3LXFA

Crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRLPALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Molecular characterization of a class I P450 electron transfer system from Novosphingobium aromaticivorans DSM12444
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Metal binding protein
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lxfA00
4A9AA 1JW9D 1FRRA 2FBWB 1J7BA 2WU5B 3AN1A 2WLBA 3NVYA 4N59A 3VR8B 1E6EB 5MPOA 1FFUA 3HUIA 1FIQA 1A70A 3CWIA 3SFEB 1FXAA 5C3JB 1PUTA 2K22A 3P63A 1R7SA 2MJ3A 1WRIA 3AEBB 4P6VF 1L5PA 3AE9B 1YJIA 1QOGA 2PVOD 4JX1C 2QIEB 3AEEB 3ZYYX 4KX6B 1B9RA 1N5XA 3VRAB 1XLOA 1N60A 1WWTA 1E9MA 5G5HA 1WYGA 1KFYB 4YSXB 3BIID 1N62A 4USAA 3W5VB 1CZPA 1N63A 2QJLA 2WDVB 3P1MA 1JRPA 3AE2B 4N58A 1FM0D 3HRDD 2AX5A 2BS3B 2W3SA 3B2GA 4ZHOA 1YQ3B 1VDVA 3AE6B 1FO4A 1F0ZA 1VJKA 1J7CA 2W54A 1TKEA 1DOXA 1NEKB 1TKYA 2EKIA 4YXDB 1L6UA 5H8YE 2JQRB 5EE1A 3SR6A 1XLPA 1IUEA 1AYFA 2K5PA 3P4SB 2Y5CA 3AM9A 2KAJA 4ITKA 4LTUA 5AUIA 1E10A 2JX5A 1DOIA 4HROA 3P4QB 1PFDA 2H88B 1FRDA 1DOYA 1ZP0B 1AWDA 2PVGC 2WU2B 1TKGA 3EUB2 2OHFA 1FMAD 1NYQA 2L52A 5EE3A 1FXIA 3SFDB 2LEKA 2PIAA 3AEAB 4WWMA 1RM6C 4C7YA 3B2FA 1JWAD 3AH7A 3NRZA 3NVZA 5EE9A 2DWQA 2HTME 3LXFA 1ROEA 4JWUC 5C2TB 3L4PA 1XLNA 1QF6A 2WDQB 1PDXA 1L6VA 1RYJA 2DBYA 2G1EA 1NENB 1JALA 2M19A 3VR9B 1QOFA 2BT6A 1I7HA 3RPFC 2CJOA 1KF6B 2BS4B 5EE0A 2MJEA 3AE4B 4YSYB 1OQRA 1ZUD2 1JWBD 1TJEA 3DWGC 4JWSC 3AEGB 2PKOA 1OFFA 3AMZA 3W5UB 1UWMA 4C80A 3VRBB 1QOAA 1JROA 1EWYC 1SF0A 2CU3A 2BS2B 4YSZB 1FFVA 4ZHPA 2WQYB 1QLBB 4HRSA 4YTPB 2L83A 5G5GA 3DWMA 5AUKA 4FXCA 3AB5A 3AE7B 3P4PB 2W3RA 4YT0B 2KMMA 1V97A 1RWSA 1XO3A 5H92C 1T3QA 4WQMA 4C7ZA 2WS3B 1QT9A 4US8A 4US9A 2ACZB 3ETRA 2K9XA 3P4RB 1JQ4A 2B76B 2MH7A 3PO0A 1CJEA 1SB3C 4YTMB 3AE3B 1XLQA 3WCQA 1E7PB 1L0VB 1ZOYB 2MJDA 2W55A 3AE1B 4IDIA 3AEDB 1J7AA 2M56B 3FC4A 1KRHA 3FAHA 1E0ZA 1QOBA 1RFKA 1ZXIA 2E3TA 2WP9B 4N6EB 1NVID 2Q5WD 3AE8B 3AEFB 3CIRB 3NVVA 1WGKA 3NVWA 1DGJA 3HVZA 1VLBA 1YQ4B 1TYGB 2N0SB 1GPXA 1NYRA 3AE5B 1SIJA 3ABVB 1V8CA 3KWLA 3AECB 3NS1A 3W9CB 1N5WA 1NI3A 1OQQA 2CJNA 4YTNB 3B9JA 2WDRB 1YJJA 1GAQB 3AV8A 1WXQA 2H89B 5GXGB 1N61A 3LB8C 4ZOHC
chains in the Genus database with same CATH superfamily
2LUMA 4REZA 4EZLA 2XK5A 1RLFA 3ZNZB 4K7UA 5FKAC 4GDLB 2D07B 2EMSA 2BVCA 1F2RI 1L5PA 2BYEA 4KX6B 5AZHA 1N5XA 1UGJA 1KJTA 5J18A 4IC7B 3A9JA 2QJLA 2GLSA 1SIFA 5L95C 2IO3B 2E6XA 4HEA1 5BMHA 4ZHOA 1VDVA 3PS6A 4GU2A 1BMLC 1SXTA 3A9KA 3NZ3A 4M8NA 3SR6A 1V80A 4HROA 1JRUA 3VH3B 4HJGE 1LM8B 1DOYA 1VR9A 3SHQA 3GS2A 4NPNA 3AEAB 1RM6C 1AW7A 4K3BA 2NMQA 2J7QB 2D11A 4JWUC 3L4PA 3S2AA 2K8HA 3MTNB 3VDZA 2LRWA 2MJEA 1K52A 2WXRA 2X38A 4L2YA 2Y3AA 4ZRPA 3ZQ4A 2O2VB 4K7WA 2C9WB 1RRBA 2BS2B 2JYEA 4OZAA 2W3RA 1SE3A 4EUTA 3RYTA 1P9DU 1F2RC 3AEDB 3U8ZA 2M56B 1QOBA 3NVVA 4JGHB 3VUYA 3JYUA 4ZRQA 4PS3A 1GPXA 2PLPA 3AECB 2AYOB 2CU1A 3V6EB 3RI7C 4GDKA 2JZZA 4RFBA 4LJPB 3PLVA 5G2NA 4JE3B 3AN1A 1WSPA 3T3OA 5C3JB 1FNWA 2N7DA 4JX1C 3NUHB 1WZ3A 1HZ6A 1A5RA 2YEPB 2GRIA 3CF6E 4AJYB 4USAA 3Q14C 3CMMB 4MJSB 3DQVA 4GN1A 2MEKA 2D3GA 1IYFA 2MBBB 2REXA 4RGNA 3H9DA 1K51A 4CO7A 4RGOS 4M0WA 3MFGA 2FUHB 3N3KB 2QSDA 5G55A 3V62A 2WXFA 3BVZA 5JXVA 1GB1A 2EKEC 3SFDB 2KVZA 3RZWC 1MPEA 1EUVB 4JLCA 1YD8U 2JRHA 3WALA 3KW5B 3SU8X 3W1SC 2LMCA 2L05A 1TZOA 2KHWB 3RD2A 1EWYC 2DYMA 3PSEB 4ZHPA 2FIDA 3OLMD 3QK0A 4G50A 3KUCB 4YT0B 1WJNA 2N7EA 2ZW1A 3BVMA 4US9A 2K8CA 3PO0A 3EFCA 1ZOYB 2O2VA 5T8IA 4AQ7A 1RFKA 4O1NA 2Q5WD 3TUOA 4MH8A 1UUPA 4RCOA 1ZPSA 1T0QC 4RGMA 1VLBA 2KXJA 1NYRA 3AE5B 1C76A 5AZGA 2KTFA 4ANVA 2R2QA 5CX3A 3LB8C 4GMVA 4W9IA 2I2YA 4FN2A 2G4SA 1E8ZA 4R3DA 1VZ8A 5CHWA 3QX1A 1J0GA 3HK0A 4KGRA 5G5HA 2OJWA 2WDVB 1WH3A 4LNIA 3ZXRA 1V5TA 4RM8A 3MJWA 3BYTB 1IGDA 3WIMA 1MG4A 3I3TB 2IPKD 2W82A 1TBEA 1YMHE 4ICVA 3UIOB 2CHWA 4W9KA 3SD5A 3GOEA 2A5UA 2JXXA 2N4FA 4M8MA 2PE6B 5LXHA 1ROEA 2OOBB 1SEBD 4WAFA 3TBLD 4II3B 3X0WA 1R4MB 2CJOA 2NPTA 2K1FA 1NBFC 4LNFA 2NS5A 2WWZA 4N9F4 1FFVA 4BFRA 1HA5A 3R2IA 1UELA 4MEMA 4FULA 3ZNHB 1TS4A 2N9LA 4H2AA 1XD3B 2IO1B 3GZNB 3VFKA 2JZ3B 4RF1A 2A4ZA 1C9FA 4DK5A 2GMIC 2E3TA 4C4VB 3AE8B 4DXFA 1WGKA 2DZMA 1YNTE 4A3PA 2JY6A 4A3OA 1ET6A 2HD5B 2KX0A 3TSSA 3GB1A 2V1YA 2D3CA 2MQJA 1D3ZA 3L16A 5D3IB 3U7ZA 2KWDA 1V86A 4XDDA 1YJIA 4JPSA 1S3SG 3A1QB 1I4QA 4KGTA 3VRAB 1XLOA 3KWVA 1I4RA 2ZCBA 3I5JC 1CZPA 2JUOA 2KDFB 1I42A 2EELA 3BINA 4KDIC 2W3SA 2DYOA 3ZJUA 3N20C 3H1UA 2FCMA 1L6UA 1EU3A 5D6JB 2K5PA 2Y5CA 2J42A 4LTUA 2IYDB 3DBHB 1NI2A 1FRDA 3ZDTA 3PRMB 1T5XD 2OHFA 1T6BX 5DPSA 2JWZA 2L52A 1KTKA 3DBSA 3T8MA 4C7YA 4CHKA 3LYYA 1JWAD 4WJPA 3Q3JA 1QF6A 4NAWB 3UI3A 4BOZB 2BBCA 4S0RA 2LZ6A 3DOWA 4FJVB 4K3CA 1C4PA 4W9CA 2FE8A 2LGIA 2RDGA 5HG2A 3FKYA 4C80A 3DVNU 2XN9C 4KGSA 3I63C 1V6EA 4KKIA 1EF5A 2WGSA 2L0TA 3HM6X 3V3XA 4US8A 3ETRA 2GOWA 1JQ4A 4PYZA 2MH7A 4W9DA 2I1JA 4HKZE 2L1AA 2J0JA 4LDTB 1YJ1A 1PYWD 4E74A 1SJHD 1E8YA 5D3DA 1JWUD 1NI3A 1WXQA 1TTNA 2FBWB 1J7BA 1J8CA 5MPOA 3URYA 4ACFA 3ML8A 3AEBB 4XZ4A 2PVOD 4JIOU 5AZFA 2C7HA 3BVGA 5IP4D 2BYFA 1WYGA 2SEBD 3BK2A 2LD9A 1TT5B 4MH0E 1RAXA 2K39A 2GB1A 3ZRFA 1YOVB 4WJQA 1NEKB 4BBNF 2KAJA 4MT5A 4ZDVA 1AARA 2N9PC 1IGCA 3R7QA 2PE9A 4B0EA 5I4DA 1CQVA 1V5OA 3N1ZC 2BGFA 1RYJA 5KHQA 5BO4B 2WXNA 1JWBD 1OQYA 5BMIA 3EA6A 4YL8A 2IY0B 3Q8BA 3PZ8A 4NAWA 2YEPF 3U7DA 2NBUA 4I6PA 5G5GA 5AUKA 3AU4A 3PV1A 1LQBA 1EO6A 3DHHC 1V1PB 2KK8A 3NOBA 4W9HA 1ZGUB 4F8CB 3NS8A 3QARA 3AE1B 3ZNGC 2KZRA 3ZNID 4DDID 2NTTA 1UBIA 1TY2A 3BZDB 1GNUA 4NY0A 2INNE 4KSKC 4HKQA 1SSNA 1HEZE 1TIFA 3B9JA 2K8BA 1N61A 2OJRA 2DHZA 4LDTD 2N9KA 2LGXA 2KACA 