3P4PB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with fumarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4pB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4pB01
3AE4B 1QT9A 1N5WA 4US8A 2WU2B 1OFFA 1NEKB 1H7WA 1ZUD2 2W55A 4IDIA 5EE3A 1NI3A 1DOIA 4A9AA 1TKYA 3SR6A 5AUIA 1JW9D 2B76B 1L5PA 3AM9A 3FC4A 1J7CA 1QLBB 3ABVB 2PVOD 4WWMA 4ITKA 2CU3A 3HUIA 1QOAA 5EE1A 3WCQA 4JX1C 3SFDB 2JX5A 2Q5WD 3AEBB 3B2GA 2WS3B 3AE5B 2PIAA 1XO3A 1NENB 1WGKA 3VRAB 1PUTA 2WP9B 3P4QB 3W9CB 1WRIA 4ZHPA 1TKGA 4FXCA 1QF6A 3NS1A 4P6VF 1EWYC 3DWMA 4LTUA 1YJIA 2WDVB 3NRZA 3AEGB 1FRDA 4USAA 1XLQA 5C2TB 3CIRB 3NVZA 1TKEA 2BS2B 1IUEA 3AV8A 1E0ZA 4HRSA 1FO4A 3DWGC 4HROA 3LB8C 3B9JA 1N60A 3HVZA 1GT8A 3AEEB 1KRHA 1OQRA 3W5VB 1ZOYB 4C7ZA 2W3RA 5H8YE 3ZYYX 2E3TA 4N59A 1N63A 3AEFB 2H89B 1JROA 2DBYA 4JWUC 1N62A 2K5PA 3P1MA 1ZP0B 3P63A 1E9MA 3RPFC 1ZXIA 1PFDA 1J7AA 2MJEA 1TYGB 3NVYA 5EE0A 4ZHOA 3VRBB 2W3SA 1QOGA 1FM0D 4YSXB 1F0ZA 3BIID 4ZOHC 1JRPA 3CF4A 1L6VA 2PKOA 2OHFA 2WLBA 3AN1A 2BS3B 1WXQA 3ETRA 4US9A 4C80A 1N5XA 2EKIA 1FFUA 1J7BA 3AE7B 2L52A 3AE2B 2QIEB 1CJEA 3AB5A 1AWDA 1NYQA 5EE9A 3AECB 1NVID 4C7YA 2DWQA 2M19A 1B9RA 1RWSA 3P4PB 3HRDD 1RYJA 1XLNA 5G5GA 3NVVA 3AEDB 3AH7A 1YJJA 1GAQB 1DGJA 1FXIA 3B2FA 1FRRA 3W5UB 4YTPB 1FIQA 3AE9B 4YSZB 1R7SA 3VR8B 1E10A 1OQQA 2WDQB 1V8CA 1DOXA 1FFVA 1FXAA 5H92C 2Y5CA 2W54A 1GPXA 3AE8B 3FAHA 1SF0A 2LEKA 3PO0A 4YTNB 2WU5B 3AE6B 2QJLA 1XLOA 1NYRA 1UWMA 2JQRB 4N58A 1WWTA 1AYFA 3SFEB 1YQ3B 3AMZA 4YXDB 1WYGA 1SB3C 1V97A 2G1EA 5MPOA 1E6EB 1XLPA 4JWSC 2ACZB 2H88B 1SIJA 2CJOA 3LXFA 3NVWA 1JWBD 1RFKA 1CZPA 2MJDA 2K9XA 2L83A 2K22A 3CWIA 1QOFA 2M56B 3P4RB 1JALA 1GTHA 4N6EB 5C3JB 2WQYB 1L6UA 1VJKA 4YTMB 2BT6A 4KX6B 4WQMA 3KWLA 1JWAD 1T3QA 2MJ3A 3AE1B 2PVGC 2KMMA 3AEAB 1QOBA 3VR9B 2HTME 1KFYB 1RM6C 2N0SB 1JQ4A 3L4PA 1FMAD 5GXGB 3P4SB 1DOYA 1L0VB 4YT0B 1I7HA 1N61A 2AX5A 1VDVA 2FBWB 1E7PB 1VLBA 1ROEA 1KF6B 3AE3B 2KAJA 1H7XA 1TJEA 4YSYB 5AUKA 2WDRB 2BS4B 2CJNA 1GTEA 1YQ4B 3EUB2 1PDXA 1A70A 2MH7A 5G5HA
chains in the Genus database with same CATH superfamily
2WXHA 2AWTA 2O2VA 4K7SA 2B76B 4M02A 1UD7A 4W9KA 3APFA 2JX5A 1XCQL 1T0QC 4OHJA 2BS2B 2VH1A 1TT5B 3AI5A 4IM2A 4GOCA 3ZGZA 4RF1A 4TQ1A 3PLUA 3PRZA 2IZVB 2SEBD 4JGHB 3A4RA 1MHHE 3U7DA 3O13A 3NVYA 5EE0A 2FCQA 2KZRA 2KKCA 3BIID 4M8NA 1JRPA 1L6VA 2JXXA 3ONSA 1WXQA 4C80A 4NJ7A 2XEWA 1C1YB 2QIEB 5BMGA 1NYQA 1L4ZB 2M19A 1JCKB 2C60A 3NVVA 4ZRKA 3ML8A 1P9DU 3VR8B 3RZFA 4MH8A 1OQQA 2V0GA 4ARCA 1CK1A 2MBOA 2KC1A 1UF0A 1V5TA 2KTRB 1GPXA 3RI7C 2JZ3B 4NAMA 3B08A 3N32A 5LLIA 2PE9A 4YWGG 1YQ3B 2JZPA 2FCNA 1K52A 3ZJVA 2XNAC 1V2YA 4DK5A 4GSWA 3RCZA 2M8SA 3EGRA 3UIPB 2YLMA 2DYOA 2BT6A 3N1YC 2D3AA 3KWLA 4MT5A 4XGAB 3AEAB 3A1QB 2INDC 1FMAD 1I7HA 1ESFA 4C4VB 4IC7B 1AN8A 1E7PB 3W1YA 1H7XA 2JF5A 2J42A 2ZNVC 4HJGE 4WWNA 4W9JA 2RMMA 4DXAB 4IDIA 4RM9A 1WXVA 3SR6A 1G6JA 3ABVB 3ZO5B 3HUIA 3DHIC 3AEBB 4HDQA 4MM3A 1PGXA 4JQWC 3M3JA 2JT4B 1Z2MA 4FJZA 4USAA 2MX2A 4K3BA 4ANWA 2QILA 3MHSD 2HDEA 3RD2A 1UUPA 1XQQA 5HKHA 4TKNA 1TS2A 1JWMD 4P16A 2KDBA 2PJHA 4ICUA 2GBNA 1ZP0B 5TR5A 1R4NI 3GS2A 3GOEA 2JUOA 3DBRI 2KN5A 4MJSB 2AQ2B 4ANUA 2PKOA 2IO3B 3VFKA 2WXFA 5FKAC 2L52A 5EE9A 4LJOB 1WX9A 3AH7A 1UBQA 1LFDA 3R66C 1LGRA 1T5XD 3EFUA 2DLBA 1VZ7A 2DNFA 2Y5CA 3R8BA 2QMTA 2GLSA 4GDKB 3PZ8A 2KX3A 4HKZE 5GMVA 3T3OA 3KLSX 3QWZB 5IA7A 2IY1B 2PW9A 3CWIA 1ZGUB 2V4LA 5HHDG 5C3JB 4J3OD 4K81A 5CX3A 3T9LA 4IM3A 4LK0M 3ZKJC 1I4QA 1NI2A 1VDVA 3WAOA 3A9JA 1WJ6A 2CS4A 4RFBA 5J17A 2I38A 3H6NA 2FIFA 5TSSA 3IAM1 4MGZE 4HK2A 5BMHA 4A3OA 2OJRA 2BKFA 3PZ7A 5L95C 3KYDD 2G9HD 2PVOD 3CSFA 2WS3B 4HWIB 4EZKA 4A6QA 4XWWA 4ZHPA 4LTUA 2DENB 1XLQA 3PSEB 3PTFC 3DQVA 3OJ3A 4MGYE 3ZJUA 2IY0B 2DAFA 3W5VB 5IO9A 2K5PA 2MBBB 2KT7A 2KDEB 4XYCA 2W3SA 4CHKA 3TMPB 1E90A 3PT2B 1EWCA 3Q8FA 3CF4A 2BS3B 1R4MI 1FNWA 1FFUA 2D3CA 2WXPA 4N9F4 5CHWA 2INCC 1YJJA 3W2DA 1DGJA 1ACCA 2C7NB 5T8IA 4D2KA 3DBHB 3T3NA 1WY8A 1UWXA 3QA8A 2WU5B 4PYUA 3AXCA 4XDCA 1NYRA 4LDTD 3RUIB 1KLUD 4M01A 2DX5B 4NPNA 1XLPA 4GDLA 1WGGA 1HE8A 2V4IB 1MFWA 1V81A 3NUHB 2ZCBA 2J0KA 1M94A 4WQMA 3EA6A 1WIAA 3FKYA 2N0SB 2IGDA 3A9JB 3BVGA 3DVNV 2WXGA 3DHHC 1A70A 2GBRA 2WU2B 1HA5A 1NI3A 1KLGD 1L2NA 1P1AA 1Z5SB 3H8HA 5EE1A 4ITKA 1QOAA 3B2GA 2Q5WD 1LXDA 3VH4B 1MPEA 1WGKA 1C9FA 4A8XC 5D94A 1R4MB 1S3SG 1YIWA 2LXCA 1WZ0A 4L2YA 2OEDA 1GT8A 1OQRA 2V3PA 2AL6A 4KSLC 1E9MA 3IVFA 1Y8RC 1RLFA 1WMHA 1TYGB 1PGAA 2GBMA 3K9OB 4DWFA 3SDLC 1PYWD 1F1HA 5AEKB 4NZLB 4KGTA 4IM0A 2IPKD 2NCNA 2KFKA 3JSVA 5E6NA 4W9IA 2Z0DB 1GAQB 3AE9B 4YSZB 5DPWA 4RGMA 2GBJA 1WGDA 3NHEB 4WH4A 3V60A 3ZVVA 3AE8B 3VVWB 1WM3A 3MTNB 1WJ4A 4NJ6A 4WJNA 1WWTA 1TS3A 3CF6E 2M1MA 4W9LA 1D5ZC 2ACZB 2J0MA 1Q0WB 4S17A 2BB6A 2WXJA 3N9YC 2M56B 2UYZB 2NBWB 1JALA 1L4DB 3A33B 2L76A 4HVBA 3NOBA 4TSSA 2FCSA 4RM8A 3ZXRA 1YX6B 2K8CA 4I6PA 3PHXB 1KF6B 2G3QB 2QDFA 4JPSA 3VHTC 3MC8A 1F2RI 2GBKA 1QT9A 2ZJDA 1XT9B 2JWUA 2HTHA 1MJDA 4FN2A 2MP2B 1V86A 2ZW1A 4DBGA 1SGHA 5AZGA 1NENB 2ZNVB 2HJ1A 1IP9A 1WRIA 4HPPA 3DVGX 4J6IA 4BOSC 3R2TA 4W9HA 4A90A 4EUTA 1FO4A 4AUQC 1T0SC 4II2B 3HIZA 2ZZPB 4A20A 4AJWA 1I4RA 2EELA 1OTRB 3TEXA 3BYYB 4N59A 3JW0X 3U52E 2LUEA 3JYUA 2PTLA 4OZCA 3SU8X 2FE8A 2LZ6A 4CQNA 3VUYA 2Z8LA 4US9A 2CHXA 4XC2A 1N5XA 4HKQA 1Q5WB 1AWDA 4HEA1 3HRDD 1TZOA 1U4AA 3X23A 2D3BA 2WYQA 2W9NA 3GE8C 3IT4B 2LVPA 2N9KA 4RGNA 3TUOA 4IUMB 4QAYA 3PS6A 2JQRB 1I4GA 3AULA 4NAWA 1GJZA 3LXFA 3VXWA 3GE3C 2O6VB 2BWES 1J0GA 1ET6A 1FCCC 5C1ZA 1VJKA 2SAKA 3RNGC 4YTMB 1WE7A 3R3MA 2ZW0A 1I35A 2MJ3A 3AE1B 2I1JA 2MSED 1EM7A 3MJWA 2AX5A 1ZXHA 4B0MA 2KWUB 4KGRA 1L0YB 2KMCA 2BS4B 