5J17A

Solution structure of ras binding domain (rbd) of b-raf
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
b'SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title A Small Molecule RAS-Mimetic Disrupts RAS Association with Effector Proteins to Block Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 80
sequence length 80
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5j17A01
3RZWC 4G11A 3DVNU 2LGYA 1Q1OA 1J19A 1V9JA 4FHKA 3RZFA 4AJYB 1QZEA 4W9IA 2BWES 2BWFA 3Q3JA 4DXAB 2KQ7A 1KOTA 5D94A 2MBOA 4DHJD 4GN1A 3HHMA 1GNUA 2Y5BB 3HIZA 3WANA 3ECIA 3ZKJC 3P2BA 5EDSA 1GC6A 2L00B 1WX9A 4HLEA 1A5RA 3SDLC 4GDKB 1WH3A 3NHEB 1OTRB 2FCQA 1WRDB 4DBGA 2N9PC 3M3JA 5JZEB 3QIJA 3DOWA 2RGFA 5DPSA 1OQYA 4IUMB 1YQBA 4BOSC 4KDLB 2MRPA 1ZGUB 3DVGX 5CTRC 2AYOB 2LI5A 4WWPA 5DCNA 5AZGA 1ZKHA 2PE6B 2KNBA 1Y8RC 4GXBA 1WXAA 2JRHA 2MBBB 3DCGA 3VHTC 3ZVVA 4BBNC 2O6VD 3KW5B 3APFA 1YIWA 2KLGA 5JHAA 2NCNA 5G2NA 3AU4A 1YJ1A 2KK8A 4W9KA 1XQQA 1J0GA 2IO0B 3I3TB 2PPHA 3M95A 4DHZB 4XX5A 4HJKA 3ZO5B 3QQ8B 4W9FA 4I6LB 2KQSA 1WXMA 4J6IA 3VTVA 2KX0A 2L8JA 2KDIA 4JIOU 2B3AA 3VDZA 1V49A 4WJQA 3K9PB 5JHBA 3EC8A 4WJPA 2HTHA 4FULA 2EKEC 2PJHA 4I6PA 1RAXA 1WM2A 3JVZX 4RMAA 5LXHA 4W9DA 1WXVA 4GGQA 1WI0A 2N9EB 5C1ZA 2MX2A 1SIFA 1WGDA 2KOXA 5IAAC 4TKNA 3V62A 4AUQC 3DVNV 3PRZA 2KJRA 4KDIC 2ASQA 4HXDA 4CO7A 2FUHB 3H9DA 4MSMB 4WWOA 2JRIB 2C5LC 2CHXA 1WJ6A 2W9NA 3NY5A 3QJZA 2BF8B 1K8RB 2KMAA 3QCAA 3CSFA 3AU5A 3JW0X 3NZUA 4M8NA 4BKSA 2LVQA 4MH0E 2VRRB 2IYDB 3T9LA 1FXTB 3PPAA 1S3SG 2AEHA 3PV1A 4NJ6A 3X0WA 4WWNA 4A3PA 4FBJB 2KDFB 2BKFA 2GBKA 3N32A 4N9F4 4CYEA 3PRPB 2EMSA 2IO1B 4ICUA 4XC2A 3PREA 3ENEA 1MG8A 1UELA 4DDGD 4HVBA 2BYEA 2KKCA 1P3QU 4NNJB 3DBSA 1VD2A 2KJHB 3VQIA 4II2B 2KMCA 2KTRB 2XK5B 2O2VB 1GC7A 2CHZA 1JRUA 2KWCA 1LQBA 2KXJA 5CHFA 3WAMA 4MELA 3VAWA 4FHJA 4K1RB 4HCPB 4HWIB 4GU2A 1YX6B 4BBNF 1WX7A 3H6NA 5CX3A 3R7QA 2PEAA 3KYCD 2IO3B 1L7YA 2AL3A 3L13A 1XD3B 2KWUB 3CSTA 1EO6A 4WQOB 3MTNB 2DAJA 1WR6E 4M0WB 4X57B 1AARA 1P98A 1RFAA 2LRUA 3A33B 1V80A 2IY0B 4JGHB 1P0RA 4DHZE 3AXCA 5HKHA 1I35A 2DZJA 2I1JA 1RRBA 2ZVOA 2LD9A 3VH3B 4EUTA 2LVPA 3HM3A 1KLVA 3ZNID 5D2MB 2LJ5A 2LXCA 2FIDA 1IYFA 3VFKA 2G45B 2J7QB 1TTNA 4ASWC 2NBWB 3ZRFA 5LXIB 4IWQA 2O2VA 1WJNA 4BOZB 1E8WA 2NBUA 3APDA 4KIKA 2DAFA 3L0WB 1NDDA 1WZ3A 2G4DB 3PSEB 2LUEA 4IWOA 4IC7B 3VTUA 2NPTA 3M63B 1UGMA 4GMVA 5CHWA 3VXWA 2MW5A 3L10B 4ANUA 1WGHA 2KLCA 1WGYA 4G3XB 3OLMD 3T8MA 3JSVA 3UIPB 3VUXA 3W1SC 1D3ZA 4TV3A 2Z0EB 2A5UA 4G50A 3A4SC 3TL5A 1YD8U 2IZVB 2LGXA 5G55A 2M1MA 1WX8A 4NAWB 1E8ZA 1T0YA 3VVWB 4EFOA 2JT4B 1KJTA 3TIXA 3DDCB 3X23A 1EF1A 3OAWA 1R4MI 4LDTB 1V6EA 2BKRB 2ZEQA 4K7UA 3PLUA 2N1VA 5C23A 2M0XA 1V5TA 2KC1A 3UIOB 1VCBA 2CU1A 2KN5A 1L2NA 2ZPYA 2RD0A 2WX1A 2KDEB 3QWZB 1SE9A 1NBFC 2WYQA 4WJNA 1IPGA 3W1YA 2LVOA 2KO3A 3QC8B 2REXA 5IA7A 2G4SA 2NBVB 3KYDD 1WE6A 2FCSA 1WMHA 2MLBA 1WZ0A 3PHXB 3VUWA 1ZW7A 1OGWA 2A4ZA 3CMMB 4NAWA 3RCZA 3WAPA 4ANWA 2Z59B 4CHKA 3UGBB 4FA6A 3Q3FA 5LLIA 2IY1B 4PS8A 2UYZB 4HK2A 2LGDA 2UWQA 2HD5B 3NZSA 5E6NA 4A3OA 4MGKE 3IVFA 5L95C 4ZRJA 4II3B 3SU8X 3H7PA 1BT0A 1WR1A 3A9KA 3K9OB 4FJYA 3WAOA 2V3SA 4PS7A 3TBLD 3S2AA 1F9JA 4MM3A 2OJRA 3ALBA 3OJ3A 4OVVA 4K81A 3UQAA 5CHVC 2CKHB 3C0RB 4F1SA 4W9JA 1X1MA 4MJSB 3R7RA 2MA9B 4F7ZA 2WX0A 4BKTA 3L54A 4LCDE 3KUZA 1V5OA 2DZMA 1LXDA 2MCNB 4PS3A 1C3TA 4LDTD 2BYVE 3A4RA 1Z5SB 2BPSA 4BFRA 3NOBA 2LASA 2PE9A 1I42A 2DZIA 3M62B 3RULA 4AOFA 5J18A 3IBEA 4KV2A 1OEYA 2CS4A 3DVGY 