3P4PB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with fumarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4pB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4pB01
1RWSA 5GXGB 4FXCA 1J7CA 3CIRB 4A9AA 1QOGA 1SB3C 2WQYB 1FRDA 1NENB 3L4PA 2WLBA 3FAHA 5G5GA 3P4RB 2W55A 1WYGA 5G5HA 1XLPA 2JQRB 4ZHOA 1QF6A 3VRAB 1I7HA 3HVZA 4YTPB 2EKIA 4YSXB 2W3SA 3LXFA 1L0VB 1WXQA 3NVZA 3HRDD 1CZPA 1VDVA 1L5PA 1AYFA 3AEDB 1QOAA 1T3QA 1PUTA 1N60A 3AEBB 1TKEA 1NYRA 1PDXA 2JX5A 3NS1A 1E10A 2CJOA 3AMZA 3VRBB 4JWUC 2PKOA 4WQMA 2L83A 2WU2B 3AE2B 4N58A 3W9CB 1NVID 4C7YA 3AM9A 2BS2B 1RFKA 4HROA 2KAJA 3NRZA 2FBWB 2M56B 2WU5B 2MJDA 1DOXA 1JQ4A 1YQ3B 3SR6A 1NYQA 1GTHA 2WS3B 1QT9A 1H7XA 1KRHA 4YTNB 1FXIA 2MJEA 4IDIA 1ROEA 1GT8A 3AN1A 2DWQA 4US9A 1YJJA 1DGJA 2W3RA 1E7PB 3AE8B 1A70A 1XLOA 2H88B 1V8CA 3B2FA 1J7BA 2PVOD 2W54A 3EUB2 3CF4A 3AV8A 2ACZB 3HUIA 1B9RA 1F0ZA 1OFFA 1PFDA 1XLNA 1JWAD 1ZP0B 1SF0A 1N62A 3VR8B 2K5PA 1XO3A 3AE4B 2DBYA 4ZOHC 1OQRA 2WP9B 1JWBD 3B2GA 1ZOYB 1R7SA 1TKYA 2WDRB 1FM0D 1UWMA 2E3TA 2QJLA 4ZHPA 3B9JA 1WRIA 1FO4A 3FC4A 3P63A 5H8YE 1L6VA 1N5WA 2AX5A 3CWIA 3P1MA 5H92C 5AUKA 2Q5WD 3RPFC 2BT6A 1NEKB 3SFEB 3AE1B 1N63A 3W5UB 2CJNA 3P4PB 1FIQA 1V97A 5EE3A 3SFDB 3NVYA 4US8A 1KF6B 4YT0B 4KX6B 1JROA 1TKGA 2KMMA 4HRSA 4N6EB 3AEFB 2L52A 1FRRA 3WCQA 5C3JB 1FMAD 5EE9A 2LEKA 3AE6B 1DOYA 2CU3A 1TYGB 3VR9B 3NVVA 1VLBA 1ZXIA 3AEAB 1CJEA 2BS4B 1N5XA 2WDQB 1H7WA 1OQQA 1JALA 3AEEB 2M19A 2QIEB 4JWSC 4LTUA 1GPXA 2BS3B 4N59A 4ITKA 2PVGC 5EE0A 1WWTA 3ETRA 4C7ZA 2N0SB 3ABVB 1RYJA 2MJ3A 3AE3B 5MPOA 2WDVB 2Y5CA 3PO0A 1AWDA 2HTME 2PIAA 3BIID 4C80A 4USAA 1E9MA 3P4QB 1YJIA 3AB5A 3W5VB 2K9XA 1J7AA 1QOBA 1SIJA 1YQ4B 1N61A 1KFYB 2K22A 4WWMA 3ZYYX 2G1EA 5AUIA 1GAQB 3AECB 1NI3A 1RM6C 4P6VF 1VJKA 1IUEA 3AE7B 4YTMB 1TJEA 1ZUD2 3DWMA 1GTEA 3AE9B 1DOIA 4JX1C 2B76B 1XLQA 2MH7A 1FXAA 1QLBB 2OHFA 4YXDB 1QOFA 3DWGC 1FFVA 1L6UA 3AH7A 1JW9D 4YSZB 3AEGB 3P4SB 3NVWA 5EE1A 1E0ZA 3LB8C 1FFUA 1EWYC 3KWLA 3AE5B 1E6EB 5C2TB 1JRPA 4YSYB 2H89B 1WGKA
chains in the Genus database with same CATH superfamily
4A20A 1LO5D 2WQYB 2N9XA 4PS7A 5AZFA 4KDLB 1FNVA 1XLPA 3PHWB 2D2QA 1LFDA 3AEDB 3H8HA 4MELA 4B6WA 3DBHB 3Q2AC 2A5UA 1ET9A 3SR6A 2XEWA 4FADA 2ZCBA 1H7XA 3V61A 4US9A 1YJJA 2WXIA 1V2YA 3Q3MC 1EM7A 3B2FA 2WGSA 2XNAC 2WXGA 1P7EA 1B9RA 2QHOA 3KW5B 3UF8A 4JPSA 4HEA1 2MP2B 2BB5A 3SFEB 3V3XA 3ZNGC 1L7YA 2INPE 1VZ8A 4LNKA 4P16A 4ZRPA 3ALBA 3AE6B 3IT6B 2ZNVB 2ZNVC 3O13A 1FD6A 2JT4B 4XX5A 4IG7B 2LXAA 2RSUA 3ETRA 1IBXB 1AN8A 3Q6BA 1IGCA 1TY0A 2IGGA 4TUUA 3VTVA 3AB5A 1N61A 2WNMA 4CYEA 5D94A 2G1EA 2FUG1 4B0MA 3LJ3A 4DQOC 4BAXA 1WXAA 1I4HA 2EELA 2KT7A 1ZXHA 3DWGC 2AQ3B 4KIKA 2D3AA 2KO3A 1N6ZA 3CIRB 2Z0EB 4M02A 4PK1A 2JXTA 3MC9A 4LDTB 4RNAA 2LMCA 2EKIA 2JY6A 1WXQA 2PLPA 4BFRA 1TGZB 2IGHA 1N60A 3L13A 1V81A 2MLBA 2KAJA 3VTUA 2LGYA 4C56C 2AQ2B 4AP4C 1Q5WB 4IDIA 3RNCC 3IG3A 1D6EC 1YN3A 4KKIA 2RDHA 1E7PB 2HJ1A 2WXQA 4GN1A 2KWDA 1E8YA 2RMMA 3KWVA 2KANA 5CHWA 1E8WA 2KJRA 3UI3A 1PQSA 1WMHA 3RNEC 1RAXA 1P1AA 4NQKE 2BT6A 2DZJA 3C19A 4WIPA 3VUYA 5AEKB 1TKGA 2RR9A 1GC6A 2WXNA 3QWZB 3R7QA 2KQSA 2AQ1B 3OAWA 1PGAA 3Q8EA 1WR1A 3O65B 4M8MA 2V3PA 2PJHA 3EECA 2M19A 1C78A 1GPXA 2PVGC 3HM3A 4OHJA 4MEMA 3P4QB 3B0AA 1ET6A 3R66C 4WWMA 1RM6C 2QSDA 1VJKA 5G55A 3H7SA 3Q8AA 4GOCA 2KWCA 1DOIA 2KACA 1C77A 2OHFA 4IKGA 4XWWA 3FKYA 1JRPA 2Q5WD 2CJNA 2DAJA 3QHTA 1M94A 3TEZA 1RRBA 2LUEA 1A5RA 2W3SA 3BINA 2W82A 3IAS1 2CJOA 1WH3A 3BK1A 4PS3A 1NVID 2CHZA 4ASWC 1QT9A 1MHHE 1ZKHA 4OVZA 4HCNB 2GI9A 3N32A 2H88B 3ZKJC 3CF4A 4ICUA 1F0ZA 1JWAD 1CK1A 3JW0X 1K52A 1YX6B 2TSSA 2WP9B 2JZPA 5D2MB 2NPTA 4ZRIA 1PYWD 3RNAC 3P63A 1L6VA 4DDGD 3P1MA 2VZKB 4KDIC 3ZRCA 3AE1B 4A6QA 3I3TB 3HVDA 1FIQA 3NZUA 2IBIB 4RGOS 5EE9A 1YX5B 4NJ6A 2LJ5A 1D5ZC 2IPKD 1JALA 1KLGD 3RNBC 2DLBA 2EKEC 4G11A 2O2VB 4HKZE 4G50A 5MPOA 2Y5CA 1M4VA 1MG8A 2KHWB 2HTME 5LNK1 2V0GA 1D3ZA 1HQRD 2QC8A 5FR6A 2WXRA 4B95A 2K8CA 4M0WB 1YNTE 3WAMA 3N1YC 1ZUD2 1XD3B 1WM2A 3RN9C 2WXMA 4XDDA 1E8ZA 5J17A 4DBGA 2M0XA 4C4VB 5C2TB 4IWPA 2X8XX 4IUMB 2LFIA 4K3BA 1BT0A 2KDEB 5DPSA 3QJZA 1I42A 3QCAA 1GUAB 2KFKA 2KDBA 1AW7A 3NOBA 3GZNI 2GMIC 4LJPB 5IAAC 3ZNZB 5L95C 3MC8A 3QK0A 2ASQA 1MJDA 4BKTA 5L83A 2KOXA 2M8SA 1ISNA 1NI2A 2BYVE 2J7QB 3HIZA 4DWFA 3NRZA 1HZ5A 2MJDA 4IM0A 3RZWC 2ZPNA 2N9LA 3R7RA 1MFWA 1LQBA 2UYZB 4ZYSA 4ACFA 4LNOA 3Q3NC 3DBHI 2ACZB 3ZXRA 1ZP0B 2GRIA 4YWGG 4P1CC 4FJYA 3IVFA 1JWBD 2QJLA 1R7SA 2I38A 2E3TA 2HD5B 1WRIA 1LXDA 3PT2B 3ML9A 3SEBA 3ZIMA 1T0YA 2WXKA 3RD2A 2BWFA 2O6VA 4M0WA 3AEFB 2N1WA 2KDMA 2XBBC 1DOYA 1TYGB 3AEAB 2GB1A 3IT4B 4JWSC 2BKFA 4EEWA 2BS3B 4HK2A 4LNNA 1P3QU 1JWSD 4Q2JA 3PRMB 3ML8A 1XEEA 4E71A 4I6LB 3JSVA 2ZZPB 3R3MA 2IZVB 1NI3A 3W1SA 1V5TA 4YTMB 2LVPA 1WY8A 3WAPA 3Q3FA 1L6UA 1Z5SB 1VD2A 3N20C 3ZDMC 2QILA 3A4RA 4ICVA 1FFUA 1WI0A 5C1ZA 1C76A 3PZ7A 3PPAA 2KD0A 4TV3A 3R2TA 3VAWA 3ZO5B 1D4BA 3GOEA 4G3XB 5HHDG 2CS4A 2MW5A 2AL3A 1L5PA 1T3QA 1STEA 4P7IA 4W9HA 1PDXA 4II3B 3NS1A 2IYDB 3AMZA 4HXDA 2J0KA 2KX0A 2J4XA 1K8RB 1D5MC 3AI5A 3N30A 1R4NI 5BMGA 4MM3B 1GOZA 4DXAB 1PGBA 2MJEA 1FEHA 1ROEA 2K25A 4EKUA 3IAM1 3KQ4A 1SBBB 2WXFA 4A8XC 2LJIA 2WXLA 1SIFA 1WZ3A 2WDTB 3H7PB 1UD7A 2KK8A 3GE8C 2JSVX 1NEKB 2JWZA 5LXIB 4GB9A 4O1NA 4MJSB 2LD9A 2KMMA 3NS8A 3NY5A 2DNFA 1I4QA 1EU4A 2OOBB 4WWPA 1TZ1A 2K0PA 4A55A 3NVVA 4OZCA 4GDLB 4FHKA 4TKNA 2G4SA 1UF0A 4II2B 2EMTA 2KDFB 3TUOA 2FCMA 4W9IA 1E7UA 1QZEA 1SIJA 2IO2B 2KJHB 4KVGB 2FUHB 2C7HA 2JYTA 3AE9B 2MEKA 4OVUA 3PRZA 3ZXVA 3AH7A 3DHHC 4TQ1A 3L17A 1HE8A 4EZLA 5G5GA 2J42A 5GXGB 4W9JA 2M4NA 1SB3C 1JCKB 3WA0A 2ZJDA 2JQRB 4BBNC 