3LXFA

Crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
TAILVTTRDGTRTEIQAEPGLSLMEALRDAGIDELLALCGGCCSCATCHVLVAPAFADRLPALSGDENDLLDSSDHRTPHSRLSCQITINDKLEGLEVEIAPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Molecular characterization of a class I P450 electron transfer system from Novosphingobium aromaticivorans DSM12444
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Metal binding protein
total genus 27
structure length 104
sequence length 104
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lxfA00
3NVVA 1E6EB 2M56B 3AN1A 1J7BA 1QOFA 4YT0B 2CJOA 4C80A 3P4PB 3RPFC 2KMMA 2N0SB 3NVWA 5EE0A 2JX5A 2WDVB 3WCQA 1WGKA 1XLQA 1WYGA 3LB8C 3CWIA 5C2TB 1FFUA 1XLPA 5G5HA 3VR9B 3NVYA 2KAJA 2PVOD 3LXFA 1KFYB 4YTMB 2L52A 2Q5WD 1FO4A 3W9CB 1YJJA 4US8A 1I7HA 1TKGA 2K22A 1JALA 4WWMA 3AE7B 1PDXA 2BS4B 2Y5CA 4WQMA 4JWSC 1ZOYB 1T3QA 2LEKA 2MH7A 1VLBA 2W3RA 3HVZA 2B76B 5C3JB 1OQRA 2MJEA 1DOIA 1XLOA 1RWSA 1YQ4B 3AE9B 3AECB 1OFFA 4HRSA 4ZHOA 3AEBB 1NYRA 1WRIA 3BIID 3ZYYX 1QLBB 1AYFA 4ZOHC 4YSXB 1KF6B 3SFDB 1SIJA 3AMZA 3AE6B 3KWLA 2JQRB 1E7PB 2WQYB 4LTUA 5EE1A 5AUKA 1IUEA 4FXCA 2OHFA 1UWMA 1FMAD 1WWTA 4P6VF 4YXDB 2HTME 2WDQB 1N5XA 3AEFB 5AUIA 1GPXA 1FRDA 3AE2B 1QF6A 1EWYC 2H89B 1DOXA 3SFEB 4A9AA 3AEGB 3PO0A 1XO3A 1SB3C 1ZXIA 2DWQA 1QOAA 1R7SA 1RM6C 3AE3B 3FAHA 4JX1C 4YTNB 1E10A 1DOYA 3VRAB 3P4RB 2M19A 3CIRB 1A70A 2CJNA 3AE1B 1E9MA 2E3TA 2PVGC 1SF0A 1NENB 2H88B 1CJEA 1QT9A 1V97A 1JW9D 2MJDA 1L6VA 2W3SA 2QJLA 3AEDB 1CZPA 2K5PA 1JRPA 2WP9B 4JWUC 4US9A 4YTPB 1L5PA 1NYQA 2PKOA 1NI3A 4KX6B 1TKYA 3AV8A 2WDRB 3VRBB 3DWGC 4C7ZA 1L6UA 4N59A 3DWMA 2BT6A 1FXAA 1KRHA 4IDIA 4ITKA 3VR8B 1ZP0B 3W5VB 1J7AA 3NVZA 3B2GA 3HRDD 3AEEB 3AH7A 1QOBA 3P4QB 2MJ3A 4ZHPA 5EE3A 1F0ZA 2ACZB 1N60A 1ZUD2 2L83A 1J7CA 1FFVA 1N63A 2FBWB 3NS1A 3P4SB 2WLBA 1N61A 4N58A 3ABVB 1RYJA 5GXGB 4C7YA 2W55A 3AB5A 1XLNA 4USAA 1NEKB 1VDVA 1RFKA 1DGJA 1GAQB 1L0VB 1VJKA 3B9JA 4YSZB 1B9RA 1TKEA 1JWAD 3L4PA 2WS3B 1FM0D 2BS2B 3P63A 1PUTA 3FC4A 1TYGB 1JWBD 2BS3B 3AE4B 1OQQA 3P1MA 1QOGA 4YSYB 2WU5B 2AX5A 2W54A 2PIAA 1YQ3B 1V8CA 2K9XA 5EE9A 1PFDA 1E0ZA 2QIEB 3ETRA 3W5UB 1JQ4A 2WU2B 3NRZA 1AWDA 2EKIA 1WXQA 4HROA 1FRRA 1FXIA 1ROEA 2G1EA 5H8YE 3B2FA 2CU3A 3AM9A 5G5GA 3AE5B 3SR6A 1N5WA 1JROA 3EUB2 1TJEA 1YJIA 3AEAB 1NVID 5MPOA 5H92C 2DBYA 3AE8B 3HUIA 4N6EB 1FIQA 1N62A
chains in the Genus database with same CATH superfamily
1TT5B 3AN1A 2GOWA 1VD2A 2CHXA 4GGQA 2XK5B 3NHEB 3ALBA 3PGEA 1KLVA 5BYQA 1VZ7A 4B0MA 2GBMA 4MH0E 3SHQA 4IUMB 4LK0M 3ECIA 1XEEA 1D3ZA 3RD2A 3TMPB 2INPE 4BOSC 4FBJB 2INCC 2NR2A 3V62A 2KFJA 5IA7A 5EE1A 4JL9A 4CYEA 2KLCA 1WWTA 3TEXA 4FN2A 1QF6A 1EWYC 4FJZA 4B0EA 3PO0A 2IGHA 2DWQA 3CSFA 3VRAB 3OWEB 3VXWA 2LZ6A 1V97A 4ANWA 2PEAA 1B9RA 1CK1A 2DAJA 2L0TA 3B2GA 1NBFC 5EE3A 3IG3A 1FCLA 2VZKD 2IO0B 2MSED 2TSSA 4DHJD 2HJ8A 4KGSA 2IPKD 1EF1A 3APFA 4MM3A 1TKEA 3L4PA 4PT5A 1EM7A 4KSLC 3B1LX 3ONSA 1BT0A 1OEYA 2UYZB 4NJ6A 1V81A 1FRRA 1WH3A 3N30A 3V05A 3R7RA 3H9DA 3BWUD 2DBYA 5IO9A 4RM8A 1VCBA 4EKUA 1E6EB 4C80A 2KC1A 2Y5BB 2M17A 2WX0A 5C2TB 4IOIE 3ZTDA 2PVOD 3AU5A 5DPTA 1ZGUB 2LGSA 2Q5WD 1FEHA 3Q6BA 2WXOA 4WWMA 3AE7B 4JWSC 2W3RA 4RGMA 4TMAB 3AECB 3GOEA 3EA6A 4HRSA 1EU3A 3BIID 2BQQA 3C19A 3PHXB 1WMHA 3TEWA 2WXHA 4MJSB 3URYA 1PQSA 4FHKA 4RCOA 1K51A 5AUKA 1I35A 2JUOA 1IUEA 5LXHA 1FMAD 3L08A 5AUIA 4MGZE 1ZKHA 2J52A 5JXVA 5D3IB 3R2TA 2RPQA 3QA8A 1FCCC 3ZRCA 3WA0A 2GRIA 4KIKB 3DHIC 2X38A 3NUHB 1JW9D 4ANUA 1YQBA 1YN4A 1D5ZC 2ZW1A 2N9KA 4E3CA 2KX3A 2CU1A 1I4GA 2MP2A 4JPSA 3KYDD 1IBXA 3BVMA 4OZCA 3AH7A 3DBLI 1OGWA 1T0QC 3J9CA 1J7CA 3T3NA 1P0RA 2IGDA 4FADA 1VJKA 1V49A 4HDQA 1JWAD 2D5GA 1WXVA 1PUTA 3RYTA 2BS3B 3L16A 1WFYA 2VH1A 4WJPA 1GOZA 1MHXA 2K1FA 1SJED 2E6XA 5J2RA 1FXIA 4IW0A 1WI0A 4XGAB 2SAKA 2JSVX 3MJWA 1N5WA 2FCNA 1ET6A 1WR1A 4GXBA 1YN3A 4J6IA 2MBBB 3DOWA 4JGHB 3RPFC 3A9JB 1I4XA 5C23A 2GLSA 2Z59B 5E6NA 3WCQA 1X1MA 2V3SA 2LJ5A 3W9CB 3DQVA 3U8ZA 2PPHA 4EFOA 1TKGA 4RNAA 3ZVVA 1F1HA 1YNTE 1S1QB 1TS2A 5EDSA 4DDGD 4HEA1 1YQ4B 3VH3B 3ZYYX 1TS4A 4WJOA 5AEKB 5D94A 3SFDB 1C79A 1SIJA 3AMZA 4L1BA 3TEYA 2OHFA 3GS2A 4KKJA 1DYQA 3SDLC 1FRDA 4YWGG 2QMTA 4IWQA 4OVUA 2RPVA 1GNUA 2YEPF 1CMXB 2FCSA 3QWZB 4X57B 1WM3A 5E6OA 2K6QA 2Z8LA 2OEDA 3IHPC 1KH0A 1H8CA 2V1YA 5CHFA 2NTSA 1D5MC 3IBEA 3NY5A 4JE3B 4NPNA 1WX8A 1E9MA 1C4AA 4MT5A 2D3GA 4S17A 3FKYA 1JWMD 3DWMA 3Q69A 2DHZA 1YD8U 1TZ1A 2J0JA 4M8NA 1FFVA 3N1ZC 1R4NI 3AB5A 1FNUA 2QC8A 3QIJA 3VFKA 4A8XC 3B9JA 1T0SC 2LWPA 4L2YA 1CQVA 3MC0B 4NAWA 5H8YE 3RFZB 3PPAA 1WGRA 4WAFA 4AOFA 2L8JA 3PZ8A 2KO3A 2C60A 1SIFA 4K3CA 2RMMA 4KKIA 1H4RA 1C3TA 1QKZA 2HE7A 2GBNA 4YTMB 3BINA 2G45B 2ONQA 3PREA 4Q2JA 1PDXA 2ZJDA 4RGOS 4WQMA 2MHJA 2N9XA 3T8MA 3A4RA 5HHDG 3HK0A 5JH5C 1IP9A 1NYRA 4FA6A 3KUCB 3RT3B 4ZOHC 4BBNF 4AP4C 4W9DA 3VQIA 2KN4A 1I4PA 1GB1A 2WWZA 2GBRA 4WQOB 4YXDB 4A3PA 3H8HA 3AEFB 3NJTA 1QQRA 4MGKE 1M94A 3WAPA 3I57A 1XT9B 1ZW7A 1MVKA 4EUTA 2J42A 2JT4B 3CIRB 1A70A 2BBCA 2KMCA 3ML8A 2MJDA 2QJLA 2K5PA 4XC2A 3AXCA 3O65B 1L6UA 3RULA 1MG8A 1WGYA 4DK5A 1FXAA 3BVGA 4HLEA 4DXFA 2N9LA 1F0ZA 3P4QB 1LXDA 2RR9A 1WYWB 2KTRA 2L76A 3QX1A 1WJNA 1XQQA 2BS2B 4I6LB 1OQQA 1E90A 2CHZA 3R66C 1P1AA 1V8CA 1C1YB 2MBEA 4GOCA 3VTUA 3IT4B 1TS5A 1SE2A 2D3BA 3VUXA 2ZPNA 2CU3A 1B1ZA 3V6EB 3SR6A 1YOVB 3ZRFA 1YJIA 1FD6A 5H92C 2PE6B 1HQRD 3AE8B 3RZWC 1V1PA 3EFUA 2KKCA 2RDBC 3P4PB 2N1VA 1FFUA 3GB1A 3ZJTA 2FCQA 2KDEB 2JPHA 2VH2A 1J0GA 3OG5A 1SGHA 1YX5B 3OAWA 1TY2A 4ANVA 2KJ6A 3PV1A 4D2KA 2BPSA 3I9V1 3NS8A 1F9JA 3V60A 3A1QA 2NPTA 1EU4A 1ACCA 1ZPSA 1SE4A 3L0WB 2KACA 2R2OA 4M00A 3AE3B 4JX1C 3H1UA 4AUQC 1DOYA 