4KGRA

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-lys31, beta-3-asn35
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein-like Tertiary Folding Behavior from Heterogeneous Backbones.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-3-
total genus 13
structure length 52
sequence length 56
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kgrA00
1MPEA 4GLSC 1MI0A 1MVKA 2JXTA 5BMGA 4KGTA 1XCTL 4IOIE 1QKZA 3UI3A 1GB4A 4KGRA 2ONQA 4OZCA 5HFYA 1IGCA 2J52A 1XCQL 1K52A 2I2YA 1ZXHA 2KWDA 1PGBA 1FCLA 4WH4A 1IBXB 1MHXA 1FD6A 4KGSA 4OZBA 2N9KA 1UWXA 1F2RI 1EM7A 2KDMA 2I38A 2JSVX 2PTLA 2LUMA 2ZW0A 2LHEA 1P7FA 5HG2A 2LGIA 1F2RC 2EELA 2IGHA 3GB1A 2GB1A 1KH0A 1HZ5A 2LHDA 2JWUA 2RPVA 4OZAA 1C9FA 1IBXA 3V3XA 3MP9A 5HI1A 1GB1A 1XF5L 4HJGE 1D4BA 2JU6X 2J53A 4D2KA 1HEZE 2JZPA 2PW9A 4HKZE 1Q10A 1MHHE 2NMQA 2ZW1A 1JMLA 2K0PA 2KQ4X 5BMIA 2QMTA 2ON8A 5HHDG 2IGDA 4MACA 1K53A 2OEDA 2KN4A 2N7JA 1IGDA 3FILA 1YMHE 2GI9A 2RMMA 2KACA 1HZ6A 1PGXA 1K50A 3FILB 1YNTE 1P7EA 2IGGA 2QSDA 2PLPA 2N9LA 5BMHA 1FCCC 4IKGA 1PGAA 5JXVA 1K51A
chains in the Genus database with same CATH superfamily
3UQBA 3P2BA 2O6VD 2V3PA 3Q3OC 3VAWA 1CMXB 2W3SA 1E6EB 1UWMA 3RULA 4W9FA 3NVZA 3L16A 1XCQL 4K3CA 4EZKA 3C8YA 2Y5CA 2QIEB 3APCA 5E6NA 2MH7A 3DBRI 2I1JA 2EKEC 3R66C 1TZOA 4BOZB 1LQBA 2OHFA 2B76B 4P7IA 5KHOA 1UH6A 4HXDA 5G55A 1V9JA 1WXSA 3LB8C 1Z2MA 1GJZA 3U52E 1F0ZA 2KFKB 2W54A 1YX6B 3QHTA 1ESFA 1L0VB 1L2NA 1I4PA 1WXVA 1N61A 3WIMA 3W5UB 3UF8A 3RZWC 1D4BA 3A9KB 2JPHA 1FNUA 1TJEA 2FCSA 2BS3B 2Z0DB 3V61A 4M00A 1UGJA 4S17A 2EMTA 2XN9C 1MG8A 2QILA 3NY5A 1TKGA 2RD0A 3Q3JA 5DPSA 4HPMB 1KM7A 1R4MI 4MM3A 3L4PA 2IGDA 1NYRA 3DVNV 3VUWA 2KMAA 1T0QC 2LEKA 3JVZX 3A1QA 2KTFA 3BYYB 3BK1A 2KANA 4ICUA 1YNTE 2REXA 2LGSA 5DCNA 4OVZA 3TEXA 2ZJDA 1JWAD 4IKGA 3NRZA 1QOFA 5JXVA 1MVKA 2MLBA 1QKZA 1SJHD 3UIOB 1T5XD 3N32A 2LVPA 2KVZA 2LRWA 2DYOA 2K8BA 1ZDXA 1K52A 1T3QA 3R2TA 1JRPA 2KWDA 1KF6B 2RPQA 1WR6E 1WGKA 3Q6BA 4C00A 2QDFA 3KUDB 4NAMA 2VH1A 4GMVA 1H8CA 3OLMD 2ZVNA 2HTME 4EE2A 1ZXIA 3I3TB 1UNSA 2LUEA 2WXRA 2JYEA 3CSFA 2PTLA 4A6QA 5HG2A 2KFJA 4GXBA 4L23A 2NTSA 1ZGUB 3GB1A 4W9LA 1E5WA 2LHDA 1YJ1A 1NEKB 1SIFA 3VR8B 3RNAC 2KMMA 3H7PB 1XF5L 2UYZB 3MC8A 1N5XA 4G3XB 4D2KA 1T0SC 3TSSA 3PHXB 5FR3A 4RF1A 1WE7A 2DZMA 1EWCA 1OQYA 1STEA 2KQ4X 1UELA 4E71A 1EUVB 3DWMA 4AQ7A 4FADA 2MJ3A 2EKIA 2LD9A 3WAOA 1WXQA 4AS1A 1R7SA 3RYTA 3CIRB 3KQ4A 1E0ZA 2ZNVC 3PPAA 2GI9A 2BKRB 3ETRA 3T8MA 1PGXA 2QEJC 4BOSC 4C4VA 3KUCB 1VLBA 2QSDA 2MX2A 2PLPA 2N7EA 5FR6A 2WYQA 1TKYA 2AQ1B 4GLSC 2KDEB 4IWQA 3Q14C 4F8CB 1WIAA 1Z5SB 4KX6B 1TBEA 3PZDA 2KK8A 4IDIA 1IGCA 2FAZA 2W3RA 2BPSA 2VZKD 3KWVA 2K9XA 2D3AA 2KAJA 3SFEB 4EEWA 3MHSD 2M56B 1FNVA 1JCKB 1Q1OA 2IY1B 2CU3A 1GC6A 4US9A 2MHJA 1EU4A 2LGYA 2DHZA 3ZDTA 2DBYA 2BF8B 3N1YC 4HPPA 2BTEA 2JQRB 1C4AA 5L83A 2LXAA 4C56C 4TQ1A 3AEFB 1V8CA 4FULA 4DBGA 3Q8AA 1ZW7A 3ONSA 3QIJA 2FUG1 4JE3B 3KYCD 4B0EA 2JT4B 3I9V1 2V3SA 4HWIB 4MGZE 4ICVA 2AEHA 4IC7B 1OQRA 4K3BA 4WWNA 2SEBD 2MP2A 1WJUA 2DZKA 3A9JB 3GOEA 3NVVA 1R4NB 1SJED 1WGRA 2BGFA 3ZTCA 3P4QB 1K53A 3VH4B 1IGDA 2GOWA 3P1MA 1T0YA 4WIPA 5D3DA 1MG4A 1WJNA 2L76A 1HQRD 2L7RA 1V80A 1PQSA 4USAA 3P4RB 1WXAA 1FXTB 4HEA1 1F77A 1OTRB 4EUTA 3AECB 2IYDB 4ANVA 2IJ0A 1GB4A 2WLBA 4KGRA 1E9MA 4PS3A 2IO2B 3ZVVA 1ET6A 1WRIA 4XGAB 1WR1A 4M02A 3KW5B 4MH0E 4GB9A 3RNEC 2BKFA 1KTKA 3H9DA 5TSSA 4EZJA 1L4DB 3E9SA 1CQVA 2KX3A 2EMSA 1XLPA 4JWSC 3RUIB 1F2RC 1WZ3A 2JRIB 3RZFA 3AULA 1TS5A 4MGIE 2N9PC 4CHKA 3OWEB 3NS1A 1IPGA 3WAPA 2RR9A 4G0NB 1SF0A 2MJDA 3AI5A 3NHEB 3QA8A 3TL5A 5HKHA 3H8HA 2M19A 2WXGA 4LNOA 2BYFA 3FC4A 4C7YA 3RD2A 5CHFA 4DXGA 3NJTA 3VTVA 3MC9A 4NNJB 2JZZA 3BYTB 3AE4B 3T3OA 3IT4B 5CHWA 1WMHA 1WX8A 3DVGY 4ANUA 4BVUC 4N9F4 1TTNA 1RWSA 2Q5WD 1P98A 2J0JA 4M0WA 2C7NB 4XWWA 1V5OA 2M4NA 3X0WA 4RGTA 2QC8A 5J17A 3EECA 1GPXA 4NY0A 3H6NA 3ENEA 3DBRB 2N9LA 2WXJA 2N0SB 5IAAC 1N5WA 4NJCA 4FHKA 3NUHB 4FJZA 2G1EA 3IHPC 3D32A 2IO0B 1J19A 5LLIA 3VQIA 1I4GA 5EDSA 4QAYA 5D94A 3Q8BA 4B9KA 3RFZB 1DOXA 4ZYNA 1FD6A 2KLCA 2LZ6A 1F1HA 4AJYB 2WDRB 4NJ7A 4RGMA 3AE6B 3A4RA 2QHOA 2ZPNA 1SSNA 2MSED 3J9CA 1VR9A 4DXFA 2INCC 2MA9B 3TEYA 5DPWA 2J7QB 4REZA 3R8BA 4WJNA 2N1VA 5GXGB 1L6UA 3AE2B 5AUKA 2INDC 3SEBA 4MGKE 1WGHA 2RPVA 3APDA 4ZHPA 1C9FA 4XDDA 1L6VA 3KYDD 4HJGE 1E8ZA 4HLEA 2WXHA 2LRUA 4K7UA 3KVFB 1DOYA 3HVZA 3FKYA 1LXDA 3OJ3A 2MBOA 4EFOA 4HK2A 4XYCA 1IUEA 4AUQC 4JIOU 5IO9A 1JMLA 4YL8A 4S0RA 5T8IA 2YLMA 3K9OB 2WU2B 2L32A 2WXMA 3H1UA 4KIKA 3A33B 1FNWA 5AZFA 3U8ZA 4CYEA 2D3CA 3DBHB 4EOYA 3ZJTA 2KN4A 4W9JA 4KKIA 2CHZA 2RMMA 1LGRA 4GOCA 3Q69A 4IW0A 3AB5A 4YT0B 1HZ6A 4DHZE 4ZYSA 2CS4A 5AUIA 1EO6A 1TYGB 4ACFA 2ZVOA 3RMKC 5BMHA 2VRRB 1YIWA 3AE3B 1VRAB 1JWMD 4WWPA 1MPEA 1OFFA 3GE8C 1DYQA 3SFDB 4XX5A 1NI3A 4LNKA 2R2OA 2K25A 3DVGX 3CF6E 5TR5A 3ZO5B 4A3OA 2KJHB 3AEAB 4RFBA 4TMAB 3V6CB 3DQVA 1V81A 4AWJA 3DHIC 2DYMA 4YXDB 2N9EB 2HE7A 3ZKJC 3P42A 3PO0A 2INPE 3BIID 1R4MB 1FFUA 1WGDA 4LNNA 4A8XC 4YTPB 1UGMA 4KKJA 2D2QA 1P7FA 2KWCA 4II2B 2LGIA 2PE9A 4YSXB 3WALA 3TBLD 2V1YA 2TSSA 1TS4A 3H7SA 2KWUB 4H2AA 3U2SC 4A90A 1JWUD 3OG5A 4YTMB 4RF0A 3GP7A 3TIXA 4F7ZA 2IO3B 4HKZE 2Z59B 2MBBB 1ROEA 5IOIA 3BK2A 3GS2A 1GNUA 4M8MA 1V97A 1YQ3B 1P9DU 4F1SA 3UQAA 