4BKTA

Von hippel lindau protein:elonginb:elonginc complex, in complex with (2s,4r)-n-methyl-1-[2-(3-methyl-1,2-oxazol-5-yl)ethanoyl]-4-oxidanyl-pyrrolidine-2-carboxamide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
103
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
publication title Is NMR Fragment Screening Fine-Tuned to Assess Druggability of Protein-Protein Interactions?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 25
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4bktA00
2UYZB 1WE7A 4W9GA 2BYEA 3APFA 4LDTD 3RZWC 1E8WA 2M17A 2LGXA 4WJPA 2ASQA 4MSMB 3ZDMC 2KC1A 4NJ6A 3ZW3A 2LI5A 3A9KB 4FJYA 4BKGA 1UBQA 1AARA 2KWUB 2K6DB 2KLGA 2ZVOA 3UINB 4A3PA 2L8JA 2MLBA 5C23A 4MELA 2K8HA 1CMXB 4TV3A 5E6OA 3ZIMA 2MP2A 1WIAA 3CMMB 5G2NA 2AWTA 2OOBB 2PE9A 5DPTA 3DVNU 2WX1A 3OJ3A 2FCQA 2N9XA 4ZRKA 3IG3A 2KVRA 2UWQA 1OEYA 5J17A 1ZKHA 4NY0A 1LFDA 1EO6A 2XK5A 1WFYA 1OGWA 3NHEB 3ZNID 1WH3A 4LCDE 3ECIA 3PZDA 2A4ZA 2DZIA 3DVGX 3ZTCA 2O2VA 4NAWA 3H7PA 2NPTB 2RSUA 3VFKA 2KFJA 4FN2A 1J8CA 3V6CB 2DAFA 4K81A 4X57B 1YIWA 2ZZPB 4BKSA 2KFKA 2IYDB 2N4FA 3BINA 2WDTB 4XX5A 5DPRA 1RFAA 2IY0B 3APCA 2J0KA 2GBKA 1Q1OA 1WY8A 2KXJA 2NCNA 5FR6A 1D3ZA 5JHAA 4ICUA 3QCAA 3ZUNA 4EKUA 5DCNA 2GBNA 5D6JB 5AZFA 5IAAC 5J18A 1WI0A 5CX3A 4EZJA 2MBQA 4AWJA 1U4AA 3L13A 3HIZA 2MA9B 4HDOA 1E5WA 1YX5B 2D2QA 2G45B 1IPGA 2LVOA 4KDLB 3RUIB 5EDSA 1WX8A 1YQBA 3KYCD 5L95C 2JPHA 3A4SC 3OAWA 4I6LB 1WXAA 3DVNV 4IWQA 3R66C 2MW5A 4GN1A 1WZ3A 2C7NB 3A9JB 3ZDTA 2NR2A 3N32A 1L7YA 3MHSD 1WMHB 2L05A 4WJNA 3M3JA 3MTNB 3QQ8B 5D94A 2FNJB 1M94A 4G3XB 1ISNA 2ZCCA 3EECA 1WGRA 3IHPC 3RZFA 2O6VD 3X0WA 4EFOA 2LGYA 4KSLC 2W9NA 2KDEB 2NBUA 1GC6A 2N1WA 4M8NA 5E6PA 5JZEB 4W9EA 3ZLZA 1VD2A 5LLIA 3WA0A 4BKSD 4JGHB 3PV1A 5AEKB 2VRRB 1WR6E 2A5UA 2BGFA 2CS4A 3QWZB 2KX0A 3ML9A 3ONSA 2ZNVC 5HKHA 4MH0E 1WGGA 4NJ7A 3KUZA 4K7SA 2V4LA 2JWZA 2RD0A 1RAXA 3LDZE 4N9F4 2JVCA 3Q3FA 3JSVB 3A1QB 2IO3B 2LRUA 5L83A 3WALA 1L2NA 2FCNA 2C60A 2J0JA 1ZW7A 4KIKA 1K8RB 2L7RA 1R4NI 4ANWA 2KWVB 4IM3A 4I6PA 2M0XA 4MM3A 2GOWA 3UGBB 2J0MA 2XBBC 1V49A 2KWCA 4HK2A 2DENB 2LD9A 2L0TA 4BBNF 1NBFC 3L10B 3RD2A 4W9JA 1V6EA 2KANA 2KTRA 3VUXA 3PSEB 1WM2A 3QARA 3L08A 4GU2A 3TBLD 3A33B 4TUUA 5D2MB 1LM8B 1P0RA 1WE6A 3JW0X 3O65B 3P2BA 2LASA 2NBVB 2GBRA 2XEWA 3C0RB 3CF6E 3ZNGC 1WRDB 3SDLC 1WXSA 2CHWA 3UQBA 3ZTDA 2KN5A 2MX2A 2YLMA 4HVBA 4NPNA 4WWOA 1YD8U 2KK8A 4HDQA 2WYQA 4HXDA 2ZCBA 3WAPA 1S3SG 4DHZB 2JZ3B 2ZPYA 3Q3JA 5AZHA 3OJ4B 2DHZA 1KJTA 1WR1A 2O6VB 3H7PB 3VXWA 3L16A 3IBEA 4PS7A 2DAJA 1KLVA 4FLHA 4EZLA 2N7EA 3D32A 2IO2B 3QHTA 2MCNB 3VVWB 4BVUC 2DYBA 2M8SA 2KJRA 2IBIB 4GGQA 2KMAA 3KUCB 4FBJB 1GUAB 2EKEC 2V1YA 4OVUA 3CSTA 5AZGA 3L17A 2KOXA 3WAOA 2ZJDA 3QA8A 1NI2A 4B95A 2OJRA 4II3B 4KZ0A 1TZ1A 2Z59B 3DQVA 5IA7A 5JHBA 1VCBA 1G6JA 4W9KA 2CHZA 1KOTA 2KJHB 4P7IA 3EHVA 4YL8A 3PLVA 1UELA 3RCZA 3K9OB 4ZRIA 2FIDA 4XZ4A 4B6WA 2LXCA 1UH6A 3RT3B 2MBBB 1UZXB 3CSFA 3V61A 3VTWA 5DPWA 4ZYNA 5CTRC 2RGFA 4W9CA 2CU1A 2MBEA 4ICVA 3IVFA 4KV2A 4W9HA 3VUWA 2C7HA 1MG8A 3B0AA 3T9LA 4JIOU 4RMAA 5D7GA 1OQYA 2AL3A 4LJPB 2AEHA 2D10A 3AXCA 4BFRA 2DZKA 3PHWB 4LDTB 4EEWA 1H8CA 2GMIC 2WX0A 2DZJA 4HPMB 5DPSA 2GBMA 2JY6A 2IO0B 1SE9A 2PJHA 2FIFA 3GOEA 3KW5B 4HPLB 2ZEQA 4ASWC 4AUQC 1I42A 1V86A 4AP4C 5J2RA 4A20A 1WX9A 2BPSA 4IWPA 3RYTA 2G3QB 2KHWB 5C1ZA 1SIFA 2K25A 3PS6A 3X23A 3NZSA 2L76A 3W1SC 4ANUA 4MGZE 1Y8RC 2MBOA 4K1RB 1OTRB 4MDKE 2DYMA 2JXXA 1P1AA 3VAWA 1NDDA 4KZCA 1V2YA 1C1YB 1LQBA 2L0FA 4A3OA 3EFUA 3QAQA 2KQSA 2KC2A 3R7RA 4IUMB 4HJKA 1SGHA 3TIXA 3UIOB 4IG7B 3VH4B 3NY5A 3ZKJC 4LJOB 2RPQA 2I1KA 3WIMA 1YJ1A 2BKFA 4GDLA 3PRMB 1OEYJ 2KTFA 4ZRJA 1UD7A 2KKCA 2D07B 4GDKA 3DBSA 2KO3A 2L3ZA 1R4MI 2MQJA 4MGKE 4E3CA 1UGMA 1E8ZA 5BO4B 2KDIA 2KD0A 2MBHA 2KTRB 4F1SA 2N9EB 5CHFA 1XT9B 1YX6B 2LRWA 3ALBA 3MJWA 4K7WA 3ZRFA 2KZRA 4MGYE 2JUOA 3I3TB 2K1FA 3QC8B 3V60A 2LGDA 4RM9A 4ZDVA 3OLMD 3PTFC 2LJ5A 4G0NB 2AYOB 2CR5A 4EUTA 1WMHA 4GB9A 4RM8A 2AL6A 3DBLI 2N7DA 4HCNB 3ZNHB 2QHOA 1RRBA 1WXMA 2HJ8A 1F9JA 2EMSA 2LXAA 2MP2B 3JVZX 1WM3A 3U8ZA 4CYEA 2FAZA 2KDBA 1E8YA 3AULA 4I6NB 2FCMA 4E74A 4NNJB 3DPDA 2Z0DB 1Q5WB 2MRPA 2DX5B 4XC2A 2XK5B 1E90A 2B3AA 3PRZA 2ZPNA 4FHJA 1P3QU 2NS5A 4DBGA 1A5RA 3N3KB 4EOYA 1WX7A 2LVQA 4M0WB 4W9FA 3SD5A 3IFWB 1J19A 1WJ4A 2D11A 3DOWA 3JSVA 3A1QA 1Q0WB 1WJ6A 2CKHB 3SU8X 2C5LC 4BKTA 2O2VB 4NAWB 1EF5A 2BF8B 2HE7A 3K9PB 3V6EB 3W1YA 2WWZA 4GSWA 2YVCA 4MJSA 4W9DA 2KFKB 2G4SA 3H1UA 2RR9A 1J0GA 3DBHI 1PQSA 4DHJD 2LZ6A 3GZNI 4W9LA 4MEMA 2KDFB 3NS8A 4HWIB 1X1MA 2BYFA 2DZMA 2K8CA 3VUYA 2LWPA 1E7UA 4G11A 3UQAA 3TL5A 3AU5A 2LVPA 1XQQA 2JF5A 4GOCA 3PLUA 1WGHA 4IC7B 3VTVA 2C7MB 3AI5A 1EF1A 3ZNZB 1TGZB 5JH5C 4DDGD 3B08A 4DWFA 3VDZA 4ANXA 3ML8A 1RLFA 1T0YA 1QZEA 4IM0A 2BWFA 3BY4B 1GG3A 4FADA 3A4RA 3A9KA 2M4NA 1GNUA 4DXAB 4BOSC 1GC7A 4AJWA 5GMVA 2IY1B 3L54A 4JL9A 4PYZA 1BT0A 4DK5A 1WF9A 1WGYA 1KM7A 3NOBA 2DYOA 4FJZA 3T8MA 2BYVE 1P98A 2IO1B 2JT4B 3KYDD 4MSQB 2M1MA 5TR5A 4CO7A 4FHKA 3RULA 2FCSA 2G4DB 2HTHA 2O6VA 2PPHA 4WWPA 3HM3A 4E71A 2BKRB 3R3MA 4KVGB 4EZKA 4URKA 4AOFA 3M95A 3L0WB 3QJZA 4ANVA 4CHKA 3VQIA 5KHOA 4KDIC 2KJ6A 3DCGA 1P9DU 3LJ3A 3QK0A 3DDCB 5G55A 1V80A 1HE8A 4PS8A 4GDLB 3HM6X 2K39A 2JZZA 1TTNA 3PHXB 3M62B 1E8XA 4WQOB 3VTUA 3PREA 4BOZB 5LXIB 2NPTA 3DBRI 4GDKB 3KUDB 3B1LX 4BBNC 4WJQA 2MWSB 5E6NA 4PS3A 2R2OA 3H9DA 4FJVB 2N9PC 2KLCA 4HCPB 3QIJA 3SHQA 4F8CB 5LXHA 1E7VA 2K6QA 3NZUA 3ZO5B 2JRHA 3WAMA 3M63B 4FULA 1Z2MA 2PEAA 4GIVA 1JRUA 5CHWA 4DHJB 4K7UA 2V3SA 3AU4A 1WJUA 2N1VA 3TCAA 4KIKB 3PGEA 1WJNA 2Z0EB 3U7DA 1IYFA 4JQWC 1IP9A 2L00B 3JYUA 2I1JA 3PPAA 4OVVA 4AJYB 1V81A 2C9WB 2EMTA 2HD5B 4II2B 3EC8A 1S1QB 4IM2A 2PE6B 3U30A 2NBWB 3DVGY 4MGIE 4DHZE 2GBJA 4W9IA 2MSED 2R2QA 1H4RA 1WXVA 3TJPA 1C3TA 3R7QA 3UIPB 1WGDA 2KX3A 2NVUI 3N30A 3KVFB 4TQ1A 4WWNA 4FA6A 3HK0A 3HHMA 3A9JA 3WANA 3PRPB 1V5OA 4PYUA 4J6IA 3UF8A 4IW0A 2KQ7A 2FUHB 5KHQA 1TBEA 2KMCA 2ZVNA 3VH3B 1XD3B 4B9KA 3H7SA 4GXBA 2D3GA 2J7QB 1WZ0A 3ENEA 4NQLB 4JLCA 2JRIB 4IWOA 3PT2B 4TKNA 3ZRCA 4KSKC 4WAAA 3W1SA 2Y5BB 4DDID 3QX1A 1WYWB 2BWES 4WJOA 3S2AA 1V9JA 1UBIA 1V5TA 4HLEA 1ZGUB 3H6NA 3KH0A 2KNBA 4MJSB 2IZVB 5CHVC 2ZNVB 4F7ZA 3PVLA 1EUVB 4M8MA 4GMVA 1FXTB 3V62A 1LXDA 3ZVVA 1I35A 1GJZA 3APDA 3TMPB 3VHTC 2LUEA 2CHXA 2K8BA 1Z5SB 4TQ0A 4NQKE 4G50A 2REXA
chains in the Genus database with same CATH superfamily
