1RRBA

The ras-binding domain of raf-1 from rat, nmr, 1 structure
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
NTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
publication title Nuclear magnetic resonance and molecular dynamics studies on the interactions of the Ras-binding domain of Raf-1 with wild-type and mutant Ras proteins.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1rrbA00
4NJ6A 3MHSD 2RD0A 3RULA 1WXSA 2FIDA 3PTFC 3OJ3A 1WXAA 3H6NA 4IWOA 4LCDE 4W9IA 2KKCA 1WE6A 2PJHA 3KUDB 5D6JB 3ZNHB 1AARA 2N7EA 1ZW7A 2OJRA 4FHJA 2LVOA 2WX1A 2D10A 3JYUA 3SD5A 1Q5WB 1GJZA 3VDZA 1IYFA 2D3GA 4N9F4 2DZIA 4GB9A 3JW0X 1V6EA 2M0XA 3ZNGC 3DVNV 1SE9A 4KSLC 4PYUA 1ISNA 1EO6A 3KYDD 3V60A 5EDSA 4LDTB 3A1QA 4EFOA 1K8RB 5J2RA 2KC1A 4KIKA 2LI5A 4EZLA 4B9KA 2GBKA 2Z0DB 4M8MA 3KW5B 3DOWA 2N9XA 5FR6A 3M95A 4IWQA 2BGFA 1D3ZA 3ZDMC 3X23A 2RSUA 4ANVA 2J0MA 4KDLB 4IM3A 3HK0A 4TV3A 1WYWB 2GMIC 2V1YA 3DVGY 4I6NB 3L08A 4DWFA 3PS6A 1PQSA 4AUQC 3DBRI 4NAWB 4WJQA 1WGRA 1GC6A 1V5TA 4HPMB 3AXCA 3O65B 4KZ0A 2BKRB 4GGQA 4GMVA 2N7DA 2KJHB 2GBMA 2DX5B 3PSEB 3PGEA 4W9LA 3SU8X 2O6VB 3VUYA 3RZWC 2LRWA 1Z5SB 2PEAA 3ECIA 1JRUA 2N9PC 2NPTB 3DBLI 4LJOB 4M0WB 4KZCA 3A4RA 4BOZB 1XD3B 2LGDA 3APCA 2L00B 1C1YB 3VUXA 4WJOA 3DBSA 4FJZA 1E90A 4IG7B 2GBNA 4IM0A 1WJUA 1LQBA 5D7GA 3Q3JA 1V9JA 4HLEA 1YX6B 2KJ6A 4XZ4A 2MSED 3EC8A 2MLBA 2LGXA 3MTNB 5DPRA 2FCQA 4FJYA 3UINB 4E74A 1GUAB 2JUOA 2M1MA 4F7ZA 2O2VB 3VTWA 4K1RB 3ZTCA 2O6VA 3PHWB 3MJWA 4IW0A 4YL8A 1GG3A 2FAZA 3V62A 3W1SA 3QHTA 4GN1A 4FA6A 3JSVA 5DPTA 1YIWA 3NZSA 4MGIE 2KWUB 1VD2A 4GIVA 3ZO5B 4AJWA 1WMHA 1WF9A 3VFKA 3PREA 4P7IA 3GOEA 4E71A 3L54A 3BY4B 2AEHA 5CHWA 2V4LA 5E6NA 1LM8B 4GDKB 1WGYA 3IFWB 4TQ1A 1NBFC 4BOSC 2LASA 2O2VA 5CHVC 2WX0A 4KDIC 2BWES 2BWFA 5LXHA 2K25A 3AULA 4OVUA 4URKA 1S1QB 3UGBB 4BVUC 1WX9A 4ZRJA 4W9KA 2G4SA 4W9GA 2HD5B 3R3MA 1UD7A 3IBEA 3PLVA 2IBIB 4GU2A 4W9CA 3OLMD 3VHTC 3L16A 1NI2A 2KTRB 4I6PA 1Y8RC 1LXDA 2Y5BB 2MBOA 3DVNU 4A3OA 3UQAA 3ZIMA 5AZHA 4K7WA 3PV1A 4GDKA 1IPGA 3DDCB 4WQOB 3K9PB 2CHZA 3QIJA 4BKSA 4CYEA 5G2NA 1G6JA 4WWNA 4IUMB 4ASWC 3ZKJC 1KM7A 1E7VA 2J0KA 2Z59B 2KWVB 3L17A 2MRPA 2KWCA 3B0AA 3QJZA 2IY0B 2IO1B 4GOCA 4EKUA 2VRRB 3A1QB 1WI0A 1XQQA 2C7NB 3RT3B 2KO3A 2ZZPB 3M3JA 2EMTA 4KIKB 1P1AA 4MSMB 4A20A 2I1JA 1UZXB 5G55A 4FN2A 4TQ0A 2KTRA 3A4SC 4AJYB 3N32A 3BINA 2BPSA 2KXJA 3ZTDA 3AU4A 1RFAA 2GBRA 2AYOB 5AZFA 1EF1A 2L76A 4TUUA 4NPNA 3ZDTA 2CHWA 3VTVA 3DBHI 1E8WA 3ENEA 3A9JB 2N4FA 4MGZE 4HCPB 3N3KB 1SIFA 3QK0A 4HDQA 2C7MB 4ANWA 1WX8A 5D2MB 1V81A 3UQBA 2LWPA 5AEKB 4DHZE 2KMAA 2XEWA 2UYZB 1V80A 2KMCA 3W1YA 4NQKE 4DHJD 4EZKA 2CKHB 2DZKA 1OTRB 2FIFA 3QC8B 4RM9A 4FBJB 2L05A 4JGHB 4MDKE 2IO3B 3JVZX 2YVCA 3ZLZA 2ZCCA 3PT2B 3NY5A 4MGYE 3VH3B 3ZW3A 1RRBA 1NDDA 2HTHA 3QA8A 1RAXA 1Z2MA 2LJ5A 1X1MA 3A9JA 1FXTB 3OAWA 2N1WA 4G3XB 4NNJB 4WJNA 3V61A 4DXAB 3ZNID 2K6DB 4WWPA 3NZUA 3UIPB 4MSQB 2ASQA 1P3QU 3WA0A 2DAJA 2MW5A 2CR5A 3HIZA 2LUEA 2BYVE 3SDLC 5CHFA 1J19A 4G0NB 2JZ3B 2CS4A 4NJ7A 1R4NI 1UELA 3DPDA 2R2OA 1L2NA 5C23A 4K7UA 3Q3FA 3ZNZB 2CU1A 4ZRIA 1OEYA 4IM2A 3RCZA 1GC7A 4PS8A 4M8NA 1L7YA 3TL5A 2MBQA 1SGHA 2JXXA 1ZGUB 3KUZA 3LJ3A 5KHOA 3R7QA 2KN5A 1E8XA 3JSVB 1VCBA 4K7SA 4XX5A 2KFJA 1KJTA 2KHWB 2ZPNA 1WMHB 2A4ZA 2WYQA 3NOBA 4MEMA 4GXBA 3L10B 2B3AA 3T9LA 1YQBA 1YD8U 1TBEA 3EFUA 4LDTD 3QARA 5J17A 4HDOA 2Z0EB 3PZDA 2M17A 3C0RB 2BKFA 4KVGB 2KX3A 4HXDA 2AL6A 2KDBA 2WWZA 3ZVVA 4BFRA 2FUHB 1P9DU 3L0WB 2XK5A 4FLHA 4W9DA 2PE9A 2AL3A 3A33B 2K8HA 4I6LB 3OJ4B 1TGZB 1J0GA 3RZFA 5JZEB 2ZPYA 2K8CA 2L7RA 2G45B 2JY6A 2REXA 4DHZB 2DAFA 1WH3A 3LDZE 4ANUA 5D94A 4F8CB 1BT0A 1IP9A 4MJSA 4DK5A 2KANA 2N1VA 3RUIB 2MBHA 1UH6A 2NR2A 2KQ7A 3KYCD 1UBIA 5DPWA 2GBJA 4PS3A 4W9EA 4W9HA 1M94A 4B95A 2PE6B 3W1SC 1P0RA 1WM3A 4G50A 4BBNC 5L95C 2ZNVB 3DCGA 2KK8A 3PVLA 3V6EB 2KDEB 4FADA 3D32A 5CX3A 3DVGX 3IG3A 2LXCA 3M63B 4X57B 4DDID 3PPAA 2M4NA 1QZEA 2FCNA 2WDTB 3TIXA 3TCAA 1WIAA 1OGWA 4FHKA 1P98A 2C7HA 1T0YA 3M62B 3TBLD 1Q0WB 1WJNA 3ONSA 3VUWA 3IVFA 2MBEA 3QQ8B 2A5UA 3I3TB 3L13A 4EEWA 3WALA 3U30A 1R4MI 2JRIB 2NBWB 4HCNB 1WGHA 3RD2A 4ZRKA 2MX2A 2K39A 2FNJB 2KJRA 1OQYA 4HPLB 1WXMA 3PRMB 3U7DA 2MA9B 3QX1A 1WJ6A 4KSKC 3VH4B 2N9EB 1GNUA 5DCNA 2HJ8A 4IC7B 3R7RA 2D07B 4II2B 1RLFA 3CSFA 4NY0A 1YJ1A 2ZJDA 2D11A 4EUTA 2I1KA 5J18A 4BKSD 2MWSB 2JT4B 4WJPA 1V49A 3H7SA 4XC2A 2K8BA 2L3ZA 2J0JA 3WAMA 2ZNVC 2C9WB 2BYEA 2KLGA 3NS8A 2IZVB 2D2QA 2QHOA 2KLCA 4MH0E 5L83A 3ZRCA 1WR1A 2IY1B 3RYTA 1EF5A 2RR9A 2ZCBA 1I35A 4ZDVA 3VQIA 2KFKA 3PLUA 3WAOA 2GOWA 3HM3A 1E8YA 1UGMA 3V6CB 4W9JA 2JF5A 2R2QA 2W9NA 4K81A 2PPHA 2KOXA 1WFYA 2NBVB 1WE7A 2JWZA 4NQLB 2LGYA 4ANXA 3H9DA 4DDGD 1V2YA 1WXVA 2AWTA 3A9KB 3N30A 1H4RA 4AOFA 3HM6X 2LRUA 2DENB 2LD9A 5IA7A 3NHEB 2MBBB 3IHPC 1WJ4A 5GMVA 2J7QB 3P2BA 2MCNB 2L0FA 2G4DB 2KD0A 3APFA 2IO0B 3K9OB 5JHAA 3ALBA 3R66C 5KHQA 3H7PB 3QAQA 5DPSA 3UF8A 2XK5B 1WZ0A 4JL9A 4ICUA 3VVWB 2DYMA 3WIMA 3APDA 4GDLB 3WAPA 1LFDA 4G11A 2JZZA 2KDFB 5IAAC 1XT9B 2ZVOA 2YLMA 1E5WA 4FULA 2V3SA 1F9JA 1ZKHA 3A9KA 1WY8A 4WWOA 2OOBB 1I42A 4CO7A 4MJSB 2KVRA 4FJVB 5BO4B 2HE7A 3AU5A 3VAWA 5CTRC 2NCNA 1C3TA 3H7PA 2FCMA 4PS7A 4JIOU 1H8CA 3U8ZA 3ZRFA 3PRPB 1WGDA 2C5LC 2L0TA 2UWQA 4GSWA 4MGKE 4TKNA 4HVBA 2DYBA 2FCSA 4GDLA 5E6PA 1Q1OA 2LVPA 4HWIB 2DZJA 4BKGA 4EOYA 2L8JA 3EHVA 4NAWA 4HK2A 5AZGA 3QCAA 3UIOB 2RPQA 2IYDB 5HKHA 4WAAA 1WGGA 3CSTA 1KOTA 5E6OA 4JLCA 2RGFA 3HHMA 2ZEQA 4KV2A 4MM3A 2MP2B 3KVFB 2DHZA 3PHXB 2IO2B 4MELA 3B08A 4JQWC 3ML8A 5JHBA 1MG8A 3CF6E 1KLVA 2XBBC 1A5RA 3QWZB 2NPTA 2O6VD 2KQSA 3TJPA 5LLIA 3CMMB 4J6IA 2G3QB 3WANA 4F1SA 1E7UA 3KH0A 4RM8A 3X0WA 1YX5B 1HE8A 2LZ6A 3ML9A 4E3CA 4II3B 2DZMA 3VTUA 2KX0A 4AWJA 4BKTA 2M8SA 3VXWA 2LXAA 4HJKA 4ICVA 4AP4C 1V86A 1TZ1A 1V5OA 4CHKA 4BBNF 2BYFA 3B1LX 2MP2A 2K1FA 2KTFA 2BF8B 2DYOA 1WM2A 3EECA 1OEYJ 4DBGA 3TMPB 2JRHA 4DHJB 2NBUA 3KUCB 4IWPA 4A3PA 3PRZA 2ZVNA 1WR6E 5TR5A 3T8MA 3ZUNA 2JVCA 1J8CA 2MQJA 2KNBA 2NS5A 1CMXB 4LJPB 3H1UA 4ZYNA 1S3SG 3S2AA 1WZ3A 1U4AA 2KC2A 2KFKB 4OVVA 2K6QA 3SHQA 5JH5C 4W9FA 1TTNA 4PYZA 2C60A 2KZRA 5C1ZA 1WX7A 3GZNI 2LVQA 2NVUI 2EKEC 3AI5A 4EZJA 1WRDB 1EUVB 2JPHA 2EMSA 4B6WA 3DQVA 1UBQA 1E8ZA 2KDIA 4RMAA 5LXIB 2CHXA
chains in the Genus database with same CATH superfamily
