1RRBA

The ras-binding domain of raf-1 from rat, nmr, 1 structure
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
NTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
publication title Nuclear magnetic resonance and molecular dynamics studies on the interactions of the Ras-binding domain of Raf-1 with wild-type and mutant Ras proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1rrbA00
3M63B 2KXJA 3NY5A 4KZCA 5FR6A 3IBEA 2W9NA 2C60A 2G45B 4GN1A 5G55A 2CHZA 4EFOA 3DBHI 4KSLC 2C7NB 4PYZA 4EEWA 3V6CB 1UELA 2EKEC 2MWSB 2NR2A 2CS4A 2RD0A 4WWNA 1UD7A 1P9DU 3PTFC 4ICVA 1J0GA 4F7ZA 1I35A 1E7VA 1L7YA 2BKRB 2KMCA 1BT0A 3L54A 4M8MA 2D2QA 4WWPA 5CTRC 1WXAA 1OQYA 3C0RB 2FIDA 3HM6X 2WYQA 3N3KB 1MG8A 4MEMA 2KFKB 2KDEB 3PSEB 4GMVA 4KVGB 4II3B 4IWPA 2LWPA 3GOEA 3PPAA 4WAAA 3SDLC 3U7DA 2XK5A 3MTNB 2IO1B 2ZNVC 3Q3FA 3IHPC 4NAWA 4W9JA 2IZVB 2IO2B 2RGFA 4FA6A 2L05A 3WALA 3PLUA 4EZLA 2GBRA 3A4SC 2ASQA 2NBUA 2V4LA 2AL6A 3AU5A 1C1YB 4DXAB 2PJHA 3WIMA 3L17A 3NZUA 2O2VA 5DPRA 4E71A 1GUAB 3H6NA 2MBBB 4TQ1A 4DHJD 4JGHB 2G4SA 4MJSB 1WRDB 3PV1A 2RR9A 5DPWA 1WXSA 1UH6A 2KOXA 5D94A 2LVOA 1I42A 3JSVB 1A5RA 4B9KA 3QARA 2BWES 2MBOA 3QJZA 4IWQA 4DHZB 1Z5SB 2FAZA 2FCMA 3UQAA 4N9F4 4FHJA 2CHWA 3I3TB 1SIFA 1UZXB 1EUVB 4A3OA 1RAXA 1WXMA 3UQBA 3RUIB 2LRWA 1KOTA 4B95A 5GMVA 1J8CA 3KYCD 3KUDB 3PHXB 4ZRIA 3P2BA 2O6VD 2HTHA 4MGZE 2KC2A 4WJPA 3VQIA 1E7UA 3PZDA 4PS7A 1R4MI 2JRHA 3EFUA 3L16A 4W9EA 4P7IA 3X0WA 2V1YA 4MGKE 2YVCA 3QWZB 4NQKE 1IPGA 5DPTA 4XX5A 3EECA 5EDSA 5AZHA 3ZTDA 4WWOA 3M95A 4GDLB 4W9FA 4ICUA 4I6PA 1VCBA 2D07B 2C5LC 4GDKB 2GBMA 1TBEA 2CKHB 2RSUA 2K8HA 3T8MA 3EHVA 1TZ1A 4IG7B 3KH0A 4X57B 1J19A 1WIAA 2KDBA 4FN2A 5D2MB 4BKSA 2GMIC 4RM8A 3ZW3A 1XQQA 3WAOA 4BKGA 1SGHA 1WGGA 2O6VB 2R2OA 4E3CA 3V61A 1WX7A 1ISNA 2ZEQA 1WGDA 3PRPB 2PE6B 2N7EA 3X23A 3A9JA 2VRRB 1WH3A 2R2QA 3HHMA 3W1SC 4AUQC 1IYFA 2KWCA 3VVWB 4NJ7A 1RRBA 3PLVA 5JH5C 4KIKA 2CHXA 1NI2A 3ONSA 2D10A 2LJ5A 2IO0B 4RM9A 1R4NI 4PYUA 3SD5A 3D32A 4DWFA 3QQ8B 2KMAA 2WX0A 2NBWB 2LXAA 3ZTCA 3AXCA 3K9PB 2B3AA 1HE8A 3ZIMA 4HPLB 1V9JA 1OGWA 1X1MA 3ZNZB 4M0WB 3WA0A 3ZDMC 3V62A 3H9DA 3KW5B 1E8ZA 3B08A 5AZGA 2K8CA 2RPQA 4F1SA 4LJPB 4W9LA 2FUHB 2FCQA 2LZ6A 2N1VA 2BGFA 2M17A 2MRPA 2FCNA 4IM3A 4XZ4A 2FNJB 2DX5B 3R7QA 3HK0A 3VUWA 2YLMA 4AJWA 3NZSA 2KFJA 2K1FA 4FJZA 2JT4B 1TTNA 5J17A 4LCDE 3TCAA 2N4FA 2FCSA 4K81A 3A1QA 3DVGY 5E6PA 2LGYA 1FXTB 1OEYA 2L0TA 2IY0B 3A9KA 3QIJA 4IC7B 2KLGA 4TV3A 2JY6A 2A4ZA 4IWOA 4W9GA 3TJPA 1KJTA 2JZ3B 3RZWC 1V5OA 2L00B 3RD2A 2DENB 1WJ4A 2KQ7A 3DVNV 1EO6A 1TGZB 2KTRB 4KDLB 1YQBA 2WX1A 3VH4B 1YX6B 3QK0A 3H1UA 2HE7A 1LFDA 1V49A 4ZRKA 3RT3B 3ZNID 4NPNA 4NY0A 2DYBA 4MGYE 3PRZA 3TBLD 3KYDD 2LVPA 4KDIC 1S1QB 2DYOA 2BPSA 3U8ZA 2M1MA 2IBIB 3RZFA 2KK8A 1YX5B 1NBFC 2BYFA 3ALBA 2JPHA 2DAJA 2KDIA 3VTVA 4PS3A 3UGBB 1SE9A 5J2RA 2ZNVB 3CF6E 3RYTA 2K39A 1WZ0A 4W9IA 1RFAA 2L0FA 2JWZA 2J0JA 3DQVA 5G2NA 3WAPA 1D3ZA 2NPTB 2BF8B 3S2AA 2ZVNA 3HM3A 1E8XA 4HWIB 2BWFA 2LXCA 4IUMB 2EMSA 4BKTA 4PS8A 4MSMB 3DVNU 4M8NA 3APDA 3ZNHB 2WWZA 3AU4A 4ZRJA 4FBJB 1WMHB 4GXBA 1GG3A 1Q1OA 3ZNGC 4FHKA 4K7WA 1WR6E 4K7SA 1GC7A 1WM3A 2K6DB 4MGIE 5LXHA 2OJRA 3KUZA 4MM3A 2M8SA 4A3PA 3UF8A 5DCNA 3MHSD 3ZDTA 3ZLZA 4ANVA 4KZ0A 5JHAA 3VTUA 1YJ1A 2C7MB 3L0WB 4HDQA 4IM0A 2LVQA 3L13A 3R66C 3DOWA 3ZO5B 2MP2B 4MJSA 4AOFA 2L7RA 4CYEA 3A33B 3TIXA 3JW0X 2KLCA 3OJ4B 4NQLB 2KJRA 3JSVA 3RULA 3VUYA 3H7PB 2KWVB 3H7SA 1WE7A 3U30A 2KDFB 3OAWA 1Y8RC 2XBBC 4FADA 4KV2A 2D3GA 5CHWA 1M94A 2KJ6A 2UYZB 4MH0E 3UIPB 2Z0EB 4LJOB 5IAAC 2J0MA 1WGRA 4TUUA 3QHTA 3OLMD 4GOCA 2MSED 3QC8B 2JVCA 1XD3B 1E8YA 1WX8A 2LI5A 2MX2A 2ZZPB 4FLHA 1WYWB 4LDTD 4URKA 3JYUA 1H8CA 1V2YA 4IM2A 1KLVA 3AULA 1C3TA 3VUXA 4MSQB 3VTWA 4ANUA 4GDLA 2L8JA 3UINB 5BO4B 1K8RB 2DZJA 4RMAA 1PQSA 2MQJA 4GDKA 1L2NA 1Q0WB 1V5TA 3M3JA 3NOBA 4JQWC 1S3SG 4WQOB 4WJQA 3T9LA 1E8WA 3CSTA 3ZRFA 4YL8A 4HCNB 4HPMB 4HVBA 2KKCA 2LD9A 2WDTB 5E6NA 2O6VA 1WJUA 2J7QB 2J0KA 1WFYA 4LDTB 4ASWC 2M4NA 4JLCA 3VDZA 3NS8A 3ENEA 2N9PC 3NHEB 1V6EA 3LJ3A 4BVUC 1EF1A 3OJ3A 1KM7A 2KX0A 3DBSA 1LXDA 2GBJA 4OVUA 1WE6A 2D11A 3BINA 2IYDB 1WF9A 1YIWA 4EUTA 5CX3A 5L83A 2GOWA 2DZKA 1UGMA 1AARA 2HJ8A 3ECIA 1GC6A 4FJVB 2AEHA 4K7UA 4FULA 4E74A 4G50A 4EKUA 2NCNA 4AP4C 4ZYNA 5HKHA 4BBNF 1WXVA 3MJWA 3ML9A 1WX9A 3PS6A 4DBGA 2GBKA 2Y5BB 2M0XA 2C9WB 2ZCBA 4G0NB 4JL9A 3R7RA 3VFKA 1EF5A 4GU2A 4WJNA 4G3XB 2XK5B 4W9KA 2KC1A 5C1ZA 4NNJB 4MELA 2K8BA 5IA7A 3B0AA 1ZW7A 4TQ0A 4NAWB 2G4DB 3KUCB 2KN5A 2A5UA 3QX1A 2KZRA 4GIVA 3VH3B 3KVFB 3N32A 4DK5A 1WI0A 3PHWB 2EMTA 2HD5B 2O2VB 2AWTA 1WZ3A 4WJOA 2ZCCA 3K9OB 3WAMA 3LDZE 4HDOA 5D7GA 2G3QB 2BYVE 2KTRA 1T0YA 5TR5A 5J18A 1E5WA 4HCPB 2ZPYA 2DYMA 4F8CB 5L95C 1ZKHA 4AJYB 2DZMA 3CSFA 3PT2B 1P0RA 4I6LB 2OOBB 3SU8X 1GNUA 1ZGUB 2V3SA 2KFKA 4CHKA 1E90A 4HJKA 2BYEA 2XEWA 4IW0A 4BKSD 4XC2A 3Q3JA 3M62B 1WJNA 4A20A 2PEAA 3CMMB 2IO3B 1Q5WB 2LGXA 2KJHB 4NJ6A 1OEYJ 2CU1A 4JIOU 1OTRB 3APCA 3R3MA 3DPDA 2NS5A 2KANA 4DDGD 2NPTA 3V60A 2JZZA 3ZVVA 4G11A 3VXWA 1LM8B 4BBNC 4ANWA 2IY1B 1NDDA 1H4RA 1JRUA 2KNBA 3O65B 2DHZA 3SHQA 1V86A 1UBIA 2K6QA 4FJYA 4GSWA 4EZJA 5JZEB 1P3QU 2MCNB 2N7DA 1WMHA 3DDCB 2K25A 5CHFA 5DPSA 2KO3A 3PRMB 1UBQA 1GJZA 2PPHA 5JHBA 2N1WA 2MBHA 5LXIB 5C23A 2REXA 1F9JA 4DHJB 3A9JB 3DBLI 3IG3A 2I1JA 5LLIA 1U4AA 2L3ZA 4ZDVA 2L76A 2KTFA 1Z2MA 3PGEA 3TMPB 2ZJDA 2QHOA 3ZKJC 2MP2A 2DAFA 4TKNA 4K1RB 4KIKB 2LGDA 2DZIA 3DVGX 2MLBA 3N30A 1QZEA 4B6WA 2KX3A 3VHTC 3DCGA 3EC8A 1WM2A 2LRUA 3H7PA 4BOZB 2N9XA 2Z0DB 4GGQA 1G6JA 4EZKA 5AZFA 4AWJA 1V80A 2JXXA 3BY4B 1LQBA 1CMXB 2KWUB 3IFWB 1WJ6A 5KHOA 5AEKB 4EOYA 4J6IA 4II2B 2JRIB 3ML8A 1WY8A 2N9EB 3AI5A 3APFA 2PE9A 4HK2A 2GBNA 3ZRCA 1VD2A 2CR5A 2FIFA 4BOSC 2C7HA 3QCAA 3GZNI 3UIOB 2AYOB 3L08A 1XT9B 3JVZX 2BKFA 2KVRA 4DHZE 4HLEA 2JF5A 2MA9B 3TL5A 4ANXA 2KQSA 4GB9A 2LASA 2JUOA 2KD0A 4W9HA 2MW5A 5E6OA 3ZUNA 4W9CA 3DBRI 5KHQA 4I6NB 4W9DA 3W1SA 3A1QB 4OVVA 2Z59B 3WANA 2MBEA 3A9KB 4MDKE 2LUEA 2UWQA 2NBVB 1WGHA 5D6JB 4BFRA 3L10B 2KHWB 2ZPNA 3V6EB 3A4RA 3B1LX 1RLFA 3W1YA 4DDID 2MBQA 2ZVOA 3IVFA 4HXDA 2I1KA 5CHVC 1IP9A 1YD8U 3VAWA 1WR1A 3QA8A 3PREA 4KSKC 3QAQA 1V81A 1P98A 2AL3A 2NVUI 1WGYA 3HIZA 3PVLA 3RCZA 1P1AA 4CO7A
chains in the Genus database with same CATH superfamily
