5J17A

Solution structure of ras binding domain (rbd) of b-raf
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Serine/threonine-protein kinase B-raf
publication title A Small Molecule RAS-Mimetic Disrupts RAS Association with Effector Proteins to Block Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 80
sequence length 80
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5j17A01
1WX7A 1WZ3A 2JT4B 3IVFA 4MSQB 2J7QB 3ECIA 1XQQA 2ZVNA 2BKRB 3JVZX 2ZPNA 4F7ZA 2ZCCA 4W9LA 2ASQA 3WALA 1L7YA 2W9NA 3Q3JA 3HIZA 4TQ0A 3ONSA 2ZEQA 1WJ6A 5D2MB 4BOSC 3QCAA 3A9JA 3RZFA 3DVGX 3OJ3A 4ANWA 2M0XA 2JXXA 2N1WA 4WJQA 3ZNHB 2N4FA 3VTUA 2GBJA 2L3ZA 3APDA 4MELA 3PHXB 4JQWC 5G55A 1WX9A 2J0JA 1UD7A 1WX8A 2MLBA 2NCNA 4M8MA 2IO2B 3A9JB 2LGDA 3PLUA 4FADA 1H8CA 1M94A 4K81A 3VTWA 4ZYNA 1D3ZA 1KLVA 4MGZE 3N32A 4BKTA 2KWVB 1WRDB 2DAJA 1F9JA 4GB9A 2LVQA 1Y8RC 3A4SC 3ZDMC 3R7QA 2LGXA 1NDDA 2CU1A 4IUMB 4MH0E 2BKFA 1TZ1A 2KDBA 2HD5B 2KQSA 4ZRIA 3RCZA 5KHQA 4PS7A 2V1YA 5EDSA 2C5LC 2BGFA 2KFKA 4DWFA 2L00B 3NY5A 2QHOA 2DZJA 2AL3A 2JPHA 4CO7A 1UGMA 2KC2A 1EF1A 3LDZE 4KSLC 4MM3A 1V80A 2O2VA 1UBIA 1X1MA 4XX5A 2FCSA 3PZDA 3QK0A 3CSFA 4CHKA 1L2NA 4MDKE 1WI0A 2KFKB 1WMHA 2KMAA 4HXDA 3AU4A 3TL5A 1V81A 2XK5A 4HDQA 2K1FA 4KDIC 4HK2A 2O2VB 2DZKA 3ALBA 4IW0A 1J0GA 1H4RA 1P9DU 5HKHA 1LM8B 2MWSB 2WX0A 3PHWB 4NPNA 3A33B 1WYWB 4CYEA 1WMHB 3VAWA 3P2BA 2WYQA 4IWQA 4ICUA 2XK5B 2KDIA 3M62B 3AI5A 4NQLB 3DVNV 5E6NA 1QZEA 4M0WB 2DZMA 4IM0A 3OJ4B 2MBEA 1ZW7A 3W1YA 2L76A 4ANVA 1WR6E 3WAMA 2WDTB 4E74A 2KTFA 4NNJB 4MEMA 3PRMB 2IO0B 2RSUA 3UIPB 5LXIB 3DBRI 3PREA 2JVCA 2MW5A 2NVUI 3V62A 1NBFC 1V5OA 2O6VA 5DPRA 2MQJA 3PSEB 2MA9B 2R2OA 4KV2A 4RM8A 2HJ8A 2BWFA 2DENB 2IY1B 2KJ6A 2ZVOA 4FHJA 2KC1A 4GOCA 4G11A 4WWNA 2OOBB 4XC2A 3X0WA 1E8WA 3RYTA 2C7HA 3ZTDA 4AOFA 4HCNB 3BY4B 2O6VB 3KH0A 3QC8B 2KN5A 4II3B 4KZ0A 1JRUA 1WJUA 1RAXA 2NBWB 3VXWA 5J2RA 4WWPA 3NOBA 3VHTC 3UQAA 2PPHA 4BBNF 1YX6B 3B1LX 3WA0A 2L05A 4W9IA 2KO3A 3IHPC 3QWZB 2KDFB 4ANXA 4NQKE 4GN1A 2MBOA 3U8ZA 2PJHA 1Z2MA 2K39A 3B08A 4BKSA 2KD0A 4MGKE 5D94A 3T9LA 3I3TB 3IG3A 2IO1B 2KLGA 3CSTA 3L13A 4NAWA 4AWJA 5LXHA 4HLEA 5CHWA 1VD2A 4ASWC 1CMXB 2PE9A 3VH4B 1PQSA 4W9HA 1C3TA 4RMAA 5IAAC 1BT0A 3R66C 5AZFA 1TBEA 2JY6A 3VUWA 1UBQA 2Y5BB 1I35A 4MJSB 1R4MI 4NAWB 3ZW3A 1V6EA 3ENEA 4IM2A 2DYBA 1J8CA 1J19A 1KJTA 3CMMB 2LVOA 1V49A 3DVNU 4ANUA 3ML9A 2PEAA 1OEYA 4WJOA 4K7UA 2KKCA 1YIWA 3ZTCA 3O65B 2BPSA 5BO4B 3KW5B 2CHZA 2WWZA 1S1QB 3VVWB 1RFAA 4BKGA 2L8JA 4W9KA 4ZRJA 2ZNVC 2FCQA 2FCMA 3DPDA 2LXAA 3H1UA 4FJZA 4DDID 1E8YA 5IA7A 1WJ4A 2MBHA 4BFRA 2K6DB 3UF8A 2LRWA 2MP2A 4RM9A 1UELA 2FCNA 1KOTA 3QA8A 4NJ6A 3TMPB 3VUXA 3AULA 3VUYA 4FA6A 2KJHB 3ZVVA 3QJZA 4HDOA 5C23A 4DK5A 2AYOB 1WH3A 1WF9A 5G2NA 1WJNA 1ZKHA 4DHJB 2MP2B 2EMTA 2K6QA 3PRZA 1LXDA 3QARA 4HCPB 2DX5B 1YD8U 4NJ7A 2L0FA 3QHTA 1E90A 2V3SA 3DDCB 2K8BA 3V6CB 4DHZE 1WGGA 3ZNID 5KHOA 1WR1A 4K7WA 2BYEA 2N1VA 2G4SA 1WE6A 1SE9A 4JLCA 1P1AA 4LJPB 3U30A 2IYDB 5LLIA 4MGIE 3X23A 2KXJA 3PGEA 3TJPA 2KMCA 1R4NI 1V86A 3WAPA 3KUDB 2GBKA 3ZO5B 4AUQC 5JH5C 5DPWA 3RUIB 2RD0A 1VCBA 4A3OA 2LD9A 3KYDD 3CF6E 1E7UA 3AXCA 2J0MA 3KUZA 2KVRA 2VRRB 2IZVB 4GXBA 1TTNA 3QX1A 4BVUC 5L83A 3PLVA 3W1SC 3DVGY 1OQYA 1T0YA 4JL9A 3BINA 4EUTA 2KK8A 3NS8A 4TQ1A 3NZSA 2GMIC 1E5WA 2YLMA 4OVVA 3L54A 3RT3B 3OAWA 1KM7A 2XBBC 2GBNA 1SIFA 2KTRA 2A4ZA 3N30A 1WIAA 3DBHI 3PS6A 3ZNZB 2IBIB 4HPMB 2KANA 4DHJD 2Z59B 3APFA 3HHMA 2N9XA 3K9PB 4FULA 4ZDVA 3TIXA 4KZCA 4JIOU 3ZRFA 3M95A 2V4LA 3DQVA 5JHBA 3UINB 1GNUA 4B95A 2KDEB 3UQBA 2KTRB 4DXAB 2KX3A 2I1JA 3L08A 4EZJA 3R3MA 2AL6A 2C7NB 2DHZA 5E6PA 1I42A 2N9EB 4PS8A 3PT2B 2LGYA 4KVGB 4F1SA 4AJWA 2A5UA 5FR6A 1GC6A 1OEYJ 1EF5A 4W9JA 4EEWA 3ZUNA 4EZKA 2LASA 2GOWA 2HE7A 3HK0A 4I6LB 4GU2A 4AJYB 5TR5A 2ZPYA 1ISNA 1RRBA 2Z0EB 3RULA 2BF8B 1HE8A 4LCDE 3ZDTA 2CS4A 3PV1A 2JZ3B 3GOEA 4MJSA 1OGWA 4LDTB 4MSMB 4GDLA 3RD2A 2D07B 2ZZPB 3VH3B 2L0TA 2KZRA 4AP4C 1WGYA 1XD3B 4WJNA 2B3AA 2CKHB 5JZEB 3ZRCA 4TKNA 2JRHA 5CHFA 3EFUA 3TBLD 2KLCA 4GDLB 3RZWC 4X57B 3MHSD 1YJ1A 3QIJA 4MGYE 3WAOA 2KNBA 4DBGA 3D32A 2EKEC 4KSKC 1V5TA 3ZLZA 3A4RA 4WAAA 1E7VA 2M4NA 5J17A 4P7IA 3S2AA 4EFOA 2OJRA 5CTRC 1E8XA 3DOWA 3T8MA 4WWOA 1MG8A 1IPGA 1WM2A 1UH6A 4FJYA 2K8HA 1YQBA 1WGHA 2NR2A 3V61A 4WQOB 3V6EB 2MRPA 2O6VD 3VQIA 2M8SA 3IFWB 2RPQA 1V2YA 3B0AA 1WGRA 3NHEB 2NS5A 4OVUA 1WM3A 2UWQA 1P0RA 3ML8A 4GDKB 2FIFA 2GBRA 2JF5A 3PRPB 2NBUA 2N7EA 4DHZB 1AARA 3A1QB 5C1ZA 4WJPA 3ZKJC 3C0RB 1WXVA 4HWIB 2EMSA 2ZNVB 3DCGA 1E8ZA 4GGQA 1S3SG 2AWTA 3L17A 3M3JA 1UZXB 2FUHB 4HPLB 5L95C 2D2QA 1WXMA 4LDTD 4J6IA 5GMVA 3PTFC 4TUUA 2G3QB 3LJ3A 4GIVA 1RLFA 2KX0A 1P98A 1WGDA 1ZGUB 4BKSD 4G0NB 3A9KA 2RR9A 1WXAA 3H6NA 4KIKA 1GG3A 2C7MB 2L7RA 2CHXA 4IC7B 3SDLC 1V9JA 1IYFA 1GJZA 2HTHA 4G50A 4K7SA 4YL8A 1K8RB 3VTVA 2N7DA 3H7SA 4FLHA 3A9KB 2AEHA 2DAFA 5AZGA 1WZ0A 4KIKB 4DDGD 4IWPA 5DPTA 2PE6B 2R2QA 2KJRA 3HM3A 5CX3A 4BBNC 1A5RA 2LUEA 1Z5SB 3VDZA 4E71A 2FAZA 2MBQA 2MCNB 1GC7A 1WE7A 4FN2A 2K25A 4BOZB 2DYOA 3SD5A 4W9CA 4PYZA 2LJ5A 4TV3A 3UIOB 3W1SA 4FJVB 2MX2A 2J0KA 5DPSA 4W9EA 3V60A 3MJWA 3WIMA 3VFKA 2KFJA 2G45B 4LJOB 2NPTA 1FXTB 2LRUA 3WANA 4IM3A 4IG7B 3SU8X 2JWZA 4A20A 4GMVA 3HM6X 1WY8A 2BYVE 2KHWB 2IO3B 5AZHA 1P3QU 1EUVB 4B9KA 3H7PA 2NPTB 2ZCBA 2N9PC 1Q5WB 5DCNA 2LWPA 4K1RB 3MTNB 1GUAB 4HVBA 3JSVA 1YX5B 4I6PA 2G4DB 5D6JB 3H7PB 2FNJB 4EZLA 4M8NA 5D7GA 1WFYA 3IBEA 1LQBA 1EO6A 1U4AA 2M17A 4W9DA 4EOYA 3ZNGC 1C1YB 1LFDA 4F8CB 2LVPA 5JHAA 3JSVB 3L16A 1NI2A 2BWES 4XZ4A 2FIDA 2WX1A 4ZRKA 3KUCB 3PPAA 4A3PA 2DYMA 4JGHB 4NY0A 2K8CA 2LI5A 4GSWA 5J18A 2JUOA 2GBMA 3K9OB 3KVFB 3N3KB 3SHQA 4FBJB 1WXSA 1G6JA 3H9DA 2NBVB 2MSED 4W9GA 2DZIA 2C9WB 2KQ7A 2JZZA 2M1MA 2LXCA 5AEKB 4FHKA 3DBLI 2D10A 3APCA 1XT9B 4ICVA 3U7DA 2YVCA 3EHVA 1Q1OA 2LZ6A 3L10B 1SGHA 3L0WB 3GZNI 1OTRB 3Q3FA 2ZJDA 1Q0WB 2KWUB 3QQ8B 4URKA 3OLMD 4PS3A 3JW0X 2KOXA 3JYUA 3AU5A 4B6WA 3DBSA 2CHWA 2BYFA 3QAQA 4HJKA 2D3GA 1TGZB 2IY0B 3ZIMA 4EKUA 2MBBB 2C60A 2I1KA 3KYCD 4IWOA 4N9F4 4G3XB 4PYUA 3PVLA 3UGBB 4GDKA 1IP9A 2XEWA 4W9FA 3A1QA 2Z0DB 2RGFA 2REXA 3M63B 4I6NB 4II2B 4KDLB 3TCAA 3R7RA 4E3CA 2CR5A 5CHVC 2D11A 2JRIB 5E6OA 3EC8A 3NZUA 2UYZB 2KWCA 3EECA
chains in the Genus database with same CATH superfamily
