B;  2ZNV B;  3O65 B;  3H6N A;  2HTH A;  1WM2 A;  3JSV B;  4F8C B;  2KWV B;  3SHQ A;  3ZNH B;  5CHV C;  5D6J B;  3ML9 A;  4NJ7 A;  1WMH A;  2HD5 B;  3VTW A;  3VXW A;  1YIW A;  1GJZ A;  2W9N A;  2WYQ A;  3IG3 A;  4E71 A;  2FCN A;  4DDI D;  2M1M A;  1BT0 A;  2IY0 B;  3GOE A;  3QAQ A;  4XC2 A;  2UWQ A;  4ZRI A;  3JVZ X;  2ZPY A;  3PTF C;  3RZW C;  5E6O A;  2MSE D;  4GDL B;  5IAA C;  2CU1 A;  2JRI B;  2AYO B;  2FUH B;  1L2N A;  2AEH A;  5CHW A;  2KWC A;  2JPH A;  3ZTD A;  3OJ4 B;  3I3T B;  4DHJ B;  5GMV A;  3ZW3 A;  3TL5 A;  3IFW B;  2WDT B;  4IM0 A;  3RZF A;  4MH0 E;  4DHZ B;  2FCQ A;  3EC8 A;  3UQB A;  2L7R A;  2KFJ A;  2M17 A;  4F7Z A;  3PGE A;  4ZYN A;  3DVN U;  5DCN A;  1WZ3 A;  2FCS A;  1V6E A;  1UBQ A;  3QCA A;  3QWZ B;  4ICV A;  2GMI C;  3ZO5 B;  3APF A;  1P1A A;  3QQ8 B;  2V3S A;  1WGY A;  3ZNG C;  1LFD A;  3ZDM C;  4B95 A;  4CYE A;  2IO3 B;  3B1L X;  5LXI B;  2JT4 B;  5L83 A;  2JRH A;  3JW0 X;  4W9E A;  4ANU A;  4W9L A;  2L0F A;  4DK5 A;  4EZK A;  3VVW B;  3RCZ A;  3ZRF A;  3A4R A;  3PRP B;  4ASW C;  3N3K B;  4IWO A;  4KZ0 A;  2KK8 A;  3W1S C;  4MJS B;  3SU8 X;  1GG3 A;  2KD0 A;  3NY5 A;  1EUV B;  2G45 B;  1WIA A;  2REX A;  2LRU A;  2MLB A;  2MX2 A;  2XEW A;  1V86 A;  2GBN A;  2JY6 A;  2WX1 A;  3N32 A;  1LXD A;  2KC1 A;  3ZDT A;  4NQK E;  5IA7 A;  1WE6 A;  3VFK A;  2N1V A;  2MBE A;  2ZPN A;  2HE7 A;  2RPQ A;  4FHK A;  2KOX A;  3P2B A;  4A3O A;  3D32 A;  5E6N A;  3WAL A;  3A9J B;  3R66 C;  4MDK E;  2IO1 B;  2C7N B;  2BKR B;  2DZI A;  1UBI A;  1NBF C;  2N7E A;  2Z0E B;  3AXC A;  3DBH I;  3DVG X;  2DYO A;  4E3C A;  1U4A A;  1KLV A;  1WFY A;  4KVG B;  1ZKH A;  4DHZ E;  4KIK B;  5E6P A;  2ZEQ A;  1WX7 A;  1WXV A;  5LLI A;  4BOZ B;  1WGG A;  2KJ6 A;  2C9W B;  2ZZP B;  1RLF A;  4RM8 A;  4DHJ D;  2C60 A;  2KO3 A;  2A5U A;  1YX5 B;  3DCG A;  2I1J A;  3R7Q A;  3NS8 A;  2BF8 B;  4NAW A;  2K6D B;  2M4N A;  3KVF B;  3K9P B;  3H7P B;  2HJ8 A;  1P9D U;  2JVC A;  4WWN A;  4N9F 4;  3TMP B;  4TUU A;  4FJV B;  1R4N I;  4FN2 A;  2EMS A;  2NVU I;  1E8W A;  2Z0D B;  3QX1 A;  4WQO B;  2FID A;  3NHE B;  4W9C A;  4TQ0 A;  2C7H A;  3APD A;  3OAW A;  3UIP B;  4MEM A;  2L0T A;  2ZJD A;  4WJO A;  2VRR B;  2ASQ A;  2MWS B;  3DDC B;  5C23 A;  3NOB A;  2O2V B;  1XT9 B;  1WI0 A;  4AOF A;  2AL6 A;  2DYB A;  2BWF A;  4CHK A;  1WR1 A;  2AL3 A;  2LJ5 A;  1IYF A;  3QIJ A;  2KQS A;  3KYC D;  5HKH A;  4W9K A;  3UIN B;  1E7U A;  2N9E B;  3H7P A;  2KN5 A;  1C1Y B;  2KTR B;  4HCP B;  3WAN A;  2BYF A;  2KDI A;  3EFU A;  2K6Q A;  3PRE A;  2KHW B;  1WR6 E;  2K39 A;  1TBE A;  4HK2 A;  2ZVO A;  4RM9 A;  4HPM B;  2C7M B;  4KSK C;  4MGI E;  3WA0 A;  3ZUN A;  4BVU C;  1IP9 A;  2CHW A;  4K1R B;  1WXM A;  2AWT A;  3RUL A;  4GOC A;  4MGY E;  4K7S A;  1Q1O A;  2IBI B;  3SD5 A;  5JH5 C;  3WIM A;  3ZIM A;  3VDZ A;  2RGF A;  4IM3 A;  2NBW B;  4TV3 A;  2LUE A;  3V6C B;  3U8Z A;  3TIX A;  4BBN C;  3ECI A;  3GZN I;  5CX3 A;  3KW5 B;  3KH0 A;  4PS3 A;  4AJW A;  4M8N A;  3Q3J A;  3AI5 A;  2LVP A;  2GBK A;  2JZZ A;  4W9F A;  2NCN A;  3L13 A;  1WY8 A;  3VH4 B;  3ALB A;  3A1Q B;  3PHW B;  2PJH A;  3VAW A;  4ANX A;  3KUD B;  1WX9 A;  2GBR A;  4B6W A;  2IYD B;  2KLC A;  3JSV A;  4FJZ A;  3ZNI D;  3H1U A;  1ISN A;  1RAX A;  4XZ4 A;  2NBU A;  5FR6 A;  2BWE S;  2DX5 B;  4JGH B;  1SE9 A;  2L76 A;  3C0R B;  4W9G A; 
#chains in the Genus database with same CATH topology
