3P4PB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with fumarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4pB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4pB01
1E7PB 3FAHA 2Y5CA 4YT0B 1AYFA 2AX5A 2H88B 2HTME 3AN1A 1H7WA 2PVOD 4YSZB 1N5XA 2BS4B 2H89B 2OHFA 3AH7A 3CWIA 3PO0A 4HROA 2L83A 1NI3A 1FM0D 1GTEA 1PFDA 1NENB 1V8CA 1RM6C 1XLQA 2JX5A 4N59A 4ZOHC 5EE0A 1E0ZA 4C7YA 2N0SB 1NYQA 5C3JB 1JWAD 2K22A 2K9XA 2W3RA 3AEGB 3HRDD 4ZHOA 1R7SA 5C2TB 1FFVA 2MJ3A 2E3TA 1QT9A 2PIAA 1VJKA 1ZXIA 4JWUC 1JWBD 3BIID 2PKOA 4US9A 1OQRA 2EKIA 1TJEA 2MH7A 1JRPA 3CF4A 2W54A 2CJOA 3L4PA 1SB3C 4WWMA 3NRZA 1ROEA 2WDRB 3AB5A 1EWYC 3KWLA 4WQMA 1NYRA 5AUIA 3NVZA 1OFFA 1L0VB 1ZP0B 3AE5B 1UWMA 2CJNA 1NEKB 3NVVA 1SIJA 2WU2B 1J7AA 1V97A 4ZHPA 1QOBA 4YSXB 2JQRB 3VRBB 4LTUA 1YQ3B 3AEFB 3RPFC 3P4SB 3P4RB 1YJJA 1KRHA 1GT8A 1PDXA 5GXGB 1XLPA 4C7ZA 2K5PA 2DWQA 1FO4A 3B2GA 3AE3B 2L52A 1FFUA 3EUB2 4JX1C 1TYGB 3VRAB 1QLBB 4YTMB 4A9AA 3B2FA 2BT6A 3NS1A 2QIEB 2KMMA 4P6VF 2ACZB 3VR8B 1WXQA 3ABVB 4FXCA 3CIRB 1VLBA 2WQYB 1FIQA 2QJLA 2W55A 1H7XA 1E9MA 1TKEA 3DWGC 4YTPB 4C80A 1J7BA 1KF6B 3SFDB 1WWTA 4JWSC 1QOGA 1L5PA 5EE3A 2Q5WD 1FRDA 3AEAB 3AECB 3SFEB 3LXFA 3W9CB 3P4PB 3WCQA 1ZUD2 3VR9B 2LEKA 2M19A 3HVZA 3AV8A 4ITKA 3AE6B 1N5WA 1DOXA 1DOYA 3AEEB 1GTHA 5H92C 1E10A 1IUEA 2B76B 1FMAD 4YXDB 5H8YE 1T3QA 2WDVB 1DGJA 2WDQB 4KX6B 4YTNB 2CU3A 3P1MA 4N58A 2FBWB 4USAA 2MJDA 3AEBB 5EE9A 3AEDB 1A70A 3W5VB 1ZOYB 3AE7B 3B9JA 4HRSA 5AUKA 1QOFA 2WP9B 1PUTA 3AE9B 1RFKA 1AWDA 2WLBA 3P63A 2PVGC 3FC4A 2M56B 1J7CA 3W5UB 3ZYYX 3AE2B 3LB8C 2DBYA 3AE4B 4YSYB 1GAQB 3ETRA 1RYJA 1XO3A 1YQ4B 4IDIA 1JALA 3AE8B 1N61A 1F0ZA 5G5HA 5G5GA 3P4QB 1FXIA 1RWSA 2BS3B 1JQ4A 2KAJA 1L6VA 1B9RA 1SF0A 1YJIA 1E6EB 1WRIA 3AM9A 3AE1B 1WYGA 1OQQA 1N63A 1QOAA 1XLNA 3NVWA 3SR6A 1CZPA 3DWMA 2BS2B 1N62A 1WGKA 1NVID 1TKGA 2WS3B 1GPXA 4N6EB 3HUIA 1JROA 1FXAA 1JW9D 5EE1A 1I7HA 3AMZA 1XLOA 1L6UA 2WU5B 1VDVA 4US8A 5MPOA 1N60A 1CJEA 2MJEA 1QF6A 2G1EA 1KFYB 1DOIA 1FRRA 3NVYA 2W3SA 1TKYA
chains in the Genus database with same CATH superfamily
2IDYA 1F1HA 1SJED 4E3CA 2AX5A 4RGNA 2N1VA 2PVOD 3TEZA 1ENFA 1V8CA 2D5GA 4N59A 5G55A 2KXJA 3VQIA 5FR6A 1Q5WB 1I4HA 4TMAB 1JWBD 2K6QA 3QA8A 1HXYD 3IXSA 3E56A 5E6JA 2WDRB 5DPTA 3KYDD 1L0VB 2C7MB 4NJCA 2A5UA 2DZIA 1ZPSA 2NS5A 3ML9A 4LTUA 3UQAA 1L2NA 2C60A 3MHZA 1GT8A 2DWQA 2QMTA 1JWUD 2BT6A 2MEKA 4D2KA 4FA6A 3DOWA 4FJVB 4EKUA 1FIQA 1WXAA 4S17A 1KF6B 3V3XA 2VH1A 3DBLB 2MLBA 3W1SA 2LEKA 3ZGZA 4DHJD 1UELA 1E8YA 3P1MA 3QHTA 3N1YC 3ZNZB 1T0QC 4L23A 5CHVC 2KJRA 5HI1A 3X0WA 1C1YB 3Q3FA 1P7FA 1WF9A 1ZXHA 3SDLC 4HWIB 1EU3A 3AI5A 4YSYB 1GAQB 2LXCA 1MFWA 4IDIA 1JALA 3DHIC 3P42A 3P4QB 4NPNA 4KIKA 2NPTB 1KOTA 1WGHA 1D4BA 2GMIC 2KC1A 3RMKC 1Z5SB 4MJSA 4BOSC 3VFKA 4W9HA 2WXNA 2LRWA 4GDKA 1V5TA 4GMVA 2WXOA 2KFJA 4RM9A 3S2AA 2V3PA 1FRRA 4WJOA 3RNFC 3NG0A 5BMIA 3BWUD 1N5XA 3RNGC 4PYZA 4MH8A 3AXCA 3N1XC 2NMQA 1S1QB 3DBLI 2AQ1B 4BOZB 2JT4B 4FHKA 1ZXIA 1D5XC 2O2VA 3QARA 3HHMA 2VH2A 1HZ5A 4LDTD 4IM2A 5AZFA 1UUPA 3ZKJC 1HA5A 4WQMA 1C9FA 1KLGD 1UWMA 2PEAA 4LJPB 3QK0A 4K81A 1U4AA 3GP7A 4MT5A 4DDID 3DDCB 3RNCC 2AEHA 4HCPB 2KMCA 3PZ7A 3ABVB 4NAWB 2KVZA 3Q3NC 1XT9B 4AUQC 1AN8A 4DXFA 2KLCA 2D2QA 2Q5WD 3HM6X 4YWGG 4R3DA 4FHJA 1TS3A 4WURA 5DPWA 1IUEA 4IM0A 2QC8A 1FXTB 4KX6B 1HEZE 1ISNA 1RFKA 2L7RA 2DBYA 1PGAA 1RYJA 3HK0A 2ZPNA 2N9LA 2N7JA 1J19A 5HFYA 1CQVA 2BS2B 2J52A 2BPSA 2KDEB 2FNJB 1ACCA 4LNOA 3RD2A 2FCSA 3FKYA 3VTVA 2IGHA 1C76A 2KWVB 1QF6A 3NY5A 4KV2A 1M94A 2X8XX 3RULA 4W9EA 1SXTA 4K3BA 1H7WA 2H89B 1RRBA 2OHFA 4HK2A 1NI3A 4ZRJA 1FM0D 2KX0A 1XLQA 3APFA 3QCAA 2K22A 4ANWA 3R2TA 4MGZE 2BTEA 4XWTA 1T0SC 2EKIA 4DDGD 1QZEA 2YLMA 2Y5BB 2WGSA 3RNEC 2VZKB 3KWLA 3WAPA 5IA7A 4KGSA 2KNBA 4C4VA 4I6LB 3MC9A 3C8YA 2JQRB 2N9KA 4RF0A 3RPFC 2INNE 4I6PA 1G6JA 2L76A 4F8CB 2DYBA 5E6NA 3Q8AA 2M0XA 1STEA 1UWXA 4WWNA 4BKTA 4A55A 2W55A 4B6WA 1M4VA 4FJYA 3ZQ4A 1QKZA 3BYTB 3L13A 1MG8A 2TSSA 3IBEA 1YD8U 5C23A 3RI7C 3DBRB 1TBEA 3PV1A 2CU3A 4GXBA 3TSSA 1H4RA 3VUXA 3AEDB 1A70A 3AE7B 1EM7A 1VR9A 3WAOA 5E6PA 2DAFA 3Q69A 1ZKHA 2MSED 1L6VA 3NOBA 2LD9A 1OQQA 3NZ3A 1WMHB 2N9XA 1V2YA 4XDDA 2D3AA 4JL9A 2CHXA 3VHTC 5IKCM 1KLUD 2GI9A 3PHWB 3EHVA 1RM6C 3A9KA 4OZCA 3HRDD 4NAMA 2C5LC 3RNBC 2BYVE 3ZDMC 2KDMA 3T8MA 2G4SA 4KVGB 4TQ1A 5BYQA 3N32A 5CHWA 1EU4A 3AE5B 4W9JA 4FULA 2N7EA 1UNSA 2MW5A 1K51A 2IYDB 4F1SA 3VTUA 1EWCA 2SEBD 4WH4A 3V60A 1LXDA 1WXQA 2MP2B 2INCC 1MG4A 1FNWA 2KT7A 1C3TA 3WCQA 2CU1A 1BMLC 5J17A 3PRZA 3IG3A 2B76B 2HE7A 5H8YE 2KX3A 1N6ZA 5EDSA 4N58A 5AZHA 3ZJUA 3DHGC 3M95A 1Y56A 1PUTA 1IP9A 1WXMA 5D2MB 1AWDA 2IZVB 2N9EB 3W5UB 3M63B 2KVRA 1L4ZB 1RWSA 3MJWA 4ZRKA 1CZPA 3DWMA 3OLMD 1N62A 1IBXA 4DHJB 4W9DA 1C79A 1I7HA 4M8MA 3SEBA 1IGCA 1LQBA 2IO2B 4OVVA 2LGSA 2ZNVB 4YSZB 2PPHA 3I57A 3ZDTA 5JXVA 2WXIA 2JX5A 3ZNID 2EMSA 2DYOA 3VUWA 2ON8A 1AW7A 2O6VB 2R61A 2MRPA 4US9A 2MH7A 4ZRPA 1NDDA 2L8JA 1ROEA 4ICVA 2NCNA 1YIWA 1HE8A 3APDA 2KZRA 1HTQA 1V97A 4JE3B 4WJQA 3KUCB 4L1BA 3B08A 2L52A 3PRMB 5D6JB 4HEA1 2LGYA 1TZOA 2KMMA 4P6VF 5D3DA 1I35A 2KKCA 1WXVA 1TS4A 2QJLA 4EFOA 1V1OA 1YMHE 3VXWA 4JWSC 1Q10A 4FADA 1YX6B 2M4NA 3W9CB 2AWTA 2DYMA 3DQVA 2G9HD 2KO3A 3URYA 3EFCA 3RZWC 3B9JA 1L0XB 3DBHI 1J7CA 2K25A 2XNAC 1SGHA 4Q2JA 4PS3A 2K39A 1WIAA 1P3QU 2J0MA 3IAS1 3OG5A 5BYSA 1B9RA 1T0YA 3MP9A 2WXFA 3L16A 3DBSA 4W9KA 4OHJA 5C1ZA 4DXAB 3TEYA 3ZRCA 4A20A 1N60A 3K9PB 2L0FA 3MFGA 1Z2MA 2FCMA 4M02A 2W82A 5DPRA 2HTME 1GUAB 1OEYA 2R2QA 2DLBA 5HHDG 3ZTDA 1E0ZA 2AL6A 1GNUA 2G3QB 2LJ5A 1WGYA 1P0RA 3UQBA 2KACA 4MSQB 3VH3B 4KIKB 5BMGA 1J0GA 4AJYB 3GOEA 