4KGRA

Backbone modifications in the protein gb1 helix: beta-3-ala24, beta-3-lys28, beta-3-lys31, beta-3-asn35
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
52
Chain Sequence
DTYKLILNGKTLKGETTTEAVDATAEVFQYADNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-3-
publication title Protein-like Tertiary Folding Behavior from Heterogeneous Backbones.
pubmed doi rcsb
total genus 13
structure length 52
sequence length 56
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kgrA00
4IOIE 1K50A 4KGSA 1EM7A 2ZW0A 2KQ4X 2JWUA 4D2KA 4OZAA 2RPVA 1XCTL 2ONQA 1HZ6A 3FILB 2KN4A 3GB1A 2JXTA 2LGIA 4HJGE 1C9FA 1PGBA 4KGTA 4IKGA 1FD6A 1KH0A 5HI1A 2LHDA 5BMGA 2JU6X 1YMHE 1JMLA 1K52A 2KDMA 4OZCA 1MPEA 2JSVX 2OEDA 1Q10A 1GB4A 2K0PA 1K51A 3V3XA 1PGAA 5HG2A 2J52A 2N7JA 5HHDG 1IBXB 2I38A 2ZW1A 1ZXHA 2LUMA 3UI3A 3FILA 1F2RC 1IGCA 1HZ5A 2IGGA 1XCQL 2QSDA 2RMMA 2J53A 1D4BA 1UWXA 5BMIA 2ON8A 1YNTE 2LHEA 1IGDA 1F2RI 2IGHA 1XF5L 1PGXA 4HKZE 1MHXA 1MVKA 1P7EA 4WH4A 4KGRA 4OZBA 1QKZA 1GB1A 1FCLA 2PW9A 1IBXA 2N9KA 1P7FA 2N9LA 4MACA 4GLSC 2NMQA 2GI9A 5HFYA 2I2YA 2GB1A 2PTLA 1MHHE 5JXVA 2EELA 1MI0A 1FCCC 2QMTA 2JZPA 2KACA 1HEZE 2KWDA 3MP9A 1K53A 2IGDA 5BMHA 2PLPA
chains in the Genus database with same CATH superfamily
3C19A 1C4PA 4PT5A 2NTSA 4OZAA 2WP9B 2KQSA 3FAHA 1XCTL 1WGYA 3FILB 3GB1A 4MM3A 3TL5A 2LJIA 4B9KA 4LNOA 4A3OA 1DYQA 3VVWB 1E9MA 3WAOA 4K1RB 3GOEA 3WCQA 2BT6A 3RI7C 3E56A 3H7PB 1FXIA 3AE4B 4W9FA 3SR6A 2V9HA 1E8ZA 4IWPA 1ZKHA 2IDYA 2B76B 2Q5WD 4GSWA 2HTME 2L7RA 1KM7A 2R61A 4W9JA 1QF6A 1UD7A 4KKJA 3KUDB 2LUMA 1JWSD 4JL9A 2DZJA 2G3QB 3KH0A 3CWIA 3P42A 5CHFA 1GC7A 2MH7A 2IGGA 1UGJA 1F9JA 2KQ7A 4YSZB 4NAWA 5EE3A 2FIDA 4MGIE 1YNTE 1TKEA 2BS3B 3R8BA 3QARA 3L4PA 2FNJB 2WYQA 2MHJA 2ZCCA 2KTRA 1OEYA 4C4VA 4AS1A 1R4MB 2CS4A 1FRRA 3RN9C 3RD2A 3OJ4B 4KDLB 1D5ZC 1P98A 4RGMA 2C7MB 3GE3C 4DHZB 2FE8A 2REXA 2ZEQA 2UU7A 1YJIA 2BGFA 2KDFB 2MP2B 1KLUD 3N1ZC 1QOFA 1UF0A 1LO5D 2KQ4X 3PZ8A 3P4QB 3P1MA 5FK9C 1BUIC 2ZJDA 1JW9D 1XLNA 2DAJA 1L7YA 4HJGE 1AWDA 1JWAD 3O13A 2JUOA 4E74A 3Q3JA 2M0AA 1J7BA 4AQ7A 3BVGA 2LVQA 1VCBA 2AQ1B 3HM6X 3ZW3A 4S17A 2V4IB 1ZDVA 4K7WA 3DCGA 1SF0A 3QHTA 1SE9A 1J0GA 2WXJA 4I6PA 4FJVB 3ZDMC 4WQOB 1E7UA 3AE6B 4LCDE 3NVWA 2N1VA 2GMIC 3ABVB 1QOAA 2KWCA 4PK1A 1VZ7A 4DWFA 4A8XC 1FXAA 3Q8FA 3BY4B 3AV8A 1E8XA 3LB8C 3X0WA 2VRRB 4NZLB 1D4BA 3P4SB 3GS2A 3ZVVA 2KK8A 2D3BA 2BYTA 3B2GA 3CMMB 3IVFA 1UZXB 4L23A 4EEWA 3L13A 1PGXA 3CF6E 3NY5A 3ZYYX 2AQ2B 4NJ7A 1WR6E 1NI3A 3IHPC 1FO4A 4WJPA 4M8NA 4DHZE 3H8HA 3OG5A 2W9NA 4WIPA 4P16A 1FPYA 1XQQA 4E71A 2PKOA 3WAMA 1P7FA 4CYEA 3CSFA 4FXCA 2NMQA 3RNCC 2LD9A 2EMSA 3GZNB 4H2AA 2C7HA 4GB9A 1T0YA 3RZWC 1G6JA 3ZNHB 2K39A 1EU3A 3NZUA 3UIPB 1WYWB 3KW5B 2WDQB 4C7YA 1TS4A 4D2KA 2EKIA 2CJNA 4RFBA 4FJZA 2LGIA 2WNMA 2NVUI 3VAWA 2N9EB 2BW2A 2DYMA 2KVZA 4IC7B 2IZVB 4YXDB 4W9DA 2D5GA 4LJOB 4XZ4A 3RNEC 5BMGA 2V3NA 4TSSA 1J19A 3HUIA 1T3QA 2DHZA 2TSSA 2C5LC 2BF8B 3PRMB 1EUVB 2Y5BB 4ZRQA 2NPTA 2INNE 2INDC 3EFUA 2MJ3A 1SSNA 3W2DA 1L6VA 1YN5A 2N7JA 2KHWB 1WSPA 2GBMA 3ZNID 4MEMA 4LK0M 1F2RC 1PFDA 1ZPSA 3DBHI 2NBWB 1M94A 4KIKB 2N9PC 2QC8A 2LHEA 3WA0A 4M0WA 4IM0A 1T5XD 3ZUNA 4BBNF 3DPDA 1VDVA 1TGZB 4IDIA 3BVMA 2JY6A 4KDIC 2ICIA 3AEGB 4PS8A 1FCLA 2J7QB 2QIEB 4M02A 2W82A 4LNIA 1YQBA 2GB1A 1SJED 2K8BA 1FMAD 1WMHB 2MWSB 4EZLA 2L00B 2DBYA 1L4ZB 2KZRA 1Q1OA 4K81A 1E8YA 2KACA 3L08A 4MJSB 4DDID 3NUHB 4FADA 1MG8A 1WH3A 3DVGY 4DDGD 2WXOA 5DPRA 1P3QU 2WQYB 4KGTA 2LGXA 4RCOA 3H1UA 4IKGA 4JPSA 2SAKA 3PHXB 4HDOA 2OHFA 1V5TA 1YMHE 2D3CA 4GDLA 4TUUA 3RMKC 4HPMB 3AE1B 3MTNB 4YTNB 4N59A 1HXYD 1PGAA 1OFFA 1X1MA 3N9YC 3P4RB 1IBXB 2Y5PA 1AYFA 1YIWA 3DDCB 2K25A 1YX5B 2DLBA 1WFYA 3Q3OC 2WU2B 1JRPA 1U4AA 1JRUA 2KO3A 3PLVA 2BVCA 2RMMA 4JWSC 2LJ5A 4DXFA 3N1YC 3LDZE 3IAS1 4URKA 1C4CA 4RH6A 2WLBA 2MBHA 4KSKC 1SE2A 4G0NB 4OZBA 1Y56A 4ACFA 1I4QA 4G50A 2XBBC 2PW9A 4OVVA 3IFWB 2L0FA 2LI5A 2JRHA 1V2YA 2N7DA 4IM2A 5D3DA 1HQRD 5L95C 1MG4A 4OW0A 2DYOA 1UNSA 3CIRB 2O6VB 3N1XC 3W5VB 4HVBA 2N1WA 5G2NA 2JZ3B 2XK5B 4GIVA 3H6NA 1ET9A 4KX6B 3PVLA 2NCNA 2LFIA 1L5PA 1N61A 3KQ4A 3ECIA 3PHWB 3M63B 4MGKE 5BYRA 3Q6BA 2WWZA 1SB3C 1ENFA 3B2FA 4R3DA 3R3MA 3DVNU 1I4GA 1B1ZA 1IP9A 5HI1A 1TS2A 4XDDA 2LGYA 1E7PB 4NQLB 4OZCA 1TTNA 1T0SC 3PPAA 1V86A 3FC4A 3AEAB 1I7HA 3V3XA 2JX5A 1WX9A 3ML9A 3NS1A 3BIID 3QX1A 2A5UA 4RGOS 3AEEB 4Q2JA 2Y3AA 2BWFA 3TEXA 3Q2AC 1SE3A 2VH2A 1YOVB 1PUTA 1V81A 2BS4B 1OEYJ 3BINA 3R2IA 3SFEB 5FR3A 4WWNA 3SFDB 2KVRA 2DYBA 4HKZE 4PYZA 3V61A 2AEHA 4X57B 1AN8A 3IG3A 3R7RA 3UF8A 4M00A 1I4PA 4IM3A 2I1KA 2CR5A 1Q0WB 4WJNA 4JE3B 5LXHA 2LRWA 2DZKA 2G1EA 2VZKD 1WGGA 1L0XB 1UBIA 2X8XX 1TS5A 4EE2A 1MI0A 2NBVB 2KJHB 4F8CB 1HEZE 4XGAB 5JH5C 2IGDA 1EO6A 5CTRC 1V1OA 1V49A 1A70A 1CZPA 4BOSC 5EDSA 1GJZA 1H8CA 3QC8B 3V6EB 2WXHA 2BBCA 3CSTA 4WWMA 1TYGB 1ISNA 2K22A 2O2VB 3TSSA 1GUAB 3HVDA 2E6XA 1OQQA 4MSMB 2KJRA 3BZDB 3URYA 2YEPF 4N9F4 1V1PA 1ZE3D 2D07B 4MELA 2LXCA 3DBRI 4PYUA 2K0PA 4GDKA 2Z0EB 5IP4D 1WGKA 1D5XC 3VTWA 3AH7A 5HG2A 3B08A 4YSXB 4W9LA 2X38A 2JVCA 3PTFC 2J4XA 5EE9A 2ZZPB 4ICUA 4P7IA 2YEPB 2DENB 3U7ZA 4ZRKA 4XX5A 4LJPB 5E6PA 3T9LA 3PSEB 1XCQL 2KLCA 4K7UA 1SJHD 4BKGA 3BK1A 3SU8X 1P1AA 1GAQB 4DQOC 2NR2A 4GGQA 4TQ0A 1RRBA 4L1BA 1SGHA 3N32A 4RM8A 