3LXFA

Crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRLPALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferredoxin
publication title Molecular characterization of a class I P450 electron transfer system from Novosphingobium aromaticivorans DSM12444
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lxfA00
2H89B 1N62A 3WCQA 1WGKA 2MJDA 1CJEA 2JX5A 1GAQB 3B2FA 3HRDD 1YQ3B 2L83A 3L4PA 4JWUC 1PUTA 3LB8C 3AE8B 1VLBA 3W9CB 4ZHPA 1QOFA 1YJIA 5C3JB 1TJEA 4N58A 1V8CA 4YTMB 1NVID 1L0VB 1YQ4B 1JWBD 1WXQA 1XLQA 2K9XA 1ZUD2 3NS1A 5EE9A 1B9RA 2OHFA 3SR6A 2PIAA 2Y5CA 1N60A 1ROEA 3NVWA 3AEAB 3VRAB 3HUIA 2B76B 3NVVA 2K5PA 1KFYB 3DWGC 1DOYA 1N5WA 3AEDB 3NVYA 4US9A 2JQRB 3AEEB 3P4PB 3AB5A 4YTNB 1A70A 1XLOA 1QOAA 4C7ZA 1XLPA 2BS3B 2E3TA 4C80A 1E0ZA 1KF6B 1JWAD 3CWIA 3NVZA 1RYJA 3P4RB 1PFDA 4WWMA 4YSZB 1E10A 1J7CA 3RPFC 2BS4B 1JRPA 1TKEA 3AMZA 1JALA 2PVGC 2WQYB 1QOGA 3P1MA 3P4QB 5H92C 3W5UB 1L6UA 5MPOA 1F0ZA 1WRIA 1QOBA 1N5XA 2MH7A 2WU5B 1YJJA 4C7YA 3AE2B 4IDIA 5AUKA 1FRRA 1FFUA 4HRSA 4WQMA 3AN1A 5GXGB 2Q5WD 1OQQA 1VJKA 3AM9A 1FO4A 1V97A 4YXDB 1ZOYB 1CZPA 3AE9B 1AYFA 1ZXIA 3AEGB 2KMMA 3AH7A 1GPXA 1QT9A 4JWSC 1TYGB 2WS3B 1FXAA 2MJ3A 4LTUA 1NENB 1FXIA 1JQ4A 2QIEB 5AUIA 3AE6B 2W55A 1DOIA 2MJEA 5C2TB 3FC4A 1OQRA 3SFDB 4HROA 1KRHA 4YTPB 5H8YE 2BT6A 2PKOA 3AE5B 3ABVB 3B9JA 2N0SB 2LEKA 3NRZA 2QJLA 1I7HA 1N61A 1NYQA 1E9MA 1TKYA 2WU2B 4ZOHC 2AX5A 3VRBB 1EWYC 2W3RA 3AEBB 2W3SA 3AEFB 3DWMA 1AWDA 1SIJA 1E7PB 2DBYA 3P4SB 3PO0A 3VR8B 1DOXA 3AECB 3AE3B 4YSYB 3LXFA 2K22A 1NI3A 4FXCA 1IUEA 1FMAD 1FIQA 2BS2B 2W54A 3VR9B 1SB3C 2CJOA 2FBWB 2G1EA 1DGJA 5EE0A 1NYRA 1QF6A 4P6VF 3AE4B 1JROA 3B2GA 5EE3A 1ZP0B 1RM6C 1RFKA 1XLNA 1UWMA 4USAA 2HTME 2CJNA 3W5VB 1VDVA 2PVOD 5EE1A 1N63A 1QLBB 3P63A 4YT0B 4A9AA 3ZYYX 2CU3A 2M19A 3CIRB 2EKIA 2ACZB 1J7BA 2WDVB 1RWSA 3FAHA 3AE7B 2DWQA 1TKGA 3AV8A 4ITKA 4N59A 1R7SA 2WDRB 1J7AA 2WLBA 4US8A 3KWLA 3AE1B 4ZHOA 1E6EB 2M56B 3ETRA 1FM0D 1T3QA 3HVZA 2WP9B 3EUB2 1FRDA 1L6VA 1PDXA 1OFFA 1NEKB 2H88B 2L52A 4JX1C 2WDQB 3BIID 5G5HA 4KX6B 4YSXB 1WWTA 2KAJA 1FFVA 1JW9D 1L5PA 3SFEB 1WYGA 5G5GA 4N6EB 1SF0A 1XO3A
chains in the Genus database with same CATH superfamily
2G4DB 2KQ4X 2KWCA 2KX3A 4MGZE 2NMQA 2BYEA 4TMAB 1GB1A 3AI5A 1XLQA 4HCNB 1HQRD 2DZKA 5J2RA 3DVGX 5TSSA 4OZBA 2LUEA 2NTSA 1N60A 1WR6E 1JMLA 3Q69A 4BOZB 1V86A 3R3MA 2D07B 2DZIA 1BXTA 1MHHE 2JRIB 4KZCA 1ISNA 3MJWA 4RGNA 2LWPA 1JWUD 2KDEB 4W9JA 2BBCA 1QOGA 3R7QA 1L6UA 3U7DA 3QX1A 2ICIA 4ZRJA 2Q5WD 3DVNU 1V97A 3AEGB 5D3DA 2JWZA 4MELA 4PYUA 1OEYJ 1WE6A 5E6JA 2J7QB 3NZ3A 4BAXA 3EGRA 5AUIA 4C4VB 2MJEA 3VH3B 4LDTD 1U4AA 2KLCA 3MJ5A 1EF5A 2N1WA 4HPPA 4EKUA 2PKOA 3BVZA 3ECIA 5CHWA 4K7SA 4B0EA 2KC2A 2WNMA 3AEBB 4P7IA 1WGRA 1DOXA 3AE3B 4LNOA 4FA6A 3Q8CA 3EHVA 4FXCA 1V49A 4C56C 1TS4A 2KZRA 1YN5A 5E6NA 3QCAA 1ZPSA 4HJGE 4TSSA 3A9KA 3HIZA 2Y5PA 4MGKE 1K52A 4DDID 1PYWD 1L6VA 3SDLC 3N30A 1C4AA 3NZUA 4ZRKA 4ZYSA 1C79A 1WYGA 2R2QA 1I35A 3WCQA 1TIFA 4E3CA 2JUOA 3B08A 4KDIC 2MBQA 1YX6B 1WGHA 3N1XC 1JCKB 2LJIA 3C8YA 3SR6A 2ZPNA 1PQSA 1CK1A 4FADA 1UH6A 1D5ZC 1CQVA 1N5WA 2M0XA 3DDCB 3IAM1 2E3TA 4W9DA 1OTRB 4HKZE 2I1JA 1PFDA 1E10A 1UWXA 4HWIB 4IOIE 1SE4A 5H92C 3NJTA 4KGRA 1BMLC 1WRIA 1PGXA 3PV1A 4WQOB 2ZZPB 1K8RB 1WX8A 1QT9A 1MHXA 4EEWA 1UGJA 3X0WA 3AE6B 5C2TB 3ZO5B 2INNE 3U52E 1R4MI 5DPSA 1GC6A 1C78A 2INPE 1P98A 1GUAB 2WXIA 1S1QB 2WU2B 4S17A 3DWMA 1WF9A 2G4SA 3PPAA 4GSWA 4HLEA 1NI2A 2BS2B 3I63C 1WYWB 4GDKB 4KIKB 2PPHA 3RNFC 2PVOD 1UF0A 1LGRA 3I57A 2EKIA 3T3OA 1R7SA 2BYFA 2BTEA 2B3AA 4J3OD 3HVZA 2D3BA 2WDQB 5IA7A 3R7RA 1OEYA 3RYTA 2N1VA 1L4DB 1WI0A 2KNBA 4WJOA 5AZGA 4KKJA 1SIFA 3KUDB 3LB8C 1MVKA 4L1BA 1V8CA 2OOBB 4YTMB 1JWBD 3ZDTA 1WXMA 4MJSB 1SE2A 4A6QA 4BBNF 1HZ5A 2L05A 1ROEA 2B76B 3J9CA 5JH5C 3DWGC 3AEDB 3NVYA 4TV3A 3AEEB 5G2NA 4AS1A 4BKGA 1HXYD 3ENEA 2G3QB 3H7SA 3ZUNA 3ZKJC 3L13A 1F0ZA 4ARIA 3M3JA 2M17A 2BQQA 5AUKA 2G45B 1WRDB 4HRSA 3I9V1 3LYYA 2BB5A 5D6JB 3A1QB 4LJPB 1UBIA 5FKAC 2LVOA 2LGXA 3Q14C 1C1YB 4RMAA 3ZRFA 1LM8B 3L54A 4KV2A 3H7PA 4WJNA 3DCGA 1WX7A 4ANUA 2LD9A 1UGMA 3Q8BA 2KO3A 4A55A 2ZJDA 3A9JA 1WJ4A 5D2MB 3R2TA 2PLPA 3KLSX 3VTWA 2RR9A 2N9EB 1T6BX 2KD0A 1E8ZA 4HPLB 1C4CA 1WY8A 1IPGA 2MP2A 3LXFA 2KYWA 3VH4B 1KM7A 1FMAD 4IG7B 4ZYNA 5IO9A 4BOSC 2JU6X 4G0NB 3BYTB 3W5VB 2CU1A 1SSNA 3QQ8B 2REXA 1Y8RC 4XGAB 5D3IB 4XC2A 1YJ1A 1EU3A 1WSPA 2A4ZA 1FCCC 3SU8X 1WWTA 1FFVA 3PVLA 1SF0A 3R8BA 1GJZA 2PTLA 3QWZB 3ZDMC 3JVZX 3OAWA 3AE8B 3UQBA 1I4QA 2EMTA 3VDZA 3RFZB 4M01A 4JE3B 2ZW0A 2KVZA 2RMMA 3VRAB 1A70A 3RNBC 2BS3B 1XQQA 2KKCA 3S2AA 1JALA 3JSVA 5FR3A 3PGEA 5HKHA 3UIPB 4TKNA 1E8XA 1FO4A 1OQQA 2FCMA 1TZ1A 1TT5B 3QARA 1TTNA 2X8XX 2UU7A 4JWSC 1ZDXA 4YL8A 1ET9A 3HM3A 2W55A 5CHFA 1NDDA 3SFDB 2XNAC 3EA6A 4EZLA 3GP7A 2J0MA 1ZKHA 3BWUD 5J18A 2LEKA 3NRZA 1P7FA 2AX5A 2A5UA 5JZEB 3SEBA 2K25A 2W54A 4NAWB 5D7GA 3ZNZB 1QLBB 3TSSA 3RMKC 2E6XA 2INDC 3AV8A 2WDRB 2WLBA 3N1YC 3ETRA 3TIXA 2TSSA 5JHAA 1C4PA 4A90A 2BWES 1OFFA 4WAAA 4P16A 4NQLB 3RNEC 1T5XD 1STEA 2JSVX 5G5GA 4B95A 3PZDA 1HEZE 1T0YA 1CJEA 2IZVB 3L4PA 3W9CB 4WWOA 2MLBA 5TR5A 3V61A 4XDDA 1F77A 1MI0A 3U7ZA 3ZXVA 2Z8LA 4DHJD 2MBOA 2KJHB 3MHSD 3QC8B 2L76A 3A4SC 1RYJA 4OVUA 2PVGC 5FR6A 1L0YB 1QOBA 4C7YA 2GLSA 3PZ7A 5GXGB 4BKSD 3KW5B 4DBGA 4YXDB 2Z59B 3AULA 3OJ4B 3IHPC 1VCBA 2INCC 3U4EG 1KJTA 1BUIC 2C9WB 3GZNI 3NHEB 4ANXA 3KUZA 2KJRA 2WXHA 2DAJA 2LGYA 4W9FA 3PRMB 2BVCA 2DNFA 4XE0A 1OQYA 1TKYA 3AU5A 4LJOB 2W3SA 3V05A 4P1CC 3P4SB 4EUTA 2NTTA 2KVRA 3M63B 4GDLB 2WXGA 2ONQA 3NS8A 4E74A 2FUG1 1J8CA 2EKEC 2M19A 2QILA 1HTOA 1TKGA 3LJ3A 