3P4PB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with fumarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
b'AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4pB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4pB01
1RM6C 1YJJA 2WDVB 1KF6B 2WQYB 1I7HA 3VRBB 3PO0A 4WWMA 3AEFB 4N6EB 2PKOA 1YQ4B 1OFFA 3AMZA 1H7WA 4YSXB 1VLBA 2CU3A 3NVYA 1CZPA 1JALA 1NYRA 3NVWA 1OQRA 5G5HA 4A9AA 1YQ3B 2PVGC 1FMAD 1WGKA 5C3JB 3AEBB 3W5VB 1WRIA 2QJLA 4YXDB 2H89B 1KRHA 4KX6B 1VDVA 1IUEA 3LXFA 2W3RA 3HVZA 1QOBA 1VJKA 3AB5A 1V8CA 1QT9A 2KAJA 2N0SB 3B2GA 2ACZB 1NENB 2Q5WD 4HRSA 2WU5B 2LEKA 4IDIA 1FXAA 4ZHOA 1JWAD 4N58A 5H92C 3AN1A 3RPFC 2W3SA 3AE7B 1XLQA 4YTNB 5EE3A 3P4QB 1JROA 3AE1B 5EE0A 5AUKA 5AUIA 2W55A 1NYQA 2PIAA 1DOXA 1AYFA 3HUIA 1XLNA 1XO3A 3SR6A 3W5UB 2Y5CA 1RWSA 2OHFA 4ZOHC 4YT0B 1YJIA 3P1MA 5GXGB 1XLOA 1J7AA 3NVVA 4C80A 1J7BA 2DWQA 1UWMA 4YSZB 2K5PA 1NVID 1QLBB 4WQMA 3P4SB 1GTHA 4P6VF 1V97A 2WS3B 3AEDB 3AE8B 3SFDB 3KWLA 4N59A 1N5WA 3W9CB 4US8A 3AE6B 2K22A 1N61A 3WCQA 3AH7A 4USAA 1AWDA 1ZXIA 1FFVA 1QOGA 1JQ4A 1XLPA 2L83A 3AV8A 1E10A 2B76B 1ZP0B 1FFUA 2BT6A 1EWYC 4LTUA 1FIQA 4YSYB 4ITKA 4C7ZA 1RYJA 1R7SA 4JWUC 1GPXA 3P4PB 5MPOA 1PFDA 3BIID 1F0ZA 1ZUD2 1DOYA 1GTEA 3DWGC 4JX1C 1L6VA 3AM9A 3AE4B 1QOFA 1B9RA 1TJEA 1QF6A 3ZYYX 1A70A 1N63A 1SF0A 2KMMA 2EKIA 2BS2B 3AE3B 1E9MA 3AE5B 1CJEA 2M19A 1E7PB 1SB3C 2MJEA 1FRDA 1FO4A 3NRZA 3AEEB 3AE9B 3CF4A 3CIRB 1PDXA 1ZOYB 1NEKB 2MH7A 3FAHA 5EE9A 1QOAA 1TKYA 2WU2B 1RFKA 1KFYB 2WDQB 3L4PA 5G5GA 3EUB2 4JWSC 2AX5A 1L6UA 2E3TA 2QIEB 2BS3B 3VR9B 2DBYA 2HTME 5C2TB 1E6EB 2FBWB 1N5XA 2CJOA 2K9XA 3AECB 2CJNA 3AE2B 3AEGB 1N62A 4ZHPA 2MJDA 1JWBD 4HROA 1JW9D 2W54A 2M56B 2WP9B 1T3QA 3CWIA 1FRRA 1N60A 3SFEB 2WDRB 5H8YE 2H88B 3NVZA 1L5PA 2WLBA 4C7YA 1GT8A 1DOIA 1WYGA 1L0VB 2BS4B 3NS1A 3ETRA 5EE1A 3VR8B 1PUTA 3VRAB 1E0ZA 1JRPA 2MJ3A 2PVOD 1WWTA 1J7CA 3B2FA 1SIJA 4US9A 1OQQA 1WXQA 3LB8C 1FXIA 1NI3A 1FM0D 1ROEA 3P63A 1H7XA 2L52A 3DWMA 4FXCA 3P4RB 3HRDD 2JX5A 3ABVB 3B9JA 2JQRB 4YTPB 1GAQB 1TYGB 3AEAB 4YTMB 1TKEA 1DGJA 3FC4A 2G1EA 1TKGA
chains in the Genus database with same CATH superfamily
2AL6A 4LJOB 3Q3JA 3VTWA 5J17A 4BKSA 3L10B 2JWZA 2MW5A 1IP9A 4IC7B 3AULA 4AQ7A 4MSQB 1B1ZA 3TMPB 3DQVA 3DVGX 4HDOA 3ZRCA 4E71A 1KM7A 1V6EA 1TTNA 1L2NA 4NJCA 2LEKA 1FXAA 2DYMA 1UD7A 2AQ1B 2YEPF 2DZIA 2XK5B 4NAMA 3RMKC 1FCCC 2Y5CA 1I35A 3RUIB 1SIFA 3QIJA 2KNBA 3FILB 3APFA 4P6VF 2ZW0A 2WWZA 3SFDB 1F52A 2LD9A 2K22A 1TBEA 4M00A 1AWDA 3V05A 3AV8A 2WXMA 1S1QB 1I4HA 1R7SA 3M63B 1P0RA 2CS4A 3DBSA 1E8XA 4MJSA 1B9RA 2M1MA 1AW7A 4DHJB 2WX1A 2KD0A 4BBNF 3AEEB 3AE9B 3BVGA 1VCBA 3BVMA 2RDGA 1D3ZA 1N5XA 4BAXA 3H8HA 2G9HD 2JRIB 3N32A 3RCZA 2GOWA 3I57A 3Q3OC 4RM8A 4FA6A 1DOIA 4FJYA 1L0VB 1T6BX 3ZXRA 1WMHA 1WYWB 3V6EB 4KDLB 2LHEA 4LDTD 2IJ0A 1WH3A 3A9KB 1ZDXA 3AEFB 1EM7A 2ZW1A 3VUXA 1NYRA 1WR1A 2ZNVC 4D2KA 2D07B 1H4RA 4KKJA 2EKEC 2ACZB 4HPMB 1NENB 5IAAC 2Z59B 1C4CA 1XLQA 2KDMA 4WQOB 4B0MA 2W55A 4GSWA 1EUVB 2DAJA 3TJPA 1J7BA 2PPHA 3GE3C 1NVID 3MHZA 1GUAB 4WQMA 2MBOA 1UNSA 4PK1A 3GZNB 1BMLC 4TQ0A 2X38A 2NPTA 3ZNID 1YD8U 2DAFA 1UGMA 2WXIA 3VH3B 2LGIA 1WFYA 4G0NB 4IKGA 2DZJA 3CMMB 3DBLB 3RNBC 5DPWA 2E3TA 3SEBA 1I4QA 3U7DA 2O6VB 3QAQA 1MVKA 3AECB 4RM9A 3NJTA 3I5JC 4AJWA 4PS3A 1T5XD 1I4XA 1IYFA 2KFJA 4WURA 3NVZA 4BOZB 2WLBA 1JRUA 1UBIA 3ETRA 4ARCA 1WRDB 2KMCA 2MJ3A 3PLUA 3T3NA 1MPEA 1NI3A 3R7QA 2UU7A 5JZEB 4WAAA 1PQSA 3P4RB 3TEYA 4XYCA 1EO6A 3E9SA 2JQRB 3VRBB 5D3IB 1YQ4B 2N1VA 2LXCA 2IYDB 3SD5A 2MRPA 4ICUA 1KRHA 3GZNI 2D5GA 3NZSA 1VJKA 3BK2A 5TR5A 4XZ4A 3QARA 4N58A 2MCNB 1JCKB 3RPFC 2W3SA 3C19A 3N20C 1Z5SB 3QA8A 2JXXA 2J0JA 1LM8B 4MJSB 4DHJD 1UF0A 3DBLI 1QZEA 3Q3MC 3EA6A 3SU8X 2I38A 1HZ5A 3GOEA 4KGRA 2B76B 1TS4A 1E90A 1RYJA 2BYTA 1PGAA 2MSED 2K8BA 2V4LA 2J0KA 4ANUA 1WX7A 1UBQA 1ZXHA 2KXJA 1E7PB 2SEBD 4BFRA 2VH2A 1X1MA 4WIPA 4E3CA 4ZRPA 1V81A 1ZGUB 3OWEB 3CSTA 4MACA 4HEA1 3AEGB 1JWBD 3QQ8B 1T3QA 3AU4A 4C00A 1Q5WB 2YVCA 2NVUI 3TEXA 4NNJB 5FR3A 3VR8B 1NDDA 3VRAB 2AL3A 2LMCA 2GRIA 1ISNA 3LB8C 1J0GA 3DWMA 3U8ZA 2XNAC 1GAQB 3AEAB 3BYYB 1YJJA 3K9OB 3IBEA 4P16A 1C79A 1H7WA 1VLBA 3NVWA 2PW9A 3DBRB 3MC0B 5LXIB 1WJUA 1H8CA 2ZEQA 5JHBA 1XQQA 4HRSA 3A4SC 2IBIB 1WZ3A 2J53A 1KLUD 1WGYA 1TZOA 4RF1A 2PEAA 2WXRA 1HZ6A 1DYQA 2JT4B 2ASQA 4RGNA 2QMTA 1QLBB 2REXA 2WS3B 1EU3A 1E7UA 2ZCBA 1V2YA 3WCQA 2JUOA 4GLSC 2L76A 4YSYB 2K1FA 1K8RB 2O6VD 4X57B 3N9YC 1SE9A 1S3SG 4WJOA 3QHTA 1TJEA 2L7RA 2IGDA 4II2B 4FBJB 2BS2B 1WZ0A 4BKSD 2M19A 2BW2A 4JQWC 4A90A 3NRZA 3ZNZB 2WXFA 2DYBA 1ZOYB 2M17A 4JIOU 3L4PA 2KJHB 3KUDB 2JPHA 4YL8A 1NI2A 2MJDA 2I2YA 2QCZA 4A3OA 1M4VA 4K3CA 3DBRI 4OZAA 3ZDMC 3OG5A 4FJZA 2PJHA 2GBRA 4W9CA 1JRPA 3PZDA 1WE6A 4CYEA 3P63A 3U4EG 3BYTB 4KGTA 2IO0B 2ZPNA 2JX5A 4H2AA 1Q0WB 4N6EB 4HWIB 1L7YA 1TY2A 1SEBD 2KFKA 4DQOC 3TEZA 2KN5A 2K6DB 3Q2AC 4XE0A 2LGYA 2ZVNA 2A4ZA 1PGBA 5CX3A 2BB6A 4WJPA 4FHJA 3A1QA 2D3BA 2UWQA 2NBVB 1C4PA 1CQVA 5HG2A 4M0WA 3WANA 1P7FA 3RFZB 4IW0A 3LDZE 1MJDA 1OGWA 5CHVC 1BXTA 1OEYA 1JWUD 1TS5A 1QOGA 4MGKE 4JL9A 1ZP0B 3Q3FA 3CF6E 4ASWC 1M94A 4GMVA 3P4PB 1HTQA 5IKCM 3JSVB 2QILA 5G55A 1L0YB 2EKIA 3TEWA 3AE3B 3AE5B 4LNFA 4M01A 1ESFA 1FRDA 3SDLC 2L0FA 3CIRB 1HA5A 5FR6A 5G5GA 2CJOA 3QJZA 2Y5PA 4ZHPA 2KKCA 2BYEA 3CWIA 2FCQA 2E6XA 5J2RA 1E7VA 3KH0A 1ET6A 2MQJA 3Q8EA 4MM3B 3DHHC 4B0EA 1C3TA 1WWTA 1J7CA 2UYZB 3U2SC 4CHKA 4F8CB 2BBCA 3MJWA 2LHDA 1V86A 2N7DA 2ZZPB 3RYTA 3PZ7A 2FE8A 2V1YA 5IOIA 2K25A 4LJPB 1RAXA 3NG0A 1FD6A 4LNIA 3NY5A 2PVGC 1KJTA 2OJRA 3Q6BA 4W9IA 2DENB 3W5VB 2D2QA 1WJNA 1YJ1A 1UGJA 3LXFA 1VRAB 1L4ZB 2LJIA 3PHWB 2OOBB 3L0WB 