1RRBA

The ras-binding domain of raf-1 from rat, nmr, 1 structure
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
NTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
publication title Nuclear magnetic resonance and molecular dynamics studies on the interactions of the Ras-binding domain of Raf-1 with wild-type and mutant Ras proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 14
structure length 76
sequence length 76
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1rrbA00
3JVZX 4WWOA 2K6QA 2ZCCA 2L05A 3VTVA 2KLCA 3L16A 5LXHA 5D2MB 1RAXA 5C1ZA 2FAZA 4ANXA 5DCNA 2DZKA 3HIZA 2KD0A 3O65B 1M94A 2FCSA 1GC6A 3A33B 3GOEA 2LGXA 2HD5B 3MJWA 2KMCA 2V3SA 4ANWA 3JYUA 4MGIE 2WX0A 3UGBB 5E6PA 1BT0A 3SD5A 2C7HA 3W1SA 4I6NB 2PE6B 5AEKB 3UQBA 1WJ6A 2MSED 5TR5A 3RZWC 5JZEB 2LUEA 3EECA 1YJ1A 1TBEA 3CF6E 3LDZE 1RFAA 3U30A 1E90A 2J0MA 2JPHA 4XZ4A 3M3JA 4ZRJA 4DBGA 2CKHB 3PT2B 3DVGX 2W9NA 1WR1A 2KWVB 4W9IA 3ZNID 2LZ6A 2KFJA 4GDKA 3B08A 1WXAA 2N9EB 1WX7A 3RULA 2MRPA 4DHZE 4FJYA 3R7RA 2VRRB 2K1FA 4AUQC 2NS5A 4KDLB 3V60A 3ZNHB 1WZ3A 4KZ0A 4ZYNA 2C7NB 3VDZA 2EMSA 2L3ZA 4AJWA 2D2QA 2GBNA 2N7EA 3U7DA 3V61A 2V4LA 2HTHA 2AYOB 3ALBA 3VUXA 1R4MI 2DHZA 2UWQA 3ZIMA 4MELA 2IO0B 4BFRA 4WJPA 3PPAA 1A5RA 4WQOB 2HE7A 5AZHA 5EDSA 2Z0DB 3VUYA 2ZNVC 4HLEA 3QA8A 4HWIB 3RZFA 3L10B 2KHWB 4BKSA 2D10A 4GDLB 2O2VA 3N3KB 1X1MA 4OVUA 2XEWA 2IYDB 3DBHI 1E7UA 3AU5A 2JRIB 1GJZA 1XD3B 2KKCA 1TTNA 1WMHA 1VCBA 4F8CB 4FN2A 2NVUI 3QIJA 3X23A 4ICUA 2B3AA 2KWCA 4B6WA 2GMIC 5CHWA 3SU8X 4IG7B 2FIDA 5D94A 2NR2A 2PPHA 2KX3A 2OJRA 2WDTB 3U8ZA 1WGDA 3A9KA 3R66C 3RUIB 4G11A 2IY0B 2KNBA 2L00B 4KIKA 2J0JA 2PJHA 4ZRKA 3WIMA 1I35A 2KZRA 3UF8A 2G3QB 3NZSA 3RT3B 1RRBA 3GZNI 4M8MA 1WR6E 3NOBA 4HJKA 1C3TA 1YQBA 4IC7B 2N4FA 4BVUC 4XX5A 3KUZA 3KVFB 1OEYA 2Z0EB 5BO4B 1ISNA 2FNJB 4EKUA 3VAWA 2KJ6A 3OAWA 1J19A 4ANVA 4GXBA 4IWOA 2NCNA 4IM0A 4TQ1A 1GG3A 4FA6A 3B0AA 2FCMA 1V2YA 4XC2A 4GDKB 1V5OA 2ZVOA 2MP2A 3QK0A 3VH4B 4WWPA 4EEWA 2ZCBA 4RM8A 4K7SA 3W1YA 5FR6A 3ZTCA 4AJYB 2MQJA 2REXA 4TV3A 4WJQA 2KQ7A 4MEMA 3VXWA 1WM2A 2MA9B 2DAJA 4P7IA 4MH0E 3QX1A 4JLCA 2BWFA 2C5LC 1C1YB 2GBJA 3DBRI 3PGEA 1WX8A 1WYWB 1UELA 4YL8A 4HCPB 3UQAA 3L17A 3JW0X 2BKRB 3QWZB 1P3QU 3APDA 2KFKA 2KJRA 4NQLB 4W9CA 2K8BA 3TCAA 1Q1OA 2MLBA 4PS3A 1P0RA 3QHTA 1J0GA 1ZW7A 3TJPA 1R4NI 4BKGA 3MHSD 3RYTA 4HXDA 2BKFA 4OVVA 3ZW3A 1EO6A 4DXAB 1WE6A 5JH5C 2K39A 4KDIC 3DDCB 1E8XA 1UH6A 4BBNF 3I3TB 3L0WB 3Q3JA 3VVWB 5DPTA 2PE9A 4NY0A 4W9LA 5L95C 1F9JA 1UGMA 2CHWA 2KDEB 2N9PC 2KANA 3ECIA 3KH0A 1OEYJ 4G0NB 2DYMA 2MBOA 2O6VA 4FULA 3N30A 2DX5B 1P1AA 2JVCA 2M1MA 1FXTB 1OQYA 5LXIB 3WA0A 4ASWC 1TZ1A 4PYUA 4FADA 2KC1A 3EHVA 4GMVA 2DZIA 2KC2A 3VFKA 3IG3A 3UIPB 2A4ZA 2L0FA 1WFYA 3SHQA 3ML8A 1WX9A 1EUVB 2ZPYA 1E5WA 2GBKA 2JF5A 1SIFA 1UBQA 5CTRC 3IVFA 4HPMB 3CMMB 4WAAA 1V6EA 2DZMA 2KOXA 4CO7A 2NPTB 3PVLA 4IW0A 3A9JA 1XT9B 2R2OA 4M0WB 3WALA 4F1SA 2DZJA 4K81A 2MP2B 2KJHB 3DPDA 4NJ6A 3H6NA 4NAWB 1OTRB 4DHJD 5J18A 3OLMD 4X57B 4GOCA 3ZRFA 3RD2A 4EUTA 3WAOA 1XQQA 3M95A 4GGQA 2UYZB 2IO3B 3IBEA 1VD2A 2FCQA 1P98A 2JWZA 3DVGY 4LCDE 4ZDVA 2MBHA 5J2RA 4MM3A 4NNJB 1HE8A 2BPSA 2K6DB 2ZPNA 3APFA 3QCAA 4HCNB 4J6IA 4W9KA 2K25A 2BWES 2M8SA 4KSLC 4DHJB 3DBLI 4JQWC 4HVBA 1WXVA 4A3OA 3AI5A 4TQ0A 3PRZA 2XK5B 2LXCA 3WAPA 4DDGD 2Z59B 1NI2A 3T9LA 3QARA 1UZXB 1UD7A 3QJZA 1E8YA 5JHAA 2LGYA 2JUOA 3M63B 2JY6A 3K9OB 1TGZB 3QAQA 2DENB 2IBIB 4K1RB 4MJSA 1Z2MA 2CHXA 2DYOA 2YVCA 3IHPC 4W9GA 2NBWB 3TMPB 4B9KA 5J17A 2KTRA 2D3GA 2EKEC 2N7DA 4IM3A 5IA7A 2BYEA 2FCNA 2AWTA 3R3MA 4WJOA 2LVPA 2NBVB 4A20A 4MSQB 2IO1B 2AL6A 2AL3A 1CMXB 1WY8A 1WJ4A 2RD0A 3PS6A 5E6OA 4GB9A 4N9F4 4A3PA 2LRUA 1L7YA 2GBMA 1WGYA 2MW5A 1GNUA 3L13A 1PQSA 3TIXA 4GSWA 4II2B 4ZRIA 3UIOB 4AOFA 4HK2A 4JL9A 3OJ4B 1EF5A 2D07B 1E7VA 3NZUA 2C7MB 2N1VA 5C23A 4K7UA 2FUHB 4IM2A 1ZGUB 1LM8B 3NY5A 3WAMA 4AWJA 1SGHA 1KOTA 2KN5A 4MGKE 3VUWA 4W9FA 2RPQA 2ZVNA 3NHEB 4TUUA 1YX5B 3W1SC 4CYEA 1KLVA 4KSKC 2L76A 3PTFC 5CX3A 3PRMB 3KUDB 2KO3A 1JRUA 2G4DB 1GUAB 1P9DU 2I1KA 2KX0A 3S2AA 2CHZA 1Y8RC 2LASA 4B95A 1Q0WB 3L08A 2RR9A 3DOWA 5DPWA 4NJ7A 3B1LX 1V5TA 3DVNV 2YLMA 4TKNA 3N32A 4I6PA 3HM6X 2R2QA 3PREA 2O2VB 2BYVE 1WGGA 2IZVB 2MBBB 2WX1A 2IO2B 1WZ0A 4FHKA 1WMHB 1V49A 4DWFA 4E74A 4ANUA 2JXXA 3AULA 3A4RA 3ZUNA 1GC7A 2KDIA 4W9EA 2DAFA 2KTFA 3PSEB 4E3CA 2RGFA 1WE7A 4IUMB 3A9KB 1Q5WB 4FJVB 4M8NA 4LDTD 1WH3A 2LJ5A 4FJZA 4KIKB 4E71A 4PYZA 3AXCA 1WM3A 2C9WB 3PLUA 3QC8B 1IP9A 4GU2A 3M62B 3ZKJC 4FLHA 2J7QB 3DQVA 4HDOA 5CHFA 1S1QB 1WJUA 2BYFA 2L8JA 4IWQA 1WGRA 2ASQA 1OGWA 2JZZA 2FIFA 2LVQA 3VHTC 4LDTB 1WXSA 1V81A 3UINB 4EZJA 5DPSA 2KDBA 4BBNC 2MBEA 4G50A 4MGYE 3EFUA 3VTUA 3PHWB 3TBLD 5DPRA 4BOZB 2BGFA 3OJ3A 3VH3B 4II3B 2G4SA 1YIWA 1G6JA 5G55A 3ZO5B 1WGHA 2XBBC 3X0WA 3JSVA 4URKA 2G45B 4RM9A 3WANA 3NS8A 1V80A 3CSFA 4KV2A 5KHOA 5E6NA 1LXDA 2M17A 3AU4A 2ZNVB 4EOYA 2KVRA 3RCZA 4F7ZA 2KFKB 2GBRA 4EZKA 2CS4A 3ZLZA 3MTNB 2ZEQA 1H8CA 4CHKA 4BKTA 1AARA 3ZVVA 2I1JA 2LI5A 5JHBA 4AP4C 3KW5B 2KK8A 2EMTA 2N1WA 1IPGA 2O6VD 3ENEA 4NQKE 5D7GA 5AZFA 3P2BA 5G2NA 2QHOA 2Y5BB 3H9DA 3PRPB 1NBFC 4FBJB 4K7WA 2KQSA 3A1QA 2JRHA 3KUCB 3VQIA 3ZNGC 3ZNZB 4EFOA 2O6VB 1WXMA 3PLVA 2LRWA 3H7PA 1T0YA 2AEHA 2BF8B 2J0KA 1U4AA 2V1YA 4IWPA 4PS8A 2GOWA 1YD8U 1K8RB 3A4SC 3L54A 4LJOB 3QQ8B 3C0RB 1LFDA 3DBSA 5AZGA 3PZDA 4G3XB 2M0XA 1S3SG 2LVOA 3V6CB 3ZRCA 4DHZB 2HJ8A 3V6EB 2C60A 1UBIA 2WYQA 3DCGA 4GIVA 1IYFA 3ZDMC 4W9DA 4HPLB 1QZEA 4KZCA 5HKHA 4MDKE 3SDLC 3ZDTA 3K9PB 2JT4B 3BINA 2L7RA 3IFWB 4DK5A 1I42A 3CSTA 1WRDB 4PS7A 5IAAC 2MBQA 2NBUA 3PV1A 3A9JB 4I6LB 2MCNB 2WWZA 3T8MA 2RSUA 2LWPA 1SE9A 1E8WA 2OOBB 2KLGA 2LXAA 1L2NA 3VTWA 3D32A 3H1UA 4NPNA 2MWSB 3DVNU 3HHMA 3R7QA 1RLFA 4W9JA 3H7SA 3JSVB 4LJPB 1D3ZA 4EZLA 3ML9A 5KHQA 1V9JA 2KDFB 2KWUB 3ONSA 4BKSD 4BOSC 3LJ3A 2PEAA 3BY4B 4WWNA 5L83A 1V86A 2N9XA 3Q3FA 1LQBA 1KM7A 1KJTA 1ZKHA 2JZ3B 1WJNA 2NPTA 1E8ZA 2ZJDA 4DDID 1MG8A 2LGDA 2K8HA 4MSMB 4FHJA 4RMAA 5D6JB 3APCA 4JGHB 3ZTDA 2A5UA 3PHXB 4KVGB 2MX2A 4NAWA 3V62A 4MGZE 4WJNA 2LD9A 2ZZPB 3KYDD 2KXJA 3TL5A 1YX6B 4JIOU 3HK0A 1EF1A 3KYCD 4HDQA 2D11A 2DYBA 4MJSB 4ICVA 3A1QB 2KMAA 2CU1A 4GN1A 5CHVC 3EC8A 2M4NA 1WI0A 1H4RA 5GMVA 1WIAA 2KTRB 1J8CA 3H7PB 2CR5A 2L0TA 3HM3A 4W9HA 1WF9A 2XK5A 2IY1B 5LLIA 1Z5SB 1NDDA 2K8CA 4GDLA
chains in the Genus database with same CATH superfamily