3A1QA 4MJSB 1SB3C 3JSVA 3PS6A 3SD5A 4HXDA 3OWEB 1WM3A 4KGTA 4GDKB 1OFFA 3KQ4A 5E6OA 2IGDA 5DCNA 5KHQA 1D5MC 2UYZB 4B9KA 4ACFA 2JZ3B 4KDLB 3WALA 3BINA 2WDTB 3GZNI 4HDOA 2WNMA 1FO4A 1XLPA 2K5PA 4OW0A 3AE3B 3KWVA 4EUTA 1MHXA 1K8RB 3CIRB 2AL3A 2EELA 2W9NA 1H7XA 3DWGC 2O2VB 2LASA 1FRDA 3P4PB 3ALBA 4TKNA 1V1PA 4AJWA 1GTHA 1YJ1A 3AU5A 5H92C 3B1LX 1BXTA 2JRHA 2OJRA 3JVZX 2BB6A 1PGXA 2ASQA 4S0RA 2WP9B 2XK5A 1TS2A 3FC4A 2NR2A 2KHWB 2Z0EB 2AQ2B 3ZTCA 3AE8B 4LNNA 1P98A 1E7UA 1WRIA 2WXLA 4KZCA 1ZE3D 2JSVX 2MHJA 2KDBA 1YX5B 2DZJA 3AMZA 4FLHA 3PHXB 2YVCA 4BBNF 4ZDVA 2MJEA 3RZFA 2BKRB 1TKYA 2IJ0A 4KSLC 4EOYA 2UWQA 1T6BX 1F2RC 1WX7A 4AOFA 1WJ6A 2O6VD 2CR5A 2LWPA 4MACA 4RH6A 2K9XA 3AEGB 1T0RC 2K6DB 3ENEA 1TJEA 1WXSA 1GC7A 2W54A 1TZ1A 1AARA 1EWYC 4GIVA 3WA0A 3T3NA 1NI2A 1QOBA 2DZMA 3NS8A 4W9CA 4ANXA 1YQ3B 3N9YC 4ANUA 1PYWD 4JLCA 1IPGA 4ZRQA 3H7PA 3ML8A 1FCCC 1FFUA 3DCGA 2VRRB 1I4QA 2JVCA 2NVUI 3HVDA 2GOWA 3DHHC 2MBBB 2L00B 3TUOA 1FNUA 1BUIC 3I63C 2NBVB 3SFDB 2B3AA 2KDIA 3VDZA 1OTRB 5J18A 5AEKB 2NTSA 2J0KA 4DHZE 3U2SC 1E10A 2IY1B 2DX5B 2MBHA 3PLUA 3A4RA 1D3ZA 2JF5A 3EECA 3ZXVA 2PW9A 4C4VB 4HRSA 4RNAA 4XE0A 2KOXA 4E74A 4IUMB 1K53A 4HLEA 1WE7A 1F0ZA 4CYEA 1CK1A 1LFDA 2GLSA 1R4MB 2ZPYA 4BFRA 4BBNC 4IWQA 2BGFA 2KWCA 1XLNA 2BYEA 5BYRA 1WGKA 2QEJC 2PMVA 3GE3C 1VCBA 2UU7A 2V4IB 3HUIA 1XCTL 2KC2A 1JW9D 2KQ4X 1L6UA 2K8BA 4OZAA 1CJEA 2V4LA 2K1FA 2LUEA 3AN1A 4RGMA 3R3MA 2BF8B 1V80A 2Y5PA 1GTEA 1NENB 3I5JC 2YEPB 4KKIA 4LK0M 4FBJB 2BYTA 2IO0B 2MWSB 1XD3B 2OEDA 1F2RI 2BKFA 2BW2A 1E5WA 1WJUA 4P1BC 3W1YA 2E3TA 4LNKA 1VJKA 3MC8A 3ZNGC 5IAAC 1VZ6A 1OQRA 2NPTA 4C00A 2M17A 3NRZA 4A3OA 4J3OD 4LCDE 4AS1A 2X38A 3NVZA 4OVUA 4UDUC 1ZP0B 3OJ4B 1J7AA 3E9SA 3UGBB 4RGOS 4HKZE 2Z0DB 1SE2A 3O13A 1TY0A 1WYWB 2RD0A 2Z8LA 1KRHA 1BT0A 2E6XA 3A9KB 2WHIA 2WXGA 4MH0E 4FXCA 3WAMA 2KN5A 4C80A 3DVGY 4TQ0A 4W9LA 3QX1A 4RM8A 4P1CC 3SFEB 4JPSA 1ZUD2 3VR9B 2FCNA 3CF6E 4GN1A 3Q8FA 5FKAC 1DOYA 1SSNA 3ZNHB 2I2YA 2HJ1A 2ZEQA 2LVQA 1RAXA 1YN4A 2INDC 5HG2A 2FAZA 2Y3AA 3IT4B 4MM3A 2CHZA 2GBKA 2I1KA 2KAJA 1SIFA 1OGWA 4K1RB 4HPLB 3AM9A 2M8SA 3X23A 2KJHB 1VD2A 3SR6A 4NAWA 1NVID 3MHSD 2OOBB 4ARCA 1FXAA 5EE1A 2D10A 3BVZA 3UINB 4G3XB 5D94A 2FIDA 3AU4A 5DPSA 1SE4A 1PFDA 2J42A 1WJ4A 4GGQA 5JHBA 2NTTA 1WGRA 1FFVA 4RMAA 3BIID 5HKHA 2J53A 3R8BA 2CJOA 3L4PA 1IBXB 3QJZA 4M0WA 3VUYA 1SIJA 2K3UA 4XZ4A 2KQSA 5L83A 2D3BA 2ZVNA 4DBGA 3C0RB 2HDEA 3BY4B 3GB1A 5LLIA 1YJJA 1WR1A 4NJ6A 2JRIB 2J7QB 1TIFA 2QILA 3VRAB 4WAAA 2KK8A 4GU2A 3VR8B 3DBRI 5AZGA 2RDGA 4JQWC 4YTPB 2KYWA 4EZJA 3ZIMA 2WXPA 2WX1A 4NJ7A 3OJ3A 3AE6B 1N5WA 3AEEB 2L3ZA 4YXDB 4CO7A 1VRAB 1T5XD 3U52E 2MJDA 2DENB 4G11A 2FUHB 2FCQA 3AE9B 4GDLA 1KM7A 3DVGX 2KWUB 2BBCA 2J4XA 1ZDVA 1OQYA 4G50A 4MDKE 3W2DA 4WIPA 3U7ZA 2ZNVC 3KUZA 1E90A 3RCZA 4ICUA 2WU5B 3BVMA 4H2AA 1EUVB 1E8XA 2KTRA 3EFUA 1AYFA 3B0AA 4IOIE 5TR5A 2RPQA 3AH7A 4HROA 1MJDA 4EZKA 4J6IA 1VZ7A 3MTNB 4ANVA 2W3RA 1NYQA 4ZHOA 2N7DA 3RUIB 2JU6X 2D11A 2PIAA 3A9JA 2N1WA 1V49A 1V9JA 1P1AA 3Q8BA 1XQQA 3JW0X 4N9F4 1YNTE 1JRPA 2BYFA 4PT5A 2LVPA 4WQOB 1D6EC 1NYRA 3ECIA 2ZZPB 1GOZA 3H8HA 4URKA 4WAFA 3VTWA 3ZUNA 4MEMA 2RSUA 4DK5A 3IFWB 3AEFB 1TS5A 3L0WB 1WRDB 2KANA 4PYUA 4JX1C 1TYGB 3RFZB 3B2FA 2CS4A 1WH3A 2IBIB 1UF0A 3TEWA 3L10B 5D7GA 5T8IA 3LXFA 4OVZA 3DVNU 2M19A 3A1QB 2HJ8A 2HD5B 3JSVB 5J2RA 1UGMA 2ZVOA 4L2YA 4LJOB 2RGFA 3ZO5B 1WZ0A 2DZKA 3W1SC 5TSSA 2LJIA 2BWFA 4GLSC 1WJNA 4YL8A 3AE4B 2GBNA 5JH5C 1WFYA 4WJPA 3UF8A 5G5HA 3V6CB 1Y8RC 3TL5A 1HQRD 1OEYJ 1SF0A 1P7EA 2D3CA 2XEWA 2JXXA 1YOVB 4MGKE 2MP2A 2WS3B 4I6NB 1WX9A 1WY8A 1QQRA 1V1PB 4US8A 5MPOA 1L0YB 1I4XA 3NVYA 2H88B 2M0AA 2BVCA 4NZLB 1Q0WB 1ET9A 3U7DA 4ZOHC 5KHOA 1YQBA 3BYYB 5C2TB 1SBBB 1TT5B 4X57B 2ZW0A 4GSWA 2FIFA 3CF4A 1L4DB 2GRIA 1KTKA 4PS7A 3N30A 1FD6A 3CMMB 2WU2B 3N1ZC 4NQLB 1UGJA 3HM3A 4PK1A 1RLFA 3KLSX 3PREA 2LUMA 1WSPA 1PDXA 2PE9A 3EUB2 3N20C 1GG3A 4NQKE 2LVOA 4ASWC 2EMTA 1C4AA 2JWUA 1ZGUB 3CSTA 4K3CA 4KSKC 3TMPB 1WX8A 4LNFA 2N4FA 2JYTA 4HJGE 5EE3A 2L32A 5LXIB 3HVZA 4O1NA 4HJKA 2LGXA 1KJTA 4USAA 2MA9B 5EE9A 1UZXB 3O65B 5AUKA 4G0NB 4HKQA 1I4RA 1VZ8A 2GBRA 2QDFA 3H7PB 1JMLA 3DVNV 1N61A 2RMMA 2SAKA 3BK1A 3VH4B 5G5GA 3ZRFA 3M3JA 3ZJVA 1JRUA 3NVWA 3PT2B 1QOAA 1R4NB 2G4DB 2V0GA 2D07B 5D3IB 5FK9C 1EF1A 3VAWA 3FILA 4RF1A 4B0MA 2BQQA 1VDVA 4M8NA 5CX3A 4BVUC 2MCNB 4EEWA 2W3SA 3K9OB 2WXQA 1GJZA 5LXHA 4GB9A 2C7NB 2IO1B 3BZDB 3WIMA 2BS4B 2YEPF 2IGGA 4P7IA 2L83A 3U4EG 2LZ6A 5CTRC 1E7VA 4XGAB 4C7YA 3QWZB 2WX0A 4GOCA 4RGTA 4A90A 5LNK1 3RN9C 1R7SA 2WYQA 2KDFB 2KFKA 4A3PA 2K8HA 2M1MA 3AB5A 1C4CA 1NBFC 3IT6B 4EE2A 1F9JA 2CKHB 3QAQA 1LGRA 2NBUA 4ZHPA 3BVGA 3P4SB 5GXGB 3DPDA 2L0TA 1GB4A 3EC8A 4A9AA 3Q14C 3NS1A 4KKJA 1R4NI 3MJ5A 2ACZB 2WQYB 1TKEA 2PJHA 2JY6A 3L08A 1MVKA 3C19A 4KGRA 3AECB 3T9LA 2FE8A 3OAWA 1CMXB 1UBQA 4OZBA 3AULA 3H7SA 1DGJA 3R7QA 2ICIA 3KW5B 2ZJDA 5IOIA 2PVGC 2M56B 3LB8C 4DWFA 1XO3A 4HPPA 2N9PC 2BS3B 1WE6A 2LI5A 1FPYA 1I4PA 3QC8B 4LNIA 3ZXRA 3CSFA 2R2OA 4XX5A 3LJ3A 1FEHA 2L05A 4BKGA 3D32A 2Y5CA 1ET6A 1V5OA 2REXA 1HTOA 3PO0A 5I4DA 3Q3OC 2KLGA 4MM3B 3R2IA 3UIOB 3LDZE 2PE6B 3PZDA 3Q6BA 3A4SC 4M00A 2JXTA 4WWPA 4II2B 4M01A 2V3SA 4WWMA 2I1JA 3P2BA 3PRPB 4A8XC 4BKSA 2WXJA 2JZPA 5BMHA 1WGGA 1YN3A 4MELA 3TIXA 2V3NA 2LRUA 2IY0B 1IGDA 3VRBB 2KMAA 4B0EA 4E71A 2RPVA 1FCLA 3QIJA 3Q2AC 1S3SG 1I42A 3V61A 3Q3MC 2RR9A 1VLBA 2GBMA 2K0PA 5G2NA 3KUDB 2EKEC 1MI0A 3TEXA 3AV8A 2KTFA 3ZVVA 2AYOB 1SEBD 4MGYE 2J0JA 1L7YA 1T3QA 1YN5A 4M0WB 3R7RA 3UI3A 1R4MI 3AEBB 3V6EB 1EO6A 3BK2A 1ZOYB 1TY2A 3SU8X 3ETRA 4TUUA 1E8ZA 1YQ4B 4JIOU 1KH0A 2MX2A 1FXIA 1JWMD 2JWZA 4HVBA 