1LO5D 1WX7A 1WZ3A 4MSQB 2J7QB 2ZVNA 3NVVA 4W9LA 2ASQA 2W9NA 3Q3JA 3ONSA 1ET9A 3IXSA 1I4GA 2L3ZA 1ZXHA 5G55A 3BYTB 1WX8A 1RM6C 5BMGA 4FADA 1H8CA 3AN1A 4K81A 1D3ZA 4YTNB 1PDXA 1CZPA 3N32A 2DAJA 2LVQA 2LGXA 4IUMB 1T5XD 2L00B 2PW9A 3ZYYX 2DZJA 4XYCA 1UGMA 4MM3A 1V1PB 2O2VA 1UBIA 4NJCA 2FCSA 3I9V1 3QK0A 3MC0B 4MDKE 1WI0A 2KMAA 5HFYA 2K1FA 4KDIC 4HK2A 4IW0A 1J0GA 1H4RA 1LM8B 3FILA 4KKIA 1SF0A 3VAWA 1UGJA 2JYTA 2WYQA 1TKGA 2KDIA 5IN7A 4NQLB 2B76B 4M0WB 3OJ4B 1ZW7A 3W1YA 5G5HA 1V1OA 3WAMA 1WYGA 1F1HA 3EUB2 1ZDXA 1YQ4B 3PREA 2MW5A 1FNVA 4AS1A 2ZVOA 2BWFA 2IY1B 4GOCA 2MH7A 3X0WA 3ZTDA 4HCNB 3BY4B 4HKQA 4KZ0A 1JRUA 4WURA 1RAXA 2WP9B 3UQAA 1XCTL 4BBNF 3WA0A 2KDFB 2WS3B 4ANXA 4NQKE 2PJHA 3B08A 2KD0A 3N1ZC 5D94A 3T9LA 3I3TB 4US9A 2KLGA 3L13A 4NAMA 3AEEB 1VD2A 4TMAB 4A8XC 1CMXB 2ON8A 3CIRB 1BT0A 5AZFA 1TBEA 2Y5BB 4YWGG 3AEBB 4IM2A 2N9KA 1NYQA 3CMMB 2DWQA 1TS2A 2Y3AA 1V49A 4ANUA 2KKCA 1VLBA 2BPSA 3O65B 5BO4B 2WXIA 2WWZA 1S1QB 3VVWB 1PGBA 4W9KA 2FCQA 2LXAA 3H1UA 3TSSA 3MC9A 3H8HA 3KQ4A 3VUXA 1VZ8A 3UI3A 3ZVVA 2JWUA 2AYOB 1WH3A 5G2NA 2ONQA 3QARA 1YD8U 2WQYB 2V3SA 3DDCB 5EE0A 1YNTE 3RNCC 3ZNID 2BYEA 2N1VA 4YTMB 2GB1A 2G4SA 1WE6A 2E6XA 2BTEA 3U30A 1NVID 2IYDB 2VZKD 3X23A 4MGIE 3PGEA 3TJPA 3ZO5B 3RUIB 1BXTA 2LHEA 2LD9A 2WXKA 3AH7A 1E7UA 2J0MA 2VH1A 3QX1A 1CJEA 3AM9A 2LGIA 1JWSD 4LNNA 4L23A 2WXOA 3PS6A 5IO9A 2IBIB 2QEJC 1HZ5A 1HXYD 4ITKA 3HHMA 2N9XA 2ZW1A 1YJJA 3TIXA 3DQVA 3UINB 1GNUA 2KX3A 1SJED 3AE9B 2BS3B 2KMMA 3R3MA 2C7NB 3RFZB 3AEGB 4AJWA 1OEYJ 2V3NA 1EF5A 4RF1A 1K53A 2WXFA 4EEWA 1T3QA 3MJ5A 2Y5PA 2LASA 4RGNA 4I6LB 4GU2A 1RRBA 3RULA 4LCDE 2CS4A 1F77A 2JZ3B 1JRPA 4MJSA 1OGWA 4LDTB 3RNAC 4L1BA 3RD2A 1TYGB 1TS5A 2D07B 1MVKA 3DHIC 5JZEB 2CU3A 1QKZA 4X57B 3MP9A 3D32A 1QOBA 5CTRC 1MG8A 1IPGA 4FJYA 2K8HA 1WGHA 3VQIA 1WSPA 2M8SA 3IFWB 1WGRA 4OVUA 1WM3A 1P0RA 2FIFA 5C1ZA 3Q8EA 1VRAB 1AW7A 1WXVA 3NS1A 3NVZA 3FAHA 3DCGA 3RNEC 5BMHA 5L95C 2D2QA 4LDTD 1UWXA 5GMVA 4PT5A 4TUUA 1RFKA 1WGDA 2FE8A 1AYFA 1ZPSA 3A9KA 3H6NA 4KIKA 4EE2A 3FKYA 1IYFA 4G50A 3VTVA 1QOGA 4FLHA 4DDGD 2RDGA 3HM3A 5CX3A 3KWVA 4BBNC 2K0PA 2LUEA 3VDZA 3HVZA 3CWIA 4A90A 1MG4A 4W9CA 3EGRA 1N60A 4REZA 2LJ5A 4TV3A 3W1SA 1M4VA 1P7FA 4W9EA 1IBXB 1GB4A 1N6ZA 1STEA 2LGSA 2NPTA 1FXTB 4P6VF 3SU8X 4GMVA 1WY8A 2WDQB 4B9KA 1C4PA 1L6VA 2N9PC 3TUOA 2WLBA 3TEYA 4HVBA 3RI7C 1L0XB 2G4DB 3H7PB 3TEXA 1XF5L 2M17A 3W9CB 1C1YB 4PK1A 2LVPA 2WDVB 3E56A 3JSVB 3L16A 3IAM1 4XZ4A 1GAQB 3PZ8A 4JGHB 4NY0A 5J18A 2JUOA 3KVFB 3N3KB 1G6JA 1C77A 2DZIA 2C9WB 2L32A 2H88B 4P1CC 2LZ6A 1SGHA 5IOIA 3L0WB 1OTRB 2QJLA 3C8YA 1UUPA 5FK9C 2W3RA 4PS3A 4C00A 3LXFA 2KOXA 3AU5A 3DBSA 2CHWA 2BYFA 3NZ3A 2D3GA 4KKJA 3EA6A 3ZIMA 2G1EA 3KYCD 1F2RI 1EWYC 4GDKA 2IPKD 2PKOA 1VR9A 2K5PA 3M63B 4II2B 4QAYA 3TCAA 3ZJVA 5E6OA 2BB5A 3NZUA 3KUCB 2TSSA 2MJ3A 4C80A 3JVZX 2ZPNA 2ZCCA 2JU6X 4BOSC 3QCAA 4MT5A 1V8CA 3RZFA 4C4VB 3ZNHB 3VTUA 1KLGD 3P4QB 3PHXB 1JWAD 2NTSA 2INDC 2D3CA 2LGDA 3NVYA 1A70A 1M94A 3VTWA 4ZYNA 3AV8A 1FXAA 4MGZE 3U2SC 4GB9A 3ZDMC 1V1PA 2D3BA 4MH0E 2BKFA 2KDBA 2HD5B 3RCZA 5KHQA 2V1YA 5EDSA 2BGFA 3NY5A 1ACCA 4CO7A 2KC2A 1V80A 4AQ7A 1X1MA 2QSDA 2QC8A 1I4XA 3HVDA 1V81A 1D5ZC 4M0WA 2X8XX 2MWSB 1FCCC 4NPNA 3A33B 3DWMA 1WMHB 3AEDB 1YN5A 2BS2B 4WWMA 1TY2A 2MBEA 3Q3MC 4ANVA 4E74A 2INCC 4KX6B 1TZOA 2IO0B 2J53A 2RSUA 2WXPA 4P1BC 3N9YC 5DPRA 2MQJA 2WU2B 2HJ8A 3RMKC 2OOBB 1N5XA 3AEAB 4II3B 5HI1A 4WWPA 3NOBA 1C79A 3BVZA 2PPHA 2SEBD 4WH4A 2KO3A 2MBOA 1Z2MA 5C2TB 1FCLA 3IG3A 1YQ3B 2IO1B 3CSTA 4YXDB 1BUIC 2WXQA 4N59A 1EU4A 1FMAD 4JX1C 1KTKA 1GOZA 1I35A 1R4MI 4NAWB 3ZW3A 4NZLB 1V6EA 3LB8C 4HEA1 1TY0A 1JALA 2LVOA 2JZPA 4WJOA 4J3OD 4JE3B 1FPYA 2HDEA 3ZTCA 2WXMA 3KW5B 2CHZA 1FNUA 4WIPA 4XE0A 2XNAC 4ZRJA 4M02A 2ZNVC 3BVGA 3C19A 2Y5CA 1UELA 2FCNA 3P4RB 3AULA 1FM0D 4FA6A 2JXTA 2KJHB 3QJZA 4DK5A 1WJNA 4DHJB 2MP2B 1UWMA 1LXDA 2DX5B 3Q6BA 4NJ7A 1E90A 5KHOA 1WR1A 4K7WA 4Q2JA 2VH2A 2X38A 1SJHD 5LLIA 4AUQC 5DPWA 2GBKA 1N62A 3Q8FA 1QILA 3CF6E 1L5PA 2KWDA 3KUZA 2KVRA 2VRRB 4TSSA 2IZVB 4GXBA 5L83A 3PLVA 3W1SC 1OQYA 4JL9A 3L4PA 3ZXVA 2M56B 3L54A 1KM7A 1SIFA 2K22A 3N30A 1QLBB 4DHJD 3K9PB 4FULA 1QT9A 1UNSA 4JIOU 1PGXA 1VZ6A 2KACA 2V4LA 5H8YE 4B95A 2KTRB 4DXAB 3L08A 1SE3A 2N9LA 4B0EA 4LNOA 1R4MB 5E6PA 2N9EB 4PS8A 2V9HA 1P7EA 3DHHC 3VR9B 4KVGB 2A5UA 2W55A 5FR6A 1QF6A 2W54A 3ZUNA 4YSZB 4LNIA 4MH8A 1ISNA 4XWWA 1FO4A 2BF8B 3W5UB 3ZDTA 4MSMB 3VH3B 1JW9D 4AP4C 1FIQA 2BVCA 1E6EB 3BYYB 2JRHA 5CHFA 3RZWC 1YJ1A 2OHFA 3QIJA 3WAOA 3P42A 2EKEC 1V5TA 3A4RA 1MJDA 5C3JB 1HQRD 3DOWA 3T8MA 1I4QA 3TEWA 3V61A 4WQOB 3NHEB 3B0AA 1HTOA 1MHXA 2JF5A 3RPFC 1AARA 3A1QB 4WJPA 3ZKJC 3GP7A 2KT7A 2DNFA 3L17A 4LNFA 4HPLB 4OVZA 1WXMA 2AQ1B 3LJ3A 1ZGUB 3AE8B 4G0NB 1GPXA 1WXAA 5EE3A 2R61A 3N20C 1V9JA 4IC7B 2HTHA 4YL8A 3ABVB 2K9XA 1K8RB 2V3PA 2N7DA 2JX5A 2AEHA 2DAFA 1WZ0A 4IWPA 3N1XC 3BK2A 4YSYB 2LMCA 4M01A 3SEBA 2KDMA 3AE4B 4BOZB 5BYQA 1ENFA 4D2KA 2D5GA 4FJVB 3FC4A 1DOYA 1JWUD 1ESFA 3VFKA 2KFJA 3OG5A 3H7PA 1LGRA 1NEKB 2BQQA 4K1RB 3MTNB 3ZXRA 1GUAB 3JSVA 1YX5B 4S0RA 1FFVA 1SB3C 3GB1A 1T6BX 2IGHA 4M8NA 2RMMA 1LQBA 1EO6A 4W9DA 3ZNGC 1LFDA 4YSXB 1NI2A 2FIDA 2J4XA 4A3PA 2DYMA 2K8CA 4GSWA 2I38A 3HUIA 4M00A 4YTPB 4ICVA 1XT9B 3Q3NC 2YVCA 3L10B 3GZNI 2ZJDA 4CQNA 3OLMD 1TJEA 3JW0X 1KH0A 3JYUA 4HPPA 3RNBC 2MBBB 3W2DA 2I1KA 4IWOA 1OQRA 1YMHE 4PYUA 1IP9A 2XEWA 2REXA 2WXLA 4I6NB 4XDDA 3R7RA 2CR5A 2D11A 4EZJA 2UYZB 3DVNV 2KWCA 1BMLC 2LEKA 3IVFA 3ECIA 1K50A 1XQQA 1I7HA 2DLBA 2BKRB 4C4VA 2QDFA 4F7ZA 5D2MB 5FR3A 3DVGX 2N1WA 2QCZA 1FRRA 4ZRQA 2GBJA 1RWSA 2D3AA 4JQWC 1UD7A 2MLBA 2NCNA 1EM7A 2JQRB 4M8MA 3A9JB 1HEZE 1Y56A 1L4DB 3PZ7A 2N7JA 2WXHA 4BKTA 1F9JA 1Y8RC 3A4SC 3R7QA 1NDDA 2CU1A 2L83A 4ZRIA 5IKCM 4PS7A 4DWFA 5E6JA 2QHOA 2AL3A 2JPHA 2K3UA 1EF1A 4KSLC 2HTME 4BAXA 3CSFA 1L2NA 2KFKB 1WMHA 1NENB 4HXDA 3TL5A 1C76A 2WX0A 3PHWB 1WYWB 1T0SC 1VDVA 2WDRB 3GZNB 4DQOC 1J7AA 3P2BA 1IUEA 4N58A 4ICUA 4HRSA 2XK5B 3AMZA 3AI5A 3M62B 2DZMA 2WU5B 4IM0A 3AEFB 1WRIA 2L76A 1WR6E 2WDTB 2KTFA 4ARCA 1DOIA 4MEMA 3PRMB 3V62A 1NBFC 3PSEB 2MA9B 2R2OA 4KV2A 2KJ6A 1FD6A 2DENB 3Q8AA 4G11A 4XC2A 1E8WA 3RYTA 2C7HA 3KH0A 2O6VB 3QC8B 3NJTA 2NBWB 3VXWA 5J2RA 1L6UA 1YX6B 3B1LX 4OZCA 2L05A 3IHPC 1YN4A 4GN1A 3U8ZA 4RF0A 4MGKE 2V4IB 4AWJA 4NAWA 4OW0A 5LXHA 1D4BA 2MJEA 4HLEA 4HROA 5CHWA 4ASWC 1D5XC 4JWUC 2PE9A 3VH4B 1PQSA 2ICIA 4W9HA 4RMAA 3R66C 3VUWA 2J52A 4MJSB 1XLOA 2M19A 3ZJTA 1DOXA 1KJTA 4OZBA 2XN9C 3DVNU 2HJ1A 3ML9A 4K7UA 1YIWA 1E10A 3BIID 3VRBB 4BKGA 4DDID 1RYJA 1UF0A 5IA7A 3DWGC 1WJ4A 3I63C 4BFRA 2K6DB 3UF8A 4C7YA 2LRWA 2MP2A 4NJ6A 5AUIA 3VUYA 1FEHA 2ZW0A 1ZKHA 2CJOA 2WXRA 3PRZA 2RDBC 1NYRA 2L0FA 3QHTA 3V6CB 1WGGA 1SE9A 4JLCA 1P1AA 4LJPB 3RNFC 3R2TA 1V86A 3KUDB 4IKGA 5JH5C 1KRHA 1VCBA 2PMVA 4A3OA 2AQ2B 1ROEA 2JSVX 1ZXIA 3SFEB 1YJIA 4LLGM 1TTNA 4RNAA 1C78A 3DVGY 3BINA 4TQ1A 4N6EB 2GMIC 1E5WA 2YLMA 4OVVA 2XBBC 2KTRA 3Q14C 2A4ZA 1WIAA 3ZNZB 1AN8A 1R7SA 2WNMA 3Q69A 2Z59B 3APFA 4ZDVA 1JQ4A 2KDEB 2I1JA 4RCOA 2W82A 2ACZB 2DHZA 1I42A 4ARIA 2W3SA 3WCQA 4W9JA 4EZKA 2GOWA 2HE7A 3HK0A 4OHJA 1SEBD 5TR5A 2ZPYA 2Z0EB 3NRZA 1HE8A 5D3DA 3AE5B 1SE4A 4IDIA 1TIFA 1XCQL 1XEEA 1WGYA 1XD3B 4WJNA 3NG0A 2B3AA 2NTTA 1E0ZA 4LK0M 1JCKB 2H89B 3ZRCA 4TKNA 1L0VB 3TBLD 1QQRA 2KLCA 4GDLB 3MHSD 4MGYE 4O1NA 1TS3A 4KSKC 4WAAA 1HZ6A 1E7VA 2M4NA 5J17A 4P7IA 1KLUD 4EFOA 1SXTA 1E8XA 4WWOA 1WM2A 3URYA 5MPOA 2INPE 2NR2A 3V6EB 1NI3A 2RPQA 2WHIA 1K51A 2UWQA 3ML8A 4GDKB 1E7PB 4DHZB 2N7EA 3SR6A 1F0ZA 4KGTA 1MFWA 2EMSA 4HWIB 3V3XA 1S3SG 5AUKA 3M3JA 1UZXB 2FUHB 4J6IA 2L52A 1C9FA 4MACA 2I2YA 2G3QB 2AX5A 1RLFA 1P98A 4DXFA 1GG3A 2CHXA 4K7SA 4USAA 4UDUC 2PVGC 4HJGE 1WWTA 3TEZA 5AZGA 2BYTA 4GLSC 2R2QA 2KJRA 5BMIA 1A5RA 1Q10A 1FFUA 4E71A 2FAZA 2MBQA 2MCNB 2FUG1 2K25A 2LHDA 2DYOA 3AE2B 3OWEB 4PYZA 3O13A 1OQQA 2G9HD 1SE2A 4P16A 5DPSA 4ZHPA 1DYQA 3WIMA 2FBWB 3HRDD 2PIAA 5HHDG 3WANA 4A20A 3IT4B 3HM6X 5H92C 1ZOYB 2IO3B 5FKAC 2GRIA 5D3IB 1P3QU 1MPEA 4A9AA 2WXNA 5DCNA 2LWPA 4IOIE 1IGCA 4HKZE 1F2RC 4I6PA 5D6JB 2AQ3B 1WFYA 3IBEA 1U4AA 4EOYA 1ET6A 3KWLA 4F8CB 5JHAA 5BYSA 2BWES 4H2AA 3PPAA 4RFBA 2LI5A 3ZGZA 1JWMD 1QOAA 