3NY5A 3AE8B 5IOIA 2W9NA 2C60A 2YEPF 2G45B 5G55A 1R4MB 2CHZA 2DWQA 2CU3A 2EKEC 2NR2A 2CS4A 1RWSA 1UD7A 1QOAA 3N1YC 1FXAA 1JWMD 1PGAA 4GLSC 2KMCA 1BT0A 3L54A 1EWYC 3C0RB 2WP9B 1KTKA 2KDEB 4GMVA 4KVGB 3PPAA 2IO1B 3B2FA 4NAWA 1C4CA 4Q2JA 1V97A 4EZLA 2GBRA 2V4LA 4DXAB 3WIMA 3L17A 1K53A 1GUAB 2R61A 4DHJD 4JGHB 2G4SA 2RR9A 4C7ZA 4DXGA 1UH6A 2L52A 1I42A 4B9KA 3QARA 2BWES 3QJZA 3MFGA 2FCMA 3UQAA 3I3TB 1SIFA 1RAXA 1WXMA 1KOTA 1T3QA 3KUDB 4ZRIA 2HTHA 3VQIA 1E7UA 4BAXA 4W9EA 3X0WA 2V1YA 4MGKE 2YVCA 3W5UB 1I7HA 5EDSA 1FRRA 5AZHA 4WWOA 2Y5CA 3PZ7A 1HTQA 4W9FA 2N0SB 1OQQA 4GDKB 1TZ1A 3SR6A 3KH0A 4M02A 2INNE 1WIAA 5D2MB 2GMIC 4RM8A 4A9AA 2H88B 1VRAB 2GI9A 3RNBC 4E3CA 4IOIE 3Q3NC 3V61A 1WX7A 1ISNA 2ZEQA 4RF1A 1WGDA 3PRPB 1N6ZA 4AQ7A 2R2QA 4AUQC 1RRBA 1RFKA 2JX5A 1NI2A 4RM9A 1LO5D 3D32A 2WDQB 4M01A 2INPE 2KMAA 1EU3A 3AXCA 2B3AA 3C8YA 3Q8EA 1DOXA 4HPLB 4ZRQA 3ZNZB 3WA0A 3V62A 3KW5B 1T0QC 4F1SA 4LJPB 2FUHB 2M17A 2MJEA 4ZHPA 4FJZA 2MHJA 1VZ7A 3DVGY 1XLPA 1Y56A 2PVGC 3A9KA 4IC7B 2KLGA 4W9GA 3TJPA 1KJTA 3RZWC 4ZRPA 4HROA 2AX5A 3DVNV 5EE1A 3VH4B 1YX6B 3QK0A 1LFDA 2D3BA 1FM0D 2DYBA 4UDUC 5BYRA 3KYDD 2PMVA 1F77A 2L83A 2KQ4X 4KDIC 3BWUD 2BPSA 2KWDA 2BYFA 5BYSA 3P1MA 2K39A 1RFAA 2L0FA 2JWZA 2J0JA 3S2AA 2ZVNA 3HM3A 4YXDB 3TEWA 1D6EC 3DVNU 4M8NA 3ZJTA 4US9A 3ABVB 1WMHB 4K7WA 4K7SA 1TKEA 3NVYA 4MGIE 1I4QA 2L32A 3KUZA 4JWUC 3UF8A 3MHSD 1KF6B 2XN9C 2C7MB 4IM0A 3U7ZA 3DOWA 2MP2B 1NYQA 1MFWA 2KLCA 3VUYA 2KJRA 1PYWD 2WXJA 1M94A 4OZCA 5IAAC 2J0MA 1WGRA 3OLMD 2MSED 2JVCA 1WX8A 3TUOA 2QMTA 4IM2A 4MSQB 2DLBA 4ANUA 1OFFA 5BO4B 4YSXB 2FE8A 1K51A 2DZJA 4GDKA 1L2NA 3LXFA 2WXMA 3M3JA 3NOBA 1QILA 3BZDB 3T9LA 4YL8A 1SXTA 1C79A 4HPMB 1WJUA 4HEA1 3VRBB 1JWUD 1T5XD 3NS8A 1QT9A 2N9PC 1EF1A 3OJ3A 1KM7A 2GBJA 1WE6A 4RF0A 5H8YE 5BMIA 3ECIA 1L0XB 2X38A 4OZAA 1N62A 2EKIA 2KN4A 1VZ8A 4G50A 2KT7A 1VLBA 1MG4A 4DBGA 1FD6A 4GU2A 2ACZB 4G3XB 2XK5B 5C1ZA 2J42A 2KN5A 2KZRA 3KVFB 2X8XX 2Z8LA 3PHWB 2O2VB 4L1BA 2ZCCA 2W54A 5D7GA 3BVZA 2BYVE 3AE3B 1T0YA 2ZPYA 5TSSA 5L95C 1ZKHA 1SE2A 3CSFA 3PT2B 1P0RA 3SU8X 4DQOC 1E90A 2V9HA 4TSSA 4BKSD 3U4EG 3SFDB 3CMMB 1Q5WB 1PDXA 3EUB2 2CU1A 1SBBB 2M56B 1ZPSA 3DPDA 2KANA 3I5JC 3V60A 2IY1B 1AWDA 2KNBA 3TEZA 2DHZA 3SHQA 4FJYA 2K6QA 4GSWA 1P3QU 3HVDA 3MC8A 2MCNB 1WMHA 5CHFA 1YQ3B 1JROA 5JHBA 1FXIA 2DBYA 2MBHA 1L6VA 2REXA 1F9JA 4DHJB 3PGEA 2MP2A 1JQ4A 4TKNA 3DBHB 2MLBA 3N30A 1L0VB 3Q8FA 3DCGA 3Q6BA 2WXKA 4ARIA 3L4PA 4AWJA 1LQBA 1ZXIA 1CMXB 1WJ6A 3ML8A 4HK2A 2V3NA 3AE7B 3N20C 1YOVB 3GZNI 3L08A 4DHZE 4HLEA 2J4XA 2KQSA 4GB9A 2LASA 5HFYA 1YJJA 1UUPA 2WDRB 4MDKE 4BFRA 2ZPNA 3B1LX 1RLFA 2MBQA 4HXDA 1WR1A 3QA8A 1K52A 2AQ1B 1P98A 2SEBD 3HIZA 2E3TA 3M63B 4PT5A 1F52A 1E0ZA 4GN1A 2BBCA 3HRDD 4PYZA 2BT6A 2MWSB 4WWNA 2H89B 2LJIA 1J0GA 1I35A 2PIAA 1E7VA 3MP9A 1L7YA 2BKRB 1MJDA 5CTRC 5EE3A 1OQYA 3HM6X 1MG8A 4MEMA 3PSEB 3U7DA 2LWPA 3SDLC 2XK5A 2HDEA 3IHPC 4W9JA 3Q3OC 2ASQA 2AL6A 1WGKA 2Y3AA 2BB5A 2PJHA 5DPRA 2O2VA 3RNFC 1Q10A 3H6NA 3ZJVA 2BVCA 4D2KA 1F2RC 2KOXA 1YN3A 1R7SA 1TKGA 2MBOA 2FAZA 3ZXRA 4C56C 1ZDXA 4N9F4 3NVVA 5HG2A 1N61A 1GAQB 3RUIB 5GMVA 3R8BA 4YTPB 3PHXB 1SJED 4RGOS 2O6VD 4WJPA 2KC2A 4PS7A 2JRHA 3EFUA 5DPTA 1IPGA 2BYTA 1TS3A 5IN7A 2JYTA 3ZTDA 3M95A 2G1EA 1VCBA 2D07B 2GBMA 2N9LA 3FILB 3EHVA 1TZOA 4X57B 1J19A 2KDBA 2D3AA 5C2TB 3ZW3A 1XQQA 3AE5B 2NTSA 1QOBA 1XF5L 1WH3A 3PZ8A 1AW7A 3VVWB 5JH5C 1BXTA 3ONSA 2D10A 3SD5A 1RYJA 4DWFA 3BYTB 1EWCA 2ON8A 3AN1A 2NBWB 3TEXA 3RPFC 3ZIMA 1OGWA 4LK0M 1J7BA 1SE3A 5AZGA 2K8CA 3RNEC 1KH0A 2LZ6A 2MRPA 2FCNA 4IM3A 2FNJB 1DOIA 2YLMA 3NZSA 1TTNA 5J17A 4LCDE 3TCAA 2FCSA 4K81A 2V4IB 1OEYA 2L0TA 3QIJA 4TV3A 2JY6A 2JZ3B 2RDBC 2KQ7A 5T8IA 1XCQL 1TGZB 2KTRB 1YQBA 3CWIA 2HE7A 1V49A 3RT3B 1ZOYB 1QQRA 4LNFA 4JPSA 3U8ZA 3RZFA 1FNWA 2KK8A 2KDIA 1ENFA 4PS3A 4XWWA 3WCQA 2D5GA 1WZ0A 1E9MA 3DQVA 3BK1A 3HVZA 2NPTB 1D3ZA 2BF8B 2LXCA 4IUMB 3MHZA 4MSMB 3EFCA 4PS8A 3APDA 1XCTL 3ZNHB 1YJIA 2WWZA 2JSVX 3AU4A 4GXBA 3RNAC 1C78A 1WM3A 3HUIA 3TEYA 4S0RA 4XDDA 2OJRA 5LXHA 2M8SA 2BQQA 4HDQA 3VRAB 3Q3MC 3H8HA 3ZO5B 2L7RA 3A33B 3U52E 3AE4B 3DHIC 3H7PB 2KWVB 3H7SA 1WE7A 2OEDA 2XBBC 2WXGA 3GE8C 1ET9A 4KV2A 2D3GA 2KJ6A 3UI3A 4TUUA 4KKIA 2IGDA 3QC8B 2ZZPB 2QJLA 4FLHA 2WQYB 4LDTD 1J7CA 3JYUA 1KLVA 2JU6X 3VTWA 1VR9A 1K8RB 4RMAA 1PQSA 3BIID 3FILA 4JQWC 1S3SG 3CSTA 1WYGA 1C9FA 1MI0A 4C4VB 2J0KA 1NYRA 1WFYA 5HI1A 3DWMA 4DXFA 4LLGM 4JLCA 3RN9C 1V6EA 1TS2A 1D5MC 2D11A 1LGRA 4NAMA 1I4RA 5L83A 5IP4D 4ITKA 1UGMA 1AARA 4FJVB 4K7UA 2AEHA 3RI7C 4EKUA 2QILA 3NVZA 2JQRB 3ML9A 4G0NB 2M0XA 2ZCBA 1ZXHA 1QOFA 1AN8A 4W9KA 2K8BA 5IA7A 1ZW7A 2G4DB 3KUCB 1JW9D 1RM6C 2J52A 2RDGA 3QX1A 3GE3C 4GIVA 3OWEB 2AWTA 3PO0A 4WJOA 4N59A 2NMQA 3WAMA 3AEBB 5BMGA 4K3CA 3GP7A 1ROEA 2KTRA 3W2DA 2GLSA 5TR5A 1FNUA 3AE1B 4HCPB 4A6QA 5E6JA 3AECB 2LHEA 1HA5A 1YNTE 1D4BA 5G5HA 4CHKA 2BYEA 4A90A 3BVGA 1VJKA 2I2YA 3MJ5A 1TY2A 4A20A 1ACCA 4C00A 4NJ6A 1OEYJ 4JIOU 3APCA 4A55A 1GB4A 3R2TA 2NPTA 3AMZA 3ZVVA 3VXWA 1LM8B 2W82A 2KAJA 1H4RA 1JRUA 5FK9C 3V3XA 3DDCB 2WXPA 3AB5A 3NRZA 2N1WA 1SB3C 2K0PA 3A9JB 3DBLI 3IG3A 4RH6A 2L76A 2EELA 3AEEB 2ZJDA 2DAFA 4KIKB 4KGTA 2DZIA 3B2GA 3EA6A 1QZEA 2KX3A 3VHTC 3EC8A 2LRUA 3H7PA 4BOZB 2Z0DB 3B9JA 2W3RA 5AZFA 2WXOA 3BY4B 2VZKD 4FXCA 2KWUB 1CQVA 5KHOA 4KKJA 4EOYA 4J6IA 3NG0A 3AI5A 3APFA 1ZDVA 1PUTA 2GBNA 3J9CA 2VH1A 4S17A 3ZRCA 3SFEB 1XT9B 4YSYB 2K9XA 3MC0B 2QDFA 2KD0A 3BVMA 2MW5A 4I6NB 3A1QB 4OVVA 3WANA 5G5GA 1QLBB 2E6XA 3L10B 1UNSA 5D3DA 1C4AA 3LB8C 3W1YA 3IVFA 1VDVA 2RDHA 4C4VA 2I1KA 4P16A 1IP9A 3Q14C 4KSKC 2NVUI 1I4HA 5GXGB 1SSNA 1JWSD 3AE6B 3Q8CA 4EFOA 4KSLC 2C7NB 4EEWA 1UELA 1P7EA 4B0MA 3IXSA 3PTFC 5AUKA 4F7ZA 2IJ0A 3R2IA 4M8MA 2D2QA 4L2YA 4WWPA 5C3JB 3P4SB 3N3KB 4TMAB 2KFKB 4II3B 3GOEA 3MTNB 4LNNA 2BS2B 1ZE3D 2IO2B 2RGFA 4MM3B 2L05A 3TSSA 4OVZA 4E71A 2Y5PA 2MBBB 4TQ1A 4MJSB 3PV1A 4MT5A 5DPWA 2V3PA 5D94A 4REZA 2LVOA 2JXTA 4YTMB 1MVKA 2K22A 2CHWA 5JXVA 1EUVB 3UQBA 3T3OA 4IKGA 3P2BA 1YN4A 2FBWB 4MGZE 2INCC 1E10A 1R4MI 4NJCA 2WU5B 1EU4A 4NQKE 4XX5A 2WXIA 1KFYB 4R3DA 1JWAD 3I57A 4OW0A 2C5LC 1TBEA 2CKHB 2Q5WD 2K8HA 1NENB 1TS5A 4IG7B 4FN2A 1TIFA 2R2OA 1FIQA 2N7EA 3A9JA 3HHMA 4ACFA 1IYFA 1IBXB 3PLVA 3SEBA 4KIKA 3DWGC 2INDC 2LJ5A 4WURA 1R4NI 4PYUA 4XGAB 3BK2A 3ZTCA 2RMMA 1V9JA 1X1MA 4M0WB 1OQRA 2RPQA 2WU2B 2K5PA 4W9LA 4RCOA 2FCQA 2N1VA 3R7QA 4AJWA 1A70A 4KX6B 1AYFA 3A1QA 5E6PA 2IY0B 3P4RB 2OJWA 4OHJA 4IWOA 1V5OA 2L00B 2DENB 1WJ4A 2QCZA 2G9HD 2WX1A 3H1UA 1ET6A 1HQRD 4ZRKA 2M19A 3Q2AC 4NY0A 1M4VA 1SF0A 3DBLB 1S1QB 2DYOA 2M1MA 2IBIB 1YX5B 1N60A 3ALBA 3VTVA 2JPHA 2DAJA 3CF6E 4NZLB 1FEHA 1XO3A 3AEGB 4A8XC 4HWIB 4USAA 2BWFA 2ICIA 4BKTA 2IDYA 1GPXA 3P4PB 1FCCC 1UWMA 4ZRJA 3NZ3A 1GG3A 1Q1OA 4FHKA 3N1ZC 1WR6E 1HTOA 2IPKD 4MM3A 4A3PA 3ZDTA 4KZ0A 4JX1C 3VTUA 2LVQA 3R66C 1NVID 4MJSA 4AOFA 2MH7A 3KQ4A 4NQLB 3RULA 1D5ZC 3Q8AA 1Y8RC 1XEEA 2WS3B 1PFDA 5CHWA 4RGMA 2UYZB 3UIPB 2BB6A 5EE9A 2V0GA 3GB1A 1YQ4B 3QHTA 1E8YA 2WHIA 2MX2A 4URKA 1WYWB 2D3CA 3AULA 1C3TA 2N7JA 1JALA 4J3OD 2L8JA 3UINB 4P1BC 1YMHE 1Q0WB 3URYA 4WJQA 1MHHE 5MPOA 2QIEB 4HVBA 3NUHB 2WDTB 2W55A 2J7QB 3NJTA 3FAHA 3VDZA 3NHEB 1IBXA 3LJ3A 4WAFA 1L5PA 2I38A 3IAS1 1N5XA 2GB1A 2KX0A 1BMLC 1LXDA 1L4DB 1WF9A 4AS1A 5CX3A 2VZKB 1FMAD 1L4ZB 2CJOA 2HJ8A 1GC6A 4M0WA 2NCNA 4ZYNA 2VH2A 5IO9A 3MJWA 1WX9A 3PS6A 2GBKA 2Y5BB 4JL9A 3VFKA 3R7RA 3ZGZA 4C80A 4WJNA 2KC1A 3CIRB 1IGDA 4TQ0A 2A5UA 3U2SC 3VR9B 1WI0A 1V1PB 4WH4A 2WXRA 2HD5B 4N6EB 2JZPA 1J7AA 2G3QB 1E5WA 1EM7A 1XLQA 2DYMA 2BW2A 4AJYB 1ZGUB 2QEJC 1C77A 2QSDA 5D3IB 4IW0A 4XC2A 1WJNA 3GZNB 2IO3B 2LGXA 3AEAB 4PK1A 1OTRB 1R4NB 2WXHA 1SJHD 4DDGD 2JZZA 1NDDA 2LFIA 3O65B 1NEKB 1UBIA 5JZEB 2HTME 1IGCA 2DNFA 4MH8A 1XXGA 3PRMB 3RFZB 1UBQA 1GJZA 4MACA 5EE0A 2LGSA 1HEZE 1CZPA 2UU7A 4ZOHC 5HHDG 5BYQA 5LXIB 3FKYA 2I1JA 5LLIA 1K50A 4ZDVA 2KTFA 1Z2MA 2AQ3B 2QHOA 3ZKJC 1PGXA 4YTNB 2BTEA 1F1HA 4B6WA 1C4PA 1WM2A 2LEKA 4GGQA 3ZYYX 2W3SA 4LNKA 3AEFB 1DGJA 1XLNA 1CJEA 4II2B 1VD2A 2CR5A 2FIFA 1UF0A 3OG5A 2AYOB 3Q69A 3JVZX 2BKFA 2KVRA 4YSZB 2MA9B 3AE2B 3TL5A 4W9HA 1JCKB 5KHQA 3ZUNA 4LNIA 4W9CA 3DBRI 4W9DA 1QF6A 3AV8A 2J53A 