1IP9A 1TBEA 2ZJDA 2C7HA 3SD5A 3GZNI 2D11A 3IHPC 2L05A 2NVUI 1WGRA 2YLMA 3U30A 2JXXA 4KIKB 3U8ZA 2J0MA 3V61A 4BKGA 3PVLA 4ANXA 3AULA 2KWVB 4BKSD 4FN2A 2OOBB 2NPTB 2KX3A 3A9JB 3ZIMA 2L76A 4EZLA 2N7DA 5AEKB 1WM3A 5FR6A 2MP2A 4MJSA 5D6JB 1PQSA 4ICVA 3APCA 2DYOA 2LXAA 3QAQA 1GJZA 1WE7A 1HE8A 3JSVB 3VUYA 1V2YA 4GIVA 1C1YB 3KH0A 5BO4B 4DDID 2MQJA 2ZCBA 2N4FA 2L0TA 5E6OA 2C60A 2ZZPB 3TMPB 3UF8A 4DHJB 3D32A 2ZPNA 3DBHI 4MSQB 4W9CA 2RSUA 3A1QB 5DPWA 2JWZA 2MBEA 3ONSA 4GDLA 4LJOB 4HDQA 3ZNGC 4MGYE 4JLCA 4MDKE 2KANA 2RR9A 2ZVNA 2V1YA 4M8MA 4LJPB 5KHOA 3DPDA 2EMTA 3MJWA 4JL9A 4KZCA 2ZNVB 2KFJA 1P9DU 3WALA 4TQ1A 2KFKB 3GOEA 3EFUA 4PYUA 3A9JA 4W9GA 5DPTA 2HE7A 2KDBA 1Z2MA 3PT2B 2AWTA 3ML9A 5L83A 4IG7B 2O6VB 4HCNB 3B1LX 2XBBC 1Q5WB 4RM8A 3LJ3A 4GSWA 2DENB 2D10A 2DZKA 4P7IA 1UBQA 1E8YA 2FCMA 2V4LA 1M94A 4NPNA 1V86A 3A1QA 2KVRA 3PHWB 1WF9A 1WMHB 4EKUA 4IM3A 3UINB 3N3KB 3PTFC 3H7SA 4WAAA 3ZTCA 3H1UA 3RD2A 2YVCA 2C7MB 3MHSD 1S1QB 1UBIA 2M8SA 1E5WA 2GBNA 3OJ4B 1WJ4A 2K1FA 3V6EB 1LM8B 1UD7A 4OVUA 2NR2A 2KFKA 4FJVB 5J2RA 1GUAB 2L3ZA 5JH5C 2FNJB 1G6JA 3H7PB 4ZRIA 3A9KB 1H4RA 5E6PA 2DHZA 2BYFA 2D07B 2IBIB 2ZNVC 2GMIC 2L7RA 3L08A 4DK5A 2GOWA 2JUOA 2O6VA 2G3QB 2R2QA 2LWPA 3L16A 4IM0A 1TGZB 1Q0WB 3BY4B 3V60A 4ZDVA 4YL8A 2XEWA 2KHWB 3ZTDA 2RPQA 2HJ8A 3U7DA 3DBRI 3ZDTA 4E74A 5J17A 1NI2A 3QX1A 1WJUA 4KVGB 3QK0A 2K8HA 1GG3A 1WFYA 2J0KA 2M4NA 3ZLZA 4NJ7A 3ZNHB 2GBRA 3ZNZB 3N30A 4GOCA 2LZ6A 2Z0DB 4W9LA 3VTWA 2CHWA 3ZDMC 4URKA 3KUCB 4MGIE 3WA0A 1YX5B 4GB9A 1XT9B 1LFDA 5DPRA 4B6WA 3PS6A 4ZRKA 4PYZA 2L0FA 2D3GA 4EOYA 3VH4B 2C9WB 4AP4C 1H8CA 2KZRA 2AL6A 2GBJA 5AZFA 1R4NI 2K39A 3KVFB 3PGEA 4B95A 3B0AA 2WWZA 2MP2B 3QARA 3PZDA 4GDKA 4NQKE 4RM9A 3NS8A 2C7NB 4FJZA 4A20A 1SGHA 4ANVA 4DWFA 2KJ6A 4W9EA 4HPLB 4MEMA 1EF5A 1WYWB 2FIFA 5GMVA 3DQVA 4I6NB 2K6DB 4HPMB 5TR5A 2WDTB 2KD0A 4G0NB 2N7EA 3QA8A 4NQLB 2J0JA 4IW0A 4B9KA 3TCAA 4TUUA 4FLHA 2MBQA 4GDLB 4KZ0A 1WXSA 2NS5A 2N9XA 3ML8A 2IO2B 3HM6X 3ZW3A 1WIAA 3HK0A 2MWSB 4E71A 3EECA 3RUIB 4KSKC 1P1AA 1WY8A 3ZUNA 1E8XA 4W9HA 3RYTA 2JZZA 2KTFA 2K8BA 3L17A 2M17A 2K6QA 2CR5A 1J8CA 4IWPA 1U4AA 4K7WA 4KSLC 3R3MA 3O65B 2MBHA 4TQ0A 5AZHA 4E3CA 4WJOA 3AI5A 1UZXB 1ISNA 1EUVB 3DBLI 3TJPA 4ZYNA 2QHOA 4F8CB 1E7UA 4BVUC 2DYMA 4EZKA 3PLVA 4JQWC 3SHQA 2DYBA 1V81A 4IM2A 3R66C 2BGFA 3QHTA 3WIMA 2K8CA 3JYUA 2JPHA 3PRMB 1UH6A 1WGGA 2FAZA 2ZCCA 1KM7A 1E7VA 2MSED 2JZ3B 2R2OA 3CF6E 3BINA 4XZ4A 5D7GA 3EHVA 3UQBA 1E90A 1OEYJ 2DX5B 2N1WA 2D2QA 3B08A 4AJWA 3KUDB 1CMXB 1TZ1A 4HDOA 2JY6A 3LDZE 2JF5A 4AWJA 4FADA 2KTRA 2K25A 2XK5A 3IG3A 4MGZE 3V6CB 1RLFA 2KC2A 2LRWA 2FCNA 4NY0A 4K7SA 2GBMA 3ZRCA 5KHQA 4EEWA 3IFWB 3RT3B 3W1SA 4EZJA 2I1KA 2JVCA
chains in the Genus database with same CATH superfamily
3RZWC 4G11A 1Q1OA 4OZBA 4DQOC 5H92C 4RH6A 3RZFA 2BWFA 2PLPA 3Q3JA 5D94A 2MBOA 2VH2A 4H2AA 5EE1A 5H8YE 2DNFA 3DBLB 1F77A 4PK1A 3ZKJC 1A5RA 1WX9A 4GDKB 2XN9C 5DPSA 1OQYA 1YQBA 1PYWD 2AYOB 4WWPA 1WXAA 2JRHA 3VHTC 1QT9A 3GE8C 1IGCA 2V4IB 1QILA 5JHAA 3BIID 2B76B 3AU4A 1J0GA 3Q3NC 3M95A 4DHZB 3ZO5B 2WU5B 3FILB 4W9FA 4I6LB 1CK1A 4J6IA 2L8JA 2CJNA 2KDIA 2EKEC 2PJHA 5LXHA 1IGDA 4W9DA 1FNWA 3Q6BA 4GGQA 2XNAC 4XYCA 1SIFA 4TKNA 4AUQC 2ASQA 3EA6A 1TYGB 1MHHE 1N60A 4WH4A 3AU5A 3NZUA 2LVQA 3T9LA 5C2TB 1ZE3D 1BUIC 4WWNA 4BAXA 2M19A 3PRPB 3PREA 1MG8A 4DDGD 4HVBA 2VZKB 2KWCA 1LQBA 5CHFA 2D3CA 4FHJA 4K1RB 4HCPB 3AE8B 1QOGA 3W9CB 1AN8A 5BMHA 3VRBB 1R4NB 4YSZB 1P98A 1GB4A 2LRUA 3A33B 1WGKA 4DHZE 2IY0B 