4BKGA 1IYFA 3A9KA 5TR5A 2QEJC 2FIFA 1MI0A 2XN9C 2WP9B 3PS6A 2ASQA 4BKSA 5HI1A 3RZFA 4N59A 3GE3C 5DPRA 4DDID 2INDC 3HM6X 4OZBA 3UQAA 3PTFC 1N60A 3EFCA 4N58A 5FK9C 4NJ7A 2W55A 3I5JC 1LFDA 1I4QA 1FM0D 4F1SA 2QHOA 5L95C 3FC4A 2PW9A 4A6QA 3B0AA 3QJZA 1C76A 4ACFA 3BY4B 5AZFA 4M0WA 2QDFA 1V2YA 3PSEB 4MM3B 4EZLA 4K81A 3HM3A 3QK0A 1J8CA 5AZGA 1FNVA 2JY6A 3ENEA 3QQ8B 2FAZA 2KQ4X 4WIPA 3LB8C 2AYOB 3RCZA 1P7FA 4FJVB 3VHTC 3TL5A 2KDBA 1AARA 1TGZB 2I2YA 5E6JA 1K50A 2IZVB 2PTLA 1WX7A 1VLBA 4TUUA 1DOIA 1FNWA 2KD0A 1AN8A 4ZHOA 1EUVB 4MSQB 3ZXVA 1QLBB 5T8IA 2KMAA 4NJCA 3R2IA 2KFKA 4FXCA 1UGJA 2LRWA 2FCMA 2K25A 2WDQB 3QHTA 4MGYE 4TQ1A 5IAAC 2FUHB 2BWES 1WMHB 3ZXRA 4C4VB 2IGGA 2L0FA 3Q8BA 3M95A 2N7DA 1QT9A 1L6VA 5FR3A 4YTPB 3H7SA 1XF5L 3VRBB 4C7ZA 4G0NB 3CSTA 1EO6A 4AJYB 5LLIA 4UDUC 1GB4A 2KX0A 2FBWB 3P4SB 4RF0A 2Z0EB 5GXGB 4EOYA 3FILA 1GAQB 1D6EC 1XCQL 2KC2A 2EMSA 4HPLB 5LNK1 1D4BA 1JWUD 2BVCA 3KW5B 2MP2B 2LUEA 4XZ4A 3UIPB 1IBXB 4LDTB 3ETRA 4R3DA 2D3AA 3AEAB 2K8BA 1NVID 2JRHA 4LCDE 2WXPA 4XYCA 2M56B 4MSMB 4K7UA 3KQ4A 3NVWA 4M01A 2R2QA 5EE0A 1PGBA 1LQBA 3R8BA 4GU2A 4LNIA 1Q10A 1OQYA 3SEBA 4WJQA 5BMIA 1TIFA 3HHMA 3TIXA 4W9IA 3N9YC 2O6VA 2LVPA 3P42A 2JZPA 2JZ3B 2RSUA 4WURA 1R4MI 4A3OA 2C7NB 3L17A 3V6CB 3JVZX 4FULA 4C00A 1Q5WB 1V80A 2H89B 4P1CC 1GUAB 2ZZPB 2K3UA 2DLBA 1YMHE 3W1YA 4A20A 2EMTA 3FAHA 2JF5A 1ET9A 2W82A 3ZQ4A 4GDLA 3DVNU 3DDCB 2RDHA 3VDZA 1OEYJ 1E7UA 3V61A 2DYOA 4HK2A 3U4EG 2BKFA 2L1AA 2XK5A 1TKYA 4HJKA 2UU7A 4XX5A 2BKRB 4ITKA 1ZP0B 2MA9B 3NVZA 2L00B 2N7JA 4BVUC 2CR5A 3GZNI 2FE8A 3MC9A 2DYMA 2BTEA 1P3QU 1Q0WB 1RLFA 4II2B 4H2AA 5IOIA 2DZMA 2D07B 3DHGC 3AE4B 3P1MA 2LGIA 2KJHB 2L32A 4ZRKA 3L13A 1MPEA 4AJWA 1SBBB 3U30A 2KVZA 2LASA 2Y5PA 2ON8A 3IT6B 1UUPA 4PYZA 2ZW0A 2PLPA 4EE2A 4IKGA 3PRMB 2DZIA 3DHHC 4P1BC 3WANA 1QOFA 4YT0B 4WH4A 4XDDA 5DCNA 2LXCA 1V1OA 1WGKA 1WYGA 2HDEA 4REZA 3H7PB 5G2NA 1FO4A 1WR6E 2AL6A 5FKAC 5KHOA 3ZIMA 2RGFA 3NG0A 3GP7A 1OQRA 1RWSA 3APDA 3RNCC 2C7HA 2HTHA 3PVLA 3A33B 4KZCA 4NQLB 2WXMA 3ZNGC 2KWVB 3CMMB 3Q3JA 1Z2MA 3U52E 1F52A 2I38A 4XE0A 2J0KA 2MBQA 4JIOU 1J19A 1SE3A 1E10A 4RH6A 3P4RB 1E8ZA 1U4AA 2JRIB 3ZUNA 4W9LA 4EZKA 4CO7A 1CZPA 1S3SG 3BVZA 1PGAA 4ZYNA 4LNKA 3PT2B 4HPPA 3PZ7A 5BMHA 3HVDA 1VZ8A 3S2AA 1HXYD 4HPMB 1N6ZA 1EF5A 1GJZA 1IGCA 4BKTA 3MTNB 1NEKB 1VDVA 1P98A 3DVNV 1C4PA 4IM3A 1JWBD 4MJSA 2WU5B 2M4NA 1YQ3B 2O2VA 2V9HA 4L23A 3R7QA 1WXMA 2WU2B 1WXQA 1RRBA 2KTRB 3AE5B 3M3JA 1JROA 2IJ0A 5CHWA 4G50A 1YN5A 4QAYA 4HKQA 2WLBA 4W9GA 2K8HA 1NDDA 4XWTA 3H6NA 4KIKA 2YLMA 2D10A 3Q8FA 4XDCA 5FR6A 2QCZA 2KAJA 1MJDA 2K22A 1LGRA 1VZ6A 2MW5A 4W9KA 5C3JB 2MJEA 2V4LA 2LMCA 1WRIA 4W9EA 3MHSD 3IAS1 1AYFA 1KF6B 2KWUB 1WE7A 3KUDB 3SD5A 3DBLB 3TJPA 5TSSA 1WX9A 1EWCA 2ZEQA 2DENB 4CQNA 2JWZA 4RMAA 2RD0A 4I6NB 1WXSA 1I4RA 4P16A 4WAAA 1CJEA 3A1QB 2ZVOA 5IP4D 3D32A 3A9JA 1XXGA 1L4DB 2KXJA 1WY8A 2SEBD 4ZRJA 3M63B 3V3XA 3VR8B 2FIDA 2C5LC 2YVCA 2X8XX 1QILA 2L83A 4HCNB 3TCAA 2MCNB 3NS1A 1RYJA 3KWVA 3W1SA 4PYUA 1WGDA 5D6JB 1WXAA 3N20C 1L7YA 2LHEA 4GIVA 2DYBA 4DHZB 1QOGA 3DBRI 3EGRA 3W5UB 1UWXA 4TQ0A 1WZ0A 1L0XB 5D3DA 2GI9A 3HUIA 1RAXA 4N6EB 3E56A 3JSVA 3NVVA 1K53A 2XBBC 3DBHI 2WXIA 4EZJA 4I6PA 1FXTB 3MP9A 4GB9A 3Q3MC 4F7ZA 3NOBA 4PS8A 3PLVA 1ZOYB 1T3QA 4G11A 2M0XA 2B76B 2AEHA 2WXGA 1QZEA 2J4XA 2EKEC 2MBOA 4BBNC 5JHAA 3QAQA 2MQJA 4II3B 3AE6B 2WQYB 2WGSA 4GDKB 4MDKE 1UWMA 4CHKA 2WDTB 5DPWA 3AE2B 3UIOB 1R4NB 3UF8A 3IVFA 1DOXA 2MRPA 3N32A 1RFAA 2LJIA 2M0AA 3ZTCA 3Q14C 3AE1B 4NZLB 1FPYA 4LDTD 3O13A 1NYQA 2K39A 1NI3A 3ZLZA 3AV8A 3U7ZA 4LLGM 2GBKA 1KRHA 2KN5A 2WXRA 3HRDD 5HG2A 2W9NA 4ZHPA 3VAWA 2REXA 4EEWA 5IN7A 2G9HD 3VVWB 1XLNA 4K3BA 4NAMA 2CKHB 1V5OA 2LFIA 3UGBB 3N1YC 1P9DU 2I1KA 2ICIA 4PK1A 1L2NA 2ZNVC 2W54A 1UD7A 1PFDA 1WF9A 3I3TB 1JQ4A 1V86A 2DZKA 3BYTB 1WM2A 1ROEA 2ZVNA 5G5GA 4DXAB 1TJEA 1FIQA 3QARA 3U2SC 2KMMA 3DBSA 4P7IA 4W9HA 3IXSA 3VR9B 2IY1B 5I4DA 3KUZA 1VRAB 3LXFA 5HKHA 4LNNA 3LJ3A 4MEMA 4US8A 2KK8A 2I1JA 1BXTA 1I7HA 4S0RA 2NS5A 4OHJA 4ASWC 2LXAA 4E74A 3VTVA 4LNOA 3KLSX 1G6JA 4W9JA 3HVZA 2JZZA 4HDOA 4DWFA 1TS3A 3AEBB 3PRZA 1KOTA 1WIAA 4FJYA 3KWLA 1V9JA 2HTME 4AS1A 4IC7B 3Q8EA 2AL3A 3WAOA 2BF8B 5J18A 1KJTA 4NY0A 3N1XC 3AEGB 1PGXA 1QOAA 5G55A 2CS4A 2E3TA 2PVGC 1HEZE 1TY0A 1K52A 4BZAA 3PHWB 4JWUC 4G3XB 4AQ7A 1HTQA 2KNBA 5BYSA 3CF6E 4K1RB 4GMVA 3LYYA 3W5VB 4IG7B 2BWFA 4KVGB 3HIZA 3EECA 3KYCD 2KTFA 3P2BA 1IPGA 3DVGX 2NTTA 5HFYA 4M02A 3P63A 5IKCM 3E9SA 3LDZE 3UQBA 3VUWA 2QIEB 3OJ3A 3UINB 1M4VA 1ZXHA 2IBIB 2XEWA 4OVZA 1YX6B 5MPOA 1WGHA 3ZJVA 2BB5A 1WRDB 1GC6A 1J7BA 4B95A 3QC8B 2RDGA 2BYVE 1Z5SB 4KSKC 1KFYB 1YJJA 3RNAC 2BS4B 2Y5CA 4HVBA 3ZNHB 2LEKA 4W9CA 4RF1A 3AE9B 1XLOA 3Q8AA 4W9FA 2N1WA 4N9F4 4O1NA 5GMVA 3UI3A 2Z0DB 4YSXB 4YL8A 2N4FA 3AI5A 4IM2A 2A5UA 2KWDA 4B9KA 3ZDTA 4TV3A 2L05A 1UF0A 4URKA 1SB3C 2WXKA 4KZ0A 4ICVA 3C8YA 2HJ1A 2WXFA 4NNJB 2K8CA 3RMKC 2CJNA 3MJ5A 5AZHA 1C77A 5G5HA 3AEDB 1WSPA 3C0RB 1YIWA 5C1ZA 2PKOA 5CHVC 5CTRC 2BT6A 4ZYSA 4IDIA 2JYEA 1QOBA 1ZUD2 1N63A 1N61A 3TBLD 1RFKA 4KGRA 2OJRA 4YSZB 3M62B 2WS3B 2PMVA 4AWJA 4WWPA 4ZRPA 2PJHA 4WWOA 2CHWA 4YSYB 2JXXA 5EE9A 1E0ZA 3ZNID 2KJRA 4ZRIA 3RI7C 3RNGC 4JLCA 4GLSC 2NBWB 2CJOA 4C4VA 2AQ2B 2MLBA 2IO1B 2O2VB 4RGTA 2WDVB 1XLQA 1JRUA 2BYTA 1ISNA 3AU4A 2LGYA 1MHHE 2LHDA 3T9LA 2L52A 2MEKA 1UELA 2J0MA 4E71A 4TSSA 1XD3B 1JALA 1SE9A 1HZ5A 2ZCCA 3Q8CA 2G4SA 2WNMA 3PZDA 4OVVA 4F8CB 3K9OB 2KWCA 3I63C 2MX2A 3OLMD 2AWTA 2K0PA 4LTUA 3ZGZA 4NAWB 3WALA 4P6VF 2EELA 3NZUA 4ARCA 5LXIB 3JYUA 2L3ZA 3VTWA 4B6WA 1R7SA 2LVQA 3L10B 1WJ4A 3RNFC 2M19A 4BKSD 1UBQA 1K8RB 1C4CA 3WAMA 3W1SC 1HE8A 1UGMA 3BYYB 