1JQ4A 3AE1B 1ZDXA 4JGHB 4IWOA 3L54A 5IO9A 3IVFA 1V86A 3UIPB 2LGIA 3APCA 2ZW1A 1KFYB 2WXMA 3N3KB 3FAHA 1XCQL 4GDLB 5L95C 1I4GA 2NBWB 3Q3JA 3KVFB 1DYQA 3Q8CA 1TGZB 1MHHE 4F7ZA 2QSDA 5C3JB 2D3GA 3TJPA 5IN7A 1XF5L 2JUOA 3U30A 4C56C 1C77A 1P9DU 2PKOA 4KZ0A 1MPEA 1WI0A 4PS8A 2CJNA 4P16A 3PTFC 4BKSD 1ZW7A 2KTRB 3P4RB 2KWDA 2CHWA 4REZA 2GBJA 1PQSA 3B2GA 4FJZA 4AP4C 1A5RA 2DNFA 3QQ8B 4HCNB 1E9MA 3EA6A 3A9JB 1WWTA 1K52A 2RDHA 4NNJB 1DOXA 1LO5D 3RYTA 2LHDA 3ZLZA 4ZRIA 2C9WB 5FR3A 2WLBA 3AE2B 1F52A 2V9HA 4DQOC 3GE8C 2LHEA 4IM3A 1E6EB 2A4ZA 2XN9C 4W9IA 1N63A 2DHZA 4CQNA 1TTNA 1QILA 1GPXA 5BO4B 4AQ7A 4QAYA 1XLOA 1C4PA 3H9DA 1D5ZC 4WJNA 1DOIA 2PTLA 1K50A 4KDIC 2BB5A 2XBBC 3CWIA 2IPKD 2MBQA 5EE0A 4IWPA 1UBIA 2N0SB 4FN2A 1JWAD 1WR6E 2MJ3A 1QT9A 4HDQA 4JWUC 2LMCA 1SJHD 2QHOA 3RNAC 4W9FA 5CHFA 3M62B 1KLVA 3NVVA 3T3OA 4YSXB 3KH0A 3H1UA 2LFIA 4MSMB 4K7SA 2L1AA 3TCAA 1QLBB 3V62A 1X1MA 1WGDA 2G45B 2QIEB 4WWOA 3I9V1 1WMHA 2GB1A 1E8WA 2LXAA 4IW0A 1J7BA 4BAXA 2JYEA 1QOGA 1L5PA 1FNVA 2HTHA 4IC7B 4K7UA 2RDBC 5IP4D 1FMAD 4A6QA 2WDVB 2WXRA 4YTNB 4B95A 2FBWB 1F77A 4HPMB 1JCKB 3A33B 3GS2A 3PLVA 4AWJA 3P63A 4TV3A 2LGDA 2ZCCA 3I3TB 3NJTA 2AQ3B 4DXGA 3DBHB 3IAM1 1HZ6A 4II3B 4XC2A 4IG7B 4K7WA 4RFBA 2ZCBA 2VZKD 4BZAA 1RFAA 2Z59B 3IHPC 1H8CA 4TSSA 1E7PB 3PGEA 2JPHA 2INPE 4YT0B 2ONQA 4XWWA 2KD0A 1ESFA 4DHZB 3Q8EA 2V1YA 2C7HA 2WXKA 2KJ6A 3PPAA 3LYYA 3U8ZA 3L17A 1LM8B 4CHKA 1B1ZA 3FILB 1SE3A 3MC0B 5AUIA 4LDTB 1NEKB 2BWES 2KN4A 2WWZA 4LLGM 4EZLA 2XK5B 1UD7A 5JHAA 3NHEB 4IKGA 2MBOA 1UH6A 1C78A 4C7ZA 3EGRA 4W9GA 1Q1OA 4YTMB 2FUG1 3ZW3A 1GC6A 2MBEA 4ARIA 3GZNB 3J9CA 1SE9A 5GMVA 3TBLD 2PLPA 2K8CA 2I38A 1JWSD 2KFKB 3AEAB 1V81A 4ITKA 5JZEB 2WDQB 3ONSA 3VVWB 2IO3B 1V6EA 3H6NA 3W5VB 1QOFA 3KYCD 3V05A 3NZUA 4NY0A 3ZYYX 2QCZA 1GB1A 3SHQA 3JYUA 3NUHB 4MGIE 3WANA 1J8CA 2MQJA 3R66C 4RCOA 2DAJA 3PZ8A 2O6VA 3RT3B 2JZZA 1YJIA 2OJWA 1WYGA 1XXGA 1EF5A 1PGBA 4ZYNA 2KQ7A 3HIZA 1TKGA 1XEEA 4N6EB 1JROA 4ZYSA 3NZSA 1WM2A 4XDCA 3ZJTA 2WXHA 3PSEB 2G1EA 4XYCA 3PVLA 1WZ3A 1IYFA
chains in the Genus database with same CATH topology
2Y5CA 1ET6A 2IDYA 1SJED 2AX5A 4RGNA 2PVOD 4YSZB 3I57A 3TEZA 3PO0A 5JXVA 5I4DA 1SE4A 1ENFA 1PFDA 1V8CA 2D5GA 2J42A 2WXIA 4N59A 2JX5A 2NTTA 4MM3B 3VQIA 3R2IA 1I4HA 2DYOA 1FFVA 2ON8A 1AW7A 2R61A 4TMAB 2JXTA 1JWBD 3BIID 4US9A 2MH7A 1HXYD 2J53A 4ZRPA 2CJOA 3L4PA 3R8BA 1IBXB 3IXSA 3E56A 4WWMA 1ROEA 5E6JA 2WDRB 4A8XC 1L0VB 2WXJA 2JZPA 4M0WA 4NJCA 1YN3A 5BMHA 1SIJA 2K3UA 1V97A 2V3NA 1ZPSA 4JE3B 1IGDA 3VRBB 4LTUA 4B0EA 2HDEA 3GB1A 2RPVA 1FCLA 1YJJA 3MHZA 4L1BA 1GT8A 2DWQA 2QMTA 2L52A 2QILA 3VRAB 1JWUD 2BT6A 2MEKA 4HEA1 4D2KA 1TZOA 2KMMA 4P6VF 5D3DA 3VR8B 1TS4A 1VLBA 1FIQA 2K0PA 2QJLA 1V1OA 1YMHE 2RDGA 4YTPB 1KF6B 4JWSC 3V3XA 1Q10A 2WXPA 3W1SA 3W9CB 2LEKA 1MI0A 2DYMA 3TEXA 3ZGZA 3AV8A 3AE6B 1N5WA 1SEBD 3AEEB 2G9HD 4YXDB 1T3QA 1YN5A 3P1MA 1VRAB 3URYA 1T5XD 3U52E 2MJDA 4L23A 3AEBB 3UI3A 3BK2A 5HI1A 1ZOYB 3B9JA 3AE9B 1L0XB 1P7FA 1ZXHA 1TY2A 1J7CA 2XNAC 1EU3A 4Q2JA 4YSYB 1GAQB 3ETRA 1YQ4B 4IDIA 1JALA 1KH0A 2BBCA 2J4XA 3IAS1 3P42A 3P4QB 1FXIA 1JWMD 1ZDVA 1JQ4A 5BYSA 1B9RA 3MP9A 3W2DA 1D4BA 2WXFA 3AE1B 4WIPA 3U7ZA 1ZDXA 4OHJA 2WXNA 3TEYA 2LGIA 2WXOA 2WU5B 1N60A 3BVMA 2ZW1A 1KFYB 2V3PA 4H2AA 1FRRA 2WXMA 3MFGA 3FAHA 2W82A 5BMIA 1AYFA 2HTME 3BWUD 4IOIE 1XCQL 1N5XA 4GDLB 3AH7A 4HROA 2DLBA 4MH8A 1I4GA 5HHDG 1DYQA 3Q8CA 1E0ZA 1VZ7A 1MHHE 2QSDA 1NYQA 5C3JB 2W3RA 4ZHOA 2NMQA 2KACA 2AQ1B 1XF5L 2JU6X 2PIAA 1ZXIA 1D5XC 3Q8BA 4C56C 1C77A 5BMGA 2PKOA 1MPEA 1YNTE 1JRPA 1HZ5A 1SB3C 1UUPA 4PT5A 1HA5A 3OWEB 1D6EC 4KGTA 4WQMA 1NYRA 4GDKB 1KLGD 1C9FA 1OFFA 1UWMA 2CJNA 3KQ4A 4P16A 2IGDA 1D5MC 1GOZA 3H8HA 4WAFA 3GP7A 3AEFB 4MT5A 3P4RB 2KWDA 1TS5A 4REZA 2WNMA 1FO4A 1XLPA 2K5PA 4OW0A 3B2GA 3AE3B 4JX1C 3KWVA 1TYGB 3RFZB 3B2FA 1MHXA 3PZ7A 3ABVB 3CIRB 4NAWB 3TEWA 2EELA 1H7XA 1E9MA 3DWGC 3EA6A 1WWTA 1AN8A 4DXFA 5D7GA 2Q5WD 5T8IA 1FRDA 3LXFA 4OVZA 3P4PB 4YWGG 2M19A 1K52A 4R3DA 2RDHA 1TS3A 4WURA 1V1PA 1LO5D 1DOXA 1GTHA 5H92C 1IUEA 1BXTA 4KX6B 2LHDA 1HEZE 4L2YA 2BB6A 5FR3A 1PGXA 2WP9B 1RFKA 1TS2A 2WLBA 5TSSA 2LJIA 3FC4A 4GLSC 3AE2B 2DBYA 3AE4B 1PGAA 1RYJA 2AQ2B 3AE8B 5G5HA 4DQOC 2N9LA 2N7JA 1HQRD 1SF0A 2LHEA 5HFYA 1E6EB 1WRIA 2XN9C 2WXLA 1P7EA 1N63A 1CQVA 2BS2B 2J52A 1ZE3D 2JSVX 4CQNA 1GPXA 2WS3B 1QILA 1ACCA 4AQ7A 1QQRA 3AMZA 1XLOA 1C4PA 1V1PB 2IGHA 4US8A 1D5ZC 1C76A 5MPOA 2MJEA 1L0YB 1QF6A 1DOIA 1I4XA 2PTLA 3NVYA 1K50A 1TKYA 2IJ0A 2BB5A 1SXTA 2H88B 2M0AA 1H7WA 1T6BX 2H89B 2OHFA 1F2RC 4NZLB 3CWIA 2IPKD 1NI3A 1FM0D 5EE0A 1XLQA 1ET9A 4ZOHC 2N0SB 4MACA 1JWAD 2K22A 4RH6A 2K9XA 3AEGB 3R2TA 3BYYB 5C2TB 1SBBB 2MJ3A 2BTEA 1QT9A 2ZW0A 4JWUC 2LMCA 1SJHD 4XWTA 2EKIA 1TJEA 3CF4A 2W54A 1L4DB 2GRIA 1KTKA 1EWYC 2VZKB 3KWLA 1FD6A 3NVVA 4KGSA 2WU2B 3T3OA 1UGJA 3T3NA 3C8YA 1QOBA 4YSXB 2JQRB 2N9KA 4RF0A 3KLSX 1YQ3B 2LFIA 3N9YC 3RPFC 2INNE 2LUMA 1WSPA 2L1AA 1PYWD 1PDXA 4ZRQA 1FCCC 3EUB2 1FFUA 1QLBB 1I4QA 2QIEB 3HVDA 3Q8AA 1STEA 1UWXA 1C4AA 3I9V1 4A55A 3TUOA 1FNUA 2GB1A 2JWUA 1BUIC 2W55A 1M4VA 1J7BA 3SFDB 3ZQ4A 2JYEA 1QOGA 1L5PA 5EE3A 1QKZA 2JYTA 3BYTB 4HJGE 2L32A 2NTSA 3HVZA 1FNVA 2TSSA 3U2SC 1E10A 1FMAD 4A6QA 4O1NA 2WDVB 2WXRA 2CU3A 4YTNB 2FBWB 1F77A 4USAA 3TSSA 1JCKB 2PW9A 5EE9A 3AEDB 1A70A 3AE7B 3GS2A 4HRSA 5AUKA 1EM7A 1VR9A 4RNAA 3P63A 4XE0A 1K53A 4HKQA 1I4RA 1VZ8A 3Q69A 1JMLA 1F0ZA 1N61A 2RMMA 1CK1A 2SAKA 3BK1A 5G5GA 1L6VA 2AQ3B 4DXGA 3IAM1 1OQQA 1QOAA 3NVWA 1HZ6A 1XLNA 3NZ3A 5BYRA 2V0GA 3ZJVA 1WGKA 2QEJC 2PMVA 5D3IB 5FK9C 4RFBA 2V4IB 3HUIA 1XCTL 4XDDA 1JW9D 3FILA 2KQ4X 4RF1A 1L6UA 2VZKD 4OZAA 1VDVA 4B0MA 1CJEA 