1H4RA 3UQAA 1C77A 1B9RA 2D3AA 5GXGB 1DGJA 3Q3NC 3J9CA 2NBUA 4ANXA 2MRPA 1C79A 2WXRA 2WXPA 3VR8B 1WZ0A 1KRHA 3VH4B 2GBRA 2IY1B 2K1FA 3I63C 2JF5A 2PE6B 3C0RB 4ANUA 3EA6A 3NRZA 2LWPA 1L0YB 1WRDB 4XWWA 5C2TB 5BMHA 3RNBC 1UELA 3AM9A 2D11A 2L05A 3RUIB 4HK2A 1MFWA 5TR5A 1TZOA 3R7QA 3OAWA 3TCAA 4EOYA 2KLGA 1R7SA 2M19A 1LXDA 3A1QA 2FUHB 4K3CA 1J8CA 1CQVA 4ITKA 4NQKE 1FRDA 4WQMA 1KOTA 4WURA 2L83A 2L76A 1F52A 3K9OB 4YWGG 4TQ1A 4MH8A 4FHKA 4LNFA 3UI3A 4CQNA 1LM8B 2M17A 2K6QA 2RD0A 3FILA 4KZCA 1R4MI 3IBEA 2G4DB 2UYZB 2QSDA 4KZ0A 2KAJA 4PS3A 3V6CB 3NZ3A 1VR9A 2V3PA 3H7PA 5D94A 4RGTA 3EGRA 2RDBC 2N9XA 1P9DU 5AUIA 1BXTA 1F77A 1WY8A 1FNWA 2WX1A 2KC2A 3MC0B 3L16A 1ACCA 1QQRA 2C7NB 4MDKE 1GNUA 3VHTC 2KOXA 5H8YE 1XD3B 5J17A 1EU4A 1FFUA 4A3PA 5J18A 1FCCC 1IPGA 4REZA 3Q8AA 2Z59B 2WHIA 4N58A 4A90A 4YT0B 4CHKA 3KVFB 4EZJA 4ZRPA 2WDVB 3NS8A 2L0TA 2D10A 3NVYA 3PS6A 5GMVA 1VZ8A 2IYDB 2LXAA 5C1ZA 3W1YA 5J2RA 3KLSX 1FD6A 4LDTD 1QOGA 1ROEA 2LVPA 1E7VA 2LHDA 2KWVB 1RM6C 4ZYSA 3ENEA 3Q3MC 4GU2A 2KX3A 2KDMA 3O65B 4DXAB 1LQBA 3MC9A 1GB4A 2FCSA 3A33B 4NAMA 3P63A 1ZW7A 1FXTB 1QOBA 2KKCA 3JSVB 2BS2B 1FNVA 3P2BA 3PREA 3U4EG 1R4NB 2INCC 2H89B 3ETRA 3Q8CA 2PEAA 1IGCA 3TEZA 4I6NB 5AUKA 2BB6A 1UWXA 2ON8A 3GZNI 2CHWA 1WF9A 2N4FA 1F2RI 1MVKA 2LASA 2QJLA 1QKZA 4ANVA 1QLBB 3P4PB 2MLBA 2RDHA 2L8JA 1N6ZA 3AI5A 2NTTA 1A5RA 4W9KA 1D3ZA 1C1YB 1K8RB 1JALA 2KNBA 1GOZA 4IUMB 2EELA 4B0EA 5D7GA 1YQ3B 2KFKA 3LJ3A 3AECB 5KHQA 3AN1A 3NOBA 2JZPA 2ZVNA 2KANA 4RNAA 1NVID 3ONSA 4BKTA 3SHQA 3JW0X 2R2QA 3PRPB 2HDEA 2FCMA 2RPVA 3AE5B 1TKYA 2KN4A 3PO0A 3JYUA 5C3JB 3RZFA 4ZRIA 4WWPA 3LYYA 4FA6A 1C9FA 1PGBA 1ZP0B 1PDXA 3DBLB 1NEKB 4KKIA 4MGZE 2JT4B 5MPOA 5JHBA 1TIFA 2KN5A 5L83A 1XT9B 2XNAC 3APFA 1HTOA 2MCNB 2JRIB 2OEDA 2CKHB 2MJEA 3KUZA 3Q14C 4IWOA 1L6UA 3VTUA 1K51A 3R2TA 1WM2A 2FIFA 4WAFA 2D2QA 1WXAA 2AL3A 4BOZB 4EZKA 1WE7A 3EC8A 4XDCA 4W9HA 3ZKJC 1L2NA 5DPWA 4GOCA 2N0SB 3RPFC 3AU4A 4HPLB 2J53A 1ET6A 5D2MB 3HK0A 1ZDXA 4MT5A 4K3BA 1V80A 4KVGB 3DQVA 4FJYA 2IGHA 3PGEA 1T0QC 4P1CC 3I5JC 3ZDTA 2BKRB 4AUQC 4BBNC 1XLOA 1J7AA 3A9JB 4ZYNA 4TKNA 1FNUA 1KTKA 3KWVA 1UGMA 1XLQA 1NDDA 2WXIA 3DWGC 3EUB2 5BYQA 3ML8A 1D6EC 3ZQ4A 3TEYA 1SE4A 3ZRCA 4YL8A 1NBFC 2KWDA 2AL6A 4KIKA 2V4LA 3D32A 1K53A 2Z8LA 4C80A 4LLGM 5FKAC 2QHOA 2VZKB 3H7SA 3NVZA 5C23A 4BZAA 2KXJA 2L32A 3RULA 2BYFA 2DZMA 4IW0A 2WXKA 5IKCM 3U8ZA 3PT2B 1LGRA 2IO0B 2Z0DB 4DHJD 3FKYA 1WJ6A 1RFAA 4W9IA 1JWUD 3SD5A 4HCPB 4B0MA 4A6QA 1WI0A 3HVZA 1QT9A 1S1QB 1JMLA 1WMHA 2ZPYA 1WXSA 4FBJB 3ZTDA 2DZIA 1YN3A 3T3NA 4A55A 1WZ3A 4MJSA 4RGNA 3APDA 1ZXHA 3C8YA 4YTMB 4J3OD 1V6EA 4JWUC 4AOFA 2ZCBA 2A4ZA 4BKSA 2J42A 2WDRB 1HZ5A 2WXQA 4B6WA 3A9KB 1EF5A 3Q3FA 4YTPB 1RLFA 3AEDB 4JQWC 4O1NA 1P7EA 4WH4A 3VQIA 4BKSD 3VTVA 2NS5A 3DHGC 4MM3B 3IT4B 1RAXA 3AE3B 2SEBD 2PMVA 1IBXA 1JWMD 2EKEC 4E3CA 2WDTB 2ACZB 3U7DA 3ZGZA 2FCNA 5AZHA 4LNNA 4ARIA 2XEWA 2BTEA 2CJOA 2LEKA 1I42A 1I4RA 4II3B 1RFKA 5DCNA 2W55A 1KLGD 2IJ0A 4II2B 4G11A 2BB5A 4HEA1 4DXGA 4GXBA 2K8CA 5LNK1 2KD0A 2OJWA 2MQJA 5E6OA 3BWUD 3W1SC 3ALBA 5JHAA 4AWJA 2OJRA 2WU5B 5EE0A 4EUTA 3DVNV 3DWMA 1J7CA 2AX5A 3N20C 1TBEA 4LTUA 4BAXA 4HXDA 3LXFA 4NAWB 3AE7B 2KTFA 1OQYA 3KYDD 4HJKA 4HCNB 2GOWA 2QCZA 3HM3A 2WXMA 2M56B 4XWTA 4A20A 5G55A 3WIMA 5AEKB 2O6VA 4M8MA 4I6LB 2KTRB 3DBRB 4W9EA 3B1LX 4TV3A 1N63A 4ZHPA 2CU3A 2XK5A 4C4VB 2J52A 4ZRJA 5G5GA 5HHDG 2WXLA 4RMAA 5IAAC 3MC8A 3DHIC 4KSLC 1N5WA 2J0KA 1I35A 1DOYA 2K5PA 3W5UB 2IY0B 2KDBA 3T8MA 1WJNA 3ZIMA 2IPKD 5DPTA 1AW7A 4A9AA 1CMXB 3RT3B 1PQSA 3QJZA 1IGDA 3RYTA 4NY0A 1WXVA 1HE8A 2KC1A 1WWTA 1XLPA 3DVGX 4ZOHC 3M62B 5EE1A 1KLVA 5LLIA 4JX1C 2M4NA 1NYRA 4US9A 2GI9A 2JYEA 1AARA 1WX7A 4JLCA 3SDLC 4M01A 2K9XA 2DNFA 2W3SA 3RNGC 4DBGA 3Q69A 1HTQA 1VJKA 3X23A 1E0ZA 3NG0A 1EWYC 5D6JB 3HIZA 3QWZB 5FR6A 4GN1A 2ZW0A 3W9CB 3AEFB 1KF6B 1S3SG 5E6NA 3ZXRA 3WALA 3VR9B 3AE9B 4IWQA 4HPPA 2EMTA 1KH0A 2HJ8A 5G5HA 1YJ1A 1E90A 4F7ZA 1C3TA 3VRBB 3VUWA 4MSQB 1K52A 4C7ZA 1WGHA 3DHHC 2V1YA 3WANA 4RM9A 2MA9B 4LDTB 1VRAB 2MSED 2G4SA 2FCQA 1Q5WB 3B0AA 2I38A 2ZW1A 1GG3A 2BPSA 2AWTA 1V8CA 2MBEA 5KHOA 4HROA 4PS7A 3RFZB 3AE8B 2O2VA 2PJHA 1E8WA 1N5XA 3EECA 1YQ4B 2HD5B 1C78A 2FBWB 5IOIA 2J0MA 1WE6A 1Z5SB 3K9PB 3MHSD 2H88B 3PRZA 2I1JA 4S0RA 4EKUA 1JWBD 1N60A 1SXTA 4AJYB 2UWQA 3TUOA 4OHJA 4G3XB 1YX6B 3N30A 2N9KA 4TMAB 3I9V1 1ESFA 1HA5A 2LMCA 3TIXA 2MW5A 5HFYA 1NI2A 4NPNA 1GPXA 2QEJC 3PZ7A 1WX8A 4ICVA 2ZNVB 3QAQA 4P1BC 2NPTB 2KX0A 1E6EB 3Q8EA 4K7SA 2K8HA 4W9CA 2HE7A 2WX0A 2PLPA 5TSSA 1VZ6A 1YN4A 2JWUA 2B3AA 2LZ6A 1P0RA 3TMPB 2ZVOA 1WYGA 1L4DB 2C60A 1I4XA 2HJ1A 2KFKB 4M0WB 2JU6X 4WWOA 2G9HD 2JPHA 3S2AA 1WR1A 2JSVX 3BK2A 2GBJA 4JGHB 5I4DA 1E10A 1OGWA 1ZUD2 1WXMA 1TJEA 3ZNZB 1LFDA 1KFYB 2KFJA 2ZNVC 2RDGA 2WS3B 2YVCA 4W9GA 1C4AA 2MBOA 1SIJA 2PPHA 2OOBB 5HKHA 3L54A 3VUYA 3Q8BA 3L17A 5IN7A 4F1SA 2M1MA 2DAFA 4ASWC 4HKQA 2JQRB 2MP2A 4WAAA 4AP4C 1T0RC 3H9DA 4KGRA 1I4HA 3VH3B 4UDUC 1GB1A 2KDEB 1ZGUB 2RR9A 3DBHB 2N9LA 3RCZA 1TY0A 1TT5B 2PVGC 2LVOA 2RGFA 3VXWA 3V60A 3R66C 2MBBB 2JYTA 4GDLB 3TEWA 2LGSA 3E9SA 4HLEA 2L3ZA 3QK0A 2PVOD 1C76A 3U30A 2D3GA 2KWUB 1WM3A 1CK1A 2AYOB 5CHWA 2BQQA 4ANWA 1EM7A 1L0VB 4NJ6A 3GE8C 1SBBB 3RNFC 1WGRA 3ZTCA 2KMCA 4WJOA 2L1AA 2ONQA 4AJWA 2MBQA 4L2YA 3IXSA 4OVZA 1DOIA 