3JVZX 1PGBA 2GLSA 1RAXA 1SJHD 1ET9A 1QOFA 3N20C 1M94A 1WXQA 3O65B 2NMQA 1L4DB 2FUG1 4MGIE 1BT0A 4I6NB 3H8HA 5AEKB 1P7FA 4JPSA 3RZWC 3EECA 5BYQA 3CF6E 3LDZE 4DBGA 3CWIA 2KWVB 4W9IA 4GDKA 3N1XC 4DHZE 4FJYA 3AEAB 1SB3C 3R7RA 1HZ6A 2K1FA 2L3ZA 2D2QA 2GBNA 2W54A 3P4RB 4JX1C 5EE9A 2KQ4X 3VUYA 4BKSA 2D10A 2Q5WD 4GDLB 4MACA 2IYDB 2BYTA 3HUIA 1E7UA 2RPVA 3AU5A 1I4RA 5IO9A 4F8CB 3QIJA 3HVDA 1JALA 3X23A 4ICUA 2H88B 2KWCA 4B6WA 5CHWA 4WH4A 2BS2B 3AE9B 3LXFA 5IP4D 2KX3A 1SBBB 2WDTB 4HRSA 3R66C 3RUIB 4M00A 4AQ7A 2PJHA 5G5HA 3W2DA 2KZRA 2G3QB 3NVYA 1RRBA 1WWTA 4M8MA 4CQNA 2N4FA 3E56A 1FXAA 1UWMA 1CJEA 3OAWA 1J19A 1KH0A 1WGKA 4GXBA 4M01A 4IM0A 4WQMA 4FA6A 3B0AA 4XC2A 1XO3A 1I7HA 3GS2A 2ZVOA 3AEBB 1HTQA 3QK0A 3VH4B 4EEWA 2ZCBA 3W1YA 2REXA 2WS3B 2DAJA 3QX1A 3PGEA 1UELA 4YL8A 4HCPB 2AQ1B 4NQLB 1I4HA 3RFZB 1L0XB 1JMLA 2QJLA 3MHSD 4UDUC 4HXDA 3ZW3A 5MPOA 4KDIC 2QILA 3L0WB 5DPTA 2N9PC 4KZCA 1L4ZB 2O6VA 3N30A 1JW9D 2JVCA 5FKAC 2M1MA 1FXTB 4GMVA 4KKIA 4KGTA 3IG3A 4DQOC 3SHQA 1F1HA 1MG4A 2QIEB 3IVFA 3URYA 1T6BX 2DZMA 2KOXA 2WXNA 4M0WB 4K81A 1F77A 3UI3A 3OLMD 2X38A 3RD2A 3HVZA 2UYZB 3IBEA 4ZDVA 2FCQA 1P98A 2JWZA 2MBHA 4XGAB 1I4PA 3RI7C 2J53A 3QCAA 4OW0A 1ZDVA 4JQWC 4HVBA 4A3OA 2I2YA 1ZXIA 3PRZA 2JU6X 4ARCA 2LXCA 2Z59B 1NI2A 2WU5B 3J9CA 1JQ4A 3QARA 2K9XA 3IXSA 4YTNB 2CHXA 3IHPC 2KTRA 2QMTA 2D3GA 2M19A 4IM3A 5IA7A 2BYEA 1ENFA 4C7ZA 4WJOA 2LVPA 2AL6A 1CMXB 4C00A 5GXGB 5E6OA 4YSYB 4IOIE 2PVGC 1YJIA 4A3PA 3L13A 4ZRIA 2WXGA 2N1VA 2FUHB 4RH6A 2L32A 4ZOHC 4AWJA 1SGHA 2KN5A 3OWEB 3RN9C 4TUUA 3BYTB 3W1SC 4CYEA 2KT7A 3PRMB 3P1MA 1GUAB 2I1KA 1FMAD 2KX0A 2BS4B 3S2AA 3Q8FA 4B95A 5DPWA 4NJ7A 3O13A 1ZP0B 1V5TA 2WHIA 4BZAA 1YN3A 1WGGA 2IZVB 3IAM1 2IO2B 2PW9A 2EELA 2PVOD 1FIQA 4W9EA 2DAFA 1QT9A 3PSEB 4LNIA 4E3CA 2RGFA 3A9KB 2WXQA 1WH3A 3QC8B 3PLUA 1IP9A 2JX5A 4HKQA 1UNSA 2BS3B 1WJUA 2L8JA 3P4QB 2WNMA 2LVQA 4XYCA 2H89B 1WXSA 3UINB 4EZJA 2MBEA 2V9HA 3PHWB 3VH3B 2G4SA 2G9HD 5G55A 2XBBC 4C4VA 2G45B 2UU7A 2VZKB 3CSFA 3RCZA 2ZEQA 4CHKA 4BKTA 1AARA 2LI5A 4AP4C 1L5PA 2IGDA 5G2NA 3PRPB 2MH7A 3A1QA 3KUCB 3KWLA 1MFWA 4EFOA 3RNGC 1WXMA 2WXIA 2J0KA 4PS8A 1K8RB 1XLPA 3DBSA 3V6CB 2LVOA 3ZRCA 2HJ8A 3V6EB 1UBIA 5BMGA 4GIVA 1IYFA 3AECB 5HKHA 4MDKE 3SDLC 2WXRA 3U52E 4DK5A 5IAAC 2MBQA 3A9JB 1K52A 2OOBB 1E8WA 1TS2A 2KLGA 3AEDB 2LXAA 4C7YA 4WWMA 1SXTA 3VRAB 3D32A 1FXIA 2NTTA 5C3JB 2GI9A 4EZLA 2KDFB 4BKSD 1BUIC 4MM3B 2PEAA 3BY4B 2JQRB 2N9XA 3Q3FA 2AQ3B 2KVZA 2ZJDA 4DDID 4M0WA 1MG8A 2LGDA 1D5MC 1DOIA 4MSMB 4FHJA 5D6JB 4JGHB 3ZTDA 3NVWA 3DBHB 4WJNA 2LD9A 4JIOU 3HK0A 2WXFA 2DYBA 1YNTE 2KMAA 5AUIA 2CU1A 5CHVC 1SE2A 4L1BA 2KACA 4XWWA 1J8CA 5E6JA 4W9HA 1T0SC 1WF9A 5LLIA 4RGTA 1I4GA 2KLCA 1F52A 5LXHA 1GPXA 4RF1A 1D5ZC 3BWUD 5C1ZA 4ANXA 5DCNA 2DZKA 2FCSA 2WDQB 2LGXA 1E9MA 3UGBB 2AQ2B 1UUPA 2PE6B 2LUEA 3U30A 1E90A 2J0MA 1UGJA 4ZRPA 4BAXA 2W9NA 1WR1A 3ZNID 2KFJA 3B08A 4LNNA 2M56B 1LGRA 1QOGA 1KFYB 2MRPA 4AUQC 2NS5A 4KDLB 4ZYNA 2C7NB 2EMSA 3GE8C 4AJWA 2WU2B 3ALBA 1R4MI 2DHZA 4MELA 4ARIA 2HE7A 3SR6A 4US9A 2ZNVC 4HLEA 3QA8A 4HWIB 3L10B 1P7EA 1T5XD 4HPPA 4OVUA 2XEWA 1YOVB 1XD3B 1VCBA 4A9AA 2NVUI 2N7JA 4A90A 2W55A 1NENB 1WGDA 3A9KA 4G11A 2KNBA 5LNK1 3GZNI 3NOBA 1C3TA 1ZUD2 2G1EA 1YQBA 3FKYA 2Y5PA 1M4VA 4XX5A 3KVFB 2Z0EB 5BO4B 3IT6B 3AE7B 4LNOA 1FD6A 3TEYA 2INNE 4TQ1A 2FCMA 3RMKC 2DLBA 3DBLB 3P42A 2MP2A 1MPEA 2LMCA 4WJQA 1SIJA 1WM2A 2L52A 1QKZA 4HJGE 2LUMA 2GBJA 1WX8A 1WYWB 2PKOA 1TKGA 3BK1A 3UQAA 3ZGZA 1V1PA 2HJ1A 3JW0X 4W9CA 2K8BA 1Q1OA 1EWCA 1TY2A 4PS3A 1MHXA 1BXTA 4FXCA 4PT5A 2BT6A 5JH5C 1SF0A 2K39A 3BVMA 1UH6A 3VVWB 5L95C 3FAHA 1F9JA 2CHWA 2KANA 4G0NB 1Q10A 1OQYA 5LXIB 1TZ1A 5IKCM 3EHVA 3U2SC 3I5JC 5AUKA 1EUVB 2ZPYA 1FFVA 2LGIA 2GBKA 1SIFA 1SEBD 3CMMB 2JWUA 1V6EA 4K3BA 2NPTB 4IW0A 3A9JA 1GAQB 3WALA 4F1SA 3TUOA 2N0SB 1VZ8A 3NZ3A 1R4NB 4NJ6A 5J18A 3WAOA 1XQQA 2D5GA 2IO3B 3DVGY 4MM3A 4NZLB 2BPSA 3APFA 1XLQA 2D3AA 1UF0A 2K25A 2M8SA 1E6EB 3AE4B 3BYYB 4TQ0A 2XK5B 1L6VA 4DDGD 3N1ZC 1E8YA 5JHAA 3M63B 1AWDA 2DENB 2IBIB 1L6UA 2YEPB 3E9SA 4LNKA 2CJOA 1D4BA 5IOIA 1JWSD 4W9GA 4B9KA 4ZYSA 1ZOYB 5J17A 3R3MA 1GB4A 2NBVB 3IT4B 4MSQB 3FILB 4GLSC 4MH8A 2RD0A 4GB9A 4N9F4 1TIFA 2N9KA 4LLGM 1WGYA 2MW5A 1GNUA 1PQSA 4GSWA 4HK2A 2IGGA 1FRDA 2NTSA 1L0VB 1OFFA 2C7MB 1ZGUB 1LM8B 3NY5A 5HG2A 1KOTA 4MGKE 2BVCA 1YN5A 2L76A 1XF5L 3KUDB 3R8BA 3ZYYX 2INDC 4YT0B 1KTKA 2RR9A 3L08A 1FFUA 4TKNA 4I6PA 3PREA 2O2VB 2WX1A 1N60A 4DWFA 3NRZA 4ANUA 2BBCA 3AULA 2MEKA 1WE7A 4IUMB 4M8NA 1N62A 4FJZA 3VRBB 1TT5B 4PYZA 2C9WB 2IGHA 2DWQA 3M62B 3ZKJC 2L1AA 3EUB2 1S1QB 1FM0D 1WGRA 2ASQA 1OGWA 5D3DA 3TEXA 5DPSA 2KDBA 1CK1A 4G50A 1IGDA 4MGYE 2WDRB 3TBLD 4TSSA 5DPRA 4BOZB 2BGFA 1PFDA 1VLBA 4II3B 4USAA 1G6JA 1C4CA 2IDYA 4N59A 3L4PA 3JSVA 2XNAC 1V80A 5E6NA 3P4PB 2ZNVB 3AEEB 2K5PA 3ZLZA 3MTNB 1OQQA 3Q8AA 3ZVVA 2KK8A 3ENEA 3NVVA 3Q3MC 2Y5BB 1TS4A 4FBJB 1TKYA 4K7WA 2V3PA 1I4QA 1SJED 3VQIA 1C4AA 1IUEA 3ZNZB 2ON8A 3ZXVA 3H7PA 1QLBB 1U4AA 2V1YA 1JWAD 3MHZA 1YD8U 3A4SC 1V1OA 4ZRQA 4LJOB 1LFDA 4DHZB 4G3XB 2M0XA 4K3CA 1QZEA 1N5WA 3VR9B 3B2FA 1WRDB 3PV1A 2NBUA 1C9FA 2WWZA 1B1ZA 2MWSB 4W9JA 2ZW1A 3H7SA 1NVID 5KHQA 1V9JA 3ONSA 3RNBC 5EE3A 1R7SA 1C79A 1KJTA 1ZKHA 1WJNA 2NPTA 1E8ZA 5D3IB 3AE8B 3W9CB 2K8HA 5TSSA 1L0YB 3RNEC 3PHXB 4MGZE 4JWSC 1FNVA 2D11A 4MJSB 2CJNA 4C56C 1TS5A 3EC8A 5GMVA 1EWYC 2TSSA 1B9RA 2L0TA 2XK5A 1NDDA 1D6EC 2K8CA 4GDLA 4P1CC 2ZCCA 2WXOA 3LYYA 5D2MB 2FAZA 3MC9A 4RGOS 1QILA 1GC6A 3GOEA 3MJWA 2KMCA 1EM7A 3JYUA 4ANWA 3MJ5A 2WX0A 2VZKD 5I4DA 1PUTA 2MJ3A 3ZXRA 1WJ6A 5JZEB 1E0ZA 1TBEA 1RFAA 1TJEA 4P16A 3SFDB 2K22A 4ZRJA 1NYRA 2CKHB 1TZOA 3PT2B 3DVGX 4ITKA 3V05A 2LZ6A 1WXAA 2N9EB 1CQVA 1WX7A 4YSXB 1XXGA 1FCLA 4XWTA 2VRRB 3ZJTA 4KZ0A 1MVKA 3ZJUA 3V61A 2AYOB 3VUXA 2JXTA 2UWQA 1RM6C 4C80A 4HKZE 4BFRA 4WJPA 1A5RA 2OJWA 5AZHA 4YTPB 2Z0DB 1SE3A 2ONQA 3RZFA 4AS1A 2KHWB 4US8A 2O2VA 3VR8B 3N3KB 1X1MA 2JYEA 2JYTA 1GOZA 3R2TA 1TTNA 4FN2A 1JROA 2B3AA 3SU8X 4IG7B 2FIDA 1EU3A 5D94A 2NR2A 2GB1A 2PPHA 2OJRA 3AE5B 2J4XA 4ZRKA 3WIMA 4RGMA 4TMAB 1VRAB 1YN4A 4IC7B 3KUZA 1OEYA 1ISNA 3VAWA 3AN1A 1HQRD 4IWOA 2NCNA 1TYGB 4GDKB 4NAMA 1V5OA 2RDGA 4WWPA 3AV8A 4RM8A 4K7SA 3ZTCA 2QCZA 1PGXA 4TV3A 1ZXHA 2KQ7A 1XLNA 3C8YA 3DHHC 1ZE3D 4HROA 4JLCA 2BWFA 2E6XA 2AX5A 4P6VF 3L17A 1CZPA 1P3QU 1FEHA 2JSVX 2KJRA 3TCAA 2WXKA 2K0PA 4S17A 1Y56A 4OZBA 4KKJA 3QHTA 1J0GA 1ZW7A 3TJPA 1R4NI 1F2RI 2BKFA 2KYWA 1WE6A 3TSSA 1YQ4B 2K3UA 3NG0A 4BBNF 2FBWB 3Q3JA 2KMMA 2KDEB 3KH0A 1T3QA 2MBOA 4FULA 2DX5B 1P1AA 2LGSA 1KRHA 1I4XA 4ASWC 4PYUA 4FADA 2KC1A 3GP7A 2DZIA 2KC2A 3VFKA 3UIPB 2A4ZA 2L0FA 1WFYA 2Z8LA 4DXFA 1HTOA 2JF5A 2BB6A 3DBRB 5H92C 1AYFA 2WXPA 3RNFC 1WSPA 4CO7A 3PVLA 2PTLA 2R2OA 1XCTL 4OZCA 2KJHB 3EGRA 3DPDA 3H6NA 4NAWB 4S0RA 4X57B 4GOCA 3ZRFA 3M95A 1VD2A 4NNJB 1HE8A 3GB1A 2WLBA 4W9KA 1RFKA 3AI5A 2M0AA 2WQYB 1ZPSA 3T9LA 3LB8C 2L83A 3QJZA 2LGYA 2JUOA 3PO0A 3K9OB 1TGZB 4K1RB 4MJSA 2DYOA 1KLUD 2IJ0A 2YVCA 2FE8A 2NBWB 3TMPB 4B0MA 3KQ4A 3MP9A 2FCNA 2AWTA 4DXGA 1JRPA 1J7CA 2IO1B 4RFBA 2AL3A 1WY8A 3PS6A 3ETRA 2Y3AA 2LRUA 1L7YA 4II2B 1STEA 3UIOB 3RPFC 4JL9A 3Q8BA 3ABVB 3OJ4B 2D07B 3AEGB 5C23A 3Q8EA 4K7UA 4IM2A 2PMVA 4WURA 1VJKA 4W9FA 2ZVNA 1PGAA 1MHHE 3EA6A 4KSKC 1QOBA 5CX3A 1JRUA 2CU3A 2KO3A 1P9DU 3TEWA 2CHZA 3KLSX 4YSZB 3DOWA 3SFEB 3B1LX 1JCKB 3N32A 3HM6X 2R2QA 1QQRA 5HFYA 2MJDA 4NJCA 1V97A 5BYRA 2BYVE 2MBBB 1WMHB 1V49A 4E74A 4YXDB 4MT5A 2BW2A 3B2GA 3RNCC 3IAS1 4XE0A 3ZUNA 1GC7A 2KDIA 4WAFA 5JXVA 4FJVB 2B76B 3NUHB 2LJ5A 2QEJC 4KIKB 2N9LA 1WM3A 5EE1A 3DQVA 4ZHPA 2EKIA 1NYQA 1E10A 2JZZA 2FIFA 1A70A 1V81A 2OHFA 2LHEA 3Q2AC 4OHJA 3EFUA 3VTUA 3DHGC 2QDFA 3ZO5B 1NEKB 1TS3A 1XLOA 3X0WA 4L2YA 2D3CA 3NS8A 1VZ6A 4KV2A 5FK9C 1LXDA 2M17A 4ACFA 4EOYA 2KVRA 2KFKB 2GBRA 4EZKA 2CS4A 1H8CA 1WRIA 3CIRB 3NS1A 5BYSA 1WYGA 2I1JA 3KW5B 2N1WA 1XEEA 4NQKE 5D7GA 5AZFA 3P2BA 1MJDA 2QHOA 4KGRA 1NBFC 2KQSA 2WXMA 3ZNGC 4JWUC 3SEBA 1IBXB 3PLVA 2BF8B 2VH2A 3RNAC 3NJTA 3L54A 3QQ8B 2KWDA 3P63A 5AZGA 1S3SG 4OZAA 2C60A 2WYQA 3DCGA 4W9DA 2X8XX 1RWSA 2JT4B 2WDVB 3BINA 