2W3SA 2WXQA 4TSSA 1E7PB 1KLUD 2INPE 4YT0B 3BZDB 3AN1A 2ONQA 2GI9A 4RGMA 4XWWA 2BS4B 2YEPF 2IGGA 3U4EG 2L83A 2Y5PA 1GTEA 1NENB 1RM6C 2YEPB 4KKIA 4LK0M 2BYTA 4C7YA 1ESFA 2OEDA 4OZCA 1F2RI 3Q8EA 3HRDD 2BW2A 4NAMA 4RGTA 4A90A 5LNK1 1R7SA 2KDMA 2E3TA 2WXKA 1VJKA 1VZ6A 1OQRA 4TQ1A 5BYQA 3LYYA 3NRZA 1B1ZA 3AB5A 3FILB 1SE3A 3MC0B 4J3OD 5AUIA 2X38A 1EU4A 3NVZA 1C4CA 1ZP0B 3AE5B 4UDUC 4AS1A 3IT6B 1NEKB 4EE2A 2KN4A 4LLGM 1J7AA 3E9SA 4RGOS 4ZHPA 4HKZE 4IKGA 1SE2A 3BVGA 1UNSA 3O13A 1K51A 3P4SB 1TY0A 1C78A 2Z8LA 1KRHA 4C7ZA 3EGRA 5GXGB 1GB4A 1EWCA 2SEBD 4YTMB 2FUG1 4A9AA 2E6XA 3NS1A 4KKJA 4WH4A 2WXGA 3MJ5A 2ACZB 1WXQA 4FXCA 4ARIA 2WQYB 3J9CA 1TKEA 4C80A 4TQ0A 2PLPA 2I38A 1FNWA 1JWSD 1MVKA 3AEAB 3AECB 3SFEB 4KGRA 4JPSA 1ZUD2 3VR9B 3WCQA 2FE8A 4ITKA 5FKAC 1BMLC 3Q8FA 1DOYA 1SSNA 4OZBA 2B76B 5H8YE 2I2YA 1DGJA 2WDQB 4N58A 3ZJUA 1YN4A 2ICIA 3W5VB 1Y56A 1QOFA 1PUTA 3V05A 1AWDA 5HG2A 2PVGC 2M56B 2Y3AA 3IT4B 3W5UB 3ZYYX 3LB8C 1GB1A 1XO3A 3NUHB 1L4ZB 1RWSA 2BS3B 2KAJA 4RCOA 3PZ8A 1YJIA 3AM9A 1WYGA 1XXGA 3SR6A 1CZPA 3DWMA 1N62A 1PGBA 1NVID 1IBXA 1I4PA 1TKGA 4ARCA 1XEEA 4N6EB 1JROA 4ZYSA 1FXAA 1C79A 1I7HA 5EE1A 4XDCA 3ZJTA 3SEBA 2WXHA 1FEHA 1IGCA 3BVZA 2G1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7P B;  3FAH A;  2Y5C A;  4YT0 B;  1AYF A;  2AX5 A;  2H88 B;  2HTM E;  3AN1 A;  1H7W A;  2PVO D;  4YSZ B;  1N5X A;  2BS4 B;  2H89 B;  2OHF A;  3AH7 A;  3CWI A;  3PO0 A;  4HRO A;  2L83 A;  1NI3 A;  1FM0 D;  1GTE A;  1PFD A;  1NEN B;  1V8C A;  1RM6 C;  1XLQ A;  2JX5 A;  4N59 A;  4ZOH C;  5EE0 A;  1E0Z A;  4C7Y A;  2N0S B;  1NYQ A;  5C3J B;  1JWA D;  2K22 A;  2K9X A;  2W3R A;  3AEG B;  3HRD D;  4ZHO A;  1R7S A;  5C2T B;  1FFV A;  2MJ3 A;  2E3T A;  1QT9 A;  2PIA A;  1VJK A;  1ZXI A;  4JWU C;  1JWB D;  3BII D;  2PKO A;  4US9 A;  1OQR A;  2EKI A;  1TJE A;  2MH7 A;  1JRP A;  3CF4 A;  2W54 A;  2CJO A;  3L4P A;  1SB3 C;  4WWM A;  3NRZ A;  1ROE A;  2WDR B;  3AB5 A;  1EWY C;  3KWL A;  4WQM A;  1NYR A;  5AUI A;  3NVZ A;  1OFF A;  1L0V B;  1ZP0 B;  3AE5 B;  1UWM A;  2CJN A;  1NEK B;  3NVV A;  1SIJ A;  2WU2 B;  1J7A A;  1V97 A;  4ZHP A;  1QOB A;  4YSX B;  2JQR B;  3VRB B;  4LTU A;  1YQ3 B;  3AEF B;  3RPF C;  3P4S B;  3P4R B;  1YJJ A;  1KRH A;  1GT8 A;  1PDX A;  5GXG B;  1XLP A;  4C7Z A;  2K5P A;  2DWQ A;  1FO4 A;  3B2G A;  3AE3 B;  2L52 A;  1FFU A;  3EUB 2;  4JX1 C;  1TYG B;  3VRA B;  1QLB B;  4YTM B;  4A9A A;  3B2F A;  2BT6 A;  3NS1 A;  2QIE B;  2KMM A;  4P6V F;  2ACZ B;  3VR8 B;  1WXQ A;  3ABV B;  4FXC A;  3CIR B;  1VLB A;  2WQY B;  1FIQ A;  2QJL A;  2W55 A;  1H7X A;  1E9M A;  1TKE A;  3DWG C;  4YTP B;  4C80 A;  1J7B A;  1KF6 B;  3SFD B;  1WWT A;  4JWS C;  1QOG A;  1L5P A;  5EE3 A;  2Q5W D;  1FRD A;  3AEA B;  3AEC B;  3SFE B;  3LXF A;  3W9C B;  3P4P B;  3WCQ A;  1ZUD 2;  3VR9 B;  2LEK A;  2M19 A;  3HVZ A;  3AV8 A;  4ITK A;  3AE6 B;  1N5W A;  1DOX A;  1DOY A;  3AEE B;  1GTH A;  5H92 C;  1E10 A;  1IUE A;  2B76 B;  1FMA D;  4YXD B;  5H8Y E;  1T3Q A;  2WDV B;  1DGJ A;  2WDQ B;  4KX6 B;  4YTN B;  2CU3 A;  3P1M A;  4N58 A;  2FBW B;  4USA A;  2MJD A;  3AEB B;  5EE9 A;  3AED B;  1A70 A;  3W5V B;  1ZOY B;  3AE7 B;  3B9J A;  4HRS A;  5AUK A;  1QOF A;  2WP9 B;  1PUT A;  3AE9 B;  1RFK A;  1AWD A;  2WLB A;  3P63 A;  2PVG C;  3FC4 A;  2M56 B;  1J7C A;  3W5U B;  3ZYY X;  3AE2 B;  3LB8 C;  2DBY A;  3AE4 B;  4YSY B;  1GAQ B;  3ETR A;  1RYJ A;  1XO3 A;  1YQ4 B;  4IDI A;  1JAL A;  3AE8 B;  1N61 A;  1F0Z A;  5G5H A;  5G5G A;  3P4Q B;  1FXI A;  1RWS A;  2BS3 B;  1JQ4 A;  2KAJ A;  1L6V A;  1B9R A;  1SF0 A;  1YJI A;  1E6E B;  1WRI A;  3AM9 A;  3AE1 B;  1WYG A;  1OQQ A;  1N63 A;  1QOA A;  1XLN A;  3NVW A;  3SR6 A;  1CZP A;  3DWM A;  2BS2 B;  1N62 A;  1WGK A;  1NVI D;  1TKG A;  2WS3 B;  1GPX A;  4N6E B;  3HUI A;  1JRO A;  1FXA A;  1JW9 D;  5EE1 A;  1I7H A;  3AMZ A;  1XLO A;  1L6U A;  2WU5 B;  1VDV A;  4US8 A;  5MPO A;  1N60 A;  1CJE A;  2MJE A;  1QF6 A;  2G1E A;  1KFY B;  1DOI A;  1FRR A;  3NVY A;  2W3S A;  1TKY A; 
#chains in the Genus database with same CATH topology
 2IDY A;  1F1H A;  1SJE D;  4E3C A;  2AX5 A;  4RGN A;  2N1V A;  2PVO D;  3TEZ A;  1ENF A;  1V8C A;  2D5G A;  4N59 A;  5G55 A;  2KXJ A;  3VQI A;  5FR6 A;  1Q5W B;  1I4H A;  4TMA B;  1JWB D;  2K6Q A;  3QA8 A;  1HXY D;  3IXS A;  3E56 A;  5E6J A;  2WDR B;  5DPT A;  3KYD D;  1L0V B;  2C7M B;  4NJC A;  2A5U A;  2DZI A;  1ZPS A;  2NS5 A;  3ML9 A;  4LTU A;  3UQA A;  1L2N A;  2C60 A;  3MHZ A;  1GT8 A;  2DWQ A;  2QMT A;  1JWU D;  2BT6 A;  2MEK A;  4D2K A;  4FA6 A;  3DOW A;  4FJV B;  4EKU A;  1FIQ A;  1WXA A;  4S17 A;  1KF6 B;  3V3X A;  2VH1 A;  3DBL B;  2MLB A;  3W1S A;  2LEK A;  3ZGZ A;  4DHJ D;  1UEL A;  1E8Y A;  3P1M A;  3QHT A;  3N1Y C;  3ZNZ B;  1T0Q C;  4L23 A;  5CHV C;  2KJR A;  5HI1 A;  3X0W A;  1C1Y B;  3Q3F A;  1P7F A;  1WF9 A;  1ZXH A;  3SDL C;  4HWI B;  1EU3 A;  3AI5 A;  4YSY B;  1GAQ B;  2LXC A;  1MFW A;  4IDI A;  1JAL A;  3DHI C;  3P42 A;  3P4Q B;  4NPN A;  4KIK A;  2NPT B;  1KOT A;  1WGH A;  1D4B A;  2GMI C;  2KC1 A;  3RMK C;  1Z5S B;  4MJS A;  4BOS C;  3VFK A;  4W9H A;  2WXN A;  2LRW A;  4GDK A;  1V5T A;  4GMV A;  2WXO A;  2KFJ A;  4RM9 A;  3S2A A;  2V3P A;  1FRR A;  4WJO A;  3RNF C;  3NG0 A;  5BMI A;  3BWU D;  1N5X A;  3RNG C;  4PYZ A;  4MH8 A;  3AXC A;  3N1X C;  2NMQ A;  1S1Q B;  3DBL I;  2AQ1 B;  4BOZ B;  2JT4 B;  4FHK A;  1ZXI A;  1D5X C;  2O2V A;  3QAR A;  3HHM A;  2VH2 A;  1HZ5 A;  4LDT D;  4IM2 A;  5AZF A;  1UUP A;  3ZKJ C;  1HA5 A;  4WQM A;  1C9F A;  1KLG D;  1UWM A;  2PEA A;  4LJP B;  