3APFA 2J4XA 1E8WA 2IGDA 4A90A 5IOIA 1RM6C 4BKGA 1AARA 2K6DB 2Y3AA 3RNGC 2L8JA 2IDYA 4ACFA 2MLBA 5C23A 4MELA 3BVMA 2DBYA 5G2NA 2AWTA 5DPTA 3DVNU 2WX1A 2V3NA 2J52A 1OEYA 1ZKHA 1L6UA 2Y5CA 3ZNID 2PKOA 4NZLB 2WXGA 1JMLA 5FK9C 3HVZA 4ZRPA 1SBBB 3PZ8A 1MI0A 2O2VA 1KLGD 2RSUA 2KFJA 4FN2A 1J8CA 2LHEA 4Q2JA 2W82A 2ZZPB 1GB1A 3APCA 2J0KA 2GBKA 2WGSA 2KMMA 1Q1OA 1WY8A 1GOZA 5JHAA 3AM9A 4ICUA 4RF1A 1ZP0B 5AZFA 1WI0A 5CX3A 4EZJA 2MBQA 4AWJA 1L4DB 4MT5A 3HIZA 5BYQA 1IPGA 2INPE 3RUIB 1WX8A 4USAA 3A4SC 2M19A 2BBCA 1WXAA 3AEAB 4GN1A 2C7NB 4DQOC 1B1ZA 3ZDTA 1B9RA 3MC0B 1TKGA 2L83A 3H8HA 3M3JA 5D94A 3T3NA 1ISNA 2GB1A 2HDEA 4KSLC 2NTSA 2NBUA 2M56B 5LLIA 5BYRA 4C7ZA 5AEKB 4ARIA 3ML9A 1XLOA 2N0SB 2V4LA 2JWZA 3VR9B 3A1QB 1RWSA 3Q8BA 1ZW7A 1FXAA 3AE5B 1J7AA 1IBXA 4NAMA 3UGBB 1PFDA 1YJIA 4W9JA 1V6EA 3HUIA 3QARA 3L08A 1TY0A 5D2MB 4P6VF 2LASA 2XEWA 1SE2A 3ZNGC 3FC4A 5BMIA 2YLMA 1TY2A 4HDQA 4UDUC 4DHZB 2JZ3B 3RNAC 2ZPYA 1AW7A 5AZHA 3OJ4B 3VR8B 3NVWA 2GI9A 2IBIB 1VDVA 1YQ4B 4FBJB 3ETRA 5AZGA 3WAOA 3Q3MC 2D3CA 5IA7A 2ACZB 4IDIA 1G6JA 1UELA 3RCZA 1UZXB 4ZYNA 5CTRC 2MBEA 4W9HA 3VUWA 2C7HA 3R2TA 3T9LA 4JIOU 1OQYA 2INDC 4EEWA 3PHWB 4LDTB 1K52A 2GMIC 2DZJA 4AUQC 3GOEA 1SXTA 3DBLB 2BPSA 4IWPA 3RYTA 2KHWB 2CJNA 1T0RC 1MHHE 2QCZA 4ANUA 4KGTA 2WXHA 4C56C 2QSDA 4MDKE 1N63A 2JXXA 1NDDA 1V2YA 2L0FA 3AE6B 4A3OA 4MACA 2KQSA 4HJKA 4IG7B 2PVOD 4LJOB 5EE9A 4EE2A 3PRMB 1OEYJ 2N9KA 1UD7A 2IPKD 2CU3A 4RGNA 2KO3A 2L3ZA 4MGKE 3BK1A 1E8ZA 4LNKA 3TEZA 3DBHB 4F1SA 5CHFA 2LRWA 1YX6B 3ALBA 2PTLA 2RMMA 3I3TB 3V60A 1EWYC 1UWMA 1YNTE 2MJ3A 4GB9A 1YJJA 3DBLI 4HCNB 2K3UA 1C76A 1WXMA 1WM3A 2FAZA 2E3TA 4I6NB 2FCMA 1NENB 4FXCA 1K51A 2Z0DB 2MRPA 2DX5B 1T0QC 1E90A 2B3AA 2V3PA 4FHJA 2NS5A 3Q8FA 2LVQA 2XN9C 4W9FA 2QILA 3A1QA 3B2GA 4BKTA 1EF5A 2Z8LA 3OWEB 1VZ8A 3AH7A 2RR9A 3B9JA 4B0MA 3DBHI 3NRZA 2BS3B 1ENFA 2NMQA 2KQ4X 2SEBD 4HWIB 1X1MA 2K8CA 2LWPA 1E7UA 2SAKA 2LVPA 4GOCA 4IC7B 2UU7A 1EF1A 3ZNZB 4DWFA 3P4SB 3ML8A 1RLFA 3Q2AC 1JWAD 2BWFA 3BY4B 4FADA 3A9KA 3BK2A 5G5HA 1YN5A 4DXAB 1XF5L 5EE0A 3L54A 3EFCA 3LB8C 4DK5A 1KM7A 1DYQA 3T8MA 2RDHA 2JT4B 2M1MA 3RULA 3HM3A 4QAYA 3MC9A 1XLNA 3QJZA 4YSYB 1WRIA 3ABVB 5KHOA 1QT9A 3DCGA 1ZDVA 2AQ3B 3U2SC 3DDCB 1HE8A 2K39A 2JZZA 3PHXB 3VTUA 1E8XA 4WQOB 5HG2A 4WIPA 4JE3B 1MFWA 4PS3A 2N9PC 1R7SA 2KLCA 2JU6X 3AB5A 2K6QA 3NZUA 3ZO5B 3M63B 1D5ZC 2QDFA 2V3SA 1CQVA 4KIKB 1YOVB 4JQWC 2I1JA 3GE3C 4MGIE 4M00A 3RN9C 1H4RA 1JW9D 1NEKB 3MHZA 3TEYA 3NZ3A 1WGDA 5JXVA 3NG0A 4KGRA 4WWNA 3HHMA 3PRPB 4PYUA 4J6IA 3UF8A 4IW0A 2KQ7A 1ZUD2 5KHQA 4KX6B 2KMCA 3VH3B 3BVGA 4GXBA 5HFYA 4RH6A 4JLCA 1FMAD 3C19A 3PT2B 3ZRCA 3W1SA 4DDID 2BWES 1ZGUB 2AQ2B 2WS3B 2IZVB 1HZ5A 2ZNVB 5CHVC 4GMVA 1FXTB 1MJDA 2INCC 3FAHA 3VHTC 2LUEA 5TSSA 3N1YC 4MSMB 3ZDMC 3FILB 2KC1A 4K3CA 4NJ6A 2KAJA 1YQ3B 2KWUB 3VRAB 2ZVOA 3AECB 4JWUC 1XCQL 3URYA 1TJEA 3GS2A 3CMMB 1FFUA 3OJ3A 2N9XA 3Q8CA 4HRSA 3IG3A 2KVRA 2UWQA 3DWMA 5J17A 4B0EA 2ZW0A 4YSXB 1WH3A 3ECIA 2DZIA 4DXGA 3RNFC 3DVGX 3ZTCA 2AX5A 2BB5A 3VFKA 2RDBC 4K81A 1QLBB 1FCCC 2IYDB 2N4FA 3RNCC 2WDTB 3BYYB 3GP7A 4N59A 2WXNA 5FR6A 1D3ZA 2D3AA 2GBNA 5D6JB 1DOXA 1U4AA 4IOIE 1YX5B 4KDLB 2LVOA 3DHIC 4BZAA 1YQBA 2L52A 3R66C 3W9CB 1WZ3A 2NR2A 2WDQB 1L7YA 2JWUA 1WMHB 1SEBD 1UNSA 3MTNB 2ON8A 2FNJB 2V4IB 2LGYA 3T3OA 4BKSD 2MHJA 2QIEB 2H89B 2BGFA 2KX0A 4MH0E 1WGGA 1V1OA 3KUZA 4K7SA 2JVCA 3RPFC 2IO3B 3NJTA 4XE0A 1L2NA 1KRHA 4IKGA 1I4GA 4KIKA 4XGAB 4I6PA 2M0XA 1V49A 4HK2A 2JXTA 2DENB 2WHIA 1T3QA 3BVZA 2L0TA 4BBNF 4ZRQA 4OZBA 4A9AA 2KANA 1WM2A 4A6QA 3TBLD 2MEKA 2PMVA 2WXMA 2KT7A 2LMCA 1P0RA 1WE6A 3JW0X 1QILA 4J3OD 4D2KA 2NBVB 3C0RB 2WXRA 3CF6E 4P1CC 5EE3A 5BYSA 3IT4B 4HVBA 4NPNA 1HXYD 1YD8U 4HXDA 4WH4A 2ZCBA 3Q3OC 3WCQA 1A70A 2DHZA 1WR1A 3H7PB 1DGJA 3IBEA 2FE8A 3LXFA 3PO0A 1BMLC 2DAJA 2IO2B 2LGIA 1L5PA 1SJHD 4GGQA 1N61A 2EKEC 1UUPA 1MHXA 3CSTA 2Z59B 3DQVA 5JHBA 1EWCA 4LLGM 3FILA 4OZAA 4YTNB 2KJHB 3LYYA 1R4MB 3PLVA 4KKJA 2FIDA 4ZRIA 4B6WA 3RT3B 2MBBB 3CSFA 3VTWA 5DPWA 2RGFA 4W9CA 1F2RC 2CU1A 4KV2A 5BMHA 3B0AA 5D7GA 2AL3A 4REZA 2DZKA 2WX0A 2KWDA 4HPMB 2ICIA 3U52E 5E6JA 2IO0B 2PJHA 3KW5B 1FEHA 2PVGC 2G3QB 1PGAA 3PS6A 3W1SC 1JQ4A 2WXLA 4MGZE 1TS2A 2DLBA 2MBOA 4K1RB 1OTRB 1STEA 3VAWA 4KZCA 2CJOA 3E9SA 3QAQA 3AE4B 4IUMB 3ZGZA 3TIXA 3UIOB 2RPVA 3Q3NC 2WU5B 4P1BC 3WIMA 2BS2B 2KTFA 2K0PA 3P4RB 3AEFB 2KKCA 4MM3B 2D07B 3DBSA 1AWDA 1R4MI 5BO4B 2KDIA 4DXFA 2KTRB 3Q14C 1QOGA 3GZNB 2BYTA 2LGDA 4RM9A 4A8XC 3HVDA 3OLMD 3PTFC 1SSNA 4G0NB 2CR5A 1WMHA 1GAQB 2D5GA 1V1PB 3IXSA 3ZXRA 2BS4B 1RRBA 2HJ8A 3AV8A 3AE1B 2MP2B 3JVZX 4CYEA 4RGMA 3P1MA 4NNJB 4TSSA 1N5WA 1Q5WB 3EA6A 4XC2A 1DOYA 4YTPB 3N3KB 4M0WB 2VH2A 2K22A 1J19A 2D11A 3IFWB 3DOWA 1WJ6A 3NVYA 3K9PB 3V6EB 4NJCA 2OEDA 4GSWA 4MJSA 1V8CA 3ZQ4A 1PQSA 3GZNI 4W9LA 2KDFB 2L32A 2LJIA 1TS5A 2DZMA 3VUYA 4G11A 5FKAC 3AU5A 2KYWA 2JF5A 3PLUA 2V9HA 3VTVA 2KDMA 1Y56A 3MC8A 1RFKA 1NI3A 4DDGD 1HA5A 3AE2B 3B08A 5MPOA 1T0YA 1QZEA 2INNE 2M4NA 1GNUA 1GC7A 2W3RA 2IY1B 4JL9A 1QOBA 1WF9A 1WGYA 2DYOA 2BYVE 1ROEA 1MPEA 4CO7A 2WLBA 2G4DB 3I9V1 2WXKA 1TIFA 3EUB2 4EZKA 4AOFA 3M95A 3L0WB 1EU4A 4C7YA 4ANVA 4CHKA 2B76B 2K5PA 2KJ6A 5I4DA 1SB3C 1V80A 1FD6A 4GDLB 2DWQA 3DBRI 4GDKB 3KUDB 1PUTA 3IT6B 3H9DA 4F8CB 4LNNA 3V3XA 3QIJA 2JRHA 3IAS1 4FULA 3WAMA 2D3BA 2WQYB 5CHWA 1C4AA 3MFGA 3AU4A 3TCAA 2N1VA 3KQ4A 3PGEA 1WJNA 2WNMA 3PPAA 1VZ6A 4AJYB 4II2B 2IJ0A 2GBJA 4LK0M 3TJPA 4HKQA 1YN4A 3N30A 1PGXA 1L0VB 4FA6A 2H88B 2YEPF 2QC8A 2J7QB 3ENEA 4NQLB 4US8A 4JX1C 4OZCA 4TKNA 4YWGG 2Y5BB 1WYWB 1V9JA 1UBIA 1E6EB 1EUVB 4M8MA 1LXDA 1E10A 1I35A 1GJZA 3W5VB 2FUG1 3TMPB 1EU3A 2CHXA 1Z5SB 4TQ0A 4NQKE 3Q6BA 1F2RI 4KGSA 1WE7A 4W9GA 2BYEA 5C2TB 3RZWC 4XWWA 2M17A 1I4HA 2LGXA 1K53A 2ASQA 3N1ZC 3SFEB 1XEEA 3ZW3A 2LI5A 4FJYA 1UBQA 3UINB 4A3PA 2N7JA 1FNWA 5E6OA 2MP2A 2OOBB 2WXFA 1C4CA 2RDGA 3C8YA 2WXQA 4OHJA 3J9CA 1FRRA 1EO6A 3N1XC 1OGWA 2G9HD 3NHEB 1C79A 4M0WA 2WDRB 2A4ZA 1WSPA 4CQNA 2NPTB 4K3BA 2W54A 2DAFA 1JALA 4XX5A 5DPRA 2BB6A 3VRBB 5HI1A 3RNEC 2K9XA 2NCNA 3QCAA 1NVID 4EKUA 5IAAC 1R4NB 2MA9B 4HDOA 4KKIA 1E5WA 1ZE3D 5EDSA 2HJ1A 1EM7A 3KYCD 5L95C 2JPHA 5H92C 4I6LB 1P7FA 3DVNV 4IWQA 1SE3A 1ZOYB 3A9JB 3W2DA 2YEPB 4RF0A 4L2YA 3OG5A 1C9FA 3BYTB 1M94A 2L1AA 4G3XB 2ZCCA 3EECA 1WGRA 3RZFA 3X0WA 2KDEB 4M8NA 1GC6A 2N1WA 5JZEB 1IUEA 5E6PA 1TKYA 3WA0A 3PV1A 2VRRB 1LO5D 1VJKA 1WR6E 1PDXA 3QWZB 3U4EG 5HKHA 4RCOA 1YN3A 1WWTA 1JWBD 2RD0A 3LDZE 4N9F4 4RGTA 1CJEA 2FCNA 2L7RA 1R4NI 4RGOS 2GOWA 2J0MA 1VRAB 2KWCA 3GE8C 2JSVX 3RD2A 1KFYB 1N6ZA 3VUXA 1I4RA 3PSEB 1FFVA 2GRIA 4GU2A 4TUUA 2BW2A 1JRPA 4WAFA 1UGJA 3O65B 3P2BA 2GBRA 3O13A 4OVZA 1YMHE 1WXSA 4C4VB 3ZTDA 4WWOA 2WYQA 3WAPA 3Q3JA 4XDDA 1KJTA 2KN4A 3L16A 3BIID 4PS7A 1SE4A 3D32A 2DYBA 2I38A 2KMAA 3KUCB 3TEXA 4OVUA 4N58A 2ZJDA 3QA8A 1NI2A 4B95A 2OJRA 4II3B 4US9A 1TZ1A 3KLSX 1VCBA 3R8BA 4BAXA 4W9KA 5GXGB 1KOTA 4YL8A 4ZHPA 3K9OB 2LXCA 1V97A 4YXDB 2OHFA 4LJPB 3AXCA 2N9LA 3RNBC 2JY6A 1SE9A 2XNAC 4HPLB 4ASWC 2PIAA 1VLBA 3NUHB 1BXTA 1QF6A 1I42A 1V86A 5J2RA 1J7BA 5C1ZA 1SIFA 1QOAA 1RYJA 3X23A 2MJDA 3NZSA 2L76A 3Q8AA 4TMAB 1Y8RC 3P42A 1PYWD 4ZHOA 3P63A 1P1AA 3U7ZA 1C1YB 1LQBA 2KC2A 2JX5A 3SR6A 3KWLA 3VH4B 3ZKJC 4JWSC 4LNOA 1T5XD 2BKFA 3ZJUA 1C4PA 2MQJA 3I63C 1UGMA 2KD0A 4ARCA 1C78A 3MJWA 4MGYE 2JUOA 2K1FA 3QC8B 2IGHA 2LJ5A 2AYOB 5IP4D 1CZPA 4RM8A 2N7DA 2LXAA 3U8ZA 5LNK1 2KDBA 1JROA 4N6EB 1ET6A 3R2IA 2WP9B 1NYRA 2XK5B 1F0ZA 3PRZA 3RI7C 2ZPNA 1P3QU 1F1HA 1L0YB 1WJ4A 2CKHB 4NAWB 3W1YA 2BF8B 1FO4A 2WXOA 2YVCA 4W9DA 2KFKB 2G4SA 3H1UA 1KH0A 4DHJD 2LZ6A 3DWGC 2BYFA 3UQAA 3TL5A 2KVZA 1WGHA 1SIJA 3AI5A 1XCTL 1FCLA 5JH5C 1IGDA 2BTEA 3VDZA 1FRDA 3A4RA 5G5GA 1I4PA 3CIRB 4S0RA 4C4VA 2WXJA 4BOSC 5GMVA 3TSSA 4PYZA 1BT0A 2Q5WD 2LFIA 2PW9A 3AEBB 1P98A 1ZXHA 2IO1B 3P4QB 2FCSA 1HEZE 2PPHA 1NYQA 3R3MA 4HJGE 1HTOA 4URKA 5H8YE 1JWSD 4YT0B 1N5XA 5D3IB 2LEKA 5AUKA 1FM0D 4XYCA 3LJ3A 3QK0A 1IGCA 1JWMD 5G55A 4PS8A 5FR3A 1D5XC 4RNAA 1I4XA 1FPYA 1TTNA 3M62B 4BOZB 3PREA 3HRDD 2MWSB 5E6NA 1VZ7A 2R2OA 4FJVB 4HCPB 2TSSA 5LXHA 1E7VA 