3K9PB 3IFWB 3CSTA 3T8MA 2MCNB 1J7BA 5C2TB 1SE9A 4H2AA 1NI3A 1RLFA 4C4VB 1EU4A 1D3ZA 3DWGC 3ML9A 2KWUB 1TY0A 1R4MB 5L83A 4WWNA 1V86A 2ZW0A 1LQBA 1TKEA 1KM7A 4N6EB 5G5GA 4M02A 3TEZA 4RMAA 3APCA 4KVGB 2INPE 4NAWA 3V62A 3FC4A 2SEBD 1AN8A 2KXJA 3TL5A 3NVZA 4ICVA 3A1QB 4GN1A 2M4NA 1JWMD 1WI0A 3R2IA 1WIAA 2CR5A 4XDCA 3HM3A 2W3RA 2ICIA 2IY1B 2Y5CA 1Z5SB 3GZNB 3MFGA 4L23A 4WWOA 2K6QA 3VTVA 2L05A 2JZPA 4PK1A 3L16A 1E7PB 3HIZA 2KD0A 3A33B 4YTMB 2HD5B 2IPKD 2V3SA 3AB5A 5E6PA 2DBYA 3SD5A 2C7HA 3B9JA 3W1SA 3UQBA 2XN9C 2MSED 5TR5A 1AW7A 1YJ1A 1YJJA 2JPHA 4XZ4A 3M3JA 1FPYA 1N5XA 3WCQA 3Q3OC 1J7AA 5EE0A 3RULA 2BQQA 3EFCA 2WGSA 3ZNHB 3V60A 1WZ3A 2HDEA 1ET6A 3VDZA 2N7EA 3U7DA 3PZ7A 2V4LA 3AE2B 2HTHA 4QAYA 3U7ZA 3U4EG 3ZIMA 2IO0B 1T0RC 2RDHA 3PPAA 4WQOB 5EDSA 2QSDA 2WP9B 3BK2A 1QF6A 3DBHI 4D2KA 2JRIB 1GJZA 2KKCA 3I57A 1WMHA 3I63C 2GMIC 3U8ZA 3KWVA 2IY0B 2L00B 2VH1A 4KIKA 2J0JA 1I35A 3C19A 4LK0M 4ZHOA 5IN7A 2R61A 3UF8A 3NZSA 3RT3B 1WR6E 4HJKA 4BVUC 2FNJB 4EKUA 2KJ6A 4LNFA 4ANVA 3OG5A 2RMMA 1GG3A 1V2YA 3PZ8A 1HEZE 4KGSA 5FR6A 4AJYB 2MQJA 3BIID 3N1YC 1N61A 4MEMA 3VXWA 2MA9B 4P7IA 4MH0E 5H8YE 2C5LC 1C1YB 3DBRI 1IGCA 3QWZB 2BKRB 3APDA 2KFKA 1MI0A 2MLBA 1SE4A 1P0RA 3AMZA 2WXJA 4BKGA 2GRIA 3RYTA 4OVVA 4DXAB 1EO6A 1JWUD 3DDCB 1E8XA 4RF0A 2BTEA 3AE3B 3I3TB 1D5XC 2LHDA 2PE9A 2PLPA 4NY0A 4W9LA 2J42A 1UGMA 3ECIA 3WAMA 1OEYJ 2DYMA 1IBXA 4WIPA 1V8CA 1HZ5A 3WA0A 1N6ZA 1K53A 3FILA 5FR3A 3ML8A 1WX9A 4N58A 1E5WA 3BZDB 1UBQA 5CTRC 4HPMB 3Q3NC 4WAAA 2HTME 4A55A 4YWGG 1XCQL 1XT9B 2DZJA 1DOYA 2MP2B 3Q69A 1FRRA 1OTRB 1ZDXA 4DHJD 1LO5D 2V0GA 4EUTA 1FO4A 4GGQA 4A6QA 1C76A 4LCDE 5J2RA 1DOXA 2BB5A 4R3DA 2K6DB 2ZPNA 3P4SB 4HCNB 4J6IA 1V1PB 4KSLC 2BWES 4DHJB 3DBLI 1WXVA 4RCOA 3WAPA 3V3XA 3BVGA 1UZXB 1UD7A 2W3SA 1F2RC 2JY6A 3QAQA 1Z2MA 2YEPF 2OEDA 1T0QC 3N9YC 1YQ3B 2EKEC 2N7DA 4LTUA 4A20A 1OQRA 1WJ4A 2E3TA 1F0ZA 2GBMA 2J52A 2WXHA 3DHIC 1SSNA 2V4IB 2KN4A 3TIXA 1DYQA 4AOFA 2MJEA 1EF5A 2INCC 1E7VA 3NZUA 3AH7A 5HI1A 2RDBC 3MC8A 1FCCC 1ACCA 3VUWA 2WXLA 2RPQA 3NHEB 1YX5B 1KLVA 3PTFC 3AE6B 1K50A 2G4DB 1C77A 1Y8RC 2LASA 1Q0WB 3T3NA 2D3BA 3W5UB 3DVNV 2YLMA 4IKGA 1WZ0A 4FHKA 3DWMA 3Q14C 2LJIA 2JXXA 3A4RA 2QC8A 2KTFA 2MHJA 1Q5WB 2KAJA 1HA5A 4LDTD 1C4PA 4E71A 3AXCA 2PIAA 4XDDA 4GU2A 4FLHA 2J7QB 4HDOA 3HRDD 4OVZA 5CHFA 1GB1A 2BYFA 2W82A 4IWQA 3VHTC 4LDTB 4BBNC 3GE3C 1C78A 4B0EA 3T3OA 3OJ3A 1PDXA 3Q6BA 1YIWA 2DNFA 1VDVA 1WGHA 1VZ7A 4EE2A 1RYJA 4URKA 4RM9A 3WANA 4J3OD 2LFIA 5KHOA 3AU4A 4F7ZA 4P1BC 4JE3B 5JHBA 2KDMA 2V3NA 2EMTA 1IPGA 2O6VD 3AE1B 1KF6B 3H9DA 2JRHA 1YMHE 2SAKA 4KX6B 1DGJA 5BMIA 2O6VB 1JWBD 2LRWA 1T0YA 2AEHA 4IWPA 2GOWA 1FNWA 3C0RB 1BMLC 3PZDA 3ZQ4A 3ZDMC 4HPLB 3ZJVA 1N63A 3ZDTA 2L7RA 1I42A 4PS7A 1VR9A 4I6LB 1ROEA 2RSUA 2LWPA 1L2NA 4RNAA 4Q2JA 3VTWA 3H1UA 1KLGD 4NPNA 3Q8CA 3DVNU 5T8IA 3HHMA 3R7QA 2ACZB 3JSVB 4LJPB 3AEFB 4A8XC 4BOSC 3LJ3A 4IDIA 1UWXA 3BVZA 4O1NA 2JZ3B 4REZA 3MC0B 2I38A 2LEKA 3W5VB 2A5UA 2MX2A 2ZZPB 3KYDD 1HXYD 1YX6B 1FNUA 1EF1A 3KYCD 4HDQA 4HEA1 5BMHA 1K51A 5HHDG 1ESFA 1H4RA 1QOAA 1PYWD 2KTRB 4RGNA 3H7PB 3AM9A 3I9V1
chains in the Genus database with same CATH topology
3JVZX 4WWOA 2K6QA 2ZCCA 2L05A 3VTVA 2KLCA 3L16A 5LXHA 5D2MB 1RAXA 5C1ZA 2FAZA 4ANXA 5DCNA 2DZKA 3HIZA 2KD0A 3O65B 1M94A 2FCSA 1GC6A 3A33B 3GOEA 2LGXA 2HD5B 3MJWA 2KMCA 2V3SA 4ANWA 3JYUA 4MGIE 2WX0A 3UGBB 5E6PA 1BT0A 3SD5A 2C7HA 3W1SA 4I6NB 2PE6B 5AEKB 3UQBA 1WJ6A 2MSED 5TR5A 3RZWC 5JZEB 2LUEA 3EECA 1YJ1A 1TBEA 3CF6E 3LDZE 1RFAA 3U30A 1E90A 2J0MA 2JPHA 4XZ4A 3M3JA 4ZRJA 4DBGA 2CKHB 3PT2B 3DVGX 2W9NA 1WR1A 2KWVB 4W9IA 3ZNID 2LZ6A 2KFJA 4GDKA 3B08A 1WXAA 2N9EB 1WX7A 3RULA 2MRPA 4DHZE 4FJYA 3R7RA 2VRRB 2K1FA 4AUQC 2NS5A 4KDLB 3V60A 3ZNHB 1WZ3A 4KZ0A 4ZYNA 2C7NB 3VDZA 2EMSA 2L3ZA 4AJWA 2D2QA 2GBNA 2N7EA 3U7DA 3V61A 2V4LA 2HTHA 2AYOB 3ALBA 3VUXA 1R4MI 2DHZA 2UWQA 3ZIMA 4MELA 2IO0B 4BFRA 4WJPA 3PPAA 1A5RA 4WQOB 2HE7A 5AZHA 5EDSA 2Z0DB 3VUYA 2ZNVC 4HLEA 3QA8A 4HWIB 3RZFA 3L10B 2KHWB 4BKSA 2D10A 4GDLB 2O2VA 3N3KB 1X1MA 4OVUA 2XEWA 2IYDB 3DBHI 1E7UA 3AU5A 2JRIB 1GJZA 1XD3B 2KKCA 1TTNA 1WMHA 1VCBA 4F8CB 4FN2A 2NVUI 3QIJA 3X23A 4ICUA 2B3AA 2KWCA 4B6WA 2GMIC 5CHWA 3SU8X 4IG7B 2FIDA 5D94A 2NR2A 2PPHA 2KX3A 2OJRA 2WDTB 3U8ZA 1WGDA 3A9KA 3R66C 3RUIB 4G11A 2IY0B 2KNBA 2L00B 4KIKA 2J0JA 2PJHA 4ZRKA 3WIMA 1I35A 2KZRA 3UF8A 2G3QB 3NZSA 3RT3B 1RRBA 3GZNI 4M8MA 1WR6E 3NOBA 4HJKA 1C3TA 1YQBA 4IC7B 2N4FA 4BVUC 4XX5A 3KUZA 3KVFB 1OEYA 2Z0EB 5BO4B 1ISNA 2FNJB 4EKUA 3VAWA 2KJ6A 3OAWA 1J19A 4ANVA 4GXBA 4IWOA 2NCNA 4IM0A 4TQ1A 1GG3A 4FA6A 3B0AA 2FCMA 1V2YA 4XC2A 4GDKB 1V5OA 2ZVOA 2MP2A 3QK0A 3VH4B 4WWPA 4EEWA 2ZCBA 4RM8A 4K7SA 3W1YA 5FR6A 3ZTCA 4AJYB 2MQJA 2REXA 4TV3A 4WJQA 2KQ7A 4MEMA 3VXWA 1WM2A 2MA9B 2DAJA 4P7IA 4MH0E 3QX1A 4JLCA 2BWFA 2C5LC 1C1YB 2GBJA 3DBRI 3PGEA 1WX8A 1WYWB 1UELA 4YL8A 4HCPB 3UQAA 3L17A 3JW0X 2BKRB 3QWZB 1P3QU 3APDA 2KFKA 2KJRA 4NQLB 4W9CA 2K8BA 3TCAA 1Q1OA 2MLBA 4PS3A 1P0RA 3QHTA 1J0GA 1ZW7A 3TJPA 1R4NI 4BKGA 3MHSD 3RYTA 4HXDA 2BKFA 4OVVA 3ZW3A 1EO6A 4DXAB 1WE6A 5JH5C 2K39A 4KDIC 3DDCB 1E8XA 1UH6A 4BBNF 3I3TB 3L0WB 3Q3JA 3VVWB 5DPTA 2PE9A 4NY0A 4W9LA 5L95C 1F9JA 1UGMA 2CHWA 2KDEB 2N9PC 2KANA 3ECIA 3KH0A 1OEYJ 4G0NB 2DYMA 2MBOA 2O6VA 4FULA 3N30A 2DX5B 1P1AA 2JVCA 2M1MA 1FXTB 1OQYA 5LXIB 3WA0A 4ASWC 1TZ1A 4PYUA 4FADA 2KC1A 3EHVA 4GMVA 2DZIA 2KC2A 3VFKA 3IG3A 3UIPB 2A4ZA 2L0FA 1WFYA 3SHQA 3ML8A 1WX9A 1EUVB 2ZPYA 1E5WA 2GBKA 2JF5A 1SIFA 1UBQA 5CTRC 3IVFA 4HPMB 3CMMB 4WAAA 1V6EA 2DZMA 2KOXA 4CO7A 2NPTB 3PVLA 4IW0A 3A9JA 1XT9B 2R2OA 4M0WB 3WALA 4F1SA 2DZJA 4K81A 2MP2B 2KJHB 3DPDA 4NJ6A 3H6NA 4NAWB 1OTRB 4DHJD 5J18A 3OLMD 4X57B 4GOCA 3ZRFA 3RD2A 4EUTA 3WAOA 1XQQA 3M95A 4GGQA 2UYZB 2IO3B 3IBEA 1VD2A 2FCQA 1P98A 2JWZA 3DVGY 4LCDE 4ZDVA 2MBHA 5J2RA 4MM3A 4NNJB 1HE8A 2BPSA 2K6DB 2ZPNA 3APFA 3QCAA 4HCNB 4J6IA 4W9KA 2K25A 2BWES 2M8SA 4KSLC 4DHJB 3DBLI 4JQWC 4HVBA 1WXVA 4A3OA 3AI5A 4TQ0A 3PRZA 2XK5B 2LXCA 3WAPA 4DDGD 2Z59B 1NI2A 3T9LA 3QARA 1UZXB 1UD7A 3QJZA 1E8YA 5JHAA 2LGYA 2JUOA 3M63B 2JY6A 3K9OB 1TGZB 3QAQA 2DENB 2IBIB 4K1RB 4MJSA 1Z2MA 2CHXA 2DYOA 2YVCA 3IHPC 4W9GA 2NBWB 3TMPB 4B9KA 5J17A 2KTRA 2D3GA 2EKEC 2N7DA 4IM3A 5IA7A 2BYEA 2FCNA 2AWTA 3R3MA 4WJOA 2LVPA 2NBVB 4A20A 4MSQB 2IO1B 2AL6A 2AL3A 1CMXB 1WY8A 1WJ4A 2RD0A 3PS6A 5E6OA 4GB9A 4N9F4 4A3PA 2LRUA 1L7YA 2GBMA 1WGYA 2MW5A 1GNUA 3L13A 1PQSA 3TIXA 4GSWA 4II2B 4ZRIA 3UIOB 4AOFA 4HK2A 4JL9A 3OJ4B 1EF5A 2D07B 1E7VA 3NZUA 2C7MB 2N1VA 5C23A 4K7UA 2FUHB 4IM2A 1ZGUB 1LM8B 3NY5A 3WAMA 4AWJA 1SGHA 1KOTA 2KN5A 4MGKE 3VUWA 4W9FA 2RPQA 2ZVNA 3NHEB 4TUUA 1YX5B 3W1SC 4CYEA 1KLVA 4KSKC 2L76A 3PTFC 5CX3A 3PRMB 3KUDB 2KO3A 1JRUA 2G4DB 1GUAB 1P9DU 2I1KA 2KX0A 3S2AA 2CHZA 1Y8RC 2LASA 4B95A 1Q0WB 3L08A 2RR9A 3DOWA 5DPWA 4NJ7A 3B1LX 1V5TA 3DVNV 2YLMA 4TKNA 3N32A 4I6PA 3HM6X 2R2QA 3PREA 2O2VB 2BYVE 1WGGA 2IZVB 2MBBB 2WX1A 2IO2B 1WZ0A 4FHKA 1WMHB 1V49A 4DWFA 4E74A 4ANUA 2JXXA 3AULA 3A4RA 3ZUNA 1GC7A 2KDIA 4W9EA 2DAFA 2KTFA 3PSEB 4E3CA 2RGFA 1WE7A 4IUMB 3A9KB 1Q5WB 4FJVB 4M8NA 4LDTD 1WH3A 2LJ5A 4FJZA 4KIKB 4E71A 4PYZA 3AXCA 1WM3A 2C9WB 3PLUA 3QC8B 1IP9A 4GU2A 3M62B 3ZKJC 4FLHA 2J7QB 3DQVA 4HDOA 5CHFA 1S1QB 1WJUA 2BYFA 2L8JA 4IWQA 