5E6JA 2I1JA 2KQ4X 2ZVOA 2LD9A 4FXCA 2G45B 3E56A 3ZRFA 4KIKA 3TUOA 1NDDA 1WZ3A 3I63C 2G4DB 2J52A 4IWOA 5TSSA 3VTUA 1ZPSA 1UGMA 3AE7B 3L10B 4ANUA 4G3XB 4C7YA 1AWDA 5T8IA 3VUXA 3W1SC 3MC9A 4G50A 2W54A 2WXLA 3TL5A 3MP9A 2BS3B 2YEPB 3IXSA 1YMHE 1FNUA 1XLNA 1UWXA 2JT4B 3X23A 3DDCB 4LNFA 1EF1A 1WXQA 2TSSA 3OAWA 1SIJA 4LDTB 1V6EA 5C23A 2M0XA 2WHIA 1VCBA 1FO4A 1L2NA 4MM3B 1FEHA 2WX1A 2KDEB 3RFZB 2WDVB 2WYQA 2JWUA 1DOYA 2WXHA 5IA7A 2RDHA 3KYDD 4P6VF 2MLBA 1OGWA 2K22A 4NAWA 3WAPA 3Q3FA 2L52A 2WLBA 2UYZB 4B0MA 3AEEB 2IPKD 1YN3A 5IOIA 2UWQA 4A3OA 4ZRJA 3SU8X 2HTME 2V3SA 1MPEA 3KWVA 3S2AA 1F9JA 3ALBA 2QIEB 5IN7A 3AE1B 3C0RB 4F1SA 3L54A 1LXDA 4PS3A 5MPOA 2BPSA 3NOBA 2DZIA 3DWGC 3DVGY 3SD5A 2ICIA 3IHPC 2NTTA 2YLMA 3U30A 1RWSA 4KIKB 3U8ZA 1QF6A 2LHDA 4BKSD 1YQ4B 2ACZB 5GXGB 2KX3A 4EZLA 2N7DA 1WM3A 5FR6A 1I4XA 2MP2A 5D6JB 4ICVA 2DYOA 1SJED 2LXAA 1GJZA 3VUYA 5BO4B 4DHJB 2ZZPB 3UF8A 1QOBA 3RN9C 1PGBA 2ZPNA 3DBHI 2RSUA 5DPWA 3Q3OC 2WNMA 3ZJTA 2JWZA 4GDLA 2KANA 1DOXA 2WGSA 5KHOA 2KFJA 1P9DU 3WCQA 2N0SB 4TQ1A 2H88B 2WXQA 2KYWA 5DPTA 2HE7A 1Z2MA 1LO5D 3TEZA 1FRRA 1Q5WB 4GSWA 3AM9A 2JSVX 1PGXA 2W3SA 1UBQA 2DLBA 1V86A 3A1QA 4IM3A 2SAKA 3N3KB 3H7SA 1B1ZA 3RD2A 2YVCA 2Q5WD 1Y56A 2M8SA 1E5WA 4OHJA 3NVVA 1V1OA 1STEA 3V6EB 3Q8CA 2KFKA 5J2RA 1HXYD 2L3ZA 5JH5C 2FNJB 1G6JA 4ZRIA 1H4RA 5E6PA 2DHZA 2BYFA 2IBIB 2JUOA 2G3QB 1TGZB 1E9MA 4YL8A 1TKYA 2KDMA 3DBHB 2HJ8A 1TJEA 3DBRI 5J17A 4REZA 5BYQA 2OJWA 1E10A 2J0KA 1WWTA 3AN1A 2WDRB 1ESFA 4NJ7A 3ZNHB 1NYRA 4GOCA 3VTWA 4EE2A 1LGRA 1H8CA 2D3GA 2GBJA 4ARIA 1MJDA 3KVFB 2MP2B 3PZDA 4NQKE 4ANVA 4DWFA 4FJZA 4A20A 5AEKB 1RM6C 2KJ6A 1EF5A 2FIFA 2OHFA 3L4PA 1ET6A 2K6DB 4HPMB 4OZCA 4NQLB 2WDQB 4US8A 2MBQA 4GDLB 4S0RA 2E3TA 2INDC 3HM6X 1L0XB 3RUIB 1L6VA 4LNOA 2M17A 3DBRB 4K7WA 2GB1A 4E3CA 3AI5A 2K0PA 4F8CB 1C9FA 1J7AA 1VZ6A 2DYBA 1V81A 1TY0A 3R66C 3N9YC 5G5GA 4LNIA 1P7FA 1D4BA 1F0ZA 2R2OA 5D7GA 1JWBD 3PO0A 3Q8EA 3Q69A 2H89B 1RFKA 2D2QA 2IGDA 5EE9A 3LDZE 1EWCA 4AWJA 3NVZA 2XK5A 2J42A 4C56C 2LRWA 3SFDB 4NY0A 3ZQ4A 5KHQA 2WXPA 2I1KA 1KLVA 2JVCA 4WQMA 2LGYA 1UF0A 1J19A 1V9JA 4N6EB 2N9LA 2M0AA 4M0WA 3C19A 4W9IA 2BWES 4LTUA 3RNFC 1KOTA 1PUTA 4DHJD 1GNUA 1FRDA 3WANA 3ECIA 1KFYB 1GC6A 4ITKA 4HLEA 5EDSA 1FD6A 2PVGC 1WH3A 1WRDB 4DBGA 2N9PC 1JALA 1ZGUB 5CTRC 1VR9A 2LI5A 5AZGA 1ZKHA 1Y8RC 2MBBB 4BBNC 4YSYB 2NCNA 1XQQA 1C77A 1IUEA 3BK2A 3I3TB 1SE4A 1JQ4A 5IO9A 4XX5A 1WXMA 4WJQA 2L83A 4FULA 4RMAA 3JVZX 1PFDA 3TSSA 1I4RA 2FBWB 3NVWA 1NI3A 4A55A 5C1ZA 2KOXA 5IAAC 3DVNV 3PRZA 4KDIC 3MC8A 1WSPA 4HXDA 3H9DA 4MSMB 4WWOA 2JRIB 3MC0B 3NY5A 1K8RB 1I4GA 3QCAA 4BKSA 3JW0X 4MH0E 2VRRB 1FXTB 2AEHA 1L6UA 2IGGA 3U2SC 3BVZA 1ZOYB 4N9F4 3I5JC 4ICUA 1F1HA 3ENEA 1ZXHA 3SFEB 1P3QU 2KJHB 2PW9A 2XK5B 4O1NA 5I4DA 1YOVB 4MELA 4KKIA 3ZXVA 3AEAB 1N61A 4HWIB 3HUIA 4GU2A 1WX7A 4KX6B 2JYTA 1XD3B 4WQOB 1EO6A 1WR6E 4JE3B 4M0WB 1AARA 1P0RA 2UU7A 3AXCA 1I35A 1RRBA 4K3CA 1WYGA 3HM3A 1E6EB 3SEBA 3ZNID 5D2MB 3BVMA 2FIDA 1IYFA 2J7QB 3P4QB 1FCLA 1SXTA 4BOZB 3L0WB 2N7JA 1XO3A 1BMLC 3IT6B 3PSEB 4NJCA 1FM0D 4GMVA 2JZPA 2MW5A 2KLCA 3T8MA 3UIPB 2AQ3B 2Z0EB 3A4SC 1XCQL 1YD8U 2IZVB 2WXRA 5G55A 2M1MA 1WX8A 1E8ZA 3Q8BA 4ZOHC 3NJTA 1NENB 2ZEQA 4K7UA 2KT7A 3PLUA 4YTNB 3NS1A 2CU1A 2PVOD 4P1BC 2KACA 3N1ZC 2G9HD 2V9HA 2Z8LA 2KO3A 1TKGA 2FCSA 2RDBC 5FR3A 1ZW7A 2A4ZA 4ANWA 2Z59B 4FA6A 3UGBB 1VLBA 1ZXIA 5LLIA 2ON8A 4PS8A 3E9SA 4RGNA 5E6NA 3IVFA 1WR1A 3A9KA 3HRDD 4PS7A 4MM3A 3UQAA 5CHVC 2BVCA 3P1MA 4S17A 2WX0A 