3LXFA

Crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRLPALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular characterization of a class I P450 electron transfer system from Novosphingobium aromaticivorans DSM12444
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Metal binding protein
molecule keywords Ferredoxin
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lxfA00
1V8CA 3AE1B 3VRBB 2M56B 1RYJA 1ZP0B 1WWTA 1FM0D 2BS3B 4HROA 5EE9A 3SFEB 1QOBA 1T3QA 1VJKA 1YJIA 3PO0A 2MJ3A 2L52A 1KRHA 1FFVA 1JRPA 1NYRA 1N5WA 2N0SB 2OHFA 3AE3B 4YTPB 3FAHA 3W5UB 3NS1A 4C80A 1V97A 3CWIA 2AX5A 1EWYC 2DBYA 3NVYA 1XLOA 1L6UA 1CJEA 2KAJA 3HVZA 4N6EB 2BS2B 1DOIA 2HTME 1FRRA 1RFKA 3B2GA 3NVWA 3B2FA 4ZHPA 1ZUD2 4P6VF 1E10A 1QF6A 1N61A 2Q5WD 4YT0B 2W54A 4YTMB 1NVID 1NYQA 3SR6A 1TKGA 1VLBA 1UWMA 3ABVB 1GPXA 2Y5CA 3W5VB 2BT6A 1FMAD 2WLBA 2B76B 3AEGB 1SB3C 2CJOA 5G5HA 2WU2B 3NVVA 1DOYA 1F0ZA 5AUIA 4ZOHC 5C3JB 1QOFA 1QT9A 1YQ4B 3P4SB 1FXIA 3AE7B 1XLNA 1KF6B 1RM6C 4YSZB 4KX6B 1L5PA 5H8YE 3AMZA 1OQRA 1PUTA 1TJEA 2K22A 2M19A 3WCQA 1NEKB 1ZOYB 2LEKA 3AE5B 2L83A 4FXCA 3RPFC 1E0ZA 1QOAA 4US8A 1CZPA 4JWUC 2EKIA 1JWBD 2KMMA 2WDRB 3AE9B 4N58A 1J7BA 1L0VB 1SIJA 2ACZB 2WQYB 3AM9A 1YQ3B 1ROEA 2MJDA 3HUIA 2E3TA 1JQ4A 2CU3A 2WS3B 3P4RB 3ZYYX 1NI3A 1N63A 4WQMA 5C2TB 2W3SA 4N59A 3NVZA 3AE6B 3AB5A 4WWMA 5EE1A 1FO4A 3HRDD 2CJNA 2MH7A 1XLQA 1YJJA 3EUB2 3LXFA 4LTUA 3B9JA 1FFUA 2PIAA 2WP9B 3W9CB 3BIID 4USAA 1L6VA 2JX5A 3AEFB 5GXGB 5G5GA 2BS4B 2QJLA 4IDIA 1XLPA 1JALA 2WDVB 3ETRA 3NRZA 2K5PA 4ZHOA 3AEDB 3AEAB 3P4PB 3AEEB 3LB8C 1QOGA 4C7YA 1J7AA 4ITKA 4YXDB 4YSYB 2G1EA 1SF0A 1JROA 2H88B 3VR8B 3AE2B 3DWMA 1PFDA 1R7SA 2WU5B 3P63A 2PVGC 1JWAD 2FBWB 1DOXA 1TKYA 2H89B 3AEBB 4US9A 4C7ZA 3CIRB 3AV8A 1AYFA 4YTNB 1J7CA 3DWGC 1E6EB 5H92C 1FRDA 1GAQB 1KFYB 3P1MA 1B9RA 3AN1A 1N62A 1NENB 1XO3A 1N60A 1IUEA 2QIEB 3AE4B 3AE8B 4JWSC 1PDXA 2W3RA 3VRAB 4YSXB 1DGJA 1ZXIA 2WDQB 1A70A 1AWDA 1TYGB 3SFDB 3VR9B 4A9AA 2MJEA 2W55A 5MPOA 1OFFA 1I7HA 1VDVA 2DWQA 3KWLA 2PKOA 2PVOD 5EE0A 1WRIA 3AECB 1JW9D 5AUKA 3P4QB 4HRSA 1WXQA 1RWSA 5EE3A 1FIQA 1WGKA 3FC4A 1QLBB 3L4PA 4JX1C 1WYGA 3AH7A 1FXAA 2K9XA 1E7PB 2JQRB 1OQQA 1E9MA 1TKEA 1N5XA
chains in the Genus database with same CATH superfamily
2INDC 4DQOC 2V3SA 3V6EB 3VQIA 2BS3B 2REXA 3TBLD 5D3DA 1VJKA 3BVGA 2RDGA 1FFVA 2ZPYA 5KHQA 4RNAA 4XC2A 4N6EB 4MM3A 4B95A 2HTME 1SGHA 4KGSA 1A5RA 2LGYA 4EUTA 2W54A 1QILA 5DPTA 2QDFA 3LDZE 1HE8A 3R8BA 3LJ3A 4NZLB 3APDA 2V9HA 3DHGC 3PRZA 2IYDB 3K9OB 3MJWA 1RM6C 2D3GA 4IM2A 1OQRA 5H8YE 1OQYA 4MJSA 1E0ZA 1V5TA 1L0VB 2KFKB 3ZJVA 3ZGZA 2MJDA 1TZOA 2L32A 5D94A 3AE6B 2CJNA 3N32A 3KW5B 3VAWA 2KWDA 3VVWB 4KZ0A 4JGHB 5GXGB 4WAFA 1SBBB 1E7VA 1K8RB 3CSFA 5E6NA 2H88B 4N9F4 1WM2A 1PFDA 1F77A 1WGGA 1KLGD 2WXGA 1LM8B 3J9CA 3GS2A 1GOZA 4DHJB 3ZQ4A 4RM8A 3PT2B 1GB1A 1YIWA 3QQ8B 1WRIA 5BMGA 1F9JA 1XF5L 4OW0A 3BY4B 3KLSX 1V80A 4DXFA 1QLBB 1C9FA 1OQQA 1E9MA 2GI9A 1N5XA 3ZJUA 1WXMA 1WWTA 2PTLA 1T3QA 3FILA 2C5LC 1UH6A 2MJ3A 3KQ4A 1E7UA 1JRPA 3ZW3A 2LI5A 4KSLC 4LK0M 4NAMA 1TT5B 3B08A 1Z5SB 4P1CC 3NVYA 2ZNVC 4DHZE 4KDLB 2BPSA 3NVWA 3B2GA 1WMHB 3H8HA 4NAWA 4AJYB 1P7FA 3ZVVA 4KKJA 1HXYD 3P2BA 1UWMA 3CF6E 3ABVB 2MBOA 1F0ZA 2KJHB 3TEXA 3PS6A 2G4SA 2NMQA 2KO3A 4YSZB 1ZDXA 2VH2A 1WXSA 3EFUA 2RD0A 2XNAC 4AS1A 4NPNA 2MW5A 1QOAA 4A90A 1E8ZA 2FCQA 4P7IA 4K3BA 2WXIA 1SIJA 3GZNI 5HFYA 4N59A 1C4CA 2K6DB 3B9JA 1WXVA 4EZJA 2QJLA 1SJED 4IG7B 2JWUA 1SF0A 1R4MI 3SEBA 1R7SA 2I2YA 1JWAD 1P0RA 4J6IA 4II3B 1TTNA 1SE4A 1TS3A 2JU6X 2RR9A 2N9XA 4K81A 4IWPA 1ZXHA 2W3RA 2M4NA 4RF1A 3SFDB 2BYVE 4C4VA 3L08A 1V6EA 2BQQA 4RGTA 2K8CA 2IDYA 2WYQA 2ON8A 2KHWB 3RNAC 4EE2A 2K9XA 1JWUD 4OHJA 3DVGX 3VRBB 1KOTA 4GB9A 2JYEA 4M0WA 2LGDA 3A1QA 2OHFA 3NS1A 2BBCA 2AX5A 1RFKA 3V6CB 1QF6A 3Q3MC 2KTFA 3ZNID 2BF8B 3SR6A 1VLBA 4IW0A 3W5VB 4OZAA 3TCAA 3AEGB 1VZ8A 2R61A 2L0TA 1F1HA 3W1SA 2LXCA 3Q8BA 2NR2A 2JF5A 2I38A 2GBJA 4KX6B 2C7MB 1H8CA 1HTOA 1JCKB 2KDEB 3Q3NC 4JWUC 3L17A 2ACZB 1YQ3B 4LJOB 2E3TA 2LASA 1V1PB 2UWQA 2C7NB 3TEYA 1T0SC 4DHZB 1BXTA 1EF5A 3W9CB 3PV1A 4OVUA 3Q8EA 1ZPSA 2BB6A 1MI0A 2LWPA 4M02A 4DDGD 3NS8A 4HPPA 2WXOA 2JT4B 2ZPNA 3AE2B 4WWNA 2PW9A 1LFDA 4IM0A 2HTHA 3VTUA 2C9WB 2LUEA 2MBHA 1FRDA 2C60A 2DNFA 3QA8A 1N60A 4M01A 5D7GA 3R7RA 2LJIA 3U4EG 4IOIE 1WRDB 1WR1A 1WE7A 1MVKA 1L2NA 1JW9D 5JXVA 2WXPA 4NNJB 2ZNVB 1TIFA 4HJGE 3RZFA 2JZ3B 3ALBA 1GB4A 4HK2A 4YTPB 3IT4B 1V97A 4O1NA 1XLOA 1CJEA 4HKZE 1FRRA 4ZHPA 2AQ1B 4KGRA 2QC8A 4ARCA 1I4RA 2LMCA 4UDUC 3RNEC 1V2YA 1XD3B 3Q2AC 3U2SC 3BVMA 2KX0A 1VR9A 3P4SB 5JHAA 4AP4C 1L5PA 3AMZA 3WCQA 3QCAA 4XWTA 4NY0A 4XE0A 2VRRB 2EKIA 3BWUD 1AW7A 2VZKD 2WS3B 1WY8A 1IP9A 4JE3B 4LTUA 2DX5B 3UI3A 4HXDA 3PHWB 3WA0A 2FIFA 5I4DA 2G9HD 5DCNA 3P4PB 1FCCC 2LFIA 1E90A 4YXDB 1EU4A 1JROA 2EELA 5IP4D 4XZ4A 2MWSB 1WMHA 1WGHA 1WX7A 3M63B 4F7ZA 5IA7A 3OWEB 1IUEA 3BVZA 5JH5C 4E71A 4NJCA 3C0RB 3I5JC 1SSNA 4TV3A 4WH4A 3E56A 1WJUA 4R3DA 3Q6BA 4W9CA 4GDLB 1XCTL 2J0MA 2MQJA 4F8CB 4XYCA 1YNTE 1M94A 3GB1A 4FHKA 1KM7A 2LD9A 3HHMA 2L0FA 2N4FA 2CS4A 3VTWA 4LCDE 3SFEB 1FNVA 2G3QB 1MG4A 2MCNB 3FAHA 1P7EA 2N9KA 2BYEA 2DZKA 1NYQA 2EMSA 2X38A 2ZCBA 2Y5CA 3PZDA 4PYZA 2M8SA 2LGXA 3L54A 4ZOHC 4A8XC 3U52E 2I1JA 1YQ4B 4GIVA 3BYTB 3VTVA 2L7RA 2KTRA 1NEKB 1YN4A 1WJNA 4MH0E 4BKSA 3Q3FA 4PYUA 1J7BA 1XCQL 4REZA 3A9KA 2QSDA 3IAS1 4HWIB 3L13A 3P4RB 4MGKE 4K7SA 4CHKA 5C2TB 4H2AA 1YOVB 3AB5A 3HRDD 2PJHA 1XLQA 4GLSC 4AJWA 2L3ZA 4HCNB 1L6VA 5LNK1 1WR6E 1EWCA 4KV2A 3NRZA 1Q5WB 2L76A 1R4NI 5AEKB 1JWSD 1IBXB 2WXQA 2K8BA 3SHQA 3UQAA 1T0QC 1UBQA 4C7ZA 2WX1A 1R4MB 