3P4PB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with fumarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4pB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4pB01
1WGKA 1VJKA 1J7BA 1H7WA 1YJJA 2MJ3A 1FO4A 1B9RA 2WS3B 1WYGA 2WU2B 1DGJA 1UWMA 2BS3B 3SFDB 1T3QA 1N63A 2MH7A 5AUKA 2L83A 3RPFC 2KAJA 3AE8B 3VRAB 1V8CA 4WWMA 2K9XA 1ZOYB 1IUEA 1ZP0B 4C80A 1YQ3B 3NRZA 1CZPA 4C7YA 4YSXB 2BS4B 1N5WA 2OHFA 1FRRA 4JX1C 3AEGB 1ZUD2 2DWQA 4HRSA 1FIQA 1QOGA 2L52A 4N59A 3NVYA 4US8A 1H7XA 1GAQB 3AE4B 3AE9B 1JWAD 1XLPA 1KF6B 4YTPB 1AWDA 1EWYC 1XO3A 1YJIA 3NVWA 3AEAB 3AEFB 3CF4A 3CIRB 1VLBA 2QJLA 3AMZA 1QLBB 1FFVA 3W5VB 4JWSC 4FXCA 1XLQA 1E0ZA 5G5GA 3ZYYX 1DOXA 1L0VB 2H89B 1NENB 4YSYB 1WWTA 2MJEA 2WDRB 2W3RA 3B2GA 1KFYB 1SB3C 2M19A 1FXAA 3AEBB 3P63A 1V97A 3VR8B 3P4RB 1E6EB 4USAA 1E7PB 3AEEB 2PKOA 1OQQA 3AM9A 1TYGB 1CJEA 3W5UB 2BT6A 2WDQB 1ROEA 4C7ZA 3DWGC 3AEDB 4N58A 2AX5A 1PDXA 5H8YE 3KWLA 1L6UA 1WRIA 4IDIA 4ZHOA 3AN1A 1F0ZA 1JALA 5G5HA 2H88B 1NEKB 1JW9D 4YSZB 1E9MA 1OQRA 2WLBA 1NYQA 4YTNB 4YT0B 3EUB2 3AE6B 1GTEA 1RYJA 2DBYA 2Q5WD 4WQMA 5MPOA 2W54A 1FM0D 3AECB 1SF0A 1JRPA 1L6VA 1GT8A 1R7SA 1TKYA 1OFFA 3ABVB 1PUTA 5EE0A 2LEKA 4ZOHC 2K5PA 2M56B 1I7HA 2K22A 4KX6B 1QOAA 2WU5B 1NI3A 1JQ4A 1FXIA 4JWUC 5EE3A 2G1EA 3CWIA 1RWSA 2KMMA 5C3JB 3B9JA 1SIJA 2WQYB 3SR6A 1N61A 1QOBA 2CJOA 3LB8C 2WDVB 4A9AA 1PFDA 3AE5B 4YXDB 1QF6A 2B76B 1N60A 4HROA 1AYFA 1N5XA 3AE2B 5AUIA 3WCQA 1FRDA 2Y5CA 4N6EB 4YTMB 1NYRA 2W55A 1NVID 3FC4A 2JX5A 2JQRB 5H92C 2WP9B 4US9A 1DOIA 3FAHA 2BS2B 1J7AA 4P6VF 1RFKA 2QIEB 1TJEA 1XLNA 3ETRA 1L5PA 1RM6C 3AH7A 5EE1A 4ITKA 3P4SB 2PVGC 3PO0A 3AB5A 1E10A 4ZHPA 2CU3A 1WXQA 3HRDD 3VRBB 1J7CA 3VR9B 1QOFA 1FMAD 3LXFA 3P4QB 3SFEB 1FFUA 2EKIA 3B2FA 2MJDA 1A70A 3AE7B 1QT9A 2HTME 3DWMA 1KRHA 2N0SB 1N62A 3BIID 2ACZB 3HVZA 1ZXIA 3NVVA 1YQ4B 1TKEA 2E3TA 3HUIA 1GTHA 1JWBD 2FBWB 2PVOD 2PIAA 2W3SA 3L4PA 3NVZA 5GXGB 3AE3B 1VDVA 1XLOA 3W9CB 3AE1B 5C2TB 5EE9A 1DOYA 3P4PB 4LTUA 1JROA 3NS1A 3AV8A 3P1MA 1GPXA 2CJNA 1TKGA
chains in the Genus database with same CATH superfamily
3N9YC 3RI7C 5HG2A 1EO6A 2GLSA 2JF5A 3VQIA 5D94A 3QJZA 3Q8FA 2K6DB 2BVCA 2WXMA 2DAFA 5HFYA 1ZP0B 4C80A 1ZXHA 2WXNA 3U2SC 4N59A 3N32A 1OGWA 1KM7A 1YJIA 3CF4A 2FIFA 3CIRB 3NG0A 2MJEA 2WYQA 1UBIA 1KFYB 1FXAA 1Q5WB 4IUMB 3AM9A 2ZVNA 1ACCA 3UQAA 2BB5A 4ZHOA 3X23A 1C76A 1V1PB 4GOCA 2WXGA 2KK8A 3DHIC 2Q5WD 3PV1A 4NZLB 4DHJB 2MRPA 2QEJC 2N9KA 1AW7A 4K3BA 4ZOHC 1SEBD 3WANA 3EFCA 2J0JA 1YIWA 2LJIA 3L54A 2NTTA 2JU6X 3BVGA 2ZEQA 3A9KB 4HWIB 3RZFA 2KACA 3AXCA 2WDVB 4ANVA 4GU2A 4YXDB 3DQVA 1NYRA 3BVZA 2KQ7A 2L0FA 2YLMA 3GOEA 1D6EC 2J53A 3VVWB 1C78A 2BS2B 2Y3AA 4P6VF 3U52E 2XNAC 3SDLC 3IG3A 4TQ1A 4ZYNA 2G45B 2KHWB 1CMXB 2KDMA 3GP7A 2K39A 1FFUA 3HVDA 3ZXRA 1WH3A 3DHGC 4AUQC 4DDGD 2LXCA 3ZRFA 3OLMD 2PVOD 4JLCA 3AE3B 4C00A 1F52A 1TS3A 3ZNZB 4DBGA 1TKGA 2LFIA 3KQ4A 2WU2B 2BS3B 4BAXA 4PT5A 4ANWA 3RNBC 3A9JB 4ZRPA 2JRIB 4IM2A 2D3AA 1GAQB 4HDQA 3AE9B 5JH5C 3RPFC 4KDLB 2LUMA 1UELA 4MGZE 2WXRA 3R2TA 1DOXA 3PZDA 1WWTA 2J7QB 1L0YB 2KQ4X 3FILA 3V3XA 3VR8B 4FULA 3EC8A 2L0TA 2GBJA 3PVLA 1BUIC 3Q8BA 4EOYA 2DNFA 2ZVOA 1WZ0A 4YT0B 1NDDA 3JW0X 3QWZB 5BYSA 1OFFA 4KSLC 1PUTA 3VH4B 1WXAA 2ZNVC 2CU1A 2DZKA 4TUUA 2INDC 4ZDVA 4AQ7A 2RDBC 2ASQA 3DVNU 3AE2B 4FJVB 1ZDXA 2W55A 4M0WA 4RNAA 1NVID 1TY0A 3VDZA 1C4PA 4F7ZA 1K50A 4L1BA 4G50A 4JGHB 5EE1A 3ZW3A 4PS3A 3RCZA 2BWFA 3HRDD 1QOFA 4ICUA 2KKCA 3B2FA 1IPGA 3PLUA 3BVMA 2QHOA 5E6JA 3ZDTA 2WXLA 2PJHA 4TSSA 3KUDB 2KD0A 3AV8A 1VCBA 2LRUA 2LGIA 4F8CB 1S1QB 2WS3B 2PE6B 3QIJA 1IUEA 2BB6A 3KUZA 1ISNA 2C5LC 4C56C 3NRZA 3PZ8A 4GDLB 3ZNHB 2G4SA 3IXSA 2OEDA 3ZLZA 2INCC 3KW5B 1JWAD 2DZMA 3AE4B 1XLPA 5BO4B 4YTPB 1TBEA 1PGBA 1XD3B 2JUOA 1WX7A 1FFVA 4MDKE 1WGRA 1WJNA 2K6QA 1V86A 1EF1A 1RFAA 4MGIE 1V97A 2HDEA 1MI0A 4DWFA 1TGZB 5JHBA 3N30A 3TCAA 1FCLA 4JIOU 1ZE3D 3PRZA 1ET6A 4K81A 3ZNGC 4A55A 3ZVVA 1GJZA 1VD2A 4K3CA 2EMSA 2LVOA 1OEYA 3Q8EA 4M8MA 1GT8A 4G0NB 5EE0A 3SU8X 1YN4A 4NJ6A 3VTVA 5DPRA 2LWPA 5L83A 2YEPB 3W2DA 1YOVB 2CJOA 3H1UA 4GIVA 3AE5B 3MC8A 4MM3B 4WAFA 3JSVB 3KVFB 4K1RB 4W9FA 4YTMB 1J8CA 4AJYB 4IM3A 4BFRA 4HDOA 2HD5B 3AU5A 4D2KA 4M01A 4P7IA 1L5PA 1E5WA 2RSUA 1Q1OA 4B0MA 4WJNA 1A70A 2UWQA 1H8CA 3PRMB 1FCCC 2RPVA 1WMHA 1ZXIA 1XEEA 2IPKD 3MP9A 2OJRA 4HLEA 2N1WA 5CHFA 3R66C 2KDEB 4E74A 1B9RA 3UINB 3W1SA 5CTRC 3CMMB 2N9XA 2MEKA 1V8CA 3NZUA 1E8XA 1YNTE 1I4XA 2N9EB 1CZPA 4I6PA 1RLFA 2LVQA 3RNCC 3VAWA 2D2QA 2WXQA 4MT5A 1WY8A 3I3TB 4OVZA 3SD5A 3AMZA 1XT9B 3U7DA 3RUIB 4Q2JA 3DBRI 4KIKB 2XBBC 3W5UB 2N7EA 1WGGA 3BYYB 3SHQA 5H8YE 1K52A 1MG8A 1JW9D 1EM7A 3H7SA 2K8HA 4WWPA 4I6NB 2J0KA 1KLGD 2ZPYA 2WGSA 3P42A 1Z2MA 3ECIA 5D3IB 1NI3A 3PRPB 4MEMA 2KX0A 4ZRKA 1WE6A 3B0AA 3UGBB 5DPWA 2KWVB 1N6ZA 2WQYB 3ZQ4A 3ZGZA 1D5ZC 3LB8C 2V4LA 4LNNA 3D32A 1T0RC 3M95A 1ZKHA 1N5XA 5AUIA 4W9DA 2MLBA 3KWVA 1C77A 3BY4B 2KDBA 2LGSA 4KGRA 1P1AA 4E3CA 3AB5A 4MACA 4C4VB 1HZ5A 1V5TA 2C7NB 2YEPF 4GDKA 2INPE 2O6VA 3DWMA 3Q3NC 3ZTCA 1UF0A 1VZ6A 2KQSA 3L4PA 4MJSA 5C2TB 1YJ1A 2FIDA 4O1NA 4BVUC 3NS1A 2CR5A 3ML9A 2QSDA 4QAYA 1KTKA 2JZ3B 4FADA 3DBSA 4UDUC 1T5XD 5J18A 2JT4B 4HCPB 3RYTA 3RMKC 2AYOB 1LXDA 2OHFA 1LGRA 3KLSX 3TIXA 2LHDA 5C1ZA 4GB9A 5HKHA 4KKJA 4YWGG 1WSPA 4W9IA 3P4RB 1E6EB 1L7YA 4OZCA 3OJ3A 1G6JA 4OHJA 3ENEA 1XF5L 4S0RA 1L6UA 1L2NA 2I1KA 3WIMA 3HIZA 3AE6B 1T6BX 4MGKE 2N4FA 3OG5A 1YX5B 2NCNA 2K22A 2EMTA 3BK1A 1C79A 3E9SA 1ET9A 5LNK1 1KLVA 5FKAC 4IKGA 1GC7A 2MBEA 4I6LB 1M94A 2KXJA 1E8WA 1WX8A 4LNFA 1A5RA 4P16A 2IY1B 5CX3A 3VH3B 4ARCA 1QKZA 2CU3A 3DVGY 2NS5A 4PS7A 3URYA 4W9EA 1HZ6A 4K7WA 4BKTA 2N0SB 4G11A 3I5JC 1T0SC 3U8ZA 2L3ZA 2MW5A 2ICIA 1JROA 5C23A 2CJNA 1WGKA 1V6EA 4M00A 1C1YB 1WYGA 4E71A 5FR3A 3IAM1 2WXHA 3GE3C 5IOIA 3DCGA 2GBRA 2OJWA 3ONSA 2JPHA 4C7YA 4FHJA 2HTHA 4M02A 2DYOA 3NVYA 4GSWA 3AEFB 1F2RI 1WF9A 3NJTA 3L17A 4EZJA 3P63A 2FE8A 1GB4A 1UNSA 2BTEA 1WIAA 2BYTA 1T0QC 4DHZE 2INNE 2DX5B 1B1ZA 3ZDMC 1JALA 4XX5A 1E9MA 2WNMA 4JQWC 1P7FA 1WXSA 1D5MC 3NHEB 5DCNA 4PYZA 3UIPB 3B9JA 3V60A 2D3BA 3JYUA 1UZXB 1JWUD 2YVCA 4A6QA 1N60A 3Q3JA 4KZCA 3VHTC 1VZ8A 5BYRA 3H7PB 1J7AA 3I57A 1VR9A 3IT4B 1WXMA 1RM6C 1TTNA 1UWXA 3TUOA 1WXQA 3N1YC 4A90A 4PYUA 2M0AA 2QDFA 1KRHA 2AL3A 4ZRIA 2WX0A 3APDA 3ALBA 2KN5A 4AP4C 5DPSA 3ZJUA 2FBWB 1YN5A 2FCNA 4DXGA 1WR6E 4BKGA 2RDGA 1V80A 1YQBA 5TSSA 2JY6A 4WWMA 2DYBA 4AS1A 2KC1A 2KWDA 2O2VB 2JSVX 4HXDA 1R4MI 2D3CA 3TJPA 3APFA 3TEYA 3DBHI 1IBXB 2L32A 1ESFA 5LXHA 1FNWA 4P1CC 4FJZA 3Q69A 2VZKD 4C7ZA 3Q14C 2LXAA 1WRIA 1H4RA 1SJHD 1GPXA 4W9CA 3EUB2 2RDHA 3SEBA 1NI2A 1QOAA 1TS2A 5D2MB 1JRUA 3TEXA 2J4XA 2K3UA 1HQRD 3MHZA 1VRAB 1TT5B 2DHZA 1QF6A 5JZEB 2WX1A 3RNFC 2JX5A 2JYEA 1YD8U 4MSMB 4US9A 1R4NI 1HTOA 2BGFA 2HE7A 1V81A 3VUXA 2JXTA 3T3OA 1Y8RC 2GRIA 1UUPA 4AJWA 2KMAA 3LXFA 5HHDG 4MGYE 4OZAA 4HPMB 5BMIA 5EDSA 1N62A 3N3KB 1TKEA 4XYCA 1ZPSA 2LHEA 4IM0A 1JWBD 2Y5PA 3BZDB 3H6NA 4XZ4A 3OJ4B 1WGYA 2FNJB 2AWTA 3KH0A 1FO4A 3UIOB 2MCNB 4RGNA 3A1QB 1XCQL 3AE8B 5L95C 1YQ3B 4J3OD 2D5GA 1OQYA 4YSXB 1IYFA 3L08A 4HCNB 4US8A 1UH6A 3DPDA 2KVRA 3NVWA 2GBKA 4JWSC 5D6JB 1AARA 3IT6B 5G55A 1MJDA 1SSNA 2VH1A 3V61A 1GNUA 1PGXA 3AU4A 2GB1A 1NBFC 4USAA 1OQQA 4GMVA 5IP4D 3KWLA 5KHQA 2KTRA 2RGFA 3PREA 4RF1A 1JCKB 1GTEA 1UGJA 1JRPA 1P9DU 2IY0B 3N1XC 2XK5A 4BZAA 1QZEA 5E6PA 3Q3MC 2WU5B 2Z59B 2KFKA 2NPTB 3CWIA 2ZCBA 3WAMA 5C3JB 4NAWA 2VRRB 4XWTA 4A9AA 4LLGM 4XC2A 2L1AA 1STEA 3PZ7A 4RMAA 3FC4A 2MP2B 3KYCD 3U30A 1TZ1A 1VZ7A 3ETRA 3K9OB 4RFBA 4WURA 2NMQA 4JL9A 3PHWB 1ENFA 2MJDA 3RNEC 3TEWA 2W3SA 1JWSD 4CYEA 1K51A 2ZCCA 2BYFA 4OVVA 1WJUA 3TL5A 1N63A 2LASA 5AUKA 3RFZB 2KLCA 1LO5D 3LJ3A 1P98A 4AWJA 5KHOA 2WXFA 1FIQA 3OAWA 2BKRB 5FK9C 3DOWA 4LCDE 2R2QA 2QJLA 2PW9A 2XEWA 3ZYYX 3EHVA 3MJWA 4WIPA 2R2OA 2BT6A 5AZFA 3R7RA 3V6EB 4KSKC 4RM9A 2L05A 5E6NA 3PTFC 4WQMA 4IWOA 4HVBA 5MPOA 1V1OA 1EF5A 4HEA1 4TQ0A 1KOTA 2IGDA 2M56B 4DXFA 1MG4A 3VFKA 2OOBB 4HJGE 1FXIA 4NQKE 1BMLC 2PE9A 1BT0A 3DDCB 2KMMA 1QOBA 3QHTA 2LMCA 1IGDA 2KC2A 3NZSA 1HTQA 1V1PA 5IA7A 4DHZB 4XDCA 2QIEB 1WYWB 4KDIC 3ZNID 3BK2A 1E10A 4LK0M 2KWCA 3BYTB 1C4AA 2M0XA 3P4QB 3A9KA 2IGGA 2FCQA 3QAQA 1WJ6A 2BYVE 4AOFA 2SEBD 4EZLA 4MH0E 1D3ZA 1KLUD 5EE9A 3P4PB 3WAPA 3WA0A 4ZRJA 4EE2A 5FR6A 1J7BA 1H7WA 3FILB 3M63B 4HPLB 1WM3A 2L83A 2L8JA 2CHWA 4HK2A 1LFDA 1SE4A 2MBBB 4N9F4 2RPQA 5HI1A 2DWQA 2MBOA 1KH0A 3VXWA 4BOZB 4FA6A 1HXYD 2L76A 2ONQA 3AEAB 3GB1A 1QLBB 4IW0A 1CQVA 2ZW0A 4DXAB 4RGTA 3DBLI 4KVGB 3AEEB 4WWOA 3ZJVA 2KFJA 3A9JA 3DHHC 3Q8CA 2ON8A 4N58A 2AX5A 1PDXA 2V9HA 3CF6E 2FCSA 4PS8A 3AN1A 1SBBB 1WE7A 4M0WB 1UD7A 2WLBA 5AEKB 5JXVA 2IO2B 3GZNI 4ARIA 2SAKA 1Y56A 1WM2A 2LGXA 3ABVB 4HKZE 2G3QB 2BF8B 4HJKA 4KX6B 2UYZB 1JQ4A 1LM8B 4JWUC 3RN9C 2G1EA 4K7UA 4WWNA 2BQQA 3J9CA 2TSSA 4LNKA 1EU3A 2DAJA 5JHAA 2GBMA 5CHWA 2JQRB 3QQ8B 1R4MB 2DZJA 1TS5A 3TBLD 3M3JA 4B6WA 1E90A 2N1VA 3MFGA 3CSTA 2WDTB 4BBNC 4ITKA 3DBHB 4ASWC 1WJ4A 4G3XB 4DHJD 4IG7B 3WAOA 2JXXA 3SFEB 4W9LA 5BYQA 2PPHA 3WCQA 3P2BA 3BIID 1WR1A 3A4RA 5GXGB 3NVZA 4OZBA 4BKSD 1YMHE 1HA5A 1P0RA 2FCMA 1LQBA 3MJ5A 4X57B 3N20C 2BBCA 3L0WB 1YJJA 3V05A 4R3DA 4KGTA 3NY5A 3T3NA 2I38A 2K9XA 2KVZA 3L10B 3Q3FA 2LVPA 1XXGA 3IVFA 1N5WA 4LDTB 4MSQB 4HRSA 1DYQA 1KF6B 1XQQA 4W9HA 3AI5A 2KO3A 4YL8A 3T9LA 2MBHA 4NAMA 2BPSA 2H89B 3B2GA 4MH8A 1GUAB 1PYWD 1R4NB 2PMVA 2IO1B 1RRBA 3H9DA 1S3SG 4A3OA 4GXBA 2KWUB 1Q0WB 2JRHA 4L23A 2KANA 4GDLA 2M1MA 1JMLA 1NEKB 2K8BA 2DBYA 1FPYA 2W54A 2V0GA 1K53A 1L6VA 1FD6A 1TS4A 1I35A 3VUWA 2K1FA 4W9JA 4ZYSA 3MC0B 4NPNA 5J2RA 2MQJA 3SR6A 4MELA 1V5OA 4RGOS 1WMHB 3VTUA 3U4EG 2XN9C 4TKNA 2D11A 5H92C 2WP9B 2PLPA 5CHVC 3ZKJC 2A5UA 4DQOC 1XLNA 3PT2B 1SIFA 3UF8A 3PO0A 4OVUA 2QC8A 2ZJDA 5BMGA 3IHPC 4B0EA 3C0RB 2EELA 2PEAA 3GE8C 3WALA 2HJ8A 2ACZB 4EZKA 4TMAB 3T8MA 3W1YA 4MM3A 3QARA 1J0GA 2BYEA 2CHXA 3JSVA 4B9KA 2IJ0A 3ZO5B 2K25A 4OW0A 1RAXA 5T8IA 2HJ1A 1VJKA 2IZVB 1UWMA 1DGJA 3QCAA 2KAJA 1EUVB 2D3GA 3BINA 1IGCA 4L2YA 2JZPA 2R61A 4XE0A 1QOGA 2I1JA 1QILA 4S17A 2ZZPB 1PQSA 1XLQA 2WDRB 1SB3C 2M19A 3ZIMA 3OWEB 1QQRA 2C9WB 4CO7A 2PKOA 4RCOA 3PSEB 5LLIA 1SE3A 3C19A 4NQLB 2QCZA 2IDYA 2LGDA 2AQ2B 1F0ZA 4KGSA 2KOXA 1RYJA 4XWWA 3AULA 2K5PA 2GOWA 4RF0A 2M4NA 2E6XA 2GMIC 4HPPA 3IBEA 4KIKA 2C60A 1AN8A 1SIJA 2KYWA 3MHSD 4WJPA 4GDKB 2NTSA 2O6VB 4H2AA 2RMMA 2I2YA 4MJSB 3O13A 1FRDA 1FNUA 1F77A 2Y5CA 4NJCA 1YN3A 4FHKA 1SXTA 3PHXB 1TJEA 2BW2A 1GC6A 2JWZA 1F1HA 1IP9A 2LGYA 1I4HA 1V2YA 1WX9A 4KZ0A 1TZOA 4K7SA 1GTHA 1GB1A 2CHZA 2DLBA 3W9CB 4EFOA 1PGAA 3MC9A 1YX6B 2LRWA 2MJ3A 1I4RA 4P1BC 3SFDB 4LNIA 4C4VA 1ZOYB 2KMCA 2MBQA 4CHKA 4XGAB 4W9GA 3DBRB 5J17A 3I63C 2NR2A 2KJ6A 3A33B 1MHHE 2KZRA 4YSYB 3QK0A 2Z0DB 2X8XX 2WDQB 1ROEA 1V49A 2V3NA 4HKQA 2WXOA 2G9HD 4GLSC 4RH6A 4TV3A 4IDIA 5G5HA 2DZIA 4PK1A 2KJRA 4NY0A 2N9LA 4IWQA 1FM0D 3AECB 1SF0A 1R7SA 1I4QA 2MHJA 1E7VA 2K0PA 1I7HA 3IAS1 2QILA 3QC8B 1MFWA 3TSSA 1WZ3A 3RT3B 1N61A 3W1SC 1L0XB 2V3SA 2AQ1B 1TY2A 3E56A 4HROA 3VTWA 1JWMD 1SE2A 4WQOB 1HEZE 4EEWA 3UQBA 2WXIA 3A4SC 3X0WA 4JPSA 5I4DA 3P4SB 1J7CA 1FMAD 1MPEA 3C8YA 2MSED 3MTNB 2EKIA 3ML8A 3DBLB 2KDIA 1QT9A 2QMTA 3NUHB 5E6OA 4RGMA 5D7GA 1SJED 2DENB 2J0MA 3NS8A 1DOYA 2WWZA 2J42A 4LNOA 1C4CA 3P1MA 2VZKB 5IN7A 3QX1A 3GZNB 3M62B 1T3QA 2MH7A 2W9NA 4DDID 5TR5A 4WJOA 