1WGRA 2ASQA 1OGWA 2JZZA 2FIFA 2LVQA 3VHTC 4LDTB 1WXSA 1V81A 3UINB 4EZJA 5DPSA 2KDBA 4BBNC 2MBEA 4G50A 4MGYE 3EFUA 3VTUA 3PHWB 3TBLD 5DPRA 4BOZB 2BGFA 3OJ3A 3VH3B 4II3B 2G4SA 1YIWA 1G6JA 5G55A 3ZO5B 1WGHA 2XBBC 3X0WA 3JSVA 4URKA 2G45B 4RM9A 3WANA 3NS8A 1V80A 3CSFA 4KV2A 5KHOA 5E6NA 1LXDA 2M17A 3AU4A 2ZNVB 4EOYA 2KVRA 3RCZA 4F7ZA 2KFKB 2GBRA 4EZKA 2CS4A 3ZLZA 3MTNB 2ZEQA 1H8CA 4CHKA 4BKTA 1AARA 3ZVVA 2I1JA 2LI5A 5JHBA 4AP4C 3KW5B 2KK8A 2EMTA 2N1WA 1IPGA 2O6VD 3ENEA 4NQKE 5D7GA 5AZFA 3P2BA 5G2NA 2QHOA 2Y5BB 3H9DA 3PRPB 1NBFC 4FBJB 4K7WA 2KQSA 3A1QA 2JRHA 3KUCB 3VQIA 3ZNGC 3ZNZB 4EFOA 2O6VB 1WXMA 3PLVA 2LRWA 3H7PA 1T0YA 2AEHA 2BF8B 2J0KA 1U4AA 2V1YA 4IWPA 4PS8A 2GOWA 1YD8U 1K8RB 3A4SC 3L54A 4LJOB 3QQ8B 3C0RB 1LFDA 3DBSA 5AZGA 3PZDA 4G3XB 2M0XA 1S3SG 2LVOA 3V6CB 3ZRCA 4DHZB 2HJ8A 3V6EB 2C60A 1UBIA 2WYQA 3DCGA 4GIVA 1IYFA 3ZDMC 4W9DA 4HPLB 1QZEA 4KZCA 5HKHA 4MDKE 3SDLC 3ZDTA 3K9PB 2JT4B 3BINA 2L7RA 3IFWB 4DK5A 1I42A 3CSTA 1WRDB 4PS7A 5IAAC 2MBQA 2NBUA 3PV1A 3A9JB 4I6LB 2MCNB 2WWZA 3T8MA 2RSUA 2LWPA 1SE9A 1E8WA 2OOBB 2KLGA 2LXAA 1L2NA 3VTWA 3D32A 3H1UA 4NPNA 2MWSB 3DVNU 3HHMA 3R7QA 1RLFA 4W9JA 3H7SA 3JSVB 4LJPB 1D3ZA 4EZLA 3ML9A 5KHQA 1V9JA 2KDFB 2KWUB 3ONSA 4BKSD 4BOSC 3LJ3A 2PEAA 3BY4B 4WWNA 5L83A 1V86A 2N9XA 3Q3FA 1LQBA 1KM7A 1KJTA 1ZKHA 2JZ3B 1WJNA 2NPTA 1E8ZA 2ZJDA 4DDID 1MG8A 2LGDA 2K8HA 4MSMB 4FHJA 4RMAA 5D6JB 3APCA 4JGHB 3ZTDA 2A5UA 3PHXB 4KVGB 2MX2A 4NAWA 3V62A 4MGZE 4WJNA 2LD9A 2ZZPB 3KYDD 2KXJA 3TL5A 1YX6B 4JIOU 3HK0A 1EF1A 3KYCD 4HDQA 2D11A 2DYBA 4MJSB 4ICVA 3A1QB 2KMAA 2CU1A 4GN1A 5CHVC 3EC8A 2M4NA 1WI0A 1H4RA 5GMVA 1WIAA 2KTRB 1J8CA 3H7PB 2CR5A 2L0TA 3HM3A 4W9HA 1WF9A 2XK5A 2IY1B 5LLIA 1Z5SB 1NDDA 2K8CA 4GDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVZ X;  4WWO A;  2K6Q A;  2ZCC A;  2L05 A;  3VTV A;  2KLC A;  3L16 A;  5LXH A;  5D2M B;  1RAX A;  5C1Z A;  2FAZ A;  4ANX A;  5DCN A;  2DZK A;  3HIZ A;  2KD0 A;  3O65 B;  1M94 A;  2FCS A;  1GC6 A;  3A33 B;  3GOE A;  2LGX A;  2HD5 B;  3MJW A;  2KMC A;  2V3S A;  4ANW A;  3JYU A;  4MGI E;  2WX0 A;  3UGB B;  5E6P A;  1BT0 A;  3SD5 A;  2C7H A;  3W1S A;  4I6N B;  2PE6 B;  5AEK B;  3UQB A;  1WJ6 A;  2MSE D;  5TR5 A;  3RZW C;  5JZE B;  2LUE A;  3EEC A;  1YJ1 A;  1TBE A;  3CF6 E;  3LDZ E;  1RFA A;  3U30 A;  1E90 A;  2J0M A;  2JPH A;  4XZ4 A;  3M3J A;  4ZRJ A;  4DBG A;  2CKH B;  3PT2 B;  3DVG X;  2W9N A;  1WR1 A;  2KWV B;  4W9I A;  3ZNI D;  2LZ6 A;  2KFJ A;  4GDK A;  3B08 A;  1WXA A;  2N9E B;  1WX7 A;  3RUL A;  2MRP A;  4DHZ E;  4FJY A;  3R7R A;  2VRR B;  2K1F A;  4AUQ C;  2NS5 A;  4KDL B;  3V60 A;  3ZNH B;  1WZ3 A;  4KZ0 A;  4ZYN A;  2C7N B;  3VDZ A;  2EMS A;  2L3Z A;  4AJW A;  2D2Q A;  2GBN A;  2N7E A;  3U7D A;  3V61 A;  2V4L A;  2HTH A;  2AYO B;  3ALB A;  3VUX A;  1R4M I;  2DHZ A;  2UWQ A;  3ZIM A;  4MEL A;  2IO0 B;  4BFR A;  4WJP A;  3PPA A;  1A5R A;  4WQO B;  2HE7 A;  5AZH A;  5EDS A;  2Z0D B;  3VUY A;  2ZNV C;  4HLE A;  3QA8 A;  4HWI B;  3RZF A;  3L10 B;  2KHW B;  4BKS A;  2D10 A;  4GDL B;  2O2V A;  3N3K B;  1X1M A;  4OVU A;  2XEW A;  2IYD B;  3DBH I;  1E7U A;  3AU5 A;  2JRI B;  1GJZ A;  1XD3 B;  2KKC A;  1TTN A;  1WMH A;  1VCB A;  4F8C B;  4FN2 A;  2NVU I;  3QIJ A;  3X23 A;  4ICU A;  2B3A A;  2KWC A;  4B6W A;  2GMI C;  5CHW A;  3SU8 X;  4IG7 B;  2FID A;  5D94 A;  2NR2 A;  2PPH A;  2KX3 A;  2OJR A;  2WDT B;  3U8Z A;  1WGD A;  3A9K A;  3R66 C;  3RUI B;  4G11 A;  2IY0 B;  2KNB A;  2L00 B;  4KIK A;  2J0J A;  2PJH A;  4ZRK A;  3WIM A;  1I35 A;  2KZR A;  3UF8 A;  2G3Q B;  3NZS A;  3RT3 B;  1RRB A;  3GZN I;  4M8M A;  1WR6 E;  3NOB A;  4HJK A;  1C3T A;  1YQB A;  4IC7 B;  2N4F A;  4BVU C;  4XX5 A;  3KUZ A;  3KVF B;  1OEY A;  2Z0E B;  5BO4 B;  1ISN A;  2FNJ B;  4EKU A;  3VAW A;  2KJ6 A;  3OAW A;  1J19 A;  4ANV A;  4GXB A;  4IWO A;  2NCN A;  4IM0 A;  4TQ1 A;  1GG3 A;  4FA6 A;  3B0A A;  2FCM A;  1V2Y A;  4XC2 A;  4GDK B;  1V5O A;  2ZVO A;  2MP2 A;  3QK0 A;  3VH4 B;  4WWP A;  4EEW A;  2ZCB A;  4RM8 A;  4K7S A;  3W1Y A;  5FR6 A;  3ZTC A;  4AJY B;  2MQJ A;  2REX A;  4TV3 A;  4WJQ A;  2KQ7 A;  4MEM A;  3VXW A;  1WM2 A;  2MA9 B;  2DAJ A;  4P7I A;  4MH0 E;  3QX1 A;  4JLC A;  2BWF A;  2C5L C;  1C1Y B;  2GBJ A;  3DBR I;  3PGE A;  1WX8 A;  1WYW B;  1UEL A;  4YL8 A;  4HCP B;  3UQA A;  3L17 A;  3JW0 X;  2BKR B;  3QWZ B;  1P3Q U;  3APD A;  2KFK A;  2KJR A;  4NQL B;  4W9C A;  2K8B A;  3TCA A;  1Q1O A;  2MLB A;  4PS3 A;  1P0R A;  3QHT A;  1J0G A;  1ZW7 A;  3TJP A;  1R4N I;  4BKG A;  3MHS D;  3RYT A;  4HXD A;  2BKF A;  4OVV A;  3ZW3 A;  1EO6 A;  4DXA B;  1WE6 A;  5JH5 C;  2K39 A;  4KDI C;  3DDC B;  1E8X A;  1UH6 A;  4BBN F;  3I3T B;  3L0W B;  3Q3J A;  3VVW B;  5DPT A;  2PE9 A;  4NY0 A;  4W9L A;  5L95 C;  1F9J A;  1UGM A;  2CHW A;  2KDE B;  2N9P C;  2KAN A;  3ECI A;  3KH0 A;  1OEY J;  4G0N B;  2DYM A;  2MBO A;  2O6V A;  4FUL A;  3N30 A;  2DX5 B;  1P1A A;  2JVC A;  2M1M A;  1FXT B;  1OQY A;  5LXI B;  3WA0 A;  4ASW C;  1TZ1 A;  4PYU A;  4FAD A;  2KC1 A;  3EHV A;  4GMV A;  2DZI A;  2KC2 A;  3VFK A;  3IG3 A;  3UIP B;  2A4Z A;  2L0F A;  1WFY A;  3SHQ A;  3ML8 A;  1WX9 A;  1EUV B;  2ZPY A;  1E5W A;  2GBK A;  2JF5 A;  1SIF A;  1UBQ A;  5CTR C;  3IVF A;  4HPM B;  3CMM B;  4WAA A;  1V6E A;  2DZM A;  2KOX A;  4CO7 A;  2NPT B;  3PVL A;  4IW0 A;  3A9J A;  1XT9 B;  2R2O A;  4M0W B;  3WAL A;  4F1S A;  2DZJ A;  4K81 A;  2MP2 B;  2KJH B;  3DPD A;  4NJ6 A;  3H6N A;  4NAW B;  1OTR B;  4DHJ D;  5J18 A;  3OLM D;  4X57 B;  4GOC A;  3ZRF A;  3RD2 A;  4EUT A;  3WAO A;  1XQQ A;  3M95 A;  4GGQ A;  2UYZ B;  2IO3 B;  3IBE A;  1VD2 A;  2FCQ A;  1P98 A;  2JWZ A;  3DVG Y;  4LCD E;  4ZDV A;  2MBH A;  5J2R A;  4MM3 A;  4NNJ B;  1HE8 A;  2BPS A;  2K6D B;  2ZPN A;  3APF A;  3QCA A;  4HCN B;  4J6I A;  4W9K A;  2K25 A;  2BWE S;  2M8S A;  4KSL C;  4DHJ B;  3DBL I;  4JQW C;  4HVB A;  1WXV A;  4A3O A;  3AI5 A;  4TQ0 A;  3PRZ A;  2XK5 B;  2LXC A;  3WAP A;  4DDG D;  2Z59 B;  1NI2 A;  3T9L A;  3QAR A;  1UZX B;  1UD7 A;  3QJZ A;  1E8Y A;  5JHA A;  2LGY A;  2JUO A;  3M63 B;  2JY6 A;  3K9O B;  1TGZ B;  3QAQ A;  2DEN B;  2IBI B;  4K1R B;  4MJS A;  1Z2M A;  2CHX A;  2DYO A;  2YVC A;  3IHP C;  4W9G A;  2NBW B;  3TMP B;  4B9K A;  5J17 A;  2KTR A;  2D3G A;  2EKE C;  2N7D A;  4IM3 A;  5IA7 A;  2BYE A;  2FCN A;  2AWT A;  3R3M A;  4WJO A;  2LVP A;  2NBV B;  4A20 A;  4MSQ B;  2IO1 B;  2AL6 A;  2AL3 A;  1CMX B;  1WY8 A;  1WJ4 A;  2RD0 A;  3PS6 A;  5E6O A;  4GB9 A;  4N9F 4;  4A3P A;  2LRU A;  1L7Y A;  2GBM A;  1WGY A;  2MW5 A;  1GNU A;  3L13 A;  1PQS A;  3TIX A;  4GSW A;  4II2 B;  4ZRI A;  3UIO B;  4AOF A;  4HK2 A;  4JL9 A;  3OJ4 B;  1EF5 A;  2D07 B;  1E7V A;  3NZU A;  2C7M B;  2N1V A;  5C23 A;  4K7U A;  2FUH B;  4IM2 A;  1ZGU B;  1LM8 B;  3NY5 A;  3WAM A;  4AWJ A;  1SGH A;  1KOT A;  2KN5 A;  4MGK E;  3VUW A;  4W9F A;  2RPQ A;  2ZVN A;  3NHE B;  4TUU A;  1YX5 B;  3W1S C;  4CYE A;  1KLV A;  4KSK C;  2L76 A;  3PTF C;  5CX3 A;  3PRM B;  3KUD B;  2KO3 A;  1JRU A;  2G4D B;  1GUA B;  1P9D U;  2I1K A;  2KX0 A;  3S2A A;  2CHZ A;  1Y8R C;  2LAS A;  4B95 A;  1Q0W B;  3L08 A;  2RR9 A;  3DOW A;  5DPW A;  4NJ7 A;  3B1L X;  1V5T A;  3DVN V;  2YLM A;  4TKN A;  3N32 A;  4I6P A;  3HM6 X;  2R2Q A;  3PRE A;  2O2V B;  2BYV E;  1WGG A;  2IZV B;  2MBB B;  2WX1 A;  2IO2 B;  1WZ0 A;  4FHK A;  1WMH B;  1V49 A;  4DWF A;  4E74 A;  4ANU A;  2JXX A;  3AUL A;  3A4R A;  3ZUN A;  1GC7 A;  2KDI A;  4W9E A;  2DAF A;  2KTF A;  3PSE B;  4E3C A;  2RGF A;  1WE7 A;  4IUM B;  3A9K B;  1Q5W B;  4FJV B;  4M8N A;  4LDT D;  1WH3 A;  2LJ5 A;  4FJZ A;  4KIK B;  4E71 A;  4PYZ A;  3AXC A;  1WM3 A;  2C9W B;  3PLU A;  3QC8 B;  1IP9 A;  4GU2 A;  3M62 B;  3ZKJ C;  4FLH A;  2J7Q B;  3DQV A;  4HDO A;  5CHF A;  1S1Q B;  1WJU A;  2BYF A;  2L8J A;  4IWQ A;  1WGR A;  2ASQ A;  1OGW A;  2JZZ A;  2FIF A;  2LVQ A;  3VHT C;  4LDT B;  1WXS A;  1V81 A;  3UIN B;  4EZJ A;  5DPS A;  2KDB A;  4BBN C;  2MBE A;  4G50 A;  4MGY E;  3EFU A;  3VTU A;  3PHW B;  3TBL D;  5DPR A;  4BOZ B;  2BGF A;  3OJ3 A;  3VH3 B;  4II3 B;  2G4S A;  1YIW A;  1G6J A;  5G55 A;  3ZO5 B;  1WGH A;  2XBB C;  3X0W A;  3JSV A;  4URK A;  2G45 B;  4RM9 A;  3WAN A;  3NS8 A;  1V80 A;  3CSF A;  4KV2 A;  5KHO A;  5E6N A;  1LXD A;  2M17 A;  3AU4 A;  2ZNV B;  4EOY A;  2KVR A;  3RCZ A;  4F7Z A;  2KFK B;  2GBR A;  4EZK A;  2CS4 A;  3ZLZ A;  3MTN B;  2ZEQ A;  1H8C A;  4CHK A;  4BKT A;  1AAR A;  3ZVV A;  2I1J A;  2LI5 A;  5JHB A;  4AP4 C;  3KW5 B;  2KK8 A;  2EMT A;  2N1W A;  1IPG A;  2O6V D;  3ENE A;  4NQK E;  5D7G A;  5AZF A;  3P2B A;  5G2N A;  2QHO A;  2Y5B B;  3H9D A;  3PRP B;  1NBF C;  4FBJ B;  4K7W A;  2KQS A;  3A1Q A;  2JRH A;  3KUC B;  3VQI A;  3ZNG C;  3ZNZ B;  4EFO A;  2O6V B;  1WXM A;  3PLV A;  2LRW A;  3H7P A;  1T0Y A;  2AEH A;  2BF8 B;  2J0K A;  1U4A A;  2V1Y A;  4IWP A;  4PS8 A;  2GOW A;  1YD8 U;  1K8R B;  3A4S C;  3L54 A;  4LJO B;  3QQ8 B;  3C0R B;  1LFD A;  3DBS A;  5AZG A;  3PZD A;  4G3X B;  2M0X A;  1S3S G;  2LVO A;  3V6C B;  3ZRC A;  4DHZ B;  2HJ8 A;  3V6E B;  2C60 A;  1UBI A;  2WYQ A;  3DCG A;  4GIV A;  1IYF A;  3ZDM C;  4W9D A;  4HPL B;  1QZE A;  4KZC A;  5HKH A;  4MDK E;  3SDL C;  3ZDT A;  3K9P B;  2JT4 B;  3BIN A;  2L7R A;  3IFW B;  4DK5 A;  1I42 A;  3CST A;  1WRD B;  4PS7 A;  5IAA C;  2MBQ A;  2NBU A;  3PV1 A;  3A9J B;  4I6L B;  2MCN B;  2WWZ A;  3T8M A;  2RSU A;  2LWP A;  1SE9 A;  1E8W A;  2OOB B;  2KLG A;  2LXA A;  1L2N A;  3VTW A;  3D32 A;  3H1U A;  4NPN A;  2MWS B;  3DVN U;  3HHM A;  3R7Q A;  1RLF A;  4W9J A;  3H7S A;  3JSV B;  4LJP B;  1D3Z A;  4EZL A;  3ML9 A;  5KHQ A;  1V9J A;  2KDF B;  2KWU B;  3ONS A;  4BKS D;  4BOS C;  3LJ3 A;  2PEA A;  3BY4 B;  4WWN A;  5L83 A;  1V86 A;  2N9X A;  3Q3F A;  1LQB A;  1KM7 A;  1KJT A;  1ZKH A;  2JZ3 B;  1WJN A;  2NPT A;  1E8Z A;  2ZJD A;  4DDI D;  1MG8 A;  2LGD A;  2K8H A;  4MSM B;  4FHJ A;  4RMA A;  5D6J B;  3APC A;  4JGH B;  3ZTD A;  2A5U A;  3PHX B;  4KVG B;  2MX2 A;  4NAW A;  3V62 A;  4MGZ E;  4WJN A;  2LD9 A;  2ZZP B;  3KYD D;  2KXJ A;  3TL5 A;  1YX6 B;  4JIO U;  3HK0 A;  1EF1 A;  3KYC D;  4HDQ A;  2D11 A;  2DYB A;  4MJS B;  4ICV A;  3A1Q B;  2KMA A;  2CU1 A;  4GN1 A;  5CHV C;  3EC8 A;  2M4N A;  1WI0 A;  1H4R A;  5GMV A;  1WIA A;  2KTR B;  1J8C A;  3H7P B;  2CR5 A;  2L0T A;  3HM3 A;  4W9H A;  1WF9 A;  2XK5 A;  2IY1 B;  5LLI A;  1Z5S B;  1NDD A;  2K8C A;  4GDL A; 
#chains in the Genus database with same CATH topology
 3JVZ X;  1PGB A;  2GLS A;  1RAX A;  1SJH D;  1ET9 A;  1QOF A;  3N20 C;  1M94 A;  1WXQ A;  3O65 B;  2NMQ A;  1L4D B;  2FUG 1;  4MGI E;  1BT0 A;  4I6N B;  3H8H A;  5AEK B;  1P7F A;  4JPS A;  3RZW C;  3EEC A;  5BYQ A;  3CF6 E;  3LDZ E;  4DBG A;  3CWI A;  2KWV B;  4W9I A;  4GDK A;  3N1X C;  4DHZ E;  4FJY A;  3AEA B;  1SB3 C;  3R7R A;  1HZ6 A;  2K1F A;  2L3Z A;  2D2Q A;  2GBN A;  2W54 A;  3P4R B;  4JX1 C;  5EE9 A;  2KQ4 X;  3VUY A;  4BKS A;  2D10 A;  2Q5W D;  4GDL B;  4MAC A;  2IYD B;  2BYT A;  3HUI A;  1E7U A;  2RPV A;  3AU5 A;  1I4R A;  5IO9 A;  4F8C B;  3QIJ A;  3HVD A;  1JAL A;  3X23 A;  4ICU A;  2H88 B;  2KWC A;  4B6W A;  5CHW A;  4WH4 A;  2BS2 B;  3AE9 B;  3LXF A;  5IP4 D;  2KX3 A;  1SBB B;  2WDT B;  4HRS A;  3R66 C;  3RUI B;  4M00 A;  4AQ7 A;  2PJH A;  5G5H A;  3W2D A;  2KZR A;  2G3Q B;  3NVY A;  1RRB A;  1WWT A;  4M8M A;  4CQN A;  2N4F A;  3E56 A;  1FXA A;  1UWM A;  1CJE A;  3OAW A;  1J19 A;  1KH0 A;  1WGK A;  4GXB A;  4M01 A;  4IM0 A;  4WQM A;  4FA6 A;  3B0A A;  4XC2 A;  1XO3 A;  1I7H A;  3GS2 A;  2ZVO A;  3AEB B;  1HTQ A;  3QK0 A;  3VH4 B;  4EEW A;  2ZCB A;  3W1Y A;  2REX A;  2WS3 B;  2DAJ A;  3QX1 A;  3PGE A;  1UEL A;  4YL8 A;  4HCP B;  2AQ1 B;  4NQL B;  1I4H A;  3RFZ B;  1L0X B;  1JML A;  2QJL A;  3MHS D;  4UDU C;  4HXD A;  3ZW3 A;  5MPO A;  4KDI C;  2QIL A;  3L0W B;  5DPT A;  2N9P C;  4KZC A;  1L4Z B;  2O6V A;  3N30 A;  1JW9 D;  2JVC A;  5FKA C;  2M1M A;  1FXT B;  4GMV A;  4KKI A;  4KGT A;  3IG3 A;  4DQO C;  3SHQ A;  1F1H A;  1MG4 A;  2QIE B;  3IVF A;  3URY A;  1T6B X;  2DZM A;  2KOX A;  2WXN A;  4M0W B;  4K81 A;  1F77 A;  3UI3 A;  3OLM D;  2X38 A;  3RD2 A;  3HVZ A;  2UYZ B;  3IBE A;  4ZDV A;  2FCQ A;  1P98 A;  2JWZ A;  2MBH A;  4XGA B;  1I4P A;  3RI7 C;  2J53 A;  3QCA A;  4OW0 A;  1ZDV A;  4JQW C;  4HVB A;  4A3O A;  2I2Y A;  1ZXI A;  3PRZ A;  2JU6 X;  4ARC A;  2LXC A;  2Z59 B;  1NI2 A;  2WU5 B;  3J9C A;  1JQ4 A;  3QAR A;  2K9X A;  3IXS A;  4YTN B;  2CHX A;  3IHP C;  2KTR A;  2QMT A;  2D3G A;  2M19 A;  4IM3 A;  5IA7 A;  2BYE A;  1ENF A;  4C7Z A;  4WJO A;  2LVP A;  2AL6 A;  1CMX B;  4C00 A;  5GXG B;  5E6O A;  4YSY B;  4IOI E;  2PVG C;  1YJI A;  4A3P A;  3L13 A;  4ZRI A;  2WXG A;  2N1V A;  2FUH B;  4RH6 A;  2L32 A;  4ZOH C;  4AWJ A;  1SGH A;  2KN5 A;  3OWE B;  3RN9 C;  4TUU A;  3BYT B;  3W1S C;  4CYE A;  2KT7 A;  3PRM B;  3P1M A;  1GUA B;  2I1K A;  1FMA D;  2KX0 A;  2BS4 B;  3S2A A;  3Q8F A;  4B95 A;  5DPW A;  4NJ7 A;  3O13 A;  1ZP0 B;  1V5T A;  2WHI A;  4BZA A;  1YN3 A;  1WGG A;  2IZV B;  3IAM 1;  2IO2 B;  2PW9 A;  2EEL A;  2PVO D;  1FIQ A;  4W9E A;  2DAF A;  1QT9 A;  3PSE B;  4LNI A;  4E3C A;  2RGF A;  3A9K B;  2WXQ A;  1WH3 A;  3QC8 B;  3PLU A;  1IP9 A;  2JX5 A;  4HKQ A;  1UNS A;  2BS3 B;  1WJU A;  2L8J A;  3P4Q B;  2WNM A;  2LVQ A;  4XYC A;  2H89 B;  1WXS A;  3UIN B;  4EZJ A;  2MBE A;  2V9H A;  3PHW B;  3VH3 B;  2G4S A;  2G9H D;  5G55 A;  2XBB C;  4C4V A;  2G45 B;  2UU7 A;  2VZK B;  3CSF A;  3RCZ A;  2ZEQ A;  4CHK A;  4BKT A;  1AAR A;  2LI5 A;  4AP4 C;  1L5P A;  2IGD A;  5G2N A;  3PRP B;  2MH7 A;  3A1Q A;  3KUC B;  3KWL A;  1MFW A;  4EFO A;  3RNG C;  1WXM A;  2WXI A;  2J0K A;  4PS8 A;  1K8R B;  1XLP A;  3DBS A;  3V6C B;  2LVO A;  3ZRC A;  2HJ8 A;  3V6E B;  1UBI A;  5BMG A;  4GIV A;  1IYF A;  3AEC B;  5HKH A;  4MDK E;  3SDL C;  2WXR A;  3U52 E;  4DK5 A;  5IAA C;  2MBQ A;  3A9J B;  1K52 A;  2OOB B;  1E8W A;  1TS2 A;  2KLG A;  3AED B;  2LXA A;  4C7Y A;  4WWM A;  1SXT A;  3VRA B;  3D32 A;  1FXI A;  2NTT A;  5C3J B;  2GI9 A;  4EZL A;  2KDF B;  4BKS D;  1BUI C;  4MM3 B;  2PEA A;  3BY4 B;  2JQR B;  2N9X A;  3Q3F A;  2AQ3 B;  2KVZ A;  2ZJD A;  4DDI D;  4M0W A;  1MG8 A;  2LGD A;  1D5M C;  1DOI A;  4MSM B;  4FHJ A;  5D6J B;  4JGH B;  3ZTD A;  3NVW A;  3DBH B;  4WJN A;  2LD9 A;  4JIO U;  3HK0 A;  2WXF A;  