1JWAD 3AE7B 2G4SA 4YTNB 2O2VB 5AZGA 4REZA 2RSUA 3FKYA 4ANXA 3U7ZA 3NVVA 1LXDA 3X0WA 4G50A 1UWMA 5CHFA 1EWCA 4S17A 4NAWA 2KACA 2RDBC 4DXAB 5E6JA 3UINB 1Y56A 1FFUA 3IT6B 3Q14C 4EKUA 3X23A 4KGSA 5HHDG 2V4IB 3ZTDA 2KC1A 3DWGC 1WJ6A 1WF9A 3KWVA 1SF0A 2HTHA 4DXFA 4HJGE 4WWPA 2ZNVB 4K3BA 1PGXA 2QIEB 4XWWA 1WGHA 1JMLA 1YOVB 1JW9D 1N60A 2HDEA 3IFWB 5HKHA 1WYGA 3I3TB 4DDID 5AZHA 5FK9C 2M4NA 4AUQC 1CMXB 3T9LA 3ZDTA 1WY8A 1WI0A 4K1RB 3A9JA 2KZRA 2WQYB 4WWMA 3A4RA 3UIOB 3ENEA 3AMZA 1OFFA 1L4DB 4KZCA 2IDYA 2LASA 3I9V1 1SJED 1WM2A 4C4VA 4JPSA 1VZ8A 3KUCB 4Q2JA 2IZVB 3BZDB 3URYA 2FUHB 3PSEB 4M0WB 2KANA 2KAJA 3AB5A 3GP7A 5BO4B 3ZO5B 2C7MB 1PYWD 3DHIC 2D3GA 4HVBA 3R2IA 4WAFA 3RULA 5LLIA 5GXGB 1SE2A 4C80A 1FPYA 1RLFA 2KWUB 1KLGD 1V5OA 1YN5A 3HM3A 4N59A 2NBUA 4IWOA 1IGDA 4DHZE 4EUTA 3BINA 3OJ3A 2N9XA 2KJRA 1IBXA 4K7UA 2RR9A 1XLPA 1WM3A 1YQBA 1E10A 4LTUA 1WR6E 3IAM1 1Y8RC 1GPXA 4DWFA 2HE7A 2BWES 3ZXVA 3JW0X 3OJ4B 5IN7A 1QF6A 2VRRB 3L54A 1WXSA 1UELA 2C60A 4KIKA 2N4FA 4A20A 3FAHA 1T0SC 3GE8C 3ZW3A 2MBBB 3E56A 3EUB2 3UF8A 3VHTC 1N62A 1SJHD 2ON8A 3HVDA 4MGIE 2KVRA 2KOXA 4MDKE 3NHEB 1L5PA 2BS4B 4PT5A 5EE1A 1BT0A 4AJYB 4ANVA 1ROEA 4FJVB 4J6IA 1H7XA 2MX2A 2D3AA 3BWUD 1WE7A 5BYRA 3V3XA 4AP4C 2G1EA 4CO7A 3EC8A 2FIFA 4PYZA 2BGFA 4JGHB 3JVZX 1CZPA 1JALA 4KKIA 1FNVA 3NZUA 2MA9B 2W9NA 4FLHA 4PS8A 1J19A 4NAWB 1MHHE 2XEWA 5HI1A 2LI5A 5EE0A 2NBWB 3P42A 2JVCA 3B1LX 1TS2A 4W9HA 4YT0B 1C77A 1WXMA 2DWQA 3KQ4A 4W9EA 5D6JB 4P1BC 1LFDA 4RFBA 4KSLC 5EDSA 3ECIA 1OQYA 2XBBC 2Z0DB 1FXTB 2IY1B 4GDKA 3S2AA 1WGRA 4ITKA 2GI9A 5D2MB 5J18A 1D5XC 2BF8B 1F9JA 1ENFA 3N1ZC 3Q8CA 1E9MA 2BWFA 2N9KA 1MFWA 2LUEA 2MJEA 3UQBA 3RNGC 3APDA 1TT5B 3ML8A 4W9DA 4MGZE 4BZAA 5HFYA 3OAWA 4ZRQA 3DOWA 1E5WA 3A9JB 2N7EA 1I4RA 2EELA 3NS1A 3V62A 5IA7A 1P7EA 3VVWB 2DX5B 2KT7A 3B2FA 1WMHB 3ALBA 4EFOA 4MH8A 4XC2A 2M0XA 2WGSA 1WGGA 3RNFC 1TKEA 3TUOA 1A5RA 5DPSA 2CU3A 5JHAA 1I4PA 3J9CA 5IP4D 2GLSA 4A9AA 1OQRA 2FCSA 3RI7C 1KTKA 4B95A 4A55A 1IUEA 2INCC 3O65B 1V8CA 2N0SB 2BYFA 2IPKD 3AI5A 4YWGG 3I63C 1IBXB 3P4QB 1R4MB 3EECA 3QX1A 1V1PA 2NTSA 3W5UB 2M0AA 1SSNA 3RD2A 1OTRB 4DK5A 1C76A 3NZ3A 1GC6A 1AARA 4KIKB 5E6PA 2LWPA 2L32A 1D5MC 2L3ZA 4TMAB 2LJ5A 1Z2MA 2KLGA 2J52A 3L13A 4I6PA 3WAOA 3LYYA 2NPTB 3BY4B 4C7ZA 4GDLA 3IG3A 3IHPC 2LVOA 2C9WB 4HCPB 1A70A 2MP2A 4FN2A 3NOBA 1SB3C 2D3CA 1STEA 3ZJTA 2MH7A 4GOCA 3RNAC 2WXNA 4G11A 3WAMA 3AU5A 3L08A 1E6EB 2BB5A 4LCDE 1ZE3D 2W54A 1SBBB 2WP9B 4HLEA 3CSFA 2WHIA 4LK0M 2H88B 3ZLZA 3N1YC 3O13A 3PRZA 4ZRJA 2BKFA 4GN1A 3PTFC 2IO3B 4FHKA 3NS8A 1FM0D 3HIZA 2L52A 3ZUNA 1R4MI 2QDFA 3DDCB 4ZDVA 1TYGB 1DGJA 4C56C 1V80A 2PKOA 4YSXB 3MJ5A 2JSVX 2C5LC 4EEWA 2DHZA 1VDVA 1HXYD 5I4DA 4A6QA 3Q8AA 1BUIC 2G45B 4IDIA 5IO9A 5H92C 1WSPA 3AN1A 4TKNA 4DXGA 3AE1B 5AUIA 4F7ZA 3T3OA 2MLBA 1RWSA 4KSKC 2KDEB 2ZCCA 3MHSD 2QEJC 2JF5A 3VH4B 4NQKE 3AEDB 4LNNA 3EHVA 5TSSA 2Z0EB 4US8A 2WXLA 2VH1A 1FFVA 3EGRA 3APCA 1JQ4A 2L83A 2BT6A 4AS1A 2MBHA 2J4XA 4K81A 3BIID 5BYQA 4EZJA 2X8XX 3D32A 3H9DA 2MEKA 3DCGA 2INNE 1FEHA 2J42A 1ZKHA 5LNK1 2KMMA 2DNFA 5JH5C 2K0PA 3BK1A 2WXOA 3CF4A 5KHOA 4JLCA 1TKYA 4WWOA 1KFYB 3VR9B 1K52A 1T0YA 2INPE 3Q8BA 3AE2B 4NJ6A 3C0RB 2WNMA 5DCNA 3UIPB 4C7YA 2PLPA 2V9HA 4WWNA 1ACCA 2KLCA 2AYOB 2PVOD 4IG7B 1WXAA 1OQQA 3HM6X 3A9KA 4ACFA 1QILA 1L0XB 1TZ1A 2KQSA 4PYUA 4P7IA 1V1OA 2IGGA 1KF6B 2JY6A 5D3DA 2BVCA 3W1YA 4OW0A 2WXHA 2JZZA 3W1SC 2MBEA 1V1PB 3ZVVA 2WXQA 1FMAD 2LGXA 2JYTA 3P2BA 2KWCA 2H89B 4KX6B 3B0AA 1FNWA 1XF5L 1P98A 3ZNHB 2V3SA 3V60A 1MI0A 4IWPA 2R2QA 4TSSA 3R66C 2RMMA 3PT2B 2KO3A 1V9JA 2KYWA 1FCLA 1XO3A 1D4BA 2WXJA 4KVGB 2K3UA 1SE3A 4GDLB 1V5TA 3PHXB 2PMVA 1YJIA 3GS2A 1XLOA 2J0MA 4OVZA 3DHGC 3T8MA 2MP2B 3AE8B 2KX0A 1F2RI 4M8NA 4OVUA 2IY0B 1ZPSA 2L1AA 1WJ4A 2GBJA 3PRPB 5KHQA 2QC8A 3VUWA 2J7QB 1F0ZA 4XX5A 1GTEA 3ZYYX 2AQ2B 2HJ1A 2BYVE 4NY0A 4JE3B 2DBYA 3LJ3A 2Y3AA 4NJ7A 3PREA 1KH0A 1EF5A 4E74A 2YLMA 2LRUA 4HROA 1C78A 1T0RC 4HPLB 1RFAA 5H8YE 2VZKB 1NBFC 3M62B 2RDHA 4US9A 1SIJA 2I1JA 3M95A 2WYQA 1E8ZA 3HRDD 3ABVB 2JXTA 4O1NA 1YX6B 1MG8A 1WX9A 1I7HA 2KTRA 1GNUA 4MH0E 4MGYE 3KUZA 4MT5A 3U30A 1D5ZC 5C3JB 4IM3A 2ONQA 2KFKB 3WIMA 2QJLA 4YXDB 4HCNB 3N30A 3KVFB 4S0RA 1I4GA 4HXDA 4WJQA 2KWDA 1QT9A 4EZLA 2WU5B 1TS3A 2R2OA 3TIXA 4ZHOA 3GB1A 2OJWA 5BYSA 3ZTCA 1P9DU 4L1BA 3HUIA 1XLNA 3SR6A 3RN9C 3A1QB 5T8IA 4R3DA 1XT9B 1LO5D 2NS5A 3B08A 4BBNC 1YIWA 1GTHA 3MP9A 5LXHA 2L05A 1TGZB 4W9JA 4MEMA 4LNOA 3RNEC 4GB9A 2AEHA 4MSMB 3DBHB 3IT4B 4XDCA 5MPOA 3TL5A 2EMSA 1L6VA 4BVUC 2IO2B 3AXCA 1GB1A 1CJEA 5G2NA 3MC8A 3HK0A 2KDBA 3H7PA 2BPSA 4A3PA 2CKHB 5BMIA 2DYOA 2N9EB 4URKA 2WU2B 2WDQB 4I6LB 4LNKA 2K9XA 2GBMA 3WA0A 2CJNA 2WX0A 2GMIC 5D7GA 4GGQA 2JYEA 4HKZE 2A5UA 2PE6B 2KQ7A 1VR9A 4ANWA 3UI3A 1P1AA 1WXVA 2FUG1 3RT3B 4DHZB 2LVPA 5E6OA 3QK0A 2PTLA 3PPAA 1IPGA 2LVQA 4RMAA 5C23A 1RM6C 2BKRB 2WDVB 2DZKA 4LLGM 2WXPA 1CK1A 2R61A 4RF0A 1VZ6A 3UQAA 3R3MA 3VQIA 2W3RA 2D11A 3B2GA 2Q5WD 4MELA 2KK8A 3L17A 3DBHI 2RPVA 4GU2A 2PIAA 1AYFA 3ZIMA 2C7HA 3H1UA 4WJNA 4ARIA 4ZOHC 4NPNA 2K5PA 2LXAA 4HDQA 5CTRC 3P4SB 5BMHA 1UUPA 2B3AA 3VAWA 3W9CB 1K50A 1Q10A 4USAA 3U52E 3VTUA 2KC2A 1OEYJ 1EWYC 1SGHA 4M02A 1VZ7A 4ZYSA 1PFDA 4M8MA 5CHWA 3DPDA 4XGAB 1QOFA 2NMQA 1C9FA 4NZLB 3RZFA 2VZKD 2DZMA 5GMVA 4IOIE 4BOSC 4HK2A 3PGEA 2BS3B 1KOTA 5DPTA 2LGDA 2MWSB 1LQBA 1FRRA 3ML9A 3SFEB 2I1KA 3W1SA 3KYDD 2KTRB 4B6WA 3Q3NC 1JWSD 1GT8A 2JZPA 2LRWA 1E0ZA 1SXTA 3DVNV 3MC9A 4OHJA 1FXIA 1GOZA 2KDIA 4HJKA 3Q69A 1XEEA 4EOYA 2L8JA 2CHWA 2FAZA 3IVFA 3PO0A 2L00B 2CHZA 4I6NB 4KDIC 5G5HA 1YQ3B 4W9LA 2K39A 4WH4A 3EFCA 2G3QB 4C4VB 4RNAA 1YN3A 3BVZA 2KWVB 4W9FA 