1U4AA 2MA9B 1ZUD2 3Q6BA 1EWCA 2REXA 1H7XA 2DYMA 4IC7B 1AWDA 2X38A 1C3TA 1VLBA 4GN1A 2IO3B 4FXCA 3EGRA 5G5GA 4NNJB 3AEBB 1P3QU 3KYDD 2GI9A 2L00B 3HM6X 2Z8LA 3UI3A 2FUG1 4WH4A 2KDFB 2G4DB 5AZHA 1WFYA 3HM3A 5G2NA 2ZPNA 3ZTDA 2H88B 4YSZB 1OQRA 2B3AA 1M4VA 3O65B 1P7EA 1WRDB 3RD2A 2LEKA 2KNBA 4DK5A 1ZGUB 5IAAC 5D3DA 3RNGC 4REZA 4BOSC 1WI0A 3KUCB 1V9JA 1SGHA 2EKEC 1PFDA 1ZW7A 2B76B 2NBUA 3L16A 3DVGX 5BMHA 1K8RB 2C7MB 2D10A 3FAHA 4ANXA 4W9KA 3RULA 3CSFA 1HE8A 2PVGC 1C9FA 4A8XC 3HHMA 3FKYA 2IBIB 2WXKA 3HVZA 3NVVA 2N7JA 5IKCM 2NBVB 1YQ4B 5AZGA 2E3TA 4CQNA 1WXVA 1XLOA 1WGDA 3H7PA 4LTUA 2N7DA 2AQ3B 3PPAA 4FBJB 2RR9A 3V62A 3Q2AC 4BKSA 3PLVA 3QA8A 2J52A 3PS6A 1XO3A 1EWYC 2IYDB 4FN2A 3GS2A 5LXIB 4LDTD 4EUTA 2WXPA 2C7HA 4J6IA 4RM8A 2W3RA 2GBNA 2K8CA 3Q8AA 1TIFA 1I42A 1CJEA 1OTRB 3DWGC 2CS4A 2O2VA 1OEYJ 2V3PA 3JVZX 1NYQA 1E8YA 2WHIA 1D5XC 4XDDA 2KJHB 4ANUA 4BBNF 1IBXA 3EFUA 3EA6A 3RNAC 4JE3B 5EE3A 3PGEA 5GMVA 3R2IA 2KX3A 4URKA 4IWPA 2CKHB 3NOBA 4F1SA 3R7QA 1D4BA 4N6EB 2MWSB 4ICVA 2LD9A 2WXJA 3TMPB 1UBQA 1RFKA 3AH7A 4M8NA 1WGHA 2V4IB 1I4PA 2ZW1A 3U7ZA 3VRBB 3ZRCA 3VR9B 3V6CB 2UU7A 3N1ZC 2M17A 4A20A 3S2AA 4WAAA 3HUIA 1L4DB 1SE9A 2AL6A 1Q10A 1VDVA 3AE1B 4FJYA 1MHXA 4KV2A 1FXTB 3H8HA 4IOIE 4A3PA 3DVNV 3APCA 1BXTA 3R3MA 3I9V1 2LI5A 3VRAB 1ZDVA 4KKIA 3ZJTA 2KTRB 2BS4B 1FRRA 1XCTL 3AEGB 2BKFA 4JX1C 3ZUNA 2L52A 2FUHB 3LDZE 3BWUD 1UGMA 2KN4A 3W5VB 1EU4A 2XK5B 2D07B 1E0ZA 3NZ3A 2Y5BB 3EECA 3HK0A 1L0VB 1NENB 2VH2A 2W82A 2KLGA 2KFKB 2JZZA 4II2B 3L13A 1X1MA 1E7PB 3A1QA 1TYGB 4NAWB 2LZ6A 1KJTA 3TEZA 3AEDB 3VUYA 3B08A 1Z5SB 3Q3OC 3R8BA 2NVUI 4YTNB 1FNVA 2M8SA 2V1YA 1J19A 2N9PC 1GG3A 5DPTA 4WJQA 2FAZA 3B1LX 3IFWB 2JWUA 1E7UA 3K9PB 1RWSA 2Z0EB 3LYYA 2L7RA 2IO0B 4B95A 3ZXVA 1CK1A 2LJ5A 2RD0A 1AYFA 1FEHA 4LJOB 2IGHA 2O6VD 1F9JA 1DOIA 2ZNVB 5IO9A 2JVCA 2LUEA 1MVKA 4GGQA 2MX2A 4II3B 4ZHPA 2NPTA 3RZWC 4EKUA 1GOZA 2HTME 3AE7B 2KT7A 2A4ZA 1F2RC 2JYTA 2KTFA 4LJPB 1I4GA 1T0YA 2AEHA 4NJ7A 2NBWB 4ZRQA 2PIAA 2PTLA 4ACFA 2BWES 2MP2A 1L4ZB 1E8ZA 4FLHA 1TKYA
chains in the Genus database with same CATH topology
1KTKA 2MJ3A 3N9YC 1I4RA 5HG2A 3VQIA 3SFDB 3Q8FA 1N63A 5AUKA 3RFZB 2WXMA 4UDUC 1T5XD 1ZOYB 1LO5D 5HFYA 1ZP0B 4C80A 1ZXHA 2WXNA 3U2SC 2OHFA 2WXFA 1FIQA 3KLSX 4N59A 2LHDA 5FK9C 1YJIA 3CF4A 3CIRB 2QJLA 4KKJA 1MHHE 4YWGG 1WSPA 2PW9A 3ZYYX 4YSYB 2MJEA 1KFYB 1FXAA 3P4RB 1E6EB 4OZCA 3AM9A 4WIPA 2BT6A 2WDQB 1ROEA 2V3NA 4HKQA 4OHJA 1ACCA 2BB5A 1XF5L 2WXOA 1L6UA 2G9HD 4GLSC 4RH6A 4IDIA 4ZHOA 1C76A 5G5HA 1V1PB 2WXGA 3AE6B 2Q5WD 4WQMA 2N9LA 4NZLB 5MPOA 1V1OA 1FM0D 3AECB 1SF0A 1R7SA 1I4QA 1T6BX 2N9KA 2QEJC 4HEA1 4TQ0A 1AW7A 2IGDA 4ZOHC 2M56B 2K0PA 1SEBD 1I7HA 4DXFA 2K22A 3IAS1 3BK1A 2QILA 2LJIA 1C79A 3E9SA 1ET9A 1FXIA 4HJGE 5LNK1 1BMLC 2NTTA 2KMMA 2JU6X 5FKAC 4IKGA 3BVGA 3TSSA 1N61A 1QOBA 2KACA 2WDVB 2LMCA 1IGDA 1L0XB 4YXDB 2AQ1B 1TY2A 3E56A 4HROA 1V1PA 1NYRA 4P16A 1JWMD 3BVZA 1D6EC 2J53A 1C78A 1SE2A 2BS2B 2Y3AA 4P6VF 3U52E 1HEZE 2QIEB 4XDCA 2XNAC 2WXIA 4JPSA 4ARCA 5I4DA 4TQ1A 3BK2A 1E10A 3P4SB 4LK0M 1QKZA 3BYTB 2CU3A 2KDMA 1C4AA 1J7CA 3URYA 1FMAD 1MPEA 3C8YA 3P4QB 3GP7A 1FFUA 2EKIA 1HZ6A 3HVDA 2IGGA 1QT9A 2QMTA 3NUHB 2N0SB 4RGMA 5D7GA 1SJED 2SEBD 2PVOD 3AE3B 1KLUD 1TS3A 5EE9A 1DOYA 3P4PB 2ICIA 1JROA 2J42A 1C4CA 3P1MA 2VZKB 2CJNA 1TKGA 4EE2A 1WGKA 2LFIA 3KQ4A 1J7BA 1H7WA 3FILB 1WYGA 2WU2B 2BS3B 1T3QA 2MH7A 3IAM1 5FR3A 2WXHA 2L83A 4PT5A 4ZRPA 2QSDA 1SE4A 4C7YA 5HI1A 1ZUD2 2DWQA 1EWCA 2DYOA 3NVYA 1H7XA 1GAQB 2DYMA 3AE9B 1KH0A 1AWDA 2X38A 1HXYD 2ONQA 3RPFC 3AEAB 3AEFB 1VLBA 3GB1A 1F2RI 1QLBB 2LUMA 1CQVA 2ZW0A 4FXCA 3EGRA 2WXRA 5G5GA 3R2TA 1DOXA 4RGTA 1WWTA 3P63A 1L0YB 2KQ4X 3FILA 3AEBB 2FE8A 3V3XA 3VR8B 1GB4A 1UNSA 2GI9A 3AEEB 2BTEA 2Z8LA 3ZJVA 3Q8CA 3UI3A 2BYTA 2ON8A 2FUG1 2INNE 4N58A 1BUIC 3Q8BA 2AX5A 1PDXA 4WH4A 1B1ZA 3AN1A 1JALA 1SBBB 2H88B 4YSZB 1E9MA 1OQRA 2WLBA 5JXVA 4YT0B 2WNMA 1M4VA 1P7FA 1P7EA 4ARIA 2SAKA 1D5MC 1Y56A 5BYSA 1OFFA 3ABVB 1PUTA 4HKZE 2LEKA 4KX6B 5D3DA 1JQ4A 4REZA 4JWUC 2G1EA 3B9JA 1JWUD 1PFDA 4A6QA 4AQ7A 2B76B 1N60A 3J9CA 2TSSA 3AE2B 1EU3A 5BMHA 1VZ8A 1ZDXA 2W55A 4M0WA 1NVID 1TY0A 4RNAA 2JQRB 5BYRA 1C4PA 3FAHA 1TS5A 1K50A 1J7AA 3I57A 1VR9A 3IT4B 4L1BA 3MFGA 1RM6C 1UWXA 5EE1A 4ITKA 1C9FA 2PVGC 4A8XC 3TUOA 1WXQA 3HRDD 1QOFA 4A90A 3SFEB 2WXKA 5BYQA 2M0AA 3B2FA 3WCQA 1KRHA 3BIID 3HVZA 3BVMA 3NVVA 2N7JA 5E6JA 1YQ4B 2WXLA 2E3TA 4TSSA 5GXGB 3ZJUA 4CQNA 2FBWB 3NVZA 4OZBA 1YMHE 1XLOA 1HA5A 1YN5A 4LTUA 3MJ5A 2AQ3B 3AV8A 4DXGA 2LGIA 2BBCA 1YJJA 2WS3B 2RDGA 3V05A 4R3DA 5TSSA 4KGTA 4WWMA 3T3NA 2I38A 2K9XA 1IUEA 2BB6A 4AS1A 4C56C 2KWDA 3NRZA 3PZ8A 4GDLB 1XXGA 2JSVX 1N5WA 4HRSA 3IXSA 2OEDA 1DYQA 2J52A 1JWAD 3AE4B 1XLPA 1KF6B 4YTPB 1EWYC 1PGBA 1XO3A 3GS2A 3TEYA 1FFVA 4NAMA 1IBXB 2WXPA 2L32A 2H89B 3B2GA 4MH8A 2W3RA 1ESFA 1PYWD 1V97A 2HDEA 1MI0A 2PMVA 1FNWA 3Q8AA 1CJEA 3Q69A 2VZKD 1FCLA 4L23A 4C7ZA 3DWGC 1ZE3D 1WRIA 2V3PA 1JMLA 1SJHD 1ET6A 1NEKB 1GPXA 3EUB2 1NYQA 4A55A 2DBYA 2RDHA 2W54A 2V0GA 3Q8EA 1K53A 3SEBA 1L6VA 1GT8A 1D5XC 4XDDA 1FD6A 5EE0A 1TS4A 1IBXA 1QOAA 1YN4A 4ZYSA 3EA6A 1TS2A 4JE3B 5EE3A 3MC0B 3TEXA 2J4XA 2K3UA 2YEPB 3W2DA 3SR6A 3R2IA 1HQRD 2CJOA 3MHZA 4RGOS 3AE5B 1VRAB 3U4EG 4MM3B 1QF6A 2XN9C 4WAFA 1D4BA 4N6EB 4YTMB 5H92C 2JX5A 2JYEA 2WP9B 4US9A 2PLPA 2WXJA 4D2KA 1RFKA 2JXTA 4DQOC 1XLNA 3T3OA 1L5PA 2GRIA 3AH7A 1UUPA 3PO0A 2V4IB 1I4PA 2ZW1A 3U7ZA 3VRBB 3VR9B 3LXFA 5BMGA 4B0MA 5HHDG 4B0EA 4OZAA 2EELA 5BMIA 1A70A 1FCCC 1N62A 2RPVA 2ACZB 1ZXIA 1XEEA 1TKEA 4TMAB 1ZPSA 2LHEA 2IPKD 3HUIA 3MP9A 1JWBD 1L4DB 2Y5PA 1Q10A 2IJ0A 1VDVA 3AE1B 1MHXA 4OW0A 3H8HA 5T8IA 