3QK0 A;  4K81 A;  1U4A A;  3GP7 A;  4MT5 A;  4DDI D;  3DDC B;  3RNC C;  2AEH A;  4HCP B;  2KMC A;  3PZ7 A;  3ABV B;  4NAW B;  2KVZ A;  3Q3N C;  1XT9 B;  4AUQ C;  1AN8 A;  4DXF A;  2KLC A;  2D2Q A;  2Q5W D;  3HM6 X;  4YWG G;  4R3D A;  4FHJ A;  1TS3 A;  4WUR A;  5DPW A;  1IUE A;  4IM0 A;  2QC8 A;  1FXT B;  4KX6 B;  1HEZ E;  1ISN A;  1RFK A;  2L7R A;  2DBY A;  1PGA A;  1RYJ A;  3HK0 A;  2ZPN A;  2N9L A;  2N7J A;  1J19 A;  5HFY A;  1CQV A;  2BS2 B;  2J52 A;  2BPS A;  2KDE B;  2FNJ B;  1ACC A;  4LNO A;  3RD2 A;  2FCS A;  3FKY A;  3VTV A;  2IGH A;  1C76 A;  2KWV B;  1QF6 A;  3NY5 A;  4KV2 A;  1M94 A;  2X8X X;  3RUL A;  4W9E A;  1SXT A;  4K3B A;  1H7W A;  2H89 B;  1RRB A;  2OHF A;  4HK2 A;  1NI3 A;  4ZRJ A;  1FM0 D;  2KX0 A;  1XLQ A;  3APF A;  3QCA A;  2K22 A;  4ANW A;  3R2T A;  4MGZ E;  2BTE A;  4XWT A;  1T0S C;  2EKI A;  4DDG D;  1QZE A;  2YLM A;  2Y5B B;  2WGS A;  3RNE C;  2VZK B;  3KWL A;  3WAP A;  5IA7 A;  4KGS A;  2KNB A;  4C4V A;  4I6L B;  3MC9 A;  3C8Y A;  2JQR B;  2N9K A;  4RF0 A;  3RPF C;  2INN E;  4I6P A;  1G6J A;  2L76 A;  4F8C B;  2DYB A;  5E6N A;  3Q8A A;  2M0X A;  1STE A;  1UWX A;  4WWN A;  4BKT A;  4A55 A;  2W55 A;  4B6W A;  1M4V A;  4FJY A;  3ZQ4 A;  1QKZ A;  3BYT B;  3L13 A;  1MG8 A;  2TSS A;  3IBE A;  1YD8 U;  5C23 A;  3RI7 C;  3DBR B;  1TBE A;  3PV1 A;  2CU3 A;  4GXB A;  3TSS A;  1H4R A;  3VUX A;  3AED B;  1A70 A;  3AE7 B;  1EM7 A;  1VR9 A;  3WAO A;  5E6P A;  2DAF A;  3Q69 A;  1ZKH A;  2MSE D;  1L6V A;  3NOB A;  2LD9 A;  1OQQ A;  3NZ3 A;  1WMH B;  2N9X A;  1V2Y A;  4XDD A;  2D3A A;  4JL9 A;  2CHX A;  3VHT C;  5IKC M;  1KLU D;  2GI9 A;  3PHW B;  3EHV A;  1RM6 C;  3A9K A;  4OZC A;  3HRD D;  4NAM A;  2C5L C;  3RNB C;  2BYV E;  3ZDM C;  2KDM A;  3T8M A;  2G4S A;  4KVG B;  4TQ1 A;  5BYQ A;  3N32 A;  5CHW A;  1EU4 A;  3AE5 B;  4W9J A;  4FUL A;  2N7E A;  1UNS A;  2MW5 A;  1K51 A;  2IYD B;  4F1S A;  3VTU A;  1EWC A;  2SEB D;  4WH4 A;  3V60 A;  1LXD A;  1WXQ A;  2MP2 B;  2INC C;  1MG4 A;  1FNW A;  2KT7 A;  1C3T A;  3WCQ A;  2CU1 A;  1BML C;  5J17 A;  3PRZ A;  3IG3 A;  2B76 B;  2HE7 A;  5H8Y E;  2KX3 A;  1N6Z A;  5EDS A;  4N58 A;  5AZH A;  3ZJU A;  3DHG C;  3M95 A;  1Y56 A;  1PUT A;  1IP9 A;  1WXM A;  5D2M B;  1AWD A;  2IZV B;  2N9E B;  3W5U B;  3M63 B;  2KVR A;  1L4Z B;  1RWS A;  3MJW A;  4ZRK A;  1CZP A;  3DWM A;  3OLM D;  1N62 A;  1IBX A;  4DHJ B;  4W9D A;  1C79 A;  1I7H A;  4M8M A;  3SEB A;  1IGC A;  1LQB A;  2IO2 B;  4OVV A;  2LGS A;  2ZNV B;  4YSZ B;  2PPH A;  3I57 A;  3ZDT A;  5JXV A;  2WXI A;  2JX5 A;  3ZNI D;  2EMS A;  2DYO A;  3VUW A;  2ON8 A;  1AW7 A;  2O6V B;  2R61 A;  2MRP A;  4US9 A;  2MH7 A;  4ZRP A;  1NDD A;  2L8J A;  1ROE A;  4ICV A;  2NCN A;  1YIW A;  1HE8 A;  3APD A;  2KZR A;  1HTQ A;  1V97 A;  4JE3 B;  4WJQ A;  3KUC B;  4L1B A;  3B08 A;  2L52 A;  3PRM B;  5D6J B;  4HEA 1;  2LGY A;  1TZO A;  2KMM A;  4P6V F;  5D3D A;  1I35 A;  2KKC A;  1WXV A;  1TS4 A;  2QJL A;  4EFO A;  1V1O A;  1YMH E;  3VXW A;  4JWS C;  1Q10 A;  4FAD A;  1YX6 B;  2M4N A;  3W9C B;  2AWT A;  2DYM A;  3DQV A;  2G9H D;  2KO3 A;  3URY A;  3EFC A;  3RZW C;  3B9J A;  1L0X B;  3DBH I;  1J7C A;  2K25 A;  2XNA C;  1SGH A;  4Q2J A;  4PS3 A;  2K39 A;  1WIA A;  1P3Q U;  2J0M A;  3IAS 1;  3OG5 A;  5BYS A;  1B9R A;  1T0Y A;  3MP9 A;  2WXF A;  3L16 A;  3DBS A;  4W9K A;  4OHJ A;  5C1Z A;  4DXA B;  3TEY A;  3ZRC A;  4A20 A;  1N60 A;  3K9P B;  2L0F A;  3MFG A;  1Z2M A;  2FCM A;  4M02 A;  2W82 A;  5DPR A;  2HTM E;  1GUA B;  1OEY A;  2R2Q A;  2DLB A;  5HHD G;  3ZTD A;  1E0Z A;  2AL6 A;  1GNU A;  2G3Q B;  2LJ5 A;  1WGY A;  1P0R A;  3UQB A;  2KAC A;  4MSQ B;  3VH3 B;  4KIK B;  5BMG A;  1J0G A;  4AJY B;  3GOE A;  3A1Q A;  4MJS B;  1SB3 C;  3JSV A;  3PS6 A;  3SD5 A;  4HXD A;  3OWE B;  1WM3 A;  4KGT A;  4GDK B;  1OFF A;  3KQ4 A;  5E6O A;  2IGD A;  5DCN A;  5KHQ A;  1D5M C;  2UYZ B;  4B9K A;  4ACF A;  2JZ3 B;  4KDL B;  3WAL A;  3BIN A;  2WDT B;  3GZN I;  4HDO A;  2WNM A;  1FO4 A;  1XLP A;  2K5P A;  4OW0 A;  3AE3 B;  3KWV A;  4EUT A;  1MHX A;  1K8R B;  3CIR B;  2AL3 A;  2EEL A;  2W9N A;  1H7X A;  3DWG C;  2O2V B;  2LAS A;  1FRD A;  3P4P B;  3ALB A;  4TKN A;  1V1P A;  4AJW A;  1GTH A;  1YJ1 A;  3AU5 A;  5H92 C;  3B1L X;  1BXT A;  2JRH A;  2OJR A;  3JVZ X;  2BB6 A;  1PGX A;  2ASQ A;  4S0R A;  2WP9 B;  2XK5 A;  1TS2 A;  3FC4 A;  2NR2 A;  2KHW B;  2Z0E B;  2AQ2 B;  3ZTC A;  3AE8 B;  4LNN A;  1P98 A;  1E7U A;  1WRI A;  2WXL A;  4KZC A;  1ZE3 D;  2JSV X;  2MHJ A;  2KDB A;  1YX5 B;  2DZJ A;  3AMZ A;  4FLH A;  3PHX B;  2YVC A;  4BBN F;  4ZDV A;  2MJE A;  3RZF A;  2BKR B;  1TKY A;  2IJ0 A;  4KSL C;  4EOY A;  2UWQ A;  1T6B X;  1F2R C;  1WX7 A;  4AOF A;  1WJ6 A;  2O6V D;  2CR5 A;  2LWP A;  4MAC A;  4RH6 A;  2K9X A;  3AEG B;  1T0R C;  2K6D B;  3ENE A;  1TJE A;  1WXS A;  1GC7 A;  2W54 A;  1TZ1 A;  1AAR A;  1EWY C;  4GIV A;  3WA0 A;  3T3N A;  1NI2 A;  1QOB A;  2DZM A;  3NS8 A;  4W9C A;  4ANX A;  1YQ3 B;  3N9Y C;  4ANU A;  1PYW D;  4JLC A;  1IPG A;  4ZRQ A;  3H7P A;  3ML8 A;  1FCC C;  1FFU A;  3DCG A;  2VRR B;  1I4Q A;  2JVC A;  2NVU I;  3HVD A;  2GOW A;  3DHH C;  2MBB B;  2L00 B;  3TUO A;  1FNU A;  1BUI C;  3I63 C;  2NBV B;  3SFD B;  2B3A A;  2KDI A;  3VDZ A;  1OTR B;  5J18 A;  5AEK B;  2NTS A;  2J0K A;  4DHZ E;  3U2S C;  1E10 A;  2IY1 B;  2DX5 B;  2MBH A;  3PLU A;  3A4R A;  1D3Z A;  2JF5 A;  3EEC A;  3ZXV A;  2PW9 A;  4C4V B;  4HRS A;  4RNA A;  4XE0 A;  2KOX A;  4E74 A;  4IUM B;  1K53 A;  4HLE A;  1WE7 A;  1F0Z A;  4CYE A;  1CK1 A;  1LFD A;  2GLS A;  1R4M