5HHDG 1P3QU 2R61A 2KVRA 2MJ3A 2QIEB 3ZYYX 1GC7A 4B0MA 2AEHA 1KFYB 2KANA 2KN5A 1MJDA 2KWUB 4JQWC 3P2BA 4AOFA 3ZJVA 2KWCA 1ZKHA 2BS3B 3O65B 1FEHA 4ARCA 3W1YA 4YXDB 5H8YE 4G3XB 4E3CA 3AI5A 2KTRB 4HCPB 5CTRC 1PFDA 2ZCCA 2BWFA 1DYQA 3ZDMC 3AXCA 5E6PA 1HTOA 4PK1A 5JHAA 5EE9A 4C56C 2KDEB 5AEKB 1AN8A 4IWQA 1TGZB 4DXAB 5E6NA 3RCZA 1I7HA 3U4EG 2WXGA 2YVCA 1I4PA 4GSWA 2C5LC 3VAWA 2D3AA 3RUIB 1ESFA 3U30A 1V97A 5H92C 1PGXA 4A6QA 3RMKC 3RNGC 4ZYSA 3TMPB 3NG0A 1FCLA 4HPLB 4M01A 1WXMA 3H7PB 4GB9A 4KIKB 1Z5SB 2WYQA 1DGJA 4NQLB 2HJ1A 1V1PA 3ZTDA 3PT2B 1WIAA 4UDUC 4IM2A 1N6ZA 3Q3OC 2KFJA 3LDZE 4ZYNA 5E6OA 3IT6B 2XBBC 2GBKA 3C8YA 1WFYA 3DBLI 3L17A 2K6QA 2MP2B 1N60A 2AL3A 2FCQA 3PTFC 4K81A 1MFWA 1V9JA 2WXQA 5C23A 1KOTA 3P1MA 5HKHA 3ZUNA 4WH4A 3ONSA 4W9FA 3HRDD 1P7EA 2QC8A 3U2SC 2JSVX 4L1BA 1OGWA 2ZJDA 4D2KA 3KLSX 2PW9A 1XLPA 3V05A 3UF8A 2JX5A 2QMTA 5C1ZA 3P4QB 3QCAA 4XYCA 5LNK1 1FMAD 2DAFA 5EE3A 4F1SA 2LVPA 2DENB 1FNUA 2KC1A 4P7IA 1F77A 3N1XC 3NVZA 2HTME 2JRIB 2MBEA 5LLIA 1WY8A 2WDQB 4GDLA 4B9KA 1D5MC 4P1CC 5FR6A 3IFWB 2FUG1 1XEEA 4YSYB 1B1ZA 3ECIA 1UGMA 2MCNB 4DBGA 3VUXA 1QZEA 1G6JA 4FXCA 2LHEA 2MRPA 1C3TA 1T3QA 4C7ZA 1V2YA 2KKCA 1WX7A 2CS4A 2MBHA 2IDYA 4XDCA 2KC2A 2N7JA 3WCQA 5D94A 2ONQA 2BTEA 1R4NI 3FC4A 1KRHA 2KJRA 1NDDA 4N6EB 2VH2A 1WM2A 5E6JA 2IJ0A 2WXOA 1Q10A 1TYGB 1WE7A 3A4SC 3B1LX 1N5WA 2WDRB 4MGIE 5GXGB 3A33B 4A20A 2KQSA 2RR9A 1JCKB 4BKGA 1KLVA 2PPHA 2AQ3B 3NVYA 1MG8A 3VR8B 2ZVOA 3V6CB 4KIKA 1FFUA 1RFAA 1PUTA 2RGFA 3P42A 2YLMA 1JWSD 1UZXB 3GE8C 3QAQA 4HDOA 4QAYA 4KSLC 5DPTA 3JW0X 2I1KA 1ISNA 4F7ZA 1H4RA 4FHJA 3APDA 1LO5D 1MVKA 2KNBA 4GIVA 4LNNA 3B0AA 3Q8AA 2WXIA 1L0XB 5EDSA 1OEYA 1T0YA 2MP2A 2DNFA 1FPYA 5AUIA 1DOIA 3C0RB 1SE2A 2WXHA 3RN9C 4DHZB 3Q8FA 3K9PB 4I6NB 2GBRA 2KMCA 1NYQA 3KYCD 3J9CA 4J3OD 2G9HD 3EGRA 3O13A 4WWMA 1UD7A 3UINB 1SGHA 2DWQA 1BUIC 3LXFA 4KVGB 4CYEA 1C1YB 2LRUA 1E5WA 3LJ3A 5TSSA 1WMHB 3H7SA 1YX5B 2MHJA 5FK9C 1D5ZC 1UBQA 4MJSA 3DCGA 2EMTA 1ZW7A 4FLHA 4WJNA 3NZUA 4I6LB 4A90A 4HRSA 1HQRD 2PTLA 3P4PB 1U4AA 4M02A 4XWWA 1L7YA 1Z2MA 4MELA 4EOYA 3DPDA 2B76B 1XLQA 1GC6A 3BYYB 1L0VB 2VRRB 1HTQA 4LNOA 2JZPA 4AUQC 2J0MA 1V81A 2BF8B 4NNJB 3ML9A 3DVNV 1GUAB 3W9CB 1QKZA 2FIFA 4MSMB 3Q6BA 1C77A 3AV8A 2ZPNA 2CR5A 2KDBA 1WJ6A 2RMMA 3HM3A 3R2TA 2AQ1B 2IGHA 3VVWB 2FNJB 2N1VA 3PRPB 4BVUC 2I38A 2BB5A 1QILA 2V3NA 2ZW0A 4W9JA 2INCC 2NBWB 1J7CA 3MC0B 1E7VA 1DOXA 2EKIA 1TKYA 4GGQA 4OHJA 3DVGY 1BT0A 2DZKA 3ZO5B 1LGRA 4RMAA 2PVGC 2DZIA 2D2QA 1K50A 3R66C 4FBJB 1STEA 2G1EA 2SAKA 2Y5BB 4W9EA 3IVFA 1E8WA 3BWUD 2IBIB 4YSZB 2CHZA 3NHEB 1EM7A 1H8CA 1UF0A 3UGBB 3JSVB 3PHWB 1KLGD 3WANA 2MJDA 3SDLC 2JWUA 4A8XC 4RF0A 3ENEA 2LVQA 3K9OB 1Q5WB 5HI1A 4TQ0A 4BKTA 3U52E 2MA9B 1FNVA 5DCNA 5CHFA 4NQKE 1SIJA 1V8CA 2C7MB 1TZ1A 1OQQA 3Q8EA 1YJJA 2XEWA 2PEAA 1KH0A 3RNBC 5JH5C 2WLBA 4G11A 4G0NB 3KQ4A 3E56A 2K22A 1R7SA 2AQ2B 3DHIC 2NTSA 3RNFC 1I4HA 3TEZA 1L0YB 4JL9A 4EFOA 1N62A 4ARIA 3W5VB 3ZW3A 4DHJB 1I4XA 1JRPA 1YN3A 2JVCA 2AX5A 1HXYD 1F0ZA 2MW5A 2W54A 3ZVVA 1TKEA 1VZ7A 2JPHA 2L8JA 3RT3B 2ICIA 4C4VA 5EE1A 3L10B 4ITKA 4ANXA 2ZPYA 2J53A 3ZGZA 3EUB2 2UWQA 3WAOA 3T9LA 3ZLZA 1T0SC 2WXLA 1LFDA 4M00A 3L08A 1SE4A 3MJ5A 1D5XC 4BOSC 4HWIB 3A1QA 2XK5B 2Z8LA 2ZEQA 3DBLB 1CK1A 3VTUA 2PKOA 2FCSA 3GE3C 5IA7A 1XCTL 3V60A 3IAS1 2ASQA 1RWSA 2KJ6A 3A9JB 3PRZA 5LXIB 4ICUA 3B08A 3P4RB 4E71A 3EC8A 2JF5A 1JWMD 1VZ6A 1P98A 2BKFA 1WJ4A 3FAHA 3A9KB 3AEFB 2LASA 1ZDVA 4IM0A 3JSVA 4A55A 2G45B 3ZRCA 4A9AA 2BYVE 4HPPA 3SEBA 2KO3A 2WX0A 1FD6A 3VQIA 2QHOA 3ZTCA 3CWIA 2JT4B 2KDMA 4GXBA 1FO4A 2QILA 1J19A 4IM3A 3UQAA 1SBBB 1V1OA 4RM9A 3OAWA 1HE8A 3R7RA 1M4VA 1UNSA 4ZRIA 2LGSA 2CHXA 1E8XA 3Q3FA 2MBOA 1R4NB 4PS7A 5GMVA 3Q2AC 2KLGA 4DHJD 2RDBC 3FILB 3EECA 3ZIMA 1OEYJ 4NJ6A 1GB4A 3RULA 1FXIA 2NBVB 1GJZA 4AWJA 4FA6A 4GDKB 1JALA 1ET9A 1QOFA 2BT6A 2RD0A 1E90A 3RPFC 2BS4B 3PZ7A 1ZUD2 3DBHI 1TJEA 4FHKA 2KN4A 2FAZA 4KKJA 1WGDA 2WQYB 4KZCA 2N9XA 2M17A 1MI0A 3L13A 1VRAB 1QT9A 4MDKE 2ACZB 4OVZA 3QC8B 4TMAB 2LXAA 3W1SA 2KDIA 3AE3B 3PLUA 4IKGA 3RZFA 3TEXA 2INDC 5BYRA 4AP4C 4FJYA 2PJHA 2LUEA 3DBRI 3L0WB 1ZXIA 1EU4A 4MGZE 4LNKA 3UIPB 3UQBA 4M0WB 4TSSA 1XF5L 1GAQB 3CSFA 5IOIA 3M63B 4BZAA 3EHVA 4WWOA 2C7NB 1A70A 2LVOA 1EWCA 1WRIA 1F52A 5L83A 1XXGA 2N1WA 3C19A 1GG3A 1WYWB 1KM7A 3RNAC 1YIWA 1ZDXA 2BYTA 1PGAA 2M0AA 3PHXB 4B6WA 1BXTA 4WWPA 4B95A 1YN4A 2JQRB 4ANUA 1IUEA 4OZCA 3MC9A 4RGTA 2H88B 2JXTA 1TKGA 4ASWC 3KVFB 2WDTB 2PIAA 2WXJA 3AH7A 4W9GA 4HCNB 2LGDA 2AL6A 1WX8A 1WXAA 3X23A 1PDXA 2Z59B 2MX2A 4EZJA 2LFIA 3KUDB 3FILA 4MSQB 4WQOB 2KX3A 1WGYA 2M0XA 5BYQA 2KMAA 3W5UB 2CU3A 2L0FA 1FCCC 4HVBA 1ACCA 2TSSA 5IO9A 3DWMA 1M94A 2NCNA 2UYZB 4GLSC 4KZ0A 4WQMA 4ZRKA 4HK2A 1L2NA 3ALBA 1V49A 1SB3C 2W55A 3I57A 3BK1A 2V9HA 2KTRA 2NR2A 3APCA 3VH4B 3H8HA 3NJTA 4DWFA 2WP9B 2QDFA 3NVWA 2G4DB 3R8BA 3ABVB 2BKRB 4C00A 2HE7A 2H89B 3HIZA 1I4GA 1C78A 2B3AA 4BKSD 4MM3B 3M3JA 4BKSA 1S1QB 1YQBA 2XNAC 3QQ8B 2V4LA 3QA8A 2BWES 2NPTB 3QIJA 4P16A 5J2RA 4KDLB 2MSED 1PGBA 1WGHA 2IO2B 3MHZA 3L54A 1FM0D 4N58A 2MLBA 3B2GA 4II2B 4ANWA 1VJKA 3H7PA 4TKNA 3M95A 4RH6A 4IOIE 3MP9A 4MACA 4OW0A 2DLBA 2GBJA 1WR1A 2ZZPB 4J6IA 4EKUA 4IUMB 1ZP0B 2KJHB 1C4CA 2ZNVC 3MHSD 2LEKA 3ZKJC 1QQRA 3B2FA 3OJ4B 4KV2A 2IGGA 5CHVC 1VCBA 2KWVB 4LLGM 5JHBA 1NENB 2RPQA 3N30A 4IW0A 5J17A 2M19A 4BAXA 1WR6E 3A4RA 1EF1A 1KF6B 4NJCA 4WWNA 4JWSC 3JVZX 1UWMA 2NVUI 1X1MA 3E9SA 4RNAA 1YX6B 4YTPB 3V61A 4TV3A 4HXDA 2KMMA 2L76A 2V4IB 3R3MA 1WX9A 2Z0DB 3DHGC 3IAM1 1ENFA 1CJEA 4YTMB 4HLEA 1E7PB 1WZ0A 3PZDA 1J7AA 3CSTA 2HTHA 4K1RB 2K3UA 5IN7A 2LXCA 3HVZA 1ZE3D 2DYBA 1XCQL 1E10A 