4GDKA 2O6VD 2FNJB 2LHDA 4HJKA 3JVZX 1C4CA 1IPGA 3Q14C 4MGYE 3URYA 1E10A 1QQRA 2FAZA 4FN2A 3PREA 4KIKB 2Z0DB 4EE2A 1UUPA 2WXPA 2QEJC 1IGDA 1JQ4A 1DOXA 1YQ3B 1L0YB 1C9FA 1TT5B 4ANVA 5IN7A 3JSVB 3W1SC 3AE8B 1A70A 3GB1A 1YQBA 3GS2A 3VHTC 2VH1A 2KQ7A 2G4DB 4G0NB 1IBXA 1T5XD 1OQRA 2PPHA 3RMKC 1UWMA 2LRWA 3V62A 1EWCA 3W5UB 3BZDB 3Q8BA 3VXWA 2LI5A 4PYUA 4WJOA 3ZTCA 2GBKA 4KKJA 2LZ6A 1WSPA 1ZXIA 3APDA 3AU5A 1H7WA 2RPVA 4KZCA 2X38A 4C7ZA 4HWIB 2L1AA 1RYJA 5GMVA 3H1UA 1B1ZA 1YJIA 5HG2A 3BVGA 4L1BA 3VH4B 3AECB 2JU6X 2KX3A 1WJ6A 2DENB 2INCC 2LVQA 3QIJA 4KGSA 3ZGZA 2B76B 3DBRI 4RM8A 1XQQA 3AEGB 3LB8C 1HA5A 2BYFA 1GC7A 4LDTD 2CHWA 1NENB 1D5XC 2N1VA 4A3PA 4W9CA 3VRAB 3KLSX 4YSXB 4W9DA 2Y5BB 3C0RB 3L54A 1KLUD 4IW0A 3NUHB 2PKOA 1E5WA 2ON8A 5IO9A 3ZVVA 2M17A 1FCCC 4MSMB 2BWES 3QQ8B 4OW0A 3TEYA 2JWUA 1FXIA 1NBFC 3T3NA 3E9SA 5DPTA 2W3RA 4ZYNA 5FKAC 2KDIA 3EUB2 3Q8FA 1XLNA 3IXSA 4JL9A 1C1YB 5AZHA 5H92C 4AOFA 2KN5A 3P4PB 1OQYA 4K3CA 4JGHB 3CF6E 4MSQB 2JUOA 5C3JB 3DVGY 3LDZE 2NBUA 4PYZA 4ANXA 3MP9A 3UQAA 3N1XC 3MC0B 3VR9B 2XK5A 3TMPB 4BKSD 3Q3JA 3ZJUA 4GDKB 1WYWB 4NAWB 2D11A 2KNBA 5J2RA 2G3QB 2N0SB 3ZRFA 2MA9B 3BIID 3W2DA 2BYTA 4BBNF 2NTSA 1SXTA 4HKQA 2I2YA 1QILA 2IO3B 2W9NA 4ANUA 1XLQA 1FXAA 1MHXA 3OLMD 4NAMA 4WURA 3KWLA 2NPTB 4WQMA 3T8MA 1E90A 1TS5A 4GLSC 2IY1B 3A33B 2VRRB 3QC8B 3GE3C 2HJ8A 4BVUC 1NDDA 3NZ3A 3H6NA 3J9CA 2JRIB 3DOWA 3OJ4B 4ZRQA 4N58A 1S3SG 4W9GA 4S0RA 1UGJA 1GTHA 1F52A 2FCQA 3OG5A 1KM7A 2N7EA 4MGIE 3AN1A 3C8YA 2BB6A 4L2YA 1C4AA 5JH5C 3NZSA 3VUWA 3S2AA 5HKHA 2W54A 1P0RA 4DDID 1OFFA 4A90A 1PGXA 3NJTA 3AE4B 1BMLC 1C4PA 1WF9A 4W9KA 2UU7A 2WDRB 1WFYA 1SE4A 2CU1A 4XC2A 5E6NA 4LK0M 4GGQA 5AUKA 3ECIA 2M0AA 2KKCA 2C5LC 3DPDA 2DYBA 4EOYA 4BOSC 1FMAD 2WXHA 2LEKA 3TEXA 3VH3B 1V1PA 2CU3A 2K6DB 3UGBB 1T0SC 3H9DA 1J0GA 2ZCCA 5I4DA 2QIEB 2QCZA 3PLUA 3TIXA 2V4LA 1Q0WB 4N59A 4AJYB 4HJGE 3U52E 4DXFA 2AYOB 3H7PA 3DBLB 2YVCA 2OJRA 2C60A 3A9JA 3TJPA 2LXCA 5IOIA 4KZ0A 1V49A 1WR6E 2BKRB 4IC7B 4W9EA 3RFZB 2WHIA 3PTFC 3DWMA 2PEAA 1JW9D 3P4SB 4DHJB 4ARCA 2A4ZA 3CSFA 2KFKB 4K81A 2DX5B 5FK9C 5BYQA 4XGAB 3VVWB 2N7JA 4FHJA 4LJOB 3FAHA 4M00A 2BF8B 3HVZA 3HRDD 2N7DA 1SE3A 1TKEA 2J0JA 1H4RA 2L83A 2WU2B 3W9CB 1KJTA 2BS2B 3X0WA 4R3DA 4PT5A 2KVRA 4RGTA 2Y5PA 1LGRA 4YTNB 5DPWA 2ZVOA 2ICIA 2K39A 4MDKE 3Q69A 1J19A 1N62A 3W1YA 2DAFA 2DBYA 1SE2A 3SU8X 2L0TA 2QDFA 2MQJA 1TS4A 2MCNB 1MI0A 2LUMA 1AARA 2NCNA 1WGHA 1UBIA 2L32A 3RPFC 1N63A 4F1SA 3SHQA 1K50A 4DHZB 2IJ0A 2RDBC 3A1QA 5J18A 1SE9A 1SJHD 4RCOA 3GP7A 1Q1OA 1V1OA 4IWOA 3PZDA 3DCGA 2PTLA 4LTUA 3R2IA 2ZW1A 1YD8U 1H8CA 2K9XA 1J7AA 2NBVB 2VH2A 1RLFA 3NG0A 1KFYB 2L00B 3PGEA 3UQBA 1IUEA 3AE7B 4S17A 3TEWA 3APCA 2MBHA 3PVLA 3M62B 4C4VA 2GBMA 1UH6A 1ACCA 5CTRC 1J8CA 4FA6A 1E0ZA 1WX8A 3WALA 2NMQA 4YSYB 2R2OA 1VCBA 3RCZA 4BOZB 1WX9A 2O2VA 3VQIA 3RI7C 3V05A 1K51A 4ZHOA 1I7HA 3LXFA 5E6OA 1WJUA 1GG3A 4JQWC 2B3AA 5JXVA 1F77A 1F1HA 2KTRA 4F7ZA 1TTNA 3EFUA 5D3DA 4EZJA 2FCSA 2DHZA 4E3CA 2N9PC 3QARA 5BMHA 2WS3B 4F8CB 3ZNID 1TIFA 5JZEB 1T6BX 1OEYA 1XLOA 4RMAA 1WGGA 3AV8A 1UBQA 1P7FA 5LLIA 4MT5A 1SSNA 1VR9A 3RNGC 2DYMA 2AX5A 1UZXB 2FIDA 2PW9A 3N1ZC 5EE3A 2LGDA 1CMXB 4US8A 3MTNB 4N6EB 4BKGA 3K9OB 5JHBA 5C23A 1UELA 1R4MI 2BTEA 4AWJA 2KMAA 1CJEA 2G45B 1MPEA 1I4PA 1L4DB 1G6JA 4RH6A 3EC8A 2FE8A 4KSLC 4HPPA 4WH4A 4LLGM 3N9YC 1TBEA 4ZRKA 1QOFA 3NVWA 2HDEA 4EFOA 1WM3A 1EWYC 4XYCA 2NR2A 2DZMA 3DHIC 4A9AA 1BXTA 1YOVB 1FRDA 4JLCA 1OGWA 3P4RB 2L0FA 1WYGA 5G5HA 3WAOA 4XDCA 4YTPB 1CQVA 3NVZA 4MACA 2MBOA 1TS3A 1VDVA 2GBJA 4L23A 2V3SA 2JX5A 4IM3A 1WE6A 4FBJB 3AE2B 3QX1A 1HXYD 5KHOA 3AM9A 2JRHA 5EDSA 1KRHA 1J7BA 4LCDE 4DHJD 1WMHB 3U2SC 1V86A 2J52A 1JWMD 4W9LA 3B2GA 3A1QB 2LGIA 3BVMA 1I4XA 3L08A 4RM9A 4JE3B 1K53A 1VZ7A 3BYTB 3TCAA 4YT0B 1JWUD 4HRSA 5HI1A 1UWXA 1WXSA 4DK5A 5CHFA 2KZRA 3U8ZA 2KLCA 2SAKA 4MJSA 4FULA 2JZZA 4IOIE 4OZBA 4ITKA 4FJZA 5CHVC 3AE3B 4K1RB 1C79A 3PO0A 2CKHB 4USAA 1UNSA 1WX7A 1YQ4B 1ZPSA 1FNWA 5AUIA 2JXXA 4NJCA 5BMIA 4ZRJA 2K8BA 2JYEA 3TSSA 2XK5B 1FFVA 2PE6B 4MM3A 5EE1A 1KOTA 2MBBB 1EF5A 2BYEA 3DBLI 3ZW3A 4NPNA 3PRPB 5T8IA 3L10B 2NBWB 4WJPA 4GMVA 2BVCA 1MVKA 4KGRA 1X1MA 4NZLB 2LRUA 2V4IB 2W55A 2PE9A 3I5JC 5CX3A 2WX0A 3IFWB 4FJVB 4NQLB 4MGZE 4W9FA 2JZ3B 2HE7A 2LGXA 1GJZA 4HLEA 2BQQA 3TL5A 3VRBB 4PS8A 2L3ZA 3ZTDA 4C7YA 4UDUC 3V6EB 2JPHA 4H2AA 2FCNA 2C9WB 1ZDVA 3AXCA 4TMAB 2ONQA 4URKA 2MSED 1DGJA 1WGYA 1DYQA 3VFKA 3WANA 1L2NA 4GDLA 5DCNA 2LVOA 3MJ5A 4KV2A 2N4FA 3KUCB 2K5PA 5D3IB 1XO3A 1OEYJ 1YMHE 2IY0B 1YN4A 1TKYA 1WE7A 2EMSA 4EZKA 1V80A 3FC4A 4WAAA 2R2QA 5KHQA 2IGDA 1V9JA 3BY4B 3FILA 2KN4A 1KF6B 4KX6B 4KSKC 2ZPYA 3GZNB 2CHXA 2M1MA 4IWQA 4IM2A 1I35A 1P9DU 3M95A 3DHGC 2O6VB 4GIVA 3P42A 2WDQB 4NNJB 3U7ZA 2L8JA 3AEEB 4TSSA 4XWTA 2LWPA 1HZ6A 1XCQL 3CSTA 1FCLA 2PIAA 5IKCM 2YEPF 1WJ4A 1QOBA 3ZYYX 3WIMA 3DVNV 4HDQA 4P6VF 1T0RC 3OJ3A 2GOWA 1RFAA 3X23A 1GTEA 3UIPB 1L4ZB 2KWVB 2AWTA 4HPLB 4D2KA 4YSZB 1WGRA 1SJED 4AJWA 4M8NA 1ZE3D 1E6EB 2KVZA 3QAQA 2KFJA 4FXCA 3BK2A 1Y56A 3V60A 2DZKA 2KLGA 3BVZA 2WLBA 3UINB 4J6IA 4MH8A 1ESFA 5G2NA 5IP4D 2D3BA 4OZAA 2IO0B 2PMVA 3MHZA 4NY0A 2GBRA 3A9KB 2J53A 3PHXB 3I63C 2L7RA 4HROA 2FBWB 2M56B 1Y8RC 4JIOU 1ZW7A 3EFCA 4REZA 1NYQA 4RGMA 1YN5A 1HTOA 2I1JA 3ZNHB 1V8CA 1E8XA 3DBRB 3DQVA 1KLVA 1PFDA 2BGFA 3VR8B 4ZOHC 4WJQA 2N9EB 1OTRB 1N5WA 1XT9B 3EHVA 4MH0E 2N9KA 3KYDD 1WIAA 2KTFA 1ZDXA 1HTQA 1Z2MA 1TY2A 3IBEA 2J0MA 1N5XA 2C7NB 1EF1A 2D3CA 2RDGA 4I6PA 1OQQA 4HCPB 3PV1A 2L76A 5EE0A 1YJ1A 3A9JB 3ZJTA 2WDVB 1WXVA 4DHZE 3APFA 1XCTL 3MFGA 1R4MB 3DVGX 1IP9A 2MBQA 3PSEB 2MRPA 3ZJVA 1E7VA 3SDLC 1QLBB 4KGTA 2SEBD 2GBNA 