2Z59B 2MBEA 2ZW0A 4XWTA 2WLBA 2LUEA 5D6JB 1WGHA 1WRIA 1N5WA 2KHWB 4WWMA 3V6EB 2ZVOA 4LNOA 1ESFA 1P1AA 3PREA 3QAQA 1V81A 2JWUA 1WGYA 3RCZA 4HPPA 4CO7A 2KXJA 2IGHA 4KZCA 5FR6A 3IBEA 1ZP0B 3IT4B 5BMHA 3DBHI 3V6CB 4P6VF 2RD0A 1I4GA 2XNAC 4O1NA 4K3BA 1P9DU 4ICVA 4QAYA 2LHDA 1WXAA 2FIDA 2WGSA 2WYQA 4WAAA 4IWPA 1F0ZA 2ZNVC 3Q3FA 1TKYA 2IZVB 5AUIA 4FA6A 1BUIC 3WALA 3PLUA 3A4SC 2NBUA 3AU5A 1C1YB 1V1PA 4HJGE 3NZUA 1WRDB 1WXSA 3ZXVA 2PKOA 3JSVB 1A5RA 3MC9A 4IWQA 1HZ6A 1JMLA 4DHZB 1Z5SB 1TY0A 4FHJA 1UZXB 4A3OA 1SEBD 1HXYD 4RGNA 2LRWA 4B95A 1J8CA 3KYCD 4JWSC 2YEPB 3PZDA 3L16A 4P7IA 3QWZB 1V8CA 2WXQA 3EECA 1B9RA 4GDLB 3N9YC 4ICUA 3NS1A 4I6PA 4RFBA 4KGRA 2RSUA 3DHHC 3T8MA 2FUG1 3E56A 4BKSA 3WAOA 4BKGA 1TJEA 1SGHA 3T3NA 2HJ1A 1WGGA 2O6VB 1KLUD 1ZUD2 1SIJA 1I4XA 2PE6B 3X23A 1TYGB 2VRRB 3LYYA 5I4DA 4BZAA 3W1SC 2KWCA 4NJ7A 3BYYB 2JYEA 4ZHOA 2CHXA 2IO0B 2M0AA 3QQ8B 2WX0A 3E9SA 2LXAA 3P42A 3K9PB 1XLOA 1HE8A 1T0SC 3ZDMC 3H9DA 1PGBA 1E8ZA 3B08A 4YWGG 3RNCC 3IT6B 4LTUA 2B76B 3IAM1 2BGFA 4XZ4A 2DX5B 3HK0A 3VUWA 1SE4A 2TSSA 2KFJA 2K1FA 2JT4B 1IUEA 1CK1A 2N4FA 2KMMA 4HKZE 3FC4A 2LGYA 2NTTA 1FXTB 2WXNA 1WXQA 2A4ZA 1GB1A 1UWXA 3W5VB 3RD2A 1EO6A 1GOZA 4KDLB 2LMCA 1WSPA 3ZNID 4NPNA 4MGYE 3PRZA 3TBLD 2MJDA 2LVPA 1WWTA 1NBFC 3UGBB 1SE9A 5J2RA 2KYWA 2ZNVB 3RYTA 4ARCA 1L6UA 4W9IA 3WAPA 2WXLA 5G2NA 1E8XA 2IGGA 2EMSA 2WDVB 4H2AA 2QC8A 1KLGD 2WXFA 2MJ3A 4FBJB 1MPEA 3ZNGC 4RGTA 2PVOD 1GC7A 2K6DB 5DCNA 4C7YA 3ZLZA 4ANVA 2PLPA 5JHAA 1YJ1A 4B0EA 3W9CB 3L0WB 3DBRB 3I9V1 3L13A 4CYEA 3TIXA 3JW0X 3KWLA 3OJ4B 3JSVA 2K3UA 2WNMA 3U30A 2KDFB 3OAWA 2N9KA 1FFVA 4FADA 3ZJUA 1MHXA 4MH0E 3RMKC 2AQ2B 2Z0EB 4LJOB 3AH7A 4GOCA 4M00A 2SAKA 5H92C 1XD3B 2LI5A 5FKAC 3C19A 1H8CA 1V2YA 4L23A 3N1XC 3VUXA 2KDMA 4GDLA 1T0RC 2MQJA 2L1AA 1V5TA 3GS2A 4JE3B 4WQOB 1E8WA 3ZRFA 1V1OA 1P7FA 4HCNB 1F2RI 1T6BX 2KKCA 2LD9A 5E6NA 2O6VA 3EGRA 1JWBD 4LDTB 4ASWC 2M4NA 2RPVA 3V05A 3Q8BA 3ENEA 4CQNA 4BVUC 3DHGC 1TT5B 3DBSA 3ETRA 4OVUA 3BINA 5LNK1 1FO4A 2IYDB 1YIWA 4EUTA 2GOWA 2DZKA 4WIPA 4XDCA 4EE2A 1UGJA 2ONQA 4FULA 4E74A 1JRPA 4WQMA 4AP4C 3P4QB 5HKHA 4BBNF 1WXVA 2C9WB 1EF5A 3NVWA 1L0YB 1QKZA 4NNJB 1YN5A 4MELA 2BS4B 3B0AA 4NAWB 3VH3B 3N32A 4DK5A 1QOGA 2EMTA 1D5XC 4RNAA 1WZ3A 3K9OB 2PW9A 3RNGC 3LDZE 3I63C 4HDOA 4P1CC 5J18A 1I4PA 3P63A 2BS3B 4OZBA 2LUMA 4N58A 4F8CB 4YT0B 2DZMA 2MEKA 4I6LB 2OOBB 4US8A 1GNUA 4IDIA 2V3SA 2KFKA 4HJKA 2XEWA 2PTLA 1FRDA 3Q3JA 3M62B 1FPYA 2PEAA 1E7PB 2KJHB 3R3MA 1E6EB 2NS5A 1FNVA 4G11A 1DYQA 4BBNC 4ANWA 1STEA 2GRIA 1C76A 4EZJA 1V86A 2N7DA 2K25A 3AEDB 5DPSA 4ZYSA 2KO3A 4XE0A 2PPHA 5C23A 1U4AA 2L3ZA 4HKQA 3TMPB 4K1RB 2LGDA 3DVGX 1G6JA 2N9XA 2OHFA 4EZKA 1HZ5A 1V80A 1TS4A 2JXXA 3IFWB 4XYCA 5IKCM 5AEKB 2LGIA 2JRIB 1VZ6A 1WY8A 2CJNA 2KACA 2N9EB 2PE9A 4BOSC 2C7HA 3QCAA 1NI3A 3UIOB 5FR3A 2ZW1A 2JF5A 2KVZA 4ANXA 3VR8B 3KWVA 2JUOA 5E6OA 1DOYA 3W1SA 1KRHA 4KGSA 3A9KB 2UWQA 2NBVB 3AM9A 3AE9B 3A4RA 4HRSA 4DDID 3ZQ4A 1FCLA 3KLSX 5CHVC 1N63A 3O13A 1YD8U 3VAWA 1B1ZA 2AL3A 3PVLA 1FFUA
chains in the Genus database with same CATH topology
3M63B 2KXJA 3NY5A 4KZCA 5FR6A 3IBEA 2W9NA 2C60A 2G45B 4GN1A 5G55A 2CHZA 4EFOA 3DBHI 4KSLC 2C7NB 4PYZA 4EEWA 3V6CB 1UELA 2EKEC 2MWSB 2NR2A 2CS4A 2RD0A 4WWNA 1UD7A 1P9DU 3PTFC 4ICVA 1J0GA 4F7ZA 1I35A 1E7VA 1L7YA 2BKRB 2KMCA 1BT0A 3L54A 4M8MA 2D2QA 4WWPA 5CTRC 1WXAA 1OQYA 3C0RB 2FIDA 3HM6X 2WYQA 3N3KB 1MG8A 4MEMA 2KFKB 2KDEB 3PSEB 4GMVA 4KVGB 4II3B 4IWPA 2LWPA 3GOEA 3PPAA 4WAAA 3SDLC 3U7DA 2XK5A 3MTNB 2IO1B 2ZNVC 3Q3FA 3IHPC 4NAWA 4W9JA 2IZVB 2IO2B 2RGFA 4FA6A 2L05A 3WALA 3PLUA 4EZLA 2GBRA 3A4SC 2ASQA 2NBUA 2V4LA 2AL6A 3AU5A 1C1YB 4DXAB 2PJHA 3WIMA 3L17A 3NZUA 2O2VA 5DPRA 4E71A 1GUAB 3H6NA 2MBBB 4TQ1A 4DHJD 4JGHB 2G4SA 4MJSB 1WRDB 3PV1A 2RR9A 5DPWA 1WXSA 1UH6A 2KOXA 5D94A 2LVOA 1I42A 3JSVB 1A5RA 4B9KA 3QARA 2BWES 2MBOA 3QJZA 4IWQA 4DHZB 1Z5SB 2FAZA 2FCMA 3UQAA 4N9F4 4FHJA 2CHWA 3I3TB 1SIFA 1UZXB 1EUVB 4A3OA 1RAXA 1WXMA 3UQBA 3RUIB 2LRWA 1KOTA 4B95A 5GMVA 1J8CA 3KYCD 3KUDB 3PHXB 4ZRIA 3P2BA 2O6VD 2HTHA 4MGZE 2KC2A 4WJPA 3VQIA 1E7UA 3PZDA 4PS7A 1R4MI 2JRHA 3EFUA 3L16A 4W9EA 4P7IA 3X0WA 2V1YA 4MGKE 2YVCA 3QWZB 4NQKE 1IPGA 5DPTA 4XX5A 3EECA 5EDSA 5AZHA 3ZTDA 4WWOA 3M95A 4GDLB 4W9FA 4ICUA 4I6PA 1VCBA 2D07B 2C5LC 4GDKB 2GBMA 1TBEA 2CKHB 2RSUA 2K8HA 3T8MA 3EHVA 1TZ1A 4IG7B 3KH0A 4X57B 1J19A 1WIAA 2KDBA 4FN2A 5D2MB 4BKSA 2GMIC 4RM8A 3ZW3A 1XQQA 3WAOA 4BKGA 1SGHA 1WGGA 2O6VB 2R2OA 4E3CA 3V61A 1WX7A 1ISNA 2ZEQA 1WGDA 3PRPB 2PE6B 2N7EA 3X23A 3A9JA 2VRRB 1WH3A 2R2QA 3HHMA 3W1SC 4AUQC 1IYFA 2KWCA 3VVWB 4NJ7A 1RRBA 3PLVA 5JH5C 4KIKA 2CHXA 1NI2A 3ONSA 2D10A 2LJ5A 2IO0B 4RM9A 1R4NI 4PYUA 3SD5A 3D32A 4DWFA 3QQ8B 2KMAA 2WX0A 2NBWB 2LXAA 3ZTCA 3AXCA 3K9PB 2B3AA 1HE8A 3ZIMA 4HPLB 1V9JA 1OGWA 1X1MA 3ZNZB 4M0WB 3WA0A 3ZDMC 3V62A 3H9DA 3KW5B 1E8ZA 3B08A 5AZGA 2K8CA 2RPQA 4F1SA 4LJPB 4W9LA 2FUHB 2FCQA 2LZ6A 2N1VA 2BGFA 2M17A 2MRPA 2FCNA 4IM3A 4XZ4A 2FNJB 2DX5B 3R7QA 3HK0A 3VUWA 2YLMA 4AJWA 3NZSA 2KFJA 2K1FA 4FJZA 2JT4B 1TTNA 5J17A 4LCDE 3TCAA 2N4FA 2FCSA 4K81A 3A1QA 3DVGY 5E6PA 2LGYA 1FXTB 1OEYA 2L0TA 2IY0B 3A9KA 3QIJA 4IC7B 2KLGA 4TV3A 2JY6A 2A4ZA 4IWOA 4W9GA 3TJPA 1KJTA 2JZ3B 3RZWC 1V5OA 2L00B 3RD2A 2DENB 1WJ4A 2KQ7A 3DVNV 1EO6A 1TGZB 2KTRB 4KDLB 1YQBA 2WX1A 3VH4B 1YX6B 3QK0A 3H1UA 2HE7A 1LFDA 1V49A 4ZRKA 3RT3B 3ZNID 4NPNA 4NY0A 2DYBA 4MGYE 3PRZA 3TBLD 3KYDD 2LVPA 4KDIC 1S1QB 2DYOA 2BPSA 3U8ZA 2M1MA 2IBIB 3RZFA 2KK8A 1YX5B 1NBFC 2BYFA 3ALBA 2JPHA 2DAJA 2KDIA 3VTVA 4PS3A 3UGBB 1SE9A 5J2RA 2ZNVB 3CF6E 3RYTA 2K39A 1WZ0A 4W9IA 1RFAA 2L0FA 2JWZA 2J0JA 3DQVA 5G2NA 3WAPA 1D3ZA 2NPTB 2BF8B 3S2AA 2ZVNA 3HM3A 1E8XA 4HWIB 2BWFA 2LXCA 4IUMB 2EMSA 4BKTA 4PS8A 4MSMB 3DVNU 4M8NA 3APDA 3ZNHB 2WWZA 3AU4A 4ZRJA 4FBJB 1WMHB 4GXBA 1GG3A 1Q1OA 3ZNGC 4FHKA 4K7WA 1WR6E 4K7SA 1GC7A 1WM3A 2K6DB 4MGIE 5LXHA 2OJRA 3KUZA 4MM3A 2M8SA 4A3PA 3UF8A 5DCNA 3MHSD 3ZDTA 3ZLZA 4ANVA 4KZ0A 5JHAA 3VTUA 1YJ1A 2C7MB 3L0WB 4HDQA 4IM0A 2LVQA 3L13A 3R66C 3DOWA 3ZO5B 2MP2B 4MJSA 4AOFA 2L7RA 4CYEA 3A33B 3TIXA 3JW0X 2KLCA 3OJ4B 4NQLB 2KJRA 3JSVA 3RULA 3VUYA 3H7PB 2KWVB 3H7SA 1WE7A 3U30A 2KDFB 3OAWA 1Y8RC 2XBBC 4FADA 4KV2A 2D3GA 5CHWA 1M94A 2KJ6A 2UYZB 4MH0E 3UIPB 2Z0EB 4LJOB 5IAAC 2J0MA 1WGRA 4TUUA 3QHTA 3OLMD 4GOCA 2MSED 3QC8B 2JVCA 1XD3B 1E8YA 1WX8A 2LI5A 2MX2A 2ZZPB 4FLHA 1WYWB 4LDTD 4URKA 3JYUA 1H8CA 1V2YA 4IM2A 1KLVA 3AULA 1C3TA 3VUXA 4MSQB 3VTWA 4ANUA 4GDLA 2L8JA 3UINB 5BO4B 1K8RB 2DZJA 4RMAA 1PQSA 2MQJA 4GDKA 1L2NA 1Q0WB 1V5TA 3M3JA 3NOBA 4JQWC 1S3SG 4WQOB 4WJQA 3T9LA 1E8WA 3CSTA 3ZRFA 4YL8A 4HCNB 4HPMB 4HVBA 2KKCA 2LD9A 2WDTB 5E6NA 2O6VA 1WJUA 2J7QB 2J0KA 1WFYA 4LDTB 4ASWC 2M4NA 4JLCA 3VDZA 3NS8A 3ENEA 2N9PC 3NHEB 1V6EA 3LJ3A 4BVUC 1EF1A 3OJ3A 1KM7A 2KX0A 3DBSA 1LXDA 2GBJA 4OVUA 1WE6A 2D11A 3BINA 2IYDB 1WF9A 1YIWA 4EUTA 5CX3A 5L83A 2GOWA 2DZKA 1UGMA 1AARA 2HJ8A 3ECIA 1GC6A 4FJVB 2AEHA 4K7UA 4FULA 4E74A 4G50A 4EKUA 2NCNA 4AP4C 4ZYNA 5HKHA 4BBNF 1WXVA 3MJWA 3ML9A 1WX9A 3PS6A 4DBGA 2GBKA 2Y5BB 2M0XA 2C9WB 2ZCBA 4G0NB 4JL9A 3R7RA 3VFKA 1EF5A 4GU2A 4WJNA 4G3XB 2XK5B 4W9KA 2KC1A 5C1ZA 4NNJB 4MELA 2K8BA 5IA7A 3B0AA 1ZW7A 4TQ0A 4NAWB 2G4DB 3KUCB 2KN5A 2A5UA 3QX1A 2KZRA 4GIVA 