3R3MA 4HWIB 2WDRB 4A55A 2NBUA 3DWGC 4BFRA 2J53A 1J7AA 2FUG1 2LVOA 2MJ3A 2K6DB 1T6BX 3TSSA 3ML9A 2ZCBA 3N3KB 4IWPA 4MELA 4LJPB 3ZNZB 1TYGB 1UBIA 4MACA 2LGDA 2KDMA 4LJOB 4HJGE 1VR9A 1MFWA 2N9EB 1R4MB 4GSWA 2AQ3B 2VZKB 2D11A 4DHJB 1JCKB 2N0SB 2N7EA 1SSNA 3Q2AC 1P7EA 4J3OD 2V4IB 2G4DB 2C9WB 1SJHD 3BK1A 1GC7A 4HKZE 3ZJUA 2JYTA 3JSVB 1E8WA 2JWUA 2NBVB 2IYDB 1WJ6A 3K9PB 2DZJA 3Q3NC 2KDFB 4KDLB 4MGIE 2LI5A 1HTOA 1E7PB 3ZDMC 5D7GA 2KQ7A 3GZNB 1UZXB 2BGFA 3SFEB 2L7RA 1V1PB 3QCAA 3B08A 3A4SC 1GG3A 3IAM1 1D5XC 1Q1OA 5J17A 4JQWC 1SF0A 1NENB 2H88B 3RUIB 1JRPA 2NMQA 1ZDXA 2B3AA 4HXDA 4DBGA 4FLHA 2DX5B 3X0WA 1L0YB 3H7PA 3PLUA 3AEEB 1WE6A 2IO2B 4BOZB 2ACZB 3BK2A 2BYFA 3ABVB 3T3OA 3KVFB 4K7SA 4C56C 1I42A 1JMLA 4KV2A 1WZ3A 4ZRQA 2NPTB 3MC8A 1A5RA 2PIAA 1KM7A 4ANXA 3JW0X 1AW7A 1AWDA 2EKIA 4M8MA 2OOBB 2KANA 3A9KB 2FNJB 2R61A 2LRUA 3ZKJC 2YEPB 1OTRB 1WJUA 2LGXA 1LO5D 4IWOA 3GE8C 2DNFA 3Q3FA 2IO3B 1TZOA 1E7VA 4WWNA 2O6VD 5DPSA 4ARIA 3RN9C 4A90A 1BUIC 1V6EA 2GMIC 3U7DA 3W2DA 2M1MA 1OFFA 2VRRB 3ZW3A 2MBHA 2WYQA 5L83A 2WXLA 5BYRA 1LM8B 2WXJA 2JQRB 4KGTA 4M0WB 1E5WA 2V0GA 4RM9A 4K7WA 1Y56A 1C78A 1C9FA 3EC8A 1JWSD 3RNEC 1WGGA 5E6PA 2WXNA 1E8XA 2NCNA 2AQ1B 2KZRA 1KLGD 2W3SA 3VUYA 1IGDA 2GB1A 1NI2A 1L5PA 1L4ZB 1KTKA 1PYWD 1T0RC 5JZEB 4FHJA 2D3CA 1F2RI 4C7YA 3SU8X 1TBEA 1F77A 4USAA 4GN1A 1YJ1A 1I4HA 3DVGY 1DGJA 1SXTA 1L0VB 2KFKB 3KH0A 4HCPB 4PS7A 2KQSA 2Y3AA 2HD5B 2IDYA 4XWWA 2AX5A 2NVUI 4IM0A 1V5TA 3Q3OC 3NRZA 3ZO5B 4BAXA 3DCGA 4HROA 1T5XD 2OJWA 3B2FA 2D2QA 1UNSA 3EUB2 1ZE3D 2BYEA 2KHWB 5JHBA 4ICUA 1KLUD 3MHZA 2KLGA 3PRPB 2KVRA 2JX5A 1STEA 2GBJA 3CWIA 1XLPA 4MH8A 3NVYA 2MWSB 2C7MB 2J7QB 2IY0B 2JVCA 3AULA 1HZ6A 2XNAC 4PS3A 2DAFA 4OW0A 3MFGA 2MH7A 2M8SA 3FILB 3NZ3A 2KT7A 3X23A 1ZDVA 3NZSA 1E8YA 2WXQA 2INNE 2BB6A 2QILA 1ENFA 2KDIA 3OJ4B 1N5XA 1GPXA 4KDIC 1TTNA 1XCTL 4A9AA 1BMLC 1XO3A 2WHIA 3TUOA 4RGNA 3L54A 2UWQA 3RNBC 1ZXIA 1RM6C 4YTNB 3BZDB 3VH4B 4DQOC 4LNFA 2ZNVB 2JU6X 3DBRB 2N9PC 4NQKE 4DXGA 2QSDA 4US9A 1UH6A 2JXTA 5BMGA 3APCA 4DHZE 2BW2A 2LUMA 4KX6B 1SEBD 1T0YA 2KYWA 2A4ZA 2V3PA 4OZAA 5KHQA 2O6VB 5D2MB 3DBHB 1ESFA 3TEZA 2LD9A 1F2RC 2G3QB 4WJNA 3DPDA 2ZPYA 4TKNA 5BO4B 4RFBA 1Y8RC 1HA5A 2V3NA 2K9XA 4GDKA 1MG4A 4ZDVA 5CX3A 2KOXA 2G1EA 2WX1A 3WIMA 3AM9A 3IFWB 4GDLB 3EHVA 2PE9A 1N62A
chains in the Genus database with same CATH topology
3AN1A 4GLSC 2CJOA 4XWTA 3P4PB 2AQ2B 4RGTA 2WDVB 1XLQA 3Q8FA 1FFUA 3GB1A 4XDCA 2BYTA 3ZJTA 2KAJA 1MHHE 2LHDA 2L52A 1VZ7A 5BYQA 4B0MA 2MEKA 4TSSA 2K22A 1JALA 1VZ6A 1HZ5A 4LK0M 3Q8CA 1XEEA 5C3JB 2WNMA 2MJEA 2LMCA 2INPE 1WRIA 1TY2A 3IAS1 1AYFA 4D2KA 1KF6B 2K0PA 4LTUA 5EE1A 3I9V1 3ZGZA 4NAWB 1WWTA 4P6VF 2EELA 3TEXA 1QF6A 1EU4A 1EWYC 4ARCA 5TSSA 1ACCA 1EWCA 1ZPSA 4B0EA 3PO0A 1SE4A 2IGHA 4CQNA 2KACA 2DWQA 1R7SA 3AE3B 4JX1C 1I4RA 1DOYA 3VRAB 2M19A 4P16A 2QEJC 1C4CA 3OWEB 1MI0A 1CJEA 1V97A 2XN9C 1B9RA 2WP9B 1XXGA 1L4DB 1CK1A 3BYYB 2WDRB 5HI1A 4A55A 3DWGC 4N59A 2J53A 2SEBD 3V3XA 3VR8B 1J7AA 3B2GA 2FUG1 4OZBA 1QILA 2MJ3A 5EE3A 1FCLA 1N60A 2L83A 2VZKD 1T6BX 3NS1A 4N58A 5FK9C 3TSSA 1RYJA 2TSSA 2W55A 3KWVA 4KGSA 2IPKD 3W1SA 1TKEA 3L4PA 1I4QA 4PT5A 1FM0D 2LHEA 3FC4A 1TYGB 1EM7A 2PW9A 4A6QA 1QOGA 4MACA 1C76A 3EGRA 3W5UB 2KDMA 1UWXA 4HJGE 1FRRA 1VR9A 4M0WA 4TQ0A 1L0XB 5D3DA 3V05A 2GI9A 4MM3B 3BWUD 2DBYA 3HUIA 2AQ3B 4N6EB 3E56A 2VZKB 3NVVA 1E6EB 1FNVA 1K53A 4C80A 2WXIA 1JCKB 2KQ4X 2N0SB 4WIPA 1SSNA 3LB8C 5C2TB 1P7FA 3MP9A 1P7EA 4J3OD 4IOIE 2PVOD 2V4IB 2Q5WD 1FEHA 1SJHD 3BK1A 2I2YA 2WXOA 4HKZE 1K50A 4WWMA 5E6JA 3AE7B 3ZJUA 4JWSC 1ZOYB 1T3QA 2JYTA 2PTLA 1VLBA 2W3RA 4RGMA 4TMAB 2B76B 2JWUA 2WXGA 3AECB 1DOIA 1FNWA 3EA6A 1AN8A 4ZHOA 4HRSA 1EU3A 2J4XA 3BIID 1QLBB 5T8IA 3TEWA 2WXHA 4NJCA 3R2IA 3URYA 4RCOA 1K51A 3AE6B 5AUKA 1E7PB 2WQYB 4GDKB 1IUEA 5D7GA 4FXCA 1UWMA 1FMAD 1UGJA 2WDQB 5AUIA 3AE2B 2J52A 5JXVA 5D3IB 3R2TA 4TQ1A 1DOXA 3SFEB 1V1PB 1FCCC 3IAM1 1D5XC 2GRIA 2IGGA 2LJIA 2M0AA 3Q8BA 3AE1B 4NZLB 2X38A 3NUHB 1SF0A 1NENB 2H88B 1QT9A 1JW9D 1L6VA 5FR3A 1YN4A 1D5ZC 1JRPA 2NMQA 4YTPB 1ZDXA 3O13A 1NYQA 1NI3A 2ZW1A 2N9KA 3AV8A 1XF5L 3VRBB 3U7ZA 4C7ZA 1I4GA 4LLGM 1L0YB 4JPSA 1KRHA 1IBXA 3BVMA 2WXRA 3HRDD 4OZCA 3AEEB 3AH7A 5HG2A 4ZHPA 4UDUC 1GB4A 2ACZB 3J9CA 1J7CA 3BK2A 2G9HD 2FBWB 3P4SB 4RF0A 3ABVB 3T3NA 5GXGB 3T3OA 3FILA 1XLNA 2IGDA 4NAMA 1GAQB 1VJKA 1D6EC 1XCQL 4C56C 1JMLA 1JWAD 2LFIA 2D5GA 5LNK1 1PUTA 1D4BA 1JWUD 2ICIA 4ZRQA 2BS3B 2W54A 1IBXB 2PIAA 1GOZA 1MHXA 1PFDA 1AW7A 3ETRA 1JQ4A 1SJED 3BYTB 1AWDA 2EKIA 2E6XA 1ROEA 1FXIA 5G5GA 4R3DA 2SAKA 2JSVX 1N5WA 1TJEA 3AEAB 1NVID 1ET6A 2R61A 1FIQA 1YN3A 2WXPA 2M56B 2YEPB 3RPFC 2KMMA 3U2SC 3KQ4A 1I4XA 3NVWA 5EE0A 1PGBA 3WCQA 1LO5D 3IXSA 3R8BA 1TZOA 3VR9B 5I4DA 1VRAB 3LXFA 1Q10A 3W9CB 4US8A 4ARIA 1BXTA 1I7HA 3SEBA 1TKGA 4OHJA 4RNAA 5BMIA 4A90A 1YNTE 1BUIC 3KLSX 1TS2A 3HVZA 3N9YC 4HEA1 1YQ4B 3W2DA 3P42A 1OFFA 1TS3A 1TS4A 3AEBB 3ZYYX 2JZPA 2WXLA 4WURA 5BYRA 3SFDB 1C79A 1SIJA 2WXJA 3AMZA 4L1BA 3KWLA 2JQRB 3TEYA 2OHFA 4KGTA 3GS2A 2HTME 4KKJA 4AS1A 1DYQA 3Q8EA 1FRDA 4YWGG 2QMTA 2H89B 2RPVA 2YEPF 2K3UA 2DLBA 2Z8LA 2V0GA 3AEGB 1YMHE 2OEDA 1PGXA 1QOAA 1Y56A 1C78A 1KH0A 1ET9A 2W82A 3FAHA 3ZQ4A 2NTSA 1C9FA 1JWSD 1D5MC 4JE3B 2WXNA 2RDHA 1E9MA 2E3TA 1HEZE 2PVGC 1TY0A 1K52A 2AQ1B 1KLGD 2W3SA 2DYOA 4JWUC 1IGDA 2GB1A 1C4AA 4AQ7A 1L5PA 1L4ZB 4MT5A 3U4EG 1KTKA 2L1AA 5BYSA 1TKYA 1PYWD 1JWMD 3DWMA 3Q69A 4ITKA 3LYYA 3W5VB 1ZP0B 3NVZA 2N7JA 1FFVA 2FE8A 1F2RI 4C7YA 1F77A 2DYMA 3AB5A 4USAA 2BTEA 1FNUA 1I4HA 4A8XC 1DGJA 1SXTA 1L0VB 3B9JA 2NTTA 4H2AA 5HFYA 2Y3AA 3P63A 2IDYA 4XWWA 4L2YA 3AE4B 3P1MA 3E9SA 2LGIA 2AX5A 1CQVA 