3NUHB 3RUIB 1CMXB 3T3NA 2QSDA 1GG3A 2KDMA 4CO7A 3IG3A 1PDXA 3ZTCA 3DBSA 4JX1C 4DK5A 4KX6B 3Q8FA 4M00A 2UWQA 5EE9A 1N62A 3CSTA 1SXTA 3SD5A 4RCOA 2AQ1B 3B2FA 1PUTA 4UDUC 4W9HA 3ZXRA 3TEWA 2Y5CA 2RPQA 3T9LA 1UBQA 3UF8A 4F7ZA 2VH1A 1I42A 4MSMB 3PHXB 2QHOA 4RGMA 2NPTA 5D94A 4C80A 1Q1OA 3RZWC 1XLPA 2KFKB 1ACCA 3HM6X 2JT4B 3BZDB 3QA8A 2GMIC 4F8CB 3VTUA 3ZNGC 2K8HA 1R4NI 2JRHA 2O2VB 1XCQL 2O6VA 2FCQA 3JW0X 5CX3A 1ZXIA 4XWWA 5KHQA 3DBLI 4I6PA 3QK0A 2CKHB 4EZKA 2D3AA 4FLHA 4MT5A 4JIOU 5H8YE 2LMCA 4LNFA 1JWSD 1E8YA 2CHXA 2IO1B 4LCDE 2NBVB 3PT2B 1IP9A 4PS7A 2N0SB 4S0RA 5GMVA 1N61A 2WGSA 2WXRA 3A1QA 4FBJB 3W1SC 3PO0A 4NAMA 1SB3C 2CJOA 3L16A 1NYRA 4P6VF 4W9CA 2RDBC 2DENB 4DHZB 3CIRB 3ZW3A 1RWSA 1SE9A 1L0XB 2BYVE 2D3GA 1T3QA 1TS2A 5EDSA 2SAKA 3APDA 3ZGZA 1LQBA 3BIID 2CHZA 2WX0A 2KTRB 4N6EB 4XX5A 2LJ5A 1WGKA 2MJDA 3Q6BA 2IGDA 4FN2A 1D4BA 2L0FA 3HRDD 3BINA 4LNKA 2W82A 1QOFA 1YJIA 4N58A 1NVID 1ZUD2 1C3TA 2DYBA 4RM9A 4DDGD 3ZJTA 2BGFA 3IVFA 4ARCA 3L0WB 4NQKE 2GBNA 3IAS1 2NCNA 3V62A 3NOBA 2Y5BB 3AMZA 2KQ7A 3ZJUA 5HI1A 2R61A 3AE2B 3APCA 1S3SG 2FAZA 2NBUA 2N7EA 1AYFA 4RGTA 3IT6B 2G9HD 2VH2A 4ZRQA 4O1NA 1OQRA 2J0KA 1MPEA 4GMVA 3A4RA 3FILB 2L32A 2QJLA 1ZDVA 4ZRPA 2DAFA 3TMPB 1N6ZA 3NY5A 4MH8A 3B1LX 5T8IA 2VZKD 3Q8AA 2DYOA 1NBFC 1QF6A 4KGSA 1YN4A 3AE4B 2J42A 3WAPA 2OEDA 2JXXA 2IY1B 4LK0M 1PGAA 1R4MB 4FHJA 1UELA 4IWPA 3DBHI 2ACZB 2ZEQA 4RF0A 3H8HA 4G3XB 3AE1B 1MFWA 1WX9A 1FM0D 5E6PA 2KN5A 2L52A 2IYDB 2V3SA 2AEHA 4HDQA 1KOTA 2KAJA 1WXSA 2DZJA 3SFEB 4A8XC 1IBXB 1XCTL 2H89B 3N9YC 1GAQB 4IWOA 3OLMD 4K7UA 4JWUC 2GBJA 3Q3NC 1YQ4B 2YEPF 1WE7A 2FNJB 2ZPYA 3RULA 3ZVVA 4P1BC 2OHFA 3CSFA 3PLVA 1F2RC 1UZXB 1KLUD 3NVVA 2I2YA 2K5PA 1HZ6A 2MSED 4WIPA 4YTNB 4AP4C 3CWIA 3QJZA 2XBBC 2M4NA 3ZJVA 2Z0EB 5HHDG 3V60A 3AN1A 1E7UA 1V1PA 1ENFA 1WMHB 3M62B 1EWCA 4DHJB 2JZZA 2WS3B 2L3ZA 2I38A 1D5XC 4IWQA 1JQ4A 3DHGC 1Z5SB 1UNSA 5IN7A 5AZFA 2HD5B 4OZCA 1ET6A 1IGDA 4HROA 4YTPB 1WFYA 4L2YA 4RM8A 2XK5B 4HEA1 3E9SA 4I6NB 5G55A 2WWZA 3QAQA 2V3NA 3C19A 4CQNA 4G11A 3BK2A 2DBYA 3TL5A 3DVGY 3UINB 1K50A 1IUEA 4PS3A 4FULA 3VUYA 1DGJA 1ZP0B 3OJ3A 3Q3JA 1I4HA 2MCNB 3ZTDA 1P9DU 2NBWB 3FAHA 1J7BA 1GC7A 3DHHC 4N59A 4WJPA 4DXFA 2JF5A 4GDLA 1LO5D 3RNAC 4K7WA 2GBMA 2DLBA 2JZ3B 2QEJC 2KJ6A 3EECA 2IO2B 4WJQA 1TJEA 1L0VB 1WXQA 4WWNA 3N32A 3HVDA 4I6LB 4AWJA 5L83A 4DXAB 3NVWA 4MM3A 2IGHA 4US9A 5BMIA 3VTVA 2AQ3B 2M8SA 3BVMA 2AYOB 3V3XA 5JXVA 1LFDA 4MGIE 1QQRA 4AJWA 1TKEA 3HK0A 4BZAA 2WQYB 2ZCCA 1V81A 1VZ7A 2LVQA 3OG5A 1YJJA 5AEKB 2WXFA 1KLVA 3Q3MC 3RD2A 3A9KB 1TYGB 4KVGB 2DZMA 2K6QA 3RCZA 1FXIA 2KT7A 4XZ4A 4FJZA 3T8MA 4II2B 2K6DB 2JPHA 1YN3A 4IKGA 2BT6A 4N9F4 1HE8A 1RFAA 2N7DA 4HVBA 2PE6B 3TEZA 3X23A 1Q5WB 1WJUA 3I3TB 3TUOA 5HG2A 3MP9A 4NJ6A 5IOIA 1LXDA 2LHEA 1WIAA 1NI3A 4KZ0A 4DHZE 2K1FA 2KDFB 2WX1A 3E56A 1VR9A 4KGTA 1T0QC 3AU4A 2PEAA 2HTME 1V5TA 4OVVA 5EE1A 3PRPB 2DWQA 3DBRI 1J0GA 2V9HA 4ITKA 1M4VA 1J19A 4TQ1A 3IXSA 4W9IA 4IC7B 1WGDA 4C4VA 1E90A 5C3JB 1TBEA 2IJ0A 3QHTA 2D3CA 2K9XA 1AW7A 2BKRB 1WR1A 1WJNA 4TQ0A 2K8BA 2C7NB 4ICVA 2L8JA 4HPMB 5BMGA 3KWVA 3MC8A 1J7CA 3RPFC 3W5UB 2KOXA 4HXDA 4KDLB 4IDIA 4WQMA 1VJKA 5J17A 2RD0A 2HE7A 1ZOYB 1C9FA 2MWSB 4JLCA 3IBEA 1JRUA 2FCSA 4MACA 4BFRA 4ACFA 1KRHA 4K1RB 2WXLA 2KMCA 1VZ8A 1SJED 2X38A 3K9OB 2WXMA 1XXGA 4GU2A 3VRBB 5C1ZA 1L2NA 2O6VD 3ZLZA 4YSYB 4K3CA 3B2GA 1EUVB 3PS6A 3GZNB 1UWMA 3U8ZA 4URKA 4K3BA 4GIVA 2ZNVB 2LI5A 4IM0A 2N9XA 3AE7B 2NR2A 2ZVOA 4NZLB 1J7AA 3FKYA 3KWLA 2FE8A 4ASWC 1WM3A 2VZKB 1XF5L 1L5PA 2C60A 3MHZA 1P3QU 2RGFA 2BKFA 4GN1A 3ZQ4A 1TS5A 1TZOA 3A9JB 3R66C 2AL6A 1FCLA 2MW5A 4D2KA 2KTFA 5BYSA 3HUIA 2MP2B 3MTNB 1KFYB 4MSQB 2GBKA 4GDKA 2JQRB 4KIKA 4EFOA 1V6EA 1ZW7A 1XLOA 4AQ7A 1E0ZA 2QDFA 4GGQA 3NVZA 5CTRC 3UI3A 3DVNV 4HK2A 1L4ZB 3PTFC 4QAYA 1X1MA 2V0GA 2KDBA 3VXWA 5KHOA 3H1UA 5LNK1 1DYQA 2IO0B 2KMMA 4IM3A 1PGBA 3VAWA 1H8CA 5CHVC 4NJ7A 5FK9C 3EFCA 1EO6A 2Z0DB 2LZ6A 5BYRA 3ML9A 4WH4A 4MJSA 1R4NB 4ZOHC 1V2YA 3H9DA 2N9LA 2MBHA 2YLMA 3PZ8A 2GI9A 2K22A 2PJHA 1Q0WB 1Q10A 3MFGA 2IO3B 2NVUI 2FBWB 3DBLB 5LLIA 5DCNA 1AN8A 4KSLC 1ZGUB 2XK5A 1K51A 3VUWA 5JHBA 2UYZB 4BKSA 2WDVB 3JSVB 4PT5A 2LGSA 2D5GA 3HHMA 1YQBA 3TCAA 3N3KB 2KC1A 4US8A 1SBBB 3N20C 3IT4B 5E6OA 2KX0A 5G5HA 1Y56A 1I4GA 1K53A 2K3UA 2AQ2B 1A5RA 1YQ3B 2L83A 4DXGA 2LHDA 3PLUA 3PRZA 2LGDA 4JL9A 3NS1A 3L08A 1FNVA 2J0JA 1WZ3A 2PE9A 1EU4A 2V4LA 4M0WB 1I4XA 4C7ZA 3BYYB 2J52A 2J53A 1OGWA 4WWMA 2WDTB 2BS4B 1F52A 3P2BA 5MPOA 2WU5B 2R2OA 1FRRA 1FFUA 1SJHD 2Y3AA 1XT9B 2KN4A 2D11A 5L95C 1QILA 3AH7A 4XYCA 4HJKA 5DPWA 2MEKA 4LTUA 2MQJA 2KXJA 1DOIA 3KYDD 3TEYA 1RRBA 4E71A 4EOYA 1D5MC 2EMSA 2IPKD 3AE5B 2MBEA 3WAMA 2WXJA 4G50A 1NYQA 4NPNA 3U30A 1GOZA 2LXCA 1EWYC 2IGGA 3V6CB 3GB1A 1QKZA 4NY0A 3M95A 4REZA 1I4RA 4WURA 2BPSA 2KLGA 4XWTA 5LXHA 2XN9C 3W1SA 2N7JA 3VR9B 2LRUA 4RFBA 3RNCC 4PK1A 4DWFA 2IY0B 4MDKE 4GLSC 4ANVA 1XLNA 3O13A 1VDVA 3EFUA 3Q2AC 4OW0A 1H4RA 4EZJA 1WGGA 4ZHOA 2M56B 2I1KA 4W9EA 2AWTA 3V6EB 4YSZB 2MH7A 2N9KA 1MG4A 4CHKA 1VLBA 3PSEB 4R3DA 5BMHA 4C00A 2QMTA 2NS5A 3DBHB 3SHQA 3P42A 3PREA 4A3PA 3AEAB 2FCNA 4W9LA 4TUUA 1WZ0A 1YOVB 2WXQA 2KFJA 2ZNVC 1QOAA 4NAWA 1VD2A 1JRPA 1IYFA 3DHIC 3BK1A 1D6EC 1YNTE 1ZE3D 1KLGD 4OZAA 4W9KA 2DX5B 2KHWB 2CR5A 1FEHA 1TGZB 2L0TA 1RAXA 2ON8A 3L17A 4BBNC 4XDCA 1HA5A 2CS4A 2BW2A 1VZ6A 3APFA 3GE8C 3VVWB 3KQ4A 2XEWA 1GNUA 2WXNA 4CYEA 5HFYA 1YMHE 1RLFA 1E9MA 4W9GA 1I4PA 2HJ8A 1TY2A 2YVCA 1SIJA 2JYTA 4RH6A 1P7EA 4GB9A 3AECB 3EC8A 2DYMA 2C7HA 2NPTB 3DPDA 1IGCA 2J4XA 3GOEA 2HDEA 1E7VA 4USAA 2W9NA 1N63A 1KH0A 2RDHA 4ZDVA 2O6VB 2ASQA 3Q3FA 1T0RC 2BF8B 1C77A 