4KGRA

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-lys31, beta-3-asn35
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
52
Chain Sequence
b'DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-3-
molecule tags De novo protein
publication title Protein-like Tertiary Folding Behavior from Heterogeneous Backbones.
pubmed doi rcsb
total genus 13
structure length 52
sequence length 56
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kgrA00
1P7FA 2LUMA 1YMHE 1GB1A 1JMLA 2I2YA 1IBXA 3FILB 4OZBA 2KWDA 2QMTA 1P7EA 2LHEA 3GB1A 2J53A 3UI3A 2I38A 4HJGE 5HHDG 1FCCC 1IGDA 1XF5L 2KACA 2KDMA 5BMIA 2LGIA 1Q10A 4KGSA 2OEDA 4OZCA 2PW9A 5HFYA 4OZAA 2KN4A 1PGBA 1YNTE 1EM7A 1HEZE 1FD6A 5BMGA 2EELA 1KH0A 4WH4A 1MPEA 5JXVA 2GB1A 2ON8A 1K52A 5HG2A 2KQ4X 3MP9A 2N9LA 2JWUA 3FILA 4IOIE 1IBXB 1ZXHA 1K53A 1PGAA 1K51A 5BMHA 1GB4A 1FCLA 1MHXA 4KGRA 1XCQL 2PLPA 4KGTA 2IGDA 1XCTL 1MHHE 4HKZE 2JU6X 2JSVX 4IKGA 1MVKA 2LHDA 1HZ6A 1HZ5A 2JZPA 1K50A 2ONQA 2NMQA 2RPVA 3V3XA 4D2KA 2JXTA 2ZW0A 2N9KA 2QSDA 4MACA 2J52A 2RMMA 1F2RC 2IGHA 2PTLA 1F2RI 1UWXA 5HI1A 2IGGA 1PGXA 1MI0A 2N7JA 1IGCA 2ZW1A 4GLSC 2GI9A 2K0PA 1QKZA 1C9FA 1D4BA
chains in the Genus database with same CATH superfamily
2IPKD 2ZZPB 1F77A 3VTVA 1WGHA 3ONSA 2KHWB 2RDHA 1IBXA 3ZXRA 1L0XB 2LXAA 1E90A 3H7SA 4K1RB 3C0RB 4FA6A 1DOIA 3I3TB 4W9LA 1JWMD 1XF5L 2PE6B 3A4RA 2G4SA 3Q8BA 4WURA 3I57A 1M94A 1TJEA 4XE0A 3WIMA 1YQBA 4RNAA 4EZKA 3AEAB 3VR8B 3L4PA 3KYDD 2KOXA 3N1XC 4A90A 3NRZA 4A6QA 3AU5A 1WXSA 1BT0A 1GC6A 2L76A 3VVWB 3AE4B 1PYWD 1V1PB 1XCQL 2M8SA 3PREA 4BBNC 3KH0A 1WX9A 5BYSA 3PS6A 1ZE3D 2BGFA 4FJYA 1A5RA 1YX5B 3RYTA 2D07B 3UIOB 3AE8B 2RPVA 1PFDA 3PZ8A 3ZDMC 2DZIA 4P7IA 4GDLB 1JQ4A 5CHWA 2KAJA 2N1WA 1WZ3A 3KQ4A 1E8ZA 2N1VA 2RD0A 4CO7A 3RNAC 1I4XA 1QQRA 3RZWC 3VHTC 4KSKC 1WF9A 3BK1A 1YMHE 4BKGA 1WRDB 5C3JB 1NEKB 2BKFA 1FM0D 4M0WA 1KJTA 1OQRA 2YLMA 2AQ1B 4B0EA 1TKEA 2HJ8A 4HRSA 3KLSX 1SE3A 1YQ4B 4C4VA 4LDTD 1FEHA 4EZLA 2INNE 2B76B 2R2QA 5GXGB 4B0MA 1YN3A 2H89B 3P42A 5BMIA 4DXFA 3WAMA 2LWPA 3KUZA 4S17A 2V9HA 2MBEA 3JW0X 4OZCA 1L4ZB 2LJ5A 2M19A 4WWNA 2K39A 4HPLB 3GZNI 4GSWA 3V6CB 2C7NB 3CF6E 4FJZA 4MH0E 1ZKHA 1N61A 3R66C 3MJ5A 2LZ6A 3H7PB 2N9LA 3V61A 2IO1B 4HKQA 3AEEB 1VZ8A 3GOEA 1R4MB 1GG3A 4R3DA 3DWGC 2PMVA 2KWCA 1BXTA 4MSMB 4GDLA 4I6LB 2WXRA 4YXDB 2DWQA 3DHIC 4HROA 2K9XA 2QEJC 4IUMB 4II3B 5DCNA 5C23A 5LNK1 1UWMA 3U8ZA 4F1SA 1ZOYB 4C56C 2QSDA 2KNBA 2J0MA 2D2QA 2ZPYA 4YSZB 3L16A 5J2RA 1ACCA 2Y5CA 3PRMB 2KDBA 2V3SA 1EO6A 3QK0A 1PGXA 1BUIC 3A33B 3D32A 2M0AA 3RNBC 1L4DB 1P7FA 1L6VA 1JMLA 1RYJA 1V9JA 1AWDA 4OZBA 3UGBB 1T6BX 1SXTA 3V05A 4MGYE 4DDGD 4M02A 1OEYA 2XNAC 4XDDA 3UI3A 2CU1A 3EFUA 1P98A 2I1KA 1WRIA 3IT4B 3IBEA 5EE0A 2UU7A 2BWES 4C00A 1NDDA 4WQOB 3PLVA 4LJOB 2MJ3A 2N4FA 3CWIA 1OTRB 1QOAA 1TKGA 3L08A 1SGHA 4FADA 2K3UA 2CJOA 1YJ1A 2DX5B 1LXDA 5TSSA 2RGFA 2GB1A 2KFJA 4EOYA 3ZJUA 3WA0A 2JWUA 3NOBA 2JYTA 1FPYA 3DVNV 3Q3OC 3MJWA 2KANA 4FHKA 5LXIB 2DYMA 3AECB 3QAQA 4KKIA 2IO0B 1WJ6A 2FUG1 2WX1A 1NENB 2UYZB 2WXLA 2PJHA 3KVFB 1HA5A 4HPPA 2G1EA 1EU4A 4WJQA 3AM9A 1JWBD 2MQJA 4UDUC 4W9GA 1WGGA 3SFEB 1RFAA 4N9F4 4LDTB 1SE2A 1ZDXA 5KHOA 5LXHA 4LJPB 3OAWA 2JRHA 2MBQA 2KTRB 3W9CB 1D5ZC 2MSED 3L13A 3AU4A 2CJNA 1QF6A 1WX7A 3ZYYX 3M62B 3DBRI 2IDYA 3A9KB 5AEKB 2MRPA 2C7HA 1TZOA 1CJEA 3LYYA 3ZVVA 1I42A 2DBYA 3Q3JA 1P9DU 3P63A 1GNUA 3HVDA 5J18A 2WNMA 3NZ3A 4FHJA 3KUCB 3AEBB 4JIOU 1F52A 4EUTA 2PE9A 1C3TA 3BVMA 1Q0WB 1OFFA 2LGIA 2IO2B 3NS8A 2WU5B 4TKNA 5J17A 5HFYA 3B2FA 3QHTA 1KLUD 2D5GA 3MFGA 4G50A 4X57B 2WX0A 3MP9A 2K8CA 3TCAA 4YT0B 4S0RA 1K53A 4RM9A 3DWMA 2BS3B 1C78A 3A9KA 5JHAA 4ZRPA 2AQ3B 1WY8A 2HE7A 2KWVB 1P3QU 1Q5WB 2RR9A 4KZCA 3HVZA 4C7ZA 3SHQA 5MPOA 5IN7A 1DYQA 2PLPA 3AE1B 2L52A 2HD5B 4PYUA 4L1BA 2PPHA 1E9MA 3ZIMA 4RCOA 1HTOA 1HZ5A 5IP4D 4G11A 2K6QA 2DAJA 2ONQA 2WDVB 2CHZA 2JUOA 1QOBA 1TY2A 3AV8A 3LXFA 1T0SC 1CK1A 3ABVB 3SD5A 4HVBA 3GP7A 2DAFA 2WU2B 4NJCA 2J0JA 3URYA 1WJUA 1U4AA 3R7QA 2W3SA 3DDCB 3AE2B 1C1YB 2M4NA 3M63B 1AN8A 2KQSA 2JPHA 3ZJVA 2I2YA 1UZXB 3FILB 2QMTA 3B2GA 3ML9A 2A4ZA 2KKCA 2CKHB 2JZZA 4AJWA 4EKUA 1S1QB 1BMLC 1E7UA 2Z0DB 4MH8A 1IGDA 2FUHB 2WXOA 4NZLB 1OQQA 2KACA 4GDKB 1STEA 4MGKE 2EMSA 3AEGB 4W9JA 1YQ3B 5D7GA 1UNSA 4HCNB 4KGSA 5BO4B 2BB6A 2G45B 2KN4A 1FXAA 4RMAA 5L95C 1JWSD 1TZ1A 1FD6A 1A70A 3I9V1 1RRBA 1TS5A 3W1SA 1XLPA 1TY0A 3KWLA 3V62A 4E71A 5LLIA 4ARCA 4ANVA 2V1YA 1DOXA 1E7VA 4IM0A 4AQ7A 1XO3A 2E3TA 4ZRIA 4W9EA 3IHPC 4BKTA 3VXWA 2BWFA 3S2AA 3U30A 1EWYC 1FMAD 2FNJB 4HWIB 1E0ZA 4ANWA 3VDZA 1F1HA 4GXBA 4KZ0A 1K50A 3CMMB 4XWWA 1P0RA 5EE3A 2L83A 1WH3A 4LNKA 4P16A 4JQWC 2V4LA 1SE4A 2LEKA 4IWOA 1YN5A 2RMMA 3KYCD 2DZMA 4B6WA 3TL5A 3MTNB 5AZHA 3ZRCA 4OW0A 5IOIA 1HXYD 4JL9A 1LQBA 2X38A 3PZ7A 2CS4A 2WHIA 2JX5A 2REXA 2QIEB 1HQRD 2WGSA 3DHHC 5D3DA 4LNIA 1I4PA 3FAHA 5I4DA 2KWDA 2V3PA 2KTFA 4US8A 2LHEA 2B3AA 1V8CA 4HCPB 3TMPB 4M00A 2KN5A 4RH6A 2WDRB 2KFKA 3MC0B 3O13A 2W3RA 3PHWB 3AE7B 1R4NI 4MM3A 4C7YA 3EGRA 3ZNID 2UWQA 2FE8A 2KQ7A 2IO3B 2PW9A 2IY0B 2MX2A 1I4HA 3ZNHB 1ZGUB 3DBHI 1N5WA 1E8XA 2LXCA 2PEAA 1FXTB 1ZDVA 5DPSA 4M0WB 1J7BA 2LASA 1ZXHA 4RGOS 3UQAA 2AYOB 3GE8C 1LO5D 1TBEA 3B9JA 1UH6A 2XK5B 3DOWA 3NVZA 1WJ4A 1FCLA 2CR5A 2M1MA 4IWPA 1NVID 4YTPB 3RULA 