2GLSA 1EF1A 4HRSA 3PLUA 1R4NI 1ZOYB 2JWZA 4USAA 3L0WB 2Y5CA 3I3TB 1MPEA 2BWES 4WJQA 4DHJB 3QCAA 4MGYE 2MX2A 1OQRA 1IYFA 2RPQA 2PE9A 2R2OA 2QDFA 3UINB 1YJJA 1TKGA 2E3TA 4JIOU 4FLHA 5BMIA 2YLMA 1V5OA 2GBNA 3KYCD 1BT0A 2IO2B 5JZEB 2J0JA 3AE2B 1WRIA 1XF5L 1KJTA 4GMVA 1JROA 5IO9A 3PV1A 3N3KB 2KT7A 1RYJA 3ZO5B 3ZJTA 4YSYB 3AU5A 1STEA 1TS3A 2V3SA 3UGBB 1GC6A 1ZXIA 4RF0A 3JSVA 1TZ1A 3AEBB 2LGDA 1BMLC 2I2YA 2KJ6A 1F0ZA 3PZDA 4XE0A 2AQ3B 2WXFA 3DBLI 1SEBD 1N62A 1FFVA 3TJPA 3ZJUA 2KMAA 2JZZA 3AB5A 3BYYB 2M8SA 1K50A 4CO7A 3NVVA 1FM0D 1F1HA 1HZ6A 3NZSA 5E6JA 3AMZA 3EFCA 2PIAA 3A4SC 4LNKA 3VFKA 2HTHA 3OLMD 2CU1A 3VDZA 3ZXVA 1RWSA 4EFOA 3BVZA 4P6VF 1IUEA 1CJEA 2ZPNA 1E5WA 3ZLZA 2WXGA 3A4RA 5CX3A 1Q10A 2BYEA 3U2SC 4US8A 1TY2A 1MJDA 1UWMA 3MHZA 2KYWA 1XEEA 1Y8RC 5T8IA 4BFRA 3V05A 2LRUA 2DX5B 4DK5A 2RSUA 5BYSA 1VD2A 3NHEB 3ZNGC 2FUG1 4NNJB 3BYTB 2W3RA 3JVZX 1YD8U 4MH0E 1UBQA 2G45B 5BO4B 1T6BX 2IO3B 3OJ3A 2QILA 3MJWA 1WIAA 1QILA 2WXNA 4XYCA 3DBSA 2BKFA 3QQ8B 2K3UA 3HHMA 5CHVC 2WGSA 1V1PB 2IO1B 1UH6A 2PTLA 1MHHE 1Z2MA 2GRIA 5H92C 3NJTA 1D5MC 3UIOB 3V62A 4GDKB 2XN9C 3I57A 4HWIB 1FIQA 2QMTA 3GP7A 3MP9A 1V97A 4ZDVA 4NJCA 3M95A 3WAPA 3KWLA 2CHZA 5LXIB 3QA8A 4IOIE 4KGSA 4C56C 4ARCA 1JCKB 2FAZA 4J6IA 3VUXA 1PYWD 2VH1A 3B9JA 4IG7B 2JXTA 2V0GA 3L10B 4OVUA 3VRAB 2MJDA 3A9JA 2MEKA 5D3IB 1XO3A 3M3JA 1XXGA 3AXCA 5IA7A 1JQ4A 3IAM1 1VLBA 4HDQA 2JXXA 2BYVE 1DOXA 3MFGA 4KV2A 4RF1A 3ZJVA 2DWQA 4FULA 2ASQA 3U52E 2INPE 4FHJA 1V9JA 1WGDA 3APCA 3KUCB 4BVUC 3MJ5A 3RNAC 2K6DB 3DOWA 4N6EB 3SEBA 4FN2A 4C00A 3IT6B 2KDIA 2GBKA 2IBIB 2N7EA 5AZFA 3EHVA 4B95A 4ZHOA 5DPSA 1SIFA 1WXQA 1EWCA 2C9WB 2KMMA 2M0XA 1MHXA 5AZGA 1OTRB 1M4VA 3OWEB 2L52A 2LUEA 3TBLD 2O6VD 3UQBA 1QZEA 1WJUA 1UUPA 3A1QB 4MACA 4GLSC 3T3OA 3QIJA 3W1SA 4QAYA 2W54A 5JXVA 2CHXA 1WJ4A 1NENB 3AULA 1FEHA 3HRDD 3A9KA 4XC2A 1NYQA 3ZRFA
chains in the Genus database with same CATH topology
5TSSA 1VZ6A 2LFIA 1L5PA 1YN4A 1N61A 1C4PA 4PT5A 3KQ4A 2JWUA 2NTSA 4OZAA 2HDEA 2WP9B 2RPVA 3FAHA 1XCTL 3AE5B 3FILB 1TKYA 2KN4A 3GB1A 3PO0A 5BYRA 5C3JB 2LJIA 1DYQA 1WYGA 1E9MA 1SB3C 1ENFA 1L4DB 1PGBA 1ZP0B 1PDXA 3B2FA 3LYYA 1C9FA 4R3DA 3WCQA 2BT6A 1NEKB 4KKIA 1I4GA 1B1ZA 3E56A 1FXIA 5MPOA 3AE4B 5HI1A 1I4XA 1TS2A 4XDDA 3SR6A 1E7PB 2JU6X 2XNAC 2G9HD 2IDYA 2Q5WD 2B76B 4OZCA 2HTME 2JSVX 2OEDA 2MJEA 3BK2A 1L6UA 5I4DA 3FC4A 1K51A 3AEAB 1I7HA 3R2TA 3V3XA 1E10A 2R61A 2JX5A 3NS1A 3BIID 1QF6A 1ZUD2 4KKJA 1TJEA 4RGOS 3AEEB 4WAFA 4Q2JA 2Y3AA 2LUMA 1JWSD 4XDCA 1KFYB 2RDGA 3TEXA 2WS3B 3CWIA 1SE3A 3P42A 1C4AA 1SIJA 2MH7A 2N0SB 3RPFC 1PUTA 2IGGA 2BS4B 1UGJA 4YSZB 2J53A 3R2IA 5EE3A 3Q8BA 3SFEB 5FR3A 1ET6A 1YNTE 1TKEA 1ZDXA 3SFDB 4MT5A 2BS3B 3R8BA 4HKQA 3L4PA 2JQRB 2IGHA 4HKZE 4KGRA 1I4HA 1AN8A 4UDUC 1GB1A 1XLOA 1J7AA 4AS1A 2N9LA 1I4PA 1TY0A 1FRRA 1FNUA 1KTKA 3KWVA 1XLQA 4JE3B 5BYQA 2PVGC 2WXIA 3DWGC 3EUB2 1D5ZC 2G1EA 2VZKD 1D6EC 1L0XB 4RGMA 3ZQ4A 1TS5A 3TEYA 4EE2A 2JYTA 4GDLB 3TEWA 1SE4A 1MI0A 3E9SA 2FE8A 1YJIA 2PVOD 1C76A 1HEZE 2KWDA 1K53A 2IGDA 1CK1A 2Z8LA 4LLGM 5FKAC 2VZKB 4C80A 1V1OA 3NVZA 1KLUD 1A70A 1EM7A 1L0VB 1LO5D 1QOFA 1CZPA 2KQ4X 3PZ8A 3P4QB 3P1MA 1SBBB 5FK9C 2L32A 2WXHA 2BBCA 4WWMA 1BUIC 2WXKA 1TYGB 2K22A 1JW9D 2L1AA 1XLNA 2ONQA 4L2YA 3IXSA 3TSSA 4HJGE 1AWDA 4OVZA 1JWAD 3O13A 1DOIA 3HVDA 2E6XA 1OQQA 2M0AA 4HRSA 1J7BA 4AQ7A 1JWUD 1ZOYB 3BZDB 3BVGA 4USAA 4B0MA 4A6QA 3URYA 2Y5CA 2YEPF 3HVZA 2AQ1B 1V1PA 1QT9A 1ZE3D 1JMLA 1MPEA 2V4IB 1ZDVA 2K0PA 1YN3A 3T3NA 1WGKA 1SF0A 1D5XC 2WXJA 3AH7A 5HG2A 4A55A 4YSXB 4RGNA 1OQRA 2X38A 3AE6B 1ZXHA 2J4XA 3C8YA 4YTMB 4J3OD 5EE9A 3NVWA 4JWUC 2YEPB 3U7ZA 3ABVB 1QOAA 1VZ7A 1YJJA 2J42A 2WDRB 1HZ5A 1FXAA 2WXQA 3Q8FA 4A8XC 3AV8A 1XCQL 1SJHD 3LB8C 1TKGA 2E3TA 4NZLB 3BK1A 5BMIA 3P4SB 1D4BA 1GAQB 3GS2A 4DQOC 2BYTA 3B2GA 4TQ0A 4YTPB 3AEDB 3AE2B 4L1BA 1WRIA 1XF5L 4L23A 1PGXA 4O1NA 1JROA 1P7EA 4WH4A 3VQIA 3ZYYX 2AQ2B 1NI3A 1C77A 1B9RA 4MM3B 5GXGB 1FO4A 3IT4B 1DGJA 1RYJA 3H8HA 4YSYB 3AE3B 3ZJTA 3J9CA 2SEBD 4WIPA 4P16A 2PMVA 1STEA 1TS3A 1IBXA 2PKOA 1P7FA 1JWMD 1C79A 1ZXIA 4RF0A 2WXRA 4FXCA 2ACZB 2WXPA 2NMQA 3AEBB 2I2YA 1BMLC 3VR8B 3ZGZA 1KRHA 4H2AA 1F0ZA 4XE0A 2BTEA 4ARIA 2AQ3B 2WXFA 2CJOA 2LEKA 1SEBD 1N62A 1I4RA 1RFKA 1FFVA 3ZJUA 2W55A 1KLGD 2IJ0A 1EU3A 3EA6A 3NRZA 2BB5A 4HEA1 1L0YB 4DXGA 4XWWA 3AB5A 5C2TB 5BMHA 3BYYB 5LNK1 2WDQB 4C7YA 1K50A 3BWUD 1TS4A 3AM9A 4D2KA 2EKIA 2WU5B 1FM0D 3NVVA 2CJNA 5EE0A 3DWMA 1J7CA 2AX5A 1HZ6A 4RFBA 5E6JA 3AMZA 1TZOA 2LGIA 4LTUA 2PIAA 2WNMA 3LXFA 2BW2A 2DYMA 4NAWB 4YXDB 3AE7B 1R7SA 1RWSA 2M19A 2D5GA 3BVZA 5BMGA 2V3NA 4TSSA 4P6VF 1IUEA 1T3QA 2TSSA 1CJEA 1CQVA 2WXMA 3HUIA 2M56B 4XWTA 4ITKA 1FRDA 2WXGA 1Q10A 4ZRQA 4WQMA 3U2SC 2INNE 4US8A 1TY2A 2MJ3A 1N63A 2L83A 2CU3A 4WURA 1SSNA 4ZHPA 3W2DA 1L6VA 2J52A 1YN5A 5G5GA 2N7JA 5HHDG 1UWMA 2WXLA 3MHZA 4YWGG 4TQ1A 1XEEA 1WSPA 1N5WA 5T8IA 4MH8A 1DOYA 4LK0M 3UI3A 4CQNA 2K5PA 3W5UB 3FILA 1F2RC 1PFDA 1ZPSA 3V05A 2QSDA 2KAJA 2IPKD 1AW7A 5BYSA 4A9AA 2FUG1 3NZ3A 1VR9A 2LHEA 2W3RA 3BYTB 2V3PA 1IGDA 4M0WA 4RGTA 1T5XD 1T6BX 3EGRA 1VDVA 4IDIA 1WWTA 1XLPA 3BVMA 5AUIA 1BXTA 4ZOHC 2QILA 1F77A 2ICIA 5EE1A 1FNWA 3AEGB 1QILA 1FCLA 2WXNA 2QIEB 3MC0B 2K3UA 2W82A 1ACCA 4JX1C 1QQRA 1NYRA 4US9A 2GI9A 2JYEA 1V1PB 2GB1A 2PTLA 1MHHE 1SJED 2GRIA 