2WP9B 4FJYA 2H88B 4DQOC 4JPSA 2IBIB 2M1MA 4IUMB 1YIWA 4MEMA 3KVFB 2C5LC 4AUQC 3N1ZC 1P0RA 4HDOA 2RPVA 4OVZA 1E5WA 5AZHA 2V4IB 4LNNA 4KSKC 2AL3A 4WAFA 1GB4A 4RGOS 1B9RA 3WALA 3TEXA 1SGHA 3VFKA 4L23A 4ANWA 2JVCA 1FXTB 1DOYA 2FUHB 1WH3A 2KWDA 4Q2JA 3P4RB 2JWUA 4WWPA 3K9PB 1T0SC 3P4QB 4JGHB 3LDZE 1UUPA 2MA9B 4H2AA 3AM9A 3AE9B 3BVGA 1GPXA 5I4DA 3BY4B 1FXAA 2PW9A 1NENB 2VRRB 2QCZA 2LASA 3PHWB 4M8MA 3I5JC 2IDYA 4ICUA 1D3ZA 1V80A 2RDGA 1FNUA 3B9JA 4PS8A 1MJDA 1WGYA 2ZW1A 2WXOA 3ZNHB 4LNIA 1AWDA 3GE3C 1E7PB 2K0PA 2BYTA 1YX5B 2LGIA 1EF1A 1FIQA 1FNWA 2G1EA 2WHIA 2KFKA 2RSUA 1YD8U 2LUMA 1RM6C 1JWMD 4JQWC 1WXVA 1F1HA 4HKQA 2N9PC 2KANA 3NZSA 3P63A 4IM2A 4A9AA 3ZYYX 3D32A 2KQSA 2O2VA 2SEBD 5DPTA 2OJRA 5IKCM 1TS3A 2KWUB 3ALBA 4AJYB 3EUB2 1FRDA 2HTHA 1NEKB 2WYQA 5C23A 2MRPA 1JW9D 5BYQA 3NG0A 1XO3A 3KH0A 2K39A 2D10A 1ZXHA 1V9JA 3RN9C 1XEEA 2MHJA 2C7MB 1P1AA 3DBRB 2L7RA 3IFWB 3L10B 2OJWA 2GBRA 2D2QA 3P4PB 3AB5A 3RT3B 4RF1A 2FIFA 4M8NA 4X57B 3WIMA 1KF6B 1UD7A 2CHWA 4II3B 2KACA 4YSXB 2JZPA 2BWFA 1V1OA 1VRAB 3A33B 1SEBD 1C76A 4BKTA 5LXIB 3WANA 1CZPA 3QIJA 3URYA 3MC9A 3VHTC 3ZIMA 4ZRIA 4M0WA 2V3PA 2KTRA 2QIEB 4KKIA 4LDTB 2GOWA 3Q8EA 3ONSA 2V1YA 3OWEB 4FHKA 3ABVB 4OHJA 3WA0A 3C0RB 4B0MA 1V5OA 2W3RA 3RNGC 3AEFB 3VR8B 2EELA 5IP4D 4NNJB 2JY6A 5EE3A 1E8WA 1RFKA 5IAAC 4BVUC 2JYEA 3RZFA 1WXAA 3ZNID 2GB1A 4B6WA 1V1PB 1E6EB 1BT0A 3Q3OC 3MC0B 4A3OA 3ML8A 2KMAA 4RNAA 1FPYA 2JX5A 1SE3A 1L7YA 4ZHPA 2YEPB 3FILA 4K81A 3VUXA 2ZVNA 2GRIA 4F1SA 4AOFA 1HTQA 2PIAA 3WAOA 3KYCD 2LXAA 2MBBB 2WXPA 2L1AA 2PMVA 2WXKA 4YWGG 1AARA 3ZRCA 3CMMB 3W2DA 4IW0A 1F9JA 3B0AA 3UQAA 1M94A 3U2SC 3H7PB 1JWAD 1MG8A 3AXCA 4EE2A 2KWVB 1XD3B 1WJ6A 4MH0E 3P1MA 4PYZA 3R2IA 1N5XA 2ZCBA 2KK8A 2FIDA 1G6JA 4NJCA 3RI7C 1QZEA 2K8CA 3JYUA 1FD6A 5BO4B 2MJ3A 1IBXA 4B9KA 1F2RI 2L00B 4GOCA 3UIOB 4HCPB 3FC4A 3H6NA 3GS2A 4A20A 5DPRA 4M02A 1I7HA 4MGYE 1TY0A 2LVPA 4LLGM 3TJPA 3VQIA 2MX2A 1WM2A 3DOWA 4MM3B 3W1YA 2QC8A 2JXTA 3KUCB 5EE0A 1JROA 3UGBB 2BB6A 3O65B 2KDIA 2CJNA 4YT0B 2DHZA 2CU3A 2LFIA 4J6IA 4FJVB 1ESFA 3DQVA 4GXBA 2HJ1A 1WMHA 2LRWA 1KTKA 3TBLD 1B1ZA 2N4FA 1EM7A 2M0AA 1Z2MA 3CF6E
chains in the Genus database with same CATH topology
2N9KA 1CJEA 2KQ4X 2QEJC 2NMQA 3L4PA 4TMAB 3W9CB 1GB1A 1VLBA 4R3DA 1TJEA 5BMHA 1L0VB 2QMTA 1WXQA 1XLQA 1HQRD 4XDDA 3HVDA 3P42A 5TSSA 4OZBA 1F77A 2NTSA 1N60A 1MI0A 3NVWA 3AEAB 1JMLA 2IGHA 3Q69A 3U7ZA 2Z8LA 4US9A 5BMIA 2AQ3B 3BVMA 2WXQA 3V3XA 1QOAA 1BXTA 1MHHE 5JXVA 1RYJA 1QQRA 4RGNA 1JWUD 1JRPA 1TKEA 2BBCA 2PVGC 2WQYB 1QOGA 3BK1A 1VZ7A 1L0YB 1L6UA 1QOBA 4C7YA 1YJJA 1D6EC 3PZ7A 1YNTE 5GXGB 1ZE3D 2WXFA 2ICIA 2Q5WD 1KLGD 4OZAA 1V97A 4YXDB 1FEHA 3AEGB 5D3DA 1TYGB 3U4EG 5E6JA 1BUIC 3NZ3A 1FXIA 3EGRA 5AUIA 2MJEA 2ON8A 4XDCA 1HA5A 2BW2A 1VZ6A 1YN3A 4IKGA 3MJ5A 2WXHA 3KQ4A 2BT6A 2PKOA 2WXNA 3BVZA 5HFYA 4B0EA 3TEZA 1YMHE 4XE0A 1E9MA 1TKYA 1I4PA 2WNMA 1TY2A 3TUOA 5HG2A 3AEBB 3MP9A 2W3SA 3V05A 1SIJA 2JYTA 4RH6A 1P7EA 2LHEA 3P4SB 2NTTA 1DOXA 3AECB 3AE3B 4GDLB 3Q8CA 2WXGA 1NI3A 4FXCA 2DYMA 2ONQA 4C56C 1IGCA 2J4XA 3E56A 1TS4A 1VR9A 4KGTA 2HDEA 1YN5A 2HTME 4USAA 2FUG1 5EE1A 1N63A 1ZPSA 1KH0A 2M19A 2RDHA 2QILA 2DWQA 4HJGE 1TKGA 4TSSA 4ITKA 3NUHB 3T3NA 2Y5PA 2QSDA 1M4VA 2KDMA 1C77A 2WP9B 1K52A 1PYWD 4TQ1A 1L6VA 1PDXA 3IXSA 2H88B 4JX1C 1C4AA 4DQOC 4JPSA 4KX6B 4ZYSA 3Q8FA 1C79A 1WYGA 5EE9A 1N62A 3WCQA 1SXTA 4RCOA 2AQ1B 3B2FA 2RPVA 1PUTA 4OVZA 5C3JB 4UDUC 2V4IB 2IJ0A 2K9XA 4WAFA 1GB4A 1AW7A 4RGOS 1JCKB 2LJIA 3C8YA 1B9RA 3SR6A 3TEWA 3TEXA 2Y5CA 4TQ0A 1CK1A 4L23A 1D5ZC 1CQVA 1DOYA 1N5WA 4RGMA 2KWDA 5BMGA 4C80A 3IAM1 1XLPA 2E3TA 4Q2JA 3KWVA 3P4RB 4HKZE 1ACCA 1PFDA 1E10A 1UWXA 2JWUA 1J7CA 3BZDB 4IOIE 1SE4A 3RPFC 5H92C 3P4QB 3W5UB 1UUPA 4KGRA 1BMLC 1WRIA 1PGXA 1XCQL 4IDIA 4WQMA 4H2AA 1VJKA 3AM9A 1ZOYB 1C9FA 3AE9B 3BVGA 1ZXIA 1GPXA 4XWWA 1QT9A 5I4DA 1MHXA 1FXAA 2PW9A 1NENB 1UGJA 3AE6B 4MACA 5C2TB 2INNE 3U52E 4MT5A 2IDYA 1KRHA 1C78A 5H8YE 2LMCA 1JWSD 2INPE 2RDGA 2WXLA 1FNUA 1VZ8A 1SJED 2WXIA 3B9JA 2N0SB 2X38A 2WXMA 1XXGA 1N61A 2ZW1A 2WXRA 3VRBB 2WU2B 2WXOA 3DWMA 1AWDA 1E7PB 2K0PA 3PO0A 2BYTA 4NAMA 4YSYB 2LGIA 2BS2B 1FIQA 4GDKB 1SB3C 2CJOA 1FNWA 2G1EA 1NYRA 4P6VF 3B2GA 2LUMA 1RM6C 1JWMD 1UWMA 2PVOD 4HKQA 3P63A 4A9AA 3ZYYX 3CIRB 3I57A 2EKIA 1RWSA 2SEBD 3T3OA 3AE7B 1L0XB 1TS3A 1R7SA 4NZLB 1J7AA 3KWLA 2BTEA 2FE8A 4J3OD 3HVZA 1T3QA 1TS2A 3EUB2 1FRDA 2SAKA 2VZKB 1NEKB 1XF5L 3ZGZA 2WDQB 3BIID 1JW9D 1L5PA 5BYQA 4N6EB 1L4DB 1XO3A 3MHZA 1WGKA 2MJDA 2IGDA 1D4BA 3HRDD 4KKJA 3LB8C 3ZQ4A 1MVKA 2W82A 1QOFA 1YJIA 1TS5A 1ZXHA 4L1BA 1TZOA 1V8CA 4N58A 1NVID 4YTMB 1JWBD 1XEEA 1FCLA 1ZUD2 1SE2A 4A6QA 1HZ5A 4D2KA 1ROEA 5BYSA 3HUIA 2B76B 3J9CA 3ZJTA 1KFYB 3DWGC 3AEDB 3NVYA 2JQRB 3AEEB 3P4PB 3AB5A 4ARCA 4RF1A 1XLOA 4AQ7A 4AS1A 1E0ZA 1HXYD 3UI3A 1KF6B 3NVZA 3IAS1 4YSZB 1L4ZB 2KACA 3AMZA 4YSXB 2V0GA 3ZJUA 5HI1A 1F0ZA 2R61A 4ARIA 2JZPA 1V1OA 1VRAB 3AE2B 1SEBD 5AUKA 1C76A 4HRSA 3I9V1 3LYYA 2BB5A 5LNK1 1DYQA 1CZPA 1AYFA 4RGTA 3URYA 2KMMA 5FKAC 1PGBA 3IT6B 2G9HD 4M0WA 2V3PA 4ZRQA 2QIEB 4KKIA 4O1NA 3Q8EA 1OQRA 5FK9C 3OWEB 3Q8BA 4A55A 1MPEA 2PLPA 3KLSX 3R2TA 5BYRA 3ABVB 1T6BX 2L32A 3FILB 4OHJA 2QJLA 4WH4A 1ZDVA 4ZOHC 4ZRPA 2N9LA 1C4CA 4B0MA 2W3RA 3AEFB 3PZ8A 3VR8B 2EELA 3LXFA 2GI9A 2K22A 4MH8A 1Q10A 3MFGA 1FMAD 5T8IA 2VZKD 3Q8AA 2FBWB 2DYOA 1QF6A 4KGSA 1YN4A 3AE4B 2J42A 5EE3A 1AN8A 2OEDA 2JU6X 1RFKA 3BYTB 4LK0M 1PGAA 3W5VB 2JYEA 1K51A 2ACZB 2WDVB 4PT5A 1SSNA 2D5GA 2GB1A 4RF0A 3H8HA 4US8A 5D3IB 3AE1B 1SBBB 1E6EB 1V1PB 1FM0D 1EU3A 1WSPA 3IT4B 3MC0B 2L52A 5G5HA 1FCCC 2KAJA 1WWTA 1FFVA 1Y56A 4RNAA 3SFEB 4A8XC 1IBXB 1I4GA 1SF0A 1XCTL 3R8BA 2H89B 1K53A 2K3UA 3N9YC 2PTLA 2JX5A 2AQ2B 1GAQB 1SE3A 1YQ3B 2L83A 4JWUC 3AE8B 4DXGA 2LHDA 4ZHPA 2YEPB 3FILA 1I4QA 1YQ4B 2YEPF 2GRIA 3RFZB 3NS1A 1FNVA 2OHFA 4JE3B 2ZW0A 2PIAA 2RMMA 2WXPA 1F2RC 2L1AA 2PMVA 3VRAB 2WXKA 1KLUD 3NVVA 4YWGG 2K5PA 1HZ6A 2I2YA 1EU4A 4WIPA 3W2DA 4YTNB 1I4XA 1A70A 4C7ZA 2BS3B 3BYYB 3U2SC 2J52A 1JWAD 3CWIA 2J53A 4EE2A 4WWMA 2BS4B 3P1MA 1JALA 5MPOA 3ZJVA 3R2IA 5FR3A 1N5XA 2WU5B 5HHDG 1FRRA 1FFUA 1SJHD 1FO4A 3AN1A 1OQQA 2Y3AA 4NJCA 1V1PA 1ENFA 2KN4A 1FD6A 1QILA 1EWCA 3AH7A 4JWSC 2WS3B 1ZDXA 2I38A 1ET9A 2MJ3A 1D5XC 2MEKA 4LTUA 1F2RI 1IBXA 1JQ4A 1UNSA 2W55A 1DOIA 3TEYA 4OZCA 3FC4A 1ET6A 1IGDA 4HROA 3SFDB 2XNAC 1D5MC 3EA6A 4YTPB 3GP7A 4L2YA 3GS2A 2IPKD 4HEA1 3AE5B 3BWUD 3E9SA 2WXJA 2LEKA 3NRZA 1P7FA 2V3NA 1I7HA 1NYQA 4CQNA 1GOZA 2AX5A 1TY0A 1EWYC 2IGGA 3BK2A 4LLGM 3GB1A 1QKZA 3VQIA 4REZA 2DBYA 1I4RA 4WURA 4XWTA 4MM3B 1K50A 2XN9C 3SEBA 3W1SA 1IUEA 2N7JA 2W54A 2JXTA 3VR9B 4RFBA 1DGJA 5EE0A 4NAWB 4GLSC 1JROA 1ZP0B 2BB6A 1I4HA 1XLNA 3O13A 5D7GA 2CJNA 1VDVA 4YT0B 1QLBB 3TSSA 2CU3A 4OW0A 2E6XA 1J7BA 2LFIA 3FAHA 3AV8A 4N59A 1ESFA 2WDRB 2WLBA 4DXFA 4ZHOA 2M56B 1KTKA 3ETRA 1B1ZA 2TSSA 1LO5D 1C4PA 1EM7A 2M0AA 4A90A 1OFFA 4P16A 1T5XD 1STEA 2JSVX 5G5GA 1HEZE 2MH7A 2DLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H89 B;  1N62 A;  3WCQ A;  1WGK A;  2MJD A;  1CJE A;  2JX5 A;  1GAQ B;  3B2F A;  3HRD D;  1YQ3 B;  2L83 A;  3L4P A;  4JWU C;  1PUT A;  3LB8 C;  3AE8 B;  1VLB A;  3W9C B;  4ZHP A;  1QOF A;  1YJI A;  5C3J B;  1TJE A;  4N58 A;  1V8C A;  4YTM B;  1NVI D;  1L0V B;  1YQ4 B;  1JWB D;  1WXQ A;  1XLQ A;  2K9X A;  1ZUD 2;  3NS1 A;  5EE9 A;  1B9R A;  2OHF A;  3SR6 A;  2PIA A;  2Y5C A;  1N60 A;  1ROE A;  3NVW A;  3AEA B;  3VRA B;  3HUI A;  2B76 B;  3NVV A;  2K5P A;  1KFY B;  3DWG C;  1DOY A;  1N5W A;  3AED B;  3NVY A;  4US9 A;  2JQR B;  3AEE B;  3P4P B;  3AB5 A;  4YTN B;  1A70 A;  1XLO A;  1QOA A;  4C7Z A;  1XLP A;  2BS3 B;  2E3T A;  4C80 A;  1E0Z A;  1KF6 B;  1JWA D;  3CWI A;  3NVZ A;  1RYJ A;  3P4R B;  1PFD A;  4WWM A;  4YSZ B;  1E10 A;  1J7C A;  3RPF C;  2BS4 B;  1JRP A;  1TKE A;  3AMZ A;  1JAL A;  2PVG C;  2WQY B;  1QOG A;  3P1M A;  3P4Q B;  5H92 C;  3W5U B;  1L6U A;  5MPO A;  1F0Z A;  1WRI A;  1QOB A;  1N5X A;  2MH7 A;  2WU5 B;  1YJJ A;  4C7Y A;  3AE2 B;  4IDI A;  5AUK A;  1FRR A;  1FFU A;  4HRS A;  4WQM A;  3AN1 A;  5GXG B;  2Q5W D;  1OQQ A;  1VJK A;  3AM9 A;  1FO4 A;  1V97 A;  4YXD B;  1ZOY B;  1CZP A;  3AE9 B;  1AYF A;  1ZXI A;  3AEG B;  2KMM A;  3AH7 A;  1GPX A;  1QT9 A;  4JWS C;  1TYG B;  2WS3 B;  1FXA A;  2MJ3 A;  4LTU A;  1NEN B;  1FXI A;  1JQ4 A;  2QIE B;  5AUI A;  3AE6 B;  2W55 A;  1DOI A;  2MJE A;  5C2T B;  3FC4 A;  1OQR A;  3SFD B;  4HRO A;  1KRH A;  4YTP B;  5H8Y E;  2BT6 A;  2PKO A;  3AE5 B;  3ABV B;  3B9J A;  2N0S B;  2LEK A;  3NRZ A;  2QJL A;  1I7H A;  1N61 A;  1NYQ A;  1E9M A;  1TKY A;  2WU2 B;  4ZOH C;  2AX5 A;  3VRB B;  1EWY C;  2W3R A;  3AEB B;  2W3S A;  3AEF B;  3DWM A;  1AWD A;  1SIJ A;  1E7P B;  2DBY A;  3P4S B;  3PO0 A;  3VR8 B;  1DOX A;  3AEC B;  3AE3 B;  4YSY B;  3LXF A;  2K22 A;  1NI3 A;  4FXC A;  1IUE A;  1FMA D;  1FIQ A;  2BS2 B;  2W54 A;  3VR9 B;  1SB3 C;  2CJO A;  2FBW B;  2G1E A;  1DGJ A;  5EE0 A;  1NYR A;  1QF6 A;  4P6V F;  3AE4 B;  1JRO A;  3B2G A;  5EE3 A;  1ZP0 B;  1RM6 C;  1RFK A;  1XLN A;  1UWM A;  4USA A;  2HTM E;  2CJN A;  3W5V B;  1VDV A;  2PVO D;  5EE1 A;  1N63 A;  1QLB B;  3P63 A;  4YT0 B;  4A9A A;  3ZYY X;  2CU3 A;  2M19 A;  3CIR B;  2EKI A;  2ACZ B;  1J7B A;  2WDV B;  1RWS A;  3FAH A;  3AE7 B;  2DWQ A;  1TKG A;  3AV8 A;  4ITK A;  4N59 A;  1R7S A;  2WDR B;  1J7A A;  2WLB A;  4US8 A;  3KWL A;  3AE1 B;  4ZHO A;  1E6E B;  2M56 B;  3ETR A;  1FM0 D;  1T3Q A;  3HVZ A;  2WP9 B;  3EUB 2;  1FRD A;  1L6V A;  1PDX A;  1OFF A;  1NEK B;  2H88 B;  2L52 A;  4JX1 C;  2WDQ B;  3BII D;  5G5H A;  4KX6 B;  4YSX B;  1WWT A;  2KAJ A;  1FFV A;  1JW9 D;  1L5P A;  3SFE B;  1WYG A;  5G5G A;  4N6E B;  1SF0 A;  1XO3 A; 
#chains in the Genus database with same CATH topology
 2G4D B;  2KQ4 X;  2KWC A;  2KX3 A;  4MGZ E;  2NMQ A;  2BYE A;  4TMA B;  1GB1 A;  3AI5 A;  1XLQ A;  4HCN B;  1HQR D;  2DZK A;  5J2R A;  3DVG X;  5TSS A;  4OZB A;  2LUE A;  2NTS A;  1N60 A;  1WR6 E;  1JML A;  3Q69 A;  4BOZ B;  1V86 A;  3R3M A;  2D07 B;  2DZI A;  1BXT A;  1MHH E;  2JRI B;  4KZC A;  1ISN A;  3MJW A;  4RGN A;  2LWP A;  1JWU D;  2KDE B;  4W9J A;  2BBC A;  1QOG A;  3R7Q A;  1L6U A;  3U7D A;  3QX1 A;  2ICI A;  4ZRJ A;  2Q5W D;  3DVN U;  1V97 A;  3AEG B;  5D3D A;  2JWZ A;  4MEL A;  4PYU A;  1OEY J;  1WE6 A;  5E6J A;  2J7Q B;  3NZ3 A;  4BAX A;  3EGR A;  5AUI A;  4C4V B;  2MJE A;  3VH3 B;  4LDT D;  1U4A A;  2KLC A;  3MJ5 A;  1EF5 A;  2N1W A;  4HPP A;  4EKU A;  2PKO A;  3BVZ A;  3ECI A;  5CHW A;  4K7S A;  4B0E A;  2KC2 A;  2WNM A;  3AEB B;  4P7I A;  1WGR A;  1DOX A;  3AE3 B;  4LNO A;  4FA6 A;  3Q8C A;  3EHV A;  4FXC A;  1V49 A;  4C56 C;  1TS4 A;  2KZR A;  1YN5 A;  5E6N A;  3QCA A;  1ZPS A;  4HJG E;  4TSS A;  3A9K A;  3HIZ A;  2Y5P A;  4MGK E;  1K52 A;  4DDI D;  1PYW D;  1L6V A;  3SDL C;  3N30 A;  1C4A A;  3NZU A;  4ZRK A;  4ZYS A;  1C79 A;  1WYG A;  2R2Q A;  1I35 A;  3WCQ A;  1TIF A;  4E3C A;  2JUO A;  3B08 A;  4KDI C;  2MBQ A;  1YX6 B;  1WGH A;  3N1X C;  1JCK B;  2LJI A;  3C8Y A;  3SR6 A;  2ZPN A;  1PQS A;  1CK1 A;  4FAD A;  1UH6 A;  1D5Z C;  1CQV A;  1N5W A;  2M0X A;  3DDC B;  3IAM 1;  2E3T A;  4W9D A;  1OTR B;  4HKZ E;  2I1J A;  1PFD A;  1E10 A;  