3VH3B 3KVFB 3N32A 4DK5A 1WI0A 3PHWB 2EMTA 2HD5B 2O2VB 2AWTA 1WZ3A 4WJOA 2ZCCA 3K9OB 3WAMA 3LDZE 4HDOA 5D7GA 2G3QB 2BYVE 2KTRA 1T0YA 5TR5A 5J18A 1E5WA 4HCPB 2ZPYA 2DYMA 4F8CB 5L95C 1ZKHA 4AJYB 2DZMA 3CSFA 3PT2B 1P0RA 4I6LB 2OOBB 3SU8X 1GNUA 1ZGUB 2V3SA 2KFKA 4CHKA 1E90A 4HJKA 2BYEA 2XEWA 4IW0A 4BKSD 4XC2A 3Q3JA 3M62B 1WJNA 4A20A 2PEAA 3CMMB 2IO3B 1Q5WB 2LGXA 2KJHB 4NJ6A 1OEYJ 2CU1A 4JIOU 1OTRB 3APCA 3R3MA 3DPDA 2NS5A 2KANA 4DDGD 2NPTA 3V60A 2JZZA 3ZVVA 4G11A 3VXWA 1LM8B 4BBNC 4ANWA 2IY1B 1NDDA 1H4RA 1JRUA 2KNBA 3O65B 2DHZA 3SHQA 1V86A 1UBIA 2K6QA 4FJYA 4GSWA 4EZJA 5JZEB 1P3QU 2MCNB 2N7DA 1WMHA 3DDCB 2K25A 5CHFA 5DPSA 2KO3A 3PRMB 1UBQA 1GJZA 2PPHA 5JHBA 2N1WA 2MBHA 5LXIB 5C23A 2REXA 1F9JA 4DHJB 3A9JB 3DBLI 3IG3A 2I1JA 5LLIA 1U4AA 2L3ZA 4ZDVA 2L76A 2KTFA 1Z2MA 3PGEA 3TMPB 2ZJDA 2QHOA 3ZKJC 2MP2A 2DAFA 4TKNA 4K1RB 4KIKB 2LGDA 2DZIA 3DVGX 2MLBA 3N30A 1QZEA 4B6WA 2KX3A 3VHTC 3DCGA 3EC8A 1WM2A 2LRUA 3H7PA 4BOZB 2N9XA 2Z0DB 4GGQA 1G6JA 4EZKA 5AZFA 4AWJA 1V80A 2JXXA 3BY4B 1LQBA 1CMXB 2KWUB 3IFWB 1WJ6A 5KHOA 5AEKB 4EOYA 4J6IA 4II2B 2JRIB 3ML8A 1WY8A 2N9EB 3AI5A 3APFA 2PE9A 4HK2A 2GBNA 3ZRCA 1VD2A 2CR5A 2FIFA 4BOSC 2C7HA 3QCAA 3GZNI 3UIOB 2AYOB 3L08A 1XT9B 3JVZX 2BKFA 2KVRA 4DHZE 4HLEA 2JF5A 2MA9B 3TL5A 4ANXA 2KQSA 4GB9A 2LASA 2JUOA 2KD0A 4W9HA 2MW5A 5E6OA 3ZUNA 4W9CA 3DBRI 5KHQA 4I6NB 4W9DA 3W1SA 3A1QB 4OVVA 2Z59B 3WANA 2MBEA 3A9KB 4MDKE 2LUEA 2UWQA 2NBVB 1WGHA 5D6JB 4BFRA 3L10B 2KHWB 2ZPNA 3V6EB 3A4RA 3B1LX 1RLFA 3W1YA 4DDID 2MBQA 2ZVOA 3IVFA 4HXDA 2I1KA 5CHVC 1IP9A 1YD8U 3VAWA 1WR1A 3QA8A 3PREA 4KSKC 3QAQA 1V81A 1P98A 2AL3A 2NVUI 1WGYA 3HIZA 3PVLA 3RCZA 1P1AA 4CO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 B;  2KXJ A;  3NY5 A;  4KZC A;  5FR6 A;  3IBE A;  2W9N A;  2C60 A;  2G45 B;  4GN1 A;  5G55 A;  2CHZ A;  4EFO A;  3DBH I;  4KSL C;  2C7N B;  4PYZ A;  4EEW A;  3V6C B;  1UEL A;  2EKE C;  2MWS B;  2NR2 A;  2CS4 A;  2RD0 A;  4WWN A;  1UD7 A;  1P9D U;  3PTF C;  4ICV A;  1J0G A;  4F7Z A;  1I35 A;  1E7V A;  1L7Y A;  2BKR B;  2KMC A;  1BT0 A;  3L54 A;  4M8M A;  2D2Q A;  4WWP A;  5CTR C;  1WXA A;  1OQY A;  3C0R B;  2FID A;  3HM6 X;  2WYQ A;  3N3K B;  1MG8 A;  4MEM A;  2KFK B;  2KDE B;  3PSE B;  4GMV A;  4KVG B;  4II3 B;  4IWP A;  2LWP A;  3GOE A;  3PPA A;  4WAA A;  3SDL C;  3U7D A;  2XK5 A;  3MTN B;  2IO1 B;  2ZNV C;  3Q3F A;  3IHP C;  4NAW A;  4W9J A;  2IZV B;  2IO2 B;  2RGF A;  4FA6 A;  2L05 A;  3WAL A;  3PLU A;  4EZL A;  2GBR A;  3A4S C;  2ASQ A;  2NBU A;  2V4L A;  2AL6 A;  3AU5 A;  1C1Y B;  4DXA B;  2PJH A;  3WIM A;  3L17 A;  3NZU A;  2O2V A;  5DPR A;  4E71 A;  1GUA B;  3H6N A;  2MBB B;  4TQ1 A;  4DHJ D;  4JGH B;  2G4S A;  4MJS B;  1WRD B;  3PV1 A;  2RR9 A;  5DPW A;  1WXS A;  1UH6 A;  2KOX A;  5D94 A;  2LVO A;  1I42 A;  3JSV B;  1A5R A;  4B9K A;  3QAR A;  2BWE S;  2MBO A;  3QJZ A;  4IWQ A;  4DHZ B;  1Z5S B;  2FAZ A;  2FCM A;  3UQA A;  4N9F 4;  4FHJ A;  2CHW A;  3I3T B;  1SIF A;  1UZX B;  1EUV B;  4A3O A;  1RAX A;  1WXM A;  3UQB A;  3RUI B;  2LRW A;  1KOT A;  4B95 A;  5GMV A;  1J8C A;  3KYC D;  3KUD B;  3PHX B;  4ZRI A;  3P2B A;  2O6V D;  2HTH A;  4MGZ E;  2KC2 A;  4WJP A;  3VQI A;  1E7U A;  3PZD A;  4PS7 A;  1R4M I;  2JRH A;  3EFU A;  3L16 A;  4W9E A;  4P7I A;  3X0W A;  2V1Y A;  4MGK E;  2YVC A;  3QWZ B;  4NQK E;  1IPG A;  5DPT A;  4XX5 A;  3EEC A;  5EDS A;  5AZH A;  3ZTD A;  4WWO A;  3M95 A;  4GDL B;  4W9F A;  4ICU A;  4I6P A;  1VCB A;  2D07 B;  2C5L C;  4GDK B;  2GBM A;  1TBE A;  2CKH B;  2RSU A;  2K8H A;  3T8M A;  3EHV A;  1TZ1 A;  4IG7 B;  3KH0 A;  4X57 B;  1J19 A;  1WIA A;  2KDB A;  4FN2 A;  5D2M B;  4BKS A;  2GMI C;  4RM8 A;  3ZW3 A;  1XQQ A;  3WAO A;  4BKG A;  1SGH A;  1WGG A;  2O6V B;  2R2O A;  4E3C A;  3V61 A;  1WX7 A;  1ISN A;  2ZEQ A;  1WGD A;  3PRP B;  2PE6 B;  2N7E A;  3X23 A;  3A9J A;  2VRR B;  1WH3 A;  2R2Q A;  3HHM A;  3W1S C;  4AUQ C;  1IYF A;  2KWC A;  3VVW B;  4NJ7 A;  1RRB A;  3PLV A;  5JH5 C;  4KIK A;  2CHX A;  1NI2 A;  3ONS A;  2D10 A;  2LJ5 A;  2IO0 B;  4RM9 A;  1R4N I;  4PYU A;  3SD5 A;  3D32 A;  4DWF A;  3QQ8 B;  2KMA A;  2WX0 A;  2NBW B;  2LXA A;  3ZTC A;  3AXC A;  3K9P B;  2B3A A;  1HE8 A;  3ZIM A;  4HPL B;  1V9J A;  1OGW A;  1X1M A;  3ZNZ B;  4M0W B;  3WA0 A;  3ZDM C;  3V62 A;  3H9D A;  3KW5 B;  1E8Z A;  3B08 A;  5AZG A;  2K8C A;  2RPQ A;  4F1S A;  4LJP B;  4W9L A;  2FUH B;  2FCQ A;  2LZ6 A;  2N1V A;  2BGF A;  2M17 A;  2MRP A;  2FCN A;  4IM3 A;  4XZ4 A;  2FNJ B;  2DX5 B;  3R7Q A;  3HK0 A;  3VUW A;  2YLM A;  4AJW A;  3NZS A;  2KFJ A;  2K1F A;  4FJZ A;  2JT4 B;  1TTN A;  5J17 A;  4LCD E;  3TCA A;  2N4F A;  2FCS A;  4K81 A;  3A1Q A;  3DVG Y;  5E6P A;  2LGY A;  1FXT B;  1OEY A;  2L0T A;  2IY0 B;  3A9K A;  3QIJ A;  4IC7 B;  2KLG A;  4TV3 A;  2JY6 A;  2A4Z A;  4IWO A;  4W9G A;  3TJP A;  1KJT A;  2JZ3 B;  3RZW C;  1V5O A;  2L00 B;  3RD2 A;  2DEN B;  1WJ4 A;  2KQ7 A;  3DVN V;  1EO6 A;  1TGZ B;  2KTR B;  4KDL B;  1YQB A;  2WX1 A;  3VH4 B;  1YX6 B;  3QK0 A;  3H1U A;  2HE7 A;  1LFD A;  1V49 A;  4ZRK A;  3RT3 B;  3ZNI D;  4NPN A;  4NY0 A;  2DYB A;  4MGY E;  3PRZ A;  3TBL D;  3KYD D;  2LVP A;  4KDI C;  1S1Q B;  2DYO A;  2BPS A;  3U8Z A;  2M1M A;  2IBI B;  3RZF A;  2KK8 A;  1YX5 B;  1NBF C;  2BYF A;  3ALB A;  2JPH A;  2DAJ A;  2KDI A;  3VTV A;  4PS3 A;  3UGB B;  1SE9 A;  5J2R A;  2ZNV B;  3CF6 E;  3RYT A;  2K39 A;  1WZ0 A;  4W9I A;  1RFA A;  2L0F A;  2JWZ A;  2J0J A;  3DQV A;  5G2N A;  3WAP A;  1D3Z A;  2NPT B;  2BF8 B;  3S2A A;  2ZVN A;  3HM3 A;  1E8X A;  4HWI B;  2BWF A;  2LXC A;  4IUM B;  2EMS A;  4BKT A;  4PS8 A;  4MSM B;  3DVN U;  4M8N A;  3APD A;  3ZNH B;  2WWZ A;  3AU4 A;  4ZRJ A;  4FBJ B;  1WMH B;  4GXB A;  1GG3 A;  1Q1O A;  3ZNG C;  4FHK A;  4K7W A;  1WR6 E;  4K7S A;  1GC7 A;  1WM3 A;  2K6D B;  4MGI E;  5LXH A;  2OJR A;  3KUZ A;  4MM3 A;  2M8S A;  4A3P A;  3UF8 A;  5DCN A;  3MHS D;  3ZDT A;  3ZLZ A;  4ANV A;  4KZ0 A;  5JHA A;  3VTU A;  1YJ1 A;  2C7M B;  3L0W B;  4HDQ A;  4IM0 A;  2LVQ A;  3L13 A;  3R66 C;  3DOW A;  3ZO5 B;  2MP2 B;  4MJS A;  4AOF A;  2L7R A;  4CYE A;  3A33 B;  3TIX A;  3JW0 X;  2KLC A;  3OJ4 B;  4NQL B;  2KJR A;  3JSV A;  3RUL A;  3VUY A;  3H7P B;  2KWV B;  3H7S A;  1WE7 A;  3U30 A;  2KDF B;  3OAW A;  1Y8R C;  2XBB C;  4FAD A;  4KV2 A;  2D3G A;  5CHW A;  1M94 A;  2KJ6 A;  2UYZ B;  4MH0 E;  3UIP B;  2Z0E B;  4LJO B;  5IAA C;  2J0M A;  1WGR A;  4TUU A;  3QHT A;  3OLM D;  4GOC A;  2MSE D;  3QC8 B;  2JVC A;  1XD3 B;  1E8Y A;  1WX8 A;  2LI5 A;  2MX2 A;  2ZZP B;  4FLH A;  1WYW B;  4LDT D;  4URK A;  3JYU A;  1H8C A;  1V2Y A;  4IM2 A;  1KLV A;  3AUL A;  1C3T A;  3VUX A;  4MSQ B;  3VTW A;  4ANU A;  4GDL A;  2L8J A;  3UIN B;  5BO4 B;  1K8R B;  2DZJ A;  4RMA A;  1PQS A;  2MQJ A;  4GDK A;  1L2N A;  1Q0W B;  1V5T A;  3M3J A;  3NOB A;  4JQW C;  1S3S G;  4WQO B;  4WJQ A;  3T9L A;  1E8W A;  3CST A;  3ZRF A;  4YL8 A;  4HCN B;  4HPM B;  4HVB A;  2KKC A;  2LD9 A;  2WDT B;  5E6N A;  2O6V A;  1WJU A;  2J7Q B;  2J0K A;  1WFY A;  4LDT B;  4ASW C;  2M4N A;  4JLC A;  3VDZ A;  3NS8 A;  3ENE A;  2N9P C;  3NHE B;  1V6E A;  3LJ3 A;  4BVU C;  1EF1 A;  3OJ3 