4FBJB 3SHQA 2NBVB 4L2YA 5G5GA 2KQ7A 1K52A 2M1MA 1N61A 3DBLI 1VJKA 3APCA 3EHVA 1Q1OA 3T3NA 2RDHA 2WXGA 3Q3FA 1Q0WB 2KWUB 3MFGA 4B6WA 1FXIA 3QAQA 3R2IA 1JROA 4HJKA 1TGZB 3AE6B 4ZYSA 4N9F4 4DXGA 3DHGC 1L0YB 4BZAA 3PVLA 3UGBB 2RGFA 3BK1A 4KDLB 2NMQA 5CHVC 3EECA 2JT4B 2YEPF 1YN3A 2VZKB 3WALA 4JPSA 1L7YA 1CK1A 3HIZA 1HA5A 4TQ0A 2ZEQA 1WJ6A 3A9JA 4XWTA 3OJ3A 4ANWA 2M0XA 2JXXA 4WJQA 2N4FA 3APDA 5JXVA 4MELA 1WX9A 2J0JA 3BWUD 4C7ZA 5T8IA 2IO2B 1J7BA 3PLUA 3NVWA 1KLVA 1B1ZA 2KWVB 2QILA 1WRDB 2QIEB 1PYWD 3EFCA 2PTLA 1CQVA 2M0AA 1IBXA 1TZ1A 2KQSA 1SSNA 2KYWA 3U7ZA 3GE8C 3I5JC 4RGTA 2C5LC 2KFKA 3V05A 2IDYA 5BYRA 3LDZE 2PLPA 5HG2A 4ZOHC 4XX5A 1MHHE 3PZDA 4CHKA 4A55A 3AU4A 2XK5A 3N1YC 2LJIA 4HDQA 4MM3B 2L1AA 2O2VB 2DZKA 3ALBA 1P9DU 3DBLB 5HKHA 3U4EG 4CYEA 2YEPB 4IWQA 3SFDB 3E9SA 5E6NA 1QZEA 1WXQA 3FILB 3AE7B 5GXGB 3GS2A 1XLPA 4B0MA 1N5WA 4NNJB 3UIPB 3B9JA 5LXIB 3DBRI 2JVCA 4OZAA 2NVUI 2O6VA 1V5OA 4RM8A 4FHJA 1JWBD 2KC1A 4K3CA 2PVOD 4WWNA 3P4PB 1ZP0B 2WGSA 4AOFA 1T0QC 1FNWA 3KLSX 2KN5A 1WJUA 4ZRPA 3VHTC 2IGGA 4W9IA 3BZDB 3QWZB 1D6EC 2K39A 4BKSA 2E3TA 1L4ZB 3Q2AC 4RGMA 1EU3A 3AE1B 3MC8A 2DBYA 2BS4B 2EELA 2MEKA 1C3TA 5IAAC 3VRAB 2JY6A 1UBQA 3LYYA 3ZQ4A 3ENEA 2DYBA 1F52A 1YOVB 1J8CA 1J19A 2GLSA 2BW2A 2PEAA 1OEYA 3W5VB 1T0RC 4US8A 1RFAA 2RPVA 2L8JA 1TS4A 2FCMA 3DPDA 4FJZA 1E8YA 5EE9A 2MBHA 1FRDA 4RM9A 1KOTA 3QA8A 3TMPB 1EWCA 2LFIA 4HDOA 5C23A 1WF9A 1V97A 3R8BA 2EMTA 2K6QA 4HCPB 4RH6A 3BVMA 2MHJA 2K8BA 4DHZE 5LNK1 4JWSC 2J42A 2KXJA 2KMCA 1R4NI 2KVZA 3DBRB 1ZUD2 3WAPA 2RD0A 3KYDD 3AXCA 3ZJUA 4R3DA 1PUTA 4BVUC 1DGJA 1MI0A 1T0YA 1WGKA 1C4AA 4EUTA 2KK8A 1I4HA 3IT6B 3NS8A 3NZSA 3RT3B 3OAWA 2GBNA 1ZDVA 3DBHI 4HPMB 2KANA 4LNKA 3PO0A 4KZCA 3ZRFA 3AB5A 3M95A 5JHBA 1TKEA 3Q8BA 3UQBA 1XLQA 4YT0B 2AL6A 3MHZA 4S17A 3PT2B 1ZE3D 2KN4A 2LGYA 1PFDA 4F1SA 1TKYA 1GC6A 4WAFA 1SIJA 1C4CA 4AJYB 1I4RA 2INNE 2KAJA 2IJ0A 3PV1A 3GOEA 4GDLA 2ZZPB 2L0TA 2KZRA 4XDCA 2BB6A 3P4SB 2CJNA 2CKHB 3ETRA 4WQMA 4LTUA 3EFUA 2KNBA 4DBGA 2MJDA 3ZLZA 1IGDA 3S2AA 2OJRA 1KF6B 1UH6A 1YQBA 2MRPA 2O6VD 3J9CA 1V2YA 1R4NB 2NS5A 3NUHB 3PRPB 2GBRA 2NBUA 1E9MA 3C0RB 1VZ7A 4KGSA 2BBCA 5IP4D 2ZNVB 1QOFA 1E8ZA 4GGQA 3Q8CA 2AWTA 3T3OA 3AE3B 4XGAB 3PTFC 3RN9C 1OFFA 4GIVA 2KX0A 1XO3A 5EE1A 2Q5WD 4BKSD 1KFYB 3B2GA 3B2FA 2RR9A 1PGAA 2C7MB 2L7RA 3SDLC 3DBHB 2N0SB 3GE3C 3U52E 3H7SA 3AECB 1XXGA 3A9KB 4KIKB 5DPTA 2PE6B 3IAS1 1AWDA 1Z5SB 1GC7A 1WE7A 4FN2A 5TSSA 5I4DA 3SD5A 1XLNA 3P63A 3UIOB 1JMLA 2MX2A 2J0KA 4A6QA 3V60A 4RGOS 3MJWA 2QMTA 1SBBB 2G45B 4LJOB 2LRUA 4IM3A 2Z8LA 4IG7B 4FXCA 2JWZA 4KGRA 2BYVE 2KHWB 5AZHA 1D5MC 1EUVB 1TT5B 2UU7A 2NPTB 2ZCBA 1Q5WB 4C56C 1N63A 2BT6A 2FNJB 2GI9A 4EZLA 2OEDA 2OJWA 5D7GA 2V0GA 2WXJA 1B9RA 4ZHOA 4K3BA 2WX1A 4ZRKA 2JYEA 1I4PA 4ACFA 1J7CA 2GBMA 3K9OB 1WXSA 3H9DA 2MSED 1HTQA 4W9GA 3RNGC 3VR8B 2JZZA 5AEKB 2LXCA 4FHKA 2LUMA 2D10A 3U7DA 2KQ4X 3P1MA 3QQ8B 4URKA 2IGDA 2IY0B 1GB1A 4EKUA 2C60A 4G3XB 2EKIA 4W9FA 3A1QA 2Z0DB 4E3CA 2JRIB 2SAKA 3I57A 3EC8A 3Q3OC 1GJZA
chains in the Genus database with same CATH topology
1WX7A 1WZ3A 2JT4B 3IVFA 4MSQB 2J7QB 3ECIA 1XQQA 2ZVNA 2BKRB 3JVZX 2ZPNA 4F7ZA 2ZCCA 4W9LA 2ASQA 3WALA 1L7YA 2W9NA 3Q3JA 3HIZA 4TQ0A 3ONSA 2ZEQA 1WJ6A 5D2MB 4BOSC 3QCAA 3A9JA 3RZFA 3DVGX 3OJ3A 4ANWA 2M0XA 2JXXA 2N1WA 4WJQA 3ZNHB 2N4FA 3VTUA 2GBJA 2L3ZA 3APDA 4MELA 3PHXB 4JQWC 5G55A 1WX9A 2J0JA 1UD7A 1WX8A 2MLBA 2NCNA 4M8MA 2IO2B 3A9JB 2LGDA 3PLUA 4FADA 1H8CA 1M94A 4K81A 3VTWA 4ZYNA 1D3ZA 1KLVA 4MGZE 3N32A 4BKTA 2KWVB 1WRDB 2DAJA 1F9JA 4GB9A 2LVQA 1Y8RC 3A4SC 3ZDMC 3R7QA 2LGXA 1NDDA 2CU1A 4IUMB 4MH0E 2BKFA 1TZ1A 2KDBA 2HD5B 2KQSA 4ZRIA 3RCZA 5KHQA 4PS7A 2V1YA 5EDSA 2C5LC 2BGFA 2KFKA 4DWFA 2L00B 3NY5A 2QHOA 2DZJA 2AL3A 2JPHA 4CO7A 1UGMA 2KC2A 1EF1A 3LDZE 4KSLC 4MM3A 1V80A 2O2VA 1UBIA 1X1MA 4XX5A 2FCSA 3PZDA 3QK0A 3CSFA 4CHKA 1L2NA 4MDKE 1WI0A 2KFKB 1WMHA 2KMAA 4HXDA 3AU4A 3TL5A 1V81A 2XK5A 4HDQA 2K1FA 4KDIC 4HK2A 2O2VB 2DZKA 3ALBA 4IW0A 1J0GA 1H4RA 1P9DU 5HKHA 1LM8B 2MWSB 2WX0A 3PHWB 4NPNA 3A33B 1WYWB 4CYEA 1WMHB 3VAWA 3P2BA 2WYQA 4IWQA 4ICUA 2XK5B 2KDIA 3M62B 3AI5A 4NQLB 3DVNV 5E6NA 1QZEA 4M0WB 2DZMA 4IM0A 3OJ4B 2MBEA 1ZW7A 3W1YA 2L76A 4ANVA 1WR6E 3WAMA 2WDTB 4E74A 2KTFA 4NNJB 4MEMA 3PRMB 2IO0B 2RSUA 3UIPB 5LXIB 3DBRI 3PREA 2JVCA 2MW5A 2NVUI 3V62A 1NBFC 1V5OA 2O6VA 5DPRA 2MQJA 3PSEB 2MA9B 2R2OA 4KV2A 4RM8A 2HJ8A 2BWFA 2DENB 2IY1B 2KJ6A 2ZVOA 4FHJA 2KC1A 4GOCA 4G11A 4WWNA 2OOBB 4XC2A 3X0WA 1E8WA 3RYTA 2C7HA 3ZTDA 4AOFA 4HCNB 3BY4B 2O6VB 3KH0A 3QC8B 2KN5A 4II3B 4KZ0A 1JRUA 1WJUA 1RAXA 2NBWB 3VXWA 5J2RA 4WWPA 3NOBA 3VHTC 3UQAA 2PPHA 4BBNF 1YX6B 3B1LX 3WA0A 2L05A 4W9IA 2KO3A 3IHPC 3QWZB 2KDFB 4ANXA 4NQKE 4GN1A 2MBOA 3U8ZA 2PJHA 1Z2MA 2K39A 3B08A 4BKSA 2KD0A 4MGKE 5D94A 3T9LA 3I3TB 3IG3A 2IO1B 2KLGA 3CSTA 3L13A 4NAWA 4AWJA 5LXHA 4HLEA 5CHWA 1VD2A 4ASWC 1CMXB 2PE9A 3VH4B 1PQSA 4W9HA 1C3TA 4RMAA 5IAAC 1BT0A 3R66C 5AZFA 1TBEA 2JY6A 3VUWA 1UBQA 2Y5BB 1I35A 4MJSB 1R4MI 4NAWB 3ZW3A 1V6EA 3ENEA 4IM2A 2DYBA 1J8CA 1J19A 1KJTA 3CMMB 2LVOA 1V49A 3DVNU 4ANUA 3ML9A 2PEAA 1OEYA 4WJOA 4K7UA 2KKCA 1YIWA 3ZTCA 3O65B 2BPSA 5BO4B 3KW5B 2CHZA 2WWZA 1S1QB 3VVWB 1RFAA 4BKGA 2L8JA 4W9KA 4ZRJA 2ZNVC 2FCQA 2FCMA 3DPDA 2LXAA 3H1UA 4FJZA 4DDID 1E8YA 5IA7A 1WJ4A 2MBHA 4BFRA 2K6DB 3UF8A 2LRWA 2MP2A 4RM9A 1UELA 2FCNA 1KOTA 3QA8A 4NJ6A 3TMPB 3VUXA 3AULA 3VUYA 4FA6A 2KJHB 3ZVVA 3QJZA 4HDOA 5C23A 4DK5A 2AYOB 1WH3A 1WF9A 5G2NA 1WJNA 1ZKHA 4DHJB 2MP2B 2EMTA 2K6QA 3PRZA 1LXDA 3QARA 4HCPB 2DX5B 1YD8U 4NJ7A 2L0FA 3QHTA 1E90A 2V3SA 3DDCB 2K8BA 3V6CB 4DHZE 1WGGA 3ZNID 5KHOA 1WR1A 4K7WA 2BYEA 2N1VA 2G4SA 1WE6A 1SE9A 4JLCA 1P1AA 4LJPB 3U30A 2IYDB 5LLIA 4MGIE 3X23A 2KXJA 3PGEA 3TJPA 2KMCA 1R4NI 1V86A 3WAPA 3KUDB 2GBKA 3ZO5B 4AUQC 5JH5C 5DPWA 3RUIB 2RD0A 1VCBA 4A3OA 2LD9A 3KYDD 3CF6E 1E7UA 3AXCA 2J0MA 3KUZA 2KVRA 2VRRB 2IZVB 4GXBA 1TTNA 3QX1A 4BVUC 5L83A 3PLVA 3W1SC 3DVGY 1OQYA 1T0YA 4JL9A 3BINA 4EUTA 2KK8A 3NS8A 4TQ1A 3NZSA 2GMIC 1E5WA 2YLMA 4OVVA 3L54A 3RT3B 3OAWA 1KM7A 2XBBC 2GBNA 1SIFA 2KTRA 2A4ZA 3N30A 1WIAA 3DBHI 3PS6A 3ZNZB 2IBIB 4HPMB 2KANA 4DHJD 2Z59B 3APFA 3HHMA 2N9XA 3K9PB 4FULA 4ZDVA 3TIXA 4KZCA 4JIOU 3ZRFA 3M95A 2V4LA 3DQVA 5JHBA 3UINB 1GNUA 4B95A 2KDEB 3UQBA 2KTRB 4DXAB 2KX3A 2I1JA 3L08A 4EZJA 3R3MA 2AL6A 2C7NB 2DHZA 5E6PA 1I42A 2N9EB 4PS8A 3PT2B 2LGYA 4KVGB 4F1SA 4AJWA 2A5UA 5FR6A 1GC6A 1OEYJ 1EF5A 4W9JA 4EEWA 3ZUNA 4EZKA 2LASA 2GOWA 2HE7A 3HK0A 4I6LB 4GU2A 4AJYB 5TR5A 2ZPYA 1ISNA 1RRBA 2Z0EB 3RULA 2BF8B 1HE8A 4LCDE 3ZDTA 2CS4A 3PV1A 2JZ3B 3GOEA 4MJSA 1OGWA 4LDTB 4MSMB 4GDLA 3RD2A 2D07B 2ZZPB 3VH3B 2L0TA 2KZRA 4AP4C 1WGYA 1XD3B 4WJNA 2B3AA 2CKHB 5JZEB 3ZRCA 4TKNA 2JRHA 5CHFA 3EFUA 3TBLD 2KLCA 4GDLB 3RZWC 4X57B 3MHSD 1YJ1A 3QIJA 4MGYE 3WAOA 2KNBA 4DBGA 3D32A 2EKEC 4KSKC 1V5TA 3ZLZA 3A4RA 4WAAA 1E7VA 2M4NA 5J17A 4P7IA 3S2AA 4EFOA 2OJRA 5CTRC 1E8XA 3DOWA 3T8MA 4WWOA 1MG8A 1IPGA 1WM2A 1UH6A 4FJYA 2K8HA 1YQBA 1WGHA 2NR2A 3V61A 4WQOB 3V6EB 2MRPA 2O6VD 3VQIA 2M8SA 3IFWB 2RPQA 1V2YA 3B0AA 1WGRA 3NHEB 2NS5A 4OVUA 1WM3A 2UWQA 1P0RA 3ML8A 4GDKB 2FIFA 2GBRA 2JF5A 3PRPB 2NBUA 2N7EA 4DHZB 1AARA 3A1QB 5C1ZA 4WJPA 3ZKJC 3C0RB 1WXVA 4HWIB 2EMSA 2ZNVB 3DCGA 1E8ZA 