3LXFA

Crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRLPALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Molecular characterization of a class I P450 electron transfer system from Novosphingobium aromaticivorans DSM12444
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Metal binding protein
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lxfA00
4KX6B 3NVZA 5C2TB 1R7SA 2L52A 1DOYA 5MPOA 1QF6A 4WQMA 2EKIA 1L6UA 3AEDB 1QOAA 4YXDB 4US9A 4P6VF 2CU3A 5H92C 3RPFC 1FMAD 2B76B 1A70A 2M19A 2BS2B 5AUIA 1JALA 4N58A 2K22A 1E7PB 3B2GA 1WWTA 2WDRB 1NENB 3AE1B 2MH7A 3BIID 5GXGB 4WWMA 3P4RB 4ZOHC 1RFKA 2G1EA 2DBYA 2OHFA 2QIEB 3AV8A 3AEAB 3P4QB 5G5HA 2H89B 3VR9B 3AE3B 1FIQA 1WRIA 1AYFA 1KRHA 1J7AA 1NYQA 1JW9D 2MJEA 3HVZA 3HRDD 3AE7B 1L5PA 2E3TA 1VLBA 3AB5A 5EE0A 2W54A 2DWQA 4US8A 5G5GA 4N6EB 1ROEA 1RYJA 2WP9B 3B2FA 2Q5WD 3ETRA 3W9CB 2BS4B 1NVID 2K9XA 1FRDA 3KWLA 4YTPB 1VDVA 3B9JA 1N62A 3AE9B 4HRSA 3CIRB 2WQYB 1N61A 1KF6B 3AE5B 1YQ4B 3P4SB 3SFDB 1SF0A 3AMZA 4JX1C 1E10A 1NYRA 2BT6A 3FC4A 4YTMB 2WU5B 1WYGA 1DGJA 3NRZA 1TKEA 4YT0B 4C80A 3SFEB 1ZOYB 4C7YA 3ZYYX 3AECB 3AE4B 1FM0D 3AEBB 3LB8C 2H88B 3VR8B 2L83A 1UWMA 3P1MA 2M56B 1F0ZA 1N5WA 1NI3A 1QT9A 1OFFA 2CJNA 1FXIA 3HUIA 1SB3C 1YJJA 3LXFA 4ZHOA 3AEEB 2CJOA 2WU2B 1FFUA 4A9AA 1JWBD 3EUB2 2WDQB 5EE1A 2K5PA 3SR6A 3AEGB 1EWYC 1N63A 2JQRB 1T3QA 2W3RA 1B9RA 1RWSA 4C7ZA 4YSZB 1PDXA 1PFDA 2LEKA 1TYGB 3NVYA 4JWUC 1XLOA 2MJDA 3CWIA 3AEFB 3NVWA 1GAQB 2BS3B 2HTME 3AN1A 1QLBB 3AM9A 3ABVB 2QJLA 1XLNA 1OQRA 2WS3B 5H8YE 4ZHPA 2ACZB 4YSXB 1I7HA 3AH7A 3VRBB 4HROA 3P63A 2JX5A 5EE9A 1FXAA 1E6EB 1OQQA 1CZPA 1V8CA 1XO3A 1IUEA 1L6VA 1KFYB 2KAJA 4IDIA 3AE8B 1WXQA 1L0VB 3P4PB 1CJEA 1QOBA 1TJEA 2W3SA 3W5VB 2MJ3A 3W5UB 3WCQA 1GPXA 1TKGA 3FAHA 5C3JB 2W55A 1J7CA 5AUKA 4FXCA 4USAA 1XLPA 2AX5A 3VRAB 1RM6C 1NEKB 1TKYA 1E9MA 2N0SB 1DOIA 3AE6B 1E0ZA 1AWDA 4YTNB 2KMMA 2PVOD 2WDVB 1PUTA 1ZXIA 1FO4A 1ZP0B 1DOXA 1FRRA 1J7BA 3DWGC 4N59A 2Y5CA 4YSYB 1ZUD2 3NVVA 4ITKA 1QOGA 3DWMA 1JROA 1N60A 1QOFA 1VJKA 1FFVA 1XLQA 1JWAD 1V97A 1JQ4A 3NS1A 2PIAA 2WLBA 4LTUA 1YJIA 3AE2B 3PO0A 4JWSC 5EE3A 1YQ3B 2PKOA 1SIJA 3L4PA 2FBWB 2PVGC 1WGKA 1JRPA 1N5XA
chains in the Genus database with same CATH superfamily
1UGJA 1V49A 5MPOA 1L6UA 5IN7A 1TS5A 3UI3A 1NENB 2KLGA 4XC2A 1K51A 3Q2AC 1SGHA 1NYQA 2XK5A 2XBBC 1L0XB 2E3TA 2R2QA 5EE0A 2KHWB 5C23A 3KUDB 4PK1A 2Q5WD 1JWUD 4RFBA 2DX5B 3MJ5A 3QX1A 2QMTA 1EUVB 1PGXA 1ZPSA 3AMZA 3M62B 4DDGD 4TV3A 5G2NA 1C76A 2KD0A 2K8CA 4XDDA 3KUCB 4MGYE 5BO4B 2ZPYA 1EWYC 3R66C 3IAM1 4C4VA 1HEZE 1UH6A 4LLGM 3AEFB 4EOYA 5AZGA 2WXOA 2LUMA 4ANXA 4LDTD 1LGRA 2XEWA 1IYFA 2KMCA 1HA5A 1V2YA 3O65B 5D3DA 2CKHB 1OTRB 2C5LC 2LVQA 2JYTA 3CSFA 3H7SA 4A90A 1ZXHA 4KGRA 2Z0EB 2NVUI 2JRHA 1GB1A 2MWSB 2JY6A 2NBWB 2SAKA 1WXSA 1WR6E 1N60A 2LZ6A 2DLBA 4BZAA 4MSQB 4GGQA 4JWSC 3A4SC 4HPPA 3DOWA 3PGEA 4AS1A 2RGFA 1JRPA 2D3GA 1Q10A 1WF9A 2EKEC 3DBRB 1UWXA 3RFZB 3N1XC 3NOBA 1ESFA 3RPFC 4F1SA 4GIVA 2WXQA 1AW7A 2DAJA 2CHZA 2WXLA 2ZJDA 3DBRI 3TEWA 4HEA1 2GLSA 3HRDD 3AE7B 2W54A 5G5GA 2VRRB 1YIWA 1VDVA 2BWES 1UZXB 2YEPF 3DPDA 2BT6A 5LLIA 2NR2A 2MEKA 3LB8C 2KC2A 3AE4B 4XX5A 1FNUA 4EKUA 3ZDMC 1UWMA 5J2RA 1GJZA 3LYYA 1V1PA 2TSSA 1VD2A 3A33B 1YJ1A 2EMTA 1BT0A 1N63A 3S2AA 4B6WA 2N1VA 5DPRA 3ZXVA 4M01A 3KH0A 3L10B 4GU2A 3CWIA 1UBIA 4KGSA 3WAOA 4RM8A 3KLSX 3SEBA 4MM3A 3WANA 1L4DB 2N7JA 4NNJB 3WALA 5CHVC 2JF5A 1SXTA 5C3JB 1F2RI 5AUKA 1B1ZA 4G3XB 2K1FA 1NEKB 3AE6B 2ZNVC 3JVZX 3N9YC 4KKIA 2VZKB 2MSED 4L1BA 4MGIE 4I6PA 1RRBA 4GSWA 2V4LA 1MHXA 3ZO5B 4M8NA 1V81A 2NTTA 4BOSC 2KWDA 2A4ZA 1AN8A 3QHTA 3N1ZC 1XEEA 2DENB 3AI5A 1V1PB 4M02A 3B0AA 4P1CC 4WJPA 3QARA 4C56C 3MFGA 2FCMA 1E8ZA 1WWTA 1YD8U 1ET6A 1WGRA 2I1KA 4HLEA 2WXGA 4G50A 4MM3B 4RGOS 1WRIA 3Q8FA 3OLMD 1C4AA 4KZ0A 4ICVA 2ZVOA 1TS3A 3UF8A 1UUPA 4FJZA 2BS4B 1WGHA 1N62A 3QQ8B 2V3NA 1HTOA 2I2YA 4JX1C 3V61A 2WXFA 4LNNA 4C7YA 3ZYYX 4HXDA 4DWFA 2BVCA 3VR8B 3APFA 1F77A 4DHZB 2WU2B 1C4PA 3ZRFA 3A9JB 4XWTA 1IGCA 4QAYA 4IWQA 4EZJA 2L8JA 1KLGD 2DHZA 2PMVA 2XN9C 3B1LX 2D11A 3AN1A 2LGIA 3L17A 1CMXB 3EHVA 2AEHA 4XE0A 2KWVB 1XO3A 1SEBD 1KFYB 3K9OB 5CHWA 4G0NB 2BF8B 2LJ5A 1TKGA 2KLCA 3Q69A 4RH6A 2KJ6A 3B08A 1E9MA 2KMMA 2L0TA 3PVLA 3BK2A 4KSLC 3ZDTA 3HM3A 5D6JB 5J17A 3DWMA 3MC9A 1OQYA 1FXTB 3VVWB 1SE9A 1C79A 3MC8A 4ZRIA 1WJNA 4ARIA 2KQ4X 2WHIA 1QOAA 2VZKD 5GXGB 2EELA 4ANUA 3AE1B 5BYRA 2RDHA 3VQIA 2KTFA 3DDCB 3HVZA 2FAZA 4DQOC 1LFDA 2KJRA 3KWLA 3QC8B 3ZUNA 1XQQA 3ZKJC 2ZCCA 1FCCC 3QIJA 2LHEA 2KXJA 5JH5C 2JU6X 1GB4A 4RMAA 2I1JA 3JSVA 3SFEB 1F52A 4TQ1A 3EECA 3R7QA 1LM8B 3AEEB 1L4ZB 3C19A 2QC8A 2WDQB 2BYFA 1JWSD 4S0RA 1RWSA 4IUMB 2BB6A 2L0FA 3PRZA 2WX0A 2QSDA 1MHHE 4GDKB 2HTME 3ABVB 2B3AA 1XLNA 3WAMA 4KDLB 2IJ0A 1Q5WB 1D5MC 3DHGC 4NJ7A 3PZ7A 4AWJA 1WXQA 2K39A 5FR6A 1VZ8A 4YSXB 2W3SA 1K53A 3KW5B 1ZGUB 2ZNVB 1XLPA 5JZEB 2AX5A 3UIOB 2INDC 3OG5A 1PYWD 4NAMA 4HDQA 3WAPA 2WDVB 4HVBA 1ZXIA 1P1AA 3OWEB 4YSYB 1H8CA 4A8XC 2LGSA 1VJKA 1FFVA 3HHMA 1D3ZA 3AE2B 3I63C 1E5WA 2K0PA 5TR5A 4OZBA 4WIPA 2IGGA 4GOCA 1WZ3A 4NAWA 4DXFA 4KKJA 5HKHA 1C3TA 1JALA 2DZJA 3W1YA 4W9JA 4ZOHC 3ZNGC 3KYCD 2YVCA 2M17A 3RD2A 3L13A 2Y5BB 3SD5A 2C7HA 2KWCA 1VLBA 3I3TB 2JXXA 4MEMA 2RMMA 4EZLA 2CHXA 1I4GA 1WI0A 4EFOA 1SF0A 3UQAA 1OEYJ 2LJIA 4ICUA 3FC4A 4AJYB 2WU5B 1DGJA 2M0AA 4JGHB 3DBSA 1F1HA 2CR5A 3I57A 1NI3A 2PPHA 1OFFA 2CJNA 2N9XA 4K7UA 1YJJA 3OJ3A 2J53A 3A1QA 1FFUA 4BOZB 3A9KB 2KYWA 3IAS1 4IC7B 4MSMB 3H7PB 4HDOA 2MQJA 3IFWB 3QCAA 3L54A 1MJDA 4GMVA 3GZNB 2WS3B 5H8YE 1T0RC 2PE6B 3PREA 1HQRD 4OVVA 2DYOA 1QOBA 3U7DA 3M3JA 2ICIA 