4MELA 5LXIB 5G5HA 1ZUD2 2W55A 1SEBD 3PGEA 3A4SC 3IG3A 1L5PA 5AZFA 1J7CA 5G5GA 4BKSA 2Z59B 3AE5B 2IGHA 1KM7A 1VZ8A 3CSTA 1PUTA 2BYFA 4PS7A 4FJVB 1FRDA 1UGJA 3IXSA 2RDBC 5D2MB 4RCOA 4XX5A 3DDCB 1KRHA 2KMAA 3ZW3A 2PPHA 1SJHD 2OOBB 3OLMD 1F77A 3C8YA 2L05A 2BF8B 4B6WA 1L0XB 3RNAC 3Q8CA 4CYEA 4G0NB 3TEYA 4ZOHC 2Z0EB 5DPTA 1KH0A 5EDSA 3L17A 3AE2B 3TIXA 2Y3AA 3ML9A 3P4PB 3ZQ4A 4OW0A 1EU3A 1FXIA 4YTPB 1FD6A 4MH0E 2IJ0A 3VTVA 3UQBA 1DOXA 1FFVA 1HTOA 1FPYA 3FAHA 3QJZA 4NAWB 1VRAB 4EE2A 4HJKA 3AMZA 3BYTB 3BWUD 4JWSC 4DHZE 1WR1A 4A55A 2IDYA 2K1FA 2CJOA 4ZRPA 4DHJD 2BWFA 3OJ4B 3KWVA 3GP7A 2HD5B 1ZKHA 2PVGC 1QOBA 1HTQA 2AQ3B 2V1YA 1N61A 5C23A 3PREA 4L23A 4F1SA 2IYDB 3BINA 4KIKB 2WWZA 4A9AA 2J53A 1WYWB 1LQBA 2LI5A 3MFGA 2CU3A 1WXAA 4LNFA 2K6DB 2ZEQA 4Q2JA 4KGSA 3U2SC 1GC7A 2LHEA 1FNUA 4GIVA 4K3CA 1P7EA 2GRIA 1IUEA 3Q8BA 3H7PA 4C7ZA 4AP4C 1XD3B 1C77A 1PFDA 4FADA 4IWPA 4LNNA 3ECIA 3NZSA 1QOGA 1FM0D 4E74A 3Q8EA 2OHFA 1J7BA 2A5UA 1XLNA 4RMAA 2RR9A 2MBHA 4WWOA 1E10A 2KLCA 3OAWA 1MG4A 1GNUA 1FXAA 2QEJC 4OVZA 3HHMA 2GI9A 4KVGB 2G4DB 4FHKA 4DHJB 1P98A 4N58A 1AYFA 1P0RA 2N1VA 4FLHA 2LVOA 1SB3C 5MPOA 2RDHA 3VQIA 1SIJA 2ZCCA 3DVGY 1Y56A 2KQ7A 3VTWA 3MHZA 3PRPB 3V6CB 2L32A 4TMAB 2FUHB 2HTME 1RM6C 3OG5A 3L4PA 2Y5PA 2M0AA 4YT0B 4M8MA 4WURA 5J18A 2J52A 2BYVE 4GLSC 2CJNA 1FNVA 3DVNU 3LJ3A 2MH7A 4LNIA 4WJOA 4AOFA 2EMSA 1OFFA 3NJTA 4EEWA 3HM3A 3WAMA 2OJWA 2MHJA 1M4VA 1WRDB 2C5LC 3I9V1 1MG8A 1KOTA 3PVLA 1WGHA 4BKGA 3KVFB 3RNEC 3DWMA 3QQ8B 3AV8A 4IOIE 1BUIC 2D10A 5HFYA 2QHOA 4I6NB 3PHWB 1ZOYB 5D6JB 1GUAB 1RRBA 3Q2AC 3U30A 1TY2A 2C7HA 2INNE 1UNSA 2MP2A 1B9RA 4W9GA 2DWQA 1D3ZA 2RDGA 3VUWA 1MHXA 1C4CA 1BT0A 1KTKA 2WXMA 2AEHA 1R4NB 2KJHB 1SF0A 3PO0A 3A9KA 2EKEC 1YQBA 2MA9B 2LVQA 5CHVC 3WANA 1QQRA 5DPSA 2R2OA 3VAWA 2JWZA 4XE0A 1YN4A 2D2QA 3L16A 3ZNID 3QAQA 1UBIA 3Q3NC 2K22A 5KHOA 4GDKA 2W82A 3I57A 1D5XC 2WQYB 2UWQA 1QZEA 2VZKD 1EUVB 1DYQA 1ISNA 4HPMB 2NPTB 4RF0A 2REXA 1K8RB 5E6PA 4LCDE 3DCGA 2M0XA 1VLBA 2ICIA 3P42A 2KJRA 3TEZA 2DHZA 2WXLA 3ZIMA 4P6VF 2MQJA 4EKUA 3L10B 4ZYSA 4US8A 4IG7B 5BYRA 5JHAA 2GOWA 2HE7A 2KTFA 1WI0A 5JH5C 4ZRQA 1IGDA 4WWMA 1WX7A 3FILB 4RGTA 3ZRFA 2PIAA 3ZDMC 2AYOB 1XO3A 3VRAB 2WP9B 3QC8B 3HVDA 3Q3OC 3GB1A 3NY5A 5C2TB 5L83A 3PZDA 3N1ZC 4B95A 3UQAA 1V49A 4NQLB 4RH6A 3UIOB 2KN4A 2J0JA 3ZRCA 1JROA 1CMXB 4IWQA 3P63A 3RPFC 2MJEA 3L0WB 3H9DA 2GB1A 4P1BC 2DAJA 3ZJTA 1TIFA 1WZ3A 3BK1A 3DPDA 4BKTA 2O6VA 2KQSA 3RYTA 2MBQA 2IGGA 5KHQA 5HG2A 3IT6B 1RWSA 3J9CA 1J8CA 3R7QA 4DHZB 3B2FA 3A1QA 3RFZB 4M0WA 3X0WA 1V8CA 5JHBA 4LNKA 3DBRB 3N3KB 3ZUNA 1E8YA 3TSSA 1D4BA 4YTNB 1SIFA 4OZAA 5DCNA 4GGQA 2NR2A 2VZKB 4II3B 3RNCC 4NNJB 2LRUA 4HXDA 2JYTA 2K9XA 1QOFA 2NTTA 3IAS1 3DBLI 2MW5A 2NPTA 1SE2A 2K6QA 3DBHI 5IP4D 1GB1A 1YN5A 4WAFA 1WXMA 3TEWA 1EF1A 5GXGB 1LO5D 3KW5B 2NS5A 4G11A 5AUKA 3NS8A 1V5OA 2WDRB 2CHWA 1GTEA 2NTSA 3RT3B 1PDXA 2KK8A 2KWCA 5EE3A 3AM9A 1IPGA 2R2QA 2YEPF 5FR3A 2JXTA 4B0EA 4BBNC 3UI3A 2XK5A 1AW7A 2KD0A 3W1SC 2KVZA 1TKGA 4W9EA 1EWYC 5HI1A 2L00B 2KC2A 3HVZA 3M63B 5LXHA 2W3RA 3I3TB 4GXBA 1TBEA 2B3AA 1N62A 1VCBA 2MWSB 2LFIA 3ZLZA 3CMMB 4BOZB 2BYEA 4GN1A 3VRBB 2WX0A 1QKZA 3AU5A 1XXGA 4I6LB 1WJUA 3PPAA 1F0ZA 1H4RA 2G45B 4XDDA 3TCAA 2TSSA 1D6EC 1RYJA 4C4VA 1CQVA 2N9EB 1WGYA 2L8JA 4M0WB 1GOZA 2V9HA 3R2IA 2LGYA 1Q1OA 1C78A 3DHGC 3SEBA 3KH0A 3QHTA 3RN9C 1E8WA 2DZJA 2Y5BB 2BBCA 1YN3A 1UWMA 2LGXA 2LUMA 4YXDB 4F7ZA 2JZZA 1YOVB 2L0FA 3IFWB 3MJ5A 2RSUA 2DZIA 1JWBD 1WGRA 3BVZA 2DZMA 3Q3FA 4MEMA 1K53A 4K7UA 2N9PC 2RPQA 2RD0A 3M95A 1I4XA 4KIKA 1DOYA 2L0TA 3GZNB 4EZJA 4KKJA 3AE3B 3QX1A 3UF8A 1RFAA 2PE6B 3DBLB 1TZ1A 3EC8A 2KYWA 1YQ4B 4BVUC 5D3DA 3SHQA 1P3QU 3AE4B 1N5WA 4C00A 3DOWA 3ZDTA 2WHIA 4A3PA 1QLBB 3WCQA 1I4HA 3N30A 1VR9A 2XK5B 2NMQA 2BKRB 1TKEA 1OEYJ 4MSMB 1C3TA 3DWGC 4HROA 4X57B 5IKCM 4B9KA 4MDKE 2PMVA 2KJ6A 1TTNA 1ZDXA 4ZHOA 3ZNGC 3Q6BA 2JU6X 5IN7A 4XWTA 1VZ6A 2JRHA 5J2RA 2WDTB 2HJ8A 3Q69A 2D3GA 4KDLB 2N4FA 4RNAA 2LJIA 3AECB 2N7DA 3AEDB 3UINB 1TS5A 1E5WA 4FJYA 4G3XB 2DYMA 1L7YA 2JSVX 2A4ZA 2J7QB 2LEKA 2M4NA 4HLEA 2FNJB 2KVRA 1WYGA 1V97A 2G1EA 1E6EB 3WIMA 3EECA 1ZE3D 2LRWA 2LXAA 1VD2A 4HCPB 3WA0A 1CZPA 2KTRA 2IO2B 3P4RB 3O65B 1B1ZA 3APCA 5BMIA 1OEYA 2RPVA 2KMMA 1D5MC 3E9SA 2ON8A 3W1SA 2FBWB 3I5JC 3BK2A 1UELA 3SD5A 2AL3A 4IWOA 3V3XA 2L1AA 5E6JA 4C56C 3C19A 2K3UA 4MJSA 3VH3B 1FXTB 1SE3A 3P4QB 1BXTA 4IKGA 3NS1A 3EHVA 1ZDVA 2XBBC 1LM8B 1HZ5A 3NVZA 1E0ZA 2C9WB 2WXNA 2LD9A 2LHDA 2ZPNA 3ZYYX 2BW2A 1N63A 4JIOU 1XF5L 4AJYB 5IOIA 3P1MA 2WXIA 1OGWA 2YVCA 1J7AA 3A9KB 4ZYNA 2LGIA 3AN1A 1E7VA 2R61A 1IBXA 3TJPA 3E56A 3NG0A 3AB5A 3IHPC 4KSKC 4EOYA 3FILA 2WXKA 2I2YA 1FCLA 2K25A 3PV1A 1TS4A 3LYYA 5G2NA 1FRRA 4ZDVA 2NBUA 1YMHE 4E71A 2CU1A 5FR6A 1IBXB 4G50A 2W54A 3K9PB 2FUG1 5E6OA 1OQYA 3L54A 3SFEB 4BAXA 4BFRA 2MJDA 2GMIC 2L83A 3RULA 1E8ZA 1L6UA 4PS3A 2O6VD 1WR6E 4KX6B 2ONQA 4ANVA 4PT5A 3LDZE 4GU2A 1S1QB 2V3NA 1KFYB 1JQ4A 3ZTCA 3P4SB 1GB4A 1PGBA 2IO0B 4F8CB 3H7SA 4PK1A 2KAJA 4S0RA 4YL8A 1SSNA 3U8ZA 2DZKA 3V6EB 2L3ZA 2I1KA 4KDIC 1JMLA 3WAPA 1YJ1A 1DOIA 2KX0A 1SXTA 1E7UA 3FC4A 3RNBC 1XCTL 4ZRIA 4JX1C 4AQ7A 3SFDB 4RGOS 3W9CB 5LNK1 2LMCA 4MGKE 3KQ4A 5JXVA 2BQQA 3CIRB 2WNMA 2M17A 3B9JA 3OWEB 1N60A 3T8MA 1NBFC 1TY0A 2LASA 1T0YA 1HZ6A 2FAZA 3AEFB 4LLGM 3Q3JA 2MBEA 1SJED 4K7WA 4JWUC 1V1PB 1PQSA 1WFYA 3S2AA 4BBNF 5BYSA 2WLBA 3ETRA 4GMVA 3N1XC 2EKIA 3QARA 2VRRB 2JY6A 1NVID 3UGBB 1WH3A 3NZUA 1WX8A 3APDA 2NBVB 3W5UB 2D07B 2JRIB 3URYA 3ENEA 3RZWC 1JRUA 1ENFA 1XLOA 1MI0A 2KNBA 4BZAA 2ZVNA 5G55A 4MACA 3I63C 2XN9C 1ZPSA 2QC8A 2K0PA 1GTHA 4N6EB 2E6XA 4ASWC 3GZNI 3L08A 1K50A 2MRPA 2LGDA 