4DXGA 2N9EB 1JW9D 1K53A 1FRRA 1WJUA 3PGEA 4GOCA 4N59A 1WXVA 3N1YC 1ZXHA 2GBNA 3WAMA 1UWXA 3BY4B 1P7FA 4YWGG 2K0PA 3DDCB 3AE9B 3AEEB 4XWTA 1SJED 3T3NA 2V3PA 5JZEB 4PS8A 2JYTA 2DZJA 4YSXB 1F9JA 1IBXB 1WE6A 2KQ7A 4W9LA 4MM3A 1TS3A 4EE2A 3AE2B 2L7RA 2QCZA 3AE6B 1L4ZB 4IG7B 2INPE 3ZJTA 2M8SA 2MBQA 1C4AA 2KD0A 1LXDA 4L23A 3P4SB 2WXMA 3Q3NC 1MHXA 2UU7A 2WU2B 4HJKA 3Q3MC 5D7GA 2KT7A 1FXTB 1PQSA 4K7SA 3KH0A 1TS5A 2DX5B 5C2TB 1WRDB 2D3BA 1L6VA 4WJOA 4DQOC 3KUZA 4OVUA 2KFKB 2MWSB 1TS2A 1JMLA 1F1HA 3QHTA 3QJZA 3QWZB 4WIPA 1QLBB 4FJZA 3APFA 2L83A 2BB6A 3AE7B 2DAJA 2JU6X 4MGYE 2V3SA 1WI0A 2WS3B 3WAPA 3PPAA 1Q0WB 3TEWA 3IBEA 2WNMA 2D5GA 1E0ZA 2J52A 2KQ4X 2W9NA 1P0RA 4LJOB 1IP9A 4OVVA 1YQ4B 2N0SB 2VZKB 3NS1A 1Q1OA 5BMGA 4YTNB 2CJNA 2RDHA 4AJWA 3OWEB 2IZVB 1WMHA 1Y56A 1WGRA 4URKA 4BBNC 2WU5B 3DVGX 4HPMB 1WM3A 1XQQA 2GI9A 2L32A 3SFEB 4TQ1A 4DHZE 2LI5A 3TJPA 3IT4B 1B9RA 4MGKE 1E9MA 3KYDD 3BIID 1N63A 5FR3A 1WXSA 3EFUA 2L00B 2Y5PA 1WGGA 2M1MA 4X57B 3TEYA 1YN5A 3PREA 3HVDA 3DBRB 3AM9A 3TL5A 1IBXA 3Q69A 5D2MB 1I35A 2K25A 1KLUD 4ZRJA 4PYUA 4LCDE 1IPGA 3NRZA 2M4NA 3TIXA 4EEWA 2WXPA 3D32A 3PVLA 4S17A 2RPVA 4TUUA 2J4XA 3VTVA 4XX5A 4PT5A 3N9YC 4IWOA 3Q8CA 2AWTA 2O6VB 3AE4B 1OQRA 3DWGC 4CQNA 3AEGB 3AMZA 1D6EC 3VRBB 1QOAA 1JROA 4NZLB 2PMVA 1SE9A 5DPWA 2ZVNA 2LWPA 2HDEA 1XO3A 3ZXVA 2KFKA 3VXWA 2K9XA 3MC8A 3H6NA 5KHOA 2BQQA 1HZ5A 2LJIA 2J0KA 1NVID 3CIRB 4LK0M 1WF9A 1XT9B 4EZKA 2D10A 2GBMA 2CKHB 4OZBA 3N32A 1MHHE 3I9V1 1GOZA 3AULA 2WHIA 2Z0EB 4ZOHC 4AS1A 1Y8RC 2FCNA 2WX1A 3VUWA 1TY0A 3NY5A 2IO0B 1E6EB 2K6DB 3HUIA 4WURA 1FIQA 2WXKA 1FXAA 3IXSA 2LHDA 3TCAA 1R4MI 2VZKD 3P63A 2BPSA 3IG3A 4P6VF 1QOGA 3VHTC 3RNCC 1C79A 1WWTA 2KYWA 3M62B 4FADA 1VD2A 4NAMA 4XGAB 2ZNVB 2L3ZA 2C60A 1YQ3B 3OJ3A 3GZNI 5BYSA 5IKCM 4XE0A 1AYFA 4Q2JA 5IAAC 1AWDA 2KLCA 3W2DA 2HJ8A 2LJ5A 1P1AA 2ON8A 3GP7A 3RNEC 1XLNA 2DBYA 2LGYA 3VR9B 5HFYA 5TR5A 3NZSA 5EE0A 1OFFA 1SF0A 2OEDA 2RSUA 5DPRA 2IGDA 1L4DB 4NJ7A 3RFZB 1CMXB 1T0RC 3AB5A 2G3QB 1OTRB 2KOXA 2O6VD 3VTWA 2O6VA 4WAAA 1UH6A 1D4BA 3AU5A 4IDIA 1E7UA 2BW2A 2VH1A 3HHMA 3WA0A 2V0GA 1K8RB 4P1BC 4DDGD 3IHPC 4IWPA 2IY1B 2R2OA 4XC2A 2QEJC 3KWLA 2X8XX 3OG5A 4HDQA
chains in the Genus database with same CATH topology
2LUMA 4REZA 2RMMA 2FBWB 1J7BA 4MM3B 3R2TA 2XNAC 5MPOA 5FKAC 3URYA 4GDLB 2AQ1B 1F2RI 3AEBB 1L5PA 2IGHA 2PVOD 4KX6B 1N5XA 4P16A 1UGJA 3BVGA 1WYGA 2SEBD 3BK2A 2I38A 2QJLA 1PGBA 2BB5A 1QILA 2GB1A 3MHZA 2V3NA 1FM0D 4N58A 2E6XA 2ZW0A 4HEA1 5BMHA 3B2GA 4ZHOA 1VDVA 1VJKA 1J7CA 3MC0B 1BMLC 1SXTA 1DOXA 4RH6A 1NEKB 1TKYA 2EKIA 3NZ3A 4OHJA 3SR6A 4IOIE 2KAJA 3MP9A 4MT5A 4MACA 4HROA 4OW0A 2DLBA 4HJGE 1IGCA 1DOYA 1ZP0B 1VR9A 2PVGC 3GS2A 1C4CA 4B0EA 2LEKA 5I4DA 3AEAB 1CQVA 1RM6C 1AW7A 1QQRA 3B2FA 2IGGA 1K50A 2NMQA 4JWUC 3L4PA 4LLGM 1RYJA 1STEA 2G1EA 1NENB 2SAKA 2M19A 1KF6B 4NJCA 2MJEA 1K52A 2WXRA 2WXNA 2X38A 1JWBD 4JWSC 4L2YA 5BMIA 2Y3AA 4ZRPA 3ZQ4A 1UWMA 3EA6A 3BWUD 3Q8BA 2BS2B 4YSZB 3E9SA 3PZ8A 4RNAA 2YEPF 4YTPB 5G5GA 5AUKA 2JYEA 4OZAA 2W3RA 2KMMA 1EM7A 1SE3A 2V4IB 1V1PB 1KLGD 3IAM1 1ENFA 1CJEA 4YTMB 1F2RC 1E7PB 2MJDA 3AE1B 2JWUA 4A8XC 3AEDB 4RF0A 1J7AA 2M56B 2NTTA 1QOBA 1TY2A 3BZDB 3NVVA 2INNE 5HI1A 2K3UA 4TQ0A 3U52E 4HKQA 1FNVA 3HVZA 1SSNA 4ZRQA 1GPXA 1ZE3D 1SIJA 2PLPA 1V8CA 1HEZE 3AECB 1OQQA 3B9JA 3Q8EA 1YJJA 1KH0A 1XCQL 1N61A 4RFBA 1E10A 4DXGA 1JW9D 1K53A 1FRRA 4JE3B 3AN1A 4N59A 2WLBA 1WSPA 1ZXHA 2N9KA 3T3OA 1UWXA 2KACA 3KQ4A 5HHDG 3E56A 5C3JB 1P7FA 2K22A 2R61A 1FNWA 1R7SA 2AQ2B 2MJ3A 2K0PA 2NTSA 4YWGG 3AE9B 4JX1C 3NUHB 2QIEB 3AEEB 4XWTA 3ZYYX 1HZ6A 1I4HA 1SJED 3T3NA 3TEZA 1L0YB 2YEPB 2GRIA 2V3PA 4B0MA 4YSXB 1KFYB 2JYTA 1N62A 4USAA 3W5VB 4ARIA 1IBXB 2MEKA 1TS3A 1I4XA 4EE2A 1JRPA 3AE2B 3ZJVA 1YN3A 2AX5A 2BS3B 3AE6B 1L4ZB 1HXYD 1F0ZA 3ZJTA 2INPE 2W54A 1TKEA 1FEHA 4RGNA 4ARCA 1VZ7A 1C4AA 2ICIA 4YXDB 1K51A 5EE1A 5H8YE 4L23A 3P4SB 4ITKA 4RGOS 2WXMA 2J53A 4M0WA 3ZGZA 3MFGA 1PFDA 2QSDA 1MHXA 2WU2B 2WXFA 1DYQA 3EUB2 3BVZA 5JXVA 5D7GA 1GB1A 2WXLA 3SFDB 5EE9A 1MPEA 4C56C 1TS5A 5C2TB 1SE4A 1AN8A 3MJ5A 1L6VA 4DQOC 1D5XC 1I7HA 2LMCA 2Z8LA 3U4EG 1TS2A 2WXGA 1JMLA 1TZOA 1CK1A 2PKOA 4WIPA 1I4PA 1EWYC 1XCTL 2DYMA 1ESFA 4ZHPA 1QLBB 2L83A 2BB6A 3IAS1 3AE7B 4YT0B 1V97A 1RWSA 5H92C 2JU6X 2ZW1A 1PGXA 2WS3B 4A6QA 3BVMA 4US9A 3P4RB 3PO0A 4ZYSA 1JWMD 1ZOYB 3TEWA 1VZ6A 2WNMA 1FCLA 2D5GA 5T8IA 4AQ7A 1E0ZA 3FAHA 1RFKA 2J52A 4O1NA 2KQ4X 2Q5WD 3AEFB 3TUOA 4MH8A 1UUPA 4RCOA 1DGJA 1ZPSA 4RGMA 1VLBA 1YQ4B 2N0SB 1ZDVA 2VZKB 1NYRA 3AE5B 3NS1A 5BMGA 1C76A 1V1PA 4YTNB 2CJNA 4A55A 2RDHA 3LB8C 3OWEB 1Y56A 4A9AA 3SEBA 2WU5B 2I2YA 1FD6A 3VQIA 4UDUC 2GI9A 2L32A 1VZ8A 4R3DA 3CWIA 3SFEB 2KDMA 4TQ1A 3IT6B 1FO4A 3C8YA 4KGRA 2QILA 3IT4B 1B9RA 1N60A 1E9MA 5G5HA 1SBBB 3BIID 2WXQA 1N63A 2WDVB 1V1OA 5FR3A 3P1MA 4WH4A 3BYTB 3HRDD 1P7EA 2Y5PA 1IGDA 1M4VA 1UNSA 3U2SC 2JSVX 4L1BA 2IPKD 3TEYA 2W82A 1YN5A 4D2KA 1YMHE 3KLSX 2PW9A 1XLPA 3V05A 3HVDA 3AM9A 1IBXA 2JX5A 2QMTA 3Q69A 3P4QB 3FILB 1KLUD 5LNK1 1FMAD 5EE3A 1GB4A 1FXIA 1FNUA 1F77A 3NRZA 3NVZA 2HTME 2WXPA 1ROEA 2WDQB 1SEBD 2RPVA 2J4XA 4GDKB 1JALA 4WAFA 1D5MC 1ET9A 1QOFA 4PT5A 2BT6A 3N9YC 3Q8CA 3RPFC 2CJOA 2BS4B 2FUG1 1XEEA 3AE4B 3PZ7A 4YSYB 1OQRA 1ZUD2 1B1ZA 1TJEA 3DWGC 4CQNA 3AEGB 3AMZA 2KN4A 1D6EC 3VRBB 1QOAA 1JROA 4NZLB 2PMVA 1FFVA 4KKJA 2WQYB 4FXCA 1MI0A 2HDEA 1HA5A 1VRAB 1XO3A 2LHEA 3R2IA 1T3QA 4C7ZA 1QT9A 2ACZB 4OVZA 2IDYA 1TS4A 2K9XA 2N9LA 4H2AA 4TMAB 3W1SA 3AE3B 4IKGA 4XDCA 2N7JA 3TEXA 3WCQA 2ONQA 5BYRA 2BTEA 4RF1A 1C9FA 1HZ5A 2LJIA 3FC4A 1KRHA 1ZXIA 2E3TA 4N6EB 1EU4A 1NVID 3AE8B 2IJ0A 3CIRB 5E6JA 4DXFA 2WXOA 