1FM0D 4W9DA 3UINB 2OEDA 2KVRA 2N7JA 3KUZA 5J18A 2YEPB 4C4VB 2D11A 4NQKE 1YN4A 1E8YA 1FRRA 1RAXA 1BXTA 2L3ZA 2FCMA 2GRIA 2UWQA 3N1ZC 4BKGA 2CJNA 3BWUD 2KXJA 1E7PB 1WGYA 2AX5A 2BT6A 3PSEB 4N59A 2KKCA 1XD3B 4OZCA 2ZNVB 3WA0A 2N4FA 4OHJA 2JF5A 2PMVA 4GN1A 4P1CC 3LYYA 4II3B 3CWIA 2D07B 3DBLB 1FCLA 4PYZA 2FIFA 5CHVC 5JHBA 4HROA 4K7SA 3AXCA 1RM6C 5CX3A 4C7ZA 3VUYA 1SE9A 4EKUA 4FA6A 2DNFA 3Q3MC 5D7GA 2JSVX 3I5JC 4K81A 3ZW3A 1OQQA 3EGRA 3M63B 2LUMA 2J42A 5EE3A 2L8JA 1LFDA 1EU3A 2JRHA 3MTNB 2ZZPB 1N6ZA 2PVOD 4IM2A 1NDDA 1UUPA 4MGYE 3PRMB 2K3UA 4A20A 4ASWC 4ZDVA 4O1NA 1WY8A 3VRAB 5G2NA 4I6LB 2PW9A 3AEGB 4GDKB 2KWVB 3W2DA 3A9JA 2IDYA 1D6EC 1G6JA 3VH3B 5CTRC 4AJWA 2IPKD 2D10A 2L0FA 4MACA 3B2GA 4GDLB 1BUIC 4P6VF 1WI0A 2G4DB 2KACA 1AW7A 3RNFC 3SHQA 3T9LA 3O65B 4DWFA 1FCCC 3K9PB 2DAJA 1JALA 4W9EA 1ENFA 1WJ6A 1E8XA 4AP4C 1FRDA 3EA6A 4DHZB 3NOBA 4I6PA 4NZLB 1F9JA 2K6QA 3L08A 2BW2A 1FEHA 4HPLB 3PT2B 2M17A 2I1KA 2LXCA 1RLFA 3KLSX 3CMMB 1K8RB 3WANA 3KWLA 1QOAA 2WS3B 3QC8B 2KDFB 2N9KA 3EFCA 2WU5B 2DWQA 2QJLA 4R3DA 4NAWA 1EM7A 2WQYB 3FAHA 1VJKA 2I38A 2KC1A 3TEWA 4W9KA 2WDVB 2X8XX 1LO5D 2GB1A 1KH0A 1HZ5A 2FIDA 2D5GA 2KLGA 2DYBA 4MSMB 3MP9A 3P4SB 1WX9A 1A5RA 1D3ZA 1XLOA 4WWMA 3TJPA 2YEPF 4PT5A 1HEZE 3PLVA 1HXYD 3AH7A 4GU2A 3DBSA 4BAXA 2KHWB 2ACZB 1ZOYB 2Z0EB 3B2FA 2A5UA 2KZRA 1NVID 2N9XA 1KRHA 3DWGC 4DQOC 2IBIB 4BKSD 4LLGM 3ZJUA 2E6XA 2KJRA 3ZLZA 1YMHE 5EE1A 3RI7C 4ANWA 4KV2A 2L00B 1P7EA 3MFGA 3AEEB 3MC0B 2NCNA 1PGAA 3PRZA 1C3TA 2K6DB 1MI0A 3VFKA 4TQ0A 4TSSA 3L54A 1RRBA 3DBHI 2LJIA 4URKA 2CHXA 3N3KB 1WWTA 2LGXA 3QARA 3R7QA 2CJOA 4JGHB 3HIZA 2KTRA 1FXIA 4MH8A 5L95C 1TS3A 1SBBB 2KNBA 3ZQ4A 2DZJA 2NBWB 5LNK1 2OJRA 3JSVB 3X23A 3TUOA 2K1FA 2KYWA 1VDVA 2R2QA 3DHGC 3M95A 4FLHA 4W9GA 3UIPB 3AE7B 5G5GA 1XEEA 4OW0A 3Q8FA 2ZPYA 1B9RA 2Y5BB 2FBWB 3NZUA 4J3OD 3ZUNA 4RM9A 2WXOA 3M3JA 2CR5A 2GBMA 2WNMA 2XK5B 1VZ6A 3EFUA 2JZPA 3L13A 1F52A 3SR6A 2SAKA 2M8SA 3ZDMC 2V3NA 4LCDE 1T6BX 4J6IA 1UZXB 1QF6A 1C4CA 4DDID 4WJOA 4Q2JA 1GAQB 4YTNB 3Q3FA 5IKCM 2NPTA 5BYRA 4HCPB 2C60A 3ZYYX 1JRUA 2DENB 3UGBB 3EUB2 2WX1A 3PTFC 3DHHC 3L0WB 4LNFA 3Q3NC 4FBJB 5FK9C 1WM2A 2JXXA 1N62A 2XNAC 4US8A 1I4HA 1UF0A 3NVWA 3ZRCA 3UI3A 1WMHB 1I35A 1TS2A 4FJVB 2NPTB 3ECIA 1C76A 2BWFA 2WXLA 1ET9A 3B0AA 3ML9A 2B3AA 3JSVA 3IG3A 3SU8X 4G50A 1MJDA 4BBNF 4XWTA 2K22A 4BFRA 3NZSA 4GSWA 3U4EG 2FE8A 2Y3AA 2WXQA 1V1PA 2IY0B 1YOVB 2JWZA 3VUXA 1AN8A 2LHEA 4HKQA 1YJIA 2BB5A 1KLVA 3PZ8A 1L7YA 3A9KA 5BO4B 4FXCA 1WXMA 2VH2A 4FN2A 4B95A 4WAFA 4BKSA 1CK1A 4EZLA 1FPYA 2OOBB 4KDLB 1C77A 4A3PA 5C3JB 1Q5WB 1S3SG 1TY0A 2K0PA 1ZE3D 2J0MA 1L5PA 2N1WA 2WXKA 1JW9D 2WHIA 2XBBC 4W9IA 3E56A 2BS4B 3ALBA 1X1MA 3HHMA 1RYJA 4LDTB 2PJHA 1ISNA 3AE9B 4KVGB 3JYUA 4WJQA 4LDTD 1L0YB 3A4SC 4PYUA 4ARCA 1U4AA 5BMGA 5IN7A 3S2AA 1YD8U 3IXSA 4A55A 1Q0WB 3DCGA 3VXWA 1WX7A 2PPHA 3AU5A 1WFYA 2DX5B 4XDCA 2WWZA 2I2YA 2D3BA 4TUUA 1PGBA 2W9NA 1B1ZA 2WP9B 3LXFA 3W1YA 4KGSA 1QILA 1IP9A 4NQLB 3P4PB 1QZEA 4BKTA 1HE8A 2WXIA 1RFAA 1F2RI 1GUAB 4ARIA 2J4XA 1OEYJ 1WE6A 1OGWA 2QCZA 1M4VA 2KMCA 1NI2A 2RDHA 1KLUD 2NS5A 1SE3A 3N9YC 1KOTA 2D3GA 4NJ6A 5H8YE 2LVOA 3URYA 2XEWA 3N1XC 1TGZB 5FKAC 2AL3A 3IVFA 5BYSA 1JWSD 2LI5A 3HK0A 1XXGA 3ZTDA 5LXIB 1V6EA 2PE6B 2IO1B 3HUIA 3PV1A 2KD0A 1UD7A 1MHHE 2WXPA 3ML8A 2BYVE 1H4RA 2NTTA 3GZNI 3AE5B 5AEKB 3ZXRA 1WYGA 5HHDG 2MQJA 4FHJA 4KZCA 4G11A 2KDBA 1TIFA 3BVMA 1I4RA 4RNAA 3B1LX 2FCNA 1D5ZC 1KFYB 3FILB 4AOFA 1TZ1A 2GBNA 2MW5A 4L2YA 4C80A 1SE4A 1GOZA 1BMLC 1K51A 3TCAA 4WAAA 1WZ0A 2PEAA 3N30A 1C4PA 2L83A 5BYQA 4B6WA 2AQ2B 2W55A 4IUMB 4HCNB 2G45B 4WURA 1J7AA 1MFWA 5E6PA 2DLBA 2CKHB 3V62A 3ABVB 1MHXA 3AU4A 5JHAA 4NAWB 2KT7A 1YN3A 1VZ7A 1WGGA 1PUTA 2LGDA 5G5HA 2FCQA 2BYEA 2AQ3B 3L10B 1DGJA 3IBEA 4E74A 3QCAA 1E7VA 3N20C 2EELA 1QOBA 2IGHA 4RM8A 5AZHA 3T3NA 4MM3B 1V86A 1EF5A 3QQ8B 3V05A 3I57A 3RNGC 4LJOB 2JU6X 3PHWB 4ZRJA 3OAWA 1J0GA 2V0GA 1V1OA 1N60A 5D6JB 2ICIA 3L17A 1OEYA 1PDXA 3B9JA 4KDIC 3GE3C 2ZW1A 4JWUC 1J7CA 2H88B 2BBCA 2L0TA 3AV8A 3HRDD 1C78A 1V5TA 4M8NA 2QMTA 2DAFA 4MJSB 4L1BA 5EE0A 4ZHOA 1TKEA 5C2TB 4KZ0A 1RFKA 5IA7A 4WWOA 4RCOA 1SEBD 4TKNA 2HDEA 2WDTB 1E10A 1FIQA 4DHJB 2JVCA 3VRBB 4RGNA 4LTUA 2WXNA 3TMPB 3M62B 2NR2A 2KC2A 2IZVB 2NVUI 5D2MB 2LVQA 1SB3C 1FFVA 2ZCBA 3RNBC 5MPOA 2BYTA 3AEDB 1YQBA 3AMZA 3DPDA 1GG3A 2MBEA 1HTQA 5IP4D 4GDLA 2JZ3B 1AARA 2J0KA 3R3MA 3WAMA 4W9CA 2K8CA 2KTRB 4PS7A 2K8HA 1VZ8A 2FNJB 4OVVA 1QQRA 4I6NB 1UWXA 2CHWA 4HDOA 3RPFC 4CQNA 5DPRA 1SXTA 3ZXVA 1EF1A 1WJ4A 3DOWA 2O6VB 4WQOB 1FO4A 2BVCA 3AN1A 4NPNA 4GIVA 1D5XC 2JWUA 1SGHA 2KO3A 1R4NI 4MDKE 4OZAA 4IWOA 3PREA 1E90A 5C1ZA 1IBXA 3U7ZA 3V3XA 2XK5A 2MBHA 4JPSA 3B08A 3ZNID 2GMIC 2HJ8A 3PVLA 2GBJA 4PK1A 3QWZB 2WX0A 2V4LA 2K39A 5E6OA 1YJJA 2O6VA 4RMAA 5BMIA 3RNCC 2KQ7A 1PFDA 1XQQA 3IAS1 2RSUA 1Y56A 1WM3A 3HM6X 2C9WB 3BVZA 1SIJA 2E3TA 1EWYC 2NBUA 2L1AA 1QLBB 3PS6A 3MHZA 4N6EB 4XE0A 4DDGD 3R7RA 2ZCCA 2NBVB 3WCQA 3HM3A 4DK5A 2O2VA 1ZPSA 1AYFA 5JH5C 2WXFA 2C7MB 1L4ZB 4M01A 3VR9B 3KH0A 1BT0A 3W1SC 2PVGC 3LDZE 3VVWB 2V9HA 1TT5B 2BWES 2MJEA 1WH3A 2KX0A 1A70A 1ZXHA 1PYWD 1V1PB 2AWTA 4P1BC 1JQ4A 1YN5A 2KDMA 1YX5B 3AEBB 1J8CA 1C79A 1XT9B 4XC2A 1NBFC 3BINA 2LMCA 1FMAD 1Y8RC 3ZNZB 2H89B 1JROA 3AE8B 1WF9A 2JYTA 1D5MC 4E3CA 