 1F9J A;  2WS3 B;  4WWP A;  5FK9 C;  3SEB A;  4PK1 A;  1E6E B;  5G5H A;  1TZ1 A;  4ACF A;  4GDL A;  4N59 A;  3AEG B;  3M62 B;  2KZR A;  2J4X A;  3MHZ A;  2DYM A;  5TR5 A;  1XD3 B;  3RN9 C;  1E0Z A;  4ZRK A;  1EF5 A;  2OJR A;  1KJT A;  4FHJ A;  1TTN A;  3AH7 A;  4GIV A;  1VRA B;  1QIL A;  2FBW B;  3A4S C;  2IGG A;  1ESF A;  3AU4 A;  1TKG A;  1WX8 A;  4EEW A;  1V1P A;  2IGH A;  3AE7 B;  1L7Y A;  1T0Q C;  2WXH A;  1H8C A;  4KGR A;  2I1K A;  4HKZ E;  3RNE C;  4WWO A;  3IT6 B;  1EO6 A;  4HXD A;  3TEX A;  2DEN B;  1C4P A;  1G6J A;  3VUW A;  2D3G A;  3FAH A;  3AMZ A;  3CSF A;  1WJ6 A;  2BB6 A;  2ZNV C;  1F52 A;  1MG8 A;  4GSW A;  4GXB A;  3PV1 A;  3RNB C;  3Q8F A;  2PEA A;  3LJ3 A;  2V0G A;  2DZM A;  4KIK A;  2CU3 A;  1PQS A;  3U4E G;  2KXJ A;  4FUL A;  2AQ1 B;  4RH6 A;  3H7S A;  2J0J A;  1ZW7 A;  2LWP A;  3GE3 C;  3V60 A;  1Q5W B;  1K53 A;  4C4V B;  2MJ3 A;  1OGW A;  1F2R I;  3HVZ A;  1AW7 A;  5AZF A;  1ROE A;  2WWZ A;  3L17 A;  4MAC A;  4PS8 A;  2EMT A;  1JWA D;  4II3 B;  1OEY A;  3X23 A;  4DQO C;  1WH3 A;  1WYG A;  3ZRC A;  5D7G A;  4K7W A;  1OQQ A;  1WGR A;  2NTS A;  1L4D B;  2KTR A;  4W9D A;  1YQB A;  1QT9 A;  3AU5 A;  4P16 A;  1FPY A;  4RMA A;  2K3U A;  1C3T A;  4ANV A;  2YVC A;  5J2R A;  4URK A;  3P4Q B;  4II2 B;  1T5X D;  4WJQ A;  3Q6B A;  3RD2 A;  1YD8 U;  2W3S A;  1STE A;  1FFU A;  5JHB A;  1JQ4 A;  4TMA B;  3CF6 E;  2MJE A;  4MSM B;  2LUM A;  5BMH A;  4J6I A;  3A1Q A;  1Z5S B;  3R7R A;  3ZVV A;  2D3C A;  2BQQ A;  2Y5B B;  2D3A A;  3L08 A;  5JXV A;  2RR9 A;  1R4M I;  1DYQ A;  4MGK E;  4EOY A;  1JRO A;  4BBN F;  4BKT A;  5AEK B;  1N5X A;  2LAS A;  4IM2 A;  1SF0 A;  4ICU A;  3VTU A;  3BWU D;  1VR9 A;  1F1H A;  1QKZ A;  2RD0 A;  2B3A A;  3AB5 A;  3ZJU A;  1RYJ A;  2V4L A;  1GB1 A;  4GU2 A;  2MRP A;  4XGA B;  3GE8 C;  2L05 A;  1TT5 B;  4GN1 A;  2DZK A;  3TEZ A;  4OZB A;  2KDM A;  1XLN A;  2KDB A;  1WYW B;  4NJ6 A;  4PYU A;  2YLM A;  1YNT E;  2W3R A;  2HTM E;  1T0Y A;  2D5G A;  4FA6 A;  3QA8 A;  1GUA B;  3GZN B;  2MP2 A;  3IAS 1;  5EE3 A;  4C7Y A;  2QCZ A;  2QMT A;  1J7B A;  4LJP B;  3QC8 B;  2KYW A;  1D6E C;  2KLG A;  2V3P A;  4YL8 A;  1HZ6 A;  1NVI D;  2K0P A;  1NYR A;  3VTV A;  2HDE A;  4TQ1 A;  5BYR A;  5JHA A;  2JXX A;  3L54 A;  1FM0 D;  3M95 A;  2INN E;  4YSY B;  4OVU A;  1C78 A;  1OFF A;  2DLB A;  4GDK A;  4IC7 B;  2PE9 A;  1ZUD 2;  4FBJ B;  4G11 A;  3N30 A;  1P7F A;  2KX3 A;  3ZKJ C;  4XWT A;  1K8R B;  4GB9 A;  4XX5 A;  1SE2 A;  3QHT A;  4IWP A;  4RF0 A;  1D3Z A;  4F8C B;  3O65 B;  2HTH A;  1WM2 A;  3MC0 B;  1WMH A;  4DXG A;  2W9N A;  2WYQ A;  1C76 A;  3IG3 A;  4E71 A;  1N6Z A;  5IAA C;  2FUH B;  2JZP A;  2KWC A;  2JPH A;  2RDG A;  3ZTD A;  5GMV A;  1VDV A;  4MH0 E;  1FXI A;  1XEE A;  1DGJ A;  2PVO D;  2M17 A;  3PGE A;  3I5J C;  1Q10 A;  3Q2A C;  2GMI C;  3ZO5 B;  3APF A;  1N5W A;  2V3S A;  2GB1 A;  1LFD A;  4B95 A;  1FFV A;  4L23 A;  4W9E A;  4ANU A;  2L0F A;  4REZ A;  3ZRF A;  3A4R A;  3PRP B;  2WXF A;  3AM9 A;  3VRB B;  1GG3 A;  3NY5 A;  1EUV B;  2G45 B;  2XEW A;  1V86 A;  2GBN A;  2JY6 A;  3N32 A;  3ZDT A;  1WE6 A;  2WDR B;  4S17 A;  3FIL B;  3VFK A;  3N20 C;  3Q14 C;  3MJ5 A;  4FHK A;  1VLB A;  2J52 A;  2INP E;  5E6N A;  3WAL A;  4M0W A;  4A8X C;  2BKR B;  2DZI A;  3DVG X;  1NBF C;  2M19 A;  2N7E A;  3AXC A;  1U4A A;  1WFY A;  1ZKH A;  1GOZ A;  1WX7 A;  1TY0 A;  3AED B;  1I4X A;  2KO3 A;  2A5U A;  2MH7 A;  5BMG A;  2MJD A;  2M56 B;  1CK1 A;  3H7P B;  2JVC A;  4HPP A;  5D3I B;  4N9F 4;  1R4N I;  2YEP F;  1FRR A;  2WHI A;  4WQO B;  3R8B A;  2FID A;  3ABV B;  3RNF C;  3AE8 B;  3APD A;  3UIP B;  2IND C;  4MEM A;  2L0T A;  1TYG B;  2ASQ A;  1WI0 A;  4A90 A;  4CHK A;  2BWF A;  5GXG B;  2LJ5 A;  2KQS A;  