3DVGX 2J7QB 3T9LA 4DHJB 4IC7B 2Z0EB 4KSLC 1IUEA 2WQYB 1GC7A 2DZJA 4HKZE 2JU6X 1TS3A 2RSUA 2W54A 1QT9A 1JW9D 2N0SB 3DQVA 1J7AA 4TUUA 1L6UA 3OWEB 1GPXA 3UIPB 2WYQA 2EKIA 3U4EG 2C5LC 1KFYB 3AN1A 2OOBB 2O2VA 1UWXA 4ZDVA 1E10A 1C4AA 5HI1A 2C9WB 1V1PA 1N62A 3A9JB 1IGCA 1QOGA 4JWUC 1WXMA 4A3PA 1XXGA 4OVVA 2WXJA 2MEKA 4I6NB 4IWQA 1JWAD 4URKA 2M56B 3ETRA 3H8HA 1KRHA 5EE1A 2JF5A 1XT9B 3AI5A 2KVRA 3ZQ4A 1I4RA 3ZGZA 3RI7C 2LVPA 2X8XX 5D2MB 1WM2A 1QILA 1N60A 4DHJD 1PGBA 1L5PA 1Y8RC 2O6VA 4OHJA 4RF0A 2EKEC 4BVUC 1OQYA 3CIRB 3H6NA 3HUIA 2V4IB 4HPMB 3OLMD 2R2OA 1FIQA 3UINB 1IBXB 2BPSA 4ASWC 3DBLB 1K51A 3K9PB 4IM2A 1IP9A 4I6PA 2LFIA 1X1MA 3EFCA 1UBQA 4CYEA 2IGDA 1NI2A 5L83A 2FBWB 2KK8A 1ZP0B 2K8BA 1TS2A 1WXVA 1UUPA 1NI3A 4WAFA 1JWUD 5FKAC 3N32A 2K5PA 4W9HA 4MSQB 2WDTB 2GLSA 2BBCA 4P1CC 3T8MA 2EMTA 4YSYB 4WWOA 1EF1A 2MJEA 3BWUD 4HEA1 2DENB 4XC2A 3L0WB 4W9CA 4OVUA 1WGKA 2Y5BB 1QKZA 3PTFC 5KHQA 2JY6A 2OHFA 2QC8A 4YL8A 4DQOC 1YX6B 2KDEB 4WWMA 2KDFB 2KMAA 4K3BA 1AYFA 4DBGA 1V1OA 4HDOA 2L1AA 1R4NB 4B95A 4PS8A 4HJGE 3TIXA 3AULA 2KWUB 2N7EA 4EZJA 5TR5A 3MC8A 2RDGA 4NAMA 2H88B 1J7CA 3A1QB 3VAWA 4M8NA 3VTUA 2IYDB 5IO9A 2OEDA 1PQSA 4KX6B 1FRRA 4N58A 2J4XA 2N7DA 3A4SC 2MH7A 1I7HA 1MPEA 2VH1A 3HM6X 3WCQA 2LVOA 5D94A 3X0WA 1MFWA 2HJ1A 5CX3A 1V86A 1OGWA 2KYWA 3VR9B 1MJDA 2V3NA 3P4RB 4TSSA 1WR6E 4MDKE 1JRUA 4ZOHC 3ZRFA 3BINA 1EU3A 3EUB2 2AQ2B 1XD3B 1MHHE 4KKJA 4WIPA 4XWTA 1AARA 3U52E 1NYRA 2JSVX 4IKGA 4XX5A 2MBBB 1WE7A 2BQQA 4GB9A 4AS1A 1RM6C 2J0KA 2G3QB 2K22A 1IPGA 2MP2A 3JVZX 4GU2A 1VZ7A 2D11A 3AE3B 4BFRA 1D5XC 2N9KA 4MACA 4A55A 2LGXA 3B1LX 3DCGA 1ESFA 2KMMA 2GBNA 3PRZA 2JWZA 1WMHA 3K9OB 1SE9A 3QC8B 3DVNU 3APFA 1C9FA 4N59A 5C2TB 4QAYA 1WJNA 3ZO5B 2WXPA 4ITKA 1RWSA 2AEHA 1C79A 1WSPA 3P2BA 3OJ3A 1QLBB 3ZJTA 5JHBA 1FCCC 3AMZA 1JRPA 1RLFA 1SB3C 1VZ6A 1CMXB 1PDXA 3NVYA 4GN1A 2TSSA 4GOCA 3VRBB 3Q8FA 3RMKC 4BOZB 2CHWA 4BBNF 4DHZE 3I5JC 3HK0A 4MJSA 1DGJA 1HEZE 1TGZB 1DOYA 2ZNVB 2N9XA 1KH0A 3APCA 1D5MC 5JXVA 2NPTA 1K52A 4FLHA 2KQ4X 4G3XB 1V49A 3DBLI 3W5VB 2Z8LA 4RGTA 4K81A 1XLOA 5C1ZA 5E6OA 2K6DB 3HRDD 5BMHA 2QDFA 4KVGB 1GB4A 4KGRA 5H92C 3Q69A 1SIJA 2XEWA 3TSSA 3AB5A 2M17A 1WXQA 1TS4A 2MBHA 2WXGA 1ZUD2 3VFKA 4TQ0A 1TYGB 3IAS1 4XDCA 3AH7A 3W2DA 4D2KA 2FCQA 2JRIB 4JE3B 3NZSA 3PPAA 2PKOA 2J52A 4LNOA 2JZ3B 4TV3A 3ZKJC 2XBBC 2PTLA 3IAM1 1H4RA 4DWFA 3A9JA 4HJKA 3BYTB 3C8YA 2INPE 2N7JA 3Q3NC 3DVGY 1N63A 1N6ZA 2ASQA 4NAWB 4ZHPA 2L3ZA 3KWVA 3QCAA 2NTSA 1ENFA 2FCNA 2XN9C 5FR3A 3P1MA 3EECA 4RGMA 1J8CA 4WJPA 3EHVA 3I63C 2VH2A 4GIVA 1XQQA 3GE3C 2FAZA 3L54A 3QARA 3JSVB 3WANA 1PUTA 2D3GA 2K1FA 3PVLA 4RGNA 3PLUA 4LK0M 3Q6BA 4AJYB 4K7WA 2CU3A 3Q8EA 1WIAA 5G5HA 4YTNB 3TEWA 2ON8A 4WWPA 2ZVOA 4WJNA 3U7ZA 4JX1C 5HKHA 1KLGD 4ARIA 1IYFA 1L2NA 2MJDA 1NYQA 3GS2A 4ZHOA 2V0GA 4O1NA 2HTME 3BK2A 1YD8U 3NS1A 2KFKB 3PT2B 4LNFA 2ACZB 5E6PA 3RNGC 4M01A 4EEWA 3ZUNA 4P6VF 2JZPA 1FFVA 2WXQA 3RCZA 1UELA 4LCDE 2ICIA 2WXMA 4PS3A 2WXFA 1ET6A 3MHSD 4ACFA 1Z5SB 1I35A 3DPDA 3N20C 1JCKB 3RD2A 2WXNA 3Q3FA 4NAWA 1F2RI 3W1YA 3TUOA 5IA7A 4ICUA 2FIFA 1ET9A 4BOSC 1G6JA 2LGSA 1D4BA 4BKSD 5D6JB 2G9HD 3QJZA 1KM7A 4YWGG 3TEXA 4CQNA 1GOZA 1FFUA 4NY0A 2DYOA 1XLQA 4HDQA 1YIWA 2MCNB 4MJSB 5CHVC 2Y5PA 1QOFA 1VLBA 3NVWA 1Q10A 4NPNA 2LRWA 4REZA 4L2YA 1T5XD 3N3KB 3U2SC 2AX5A 1GAQB 2BS2B 2KJHB 1J0GA 3B0AA 2GBKA 3FKYA 2BF8B 2I1JA 3ZNZB 5BYRA 1Q1OA 4W9DA 2BYVE 1PGAA 5JH5C 1EWCA 1UD7A 1LM8B 1MHXA 3VUXA 4A20A 1XEEA 2ZCCA 4H2AA 3R7RA 1WWTA 1VDVA 3PV1A 2D3BA 5EDSA 1E6EB 4GDKA 2LUEA 4W9IA 2L7RA 3MHZA 3V60A 3N30A 4HK2A 4XYCA 1OEYJ 4EFOA 4GMVA 1C4PA 3FC4A 3WALA 2J42A 3SR6A 4JGHB 5BYQA 2GBRA 3RFZB 3VUWA 2BKRB 1VRAB 4EE2A 4YTMB 2BVCA 4RM8A 3MC9A 2DNFA 2GI9A 5GMVA 2KLGA 2LGYA 2L8JA 5IAAC 1EUVB 2AWTA 2KX3A 2L0TA 2SAKA 2N9EB 4OVZA 4Q2JA 3RZFA 1FXIA 4HLEA 5DPWA 2G4DB 4USAA 5HHDG 1UF0A 1VD2A 2QHOA 3A1QA 4ZRKA 3SU8X 3EA6A 1YNTE 3M3JA 3KUDB 4W9FA 4BKSA 3O65B 4KDLB 3NG0A 2KX0A 4WH4A 3NHEB 1VJKA 2GBMA 1FNWA 3L17A 5T8IA 2KJ6A 3SEBA 5FR6A 3WAOA 3T3OA 3Q14C 1LGRA 2NTTA 4ANXA 2MBOA 3ZTDA 2JQRB 2WXHA 2BYFA 2WS3B 1T0RC 4DHZB 3Q3MC 3H9DA 1FRDA 2MA9B 1I4QA 1HZ6A 2Q5WD 1SJHD 3P4SB 2RPQA 3AEDB 3E56A 2LD9A 3PSEB 1F0ZA 1T3QA 4IDIA 2KO3A 3RNEC 1H8CA 1I4GA 3RN9C 2KXJA 2ZW0A 1WGDA 3PGEA 3ZLZA 1XLNA 2IGHA 1WI0A 3Q2AC 1WM3A 4LTUA 3JYUA 4CHKA 4JPSA 2W55A 2WDQB 1RAXA 3TJPA 5CTRC 1V5TA 2K25A 5EE9A 3V6EB 2KTRA 2ZVNA 1HE8A 2GOWA 4K3CA 4TQ1A 2WWZA 3AE6B 3VRAB 4AWJA 1F9JA 4II2B 2NBUA 4DK5A 1ROEA 2O6VB 3RT3B 1V81A 2NS5A 1SIFA 1SBBB 3LDZE 1T0QC 1MG4A 4K7UA 1SJED 2K8HA 2VZKB 2MHJA 5E6JA 3T3NA 2ZCBA 3UQBA 2BYEA 4IW0A 4ANUA 5DPTA 4MGZE 5BMGA 3BVZA 3HM3A 1Z2MA 5AUIA 5HG2A 4LLGM 1R7SA 3DBRB 4NQKE 5H8YE 2FCSA 1GJZA 4JWSC 1M4VA 2DLBA 3AEFB 4IM3A 2D3AA 2KT7A 1UGMA 2SEBD 2O2VB 2BW2A 4KGTA 3KW5B 1MVKA 3DBHB 2ZNVC 1WYWB 1B9RA 1E5WA 2NMQA 1FO4A 4F8CB 3V3XA 5DPRA 1YOVB 3NJTA 4JLCA 2DYBA 1SSNA 2LMCA 1VR9A 3ML8A 2IGGA 2L0FA 4J6IA 1K8RB 3Q8CA 3ZXVA 5AZFA 3RNCC 2E6XA 2BB5A 2LUMA 5G2NA 2W9NA 2FCMA 4ZRQA 1WGRA 1CZPA 4WJOA 2KLCA 3GB1A 5D3IB 2J53A 4NNJB 3IFWB 4N6EB 3TEZA 2MWSB 2BT6A 4K7SA 4MELA 5JZEB 2KDMA 3QX1A 2D10A 3JSVA 3B08A 4MM3B 4AOFA 3IVFA 4US9A 1L7YA 2WLBA 1YN4A 3VH3B 2YEPF 2XK5A 2LGDA 3TEYA 1TKYA 1CQVA 3WAPA 2GRIA 3H7PA 2QJLA 2N9PC 5FK9C 