4GGQA 1S3SG 2AWTA 3L17A 3M3JA 1UZXB 2FUHB 4HPLB 5L95C 2D2QA 1WXMA 4LDTD 4J6IA 5GMVA 3PTFC 4TUUA 2G3QB 3LJ3A 4GIVA 1RLFA 2KX0A 1P98A 1WGDA 1ZGUB 4BKSD 4G0NB 3A9KA 2RR9A 1WXAA 3H6NA 4KIKA 1GG3A 2C7MB 2L7RA 2CHXA 4IC7B 3SDLC 1V9JA 1IYFA 1GJZA 2HTHA 4G50A 4K7SA 4YL8A 1K8RB 3VTVA 2N7DA 3H7SA 4FLHA 3A9KB 2AEHA 2DAFA 5AZGA 1WZ0A 4KIKB 4DDGD 4IWPA 5DPTA 2PE6B 2R2QA 2KJRA 3HM3A 5CX3A 4BBNC 1A5RA 2LUEA 1Z5SB 3VDZA 4E71A 2FAZA 2MBQA 2MCNB 1GC7A 1WE7A 4FN2A 2K25A 4BOZB 2DYOA 3SD5A 4W9CA 4PYZA 2LJ5A 4TV3A 3UIOB 3W1SA 4FJVB 2MX2A 2J0KA 5DPSA 4W9EA 3V60A 3MJWA 3WIMA 3VFKA 2KFJA 2G45B 4LJOB 2NPTA 1FXTB 2LRUA 3WANA 4IM3A 4IG7B 3SU8X 2JWZA 4A20A 4GMVA 3HM6X 1WY8A 2BYVE 2KHWB 2IO3B 5AZHA 1P3QU 1EUVB 4B9KA 3H7PA 2NPTB 2ZCBA 2N9PC 1Q5WB 5DCNA 2LWPA 4K1RB 3MTNB 1GUAB 4HVBA 3JSVA 1YX5B 4I6PA 2G4DB 5D6JB 3H7PB 2FNJB 4EZLA 4M8NA 5D7GA 1WFYA 3IBEA 1LQBA 1EO6A 1U4AA 2M17A 4W9DA 4EOYA 3ZNGC 1C1YB 1LFDA 4F8CB 2LVPA 5JHAA 3JSVB 3L16A 1NI2A 2BWES 4XZ4A 2FIDA 2WX1A 4ZRKA 3KUCB 3PPAA 4A3PA 2DYMA 4JGHB 4NY0A 2K8CA 2LI5A 4GSWA 5J18A 2JUOA 2GBMA 3K9OB 3KVFB 3N3KB 3SHQA 4FBJB 1WXSA 1G6JA 3H9DA 2NBVB 2MSED 4W9GA 2DZIA 2C9WB 2KQ7A 2JZZA 2M1MA 2LXCA 5AEKB 4FHKA 3DBLI 2D10A 3APCA 1XT9B 4ICVA 3U7DA 2YVCA 3EHVA 1Q1OA 2LZ6A 3L10B 1SGHA 3L0WB 3GZNI 1OTRB 3Q3FA 2ZJDA 1Q0WB 2KWUB 3QQ8B 4URKA 3OLMD 4PS3A 3JW0X 2KOXA 3JYUA 3AU5A 4B6WA 3DBSA 2CHWA 2BYFA 3QAQA 4HJKA 2D3GA 1TGZB 2IY0B 3ZIMA 4EKUA 2MBBB 2C60A 2I1KA 3KYCD 4IWOA 4N9F4 4G3XB 4PYUA 3PVLA 3UGBB 4GDKA 1IP9A 2XEWA 4W9FA 3A1QA 2Z0DB 2RGFA 2REXA 3M63B 4I6NB 4II2B 4KDLB 3TCAA 3R7RA 4E3CA 2CR5A 5CHVC 2D11A 2JRIB 5E6OA 3EC8A 3NZUA 2UYZB 2KWCA 3EECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX7 A;  1WZ3 A;  2JT4 B;  3IVF A;  4MSQ B;  2J7Q B;  3ECI A;  1XQQ A;  2ZVN A;  2BKR B;  3JVZ X;  2ZPN A;  4F7Z A;  2ZCC A;  4W9L A;  2ASQ A;  3WAL A;  1L7Y A;  2W9N A;  3Q3J A;  3HIZ A;  4TQ0 A;  3ONS A;  2ZEQ A;  1WJ6 A;  5D2M B;  4BOS C;  3QCA A;  3A9J A;  3RZF A;  3DVG X;  3OJ3 A;  4ANW A;  2M0X A;  2JXX A;  2N1W A;  4WJQ A;  3ZNH B;  2N4F A;  3VTU A;  2GBJ A;  2L3Z A;  3APD A;  4MEL A;  3PHX B;  4JQW C;  5G55 A;  1WX9 A;  2J0J A;  1UD7 A;  1WX8 A;  2MLB A;  2NCN A;  4M8M A;  2IO2 B;  3A9J B;  2LGD A;  3PLU A;  4FAD A;  1H8C A;  1M94 A;  4K81 A;  3VTW A;  4ZYN A;  1D3Z A;  1KLV A;  4MGZ E;  3N32 A;  4BKT A;  2KWV B;  1WRD B;  2DAJ A;  1F9J A;  4GB9 A;  2LVQ A;  1Y8R C;  3A4S C;  3ZDM C;  3R7Q A;  2LGX A;  1NDD A;  2CU1 A;  4IUM B;  4MH0 E;  2BKF A;  1TZ1 A;  2KDB A;  2HD5 B;  2KQS A;  4ZRI A;  3RCZ A;  5KHQ A;  4PS7 A;  2V1Y A;  5EDS A;  2C5L C;  2BGF A;  2KFK A;  4DWF A;  2L00 B;  3NY5 A;  2QHO A;  2DZJ A;  2AL3 A;  2JPH A;  4CO7 A;  1UGM A;  2KC2 A;  1EF1 A;  3LDZ E;  4KSL C;  4MM3 A;  1V80 A;  2O2V A;  1UBI A;  1X1M A;  4XX5 A;  2FCS A;  3PZD A;  3QK0 A;  3CSF A;  4CHK A;  1L2N A;  4MDK E;  1WI0 A;  2KFK B;  1WMH A;  2KMA A;  4HXD A;  3AU4 A;  3TL5 A;  1V81 A;  2XK5 A;  4HDQ A;  2K1F A;  4KDI C;  4HK2 A;  2O2V B;  2DZK A;  3ALB A;  4IW0 A;  1J0G A;  1H4R A;  1P9D U;  5HKH A;  1LM8 B;  2MWS B;  2WX0 A;  3PHW B;  4NPN A;  3A33 B;  1WYW B;  4CYE A;  1WMH B;  3VAW A;  3P2B A;  2WYQ A;  4IWQ A;  4ICU A;  2XK5 B;  2KDI A;  3M62 B;  3AI5 A;  4NQL B;  3DVN V;  5E6N A;  1QZE A;  4M0W B;  2DZM A;  4IM0 A;  3OJ4 B;  2MBE A;  1ZW7 A;  3W1Y A;  2L76 A;  4ANV A;  1WR6 E;  3WAM A;  2WDT B;  4E74 A;  2KTF A;  4NNJ B;  4MEM A;  3PRM B;  2IO0 B;  2RSU A;  3UIP B;  5LXI B;  3DBR I;  3PRE A;  2JVC A;  2MW5 A;  2NVU I;  3V62 A;  1NBF C;  1V5O A;  2O6V A;  5DPR A;  2MQJ A;  3PSE B;  2MA9 B;  2R2O A;  4KV2 A;  4RM8 A;  2HJ8 A;  2BWF A;  2DEN B;  2IY1 B;  2KJ6 A;  2ZVO A;  4FHJ A;  2KC1 A;  4GOC A;  4G11 A;  4WWN A;  2OOB B;  4XC2 A;  3X0W A;  1E8W A;  3RYT A;  2C7H A;  3ZTD A;  4AOF A;  4HCN B;  3BY4 B;  2O6V B;  3KH0 A;  3QC8 B;  2KN5 A;  4II3 B;  4KZ0 A;  1JRU A;  1WJU A;  1RAX A;  2NBW B;  3VXW A;  5J2R A;  4WWP A;  3NOB A;  3VHT C;  3UQA A;  2PPH A;  4BBN F;  1YX6 B;  3B1L X;  3WA0 A;  2L05 A;  4W9I A;  2KO3 A;  3IHP C;  3QWZ B;  2KDF B;  4ANX A;  4NQK E;  4GN1 A;  2MBO A;  3U8Z A;  2PJH A;  1Z2M A;  2K39 A;  3B08 A;  4BKS A;  2KD0 A;  4MGK E;  5D94 A;  3T9L A;  3I3T B;  3IG3 A;  2IO1 B;  2KLG A;  3CST A;  3L13 A;  4NAW A;  4AWJ A;  5LXH A;  4HLE A;  5CHW A;  1VD2 A;  4ASW C;  1CMX B;  2PE9 A;  3VH4 B;  1PQS A;  4W9H A;  1C3T A;  4RMA A;  5IAA C;  1BT0 A;  3R66 C;  5AZF A;  1TBE A;  2JY6 A;  3VUW A;  1UBQ A;  2Y5B B;  1I35 A;  4MJS B;  1R4M I;  4NAW B;  3ZW3 A;  1V6E A;  3ENE A;  4IM2 A;  2DYB A;  1J8C A;  1J19 A;  1KJT A;  3CMM B;  2LVO A;  1V49 A;  3DVN U;  4ANU A;  3ML9 A;  2PEA A;  1OEY A;  4WJO A;  4K7U A;  2KKC A;  1YIW A;  3ZTC A;  3O65 B;  2BPS A;  5BO4 B;  3KW5 B;  2CHZ A;  2WWZ A;  1S1Q B;  3VVW B;  1RFA A;  4BKG A;  2L8J A;  4W9K A;  4ZRJ A;  2ZNV C;  2FCQ A;  2FCM A;  3DPD A;  2LXA A;  3H1U A;  4FJZ A;  4DDI D;  1E8Y A;  5IA7 A;  1WJ4 A;  2MBH A;  4BFR A;  2K6D B;  3UF8 A;  2LRW A;  2MP2 A;  4RM9 A;  1UEL A;  2FCN A;  1KOT A;  3QA8 A;  4NJ6 A;  3TMP B;  3VUX A;  3AUL A;  3VUY A;  4FA6 A;  2KJH B;  3ZVV A;  3QJZ A;  4HDO A;  5C23 A;  4DK5 A;  2AYO B;  1WH3 A;  1WF9 A;  5G2N A;  1WJN A;  1ZKH A;  4DHJ B;  2MP2 B;  2EMT A;  2K6Q A;  3PRZ A;  1LXD A;  3QAR A;  4HCP B;  2DX5 B;  1YD8 U;  4NJ7 A;  2L0F A;  3QHT A;  1E90 A;  2V3S A;  3DDC B;  2K8B A;  3V6C B;  4DHZ E;  1WGG A;  3ZNI D;  5KHO A;  1WR1 A;  4K7W A;  2BYE A;  2N1V A;  2G4S A;  1WE6 A;  1SE9 A;  4JLC A;  1P1A A;  4LJP B;  3U30 A;  2IYD B;  5LLI A;  4MGI E;  3X23 A;  2KXJ A;  3PGE A;  3TJP A;  2KMC A;  1R4N I;  1V86 A;  3WAP A;  3KUD B;  2GBK A;  3ZO5 B;  4AUQ C;  5JH5 C;  5DPW A;  3RUI B;  2RD0 A;  1VCB A;  4A3O A;  2LD9 A;  3KYD D;  3CF6 E;  1E7U A;  3AXC A;  2J0M A;  3KUZ A;  2KVR A;  2VRR B;  2IZV B;  4GXB A;  1TTN A;  3QX1 A;  4BVU C;  5L83 A;  3PLV A;  3W1S C;  3DVG Y;  1OQY A;  1T0Y A;  4JL9 A;  3BIN A;  4EUT A;  2KK8 A;  3NS8 A;  4TQ1 A;  3NZS A;  2GMI C;  1E5W A;  2YLM A;  4OVV A;  3L54 A;  3RT3 B;  3OAW A;  1KM7 A;  2XBB C;  2GBN A;  1SIF A;  2KTR A;  2A4Z A;  3N30 A;  1WIA A;  3DBH I;  3PS6 A;  3ZNZ B;  2IBI B;  4HPM B;  2KAN A;  4DHJ D;  2Z59 B;  3APF A;  3HHM A;  2N9X A;  3K9P B;  4FUL A;  4ZDV A;  3TIX A;  4KZC A;  4JIO U;  3ZRF A;  3M95 A;  2V4L A;  3DQV A;  5JHB A;  3UIN B;  1GNU A;  4B95 A;  2KDE B;  3UQB A;  2KTR B;  4DXA B;  2KX3 A;  2I1J A;  3L08 A;  4EZJ A;  3R3M A;  2AL6 A;  2C7N B;  2DHZ A;  5E6P A;  1I42 A;  2N9E B;  4PS8 A;  3PT2 B;  2LGY A;  4KVG B;  4F1S A;  4AJW A;  2A5U A;  5FR6 A;  1GC6 A;  1OEY J;  1EF5 A;  4W9J A;  4EEW A;  3ZUN A;  4EZK A;  2LAS A;  2GOW A;  2HE7 A;  3HK0 A;  4I6L B;  4GU2 A;  4AJY B;  5TR5 A;  2ZPY A;  1ISN A;  1RRB A;  2Z0E B;  3RUL A;  2BF8 B;  1HE8 A;  4LCD E;  3ZDT A;  2CS4 A;  3PV1 A;  2JZ3 B;  3GOE A;  4MJS A;  1OGW A;  4LDT B;  4MSM B;  4GDL A;  3RD2 A;  2D07 B;  2ZZP B;  3VH3 B;  2L0T A;  2KZR A;  4AP4 C;  1WGY A;  1XD3 B;  4WJN A;  2B3A A;  2CKH B;  5JZE B;  3ZRC A;  4TKN A;  2JRH A;  5CHF A;  3EFU A;  3TBL D;  2KLC A;  4GDL B;  3RZW C;  4X57 B;  3MHS D;  