A;  1KM7 A;  2KX0 A;  3DBS A;  1LXD A;  2GBJ A;  4OVU A;  1WE6 A;  2D11 A;  3BIN A;  2IYD B;  1WF9 A;  1YIW A;  4EUT A;  5CX3 A;  5L83 A;  2GOW A;  2DZK A;  1UGM A;  1AAR A;  2HJ8 A;  3ECI A;  1GC6 A;  4FJV B;  2AEH A;  4K7U A;  4FUL A;  4E74 A;  4G50 A;  4EKU A;  2NCN A;  4AP4 C;  4ZYN A;  5HKH A;  4BBN F;  1WXV A;  3MJW A;  3ML9 A;  1WX9 A;  3PS6 A;  4DBG A;  2GBK A;  2Y5B B;  2M0X A;  2C9W B;  2ZCB A;  4G0N B;  4JL9 A;  3R7R A;  3VFK A;  1EF5 A;  4GU2 A;  4WJN A;  4G3X B;  2XK5 B;  4W9K A;  2KC1 A;  5C1Z A;  4NNJ B;  4MEL A;  2K8B A;  5IA7 A;  3B0A A;  1ZW7 A;  4TQ0 A;  4NAW B;  2G4D B;  3KUC B;  2KN5 A;  2A5U A;  3QX1 A;  2KZR A;  4GIV A;  3VH3 B;  3KVF B;  3N32 A;  4DK5 A;  1WI0 A;  3PHW B;  2EMT A;  2HD5 B;  2O2V B;  2AWT A;  1WZ3 A;  4WJO A;  2ZCC A;  3K9O B;  3WAM A;  3LDZ E;  4HDO A;  5D7G A;  2G3Q B;  2BYV E;  2KTR A;  1T0Y A;  5TR5 A;  5J18 A;  1E5W A;  4HCP B;  2ZPY A;  2DYM A;  4F8C B;  5L95 C;  1ZKH A;  4AJY B;  2DZM A;  3CSF A;  3PT2 B;  1P0R A;  4I6L B;  2OOB B;  3SU8 X;  1GNU A;  1ZGU B;  2V3S A;  2KFK A;  4CHK A;  1E90 A;  4HJK A;  2BYE A;  2XEW A;  4IW0 A;  4BKS D;  4XC2 A;  3Q3J A;  3M62 B;  1WJN A;  4A20 A;  2PEA A;  3CMM B;  2IO3 B;  1Q5W B;  2LGX A;  2KJH B;  4NJ6 A;  1OEY J;  2CU1 A;  4JIO U;  1OTR B;  3APC A;  3R3M A;  3DPD A;  2NS5 A;  2KAN A;  4DDG D;  2NPT A;  3V60 A;  2JZZ A;  3ZVV A;  4G11 A;  3VXW A;  1LM8 B;  4BBN C;  4ANW A;  2IY1 B;  1NDD A;  1H4R A;  1JRU A;  2KNB A;  3O65 B;  2DHZ A;  3SHQ A;  1V86 A;  1UBI A;  2K6Q A;  4FJY A;  4GSW A;  4EZJ A;  5JZE B;  1P3Q U;  2MCN B;  2N7D A;  1WMH A;  3DDC B;  2K25 A;  5CHF A;  5DPS A;  2KO3 A;  3PRM B;  1UBQ A;  1GJZ A;  2PPH A;  5JHB A;  2N1W A;  2MBH A;  5LXI B;  5C23 A;  2REX A;  1F9J A;  4DHJ B;  3A9J B;  3DBL I;  3IG3 A;  2I1J A;  5LLI A;  1U4A A;  2L3Z A;  4ZDV A;  2L76 A;  2KTF A;  1Z2M A;  3PGE A;  3TMP B;  2ZJD A;  2QHO A;  3ZKJ C;  2MP2 A;  2DAF A;  4TKN A;  4K1R B;  4KIK B;  2LGD A;  2DZI A;  3DVG X;  2MLB A;  3N30 A;  1QZE A;  4B6W A;  2KX3 A;  3VHT C;  3DCG A;  3EC8 A;  1WM2 A;  2LRU A;  3H7P A;  4BOZ B;  2N9X A;  2Z0D B;  4GGQ A;  1G6J A;  4EZK A;  5AZF A;  4AWJ A;  1V80 A;  2JXX A;  3BY4 B;  1LQB A;  1CMX B;  2KWU B;  3IFW B;  1WJ6 A;  5KHO A;  5AEK B;  4EOY A;  4J6I A;  4II2 B;  2JRI B;  3ML8 A;  1WY8 A;  2N9E B;  3AI5 A;  3APF A;  2PE9 A;  4HK2 A;  2GBN A;  3ZRC A;  1VD2 A;  2CR5 A;  2FIF A;  4BOS C;  2C7H A;  3QCA A;  3GZN I;  3UIO B;  2AYO B;  3L08 A;  1XT9 B;  3JVZ X;  2BKF A;  2KVR A;  4DHZ E;  4HLE A;  2JF5 A;  2MA9 B;  3TL5 A;  4ANX A;  2KQS A;  4GB9 A;  2LAS A;  2JUO A;  2KD0 A;  4W9H A;  2MW5 A;  5E6O A;  3ZUN A;  4W9C A;  3DBR I;  5KHQ A;  4I6N B;  4W9D A;  3W1S A;  3A1Q B;  4OVV A;  2Z59 B;  3WAN A;  2MBE A;  3A9K B;  4MDK E;  2LUE A;  2UWQ A;  2NBV B;  1WGH A;  5D6J B;  4BFR A;  3L10 B;  2KHW B;  2ZPN A;  3V6E B;  3A4R A;  3B1L X;  1RLF A;  3W1Y A;  4DDI D;  2MBQ A;  2ZVO A;  3IVF A;  4HXD A;  2I1K A;  5CHV C;  1IP9 A;  1YD8 U;  3VAW A;  1WR1 A;  3QA8 A;  3PRE A;  4KSK C;  3QAQ A;  1V81 A;  1P98 A;  2AL3 A;  2NVU I;  1WGY A;  3HIZ A;  3PVL A;  3RCZ A;  1P1A A;  4CO7 A; 
#chains in the Genus database with same CATH topology
 3NY5 A;  3AE8 B;  5IOI A;  2W9N A;  2C60 A;  2YEP F;  2G45 B;  5G55 A;  1R4M B;  2CHZ A;  2DWQ A;  2CU3 A;  2EKE C;  2NR2 A;  2CS4 A;  1RWS A;  1UD7 A;  1QOA A;  3N1Y C;  1FXA A;  1JWM D;  1PGA A;  4GLS C;  2KMC A;  1BT0 A;  3L54 A;  1EWY C;  3C0R B;  2WP9 B;  1KTK A;  2KDE B;  4GMV A;  4KVG B;  3PPA A;  2IO1 B;  3B2F A;  4NAW A;  1C4C A;  4Q2J A;  1V97 A;  4EZL A;  2GBR A;  2V4L A;  4DXA B;  3WIM A;  3L17 A;  1K53 A;  1GUA B;  2R61 A;  4DHJ D;  4JGH B;  2G4S A;  2RR9 A;  4C7Z A;  4DXG A;  1UH6 A;  2L52 A;  1I42 A;  4B9K A;  3QAR A;  2BWE S;  3QJZ A;  3MFG A;  2FCM A;  3UQA A;  3I3T B;  1SIF A;  1RAX A;  1WXM A;  1KOT A;  1T3Q A;  3KUD B;  4ZRI A;  2HTH A;  3VQI A;  1E7U A;  4BAX A;  4W9E A;  3X0W A;  2V1Y A;  4MGK E;  2YVC A;  3W5U B;  1I7H A;  5EDS A;  1FRR A;  5AZH A;  4WWO A;  2Y5C A;  3PZ7 A;  1HTQ A;  4W9F A;  2N0S B;  1OQQ A;  4GDK B;  1TZ1 A;  3SR6 A;  3KH0 A;  4M02 A;  2INN E;  1WIA A;  5D2M B;  2GMI C;  4RM8 A;  4A9A A;  2H88 B;  1VRA B;  2GI9 A;  3RNB C;  4E3C A;  4IOI E;  3Q3N C;  3V61 A;  1WX7 A;  1ISN A;  2ZEQ A;  4RF1 A;  1WGD A;  3PRP B;  1N6Z A;  4AQ7 A;  2R2Q A;  4AUQ C;  1RRB A;  1RFK A;  2JX5 A;  1NI2 A;  4RM9 A;  1LO5 D;  3D32 A;  2WDQ B;  4M01 A;  2INP E;  2KMA A;  1EU3 A;  3AXC A;  2B3A A;  3C8Y A;  3Q8E A;  1DOX A;  4HPL B;  4ZRQ A;  3ZNZ B;  3WA0 A;  3V62 A;  3KW5 B;  1T0Q C;  4F1S A;  4LJP B;  2FUH B;  2M17 A;  2MJE A;  4ZHP A;  4FJZ A;  2MHJ A;  1VZ7 A;  3DVG Y;  1XLP A;  1Y56 A;  2PVG C;  3A9K A;  4IC7 B;  2KLG A;  4W9G A;  3TJP A;  1KJT A;  3RZW C;  4ZRP A;  4HRO A;  2AX5 A;  3DVN V;  5EE1 A;  3VH4 B;  1YX6 B;  3QK0 A;  1LFD A;  2D3B A;  1FM0 D;  2DYB A;  4UDU C;  5BYR A;  3KYD D;  2PMV A;  1F77 A;  2L83 A;  2KQ4 X;  4KDI C;  3BWU D;  2BPS A;  2KWD A;  2BYF A;  5BYS A;  3P1M A;  2K39 A;  1RFA A;  2L0F A;  2JWZ A;  2J0J A;  3S2A A;  2ZVN A;  3HM3 A;  4YXD B;  3TEW A;  1D6E C;  3DVN U;  4M8N A;  3ZJT A;  4US9 A;  3ABV B;  1WMH B;  4K7W A;  4K7S A;  1TKE A;  3NVY A;  4MGI E;  1I4Q A;  2L32 A;  3KUZ A;  4JWU C;  3UF8 A;  3MHS D;  1KF6 B;  2XN9 C;  2C7M B;  4IM0 A;  3U7Z A;  3DOW A;  2MP2 B;  1NYQ A;  1MFW A;  2KLC A;  3VUY A;  2KJR A;  1PYW D;  2WXJ A;  1M94 A;  4OZC A;  5IAA C;  2J0M A;  1WGR A;  3OLM D;  2MSE D;  2JVC A;  1WX8 A;  3TUO A;  2QMT A;  4IM2 A;  4MSQ B;  2DLB A;  4ANU A;  1OFF A;  5BO4 B;  4YSX B;  2FE8 A;  1K51 A;  2DZJ A;  4GDK A;  1L2N A;  3LXF A;  2WXM A;  3M3J A;  3NOB A;  1QIL A;  3BZD B;  3T9L A;  4YL8 A;  1SXT A;  1C79 A;  4HPM B;  1WJU A;  4HEA 1;  3VRB B;  1JWU D;  1T5X D;  3NS8 A;  1QT9 A;  2N9P C;  1EF1 A;  3OJ3 A;  1KM7 A;  2GBJ A;  1WE6 A;  4RF0 A;  5H8Y E;  5BMI A;  3ECI A;  1L0X B;  2X38 A;  4OZA A;  1N62 A;  2EKI A;  2KN4 A;  1VZ8 A;  4G50 A;  2KT7 A;  1VLB A;  1MG4 A;  4DBG A;  1FD6 A;  4GU2 A;  2ACZ B;  4G3X B;  2XK5 B;  5C1Z A;  2J42 A;  2KN5 A;  2KZR A;  3KVF B;  2X8X X;  2Z8L A;  3PHW B;  2O2V B;  4L1B A;  2ZCC A;  2W54 A;  5D7G A;  3BVZ A;  2BYV E;  3AE3 B;  1T0Y A;  2ZPY A;  5TSS A;  5L95 C;  1ZKH A;  1SE2 A;  3CSF A;  3PT2 B;  1P0R A;  3SU8 X;  4DQO C;  1E90 A;  2V9H A;  4TSS A;  4BKS D;  3U4E G;  3SFD B;  3CMM B;  1Q5W B;  1PDX A;  3EUB 2;  2CU1 A;  1SBB B;  2M56 B;  1ZPS A;  3DPD A;  2KAN A;  3I5J C;  3V60 A;  2IY1 B;  1AWD A;  2KNB A;  3TEZ A;  2DHZ A;  3SHQ A;  4FJY A;  2K6Q A;  4GSW A;  1P3Q U;  3HVD A;  3MC8 A;  2MCN B;  1WMH A;  5CHF A;  1YQ3 B;  1JRO A;  5JHB A;  1FXI A;  2DBY A;  2MBH A;  1L6V A;  2REX A;  1F9J A;  4DHJ B;  3PGE A;  2MP2 A;  1JQ4 A;  4TKN A;  3DBH B;  2MLB A;  3N30 A;  1L0V B;  3Q8F A;  3DCG A;  3Q6B A;  2WXK A;  4ARI A;  3L4P A;  4AWJ A;  1LQB A;  1ZXI A;  1CMX B;  1WJ6 A;  3ML8 A;  4HK2 A;  2V3N A;  3AE7 B;  3N20 C;  1YOV B;  3GZN I;  3L08 A;  4DHZ E;  4HLE A;  2J4X A;  2KQS A;  4GB9 A;  2LAS A;  5HFY A;  1YJJ A;  1UUP A;  2WDR B;  4MDK E;  4BFR A;  