3V05A 2JUOA 3AN1A 3MC9A 3PLVA 1DGJA 3ZDMC 1ISNA 1FIQA 2MBQA 3M62B 4GDKA 3DOWA 4GDKB 1V8CA 4ZYNA 4W9GA 2DENB 2PPHA 4BFRA 4M0WB 5IKCM 4HROA 2LGIA 4DK5A 3H1UA 1Q1OA 3JSVA 3AE3B 4M8MA 2KYWA 1KTKA 4C80A 2MRPA 2KTRB 4LNOA 3VH3B 4W9HA 4MGYE 5HI1A 4RMAA 4S17A 2GBKA 1MG8A 2MA9B 1VZ7A 4LNKA 1GC6A 3VUXA 2LGSA 4XGAB 4IUMB 1PQSA 3PSEB 3ZDTA 5C3JB 1QT9A 1D5XC 5LXIB 3A33B 1ZOYB 5D6JB 3RD2A 2LRWA 2NBWB 2N7DA 1GNUA 3QIJA 1N63A 1V86A 2O2VA 2INNE 2KDMA 2O2VB 4KVGB 2AYOB 1V1OA 4DXAB 1YJJA 3EUB2 3LXFA 1L4ZB 1FFUA 4URKA 1VZ6A 3DBRB 3S2AA 4ZHOA 5GMVA 3RNGC 4L23A 3TL5A 4IWOA 1GJZA 4WJOA 3QJZA 3DBRI 1I35A 3A9JB 3ML8A 3MC0B 4IKGA 1PYWD 1E8YA 3N30A 1GAQB 1PGBA 1KFYB 1EUVB 2QEJC 1WIAA 3T8MA 2JRIB 1UNSA 3VRAB 2BVCA 3UF8A 2KMAA 1L0YB 3D32A 1OTRB 2PKOA 1EM7A 4ZYSA 3VDZA 4MJSB 2N7JA 3CMMB 1C79A 3N3KB 3FKYA 1S3SG 3CWIA 4NJ7A 4ICUA 2QCZA 1XEEA 2M1MA 2X8XX 3I63C 4ICVA 1K51A 4YTMB 2NBUA 5TSSA 1FPYA 2BT6A 1C76A 2G4DB 3NHEB 1D5ZC 5KHOA 5CX3A 1RLFA 1ZKHA 1ZW7A 1PUTA 3TEWA 3OAWA 3SU8X 1B1ZA 5TR5A 1QZEA 2SEBD 4JLCA 2WDRB 2DYMA 2NPTB 3TJPA 2KD0A 3C19A 3EHVA 2W82A 3DPDA 1UUPA 1V49A 3V62A 5FR6A 3H7SA 4GXBA 5G55A 1L7YA 4FJVB 1C3TA 4OZBA 2WWZA 3P63A 2WXHA 2WGSA 3R2IA 1WX9A 2XEWA 2KDFB 3RN9C 3AV8A 5D2MB 2VZKB 1SE9A 3Q8FA 5H92C 1PGAA 1I4QA 1HTQA 3WANA 2V4LA 1CK1A 2KMCA 4HPLB 2LVPA 2WDQB 3VR9B 2D07B 4ANWA 1UD7A 2NCNA 2DWQA 5IOIA 3R3MA 2PVOD 2JSVX 2NVUI 2VH1A 2W9NA 2ZEQA 1EO6A 4FADA 3DVNU 3FC4A 2WXNA 4FJYA 1YJ1A 3ZNGC 4MEMA 2MEKA 3A9KB 2KJRA 3EFCA 4AUQC 3HVDA 3LYYA 5BMHA 4ASWC 4JL9A 1BMLC 2Y3AA 2K25A 1OEYJ 4BBNF 3RT3B 1L6UA 4W9FA 1JRUA 3B2FA 5T8IA 3UIPB 1TKGA 2E6XA 2BTEA 1GPXA 1HEZE 4A3PA 2JZPA 3X23A 2A4ZA 1YD8U 1UBIA 3VUWA 1LO5D 1FXIA 1Q0WB 2Z59B 1XLNA 1E8WA 3RULA 3TUOA 4P1BC 3VUYA 3I3TB 1KLUD 5CTRC 4AWJA 4EKUA 2R2OA 2CU1A 3OJ3A 2DZMA 2GMIC 1MFWA 1SXTA 2Z8LA 4KSKC 5J2RA 3A1QB 2DYOA 2D3AA 4JQWC 3KUCB 1I4PA 4WWOA 4NJ6A 2N7EA 4YSYB 3ZTCA 5HG2A 1YX5B 1KLVA 4W9LA 3V60A 3ZXRA 1NDDA 2HJ8A 3L16A 1WE6A 4LNIA 3CIRB 3ZXVA 1FNWA 4QAYA 1I42A 2WDTB 3H7PA 1AARA 5JZEB 1ENFA 2MJEA 2ZW0A 3T9LA 2GOWA 2JY6A 1XT9B 4L2YA 2DZIA 3IT6B 1VRAB 2O6VD 4MT5A 3NJTA 4I6LB 4G0NB 2R2QA 1WYGA 3C8YA 3N1YC 1E7PB 1MHXA 2OJRA 4K7WA 4MACA 3DHIC 1KRHA 4ZRJA 1CQVA 1TS2A 2K0PA 2GLSA 1DOIA 1WM3A 2ICIA 3PPAA 1T0YA 2N9LA 4P6VF 3SD5A 2OOBB 1E10A 2RMMA 3PGEA 4J3OD 3DBSA 5CHWA 2V4IB 3QAQA 2MHJA 2BW2A 3WAPA 2BYFA 2PE9A 2KQSA 3FILB 1UGJA 2KVRA 4FJZA 4E3CA 1ET9A 2M19A 2LEKA 4BVUC 3AE5B 3L0WB 3V3XA 1BT0A 1Y56A 1MHHE 1JWBD 2KFKA 3BK2A 3ZYYX 2BYTA 4ANXA 1WGRA 2D11A 3ZO5B 4G50A 1NI3A 3JYUA 2IY0B 3OJ4B 3QK0A 2FCNA 2MH7A 3DHHC 4RCOA 4HCPB 2FUHB 5G5GA 2KX3A 1WJ6A 3ETRA 3RNFC 2K5PA 2CKHB 1T6BX 1WGDA 4G3XB 1QOGA 4C7YA 2AQ2B 3ZRCA 3E9SA 2XN9C 5AZGA 3L10B 4FBJB 1N6ZA 4OVZA 2H89B 4GDLA 2V1YA 2LHEA 4W9KA 1J7CA 3DWGC 3W2DA 4GOCA 3WALA 3P1MA 2LVQA 2D5GA 2QIEB 3ZUNA 4JWSC 2HE7A 1P98A 4DWFA 3IG3A 1FD6A 3AU5A 5MPOA 2Y5PA 3A9JA 4RGOS 2L00B 3DDCB 2IO2B 5DPWA 2BWFA 4BKGA 5E6JA 3KH0A 1WI0A 2GB1A 4II2B 3RI7C 2ZVOA 4HVBA 3MHZA 3AE1B 2J4XA 4TSSA 2UU7A 3M95A 3GP7A 2N0SB 2M0AA 4C56C 4I6NB 2IZVB 1L0XB 1SE3A 2DZJA 3PZ8A 2NS5A 2JWZA 4MDKE 2LXAA 1N61A 4BOSC 3BZDB 3ENEA 3TMPB 3GE8C 2QHOA 3A4RA 2CJOA 3NVVA 1TBEA 2N9PC 4WWPA 2EKEC 1WSPA 2KNBA 2INPE 1RAXA 3OG5A 2RDBC 2L05A 1VD2A 3Q14C 3APFA 3HM6X 4N58A 3AM9A 2IGGA 3HUIA 3TEZA 2HD5B 1P9DU 4IM3A 2W3SA 2Y5BB 4WWMA 4RGNA 2WP9B 1I4XA 2JX5A 3DBHB 1K52A 4IDIA 1WH3A 4C00A 2O6VA 2AQ3B 2O6VB 5FK9C 4B6WA 1F52A 4ITKA 3IVFA 3W1YA 4FA6A 3Q3JA 2MSED 2K39A 3A4SC 4W9JA 1QKZA 4LJPB 1V9JA 4US9A 5C23A 3VXWA 4YTNB 1OEYA 4A3OA 4MGIE 1B9RA 3KYCD 1NENB 1SIFA 2JPHA 3N20C 2J53A 3PTFC 4A9AA 4BOZB 4GU2A 2WXMA 3T3OA 1EU3A 2K6QA 4WQOB 1L4DB 4IC7B 4HRSA 1WF9A 2XK5B 1WGKA 3K9PB 2PE6B 4ZRQA 1TZ1A 1WXAA 1ZP0B 4W9DA 2IJ0A 5C1ZA 1I4HA 2LZ6A 4A20A 4MELA 2IBIB 1ACCA 4RFBA 2WXFA 4TUUA 1YMHE 3WIMA 2GRIA 2AWTA 3SDLC 1J19A 2NPTA 2YEPF 4YT0B 3DQVA 2MP2A 2XBBC 4HDQA 2B76B 1UWXA 3RYTA 3WAOA 2WX0A 3HM3A 2FUG1 4JPSA 2GBMA 2J52A 3MJ5A 1YN5A 4M00A 1STEA 4WAAA 2DLBA 3ZIMA 1MPEA 5AZHA 3PRPB 2AL6A 1LXDA 4ZDVA 1AN8A 1D6EC 4KIKA 1JQ4A 3CSTA 2FE8A 2JVCA 3QHTA 3U7DA 4LNFA 2JXTA 5EE1A 2KWCA 2NTSA 4WURA 2PIAA 1LGRA 2DYBA 2BS4B 2YEPB 3RMKC 3OLMD 2GBNA 2WDVB 3AEEB 1E8XA 2ZJDA 1IPGA 2FBWB 1DOXA 2ONQA 5FR3A 2K1FA 4AOFA 1KJTA 1XQQA 2FNJB 1XO3A 2AEHA 2QILA 3ZNZB 2D3BA 2LVOA 2FCSA 2JZZA 3ZJTA 4B0MA 3N1XC 3PREA 5E6OA 3BYYB 1WJ4A 3L4PA 2IY1B 3KUDB 2J0KA 4NAWB 3KWVA 1TKEA 2N9EB 4ZRKA 1NBFC 2BWES 5IN7A 5CHFA 2MLBA 4MSMB 2KC1A 1YJIA 4HPMB 3PO0A 4MSQB 4ZRPA 3B0AA 4YL8A 2M17A 2BS2B 3TSSA 3APCA 3N1ZC 4I6PA 3R66C 4JIOU 3QX1A 2KFJA 3U8ZA 1SEBD 3EA6A 1C77A 3HK0A 1HA5A 1PGXA 3DCGA 4IWQA 4D2KA 2L1AA 2NBVB 2L83A 4FXCA 3UQBA 2V3PA 5J17A 1CZPA 4TQ1A 1IGCA 4TKNA 1F2RI 4RH6A 3RNCC 4KKIA 3IFWB 4BZAA 2KN5A 2WXKA 1U4AA 1ESFA 4PS7A 1UGMA 4B9KA 4PS3A 3AEAB 3URYA 1NI2A 3DVGY 4C4VB 3DWMA 3KYDD 2WU5B 3O65B 1MJDA 1UELA 4S0RA 1TKYA 2FAZA 3TIXA 4DXGA 4B0EA 2WHIA 1HZ5A 3ZKJC 2ASQA 3VHTC 2KOXA 2KQ4X 1TY0A 4GSWA 1D4BA 5EE0A 4WJPA 4W9EA 1WXQA 1RWSA 3PLUA 1ZGUB 2RPQA 1IBXA 3AH7A 3NZSA 3Q69A 4M8NA 2M56B 2OEDA 5EE9A 2KACA 2N1WA 1C1YB 2L52A 2RGFA 1N5WA 1C4AA 3W5UB 1EWYC 2KAJA 1JMLA 3HIZA 2DAFA 5HHDG 2Q5WD 3ECIA 1RRBA 1D3ZA 1NVID 3RFZB 1TS5A 2KXJA 2Z0EB 3ML9A 1SB3C 1I4GA 2WXLA 2D10A 4EFOA 4A55A 4MGZE 1KF6B 1TJEA 2LJ5A 5IO9A 2RPVA 2WXRA 3BINA 4Q2JA 1JWMD 1TS4A 4DHJD 1Z2MA 1WGYA 3NVZA 1FO4A 3MHSD 1FCLA 3R7QA 2J0JA 3BIID 4USAA 3AEFB 2GBRA 3AU4A 3BK1A 1JALA 3UINB 1LQBA 5EDSA 3LB8C 1Y8RC 1K53A 3MFGA 2G1EA 2JXXA 2LRUA 4K3CA 3RCZA 3VR8B 4CQNA 2ZZPB 4RF0A 4K7UA 3EGRA 2NTTA 3MTNB 2N1VA 1R4NB 