5JHAA 1VZ6A 2RGFA 3AE5B 2UWQA 1JMLA 1RWSA 2ZEQA 1WZ0A 1KH0A 3DDCB 4XE0A 2Z8LA 2V9HA 4RF1A 1PUTA 3AEBB 1V5OA 4BZAA 5LXHA 4JWUC 1GB1A 3HK0A 4HVBA 3I57A 4MGKE 3T9LA 3U7DA 5D6JB 4AQ7A 4DXGA 2MX2A 2DWQA 2GLSA 4YL8A 1WJNA 2PVOD 1Q10A 3HUIA 3RUIB 5IA7A 2MHJA 3VDZA 1LM8B 2BPSA 4GU2A 4I6NB 4ZHPA 3B9JA 5BYSA 2KC2A 3PS6A 3RULA 2LASA 1C3TA 2OJWA 1S1QB 1V97A 3AULA 4QAYA 4WJNA 3SFDB 1I4GA 1JROA 1GB4A 2WXJA 2DYOA 3VTWA 2V1YA 2IO1B 2WWZA 3KUZA 3BYYB 1FNUA 1L0XB 1WWTA 2NS5A 4B9KA 2MJ3A 2I1KA 4A3OA 1AWDA 3L0WB 3R8BA 2G9HD 1EU3A 3ONSA 2RD0A 4GSWA 3FILB 3DVNU 4C00A 2FIFA 3P2BA 2INDC 2Y3AA 4RFBA 1MG4A 4LNFA 4ZDVA 4B0EA 2INNE 4WWOA 5D7GA 2K3UA 3MHSD 3BWUD 3B1LX 1J7CA 1HEZE 3PLVA 3Q3OC 3L16A 2YLMA 2LHEA 4AUQC 1BUIC 4N9F4 1QF6A 1V6EA 4OVVA 3UIOB 2D10A 3IHPC 4WWNA 2JF5A 1CZPA 1QKZA 3ZLZA 3KH0A 3K9PB 1NYRA 2K8HA 3V6CB 3KYCD 2WX1A 4CQNA 1FXTB 3A4SC 4NAWA 2MWSB 2K6QA 3U30A 1GT8A 3U4EG 3DBSA 4LNIA 2C7MB 1JRUA 2REXA 4M01A 2KYWA 2HTHA 5BO4B 1ZOYB 2Z59B 3HHMA 1U4AA 5H8YE 4ANWA 2BW2A 4K7WA 2LGSA 1V1PB 2AEHA 2ZVNA 3ZUNA 3T3OA 1KTKA 3NVYA 3VUXA 4C80A 2L52A 1FRRA 5HFYA 4J3OD 1WRDB 2R61A 2BS4B 4WQOB 1R4NB 2MP2A 3QA8A 2KTRB 1YIWA 2XN9C 3ZDTA 1EUVB 3NHEB 3W5VB 4WAFA 2K22A 4HPMB 2KMCA 1GAQB 3JYUA 4HDOA 3D32A 2E6XA 2AL6A 2CR5A 3A9KA 1TS2A 4XZ4A 2K1FA 4JX1C 2MH7A 3TBLD 5AZGA 2D3GA 4YXDB 1XF5L 3RZFA 2H89B 1WGKA 3I9V1 2L05A 4P1BC 2RPQA 4K7UA 1VRAB 1F2RI 1QOGA 1TZOA 3M63B 3L4PA 3N3KB 1GNUA 2KQ4X 1L0VB 2BBCA 2IDYA 1QOAA 1AYFA 1XXGA 3EGRA 5E6PA 4K7SA 4NJ7A 1RFKA 5FR3A 2WU5B 1EO6A 4TQ0A 3MJWA 2D07B 5DPRA 1F2RC 4CHKA 5BYRA 3CMMB 3B08A 3SD5A 4EUTA 1I4RA 4ARIA 2KJ6A 2WYQA 5TR5A 2YEPB 1SF0A 1FPYA 2QMTA 2JVCA 4RGNA 1ZGUB 1FM0D 1FO4A 2NTTA 2V3NA 3ENEA 3CWIA 4AS1A 1P98A 2KC1A 4BKSA 3WCQA 2OEDA 3M3JA 2KXJA 3E56A 2MBEA 1VLBA 4X57B 5TSSA 3LYYA 1UGMA 2NVUI 3EA6A 4GXBA 1IYFA 3RYTA 1WGDA 3ZQ4A 3ABVB 2D5GA 2VZKD 3HM6X 4E74A 3RT3B 3KUDB 4RF0A 5E6JA 1E9MA 3RNFC 1SEBD 1WXMA 4FLHA 3KVFB 2DZIA 3OWEB 1SGHA 2WXOA 3Q8CA 1F9JA 1TJEA 4CO7A 2KWUB 3PZ8A 1T0QC 2ZW0A 1ENFA 3AU4A
chains in the Genus database with same CATH topology
5BYQA 1C76A 4FXCA 3BK2A 3PZ7A 2N7JA 1Y56A 3R2TA 1LO5D 2WQYB 3BVZA 2WLBA 1D4BA 3FAHA 4MH8A 1ESFA 1FNVA 1XLPA 4OZAA 3HVZA 5HHDG 3HRDD 1L5PA 1T3QA 3AEDB 1SE3A 2PMVA 3H8HA 3MHZA 1STEA 1TKEA 1PDXA 2J53A 3NS1A 3AMZA 2J4XA 2L83A 2WU2B 3W9CB 1D5MC 2BS2B 4HROA 5BMGA 2FBWB 2M56B 4MM3B 1GOZA 4R3DA 1ET9A 4PT5A 4RGTA 4REZA 1NYQA 1PGBA 4RGMA 3SR6A 2Y5PA 1H7XA 2MJEA 4YTNB 1FEHA 1ROEA 1YN5A 4US9A 1YJJA 2WXIA 3IAM1 3KQ4A 2ICIA 1V8CA 1EM7A 1SBBB 3B2FA 3Q69A 2WXFA 2XNAC 2WXGA 1P7EA 1B9RA 4A8XC 1PFDA 1N62A 3VR8B 2LJIA 2WXLA 2DBYA 4JPSA 4ZOHC 1SE2A 4HEA1 1TS4A 1MI0A 2LUMA 1N5WA 2L32A 3RPFC 2JSVX 2BB5A 1NEKB 3SFEB 1N63A 2N9KA 4O1NA 3V3XA 1K50A 1ZDXA 2IJ0A 1VZ8A 2INPE 2KMMA 1I4QA 4P16A 1EU4A 4ZRPA 1SJHD 3AE6B 3IT6B 4RCOA 1TY2A 3GP7A 2K0PA 4A55A 3O13A 3NVVA 1V1OA 1FD6A 4OZCA 4GDLB 1N5XA 2RDGA 1OQQA 2PTLA 4LTUA 3R2IA 5EE0A 3ETRA 1IBXB 1AN8A 3ZJTA 2WDVB 1IGCA 1TY0A 2IGGA 2ZW1A 3TUOA 3AB5A 2K9XA 1J7AA 1XCTL 1SIJA 3MFGA 1N61A 1KFYB 2WNMA 2G1EA 2FUG1 4B0MA 4DQOC 1IUEA 1I4HA 3AE7B 2JYTA 3TEWA 3AE9B 3ZJVA 2MEKA 2EELA 1QLBB 4KGTA 1ZXHA 1ACCA 3AH7A 3DWGC 2SEBD 2AQ3B 4TQ1A 1E0ZA 1VZ6A 3AE5B 5G5GA 2NMQA 4YSYB 2J42A 1JMLA 1RWSA 5GXGB 3CIRB 1KH0A 1SB3C 1JCKB 3VQIA 2JXTA 3V05A 4XE0A 4RNAA 1K51A 2JQRB 2Z8LA 4ZHOA 1I7HA 2LMCA 2EKIA 3LXFA 1WXQA 2PLPA 2LHDA 1C4CA 4RF1A 2IGHA 1PUTA 1N60A 3AEBB 3URYA 5JXVA 1E10A 1QQRA 1F77A 4JWUC 1GB1A 4EE2A 1UUPA 3I57A 2WXPA 5D3DA 2QEJC 2KAJA 1IGDA 4C56C 1JQ4A 1DOXA 1YQ3B 2AQ2B 5BMHA 2WS3B 1L0YB 1C9FA 4IDIA 1D6EC 4AQ7A 4DXGA 1YN3A 4KKIA 2DWQA 2RDHA 1T6BX 1E7PB 3AE8B 1A70A 1XLOA 2WXQA 3GB1A 2PVOD 1Q10A 3AV8A 3GS2A 3HUIA 2KWDA 1P7FA 3KWVA 2RMMA 4MT5A 1IBXA 1SSNA 1OQRA 1T5XD 1UWMA 3UI3A 1VR9A 4ZHPA 3B9JA 5BYSA 2DYMA 2AX5A 2PW9A 2BT6A 1EWCA 4WIPA 3W5UB 3BZDB 1V97A 5EE3A 3SFDB 3Q8BA 1I4GA 4US8A 1JROA 1TKGA 4N6EB 1GB4A 4KKJA 2WXNA 2BTEA 2AQ1B 2WXJA 1PGAA 1WSPA 2DYOA 3Q8EA 1ZXIA 1CJEA 2V3PA 1H7WA 2RPVA 2M19A 1C78A 1GPXA 2X38A 3BYYB 1MPEA 2PVGC 1FNUA 1I4PA 1L0XB 1L4DB 1WWTA 4C7ZA 2L1AA 1RYJA 2MJ3A 4OHJA 4RH6A 1B1ZA 1AWDA 1YJIA 3P4QB 5HG2A 3BVGA 1ET6A 3R8BA 2G9HD 1EU3A 2FE8A 4WWMA 4L1BA 3AECB 1RM6C 2JU6X 2QSDA 1VJKA 4WH4A 3Q8AA 4KGSA 3FILB 4LLGM 1DOIA 2KACA 3N9YC 3ZGZA 2B76B 1C77A 2OHFA 1QOFA 4IKGA 3AEGB 2Y3AA 3NVWA 2HDEA 4XWWA 4RFBA 3LB8C 1HA5A 1EWYC 2INNE 4B0EA 5D7GA 1JRPA 2K3UA 2Q5WD 2CJNA 3BWUD 1J7CA 1HEZE 4A9AA 1BXTA 3TEZA 2LHEA 1FRDA 1NENB 1BUIC 1D5XC 3P4RB 1WYGA 5G5HA 1QF6A 3VRAB 4XDCA 4YTPB 1CQVA 4YSXB 2W3SA 3KLSX 3NVZA 1CZPA 4MACA 1TS3A 1VDVA 1QKZA 4L23A 2W82A 1NYRA 1KLUD 2JX5A 3IAS1 2CJOA 3NUHB 2PKOA 3BK1A 3AE2B 1NVID 1HXYD 4CQNA 2ON8A 3AM9A 1FCCC 4OW0A 3TEYA 1QT9A 1MHHE 2JWUA 1KRHA 1FXIA 1GT8A 3U4EG 4OVZA 3T3NA 2GI9A 3E9SA 2W3RA 2H88B 5FKAC 1J7BA 3EUB2 3CF4A 1F0ZA 3Q8FA 1XLNA 1JWAD 3U2SC 1CK1A 3IXSA 1K52A 2J52A 2TSSA 2WP9B 1JWMD 2JZPA 1ZOYB 3B2GA 1PYWD 2LGIA 3BVMA 1I4XA 5H8YE 3P63A 1L6VA 2BW2A 5H92C 3P1MA 2VZKB 4JE3B 1V1PB 3AE1B 4A6QA 3T3OA 3HVDA 3P4PB 1FIQA 1K53A 1KTKA 1VZ7A 3BYTB 3NVYA 4YT0B 1JWUD 4C80A 4HRSA 5HI1A 2L52A 1FRRA 1UWXA 5C3JB 4RGOS 5HFYA 5EE9A 3MP9A 4J3OD 3MC0B 3VR9B 2R61A 2SAKA 3ZJUA 2BS4B 4GDKB 1D5ZC 2IPKD 4IOIE 4NAWB 1JALA 1KLGD 4OZBA 4ITKA 2DLBA 2N0SB 4HKZE 3AE3B 5MPOA 1C79A 2Y5CA 1M4VA 2XN9C 3PO0A 2HTME 5LNK1 2V0GA 3BIID 3W2DA 4USAA 2BYTA 1HQRD 1UNSA 3W5VB 2NTSA 4WAFA 1YQ4B 1SXTA 1ZPSA 2K22A 4HKQA 1FNWA 5AUIA 1QILA 1GAQB 2I2YA 2WXRA 4NJCA 2E6XA 5BMIA 1YNTE 1TS2A 2JYEA 3TSSA 1ZUD2 4JX1C 2MH7A 1XLQA 1FXAA 1MHXA 4YXDB 2WXMA 4XDDA 1FFVA 1XF5L 