1N63A 4A9AA 4MELA 1NENB 4JLCA 2R61A 3ZJVA 2L05A 2MWSB 4W9HA 3NZ3A 2L52A 1XLNA 4TV3A 3ZRFA 3H7PA 1NYQA 2CU1A 3ZIMA 4IM3A 1Q10A 3QX1A 2M1MA 3QK0A 2NMQA 2UU7A 1UBQA 1DOIA 2JX5A 1I42A 2G3QB 2BQQA 3NS8A 1I4QA 4BBNC 1KJTA 2Y5PA 3JW0X 2ON8A 4HVBA 4ZRQA 3BVGA 5KHQA 1CJEA 4JL9A 1CZPA 1V49A 3AE1B 5D3IB 5E6JA 1HTOA 1VCBA 1P3QU 2M0AA 4IWPA 1K50A 3SDLC 2IGGA 1LM8B 2W82A 3DBLI 3RT3B 2LASA 4WQMA 1UBIA 3PGEA 2KN5A 3Q8CA 1I7HA 4RGOS 3RCZA 5I4DA 3BY4B 2ONQA 4JQWC 5HFYA 3O13A 2DZIA 1P1AA 2GBKA 4UDUC 2V4IB 1ZUD2 2ASQA 2VZKB 3VTWA 4B0MA 2LJ5A 3QAQA 2JUOA 2G4SA 3DDCB 3MJWA 4OZBA 3SD5A 3ZNHB 1SE2A 1QOGA 4MEMA 2AL6A 1I4XA 4GDKA 3MJ5A 1HA5A 1ZKHA 5C23A 5J2RA 2KDIA 2ZEQA 3Q2AC 4WJPA 3W1SA 3DVNU 1GC7A 4IM0A 5DPTA 2LWPA 3U30A 4DHJD 2MCNB 2MEKA 4IG7B 4MJSA 1V2YA 1TY2A 1GB1A 4ITKA 4FJYA 3ZNGC 2OJWA 1JWBD 4BZAA 4HRSA 4ZRKA 1WYWB 2G9HD 3PRPB 4LNIA 4CO7A 2RDBC 2HJ1A 1XLQA 1ZDVA 4JX1C 4ZOHC 3NVYA 3HVDA 4YSZB 1S1QB 4N58A 2WGSA 5H92C 1AWDA 2MP2B 4YSYB 4HJKA 3FILA 3BZDB 4X57B 2A4ZA 4YWGG 4GGQA 4MSQB 1T0RC 1WRDB 2Z8LA 3LJ3A 3IT6B 3IAM1 1VD2A 1M94A 4LK0M 2GLSA 4P16A 1QT9A 2HTHA 2BB6A 2JXTA 4KGTA 1XCTL 4IOIE 1L0XB 3C0RB 1IYFA 5AZGA 2J52A 2KOXA 4XZ4A 3I63C 1C1YB 2M0XA 3AM9A 1XO3A 2X38A 4WH4A 1IBXB 2HD5B 5EE9A 3EC8A 2AYOB 3RN9C 3QJZA 1E8WA 3CSTA 4DXAB 2KQSA 2MBQA 3OJ4B 4K1RB 4K7WA 3C19A 1WSPA 4HDQA 2C7HA 2MRPA 3IFWB 3R2IA 2RDGA 2ZW0A 2LFIA 1ACCA 4ANXA 1ZP0B 2GBRA 3VDZA 3ZGZA 1P0RA 2K5PA 4KIKB 5JZEB 3VHTC 2KFKA 1YQ4B 5HI1A 2N7DA 5LXHA 3PZ7A 2KJ6A 1KLGD 2J53A 4KSLC 3APFA 3Q8EA 3PLUA 3GZNB 4ZRIA 3EHVA 4LJPB 2WDQB 2O2VB 2RGFA 2FUHB 2PIAA 4OVUA 3NG0A 4KSKC 3U7DA 1FXAA 3P63A 5GMVA 3TEZA 2YVCA 3V6EB 3V60A 2JY6A 4M0WB 4MT5A 3W9CB 1J7BA 3W5VB 1E7UA 2PKOA 3VTUA 4PS8A 3A1QB 2INNE 2BS2B 4ZRPA 2C5LC 4RH6A
chains in the Genus database with same CATH topology
1N5WA 4NJCA 2V3PA 1MI0A 1SB3C 2W3SA 4TQ0A 1FFVA 3NUHB 2G1EA 5MPOA 1E6EB 2BYTA 3AEDB 4TSSA 3AMZA 2LJIA 1UWMA 1WWTA 3NVZA 3VQIA 1I4GA 2CJOA 1XCQL 1FXIA 4MH8A 3C8YA 2Y5CA 2QIEB 1TS3A 2MH7A 1SBBB 3Q8BA 3ZQ4A 3RFZB 1DOXA 1FD6A 1TZOA 5LNK1 2OHFA 1VZ8A 2WDRB 4RGMA 3AE6B 2B76B 3TUOA 1QQRA 1UWXA 3J9CA 1SSNA 3RPFC 4CQNA 1VR9A 4DXFA 1VDVA 1SXTA 3LB8C 3AE7B 3TEYA 5G5GA 1XEEA 4OW0A 4REZA 1FO4A 3R8BA 3Q8FA 3U52E 5GXGB 1F0ZA 2W54A 1B9RA 1L6UA 3AE2B 3AN1A 5AUKA 2FBWB 3SEBA 1D5XC 4J3OD 2JWUA 2RPVA 1ESFA 1L0VB 4OZAA 4ZHPA 4XDDA 1C9FA 1I4PA 1IBXA 3U7ZA 1N61A 3V3XA 1L6VA 3W5UB 2WXOA 4HJGE 4JPSA 1D4BA 1FNUA 1TJEA 2WNMA 2WXHA 2BS3B 1DOYA 1VZ6A 2JZPA 3HVZA 1UGJA 3SR6A 2SAKA 1IUEA 2V3NA 1T6BX 2XN9C 1YJJA 1JMLA 1QF6A 2QILA 1C4CA 5T8IA 5BMIA 1PFDA 1TKGA 4Q2JA 1GAQB 2WU2B 2L32A 2WXMA 3IAS1 4YTNB 1Y56A 3L4PA 1FNWA 3BVZA 1SIJA 1NYRA 2IGDA 1EWYC 2E3TA 5BYRA 3ZJTA 2KN4A 1QLBB 2L1AA 2LEKA 3ZYYX 4KKIA 2RMMA 3MHZA 4N6EB 3BYYB 3BK1A 3Q69A 3AB5A 4YT0B 1HZ6A 3EUB2 4ZYSA 4XE0A 1YNTE 5AUIA 4OVZA 1TYGB 3WCQA 5BMHA 3TEXA 5FK9C 1JWAD 4IKGA 3NRZA 1QOFA 5JXVA 3AE3B 1ZPSA 1VRAB 1N62A 2XNAC 1JWMD 1AYFA 1MPEA 1MVKA 2WXFA 4US8A 1I4HA 1OFFA 3NVWA 1DYQA 1L4ZB 3UI3A 1QKZA 1SJHD 1T5XD 3SFDB 1TS2A 3VR9B 1NI3A 2PVGC 2DYOA 2MJEA 1C76A 1ZDXA 1A70A 1K52A 3AEAB 1T3QA 4RFBA 2WXLA 4TMAB 1ZXHA 3R2TA 1ET9A 1JRPA 2KWDA 1KF6B 1WGKA 4XWTA 2K22A 4NAMA 1PYWD 2DYMA 1V1PB 4YXDB 3U4EG 2HTME 2FE8A 4EE2A 2Y3AA 3P42A 2WXQA 3PO0A 2INPE 1ZXIA 3BIID 1YN5A 1JQ4A 1V1PA 2KDMA 3AEBB 1FFUA 1UNSA 1C79A 2WXRA 4A8XC 4YTPB 2JYEA 2PTLA 4KKJA 1AN8A 2LHEA 1P7FA 4A6QA 5HG2A 1YJIA 4HKQA 2LMCA 4L23A 2BB5A 1FMAD 2LGIA 2NTSA 3GB1A 4YSXB 3PZ8A 2LHDA 2H89B 2TSSA 1TS4A 1JROA 4H2AA 3U2SC 4A90A 4FXCA 3AE8B 1JWUD 1NEKB 3VR8B 2JYTA 1D5MC 4YTMB 4RF0A 2KMMA 1XF5L 1N63A 4WAFA 4A9AA 3GP7A 1NENB 2R61A 3ZJVA 1N5XA 3NZ3A 2L52A 1XLNA 1CK1A 4D2KA 3TSSA 4HKZE 1C77A 1NYQA 1ROEA 5C3JB 1Q10A 5FR3A 4RF1A 1TY0A 2NMQA 3BK2A 3GS2A 1DOIA 1EWCA 2JX5A 2K0PA 1STEA 2KQ4X 1ZE3D 1V97A 1L5PA 1I4QA 1YQ3B 3DWMA 4AQ7A 2Y5PA 2ON8A 2MJ3A 2WXKA 2EKIA 1FM0D 1WXQA 1JW9D 4AS1A 4ZRQA 3BVGA 2OEDA 1R7SA 2N7JA 1CJEA 2YEPB 3CIRB 1CZPA 3AE1B 3E56A 2BS4B 3KQ4A 5D3IB 5E6JA 1RYJA 1E0ZA 2GI9A 1YN4A 2M0AA 3ETRA 3AE9B 1FRRA 1PGXA 2QEJC 1K50A 1BXTA 1VLBA 2IGGA 2QSDA 2W82A 2PLPA 1L0YB 2GRIA 4WQMA 1TKYA 2AQ1B 4ARCA 2CJNA 3BWUD 4GLSC 5BMGA 1E7PB 3Q8CA 3IXSA 4A55A 1I7HA 2AX5A 2BT6A 4RGOS 4KX6B 5I4DA 4N59A 2ONQA 4OZCA 4IDIA 5HFYA 1IGCA 2W3RA 4OHJA 2PMVA 2VZKD 3O13A 3KWVA 4UDUC 2K9XA 4XDCA 2I2YA 2V4IB 2KAJA 3LYYA 1ZUD2 3CWIA 1PGBA 3SFEB 1FCLA 2M56B 1B1ZA 2VZKB 2WP9B 3LXFA 4B0MA 4HROA 1FNVA 1QILA 1JCKB 4KGSA 4OZBA 1RM6C 2CU3A 1SE2A 3P4PB 1QOGA 4C7ZA 4US9A 2WXIA 1F2RI 1EU4A 4ARIA 2J4XA 1I4XA 2DBYA 3MJ5A 5D7GA 1HA5A 2JSVX 1M4VA 1OQQA 3EGRA 2LUMA 2BTEA 3W1SA 2JQRB 2RDHA 1C4AA 1KLUD 1SE3A 3N9YC 4C56C 5H8YE 2J42A 2MEKA 3AEFB 4TQ1A 5EE3A 1V8CA 3URYA 1EU3A 3Q8AA 5FKAC 1TY2A 2FUG1 2PVOD 1GB1A 4ITKA 1UUPA 1JWSD 5BYSA 4JE3B 2K3UA 1XXGA 4O1NA 3VRAB 4B0EA 3HUIA 3I9V1 2PW9A 3AEGB 4GDKB 1JWBD 1MHHE 1OQRA 3W2DA 2WXPA 2IDYA 4HRSA 2G9HD 2NTTA 2SEBD 3AE5B 1D6EC 1XLQA 1ZDVA 3NVVA 4JX1C 4ZOHC 1SJED 3NVYA 3HVDA 4YSZB 1WYGA 5HHDG 2IPKD 4N58A 4MACA 5H92C 1AWDA 3P4QB 1K53A 3B2GA 4GDLB 4YSYB 1IGDA 3FILA 3P1MA 1BUIC 3BZDB 3BVMA 4P6VF 1I4RA 4RNAA 4WIPA 4YWGG 5D3DA 2KACA 1AW7A 1D5ZC 1KFYB 3FILB 1HQRD 2Z8LA 3IT6B 4USAA 4L2YA 3P4RB 1FCCC 1SE4A 1GOZA 3IAM1 