2DYB A;  1YNT E;  2KMA A;  5AUI A;  2CU1 A;  5CHV C;  1SE2 A;  4L1B A;  2KAC A;  4XWW A;  1J8C A;  5E6J A;  4W9H A;  1T0S C;  1WF9 A;  5LLI A;  4RGT A;  1I4G A;  2KLC A;  1F52 A;  5LXH A;  1GPX A;  4RF1 A;  1D5Z C;  3BWU D;  5C1Z A;  4ANX A;  5DCN A;  2DZK A;  2FCS A;  2WDQ B;  2LGX A;  1E9M A;  3UGB B;  2AQ2 B;  1UUP A;  2PE6 B;  2LUE A;  3U30 A;  1E90 A;  2J0M A;  1UGJ A;  4ZRP A;  4BAX A;  2W9N A;  1WR1 A;  3ZNI D;  2KFJ A;  3B08 A;  4LNN A;  2M56 B;  1LGR A;  1QOG A;  1KFY B;  2MRP A;  4AUQ C;  2NS5 A;  4KDL B;  4ZYN A;  2C7N B;  2EMS A;  3GE8 C;  4AJW A;  2WU2 B;  3ALB A;  1R4M I;  2DHZ A;  4MEL A;  4ARI A;  2HE7 A;  3SR6 A;  4US9 A;  2ZNV C;  4HLE A;  3QA8 A;  4HWI B;  3L10 B;  1P7E A;  1T5X D;  4HPP A;  4OVU A;  2XEW A;  1YOV B;  1XD3 B;  1VCB A;  4A9A A;  2NVU I;  2N7J A;  4A90 A;  2W55 A;  1NEN B;  1WGD A;  3A9K A;  4G11 A;  2KNB A;  5LNK 1;  3GZN I;  3NOB A;  1C3T A;  1ZUD 2;  2G1E A;  1YQB A;  3FKY A;  2Y5P A;  1M4V A;  4XX5 A;  3KVF B;  2Z0E B;  5BO4 B;  3IT6 B;  3AE7 B;  4LNO A;  1FD6 A;  3TEY A;  2INN E;  4TQ1 A;  2FCM A;  3RMK C;  2DLB A;  3DBL B;  3P42 A;  2MP2 A;  1MPE A;  2LMC A;  4WJQ A;  1SIJ A;  1WM2 A;  2L52 A;  1QKZ A;  4HJG E;  2LUM A;  2GBJ A;  1WX8 A;  1WYW B;  2PKO A;  1TKG A;  3BK1 A;  3UQA A;  3ZGZ A;  1V1P A;  2HJ1 A;  3JW0 X;  4W9C A;  2K8B A;  1Q1O A;  1EWC A;  1TY2 A;  4PS3 A;  1MHX A;  1BXT A;  4FXC A;  4PT5 A;  2BT6 A;  5JH5 C;  1SF0 A;  2K39 A;  3BVM A;  1UH6 A;  3VVW B;  5L95 C;  3FAH A;  1F9J A;  2CHW A;  2KAN A;  4G0N B;  1Q10 A;  1OQY A;  5LXI B;  1TZ1 A;  5IKC M;  3EHV A;  3U2S C;  3I5J C;  5AUK A;  1EUV B;  2ZPY A;  1FFV A;  2LGI A;  2GBK A;  1SIF A;  1SEB D;  3CMM B;  2JWU A;  1V6E A;  4K3B A;  2NPT B;  4IW0 A;  3A9J A;  1GAQ B;  3WAL A;  4F1S A;  3TUO A;  2N0S B;  1VZ8 A;  3NZ3 A;  1R4N B;  4NJ6 A;  5J18 A;  3WAO A;  1XQQ A;  2D5G A;  2IO3 B;  3DVG Y;  4MM3 A;  4NZL B;  2BPS A;  3APF A;  1XLQ A;  2D3A A;  1UF0 A;  2K25 A;  2M8S A;  1E6E B;  3AE4 B;  3BYY B;  4TQ0 A;  2XK5 B;  1L6V A;  4DDG D;  3N1Z C;  1E8Y A;  5JHA A;  3M63 B;  1AWD A;  2DEN B;  2IBI B;  1L6U A;  2YEP B;  3E9S A;  4LNK A;  2CJO A;  1D4B A;  5IOI A;  1JWS D;  4W9G A;  4B9K A;  4ZYS A;  1ZOY B;  5J17 A;  3R3M A;  1GB4 A;  2NBV B;  3IT4 B;  4MSQ B;  3FIL B;  4GLS C;  4MH8 A;  2RD0 A;  4GB9 A;  4N9F 4;  1TIF A;  2N9K A;  4LLG M;  1WGY A;  2MW5 A;  1GNU A;  1PQS A;  4GSW A;  4HK2 A;  2IGG A;  1FRD A;  2NTS A;  1L0V B;  1OFF A;  2C7M B;  1ZGU B;  1LM8 B;  3NY5 A;  5HG2 A;  1KOT A;  4MGK E;  2BVC A;  1YN5 A;  2L76 A;  1XF5 L;  3KUD B;  3R8B A;  3ZYY X;  2IND C;  4YT0 B;  1KTK A;  2RR9 A;  3L08 A;  1FFU A;  4TKN A;  4I6P A;  3PRE A;  2O2V B;  2WX1 A;  1N60 A;  4DWF A;  3NRZ A;  4ANU A;  2BBC A;  3AUL A;  2MEK A;  1WE7 A;  4IUM B;  4M8N A;  1N62 A;  4FJZ A;  3VRB B;  1TT5 B;  4PYZ A;  2C9W B;  2IGH A;  2DWQ A;  3M62 B;  3ZKJ C;  2L1A A;  3EUB 2;  1S1Q B;  1FM0 D;  1WGR A;  2ASQ A;  1OGW A;  5D3D A;  3TEX A;  5DPS A;  2KDB A;  1CK1 A;  4G50 A;  1IGD A;  4MGY E;  2WDR B;  3TBL D;  4TSS A;  5DPR A;  4BOZ B;  2BGF A;  1PFD A;  1VLB A;  4II3 B;  4USA A;  1G6J A;  1C4C A;  2IDY A;  4N59 A;  3L4P A;  3JSV A;  2XNA C;  1V80 A;  5E6N A;  3P4P B;  2ZNV B;  3AEE B;  2K5P A;  3ZLZ A;  3MTN B;  1OQQ A;  3Q8A A;  3ZVV A;  2KK8 A;  3ENE A;  3NVV A;  3Q3M C;  2Y5B B;  1TS4 A;  4FBJ B;  1TKY A;  4K7W A;  2V3P A;  1I4Q A;  1SJE D;  3VQI A;  1C4A A;  1IUE A;  3ZNZ B;  2ON8 A;  3ZXV A;  3H7P A;  1QLB B;  1U4A A;  2V1Y A;  1JWA D;  3MHZ A;  1YD8 U;  3A4S C;  1V1O A;  4ZRQ A;  4LJO B;  1LFD A;  4DHZ B;  4G3X B;  2M0X A;  4K3C A;  1QZE A;  1N5W A;  3VR9 B;  3B2F A;  1WRD B;  3PV1 A;  2NBU A;  1C9F A;  2WWZ A;  1B1Z A;  2MWS B;  4W9J A;  2ZW1 A;  3H7S A;  1NVI D;  5KHQ A;  1V9J A;  3ONS A;  3RNB C;  5EE3 A;  1R7S A;  1C79 A;  1KJT A;  1ZKH A;  1WJN A;  2NPT A;  1E8Z A;  5D3I B;  3AE8 B;  3W9C B;  2K8H A;  5TSS A;  1L0Y B;  3RNE C;  3PHX B;  4MGZ E;  4JWS C;  1FNV A;  2D11 A;  4MJS B;  2CJN A;  4C56 C;  1TS5 A;  3EC8 A;  5GMV A;  1EWY C;  2TSS A;  1B9R A;  2L0T A;  2XK5 A;  1NDD A;  1D6E C;  2K8C A;  4GDL A;  4P1C C;  2ZCC A;  2WXO A;  3LYY A;  5D2M B;  2FAZ A;  3MC9 A;  4RGO S;  1QIL A;  1GC6 A;  3GOE A;  3MJW A;  2KMC A;  1EM7 A;  3JYU A;  4ANW A;  3MJ5 A;  2WX0 A;  2VZK D;  5I4D A;  1PUT A;  2MJ3 A;  3ZXR A;  1WJ6 A;  5JZE B;  1E0Z A;  1TBE A;  1RFA A;  1TJE A;  4P16 A;  3SFD B;  2K22 A;  4ZRJ A;  1NYR A;  2CKH B;  1TZO A;  3PT2 B;  3DVG X;  4ITK A;  3V05 A;  2LZ6 A;  1WXA A;  2N9E B;  1CQV A;  1WX7 A;  4YSX B;  1XXG A;  1FCL A;  4XWT A;  2VRR B;  3ZJT A;  4KZ0 A;  1MVK A;  3ZJU A;  3V61 A;  2AYO B;  3VUX A;  2JXT A;  2UWQ A;  1RM6 C;  4C80 A;  4HKZ E;  4BFR A;  4WJP A;  1A5R A;  2OJW A;  5AZH A;  4YTP B;  2Z0D B;  1SE3 A;  2ONQ A;  3RZF A;  4AS1 A;  2KHW B;  4US8 A;  2O2V A;  3VR8 B;  3N3K B;  1X1M A;  2JYE A;  2JYT A;  1GOZ A;  3R2T A;  1TTN A;  4FN2 A;  1JRO A;  2B3A A;  3SU8 X;  4IG7 B;  2FID A;  1EU3 A;  5D94 A;  2NR2 A;  2GB1 A;  2PPH A;  2OJR A;  3AE5 B;  2J4X A;  4ZRK A;  3WIM A;  4RGM A;  4TMA B;  1VRA B;  1YN4 A;  4IC7 B;  3KUZ A;  1OEY A;  1ISN A;  3VAW A;  3AN1 A;  1HQR D;  4IWO A;  2NCN A;  1TYG B;  4GDK B;  4NAM A;  1V5O A;  2RDG A;  4WWP A;  3AV8 A;  4RM8 A;  4K7S A;  3ZTC A;  2QCZ A;  1PGX A;  4TV3 A;  1ZXH A;  2KQ7 A;  1XLN A;  3C8Y A;  3DHH C;  1ZE3 D;  4HRO A;  4JLC A;  2BWF A;  2E6X A;  2AX5 A;  4P6V F;  3L17 A;  1CZP A;  1P3Q U;  1FEH A;  2JSV X;  2KJR A;  3TCA A;  2WXK A;  2K0P A;  4S17 A;  1Y56 A;  4OZB A;  4KKJ A;  3QHT A;  1J0G A;  1ZW7 A;  3TJP A;  1R4N I;  1F2R I;  2BKF A;  2KYW A;  1WE6 A;  3TSS A;  1YQ4 B;  2K3U A;  3NG0 A;  4BBN F;  2FBW B;  3Q3J A;  2KMM A;  2KDE B;  3KH0 A;  1T3Q A;  2MBO A;  4FUL A;  2DX5 B;  1P1A A;  2LGS A;  1KRH A;  1I4X A;  4ASW C;  4PYU A;  4FAD A;  2KC1 A;  3GP7 A;  2DZI A;  2KC2 A;  3VFK A;  3UIP B;  2A4Z A;  2L0F A;  1WFY A;  2Z8L A;  4DXF A;  1HTO A;  2JF5 A;  2BB6 A;  3DBR B;  5H92 C;  1AYF A;  2WXP A;  3RNF C;  1WSP A;  4CO7 A;  3PVL A;  2PTL A;  2R2O A;  1XCT L;  4OZC A;  2KJH B;  3EGR A;  3DPD A;  3H6N A;  4NAW B;  4S0R A;  4X57 B;  4GOC A;  3ZRF A;  3M95 A;  1VD2 A;  4NNJ B;  1HE8 A;  3GB1 A;  2WLB A;  4W9K A;  1RFK A;  3AI5 A;  2M0A A;  2WQY B;  1ZPS A;  3T9L A;  3LB8 C;  2L83 A;  3QJZ A;  2LGY A;  2JUO A;  3PO0 A;  3K9O B;  1TGZ B;  4K1R B;  4MJS A;  2DYO A;  1KLU D;  2IJ0 A;  2YVC A;  2FE8 A;  2NBW B;  3TMP B;  4B0M A;  3KQ4 A;  3MP9 A;  2FCN A;  2AWT A;  4DXG A;  1JRP A;  1J7C A;  2IO1 B;  4RFB A;  2AL3 A;  1WY8 A;  3PS6 A;  3ETR A;  2Y3A A;  2LRU A;  1L7Y A;  4II2 B;  1STE A;  3UIO B;  3RPF C;  4JL9 A;  3Q8B A;  3ABV B;  3OJ4 B;  2D07 B;  3AEG B;  5C23 A;  3Q8E A;  4K7U A;  4IM2 A;  2PMV A;  4WUR A;  1VJK A;  4W9F A;  2ZVN A;  1PGA A;  1MHH E;  3EA6 A;  4KSK C;  1QOB A;  5CX3 A;  1JRU A;  2CU3 A;  2KO3 A;  1P9D U;  3TEW A;  2CHZ A;  3KLS X;  4YSZ B;  3DOW A;  3SFE B;  3B1L X;  1JCK B;  3N32 A;  3HM6 X;  2R2Q A;  1QQR A;  5HFY A;  2MJD A;  4NJC A;  1V97 A;  5BYR A;  2BYV E;  2MBB B;  1WMH B;  1V49 A;  4E74 A;  4YXD B;  4MT5 A;  