2IO1B 4ANXA 2N1WA 4LJPB 1NDDA 1ROEA 2V3SA 1TJEA 4YSYB 3ZNHB 3EUB2 4ZRJA 1H7WA 2KFJA 1V6EA 1JWUD 5AUIA 1JW9D 1AARA 2KWVB 3VTUA 4W9DA 1EO6A 1UGMA 2L7RA 3P2BA 1QF6A 4FXCA 3KUZA 1TGZB 2KDIA 3AEGB 4HRSA 2K8HA 2WXOA 1WM2A 1EU4A 3U7ZA 5H8YE 2LWPA 3IBEA 2MCNB 2E3TA 4KZCA 4FHJA 1UZXB 4TUUA 4H2AA 4HCNB 2K39A 4LNOA 3HM6X 4YSXB 1WSPA 1GC6A 2JYEA 5FK9C 1A5RA 3QK0A 4AWJA 1F9JA 4AS1A 2IBIB 2WGSA 1C79A 2LJ5A 4BKSD 3KUDB 5CHFA 1R7SA 1KJTA 2KDMA 1HQRD 2BVCA 1WJNA 4KKIA 4PYZA 2QJLA 3H7PB 3PLVA 1EF5A 3RMKC 3KUCB 2KWDA 4L1BA 3EFCA 3N20C 3KYCD 2CR5A 4XZ4A 2FCMA 4O1NA 3B0AA 1I4PA 4REZA 4NQKE 2YEPB 3VR9B 3WALA 4W9CA 4ARIA 4E3CA 4OZBA 5CTRC 4FBJB 3NZ3A 4ICVA 1L0VB 3Q3MC 5BO4B 4WAAA 2J4XA 1BMLC 2MEKA 3AU4A 3DBSA 4HPLB 4DDID 2BB5A 3TL5A 1IGCA 2N7JA 3Q14C 1WE6A 1YJIA 4HDOA 2CHZA 4DXGA 4CO7A 3ZNZB 2KDFB 1SE9A 2JPHA 3AEEB 2ZVOA 2D11A 4OVVA 3B1LX 4M00A 1V80A 5D3IB 4KZ0A 1ZXIA 5I4DA 4JE3B 4JLCA 1E8XA 2KLGA 4P7IA 4R3DA 5BYQA 2KANA 1KLVA 3ZXVA 2BGFA 2KOXA 1MVKA 4WQOB 3ZTDA 1C76A 1X1MA 3VUXA 4C7YA 2KHWB 1IYFA 2VH2A 1F2RC 1WF9A 1K51A 4TQ0A 2KFKB 2WX1A 2KQ4X 2AQ1B 2NVUI 4FA6A 2WDQB 1HXYD 2WXQA 5H92C 5DPRA 3L13A 4LDTB 4P1CC 1T0RC 1WXSA 4MSQB 2ZPYA 2QCZA 2KXJA 3BY4B 4JL9A 1YX5B 3V61A 2H88B 3NVWA 1RFKA 3V62A 2EMTA 1N6ZA 1YD8U 4TV3A 1C4AA 1C4PA 4EFOA 3RNFC 2LGSA 1QILA 5AZHA 4K1RB 1XEEA 1V1PA 3M62B 4EZLA 1STEA 2C7MB 4WJPA 1FEHA 1NEKB 1J19A 1Q10A 2DYBA 1TKYA 2INPE 2G4SA 1YNTE 3ALBA 3MP9A 2KO3A 2X8XX 3QIJA 2FIDA 4NY0A 2WDVB 3JVZX 3NRZA 1RAXA 1I42A 2MLBA 3QCAA 3LB8C 3HK0A 2BTEA 1V1OA 1JWSD 5IAAC 4KV2A 3MC0B 2H89B 2DBYA 3D32A 4W9FA 2BYTA 2X38A 4GDLB 2N7EA 2PEAA 2ASQA 3MC9A 3Q8AA 1P7FA 1F52A 4WIPA 4GB9A 2WXRA 3AE7B 3BZDB 1CJEA 4DXFA 2PLPA 3BVMA 3V05A 4UDUC 3U4EG 1ZW7A 1ET9A 5D7GA 3VDZA 1SBBB 1FIQA 1UH6A 4NJCA 4MGIE 3H1UA 2QSDA 3PRMB 3TBLD 1HEZE 3AE6B 4IW0A 1V9JA 4DDGD 1WMHB 4OVUA 4DQOC 2K8BA 2BPSA 4MM3B 5JZEB 4URKA 2N9LA 3C0RB 2CKHB 2JVCA 2KACA 4WJQA 4WWPA 1SE4A 3JSVB 2D5GA 1T3QA 1JWAD 4PS8A 3R7RA 2N9XA 2RGFA 2O2VB 1T6BX 4ACFA 1GG3A 2UU7A 4FULA 1H8CA
chains in the Genus database with same CATH topology
4ZYSA 1QT9A 4US8A 1JMLA 5BYRA 2WXHA 1DOIA 2JWUA 1SXTA 2B76B 3FC4A 4ZRQA 1IGDA 4WWMA 3FILB 1XCTL 4JX1C 4RGTA 4AQ7A 3SFDB 2JX5A 1XCQL 2ZW1A 2PIAA 1XO3A 1NENB 3VRAB 4RGOS 2WP9B 3W9CB 1WRIA 5LNK1 3HVDA 2LMCA 4P6VF 3GB1A 3KQ4A 5JXVA 5C2TB 3R2TA 3CIRB 2WNMA 4OHJA 2BS2B 4A90A 1FO4A 3ZGZA 3B9JA 3OWEB 4RF1A 1N60A 4RH6A 1I4RA 1TY0A 2EELA 3TEXA 2KN4A 1HZ6A 4TQ1A 3BYYB 4N59A 3AEFB 4LLGM 1JROA 2SEBD 3U52E 1SJED 4JWUC 3P63A 1V1PB 1MHHE 3RPFC 2PTLA 3O13A 2MJEA 3NVYA 5EE0A 4OZCA 2FE8A 2GB1A 4CQNA 3ZJTA 3BIID 1JRPA 1L6VA 5BYSA 3BK1A 2WLBA 2Z8LA 4C80A 1WXQA 3ETRA 4US9A 1N5XA 4HKQA 2EKIA 2IGGA 5HG2A 2QIEB 5BMGA 1AWDA 1NYQA 4HEA1 1L4ZB 1NVID 2M19A 3IT6B 1RWSA 1JCKB 3HRDD 3J9CA 1TZOA 3NVVA 3B2FA 3W5UB 3VR8B 4MH8A 1OQQA 3IT4B 3RFZB 4M0WA 1V8CA 2N9KA 3URYA 2V0GA 1CK1A 4RGNA 4ARCA 3TUOA 1GPXA 1ENFA 3TSSA 1D4BA 4NAMA 4YTNB 1XLOA 1MI0A 4OZAA 2JQRB 1I4GA 4YWGG 1YQ3B 2JZPA 2VZKB 1K52A 3ZJVA 2XNAC 4MACA 3LXFA 2XN9C 2JYTA 1ZPSA 2K9XA 1QOFA 2NTTA 3EGRA 2K0PA 1ET6A 1FCCC 1GTHA 2DYOA 3IAS1 4N6EB 2BT6A 1VJKA 2E6XA 2SAKA 4YTMB 2ZW0A 3KWLA 1SE2A 4MT5A 1GB1A 1K50A 2MJ3A 3AE1B 1YN5A 4WAFA 3AEAB 3TEWA 1FMAD 5GXGB 1EM7A 1LO5D 1I7HA 1ESFA 2AX5A 1AN8A 1E7PB 1ZXHA 4B0MA 4KGRA 1ROEA 1L0YB 1H7XA 1TJEA 4YSYB 2J42A 2WDRB 5AUKA 4HJGE 2BS4B 1GTEA 2NTSA 3EUB2 1PDXA 5G5HA 2RMMA 1ZUD2 1H7WA 5EE3A 2W55A 4IDIA 1SEBD 3SR6A 1JWUD 5AUIA 1JW9D 1L5PA 3AM9A 2YEPF 1J7CA 5G5GA 3ABVB 5FR3A 3HUIA 2JXTA 4B0EA 3UI3A 3AEBB 3AE5B 2IGHA 1AW7A 1VZ8A 1PGXA 1PUTA 1TKGA 4FXCA 1QF6A 1EWYC 3AEGB 1FRDA 1UGJA 3IXSA 4USAA 5HI1A 4RCOA 4HRSA 2WXOA 2QILA 2HDEA 1EU4A 1UUPA 3HVZA 3U7ZA 1KRHA 1TS2A 2W3RA 5H8YE 1SJHD 2E3TA 1F77A 1JWMD 4P16A 3C8YA 1N62A 1ZP0B 2LFIA 3GS2A 4H2AA 3VRBB 1L0XB 1QKZA 3Q8CA 4YSXB 1WSPA 1XXGA 3TEYA 2AQ2B 2JYEA 4ZOHC 1F0ZA 2PKOA 5FK9C 2WXFA 1KH0A 5FKAC 4XDDA 2L52A 3AE2B 5EE9A 2Y3AA 2TSSA 4AS1A 3P4PB 1D6EC 1RYJA 1EU3A 1CQVA 4OW0A 3ZQ4A 1GOZA 3AH7A 1C79A 1FXIA 3R2IA 4YTPB 1T5XD 1R7SA 2DLBA 1C78A 1FD6A 3SEBA 1VZ7A 2KDMA 2IJ0A 1HQRD 1DOXA 1FFVA 2Y5CA 3R8BA 2QMTA 4KKIA 3FAHA 4NAWB 4GDKB 1VRAB 2QJLA 2BBCA 3PZ8A 4EE2A 1YN3A 1UWMA 2KWDA 4L1BA 3AMZA 2LUMA 4YXDB 3BYTB 4HKZE 3BWUD 4JWSC 3T3OA 3KLSX 4A55A 3MJ5A 2IDYA 4ZRPA 2CJOA 2PW9A 1JWBD 3BVZA 3CWIA 3KWVA 4O1NA 3GP7A 5HHDG 5C3JB 4J3OD 1I4PA 1K53A 4REZA 2PVGC 1QOBA 2YEPB 3VR9B 4LK0M 2AQ3B 1I4XA 4ARIA 1DOYA 1N61A 1I4QA 1VDVA 4KKJA 3AE3B 4L23A 4OZBA 3NZ3A 4RFBA 2I38A 1YQ4B 5D3DA 1L0VB 3AE4B 5TSSA 1N5WA 3IAM1 5BMHA 4A9AA 2J4XA 2J53A 1BMLC 3PZ7A 2MEKA 2G9HD 1QLBB 2PVOD 3MFGA 2CU3A 3WCQA 1I4HA 2BB5A 2WS3B 1IGCA 2N7JA 4KGSA 4Q2JA 4A6QA 1VR9A 4XWWA 3U2SC 4ZHPA 2LHEA 1FNUA 4LTUA 1YJIA 2NMQA 1P7EA 1XLQA 4DXGA 2GRIA 1TKEA 1IUEA 3DWGC 4HROA 3ZJUA 3Q8BA 4C7ZA 3AEEB 3W5VB 2PMVA 1C77A 2K5PA 5D3IB 1ZXIA 5I4DA 1PFDA 4JE3B 1ZDXA 4ZHOA 2W3SA 4R3DA 1QOGA 1FM0D 2JU6X 4XWTA 1VZ6A 5BYQA 1EWCA 3Q8FA 3CF4A 3Q69A 3Q8EA 2OHFA 2BS3B 1MVKA 1FNWA 1FFUA 1J7BA 4RNAA 2LJIA 2WXPA 1C76A 4C7YA 3AECB 1XLNA 1F2RC 3AEDB 1YJJA 3W2DA 1K51A 1DGJA 4TQ0A 1TS5A 1ACCA 2KQ4X 5T8IA 2AQ1B 4D2KA 1E10A 3T3NA 2DYMA 2WDQB 1UWXA 2JSVX 1HXYD 2WXQA 1FXAA 2QEJC 5H92C 4OVZA 2GI9A 2LEKA 2WU5B 4XDCA 1NYRA 4N58A 1AYFA 1KLUD 1WYGA 1SB3C 1V97A 2G1EA 2RDHA 5MPOA 1E6EB 1XLPA 3VQIA 2H88B 1SIJA 1Y56A 1ZE3D 3NVWA 1RFKA 2V4IB 1CZPA 3MHZA 3P4RB 2L32A 1C4AA 3NUHB 1B1ZA 1C4PA 4WQMA 5BMIA 4TMAB 2RPVA 2KMMA 3EA6A 1QILA 1D5MC 2HTME 3E9SA 1RM6C 2N0SB 3L4PA 2IGDA 1XEEA 2Y5PA 3BVGA 2M0AA 2ON8A 4YT0B 4WURA 3W1SA 2FBWB 1V1PA 2J52A 4GLSC 2WXGA 3BK2A 