1WIAA 3L16A 5D94A 1V49A 1HQRD 4YSZB 2K8CA 1G6JA 2FCMA 1V97A 2W82A 3R7RA 1N5WA 3TSSA 3H7PB 5BMGA 4QAYA 4K7SA 2PE9A 3JSVA 3K9PB 4DBGA 2ZPYA 5AEKB 1ZUD2 4CQNA 1J8CA 1DOYA 2KHWB 3AM9A 3AE4B 4IM0A 4RH6A 3TBLD 1N63A 1Q1OA 4PS7A 3QCAA 4JWSC 2AX5A 5C1ZA 4IUMB 1R4NB 2C7NB 1KLVA 2M56B 2D10A 2KTFA 3OLMD 4MM3A 3Q8FA 4B9KA 3A33B 1P3QU 2CR5A 1PUTA 4RGMA 1WXQA 4II3B 3PZ8A 4P1CC 1MHXA 3ZJVA 2V3NA 2Z8LA 2RD0A 3TCAA 4HPPA 2NCNA 2ZVOA 3B9JA 3QC8B 4YTMB 2KQ4X 1LGRA 3UGBB 1UWXA 3HHMA 1XCTL 1K51A 4XDDA 1WGKA 3AEBB 1WRIA 4RGTA 4RCOA 3VUYA 1YNTE 1GC7A 1TY0A 3KLSX 1JWMD 2QSDA 2KX3A 1C4AA 2O2VA 4OZCA 1YX5B 1U4AA 3VDZA 4EE2A 1GJZA 3W2DA 5AUKA 2QHOA 1XXGA 2LUMA 1WGDA 1NYQA 2N1WA 4EZKA 1YMHE 4TUUA 2LZ6A 3P1MA 2K6QA 3H7SA 2CHXA 4FULA 2LFIA 3M3JA 3ZRFA 3JYUA 2KMAA 3KWLA 3ZKJC 2L0TA 3MFGA 4L23A 1ZDVA 3PV1A 1E8WA 1N61A 3AH7A 3RZWC 2GBKA 1R4NI 4FADA 3WAPA 2XK5A 4W9GA 4RGOS 4JWUC 1SE4A 4GDKB 2JRHA 5FKAC 3PS6A 2RGFA 1F1HA 3FILA 4AOFA 4KV2A 4OZBA 2HJ8A 2K8HA 1FO4A 2N7JA 4L2YA 2KVZA 1HE8A 1NEKB 2JWUA 1QOAA 2WXGA 1UZXB 2MHJA 5L95C 1EF1A 1L6UA 2HTME 5C2TB 4G3XB 1N6ZA 2DLBA 1WX8A 1ZW7A 4XWTA 1I42A 1C1YB 2JZ3B 1VD2A 2WDRB 2HD5B 5AZFA 4KZ0A 1TIFA 2GB1A 2M8SA 5E6NA 2V3PA 3KYCD 4TV3A 4N9F4 2KDFB 2INDC 1IGCA 3KW5B 4A8XC 2IO1B 2EMTA 4FXCA 3PVLA 3H6NA 1XD3B 4OVVA 4YTPB 3VTVA 3ONSA 2NTTA 1MG4A 3EFUA 3V6CB 3VFKA 2KN4A 3NVYA 2N9LA 2TSSA 1F77A 1RRBA 1E8YA 5DPRA 1HEZE 4GIVA 1ET9A 2AWTA 3PRMB 4K7WA 3ZNGC 3HVZA 1QOBA 4LDTB 3MTNB 4ICVA 3WALA 3DVGY 3IAS1 1T0QC 2N9PC 4DDGD 1QKZA 4F1SA 3ZQ4A 5EE3A 1GG3A 1JROA 1D6EC 4UDUC 3ZGZA 1DOXA 2SAKA 2Y5BB 2OHFA 1K53A 1HTOA 1QQRA 1GB4A 2CU1A 4BKTA 1J7AA 1EU4A 5JXVA 1XCQL 2IGHA 4ZRIA 3RNCC 2ICIA 3AE6B 3R8BA 3QWZB 2FCNA 4HKQA 3C8YA 3N3KB 1ZXIA 1AN8A 2G4DB 3V61A 3DVNU 2JU6X 2NR2A 2WDTB 1FIQA 3IXSA 3SHQA 4ZYNA 2ZJDA 2YEPB 2GBNA 3N1XC 2RPQA 4JX1C 2BQQA 5L83A 1UH6A 2LGSA 4IM2A 1PDXA 2FIDA 5EE9A 2OEDA 4AWJA 1RFKA 3VXWA 3ZJUA 2FBWB 4ZRKA 4NQLB 3NUHB 2BTEA 4TQ1A 2WXKA 2KJ6A 2MBQA 3PLVA 2V0GA 4BKGA 4IWQA 2XN9C 1F2RC 1FNUA 2O6VA 4J3OD 4GXBA 2AQ3B 2FNJB 3R2TA 4W9KA 1YN4A 3FC4A 1TKGA
chains in the Genus database with same CATH topology
1RM6C 2WDVB 3TUOA 4N6EB 2CU3A 1I4PA 3J9CA 4DQOC 1TY2A 1SEBD 4LLGM 3TEZA 4A9AA 4AQ7A 1OQRA 2WXPA 1B1ZA 1KTKA 1CK1A 4XE0A 2R61A 4RF0A 4A55A 1VZ6A 1PGBA 1IUEA 3VQIA 2W3RA 1V8CA 2N0SB 3B2GA 2BB6A 4NJCA 2Q5WD 2LEKA 1FXAA 2DYMA 4YWGG 2IPKD 2AQ1B 1IBXB 3P4QB 2YEPF 2RPVA 2PIAA 1AYFA 4NAMA 1FCCC 1V1PA 2NTSA 3W5UB 2M0AA 1SSNA 2Y5CA 4ARIA 4ZOHC 1C4PA 1CQVA 3FILB 5HG2A 2K5PA 4M0WA 1C76A 3P4SB 5BMHA 4P6VF 1UUPA 2ZW0A 3NZ3A 3SFDB 1P7FA 3RFZB 3W9CB 1K50A 1Q10A 1BXTA 2K22A 2L32A 1D5MC 1JWUD 1TS5A 4USAA 4TMAB 1AWDA 1QOGA 3U52E 2J52A 3V05A 3AV8A 2WXMA 1ZP0B 1EWYC 3LYYA 4C7ZA 1I4HA 1R7SA 1VZ7A 3P4PB 4ZYSA 1PFDA 1B9RA 1QOFA 1AW7A 2NMQA 1A70A 1C9FA 4NZLB 2QILA 1L0YB 2EKIA 3TEWA 3AE3B 3AE5B 2VZKD 1ESFA 1SB3C 1FRDA 3AEEB 1STEA 3AE9B 3ZJTA 3CIRB 2MH7A 1HA5A 3BVGA 4IOIE 2WXNA 5G5GA 3BVMA 2BS3B 2RDGA 1E6EB 1N5XA 2CJOA 2BB5A 2G9HD 3H8HA 1ZE3D 2Y5PA 4ZHPA 2W54A 1SBBB 2WP9B 3CWIA 1FRRA 3SFEB 2E6XA 3W1SA 3I57A 4LK0M 1ET6A 2H88B 1JWSD 3O13A 1GT8A 1DOIA 2JZPA 1L0VB 1T6BX 3Q8EA 4MM3B 1E0ZA 4B0EA 1SXTA 1WWTA 1J7CA 4OHJA 3U2SC 1FXIA 1FM0D 2LHEA 2BBCA 1GOZA 2L52A 2LHDA 3Q69A 1XEEA 2IJ0A 3PZ7A 2FE8A 1TYGB 1DGJA 1ZDXA 4C56C 3PO0A 3AEFB 2PKOA 4YSXB 1FD6A 1EM7A 2JSVX 3MJ5A 2ZW1A 1NYRA 5G5HA 1YQ3B 2PVGC 3W5VB 4WH4A 1VDVA 4D2KA 1UGJA 3LXFA 1VRAB 1HXYD 1L4ZB 2LJIA 4KKJA 5I4DA 2ACZB 4RNAA 4A6QA 1NENB 3Q8AA 1BUIC 4IDIA 1JWAD 5H92C 1WSPA 3AN1A 1YN3A 3BVZA 3AE7B 1C4CA 4YTNB 1XLQA 4DXGA 2KDMA 3AE1B 5AUIA 4B0MA 2W55A 4REZA 3T3OA 1RWSA 3U7ZA 3NVVA 1J7BA 1HQRD 1UWMA 4YSZB 1NVID 3MHZA 4WQMA 2QEJC 1V97A 1UNSA 3AEDB 2W82A 1EWCA 5TSSA 1N5WA 1BMLC 3TSSA 4US8A 4TQ0A 2X38A 2KACA 2WXLA 5BMGA 1FFVA 3EGRA 1JQ4A 2L83A 5E6JA 1Y56A 1FFUA 2BT6A 3IT6B 4AS1A 2WXIA 2J4XA 4KGSA 2LGIA 5HHDG 5BYQA 2V4IB 3BIID 1ZUD2 4CQNA 1DOYA 3DWGC 2MEKA 3AE4B 3AM9A 2INNE 1FEHA 4RH6A 1N63A 2J42A 3KWVA 4IKGA 5LNK1 1SF0A 2KMMA 4DXFA 4HJGE 2K0PA 3BK1A 2WXOA 3CF4A 1TKYA 1KFYB 1PGXA 4JWSC 2AX5A 2E3TA 2QIEB 1I4QA 3VR9B 1K52A 3SEBA 4XWWA 2INPE 1JMLA 3AECB 1MVKA 3Q8BA 3AE2B 2WNMA 1JW9D 1T5XD 2M56B 1I4XA 1N60A 2HDEA 4WURA 3Q8FA 3NVZA 2WLBA 4C7YA 1WYGA 2PLPA 3ETRA 1PUTA 1ACCA 4ARCA 2MJ3A 2PVOD 5FK9C 3T3NA 4RGMA 1OQQA 1WXQA 3PZ8A 1MHXA 1MPEA 1NI3A 3ZJVA 2V3NA 2Z8LA 1QILA 3P4RB 3TEYA 1L0XB 3B9JA 3E9SA 2JQRB 4YTMB 1V1OA 2IGGA 2KQ4X 2WQYB 1KF6B 4WWMA 5D3DA 3VRBB 1UWXA 5D3IB 1YQ4B 1OFFA 1XCTL 1L4DB 2WXHA 3AMZA 1K51A 4OW0A 2IDYA 1V1PB 4XDDA 3I9V1 2WXQA 1FMAD 1SJED 1WGKA 2JYTA 3AEBB 1WRIA 4RGTA 4JPSA 1VZ8A 2H89B 1KRHA 4KX6B 4Q2JA 2D5GA 3BZDB 4RCOA 3URYA 1YNTE 1FNWA 1VJKA 3AB5A 1XF5L 2KAJA 3BK2A 1TY0A 3GP7A 1JWMD 2QSDA 3KLSX 1C4AA 4OZCA 1MI0A 4N58A 1JCKB 3RPFC 2W3SA 4TSSA 4EE2A 1PYWD 3W2DA 5AUKA 2RMMA 1XXGA 2LUMA 1NYQA 1FCLA 1XO3A 1YMHE 2WXJA 1D4BA 3R2IA 4WAFA 2K3UA 1SE3A 4GDLB 2PMVA 1YJIA 3P1MA 3GS2A 5GXGB 1XLOA 1SE2A 4C80A 2LFIA 4OVZA 1KLGD 1YN5A 4N59A 3AE8B 3KWLA 1IGDA 1F2RI 3MFGA 4L23A 1ZDVA 1N61A 3AH7A 1ZPSA 2L1AA 1IBXA 3EA6A 2I38A 1HZ5A 1XLPA 1E10A 4KGRA 2B76B 1TS4A 4LTUA 4RGOS 3IAM1 1RYJA 4JWUC 2BYTA 1SE4A 1GPXA 4GDKB 1PGAA 1F0ZA 5FKAC 1GTEA 3FILA 1QF6A 3ZYYX 2AQ2B 4OZBA 1ZXHA 1E7PB 2SEBD 4WIPA 2N7JA 4ZRPA 1FO4A 4L2YA 3FAHA 1NEKB 2JWUA 1QOAA 2WXGA 4JE3B 3E56A 3EUB2 1L6UA 3OWEB 2DBYA 2HTME 2Y3AA 5C2TB 4MACA 1KH0A 4HEA1 2DLBA 3AEGB 1N62A 4HROA 1JWBD 4XWTA 1C78A 1SJHD 1T3QA 2ON8A 3HVDA 2WDRB 5H8YE 2GB1A 1L5PA 2VZKB 2RDHA 2V3PA 2BS4B 4PT5A 3TEXA 5FR3A 5EE1A 3VR8B 3VRAB 2LMCA 2GRIA 1IGCA 4US9A 1SIJA 3LB8C 1ROEA 4A8XC 