1K52A 2J42A 1KFYB 3C19A 3RNAC 4IWOA 2LFIA 1WE6A 1OFFA 2N7EA 3GZNB 4FHJA 1L6UA 1I4XA 2D3GA 4GB9A 1V6EA 4C00A 3DVNV 1SE9A 3KYDD 4HEA1 2KC1A 4EZLA 3AEGB 3KW5B 3DOWA 3N1YC 3AMZA 2BGFA 2PMVA 3RI7C 3ZDMC 3NVZA 1L6VA 4A9AA 3U7ZA 1D5XC 4AUQC 4NAWB 4RGMA 1C77A 4GGQA 2M19A 4KZ0A 4RF0A 2GBMA 3PSEB 3PGEA 3SU8X 2O6VB 3RNEC 2LRWA 1Z5SB 2LJIA 1JRUA 2N9PC 4LNFA 3DBLI 4OHJA 4KZCA 4BOZB 1SE3A 1XD3B 2LGDA 2PTLA 3APCA 3VUXA 2W3RA 1ESFA 4YWGG 2WQYB 2GBNA 2WLBA 3Q3JA 1V9JA 1YX6B 1FNVA 2LGXA 2FCQA 2JUOA 2O2VB 3N9YC 3T3NA 3VTWA 1IGCA 3ZTCA 2O6VA 3B2FA 4YL8A 2K0PA 1GG3A 2FAZA 3V62A 4RGOS 3W1SA 4GN1A 4AQ7A 3Q8AA 1N63A 3ABVB 4P7IA 4E71A 2GLSA 2V4LA 1LM8B 1GB4A 1WGYA 3FAHA 1TS3A 4OZBA 1JWAD 2O2VA 5CHVC 3HRDD 2JX5A 2BQQA 2MJDA 3W5UB 2HD5B 3IBEA 3LXFA 3U2SC 3L16A 1NI2A 2BYTA 2Y5BB 4A3OA 3SR6A 3UQAA 3ZIMA 5AZHA 3IAS1 2QEJC 5HHDG 2CHZA 4CYEA 5G2NA 4ARIA 4FXCA 2W55A 1TT5B 3ZKJC 2Z59B 3B0AA 2WU5B 1YQ4B 3A1QB 3RT3B 1L5PA 2ZZPB 2EMTA 2I1JA 4NZLB 1BMLC 5HFYA 4O1NA 1XEEA 1RFAA 2N7JA 3VTVA 1E8WA 3A9JB 2N4FA 3N1XC 1T6BX 3KWVA 3N3KB 5D2MB 3UQBA 5AEKB 1YJIA 4DXFA 2SAKA 2CKHB 3QC8B 2Y5CA 1C79A 1PGXA 1IGDA 3MC0B 4JGHB 2IO3B 3PT2B 5HG2A 2BS4B 2HTHA 3QA8A 1RAXA 1JW9D 1GAQB 3A9JA 3OAWA 2N1WA 4G3XB 5HI1A 4S17A 4WWPA 5G5HA 2WDVB 3WA0A 2MW5A 2CR5A 3HIZA 1SIJA 5CHFA 2IGDA 2JZ3B 1UELA 5C23A 3Q3FA 2N0SB 4ZHOA 2CU1A 4IM2A 1GC7A 3IAM1 1HTOA 4M8NA 1L7YA 2MBQA 2JXXA 3LJ3A 2WXRA 3JSVB 1VCBA 4K7SA 2KFJA 2K3UA 3EUB2 5D3IB 4KGRA 2A4ZA 2WYQA 3R2IA 1YQBA 5J17A 4HDOA 2BKFA 4KVGB 2AL6A 2WWZA 3ZVVA 4BFRA 1P9DU 3BVMA 4FLHA 3DHGC 2AL3A 4I6LB 1PGBA 2K8CA 4DHZB 2IJ0A 1F2RC 4ANUA 5D94A 2H89B 2D3BA 3RUIB 1I4PA 4XWTA 2E3TA 2KQ7A 3KYCD 5DPWA 1QQRA 4PS3A 4W9HA 2V4IB 1P0RA 4M02A 5L95C 1L0VB 2YEPB 2KK8A 3MJ5A 4FADA 2WXOA 2WDRB 3Q3OC 3M63B 3UI3A 2WXHA 2M4NA 1QZEA 2FCNA 3NVVA 2PW9A 1T0YA 3ONSA 2A5UA 3L13A 1WGHA 2HJ1A 1AWDA 4MT5A 1STEA 3QX1A 4EE2A 1UUPA 2I38A 2PIAA 4IC7B 2D07B 1ET6A 1V97A 1VRAB 1JCKB 3AN1A 1XXGA 2J0JA 2CJNA 1TKGA 2IZVB 1N5WA 2D2QA 4KKIA 5BYSA 3Q8EA 3J9CA 1I35A 3PLUA 4PK1A 3RNCC 3HM3A 1QF6A 2Q5WD 4P16A 4ITKA 2AWTA 1XO3A 2DENB 2LD9A 3RFZB 3N1ZC 1DGJA 1WJ4A 1KH0A 4JX1C 3AE4B 2FUG1 3NJTA 3AECB 1ZE3D 5T8IA 2DYMA 5C2TB 2WDQB 1LFDA 5IAAC 4L23A 1F9JA 1WY8A 4MJSB 4FJVB 3Q14C 2J52A 2IGGA 1FNWA 3ZRFA 2L0TA 4GSWA 2FCSA 4WH4A 2DZJA 1ZPSA 3BYTB 2GRIA 3UIOB 2RPQA 2IYDB 5E6JA 3I57A 5HKHA 2INCC 5E6OA 4D2KA 4US8A 3MC9A 1SXTA 4L2YA 1JROA 4CQNA 4MELA 3B08A 1FXAA 4JWUC 4A55A 4C80A 3ZXVA 3WANA 4F1SA 1JRPA 5I4DA 1A70A 2BYFA 3AEFB 3B1LX 2KTFA 1SE2A 1WSPA 1BXTA 4IDIA 2MJ3A 3KUCB 3P4PB 4ZYNA 1S3SG 3S2AA 1L0XB 2KC2A 3LB8C 2K6QA 4MACA 4ZYSA 2C60A 5C1ZA 4WQMA 2LVQA 2NVUI 3E56A 4EZJA 1TS2A 1WRDB 1EUVB 1F77A 4B6WA 3DQVA 2KDIA 2LUMA 2MH7A 4NJ6A 1WXSA 2FIDA 3OJ3A 3GE3C 3KQ4A 4IKGA 1ZW7A 2OJRA 2LVOA 1UGJA 4YTMB 3JW0X 3L4PA 3DWGC 3AE6B 1TS5A 4KKJA 1ISNA 1EO6A 4EFOA 5J2RA 4KIKA 1WYGA 3AEAB 2Z0DB 3P42A 4M8MA 2N9XA 2L32A 1D3ZA 3AB5A 3RNFC 2J0MA 4KDLB 3HK0A 4TV3A 2GMIC 2AQ2B 3URYA 3DVGY 4I6NB 2NTSA 4ZRPA 4DWFA 3PS6A 1PQSA 2INNE 3DBRI 4WJQA 1V5TA 3AXCA 2BKRB 4GMVA 2N7DA 1NEKB 2KJHB 2J53A 5BMIA 3EGRA 1YN3A 2PEAA 3EA6A 3PO0A 2NPTB 4LJOB 3SEBA 1C1YB 4LK0M 4WJOA 2L83A 3DBSA 4IG7B 2WP9B 3NS1A 1WJUA 1LQBA 1T5XD 2MSED 3BVZA 3RN9C 3MTNB 5DPRA 1GUAB 4USAA 4HROA 1QLBB 4K1RB 3PHWB 1YJJA 1GB1A 4FA6A 5FR3A 5DPTA 4MGIE 2WS3B 3NZSA 4WWMA 4AJWA 1WMHA 1OQQA 3GOEA 3U4EG 4P6VF 3RPFC 3BY4B 3Q8CA 2AEHA 4DXGA 1C78A 3V3XA 3NZ3A 1NBFC 3ZQ4A 2LASA 3BYYB 2WX0A 1S1QB 4BVUC 1WX9A 4W9KA 1UD7A 2IBIB 4W9CA 1D5ZC 1YN5A 2M0AA 3VHTC 3DVNU 1C4AA 1I7HA 2OHFA 1OQRA 1IPGA 3DDCB 1VZ7A 1AN8A 1G6JA 1QOAA 4WWNA 1KM7A 2KWVB 1FFUA 2ON8A 4LLGM 2IY0B 4GOCA 2C7NB 4MSMB 1P1AA 3KWLA 1EWCA 1NYQA 3FILA 4OVZA 5G55A 2Y3AA 3A4SC 4AJYB 3BINA 2BPSA 2KXJA 1CQVA 1EF1A 2L76A 4TUUA 3ZDTA 3HVDA 1ZDXA 1MPEA 4MGZE 2JWUA 4H2AA 4HDQA 2C7MB 3ZJTA 4DHZE 2PVOD 2CU3A 4NQKE 1ET9A 3JVZX 4OW0A 2WXFA 2JU6X 4J3OD 3ZLZA 2ZCCA 3NY5A 1NDDA 2LJ5A 4R3DA 1D5MC 3V61A 3ZNID 2UU7A 1CK1A 4HRSA 1P3QU 3SDLC 1I4HA 2VH2A 1J19A 4NJ7A 3DPDA 2R2OA 1L2NA 4ZRIA 3RCZA 1MI0A 4PS8A 4ZRQA 1AYFA 1SGHA 3R7QA 3KUZA 2RMMA 1E8XA 5BYQA 4ACFA 1KJTA 2KHWB 2ZPNA 4GXBA 2B3AA 3T9LA 2IGHA 1TBEA 3EFUA 5IOIA 3QARA 4TSSA 3PZDA 1TIFA 3DBLB 2KDBA 4RCOA 2XK5A 1YNTE 2PE9A 3A33B 4NAMA 1SJHD 3OJ4B 3LDZE 2FE8A 4F8CB 1BT0A 1IP9A 1K53A 2INPE 2NR2A 1MVKA 1M94A 2ZNVB 2KDEB 3DVGX 1FMAD 2RDHA 1RM6C 1GPXA 1WIAA 1LO5D 5G5GA 2BS3B 3NRZA 1P7EA 4BAXA 2MBEA 3QQ8B 1XLNA 3U30A 1R4MI 2NBWB 2WU2B 3I5JC 3W9CB 2AQ3B 4ZOHC 2DNFA 3RD2A 4ZRKA 3B2GA 2FNJB 2KJRA 2V0GA 3U7DA 1NENB 4KSKC 2N9EB 2WNMA 5DCNA 2KACA 1I4RA 4YTPB 1SEBD 1TZOA 3E9SA 1WXQA 1RLFA 4II2B 2I2YA 1R4MB 4XC2A 3H7SA 2BYEA 1NVID 1UNSA 2QHOA 2KLCA 3ZRCA 2KDMA 2IY1B 1FPYA 4ZDVA 1HEZE 3AV8A 3VQIA 1EM7A 2KFKA 3WAOA 1UGMA 2R2QA 3P4RB 2G9HD 1WE7A 4NQLB 1V2YA 1WXVA 2XNAC 3N30A 2D3CA 1NYRA 1YOVB 2OEDA 3LYYA 5GMVA 3P2BA 1K50A 2L0FA 3K9OB 3ALBA 5DPSA 4ICUA 3VVWB 1EU4A 1VR9A 1SE4A 3AH7A 2BB5A 1FCCC 1I42A 1PYWD 1YN4A 5BO4B 2NCNA 3U8ZA 3DHIC 1XF5L 2UWQA 4MGKE 4HVBA 2DYBA 1Q1OA 4HWIB 3EHVA 1V1OA 2V9HA 5AZGA 1WGGA 3CSTA 1QOBA 2ZEQA 3AE9B 3PHXB 4JQWC 3ML8A 4M0WA 2O6VD 2IPKD 4JWSC 5LLIA 1E7UA 2GB1A 1HE8A 2LZ6A 3ML9A 1ZDVA 4S0RA 1C76A 3VTUA 4AWJA 4BKTA 1I4QA 3VXWA 3Q69A 3NVWA 4ICVA 4AP4C 1V86A 4RH6A 4XGAB 1DOYA 2V3NA 3EECA 1OEYJ 4DBGA 1KF6B 4GLSC 1PUTA 4BZAA 4C7YA 2ZVNA 1J8CA 2KNBA 3Q8FA 4XDDA 2NS5A 3OG5A 1PGAA 3SHQA 4W9FA 1TTNA 1YQ3B 2CJOA 4PYZA 2KZRA 2EMSA 3N20C 2CHXA 3GS2A 3VR8B 2RD0A 2KQ4X 1WXAA 3WCQA 3R8BA 4LCDE 4W9IA 2KKCA 2QDFA 1AARA 2WX1A 2D10A 4Q2JA 1Q5WB 1GJZA 5EE1A 4N9F4 5LNK1 2M0XA 3MC8A 1EWYC 4TMAB 4KSLC 3V60A 4LDTB 2LI5A 5BMHA 4B9KA 2JYTA 1F2RI 5IP4D 3M95A 1BUIC 4ANVA 1WYWB 3FKYA 2V1YA 3BZDB 4PT5A 1TJEA 4HPMB 4W9LA 2PVGC 2DLBA 2WXQA 4P1BC 2RDGA 1QKZA 2HTME 3A4RA 4KGTA 1JQ4A 4FJZA 1T0RC 1E90A 4IM0A 5D7GA 1TY0A 4N58A 2KJ6A 4XZ4A 2MLBA 2L1AA 2MHJA 2X8XX 1Y56A 3NUHB 2RDBC 2JSVX 4IW0A 4LNNA 3QHTA 1XLQA 2Z8LA 1YIWA 2QIEB 2KWUB 4GIVA 1QILA 1WF9A 4A6QA 4YSZB 5CHWA 5E6NA 4GDKB 4TQ1A 3ZXRA 2Y5PA 4KDIC 2BWES 3RNGC 3AULA 4OVUA 2G4SA 1P7FA 3R3MA 4KX6B 1FEHA 2OJWA 2BT6A 1YMHE 1Y8RC 1LXDA 3Q2AC 2H88B 4GDKA 3K9PB 3QIJA 1N60A 4ASWC 2WXLA 1E7VA 2IO1B 2AQ1B 4EKUA 1MHXA 1WGKA 1WI0A 1XQQA 2KO3A 1JWSD 4KIKB 3M3JA 3Q6BA 1MHHE 4HJGE 4A20A 4TQ0A 4FN2A 3N32A 4LTUA 3AE2B 2AYOB 4NPNA 2CHWA 3DBHI 2YEPF 1XCTL 1HZ6A 4HCPB 1SIFA 1GOZA 2BW2A 2LWPA 1IBXB 1DYQA 5JXVA 5MPOA 2DZKA 3C8YA 2D5GA 4FBJB 2YVCA 4MGYE 1QT9A 3ZW3A 4DXAB 1FXTB 4NNJB 3NZUA 3UIPB 2ASQA 2DAJA 2DBYA 2QCZA 2LUEA 4XE0A 4NJCA 1IBXA 2CS4A 1R4NI 3AE1B 2M56B 2PLPA 4QAYA 1ZP0B 2SEBD 3Q3MC 2MJEA 4C56C 1V1PB 1ZGUB 5KHOA 3DBRB 2KN5A 3TSSA 1D6EC 1R4NB 1WMHB 3FC4A 1E6EB 3L10B 1C4PA 2E6XA 1YD8U 3SFEB 4LDTD 2M17A 5EE0A 3TEZA 1UWXA 2FUHB 3L0WB 2WXMA 4K3CA 4W9DA 1V1PA 4M00A 2K8HA 2NMQA 4JPSA 1FXIA 3RZFA 5JZEB 2L7RA 5C3JB 2VZKB 2J4XA 1KTKA 2DAFA 1WH3A 1E0ZA 1VZ6A 2N1VA 2ICIA 2MBHA 4YSXB 3AE3B 1UBIA 2KT7A 1ACCA 1N6ZA 1NI3A 3W1SC 1WM3A 4WURA 3PVLA 3D32A 3FILB 4X57B 2WDTB 3VRBB 2JQRB 3O13A 2QMTA 1P98A 1FRRA 2C7HA 3TBLD 3VUWA 1K51A 3I3TB 3WALA 4HCNB 2MX2A 4MH8A 1OQYA 3CWIA 1WXMA 4HPLB 3VR9B 2MA9B 2NTTA 1WJ6A 2HJ8A 1L0YB 2AX5A 1J7CA 1ZUD2 2ZJDA 1KLGD 2D11A 2I1KA 5J18A 2JT4B 4WJPA 1E7PB 2K8BA 2WXNA 2L3ZA 3WAMA 2ZNVC 2C9WB 4AS1A 2FBWB 3AE7B 1DOXA 3AE5B 4MH0E 5L83A 1WR1A 2BVCA 4A90A 3RYTA 2RR9A 4B0MA 3TUOA 1HA5A 2LMCA 4RNAA 1F1HA 1SBBB 2JF5A 2W9NA 4K81A 2PPHA 1WFYA 2JWZA 2LGYA 3VRAB 4N59A 4B0EA 4ANXA 3H9DA 1FRDA 3NHEB 1CZPA 2MBBB 4YSYB 3IHPC 2MCNB 3APFA 2G4DB 1SB3C 3TEYA 4WAFA 3R66C 5KHQA 4XDCA 2V3PA 2INDC 3QAQA 3UF8A 1N5XA 2XK5B 4JL9A 3AE8B 3APDA 2JZPA 2QJLA 2JZZA 2W3SA 2YLMA 4FULA 2V3SA 1ZKHA 4WIPA 4WWOA 5AUIA 4MM3B 2HE7A 3AU5A 3VAWA 5CTRC 1L4DB 2FCMA 4JIOU 1H8CA 4K3BA 3PRPB 1Q10A 3IXSA 2C5LC 2WXPA 4RGNA 1RYJA 5H92C 2LVPA 2L8JA 4NAWA 2JXTA 5IO9A 3HUIA 1KOTA 4JLCA 3HHMA 4MM3A 3W2DA 2X38A 1T3QA 5JHBA 3CF6E 1KLVA 3QWZB 4DQOC 2KQSA 3CIRB 3X0WA 2LGSA 4E3CA 4II3B 2DZMA 2KX0A 2M8SA 4HJKA 1TZ1A 4CHKA 4BBNF 2DYOA 1WM2A 3W5VB 2JRHA 4DHJB 3PRZA 1WR6E 3AM9A 5TR5A 2JVCA 4LNOA 1ZXHA 1VLBA 1HZ5A 1CMXB 