1Z2MA 2OJWA 4GIVA 1JRUA 4DHJB 4K7UA 2MH7A 1VR9A 2W3SA 4XWTA 2Z0EB 1K50A 3U7DA 1T0SC 2L00B 1SF0A 2C9WB 2HD5B 2PE6B 3U30A 2NBWB 4W9IA 1WXVA 1CK1A 2AQ1B 1GB4A 2QMTA 2KX3A 2NVUI 1HTQA 2FBWB 3MJ5A 3HK0A 4C80A 3WANA 2LUMA 1D6EC 4HROA 2FUHB 2ZVNA 3TUOA 4B9KA 3H7SA 3ZYYX 1WZ0A 2EELA 1MVKA 2BQQA 4AQ7A 5IKCM 3EGRA 1V5TA 4O1NA 4HLEA 1TS4A 4F7ZA 3PVLA 3IAM1 3V62A 3ZVVA 3APDA 4G50A 2UYZB 2JZPA 4LDTD 1D5MC 4WJPA 5D3DA 2WXIA 3DBRB 3A9KB 4LTUA 1KTKA 2KLGA 1D4BA 1FNVA 1TYGB 3RFZB 4LNIA 2K8HA 1CMXB 4TV3A 3ZIMA 1WIAA 1HQRD 2PE9A 1XLPA 1JWUD 2FCQA 4ZRKA 3DHHC 2JYTA 4NY0A 1LFDA 2XK5A 1WFYA 1GPXA 3N9YC 4LCDE 3PZDA 2Y5PA 2EKIA 4MH8A 4NAWA 3H7PA 2MJEA 3V6CB 4BKSA 4X57B 1YIWA 3W5UB 2KFKA 4ITKA 3BINA 1RFAA 2IY0B 2ZW1A 3AEDB 2KXJA 4L23A 2JQRB 3ZUNA 5DCNA 5J18A 1L0XB 3L13A 2D2QA 2G45B 3OAWA 3ZJTA 2BT6A 3PZ7A 2MW5A 3DHGC 3N32A 4PT5A 4HEA1 2PLPA 3MHSD 3RMKC 3I5JC 3I57A 1XXGA 2L05A 1TS3A 2LHDA 4WJNA 3QQ8B 4PK1A 1UF0A 3IHPC 2O6VD 4ZOHC 4EFOA 2W9NA 1OQRA 4W9EA 3ZLZA 1VD2A 4WWMA 4JGHB 3Q69A 1L6VA 1OFFA 2W55A 1ZXIA 2A5UA 2CS4A 1KF6B 3ONSA 2ZNVC 4NJ7A 4HPPA 1RAXA 3Q3FA 3JSVB 4ZYSA 2LRUA 5L83A 1ZDXA 5HHDG 3WALA 2C60A 1P7EA 2J0JA 1K8RB 4ANWA 2KWVB 4IM3A 3P4PB 4MM3A 2XBBC 2LD9A 1QQRA 3GB1A 1NBFC 3L10B 2KTRA 5EE1A 3SEBA 1ACCA 2BVCA 3A33B 3V05A 1LM8B 4LNFA 2DNFA 1WRDB 2M0AA 3SDLC 2CHWA 3UQBA 1WGKA 2KN5A 2MX2A 1MG4A 1V1PA 2KK8A 4YSZB 1S3SG 4XDCA 1TZOA 5T8IA 4L1BA 1Q10A 2O6VB 1FNUA 3VXWA 4RFBA 1C77A 1KLVA 4FLHA 4EZLA 2N7EA 3QHTA 2MCNB 3VVWB 4BVUC 1SJED 2M8SA 2KJRA 1UWXA 2HTME 1GUAB 4WQMA 2V1YA 1AN8A 2QEJC 3L17A 2KOXA 2JYEA 1QOFA 4KZ0A 5BMGA 3N20C 1ET9A 2CHZA 4P7IA 3EHVA 4XZ4A 1QKZA 1UH6A 3V61A 4HKZE 3NS1A 4ICVA 3IVFA 1MG8A 1F77A 4RMAA 1ESFA 2AEHA 2D10A 1H8CA 4BFRA 5DPSA 2GBMA 3KWVA 2FIFA 2ZEQA 4AP4C 4A20A 1WX9A 1AYFA 2K25A 1FIQA 4AS1A 1XLQA 2KACA 1J7CA 3AEEB 2DYMA 1BUIC 3EFUA 2R61A 3R7RA 1SGHA 4R3DA 3NY5A 2RPQA 2I1KA 1YJ1A 1T6BX 1WXQA 4GDLA 4H2AA 1N62A 4ZRJA 3B2FA 4GDKA 2VZKD 4E3CA 1WYGA 2VH1A 1FXIA 1TT5B 4A55A 2MBHA 2N9EB 3L4PA 1XT9B 4K7WA 1E7PB 3ZRFA 2KZRA 3AN1A 4ZDVA 3AE8B 3MP9A 3NVVA 4EUTA 2AL6A 3ZNHB 2QHOA 3UI3A 1DOIA 1F9JA 2EMSA 1E8YA 3AULA 1E0ZA 4E74A 3DPDA 1E9MA 3AE9B 3Q8EA 4DBGA 1A5RA 2J53A 4EOYA 1WX7A 3SD5A 3JSVA 2GLSA 1Q0WB 4S17A 3SU8X 2C5LC 1I7HA 1OQQA 2O2VB 2HE7A 2WWZA 1J0GA 1HZ6A 5AUIA 4MEMA 2VZKB 3NS8A 1JCKB 3SFDB 1XO3A 1XQQA 2C7MB 3FKYA 1TGZB 5IO9A 4ANXA 4IM0A 1GG3A 4M01A 3AMZA 3E56A 2V0GA 1ZPSA 4AJWA 3AEGB 2ONQA 3NOBA 4JPSA 4FJZA 5IN7A 2IGGA 3KYDD 4MSQB 5TR5A 4FHKA 2O6VA 2HTHA 4GLSC 4WWPA 1F52A 4E71A 2BKRB 4KVGB 3VQIA 1M4VA 1L4ZB 2E6XA 4KDIC 3ZXVA 1P9DU 3HM6X 4OW0A 2LGSA 5LXIB 2NPTA 3B1LX 4BBNC 4WJQA 3ZJVA 2I2YA 3SHQA 4C00A 2PEAA 1LGRA 4M02A 1WJUA 1IBXB 2WU2B 1IYFA 1IP9A 2J42A 3JYUA 4OVVA 2X38A 3TEWA 1V81A 2EMTA 3EC8A 1S1QB 2WXPA 4IM2A 2NTTA 3AE3B 3DVGY 2X8XX 4DHZE 2MSED 3AE7B 2R2QA 1C3TA 4P16A 3R7QA 3UIPB 3KVFB 4TQ1A 1PGBA 2WDVB 1I4QA 2G1EA 3A9JA 1N60A 3BWUD 1V5OA 2QJLA 1TBEA 1XD3B 2D3GA 2JRIB 3NVZA 4IWOA 1TKEA 4KSKC 4WAAA 3QX1A 3S2AA 4WJOA 1KLUD 3H6NA 2KNBA 3KH0A 4MJSB 3CWIA 5C3JB 3BZDB 2K8BA 4YTMB 2REXA 4WURA
chains in the Genus database with same CATH topology
2UYZB 1WE7A 4W9GA 2BYEA 3APFA 4LDTD 3RZWC 1E8WA 2M17A 2LGXA 4WJPA 2ASQA 4MSMB 3ZDMC 2KC1A 4NJ6A 3ZW3A 2LI5A 3A9KB 4FJYA 4BKGA 1UBQA 1AARA 2KWUB 2K6DB 2KLGA 2ZVOA 3UINB 4A3PA 2L8JA 2MLBA 5C23A 4MELA 2K8HA 1CMXB 4TV3A 5E6OA 3ZIMA 2MP2A 1WIAA 3CMMB 5G2NA 2AWTA 2OOBB 2PE9A 5DPTA 3DVNU 2WX1A 3OJ3A 2FCQA 2N9XA 4ZRKA 3IG3A 2KVRA 2UWQA 1OEYA 5J17A 1ZKHA 4NY0A 1LFDA 1EO6A 2XK5A 1WFYA 1OGWA 3NHEB 3ZNID 1WH3A 4LCDE 3ECIA 3PZDA 2A4ZA 2DZIA 3DVGX 3ZTCA 2O2VA 4NAWA 3H7PA 2NPTB 2RSUA 3VFKA 2KFJA 4FN2A 1J8CA 3V6CB 2DAFA 4K81A 4X57B 1YIWA 2ZZPB 4BKSA 2KFKA 2IYDB 2N4FA 3BINA 2WDTB 4XX5A 5DPRA 1RFAA 2IY0B 3APCA 2J0KA 2GBKA 1Q1OA 1WY8A 2KXJA 2NCNA 5FR6A 1D3ZA 5JHAA 4ICUA 3QCAA 3ZUNA 4EKUA 5DCNA 2GBNA 5D6JB 5AZFA 5IAAC 5J18A 1WI0A 5CX3A 4EZJA 2MBQA 4AWJA 1U4AA 3L13A 3HIZA 2MA9B 4HDOA 1E5WA 1YX5B 2D2QA 2G45B 1IPGA 2LVOA 4KDLB 3RUIB 5EDSA 1WX8A 1YQBA 3KYCD 5L95C 2JPHA 3A4SC 3OAWA 4I6LB 1WXAA 3DVNV 4IWQA 3R66C 2MW5A 4GN1A 1WZ3A 2C7NB 3A9JB 3ZDTA 2NR2A 3N32A 1L7YA 3MHSD 1WMHB 2L05A 4WJNA 3M3JA 3MTNB 3QQ8B 5D94A 2FNJB 1M94A 4G3XB 1ISNA 2ZCCA 3EECA 1WGRA 3IHPC 3RZFA 2O6VD 3X0WA 4EFOA 2LGYA 4KSLC 2W9NA 2KDEB 2NBUA 1GC6A 2N1WA 4M8NA 5E6PA 5JZEB 4W9EA 3ZLZA 1VD2A 5LLIA 3WA0A 4BKSD 4JGHB 3PV1A 5AEKB 2VRRB 1WR6E 2A5UA 2BGFA 2CS4A 3QWZB 2KX0A 3ML9A 3ONSA 2ZNVC 5HKHA 4MH0E 1WGGA 4NJ7A 3KUZA 4K7SA 2V4LA 2JWZA 2RD0A 1RAXA 3LDZE 4N9F4 2JVCA 3Q3FA 3JSVB 3A1QB 2IO3B 2LRUA 5L83A 3WALA 1L2NA 2FCNA 2C60A 2J0JA 1ZW7A 4KIKA 1K8RB 2L7RA 1R4NI 4ANWA 2KWVB 4IM3A 4I6PA 2M0XA 4MM3A 2GOWA 3UGBB 2J0MA 2XBBC 1V49A 2KWCA 4HK2A 2DENB 2LD9A 2L0TA 4BBNF 1NBFC 3L10B 3RD2A 4W9JA 1V6EA 2KANA 2KTRA 3VUXA 3PSEB 1WM2A 3QARA 3L08A 4GU2A 3TBLD 3A33B 4TUUA 5D2MB 1LM8B 1P0RA 1WE6A 3JW0X 3O65B 3P2BA 2LASA 2NBVB 2GBRA 2XEWA 3C0RB 3CF6E 3ZNGC 1WRDB 3SDLC 1WXSA 2CHWA 3UQBA 3ZTDA 2KN5A 2MX2A 2YLMA 4HVBA 4NPNA 4WWOA 1YD8U 2KK8A 4HDQA 2WYQA 4HXDA 2ZCBA 3WAPA 1S3SG 4DHZB 2JZ3B 2ZPYA 3Q3JA 5AZHA 3OJ4B 2DHZA 1KJTA 1WR1A 2O6VB 3H7PB 3VXWA 3L16A 3IBEA 4PS7A 2DAJA 1KLVA 4FLHA 4EZLA 2N7EA 3D32A 2IO2B 3QHTA 2MCNB 3VVWB 4BVUC 2DYBA 2M8SA 2KJRA 2IBIB 4GGQA 2KMAA 3KUCB 4FBJB 1GUAB 2EKEC 2V1YA 4OVUA 3CSTA 5AZGA 3L17A 2KOXA 3WAOA 2ZJDA 3QA8A 1NI2A 4B95A 2OJRA 4II3B 4KZ0A 1TZ1A 2Z59B 3DQVA 5IA7A 5JHBA 1VCBA 1G6JA 4W9KA 2CHZA 1KOTA 2KJHB 4P7IA 3EHVA 4YL8A 3PLVA 1UELA 3RCZA 3K9OB 4ZRIA 2FIDA 4XZ4A 4B6WA 2LXCA 1UH6A 3RT3B 2MBBB 1UZXB 3CSFA 3V61A 3VTWA 5DPWA 4ZYNA 5CTRC 2RGFA 4W9CA 2CU1A 2MBEA 4ICVA 3IVFA 4KV2A 4W9HA 3VUWA 2C7HA 1MG8A 3B0AA 3T9LA 4JIOU 4RMAA 5D7GA 1OQYA 2AL3A 4LJPB 2AEHA 2D10A 3AXCA 4BFRA 2DZKA 3PHWB 4LDTB 4EEWA 1H8CA 2GMIC 2WX0A 2DZJA 4HPMB 5DPSA 2GBMA 2JY6A 2IO0B 1SE9A 2PJHA 2FIFA 3GOEA 3KW5B 4HPLB 2ZEQA 4ASWC 4AUQC 1I42A 1V86A 4AP4C 5J2RA 4A20A 1WX9A 2BPSA 4IWPA 3RYTA 2G3QB 2KHWB 5C1ZA 1SIFA 2K25A 3PS6A 3X23A 3NZSA 2L76A 3W1SC 4ANUA 4MGZE 1Y8RC 2MBOA 4K1RB 1OTRB 4MDKE 2DYMA 2JXXA 1P1AA 3VAWA 1NDDA 4KZCA 1V2YA 1C1YB 1LQBA 2L0FA 4A3OA 3EFUA 3QAQA 2KQSA 2KC2A 3R7RA 4IUMB 4HJKA 1SGHA 3TIXA 3UIOB 4IG7B 3VH4B 3NY5A 3ZKJC 4LJOB 2RPQA 2I1KA 3WIMA 1YJ1A 2BKFA 4GDLA 3PRMB 1OEYJ 2KTFA 4ZRJA 1UD7A 2KKCA 2D07B 4GDKA 3DBSA 2KO3A 2L3ZA 1R4MI 2MQJA 4MGKE 4E3CA 1UGMA 1E8ZA 5BO4B 2KDIA 2KD0A 2MBHA 2KTRB 4F1SA 2N9EB 5CHFA 1XT9B 1YX6B 2LRWA 3ALBA 3MJWA 4K7WA 3ZRFA 2KZRA 4MGYE 2JUOA 3I3TB 2K1FA 3QC8B 3V60A 2LGDA 4RM9A 4ZDVA 3OLMD 3PTFC 2LJ5A 4G0NB 2AYOB 2CR5A 4EUTA 1WMHA 4GB9A 4RM8A 2AL6A 3DBLI 2N7DA 4HCNB 3ZNHB 2QHOA 1RRBA 1WXMA 2HJ8A 1F9JA 2EMSA 2LXAA 2MP2B 3JVZX 1WM3A 3U8ZA 4CYEA 2FAZA 2KDBA 1E8YA 3AULA 4I6NB 2FCMA 4E74A 4NNJB 3DPDA 2Z0DB 1Q5WB 2MRPA 2DX5B 4XC2A 2XK5B 1E90A 2B3AA 3PRZA 2ZPNA 4FHJA 1P3QU 2NS5A 4DBGA 1A5RA 3N3KB 4EOYA 1WX7A 2LVQA 4M0WB 4W9FA 3SD5A 3IFWB 1J19A 1WJ4A 2D11A 3DOWA 3JSVA 3A1QA 1Q0WB 1WJ6A 2CKHB 3SU8X 2C5LC 4BKTA 2O2VB 4NAWB 1EF5A 2BF8B 2HE7A 3K9PB 3V6EB 3W1YA 2WWZA 4GSWA 2YVCA 4MJSA 4W9DA 2KFKB 2G4SA 3H1UA 2RR9A 1J0GA 3DBHI 1PQSA 4DHJD 2LZ6A 3GZNI 4W9LA 4MEMA 2KDFB 3NS8A 4HWIB 1X1MA 2BYFA 2DZMA 2K8CA 