4JLCA 3GZNI 3MHZA 4K7WA 4USAA 2RDGA 2LWPA 2N1WA 1PQSA 4W9IA 2C7MB 2N0SB 1U4AA 2Y5PA 1KH0A 3TEYA 3E56A 4OZAA 3PHWB 3DWGC 4W9GA 3LDZE 5E6OA 3QJZA 4W9FA 4MACA 4IM2A 1YJIA 3TEXA 2JWUA 3L4PA 4JL9A 3ZW3A 3PHXB 3R8BA 1GC6A 2X8XX 4PT5A 2I38A 2N4FA 3PTFC 1FMAD 3MTNB 3IT4B 3MJWA 4HJKA 3RNEC 4WWMA 1Q0WB 1WGYA 2KJHB 3PS6A 2LUEA 2MJEA 1WE6A 3URYA 3PZDA 1NI2A 2HE7A 3V60A 2OOBB 3ETRA 1WX8A 1MFWA 2REXA 1HZ6A 4IOIE 1K52A 2DYBA 2L76A 1C9FA 1E10A 1FEHA 1S3SG 2KANA 5D3IB 3R2TA 1WMHB 1F0ZA 2IBIB 2WWZA 1WJUA 2CJOA 4M8MA 1WR1A 4A9AA 4TQ0A 4W9KA 1NBFC 2K5PA 2KFKB 1T3QA 2PLPA 2X38A 5E6NA 3Q3NC 2D5GA 5KHOA 5JHBA 2KVRA 3VDZA 2D2QA 1I7HA 4ARCA 1CZPA 3GE3C 4LNFA 3AE8B 2O2VB 4OZCA 1R4NI 4C00A 4FBJB 4NJ6A 2V4IB 4W9DA 2RR9A 1TIFA 1E0ZA 2WXHA 3KVFB 2HJ1A 2G4DB 2KX0A 2LRWA 2OEDA 3BVMA 2MX2A 3NS8A 2Y5CA 3VXWA 3U30A 3ZQ4A 3TUOA 2AQ2B 4W9EA 2CU1A 3ZJUA 1YMHE 1EM7A 1KLVA 2NPTA 1ET9A 3R2IA 2KDIA 4Q2JA 2CHWA 2XK5B 1XF5L 1CK1A 3N3KB 1WRDB 4KIKA 1OEYA 1GNUA 1L2NA 1VRAB 4IG7B 2MH7A 1TY0A 1RAXA 3P4QB 3I9V1 3QK0A 3TMPB 2V3PA 3VTWA 4US8A 2INNE 3VTUA 3W9CB 4A3PA 1I42A 4IW0A 3AE9B 3CIRB 3AE5B 5FR3A 4FHJA 4C4VB 1IPGA 3RYTA 2L1AA 4BKSA 4DXGA 1SB3C 4HKZE 2V1YA 2C7NB 3TBLD 1YX6B 2GBKA 4WJQA 5HFYA 2WXNA 2HJ8A 1Y8RC 3L0WB 2NPTB 3NVYA 5KHQA 3OAWA 3NVWA 4E3CA 3UQBA 1OGWA 2BS3B 2IO1B 3AM9A 3BYTB 2KFJA 1P9DU 3WCQA 1P0RA 4GN1A 1G6JA 4NQLB 2WXPA 2HDEA 2MW5A 4IWOA 3J9CA 1DOXA 3ML9A 3NZUA 1MVKA 3NVVA 1HTQA 3U7ZA 1ZW7A 4BKGA 2PIAA 2WXRA 1KTKA 4DHJD 3QAQA 3SDLC 1FNVA 4PS3A 5AZFA 3RNFC 3GP7A 4XZ4A 2O6VA 4GB9A 4WQMA 2EKIA 4OVUA 4K1RB 4P6VF 2K8BA 2BS2B 4W9HA 3TIXA 2K22A 3P4RB 2G1EA 1BXTA 4FJYA 2WXMA 2ZCBA 2IPKD 2RD0A 3GB1A 3U52E 2ON8A 4IWPA 1YN3A 2DYMA 3UINB 3APDA 2N7DA 1JW9D 2AQ1B 1C77A 3PSEB 3DBLB 1UGMA 1V6EA 1WJ6A 4HPLB 2JZZA 4REZA 4HRSA 1GOZA 5BMHA 3R7RA 3ZJVA 1LXDA 1MG4A 3DBLI 1GPXA 1ZOYB 1Y56A 1SJHD 2L83A 3P1MA 3Q8EA 1WYWB 2J42A 4AOFA 3VFKA 1B9RA 2LXAA 1C1YB 1PGBA 4JWUC 2BPSA 2GOWA 1WGGA 4RF1A 3IBEA 5CHFA 2MBHA 2ZZPB 4MH0E 1IGDA 3KYDD 1L6VA 4D2KA 2Y3AA 3W1SC 1SSNA 2G45B 3N20C 3RCZA 2J4XA 2KDEB 4JPSA 3T3OA 1R4MB 3VH3B 3BVGA 1DOIA 3VUWA 1ZKHA 4J6IA 2KACA 1JMLA 3ECIA 2WXKA 2GBNA 1ZP0B 1FRRA 4RGTA 2RPQA 2JSVX 1C78A 1T0YA 2KMAA 1R4MI 1LQBA 3ZGZA 2PKOA 1TT5B 1D4BA 3UGBB 2J52A 2NCNA 1VCBA 1A5RA 1TY2A 4F8CB 2JZPA 2R61A 1MG8A 4B95A 1TS4A 1E8WA 3AEDB 1XCQL 4YXDB 5LXHA 2B76B 1EU4A 2ZEQA 4N58A 3DVNV 3AEAB 2L00B 3SU8X 5G5HA 1FIQA 3AXCA 4BKSD 2MHJA 3VTVA 1RLFA 3DBHB 1E7VA 3B9JA 1X1MA 3SFDB 1D6EC 3GE8C 3R3MA 4CYEA 4S17A 2UU7A 1WYGA 4YT0B 4TSSA 4NZLB 1UBQA 1YNTE 3AU4A 3DBHI 3DVGX 4HK2A 2J0MA 1EF5A 2AL3A 4MT5A 3U4EG 3Q14C 2YLMA 1IP9A 3AEGB 2KDBA 4P7IA 4LNOA 4CQNA 2QJLA 4HROA 1H4RA 4DDID 4IDIA 1IUEA 4HKQA 3P4PB 1TJEA 5DPWA 2M8SA 1TZ1A 1N6ZA 2DNFA 2W82A 1SE3A 4YTNB 2GBMA 3M95A 1PUTA 2BQQA 5IA7A 4TMAB 2BYEA 4M0WA 4AUQC 4DBGA 3SHQA 1WIAA 1JQ4A 3NS1A 3DCGA 4LTUA 2D10A 3T9LA 1ISNA 1WGKA 3EC8A 4MGKE 4MH8A 3X0WA 1R7SA 1DOYA 1ZDVA 1I35A 4WAAA 3V6EB 1A70A 4EEWA 3W1SA 2ZVNA 4KSKC 1GC7A 2DBYA 1WFYA 2H89B 2K6QA 2Z59B 4IM0A 3JSVB 4II3B 2RSUA 4P1BC 3ZVVA 2MBBB 1ROEA 2J0JA 1SIFA 4WJNA 2D3BA 2LGYA 1F9JA 3P4SB 1NYRA 2MBOA 4YTMB 5DCNA 2MRPA 4PS7A 3JYUA 2KN4A 1YN5A 4FADA 3C8YA 3EFUA 2BGFA 3ZNHB 5HG2A 3N32A 2NBUA 5JXVA 3SR6A 3VUXA 4TUUA 3ENEA 2N9LA 2LD9A 3IT6B 1QQRA 1V1OA 1UF0A 1I4QA 2D3CA 2IZVB 2C9WB 3Q3JA 3V05A 2KX3A 2N9KA 2V9HA 1V86A 4BVUC 1L0VB 4OVZA 4XDCA 2NBVB 1KM7A 4K81A 2MA9B 3RNAC 3TCAA 2KZRA 4II2B 4NAWB 4HCPB 4N59A 3MHSD 4EUTA 1JROA 2DZKA 1JWAD 1V97A 2JRIB 1LO5D 1QKZA 2L32A 3PO0A 3ML8A 5EDSA 2MBQA 2DZIA 2PE9A 3EGRA 3PV1A 4FULA 3DHIC 4KDIC 1I4PA 4KX6B 2KT7A 2D3AA 1V5TA 4B0MA 3L16A 1JRUA 3BVZA 1WY8A 3WIMA 1TGZB 3BIID 2OJWA 3BK1A 1NDDA 3RMKC 4DXAB 2LXCA 2FNJB 2ZW0A 2ZPNA 3A1QB 1NVID 2KVZA 4YTPB 1E8XA 4AQ7A 5IOIA 2BWFA 1UELA 1ENFA 2FIFA 2YEPB 1F2RC 3NRZA 4WH4A 1FXIA 2L3ZA 3LXFA 1EU3A 1SE4A 1JWBD 4AJWA 2FIDA 4L23A 2M0XA 2RDBC 1YX5B 1XLOA 4K7SA 3ZXRA 2LFIA 3IXSA 2BBCA 3AH7A 1OQQA 1V8CA 2KAJA 4GXBA 4LK0M 2IY0B 3FAHA 3HK0A 1J19A 5BYQA 4ANWA 3K9PB 3NJTA 1AWDA 3DHHC 4OHJA 1E90A 4N9F4 1WX7A 4OW0A 4L2YA 1R4NB 2WX1A 1UNSA 3GOEA 4RF0A 1E8YA 3CF6E 4WQOB 1J8CA 3CMMB 2GBRA 3APCA 5T8IA 3C0RB 1HXYD 2M1MA 3X23A 4DHJB 2WDTB 4E74A 3RI7C 3NY5A 3NVZA 2ZW1A 2L52A 2AL6A 1GUAB 2NS5A 4CHKA 2LHDA 1L0YB 2WXIA 4LJOB 1TS2A 2UWQA 3AULA 5AUIA 1I4XA 2A5UA 1E7PB 3ZNZB 4ACFA 4ASWC 2QIEB 1D5XC 1I4RA 1ZDXA 1V80A 4LNIA 3NG0A 2MBEA 1CQVA 2GMIC 2WP9B 3Q6BA 3IG3A 4HWIB 2LASA 3GS2A 1YQ4B 3NZ3A 1WM3A 2HD5B 3QWZB 4C80A 1YN4A 2INPE 1K50A 3AEBB 4YL8A 5AEKB 5BYSA 1N5WA 3HUIA 1YOVB 3Q8AA 1SJED 4G11A 4ZDVA 4RM9A 2JQRB 1MPEA 4LJPB 4ZRJA 4URKA 1JCKB 4C7ZA 2KTRA 2M4NA 3HVDA 4RGMA 3Q3MC 3P42A 3RNGC 4RGNA 4ZRPA 1QILA 1P3QU 3U2SC 1E6EB 3N1YC 3W5VB 1CJEA 3KUZA 2W9NA 3HM6X 4NQKE 3PRMB 2W55A 3L08A 1DYQA 2WGSA 5FKAC 3ZIMA 3AU5A 2AWTA 1FD6A 1WE7A 5IKCM 4KIKB 1WSPA 3PZ8A 3DVGY 1V5OA 1Z5SB 5CTRC 4IM3A 4I6NB 5IAAC 3MP9A 1BUIC 1V9JA 1KOTA 3RN9C 5H92C 1STEA 2M19A 2KTRB 3E9SA 3B2GA 2WDRB 2D07B 2OHFA 3TSSA 3RUIB 4FHKA 3VR9B 2Z0DB 3AE3B 1XCTL 2N9PC 2KQSA 2INCC 4KVGB 2MLBA 2G4SA 1FRDA 3LJ3A 2QCZA 3PLUA 5G55A 1SBBB 3H1UA 2NMQA 3RZFA 1D5ZC 1YQBA 2K8HA 1TKEA 3RNCC 1WGDA 2M56B 4P16A 1WXVA 2MP2A 1TBEA 5CX3A 4KZCA 2PEAA 4YSZB 3OJ4B 4JQWC 2JXTA 4A6QA 3BINA 4B9KA 1OQRA 4KV2A 2ACZB 3KQ4A 2G3QB 2LRUA 2BB5A 3A9JA 2KKCA 2KN5A 2MJ3A 4RCOA 1ACCA 4WJOA 3IHPC 2IYDB 5D2MB 2GB1A 3TL5A 3CSTA 2JWZA 1WXAA 2O6VB 1WZ0A 2IGHA 1ZUD2 1P7EA 1SE2A 4M00A 2WLBA 4GLSC 2MCNB 3ZTCA 1EO6A 1SIJA 3ZLZA 3Q3OC 2K3UA 2PJHA 3FILA 5C2TB 5C1ZA 2FCNA 4JE3B 2MP2B 4US9A 1XXGA 3ZTDA 1FCLA 1WH3A 1Z2MA 