4IOIE 1VJKA 1B9RA 1FO4A 4RGNA 1UWMA 1DGJA 1BXTA 3W1SA 2MEKA 1XCQL 3I9V1 2KAJA 3AE8B 3VRAB 1V8CA 1ZDVA 1YNTE 1I4XA 1YQ3B 4J3OD 2D5GA 4KKIA 1CZPA 3ZJTA 4YSXB 1IGCA 2BS4B 1FRRA 1XCTL 3AEGB 2JZPA 4JX1C 2R61A 4L2YA 4XE0A 1QOGA 2L52A 4US8A 3BWUD 2WXQA 4MT5A 4OVZA 3NVWA 1QILA 3AMZA 2KN4A 3W5VB 1EU4A 4JWSC 1XLQA 1E0ZA 3IT6B 3NZ3A 1L0VB 1SSNA 1NENB 2W82A 2WDRB 1SB3C 2M19A 4Q2JA 3OWEB 1PGXA 1QQRA 2GB1A 4USAA 1E7PB 2PKOA 1OQQA 1TYGB 4NAWB 4RCOA 3W5UB 1SE3A 3BYYB 3TEZA 3AEDB 5H8YE 3KWLA 1K52A 2IDYA 2AQ2B 1F0ZA 4KGSA 3R8BA 4RF1A 1JW9D 1JCKB 1EM7A 4YTNB 1FNVA 1GTEA 1RYJA 1UGJA 4XWWA 1JRPA 1KLGD 3P42A 2K5PA 4RF0A 2E6XA 5D3IB 2WU5B 1NI3A 2JWUA 3CWIA 1RWSA 3LYYA 5C3JB 1AN8A 1SIJA 2WQYB 3ZQ4A 3ZGZA 1D5ZC 4GDKB 2NTSA 3LB8C 4XWTA 4A9AA 4H2AA 2RMMA 2I2YA 1CK1A 4LLGM 2L1AA 1AYFA 1N5XA 1STEA 5AUIA 3PZ7A 3O13A 1FRDA 1FNUA 1F77A 1FEHA 2Y5CA 3KWVA 1C77A 4NJCA 3FC4A 1YN3A 2IGHA 1SXTA 1DOIA 1MVKA 1TJEA 1VZ7A 3ETRA 2BW2A 4KGRA 3AB5A 4ZHPA 1I4HA 4MACA 4RFBA 1HZ5A 4WURA 2NMQA 1GOZA 1ENFA 2MJDA 2HTME 3AE7B 2INPE 2YEPF 3DWMA 3TEWA 2JYTA 1F2RC 1TZOA 1I4GA 1VZ6A 1GTHA 3L4PA 4ZRQA 2PIAA 2PTLA 2W3SA 1JWSD 2DLBA 3W9CB 1GB1A 5C2TB 1K51A 4O1NA 1L4ZB 3NS1A 1PGAA 3BZDB 1TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGK A;  1VJK A;  1J7B A;  1H7W A;  1YJJ A;  2MJ3 A;  1FO4 A;  1B9R A;  2WS3 B;  1WYG A;  2WU2 B;  1DGJ A;  1UWM A;  2BS3 B;  3SFD B;  1T3Q A;  1N63 A;  2MH7 A;  5AUK A;  2L83 A;  3RPF C;  2KAJ A;  3AE8 B;  3VRA B;  1V8C A;  4WWM A;  2K9X A;  1ZOY B;  1IUE A;  1ZP0 B;  4C80 A;  1YQ3 B;  3NRZ A;  1CZP A;  4C7Y A;  4YSX B;  2BS4 B;  1N5W A;  2OHF A;  1FRR A;  4JX1 C;  3AEG B;  1ZUD 2;  2DWQ A;  4HRS A;  1FIQ A;  1QOG A;  2L52 A;  4N59 A;  3NVY A;  4US8 A;  1H7X A;  1GAQ B;  3AE4 B;  3AE9 B;  1JWA D;  1XLP A;  1KF6 B;  4YTP B;  1AWD A;  1EWY C;  1XO3 A;  1YJI A;  3NVW A;  3AEA B;  3AEF B;  3CF4 A;  3CIR B;  1VLB A;  2QJL A;  3AMZ A;  1QLB B;  1FFV A;  3W5V B;  4JWS C;  4FXC A;  1XLQ A;  1E0Z A;  5G5G A;  3ZYY X;  1DOX A;  1L0V B;  2H89 B;  1NEN B;  4YSY B;  1WWT A;  2MJE A;  2WDR B;  2W3R A;  3B2G A;  1KFY B;  1SB3 C;  2M19 A;  1FXA A;  3AEB B;  3P63 A;  1V97 A;  3VR8 B;  3P4R B;  1E6E B;  4USA A;  1E7P B;  3AEE B;  2PKO A;  1OQQ A;  3AM9 A;  1TYG B;  1CJE A;  3W5U B;  2BT6 A;  2WDQ B;  1ROE A;  4C7Z A;  3DWG C;  3AED B;  4N58 A;  2AX5 A;  1PDX A;  5H8Y E;  3KWL A;  1L6U A;  1WRI A;  4IDI A;  4ZHO A;  3AN1 A;  1F0Z A;  1JAL A;  5G5H A;  2H88 B;  1NEK B;  1JW9 D;  4YSZ B;  1E9M A;  1OQR A;  2WLB A;  1NYQ A;  4YTN B;  4YT0 B;  3EUB 2;  3AE6 B;  1GTE A;  1RYJ A;  2DBY A;  2Q5W D;  4WQM A;  5MPO A;  2W54 A;  1FM0 D;  3AEC B;  1SF0 A;  1JRP A;  1L6V A;  1GT8 A;  1R7S A;  1TKY A;  1OFF A;  3ABV B;  1PUT A;  5EE0 A;  2LEK A;  4ZOH C;  2K5P A;  2M56 B;  1I7H A;  2K22 A;  4KX6 B;  1QOA A;  2WU5 B;  1NI3 A;  1JQ4 A;  1FXI A;  4JWU C;  5EE3 A;  2G1E A;  3CWI A;  1RWS A;  2KMM A;  5C3J B;  3B9J A;  1SIJ A;  2WQY B;  3SR6 A;  1N61 A;  1QOB A;  2CJO A;  3LB8 C;  2WDV B;  4A9A A;  1PFD A;  3AE5 B;  4YXD B;  1QF6 A;  2B76 B;  1N60 A;  4HRO A;  1AYF A;  1N5X A;  3AE2 B;  5AUI A;  3WCQ A;  1FRD A;  2Y5C A;  4N6E B;  4YTM B;  1NYR A;  2W55 A;  1NVI D;  3FC4 A;  2JX5 A;  2JQR B;  5H92 C;  2WP9 B;  4US9 A;  1DOI A;  3FAH A;  2BS2 B;  1J7A A;  4P6V F;  1RFK A;  2QIE B;  1TJE A;  1XLN A;  3ETR A;  1L5P A;  1RM6 C;  3AH7 A;  5EE1 A;  4ITK A;  3P4S B;  2PVG C;  3PO0 A;  3AB5 A;  1E10 A;  4ZHP A;  2CU3 A;  1WXQ A;  3HRD D;  3VRB B;  1J7C A;  3VR9 B;  1QOF A;  1FMA D;  3LXF A;  3P4Q B;  3SFE B;  1FFU A;  2EKI A;  3B2F A;  2MJD A;  1A70 A;  3AE7 B;  1QT9 A;  2HTM E;  3DWM A;  1KRH A;  2N0S B;  1N62 A;  3BII D;  2ACZ B;  3HVZ A;  1ZXI A;  3NVV A;  1YQ4 B;  1TKE A;  2E3T A;  3HUI A;  1GTH A;  1JWB D;  2FBW B;  2PVO D;  2PIA A;  2W3S A;  3L4P A;  3NVZ A;  5GXG B;  3AE3 B;  1VDV A;  1XLO A;  3W9C B;  3AE1 B;  5C2T B;  5EE9 A;  1DOY A;  3P4P B;  4LTU A;  1JRO A;  3NS1 A;  3AV8 A;  3P1M A;  1GPX A;  2CJN A;  1TKG A; 
#chains in the Genus database with same CATH topology
 3N9Y C;  3RI7 C;  5HG2 A;  1EO6 A;  2GLS A;  2JF5 A;  3VQI A;  5D94 A;  3QJZ A;  3Q8F A;  2K6D B;  2BVC A;  2WXM A;  2DAF A;  5HFY A;  1ZP0 B;  4C80 A;  1ZXH A;  2WXN A;  3U2S C;  4N59 A;  3N32 A;  1OGW A;  1KM7 A;  1YJI A;  3CF4 A;  2FIF A;  3CIR B;  3NG0 A;  2MJE A;  2WYQ A;  1UBI A;  1KFY B;  1FXA A;  1Q5W B;  4IUM B;  3AM9 A;  2ZVN A;  1ACC A;  3UQA A;  2BB5 A;  4ZHO A;  3X23 A;  1C76 A;  1V1P B;  4GOC A;  2WXG A;  2KK8 A;  3DHI C;  2Q5W D;  3PV1 A;  4NZL B;  4DHJ B;  2MRP A;  2QEJ C;  2N9K A;  1AW7 A;  4K3B A;  4ZOH C;  1SEB D;  3WAN A;  3EFC A;  2J0J A;  1YIW A;  2LJI A;  3L54 A;  2NTT A;  2JU6 X;  3BVG A;  2ZEQ A;  3A9K B;  4HWI B;  3RZF A;  2KAC A;  3AXC A;  2WDV B;  4ANV A;  4GU2 A;  4YXD B;  3DQV A;  1NYR A;  3BVZ A;  2KQ7 A;  2L0F A;  2YLM A;  3GOE A;  1D6E C;  2J53 A;  3VVW B;  1C78 A;  2BS2 B;  2Y3A A;  4P6V F;  3U52 E;  2XNA C;  3SDL C;  3IG3 A;  4TQ1 A;  4ZYN A;  2G45 B;  2KHW B;  1CMX B;  2KDM A;  3GP7 A;  2K39 A;  1FFU A;  3HVD A;  3ZXR A;  1WH3 A;  3DHG C;  4AUQ C;  4DDG D;  2LXC A;  3ZRF A;  3OLM D;  2PVO D;  4JLC A;  3AE3 B;  4C00 A;  1F52 A;  1TS3 A;  3ZNZ B;  4DBG A;  1TKG A;  2LFI A;  3KQ4 A;  2WU2 B;  2BS3 B;  4BAX A;  4PT5 A;  4ANW A;  3RNB C;  3A9J B;  4ZRP A;  2JRI B;  4IM2 A;  2D3A A;  1GAQ B;  4HDQ A;  3AE9 B;  5JH5 C;  3RPF C;  4KDL B;  2LUM A;  1UEL A;  4MGZ E;  2WXR A;  3R2T A;  1DOX A;  3PZD A;  1WWT A;  2J7Q B;  1L0Y B;  2KQ4 X;  3FIL A;  3V3X A;  3VR8 B;  4FUL A;  