4LJPB 3H1UA 3B9JA 2KFKB 1U4AA 2QSDA 1KRHA 2VZKD 1MFWA 5FKAC 3H8HA 3ZGZA 2EKEC 3AI5A 2EKIA 4LNKA 2JPHA 1TS4A 1EU3A 1E8ZA 2KYWA 3DHHC 1WGDA 3MHSD 3RULA 3PTFC 4IOIE 3H6NA 4ZHPA 2PJHA 3KUDB 1VJKA 5D6JB 3BIID 3ZNHB 1AW7A 1LGRA 3JYUA 3SD5A 3VDZA 1IYFA 2GI9A 1F52A 3PZ7A 2DZIA 3BVGA 3ZNGC 3ZYYX 4PYUA 5EDSA 2ZW1A 2L52A 3A1QA 5H8YE 1K8RB 4RGTA 2GBKA 4HKZE 2R61A 3OWEB 5FR6A 4N6EB 4IWQA 3X23A 2VH1A 2RSUA 5EE9A 1N62A 2G1EA 4IM3A 2KVZA 3L08A 3TEWA 2LEKA 1JWUD 2RPVA 3MP9A 1WGRA 1GC6A 3GB1A 2WHIA 3O65B 2K9XA 1J7BA 3ZJUA 1MJDA 2DX5B 1FNUA 1FD6A 1ENFA 3RZWC 3VUYA 2LGIA 5IKCM 1FFVA 3ECIA 4M0WB 1XLOA 1B1ZA 2L00B 3Q8BA 1T0QC 2WXGA 4HLEA 3EC8A 4YXDB 5TSSA 4RF1A 2IDYA 4FJYA 3UINB 4E74A 4F7ZA 2M1MA 1XLPA 2BTEA 3MJWA 5FK9C 1HQRD 3JSVA 2ONQA 1VD2A 3AEBB 3ZO5B 2DWQA 3VFKA 2BS2B 3PREA 3L54A 2ACZB 3GE8C 3IFWB 3NVYA 4BOSC 4US9A 2WXJA 4HKQA 2BWFA 3EFCA 5LXHA 2K25A 4URKA 3UGBB 2W82A 4ZRJA 5AUKA 1VZ8A 4W9GA 1JWBD 3PLVA 4GU2A 3OLMD 2ZW0A 3KLSX 2KMMA 2KTRB 4I6PA 2MBOA 4YTNB 1JWMD 5IN7A 2JYEA 4K7WA 3PV1A 2KAJA 4WQOB 2K5PA 4RFBA 4BKSA 4IUMB 4LNIA 2J0KA 3L17A 2MRPA 2KWCA 3QJZA 2VRRB 1SSNA 1UZXB 2KTRA 3BWUD 3ZTDA 3AU4A 2GBRA 1C4CA 5AZFA 3ENEA 1FIQA 1D4BA 2LHEA 1JMLA 1M4VA 5GXGB 3QK0A 4ANWA 1WX8A 1V81A 2KMAA 2XEWA 4REZA 2UYZB 3ZJVA 1V80A 2KMCA 3W1YA 2BB6A 4DHJD 4EZKA 3RNBC 3U52E 2FIFA 1OTRB 4RM9A 4M01A 2L05A 4JE3B 4MDKE 3VH3B 1RRBA 2WXIA 1ZXIA 1VDVA 1Z2MA 1X1MA 4WJNA 2K6DB 4MSQB 2BYVE 4G0NB 3DWMA 4K7UA 3ZNZB 1R7SA 1OEYA 2BBCA 2XN9C 1PDXA 3TL5A 3MHZA 4XX5A 3NOBA 4MEMA 2Z0EB 3C0RB 3P63A 2KX3A 4HXDA 3HVZA 1RWSA 3TEXA 4UDUC 3I9V1 1TGZB 4A8XC 1J0GA 1L4ZB 2ZPYA 2REXA 4OZCA 2G45B 2JY6A 4OZAA 2QC8A 3MFGA 3BK1A 4C4VB 3R2TA 4MJSA 3AEEB 2KANA 4DK5A 1DOIA 2KWDA 1UH6A 1TYGB 1HXYD 2GBJA 4W9EA 4B95A 2PE6B 1TKEA 4G50A 4BBNC 2D3AA 3DCGA 3I63C 3V6EB 5CX3A 3ETRA 3IG3A 2LXCA 4DDID 3PPAA 3TIXA 1RFKA 3TCAA 4C4VA 1OGWA 4FHKA 2K22A 3M62B 1Q0WB 1WJNA 2WXKA 3IVFA 1XCQL 3AEDB 1ROEA 4EEWA 1FCLA 2JRIB 1SF0A 2K39A 2KN4A 3IT6B 3PZ8A 3PRMB 4YT0B 3VH4B 5BYRA 3IT4B 1GNUA 2EELA 1TKYA 3R7RA 3CSFA 4NY0A 1V8CA 1YJ1A 4EUTA 4BKSD 2MWSB 1V49A 1E10A 2KLGA 3NS8A 1WWTA 1EF5A 2ZCBA 1N61A 3DBHB 1SJED 3P4QB 2GOWA 1E8YA 4L1BA 3RMKC 3V6CB 4W9JA 1F0ZA 2KOXA 1IUEA 2NBVB 1E9MA 4KGSA 4DDGD 3A9KB 1H4RA 3SFDB 4AOFA 3HM6X 2LRUA 2PKOA 5IA7A 1UF0A 1FO4A 1ZOYB 1C9FA 2J7QB 1TY2A 3GP7A 1KLUD 2KD0A 5JHAA 2IO0B 2N9KA 4HPPA 3H7PB 2N9LA 1QOGA 1WZ0A 4C7ZA 2B76B 5BMGA 3WIMA 4GDLB 3WAPA 4G11A 2KDFB 1XT9B 2ZVOA 1E5WA 4ARCA 4P1CC 3A9KA 5EE3A 2OOBB 4CO7A 3NG0A 2KVRA 1PFDA 1C3TA 3H7PA 4PS7A 4TKNA 1JALA 4GDLA 5E6PA 2WGSA 3BK2A 4BKGA 4EOYA 4HK2A 1CJEA 3QCAA 1WRIA 4WAAA 5D3DA 3P4SB 2HDEA 2RGFA 4KV2A 2MP2B 3KVFB 2DHZA 2LHDA 2IO2B 1MG8A 2XBBC 1A5RA 3P1MA 2NPTA 4XYCA 3T3OA 2QILA 1UWMA 3TJPA 3CMMB 2TSSA 2G3QB 4J6IA 3KH0A 4RM8A 1YX5B 1I4GA 2LXAA 1V5OA 1T0SC 4XWWA 2MP2A 1QOFA 2K1FA 2BF8B 1FM0D 3V05A 1B9RA 3TMPB 2NBUA 4A3PA 4IWPA 2W54A 3ZUNA 3T8MA 1MG4A 1HTQA 2MQJA 1WZ3A 3Q3NC 4OVVA 5JH5C 2MEKA 1WX7A 3GZNI 1J7AA 1UBQA 4RMAA 5LXIB
chains in the Genus database with same CATH topology
4NJ6A 3MHSD 2RD0A 3RULA 1WXSA 2FIDA 3PTFC 3OJ3A 1WXAA 3H6NA 4IWOA 4LCDE 4W9IA 2KKCA 1WE6A 2PJHA 3KUDB 5D6JB 3ZNHB 1AARA 2N7EA 1ZW7A 2OJRA 4FHJA 2LVOA 2WX1A 2D10A 3JYUA 3SD5A 1Q5WB 1GJZA 3VDZA 1IYFA 2D3GA 4N9F4 2DZIA 4GB9A 3JW0X 1V6EA 2M0XA 3ZNGC 3DVNV 1SE9A 4KSLC 4PYUA 1ISNA 1EO6A 3KYDD 3V60A 5EDSA 4LDTB 3A1QA 4EFOA 1K8RB 5J2RA 2KC1A 4KIKA 2LI5A 4EZLA 4B9KA 2GBKA 2Z0DB 4M8MA 3KW5B 3DOWA 2N9XA 5FR6A 3M95A 4IWQA 2BGFA 1D3ZA 3ZDMC 3X23A 2RSUA 4ANVA 2J0MA 4KDLB 4IM3A 3HK0A 4TV3A 1WYWB 2GMIC 2V1YA 3DVGY 4I6NB 3L08A 4DWFA 3PS6A 1PQSA 4AUQC 3DBRI 4NAWB 4WJQA 1WGRA 1GC6A 1V5TA 4HPMB 3AXCA 3O65B 4KZ0A 2BKRB 4GGQA 4GMVA 2N7DA 2KJHB 2GBMA 2DX5B 3PSEB 3PGEA 4W9LA 3SU8X 2O6VB 3VUYA 3RZWC 2LRWA 1Z5SB 2PEAA 3ECIA 1JRUA 2N9PC 2NPTB 3DBLI 4LJOB 4M0WB 4KZCA 3A4RA 4BOZB 1XD3B 2LGDA 3APCA 2L00B 1C1YB 3VUXA 4WJOA 3DBSA 4FJZA 1E90A 4IG7B 2GBNA 4IM0A 1WJUA 1LQBA 5D7GA 3Q3JA 1V9JA 4HLEA 1YX6B 2KJ6A 4XZ4A 2MSED 3EC8A 2MLBA 2LGXA 3MTNB 5DPRA 2FCQA 4FJYA 3UINB 4E74A 1GUAB 2JUOA 2M1MA 4F7ZA 2O2VB 3VTWA 4K1RB 3ZTCA 2O6VA 3PHWB 3MJWA 4IW0A 4YL8A 1GG3A 2FAZA 3V62A 3W1SA 3QHTA 4GN1A 4FA6A 3JSVA 5DPTA 1YIWA 3NZSA 4MGIE 2KWUB 1VD2A 4GIVA 3ZO5B 4AJWA 1WMHA 1WF9A 3VFKA 3PREA 4P7IA 3GOEA 4E71A 3L54A 3BY4B 2AEHA 5CHWA 2V4LA 5E6NA 1LM8B 4GDKB 1WGYA 3IFWB 4TQ1A 1NBFC 4BOSC 2LASA 2O2VA 5CHVC 2WX0A 4KDIC 2BWES 2BWFA 5LXHA 2K25A 3AULA 4OVUA 4URKA 1S1QB 3UGBB 4BVUC 1WX9A 4ZRJA 4W9KA 2G4SA 4W9GA 2HD5B 3R3MA 1UD7A 3IBEA 3PLVA 2IBIB 4GU2A 4W9CA 3OLMD 3VHTC 3L16A 1NI2A 2KTRB 4I6PA 1Y8RC 1LXDA 2Y5BB 2MBOA 3DVNU 4A3OA 3UQAA 3ZIMA 5AZHA 4K7WA 3PV1A 4GDKA 1IPGA 3DDCB 4WQOB 3K9PB 2CHZA 3QIJA 4BKSA 4CYEA 5G2NA 1G6JA 4WWNA 4IUMB 4ASWC 3ZKJC 1KM7A 1E7VA 2J0KA 2Z59B 2KWVB 3L17A 2MRPA 2KWCA 3B0AA 3QJZA 2IY0B 2IO1B 4GOCA 4EKUA 2VRRB 3A1QB 1WI0A 1XQQA 2C7NB 3RT3B 2KO3A 2ZZPB 3M3JA 2EMTA 4KIKB 1P1AA 4MSMB 4A20A 2I1JA 1UZXB 5G55A 4FN2A 4TQ0A 2KTRA 3A4SC 4AJYB 3N32A 3BINA 2BPSA 2KXJA 3ZTDA 3AU4A 1RFAA 2GBRA 2AYOB 5AZFA 1EF1A 2L76A 4TUUA 4NPNA 3ZDTA 2CHWA 3VTVA 3DBHI 1E8WA 3ENEA 3A9JB 2N4FA 4MGZE 4HCPB 3N3KB 1SIFA 3QK0A 4HDQA 2C7MB 4ANWA 1WX8A 5D2MB 1V81A 3UQBA 2LWPA 5AEKB 4DHZE 2KMAA 2XEWA 2UYZB 1V80A 2KMCA 3W1YA 4NQKE 4DHJD 4EZKA 2CKHB 2DZKA 1OTRB 2FIFA 3QC8B 4RM9A 4FBJB 2L05A 4JGHB 4MDKE 2IO3B 3JVZX 2YVCA 3ZLZA 2ZCCA 3PT2B 3NY5A 4MGYE 3VH3B 3ZW3A 1RRBA 1NDDA 2HTHA 3QA8A 1RAXA 1Z2MA 2LJ5A 1X1MA 3A9JA 1FXTB 3OAWA 2N1WA 4G3XB 4NNJB 4WJNA 3V61A 4DXAB 3ZNID 2K6DB 4WWPA 3NZUA 3UIPB 4MSQB 2ASQA 1P3QU 3WA0A 2DAJA 2MW5A 2CR5A 3HIZA 2LUEA 2BYVE 3SDLC 5CHFA 1J19A 4G0NB 2JZ3B 2CS4A 4NJ7A 1R4NI 1UELA 3DPDA 2R2OA 1L2NA 5C23A 4K7UA 3Q3FA 3ZNZB 2CU1A 4ZRIA 1OEYA 4IM2A 3RCZA 1GC7A 4PS8A 4M8NA 1L7YA 3TL5A 2MBQA 1SGHA 2JXXA 1ZGUB 3KUZA 3LJ3A 5KHOA 3R7QA 2KN5A 1E8XA 3JSVB 1VCBA 4K7SA 4XX5A 2KFJA 1KJTA 2KHWB 2ZPNA 1WMHB 2A4ZA 2WYQA 3NOBA 4MEMA 4GXBA 3L10B 2B3AA 3T9LA 1YQBA 1YD8U 1TBEA 3EFUA 4LDTD 3QARA 5J17A 4HDOA 2Z0EB 3PZDA 2M17A 3C0RB 2BKFA 4KVGB 2KX3A 4HXDA 2AL6A 2KDBA 2WWZA 3ZVVA 4BFRA 2FUHB 1P9DU 3L0WB 2XK5A 4FLHA 4W9DA 2PE9A 2AL3A 3A33B 2K8HA 4I6LB 3OJ4B 1TGZB 1J0GA 3RZFA 5JZEB 2ZPYA 2K8CA 2L7RA 2G45B 2JY6A 2REXA 4DHZB 2DAFA 1WH3A 3LDZE 4ANUA 5D94A 4F8CB 1BT0A 1IP9A 4MJSA 4DK5A 2KANA 2N1VA 3RUIB 2MBHA 1UH6A 2NR2A 2KQ7A 3KYCD 1UBIA 5DPWA 2GBJA 4PS3A 4W9EA 4W9HA 1M94A 4B95A 2PE6B 3W1SC 1P0RA 1WM3A 4G50A 4BBNC 5L95C 2ZNVB 3DCGA 2KK8A 3PVLA 3V6EB 2KDEB 4FADA 3D32A 5CX3A 3DVGX 3IG3A 2LXCA 3M63B 4X57B 4DDID 3PPAA 2M4NA 1QZEA 2FCNA 2WDTB 3TIXA 3TCAA 1WIAA 1OGWA 4FHKA 1P98A 2C7HA 1T0YA 3M62B 3TBLD 1Q0WB 1WJNA 3ONSA 3VUWA 3IVFA 2MBEA 3QQ8B 2A5UA 3I3TB 3L13A 4EEWA 3WALA 3U30A 1R4MI 2JRIB 2NBWB 4HCNB 1WGHA 3RD2A 4ZRKA 2MX2A 2K39A 2FNJB 2KJRA 1OQYA 4HPLB 1WXMA 3PRMB 3U7DA 2MA9B 3QX1A 1WJ6A 4KSKC 3VH4B 2N9EB 1GNUA 5DCNA 2HJ8A 4IC7B 3R7RA 2D07B 4II2B 1RLFA 3CSFA 4NY0A 1YJ1A 2ZJDA 2D11A 4EUTA 2I1KA 5J18A 4BKSD 2MWSB 2JT4B 4WJPA 1V49A 3H7SA 4XC2A 2K8BA 2L3ZA 2J0JA 3WAMA 2ZNVC 2C9WB 2BYEA 2KLGA 3NS8A 2IZVB 2D2QA 2QHOA 2KLCA 4MH0E 5L83A 3ZRCA 1WR1A 2IY1B 3RYTA 1EF5A 2RR9A 2ZCBA 1I35A 4ZDVA 3VQIA 