3ZJT A;  3KYC D;  4LNI A;  1YJI A;  3NZ3 A;  4HCP B;  4JE3 B;  3EA6 A;  1WR6 E;  1TBE A;  3P1M A;  2ZVO A;  2C7M B;  1IP9 A;  2CHW A;  2AWT A;  3AEA B;  1Q1O A;  2RGF A;  4TV3 A;  3U8Z A;  3TIX A;  4BBN C;  3GB1 A;  3KW5 B;  4PS3 A;  2GBK A;  4W9F A;  3L13 A;  2H88 B;  1K52 A;  3ALB A;  2DBY A;  3T3O A;  1WX9 A;  2GBR A;  4B6W A;  4FJZ A;  3ZNI D;  1JML A;  2NBU A;  2XN9 C;  2DX5 B;  1TKY A;  3C0R B;  1A70 A;  4LDT B;  4KKJ A;  3PZD A;  3PLU A;  4ITK A;  4YTN B;  4XWW A;  1XQQ A;  3TSS A;  3V62 A;  2VH1 A;  2DAJ A;  2QEJ C;  2Z8L A;  1N63 A;  2ICI A;  3NRZ A;  5FKA C;  4ARC A;  3VH3 B;  4MT5 A;  1OQY A;  1E90 A;  3AUL A;  4W9I A;  5CTR C;  3IHP C;  5DPR A;  2QIL A;  2KMA A;  4HVB A;  3HUI A;  1FMA D;  1YQ4 B;  2Y5C A;  4MJS A;  3N1Y C;  2IO2 B;  3QAR A;  4BOS C;  1Y8R C;  5EE9 A;  1SIJ A;  5BYQ A;  1ZXI A;  5JZE B;  5BO4 B;  4AS1 A;  5AZH A;  3WAO A;  5D3D A;  3PHX B;  2WXP A;  4HLE A;  4WIP A;  3U7Z A;  3PS6 A;  2ZCB A;  2N0S B;  1TS4 A;  2J0K A;  1TS2 A;  3VRA B;  2KJR A;  2WXO A;  3A9J A;  4LDT D;  1XCT L;  4NJC A;  3KUC B;  1V80 A;  4OZA A;  2C5L C;  3R3M A;  5KHO A;  4YSX B;  4BKS D;  2KDF B;  4XDC A;  3IT4 B;  3PPA A;  2CS4 A;  3U30 A;  1UZX B;  1PDX A;  1S1Q B;  4I6L B;  1L0Y B;  2JWU A;  2W82 A;  3BVG A;  3LXF A;  3ZYY X;  2BYT A;  3KWV A;  5EE1 A;  3KYD D;  1E8X A;  2LVO A;  4ZRJ A;  1IBX A;  1ZGU B;  2Y3A A;  4LCD E;  2O2V A;  1I4R A;  1NI2 A;  1V8C A;  1X1M A;  4NQL B;  2D07 B;  2D2Q A;  3DVG Y;  4KSL C;  3KLS X;  4C4V A;  1A5R A;  1L5P A;  2D10 A;  1I4P A;  1RFA A;  2WXL A;  1LM8 B;  1H4R A;  3HK0 A;  2RDH A;  2MBH A;  2IZV B;  2LJI A;  1F2R C;  2R61 A;  3K9O B;  1UH6 A;  4KGS A;  2LGY A;  4K7U A;  5C3J B;  2X38 A;  3R2T A;  3WAM A;  1Z2M A;  2MEK A;  3DBL I;  2D11 A;  4JLC A;  4FXC A;  4ANW A;  2KJH B;  4ZHP A;  5EDS A;  2JF5 A;  1N62 A;  2LHD A;  1D5Z C;  2BPS A;  2FIF A;  3DPD A;  3H9D A;  4JQW C;  2J0M A;  4L1B A;  1C4C A;  4CQN A;  2TSS A;  1S3S G;  2N9P C;  2KKC A;  3M3J A;  2O6V A;  4KKI A;  1KM7 A;  3BVM A;  1WGD A;  3BY4 B;  1WJ4 A;  2CR5 A;  3W1Y A;  2FE8 A;  2KVR A;  2MBQ A;  1BXT A;  1M4V A;  1QF6 A;  3TEY A;  4IDI A;  4LLG M;  4O1N A;  1HE8 A;  5FR3 A;  4IWQ A;  4PS7 A;  3S2A A;  3HRD D;  3L0W B;  1E5W A;  1UNS A;  4K81 A;  3ZQ4 A;  4B9K A;  1YN4 A;  4A6Q A;  2RSU A;  3SFD B;  4B0E A;  4MGZ E;  5G55 A;  3AE5 B;  3Q8A A;  2KFK A;  1TS5 A;  2K8C A;  5DPT A;  2NPT A;  2YEP B;  4TKN A;  2BGF A;  4TSS A;  4LK0 M;  2K8H A;  2XK5 A;  1J0G A;  4HPL B;  1SE3 A;  4OHJ A;  4IG7 B;  4A3P A;  4EKU A;  2MA9 B;  4BAX A;  2ZNV B;  2WP9 B;  2WXG A;  3JSV B;  1PGX A;  3ZNH B;  4NJ7 A;  2OJW A;  1B9R A;  1JRP A;  1L4Z B;  1VJK A;  3BII D;  4DDI D;  1BT0 A;  3QAQ A;  3JVZ X;  2BBC A;  2WXI A;  4RF1 A;  4GDL B;  2CU1 A;  1WWT A;  2JRI B;  2AYO B;  1L2N A;  2AEH A;  2WXR A;  3B9J A;  2WXK A;  3IFW B;  2WDT B;  4DHZ B;  2FCQ A;  1YOV B;  1MHX A;  1DOI A;  4F7Z A;  4ZYN A;  1V6E A;  4ICV A;  3QCA A;  3ZNG C;  1AYF A;  3RFZ B;  1SJH D;  4NZL B;  4IOI E;  4W9L A;  2AQ2 B;  2BS4 B;  1V1P B;  3T3N A;  3Q3M C;  1GAQ B;  4C80 A;  3RI7 C;  3SU8 X;  2KD0 A;  2REX A;  2LRU A;  5IKC M;  5IA7 A;  2JXT A;  2N1V A;  3FKY A;  3AE2 B;  1JWS D;  4RGT A;  2LFI A;  2KOX A;  3P2B A;  3D32 A;  1BUI C;  4MDK E;  1XCQ L;  2C7N B;  4P1C C;  4AQ7 A;  2Z0E B;  2BVC A;  3RMK C;  2BB5 A;  3TEW A;  4DHZ E;  3BZD B;  4KIK B;  1WXQ A;  4BOZ B;  1WGG A;  2KJ6 A;  3AEB B;  1QOB A;  1L0V B;  3R7Q A;  3Q8B A;  1EWY C;  4NAW A;  2K6D B;  1FO4 A;  4TUU A;  4FJV B;  1OQR A;  1XLQ A;  1QOA