4J3OD 1NBFC 2L00B 2NBVB 3NVVA 3HHMA 5AZGA 3R2IA 2GMIC 4LNNA 4E3CA 1VCBA 2AL3A 3U7DA 2KD0A 1LFDA 3PRPB 2PIAA 3R2TA 2C60A 2C7MB 3ENEA 2INCC 1WYGA 1D6EC 3NY5A 2NBWB 4DXAB 2LRUA 4C4VB 1ZXIA 1V6EA 3RUIB 3P4QB 2WXKA 4ICVA 2KMCA 3IXSA 1WGYA 3BY4B 3BVGA 4FJVB 2KDIA 4MT5A 3RPFC 3Q8AA 2MW5A 1KTKA 2ZPNA 1F2RC 4FBJB 2D3CA 2BYTA 3M95A 4A9AA 1WFYA 4XGAB 5G5GA 2KC1A 4RFBA 2BS4B 5G55A 1SEBD 1MI0A 3NZUA 4NJ6A 3L10B 1GB1A 3W1SC 4F7ZA 3PHXB 4ZYNA 3QA8A 1WR1A 4BZAA 4IG7B 4XZ4A 1EF5A 4DDID 2NPTB 3PZDA 2OJWA 4PS7A 2YEPB 2LVQA 2I38A 3DHGC 2ZEQA 4MGIE 3TBLD 2LI5A 3ZTCA 3RNFC 1ISNA 3P4PB 3SFDB 2DHZA 2BTEA 1T0YA 3N9YC 4ZRJA 2MLBA 2JXXA 1EM7A 4A8XC 4PK1A 3R8BA 3APDA 2L05A 2L32A 3H1UA 3SDLC 3DBSA 3FILA 3OJ4B 4IOIE 1N5XA 4A3OA 2RDBC 3QWZB 4TMAB 1L0VB 1HTQA 4FN2A 1V80A 1L0YB 1WMHB 2LJIA 3LJ3A 4AUQC 1AW7A 1D3ZA 1WE6A 1WXAA 4PYZA 2A5UA 4DXGA 2JYEA 2PVOD 3GZNB 4BAXA 1UGJA 1KLVA 3BIID 1E8WA 1C4CA 2LHDA 1FNUA 2MP2B 1C76A 2W82A 1KF6B 1WX8A 3CSFA 1J19A 2JXTA 2KJRA 2IZVB 4KDIC 2NCNA 4ZYSA 1R4MI 2VRRB 3QQ8B 2KZRA 4G0NB 1E8YA 3NUHB 2R61A 2AL6A 4P1BC 4WAAA 4RF1A 4NJ7A 4GLSC 2YVCA 3R3MA 4NQLB 3IT6B 1GUAB 2O6VD 1B1ZA 1V2YA 5AUKA 2NVUI 1P7EA 2WP9B 3ECIA 4KIKB 3VQIA 3LB8C 2KC2A 2Y3AA 4B9KA 2Z59B 2ZJDA 3C19A 4WQMA 2QILA 2NR2A 4FULA 2M0XA 3BZDB 3IG3A 5CHFA 1ZW7A 3ZW3A 4C80A 1S3SG 2KVZA 4KV2A 1JALA 1UBIA 4YSXB 2HDEA 4E74A 3UF8A 1WZ0A 4GGQA 4OZAA 1V5OA 1C77A 4MEMA 4PT5A 3AE9B 1QZEA 2EELA 1YJJA 5IKCM 1JROA 1P1AA 4HXDA 2JT4B 1ZPSA 3E9SA 1TTNA 2DZKA 4AP4C 1TT5B 3PO0A 4L23A 2IJ0A 5E6NA 3J9CA 2FIDA 1SF0A 3VUYA 2OJRA 1YJIA 2HTHA 2IBIB 2QCZA 1XCTL 1Y56A 3HIZA 2JVCA 3ZDTA 2CHXA 2INDC 1E7PB 1FNVA 2IY1B 4W9KA 1V97A 3ALBA 3OG5A 2WXIA 3CSTA 3X23A 4KIKA 1KOTA 1TIFA 3EC8A 3VH4B 3N1ZC 3ZNGC 2GBJA 3AE5B 4M8MA 3AXCA 3BYYB 2VZKD 3VTWA 2PVGC 2ZW1A 1MG8A 3QIJA 4FXCA 2K0PA 3W5UB 1RFKA 3N1YC
chains in the Genus database with same CATH topology
2IPKD 3ZJVA 1F77A 2RDHA 2I2YA 1IBXA 3FILB 1L0XB 2WXPA 4ITKA 4TQ1A 2QMTA 3B2GA 3AE6B 3VRAB 1RWSA 1C79A 1WSPA 1DOIA 1BMLC 1QLBB 1ROEA 3ZJTA 4MH8A 1FCCC 3AMZA 1JWMD 1IGDA 2WXOA 1JRPA 1XF5L 4NZLB 1SBBB 1OQQA 1SB3C 1VZ6A 1PDXA 2KACA 1SJED 3NVYA 4GDKB 1STEA 2TSSA 2VZKB 3AEGB 1YQ3B 5D7GA 1UNSA 3VRBB 3Q8FA 3Q8BA 4WURA 4KGSA 5E6JA 3I57A 3T3NA 1TJEA 2BB6A 2KN4A 1FXAA 4XE0A 1DGJA 1JWSD 1HEZE 1FD6A 1DOYA 5BMGA 1A70A 3I9V1 1TS5A 1KH0A 3W1SA 4RNAA 3BVZA 1D5MC 5JXVA 3AEAB 1XLPA 1TY0A 3VR8B 1K52A 5AUIA 5HG2A 2KQ4X 3L4PA 4LLGM 3KWLA 1R7SA 5H8YE 4ARCA 3W5VB 4A90A 3NRZA 2Z8LA 4A6QA 1DOXA 4RGTA 1XLOA 4JWSC 1M4VA 2DLBA 1XO3A 2E3TA 3HRDD 3AEFB 5BMHA 4AQ7A 1GB4A 3AE4B 1PYWD 1V1PB 4KGRA 5H92C 2SEBD 3Q69A 1SIJA 1XCQL 2BW2A 4KGTA 3AB5A 3TSSA 1EWYC 1FMAD 5BYSA 1WXQA 1TS4A 1ZE3D 1E0ZA 1MVKA 2WXGA 1ZUD2 4TQ0A 1TYGB 3IAS1 1K50A 4XDCA 1B9RA 3AE8B 3AH7A 2NMQA 1FO4A 2RPVA 3W2DA 3V3XA 5EE3A 4XWWA 2L83A 4D2KA 1PFDA 3PZ8A 4JE3B 4P16A 1SE4A 2LEKA 4GDLB 1JQ4A 1YN5A 2PKOA 2J52A 2RMMA 1SSNA 2KAJA 2LMCA 3KQ4A 2PTLA 1VR9A 3IAM1 2IGGA 3BYTB 1I4XA 1QQRA 1HXYD 4OW0A 3C8YA 2INPE 2N7JA 2X38A 3PZ7A 1N63A 3Q8CA 4NAWB 4ZHPA 2E6XA 2BB5A 2LUMA 2JX5A 1YMHE 3BK1A 3KWVA 2QIEB 2NTSA 1HQRD 5D3DA 5C3JB 1NEKB 1I4PA 3FAHA 5I4DA 4ZRQA 1CZPA 1FM0D 2KWDA 1ENFA 4M0WA 2XN9C 1OQRA 2V3PA 4US8A 5FR3A 3P1MA 2AQ1B 2LHEA 3GB1A 5D3IB 1V8CA 4RGMA 4B0EA 1TKEA 4HRSA 3KLSX 2J53A 1SE3A 4N6EB 3TEZA 1YQ4B 2BT6A 4RH6A 2WDRB 1FEHA 5C2TB 2INNE 2B76B 5GXGB 4B0MA 3MC0B 1YN3A 3O13A 2W3RA 2H89B 2KDMA 3AE7B 3P42A 5BMIA 4C7YA 3EGRA 4DXFA 1PUTA 2FE8A 4MM3B 4OZCA 2PW9A 4US9A 1L4ZB 2M19A 4RGNA 4LK0M 2WLBA 1YN4A 2CU3A 3Q8EA 1I4HA 2YEPF 1N61A 3TEYA 3MJ5A 1TKYA 5G5HA 4YTNB 1CQVA 1N5WA 3TEWA 2ON8A 1ZDVA 2GRIA 3U7ZA 1J7BA 2N9LA 2QJLA 1ZXHA 4RGOS 5FK9C 4J3OD 4HKQA 4JX1C 1KLGD 4ARIA 1LO5D 3AEEB 3B9JA 3NVVA 3NVZA 1VZ8A 3R2IA 1FCLA 2MJDA 1NVID 1NYQA 4YTPB 3GS2A 4ZHOA 2V0GA 4O1NA 4R3DA 3DWGC 2PMVA 1IUEA 2PIAA 2WQYB 3R2TA 2HTME 3BK2A 1BXTA 4HKZE 2JU6X 2WXRA 1TS3A 2DWQA 3NS1A 2W54A 4HROA 4YXDB 2K9XA 2ACZB 1QT9A 2QEJC 1WYGA 1D6EC 1JW9D 4P6VF 2JZPA 1FFVA 2WXQA 2N0SB 1ZXIA 1J7AA 3P4QB 2ICIA 2WXKA 2WXMA 3IXSA 1L6UA 2WXFA 3OWEB 1UWMA 5LNK1 1GPXA 3BVGA 1ET6A 4MT5A 2EKIA 1ZOYB 3U4EG 4C56C 3RPFC 2QSDA 3Q8AA 1JCKB 1KTKA 2WXNA 4YSZB 1F2RC 1KFYB 3AN1A 1F2RI 2BYTA 1ACCA 1UWXA 4A9AA 1E10A 2Y5CA 1C4AA 5HI1A 5G5GA 3TUOA 1V1PA 4RFBA 2BS4B 1N62A 1SEBD 1PGXA 1MI0A 1BUIC 1IGCA 1ET9A 2M0AA 1QOGA 4JWUC 1D4BA 1L4DB 1P7FA 1L6VA 1GB1A 1JMLA 1XXGA 1RYJA 2G9HD 1AWDA 4OZBA 4YWGG 1T6BX 3TEXA 1SXTA 3V05A 2WXJA 2MEKA 4CQNA 1GOZA 1FFUA 2XNAC 2YEPB 4XDDA 2DYOA 1JWAD 3UI3A 2I38A 2M56B 1XLQA 1WRIA 3ETRA 3H8HA 2Y5PA 1QOFA 3IT4B 1KRHA 5EE1A 1VLBA 5EE0A 3NVWA 3P4PB 3ZQ4A 3SFDB 1I4RA 3ZGZA 1Q10A 4REZA 4L2YA 1T5XD 2BTEA 3U2SC 2MJ3A 1QILA 1N60A 2AX5A 3N9YC 3CWIA 1QOAA 1GAQB 1PGBA 1L5PA 1EM7A 1TKGA 2BS2B 2K3UA 2CJOA 4OHJA 4RF0A 5TSSA 4A8XC 3R8BA 2GB1A 3ZJUA 2L32A 3CIRB 3HUIA 5BYRA 2V4IB 2JWUA 3FILA 1FIQA 4IOIE 1N5XA 1IBXB 2JYTA 4TMAB 1L0VB 2DYMA 3AECB 1PGAA 4KKIA 1K51A 1EWCA 2FUG1 1MHXA 1L0YB 1NENB 2LJIA 1XEEA 1AW7A 2LFIA 2WXLA 4H2AA 1WWTA 1VDVA 4DXGA 2JYEA 2IGDA 2FBWB 1E6EB 2PVOD 1UGJA 1ZP0B 1TS2A 1HA5A 1UUPA 4N59A 1NI3A 3BIID 4WAFA 3MHZA 2G1EA 1C4CA 1EU4A 1JWUD 2LHDA 1FNUA 5FKAC 1C76A 3AM9A 1JWBD 2W82A 4UDUC 1KF6B 3SFEB 2K5PA 1SE2A 1ZDXA 2JXTA 1C4PA 2BBCA 