3EC8 A;  2L0T A;  2GBJ A;  3PVL A;  1BUI C;  3Q8B A;  4EOY A;  2DNF A;  2ZVO A;  1WZ0 A;  4YT0 B;  1NDD A;  3JW0 X;  3QWZ B;  5BYS A;  1OFF A;  4KSL C;  1PUT A;  3VH4 B;  1WXA A;  2ZNV C;  2CU1 A;  2DZK A;  4TUU A;  2IND C;  4ZDV A;  4AQ7 A;  2RDB C;  2ASQ A;  3DVN U;  3AE2 B;  4FJV B;  1ZDX A;  2W55 A;  4M0W A;  4RNA A;  1NVI D;  1TY0 A;  3VDZ A;  1C4P A;  4F7Z A;  1K50 A;  4L1B A;  4G50 A;  4JGH B;  5EE1 A;  3ZW3 A;  4PS3 A;  3RCZ A;  2BWF A;  3HRD D;  1QOF A;  4ICU A;  2KKC A;  3B2F A;  1IPG A;  3PLU A;  3BVM A;  2QHO A;  5E6J A;  3ZDT A;  2WXL A;  2PJH A;  4TSS A;  3KUD B;  2KD0 A;  3AV8 A;  1VCB A;  2LRU A;  2LGI A;  4F8C B;  1S1Q B;  2WS3 B;  2PE6 B;  3QIJ A;  1IUE A;  2BB6 A;  3KUZ A;  1ISN A;  2C5L C;  4C56 C;  3NRZ A;  3PZ8 A;  4GDL B;  3ZNH B;  2G4S A;  3IXS A;  2OED A;  3ZLZ A;  2INC C;  3KW5 B;  1JWA D;  2DZM A;  3AE4 B;  1XLP A;  5BO4 B;  4YTP B;  1TBE A;  1PGB A;  1XD3 B;  2JUO A;  1WX7 A;  1FFV A;  4MDK E;  1WGR A;  1WJN A;  2K6Q A;  1V86 A;  1EF1 A;  1RFA A;  4MGI E;  1V97 A;  2HDE A;  1MI0 A;  4DWF A;  1TGZ B;  5JHB A;  3N30 A;  3TCA A;  1FCL A;  4JIO U;  1ZE3 D;  3PRZ A;  1ET6 A;  4K81 A;  3ZNG C;  4A55 A;  3ZVV A;  1GJZ A;  1VD2 A;  4K3C A;  2EMS A;  2LVO A;  1OEY A;  3Q8E A;  4M8M A;  1GT8 A;  4G0N B;  5EE0 A;  3SU8 X;  1YN4 A;  4NJ6 A;  3VTV A;  5DPR A;  2LWP A;  5L83 A;  2YEP B;  3W2D A;  1YOV B;  2CJO A;  3H1U A;  4GIV A;  3AE5 B;  3MC8 A;  4MM3 B;  4WAF A;  3JSV B;  3KVF B;  4K1R B;  4W9F A;  4YTM B;  1J8C A;  4AJY B;  4IM3 A;  4BFR A;  4HDO A;  2HD5 B;  3AU5 A;  4D2K A;  4M01 A;  4P7I A;  1L5P A;  1E5W A;  2RSU A;  1Q1O A;  4B0M A;  4WJN A;  1A70 A;  2UWQ A;  1H8C A;  3PRM B;  1FCC C;  2RPV A;  1WMH A;  1ZXI A;  1XEE A;  2IPK D;  3MP9 A;  2OJR A;  4HLE A;  2N1W A;  5CHF A;  3R66 C;  2KDE B;  4E74 A;  1B9R A;  3UIN B;  3W1S A;  5CTR C;  3CMM B;  2N9X A;  2MEK A;  1V8C A;  3NZU A;  1E8X A;  1YNT E;  1I4X A;  2N9E B;  1CZP A;  4I6P A;  1RLF A;  2LVQ A;  3RNC C;  3VAW A;  2D2Q A;  2WXQ A;  4MT5 A;  1WY8 A;  3I3T B;  4OVZ A;  3SD5 A;  3AMZ A;  1XT9 B;  3U7D A;  3RUI B;  4Q2J A;  3DBR I;  4KIK B;  2XBB C;  3W5U B;  2N7E A;  1WGG A;  3BYY B;  3SHQ A;  5H8Y E;  1K52 A;  1MG8 A;  1JW9 D;  1EM7 A;  3H7S A;  2K8H A;  4WWP A;  4I6N B;  2J0K A;  1KLG D;  2ZPY A;  2WGS A;  3P42 A;  1Z2M A;  3ECI A;  5D3I B;  1NI3 A;  3PRP B;  4MEM A;  2KX0 A;  4ZRK A;  1WE6 A;  3B0A A;  3UGB B;  5DPW A;  2KWV B;  1N6Z A;  2WQY B;  3ZQ4 A;  3ZGZ A;  1D5Z C;  3LB8 C;  2V4L A;  4LNN A;  3D32 A;  1T0R C;  3M95 A;  1ZKH A;  1N5X A;  5AUI A;  4W9D A;  2MLB A;  3KWV A;  1C77 A;  3BY4 B;  2KDB A;  2LGS A;  4KGR A;  1P1A A;  4E3C A;  3AB5 A;  4MAC A;  4C4V B;  1HZ5 A;  1V5T A;  2C7N B;  2YEP F;  4GDK A;  2INP E;  2O6V A;  3DWM A;  3Q3N C;  3ZTC A;  1UF0 A;  1VZ6 A;  2KQS A;  3L4P A;  4MJS A;  5C2T B;  1YJ1 A;  2FID A;  4O1N A;  4BVU C;  3NS1 A;  2CR5 A;  3ML9 A;  2QSD A;  4QAY A;  1KTK A;  2JZ3 B;  4FAD A;  3DBS A;  4UDU C;  1T5X D;  5J18 A;  2JT4 B;  4HCP B;  3RYT A;  3RMK C;  2AYO B;  1LXD A;  2OHF A;  1LGR A;  3KLS X;  3TIX A;  2LHD A;  5C1Z A;  4GB9 A;  5HKH A;  4KKJ A;  4YWG G;  1WSP A;  4W9I A;  3P4R B;  1E6E B;  1L7Y A;  4OZC A;  3OJ3 A;  1G6J A;  4OHJ A;  3ENE A;  1XF5 L;  4S0R A;  1L6U A;  1L2N A;  2I1K A;  3WIM A;  3HIZ A;  3AE6 B;  1T6B X;  4MGK E;  2N4F A;  3OG5 A;  1YX5 B;  2NCN A;  2K22 A;  2EMT A;  3BK1 A;  1C79 A;  3E9S A;  1ET9 A;  5LNK 1;  1KLV A;  5FKA C;  4IKG A;  1GC7 A;  2MBE A;  4I6L B;  1M94 A;  2KXJ A;  1E8W A;  1WX8 A;  4LNF A;  1A5R A;  4P16 A;  2IY1 B;  5CX3 A;  3VH3 B;  4ARC A;  1QKZ A;  2CU3 A;  3DVG Y;  2NS5 A;  4PS7 A;  3URY A;  4W9E A;  1HZ6 A;  4K7W A;  4BKT A;  2N0S B;  4G11 A;  3I5J C;  1T0S C;  3U8Z A;  2L3Z A;  2MW5 A;  2ICI A;  1JRO A;  5C23 A;  2CJN A;  1WGK A;  1V6E A;  4M00 A;  1C1Y B;  1WYG A;  4E71 A;  5FR3 A;  3IAM 1;  2WXH A;  3GE3 C;  5IOI A;  3DCG A;  2GBR A;  2OJW A;  3ONS A;  2JPH A;  4C7Y A;  4FHJ A;  2HTH A;  4M02 A;  2DYO A;  3NVY A;  4GSW A;  3AEF B;  1F2R I;  1WF9 A;  3NJT A;  3L17 A;  4EZJ A;  3P63 A;  2FE8 A;  1GB4 A;  1UNS A;  2BTE A;  1WIA A;  2BYT A;  1T0Q C;  4DHZ E;  2INN E;  2DX5 B;  1B1Z A;  3ZDM C;  1JAL A;  4XX5 A;  1E9M A;  2WNM A;  4JQW C;  1P7F A;  1WXS A;  1D5M C;  3NHE B;  5DCN A;  4PYZ A;  3UIP B;  3B9J A;  3V60 A;  2D3B A;  3JYU A;  1UZX B;  1JWU D;  2YVC A;  4A6Q A;  1N60 A;  3Q3J A;  4KZC A;  3VHT C;  1VZ8 A;  5BYR A;  3H7P B;  1J7A A;  3I57 A;  1VR9 A;  3IT4 B;  1WXM A;  1RM6 C;  1TTN A;  1UWX A;  3TUO A;  1WXQ A;  3N1Y C;  4A90 A;  4PYU A;  2M0A A;  2QDF A;  1KRH A;  2AL3 A;  4ZRI A;  2WX0 A;  3APD A;  3ALB A;  2KN5 A;  4AP4 C;  5DPS A;  3ZJU A;  2FBW B;  1YN5 A;  2FCN A;  4DXG A;  1WR6 E;  4BKG A;  2RDG A;  1V80 A;  1YQB A;  5TSS A;  2JY6 A;  4WWM A;  2DYB A;  4AS1 A;  2KC1 A;  2KWD A;  2O2V B;  2JSV X;  4HXD A;  1R4M I;  2D3C A;  3TJP A;  3APF A;  3TEY A;  3DBH I;  1IBX B;  2L32 A;  1ESF A;  5LXH A;  1FNW A;  4P1C C;  4FJZ A;  3Q69 A;  2VZK D;  4C7Z A;  3Q14 C;  2LXA A;  1WRI A;  1H4R A;  1SJH D;  1GPX A;  4W9C A;  3EUB 2;  2RDH A;  3SEB A;  1NI2 A;  1QOA A;  1TS2 A;  5D2M B;  1JRU A;  3TEX A;  2J4X A;  2K3U A;  1HQR D;  3MHZ A;  1VRA B;  1TT5 B;  2DHZ A;  1QF6 A;  5JZE B;  2WX1 A;  3RNF C;  2JX5 A;  2JYE A;  1YD8 U;  4MSM B;  4US9 A;  1R4N I;  1HTO A;  2BGF A;  2HE7 A;  1V81 A;  3VUX A;  2JXT A;  3T3O A;  1Y8R C;  2GRI A;  1UUP A;  4AJW A;  2KMA A;  3LXF A;  5HHD G;  4MGY E;  4OZA A;  4HPM B;  5BMI A;  5EDS A;  1N62 A;  3N3K B;  1TKE A;  4XYC