2L32A 3MC0B 1MPEA 1SBBB 2QIEB 3NRZA 1M4VA 4HROA 5H8YE 1T5XD 1ZXHA 3RFZB 4WAFA 3B2FA 4OVZA 1UNSA 2Y5PA 3EUB2 1ZE3D 2ON8A 3IT6B 1UUPA 5MPOA 3PZ8A 3ZJVA 2ZW0A 2BB5A 2PLPA 4EE2A 4IKGA 1KLUD 3MHZA 1J7BA 1QOFA 2RMMA 4WH4A 4YT0B 4KKIA 4XDDA 2JX5A 1STEA 1V1OA 2RDGA 1WGKA 1WYGA 2HDEA 3CWIA 1XLPA 4MH8A 3NVYA 1QKZA 4REZA 4YTMB 1KFYB 1FO4A 1YJJA 1HZ6A 2XNAC 2ONQA 5FKAC 4Q2JA 1PDXA 2BS4B 4OW0A 2Y5CA 3MFGA 4RGOS 4WQMA 2MH7A 2LEKA 3FILB 3NZ3A 4RF1A 5HHDG 3GP7A 1OQRA 1ZDVA 1XLOA 3AE9B 1RWSA 3Q8AA 1NYRA 4O1NA 3UI3A 4ZOHC 4YSXB 2WXMA 2WXQA 2INNE 3VQIA 2KN4A 1I4PA 1GB1A 2BB6A 2QILA 1ENFA 3U52E 4YXDB 3H8HA 3AEFB 1N5XA 1GPXA 2KWDA 2I38A 1QQRA 4XE0A 1XCTL 3I57A 4A9AA 1BMLC 1MVKA 1XO3A 3TUOA 1SB3C 2WXKA 4RGNA 1SE3A 1ZXIA 2J42A 1RM6C 4YTNB 3BZDB 3C8YA 4DQOC 1E10A 4RH6A 2WXFA 3P4RB 3CIRB 2JU6X 1A70A 2BBCA 2CJNA 3MJ5A 1C77A 4DXGA 2MJDA 5G5HA 2QSDA 3AEDB 1WSPA 2QJLA 1CZPA 2K5PA 4US9A 2JXTA 3BVZA 5BMGA 2PKOA 1PGAA 2BW2A 2LUMA 4KX6B 1L6UA 1SEBD 3PZ7A 5BMHA 2V3PA 2BT6A 3HVDA 1FXAA 1VZ8A 3BVGA 4ZYSA 4IDIA 4OZAA 1HXYD 4DXFA 2N9LA 2JYEA 1QOBA 3P4QB 1F0ZA 1ESFA 3TEZA 1ZUD2 1N63A 1IGCA 1N61A 2WLBA 1F2RC 1NEKB 1VDVA 1RFKA 4KGRA 4YSZB 2WS3B 2BS2B 1C4PA 2PMVA 4RFBA 1JWBD 4ZRPA 1OQQA 4YSYB 2WU5B 1HA5A 1YQ3B 1V8CA 2V3NA 2K9XA 4L23A 5EE9A 1E0ZA 2WU2B 3IT4B 1WXQA 1TS5A 1SE2A 2G1EA 3AM9A 2CU3A 1B1ZA 3AE5B 3SR6A 1JROA 2IJ0A 1YJIA 4GDLB 1FD6A 5H92C 1HQRD 1YN5A 3AE8B 4HKQA 1V1PA 1N62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVV A;  1E6E B;  2M56 B;  3AN1 A;  1J7B A;  1QOF A;  4YT0 B;  2CJO A;  4C80 A;  3P4P B;  3RPF C;  2KMM A;  2N0S B;  3NVW A;  5EE0 A;  2JX5 A;  2WDV B;  3WCQ A;  1WGK A;  1XLQ A;  1WYG A;  3LB8 C;  3CWI A;  5C2T B;  1FFU A;  1XLP A;  5G5H A;  3VR9 B;  3NVY A;  2KAJ A;  2PVO D;  3LXF A;  1KFY B;  4YTM B;  2L52 A;  2Q5W D;  1FO4 A;  3W9C B;  1YJJ A;  4US8 A;  1I7H A;  1TKG A;  2K22 A;  1JAL A;  4WWM A;  3AE7 B;  1PDX A;  2BS4 B;  2Y5C A;  4WQM A;  4JWS C;  1ZOY B;  1T3Q A;  2LEK A;  2MH7 A;  1VLB A;  2W3R A;  3HVZ A;  2B76 B;  5C3J B;  1OQR A;  2MJE A;  1DOI A;  1XLO A;  1RWS A;  1YQ4 B;  3AE9 B;  3AEC B;  1OFF A;  4HRS A;  4ZHO A;  3AEB B;  1NYR A;  1WRI A;  3BII D;  3ZYY X;  1QLB B;  1AYF A;  4ZOH C;  4YSX B;  1KF6 B;  3SFD B;  1SIJ A;  3AMZ A;  3AE6 B;  3KWL A;  2JQR B;  1E7P B;  2WQY B;  4LTU A;  5EE1 A;  5AUK A;  1IUE A;  4FXC A;  2OHF A;  1UWM A;  1FMA D;  1WWT A;  4P6V F;  4YXD B;  2HTM E;  2WDQ B;  1N5X A;  3AEF B;  5AUI A;  1GPX A;  1FRD A;  3AE2 B;  1QF6 A;  1EWY C;  2H89 B;  1DOX A;  3SFE B;  4A9A A;  3AEG B;  3PO0 A;  1XO3 A;  1SB3 C;  1ZXI A;  2DWQ A;  1QOA A;  1R7S A;  1RM6 C;  3AE3 B;  3FAH A;  4JX1 C;  4YTN B;  1E10 A;  1DOY A;  3VRA B;  3P4R B;  2M19 A;  3CIR B;  1A70 A;  2CJN A;  3AE1 B;  1E9M A;  2E3T A;  2PVG C;  1SF0 A;  1NEN B;  2H88 B;  1CJE A;  1QT9 A;  1V97 A;  1JW9 D;  2MJD A;  1L6V A;  2W3S A;  2QJL A;  3AED B;  1CZP A;  2K5P A;  1JRP A;  2WP9 B;  4JWU C;  4US9 A;  4YTP B;  1L5P A;  1NYQ A;  2PKO A;  1NI3 A;  4KX6 B;  1TKY A;  3AV8 A;  2WDR B;  3VRB B;  3DWG C;  4C7Z A;  1L6U A;  4N59 A;  3DWM A;  2BT6 A;  1FXA A;  1KRH A;  4IDI A;  4ITK A;  3VR8 B;  1ZP0 B;  3W5V B;  1J7A A;  3NVZ A;  3B2G A;  3HRD D;  3AEE B;  3AH7 A;  1QOB A;  3P4Q B;  2MJ3 A;  4ZHP A;  5EE3 A;  1F0Z A;  2ACZ B;  1N60 A;  1ZUD 2;  2L83 A;  1J7C A;  1FFV A;  1N63 A;  2FBW B;  3NS1 A;  3P4S B;  2WLB A;  1N61 A;  4N58 A;  3ABV B;  1RYJ A;  5GXG B;  4C7Y A;  2W55 A;  3AB5 A;  1XLN A;  4USA A;  1NEK B;  1VDV A;  1RFK A;  1DGJ A;  1GAQ B;  1L0V B;  1VJK A;  3B9J A;  4YSZ B;  1B9R A;  1TKE A;  1JWA D;  3L4P A;  2WS3 B;  1FM0 D;  2BS2 B;  3P63 A;  1PUT A;  3FC4 A;  1TYG B;  1JWB D;  2BS3 B;  3AE4 B;  1OQQ A;  3P1M A;  1QOG A;  4YSY B;  2WU5 B;  2AX5 A;  2W54 A;  2PIA A;  1YQ3 B;  1V8C A;  2K9X A;  5EE9 A;  1PFD A;  1E0Z A;  2QIE B;  3ETR A;  3W5U B;  1JQ4 A;  2WU2 B;  3NRZ A;  1AWD A;  2EKI A;  1WXQ A;  4HRO A;  1FRR A;  1FXI A;  1ROE A;  2G1E A;  5H8Y E;  3B2F A;  2CU3 A;  3AM9 A;  5G5G A;  3AE5 B;  3SR6 A;  1N5W A;  1JRO A;  3EUB 2;  1TJE A;  1YJI A;  3AEA B;  1NVI D;  5MPO A;  5H92 C;  2DBY A;  3AE8 B;  3HUI A;  4N6E B;  1FIQ A;  1N62 A; 
#chains in the Genus database with same CATH topology
 1TT5 B;  3AN1 A;  2GOW A;  1VD2 A;  2CHX A;  4GGQ A;  2XK5 B;  3NHE B;  3ALB A;  3PGE A;  1KLV A;  5BYQ A;  1VZ7 A;  4B0M A;  2GBM A;  4MH0 E;  3SHQ A;  4IUM B;  4LK0 M;  3ECI A;  1XEE A;  1D3Z A;  3RD2 A;  3TMP B;  2INP E;  4BOS C;  4FBJ B;  2INC C;  2NR2 A;  3V62 A;  2KFJ A;  5IA7 A;  5EE1 A;  4JL9 A;  4CYE A;  2KLC A;  1WWT A;  3TEX A;  4FN2 A;  1QF6 A;  1EWY C;  4FJZ A;  4B0E A;  3PO0 A;  2IGH A;  2DWQ A;  3CSF A;  3VRA B;  3OWE B;  3VXW A;  2LZ6 A;  1V97 A;  4ANW A;  2PEA A;  1B9R A;  1CK1 A;  2DAJ A;  2L0T A;  3B2G A;  1NBF C;  5EE3 A;  3IG3 A;  1FCL A;  2VZK D;  2IO0 B;  2MSE D;  2TSS A;  4DHJ D;  2HJ8 A;  4KGS A;  2IPK D;  1EF1 A;  3APF A;  4MM3 A;  1TKE A;  3L4P A;  4PT5 A;  1EM7 A;  4KSL C;  3B1L X;  3ONS A;  1BT0 A;  1OEY A;  2UYZ B;  4NJ6 A;  1V81 A;  1FRR A;  1WH3 A;  3N30 A;  3V05 A;  3R7R A;  3H9D A;  3BWU D;  2DBY A;  5IO9 A;  4RM8 A;  1VCB A;  4EKU A;  1E6E B;  4C80 A;  2KC1 A;  2Y5B B;  2M17 A;  2WX0 A;  5C2T B;  4IOI E;  3ZTD A;  2PVO D;  3AU5 A;  5DPT A;  1ZGU B;  2LGS A;  2Q5W D;  1FEH A;  3Q6B A;  2WXO A;  4WWM A;  3AE7 B;  4JWS C;  2W3R A;  4RGM A;  4TMA B;  3AEC B;  3GOE A;  3EA6 A;  4HRS A;  1EU3 A;  3BII D;  2BQQ A;  3C19 A;  3PHX B;  1WMH A;  3TEW A;  2WXH A;  4MJS B;  3URY A;  1PQS A;  4FHK A;  4RCO A;  1K51 A;  5AUK A;  1I35 A;  