1Q10A 1WGKA 4LK0M 1TYGB 1YNTE 4TSSA 1XF5L 4OZBA 1N5WA 1ET6A 1MHHE 3I9V1 2WDRB 1GAQB 1GOZA 5GXGB 4ZOHC 4AS1A 1JCKB 3TSSA 3GB1A 2AQ3B 3NVYA 3VR8B 1TY0A 1E6EB 1FFUA 3HUIA 4WURA 5D3IB 1FIQA 1A70A 2WXKA 3U7ZA 1FXAA 3IXSA 2LHDA 1PUTA 2KWDA 2VZKD 4XDDA 3P63A 3P42A 1EWCA 1WRIA 4P6VF 1YJIA 1QOGA 4JPSA 1XXGA 1I4QA 1JWSD 4KGTA 3VRAB 1C79A 1WWTA 1XLOA 3KWVA 1I4RA 1CZPA 4NAMA 1ZDXA 2BYTA 1LO5D 1PGAA 2EELA 1MVKA 2M0AA 2W3SA 2DYOA 3ZJUA 1YQ3B 3Q8AA 2WXIA 1BXTA 1L0XB 5BYSA 1L6UA 1YN4A 2JQRB 1EU3A 1IUEA 4XE0A 1AYFA 2K5PA 2Y5CA 4OZCA 5AUIA 2J42A 4LTUA 4Q2JA 1DOIA 1SE2A 2WXHA 4RGTA 2H88B 1FRDA 2JXTA 3Q8FA 1AWDA 1T5XD 1TKGA 2OHFA 1T6BX 1NYQA 2L52A 3W2DA 1KTKA 2ON8A 3GP7A 2PIAA 3J9CA 4J3OD 2G9HD 2WXJA 3EGRA 3O13A 4WWMA 3LYYA 4C7YA 1JWAD 3AH7A 2DWQA 1BUIC 3LXFA 1QF6A 4NAWB 3UI3A 1XLNA 2BBCA 1PDXA 2DBYA 5TSSA 3VR9B 5HFYA 2LFIA 1C4PA 3FILA 2FE8A 5EE0A 5FK9C 1D5ZC 2LGIA 2RDGA 5HG2A 1OFFA 5BYQA 3W5UB 4C80A 1SF0A 2CU3A 2OEDA 2XN9C 1FCCC 2IGDA 4A90A 1L4DB 4KGSA 1ACCA 4HRSA 2TSSA 3DWMA 3RFZB 1HQRD 2PTLA 3AB5A 3P4PB 4KKIA 4GLSC 4XWWA 4WQMA 3V3XA 4US8A 3ETRA 1JQ4A 2B76B 2MH7A 1SB3C 1XLQA 3BYYB 2W55A 1L0VB 2L1AA 3BK1A 3I57A 4HKZE 4IDIA 1D4BA 2BW2A 3H8HA 2JZPA 2WP9B 1PYWD 2V0GA 1SJHD 3NVWA 3R8BA 2QEJC 5D3DA 3W9CB 1JWUD 3ABVB 3KWLA 1QKZA 1NI3A 1C77A 3AV8A 1WXQA 2H89B 1I4GA 1C78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9A A;  1JW9 D;  1FRR A;  2FBW B;  1J7B A;  2WU5 B;  3AN1 A;  2WLB A;  3NVY A;  4N59 A;  3VR8 B;  1E6E B;  5MPO A;  1FFU A;  3HUI A;  1FIQ A;  1A70 A;  3CWI A;  3SFE B;  1FXA A;  5C3J B;  1PUT A;  2K22 A;  3P63 A;  1R7S A;  2MJ3 A;  1WRI A;  3AEB B;  4P6V F;  1L5P A;  3AE9 B;  1YJI A;  1QOG A;  2PVO D;  4JX1 C;  2QIE B;  3AEE B;  3ZYY X;  4KX6 B;  1B9R A;  1N5X A;  3VRA B;  1XLO A;  1N60 A;  1WWT A;  1E9M A;  5G5H A;  1WYG A;  1KFY B;  4YSX B;  3BII D;  1N62 A;  4USA A;  3W5V B;  1CZP A;  1N63 A;  2QJL A;  2WDV B;  3P1M A;  1JRP A;  3AE2 B;  4N58 A;  1FM0 D;  3HRD D;  2AX5 A;  2BS3 B;  2W3S A;  3B2G A;  4ZHO A;  1YQ3 B;  1VDV A;  3AE6 B;  1FO4 A;  1F0Z A;  1VJK A;  1J7C A;  2W54 A;  1TKE A;  1DOX A;  1NEK B;  1TKY A;  2EKI A;  4YXD B;  1L6U A;  5H8Y E;  2JQR B;  5EE1 A;  3SR6 A;  1XLP A;  1IUE A;  1AYF A;  2K5P A;  3P4S B;  2Y5C A;  3AM9 A;  2KAJ A;  4ITK A;  4LTU A;  5AUI A;  1E10 A;  2JX5 A;  1DOI A;  4HRO A;  3P4Q B;  1PFD A;  2H88 B;  1FRD A;  1DOY A;  1ZP0 B;  1AWD A;  2PVG C;  2WU2 B;  1TKG A;  3EUB 2;  2OHF A;  1FMA D;  1NYQ A;  2L52 A;  5EE3 A;  1FXI A;  3SFD B;  2LEK A;  2PIA A;  3AEA B;  4WWM A;  1RM6 C;  4C7Y A;  3B2F A;  1JWA D;  3AH7 A;  3NRZ A;  3NVZ A;  5EE9 A;  2DWQ A;  2HTM E;  3LXF A;  1ROE A;  4JWU C;  5C2T B;  3L4P A;  1XLN A;  1QF6 A;  2WDQ B;  1PDX A;  1L6V A;  1RYJ A;  2DBY A;  2G1E A;  1NEN B;  1JAL A;  2M19 A;  3VR9 B;  1QOF A;  2BT6 A;  1I7H A;  3RPF C;  2CJO A;  1KF6 B;  2BS4 B;  5EE0 A;  2MJE A;  3AE4 B;  4YSY B;  1OQR A;  1ZUD 2;  1JWB D;  1TJE A;  3DWG C;  4JWS C;  3AEG B;  2PKO A;  1OFF A;  3AMZ A;  3W5U B;  1UWM A;  4C80 A;  3VRB B;  1QOA A;  1JRO A;  1EWY C;  1SF0 A;  2CU3 A;  2BS2 B;  4YSZ B;  1FFV A;  4ZHP A;  2WQY B;  1QLB B;  4HRS A;  4YTP B;  2L83 A;  5G5G A;  3DWM A;  5AUK A;  4FXC A;  3AB5 A;  3AE7 B;  3P4P B;  2W3R A;  4YT0 B;  2KMM A;  1V97 A;  1RWS A;  1XO3 A;  5H92 C;  1T3Q A;  4WQM A;  4C7Z A;  2WS3 B;  1QT9 A;  4US8 A;  4US9 A;  2ACZ B;  3ETR A;  2K9X A;  3P4R B;  1JQ4 A;  2B76 B;  2MH7 A;  3PO0 A;  1CJE A;  1SB3 C;  4YTM B;  3AE3 B;  1XLQ A;  3WCQ A;  1E7P B;  1L0V B;  1ZOY B;  2MJD A;  2W55 A;  3AE1 B;  4IDI A;  3AED B;  1J7A A;  2M56 B;  3FC4 A;  1KRH A;  3FAH A;  1E0Z A;  1QOB A;  1RFK A;  1ZXI A;  2E3T A;  2WP9 B;  4N6E B;  1NVI D;  2Q5W D;  3AE8 B;  3AEF B;  3CIR B;  3NVV A;  1WGK A;  3NVW A;  1DGJ A;  3HVZ A;  1VLB A;  1YQ4 B;  1TYG B;  2N0S B;  1GPX A;  1NYR A;  3AE5 B;  1SIJ A;  3ABV B;  1V8C A;  3KWL A;  3AEC B;  3NS1 A;  3W9C B;  1N5W A;  1NI3 A;  1OQQ A;  2CJN A;  4YTN B;  3B9J A;  2WDR B;  1YJJ A;  1GAQ B;  3AV8 A;  1WXQ A;  2H89 B;  5GXG B;  1N61 A;  3LB8 C;  4ZOH C; 
#chains in the Genus database with same CATH topology
 2LUM A;  4REZ A;  4EZL A;  2XK5 A;  1RLF A;  3ZNZ B;  4K7U A;  5FKA C;  4GDL B;  2D07 B;  2EMS A;  2BVC A;  1F2R I;  1L5P A;  2BYE A;  4KX6 B;  5AZH A;  1N5X A;  1UGJ A;  1KJT A;  5J18 A;  4IC7 B;  3A9J A;  2QJL A;  2GLS A;  1SIF A;  5L95 C;  2IO3 B;  2E6X A;  4HEA 1;  5BMH A;  4ZHO A;  1VDV A;  3PS6 A;  4GU2 A;  1BML C;  1SXT A;  3A9K A;  3NZ3 A;  4M8N A;  3SR6 A;  1V80 A;  4HRO A;  1JRU A;  3VH3 B;  4HJG E;  1LM8 B;  1DOY A;  1VR9 A;  3SHQ A;  3GS2 A;  4NPN A;  3AEA B;  1RM6 C;  1AW7 A;  4K3B A;  2NMQ A;  2J7Q B;  2D11 A;  4JWU C;  3L4P A;  3S2A A;  2K8H A;  3MTN B;  3VDZ A;  2LRW A;  2MJE A;  1K52 A;  2WXR A;  2X38 A;  4L2Y A;  2Y3A A;  4ZRP A;  3ZQ4 A;  2O2V B;  4K7W A;  2C9W B;  1RRB A;  2BS2 B;  2JYE A;  4OZA A;  2W3R A;  1SE3 A;  4EUT A;  3RYT A;  1P9D U;  1F2R C;  3AED B;  3U8Z A;  2M56 B;  1QOB A;  3NVV A;  4JGH B;  3VUY A;  3JYU A;  4ZRQ A;  4PS3 A;  1GPX A;  2PLP A;  3AEC B;  2AYO B;  2CU1 A;  3V6E B;  3RI7 C;  4GDK A;  2JZZ A;  4RFB A;  4LJP B;  3PLV A;  5G2N A;  4JE3 B;  3AN1 A;  1WSP A;  3T3O A;  5C3J B;  1FNW A;  2N7D A;  4JX1 C;  3NUH B;  1WZ3 A;  1HZ6 A;  1A5R A;  2YEP B;  2GRI A;  3CF6 E;  4AJY B;  4USA A;  3Q14 C;  3CMM B;  4MJS B;  3DQV A;  4GN1 A;  2MEK A;  2D3G A;  1IYF A;  2MBB B;  2REX A;  4RGN A;  3H9D A;  1K51 A;  4CO7 A;  4RGO S;  4M0W A;  3MFG A;  2FUH B;  3N3K B;  2QSD A;  5G55 A;  3V62 A;  2WXF A;  3BVZ A;  5JXV A;  1GB1 A;  2EKE C;  3SFD B;  2KVZ A;  3RZW C;  1MPE A;  1EUV B;  4JLC A;  1YD8 U;  2JRH A;  3WAL A;  3KW5 B;  3SU8 X;  3W1S C;  2LMC A;  2L05 A;  1TZO A;  2KHW B;  3RD2 A;  1EWY C;  2DYM A;  3PSE B;  4ZHP A;  2FID A;  3OLM D;  3QK0 A;  4G50 A;  3KUC B;  4YT0 B;  1WJN A;  2N7E A;  2ZW1 A;  3BVM A;  4US9 A;  2K8C A;  3PO0 A;  3EFC A;  1ZOY B;  2O2V A;  5T8I A;  4AQ7 A;  1RFK A;  4O1N A;  2Q5W D;  3TUO A;  4MH8 A;  1UUP A;  4RCO A;  1ZPS A;  1T0Q C;  4RGM A;  1VLB A;  2KXJ A;  1NYR A;  3AE5 B;  1C76 A;  5AZG A;  2KTF A;  4ANV A;  2R2Q A;  5CX3 A;  3LB8 C;  4GMV A;  4W9I A;  2I2Y A;  4FN2 A;  2G4S A;  1E8Z A;  4R3D A;  1VZ8 A;  5CHW A;  3QX1 A;  1J0G A;  3HK0 A;  4KGR A;  5G5H A;  2OJW A;  2WDV B;  1WH3 A;  4LNI A;  3ZXR A;  1V5T A;  4RM8 A;  3MJW A;  3BYT B;  1IGD A;  3WIM A;  1MG4 A;  3I3T B;  2IPK D;  2W82 A;  1TBE A;  1YMH E;  4ICV A;  3UIO B;  2CHW A;  4W9K A;  3SD5 A;  3GOE A;  2A5U A;  2JXX A;  2N4F A;  4M8M A;  2PE6 B;  5LXH A;  1ROE A;  2OOB B;  1SEB D;  4WAF A;  3TBL D;  4II3 B;  3X0W A;  1R4M B;  2CJO A;  2NPT A;  2K1F A;  1NBF C;  4LNF A;  2NS5 A;  2WWZ A;  4N9F 4;  1FFV A;  4BFR A;  1HA5 A;  3R2I A;  1UEL A;  4MEM A;  4FUL A;  3ZNH B;  1TS4 A;  2N9L A;  4H2A A;  1XD3 B;  2IO1 B;  3GZN B;  3VFK A;  2JZ3 B;  4RF1 A;  2A4Z A;  1C9F A;  4DK5 A;  2GMI C;  2E3T A;  4C4V B;  3AE8 B;  4DXF A;  1WGK A;  2DZM A;  1YNT E;  4A3P A;  2JY6 A;  4A3O A;  1ET6 A;  2HD5 B;  2KX0 A;  3TSS A;  3GB1 A;  2V1Y A;  2D3C A;  2MQJ A;  1D3Z A;  3L16 A;  5D3I B;  3U7Z A;  2KWD A;  1V86 A;  4XDD A;  1YJI A;  4JPS A;  1S3S G;  3A1Q B;  1I4Q A;  4KGT A;  3VRA B;  1XLO A;  3KWV A;  1I4R A;  2ZCB A;  3I5J C;  1CZP A;  2JUO A;  2KDF B;  1I42 A;  2EEL A;  3BIN A;  4KDI C;  2W3S A;  2DYO A;  3ZJU A;  3N20 C;  3H1U A;  2FCM A;  1L6U A;  1EU3 A;  5D6J B;  2K5P A;  2Y5C A;  2J42 A;  4LTU A;  2IYD B;  3DBH B;  1NI2 A;  1FRD A;  3ZDT A;  3PRM B;  1T5X D;  2OHF A;  1T6B X;  5DPS A;  2JWZ A;  2L52 A;  1KTK A;  3DBS A;  3T8M A;  4C7Y A;  4CHK A;  3LYY A;  1JWA D;  4WJP A;  3Q3J A;  1QF6 A;  4NAW B;  3UI3 A;  4BOZ B;  2BBC A;  4S0R A;  2LZ6 A;  3DOW A;  4FJV B;  4K3C A;  1C4P A;  4W9C A;  2FE8 A;  2LGI A;  2RDG A;  5HG2 A;  3FKY A;  4C80 A;  3DVN U;  2XN9 C;  4KGS A;  3I63 C;  1V6E A;  4KKI A;  1EF5 A;  2WGS A;  2L0T A;  3HM6 X;  3V3X A;  4US8 A;  3ETR A;  2GOW A;  1JQ4 A;  4PYZ A;  2MH7 A;  4W9D A;  2I1J A;  4HKZ E;  2L1A A;  2J0J A;  4LDT B;  1YJ1 A;  1PYW D;  4E74 A;  1SJH D;  1E8Y A;  5D3D A;  1JWU D;  1NI3 A;  1WXQ A;  1TTN A;  2FBW B;  1J7B A;  1J8C A;  5MPO A;  3URY A;  4ACF A;  3ML8 A;  3AEB B;  4XZ4 A;  2PVO D;  4JIO U;  5AZF A;  2C7H A;  3BVG A;  5IP4 D;  2BYF A;  1WYG A;  2SEB D;  3BK2 A;  2LD9 A;  1TT5 B;  4MH0 E;  1RAX A;  2K39 A;  2GB1 A;  3ZRF A;  1YOV B;  4WJQ A;  1NEK B;  4BBN F;  2KAJ A;  4MT5 A;  4ZDV A;  1AAR A;  2N9P C;  1IGC A;  3R7Q A;  2PE9 A;  4B0E A;  5I4D A;  1CQV A;  1V5O A;  3N1Z C;  2BGF A;  1RYJ A;  5KHQ A;  5BO4 B;  2WXN A;  1JWB D;  1OQY A;  5BMI A;  3EA6 A;  4YL8 A;  2IY0 B;  3Q8B A;  3PZ8 A;  4NAW A;  2YEP F;  3U7D A;  2NBU A;  4I6P A;  5G5G A;  5AUK A;  3AU4 A;  3PV1 A;  1LQB A;  1EO6 A;  3DHH C;  1V1P B;  2KK8 A;  3NOB A;  4W9H A;  1ZGU B;  4F8C B;  3NS8 A;  3QAR A;  3AE1 B;  3ZNG C;  2KZR A;  3ZNI D;  4DDI D;  2NTT A;  1UBI A;  1TY2 A;  3BZD B;  1GNU A;  4NY0 A;  2INN E;  4KSK C;  4HKQ A;  1SSN A;  1HEZ E;  1TIF A;  3B9J A;  2K8B A;  1N61 A;  2OJR A;  2DHZ A;  4LDT D;  2N9K A;  2LGX A;  2KAC A;  5HHD G;  1P3Q U;  2R61 A;  2KVR A;  2MJ3 A;  2QIE B;  3ZYY X;  1GC7 A;  4B0M A;  2AEH A;  1KFY B;  2KAN A;  2KN5 A;  1MJD A;  2KWU B;  4JQW C;  3P2B A;  4AOF A;  3ZJV A;  2KWC A;  1ZKH A;  2BS3 B;  3O65 B;  1FEH A;  4ARC A;  3W1Y A;  4YXD B;  5H8Y E;  4G3X B;  4E3C A;  3AI5 A;  2KTR B;  4HCP B;  5CTR C;  1PFD A;  2ZCC A;  2BWF A;  1DYQ A;  3ZDM C;  3AXC A;  5E6P A;  1HTO A;  4PK1 A;  5JHA A;  5EE9 A;  4C56 C;  2KDE B;  5AEK B;  1AN8 A;  4IWQ A;  1TGZ B;  4DXA B;  5E6N A;  3RCZ A;  1I7H A;  3U4E G;  2WXG A;  2YVC A;  1I4P A;  4GSW A;  2C5L C;  3VAW A;  2D3A A;  3RUI B;  1ESF A;  3U30 A;  1V97 A;  5H92 C;  1PGX A;  4A6Q A;  3RMK C;  3RNG C;  4ZYS A;  3TMP B;  3NG0 A;  1FCL A;  4HPL B;  4M01 A;  1WXM A;  3H7P B;  4GB9 A;  4KIK B;  1Z5S B;  2WYQ A;  1DGJ A;  4NQL B;  2HJ1 A;  1V1P A;  3ZTD A;  3PT2 B;  1WIA A;  4UDU C;  4IM2 A;  1N6Z A;  3Q3O C;  2KFJ A;  3LDZ E;  4ZYN A;  5E6O A;  3IT6 B;  2XBB C;  2GBK A;  3C8Y A;  1WFY A;  3DBL I;  3L17 A;  2K6Q A;  2MP2 B;  1N60 A;  2AL3 A;  2FCQ A;  3PTF C;  4K81 A;  1MFW A;  1V9J A;  2WXQ A;  5C23 A;  1KOT A;  3P1M A;  5HKH A;  3ZUN A;  4WH4 A;  3ONS A;  4W9F A;  3HRD D;  1P7E A;  2QC8 A;  3U2S C;  2JSV X;  4L1B A;  1OGW A;  2ZJD A;  4D2K A;  3KLS X;  2PW9 A;  1XLP A;  3V05 A;  3UF8 A;  2JX5 A;  2QMT A;  5C1Z A;  3P4Q B;  3QCA A;  4XYC A;  5LNK 1;  1FMA D;  2DAF A;  5EE3 A;  4F1S A;  2LVP A;  2DEN B;  1FNU A;  2KC1 A;  4P7I A;  1F77 A;  3N1X C;  3NVZ A;  2HTM E;  2JRI B;  2MBE A;  5LLI A;  1WY8 A;  2WDQ B;  4GDL A;  4B9K A;  1D5M C;  4P1C C;  5FR6 A;  3IFW B;  2FUG 1;  1XEE A;  4YSY B;  1B1Z A;  3ECI A;  1UGM A;  2MCN B;  4DBG A;  3VUX A;  1QZE A;  1G6J A;  4FXC A;  2LHE A;  2MRP A;  1C3T A;  1T3Q A;  4C7Z A;  1V2Y A;  2KKC A;  1WX7 A;  2CS4 A;  2MBH A;  2IDY A;  4XDC A;  2KC2 A;  2N7J A;  3WCQ A;  5D94 A;  2ONQ A;  2BTE A;  1R4N I;  3FC4 A;  1KRH A;  2KJR A;  1NDD A;  4N6E B;  2VH2 A;  1WM2 A;  5E6J A;  2IJ0 A;  2WXO A;  1Q10 A;  1TYG B;  1WE7 A;  3A4S