A;  2Z0D B;  2DWQ A;  4W9C A;  4TQ0 A;  2C7H A;  2LGS A;  1T0S C;  3NOB A;  1XT9 B;  4AOF A;  5TSS A;  1IYF A;  2PKO A;  1CZP A;  4W9K A;  3ETR A;  3H7P A;  2KN5 A;  2KTR B;  2Y5P A;  1MHH E;  4PT5 A;  1UF0 A;  2K39 A;  4HK2 A;  3ZUN A;  2FUG 1;  1SEB D;  2WU5 B;  4K1R B;  1WXM A;  3RUL A;  2ZW1 A;  3ECI A;  3GZN I;  3KH0 A;  4M8N A;  3Q3J A;  3AI5 A;  2N7J A;  1FD6 A;  1WY8 A;  3A1Q B;  3N1X C;  1RM6 C;  3VAW A;  4ANX A;  3P63 A;  2IYD B;  1ISN A;  2WQY B;  1RAX A;  2ON8 A;  2BWE S;  4JGH B;  2RDB C;  2WXN A;  2QDF A;  1FCC C;  5HI1 A;  1TY2 A;  4FAD A;  1NEN B;  4RNA A;  1SIF A;  3HHM A;  3JYU A;  1SGH A;  3Q69 A;  2EKE C;  3DVN V;  2JZ3 B;  1C79 A;  1K50 A;  1UUP A;  4AUQ C;  3DQV A;  4K3C A;  3MHS D;  2KC2 A;  2BTE A;  4P7I A;  3CMM B;  3ZXV A;  4AWJ A;  3PO0 A;  1AWD A;  5C1Z A;  4I6P A;  2LMC A;  3RYT A;  4DBG A;  1WF9 A;  2NMQ A;  3TUO A;  1WXA A;  3PRM B;  2RMM A;  1P98 A;  4HDO A;  3V6E B;  1YMH E;  2LHE A;  4DXA B;  2R2Q A;  1V2Y A;  3B0A A;  1D5X C;  1UWM A;  1QZE A;  2BW2 A;  2BKF A;  1FXA A;  2PMV A;  3Q3F A;  1E7V A;  5IN7 A;  1EM7 A;  3OLM D;  2G4S A;  2IDY A;  4NNJ B;  2G9H D;  2V4I B;  1UEL A;  2CKH B;  3PRZ A;  4HWI B;  3WAP A;  1XF5 L;  2JU6 X;  3DHG C;  2LXA A;  4MEL A;  2X8X X;  3Q8C A;  1E10 A;  4GDK B;  4WJP A;  2FCM A;  2PTL A;  4EZJ A;  2IGD A;  1FNW A;  3BK1 A;  4OVV A;  2E3T A;  1J19 A;  1ET6 A;  2KX0 A;  2WU2 B;  1F77 A;  2PLP A;  2PW9 A;  2WNM A;  1KOT A;  2MW5 A;  3HM6 X;  3P4P B;  2L83 A;  1I42 A;  1RFK A;  3A33 B;  2KDE B;  2WXM A;  2A4Z A;  1HXY D;  3BIN A;  3C19 A;  3UF8 A;  1OEY J;  1WMH B;  5IO9 A;  2KAN A;  2ONQ A;  3ZGZ A;  3SDL C;  1FNU A;  1QLB B;  1WRD B;  1PGA A;  2LGI A;  2K5P A;  3EHV A;  4MM3 A;  3E9S A;  2BT6 A;  2JSV X;  3LDZ E;  2BYE A;  2QIE B;  4XYC A;  4HEA 1;  5H8Y E;  1KFY B;  2KQ4 X;  2NTT A;  4ZDV A;  1VCB A;  3P4R B;  2L8J A;  1XXG A;  4N58 A;  3H8H A;  3AV8 A;  3DOW A;  1SXT A;  3B08 A;  3RNA C;  2MBO A;  3NVV A;  4HRS A;  2E6X A;  3DBH B;  3SR6 A;  1KH0 A;  4HJK A;  4F1S A;  3W5V B;  4YT0 B;  3AE6 B;  4W9H A;  3OJ3 A;  4G3X B;  5EE0 A;  2JX5 A;  1V81 A;  4FJY A;  3UI3 A;  3V61 A;  2ZCC A;  4A9A A;  3PVL A;  3W9C B;  2FAZ A;  1ACC A;  3I57 A;  1NDD A;  2KTF A;  3VHT C;  1WSP A;  2DHZ A;  5J17 A;  1RRB A;  3AE4 B;  3DBS A;  2KQ7 A;  2MCN B;  3A9K B;  1J7A A;  3X0W A;  3GP7 A;  3AEF B;  3T9L A;  1WE7 A;  3RNG C;  4M0W B;  4BKG A;  1AAR A;  4JL9 A;  4WQM A;  1XLO A;  2WXJ A;  5DPS A;  1YJ1 A;  3NZU A;  1MFW A;  1T0R C;  5CHF A;  5DPW A;  2GI9 A;  4ZRP A;  1HTO A;  3M63 B;  4YSZ B;  3VQI A;  3AE3 B;  3IBE A;  3NVY A;  4IUM B;  2VH2 A;  1ZXH A;  2Z59 B;  3RPF C;  3DBR B;  1V9J A;  4US8 A;  1YX6 B;  2K9X A;  1NEK B;  1V49 A;  3ONS A;  4JIO U;  3TJP A;  1CMX B;  4I6N B;  1ZP0 B;  4HKQ A;  4G0N B;  2KMM A;  3QK0 A;  4KV2 A;  5E6J A;  2N9K A;  3PLV A;  3R2I A;  2OOB B;  2V1Y A;  5G5G A;  4FLH A;  1J8C A;  4M00 A;  4ZYS A;  2KNB A;  3VUX A;  1AN8 A;  2IO0 B;  1ZE3 D;  3RT3 B;  5AZG A;  2CHX A;  2L3Z A;  3W1S A;  1FRD A;  4B0M A;  1SJE D;  3MC9 A;  1YN3 A;  2IJ0 A;  2LZ6 A;  2V3N A;  3BYY B;  2M0A A;  1IPG A;  3BK2 A;  1VD2 A;  4P1B C;  2UU7 A;  1JAL A;  4GLS C;  4BZA A;  4WWM A;  1EU3 A;  3DBR I;  2N9X A;  4AJY B;  3H6N A;  1YJJ A;  4YWG G;  3SHQ A;  5D6J B;  3VTW A;  1YIW A;  1GJZ A;  3NVZ A;  2FCN A;  3Q3O C;  3HVD A;  4M02 A;  2IY0 B;  4ZRI A;  4XC2 A;  2UWQ A;  2ZPY A;  1T3Q A;  3OJ4 B;  3ZXR A;  4DHJ B;  3ZW3 A;  2D3B A;  3TL5 A;  5IP4 D;  3UQB A;  2KFJ A;  2FCS A;  3QWZ B;  1P1A A;  3QQ8 B;  1L6U A;  3N1Z