3VUYA 2LWPA 1E7UA 4G11A 3UQAA 3TL5A 3AU5A 2LVPA 1XQQA 2JF5A 4GOCA 3PLUA 1WGHA 4IC7B 3VTVA 2C7MB 3AI5A 1EF1A 3ZNZB 1TGZB 5JH5C 4DDGD 3B08A 4DWFA 3VDZA 4ANXA 3ML8A 1RLFA 1T0YA 1QZEA 4IM0A 2BWFA 3BY4B 1GG3A 4FADA 3A4RA 3A9KA 2M4NA 1GNUA 4DXAB 4BOSC 1GC7A 4AJWA 5GMVA 2IY1B 3L54A 4JL9A 4PYZA 1BT0A 4DK5A 1WF9A 1WGYA 1KM7A 3NOBA 2DYOA 4FJZA 3T8MA 2BYVE 1P98A 2IO1B 2JT4B 3KYDD 4MSQB 2M1MA 5TR5A 4CO7A 4FHKA 3RULA 2FCSA 2G4DB 2HTHA 2O6VA 2PPHA 4WWPA 3HM3A 4E71A 2BKRB 3R3MA 4KVGB 4EZKA 4URKA 4AOFA 3M95A 3L0WB 3QJZA 4ANVA 4CHKA 3VQIA 5KHOA 4KDIC 2KJ6A 3DCGA 1P9DU 3LJ3A 3QK0A 3DDCB 5G55A 1V80A 1HE8A 4PS8A 4GDLB 3HM6X 2K39A 2JZZA 1TTNA 3PHXB 3M62B 1E8XA 4WQOB 3VTUA 3PREA 4BOZB 5LXIB 2NPTA 3DBRI 4GDKB 3KUDB 3B1LX 4BBNC 4WJQA 2MWSB 5E6NA 4PS3A 2R2OA 3H9DA 4FJVB 2N9PC 2KLCA 4HCPB 3QIJA 3SHQA 4F8CB 5LXHA 1E7VA 2K6QA 3NZUA 3ZO5B 2JRHA 3WAMA 3M63B 4FULA 1Z2MA 2PEAA 4GIVA 1JRUA 5CHWA 4DHJB 4K7UA 2V3SA 3AU4A 1WJUA 2N1VA 3TCAA 4KIKB 3PGEA 1WJNA 2Z0EB 3U7DA 1IYFA 4JQWC 1IP9A 2L00B 3JYUA 2I1JA 3PPAA 4OVVA 4AJYB 1V81A 2C9WB 2EMTA 2HD5B 4II2B 3EC8A 1S1QB 4IM2A 2PE6B 3U30A 2NBWB 3DVGY 4MGIE 4DHZE 2GBJA 4W9IA 2MSED 2R2QA 1H4RA 1WXVA 3TJPA 1C3TA 3R7QA 3UIPB 1WGDA 2KX3A 2NVUI 3N30A 3KVFB 4TQ1A 4WWNA 4FA6A 3HK0A 3HHMA 3A9JA 3WANA 3PRPB 1V5OA 4PYUA 4J6IA 3UF8A 4IW0A 2KQ7A 2FUHB 5KHQA 1TBEA 2KMCA 2ZVNA 3VH3B 1XD3B 4B9KA 3H7SA 4GXBA 2D3GA 2J7QB 1WZ0A 3ENEA 4NQLB 4JLCA 2JRIB 4IWOA 3PT2B 4TKNA 3ZRCA 4KSKC 4WAAA 3W1SA 2Y5BB 4DDID 3QX1A 1WYWB 2BWES 4WJOA 3S2AA 1V9JA 1UBIA 1V5TA 4HLEA 1ZGUB 3H6NA 3KH0A 2KNBA 4MJSB 2IZVB 5CHVC 2ZNVB 4F7ZA 3PVLA 1EUVB 4M8MA 4GMVA 1FXTB 3V62A 1LXDA 3ZVVA 1I35A 1GJZA 3APDA 3TMPB 3VHTC 2LUEA 2CHXA 2K8BA 1Z5SB 4TQ0A 4NQKE 4G50A 2REXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYZ B;  1WE7 A;  4W9G A;  2BYE A;  3APF A;  4LDT D;  3RZW C;  1E8W A;  2M17 A;  2LGX A;  4WJP A;  2ASQ A;  4MSM B;  3ZDM C;  2KC1 A;  4NJ6 A;  3ZW3 A;  2LI5 A;  3A9K B;  4FJY A;  4BKG A;  1UBQ A;  1AAR A;  2KWU B;  2K6D B;  2KLG A;  2ZVO A;  3UIN B;  4A3P A;  2L8J A;  2MLB A;  5C23 A;  4MEL A;  2K8H A;  1CMX B;  4TV3 A;  5E6O A;  3ZIM A;  2MP2 A;  1WIA A;  3CMM B;  5G2N A;  2AWT A;  2OOB B;  2PE9 A;  5DPT A;  3DVN U;  2WX1 A;  3OJ3 A;  2FCQ A;  2N9X A;  4ZRK A;  3IG3 A;  2KVR A;  2UWQ A;  1OEY A;  5J17 A;  1ZKH A;  4NY0 A;  1LFD A;  1EO6 A;  2XK5 A;  1WFY A;  1OGW A;  3NHE B;  3ZNI D;  1WH3 A;  4LCD E;  3ECI A;  3PZD A;  2A4Z A;  2DZI A;  3DVG X;  3ZTC A;  2O2V A;  4NAW A;  3H7P A;  2NPT B;  2RSU A;  3VFK A;  2KFJ A;  4FN2 A;  1J8C A;  3V6C B;  2DAF A;  4K81 A;  4X57 B;  1YIW A;  2ZZP B;  4BKS A;  2KFK A;  2IYD B;  2N4F A;  3BIN A;  2WDT B;  4XX5 A;  5DPR A;  1RFA A;  2IY0 B;  3APC A;  2J0K A;  2GBK A;  1Q1O A;  1WY8 A;  2KXJ A;  2NCN A;  5FR6 A;  1D3Z A;  5JHA A;  4ICU A;  3QCA A;  3ZUN A;  4EKU A;  5DCN A;  2GBN A;  5D6J B;  5AZF A;  5IAA C;  5J18 A;  1WI0 A;  5CX3 A;  4EZJ A;  2MBQ A;  4AWJ A;  1U4A A;  3L13 A;  3HIZ A;  2MA9 B;  4HDO A;  1E5W A;  1YX5 B;  2D2Q A;  2G45 B;  1IPG A;  2LVO A;  4KDL B;  3RUI B;  5EDS A;  1WX8 A;  1YQB A;  3KYC D;  5L95 C;  2JPH A;  3A4S C;  3OAW A;  4I6L B;  1WXA A;  3DVN V;  4IWQ A;  3R66 C;  2MW5 A;  4GN1 A;  1WZ3 A;  2C7N B;  3A9J B;  3ZDT A;  2NR2 A;  3N32 A;  1L7Y A;  3MHS D;  1WMH B;  2L05 A;  4WJN A;  3M3J A;  3MTN B;  3QQ8 B;  5D94 A;  2FNJ B;  1M94 A;  4G3X B;  1ISN A;  2ZCC A;  3EEC A;  1WGR A;  3IHP C;  3RZF A;  2O6V D;  3X0W A;  4EFO A;  2LGY A;  4KSL C;  2W9N A;  2KDE B;  2NBU A;  1GC6 A;  2N1W A;  4M8N A;  5E6P A;  5JZE B;  4W9E A;  3ZLZ A;  1VD2 A;  5LLI A;  3WA0 A;  4BKS D;  4JGH B;  3PV1 A;  5AEK B;  2VRR B;  1WR6 E;  2A5U A;  2BGF A;  2CS4 A;  3QWZ B;  2KX0 A;  3ML9 A;  3ONS A;  2ZNV C;  5HKH A;  4MH0 E;  1WGG A;  4NJ7 A;  3KUZ A;  4K7S A;  2V4L A;  2JWZ A;  2RD0 A;  1RAX A;  3LDZ E;  4N9F 4;  2JVC A;  3Q3F A;  3JSV B;  3A1Q B;  2IO3 B;  2LRU A;  5L83 A;  3WAL A;  1L2N A;  2FCN A;  2C60 A;  2J0J A;  1ZW7 A;  4KIK A;  1K8R B;  2L7R A;  1R4N I;  4ANW A;  2KWV B;  4IM3 A;  4I6P A;  2M0X A;  4MM3 A;  2GOW A;  3UGB B;  2J0M A;  2XBB C;  1V49 A;  2KWC A;  4HK2 A;  2DEN B;  2LD9 A;  2L0T A;  4BBN F;  1NBF C;  3L10 B;  3RD2 A;  4W9J A;  1V6E A;  2KAN A;  2KTR A;  3VUX A;  3PSE B;  1WM2 A;  3QAR A;  3L08 A;  4GU2 A;  3TBL D;  3A33 B;  4TUU A;  5D2M B;  1LM8 B;  1P0R A;  1WE6 A;  3JW0 X;  3O65 B;  3P2B A;  2LAS A;  2NBV B;  2GBR A;  2XEW A;  3C0R B;  3CF6 E;  3ZNG C;  1WRD B;  3SDL C;  1WXS A;  2CHW A;  3UQB A;  3ZTD A;  2KN5 A;  2MX2 A;  2YLM A;  4HVB A;  4NPN A;  4WWO A;  1YD8 U;  2KK8 A;  4HDQ A;  2WYQ A;  4HXD A;  2ZCB A;  3WAP A;  1S3S G;  4DHZ B;  2JZ3 B;  2ZPY A;  3Q3J A;  5AZH A;  3OJ4 B;  2DHZ A;  1KJT A;  1WR1 A;  2O6V B;  3H7P B;  3VXW A;  3L16 A;  3IBE A;  4PS7 A;  2DAJ A;  1KLV A;  4FLH A;  4EZL A;  2N7E A;  3D32 A;  2IO2 B;  3QHT A;  2MCN B;  3VVW B;  4BVU C;  2DYB A;  2M8S A;  2KJR A;  2IBI B;  4GGQ A;  2KMA A;  3KUC B;  4FBJ B;  1GUA B;  2EKE C;  2V1Y A;  4OVU A;  3CST A;  5AZG A;  3L17 A;  2KOX A;  3WAO A;  2ZJD A;  3QA8 A;  1NI2 A;  4B95 A;  2OJR A;  4II3 B;  4KZ0 A;  1TZ1 A;  2Z59 B;  3DQV A;  5IA7 A;  5JHB A;  1VCB A;  1G6J A;  4W9K A;  2CHZ A;  1KOT A;  2KJH B;  4P7I A;  3EHV A;  4YL8 A;  3PLV A;  1UEL A;  3RCZ A;  3K9O B;  4ZRI A;  2FID A;  4XZ4 A;  4B6W A;  2LXC A;  1UH6 A;  3RT3 B;  2MBB B;  1UZX B;  3CSF A;  3V61 A;  3VTW A;  5DPW A;  4ZYN A;  5CTR C;  2RGF A;  4W9C A;  2CU1 A;  2MBE A;  4ICV A;  3IVF A;  4KV2 A;  4W9H A;  3VUW A;  2C7H A;  1MG8 A;  3B0A A;  3T9L A;  4JIO U;  4RMA A;  5D7G A;  1OQY A;  2AL3 A;  4LJP B;  2AEH A;  2D10 A;  3AXC A;  4BFR A;  2DZK A;  3PHW B;  4LDT B;  4EEW A;  1H8C A;  2GMI C;  2WX0 A;  2DZJ A;  4HPM B;  5DPS A;  2GBM A;  2JY6 A;  2IO0 B;  1SE9 A;  2PJH A;  2FIF A;  3GOE A;  3KW5 B;  4HPL B;  2ZEQ A;  4ASW C;  4AUQ C;  1I42 A;  1V86 A;  4AP4 C;  5J2R A;  4A20 A;  1WX9 A;  2BPS A;  4IWP A;  3RYT A;  2G3Q B;  2KHW B;  5C1Z A;  1SIF A;  2K25 A;  3PS6 A;  3X23 A;  3NZS A;  2L76 A;  3W1S C;  4ANU A;  4MGZ E;  1Y8R C;  2MBO A;  4K1R B;  1OTR B;  4MDK E;  2DYM A;  2JXX A;  1P1A A;  3VAW A;  1NDD A;  4KZC A;  1V2Y A;  1C1Y B;  1LQB A;  2L0F A;  4A3O A;  3EFU A;  3QAQ A;  2KQS A;  2KC2 A;  3R7R A;  4IUM B;  4HJK A;  1SGH A;  3TIX A;  3UIO B;  4IG7 B;  3VH4 B;  3NY5 A;  3ZKJ C;  4LJO B;  2RPQ A;  2I1K A;  3WIM A;  1YJ1 A;  2BKF A;  4GDL A;  3PRM B;  1OEY J;  2KTF A;  4ZRJ A;  1UD7 A;  2KKC A;  2D07 B;  4GDK A;  3DBS A;  2KO3 A;  2L3Z A;  1R4M I;  2MQJ A;  4MGK E;  4E3C A;  1UGM A;  1E8Z A;  5BO4 B;  2KDI A;  2KD0 A;  2MBH A;  2KTR B;  4F1S A;  2N9E B;  5CHF A;  1XT9 B;  1YX6 B;  2LRW A;  3ALB A;  3MJW A;  4K7W A;  3ZRF A;  2KZR A;  4MGY E;  2JUO A;  3I3T B;  2K1F A;  3QC8 B;  3V60 A;  2LGD A;  4RM9 A;  4ZDV A;  3OLM D;  3PTF C;  2LJ5 A;  4G0N B;  2AYO B;  2CR5 A;  4EUT A;  1WMH A;  4GB9 A;  4RM8 A;  2AL6 A;  3DBL I;  2N7D A;  4HCN B;  3ZNH B;  2QHO A;  1RRB A;  1WXM A;  2HJ8 A;  1F9J A;  2EMS A;  2LXA A;  2MP2 B;  3JVZ X;  1WM3 A;  3U8Z A;  4CYE A;  2FAZ A;  2KDB A;  1E8Y A;  3AUL A;  4I6N B;  2FCM A;  4E74 A;  4NNJ B;  3DPD