3BVGA 4A9AA 1KLUD 2BYVE 1TY2A 5D3DA 4BFRA 3DWMA 1I42A 3IBEA 1OEYA 1TBEA 2ZJDA 1N5XA 2N9KA 1WGRA 2J0MA 3V61A 3PVLA 4ANXA 1EU4A 1ZP0B 3A9JB 2L76A 2R61A 3ZJUA 1F52A 1PQSA 3APCA 4A8XC 1PDXA 1C1YB 4DDID 2MQJA 4XWTA 1UWMA 1C76A 3D32A 4W9CA 2OEDA 4LJOB 3BYTB 4MGYE 4JLCA 4M8MA 3MJWA 4KZCA 3NZ3A 2ZNVB 4WURA 4OZAA 4YWGG 5L83A 4M00A 1K52A 1YN5A 2XBBC 1T0RC 4RM8A 3OG5A 3AEGB 1HZ5A 5D3IB 1UGJA 2V4LA 1M94A 1VRAB 4NPNA 3W5UB 4UDUC 1WF9A 3UINB 3ZTCA 1FFUA 4RCOA 3H1UA 1N5WA 2C7MB 1S1QB 2X8XX 3OJ4B 4OVUA 4N58A 2RDGA 1GUAB 3A9KB 2D07B 3H8HA 3L08A 3L16A 4ZDVA 2LUMA 2XEWA 3ZTDA 1DGJA 4DXFA 1NI2A 3QX1A 4KVGB 2K8HA 3R2IA 2M4NA 3RNBC 3N30A 2Z0DB 2V3PA 4W9LA 4RGOS 2QJLA 4MGIE 2EKIA 4ZRKA 2MJDA 4PYZA 3AH7A 4EOYA 2VH1A 2Y5CA 4LK0M 4JWUC 2K39A 3PGEA 2BBCA 1AYFA 4RM9A 4W9EA 1L0YB 5GMVA 2PIAA 1V1PA 2N7EA 3QA8A 2JYEA 2L1AA 4IW0A 4B9KA 1GB1A 3TCAA 4FLHA 3AE5B 2QEJC 2MWSB 1ZDVA 4W9HA 3RYTA 2JZZA 2KTFA 2K8BA 3L17A 2CR5A 1HZ6A 4IWPA 3O65B 1YN4A 1FIQA 4WJOA 1ISNA 1EUVB 2QHOA 4BVUC 3OWEB 3PLVA 1C79A 3SHQA 3BK1A 4MACA 2JPHA 3RNCC 2ZCCA 3CF6E 3BINA 3EHVA 4NZLB 2AX5A 1K50A 4RF1A 3B2GA 1K51A 1M4VA 3NVYA 4AJWA 1CMXB 1TZ1A 2AQ2B 4HDOA 1SE2A 2JF5A 2WXMA 4FADA 2KTRA 1YNTE 3V6CB 1RLFA 2FCNA 2GBMA 3ZRCA 2D5GA 3IFWB 3RT3B 2EELA 3VR9B 2BQQA 1QQRA 4ZHPA 4AJYB 1QZEA 3U7ZA 5EE3A 1YJJA 4DXAB 2KQ7A 1GPXA 4GN1A 3HHMA 3Q2AC 1JWUD 3P2BA 3VRAB 1L5PA 3SDLC 2MHJA 3NHEB 4TMAB 5IP4D 4PT5A 3M3JA 5JZEB 3QIJA 2E6XA 3AE2B 2V3NA 4KDLB 1XLQA 1V1PB 5DCNA 2PE6B 4XDDA 4C4VB 2KNBA 4GXBA 3DCGA 3APFA 3Q3MC 1KH0A 5G2NA 2WXFA 1YJ1A 1SSNA 2IO0B 1KLGD 4HJKA 1D5XC 2PMVA 3AEBB 2KQSA 1FMAD 2HDEA 2KX0A 2B3AA 3K9PB 3Q8AA 2L32A 3EC8A 4WJPA 4I6PA 1RAXA 1WI0A 3URYA 1WGDA 3V62A 4P1CC 1NVID 5C3JB 2INNE 1E7PB 2CHXA 1WJ6A 2W9NA 3CSFA 3MJ5A 3PPAA 4NAMA 3ZGZA 2BKFA 2GBKA 4ZYSA 2EMSA 4XC2A 4NNJB 1VD2A 1SBBB 3VQIA 2KMCA 2KTRB 2O2VB 1JRUA 3WAMA 2KXJA 3ABVB 2G1EA 3B9JA 1FNVA 1YX6B 2BB5A 5CX3A 2IO3B 1OQRA 3L13A 3AMZA 1DYQA 1RFAA 1V80A 4A90A 5HKHA 2BB6A 2DZJA 2KN4A 2LVPA 4US9A 1FPYA 1K53A 4A6QA 2MH7A 2IDYA 4B0EA 3VFKA 4ASWC 3UI3A 5LXIB 4IWQA 2YEPF 3APDA 2DAFA 3ZYYX 5HFYA 4IC7B 2NPTA 3M63B 3MHZA 1J7BA 3VXWA 4KGRA 4HKQA 1WGHA 1HTQA 1GAQB 1WGYA 3OLMD 1VDVA 4TV3A 1CJEA 4M02A 3IAM1 2A5UA 2QILA 2RPVA 1I4HA 1MG4A 1JWSD 5G5HA 3VVWB 4EFOA 1KJTA 3TIXA 2JX5A 2N1VA 4ZRPA 2KN5A 2RD0A 4IOIE 1T5XD 3QWZB 4USAA 1SE9A 3BWUD 3QC8B 2REXA 1WMHA 3VUWA 3PHXB 2IY1B 4HK2A 2J4XA 1ENFA 3FAHA 4D2KA 3AB5A 2GI9A 3NZSA 5L95C 4MGKE 4WIPA 4FJYA 3WAOA 1F2RI 3TEWA 2WXJA 2ONQA 4W9JA 1X1MA 4MJSB 3R7RA 4LCDE 1V5OA 1TS3A 1KTKA 1HA5A 3TEXA 3A4RA 1C4PA 2X38A 3TEYA 1WRIA 2BYTA 3RULA 5AUIA 4ARCA 2CS4A 3AEDB 3GZNI 1L0VB 2NVUI 2JXXA 2WU2B 3B2FA 3AULA 2CJOA 2OOBB 2BTEA 2NPTB 4M01A 3GP7A 4LNKA 4BZAA 1TS4A 3QAQA 1WE7A 1V2YA 2D3BA 2ZCBA 4LNNA 2N4FA 4RGTA 5E6OA 4LLGM 4KGSA 3DHHC 1D5MC 1T6BX 4MSQB 1JW9D 4RFBA 2WS3B 3ONSA 4HDQA 3ZNGC 2RR9A 2ZVNA 3PZ7A 2V1YA 1XEEA 4LJPB 4OVZA 4JL9A 2KVZA 4XDCA 3EFUA 1MI0A 3A9JA 2KDBA 4R3DA 1QOAA 1I4QA 4L2YA 2O6VB 4HCNB 2J53A 4TSSA 1I4PA 2DENB 2BS2B 2D10A 1IBXA 2JQRB 2KVRA 3CWIA 3ETRA 3PHWB 1WMHB 3PTFC 4WAAA 1SE3A 3GZNB 3MHSD 5BYSA 1UBIA 3RNEC 1LM8B 1UD7A 1BXTA 2NR2A 1QKZA 3EUB2 4HKZE 4ACFA 4XWWA 3KLSX 3J9CA 5IKCM 4AS1A 2LFIA 2ZNVC 3N1YC 2L7RA 2R2QA 2LWPA 3P42A 1Q0WB 3BY4B 2RPQA 3U7DA 1JWMD 3RNAC 2FE8A 3U52E 4GLSC 2GBRA 3ZNZB 1R7SA 2CHWA 3AE4B 4URKA 3KUCB 4GB9A 4RNAA 1EM7A 5DPRA 4B6WA 3PS6A 3VH4B 2C9WB 4AP4C 2MJEA 2KZRA 2AL6A 1C4CA 5AZFA 1R4NI 4B95A 3B0AA 