3FC4A 2J42A 3SR6A 4YSYB 4ZYSA 5BYQA 2MJEA 3RFZB 3W9CB 3BWUD 1VRAB 1D5ZC 4EE2A 3NUHB 4YTMB 2R61A 4HEA1 2CJNA 1QF6A 4RF1A 1WGKA 3ZYYX 4GLSC 2IDYA 2GI9A 1QKZA 3IT6B 2OHFA 1B1ZA 1TZOA 1CJEA 3LYYA 5AUKA 4DQOC 2DBYA 1P7EA 4WWMA 2WP9B 2SAKA 3P63A 3HVDA 1AYFA 4OVZA 3VQIA 1V1OA 3LB8C 4Q2JA 2WNMA 3NZ3A 2L1AA 2Y3AA 4WQMA 1FXIA 3AEBB 2QILA 3BZDB 4HJGE 4USAA 5HHDG 4C80A 3BVMA 1JALA 1OFFA 2LGIA 2RDGA 4NAMA 2WU5B 4YSXB 2H88B 2HDEA 1J7CA 2OEDA 4KX6B 5HFYA 1FRRA 3B2FA 4OZAA 1KLUD 4N58A 2D5GA 2J4XA 3EA6A 1C77A 3MFGA 1YNTE 4PT5A 3AE9B 2EELA 2MH7A 1I7HA 4WH4A 1YJJA 1MPEA 1JROA 3WCQA 1VJKA 1FNWA 3MP9A 5T8IA 4YT0B 3SEBA 1K53A 1ZPSA 3T3OA 3DWMA 2BS3B 3E9SA 1C78A 4ZRPA 2AQ3B 3VR9B 3PO0A 4L23A 2IJ0A 2NTTA 2V3NA 3HVZA 3P4RB 4C7ZA 4TSSA 3J9CA 4ZOHC 1SF0A 5MPOA 1DYQA 2PLPA 3AE1B 2L52A 1EU3A 1YJIA 2JQRB 2AQ2B 3EUB2 1XCTL 1MHHE 1Y56A 2WXHA 4KKJA 2WS3B 4WIPA 4XWTA 3U52E 1NYRA 4L1BA 2JSVX 1E9MA 4IKGA 4RCOA 1E7PB 1FNVA 1FRDA 1I4QA 1HZ6A 2Q5WD 1SJHD 1HZ5A 3P4SB 2ONQA 2WDVB 1V97A 3AEDB 3E56A 4AS1A 2WXIA 1RM6C 1QOBA 1TY2A 1F0ZA 1T3QA 3AV8A 4IDIA 2K22A 3LXFA 1CK1A 1I4GA 3ABVB 1VZ7A 3GP7A 3AE3B 2ZW0A 1D5XC 2N9KA 4MACA 4A55A 2WU2B 4NJCA 1ESFA 3URYA 2KMMA 3AE5B 1XLNA 2IGHA 2W3SA 3AE2B 4LTUA 3BYYB 2VZKD 2PVGC 2ZW1A 4FXCA 4JPSA 2W55A 2K0PA 3W5UB 1C9FA 2WDQB 1RFKA 1AN8A 5EE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7F A;  2LUM A;  1YMH E;  1GB1 A;  1JML A;  2I2Y A;  1IBX A;  3FIL B;  4OZB A;  2KWD A;  2QMT A;  1P7E A;  2LHE A;  3GB1 A;  2J53 A;  3UI3 A;  2I38 A;  4HJG E;  5HHD G;  1FCC C;  1IGD A;  1XF5 L;  2KAC A;  2KDM A;  5BMI A;  2LGI A;  1Q10 A;  4KGS A;  2OED A;  4OZC A;  2PW9 A;  5HFY A;  4OZA A;  2KN4 A;  1PGB A;  1YNT E;  1EM7 A;  1HEZ E;  1FD6 A;  5BMG A;  2EEL A;  1KH0 A;  4WH4 A;  1MPE A;  5JXV A;  2GB1 A;  2ON8 A;  1K52 A;  5HG2 A;  2KQ4 X;  3MP9 A;  2N9L A;  2JWU A;  3FIL A;  4IOI E;  1IBX B;  1ZXH A;  1K53 A;  1PGA A;  1K51 A;  5BMH A;  1GB4 A;  1FCL A;  1MHX A;  4KGR A;  1XCQ L;  2PLP A;  4KGT A;  2IGD A;  1XCT L;  1MHH E;  4HKZ E;  2JU6 X;  2JSV X;  4IKG A;  1MVK A;  2LHD A;  1HZ6 A;  1HZ5 A;  2JZP A;  1K50 A;  2ONQ A;  2NMQ A;  2RPV A;  3V3X A;  4D2K A;  2JXT A;  2ZW0 A;  2N9K A;  2QSD A;  4MAC A;  2J52 A;  2RMM A;  1F2R C;  2IGH A;  2PTL A;  1F2R I;  1UWX A;  5HI1 A;  2IGG A;  1PGX A;  1MI0 A;  2N7J A;  1IGC A;  2ZW1 A;  4GLS C;  2GI9 A;  2K0P A;  1QKZ A;  1C9F A;  1D4B A; 
#chains in the Genus database with same CATH topology
 2IPK D;  2ZZP B;  1F77 A;  3VTV A;  1WGH A;  3ONS A;  2KHW B;  2RDH A;  1IBX A;  3ZXR A;  1L0X B;  2LXA A;  1E90 A;  3H7S A;  4K1R B;  3C0R B;  4FA6 A;  1DOI A;  3I3T B;  4W9L A;  1JWM D;  1XF5 L;  2PE6 B;  3A4R A;  2G4S A;  3Q8B A;  4WUR A;  3I57 A;  1M94 A;  1TJE A;  4XE0 A;  3WIM A;  1YQB A;  4RNA A;  4EZK A;  3AEA B;  3VR8 B;  3L4P A;  3KYD D;  2KOX A;  3N1X C;  4A90 A;  3NRZ A;  4A6Q A;  3AU5 A;  1WXS A;  1BT0 A;  1GC6 A;  2L76 A;  3VVW B;  3AE4 B;  1PYW D;  1V1P B;  1XCQ L;  2M8S A;  3PRE A;  4BBN C;  3KH0 A;  1WX9 A;  5BYS A;  3PS6 A;  1ZE3 D;  2BGF A;  4FJY A;  1A5R A;  1YX5 B;  3RYT A;  2D07 B;  3UIO B;  3AE8 B;  2RPV A;  1PFD A;  3PZ8 A;  3ZDM C;  2DZI A;  4P7I A;  4GDL B;  1JQ4 A;  5CHW A;  2KAJ A;  2N1W A;  1WZ3 A;  3KQ4 A;  1E8Z A;  2N1V A;  2RD0 A;  4CO7 A;  3RNA C;  1I4X A;  1QQR A;  3RZW C;  3VHT C;  4KSK C;  1WF9 A;  3BK1 A;  1YMH E;  4BKG A;  1WRD B;  5C3J B;  1NEK B;  2BKF A;  1FM0 D;  4M0W A;  1KJT A;  1OQR A;  2YLM A;  2AQ1 B;  4B0E A;  1TKE A;  2HJ8 A;  4HRS A;  3KLS X;  1SE3 A;  1YQ4 B;  4C4V A;  4LDT D;  1FEH A;  4EZL A;  2INN E;  2B76 B;  2R2Q A;  5GXG B;  4B0M A;  1YN3 A;  2H89 B;  3P42 A;  5BMI A;  4DXF A;  3WAM A;  2LWP A;  3KUZ A;  4S17 A;  2V9H A;  2MBE A;  3JW0 X;  4OZC A;  1L4Z B;  2LJ5 A;  2M19 A;  4WWN A;  2K39 A;  4HPL B;  3GZN I;  4GSW A;  3V6C B;  2C7N B;  3CF6 E;  4FJZ A;  4MH0 E;  1ZKH A;  1N61 A;  3R66 C;  3MJ5 A;  2LZ6 A;  3H7P B;  2N9L A;  3V61 A;  2IO1 B;  4HKQ A;  3AEE B;  1VZ8 A;  3GOE A;  1R4M B;  1GG3 A;  4R3D A;  3DWG C;  2PMV A;  2KWC A;  1BXT A;  4MSM B;  4GDL A;  4I6L B;  2WXR A;  4YXD B;  2DWQ A;  3DHI C;  4HRO A;  2K9X A;  2QEJ C;  4IUM B;  4II3 B;  5DCN A;  5C23 A;  5LNK 1;  1UWM A;  3U8Z A;  4F1S A;  1ZOY B;  4C56 C;  2QSD A;  2KNB A;  2J0M A;  2D2Q A;  2ZPY A;  4YSZ B;  3L16 A;  5J2R A;  1ACC A;  2Y5C A;  3PRM B;  2KDB A;  2V3S A;  1EO6 A;  3QK0 A;  1PGX A;  1BUI C;  3A33 B;  3D32 A;  2M0A A;  3RNB C;  1L4D B;  1P7F A;  1L6V A;  1JML A;  1RYJ A;  1V9J A;  1AWD A;  4OZB A;  3UGB B;  1T6B X;  1SXT A;  3V05 A;  4MGY E;  4DDG D;  4M02 A;  1OEY A;  2XNA C;  4XDD A;  3UI3 A;  2CU1 A;  3EFU A;  1P98 A;  2I1K A;  1WRI A;  3IT4 B;  3IBE A;  5EE0 A;  2UU7 A;  2BWE S;  4C00 A;  1NDD A;  4WQO B;  3PLV A;  4LJO B;  2MJ3 A;  2N4F A;  3CWI A;  1OTR B;  1QOA A;  1TKG A;  3L08 A;  1SGH A;  4FAD A;  2K3U A;  2CJO A;  1YJ1 A;  2DX5 B;  1LXD A;  5TSS A;  2RGF A;  2GB1 A;  2KFJ A;  4EOY A;  3ZJU A;  3WA0 A;  2JWU A;  3NOB A;  2JYT A;  1FPY A;  3DVN V;  3Q3O C;  3MJW A;  2KAN A;  4FHK A;  5LXI B;  2DYM A;  3AEC B;  3QAQ A;  4KKI A;  2IO0 B;  1WJ6 A;  2FUG 1;  2WX1 A;  1NEN B;  2UYZ B;  2WXL A;  2PJH A;  3KVF B;  1HA5 A;  4HPP A;  2G1E A;  1EU4 