2KFKA 3PLUA 3WAOA 2GOWA 3HM3A 1E8YA 1UGMA 3V6CB 4W9JA 2JF5A 2R2QA 2W9NA 4K81A 2PPHA 2KOXA 1WFYA 2NBVB 1WE7A 2JWZA 4NQLB 2LGYA 4ANXA 3H9DA 4DDGD 1V2YA 1WXVA 2AWTA 3A9KB 3N30A 1H4RA 4AOFA 3HM6X 2LRUA 2DENB 2LD9A 5IA7A 3NHEB 2MBBB 3IHPC 1WJ4A 5GMVA 2J7QB 3P2BA 2MCNB 2L0FA 2G4DB 2KD0A 3APFA 2IO0B 3K9OB 5JHAA 3ALBA 3R66C 5KHQA 3H7PB 3QAQA 5DPSA 3UF8A 2XK5B 1WZ0A 4JL9A 4ICUA 3VVWB 2DYMA 3WIMA 3APDA 4GDLB 3WAPA 1LFDA 4G11A 2JZZA 2KDFB 5IAAC 1XT9B 2ZVOA 2YLMA 1E5WA 4FULA 2V3SA 1F9JA 1ZKHA 3A9KA 1WY8A 4WWOA 2OOBB 1I42A 4CO7A 4MJSB 2KVRA 4FJVB 5BO4B 2HE7A 3AU5A 3VAWA 5CTRC 2NCNA 1C3TA 3H7PA 2FCMA 4PS7A 4JIOU 1H8CA 3U8ZA 3ZRFA 3PRPB 1WGDA 2C5LC 2L0TA 2UWQA 4GSWA 4MGKE 4TKNA 4HVBA 2DYBA 2FCSA 4GDLA 5E6PA 1Q1OA 2LVPA 4HWIB 2DZJA 4BKGA 4EOYA 2L8JA 3EHVA 4NAWA 4HK2A 5AZGA 3QCAA 3UIOB 2RPQA 2IYDB 5HKHA 4WAAA 1WGGA 3CSTA 1KOTA 5E6OA 4JLCA 2RGFA 3HHMA 2ZEQA 4KV2A 4MM3A 2MP2B 3KVFB 2DHZA 3PHXB 2IO2B 4MELA 3B08A 4JQWC 3ML8A 5JHBA 1MG8A 3CF6E 1KLVA 2XBBC 1A5RA 3QWZB 2NPTA 2O6VD 2KQSA 3TJPA 5LLIA 3CMMB 4J6IA 2G3QB 3WANA 4F1SA 1E7UA 3KH0A 4RM8A 3X0WA 1YX5B 1HE8A 2LZ6A 3ML9A 4E3CA 4II3B 2DZMA 3VTUA 2KX0A 4AWJA 4BKTA 2M8SA 3VXWA 2LXAA 4HJKA 4ICVA 4AP4C 1V86A 1TZ1A 1V5OA 4CHKA 4BBNF 2BYFA 3B1LX 2MP2A 2K1FA 2KTFA 2BF8B 2DYOA 1WM2A 3EECA 1OEYJ 4DBGA 3TMPB 2JRHA 4DHJB 2NBUA 3KUCB 4IWPA 4A3PA 3PRZA 2ZVNA 1WR6E 5TR5A 3T8MA 3ZUNA 2JVCA 1J8CA 2MQJA 2KNBA 2NS5A 1CMXB 4LJPB 3H1UA 4ZYNA 1S3SG 3S2AA 1WZ3A 1U4AA 2KC2A 2KFKB 4OVVA 2K6QA 3SHQA 5JH5C 4W9FA 1TTNA 4PYZA 2C60A 2KZRA 5C1ZA 1WX7A 3GZNI 2LVQA 2NVUI 2EKEC 3AI5A 4EZJA 1WRDB 1EUVB 2JPHA 2EMSA 4B6WA 3DQVA 1UBQA 1E8ZA 2KDIA 4RMAA 5LXIB 2CHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ6 A;  3MHS D;  2RD0 A;  3RUL A;  1WXS A;  2FID A;  3PTF C;  3OJ3 A;  1WXA A;  3H6N A;  4IWO A;  4LCD E;  4W9I A;  2KKC A;  1WE6 A;  2PJH A;  3KUD B;  5D6J B;  3ZNH B;  1AAR A;  2N7E A;  1ZW7 A;  2OJR A;  4FHJ A;  2LVO A;  2WX1 A;  2D10 A;  3JYU A;  3SD5 A;  1Q5W B;  1GJZ A;  3VDZ A;  1IYF A;  2D3G A;  4N9F 4;  2DZI A;  4GB9 A;  3JW0 X;  1V6E A;  2M0X A;  3ZNG C;  3DVN V;  1SE9 A;  4KSL C;  4PYU A;  1ISN A;  1EO6 A;  3KYD D;  3V60 A;  5EDS A;  4LDT B;  3A1Q A;  4EFO A;  1K8R B;  5J2R A;  2KC1 A;  4KIK A;  2LI5 A;  4EZL A;  4B9K A;  2GBK A;  2Z0D B;  4M8M A;  3KW5 B;  3DOW A;  2N9X A;  5FR6 A;  3M95 A;  4IWQ A;  2BGF A;  1D3Z A;  3ZDM C;  3X23 A;  2RSU A;  4ANV A;  2J0M A;  4KDL B;  4IM3 A;  3HK0 A;  4TV3 A;  1WYW B;  2GMI C;  2V1Y A;  3DVG Y;  4I6N B;  3L08 A;  4DWF A;  3PS6 A;  1PQS A;  4AUQ C;  3DBR I;  4NAW B;  4WJQ A;  1WGR A;  1GC6 A;  1V5T A;  4HPM B;  3AXC A;  3O65 B;  4KZ0 A;  2BKR B;  4GGQ A;  4GMV A;  2N7D A;  2KJH B;  2GBM A;  2DX5 B;  3PSE B;  3PGE A;  4W9L A;  3SU8 X;  2O6V B;  3VUY A;  3RZW C;  2LRW A;  1Z5S B;  2PEA A;  3ECI A;  1JRU A;  2N9P C;  2NPT B;  3DBL I;  4LJO B;  4M0W B;  4KZC A;  3A4R A;  4BOZ B;  1XD3 B;  2LGD A;  3APC A;  2L00 B;  1C1Y B;  3VUX A;  4WJO A;  3DBS A;  4FJZ A;  1E90 A;  4IG7 B;  2GBN A;  4IM0 A;  1WJU A;  1LQB A;  5D7G A;  3Q3J A;  1V9J A;  4HLE A;  1YX6 B;  2KJ6 A;  4XZ4 A;  2MSE D;  3EC8 A;  2MLB A;  2LGX A;  3MTN B;  5DPR A;  2FCQ A;  4FJY A;  3UIN B;  4E74 A;  1GUA B;  2JUO A;  2M1M A;  4F7Z A;  2O2V B;  3VTW A;  4K1R B;  3ZTC A;  2O6V A;  3PHW B;  3MJW A;  4IW0 A;  4YL8 A;  1GG3 A;  2FAZ A;  3V62 A;  3W1S A;  3QHT A;  4GN1 A;  4FA6 A;  3JSV A;  5DPT A;  1YIW A;  3NZS A;  4MGI E;  2KWU B;  1VD2 A;  4GIV A;  3ZO5 B;  4AJW A;  1WMH A;  1WF9 A;  3VFK A;  3PRE A;  4P7I A;  3GOE A;  4E71 A;  3L54 A;  3BY4 B;  2AEH A;  5CHW A;  2V4L A;  5E6N A;  1LM8 B;  4GDK B;  1WGY A;  3IFW B;  4TQ1 A;  1NBF C;  4BOS C;  2LAS A;  2O2V A;  5CHV C;  2WX0 A;  4KDI C;  2BWE S;  2BWF A;  5LXH A;  2K25 A;  3AUL A;  4OVU A;  4URK A;  1S1Q B;  3UGB B;  4BVU C;  1WX9 A;  4ZRJ A;  4W9K A;  2G4S A;  4W9G A;  2HD5 B;  3R3M A;  1UD7 A;  3IBE A;  3PLV A;  2IBI B;  4GU2 A;  4W9C A;  3OLM D;  3VHT C;  3L16 A;  1NI2 A;  2KTR B;  4I6P A;  1Y8R C;  1LXD A;  2Y5B B;  2MBO A;  3DVN U;  4A3O A;  3UQA A;  3ZIM A;  5AZH A;  4K7W A;  3PV1 A;  4GDK A;  1IPG A;  3DDC B;  4WQO B;  3K9P B;  2CHZ A;  3QIJ A;  4BKS A;  4CYE A;  5G2N A;  1G6J A;  4WWN A;  4IUM B;  4ASW C;  3ZKJ C;  1KM7 A;  1E7V A;  2J0K A;  2Z59 B;  2KWV B;  3L17 A;  2MRP A;  2KWC A;  3B0A A;  3QJZ A;  2IY0 B;  2IO1 B;  4GOC A;  4EKU A;  2VRR B;  3A1Q B;  1WI0 A;  1XQQ A;  2C7N B;  3RT3 B;  2KO3 A;  2ZZP B;  3M3J A;  2EMT A;  4KIK B;  1P1A A;  4MSM B;  4A20 A;  2I1J A;  1UZX B;  5G55 A;  4FN2 A;  4TQ0 A;  2KTR A;  3A4S C;  4AJY B;  3N32 A;  3BIN A;  2BPS A;  2KXJ A;  3ZTD A;  3AU4 A;  1RFA A;  2GBR A;  2AYO B;  5AZF A;  1EF1 A;  2L76 A;  4TUU A;  4NPN A;  3ZDT A;  2CHW A;  3VTV A;  3DBH I;  1E8W A;  3ENE A;  3A9J B;  2N4F A;  4MGZ E;  4HCP B;  3N3K B;  1SIF A;  3QK0 A;  4HDQ A;  2C7M B;  4ANW A;  1WX8 A;  5D2M B;  1V81 A;  3UQB A;  2LWP A;  5AEK B;  4DHZ E;  2KMA A;  2XEW A;  2UYZ B;  1V80 A;  2KMC A;  3W1Y A;  4NQK E;  4DHJ D;  4EZK A;  2CKH B;  2DZK A;  1OTR B;  2FIF A;  3QC8 B;  4RM9 A;  4FBJ B;  2L05 A;  4JGH B;  4MDK E;  2IO3 B;  3JVZ X;  2YVC A;  3ZLZ A;  2ZCC A;  3PT2 B;  3NY5 A;  4MGY E;  3VH3 B;  3ZW3 A;  1RRB A;  1NDD A;  2HTH A;  3QA8 A;  1RAX A;  1Z2M A;  2LJ5 A;  1X1M A;  3A9J A;  1FXT B;  3OAW A;  2N1W A;  4G3X B;  4NNJ B;  4WJN A;  3V61 A;  4DXA B;  3ZNI D;  2K6D B;  4WWP A;  3NZU A;  3UIP B;  4MSQ B;  2ASQ A;  1P3Q U;  3WA0 A;  2DAJ A;  2MW5 A;  2CR5 A;  3HIZ A;  2LUE A;  2BYV E;  3SDL C;  5CHF A;  1J19 A;  4G0N B;  2JZ3 B;  2CS4 A;  4NJ7 A;  1R4N I;  1UEL A;  3DPD A;  2R2O A;  1L2N A;  5C23 A;  4K7U A;  3Q3F A;  3ZNZ B;  2CU1 A;  4ZRI A;  1OEY A;  4IM2 A;  3RCZ A;  1GC7 A;  4PS8 A;  4M8N A;  1L7Y A;  3TL5 A;  2MBQ A;  1SGH A;  2JXX A;  1ZGU B;  3KUZ A;  3LJ3 A;  5KHO A;  3R7Q A;  2KN5 A;  1E8X A;  3JSV B;  1VCB A;  4K7S A;  4XX5 A;  2KFJ A;  1KJT A;  2KHW B;  2ZPN A;  1WMH B;  2A4Z A;  2WYQ A;  3NOB A;  4MEM A;  4GXB A;  3L10 B;  2B3A A;  3T9L A;  1YQB A;  1YD8 U;  1TBE A;  3EFU A;  4LDT D;  3QAR A;  5J17 A;  4HDO A;  2Z0E B;  3PZD A;  2M17 A;  3C0R B;  2BKF A;  4KVG B;  2KX3 A;  4HXD A;  2AL6 A;  2KDB A;  2WWZ A;  3ZVV A;  4BFR A;  2FUH B;  1P9D U;  3L0W B;  2XK5 A;  4FLH A;  4W9D A;  2PE9 A;  2AL3 A;  3A33 B;  2K8H A;  4I6L B;  3OJ4 B;  1TGZ B;  1J0G A;  3RZF A;  5JZE B;  2ZPY A;  2K8C A;  2L7R A;  2G45 B;  2JY6 A;  2REX A;  4DHZ B;  2DAF A;  1WH3 A;  3LDZ E;  4ANU A;  5D94 A;  4F8C B;  1BT0 A;  1IP9 A;  4MJS A;  4DK5 A;  2KAN A;  2N1V A;  3RUI B;  2MBH A;  1UH6 A;  2NR2 A;  2KQ7 A;  3KYC D;  1UBI A;  5DPW A;  2GBJ A;  4PS3 A;  4W9E A;  4W9H A;  1M94 A;  4B95 A;  2PE6 B;  3W1S C;  1P0R A;  1WM3 A;  4G50 A;  4BBN C;  5L95 C;  2ZNV B;  3DCG A;  2KK8 A;  3PVL A;  3V6E B;  2KDE B;  4FAD A;  3D32 A;  5CX3 A;  3DVG X;  3IG3 A;  2LXC A;  3M63 B;  4X57 B;  4DDI D;  3PPA A;  2M4N A;  1QZE A;  2FCN A;  2WDT B;  3TIX A;  3TCA A;  1WIA A;  1OGW A;  4FHK A;  1P98 A;  2C7H A;  1T0Y A;  3M62 B;  3TBL D;  1Q0W B;  1WJN A;  3ONS A;  3VUW A;  3IVF A;  2MBE A;  3QQ8 B;  2A5U A;  3I3T B;  3L13 A;  