2JUO A;  1IUE A;  5LXH A;  1FMA D;  3L08 A;  5AUI A;  4MGZ E;  1ZKH A;  2J52 A;  5JXV A;  5D3I B;  3R2T A;  2RPQ A;  3QA8 A;  1FCC C;  3ZRC A;  3WA0 A;  2GRI A;  4KIK B;  3DHI C;  2X38 A;  3NUH B;  1JW9 D;  4ANU A;  1YQB A;  1YN4 A;  1D5Z C;  2ZW1 A;  2N9K A;  4E3C A;  2KX3 A;  2CU1 A;  1I4G A;  2MP2 A;  4JPS A;  3KYD D;  1IBX A;  3BVM A;  4OZC A;  3AH7 A;  3DBL I;  1OGW A;  1T0Q C;  3J9C A;  1J7C A;  3T3N A;  1P0R A;  2IGD A;  4FAD A;  1VJK A;  1V49 A;  4HDQ A;  1JWA D;  2D5G A;  1WXV A;  1PUT A;  3RYT A;  2BS3 B;  3L16 A;  1WFY A;  2VH1 A;  4WJP A;  1GOZ A;  1MHX A;  2K1F A;  1SJE D;  2E6X A;  5J2R A;  1FXI A;  4IW0 A;  1WI0 A;  4XGA B;  2SAK A;  2JSV X;  3MJW A;  1N5W A;  2FCN A;  1ET6 A;  1WR1 A;  4GXB A;  1YN3 A;  4J6I A;  2MBB B;  3DOW A;  4JGH B;  3RPF C;  3A9J B;  1I4X A;  5C23 A;  2GLS A;  2Z59 B;  5E6N A;  3WCQ A;  1X1M A;  2V3S A;  2LJ5 A;  3W9C B;  3DQV A;  3U8Z A;  2PPH A;  4EFO A;  1TKG A;  4RNA A;  3ZVV A;  1F1H A;  1YNT E;  1S1Q B;  1TS2 A;  5EDS A;  4DDG D;  4HEA 1;  1YQ4 B;  3VH3 B;  3ZYY X;  1TS4 A;  4WJO A;  5AEK B;  5D94 A;  3SFD B;  1C79 A;  1SIJ A;  3AMZ A;  4L1B A;  3TEY A;  2OHF A;  3GS2 A;  4KKJ A;  1DYQ A;  3SDL C;  1FRD A;  4YWG G;  2QMT A;  4IWQ A;  4OVU A;  2RPV A;  1GNU A;  2YEP F;  1CMX B;  2FCS A;  3QWZ B;  4X57 B;  1WM3 A;  5E6O A;  2K6Q A;  2Z8L A;  2OED A;  3IHP C;  1KH0 A;  1H8C A;  2V1Y A;  5CHF A;  2NTS A;  1D5M C;  3IBE A;  3NY5 A;  4JE3 B;  4NPN A;  1WX8 A;  1E9M A;  1C4A A;  4MT5 A;  2D3G A;  4S17 A;  3FKY A;  1JWM D;  3DWM A;  3Q69 A;  2DHZ A;  1YD8 U;  1TZ1 A;  2J0J A;  4M8N A;  1FFV A;  3N1Z C;  1R4N I;  3AB5 A;  1FNU A;  2QC8 A;  3QIJ A;  3VFK A;  4A8X C;  3B9J A;  1T0S C;  2LWP A;  4L2Y A;  1CQV A;  3MC0 B;  4NAW A;  5H8Y E;  3RFZ B;  3PPA A;  1WGR A;  4WAF A;  4AOF A;  2L8J A;  3PZ8 A;  2KO3 A;  2C60 A;  1SIF A;  4K3C A;  2RMM A;  4KKI A;  1H4R A;  1C3T A;  1QKZ A;  2HE7 A;  2GBN A;  4YTM B;  3BIN A;  2G45 B;  2ONQ A;  3PRE A;  4Q2J A;  1PDX A;  2ZJD A;  4RGO S;  4WQM A;  2MHJ A;  2N9X A;  3T8M A;  3A4R A;  5HHD G;  3HK0 A;  5JH5 C;  1IP9 A;  1NYR A;  4FA6 A;  3KUC B;  3RT3 B;  4ZOH C;  4BBN F;  4AP4 C;  4W9D A;  3VQI A;  2KN4 A;  1I4P A;  1GB1 A;  2WWZ A;  2GBR A;  4WQO B;  4YXD B;  4A3P A;  3H8H A;  3AEF B;  3NJT A;  1QQR A;  4MGK E;  1M94 A;  3WAP A;  3I57 A;  1XT9 B;  1ZW7 A;  1MVK A;  4EUT A;  2J42 A;  2JT4 B;  3CIR B;  1A70 A;  2BBC A;  2KMC A;  3ML8 A;  2MJD A;  2QJL A;  2K5P A;  4XC2 A;  3AXC A;  3O65 B;  1L6U A;  3RUL A;  1MG8 A;  1WGY A;  4DK5 A;  1FXA A;  3BVG A;  4HLE A;  4DXF A;  2N9L A;  1F0Z A;  3P4Q B;  1LXD A;  2RR9 A;  1WYW B;  2KTR A;  2L76 A;  3QX1 A;  1WJN A;  1XQQ A;  2BS2 B;  4I6L B;  1OQQ A;  1E90 A;  2CHZ A;  3R66 C;  1P1A A;  1V8C A;  1C1Y B;  2MBE A;  4GOC A;  3VTU A;  3IT4 B;  1TS5 A;  1SE2 A;  2D3B A;  3VUX A;  2ZPN A;  2CU3 A;  1B1Z A;  3V6E B;  3SR6 A;  1YOV B;  3ZRF A;  1YJI A;  1FD6 A;  5H92 C;  2PE6 B;  1HQR D;  3AE8 B;  3RZW C;  1V1P A;  3EFU A;  2KKC A;  2RDB C;  3P4P B;  2N1V A;  1FFU A;  3GB1 A;  3ZJT A;  2FCQ A;  2KDE B;  2JPH A;  2VH2 A;  1J0G A;  3OG5 A;  1SGH A;  1YX5 B;  3OAW A;  1TY2 A;  4ANV A;  2KJ6 A;  3PV1 A;  4D2K A;  2BPS A;  3I9V 1;  3NS8 A;  1F9J A;  3V60 A;  3A1Q A;  2NPT A;  1EU4 A;  1ACC A;  1ZPS A;  1SE4 A;  3L0W B;  2KAC A;  2R2O A;  4M00 A;  3AE3 B;  4JX1 C;  3H1U A;  4AUQ C;  1DOY A;  4BKG A;  1IYF A;  3A9K A;  5TR5 A;  2QEJ C;  2FIF A;  1MI0 A;  2XN9 C;  2WP9 B;  3PS6 A;  2ASQ A;  4BKS A;  5HI1 A;  3RZF A;  4N59 A;  3GE3 C;  5DPR A;  4DDI D;  2IND C;  3HM6 X;  4OZB A;  3UQA A;  3PTF C;  1N60 A;  3EFC A;  4N58 A;  5FK9 C;  4NJ7 A;  2W55 A;  3I5J C;  1LFD A;  1I4Q A;  1FM0 D;  4F1S A;  2QHO A;  5L95 C;  3FC4 A;  2PW9 A;  4A6Q A;  3B0A A;  3QJZ A;  1C76 A;  4ACF A;  3BY4 B;  5AZF A;  4M0W A;  2QDF A;  1V2Y A;  3PSE B;  4MM3 B;  4EZL A;  4K81 A;  3HM3 A;  3QK0 A;  1J8C A;  5AZG A;  1FNV A;  2JY6 A;  3ENE A;  3QQ8 B;  2FAZ A;  2KQ4 X;  4WIP A;  3LB8 C;  2AYO B;  3RCZ A;  1P7F A;  4FJV B;  3VHT C;  3TL5 A;  2KDB A;  1AAR A;  1TGZ B;  2I2Y A;  5E6J A;  1K50 A;  2IZV B;  2PTL A;  1WX7 A;  1VLB A;  4TUU A;  1DOI A;  1FNW A;  2KD0 A;  1AN8 A;  4ZHO A;  1EUV B;  4MSQ B;  3ZXV A;  1QLB B;  5T8I A;  2KMA A;  4NJC A;  3R2I A;  2KFK A;  4FXC A;  1UGJ A;  2LRW A;  2FCM A;  2K25 A;  2WDQ B;  3QHT A;  4MGY E;  4TQ1 A;  5IAA C;  2FUH B;  2BWE S;  1WMH B;  3ZXR A;  4C4V B;  2IGG A;  2L0F A;  3Q8B A;  3M95 A;  2N7D A;  1QT9 A;  1L6V A;  5FR3 A;  4YTP B;  3H7S A;  1XF5 L;  3VRB B;  4C7Z A;  4G0N B;  3CST A;  1EO6 A;  4AJY B;  5LLI A;  4UDU C;  1GB4 A;  2KX0 A;  2FBW B;  3P4S B;  4RF0 A;  2Z0E B;  5GXG B;  4EOY A;  3FIL A;  1GAQ B;  1D6E C;  1XCQ L;  2KC2 A;  2EMS A;  4HPL B;  5LNK 1;  1D4B A;  1JWU D;  2BVC A;  3KW5 B;  2MP2 B;  2LUE A;  4XZ4 A;  3UIP B;  1IBX B;  4LDT B;  3ETR A;  4R3D A;  2D3A A;  3AEA B;  2K8B A;  1NVI D;  2JRH A;  4LCD E;  2WXP A;  4XYC A;  2M56 B;  4MSM B;  4K7U A;  3KQ4 A;  3NVW A;  4M01 A;  2R2Q A;  5EE0 A;  1PGB A;  1LQB A;  3R8B A;  4GU2 A;  4LNI A;  1Q10 A;  1OQY A;  3SEB A;  4WJQ A;  5BMI A;  1TIF A;  3HHM A;  3TIX A;  4W9I A;  3N9Y C;  2O6V A;  2LVP A;  3P42 A;  2JZP A;  2JZ3 B;  2RSU A;  4WUR A;  1R4M I;  4A3O A;  2C7N B;  3L17 A;  3V6C B;  3JVZ X;  4FUL A;  4C00 A;  1Q5W B;  1V80 A;  2H89 B;  4P1C C;  1GUA B;  2ZZP B;  2K3U A;  2DLB A;  1YMH E;  3W1Y A;  4A20 A;  2EMT A;  3FAH A;  2JF5 A;  1ET9 A;  2W82 A;  3ZQ4 A;  4GDL A;  3DVN U;  3DDC B;  2RDH A;  3VDZ A;  1OEY J;  1E7U A;  3V61 A;  2DYO A;  4HK2 