2IGDA 3O13A 3EA6A 5J18A 2KDMA 3VHTC 1TZOA 3KWVA 2V3SA 2L05A 3AB5A 2DWQA 4ZRQA 2GBJA 1RYJA 3B2FA 4DK5A 2BKRB 2VH2A 3FKYA 3PPAA 1N61A 5AZHA 2QILA 1UD7A 4A20A 4FLHA 1KJTA 4O1NA 5HHDG 3WA0A 4BFRA 4J3OD 2LGXA 3D32A 4LNKA 1QT9A 3T3NA 4MJSA 3DQVA 5EE1A 1WM2A 4HPMB 4NJCA 2QEJC 2R2OA 1T0SC 4BBNF 3FILB 1TYGB 2KWUB 1P7FA 1M4VA 4WAFA 3PLVA 2CS4A 2LVOA 1FNWA 3ALBA 4PYZA 3JW0X 3NUHB 3ONSA 2JZ3B 2LGDA 2Z8LA 4BAXA 4FN2A 2WYQA 4NPNA 5LXIB 1HZ5A 4XGAB 1J0GA 2EMSA 2VH1A 4B0EA 4EZKA 2NTSA 4GDKA 2JT4B 4JIOU 1EWCA 3EFCA 2FCQA 3H6NA 3IVFA 1FO4A 4ITKA 3HIZA 3ZRCA 1MI0A 1QOFA 2C60A 3N30A 2DAFA 2IO2B 2N7EA 5EE3A 1XD3B 1YQ3B 2G9HD 2FBWB 2K6DB 3H9DA 2PW9A 4K3BA 3M63B 2N9EB 4MJSB 2K25A 1QF6A 4TKNA 2CU3A 2JYEA 3Q8BA 3TJPA 1WJ4A 3V6CB 2O6VD 4FJVB 1KLUD 4E71A 1RFKA 4I6LB 4BKTA 4XWWA 3AV8A 1IBXA 3PRPB 1I4HA 1XT9B 2HTHA 3PT2B 2KK8A 4GDLA 1VR9A 4YWGG 2AQ3B 1ZE3D 4N6EB 2K9XA 5DPSA 1S1QB 4IKGA 2JPHA 4DHZE 2L7RA 4XYCA 3T8MA 3MC0B 5IP4D 1EF1A 3P2BA 2ONQA 5DPTA 2QDFA 4EE2A 5L95C 1TTNA 2KO3A 4ZYSA 3QA8A 2W3RA 5E6PA 4CO7A 3BYYB 2BW2A 3RNBC 4WWOA 1PFDA 2MJDA 4UDUC 1P98A 4HCNB 1QLBB 4ZHPA 4F7ZA 1VZ6A 3VRBB 3P63A 2JX5A 1FXAA 4M0WB 3DVNU 3A9KA 5E6JA 1T0QC 3BZDB 4K3CA 1T6BX 1IBXB 3W5UB 2KOXA 4ANVA 3TEZA 3H7PA 4GDLB 2LMCA 3VRAB 4WWPA 5GMVA 1HE8A 2PVOD 2V0GA 4PS8A 2ASQA 3V62A 4KGTA 5IO9A 2OJRA 5JHAA 2IY1B 1QOGA 1C4CA 1E7UA 2PTLA 4RNAA 4HJGE 3H8HA 2LI5A 5D94A 3VUYA 3BWUD 2KDFB 3BY4B 3ZJTA 1K8RB 3ZNID 5TSSA 3Q3FA 4WWNA 1M94A 4A55A 2IDYA 2JVCA 3RT3B 3U8ZA 2XNAC 3A4RA 1JWMD 1WX9A 2J0KA 1PGAA 4ZYNA 2DZMA 2KNBA 1RFAA 2AYOB 2BYVE 2J7QB 2KQ7A 3VAWA 1QZEA 2FCSA 5L83A 1AYFA 3NHEB 1KRHA 1AARA 1J7AA 4MGZE 5BMGA 4H2AA 1L5PA 2IO0B 2BYTA 3Q8CA 1WXMA 4A3OA 4WURA 2RPVA 2KC1A 5FK9C 2WQYB 3RZWC 1KF6B 2LVPA 1L7YA 4BBNC 3I5JC 4LDTB 1BMLC 3AECB 1FM0D 2BTEA 2H88B 2BKFA 4LCDE 3RULA 5HI1A 2E6XA 2FUHB 4ZHOA 3EUB2 4W9LA 3W2DA 2JUOA 3V3XA 1Q1OA 1VZ7A 2QHOA 1PDXA 2LEKA 1FPYA 1GAQB 4PYUA 3NZSA 2GRIA 2IO3B 2SEBD 4MDKE 4X57B 1GG3A 1WMHA 4W9CA 5D7GA 2FE8A 4NY0A 5EE9A 4R3DA 2KFKA 4ZRKA 5LNK1 2WXJA 3UIPB 1J7CA 4FXCA 2WNMA 1RM6C 1TKYA 4FA6A 4AP4C 5BMIA 1J7BA 2GI9A 2O2VA 4MELA 1XLQA 5I4DA 2FUG1 1T5XD 2UYZB 2PVGC 3VH4B 1N5XA
chains in the Genus database with same CATH topology
1TY2A 1UGJA 2JZPA 2R61A 1TS4A 5MPOA 3MP9A 4DXFA 3AEDB 1L6UA 1BUIC 1XCQL 4KKJA 4YXDB 1TS5A 5H92C 1STEA 2B76B 2M19A 3UI3A 1EU4A 1JALA 4N58A 3E9SA 3B2GA 2WDRB 1NENB 4ZOHC 2OHFA 3TSSA 3AEAB 1K51A 5G5HA 3VR9B 3AE3B 1FIQA 1XCTL 1NYQA 1L0XB 2E3TA 1VLBA 5EE0A 2Q5WD 1FRDA 1JWUD 4RFBA 2RMMA 3B9JA 1I4GA 3SFDB 1SBBB 3MJ5A 2NMQA 1SF0A 2QMTA 1PGXA 1ZPSA 1D6EC 3AMZA 1D5ZC 2LJIA 3FC4A 2WU5B 1WYGA 1DGJA 4TSSA 1C76A 1TKEA 1YNTE 2M0AA 4NZLB 4YT0B 3I57A 2M56B 1NI3A 4P16A 1OFFA 2CJNA 4XDDA 1YJJA 2J53A 1FFUA 4MT5A 3U4EG 3IAS1 3AEGB 1EWYC 3IAM1 1HEZE 4YSZB 4LLGM 4CQNA 2JXTA 3AEFB 4A6QA 2WXOA 2LUMA 2QJLA 2WS3B 1OQRA 5H8YE 2ACZB 3KQ4A 4HROA 1HQRD 4IDIA 1HA5A 1IUEA 2BB5A 5D3DA 4HKQA 2DYOA 1QOBA 1TJEA 3P4PB 2MJ3A 2ICIA 4RCOA 2JYTA 3MHZA 4USAA 2RDGA 4A90A 2W82A 1ACCA 2N0SB 2Y5PA 1SE3A 1ZXHA 4KGRA 2GB1A 1KH0A 4YTNB 3TEYA 1PUTA 1GB1A 3E56A 4OZAA 4TMAB 2SAKA 2IGHA 3DWGC 4M0WA 1ZUD2 1P7EA 1N60A 1SE2A 2DLBA 4MACA 1JQ4A 3NS1A 2WLBA 4GLSC 1YJIA 4LTUA 4JWSC 3TEXA 2JWUA 1SIJA 3L4PA 1WGKA 4AS1A 2K3UA 1JRPA 4MH8A 1Q10A 3FILA 3R8BA 5C2TB 1R7SA 4PT5A 1DOYA 4JE3B 1ZDVA 2I38A 1UWXA 3RFZB 1ESFA 4US9A 3RPFC 1FMAD 1A70A 1XXGA 3IT4B 2WXQA 1FCLA 1AW7A 3W1SA 4WWMA 2DBYA 2WXLA 2IGDA 3O13A 2H89B 3EA6A 3TEWA 2KDMA 4HEA1 2MJEA 1TZOA 3KWVA 3HRDD 3URYA 3AE7B 3AB5A 2W54A 2DWQA 5G5GA 4ZRQA 1ROEA 1RYJA 3B2FA 3ETRA 1VDVA 1HZ6A 1N61A 3P4SB 4IOIE 1K52A 2QILA 2YEPF 1C9FA 1NYRA 1E10A 2BT6A 1FEHA 4O1NA 4YTMB 5HHDG 2MEKA 3LB8C 3AE4B 5D3IB 4J3OD 1FNUA 3R2TA 1UWMA 1F0ZA 1QT9A 3LYYA 2KN4A 1V1PA 2TSSA 1YN5A 2CJOA 3C8YA 4A9AA 4TQ0A 3T3NA 5EE1A 5HG2A 5JXVA 2K5PA 4NJCA 2QEJC 1N63A 3SR6A 1T3QA 2PLPA 2X38A 2N9LA 3FILB 1TYGB 3IT6B 1P7FA 1QQRA 1M4VA 2D5GA 4WAFA 3CWIA 1FNWA 1V1OA 3NUHB 4KGSA 3KLSX 1I4QA 3SEBA 2Z8LA 3V05A 1I7HA 1L4DB 2N9KA 1HZ5A 2N7JA 4ARCA 1CZPA 3AE8B 1L0VB 4OVZA 4XDCA 4OZCA 4B0EA 1SXTA 5C3JB 1F2RI 2V4IB 1B1ZA 5AUKA 2NTSA 1NEKB 3AE6B 1E0ZA 3N9YC 4KKIA 2VZKB 2WXHA 4L1BA 2OEDA 1EWCA 4NAWB 3BVMA 1FO4A 4N59A 2Y5CA 4ITKA 3ZQ4A 3TUOA 1MHXA 1JROA 1MI0A 1QOFA 2AQ2B 1JWAD 1V97A 2NTTA 1LO5D 1QKZA 2L32A 3PO0A 5EE3A 1YQ3B 2KWDA 3ZJUA 2G9HD 2FBWB 1AN8A 1XEEA 1YMHE 3EGRA 2PW9A 1EM7A 1V1PB 1ET9A 4KX6B 1I4PA 3R2IA 4Q2JA 4B0MA 1QF6A 1XF5L 1CK1A 2CU3A 2JYEA 3Q8BA 4C56C 1VRAB 3BVZA 3MFGA 1WWTA 3BIID 2MH7A 1KLUD 1TY0A 1RFKA 1ET6A 4XWWA 3AV8A 1IBXA 3P4QB 2WXGA 3BK1A 1I4HA 3I9V1 4MM3B 4RGOS 1WRIA 3Q8FA 2V3PA 1C4AA 1VR9A 4YWGG 4US8A 1TS3A 2AQ3B 1ZE3D 2INNE 1UUPA 4N6EB 2ZW0A 3W9CB 2BS4B 1NVID 2K9XA 4YTPB 1N62A 3AE9B 3CIRB 3AE5B 5FR3A 4AQ7A 2V3NA 2I2YA 1ENFA 4JX1C 4IKGA 2WXFA 2YEPB 1F2RC 3NRZA 3MC0B 4C7YA 3ZYYX 4WH4A 2ONQA 3VR8B 2L1AA 4DXGA 1FXIA 4EE2A 1SB3C 1F77A 1EU3A 3LXFA 4HKZE 2WU2B 1C4PA 1JWBD 1SE4A 4ZYSA 5HFYA 2WXNA 2W3RA 3BYYB 2BW2A 4XWTA 1IGCA 4L23A 1PFDA 3NVYA 1XLOA 1KLGD 2MJDA 2PMVA 2XN9C 4UDUC 3NVWA 2BS3B 3AN1A 1QLBB 2LGIA 3AM9A 2LFIA 4ZHPA 3IXSA 3BYTB 2BBCA 3AH7A 1VZ6A 3VRBB 3P63A 2JX5A 1FXAA 1OQQA 4XE0A 1V8CA 1XO3A 1SEBD 1KFYB 2KAJA 4LK0M 5E6JA 3BZDB 1T6BX 3WCQA 1IBXB 3W5UB 1TKGA 3TEZA 3FAHA 3Q69A 2WXPA 4GDLB 4RH6A 5BYQA 2LMCA 3VRAB 2HDEA 1E9MA 1AWDA 2KMMA 2PVOD 4OHJA 3J9CA 2V0GA 3BK2A 4OW0A 4L2YA 1DOXA 1UNSA 1MVKA 4KGTA 4RF0A 3NVVA 1QOGA 3DWMA 1C4CA 2PTLA 3U7ZA 4RNAA 2PIAA 4HJGE 5T8IA 2WXRA 3H8HA 1KTKA 1HXYD 1FNVA 3BWUD 3GP7A 1C79A 3ZJTA 3NVZA 2ZW1A 4ARIA 2KQ4X 2L52A 5TSSA 