1UWX A;  4HWI B;  4IOI E;  1SE4 A;  5H92 C;  3NJT A;  4KGR A;  1BML C;  1WRI A;  1PGX A;  3PV1 A;  4WQO B;  2ZZP B;  1K8R B;  1WX8 A;  1QT9 A;  1MHX A;  4EEW A;  1UGJ A;  3X0W A;  3AE6 B;  5C2T B;  3ZO5 B;  2INN E;  3U52 E;  1R4M I;  5DPS A;  1GC6 A;  1C78 A;  2INP E;  1P98 A;  1GUA B;  2WXI A;  1S1Q B;  2WU2 B;  4S17 A;  3DWM A;  1WF9 A;  2G4S A;  3PPA A;  4GSW A;  4HLE A;  1NI2 A;  2BS2 B;  3I63 C;  1WYW B;  4GDK B;  4KIK B;  2PPH A;  3RNF C;  2PVO D;  1UF0 A;  1LGR A;  3I57 A;  2EKI A;  3T3O A;  1R7S A;  2BYF A;  2BTE A;  2B3A A;  4J3O D;  3HVZ A;  2D3B A;  2WDQ B;  5IA7 A;  3R7R A;  1OEY A;  3RYT A;  2N1V A;  1L4D B;  1WI0 A;  2KNB A;  4WJO A;  5AZG A;  4KKJ A;  1SIF A;  3KUD B;  3LB8 C;  1MVK A;  4L1B A;  1V8C A;  2OOB B;  4YTM B;  1JWB D;  3ZDT A;  1WXM A;  4MJS B;  1SE2 A;  4A6Q A;  4BBN F;  1HZ5 A;  2L05 A;  1ROE A;  2B76 B;  3J9C A;  5JH5 C;  3DWG C;  3AED B;  3NVY A;  4TV3 A;  3AEE B;  5G2N A;  4AS1 A;  4BKG A;  1HXY D;  3ENE A;  2G3Q B;  3H7S A;  3ZUN A;  3ZKJ C;  3L13 A;  1F0Z A;  4ARI A;  3M3J A;  2M17 A;  2BQQ A;  5AUK A;  2G45 B;  1WRD B;  4HRS A;  3I9V 1;  3LYY A;  2BB5 A;  5D6J B;  3A1Q B;  4LJP B;  1UBI A;  5FKA C;  2LVO A;  2LGX A;  3Q14 C;  1C1Y B;  4RMA A;  3ZRF A;  1LM8 B;  3L54 A;  4KV2 A;  3H7P A;  4WJN A;  3DCG A;  1WX7 A;  4ANU A;  2LD9 A;  1UGM A;  3Q8B A;  2KO3 A;  4A55 A;  2ZJD A;  3A9J A;  1WJ4 A;  5D2M B;  3R2T A;  2PLP A;  3KLS X;  3VTW A;  2RR9 A;  2N9E B;  1T6B X;  2KD0 A;  1E8Z A;  4HPL B;  1C4C A;  1WY8 A;  1IPG A;  2MP2 A;  3LXF A;  2KYW A;  3VH4 B;  1KM7 A;  1FMA D;  4IG7 B;  4ZYN A;  5IO9 A;  4BOS C;  2JU6 X;  4G0N B;  3BYT B;  3W5V B;  2CU1 A;  1SSN A;  3QQ8 B;  2REX A;  1Y8R C;  4XGA B;  5D3I B;  4XC2 A;  1YJ1 A;  1EU3 A;  1WSP A;  2A4Z A;  1FCC C;  3SU8 X;  1WWT A;  1FFV A;  3PVL A;  1SF0 A;  3R8B A;  1GJZ A;  2PTL A;  3QWZ B;  3ZDM C;  3JVZ X;  3OAW A;  3AE8 B;  3UQB A;  1I4Q A;  2EMT A;  3VDZ A;  3RFZ B;  4M01 A;  4JE3 B;  2ZW0 A;  2KVZ A;  2RMM A;  3VRA B;  1A70 A;  3RNB C;  2BS3 B;  1XQQ A;  2KKC A;  3S2A A;  1JAL A;  3JSV A;  5FR3 A;  3PGE A;  5HKH A;  3UIP B;  4TKN A;  1E8X A;  1FO4 A;  1OQQ A;  2FCM A;  1TZ1 A;  1TT5 B;  3QAR A;  1TTN A;  2X8X X;  2UU7 A;  4JWS C;  1ZDX A;  4YL8 A;  1ET9 A;  3HM3 A;  2W55 A;  5CHF A;  1NDD A;  3SFD B;  2XNA C;  3EA6 A;  4EZL A;  3GP7 A;  2J0M A;  1ZKH A;  3BWU D;  5J18 A;  2LEK A;  3NRZ A;  1P7F A;  2AX5 A;  2A5U A;  5JZE B;  3SEB A;  2K25 A;  2W54 A;  4NAW B;  5D7G A;  3ZNZ B;  1QLB B;  3TSS A;  3RMK C;  2E6X A;  2IND C;  3AV8 A;  2WDR B;  2WLB A;  3N1Y C;  3ETR A;  3TIX A;  2TSS A;  5JHA A;  1C4P A;  4A90 A;  2BWE S;  1OFF A;  4WAA A;  4P16 A;  4NQL B;  3RNE C;  1T5X D;  1STE A;  2JSV X;  5G5G A;  4B95 A;  3PZD A;  1HEZ E;  1T0Y A;  1CJE A;  2IZV B;  3L4P A;  3W9C B;  4WWO A;  2MLB A;  5TR5 A;  3V61 A;  4XDD A;  1F77 A;  1MI0 A;  3U7Z A;  3ZXV A;  2Z8L A;  4DHJ D;  2MBO A;  2KJH B;  3MHS D;  3QC8 B;  2L76 A;  3A4S C;  1RYJ A;  4OVU A;  2PVG C;  5FR6 A;  1L0Y B;  1QOB A;  4C7Y A;  2GLS A;  3PZ7 A;  5GXG B;  4BKS D;  3KW5 B;  4DBG A;  4YXD B;  2Z59 B;  3AUL A;  3OJ4 B;  3IHP C;  1VCB A;  2INC C;  3U4E G;  1KJT A;  1BUI C;  2C9W B;  3GZN I;  3NHE B;  4ANX A;  3KUZ A;  2KJR A;  2WXH A;  2DAJ A;  2LGY A;  4W9F A;  3PRM B;  2BVC A;  2DNF A;  4XE0 A;  1OQY A;  1TKY A;  3AU5 A;  4LJO B;  2W3S A;  3V05 A;  4P1C C;  3P4S B;  4EUT A;  2NTT A;  2KVR A;  3M63 B;  4GDL B;  2WXG A;  2ONQ A;  3NS8 A;  4E74 A;  2FUG 1;  1J8C A;  2EKE C;  2M19 A;  2QIL A;  1HTO A;  1TKG A;  3LJ3 A;  3NUH B;  3RUI B;  1CMX B;  3T3N A;  2QSD A;  1GG3 A;  2KDM A;  4CO7 A;  3IG3 A;  1PDX A;  3ZTC A;  3DBS A;  4JX1 C;  4DK5 A;  4KX6 B;  3Q8F A;  4M00 A;  2UWQ A;  5EE9 A;  1N62 A;  3CST A;  1SXT A;  3SD5 A;  4RCO A;  2AQ1 B;  3B2F A;  1PUT A;  4UDU C;  4W9H A;  3ZXR A;  3TEW A;  2Y5C A;  2RPQ A;  3T9L A;  1UBQ A;  3UF8 A;  4F7Z A;  2VH1 A;  1I42 A;  4MSM B;  3PHX B;  2QHO A;  4RGM A;  2NPT A;  5D94 A;  4C80 A;  1Q1O A;  3RZW C;  1XLP A;  2KFK B;  1ACC A;  3HM6 X;  2JT4 B;  3BZD B;  3QA8 A;  2GMI C;  4F8C B;  3VTU A;  3ZNG C;  2K8H A;  1R4N I;  2JRH A;  2O2V B;  1XCQ L;  2O6V A;  2FCQ A;  3JW0 X;  5CX3 A;  1ZXI A;  4XWW A;  5KHQ A;  3DBL I;  4I6P A;  3QK0 A;  2CKH B;  4EZK A;  2D3A A;  4FLH A;  4MT5 A;  4JIO U;  5H8Y E;  2LMC A;  4LNF A;  1JWS D;  1E8Y A;  2CHX A;  2IO1 B;  4LCD E;  2NBV B;  3PT2 B;  1IP9 A;  4PS7 A;  2N0S B;  4S0R A;  5GMV A;  1N61 A;  2WGS A;  2WXR A;  3A1Q A;  4FBJ B;  3W1S C;  3PO0 A;  4NAM A;  1SB3 C;  2CJO A;  3L16 A;  1NYR A;  4P6V F;  4W9C A;  2RDB C;  2DEN B;  4DHZ B;  3CIR B;  3ZW3 A;  1RWS A;  1SE9 A;  1L0X B;  2BYV E;  2D3G A;  1T3Q A;  1TS2 A;  5EDS A;  2SAK A;  3APD A;  3ZGZ A;  1LQB A;  3BII D;  2CHZ A;  2WX0 A;  2KTR B;  4N6E B;  4XX5 A;  2LJ5 A;  1WGK A;  2MJD A;  3Q6B A;  2IGD A;  4FN2 A;  1D4B A;  2L0F A;  3HRD D;  3BIN A;  4LNK A;  2W82 A;  1QOF A;  1YJI A;  4N58 A;  1NVI D;  1ZUD 2;  1C3T A;  2DYB A;  4RM9 A;  4DDG D;  3ZJT A;  2BGF A;  3IVF A;  4ARC A;  3L0W B;  4NQK E;  2GBN A;  3IAS 1;  2NCN A;  3V62 A;  3NOB A;  2Y5B B;  3AMZ A;  2KQ7 A;  3ZJU A;  5HI1 A;  2R61 A;  3AE2 B;  3APC A;  1S3S G;  2FAZ A;  2NBU A;  2N7E A;  1AYF A;  4RGT A;  3IT6 B;  2G9H D;  2VH2 A;  4ZRQ A;  4O1N A;  1OQR A;  2J0K A;  1MPE A;  4GMV A;  3A4R A;  3FIL B;  2L32 A;  2QJL A;  1ZDV A;  4ZRP A;  2DAF A;  3TMP B;  1N6Z A;  3NY5 A;  4MH8 A;  3B1L X;  5T8I A;  2VZK D;  3Q8A A;  2DYO A;  1NBF C;  1QF6 A;  4KGS A;  1YN4 A;  3AE4 B;  2J42 