C;  4NAM A;  2JT4 B;  5L83 A;  2JRH A;  5MPO A;  4DK5 A;  4EZK A;  3EFC A;  3VR9 B;  1KF6 B;  4ASW C;  2WGS A;  3N3K B;  4IWO A;  4KZ0 A;  1I7H A;  3W1S C;  4MJS B;  1PUT A;  3KWL A;  4LNN A;  1SE4 A;  2MLB A;  2KC1 A;  4NQK E;  2W54 A;  1TZO A;  2WXQ A;  3A9J B;  1CQV A;  4JPS A;  1V1O A;  4E3C A;  3AEE B;  2KWD A;  2LEK A;  4JX1 C;  3Q8E A;  3OG5 A;  1WXV A;  5LLI A;  2C9W B;  2ZZP B;  1RLF A;  4JWU C;  4RM8 A;  4DHJ D;  2C60 A;  2W55 A;  4RGO S;  1YX5 B;  3DCG A;  1KTK A;  4LNK A;  3RNC C;  3NS8 A;  3MP9 A;  2BF8 B;  1I4G A;  2M4N A;  3K9P B;  4WWN A;  3TMP B;  5HHD G;  4HRO A;  4N6E B;  2N9L A;  1E8W A;  4JWS C;  3NHE B;  2PIA A;  4C56 C;  3OAW A;  1L6V A;  1IBX B;  2MWS B;  3DDC B;  5C23 A;  2O2V B;  2AL6 A;  1V97 A;  3B2F A;  3AE1 B;  3QIJ A;  2AX5 A;  5HKH A;  3UIN B;  1BML C;  2N9E B;  5AUI A;  1C1Y B;  1HEZ E;  1R4M B;  2KDI A;  3EFU A;  2K6Q A;  3PRE A;  1FCL A;  1I4H A;  2KAJ A;  2KHW B;  4RM9 A;  3WA0 A;  4HPM B;  4WAF A;  4C00 A;  1Y56 A;  4USA A;  4BVU C;  1DOY A;  3B2G A;  1T6B X;  3MC8 A;  1F0Z A;  1JWU D;  4RGN A;  3NJT A;  2V9H A;  3WIM A;  1CJE A;  3ZIM A;  3VDZ A;  4IM3 A;  2NBW B;  2WDV B;  5CX3 A;  2LVP A;  2ZW0 A;  1ZOY B;  2JZZ A;  3AE9 B;  4RFB A;  3VH4 B;  4OVZ A;  3PHW B;  4XE0 A;  2KLC A;  1PFD A;  3H1U A;  4Q2J A;  1L0X B;  3AEC B;  4D2K A;  3BVZ A;  2KWU B;  2OED A;  4HJG E;  3TBL D;  1KRH A;  4US9 A;  3IAM 1;  4L2Y A;  5H92 C;  1WGH A;  1VZ6 A;  1GC7 A;  1QOF A;  1TKE A;  2JUO A;  4WH4 A;  4C7Z A;  1UGJ A;  1NYQ A;  2XBB C;  5D94 A;  4CO7 A;  5J18 A;  1ET9 A;  4BFR A;  4EZL A;  3O13 A;  1GB4 A;  2O6V B;  1GPX A;  5L95 C;  2QJL A;  1SBB B;  1V5O A;  2I38 A;  2Q5W D;  4YTM B;  2G4D B;  3DHI C;  3CIR B;  1GC6 A;  1P3Q U;  4YXD B;  2INC C;  4LJO B;  5HFY A;  1UD7 A;  2IY1 B;  2LVQ A;  3PSE B;  2LXC A;  2NR2 A;  4UDU C;  2JYE A;  2N1W A;  2UYZ B;  2GBJ A;  3VUY A;  3CST A;  4K3B A;  2PPH A;  2K25 A;  4KDL B;  3NZS A;  4M8M A;  3ENE A;  1I35 A;  1YQ3 B;  2CJO A;  4MSQ B;  3U52 E;  3NVW A;  4W9J A;  3FIL A;  1DOX A;  2K8B A;  4AP4 C;  2LRW A;  1LQB A;  1HTQ A;  3EUB 2;  2G3Q B;  4EUT A;  2PE6 B;  2KFK B;  1N60 A;  3ML8 A;  3ZNZ B;  2GRI A;  1WZ0 A;  3ZTC A;  2NPT B;  1E8Z A;  4ARI A;  1WXS A;  2HJ1 A;  2M8S A;  1LGR A;  4A55 A;  4NY0 A;  4XDD A;  2ZVN A;  4GGQ A;  3W2D A;  5KHQ A;  3APC A;  1IGD A;  4H2A A;  2NBV B;  1V5T A;  1JWB D;  2XK5 B;  2O6V D;  4ZHO A;  1E8Y A;  3PT2 B;  2LI5 A;  4ZRQ A;  1JWM D;  2CJN A;  3J9C A;  2NS5 A;  3CWI A;  2ACZ B;  1C4A A;  4GMV A;  3KUZ A;  1QQR A;  2J7Q B;  2L00 B;  2SAK A;  5LNK 1;  1HZ5 A;  1EU4 A;  4KZC A;  2KMC A;  3WCQ A;  5LXH A;  1P0R A;  3Q3N C;  1FEH A;  4WAA A;  1UWX A;  3RUI B;  4WJN A;  1I4Q A;  4IW0 A;  3VR8 B;  1WJN A;  2LGX A;  5AUK A;  3KQ4 A;  4DWF A;  2JWZ A;  1IUE A;  2EKI A;  2N4F A;  4A20 A;  1EF1 A;  4HDQ A;  2R2O A;  2MQJ A;  3NS1 A;  4LTU A;  1WJU A;  2BS3 B;  3DWM A;  3NG0 A;  3L10 B;  1JW9 D;  4HCN B;  5HG2 A;  4KX6 B;  3HIZ A;  2VZK B;  1M94 A;  4KDI C;  4EFO A;  3MJW A;  1NI3 A;  2KVZ A;  3MTN B;  2FNJ B;  2WX0 A;  3P4S B;  2N7D A;  3V05 A;  2DZJ A;  1R4N B;  1SSN A;  1WM3 A;  1TGZ B;  3UGB B;  1J7C A;  3TCA A;  1HQR D;  4BKS A;  2GOW A;  2MBB B;  3LYY A;  1FXT B;  2KAC A;  3L16 A;  1IGC A;  2QC8 A;  3V3X A;  2MP2 B;  1TJE A;  3E56 A;  5G2N A;  4QAY A;  2LGD A;  4RCO A;  2PVG C;  3A9K A;  4NAW B;  2LD9 A;  3ZJV A;  4PYZ A;  3ZLZ A;  1MVK A;  3FC4 A;  3HM3 A;  2IPK D;  2K1F A;  1N61 A;  4R3D A;  4DDG D;  1JRU A;  2AQ3 B;  2MHJ A;  1RWS A;  2VZK D;  3EEC A;  1KLU D;  1MI0 