4WQMA 2LHDA 2EKIA 1L0YB 1QOAA 2IDYA 2VZKD 2WXIA 4A55A 4P6VF 1TS2A 2BS2B 2XNAC 5AUIA 1I4XA 1JWMD 2K22A 1E7PB 5GXGB 2EELA 3AE1B 3P4RB 1PGAA 2G1EA 1BXTA 5BYRA 2QIEB 2RDHA 3VQIA 2WXMA 2IPKD 3GB1A 1D5XC 3U52E 2ON8A 1YN3A 2DYMA 1AYFA 1KRHA 1J7AA 1JW9D 2AQ1B 5BMGA 3HVZA 4H2AA 1C77A 1L5PA 1I4RA 2BYTA 1ZDXA 3Q8CA 1CQVA 2WP9B 4DQOC 4WURA 2RPVA 3KWLA 4REZA 5FK9C 4HRSA 1GOZA 2WQYB 1KF6B 3GS2A 1YQ4B 5BMHA 1FCCC 3ZJVA 3NZ3A 2LHEA 2JU6X 1GB4A 4C80A 1BMLC 1GPXA 3SFEB 1ZOYB 1YN4A 2INPE 1K50A 3AECB 1FM0D 1Y56A 1SJHD 3AEBB 2BTEA 2H88B 5BYSA 2L83A 3P1MA 1N5WA 4TQ1A 3Q8EA 3HUIA 3Q8AA 2E6XA 5HI1A 1SJED 2J42A 4ZHOA 3AEEB 1L4ZB 3EUB2 2WDQB 2JQRB 1JWSD 1MPEA 3V3XA 3W2DA 1B9RA 1RWSA 1JCKB 4C7ZA 1VZ7A 2BB6A 1PGBA 1PDXA 2LEKA 4JWUC 2QSDA 1MHHE 3HVDA 4GDKB 4RGMA 1GAQB 4RF1A 2HTME 2GRIA 3ABVB 2SEBD 1XLNA 3P42A 5D7GA 2FE8A 2IJ0A 1IGDA 4RGNA 4ZRPA 1QILA 1D5MC 5EE9A 1E6EB 3U2SC 1L6VA 3PZ7A 4D2KA 1WXQA 2Y3AA 1VZ8A 4R3DA 1CJEA 1SSNA 2W3SA 3W5VB 4YSXB 5LNK1 1K53A 2WXJA 2J4XA 2W55A 4JPSA 1J7CA 3T3OA 4FXCA 1XLPA 1DYQA 2WNMA 2AX5A 5FKAC 3BVGA 1RM6C 1TKYA 1DOIA 1PYWD 4NAMA 1FD6A 2KACA 2WDVB 5BMIA 1JMLA 1ZXIA 2WXKA 1ZP0B 3OWEB 1FRRA 4RGTA 1J7BA 4YSYB 2JSVX 1C78A 1WSPA 2GI9A 3PZ8A 4A8XC 1VJKA 1FFVA 1XLQA 3ZGZA 3AE2B 2K0PA 2PKOA 4OZBA 5I4DA 1D4BA 2FUG1 1T5XD 4WIPA 2IGGA 2PVGC 2J52A 1N5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KX6 B;  3NVZ A;  5C2T B;  1R7S A;  2L52 A;  1DOY A;  5MPO A;  1QF6 A;  4WQM A;  2EKI A;  1L6U A;  3AED B;  1QOA A;  4YXD B;  4US9 A;  4P6V F;  2CU3 A;  5H92 C;  3RPF C;  1FMA D;  2B76 B;  1A70 A;  2M19 A;  2BS2 B;  5AUI A;  1JAL A;  4N58 A;  2K22 A;  1E7P B;  3B2G A;  1WWT A;  2WDR B;  1NEN B;  3AE1 B;  2MH7 A;  3BII D;  5GXG B;  4WWM A;  3P4R B;  4ZOH C;  1RFK A;  2G1E A;  2DBY A;  2OHF A;  2QIE B;  3AV8 A;  3AEA B;  3P4Q B;  5G5H A;  2H89 B;  3VR9 B;  3AE3 B;  1FIQ A;  1WRI A;  1AYF A;  1KRH A;  1J7A A;  1NYQ A;  1JW9 D;  2MJE A;  3HVZ A;  3HRD D;  3AE7 B;  1L5P A;  2E3T A;  1VLB A;  3AB5 A;  5EE0 A;  2W54 A;  2DWQ A;  4US8 A;  5G5G A;  4N6E B;  1ROE A;  1RYJ A;  2WP9 B;  3B2F A;  2Q5W D;  3ETR A;  3W9C B;  2BS4 B;  1NVI D;  2K9X A;  1FRD A;  3KWL A;  4YTP B;  1VDV A;  3B9J A;  1N62 A;  3AE9 B;  4HRS A;  3CIR B;  2WQY B;  1N61 A;  1KF6 B;  3AE5 B;  1YQ4 B;  3P4S B;  3SFD B;  1SF0 A;  3AMZ A;  4JX1 C;  1E10 A;  1NYR A;  2BT6 A;  3FC4 A;  4YTM B;  2WU5 B;  1WYG A;  1DGJ A;  3NRZ A;  1TKE A;  4YT0 B;  4C80 A;  3SFE B;  1ZOY B;  4C7Y A;  3ZYY X;  3AEC B;  3AE4 B;  1FM0 D;  3AEB B;  3LB8 C;  2H88 B;  3VR8 B;  2L83 A;  1UWM A;  3P1M A;  2M56 B;  1F0Z A;  1N5W A;  1NI3 A;  1QT9 A;  1OFF A;  2CJN A;  1FXI A;  3HUI A;  1SB3 C;  1YJJ A;  3LXF A;  4ZHO A;  3AEE B;  2CJO A;  2WU2 B;  1FFU A;  4A9A A;  1JWB D;  3EUB 2;  2WDQ B;  5EE1 A;  2K5P A;  3SR6 A;  3AEG B;  1EWY C;  1N63 A;  2JQR B;  1T3Q A;  2W3R A;  1B9R A;  1RWS A;  4C7Z A;  4YSZ B;  1PDX A;  1PFD A;  2LEK A;  1TYG B;  3NVY A;  4JWU C;  1XLO A;  2MJD A;  3CWI A;  3AEF B;  3NVW A;  1GAQ B;  2BS3 B;  2HTM E;  3AN1 A;  1QLB B;  3AM9 A;  3ABV B;  2QJL A;  1XLN A;  1OQR A;  2WS3 B;  5H8Y E;  4ZHP A;  2ACZ B;  4YSX B;  1I7H A;  3AH7 A;  3VRB B;  4HRO A;  3P63 A;  2JX5 A;  5EE9 A;  1FXA A;  1E6E B;  1OQQ A;  1CZP A;  1V8C A;  1XO3 A;  1IUE A;  1L6V A;  1KFY B;  2KAJ A;  4IDI A;  3AE8 B;  1WXQ A;  1L0V B;  3P4P B;  1CJE A;  1QOB A;  1TJE A;  2W3S A;  3W5V B;  2MJ3 A;  3W5U B;  3WCQ A;  1GPX A;  1TKG A;  3FAH A;  5C3J B;  2W55 A;  1J7C A;  5AUK A;  4FXC A;  4USA A;  1XLP A;  2AX5 A;  3VRA B;  1RM6 C;  1NEK B;  1TKY A;  1E9M A;  2N0S B;  1DOI A;  3AE6 B;  1E0Z A;  1AWD A;  4YTN B;  2KMM A;  2PVO D;  2WDV B;  1PUT A;  1ZXI A;  1FO4 A;  1ZP0 B;  1DOX A;  1FRR A;  1J7B A;  3DWG C;  4N59 A;  2Y5C A;  4YSY B;  1ZUD 2;  3NVV A;  4ITK A;  1QOG A;  3DWM A;  1JRO A;  1N60 A;  1QOF A;  1VJK A;  1FFV A;  1XLQ A;  1JWA D;  1V97 A;  1JQ4 A;  3NS1 A;  2PIA A;  2WLB A;  4LTU A;  1YJI A;  3AE2 B;  3PO0 A;  4JWS C;  5EE3 A;  1YQ3 B;  2PKO A;  1SIJ A;  3L4P A;  2FBW B;  2PVG C;  1WGK A;  1JRP A;  1N5X A; 
#chains in the Genus database with same CATH topology
 1UGJ A;  1V49 A;  5MPO A;  1L6U A;  5IN7 A;  1TS5 A;  3UI3 A;  1NEN B;  2KLG A;  4XC2 A;  1K51 A;  3Q2A C;  1SGH A;  1NYQ A;  2XK5 A;  2XBB C;  1L0X B;  2E3T A;  2R2Q A;  5EE0 A;  2KHW B;  5C23 A;  3KUD B;  4PK1 A;  2Q5W D;  1JWU D;  4RFB A;  2DX5 B;  3MJ5 A;  3QX1 A;  2QMT A;  1EUV B;  1PGX A;  1ZPS A;  3AMZ A;  3M62 B;  4DDG D;  4TV3 A;  5G2N A;  1C76 A;  2KD0 A;  2K8C A;  4XDD A;  3KUC B;  4MGY E;  5BO4 B;  2ZPY A;  1EWY C;  3R66 C;  3IAM 1;  4C4V A;  1HEZ E;  1UH6 A;  4LLG M;  3AEF B;  4EOY A;  5AZG A;  2WXO A;  2LUM A;  4ANX A;  4LDT D;  1LGR A;  2XEW A;  1IYF A;  2KMC A;  1HA5 A;  1V2Y A;  3O65 B;  5D3D A;  2CKH B;  1OTR B;  2C5L C;  2LVQ A;  2JYT A;  3CSF A;  3H7S A;  4A90 A;  1ZXH A;  4KGR A;  2Z0E B;  2NVU I;  2JRH A;  1GB1 A;  2MWS B;  2JY6 A;  2NBW B;  2SAK A;  1WXS A;  1WR6 E;  1N60 A;  2LZ6 A;  2DLB A;  4BZA A;  4MSQ B;  4GGQ A;  4JWS C;  3A4S C;  4HPP A;  3DOW A;  3PGE A;  4AS1 A;  2RGF A;  1JRP A;  2D3G A;  1Q10 A;  1WF9 A;  2EKE C;  3DBR B;  1UWX A;  3RFZ B;  3N1X C;  3NOB A;  1ESF A;  3RPF C;  4F1S A;  4GIV A;  2WXQ A;  1AW7 A;  2DAJ A;  2CHZ A;  2WXL A;  2ZJD A;  3DBR I;  3TEW A;  4HEA 1;  2GLS A;  3HRD D;  3AE7 B;  2W54 A;  5G5G A;  2VRR B;  1YIW A;  1VDV A;  2BWE S;  1UZX B;  2YEP F;  3DPD A;  2BT6 A;  5LLI A;  2NR2 A;  2MEK A;  3LB8 C;  2KC2 A;  3AE4 B;  4XX5 A;  1FNU A;  4EKU A;  3ZDM C;  1UWM A;  5J2R A;  1GJZ A;  3LYY A;  1V1P A;  2TSS A;  1VD2 A;  3A33 B;  1YJ1 A;  2EMT A;  1BT0 A;  1N63 A;  3S2A A;  4B6W A;  2N1V A;  5DPR A;  3ZXV A;  4M01 A;  3KH0 A;  3L10 B;  4GU2 A;  3CWI A;  1UBI A;  4KGS A;  3WAO A;  4RM8 A;  3KLS X;  3SEB A;  4MM3 A;  3WAN A;  1L4D B;  2N7J A;  4NNJ B;  3WAL A;  5CHV C;  2JF5 A;  1SXT A;  5C3J B;  1F2R I;  5AUK A;  1B1Z A;  4G3X B;  2K1F A;  1NEK B;  3AE6 B;  2ZNV C;  3JVZ X;  3N9Y C;  4KKI A;  2VZK B;  2MSE D;  4L1B A;  4MGI E;  4I6P A;  1RRB A;  4GSW A;  2V4L A;  1MHX A;  3ZO5 B;  4M8N A;  1V81 A;  2NTT A;  4BOS C;  2KWD A;  2A4Z A;  1AN8 A;  3QHT A;  3N1Z C;  1XEE A;  2DEN B;  3AI5 A;  1V1P B;  4M02 A;  3B0A A;  4P1C C;  4WJP A;  3QAR A;  4C56 C;  3MFG A;  2FCM A;  1E8Z A;  1WWT A;  1YD8 U;  1ET6 A;  1WGR A;  2I1K A;  4HLE A;  2WXG A;  4G50 A;  4MM3 B;  4RGO S;  1WRI A;  3Q8F A;  3OLM D;  1C4A A;  4KZ0 A;  4ICV A;  2ZVO A;  1TS3 A;  3UF8 A;  1UUP A;  4FJZ A;  2BS4 B;  1WGH A;  1N62 A;  3QQ8 B;  2V3N A;  1HTO A;  2I2Y A;  4JX1 C;  3V61 A;  2WXF A;  4LNN A;  4C7Y A;  3ZYY X;  4HXD A;  4DWF A;  2BVC A;  3VR8 B;  3APF A;  1F77 A;  4DHZ B;  2WU2 B;  1C4P A;  3ZRF A;  3A9J B;  4XWT A;  1IGC A;  4QAY A;  4IWQ A;  4EZJ A;  2L8J A;  1KLG D;  2DHZ A;  2PMV A;  2XN9 C;  3B1L X;  2D11 A;  3AN1 A;  2LGI A;  3L17 A;  1CMX B;  3EHV A;  2AEH A;  4XE0 A;  2KWV B;  1XO3 A;  1SEB D;  1KFY B;  3K9O B;  5CHW A;  4G0N B;  2BF8 B;  2LJ5 A;  1TKG A;  2KLC A;  3Q69 A;  4RH6 A;  2KJ6 A;  3B08 A;  1E9M A;  2KMM A;  2L0T A;  3PVL A;  3BK2 A;  4KSL C;  3ZDT A;  3HM3 A;  5D6J B;  5J17 A;  3DWM A;  3MC9 A;  1OQY A;  1FXT B;  3VVW B;  1SE9 A;  1C79 A;  3MC8 A;  4ZRI A;  1WJN A;  4ARI A;  2KQ4 X;  2WHI A;  1QOA A;  2VZK D;  5GXG B;  2EEL A;  4ANU A;  3AE1 B;  5BYR A;  2RDH A;  3VQI A;  2KTF A;  3DDC B;  3HVZ A;  2FAZ A;  4DQO C;  1LFD A;  2KJR A;  3KWL A;  3QC8 B;  3ZUN A;  1XQQ A;  3ZKJ C;  2ZCC A;  1FCC C;  3QIJ A;  2LHE A;  2KXJ A;  5JH5 C;  2JU6 X;  1GB4 A;  4RMA A;  2I1J A;  3JSV A;  3SFE B;  1F52 A;  4TQ1 A;  3EEC A;  3R7Q A;  1LM8 B;  3AEE B;  1L4Z B;  3C19 A;  2QC8 A;  2WDQ B;  2BYF A;  1JWS D;  4S0R A;  1RWS A;  4IUM B;  2BB6 A;  2L0F A;  3PRZ A;  2WX0 A;  2QSD A;  1MHH E;  4GDK B;  2HTM E;  3ABV B;  2B3A A;  1XLN A;  3WAM A;  4KDL B;  2IJ0 A;  1Q5W B;  1D5M C;  3DHG C;  4NJ7 A;  3PZ7 A;  4AWJ A;  1WXQ A;  2K39 A;  5FR6 A;  1VZ8 A;  4YSX B;  2W3S A;  1K53 A;  3KW5 B;  1ZGU B;  2ZNV B;  1XLP A;  5JZE B;  2AX5 A;  3UIO B;  2IND C;  3OG5 A;  1PYW D;  4NAM A;  4HDQ A;  3WAP A;  2WDV B;  4HVB A;  1ZXI A;  1P1A A;  3OWE B;  4YSY B;  1H8C A;  4A8X C;  2LGS A;  1VJK A;  1FFV A;  3HHM A;  1D3Z A;  3AE2 B;  3I63 C;  1E5W A;  2K0P A;  5TR5 A;  4OZB A;  4WIP A;  2IGG A;  4GOC A;  1WZ3 A;  4NAW A;  4DXF A;  4KKJ A;  5HKH A;  1C3T A;  1JAL A;  2DZJ A;  3W1Y A;  4W9J A;  4ZOH C;  3ZNG C;  3KYC D;  2YVC A;  2M17 A;  3RD2 A;  3L13 A;  2Y5B B;  3SD5 A;  2C7H A;  2KWC A;  1VLB A;  3I3T B;  2JXX A;  4MEM A;  2RMM A;  4EZL A;  2CHX A;  1I4G A;  1WI0 A;  4EFO A;  1SF0 A;  3UQA A;  1OEY J;  2LJI A;  4ICU A;  3FC4 A;  4AJY B;  2WU5 B;  1DGJ A;  2M0A A;  4JGH B;  3DBS A;  1F1H A;  2CR5 A;  3I57 A;  1NI3 A;  2PPH A;  1OFF A;  2CJN A;  2N9X A;  4K7U A;  1YJJ A;  3OJ3 A;  2J53 A;  3A1Q A;  1FFU A;  4BOZ B;  3A9K B;  2KYW A;  3IAS 1;  4IC7 B;  4MSM B;  3H7P B;  4HDO A;  2MQJ A;  3IFW B;  3QCA A;  3L54 A;  1MJD A;  4GMV A;  3GZN B;  2WS3 B;  5H8Y E;  1T0R C;  2PE6 B;  3PRE A;  1HQR D;  4OVV A;  2DYO A;  1QOB A;  3U7D A;  3M3J A;  2ICI A;  4JLC A;  3GZN I;  3MHZ A;  4K7W A;  4USA A;  2RDG A;  2LWP A;  2N1W A;  1PQS A;  4W9I A;  2C7M B;  2N0S B;  1U4A A;  2Y5P A;  1KH0 A;  3TEY A;  3E56 A;  4OZA A;  3PHW B;  3DWG C;  4W9G A;  3LDZ E;  5E6O A;  3QJZ A;  4W9F A;  4MAC A;  4IM2 A;  1YJI A;  3TEX A;  2JWU A;  3L4P A;  4JL9 A;  3ZW3 A;  3PHX B;  3R8B A;  1GC6 A;  2X8X X;  4PT5 A;  2I38 A;  2N4F A;  3PTF C;  1FMA D;  3MTN B;  3IT4 B;  3MJW A;  4HJK A;  3RNE C;  4WWM A;  1Q0W B;  1WGY A;  2KJH B;  3PS6 A;  2LUE A;  2MJE A;  1WE6 A;  3URY A;  3PZD A;  1NI2 A;  2HE7 A;  3V60 A;  2OOB B;  3ETR A;  1WX8 A;  1MFW A;  2REX A;  1HZ6 A;  4IOI E;  1K52 A;  2DYB A;  2L76 A;  1C9F A;  1E10 A;  1FEH A;  1S3S G;  2KAN A;  5D3I B;  3R2T A;  1WMH B;  1F0Z A;  2IBI B;  2WWZ A;  1WJU A;  2CJO A;  4M8M A;  1WR1 A;  4A9A A;  4TQ0 A;  4W9K A;  1NBF C;  2K5P A;  2KFK B;  1T3Q A;  2PLP A;  2X38 A;  5E6N A;  3Q3N C;  2D5G A;  5KHO A;  5JHB A;  2KVR A;  3VDZ A;  2D2Q A;  1I7H A;  4ARC A;  1CZP A;  3GE3 C;  4LNF A;  3AE8 B;  2O2V B;  4OZC A;  1R4N I;  4C00 A;  4FBJ B;  4NJ6 A;  2V4I B;  4W9D A;  2RR9 A;  1TIF A;  1E0Z A;  2WXH A;  3KVF B;  2HJ1 A;  2G4D B;  2KX0 A;  2LRW A;  2OED A;  3BVM A;  2MX2 A;  3NS8 A;  2Y5C A;  3VXW A;  3U30 A;  3ZQ4 A;  3TUO A;  2AQ2 B;  4W9E A;  2CU1 A;  3ZJU A;  1YMH E;  1EM7 A;  1KLV A;  2NPT A;  1ET9 A;  3R2I A;  2KDI A;  4Q2J A;  2CHW A;  2XK5 B;  1XF5 L;  1CK1 A;  3N3K B;  1WRD B;  4KIK A;  1OEY A;  1GNU A;  1L2N A;  1VRA B;  4IG7 B;  2MH7 A;  1TY0 A;  1RAX A;  3P4Q B;  3I9V 1;  3QK0 A;  3TMP B;  2V3P A;  3VTW A;  4US8 A;  2INN E;  3VTU A;  3W9C B;  4A3P A;  1I42 A;  4IW0 A;  3AE9 B;  3CIR B;  3AE5 B;  5FR3 A;  4FHJ A;  4C4V B;  1IPG A;  3RYT A;  2L1A A;  4BKS A;  4DXG A;  1SB3 C;  4HKZ E;  2V1Y A;  2C7N B;  3TBL D;  1YX6 B;  2GBK A;  4WJQ A;  5HFY A;  2WXN A;  2HJ8 A;  1Y8R C;  3L0W B;  2NPT B;  3NVY A;  5KHQ A;  3OAW A;  3NVW A;  4E3C A;  3UQB A;  1OGW A;  2BS3 B;  2IO1 B;  3AM9 A;  3BYT B;  2KFJ A;  1P9D U;  3WCQ A;  1P0R