4NAMA 4WURA 5EE1A 3KWLA 5C2TB 2H89B 1WGKA 3I9V1 4WQMA 5T8IA 2LFIA 1TS5A 1VRAB 4GLSC 1F2RI 1QOGA 1TZOA 1MVKA 3L4PA 4KGRA 4NZLB 2KQ4X 2V4IB 2W55A 1AW7A 1L0VB 2BBCA 2IDYA 1QOAA 1AYFA 1XXGA 3EGRA 3NZ3A 3J9CA 3VRBB 4ZRQA 4N58A 4C7YA 4UDUC 1RFKA 1UGJA 5FR3A 3NRZA 1HZ5A 2MJDA 2WU5B 4TQ0A 4H2AA 1GTHA 1F2RC 5BYRA 1ZDVA 4TMAB 2N9LA 3AN1A 3C8YA 2BB6A 2ONQA 4L2YA 1C4AA 1I4RA 1DGJA 4ZYSA 4ARIA 1DYQA 2W54A 3MJ5A 2ACZB 1OFFA 4A90A 2YEPB 1ZP0B 1SF0A 2GRIA 2QMTA 1PGXA 2K5PA 5D3IB 1XO3A 4YWGG 3AE4B 1BMLC 1C4PA 4RGNA 1YMHE 1JWBD 1YN4A 1R7SA 1TKYA 2WDRB 1FM0D 2I38A 2E3TA 2QJLA 1FO4A 1WRIA 1SE4A 2NTTA 2V3NA 3FC4A 4LK0M 2IGDA 3CWIA 5AUKA 3SEBA 2M0AA 4AS1A 2WXKA 3FILA 2KN4A 1KF6B 4KX6B 4M0WA 3AEFB 3WCQA 1FMAD 2WXHA 2KDMA 2LEKA 2OEDA 3TEXA 3E56A 1DOYA 1V1PA 2CU3A 1TYGB 1VLBA 3AEAB 2GB1A 3IT4B 3P42A 5TSSA 2WDQB 3U7ZA 3LYYA 3EA6A 5I4DA 4JWSC 3AEEB 2QIEB 4TSSA 2BS3B 4N59A 4XWTA 3ZQ4A 4HJGE 3ABVB 3U52E 1HZ6A 1XCQL 2D5GA 2VZKD 4DXFA 1FCLA 1JWSD 2PIAA 4RF0A 5E6JA 1E9MA 1SEBD 2YEPF 4Q2JA 1XEEA 1QOBA 3OWEB 3ZYYX 1NI3A 2WXOA 3Q8CA 4P6VF 3W1SA 4YTMB 3RFZB 1TJEA 3DWMA 1GTEA 1L4ZB 3PZ8A 1L6UA 4D2KA 1JW9D 4YSZB 3P4SB 2QILA 1SJED 2ZW0A 4ARCA 1FFUA 1ENFA 1ZE3D 1E6EB 5FK9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWS A;  5GXG B;  4FXC A;  1J7C A;  3CIR B;  4A9A A;  1QOG A;  1SB3 C;  2WQY B;  1FRD A;  1NEN B;  3L4P A;  2WLB A;  3FAH A;  5G5G A;  3P4R B;  2W55 A;  1WYG A;  5G5H A;  1XLP A;  2JQR B;  4ZHO A;  1QF6 A;  3VRA B;  1I7H A;  3HVZ A;  4YTP B;  2EKI A;  4YSX B;  2W3S A;  3LXF A;  1L0V B;  1WXQ A;  3NVZ A;  3HRD D;  1CZP A;  1VDV A;  1L5P A;  1AYF A;  3AED B;  1QOA A;  1T3Q A;  1PUT A;  1N60 A;  3AEB B;  1TKE A;  1NYR A;  1PDX A;  2JX5 A;  3NS1 A;  1E10 A;  2CJO A;  3AMZ A;  3VRB B;  4JWU C;  2PKO A;  4WQM A;  2L83 A;  2WU2 B;  3AE2 B;  4N58 A;  3W9C B;  1NVI D;  4C7Y A;  3AM9 A;  2BS2 B;  1RFK A;  4HRO A;  2KAJ A;  3NRZ A;  2FBW B;  2M56 B;  2WU5 B;  2MJD A;  1DOX A;  1JQ4 A;  1YQ3 B;  3SR6 A;  1NYQ A;  1GTH A;  2WS3 B;  1QT9 A;  1H7X A;  1KRH A;  4YTN B;  1FXI A;  2MJE A;  4IDI A;  1ROE A;  1GT8 A;  3AN1 A;  2DWQ A;  4US9 A;  1YJJ A;  1DGJ A;  2W3R A;  1E7P B;  3AE8 B;  1A70 A;  1XLO A;  2H88 B;  1V8C A;  3B2F A;  1J7B A;  2PVO D;  2W54 A;  3EUB 2;  3CF4 A;  3AV8 A;  2ACZ B;  3HUI A;  1B9R A;  1F0Z A;  1OFF A;  1PFD A;  1XLN A;  1JWA D;  1ZP0 B;  1SF0 A;  1N62 A;  3VR8 B;  2K5P A;  1XO3 A;  3AE4 B;  2DBY A;  4ZOH C;  1OQR A;  2WP9 B;  1JWB D;  3B2G A;  1ZOY B;  1R7S A;  1TKY A;  2WDR B;  1FM0 D;  1UWM A;  2E3T A;  2QJL A;  4ZHP A;  3B9J A;  1WRI A;  1FO4 A;  3FC4 A;  3P63 A;  5H8Y E;  1L6V A;  1N5W A;  2AX5 A;  3CWI A;  3P1M A;  5H92 C;  5AUK A;  2Q5W D;  3RPF C;  2BT6 A;  1NEK B;  3SFE B;  3AE1 B;  1N63 A;  3W5U B;  2CJN A;  3P4P B;  1FIQ A;  1V97 A;  5EE3 A;  3SFD B;  3NVY A;  4US8 A;  1KF6 B;  4YT0 B;  4KX6 B;  1JRO A;  1TKG A;  2KMM A;  4HRS A;  4N6E B;  3AEF B;  2L52 A;  1FRR A;  3WCQ A;  5C3J B;  1FMA D;  5EE9 A;  2LEK A;  3AE6 B;  1DOY A;  2CU3 A;  1TYG B;  3VR9 B;  3NVV A;  1VLB A;  1ZXI A;  3AEA B;  1CJE A;  2BS4 B;  1N5X A;  2WDQ B;  1H7W A;  1OQQ A;  1JAL A;  3AEE B;  2M19 A;  2QIE B;  4JWS C;  4LTU A;  1GPX A;  2BS3 B;  4N59 A;  4ITK A;  2PVG C;  5EE0 A;  1WWT A;  3ETR A;  4C7Z A;  2N0S B;  3ABV B;  1RYJ A;  2MJ3 A;  3AE3 B;  5MPO A;  2WDV B;  2Y5C A;  3PO0 A;  1AWD A;  2HTM E;  2PIA A;  3BII D;  4C80 A;  4USA A;  1E9M A;  3P4Q B;  1YJI A;  3AB5 A;  3W5V B;  2K9X A;  1J7A A;  1QOB A;  1SIJ A;  1YQ4 B;  1N61 A;  1KFY B;  2K22 A;  4WWM A;  3ZYY X;  2G1E A;  5AUI A;  1GAQ B;  3AEC B;  1NI3 A;  1RM6 C;  4P6V F;  1VJK A;  1IUE A;  3AE7 B;  4YTM B;  1TJE A;  1ZUD 2;  3DWM A;  1GTE A;  3AE9 B;  1DOI A;  4JX1 C;  2B76 B;  1XLQ A;  2MH7 A;  1FXA A;  1QLB B;  2OHF A;  4YXD B;  1QOF A;  3DWG C;  1FFV A;  1L6U A;  3AH7 A;  1JW9 D;  4YSZ B;  3AEG B;  3P4S B;  3NVW A;  5EE1 A;  1E0Z A;  3LB8 C;  1FFU A;  1EWY C;  3KWL A;  3AE5 B;  1E6E B;  5C2T B;  1JRP A;  4YSY B;  2H89 B;  1WGK A; 
#chains in the Genus database with same CATH topology
 4A20 A;  1LO5 D;  2WQY B;  2N9X A;  4PS7 A;  5AZF A;  4KDL B;  1FNV A;  1XLP A;  3PHW B;  2D2Q A;  1LFD A;  3AED B;  3H8H A;  4MEL A;  4B6W A;  3DBH B;  3Q2A C;  2A5U A;  1ET9 A;  3SR6 A;  2XEW A;  4FAD A;  2ZCB A;  1H7X A;  3V61 A;  4US9 A;  1YJJ A;  2WXI A;  1V2Y A;  3Q3M C;  1EM7 A;  3B2F A;  2WGS A;  2XNA C;  2WXG A;  1P7E A;  1B9R A;  2QHO A;  3KW5 B;  3UF8 A;  4JPS A;  4HEA 1;  2MP2 B;  2BB5 A;  3SFE B;  3V3X A;  3ZNG C;  1L7Y A;  2INP E;  1VZ8 A;  4LNK A;  4P16 A;  4ZRP A;  3ALB A;  3AE6 B;  3IT6 B;  2ZNV B;  2ZNV C;  3O13 A;  1FD6 A;  2JT4 B;  4XX5 A;  4IG7 B;  2LXA A;  2RSU A;  3ETR A;  1IBX B;  1AN8 A;  3Q6B A;  1IGC A;  1TY0 A;  2IGG A;  4TUU A;  3VTV A;  3AB5 A;  1N61 A;  2WNM A;  4CYE A;  5D94 A;  2G1E A;  2FUG 1;  4B0M A;  3LJ3 A;  4DQO C;  4BAX A;  1WXA A;  1I4H A;  2EEL A;  2KT7 A;  1ZXH A;  3DWG C;  2AQ3 B;  4KIK A;  2D3A A;  2KO3 A;  1N6Z A;  3CIR B;  2Z0E B;  4M02 A;  4PK1 A;  2JXT A;  3MC9 A;  4LDT B;  4RNA A;  2LMC A;  2EKI A;  2JY6 A;  1WXQ A;  2PLP A;  4BFR A;  1TGZ B;  2IGH A;  1N60 A;  3L13 A;  1V81 A;  2MLB A;  2KAJ A;  3VTU A;  2LGY A;  4C56 C;  2AQ2 B;  4AP4 C;  1Q5W B;  4IDI A;  3RNC C;  3IG3 A;  1D6E C;  1YN3 A;  4KKI A;  2RDH A;  1E7P B;  2HJ1 A;  2WXQ A;  4GN1 A;  2KWD A;  1E8Y A;  2RMM A;  3KWV A;  2KAN A;  5CHW A;  1E8W A;  2KJR A;  3UI3 A;  1PQS A;  1WMH A;  3RNE C;  1RAX A;  1P1A A;  4NQK E;  2BT6 A;  2DZJ A;  3C19 A;  4WIP A;  3VUY A;  5AEK B;  1TKG A;  2RR9 A;  