4EEW A;  3WAL A;  3U30 A;  1R4M I;  2JRI B;  2NBW B;  4HCN B;  1WGH A;  3RD2 A;  4ZRK A;  2MX2 A;  2K39 A;  2FNJ B;  2KJR A;  1OQY A;  4HPL B;  1WXM A;  3PRM B;  3U7D A;  2MA9 B;  3QX1 A;  1WJ6 A;  4KSK C;  3VH4 B;  2N9E B;  1GNU A;  5DCN A;  2HJ8 A;  4IC7 B;  3R7R A;  2D07 B;  4II2 B;  1RLF A;  3CSF A;  4NY0 A;  1YJ1 A;  2ZJD A;  2D11 A;  4EUT A;  2I1K A;  5J18 A;  4BKS D;  2MWS B;  2JT4 B;  4WJP A;  1V49 A;  3H7S A;  4XC2 A;  2K8B A;  2L3Z A;  2J0J A;  3WAM A;  2ZNV C;  2C9W B;  2BYE A;  2KLG A;  3NS8 A;  2IZV B;  2D2Q A;  2QHO A;  2KLC A;  4MH0 E;  5L83 A;  3ZRC A;  1WR1 A;  2IY1 B;  3RYT A;  1EF5 A;  2RR9 A;  2ZCB A;  1I35 A;  4ZDV A;  3VQI A;  2KFK A;  3PLU A;  3WAO A;  2GOW A;  3HM3 A;  1E8Y A;  1UGM A;  3V6C B;  4W9J A;  2JF5 A;  2R2Q A;  2W9N A;  4K81 A;  2PPH A;  2KOX A;  1WFY A;  2NBV B;  1WE7 A;  2JWZ A;  4NQL B;  2LGY A;  4ANX A;  3H9D A;  4DDG D;  1V2Y A;  1WXV A;  2AWT A;  3A9K B;  3N30 A;  1H4R A;  4AOF A;  3HM6 X;  2LRU A;  2DEN B;  2LD9 A;  5IA7 A;  3NHE B;  2MBB B;  3IHP C;  1WJ4 A;  5GMV A;  2J7Q B;  3P2B A;  2MCN B;  2L0F A;  2G4D B;  2KD0 A;  3APF A;  2IO0 B;  3K9O B;  5JHA A;  3ALB A;  3R66 C;  5KHQ A;  3H7P B;  3QAQ A;  5DPS A;  3UF8 A;  2XK5 B;  1WZ0 A;  4JL9 A;  4ICU A;  3VVW B;  2DYM A;  3WIM A;  3APD A;  4GDL B;  3WAP A;  1LFD A;  4G11 A;  2JZZ A;  2KDF B;  5IAA C;  1XT9 B;  2ZVO A;  2YLM A;  1E5W A;  4FUL A;  2V3S A;  1F9J A;  1ZKH A;  3A9K A;  1WY8 A;  4WWO A;  2OOB B;  1I42 A;  4CO7 A;  4MJS B;  2KVR A;  4FJV B;  5BO4 B;  2HE7 A;  3AU5 A;  3VAW A;  5CTR C;  2NCN A;  1C3T A;  3H7P A;  2FCM A;  4PS7 A;  4JIO U;  1H8C A;  3U8Z A;  3ZRF A;  3PRP B;  1WGD A;  2C5L C;  2L0T A;  2UWQ A;  4GSW A;  4MGK E;  4TKN A;  4HVB A;  2DYB A;  2FCS A;  4GDL A;  5E6P A;  1Q1O A;  2LVP A;  4HWI B;  2DZJ A;  4BKG A;  4EOY A;  2L8J A;  3EHV A;  4NAW A;  4HK2 A;  5AZG A;  3QCA A;  3UIO B;  2RPQ A;  2IYD B;  5HKH A;  4WAA A;  1WGG A;  3CST A;  1KOT A;  5E6O A;  4JLC A;  2RGF A;  3HHM A;  2ZEQ A;  4KV2 A;  4MM3 A;  2MP2 B;  3KVF B;  2DHZ A;  3PHX B;  2IO2 B;  4MEL A;  3B08 A;  4JQW C;  3ML8 A;  5JHB A;  1MG8 A;  3CF6 E;  1KLV A;  2XBB C;  1A5R A;  3QWZ B;  2NPT A;  2O6V D;  2KQS A;  3TJP A;  5LLI A;  3CMM B;  4J6I A;  2G3Q B;  3WAN A;  4F1S A;  1E7U A;  3KH0 A;  4RM8 A;  3X0W A;  1YX5 B;  1HE8 A;  2LZ6 A;  3ML9 A;  4E3C A;  4II3 B;  2DZM A;  3VTU A;  2KX0 A;  4AWJ A;  4BKT A;  2M8S A;  3VXW A;  2LXA A;  4HJK A;  4ICV A;  4AP4 C;  1V86 A;  1TZ1 A;  1V5O A;  4CHK A;  4BBN F;  2BYF A;  3B1L X;  2MP2 A;  2K1F A;  2KTF A;  2BF8 B;  2DYO A;  1WM2 A;  3EEC A;  1OEY J;  4DBG A;  3TMP B;  2JRH A;  4DHJ B;  2NBU A;  3KUC B;  4IWP A;  4A3P A;  3PRZ A;  2ZVN A;  1WR6 E;  5TR5 A;  3T8M A;  3ZUN A;  2JVC A;  1J8C A;  2MQJ A;  2KNB A;  2NS5 A;  1CMX B;  4LJP B;  3H1U A;  4ZYN A;  1S3S G;  3S2A A;  1WZ3 A;  1U4A A;  2KC2 A;  2KFK B;  4OVV A;  2K6Q A;  3SHQ A;  5JH5 C;  4W9F A;  1TTN A;  4PYZ A;  2C60 A;  2KZR A;  5C1Z A;  1WX7 A;  3GZN I;  2LVQ A;  2NVU I;  2EKE C;  3AI5 A;  4EZJ A;  1WRD B;  1EUV B;  2JPH A;  2EMS A;  4B6W A;  3DQV A;  1UBQ A;  1E8Z A;  2KDI A;  4RMA A;  5LXI B;  2CHX A; 
#chains in the Genus database with same CATH topology
 1K52 A;  2J42 A;  1KFY B;  3C19 A;  3RNA C;  4IWO A;  2LFI A;  1WE6 A;  1OFF A;  2N7E A;  3GZN B;  4FHJ A;  1L6U A;  1I4X A;  2D3G A;  4GB9 A;  1V6E A;  4C00 A;  3DVN V;  1SE9 A;  3KYD D;  4HEA 1;  2KC1 A;  4EZL A;  3AEG B;  3KW5 B;  3DOW A;  3N1Y C;  3AMZ A;  2BGF A;  2PMV A;  3RI7 C;  3ZDM C;  3NVZ A;  1L6V A;  4A9A A;  3U7Z A;  1D5X C;  4AUQ C;  4NAW B;  4RGM A;  1C77 A;  4GGQ A;  2M19 A;  4KZ0 A;  4RF0 A;  2GBM A;  3PSE B;  3PGE A;  3SU8 X;  2O6V B;  3RNE C;  2LRW A;  1Z5S B;  2LJI A;  1JRU A;  2N9P C;  4LNF A;  3DBL I;  4OHJ A;  4KZC A;  4BOZ B;  1SE3 A;  1XD3 B;  2LGD A;  2PTL A;  3APC A;  3VUX A;  2W3R A;  1ESF A;  4YWG G;  2WQY B;  2GBN A;  2WLB A;  3Q3J A;  1V9J A;  1YX6 B;  1FNV A;  2LGX A;  2FCQ A;  2JUO A;  2O2V B;  3N9Y C;  3T3N A;  3VTW A;  1IGC A;  3ZTC A;  2O6V A;  3B2F A;  4YL8 A;  2K0P A;  1GG3 A;  2FAZ A;  3V62 A;  4RGO S;  3W1S A;  4GN1 A;  4AQ7 A;  3Q8A A;  1N63 A;  3ABV B;  4P7I A;  4E71 A;  2GLS A;  2V4L A;  1LM8 B;  1GB4 A;  1WGY A;  3FAH A;  1TS3 A;  4OZB A;  1JWA D;  2O2V A;  5CHV C;  3HRD D;  2JX5 A;  2BQQ A;  2MJD A;  3W5U B;  2HD5 B;  3IBE A;  3LXF A;  3U2S C;  3L16 A;  1NI2 A;  2BYT A;  2Y5B B;  4A3O A;  3SR6 A;  3UQA A;  3ZIM A;  5AZH A;  3IAS 1;  2QEJ C;  5HHD G;  2CHZ A;  4CYE A;  5G2N A;  4ARI A;  4FXC A;  2W55 A;  1TT5 B;  3ZKJ C;  2Z59 B;  3B0A A;  2WU5 B;  1YQ4 B;  3A1Q B;  3RT3 B;  1L5P A;  2ZZP B;  2EMT A;  2I1J A;  4NZL B;  1BML C;  5HFY A;  4O1N A;  1XEE A;  1RFA A;  2N7J A;  3VTV A;  1E8W A;  3A9J B;  2N4F A;  3N1X C;  1T6B X;  3KWV A;  3N3K B;  5D2M B;  3UQB A;  5AEK B;  1YJI A;  4DXF A;  2SAK A;  2CKH B;  3QC8 B;  2Y5C A;  1C79 A;  1PGX A;  1IGD A;  3MC0 B;  4JGH B;  2IO3 B;  3PT2 B;  5HG2 A;  2BS4 B;  2HTH A;  3QA8 A;  1RAX A;  1JW9 D;  1GAQ B;  3A9J A;  3OAW A;  2N1W A;  4G3X B;  5HI1 A;  4S17 A;  4WWP A;  5G5H A;  2WDV B;  3WA0 A;  2MW5 A;  2CR5 A;  3HIZ A;  1SIJ A;  5CHF A;  2IGD A;  2JZ3 B;  1UEL A;  5C23 A;  3Q3F A;  2N0S B;  4ZHO A;  2CU1 A;  4IM2 A;  1GC7 A;  3IAM 1;  1HTO A;  4M8N A;  1L7Y A;  2MBQ A;  2JXX A;  3LJ3 A;  2WXR A;  3JSV B;  1VCB A;  4K7S A;  2KFJ A;  2K3U A;  3EUB 2;  5D3I B;  4KGR A;  2A4Z A;  2WYQ A;  3R2I A;  1YQB A;  5J17 A;  4HDO A;  2BKF A;  4KVG B;  2AL6 A;  2WWZ A;  3ZVV A;  4BFR A;  1P9D U;  3BVM A;  4FLH A;  3DHG C;  2AL3 A;  4I6L B;  1PGB A;  2K8C A;  4DHZ B;  2IJ0 A;  1F2R C;  4ANU A;  5D94 A;  2H89 B;  2D3B A;  3RUI B;  1I4P A;  4XWT A;  2E3T A;  2KQ7 A;  3KYC D;  5DPW A;  1QQR A;  4PS3 A;  4W9H A;  2V4I B;  1P0R A;  4M02 A;  5L95 C;  1L0V B;  2YEP B;  2KK8 A;  3MJ5 A;  4FAD A;  2WXO A;  2WDR B;  3Q3O C;  3M63 B;  3UI3 A;  2WXH A;  2M4N A;  1QZE A;  2FCN A;  3NVV A;  2PW9 A;  1T0Y A;  3ONS A;  2A5U A;  3L13 A;  1WGH A;  2HJ1 A;  1AWD A;  4MT5 A;  1STE A;  3QX1 A;  4EE2 A;  1UUP A;  2I38 A;  2PIA A;  4IC7 B;  2D07 B;  1ET6 A;  1V97 A;  1VRA B;  1JCK B;  3AN1 A;  1XXG A;  2J0J A;  2CJN A;  1TKG A;  2IZV B;  1N5W A;  2D2Q A;  4KKI A;  5BYS A;  3Q8E A;  3J9C A;  1I35 A;  3PLU A;  4PK1 A;  3RNC C;  3HM3 A;  1QF6 A;  2Q5W D;  4P16 A;  4ITK A;  2AWT A;  1XO3 A;  2DEN B;  2LD9 A;  3RFZ B;  3N1Z C;  1DGJ A;  1WJ4 A;  1KH0 A;  4JX1 C;  3AE4 B;  2FUG 1;  3NJT A;  3AEC B;  1ZE3 D;  5T8I A;  2DYM A;  5C2T B;  2WDQ B;  1LFD A;  5IAA C;  4L23 A;  1F9J A;  1WY8 A;  4MJS B;  4FJV B;  3Q14 C;  2J52 A;  2IGG A;  1FNW A;  3ZRF A;  2L0T A;  4GSW A;  2FCS A;  4WH4 A;  2DZJ A;  1ZPS A;  3BYT B;  2GRI A;  3UIO B;  2RPQ A;  2IYD B;  5E6J A;  3I57 A;  5HKH A;  2INC C;  5E6O A;  4D2K A;  4US8 A;  3MC9 A;  1SXT A;  4L2Y A;  1JRO A;  4CQN A;  4MEL A;  3B08 A;  1FXA A;  4JWU C;  4A55 A;  4C80 A;  3ZXV A;  3WAN A;  4F1S A;  1JRP A;  5I4D A;  1A70 A;  2BYF A;  3AEF B;  3B1L X;  2KTF A;  1SE2 A;  1WSP A;  1BXT A;  4IDI A;  2MJ3 A;  3KUC B;  3P4P B;  4ZYN A;  1S3S G;  3S2A A;  1L0X B;  2KC2 A;  