1H7XA 3DWMA 3BWUD 2XNAC 4FXCA 3HRDD 5BYRA 3ABVB 2JXTA 4O1NA 3V3XA 4YTPB 1GAQB 3AEAB 3BYYB 2G1EA 1YJJA 2NTTA 1I7HA 4P16A 1C79A 1H7WA 1VLBA 2KN4A 3NVYA 2N9LA 2TSSA 1CZPA 1JALA 1F77A 3NVWA 4MT5A 1HEZE 2PW9A 3MC0B 1D5ZC 1ET9A 5C3JB 2ONQA 2QJLA 4YXDB 4KKIA 1I4GA 1FNVA 3HVZA 1QOBA 2KWDA 1QT9A 4HRSA 3IAS1 2WU5B 1TS3A 4ZHOA 1QKZA 3GB1A 4NAWB 1MHHE 3ZQ4A 5EE3A 2J53A 5BYSA 5HI1A 1JROA 5EE0A 1D6EC 4UDUC 3ZGZA 4L1BA 1DOXA 1KLUD 3HUIA 1XLNA 2SAKA 1TZOA 3P42A 3SR6A 5T8IA 2OHFA 1K53A 1QQRA 1TS2A 4RF1A 1GB4A 4YT0B 1C77A 2WXRA 1J7AA 1HZ6A 1DYQA 4R3DA 1EU4A 5JXVA 2DWQA 3KQ4A 1XCQL 4RGNA 2QMTA 1QLBB 2IGHA 1LO5D 1GTHA 3MP9A 4RFBA 2WS3B 1EU3A 2ICIA 3AE6B 3R8BA 3WCQA 4HKQA 3C8YA 4GLSC 1ZXIA 1AN8A 2JU6X 1FIQA 4YSYB 3IXSA 2GI9A 4ITKA 1D5XC 3IT4B 4XDCA 5MPOA 3N9YC 2YEPB 4JX1C 1L6VA 1TJEA 1ENFA 2IGDA 3Q8CA 2BS2B 1E9MA 1GB1A 1CJEA 2M19A 2N9KA 2MJEA 2BW2A 4A90A 3NRZA 2WXFA 1PDXA 1ZOYB 5BMIA 5EE9A 2OEDA 2DYOA 2WU2B 1RFKA 2WDQB 3L4PA 3ZJUA 2K9XA 2FBWB 2CJNA 5HFYA 2MJDA 4ZRQA 2I2YA 5D7GA 3NUHB 2BTEA 2JYEA 4TQ1A 4HKZE 1M4VA 2WXKA 4OZAA 1I4RA 2EELA 3NS1A 1VR9A 2V0GA 3UI3A 1P7EA 1JRPA 2XN9C 1F2RC 1FNUA 3B2FA 2FUG1 3P63A 3U4EG 3BYTB 4KGTA 4MH8A 2PTLA 4J3OD 2AQ3B 3R2TA 2JX5A 4H2AA 1TKEA 1YN4A 3FC4A 1TKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM6 C;  1YJJ A;  2WDV B;  1KF6 B;  2WQY B;  1I7H A;  3VRB B;  3PO0 A;  4WWM A;  3AEF B;  4N6E B;  2PKO A;  1YQ4 B;  1OFF A;  3AMZ A;  1H7W A;  4YSX B;  1VLB A;  2CU3 A;  3NVY A;  1CZP A;  1JAL A;  1NYR A;  3NVW A;  1OQR A;  5G5H A;  4A9A A;  1YQ3 B;  2PVG C;  1FMA D;  1WGK A;  5C3J B;  3AEB B;  3W5V B;  1WRI A;  2QJL A;  4YXD B;  2H89 B;  1KRH A;  4KX6 B;  1VDV A;  1IUE A;  3LXF A;  2W3R A;  3HVZ A;  1QOB A;  1VJK A;  3AB5 A;  1V8C A;  1QT9 A;  2KAJ A;  2N0S B;  3B2G A;  2ACZ B;  1NEN B;  2Q5W D;  4HRS A;  2WU5 B;  2LEK A;  4IDI A;  1FXA A;  4ZHO A;  1JWA D;  4N58 A;  5H92 C;  3AN1 A;  3RPF C;  2W3S A;  3AE7 B;  1XLQ A;  4YTN B;  5EE3 A;  3P4Q B;  1JRO A;  3AE1 B;  5EE0 A;  5AUK A;  5AUI A;  2W55 A;  1NYQ A;  2PIA A;  1DOX A;  1AYF A;  3HUI A;  1XLN A;  1XO3 A;  3SR6 A;  3W5U B;  2Y5C A;  1RWS A;  2OHF A;  4ZOH C;  4YT0 B;  1YJI A;  3P1M A;  5GXG B;  1XLO A;  1J7A A;  3NVV A;  4C80 A;  1J7B A;  2DWQ A;  1UWM A;  4YSZ B;  2K5P A;  1NVI D;  1QLB B;  4WQM A;  3P4S B;  1GTH A;  4P6V F;  1V97 A;  2WS3 B;  3AED B;  3AE8 B;  3SFD B;  3KWL A;  4N59 A;  1N5W A;  3W9C B;  4US8 A;  3AE6 B;  2K22 A;  1N61 A;  3WCQ A;  3AH7 A;  4USA A;  1AWD A;  1ZXI A;  1FFV A;  1QOG A;  1JQ4 A;  1XLP A;  2L83 A;  3AV8 A;  1E10 A;  2B76 B;  1ZP0 B;  1FFU A;  2BT6 A;  1EWY C;  4LTU A;  1FIQ A;  4YSY B;  4ITK A;  4C7Z A;  1RYJ A;  1R7S A;  4JWU C;  1GPX A;  3P4P B;  5MPO A;  1PFD A;  3BII D;  1F0Z A;  1ZUD 2;  1DOY A;  1GTE A;  3DWG C;  4JX1 C;  1L6V A;  3AM9 A;  3AE4 B;  1QOF A;  1B9R A;  1TJE A;  1QF6 A;  3ZYY X;  1A70 A;  1N63 A;  1SF0 A;  2KMM A;  2EKI A;  2BS2 B;  3AE3 B;  1E9M A;  3AE5 B;  1CJE A;  2M19 A;  1E7P B;  1SB3 C;  2MJE A;  1FRD A;  1FO4 A;  3NRZ A;  3AEE B;  3AE9 B;  3CF4 A;  3CIR B;  1PDX A;  1ZOY B;  1NEK B;  2MH7 A;  3FAH A;  5EE9 A;  1QOA A;  1TKY A;  2WU2 B;  1RFK A;  1KFY B;  2WDQ B;  3L4P A;  5G5G A;  3EUB 2;  4JWS C;  2AX5 A;  1L6U A;  2E3T A;  2QIE B;  2BS3 B;  3VR9 B;  2DBY A;  2HTM E;  5C2T B;  1E6E B;  2FBW B;  1N5X A;  2CJO A;  2K9X A;  3AEC B;  2CJN A;  3AE2 B;  3AEG B;  1N62 A;  4ZHP A;  2MJD A;  1JWB D;  4HRO A;  1JW9 D;  2W54 A;  2M56 B;  2WP9 B;  1T3Q A;  3CWI A;  1FRR A;  1N60 A;  3SFE B;  2WDR B;  5H8Y E;  2H88 B;  3NVZ A;  1L5P A;  2WLB A;  4C7Y A;  1GT8 A;  1DOI A;  1WYG A;  1L0V B;  2BS4 B;  3NS1 A;  3ETR A;  5EE1 A;  3VR8 B;  1PUT A;  3VRA B;  1E0Z A;  1JRP A;  2MJ3 A;  2PVO D;  1WWT A;  1J7C A;  3B2F A;  1SIJ A;  4US9 A;  1OQQ A;  1WXQ A;  3LB8 C;  1FXI A;  1NI3 A;  1FM0 D;  1ROE A;  3P63 A;  1H7X A;  2L52 A;  3DWM A;  4FXC A;  3P4R B;  3HRD D;  2JX5 A;  3ABV B;  3B9J A;  2JQR B;  4YTP B;  1GAQ B;  1TYG B;  3AEA B;  4YTM B;  1TKE A;  1DGJ A;  3FC4 A;  2G1E A;  1TKG A; 
#chains in the Genus database with same CATH topology
 2AL6 A;  4LJO B;  3Q3J A;  3VTW A;  5J17 A;  4BKS A;  3L10 B;  2JWZ A;  2MW5 A;  1IP9 A;  4IC7 B;  3AUL A;  4AQ7 A;  4MSQ B;  1B1Z A;  3TMP B;  3DQV A;  3DVG X;  4HDO A;  3ZRC A;  4E71 A;  1KM7 A;  1V6E A;  1TTN A;  1L2N A;  4NJC A;  2LEK A;  1FXA A;  2DYM A;  1UD7 A;  2AQ1 B;  2YEP F;  2DZI A;  2XK5 B;  4NAM A;  3RMK C;  1FCC C;  2Y5C A;  1I35 A;  3RUI B;  1SIF A;  3QIJ A;  2KNB A;  3FIL B;  3APF A;  4P6V F;  2ZW0 A;  2WWZ A;  3SFD B;  1F52 A;  2LD9 A;  2K22 A;  1TBE A;  4M00 A;  1AWD A;  3V05 A;  3AV8 A;  2WXM A;  1S1Q B;  1I4H A;  1R7S A;  3M63 B;  1P0R A;  2CS4 A;  3DBS A;  1E8X A;  4MJS A;  1B9R A;  2M1M A;  1AW7 A;  4DHJ B;  2WX1 A;  2KD0 A;  4BBN F;  3AEE B;  3AE9 B;  3BVG A;  1VCB A;  3BVM A;  2RDG A;  1D3Z A;  1N5X A;  4BAX A;  3H8H A;  2G9H D;  2JRI B;  3N32 A;  3RCZ A;  2GOW A;  3I57 A;  3Q3O C;  4RM8 A;  4FA6 A;  1DOI A;  4FJY A;  1L0V B;  1T6B X;  3ZXR A;  1WMH A;  1WYW B;  3V6E B;  4KDL B;  2LHE A;  4LDT D;  2IJ0 A;  1WH3 A;  3A9K B;  1ZDX A;  3AEF B;  1EM7 A;  2ZW1 A;  3VUX A;  1NYR A;  1WR1 A;  2ZNV C;  4D2K A;  2D07 B;  1H4R A;  4KKJ A;  2EKE C;  2ACZ B;  4HPM B;  1NEN B;  5IAA C;  2Z59 B;  1C4C A;  1XLQ A;  2KDM A;  4WQO B;  4B0M A;  2W55 A;  4GSW A;  1EUV B;  2DAJ A;  3TJP A;  1J7B A;  2PPH A;  3GE3 C;  1NVI D;  3MHZ A;  1GUA B;  4WQM A;  2MBO A;  1UNS A;  4PK1 A;  3GZN B;  1BML C;  4TQ0 A;  2X38 A;  2NPT A;  3ZNI D;  1YD8 U;  2DAF A;  1UGM A;  2WXI