2JXTA 3QARA 4YXDB 1KRHA 3NS8A 2I2YA 4JWSC 2W3RA 4HPLB 1VZ7A 2FUG1 4MEMA 2INPE 3PZ8A 3DQVA 1N6ZA 5TR5A 2WDTB 2KD0A 2J0JA 2LGSA 4C00A 4K3BA 4KZ0A 2NS5A 2N9XA 3ML8A 2GRIA 2IO2B 1RYJA 4KSKC 3ZUNA 2Y3AA 3HVDA 3EGRA 4QAYA 1U4AA 4KSLC 3R3MA 2MBHA 3RI7C 1N62A 4ZYNA 3VR8B 1JRPA 4EZKA 1IBXB 4JQWC 3I9V1 3NUHB 4CQNA 4IM2A 4HPPA 2BGFA 4AQ7A 3QHTA 2K8CA 1D6EC 3PRMB 2FAZA 1KM7A 1E7VA 2MSED 2INCC 3I57A 1E90A 2WXGA 2Y5PA 1TKEA 1OEYJ 2DX5B 2N1WA 3B08A 5FKAC 3KUDB 1L4ZB 4MH8A 2JY6A 4RGMA 2K25A 3IG3A 4MGZE 2K5PA 2KC2A 4K7SA 1JROA 1FCCC 4EEWA 1V97A 3W1SA 3V05A 5AUKA 4EZJA 3DVNU 1HQRD 1VJKA 4FHKA 2MEKA 2WXIA 5JXVA 4IKGA 1I7HA 2Y5BB 3HIZA 3KQ4A 4HJGE 3HVZA 2L00B 3LB8C 1HTOA 1OTRB 2FCQA 3DOWA 2RGFA 4IUMB 4BOSC 2MRPA 3DVGX 5HI1A 3R2TA 3GB1A 1YJIA 1TZOA 3ZVVA 1MHXA 2O6VD 3KW5B 1YIWA 2KLGA 2KK8A 4W9KA 2PPHA 1KF6B 3QQ8B 2WQYB 3VTVA 1FFVA 4JIOU 3VDZA 1V49A 5JHBA 2HTHA 1WM2A 3SR6A 1WXVA 2W82A 1C4AA 2N9EB 2MX2A 4C4VA 2KJRA 3GS2A 5BYRA 4CO7A 2FUHB 2C5LC 3QJZA 3N20C 2BF8B 2KMAA 3BZDB 4M8NA 2BT6A 2IYDB 4JPSA 1S3SG 3PV1A 2M56B 4NJ6A 3X0WA 4L1BA 4J3OD 2I38A 4A3PA 4FBJB 2KDFB 2QSDA 3N32A 4CYEA 1T3QA 1ZUD2 2IO1B 1UELA 2BYEA 2KKCA 3DBSA 4II2B 1ACCA 1GC7A 2CHZA 4RF0A 3VAWA 2QCZA 1NYQA 2LGIA 2IJ0A 4BBNF 3H6NA 3R7QA 2PEAA 3KYCD 2CU3A 1L7YA 2AL3A 1OQQA 2KWUB 3CSTA 3MTNB 2DAJA 4X57B 3ZXRA 4JGHB 2KWDA 3VH3B 4EUTA 3U4EG 2LJ5A 2LXCA 1TTNA 2NBWB 2O2VA 1WJNA 1E8WA 2NBUA 4HEA1 3IAS1 2LUEA 3EFCA 2LJIA 1PGAA 5CHWA 4P16A 1D5ZC 2BS4B 3LYYA 2LHEA 3JSVA 1D3ZA 2VZKD 1UNSA 3V3XA 4KKJA 2LGXA 3P4RB 1TT5B 4WWMA 4NAWB 1T0YA 1SF0A 3DHGC 3RPFC 3P63A 4YTMB 1TS2A 1R4MI 2HJ1A 4HROA 3Q8FA 2WXNA 2BKRB 3RNGC 1JMLA 5HG2A 3UIOB 1V5TA 2KC1A 1JWAD 3ZJVA 2ZPYA 2SEBD 1VZ8A 3P4PB 4WJNA 1NBFC 1IPGA 3W1YA 2LVOA 3AE9B 3RMKC 2G4SA 2NBVB 4ZRQA 1WE6A 1A70A 1WZ0A 1T0QC 3RCZA 4C7ZA 3CMMB 3AE6B 4CHKA 2JU6X 3P4SB 1QLBB 2V0GA 2LGDA 2HD5B 2PKOA 5BMGA 4II3B 2WXOA 3H7PA 1BT0A 1OFFA 5FK9C 2RMMA 3K9OB 4DXGA 3TBLD 5BMIA 3KWLA 2OJRA 3OJ3A 4OVVA 3AEFB 4K81A 1XLPA 3W5VB 2CKHB 3W2DA 4XGAB 2ZW1A 1N63A 2MA9B 4F7ZA 4BKTA 3KUZA 4ZHOA 2DZMA 2MCNB 1C3TA 4L23A 4LDTD 1Z5SB 2MJ3A 2QDFA 2LASA 2PE9A 1R4MB 3Q14C 3M62B 4AOFA 5J18A 4KV2A 4XE0A 1EWYC 1IP9A 2C7HA 2D11A 2L05A 2LMCA 4WAFA 4BKGA 1FXIA 4YTPB 1AW7A 2KWVB 4FN2A 3ZIMA 1XLOA 1CQVA 4MJSA 3NG0A 1HE8A 3JSVB 5LNK1 4GIVA 3KH0A 1EU3A 4YT0B 2L0TA 3TMPB 2C60A 3A1QB 1SB3C 2QMTA 2MBEA 3FC4A 4C80A 4MDKE 3DPDA 2EMTA 3CIRB 3WALA 2KFKB 3GOEA 4PYUA 4W9GA 3C8YA 3PT2B 2AWTA 2QC8A 3ML9A 4IG7B 1P7EA 3B1LX 1TIFA 3LJ3A 1E0ZA 1YQ3B 2DZKA 4P7IA 1E8YA 2FCMA 1XF5L 4EKUA 1T0SC 1GOZA 2GBNA 1WJ4A 2K1FA 2AQ1B 4FJVB 4YSXB 1FXAA 2KAJA 4MT5A 1L4DB 3H7PB 3T3NA 1F2RC 3AV8A 1TS5A 2GMIC 4DK5A 2GOWA 2O6VA 4IM0A 2LEKA 2DBYA 3V60A 2K9XA 4N59A 2KHWB 3ZDTA 4E74A 1WJUA 2K3UA 1NEKB 3QK0A 3IT4B 1GG3A 1J7CA 1WFYA 1HEZE 3MFGA 3ZLZA 2LZ6A 5EE0A 2W55A 2KMMA 3ZDMC 1SJHD 3WA0A 1YX5B 1Q10A 1XT9B 1LFDA 2WP9B 1CZPA 2NTSA 1UUPA 2L0FA 2PTLA 1MFWA 2D3AA 2WWZA 4GDKA 2C7NB 3R8BA 1SGHA 5HHDG 1XCTL 4KGTA 2NMQA 1WYWB 4I6NB 1B9RA 4G0NB 1DOIA 4TUUA 1WXSA 3T3OA 1QOFA 2DWQA 3ZW3A 1WIAA 3HK0A 4E71A 3EECA 1P1AA 1WY8A 3GE3C 1E8XA 2ZW0A 3BYYB 1ZDXA 3FILA 2K6QA 1J8CA 1MVKA 2BW2A 4TQ0A 3AECB 5AZHA 1UZXB 3DBLI 4IDIA 3TJPA 1E7UA 2DYMA 4OW0A 3FKYA 4HRSA 2GLSA 3WIMA 3JYUA 2WXKA 1UH6A 1WGGA 4JX1C 2JZ3B 1C78A 4XZ4A 3UQBA 3N1XC 1ET9A 4Q2JA 3LXFA 1V8CA 3NRZA 1SEBD 2IGHA 1JCKB 1XXGA 3O13A 3AE3B 3DHIC 1ROEA
chains in the Genus database with same CATH topology