1D5MC 1E6EB 5BMIA 2WXJA 1N62A 1P1AA 3AE4B 3H7PB 1PDXA 3ONSA 4YSXB 1H4RA 3JVZX 5AZFA 3RUIB 4AQ7A 2OJWA 5BYQA 4HLEA 2J42A 3JW0X 5EE3A 5BO4B 4EOYA 1Q10A 4GMVA 2K22A 2IO1B 3IBEA 2KDIA 4KIKB 1UZXB 4EZLA 2L8JA 1E5WA 2FCMA 3ZNHB 2DBYA 2CHXA 3HVZA 4NQLB 1ZUD2 5LLIA 3H6NA 2IGHA 3AXCA 1P3QU 1XXGA 1F2RC 2CR5A 2INCC 3DVNV 4KGTA 2WLBA 3PHXB 1KH0A 1DOYA 1FXTB 2ZCCA 5G5HA 4CO7A 4XWWA 3T3NA 5AUIA 4GN1A 3Q3OC 3ZLZA 3O13A 4CYEA 4KZCA 5D3IB 1HZ6A 2KKCA 4BAXA 3IAM1 2KANA 1C78A 1YQBA 4US8A 5BYRA 1GG3A 2KMMA 3AE9B 3U7ZA 3DBLI 2V0GA 2IGDA 2PLPA 3IXSA 4A6QA 3U30A 4L1BA 3DBLB 2RSUA 2LUMA 3MP9A 2FIDA 1SJHD 4XDDA 3KUZA 3AEDB 2IO0B 3NZ3A 1TY2A 2BKFA 2JYTA 2KLCA 4MM3B 4X57B 4ACFA 1J8CA 4LNNA 4PT5A 2J7QB 3WAMA 2PEAA 3PRMB 3Q8CA 2KZRA 3NOBA 4YWGG 5BYSA 1A70A 4P16A 4WIPA 4BKTA 2EMTA 1OFFA 1I7HA 3EECA 5J18A 4WJQA 2MBBB 5AUKA 1V5OA 1RFAA 2K3UA 2K8HA 3RNBC 2JQRB 5E6PA 1RYJA 4F1SA 1QOBA 1T5XD 1ET6A 1WFYA 1BUIC 1OGWA 2KWVB 3VFKA 3B1LX 2ZVNA 3PZ7A 4DDID 4OVVA 4DBGA 2D2QA 4LLGM 5CHVC 1V1PA 1T0RC 3ZRFA 4GGQA 4KDIC 1M4VA 1QOFA 4BBNC 2YVCA 3PVLA 4HEA1 1J0GA 2KWUB 4WJNA 4RGMA 1WYWB 3RPFC 5JHBA 2KJ6A 3GOEA 2HDEA 1ROEA 3EC8A 2KQ7A 4WQMA 2CHZA 5L83A 2I1KA 2BGFA 5LXHA 3X0WA 2BKRB 1FEHA 2CHWA 1XLPA 4RM9A 2YLMA 1C4PA 4W9IA 3UGBB 4TMAB 4TQ0A 3VH4B 2PVGC 1WZ0A 3AEBB 1AYFA 1HQRD 4HJKA 3ZTDA 3AE8B 1QQRA 2KK8A 1V81A 1AWDA 1TYGB 3AI5A 2DAJA 4HKQA 5G2NA 4HDOA 3KWLA 2KVZA 2BB5A 3NG0A 5FKAC 4BKSD 1YX6B 3AECB 4XX5A 4ARIA 1S1QB 4EEWA 4LDTB 3I9V1 2TSSA 2XK5A 1UF0A 4JX1C 1WX8A 1TGZB 3KVFB 2WQYB 2PMVA 5DPRA 2JRHA 4FHJA 3DBHI 1WZ3A 1FM0D 3IHPC 3QWZB 2LHDA 2MX2A 3NUHB 3P42A 1NYRA 2SAKA 1ZE3D 3QARA 2KDBA 4E74A 3W1SC 1GC7A 2DHZA 3N9YC 2UYZB 4LDTD 2M0XA 2V3NA 3QC8B 1FMAD 4PK1A 3R2TA 5DPSA 4EZKA 2C7HA 2Z0DB 2WU2B 1FNUA 4ANUA 1DYQA 3AE7B 4FULA 4NQKE 4ZRIA 4PS8A 1CMXB 2D3CA 3I57A 2MBEA 5L95C 3M3JA 1ZDVA 4MH8A 2HJ1A 2IPKD 2QMTA 2CU3A 2RDHA 2ZW1A 3NY5A 3RZWC 4OZCA 1GUAB 4FN2A 3NZUA 2WNMA 2KT7A 2G45B 4ANVA 3H9DA 2KLGA 3JSVB 3UIOB 1J7AA 1VCBA 1EF1A 3GZNB 2MP2B 1G6JA 5IAAC 4K1RB 1IGDA 4G11A 3GE3C 4FLHA 2IO3B 2AL3A 2KN4A 2A5UA 2KC2A 1ZXIA 1K50A 2W55A 1X1MA 1VDVA 3MC8A 3AULA 4XDCA 2B3AA 1IYFA 3P4QB 5HKHA 1SE2A 1YN3A 3V61A 1FXAA 3Q8AA
chains in the Genus database with same CATH topology
1MHXA 2M56B 4DQOC 2OEDA 3VQIA 2BS3B 3SFEB 5EE9A 2KACA 5D3DA 1VJKA 1FNVA 3BVGA 4MACA 2RDGA 2L52A 1KRHA 1FFVA 1N5WA 1C4AA 3FAHA 4RNAA 3W5UB 1CQVA 1TS2A 2K0PA 1EWYC 1P7EA 2N9KA 2KAJA 1JMLA 4N6EB 1DOIA 2HTME 2ICIA 4KGSA 5HHDG 2N9LA 4P6VF 1E10A 2Q5WD 2W54A 1QILA 1NVID 1NYQA 3RFZB 1TS5A 2RMMA 4J3OD 2X38A 2V4IB 2Y5CA 3R8BA 4NZLB 2BW2A 1SB3C 1I4GA 2WXLA 4ZOHC 4A8XC 3FILB 3U52E 1YQ4B 4A55A 3BYTB 1KF6B 1RM6C 1UGJA 5H8YE 1OQRA 1TJEA 1ET9A 2M19A 1NEKB 1YN4A 2LEKA 3AE5B 1E0ZA 2RPVA 2WXRA 3V3XA 4Q2JA 1Y56A 1MHHE 1JWBD 3BK2A 1JWMD 3ZYYX 1J7BA 1L0VB 1TS4A 1XCQL 4REZA 2BYTA 2MJDA 3ZJVA 1TZOA 3ZGZA 2QSDA 3IAS1 3P4RB 1NI3A 5C2TB 4H2AA 2L32A 3NVZA 3AE6B 3AB5A 1FO4A 3HRDD 2CJNA 2MH7A 1XLQA 4GLSC 1FCLA 4RCOA 3BIID 4USAA 1L6VA 2KWDA 3AEFB 5GXGB 5G5GA 5LNK1 3BK1A 1EWCA 1JALA 3ETRA 3NRZA 2K5PA 4WAFA 1SBBB 1T6BX 3LB8C 1QOGA 4C7YA 2AQ2B 1K53A 3MFGA 2G1EA 2H88B 4CQNA 3VR8B 1PFDA 1F77A 1JWSD 2WXGA 1KLGD 2XN9C 3E9SA 4RF0A 3EGRA 3J9CA 1IBXB 3GS2A 2WXQA 1GOZA 4OVZA 3ZQ4A 2H89B 2NTTA 4C7ZA 2LHEA 1D5MC 1J7CA 3DWGC 1E6EB 5BMIA 2WXJA 3V05A 3W2DA 3P1MA 3AN1A 1N62A 2D5GA 2QIEB 3AE4B 4JWSC 1PDXA 4YSXB 1DGJA 1GB1A 1FD6A 5MPOA 2Y5PA 4AQ7A 5BYQA 1WRIA 5BMGA 4RGOS 2J42A 1XF5L 4OW0A 5EE3A 3KLSX 1FIQA 4DXFA 1QLBB 1C9FA 5E6JA 1Q10A 2GB1A 1OQQA 1E9MA 2GI9A 2K22A 1N5XA 3MHZA 1V8CA 4GDKB 3AE1B 2J4XA 4TSSA 3ZJUA 1WWTA 2PTLA 4HROA 2LGIA 1T3QA 3FILA 2MJ3A 3KQ4A 3GP7A 2N0SB 3AE3B 1JRPA 2M0AA 4C56C 4LK0M 4NAMA 1KTKA 4C80A 1L0XB 1SE3A 2DBYA 3NVYA 3PZ8A 3HVZA 3NVWA 3B2GA 3H8HA 1ZUD2 5HI1A 2IGHA 1P7FA 1N61A 4KKJA 1HXYD 3BZDB 1UWMA 1XXGA 3ABVB 1F2RC 1VZ7A 4KGTA 2WLBA 1KH0A 1DOYA 5G5HA 3T3NA 2CJOA 4XWWA 3NVVA 1F0ZA 5AUIA 5C3JB 3TEXA 1QT9A 1D5XC 2NMQA 3O13A 1WSPA 2INPE 4YSZB 5D3IB 1HZ6A 1ZDXA 1ZOYB 2XNAC 4AS1A 3IAM1 1QOAA 4A90A 1C78A 4US8A 5BYRA 3U7ZA 2KMMA 2WXIA 3AE9B 4N58A 1SIJA 3AM9A 2IGGA 3HUIA 3TEZA 2V0GA 1N63A 2IGDA 2PLPA 5HFYA 2INNE 2KDMA 2W3SA 3IXSA 4N59A 4WWMA 1C4CA 1V1OA 4A6QA 1YJJA 4RGNA 3EUB2 3LXFA 1L4ZB 3B9JA 1FFUA 4L1BA 2WP9B 1I4XA 2JX5A 2LUMA 1K52A 3MP9A 1VZ6A 1SJHD 2QJLA 4IDIA 1SJED 4XDDA 4ZHOA 2AQ3B 3AEDB 2JWUA 4L23A 5FK9C 3NZ3A 4ITKA 1TY2A 1SF0A 2JYTA 3SEBA 1R7SA 2I2YA 1JWAD 4MM3B 1QKZA 3MC0B 1SE4A 4IKGA 4US9A 1PYWD 1TS3A 4PT5A 2JU6X 4YTNB 1GAQB 1PGBA 1KFYB 1B9RA 2QEJC 1NENB 3Q8CA 1ZXHA 4YWGG 1UNSA 2J53A 2W3RA 3VRAB 5BYSA 1A70A 4RF1A 3SFDB 4A9AA 4P16A 4WIPA 2WXMA 3T3OA 1EU3A 1L0YB 1OFFA 1I7HA 2PKOA 4RGTA 1L4DB 5AUKA 4HRSA 1EM7A 4ZYSA 2IDYA 1WGKA 2ON8A 2K3UA 4EE2A 2N7JA 2K9XA 1JWUD 4ZRQA 2JQRB 4OHJA 1C79A 3VRBB 2JYEA 1RYJA 1ZP0B 4M0WA 2IJ0A 1QOBA 1T5XD 1I4HA 1ET6A 1BUIC 1ACCA 2OHFA 4RFBA 2WXFA 3NS1A 1YMHE 3CWIA 2BBCA 2AX5A 2GRIA 1XEEA 1RFKA 3PZ7A 1QF6A 2YEPF 4YT0B 1K51A 4YTMB 5TSSA 3SR6A 1VLBA 4LLGM 3W5VB 4OZAA 1V1PA 2BT6A 1C76A 1M4VA 2B76B 3AEGB 1UWXA 1VZ8A 1D5ZC 2R61A 1QOFA 3W1SA 3Q8BA 2FUG1 4JPSA 2I38A 4KX6B 4HEA1 1PUTA 2J52A 3TEWA 4RGMA 3MJ5A 1YN5A 1B1ZA 3RPFC 1JCKB 1STEA 2DLBA 4JWUC 2SEBD 2WDRB 2ACZB 2HDEA 1MPEA 2DYMA 1YQ3B 1ROEA 1AN8A 1D6EC 2E3TA 1JQ4A 2FE8A 2W82A 4WQMA 1V1PB 2JXTA 5EE1A 2NTSA 1UUPA 3TEYA 1BXTA 4WURA 2PIAA 3W9CB 3Q8EA 1FEHA 1ZPSA 2BS4B 2YEPB 1XLPA 2BB6A 2WDVB 1MI0A 3AEEB 1C4PA 4OZBA 4TMAB 2WXOA 3AE2B 2PW9A 4TQ0A 3P63A 2PVGC 2WXHA 2FBWB 1DOXA 2ONQA 5FR3A 3R2IA 3AEBB 3AV8A 1AYFA 2VZKB 1HQRD 3Q8FA 5H92C 1FRDA 1I4QA 