A;  4WJQ A;  3AM9 A;  1JWB D;  2MQJ A;  4UDU C;  4W9G A;  1WGG A;  3SFE B;  1RFA A;  4N9F 4;  4LDT B;  1SE2 A;  1ZDX A;  5KHO A;  5LXH A;  4LJP B;  3OAW A;  2JRH A;  2MBQ A;  2KTR B;  3W9C B;  1D5Z C;  2MSE D;  3L13 A;  3AU4 A;  2CJN A;  1QF6 A;  1WX7 A;  3ZYY X;  3M62 B;  3DBR I;  2IDY A;  3A9K B;  5AEK B;  2MRP A;  2C7H A;  1TZO A;  1CJE A;  3LYY A;  3ZVV A;  1I42 A;  2DBY A;  3Q3J A;  1P9D U;  3P63 A;  1GNU A;  3HVD A;  5J18 A;  2WNM A;  3NZ3 A;  4FHJ A;  3KUC B;  3AEB B;  4JIO U;  1F52 A;  4EUT A;  2PE9 A;  1C3T A;  3BVM A;  1Q0W B;  1OFF A;  2LGI A;  2IO2 B;  3NS8 A;  2WU5 B;  4TKN A;  5J17 A;  5HFY A;  3B2F A;  3QHT A;  1KLU D;  2D5G A;  3MFG A;  4G50 A;  4X57 B;  2WX0 A;  3MP9 A;  2K8C A;  3TCA A;  4YT0 B;  4S0R A;  1K53 A;  4RM9 A;  3DWM A;  2BS3 B;  1C78 A;  3A9K A;  5JHA A;  4ZRP A;  2AQ3 B;  1WY8 A;  2HE7 A;  2KWV B;  1P3Q U;  1Q5W B;  2RR9 A;  4KZC A;  3HVZ A;  4C7Z A;  3SHQ A;  5MPO A;  5IN7 A;  1DYQ A;  2PLP A;  3AE1 B;  2L52 A;  2HD5 B;  4PYU A;  4L1B A;  2PPH A;  1E9M A;  3ZIM A;  4RCO A;  1HTO A;  1HZ5 A;  5IP4 D;  4G11 A;  2K6Q A;  2DAJ A;  2ONQ A;  2WDV B;  2CHZ A;  2JUO A;  1QOB A;  1TY2 A;  3AV8 A;  3LXF A;  1T0S C;  1CK1 A;  3ABV B;  3SD5 A;  4HVB A;  3GP7 A;  2DAF A;  2WU2 B;  4NJC A;  2J0J A;  3URY A;  1WJU A;  1U4A A;  3R7Q A;  2W3S A;  3DDC B;  3AE2 B;  1C1Y B;  2M4N A;  3M63 B;  1AN8 A;  2KQS A;  2JPH A;  3ZJV A;  2I2Y A;  1UZX B;  3FIL B;  2QMT A;  3B2G A;  3ML9 A;  2A4Z A;  2KKC A;  2CKH B;  2JZZ A;  4AJW A;  4EKU A;  1S1Q B;  1BML C;  1E7U A;  2Z0D B;  4MH8 A;  1IGD A;  2FUH B;  2WXO A;  4NZL B;  1OQQ A;  2KAC A;  4GDK B;  1STE A;  4MGK E;  2EMS A;  3AEG B;  4W9J A;  1YQ3 B;  5D7G A;  1UNS A;  4HCN B;  4KGS A;  5BO4 B;  2BB6 A;  2G45 B;  2KN4 A;  1FXA A;  4RMA A;  5L95 C;  1JWS D;  1TZ1 A;  1FD6 A;  1A70 A;  3I9V 1;  1RRB A;  1TS5 A;  3W1S A;  1XLP A;  1TY0 A;  3KWL A;  3V62 A;  4E71 A;  5LLI A;  4ARC A;  4ANV A;  2V1Y A;  1DOX A;  1E7V A;  4IM0 A;  4AQ7 A;  1XO3 A;  2E3T A;  4ZRI A;  4W9E A;  3IHP C;  4BKT A;  3VXW A;  2BWF A;  3S2A A;  3U30 A;  1EWY C;  1FMA D;  2FNJ B;  4HWI B;  1E0Z A;  4ANW A;  3VDZ A;  1F1H A;  4GXB A;  4KZ0 A;  1K50 A;  3CMM B;  4XWW A;  1P0R A;  5EE3 A;  2L83 A;  1WH3 A;  4LNK A;  4P16 A;  4JQW C;  2V4L A;  1SE4 A;  2LEK A;  4IWO A;  1YN5 A;  2RMM A;  3KYC D;  2DZM A;  4B6W A;  3TL5 A;  3MTN B;  5AZH A;  3ZRC A;  4OW0 A;  5IOI A;  1HXY D;  4JL9 A;  1LQB A;  2X38 A;  3PZ7 A;  2CS4 A;  2WHI A;  2JX5 A;  2REX A;  2QIE B;  1HQR D;  2WGS A;  3DHH C;  5D3D A;  4LNI A;  1I4P A;  3FAH A;  5I4D A;  2KWD A;  2V3P A;  2KTF A;  4US8 A;  2LHE A;  2B3A A;  1V8C A;  4HCP B;  3TMP B;  4M00 A;  2KN5 A;  4RH6 A;  2WDR B;  2KFK A;  3MC0 B;  3O13 A;  2W3R A;  3PHW B;  3AE7 B;  1R4N I;  4MM3 A;  4C7Y A;  3EGR A;  3ZNI D;  2UWQ A;  2FE8 A;  2KQ7 A;  2IO3 B;  2PW9 A;  2IY0 B;  2MX2 A;  1I4H A;  3ZNH B;  1ZGU B;  3DBH I;  1N5W A;  1E8X A;  2LXC A;  2PEA A;  1FXT B;  1ZDV A;  5DPS A;  4M0W B;  1J7B A;  2LAS A;  1ZXH A;  4RGO S;  3UQA A;  2AYO B;  3GE8 C;  1LO5 D;  1TBE A;  3B9J A;  1UH6 A;  2XK5 B;  3DOW A;  3NVZ A;  1WJ4 A;  1FCL A;  2CR5 A;  2M1M A;  4IWP A;  1NVI D;  4YTP B;  3RUL A;  3DVG X;  2J7Q B;  3T9L A;  4DHJ B;  4IC7 B;  2Z0E B;  4KSL C;  1IUE A;  2WQY B;  1GC7 A;  2DZJ A;  4HKZ E;  2JU6 X;  1TS3 A;  2RSU A;  2W54 A;  1QT9 A;  1JW9 D;  2N0S B;  3DQV A;  1J7A A;  4TUU A;  1L6U A;  3OWE B;  1GPX A;  3UIP B;  2WYQ A;  2EKI A;  3U4E G;  2C5L C;  1KFY B;  3AN1 A;  2OOB B;  2O2V A;  1UWX A;  4ZDV A;  1E10 A;  1C4A A;  5HI1 A;  2C9W B;  1V1P A;  1N62 A;  3A9J B;  1IGC A;  1QOG A;  4JWU C;  1WXM A;  4A3P A;  1XXG A;  4OVV A;  2WXJ A;  2MEK A;  4I6N B;  4IWQ A;  1JWA D;  4URK A;  2M56 B;  3ETR A;  3H8H A;  1KRH A;  5EE1 A;  2JF5 A;  1XT9 B;  3AI5 A;  2KVR A;  3ZQ4 A;  1I4R A;  3ZGZ A;  3RI7 C;  2LVP A;  2X8X X;  5D2M B;  1WM2 A;  1QIL A;  1N60 A;  4DHJ D;  1PGB A;  1L5P A;  1Y8R C;  2O6V A;  4OHJ A;  4RF0 A;  2EKE C;  4BVU C;  1OQY A;  3CIR B;  3H6N A;  3HUI A;  2V4I B;  4HPM B;  3OLM D;  2R2O A;  1FIQ A;  3UIN B;  1IBX B;  2BPS A;  4ASW C;  3DBL B;  1K51 A;  3K9P B;  4IM2 A;  1IP9 A;  4I6P A;  2LFI A;  1X1M A;  3EFC A;  1UBQ A;  4CYE A;  2IGD A;  1NI2 A;  5L83 A;  2FBW B;  2KK8 A;  1ZP0 B;  2K8B A;  1TS2 A;  1WXV A;  1UUP A;  1NI3 A;  4WAF A;  1JWU D;  5FKA C;  3N32 A;  2K5P A;  4W9H A;  4MSQ B;  2WDT B;  2GLS A;  2BBC A;  4P1C C;  3T8M A;  2EMT A;  4YSY B;  4WWO A;  1EF1 A;  2MJE A;  3BWU D;  4HEA 1;  2DEN B;  4XC2 A;  3L0W B;  4W9C A;  4OVU A;  1WGK A;  2Y5B B;  1QKZ A;  3PTF C;  5KHQ A;  2JY6 A;  2OHF A;  2QC8 A;  4YL8 A;  4DQO C;  1YX6 B;  2KDE B;  4WWM A;  2KDF B;  2KMA A;  4K3B A;  1AYF A;  4DBG A;  1V1O A;  4HDO A;  2L1A A;  1R4N B;  4B95 A;  4PS8 A;  4HJG E;  3TIX A;  3AUL A;  2KWU B;  2N7E A;  4EZJ A;  5TR5 A;  3MC8 A;  2RDG A;  4NAM A;  2H88 B;  1J7C A;  3A1Q B;  3VAW A;  4M8N A;  3VTU A;  2IYD B;  5IO9 A;  2OED A;  1PQS A;  4KX6 B;  1FRR A;  4N58 A;  2J4X A;  2N7D A;  3A4S C;  2MH7 A;  1I7H A;  1MPE A;  2VH1 A;  3HM6 X;  3WCQ A;  2LVO A;  5D94 A;  3X0W A;  1MFW A;  2HJ1 A;  5CX3 A;  1V86 A;  1OGW A;  2KYW A;  3VR9 B;  1MJD A;  2V3N A;  3P4R