4C80A 1JALA 1BMLC 1F77A 1K51A 4HEA1 4LK0M 1ENFA 4P16A 1QT9A 3AECB 1C4PA 2BB6A 1FRDA 2JXTA 2L83A 3EA6A 4KGTA 2IJ0A 1XCTL 4IOIE 4NZLB 1GB4A 5BYQA 1L0XB 2AQ2B 2W55A 2BW2A 2WLBA 1FEHA 4KGRA 1E9MA 4WURA 2J52A 1J7AA 3KLSX 1ET6A 3AM9A 1WRIA 1XO3A 2DLBA 2X38A 4WH4A 3KWLA 3ABVB 1IBXB 1MHXA 1QOAA 5EE9A 2WS3B 4NAWB 1YN3A 1VZ7A 1KTKA 2N9KA 2WU5B 1PUTA 2DWQA 2QJLA 4R3DA 1EM7A 2WQYB 3FAHA 5G5HA 5TSSA 1VJKA 1L4DB 1WSPA 3E9SA 2I38A 1CQVA 3TEWA 2AQ3B 2WDVB 3R2IA 1DGJA 1XLPA 2RDGA 2ZW0A 2LFIA 1ACCA 1ZP0B 4JWSC 1F2RC 1QOBA 2EELA 2IGHA 3ZGZA 1LO5D 2GB1A 1KH0A 1HZ5A 1TS5A 2K5PA 3T3NA 4MM3B 2D5GA 3OWEB 3V05A 1YQ4B 3NS1A 3MP9A 3P4SB 3I57A 5HI1A 3PZ7A 1SF0A 2MJDA 1KLGD 2JU6X 1XLOA 3H8HA 4WWMA 2M19A 2WXGA 2YEPF 2J53A 4PT5A 1HEZE 2V0GA 3FC4A 3Q8EA 1V1OA 1N60A 4C7YA 2ICIA 1PDXA 2WDQB 1HXYD 3AH7A 4DXGA 3B9JA 2ZW1A 3BYTB 4JWUC 1J7CA 3AE4B 2ACZB 2PIAA 3T3OA 3IT4B 2H88B 2BBCA 1ZOYB 3AV8A 3HRDD 3B2FA 1C78A 4L1BA 2QMTA 5EE0A 4ZHOA 1NVID 1TKEA 1KRHA 1FXAA 1RWSA 3DWGC 3P63A 5C2TB 4DQOC 1RFKA 2Q5WD 3TEZA 4LLGM 4RCOA 4M0WA 4XWWA 2E6XA 1SEBD 3ZJUA 2HDEA 1YMHE 4RGTA 5EE1A 1E10A 1FIQA 3VRBB 4RGNA 4LTUA 2WXNA 1GPXA 4MT5A 3W9CB 1J7BA 3W5VB 2PKOA 1P7EA 3MFGA 3AEEB 2INNE 3MC0B 2N9LA 2BS2B 4ZRPA 2WXJA 4RH6A 1PGAA 2N0SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPE A;  4GLS C;  1MI0 A;  1MVK A;  2JXT A;  5BMG A;  4KGT A;  1XCT L;  4IOI E;  1QKZ A;  3UI3 A;  1GB4 A;  4KGR A;  2ONQ A;  4OZC A;  5HFY A;  1IGC A;  2J52 A;  1XCQ L;  1K52 A;  2I2Y A;  1ZXH A;  2KWD A;  1PGB A;  1FCL A;  4WH4 A;  1IBX B;  1MHX A;  1FD6 A;  4KGS A;  4OZB A;  2N9K A;  1UWX A;  1F2R I;  1EM7 A;  2KDM A;  2I38 A;  2JSV X;  2PTL A;  2LUM A;  2ZW0 A;  2LHE A;  1P7F A;  5HG2 A;  2LGI A;  1F2R C;  2EEL A;  2IGH A;  3GB1 A;  2GB1 A;  1KH0 A;  1HZ5 A;  2LHD A;  2JWU A;  2RPV A;  4OZA A;  1C9F A;  1IBX A;  3V3X A;  3MP9 A;  5HI1 A;  1GB1 A;  1XF5 L;  4HJG E;  1D4B A;  2JU6 X;  2J53 A;  4D2K A;  1HEZ E;  2JZP A;  2PW9 A;  4HKZ E;  1Q10 A;  1MHH E;  2NMQ A;  2ZW1 A;  1JML A;  2K0P A;  2KQ4 X;  5BMI A;  2QMT A;  2ON8 A;  5HHD G;  2IGD A;  4MAC A;  1K53 A;  2OED A;  2KN4 A;  2N7J A;  1IGD A;  3FIL A;  1YMH E;  2GI9 A;  2RMM A;  2KAC A;  1HZ6 A;  1PGX A;  1K50 A;  3FIL B;  1YNT E;  1P7E A;  2IGG A;  2QSD A;  2PLP A;  2N9L A;  5BMH A;  1FCC C;  4IKG A;  1PGA A;  5JXV A;  1K51 A; 
#chains in the Genus database with same CATH topology
 3UQB A;  3P2B A;  2O6V D;  2V3P A;  3Q3O C;  3VAW A;  1CMX B;  2W3S A;  1E6E B;  1UWM A;  3RUL A;  4W9F A;  3NVZ A;  3L16 A;  1XCQ L;  4K3C A;  4EZK A;  3C8Y A;  2Y5C A;  2QIE B;  3APC A;  5E6N A;  2MH7 A;  3DBR I;  2I1J A;  2EKE C;  3R66 C;  1TZO A;  4BOZ B;  1LQB A;  2OHF A;  2B76 B;  4P7I A;  5KHO A;  1UH6 A;  4HXD A;  5G55 A;  1V9J A;  1WXS A;  3LB8 C;  1Z2M A;  1GJZ A;  3U52 E;  1F0Z A;  2KFK B;  2W54 A;  1YX6 B;  3QHT A;  1ESF A;  1L0V B;  1L2N A;  1I4P A;  1WXV A;  1N61 A;  3WIM A;  3W5U B;  3UF8 A;  3RZW C;  1D4B A;  3A9K B;  2JPH A;  1FNU A;  1TJE A;  2FCS A;  2BS3 B;  2Z0D B;  3V61 A;  4M00 A;  1UGJ A;  4S17 A;  2EMT A;  2XN9 C;  1MG8 A;  2QIL A;  3NY5 A;  1TKG A;  2RD0 A;  3Q3J A;  5DPS A;  4HPM B;  1KM7 A;  1R4M I;  4MM3 A;  3L4P A;  2IGD A;  1NYR A;  3DVN V;  3VUW A;  2KMA A;  1T0Q C;  2LEK A;  3JVZ X;  3A1Q A;  2KTF A;  3BYY B;  3BK1 A;  2KAN A;  4ICU A;  1YNT E;  2REX A;  2LGS A;  5DCN A;  4OVZ A;  3TEX A;  2ZJD A;  1JWA D;  4IKG A;  3NRZ A;  1QOF A;  5JXV A;  1MVK A;  2MLB A;  1QKZ A;  1SJH D;  3UIO B;  1T5X D;  3N32 A;  2LVP A;  2KVZ A;  2LRW A;  2DYO A;  2K8B A;  1ZDX A;  1K52 A;  1T3Q A;  3R2T A;  1JRP A;  2KWD A;  1KF6 B;  2RPQ A;  1WR6 E;  1WGK A;  3Q6B A;  4C00 A;  2QDF A;  3KUD B;  4NAM A;  2VH1 A;  4GMV A;  1H8C A;  3OLM D;  2ZVN A;  2HTM E;  4EE2 A;  1ZXI A;  3I3T B;  1UNS A;  2LUE A;  2WXR A;  2JYE A;  3CSF A;  2PTL A;  4A6Q A;  5HG2 A;  2KFJ A;  4GXB A;  4L23 A;  2NTS A;  1ZGU B;  3GB1 A;  4W9L A;  1E5W A;  2LHD A;  1YJ1 A;  1NEK B;  1SIF A;  3VR8 B;  3RNA C;  2KMM A;  3H7P B;  1XF5 L;  2UYZ B;  3MC8 A;  1N5X A;  4G3X B;  4D2K A;  1T0S C;  3TSS A;  3PHX B;  5FR3 A;  4RF1 A;  1WE7 A;  2DZM A;  1EWC A;  1OQY A;  1STE A;  2KQ4 X;  1UEL A;  4E71 A;  1EUV B;  3DWM A;  4AQ7 A;  4FAD A;  2MJ3 A;  2EKI A;  2LD9 A;  3WAO A;  1WXQ A;  4AS1 A;  1R7S A;  3RYT A;  3CIR B;  3KQ4 A;  1E0Z A;  2ZNV C;  3PPA A;  2GI9 A;  2BKR B;  3ETR A;  3T8M A;  1PGX A;  2QEJ C;  4BOS C;  4C4V A;  3KUC B;  1VLB A;  2QSD A;  2MX2 A;  2PLP A;  2N7E A;  5FR6 A;  2WYQ A;  1TKY A;  2AQ1 B;  4GLS C;  2KDE B;  4IWQ A;  3Q14 C;  4F8C B;  1WIA A;  1Z5S B;  4KX6 B;  1TBE A;  3PZD A;  2KK8 A;  4IDI A;  1IGC A;  2FAZ A;  2W3R A;  2BPS A;  2VZK D;  3KWV A;  2K9X A;  2D3A A;  2KAJ A;  3SFE B;  4EEW A;  3MHS D;  2M56 B;  1FNV A;  1JCK B;  1Q1O A;  2IY1 B;  2CU3 A;  1GC6 A;  4US9 A;  2MHJ A;  1EU4 A;  2LGY A;  2DHZ A;  3ZDT A;  2DBY A;  2BF8 B;  3N1Y C;  4HPP A;  2BTE A;  2JQR B;  1C4A A;  5L83 A;  2LXA A;  4C56 C;  4TQ1 A;  3AEF B;  1V8C A;  4FUL A;  4DBG A;  3Q8A A;  1ZW7 A;  3ONS A;  3QIJ A;  2FUG 1;  4JE3 B;  3KYC D;  4B0E A;  2JT4 B;  3I9V 1;  2V3S A;  4HWI B;  4MGZ E;  4ICV A;  2AEH A;  4IC7 B;  1OQR A;  4K3B A;  4WWN A;  2SEB D;  2MP2 