1PGAA 1XO3A 1N60A 3AE8B 5D7GA 1QQRA 2QILA 1CK1A 2WDQB 1AWDA 1TYGB 2LJIA 3VR9B 3U4EG 4IOIE 4HKQA 2DWQA 3KWLA 2BB5A 2JSVX 1MVKA 2PVOD 5FKAC 3ZJTA 3AECB 4B0MA 1JW9D 5JXVA 4ARIA 2WXPA 2TSSA 3BYYB 3I9V1 3FC4A 3L4PA 4JX1C 2WXNA 4HJGE 4NAWB 3KWVA 1TKEA 2WQYB 2PMVA 2MEKA 1FM0D 1GB4A 2LHDA 1YJIA 3PO0A 3HVDA 3LYYA 3NUHB 3P42A 4YTPB 1NYRA 5BMHA 2SAKA 4ZRPA 3IT4B 1ZE3D 1BMLC 2Y3AA 1V97A 4O1NA 1XLOA 1L6UA 1CJEA 4HKZE 2BS2B 1FRRA 3TSSA 3B2FA 4ZHPA 5T8IA 3N9YC 2AQ1B 4KGRA 1TKGA 2E6XA 2V3NA 4ARCA 2BTEA 1SEBD 1I4RA 2LMCA 4UDUC 1GPXA 3EA6A 1HEZE 1FMAD 3R2TA 1C77A 1HA5A 2WU2B 1FNUA 2JZPA 1PGXA 3U2SC 1DYQA 3BVMA 1VR9A 3P4SB 1LO5D 1FXIA 3AE7B 1XLNA 3TUOA 1L5PA 3AMZA 4D2KA 2L1AA 3WCQA 2L83A 4FXCA 2V3PA 3I57A 4XWTA 4XE0A 1CZPA 3BWUD 2EKIA 1KLUD 1ZDVA 4MH8A 1AW7A 4TQ1A 1IGCA 2IPKD 2QMTA 2CU3A 2VZKD 2WS3B 1F2RI 1SXTA 2RDHA 4RH6A 2ZW1A 2Z8LA 4JE3B 4KKIA 2DYOA 4LTUA 4OZCA 2WXKA 3UI3A 1ESFA 2WNMA 5I4DA 2G9HD 1I4PA 3AEAB 3P4PB 3URYA 1FCCC 2LFIA 1J7AA 4YXDB 1EU4A 4YSYB 5HG2A 1JROA 3DWMA 2EELA 2WU5B 1TKYA 3CIRB 4DXGA 1IGDA 1FNWA 3OWEB 4B0EA 1HZ5A 1IUEA 2KN4A 3BVZA 1ZXIA 2KQ4X 4NJCA 1TY0A 1SSNA 4WH4A 1K50A 1ENFA 2MJEA 2ZW0A 3E56A 2W55A 4L2YA 1VDVA 4R3DA 1D4BA 3IT6B 4XDCA 5EE0A 1VRAB 3P4QB 4GDLB 1WXQA 1XCTL 1SE2A 1YN3A 1RWSA 4MT5A 1IBXA 1WYGA 3AH7A 1FXAA 3C8YA 1YNTE 3Q69A 3Q8AA 1E7PB 3GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V8C A;  3AE1 B;  3VRB B;  2M56 B;  1RYJ A;  1ZP0 B;  1WWT A;  1FM0 D;  2BS3 B;  4HRO A;  5EE9 A;  3SFE B;  1QOB A;  1T3Q A;  1VJK A;  1YJI A;  3PO0 A;  2MJ3 A;  2L52 A;  1KRH A;  1FFV A;  1JRP A;  1NYR A;  1N5W A;  2N0S B;  2OHF A;  3AE3 B;  4YTP B;  3FAH A;  3W5U B;  3NS1 A;  4C80 A;  1V97 A;  3CWI A;  2AX5 A;  1EWY C;  2DBY A;  3NVY A;  1XLO A;  1L6U A;  1CJE A;  2KAJ A;  3HVZ A;  4N6E B;  2BS2 B;  1DOI A;  2HTM E;  1FRR A;  1RFK A;  3B2G A;  3NVW A;  3B2F A;  4ZHP A;  1ZUD 2;  4P6V F;  1E10 A;  1QF6 A;  1N61 A;  2Q5W D;  4YT0 B;  2W54 A;  4YTM B;  1NVI D;  1NYQ A;  3SR6 A;  1TKG A;  1VLB A;  1UWM A;  3ABV B;  1GPX A;  2Y5C A;  3W5V B;  2BT6 A;  1FMA D;  2WLB A;  2B76 B;  3AEG B;  1SB3 C;  2CJO A;  5G5H A;  2WU2 B;  3NVV A;  1DOY A;  1F0Z A;  5AUI A;  4ZOH C;  5C3J B;  1QOF A;  1QT9 A;  1YQ4 B;  3P4S B;  1FXI A;  3AE7 B;  1XLN A;  1KF6 B;  1RM6 C;  4YSZ B;  4KX6 B;  1L5P A;  5H8Y E;  3AMZ A;  1OQR A;  1PUT A;  1TJE A;  2K22 A;  2M19 A;  3WCQ A;  1NEK B;  1ZOY B;  2LEK A;  3AE5 B;  2L83 A;  4FXC A;  3RPF C;  1E0Z A;  1QOA A;  4US8 A;  1CZP A;  4JWU C;  2EKI A;  1JWB D;  2KMM A;  2WDR B;  3AE9 B;  4N58 A;  1J7B A;  1L0V B;  1SIJ A;  2ACZ B;  2WQY B;  3AM9 A;  1YQ3 B;  1ROE A;  2MJD A;  3HUI A;  2E3T A;  1JQ4 A;  2CU3 A;  2WS3 B;  3P4R B;  3ZYY X;  1NI3 A;  1N63 A;  4WQM A;  5C2T B;  2W3S A;  4N59 A;  3NVZ A;  3AE6 B;  3AB5 A;  4WWM A;  5EE1 A;  1FO4 A;  3HRD D;  2CJN A;  2MH7 A;  1XLQ A;  1YJJ A;  3EUB 2;  3LXF A;  4LTU A;  3B9J A;  1FFU A;  2PIA A;  2WP9 B;  3W9C B;  3BII D;  4USA A;  1L6V A;  2JX5 A;  3AEF B;  5GXG B;  5G5G A;  2BS4 B;  2QJL A;  4IDI A;  1XLP A;  1JAL A;  2WDV B;  3ETR A;  3NRZ A;  2K5P A;  4ZHO A;  3AED B;  3AEA B;  3P4P B;  3AEE B;  3LB8 C;  1QOG A;  4C7Y A;  1J7A A;  4ITK A;  4YXD B;  4YSY B;  2G1E A;  1SF0 A;  1JRO A;  2H88 B;  3VR8 B;  3AE2 B;  3DWM A;  1PFD A;  1R7S A;  2WU5 B;  3P63 A;  2PVG C;  1JWA D;  2FBW B;  1DOX A;  1TKY A;  2H89 B;  3AEB B;  4US9 A;  4C7Z A;  3CIR B;  3AV8 A;  1AYF A;  4YTN B;  1J7C A;  3DWG C;  1E6E B;  5H92 C;  1FRD A;  1GAQ B;  1KFY B;  3P1M A;  1B9R A;  3AN1 A;  1N62 A;  1NEN B;  1XO3 A;  1N60 A;  1IUE A;  2QIE B;  3AE4 B;  3AE8 B;  4JWS C;  1PDX A;  2W3R A;  3VRA B;  4YSX B;  1DGJ A;  1ZXI A;  2WDQ B;  1A70 A;  1AWD A;  1TYG B;  3SFD B;  3VR9 B;  4A9A A;  2MJE A;  2W55 A;  5MPO A;  1OFF A;  1I7H A;  1VDV A;  2DWQ A;  3KWL A;  2PKO A;  2PVO D;  5EE0 A;  1WRI A;  3AEC B;  1JW9 D;  5AUK A;  3P4Q B;  4HRS A;  1WXQ A;  1RWS A;  5EE3 A;  1FIQ A;  1WGK A;  3FC4 A;  1QLB B;  3L4P A;  4JX1 C;  1WYG A;  3AH7 A;  1FXA A;  2K9X A;  1E7P B;  2JQR B;  1OQQ A;  1E9M A;  1TKE A;  1N5X A; 
#chains in the Genus database with same CATH topology
 2IND C;  4DQO C;  2V3S A;  3V6E B;  3VQI A;  2BS3 B;  2REX A;  3TBL D;  5D3D A;  1VJK A;  3BVG A;  2RDG A;  1FFV A;  2ZPY A;  5KHQ A;  4RNA A;  4XC2 A;  4N6E B;  4MM3 A;  4B95 A;  2HTM E;  1SGH A;  4KGS A;  1A5R A;  2LGY A;  4EUT A;  2W54 A;  1QIL A;  5DPT A;  2QDF A;  3LDZ E;  1HE8 A;  3R8B A;  3LJ3 A;  4NZL B;  3APD A;  2V9H A;  3DHG C;  3PRZ A;  2IYD B;  3K9O B;  3MJW A;  1RM6 C;  2D3G A;  4IM2 A;  1OQR A;  5H8Y E;  1OQY A;  4MJS A;  1E0Z A;  1V5T A;  1L0V B;  2KFK B;  3ZJV A;  3ZGZ A;  2MJD A;  1TZO A;  2L32 A;  5D94 A;  3AE6 B;  2CJN A;  3N32 A;  3KW5 B;  3VAW A;  2KWD A;  3VVW B;  4KZ0 A;  4JGH B;  5GXG B;  4WAF A;  1SBB B;  1E7V A;  1K8R B;  3CSF A;  5E6N A;  2H88 B;  4N9F 4;  1WM2 A;  1PFD A;  1F77 A;  1WGG A;  1KLG D;  2WXG A;  1LM8 B;  3J9C A;  3GS2 A;  1GOZ A;  4DHJ B;  3ZQ4 A;  4RM8 A;  3PT2 B;  1GB1 A;  1YIW A;  3QQ8 B;  1WRI A;  5BMG A;  1F9J A;  1XF5 L;  4OW0 A;  3BY4 B;  3KLS X;  1V80 A;  4DXF A;  1QLB B;  1C9F A;  1OQQ A;  1E9M A;  2GI9 A;  1N5X A;  3ZJU A;  1WXM A;  1WWT A;  2PTL A;  1T3Q A;  3FIL A;  2C5L C;  1UH6 A;  2MJ3 A;  3KQ4 A;  1E7U A;  1JRP A;  3ZW3 A;  2LI5 A;  4KSL C;  4LK0 M;  4NAM A;  1TT5 B;  3B08 A;  1Z5S B;  4P1C C;  3NVY A;  2ZNV C;  4DHZ E;  4KDL B;  2BPS A;  3NVW A;  3B2G A;  1WMH B;  3H8H A;  4NAW A;  4AJY B;  1P7F A;  3ZVV A;  4KKJ A;  1HXY D;  3P2B A;  1UWM A;  3CF6 E;  3ABV B;  