A;  2Z0D B;  1Q5W B;  2MRP A;  2DX5 B;  4XC2 A;  2XK5 B;  1E90 A;  2B3A A;  3PRZ A;  2ZPN A;  4FHJ A;  1P3Q U;  2NS5 A;  4DBG A;  1A5R A;  3N3K B;  4EOY A;  1WX7 A;  2LVQ A;  4M0W B;  4W9F A;  3SD5 A;  3IFW B;  1J19 A;  1WJ4 A;  2D11 A;  3DOW A;  3JSV A;  3A1Q A;  1Q0W B;  1WJ6 A;  2CKH B;  3SU8 X;  2C5L C;  4BKT A;  2O2V B;  4NAW B;  1EF5 A;  2BF8 B;  2HE7 A;  3K9P B;  3V6E B;  3W1Y A;  2WWZ A;  4GSW A;  2YVC A;  4MJS A;  4W9D A;  2KFK B;  2G4S A;  3H1U A;  2RR9 A;  1J0G A;  3DBH I;  1PQS A;  4DHJ D;  2LZ6 A;  3GZN I;  4W9L A;  4MEM A;  2KDF B;  3NS8 A;  4HWI B;  1X1M A;  2BYF A;  2DZM A;  2K8C A;  3VUY A;  2LWP A;  1E7U A;  4G11 A;  3UQA A;  3TL5 A;  3AU5 A;  2LVP A;  1XQQ A;  2JF5 A;  4GOC A;  3PLU A;  1WGH A;  4IC7 B;  3VTV A;  2C7M B;  3AI5 A;  1EF1 A;  3ZNZ B;  1TGZ B;  5JH5 C;  4DDG D;  3B08 A;  4DWF A;  3VDZ A;  4ANX A;  3ML8 A;  1RLF A;  1T0Y A;  1QZE A;  4IM0 A;  2BWF A;  3BY4 B;  1GG3 A;  4FAD A;  3A4R A;  3A9K A;  2M4N A;  1GNU A;  4DXA B;  4BOS C;  1GC7 A;  4AJW A;  5GMV A;  2IY1 B;  3L54 A;  4JL9 A;  4PYZ A;  1BT0 A;  4DK5 A;  1WF9 A;  1WGY A;  1KM7 A;  3NOB A;  2DYO A;  4FJZ A;  3T8M A;  2BYV E;  1P98 A;  2IO1 B;  2JT4 B;  3KYD D;  4MSQ B;  2M1M A;  5TR5 A;  4CO7 A;  4FHK A;  3RUL A;  2FCS A;  2G4D B;  2HTH A;  2O6V A;  2PPH A;  4WWP A;  3HM3 A;  4E71 A;  2BKR B;  3R3M A;  4KVG B;  4EZK A;  4URK A;  4AOF A;  3M95 A;  3L0W B;  3QJZ A;  4ANV A;  4CHK A;  3VQI A;  5KHO A;  4KDI C;  2KJ6 A;  3DCG A;  1P9D U;  3LJ3 A;  3QK0 A;  3DDC B;  5G55 A;  1V80 A;  1HE8 A;  4PS8 A;  4GDL B;  3HM6 X;  2K39 A;  2JZZ A;  1TTN A;  3PHX B;  3M62 B;  1E8X A;  4WQO B;  3VTU A;  3PRE A;  4BOZ B;  5LXI B;  2NPT A;  3DBR I;  4GDK B;  3KUD B;  3B1L X;  4BBN C;  4WJQ A;  2MWS B;  5E6N A;  4PS3 A;  2R2O A;  3H9D A;  4FJV B;  2N9P C;  2KLC A;  4HCP B;  3QIJ A;  3SHQ A;  4F8C B;  5LXH A;  1E7V A;  2K6Q A;  3NZU A;  3ZO5 B;  2JRH A;  3WAM A;  3M63 B;  4FUL A;  1Z2M A;  2PEA A;  4GIV A;  1JRU A;  5CHW A;  4DHJ B;  4K7U A;  2V3S A;  3AU4 A;  1WJU A;  2N1V A;  3TCA A;  4KIK B;  3PGE A;  1WJN A;  2Z0E B;  3U7D A;  1IYF A;  4JQW C;  1IP9 A;  2L00 B;  3JYU A;  2I1J A;  3PPA A;  4OVV A;  4AJY B;  1V81 A;  2C9W B;  2EMT A;  2HD5 B;  4II2 B;  3EC8 A;  1S1Q B;  4IM2 A;  2PE6 B;  3U30 A;  2NBW B;  3DVG Y;  4MGI E;  4DHZ E;  2GBJ A;  4W9I A;  2MSE D;  2R2Q A;  1H4R A;  1WXV A;  3TJP A;  1C3T A;  3R7Q A;  3UIP B;  1WGD A;  2KX3 A;  2NVU I;  3N30 A;  3KVF B;  4TQ1 A;  4WWN A;  4FA6 A;  3HK0 A;  3HHM A;  3A9J A;  3WAN A;  3PRP B;  1V5O A;  4PYU A;  4J6I A;  3UF8 A;  4IW0 A;  2KQ7 A;  2FUH B;  5KHQ A;  1TBE A;  2KMC A;  2ZVN A;  3VH3 B;  1XD3 B;  4B9K A;  3H7S A;  4GXB A;  2D3G A;  2J7Q B;  1WZ0 A;  3ENE A;  4NQL B;  4JLC A;  2JRI B;  4IWO A;  3PT2 B;  4TKN A;  3ZRC A;  4KSK C;  4WAA A;  3W1S A;  2Y5B B;  4DDI D;  3QX1 A;  1WYW B;  2BWE S;  4WJO A;  3S2A A;  1V9J A;  1UBI A;  1V5T A;  4HLE A;  1ZGU B;  3H6N A;  3KH0 A;  2KNB A;  4MJS B;  2IZV B;  5CHV C;  2ZNV B;  4F7Z A;  3PVL A;  1EUV B;  4M8M A;  4GMV A;  1FXT B;  3V62 A;  1LXD A;  3ZVV A;  1I35 A;  1GJZ A;  3APD A;  3TMP B;  3VHT C;  2LUE A;  2CHX A;  2K8B A;  1Z5S B;  4TQ0 A;  4NQK E;  4G50 A;  2REX A; 
#chains in the Genus database with same CATH topology
 3APF A;  2J4X A;  1E8W A;  2IGD A;  4A90 A;  5IOI A;  1RM6 C;  4BKG A;  1AAR A;  2K6D B;  2Y3A A;  3RNG C;  2L8J A;  2IDY A;  4ACF A;  2MLB A;  5C23 A;  4MEL A;  3BVM A;  2DBY A;  5G2N A;  2AWT A;  5DPT A;  3DVN U;  2WX1 A;  2V3N A;  2J52 A;  1OEY A;  1ZKH A;  1L6U A;  2Y5C A;  3ZNI D;  2PKO A;  4NZL B;  2WXG A;  1JML A;  5FK9 C;  3HVZ A;  4ZRP A;  1SBB B;  3PZ8 A;  1MI0 A;  2O2V A;  1KLG D;  2RSU A;  2KFJ A;  4FN2 A;  1J8C A;  2LHE A;  4Q2J A;  2W82 A;  2ZZP B;  1GB1 A;  3APC A;  2J0K A;  2GBK A;  2WGS A;  2KMM A;  1Q1O A;  1WY8 A;  1GOZ A;  5JHA A;  3AM9 A;  4ICU A;  4RF1 A;  1ZP0 B;  5AZF A;  1WI0 A;  5CX3 A;  4EZJ A;  2MBQ A;  4AWJ A;  1L4D B;  4MT5 A;  3HIZ A;  5BYQ A;  1IPG A;  2INP E;  3RUI B;  1WX8 A;  4USA A;  3A4S C;  2M19 A;  2BBC A;  1WXA A;  3AEA B;  4GN1 A;  2C7N B;  4DQO C;  1B1Z A;  3ZDT A;  1B9R A;  3MC0 B;  1TKG A;  2L83 A;  3H8H A;  3M3J A;  5D94 A;  3T3N A;  1ISN A;  2GB1 A;  2HDE A;  4KSL C;  2NTS A;  2NBU A;  2M56 B;  5LLI A;  5BYR A;  4C7Z A;  5AEK B;  4ARI A;  3ML9 A;  1XLO A;  2N0S B;  2V4L A;  2JWZ A;  3VR9 B;  3A1Q B;  1RWS A;  3Q8B A;  1ZW7 A;  1FXA A;  3AE5 B;  1J7A A;  1IBX A;  4NAM A;  3UGB B;  1PFD A;  1YJI A;  4W9J A;  1V6E A;  3HUI A;  3QAR A;  3L08 A;  1TY0 A;  5D2M B;  4P6V F;  2LAS A;  2XEW A;  1SE2 A;  3ZNG C;  3FC4 A;  5BMI A;  2YLM A;  1TY2 A;  4HDQ A;  4UDU C;  4DHZ B;  2JZ3 B;  3RNA C;  2ZPY A;  1AW7 A;  5AZH A;  3OJ4 B;  3VR8 B;  3NVW A;  2GI9 A;  2IBI B;  1VDV A;  1YQ4 B;  4FBJ B;  3ETR A;  5AZG A;  3WAO A;  3Q3M C;  2D3C A;  5IA7 A;  2ACZ B;  4IDI A;  1G6J A;  1UEL A;  3RCZ A;  1UZX B;  4ZYN A;  5CTR C;  2MBE A;  4W9H A;  3VUW A;  2C7H A;  3R2T A;  3T9L A;  4JIO U;  1OQY A;  2IND C;  4EEW A;  3PHW B;  4LDT B;  1K52 A;  2GMI C;  2DZJ A;  4AUQ C;  3GOE A;  1SXT A;  3DBL B;  2BPS A;  4IWP A;  3RYT A;  2KHW B;  2CJN A;  1T0R C;  1MHH E;  2QCZ A;  4ANU A;  4KGT A;  2WXH A;  4C56 C;  2QSD A;  4MDK E;  1N63 A;  2JXX A;  1NDD A;  1V2Y A;  2L0F A;  3AE6 B;  4A3O A;  4MAC A;  2KQS A;  4HJK A;  4IG7 B;  2PVO D;  4LJO B;  5EE9 A;  4EE2 A;  3PRM B;  1OEY J;  2N9K A;  1UD7 A;  2IPK D;  2CU3 A;  4RGN A;  2KO3 A;  2L3Z A;  4MGK E;  3BK1 A;  1E8Z A;  4LNK A;  3TEZ A;  3DBH B;  4F1S A;  5CHF A;  2LRW A;  1YX6 B;  3ALB A;  2PTL A;  2RMM A;  3I3T B;  3V60 A;  1EWY C;  1UWM A;  1YNT E;  2MJ3 A;  4GB9 A;  1YJJ A;  3DBL I;  4HCN B;  2K3U A;  1C76 A;  1WXM A;  1WM3 A;  2FAZ A;  2E3T A;  4I6N B;  2FCM A;  1NEN B;  4FXC A;  1K51 A;  2Z0D B;  2MRP A;  2DX5 B;  1T0Q C;  1E90 A;  2B3A A;  2V3P A;  4FHJ A;  2NS5 A;  3Q8F A;  2LVQ A;  2XN9 C;  4W9F A;  2QIL A;  3A1Q A;  3B2G A;  4BKT A;  1EF5 A;  2Z8L A;  3OWE B;  1VZ8 A;  3AH7 A;  2RR9 A;  3B9J A;  4B0M A;  3DBH I;  3NRZ A;  2BS3 B;  1ENF A;  2NMQ A;  2KQ4 X;  2SEB D;  4HWI B;  1X1M A;  2K8C A;  2LWP A;  1E7U A;  2SAK A;  2LVP A;  4GOC A;  4IC7 B;  2UU7 A;  1EF1 A;  3ZNZ B;  4DWF A;  3P4S B;  3ML8 A;  1RLF A;  3Q2A C;  1JWA D;  2BWF A;  3BY4 B;  4FAD A;  3A9K A;  3BK2 A;  5G5H A;  1YN5 A;  4DXA B;  1XF5 L;  5EE0 A;  3L54 A;  3EFC A;  3LB8 C;  4DK5 A;  1KM7 A;  1DYQ A;  3T8M A;  2RDH A;  2JT4 B;  2M1M A;  3RUL A;  3HM3 A;  4QAY A;  3MC9 A;  1XLN A;  3QJZ A;  4YSY B;  1WRI A;  3ABV B;  5KHO A;  1QT9 A;  3DCG A;  1ZDV A;  2AQ3 B;  3U2S C;  3DDC B;  1HE8 A;  2K39 A;  2JZZ A;  3PHX B;  3VTU A;  1E8X A;  4WQO B;  5HG2 A;  4WIP A;  4JE3 B;  1MFW A;  4PS3 A;  2N9P C;  1R7S A;  2KLC A;  2JU6 X;  3AB5 A;  2K6Q A;  3NZU A;  3ZO5 B;  3M63 B;  1D5Z C;  2QDF A;  2V3S A;  1CQV A;  4KIK B;  1YOV B;  4JQW C;  2I1J A;  3GE3 C;  4MGI E;  4M00 A;  3RN9 C;  1H4R A;  1JW9 D;  1NEK B;  3MHZ A;  3TEY A;  3NZ3 A;  1WGD A;  5JXV A;  3NG0 A;  4KGR A;  4WWN A;  3HHM A;  3PRP B;  4PYU A;  4J6I A;  3UF8 A;  4IW0 A;  2KQ7 A;  1ZUD 2;  5KHQ A;  4KX6 B;  2KMC A;  3VH3 