3LB8 C;  2K6Q A;  4MAC A;  4ZYS A;  2C60 A;  5C1Z A;  4WQM A;  2LVQ A;  2NVU I;  3E56 A;  4EZJ A;  1TS2 A;  1WRD B;  1EUV B;  1F77 A;  4B6W A;  3DQV A;  2KDI A;  2LUM A;  2MH7 A;  4NJ6 A;  1WXS A;  2FID A;  3OJ3 A;  3GE3 C;  3KQ4 A;  4IKG A;  1ZW7 A;  2OJR A;  2LVO A;  1UGJ A;  4YTM B;  3JW0 X;  3L4P A;  3DWG C;  3AE6 B;  1TS5 A;  4KKJ A;  1ISN A;  1EO6 A;  4EFO A;  5J2R A;  4KIK A;  1WYG A;  3AEA B;  2Z0D B;  3P42 A;  4M8M A;  2N9X A;  2L32 A;  1D3Z A;  3AB5 A;  3RNF C;  2J0M A;  4KDL B;  3HK0 A;  4TV3 A;  2GMI C;  2AQ2 B;  3URY A;  3DVG Y;  4I6N B;  2NTS A;  4ZRP A;  4DWF A;  3PS6 A;  1PQS A;  2INN E;  3DBR I;  4WJQ A;  1V5T A;  3AXC A;  2BKR B;  4GMV A;  2N7D A;  1NEK B;  2KJH B;  2J53 A;  5BMI A;  3EGR A;  1YN3 A;  2PEA A;  3EA6 A;  3PO0 A;  2NPT B;  4LJO B;  3SEB A;  1C1Y B;  4LK0 M;  4WJO A;  2L83 A;  3DBS A;  4IG7 B;  2WP9 B;  3NS1 A;  1WJU A;  1LQB A;  1T5X D;  2MSE D;  3BVZ A;  3RN9 C;  3MTN B;  5DPR A;  1GUA B;  4USA A;  4HRO A;  1QLB B;  4K1R B;  3PHW B;  1YJJ A;  1GB1 A;  4FA6 A;  5FR3 A;  5DPT A;  4MGI E;  2WS3 B;  3NZS A;  4WWM A;  4AJW A;  1WMH A;  1OQQ A;  3GOE A;  3U4E G;  4P6V F;  3RPF C;  3BY4 B;  3Q8C A;  2AEH A;  4DXG A;  1C78 A;  3V3X A;  3NZ3 A;  1NBF C;  3ZQ4 A;  2LAS A;  3BYY B;  2WX0 A;  1S1Q B;  4BVU C;  1WX9 A;  4W9K A;  1UD7 A;  2IBI B;  4W9C A;  1D5Z C;  1YN5 A;  2M0A A;  3VHT C;  3DVN U;  1C4A A;  1I7H A;  2OHF A;  1OQR A;  1IPG A;  3DDC B;  1VZ7 A;  1AN8 A;  1G6J A;  1QOA A;  4WWN A;  1KM7 A;  2KWV B;  1FFU A;  2ON8 A;  4LLG M;  2IY0 B;  4GOC A;  2C7N B;  4MSM B;  1P1A A;  3KWL A;  1EWC A;  1NYQ A;  3FIL A;  4OVZ A;  5G55 A;  2Y3A A;  3A4S C;  4AJY B;  3BIN A;  2BPS A;  2KXJ A;  1CQV A;  1EF1 A;  2L76 A;  4TUU A;  3ZDT A;  3HVD A;  1ZDX A;  1MPE A;  4MGZ E;  2JWU A;  4H2A A;  4HDQ A;  2C7M B;  3ZJT A;  4DHZ E;  2PVO D;  2CU3 A;  4NQK E;  1ET9 A;  3JVZ X;  4OW0 A;  2WXF A;  2JU6 X;  4J3O D;  3ZLZ A;  2ZCC A;  3NY5 A;  1NDD A;  2LJ5 A;  4R3D A;  1D5M C;  3V61 A;  3ZNI D;  2UU7 A;  1CK1 A;  4HRS A;  1P3Q U;  3SDL C;  1I4H A;  2VH2 A;  1J19 A;  4NJ7 A;  3DPD A;  2R2O A;  1L2N A;  4ZRI A;  3RCZ A;  1MI0 A;  4PS8 A;  4ZRQ A;  1AYF A;  1SGH A;  3R7Q A;  3KUZ A;  2RMM A;  1E8X A;  5BYQ A;  4ACF A;  1KJT A;  2KHW B;  2ZPN A;  4GXB A;  2B3A A;  3T9L A;  2IGH A;  1TBE A;  3EFU A;  5IOI A;  3QAR A;  4TSS A;  3PZD A;  1TIF A;  3DBL B;  2KDB A;  4RCO A;  2XK5 A;  1YNT E;  2PE9 A;  3A33 B;  4NAM A;  1SJH D;  3OJ4 B;  3LDZ E;  2FE8 A;  4F8C B;  1BT0 A;  1IP9 A;  1K53 A;  2INP E;  2NR2 A;  1MVK A;  1M94 A;  2ZNV B;  2KDE B;  3DVG X;  1FMA D;  2RDH A;  1RM6 C;  1GPX A;  1WIA A;  1LO5 D;  5G5G A;  2BS3 B;  3NRZ A;  1P7E A;  4BAX A;  2MBE A;  3QQ8 B;  1XLN A;  3U30 A;  1R4M I;  2NBW B;  2WU2 B;  3I5J C;  3W9C B;  2AQ3 B;  4ZOH C;  2DNF A;  3RD2 A;  4ZRK A;  3B2G A;  2FNJ B;  2KJR A;  2V0G A;  3U7D A;  1NEN B;  4KSK C;  2N9E B;  2WNM A;  5DCN A;  2KAC A;  1I4R A;  4YTP B;  1SEB D;  1TZO A;  3E9S A;  1WXQ A;  1RLF A;  4II2 B;  2I2Y A;  1R4M B;  4XC2 A;  3H7S A;  2BYE A;  1NVI D;  1UNS A;  2QHO A;  2KLC A;  3ZRC A;  2KDM A;  2IY1 B;  1FPY A;  4ZDV A;  1HEZ E;  3AV8 A;  3VQI A;  1EM7 A;  2KFK A;  3WAO A;  1UGM A;  2R2Q A;  3P4R B;  2G9H D;  1WE7 A;  4NQL B;  1V2Y A;  1WXV A;  2XNA C;  3N30 A;  2D3C A;  1NYR A;  1YOV B;  2OED A;  3LYY A;  5GMV A;  3P2B A;  1K50 A;  2L0F A;  3K9O B;  3ALB A;  5DPS A;  4ICU A;  3VVW B;  1EU4 A;  1VR9 A;  1SE4 A;  3AH7 A;  2BB5 A;  1FCC C;  1I42 A;  1PYW D;  1YN4 A;  5BO4 B;  2NCN A;  3U8Z A;  3DHI C;  1XF5 L;  2UWQ A;  4MGK E;  4HVB A;  2DYB A;  1Q1O A;  4HWI B;  3EHV A;  1V1O A;  2V9H A;  5AZG A;  1WGG A;  3CST A;  1QOB A;  2ZEQ A;  3AE9 B;  3PHX B;  4JQW C;  3ML8 A;  4M0W A;  2O6V D;  2IPK D;  4JWS C;  5LLI A;  1E7U A;  2GB1 A;  1HE8 A;  2LZ6 A;  3ML9 A;  1ZDV A;  4S0R A;  1C76 A;  3VTU A;  4AWJ A;  4BKT A;  1I4Q A;  3VXW A;  3Q69 A;  3NVW A;  4ICV A;  4AP4 C;  1V86 A;  4RH6 A;  4XGA B;  1DOY A;  2V3N A;  3EEC A;  1OEY J;  4DBG A;  1KF6 B;  4GLS C;  1PUT A;  4BZA A;  4C7Y A;  2ZVN A;  1J8C A;  2KNB A;  3Q8F A;  4XDD A;  2NS5 A;  3OG5 A;  1PGA A;  3SHQ A;  4W9F A;  1TTN A;  1YQ3 B;  2CJO A;  4PYZ A;  2KZR A;  2EMS A;  3N20 C;  2CHX A;  3GS2 A;  3VR8 B;  2RD0 A;  2KQ4 X;  1WXA A;  3WCQ A;  3R8B A;  4LCD E;  4W9I A;  2KKC A;  2QDF A;  1AAR A;  2WX1 A;  2D10 A;  4Q2J A;  1Q5W B;  1GJZ A;  5EE1 A;  4N9F 4;  5LNK 1;  2M0X A;  3MC8 A;  1EWY C;  4TMA B;  4KSL C;  3V60 A;  4LDT B;  2LI5 A;  5BMH A;  4B9K A;  2JYT A;  1F2R I;  5IP4 D;  3M95 A;  1BUI C;  4ANV A;  1WYW B;  3FKY A;  2V1Y A;  3BZD B;  4PT5 A;  1TJE A;  4HPM B;  4W9L A;  2PVG C;  2DLB A;  2WXQ A;  4P1B C;  2RDG A;  1QKZ A;  2HTM E;  3A4R A;  4KGT A;  1JQ4 A;  4FJZ A;  1T0R C;  1E90 A;  4IM0 A;  5D7G A;  1TY0 A;  4N58 A;  2KJ6 A;  4XZ4 A;  2MLB A;  2L1A A;  2MHJ A;  2X8X X;  1Y56 A;  3NUH B;  2RDB C;  2JSV X;  4IW0 A;  4LNN A;  3QHT A;  1XLQ A;  2Z8L A;  1YIW A;  2QIE B;  2KWU B;  4GIV A;  1QIL A;  1WF9 A;  4A6Q A;  4YSZ B;  5CHW A;  5E6N A;  4GDK B;  4TQ1 A;  3ZXR A;  2Y5P A;  4KDI C;  2BWE S;  3RNG C;  3AUL A;  4OVU A;  2G4S A;  1P7F A;  3R3M A;  4KX6 B;  1FEH A;  2OJW A;  2BT6 A;  1YMH E;  1Y8R C;  1LXD A;  3Q2A C;  2H88 B;  4GDK A;  3K9P B;  3QIJ A;  1N60 A;  4ASW C;  2WXL A;  1E7V A;  2IO1 B;  2AQ1 B;  4EKU A;  1MHX A;  1WGK A;  1WI0 A;  1XQQ A;  2KO3 A;  1JWS D;  4KIK B;  3M3J A;  3Q6B A;  1MHH E;  4HJG E;  4A20 A;  4TQ0 A;  4FN2 A;  3N32 A;  4LTU A;  3AE2 B;  2AYO B;  4NPN A;  2CHW A;  3DBH I;  2YEP F;  1XCT L;  1HZ6 A;  4HCP B;  1SIF A;  1GOZ A;  2BW2 A;  2LWP A;  1IBX B;  1DYQ A;  5JXV A;  5MPO A;  2DZK A;  3C8Y A;  2D5G A;  4FBJ B;  2YVC A;  4MGY E;  1QT9 A;  3ZW3 A;  4DXA B;  1FXT B;  4NNJ B;  3NZU A;  3UIP B;  2ASQ A;  2DAJ A;  2DBY A;  2QCZ A;  2LUE A;  4XE0 A;  4NJC A;  1IBX A;  2CS4 A;  1R4N I;  3AE1 B;  2M56 B;  2PLP A;  4QAY A;  1ZP0 B;  2SEB D;  3Q3M C;  2MJE A;  4C56 C;  1V1P B;  1ZGU B;  5KHO A;  3DBR B;  2KN5 A;  3TSS A;  1D6E C;  1R4N B;  1WMH B;  3FC4 A;  1E6E B;  3L10 B;  1C4P A;  2E6X A;  1YD8 U;  3SFE B;  4LDT D;  2M17 A;  5EE0 A;  3TEZ A;  1UWX A;  2FUH B;  3L0W B;  2WXM A;  4K3C A;  4W9D A;  1V1P A;  4M00 A;  2K8H A;  2NMQ A;  4JPS A;  1FXI A;  3RZF A;  5JZE B;  2L7R A;  5C3J B;  2VZK B;  2J4X A;  1KTK A;  2DAF A;  1WH3 A;  1E0Z A;  1VZ6 A;  2N1V A;  2ICI A;  2MBH A;  4YSX B;  3AE3 B;  1UBI A;  2KT7 A;  1ACC A;  1N6Z A;  1NI3 A;  3W1S C;  1WM3 A;  4WUR A;  3PVL A;  3D32 A;  3FIL B;  4X57 B;  2WDT B;  3VRB B;  2JQR B;  3O13 A;  2QMT A;  1P98 A;  1FRR A;  2C7H A;  3TBL D;  3VUW A;  1K51 A;  3I3T B;  3WAL A;  4HCN B;  2MX2 A;  4MH8 A;  1OQY A;  3CWI A;  1WXM A;  4HPL B;  3VR9 B;  2MA9 B;  2NTT A;  1WJ6 A;  2HJ8 A;  1L0Y B;  2AX5 A;  1J7C A;  1ZUD 2;  2ZJD A;  1KLG D;  2D11 A;  2I1K A;  5J18 A;  2JT4 B;  4WJP A;  1E7P B;  2K8B A;  2WXN A;  2L3Z A;  3WAM A;  2ZNV C;  2C9W B;  4AS1 A;  2FBW B;  3AE7 B;  1DOX A;  3AE5 B;  4MH0 E;  5L83 A;  1WR1 A;  2BVC A;  4A90 A;  3RYT A;  2RR9 A;  4B0M A;  3TUO A;  1HA5 A;  2LMC A;  4RNA A;  1F1H A;  1SBB B;  2JF5 