3RZWC 4G11A 3DVNU 2LGYA 1Q1OA 1J19A 1V9JA 4FHKA 3RZFA 4AJYB 1QZEA 4W9IA 2BWES 2BWFA 3Q3JA 4DXAB 2KQ7A 1KOTA 5D94A 2MBOA 4DHJD 4GN1A 3HHMA 1GNUA 2Y5BB 3HIZA 3WANA 3ECIA 3ZKJC 3P2BA 5EDSA 1GC6A 2L00B 1WX9A 4HLEA 1A5RA 3SDLC 4GDKB 1WH3A 3NHEB 1OTRB 2FCQA 1WRDB 4DBGA 2N9PC 3M3JA 5JZEB 3QIJA 3DOWA 2RGFA 5DPSA 1OQYA 4IUMB 1YQBA 4BOSC 4KDLB 2MRPA 1ZGUB 3DVGX 5CTRC 2AYOB 2LI5A 4WWPA 5DCNA 5AZGA 1ZKHA 2PE6B 2KNBA 1Y8RC 4GXBA 1WXAA 2JRHA 2MBBB 3DCGA 3VHTC 3ZVVA 4BBNC 2O6VD 3KW5B 3APFA 1YIWA 2KLGA 5JHAA 2NCNA 5G2NA 3AU4A 1YJ1A 2KK8A 4W9KA 1XQQA 1J0GA 2IO0B 3I3TB 2PPHA 3M95A 4DHZB 4XX5A 4HJKA 3ZO5B 3QQ8B 4W9FA 4I6LB 2KQSA 1WXMA 4J6IA 3VTVA 2KX0A 2L8JA 2KDIA 4JIOU 2B3AA 3VDZA 1V49A 4WJQA 3K9PB 5JHBA 3EC8A 4WJPA 2HTHA 4FULA 2EKEC 2PJHA 4I6PA 1RAXA 1WM2A 3JVZX 4RMAA 5LXHA 4W9DA 1WXVA 4GGQA 1WI0A 2N9EB 5C1ZA 2MX2A 1SIFA 1WGDA 2KOXA 5IAAC 4TKNA 3V62A 4AUQC 3DVNV 3PRZA 2KJRA 4KDIC 2ASQA 4HXDA 4CO7A 2FUHB 3H9DA 4MSMB 4WWOA 2JRIB 2C5LC 2CHXA 1WJ6A 2W9NA 3NY5A 3QJZA 2BF8B 1K8RB 2KMAA 3QCAA 3CSFA 3AU5A 3JW0X 3NZUA 4M8NA 4BKSA 2LVQA 4MH0E 2VRRB 2IYDB 3T9LA 1FXTB 3PPAA 1S3SG 2AEHA 3PV1A 4NJ6A 3X0WA 4WWNA 4A3PA 4FBJB 2KDFB 2BKFA 2GBKA 3N32A 4N9F4 4CYEA 3PRPB 2EMSA 2IO1B 4ICUA 4XC2A 3PREA 3ENEA 1MG8A 1UELA 4DDGD 4HVBA 2BYEA 2KKCA 1P3QU 4NNJB 3DBSA 1VD2A 2KJHB 3VQIA 4II2B 2KMCA 2KTRB 2XK5B 2O2VB 1GC7A 2CHZA 1JRUA 2KWCA 1LQBA 2KXJA 5CHFA 3WAMA 4MELA 3VAWA 4FHJA 4K1RB 4HCPB 4HWIB 4GU2A 1YX6B 4BBNF 1WX7A 3H6NA 5CX3A 3R7QA 2PEAA 3KYCD 2IO3B 1L7YA 2AL3A 3L13A 1XD3B 2KWUB 3CSTA 1EO6A 4WQOB 3MTNB 2DAJA 1WR6E 4M0WB 4X57B 1AARA 1P98A 1RFAA 2LRUA 3A33B 1V80A 2IY0B 4JGHB 1P0RA 4DHZE 3AXCA 5HKHA 1I35A 2DZJA 2I1JA 1RRBA 2ZVOA 2LD9A 3VH3B 4EUTA 2LVPA 3HM3A 1KLVA 3ZNID 5D2MB 2LJ5A 2LXCA 2FIDA 1IYFA 3VFKA 2G45B 2J7QB 1TTNA 4ASWC 2NBWB 3ZRFA 5LXIB 4IWQA 2O2VA 1WJNA 4BOZB 1E8WA 2NBUA 3APDA 4KIKA 2DAFA 3L0WB 1NDDA 1WZ3A 2G4DB 3PSEB 2LUEA 4IWOA 4IC7B 3VTUA 2NPTA 3M63B 1UGMA 4GMVA 5CHWA 3VXWA 2MW5A 3L10B 4ANUA 1WGHA 2KLCA 1WGYA 4G3XB 3OLMD 3T8MA 3JSVA 3UIPB 3VUXA 3W1SC 1D3ZA 4TV3A 2Z0EB 2A5UA 4G50A 3A4SC 3TL5A 1YD8U 2IZVB 2LGXA 5G55A 2M1MA 1WX8A 4NAWB 1E8ZA 1T0YA 3VVWB 4EFOA 2JT4B 1KJTA 3TIXA 3DDCB 3X23A 1EF1A 3OAWA 1R4MI 4LDTB 1V6EA 2BKRB 2ZEQA 4K7UA 3PLUA 2N1VA 5C23A 2M0XA 1V5TA 2KC1A 3UIOB 1VCBA 2CU1A 2KN5A 1L2NA 2ZPYA 2RD0A 2WX1A 2KDEB 3QWZB 1SE9A 1NBFC 2WYQA 4WJNA 1IPGA 3W1YA 2LVOA 2KO3A 3QC8B 2REXA 5IA7A 2G4SA 2NBVB 3KYDD 1WE6A 2FCSA 1WMHA 2MLBA 1WZ0A 3PHXB 3VUWA 1ZW7A 1OGWA 2A4ZA 3CMMB 4NAWA 3RCZA 3WAPA 4ANWA 2Z59B 4CHKA 3UGBB 4FA6A 3Q3FA 5LLIA 2IY1B 4PS8A 2UYZB 4HK2A 2LGDA 2UWQA 2HD5B 3NZSA 5E6NA 4A3OA 4MGKE 3IVFA 5L95C 4ZRJA 4II3B 3SU8X 3H7PA 1BT0A 1WR1A 3A9KA 3K9OB 4FJYA 3WAOA 2V3SA 4PS7A 3TBLD 3S2AA 1F9JA 4MM3A 2OJRA 3ALBA 3OJ3A 4OVVA 4K81A 3UQAA 5CHVC 2CKHB 3C0RB 4F1SA 4W9JA 1X1MA 4MJSB 3R7RA 2MA9B 4F7ZA 2WX0A 4BKTA 3L54A 4LCDE 3KUZA 1V5OA 2DZMA 1LXDA 2MCNB 4PS3A 1C3TA 4LDTD 2BYVE 3A4RA 1Z5SB 2BPSA 4BFRA 3NOBA 2LASA 2PE9A 1I42A 2DZIA 3M62B 3RULA 4AOFA 5J18A 3IBEA 4KV2A 1OEYA 2CS4A 3DVGY 1IP9A 1TBEA 2ZJDA 2C7HA 3SD5A 3GZNI 2D11A 3IHPC 2L05A 2NVUI 1WGRA 2YLMA 3U30A 2JXXA 4KIKB 3U8ZA 2J0MA 3V61A 4BKGA 3PVLA 4ANXA 3AULA 2KWVB 4BKSD 4FN2A 2OOBB 2NPTB 2KX3A 3A9JB 3ZIMA 2L76A 4EZLA 2N7DA 5AEKB 1WM3A 5FR6A 2MP2A 4MJSA 5D6JB 1PQSA 4ICVA 3APCA 2DYOA 2LXAA 3QAQA 1GJZA 1WE7A 1HE8A 3JSVB 3VUYA 1V2YA 4GIVA 1C1YB 3KH0A 5BO4B 4DDID 2MQJA 2ZCBA 2N4FA 2L0TA 5E6OA 2C60A 2ZZPB 3TMPB 3UF8A 4DHJB 3D32A 2ZPNA 3DBHI 