A;  1ZPS A;  2LHE A;  4IM0 A;  1JWB D;  2Y5P A;  3BZD B;  3H6N A;  4XZ4 A;  3OJ4 B;  1WGY A;  2FNJ B;  2AWT A;  3KH0 A;  1FO4 A;  3UIO B;  2MCN B;  4RGN A;  3A1Q B;  1XCQ L;  3AE8 B;  5L95 C;  1YQ3 B;  4J3O D;  2D5G A;  1OQY A;  4YSX B;  1IYF A;  3L08 A;  4HCN B;  4US8 A;  1UH6 A;  3DPD A;  2KVR A;  3NVW A;  2GBK A;  4JWS C;  5D6J B;  1AAR A;  3IT6 B;  5G55 A;  1MJD A;  1SSN A;  2VH1 A;  3V61 A;  1GNU A;  1PGX A;  3AU4 A;  2GB1 A;  1NBF C;  4USA A;  1OQQ A;  4GMV A;  5IP4 D;  3KWL A;  5KHQ A;  2KTR A;  2RGF A;  3PRE A;  4RF1 A;  1JCK B;  1GTE A;  1UGJ A;  1JRP A;  1P9D U;  2IY0 B;  3N1X C;  2XK5 A;  4BZA A;  1QZE A;  5E6P A;  3Q3M C;  2WU5 B;  2Z59 B;  2KFK A;  2NPT B;  3CWI A;  2ZCB A;  3WAM A;  5C3J B;  4NAW A;  2VRR B;  4XWT A;  4A9A A;  4LLG M;  4XC2 A;  2L1A A;  1STE A;  3PZ7 A;  4RMA A;  3FC4 A;  2MP2 B;  3KYC D;  3U30 A;  1TZ1 A;  1VZ7 A;  3ETR A;  3K9O B;  4RFB A;  4WUR A;  2NMQ A;  4JL9 A;  3PHW B;  1ENF A;  2MJD A;  3RNE C;  3TEW A;  2W3S A;  1JWS D;  4CYE A;  1K51 A;  2ZCC A;  2BYF A;  4OVV A;  1WJU A;  3TL5 A;  1N63 A;  2LAS A;  5AUK A;  3RFZ B;  2KLC A;  1LO5 D;  3LJ3 A;  1P98 A;  4AWJ A;  5KHO A;  2WXF A;  1FIQ A;  3OAW A;  2BKR B;  5FK9 C;  3DOW A;  4LCD E;  2R2Q A;  2QJL A;  2PW9 A;  2XEW A;  3ZYY X;  3EHV A;  3MJW A;  4WIP A;  2R2O A;  2BT6 A;  5AZF A;  3R7R A;  3V6E B;  4KSK C;  4RM9 A;  2L05 A;  5E6N A;  3PTF C;  4WQM A;  4IWO A;  4HVB A;  5MPO A;  1V1O A;  1EF5 A;  4HEA 1;  4TQ0 A;  1KOT A;  2IGD A;  2M56 B;  4DXF A;  1MG4 A;  3VFK A;  2OOB B;  4HJG E;  1FXI A;  4NQK E;  1BML C;  2PE9 A;  1BT0 A;  3DDC B;  2KMM A;  1QOB A;  3QHT A;  2LMC A;  1IGD A;  2KC2 A;  3NZS A;  1HTQ A;  1V1P A;  5IA7 A;  4DHZ B;  4XDC A;  2QIE B;  1WYW B;  4KDI C;  3ZNI D;  3BK2 A;  1E10 A;  4LK0 M;  2KWC A;  3BYT B;  1C4A A;  2M0X A;  3P4Q B;  3A9K A;  2IGG A;  2FCQ A;  3QAQ A;  1WJ6 A;  2BYV E;  4AOF A;  2SEB D;  4EZL A;  4MH0 E;  1D3Z A;  1KLU D;  5EE9 A;  3P4P B;  3WAP A;  3WA0 A;  4ZRJ A;  4EE2 A;  5FR6 A;  1J7B A;  1H7W A;  3FIL B;  3M63 B;  4HPL B;  1WM3 A;  2L83 A;  2L8J A;  2CHW A;  4HK2 A;  1LFD A;  1SE4 A;  2MBB B;  4N9F 4;  2RPQ A;  5HI1 A;  2DWQ A;  2MBO A;  1KH0 A;  3VXW A;  4BOZ B;  4FA6 A;  1HXY D;  2L76 A;  2ONQ A;  3AEA B;  3GB1 A;  1QLB B;  4IW0 A;  1CQV A;  2ZW0 A;  4DXA B;  4RGT A;  3DBL I;  4KVG B;  3AEE B;  4WWO A;  3ZJV A;  2KFJ A;  3A9J A;  3DHH C;  3Q8C A;  2ON8 A;  4N58 A;  2AX5 A;  1PDX A;  2V9H A;  3CF6 E;  2FCS A;  4PS8 A;  3AN1 A;  1SBB B;  1WE7 A;  4M0W B;  1UD7 A;  2WLB A;  5AEK B;  5JXV A;  2IO2 B;  3GZN I;  4ARI A;  2SAK A;  1Y56 A;  1WM2 A;  2LGX A;  3ABV B;  4HKZ E;  2G3Q B;  2BF8 B;  4HJK A;  4KX6 B;  2UYZ B;  1JQ4 A;  1LM8 B;  4JWU C;  3RN9 C;  2G1E A;  4K7U A;  4WWN A;  2BQQ A;  3J9C A;  2TSS A;  4LNK A;  1EU3 A;  2DAJ A;  5JHA A;  2GBM A;  5CHW A;  2JQR B;  3QQ8 B;  1R4M B;  2DZJ A;  1TS5 A;  3TBL D;  3M3J A;  4B6W A;  1E90 A;  2N1V A;  3MFG A;  3CST A;  2WDT B;  4BBN C;  4ITK A;  3DBH B;  4ASW C;  1WJ4 A;  4G3X B;  4DHJ D;  4IG7 B;  3WAO A;  2JXX A;  3SFE B;  4W9L A;  5BYQ A;  2PPH A;  3WCQ A;  3P2B A;  3BII D;  1WR1 A;  3A4R A;  5GXG B;  3NVZ A;  4OZB A;  4BKS D;  1YMH E;  1HA5 A;  1P0R A;  2FCM A;  1LQB A;  3MJ5 A;  4X57 B;  3N20 C;  2BBC A;  3L0W B;  1YJJ A;  3V05 A;  4R3D A;  4KGT A;  3NY5 A;  3T3N A;  2I38 A;  2K9X A;  2KVZ A;  3L10 B;  3Q3F A;  2LVP A;  1XXG A;  3IVF A;  1N5W A;  4LDT B;  4MSQ B;  4HRS A;  1DYQ A;  1KF6 B;  1XQQ A;  4W9H A;  3AI5 A;  2KO3 A;  4YL8 A;  3T9L A;  2MBH A;  4NAM A;  2BPS A;  2H89 B;  3B2G A;  4MH8 A;  1GUA B;  1PYW D;  1R4N B;  2PMV A;  2IO1 B;  1RRB A;  3H9D A;  1S3S G;  4A3O A;  4GXB A;  2KWU B;  1Q0W B;  2JRH A;  4L23 A;  2KAN A;  4GDL A;  2M1M A;  1JML A;  1NEK B;  2K8B A;  2DBY A;  1FPY A;  2W54 A;  2V0G A;  1K53 A;  1L6V A;  1FD6 A;  1TS4 A;  1I35 A;  3VUW A;  2K1F A;  4W9J A;  4ZYS A;  3MC0 B;  4NPN A;  5J2R A;  2MQJ A;  3SR6 A;  4MEL A;  1V5O A;  4RGO S;  1WMH B;  3VTU A;  3U4E G;  2XN9 C;  4TKN A;  2D11 A;  5H92 C;  2WP9 B;  2PLP A;  5CHV C;  3ZKJ C;  2A5U A;  4DQO C;  1XLN A;  3PT2 B;  1SIF A;  3UF8 A;  3PO0 A;  4OVU A;  2QC8 A;  2ZJD A;  5BMG A;  3IHP C;  4B0E A;  3C0R B;  2EEL A;  2PEA A;  3GE8 C;  3WAL A;  2HJ8 A;  2ACZ B;  4EZK A;  4TMA B;  3T8M A;  3W1Y A;  4MM3 A;  3QAR A;  1J0G A;  2BYE A;  2CHX A;  3JSV A;  4B9K A;  2IJ0 A;  3ZO5 B;  2K25 A;  4OW0 A;  1RAX A;  5T8I A;  2HJ1 A;  1VJK A;  2IZV B;  1UWM A;  1DGJ A;  3QCA A;  2KAJ A;  1EUV B;  2D3G A;  3BIN A;  1IGC A;  4L2Y A;  2JZP A;  2R61 A;  4XE0 A;  1QOG A;  2I1J A;  1QIL A;  4S17 A;  2ZZP B;  1PQS A;  1XLQ A;  2WDR B;  1SB3 C;  2M19 A;  3ZIM A;  3OWE B;  1QQR A;  2C9W B;  4CO7 A;  2PKO A;  4RCO A;  3PSE B;  5LLI A;  1SE3 A;  3C19 A;  4NQL B;  2QCZ A;  2IDY A;  2LGD A;  2AQ2 B;  1F0Z A;  4KGS A;  2KOX A;  1RYJ A;  4XWW A;  3AUL A;  2K5P A;  2GOW A;  4RF0 A;  2M4N A;  2E6X A;  2GMI C;  4HPP A;  3IBE A;  4KIK A;  2C60 A;  1AN8 A;  1SIJ A;  2KYW A;  3MHS D;  4WJP A;  4GDK B;  2NTS A;  2O6V B;  4H2A A;  2RMM A;  2I2Y A;  4MJS B;  3O13 A;  1FRD A;  1FNU A;  1F77 A;  2Y5C A;  4NJC A;  1YN3 A;  4FHK A;  1SXT A;  3PHX B;  1TJE A;  2BW2 A;  1GC6 A;  2JWZ A;  1F1H A;  1IP9 A;  2LGY A;  1I4H A;  1V2Y A;  1WX9 A;  4KZ0 A;  1TZO A;  4K7S A;  1GTH A;  1GB1 A;  2CHZ A;  2DLB A;  3W9C B;  4EFO A;  1PGA A;  3MC9 A;  1YX6 B;  2LRW A;  2MJ3 A;  1I4R A;  4P1B C;  3SFD B;  4LNI A;  4C4V A;  1ZOY B;  2KMC A;  2MBQ A;  4CHK A;  4XGA B;  4W9G A;  3DBR B;  5J17 A;  3I63 C;  2NR2 A;  2KJ6 