5H92C 5H8YE 1EU4A 1FMAD 2K9XA 2W3SA 1FFUA 1D5MC 3Q69A 1FCCC 1VJKA 1L4ZB 2DBYA 4GDKB 2XN9C 3I57A 1FIQA 2QMTA 2KACA 3GP7A 1E0ZA 4REZA 3MP9A 1V97A 3Q8AA 4NJCA 1EWYC 3KWLA 4N58A 4YT0B 4A90A 4ZRPA 4IOIE 4KGSA 2WDVB 2ZW0A 3W9CB 3AEFB 1KF6B 3NUHB 4C56C 1JCKB 4ARCA 3NVYA 1PYWD 1VZ8A 3B9JA 3VR9B 3AE9B 2JXTA 2WXOA 2V0GA 3VRAB 2MJDA 2MEKA 2WQYB 5D3IB 4KGTA 3KLSX 1XO3A 4RCOA 4IKGA 1FD6A 1KH0A 1QOGA 1ROEA 5G5HA 1XXGA 4JPSA 2LHDA 2SAKA 3VRBB 1JQ4A 1RM6C 4ZYSA 3IAM1 2OHFA 1VLBA 1YMHE 2KDMA 1K52A 4C7ZA 1DOXA 1GB4A 3MFGA 3AE1B 4YTNB 4N59A 4RF1A 1HXYD 1VRAB 1PGAA 1OFFA 2DWQA 3ZJVA 3N9YC 3P63A 4NAMA 3P4RB 3U52E 2Y5PA 1IBXB 2I38A 2INPE 1AYFA 2ZW1A 1QOBA 2BS2B 1FNVA 3U4EG 1V8CA 2H89B 4HROA 3ETRA 2DLBA 3MJ5A 3RFZB 2WU2B 1JRPA 3AE8B 3Q8CA 1IGCA 3TEZA 4N6EB 1N5XA 3SEBA 2RMMA 4JWSC 5AUKA 4DXFA 2BB6A 1UWXA 1YQ4B 1C78A 2FBWB 2ON8A 3IT6B 3IAS1 1C4CA 4RH6A 2WLBA 4ZHOA 1WXQA 1EWCA 2H88B 1F2RI 2KMMA 1MHXA 1MVKA 1SE2A 1JWBD 1M4VA 1N60A 2QJLA 3OWEB 1SXTA 2L52A 4OZBA 1QKZA 1Y56A 1I4QA 1QLBB 3TUOA 3P4PB 4OHJA 2RDHA 2PW9A 2NTTA 2N9KA 4TMAB 3I9V1 1UUPA 1ESFA 1HA5A 4MACA 2LMCA 4GLSC 3T3OA 5HFYA 3W1SA 1JALA 1GPXA 1GOZA 5D3DA 1HQRD 2W54A 2QEJC 4OW0A 2DYOA 5JXVA 2EELA 3PZ7A 1UNSA 5D7GA 3CIRB 1YQ3B 4B0EA 1NENB 3W5VB 3AECB 3AN1A 1E6EB 3Q8EA 1FEHA 2JZPA 3HRDD 4RNAA 1ET9A 1NVID 1NYQA 4KX6B 2PLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOI E;  1K50 A;  4KGS A;  1EM7 A;  2ZW0 A;  2KQ4 X;  2JWU A;  4D2K A;  4OZA A;  2RPV A;  1XCT L;  2ONQ A;  1HZ6 A;  3FIL B;  2KN4 A;  3GB1 A;  2JXT A;  2LGI A;  4HJG E;  1C9F A;  1PGB A;  4KGT A;  4IKG A;  1FD6 A;  1KH0 A;  5HI1 A;  2LHD A;  5BMG A;  2JU6 X;  1YMH E;  1JML A;  1K52 A;  2KDM A;  4OZC A;  1MPE A;  2JSV X;  2OED A;  1Q10 A;  1GB4 A;  2K0P A;  1K51 A;  3V3X A;  1PGA A;  5HG2 A;  2J52 A;  2N7J A;  5HHD G;  1IBX B;  2I38 A;  2ZW1 A;  1ZXH A;  2LUM A;  3UI3 A;  3FIL A;  1F2R C;  1IGC A;  1HZ5 A;  2IGG A;  1XCQ L;  2QSD A;  2RMM A;  2J53 A;  1D4B A;  1UWX A;  5BMI A;  2ON8 A;  1YNT E;  2LHE A;  1IGD A;  1F2R I;  2IGH A;  1XF5 L;  1PGX A;  4HKZ E;  1MHX A;  1MVK A;  1P7E A;  4WH4 A;  4KGR A;  4OZB A;  1QKZ A;  1GB1 A;  1FCL A;  2PW9 A;  1IBX A;  2N9K A;  1P7F A;  2N9L A;  4MAC A;  4GLS C;  2NMQ A;  2GI9 A;  5HFY A;  2I2Y A;  2GB1 A;  2PTL A;  1MHH E;  5JXV A;  2EEL A;  1MI0 A;  1FCC C;  2QMT A;  2JZP A;  2KAC A;  1HEZ E;  2KWD A;  3MP9 A;  1K53 A;  2IGD A;  5BMH A;  2PLP A; 
#chains in the Genus database with same CATH topology
 3C19 A;  1C4P A;  4PT5 A;  2NTS A;  4OZA A;  2WP9 B;  2KQS A;  3FAH A;  1XCT L;  1WGY A;  3FIL B;  3GB1 A;  4MM3 A;  3TL5 A;  2LJI A;  4B9K A;  4LNO A;  4A3O A;  1DYQ A;  3VVW B;  1E9M A;  3WAO A;  4K1R B;  3GOE A;  3WCQ A;  2BT6 A;  3RI7 C;  3E56 A;  3H7P B;  1FXI A;  3AE4 B;  4W9F A;  3SR6 A;  2V9H A;  1E8Z A;  4IWP A;  1ZKH A;  2IDY A;  2B76 B;  2Q5W D;  4GSW A;  2HTM E;  2L7R A;  1KM7 A;  2R61 A;  4W9J A;  1QF6 A;  1UD7 A;  4KKJ A;  3KUD B;  2LUM A;  1JWS D;  4JL9 A;  2DZJ A;  2G3Q B;  3KH0 A;  3CWI A;  3P42 A;  5CHF A;  1GC7 A;  2MH7 A;  2IGG A;  1UGJ A;  1F9J A;  2KQ7 A;  4YSZ B;  4NAW A;  5EE3 A;  2FID A;  4MGI E;  1YNT E;  1TKE A;  2BS3 B;  3R8B A;  3QAR A;  3L4P A;  2FNJ B;  2WYQ A;  2MHJ A;  2ZCC A;  2KTR A;  1OEY A;  4C4V A;  4AS1 A;  1R4M B;  2CS4 A;  1FRR A;  3RN9 C;  3RD2 A;  3OJ4 B;  4KDL B;  1D5Z C;  1P98 A;  4RGM A;  2C7M B;  3GE3 C;  4DHZ B;  2FE8 A;  2REX A;  2ZEQ A;  2UU7 A;  1YJI A;  2BGF A;  2KDF B;  2MP2 B;  1KLU D;  3N1Z C;  1QOF A;  1UF0 A;  1LO5 D;  2KQ4 X;  3PZ8 A;  3P4Q B;  3P1M A;  5FK9 C;  1BUI C;  2ZJD A;  1JW9 D;  1XLN A;  2DAJ A;  1L7Y A;  4HJG E;  1AWD A;  1JWA D;  3O13 A;  2JUO A;  4E74 A;  3Q3J A;  2M0A A;  1J7B A;  4AQ7 A;  3BVG A;  2LVQ A;  1VCB A;  2AQ1 B;  3HM6 X;  3ZW3 A;  4S17 A;  2V4I B;  1ZDV A;  4K7W A;  3DCG A;  1SF0 A;  3QHT A;  1SE9 A;  1J0G A;  2WXJ A;  4I6P A;  4FJV B;  3ZDM C;  4WQO B;  1E7U A;  3AE6 B;  4LCD E;  3NVW A;  2N1V A;  2GMI C;  3ABV B;  1QOA A;  2KWC A;  4PK1 A;  1VZ7 A;  4DWF A;  4A8X C;  1FXA A;  3Q8F A;  3BY4 B;  3AV8 A;  1E8X A;  3LB8 C;  3X0W A;  2VRR B;  4NZL B;  1D4B A;  3P4S B;  3GS2 A;  3ZVV A;  2KK8 A;  2D3B A;  2BYT A;  3B2G A;  3CMM B;  3IVF A;  1UZX B;  4L23 A;  4EEW A;  3L13 A;  1PGX A;  3CF6 E;  3NY5 A;  3ZYY X;  2AQ2 B;  4NJ7 A;  1WR6 E;  1NI3 A;  3IHP C;  1FO4 A;  4WJP A;  4M8N A;  4DHZ E;  3H8H A;  3OG5 A;  2W9N A;  4WIP A;  4P16 A;  1FPY A;  1XQQ A;  4E71 A;  2PKO A;  3WAM A;  1P7F A;  4CYE A;  3CSF A;  4FXC A;  2NMQ A;  3RNC C;  2LD9 A;  2EMS A;  3GZN B;  4H2A A;  2C7H A;  4GB9 A;  1T0Y A;  3RZW C;  1G6J A;  3ZNH B;  2K39 A;  1EU3 A;  3NZU A;  3UIP B;  1WYW B;  3KW5 B;  2WDQ B;  4C7Y A;  1TS4 A;  4D2K A;  2EKI A;  2CJN A;  4RFB A;  4FJZ A;  2LGI A;  2WNM A;  2NVU I;  3VAW A;  2N9E B;  2BW2 A;  2DYM A;  2KVZ A;  4IC7 B;  2IZV B;  4YXD B;  4W9D A;  2D5G A;  4LJO B;  4XZ4 A;  3RNE C;  5BMG A;  2V3N A;  4TSS A;  1J19 A;  3HUI A;  1T3Q A;  2DHZ A;  2TSS A;  2C5L C;  2BF8 B;  3PRM B;  1EUV B;  2Y5B B;  4ZRQ A;  2NPT A;  2INN E;  2IND C;  3EFU A;  2MJ3 A;  1SSN A;  3W2D A;  1L6V A;  1YN5 A;  2N7J A;  2KHW B;  1WSP A;  2GBM A;  3ZNI D;  4MEM A;  4LK0 M;  1F2R C;  1PFD A;  1ZPS A;  3DBH