A;  3U4E G;  2BKF A;  2L1A A;  2XK5 A;  1TKY A;  4HJK A;  2UU7 A;  4XX5 A;  2BKR B;  4ITK A;  1ZP0 B;  2MA9 B;  3NVZ A;  2L00 B;  2N7J A;  4BVU C;  2CR5 A;  3GZN I;  2FE8 A;  3MC9 A;  2DYM A;  2BTE A;  1P3Q U;  1Q0W B;  1RLF A;  4II2 B;  4H2A A;  5IOI A;  2DZM A;  2D07 B;  3DHG C;  3AE4 B;  3P1M A;  2LGI A;  2KJH B;  2L32 A;  4ZRK A;  3L13 A;  1MPE A;  4AJW A;  1SBB B;  3U30 A;  2KVZ A;  2LAS A;  2Y5P A;  2ON8 A;  3IT6 B;  1UUP A;  4PYZ A;  2ZW0 A;  2PLP A;  4EE2 A;  4IKG A;  3PRM B;  2DZI A;  3DHH C;  4P1B C;  3WAN A;  1QOF A;  4YT0 B;  4WH4 A;  4XDD A;  5DCN A;  2LXC A;  1V1O A;  1WGK A;  1WYG A;  2HDE A;  4REZ A;  3H7P B;  5G2N A;  1FO4 A;  1WR6 E;  2AL6 A;  5FKA C;  5KHO A;  3ZIM A;  2RGF A;  3NG0 A;  3GP7 A;  1OQR A;  1RWS A;  3APD A;  3RNC C;  2C7H A;  2HTH A;  3PVL A;  3A33 B;  4KZC A;  4NQL B;  2WXM A;  3ZNG C;  2KWV B;  3CMM B;  3Q3J A;  1Z2M A;  3U52 E;  1F52 A;  2I38 A;  4XE0 A;  2J0K A;  2MBQ A;  4JIO U;  1J19 A;  1SE3 A;  1E10 A;  4RH6 A;  3P4R B;  1E8Z A;  1U4A A;  2JRI B;  3ZUN A;  4W9L A;  4EZK A;  4CO7 A;  1CZP A;  1S3S G;  3BVZ A;  1PGA A;  4ZYN A;  4LNK A;  3PT2 B;  4HPP A;  3PZ7 A;  5BMH A;  3HVD A;  1VZ8 A;  3S2A A;  1HXY D;  4HPM B;  1N6Z A;  1EF5 A;  1GJZ A;  1IGC A;  4BKT A;  3MTN B;  1NEK B;  1VDV A;  1P98 A;  3DVN V;  1C4P A;  4IM3 A;  1JWB D;  4MJS A;  2WU5 B;  2M4N A;  1YQ3 B;  2O2V A;  2V9H A;  4L23 A;  3R7Q A;  1WXM A;  2WU2 B;  1WXQ A;  1RRB A;  2KTR B;  3AE5 B;  3M3J A;  1JRO A;  2IJ0 A;  5CHW A;  4G50 A;  1YN5 A;  4QAY A;  4HKQ A;  2WLB A;  4W9G A;  2K8H A;  1NDD A;  4XWT A;  3H6N A;  4KIK A;  2YLM A;  2D10 A;  3Q8F A;  4XDC A;  5FR6 A;  2QCZ A;  2KAJ A;  1MJD A;  2K22 A;  1LGR A;  1VZ6 A;  2MW5 A;  4W9K A;  5C3J B;  2MJE A;  2V4L A;  2LMC A;  1WRI A;  4W9E A;  3MHS D;  3IAS 1;  1AYF A;  1KF6 B;  2KWU B;  1WE7 A;  3KUD B;  3SD5 A;  3DBL B;  3TJP A;  5TSS A;  1WX9 A;  1EWC A;  2ZEQ A;  2DEN B;  4CQN A;  2JWZ A;  4RMA A;  2RD0 A;  4I6N B;  1WXS A;  1I4R A;  4P16 A;  4WAA A;  1CJE A;  3A1Q B;  2ZVO A;  5IP4 D;  3D32 A;  3A9J A;  1XXG A;  1L4D B;  2KXJ A;  1WY8 A;  2SEB D;  4ZRJ A;  3M63 B;  3V3X A;  3VR8 B;  2FID A;  2C5L C;  2YVC A;  2X8X X;  1QIL A;  2L83 A;  4HCN B;  3TCA A;  2MCN B;  3NS1 A;  1RYJ A;  3KWV A;  3W1S A;  4PYU A;  1WGD A;  5D6J B;  1WXA A;  3N20 C;  1L7Y A;  2LHE A;  4GIV A;  2DYB A;  4DHZ B;  1QOG A;  3DBR I;  3EGR A;  3W5U B;  1UWX A;  4TQ0 A;  1WZ0 A;  1L0X B;  5D3D A;  2GI9 A;  3HUI A;  1RAX A;  4N6E B;  3E56 A;  3JSV A;  3NVV A;  1K53 A;  2XBB C;  3DBH I;  2WXI A;  4EZJ A;  4I6P A;  1FXT B;  3MP9 A;  4GB9 A;  3Q3M C;  4F7Z A;  3NOB A;  4PS8 A;  3PLV A;  1ZOY B;  1T3Q A;  4G11 A;  2M0X A;  2B76 B;  2AEH A;  2WXG A;  1QZE A;  2J4X A;  2EKE C;  2MBO A;  4BBN C;  5JHA A;  3QAQ A;  2MQJ A;  4II3 B;  3AE6 B;  2WQY B;  2WGS A;  4GDK B;  4MDK E;  1UWM A;  4CHK A;  2WDT B;  5DPW A;  3AE2 B;  3UIO B;  1R4N B;  3UF8 A;  3IVF A;  1DOX A;  2MRP A;  3N32 A;  1RFA A;  2LJI A;  2M0A A;  3ZTC A;  3Q14 C;  3AE1 B;  4NZL B;  1FPY A;  4LDT D;  3O13 A;  1NYQ A;  2K39 A;  1NI3 A;  3ZLZ A;  3AV8 A;  3U7Z A;  4LLG M;  2GBK A;  1KRH A;  2KN5 A;  2WXR A;  3HRD D;  5HG2 A;  2W9N A;  4ZHP A;  3VAW A;  2REX A;  4EEW A;  5IN7 A;  2G9H D;  3VVW B;  1XLN A;  4K3B A;  4NAM A;  2CKH B;  1V5O A;  2LFI A;  3UGB B;  3N1Y C;  1P9D U;  2I1K A;  2ICI A;  4PK1 A;  1L2N A;  2ZNV C;  2W54 A;  1UD7 A;  1PFD A;  1WF9 A;  3I3T B;  1JQ4 A;  1V86 A;  2DZK A;  3BYT B;  1WM2 A;  1ROE A;  2ZVN A;  5G5G A;  4DXA B;  1TJE A;  1FIQ A;  3QAR A;  3U2S C;  2KMM A;  3DBS A;  4P7I A;  4W9H A;  3IXS A;  3VR9 B;  2IY1 B;  5I4D A;  3KUZ A;  1VRA B;  3LXF A;  5HKH A;  4LNN A;  3LJ3 A;  4MEM A;  4US8 A;  2KK8 A;  2I1J A;  1BXT A;  1I7H A;  4S0R A;  2NS5 A;  4OHJ A;  4ASW C;  2LXA A;  4E74 A;  3VTV A;  4LNO A;  3KLS X;  1G6J A;  4W9J A;  3HVZ A;  2JZZ A;  4HDO A;  4DWF A;  1TS3 A;  3AEB B;  3PRZ A;  1KOT A;  1WIA A;  4FJY A;  3KWL A;  1V9J A;  2HTM E;  4AS1 A;  4IC7 B;  3Q8E A;  2AL3 A;  3WAO A;  2BF8 B;  5J18 A;  1KJT A;  4NY0 A;  3N1X C;  3AEG B;  1PGX A;  1QOA A;  5G55 A;  2CS4 A;  2E3T A;  2PVG C;  1HEZ E;  1TY0 A;  1K52 A;  4BZA A;  3PHW B;  4JWU C;  4G3X B;  4AQ7 A;  1HTQ A;  2KNB A;  5BYS A;  3CF6 E;  4K1R B;  4GMV A;  3LYY A;  3W5V B;  4IG7 B;  2BWF A;  4KVG B;  3HIZ A;  3EEC A;  3KYC D;  2KTF A;  3P2B A;  1IPG A;  3DVG X;  2NTT A;  5HFY A;  4M02 A;  3P63 A;  5IKC M;  3E9S A;  3LDZ E;  3UQB A;  3VUW A;  2QIE B;  3OJ3 A;  3UIN B;  1M4V A;  1ZXH A;  2IBI B;  2XEW A;  4OVZ A;  1YX6 B;  5MPO A;  1WGH A;  3ZJV A;  2BB5 A;  1WRD B;  1GC6 A;  1J7B A;  4B95 A;  3QC8 B;  2RDG A;  2BYV E;  1Z5S B;  4KSK C;  1KFY B;  1YJJ A;  3RNA C;  2BS4 B;  2Y5C A;  4HVB A;  3ZNH B;  2LEK A;  4W9C A;  4RF1 A;  3AE9 B;  1XLO A;  3Q8A A;  4W9F A;  2N1W A;  4N9F 4;  4O1N A;  5GMV A;  3UI3 A;  2Z0D B;  4YSX B;  4YL8 A;  2N4F A;  3AI5 A;  4IM2 A;  2A5U A;  2KWD A;  4B9K A;  3ZDT A;  4TV3 A;  2L05 A;  1UF0 A;  4URK A;  1SB3 C;  2WXK A;  4KZ0 A;  4ICV A;  3C8Y A;  2HJ1 A;  2WXF A;  4NNJ B;  2K8C A;  3RMK C;  2CJN A;  3MJ5 A;  5AZH A;  1C77 A;  5G5H A;  3AED B;  1WSP A;  3C0R B;  1YIW A;  5C1Z A;  2PKO A;  5CHV C;  5CTR C;  2BT6 A;  4ZYS A;  4IDI A;  2JYE A;  1QOB A;  1ZUD 2;  1N63 A;  1N61 A;  3TBL D;  1RFK A;  4KGR A;  2OJR A;  4YSZ B;  3M62 B;  2WS3 B;  2PMV A;  4AWJ A;  4WWP A;  4ZRP A;  2PJH A;  4WWO A;  2CHW A;  4YSY B;  2JXX A;  5EE9 A;  1E0Z A;  3ZNI D;  2KJR A;  4ZRI A;  3RI7 C;  3RNG C;  4JLC A;  4GLS C;  2NBW B;  2CJO A;  4C4V A;  2AQ2 B;  