A;  1UGM A;  2L1A A;  4NPN A;  4E74 A;  3T8M A;  2G1E A;  2EEL A;  1PGB A;  2BYV E;  1GNU A;  2L32 A;  2I2Y A;  2WLB A;  2QHO A;  3IVF A;  2CHZ A;  2M0X A;  3U7D A;  5D2M B;  3UIO B;  3QJZ A;  1Q0W B;  3U2S C;  4X57 B;  1VZ8 A;  4P6V F;  3LB8 C;  1YN5 A;  2DAF A;  2RPV A;  2GBM A;  1MJD A;  3BYT B;  4LNF A;  3UQA A;  2WDQ B;  1OTR B;  1D4B A;  2KWV B;  5BYS A;  5CHV C;  1XLP A;  3ML9 A;  2HD5 B;  3VXW A;  1ENF A;  4IKG A;  2M1M A;  2KT7 A;  4YTP B;  3GOE A;  3URY A;  3RZW C;  3PTF C;  5E6O A;  2MSE D;  3I9V 1;  2QSD A;  1MPE A;  3IXS A;  5CHW A;  4OW0 A;  2OHF A;  3I3T B;  3AN1 A;  3PZ7 A;  4IM0 A;  3RZF A;  3EC8 A;  2L7R A;  1QOG A;  1EWC A;  3DVN U;  5DCN A;  1WZ3 A;  3C8Y A;  1UBQ A;  3SFE B;  1WGY A;  1ZPS A;  4RGM A;  3ZDM C;  4CYE A;  2IO3 B;  1FNV A;  3B1L X;  5LXI B;  2JYT A;  3JW0 X;  3VVW B;  4ZOH C;  3RCZ A;  1D5M C;  2KK8 A;  1FIQ A;  1C77 A;  1WIA A;  3DHH C;  2MX2 A;  4EE2 A;  2WX1 A;  1LXD A;  5C2T B;  1R7S A;  1B1Z A;  2MBE A;  2DNF A;  2ZPN A;  2HE7 A;  2RPQ A;  1SB3 C;  4A3O A;  2BS2 B;  4J3O D;  3R66 C;  2IO1 B;  1UBI A;  4OZC A;  3DBH I;  2DYO A;  2KN4 A;  1KLV A;  4KVG B;  3P42 A;  1LO5 D;  5E6P A;  2ZEQ A;  1VZ7 A;  2JQR B;  2I1J A;  3KVF B;  1P7E A;  2HJ8 A;  1P9D U;  4FN2 A;  3N9Y C;  3I63 C;  2L52 A;  3MFG A;  1E9M A;  2EMS A;  2NVU I;  3QX1 A;  4DXF A;  2GLS A;  3W5U B;  1ZDX A;  2J42 A;  2ZJD A;  4WJO A;  2VRR B;  5T8I A;  3DBL B;  3EGR A;  2J53 A;  4MM3 B;  2DYB A;  1WR1 A;  2AL3 A;  2H89 B;  1MG4 A;  2XNA C;  4S0R A;  1E7U A;  2B76 B;  2K22 A;  1PYW D;  4M01 A;  3WAN A;  2BYF A;  5BMI A;  4KSK C;  4MGI E;  5IOI A;  3PZ8 A;  3GS2 A;  3DWG C;  4GOC A;  4MGY E;  4K7S A;  1XO3 A;  4KGT A;  1ZDV A;  2IBI B;  3SD5 A;  5JH5 C;  1TIF A;  2LUE A;  3V6C B;  1TS3 A;  2SEB D;  3L4P A;  4AJW A;  5I4D A;  4WUR A;  4LNO A;  2NCN A;  1JCK B;  1WGK A;  1WRI A;  1E7P B;  2PJH A;  3KUD B;  4MH8 A;  3JSV A;  1HA5 A;  1K51 A;  3OWE B;  4XZ4 A;  1KLG D;  5FR6 A;  1C9F A;  1SE9 A;  2L76 A;  3NUH B;  4G50 A;  4W9G A; 
#chains in the Genus database with same CATH homology
 4LDT B;  2KWU B;  1F9J A;  4WWP A;  3TBL D;  3PZD A;  3PLU A;  4FAD A;  1TZ1 A;  1WGH A;  4GDL A;  1SIF A;  3HHM A;  3JYU A;  1GC7 A;  2JUO A;  1SGH A;  1XQQ A;  2EKE C;  3DVN V;  2XBB C;  2JZ3 B;  5D94 A;  4CO7 A;  5J18 A;  4BFR A;  3V62 A;  4EZL A;  2O6V B;  3M62 B;  5L95 C;  2KZR A;  4AUQ C;  2DAJ A;  2DYM A;  1XD3 B;  3DQV A;  3MHS D;  4ZRK A;  5TR5 A;  1V5O A;  1EF5 A;  2OJR A;  1KJT A;  2KC2 A;  4P7I A;  3VH3 B;  1OQY A;  4FHJ A;  1E90 A;  2G4D B;  3AUL A;  1TTN A;  3CMM B;  4W9I A;  5CTR C;  4AWJ A;  1GC6 A;  1P3Q U;  4GIV A;  3IHP C;  5C1Z A;  4I6P A;  4LJO B;  3A4S C;  3AU4 A;  1UD7 A;  3RYT A;  2IY1 B;  2LVQ A;  5DPR A;  3PSE B;  2KMA A;  2LXC A;  4DBG A;  1WX8 A;  2NR2 A;  1WF9 A;  2N1W A;  2UYZ B;  4HVB A;  2GBJ A;  3VUY A;  4EEW A;  3CST A;  2PPH A;  1WXA A;  3PRM B;  2K25 A;  1P98 A;  1L7Y A;  4KDL B;  3NZS A;  4M8M A;  4HDO A;  3V6E B;  4MJS A;  3ENE A;  1I35 A;  4DXA B;  2R2Q A;  2IO2 B;  1V2Y A;  3QAR A;  4BOS C;  3B0A A;  1Y8R C;  1H8C A;  5JZE B;  5BO4 B;  2I1K A;  4MSQ B;  5AZH A;  1QZE A;  3WAO A;  4W9J A;  4WWO A;  3PHX B;  2BKF A;  1EO6 A;  4HXD A;  2DEN B;  2K8B A;  4AP4 C;  4HLE A;  2LRW A;  3Q3F A;  1E7V A;  3PS6 A;  1G6J A;  1LQB A;  2ZCB A;  3VUW A;  2J0K A;  2D3G A;  3OLM D;  2G3Q B;  4EUT A;  2PE6 B;  2G4S A;  2KFK B;  3CSF A;  3ML8 A;  1WJ6 A;  3ZNZ B;  4NNJ B;  2KJR A;  2ZNV C;  1WZ0 A;  3A9J A;  1UEL A;  3ZTC A;  2CKH B;  2NPT B;  3PRZ A;  4HWI B;  