1GC6 A;  2WXN A;  3QWZ B;  3R7Q A;  2KQS A;  2AQ1 B;  3OAW A;  1PGA A;  3Q8E A;  1WR1 A;  3O65 B;  4M8M A;  2V3P A;  2PJH A;  3EEC A;  2M19 A;  1C78 A;  1GPX A;  2PVG C;  3HM3 A;  4OHJ A;  4MEM A;  3P4Q B;  3B0A A;  1ET6 A;  3R66 C;  4WWM A;  1RM6 C;  2QSD A;  1VJK A;  5G55 A;  3H7S A;  3Q8A A;  4GOC A;  2KWC A;  1DOI A;  2KAC A;  1C77 A;  2OHF A;  4IKG A;  4XWW A;  3FKY A;  1JRP A;  2Q5W D;  2CJN A;  2DAJ A;  3QHT A;  1M94 A;  3TEZ A;  1RRB A;  2LUE A;  1A5R A;  2W3S A;  3BIN A;  2W82 A;  3IAS 1;  2CJO A;  1WH3 A;  3BK1 A;  4PS3 A;  1NVI D;  2CHZ A;  4ASW C;  1QT9 A;  1MHH E;  1ZKH A;  4OVZ A;  4HCN B;  2GI9 A;  3N32 A;  2H88 B;  3ZKJ C;  3CF4 A;  4ICU A;  1F0Z A;  1JWA D;  1CK1 A;  3JW0 X;  1K52 A;  1YX6 B;  2TSS A;  2WP9 B;  2JZP A;  5D2M B;  2NPT A;  4ZRI A;  1PYW D;  3RNA C;  3P63 A;  1L6V A;  4DDG D;  3P1M A;  2VZK B;  4KDI C;  3ZRC A;  3AE1 B;  4A6Q A;  3I3T B;  3HVD A;  1FIQ A;  3NZU A;  2IBI B;  4RGO S;  5EE9 A;  1YX5 B;  4NJ6 A;  2LJ5 A;  1D5Z C;  2IPK D;  1JAL A;  1KLG D;  3RNB C;  2DLB A;  2EKE C;  4G11 A;  2O2V B;  4HKZ E;  4G50 A;  5MPO A;  2Y5C A;  1M4V A;  1MG8 A;  2KHW B;  2HTM E;  5LNK 1;  2V0G A;  1D3Z A;  1HQR D;  2QC8 A;  5FR6 A;  2WXR A;  4B95 A;  2K8C A;  4M0W B;  1YNT E;  3WAM A;  3N1Y C;  1ZUD 2;  1XD3 B;  1WM2 A;  3RN9 C;  2WXM A;  4XDD A;  1E8Z A;  5J17 A;  4DBG A;  2M0X A;  4C4V B;  5C2T B;  4IWP A;  2X8X X;  4IUM B;  2LFI A;  4K3B A;  1BT0 A;  2KDE B;  5DPS A;  3QJZ A;  1I42 A;  3QCA A;  1GUA B;  2KFK A;  2KDB A;  1AW7 A;  3NOB A;  3GZN I;  2GMI C;  4LJP B;  5IAA C;  3ZNZ B;  5L95 C;  3MC8 A;  3QK0 A;  2ASQ A;  1MJD A;  4BKT A;  5L83 A;  2KOX A;  2M8S A;  1ISN A;  1NI2 A;  2BYV E;  2J7Q B;  3HIZ A;  4DWF A;  3NRZ A;  1HZ5 A;  2MJD A;  4IM0 A;  3RZW C;  2ZPN A;  2N9L A;  3R7R A;  1MFW A;  1LQB A;  2UYZ B;  4ZYS A;  4ACF A;  4LNO A;  3Q3N C;  3DBH I;  2ACZ B;  3ZXR A;  1ZP0 B;  2GRI A;  4YWG G;  4P1C C;  4FJY A;  3IVF A;  1JWB D;  2QJL A;  1R7S A;  2I38 A;  2E3T A;  2HD5 B;  1WRI A;  1LXD A;  3PT2 B;  3ML9 A;  3SEB A;  3ZIM A;  1T0Y A;  2WXK A;  3RD2 A;  2BWF A;  2O6V A;  4M0W A;  3AEF B;  2N1W A;  2KDM A;  2XBB C;  1DOY A;  1TYG B;  3AEA B;  2GB1 A;  3IT4 B;  4JWS C;  2BKF A;  4EEW A;  2BS3 B;  4HK2 A;  4LNN A;  1P3Q U;  1JWS D;  4Q2J A;  3PRM B;  3ML8 A;  1XEE A;  4E71 A;  4I6L B;  3JSV A;  2ZZP B;  3R3M A;  2IZV B;  1NI3 A;  3W1S A;  1V5T A;  4YTM B;  2LVP A;  1WY8 A;  3WAP A;  3Q3F A;  1L6U A;  1Z5S B;  1VD2 A;  3N20 C;  3ZDM C;  2QIL A;  3A4R A;  4ICV A;  1FFU A;  1WI0 A;  5C1Z A;  1C76 A;  3PZ7 A;  3PPA A;  2KD0 A;  4TV3 A;  3R2T A;  3VAW A;  3ZO5 B;  1D4B A;  3GOE A;  4G3X B;  5HHD G;  2CS4 A;  2MW5 A;  2AL3 A;  1L5P A;  1T3Q A;  1STE A;  4P7I A;  4W9H A;  1PDX A;  4II3 B;  3NS1 A;  2IYD B;  3AMZ A;  4HXD A;  2J0K A;  2KX0 A;  2J4X A;  1K8R B;  1D5M C;  3AI5 A;  3N30 A;  1R4N I;  5BMG A;  4MM3 B;  1GOZ A;  4DXA B;  1PGB A;  2MJE A;  1FEH A;  1ROE A;  2K25 A;  4EKU A;  3IAM 1;  3KQ4 A;  1SBB B;  2WXF A;  4A8X C;  2LJI A;  2WXL A;  1SIF A;  1WZ3 A;  2WDT B;  3H7P B;  1UD7 A;  2KK8 A;  3GE8 C;  2JSV X;  1NEK B;  2JWZ A;  5LXI B;  4GB9 A;  4O1N A;  4MJS B;  2LD9 A;  2KMM A;  3NS8 A;  3NY5 A;  2DNF A;  1I4Q A;  1EU4 A;  2OOB B;  4WWP A;  1TZ1 A;  2K0P A;  4A55 A;  3NVV A;  4OZC A;  4GDL B;  4FHK A;  4TKN A;  2G4S A;  1UF0 A;  4II2 B;  2EMT A;  2KDF B;  3TUO A;  2FCM A;  4W9I A;  1E7U A;  1QZE A;  1SIJ A;  2IO2 B;  2KJH B;  4KVG B;  2FUH B;  2C7H A;  2JYT A;  3AE9 B;  2MEK A;  4OVU A;  3PRZ A;  3ZXV A;  3AH7 A;  3DHH C;  4TQ1 A;  3L17 A;  1HE8 A;  4EZL A;  5G5G A;  2J42 A;  5GXG B;  4W9J A;  2M4N A;  1SB3 C;  1JCK B;  3WA0 A;  2ZJD A;  2JQR B;  4BBN C;  4GDK A;  2O6V D;  2FNJ B;  2LHD A;  4HJK A;  3JVZ X;  1C4C A;  1IPG A;  3Q14 C;  4MGY E;  3URY A;  1E10 A;  1QQR A;  2FAZ A;  4FN2 A;  3PRE A;  4KIK B;  2Z0D B;  4EE2 A;  1UUP A;  2WXP A;  2QEJ C;  1IGD A;  1JQ4 A;  1DOX A;  1YQ3 B;  1L0Y B;  1C9F A;  1TT5 B;  4ANV A;  5IN7 A;  3JSV B;  3W1S C;  3AE8 B;  1A70 A;  3GB1 A;  1YQB A;  3GS2 A;  3VHT C;  2VH1 A;  2KQ7 A;  2G4D B;  4G0N B;  1IBX A;  1T5X D;  1OQR A;  2PPH A;  3RMK C;  1UWM A;  2LRW A;  3V62 A;  1EWC A;  3W5U B;  3BZD B;  3Q8B A;  3VXW A;  2LI5 A;  4PYU A;  4WJO A;  3ZTC A;  2GBK A;  4KKJ A;  2LZ6 A;  1WSP A;  1ZXI A;  3APD A;  3AU5 A;  1H7W A;  2RPV A;  4KZC A;  2X38 A;  4C7Z A;  4HWI B;  2L1A A;  1RYJ A;  5GMV A;  3H1U A;  1B1Z A;  1YJI A;  5HG2 A;  3BVG A;  4L1B A;  3VH4 B;  3AEC B;  2JU6 X;  2KX3 A;  1WJ6 A;  2DEN B;  2INC C;  2LVQ A;  3QIJ A;  4KGS A;  3ZGZ A;  2B76 B;  3DBR I;  4RM8 A;  1XQQ A;  3AEG B;  3LB8 C;  1HA5 A;  2BYF A;  1GC7 A;  4LDT D;  2CHW A;  1NEN B;  1D5X C;  2N1V A;  4A3P A;  4W9C A;  3VRA B;  3KLS X;  4YSX B;  4W9D A;  2Y5B B;  3C0R B;  3L54 A;  1KLU D;  4IW0 A;  3NUH B;  2PKO A;  1E5W A;  2ON8 A;  5IO9 A;  3ZVV A;  2M17 A;  1FCC C;  4MSM B;  2BWE S;  3QQ8 B;  4OW0 A;  3TEY A;  2JWU A;  1FXI A;  1NBF C;  3T3N A;  3E9S A;  5DPT A;  2W3R A;  4ZYN A;  5FKA C;  2KDI A;  3EUB 2;  3Q8F A;  1XLN A;  3IXS A;  4JL9 A;  1C1Y B;  5AZH A;  5H92 C;  4AOF A;  2KN5 A;  3P4P B;  1OQY A;  4K3C A;  4JGH B;  3CF6 E;  4MSQ B;  2JUO A;  5C3J B;  3DVG Y;  3LDZ E;  2NBU A;  4PYZ A;  4ANX A;  3MP9 A;  3UQA A;  3N1X C;  3MC0 B;  3VR9 B;  2XK5 A;  3TMP B;  4BKS D;  3Q3J A;  3ZJU A;  4GDK B;  1WYW B;  4NAW B;  2D11 A;  2KNB A;  5J2R A;  2G3Q B;  2N0S B;  3ZRF A;  2MA9 B;  3BII D;  3W2D A;  2BYT A;  4BBN F;  2NTS A;  1SXT A;  4HKQ A;  2I2Y A;  1QIL A;  2IO3 B;  2W9N A;  4ANU