2CJNA 1STEA 1FNVA 1A70A 2MH7A 3V3XA 2WU2B 1OFFA 1HA5A 1FEHA 1NEKB 1Q10A 2L1AA 1NI3A 1KLGD 5E6JA 4C56C 1TKYA 2INPE 2K3UA 1YNTE 3H8HA 5EE1A 1M4VA 4ITKA 1QOAA 3B2GA 2Q5WD 3I9V1 3MP9A 1SE3A 1MPEA 1WGKA 1C9FA 3P4QB 4A8XC 1BXTA 4IKGA 3NS1A 3DWMA 2WDVB 1ZDVA 3NRZA 1HZ5A 3NVZA 1E0ZA 3AV8A 4IOIE 1BUIC 2WXNA 5HFYA 4L2YA 3LB8C 2OEDA 2BTEA 1V1OA 1JWSD 2LHDA 1GT8A 1OQRA 2V3PA 1ZOYB 3ZYYX 2BW2A 3MC0B 1N63A 2H89B 1XF5L 2DBYA 2BYTA 3P1MA 2X38A 1E9MA 4GDLB 2WXIA 1J7AA 1TYGB 3Q8AA 1PGAA 1P7FA 4WIPA 1TY2A 2LGIA 3AN1A 2INNE 1PYWD 2R61A 2WXRA 1IBXA 4NZLB 3AE7B 4KGTA 3BZDB 3E56A 2IPKD 3AB5A 1CJEA 1UNSA 2PLPA 3FILA 2WXKA 3BVMA 4DXFA 2I2YA 3V05A 2DWQA 1B9RA 1FCLA 4UDUC 3U4EG 2RDGA 1ET9A 5D7GA 1TS4A 1GAQB 3LYYA 1FRRA 1MHXA 1SBBB 1C4CA 1FIQA 3AE9B 4YSZB 1YMHE 1KTKA 2WXMA 4NJCA 4RGMA 1IBXB 4WH4A 2W54A 2QSDA 2FUG1 3AE8B 1SF0A 1HEZE 3PO0A 3AE6B 4DQOC 1QQRA 1WWTA 3SFEB 1TS3A 4XE0A 1D5ZC 1YN4A 4MM3B 2ACZB 2N9LA 2BB6A 2MJDA 2L83A 2KACA 2K22A 2WXJA 3N9YC 2M56B 1JALA 1SE4A 1D5XC 1L6UA 2WQYB 2W82A 3I57A 2D5GA 2VZKD 4KX6B 1L4DB 2ONQA 4PT5A 1DYQA 1JWAD 1T3QA 2V3NA 1KFYB 1JQ4A 4RF0A 3P4SB 4TSSA 1GB4A 1T6BX 1PGBA 3P42A 1VLBA 2ICIA 3TEZA 1KF6B 2KAJA 4JPSA 1SSNA 2WXLA 1F2RI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE4 B;  1QT9 A;  1N5W A;  4US8 A;  2WU2 B;  1OFF A;  1NEK B;  1H7W A;  1ZUD 2;  2W55 A;  4IDI A;  5EE3 A;  1NI3 A;  1DOI A;  4A9A A;  1TKY A;  3SR6 A;  5AUI A;  1JW9 D;  2B76 B;  1L5P A;  3AM9 A;  3FC4 A;  1J7C A;  1QLB B;  3ABV B;  2PVO D;  4WWM A;  4ITK A;  2CU3 A;  3HUI A;  1QOA A;  5EE1 A;  3WCQ A;  4JX1 C;  3SFD B;  2JX5 A;  2Q5W D;  3AEB B;  3B2G A;  2WS3 B;  3AE5 B;  2PIA A;  1XO3 A;  1NEN B;  1WGK A;  3VRA B;  1PUT A;  2WP9 B;  3P4Q B;  3W9C B;  1WRI A;  4ZHP A;  1TKG A;  4FXC A;  1QF6 A;  3NS1 A;  4P6V F;  1EWY C;  3DWM A;  4LTU A;  1YJI A;  2WDV B;  3NRZ A;  3AEG B;  1FRD A;  4USA A;  1XLQ A;  5C2T B;  3CIR B;  3NVZ A;  1TKE A;  2BS2 B;  1IUE A;  3AV8 A;  1E0Z A;  4HRS A;  1FO4 A;  3DWG C;  4HRO A;  3LB8 C;  3B9J A;  1N60 A;  3HVZ A;  1GT8 A;  3AEE B;  1KRH A;  1OQR A;  3W5V B;  1ZOY B;  4C7Z A;  2W3R A;  5H8Y E;  3ZYY X;  2E3T A;  4N59 A;  1N63 A;  3AEF B;  2H89 B;  1JRO A;  2DBY A;  4JWU C;  1N62 A;  2K5P A;  3P1M A;  1ZP0 B;  3P63 A;  1E9M A;  3RPF C;  1ZXI A;  1PFD A;  1J7A A;  2MJE A;  1TYG B;  3NVY A;  5EE0 A;  4ZHO A;  3VRB B;  2W3S A;  1QOG A;  1FM0 D;  4YSX B;  1F0Z A;  3BII D;  4ZOH C;  1JRP A;  3CF4 A;  1L6V A;  2PKO A;  2OHF A;  2WLB A;  3AN1 A;  2BS3 B;  1WXQ A;  3ETR A;  4US9 A;  4C80 A;  1N5X A;  2EKI A;  1FFU A;  1J7B A;  3AE7 B;  2L52 A;  3AE2 B;  2QIE B;  1CJE A;  3AB5 A;  1AWD A;  1NYQ A;  5EE9 A;  3AEC B;  1NVI D;  4C7Y A;  2DWQ A;  2M19 A;  1B9R A;  1RWS A;  3P4P B;  3HRD D;  1RYJ A;  1XLN A;  5G5G A;  3NVV A;  3AED B;  3AH7 A;  1YJJ A;  1GAQ B;  1DGJ A;  1FXI A;  3B2F A;  1FRR A;  3W5U B;  4YTP B;  1FIQ A;  3AE9 B;  4YSZ B;  1R7S A;  3VR8 B;  1E10 A;  1OQQ A;  2WDQ B;  1V8C A;  1DOX A;  1FFV A;  1FXA A;  5H92 C;  2Y5C A;  2W54 A;  1GPX A;  3AE8 B;  3FAH A;  1SF0 A;  2LEK A;  3PO0 A;  4YTN B;  2WU5 B;  3AE6 B;  2QJL A;  1XLO A;  1NYR A;  1UWM A;  2JQR B;  4N58 A;  1WWT A;  1AYF A;  3SFE B;  1YQ3 B;  3AMZ A;  4YXD B;  1WYG A;  1SB3 C;  1V97 A;  2G1E A;  5MPO A;  1E6E B;  1XLP A;  4JWS C;  2ACZ B;  2H88 B;  1SIJ A;  2CJO A;  3LXF A;  3NVW A;  1JWB D;  1RFK A;  1CZP A;  2MJD A;  2K9X A;  2L83 A;  2K22 A;  3CWI A;  1QOF A;  2M56 B;  3P4R B;  1JAL A;  1GTH A;  4N6E B;  5C3J B;  2WQY B;  1L6U A;  1VJK A;  4YTM B;  2BT6 A;  4KX6 B;  4WQM A;  3KWL A;  1JWA D;  1T3Q A;  2MJ3 A;  3AE1 B;  2PVG C;  2KMM A;  3AEA B;  1QOB A;  3VR9 B;  2HTM E;  1KFY B;  1RM6 C;  2N0S B;  1JQ4 A;  3L4P A;  1FMA D;  5GXG B;  3P4S B;  1DOY A;  1L0V B;  4YT0 B;  1I7H A;  1N61 A;  2AX5 A;  1VDV A;  2FBW B;  1E7P B;  1VLB A;  1ROE A;  1KF6 B;  3AE3 B;  2KAJ A;  1H7X A;  1TJE A;  4YSY B;  5AUK A;  2WDR B;  2BS4 B;  2CJN A;  1GTE A;  1YQ4 B;  3EUB 2;  1PDX A;  1A70 A;  2MH7 A;  5G5H A; 
#chains in the Genus database with same CATH topology
 2WXH A;  2AWT A;  2O2V A;  4K7S A;  2B76 B;  4M02 A;  1UD7 A;  4W9K A;  3APF A;  2JX5 A;  1XCQ L;  1T0Q C;  4OHJ A;  2BS2 B;  2VH1 A;  1TT5 B;  3AI5 A;  4IM2 A;  4GOC A;  3ZGZ A;  4RF1 A;  4TQ1 A;  3PLU A;  3PRZ A;  2IZV B;  2SEB D;  4JGH B;  3A4R A;  1MHH E;  3U7D A;  3O13 A;  3NVY A;  5EE0 A;  2FCQ A;  2KZR A;  2KKC A;  3BII D;  4M8N A;  1JRP A;  1L6V A;  2JXX A;  3ONS A;  1WXQ A;  4C80 A;  4NJ7 A;  2XEW A;  1C1Y B;  2QIE B;  5BMG A;  1NYQ A;  1L4Z B;  2M19 A;  1JCK B;  2C60 A;  3NVV A;  4ZRK A;  3ML8 A;  1P9D U;  3VR8 B;  3RZF A;  4MH8 A;  1OQQ A;  2V0G A;  4ARC A;  1CK1 A;  2MBO A;  2KC1 A;  1UF0 A;  1V5T A;  2KTR B;  1GPX A;  3RI7 C;  2JZ3 B;  4NAM A;  3B08 A;  3N32 A;  5LLI A;  2PE9 A;  4YWG G;  1YQ3 B;  2JZP A;  2FCN A;  1K52 A;  3ZJV A;  2XNA C;  1V2Y A;  4DK5 A;  4GSW A;  3RCZ A;  2M8S A;  3EGR A;  3UIP B;  2YLM A;  2DYO A;  2BT6 A;  3N1Y C;  2D3A A;  3KWL A;  4MT5 A;  4XGA B;  3AEA B;  3A1Q B;  2IND C;  1FMA D;  1I7H A;  1ESF A;  4C4V B;  4IC7 B;  1AN8 A;  1E7P B;  3W1Y A;  1H7X A;  2JF5 A;  2J42 A;  2ZNV C;  4HJG E;  4WWN A;  4W9J A;  2RMM A;  4DXA B;  4IDI A;  4RM9 A;  1WXV A;  3SR6 A;  1G6J A;  3ABV B;  3ZO5 B;  3HUI A;  3DHI C;  3AEB B;  4HDQ A;  4MM3 A;  1PGX A;  4JQW C;  3M3J A;  2JT4 B;  1Z2M A;  4FJZ A;  4USA A;  2MX2 A;  4K3B A;  4ANW A;  2QIL A;  3MHS D;  2HDE A;  3RD2 A;  1UUP A;  1XQQ A;  5HKH A;  4TKN A;  1TS2 A;  1JWM D;  4P16 A;  2KDB A;  2PJH A;  4ICU A;  2GBN A;  1ZP0 B;  