2MLB A;  2IO1 B;  2O2V B;  4RGT A;  2WDV B;  1XLQ A;  1JRU A;  2BYT A;  1ISN A;  3AU4 A;  2LGY A;  1MHH E;  2LHD A;  3T9L A;  2L52 A;  2MEK A;  1UEL A;  2J0M A;  4E71 A;  4TSS A;  1XD3 B;  1JAL A;  1SE9 A;  1HZ5 A;  2ZCC A;  3Q8C A;  2G4S A;  2WNM A;  3PZD A;  4OVV A;  4F8C B;  3K9O B;  2KWC A;  3I63 C;  2MX2 A;  3OLM D;  2AWT A;  2K0P A;  4LTU A;  3ZGZ A;  4NAW B;  3WAL A;  4P6V F;  2EEL A;  3NZU A;  4ARC A;  5LXI B;  3JYU A;  2L3Z A;  3VTW A;  4B6W A;  1R7S A;  2LVQ A;  3L10 B;  1WJ4 A;  3RNF C;  2M19 A;  4BKS D;  1UBQ A;  1K8R B;  1C4C A;  3WAM A;  3W1S C;  1HE8 A;  1UGM A;  3BYY B;  3R3M A;  4HWI B;  2WDR B;  4A55 A;  2NBU A;  3DWG C;  4BFR A;  2J53 A;  1J7A A;  2FUG 1;  2LVO A;  2MJ3 A;  2K6D B;  1T6B X;  3TSS A;  3ML9 A;  2ZCB A;  3N3K B;  4IWP A;  4MEL A;  4LJP B;  3ZNZ B;  1TYG B;  1UBI A;  4MAC A;  2LGD A;  2KDM A;  4LJO B;  4HJG E;  1VR9 A;  1MFW A;  2N9E B;  1R4M B;  4GSW A;  2AQ3 B;  2VZK B;  2D11 A;  4DHJ B;  1JCK B;  2N0S B;  2N7E A;  1SSN A;  3Q2A C;  1P7E A;  4J3O D;  2V4I B;  2G4D B;  2C9W B;  1SJH D;  3BK1 A;  1GC7 A;  4HKZ E;  3ZJU A;  2JYT A;  3JSV B;  1E8W A;  2JWU A;  2NBV B;  2IYD B;  1WJ6 A;  3K9P B;  2DZJ A;  3Q3N C;  2KDF B;  4KDL B;  4MGI E;  2LI5 A;  1HTO A;  1E7P B;  3ZDM C;  5D7G A;  2KQ7 A;  3GZN B;  1UZX B;  2BGF A;  3SFE B;  2L7R A;  1V1P B;  3QCA A;  3B08 A;  3A4S C;  1GG3 A;  3IAM 1;  1D5X C;  1Q1O A;  5J17 A;  4JQW C;  1SF0 A;  1NEN B;  2H88 B;  3RUI B;  1JRP A;  2NMQ A;  1ZDX A;  2B3A A;  4HXD A;  4DBG A;  4FLH A;  2DX5 B;  3X0W A;  1L0Y B;  3H7P A;  3PLU A;  3AEE B;  1WE6 A;  2IO2 B;  4BOZ B;  2ACZ B;  3BK2 A;  2BYF A;  3ABV B;  3T3O A;  3KVF B;  4K7S A;  4C56 C;  1I42 A;  1JML A;  4KV2 A;  1WZ3 A;  4ZRQ A;  2NPT B;  3MC8 A;  1A5R A;  2PIA A;  1KM7 A;  4ANX A;  3JW0 X;  1AW7 A;  1AWD A;  2EKI A;  4M8M A;  2OOB B;  2KAN A;  3A9K B;  2FNJ B;  2R61 A;  2LRU A;  3ZKJ C;  2YEP B;  1OTR B;  1WJU A;  2LGX A;  1LO5 D;  4IWO A;  3GE8 C;  2DNF A;  3Q3F A;  2IO3 B;  1TZO A;  1E7V A;  4WWN A;  2O6V D;  5DPS A;  4ARI A;  3RN9 C;  4A90 A;  1BUI C;  1V6E A;  2GMI C;  3U7D A;  3W2D A;  2M1M A;  1OFF A;  2VRR B;  3ZW3 A;  2MBH A;  2WYQ A;  5L83 A;  2WXL A;  5BYR A;  1LM8 B;  2WXJ A;  2JQR B;  4KGT A;  4M0W B;  1E5W A;  2V0G A;  4RM9 A;  4K7W A;  1Y56 A;  1C78 A;  1C9F A;  3EC8 A;  1JWS D;  3RNE C;  1WGG A;  5E6P A;  2WXN A;  1E8X A;  2NCN A;  2AQ1 B;  2KZR A;  1KLG D;  2W3S A;  3VUY A;  1IGD A;  2GB1 A;  1NI2 A;  1L5P A;  1L4Z B;  1KTK A;  1PYW D;  1T0R C;  5JZE B;  4FHJ A;  2D3C A;  1F2R I;  4C7Y A;  3SU8 X;  1TBE A;  1F77 A;  4USA A;  4GN1 A;  1YJ1 A;  1I4H A;  3DVG Y;  1DGJ A;  1SXT A;  1L0V B;  2KFK B;  3KH0 A;  4HCP B;  4PS7 A;  2KQS A;  2Y3A A;  2HD5 B;  2IDY A;  4XWW A;  2AX5 A;  2NVU I;  4IM0 A;  1V5T A;  3Q3O C;  3NRZ A;  3ZO5 B;  4BAX A;  3DCG A;  4HRO A;  1T5X D;  2OJW A;  3B2F A;  2D2Q A;  1UNS A;  3EUB 2;  1ZE3 D;  2BYE A;  2KHW B;  5JHB A;  4ICU A;  1KLU D;  3MHZ A;  2KLG A;  3PRP B;  2KVR A;  2JX5 A;  1STE A;  2GBJ A;  3CWI A;  1XLP A;  4MH8 A;  3NVY A;  2MWS B;  2C7M B;  2J7Q B;  2IY0 B;  2JVC A;  3AUL A;  1HZ6 A;  2XNA C;  4PS3 A;  2DAF A;  4OW0 A;  3MFG A;  2MH7 A;  2M8S A;  3FIL B;  3NZ3 A;  2KT7 A;  3X23 A;  1ZDV A;  3NZS A;  1E8Y A;  2WXQ A;  2INN E;  2BB6 A;  2QIL A;  1ENF A;  2KDI A;  3OJ4 B;  1N5X A;  1GPX A;  4KDI C;  1TTN A;  1XCT L;  4A9A A;  1BML C;  1XO3 A;  2WHI A;  3TUO A;  4RGN A;  3L54 A;  2UWQ A;  3RNB C;  1ZXI A;  1RM6 C;  4YTN B;  3BZD B;  3VH4 B;  4DQO C;  4LNF A;  2ZNV B;  2JU6 X;  3DBR B;  2N9P C;  4NQK E;  4DXG A;  2QSD A;  4US9 A;  1UH6 A;  2JXT A;  5BMG A;  3APC A;  4DHZ E;  2BW2 A;  2LUM A;  4KX6 B;  1SEB D;  1T0Y A;  2KYW A;  2A4Z A;  2V3P A;  4OZA A;  5KHQ A;  2O6V B;  5D2M B;  3DBH B;  1ESF A;  3TEZ A;  2LD9 A;  1F2R C;  2G3Q B;  4WJN A;  3DPD A;  2ZPY A;  4TKN A;  5BO4 B;  4RFB A;  1Y8R C;  1HA5 A;  2V3N A;  2K9X A;  4GDK A;  1MG4 A;  4ZDV A;  5CX3 A;  2KOX A;  2G1E A;  2WX1 A;  3WIM A;  3AM9 A;  3IFW B;  4GDL B;  3EHV A;  2PE9 A;  1N62 A; 
#chains in the Genus database with same CATH homology
 3AN1 A;  4GLS C;  2CJO A;  4XWT A;  3P4P B;  2AQ2 B;  4RGT A;  2WDV B;  1XLQ A;  3Q8F A;  1FFU A;  3GB1 A;  4XDC A;  2BYT A;  3ZJT A;  2KAJ A;  1MHH E;  2LHD A;  2L52 A;  1VZ7 A;  5BYQ A;  4B0M A;  2MEK A;  4TSS A;  2K22 A;  1JAL A;  1VZ6 A;  1HZ5 A;  4LK0 M;  3Q8C A;  1XEE A;  5C3J B;  2WNM A;  2MJE A;  2LMC A;  2INP E;  1WRI A;  1TY2 A;  3IAS 1;  1AYF A;  4D2K A;  1KF6 B;  2K0P A;  4LTU A;  5EE1 A;  3I9V 1;  3ZGZ A;  4NAW B;  1WWT A;  4P6V F;  2EEL A;  3TEX A;  1QF6 A;  1EU4 A;  1EWY C;  4ARC A;  5TSS A;  1ACC A;  1EWC A;  1ZPS A;  4B0E A;  3PO0 A;  1SE4 A;  2IGH A;  4CQN A;  2KAC A;  2DWQ A;  1R7S A;  3AE3 B;  4JX1 C;  1I4R A;  1DOY A;  3VRA B;  2M19 A;  4P16 A;  2QEJ C;  1C4C A;  3OWE B;  1MI0 A;  1CJE A;  1V97 A;  2XN9 C;  1B9R A;  2WP9 B;  1XXG A;  1L4D B;  1CK1 A;  3BYY B;  2WDR B;  5HI1 A;  4A55 A;  3DWG C;  4N59 A;  2J53 A;  2SEB D;  3V3X A;  3VR8 B;  1J7A A;  3B2G A;  2FUG 1;  4OZB A;  1QIL A;  2MJ3 A;  5EE3 A;  1FCL A;  1N60 A;  2L83 A;  2VZK D;  1T6B X;  3NS1 A;  4N58 A;  5FK9 C;  3TSS A;  1RYJ A;  2TSS A;  2W55 A;  3KWV A;  4KGS A;  2IPK D;  3W1S A;  1TKE A;  3L4P A;  1I4Q A;  4PT5 A;  1FM0 D;  2LHE A;  3FC4 A;  1TYG B;  1EM7 A;  2PW9 A;  4A6Q A;  1QOG A;  4MAC A;  1C76 A;  3EGR A;  3W5U B;  2KDM A;  1UWX A;  4HJG E;  1FRR A;  1VR9 A;  4M0W A;  4TQ0 A;  1L0X B;  5D3D A;  3V05 A;  2GI9 A;  4MM3 B;  3BWU D;  2DBY A;  3HUI A;  2AQ3 B;  4N6E B;  