A;  2W9N A;  4K81 A;  2PPH A;  1WFY A;  2JWZ A;  2LGY A;  3VRA B;  4N59 A;  4B0E A;  4ANX A;  3H9D A;  1FRD A;  3NHE B;  1CZP A;  2MBB B;  4YSY B;  3IHP C;  2MCN B;  3APF A;  2G4D B;  1SB3 C;  3TEY A;  4WAF A;  3R66 C;  5KHQ A;  4XDC A;  2V3P A;  2IND C;  3QAQ A;  3UF8 A;  1N5X A;  2XK5 B;  4JL9 A;  3AE8 B;  3APD A;  2JZP A;  2QJL A;  2JZZ A;  2W3S A;  2YLM A;  4FUL A;  2V3S A;  1ZKH A;  4WIP A;  4WWO A;  5AUI A;  4MM3 B;  2HE7 A;  3AU5 A;  3VAW A;  5CTR C;  1L4D B;  2FCM A;  4JIO U;  1H8C A;  4K3B A;  3PRP B;  1Q10 A;  3IXS A;  2C5L C;  2WXP A;  4RGN A;  1RYJ A;  5H92 C;  2LVP A;  2L8J A;  4NAW A;  2JXT A;  5IO9 A;  3HUI A;  1KOT A;  4JLC A;  3HHM A;  4MM3 A;  3W2D A;  2X38 A;  1T3Q A;  5JHB A;  3CF6 E;  1KLV A;  3QWZ B;  4DQO C;  2KQS A;  3CIR B;  3X0W A;  2LGS A;  4E3C A;  4II3 B;  2DZM A;  2KX0 A;  2M8S A;  4HJK A;  1TZ1 A;  4CHK A;  4BBN F;  2DYO A;  1WM2 A;  3W5V B;  2JRH A;  4DHJ B;  3PRZ A;  1WR6 E;  3AM9 A;  5TR5 A;  2JVC A;  4LNO A;  1ZXH A;  1VLB A;  1HZ5 A;  1CMX B;  4LJP B;  3H1U A;  3B9J A;  2KFK B;  1U4A A;  2QSD A;  1KRH A;  2VZK D;  1MFW A;  5FKA C;  3H8H A;  3ZGZ A;  2EKE C;  3AI5 A;  2EKI A;  4LNK A;  2JPH A;  1TS4 A;  1EU3 A;  1E8Z A;  2KYW A;  3DHH C;  1WGD A;  3MHS D;  3RUL A;  3PTF C;  4IOI E;  3H6N A;  4ZHP A;  2PJH A;  3KUD B;  1VJK A;  5D6J B;  3BII D;  3ZNH B;  1AW7 A;  1LGR A;  3JYU A;  3SD5 A;  3VDZ A;  1IYF A;  2GI9 A;  1F52 A;  3PZ7 A;  2DZI A;  3BVG A;  3ZNG C;  3ZYY X;  4PYU A;  5EDS A;  2ZW1 A;  2L52 A;  3A1Q A;  5H8Y E;  1K8R B;  4RGT A;  2GBK A;  4HKZ E;  2R61 A;  3OWE B;  5FR6 A;  4N6E B;  4IWQ A;  3X23 A;  2VH1 A;  2RSU A;  5EE9 A;  1N62 A;  2G1E A;  4IM3 A;  2KVZ A;  3L08 A;  3TEW A;  2LEK A;  1JWU D;  2RPV A;  3MP9 A;  1WGR A;  1GC6 A;  3GB1 A;  2WHI A;  3O65 B;  2K9X A;  1J7B A;  3ZJU A;  1MJD A;  2DX5 B;  1FNU A;  1FD6 A;  1ENF A;  3RZW C;  3VUY A;  2LGI A;  5IKC M;  1FFV A;  3ECI A;  4M0W B;  1XLO A;  1B1Z A;  2L00 B;  3Q8B A;  1T0Q C;  2WXG A;  4HLE A;  3EC8 A;  4YXD B;  5TSS A;  4RF1 A;  2IDY A;  4FJY A;  3UIN B;  4E74 A;  4F7Z A;  2M1M A;  1XLP A;  2BTE A;  3MJW A;  5FK9 C;  1HQR D;  3JSV A;  2ONQ A;  1VD2 A;  3AEB B;  3ZO5 B;  2DWQ A;  3VFK A;  2BS2 B;  3PRE A;  3L54 A;  2ACZ B;  3GE8 C;  3IFW B;  3NVY A;  4BOS C;  4US9 A;  2WXJ A;  4HKQ A;  2BWF A;  3EFC A;  5LXH A;  2K25 A;  4URK A;  3UGB B;  2W82 A;  4ZRJ A;  5AUK A;  1VZ8 A;  4W9G A;  1JWB D;  3PLV A;  4GU2 A;  3OLM D;  2ZW0 A;  3KLS X;  2KMM A;  2KTR B;  4I6P A;  2MBO A;  4YTN B;  1JWM D;  5IN7 A;  2JYE A;  4K7W A;  3PV1 A;  2KAJ A;  4WQO B;  2K5P A;  4RFB A;  4BKS A;  4IUM B;  4LNI A;  2J0K A;  3L17 A;  2MRP A;  2KWC A;  3QJZ A;  2VRR B;  1SSN A;  1UZX B;  2KTR A;  3BWU D;  3ZTD A;  3AU4 A;  2GBR A;  1C4C A;  5AZF A;  3ENE A;  1FIQ A;  1D4B A;  2LHE A;  1JML A;  1M4V A;  5GXG B;  3QK0 A;  4ANW A;  1WX8 A;  1V81 A;  2KMA A;  2XEW A;  4REZ A;  2UYZ B;  3ZJV A;  1V80 A;  2KMC A;  3W1Y A;  2BB6 A;  4DHJ D;  4EZK A;  3RNB C;  3U52 E;  2FIF A;  1OTR B;  4RM9 A;  4M01 A;  2L05 A;  4JE3 B;  4MDK E;  3VH3 B;  1RRB A;  2WXI A;  1ZXI A;  1VDV A;  1Z2M A;  1X1M A;  4WJN A;  2K6D B;  4MSQ B;  2BYV E;  4G0N B;  3DWM A;  4K7U A;  3ZNZ B;  1R7S A;  1OEY A;  2BBC A;  2XN9 C;  1PDX A;  3TL5 A;  3MHZ A;  4XX5 A;  3NOB A;  4MEM A;  2Z0E B;  3C0R B;  3P63 A;  2KX3 A;  4HXD A;  3HVZ A;  1RWS A;  3TEX A;  4UDU C;  3I9V 1;  1TGZ B;  4A8X C;  1J0G A;  1L4Z B;  2ZPY A;  2REX A;  4OZC A;  2G45 B;  2JY6 A;  4OZA A;  2QC8 A;  3MFG A;  3BK1 A;  4C4V B;  3R2T A;  4MJS A;  3AEE B;  2KAN A;  4DK5 A;  1DOI A;  2KWD A;  1UH6 A;  1TYG B;  1HXY D;  2GBJ A;  4W9E A;  4B95 A;  2PE6 B;  1TKE A;  4G50 A;  4BBN C;  2D3A A;  3DCG A;  3I63 C;  3V6E B;  5CX3 A;  3ETR A;  3IG3 A;  2LXC A;  4DDI D;  3PPA A;  3TIX A;  1RFK A;  3TCA A;  4C4V A;  1OGW A;  4FHK A;  2K22 A;  3M62 B;  1Q0W B;  1WJN A;  2WXK A;  3IVF A;  1XCQ L;  3AED B;  1ROE A;  4EEW A;  1FCL A;  2JRI B;  1SF0 A;  2K39 A;  2KN4 A;  3IT6 B;  3PZ8 A;  3PRM B;  4YT0 B;  3VH4 B;  5BYR A;  3IT4 B;  1GNU A;  2EEL A;  1TKY A;  3R7R A;  3CSF A;  4NY0 A;  1V8C A;  1YJ1 A;  4EUT A;  4BKS D;  2MWS B;  1V49 A;  1E10 A;  2KLG A;  3NS8 A;  1WWT A;  1EF5 A;  2ZCB A;  1N61 A;  3DBH B;  1SJE D;  3P4Q B;  2GOW A;  1E8Y A;  4L1B A;  3RMK C;  3V6C B;  4W9J A;  1F0Z A;  2KOX A;  1IUE A;  2NBV B;  1E9M A;  4KGS A;  4DDG D;  3A9K B;  1H4R A;  3SFD B;  4AOF A;  3HM6 X;  2LRU A;  2PKO A;  5IA7 A;  1UF0 A;  1FO4 A;  1ZOY B;  1C9F A;  2J7Q B;  1TY2 A;  3GP7 A;  1KLU D;  2KD0 A;  5JHA A;  2IO0 B;  2N9K A;  4HPP A;  3H7P B;  2N9L A;  1QOG A;  1WZ0 A;  4C7Z A;  2B76 B;  5BMG A;  3WIM A;  4GDL B;  3WAP A;  4G11 A;  2KDF B;  1XT9 B;  2ZVO A;  1E5W A;  4ARC A;  4P1C C;  3A9K A;  5EE3 A;  2OOB B;  4CO7 A;  3NG0 A;  2KVR A;  1PFD A;  1C3T A;  3H7P A;  4PS7 A;  4TKN A;  1JAL A;  4GDL A;  5E6P A;  2WGS A;  3BK2 A;  4BKG A;  4EOY A;  4HK2 A;  1CJE A;  3QCA A;  1WRI A;  4WAA A;  5D3D A;  3P4S B;  2HDE A;  2RGF A;  4KV2 A;  2MP2 B;  3KVF B;  2DHZ A;  2LHD A;  2IO2 B;  1MG8 A;  2XBB C;  1A5R A;  3P1M A;  2NPT A;  4XYC A;  3T3O A;  2QIL A;  1UWM A;  3TJP A;  3CMM B;  2TSS A;  2G3Q B;  4J6I A;  3KH0 A;  4RM8 A;  1YX5 B;  1I4G A;  2LXA A;  1V5O A;  1T0S C;  4XWW A;  2MP2 A;  1QOF A;  2K1F A;  2BF8 B;  1FM0 D;  3V05 A;  1B9R A;  3TMP B;  2NBU A;  4A3P A;  4IWP A;  2W54 A;  3ZUN A;  3T8M A;  1MG4 A;  1HTQ A;  2MQJ A;  1WZ3 A;  3Q3N C;  4OVV A;  5JH5 C;  2MEK A;  1WX7 A;  3GZN I;  1J7A A;  1UBQ A;  4RMA A;  5LXI B; 
#chains in the Genus database with same CATH homology
 4NJ6 A;  3MHS D;  2RD0 A;  3RUL A;  1WXS A;  2FID A;  3PTF C;  3OJ3 A;  1WXA A;  3H6N A;  4IWO A;  4LCD E;  4W9I A;  2KKC A;  1WE6 A;  2PJH A;  3KUD B;  5D6J B;  3ZNH B;  1AAR A;  2N7E A;  1ZW7 A;  2OJR A;  4FHJ A;  2LVO A;  2WX1 A;  2D10 A;  3JYU A;  3SD5 A;  1Q5W B;  1GJZ A;  3VDZ A;  1IYF A;  2D3G A;  4N9F 4;  2DZI A;  4GB9 A;  3JW0 X;  1V6E A;  2M0X A;  3ZNG C;  3DVN V;  1SE9 A;  4KSL C;  4PYU A;  1ISN A;  1EO6 A;  3KYD D;  3V60 A;  5EDS A;  4LDT B;  3A1Q A;  4EFO A;  1K8R B;  5J2R A;  2KC1 A;  4KIK A;  2LI5 A;  4EZL A;  4B9K A;  2GBK A;  2Z0D B;  4M8M A;  3KW5 B;  3DOW A;  2N9X A;  5FR6 A;  3M95 A;  4IWQ A;  2BGF A;  1D3Z A;  3ZDM C;  3X23 A;  2RSU A;  4ANV A;  2J0M A;  4KDL B;  4IM3 A;  3HK0 A;  4TV3 A;  1WYW B;  2GMI C;  2V1Y A;  3DVG Y;  4I6N B;  3L08 A;  4DWF A;  3PS6 A;  1PQS A;  4AUQ C;  3DBR I;  4NAW B;  4WJQ A;  1WGR A;  1GC6 A;  1V5T A;  4HPM B;  3AXC A;  3O65 B;  4KZ0 A;  2BKR B;  4GGQ A;  4GMV A;  2N7D A;  2KJH B;  2GBM A;  2DX5 B;  3PSE B;  3PGE A;  4W9L A;  3SU8 X;  2O6V B;  3VUY A;  3RZW C;  2LRW A;  1Z5S B;  2PEA A;  3ECI A;  1JRU A;  2N9P C;  2NPT B;  3DBL I;  4LJO B;  4M0W B;  4KZC A;  3A4R A;  4BOZ B;  1XD3 B;  2LGD A;  3APC A;  2L00 B;  1C1Y B;  3VUX A;  4WJO A;  3DBS A;  4FJZ A;  1E90 A;  4IG7 B;  2GBN A;  4IM0 A;  1WJU A;  1LQB A;  5D7G A;  3Q3J A;  1V9J A;  4HLE A;  1YX6 B;  2KJ6 A;  4XZ4 A;  2MSE D;  3EC8 A;  2MLB A;  2LGX A;  3MTN B;  5DPR A;  2FCQ A;  4FJY A;  3UIN B;  4E74 A;  1GUA B;  2JUO A;  