A;  3VH3 B;  2LGI A;  1WFY A;  4G0N B;  4IKG A;  2DZJ A;  3CMM B;  3DBL B;  3RNB C;  5DPW A;  2E3T A;  3SEB A;  1I4Q A;  3U7D A;  2O6V B;  3QAQ A;  1MVK A;  3AEC B;  4RM9 A;  3NJT A;  3I5J C;  4AJW A;  4PS3 A;  1T5X D;  1I4X A;  1IYF A;  2KFJ A;  4WUR A;  3NVZ A;  4BOZ B;  2WLB A;  1JRU A;  1UBI A;  3ETR A;  4ARC A;  1WRD B;  2KMC A;  2MJ3 A;  3PLU A;  3T3N A;  1MPE A;  1NI3 A;  3R7Q A;  2UU7 A;  5JZE B;  4WAA A;  1PQS A;  3P4R B;  3TEY A;  4XYC A;  1EO6 A;  3E9S A;  2JQR B;  3VRB B;  5D3I B;  1YQ4 B;  2N1V A;  2LXC A;  2IYD B;  3SD5 A;  2MRP A;  4ICU A;  1KRH A;  3GZN I;  2D5G A;  3NZS A;  1VJK A;  3BK2 A;  5TR5 A;  4XZ4 A;  3QAR A;  4N58 A;  2MCN B;  1JCK B;  3RPF C;  2W3S A;  3C19 A;  3N20 C;  1Z5S B;  3QA8 A;  2JXX A;  2J0J A;  1LM8 B;  4MJS B;  4DHJ D;  1UF0 A;  3DBL I;  1QZE A;  3Q3M C;  3EA6 A;  3SU8 X;  2I38 A;  1HZ5 A;  3GOE A;  4KGR A;  2B76 B;  1TS4 A;  1E90 A;  1RYJ A;  2BYT A;  1PGA A;  2MSE D;  2K8B A;  2V4L A;  2J0K A;  4ANU A;  1WX7 A;  1UBQ A;  1ZXH A;  2KXJ A;  1E7P B;  2SEB D;  4BFR A;  2VH2 A;  1X1M A;  4WIP A;  4E3C A;  4ZRP A;  1V81 A;  1ZGU B;  3OWE B;  3CST A;  4MAC A;  4HEA 1;  3AEG B;  1JWB D;  3QQ8 B;  1T3Q A;  3AU4 A;  4C00 A;  1Q5W B;  2YVC A;  2NVU I;  3TEX A;  4NNJ B;  5FR3 A;  3VR8 B;  1NDD A;  3VRA B;  2AL3 A;  2LMC A;  2GRI A;  1ISN A;  3LB8 C;  1J0G A;  3DWM A;  3U8Z A;  2XNA C;  1GAQ B;  3AEA B;  3BYY B;  1YJJ A;  3K9O B;  3IBE A;  4P16 A;  1C79 A;  1H7W A;  1VLB A;  3NVW A;  2PW9 A;  3DBR B;  3MC0 B;  5LXI B;  1WJU A;  1H8C A;  2ZEQ A;  5JHB A;  1XQQ A;  4HRS A;  3A4S C;  2IBI B;  1WZ3 A;  2J53 A;  1KLU D;  1WGY A;  1TZO A;  4RF1 A;  2PEA A;  2WXR A;  1HZ6 A;  1DYQ A;  2JT4 B;  2ASQ A;  4RGN A;  2QMT A;  1QLB B;  2REX A;  2WS3 B;  1EU3 A;  1E7U A;  2ZCB A;  1V2Y A;  3WCQ A;  2JUO A;  4GLS C;  2L76 A;  4YSY B;  2K1F A;  1K8R B;  2O6V D;  4X57 B;  3N9Y C;  1SE9 A;  1S3S G;  4WJO A;  3QHT A;  1TJE A;  2L7R A;  2IGD A;  4II2 B;  4FBJ B;  2BS2 B;  1WZ0 A;  4BKS D;  2M19 A;  2BW2 A;  4JQW C;  4A90 A;  3NRZ A;  3ZNZ B;  2WXF A;  2DYB A;  1ZOY B;  2M17 A;  4JIO U;  3L4P A;  2KJH B;  3KUD B;  2JPH A;  4YL8 A;  1NI2 A;  2MJD A;  2I2Y A;  2QCZ A;  4A3O A;  1M4V A;  4K3C A;  3DBR I;  4OZA A;  3ZDM C;  3OG5 A;  4FJZ A;  2PJH A;  2GBR A;  4W9C A;  1JRP A;  3PZD A;  1WE6 A;  4CYE A;  3P63 A;  3U4E G;  3BYT B;  4KGT A;  2IO0 B;  2ZPN A;  2JX5 A;  4H2A A;  1Q0W B;  4N6E B;  4HWI B;  1L7Y A;  1TY2 A;  1SEB D;  2KFK A;  4DQO C;  3TEZ A;  2KN5 A;  2K6D B;  3Q2A C;  4XE0 A;  2LGY A;  2ZVN A;  2A4Z A;  1PGB A;  5CX3 A;  2BB6 A;  4WJP A;  4FHJ A;  3A1Q A;  2D3B A;  2UWQ A;  2NBV B;  1C4P A;  1CQV A;  5HG2 A;  4M0W A;  3WAN A;  1P7F A;  3RFZ B;  4IW0 A;  3LDZ E;  1MJD A;  1OGW A;  5CHV C;  1BXT A;  1OEY A;  1JWU D;  1TS5 A;  1QOG A;  4MGK E;  4JL9 A;  1ZP0 B;  3Q3F A;  3CF6 E;  4ASW C;  1M94 A;  4GMV A;  3P4P B;  1HTQ A;  5IKC M;  3JSV B;  2QIL A;  5G55 A;  1L0Y B;  2EKI A;  3TEW A;  3AE3 B;  3AE5 B;  4LNF A;  4M01 A;  1ESF A;  1FRD A;  3SDL C;  2L0F A;  3CIR B;  1HA5 A;  5FR6 A;  5G5G A;  2CJO A;  3QJZ A;  2Y5P A;  4ZHP A;  2KKC A;  2BYE A;  3CWI A;  2FCQ A;  2E6X A;  5J2R A;  1E7V A;  3KH0 A;  1ET6 A;  2MQJ A;  3Q8E A;  4MM3 B;  3DHH C;  4B0E A;  1C3T A;  1WWT A;  1J7C A;  2UYZ B;  3U2S C;  4CHK A;  4F8C B;  2BBC A;  3MJW A;  2LHD A;  1V86 A;  2N7D A;  2ZZP B;  3RYT A;  3PZ7 A;  2FE8 A;  2V1Y A;  5IOI A;  2K25 A;  4LJP B;  1RAX A;  3NG0 A;  1FD6 A;  4LNI A;  3NY5 A;  2PVG C;  1KJT A;  2OJR A;  3Q6B A;  4W9I A;  2DEN B;  3W5V B;  2D2Q A;  1WJN A;  1YJ1 A;  1UGJ A;  3LXF A;  1VRA B;  1L4Z B;  2LJI A;  3PHW B;  2OOB B;  3L0W B;  1JWA D;  3AE7 B;  2G4S A;  4YTN B;  2O2V B;  5AZG A;  4REZ A;  2RSU A;  3FKY A;  4ANX A;  3U7Z A;  3NVV A;  1LXD A;  3X0W A;  4G50 A;  1UWM A;  5CHF A;  1EWC A;  4S17 A;  4NAW A;  2KAC A;  2RDB C;  4DXA B;  5E6J A;  3UIN B;  1Y56 A;  1FFU A;  3IT6 B;  3Q14 C;  4EKU A;  3X23 A;  4KGS A;  5HHD G;  2V4I B;  3ZTD A;  2KC1 A;  3DWG C;  1WJ6 A;  1WF9 A;  3KWV A;  1SF0 A;  2HTH A;  4DXF A;  4HJG E;  4WWP A;  2ZNV B;  4K3B A;  1PGX A;  2QIE B;  4XWW A;  1WGH A;  1JML A;  1YOV B;  1JW9 D;  1N60 A;  2HDE A;  3IFW B;  5HKH A;  1WYG A;  3I3T B;  4DDI D;  5AZH A;  5FK9 C;  2M4N A;  4AUQ C;  1CMX B;  3T9L A;  3ZDT A;  1WY8 A;  1WI0 A;  4K1R B;  3A9J A;  2KZR A;  2WQY B;  4WWM A;  3A4R A;  3UIO B;  3ENE A;  3AMZ A;  1OFF A;  1L4D B;  4KZC A;  2IDY A;  2LAS A;  3I9V 1;  1SJE D;  1WM2 A;  4C4V A;  4JPS A;  1VZ8 A;  3KUC B;  4Q2J A;  2IZV B;  3BZD B;  3URY A;  2FUH B;  3PSE B;  4M0W B;  2KAN A;  2KAJ A;  3AB5 A;  3GP7 A;  5BO4 B;  3ZO5 B;  2C7M B;  1PYW D;  3DHI C;  2D3G A;  4HVB A;  3R2I A;  4WAF A;  3RUL A;  5LLI A;  5GXG B;  1SE2 A;  4C80 A;  1FPY A;  1RLF A;  2KWU B;  1KLG D;  1V5O A;  1YN5 A;  3HM3 A;  4N59 A;  2NBU A;  4IWO A;  1IGD A;  4DHZ E;  4EUT A;  3BIN A;  3OJ3 A;  2N9X A;  2KJR A;  1IBX A;  4K7U A;  2RR9 A;  1XLP A;  1WM3 A;  1YQB A;  1E10 A;  4LTU A;  1WR6 E;  3IAM 1;  1Y8R C;  1GPX A;  4DWF A;  2HE7 A;  2BWE S;  3ZXV A;  3JW0 X;  3OJ4 B;  5IN7 A;  1QF6 A;  2VRR B;  3L54 A;  1WXS A;  1UEL A;  2C60 A;  4KIK A;  2N4F A;  4A20 A;  3FAH A;  1T0S C;  3GE8 C;  3ZW3 A;  2MBB B;  3E56 A;  3EUB 2;  3UF8 A;  3VHT C;  1N62 A;  1SJH D;  2ON8 A;  3HVD A;  4MGI E;  2KVR A;  2KOX A;  4MDK E;  3NHE B;  1L5P A;  2BS4 B;  4PT5 A;  5EE1 A;  1BT0 A;  4AJY B;  4ANV A;  1ROE A;  4FJV B;  4J6I A;  1H7X A;  2MX2 A;  2D3A A;  3BWU D;  1WE7 A;  5BYR A;  3V3X A;  4AP4 C;  2G1E A;  4CO7 A;  3EC8 A;  2FIF A;  