A;  1XLQ A;  1FXA A;  1MHX A;  3OLM D;  4NAM A;  4WUR A;  3KWL A;  2NPT B;  4WQM A;  3T8M A;  1E90 A;  1TS5 A;  4GLS C;  2IY1 B;  3A33 B;  2VRR B;  3QC8 B;  3GE3 C;  2HJ8 A;  4BVU C;  1NDD A;  3NZ3 A;  3H6N A;  3J9C A;  2JRI B;  3DOW A;  3OJ4 B;  4ZRQ A;  4N58 A;  1S3S G;  4W9G A;  4S0R A;  1UGJ A;  1GTH A;  1F52 A;  2FCQ A;  3OG5 A;  1KM7 A;  2N7E A;  4MGI E;  3AN1 A;  3C8Y A;  2BB6 A;  4L2Y A;  1C4A A;  5JH5 C;  3NZS A;  3VUW A;  3S2A A;  5HKH A;  2W54 A;  1P0R A;  4DDI D;  1OFF A;  4A90 A;  1PGX A;  3NJT A;  3AE4 B;  1BML C;  1C4P A;  1WF9 A;  4W9K A;  2UU7 A;  2WDR B;  1WFY A;  1SE4 A;  2CU1 A;  4XC2 A;  5E6N A;  4LK0 M;  4GGQ A;  5AUK A;  3ECI A;  2M0A A;  2KKC A;  2C5L C;  3DPD A;  2DYB A;  4EOY A;  4BOS C;  1FMA D;  2WXH A;  2LEK A;  3TEX A;  3VH3 B;  1V1P A;  2CU3 A;  2K6D B;  3UGB B;  1T0S C;  3H9D A;  1J0G A;  2ZCC A;  5I4D A;  2QIE B;  2QCZ A;  3PLU A;  3TIX A;  2V4L A;  1Q0W B;  4N59 A;  4AJY B;  4HJG E;  3U52 E;  4DXF A;  2AYO B;  3H7P A;  3DBL B;  2YVC A;  2OJR A;  2C60 A;  3A9J A;  3TJP A;  2LXC A;  5IOI A;  4KZ0 A;  1V49 A;  1WR6 E;  2BKR B;  4IC7 B;  4W9E A;  3RFZ B;  2WHI A;  3PTF C;  3DWM A;  2PEA A;  1JW9 D;  3P4S B;  4DHJ B;  4ARC A;  2A4Z A;  3CSF A;  2KFK B;  4K81 A;  2DX5 B;  5FK9 C;  5BYQ A;  4XGA B;  3VVW B;  2N7J A;  4FHJ A;  4LJO B;  3FAH A;  4M00 A;  2BF8 B;  3HVZ A;  3HRD D;  2N7D A;  1SE3 A;  1TKE A;  2J0J A;  1H4R A;  2L83 A;  2WU2 B;  3W9C B;  1KJT A;  2BS2 B;  3X0W A;  4R3D A;  4PT5 A;  2KVR A;  4RGT A;  2Y5P A;  1LGR A;  4YTN B;  5DPW A;  2ZVO A;  2ICI A;  2K39 A;  4MDK E;  3Q69 A;  1J19 A;  1N62 A;  3W1Y A;  2DAF A;  2DBY A;  1SE2 A;  3SU8 X;  2L0T A;  2QDF A;  2MQJ A;  1TS4 A;  2MCN B;  1MI0 A;  2LUM A;  1AAR A;  2NCN A;  1WGH A;  1UBI A;  2L32 A;  3RPF C;  1N63 A;  4F1S A;  3SHQ A;  1K50 A;  4DHZ B;  2IJ0 A;  2RDB C;  3A1Q A;  5J18 A;  1SE9 A;  1SJH D;  4RCO A;  3GP7 A;  1Q1O A;  1V1O A;  4IWO A;  3PZD A;  3DCG A;  2PTL A;  4LTU A;  3R2I A;  2ZW1 A;  1YD8 U;  1H8C A;  2K9X A;  1J7A A;  2NBV B;  2VH2 A;  1RLF A;  3NG0 A;  1KFY B;  2L00 B;  3PGE A;  3UQB A;  1IUE A;  3AE7 B;  4S17 A;  3TEW A;  3APC A;  2MBH A;  3PVL A;  3M62 B;  4C4V A;  2GBM A;  1UH6 A;  1ACC A;  5CTR C;  1J8C A;  4FA6 A;  1E0Z A;  1WX8 A;  3WAL A;  2NMQ A;  4YSY B;  2R2O A;  1VCB A;  3RCZ A;  4BOZ B;  1WX9 A;  2O2V A;  3VQI A;  3RI7 C;  3V05 A;  1K51 A;  4ZHO A;  1I7H A;  3LXF A;  5E6O A;  1WJU A;  1GG3 A;  4JQW C;  2B3A A;  5JXV A;  1F77 A;  1F1H A;  2KTR A;  4F7Z A;  1TTN A;  3EFU A;  5D3D A;  4EZJ A;  2FCS A;  2DHZ A;  4E3C A;  2N9P C;  3QAR A;  5BMH A;  2WS3 B;  4F8C B;  3ZNI D;  1TIF A;  5JZE B;  1T6B X;  1OEY A;  1XLO A;  4RMA A;  1WGG A;  3AV8 A;  1UBQ A;  1P7F A;  5LLI A;  4MT5 A;  1SSN A;  1VR9 A;  3RNG C;  2DYM A;  2AX5 A;  1UZX B;  2FID A;  2PW9 A;  3N1Z C;  5EE3 A;  2LGD A;  1CMX B;  4US8 A;  3MTN B;  4N6E B;  4BKG A;  3K9O B;  5JHB A;  5C23 A;  1UEL A;  1R4M I;  2BTE A;  4AWJ A;  2KMA A;  1CJE A;  2G45 B;  1MPE A;  1I4P A;  1L4D B;  1G6J A;  4RH6 A;  3EC8 A;  2FE8 A;  4KSL C;  4HPP A;  4WH4 A;  4LLG M;  3N9Y C;  1TBE A;  4ZRK A;  1QOF A;  3NVW A;  2HDE A;  4EFO A;  1WM3 A;  1EWY C;  4XYC A;  2NR2 A;  2DZM A;  3DHI C;  4A9A A;  1BXT A;  1YOV B;  1FRD A;  4JLC A;  1OGW A;  3P4R B;  2L0F A;  1WYG A;  5G5H A;  3WAO A;  4XDC A;  4YTP B;  1CQV A;  3NVZ A;  4MAC A;  2MBO A;  1TS3 A;  1VDV A;  2GBJ A;  4L23 A;  2V3S A;  2JX5 A;  4IM3 A;  1WE6 A;  4FBJ B;  3AE2 B;  3QX1 A;  1HXY D;  5KHO A;  3AM9 A;  2JRH A;  5EDS A;  1KRH A;  1J7B A;  4LCD E;  4DHJ D;  1WMH B;  3U2S C;  1V86 A;  2J52 A;  1JWM D;  4W9L A;  3B2G A;  3A1Q B;  2LGI A;  3BVM A;  1I4X A;  3L08 A;  4RM9 A;  4JE3 B;  1K53 A;  1VZ7 A;  3BYT B;  3TCA A;  4YT0 B;  1JWU D;  4HRS A;  5HI1 A;  1UWX A;  1WXS A;  4DK5 A;  5CHF A;  2KZR A;  3U8Z A;  2KLC A;  2SAK A;  4MJS A;  4FUL A;  2JZZ A;  4IOI E;  4OZB A;  4ITK A;  4FJZ A;  5CHV C;  3AE3 B;  4K1R B;  1C79 A;  3PO0 A;  2CKH B;  4USA A;  1UNS A;  1WX7 A;  1YQ4 B;  1ZPS A;  1FNW A;  5AUI A;  2JXX A;  4NJC A;  5BMI A;  4ZRJ A;  2K8B A;  2JYE A;  3TSS A;  2XK5 B;  1FFV A;  2PE6 B;  4MM3 A;  5EE1 A;  1KOT A;  2MBB B;  1EF5 A;  2BYE A;  3DBL I;  3ZW3 A;  4NPN A;  3PRP B;  5T8I A;  3L10 B;  2NBW B;  4WJP A;  4GMV A;  2BVC A;  1MVK A;  4KGR A;  1X1M A;  4NZL B;  2LRU A;  2V4I B;  2W55 A;  2PE9 A;  3I5J C;  5CX3 A;  2WX0 A;  3IFW B;  4FJV B;  4NQL B;  4MGZ E;  4W9F A;  2JZ3 B;  2HE7 A;  2LGX A;  1GJZ A;  4HLE A;  2BQQ A;  3TL5 A;  3VRB B;  4PS8 A;  2L3Z A;  3ZTD A;  4C7Y A;  4UDU C;  3V6E B;  2JPH A;  4H2A A;  2FCN A;  2C9W B;  1ZDV A;  3AXC A;  4TMA B;  2ONQ A;  4URK A;  2MSE D;  1DGJ A;  1WGY A;  1DYQ A;  3VFK A;  3WAN A;  1L2N A;  4GDL A;  5DCN A;  2LVO A;  3MJ5 A;  4KV2 A;  2N4F A;  3KUC B;  2K5P A;  5D3I B;  1XO3 A;  1OEY J;  1YMH E;  2IY0 B;  1YN4 A;  1TKY A;  1WE7 A;  2EMS A;  4EZK A;  1V80 A;  3FC4 A;  4WAA A;  2R2Q A;  5KHQ A;  2IGD A;  1V9J A;  3BY4 B;  3FIL A;  2KN4 A;  1KF6 B;  4KX6 B;  4KSK C;  2ZPY A;  3GZN B;  2CHX A;  2M1M A;  4IWQ A;  4IM2 A;  1I35 A;  1P9D U;  3M95 A;  3DHG C;  2O6V B;  4GIV A;  3P42 A;  2WDQ B;  4NNJ B;  3U7Z A;  2L8J A;  3AEE B;  4TSS A;  4XWT A;  2LWP A;  1HZ6 A;  1XCQ L;  3CST A;  1FCL A;  2PIA A;  5IKC M;  2YEP F;  1WJ4 A;  1QOB A;  3ZYY X;  3WIM A;  3DVN V;  4HDQ A;  4P6V F;  1T0R C;  3OJ3 A;  2GOW A;  1RFA A;  3X23 A;  1GTE A;  3UIP B;  1L4Z B;  2KWV B;  2AWT A;  4HPL B;  4D2K A;  4YSZ B;  1WGR A;  1SJE D;  4AJW A;  4M8N A;  1ZE3 D;  1E6E B;  2KVZ A;  3QAQ A;  