5TR5 A;  1R4N I;  3GS2 A;  3GOE A;  2JUO A;  3DBR I;  2KN5 A;  4MJS B;  2AQ2 B;  4ANU A;  2PKO A;  2IO3 B;  3VFK A;  2WXF A;  5FKA C;  2L52 A;  5EE9 A;  4LJO B;  1WX9 A;  3AH7 A;  1UBQ A;  1LFD A;  3R66 C;  1LGR A;  1T5X D;  3EFU A;  2DLB A;  1VZ7 A;  2DNF A;  2Y5C A;  3R8B A;  2QMT A;  2GLS A;  4GDK B;  3PZ8 A;  2KX3 A;  4HKZ E;  5GMV A;  3T3O A;  3KLS X;  3QWZ B;  5IA7 A;  2IY1 B;  2PW9 A;  3CWI A;  1ZGU B;  2V4L A;  5HHD G;  5C3J B;  4J3O D;  4K81 A;  5CX3 A;  3T9L A;  4IM3 A;  4LK0 M;  3ZKJ C;  1I4Q A;  1NI2 A;  1VDV A;  3WAO A;  3A9J A;  1WJ6 A;  2CS4 A;  4RFB A;  5J17 A;  2I38 A;  3H6N A;  2FIF A;  5TSS A;  3IAM 1;  4MGZ E;  4HK2 A;  5BMH A;  4A3O A;  2OJR A;  2BKF A;  3PZ7 A;  5L95 C;  3KYD D;  2G9H D;  2PVO D;  3CSF A;  2WS3 B;  4HWI B;  4EZK A;  4A6Q A;  4XWW A;  4ZHP A;  4LTU A;  2DEN B;  1XLQ A;  3PSE B;  3PTF C;  3DQV A;  3OJ3 A;  4MGY E;  3ZJU A;  2IY0 B;  2DAF A;  3W5V B;  5IO9 A;  2K5P A;  2MBB B;  2KT7 A;  2KDE B;  4XYC A;  2W3S A;  4CHK A;  3TMP B;  1E90 A;  3PT2 B;  1EWC A;  3Q8F A;  3CF4 A;  2BS3 B;  1R4M I;  1FNW A;  1FFU A;  2D3C A;  2WXP A;  4N9F 4;  5CHW A;  2INC C;  1YJJ A;  3W2D A;  1DGJ A;  1ACC A;  2C7N B;  5T8I A;  4D2K A;  3DBH B;  3T3N A;  1WY8 A;  1UWX A;  3QA8 A;  2WU5 B;  4PYU A;  3AXC A;  4XDC A;  1NYR A;  4LDT D;  3RUI B;  1KLU D;  4M01 A;  2DX5 B;  4NPN A;  1XLP A;  4GDL A;  1WGG A;  1HE8 A;  2V4I B;  1MFW A;  1V81 A;  3NUH B;  2ZCB A;  2J0K A;  1M94 A;  4WQM A;  3EA6 A;  1WIA A;  3FKY A;  2N0S B;  2IGD A;  3A9J B;  3BVG A;  3DVN V;  2WXG A;  3DHH C;  1A70 A;  2GBR A;  2WU2 B;  1HA5 A;  1NI3 A;  1KLG D;  1L2N A;  1P1A A;  1Z5S B;  3H8H A;  5EE1 A;  4ITK A;  1QOA A;  3B2G A;  2Q5W D;  1LXD A;  3VH4 B;  1MPE A;  1WGK A;  1C9F A;  4A8X C;  5D94 A;  1R4M B;  1S3S G;  1YIW A;  2LXC A;  1WZ0 A;  4L2Y A;  2OED A;  1GT8 A;  1OQR A;  2V3P A;  2AL6 A;  4KSL C;  1E9M A;  3IVF A;  1Y8R C;  1RLF A;  1WMH A;  1TYG B;  1PGA A;  2GBM A;  3K9O B;  4DWF A;  3SDL C;  1PYW D;  1F1H A;  5AEK B;  4NZL B;  4KGT A;  4IM0 A;  2IPK D;  2NCN A;  2KFK A;  3JSV A;  5E6N A;  4W9I A;  2Z0D B;  1GAQ B;  3AE9 B;  4YSZ B;  5DPW A;  4RGM A;  2GBJ A;  1WGD A;  3NHE B;  4WH4 A;  3V60 A;  3ZVV A;  3AE8 B;  3VVW B;  1WM3 A;  3MTN B;  1WJ4 A;  4NJ6 A;  4WJN A;  1WWT A;  1TS3 A;  3CF6 E;  2M1M A;  4W9L A;  1D5Z C;  2ACZ B;  2J0M A;  1Q0W B;  4S17 A;  2BB6 A;  2WXJ A;  3N9Y C;  2M56 B;  2UYZ B;  2NBW B;  1JAL A;  1L4D B;  3A33 B;  2L76 A;  4HVB A;  3NOB A;  4TSS A;  2FCS A;  4RM8 A;  3ZXR A;  1YX6 B;  2K8C A;  4I6P A;  3PHX B;  1KF6 B;  2G3Q B;  2QDF A;  4JPS A;  3VHT C;  3MC8 A;  1F2R I;  2GBK A;  1QT9 A;  2ZJD A;  1XT9 B;  2JWU A;  2HTH A;  1MJD A;  4FN2 A;  2MP2 B;  1V86 A;  2ZW1 A;  4DBG A;  1SGH A;  5AZG A;  1NEN B;  2ZNV B;  2HJ1 A;  1IP9 A;  1WRI A;  4HPP A;  3DVG X;  4J6I A;  4BOS C;  3R2T A;  4W9H A;  4A90 A;  4EUT A;  1FO4 A;  4AUQ C;  1T0S C;  4II2 B;  3HIZ A;  2ZZP B;  4A20 A;  4AJW A;  1I4R A;  2EEL A;  1OTR B;  3TEX A;  3BYY B;  4N59 A;  3JW0 X;  3U52 E;  2LUE A;  3JYU A;  2PTL A;  4OZC A;  3SU8 X;  2FE8 A;  2LZ6 A;  4CQN A;  3VUY A;  2Z8L A;  4US9 A;  2CHX A;  4XC2 A;  1N5X A;  4HKQ A;  1Q5W B;  1AWD A;  4HEA 1;  3HRD D;  1TZO A;  1U4A A;  3X23 A;  2D3B A;  2WYQ A;  2W9N A;  3GE8 C;  3IT4 B;  2LVP A;  2N9K A;  4RGN A;  3TUO A;  4IUM B;  4QAY A;  3PS6 A;  2JQR B;  1I4G A;  3AUL A;  4NAW A;  1GJZ A;  3LXF A;  3VXW A;  3GE3 C;  2O6V B;  2BWE S;  1J0G A;  1ET6 A;  1FCC C;  5C1Z A;  1VJK A;  2SAK A;  3RNG C;  4YTM B;  1WE7 A;  3R3M A;  2ZW0 A;  1I35 A;  2MJ3 A;  3AE1 B;  2I1J A;  2MSE D;  1EM7 A;  3MJW A;  2AX5 A;  1ZXH A;  4B0M A;  2KWU B;  4KGR A;  1L0Y B;  2KMC A;  2BS4 B;  4MEL A;  5LXI B;  5G5H A;  1ZUD 2;  2W55 A;  1SEB D;  3PGE A;  3A4S C;  3IG3 A;  1L5P A;  5AZF A;  1J7C A;  5G5G A;  4BKS A;  2Z59 B;  3AE5 B;  2IGH A;  1KM7 A;  1VZ8 A;  3CST A;  1PUT A;  2BYF A;  4PS7 A;  4FJV B;  1FRD A;  1UGJ A;  3IXS A;  2RDB C;  5D2M B;  4RCO A;  4XX5 A;  3DDC B;  1KRH A;  2KMA A;  3ZW3 A;  2PPH A;  1SJH D;  2OOB B;  3OLM D;  1F77 A;  3C8Y A;  2L05 A;  2BF8 B;  4B6W A;  1L0X B;  3RNA C;  3Q8C A;  4CYE A;  4G0N B;  3TEY A;  4ZOH C;  2Z0E B;  5DPT A;  1KH0 A;  5EDS A;  3L17 A;  3AE2 B;  3TIX A;  2Y3A A;  3ML9 A;  3P4P B;  3ZQ4 A;  4OW0 A;  1EU3 A;  1FXI A;  4YTP B;  1FD6 A;  4MH0 E;  2IJ0 A;  3VTV A;  3UQB A;  1DOX A;  1FFV A;  1HTO A;  1FPY A;  3FAH A;  3QJZ A;  4NAW B;  1VRA B;  4EE2 A;  4HJK A;  3AMZ A;  3BYT B;  3BWU D;  4JWS C;  4DHZ E;  1WR1 A;  4A55 A;  2IDY A;  2K1F A;  2CJO A;  4ZRP A;  4DHJ D;  2BWF A;  3OJ4 B;  3KWV A;  3GP7 A;  2HD5 B;  1ZKH A;  2PVG C;  1QOB A;  1HTQ A;  2AQ3 B;  2V1Y A;  1N61 A;  5C23 A;  3PRE A;  4L23 A;  4F1S A;  2IYD B;  3BIN A;  4KIK B;  2WWZ A;  4A9A A;  2J53 A;  1WYW B;  1LQB A;  2LI5 A;  3MFG A;  2CU3 A;  1WXA A;  4LNF A;  2K6D B;  2ZEQ A;  4Q2J A;  4KGS A;  3U2S C;  1GC7 A;  2LHE A;  1FNU A;  4GIV A;  4K3C A;  1P7E A;  2GRI A;  1IUE A;  3Q8B A;  3H7P A;  4C7Z A;  4AP4 C;  1XD3 B;  1C77 A;  1PFD A;  4FAD A;  4IWP A;  4LNN A;  3ECI A;  3NZS A;  1QOG A;  1FM0 D;  4E74 A;  3Q8E A;  2OHF A;  1J7B A;  2A5U A;  1XLN A;  4RMA A;  2RR9 A;  2MBH A;  4WWO A;  1E10 A;  2KLC A;  3OAW A;  1MG4 A;  1GNU A;  1FXA A;  2QEJ C;  4OVZ A;  3HHM A;  2GI9 A;  4KVG B;  2G4D B;  4FHK A;  4DHJ B;  1P98 A;  4N58 A;  1AYF A;  1P0R A;  2N1V A;  4FLH A;  2LVO A;  1SB3 C;  5MPO A;  2RDH A;  3VQI A;  1SIJ A;  2ZCC A;  3DVG Y;  1Y56 A;  2KQ7 A;  3VTW A;  3MHZ A;  3PRP B;  3V6C B;  2L32 A;  4TMA B;  2FUH