2BW2 A;  3B2G A;  3RNC C;  3IAS 1;  4XE0 A;  3ZUN A;  1GC7 A;  2KDI A;  4WAF A;  5JXV A;  4FJV B;  2B76 B;  3NUH B;  2LJ5 A;  2QEJ C;  4KIK B;  2N9L A;  1WM3 A;  5EE1 A;  3DQV A;  4ZHP A;  2EKI A;  1NYQ A;  1E10 A;  2JZZ A;  2FIF A;  1A70 A;  1V81 A;  2OHF A;  2LHE A;  3Q2A C;  4OHJ A;  3EFU A;  3VTU A;  3DHG C;  2QDF A;  3ZO5 B;  1NEK B;  1TS3 A;  1XLO A;  3X0W A;  4L2Y A;  2D3C A;  3NS8 A;  1VZ6 A;  4KV2 A;  5FK9 C;  1LXD A;  2M17 A;  4ACF A;  4EOY A;  2KVR A;  2KFK B;  2GBR A;  4EZK A;  2CS4 A;  1H8C A;  1WRI A;  3CIR B;  3NS1 A;  5BYS A;  1WYG A;  2I1J A;  3KW5 B;  2N1W A;  1XEE A;  4NQK E;  5D7G A;  5AZF A;  3P2B A;  1MJD A;  2QHO A;  4KGR A;  1NBF C;  2KQS A;  2WXM A;  3ZNG C;  4JWU C;  3SEB A;  1IBX B;  3PLV A;  2BF8 B;  2VH2 A;  3RNA C;  3NJT A;  3L54 A;  3QQ8 B;  2KWD A;  3P63 A;  5AZG A;  1S3S G;  4OZA A;  2C60 A;  2WYQ A;  3DCG A;  4W9D A;  2X8X X;  1RWS A;  2JT4 B;  2WDV B;  3BIN A;  3K9P B;  3IFW B;  3CST A;  3T8M A;  2MCN B;  1J7B A;  5C2T B;  1SE9 A;  4H2A A;  1NI3 A;  1RLF A;  4C4V B;  1EU4 A;  1D3Z A;  3DWG C;  3ML9 A;  2KWU B;  1TY0 A;  1R4M B;  5L83 A;  4WWN A;  1V86 A;  2ZW0 A;  1LQB A;  1TKE A;  1KM7 A;  4N6E B;  5G5G A;  4M02 A;  3TEZ A;  4RMA A;  3APC A;  4KVG B;  2INP E;  4NAW A;  3V62 A;  3FC4 A;  2SEB D;  1AN8 A;  2KXJ A;  3TL5 A;  3NVZ A;  4ICV A;  3A1Q B;  4GN1 A;  2M4N A;  1JWM D;  1WI0 A;  3R2I A;  1WIA A;  2CR5 A;  4XDC A;  3HM3 A;  2W3R A;  2ICI A;  2IY1 B;  2Y5C A;  1Z5S B;  3GZN B;  3MFG A;  4L23 A;  4WWO A;  2K6Q A;  3VTV A;  2L05 A;  2JZP A;  4PK1 A;  3L16 A;  1E7P B;  3HIZ A;  2KD0 A;  3A33 B;  4YTM B;  2HD5 B;  2IPK D;  2V3S A;  3AB5 A;  5E6P A;  2DBY A;  3SD5 A;  2C7H A;  3B9J A;  3W1S A;  3UQB A;  2XN9 C;  2MSE D;  5TR5 A;  1AW7 A;  1YJ1 A;  1YJJ A;  2JPH A;  4XZ4 A;  3M3J A;  1FPY A;  1N5X A;  3WCQ A;  3Q3O C;  1J7A A;  5EE0 A;  3RUL A;  2BQQ A;  3EFC A;  2WGS A;  3ZNH B;  3V60 A;  1WZ3 A;  2HDE A;  1ET6 A;  3VDZ A;  2N7E A;  3U7D A;  3PZ7 A;  2V4L A;  3AE2 B;  2HTH A;  4QAY A;  3U7Z A;  3U4E G;  3ZIM A;  2IO0 B;  1T0R C;  2RDH A;  3PPA A;  4WQO B;  5EDS A;  2QSD A;  2WP9 B;  3BK2 A;  1QF6 A;  3DBH I;  4D2K A;  2JRI B;  1GJZ A;  2KKC A;  3I57 A;  1WMH A;  3I63 C;  2GMI C;  3U8Z A;  3KWV A;  2IY0 B;  2L00 B;  2VH1 A;  4KIK A;  2J0J A;  1I35 A;  3C19 A;  4LK0 M;  4ZHO A;  5IN7 A;  2R61 A;  3UF8 A;  3NZS A;  3RT3 B;  1WR6 E;  4HJK A;  4BVU C;  2FNJ B;  4EKU A;  2KJ6 A;  4LNF A;  4ANV A;  3OG5 A;  2RMM A;  1GG3 A;  1V2Y A;  3PZ8 A;  1HEZ E;  4KGS A;  5FR6 A;  4AJY B;  2MQJ A;  3BII D;  3N1Y C;  1N61 A;  4MEM A;  3VXW A;  2MA9 B;  4P7I A;  4MH0 E;  5H8Y E;  2C5L C;  1C1Y B;  3DBR I;  1IGC A;  3QWZ B;  2BKR B;  3APD A;  2KFK A;  1MI0 A;  2MLB A;  1SE4 A;  1P0R A;  3AMZ A;  2WXJ A;  4BKG A;  2GRI A;  3RYT A;  4OVV A;  4DXA B;  1EO6 A;  1JWU D;  3DDC B;  1E8X A;  4RF0 A;  2BTE A;  3AE3 B;  3I3T B;  1D5X C;  2LHD A;  2PE9 A;  2PLP A;  4NY0 A;  4W9L A;  2J42 A;  1UGM A;  3ECI A;  3WAM A;  1OEY J;  2DYM A;  1IBX A;  4WIP A;  1V8C A;  1HZ5 A;  3WA0 A;  1N6Z A;  1K53 A;  3FIL A;  5FR3 A;  3ML8 A;  1WX9 A;  4N58 A;  1E5W A;  3BZD B;  1UBQ A;  5CTR C;  4HPM B;  3Q3N C;  4WAA A;  2HTM E;  4A55 A;  4YWG G;  1XCQ L;  1XT9 B;  2DZJ A;  1DOY A;  2MP2 B;  3Q69 A;  1FRR A;  1OTR B;  1ZDX A;  4DHJ D;  1LO5 D;  2V0G A;  4EUT A;  1FO4 A;  4GGQ A;  4A6Q A;  1C76 A;  4LCD E;  5J2R A;  1DOX A;  2BB5 A;  4R3D A;  2K6D B;  2ZPN A;  3P4S B;  4HCN B;  4J6I A;  1V1P B;  4KSL C;  2BWE S;  4DHJ B;  3DBL I;  1WXV A;  4RCO A;  3WAP A;  3V3X A;  3BVG A;  1UZX B;  1UD7 A;  2W3S A;  1F2R C;  2JY6 A;  3QAQ A;  1Z2M A;  2YEP F;  2OED A;  1T0Q C;  3N9Y C;  1YQ3 B;  2EKE C;  2N7D A;  4LTU A;  4A20 A;  1OQR A;  1WJ4 A;  2E3T A;  1F0Z A;  2GBM A;  2J52 A;  2WXH A;  3DHI C;  1SSN A;  2V4I B;  2KN4 A;  3TIX A;  1DYQ A;  4AOF A;  2MJE A;  1EF5 A;  2INC C;  1E7V A;  3NZU A;  3AH7 A;  5HI1 A;  2RDB C;  3MC8 A;  1FCC C;  1ACC A;  3VUW A;  2WXL A;  2RPQ A;  3NHE B;  1YX5 B;  1KLV A;  3PTF C;  3AE6 B;  1K50 A;  2G4D B;  1C77 A;  1Y8R C;  2LAS A;  1Q0W B;  3T3N A;  2D3B A;  3W5U B;  3DVN V;  2YLM A;  4IKG A;  1WZ0 A;  4FHK A;  3DWM A;  3Q14 C;  2LJI A;  2JXX A;  3A4R A;  2QC8 A;  2KTF A;  2MHJ A;  1Q5W B;  2KAJ A;  1HA5 A;  4LDT D;  1C4P A;  4E71 A;  3AXC A;  2PIA A;  4XDD A;  4GU2 A;  4FLH A;  2J7Q B;  4HDO A;  3HRD D;  4OVZ A;  5CHF A;  1GB1 A;  2BYF A;  2W82 A;  4IWQ A;  3VHT C;  4LDT B;  4BBN C;  3GE3 C;  1C78 A;  4B0E A;  3T3O A;  3OJ3 A;  1PDX A;  3Q6B A;  1YIW A;  2DNF A;  1VDV A;  1WGH A;  1VZ7 A;  4EE2 A;  1RYJ A;  4URK A;  4RM9 A;  3WAN A;  4J3O D;  2LFI A;  5KHO A;  3AU4 A;  4F7Z A;  4P1B C;  4JE3 B;  5JHB A;  2KDM A;  2V3N A;  2EMT A;  1IPG A;  2O6V D;  3AE1 B;  1KF6 B;  3H9D A;  2JRH A;  1YMH E;  2SAK A;  4KX6 B;  1DGJ A;  5BMI A;  2O6V B;  1JWB D;  2LRW A;  1T0Y A;  2AEH A;  4IWP A;  2GOW A;  1FNW A;  3C0R B;  1BML C;  3PZD A;  3ZQ4 A;  3ZDM C;  4HPL B;  3ZJV A;  1N63 A;  3ZDT A;  2L7R A;  1I42 A;  4PS7 A;  1VR9 A;  4I6L B;  1ROE A;  2RSU A;  2LWP A;  1L2N A;  4RNA A;  4Q2J A;  3VTW A;  3H1U A;  1KLG D;  4NPN A;  3Q8C A;  3DVN U;  5T8I A;  3HHM A;  3R7Q A;  2ACZ B;  3JSV B;  4LJP B;  3AEF B;  4A8X C;  4BOS C;  3LJ3 A;  4IDI A;  1UWX A;  3BVZ A;  4O1N A;  2JZ3 B;  4REZ A;  3MC0 B;  2I38 A;  2LEK A;  3W5V B;  2A5U A;  2MX2 A;  2ZZP B;  3KYD D;  1HXY D;  1YX6 B;  1FNU A;  1EF1 A;  3KYC D;  4HDQ A;  4HEA 1;  5BMH A;  1K51 A;  5HHD G;  1ESF A;  1H4R A;  1QOA A;  1PYW D;  2KTR B;  4RGN A;  3H7P B;  3AM9 A;  3I9V 1; 
#chains in the Genus database with same CATH homology
 3JVZ X;  4WWO A;  2K6Q A;  2ZCC A;  2L05 A;  3VTV A;  2KLC A;  3L16 A;  5LXH A;  5D2M B;  1RAX A;  5C1Z A;  2FAZ A;  4ANX A;  5DCN A;  2DZK A;  3HIZ A;  2KD0 A;  3O65 B;  1M94 A;  2FCS A;  1GC6 A;  3A33 B;  3GOE A;  2LGX A;  2HD5 B;  3MJW A;  2KMC A;  2V3S A;  4ANW A;  3JYU A;  4MGI E;  2WX0 A;  3UGB B;  5E6P A;  1BT0 A;  3SD5 A;  2C7H A;  3W1S A;  4I6N B;  2PE6 B;  5AEK B;  3UQB A;  1WJ6 A;  2MSE D;  5TR5 A;  3RZW C;  5JZE B;  2LUE A;  3EEC A;  1YJ1 A;  1TBE A;  3CF6 E;  3LDZ E;  1RFA A;  3U30 A;  1E90 A;  2J0M A;  2JPH A;  4XZ4 A;  3M3J A;  4ZRJ A;  4DBG A;  2CKH B;  3PT2 B;  3DVG X;  2W9N A;  1WR1 A;  2KWV B;  4W9I A;  3ZNI D;  2LZ6 A;  2KFJ A;  4GDK A;  3B08 A;  1WXA A;  2N9E B;  1WX7 A;  3RUL A;  2MRP A;  4DHZ E;  4FJY A;  3R7R A;  2VRR B;  2K1F A;  4AUQ C;  2NS5 A;  4KDL B;  3V60 A;  3ZNH B;  1WZ3 A;  4KZ0 A;  4ZYN A;  2C7N B;  3VDZ A;  2EMS A;  2L3Z A;  4AJW A;  2D2Q A;  2GBN A;  2N7E A;  3U7D A;  3V61 A;  2V4L A;  2HTH A;  2AYO B;  3ALB A;  3VUX A;  1R4M I;  2DHZ A;  2UWQ A;  3ZIM A;  4MEL A;  2IO0 B;  4BFR A;  4WJP A;  3PPA A;  1A5R A;  4WQO B;  2HE7 A;  5AZH A;  5EDS A;  2Z0D B;  3VUY A;  2ZNV C;  4HLE A;  3QA8 A;  4HWI B;  3RZF A;  3L10 B;  2KHW B;  4BKS A;  2D10 A;  4GDL B;  2O2V A;  3N3K B;  1X1M A;  4OVU A;  2XEW A;  2IYD B;  3DBH I;  1E7U A;  3AU5 A;  2JRI B;  1GJZ A;  1XD3 B;  2KKC A;  1TTN A;  1WMH A;  1VCB A;  4F8C B;  4FN2 A;  2NVU I;  3QIJ A;  3X23 A;  4ICU A;  2B3A A;  2KWC A;  4B6W A;  2GMI