2ZPN A;  3B1L X;  1RLF A;  2MBQ A;  4HXD A;  1WR1 A;  3QA8 A;  1K52 A;  2AQ1 B;  1P98 A;  2SEB D;  3HIZ A;  2E3T A;  3M63 B;  4PT5 A;  1F52 A;  1E0Z A;  4GN1 A;  2BBC A;  3HRD D;  4PYZ A;  2BT6 A;  2MWS B;  4WWN A;  2H89 B;  2LJI A;  1J0G A;  1I35 A;  2PIA A;  1E7V A;  3MP9 A;  1L7Y A;  2BKR B;  1MJD A;  5CTR C;  5EE3 A;  1OQY A;  3HM6 X;  1MG8 A;  4MEM A;  3PSE B;  3U7D A;  2LWP A;  3SDL C;  2XK5 A;  2HDE A;  3IHP C;  4W9J A;  3Q3O C;  2ASQ A;  2AL6 A;  1WGK A;  2Y3A A;  2BB5 A;  2PJH A;  5DPR A;  2O2V A;  3RNF C;  1Q10 A;  3H6N A;  3ZJV A;  2BVC A;  4D2K A;  1F2R C;  2KOX A;  1YN3 A;  1R7S A;  1TKG A;  2MBO A;  2FAZ A;  3ZXR A;  4C56 C;  1ZDX A;  4N9F 4;  3NVV A;  5HG2 A;  1N61 A;  1GAQ B;  3RUI B;  5GMV A;  3R8B A;  4YTP B;  3PHX B;  1SJE D;  4RGO S;  2O6V D;  4WJP A;  2KC2 A;  4PS7 A;  2JRH A;  3EFU A;  5DPT A;  1IPG A;  2BYT A;  1TS3 A;  5IN7 A;  2JYT A;  3ZTD A;  3M95 A;  2G1E A;  1VCB A;  2D07 B;  2GBM A;  2N9L A;  3FIL B;  3EHV A;  1TZO A;  4X57 B;  1J19 A;  2KDB A;  2D3A A;  5C2T B;  3ZW3 A;  1XQQ A;  3AE5 B;  2NTS A;  1QOB A;  1XF5 L;  1WH3 A;  3PZ8 A;  1AW7 A;  3VVW B;  5JH5 C;  1BXT A;  3ONS A;  2D10 A;  3SD5 A;  1RYJ A;  4DWF A;  3BYT B;  1EWC A;  2ON8 A;  3AN1 A;  2NBW B;  3TEX A;  3RPF C;  3ZIM A;  1OGW A;  4LK0 M;  1J7B A;  1SE3 A;  5AZG A;  2K8C A;  3RNE C;  1KH0 A;  2LZ6 A;  2MRP A;  2FCN A;  4IM3 A;  2FNJ B;  1DOI A;  2YLM A;  3NZS A;  1TTN A;  5J17 A;  4LCD E;  3TCA A;  2FCS A;  4K81 A;  2V4I B;  1OEY A;  2L0T A;  3QIJ A;  4TV3 A;  2JY6 A;  2JZ3 B;  2RDB C;  2KQ7 A;  5T8I A;  1XCQ L;  1TGZ B;  2KTR B;  1YQB A;  3CWI A;  2HE7 A;  1V49 A;  3RT3 B;  1ZOY B;  1QQR A;  4LNF A;  4JPS A;  3U8Z A;  3RZF A;  1FNW A;  2KK8 A;  2KDI A;  1ENF A;  4PS3 A;  4XWW A;  3WCQ A;  2D5G A;  1WZ0 A;  1E9M A;  3DQV A;  3BK1 A;  3HVZ A;  2NPT B;  1D3Z A;  2BF8 B;  2LXC A;  4IUM B;  3MHZ A;  4MSM B;  3EFC A;  4PS8 A;  3APD A;  1XCT L;  3ZNH B;  1YJI A;  2WWZ A;  2JSV X;  3AU4 A;  4GXB A;  3RNA C;  1C78 A;  1WM3 A;  3HUI A;  3TEY A;  4S0R A;  4XDD A;  2OJR A;  5LXH A;  2M8S A;  2BQQ A;  4HDQ A;  3VRA B;  3Q3M C;  3H8H A;  3ZO5 B;  2L7R A;  3A33 B;  3U52 E;  3AE4 B;  3DHI C;  3H7P B;  2KWV B;  3H7S A;  1WE7 A;  2OED A;  2XBB C;  2WXG A;  3GE8 C;  1ET9 A;  4KV2 A;  2D3G A;  2KJ6 A;  3UI3 A;  4TUU A;  4KKI A;  2IGD A;  3QC8 B;  2ZZP B;  2QJL A;  4FLH A;  2WQY B;  4LDT D;  1J7C A;  3JYU A;  1KLV A;  2JU6 X;  3VTW A;  1VR9 A;  1K8R B;  4RMA A;  1PQS A;  3BII D;  3FIL A;  4JQW C;  1S3S G;  3CST A;  1WYG A;  1C9F A;  1MI0 A;  4C4V B;  2J0K A;  1NYR A;  1WFY A;  5HI1 A;  3DWM A;  4DXF A;  4LLG M;  4JLC A;  3RN9 C;  1V6E A;  1TS2 A;  1D5M C;  2D11 A;  1LGR A;  4NAM A;  1I4R A;  5L83 A;  5IP4 D;  4ITK A;  1UGM A;  1AAR A;  4FJV B;  4K7U A;  2AEH A;  3RI7 C;  4EKU A;  2QIL A;  3NVZ A;  2JQR B;  3ML9 A;  4G0N B;  2M0X A;  2ZCB A;  1ZXH A;  1QOF A;  1AN8 A;  4W9K A;  2K8B A;  5IA7 A;  1ZW7 A;  2G4D B;  3KUC B;  1JW9 D;  1RM6 C;  2J52 A;  2RDG A;  3QX1 A;  3GE3 C;  4GIV A;  3OWE B;  2AWT A;  3PO0 A;  4WJO A;  4N59 A;  2NMQ A;  3WAM A;  3AEB B;  5BMG A;  4K3C A;  3GP7 A;  1ROE A;  2KTR A;  3W2D A;  2GLS A;  5TR5 A;  1FNU A;  3AE1 B;  4HCP B;  4A6Q A;  5E6J A;  3AEC B;  2LHE A;  1HA5 A;  1YNT E;  1D4B A;  5G5H A;  4CHK A;  2BYE A;  4A90 A;  3BVG A;  1VJK A;  2I2Y A;  3MJ5 A;  1TY2 A;  4A20 A;  1ACC A;  4C00 A;  4NJ6 A;  1OEY J;  4JIO U;  3APC A;  4A55 A;  1GB4 A;  3R2T A;  2NPT A;  3AMZ A;  3ZVV A;  3VXW A;  1LM8 B;  2W82 A;  2KAJ A;  1H4R A;  1JRU A;  5FK9 C;  3V3X A;  3DDC B;  2WXP A;  3AB5 A;  3NRZ A;  2N1W A;  1SB3 C;  2K0P A;  3A9J B;  3DBL I;  3IG3 A;  4RH6 A;  2L76 A;  2EEL A;  3AEE B;  2ZJD A;  2DAF A;  4KIK B;  4KGT A;  2DZI A;  3B2G A;  3EA6 A;  1QZE A;  2KX3 A;  3VHT C;  3EC8 A;  2LRU A;  3H7P A;  4BOZ B;  2Z0D B;  3B9J A;  2W3R A;  5AZF A;  2WXO A;  3BY4 B;  2VZK D;  4FXC A;  2KWU B;  1CQV A;  5KHO A;  4KKJ A;  4EOY A;  4J6I A;  3NG0 A;  3AI5 A;  3APF A;  1ZDV A;  1PUT A;  2GBN A;  3J9C A;  2VH1 A;  4S17 A;  3ZRC A;  3SFE B;  1XT9 B;  4YSY B;  2K9X A;  3MC0 B;  2QDF A;  2KD0 A;  3BVM A;  2MW5 A;  4I6N B;  3A1Q B;  4OVV A;  3WAN A;  5G5G A;  1QLB B;  2E6X A;  3L10 B;  1UNS A;  5D3D A;  1C4A A;  3LB8 C;  3W1Y A;  3IVF A;  1VDV A;  2RDH A;  4C4V A;  2I1K A;  4P16 A;  1IP9 A;  3Q14 C;  4KSK C;  2NVU I;  1I4H A;  5GXG B;  1SSN A;  1JWS D;  3AE6 B;  3Q8C A;  4EFO A;  4KSL C;  2C7N B;  4EEW A;  1UEL A;  1P7E A;  4B0M A;  3IXS A;  3PTF C;  5AUK A;  4F7Z A;  2IJ0 A;  3R2I A;  4M8M A;  2D2Q A;  4L2Y A;  4WWP A;  5C3J B;  3P4S B;  3N3K B;  4TMA B;  2KFK B;  4II3 B;  3GOE A;  3MTN B;  4LNN A;  2BS2 B;  1ZE3 D;  2IO2 B;  2RGF A;  4MM3 B;  2L05 A;  3TSS A;  4OVZ A;  4E71 A;  2Y5P A;  2MBB B;  4TQ1 A;  4MJS B;  3PV1 A;  4MT5 A;  5DPW A;  2V3P A;  5D94 A;  4REZ A;  2LVO A;  2JXT A;  4YTM B;  1MVK A;  2K22 A;  2CHW A;  5JXV A;  1EUV B;  3UQB A;  3T3O A;  4IKG A;  3P2B A;  1YN4 A;  2FBW B;  4MGZ E;  2INC C;  1E10 A;  1R4M I;  4NJC A;  2WU5 B;  1EU4 A;  4NQK E;  4XX5 A;  2WXI A;  1KFY B;  4R3D A;  1JWA D;  3I57 A;  4OW0 A;  2C5L C;  1TBE A;  2CKH B;  2Q5W D;  2K8H A;  1NEN B;  1TS5 A;  4IG7 B;  4FN2 A;  1TIF A;  2R2O A;  1FIQ A;  2N7E A;  3A9J A;  3HHM A;  4ACF A;  1IYF A;  1IBX B;  3PLV A;  3SEB A;  4KIK A;  3DWG C;  2IND C;  2LJ5 A;  4WUR A;  1R4N I;  4PYU A;  4XGA B;  3BK2 A;  3ZTC A;  2RMM A;  1V9J A;  1X1M A;  4M0W B;  1OQR A;  2RPQ A;  2WU2 B;  2K5P A;  4W9L A;  4RCO A;  2FCQ A;  2N1V A;  3R7Q A;  4AJW A;  1A70 A;  4KX6 B;  1AYF A;  3A1Q A;  5E6P A;  2IY0 B;  3P4R B;  2OJW A;  4OHJ A;  4IWO A;  1V5O A;  2L00 B;  2DEN B;  1WJ4 A;  2QCZ A;  2G9H D;  2WX1 A;  3H1U A;  1ET6 A;  1HQR D;  4ZRK A;  2M19 A;  3Q2A C;  4NY0 A;  1M4V A;  1SF0 A;  3DBL B;  1S1Q B;  2DYO A;  2M1M A;  2IBI B;  1YX5 B;  1N60 A;  3ALB A;  3VTV A;  2JPH A;  2DAJ A;  3CF6 E;  4NZL B;  1FEH A;  1XO3 A;  3AEG B;  4A8X C;  4HWI B;  4USA A;  2BWF A;  2ICI A;  4BKT A;  2IDY A;  1GPX A;  3P4P B;  1FCC C;  1UWM A;  4ZRJ A;  3NZ3 A;  1GG3 A;  1Q1O A;  4FHK A;  3N1Z C;  1WR6 E;  1HTO A;  2IPK D;  4MM3 A;  4A3P A;  3ZDT A;  4KZ0 A;  4JX1 C;  3VTU A;  2LVQ A;  3R66 C;  1NVI D;  4MJS A;  4AOF A;  2MH7 A;  3KQ4 A;  4NQL B;  3RUL A;  1D5Z C;  3Q8A A;  1Y8R C;  1XEE A;  2WS3 B;  1PFD A;  5CHW A;  4RGM A;  2UYZ B;  3UIP B;  2BB6 A;  5EE9 A;  2V0G A;  3GB1 A;  1YQ4 B;  3QHT A;  1E8Y A;  2WHI A;  2MX2 A;  4URK A;  1WYW B;  2D3C A;  3AUL A;  1C3T A;  2N7J A;  1JAL A;  4J3O D;  2L8J A;  3UIN B;  4P1B C;  1YMH E;  1Q0W B;  3URY A;  4WJQ A;  1MHH E;  5MPO A;  2QIE B;  4HVB A;  3NUH B;  2WDT B;  2W55 A;  2J7Q B;  3NJT A;  3FAH A;  3VDZ A;  3NHE B;  1IBX A;  3LJ3 A;  4WAF A;  1L5P A;  2I38 A;  3IAS 1;  1N5X A;  2GB1 A;  2KX0 A;  1BML C;  1LXD A;  1L4D B;  1WF9 A;  4AS1 A;  5CX3 A;  2VZK B;  1FMA D;  1L4Z B;  2CJO A;  2HJ8 A;  1GC6 A;  4M0W A;  2NCN A;  4ZYN A;  2VH2 A;  5IO9 A;  3MJW A;  1WX9 A;  3PS6 A;  2GBK A;  2Y5B B;  4JL9 A;  3VFK A;  3R7R A;  3ZGZ A;  4C80 A;  4WJN A;  2KC1 A;  3CIR B;  1IGD A;  4TQ0 A;  2A5U A;  3U2S C;  3VR9 B;  1WI0 