4MSQB 4W9CA 2RSUA 3A1QB 5DPWA 2JWZA 2MBEA 3ONSA 4GDLA 4LJOB 4HDQA 3ZNGC 4MGYE 4JLCA 4MDKE 2KANA 2RR9A 2ZVNA 2V1YA 4M8MA 4LJPB 5KHOA 3DPDA 2EMTA 3MJWA 4JL9A 4KZCA 2ZNVB 2KFJA 1P9DU 3WALA 4TQ1A 2KFKB 3GOEA 3EFUA 4PYUA 3A9JA 4W9GA 5DPTA 2HE7A 2KDBA 1Z2MA 3PT2B 2AWTA 3ML9A 5L83A 4IG7B 2O6VB 4HCNB 3B1LX 2XBBC 1Q5WB 4RM8A 3LJ3A 4GSWA 2DENB 2D10A 2DZKA 4P7IA 1UBQA 1E8YA 2FCMA 2V4LA 1M94A 4NPNA 1V86A 3A1QA 2KVRA 3PHWB 1WF9A 1WMHB 4EKUA 4IM3A 3UINB 3N3KB 3PTFC 3H7SA 4WAAA 3ZTCA 3H1UA 3RD2A 2YVCA 2C7MB 3MHSD 1S1QB 1UBIA 2M8SA 1E5WA 2GBNA 3OJ4B 1WJ4A 2K1FA 3V6EB 1LM8B 1UD7A 4OVUA 2NR2A 2KFKA 4FJVB 5J2RA 1GUAB 2L3ZA 5JH5C 2FNJB 1G6JA 3H7PB 4ZRIA 3A9KB 1H4RA 5E6PA 2DHZA 2BYFA 2D07B 2IBIB 2ZNVC 2GMIC 2L7RA 3L08A 4DK5A 2GOWA 2JUOA 2O6VA 2G3QB 2R2QA 2LWPA 3L16A 4IM0A 1TGZB 1Q0WB 3BY4B 3V60A 4ZDVA 4YL8A 2XEWA 2KHWB 3ZTDA 2RPQA 2HJ8A 3U7DA 3DBRI 3ZDTA 4E74A 5J17A 1NI2A 3QX1A 1WJUA 4KVGB 3QK0A 2K8HA 1GG3A 1WFYA 2J0KA 2M4NA 3ZLZA 4NJ7A 3ZNHB 2GBRA 3ZNZB 3N30A 4GOCA 2LZ6A 2Z0DB 4W9LA 3VTWA 2CHWA 3ZDMC 4URKA 3KUCB 4MGIE 3WA0A 1YX5B 4GB9A 1XT9B 1LFDA 5DPRA 4B6WA 3PS6A 4ZRKA 4PYZA 2L0FA 2D3GA 4EOYA 3VH4B 2C9WB 4AP4C 1H8CA 2KZRA 2AL6A 2GBJA 5AZFA 1R4NI 2K39A 3KVFB 3PGEA 4B95A 3B0AA 2WWZA 2MP2B 3QARA 3PZDA 4GDKA 4NQKE 4RM9A 3NS8A 2C7NB 4FJZA 4A20A 1SGHA 4ANVA 4DWFA 2KJ6A 4W9EA 4HPLB 4MEMA 1EF5A 1WYWB 2FIFA 5GMVA 3DQVA 4I6NB 2K6DB 4HPMB 5TR5A 2WDTB 2KD0A 4G0NB 2N7EA 3QA8A 4NQLB 2J0JA 4IW0A 4B9KA 3TCAA 4TUUA 4FLHA 2MBQA 4GDLB 4KZ0A 1WXSA 2NS5A 2N9XA 3ML8A 2IO2B 3HM6X 3ZW3A 1WIAA 3HK0A 2MWSB 4E71A 3EECA 3RUIB 4KSKC 1P1AA 1WY8A 3ZUNA 1E8XA 4W9HA 3RYTA 2JZZA 2KTFA 2K8BA 3L17A 2M17A 2K6QA 2CR5A 1J8CA 4IWPA 1U4AA 4K7WA 4KSLC 3R3MA 3O65B 2MBHA 4TQ0A 5AZHA 4E3CA 4WJOA 3AI5A 1UZXB 1ISNA 1EUVB 3DBLI 3TJPA 4ZYNA 2QHOA 4F8CB 1E7UA 4BVUC 2DYMA 4EZKA 3PLVA 4JQWC 3SHQA 2DYBA 1V81A 4IM2A 3R66C 2BGFA 3QHTA 3WIMA 2K8CA 3JYUA 2JPHA 3PRMB 1UH6A 1WGGA 2FAZA 2ZCCA 1KM7A 1E7VA 2MSED 2JZ3B 2R2OA 3CF6E 3BINA 4XZ4A 5D7GA 3EHVA 3UQBA 1E90A 1OEYJ 2DX5B 2N1WA 2D2QA 3B08A 4AJWA 3KUDB 1CMXB 1TZ1A 4HDOA 2JY6A 3LDZE 2JF5A 4AWJA 4FADA 2KTRA 2K25A 2XK5A 3IG3A 4MGZE 3V6CB 1RLFA 2KC2A 2LRWA 2FCNA 4NY0A 4K7SA 2GBMA 3ZRCA 5KHQA 4EEWA 3IFWB 3RT3B 3W1SA 4EZJA 2I1KA 2JVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZW C;  4G11 A;  3DVN U;  2LGY A;  1Q1O A;  1J19 A;  1V9J A;  4FHK A;  3RZF A;  4AJY B;  1QZE A;  4W9I A;  2BWE S;  2BWF A;  3Q3J A;  4DXA B;  2KQ7 A;  1KOT A;  5D94 A;  2MBO A;  4DHJ D;  4GN1 A;  3HHM A;  1GNU A;  2Y5B B;  3HIZ A;  3WAN A;  3ECI A;  3ZKJ C;  3P2B A;  5EDS A;  1GC6 A;  2L00 B;  1WX9 A;  4HLE A;  1A5R A;  3SDL C;  4GDK B;  1WH3 A;  3NHE B;  1OTR B;  2FCQ A;  1WRD B;  4DBG A;  2N9P C;  3M3J A;  5JZE B;  3QIJ A;  3DOW A;  2RGF A;  5DPS A;  1OQY A;  4IUM B;  1YQB A;  4BOS C;  4KDL B;  2MRP A;  1ZGU B;  3DVG X;  5CTR C;  2AYO B;  2LI5 A;  4WWP A;  5DCN A;  5AZG A;  1ZKH A;  2PE6 B;  2KNB A;  1Y8R C;  4GXB A;  1WXA A;  2JRH A;  2MBB B;  3DCG A;  3VHT C;  3ZVV A;  4BBN C;  2O6V D;  3KW5 B;  3APF A;  1YIW A;  2KLG A;  5JHA A;  2NCN A;  5G2N A;  3AU4 A;  1YJ1 A;  2KK8 A;  4W9K A;  1XQQ A;  1J0G A;  2IO0 B;  3I3T B;  2PPH A;  3M95 A;  4DHZ B;  4XX5 A;  4HJK A;  3ZO5 B;  3QQ8 B;  4W9F A;  4I6L B;  2KQS A;  1WXM A;  4J6I A;  3VTV A;  2KX0 A;  2L8J A;  2KDI A;  4JIO U;  2B3A A;  3VDZ A;  1V49 A;  4WJQ A;  3K9P B;  5JHB A;  3EC8 A;  4WJP A;  2HTH A;  4FUL A;  2EKE C;  2PJH A;  4I6P A;  1RAX