I;  2NBW B;  1M94 A;  4KIK B;  2N9P C;  2QC8 A;  2LHE A;  3WA0 A;  4M0W A;  4IM0 A;  1T5X D;  3ZUN A;  4BBN F;  3DPD A;  1VDV A;  1TGZ B;  4IDI A;  3BVM A;  2JY6 A;  4KDI C;  2ICI A;  3AEG B;  4PS8 A;  1FCL A;  2J7Q B;  2QIE B;  4M02 A;  2W82 A;  4LNI A;  1YQB A;  2GB1 A;  1SJE D;  2K8B A;  1FMA D;  1WMH B;  2MWS B;  4EZL A;  2L00 B;  2DBY A;  1L4Z B;  2KZR A;  1Q1O A;  4K81 A;  1E8Y A;  2KAC A;  3L08 A;  4MJS B;  4DDI D;  3NUH B;  4FAD A;  1MG8 A;  1WH3 A;  3DVG Y;  4DDG D;  2WXO A;  5DPR A;  1P3Q U;  2WQY B;  4KGT A;  2LGX A;  4RCO A;  3H1U A;  4IKG A;  4JPS A;  2SAK A;  3PHX B;  4HDO A;  2OHF A;  1V5T A;  1YMH E;  2D3C A;  4GDL A;  4TUU A;  3RMK C;  4HPM B;  3AE1 B;  3MTN B;  4YTN B;  4N59 A;  1HXY D;  1PGA A;  1OFF A;  1X1M A;  3N9Y C;  3P4R B;  1IBX B;  2Y5P A;  1AYF A;  1YIW A;  3DDC B;  2K25 A;  1YX5 B;  2DLB A;  1WFY A;  3Q3O C;  2WU2 B;  1JRP A;  1U4A A;  1JRU A;  2KO3 A;  3PLV A;  2BVC A;  2RMM A;  4JWS C;  2LJ5 A;  4DXF A;  3N1Y C;  3LDZ E;  3IAS 1;  4URK A;  1C4C A;  4RH6 A;  2WLB A;  2MBH A;  4KSK C;  1SE2 A;  4G0N B;  4OZB A;  1Y56 A;  4ACF A;  1I4Q A;  4G50 A;  2XBB C;  2PW9 A;  4OVV A;  3IFW B;  2L0F A;  2LI5 A;  2JRH A;  1V2Y A;  2N7D A;  4IM2 A;  5D3D A;  1HQR D;  5L95 C;  1MG4 A;  4OW0 A;  2DYO A;  1UNS A;  3CIR B;  2O6V B;  3N1X C;  3W5V B;  4HVB A;  2N1W A;  5G2N A;  2JZ3 B;  2XK5 B;  4GIV A;  3H6N A;  1ET9 A;  4KX6 B;  3PVL A;  2NCN A;  2LFI A;  1L5P A;  1N61 A;  3KQ4 A;  3ECI A;  3PHW B;  3M63 B;  4MGK E;  5BYR A;  3Q6B A;  2WWZ A;  1SB3 C;  1ENF A;  3B2F A;  4R3D A;  3R3M A;  3DVN U;  1I4G A;  1B1Z A;  1IP9 A;  5HI1 A;  1TS2 A;  4XDD A;  2LGY A;  1E7P B;  4NQL B;  4OZC A;  1TTN A;  1T0S C;  3PPA A;  1V86 A;  3FC4 A;  3AEA B;  1I7H A;  3V3X A;  2JX5 A;  1WX9 A;  3ML9 A;  3NS1 A;  3BII D;  3QX1 A;  2A5U A;  4RGO S;  3AEE B;  4Q2J A;  2Y3A A;  2BWF A;  3TEX A;  3Q2A C;  1SE3 A;  2VH2 A;  1YOV B;  1PUT A;  1V81 A;  2BS4 B;  1OEY J;  3BIN A;  3R2I A;  3SFE B;  5FR3 A;  4WWN A;  3SFD B;  2KVR A;  2DYB A;  4HKZ E;  4PYZ A;  3V61 A;  2AEH A;  4X57 B;  1AN8 A;  3IG3 A;  3R7R A;  3UF8 A;  4M00 A;  1I4P A;  4IM3 A;  2I1K A;  2CR5 A;  1Q0W B;  4WJN A;  4JE3 B;  5LXH A;  2LRW A;  2DZK A;  2G1E A;  2VZK D;  1WGG A;  1L0X B;  1UBI A;  2X8X X;  1TS5 A;  4EE2 A;  1MI0 A;  2NBV B;  2KJH B;  4F8C B;  1HEZ E;  4XGA B;  5JH5 C;  2IGD A;  1EO6 A;  5CTR C;  1V1O A;  1V49 A;  1A70 A;  1CZP A;  4BOS C;  5EDS A;  1GJZ A;  1H8C A;  3QC8 B;  3V6E B;  2WXH A;  2BBC A;  3CST A;  4WWM A;  1TYG B;  1ISN A;  2K22 A;  2O2V B;  3TSS A;  1GUA B;  3HVD A;  2E6X A;  1OQQ A;  4MSM B;  2KJR A;  3BZD B;  3URY A;  2YEP F;  4N9F 4;  1V1P A;  1ZE3 D;  2D07 B;  4MEL A;  2LXC A;  3DBR I;  4PYU A;  2K0P A;  4GDK A;  2Z0E B;  5IP4 D;  1WGK A;  1D5X C;  3VTW A;  3AH7 A;  5HG2 A;  3B08 A;  4YSX B;  4W9L A;  2X38 A;  2JVC A;  3PTF C;  2J4X A;  5EE9 A;  2ZZP B;  4ICU A;  4P7I A;  2YEP B;  2DEN B;  3U7Z A;  4ZRK A;  4XX5 A;  4LJP B;  5E6P A;  3T9L A;  3PSE B;  1XCQ L;  2KLC A;  4K7U A;  1SJH D;  4BKG A;  3BK1 A;  3SU8 X;  1P1A A;  1GAQ B;  4DQO C;  2NR2 A;  4GGQ A;  4TQ0 A;  1RRB A;  4L1B A;  1SGH A;  3N32 A;  4RM8 A;  1H4R A;  3UQA A;  1C77 A;  1B9R A;  2D3A A;  5GXG B;  1DGJ A;  3Q3N C;  3J9C A;  2NBU A;  4ANX A;  2MRP A;  1C79 A;  2WXR A;  2WXP A;  3VR8 B;  1WZ0 A;  1KRH A;  3VH4 B;  2GBR A;  2IY1 B;  2K1F A;  3I63 C;  2JF5 A;  2PE6 B;  3C0R B;  4ANU A;  3EA6 A;  3NRZ A;  2LWP A;  1L0Y B;  1WRD B;  4XWW A;  5C2T B;  5BMH A;  3RNB C;  1UEL A;  3AM9 A;  2D11 A;  2L05 A;  3RUI B;  4HK2 A;  1MFW A;  5TR5 A;  1TZO A;  3R7Q A;  3OAW A;  3TCA A;  4EOY A;  2KLG A;  1R7S A;  2M19 A;  1LXD A;  3A1Q A;  2FUH B;  4K3C A;  1J8C A;  1CQV A;  4ITK A;  4NQK E;  1FRD A;  4WQM A;  1KOT A;  4WUR A;  2L83 A;  2L76 A;  1F52 A;  3K9O B;  4YWG G;  4TQ1 A;  4MH8 A;  4FHK A;  4LNF A;  3UI3 A;  4CQN A;  1LM8 B;  2M17 A;  2K6Q A;  2RD0 A;  3FIL A;  4KZC A;  1R4M I;  3IBE A;  2G4D B;  2UYZ B;  2QSD A;  4KZ0 A;  2KAJ A;  4PS3 A;  3V6C B;  3NZ3 A;  1VR9 A;  2V3P A;  3H7P A;  5D94 A;  4RGT A;  3EGR A;  2RDB C;  2N9X A;  1P9D U;  5AUI A;  1BXT A;  1F77 A;  1WY8 A;  1FNW A;  2WX1 A;  2KC2 A;  3MC0 B;  3L16 A;  1ACC A;  1QQR A;  2C7N B;  4MDK E;  1GNU A;  3VHT C;  2KOX A;  5H8Y E;  1XD3 B;  5J17 A;  1EU4 A;  1FFU A;  4A3P A;  5J18 A;  1FCC C;  1IPG A;  4REZ A;  3Q8A A;  2Z59 B;  2WHI A;  4N58 A;  4A90 A;  4YT0 B;  4CHK A;  3KVF B;  4EZJ A;  4ZRP A;  2WDV B;  3NS8 A;  2L0T A;  2D10 A;  3NVY A;  3PS6 A;  5GMV A;  1VZ8 A;  2IYD B;  2LXA A;  5C1Z A;  3W1Y A;  5J2R A;  3KLS X;  1FD6 A;  4LDT D;  1QOG A;  1ROE A;  2LVP A;  1E7V A;  2LHD A;  2KWV B;  1RM6 C;  4ZYS A;  3ENE A;  3Q3M C;  4GU2 A;  2KX3 A;  2KDM A;  3O65 B;  4DXA B;  1LQB A;  3MC9 A;  1GB4 A;  2FCS A;  3A33 B;  4NAM A;  3P63 A;  1ZW7 A;  1FXT B;  1QOB A;  2KKC A;  3JSV B;  2BS2 B;  1FNV A;  3P2B A;  3PRE A;  3U4E G;  1R4N B;  2INC C;  2H89 B;  3ETR A;  3Q8C A;  2PEA A;  1IGC A;  3TEZ A;  4I6N B;  5AUK A;  2BB6 A;  1UWX A;  2ON8 A;  3GZN I;  2CHW A;  1WF9 A;  2N4F A;  1F2R I;  1MVK A;  2LAS A;  2QJL A;  1QKZ A;  4ANV A;  1QLB B;  3P4P B;  2MLB A;  2RDH A;  2L8J A;  1N6Z A;  3AI5 A;  2NTT A;  