3E56 A;  2VZK B;  3NVV A;  1E6E B;  1FNV A;  1K53 A;  4C80 A;  2WXI A;  1JCK B;  2KQ4 X;  2N0S B;  4WIP A;  1SSN A;  3LB8 C;  5C2T B;  1P7F A;  3MP9 A;  1P7E A;  4J3O D;  4IOI E;  2PVO D;  2V4I B;  2Q5W D;  1FEH A;  1SJH D;  3BK1 A;  2I2Y A;  2WXO A;  4HKZ E;  1K50 A;  4WWM A;  5E6J A;  3AE7 B;  3ZJU A;  4JWS C;  1ZOY B;  1T3Q A;  2JYT A;  2PTL A;  1VLB A;  2W3R A;  4RGM A;  4TMA B;  2B76 B;  2JWU A;  2WXG A;  3AEC B;  1DOI A;  1FNW A;  3EA6 A;  1AN8 A;  4ZHO A;  4HRS A;  1EU3 A;  2J4X A;  3BII D;  1QLB B;  5T8I A;  3TEW A;  2WXH A;  4NJC A;  3R2I A;  3URY A;  4RCO A;  1K51 A;  3AE6 B;  5AUK A;  1E7P B;  2WQY B;  4GDK B;  1IUE A;  5D7G A;  4FXC A;  1UWM A;  1FMA D;  1UGJ A;  2WDQ B;  5AUI A;  3AE2 B;  2J52 A;  5JXV A;  5D3I B;  3R2T A;  4TQ1 A;  1DOX A;  3SFE B;  1V1P B;  1FCC C;  3IAM 1;  1D5X C;  2GRI A;  2IGG A;  2LJI A;  2M0A A;  3Q8B A;  3AE1 B;  4NZL B;  2X38 A;  3NUH B;  1SF0 A;  1NEN B;  2H88 B;  1QT9 A;  1JW9 D;  1L6V A;  5FR3 A;  1YN4 A;  1D5Z C;  1JRP A;  2NMQ A;  4YTP B;  1ZDX A;  3O13 A;  1NYQ A;  1NI3 A;  2ZW1 A;  2N9K A;  3AV8 A;  1XF5 L;  3VRB B;  3U7Z A;  4C7Z A;  1I4G A;  4LLG M;  1L0Y B;  4JPS A;  1KRH A;  1IBX A;  3BVM A;  2WXR A;  3HRD D;  4OZC A;  3AEE B;  3AH7 A;  5HG2 A;  4ZHP A;  4UDU C;  1GB4 A;  2ACZ B;  3J9C A;  1J7C A;  3BK2 A;  2G9H D;  2FBW B;  3P4S B;  4RF0 A;  3ABV B;  3T3N A;  5GXG B;  3T3O A;  3FIL A;  1XLN A;  2IGD A;  4NAM A;  1GAQ B;  1VJK A;  1D6E C;  1XCQ L;  4C56 C;  1JML A;  1JWA D;  2LFI A;  2D5G A;  5LNK 1;  1PUT A;  1D4B A;  1JWU D;  2ICI A;  4ZRQ A;  2BS3 B;  2W54 A;  1IBX B;  2PIA A;  1GOZ A;  1MHX A;  1PFD A;  1AW7 A;  3ETR A;  1JQ4 A;  1SJE D;  3BYT B;  1AWD A;  2EKI A;  2E6X A;  1ROE A;  1FXI A;  5G5G A;  4R3D A;  2SAK A;  2JSV X;  1N5W A;  1TJE A;  3AEA B;  1NVI D;  1ET6 A;  2R61 A;  1FIQ A;  1YN3 A;  2WXP A;  2M56 B;  2YEP B;  3RPF C;  2KMM A;  3U2S C;  3KQ4 A;  1I4X A;  3NVW A;  5EE0 A;  1PGB A;  3WCQ A;  1LO5 D;  3IXS A;  3R8B A;  1TZO A;  3VR9 B;  5I4D A;  1VRA B;  3LXF A;  1Q10 A;  3W9C B;  4US8 A;  4ARI A;  1BXT A;  1I7H A;  3SEB A;  1TKG A;  4OHJ A;  4RNA A;  5BMI A;  4A90 A;  1YNT E;  1BUI C;  3KLS X;  1TS2 A;  3HVZ A;  3N9Y C;  4HEA 1;  1YQ4 B;  3W2D A;  3P42 A;  1OFF A;  1TS3 A;  1TS4 A;  3AEB B;  3ZYY X;  2JZP A;  2WXL A;  4WUR A;  5BYR A;  3SFD B;  1C79 A;  1SIJ A;  2WXJ A;  3AMZ A;  4L1B A;  3KWL A;  2JQR B;  3TEY A;  2OHF A;  4KGT A;  3GS2 A;  2HTM E;  4KKJ A;  4AS1 A;  1DYQ A;  3Q8E A;  1FRD A;  4YWG G;  2QMT A;  2H89 B;  2RPV A;  2YEP F;  2K3U A;  2DLB A;  2Z8L A;  2V0G A;  3AEG B;  1YMH E;  2OED A;  1PGX A;  1QOA A;  1Y56 A;  1C78 A;  1KH0 A;  1ET9 A;  2W82 A;  3FAH A;  3ZQ4 A;  2NTS A;  1C9F A;  1JWS D;  1D5M C;  4JE3 B;  2WXN A;  2RDH A;  1E9M A;  2E3T A;  1HEZ E;  2PVG C;  1TY0 A;  1K52 A;  2AQ1 B;  1KLG D;  2W3S A;  2DYO A;  4JWU C;  1IGD A;  2GB1 A;  1C4A A;  4AQ7 A;  1L5P A;  1L4Z B;  4MT5 A;  3U4E G;  1KTK A;  2L1A A;  5BYS A;  1TKY A;  1PYW D;  1JWM D;  3DWM A;  3Q69 A;  4ITK A;  3LYY A;  3W5V B;  1ZP0 B;  3NVZ A;  2N7J A;  1FFV A;  2FE8 A;  1F2R I;  4C7Y A;  1F77 A;  2DYM A;  3AB5 A;  4USA A;  2BTE A;  1FNU A;  1I4H A;  4A8X C;  1DGJ A;  1SXT A;  1L0V B;  3B9J A;  2NTT A;  4H2A A;  5HFY A;  2Y3A A;  3P63 A;  2IDY A;  4XWW A;  4L2Y A;  3AE4 B;  3P1M A;  3E9S A;  2LGI A;  2AX5 A;  1CQV A;  2L32 A;  3MC0 B;  1MPE A;  1SBB B;  2QIE B;  3NRZ A;  1M4V A;  4HRO A;  5H8Y E;  1T5X D;  1ZXH A;  3RFZ B;  4WAF A;  3B2F A;  4OVZ A;  1UNS A;  2Y5P A;  3EUB 2;  1ZE3 D;  2ON8 A;  3IT6 B;  1UUP A;  5MPO A;  3PZ8 A;  3ZJV A;  2ZW0 A;  2BB5 A;  2PLP A;  4EE2 A;  4IKG A;  1KLU D;  3MHZ A;  1J7B A;  1QOF A;  2RMM A;  4WH4 A;  4YT0 B;  4KKI A;  4XDD A;  2JX5 A;  1STE A;  1V1O A;  2RDG A;  1WGK A;  1WYG A;  2HDE A;  3CWI A;  1XLP A;  4MH8 A;  3NVY A;  1QKZ A;  4REZ A;  4YTM B;  1KFY B;  1FO4 A;  1YJJ A;  1HZ6 A;  2XNA C;  2ONQ A;  5FKA C;  4Q2J A;  1PDX A;  2BS4 B;  4OW0 A;  2Y5C A;  3MFG A;  4RGO S;  4WQM A;  2MH7 A;  2LEK A;  3FIL B;  3NZ3 A;  4RF1 A;  5HHD G;  3GP7 A;  1OQR A;  1ZDV A;  1XLO A;  3AE9 B;  1RWS A;  3Q8A A;  1NYR A;  4O1N A;  3UI3 A;  4ZOH C;  4YSX B;  2WXM A;  2WXQ A;  2INN E;  3VQI A;  2KN4 A;  1I4P A;  1GB1 A;  2BB6 A;  2QIL A;  1ENF A;  3U52 E;  4YXD B;  3H8H A;  3AEF B;  1N5X A;  1GPX A;  2KWD A;  2I38 A;  1QQR A;  4XE0 A;  1XCT L;  3I57 A;  4A9A A;  1BML C;  1MVK A;  1XO3 A;  3TUO A;  1SB3 C;  2WXK A;  4RGN A;  1SE3 A;  1ZXI A;  2J42 A;  1RM6 C;  4YTN B;  3BZD B;  3C8Y A;  4DQO C;  1E10 A;  4RH6 A;  2WXF A;  3P4R B;  3CIR B;  2JU6 X;  1A70 A;  2BBC A;  2CJN A;  3MJ5 A;  1C77 A;  4DXG A;  2MJD A;  5G5H A;  2QSD A;  3AED B;  1WSP A;  2QJL A;  1CZP A;  2K5P A;  4US9 A;  2JXT A;  3BVZ A;  5BMG A;  2PKO A;  1PGA A;  2BW2 A;  2LUM A;  4KX6 B;  1L6U A;  1SEB D;  3PZ7 A;  5BMH A;  2V3P A;  2BT6 A;  3HVD A;  1FXA A;  1VZ8 A;  3BVG A;  4ZYS A;  4IDI A;  4OZA A;  1HXY D;  4DXF A;  2N9L A;  2JYE A;  1QOB A;  3P4Q B;  1F0Z A;  1ESF A;  3TEZ A;  1ZUD 2;  1N63 A;  1IGC A;  1N61 A;  2WLB A;  1F2R C;  1NEK B;  1VDV A;  1RFK A;  4KGR A;  4YSZ B;  2WS3 B;  2BS2 B;  1C4P A;  2PMV A;  4RFB A;  1JWB D;  4ZRP A;  1OQQ A;  4YSY B;  2WU5 B;  1HA5 A;  1YQ3 B;  1V8C A;  2V3N A;  2K9X A;  4L23 A;  5EE9 A;  1E0Z A;  2WU2 B;  3IT4 B;  1WXQ A;  1TS5 A;  1SE2 A;  2G1E A;  3AM9 A;  2CU3 A;  1B1Z A;  3AE5 B;  3SR6 A;  1JRO A;  2IJ0 A;  1YJI A;  4GDL B;  1FD6 A;  5H92 C;  1HQR D;  1YN5 A;  3AE8 B;  4HKQ A;  1V1P A;  1N62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...