2KFJ A;  4FXC A;  3BK2 A;  1Y56 A;  3V60 A;  2DZK A;  2KLG A;  3BVZ A;  2WLB A;  3UIN B;  4J6I A;  4MH8 A;  1ESF A;  5G2N A;  5IP4 D;  2D3B A;  4OZA A;  2IO0 B;  2PMV A;  3MHZ A;  4NY0 A;  2GBR A;  3A9K B;  2J53 A;  3PHX B;  3I63 C;  2L7R A;  4HRO A;  2FBW B;  2M56 B;  1Y8R C;  4JIO U;  1ZW7 A;  3EFC A;  4REZ A;  1NYQ A;  4RGM A;  1YN5 A;  1HTO A;  2I1J A;  3ZNH B;  1V8C A;  1E8X A;  3DBR B;  3DQV A;  1KLV A;  1PFD A;  2BGF A;  3VR8 B;  4ZOH C;  4WJQ A;  2N9E B;  1OTR B;  1N5W A;  1XT9 B;  3EHV A;  4MH0 E;  2N9K A;  3KYD D;  1WIA A;  2KTF A;  1ZDX A;  1HTQ A;  1Z2M A;  1TY2 A;  3IBE A;  2J0M A;  1N5X A;  2C7N B;  1EF1 A;  2D3C A;  2RDG A;  4I6P A;  1OQQ A;  4HCP B;  3PV1 A;  2L76 A;  5EE0 A;  1YJ1 A;  3A9J B;  3ZJT A;  2WDV B;  1WXV A;  4DHZ E;  3APF A;  1XCT L;  3MFG A;  1R4M B;  3DVG X;  1IP9 A;  2MBQ A;  3PSE B;  2MRP A;  3ZJV A;  1E7V A;  3SDL C;  1QLB B;  4KGT A;  2SEB D;  2GBN A;  5JHA A;  1VZ6 A;  2RGF A;  3AE5 B;  2UWQ A;  1JML A;  1RWS A;  2ZEQ A;  1WZ0 A;  1KH0 A;  3DDC B;  4XE0 A;  2Z8L A;  2V9H A;  4RF1 A;  1PUT A;  3AEB B;  1V5O A;  4BZA A;  5LXH A;  4JWU C;  1GB1 A;  3HK0 A;  4HVB A;  3I57 A;  4MGK E;  3T9L A;  3U7D A;  5D6J B;  4AQ7 A;  4DXG A;  2MX2 A;  2DWQ A;  2GLS A;  4YL8 A;  1WJN A;  2PVO D;  1Q10 A;  3HUI A;  3RUI B;  5IA7 A;  2MHJ A;  3VDZ A;  1LM8 B;  2BPS A;  4GU2 A;  4I6N B;  4ZHP A;  3B9J A;  5BYS A;  2KC2 A;  3PS6 A;  3RUL A;  2LAS A;  1C3T A;  2OJW A;  1S1Q B;  1V97 A;  3AUL A;  4QAY A;  4WJN A;  3SFD B;  1I4G A;  1JRO A;  1GB4 A;  2WXJ A;  2DYO A;  3VTW A;  2V1Y A;  2IO1 B;  2WWZ A;  3KUZ A;  3BYY B;  1FNU A;  1L0X B;  1WWT A;  2NS5 A;  4B9K A;  2MJ3 A;  2I1K A;  4A3O A;  1AWD A;  3L0W B;  3R8B A;  2G9H D;  1EU3 A;  3ONS A;  2RD0 A;  4GSW A;  3FIL B;  3DVN U;  4C00 A;  2FIF A;  3P2B A;  2IND C;  2Y3A A;  4RFB A;  1MG4 A;  4LNF A;  4ZDV A;  4B0E A;  2INN E;  4WWO A;  5D7G A;  2K3U A;  3MHS D;  3BWU D;  3B1L X;  1J7C A;  1HEZ E;  3PLV A;  3Q3O C;  3L16 A;  2YLM A;  2LHE A;  4AUQ C;  1BUI C;  4N9F 4;  1QF6 A;  1V6E A;  4OVV A;  3UIO B;  2D10 A;  3IHP C;  4WWN A;  2JF5 A;  1CZP A;  1QKZ A;  3ZLZ A;  3KH0 A;  3K9P B;  1NYR A;  2K8H A;  3V6C B;  3KYC D;  2WX1 A;  4CQN A;  1FXT B;  3A4S C;  4NAW A;  2MWS B;  2K6Q A;  3U30 A;  1GT8 A;  3U4E G;  3DBS A;  4LNI A;  2C7M B;  1JRU A;  2REX A;  4M01 A;  2KYW A;  2HTH A;  5BO4 B;  1ZOY B;  2Z59 B;  3HHM A;  1U4A A;  5H8Y E;  4ANW A;  2BW2 A;  4K7W A;  2LGS A;  1V1P B;  2AEH A;  2ZVN A;  3ZUN A;  3T3O A;  1KTK A;  3NVY A;  3VUX A;  4C80 A;  2L52 A;  1FRR A;  5HFY A;  4J3O D;  1WRD B;  2R61 A;  2BS4 B;  4WQO B;  1R4N B;  2MP2 A;  3QA8 A;  2KTR B;  1YIW A;  2XN9 C;  3ZDT A;  1EUV B;  3NHE B;  3W5V B;  4WAF A;  2K22 A;  4HPM B;  2KMC A;  1GAQ B;  3JYU A;  4HDO A;  3D32 A;  2E6X A;  2AL6 A;  2CR5 A;  3A9K A;  1TS2 A;  4XZ4 A;  2K1F A;  4JX1 C;  2MH7 A;  3TBL D;  5AZG A;  2D3G A;  4YXD B;  1XF5 L;  3RZF A;  2H89 B;  1WGK A;  3I9V 1;  2L05 A;  4P1B C;  2RPQ A;  4K7U A;  1VRA B;  1F2R I;  1QOG A;  1TZO A;  3M63 B;  3L4P A;  3N3K B;  1GNU A;  2KQ4 X;  1L0V B;  2BBC A;  2IDY A;  1QOA A;  1AYF A;  1XXG A;  3EGR A;  5E6P A;  4K7S A;  4NJ7 A;  1RFK A;  5FR3 A;  2WU5 B;  1EO6 A;  4TQ0 A;  3MJW A;  2D07 B;  5DPR A;  1F2R C;  4CHK A;  5BYR A;  3CMM B;  3B08 A;  3SD5 A;  4EUT A;  1I4R A;  4ARI A;  2KJ6 A;  2WYQ A;  5TR5 A;  2YEP B;  1SF0 A;  1FPY A;  2QMT A;  2JVC A;  4RGN A;  1ZGU B;  1FM0 D;  1FO4 A;  2NTT A;  2V3N A;  3ENE A;  3CWI A;  4AS1 A;  1P98 A;  2KC1 A;  4BKS A;  3WCQ A;  2OED A;  3M3J A;  2KXJ A;  3E56 A;  2MBE A;  1VLB A;  4X57 B;  5TSS A;  3LYY A;  1UGM A;  2NVU I;  3EA6 A;  4GXB A;  1IYF A;  3RYT A;  1WGD A;  3ZQ4 A;  3ABV B;  2D5G A;  2VZK D;  3HM6 X;  4E74 A;  3RT3 B;  3KUD B;  4RF0 A;  5E6J A;  1E9M A;  3RNF C;  1SEB D;  1WXM A;  4FLH A;  3KVF B;  2DZI A;  3OWE B;  1SGH A;  2WXO A;  3Q8C A;  1F9J A;  1TJE A;  4CO7 A;  2KWU B;  3PZ8 A;  1T0Q C;  2ZW0 A;  1ENF A;  3AU4 A; 
#chains in the Genus database with same CATH homology
 5BYQ A;  1C76 A;  4FXC A;  3BK2 A;  3PZ7 A;  2N7J A;  1Y56 A;  3R2T A;  1LO5 D;  2WQY B;  3BVZ A;  2WLB A;  1D4B A;  3FAH A;  4MH8 A;  1ESF A;  1FNV A;  1XLP A;  4OZA A;  3HVZ A;  5HHD G;  3HRD D;  1L5P A;  1T3Q A;  3AED B;  1SE3 A;  2PMV A;  3H8H A;  3MHZ A;  1STE A;  1TKE A;  1PDX A;  2J53 A;  3NS1 A;  3AMZ A;  2J4X A;  2L83 A;  2WU2 B;  3W9C B;  1D5M C;  2BS2 B;  4HRO A;  5BMG A;  2FBW B;  2M56 B;  4MM3 B;  1GOZ A;  4R3D A;  1ET9 A;  4PT5 A;  4RGT A;  4REZ A;  1NYQ A;  1PGB A;  4RGM A;  3SR6 A;  2Y5P A;  1H7X A;  2MJE A;  4YTN B;  1FEH A;  1ROE A;  1YN5 A;  4US9 A;  1YJJ A;  2WXI A;  3IAM 1;  3KQ4 A;  2ICI A;  1V8C A;  1EM7 A;  1SBB B;  3B2F A;  3Q69 A;  2WXF A;  2XNA C;  2WXG A;  1P7E A;  1B9R A;  4A8X C;  1PFD A;  1N62 A;  3VR8 B;  2LJI A;  2WXL A;  2DBY A;  4JPS A;  4ZOH C;  1SE2 A;  4HEA 1;  1TS4 A;  1MI0 A;  2LUM A;  1N5W A;  2L32 A;  3RPF C;  2JSV X;  2BB5 A;  1NEK B;  3SFE B;  1N63 A;  2N9K A;  4O1N A;  3V3X A;  1K50 A;  1ZDX A;  2IJ0 A;  1VZ8 A;  2INP E;  2KMM A;  1I4Q A;  4P16 A;  1EU4 A;  4ZRP A;  1SJH D;  3AE6 B;  3IT6 B;  4RCO A;  1TY2 A;  3GP7 A;  2K0P A;  4A55 A;  3O13 A;  3NVV A;  1V1O A;  1FD6 A;  4OZC A;  4GDL B;  1N5X A;  2RDG A;  1OQQ A;  2PTL A;  4LTU A;  3R2I A;  5EE0 A;  3ETR A;  1IBX B;  1AN8 A;  3ZJT A;  2WDV B;  1IGC A;  1TY0 A;  2IGG A;  2ZW1 A;  3TUO A;  3AB5 A;  2K9X A;  1J7A A;  1XCT L;  1SIJ A;  3MFG A;  1N61 A;  1KFY B;  2WNM A;  2G1E A;  2FUG 1;  4B0M A;  4DQO C;  1IUE A;  1I4H A;  