1E8Z A;  4LDT D;  3WAP A;  1WXS A;  1MG8 A;  4GSW A;  4GXB A;  3PV1 A;  3KUC B;  1V80 A;  2M8S A;  2C5L C;  2LXA A;  2PEA A;  3LJ3 A;  3R3M A;  4MEL A;  4NY0 A;  5KHO A;  2KDF B;  2DZM A;  2ZVN A;  4KIK A;  4BKS D;  4GDK B;  1PQS A;  4GGQ A;  2FCM A;  4WJP A;  4EZJ A;  2KXJ A;  5KHQ A;  3APC A;  3PPA A;  2NBV B;  4FUL A;  1V5T A;  2CS4 A;  4OVV A;  3U30 A;  1J19 A;  1UZX B;  2XK5 B;  2O6V D;  1E8Y A;  3H7S A;  1S1Q B;  2KX0 A;  3PT2 B;  2J0J A;  4I6L B;  1ZW7 A;  2LI5 A;  1KOT A;  2LWP A;  2MW5 A;  3V60 A;  3HM6 X;  1Q5W B;  2NS5 A;  1OGW A;  1I42 A;  3A33 B;  4GMV A;  5AZF A;  3KUZ A;  2KDE B;  2J7Q B;  2L00 B;  2A4Z A;  2WWZ A;  3BIN A;  3UF8 A;  3KYD D;  1E8X A;  1OEY J;  3L17 A;  1WMH B;  2LVO A;  2KAN A;  4G50 A;  4PS8 A;  4ZRJ A;  2EMT A;  4II3 B;  1ZGU B;  3SDL C;  1WRD B;  1OEY A;  4LCD E;  2O2V A;  4KZC A;  3X23 A;  1WH3 A;  3EHV A;  1NI2 A;  4MM3 A;  2KMC A;  1X1M A;  4NQL B;  2D07 B;  3LDZ E;  5LXH A;  1P0R A;  2BYE A;  2D2Q A;  5D7G A;  3DVG Y;  4K7W A;  4KSL C;  3ZRC A;  1WGR A;  4WAA A;  1A5R A;  2KTR A;  4W9D A;  3RUI B;  1YQB A;  4WJN A;  4IW0 A;  3AU5 A;  1WJN A;  2D10 A;  2LGX A;  4RMA A;  1RFA A;  4ZDV A;  1LM8 B;  1C3T A;  1VCB A;  2L8J A;  1H4R A;  4ANV A;  4DWF A;  2JWZ A;  2N4F A;  3HK0 A;  4A20 A;  2MBH A;  2IZV B;  1EF1 A;  3DOW A;  4HDQ A;  2R2O A;  2YVC A;  2MQJ A;  5J2R A;  4URK A;  3B08 A;  4II2 B;  4WJQ A;  2MBO A;  1UH6 A;  3K9O B;  2LGY A;  1WJU A;  3RD2 A;  3L10 B;  4HCN B;  1YD8 U;  4K7U A;  5JHB A;  3WAM A;  1Z2M A;  4HJK A;  4F1S A;  3CF6 E;  4MSM B;  3HIZ A;  3DBL I;  2D11 A;  4JLC A;  4J6I A;  3A1Q A;  4ANW A;  1Z5S B;  2KJH B;  3R7R A;  1M94 A;  4KDI C;  4W9H A;  3OJ3 A;  4G3X B;  3ZVV A;  3MJW A;  4EFO A;  5EDS A;  2JF5 A;  1V81 A;  2Y5B B;  4FJY A;  3L08 A;  3MTN B;  2FNJ B;  3V61 A;  2RR9 A;  2ZCC A;  3PVL A;  1R4M I;  2WX0 A;  2FAZ A;  2BPS A;  1NDD A;  2FIF A;  2N7D A;  4MGK E;  2KTF A;  3VHT C;  2DHZ A;  3DPD A;  3H9D A;  1RRB A;  4JQW C;  2DZJ A;  4EOY A;  4BBN F;  5J17 A;  4BKT A;  3DBS A;  2J0M A;  1WM3 A;  2LAS A;  1TGZ B;  2KQ7 A;  4ICU A;  4IM2 A;  3UGB B;  3VTU A;  5AEK B;  2MCN B;  3A9K B;  3TCA A;  1S3S G;  2RD0 A;  2GOW A;  2MBB B;  2N9P C;  3X0W A;  4BKS A;  2B3A A;  2KKC A;  1FXT B;  3T9L A;  3L16 A;  3M3J A;  1WE7 A;  2V4L A;  4M0W B;  4BKG A;  1AAR A;  4GU2 A;  4JL9 A;  2O6V A;  2MRP A;  5DPS A;  1YJ1 A;  3NZU A;  1KM7 A;  5CHF A;  5DPW A;  2MP2 B;  2L05 A;  3M63 B;  1WGD A;  3BY4 B;  4GN1 A;  2DZK A;  3VQI A;  1WJ4 A;  2CR5 A;  3IBE A;  4IUM B;  3W1Y A;  5G2N A;  2LGD A;  2Z59 B;  2KVR A;  2MBQ A;  2KDB A;  1V9J A;  3A9K A;  1YX6 B;  4NAW B;  1WYW B;  2LD9 A;  1V49 A;  3ONS A;  4JIO U;  1HE8 A;  3TJP A;  4NJ6 A;  4PYU A;  2YLM A;  4IWQ A;  4PYZ A;  1CMX B;  4PS7 A;  3S2A A;  3L0W B;  4I6N B;  1T0Y A;  3ZLZ A;  3HM3 A;  2K1F A;  1E5W A;  4FA6 A;  3QA8 A;  1GUA B;  4G0N B;  4DDG D;  2MP2 A;  4K81 A;  1JRU A;  4KV2 A;  3QK0 A;  4B9K A;  2RSU A;  3EEC A;  4LJP B;  1UGM A;  3QC8 B;  4NPN A;  4E74 A;  3PLV A;  3T8M A;  2OOB B;  2V1Y A;  2KLG A;  4MGZ E;  4FLH A;  5G55 A;  1J8C A;  4YL8 A;  2KFK A;  2KNB A;  2BYV E;  3VTV A;  3VUX A;  2K8C A;  4TQ1 A;  2IO0 B;  5DPT A;  1GNU A;  2NPT A;  3RT3 B;  5JHA A;  2JXX A;  3L54 A;  5AZG A;  2CHX A;  2QHO A;  3IVF A;  2BGF A;  2L3Z A;  3M95 A;  4TKN A;  2CHZ A;  3W1S A;  2M0X A;  3U7D A;  5D2M B;  2K8H A;  3UIO B;  4OVU A;  2LZ6 A;  4GDK A;  3QJZ A;  4IC7 B;  1Q0W B;  4X57 B;  2PE9 A;  1IPG A;  2XK5 A;  4FBJ B;  1J0G A;  4G11 A;  1VD2 A;  3N30 A;  4HPL B;  2KX3 