C;  3B1L X;  1N5W A;  2WDR B;  4MGI E;  5GXG B;  3A33 B;  4A20 A;  2KQS A;  2RR9 A;  1JCK B;  4BKG A;  1KLV A;  2PPH A;  2AQ3 B;  3NVY A;  1MG8 A;  3VR8 B;  2ZVO A;  3V6C B;  4KIK A;  1FFU A;  1RFA A;  1PUT A;  2RGF A;  3P42 A;  2YLM A;  1JWS D;  1UZX B;  3GE8 C;  3QAQ A;  4HDO A;  4QAY A;  4KSL C;  5DPT A;  3JW0 X;  2I1K A;  1ISN A;  4F7Z A;  1H4R A;  4FHJ A;  3APD A;  1LO5 D;  1MVK A;  2KNB A;  4GIV A;  4LNN A;  3B0A A;  3Q8A A;  2WXI A;  1L0X B;  5EDS A;  1OEY A;  1T0Y A;  2MP2 A;  2DNF A;  1FPY A;  5AUI A;  1DOI A;  3C0R B;  1SE2 A;  2WXH A;  3RN9 C;  4DHZ B;  3Q8F A;  3K9P B;  4I6N B;  2GBR A;  2KMC A;  1NYQ A;  3KYC D;  3J9C A;  4J3O D;  2G9H D;  3EGR A;  3O13 A;  4WWM A;  1UD7 A;  3UIN B;  1SGH A;  2DWQ A;  1BUI C;  3LXF A;  4KVG B;  4CYE A;  1C1Y B;  2LRU A;  1E5W A;  3LJ3 A;  5TSS A;  1WMH B;  3H7S A;  1YX5 B;  2MHJ A;  5FK9 C;  1D5Z C;  1UBQ A;  4MJS A;  3DCG A;  2EMT A;  1ZW7 A;  4FLH A;  4WJN A;  3NZU A;  4I6L B;  4A90 A;  4HRS A;  1HQR D;  2PTL A;  3P4P B;  1U4A A;  4M02 A;  4XWW A;  1L7Y A;  1Z2M A;  4MEL A;  4EOY A;  3DPD A;  2B76 B;  1XLQ A;  1GC6 A;  3BYY B;  1L0V B;  2VRR B;  1HTQ A;  4LNO A;  2JZP A;  4AUQ C;  2J0M A;  1V81 A;  2BF8 B;  4NNJ B;  3ML9 A;  3DVN V;  1GUA B;  3W9C B;  1QKZ A;  2FIF A;  4MSM B;  3Q6B A;  1C77 A;  3AV8 A;  2ZPN A;  2CR5 A;  2KDB A;  1WJ6 A;  2RMM A;  3HM3 A;  3R2T A;  2AQ1 B;  2IGH A;  3VVW B;  2FNJ B;  2N1V A;  3PRP B;  4BVU C;  2I38 A;  2BB5 A;  1QIL A;  2V3N A;  2ZW0 A;  4W9J A;  2INC C;  2NBW B;  1J7C A;  3MC0 B;  1E7V A;  1DOX A;  2EKI A;  1TKY A;  4GGQ A;  4OHJ A;  3DVG Y;  1BT0 A;  2DZK A;  3ZO5 B;  1LGR A;  4RMA A;  2PVG C;  2DZI A;  2D2Q A;  1K50 A;  3R66 C;  4FBJ B;  1STE A;  2G1E A;  2SAK A;  2Y5B B;  4W9E A;  3IVF A;  1E8W A;  3BWU D;  2IBI B;  4YSZ B;  2CHZ A;  3NHE B;  1EM7 A;  1H8C A;  1UF0 A;  3UGB B;  3JSV B;  3PHW B;  1KLG D;  3WAN A;  2MJD A;  3SDL C;  2JWU A;  4A8X C;  4RF0 A;  3ENE A;  2LVQ A;  3K9O B;  1Q5W B;  5HI1 A;  4TQ0 A;  4BKT A;  3U52 E;  2MA9 B;  1FNV A;  5DCN A;  5CHF A;  4NQK E;  1SIJ A;  1V8C A;  2C7M B;  1TZ1 A;  1OQQ A;  3Q8E A;  1YJJ A;  2XEW A;  2PEA A;  1KH0 A;  3RNB C;  5JH5 C;  2WLB A;  4G11 A;  4G0N B;  3KQ4 A;  3E56 A;  2K22 A;  1R7S A;  2AQ2 B;  3DHI C;  2NTS A;  3RNF C;  1I4H A;  3TEZ A;  1L0Y B;  4JL9 A;  4EFO A;  1N62 A;  4ARI A;  3W5V B;  3ZW3 A;  4DHJ B;  1I4X A;  1JRP A;  1YN3 A;  2JVC A;  2AX5 A;  1HXY D;  1F0Z A;  2MW5 A;  2W54 A;  3ZVV A;  1TKE A;  1VZ7 A;  2JPH A;  2L8J A;  3RT3 B;  2ICI A;  4C4V A;  5EE1 A;  3L10 B;  4ITK A;  4ANX A;  2ZPY A;  2J53 A;  3ZGZ A;  3EUB 2;  2UWQ A;  3WAO A;  3T9L A;  3ZLZ A;  1T0S C;  2WXL A;  1LFD A;  4M00 A;  3L08 A;  1SE4 A;  3MJ5 A;  1D5X C;  4BOS C;  4HWI B;  3A1Q A;  2XK5 B;  2Z8L A;  2ZEQ A;  3DBL B;  1CK1 A;  3VTU A;  2PKO A;  2FCS A;  3GE3 C;  5IA7 A;  1XCT L;  3V60 A;  3IAS 1;  2ASQ A;  1RWS A;  2KJ6 A;  3A9J B;  3PRZ A;  5LXI B;  4ICU A;  3B08 A;  3P4R B;  4E71 A;  3EC8 A;  2JF5 A;  1JWM D;  1VZ6 A;  1P98 A;  2BKF A;  1WJ4 A;  3FAH A;  3A9K B;  3AEF B;  2LAS A;  1ZDV A;  4IM0 A;  3JSV A;  4A55 A;  2G45 B;  3ZRC A;  4A9A A;  2BYV E;  4HPP A;  3SEB A;  2KO3 A;  2WX0 A;  1FD6 A;  3VQI A;  2QHO A;  3ZTC A;  3CWI A;  2JT4 B;  2KDM A;  4GXB A;  1FO4 A;  2QIL A;  1J19 A;  4IM3 A;  3UQA A;  1SBB B;  1V1O A;  4RM9 A;  3OAW A;  1HE8 A;  3R7R A;  1M4V A;  1UNS A;  4ZRI A;  2LGS A;  2CHX A;  1E8X A;  3Q3F A;  2MBO A;  1R4N B;  4PS7 A;  5GMV A;  3Q2A C;  2KLG A;  4DHJ D;  2RDB C;  3FIL B;  3EEC A;  3ZIM A;  1OEY J;  4NJ6 A;  1GB4 A;  3RUL A;  1FXI A;  2NBV B;  1GJZ A;  4AWJ A;  4FA6 A;  4GDK B;  1JAL A;  1ET9 A;  1QOF A;  2BT6 A;  2RD0 A;  1E90 A;  3RPF C;  2BS4 B;  3PZ7 A;  1ZUD 2;  3DBH I;  1TJE A;  4FHK A;  2KN4 A;  2FAZ A;  4KKJ A;  1WGD A;  2WQY B;  4KZC A;  2N9X A;  2M17 A;  1MI0 A;  3L13 A;  1VRA B;  1QT9 A;  4MDK E;  2ACZ B;  4OVZ A;  3QC8 B;  4TMA B;  2LXA A;  3W1S A;  2KDI A;  3AE3 B;  3PLU A;  4IKG A;  3RZF A;  3TEX A;  2IND C;  5BYR A;  4AP4 C;  4FJY A;  2PJH A;  2LUE A;  3DBR I;  3L0W B;  1ZXI A;  1EU4 A;  4MGZ E;  4LNK A;  3UIP B;  3UQB A;  4M0W B;  4TSS A;  1XF5 L;  1GAQ B;  3CSF A;  5IOI A;  3M63 B;  4BZA A;  3EHV A;  4WWO A;  2C7N B;  1A70 A;  2LVO A;  1EWC A;  1WRI A;  1F52 A;  5L83 A;  1XXG A;  2N1W A;  3C19 A;  1GG3 A;  1WYW B;  1KM7 A;  3RNA C;  1YIW A;  1ZDX A;  2BYT A;  1PGA A;  2M0A A;  3PHX B;  4B6W A;  1BXT A;  4WWP A;  4B95 A;  1YN4 A;  2JQR B;  4ANU A;  1IUE A;  4OZC A;  3MC9 A;  4RGT A;  2H88 B;  2JXT A;  1TKG A;  4ASW C;  3KVF B;  2WDT B;  2PIA A;  2WXJ A;  3AH7 A;  4W9G A;  4HCN B;  2LGD A;  2AL6 A;  1WX8 A;  1WXA A;  3X23 A;  1PDX A;  2Z59 B;  2MX2 A;  4EZJ A;  2LFI A;  3KUD B;  3FIL A;  4MSQ B;  4WQO B;  2KX3 A;  1WGY A;  2M0X A;  5BYQ A;  2KMA A;  3W5U B;  2CU3 A;  2L0F A;  1FCC C;  4HVB A;  1ACC A;  2TSS A;  5IO9 A;  3DWM A;  1M94 A;  2NCN A;  2UYZ B;  4GLS C;  4KZ0 A;  4WQM A;  4ZRK A;  4HK2 A;  1L2N A;  3ALB A;  1V49 A;  1SB3 C;  2W55 A;  3I57 A;  3BK1 A;  2V9H A;  2KTR A;  2NR2 A;  3APC A;  3VH4 B;  3H8H A;  3NJT A;  4DWF A;  2WP9 B;  2QDF A;  3NVW A;  2G4D B;  3R8B A;  3ABV B;  2BKR B;  4C00 A;  2HE7 A;  2H89 B;  3HIZ A;  1I4G A;  1C78 A;  2B3A A;  4BKS D;  4MM3 B;  3M3J A;  4BKS A;  1S1Q B;  1YQB A;  2XNA C;  3QQ8 B;  2V4L A;  3QA8 A;  2BWE S;  2NPT B;  3QIJ A;  4P16 A;  5J2R A;  4KDL B;  2MSE D;  1PGB A;  1WGH A;  2IO2 B;  3MHZ A;  3L54 A;  1FM0 D;  4N58 A;  2MLB A;  3B2G A;  4II2 B;  4ANW A;  1VJK A;  3H7P A;  4TKN A;  3M95 A;  