A;  1WJU A;  2DZK A;  3A9J B;  3GOE A;  3NVV A;  1R4N B;  1SJE D;  1WGR A;  2BGF A;  3ZTC A;  3P4Q B;  1K53 A;  3VH4 B;  1IGD A;  2GOW A;  3P1M A;  1T0Y A;  4WIP A;  5D3D A;  1MG4 A;  1WJN A;  2L76 A;  1HQR D;  2L7R A;  1V80 A;  1PQS A;  4USA A;  3P4R B;  1WXA A;  1FXT B;  4HEA 1;  1F77 A;  1OTR B;  4EUT A;  3AEC B;  2IYD B;  4ANV A;  2IJ0 A;  1GB4 A;  2WLB A;  4KGR A;  1E9M A;  4PS3 A;  2IO2 B;  3ZVV A;  1ET6 A;  1WRI A;  4XGA B;  1WR1 A;  4M02 A;  3KW5 B;  4MH0 E;  4GB9 A;  3RNE C;  2BKF A;  1KTK A;  3H9D A;  5TSS A;  4EZJ A;  1L4D B;  3E9S A;  1CQV A;  2KX3 A;  2EMS A;  1XLP A;  4JWS C;  3RUI B;  1F2R C;  1WZ3 A;  2JRI B;  3RZF A;  3AUL A;  1TS5 A;  4MGI E;  2N9P C;  4CHK A;  3OWE B;  3NS1 A;  1IPG A;  3WAP A;  2RR9 A;  4G0N B;  1SF0 A;  2MJD A;  3AI5 A;  3NHE B;  3QA8 A;  3TL5 A;  5HKH A;  3H8H A;  2M19 A;  2WXG A;  4LNO A;  2BYF A;  3FC4 A;  4C7Y A;  3RD2 A;  5CHF A;  4DXG A;  3NJT A;  3VTV A;  3MC9 A;  4NNJ B;  2JZZ A;  3BYT B;  3AE4 B;  3T3O A;  3IT4 B;  5CHW A;  1WMH A;  1WX8 A;  3DVG Y;  4ANU A;  4BVU C;  4N9F 4;  1TTN A;  1RWS A;  2Q5W D;  1P98 A;  2J0J A;  4M0W A;  2C7N B;  4XWW A;  1V5O A;  2M4N A;  3X0W A;  4RGT A;  2QC8 A;  5J17 A;  3EEC A;  1GPX A;  4NY0 A;  3H6N A;  3ENE A;  3DBR B;  2N9L A;  2WXJ A;  2N0S B;  5IAA C;  1N5W A;  4NJC A;  4FHK A;  3NUH B;  4FJZ A;  2G1E A;  3IHP C;  3D32 A;  2IO0 B;  1J19 A;  5LLI A;  3VQI A;  1I4G A;  5EDS A;  4QAY A;  5D94 A;  3Q8B A;  4B9K A;  3RFZ B;  1DOX A;  4ZYN A;  1FD6 A;  2KLC A;  2LZ6 A;  1F1H A;  4AJY B;  2WDR B;  4NJ7 A;  4RGM A;  3AE6 B;  3A4R A;  2QHO A;  2ZPN A;  1SSN A;  2MSE D;  3J9C A;  1VR9 A;  4DXF A;  2INC C;  2MA9 B;  3TEY A;  5DPW A;  2J7Q B;  4REZ A;  3R8B A;  4WJN A;  2N1V A;  5GXG B;  1L6U A;  3AE2 B;  5AUK A;  2IND C;  3SEB A;  4MGK E;  1WGH A;  2RPV A;  3APD A;  4ZHP A;  1C9F A;  4XDD A;  1L6V A;  3KYD D;  4HJG E;  1E8Z A;  4HLE A;  2WXH A;  2LRU A;  4K7U A;  3KVF B;  1DOY A;  3HVZ A;  3FKY A;  1LXD A;  3OJ3 A;  2MBO A;  4EFO A;  4HK2 A;  4XYC A;  1IUE A;  4AUQ C;  4JIO U;  5IO9 A;  1JML A;  4YL8 A;  4S0R A;  5T8I A;  2YLM A;  3K9O B;  2WU2 B;  2L32 A;  2WXM A;  3H1U A;  4KIK A;  3A33 B;  1FNW A;  5AZF A;  3U8Z A;  4CYE A;  2D3C A;  3DBH B;  4EOY A;  3ZJT A;  2KN4 A;  4W9J A;  4KKI A;  2CHZ A;  2RMM A;  1LGR A;  4GOC A;  3Q69 A;  4IW0 A;  3AB5 A;  4YT0 B;  1HZ6 A;  4DHZ E;  4ZYS A;  2CS4 A;  5AUI A;  1EO6 A;  1TYG B;  4ACF A;  2ZVO A;  3RMK C;  5BMH A;  2VRR B;  1YIW A;  3AE3 B;  1VRA B;  1JWM D;  4WWP A;  1MPE A;  1OFF A;  3GE8 C;  1DYQ A;  3SFD B;  4XX5 A;  1NI3 A;  4LNK A;  2R2O A;  2K25 A;  3DVG X;  3CF6 E;  5TR5 A;  3ZO5 B;  4A3O A;  2KJH B;  3AEA B;  4RFB A;  4TMA B;  3V6C B;  3DQV A;  1V81 A;  4AWJ A;  3DHI C;  2DYM A;  4YXD B;  2N9E B;  2HE7 A;  3ZKJ C;  3P42 A;  3PO0 A;  2INP E;  3BII D;  1R4M B;  1FFU A;  1WGD A;  4LNN A;  4A8X C;  4YTP B;  1UGM A;  4KKJ A;  2D2Q A;  1P7F A;  2KWC A;  4II2 B;  2LGI A;  2PE9 A;  4YSX B;  3WAL A;  3TBL D;  2V1Y A;  2TSS A;  1TS4 A;  3H7S A;  2KWU B;  4H2A A;  3U2S C;  4A90 A;  1JWU D;  3OG5 A;  4YTM B;  4RF0 A;  3GP7 A;  3TIX A;  4F7Z A;  2IO3 B;  4HKZ E;  2Z59 B;  2MBB B;  1ROE A;  5IOI A;  3BK2 A;  3GS2 A;  1GNU A;  4M8M A;  1V97 A;  1YQ3 B;  1P9D U;  4F1S A;  3UQA A;  1FM0 D;  4W9D A;  3UIN B;  2OED A;  2KVR A;  2N7J A;  3KUZ A;  5J18 A;  2YEP B;  4C4V B;  2D11 A;  4NQK E;  1YN4 A;  1E8Y A;  1FRR A;  1RAX A;  1BXT A;  2L3Z A;  2FCM A;  2GRI A;  2UWQ A;  3N1Z C;  4BKG A;  2CJN A;  3BWU D;  2KXJ A;  1E7P B;  1WGY A;  2AX5 A;  2BT6 A;  3PSE B;  4N59 A;  2KKC A;  1XD3 B;  4OZC A;  2ZNV B;  3WA0 A;  2N4F A;  4OHJ A;  2JF5 A;  2PMV A;  4GN1 A;  4P1C C;  3LYY A;  4II3 B;  3CWI A;  2D07 B;  3DBL B;  1FCL A;  4PYZ A;  2FIF A;  5CHV C;  5JHB A;  4HRO A;  4K7S A;  3AXC A;  1RM6 C;  5CX3 A;  4C7Z A;  3VUY A;  1SE9 A;  4EKU A;  4FA6 A;  2DNF A;  3Q3M C;  5D7G A;  2JSV X;  3I5J C;  4K81 A;  3ZW3 A;  1OQQ A;  3EGR A;  3M63 B;  2LUM A;  2J42 A;  5EE3 A;  2L8J A;  1LFD A;  1EU3 A;  2JRH A;  3MTN B;  2ZZP B;  1N6Z A;  2PVO D;  4IM2 A;  1NDD A;  1UUP A;  4MGY E;  3PRM B;  2K3U A;  4A20 A;  4ASW C;  4ZDV A;  4O1N A;  1WY8 A;  3VRA B;  5G2N A;  4I6L B;  2PW9 A;  3AEG B;  4GDK B;  2KWV B;  3W2D A;  3A9J A;  2IDY A;  1D6E C;  1G6J A;  3VH3 B;  5CTR C;  4AJW A;  2IPK D;  2D10 A;  2L0F A;  4MAC A;  3B2G A;  4GDL B;  1BUI C;  4P6V F;  1WI0 A;  2G4D B;  2KAC A;  1AW7 A;  3RNF C;  3SHQ A;  3T9L A;  3O65 B;  4DWF A;  1FCC C;  3K9P B;  2DAJ A;  1JAL A;  4W9E A;  1ENF A;  1WJ6 A;  1E8X A;  4AP4 C;  1FRD A;  3EA6 A;  4DHZ B;  3NOB A;  4I6P A;  4NZL B;  1F9J A;  2K6Q A;  3L08 A;  2BW2 A;  1FEH A;  4HPL B;  3PT2 B;  2M17 A;  2I1K A;  2LXC A;  1RLF A;  3KLS X;  3CMM B;  1K8R B;  3WAN A;  3KWL A;  1QOA A;  2WS3 B;  3QC8 B;  2KDF B;  2N9K A;  3EFC A;  2WU5 B;  2DWQ A;  2QJL A;  4R3D A;  4NAW A;  1EM7 A;  2WQY B;  3FAH A;  1VJK A;  2I38 A;  2KC1 A;  3TEW A;  4W9K A;  2WDV B;  2X8X X;  1LO5 D;  2GB1 A;  1KH0 A;  1HZ5 A;  2FID A;  2D5G A;  2KLG A;  2DYB A;  4MSM B;  3MP9 A;  3P4S B;  1WX9 A;  1A5R A;  1D3Z A;  1XLO A;  4WWM A;  3TJP A;  2YEP F;  4PT5 A;  1HEZ E;  3PLV A;  1HXY D;  3AH7 A;  