1A5R A;  4W9K A;  1D3Z A;  1C1Y B;  1K8R B;  1JAL A;  2KNB A;  1GOZ A;  4IUM B;  2EEL A;  4B0E A;  5D7G A;  1YQ3 B;  2KFK A;  3LJ3 A;  3AEC B;  5KHQ A;  3AN1 A;  3NOB A;  2JZP A;  2ZVN A;  2KAN A;  4RNA A;  1NVI D;  3ONS A;  4BKT A;  3SHQ A;  3JW0 X;  2R2Q A;  3PRP B;  2HDE A;  2FCM A;  2RPV A;  3AE5 B;  1TKY A;  2KN4 A;  3PO0 A;  3JYU A;  5C3J B;  3RZF A;  4ZRI A;  4WWP A;  3LYY A;  4FA6 A;  1C9F A;  1PGB A;  1ZP0 B;  1PDX A;  3DBL B;  1NEK B;  4KKI A;  4MGZ E;  2JT4 B;  5MPO A;  5JHB A;  1TIF A;  2KN5 A;  5L83 A;  1XT9 B;  2XNA C;  3APF A;  1HTO A;  2MCN B;  2JRI B;  2OED A;  2CKH B;  2MJE A;  3KUZ A;  3Q14 C;  4IWO A;  1L6U A;  3VTU A;  1K51 A;  3R2T A;  1WM2 A;  2FIF A;  4WAF A;  2D2Q A;  1WXA A;  2AL3 A;  4BOZ B;  4EZK A;  1WE7 A;  3EC8 A;  4XDC A;  4W9H A;  3ZKJ C;  1L2N A;  5DPW A;  4GOC A;  2N0S B;  3RPF C;  3AU4 A;  4HPL B;  2J53 A;  1ET6 A;  5D2M B;  3HK0 A;  1ZDX A;  4MT5 A;  4K3B A;  1V80 A;  4KVG B;  3DQV A;  4FJY A;  2IGH A;  3PGE A;  1T0Q C;  4P1C C;  3I5J C;  3ZDT A;  2BKR B;  4AUQ C;  4BBN C;  1XLO A;  1J7A A;  3A9J B;  4ZYN A;  4TKN A;  1FNU A;  1KTK A;  3KWV A;  1UGM A;  1XLQ A;  1NDD A;  2WXI A;  3DWG C;  3EUB 2;  5BYQ A;  3ML8 A;  1D6E C;  3ZQ4 A;  3TEY A;  1SE4 A;  3ZRC A;  4YL8 A;  1NBF C;  2KWD A;  2AL6 A;  4KIK A;  2V4L A;  3D32 A;  1K53 A;  2Z8L A;  4C80 A;  4LLG M;  5FKA C;  2QHO A;  2VZK B;  3H7S A;  3NVZ A;  5C23 A;  4BZA A;  2KXJ A;  2L32 A;  3RUL A;  2BYF A;  2DZM A;  4IW0 A;  2WXK A;  5IKC M;  3U8Z A;  3PT2 B;  1LGR A;  2IO0 B;  2Z0D B;  4DHJ D;  3FKY A;  1WJ6 A;  1RFA A;  4W9I A;  1JWU D;  3SD5 A;  4HCP B;  4B0M A;  4A6Q A;  1WI0 A;  3HVZ A;  1QT9 A;  1S1Q B;  1JML A;  1WMH A;  2ZPY A;  1WXS A;  4FBJ B;  3ZTD A;  2DZI A;  1YN3 A;  3T3N A;  4A55 A;  1WZ3 A;  4MJS A;  4RGN A;  3APD A;  1ZXH A;  3C8Y A;  4YTM B;  4J3O D;  1V6E A;  4JWU C;  4AOF A;  2ZCB A;  2A4Z A;  4BKS A;  2J42 A;  2WDR B;  1HZ5 A;  2WXQ A;  4B6W A;  3A9K B;  1EF5 A;  3Q3F A;  4YTP B;  1RLF A;  3AED B;  4JQW C;  4O1N A;  1P7E A;  4WH4 A;  3VQI A;  4BKS D;  3VTV A;  2NS5 A;  3DHG C;  4MM3 B;  3IT4 B;  1RAX A;  3AE3 B;  2SEB D;  2PMV A;  1IBX A;  1JWM D;  2EKE C;  4E3C A;  2WDT B;  2ACZ B;  3U7D A;  3ZGZ A;  2FCN A;  5AZH A;  4LNN A;  4ARI A;  2XEW A;  2BTE A;  2CJO A;  2LEK A;  1I42 A;  1I4R A;  4II3 B;  1RFK A;  5DCN A;  2W55 A;  1KLG D;  2IJ0 A;  4II2 B;  4G11 A;  2BB5 A;  4HEA 1;  4DXG A;  4GXB A;  2K8C A;  5LNK 1;  2KD0 A;  2OJW A;  2MQJ A;  5E6O A;  3BWU D;  3W1S C;  3ALB A;  5JHA A;  4AWJ A;  2OJR A;  2WU5 B;  5EE0 A;  4EUT A;  3DVN V;  3DWM A;  1J7C A;  2AX5 A;  3N20 C;  1TBE A;  4LTU A;  4BAX A;  4HXD A;  3LXF A;  4NAW B;  3AE7 B;  2KTF A;  1OQY A;  3KYD D;  4HJK A;  4HCN B;  2GOW A;  2QCZ A;  3HM3 A;  2WXM A;  2M56 B;  4XWT A;  4A20 A;  5G55 A;  3WIM A;  5AEK B;  2O6V A;  4M8M A;  4I6L B;  2KTR B;  3DBR B;  4W9E A;  3B1L X;  4TV3 A;  1N63 A;  4ZHP A;  2CU3 A;  2XK5 A;  4C4V B;  2J52 A;  4ZRJ A;  5G5G A;  5HHD G;  2WXL A;  4RMA A;  5IAA C;  3MC8 A;  3DHI C;  4KSL C;  1N5W A;  2J0K A;  1I35 A;  1DOY A;  2K5P A;  3W5U B;  2IY0 B;  2KDB A;  3T8M A;  1WJN A;  3ZIM A;  2IPK D;  5DPT A;  1AW7 A;  4A9A A;  1CMX B;  3RT3 B;  1PQS A;  3QJZ A;  1IGD A;  3RYT A;  4NY0 A;  1WXV A;  1HE8 A;  2KC1 A;  1WWT A;  1XLP A;  3DVG X;  4ZOH C;  3M62 B;  5EE1 A;  1KLV A;  5LLI A;  4JX1 C;  2M4N A;  1NYR A;  4US9 A;  2GI9 A;  2JYE A;  1AAR A;  1WX7 A;  4JLC A;  3SDL C;  4M01 A;  2K9X A;  2DNF A;  2W3S A;  3RNG C;  4DBG A;  3Q69 A;  1HTQ A;  1VJK A;  3X23 A;  1E0Z A;  3NG0 A;  1EWY C;  5D6J B;  3HIZ A;  3QWZ B;  5FR6 A;  4GN1 A;  2ZW0 A;  3W9C B;  3AEF B;  1KF6 B;  1S3S G;  5E6N A;  3ZXR A;  3WAL A;  3VR9 B;  3AE9 B;  4IWQ A;  4HPP A;  2EMT A;  1KH0 A;  2HJ8 A;  5G5H A;  1YJ1 A;  1E90 A;  4F7Z A;  1C3T A;  3VRB B;  3VUW A;  4MSQ B;  1K52 A;  4C7Z A;  1WGH A;  3DHH C;  2V1Y A;  3WAN A;  4RM9 A;  2MA9 B;  4LDT B;  1VRA B;  2MSE D;  2G4S A;  2FCQ A;  1Q5W B;  3B0A A;  2I38 A;  2ZW1 A;  1GG3 A;  2BPS A;  2AWT A;  1V8C A;  2MBE A;  5KHO A;  4HRO A;  4PS7 A;  3RFZ B;  3AE8 B;  2O2V A;  2PJH A;  1E8W A;  1N5X A;  3EEC A;  1YQ4 B;  2HD5 B;  1C78 A;  2FBW B;  5IOI A;  2J0M A;  1WE6 A;  1Z5S B;  3K9P B;  3MHS D;  2H88 B;  3PRZ A;  2I1J A;  4S0R A;  4EKU A;  1JWB D;  1N60 A;  1SXT A;  4AJY B;  2UWQ A;  3TUO A;  4OHJ A;  4G3X B;  1YX6 B;  3N30 A;  2N9K A;  4TMA B;  3I9V 1;  1ESF A;  1HA5 A;  2LMC A;  3TIX A;  2MW5 A;  5HFY A;  1NI2 A;  4NPN A;  1GPX A;  2QEJ C;  3PZ7 A;  1WX8 A;  4ICV A;  2ZNV B;  3QAQ A;  4P1B C;  2NPT B;  2KX0 A;  1E6E B;  3Q8E A;  4K7S A;  2K8H A;  4W9C A;  2HE7 A;  2WX0 A;  2PLP A;  5TSS A;  1VZ6 A;  1YN4 A;  2JWU A;  2B3A A;  2LZ6 A;  1P0R A;  3TMP B;  2ZVO A;  1WYG A;  1L4D B;  2C60 A;  1I4X A;  2HJ1 A;  2KFK B;  4M0W B;  2JU6 X;  4WWO A;  2G9H D;  2JPH A;  3S2A A;  1WR1 A;  2JSV X;  3BK2 A;  2GBJ A;  4JGH B;  5I4D A;  1E10 A;  1OGW A;  1ZUD 2;  1WXM A;  1TJE A;  3ZNZ B;  1LFD A;  1KFY B;  2KFJ A;  2ZNV C;  2RDG A;  2WS3 B;  2YVC A;  4W9G A;  1C4A A;  2MBO A;  1SIJ A;  2PPH A;  2OOB B;  5HKH A;  3L54 A;  3VUY A;  3Q8B A;  3L17 A;  5IN7 A;  4F1S A;  2M1M A;  2DAF A;  4ASW C;  4HKQ A;  2JQR B;  2MP2 