C;  5CHW A;  3SU8 X;  4IG7 B;  2FID A;  5D94 A;  2NR2 A;  2PPH A;  2KX3 A;  2OJR A;  2WDT B;  3U8Z A;  1WGD A;  3A9K A;  3R66 C;  3RUI B;  4G11 A;  2IY0 B;  2KNB A;  2L00 B;  4KIK A;  2J0J A;  2PJH A;  4ZRK A;  3WIM A;  1I35 A;  2KZR A;  3UF8 A;  2G3Q B;  3NZS A;  3RT3 B;  1RRB A;  3GZN I;  4M8M A;  1WR6 E;  3NOB A;  4HJK A;  1C3T A;  1YQB A;  4IC7 B;  2N4F A;  4BVU C;  4XX5 A;  3KUZ A;  3KVF B;  1OEY A;  2Z0E B;  5BO4 B;  1ISN A;  2FNJ B;  4EKU A;  3VAW A;  2KJ6 A;  3OAW A;  1J19 A;  4ANV A;  4GXB A;  4IWO A;  2NCN A;  4IM0 A;  4TQ1 A;  1GG3 A;  4FA6 A;  3B0A A;  2FCM A;  1V2Y A;  4XC2 A;  4GDK B;  1V5O A;  2ZVO A;  2MP2 A;  3QK0 A;  3VH4 B;  4WWP A;  4EEW A;  2ZCB A;  4RM8 A;  4K7S A;  3W1Y A;  5FR6 A;  3ZTC A;  4AJY B;  2MQJ A;  2REX A;  4TV3 A;  4WJQ A;  2KQ7 A;  4MEM A;  3VXW A;  1WM2 A;  2MA9 B;  2DAJ A;  4P7I A;  4MH0 E;  3QX1 A;  4JLC A;  2BWF A;  2C5L C;  1C1Y B;  2GBJ A;  3DBR I;  3PGE A;  1WX8 A;  1WYW B;  1UEL A;  4YL8 A;  4HCP B;  3UQA A;  3L17 A;  3JW0 X;  2BKR B;  3QWZ B;  1P3Q U;  3APD A;  2KFK A;  2KJR A;  4NQL B;  4W9C A;  2K8B A;  3TCA A;  1Q1O A;  2MLB A;  4PS3 A;  1P0R A;  3QHT A;  1J0G A;  1ZW7 A;  3TJP A;  1R4N I;  4BKG A;  3MHS D;  3RYT A;  4HXD A;  2BKF A;  4OVV A;  3ZW3 A;  1EO6 A;  4DXA B;  1WE6 A;  5JH5 C;  2K39 A;  4KDI C;  3DDC B;  1E8X A;  1UH6 A;  4BBN F;  3I3T B;  3L0W B;  3Q3J A;  3VVW B;  5DPT A;  2PE9 A;  4NY0 A;  4W9L A;  5L95 C;  1F9J A;  1UGM A;  2CHW A;  2KDE B;  2N9P C;  2KAN A;  3ECI A;  3KH0 A;  1OEY J;  4G0N B;  2DYM A;  2MBO A;  2O6V A;  4FUL A;  3N30 A;  2DX5 B;  1P1A A;  2JVC A;  2M1M A;  1FXT B;  1OQY A;  5LXI B;  3WA0 A;  4ASW C;  1TZ1 A;  4PYU A;  4FAD A;  2KC1 A;  3EHV A;  4GMV A;  2DZI A;  2KC2 A;  3VFK A;  3IG3 A;  3UIP B;  2A4Z A;  2L0F A;  1WFY A;  3SHQ A;  3ML8 A;  1WX9 A;  1EUV B;  2ZPY A;  1E5W A;  2GBK A;  2JF5 A;  1SIF A;  1UBQ A;  5CTR C;  3IVF A;  4HPM B;  3CMM B;  4WAA A;  1V6E A;  2DZM A;  2KOX A;  4CO7 A;  2NPT B;  3PVL A;  4IW0 A;  3A9J A;  1XT9 B;  2R2O A;  4M0W B;  3WAL A;  4F1S A;  2DZJ A;  4K81 A;  2MP2 B;  2KJH B;  3DPD A;  4NJ6 A;  3H6N A;  4NAW B;  1OTR B;  4DHJ D;  5J18 A;  3OLM D;  4X57 B;  4GOC A;  3ZRF A;  3RD2 A;  4EUT A;  3WAO A;  1XQQ A;  3M95 A;  4GGQ A;  2UYZ B;  2IO3 B;  3IBE A;  1VD2 A;  2FCQ A;  1P98 A;  2JWZ A;  3DVG Y;  4LCD E;  4ZDV A;  2MBH A;  5J2R A;  4MM3 A;  4NNJ B;  1HE8 A;  2BPS A;  2K6D B;  2ZPN A;  3APF A;  3QCA A;  4HCN B;  4J6I A;  4W9K A;  2K25 A;  2BWE S;  2M8S A;  4KSL C;  4DHJ B;  3DBL I;  4JQW C;  4HVB A;  1WXV A;  4A3O A;  3AI5 A;  4TQ0 A;  3PRZ A;  2XK5 B;  2LXC A;  3WAP A;  4DDG D;  2Z59 B;  1NI2 A;  3T9L A;  3QAR A;  1UZX B;  1UD7 A;  3QJZ A;  1E8Y A;  5JHA A;  2LGY A;  2JUO A;  3M63 B;  2JY6 A;  3K9O B;  1TGZ B;  3QAQ A;  2DEN B;  2IBI B;  4K1R B;  4MJS A;  1Z2M A;  2CHX A;  2DYO A;  2YVC A;  3IHP C;  4W9G A;  2NBW B;  3TMP B;  4B9K A;  5J17 A;  2KTR A;  2D3G A;  2EKE C;  2N7D A;  4IM3 A;  5IA7 A;  2BYE A;  2FCN A;  2AWT A;  3R3M A;  4WJO A;  2LVP A;  2NBV B;  4A20 A;  4MSQ B;  2IO1 B;  2AL6 A;  2AL3 A;  1CMX B;  1WY8 A;  1WJ4 A;  2RD0 A;  3PS6 A;  5E6O A;  4GB9 A;  4N9F 4;  4A3P A;  2LRU A;  1L7Y A;  2GBM A;  1WGY A;  2MW5 A;  1GNU A;  3L13 A;  1PQS A;  3TIX A;  4GSW A;  4II2 B;  4ZRI A;  3UIO B;  4AOF A;  4HK2 A;  4JL9 A;  3OJ4 B;  1EF5 A;  2D07 B;  1E7V A;  3NZU A;  2C7M B;  2N1V A;  5C23 A;  4K7U A;  2FUH B;  4IM2 A;  1ZGU B;  1LM8 B;  3NY5 A;  3WAM A;  4AWJ A;  1SGH A;  1KOT A;  2KN5 A;  4MGK E;  3VUW A;  4W9F A;  2RPQ A;  2ZVN A;  3NHE B;  4TUU A;  1YX5 B;  3W1S C;  4CYE A;  1KLV A;  4KSK C;  2L76 A;  3PTF C;  5CX3 A;  3PRM B;  3KUD B;  2KO3 A;  1JRU A;  2G4D B;  1GUA B;  1P9D U;  2I1K A;  2KX0 A;  3S2A A;  2CHZ A;  1Y8R C;  2LAS A;  4B95 A;  1Q0W B;  3L08 A;  2RR9 A;  3DOW A;  5DPW A;  4NJ7 A;  3B1L X;  1V5T A;  3DVN V;  2YLM A;  4TKN A;  3N32 A;  4I6P A;  3HM6 X;  2R2Q A;  3PRE A;  2O2V B;  2BYV E;  1WGG A;  2IZV B;  2MBB B;  2WX1 A;  2IO2 B;  1WZ0 A;  4FHK A;  1WMH B;  1V49 A;  4DWF A;  4E74 A;  4ANU A;  2JXX A;  3AUL A;  3A4R A;  3ZUN A;  1GC7 A;  2KDI A;  4W9E A;  2DAF A;  2KTF A;  3PSE B;  4E3C A;  2RGF A;  1WE7 A;  4IUM B;  3A9K B;  1Q5W B;  4FJV B;  4M8N A;  4LDT D;  1WH3 A;  2LJ5 A;  4FJZ A;  4KIK B;  4E71 A;  4PYZ A;  3AXC A;  1WM3 A;  2C9W B;  3PLU A;  3QC8 B;  1IP9 A;  4GU2 A;  3M62 B;  3ZKJ C;  4FLH A;  2J7Q B;  3DQV A;  4HDO A;  5CHF A;  1S1Q B;  1WJU A;  2BYF A;  2L8J A;  4IWQ A;  1WGR A;  2ASQ A;  1OGW A;  2JZZ A;  2FIF A;  2LVQ A;  3VHT C;  4LDT B;  1WXS A;  1V81 A;  3UIN B;  4EZJ A;  5DPS A;  2KDB A;  4BBN C;  2MBE A;  4G50 A;  4MGY E;  3EFU A;  3VTU A;  3PHW B;  3TBL D;  5DPR A;  4BOZ B;  2BGF A;  3OJ3 A;  3VH3 B;  4II3 B;  2G4S A;  1YIW A;  1G6J A;  5G55 A;  3ZO5 B;  1WGH A;  2XBB C;  3X0W A;  3JSV A;  4URK A;  2G45 B;  4RM9 A;  3WAN A;  3NS8 A;  1V80 A;  3CSF A;  4KV2 A;  5KHO A;  5E6N A;  1LXD A;  2M17 A;  3AU4 A;  2ZNV B;  4EOY A;  2KVR A;  3RCZ A;  4F7Z A;  2KFK B;  2GBR A;  4EZK A;  2CS4 A;  3ZLZ A;  3MTN B;  2ZEQ A;  1H8C A;  4CHK A;  4BKT A;  1AAR A;  3ZVV A;  2I1J A;  2LI5 A;  5JHB A;  4AP4 C;  3KW5 B;  2KK8 A;  2EMT A;  2N1W A;  1IPG A;  2O6V D;  3ENE A;  4NQK E;  5D7G A;  5AZF A;  3P2B A;  5G2N A;  2QHO A;  2Y5B B;  3H9D A;  3PRP B;  1NBF C;  4FBJ B;  4K7W A;  2KQS A;  3A1Q A;  2JRH A;  3KUC B;  3VQI A;  3ZNG C;  3ZNZ B;  4EFO A;  2O6V B;  1WXM A;  3PLV A;  2LRW A;  3H7P A;  1T0Y A;  2AEH A;  2BF8 B;  2J0K A;  1U4A A;  2V1Y A;  4IWP A;  4PS8 A;  2GOW A;  1YD8 U;  1K8R B;  3A4S C;  3L54 A;  4LJO B;  3QQ8 B;  3C0R B;  1LFD A;  3DBS A;  5AZG A;  3PZD A;  4G3X B;  2M0X A;  1S3S G;  2LVO A;  3V6C B;  3ZRC A;  4DHZ B;  2HJ8 A;  3V6E B;  2C60 A;  1UBI A;  2WYQ A;  3DCG A;  4GIV A;  1IYF A;  3ZDM C;  4W9D A;  4HPL B;  1QZE A;  4KZC A;  5HKH A;  4MDK E;  3SDL C;  3ZDT A;  3K9P B;  2JT4 B;  3BIN A;  2L7R A;  3IFW B;  4DK5 A;  1I42 A;  3CST A;  1WRD B;  4PS7 A;  5IAA C;  2MBQ A;  2NBU A;  3PV1 A;  3A9J B;  4I6L B;  2MCN B;  2WWZ A;  3T8M A;  2RSU A;  2LWP A;  1SE9 A;  1E8W A;  2OOB B;  2KLG A;  2LXA A;  1L2N A;  3VTW A;  3D32 A;  3H1U A;  4NPN A;  2MWS B;  3DVN U;  3HHM A;  3R7Q A;  1RLF A;  4W9J A;  3H7S A;  3JSV B;  4LJP B;  1D3Z A;  4EZL A;  3ML9 A;  5KHQ A;  1V9J A;  2KDF B;  2KWU B;  3ONS A;  4BKS D;  4BOS C;  3LJ3 A;  2PEA A;  3BY4 B;  4WWN A;  5L83 A;  1V86 A;  2N9X A;  3Q3F A;  1LQB A;  1KM7 A;  1KJT A;  1ZKH A;  2JZ3 B;  1WJN A;  2NPT A;  1E8Z A;  2ZJD A;  4DDI D;  1MG8 A;  2LGD A;  2K8H A;  4MSM B;  4FHJ A;  4RMA A;  5D6J B;  3APC A;  4JGH B;  3ZTD A;  2A5U A;  3PHX B;  4KVG B;  2MX2 A;  4NAW A;  3V62 A;  4MGZ E;  4WJN A;  2LD9 A;  2ZZP B;  3KYD D;  2KXJ A;  3TL5 A;  1YX6 B;  4JIO U;  3HK0 A;  1EF1 A;  3KYC D;  4HDQ A;  2D11 A;  2DYB A;  4MJS B;  4ICV A;  3A1Q B;  2KMA A;  2CU1 A;  4GN1 A;  5CHV C;  3EC8 A;  2M4N A;  1WI0 A;  1H4R A;  5GMV A;  1WIA A;  2KTR B;  1J8C A;  3H7P B;  2CR5 A;  2L0T A;  3HM3 A;  4W9H A;  1WF9 A;  2XK5 A;  2IY1 B;  5LLI A;  1Z5S B;  1NDD A;  2K8C A;  4GDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...