A;  2DAF A;  3ZKJ C;  1K8R B;  4IG7 B;  2GBM A;  4GB9 A;  4A3P A;  4XX5 A;  4EKU A;  2MA9 B;  3QHT A;  3DBR I;  3UQA A;  2N9X A;  4IWP A;  1OTR B;  1D3Z A;  4AJY B;  2ZNV B;  3O65 B;  3H6N A;  2HTH A;  1WM2 A;  3JSV B;  4F8C B;  2KWV B;  3SHQ A;  3ZNH B;  5CHV C;  5D6J B;  3ML9 A;  4NJ7 A;  1WMH A;  2HD5 B;  3VTW A;  3VXW A;  1YIW A;  1GJZ A;  2W9N A;  2WYQ A;  3IG3 A;  4E71 A;  2FCN A;  4DDI D;  2M1M A;  1BT0 A;  2IY0 B;  3GOE A;  3QAQ A;  4XC2 A;  2UWQ A;  4ZRI A;  3JVZ X;  2ZPY A;  3PTF C;  3RZW C;  5E6O A;  2MSE D;  4GDL B;  5IAA C;  2CU1 A;  2JRI B;  2AYO B;  2FUH B;  1L2N A;  2AEH A;  5CHW A;  2KWC A;  2JPH A;  3ZTD A;  3OJ4 B;  3I3T B;  4DHJ B;  5GMV A;  3ZW3 A;  3TL5 A;  3IFW B;  2WDT B;  4IM0 A;  3RZF A;  4MH0 E;  4DHZ B;  2FCQ A;  3EC8 A;  3UQB A;  2L7R A;  2KFJ A;  2M17 A;  4F7Z A;  3PGE A;  4ZYN A;  3DVN U;  5DCN A;  1WZ3 A;  2FCS A;  1V6E A;  1UBQ A;  3QCA A;  3QWZ B;  4ICV A;  2GMI C;  3ZO5 B;  3APF A;  1P1A A;  3QQ8 B;  2V3S A;  1WGY A;  3ZNG C;  1LFD A;  3ZDM C;  4B95 A;  4CYE A;  2IO3 B;  3B1L X;  5LXI B;  2JT4 B;  5L83 A;  2JRH A;  3JW0 X;  4W9E A;  4ANU A;  4W9L A;  2L0F A;  4DK5 A;  4EZK A;  3VVW B;  3RCZ A;  3ZRF A;  3A4R A;  3PRP B;  4ASW C;  3N3K B;  4IWO A;  4KZ0 A;  2KK8 A;  3W1S C;  4MJS B;  3SU8 X;  1GG3 A;  2KD0 A;  3NY5 A;  1EUV B;  2G45 B;  1WIA A;  2REX A;  2LRU A;  2MLB A;  2MX2 A;  2XEW A;  1V86 A;  2GBN A;  2JY6 A;  2WX1 A;  3N32 A;  1LXD A;  2KC1 A;  3ZDT A;  4NQK E;  5IA7 A;  1WE6 A;  3VFK A;  2N1V A;  2MBE A;  2ZPN A;  2HE7 A;  2RPQ A;  4FHK A;  2KOX A;  3P2B A;  4A3O A;  3D32 A;  5E6N A;  3WAL A;  3A9J B;  3R66 C;  4MDK E;  2IO1 B;  2C7N B;  2BKR B;  2DZI A;  1UBI A;  1NBF C;  2N7E A;  2Z0E B;  3AXC A;  3DBH I;  3DVG X;  2DYO A;  4E3C A;  1U4A A;  1KLV A;  1WFY A;  4KVG B;  1ZKH A;  4DHZ E;  4KIK B;  5E6P A;  2ZEQ A;  1WX7 A;  1WXV A;  5LLI A;  4BOZ B;  1WGG A;  2KJ6 A;  2C9W B;  2ZZP B;  1RLF A;  4RM8 A;  4DHJ D;  2C60 A;  2KO3 A;  2A5U A;  1YX5 B;  3DCG A;  2I1J A;  3R7Q A;  3NS8 A;  2BF8 B;  4NAW A;  2K6D B;  2M4N A;  3KVF B;  3K9P B;  3H7P B;  2HJ8 A;  1P9D U;  2JVC A;  4WWN A;  4N9F 4;  3TMP B;  4TUU A;  4FJV B;  1R4N I;  4FN2 A;  2EMS A;  2NVU I;  1E8W A;  2Z0D B;  3QX1 A;  4WQO B;  2FID A;  3NHE B;  4W9C A;  4TQ0 A;  2C7H A;  3APD A;  3OAW A;  3UIP B;  4MEM A;  2L0T A;  2ZJD A;  4WJO A;  2VRR B;  2ASQ A;  2MWS B;  3DDC B;  5C23 A;  3NOB A;  2O2V B;  1XT9 B;  1WI0 A;  4AOF A;  2AL6 A;  2DYB A;  2BWF A;  4CHK A;  1WR1 A;  2AL3 A;  2LJ5 A;  1IYF A;  3QIJ A;  2KQS A;  3KYC D;  5HKH A;  4W9K A;  3UIN B;  1E7U A;  2N9E B;  3H7P A;  2KN5 A;  1C1Y B;  2KTR B;  4HCP B;  3WAN A;  2BYF A;  2KDI A;  3EFU A;  2K6Q A;  3PRE A;  2KHW B;  1WR6 E;  2K39 A;  1TBE A;  4HK2 A;  2ZVO A;  4RM9 A;  4HPM B;  2C7M B;  4KSK C;  4MGI E;  3WA0 A;  3ZUN A;  4BVU C;  1IP9 A;  2CHW A;  4K1R B;  1WXM A;  2AWT A;  3RUL A;  4GOC A;  4MGY E;  4K7S A;  1Q1O A;  2IBI B;  3SD5 A;  5JH5 C;  3WIM A;  3ZIM A;  3VDZ A;  2RGF A;  4IM3 A;  2NBW B;  4TV3 A;  2LUE A;  3V6C B;  3U8Z A;  3TIX A;  4BBN C;  3ECI A;  3GZN I;  5CX3 A;  3KW5 B;  3KH0 A;  4PS3 A;  4AJW A;  4M8N A;  3Q3J A;  3AI5 A;  2LVP A;  2GBK A;  2JZZ A;  4W9F A;  2NCN A;  3L13 A;  1WY8 A;  3VH4 B;  3ALB A;  3A1Q B;  3PHW B;  2PJH A;  3VAW A;  4ANX A;  3KUD B;  1WX9 A;  2GBR A;  4B6W A;  2IYD B;  2KLC A;  3JSV A;  4FJZ A;  3ZNI D;  3H1U A;  1ISN A;  1RAX A;  4XZ4 A;  2NBU A;  5FR6 A;  2BWE S;  2DX5 B;  4JGH B;  1SE9 A;  2L76 A;  3C0R B;  4W9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...