B;  3BVG A;  4GXB A;  5HFY A;  4RH6 A;  4JLC A;  1FMA D;  3C19 A;  3PT2 B;  3ZRC A;  3W1S A;  4DDI D;  2BWE S;  1ZGU B;  2AQ2 B;  2WS3 B;  2IZV B;  1HZ5 A;  2ZNV B;  5CHV C;  4GMV A;  1FXT B;  1MJD A;  2INC C;  3FAH A;  3VHT C;  2LUE A;  5TSS A;  3N1Y C;  4MSM B;  3ZDM C;  3FIL B;  2KC1 A;  4K3C A;  4NJ6 A;  2KAJ A;  1YQ3 B;  2KWU B;  3VRA B;  2ZVO A;  3AEC B;  4JWU C;  1XCQ L;  3URY A;  1TJE A;  3GS2 A;  3CMM B;  1FFU A;  3OJ3 A;  2N9X A;  3Q8C A;  4HRS A;  3IG3 A;  2KVR A;  2UWQ A;  3DWM A;  5J17 A;  4B0E A;  2ZW0 A;  4YSX B;  1WH3 A;  3ECI A;  2DZI A;  4DXG A;  3RNF C;  3DVG X;  3ZTC A;  2AX5 A;  2BB5 A;  3VFK A;  2RDB C;  4K81 A;  1QLB B;  1FCC C;  2IYD B;  2N4F A;  3RNC C;  2WDT B;  3BYY B;  3GP7 A;  4N59 A;  2WXN A;  5FR6 A;  1D3Z A;  2D3A A;  2GBN A;  5D6J B;  1DOX A;  1U4A A;  4IOI E;  1YX5 B;  4KDL B;  2LVO A;  3DHI C;  4BZA A;  1YQB A;  2L52 A;  3R66 C;  3W9C B;  1WZ3 A;  2NR2 A;  2WDQ B;  1L7Y A;  2JWU A;  1WMH B;  1SEB D;  1UNS A;  3MTN B;  2ON8 A;  2FNJ B;  2V4I B;  2LGY A;  3T3O A;  4BKS D;  2MHJ A;  2QIE B;  2H89 B;  2BGF A;  2KX0 A;  4MH0 E;  1WGG A;  1V1O A;  3KUZ A;  4K7S A;  2JVC A;  3RPF C;  2IO3 B;  3NJT A;  4XE0 A;  1L2N A;  1KRH A;  4IKG A;  1I4G A;  4KIK A;  4XGA B;  4I6P A;  2M0X A;  1V49 A;  4HK2 A;  2JXT A;  2DEN B;  2WHI A;  1T3Q A;  3BVZ A;  2L0T A;  4BBN F;  4ZRQ A;  4OZB A;  4A9A A;  2KAN A;  1WM2 A;  4A6Q A;  3TBL D;  2MEK A;  2PMV A;  2WXM A;  2KT7 A;  2LMC A;  1P0R A;  1WE6 A;  3JW0 X;  1QIL A;  4J3O D;  4D2K A;  2NBV B;  3C0R B;  2WXR A;  3CF6 E;  4P1C C;  5EE3 A;  5BYS A;  3IT4 B;  4HVB A;  4NPN A;  1HXY D;  1YD8 U;  4HXD A;  4WH4 A;  2ZCB A;  3Q3O C;  3WCQ A;  1A70 A;  2DHZ A;  1WR1 A;  3H7P B;  1DGJ A;  3IBE A;  2FE8 A;  3LXF A;  3PO0 A;  1BML C;  2DAJ A;  2IO2 B;  2LGI A;  1L5P A;  1SJH D;  4GGQ A;  1N61 A;  2EKE C;  1UUP A;  1MHX A;  3CST A;  2Z59 B;  3DQV A;  5JHB A;  1EWC A;  4LLG M;  3FIL A;  4OZA A;  4YTN B;  2KJH B;  3LYY A;  1R4M B;  3PLV A;  4KKJ A;  2FID A;  4ZRI A;  4B6W A;  3RT3 B;  2MBB B;  3CSF A;  3VTW A;  5DPW A;  2RGF A;  4W9C A;  1F2R C;  2CU1 A;  4KV2 A;  5BMH A;  3B0A A;  5D7G A;  2AL3 A;  4REZ A;  2DZK A;  2WX0 A;  2KWD A;  4HPM B;  2ICI A;  3U52 E;  5E6J A;  2IO0 B;  2PJH A;  3KW5 B;  1FEH A;  2PVG C;  2G3Q B;  1PGA A;  3PS6 A;  3W1S C;  1JQ4 A;  2WXL A;  4MGZ E;  1TS2 A;  2DLB A;  2MBO A;  4K1R B;  1OTR B;  1STE A;  3VAW A;  4KZC A;  2CJO A;  3E9S A;  3QAQ A;  3AE4 B;  4IUM B;  3ZGZ A;  3TIX A;  3UIO B;  2RPV A;  3Q3N C;  2WU5 B;  4P1B C;  3WIM A;  2BS2 B;  2KTF A;  2K0P A;  3P4R B;  3AEF B;  2KKC A;  4MM3 B;  2D07 B;  3DBS A;  1AWD A;  1R4M I;  5BO4 B;  2KDI A;  4DXF A;  2KTR B;  3Q14 C;  1QOG A;  3GZN B;  2BYT A;  2LGD A;  4RM9 A;  4A8X C;  3HVD A;  3OLM D;  3PTF C;  1SSN A;  4G0N B;  2CR5 A;  1WMH A;  1GAQ B;  2D5G A;  1V1P B;  3IXS A;  3ZXR A;  2BS4 B;  1RRB A;  2HJ8 A;  3AV8 A;  3AE1 B;  2MP2 B;  3JVZ X;  4CYE A;  4RGM A;  3P1M A;  4NNJ B;  4TSS A;  1N5W A;  1Q5W B;  3EA6 A;  4XC2 A;  1DOY A;  4YTP B;  3N3K B;  4M0W B;  2VH2 A;  2K22 A;  1J19 A;  2D11 A;  3IFW B;  3DOW A;  1WJ6 A;  3NVY A;  3K9P B;  3V6E B;  4NJC A;  2OED A;  4GSW A;  4MJS A;  1V8C A;  3ZQ4 A;  1PQS A;  3GZN I;  4W9L A;  2KDF B;  2L32 A;  2LJI A;  1TS5 A;  2DZM A;  3VUY A;  4G11 A;  5FKA C;  3AU5 A;  2KYW A;  2JF5 A;  3PLU A;  2V9H A;  3VTV A;  2KDM A;  1Y56 A;  3MC8 A;  1RFK A;  1NI3 A;  4DDG D;  1HA5 A;  3AE2 B;  3B08 A;  5MPO A;  1T0Y A;  1QZE A;  2INN E;  2M4N A;  1GNU A;  1GC7 A;  2W3R A;  2IY1 B;  4JL9 A;  1QOB A;  1WF9 A;  1WGY A;  2DYO A;  2BYV E;  1ROE A;  1MPE A;  4CO7 A;  2WLB A;  2G4D B;  3I9V 1;  2WXK A;  1TIF A;  3EUB 2;  4EZK A;  4AOF A;  3M95 A;  3L0W B;  1EU4 A;  4C7Y A;  4ANV A;  4CHK A;  2B76 B;  2K5P A;  2KJ6 A;  5I4D A;  1SB3 C;  1V80 A;  1FD6 A;  4GDL B;  2DWQ A;  3DBR I;  4GDK B;  3KUD B;  1PUT A;  3IT6 B;  3H9D A;  4F8C B;  4LNN A;  3V3X A;  3QIJ A;  2JRH A;  3IAS 1;  4FUL A;  3WAM A;  2D3B A;  2WQY B;  5CHW A;  1C4A A;  3MFG A;  3AU4 A;  3TCA A;  2N1V A;  3KQ4 A;  3PGE A;  1WJN A;  2WNM A;  3PPA A;  1VZ6 A;  4AJY B;  4II2 B;  2IJ0 A;  2GBJ A;  4LK0 M;  3TJP A;  4HKQ A;  1YN4 A;  3N30 A;  1PGX A;  1L0V B;  4FA6 A;  2H88 B;  2YEP F;  2QC8 A;  2J7Q B;  3ENE A;  4NQL B;  4US8 A;  4JX1 C;  4OZC A;  4TKN A;  4YWG G;  2Y5B B;  1WYW B;  1V9J A;  1UBI A;  1E6E B;  1EUV B;  4M8M A;  1LXD A;  1E10 A;  1I35 A;  1GJZ A;  3W5V B;  2FUG 1;  3TMP B;  1EU3 A;  2CHX A;  1Z5S B;  4TQ0 A;  4NQK E;  3Q6B A;  1F2R I;  4KGS A;  1WE7 A;  4W9G A;  2BYE A;  5C2T B;  3RZW C;  4XWW A;  2M17 A;  1I4H A;  2LGX A;  1K53 A;  2ASQ A;  3N1Z C;  3SFE B;  1XEE A;  3ZW3 A;  2LI5 A;  4FJY A;  1UBQ A;  3UIN B;  4A3P A;  2N7J A;  1FNW A;  5E6O A;  2MP2 A;  2OOB B;  2WXF A;  1C4C A;  2RDG A;  3C8Y A;  2WXQ A;  4OHJ A;  3J9C A;  1FRR A;  1EO6 A;  3N1X C;  1OGW A;  2G9H D;  3NHE B;  1C79 A;  4M0W A;  2WDR B;  2A4Z A;  1WSP A;  4CQN A;  2NPT B;  4K3B A;  2W54 A;  2DAF A;  1JAL A;  4XX5 A;  5DPR A;  2BB6 A;  3VRB B;  5HI1 A;  3RNE C;  2K9X A;  2NCN A;  3QCA A;  1NVI D;  4EKU A;  5IAA C;  1R4N B;  2MA9 B;  4HDO A;  4KKI A;  1E5W A;  1ZE3 D;  5EDS A;  2HJ1 A;  1EM7 A;  3KYC D;  5L95 C;  2JPH A;  5H92 C;  4I6L B;  1P7F A;  3DVN V;  4IWQ A;  1SE3 A;  1ZOY B;  3A9J B;  3W2D A;  2YEP B;  4RF0 A;  4L2Y A;  3OG5 A;  1C9F A;  3BYT B;  1M94 A;  2L1A A;  4G3X B;  2ZCC A;  3EEC A;  1WGR A;  3RZF A;  3X0W A;  2KDE B;  4M8N A;  1GC6 A;  2N1W A;  5JZE B;  1IUE A;  5E6P A;  1TKY A;  3WA0 A;  3PV1 A;  2VRR B;  1LO5 D;  1VJK A;  1WR6 E;  1PDX A;  3QWZ B;  3U4E G;  5HKH A;  4RCO A;  1YN3 A;  1WWT A;  1JWB D;  2RD0 A;  3LDZ E;  4N9F 4;  4RGT A;  1CJE A;  2FCN A;  2L7R A;  1R4N I;  4RGO S;  2GOW A;  2J0M A;  1VRA B;  2KWC A;  3GE8 C;  2JSV X;  3RD2 A;  1KFY B;  1N6Z A;  3VUX A;  1I4R A;  3PSE B;  1FFV A;  2GRI A;  4GU2 A;  4TUU A;  2BW2 A;  1JRP A;  4WAF A;  1UGJ A;  3O65 B;  3P2B A;  2GBR A;  3O13 A;  4OVZ A;  1YMH E;  1WXS A;  4C4V B;  3ZTD A;  4WWO A;  2WYQ A;  3WAP A;  3Q3J A;  4XDD A;  1KJT A;  2KN4 A;  3L16 A;  3BII D;  4PS7 A;  1SE4 A;  3D32 A;  2DYB A;  2I38 A;  2KMA A;  3KUC B;  3TEX A;  4OVU A;  4N58 A;  2ZJD A;  3QA8 A;  1NI2 A;  4B95 A;  2OJR A;  4II3 B;  4US9 A;  1TZ1 A;  3KLS X;  1VCB A;  3R8B A;  4BAX A;  4W9K A;  5GXG B;  1KOT A;  4YL8 A;  4ZHP A;  3K9O B;  2LXC A;  1V97 A;  4YXD B;  2OHF A;  4LJP B;  3AXC A;  2N9L A;  3RNB C;  2JY6 A;  1SE9 A;  2XNA C;  4HPL B;  4ASW C;  2PIA A;  1VLB A;  3NUH B;  1BXT A;  1QF6 A;  1I42 A;  1V86 A;  5J2R A;  1J7B A;  5C1Z A;  1SIF A;  1QOA A;  1RYJ A;  3X23 A;  2MJD A;  3NZS A;  2L76 A;  3Q8A A;  4TMA B;  1Y8R C;  3P42 A;  1PYW D;  4ZHO A;  3P63 A;  1P1A A;  3U7Z A;  1C1Y B;  1LQB A;  2KC2 A;  2JX5 A;  3SR6 A;  3KWL A;  3VH4 B;  3ZKJ C;  4JWS C;  4LNO A;  1T5X D;  2BKF A;  3ZJU A;  1C4P A;  2MQJ A;  3I63 C;  1UGM A;  2KD0 A;  4ARC A;  1C78 A;  3MJW A;  4MGY E;  2JUO A;  2K1F A;  3QC8 B;  2IGH A;  2LJ5 A;  2AYO B;  5IP4 D;  1CZP A;  4RM8 A;  2N7D A;  2LXA A;  3U8Z A;  5LNK 1;  2KDB A;  1JRO A;  4N6E B;  1ET6 A;  3R2I A;  2WP9 B;  1NYR