4PYZ A;  2BGF A;  4JGH B;  3JVZ X;  1CZP A;  1JAL A;  4KKI A;  1FNV A;  3NZU A;  2MA9 B;  2W9N A;  4FLH A;  4PS8 A;  1J19 A;  4NAW B;  1MHH E;  2XEW A;  5HI1 A;  2LI5 A;  5EE0 A;  2NBW B;  3P42 A;  2JVC A;  3B1L X;  1TS2 A;  4W9H A;  4YT0 B;  1C77 A;  1WXM A;  2DWQ A;  3KQ4 A;  4W9E A;  5D6J B;  4P1B C;  1LFD A;  4RFB A;  4KSL C;  5EDS A;  3ECI A;  1OQY A;  2XBB C;  2Z0D B;  1FXT B;  2IY1 B;  4GDK A;  3S2A A;  1WGR A;  4ITK A;  2GI9 A;  5D2M B;  5J18 A;  1D5X C;  2BF8 B;  1F9J A;  1ENF A;  3N1Z C;  3Q8C A;  1E9M A;  2BWF A;  2N9K A;  1MFW A;  2LUE A;  2MJE A;  3UQB A;  3RNG C;  3APD A;  1TT5 B;  3ML8 A;  4W9D A;  4MGZ E;  4BZA A;  5HFY A;  3OAW A;  4ZRQ A;  3DOW A;  1E5W A;  3A9J B;  2N7E A;  1I4R A;  2EEL A;  3NS1 A;  3V62 A;  5IA7 A;  1P7E A;  3VVW B;  2DX5 B;  2KT7 A;  3B2F A;  1WMH B;  3ALB A;  4EFO A;  4MH8 A;  4XC2 A;  2M0X A;  2WGS A;  1WGG A;  3RNF C;  1TKE A;  3TUO A;  1A5R A;  5DPS A;  2CU3 A;  5JHA A;  1I4P A;  3J9C A;  5IP4 D;  2GLS A;  4A9A A;  1OQR A;  2FCS A;  3RI7 C;  1KTK A;  4B95 A;  4A55 A;  1IUE A;  2INC C;  3O65 B;  1V8C A;  2N0S B;  2BYF A;  2IPK D;  3AI5 A;  4YWG G;  3I63 C;  1IBX B;  3P4Q B;  1R4M B;  3EEC A;  3QX1 A;  1V1P A;  2NTS A;  3W5U B;  2M0A A;  1SSN A;  3RD2 A;  1OTR B;  4DK5 A;  1C76 A;  3NZ3 A;  1GC6 A;  1AAR A;  4KIK B;  5E6P A;  2LWP A;  2L32 A;  1D5M C;  2L3Z A;  4TMA B;  2LJ5 A;  1Z2M A;  2KLG A;  2J52 A;  3L13 A;  4I6P A;  3WAO A;  3LYY A;  2NPT B;  3BY4 B;  4C7Z A;  4GDL A;  3IG3 A;  3IHP C;  2LVO A;  2C9W B;  4HCP B;  1A70 A;  2MP2 A;  4FN2 A;  3NOB A;  1SB3 C;  2D3C A;  1STE A;  3ZJT A;  2MH7 A;  4GOC A;  3RNA C;  2WXN A;  4G11 A;  3WAM A;  3AU5 A;  3L08 A;  1E6E B;  2BB5 A;  4LCD E;  1ZE3 D;  2W54 A;  1SBB B;  2WP9 B;  4HLE A;  3CSF A;  2WHI A;  4LK0 M;  2H88 B;  3ZLZ A;  3N1Y C;  3O13 A;  3PRZ A;  4ZRJ A;  2BKF A;  4GN1 A;  3PTF C;  2IO3 B;  4FHK A;  3NS8 A;  1FM0 D;  3HIZ A;  2L52 A;  3ZUN A;  1R4M I;  2QDF A;  3DDC B;  4ZDV A;  1TYG B;  1DGJ A;  4C56 C;  1V80 A;  2PKO A;  4YSX B;  3MJ5 A;  2JSV X;  2C5L C;  4EEW A;  2DHZ A;  1VDV A;  1HXY D;  5I4D A;  4A6Q A;  3Q8A A;  1BUI C;  2G45 B;  4IDI A;  5IO9 A;  5H92 C;  1WSP A;  3AN1 A;  4TKN A;  4DXG A;  3AE1 B;  5AUI A;  4F7Z A;  3T3O A;  2MLB A;  1RWS A;  4KSK C;  2KDE B;  2ZCC A;  3MHS D;  2QEJ C;  2JF5 A;  3VH4 B;  4NQK E;  3AED B;  4LNN A;  3EHV A;  5TSS A;  2Z0E B;  4US8 A;  2WXL A;  2VH1 A;  1FFV A;  3EGR A;  3APC A;  1JQ4 A;  2L83 A;  2BT6 A;  4AS1 A;  2MBH A;  2J4X A;  4K81 A;  3BII D;  5BYQ A;  4EZJ A;  2X8X X;  3D32 A;  3H9D A;  2MEK A;  3DCG A;  2INN E;  1FEH A;  2J42 A;  1ZKH A;  5LNK 1;  2KMM A;  2DNF A;  5JH5 C;  2K0P A;  3BK1 A;  2WXO A;  3CF4 A;  5KHO A;  4JLC A;  1TKY A;  4WWO A;  1KFY B;  3VR9 B;  1K52 A;  1T0Y A;  2INP E;  3Q8B A;  3AE2 B;  4NJ6 A;  3C0R B;  2WNM A;  5DCN A;  3UIP B;  4C7Y A;  2PLP A;  2V9H A;  4WWN A;  1ACC A;  2KLC A;  2AYO B;  2PVO D;  4IG7 B;  1WXA A;  1OQQ A;  3HM6 X;  3A9K A;  4ACF A;  1QIL A;  1L0X B;  1TZ1 A;  2KQS A;  4PYU A;  4P7I A;  1V1O A;  2IGG A;  1KF6 B;  2JY6 A;  5D3D A;  2BVC A;  3W1Y A;  4OW0 A;  2WXH A;  2JZZ A;  3W1S C;  2MBE A;  1V1P B;  3ZVV A;  2WXQ A;  1FMA D;  2LGX A;  2JYT A;  3P2B A;  2KWC A;  2H89 B;  4KX6 B;  3B0A A;  1FNW A;  1XF5 L;  1P98 A;  3ZNH B;  2V3S A;  3V60 A;  1MI0 A;  4IWP A;  2R2Q A;  4TSS A;  3R66 C;  2RMM A;  3PT2 B;  2KO3 A;  1V9J A;  2KYW A;  1FCL A;  1XO3 A;  1D4B A;  2WXJ A;  4KVG B;  2K3U A;  1SE3 A;  4GDL B;  1V5T A;  3PHX B;  2PMV A;  1YJI A;  3GS2 A;  1XLO A;  2J0M A;  4OVZ A;  3DHG C;  3T8M A;  2MP2 B;  3AE8 B;  2KX0 A;  1F2R I;  4M8N A;  4OVU A;  2IY0 B;  1ZPS A;  2L1A A;  1WJ4 A;  2GBJ A;  3PRP B;  5KHQ A;  2QC8 A;  3VUW A;  2J7Q B;  1F0Z A;  4XX5 A;  1GTE A;  3ZYY X;  2AQ2 B;  2HJ1 A;  2BYV E;  4NY0 A;  4JE3 B;  2DBY A;  3LJ3 A;  2Y3A A;  4NJ7 A;  3PRE A;  1KH0 A;  1EF5 A;  4E74 A;  2YLM A;  2LRU A;  4HRO A;  1C78 A;  1T0R C;  4HPL B;  1RFA A;  5H8Y E;  2VZK B;  1NBF C;  3M62 B;  2RDH A;  4US9 A;  1SIJ A;  2I1J A;  3M95 A;  2WYQ A;  1E8Z A;  3HRD D;  3ABV B;  2JXT A;  4O1N A;  1YX6 B;  1MG8 A;  1WX9 A;  1I7H A;  2KTR A;  1GNU A;  4MH0 E;  4MGY E;  3KUZ A;  4MT5 A;  3U30 A;  1D5Z C;  5C3J B;  4IM3 A;  2ONQ A;  2KFK B;  3WIM A;  2QJL A;  4YXD B;  4HCN B;  3N30 A;  3KVF B;  4S0R A;  1I4G A;  4HXD A;  4WJQ A;  2KWD A;  1QT9 A;  4EZL A;  2WU5 B;  1TS3 A;  2R2O A;  3TIX A;  4ZHO A;  3GB1 A;  2OJW A;  5BYS A;  3ZTC A;  1P9D U;  4L1B A;  3HUI A;  1XLN A;  3SR6 A;  3RN9 C;  3A1Q B;  5T8I A;  4R3D A;  1XT9 B;  1LO5 D;  2NS5 A;  3B08 A;  4BBN C;  1YIW A;  1GTH A;  3MP9 A;  5LXH A;  2L05 A;  1TGZ B;  4W9J A;  4MEM A;  4LNO A;  3RNE C;  4GB9 A;  2AEH A;  4MSM B;  3DBH B;  3IT4 B;  4XDC A;  5MPO A;  3TL5 A;  2EMS A;  1L6V A;  4BVU C;  2IO2 B;  3AXC A;  1GB1 A;  1CJE A;  5G2N A;  3MC8 A;  3HK0 A;  2KDB A;  3H7P A;  2BPS A;  4A3P A;  2CKH B;  5BMI A;  2DYO A;  2N9E B;  4URK A;  2WU2 B;  2WDQ B;  4I6L B;  4LNK A;  2K9X A;  2GBM A;  3WA0 A;  2CJN A;  2WX0 A;  2GMI C;  5D7G A;  4GGQ A;  2JYE A;  4HKZ E;  2A5U A;  2PE6 B;  2KQ7 A;  1VR9 A;  4ANW A;  3UI3 A;  1P1A A;  1WXV A;  2FUG 1;  3RT3 B;  4DHZ B;  2LVP A;  5E6O A;  3QK0 A;  2PTL A;  3PPA A;  1IPG A;  2LVQ A;  4RMA A;  5C23 A;  1RM6 C;  2BKR B;  2WDV B;  2DZK A;  4LLG M;  2WXP A;  1CK1 A;  2R61 A;  4RF0 A;  1VZ6 A;  3UQA A;  3R3M A;  3VQI A;  2W3R A;  2D11 A;  3B2G A;  2Q5W D;  4MEL A;  2KK8 A;  3L17 A;  3DBH I;  2RPV A;  4GU2 A;  2PIA A;  1AYF A;  3ZIM A;  2C7H A;  3H1U A;  4WJN A;  4ARI A;  