B;  2HTM E;  1RM6 C;  3OG5 A;  3L4P A;  2Y5P A;  2M0A A;  4YT0 B;  4M8M A;  4WUR A;  5J18 A;  2J52 A;  2BYV E;  4GLS C;  2CJN A;  1FNV A;  3DVN U;  3LJ3 A;  2MH7 A;  4LNI A;  4WJO A;  4AOF A;  2EMS A;  1OFF A;  3NJT A;  4EEW A;  3HM3 A;  3WAM A;  2OJW A;  2MHJ A;  1M4V A;  1WRD B;  2C5L C;  3I9V 1;  1MG8 A;  1KOT A;  3PVL A;  1WGH A;  4BKG A;  3KVF B;  3RNE C;  3DWM A;  3QQ8 B;  3AV8 A;  4IOI E;  1BUI C;  2D10 A;  5HFY A;  2QHO A;  4I6N B;  3PHW B;  1ZOY B;  5D6J B;  1GUA B;  1RRB A;  3Q2A C;  3U30 A;  1TY2 A;  2C7H A;  2INN E;  1UNS A;  2MP2 A;  1B9R A;  4W9G A;  2DWQ A;  1D3Z A;  2RDG A;  3VUW A;  1MHX A;  1C4C A;  1BT0 A;  1KTK A;  2WXM A;  2AEH A;  1R4N B;  2KJH B;  1SF0 A;  3PO0 A;  3A9K A;  2EKE C;  1YQB A;  2MA9 B;  2LVQ A;  5CHV C;  3WAN A;  1QQR A;  5DPS A;  2R2O A;  3VAW A;  2JWZ A;  4XE0 A;  1YN4 A;  2D2Q A;  3L16 A;  3ZNI D;  3QAQ A;  1UBI A;  3Q3N C;  2K22 A;  5KHO A;  4GDK A;  2W82 A;  3I57 A;  1D5X C;  2WQY B;  2UWQ A;  1QZE A;  2VZK D;  1EUV B;  1DYQ A;  1ISN A;  4HPM B;  2NPT B;  4RF0 A;  2REX A;  1K8R B;  5E6P A;  4LCD E;  3DCG A;  2M0X A;  1VLB A;  2ICI A;  3P42 A;  2KJR A;  3TEZ A;  2DHZ A;  2WXL A;  3ZIM A;  4P6V F;  2MQJ A;  4EKU A;  3L10 B;  4ZYS A;  4US8 A;  4IG7 B;  5BYR A;  5JHA A;  2GOW A;  2HE7 A;  2KTF A;  1WI0 A;  5JH5 C;  4ZRQ A;  1IGD A;  4WWM A;  1WX7 A;  3FIL B;  4RGT A;  3ZRF A;  2PIA A;  3ZDM C;  2AYO B;  1XO3 A;  3VRA B;  2WP9 B;  3QC8 B;  3HVD A;  3Q3O C;  3GB1 A;  3NY5 A;  5C2T B;  5L83 A;  3PZD A;  3N1Z C;  4B95 A;  3UQA A;  1V49 A;  4NQL B;  4RH6 A;  3UIO B;  2KN4 A;  2J0J A;  3ZRC A;  1JRO A;  1CMX B;  4IWQ A;  3P63 A;  3RPF C;  2MJE A;  3L0W B;  3H9D A;  2GB1 A;  4P1B C;  2DAJ A;  3ZJT A;  1TIF A;  1WZ3 A;  3BK1 A;  3DPD A;  4BKT A;  2O6V A;  2KQS A;  3RYT A;  2MBQ A;  2IGG A;  5KHQ A;  5HG2 A;  3IT6 B;  1RWS A;  3J9C A;  1J8C A;  3R7Q A;  4DHZ B;  3B2F A;  3A1Q A;  3RFZ B;  4M0W A;  3X0W A;  1V8C A;  5JHB A;  4LNK A;  3DBR B;  3N3K B;  3ZUN A;  1E8Y A;  3TSS A;  1D4B A;  4YTN B;  1SIF A;  4OZA A;  5DCN A;  4GGQ A;  2NR2 A;  2VZK B;  4II3 B;  3RNC C;  4NNJ B;  2LRU A;  4HXD A;  2JYT A;  2K9X A;  1QOF A;  2NTT A;  3IAS 1;  3DBL I;  2MW5 A;  2NPT A;  1SE2 A;  2K6Q A;  3DBH I;  5IP4 D;  1GB1 A;  1YN5 A;  4WAF A;  1WXM A;  3TEW A;  1EF1 A;  5GXG B;  1LO5 D;  3KW5 B;  2NS5 A;  4G11 A;  5AUK A;  3NS8 A;  1V5O A;  2WDR B;  2CHW A;  1GTE A;  2NTS A;  3RT3 B;  1PDX A;  2KK8 A;  2KWC A;  5EE3 A;  3AM9 A;  1IPG A;  2R2Q A;  2YEP F;  5FR3 A;  2JXT A;  4B0E A;  4BBN C;  3UI3 A;  2XK5 A;  1AW7 A;  2KD0 A;  3W1S C;  2KVZ A;  1TKG A;  4W9E A;  1EWY C;  5HI1 A;  2L00 B;  2KC2 A;  3HVZ A;  3M63 B;  5LXH A;  2W3R A;  3I3T B;  4GXB A;  1TBE A;  2B3A A;  1N62 A;  1VCB A;  2MWS B;  2LFI A;  3ZLZ A;  3CMM B;  4BOZ B;  2BYE A;  4GN1 A;  3VRB B;  2WX0 A;  1QKZ A;  3AU5 A;  1XXG A;  4I6L B;  1WJU A;  3PPA A;  1F0Z A;  1H4R A;  2G45 B;  4XDD A;  3TCA A;  2TSS A;  1D6E C;  1RYJ A;  4C4V A;  1CQV A;  2N9E B;  1WGY A;  2L8J A;  4M0W B;  1GOZ A;  2V9H A;  3R2I A;  2LGY A;  1Q1O A;  1C78 A;  3DHG C;  3SEB A;  3KH0 A;  3QHT A;  3RN9 C;  1E8W A;  2DZJ A;  2Y5B B;  2BBC A;  1YN3 A;  1UWM A;  2LGX A;  2LUM A;  4YXD B;  4F7Z A;  2JZZ A;  1YOV B;  2L0F A;  3IFW B;  3MJ5 A;  2RSU A;  2DZI A;  1JWB D;  1WGR A;  3BVZ A;  2DZM A;  3Q3F A;  4MEM A;  1K53 A;  4K7U A;  2N9P C;  2RPQ A;  2RD0 A;  3M95 A;  1I4X A;  4KIK A;  1DOY A;  2L0T A;  3GZN B;  4EZJ A;  4KKJ A;  3AE3 B;  3QX1 A;  3UF8 A;  1RFA A;  2PE6 B;  3DBL B;  1TZ1 A;  3EC8 A;  2KYW A;  1YQ4 B;  4BVU C;  5D3D A;  3SHQ A;  1P3Q U;  3AE4 B;  1N5W A;  4C00 A;  3DOW A;  3ZDT A;  2WHI A;  4A3P A;  1QLB B;  3WCQ A;  1I4H A;  3N30 A;  1VR9 A;  2XK5 B;  2NMQ A;  2BKR B;  1TKE A;  1OEY J;  4MSM B;  1C3T A;  3DWG C;  4HRO A;  4X57 B;  5IKC M;  4B9K A;  4MDK E;  2PMV A;  2KJ6 A;  1TTN A;  1ZDX A;  4ZHO A;  3ZNG C;  3Q6B A;  2JU6 X;  5IN7 A;  4XWT A;  1VZ6 A;  2JRH A;  5J2R A;  2WDT B;  2HJ8 A;  3Q69 A;  2D3G A;  4KDL B;  2N4F A;  4RNA A;  2LJI A;  3AEC B;  2N7D A;  3AED B;  3UIN B;  1TS5 A;  1E5W A;  4FJY A;  4G3X B;  2DYM A;  1L7Y A;  2JSV X;  2A4Z A;  2J7Q B;  2LEK A;  2M4N A;  4HLE A;  2FNJ B;  2KVR A;  1WYG A;  1V97 A;  2G1E A;  1E6E B;  3WIM A;  3EEC A;  1ZE3 D;  2LRW A;  2LXA A;  1VD2 A;  4HCP B;  3WA0 A;  1CZP A;  2KTR A;  2IO2 B;  3P4R B;  3O65 B;  1B1Z A;  3APC A;  5BMI A;  1OEY A;  2RPV A;  2KMM A;  1D5M C;  3E9S A;  2ON8 A;  3W1S A;  2FBW B;  3I5J C;  3BK2 A;  1UEL A;  3SD5 A;  2AL3 A;  4IWO A;  3V3X A;  2L1A A;  5E6J A;  4C56 C;  3C19 A;  2K3U A;  4MJS A;  3VH3 B;  1FXT B;  1SE3 A;  3P4Q B;  1BXT A;  4IKG A;  3NS1 A;  3EHV A;  1ZDV A;  2XBB C;  1LM8 B;  1HZ5 A;  3NVZ A;  1E0Z A;  2C9W B;  2WXN A;  2LD9 A;  2LHD A;  2ZPN A;  3ZYY X;  2BW2 A;  1N63 A;  4JIO U;  1XF5 L;  4AJY B;  5IOI A;  3P1M A;  2WXI A;  1OGW A;  2YVC A;  1J7A A;  3A9K B;  4ZYN A;  2LGI A;  3AN1 A;  1E7V A;  2R61 A;  1IBX A;  3TJP A;  3E56 A;  3NG0 A;  3AB5 A;  3IHP C;  4KSK C;  4EOY A;  3FIL A;  2WXK A;  2I2Y A;  1FCL A;  2K25 A;  3PV1 A;  1TS4 A;  3LYY A;  5G2N A;  1FRR A;  4ZDV A;  2NBU A;  1YMH E;  4E71 A;  2CU1 A;  5FR6 A;  1IBX B;  4G50 A;  2W54 A;  3K9P B;  2FUG 1;  5E6O A;  1OQY A;  3L54 A;  3SFE B;  4BAX A;  4BFR A;  2MJD A;  2GMI C;  2L83 A;  3RUL A;  1E8Z A;  1L6U A;  4PS3 A;  2O6V D;  1WR6 E;  4KX6 B;  2ONQ A;  4ANV A;  4PT5 A;  3LDZ E;  4GU2 A;  1S1Q B;  2V3N A;  1KFY B;  1JQ4 A;  3ZTC A;  3P4S B;  1GB4 A;  1PGB A;  2IO0 B;  4F8C B;  3H7S A;  4PK1 A;  2KAJ A;  4S0R A;  