3AE7 B;  2JYT A;  3TEW A;  3AE9 B;  3ZJV A;  2MEK A;  2EEL A;  1QLB B;  4KGT A;  1ZXH A;  1ACC A;  3AH7 A;  3DWG C;  2SEB D;  2AQ3 B;  4TQ1 A;  1E0Z A;  1VZ6 A;  3AE5 B;  5G5G A;  2NMQ A;  4YSY B;  2J42 A;  1JML A;  1RWS A;  5GXG B;  3CIR B;  1KH0 A;  1SB3 C;  1JCK B;  3VQI A;  2JXT A;  3V05 A;  4XE0 A;  4RNA A;  1K51 A;  2JQR B;  2Z8L A;  4ZHO A;  1I7H A;  2LMC A;  2EKI A;  3LXF A;  1WXQ A;  2PLP A;  2LHD A;  1C4C A;  4RF1 A;  2IGH A;  1PUT A;  1N60 A;  3AEB B;  3URY A;  5JXV A;  1E10 A;  1QQR A;  1F77 A;  4JWU C;  1GB1 A;  4EE2 A;  1UUP A;  3I57 A;  2WXP A;  5D3D A;  2QEJ C;  2KAJ A;  1IGD A;  4C56 C;  1JQ4 A;  1DOX A;  1YQ3 B;  2AQ2 B;  5BMH A;  2WS3 B;  1L0Y B;  1C9F A;  4IDI A;  1D6E C;  4AQ7 A;  4DXG A;  1YN3 A;  4KKI A;  2DWQ A;  2RDH A;  1T6B X;  1E7P B;  3AE8 B;  1A70 A;  1XLO A;  2WXQ A;  3GB1 A;  2PVO D;  1Q10 A;  3AV8 A;  3GS2 A;  3HUI A;  2KWD A;  1P7F A;  3KWV A;  2RMM A;  4MT5 A;  1IBX A;  1SSN A;  1OQR A;  1T5X D;  1UWM A;  3UI3 A;  1VR9 A;  4ZHP A;  3B9J A;  5BYS A;  2DYM A;  2AX5 A;  2PW9 A;  2BT6 A;  1EWC A;  4WIP A;  3W5U B;  3BZD B;  1V97 A;  5EE3 A;  3SFD B;  3Q8B A;  1I4G A;  4US8 A;  1JRO A;  1TKG A;  4N6E B;  1GB4 A;  4KKJ A;  2WXN A;  2BTE A;  2AQ1 B;  2WXJ A;  1PGA A;  1WSP A;  2DYO A;  3Q8E A;  1ZXI A;  1CJE A;  2V3P A;  1H7W A;  2RPV A;  2M19 A;  1C78 A;  1GPX A;  2X38 A;  3BYY B;  1MPE A;  2PVG C;  1FNU A;  1I4P A;  1L0X B;  1L4D B;  1WWT A;  4C7Z A;  2L1A A;  1RYJ A;  2MJ3 A;  4OHJ A;  4RH6 A;  1B1Z A;  1AWD A;  1YJI A;  3P4Q B;  5HG2 A;  3BVG A;  1ET6 A;  3R8B A;  2G9H D;  1EU3 A;  2FE8 A;  4WWM A;  4L1B A;  3AEC B;  1RM6 C;  2JU6 X;  2QSD A;  1VJK A;  4WH4 A;  3Q8A A;  4KGS A;  3FIL B;  4LLG M;  1DOI A;  2KAC A;  3N9Y C;  3ZGZ A;  2B76 B;  1C77 A;  2OHF A;  1QOF A;  4IKG A;  3AEG B;  2Y3A A;  3NVW A;  2HDE A;  4XWW A;  4RFB A;  3LB8 C;  1HA5 A;  1EWY C;  2INN E;  4B0E A;  5D7G A;  1JRP A;  2K3U A;  2Q5W D;  2CJN A;  3BWU D;  1J7C A;  1HEZ E;  4A9A A;  1BXT A;  3TEZ A;  2LHE A;  1FRD A;  1NEN B;  1BUI C;  1D5X C;  3P4R B;  1WYG A;  5G5H A;  1QF6 A;  3VRA B;  4XDC A;  4YTP B;  1CQV A;  4YSX B;  2W3S A;  3KLS X;  3NVZ A;  1CZP A;  4MAC A;  1TS3 A;  1VDV A;  1QKZ A;  4L23 A;  2W82 A;  1NYR A;  1KLU D;  2JX5 A;  3IAS 1;  2CJO A;  3NUH B;  2PKO A;  3BK1 A;  3AE2 B;  1NVI D;  1HXY D;  4CQN A;  2ON8 A;  3AM9 A;  1FCC C;  4OW0 A;  3TEY A;  1QT9 A;  1MHH E;  2JWU A;  1KRH A;  1FXI A;  1GT8 A;  3U4E G;  4OVZ A;  3T3N A;  2GI9 A;  3E9S A;  2W3R A;  2H88 B;  5FKA C;  1J7B A;  3EUB 2;  3CF4 A;  1F0Z A;  3Q8F A;  1XLN A;  1JWA D;  3U2S C;  1CK1 A;  3IXS A;  1K52 A;  2J52 A;  2TSS A;  2WP9 B;  1JWM D;  2JZP A;  1ZOY B;  3B2G A;  1PYW D;  2LGI A;  3BVM A;  1I4X A;  5H8Y E;  3P63 A;  1L6V A;  2BW2 A;  5H92 C;  3P1M A;  2VZK B;  4JE3 B;  1V1P B;  3AE1 B;  4A6Q A;  3T3O A;  3HVD A;  3P4P B;  1FIQ A;  1K53 A;  1KTK A;  1VZ7 A;  3BYT B;  3NVY A;  4YT0 B;  1JWU D;  4C80 A;  4HRS A;  5HI1 A;  2L52 A;  1FRR A;  1UWX A;  5C3J B;  4RGO S;  5HFY A;  5EE9 A;  3MP9 A;  4J3O D;  3MC0 B;  3VR9 B;  2R61 A;  2SAK A;  3ZJU A;  2BS4 B;  4GDK B;  1D5Z C;  2IPK D;  4IOI E;  4NAW B;  1JAL A;  1KLG D;  4OZB A;  4ITK A;  2DLB A;  2N0S B;  4HKZ E;  3AE3 B;  5MPO A;  1C79 A;  2Y5C A;  1M4V A;  2XN9 C;  3PO0 A;  2HTM E;  5LNK 1;  2V0G A;  3BII D;  3W2D A;  4USA A;  2BYT A;  1HQR D;  1UNS A;  3W5V B;  2NTS A;  4WAF A;  1YQ4 B;  1SXT A;  1ZPS A;  2K22 A;  4HKQ A;  1FNW A;  5AUI A;  1QIL A;  1GAQ B;  2I2Y A;  2WXR A;  4NJC A;  2E6X A;  5BMI A;  1YNT E;  1TS2 A;  2JYE A;  3TSS A;  1ZUD 2;  4JX1 C;  2MH7 A;  1XLQ A;  1FXA A;  1MHX A;  4YXD B;  2WXM A;  4XDD A;  1FFV A;  1XF5 L;  4NAM A;  4WUR A;  5EE1 A;  3KWL A;  5C2T B;  2H89 B;  1WGK A;  3I9V 1;  4WQM A;  5T8I A;  2LFI A;  1TS5 A;  1VRA B;  4GLS C;  1F2R I;  1QOG A;  1TZO A;  1MVK A;  3L4P A;  4KGR A;  4NZL B;  2KQ4 X;  2V4I B;  2W55 A;  1AW7 A;  1L0V B;  2BBC A;  2IDY A;  1QOA A;  1AYF A;  1XXG A;  3EGR A;  3NZ3 A;  3J9C A;  3VRB B;  4ZRQ A;  4N58 A;  4C7Y A;  4UDU C;  1RFK A;  1UGJ A;  5FR3 A;  3NRZ A;  1HZ5 A;  2MJD A;  2WU5 B;  4TQ0 A;  4H2A A;  1GTH A;  1F2R C;  5BYR A;  1ZDV A;  4TMA B;  2N9L A;  3AN1 A;  3C8Y A;  2BB6 A;  2ONQ A;  4L2Y A;  1C4A A;  1I4R A;  1DGJ A;  4ZYS A;  4ARI A;  1DYQ A;  2W54 A;  3MJ5 A;  2ACZ B;  1OFF A;  4A90 A;  2YEP B;  1ZP0 B;  1SF0 A;  2GRI A;  2QMT A;  1PGX A;  2K5P A;  5D3I B;  1XO3 A;  4YWG G;  3AE4 B;  1BML C;  1C4P A;  4RGN A;  1YMH E;  1JWB D;  1YN4 A;  1R7S A;  1TKY A;  2WDR B;  1FM0 D;  2I38 A;  2E3T A;  2QJL A;  1FO4 A;  1WRI A;  1SE4 A;  2NTT A;  2V3N A;  3FC4 A;  4LK0 M;  2IGD A;  3CWI A;  5AUK A;  3SEB A;  2M0A A;  4AS1 A;  2WXK A;  3FIL A;  2KN4 A;  1KF6 B;  4KX6 B;  4M0W A;  3AEF B;  3WCQ A;  1FMA D;  2WXH A;  2KDM A;  2LEK A;  2OED A;  3TEX A;  3E56 A;  1DOY A;  1V1P A;  2CU3 A;  1TYG B;  1VLB A;  3AEA B;  2GB1 A;  3IT4 B;  3P42 A;  5TSS A;  2WDQ B;  3U7Z A;  3LYY A;  3EA6 A;  5I4D A;  4JWS C;  3AEE B;  2QIE B;  4TSS A;  2BS3 B;  4N59 A;  4XWT A;  3ZQ4 A;  4HJG E;  3ABV B;  3U52 E;  1HZ6 A;  1XCQ L;  2D5G A;  2VZK D;  4DXF A;  1FCL A;  1JWS D;  2PIA A;  4RF0 A;  5E6J A;  1E9M A;  1SEB D;  2YEP F;  4Q2J A;  1XEE A;  1QOB A;  3OWE B;  3ZYY X;  1NI3 A;  2WXO A;  3Q8C A;  4P6V F;  3W1S A;  4YTM B;  3RFZ B;  1TJE A;  3DWM A;  1GTE A;  1L4Z B;  3PZ8 A;  1L6U A;  4D2K A;  1JW9 D;  4YSZ B;  3P4S B;  2QIL A;  1SJE D;  2ZW0 A;  4ARC A;  1FFU A;  1ENF A;  1ZE3 D;  1E6E B;  5FK9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...