A;  4WAA A;  4AP4 C;  1T0R C;  3H9D A;  4KGR A;  1I4H A;  3VH3 B;  4UDU C;  1GB1 A;  2KDE B;  1ZGU B;  2RR9 A;  3DBH B;  2N9L A;  3RCZ A;  1TY0 A;  1TT5 B;  2PVG C;  2LVO A;  2RGF A;  3VXW A;  3V60 A;  3R66 C;  2MBB B;  2JYT A;  4GDL B;  3TEW A;  2LGS A;  3E9S A;  4HLE A;  2L3Z A;  3QK0 A;  2PVO D;  1C76 A;  3U30 A;  2D3G A;  2KWU B;  1WM3 A;  1CK1 A;  2AYO B;  5CHW A;  2BQQ A;  4ANW A;  1EM7 A;  1L0V B;  4NJ6 A;  3GE8 C;  1SBB B;  3RNF C;  1WGR A;  3ZTC A;  2KMC A;  4WJO A;  2L1A A;  2ONQ A;  4AJW A;  2MBQ A;  4L2Y A;  3IXS A;  4OVZ A;  1DOI A;  2GLS A;  1EF1 A;  4HRS A;  3PLU A;  1R4N I;  1ZOY B;  2JWZ A;  4USA A;  3L0W B;  2Y5C A;  3I3T B;  1MPE A;  2BWE S;  4WJQ A;  4DHJ B;  3QCA A;  4MGY E;  2MX2 A;  1OQR A;  1IYF A;  2RPQ A;  2PE9 A;  2R2O A;  2QDF A;  3UIN B;  1YJJ A;  1TKG A;  2E3T A;  4JIO U;  4FLH A;  5BMI A;  2YLM A;  1V5O A;  2GBN A;  3KYC D;  1BT0 A;  2IO2 B;  5JZE B;  2J0J A;  3AE2 B;  1WRI A;  1XF5 L;  1KJT A;  4GMV A;  1JRO A;  5IO9 A;  3PV1 A;  3N3K B;  2KT7 A;  1RYJ A;  3ZO5 B;  3ZJT A;  4YSY B;  3AU5 A;  1STE A;  1TS3 A;  2V3S A;  3UGB B;  1GC6 A;  1ZXI A;  4RF0 A;  3JSV A;  1TZ1 A;  3AEB B;  2LGD A;  1BML C;  2I2Y A;  2KJ6 A;  1F0Z A;  3PZD A;  4XE0 A;  2AQ3 B;  2WXF A;  3DBL I;  1SEB D;  1N62 A;  1FFV A;  3TJP A;  3ZJU A;  2KMA A;  2JZZ A;  3AB5 A;  3BYY B;  2M8S A;  1K50 A;  4CO7 A;  3NVV A;  1FM0 D;  1F1H A;  1HZ6 A;  3NZS A;  5E6J A;  3AMZ A;  3EFC A;  2PIA A;  3A4S C;  4LNK A;  3VFK A;  2HTH A;  3OLM D;  2CU1 A;  3VDZ A;  3ZXV A;  1RWS A;  4EFO A;  3BVZ A;  4P6V F;  1IUE A;  1CJE A;  2ZPN A;  1E5W A;  3ZLZ A;  2WXG A;  3A4R A;  5CX3 A;  1Q10 A;  2BYE A;  3U2S C;  4US8 A;  1TY2 A;  1MJD A;  1UWM A;  3MHZ A;  2KYW A;  1XEE A;  1Y8R C;  5T8I A;  4BFR A;  3V05 A;  2LRU A;  2DX5 B;  4DK5 A;  2RSU A;  5BYS A;  1VD2 A;  3NHE B;  3ZNG C;  2FUG 1;  4NNJ B;  3BYT B;  2W3R A;  3JVZ X;  1YD8 U;  4MH0 E;  1UBQ A;  2G45 B;  5BO4 B;  1T6B X;  2IO3 B;  3OJ3 A;  2QIL A;  3MJW A;  1WIA A;  1QIL A;  2WXN A;  4XYC A;  3DBS A;  2BKF A;  3QQ8 B;  2K3U A;  3HHM A;  5CHV C;  2WGS A;  1V1P B;  2IO1 B;  1UH6 A;  2PTL A;  1MHH E;  1Z2M A;  2GRI A;  5H92 C;  3NJT A;  1D5M C;  3UIO B;  3V62 A;  4GDK B;  2XN9 C;  3I57 A;  4HWI B;  1FIQ A;  2QMT A;  3GP7 A;  3MP9 A;  1V97 A;  4ZDV A;  4NJC A;  3M95 A;  3WAP A;  3KWL A;  2CHZ A;  5LXI B;  3QA8 A;  4IOI E;  4KGS A;  4C56 C;  4ARC A;  1JCK B;  2FAZ A;  4J6I A;  3VUX A;  1PYW D;  2VH1 A;  3B9J A;  4IG7 B;  2JXT A;  2V0G A;  3L10 B;  4OVU A;  3VRA B;  2MJD A;  3A9J A;  2MEK A;  5D3I B;  1XO3 A;  3M3J A;  1XXG A;  3AXC A;  5IA7 A;  1JQ4 A;  3IAM 1;  1VLB A;  4HDQ A;  2JXX A;  2BYV E;  1DOX A;  3MFG A;  4KV2 A;  4RF1 A;  3ZJV A;  2DWQ A;  4FUL A;  2ASQ A;  3U52 E;  2INP E;  4FHJ A;  1V9J A;  1WGD A;  3APC A;  3KUC B;  4BVU C;  3MJ5 A;  3RNA C;  2K6D B;  3DOW A;  4N6E B;  3SEB A;  4FN2 A;  4C00 A;  3IT6 B;  2KDI A;  2GBK A;  2IBI B;  2N7E A;  5AZF A;  3EHV A;  4B95 A;  4ZHO A;  5DPS A;  1SIF A;  1WXQ A;  1EWC A;  2C9W B;  2KMM A;  2M0X A;  1MHX A;  5AZG A;  1OTR B;  1M4V A;  3OWE B;  2L52 A;  2LUE A;  3TBL D;  2O6V D;  3UQB A;  1QZE A;  1WJU A;  1UUP A;  3A1Q B;  4MAC A;  4GLS C;  3T3O A;  3QIJ A;  3W1S A;  4QAY A;  2W54 A;  5JXV A;  2CHX A;  1WJ4 A;  1NEN B;  3AUL A;  1FEH A;  3HRD D;  3A9K A;  4XC2 A;  1NYQ A;  3ZRF A; 
#chains in the Genus database with same CATH homology
 5TSS A;  1VZ6 A;  2LFI A;  1L5P A;  1YN4 A;  1N61 A;  1C4P A;  4PT5 A;  3KQ4 A;  2JWU A;  2NTS A;  4OZA A;  2HDE A;  2WP9 B;  2RPV A;  3FAH A;  1XCT L;  3AE5 B;  3FIL B;  1TKY A;  2KN4 A;  3GB1 A;  3PO0 A;  5BYR A;  5C3J B;  2LJI A;  1DYQ A;  1WYG A;  1E9M A;  1SB3 C;  1ENF A;  1L4D B;  1PGB A;  1ZP0 B;  1PDX A;  3B2F A;  3LYY A;  1C9F A;  4R3D A;  3WCQ A;  2BT6 A;  1NEK B;  4KKI A;  1I4G A;  1B1Z A;  3E56 A;  1FXI A;  5MPO A;  3AE4 B;  5HI1 A;  1I4X A;  1TS2 A;  4XDD A;  3SR6 A;  1E7P B;  2JU6 X;  2XNA C;  2G9H D;  2IDY A;  2Q5W D;  2B76 B;  4OZC A;  2HTM E;  2JSV X;  2OED A;  2MJE A;  3BK2 A;  1L6U A;  5I4D A;  3FC4 A;  1K51 A;  3AEA B;  1I7H A;  3R2T A;  3V3X A;  1E10 A;  2R61 A;  2JX5 A;  3NS1 A;  3BII D;  1QF6 A;  1ZUD 2;  4KKJ A;  1TJE A;  4RGO S;  3AEE B;  4WAF A;  4Q2J A;  2Y3A A;  2LUM A;  1JWS D;  4XDC A;  1KFY B;  2RDG A;  3TEX A;  2WS3 B;  3CWI A;  1SE3 A;  3P42 A;  1C4A A;  1SIJ A;  2MH7 A;  2N0S B;  3RPF C;  1PUT A;  2IGG A;  2BS4 B;  1UGJ A;  4YSZ B;  2J53 A;  3R2I A;  5EE3 A;  3Q8B A;  3SFE B;  5FR3 A;  1ET6 A;  1YNT E;  1TKE A;  1ZDX A;  3SFD B;  4MT5 A;  2BS3 B;  3R8B A;  4HKQ A;  3L4P A;  2JQR B;  2IGH A;  4HKZ E;  4KGR A;  1I4H A;  1AN8 A;  4UDU C;  1GB1 A;  1XLO A;  1J7A A;  4AS1 A;  2N9L A;  1I4P A;  1TY0 A;  1FRR A;  1FNU A;  1KTK A;  3KWV A;  1XLQ A;  4JE3 B;  5BYQ A;  2PVG C;  2WXI A;  3DWG C;  3EUB 2;  1D5Z C;  2G1E A;  2VZK D;  1D6E C;  1L0X B;  4RGM A;  3ZQ4 A;  1TS5 A;  3TEY A;  4EE2 A;  2JYT A;  4GDL B;  3TEW A;  1SE4 A;  1MI0 A;  3E9S A;  2FE8 A;  1YJI A;  2PVO D;  1C76 A;  1HEZ E;  2KWD A;  1K53 A;  2IGD A;  1CK1 A;  2Z8L A;  4LLG M;  5FKA C;  2VZK B;  4C80 A;  1V1O A;  3NVZ A;  1KLU D;  1A70 A;  1EM7 A;  1L0V B;  1LO5 D;  1QOF A;  1CZP A;  2KQ4 X;  