A;  3A33 B;  1MHH E;  2KZR A;  4YSY B;  3QK0 A;  2Z0D B;  2X8X X;  2WDQ B;  1ROE A;  1V49 A;  2V3N A;  4HKQ A;  2WXO A;  2G9H D;  4GLS C;  4RH6 A;  4TV3 A;  4IDI A;  5G5H A;  2DZI A;  4PK1 A;  2KJR A;  4NY0 A;  2N9L A;  4IWQ A;  1FM0 D;  3AEC B;  1SF0 A;  1R7S A;  1I4Q A;  2MHJ A;  1E7V A;  2K0P A;  1I7H A;  3IAS 1;  2QIL A;  3QC8 B;  1MFW A;  3TSS A;  1WZ3 A;  3RT3 B;  1N61 A;  3W1S C;  1L0X B;  2V3S A;  2AQ1 B;  1TY2 A;  3E56 A;  4HRO A;  3VTW A;  1JWM D;  1SE2 A;  4WQO B;  1HEZ E;  4EEW A;  3UQB A;  2WXI A;  3A4S C;  3X0W A;  4JPS A;  5I4D A;  3P4S B;  1J7C A;  1FMA D;  1MPE A;  3C8Y A;  2MSE D;  3MTN B;  2EKI A;  3ML8 A;  3DBL B;  2KDI A;  1QT9 A;  2QMT A;  3NUH B;  5E6O A;  4RGM A;  5D7G A;  1SJE D;  2DEN B;  2J0M A;  3NS8 A;  1DOY A;  2WWZ A;  2J42 A;  4LNO A;  1C4C A;  3P1M A;  2VZK B;  5IN7 A;  3QX1 A;  3GZN B;  3M62 B;  1T3Q A;  2MH7 A;  2W9N A;  4DDI D;  5TR5 A;  4WJO A;  1U4A A;  2MA9 B;  1ZUD 2;  3Q6B A;  1EWC A;  2REX A;  1H7X A;  2DYM A;  4IC7 B;  1AWD A;  2X38 A;  1C3T A;  1VLB A;  4GN1 A;  2IO3 B;  4FXC A;  3EGR A;  5G5G A;  4NNJ B;  3AEB B;  1P3Q U;  3KYD D;  2GI9 A;  2L00 B;  3HM6 X;  2Z8L A;  3UI3 A;  2FUG 1;  4WH4 A;  2KDF B;  2G4D B;  5AZH A;  1WFY A;  3HM3 A;  5G2N A;  2ZPN A;  3ZTD A;  2H88 B;  4YSZ B;  1OQR A;  2B3A A;  1M4V A;  3O65 B;  1P7E A;  1WRD B;  3RD2 A;  2LEK A;  2KNB A;  4DK5 A;  1ZGU B;  5IAA C;  5D3D A;  3RNG C;  4REZ A;  4BOS C;  1WI0 A;  3KUC B;  1V9J A;  1SGH A;  2EKE C;  1PFD A;  1ZW7 A;  2B76 B;  2NBU A;  3L16 A;  3DVG X;  5BMH A;  1K8R B;  2C7M B;  2D10 A;  3FAH A;  4ANX A;  4W9K A;  3RUL A;  3CSF A;  1HE8 A;  2PVG C;  1C9F A;  4A8X C;  3HHM A;  3FKY A;  2IBI B;  2WXK A;  3HVZ A;  3NVV A;  2N7J A;  5IKC M;  2NBV B;  1YQ4 B;  5AZG A;  2E3T A;  4CQN A;  1WXV A;  1XLO A;  1WGD A;  3H7P A;  4LTU A;  2N7D A;  2AQ3 B;  3PPA A;  4FBJ B;  2RR9 A;  3V62 A;  3Q2A C;  4BKS A;  3PLV A;  3QA8 A;  2J52 A;  3PS6 A;  1XO3 A;  1EWY C;  2IYD B;  4FN2 A;  3GS2 A;  5LXI B;  4LDT D;  4EUT A;  2WXP A;  2C7H A;  4J6I A;  4RM8 A;  2W3R A;  2GBN A;  2K8C A;  3Q8A A;  1TIF A;  1I42 A;  1CJE A;  1OTR B;  3DWG C;  2CS4 A;  2O2V A;  1OEY J;  2V3P A;  3JVZ X;  1NYQ A;  1E8Y A;  2WHI A;  1D5X C;  4XDD A;  2KJH B;  4ANU A;  4BBN F;  1IBX A;  3EFU A;  3EA6 A;  3RNA C;  4JE3 B;  5EE3 A;  3PGE A;  5GMV A;  3R2I A;  2KX3 A;  4URK A;  4IWP A;  2CKH B;  3NOB A;  4F1S A;  3R7Q A;  1D4B A;  4N6E B;  2MWS B;  4ICV A;  2LD9 A;  2WXJ A;  3TMP B;  1UBQ A;  1RFK A;  3AH7 A;  4M8N A;  1WGH A;  2V4I B;  1I4P A;  2ZW1 A;  3U7Z A;  3VRB B;  3ZRC A;  3VR9 B;  3V6C B;  2UU7 A;  3N1Z C;  2M17 A;  4A20 A;  3S2A A;  4WAA A;  3HUI A;  1L4D B;  1SE9 A;  2AL6 A;  1Q10 A;  1VDV A;  3AE1 B;  4FJY A;  1MHX A;  4KV2 A;  1FXT B;  3H8H A;  4IOI E;  4A3P A;  3DVN V;  3APC A;  1BXT A;  3R3M A;  3I9V 1;  2LI5 A;  3VRA B;  1ZDV A;  4KKI A;  3ZJT A;  2KTR B;  2BS4 B;  1FRR A;  1XCT L;  3AEG B;  2BKF A;  4JX1 C;  3ZUN A;  2L52 A;  2FUH B;  3LDZ E;  3BWU D;  1UGM A;  2KN4 A;  3W5V B;  1EU4 A;  2XK5 B;  2D07 B;  1E0Z A;  3NZ3 A;  2Y5B B;  3EEC A;  3HK0 A;  1L0V B;  1NEN B;  2VH2 A;  2W82 A;  2KLG A;  2KFK B;  2JZZ A;  4II2 B;  3L13 A;  1X1M A;  1E7P B;  3A1Q A;  1TYG B;  4NAW B;  2LZ6 A;  1KJT A;  3TEZ A;  3AED B;  3VUY A;  3B08 A;  1Z5S B;  3Q3O C;  3R8B A;  2NVU I;  4YTN B;  1FNV A;  2M8S A;  2V1Y A;  1J19 A;  2N9P C;  1GG3 A;  5DPT A;  4WJQ A;  2FAZ A;  3B1L X;  3IFW B;  2JWU A;  1E7U A;  3K9P B;  1RWS A;  2Z0E B;  3LYY A;  2L7R A;  2IO0 B;  4B95 A;  3ZXV A;  1CK1 A;  2LJ5 A;  2RD0 A;  1AYF A;  1FEH A;  4LJO B;  2IGH A;  2O6V D;  1F9J A;  1DOI A;  2ZNV B;  5IO9 A;  2JVC A;  2LUE A;  1MVK A;  4GGQ A;  2MX2 A;  4II3 B;  4ZHP A;  2NPT A;  3RZW C;  4EKU A;  1GOZ A;  2HTM E;  3AE7 B;  2KT7 A;  2A4Z A;  1F2R C;  2JYT A;  2KTF A;  4LJP B;  1I4G A;  1T0Y A;  2AEH A;  4NJ7 A;  2NBW B;  4ZRQ A;  2PIA A;  2PTL A;  4ACF A;  2BWE S;  2MP2 A;  1L4Z B;  1E8Z A;  4FLH A;  1TKY A; 
#chains in the Genus database with same CATH homology
 1KTK A;  2MJ3 A;  3N9Y C;  1I4R A;  5HG2 A;  3VQI A;  3SFD B;  3Q8F A;  1N63 A;  5AUK A;  3RFZ B;  2WXM A;  4UDU C;  1T5X D;  1ZOY B;  1LO5 D;  5HFY A;  1ZP0 B;  4C80 A;  1ZXH A;  2WXN A;  3U2S C;  2OHF A;  2WXF A;  1FIQ A;  3KLS X;  4N59 A;  2LHD A;  5FK9 C;  1YJI A;  3CF4 A;  3CIR B;  2QJL A;  4KKJ A;  1MHH E;  4YWG G;  1WSP A;  2PW9 A;  3ZYY X;  4YSY B;  2MJE A;  1KFY B;  1FXA A;  3P4R B;  1E6E B;  4OZC A;  3AM9 A;  4WIP A;  2BT6 A;  2WDQ B;  1ROE A;  2V3N A;  4HKQ A;  4OHJ A;  1ACC A;  2BB5 A;  1XF5 L;  2WXO A;  1L6U A;  2G9H D;  4GLS C;  4RH6 A;  4IDI A;  4ZHO A;  1C76 A;  5G5H A;  1V1P B;  2WXG A;  3AE6 B;  2Q5W D;  4WQM A;  2N9L A;  4NZL B;  5MPO A;  1V1O A;  1FM0 D;  3AEC B;  1SF0 A;  1R7S A;  1I4Q A;  1T6B X;  2N9K A;  2QEJ C;  4HEA 1;  4TQ0 A;  1AW7 A;  2IGD A;  4ZOH C;  2M56 B;  2K0P A;  1SEB D;  1I7H A;  4DXF A;  2K22 A;  3IAS 1;  3BK1 A;  2QIL A;  2LJI A;  1C79 A;  3E9S A;  1ET9 A;  1FXI A;  4HJG E;  5LNK 1;  1BML C;  2NTT A;  2KMM A;  2JU6 X;  5FKA C;  4IKG A;  3BVG A;  3TSS A;  1N61 A;  1QOB A;  2KAC A;  2WDV B;  2LMC A;  1IGD A;  1L0X B;  4YXD B;  2AQ1 B;  1TY2 A;  3E56 A;  4HRO A;  1V1P A;  1NYR A;  4P16 A;  1JWM D;  3BVZ A;  1D6E C;  2J53 A;  1C78 A;  1SE2 A;  2BS2 B;  2Y3A A;  4P6V F;  3U52 E;  1HEZ E;  2QIE B;  4XDC A;  2XNA C;  2WXI A;  4JPS A;  4ARC A;  5I4D A;  4TQ1 A;  3BK2 A;  1E10 A;  3P4S B;  4LK0 M;  1QKZ A;  3BYT B;  2CU3 A;  2KDM A;  1C4A A;  1J7C A;  3URY A;  1FMA D;  1MPE A;  3C8Y A;  