B;  2ZPY A;  4BFR A;  4BBN C;  4IWQ A;  2BGF A;  2KWC A;  1XLN A;  2BYE A;  5BYR A;  1WGK A;  2QEJ C;  2PMV A;  3GE3 C;  1VCB A;  2UU7 A;  2V4I B;  3HUI A;  1XCT L;  2KC2 A;  1JW9 D;  2KQ4 X;  1L6U A;  2K8B A;  4OZA A;  1CJE A;  2V4L A;  2K1F A;  2LUE A;  3AN1 A;  4RGM A;  3R3M A;  2BF8 B;  1V80 A;  2Y5P A;  1GTE A;  1NEN B;  3I5J C;  2YEP B;  4KKI A;  4LK0 M;  4FBJ B;  2BYT A;  2IO0 B;  2MWS B;  1XD3 B;  2OED A;  1F2R I;  2BKF A;  2BW2 A;  1E5W A;  1WJU A;  4P1B C;  3W1Y A;  2E3T A;  4LNK A;  1VJK A;  3MC8 A;  3ZNG C;  5IAA C;  1VZ6 A;  1OQR A;  2NPT A;  4C00 A;  2M17 A;  3NRZ A;  4A3O A;  4J3O D;  4LCD E;  4AS1 A;  2X38 A;  3NVZ A;  4OVU A;  4UDU C;  1ZP0 B;  3OJ4 B;  1J7A A;  3E9S A;  3UGB B;  4RGO S;  4HKZ E;  2Z0D B;  1SE2 A;  3O13 A;  1TY0 A;  1WYW B;  2RD0 A;  2Z8L A;  1KRH A;  1BT0 A;  2E6X A;  3A9K B;  2WHI A;  2WXG A;  4MH0 E;  4FXC A;  3WAM A;  2KN5 A;  4C80 A;  3DVG Y;  4TQ0 A;  4W9L A;  3QX1 A;  4RM8 A;  4P1C C;  3SFE B;  4JPS A;  1ZUD 2;  3VR9 B;  2FCN A;  3CF6 E;  4GN1 A;  3Q8F A;  5FKA C;  1DOY A;  1SSN A;  3ZNH B;  2I2Y A;  2HJ1 A;  2ZEQ A;  2LVQ A;  1RAX A;  1YN4 A;  2IND C;  5HG2 A;  2FAZ A;  2Y3A A;  3IT4 B;  4MM3 A;  2CHZ A;  2GBK A;  2I1K A;  2KAJ A;  1SIF A;  1OGW A;  4K1R B;  4HPL B;  3AM9 A;  2M8S A;  3X23 A;  2KJH B;  1VD2 A;  3SR6 A;  4NAW A;  1NVI D;  3MHS D;  2OOB B;  4ARC A;  1FXA A;  5EE1 A;  2D10 A;  3BVZ A;  3UIN B;  4G3X B;  5D94 A;  2FID A;  3AU4 A;  5DPS A;  1SE4 A;  1PFD A;  2J42 A;  1WJ4 A;  4GGQ A;  5JHB A;  2NTT A;  1WGR A;  1FFV A;  4RMA A;  3BII D;  5HKH A;  2J53 A;  3R8B A;  2CJO A;  3L4P A;  1IBX B;  3QJZ A;  4M0W A;  3VUY A;  1SIJ A;  2K3U A;  4XZ4 A;  2KQS A;  5L83 A;  2D3B A;  2ZVN A;  4DBG A;  3C0R B;  2HDE A;  3BY4 B;  3GB1 A;  5LLI A;  1YJJ A;  1WR1 A;  4NJ6 A;  2JRI B;  2J7Q B;  1TIF A;  2QIL A;  3VRA B;  4WAA A;  2KK8 A;  4GU2 A;  3VR8 B;  3DBR I;  5AZG A;  2RDG A;  4JQW C;  4YTP B;  2KYW A;  4EZJ A;  3ZIM A;  2WXP A;  2WX1 A;  4NJ7 A;  3OJ3 A;  3AE6 B;  1N5W A;  3AEE B;  2L3Z A;  4YXD B;  4CO7 A;  1VRA B;  1T5X D;  3U52 E;  2MJD A;  2DEN B;  4G11 A;  2FUH B;  2FCQ A;  3AE9 B;  4GDL A;  1KM7 A;  3DVG X;  2KWU B;  2BBC A;  2J4X A;  1ZDV A;  1OQY A;  4G50 A;  4MDK E;  3W2D A;  4WIP A;  3U7Z A;  2ZNV C;  3KUZ A;  1E90 A;  3RCZ A;  4ICU A;  2WU5 B;  3BVM A;  4H2A A;  1EUV B;  1E8X A;  2KTR A;  3EFU A;  1AYF A;  3B0A A;  4IOI E;  5TR5 A;  2RPQ A;  3AH7 A;  4HRO A;  1MJD A;  4EZK A;  4J6I A;  1VZ7 A;  3MTN B;  4ANV A;  2W3R A;  1NYQ A;  4ZHO A;  2N7D A;  3RUI B;  2JU6 X;  2D11 A;  2PIA A;  3A9J A;  2N1W A;  1V49 A;  1V9J A;  1P1A A;  3Q8B A;  1XQQ A;  3JW0 X;  4N9F 4;  1YNT E;  1JRP A;  2BYF A;  4PT5 A;  2LVP A;  4WQO B;  1D6E C;  1NYR A;  3ECI A;  2ZZP B;  1GOZ A;  3H8H A;  4URK A;  4WAF A;  3VTW A;  3ZUN A;  4MEM A;  2RSU A;  4DK5 A;  3IFW B;  3AEF B;  1TS5 A;  3L0W B;  1WRD B;  2KAN A;  4PYU A;  4JX1 C;  1TYG B;  3RFZ B;  3B2F A;  2CS4 A;  1WH3 A;  2IBI B;  1UF0 A;  3TEW A;  3L10 B;  5D7G A;  5T8I A;  3LXF A;  4OVZ A;  3DVN U;  2M19 A;  3A1Q B;  2HJ8 A;  2HD5 B;  3JSV B;  5J2R A;  1UGM A;  2ZVO A;  4L2Y A;  4LJO B;  2RGF A;  3ZO5 B;  1WZ0 A;  2DZK A;  3W1S C;  5TSS A;  2LJI A;  2BWF A;  4GLS C;  1WJN A;  4YL8 A;  3AE4 B;  2GBN A;  5JH5 C;  1WFY A;  4WJP A;  3UF8 A;  5G5H A;  3V6C B;  1Y8R C;  3TL5 A;  1HQR D;  1OEY J;  1SF0 A;  1P7E A;  2D3C A;  2XEW A;  2JXX A;  1YOV B;  4MGK E;  2MP2 A;  2WS3 B;  4I6N B;  1WX9 A;  1WY8 A;  1QQR A;  1V1P B;  4US8 A;  5MPO A;  1L0Y B;  1I4X A;  3NVY A;  2H88 B;  2M0A A;  2BVC A;  4NZL B;  1Q0W B;  1ET9 A;  3U7D A;  4ZOH C;  5KHO A;  1YQB A;  3BYY B;  5C2T B;  1SBB B;  1TT5 B;  4X57 B;  2ZW0 A;  4GSW A;  2FIF A;  3CF4 A;  1L4D B;  2GRI A;  1KTK A;  4PS7 A;  3N30 A;  1FD6 A;  3CMM B;  2WU2 B;  3N1Z C;  4NQL B;  1UGJ A;  3HM3 A;  4PK1 A;  1RLF A;  3KLS X;  3PRE A;  2LUM A;  1WSP A;  1PDX A;  2PE9 A;  3EUB 2;  3N20 C;  1GG3 A;  4NQK E;  2LVO A;  4ASW C;  2EMT A;  1C4A A;  2JWU A;  1ZGU B;  3CST A;  4K3C A;  4KSK C;  3TMP B;  1WX8 A;  4LNF A;  2N4F A;  2JYT A;  4HJG E;  5EE3 A;  2L32 A;  5LXI B;  3HVZ A;  4O1N A;  4HJK A;  2LGX A;  1KJT A;  4USA A;  2MA9 B;  5EE9 A;  1UZX B;  3O65 B;  5AUK A;  4G0N B;  4HKQ A;  1I4R A;  1VZ8 A;  2GBR A;  2QDF A;  3H7P B;  1JML A;  3DVN V;  1N61 A;  2RMM A;  2SAK A;  3BK1 A;  3VH4 B;  5G5G A;  3ZRF A;  3M3J A;  3ZJV A;  1JRU A;  3NVW A;  3PT2 B;  1QOA A;  1R4N B;  2G4D B;  2V0G A;  2D07 B;  5D3I B;  5FK9 C;  1EF1 A;  3VAW A;  3FIL A;  4RF1 A;  4B0M A;  2BQQ A;  1VDV A;  4M8N A;  5CX3 A;  4BVU C;  2MCN B;  4EEW A;  2W3S A;  3K9O B;  2WXQ A;  1GJZ A;  5LXH A;  4GB9 A;  2C7N B;  2IO1 B;  3BZD B;  3WIM A;  2BS4 B;  2YEP F;  2IGG A;  4P7I A;  2L83 A;  3U4E G;  2LZ6 A;  5CTR C;  1E7V A;  4XGA B;  4C7Y A;  3QWZ B;  2WX0 A;  4GOC A;  4RGT A;  4A90 A;  5LNK 1;  3RN9 C;  1R7S A;  2WYQ A;  2KDF B;  2KFK A;  4A3P A;  2K8H A;  2M1M A;  3AB5 A;  1C4C A;  1NBF C;  3IT6 B;  4EE2 A;  1F9J A;  2CKH B;  3QAQ A;  1LGR A;  2NBU A;  4ZHP A;  3BVG A;  3P4S B;  5GXG B;  3DPD A;  2L0T A;  1GB4 A;  3EC8 A;  4A9A A;  3Q14 C;  3NS1 A;  4KKJ A;  1R4N I;  3MJ5 A;  2ACZ B;  2WQY B;  1TKE A;  2PJH A;  2JY6 A;  3L08 A;  1MVK A;  3C19 A;  4KGR A;  3AEC B;  3T9L A;  2FE8 A;  3OAW A;  1CMX B;  1UBQ A;  4OZB A;  3AUL A;  3H7S A;  1DGJ A;  3R7Q A;  2ICI A;  3KW5 B;  2ZJD A;  5IOI A;  2PVG C;  2M56 B;  3LB8 C;  4DWF A;  1XO3 A;  4HPP A;  2N9P C;  2BS3 B;  1WE6 A;  2LI5 A;  1FPY A;  1I4P A;  3QC8 B;  4LNI A;  3ZXR A;  3CSF A;  2R2O