A;  1V1P B;  4WH4 A;  2WXR A;  2HD5 B;  4N6E B;  2JZP A;  1J7A A;  2G3Q B;  1E5W A;  1EM7 A;  1XLQ A;  2DYM A;  2BW2 A;  4AJY B;  1ZGU B;  2QEJ C;  1C77 A;  2QSD A;  5D3I B;  4IW0 A;  4XC2 A;  1WJN A;  3GZN B;  2IO3 B;  2LGX A;  3AEA B;  4PK1 A;  1OTR B;  1R4N B;  2WXH A;  1SJH D;  4DDG D;  2JZZ A;  1NDD A;  2LFI A;  3O65 B;  1NEK B;  1UBI A;  5JZE B;  2HTM E;  1IGC A;  2DNF A;  4MH8 A;  1XXG A;  3PRM B;  3RFZ B;  1UBQ A;  1GJZ A;  4MAC A;  5EE0 A;  2LGS A;  1HEZ E;  1CZP A;  2UU7 A;  4ZOH C;  5HHD G;  5BYQ A;  5LXI B;  3FKY A;  2I1J A;  5LLI A;  1K50 A;  4ZDV A;  2KTF A;  1Z2M A;  2AQ3 B;  2QHO A;  3ZKJ C;  1PGX A;  4YTN B;  2BTE A;  1F1H A;  4B6W A;  1C4P A;  1WM2 A;  2LEK A;  4GGQ A;  3ZYY X;  2W3S A;  4LNK A;  3AEF B;  1DGJ A;  1XLN A;  1CJE A;  4II2 B;  1VD2 A;  2CR5 A;  2FIF A;  1UF0 A;  3OG5 A;  2AYO B;  3Q69 A;  3JVZ X;  2BKF A;  2KVR A;  4YSZ B;  2MA9 B;  3AE2 B;  3TL5 A;  4W9H A;  1JCK B;  5KHQ A;  3ZUN A;  4LNI A;  4W9C A;  3DBR I;  4W9D A;  1QF6 A;  3AV8 A;  2J53 A;  2Z59 B;  2MBE A;  2ZW0 A;  4XWT A;  2WLB A;  2LUE A;  5D6J B;  1WGH A;  1WRI A;  1N5W A;  2KHW B;  4WWM A;  3V6E B;  2ZVO A;  4LNO A;  1ESF A;  1P1A A;  3PRE A;  3QAQ A;  1V81 A;  2JWU A;  1WGY A;  3RCZ A;  4HPP A;  4CO7 A;  2KXJ A;  2IGH A;  4KZC A;  5FR6 A;  3IBE A;  1ZP0 B;  3IT4 B;  5BMH A;  3DBH I;  3V6C B;  4P6V F;  2RD0 A;  1I4G A;  2XNA C;  4O1N A;  4K3B A;  1P9D U;  4ICV A;  4QAY A;  2LHD A;  1WXA A;  2FID A;  2WGS A;  2WYQ A;  4WAA A;  4IWP A;  1F0Z A;  2ZNV C;  3Q3F A;  1TKY A;  2IZV B;  5AUI A;  4FA6 A;  1BUI C;  3WAL A;  3PLU A;  3A4S C;  2NBU A;  3AU5 A;  1C1Y B;  1V1P A;  4HJG E;  3NZU A;  1WRD B;  1WXS A;  3ZXV A;  2PKO A;  3JSV B;  1A5R A;  3MC9 A;  4IWQ A;  1HZ6 A;  1JML A;  4DHZ B;  1Z5S B;  1TY0 A;  4FHJ A;  1UZX B;  4A3O A;  1SEB D;  1HXY D;  4RGN A;  2LRW A;  4B95 A;  1J8C A;  3KYC D;  4JWS C;  2YEP B;  3PZD A;  3L16 A;  4P7I A;  3QWZ B;  1V8C A;  2WXQ A;  3EEC A;  1B9R A;  4GDL B;  3N9Y C;  4ICU A;  3NS1 A;  4I6P A;  4RFB A;  4KGR A;  2RSU A;  3DHH C;  3T8M A;  2FUG 1;  3E56 A;  4BKS A;  3WAO A;  4BKG A;  1TJE A;  1SGH A;  3T3N A;  2HJ1 A;  1WGG A;  2O6V B;  1KLU D;  1ZUD 2;  1SIJ A;  1I4X A;  2PE6 B;  3X23 A;  1TYG B;  2VRR B;  3LYY A;  5I4D A;  4BZA A;  3W1S C;  2KWC A;  4NJ7 A;  3BYY B;  2JYE A;  4ZHO A;  2CHX A;  2IO0 B;  2M0A A;  3QQ8 B;  2WX0 A;  3E9S A;  2LXA A;  3P42 A;  3K9P B;  1XLO A;  1HE8 A;  1T0S C;  3ZDM C;  3H9D A;  1PGB A;  1E8Z A;  3B08 A;  4YWG G;  3RNC C;  3IT6 B;  4LTU A;  2B76 B;  3IAM 1;  2BGF A;  4XZ4 A;  2DX5 B;  3HK0 A;  3VUW A;  1SE4 A;  2TSS A;  2KFJ A;  2K1F A;  2JT4 B;  1IUE A;  1CK1 A;  2N4F A;  2KMM A;  4HKZ E;  3FC4 A;  2LGY A;  2NTT A;  1FXT B;  2WXN A;  1WXQ A;  2A4Z A;  1GB1 A;  1UWX A;  3W5V B;  3RD2 A;  1EO6 A;  1GOZ A;  4KDL B;  2LMC A;  1WSP A;  3ZNI D;  4NPN A;  4MGY E;  3PRZ A;  3TBL D;  2MJD A;  2LVP A;  1WWT A;  1NBF C;  3UGB B;  1SE9 A;  5J2R A;  2KYW A;  2ZNV B;  3RYT A;  4ARC A;  1L6U A;  4W9I A;  3WAP A;  2WXL A;  5G2N A;  1E8X A;  2IGG A;  2EMS A;  2WDV B;  4H2A A;  2QC8 A;  1KLG D;  2WXF A;  2MJ3 A;  4FBJ B;  1MPE A;  3ZNG C;  4RGT A;  2PVO D;  1GC7 A;  2K6D B;  5DCN A;  4C7Y A;  3ZLZ A;  4ANV A;  2PLP A;  5JHA A;  1YJ1 A;  4B0E A;  3W9C B;  3L0W B;  3DBR B;  3I9V 1;  3L13 A;  4CYE A;  3TIX A;  3JW0 X;  3KWL A;  3OJ4 B;  3JSV A;  2K3U A;  2WNM A;  3U30 A;  2KDF B;  3OAW A;  2N9K A;  1FFV A;  4FAD A;  3ZJU A;  1MHX A;  4MH0 E;  3RMK C;  2AQ2 B;  2Z0E B;  4LJO B;  3AH7 A;  4GOC A;  4M00 A;  2SAK A;  5H92 C;  1XD3 B;  2LI5 A;  5FKA C;  3C19 A;  1H8C A;  1V2Y A;  4L23 A;  3N1X C;  3VUX A;  2KDM A;  4GDL A;  1T0R C;  2MQJ A;  2L1A A;  1V5T A;  3GS2 A;  4JE3 B;  4WQO B;  1E8W A;  3ZRF A;  1V1O A;  1P7F A;  4HCN B;  1F2R I;  1T6B X;  2KKC A;  2LD9 A;  5E6N A;  2O6V A;  3EGR A;  1JWB D;  4LDT B;  4ASW C;  2M4N A;  2RPV A;  3V05 A;  3Q8B A;  3ENE A;  4CQN A;  4BVU C;  3DHG C;  1TT5 B;  3DBS A;  3ETR A;  4OVU A;  3BIN A;  5LNK 1;  1FO4 A;  2IYD B;  1YIW A;  4EUT A;  2GOW A;  2DZK A;  4WIP A;  4XDC A;  4EE2 A;  1UGJ A;  2ONQ A;  4FUL A;  4E74 A;  1JRP A;  4WQM A;  4AP4 C;  3P4Q B;  5HKH A;  4BBN F;  1WXV A;  2C9W B;  1EF5 A;  3NVW A;  1L0Y B;  1QKZ A;  4NNJ B;  1YN5 A;  4MEL A;  2BS4 B;  3B0A A;  4NAW B;  3VH3 B;  3N32 A;  4DK5 A;  1QOG A;  2EMT A;  1D5X C;  4RNA A;  1WZ3 A;  3K9O B;  2PW9 A;  3RNG C;  3LDZ E;  3I63 C;  4HDO A;  4P1C C;  5J18 A;  1I4P A;  3P63 A;  2BS3 B;  4OZB A;  2LUM A;  4N58 A;  4F8C B;  4YT0 B;  2DZM A;  2MEK A;  4I6L B;  2OOB B;  4US8 A;  1GNU A;  4IDI A;  2V3S A;  2KFK A;  4HJK A;  2XEW A;  2PTL A;  1FRD A;  3Q3J A;  3M62 B;  1FPY A;  2PEA A;  1E7P B;  2KJH B;  3R3M A;  1E6E B;  2NS5 A;  1FNV A;  4G11 A;  1DYQ A;  4BBN C;  4ANW A;  1STE A;  2GRI A;  1C76 A;  4EZJ A;  1V86 A;  2N7D A;  2K25 A;  3AED B;  5DPS A;  4ZYS A;  2KO3 A;  4XE0 A;  2PPH A;  5C23 A;  1U4A A;  2L3Z A;  4HKQ A;  3TMP B;  4K1R B;  2LGD A;  3DVG X;  1G6J A;  2N9X A;  2OHF A;  4EZK A;  1HZ5 A;  1V80 A;  1TS4 A;  2JXX A;  3IFW B;  4XYC A;  5IKC M;  5AEK B;  2LGI A;  2JRI B;  1VZ6 A;  1WY8 A;  2CJN A;  2KAC A;  2N9E B;  2PE9 A;  4BOS C;  2C7H A;  3QCA A;  1NI3 A;  3UIO B;  5FR3 A;  2ZW1 A;  2JF5 A;  2KVZ A;  4ANX A;  3VR8 B;  3KWV A;  2JUO A;  5E6O A;  1DOY A;  3W1S A;  1KRH A;  4KGS A;  3A9K B;  2UWQ A;  2NBV B;  3AM9 A;  3AE9 B;  3A4R A;  4HRS A;  4DDI D;  3ZQ4 A;  1FCL A;  3KLS X;  5CHV C;  1N63 A;  3O13 A;  1YD8 U;  3VAW A;  1B1Z A;  2AL3 A;  3PVL A;  1FFU A; 
#chains in the Genus database with same CATH homology
 3M63 B;  2KXJ A;  3NY5 A;  4KZC A;  5FR6 A;  3IBE A;  2W9N A;  2C60 A;  2G45 B;  4GN1 A;  5G55 A;  2CHZ A;  4EFO A;  3DBH I;  4KSL C;  2C7N B;  4PYZ A;  4EEW A;  3V6C B;  1UEL A;  2EKE C;  2MWS B;  2NR2 A;  2CS4 A;  2RD0 A;  4WWN A;  1UD7 A;  1P9D U;  3PTF C;  4ICV A;  1J0G A;  4F7Z A;  1I35 A;  1E7V A;  1L7Y A;  2BKR B;  2KMC A;  1BT0 A;  3L54 A;  4M8M A;  2D2Q A;  4WWP A;  5CTR C;  1WXA A;  1OQY A;  3C0R B;  2FID A;  3HM6 X;  2WYQ A;  3N3K B;  1MG8 A;  4MEM A;  2KFK B;  2KDE B;  3PSE B;  4GMV A;  4KVG B;  4II3 B;  4IWP A;  2LWP A;  3GOE A;  3PPA A;  4WAA A;  3SDL C;  3U7D A;  2XK5 A;  3MTN B;  2IO1 B;  2ZNV C;  3Q3F A;  3IHP C;  4NAW A;  4W9J A;  2IZV B;  2IO2 B;  2RGF A;  4FA6 A;  2L05 A;  3WAL A;  3PLU A;  4EZL A;  2GBR A;  3A4S C;  2ASQ A;  2NBU A;  2V4L A;  2AL6 A;  3AU5 A;  1C1Y B;  4DXA B;  2PJH A;  3WIM A;  3L17 A;  3NZU A;  2O2V A;  5DPR A;  4E71 A;  1GUA B;  3H6N A;  2MBB B;  4TQ1 A;  4DHJ D;  4JGH B;  2G4S A;  4MJS B;  1WRD B;  3PV1 A;  2RR9 A;  5DPW A;  1WXS A;  1UH6 A;  2KOX A;  5D94 A;  2LVO A;  1I42 A;  3JSV B;  1A5R A;  4B9K A;  3QAR A;  2BWE S;  2MBO A;  3QJZ A;  4IWQ A;  4DHZ B;  1Z5S B;  2FAZ A;  2FCM A;  3UQA A;  4N9F 4;  4FHJ A;  2CHW A;  3I3T B;  1SIF A;  1UZX B;  1EUV B;  4A3O A;  1RAX A;  1WXM A;  3UQB A;  3RUI B;  2LRW A;  1KOT A;  4B95 A;  5GMV A;  1J8C A;  3KYC D;  3KUD B;  3PHX B;  4ZRI A;  3P2B A;  2O6V D;  2HTH A;  4MGZ E;  2KC2 A;  4WJP A;  3VQI A;  1E7U A;  3PZD A;  4PS7 A;  1R4M I;  2JRH A;  