2MBO A;  1F0Z A;  2KJH B;  3TEX A;  3PS6 A;  2G4S A;  2NMQ A;  2KO3 A;  4YSZ B;  1ZDX A;  2VH2 A;  1WXS A;  3EFU A;  2RD0 A;  2XNA C;  4AS1 A;  4NPN A;  2MW5 A;  1QOA A;  4A90 A;  1E8Z A;  2FCQ A;  4P7I A;  4K3B A;  2WXI A;  1SIJ A;  3GZN I;  5HFY A;  4N59 A;  1C4C A;  2K6D B;  3B9J A;  1WXV A;  4EZJ A;  2QJL A;  1SJE D;  4IG7 B;  2JWU A;  1SF0 A;  1R4M I;  3SEB A;  1R7S A;  2I2Y A;  1JWA D;  1P0R A;  4J6I A;  4II3 B;  1TTN A;  1SE4 A;  1TS3 A;  2JU6 X;  2RR9 A;  2N9X A;  4K81 A;  4IWP A;  1ZXH A;  2W3R A;  2M4N A;  4RF1 A;  3SFD B;  2BYV E;  4C4V A;  3L08 A;  1V6E A;  2BQQ A;  4RGT A;  2K8C A;  2IDY A;  2WYQ A;  2ON8 A;  2KHW B;  3RNA C;  4EE2 A;  2K9X A;  1JWU D;  4OHJ A;  3DVG X;  3VRB B;  1KOT A;  4GB9 A;  2JYE A;  4M0W A;  2LGD A;  3A1Q A;  2OHF A;  3NS1 A;  2BBC A;  2AX5 A;  1RFK A;  3V6C B;  1QF6 A;  3Q3M C;  2KTF A;  3ZNI D;  2BF8 B;  3SR6 A;  1VLB A;  4IW0 A;  3W5V B;  4OZA A;  3TCA A;  3AEG B;  1VZ8 A;  2R61 A;  2L0T A;  1F1H A;  3W1S A;  2LXC A;  3Q8B A;  2NR2 A;  2JF5 A;  2I38 A;  2GBJ A;  4KX6 B;  2C7M B;  1H8C A;  1HTO A;  1JCK B;  2KDE B;  3Q3N C;  4JWU C;  3L17 A;  2ACZ B;  1YQ3 B;  4LJO B;  2E3T A;  2LAS A;  1V1P B;  2UWQ A;  2C7N B;  3TEY A;  1T0S C;  4DHZ B;  1BXT A;  1EF5 A;  3W9C B;  3PV1 A;  4OVU A;  3Q8E A;  1ZPS A;  2BB6 A;  1MI0 A;  2LWP A;  4M02 A;  4DDG D;  3NS8 A;  4HPP A;  2WXO A;  2JT4 B;  2ZPN A;  3AE2 B;  4WWN A;  2PW9 A;  1LFD A;  4IM0 A;  2HTH A;  3VTU A;  2C9W B;  2LUE A;  2MBH A;  1FRD A;  2C60 A;  2DNF A;  3QA8 A;  1N60 A;  4M01 A;  5D7G A;  3R7R A;  2LJI A;  3U4E G;  4IOI E;  1WRD B;  1WR1 A;  1WE7 A;  1MVK A;  1L2N A;  1JW9 D;  5JXV A;  2WXP A;  4NNJ B;  2ZNV B;  1TIF A;  4HJG E;  3RZF A;  2JZ3 B;  3ALB A;  1GB4 A;  4HK2 A;  4YTP B;  3IT4 B;  1V97 A;  4O1N A;  1XLO A;  1CJE A;  4HKZ E;  1FRR A;  4ZHP A;  2AQ1 B;  4KGR A;  2QC8 A;  4ARC A;  1I4R A;  2LMC A;  4UDU C;  3RNE C;  1V2Y A;  1XD3 B;  3Q2A C;  3U2S C;  3BVM A;  2KX0 A;  1VR9 A;  3P4S B;  5JHA A;  4AP4 C;  1L5P A;  3AMZ A;  3WCQ A;  3QCA A;  4XWT A;  4NY0 A;  4XE0 A;  2VRR B;  2EKI A;  3BWU D;  1AW7 A;  2VZK D;  2WS3 B;  1WY8 A;  1IP9 A;  4JE3 B;  4LTU A;  2DX5 B;  3UI3 A;  4HXD A;  3PHW B;  3WA0 A;  2FIF A;  5I4D A;  2G9H D;  5DCN A;  3P4P B;  1FCC C;  2LFI A;  1E90 A;  4YXD B;  1EU4 A;  1JRO A;  2EEL A;  5IP4 D;  4XZ4 A;  2MWS B;  1WMH A;  1WGH A;  1WX7 A;  3M63 B;  4F7Z A;  5IA7 A;  3OWE B;  1IUE A;  3BVZ A;  5JH5 C;  4E71 A;  4NJC A;  3C0R B;  3I5J C;  1SSN A;  4TV3 A;  4WH4 A;  3E56 A;  1WJU A;  4R3D A;  3Q6B A;  4W9C A;  4GDL B;  1XCT L;  2J0M A;  2MQJ A;  4F8C B;  4XYC A;  1YNT E;  1M94 A;  3GB1 A;  4FHK A;  1KM7 A;  2LD9 A;  3HHM A;  2L0F A;  2N4F A;  2CS4 A;  3VTW A;  4LCD E;  3SFE B;  1FNV A;  2G3Q B;  1MG4 A;  2MCN B;  3FAH A;  1P7E A;  2N9K A;  2BYE A;  2DZK A;  1NYQ A;  2EMS A;  2X38 A;  2ZCB A;  2Y5C A;  3PZD A;  4PYZ A;  2M8S A;  2LGX A;  3L54 A;  4ZOH C;  4A8X C;  3U52 E;  2I1J A;  1YQ4 B;  4GIV A;  3BYT B;  3VTV A;  2L7R A;  2KTR A;  1NEK B;  1YN4 A;  1WJN A;  4MH0 E;  4BKS A;  3Q3F A;  4PYU A;  1J7B A;  1XCQ L;  4REZ A;  3A9K A;  2QSD A;  3IAS 1;  4HWI B;  3L13 A;  3P4R B;  4MGK E;  4K7S A;  4CHK A;  5C2T B;  4H2A A;  1YOV B;  3AB5 A;  3HRD D;  2PJH A;  1XLQ A;  4GLS C;  4AJW A;  2L3Z A;  4HCN B;  1L6V A;  5LNK 1;  1WR6 E;  1EWC A;  4KV2 A;  3NRZ A;  1Q5W B;  2L76 A;  1R4N I;  5AEK B;  1JWS D;  1IBX B;  2WXQ A;  2K8B A;  3SHQ A;  3UQA A;  1T0Q C;  1UBQ A;  4C7Z A;  2WX1 A;  1R4M B;  3V05 A;  2JUO A;  3AN1 A;  3MC9 A;  3PLV A;  1DGJ A;  3ZDM C;  1ISN A;  1FIQ A;  2MBQ A;  3M62 B;  4GDK A;  3DOW A;  4GDK B;  1V8C A;  4ZYN A;  4W9G A;  2DEN B;  2PPH A;  4BFR A;  4M0W B;  5IKC M;  4HRO A;  2LGI A;  4DK5 A;  3H1U A;  1Q1O A;  3JSV A;  3AE3 B;  4M8M A;  2KYW A;  1KTK A;  4C80 A;  2MRP A;  2KTR B;  4LNO A;  3VH3 B;  4W9H A;  4MGY E;  5HI1 A;  4RMA A;  4S17 A;  2GBK A;  1MG8 A;  2MA9 B;  1VZ7 A;  4LNK A;  1GC6 A;  3VUX A;  2LGS A;  4XGA B;  4IUM B;  1PQS A;  3PSE B;  3ZDT A;  5C3J B;  1QT9 A;  1D5X C;  5LXI B;  3A33 B;  1ZOY B;  5D6J B;  3RD2 A;  2LRW A;  2NBW B;  2N7D A;  1GNU A;  3QIJ A;  1N63 A;  1V86 A;  2O2V A;  2INN E;  2KDM A;  2O2V B;  4KVG B;  2AYO B;  1V1O A;  4DXA B;  1YJJ A;  3EUB 2;  3LXF A;  1L4Z B;  1FFU A;  4URK A;  1VZ6 A;  3DBR B;  3S2A A;  4ZHO A;  5GMV A;  3RNG C;  4L23 A;  3TL5 A;  4IWO A;  1GJZ A;  4WJO A;  3QJZ A;  3DBR I;  1I35 A;  3A9J B;  3ML8 A;  3MC0 B;  4IKG A;  1PYW D;  1E8Y A;  3N30 A;  1GAQ B;  1PGB A;  1KFY B;  1EUV B;  2QEJ C;  1WIA A;  3T8M A;  2JRI B;  1UNS A;  3VRA B;  2BVC A;  3UF8 A;  2KMA A;  1L0Y B;  3D32 A;  1OTR B;  2PKO A;  1EM7 A;  4ZYS A;  3VDZ A;  4MJS B;  2N7J A;  3CMM B;  1C79 A;  3N3K B;  3FKY A;  1S3S G;  3CWI A;  4NJ7 A;  4ICU A;  2QCZ A;  1XEE A;  2M1M A;  2X8X X;  3I63 C;  4ICV A;  1K51 A;  4YTM B;  2NBU A;  5TSS A;  1FPY A;  2BT6 A;  1C76 A;  2G4D B;  3NHE B;  1D5Z C;  5KHO A;  5CX3 A;  1RLF A;  1ZKH A;  1ZW7 A;  1PUT A;  3TEW A;  3OAW A;  3SU8 X;  1B1Z A;  5TR5 A;  1QZE A;  2SEB D;  4JLC A;  2WDR B;  2DYM A;  2NPT B;  3TJP A;  2KD0 A;  3C19 A;  3EHV A;  2W82 A;  3DPD A;  1UUP A;  1V49 A;  3V62 A;  5FR6 A;  3H7S A;  4GXB A;  5G55 A;  1L7Y A;  4FJV B;  1C3T A;  4OZB A;  2WWZ A;  3P63 A;  2WXH A;  2WGS A;  3R2I A;  1WX9 A;  2XEW A;  2KDF B;  3RN9 C;  3AV8 A;  5D2M B;  2VZK B;  1SE9 A;  3Q8F A;  5H92 C;  1PGA A;  1I4Q A;  1HTQ A;  3WAN A;  2V4L A;  1CK1 A;  2KMC A;  4HPL B;  2LVP A;  2WDQ B;  3VR9 B;  2D07 B;  4ANW A;  1UD7 A;  2NCN A;  2DWQ A;  5IOI A;  3R3M A;  2PVO D;  2JSV X;  2NVU I;  2VH1 A;  2W9N A;  2ZEQ A;  1EO6 A;  4FAD A;  3DVN U;  3FC4 A;  2WXN A;  4FJY A;  1YJ1 A;  3ZNG C;  4MEM A;  2MEK A;  3A9K B;  2KJR A;  3EFC A;  4AUQ C;  3HVD A;  3LYY A;  5BMH A;  4ASW C;  4JL9 A;  1BML C;  2Y3A A;  2K25 A;  1OEY J;  4BBN F;  3RT3 B;  1L6U A;  4W9F A;  1JRU A;  3B2F A;  5T8I A;  3UIP B;  1TKG A;  2E6X A;  2BTE A;  1GPX A;  1HEZ E;  4A3P A;  2JZP A;  3X23 A;  2A4Z A;  1YD8 U;  1UBI A;  3VUW A;  1LO5 D;  1FXI A;  1Q0W B;  2Z59 B;  1XLN A;  1E8W A;  3RUL A;  3TUO A;  4P1B C;  3VUY A;  3I3T B;  1KLU D;  5CTR C;  4AWJ A;  4EKU A;  2R2O A;  2CU1 A;  3OJ3 A;  2DZM A;  2GMI C;  1MFW A;  1SXT A;  2Z8L A;  4KSK C;  5J2R A;  3A1Q B;  2DYO A;  2D3A A;  4JQW C;  3KUC B;  1I4P A;  4WWO A;  4NJ6 A;  2N7E A;  4YSY B;  3ZTC A;  5HG2 A;  1YX5 B;  1KLV A;  4W9L A;  3V60 A;  3ZXR A;  1NDD A;  2HJ8 A;  3L16 A;  1WE6 A;  4LNI A;  3CIR B;  3ZXV A;  1FNW A;  4QAY A;  1I42 A;  2WDT B;  3H7P A;  1AAR A;  5JZE B;  1ENF A;  2MJE A;  2ZW0 A;  3T9L A;  2GOW A;  2JY6 A;  1XT9 B;  4L2Y A;  2DZI A;  3IT6 B;  1VRA B;  2O6V D;  4MT5 A;  3NJT A;  4I6L B;  4G0N B;  2R2Q A;  1WYG A;  3C8Y A;  3N1Y C;  1E7P B;  1MHX A;  2OJR A;  4K7W A;  4MAC A;  3DHI C;  1KRH A;  4ZRJ A;  1CQV A;  1TS2 A;  2K0P A;  2GLS A;  1DOI A;  1WM3 A;  2ICI A;  3PPA A;  1T0Y A;  2N9L A;  4P6V F;  3SD5 A;  2OOB B;  1E10 A;  2RMM A;  3PGE A;  4J3O D;  3DBS A;  5CHW A;  2V4I B;  3QAQ A;  2MHJ A;  2BW2 A;  3WAP A;  2BYF A;  2PE9 A;  2KQS A;  3FIL B;  1UGJ A;  2KVR A;  4FJZ A;  4E3C A;  1ET9 A;  2M19 A;  2LEK A;  4BVU C;  3AE5 B;  3L0W B;  3V3X A;  1BT0 A;  1Y56 A;  1MHH E;  1JWB D;  2KFK A;  3BK2 A;  3ZYY X;  2BYT A;  4ANX A;  1WGR A;  2D11 A;  3ZO5 B;  4G50 A;  1NI3 A;  3JYU A;  2IY0 B;  3OJ4 B;  3QK0 A;  2FCN A;  2MH7 A;  3DHH C;  4RCO A;  4HCP B;  2FUH B;  5G5G A;  2KX3 A;  1WJ6 A;  3ETR A;  3RNF C;  2K5P A;  2CKH B;  1T6B X;  1WGD A;  4G3X B;  1QOG A;  4C7Y A;  2AQ2 B;  3ZRC A;  3E9S A;  2XN9 C;  5AZG A;  3L10 B;  4FBJ B;  1N6Z A;  4OVZ A;  2H89 B;  4GDL A;  2V1Y A;  2LHE A;  4W9K A;  1J7C A;  3DWG C;  3W2D A;  4GOC A;  3WAL A;  3P1M A;  2LVQ A;  2D5G A;  2QIE B;  3ZUN A;  4JWS C;  2HE7 A;  1P98 A;  4DWF A;  3IG3 A;  1FD6 A;  3AU5 A;  5MPO A;  2Y5P A;  3A9J A;  4RGO S;  2L00 B;  3DDC B;  2IO2 B;  5DPW A;  2BWF A;  4BKG A;  5E6J A;  3KH0 A;  1WI0 A;  2GB1 A;  4II2 B;  3RI7 C;  2ZVO A;  4HVB A;  3MHZ A;  3AE1 B;  2J4X A;  4TSS A;  2UU7 A;  3M95 A;  3GP7 A;  2N0S B;  2M0A A;  4C56 C;  4I6N B;  2IZV B;  1L0X B;  1SE3 A;  2DZJ A;  3PZ8 A;  2NS5 A;  2JWZ A;  4MDK E;  2LXA A;  1N61 A;  4BOS C;  3BZD B;  3ENE A;  3TMP B;  3GE8 C;  2QHO A;  3A4R A;  2CJO A;  3NVV A;  1TBE A;  2N9P C;  4WWP A;  2EKE C;  1WSP A;  2KNB A;  2INP E;  1RAX A;  3OG5 A;  2RDB C;  2L05 A;  1VD2 A;  3Q14 C;  3APF A;  3HM6 X;  4N58 A;  3AM9 A;  2IGG A;  3HUI A;  3TEZ A;  2HD5 B;  1P9D U;  4IM3 A;  2W3S A;  2Y5B B;  4WWM A;  4RGN A;  2WP9 B;  1I4X A;  2JX5 A;  3DBH B;  1K52 A;  4IDI A;  1WH3 A;  4C00 A;  2O6V A;  2AQ3 B;  2O6V B;  5FK9 C;  4B6W A;  1F52 A;  4ITK A;  3IVF A;  3W1Y A;  4FA6 A;  3Q3J A;  2MSE D;  2K39 A;  3A4S C;  4W9J A;  1QKZ A;  4LJP B;  1V9J A;  4US9 A;  5C23 A;  3VXW A;  4YTN B;  1OEY A;  4A3O A;  4MGI E;  1B9R A;  3KYC D;  1NEN B;  1SIF A;  2JPH A;  3N20 C;  2J53 A;  3PTF C;  4A9A A;  4BOZ B;  4GU2 A;  2WXM A;  3T3O A;  1EU3 A;  2K6Q A;  4WQO B;  1L4D B;  4IC7 B;  4HRS A;  1WF9 A;  2XK5 B;  1WGK A;  3K9P B;  2PE6 B;  4ZRQ A;  1TZ1 A;  1WXA A;  1ZP0 B;  4W9D A;  2IJ0 A;  5C1Z A;  1I4H A;  2LZ6 A;  4A20 A;  4MEL A;  2IBI B;  1ACC A;  4RFB A;  2WXF A;  4TUU A;  1YMH E;  3WIM A;  2GRI A;  2AWT A;  3SDL C;  1J19 A;  2NPT A;  2YEP F;  4YT0 B;  3DQV A;  2MP2 A;  2XBB C;  4HDQ A;  2B76 B;  1UWX A;  3RYT A;  3WAO A;  2WX0 A;  3HM3 A;  2FUG 1;  4JPS A;  2GBM A;  2J52 A;  3MJ5 A;  1YN5 A;  4M00 A;  1STE A;  4WAA A;  2DLB A;  3ZIM A;  1MPE A;  5AZH A;  3PRP B;  2AL6 A;  1LXD A;  4ZDV A;  1AN8 A;  1D6E C;  4KIK A;  1JQ4 A;  3CST A;  2FE8 A;  2JVC A;  3QHT A;  3U7D A;  4LNF A;  2JXT A;  5EE1 A;  2KWC A;  2NTS A;  4WUR A;  2PIA A;  1LGR A;  2DYB A;  2BS4 B;  2YEP B;  3RMK C;  3OLM D;  2GBN A;  2WDV B;  3AEE B;  1E8X A;  2ZJD A;  1IPG A;  2FBW B;  1DOX A;  2ONQ A;  5FR3 A;  2K1F A;  4AOF A;  1KJT A;  1XQQ A;  2FNJ B;  1XO3 A;  2AEH A;  2QIL A;  3ZNZ B;  2D3B A;  2LVO A;  2FCS A;  2JZZ A;  3ZJT A;  4B0M A;  3N1X C;  3PRE A;  5E6O A;  3BYY B;  1WJ4 A;  3L4P A;  2IY1 B;  3KUD B;  2J0K A;  4NAW B;  3KWV A;  1TKE A;  2N9E B;  4ZRK A;  1NBF C;  2BWE S;  5IN7 A;  5CHF A;  2MLB A;  4MSM B;  2KC1 A;  1YJI A;  4HPM B;  3PO0 A;  4MSQ B;  4ZRP A;  3B0A A;  4YL8 A;  2M17 A;  2BS2 B;  3TSS A;  3APC A;  3N1Z C;  4I6P A;  3R66 C;  4JIO U;  3QX1 A;  2KFJ A;  3U8Z A;  1SEB D;  3EA6 A;  1C77 A;  3HK0 A;  1HA5 A;  1PGX A;  3DCG A;  4IWQ A;  4D2K A;  2L1A A;  2NBV B;  2L83 A;  4FXC A;  3UQB A;  2V3P A;  5J17 A;  1CZP A;  4TQ1 A;  1IGC A;  4TKN A;  1F2R I;  4RH6 A;  3RNC C;  4KKI A;  3IFW B;  4BZA A;  2KN5 A;  2WXK A;  1U4A A;  1ESF A;  4PS7 A;  1UGM A;  4B9K A;  4PS3 A;  3AEA B;  3URY A;  1NI2 A;  3DVG Y;  4C4V B;  3DWM A;  3KYD D;  2WU5 B;  3O65 B;  1MJD A;  1UEL A;  4S0R A;  1TKY A;  2FAZ A;  3TIX A;  4DXG A;  4B0E A;  2WHI A;  1HZ5 A;  3ZKJ C;  2ASQ A;  3VHT C;  2KOX A;  2KQ4 X;  1TY0 A;  4GSW A;  1D4B A;  5EE0 A;  4WJP A;  4W9E A;  1WXQ A;  1RWS A;  3PLU A;  1ZGU B;  2RPQ A;  1IBX A;  3AH7 A;  3NZS A;  3Q69 A;  4M8N A;  2M56 B;  2OED A;  5EE9 A;  2KAC