A;  4XX5 A;  3LJ3 A;  1FEH A;  2L05 A;  4BKG A;  3D32 A;  2Y5C A;  1ET6 A;  1V5O A;  2REX A;  1HTO A;  3PO0 A;  5I4D A;  3Q3O C;  2KLG A;  4MM3 B;  3R2I A;  3UIO B;  3LDZ E;  2PE6 B;  3PZD A;  3Q6B A;  3A4S C;  4M00 A;  2JXT A;  4WWP A;  4II2 B;  4M01 A;  2V3S A;  4WWM A;  2I1J A;  3P2B A;  3PRP B;  4A8X C;  4BKS A;  2WXJ A;  2JZP A;  5BMH A;  1WGG A;  1YN3 A;  4MEL A;  3TIX A;  2V3N A;  2LRU A;  2IY0 B;  1IGD A;  3VRB B;  2KMA A;  4B0E A;  4E71 A;  2RPV A;  1FCL A;  3QIJ A;  3Q2A C;  1S3S G;  1I42 A;  3V61 A;  3Q3M C;  2RR9 A;  1VLB A;  2GBM A;  2K0P A;  5G2N A;  3KUD B;  2EKE C;  1MI0 A;  3TEX A;  3AV8 A;  2KTF A;  3ZVV A;  2AYO B;  1SEB D;  4MGY E;  2J0J A;  1L7Y A;  1T3Q A;  1YN5 A;  4M0W B;  3R7R A;  3UI3 A;  1R4M I;  3AEB B;  3V6E B;  1EO6 A;  3BK2 A;  1ZOY B;  1TY2 A;  3SU8 X;  3ETR A;  4TUU A;  1E8Z A;  1YQ4 B;  4JIO U;  1KH0 A;  2MX2 A;  1FXI A;  1JWM D;  2JWZ A;  4HVB A;  1JQ4 A;  3AE1 B;  1ZDX A;  4JGH B;  4IWO A;  3L54 A;  5IO9 A;  3IVF A;  1V86 A;  3UIP B;  2LGI A;  3APC A;  2ZW1 A;  1KFY B;  2WXM A;  3N3K B;  3FAH A;  1XCQ L;  4GDL B;  5L95 C;  1I4G A;  2NBW B;  3Q3J A;  3KVF B;  1DYQ A;  3Q8C A;  1TGZ B;  1MHH E;  4F7Z A;  2QSD A;  5C3J B;  2D3G A;  3TJP A;  5IN7 A;  1XF5 L;  2JUO A;  3U30 A;  4C56 C;  1C77 A;  1P9D U;  2PKO A;  4KZ0 A;  1MPE A;  1WI0 A;  4PS8 A;  2CJN A;  4P16 A;  3PTF C;  4BKS D;  1ZW7 A;  2KTR B;  3P4R B;  2KWD A;  2CHW A;  4REZ A;  2GBJ A;  1PQS A;  3B2G A;  4FJZ A;  4AP4 C;  1A5R A;  2DNF A;  3QQ8 B;  4HCN B;  1E9M A;  3EA6 A;  3A9J B;  1WWT A;  1K52 A;  2RDH A;  4NNJ B;  1DOX A;  1LO5 D;  3RYT A;  2LHD A;  3ZLZ A;  4ZRI A;  2C9W B;  5FR3 A;  2WLB A;  3AE2 B;  1F52 A;  2V9H A;  4DQO C;  3GE8 C;  2LHE A;  4IM3 A;  1E6E B;  2A4Z A;  2XN9 C;  4W9I A;  1N63 A;  2DHZ A;  4CQN A;  1TTN A;  1QIL A;  1GPX A;  5BO4 B;  4AQ7 A;  4QAY A;  1XLO A;  1C4P A;  3H9D A;  1D5Z C;  4WJN A;  1DOI A;  2PTL A;  1K50 A;  4KDI C;  2BB5 A;  2XBB C;  3CWI A;  2IPK D;  2MBQ A;  5EE0 A;  4IWP A;  1UBI A;  2N0S B;  4FN2 A;  1JWA D;  1WR6 E;  2MJ3 A;  1QT9 A;  4HDQ A;  4JWU C;  2LMC A;  1SJH D;  2QHO A;  3RNA C;  4W9F A;  5CHF A;  3M62 B;  1KLV A;  3NVV A;  3T3O A;  4YSX B;  3KH0 A;  3H1U A;  2LFI A;  4MSM B;  4K7S A;  2L1A A;  3TCA A;  1QLB B;  3V62 A;  1X1M A;  1WGD A;  2G45 B;  2QIE B;  4WWO A;  3I9V 1;  1WMH A;  2GB1 A;  1E8W A;  2LXA A;  4IW0 A;  1J7B A;  4BAX A;  2JYE A;  1QOG A;  1L5P A;  1FNV A;  2HTH A;  4IC7 B;  4K7U A;  2RDB C;  5IP4 D;  1FMA D;  4A6Q A;  2WDV B;  2WXR A;  4YTN B;  4B95 A;  2FBW B;  1F77 A;  4HPM B;  1JCK B;  3A33 B;  3GS2 A;  3PLV A;  4AWJ A;  3P63 A;  4TV3 A;  2LGD A;  2ZCC A;  3I3T B;  3NJT A;  2AQ3 B;  4DXG A;  3DBH B;  3IAM 1;  1HZ6 A;  4II3 B;  4XC2 A;  4IG7 B;  4K7W A;  4RFB A;  2ZCB A;  2VZK D;  4BZA A;  1RFA A;  2Z59 B;  3IHP C;  1H8C A;  4TSS A;  1E7P B;  3PGE A;  2JPH A;  2INP E;  4YT0 B;  2ONQ A;  4XWW A;  2KD0 A;  1ESF A;  4DHZ B;  3Q8E A;  2V1Y A;  2C7H A;  2WXK A;  2KJ6 A;  3PPA A;  3LYY A;  3U8Z A;  3L17 A;  1LM8 B;  4CHK A;  1B1Z A;  3FIL B;  1SE3 A;  3MC0 B;  5AUI A;  4LDT B;  1NEK B;  2BWE S;  2KN4 A;  2WWZ A;  4LLG M;  4EZL A;  2XK5 B;  1UD7 A;  5JHA A;  3NHE B;  4IKG A;  2MBO A;  1UH6 A;  1C78 A;  4C7Z A;  3EGR A;  4W9G A;  1Q1O A;  4YTM B;  2FUG 1;  3ZW3 A;  1GC6 A;  2MBE A;  4ARI A;  3GZN B;  3J9C A;  1SE9 A;  5GMV A;  3TBL D;  2PLP A;  2K8C A;  2I38 A;  1JWS D;  2KFK B;  3AEA B;  1V81 A;  4ITK A;  5JZE B;  2WDQ B;  3ONS A;  3VVW B;  2IO3 B;  1V6E A;  3H6N A;  3W5V B;  1QOF A;  3KYC D;  3V05 A;  3NZU A;  4NY0 A;  3ZYY X;  2QCZ A;  1GB1 A;  3SHQ A;  3JYU A;  3NUH B;  4MGI E;  3WAN A;  1J8C A;  2MQJ A;  3R66 C;  4RCO A;  2DAJ A;  3PZ8 A;  2O6V A;  3RT3 B;  2JZZ A;  1YJI A;  2OJW A;  1WYG A;  1XXG A;  1EF5 A;  1PGB A;  4ZYN A;  2KQ7 A;  3HIZ A;  1TKG A;  1XEE A;  4N6E B;  1JRO A;  4ZYS A;  3NZS A;  1WM2 A;  4XDC A;  3ZJT A;  2WXH A;  3PSE B;  2G1E A;  4XYC A;  3PVL A;  1WZ3 A;  1IYF A; 
#chains in the Genus database with same CATH homology
 2Y5C A;  1ET6 A;  2IDY A;  1SJE D;  2AX5 A;  4RGN A;  2PVO D;  4YSZ B;  3I57 A;  3TEZ A;  3PO0 A;  5JXV A;  5I4D A;  1SE4 A;  1ENF A;  1PFD A;  1V8C A;  2D5G A;  2J42 A;  2WXI A;  4N59 A;  2JX5 A;  2NTT A;  4MM3 B;  3VQI A;  3R2I A;  1I4H A;  2DYO A;  1FFV A;  2ON8 A;  1AW7 A;  2R61 A;  4TMA B;  2JXT A;  1JWB D;  3BII D;  4US9 A;  2MH7 A;  1HXY D;  2J53 A;  4ZRP A;  2CJO A;  3L4P A;  3R8B A;  1IBX B;  3IXS A;  3E56 A;  4WWM A;  1ROE A;  5E6J A;  2WDR B;  4A8X C;  1L0V B;  2WXJ A;  2JZP A;  4M0W A;  4NJC A;  1YN3 A;  5BMH A;  1SIJ A;  2K3U A;  1V97 A;  2V3N A;  1ZPS A;  4JE3 B;  1IGD A;  3VRB B;  4LTU A;  4B0E A;  2HDE A;  3GB1 A;  2RPV A;  1FCL A;  1YJJ A;  3MHZ A;  4L1B A;  1GT8 A;  2DWQ A;  2QMT A;  2L52 A;  2QIL A;  3VRA B;  1JWU D;  2BT6 A;  2MEK A;  4HEA 1;  4D2K A;  1TZO A;  2KMM A;  4P6V F;  5D3D A;  3VR8 B;  1TS4 A;  1VLB A;  1FIQ A;  2K0P A;  2QJL A;  1V1O A;  1YMH E;  2RDG A;  4YTP B;  1KF6 B;  4JWS C;  3V3X A;  1Q10 A;  2WXP A;  3W1S A;  3W9C B;  2LEK A;  1MI0 A;  2DYM A;  3TEX A;  3ZGZ A;  3AV8 A;  3AE6 B;  1N5W A;  1SEB D;  3AEE B;  2G9H D;  4YXD B;  1T3Q A;  1YN5 A;  3P1M A;  1VRA B;  3URY A;  1T5X D;  3U52 E;  2MJD A;  4L23 A;  3AEB B;  3UI3 A;  3BK2 A;  5HI1 A;  1ZOY B;  3B9J A;  3AE9 B;  1L0X B;  1P7F A;  1ZXH A;  1TY2 A;  1J7C A;  2XNA C;  1EU3 A;  4Q2J A;  4YSY B;  1GAQ B;  3ETR A;  1YQ4 B;  4IDI A;  1JAL A;  1KH0 A;  2BBC A;  2J4X A;  3IAS 1;  3P42 A;  3P4Q B;  1FXI A;  1JWM D;  1ZDV A;  1JQ4 A;  5BYS A;  1B9R A;  3MP9 A;  3W2D A;  1D4B A;  2WXF A;  3AE1 B;  4WIP A;  3U7Z A;  1ZDX A;  4OHJ A;  2WXN A;  3TEY A;  2LGI A;  2WXO A;  2WU5 B;  1N60 A;  3BVM A;  2ZW1 A;  1KFY B;  2V3P A;  4H2A A;  1FRR A;  2WXM A;  3MFG A;  3FAH A;  2W82 A;  5BMI A;  1AYF A;  2HTM E;  3BWU D;  4IOI E;  1XCQ L;  1N5X A;  4GDL B;  3AH7 A;  4HRO A;  2DLB A;  4MH8 A;  1I4G A;  5HHD G;  1DYQ A;  3Q8C A;  1E0Z A;  1VZ7 A;  1MHH E;  2QSD A;  1NYQ A;  5C3J B;  2W3R A;  4ZHO A;  2NMQ A;  2KAC A;  2AQ1 B;  1XF5 L;  2JU6 X;  2PIA A;  1ZXI A;  1D5X C;  3Q8B A;  4C56 C;  1C77 A;  5BMG A;  2PKO A;  1MPE A;  1YNT E;  1JRP A;  1HZ5 A;  1SB3 C;  1UUP A;  4PT5 A;  1HA5 A;  3OWE B;  1D6E C;  4KGT A;  4WQM A;  1NYR A;  4GDK B;  1KLG D;  1C9F A;  1OFF A;  1UWM A;  2CJN A;  3KQ4 A;  4P16 A;  2IGD A;  1D5M C;  1GOZ A;  3H8H A;  4WAF A;  3GP7 A;  3AEF B;  4MT5 A;  3P4R B;  2KWD A;  1TS5 A;  4REZ A;  2WNM A;  1FO4 A;  1XLP A;  2K5P A;  4OW0 A;  3B2G A;  3AE3 B;  4JX1 C;  3KWV A;  1TYG B;  3RFZ B;  3B2F A;  1MHX A;  3PZ7 A;  3ABV B;  3CIR B;  4NAW B;  3TEW A;  2EEL A;  1H7X A;  1E9M A;  3DWG C;  3EA6 A;  1WWT A;  1AN8 A;  4DXF A;  5D7G A;  2Q5W D;  5T8I A;  1FRD A;  3LXF A;  4OVZ A;  3P4P B;  4YWG G;  2M19 A;  1K52 A;  4R3D A;  2RDH A;  1TS3 A;  4WUR A;  1V1P A;  1LO5 D;  1DOX A;  1GTH A;  5H92 C;  1IUE A;  1BXT A;  4KX6 B;  2LHD A;  1HEZ E;  4L2Y A;  2BB6 A;  5FR3 A;  1PGX A;  2WP9 B;  1RFK A;  1TS2 A;  2WLB A;  5TSS A;  2LJI A;  3FC4 A;  4GLS C;  3AE2 B;  2DBY A;  3AE4 B;  1PGA A;  1RYJ A;  2AQ2 B;  3AE8 B;  5G5H A;  4DQO C;  2N9L A;  2N7J A;  1HQR D;  1SF0 A;  2LHE A;  5HFY A;  1E6E B;  1WRI A;  2XN9 C;  2WXL A;  1P7E A;  1N63 A;  1CQV A;  2BS2 B;  2J52 A;  1ZE3 D;  2JSV X;  4CQN A;  1GPX A;  2WS3 B;  1QIL A;  1ACC A;  4AQ7 A;  1QQR A;  3AMZ A;  1XLO A;  1C4P A;  1V1P B;  2IGH A;  4US8 A;  1D5Z C;  1C76 A;  5MPO A;  2MJE A;  1L0Y B;  1QF6 A;  1DOI A;  1I4X A;  2PTL A;  3NVY A;  1K50 A;  1TKY A;  2IJ0 A;  2BB5 A;  1SXT A;  2H88 B;  2M0A A;  1H7W A;  1T6B X;  2H89 B;  2OHF A;  1F2R C;  4NZL B;  3CWI A;  2IPK D;  1NI3 A;  1FM0 D;  5EE0 A;  1XLQ A;  1ET9 A;  4ZOH C;  2N0S B;  4MAC A;  1JWA D;  2K22 A;  4RH6 A;  2K9X A;  3AEG B;  3R2T A;  3BYY B;  5C2T B;  1SBB B;  2MJ3 A;  2BTE A;  1QT9 A;  2ZW0 A;  4JWU C;  2LMC A;  1SJH D;  4XWT A;  2EKI A;  1TJE A;  3CF4 A;  2W54 A;  1L4D B;  2GRI A;  1KTK A;  1EWY C;  2VZK B;  3KWL A;  1FD6 A;  3NVV A;  4KGS A;  2WU2 B;  3T3O A;  1UGJ A;  3T3N A;  3C8Y A;  1QOB A;  4YSX B;  2JQR B;  2N9K A;  4RF0 A;  3KLS X;  1YQ3 B;  2LFI A;  3N9Y C;  3RPF C;  2INN E;  2LUM A;  1WSP A;  2L1A A;  1PYW D;  1PDX A;  4ZRQ A;  1FCC C;  3EUB 2;  1FFU A;  1QLB B;  1I4Q A;  2QIE B;  3HVD A;  3Q8A A;  1STE A;  1UWX A;  1C4A A;  3I9V 1;  4A55 A;  3TUO A;  1FNU A;  2GB1 A;  2JWU A;  1BUI C;  2W55 A;  1M4V A;  1J7B A;  3SFD B;  3ZQ4 A;  2JYE A;  1QOG A;  1L5P A;  5EE3 A;  1QKZ A;  2JYT A;  3BYT B;  4HJG E;  2L32 A;  2NTS A;  3HVZ A;  1FNV A;  2TSS A;  3U2S C;  1E10 A;  1FMA D;  4A6Q A;  4O1N A;  2WDV B;  2WXR A;  2CU3 A;  4YTN B;  2FBW B;  1F77 A;  4USA A;  3TSS A;  1JCK B;  2PW9 A;  5EE9 A;  3AED B;  1A70 A;  3AE7 B;  3GS2 A;  4HRS A;  5AUK A;  1EM7 A;  1VR9 A;  4RNA A;  3P63 A;  4XE0 A;  1K53 A;  4HKQ A;  1I4R A;  1VZ8 A;  3Q69 A;  1JML A;  1F0Z A;  1N61 A;  2RMM A;  1CK1 A;  2SAK A;  3BK1 A;  5G5G A;  1L6V A;  2AQ3 B;  4DXG A;  3IAM 1;  1OQQ A;  1QOA A;  3NVW A;  1HZ6 A;  1XLN A;  3NZ3 A;  5BYR A;  2V0G A;  3ZJV A;  1WGK A;  2QEJ C;  2PMV A;  5D3I B;  5FK9 C;  4RFB A;  2V4I B;  3HUI A;  1XCT L;  4XDD A;  1JW9 D;  3FIL A;  2KQ4 X;  4RF1 A;  1L6U A;  2VZK D;  4OZA A;  1VDV A;  4B0M A;  1CJE A;  2W3S A;  2WXQ A;  4TSS A;  1E7P B;  1KLU D;  2INP E;  4YT0 B;  3BZD B;  3AN1 A;  2ONQ A;  2GI9 A;  4RGM A;  4XWW A;  2BS4 B;  2YEP F;  2IGG A;  3U4E G;  2L83 A;  2Y5P A;  1GTE A;  1NEN B;  1RM6 C;  2YEP B;  4KKI A;  4LK0 M;  2BYT A;  4C7Y A;  1ESF A;  2OED A;  4OZC A;  1F2R I;  3Q8E A;  3HRD D;  2BW2 A;  4NAM A;  4RGT A;  4A90 A;  5LNK 1;  1R7S A;  2KDM A;  2E3T A;  2WXK A;  1VJK A;  1VZ6 A;  1OQR A;  4TQ1 A;  5BYQ A;  3LYY A;  3NRZ A;  1B1Z A;  3AB5 A;  3FIL B;  1SE3 A;  3MC0 B;  4J3O D;  5AUI A;  2X38 A;  1EU4 A;  3NVZ A;  1C4C A;  1ZP0 B;  3AE5 B;  4UDU C;  4AS1 A;  3IT6 B;  1NEK B;  4EE2 A;  2KN4 A;  4LLG M;  1J7A A;  3E9S A;  4RGO S;  4ZHP A;  4HKZ E;  4IKG A;  1SE2 A;  3BVG A;  1UNS A;  3O13 A;  1K51 A;  3P4S B;  1TY0 A;  1C78 A;  2Z8L A;  1KRH A;  4C7Z A;  3EGR A;  5GXG B;  1GB4 A;  1EWC A;  2SEB D;  4YTM B;  2FUG 1;  4A9A A;  2E6X A;  3NS1 A;  4KKJ A;  4WH4 A;  2WXG A;  3MJ5 A;  2ACZ B;  1WXQ A;  4FXC A;  4ARI A;  2WQY B;  3J9C A;  1TKE A;  4C80 A;  4TQ0 A;  2PLP A;  2I38 A;  1FNW A;  1JWS D;  1MVK A;  3AEA B;  3AEC B;  3SFE B;  4KGR A;  4JPS A;  1ZUD 2;  3VR9 B;  3WCQ A;  2FE8 A;  4ITK A;  5FKA C;  1BML C;  3Q8F A;  1DOY A;  1SSN A;  4OZB A;  2B76 B;  5H8Y E;  2I2Y A;  1DGJ A;  2WDQ B;  4N58 A;  3ZJU A;  1YN4 A;  2ICI A;  3W5V B;  1Y56 A;  1QOF A;  1PUT A;  3V05 A;  1AWD A;  5HG2 A;  2PVG C;  2M56 B;  2Y3A A;  3IT4 B;  3W5U B;  3ZYY X;  3LB8 C;  1GB1 A;  1XO3 A;  3NUH B;  1L4Z B;  1RWS A;  2BS3 B;  2KAJ A;  4RCO A;  3PZ8 A;  1YJI A;  3AM9 A;  1WYG A;  1XXG A;  3SR6 A;  1CZP A;  3DWM A;  1N62 A;  1PGB A;  1NVI D;  1IBX A;  1I4P A;  1TKG A;  4ARC A;  1XEE A;  4N6E B;  1JRO A;  4ZYS A;  1FXA A;  1C79 A;  1I7H A;  5EE1 A;  4XDC A;  3ZJT A;  3SEB A;  2WXH A;  1FEH A;  1IGC A;  3BVZ A;  2G1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...