1YJ1 A;  3QIJ A;  4MGY E;  3WAO A;  2KNB A;  4DBG A;  3D32 A;  2EKE C;  4KSK C;  1V5T A;  3ZLZ A;  3A4R A;  4WAA A;  1E7V A;  2M4N A;  5J17 A;  4P7I A;  3S2A A;  4EFO A;  2OJR A;  5CTR C;  1E8X A;  3DOW A;  3T8M A;  4WWO A;  1MG8 A;  1IPG A;  1WM2 A;  1UH6 A;  4FJY A;  2K8H A;  1YQB A;  1WGH A;  2NR2 A;  3V61 A;  4WQO B;  3V6E B;  2MRP A;  2O6V D;  3VQI A;  2M8S A;  3IFW B;  2RPQ A;  1V2Y A;  3B0A A;  1WGR A;  3NHE B;  2NS5 A;  4OVU A;  1WM3 A;  2UWQ A;  1P0R A;  3ML8 A;  4GDK B;  2FIF A;  2GBR A;  2JF5 A;  3PRP B;  2NBU A;  2N7E A;  4DHZ B;  1AAR A;  3A1Q B;  5C1Z A;  4WJP A;  3ZKJ C;  3C0R B;  1WXV A;  4HWI B;  2EMS A;  2ZNV B;  3DCG A;  1E8Z A;  4GGQ A;  1S3S G;  2AWT A;  3L17 A;  3M3J A;  1UZX B;  2FUH B;  4HPL B;  5L95 C;  2D2Q A;  1WXM A;  4LDT D;  4J6I A;  5GMV A;  3PTF C;  4TUU A;  2G3Q B;  3LJ3 A;  4GIV A;  1RLF A;  2KX0 A;  1P98 A;  1WGD A;  1ZGU B;  4BKS D;  4G0N B;  3A9K A;  2RR9 A;  1WXA A;  3H6N A;  4KIK A;  1GG3 A;  2C7M B;  2L7R A;  2CHX A;  4IC7 B;  3SDL C;  1V9J A;  1IYF A;  1GJZ A;  2HTH A;  4G50 A;  4K7S A;  4YL8 A;  1K8R B;  3VTV A;  2N7D A;  3H7S A;  4FLH A;  3A9K B;  2AEH A;  2DAF A;  5AZG A;  1WZ0 A;  4KIK B;  4DDG D;  4IWP A;  5DPT A;  2PE6 B;  2R2Q A;  2KJR A;  3HM3 A;  5CX3 A;  4BBN C;  1A5R A;  2LUE A;  1Z5S B;  3VDZ A;  4E71 A;  2FAZ A;  2MBQ A;  2MCN B;  1GC7 A;  1WE7 A;  4FN2 A;  2K25 A;  4BOZ B;  2DYO A;  3SD5 A;  4W9C A;  4PYZ A;  2LJ5 A;  4TV3 A;  3UIO B;  3W1S A;  4FJV B;  2MX2 A;  2J0K A;  5DPS A;  4W9E A;  3V60 A;  3MJW A;  3WIM A;  3VFK A;  2KFJ A;  2G45 B;  4LJO B;  2NPT A;  1FXT B;  2LRU A;  3WAN A;  4IM3 A;  4IG7 B;  3SU8 X;  2JWZ A;  4A20 A;  4GMV A;  3HM6 X;  1WY8 A;  2BYV E;  2KHW B;  2IO3 B;  5AZH A;  1P3Q U;  1EUV B;  4B9K A;  3H7P A;  2NPT B;  2ZCB A;  2N9P C;  1Q5W B;  5DCN A;  2LWP A;  4K1R B;  3MTN B;  1GUA B;  4HVB A;  3JSV A;  1YX5 B;  4I6P A;  2G4D B;  5D6J B;  3H7P B;  2FNJ B;  4EZL A;  4M8N A;  5D7G A;  1WFY A;  3IBE A;  1LQB A;  1EO6 A;  1U4A A;  2M17 A;  4W9D A;  4EOY A;  3ZNG C;  1C1Y B;  1LFD A;  4F8C B;  2LVP A;  5JHA A;  3JSV B;  3L16 A;  1NI2 A;  2BWE S;  4XZ4 A;  2FID A;  2WX1 A;  4ZRK A;  3KUC B;  3PPA A;  4A3P A;  2DYM A;  4JGH B;  4NY0 A;  2K8C A;  2LI5 A;  4GSW A;  5J18 A;  2JUO A;  2GBM A;  3K9O B;  3KVF B;  3N3K B;  3SHQ A;  4FBJ B;  1WXS A;  1G6J A;  3H9D A;  2NBV B;  2MSE D;  4W9G A;  2DZI A;  2C9W B;  2KQ7 A;  2JZZ A;  2M1M A;  2LXC A;  5AEK B;  4FHK A;  3DBL I;  2D10 A;  3APC A;  1XT9 B;  4ICV A;  3U7D A;  2YVC A;  3EHV A;  1Q1O A;  2LZ6 A;  3L10 B;  1SGH A;  3L0W B;  3GZN I;  1OTR B;  3Q3F A;  2ZJD A;  1Q0W B;  2KWU B;  3QQ8 B;  4URK A;  3OLM D;  4PS3 A;  3JW0 X;  2KOX A;  3JYU A;  3AU5 A;  4B6W A;  3DBS A;  2CHW A;  2BYF A;  3QAQ A;  4HJK A;  2D3G A;  1TGZ B;  2IY0 B;  3ZIM A;  4EKU A;  2MBB B;  2C60 A;  2I1K A;  3KYC D;  4IWO A;  4N9F 4;  4G3X B;  4PYU A;  3PVL A;  3UGB B;  4GDK A;  1IP9 A;  2XEW A;  4W9F A;  3A1Q A;  2Z0D B;  2RGF A;  2REX A;  3M63 B;  4I6N B;  4II2 B;  4KDL B;  3TCA A;  3R7R A;  4E3C A;  2CR5 A;  5CHV C;  2D11 A;  2JRI B;  5E6O A;  3EC8 A;  3NZU A;  2UYZ B;  2KWC A;  3EEC A; 
#chains in the Genus database with same CATH topology
 1LO5 D;  1WX7 A;  1WZ3 A;  4MSQ B;  2J7Q B;  2ZVN A;  3NVV A;  4W9L A;  2ASQ A;  2W9N A;  3Q3J A;  3ONS A;  1ET9 A;  3IXS A;  1I4G A;  2L3Z A;  1ZXH A;  5G55 A;  3BYT B;  1WX8 A;  1RM6 C;  5BMG A;  4FAD A;  1H8C A;  3AN1 A;  4K81 A;  1D3Z A;  4YTN B;  1PDX A;  1CZP A;  3N32 A;  2DAJ A;  2LVQ A;  2LGX A;  4IUM B;  1T5X D;  2L00 B;  2PW9 A;  3ZYY X;  2DZJ A;  4XYC A;  1UGM A;  4MM3 A;  1V1P B;  2O2V A;  1UBI A;  4NJC A;  2FCS A;  3I9V 1;  3QK0 A;  3MC0 B;  4MDK E;  1WI0 A;  2KMA A;  5HFY A;  2K1F A;  4KDI C;  4HK2 A;  4IW0 A;  1J0G A;  1H4R A;  1LM8 B;  3FIL A;  4KKI A;  1SF0 A;  3VAW A;  1UGJ A;  2JYT A;  2WYQ A;  1TKG A;  2KDI A;  5IN7 A;  4NQL B;  2B76 B;  4M0W B;  3OJ4 B;  1ZW7 A;  3W1Y A;  5G5H A;  1V1O A;  3WAM A;  1WYG A;  1F1H A;  3EUB 2;  1ZDX A;  1YQ4 B;  3PRE A;  2MW5 A;  1FNV A;  4AS1 A;  2ZVO A;  2BWF A;  2IY1 B;  4GOC A;  2MH7 A;  3X0W A;  3ZTD A;  4HCN B;  3BY4 B;  4HKQ A;  4KZ0 A;  1JRU A;  4WUR A;  1RAX A;  2WP9 B;  3UQA A;  1XCT L;  4BBN F;  3WA0 A;  2KDF B;  2WS3 B;  4ANX A;  4NQK E;  2PJH A;  3B08 A;  2KD0 A;  3N1Z C;  5D94 A;  3T9L A;  3I3T B;  4US9 A;  2KLG A;  3L13 A;  4NAM A;  3AEE B;  1VD2 A;  4TMA B;  4A8X C;  1CMX B;  2ON8 A;  3CIR B;  1BT0 A;  5AZF A;  1TBE A;  2Y5B B;  4YWG G;  3AEB B;  4IM2 A;  2N9K A;  1NYQ A;  3CMM B;  2DWQ A;  1TS2 A;  2Y3A A;  1V49 A;  4ANU A;  2KKC A;  1VLB A;  2BPS A;  3O65 B;  5BO4 B;  2WXI A;  2WWZ A;  1S1Q B;  3VVW B;  1PGB A;  4W9K A;  2FCQ A;  2LXA A;  3H1U A;  3TSS A;  3MC9 A;  3H8H A;  3KQ4 A;  3VUX A;  1VZ8 A;  3UI3 A;  3ZVV A;  2JWU A;  2AYO B;  1WH3 A;  5G2N A;  2ONQ A;  3QAR A;  1YD8 U;  2WQY B;  2V3S A;  3DDC B;  5EE0 A;  1YNT E;  3RNC C;  3ZNI D;  2BYE A;  2N1V A;  4YTM B;  2GB1 A;  2G4S A;  1WE6 A;  2E6X A;  2BTE A;  3U30 A;  1NVI D;  2IYD B;  2VZK D;  3X23 A;  4MGI E;  3PGE A;  3TJP A;  3ZO5 B;  3RUI B;  1BXT A;  2LHE A;  2LD9 A;  2WXK A;  3AH7 A;  1E7U A;  2J0M A;  2VH1 A;  3QX1 A;  1CJE A;  3AM9 A;  2LGI A;  1JWS D;  4LNN A;  4L23 A;  2WXO A;  3PS6 A;  5IO9 A;  2IBI B;  2QEJ C;  1HZ5 A;  1HXY D;  4ITK A;  3HHM A;  2N9X A;  2ZW1 A;  1YJJ A;  3TIX A;  3DQV A;  3UIN B;  1GNU A;  2KX3 A;  1SJE D;  3AE9 B;  2BS3 B;  2KMM A;  3R3M A;  2C7N B;  3RFZ B;  3AEG B;  4AJW A;  1OEY J;  2V3N A;  1EF5 A;  4RF1 A;  1K53 A;  2WXF A;  4EEW A;  1T3Q A;  3MJ5 A;  2Y5P A;  2LAS A;  4RGN A;  4I6L B;  4GU2 A;  1RRB A;  3RUL A;  4LCD E;  2CS4 A;  1F77 A;  2JZ3 B;  1JRP A;  4MJS A;  1OGW A;  4LDT B;  3RNA C;  4L1B A;  3RD2 A;  1TYG B;  1TS5 A;  2D07 B;  1MVK A;  3DHI C;  5JZE B;  2CU3 A;  1QKZ A;  4X57 B;  3MP9 A;  3D32 A;  1QOB A;  5CTR C;  1MG8 A;  1IPG A;  4FJY A;  2K8H A;  1WGH A;  3VQI A;  1WSP A;  2M8S A;  3IFW B;  1WGR A;  4OVU A;  1WM3 A;  1P0R A;  2FIF A;  5C1Z A;  3Q8E A;  1VRA B;  1AW7 A;  1WXV A;  3NS1 A;  3NVZ A;  3FAH A;  3DCG A;  3RNE C;  5BMH A;  5L95 C;  2D2Q A;  4LDT D;  1UWX A;  5GMV A;  4PT5 A;  4TUU A;  1RFK A;  1WGD A;  2FE8 A;  1AYF A;  1ZPS A;  3A9K A;  3H6N A;  4KIK A;  4EE2 A;  3FKY A;  1IYF A;  4G50 A;  3VTV A;  1QOG A;  4FLH A;  4DDG D;  2RDG A;  3HM3 A;  5CX3 A;  3KWV A;  4BBN C;  2K0P A;  2LUE A;  3VDZ A;  3HVZ A;  3CWI A;  4A90 A;  1MG4 A;  4W9C A;  3EGR A;  1N60 A;  4REZ A;  2LJ5 A;  4TV3 A;  3W1S A;  1M4V A;  1P7F A;  4W9E A;  1IBX B;  1GB4 A;  1N6Z A;  1STE A;  2LGS A;  2NPT A;  1FXT B;  4P6V F;  3SU8 X;  4GMV A;  1WY8 A;  2WDQ B;  4B9K A;  1C4P A;  1L6V A;  2N9P C;  3TUO A;  2WLB A;  3TEY A;  4HVB A;  3RI7 C;  1L0X B;  2G4D B;  3H7P B;  3TEX A;  1XF5 L;  2M17 A;  3W9C B;  1C1Y B;  4PK1 A;  2LVP A;  2WDV B;  3E56 A;  3JSV B;  3L16 A;  3IAM 1;  4XZ4 A;  1GAQ B;  3PZ8 A;  4JGH B;  4NY0 A;  5J18 A;  2JUO A;  3KVF B;  3N3K B;  1G6J A;  1C77 A;  2DZI A;  2C9W B;  2L32 A;  2H88 B;  4P1C C;  2LZ6 A;  1SGH A;  5IOI A;  3L0W B;  1OTR B;  2QJL A;  3C8Y A;  1UUP A;  5FK9 C;  