3PZ8 A;  3P4Q B;  3P1M A;  1SBB B;  5FK9 C;  2L32 A;  2WXH A;  2BBC A;  4WWM A;  1BUI C;  2WXK A;  1TYG B;  2K22 A;  1JW9 D;  2L1A A;  1XLN A;  2ONQ A;  4L2Y A;  3IXS A;  3TSS A;  4HJG E;  1AWD A;  4OVZ A;  1JWA D;  3O13 A;  1DOI A;  3HVD A;  2E6X A;  1OQQ A;  2M0A A;  4HRS A;  1J7B A;  4AQ7 A;  1JWU D;  1ZOY B;  3BZD B;  3BVG A;  4USA A;  4B0M A;  4A6Q A;  3URY A;  2Y5C A;  2YEP F;  3HVZ A;  2AQ1 B;  1V1P A;  1QT9 A;  1ZE3 D;  1JML A;  1MPE A;  2V4I B;  1ZDV A;  2K0P A;  1YN3 A;  3T3N A;  1WGK A;  1SF0 A;  1D5X C;  2WXJ A;  3AH7 A;  5HG2 A;  4A55 A;  4YSX B;  4RGN A;  1OQR A;  2X38 A;  3AE6 B;  1ZXH A;  2J4X A;  3C8Y A;  4YTM B;  4J3O D;  5EE9 A;  3NVW A;  4JWU C;  2YEP B;  3U7Z A;  3ABV B;  1QOA A;  1VZ7 A;  1YJJ A;  2J42 A;  2WDR B;  1HZ5 A;  1FXA A;  2WXQ A;  3Q8F A;  4A8X C;  3AV8 A;  1XCQ L;  1SJH D;  3LB8 C;  1TKG A;  2E3T A;  4NZL B;  3BK1 A;  5BMI A;  3P4S B;  1D4B A;  1GAQ B;  3GS2 A;  4DQO C;  2BYT A;  3B2G A;  4TQ0 A;  4YTP B;  3AED B;  3AE2 B;  4L1B A;  1WRI A;  1XF5 L;  4L23 A;  1PGX A;  4O1N A;  1JRO A;  1P7E A;  4WH4 A;  3VQI A;  3ZYY X;  2AQ2 B;  1NI3 A;  1C77 A;  1B9R A;  4MM3 B;  5GXG B;  1FO4 A;  3IT4 B;  1DGJ A;  1RYJ A;  3H8H A;  4YSY B;  3AE3 B;  3ZJT A;  3J9C A;  2SEB D;  4WIP A;  4P16 A;  2PMV A;  1STE A;  1TS3 A;  1IBX A;  2PKO A;  1P7F A;  1JWM D;  1C79 A;  1ZXI A;  4RF0 A;  2WXR A;  4FXC A;  2ACZ B;  2WXP A;  2NMQ A;  3AEB B;  2I2Y A;  1BML C;  3VR8 B;  3ZGZ A;  1KRH A;  4H2A A;  1F0Z A;  4XE0 A;  2BTE A;  4ARI A;  2AQ3 B;  2WXF A;  2CJO A;  2LEK A;  1SEB D;  1N62 A;  1I4R A;  1RFK A;  1FFV A;  3ZJU A;  2W55 A;  1KLG D;  2IJ0 A;  1EU3 A;  3EA6 A;  3NRZ A;  2BB5 A;  4HEA 1;  1L0Y B;  4DXG A;  4XWW A;  3AB5 A;  5C2T B;  5BMH A;  3BYY B;  5LNK 1;  2WDQ B;  4C7Y A;  1K50 A;  3BWU D;  1TS4 A;  3AM9 A;  4D2K A;  2EKI A;  2WU5 B;  1FM0 D;  3NVV A;  2CJN A;  5EE0 A;  3DWM A;  1J7C A;  2AX5 A;  1HZ6 A;  4RFB A;  5E6J A;  3AMZ A;  1TZO A;  2LGI A;  4LTU A;  2PIA A;  2WNM A;  3LXF A;  2BW2 A;  2DYM A;  4NAW B;  4YXD B;  3AE7 B;  1R7S A;  1RWS A;  2M19 A;  2D5G A;  3BVZ A;  5BMG A;  2V3N A;  4TSS A;  4P6V F;  1IUE A;  1T3Q A;  2TSS A;  1CJE A;  1CQV A;  2WXM A;  3HUI A;  2M56 B;  4XWT A;  4ITK A;  1FRD A;  2WXG A;  1Q10 A;  4ZRQ A;  4WQM A;  3U2S C;  2INN E;  4US8 A;  1TY2 A;  2MJ3 A;  1N63 A;  2L83 A;  2CU3 A;  4WUR A;  1SSN A;  4ZHP A;  3W2D A;  1L6V A;  2J52 A;  1YN5 A;  5G5G A;  2N7J A;  5HHD G;  1UWM A;  2WXL A;  3MHZ A;  4YWG G;  4TQ1 A;  1XEE A;  1WSP A;  1N5W A;  5T8I A;  4MH8 A;  1DOY A;  4LK0 M;  3UI3 A;  4CQN A;  2K5P A;  3W5U B;  3FIL A;  1F2R C;  1PFD A;  1ZPS A;  3V05 A;  2QSD A;  2KAJ A;  2IPK D;  1AW7 A;  5BYS A;  4A9A A;  2FUG 1;  3NZ3 A;  1VR9 A;  2LHE A;  2W3R A;  3BYT B;  2V3P A;  1IGD A;  4M0W A;  4RGT A;  1T5X D;  1T6B X;  3EGR A;  1VDV A;  4IDI A;  1WWT A;  1XLP A;  3BVM A;  5AUI A;  1BXT A;  4ZOH C;  2QIL A;  1F77 A;  2ICI A;  5EE1 A;  1FNW A;  3AEG B;  1QIL A;  1FCL A;  2WXN A;  2QIE B;  3MC0 B;  2K3U A;  2W82 A;  1ACC A;  4JX1 C;  1QQR A;  1NYR A;  4US9 A;  2GI9 A;  2JYE A;  1V1P B;  2GB1 A;  2PTL A;  1MHH E;  1SJE D;  2GRI A;  5H92 C;  5H8Y E;  1EU4 A;  1FMA D;  2K9X A;  2W3S A;  1FFU A;  1D5M C;  3Q69 A;  1FCC C;  1VJK A;  1L4Z B;  2DBY A;  4GDK B;  2XN9 C;  3I57 A;  1FIQ A;  2QMT A;  2KAC A;  3GP7 A;  1E0Z A;  4REZ A;  3MP9 A;  1V97 A;  3Q8A A;  4NJC A;  1EWY C;  3KWL A;  4N58 A;  4YT0 B;  4A90 A;  4ZRP A;  4IOI E;  4KGS A;  2WDV B;  2ZW0 A;  3W9C B;  3AEF B;  1KF6 B;  3NUH B;  4C56 C;  1JCK B;  4ARC A;  3NVY A;  1PYW D;  1VZ8 A;  3B9J A;  3VR9 B;  3AE9 B;  2JXT A;  2WXO A;  2V0G A;  3VRA B;  2MJD A;  2MEK A;  2WQY B;  5D3I B;  4KGT A;  3KLS X;  1XO3 A;  4RCO A;  4IKG A;  1FD6 A;  1KH0 A;  1QOG A;  1ROE A;  5G5H A;  1XXG A;  4JPS A;  2LHD A;  2SAK A;  3VRB B;  1JQ4 A;  1RM6 C;  4ZYS A;  3IAM 1;  2OHF A;  1VLB A;  1YMH E;  2KDM A;  1K52 A;  4C7Z A;  1DOX A;  1GB4 A;  3MFG A;  3AE1 B;  4YTN B;  4N59 A;  4RF1 A;  1HXY D;  1VRA B;  1PGA A;  1OFF A;  2DWQ A;  3ZJV A;  3N9Y C;  3P63 A;  4NAM A;  3P4R B;  3U52 E;  2Y5P A;  1IBX B;  2I38 A;  2INP E;  1AYF A;  2ZW1 A;  1QOB A;  2BS2 B;  1FNV A;  3U4E G;  1V8C A;  2H89 B;  4HRO A;  3ETR A;  2DLB A;  3MJ5 A;  3RFZ B;  2WU2 B;  1JRP A;  3AE8 B;  3Q8C A;  1IGC A;  3TEZ A;  4N6E B;  1N5X A;  3SEB A;  2RMM A;  4JWS C;  5AUK A;  4DXF A;  2BB6 A;  1UWX A;  1YQ4 B;  1C78 A;  2FBW B;  2ON8 A;  3IT6 B;  3IAS 1;  1C4C A;  4RH6 A;  2WLB A;  4ZHO A;  1WXQ A;  1EWC A;  2H88 B;  1F2R I;  2KMM A;  1MHX A;  1MVK A;  1SE2 A;  1JWB D;  1M4V A;  1N60 A;  2QJL A;  3OWE B;  1SXT A;  2L52 A;  4OZB A;  1QKZ A;  1Y56 A;  1I4Q A;  1QLB B;  3TUO A;  3P4P B;  4OHJ A;  2RDH A;  2PW9 A;  2NTT A;  2N9K A;  4TMA B;  3I9V 1;  1UUP A;  1ESF A;  1HA5 A;  4MAC A;  2LMC A;  4GLS C;  3T3O A;  5HFY A;  3W1S A;  1JAL A;  1GPX A;  1GOZ A;  5D3D A;  1HQR D;  2W54 A;  2QEJ C;  4OW0 A;  2DYO A;  5JXV A;  2EEL A;  3PZ7 A;  1UNS A;  5D7G A;  3CIR B;  1YQ3 B;  4B0E A;  1NEN B;  3W5V B;  3AEC B;  3AN1 A;  1E6E B;  3Q8E A;  1FEH A;  2JZP A;  3HRD D;  4RNA A;  1ET9 A;  1NVI D;  1NYQ A;  4KX6 B;  2PLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...