A;  4GN1 A;  1G6J A;  4NQL B;  2WXP A;  2HDE A;  2MW5 A;  4IWO A;  3J9C A;  1DOX A;  3ML9 A;  3NZU A;  1MVK A;  3NVV A;  1HTQ A;  3U7Z A;  1ZW7 A;  4BKG A;  2PIA A;  2WXR A;  1KTK A;  4DHJ D;  3QAQ A;  3SDL C;  1FNV A;  4PS3 A;  5AZF A;  3RNF C;  3GP7 A;  4XZ4 A;  2O6V A;  4GB9 A;  4WQM A;  2EKI A;  4OVU A;  4K1R B;  4P6V F;  2K8B A;  2BS2 B;  4W9H A;  3TIX A;  2K22 A;  3P4R B;  2G1E A;  1BXT A;  4FJY A;  2WXM A;  2ZCB A;  2IPK D;  2RD0 A;  3GB1 A;  3U52 E;  2ON8 A;  4IWP A;  1YN3 A;  2DYM A;  3UIN B;  3APD A;  2N7D A;  1JW9 D;  2AQ1 B;  1C77 A;  3PSE B;  3DBL B;  1UGM A;  1V6E A;  1WJ6 A;  4HPL B;  2JZZ A;  4REZ A;  4HRS A;  1GOZ A;  5BMH A;  3R7R A;  3ZJV A;  1LXD A;  1MG4 A;  3DBL I;  1GPX A;  1ZOY B;  1Y56 A;  1SJH D;  2L83 A;  3P1M A;  3Q8E A;  1WYW B;  2J42 A;  4AOF A;  3VFK A;  1B9R A;  2LXA A;  1C1Y B;  1PGB A;  4JWU C;  2BPS A;  2GOW A;  1WGG A;  4RF1 A;  3IBE A;  5CHF A;  2MBH A;  2ZZP B;  4MH0 E;  1IGD A;  3KYD D;  1L6V A;  4D2K A;  2Y3A A;  3W1S C;  1SSN A;  2G45 B;  3N20 C;  3RCZ A;  2J4X A;  2KDE B;  4JPS A;  3T3O A;  1R4M B;  3VH3 B;  3BVG A;  1DOI A;  3VUW A;  1ZKH A;  4J6I A;  2KAC A;  1JML A;  3ECI A;  2WXK A;  2GBN A;  1ZP0 B;  1FRR A;  4RGT A;  2RPQ A;  2JSV X;  1C78 A;  1T0Y A;  2KMA A;  1R4M I;  1LQB A;  3ZGZ A;  2PKO A;  1TT5 B;  1D4B A;  3UGB B;  2J52 A;  2NCN A;  1VCB A;  1A5R A;  1TY2 A;  4F8C B;  2JZP A;  2R61 A;  1MG8 A;  4B95 A;  1TS4 A;  1E8W A;  3AED B;  1XCQ L;  4YXD B;  5LXH A;  2B76 B;  1EU4 A;  2ZEQ A;  4N58 A;  3DVN V;  3AEA B;  2L00 B;  3SU8 X;  5G5H A;  1FIQ A;  3AXC A;  4BKS D;  2MHJ A;  3VTV A;  1RLF A;  3DBH B;  1E7V A;  3B9J A;  1X1M A;  3SFD B;  1D6E C;  3GE8 C;  3R3M A;  4CYE A;  4S17 A;  2UU7 A;  1WYG A;  4YT0 B;  4TSS A;  4NZL B;  1UBQ A;  1YNT E;  3AU4 A;  3DBH I;  3DVG X;  4HK2 A;  2J0M A;  1EF5 A;  2AL3 A;  4MT5 A;  3U4E G;  3Q14 C;  2YLM A;  1IP9 A;  3AEG B;  2KDB A;  4P7I A;  4LNO A;  4CQN A;  2QJL A;  4HRO A;  1H4R A;  4DDI D;  4IDI A;  1IUE A;  4HKQ A;  3P4P B;  1TJE A;  5DPW A;  2M8S A;  1TZ1 A;  1N6Z A;  2DNF A;  2W82 A;  1SE3 A;  4YTN B;  2GBM A;  3M95 A;  1PUT A;  2BQQ A;  5IA7 A;  4TMA B;  2BYE A;  4M0W A;  4AUQ C;  4DBG A;  3SHQ A;  1WIA A;  1JQ4 A;  3NS1 A;  3DCG A;  4LTU A;  2D10 A;  3T9L A;  1ISN A;  1WGK A;  3EC8 A;  4MGK E;  4MH8 A;  3X0W A;  1R7S A;  1DOY A;  1ZDV A;  1I35 A;  4WAA A;  3V6E B;  1A70 A;  4EEW A;  3W1S A;  2ZVN A;  4KSK C;  1GC7 A;  2DBY A;  1WFY A;  2H89 B;  2K6Q A;  2Z59 B;  4IM0 A;  3JSV B;  4II3 B;  2RSU A;  4P1B C;  3ZVV A;  2MBB B;  1ROE A;  2J0J A;  1SIF A;  4WJN A;  2D3B A;  2LGY A;  1F9J A;  3P4S B;  1NYR A;  2MBO A;  4YTM B;  5DCN A;  2MRP A;  4PS7 A;  3JYU A;  2KN4 A;  1YN5 A;  4FAD A;  3C8Y A;  3EFU A;  2BGF A;  3ZNH B;  5HG2 A;  3N32 A;  2NBU A;  5JXV A;  3SR6 A;  3VUX A;  4TUU A;  3ENE A;  2N9L A;  2LD9 A;  3IT6 B;  1QQR A;  1V1O A;  1UF0 A;  1I4Q A;  2D3C A;  2IZV B;  2C9W B;  3Q3J A;  3V05 A;  2KX3 A;  2N9K A;  2V9H A;  1V86 A;  4BVU C;  1L0V B;  4OVZ A;  4XDC A;  2NBV B;  1KM7 A;  4K81 A;  2MA9 B;  3RNA C;  3TCA A;  2KZR A;  4II2 B;  4NAW B;  4HCP B;  4N59 A;  3MHS D;  4EUT A;  1JRO A;  2DZK A;  1JWA D;  1V97 A;  2JRI B;  1LO5 D;  1QKZ A;  2L32 A;  3PO0 A;  3ML8 A;  5EDS A;  2MBQ A;  2DZI A;  2PE9 A;  3EGR A;  3PV1 A;  4FUL A;  3DHI C;  4KDI C;  1I4P A;  4KX6 B;  2KT7 A;  2D3A A;  1V5T A;  4B0M A;  3L16 A;  1JRU A;  3BVZ A;  1WY8 A;  3WIM A;  1TGZ B;  3BII D;  2OJW A;  3BK1 A;  1NDD A;  3RMK C;  4DXA B;  2LXC A;  2FNJ B;  2ZW0 A;  2ZPN A;  3A1Q B;  1NVI D;  2KVZ A;  4YTP B;  1E8X A;  4AQ7 A;  5IOI A;  2BWF A;  1UEL A;  1ENF A;  2FIF A;  2YEP B;  1F2R C;  3NRZ A;  4WH4 A;  1FXI A;  2L3Z A;  3LXF A;  1EU3 A;  1SE4 A;  1JWB D;  4AJW A;  2FID A;  4L23 A;  2M0X A;  2RDB C;  1YX5 B;  1XLO A;  4K7S A;  3ZXR A;  2LFI A;  3IXS A;  2BBC A;  3AH7 A;  1OQQ A;  1V8C A;  2KAJ A;  4GXB A;  4LK0 M;  2IY0 B;  3FAH A;  3HK0 A;  1J19 A;  5BYQ A;  4ANW A;  3K9P B;  3NJT A;  1AWD A;  3DHH C;  4OHJ A;  1E90 A;  4N9F 4;  1WX7 A;  4OW0 A;  4L2Y A;  1R4N B;  2WX1 A;  1UNS A;  3GOE A;  4RF0 A;  1E8Y A;  3CF6 E;  4WQO B;  1J8C A;  3CMM B;  2GBR A;  3APC A;  5T8I A;  3C0R B;  1HXY D;  2M1M A;  3X23 A;  4DHJ B;  2WDT B;  4E74 A;  3RI7 C;  3NY5 A;  3NVZ A;  2ZW1 A;  2L52 A;  2AL6 A;  1GUA B;  2NS5 A;  4CHK A;  2LHD A;  1L0Y B;  2WXI A;  4LJO B;  1TS2 A;  2UWQ A;  3AUL A;  5AUI A;  1I4X A;  2A5U A;  1E7P B;  3ZNZ B;  4ACF A;  4ASW C;  2QIE B;  1D5X C;  1I4R A;  1ZDX A;  1V80 A;  4LNI A;  3NG0 A;  2MBE A;  1CQV A;  2GMI C;  2WP9 B;  3Q6B A;  3IG3 A;  4HWI B;  2LAS A;  3GS2 A;  1YQ4 B;  3NZ3 A;  1WM3 A;  2HD5 B;  3QWZ B;  4C80 A;  1YN4 A;  2INP E;  1K50 A;  3AEB B;  4YL8 A;  5AEK B;  5BYS A;  1N5W A;  3HUI A;  1YOV B;  3Q8A A;  1SJE D;  4G11 A;  4ZDV A;  4RM9 A;  2JQR B;  1MPE A;  4LJP B;  4ZRJ A;  4URK A;  1JCK B;  4C7Z A;  2KTR A;  2M4N A;  3HVD A;  4RGM A;  3Q3M C;  3P42 A;  3RNG C;  4RGN A;  4ZRP A;  1QIL A;  1P3Q U;  3U2S C;  1E6E B;  3N1Y C;  3W5V B;  1CJE A;  3KUZ A;  2W9N A;  3HM6 X;  4NQK E;  3PRM B;  2W55 A;  3L08 A;  1DYQ A;  2WGS A;  5FKA C;  3ZIM A;  3AU5 A;  2AWT A;  1FD6 A;  1WE7 A;  5IKC M;  4KIK B;  1WSP A;  3PZ8 A;  3DVG Y;  1V5O A;  1Z5S B;  5CTR C;  4IM3 A;  4I6N B;  5IAA C;  3MP9 A;  1BUI C;  1V9J A;  1KOT A;  3RN9 C;  5H92 C;  1STE A;  2M19 A;  2KTR B;  3E9S A;  3B2G A;  2WDR B;  2D07 B;  2OHF A;  3TSS A;  3RUI B;  4FHK A;  3VR9 B;  2Z0D B;  3AE3 B;  1XCT L;  2N9P C;  2KQS A;  2INC C;  4KVG B;  2MLB A;  2G4S A;  