4GU2 A;  3DBS A;  4BAX A;  2KHW B;  2ACZ B;  1ZOY B;  2Z0E B;  3B2F A;  2A5U A;  2KZR A;  1NVI D;  2N9X A;  1KRH A;  3DWG C;  4DQO C;  2IBI B;  4BKS D;  4LLG M;  3ZJU A;  2E6X A;  2KJR A;  3ZLZ A;  1YMH E;  5EE1 A;  3RI7 C;  4ANW A;  4KV2 A;  2L00 B;  1P7E A;  3MFG A;  3AEE B;  3MC0 B;  2NCN A;  1PGA A;  3PRZ A;  1C3T A;  2K6D B;  1MI0 A;  3VFK A;  4TQ0 A;  4TSS A;  3L54 A;  1RRB A;  3DBH I;  2LJI A;  4URK A;  2CHX A;  3N3K B;  1WWT A;  2LGX A;  3QAR A;  3R7Q A;  2CJO A;  4JGH B;  3HIZ A;  2KTR A;  1FXI A;  4MH8 A;  5L95 C;  1TS3 A;  1SBB B;  2KNB A;  3ZQ4 A;  2DZJ A;  2NBW B;  5LNK 1;  2OJR A;  3JSV B;  3X23 A;  3TUO A;  2K1F A;  2KYW A;  1VDV A;  2R2Q A;  3DHG C;  3M95 A;  4FLH A;  4W9G A;  3UIP B;  3AE7 B;  5G5G A;  1XEE A;  4OW0 A;  3Q8F A;  2ZPY A;  1B9R A;  2Y5B B;  2FBW B;  3NZU A;  4J3O D;  3ZUN A;  4RM9 A;  2WXO A;  3M3J A;  2CR5 A;  2GBM A;  2WNM A;  2XK5 B;  1VZ6 A;  3EFU A;  2JZP A;  3L13 A;  1F52 A;  3SR6 A;  2SAK A;  2M8S A;  3ZDM C;  2V3N A;  4LCD E;  1T6B X;  4J6I A;  1UZX B;  1QF6 A;  1C4C A;  4DDI D;  4WJO A;  4Q2J A;  1GAQ B;  4YTN B;  3Q3F A;  5IKC M;  2NPT A;  5BYR A;  4HCP B;  2C60 A;  3ZYY X;  1JRU A;  2DEN B;  3UGB B;  3EUB 2;  2WX1 A;  3PTF C;  3DHH C;  3L0W B;  4LNF A;  3Q3N C;  4FBJ B;  5FK9 C;  1WM2 A;  2JXX A;  1N62 A;  2XNA C;  4US8 A;  1I4H A;  1UF0 A;  3NVW A;  3ZRC A;  3UI3 A;  1WMH B;  1I35 A;  1TS2 A;  4FJV B;  2NPT B;  3ECI A;  1C76 A;  2BWF A;  2WXL A;  1ET9 A;  3B0A A;  3ML9 A;  2B3A A;  3JSV A;  3IG3 A;  3SU8 X;  4G50 A;  1MJD A;  4BBN F;  4XWT A;  2K22 A;  4BFR A;  3NZS A;  4GSW A;  3U4E G;  2FE8 A;  2Y3A A;  2WXQ A;  1V1P A;  2IY0 B;  1YOV B;  2JWZ A;  3VUX A;  1AN8 A;  2LHE A;  4HKQ A;  1YJI A;  2BB5 A;  1KLV A;  3PZ8 A;  1L7Y A;  3A9K A;  5BO4 B;  4FXC A;  1WXM A;  2VH2 A;  4FN2 A;  4B95 A;  4WAF A;  4BKS A;  1CK1 A;  4EZL A;  1FPY A;  2OOB B;  4KDL B;  1C77 A;  4A3P A;  5C3J B;  1Q5W B;  1S3S G;  1TY0 A;  2K0P A;  1ZE3 D;  2J0M A;  1L5P A;  2N1W A;  2WXK A;  1JW9 D;  2WHI A;  2XBB C;  4W9I A;  3E56 A;  2BS4 B;  3ALB A;  1X1M A;  3HHM A;  1RYJ A;  4LDT B;  2PJH A;  1ISN A;  3AE9 B;  4KVG B;  3JYU A;  4WJQ A;  4LDT D;  1L0Y B;  3A4S C;  4PYU A;  4ARC A;  1U4A A;  5BMG A;  5IN7 A;  3S2A A;  1YD8 U;  3IXS A;  4A55 A;  1Q0W B;  3DCG A;  3VXW A;  1WX7 A;  2PPH A;  3AU5 A;  1WFY A;  2DX5 B;  4XDC A;  2WWZ A;  2I2Y A;  2D3B A;  4TUU A;  1PGB A;  2W9N A;  1B1Z A;  2WP9 B;  3LXF A;  3W1Y A;  4KGS A;  1QIL A;  1IP9 A;  4NQL B;  3P4P B;  1QZE A;  4BKT A;  1HE8 A;  2WXI A;  1RFA A;  1F2R I;  1GUA B;  4ARI A;  2J4X A;  1OEY J;  1WE6 A;  1OGW A;  2QCZ A;  1M4V A;  2KMC A;  1NI2 A;  2RDH A;  1KLU D;  2NS5 A;  1SE3 A;  3N9Y C;  1KOT A;  2D3G A;  4NJ6 A;  5H8Y E;  2LVO A;  3URY A;  2XEW A;  3N1X C;  1TGZ B;  5FKA C;  2AL3 A;  3IVF A;  5BYS A;  1JWS D;  2LI5 A;  3HK0 A;  1XXG A;  3ZTD A;  5LXI B;  1V6E A;  2PE6 B;  2IO1 B;  3HUI A;  3PV1 A;  2KD0 A;  1UD7 A;  1MHH E;  2WXP A;  3ML8 A;  2BYV E;  1H4R A;  2NTT A;  3GZN I;  3AE5 B;  5AEK B;  3ZXR A;  1WYG A;  5HHD G;  2MQJ A;  4FHJ A;  4KZC A;  4G11 A;  2KDB A;  1TIF A;  3BVM A;  1I4R A;  4RNA A;  3B1L X;  2FCN A;  1D5Z C;  1KFY B;  3FIL B;  4AOF A;  1TZ1 A;  2GBN A;  2MW5 A;  4L2Y A;  4C80 A;  1SE4 A;  1GOZ A;  1BML C;  1K51 A;  3TCA A;  4WAA A;  1WZ0 A;  2PEA A;  3N30 A;  1C4P A;  2L83 A;  5BYQ A;  4B6W A;  2AQ2 B;  2W55 A;  4IUM B;  4HCN B;  2G45 B;  4WUR A;  1J7A A;  1MFW A;  5E6P A;  2DLB A;  2CKH B;  3V62 A;  3ABV B;  1MHX A;  3AU4 A;  5JHA A;  4NAW B;  2KT7 A;  1YN3 A;  1VZ7 A;  1WGG A;  1PUT A;  2LGD A;  5G5H A;  2FCQ A;  2BYE A;  2AQ3 B;  3L10 B;  1DGJ A;  3IBE A;  4E74 A;  3QCA A;  1E7V A;  3N20 C;  2EEL A;  1QOB A;  2IGH A;  4RM8 A;  5AZH A;  3T3N A;  4MM3 B;  1V86 A;  1EF5 A;  3QQ8 B;  3V05 A;  3I57 A;  3RNG C;  4LJO B;  2JU6 X;  3PHW B;  4ZRJ A;  3OAW A;  1J0G A;  2V0G A;  1V1O A;  1N60 A;  5D6J B;  2ICI A;  3L17 A;  1OEY A;  1PDX A;  3B9J A;  4KDI C;  3GE3 C;  2ZW1 A;  4JWU C;  1J7C A;  2H88 B;  2BBC A;  2L0T A;  3AV8 A;  3HRD D;  1C78 A;  1V5T A;  4M8N A;  2QMT A;  2DAF A;  4MJS B;  4L1B A;  5EE0 A;  4ZHO A;  1TKE A;  5C2T B;  4KZ0 A;  1RFK A;  5IA7 A;  4WWO A;  4RCO A;  1SEB D;  4TKN A;  2HDE A;  2WDT B;  1E10 A;  1FIQ A;  4DHJ B;  2JVC A;  3VRB B;  4RGN A;  4LTU A;  2WXN A;  3TMP B;  3M62 B;  2NR2 A;  2KC2 A;  2IZV B;  2NVU I;  5D2M B;  2LVQ A;  1SB3 C;  1FFV A;  2ZCB A;  3RNB C;  5MPO A;  2BYT A;  3AED B;  1YQB A;  3AMZ A;  3DPD A;  1GG3 A;  2MBE A;  1HTQ A;  5IP4 D;  4GDL A;  2JZ3 B;  1AAR A;  2J0K A;  3R3M A;  3WAM A;  4W9C A;  2K8C A;  2KTR B;  4PS7 A;  2K8H A;  1VZ8 A;  2FNJ B;  4OVV A;  1QQR A;  4I6N B;  1UWX A;  2CHW A;  4HDO A;  3RPF C;  4CQN A;  5DPR A;  1SXT A;  3ZXV A;  1EF1 A;  1WJ4 A;  3DOW A;  2O6V B;  4WQO B;  1FO4 A;  2BVC A;  3AN1 A;  4NPN A;  4GIV A;  1D5X C;  2JWU A;  1SGH A;  2KO3 A;  1R4N I;  4MDK E;  4OZA A;  4IWO A;  3PRE A;  1E90 A;  5C1Z A;  1IBX A;  3U7Z A;  3V3X A;  2XK5 A;  2MBH A;  4JPS A;  3B08 A;  3ZNI D;  2GMI C;  2HJ8 A;  3PVL A;  2GBJ A;  4PK1 A;  3QWZ B;  2WX0 A;  2V4L A;  2K39 A;  5E6O A;  1YJJ A;  2O6V A;  4RMA A;  5BMI A;  3RNC C;  2KQ7 A;  1PFD A;  