A;  2XK5 B;  1F0Z A;  3PRZ A;  3RI7 C;  2ZPN A;  1P3Q U;  1F1H A;  1L0Y B;  1WJ4 A;  2CKH B;  4NAW B;  3W1Y A;  2BF8 B;  1FO4 A;  2WXO A;  2YVC A;  4W9D A;  2KFK B;  2G4S A;  3H1U A;  1KH0 A;  4DHJ D;  2LZ6 A;  3DWG C;  2BYF A;  3UQA A;  3TL5 A;  2KVZ A;  1WGH A;  1SIJ A;  3AI5 A;  1XCT L;  1FCL A;  5JH5 C;  1IGD A;  2BTE A;  3VDZ A;  1FRD A;  3A4R A;  5G5G A;  1I4P A;  3CIR B;  4S0R A;  4C4V A;  2WXJ A;  4BOS C;  5GMV A;  3TSS A;  4PYZ A;  1BT0 A;  2Q5W D;  2LFI A;  2PW9 A;  3AEB B;  1P98 A;  1ZXH A;  2IO1 B;  3P4Q B;  2FCS A;  1HEZ E;  2PPH A;  1NYQ A;  3R3M A;  4HJG E;  1HTO A;  4URK A;  5H8Y E;  1JWS D;  4YT0 B;  1N5X A;  5D3I B;  2LEK A;  5AUK A;  1FM0 D;  4XYC A;  3LJ3 A;  3QK0 A;  1IGC A;  1JWM D;  5G55 A;  4PS8 A;  5FR3 A;  1D5X C;  4RNA A;  1I4X A;  1FPY A;  1TTN A;  3M62 B;  4BOZ B;  3PRE A;  3HRD D;  2MWS B;  5E6N A;  1VZ7 A;  2R2O A;  4FJV B;  4HCP B;  2TSS A;  5LXH A;  1E7V A;  1Z2M A;  2OJW A;  4GIV A;  1JRU A;  4DHJ B;  4K7U A;  2MH7 A;  1VR9 A;  2W3S A;  4XWT A;  2Z0E B;  1K50 A;  3U7D A;  1T0S C;  2L00 B;  1SF0 A;  2C9W B;  2HD5 B;  2PE6 B;  3U30 A;  2NBW B;  4W9I A;  1WXV A;  1CK1 A;  2AQ1 B;  1GB4 A;  2QMT A;  2KX3 A;  2NVU I;  1HTQ A;  2FBW B;  3MJ5 A;  3HK0 A;  4C80 A;  3WAN A;  2LUM A;  1D6E C;  4HRO A;  2FUH B;  2ZVN A;  3TUO A;  4B9K A;  3H7S A;  3ZYY X;  1WZ0 A;  2EEL A;  1MVK A;  2BQQ A;  4AQ7 A;  5IKC M;  3EGR A;  1V5T A;  4O1N A;  4HLE A;  1TS4 A;  4F7Z A;  3PVL A;  3IAM 1;  3V62 A;  3ZVV A;  3APD A;  4G50 A;  2UYZ B;  2JZP A;  4LDT D;  1D5M C;  4WJP A;  5D3D A;  2WXI A;  3DBR B;  3A9K B;  4LTU A;  1KTK A;  2KLG A;  1D4B A;  1FNV A;  1TYG B;  3RFZ B;  4LNI A;  2K8H A;  1CMX B;  4TV3 A;  3ZIM A;  1WIA A;  1HQR D;  2PE9 A;  1XLP A;  1JWU D;  2FCQ A;  4ZRK A;  3DHH C;  2JYT A;  4NY0 A;  1LFD A;  2XK5 A;  1WFY A;  1GPX A;  3N9Y C;  4LCD E;  3PZD A;  2Y5P A;  2EKI A;  4MH8 A;  4NAW A;  3H7P A;  2MJE A;  3V6C B;  4BKS A;  4X57 B;  1YIW A;  3W5U B;  2KFK A;  4ITK A;  3BIN A;  1RFA A;  2IY0 B;  2ZW1 A;  3AED B;  2KXJ A;  4L23 A;  2JQR B;  3ZUN A;  5DCN A;  5J18 A;  1L0X B;  3L13 A;  2D2Q A;  2G45 B;  3OAW A;  3ZJT A;  2BT6 A;  3PZ7 A;  2MW5 A;  3DHG C;  3N32 A;  4PT5 A;  4HEA 1;  2PLP A;  3MHS D;  3RMK C;  3I5J C;  3I57 A;  1XXG A;  2L05 A;  1TS3 A;  2LHD A;  4WJN A;  3QQ8 B;  4PK1 A;  1UF0 A;  3IHP C;  2O6V D;  4ZOH C;  4EFO A;  2W9N A;  1OQR A;  4W9E A;  3ZLZ A;  1VD2 A;  4WWM A;  4JGH B;  3Q69 A;  1L6V A;  1OFF A;  2W55 A;  1ZXI A;  2A5U A;  2CS4 A;  1KF6 B;  3ONS A;  2ZNV C;  4NJ7 A;  4HPP A;  1RAX A;  3Q3F A;  3JSV B;  4ZYS A;  2LRU A;  5L83 A;  1ZDX A;  5HHD G;  3WAL A;  2C60 A;  1P7E A;  2J0J A;  1K8R B;  4ANW A;  2KWV B;  4IM3 A;  3P4P B;  4MM3 A;  2XBB C;  2LD9 A;  1QQR A;  3GB1 A;  1NBF C;  3L10 B;  2KTR A;  5EE1 A;  3SEB A;  1ACC A;  2BVC A;  3A33 B;  3V05 A;  1LM8 B;  4LNF A;  2DNF A;  1WRD B;  2M0A A;  3SDL C;  2CHW A;  3UQB A;  1WGK A;  2KN5 A;  2MX2 A;  1MG4 A;  1V1P A;  2KK8 A;  4YSZ B;  1S3S G;  4XDC A;  1TZO A;  5T8I A;  4L1B A;  1Q10 A;  2O6V B;  1FNU A;  3VXW A;  4RFB A;  1C77 A;  1KLV A;  4FLH A;  4EZL A;  2N7E A;  3QHT A;  2MCN B;  3VVW B;  4BVU C;  1SJE D;  2M8S A;  2KJR A;  1UWX A;  2HTM E;  1GUA B;  4WQM A;  2V1Y A;  1AN8 A;  2QEJ C;  3L17 A;  2KOX A;  2JYE A;  1QOF A;  4KZ0 A;  5BMG A;  3N20 C;  1ET9 A;  2CHZ A;  4P7I A;  3EHV A;  4XZ4 A;  1QKZ A;  1UH6 A;  3V61 A;  4HKZ E;  3NS1 A;  4ICV A;  3IVF A;  1MG8 A;  1F77 A;  4RMA A;  1ESF A;  2AEH A;  2D10 A;  1H8C A;  4BFR A;  5DPS A;  2GBM A;  3KWV A;  2FIF A;  2ZEQ A;  4AP4 C;  4A20 A;  1WX9 A;  1AYF A;  2K25 A;  1FIQ A;  4AS1 A;  1XLQ A;  2KAC A;  1J7C A;  3AEE B;  2DYM A;  1BUI C;  3EFU A;  2R61 A;  3R7R A;  1SGH A;  4R3D A;  3NY5 A;  2RPQ A;  2I1K A;  1YJ1 A;  1T6B X;  1WXQ A;  4GDL A;  4H2A A;  1N62 A;  4ZRJ A;  3B2F A;  4GDK A;  2VZK D;  4E3C A;  1WYG A;  2VH1 A;  1FXI A;  1TT5 B;  4A55 A;  2MBH A;  2N9E B;  3L4P A;  1XT9 B;  4K7W A;  1E7P B;  3ZRF A;  2KZR A;  3AN1 A;  4ZDV A;  3AE8 B;  3MP9 A;  3NVV A;  4EUT A;  2AL6 A;  3ZNH B;  2QHO A;  3UI3 A;  1DOI A;  1F9J A;  2EMS A;  1E8Y A;  3AUL A;  1E0Z A;  4E74 A;  3DPD A;  1E9M A;  3AE9 B;  3Q8E A;  4DBG A;  1A5R A;  2J53 A;  4EOY A;  1WX7 A;  3SD5 A;  3JSV A;  2GLS A;  1Q0W B;  4S17 A;  3SU8 X;  2C5L C;  1I7H A;  1OQQ A;  2O2V B;  2HE7 A;  2WWZ A;  1J0G A;  1HZ6 A;  5AUI A;  4MEM A;  2VZK B;  3NS8 A;  1JCK B;  3SFD B;  1XO3 A;  1XQQ A;  2C7M B;  3FKY A;  1TGZ B;  5IO9 A;  4ANX A;  4IM0 A;  1GG3 A;  4M01 A;  3AMZ A;  3E56 A;  2V0G A;  1ZPS A;  4AJW A;  3AEG B;  2ONQ A;  3NOB A;  4JPS A;  4FJZ A;  5IN7 A;  2IGG A;  3KYD D;  4MSQ B;  5TR5 A;  4FHK A;  2O6V A;  2HTH A;  4GLS C;  4WWP A;  1F52 A;  4E71 A;  2BKR B;  4KVG B;  3VQI A;  1M4V A;  1L4Z B;  2E6X A;  4KDI C;  3ZXV A;  1P9D U;  3HM6 X;  4OW0 A;  2LGS A;  5LXI B;  2NPT A;  3B1L X;  4BBN C;  4WJQ A;  3ZJV A;  2I2Y A;  3SHQ A;  4C00 A;  2PEA A;  1LGR A;  4M02 A;  1WJU A;  1IBX B;  2WU2 B;  1IYF A;  1IP9 A;  2J42 A;  3JYU A;  4OVV A;  2X38 A;  3TEW A;  1V81 A;  2EMT A;  3EC8 A;  1S1Q B;  2WXP A;  4IM2 A;  2NTT A;  3AE3 B;  3DVG Y;  2X8X X;  4DHZ E;  2MSE D;  3AE7 B;  2R2Q A;  1C3T A;  4P16 A;  3R7Q A;  3UIP B;  3KVF B;  4TQ1 A;  1PGB A;  2WDV B;  1I4Q A;  2G1E A;  3A9J A;  1N60 A;  3BWU D;  1V5O A;  2QJL A;  1TBE A;  1XD3 B;  2D3G A;  2JRI B;  3NVZ A;  4IWO A;  1TKE A;  4KSK C;  4WAA A;  3QX1 A;  3S2A A;  4WJO A;  1KLU D;  3H6N A;  2KNB A;  3KH0 A;  4MJS B;  3CWI A;  5C3J B;  3BZD B;  2K8B A;  4YTM B;  2REX A;  4WUR A; 
#chains in the Genus database with same CATH homology
 2UYZ B;  1WE7 A;  4W9G A;  2BYE A;  3APF A;  4LDT D;  3RZW C;  1E8W A;  2M17 A;  2LGX A;  4WJP A;  2ASQ A;  4MSM B;  3ZDM C;  2KC1 A;  4NJ6 A;  3ZW3 A;  2LI5 A;  3A9K B;  4FJY A;  4BKG A;  1UBQ A;  1AAR A;  2KWU B;  2K6D B;  2KLG A;  2ZVO A;  3UIN B;  4A3P A;  2L8J A;  2MLB A;  5C23 A;  4MEL A;  2K8H A;  1CMX B;  4TV3 A;  5E6O A;  3ZIM A;  2MP2 A;  1WIA A;  3CMM B;  5G2N A;  2AWT A;  2OOB B;  2PE9 A;  5DPT A;  3DVN U;  2WX1 A;  3OJ3 A;  2FCQ A;  2N9X A;  4ZRK A;  3IG3 A;  2KVR A;  2UWQ A;  1OEY A;  5J17 A;  1ZKH A;  4NY0 A;  1LFD A;  1EO6 A;  2XK5 A;  1WFY A;  1OGW A;  3NHE B;  3ZNI D;  1WH3 A;  4LCD E;  3ECI A;  3PZD A;  2A4Z A;  2DZI A;  3DVG X;  3ZTC A;  2O2V A;  4NAW A;  3H7P A;  2NPT B;  2RSU A;  3VFK A;  2KFJ A;  4FN2 A;  1J8C A;  3V6C B;  2DAF A;  4K81 A;  4X57 B;  1YIW A;  2ZZP B;  4BKS A;  2KFK A;  2IYD B;  2N4F A;  3BIN A;  2WDT B;  4XX5 A;  5DPR A;  1RFA A;  2IY0 B;  3APC A;  2J0K A;  2GBK A;  1Q1O A;  1WY8 A;  2KXJ A;  2NCN A;  5FR6 A;  1D3Z A;  5JHA A;  4ICU A;  3QCA A;  3ZUN A;  4EKU A;  5DCN A;  2GBN A;  5D6J B;  5AZF A;  5IAA C;  5J18 A;  1WI0 A;  5CX3 A;  4EZJ A;  2MBQ A;  4AWJ A;  1U4A A;  3L13 A;  3HIZ A;  2MA9 B;  4HDO A;  1E5W A;  1YX5 B;  2D2Q A;  2G45 B;  1IPG A;  2LVO A;  4KDL B;  3RUI B;  5EDS A;  1WX8 A;  1YQB A;  3KYC D;  5L95 C;  2JPH A;  3A4S C;  3OAW A;  4I6L B;  1WXA A;  3DVN V;  4IWQ A;  3R66 C;  2MW5 A;  4GN1 A;  1WZ3 A;  2C7N B;  3A9J B;  3ZDT A;  2NR2 A;  3N32 A;  1L7Y A;  3MHS