B;  4TSS A;  1WR6 E;  4MDK E;  1JRU A;  4ZOH C;  3ZRF A;  3BIN A;  1EU3 A;  3EUB 2;  2AQ2 B;  1XD3 B;  1MHH E;  4KKJ A;  4WIP A;  4XWT A;  1AAR A;  3U52 E;  1NYR A;  2JSV X;  4IKG A;  4XX5 A;  2MBB B;  1WE7 A;  2BQQ A;  4GB9 A;  4AS1 A;  1RM6 C;  2J0K A;  2G3Q B;  2K22 A;  1IPG A;  2MP2 A;  3JVZ X;  4GU2 A;  1VZ7 A;  2D11 A;  3AE3 B;  4BFR A;  1D5X C;  2N9K A;  4MAC A;  4A55 A;  2LGX A;  3B1L X;  3DCG A;  1ESF A;  2KMM A;  2GBN A;  3PRZ A;  2JWZ A;  1WMH A;  3K9O B;  1SE9 A;  3QC8 B;  3DVN U;  3APF A;  1C9F A;  4N59 A;  5C2T B;  4QAY A;  1WJN A;  3ZO5 B;  2WXP A;  4ITK A;  1RWS A;  2AEH A;  1C79 A;  1WSP A;  3P2B A;  3OJ3 A;  1QLB B;  3ZJT A;  5JHB A;  1FCC C;  3AMZ A;  1JRP A;  1RLF A;  1SB3 C;  1VZ6 A;  1CMX B;  1PDX A;  3NVY A;  4GN1 A;  2TSS A;  4GOC A;  3VRB B;  3Q8F A;  3RMK C;  4BOZ B;  2CHW A;  4BBN F;  4DHZ E;  3I5J C;  3HK0 A;  4MJS A;  1DGJ A;  1HEZ E;  1TGZ B;  1DOY A;  2ZNV B;  2N9X A;  1KH0 A;  3APC A;  1D5M C;  5JXV A;  2NPT A;  1K52 A;  4FLH A;  2KQ4 X;  4G3X B;  1V49 A;  3DBL I;  3W5V B;  2Z8L A;  4RGT A;  4K81 A;  1XLO A;  5C1Z A;  5E6O A;  2K6D B;  3HRD D;  5BMH A;  2QDF A;  4KVG B;  1GB4 A;  4KGR A;  5H92 C;  3Q69 A;  1SIJ A;  2XEW A;  3TSS A;  3AB5 A;  2M17 A;  1WXQ A;  1TS4 A;  2MBH A;  2WXG A;  1ZUD 2;  3VFK A;  4TQ0 A;  1TYG B;  3IAS 1;  4XDC A;  3AH7 A;  3W2D A;  4D2K A;  2FCQ A;  2JRI B;  4JE3 B;  3NZS A;  3PPA A;  2PKO A;  2J52 A;  4LNO A;  2JZ3 B;  4TV3 A;  3ZKJ C;  2XBB C;  2PTL A;  3IAM 1;  1H4R A;  4DWF A;  3A9J A;  4HJK A;  3BYT B;  3C8Y A;  2INP E;  2N7J A;  3Q3N C;  3DVG Y;  1N63 A;  1N6Z A;  2ASQ A;  4NAW B;  4ZHP A;  2L3Z A;  3KWV A;  3QCA A;  2NTS A;  1ENF A;  2FCN A;  2XN9 C;  5FR3 A;  3P1M A;  3EEC A;  4RGM A;  1J8C A;  4WJP A;  3EHV A;  3I63 C;  2VH2 A;  4GIV A;  1XQQ A;  3GE3 C;  2FAZ A;  3L54 A;  3QAR A;  3JSV B;  3WAN A;  1PUT A;  2D3G A;  2K1F A;  3PVL A;  4RGN A;  3PLU A;  4LK0 M;  3Q6B A;  4AJY B;  4K7W A;  2CU3 A;  3Q8E A;  1WIA A;  5G5H A;  4YTN B;  3TEW A;  2ON8 A;  4WWP A;  2ZVO A;  4WJN A;  3U7Z A;  4JX1 C;  5HKH A;  1KLG D;  4ARI A;  1IYF A;  1L2N A;  2MJD A;  1NYQ A;  3GS2 A;  4ZHO A;  2V0G A;  4O1N A;  2HTM E;  3BK2 A;  1YD8 U;  3NS1 A;  2KFK B;  3PT2 B;  4LNF A;  2ACZ B;  5E6P A;  3RNG C;  4M01 A;  4EEW A;  3ZUN A;  4P6V F;  2JZP A;  1FFV A;  2WXQ A;  3RCZ A;  1UEL A;  4LCD E;  2ICI A;  2WXM A;  4PS3 A;  2WXF A;  1ET6 A;  3MHS D;  4ACF A;  1Z5S B;  1I35 A;  3DPD A;  3N20 C;  1JCK B;  3RD2 A;  2WXN A;  3Q3F A;  4NAW A;  1F2R I;  3W1Y A;  3TUO A;  5IA7 A;  4ICU A;  2FIF A;  1ET9 A;  4BOS C;  1G6J A;  2LGS A;  1D4B A;  4BKS D;  5D6J B;  2G9H D;  3QJZ A;  1KM7 A;  4YWG G;  3TEX A;  4CQN A;  1GOZ A;  1FFU A;  4NY0 A;  2DYO A;  1XLQ A;  4HDQ A;  1YIW A;  2MCN B;  4MJS B;  5CHV C;  2Y5P A;  1QOF A;  1VLB A;  3NVW A;  1Q10 A;  4NPN A;  2LRW A;  4REZ A;  4L2Y A;  1T5X D;  3N3K B;  3U2S C;  2AX5 A;  1GAQ B;  2BS2 B;  2KJH B;  1J0G A;  3B0A A;  2GBK A;  3FKY A;  2BF8 B;  2I1J A;  3ZNZ B;  5BYR A;  1Q1O A;  4W9D A;  2BYV E;  1PGA A;  5JH5 C;  1EWC A;  1UD7 A;  1LM8 B;  1MHX A;  3VUX A;  4A20 A;  1XEE A;  2ZCC A;  4H2A A;  3R7R A;  1WWT A;  1VDV A;  3PV1 A;  2D3B A;  5EDS A;  1E6E B;  4GDK A;  2LUE A;  4W9I A;  2L7R A;  3MHZ A;  3V60 A;  3N30 A;  4HK2 A;  4XYC A;  1OEY J;  4EFO A;  4GMV A;  1C4P A;  3FC4 A;  3WAL A;  2J42 A;  3SR6 A;  4JGH B;  5BYQ A;  2GBR A;  3RFZ B;  3VUW A;  2BKR B;  1VRA B;  4EE2 A;  4YTM B;  2BVC A;  4RM8 A;  3MC9 A;  2DNF A;  2GI9 A;  5GMV A;  2KLG A;  2LGY A;  2L8J A;  5IAA C;  1EUV B;  2AWT A;  2KX3 A;  2L0T A;  2SAK A;  2N9E B;  4OVZ A;  4Q2J A;  3RZF A;  1FXI A;  4HLE A;  5DPW A;  2G4D B;  4USA A;  5HHD G;  1UF0 A;  1VD2 A;  2QHO A;  3A1Q A;  4ZRK A;  3SU8 X;  3EA6 A;  1YNT E;  3M3J A;  3KUD B;  4W9F A;  4BKS A;  3O65 B;  4KDL B;  3NG0 A;  2KX0 A;  4WH4 A;  3NHE B;  1VJK A;  2GBM A;  1FNW A;  3L17 A;  5T8I A;  2KJ6 A;  3SEB A;  5FR6 A;  3WAO A;  3T3O A;  3Q14 C;  1LGR A;  2NTT A;  4ANX A;  2MBO A;  3ZTD A;  2JQR B;  2WXH A;  2BYF A;  2WS3 B;  1T0R C;  4DHZ B;  3Q3M C;  3H9D A;  1FRD A;  2MA9 B;  1I4Q A;  1HZ6 A;  2Q5W D;  1SJH D;  3P4S B;  2RPQ A;  3AED B;  3E56 A;  2LD9 A;  3PSE B;  1F0Z A;  1T3Q A;  4IDI A;  2KO3 A;  3RNE C;  1H8C A;  1I4G A;  3RN9 C;  2KXJ A;  2ZW0 A;  1WGD A;  3PGE A;  3ZLZ A;  1XLN A;  2IGH A;  1WI0 A;  3Q2A C;  1WM3 A;  4LTU A;  3JYU A;  4CHK A;  4JPS A;  2W55 A;  2WDQ B;  1RAX A;  3TJP A;  5CTR C;  1V5T A;  2K25 A;  5EE9 A;  3V6E B;  2KTR A;  2ZVN A;  1HE8 A;  2GOW A;  4K3C A;  4TQ1 A;  2WWZ A;  3AE6 B;  3VRA B;  4AWJ A;  1F9J A;  4II2 B;  2NBU A;  4DK5 A;  1ROE A;  2O6V B;  3RT3 B;  1V81 A;  2NS5 A;  1SIF A;  1SBB B;  3LDZ E;  1T0Q C;  1MG4 A;  4K7U A;  1SJE D;  2K8H A;  2VZK B;  2MHJ A;  5E6J A;  3T3N A;  2ZCB A;  3UQB A;  2BYE A;  4IW0 A;  4ANU A;  5DPT A;  4MGZ E;  5BMG A;  3BVZ A;  3HM3 A;  1Z2M A;  5AUI A;  5HG2 A;  4LLG M;  1R7S A;  3DBR B;  4NQK E;  5H8Y E;  2FCS A;  1GJZ A;  4JWS C;  1M4V A;  2DLB A;  3AEF B;  4IM3 A;  2D3A A;  2KT7 A;  1UGM A;  2SEB D;  2O2V B;  2BW2 A;  4KGT A;  3KW5 B;  1MVK A;  3DBH B;  2ZNV C;  1WYW B;  1B9R A;  1E5W A;  2NMQ A;  1FO4 A;  4F8C B;  3V3X A;  5DPR