1XQQ A;  3IAS 1;  2RSU A;  1Y56 A;  1WM3 A;  3HM6 X;  2C9W B;  3BVZ A;  1SIJ A;  2E3T A;  1EWY C;  2NBU A;  2L1A A;  1QLB B;  3PS6 A;  3MHZ A;  4N6E B;  4XE0 A;  4DDG D;  3R7R A;  2ZCC A;  2NBV B;  3WCQ A;  3HM3 A;  4DK5 A;  2O2V A;  1ZPS A;  1AYF A;  5JH5 C;  2WXF A;  2C7M B;  1L4Z B;  4M01 A;  3VR9 B;  3KH0 A;  1BT0 A;  3W1S C;  2PVG C;  3LDZ E;  3VVW B;  2V9H A;  1TT5 B;  2BWE S;  2MJE A;  1WH3 A;  2KX0 A;  1A70 A;  1ZXH A;  1PYW D;  1V1P B;  2AWT A;  4P1B C;  1JQ4 A;  1YN5 A;  2KDM A;  1YX5 B;  3AEB B;  1J8C A;  1C79 A;  1XT9 B;  4XC2 A;  1NBF C;  3BIN A;  2LMC A;  1FMA D;  1Y8R C;  3ZNZ B;  2H89 B;  1JRO A;  3AE8 B;  1WF9 A;  2JYT A;  1D5M C;  4E3C A;  1N63 A;  4A9A A;  4MEL A;  1NEN B;  4JLC A;  2R61 A;  3ZJV A;  2L05 A;  2MWS B;  4W9H A;  3NZ3 A;  2L52 A;  1XLN A;  4TV3 A;  3ZRF A;  3H7P A;  1NYQ A;  2CU1 A;  3ZIM A;  4IM3 A;  1Q10 A;  3QX1 A;  2M1M A;  3QK0 A;  2NMQ A;  2UU7 A;  1UBQ A;  1DOI A;  2JX5 A;  1I42 A;  2G3Q B;  2BQQ A;  3NS8 A;  1I4Q A;  4BBN C;  1KJT A;  2Y5P A;  3JW0 X;  2ON8 A;  4HVB A;  4ZRQ A;  3BVG A;  5KHQ A;  1CJE A;  4JL9 A;  1CZP A;  1V49 A;  3AE1 B;  5D3I B;  5E6J A;  1HTO A;  1VCB A;  1P3Q U;  2M0A A;  4IWP A;  1K50 A;  3SDL C;  2IGG A;  1LM8 B;  2W82 A;  3DBL I;  3RT3 B;  2LAS A;  4WQM A;  1UBI A;  3PGE A;  2KN5 A;  3Q8C A;  1I7H A;  4RGO S;  3RCZ A;  5I4D A;  3BY4 B;  2ONQ A;  4JQW C;  5HFY A;  3O13 A;  2DZI A;  1P1A A;  2GBK A;  4UDU C;  2V4I B;  1ZUD 2;  2ASQ A;  2VZK B;  3VTW A;  4B0M A;  2LJ5 A;  3QAQ A;  2JUO A;  2G4S A;  3DDC B;  3MJW A;  4OZB A;  3SD5 A;  3ZNH B;  1SE2 A;  1QOG A;  4MEM A;  2AL6 A;  1I4X A;  4GDK A;  3MJ5 A;  1HA5 A;  1ZKH A;  5C23 A;  5J2R A;  2KDI A;  2ZEQ A;  3Q2A C;  4WJP A;  3W1S A;  3DVN U;  1GC7 A;  4IM0 A;  5DPT A;  2LWP A;  3U30 A;  4DHJ D;  2MCN B;  2MEK A;  4IG7 B;  4MJS A;  1V2Y A;  1TY2 A;  1GB1 A;  4ITK A;  4FJY A;  3ZNG C;  2OJW A;  1JWB D;  4BZA A;  4HRS A;  4ZRK A;  1WYW B;  2G9H D;  3PRP B;  4LNI A;  4CO7 A;  2RDB C;  2HJ1 A;  1XLQ A;  1ZDV A;  4JX1 C;  4ZOH C;  3NVY A;  3HVD A;  4YSZ B;  1S1Q B;  4N58 A;  2WGS A;  5H92 C;  1AWD A;  2MP2 B;  4YSY B;  4HJK A;  3FIL A;  3BZD B;  4X57 B;  2A4Z A;  4YWG G;  4GGQ A;  4MSQ B;  1T0R C;  1WRD B;  2Z8L A;  3LJ3 A;  3IT6 B;  3IAM 1;  1VD2 A;  1M94 A;  4LK0 M;  2GLS A;  4P16 A;  1QT9 A;  2HTH A;  2BB6 A;  2JXT A;  4KGT A;  1XCT L;  4IOI E;  1L0X B;  3C0R B;  1IYF A;  5AZG A;  2J52 A;  2KOX A;  4XZ4 A;  3I63 C;  1C1Y B;  2M0X A;  3AM9 A;  1XO3 A;  2X38 A;  4WH4 A;  1IBX B;  2HD5 B;  5EE9 A;  3EC8 A;  2AYO B;  3RN9 C;  3QJZ A;  1E8W A;  3CST A;  4DXA B;  2KQS A;  2MBQ A;  3OJ4 B;  4K1R B;  4K7W A;  3C19 A;  1WSP A;  4HDQ A;  2C7H A;  2MRP A;  3IFW B;  3R2I A;  2RDG A;  2ZW0 A;  2LFI A;  1ACC A;  4ANX A;  1ZP0 B;  2GBR A;  3VDZ A;  3ZGZ A;  1P0R A;  2K5P A;  4KIK B;  5JZE B;  3VHT C;  2KFK A;  1YQ4 B;  5HI1 A;  2N7D A;  5LXH A;  3PZ7 A;  2KJ6 A;  1KLG D;  2J53 A;  4KSL C;  3APF A;  3Q8E A;  3PLU A;  3GZN B;  4ZRI A;  3EHV A;  4LJP B;  2WDQ B;  2O2V B;  2RGF A;  2FUH B;  2PIA A;  4OVU A;  3NG0 A;  4KSK C;  3U7D A;  1FXA A;  3P63 A;  5GMV A;  3TEZ A;  2YVC A;  3V6E B;  3V60 A;  2JY6 A;  4M0W B;  4MT5 A;  3W9C B;  1J7B A;  3W5V B;  1E7U A;  2PKO A;  3VTU A;  4PS8 A;  3A1Q B;  2INN E;  2BS2 B;  4ZRP A;  2C5L C;  4RH6 A; 
#chains in the Genus database with same CATH homology
 1N5W A;  4NJC A;  2V3P A;  1MI0 A;  1SB3 C;  2W3S A;  4TQ0 A;  1FFV A;  3NUH B;  2G1E A;  5MPO A;  1E6E B;  2BYT A;  3AED B;  4TSS A;  3AMZ A;  2LJI A;  1UWM A;  1WWT A;  3NVZ A;  3VQI A;  1I4G A;  2CJO A;  1XCQ L;  1FXI A;  4MH8 A;  3C8Y A;  2Y5C A;  2QIE B;  1TS3 A;  2MH7 A;  1SBB B;  3Q8B A;  3ZQ4 A;  3RFZ B;  1DOX A;  1FD6 A;  1TZO A;  5LNK 1;  2OHF A;  1VZ8 A;  2WDR B;  4RGM A;  3AE6 B;  2B76 B;  3TUO A;  1QQR A;  1UWX A;  3J9C A;  1SSN A;  3RPF C;  4CQN A;  1VR9 A;  4DXF A;  1VDV A;  1SXT A;  3LB8 C;  3AE7 B;  3TEY A;  5G5G A;  1XEE A;  4OW0 A;  4REZ A;  1FO4 A;  3R8B A;  3Q8F A;  3U52 E;  5GXG B;  1F0Z A;  2W54 A;  1B9R A;  1L6U A;  3AE2 B;  3AN1 A;  5AUK A;  2FBW B;  3SEB A;  1D5X C;  4J3O D;  2JWU A;  2RPV A;  1ESF A;  1L0V B;  4OZA A;  4ZHP A;  4XDD A;  1C9F A;  1I4P A;  1IBX A;  3U7Z A;  1N61 A;  3V3X A;  1L6V A;  3W5U B;  2WXO A;  4HJG E;  4JPS A;  1D4B A;  1FNU A;  1TJE A;  2WNM A;  2WXH A;  2BS3 B;  1DOY A;  1VZ6 A;  2JZP A;  3HVZ A;  1UGJ A;  3SR6 A;  2SAK A;  1IUE A;  2V3N A;  1T6B X;  2XN9 C;  1YJJ A;  1JML A;  1QF6 A;  2QIL A;  1C4C A;  5T8I A;  5BMI A;  1PFD A;  1TKG A;  4Q2J A;  1GAQ B;  2WU2 B;  2L32 A;  2WXM A;  3IAS 1;  4YTN B;  1Y56 A;  3L4P A;  1FNW A;  3BVZ A;  1SIJ A;  1NYR A;  2IGD A;  1EWY C;  2E3T A;  5BYR A;  3ZJT A;  2KN4 A;  1QLB B;  2L1A A;  2LEK A;  3ZYY X;  4KKI A;  2RMM A;  3MHZ A;  4N6E B;  3BYY B;  3BK1 A;  3Q69 A;  3AB5 A;  4YT0 B;  1HZ6 A;  3EUB 2;  4ZYS A;  4XE0 A;  1YNT E;  5AUI A;  4OVZ A;  1TYG B;  3WCQ A;  5BMH A;  3TEX A;  5FK9 C;  1JWA D;  4IKG A;  3NRZ A;  1QOF A;  5JXV A;  3AE3 B;  1ZPS A;  1VRA B;  1N62 A;  2XNA C;  1JWM D;  1AYF A;  1MPE A;  1MVK A;  2WXF A;  4US8 A;  1I4H A;  1OFF A;  3NVW A;  1DYQ A;  1L4Z B;  3UI3 A;  1QKZ A;  1SJH D;  1T5X D;  