D;  1WMH B;  2L05 A;  4WJN A;  3M3J A;  3MTN B;  3QQ8 B;  5D94 A;  2FNJ B;  1M94 A;  4G3X B;  1ISN A;  2ZCC A;  3EEC A;  1WGR A;  3IHP C;  3RZF A;  2O6V D;  3X0W A;  4EFO A;  2LGY A;  4KSL C;  2W9N A;  2KDE B;  2NBU A;  1GC6 A;  2N1W A;  4M8N A;  5E6P A;  5JZE B;  4W9E A;  3ZLZ A;  1VD2 A;  5LLI A;  3WA0 A;  4BKS D;  4JGH B;  3PV1 A;  5AEK B;  2VRR B;  1WR6 E;  2A5U A;  2BGF A;  2CS4 A;  3QWZ B;  2KX0 A;  3ML9 A;  3ONS A;  2ZNV C;  5HKH A;  4MH0 E;  1WGG A;  4NJ7 A;  3KUZ A;  4K7S A;  2V4L A;  2JWZ A;  2RD0 A;  1RAX A;  3LDZ E;  4N9F 4;  2JVC A;  3Q3F A;  3JSV B;  3A1Q B;  2IO3 B;  2LRU A;  5L83 A;  3WAL A;  1L2N A;  2FCN A;  2C60 A;  2J0J A;  1ZW7 A;  4KIK A;  1K8R B;  2L7R A;  1R4N I;  4ANW A;  2KWV B;  4IM3 A;  4I6P A;  2M0X A;  4MM3 A;  2GOW A;  3UGB B;  2J0M A;  2XBB C;  1V49 A;  2KWC A;  4HK2 A;  2DEN B;  2LD9 A;  2L0T A;  4BBN F;  1NBF C;  3L10 B;  3RD2 A;  4W9J A;  1V6E A;  2KAN A;  2KTR A;  3VUX A;  3PSE B;  1WM2 A;  3QAR A;  3L08 A;  4GU2 A;  3TBL D;  3A33 B;  4TUU A;  5D2M B;  1LM8 B;  1P0R A;  1WE6 A;  3JW0 X;  3O65 B;  3P2B A;  2LAS A;  2NBV B;  2GBR A;  2XEW A;  3C0R B;  3CF6 E;  3ZNG C;  1WRD B;  3SDL C;  1WXS A;  2CHW A;  3UQB A;  3ZTD A;  2KN5 A;  2MX2 A;  2YLM A;  4HVB A;  4NPN A;  4WWO A;  1YD8 U;  2KK8 A;  4HDQ A;  2WYQ A;  4HXD A;  2ZCB A;  3WAP A;  1S3S G;  4DHZ B;  2JZ3 B;  2ZPY A;  3Q3J A;  5AZH A;  3OJ4 B;  2DHZ A;  1KJT A;  1WR1 A;  2O6V B;  3H7P B;  3VXW A;  3L16 A;  3IBE A;  4PS7 A;  2DAJ A;  1KLV A;  4FLH A;  4EZL A;  2N7E A;  3D32 A;  2IO2 B;  3QHT A;  2MCN B;  3VVW B;  4BVU C;  2DYB A;  2M8S A;  2KJR A;  2IBI B;  4GGQ A;  2KMA A;  3KUC B;  4FBJ B;  1GUA B;  2EKE C;  2V1Y A;  4OVU A;  3CST A;  5AZG A;  3L17 A;  2KOX A;  3WAO A;  2ZJD A;  3QA8 A;  1NI2 A;  4B95 A;  2OJR A;  4II3 B;  4KZ0 A;  1TZ1 A;  2Z59 B;  3DQV A;  5IA7 A;  5JHB A;  1VCB A;  1G6J A;  4W9K A;  2CHZ A;  1KOT A;  2KJH B;  4P7I A;  3EHV A;  4YL8 A;  3PLV A;  1UEL A;  3RCZ A;  3K9O B;  4ZRI A;  2FID A;  4XZ4 A;  4B6W A;  2LXC A;  1UH6 A;  3RT3 B;  2MBB B;  1UZX B;  3CSF A;  3V61 A;  3VTW A;  5DPW A;  4ZYN A;  5CTR C;  2RGF A;  4W9C A;  2CU1 A;  2MBE A;  4ICV A;  3IVF A;  4KV2 A;  4W9H A;  3VUW A;  2C7H A;  1MG8 A;  3B0A A;  3T9L A;  4JIO U;  4RMA A;  5D7G A;  1OQY A;  2AL3 A;  4LJP B;  2AEH A;  2D10 A;  3AXC A;  4BFR A;  2DZK A;  3PHW B;  4LDT B;  4EEW A;  1H8C A;  2GMI C;  2WX0 A;  2DZJ A;  4HPM B;  5DPS A;  2GBM A;  2JY6 A;  2IO0 B;  1SE9 A;  2PJH A;  2FIF A;  3GOE A;  3KW5 B;  4HPL B;  2ZEQ A;  4ASW C;  4AUQ C;  1I42 A;  1V86 A;  4AP4 C;  5J2R A;  4A20 A;  1WX9 A;  2BPS A;  4IWP A;  3RYT A;  2G3Q B;  2KHW B;  5C1Z A;  1SIF A;  2K25 A;  3PS6 A;  3X23 A;  3NZS A;  2L76 A;  3W1S C;  4ANU A;  4MGZ E;  1Y8R C;  2MBO A;  4K1R B;  1OTR B;  4MDK E;  2DYM A;  2JXX A;  1P1A A;  3VAW A;  1NDD A;  4KZC A;  1V2Y A;  1C1Y B;  1LQB A;  2L0F A;  4A3O A;  3EFU A;  3QAQ A;  2KQS A;  2KC2 A;  3R7R A;  4IUM B;  4HJK A;  1SGH A;  3TIX A;  3UIO B;  4IG7 B;  3VH4 B;  3NY5 A;  3ZKJ C;  4LJO B;  2RPQ A;  2I1K A;  3WIM A;  1YJ1 A;  2BKF A;  4GDL A;  3PRM B;  1OEY J;  2KTF A;  4ZRJ A;  1UD7 A;  2KKC A;  2D07 B;  4GDK A;  3DBS A;  2KO3 A;  2L3Z A;  1R4M I;  2MQJ A;  4MGK E;  4E3C A;  1UGM A;  1E8Z A;  5BO4 B;  2KDI A;  2KD0 A;  2MBH A;  2KTR B;  4F1S A;  2N9E B;  5CHF A;  1XT9 B;  1YX6 B;  2LRW A;  3ALB A;  3MJW A;  4K7W A;  3ZRF A;  2KZR A;  4MGY E;  2JUO A;  3I3T B;  2K1F A;  3QC8 B;  3V60 A;  2LGD A;  4RM9 A;  4ZDV A;  3OLM D;  3PTF C;  2LJ5 A;  4G0N B;  2AYO B;  2CR5 A;  4EUT A;  1WMH A;  4GB9 A;  4RM8 A;  2AL6 A;  3DBL I;  2N7D A;  4HCN B;  3ZNH B;  2QHO A;  1RRB A;  1WXM A;  2HJ8 A;  1F9J A;  2EMS A;  2LXA A;  2MP2 B;  3JVZ X;  1WM3 A;  3U8Z A;  4CYE A;  2FAZ A;  2KDB A;  1E8Y A;  3AUL A;  4I6N B;  2FCM A;  4E74 A;  4NNJ B;  3DPD A;  2Z0D B;  1Q5W B;  2MRP A;  2DX5 B;  4XC2 A;  2XK5 B;  1E90 A;  2B3A A;  3PRZ A;  2ZPN A;  4FHJ A;  1P3Q U;  2NS5 A;  4DBG A;  1A5R A;  3N3K B;  4EOY A;  1WX7 A;  2LVQ A;  4M0W B;  4W9F A;  3SD5 A;  3IFW B;  1J19 A;  1WJ4 A;  2D11 A;  3DOW A;  3JSV A;  3A1Q A;  1Q0W B;  1WJ6 A;  2CKH B;  3SU8 X;  2C5L C;  4BKT A;  2O2V B;  4NAW B;  1EF5 A;  2BF8 B;  2HE7 A;  3K9P B;  3V6E B;  3W1Y A;  2WWZ A;  4GSW A;  2YVC A;  4MJS A;  4W9D A;  2KFK B;  2G4S A;  3H1U A;  2RR9 A;  1J0G A;  3DBH I;  1PQS A;  4DHJ D;  2LZ6 A;  3GZN I;  4W9L A;  4MEM A;  2KDF B;  3NS8 A;  4HWI B;  1X1M A;  2BYF A;  2DZM A;  2K8C A;  3VUY A;  2LWP A;  1E7U A;  4G11 A;  3UQA A;  3TL5 A;  3AU5 A;  2LVP A;  1XQQ A;  2JF5 A;  4GOC A;  3PLU A;  1WGH A;  4IC7 B;  3VTV A;  2C7M B;  3AI5 A;  1EF1 A;  3ZNZ B;  1TGZ B;  5JH5 C;  4DDG D;  3B08 A;  4DWF A;  3VDZ A;  4ANX A;  3ML8 A;  1RLF A;  1T0Y A;  1QZE A;  4IM0 A;  2BWF A;  3BY4 B;  1GG3 A;  4FAD A;  3A4R A;  3A9K A;  2M4N A;  1GNU A;  4DXA B;  4BOS C;  1GC7 A;  4AJW A;  5GMV A;  2IY1 B;  3L54 A;  4JL9 A;  4PYZ A;  1BT0 A;  4DK5 A;  1WF9 A;  1WGY A;  1KM7 A;  3NOB A;  2DYO A;  4FJZ A;  3T8M A;  2BYV E;  1P98 A;  2IO1 B;  2JT4 B;  3KYD D;  4MSQ B;  2M1M A;  5TR5 A;  4CO7 A;  4FHK A;  3RUL A;  2FCS A;  2G4D B;  2HTH A;  2O6V A;  2PPH A;  4WWP A;  3HM3 A;  4E71 A;  2BKR B;  3R3M A;  4KVG B;  4EZK A;  4URK A;  4AOF A;  3M95 A;  3L0W B;  3QJZ A;  4ANV A;  4CHK A;  3VQI A;  5KHO A;  4KDI C;  2KJ6 A;  3DCG A;  1P9D U;  3LJ3 A;  3QK0 A;  3DDC B;  5G55 A;  1V80 A;  1HE8 A;  4PS8 A;  4GDL B;  3HM6 X;  2K39 A;  2JZZ A;  1TTN A;  3PHX B;  3M62 B;  1E8X A;  4WQO B;  3VTU A;  3PRE A;  4BOZ B;  5LXI B;  2NPT A;  3DBR I;  4GDK B;  3KUD B;  3B1L X;  4BBN C;  4WJQ A;  2MWS B;  5E6N A;  4PS3 A;  2R2O A;  3H9D A;  4FJV B;  2N9P C;  2KLC A;  4HCP B;  3QIJ A;  3SHQ A;  4F8C B;  5LXH A;  1E7V A;  2K6Q A;  3NZU A;  3ZO5 B;  2JRH A;  3WAM A;  3M63 B;  4FUL A;  1Z2M A;  2PEA A;  4GIV A;  1JRU A;  5CHW A;  4DHJ B;  4K7U A;  2V3S A;  3AU4 A;  1WJU A;  2N1V A;  3TCA A;  4KIK B;  3PGE A;  1WJN A;  2Z0E B;  3U7D A;  1IYF A;  4JQW C;  1IP9 A;  2L00 B;  3JYU A;  2I1J A;  3PPA A;  4OVV A;  4AJY B;  1V81 A;  2C9W B;  2EMT A;  2HD5 B;  4II2 B;  3EC8 A;  1S1Q B;  4IM2 A;  2PE6 B;  3U30 A;  2NBW B;  3DVG Y;  4MGI E;  4DHZ E;  2GBJ A;  4W9I A;  2MSE D;  2R2Q A;  1H4R A;  1WXV A;  3TJP A;  1C3T A;  3R7Q A;  3UIP B;  1WGD A;  2KX3 A;  2NVU I;  3N30 A;  3KVF B;  4TQ1 A;  4WWN A;  4FA6 A;  3HK0 A;  3HHM A;  3A9J A;  3WAN A;  3PRP B;  1V5O A;  4PYU A;  4J6I A;  3UF8 A;  4IW0 A;  2KQ7 A;  2FUH B;  5KHQ A;  1TBE A;  2KMC A;  2ZVN A;  3VH3 B;  1XD3 B;  4B9K A;  3H7S A;  4GXB A;  2D3G A;  2J7Q B;  1WZ0 A;  3ENE A;  4NQL B;  4JLC A;  2JRI B;  4IWO A;  3PT2 B;  4TKN A;  3ZRC A;  4KSK C;  4WAA A;  3W1S A;  2Y5B B;  4DDI D;  3QX1 A;  1WYW B;  2BWE S;  4WJO A;  3S2A A;  1V9J A;  1UBI A;  1V5T A;  4HLE A;  1ZGU B;  3H6N A;  3KH0 A;  2KNB A;  4MJS B;  2IZV B;  5CHV C;  2ZNV B;  4F7Z A;  3PVL A;  1EUV B;  4M8M A;  4GMV A;  1FXT B;  3V62 A;  1LXD A;  3ZVV A;  1I35 A;  1GJZ A;  3APD A;  3TMP B;  3VHT C;  2LUE A;  2CHX A;  2K8B A;  1Z5S B;  4TQ0 A;  4NQK E;  4G50 A;  2REX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...