4ZOH C;  4NPN A;  2K5P A;  2LXA A;  4HDQ A;  5CTR C;  3P4S B;  5BMH A;  1UUP A;  2B3A A;  3VAW A;  3W9C B;  1K50 A;  1Q10 A;  4USA A;  3U52 E;  3VTU A;  2KC2 A;  1OEY J;  1EWY C;  1SGH A;  4M02 A;  1VZ7 A;  4ZYS A;  1PFD A;  4M8M A;  5CHW A;  3DPD A;  4XGA B;  1QOF A;  2NMQ A;  1C9F A;  4NZL B;  3RZF A;  2VZK D;  2DZM A;  5GMV A;  4IOI E;  4BOS C;  4HK2 A;  3PGE A;  2BS3 B;  1KOT A;  5DPT A;  2LGD A;  2MWS B;  1LQB A;  1FRR A;  3ML9 A;  3SFE B;  2I1K A;  3W1S A;  3KYD D;  2KTR B;  4B6W A;  3Q3N C;  1JWS D;  1GT8 A;  2JZP A;  2LRW A;  1E0Z A;  1SXT A;  3DVN V;  3MC9 A;  4OHJ A;  1FXI A;  1GOZ A;  2KDI A;  4HJK A;  3Q69 A;  1XEE A;  4EOY A;  2L8J A;  2CHW A;  2FAZ A;  3IVF A;  3PO0 A;  2L00 B;  2CHZ A;  4I6N B;  4KDI C;  5G5H A;  1YQ3 B;  4W9L A;  2K39 A;  4WH4 A;  3EFC A;  2G3Q B;  4C4V B;  4RNA A;  1YN3 A;  3BVZ A;  2KWV B;  4W9F A;  1WIA A;  3L16 A;  5D94 A;  1V49 A;  1HQR D;  4YSZ B;  2K8C A;  1G6J A;  2FCM A;  1V97 A;  2W82 A;  3R7R A;  1N5W A;  3TSS A;  3H7P B;  5BMG A;  4QAY A;  4K7S A;  2PE9 A;  3JSV A;  3K9P B;  4DBG A;  2ZPY A;  5AEK B;  1ZUD 2;  4CQN A;  1J8C A;  1DOY A;  2KHW B;  3AM9 A;  3AE4 B;  4IM0 A;  4RH6 A;  3TBL D;  1N63 A;  1Q1O A;  4PS7 A;  3QCA A;  4JWS C;  2AX5 A;  5C1Z A;  4IUM B;  1R4N B;  2C7N B;  1KLV A;  2M56 B;  2D10 A;  2KTF A;  3OLM D;  4MM3 A;  3Q8F A;  4B9K A;  3A33 B;  1P3Q U;  2CR5 A;  1PUT A;  4RGM A;  1WXQ A;  4II3 B;  3PZ8 A;  4P1C C;  1MHX A;  3ZJV A;  2V3N A;  2Z8L A;  2RD0 A;  3TCA A;  4HPP A;  2NCN A;  2ZVO A;  3B9J A;  3QC8 B;  4YTM B;  2KQ4 X;  1LGR A;  3UGB B;  1UWX A;  3HHM A;  1XCT L;  1K51 A;  4XDD A;  1WGK A;  3AEB B;  1WRI A;  4RGT A;  4RCO A;  3VUY A;  1YNT E;  1GC7 A;  1TY0 A;  3KLS X;  1JWM D;  2QSD A;  2KX3 A;  1C4A A;  2O2V A;  4OZC A;  1YX5 B;  1U4A A;  3VDZ A;  4EE2 A;  1GJZ A;  3W2D A;  5AUK A;  2QHO A;  1XXG A;  2LUM A;  1WGD A;  1NYQ A;  2N1W A;  4EZK A;  1YMH E;  4TUU A;  2LZ6 A;  3P1M A;  2K6Q A;  3H7S A;  2CHX A;  4FUL A;  2LFI A;  3M3J A;  3ZRF A;  3JYU A;  2KMA A;  3KWL A;  3ZKJ C;  2L0T A;  3MFG A;  4L23 A;  1ZDV A;  3PV1 A;  1E8W A;  1N61 A;  3AH7 A;  3RZW C;  2GBK A;  1R4N I;  4FAD A;  3WAP A;  2XK5 A;  4W9G A;  4RGO S;  4JWU C;  1SE4 A;  4GDK B;  2JRH A;  5FKA C;  3PS6 A;  2RGF A;  1F1H A;  3FIL A;  4AOF A;  4KV2 A;  4OZB A;  2HJ8 A;  2K8H A;  1FO4 A;  2N7J A;  4L2Y A;  2KVZ A;  1HE8 A;  1NEK B;  2JWU A;  1QOA A;  2WXG A;  1UZX B;  2MHJ A;  5L95 C;  1EF1 A;  1L6U A;  2HTM E;  5C2T B;  4G3X B;  1N6Z A;  2DLB A;  1WX8 A;  1ZW7 A;  4XWT A;  1I42 A;  1C1Y B;  2JZ3 B;  1VD2 A;  2WDR B;  2HD5 B;  5AZF A;  4KZ0 A;  1TIF A;  2GB1 A;  2M8S A;  5E6N A;  2V3P A;  3KYC D;  4TV3 A;  4N9F 4;  2KDF B;  2IND C;  1IGC A;  3KW5 B;  4A8X C;  2IO1 B;  2EMT A;  4FXC A;  3PVL A;  3H6N A;  1XD3 B;  4OVV A;  4YTP B;  3VTV A;  3ONS A;  2NTT A;  1MG4 A;  3EFU A;  3V6C B;  3VFK A;  2KN4 A;  3NVY A;  2N9L A;  2TSS A;  1F77 A;  1RRB A;  1E8Y A;  5DPR A;  1HEZ E;  4GIV A;  1ET9 A;  2AWT A;  3PRM B;  4K7W A;  3ZNG C;  3HVZ A;  1QOB A;  4LDT B;  3MTN B;  4ICV A;  3WAL A;  3DVG Y;  3IAS 1;  1T0Q C;  2N9P C;  4DDG D;  1QKZ A;  4F1S A;  3ZQ4 A;  5EE3 A;  1GG3 A;  1JRO A;  1D6E C;  4UDU C;  3ZGZ A;  1DOX A;  2SAK A;  2Y5B B;  2OHF A;  1K53 A;  1HTO A;  1QQR A;  1GB4 A;  2CU1 A;  4BKT A;  1J7A A;  1EU4 A;  5JXV A;  1XCQ L;  2IGH A;  4ZRI A;  3RNC C;  2ICI A;  3AE6 B;  3R8B A;  3QWZ B;  2FCN A;  4HKQ A;  3C8Y A;  3N3K B;  1ZXI A;  1AN8 A;  2G4D B;  3V61 A;  3DVN U;  2JU6 X;  2NR2 A;  2WDT B;  1FIQ A;  3IXS A;  3SHQ A;  4ZYN A;  2ZJD A;  2YEP B;  2GBN A;  3N1X C;  2RPQ A;  4JX1 C;  2BQQ A;  5L83 A;  1UH6 A;  2LGS A;  4IM2 A;  1PDX A;  2FID A;  5EE9 A;  2OED A;  4AWJ A;  1RFK A;  3VXW A;  3ZJU A;  2FBW B;  4ZRK A;  4NQL B;  3NUH B;  2BTE A;  4TQ1 A;  2WXK A;  2KJ6 A;  2MBQ A;  3PLV A;  2V0G A;  4BKG A;  4IWQ A;  2XN9 C;  1F2R C;  1FNU A;  2O6V A;  4J3O D;  4GXB A;  2AQ3 B;  2FNJ B;  3R2T A;  4W9K A;  1YN4 A;  3FC4 A;  1TKG A; 
#chains in the Genus database with same CATH homology
 1RM6 C;  2WDV B;  3TUO A;  4N6E B;  2CU3 A;  1I4P A;  3J9C A;  4DQO C;  1TY2 A;  1SEB D;  4LLG M;  3TEZ A;  4A9A A;  4AQ7 A;  1OQR A;  2WXP A;  1B1Z A;  1KTK A;  1CK1 A;  4XE0 A;  2R61 A;  4RF0 A;  4A55 A;  1VZ6 A;  1PGB A;  1IUE A;  3VQI A;  2W3R A;  1V8C A;  2N0S B;  3B2G A;  2BB6 A;  4NJC A;  2Q5W D;  2LEK A;  1FXA A;  2DYM A;  4YWG G;  2IPK D;  2AQ1 B;  1IBX B;  3P4Q B;  2YEP F;  2RPV A;  2PIA A;  1AYF A;  4NAM A;  1FCC C;  1V1P A;  2NTS A;  3W5U B;  2M0A A;  1SSN A;  2Y5C A;  4ARI A;  4ZOH C;  1C4P A;  1CQV A;  3FIL B;  5HG2 A;  2K5P A;  4M0W A;  1C76 A;  3P4S B;  5BMH A;  4P6V F;  1UUP A;  2ZW0 A;  3NZ3 A;  3SFD B;  1P7F A;  3RFZ B;  3W9C B;  1K50 A;  1Q10 A;  1BXT A;  2K22 A;  2L32 A;  1D5M C;  1JWU D;  1TS5 A;  4USA A;  4TMA B;  1AWD A;  1QOG A;  3U52 E;  2J52 A;  3V05 A;  3AV8 A;  2WXM A;  1ZP0 B;  1EWY C;  3LYY A;  4C7Z A;  1I4H A;  1R7S A;  1VZ7 A;  3P4P B;  4ZYS A;  1PFD A;  1B9R A;  1QOF A;  1AW7 A;  2NMQ A;  1A70 A;  1C9F A;  4NZL B;  2QIL A;  1L0Y B;  2EKI A;  3TEW A;  3AE3 B;  3AE5 B;  2VZK D;  1ESF A;  1SB3 C;  1FRD A;  3AEE B;  1STE A;  3AE9 B;  3ZJT A;  3CIR B;  2MH7 A;  1HA5 A;  3BVG A;  4IOI E;  2WXN A;  5G5G A;  3BVM A;  2BS3 B;  2RDG A;  1E6E B;  1N5X A;  2CJO A;  2BB5 A;  2G9H D;  3H8H A;  1ZE3 D;  2Y5P A;  4ZHP A;  2W54 A;  1SBB B;  2WP9 B;  3CWI A;  1FRR A;  3SFE B;  2E6X A;  3W1S A;  3I57 A;  4LK0 M;  1ET6 A;  2H88 B;  1JWS D;  3O13 A;  1GT8 A;  1DOI A;  2JZP A;  1L0V B;  1T6B X;  3Q8E