1FRD A;  3LJ3 A;  2QCZ A;  3PLU A;  5G55 A;  1SBB B;  3H1U A;  2NMQ A;  3RZF A;  1D5Z C;  1YQB A;  2K8H A;  1TKE A;  3RNC C;  1WGD A;  2M56 B;  4P16 A;  1WXV A;  2MP2 A;  1TBE A;  5CX3 A;  4KZC A;  2PEA A;  4YSZ B;  3OJ4 B;  4JQW C;  2JXT A;  4A6Q A;  3BIN A;  4B9K A;  1OQR A;  4KV2 A;  2ACZ B;  3KQ4 A;  2G3Q B;  2LRU A;  2BB5 A;  3A9J A;  2KKC A;  2KN5 A;  2MJ3 A;  4RCO A;  1ACC A;  4WJO A;  3IHP C;  2IYD B;  5D2M B;  2GB1 A;  3TL5 A;  3CST A;  2JWZ A;  1WXA A;  2O6V B;  1WZ0 A;  2IGH A;  1ZUD 2;  1P7E A;  1SE2 A;  4M00 A;  2WLB A;  4GLS C;  2MCN B;  3ZTC A;  1EO6 A;  1SIJ A;  3ZLZ A;  3Q3O C;  2K3U A;  2PJH A;  3FIL A;  5C2T B;  5C1Z A;  2FCN A;  4JE3 B;  2MP2 B;  4US9 A;  1XXG A;  3ZTD A;  1FCL A;  1WH3 A;  1Z2M A;  2IGD A;  3O13 A;  3EA6 A;  5J18 A;  2KDM A;  3VHT C;  1TZO A;  3KWV A;  2V3S A;  2L05 A;  3AB5 A;  2DWQ A;  4ZRQ A;  2GBJ A;  1RYJ A;  3B2F A;  4DK5 A;  2BKR B;  2VH2 A;  3FKY A;  3PPA A;  1N61 A;  5AZH A;  2QIL A;  1UD7 A;  4A20 A;  4FLH A;  1KJT A;  4O1N A;  5HHD G;  3WA0 A;  4BFR A;  4J3O D;  2LGX A;  3D32 A;  4LNK A;  1QT9 A;  3T3N A;  4MJS A;  3DQV A;  5EE1 A;  1WM2 A;  4HPM B;  4NJC A;  2QEJ C;  2R2O A;  1T0S C;  4BBN F;  3FIL B;  1TYG B;  2KWU B;  1P7F A;  1M4V A;  4WAF A;  3PLV A;  2CS4 A;  2LVO A;  1FNW A;  3ALB A;  4PYZ A;  3JW0 X;  3NUH B;  3ONS A;  2JZ3 B;  2LGD A;  2Z8L A;  4BAX A;  4FN2 A;  2WYQ A;  4NPN A;  5LXI B;  1HZ5 A;  4XGA B;  1J0G A;  2EMS A;  2VH1 A;  4B0E A;  4EZK A;  2NTS A;  4GDK A;  2JT4 B;  4JIO U;  1EWC A;  3EFC A;  2FCQ A;  3H6N A;  3IVF A;  1FO4 A;  4ITK A;  3HIZ A;  3ZRC A;  1MI0 A;  1QOF A;  2C60 A;  3N30 A;  2DAF A;  2IO2 B;  2N7E A;  5EE3 A;  1XD3 B;  1YQ3 B;  2G9H D;  2FBW B;  2K6D B;  3H9D A;  2PW9 A;  4K3B A;  3M63 B;  2N9E B;  4MJS B;  2K25 A;  1QF6 A;  4TKN A;  2CU3 A;  2JYE A;  3Q8B A;  3TJP A;  1WJ4 A;  3V6C B;  2O6V D;  4FJV B;  1KLU D;  4E71 A;  1RFK A;  4I6L B;  4BKT A;  4XWW A;  3AV8 A;  1IBX A;  3PRP B;  1I4H A;  1XT9 B;  2HTH A;  3PT2 B;  2KK8 A;  4GDL A;  1VR9 A;  4YWG G;  2AQ3 B;  1ZE3 D;  4N6E B;  2K9X A;  5DPS A;  1S1Q B;  4IKG A;  2JPH A;  4DHZ E;  2L7R A;  4XYC A;  3T8M A;  3MC0 B;  5IP4 D;  1EF1 A;  3P2B A;  2ONQ A;  5DPT A;  2QDF A;  4EE2 A;  5L95 C;  1TTN A;  2KO3 A;  4ZYS A;  3QA8 A;  2W3R A;  5E6P A;  4CO7 A;  3BYY B;  2BW2 A;  3RNB C;  4WWO A;  1PFD A;  2MJD A;  4UDU C;  1P98 A;  4HCN B;  1QLB B;  4ZHP A;  4F7Z A;  1VZ6 A;  3VRB B;  3P63 A;  2JX5 A;  1FXA A;  4M0W B;  3DVN U;  3A9K A;  5E6J A;  1T0Q C;  3BZD B;  4K3C A;  1T6B X;  1IBX B;  3W5U B;  2KOX A;  4ANV A;  3TEZ A;  3H7P A;  4GDL B;  2LMC A;  3VRA B;  4WWP A;  5GMV A;  1HE8 A;  2PVO D;  2V0G A;  4PS8 A;  2ASQ A;  3V62 A;  4KGT A;  5IO9 A;  2OJR A;  5JHA A;  2IY1 B;  1QOG A;  1C4C A;  1E7U A;  2PTL A;  4RNA A;  4HJG E;  3H8H A;  2LI5 A;  5D94 A;  3VUY A;  3BWU D;  2KDF B;  3BY4 B;  3ZJT A;  1K8R B;  3ZNI D;  5TSS A;  3Q3F A;  4WWN A;  1M94 A;  4A55 A;  2IDY A;  2JVC A;  3RT3 B;  3U8Z A;  2XNA C;  3A4R A;  1JWM D;  1WX9 A;  2J0K A;  1PGA A;  4ZYN A;  2DZM A;  2KNB A;  1RFA A;  2AYO B;  2BYV E;  2J7Q B;  2KQ7 A;  3VAW A;  1QZE A;  2FCS A;  5L83 A;  1AYF A;  3NHE B;  1KRH A;  1AAR A;  1J7A A;  4MGZ E;  5BMG A;  4H2A A;  1L5P A;  2IO0 B;  2BYT A;  3Q8C A;  1WXM A;  4A3O A;  4WUR A;  2RPV A;  2KC1 A;  5FK9 C;  2WQY B;  3RZW C;  1KF6 B;  2LVP A;  1L7Y A;  4BBN C;  3I5J C;  4LDT B;  1BML C;  3AEC B;  1FM0 D;  2BTE A;  2H88 B;  2BKF A;  4LCD E;  3RUL A;  5HI1 A;  2E6X A;  2FUH B;  4ZHO A;  3EUB 2;  4W9L A;  3W2D A;  2JUO A;  3V3X A;  1Q1O A;  1VZ7 A;  2QHO A;  1PDX A;  2LEK A;  1FPY A;  1GAQ B;  4PYU A;  3NZS A;  2GRI A;  2IO3 B;  2SEB D;  4MDK E;  4X57 B;  1GG3 A;  1WMH A;  4W9C A;  5D7G A;  2FE8 A;  4NY0 A;  5EE9 A;  4R3D A;  2KFK A;  4ZRK A;  5LNK 1;  2WXJ A;  3UIP B;  1J7C A;  4FXC A;  2WNM A;  1RM6 C;  1TKY A;  4FA6 A;  4AP4 C;  5BMI A;  1J7B A;  2GI9 A;  2O2V A;  4MEL A;  1XLQ A;  5I4D A;  2FUG 1;  1T5X D;  2UYZ B;  2PVG C;  3VH4 B;  1N5X A; 
#chains in the Genus database with same CATH homology
 1TY2 A;  1UGJ A;  2JZP A;  2R61 A;  1TS4 A;  5MPO A;  3MP9 A;  4DXF A;  3AED B;  1L6U A;  1BUI C;  1XCQ L;  4KKJ A;  4YXD B;  1TS5 A;  5H92 C;  1STE A;  2B76 B;  2M19 A;  3UI3 A;  1EU4 A;  1JAL A;  4N58 A;  3E9S A;  3B2G A;  2WDR B;  1NEN B;  4ZOH C;  2OHF A;  3TSS A;  3AEA B;  1K51 A;  5G5H A;  3VR9 B;  3AE3 B;  1FIQ A;  1XCT L;  1NYQ A;  1L0X B;  2E3T A;  1VLB A;  5EE0 A;  2Q5W D;  1FRD A;  1JWU D;  4RFB A;  2RMM A;  3B9J A;  1I4G A;  3SFD B;  1SBB B;  3MJ5 A;  2NMQ A;  1SF0 A;  2QMT A;  1PGX A;  1ZPS A;  1D6E C;  3AMZ A;  1D5Z C;  2LJI A;  3FC4 A;  2WU5 B;  1WYG A;  1DGJ A;  4TSS A;  1C76 A;  1TKE A;  1YNT E;  2M0A A;  4NZL B;  4YT0 B;  3I57 A;  2M56 B;  1NI3 A;  4P16 A;  1OFF A;  2CJN A;  4XDD A;  1YJJ A;  2J53 A;  1FFU A;  4MT5 A;  3U4E G;  3IAS 1;  3AEG B;  1EWY C;  3IAM 1;  1HEZ E;  4YSZ B;  4LLG M;  4CQN A;  2JXT A;  3AEF B;  4A6Q A;  2WXO A;  2LUM A;  2QJL A;  2WS3 B;  1OQR A;  5H8Y E;  2ACZ B;  3KQ4 A;  4HRO A;  1HQR D;  4IDI A;  1HA5 A;  1IUE A;  2BB5 A;  5D3D A;  4HKQ A;  2DYO A;  1QOB A;  1TJE A;  3P4P B;  2MJ3 A;  2ICI A;  4RCO A;  2JYT A;  3MHZ A;  4USA A;  2RDG A;  4A90 A;  2W82 A;  1ACC A;  2N0S B;  2Y5P A;  1SE3 A;  1ZXH A;  4KGR A;  2GB1 A;  1KH0 A;  4YTN B;  3TEY A;  1PUT A;  1GB1 A;  3E56 A;  4OZA A;  4TMA B;  2SAK A;  2IGH A;  3DWG C;  4M0W A;  1ZUD 2;  1P7E A;  1N60 A;  1SE2 A;  2DLB A;  4MAC A;  1JQ4 A;  3NS1 A;  2WLB A;  4GLS C;  1YJI A;  4LTU A;  