4YL8 A;  1SSN A;  3U8Z A;  2DZK A;  3V6E B;  2L3Z A;  2I1K A;  4KDI C;  1JML A;  3WAP A;  1YJ1 A;  1DOI A;  2KX0 A;  1SXT A;  1E7U A;  3FC4 A;  3RNB C;  1XCT L;  4ZRI A;  4JX1 C;  4AQ7 A;  3SFD B;  4RGO S;  3W9C B;  5LNK 1;  2LMC A;  4MGK E;  3KQ4 A;  5JXV A;  2BQQ A;  3CIR B;  2WNM A;  2M17 A;  3B9J A;  3OWE B;  1N60 A;  3T8M A;  1NBF C;  1TY0 A;  2LAS A;  1T0Y A;  1HZ6 A;  2FAZ A;  3AEF B;  4LLG M;  3Q3J A;  2MBE A;  1SJE D;  4K7W A;  4JWU C;  1V1P B;  1PQS A;  1WFY A;  3S2A A;  4BBN F;  5BYS A;  2WLB A;  3ETR A;  4GMV A;  3N1X C;  2EKI A;  3QAR A;  2VRR B;  2JY6 A;  1NVI D;  3UGB B;  1WH3 A;  3NZU A;  1WX8 A;  3APD A;  2NBV B;  3W5U B;  2D07 B;  2JRI B;  3URY A;  3ENE A;  3RZW C;  1JRU A;  1ENF A;  1XLO A;  1MI0 A;  2KNB A;  4BZA A;  2ZVN A;  5G55 A;  4MAC A;  3I63 C;  2XN9 C;  1ZPS A;  2QC8 A;  2K0P A;  1GTH A;  4N6E B;  2E6X A;  4ASW C;  3GZN I;  3L08 A;  1K50 A;  2MRP A;  2LGD A;  2IO1 B;  4ANX A;  2N1W A;  4LJP B;  1NDD A;  1ROE A;  2V3S A;  1TJE A;  4YSY B;  3ZNH B;  3EUB 2;  4ZRJ A;  1H7W A;  2KFJ A;  1V6E A;  1JWU D;  5AUI A;  1JW9 D;  1AAR A;  2KWV B;  3VTU A;  4W9D A;  1EO6 A;  1UGM A;  2L7R A;  3P2B A;  1QF6 A;  4FXC A;  3KUZ A;  1TGZ B;  2KDI A;  3AEG B;  4HRS A;  2K8H A;  2WXO A;  1WM2 A;  1EU4 A;  3U7Z A;  5H8Y E;  2LWP A;  3IBE A;  2MCN B;  2E3T A;  4KZC A;  4FHJ A;  1UZX B;  4TUU A;  4H2A A;  4HCN B;  2K39 A;  4LNO A;  3HM6 X;  4YSX B;  1WSP A;  1GC6 A;  2JYE A;  5FK9 C;  1A5R A;  3QK0 A;  4AWJ A;  1F9J A;  4AS1 A;  2IBI B;  2WGS A;  1C79 A;  2LJ5 A;  4BKS D;  3KUD B;  5CHF A;  1R7S A;  1KJT A;  2KDM A;  1HQR D;  2BVC A;  1WJN A;  4KKI A;  4PYZ A;  2QJL A;  3H7P B;  3PLV A;  1EF5 A;  3RMK C;  3KUC B;  2KWD A;  4L1B A;  3EFC A;  3N20 C;  3KYC D;  2CR5 A;  4XZ4 A;  2FCM A;  4O1N A;  3B0A A;  1I4P A;  4REZ A;  4NQK E;  2YEP B;  3VR9 B;  3WAL A;  4W9C A;  4ARI A;  4E3C A;  4OZB A;  5CTR C;  4FBJ B;  3NZ3 A;  4ICV A;  1L0V B;  3Q3M C;  5BO4 B;  4WAA A;  2J4X A;  1BML C;  2MEK A;  3AU4 A;  3DBS A;  4HPL B;  4DDI D;  2BB5 A;  3TL5 A;  1IGC A;  2N7J A;  3Q14 C;  1WE6 A;  1YJI A;  4HDO A;  2CHZ A;  4DXG A;  4CO7 A;  3ZNZ B;  2KDF B;  1SE9 A;  2JPH A;  3AEE B;  2ZVO A;  2D11 A;  4OVV A;  3B1L X;  4M00 A;  1V80 A;  5D3I B;  4KZ0 A;  1ZXI A;  5I4D A;  4JE3 B;  4JLC A;  1E8X A;  2KLG A;  4P7I A;  4R3D A;  5BYQ A;  2KAN A;  1KLV A;  3ZXV A;  2BGF A;  2KOX A;  1MVK A;  4WQO B;  3ZTD A;  1C76 A;  1X1M A;  3VUX A;  4C7Y A;  2KHW B;  1IYF A;  2VH2 A;  1F2R C;  1WF9 A;  1K51 A;  4TQ0 A;  2KFK B;  2WX1 A;  2KQ4 X;  2AQ1 B;  2NVU I;  4FA6 A;  2WDQ B;  1HXY D;  2WXQ A;  5H92 C;  5DPR A;  3L13 A;  4LDT B;  4P1C C;  1T0R C;  1WXS A;  4MSQ B;  2ZPY A;  2QCZ A;  2KXJ A;  3BY4 B;  4JL9 A;  1YX5 B;  3V61 A;  2H88 B;  3NVW A;  1RFK A;  3V62 A;  2EMT A;  1N6Z A;  1YD8 U;  4TV3 A;  1C4A A;  1C4P A;  4EFO A;  3RNF C;  2LGS A;  1QIL A;  5AZH A;  4K1R B;  1XEE A;  1V1P A;  3M62 B;  4EZL A;  1STE A;  2C7M B;  4WJP A;  1FEH A;  1NEK B;  1J19 A;  1Q10 A;  2DYB A;  1TKY A;  2INP E;  2G4S A;  1YNT E;  3ALB A;  3MP9 A;  2KO3 A;  2X8X X;  3QIJ A;  2FID A;  4NY0 A;  2WDV B;  3JVZ X;  3NRZ A;  1RAX A;  1I42 A;  2MLB A;  3QCA A;  3LB8 C;  3HK0 A;  2BTE A;  1V1O A;  1JWS D;  5IAA C;  4KV2 A;  3MC0 B;  2H89 B;  2DBY A;  3D32 A;  4W9F A;  2BYT A;  2X38 A;  4GDL B;  2N7E A;  2PEA A;  2ASQ A;  3MC9 A;  3Q8A A;  1P7F A;  1F52 A;  4WIP A;  4GB9 A;  2WXR A;  3AE7 B;  3BZD B;  1CJE A;  4DXF A;  2PLP A;  3BVM A;  3V05 A;  4UDU C;  3U4E G;  1ZW7 A;  1ET9 A;  5D7G A;  3VDZ A;  1SBB B;  1FIQ A;  1UH6 A;  4NJC A;  4MGI E;  3H1U A;  2QSD A;  3PRM B;  3TBL D;  1HEZ E;  3AE6 B;  4IW0 A;  1V9J A;  4DDG D;  1WMH B;  4OVU A;  4DQO C;  2K8B A;  2BPS A;  4MM3 B;  5JZE B;  4URK A;  2N9L A;  3C0R B;  2CKH B;  2JVC A;  2KAC A;  4WJQ A;  4WWP A;  1SE4 A;  3JSV B;  2D5G A;  1T3Q A;  1JWA D;  4PS8 A;  3R7R A;  2N9X A;  2RGF A;  2O2V B;  1T6B X;  4ACF A;  1GG3 A;  2UU7 A;  4FUL A;  1H8C A; 
#chains in the Genus database with same CATH homology
 4ZYS A;  1QT9 A;  4US8 A;  1JML A;  5BYR A;  2WXH A;  1DOI A;  2JWU A;  1SXT A;  2B76 B;  3FC4 A;  4ZRQ A;  1IGD A;  4WWM A;  3FIL B;  1XCT L;  4JX1 C;  4RGT A;  4AQ7 A;  3SFD B;  2JX5 A;  1XCQ L;  2ZW1 A;  2PIA A;  1XO3 A;  1NEN B;  3VRA B;  4RGO S;  2WP9 B;  3W9C B;  1WRI A;  5LNK 1;  3HVD A;  2LMC A;  4P6V F;  3GB1 A;  3KQ4 A;  5JXV A;  5C2T B;  3R2T A;  3CIR B;  2WNM A;  4OHJ A;  2BS2 B;  4A90 A;  1FO4 A;  3ZGZ A;  3B9J A;  3OWE B;  4RF1 A;  1N60 A;  4RH6 A;  1I4R A;  1TY0 A;  2EEL A;  3TEX A;  2KN4 A;  1HZ6 A;  4TQ1 A;  3BYY B;  4N59 A;  3AEF B;  4LLG M;  1JRO A;  2SEB D;  3U52 E;  1SJE D;  4JWU C;  3P63 A;  1V1P B;  1MHH E;  3RPF C;  2PTL A;  3O13 A;  2MJE A;  3NVY A;  5EE0 A;  4OZC A;  2FE8 A;  2GB1 A;  4CQN A;  3ZJT A;  3BII D;  1JRP A;  1L6V A;  5BYS A;  3BK1 A;  2WLB A;  2Z8L A;  4C80 A;  1WXQ A;  3ETR A;  4US9 A;  1N5X A;  4HKQ A;  2EKI A;  2IGG A;  5HG2 A;  2QIE B;  5BMG A;  1AWD A;  1NYQ A;  4HEA 1;  1L4Z B;  1NVI D;  2M19 A;  3IT6 B;  1RWS A;  1JCK B;  3HRD D;  3J9C A;  1TZO A;  3NVV A;  3B2F A;  3W5U B;  3VR8 B;  4MH8 A;  1OQQ A;  3IT4 B;  3RFZ B;  4M0W A;  1V8C A;  2N9K A;  3URY A;  2V0G A;  1CK1 A;  4RGN A;  4ARC A;  3TUO A;  1GPX A;  1ENF A;  3TSS A;  1D4B A;  4NAM A;  4YTN B;  1XLO A;  1MI0 A;  4OZA A;  2JQR B;  1I4G A;  4YWG G;  1YQ3 B;  2JZP A;  2VZK B;  1K52 A;  3ZJV A;  2XNA C;  4MAC A;  3LXF A;  2XN9 C;  2JYT A;  1ZPS A;  2K9X A;  1QOF A;  2NTT A;  3EGR A;  2K0P A;  1ET6 A;  1FCC C;  1GTH A;  2DYO