A;  4MM3 B;  1E0Z A;  4B0E A;  1SXT A;  1WWT A;  1J7C A;  4OHJ A;  3U2S C;  1FXI A;  1FM0 D;  2LHE A;  2BBC A;  1GOZ A;  2L52 A;  2LHD A;  3Q69 A;  1XEE A;  2IJ0 A;  3PZ7 A;  2FE8 A;  1TYG B;  1DGJ A;  1ZDX A;  4C56 C;  3PO0 A;  3AEF B;  2PKO A;  4YSX B;  1FD6 A;  1EM7 A;  2JSV X;  3MJ5 A;  2ZW1 A;  1NYR A;  5G5H A;  1YQ3 B;  2PVG C;  3W5V B;  4WH4 A;  1VDV A;  4D2K A;  1UGJ A;  3LXF A;  1VRA B;  1HXY D;  1L4Z B;  2LJI A;  4KKJ A;  5I4D A;  2ACZ B;  4RNA A;  4A6Q A;  1NEN B;  3Q8A A;  1BUI C;  4IDI A;  1JWA D;  5H92 C;  1WSP A;  3AN1 A;  1YN3 A;  3BVZ A;  3AE7 B;  1C4C A;  4YTN B;  1XLQ A;  4DXG A;  2KDM A;  3AE1 B;  5AUI A;  4B0M A;  2W55 A;  4REZ A;  3T3O A;  1RWS A;  3U7Z A;  3NVV A;  1J7B A;  1HQR D;  1UWM A;  4YSZ B;  1NVI D;  3MHZ A;  4WQM A;  2QEJ C;  1V97 A;  1UNS A;  3AED B;  2W82 A;  1EWC A;  5TSS A;  1N5W A;  1BML C;  3TSS A;  4US8 A;  4TQ0 A;  2X38 A;  2KAC A;  2WXL A;  5BMG A;  1FFV A;  3EGR A;  1JQ4 A;  2L83 A;  5E6J A;  1Y56 A;  1FFU A;  2BT6 A;  3IT6 B;  4AS1 A;  2WXI A;  2J4X A;  4KGS A;  2LGI A;  5HHD G;  5BYQ A;  2V4I B;  3BII D;  1ZUD 2;  4CQN A;  1DOY A;  3DWG C;  2MEK A;  3AE4 B;  3AM9 A;  2INN E;  1FEH A;  4RH6 A;  1N63 A;  2J42 A;  3KWV A;  4IKG A;  5LNK 1;  1SF0 A;  2KMM A;  4DXF A;  4HJG E;  2K0P A;  3BK1 A;  2WXO A;  3CF4 A;  1TKY A;  1KFY B;  1PGX A;  4JWS C;  2AX5 A;  2E3T A;  2QIE B;  1I4Q A;  3VR9 B;  1K52 A;  3SEB A;  4XWW A;  2INP E;  1JML A;  3AEC B;  1MVK A;  3Q8B A;  3AE2 B;  2WNM A;  1JW9 D;  1T5X D;  2M56 B;  1I4X A;  1N60 A;  2HDE A;  4WUR A;  3Q8F A;  3NVZ A;  2WLB A;  4C7Y A;  1WYG A;  2PLP A;  3ETR A;  1PUT A;  1ACC A;  4ARC A;  2MJ3 A;  2PVO D;  5FK9 C;  3T3N A;  4RGM A;  1OQQ A;  1WXQ A;  3PZ8 A;  1MHX A;  1MPE A;  1NI3 A;  3ZJV A;  2V3N A;  2Z8L A;  1QIL A;  3P4R B;  3TEY A;  1L0X B;  3B9J A;  3E9S A;  2JQR B;  4YTM B;  1V1O A;  2IGG A;  2KQ4 X;  2WQY B;  1KF6 B;  4WWM A;  5D3D A;  3VRB B;  1UWX A;  5D3I B;  1YQ4 B;  1OFF A;  1XCT L;  1L4D B;  2WXH A;  3AMZ A;  1K51 A;  4OW0 A;  2IDY A;  1V1P B;  4XDD A;  3I9V 1;  2WXQ A;  1FMA D;  1SJE D;  1WGK A;  2JYT A;  3AEB B;  1WRI A;  4RGT A;  4JPS A;  1VZ8 A;  2H89 B;  1KRH A;  4KX6 B;  4Q2J A;  2D5G A;  3BZD B;  4RCO A;  3URY A;  1YNT E;  1FNW A;  1VJK A;  3AB5 A;  1XF5 L;  2KAJ A;  3BK2 A;  1TY0 A;  3GP7 A;  1JWM D;  2QSD A;  3KLS X;  1C4A A;  4OZC A;  1MI0 A;  4N58 A;  1JCK B;  3RPF C;  2W3S A;  4TSS A;  4EE2 A;  1PYW D;  3W2D A;  5AUK A;  2RMM A;  1XXG A;  2LUM A;  1NYQ A;  1FCL A;  1XO3 A;  1YMH E;  2WXJ A;  1D4B A;  3R2I A;  4WAF A;  2K3U A;  1SE3 A;  4GDL B;  2PMV A;  1YJI A;  3P1M A;  3GS2 A;  5GXG B;  1XLO A;  1SE2 A;  4C80 A;  2LFI A;  4OVZ A;  1KLG D;  1YN5 A;  4N59 A;  3AE8 B;  3KWL A;  1IGD A;  1F2R I;  3MFG A;  4L23 A;  1ZDV A;  1N61 A;  3AH7 A;  1ZPS A;  2L1A A;  1IBX A;  3EA6 A;  2I38 A;  1HZ5 A;  1XLP A;  1E10 A;  4KGR A;  2B76 B;  1TS4 A;  4LTU A;  4RGO S;  3IAM 1;  1RYJ A;  4JWU C;  2BYT A;  1SE4 A;  1GPX A;  4GDK B;  1PGA A;  1F0Z A;  5FKA C;  1GTE A;  3FIL A;  1QF6 A;  3ZYY X;  2AQ2 B;  4OZB A;  1ZXH A;  1E7P B;  2SEB D;  4WIP A;  2N7J A;  4ZRP A;  1FO4 A;  4L2Y A;  3FAH A;  1NEK B;  2JWU A;  1QOA A;  2WXG A;  4JE3 B;  3E56 A;  3EUB 2;  1L6U A;  3OWE B;  2DBY A;  2HTM E;  2Y3A A;  5C2T B;  4MAC A;  1KH0 A;  4HEA 1;  2DLB A;  3AEG B;  1N62 A;  4HRO A;  1JWB D;  4XWT A;  1C78 A;  1SJH D;  1T3Q A;  2ON8 A;  3HVD A;  2WDR B;  5H8Y E;  2GB1 A;  1L5P A;  2VZK B;  2RDH A;  2V3P A;  2BS4 B;  4PT5 A;  3TEX A;  5FR3 A;  5EE1 A;  3VR8 B;  3VRA B;  2LMC A;  2GRI A;  1IGC A;  4US9 A;  1SIJ A;  3LB8 C;  1ROE A;  4A8X C;  1H7X A;  3DWM A;  3BWU D;  2XNA C;  4FXC A;  3HRD D;  5BYR A;  3ABV B;  2JXT A;  4O1N A;  3V3X A;  4YTP B;  1GAQ B;  3AEA B;  3BYY B;  2G1E A;  1YJJ A;  2NTT A;  1I7H A;  4P16 A;  1C79 A;  1H7W A;  1VLB A;  2KN4 A;  3NVY A;  2N9L A;  2TSS A;  1CZP A;  1JAL A;  1F77 A;  3NVW A;  4MT5 A;  1HEZ E;  2PW9 A;  3MC0 B;  1D5Z C;  1ET9 A;  5C3J B;  2ONQ A;  2QJL A;  4YXD B;  4KKI A;  1I4G A;  1FNV A;  3HVZ A;  1QOB A;  2KWD A;  1QT9 A;  4HRS A;  3IAS 1;  2WU5 B;  1TS3 A;  4ZHO A;  1QKZ A;  3GB1 A;  4NAW B;  1MHH E;  3ZQ4 A;  5EE3 A;  2J53 A;  5BYS A;  5HI1 A;  1JRO A;  5EE0 A;  1D6E C;  4UDU C;  3ZGZ A;  4L1B A;  1DOX A;  1KLU D;  3HUI A;  1XLN A;  2SAK A;  1TZO A;  3P42 A;  3SR6 A;  5T8I A;  2OHF A;  1K53 A;  1QQR A;  1TS2 A;  4RF1 A;  1GB4 A;  4YT0 B;  1C77 A;  2WXR A;  1J7A A;  1HZ6 A;  1DYQ A;  4R3D A;  1EU4 A;  5JXV A;  2DWQ A;  3KQ4 A;  1XCQ L;  4RGN A;  2QMT A;  1QLB B;  2IGH A;  1LO5 D;  1GTH A;  3MP9 A;  4RFB A;  2WS3 B;  1EU3 A;  2ICI A;  3AE6 B;  3R8B A;  3WCQ A;  4HKQ A;  3C8Y A;  4GLS C;  1ZXI A;  1AN8 A;  2JU6 X;  1FIQ A;  4YSY B;  3IXS A;  2GI9 A;  4ITK A;  1D5X C;  3IT4 B;  4XDC A;  5MPO A;  3N9Y C;  2YEP B;  4JX1 C;  1L6V A;  1TJE A;  1ENF A;  2IGD A;  3Q8C A;  2BS2 B;  1E9M A;  1GB1 A;  1CJE A;  2M19 A;  2N9K A;  2MJE A;  2BW2 A;  4A90 A;  3NRZ A;  2WXF A;  1PDX A;  1ZOY B;  5BMI A;  5EE9 A;  2OED A;  2DYO A;  2WU2 B;  1RFK A;  2WDQ B;  3L4P A;  3ZJU A;  2K9X A;  2FBW B;  2CJN A;  5HFY A;  2MJD A;  4ZRQ A;  2I2Y A;  5D7G A;  3NUH B;  2BTE A;  2JYE A;  4TQ1 A;  4HKZ E;  1M4V A;  2WXK A;  4OZA A;  1I4R A;  2EEL A;  3NS1 A;  1VR9 A;  2V0G A;  3UI3 A;  1P7E A;  1JRP A;  2XN9 C;  1F2R C;  1FNU A;  3B2F A;  2FUG 1;  3P63 A;  3U4E G;  3BYT B;  4KGT A;  4MH8 A;  2PTL A;  4J3O D;  2AQ3 B;  3R2T A;  2JX5 A;  4H2A A;  1TKE A;  1YN4 A;  3FC4 A;  1TKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...