4JWS C;  3TEX A;  2JWU A;  1SIJ A;  3L4P A;  1WGK A;  4AS1 A;  2K3U A;  1JRP A;  4MH8 A;  1Q10 A;  3FIL A;  3R8B A;  5C2T B;  1R7S A;  4PT5 A;  1DOY A;  4JE3 B;  1ZDV A;  2I38 A;  1UWX A;  3RFZ B;  1ESF A;  4US9 A;  3RPF C;  1FMA D;  1A70 A;  1XXG A;  3IT4 B;  2WXQ A;  1FCL A;  1AW7 A;  3W1S A;  4WWM A;  2DBY A;  2WXL A;  2IGD A;  3O13 A;  2H89 B;  3EA6 A;  3TEW A;  2KDM A;  4HEA 1;  2MJE A;  1TZO A;  3KWV A;  3HRD D;  3URY A;  3AE7 B;  3AB5 A;  2W54 A;  2DWQ A;  5G5G A;  4ZRQ A;  1ROE A;  1RYJ A;  3B2F A;  3ETR A;  1VDV A;  1HZ6 A;  1N61 A;  3P4S B;  4IOI E;  1K52 A;  2QIL A;  2YEP F;  1C9F A;  1NYR A;  1E10 A;  2BT6 A;  1FEH A;  4O1N A;  4YTM B;  5HHD G;  2MEK A;  3LB8 C;  3AE4 B;  5D3I B;  4J3O D;  1FNU A;  3R2T A;  1UWM A;  1F0Z A;  1QT9 A;  3LYY A;  2KN4 A;  1V1P A;  2TSS A;  1YN5 A;  2CJO A;  3C8Y A;  4A9A A;  4TQ0 A;  3T3N A;  5EE1 A;  5HG2 A;  5JXV A;  2K5P A;  4NJC A;  2QEJ C;  1N63 A;  3SR6 A;  1T3Q A;  2PLP A;  2X38 A;  2N9L A;  3FIL B;  1TYG B;  3IT6 B;  1P7F A;  1QQR A;  1M4V A;  2D5G A;  4WAF A;  3CWI A;  1FNW A;  1V1O A;  3NUH B;  4KGS A;  3KLS X;  1I4Q A;  3SEB A;  2Z8L A;  3V05 A;  1I7H A;  1L4D B;  2N9K A;  1HZ5 A;  2N7J A;  4ARC A;  1CZP A;  3AE8 B;  1L0V B;  4OVZ A;  4XDC A;  4OZC A;  4B0E A;  1SXT A;  5C3J B;  1F2R I;  2V4I B;  1B1Z A;  5AUK A;  2NTS A;  1NEK B;  3AE6 B;  1E0Z A;  3N9Y C;  4KKI A;  2VZK B;  2WXH A;  4L1B A;  2OED A;  1EWC A;  4NAW B;  3BVM A;  1FO4 A;  4N59 A;  2Y5C A;  4ITK A;  3ZQ4 A;  3TUO A;  1MHX A;  1JRO A;  1MI0 A;  1QOF A;  2AQ2 B;  1JWA D;  1V97 A;  2NTT A;  1LO5 D;  1QKZ A;  2L32 A;  3PO0 A;  5EE3 A;  1YQ3 B;  2KWD A;  3ZJU A;  2G9H D;  2FBW B;  1AN8 A;  1XEE A;  1YMH E;  3EGR A;  2PW9 A;  1EM7 A;  1V1P B;  1ET9 A;  4KX6 B;  1I4P A;  3R2I A;  4Q2J A;  4B0M A;  1QF6 A;  1XF5 L;  1CK1 A;  2CU3 A;  2JYE A;  3Q8B A;  4C56 C;  1VRA B;  3BVZ A;  3MFG A;  1WWT A;  3BII D;  2MH7 A;  1KLU D;  1TY0 A;  1RFK A;  1ET6 A;  4XWW A;  3AV8 A;  1IBX A;  3P4Q B;  2WXG A;  3BK1 A;  1I4H A;  3I9V 1;  4MM3 B;  4RGO S;  1WRI A;  3Q8F A;  2V3P A;  1C4A A;  1VR9 A;  4YWG G;  4US8 A;  1TS3 A;  2AQ3 B;  1ZE3 D;  2INN E;  1UUP A;  4N6E B;  2ZW0 A;  3W9C B;  2BS4 B;  1NVI D;  2K9X A;  4YTP B;  1N62 A;  3AE9 B;  3CIR B;  3AE5 B;  5FR3 A;  4AQ7 A;  2V3N A;  2I2Y A;  1ENF A;  4JX1 C;  4IKG A;  2WXF A;  2YEP B;  1F2R C;  3NRZ A;  3MC0 B;  4C7Y A;  3ZYY X;  4WH4 A;  2ONQ A;  3VR8 B;  2L1A A;  4DXG A;  1FXI A;  4EE2 A;  1SB3 C;  1F77 A;  1EU3 A;  3LXF A;  4HKZ E;  2WU2 B;  1C4P A;  1JWB D;  1SE4 A;  4ZYS A;  5HFY A;  2WXN A;  2W3R A;  3BYY B;  2BW2 A;  4XWT A;  1IGC A;  4L23 A;  1PFD A;  3NVY A;  1XLO A;  1KLG D;  2MJD A;  2PMV A;  2XN9 C;  4UDU C;  3NVW A;  2BS3 B;  3AN1 A;  1QLB B;  2LGI A;  3AM9 A;  2LFI A;  4ZHP A;  3IXS A;  3BYT B;  2BBC A;  3AH7 A;  1VZ6 A;  3VRB B;  3P63 A;  2JX5 A;  1FXA A;  1OQQ A;  4XE0 A;  1V8C A;  1XO3 A;  1SEB D;  1KFY B;  2KAJ A;  4LK0 M;  5E6J A;  3BZD B;  1T6B X;  3WCQ A;  1IBX B;  3W5U B;  1TKG A;  3TEZ A;  3FAH A;  3Q69 A;  2WXP A;  4GDL B;  4RH6 A;  5BYQ A;  2LMC A;  3VRA B;  2HDE A;  1E9M A;  1AWD A;  2KMM A;  2PVO D;  4OHJ A;  3J9C A;  2V0G A;  3BK2 A;  4OW0 A;  4L2Y A;  1DOX A;  1UNS A;  1MVK A;  4KGT A;  4RF0 A;  3NVV A;  1QOG A;  3DWM A;  1C4C A;  2PTL A;  3U7Z A;  4RNA A;  2PIA A;  4HJG E;  5T8I A;  2WXR A;  3H8H A;  1KTK A;  1HXY D;  1FNV A;  3BWU D;  3GP7 A;  1C79 A;  3ZJT A;  3NVZ A;  2ZW1 A;  4ARI A;  2KQ4 X;  2L52 A;  5TSS A;  4WQM A;  2LHD A;  2EKI A;  1L0Y B;  1QOA A;  2IDY A;  2VZK D;  2WXI A;  4A55 A;  4P6V F;  1TS2 A;  2BS2 B;  2XNA C;  5AUI A;  1I4X A;  1JWM D;  2K22 A;  1E7P B;  5GXG B;  2EEL A;  3AE1 B;  3P4R B;  1PGA A;  2G1E A;  1BXT A;  5BYR A;  2QIE B;  2RDH A;  3VQI A;  2WXM A;  2IPK D;  3GB1 A;  1D5X C;  3U52 E;  2ON8 A;  1YN3 A;  2DYM A;  1AYF A;  1KRH A;  1J7A A;  1JW9 D;  2AQ1 B;  5BMG A;  3HVZ A;  4H2A A;  1C77 A;  1L5P A;  1I4R A;  2BYT A;  1ZDX A;  3Q8C A;  1CQV A;  2WP9 B;  4DQO C;  4WUR A;  2RPV A;  3KWL A;  4REZ A;  5FK9 C;  4HRS A;  1GOZ A;  2WQY B;  1KF6 B;  3GS2 A;  1YQ4 B;  5BMH A;  1FCC C;  3ZJV A;  3NZ3 A;  2LHE A;  2JU6 X;  1GB4 A;  4C80 A;  1BML C;  1GPX A;  3SFE B;  1ZOY B;  1YN4 A;  2INP E;  1K50 A;  3AEC B;  1FM0 D;  1Y56 A;  1SJH D;  3AEB B;  2BTE A;  2H88 B;  5BYS A;  2L83 A;  3P1M A;  1N5W A;  4TQ1 A;  3Q8E A;  3HUI A;  3Q8A A;  2E6X A;  5HI1 A;  1SJE D;  2J42 A;  4ZHO A;  3AEE B;  1L4Z B;  3EUB 2;  2WDQ B;  2JQR B;  1JWS D;  1MPE A;  3V3X A;  3W2D A;  1B9R A;  1RWS A;  1JCK B;  4C7Z A;  1VZ7 A;  2BB6 A;  1PGB A;  1PDX A;  2LEK A;  4JWU C;  2QSD A;  1MHH E;  3HVD A;  4GDK B;  4RGM A;  1GAQ B;  4RF1 A;  2HTM E;  2GRI A;  3ABV B;  2SEB D;  1XLN A;  3P42 A;  5D7G A;  2FE8 A;  2IJ0 A;  1IGD A;  4RGN A;  4ZRP A;  1QIL A;  1D5M C;  5EE9 A;  1E6E B;  3U2S C;  1L6V A;  3PZ7 A;  4D2K A;  1WXQ A;  2Y3A A;  1VZ8 A;  4R3D A;  1CJE A;  1SSN A;  2W3S A;  3W5V B;  4YSX B;  5LNK 1;  1K53 A;  2WXJ A;  2J4X A;  2W55 A;  4JPS A;  1J7C A;  3T3O A;  4FXC A;  1XLP A;  1DYQ A;  2WNM A;  2AX5 A;  5FKA C;  3BVG A;  1RM6 C;  1TKY A;  1DOI A;  1PYW D;  4NAM A;  1FD6 A;  2KAC A;  2WDV B;  5BMI A;  1JML A;  1ZXI A;  2WXK A;  1ZP0 B;  3OWE B;  1FRR A;  4RGT A;  1J7B A;  4YSY B;  2JSV X;  1C78 A;  1WSP A;  2GI9 A;  3PZ8 A;  4A8X C;  1VJK A;  1FFV A;  1XLQ A;  3ZGZ A;  3AE2 B;  2K0P A;  2PKO A;  4OZB A;  5I4D A;  1D4B A;  2FUG 1;  1T5X D;  4WIP A;  2IGG A;  2PVG C;  2J52 A;  1N5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...