2M1M A;  4F7Z A;  2O2V B;  3VTW A;  4K1R B;  3ZTC A;  2O6V A;  3PHW B;  3MJW A;  4IW0 A;  4YL8 A;  1GG3 A;  2FAZ A;  3V62 A;  3W1S A;  3QHT A;  4GN1 A;  4FA6 A;  3JSV A;  5DPT A;  1YIW A;  3NZS A;  4MGI E;  2KWU B;  1VD2 A;  4GIV A;  3ZO5 B;  4AJW A;  1WMH A;  1WF9 A;  3VFK A;  3PRE A;  4P7I A;  3GOE A;  4E71 A;  3L54 A;  3BY4 B;  2AEH A;  5CHW A;  2V4L A;  5E6N A;  1LM8 B;  4GDK B;  1WGY A;  3IFW B;  4TQ1 A;  1NBF C;  4BOS C;  2LAS A;  2O2V A;  5CHV C;  2WX0 A;  4KDI C;  2BWE S;  2BWF A;  5LXH A;  2K25 A;  3AUL A;  4OVU A;  4URK A;  1S1Q B;  3UGB B;  4BVU C;  1WX9 A;  4ZRJ A;  4W9K A;  2G4S A;  4W9G A;  2HD5 B;  3R3M A;  1UD7 A;  3IBE A;  3PLV A;  2IBI B;  4GU2 A;  4W9C A;  3OLM D;  3VHT C;  3L16 A;  1NI2 A;  2KTR B;  4I6P A;  1Y8R C;  1LXD A;  2Y5B B;  2MBO A;  3DVN U;  4A3O A;  3UQA A;  3ZIM A;  5AZH A;  4K7W A;  3PV1 A;  4GDK A;  1IPG A;  3DDC B;  4WQO B;  3K9P B;  2CHZ A;  3QIJ A;  4BKS A;  4CYE A;  5G2N A;  1G6J A;  4WWN A;  4IUM B;  4ASW C;  3ZKJ C;  1KM7 A;  1E7V A;  2J0K A;  2Z59 B;  2KWV B;  3L17 A;  2MRP A;  2KWC A;  3B0A A;  3QJZ A;  2IY0 B;  2IO1 B;  4GOC A;  4EKU A;  2VRR B;  3A1Q B;  1WI0 A;  1XQQ A;  2C7N B;  3RT3 B;  2KO3 A;  2ZZP B;  3M3J A;  2EMT A;  4KIK B;  1P1A A;  4MSM B;  4A20 A;  2I1J A;  1UZX B;  5G55 A;  4FN2 A;  4TQ0 A;  2KTR A;  3A4S C;  4AJY B;  3N32 A;  3BIN A;  2BPS A;  2KXJ A;  3ZTD A;  3AU4 A;  1RFA A;  2GBR A;  2AYO B;  5AZF A;  1EF1 A;  2L76 A;  4TUU A;  4NPN A;  3ZDT A;  2CHW A;  3VTV A;  3DBH I;  1E8W A;  3ENE A;  3A9J B;  2N4F A;  4MGZ E;  4HCP B;  3N3K B;  1SIF A;  3QK0 A;  4HDQ A;  2C7M B;  4ANW A;  1WX8 A;  5D2M B;  1V81 A;  3UQB A;  2LWP A;  5AEK B;  4DHZ E;  2KMA A;  2XEW A;  2UYZ B;  1V80 A;  2KMC A;  3W1Y A;  4NQK E;  4DHJ D;  4EZK A;  2CKH B;  2DZK A;  1OTR B;  2FIF A;  3QC8 B;  4RM9 A;  4FBJ B;  2L05 A;  4JGH B;  4MDK E;  2IO3 B;  3JVZ X;  2YVC A;  3ZLZ A;  2ZCC A;  3PT2 B;  3NY5 A;  4MGY E;  3VH3 B;  3ZW3 A;  1RRB A;  1NDD A;  2HTH A;  3QA8 A;  1RAX A;  1Z2M A;  2LJ5 A;  1X1M A;  3A9J A;  1FXT B;  3OAW A;  2N1W A;  4G3X B;  4NNJ B;  4WJN A;  3V61 A;  4DXA B;  3ZNI D;  2K6D B;  4WWP A;  3NZU A;  3UIP B;  4MSQ B;  2ASQ A;  1P3Q U;  3WA0 A;  2DAJ A;  2MW5 A;  2CR5 A;  3HIZ A;  2LUE A;  2BYV E;  3SDL C;  5CHF A;  1J19 A;  4G0N B;  2JZ3 B;  2CS4 A;  4NJ7 A;  1R4N I;  1UEL A;  3DPD A;  2R2O A;  1L2N A;  5C23 A;  4K7U A;  3Q3F A;  3ZNZ B;  2CU1 A;  4ZRI A;  1OEY A;  4IM2 A;  3RCZ A;  1GC7 A;  4PS8 A;  4M8N A;  1L7Y A;  3TL5 A;  2MBQ A;  1SGH A;  2JXX A;  1ZGU B;  3KUZ A;  3LJ3 A;  5KHO A;  3R7Q A;  2KN5 A;  1E8X A;  3JSV B;  1VCB A;  4K7S A;  4XX5 A;  2KFJ A;  1KJT A;  2KHW B;  2ZPN A;  1WMH B;  2A4Z A;  2WYQ A;  3NOB A;  4MEM A;  4GXB A;  3L10 B;  2B3A A;  3T9L A;  1YQB A;  1YD8 U;  1TBE A;  3EFU A;  4LDT D;  3QAR A;  5J17 A;  4HDO A;  2Z0E B;  3PZD A;  2M17 A;  3C0R B;  2BKF A;  4KVG B;  2KX3 A;  4HXD A;  2AL6 A;  2KDB A;  2WWZ A;  3ZVV A;  4BFR A;  2FUH B;  1P9D U;  3L0W B;  2XK5 A;  4FLH A;  4W9D A;  2PE9 A;  2AL3 A;  3A33 B;  2K8H A;  4I6L B;  3OJ4 B;  1TGZ B;  1J0G A;  3RZF A;  5JZE B;  2ZPY A;  2K8C A;  2L7R A;  2G45 B;  2JY6 A;  2REX A;  4DHZ B;  2DAF A;  1WH3 A;  3LDZ E;  4ANU A;  5D94 A;  4F8C B;  1BT0 A;  1IP9 A;  4MJS A;  4DK5 A;  2KAN A;  2N1V A;  3RUI B;  2MBH A;  1UH6 A;  2NR2 A;  2KQ7 A;  3KYC D;  1UBI A;  5DPW A;  2GBJ A;  4PS3 A;  4W9E A;  4W9H A;  1M94 A;  4B95 A;  2PE6 B;  3W1S C;  1P0R A;  1WM3 A;  4G50 A;  4BBN C;  5L95 C;  2ZNV B;  3DCG A;  2KK8 A;  3PVL A;  3V6E B;  2KDE B;  4FAD A;  3D32 A;  5CX3 A;  3DVG X;  3IG3 A;  2LXC A;  3M63 B;  4X57 B;  4DDI D;  3PPA A;  2M4N A;  1QZE A;  2FCN A;  2WDT B;  3TIX A;  3TCA A;  1WIA A;  1OGW A;  4FHK A;  1P98 A;  2C7H A;  1T0Y A;  3M62 B;  3TBL D;  1Q0W B;  1WJN A;  3ONS A;  3VUW A;  3IVF A;  2MBE A;  3QQ8 B;  2A5U A;  3I3T B;  3L13 A;  4EEW A;  3WAL A;  3U30 A;  1R4M I;  2JRI B;  2NBW B;  4HCN B;  1WGH A;  3RD2 A;  4ZRK A;  2MX2 A;  2K39 A;  2FNJ B;  2KJR A;  1OQY A;  4HPL B;  1WXM A;  3PRM B;  3U7D A;  2MA9 B;  3QX1 A;  1WJ6 A;  4KSK C;  3VH4 B;  2N9E B;  1GNU A;  5DCN A;  2HJ8 A;  4IC7 B;  3R7R A;  2D07 B;  4II2 B;  1RLF A;  3CSF A;  4NY0 A;  1YJ1 A;  2ZJD A;  2D11 A;  4EUT A;  2I1K A;  5J18 A;  4BKS D;  2MWS B;  2JT4 B;  4WJP A;  1V49 A;  3H7S A;  4XC2 A;  2K8B A;  2L3Z A;  2J0J A;  3WAM A;  2ZNV C;  2C9W B;  2BYE A;  2KLG A;  3NS8 A;  2IZV B;  2D2Q A;  2QHO A;  2KLC A;  4MH0 E;  5L83 A;  3ZRC A;  1WR1 A;  2IY1 B;  3RYT A;  1EF5 A;  2RR9 A;  2ZCB A;  1I35 A;  4ZDV A;  3VQI A;  2KFK A;  3PLU A;  3WAO A;  2GOW A;  3HM3 A;  1E8Y A;  1UGM A;  3V6C B;  4W9J A;  2JF5 A;  2R2Q A;  2W9N A;  4K81 A;  2PPH A;  2KOX A;  1WFY A;  2NBV B;  1WE7 A;  2JWZ A;  4NQL B;  2LGY A;  4ANX A;  3H9D A;  4DDG D;  1V2Y A;  1WXV A;  2AWT A;  3A9K B;  3N30 A;  1H4R A;  4AOF A;  3HM6 X;  2LRU A;  2DEN B;  2LD9 A;  5IA7 A;  3NHE B;  2MBB B;  3IHP C;  1WJ4 A;  5GMV A;  2J7Q B;  3P2B A;  2MCN B;  2L0F A;  2G4D B;  2KD0 A;  3APF A;  2IO0 B;  3K9O B;  5JHA A;  3ALB A;  3R66 C;  5KHQ A;  3H7P B;  3QAQ A;  5DPS A;  3UF8 A;  2XK5 B;  1WZ0 A;  4JL9 A;  4ICU A;  3VVW B;  2DYM A;  3WIM A;  3APD A;  4GDL B;  3WAP A;  1LFD A;  4G11 A;  2JZZ A;  2KDF B;  5IAA C;  1XT9 B;  2ZVO A;  2YLM A;  1E5W A;  4FUL A;  2V3S A;  1F9J A;  1ZKH A;  3A9K A;  1WY8 A;  4WWO A;  2OOB B;  1I42 A;  4CO7 A;  4MJS B;  2KVR A;  4FJV B;  5BO4 B;  2HE7 A;  3AU5 A;  3VAW A;  5CTR C;  2NCN A;  1C3T A;  3H7P A;  2FCM A;  4PS7 A;  4JIO U;  1H8C A;  3U8Z A;  3ZRF A;  3PRP B;  1WGD A;  2C5L C;  2L0T A;  2UWQ A;  4GSW A;  4MGK E;  4TKN A;  4HVB A;  2DYB A;  2FCS A;  4GDL A;  5E6P A;  1Q1O A;  2LVP A;  4HWI B;  2DZJ A;  4BKG A;  4EOY A;  2L8J A;  3EHV A;  4NAW A;  4HK2 A;  5AZG A;  3QCA A;  3UIO B;  2RPQ A;  2IYD B;  5HKH A;  4WAA A;  1WGG A;  3CST A;  1KOT A;  5E6O A;  4JLC A;  2RGF A;  3HHM A;  2ZEQ A;  4KV2 A;  4MM3 A;  2MP2 B;  3KVF B;  2DHZ A;  3PHX B;  2IO2 B;  4MEL A;  3B08 A;  4JQW C;  3ML8 A;  5JHB A;  1MG8 A;  3CF6 E;  1KLV A;  2XBB C;  1A5R A;  3QWZ B;  2NPT A;  2O6V D;  2KQS A;  3TJP A;  5LLI A;  3CMM B;  4J6I A;  2G3Q B;  3WAN A;  4F1S A;  1E7U A;  3KH0 A;  4RM8 A;  3X0W A;  1YX5 B;  1HE8 A;  2LZ6 A;  3ML9 A;  4E3C A;  4II3 B;  2DZM A;  3VTU A;  2KX0 A;  4AWJ A;  4BKT A;  2M8S A;  3VXW A;  2LXA A;  4HJK A;  4ICV A;  4AP4 C;  1V86 A;  1TZ1 A;  1V5O A;  4CHK A;  4BBN F;  2BYF A;  3B1L X;  2MP2 A;  2K1F A;  2KTF A;  2BF8 B;  2DYO A;  1WM2 A;  3EEC A;  1OEY J;  4DBG A;  3TMP B;  2JRH A;  4DHJ B;  2NBU A;  3KUC B;  4IWP A;  4A3P A;  3PRZ A;  2ZVN A;  1WR6 E;  5TR5 A;  3T8M A;  3ZUN A;  2JVC A;  1J8C A;  2MQJ A;  2KNB A;  2NS5 A;  1CMX B;  4LJP B;  3H1U A;  4ZYN A;  1S3S G;  3S2A A;  1WZ3 A;  1U4A A;  2KC2 A;  2KFK B;  4OVV A;  2K6Q A;  3SHQ A;  5JH5 C;  4W9F A;  1TTN A;  4PYZ A;  2C60 A;  2KZR A;  5C1Z A;  1WX7 A;  3GZN I;  2LVQ A;  2NVU I;  2EKE C;  3AI5 A;  4EZJ A;  1WRD B;  1EUV B;  2JPH A;  2EMS A;  4B6W A;  3DQV A;  1UBQ A;  1E8Z A;  2KDI A;  4RMA A;  5LXI B;  2CHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...