4RH6 A;  4IOI E;  3MP9 A;  4MAC A;  4OW0 A;  2DLB A;  2GBJ A;  1WR1 A;  2ZZP B;  4J6I A;  4EKU A;  4IUM B;  1ZP0 B;  2KJH B;  1C4C A;  2ZNV C;  3MHS D;  2LEK A;  3ZKJ C;  1QQR A;  3B2F A;  3OJ4 B;  4KV2 A;  2IGG A;  5CHV C;  1VCB A;  2KWV B;  4LLG M;  5JHB A;  1NEN B;  2RPQ A;  3N30 A;  4IW0 A;  5J17 A;  2M19 A;  4BAX A;  1WR6 E;  3A4R A;  1EF1 A;  1KF6 B;  4NJC A;  4WWN A;  4JWS C;  3JVZ X;  1UWM A;  2NVU I;  1X1M A;  3E9S A;  4RNA A;  1YX6 B;  4YTP B;  3V61 A;  4TV3 A;  4HXD A;  2KMM A;  2L76 A;  2V4I B;  3R3M A;  1WX9 A;  2Z0D B;  3DHG C;  3IAM 1;  1ENF A;  1CJE A;  4YTM B;  4HLE A;  1E7P B;  1WZ0 A;  3PZD A;  1J7A A;  3CST A;  2HTH A;  4K1R B;  2K3U A;  5IN7 A;  2LXC A;  3HVZ A;  1ZE3 D;  2DYB A;  1XCQ L;  1E10 A;  4DXG A;  2N9E B;  1JW9 D;  1K53 A;  1FRR A;  1WJU A;  3PGE A;  4GOC A;  4N59 A;  1WXV A;  3N1Y C;  1ZXH A;  2GBN A;  3WAM A;  1UWX A;  3BY4 B;  1P7F A;  4YWG G;  2K0P A;  3DDC B;  3AE9 B;  3AEE B;  4XWT A;  1SJE D;  3T3N A;  2V3P A;  5JZE B;  4PS8 A;  2JYT A;  2DZJ A;  4YSX B;  1F9J A;  1IBX B;  1WE6 A;  2KQ7 A;  4W9L A;  4MM3 A;  1TS3 A;  4EE2 A;  3AE2 B;  2L7R A;  2QCZ A;  3AE6 B;  1L4Z B;  4IG7 B;  2INP E;  3ZJT A;  2M8S A;  2MBQ A;  1C4A A;  2KD0 A;  1LXD A;  4L23 A;  3P4S B;  2WXM A;  3Q3N C;  1MHX A;  2UU7 A;  2WU2 B;  4HJK A;  3Q3M C;  5D7G A;  2KT7 A;  1FXT B;  1PQS A;  4K7S A;  3KH0 A;  1TS5 A;  2DX5 B;  5C2T B;  1WRD B;  2D3B A;  1L6V A;  4WJO A;  4DQO C;  3KUZ A;  4OVU A;  2KFK B;  2MWS B;  1TS2 A;  1JML A;  1F1H A;  3QHT A;  3QJZ A;  3QWZ B;  4WIP A;  1QLB B;  4FJZ A;  3APF A;  2L83 A;  2BB6 A;  3AE7 B;  2DAJ A;  2JU6 X;  4MGY E;  2V3S A;  1WI0 A;  2WS3 B;  3WAP A;  3PPA A;  1Q0W B;  3TEW A;  3IBE A;  2WNM A;  2D5G A;  1E0Z A;  2J52 A;  2KQ4 X;  2W9N A;  1P0R A;  4LJO B;  1IP9 A;  4OVV A;  1YQ4 B;  2N0S B;  2VZK B;  3NS1 A;  1Q1O A;  5BMG A;  4YTN B;  2CJN A;  2RDH A;  4AJW A;  3OWE B;  2IZV B;  1WMH A;  1Y56 A;  1WGR A;  4URK A;  4BBN C;  2WU5 B;  3DVG X;  4HPM B;  1WM3 A;  1XQQ A;  2GI9 A;  2L32 A;  3SFE B;  4TQ1 A;  4DHZ E;  2LI5 A;  3TJP A;  3IT4 B;  1B9R A;  4MGK E;  1E9M A;  3KYD D;  3BII D;  1N63 A;  5FR3 A;  1WXS A;  3EFU A;  2L00 B;  2Y5P A;  1WGG A;  2M1M A;  4X57 B;  3TEY A;  1YN5 A;  3PRE A;  3HVD A;  3DBR B;  3AM9 A;  3TL5 A;  1IBX A;  3Q69 A;  5D2M B;  1I35 A;  2K25 A;  1KLU D;  4ZRJ A;  4PYU A;  4LCD E;  1IPG A;  3NRZ A;  2M4N A;  3TIX A;  4EEW A;  2WXP A;  3D32 A;  3PVL A;  4S17 A;  2RPV A;  4TUU A;  2J4X A;  3VTV A;  4XX5 A;  4PT5 A;  3N9Y C;  4IWO A;  3Q8C A;  2AWT A;  2O6V B;  3AE4 B;  1OQR A;  3DWG C;  4CQN A;  3AEG B;  3AMZ A;  1D6E C;  3VRB B;  1QOA A;  1JRO A;  4NZL B;  2PMV A;  1SE9 A;  5DPW A;  2ZVN A;  2LWP A;  2HDE A;  1XO3 A;  3ZXV A;  2KFK A;  3VXW A;  2K9X A;  3MC8 A;  3H6N A;  5KHO A;  2BQQ A;  1HZ5 A;  2LJI A;  2J0K A;  1NVI D;  3CIR B;  4LK0 M;  1WF9 A;  1XT9 B;  4EZK A;  2D10 A;  2GBM A;  2CKH B;  4OZB A;  3N32 A;  1MHH E;  3I9V 1;  1GOZ A;  3AUL A;  2WHI A;  2Z0E B;  4ZOH C;  4AS1 A;  1Y8R C;  2FCN A;  2WX1 A;  3VUW A;  1TY0 A;  3NY5 A;  2IO0 B;  1E6E B;  2K6D B;  3HUI A;  4WUR A;  1FIQ A;  2WXK A;  1FXA A;  3IXS A;  2LHD A;  3TCA A;  1R4M I;  2VZK D;  3P63 A;  2BPS A;  3IG3 A;  4P6V F;  1QOG A;  3VHT C;  3RNC C;  1C79 A;  1WWT A;  2KYW A;  3M62 B;  4FAD A;  1VD2 A;  4NAM A;  4XGA B;  2ZNV B;  2L3Z A;  2C60 A;  1YQ3 B;  3OJ3 A;  3GZN I;  5BYS A;  5IKC M;  4XE0 A;  1AYF A;  4Q2J A;  5IAA C;  1AWD A;  2KLC A;  3W2D A;  2HJ8 A;  2LJ5 A;  1P1A A;  2ON8 A;  3GP7 A;  3RNE C;  1XLN A;  2DBY A;  2LGY A;  3VR9 B;  5HFY A;  5TR5 A;  3NZS A;  5EE0 A;  1OFF A;  1SF0 A;  2OED A;  2RSU A;  5DPR A;  2IGD A;  1L4D B;  4NJ7 A;  3RFZ B;  1CMX B;  1T0R C;  3AB5 A;  2G3Q B;  1OTR B;  2KOX A;  2O6V D;  3VTW A;  2O6V A;  4WAA A;  1UH6 A;  1D4B A;  3AU5 A;  4IDI A;  1E7U A;  2BW2 A;  2VH1 A;  3HHM A;  3WA0 A;  2V0G A;  1K8R B;  4P1B C;  4DDG D;  3IHP C;  4IWP A;  2IY1 B;  2R2O A;  4XC2 A;  2QEJ C;  3KWL A;  2X8X X;  3OG5 A;  4HDQ A; 
#chains in the Genus database with same CATH homology
 2LUM A;  4REZ A;  2RMM A;  2FBW B;  1J7B A;  4MM3 B;  3R2T A;  2XNA C;  5MPO A;  5FKA C;  3URY A;  4GDL B;  2AQ1 B;  1F2R I;  3AEB B;  1L5P A;  2IGH A;  2PVO D;  4KX6 B;  1N5X A;  4P16 A;  1UGJ A;  3BVG A;  1WYG A;  2SEB D;  3BK2 A;  2I38 A;  2QJL A;  1PGB A;  2BB5 A;  1QIL A;  2GB1 A;  3MHZ A;  2V3N A;  1FM0 D;  4N58 A;  2E6X A;  2ZW0 A;  4HEA 1;  5BMH A;  3B2G A;  4ZHO A;  1VDV A;  1VJK A;  1J7C A;  3MC0 B;  1BML C;  1SXT A;  1DOX A;  4RH6 A;  1NEK B;  1TKY A;  2EKI A;  3NZ3 A;  4OHJ A;  3SR6 A;  4IOI E;  2KAJ A;  3MP9 A;  4MT5 A;  4MAC A;  4HRO A;  4OW0 A;  2DLB A;  4HJG E;  1IGC A;  1DOY A;  1ZP0 B;  1VR9 A;  2PVG C;  3GS2 A;  1C4C A;  4B0E A;  2LEK A;  5I4D A;  3AEA B;  1CQV A;  1RM6 C;  1AW7 A;  1QQR A;  3B2F A;  2IGG A;  1K50 A;  2NMQ A;  4JWU C;  3L4P A;  4LLG M;  1RYJ A;  1STE A;  2G1E A;  1NEN B;  2SAK A;  2M19 A;  1KF6 B;  4NJC A;  2MJE A;  1K52 A;  2WXR A;  2WXN A;  2X38 A;  1JWB D;  4JWS C;  4L2Y A;  5BMI A;  2Y3A A;  4ZRP A;  3ZQ4 A;  1UWM A;  3EA6 A;  3BWU D;  3Q8B A;  2BS2 B;  4YSZ B;  3E9S A;  3PZ8 A;  4RNA A;  2YEP F;  4YTP B;  5G5G A;  5AUK A;  2JYE A;  4OZA A;  2W3R A;  2KMM A;  1EM7 A;  1SE3 A;  2V4I B;  1V1P B;  1KLG D;  3IAM 1;  1ENF A;  1CJE A;  4YTM B;  1F2R C;  1E7P B;  2MJD A;  3AE1 B;  2JWU A;  4A8X C;  3AED B;  4RF0 A;  1J7A A;  2M56 B;  2NTT A;  1QOB A;  1TY2 A;  3BZD B;  3NVV A;  2INN E;  5HI1 A;  2K3U A;  4TQ0 A;  3U52 E;  4HKQ A;  1FNV A;  3HVZ A;  1SSN A;  4ZRQ A;  1GPX A;  1ZE3 D;  1SIJ A;  2PLP A;  1V8C A;  1HEZ E;  3AEC B;  1OQQ A;  3B9J A;  3Q8E A;  1YJJ A;  1KH0 A;  1XCQ L;  1N61 A;  4RFB A;  1E10 A;  4DXG A;  1JW9 D;  1K53 A;  1FRR A;  4JE3 B;  3AN1 A;  4N59 A;  2WLB A;  1WSP A;  1ZXH A;  2N9K A;  3T3O A;  1UWX A;  2KAC A;  3KQ4 A;  5HHD G;  3E56 A;  5C3J B;  1P7F A;  2K22 A;  2R61 A;  1FNW A;  1R7S A;  2AQ2 B;  2MJ3 A;  2K0P A;  2NTS A;  4YWG G;  3AE9 B;  4JX1 C;  3NUH B;  2QIE B;  3AEE B;  4XWT A;  3ZYY X;  1HZ6 A;  1I4H A;  1SJE D;  3T3N A;  3TEZ A;  1L0Y B;  2YEP B;  2GRI A;  2V3P A;  4B0M A;  4YSX B;  1KFY B;  2JYT A;  1N62 A;  4USA A;  3W5V B;  4ARI A;  1IBX B;  2MEK A;  1TS3 A;  1I4X A;  4EE2 A;  1JRP A;  3AE2 B;  3ZJV A;  1YN3 A;  2AX5 A;  2BS3 B;  3AE6 B;  1L4Z B;  1HXY D;  1F0Z A;  3ZJT A;  2INP E;  2W54 A;  1TKE A;  1FEH A;  4RGN A;  4ARC A;  1VZ7 A;  1C4A A;  2ICI A;  4YXD B;  1K51 A;  5EE1 A;  5H8Y E;  4L23 A;  3P4S B;  4ITK A;  4RGO S;  2WXM A;  2J53 A;  4M0W A;  3ZGZ A;  3MFG A;  1PFD A;  2QSD A;  1MHX A;  2WU2 B;  2WXF A;  1DYQ A;  3EUB 2;  3BVZ A;  5JXV A;  5D7G A;  1GB1 A;  2WXL A;  3SFD B;  5EE9 A;  1MPE A;  4C56 C;  1TS5 A;  5C2T B;  1SE4 A;  1AN8 A;  3MJ5 A;  1L6V A;  4DQO C;  1D5X C;  1I7H A;  2LMC A;  2Z8L A;  3U4E G;  1TS2 A;  2WXG A;  1JML A;  1TZO A;  1CK1 A;  2PKO A;  4WIP A;  1I4P A;  1EWY C;  1XCT L;  2DYM A;  1ESF A;  4ZHP A;  1QLB B;  2L83 A;  2BB6 A;  3IAS 1;  3AE7 B;  4YT0 B;  1V97 A;  1RWS A;  5H92 C;  2JU6 X;  2ZW1 A;  1PGX A;  2WS3 B;  4A6Q A;  3BVM A;  4US9 A;  3P4R B;  3PO0 A;  4ZYS A;  1JWM D;  1ZOY B;  3TEW A;  1VZ6 A;  2WNM A;  1FCL A;  2D5G A;  5T8I A;  4AQ7 A;  1E0Z A;  3FAH A;  1RFK A;  2J52 A;  4O1N A;  2KQ4 X;  2Q5W D;  3AEF B;  3TUO A;  4MH8 A;  1UUP A;  4RCO A;  1DGJ A;  1ZPS A;  4RGM A;  1VLB A;  1YQ4 B;  2N0S B;  1ZDV A;  2VZK B;  1NYR A;  3AE5 B;  3NS1 A;  5BMG A;  1C76 A;  1V1P A;  4YTN B;  2CJN A;  4A55 A;  2RDH A;  3LB8 C;  3OWE B;  1Y56 A;  4A9A A;  3SEB A;  2WU5 B;  2I2Y A;  1FD6 A;  3VQI A;  4UDU C;  2GI9 A;  2L32 A;  1VZ8 A;  4R3D A;  3CWI A;  3SFE B;  2KDM A;  4TQ1 A;  3IT6 B;  1FO4 A;  3C8Y A;  4KGR A;  2QIL A;  3IT4 B;  1B9R A;  1N60 A;  1E9M A;  5G5H A;  1SBB B;  3BII D;  2WXQ A;  1N63 A;  2WDV B;  1V1O A;  5FR3 A;  3P1M A;  4WH4 A;  3BYT B;  3HRD D;  1P7E A;  2Y5P A;  1IGD A;  1M4V A;  1UNS A;  3U2S C;  2JSV X;  4L1B A;  2IPK D;  3TEY A;  2W82 A;  1YN5 A;  4D2K A;  1YMH E;  3KLS X;  2PW9 A;  1XLP A;  3V05 A;  3HVD A;  3AM9 A;  1IBX A;  2JX5 A;  2QMT A;  3Q69 A;  3P4Q B;  3FIL B;  1KLU D;  5LNK 1;  1FMA D;  5EE3 A;  1GB4 A;  1FXI A;  1FNU A;  1F77 A;  3NRZ A;  3NVZ A;  2HTM E;  2WXP A;  1ROE A;  2WDQ B;  1SEB D;  2RPV A;  2J4X A;  4GDK B;  1JAL A;  4WAF A;  1D5M C;  1ET9 A;  1QOF A;  4PT5 A;  2BT6 A;  3N9Y C;  3Q8C A;  3RPF C;  2CJO A;  2BS4 B;  2FUG 1;  1XEE A;  3AE4 B;  3PZ7 A;  4YSY B;  1OQR A;  1ZUD 2;  1B1Z A;  1TJE A;  3DWG C;  4CQN A;  3AEG B;  3AMZ A;  2KN4 A;  1D6E C;  3VRB B;  1QOA A;  1JRO A;  4NZL B;  2PMV A;  1FFV A;  4KKJ A;  2WQY B;  4FXC A;  1MI0 A;  2HDE A;  1HA5 A;  1VRA B;  1XO3 A;  2LHE A;  3R2I A;  1T3Q A;  4C7Z A;  1QT9 A;  2ACZ B;  4OVZ A;  2IDY A;  1TS4 A;  2K9X A;  2N9L A;  4H2A A;  4TMA B;  3W1S A;  3AE3 B;  4IKG A;  4XDC A;  2N7J A;  3TEX A;  3WCQ A;  2ONQ A;  5BYR A;  2BTE A;  4RF1 A;  1C9F A;  1HZ5 A;  2LJI A;  3FC4 A;  1KRH A;  1ZXI A;  2E3T A;  4N6E B;  1EU4 A;  1NVI D;  3AE8 B;  2IJ0 A;  3CIR B;  5E6J A;  4DXF A;  2WXO A;  1Q10 A;  1WGK A;  4LK0 M;  1TYG B;  1YNT E;  4TSS A;  1XF5 L;  4OZB A;  1N5W A;  1ET6 A;  1MHH E;  3I9V 1;  2WDR B;  1GAQ B;  1GOZ A;  5GXG B;  4ZOH C;  4AS1 A;  1JCK B;  3TSS A;  3GB1 A;  2AQ3 B;  3NVY A;  3VR8 B;  1TY0 A;  1E6E B;  1FFU A;  3HUI A;  4WUR A;  5D3I B;  1FIQ A;  1A70 A;  2WXK A;  3U7Z A;  1FXA A;  3IXS A;  2LHD A;  1PUT A;  2KWD A;  2VZK D;  4XDD A;  3P63 A;  3P42 A;  1EWC A;  1WRI A;  4P6V F;  1YJI A;  1QOG A;  4JPS A;  1XXG A;  1I4Q A;  1JWS D;  4KGT A;  3VRA B;  1C79 A;  1WWT A;  1XLO A;  3KWV A;  1I4R A;  1CZP A;  4NAM A;  1ZDX A;  2BYT A;  1LO5 D;  1PGA A;  2EEL A;  1MVK A;  2M0A A;  2W3S A;  2DYO A;  3ZJU A;  1YQ3 B;  3Q8A A;  2WXI A;  1BXT A;  1L0X B;  5BYS A;  1L6U A;  1YN4 A;  2JQR B;  1EU3 A;  1IUE A;  4XE0 A;  1AYF A;  2K5P A;  2Y5C A;  4OZC A;  5AUI A;  2J42 A;  4LTU A;  4Q2J A;  1DOI A;  1SE2 A;  2WXH A;  4RGT A;  2H88 B;  1FRD A;  2JXT A;  3Q8F A;  1AWD A;  1T5X D;  1TKG A;  2OHF A;  1T6B X;  1NYQ A;  2L52 A;  3W2D A;  1KTK A;  2ON8 A;  3GP7 A;  2PIA A;  3J9C A;  4J3O D;  2G9H D;  2WXJ A;  3EGR A;  3O13 A;  4WWM A;  3LYY A;  4C7Y A;  1JWA D;  3AH7 A;  2DWQ A;  1BUI C;  3LXF A;  1QF6 A;  4NAW B;  3UI3 A;  1XLN A;  2BBC A;  1PDX A;  2DBY A;  5TSS A;  3VR9 B;  5HFY A;  2LFI A;  1C4P A;  3FIL A;  2FE8 A;  5EE0 A;  5FK9 C;  1D5Z C;  2LGI A;  2RDG A;  5HG2 A;  1OFF A;  5BYQ A;  3W5U B;  4C80 A;  1SF0 A;  2CU3 A;  2OED A;  2XN9 C;  1FCC C;  2IGD A;  4A90 A;  1L4D B;  4KGS A;  1ACC A;  4HRS A;  2TSS A;  3DWM A;  3RFZ B;  1HQR D;  2PTL A;  3AB5 A;  3P4P B;  4KKI A;  4GLS C;  4XWW A;  4WQM A;  3V3X A;  4US8 A;  3ETR A;  1JQ4 A;  2B76 B;  2MH7 A;  1SB3 C;  1XLQ A;  3BYY B;  2W55 A;  1L0V B;  2L1A A;  3BK1 A;  3I57 A;  4HKZ E;  4IDI A;  1D4B A;  2BW2 A;  3H8H A;  2JZP A;  2WP9 B;  1PYW D;  2V0G A;  1SJH D;  3NVW A;  3R8B A;  2QEJ C;  5D3D A;  3W9C B;  1JWU D;  3ABV B;  3KWL A;  1QKZ A;  1NI3 A;  1C77 A;  3AV8 A;  1WXQ A;  2H89 B;  1I4G A;  1C78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...