A;  2N1W A;  1C1Y B;  2L52 A;  2RGF A;  1N5W A;  1C4A A;  3W5U B;  1EWY C;  2KAJ A;  1JML A;  3HIZ A;  2DAF A;  5HHD G;  2Q5W D;  3ECI A;  1RRB A;  1D3Z A;  1NVI D;  3RFZ B;  1TS5 A;  2KXJ A;  2Z0E B;  3ML9 A;  1SB3 C;  1I4G A;  2WXL A;  2D10 A;  4EFO A;  4A55 A;  4MGZ E;  1KF6 B;  1TJE A;  2LJ5 A;  5IO9 A;  2RPV A;  2WXR A;  3BIN A;  4Q2J A;  1JWM D;  1TS4 A;  4DHJ D;  1Z2M A;  1WGY A;  3NVZ A;  1FO4 A;  3MHS D;  1FCL A;  3R7Q A;  2J0J A;  3BII D;  4USA A;  3AEF B;  2GBR A;  3AU4 A;  3BK1 A;  1JAL A;  3UIN B;  1LQB A;  5EDS A;  3LB8 C;  1Y8R C;  1K53 A;  3MFG A;  2G1E A;  2JXX A;  2LRU A;  4K3C A;  3RCZ A;  3VR8 B;  4CQN A;  2ZZP B;  4RF0 A;  4K7U A;  3EGR A;  2NTT A;  3MTN B;  2N1V A;  1R4N B;  1D5M C;  1E6E B;  5BMI A;  2WXJ A;  1N62 A;  1P1A A;  3AE4 B;  3H7P B;  1PDX A;  3ONS A;  4YSX B;  1H4R A;  3JVZ X;  5AZF A;  3RUI B;  4AQ7 A;  2OJW A;  5BYQ A;  4HLE A;  2J42 A;  3JW0 X;  5EE3 A;  5BO4 B;  4EOY A;  1Q10 A;  4GMV A;  2K22 A;  2IO1 B;  3IBE A;  2KDI A;  4KIK B;  1UZX B;  4EZL A;  2L8J A;  1E5W A;  2FCM A;  3ZNH B;  2DBY A;  2CHX A;  3HVZ A;  4NQL B;  1ZUD 2;  5LLI A;  3H6N A;  2IGH A;  3AXC A;  1P3Q U;  1XXG A;  1F2R C;  2CR5 A;  2INC C;  3DVN V;  4KGT A;  2WLB A;  3PHX B;  1KH0 A;  1DOY A;  1FXT B;  2ZCC A;  5G5H A;  4CO7 A;  4XWW A;  3T3N A;  5AUI A;  4GN1 A;  3Q3O C;  3ZLZ A;  3O13 A;  4CYE A;  4KZC A;  5D3I B;  1HZ6 A;  2KKC A;  4BAX A;  3IAM 1;  2KAN A;  1C78 A;  1YQB A;  4US8 A;  5BYR A;  1GG3 A;  2KMM A;  3AE9 B;  3U7Z A;  3DBL I;  2V0G A;  2IGD A;  2PLP A;  3IXS A;  4A6Q A;  3U30 A;  4L1B A;  3DBL B;  2RSU A;  2LUM A;  3MP9 A;  2FID A;  1SJH D;  4XDD A;  3KUZ A;  3AED B;  2IO0 B;  3NZ3 A;  1TY2 A;  2BKF A;  2JYT A;  2KLC A;  4MM3 B;  4X57 B;  4ACF A;  1J8C A;  4LNN A;  4PT5 A;  2J7Q B;  3WAM A;  2PEA A;  3PRM B;  3Q8C A;  2KZR A;  3NOB A;  4YWG G;  5BYS A;  1A70 A;  4P16 A;  4WIP A;  4BKT A;  2EMT A;  1OFF A;  1I7H A;  3EEC A;  5J18 A;  4WJQ A;  2MBB B;  5AUK A;  1V5O A;  1RFA A;  2K3U A;  2K8H A;  3RNB C;  2JQR B;  5E6P A;  1RYJ A;  4F1S A;  1QOB A;  1T5X D;  1ET6 A;  1WFY A;  1BUI C;  1OGW A;  2KWV B;  3VFK A;  3B1L X;  2ZVN A;  3PZ7 A;  4DDI D;  4OVV A;  4DBG A;  2D2Q A;  4LLG M;  5CHV C;  1V1P A;  1T0R C;  3ZRF A;  4GGQ A;  4KDI C;  1M4V A;  1QOF A;  4BBN C;  2YVC A;  3PVL A;  4HEA 1;  1J0G A;  2KWU B;  4WJN A;  4RGM A;  1WYW B;  3RPF C;  5JHB A;  2KJ6 A;  3GOE A;  2HDE A;  1ROE A;  3EC8 A;  2KQ7 A;  4WQM A;  2CHZ A;  5L83 A;  2I1K A;  2BGF A;  5LXH A;  3X0W A;  2BKR B;  1FEH A;  2CHW A;  1XLP A;  4RM9 A;  2YLM A;  1C4P A;  4W9I A;  3UGB B;  4TMA B;  4TQ0 A;  3VH4 B;  2PVG C;  1WZ0 A;  3AEB B;  1AYF A;  1HQR D;  4HJK A;  3ZTD A;  3AE8 B;  1QQR A;  2KK8 A;  1V81 A;  1AWD A;  1TYG B;  3AI5 A;  2DAJ A;  4HKQ A;  5G2N A;  4HDO A;  3KWL A;  2KVZ A;  2BB5 A;  3NG0 A;  5FKA C;  4BKS D;  1YX6 B;  3AEC B;  4XX5 A;  4ARI A;  1S1Q B;  4EEW A;  4LDT B;  3I9V 1;  2TSS A;  2XK5 A;  1UF0 A;  4JX1 C;  1WX8 A;  1TGZ B;  3KVF B;  2WQY B;  2PMV A;  5DPR A;  2JRH A;  4FHJ A;  3DBH I;  1WZ3 A;  1FM0 D;  3IHP C;  3QWZ B;  2LHD A;  2MX2 A;  3NUH B;  3P42 A;  1NYR A;  2SAK A;  1ZE3 D;  3QAR A;  2KDB A;  4E74 A;  3W1S C;  1GC7 A;  2DHZ A;  3N9Y C;  2UYZ B;  4LDT D;  2M0X A;  2V3N A;  3QC8 B;  1FMA D;  4PK1 A;  3R2T A;  5DPS A;  4EZK A;  2C7H A;  2Z0D B;  2WU2 B;  1FNU A;  4ANU A;  1DYQ A;  3AE7 B;  4FUL A;  4NQK E;  4ZRI A;  4PS8 A;  1CMX B;  2D3C A;  3I57 A;  2MBE A;  5L95 C;  3M3J A;  1ZDV A;  4MH8 A;  2HJ1 A;  2IPK D;  2QMT A;  2CU3 A;  2RDH A;  2ZW1 A;  3NY5 A;  3RZW C;  4OZC A;  1GUA B;  4FN2 A;  3NZU A;  2WNM A;  2KT7 A;  2G45 B;  4ANV A;  3H9D A;  2KLG A;  3JSV B;  3UIO B;  1J7A A;  1VCB A;  1EF1 A;  3GZN B;  2MP2 B;  1G6J A;  5IAA C;  4K1R B;  1IGD A;  4G11 A;  3GE3 C;  4FLH A;  2IO3 B;  2AL3 A;  2KN4 A;  2A5U A;  2KC2 A;  1ZXI A;  1K50 A;  2W55 A;  1X1M A;  1VDV A;  3MC8 A;  3AUL A;  4XDC A;  2B3A A;  1IYF A;  3P4Q B;  5HKH A;  1SE2 A;  1YN3 A;  3V61 A;  1FXA A;  3Q8A A; 
#chains in the Genus database with same CATH homology
 1MHX A;  2M56 B;  4DQO C;  2OED A;  3VQI A;  2BS3 B;  3SFE B;  5EE9 A;  2KAC A;  5D3D A;  1VJK A;  1FNV A;  3BVG A;  4MAC A;  2RDG A;  2L52 A;  1KRH A;  1FFV A;  1N5W A;  1C4A A;  3FAH A;  4RNA A;  3W5U B;  1CQV A;  1TS2 A;  2K0P A;  1EWY C;  1P7E A;  2N9K A;  2KAJ A;  1JML A;  4N6E B;  1DOI A;  2HTM E;  2ICI A;  4KGS A;  5HHD G;  2N9L A;  4P6V F;  1E10 A;  2Q5W D;  2W54 A;  1QIL A;  1NVI D;  1NYQ A;  3RFZ B;  1TS5 A;  2RMM A;  4J3O D;  2X38 A;  2V4I B;  2Y5C A;  3R8B A;  4NZL B;  2BW2 A;  1SB3 C;  1I4G A;  2WXL A;  4ZOH C;  4A8X C;  3FIL B;  3U52 E;  1YQ4 B;  4A55 A;  3BYT B;  1KF6 B;  1RM6 C;  1UGJ A;  5H8Y E;  1OQR A;  1TJE A;  1ET9 A;  2M19 A;  1NEK B;  1YN4 A;  2LEK A;  3AE5 B;  1E0Z A;  2RPV A;  2WXR A;  3V3X A;  4Q2J A;  1Y56 A;  1MHH E;  1JWB D;  3BK2 A;  1JWM D;  3ZYY X;  1J7B A;  1L0V B;  1TS4 A;  1XCQ L;  4REZ A;  2BYT A;  2MJD A;  3ZJV A;  1TZO A;  3ZGZ A;  2QSD A;  3IAS 1;  3P4R B;  1NI3 A;  5C2T B;  4H2A A;  2L32 A;  3NVZ A;  3AE6 B;  3AB5 A;  1FO4 A;  3HRD D;  2CJN A;  2MH7 A;  1XLQ A;  4GLS C;  1FCL A;  4RCO A;  3BII D;  4USA A;  1L6V A;  2KWD A;  3AEF B;  5GXG B;  5G5G A;  5LNK 1;  3BK1 A;  1EWC A;  1JAL A;  3ETR A;  3NRZ A;  2K5P A;  4WAF A;  1SBB B;  1T6B X;  3LB8 C;  1QOG A;  4C7Y A;  2AQ2 B;  1K53 A;  3MFG A;  2G1E A;  2H88 B;  4CQN A;  3VR8 B;  1PFD A;  1F77 A;  1JWS D;  2WXG A;  1KLG D;  2XN9 C;  3E9S A;  4RF0 A;  3EGR A;  3J9C A;  1IBX B;  3GS2 A;  2WXQ A;  1GOZ A;  4OVZ A;  3ZQ4 A;  2H89 B;  2NTT A;  4C7Z A;  2LHE A;  1D5M C;  1J7C A;  3DWG C;  1E6E B;  5BMI A;  2WXJ A;  3V05 A;  3W2D A;  3P1M A;  3AN1 A;  1N62 A;  2D5G A;  2QIE B;  3AE4 B;  4JWS C;  1PDX A;  4YSX B;  1DGJ A;  1GB1 A;  1FD6 A;  5MPO A;  2Y5P A;  4AQ7 A;  5BYQ A;  1WRI A;  5BMG A;  4RGO S;  2J42 A;  1XF5 L;  4OW0 A;  5EE3 A;  3KLS X;  1FIQ A;  4DXF A;  1QLB B;  1C9F A;  5E6J A;  1Q10 A;  2GB1 A;  1OQQ A;  1E9M A;  2GI9 A;  2K22 A;  1N5X A;  3MHZ A;  1V8C A;  4GDK B;  3AE1 B;  2J4X A;  4TSS A;  3ZJU A;  1WWT A;  2PTL A;  4HRO A;  2LGI A;  1T3Q A;  3FIL A;  2MJ3 A;  3KQ4 A;  3GP7 A;  2N0S B;  3AE3 B;  1JRP A;  2M0A A;  4C56 C;  4LK0 M;  4NAM A;  1KTK A;  4C80 A;  1L0X B;  1SE3 A;  2DBY A;  3NVY A;  3PZ8 A;  3HVZ A;  3NVW A;  3B2G A;  3H8H A;  1ZUD 2;  5HI1 A;  2IGH A;  1P7F A;  1N61 A;  4KKJ A;  1HXY D;  3BZD B;  1UWM A;  1XXG A;  3ABV B;  1F2R C;  1VZ7 A;  4KGT A;  2WLB A;  1KH0 A;  1DOY A;  5G5H A;  3T3N A;  2CJO A;  4XWW A;  3NVV A;  1F0Z A;  5AUI A;  5C3J B;  3TEX A;  1QT9 A;  1D5X C;  2NMQ A;  3O13 A;  1WSP A;  2INP E;  4YSZ B;  5D3I B;  1HZ6 A;  1ZDX A;  1ZOY B;  2XNA C;  4AS1 A;  3IAM 1;  1QOA A;  4A90 A;  1C78 A;  4US8 A;  5BYR A;  3U7Z A;  2KMM A;  2WXI A;  3AE9 B;  4N58 A;  1SIJ A;  3AM9 A;  2IGG A;  3HUI A;  3TEZ A;  2V0G A;  1N63 A;  2IGD A;  2PLP A;  5HFY A;  2INN E;  2KDM A;  2W3S A;  3IXS A;  4N59 A;  4WWM A;  1C4C A;  1V1O A;  4A6Q A;  1YJJ A;  4RGN A;  3EUB 2;  3LXF A;  1L4Z B;  3B9J A;  1FFU A;  4L1B A;  2WP9 B;  1I4X A;  2JX5 A;  2LUM A;  1K52 A;  3MP9 A;  1VZ6 A;  1SJH D;  2QJL A;  4IDI A;  1SJE D;  4XDD A;  4ZHO A;  2AQ3 B;  3AED B;  2JWU A;  4L23 A;  5FK9 C;  3NZ3 A;  4ITK A;  1TY2 A;  1SF0 A;  2JYT A;  3SEB A;  1R7S A;  2I2Y A;  1JWA D;  4MM3 B;  1QKZ A;  3MC0 B;  1SE4 A;  4IKG A;  4US9 A;  1PYW D;  1TS3 A;  4PT5 A;  2JU6 X;  4YTN B;  1GAQ B;  1PGB A;  1KFY B;  1B9R A;  2QEJ C;  1NEN B;  3Q8C A;  1ZXH A;  4YWG G;  1UNS A;  2J53 A;  2W3R A;  3VRA B;  5BYS A;  1A70 A;  4RF1 A;  3SFD B;  4A9A A;  4P16 A;  4WIP A;  2WXM A;  3T3O A;  1EU3 A;  1L0Y B;  1OFF A;  1I7H A;  2PKO A;  4RGT A;  1L4D B;  5AUK A;  4HRS A;  1EM7 A;  4ZYS A;  2IDY A;  1WGK A;  2ON8 A;  2K3U A;  4EE2 A;  2N7J A;  2K9X A;  1JWU D;  4ZRQ A;  2JQR B;  4OHJ A;  1C79 A;  3VRB B;  2JYE A;  1RYJ A;  1ZP0 B;  4M0W A;  2IJ0 A;  1QOB A;  1T5X D;  1I4H A;  1ET6 A;  1BUI C;  1ACC A;  2OHF A;  4RFB A;  2WXF A;  3NS1 A;  1YMH E;  3CWI A;  2BBC A;  2AX5 A;  2GRI A;  1XEE A;  1RFK A;  3PZ7 A;  1QF6 A;  2YEP F;  4YT0 B;  1K51 A;  4YTM B;  5TSS A;  3SR6 A;  1VLB A;  4LLG M;  3W5V B;  4OZA A;  1V1P A;  2BT6 A;  1C76 A;  1M4V A;  2B76 B;  3AEG B;  1UWX A;  1VZ8 A;  1D5Z C;  2R61 A;  1QOF A;  3W1S A;  3Q8B A;  2FUG 1;  4JPS A;  2I38 A;  4KX6 B;  4HEA 1;  1PUT A;  2J52 A;  3TEW A;  4RGM A;  3MJ5 A;  1YN5 A;  1B1Z A;  3RPF C;  1JCK B;  1STE A;  2DLB A;  4JWU C;  2SEB D;  2WDR B;  2ACZ B;  2HDE A;  1MPE A;  2DYM A;  1YQ3 B;  1ROE A;  1AN8 A;  1D6E C;  2E3T A;  1JQ4 A;  2FE8 A;  2W82 A;  4WQM A;  1V1P B;  2JXT A;  5EE1 A;  2NTS A;  1UUP A;  3TEY A;  1BXT A;  4WUR A;  2PIA A;  3W9C B;  3Q8E A;  1FEH A;  1ZPS A;  2BS4 B;  2YEP B;  1XLP A;  2BB6 A;  2WDV B;  1MI0 A;  3AEE B;  1C4P A;  4OZB A;  4TMA B;  2WXO A;  3AE2 B;  2PW9 A;  4TQ0 A;  3P63 A;  2PVG C;  2WXH A;  2FBW B;  1DOX A;  2ONQ A;  5FR3 A;  3R2I A;  3AEB B;  3AV8 A;  1AYF A;  2VZK B;  1HQR D;  3Q8F A;  5H92 C;  1FRD A;  1I4Q A;  1PGA A;  1XO3 A;  1N60 A;  3AE8 B;  5D7G A;  1QQR A;  2QIL A;  1CK1 A;  2WDQ B;  1AWD A;  1TYG B;  2LJI A;  3VR9 B;  3U4E G;  4IOI E;  4HKQ A;  2DWQ A;  3KWL A;  2BB5 A;  2JSV X;  1MVK A;  2PVO D;  5FKA C;  3ZJT A;  3AEC B;  4B0M A;  1JW9 D;  5JXV A;  4ARI A;  2WXP A;  2TSS A;  3BYY B;  3I9V 1;  3FC4 A;  3L4P A;  4JX1 C;  2WXN A;  4HJG E;  4NAW B;  3KWV A;  1TKE A;  2WQY B;  2PMV A;  2MEK A;  1FM0 D;  1GB4 A;  2LHD A;  1YJI A;  3PO0 A;  3HVD A;  3LYY A;  3NUH B;  3P42 A;  4YTP B;  1NYR A;  5BMH A;  2SAK A;  4ZRP A;  3IT4 B;  1ZE3 D;  1BML C;  2Y3A A;  1V97 A;  4O1N A;  1XLO A;  1L6U A;  1CJE A;  4HKZ E;  2BS2 B;  1FRR A;  3TSS A;  3B2F A;  4ZHP A;  5T8I A;  3N9Y C;  2AQ1 B;  4KGR A;  1TKG A;  2E6X A;  2V3N A;  4ARC A;  2BTE A;  1SEB D;  1I4R A;  2LMC A;  4UDU C;  1GPX A;  3EA6 A;  1HEZ E;  1FMA D;  3R2T A;  1C77 A;  1HA5 A;  2WU2 B;  1FNU A;  2JZP A;  1PGX A;  3U2S C;  1DYQ A;  3BVM A;  1VR9 A;  3P4S B;  1LO5 D;  1FXI A;  3AE7 B;  1XLN A;  3TUO A;  1L5P A;  3AMZ A;  4D2K A;  2L1A A;  3WCQ A;  2L83 A;  4FXC A;  2V3P A;  3I57 A;  4XWT A;  4XE0 A;  1CZP A;  3BWU D;  2EKI A;  1KLU D;  1ZDV A;  4MH8 A;  1AW7 A;  4TQ1 A;  1IGC A;  2IPK D;  2QMT A;  2CU3 A;  2VZK D;  2WS3 B;  1F2R I;  1SXT A;  2RDH A;  4RH6 A;  2ZW1 A;  2Z8L A;  4JE3 B;  4KKI A;  2DYO A;  4LTU A;  4OZC A;  2WXK A;  3UI3 A;  1ESF A;  2WNM A;  5I4D A;  2G9H D;  1I4P A;  3AEA B;  3P4P B;  3URY A;  1FCC C;  2LFI A;  1J7A A;  4YXD B;  1EU4 A;  4YSY B;  5HG2 A;  1JRO A;  3DWM A;  2EEL A;  2WU5 B;  1TKY A;  3CIR B;  4DXG A;  1IGD A;  1FNW A;  3OWE B;  4B0E A;  1HZ5 A;  1IUE A;  2KN4 A;  3BVZ A;  1ZXI A;  2KQ4 X;  4NJC A;  1TY0 A;  1SSN A;  4WH4 A;  1K50 A;  1ENF A;  2MJE A;  2ZW0 A;  3E56 A;  2W55 A;  4L2Y A;  1VDV A;  4R3D A;  1D4B A;  3IT6 B;  4XDC A;  5EE0 A;  1VRA B;  3P4Q B;  4GDL B;  1WXQ A;  1XCT L;  1SE2 A;  1YN3 A;  1RWS A;  4MT5 A;  1IBX A;  1WYG A;  3AH7 A;  1FXA A;  3C8Y A;  1YNT E;  3Q69 A;  3Q8A A;  1E7P B;  3GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...