3EFU A;  3L16 A;  4W9E A;  4P7I A;  3X0W A;  2V1Y A;  4MGK E;  2YVC A;  3QWZ B;  4NQK E;  1IPG A;  5DPT A;  4XX5 A;  3EEC A;  5EDS A;  5AZH A;  3ZTD A;  4WWO A;  3M95 A;  4GDL B;  4W9F A;  4ICU A;  4I6P A;  1VCB A;  2D07 B;  2C5L C;  4GDK B;  2GBM A;  1TBE A;  2CKH B;  2RSU A;  2K8H A;  3T8M A;  3EHV A;  1TZ1 A;  4IG7 B;  3KH0 A;  4X57 B;  1J19 A;  1WIA A;  2KDB A;  4FN2 A;  5D2M B;  4BKS A;  2GMI C;  4RM8 A;  3ZW3 A;  1XQQ A;  3WAO A;  4BKG A;  1SGH A;  1WGG A;  2O6V B;  2R2O A;  4E3C A;  3V61 A;  1WX7 A;  1ISN A;  2ZEQ A;  1WGD A;  3PRP B;  2PE6 B;  2N7E A;  3X23 A;  3A9J A;  2VRR B;  1WH3 A;  2R2Q A;  3HHM A;  3W1S C;  4AUQ C;  1IYF A;  2KWC A;  3VVW B;  4NJ7 A;  1RRB A;  3PLV A;  5JH5 C;  4KIK A;  2CHX A;  1NI2 A;  3ONS A;  2D10 A;  2LJ5 A;  2IO0 B;  4RM9 A;  1R4N I;  4PYU A;  3SD5 A;  3D32 A;  4DWF A;  3QQ8 B;  2KMA A;  2WX0 A;  2NBW B;  2LXA A;  3ZTC A;  3AXC A;  3K9P B;  2B3A A;  1HE8 A;  3ZIM A;  4HPL B;  1V9J A;  1OGW A;  1X1M A;  3ZNZ B;  4M0W B;  3WA0 A;  3ZDM C;  3V62 A;  3H9D A;  3KW5 B;  1E8Z A;  3B08 A;  5AZG A;  2K8C A;  2RPQ A;  4F1S A;  4LJP B;  4W9L A;  2FUH B;  2FCQ A;  2LZ6 A;  2N1V A;  2BGF A;  2M17 A;  2MRP A;  2FCN A;  4IM3 A;  4XZ4 A;  2FNJ B;  2DX5 B;  3R7Q A;  3HK0 A;  3VUW A;  2YLM A;  4AJW A;  3NZS A;  2KFJ A;  2K1F A;  4FJZ A;  2JT4 B;  1TTN A;  5J17 A;  4LCD E;  3TCA A;  2N4F A;  2FCS A;  4K81 A;  3A1Q A;  3DVG Y;  5E6P A;  2LGY A;  1FXT B;  1OEY A;  2L0T A;  2IY0 B;  3A9K A;  3QIJ A;  4IC7 B;  2KLG A;  4TV3 A;  2JY6 A;  2A4Z A;  4IWO A;  4W9G A;  3TJP A;  1KJT A;  2JZ3 B;  3RZW C;  1V5O A;  2L00 B;  3RD2 A;  2DEN B;  1WJ4 A;  2KQ7 A;  3DVN V;  1EO6 A;  1TGZ B;  2KTR B;  4KDL B;  1YQB A;  2WX1 A;  3VH4 B;  1YX6 B;  3QK0 A;  3H1U A;  2HE7 A;  1LFD A;  1V49 A;  4ZRK A;  3RT3 B;  3ZNI D;  4NPN A;  4NY0 A;  2DYB A;  4MGY E;  3PRZ A;  3TBL D;  3KYD D;  2LVP A;  4KDI C;  1S1Q B;  2DYO A;  2BPS A;  3U8Z A;  2M1M A;  2IBI B;  3RZF A;  2KK8 A;  1YX5 B;  1NBF C;  2BYF A;  3ALB A;  2JPH A;  2DAJ A;  2KDI A;  3VTV A;  4PS3 A;  3UGB B;  1SE9 A;  5J2R A;  2ZNV B;  3CF6 E;  3RYT A;  2K39 A;  1WZ0 A;  4W9I A;  1RFA A;  2L0F A;  2JWZ A;  2J0J A;  3DQV A;  5G2N A;  3WAP A;  1D3Z A;  2NPT B;  2BF8 B;  3S2A A;  2ZVN A;  3HM3 A;  1E8X A;  4HWI B;  2BWF A;  2LXC A;  4IUM B;  2EMS A;  4BKT A;  4PS8 A;  4MSM B;  3DVN U;  4M8N A;  3APD A;  3ZNH B;  2WWZ A;  3AU4 A;  4ZRJ A;  4FBJ B;  1WMH B;  4GXB A;  1GG3 A;  1Q1O A;  3ZNG C;  4FHK A;  4K7W A;  1WR6 E;  4K7S A;  1GC7 A;  1WM3 A;  2K6D B;  4MGI E;  5LXH A;  2OJR A;  3KUZ A;  4MM3 A;  2M8S A;  4A3P A;  3UF8 A;  5DCN A;  3MHS D;  3ZDT A;  3ZLZ A;  4ANV A;  4KZ0 A;  5JHA A;  3VTU A;  1YJ1 A;  2C7M B;  3L0W B;  4HDQ A;  4IM0 A;  2LVQ A;  3L13 A;  3R66 C;  3DOW A;  3ZO5 B;  2MP2 B;  4MJS A;  4AOF A;  2L7R A;  4CYE A;  3A33 B;  3TIX A;  3JW0 X;  2KLC A;  3OJ4 B;  4NQL B;  2KJR A;  3JSV A;  3RUL A;  3VUY A;  3H7P B;  2KWV B;  3H7S A;  1WE7 A;  3U30 A;  2KDF B;  3OAW A;  1Y8R C;  2XBB C;  4FAD A;  4KV2 A;  2D3G A;  5CHW A;  1M94 A;  2KJ6 A;  2UYZ B;  4MH0 E;  3UIP B;  2Z0E B;  4LJO B;  5IAA C;  2J0M A;  1WGR A;  4TUU A;  3QHT A;  3OLM D;  4GOC A;  2MSE D;  3QC8 B;  2JVC A;  1XD3 B;  1E8Y A;  1WX8 A;  2LI5 A;  2MX2 A;  2ZZP B;  4FLH A;  1WYW B;  4LDT D;  4URK A;  3JYU A;  1H8C A;  1V2Y A;  4IM2 A;  1KLV A;  3AUL A;  1C3T A;  3VUX A;  4MSQ B;  3VTW A;  4ANU A;  4GDL A;  2L8J A;  3UIN B;  5BO4 B;  1K8R B;  2DZJ A;  4RMA A;  1PQS A;  2MQJ A;  4GDK A;  1L2N A;  1Q0W B;  1V5T A;  3M3J A;  3NOB A;  4JQW C;  1S3S G;  4WQO B;  4WJQ A;  3T9L A;  1E8W A;  3CST A;  3ZRF A;  4YL8 A;  4HCN B;  4HPM B;  4HVB A;  2KKC A;  2LD9 A;  2WDT B;  5E6N A;  2O6V A;  1WJU A;  2J7Q B;  2J0K A;  1WFY A;  4LDT B;  4ASW C;  2M4N A;  4JLC A;  3VDZ A;  3NS8 A;  3ENE A;  2N9P C;  3NHE B;  1V6E A;  3LJ3 A;  4BVU C;  1EF1 A;  3OJ3 A;  1KM7 A;  2KX0 A;  3DBS A;  1LXD A;  2GBJ A;  4OVU A;  1WE6 A;  2D11 A;  3BIN A;  2IYD B;  1WF9 A;  1YIW A;  4EUT A;  5CX3 A;  5L83 A;  2GOW A;  2DZK A;  1UGM A;  1AAR A;  2HJ8 A;  3ECI A;  1GC6 A;  4FJV B;  2AEH A;  4K7U A;  4FUL A;  4E74 A;  4G50 A;  4EKU A;  2NCN A;  4AP4 C;  4ZYN A;  5HKH A;  4BBN F;  1WXV A;  3MJW A;  3ML9 A;  1WX9 A;  3PS6 A;  4DBG A;  2GBK A;  2Y5B B;  2M0X A;  2C9W B;  2ZCB A;  4G0N B;  4JL9 A;  3R7R A;  3VFK A;  1EF5 A;  4GU2 A;  4WJN A;  4G3X B;  2XK5 B;  4W9K A;  2KC1 A;  5C1Z A;  4NNJ B;  4MEL A;  2K8B A;  5IA7 A;  3B0A A;  1ZW7 A;  4TQ0 A;  4NAW B;  2G4D B;  3KUC B;  2KN5 A;  2A5U A;  3QX1 A;  2KZR A;  4GIV A;  3VH3 B;  3KVF B;  3N32 A;  4DK5 A;  1WI0 A;  3PHW B;  2EMT A;  2HD5 B;  2O2V B;  2AWT A;  1WZ3 A;  4WJO A;  2ZCC A;  3K9O B;  3WAM A;  3LDZ E;  4HDO A;  5D7G A;  2G3Q B;  2BYV E;  2KTR A;  1T0Y A;  5TR5 A;  5J18 A;  1E5W A;  4HCP B;  2ZPY A;  2DYM A;  4F8C B;  5L95 C;  1ZKH A;  4AJY B;  2DZM A;  3CSF A;  3PT2 B;  1P0R A;  4I6L B;  2OOB B;  3SU8 X;  1GNU A;  1ZGU B;  2V3S A;  2KFK A;  4CHK A;  1E90 A;  4HJK A;  2BYE A;  2XEW A;  4IW0 A;  4BKS D;  4XC2 A;  3Q3J A;  3M62 B;  1WJN A;  4A20 A;  2PEA A;  3CMM B;  2IO3 B;  1Q5W B;  2LGX A;  2KJH B;  4NJ6 A;  1OEY J;  2CU1 A;  4JIO U;  1OTR B;  3APC A;  3R3M A;  3DPD A;  2NS5 A;  2KAN A;  4DDG D;  2NPT A;  3V60 A;  2JZZ A;  3ZVV A;  4G11 A;  3VXW A;  1LM8 B;  4BBN C;  4ANW A;  2IY1 B;  1NDD A;  1H4R A;  1JRU A;  2KNB A;  3O65 B;  2DHZ A;  3SHQ A;  1V86 A;  1UBI A;  2K6Q A;  4FJY A;  4GSW A;  4EZJ A;  5JZE B;  1P3Q U;  2MCN B;  2N7D A;  1WMH A;  3DDC B;  2K25 A;  5CHF A;  5DPS A;  2KO3 A;  3PRM B;  1UBQ A;  1GJZ A;  2PPH A;  5JHB A;  2N1W A;  2MBH A;  5LXI B;  5C23 A;  2REX A;  1F9J A;  4DHJ B;  3A9J B;  3DBL I;  3IG3 A;  2I1J A;  5LLI A;  1U4A A;  2L3Z A;  4ZDV A;  2L76 A;  2KTF A;  1Z2M A;  3PGE A;  3TMP B;  2ZJD A;  2QHO A;  3ZKJ C;  2MP2 A;  2DAF A;  4TKN A;  4K1R B;  4KIK B;  2LGD A;  2DZI A;  3DVG X;  2MLB A;  3N30 A;  1QZE A;  4B6W A;  2KX3 A;  3VHT C;  3DCG A;  3EC8 A;  1WM2 A;  2LRU A;  3H7P A;  4BOZ B;  2N9X A;  2Z0D B;  4GGQ A;  1G6J A;  4EZK A;  5AZF A;  4AWJ A;  1V80 A;  2JXX A;  3BY4 B;  1LQB A;  1CMX B;  2KWU B;  3IFW B;  1WJ6 A;  5KHO A;  5AEK B;  4EOY A;  4J6I A;  4II2 B;  2JRI B;  3ML8 A;  1WY8 A;  2N9E B;  3AI5 A;  3APF A;  2PE9 A;  4HK2 A;  2GBN A;  3ZRC A;  1VD2 A;  2CR5 A;  2FIF A;  4BOS C;  2C7H A;  3QCA A;  3GZN I;  3UIO B;  2AYO B;  3L08 A;  1XT9 B;  3JVZ X;  2BKF A;  2KVR A;  4DHZ E;  4HLE A;  2JF5 A;  2MA9 B;  3TL5 A;  4ANX A;  2KQS A;  4GB9 A;  2LAS A;  2JUO A;  2KD0 A;  4W9H A;  2MW5 A;  5E6O A;  3ZUN A;  4W9C A;  3DBR I;  5KHQ A;  4I6N B;  4W9D A;  3W1S A;  3A1Q B;  4OVV A;  2Z59 B;  3WAN A;  2MBE A;  3A9K B;  4MDK E;  2LUE A;  2UWQ A;  2NBV B;  1WGH A;  5D6J B;  4BFR A;  3L10 B;  2KHW B;  2ZPN A;  3V6E B;  3A4R A;  3B1L X;  1RLF A;  3W1Y A;  4DDI D;  2MBQ A;  2ZVO A;  3IVF A;  4HXD A;  2I1K A;  5CHV C;  1IP9 A;  1YD8 U;  3VAW A;  1WR1 A;  3QA8 A;  3PRE A;  4KSK C;  3QAQ A;  1V81 A;  1P98 A;  2AL3 A;  2NVU I;  1WGY A;  3HIZ A;  3PVL A;  3RCZ A;  1P1A A;  4CO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...