3SFD B;  1TS2 A;  3VR9 B;  1NI3 A;  2PVG C;  2DYO A;  2MJE A;  1C76 A;  1ZDX A;  1A70 A;  1K52 A;  3AEA B;  1T3Q A;  4RFB A;  2WXL A;  4TMA B;  1ZXH A;  3R2T A;  1ET9 A;  1JRP A;  2KWD A;  1KF6 B;  1WGK A;  4XWT A;  2K22 A;  4NAM A;  1PYW D;  2DYM A;  1V1P B;  4YXD B;  3U4E G;  2HTM E;  2FE8 A;  4EE2 A;  2Y3A A;  3P42 A;  2WXQ A;  3PO0 A;  2INP E;  1ZXI A;  3BII D;  1YN5 A;  1JQ4 A;  1V1P A;  2KDM A;  3AEB B;  1FFU A;  1UNS A;  1C79 A;  2WXR A;  4A8X C;  4YTP B;  2JYE A;  2PTL A;  4KKJ A;  1AN8 A;  2LHE A;  1P7F A;  4A6Q A;  5HG2 A;  1YJI A;  4HKQ A;  2LMC A;  4L23 A;  2BB5 A;  1FMA D;  2LGI A;  2NTS A;  3GB1 A;  4YSX B;  3PZ8 A;  2LHD A;  2H89 B;  2TSS A;  1TS4 A;  1JRO A;  4H2A A;  3U2S C;  4A90 A;  4FXC A;  3AE8 B;  1JWU D;  1NEK B;  3VR8 B;  2JYT A;  1D5M C;  4YTM B;  4RF0 A;  2KMM A;  1XF5 L;  1N63 A;  4WAF A;  4A9A A;  3GP7 A;  1NEN B;  2R61 A;  3ZJV A;  1N5X A;  3NZ3 A;  2L52 A;  1XLN A;  1CK1 A;  4D2K A;  3TSS A;  4HKZ E;  1C77 A;  1NYQ A;  1ROE A;  5C3J B;  1Q10 A;  5FR3 A;  4RF1 A;  1TY0 A;  2NMQ A;  3BK2 A;  3GS2 A;  1DOI A;  1EWC A;  2JX5 A;  2K0P A;  1STE A;  2KQ4 X;  1ZE3 D;  1V97 A;  1L5P A;  1I4Q A;  1YQ3 B;  3DWM A;  4AQ7 A;  2Y5P A;  2ON8 A;  2MJ3 A;  2WXK A;  2EKI A;  1FM0 D;  1WXQ A;  1JW9 D;  4AS1 A;  4ZRQ A;  3BVG A;  2OED A;  1R7S A;  2N7J A;  1CJE A;  2YEP B;  3CIR B;  1CZP A;  3AE1 B;  3E56 A;  2BS4 B;  3KQ4 A;  5D3I B;  5E6J A;  1RYJ A;  1E0Z A;  2GI9 A;  1YN4 A;  2M0A A;  3ETR A;  3AE9 B;  1FRR A;  1PGX A;  2QEJ C;  1K50 A;  1BXT A;  1VLB A;  2IGG A;  2QSD A;  2W82 A;  2PLP A;  1L0Y B;  2GRI A;  4WQM A;  1TKY A;  2AQ1 B;  4ARC A;  2CJN A;  3BWU D;  4GLS C;  5BMG A;  1E7P B;  3Q8C A;  3IXS A;  4A55 A;  1I7H A;  2AX5 A;  2BT6 A;  4RGO S;  4KX6 B;  5I4D A;  4N59 A;  2ONQ A;  4OZC A;  4IDI A;  5HFY A;  1IGC A;  2W3R A;  4OHJ A;  2PMV A;  2VZK D;  3O13 A;  3KWV A;  4UDU C;  2K9X A;  4XDC A;  2I2Y A;  2V4I B;  2KAJ A;  3LYY A;  1ZUD 2;  3CWI A;  1PGB A;  3SFE B;  1FCL A;  2M56 B;  1B1Z A;  2VZK B;  2WP9 B;  3LXF A;  4B0M A;  4HRO A;  1FNV A;  1QIL A;  1JCK B;  4KGS A;  4OZB A;  1RM6 C;  2CU3 A;  1SE2 A;  3P4P B;  1QOG A;  4C7Z A;  4US9 A;  2WXI A;  1F2R I;  1EU4 A;  4ARI A;  2J4X A;  1I4X A;  2DBY A;  3MJ5 A;  5D7G A;  1HA5 A;  2JSV X;  1M4V A;  1OQQ A;  3EGR A;  2LUM A;  2BTE A;  3W1S A;  2JQR B;  2RDH A;  1C4A A;  1KLU D;  1SE3 A;  3N9Y C;  4C56 C;  5H8Y E;  2J42 A;  2MEK A;  3AEF B;  4TQ1 A;  5EE3 A;  1V8C A;  3URY A;  1EU3 A;  3Q8A A;  5FKA C;  1TY2 A;  2FUG 1;  2PVO D;  1GB1 A;  4ITK A;  1UUP A;  1JWS D;  5BYS A;  4JE3 B;  2K3U A;  1XXG A;  4O1N A;  3VRA B;  4B0E A;  3HUI A;  3I9V 1;  2PW9 A;  3AEG B;  4GDK B;  1JWB D;  1MHH E;  1OQR A;  3W2D A;  2WXP A;  2IDY A;  4HRS A;  2G9H D;  2NTT A;  2SEB D;  3AE5 B;  1D6E C;  1XLQ A;  1ZDV A;  3NVV A;  4JX1 C;  4ZOH C;  1SJE D;  3NVY A;  3HVD A;  4YSZ B;  1WYG A;  5HHD G;  2IPK D;  4N58 A;  4MAC A;  5H92 C;  1AWD A;  3P4Q B;  1K53 A;  3B2G A;  4GDL B;  4YSY B;  1IGD A;  3FIL A;  3P1M A;  1BUI C;  3BZD B;  3BVM A;  4P6V F;  1I4R A;  4RNA A;  4WIP A;  4YWG G;  5D3D A;  2KAC A;  1AW7 A;  1D5Z C;  1KFY B;  3FIL B;  1HQR D;  2Z8L A;  3IT6 B;  4USA A;  4L2Y A;  3P4R B;  1FCC C;  1SE4 A;  1GOZ A;  3IAM 1;  4C80 A;  1JAL A;  1BML C;  1F77 A;  1K51 A;  4HEA 1;  4LK0 M;  1ENF A;  4P16 A;  1QT9 A;  3AEC B;  1C4P A;  2BB6 A;  1FRD A;  2JXT A;  2L83 A;  3EA6 A;  4KGT A;  2IJ0 A;  1XCT L;  4IOI E;  4NZL B;  1GB4 A;  5BYQ A;  1L0X B;  2AQ2 B;  2W55 A;  2BW2 A;  2WLB A;  1FEH A;  4KGR A;  1E9M A;  4WUR A;  2J52 A;  1J7A A;  3KLS X;  1ET6 A;  3AM9 A;  1WRI A;  1XO3 A;  2DLB A;  2X38 A;  4WH4 A;  3KWL A;  3ABV B;  1IBX B;  1MHX A;  1QOA A;  5EE9 A;  2WS3 B;  4NAW B;  1YN3 A;  1VZ7 A;  1KTK A;  2N9K A;  2WU5 B;  1PUT A;  2DWQ A;  2QJL A;  4R3D A;  1EM7 A;  2WQY B;  3FAH A;  5G5H A;  5TSS A;  1VJK A;  1L4D B;  1WSP A;  3E9S A;  2I38 A;  1CQV A;  3TEW A;  2AQ3 B;  2WDV B;  3R2I A;  1DGJ A;  1XLP A;  2RDG A;  2ZW0 A;  2LFI A;  1ACC A;  1ZP0 B;  4JWS C;  1F2R C;  1QOB A;  2EEL A;  2IGH A;  3ZGZ A;  1LO5 D;  2GB1 A;  1KH0 A;  1HZ5 A;  1TS5 A;  2K5P A;  3T3N A;  4MM3 B;  2D5G A;  3OWE B;  3V05 A;  1YQ4 B;  3NS1 A;  3MP9 A;  3P4S B;  3I57 A;  5HI1 A;  3PZ7 A;  1SF0 A;  2MJD A;  1KLG D;  2JU6 X;  1XLO A;  3H8H A;  4WWM A;  2M19 A;  2WXG A;  2YEP F;  2J53 A;  4PT5 A;  1HEZ E;  2V0G A;  3FC4 A;  3Q8E A;  1V1O A;  1N60 A;  4C7Y A;  2ICI A;  1PDX A;  2WDQ B;  1HXY D;  3AH7 A;  4DXG A;  3B9J A;  2ZW1 A;  3BYT B;  4JWU C;  1J7C A;  3AE4 B;  2ACZ B;  2PIA A;  3T3O A;  3IT4 B;  2H88 B;  2BBC A;  1ZOY B;  3AV8 A;  3HRD D;  3B2F A;  1C78 A;  4L1B A;  2QMT A;  5EE0 A;  4ZHO A;  1NVI D;  1TKE A;  1KRH A;  1FXA A;  1RWS A;  3DWG C;  3P63 A;  5C2T B;  4DQO C;  1RFK A;  2Q5W D;  3TEZ A;  4LLG M;  4RCO A;  4M0W A;  4XWW A;  2E6X A;  1SEB D;  3ZJU A;  2HDE A;  1YMH E;  4RGT A;  5EE1 A;  1E10 A;  1FIQ A;  3VRB B;  4RGN A;  4LTU A;  2WXN A;  1GPX A;  4MT5 A;  3W9C B;  1J7B A;  3W5V B;  2PKO A;  1P7E A;  3MFG A;  3AEE B;  2INN E;  3MC0 B;  2N9L A;  2BS2 B;  4ZRP A;  2WXJ A;  4RH6 A;  1PGA A;  2N0S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...