2W3R A;  4PS3 A;  4C00 A;  3LXF A;  2KOX A;  3AU5 A;  3DBS A;  2CHW A;  2BYF A;  3NZ3 A;  2D3G A;  4KKJ A;  3EA6 A;  3ZIM A;  2G1E A;  3KYC D;  1F2R I;  1EWY C;  4GDK A;  2IPK D;  2PKO A;  1VR9 A;  2K5P A;  3M63 B;  4II2 B;  4QAY A;  3TCA A;  3ZJV A;  5E6O A;  2BB5 A;  3NZU A;  3KUC B;  2TSS A;  2MJ3 A;  4C80 A;  3JVZ X;  2ZPN A;  2ZCC A;  2JU6 X;  4BOS C;  3QCA A;  4MT5 A;  1V8C A;  3RZF A;  4C4V B;  3ZNH B;  3VTU A;  1KLG D;  3P4Q B;  3PHX B;  1JWA D;  2NTS A;  2IND C;  2D3C A;  2LGD A;  3NVY A;  1A70 A;  1M94 A;  3VTW A;  4ZYN A;  3AV8 A;  1FXA A;  4MGZ E;  3U2S C;  4GB9 A;  3ZDM C;  1V1P A;  2D3B A;  4MH0 E;  2BKF A;  2KDB A;  2HD5 B;  3RCZ A;  5KHQ A;  2V1Y A;  5EDS A;  2BGF A;  3NY5 A;  1ACC A;  4CO7 A;  2KC2 A;  1V80 A;  4AQ7 A;  1X1M A;  2QSD A;  2QC8 A;  1I4X A;  3HVD A;  1V81 A;  1D5Z C;  4M0W A;  2X8X X;  2MWS B;  1FCC C;  4NPN A;  3A33 B;  3DWM A;  1WMH B;  3AED B;  1YN5 A;  2BS2 B;  4WWM A;  1TY2 A;  2MBE A;  3Q3M C;  4ANV A;  4E74 A;  2INC C;  4KX6 B;  1TZO A;  2IO0 B;  2J53 A;  2RSU A;  2WXP A;  4P1B C;  3N9Y C;  5DPR A;  2MQJ A;  2WU2 B;  2HJ8 A;  3RMK C;  2OOB B;  1N5X A;  3AEA B;  4II3 B;  5HI1 A;  4WWP A;  3NOB A;  1C79 A;  3BVZ A;  2PPH A;  2SEB D;  4WH4 A;  2KO3 A;  2MBO A;  1Z2M A;  5C2T B;  1FCL A;  3IG3 A;  1YQ3 B;  2IO1 B;  3CST A;  4YXD B;  1BUI C;  2WXQ A;  4N59 A;  1EU4 A;  1FMA D;  4JX1 C;  1KTK A;  1GOZ A;  1I35 A;  1R4M I;  4NAW B;  3ZW3 A;  4NZL B;  1V6E A;  3LB8 C;  4HEA 1;  1TY0 A;  1JAL A;  2LVO A;  2JZP A;  4WJO A;  4J3O D;  4JE3 B;  1FPY A;  2HDE A;  3ZTC A;  2WXM A;  3KW5 B;  2CHZ A;  1FNU A;  4WIP A;  4XE0 A;  2XNA C;  4ZRJ A;  4M02 A;  2ZNV C;  3BVG A;  3C19 A;  2Y5C A;  1UEL A;  2FCN A;  3P4R B;  3AUL A;  1FM0 D;  4FA6 A;  2JXT A;  2KJH B;  3QJZ A;  4DK5 A;  1WJN A;  4DHJ B;  2MP2 B;  1UWM A;  1LXD A;  2DX5 B;  3Q6B A;  4NJ7 A;  1E90 A;  5KHO A;  1WR1 A;  4K7W A;  4Q2J A;  2VH2 A;  2X38 A;  1SJH D;  5LLI A;  4AUQ C;  5DPW A;  2GBK A;  1N62 A;  3Q8F A;  1QIL A;  3CF6 E;  1L5P A;  2KWD A;  3KUZ A;  2KVR A;  2VRR B;  4TSS A;  2IZV B;  4GXB A;  5L83 A;  3PLV A;  3W1S C;  1OQY A;  4JL9 A;  3L4P A;  3ZXV A;  2M56 B;  3L54 A;  1KM7 A;  1SIF A;  2K22 A;  3N30 A;  1QLB B;  4DHJ D;  3K9P B;  4FUL A;  1QT9 A;  1UNS A;  4JIO U;  1PGX A;  1VZ6 A;  2KAC A;  2V4L A;  5H8Y E;  4B95 A;  2KTR B;  4DXA B;  3L08 A;  1SE3 A;  2N9L A;  4B0E A;  4LNO A;  1R4M B;  5E6P A;  2N9E B;  4PS8 A;  2V9H A;  1P7E A;  3DHH C;  3VR9 B;  4KVG B;  2A5U A;  2W55 A;  5FR6 A;  1QF6 A;  2W54 A;  3ZUN A;  4YSZ B;  4LNI A;  4MH8 A;  1ISN A;  4XWW A;  1FO4 A;  2BF8 B;  3W5U B;  3ZDT A;  4MSM B;  3VH3 B;  1JW9 D;  4AP4 C;  1FIQ A;  2BVC A;  1E6E B;  3BYY B;  2JRH A;  5CHF A;  3RZW C;  1YJ1 A;  2OHF A;  3QIJ A;  3WAO A;  3P42 A;  2EKE C;  1V5T A;  3A4R A;  1MJD A;  5C3J B;  1HQR D;  3DOW A;  3T8M A;  1I4Q A;  3TEW A;  3V61 A;  4WQO B;  3NHE B;  3B0A A;  1HTO A;  1MHX A;  2JF5 A;  3RPF C;  1AAR A;  3A1Q B;  4WJP A;  3ZKJ C;  3GP7 A;  2KT7 A;  2DNF A;  3L17 A;  4LNF A;  4HPL B;  4OVZ A;  1WXM A;  2AQ1 B;  3LJ3 A;  1ZGU B;  3AE8 B;  4G0N B;  1GPX A;  1WXA A;  5EE3 A;  2R61 A;  3N20 C;  1V9J A;  4IC7 B;  2HTH A;  4YL8 A;  3ABV B;  2K9X A;  1K8R B;  2V3P A;  2N7D A;  2JX5 A;  2AEH A;  2DAF A;  1WZ0 A;  4IWP A;  3N1X C;  3BK2 A;  4YSY B;  2LMC A;  4M01 A;  3SEB A;  2KDM A;  3AE4 B;  4BOZ B;  5BYQ A;  1ENF A;  4D2K A;  2D5G A;  4FJV B;  3FC4 A;  1DOY A;  1JWU D;  1ESF A;  3VFK A;  2KFJ A;  3OG5 A;  3H7P A;  1LGR A;  1NEK B;  2BQQ A;  4K1R B;  3MTN B;  3ZXR A;  1GUA B;  3JSV A;  1YX5 B;  4S0R A;  1FFV A;  1SB3 C;  3GB1 A;  1T6B X;  2IGH A;  4M8N A;  2RMM A;  1LQB A;  1EO6 A;  4W9D A;  3ZNG C;  1LFD A;  4YSX B;  1NI2 A;  2FID A;  2J4X A;  4A3P A;  2DYM A;  2K8C A;  4GSW A;  2I38 A;  3HUI A;  4M00 A;  4YTP B;  4ICV A;  1XT9 B;  3Q3N C;  2YVC A;  3L10 B;  3GZN I;  2ZJD A;  4CQN A;  3OLM D;  1TJE A;  3JW0 X;  1KH0 A;  3JYU A;  4HPP A;  3RNB C;  2MBB B;  3W2D A;  2I1K A;  4IWO A;  1OQR A;  1YMH E;  4PYU A;  1IP9 A;  2XEW A;  2REX A;  2WXL A;  4I6N B;  4XDD A;  3R7R A;  2CR5 A;  2D11 A;  4EZJ A;  2UYZ B;  3DVN V;  2KWC A;  1BML C;  2LEK A;  3IVF A;  3ECI A;  1K50 A;  1XQQ A;  1I7H A;  2DLB A;  2BKR B;  4C4V A;  2QDF A;  4F7Z A;  5D2M B;  5FR3 A;  3DVG X;  2N1W A;  2QCZ A;  1FRR A;  4ZRQ A;  2GBJ A;  1RWS A;  2D3A A;  4JQW C;  1UD7 A;  2MLB A;  2NCN A;  1EM7 A;  2JQR B;  4M8M A;  3A9J B;  1HEZ E;  1Y56 A;  1L4D B;  3PZ7 A;  2N7J A;  2WXH A;  4BKT A;  1F9J A;  1Y8R C;  3A4S C;  3R7Q A;  1NDD A;  2CU1 A;  2L83 A;  4ZRI A;  5IKC M;  4PS7 A;  4DWF A;  5E6J A;  2QHO A;  2AL3 A;  2JPH A;  2K3U A;  1EF1 A;  4KSL C;  2HTM E;  4BAX A;  3CSF A;  1L2N A;  2KFK B;  1WMH A;  1NEN B;  4HXD A;  3TL5 A;  1C76 A;  2WX0 A;  3PHW B;  1WYW B;  1T0S C;  1VDV A;  2WDR B;  3GZN B;  4DQO C;  1J7A A;  3P2B A;  1IUE A;  4N58 A;  4ICU A;  4HRS A;  2XK5 B;  3AMZ A;  3AI5 A;  3M62 B;  2DZM A;  2WU5 B;  4IM0 A;  3AEF B;  1WRI A;  2L76 A;  1WR6 E;  2WDT B;  2KTF A;  4ARC A;  1DOI A;  4MEM A;  3PRM B;  3V62 A;  1NBF C;  3PSE B;  2MA9 B;  2R2O A;  4KV2 A;  2KJ6 A;  1FD6 A;  2DEN B;  3Q8A A;  4G11 A;  4XC2 A;  1E8W A;  3RYT A;  2C7H A;  3KH0 A;  2O6V B;  3QC8 B;  3NJT A;  2NBW B;  3VXW A;  5J2R A;  1L6U A;  1YX6 B;  3B1L X;  4OZC A;  2L05 A;  3IHP C;  1YN4 A;  4GN1 A;  3U8Z A;  4RF0 A;  4MGK E;  2V4I B;  4AWJ A;  4NAW A;  4OW0 A;  5LXH A;  1D4B A;  2MJE A;  4HLE A;  4HRO A;  5CHW A;  4ASW C;  1D5X C;  4JWU C;  2PE9 A;  3VH4 B;  1PQS A;  2ICI A;  4W9H A;  4RMA A;  3R66 C;  3VUW A;  2J52 A;  4MJS B;  1XLO A;  2M19 A;  3ZJT A;  1DOX A;  1KJT A;  4OZB A;  2XN9 C;  3DVN U;  2HJ1 A;  3ML9 A;  4K7U A;  1YIW A;  1E10 A;  3BII D;  3VRB B;  4BKG A;  4DDI D;  1RYJ A;  1UF0 A;  5IA7 A;  3DWG C;  1WJ4 A;  3I63 C;  4BFR A;  2K6D B;  3UF8 A;  4C7Y A;  2LRW A;  2MP2 A;  4NJ6 A;  5AUI A;  3VUY A;  1FEH A;  2ZW0 A;  1ZKH A;  2CJO A;  2WXR A;  3PRZ A;  2RDB C;  1NYR A;  2L0F A;  3QHT A;  3V6C B;  1WGG A;  1SE9 A;  4JLC A;  1P1A A;  4LJP B;  3RNF C;  3R2T A;  1V86 A;  3KUD B;  4IKG A;  5JH5 C;  1KRH A;  1VCB A;  2PMV A;  4A3O A;  2AQ2 B;  1ROE A;  2JSV X;  1ZXI A;  3SFE B;  1YJI A;  4LLG M;  1TTN A;  4RNA A;  1C78 A;  3DVG Y;  3BIN A;  4TQ1 A;  4N6E B;  2GMI C;  1E5W A;  2YLM A;  4OVV A;  2XBB C;  2KTR A;  3Q14 C;  2A4Z A;  1WIA A;  3ZNZ B;  1AN8 A;  1R7S A;  2WNM A;  3Q69 A;  2Z59 B;  3APF A;  4ZDV A;  1JQ4 A;  2KDE B;  2I1J A;  4RCO A;  2W82 A;  2ACZ B;  2DHZ A;  1I42 A;  4ARI A;  2W3S A;  3WCQ A;  4W9J A;  4EZK A;  2GOW A;  2HE7 A;  3HK0 A;  4OHJ A;  1SEB D;  5TR5 A;  2ZPY A;  2Z0E B;  3NRZ A;  1HE8 A;  5D3D A;  3AE5 B;  1SE4 A;  4IDI A;  1TIF A;  1XCQ L;  1XEE A;  1WGY A;  1XD3 B;  4WJN A;  3NG0 A;  2B3A A;  2NTT A;  1E0Z A;  4LK0 M;  1JCK B;  2H89 B;  3ZRC A;  4TKN A;  1L0V B;  3TBL D;  1QQR A;  2KLC A;  4GDL B;  3MHS D;  4MGY E;  4O1N A;  1TS3 A;  4KSK C;  4WAA A;  1HZ6 A;  1E7V A;  2M4N A;  5J17 A;  4P7I A;  1KLU D;  4EFO A;  1SXT A;  1E8X A;  4WWO A;  1WM2 A;  3URY A;  5MPO A;  2INP E;  2NR2 A;  3V6E B;  1NI3 A;  2RPQ A;  2WHI