A;  1YOV B;  3NJT A;  4JLC A;  2DYB A;  1SSN A;  2LMC A;  1VR9 A;  3ML8 A;  2IGG A;  2L0F A;  4J6I A;  1K8R B;  3Q8C A;  3ZXV A;  5AZF A;  3RNC C;  2E6X A;  2BB5 A;  2LUM A;  5G2N A;  2W9N A;  2FCM A;  4ZRQ A;  1WGR A;  1CZP A;  4WJO A;  2KLC A;  3GB1 A;  5D3I B;  2J53 A;  4NNJ B;  3IFW B;  4N6E B;  3TEZ A;  2MWS B;  2BT6 A;  4K7S A;  4MEL A;  5JZE B;  2KDM A;  3QX1 A;  2D10 A;  3JSV A;  3B08 A;  4MM3 B;  4AOF A;  3IVF A;  4US9 A;  1L7Y A;  2WLB A;  1YN4 A;  3VH3 B;  2YEP F;  2XK5 A;  2LGD A;  3TEY A;  1TKY A;  1CQV A;  3WAP A;  2GRI A;  3H7P A;  2QJL A;  2N9P C;  5FK9 C;  4J3O D;  1NBF C;  2L00 B;  2NBV B;  3NVV A;  3HHM A;  5AZG A;  3R2I A;  2GMI C;  4LNN A;  4E3C A;  1VCB A;  2AL3 A;  3U7D A;  2KD0 A;  1LFD A;  3PRP B;  2PIA A;  3R2T A;  2C60 A;  2C7M B;  3ENE A;  2INC C;  1WYG A;  1D6E C;  3NY5 A;  2NBW B;  4DXA B;  2LRU A;  4C4V B;  1ZXI A;  1V6E A;  3RUI B;  3P4Q B;  2WXK A;  4ICV A;  2KMC A;  3IXS A;  1WGY A;  3BY4 B;  3BVG A;  4FJV B;  2KDI A;  4MT5 A;  3RPF C;  3Q8A A;  2MW5 A;  1KTK A;  2ZPN A;  1F2R C;  4FBJ B;  2D3C A;  2BYT A;  3M95 A;  4A9A A;  1WFY A;  4XGA B;  5G5G A;  2KC1 A;  4RFB A;  2BS4 B;  5G55 A;  1SEB D;  1MI0 A;  3NZU A;  4NJ6 A;  3L10 B;  1GB1 A;  3W1S C;  4F7Z A;  3PHX B;  4ZYN A;  3QA8 A;  1WR1 A;  4BZA A;  4IG7 B;  4XZ4 A;  1EF5 A;  4DDI D;  2NPT B;  3PZD A;  2OJW A;  4PS7 A;  2YEP B;  2LVQ A;  2I38 A;  3DHG C;  2ZEQ A;  4MGI E;  3TBL D;  2LI5 A;  3ZTC A;  3RNF C;  1ISN A;  3P4P B;  3SFD B;  2DHZ A;  2BTE A;  1T0Y A;  3N9Y C;  4ZRJ A;  2MLB A;  2JXX A;  1EM7 A;  4A8X C;  4PK1 A;  3R8B A;  3APD A;  2L05 A;  2L32 A;  3H1U A;  3SDL C;  3DBS A;  3FIL A;  3OJ4 B;  4IOI E;  1N5X A;  4A3O A;  2RDB C;  3QWZ B;  4TMA B;  1L0V B;  1HTQ A;  4FN2 A;  1V80 A;  1L0Y B;  1WMH B;  2LJI A;  3LJ3 A;  4AUQ C;  1AW7 A;  1D3Z A;  1WE6 A;  1WXA A;  4PYZ A;  2A5U A;  4DXG A;  2JYE A;  2PVO D;  3GZN B;  4BAX A;  1UGJ A;  1KLV A;  3BII D;  1E8W A;  1C4C A;  2LHD A;  1FNU A;  2MP2 B;  1C76 A;  2W82 A;  1KF6 B;  1WX8 A;  3CSF A;  1J19 A;  2JXT A;  2KJR A;  2IZV B;  4KDI C;  2NCN A;  4ZYS A;  1R4M I;  2VRR B;  3QQ8 B;  2KZR A;  4G0N B;  1E8Y A;  3NUH B;  2R61 A;  2AL6 A;  4P1B C;  4WAA A;  4RF1 A;  4NJ7 A;  4GLS C;  2YVC A;  3R3M A;  4NQL B;  3IT6 B;  1GUA B;  2O6V D;  1B1Z A;  1V2Y A;  5AUK A;  2NVU I;  1P7E A;  2WP9 B;  3ECI A;  4KIK B;  3VQI A;  3LB8 C;  2KC2 A;  2Y3A A;  4B9K A;  2Z59 B;  2ZJD A;  3C19 A;  4WQM A;  2QIL A;  2NR2 A;  4FUL A;  2M0X A;  3BZD B;  3IG3 A;  5CHF A;  1ZW7 A;  3ZW3 A;  4C80 A;  1S3S G;  2KVZ A;  4KV2 A;  1JAL A;  1UBI A;  4YSX B;  2HDE A;  4E74 A;  3UF8 A;  1WZ0 A;  4GGQ A;  4OZA A;  1V5O A;  1C77 A;  4MEM A;  4PT5 A;  3AE9 B;  1QZE A;  2EEL A;  1YJJ A;  5IKC M;  1JRO A;  1P1A A;  4HXD A;  2JT4 B;  1ZPS A;  3E9S A;  1TTN A;  2DZK A;  4AP4 C;  1TT5 B;  3PO0 A;  4L23 A;  2IJ0 A;  5E6N A;  3J9C A;  2FID A;  1SF0 A;  3VUY A;  2OJR A;  1YJI A;  2HTH A;  2IBI B;  2QCZ A;  1XCT L;  1Y56 A;  3HIZ A;  2JVC A;  3ZDT A;  2CHX A;  2IND C;  1E7P B;  1FNV A;  2IY1 B;  4W9K A;  1V97 A;  3ALB A;  3OG5 A;  2WXI A;  3CST A;  3X23 A;  4KIK A;  1KOT A;  1TIF A;  3EC8 A;  3VH4 B;  3N1Z C;  3ZNG C;  2GBJ A;  3AE5 B;  4M8M A;  3AXC A;  3BYY B;  2VZK D;  3VTW A;  2PVG C;  2ZW1 A;  1MG8 A;  3QIJ A;  4FXC A;  2K0P A;  3W5U B;  1RFK A;  3N1Y C; 
#chains in the Genus database with same CATH homology
 2IPK D;  3ZJV A;  1F77 A;  2RDH A;  2I2Y A;  1IBX A;  3FIL B;  1L0X B;  2WXP A;  4ITK A;  4TQ1 A;  2QMT A;  3B2G A;  3AE6 B;  3VRA B;  1RWS A;  1C79 A;  1WSP A;  1DOI A;  1BML C;  1QLB B;  1ROE A;  3ZJT A;  4MH8 A;  1FCC C;  3AMZ A;  1JWM D;  1IGD A;  2WXO A;  1JRP A;  1XF5 L;  4NZL B;  1SBB B;  1OQQ A;  1SB3 C;  1VZ6 A;  1PDX A;  2KAC A;  1SJE D;  3NVY A;  4GDK B;  1STE A;  2TSS A;  2VZK B;  3AEG B;  1YQ3 B;  5D7G A;  1UNS A;  3VRB B;  3Q8F A;  3Q8B A;  4WUR A;  4KGS A;  5E6J A;  3I57 A;  3T3N A;  1TJE A;  2BB6 A;  2KN4 A;  1FXA A;  4XE0 A;  1DGJ A;  1JWS D;  1HEZ E;  1FD6 A;  1DOY A;  5BMG A;  1A70 A;  3I9V 1;  1TS5 A;  1KH0 A;  3W1S A;  4RNA A;  3BVZ A;  1D5M C;  5JXV A;  3AEA B;  1XLP A;  1TY0 A;  3VR8 B;  1K52 A;  5AUI A;  5HG2 A;  2KQ4 X;  3L4P A;  4LLG M;  3KWL A;  1R7S A;  5H8Y E;  4ARC A;  3W5V B;  4A90 A;  3NRZ A;  2Z8L A;  4A6Q A;  1DOX A;  4RGT A;  1XLO A;  4JWS C;  1M4V A;  2DLB A;  1XO3 A;  2E3T A;  3HRD D;  3AEF B;  5BMH A;  4AQ7 A;  1GB4 A;  3AE4 B;  1PYW D;  1V1P B;  4KGR A;  5H92 C;  2SEB D;  3Q69 A;  1SIJ A;  1XCQ L;  2BW2 A;  4KGT A;  3AB5 A;  3TSS A;  1EWY C;  1FMA D;  5BYS A;  1WXQ A;  1TS4 A;  1ZE3 D;  1E0Z A;  1MVK A;  2WXG A;  1ZUD 2;  4TQ0 A;  1TYG B;  3IAS 1;  1K50 A;  4XDC A;  1B9R A;  3AE8 B;  3AH7 A;  2NMQ A;  1FO4 A;  2RPV A;  3W2D A;  3V3X A;  5EE3 A;  4XWW A;  2L83 A;  4D2K A;  1PFD A;  3PZ8 A;  4JE3 B;  4P16 A;  1SE4 A;  2LEK A;  4GDL B;  1JQ4 A;  1YN5 A;  2PKO A;  2J52 A;  2RMM A;  1SSN A;  2KAJ A;  2LMC A;  3KQ4 A;  2PTL A;  1VR9 A;  3IAM 1;  2IGG A;  3BYT B;  1I4X A;  1QQR A;  1HXY D;  4OW0 A;  3C8Y A;  2INP E;  2N7J A;  2X38 A;  3PZ7 A;  1N63 A;  3Q8C A;  4NAW B;  4ZHP A;  2E6X A;  2BB5 A;  2LUM A;  2JX5 A;  1YMH E;  3BK1 A;  3KWV A;  2QIE B;  2NTS