A;  3WAP A;  2OED A;  2JXX A;  2IY1 B;  4LK0 M;  1PGA A;  1R4M B;  4FHJ A;  1UEL A;  4IWP A;  3DBH I;  2ACZ B;  2ZEQ A;  4RF0 A;  3H8H A;  4G3X B;  3AE1 B;  1MFW A;  1WX9 A;  1FM0 D;  5E6P A;  2KN5 A;  2L52 A;  2IYD B;  2V3S A;  2AEH A;  4HDQ A;  1KOT A;  2KAJ A;  1WXS A;  2DZJ A;  3SFE B;  4A8X C;  1IBX B;  1XCT L;  2H89 B;  3N9Y C;  1GAQ B;  4IWO A;  3OLM D;  4K7U A;  4JWU C;  2GBJ A;  3Q3N C;  1YQ4 B;  2YEP F;  1WE7 A;  2FNJ B;  2ZPY A;  3RUL A;  3ZVV A;  4P1B C;  2OHF A;  3CSF A;  3PLV A;  1F2R C;  1UZX B;  1KLU D;  3NVV A;  2I2Y A;  2K5P A;  1HZ6 A;  2MSE D;  4WIP A;  4YTN B;  4AP4 C;  3CWI A;  3QJZ A;  2XBB C;  2M4N A;  3ZJV A;  2Z0E B;  5HHD G;  3V60 A;  3AN1 A;  1E7U A;  1V1P A;  1ENF A;  1WMH B;  3M62 B;  1EWC A;  4DHJ B;  2JZZ A;  2WS3 B;  2L3Z A;  2I38 A;  1D5X C;  4IWQ A;  1JQ4 A;  3DHG C;  1Z5S B;  1UNS A;  5IN7 A;  5AZF A;  2HD5 B;  4OZC A;  1ET6 A;  1IGD A;  4HRO A;  4YTP B;  1WFY A;  4L2Y A;  4RM8 A;  2XK5 B;  4HEA 1;  3E9S A;  4I6N B;  5G55 A;  2WWZ A;  3QAQ A;  2V3N A;  3C19 A;  4CQN A;  4G11 A;  3BK2 A;  2DBY A;  3TL5 A;  3DVG Y;  3UIN B;  1K50 A;  1IUE A;  4PS3 A;  4FUL A;  3VUY A;  1DGJ A;  1ZP0 B;  3OJ3 A;  3Q3J A;  1I4H A;  2MCN B;  3ZTD A;  1P9D U;  2NBW B;  3FAH A;  1J7B A;  1GC7 A;  3DHH C;  4N59 A;  4WJP A;  4DXF A;  2JF5 A;  4GDL A;  1LO5 D;  3RNA C;  4K7W A;  2GBM A;  2DLB A;  2JZ3 B;  2QEJ C;  2KJ6 A;  3EEC A;  2IO2 B;  4WJQ A;  1TJE A;  1L0V B;  1WXQ A;  4WWN A;  3N32 A;  3HVD A;  4I6L B;  4AWJ A;  5L83 A;  4DXA B;  3NVW A;  4MM3 A;  2IGH A;  4US9 A;  5BMI A;  3VTV A;  2AQ3 B;  2M8S A;  3BVM A;  2AYO B;  3V3X A;  5JXV A;  1LFD A;  4MGI E;  1QQR A;  4AJW A;  1TKE A;  3HK0 A;  4BZA A;  2WQY B;  2ZCC A;  1V81 A;  1VZ7 A;  2LVQ A;  3OG5 A;  1YJJ A;  5AEK B;  2WXF A;  1KLV A;  3Q3M C;  3RD2 A;  3A9K B;  1TYG B;  4KVG B;  2DZM A;  2K6Q A;  3RCZ A;  1FXI A;  2KT7 A;  4XZ4 A;  4FJZ A;  3T8M A;  4II2 B;  2K6D B;  2JPH A;  1YN3 A;  4IKG A;  2BT6 A;  4N9F 4;  1HE8 A;  1RFA A;  2N7D A;  4HVB A;  2PE6 B;  3TEZ A;  3X23 A;  1Q5W B;  1WJU A;  3I3T B;  3TUO A;  5HG2 A;  3MP9 A;  4NJ6 A;  5IOI A;  1LXD A;  2LHE A;  1WIA A;  1NI3 A;  4KZ0 A;  4DHZ E;  2K1F A;  2KDF B;  2WX1 A;  3E56 A;  1VR9 A;  4KGT A;  1T0Q C;  3AU4 A;  2PEA A;  2HTM E;  1V5T A;  4OVV A;  5EE1 A;  3PRP B;  2DWQ A;  3DBR I;  1J0G A;  2V9H A;  4ITK A;  1M4V A;  1J19 A;  4TQ1 A;  3IXS A;  4W9I A;  4IC7 B;  1WGD A;  4C4V A;  1E90 A;  5C3J B;  1TBE A;  2IJ0 A;  3QHT A;  2D3C A;  2K9X A;  1AW7 A;  2BKR B;  1WR1 A;  1WJN A;  4TQ0 A;  2K8B A;  2C7N B;  4ICV A;  2L8J A;  4HPM B;  5BMG A;  3KWV A;  3MC8 A;  1J7C A;  3RPF C;  3W5U B;  2KOX A;  4HXD A;  4KDL B;  4IDI A;  4WQM A;  1VJK A;  5J17 A;  2RD0 A;  2HE7 A;  1ZOY B;  1C9F A;  2MWS B;  4JLC A;  3IBE A;  1JRU A;  2FCS A;  4MAC A;  4BFR A;  4ACF A;  1KRH A;  4K1R B;  2WXL A;  2KMC A;  1VZ8 A;  1SJE D;  2X38 A;  3K9O B;  2WXM A;  1XXG A;  4GU2 A;  3VRB B;  5C1Z A;  1L2N A;  2O6V D;  3ZLZ A;  4YSY B;  4K3C A;  3B2G A;  1EUV B;  3PS6 A;  3GZN B;  1UWM A;  3U8Z A;  4URK A;  4K3B A;  4GIV A;  2ZNV B;  2LI5 A;  4IM0 A;  2N9X A;  3AE7 B;  2NR2 A;  2ZVO A;  4NZL B;  1J7A A;  3FKY A;  3KWL A;  2FE8 A;  4ASW C;  1WM3 A;  2VZK B;  1XF5 L;  1L5P A;  2C60 A;  3MHZ A;  1P3Q U;  2RGF A;  2BKF A;  4GN1 A;  3ZQ4 A;  1TS5 A;  1TZO A;  3A9J B;  3R66 C;  2AL6 A;  1FCL A;  2MW5 A;  4D2K A;  2KTF A;  5BYS A;  3HUI A;  2MP2 B;  3MTN B;  1KFY B;  4MSQ B;  2GBK A;  4GDK A;  2JQR B;  4KIK A;  4EFO A;  1V6E A;  1ZW7 A;  1XLO A;  4AQ7 A;  1E0Z A;  2QDF A;  4GGQ A;  3NVZ A;  5CTR C;  3UI3 A;  3DVN V;  4HK2 A;  1L4Z B;  3PTF C;  4QAY A;  1X1M A;  2V0G A;  2KDB A;  3VXW A;  5KHO A;  3H1U A;  5LNK 1;  1DYQ A;  2IO0 B;  2KMM A;  4IM3 A;  1PGB A;  3VAW A;  1H8C A;  5CHV C;  4NJ7 A;  5FK9 C;  3EFC A;  1EO6 A;  2Z0D B;  2LZ6 A;  5BYR A;  3ML9 A;  4WH4 A;  4MJS A;  1R4N B;  4ZOH C;  1V2Y A;  3H9D A;  2N9L A;  2MBH A;  2YLM A;  3PZ8 A;  2GI9 A;  2K22 A;  2PJH A;  1Q0W B;  1Q10 A;  3MFG A;  2IO3 B;  2NVU I;  2FBW B;  3DBL B;  5LLI A;  5DCN A;  1AN8 A;  4KSL C;  1ZGU B;  2XK5 A;  1K51 A;  3VUW A;  5JHB A;  2UYZ B;  4BKS A;  2WDV B;  3JSV B;  4PT5 A;  2LGS A;  2D5G A;  3HHM A;  1YQB A;  3TCA A;  3N3K B;  2KC1 A;  4US8 A;  1SBB B;  3N20 C;  3IT4 B;  5E6O A;  2KX0 A;  5G5H A;  1Y56 A;  1I4G A;  1K53 A;  2K3U A;  2AQ2 B;  1A5R A;  1YQ3 B;  2L83 A;  4DXG A;  2LHD A;  3PLU A;  3PRZ A;  2LGD A;  4JL9 A;  3NS1 A;  3L08 A;  1FNV A;  2J0J A;  1WZ3 A;  2PE9 A;  1EU4 A;  2V4L A;  4M0W B;  1I4X A;  4C7Z A;  3BYY B;  2J52 A;  2J53 A;  1OGW A;  4WWM A;  2WDT B;  2BS4 B;  1F52 A;  3P2B A;  5MPO A;  2WU5 B;  2R2O A;  1FRR A;  1FFU A;  1SJH D;  2Y3A A;  1XT9 B;  2KN4 A;  2D11 A;  5L95 C;  1QIL A;  3AH7 A;  4XYC A;  4HJK A;  5DPW A;  2MEK A;  4LTU A;  2MQJ A;  2KXJ A;  1DOI A;  3KYD D;  3TEY A;  1RRB A;  4E71 A;  4EOY A;  1D5M C;  2EMS A;  2IPK D;  3AE5 B;  2MBE A;  3WAM A;  2WXJ A;  4G50 A;  1NYQ A;  4NPN A;  3U30 A;  1GOZ A;  2LXC A;  1EWY C;  2IGG A;  3V6C B;  3GB1 A;  1QKZ A;  4NY0 A;  3M95 A;  4REZ A;  1I4R A;  4WUR A;  2BPS A;  2KLG A;  4XWT A;  5LXH A;  2XN9 C;  3W1S A;  2N7J A;  3VR9 B;  2LRU A;  4RFB A;  3RNC C;  4PK1 A;  4DWF A;  2IY0 B;  4MDK E;  4GLS C;  4ANV A;  1XLN A;  3O13 A;  1VDV A;  3EFU A;  3Q2A C;  4OW0 A;  1H4R A;  4EZJ A;  1WGG A;  4ZHO A;  2M56 B;  2I1K A;  4W9E A;  2AWT A;  3V6E B;  4YSZ B;  2MH7 A;  2N9K A;  1MG4 A;  4CHK A;  1VLB A;  3PSE B;  4R3D A;  5BMH A;  4C00 A;  2QMT A;  2NS5 A;  3DBH B;  3SHQ A;  3P42 A;  3PRE A;  4A3P A;  3AEA B;  2FCN A;  4W9L A;  4TUU A;  1WZ0 A;  1YOV B;  2WXQ A;  2KFJ A;  2ZNV C;  1QOA A;  4NAW A;  1VD2 A;  1JRP A;  1IYF A;  3DHI C;  3BK1 A;  1D6E C;  1YNT E;  1ZE3 D;  1KLG D;  4OZA A;  4W9K A;  2DX5 B;  2KHW B;  2CR5 A;  1FEH A;  1TGZ B;  2L0T A;  1RAX A;  2ON8 A;  3L17 A;  4BBN C;  4XDC A;  1HA5 A;  2CS4 A;  2BW2 A;  1VZ6 A;  3APF A;  3GE8 C;  3VVW B;  3KQ4 A;  2XEW A;  1GNU A;  2WXN A;  4CYE A;  5HFY A;  1YMH E;  1RLF A;  1E9M A;  4W9G A;  1I4P A;  2HJ8 A;  1TY2 A;  2YVC A;  1SIJ A;  2JYT A;  4RH6 A;  1P7E A;  4GB9 A;  3AEC B;  3EC8 A;  2DYM A;  2C7H A;  2NPT B;  3DPD A;  1IGC A;  2J4X A;  3GOE A;  2HDE A;  1E7V A;  4USA A;  2W9N A;  1N63 A;  1KH0 A;  2RDH A;  4ZDV A;  2O6V B;  2ASQ A;  3Q3F A;  1T0R C;  2BF8 B;  1C77 A;  2WP9 B;  4FJY A;  2H88 B;  4DQO C;  4JPS A;  2IBI B;  2M1M A;  4IUM B;  1YIW A;  4MEM A;  3KVF B;  2C5L C;  4AUQ C;  3N1Z C;  1P0R A;  4HDO A;  2RPV A;  4OVZ A;  1E5W A;  5AZH A;  2V4I B;  4LNN A;  4KSK C;  2AL3 A;  4WAF A;  1GB4 A;  4RGO S;  1B9R A;  3WAL A;  3TEX A;  1SGH A;  3VFK A;  4L23 A;  4ANW A;  2JVC A;  1FXT B;  1DOY A;  2FUH B;  1WH3 A;  2KWD A;  4Q2J A;  3P4R B;  2JWU A;  4WWP A;  3K9P B;  1T0S C;  3P4Q B;  4JGH B;  3LDZ E;  1UUP A;  2MA9 B;  4H2A A;  3AM9 A;  3AE9 B;  3BVG A;  1GPX A;  5I4D A;  3BY4 B;  1FXA A;  2PW9 A;  1NEN B;  2VRR B;  2QCZ A;  2LAS A;  3PHW B;  4M8M A;  3I5J C;  2IDY A;  4ICU A;  1D3Z A;  1V80 A;  2RDG A;  1FNU A;  3B9J A;  4PS8 A;  1MJD A;  1WGY A;  2ZW1 A;  2WXO A;  3ZNH B;  4LNI A;  1AWD A;  3GE3 C;  1E7P B;  2K0P A;  2BYT A;  1YX5 B;  2LGI A;  1EF1 A;  1FIQ A;  1FNW A;  2G1E A;  2WHI A;  2KFK A;  2RSU A;  1YD8 U;  2LUM A;  1RM6 C;  1JWM D;  4JQW C;  1WXV A;  1F1H A;  4HKQ A;  2N9P C;  2KAN A;  3NZS A;  3P63 A;  4IM2 A;  4A9A A;  3ZYY X;  3D32 A;  2KQS A;  2O2V A;  2SEB D;  5DPT A;  2OJR A;  5IKC M;  1TS3 A;  2KWU B;  3ALB A;  4AJY B;  3EUB 2;  1FRD A;  2HTH A;  1NEK B;  2WYQ A;  5C23 A;  2MRP A;  1JW9 D;  5BYQ A;  3NG0 A;  1XO3 A;  3KH0 A;  2K39 A;  2D10 A;  1ZXH A;  1V9J A;  3RN9 C;  1XEE A;  2MHJ A;  2C7M B;  1P1A A;  3DBR B;  2L7R A;  3IFW B;  3L10 B;  2OJW A;  2GBR A;  2D2Q A;  3P4P B;  3AB5 A;  3RT3 B;  4RF1 A;  2FIF A;  4M8N A;  4X57 B;  3WIM A;  1KF6 B;  1UD7 A;  2CHW A;  4II3 B;  2KAC A;  4YSX B;  2JZP A;  2BWF A;  1V1O A;  1VRA B;  3A33 B;  1SEB D;  1C76 A;  4BKT A;  5LXI B;  3WAN A;  1CZP A;  3QIJ A;  3URY A;  3MC9 A;  3VHT C;  3ZIM A;  4ZRI A;  4M0W A;  2V3P A;  2KTR A;  2QIE B;  4KKI A;  4LDT B;  2GOW A;  3Q8E A;  3ONS A;  2V1Y A;  3OWE B;  4FHK A;  3ABV B;  4OHJ A;  3WA0 A;  3C0R B;  4B0M A;  1V5O A;  2W3R A;  3RNG C;  3AEF B;  3VR8 B;  2EEL A;  5IP4 D;  4NNJ B;  2JY6 A;  5EE3 A;  1E8W A;  1RFK A;  5IAA C;  4BVU C;  2JYE A;  3RZF A;  1WXA A;  3ZNI D;  2GB1 A;  4B6W A;  1V1P B;  1E6E B;  1BT0 A;  3Q3O C;  3MC0 B;  4A3O A;  3ML8 A;  2KMA A;  4RNA A;  1FPY A;  2JX5 A;  1SE3 A;  1L7Y A;  4ZHP A;  2YEP B;  3FIL A;  4K81 A;  3VUX A;  2ZVN A;  2GRI A;  4F1S A;  4AOF A;  1HTQ A;  2PIA A;  3WAO A;  3KYC D;  2LXA A;  2MBB B;  2WXP A;  2L1A A;  2PMV A;  2WXK A;  4YWG G;  1AAR A;  3ZRC A;  3CMM B;  3W2D A;  4IW0 A;  1F9J A;  3B0A A;  3UQA A;  1M94 A;  3U2S C;  3H7P B;  1JWA D;  1MG8 A;  3AXC A;  4EE2 A;  2KWV B;  1XD3 B;  1WJ6 A;  4MH0 E;  3P1M A;  4PYZ A;  3R2I A;  1N5X A;  2ZCB A;  2KK8 A;  2FID A;  1G6J A;  4NJC A;  3RI7 C;  1QZE A;  2K8C A;  3JYU A;  1FD6 A;  5BO4 B;  2MJ3 A;  1IBX A;  4B9K A;  1F2R I;  2L00 B;  4GOC A;  3UIO B;  4HCP B;  3FC4 A;  3H6N A;  3GS2 A;  4A20 A;  5DPR A;  4M02 A;  1I7H A;  4MGY E;  1TY0 A;  2LVP A;  4LLG M;  3TJP A;  3VQI A;  2MX2 A;  1WM2 A;  3DOW A;  4MM3 B;  3W1Y A;  2QC8 A;  2JXT A;  3KUC B;  5EE0 A;  1JRO A;  3UGB B;  2BB6 A;  3O65 B;  2KDI A;  2CJN A;  4YT0 B;  2DHZ A;  2CU3 A;  2LFI A;  4J6I A;  4FJV B;  1ESF A;  3DQV A;  4GXB A;  2HJ1 A;  1WMH A;  2LRW A;  1KTK A;  3TBL D;  1B1Z A;  2N4F A;  1EM7 A;  2M0A A;  1Z2M A;  3CF6 E; 
#chains in the Genus database with same CATH homology
 2N9K A;  1CJE A;  2KQ4 X;  2QEJ C;  2NMQ A;  3L4P A;  4TMA B;  3W9C B;  1GB1 A;  1VLB A;  4R3D A;  1TJE A;  5BMH A;  1L0V B;  2QMT A;  1WXQ A;  1XLQ A;  1HQR D;  4XDD A;  3HVD A;  3P42 A;  5TSS A;  4OZB A;  1F77 A;  2NTS A;  1N60 A;  1MI0 A;  3NVW A;  3AEA B;  1JML A;  2IGH A;  3Q69 A;  3U7Z A;  2Z8L A;  4US9 A;  5BMI A;  2AQ3 B;  3BVM A;  2WXQ A;  3V3X A;  1QOA A;  1BXT A;  1MHH E;  5JXV A;  1RYJ A;  1QQR A;  4RGN A;  1JWU D;  1JRP A;  1TKE A;  2BBC A;  2PVG C;  2WQY B;  1QOG A;  3BK1 A;  1VZ7 A;  1L0Y B;  1L6U A;  1QOB A;  4C7Y A;  1YJJ A;  1D6E C;  3PZ7 A;  1YNT E;  5GXG B;  1ZE3 D;  2WXF A;  2ICI A;  2Q5W D;  1KLG D;  4OZA A;  1V97 A;  4YXD B;  1FEH A;  3AEG B;  5D3D A;  1TYG B;  3U4E G;  5E6J A;  1BUI C;  3NZ3 A;  1FXI A;  3EGR A;  5AUI A;  2MJE A;  2ON8 A;  4XDC A;  1HA5 A;  2BW2 A;  1VZ6 A;  1YN3 A;  4IKG A;  3MJ5 A;  2WXH A;  3KQ4 A;  2BT6 A;  2PKO A;  2WXN A;  3BVZ A;  5HFY A;  4B0E A;  3TEZ A;  1YMH E;  4XE0 A;  1E9M A;  1TKY A;  1I4P A;  2WNM A;  1TY2 A;  3TUO A;  5HG2 A;  3AEB B;  3MP9 A;  2W3S A;  3V05 A;  1SIJ A;  2JYT A;  4RH6 A;  1P7E A;  2LHE A;  3P4S B;  2NTT A;  1DOX A;  3AEC B;  3AE3 B;  4GDL B;  3Q8C A;  2WXG A;  1NI3 A;  4FXC A;  2DYM A;  2ONQ A;  4C56 C;  1IGC A;  2J4X A;  3E56 A;  1TS4 A;  1VR9 A;  4KGT A;  2HDE A;  1YN5 A;  2HTM E;  4USA A;  2FUG 1;  5EE1 A;  1N63 A;  1ZPS A;  1KH0 A;  2M19 A;  2RDH A;  2QIL A;  2DWQ A;  4HJG E;  1TKG A;  4TSS A;  4ITK A;  