A;  1K51 A;  2UWQ A;  3ML8 A;  4GDK B;  1E7P B;  4DHZ B;  2N7E A;  3SR6 A;  1F0Z A;  4KGT A;  1MFW A;  2EMS A;  4HWI B;  3V3X A;  1S3S G;  5AUK A;  3M3J A;  1UZX B;  2FUH B;  4J6I A;  2L52 A;  1C9F A;  4MAC A;  2I2Y A;  2G3Q B;  2AX5 A;  1RLF A;  1P98 A;  4DXF A;  1GG3 A;  2CHX A;  4K7S A;  4USA A;  4UDU C;  2PVG C;  4HJG E;  1WWT A;  3TEZ A;  5AZG A;  2BYT A;  4GLS C;  2R2Q A;  2KJR A;  5BMI A;  1A5R A;  1Q10 A;  1FFU A;  4E71 A;  2FAZ A;  2MBQ A;  2MCN B;  2FUG 1;  2K25 A;  2LHD A;  2DYO A;  3AE2 B;  3OWE B;  4PYZ A;  3O13 A;  1OQQ A;  2G9H D;  1SE2 A;  4P16 A;  5DPS A;  4ZHP A;  1DYQ A;  3WIM A;  2FBW B;  3HRD D;  2PIA A;  5HHD G;  3WAN A;  4A20 A;  3IT4 B;  3HM6 X;  5H92 C;  1ZOY B;  2IO3 B;  5FKA C;  2GRI A;  5D3I B;  1P3Q U;  1MPE A;  4A9A A;  2WXN A;  5DCN A;  2LWP A;  4IOI E;  1IGC A;  4HKZ E;  1F2R C;  4I6P A;  5D6J B;  2AQ3 B;  1WFY A;  3IBE A;  1U4A A;  4EOY A;  1ET6 A;  3KWL A;  4F8C B;  5JHA A;  5BYS A;  2BWE S;  4H2A A;  3PPA A;  4RFB A;  2LI5 A;  3ZGZ A;  1JWM D;  1QOA A;  4FBJ B;  3SHQ A;  2NBV B;  4L2Y A;  5G5G A;  2KQ7 A;  1K52 A;  2M1M A;  1N61 A;  3DBL I;  1VJK A;  3APC A;  3EHV A;  1Q1O A;  3T3N A;  2RDH A;  2WXG A;  3Q3F A;  1Q0W B;  2KWU B;  3MFG A;  4B6W A;  1FXI A;  3QAQ A;  3R2I A;  1JRO A;  4HJK A;  1TGZ B;  3AE6 B;  4ZYS A;  4N9F 4;  4DXG A;  3DHG C;  1L0Y B;  4BZA A;  3PVL A;  3UGB B;  2RGF A;  3BK1 A;  4KDL B;  2NMQ A;  5CHV C;  3EEC A;  2JT4 B;  2YEP F;  1YN3 A;  2VZK B;  3WAL A;  4JPS A;  1L7Y A;  1CK1 A;  3HIZ A;  1HA5 A;  4TQ0 A;  2ZEQ A;  1WJ6 A;  3A9J A;  4XWT A;  3OJ3 A;  4ANW A;  2M0X A;  2JXX A;  4WJQ A;  2N4F A;  3APD A;  5JXV A;  4MEL A;  1WX9 A;  2J0J A;  3BWU D;  4C7Z A;  5T8I A;  2IO2 B;  1J7B A;  3PLU A;  3NVW A;  1KLV A;  1B1Z A;  2KWV B;  2QIL A;  1WRD B;  2QIE B;  1PYW D;  3EFC A;  2PTL A;  1CQV A;  2M0A A;  1IBX A;  1TZ1 A;  2KQS A;  1SSN A;  2KYW A;  3U7Z A;  3GE8 C;  3I5J C;  4RGT A;  2C5L C;  2KFK A;  3V05 A;  2IDY A;  5BYR A;  3LDZ E;  2PLP A;  5HG2 A;  4ZOH C;  4XX5 A;  1MHH E;  3PZD A;  4CHK A;  4A55 A;  3AU4 A;  2XK5 A;  3N1Y C;  2LJI A;  4HDQ A;  4MM3 B;  2L1A A;  2O2V B;  2DZK A;  3ALB A;  1P9D U;  3DBL B;  5HKH A;  3U4E G;  4CYE A;  2YEP B;  4IWQ A;  3SFD B;  3E9S A;  5E6N A;  1QZE A;  1WXQ A;  3FIL B;  3AE7 B;  5GXG B;  3GS2 A;  1XLP A;  4B0M A;  1N5W A;  4NNJ B;  3UIP B;  3B9J A;  5LXI B;  3DBR I;  2JVC A;  4OZA A;  2NVU I;  2O6V A;  1V5O A;  4RM8 A;  4FHJ A;  1JWB D;  2KC1 A;  4K3C A;  2PVO D;  4WWN A;  3P4P B;  1ZP0 B;  2WGS A;  4AOF A;  1T0Q C;  1FNW A;  3KLS X;  2KN5 A;  1WJU A;  4ZRP A;  3VHT C;  2IGG A;  4W9I A;  3BZD B;  3QWZ B;  1D6E C;  2K39 A;  4BKS A;  2E3T A;  1L4Z B;  3Q2A C;  4RGM A;  1EU3 A;  3AE1 B;  3MC8 A;  2DBY A;  2BS4 B;  2EEL A;  2MEK A;  1C3T A;  5IAA C;  3VRA B;  2JY6 A;  1UBQ A;  3LYY A;  3ZQ4 A;  3ENE A;  2DYB A;  1F52 A;  1YOV B;  1J8C A;  1J19 A;  2GLS A;  2BW2 A;  2PEA A;  1OEY A;  3W5V B;  1T0R C;  4US8 A;  1RFA A;  2RPV A;  2L8J A;  1TS4 A;  2FCM A;  3DPD A;  4FJZ A;  1E8Y A;  5EE9 A;  2MBH A;  1FRD A;  4RM9 A;  1KOT A;  3QA8 A;  3TMP B;  1EWC A;  2LFI A;  4HDO A;  5C23 A;  1WF9 A;  1V97 A;  3R8B A;  2EMT A;  2K6Q A;  4HCP B;  4RH6 A;  3BVM A;  2MHJ A;  2K8B A;  4DHZ E;  5LNK 1;  4JWS C;  2J42 A;  2KXJ A;  2KMC A;  1R4N I;  2KVZ A;  3DBR B;  1ZUD 2;  3WAP A;  2RD0 A;  3KYD D;  3AXC A;  3ZJU A;  4R3D A;  1PUT A;  4BVU C;  1DGJ A;  1MI0 A;  1T0Y A;  1WGK A;  1C4A A;  4EUT A;  2KK8 A;  1I4H A;  3IT6 B;  3NS8 A;  3NZS A;  3RT3 B;  3OAW A;  2GBN A;  1ZDV A;  3DBH I;  4HPM B;  2KAN A;  4LNK A;  3PO0 A;  4KZC A;  3ZRF A;  3AB5 A;  3M95 A;  5JHB A;  1TKE A;  3Q8B A;  3UQB A;  1XLQ A;  4YT0 B;  2AL6 A;  3MHZ A;  4S17 A;  3PT2 B;  1ZE3 D;  2KN4 A;  2LGY A;  1PFD A;  4F1S A;  1TKY A;  1GC6 A;  4WAF A;  1SIJ A;  1C4C A;  4AJY B;  1I4R A;  2INN E;  2KAJ A;  2IJ0 A;  3PV1 A;  3GOE A;  4GDL A;  2ZZP B;  2L0T A;  2KZR A;  4XDC A;  2BB6 A;  3P4S B;  2CJN A;  2CKH B;  3ETR A;  4WQM A;  4LTU A;  3EFU A;  2KNB A;  4DBG A;  2MJD A;  3ZLZ A;  1IGD A;  3S2A A;  2OJR A;  1KF6 B;  1UH6 A;  1YQB A;  2MRP A;  2O6V D;  3J9C A;  1V2Y A;  1R4N B;  2NS5 A;  3NUH B;  3PRP B;  2GBR A;  2NBU A;  1E9M A;  3C0R B;  1VZ7 A;  4KGS A;  2BBC A;  5IP4 D;  2ZNV B;  1QOF A;  1E8Z A;  4GGQ A;  3Q8C A;  2AWT A;  3T3O A;  3AE3 B;  4XGA B;  3PTF C;  3RN9 C;  1OFF A;  4GIV A;  2KX0 A;  1XO3 A;  5EE1 A;  2Q5W D;  4BKS D;  1KFY B;  3B2G A;  3B2F A;  2RR9 A;  1PGA A;  2C7M B;  2L7R A;  3SDL C;  3DBH B;  2N0S B;  3GE3 C;  3U52 E;  3H7S A;  3AEC B;  1XXG A;  3A9K B;  4KIK B;  5DPT A;  2PE6 B;  3IAS 1;  1AWD A;  1Z5S B;  1GC7 A;  1WE7 A;  4FN2 A;  5TSS A;  5I4D A;  3SD5 A;  1XLN A;  3P63 A;  3UIO B;  1JML A;  2MX2 A;  2J0K A;  4A6Q A;  3V60 A;  4RGO S;  3MJW A;  2QMT A;  1SBB B;  2G45 B;  4LJO B;  2LRU A;  4IM3 A;  2Z8L A;  4IG7 B;  4FXC A;  2JWZ A;  4KGR A;  2BYV E;  2KHW B;  5AZH A;  1D5M C;  1EUV B;  1TT5 B;  2UU7 A;  2NPT B;  2ZCB A;  1Q5W B;  4C56 C;  1N63 A;  2BT6 A;  2FNJ B;  2GI9 A;  4EZL A;  2OED A;  2OJW A;  5D7G A;  2V0G A;  2WXJ A;  1B9R A;  4ZHO A;  4K3B A;  2WX1 A;  4ZRK A;  2JYE A;  1I4P A;  4ACF A;  1J7C A;  2GBM A;  3K9O B;  1WXS A;  3H9D A;  2MSE D;  1HTQ A;  4W9G A;  3RNG C;  3VR8 B;  2JZZ A;  5AEK B;  2LXC A;  4FHK A;  2LUM A;  2D10 A;  3U7D A;  2KQ4 X;  3P1M A;  3QQ8 B;  4URK A;  2IGD A;  2IY0 B;  1GB1 A;  4EKU A;  2C60 A;  4G3X B;  2EKI A;  4W9F A;  3A1Q A;  2Z0D B;  4E3C A;  2JRI B;  2SAK A;  3I57 A;  3EC8 A;  3Q3O C;  1GJZ A; 
#chains in the Genus database with same CATH homology
 1WX7 A;  1WZ3 A;  2JT4 B;  3IVF A;  4MSQ B;  2J7Q B;  3ECI A;  1XQQ A;  2ZVN A;  2BKR B;  3JVZ X;  2ZPN A;  4F7Z A;  2ZCC A;  4W9L A;  2ASQ A;  3WAL A;  1L7Y A;  2W9N A;  3Q3J A;  3HIZ A;  4TQ0 A;  3ONS A;  2ZEQ A;  1WJ6 A;  5D2M B;  4BOS C;  3QCA A;  3A9J A;  3RZF A;  3DVG X;  3OJ3 A;  4ANW A;  2M0X A;  2JXX A;  2N1W A;  4WJQ A;  3ZNH B;  2N4F A;  3VTU A;  2GBJ A;  2L3Z A;  3APD A;  4MEL A;  3PHX B;  4JQW C;  5G55 A;  1WX9 A;  2J0J A;  1UD7 A;  1WX8 A;  2MLB A;  2NCN A;  4M8M A;  2IO2 B;  3A9J B;  2LGD A;  3PLU A;  4FAD A;  1H8C A;  1M94 A;  4K81 A;  3VTW A;  4ZYN A;  1D3Z A;  1KLV A;  4MGZ E;  3N32 A;  4BKT A;  2KWV B;  1WRD B;  2DAJ A;  1F9J A;  4GB9 A;  2LVQ A;  1Y8R C;  3A4S C;  3ZDM C;  3R7Q A;  2LGX A;  1NDD A;  2CU1 A;  4IUM B;  4MH0 E;  2BKF A;  1TZ1 A;  2KDB A;  2HD5 B;  2KQS A;  4ZRI A;  3RCZ A;  5KHQ A;  4PS7 A;  2V1Y A;  5EDS A;  2C5L C;  2BGF A;  2KFK A;  4DWF A;  2L00 B;  3NY5 A;  2QHO A;  2DZJ A;  2AL3 A;  2JPH A;  4CO7 A;  1UGM A;  2KC2 A;  1EF1 A;  3LDZ E;  4KSL C;  4MM3 A;  1V80 A;  2O2V A;  1UBI A;  1X1M A;  4XX5 A;  2FCS A;  3PZD A;  3QK0 A;  3CSF A;  4CHK A;  1L2N A;  4MDK E;  1WI0 A;  2KFK B;  1WMH A;  2KMA A;  4HXD A;  3AU4 A;  3TL5 A;  1V81 A;  2XK5 A;  4HDQ A;  2K1F A;  4KDI C;  4HK2 A;  2O2V B;  2DZK A;  3ALB A;  4IW0 A;  1J0G A;  1H4R A;  1P9D U;  5HKH A;  1LM8 B;  2MWS B;  2WX0 A;  3PHW B;  4NPN A;  3A33 B;  1WYW B;  4CYE A;  1WMH B;  3VAW A;  3P2B A;  2WYQ A;  4IWQ A;  4ICU A;  2XK5 B;  2KDI A;  