A;  1HQR D;  5D3D A;  5C3J B;  1NEK B;  1I4P A;  3FAH A;  5I4D A;  4ZRQ A;  1CZP A;  1FM0 D;  2KWD A;  1ENF A;  4M0W A;  2XN9 C;  1OQR A;  2V3P A;  4US8 A;  5FR3 A;  3P1M A;  2AQ1 B;  2LHE A;  3GB1 A;  5D3I B;  1V8C A;  4RGM A;  4B0E A;  1TKE A;  4HRS A;  3KLS X;  2J53 A;  1SE3 A;  4N6E B;  3TEZ A;  1YQ4 B;  2BT6 A;  4RH6 A;  2WDR B;  1FEH A;  5C2T B;  2INN E;  2B76 B;  5GXG B;  4B0M A;  3MC0 B;  1YN3 A;  3O13 A;  2W3R A;  2H89 B;  2KDM A;  3AE7 B;  3P42 A;  5BMI A;  4C7Y A;  3EGR A;  4DXF A;  1PUT A;  2FE8 A;  4MM3 B;  4OZC A;  2PW9 A;  4US9 A;  1L4Z B;  2M19 A;  4RGN A;  4LK0 M;  2WLB A;  1YN4 A;  2CU3 A;  3Q8E A;  1I4H A;  2YEP F;  1N61 A;  3TEY A;  3MJ5 A;  1TKY A;  5G5H A;  4YTN B;  1CQV A;  1N5W A;  3TEW A;  2ON8 A;  1ZDV A;  2GRI A;  3U7Z A;  1J7B A;  2N9L A;  2QJL A;  1ZXH A;  4RGO S;  5FK9 C;  4J3O D;  4HKQ A;  4JX1 C;  1KLG D;  4ARI A;  1LO5 D;  3AEE B;  3B9J A;  3NVV A;  3NVZ A;  1VZ8 A;  3R2I A;  1FCL A;  2MJD A;  1NVI D;  1NYQ A;  4YTP B;  3GS2 A;  4ZHO A;  2V0G A;  4O1N A;  4R3D A;  3DWG C;  2PMV A;  1IUE A;  2PIA A;  2WQY B;  3R2T A;  2HTM E;  3BK2 A;  1BXT A;  4HKZ E;  2JU6 X;  2WXR A;  1TS3 A;  2DWQ A;  3NS1 A;  2W54 A;  4HRO A;  4YXD B;  2K9X A;  2ACZ B;  1QT9 A;  2QEJ C;  1WYG A;  1D6E C;  1JW9 D;  4P6V F;  2JZP A;  1FFV A;  2WXQ A;  2N0S B;  1ZXI A;  1J7A A;  3P4Q B;  2ICI A;  2WXK A;  2WXM A;  3IXS A;  1L6U A;  2WXF A;  3OWE B;  1UWM A;  5LNK 1;  1GPX A;  3BVG A;  1ET6 A;  4MT5 A;  2EKI A;  1ZOY B;  3U4E G;  4C56 C;  3RPF C;  2QSD A;  3Q8A A;  1JCK B;  1KTK A;  2WXN A;  4YSZ B;  1F2R C;  1KFY B;  3AN1 A;  1F2R I;  2BYT A;  1ACC A;  1UWX A;  4A9A A;  1E10 A;  2Y5C A;  1C4A A;  5HI1 A;  5G5G A;  3TUO A;  1V1P A;  4RFB A;  2BS4 B;  1N62 A;  1SEB D;  1PGX A;  1MI0 A;  1BUI C;  1IGC A;  1ET9 A;  2M0A A;  1QOG A;  4JWU C;  1D4B A;  1L4D B;  1P7F A;  1L6V A;  1GB1 A;  1JML A;  1XXG A;  1RYJ A;  2G9H D;  1AWD A;  4OZB A;  4YWG G;  1T6B X;  3TEX A;  1SXT A;  3V05 A;  2WXJ A;  2MEK A;  4CQN A;  1GOZ A;  1FFU A;  2XNA C;  2YEP B;  4XDD A;  2DYO A;  1JWA D;  3UI3 A;  2I38 A;  2M56 B;  1XLQ A;  1WRI A;  3ETR A;  3H8H A;  2Y5P A;  1QOF A;  3IT4 B;  1KRH A;  5EE1 A;  1VLB A;  5EE0 A;  3NVW A;  3P4P B;  3ZQ4 A;  3SFD B;  1I4R A;  3ZGZ A;  1Q10 A;  4REZ A;  4L2Y A;  1T5X D;  2BTE A;  3U2S C;  2MJ3 A;  1QIL A;  1N60 A;  2AX5 A;  3N9Y C;  3CWI A;  1QOA A;  1GAQ B;  1PGB A;  1L5P A;  1EM7 A;  1TKG A;  2BS2 B;  2K3U A;  2CJO A;  4OHJ A;  4RF0 A;  5TSS A;  4A8X C;  3R8B A;  2GB1 A;  3ZJU A;  2L32 A;  3CIR B;  3HUI A;  5BYR A;  2V4I B;  2JWU A;  3FIL A;  1FIQ A;  4IOI E;  1N5X A;  1IBX B;  2JYT A;  4TMA B;  1L0V B;  2DYM A;  3AEC B;  1PGA A;  4KKI A;  1K51 A;  1EWC A;  2FUG 1;  1MHX A;  1L0Y B;  1NEN B;  2LJI A;  1XEE A;  1AW7 A;  2LFI A;  2WXL A;  4H2A A;  1WWT A;  1VDV A;  4DXG A;  2JYE A;  2IGD A;  2FBW B;  1E6E B;  2PVO D;  1UGJ A;  1ZP0 B;  1TS2 A;  1HA5 A;  1UUP A;  4N59 A;  1NI3 A;  3BII D;  4WAF A;  3MHZ A;  2G1E A;  1C4C A;  1EU4 A;  1JWU D;  2LHD A;  1FNU A;  5FKA C;  1C76 A;  3AM9 A;  1JWB D;  2W82 A;  4UDU C;  1KF6 B;  3SFE B;  2K5P A;  1SE2 A;  1ZDX A;  2JXT A;  1C4P A;  2BBC A;  3FC4 A;  2J42 A;  3SR6 A;  4YSY B;  4ZYS A;  5BYQ A;  2MJE A;  3RFZ B;  3W9C B;  3BWU D;  1VRA B;  1D5Z C;  4EE2 A;  3NUH B;  4YTM B;  2R61 A;  4HEA 1;  2CJN A;  1QF6 A;  4RF1 A;  1WGK A;  3ZYY X;  4GLS C;  2IDY A;  2GI9 A;  1QKZ A;  3IT6 B;  2OHF A;  1B1Z A;  1TZO A;  1CJE A;  3LYY A;  5AUK A;  4DQO C;  2DBY A;  1P7E A;  4WWM A;  2WP9 B;  2SAK A;  3P63 A;  3HVD A;  1AYF A;  4OVZ A;  3VQI A;  1V1O A;  3LB8 C;  4Q2J A;  2WNM A;  3NZ3 A;  2L1A A;  2Y3A A;  4WQM A;  1FXI A;  3AEB B;  2QIL A;  3BZD B;  4HJG E;  4USA A;  5HHD G;  4C80 A;  3BVM A;  1JAL A;  1OFF A;  2LGI A;  2RDG A;  4NAM A;  2WU5 B;  4YSX B;  2H88 B;  2HDE A;  1J7C A;  2OED A;  4KX6 B;  5HFY A;  1FRR A;  3B2F A;  4OZA A;  1KLU D;  4N58 A;  2D5G A;  2J4X A;  3EA6 A;  1C77 A;  3MFG A;  1YNT E;  4PT5 A;  3AE9 B;  2EEL A;  2MH7 A;  1I7H A;  4WH4 A;  1YJJ A;  1MPE A;  1JRO A;  3WCQ A;  1VJK A;  1FNW A;  3MP9 A;  5T8I A;  4YT0 B;  3SEB A;  1K53 A;  1ZPS A;  3T3O A;  3DWM A;  2BS3 B;  3E9S A;  1C78 A;  4ZRP A;  2AQ3 B;  3VR9 B;  3PO0 A;  4L23 A;  2IJ0 A;  2NTT A;  2V3N A;  3HVZ A;  3P4R B;  4C7Z A;  4TSS A;  3J9C A;  4ZOH C;  1SF0 A;  5MPO A;  1DYQ A;  2PLP A;  3AE1 B;  2L52 A;  1EU3 A;  1YJI A;  2JQR B;  2AQ2 B;  3EUB 2;  1XCT L;  1MHH E;  1Y56 A;  2WXH A;  4KKJ A;  2WS3 B;  4WIP A;  4XWT A;  3U52 E;  1NYR A;  4L1B A;  2JSV X;  1E9M A;  4IKG A;  4RCO A;  1E7P B;  1FNV A;  1FRD A;  1I4Q A;  1HZ6 A;  2Q5W D;  1SJH D;  1HZ5 A;  3P4S B;  2ONQ A;  2WDV B;  1V97 A;  3AED B;  3E56 A;  4AS1 A;  2WXI A;  1RM6 C;  1QOB A;  1TY2 A;  1F0Z A;  1T3Q A;  3AV8 A;  4IDI A;  2K22 A;  3LXF A;  1CK1 A;  1I4G A;  3ABV B;  1VZ7 A;  3GP7 A;  3AE3 B;  2ZW0 A;  1D5X C;  2N9K A;  4MAC A;  4A55 A;  2WU2 B;  4NJC A;  1ESF A;  3URY A;  2KMM A;  3AE5 B;  1XLN A;  2IGH A;  2W3S A;  3AE2 B;  4LTU A;  3BYY B;  2VZK D;  2PVG C;  2ZW1 A;  4FXC A;  4JPS A;  2W55 A;  2K0P A;  3W5U B;  1C9F A;  2WDQ B;  1RFK A;  1AN8 A;  5EE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...