3P4Q B;  3GP7 A;  1FFU A;  2EKI A;  1HZ6 A;  3HVD A;  2IGG A;  1QT9 A;  2QMT A;  3NUH B;  2N0S B;  4RGM A;  5D7G A;  1SJE D;  2SEB D;  2PVO D;  3AE3 B;  1KLU D;  1TS3 A;  5EE9 A;  1DOY A;  3P4P B;  2ICI A;  1JRO A;  2J42 A;  1C4C A;  3P1M A;  2VZK B;  2CJN A;  1TKG A;  4EE2 A;  1WGK A;  2LFI A;  3KQ4 A;  1J7B A;  1H7W A;  3FIL B;  1WYG A;  2WU2 B;  2BS3 B;  1T3Q A;  2MH7 A;  3IAM 1;  5FR3 A;  2WXH A;  2L83 A;  4PT5 A;  4ZRP A;  2QSD A;  1SE4 A;  4C7Y A;  5HI1 A;  1ZUD 2;  2DWQ A;  1EWC A;  2DYO A;  3NVY A;  1H7X A;  1GAQ B;  2DYM A;  3AE9 B;  1KH0 A;  1AWD A;  2X38 A;  1HXY D;  2ONQ A;  3RPF C;  3AEA B;  3AEF B;  1VLB A;  3GB1 A;  1F2R I;  1QLB B;  2LUM A;  1CQV A;  2ZW0 A;  4FXC A;  3EGR A;  2WXR A;  5G5G A;  3R2T A;  1DOX A;  4RGT A;  1WWT A;  3P63 A;  1L0Y B;  2KQ4 X;  3FIL A;  3AEB B;  2FE8 A;  3V3X A;  3VR8 B;  1GB4 A;  1UNS A;  2GI9 A;  3AEE B;  2BTE A;  2Z8L A;  3ZJV A;  3Q8C A;  3UI3 A;  2BYT A;  2ON8 A;  2FUG 1;  2INN E;  4N58 A;  1BUI C;  3Q8B A;  2AX5 A;  1PDX A;  4WH4 A;  1B1Z A;  3AN1 A;  1JAL A;  1SBB B;  2H88 B;  4YSZ B;  1E9M A;  1OQR A;  2WLB A;  5JXV A;  4YT0 B;  2WNM A;  1M4V A;  1P7F A;  1P7E A;  4ARI A;  2SAK A;  1D5M C;  1Y56 A;  5BYS A;  1OFF A;  3ABV B;  1PUT A;  4HKZ E;  2LEK A;  4KX6 B;  5D3D A;  1JQ4 A;  4REZ A;  4JWU C;  2G1E A;  3B9J A;  1JWU D;  1PFD A;  4A6Q A;  4AQ7 A;  2B76 B;  1N60 A;  3J9C A;  2TSS A;  3AE2 B;  1EU3 A;  5BMH A;  1VZ8 A;  1ZDX A;  2W55 A;  4M0W A;  1NVI D;  1TY0 A;  4RNA A;  2JQR B;  5BYR A;  1C4P A;  3FAH A;  1TS5 A;  1K50 A;  1J7A A;  3I57 A;  1VR9 A;  3IT4 B;  4L1B A;  3MFG A;  1RM6 C;  1UWX A;  5EE1 A;  4ITK A;  1C9F A;  2PVG C;  4A8X C;  3TUO A;  1WXQ A;  3HRD D;  1QOF A;  4A90 A;  3SFE B;  2WXK A;  5BYQ A;  2M0A A;  3B2F A;  3WCQ A;  1KRH A;  3BII D;  3HVZ A;  3BVM A;  3NVV A;  2N7J A;  5E6J A;  1YQ4 B;  2WXL A;  2E3T A;  4TSS A;  5GXG B;  3ZJU A;  4CQN A;  2FBW B;  3NVZ A;  4OZB A;  1YMH E;  1XLO A;  1HA5 A;  1YN5 A;  4LTU A;  3MJ5 A;  2AQ3 B;  3AV8 A;  4DXG A;  2LGI A;  2BBC A;  1YJJ A;  2WS3 B;  2RDG A;  3V05 A;  4R3D A;  5TSS A;  4KGT A;  4WWM A;  3T3N A;  2I38 A;  2K9X A;  1IUE A;  2BB6 A;  4AS1 A;  4C56 C;  2KWD A;  3NRZ A;  3PZ8 A;  4GDL B;  1XXG A;  2JSV X;  1N5W A;  4HRS A;  3IXS A;  2OED A;  1DYQ A;  2J52 A;  1JWA D;  3AE4 B;  1XLP A;  1KF6 B;  4YTP B;  1EWY C;  1PGB A;  1XO3 A;  3GS2 A;  3TEY A;  1FFV A;  4NAM A;  1IBX B;  2WXP A;  2L32 A;  2H89 B;  3B2G A;  4MH8 A;  2W3R A;  1ESF A;  1PYW D;  1V97 A;  2HDE A;  1MI0 A;  2PMV A;  1FNW A;  3Q8A A;  1CJE A;  3Q69 A;  2VZK D;  1FCL A;  4L23 A;  4C7Z A;  3DWG C;  1ZE3 D;  1WRI A;  2V3P A;  1JML A;  1SJH D;  1ET6 A;  1NEK B;  1GPX A;  3EUB 2;  1NYQ A;  4A55 A;  2DBY A;  2RDH A;  2W54 A;  2V0G A;  3Q8E A;  1K53 A;  3SEB A;  1L6V A;  1GT8 A;  1D5X C;  4XDD A;  1FD6 A;  5EE0 A;  1TS4 A;  1IBX A;  1QOA A;  1YN4 A;  4ZYS A;  3EA6 A;  1TS2 A;  4JE3 B;  5EE3 A;  3MC0 B;  3TEX A;  2J4X A;  2K3U A;  2YEP B;  3W2D A;  3SR6 A;  3R2I A;  1HQR D;  2CJO A;  3MHZ A;  4RGO S;  3AE5 B;  1VRA B;  3U4E G;  4MM3 B;  1QF6 A;  2XN9 C;  4WAF A;  1D4B A;  4N6E B;  4YTM B;  5H92 C;  2JX5 A;  2JYE A;  2WP9 B;  4US9 A;  2PLP A;  2WXJ A;  4D2K A;  1RFK A;  2JXT A;  4DQO C;  1XLN A;  3T3O A;  1L5P A;  2GRI A;  3AH7 A;  1UUP A;  3PO0 A;  2V4I B;  1I4P A;  2ZW1 A;  3U7Z A;  3VRB B;  3VR9 B;  3LXF A;  5BMG A;  4B0M A;  5HHD G;  4B0E A;  4OZA A;  2EEL A;  5BMI A;  1A70 A;  1FCC C;  1N62 A;  2RPV A;  2ACZ B;  1ZXI A;  1XEE A;  1TKE A;  4TMA B;  1ZPS A;  2LHE A;  2IPK D;  3HUI A;  3MP9 A;  1JWB D;  1L4D B;  2Y5P A;  1Q10 A;  2IJ0 A;  1VDV A;  3AE1 B;  1MHX A;  4OW0 A;  3H8H A;  5T8I A;  4IOI E;  1VJK A;  1B9R A;  1FO4 A;  4RGN A;  1UWM A;  1DGJ A;  1BXT A;  3W1S A;  2MEK A;  1XCQ L;  3I9V 1;  2KAJ A;  3AE8 B;  3VRA B;  1V8C A;  1ZDV A;  1YNT E;  1I4X A;  1YQ3 B;  4J3O D;  2D5G A;  4KKI A;  1CZP A;  3ZJT A;  4YSX B;  1IGC A;  2BS4 B;  1FRR A;  1XCT L;  3AEG B;  2JZP A;  4JX1 C;  2R61 A;  4L2Y A;  4XE0 A;  1QOG A;  2L52 A;  4US8 A;  3BWU D;  2WXQ A;  4MT5 A;  4OVZ A;  3NVW A;  1QIL A;  3AMZ A;  2KN4 A;  3W5V B;  1EU4 A;  4JWS C;  1XLQ A;  1E0Z A;  3IT6 B;  3NZ3 A;  1L0V B;  1SSN A;  1NEN B;  2W82 A;  2WDR B;  1SB3 C;  2M19 A;  4Q2J A;  3OWE B;  1PGX A;  1QQR A;  2GB1 A;  4USA A;  1E7P B;  2PKO A;  1OQQ A;  1TYG B;  4NAW B;  4RCO A;  3W5U B;  1SE3 A;  3BYY B;  3TEZ A;  3AED B;  5H8Y E;  3KWL A;  1K52 A;  2IDY A;  2AQ2 B;  1F0Z A;  4KGS A;  3R8B A;  4RF1 A;  1JW9 D;  1JCK B;  1EM7 A;  4YTN B;  1FNV A;  1GTE A;  1RYJ A;  1UGJ A;  4XWW A;  1JRP A;  1KLG D;  3P42 A;  2K5P A;  4RF0 A;  2E6X A;  5D3I B;  2WU5 B;  1NI3 A;  2JWU A;  3CWI A;  1RWS A;  3LYY A;  5C3J B;  1AN8 A;  1SIJ A;  2WQY B;  3ZQ4 A;  3ZGZ A;  1D5Z C;  4GDK B;  2NTS A;  3LB8 C;  4XWT A;  4A9A A;  4H2A A;  2RMM A;  2I2Y A;  1CK1 A;  4LLG M;  2L1A A;  1AYF A;  1N5X A;  1STE A;  5AUI A;  3PZ7 A;  3O13 A;  1FRD A;  1FNU A;  1F77 A;  1FEH A;  2Y5C A;  3KWV A;  1C77 A;  4NJC A;  3FC4 A;  1YN3 A;  2IGH A;  1SXT A;  1DOI A;  1MVK A;  1TJE A;  1VZ7 A;  3ETR A;  2BW2 A;  4KGR A;  3AB5 A;  4ZHP A;  1I4H A;  4MAC A;  4RFB A;  1HZ5 A;  4WUR A;  2NMQ A;  1GOZ A;  1ENF A;  2MJD A;  2HTM E;  3AE7 B;  2INP E;  2YEP F;  3DWM A;  3TEW A;  2JYT A;  1F2R C;  1TZO A;  1I4G A;  1VZ6 A;  1GTH A;  3L4P A;  4ZRQ A;  2PIA A;  2PTL A;  2W3S A;  1JWS D;  2DLB A;  3W9C B;  1GB1 A;  5C2T B;  1K51 A;  4O1N A;  1L4Z B;  3NS1 A;  1PGA A;  3BZD B;  1TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...