3NUH B;  3T3N A;  2Y5P A;  2QSD A;  1M4V A;  2KDM A;  1C77 A;  2WP9 B;  1K52 A;  1PYW D;  4TQ1 A;  1L6V A;  1PDX A;  3IXS A;  2H88 B;  4JX1 C;  1C4A A;  4DQO C;  4JPS A;  4KX6 B;  4ZYS A;  3Q8F A;  1C79 A;  1WYG A;  5EE9 A;  1N62 A;  3WCQ A;  1SXT A;  4RCO A;  2AQ1 B;  3B2F A;  2RPV A;  1PUT A;  4OVZ A;  5C3J B;  4UDU C;  2V4I B;  2IJ0 A;  2K9X A;  4WAF A;  1GB4 A;  1AW7 A;  4RGO S;  1JCK B;  2LJI A;  3C8Y A;  1B9R A;  3SR6 A;  3TEW A;  3TEX A;  2Y5C A;  4TQ0 A;  1CK1 A;  4L23 A;  1D5Z C;  1CQV A;  1DOY A;  1N5W A;  4RGM A;  2KWD A;  5BMG A;  4C80 A;  3IAM 1;  1XLP A;  2E3T A;  4Q2J A;  3KWV A;  3P4R B;  4HKZ E;  1ACC A;  1PFD A;  1E10 A;  1UWX A;  2JWU A;  1J7C A;  3BZD B;  4IOI E;  1SE4 A;  3RPF C;  5H92 C;  3P4Q B;  3W5U B;  1UUP A;  4KGR A;  1BML C;  1WRI A;  1PGX A;  1XCQ L;  4IDI A;  4WQM A;  4H2A A;  1VJK A;  3AM9 A;  1ZOY B;  1C9F A;  3AE9 B;  3BVG A;  1ZXI A;  1GPX A;  4XWW A;  1QT9 A;  5I4D A;  1MHX A;  1FXA A;  2PW9 A;  1NEN B;  1UGJ A;  3AE6 B;  4MAC A;  5C2T B;  2INN E;  3U52 E;  4MT5 A;  2IDY A;  1KRH A;  1C78 A;  5H8Y E;  2LMC A;  1JWS D;  2INP E;  2RDG A;  2WXL A;  1FNU A;  1VZ8 A;  1SJE D;  2WXI A;  3B9J A;  2N0S B;  2X38 A;  2WXM A;  1XXG A;  1N61 A;  2ZW1 A;  2WXR A;  3VRB B;  2WU2 B;  2WXO A;  3DWM A;  1AWD A;  1E7P B;  2K0P A;  3PO0 A;  2BYT A;  4NAM A;  4YSY B;  2LGI A;  2BS2 B;  1FIQ A;  4GDK B;  1SB3 C;  2CJO A;  1FNW A;  2G1E A;  1NYR A;  4P6V F;  3B2G A;  2LUM A;  1RM6 C;  1JWM D;  1UWM A;  2PVO D;  4HKQ A;  3P63 A;  4A9A A;  3ZYY X;  3CIR B;  3I57 A;  2EKI A;  1RWS A;  2SEB D;  3T3O A;  3AE7 B;  1L0X B;  1TS3 A;  1R7S A;  4NZL B;  1J7A A;  3KWL A;  2BTE A;  2FE8 A;  4J3O D;  3HVZ A;  1T3Q A;  1TS2 A;  3EUB 2;  1FRD A;  2SAK A;  2VZK B;  1NEK B;  1XF5 L;  3ZGZ A;  2WDQ B;  3BII D;  1JW9 D;  1L5P A;  5BYQ A;  4N6E B;  1L4D B;  1XO3 A;  3MHZ A;  1WGK A;  2MJD A;  2IGD A;  1D4B A;  3HRD D;  4KKJ A;  3LB8 C;  3ZQ4 A;  1MVK A;  2W82 A;  1QOF A;  1YJI A;  1TS5 A;  1ZXH A;  4L1B A;  1TZO A;  1V8C A;  4N58 A;  1NVI D;  4YTM B;  1JWB D;  1XEE A;  1FCL A;  1ZUD 2;  1SE2 A;  4A6Q A;  1HZ5 A;  4D2K A;  1ROE A;  5BYS A;  3HUI A;  2B76 B;  3J9C A;  3ZJT A;  1KFY B;  3DWG C;  3AED B;  3NVY A;  2JQR B;  3AEE B;  3P4P B;  3AB5 A;  4ARC A;  4RF1 A;  1XLO A;  4AQ7 A;  4AS1 A;  1E0Z A;  1HXY D;  3UI3 A;  1KF6 B;  3NVZ A;  3IAS 1;  4YSZ B;  1L4Z B;  2KAC A;  3AMZ A;  4YSX B;  2V0G A;  3ZJU A;  5HI1 A;  1F0Z A;  2R61 A;  4ARI A;  2JZP A;  1V1O A;  1VRA B;  3AE2 B;  1SEB D;  5AUK A;  1C76 A;  4HRS A;  3I9V 1;  3LYY A;  2BB5 A;  5LNK 1;  1DYQ A;  1CZP A;  1AYF A;  4RGT A;  3URY A;  2KMM A;  5FKA C;  1PGB A;  3IT6 B;  2G9H D;  4M0W A;  2V3P A;  4ZRQ A;  2QIE B;  4KKI A;  4O1N A;  3Q8E A;  1OQR A;  5FK9 C;  3OWE B;  3Q8B A;  4A55 A;  1MPE A;  2PLP A;  3KLS X;  3R2T A;  5BYR A;  3ABV B;  1T6B X;  2L32 A;  3FIL B;  4OHJ A;  2QJL A;  4WH4 A;  1ZDV A;  4ZOH C;  4ZRP A;  2N9L A;  1C4C A;  4B0M A;  2W3R A;  3AEF B;  3PZ8 A;  3VR8 B;  2EEL A;  3LXF A;  2GI9 A;  2K22 A;  4MH8 A;  1Q10 A;  3MFG A;  1FMA D;  5T8I A;  2VZK D;  3Q8A A;  2FBW B;  2DYO A;  1QF6 A;  4KGS A;  1YN4 A;  3AE4 B;  2J42 A;  5EE3 A;  1AN8 A;  2OED A;  2JU6 X;  1RFK A;  3BYT B;  4LK0 M;  1PGA A;  3W5V B;  2JYE A;  1K51 A;  2ACZ B;  2WDV B;  4PT5 A;  1SSN A;  2D5G A;  2GB1 A;  4RF0 A;  3H8H A;  4US8 A;  5D3I B;  3AE1 B;  1SBB B;  1E6E B;  1V1P B;  1FM0 D;  1EU3 A;  1WSP A;  3IT4 B;  3MC0 B;  2L52 A;  5G5H A;  1FCC C;  2KAJ A;  1WWT A;  1FFV A;  1Y56 A;  4RNA A;  3SFE B;  4A8X C;  1IBX B;  1I4G A;  1SF0 A;  1XCT L;  3R8B A;  2H89 B;  1K53 A;  2K3U A;  3N9Y C;  2PTL A;  2JX5 A;  2AQ2 B;  1GAQ B;  1SE3 A;  1YQ3 B;  2L83 A;  4JWU C;  3AE8 B;  4DXG A;  2LHD A;  4ZHP A;  2YEP B;  3FIL A;  1I4Q A;  1YQ4 B;  2YEP F;  2GRI A;  3RFZ B;  3NS1 A;  1FNV A;  2OHF A;  4JE3 B;  2ZW0 A;  2PIA A;  2RMM A;  2WXP A;  1F2R C;  2L1A A;  2PMV A;  3VRA B;  2WXK A;  1KLU D;  3NVV A;  4YWG G;  2K5P A;  1HZ6 A;  2I2Y A;  1EU4 A;  4WIP A;  3W2D A;  4YTN B;  1I4X A;  1A70 A;  4C7Z A;  2BS3 B;  3BYY B;  3U2S C;  2J52 A;  1JWA D;  3CWI A;  2J53 A;  4EE2 A;  4WWM A;  2BS4 B;  3P1M A;  1JAL A;  5MPO A;  3ZJV A;  3R2I A;  5FR3 A;  1N5X A;  2WU5 B;  5HHD G;  1FRR A;  1FFU A;  1SJH D;  1FO4 A;  3AN1 A;  1OQQ A;  2Y3A A;  4NJC A;  1V1P A;  1ENF A;  2KN4 A;  1FD6 A;  1QIL A;  1EWC A;  3AH7 A;  4JWS C;  2WS3 B;  1ZDX A;  2I38 A;  1ET9 A;  2MJ3 A;  1D5X C;  2MEK A;  4LTU A;  1F2R I;  1IBX A;  1JQ4 A;  1UNS A;  2W55 A;  1DOI A;  3TEY A;  4OZC A;  3FC4 A;  1ET6 A;  1IGD A;  4HRO A;  3SFD B;  2XNA C;  1D5M C;  3EA6 A;  4YTP B;  3GP7 A;  4L2Y A;  3GS2 A;  2IPK D;  4HEA 1;  3AE5 B;  3BWU D;  3E9S A;  2WXJ A;  2LEK A;  3NRZ A;  1P7F A;  2V3N A;  1I7H A;  1NYQ A;  4CQN A;  1GOZ A;  2AX5 A;  1TY0 A;  1EWY C;  2IGG A;  3BK2 A;  4LLG M;  3GB1 A;  1QKZ A;  3VQI A;  4REZ A;  2DBY A;  1I4R A;  4WUR A;  4XWT A;  4MM3 B;  1K50 A;  2XN9 C;  3SEB A;  3W1S A;  1IUE A;  2N7J A;  2W54 A;  2JXT A;  3VR9 B;  4RFB A;  1DGJ A;  5EE0 A;  4NAW B;  4GLS C;  1JRO A;  1ZP0 B;  2BB6 A;  1I4H A;  1XLN A;  3O13 A;  5D7G A;  2CJN A;  1VDV A;  4YT0 B;  1QLB B;  3TSS A;  2CU3 A;  4OW0 A;  2E6X A;  1J7B A;  2LFI A;  3FAH A;  3AV8 A;  4N59 A;  1ESF A;  2WDR B;  2WLB A;  4DXF A;  4ZHO A;  2M56 B;  1KTK A;  3ETR A;  1B1Z A;  2TSS A;  1LO5 D;  1C4P A;  1EM7 A;  2M0A A;  4A90 A;  1OFF A;  4P16 A;  1T5X D;  1STE A;  2JSV X;  5G5G A;  1HEZ E;  2MH7 A;  2DLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...