A;  3IAS 1;  4N6E B;  2BT6 A;  1VJK A;  2E6X A;  2SAK A;  4YTM B;  2ZW0 A;  3KWL A;  1SE2 A;  4MT5 A;  1GB1 A;  1K50 A;  2MJ3 A;  3AE1 B;  1YN5 A;  4WAF A;  3AEA B;  3TEW A;  1FMA D;  5GXG B;  1EM7 A;  1LO5 D;  1I7H A;  1ESF A;  2AX5 A;  1AN8 A;  1E7P B;  1ZXH A;  4B0M A;  4KGR A;  1ROE A;  1L0Y B;  1H7X A;  1TJE A;  4YSY B;  2J42 A;  2WDR B;  5AUK A;  4HJG E;  2BS4 B;  1GTE A;  2NTS A;  3EUB 2;  1PDX A;  5G5H A;  2RMM A;  1ZUD 2;  1H7W A;  5EE3 A;  2W55 A;  4IDI A;  1SEB D;  3SR6 A;  1JWU D;  5AUI A;  1JW9 D;  1L5P A;  3AM9 A;  2YEP F;  1J7C A;  5G5G A;  3ABV B;  5FR3 A;  3HUI A;  2JXT A;  4B0E A;  3UI3 A;  3AEB B;  3AE5 B;  2IGH A;  1AW7 A;  1VZ8 A;  1PGX A;  1PUT A;  1TKG A;  4FXC A;  1QF6 A;  1EWY C;  3AEG B;  1FRD A;  1UGJ A;  3IXS A;  4USA A;  5HI1 A;  4RCO A;  4HRS A;  2WXO A;  2QIL A;  2HDE A;  1EU4 A;  1UUP A;  3HVZ A;  3U7Z A;  1KRH A;  1TS2 A;  2W3R A;  5H8Y E;  1SJH D;  2E3T A;  1F77 A;  1JWM D;  4P16 A;  3C8Y A;  1N62 A;  1ZP0 B;  2LFI A;  3GS2 A;  4H2A A;  3VRB B;  1L0X B;  1QKZ A;  3Q8C A;  4YSX B;  1WSP A;  1XXG A;  3TEY A;  2AQ2 B;  2JYE A;  4ZOH C;  1F0Z A;  2PKO A;  5FK9 C;  2WXF A;  1KH0 A;  5FKA C;  4XDD A;  2L52 A;  3AE2 B;  5EE9 A;  2Y3A A;  2TSS A;  4AS1 A;  3P4P B;  1D6E C;  1RYJ A;  1EU3 A;  1CQV A;  4OW0 A;  3ZQ4 A;  1GOZ A;  3AH7 A;  1C79 A;  1FXI A;  3R2I A;  4YTP B;  1T5X D;  1R7S A;  2DLB A;  1C78 A;  1FD6 A;  3SEB A;  1VZ7 A;  2KDM A;  2IJ0 A;  1HQR D;  1DOX A;  1FFV A;  2Y5C A;  3R8B A;  2QMT A;  4KKI A;  3FAH A;  4NAW B;  4GDK B;  1VRA B;  2QJL A;  2BBC A;  3PZ8 A;  4EE2 A;  1YN3 A;  1UWM A;  2KWD A;  4L1B A;  3AMZ A;  2LUM A;  4YXD B;  3BYT B;  4HKZ E;  3BWU D;  4JWS C;  3T3O A;  3KLS X;  4A55 A;  3MJ5 A;  2IDY A;  4ZRP A;  2CJO A;  2PW9 A;  1JWB D;  3BVZ A;  3CWI A;  3KWV A;  4O1N A;  3GP7 A;  5HHD G;  5C3J B;  4J3O D;  1I4P A;  1K53 A;  4REZ A;  2PVG C;  1QOB A;  2YEP B;  3VR9 B;  4LK0 M;  2AQ3 B;  1I4X A;  4ARI A;  1DOY A;  1N61 A;  1I4Q A;  1VDV A;  4KKJ A;  3AE3 B;  4L23 A;  4OZB A;  3NZ3 A;  4RFB A;  2I38 A;  1YQ4 B;  5D3D A;  1L0V B;  3AE4 B;  5TSS A;  1N5W A;  3IAM 1;  5BMH A;  4A9A A;  2J4X A;  2J53 A;  1BML C;  3PZ7 A;  2MEK A;  2G9H D;  1QLB B;  2PVO D;  3MFG A;  2CU3 A;  3WCQ A;  1I4H A;  2BB5 A;  2WS3 B;  1IGC A;  2N7J A;  4KGS A;  4Q2J A;  4A6Q A;  1VR9 A;  4XWW A;  3U2S C;  4ZHP A;  2LHE A;  1FNU A;  4LTU A;  1YJI A;  2NMQ A;  1P7E A;  1XLQ A;  4DXG A;  2GRI A;  1TKE A;  1IUE A;  3DWG C;  4HRO A;  3ZJU A;  3Q8B A;  4C7Z A;  3AEE B;  3W5V B;  2PMV A;  1C77 A;  2K5P A;  5D3I B;  1ZXI A;  5I4D A;  1PFD A;  4JE3 B;  1ZDX A;  4ZHO A;  2W3S A;  4R3D A;  1QOG A;  1FM0 D;  2JU6 X;  4XWT A;  1VZ6 A;  5BYQ A;  1EWC A;  3Q8F A;  3CF4 A;  3Q69 A;  3Q8E A;  2OHF A;  2BS3 B;  1MVK A;  1FNW A;  1FFU A;  1J7B A;  4RNA A;  2LJI A;  2WXP A;  1C76 A;  4C7Y A;  3AEC B;  1XLN A;  1F2R C;  3AED B;  1YJJ A;  3W2D A;  1K51 A;  1DGJ A;  4TQ0 A;  1TS5 A;  1ACC A;  2KQ4 X;  5T8I A;  2AQ1 B;  4D2K A;  1E10 A;  3T3N A;  2DYM A;  2WDQ B;  1UWX A;  2JSV X;  1HXY D;  2WXQ A;  1FXA A;  2QEJ C;  5H92 C;  4OVZ A;  2GI9 A;  2LEK A;  2WU5 B;  4XDC A;  1NYR A;  4N58 A;  1AYF A;  1KLU D;  1WYG A;  1SB3 C;  1V97 A;  2G1E A;  2RDH A;  5MPO A;  1E6E B;  1XLP A;  3VQI A;  2H88 B;  1SIJ A;  1Y56 A;  1ZE3 D;  3NVW A;  1RFK A;  2V4I B;  1CZP A;  3MHZ A;  3P4R B;  2L32 A;  1C4A A;  3NUH B;  1B1Z A;  1C4P A;  4WQM A;  5BMI A;  4TMA B;  2RPV A;  2KMM A;  3EA6 A;  1QIL A;  1D5M C;  2HTM E;  3E9S A;  1RM6 C;  2N0S B;  3L4P A;  2IGD A;  1XEE A;  2Y5P A;  3BVG A;  2M0A A;  2ON8 A;  4YT0 B;  4WUR A;  3W1S A;  2FBW B;  1V1P A;  2J52 A;  4GLS C;  2WXG A;  3BK2 A;  2CJN A;  1STE A;  1FNV A;  1A70 A;  2MH7 A;  3V3X A;  2WU2 B;  1OFF A;  1HA5 A;  1FEH A;  1NEK B;  1Q10 A;  2L1A A;  1NI3 A;  1KLG D;  5E6J A;  4C56 C;  1TKY A;  2INP E;  2K3U A;  1YNT E;  3H8H A;  5EE1 A;  1M4V A;  4ITK A;  1QOA A;  3B2G A;  2Q5W D;  3I9V 1;  3MP9 A;  1SE3 A;  1MPE A;  1WGK A;  1C9F A;  3P4Q B;  4A8X C;  1BXT A;  4IKG A;  3NS1 A;  3DWM A;  2WDV B;  1ZDV A;  3NRZ A;  1HZ5 A;  3NVZ A;  1E0Z A;  3AV8 A;  4IOI E;  1BUI C;  2WXN A;  5HFY A;  4L2Y A;  3LB8 C;  2OED A;  2BTE A;  1V1O A;  1JWS D;  2LHD A;  1GT8 A;  1OQR A;  2V3P A;  1ZOY B;  3ZYY X;  2BW2 A;  3MC0 B;  1N63 A;  2H89 B;  1XF5 L;  2DBY A;  2BYT A;  3P1M A;  2X38 A;  1E9M A;  4GDL B;  2WXI A;  1J7A A;  1TYG B;  3Q8A A;  1PGA A;  1P7F A;  4WIP A;  1TY2 A;  2LGI A;  3AN1 A;  2INN E;  1PYW D;  2R61 A;  2WXR A;  1IBX A;  4NZL B;  3AE7 B;  4KGT A;  3BZD B;  3E56 A;  2IPK D;  3AB5 A;  1CJE A;  1UNS A;  2PLP A;  3FIL A;  2WXK A;  3BVM A;  4DXF A;  2I2Y A;  3V05 A;  2DWQ A;  1B9R A;  1FCL A;  4UDU C;  3U4E G;  2RDG A;  1ET9 A;  5D7G A;  1TS4 A;  1GAQ B;  3LYY A;  1FRR A;  1MHX A;  1SBB B;  1C4C A;  1FIQ A;  3AE9 B;  4YSZ B;  1YMH E;  1KTK A;  2WXM A;  4NJC A;  4RGM A;  1IBX B;  4WH4 A;  2W54 A;  2QSD A;  2FUG 1;  3AE8 B;  1SF0 A;  1HEZ E;  3PO0 A;  3AE6 B;  4DQO C;  1QQR A;  1WWT A;  3SFE B;  1TS3 A;  4XE0 A;  1D5Z C;  1YN4 A;  4MM3 B;  2ACZ B;  2N9L A;  2BB6 A;  2MJD A;  2L83 A;  2KAC A;  2K22 A;  2WXJ A;  3N9Y C;  2M56 B;  1JAL A;  1SE4 A;  1D5X C;  1L6U A;  2WQY B;  2W82 A;  3I57 A;  2D5G A;  2VZK D;  4KX6 B;  1L4D B;  2ONQ A;  4PT5 A;  1DYQ A;  1JWA D;  1T3Q A;  2V3N A;  1KFY B;  1JQ4 A;  4RF0 A;  3P4S B;  4TSS A;  1GB4 A;  1T6B X;  1PGB A;  3P42 A;  1VLB A;  2ICI A;  3TEZ A;  1KF6 B;  2KAJ A;  4JPS A;  1SSN A;  2WXL A;  1F2R I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...