3M62 B;  3AI5 A;  4NQL B;  3DVN V;  5E6N A;  1QZE A;  4M0W B;  2DZM A;  4IM0 A;  3OJ4 B;  2MBE A;  1ZW7 A;  3W1Y A;  2L76 A;  4ANV A;  1WR6 E;  3WAM A;  2WDT B;  4E74 A;  2KTF A;  4NNJ B;  4MEM A;  3PRM B;  2IO0 B;  2RSU A;  3UIP B;  5LXI B;  3DBR I;  3PRE A;  2JVC A;  2MW5 A;  2NVU I;  3V62 A;  1NBF C;  1V5O A;  2O6V A;  5DPR A;  2MQJ A;  3PSE B;  2MA9 B;  2R2O A;  4KV2 A;  4RM8 A;  2HJ8 A;  2BWF A;  2DEN B;  2IY1 B;  2KJ6 A;  2ZVO A;  4FHJ A;  2KC1 A;  4GOC A;  4G11 A;  4WWN A;  2OOB B;  4XC2 A;  3X0W A;  1E8W A;  3RYT A;  2C7H A;  3ZTD A;  4AOF A;  4HCN B;  3BY4 B;  2O6V B;  3KH0 A;  3QC8 B;  2KN5 A;  4II3 B;  4KZ0 A;  1JRU A;  1WJU A;  1RAX A;  2NBW B;  3VXW A;  5J2R A;  4WWP A;  3NOB A;  3VHT C;  3UQA A;  2PPH A;  4BBN F;  1YX6 B;  3B1L X;  3WA0 A;  2L05 A;  4W9I A;  2KO3 A;  3IHP C;  3QWZ B;  2KDF B;  4ANX A;  4NQK E;  4GN1 A;  2MBO A;  3U8Z A;  2PJH A;  1Z2M A;  2K39 A;  3B08 A;  4BKS A;  2KD0 A;  4MGK E;  5D94 A;  3T9L A;  3I3T B;  3IG3 A;  2IO1 B;  2KLG A;  3CST A;  3L13 A;  4NAW A;  4AWJ A;  5LXH A;  4HLE A;  5CHW A;  1VD2 A;  4ASW C;  1CMX B;  2PE9 A;  3VH4 B;  1PQS A;  4W9H A;  1C3T A;  4RMA A;  5IAA C;  1BT0 A;  3R66 C;  5AZF A;  1TBE A;  2JY6 A;  3VUW A;  1UBQ A;  2Y5B B;  1I35 A;  4MJS B;  1R4M I;  4NAW B;  3ZW3 A;  1V6E A;  3ENE A;  4IM2 A;  2DYB A;  1J8C A;  1J19 A;  1KJT A;  3CMM B;  2LVO A;  1V49 A;  3DVN U;  4ANU A;  3ML9 A;  2PEA A;  1OEY A;  4WJO A;  4K7U A;  2KKC A;  1YIW A;  3ZTC A;  3O65 B;  2BPS A;  5BO4 B;  3KW5 B;  2CHZ A;  2WWZ A;  1S1Q B;  3VVW B;  1RFA A;  4BKG A;  2L8J A;  4W9K A;  4ZRJ A;  2ZNV C;  2FCQ A;  2FCM A;  3DPD A;  2LXA A;  3H1U A;  4FJZ A;  4DDI D;  1E8Y A;  5IA7 A;  1WJ4 A;  2MBH A;  4BFR A;  2K6D B;  3UF8 A;  2LRW A;  2MP2 A;  4RM9 A;  1UEL A;  2FCN A;  1KOT A;  3QA8 A;  4NJ6 A;  3TMP B;  3VUX A;  3AUL A;  3VUY A;  4FA6 A;  2KJH B;  3ZVV A;  3QJZ A;  4HDO A;  5C23 A;  4DK5 A;  2AYO B;  1WH3 A;  1WF9 A;  5G2N A;  1WJN A;  1ZKH A;  4DHJ B;  2MP2 B;  2EMT A;  2K6Q A;  3PRZ A;  1LXD A;  3QAR A;  4HCP B;  2DX5 B;  1YD8 U;  4NJ7 A;  2L0F A;  3QHT A;  1E90 A;  2V3S A;  3DDC B;  2K8B A;  3V6C B;  4DHZ E;  1WGG A;  3ZNI D;  5KHO A;  1WR1 A;  4K7W A;  2BYE A;  2N1V A;  2G4S A;  1WE6 A;  1SE9 A;  4JLC A;  1P1A A;  4LJP B;  3U30 A;  2IYD B;  5LLI A;  4MGI E;  3X23 A;  2KXJ A;  3PGE A;  3TJP A;  2KMC A;  1R4N I;  1V86 A;  3WAP A;  3KUD B;  2GBK A;  3ZO5 B;  4AUQ C;  5JH5 C;  5DPW A;  3RUI B;  2RD0 A;  1VCB A;  4A3O A;  2LD9 A;  3KYD D;  3CF6 E;  1E7U A;  3AXC A;  2J0M A;  3KUZ A;  2KVR A;  2VRR B;  2IZV B;  4GXB A;  1TTN A;  3QX1 A;  4BVU C;  5L83 A;  3PLV A;  3W1S C;  3DVG Y;  1OQY A;  1T0Y A;  4JL9 A;  3BIN A;  4EUT A;  2KK8 A;  3NS8 A;  4TQ1 A;  3NZS A;  2GMI C;  1E5W A;  2YLM A;  4OVV A;  3L54 A;  3RT3 B;  3OAW A;  1KM7 A;  2XBB C;  2GBN A;  1SIF A;  2KTR A;  2A4Z A;  3N30 A;  1WIA A;  3DBH I;  3PS6 A;  3ZNZ B;  2IBI B;  4HPM B;  2KAN A;  4DHJ D;  2Z59 B;  3APF A;  3HHM A;  2N9X A;  3K9P B;  4FUL A;  4ZDV A;  3TIX A;  4KZC A;  4JIO U;  3ZRF A;  3M95 A;  2V4L A;  3DQV A;  5JHB A;  3UIN B;  1GNU A;  4B95 A;  2KDE B;  3UQB A;  2KTR B;  4DXA B;  2KX3 A;  2I1J A;  3L08 A;  4EZJ A;  3R3M A;  2AL6 A;  2C7N B;  2DHZ A;  5E6P A;  1I42 A;  2N9E B;  4PS8 A;  3PT2 B;  2LGY A;  4KVG B;  4F1S A;  4AJW A;  2A5U A;  5FR6 A;  1GC6 A;  1OEY J;  1EF5 A;  4W9J A;  4EEW A;  3ZUN A;  4EZK A;  2LAS A;  2GOW A;  2HE7 A;  3HK0 A;  4I6L B;  4GU2 A;  4AJY B;  5TR5 A;  2ZPY A;  1ISN A;  1RRB A;  2Z0E B;  3RUL A;  2BF8 B;  1HE8 A;  4LCD E;  3ZDT A;  2CS4 A;  3PV1 A;  2JZ3 B;  3GOE A;  4MJS A;  1OGW A;  4LDT B;  4MSM B;  4GDL A;  3RD2 A;  2D07 B;  2ZZP B;  3VH3 B;  2L0T A;  2KZR A;  4AP4 C;  1WGY A;  1XD3 B;  4WJN A;  2B3A A;  2CKH B;  5JZE B;  3ZRC A;  4TKN A;  2JRH A;  5CHF A;  3EFU A;  3TBL D;  2KLC A;  4GDL B;  3RZW C;  4X57 B;  3MHS D;  1YJ1 A;  3QIJ A;  4MGY E;  3WAO A;  2KNB A;  4DBG A;  3D32 A;  2EKE C;  4KSK C;  1V5T A;  3ZLZ A;  3A4R A;  4WAA A;  1E7V A;  2M4N A;  5J17 A;  4P7I A;  3S2A A;  4EFO A;  2OJR A;  5CTR C;  1E8X A;  3DOW A;  3T8M A;  4WWO A;  1MG8 A;  1IPG A;  1WM2 A;  1UH6 A;  4FJY A;  2K8H A;  1YQB A;  1WGH A;  2NR2 A;  3V61 A;  4WQO B;  3V6E B;  2MRP A;  2O6V D;  3VQI A;  2M8S A;  3IFW B;  2RPQ A;  1V2Y A;  3B0A A;  1WGR A;  3NHE B;  2NS5 A;  4OVU A;  1WM3 A;  2UWQ A;  1P0R A;  3ML8 A;  4GDK B;  2FIF A;  2GBR A;  2JF5 A;  3PRP B;  2NBU A;  2N7E A;  4DHZ B;  1AAR A;  3A1Q B;  5C1Z A;  4WJP A;  3ZKJ C;  3C0R B;  1WXV A;  4HWI B;  2EMS A;  2ZNV B;  3DCG A;  1E8Z A;  4GGQ A;  1S3S G;  2AWT A;  3L17 A;  3M3J A;  1UZX B;  2FUH B;  4HPL B;  5L95 C;  2D2Q A;  1WXM A;  4LDT D;  4J6I A;  5GMV A;  3PTF C;  4TUU A;  2G3Q B;  3LJ3 A;  4GIV A;  1RLF A;  2KX0 A;  1P98 A;  1WGD A;  1ZGU B;  4BKS D;  4G0N B;  3A9K A;  2RR9 A;  1WXA A;  3H6N A;  4KIK A;  1GG3 A;  2C7M B;  2L7R A;  2CHX A;  4IC7 B;  3SDL C;  1V9J A;  1IYF A;  1GJZ A;  2HTH A;  4G50 A;  4K7S A;  4YL8 A;  1K8R B;  3VTV A;  2N7D A;  3H7S A;  4FLH A;  3A9K B;  2AEH A;  2DAF A;  5AZG A;  1WZ0 A;  4KIK B;  4DDG D;  4IWP A;  5DPT A;  2PE6 B;  2R2Q A;  2KJR A;  3HM3 A;  5CX3 A;  4BBN C;  1A5R A;  2LUE A;  1Z5S B;  3VDZ A;  4E71 A;  2FAZ A;  2MBQ A;  2MCN B;  1GC7 A;  1WE7 A;  4FN2 A;  2K25 A;  4BOZ B;  2DYO A;  3SD5 A;  4W9C A;  4PYZ A;  2LJ5 A;  4TV3 A;  3UIO B;  3W1S A;  4FJV B;  2MX2 A;  2J0K A;  5DPS A;  4W9E A;  3V60 A;  3MJW A;  3WIM A;  3VFK A;  2KFJ A;  2G45 B;  4LJO B;  2NPT A;  1FXT B;  2LRU A;  3WAN A;  4IM3 A;  4IG7 B;  3SU8 X;  2JWZ A;  4A20 A;  4GMV A;  3HM6 X;  1WY8 A;  2BYV E;  2KHW B;  2IO3 B;  5AZH A;  1P3Q U;  1EUV B;  4B9K A;  3H7P A;  2NPT B;  2ZCB A;  2N9P C;  1Q5W B;  5DCN A;  2LWP A;  4K1R B;  3MTN B;  1GUA B;  4HVB A;  3JSV A;  1YX5 B;  4I6P A;  2G4D B;  5D6J B;  3H7P B;  2FNJ B;  4EZL A;  4M8N A;  5D7G A;  1WFY A;  3IBE A;  1LQB A;  1EO6 A;  1U4A A;  2M17 A;  4W9D A;  4EOY A;  3ZNG C;  1C1Y B;  1LFD A;  4F8C B;  2LVP A;  5JHA A;  3JSV B;  3L16 A;  1NI2 A;  2BWE S;  4XZ4 A;  2FID A;  2WX1 A;  4ZRK A;  3KUC B;  3PPA A;  4A3P A;  2DYM A;  4JGH B;  4NY0 A;  2K8C A;  2LI5 A;  4GSW A;  5J18 A;  2JUO A;  2GBM A;  3K9O B;  3KVF B;  3N3K B;  3SHQ A;  4FBJ B;  1WXS A;  1G6J A;  3H9D A;  2NBV B;  2MSE D;  4W9G A;  2DZI A;  2C9W B;  2KQ7 A;  2JZZ A;  2M1M A;  2LXC A;  5AEK B;  4FHK A;  3DBL I;  2D10 A;  3APC A;  1XT9 B;  4ICV A;  3U7D A;  2YVC A;  3EHV A;  1Q1O A;  2LZ6 A;  3L10 B;  1SGH A;  3L0W B;  3GZN I;  1OTR B;  3Q3F A;  2ZJD A;  1Q0W B;  2KWU B;  3QQ8 B;  4URK A;  3OLM D;  4PS3 A;  3JW0 X;  2KOX A;  3JYU A;  3AU5 A;  4B6W A;  3DBS A;  2CHW A;  2BYF A;  3QAQ A;  4HJK A;  2D3G A;  1TGZ B;  2IY0 B;  3ZIM A;  4EKU A;  2MBB B;  2C60 A;  2I1K A;  3KYC D;  4IWO A;  4N9F 4;  4G3X B;  4PYU A;  3PVL A;  3UGB B;  4GDK A;  1IP9 A;  2XEW A;  4W9F A;  3A1Q A;  2Z0D B;  2RGF A;  2REX A;  3M63 B;  4I6N B;  4II2 B;  4KDL B;  3TCA A;  3R7R A;  4E3C A;  2CR5 A;  5CHV C;  2D11 A;  2JRI B;  5E6O A;  3EC8 A;  3NZU A;  2UYZ B;  2KWC A;  3EEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...