A;  1WM2 A;  3JVZ X;  4RMA A;  5LXH A;  4W9D A;  1WXV A;  4GGQ A;  1WI0 A;  2N9E B;  5C1Z A;  2MX2 A;  1SIF A;  1WGD A;  2KOX A;  5IAA C;  4TKN A;  3V62 A;  4AUQ C;  3DVN V;  3PRZ A;  2KJR A;  4KDI C;  2ASQ A;  4HXD A;  4CO7 A;  2FUH B;  3H9D A;  4MSM B;  4WWO A;  2JRI B;  2C5L C;  2CHX A;  1WJ6 A;  2W9N A;  3NY5 A;  3QJZ A;  2BF8 B;  1K8R B;  2KMA A;  3QCA A;  3CSF A;  3AU5 A;  3JW0 X;  3NZU A;  4M8N A;  4BKS A;  2LVQ A;  4MH0 E;  2VRR B;  2IYD B;  3T9L A;  1FXT B;  3PPA A;  1S3S G;  2AEH A;  3PV1 A;  4NJ6 A;  3X0W A;  4WWN A;  4A3P A;  4FBJ B;  2KDF B;  2BKF A;  2GBK A;  3N32 A;  4N9F 4;  4CYE A;  3PRP B;  2EMS A;  2IO1 B;  4ICU A;  4XC2 A;  3PRE A;  3ENE A;  1MG8 A;  1UEL A;  4DDG D;  4HVB A;  2BYE A;  2KKC A;  1P3Q U;  4NNJ B;  3DBS A;  1VD2 A;  2KJH B;  3VQI A;  4II2 B;  2KMC A;  2KTR B;  2XK5 B;  2O2V B;  1GC7 A;  2CHZ A;  1JRU A;  2KWC A;  1LQB A;  2KXJ A;  5CHF A;  3WAM A;  4MEL A;  3VAW A;  4FHJ A;  4K1R B;  4HCP B;  4HWI B;  4GU2 A;  1YX6 B;  4BBN F;  1WX7 A;  3H6N A;  5CX3 A;  3R7Q A;  2PEA A;  3KYC D;  2IO3 B;  1L7Y A;  2AL3 A;  3L13 A;  1XD3 B;  2KWU B;  3CST A;  1EO6 A;  4WQO B;  3MTN B;  2DAJ A;  1WR6 E;  4M0W B;  4X57 B;  1AAR A;  1P98 A;  1RFA A;  2LRU A;  3A33 B;  1V80 A;  2IY0 B;  4JGH B;  1P0R A;  4DHZ E;  3AXC A;  5HKH A;  1I35 A;  2DZJ A;  2I1J A;  1RRB A;  2ZVO A;  2LD9 A;  3VH3 B;  4EUT A;  2LVP A;  3HM3 A;  1KLV A;  3ZNI D;  5D2M B;  2LJ5 A;  2LXC A;  2FID A;  1IYF A;  3VFK A;  2G45 B;  2J7Q B;  1TTN A;  4ASW C;  2NBW B;  3ZRF A;  5LXI B;  4IWQ A;  2O2V A;  1WJN A;  4BOZ B;  1E8W A;  2NBU A;  3APD A;  4KIK A;  2DAF A;  3L0W B;  1NDD A;  1WZ3 A;  2G4D B;  3PSE B;  2LUE A;  4IWO A;  4IC7 B;  3VTU A;  2NPT A;  3M63 B;  1UGM A;  4GMV A;  5CHW A;  3VXW A;  2MW5 A;  3L10 B;  4ANU A;  1WGH A;  2KLC A;  1WGY A;  4G3X B;  3OLM D;  3T8M A;  3JSV A;  3UIP B;  3VUX A;  3W1S C;  1D3Z A;  4TV3 A;  2Z0E B;  2A5U A;  4G50 A;  3A4S C;  3TL5 A;  1YD8 U;  2IZV B;  2LGX A;  5G55 A;  2M1M A;  1WX8 A;  4NAW B;  1E8Z A;  1T0Y A;  3VVW B;  4EFO A;  2JT4 B;  1KJT A;  3TIX A;  3DDC B;  3X23 A;  1EF1 A;  3OAW A;  1R4M I;  4LDT B;  1V6E A;  2BKR B;  2ZEQ A;  4K7U A;  3PLU A;  2N1V A;  5C23 A;  2M0X A;  1V5T A;  2KC1 A;  3UIO B;  1VCB A;  2CU1 A;  2KN5 A;  1L2N A;  2ZPY A;  2RD0 A;  2WX1 A;  2KDE B;  3QWZ B;  1SE9 A;  1NBF C;  2WYQ A;  4WJN A;  1IPG A;  3W1Y A;  2LVO A;  2KO3 A;  3QC8 B;  2REX A;  5IA7 A;  2G4S A;  2NBV B;  3KYD D;  1WE6 A;  2FCS A;  1WMH A;  2MLB A;  1WZ0 A;  3PHX B;  3VUW A;  1ZW7 A;  1OGW A;  2A4Z A;  3CMM B;  4NAW A;  3RCZ A;  3WAP A;  4ANW A;  2Z59 B;  4CHK A;  3UGB B;  4FA6 A;  3Q3F A;  5LLI A;  2IY1 B;  4PS8 A;  2UYZ B;  4HK2 A;  2LGD A;  2UWQ A;  2HD5 B;  3NZS A;  5E6N A;  4A3O A;  4MGK E;  3IVF A;  5L95 C;  4ZRJ A;  4II3 B;  3SU8 X;  3H7P A;  1BT0 A;  1WR1 A;  3A9K A;  3K9O B;  4FJY A;  3WAO A;  2V3S A;  4PS7 A;  3TBL D;  3S2A A;  1F9J A;  4MM3 A;  2OJR A;  3ALB A;  3OJ3 A;  4OVV A;  4K81 A;  3UQA A;  5CHV C;  2CKH B;  3C0R B;  4F1S A;  4W9J A;  1X1M A;  4MJS B;  3R7R A;  2MA9 B;  4F7Z A;  2WX0 A;  4BKT A;  3L54 A;  4LCD E;  3KUZ A;  1V5O A;  2DZM A;  1LXD A;  2MCN B;  4PS3 A;  1C3T A;  4LDT D;  2BYV E;  3A4R A;  1Z5S B;  2BPS A;  4BFR A;  3NOB A;  2LAS A;  2PE9 A;  1I42 A;  2DZI A;  3M62 B;  3RUL A;  4AOF A;  5J18 A;  3IBE A;  4KV2 A;  1OEY A;  2CS4 A;  3DVG Y;  1IP9 A;  1TBE A;  2ZJD A;  2C7H A;  3SD5 A;  3GZN I;  2D11 A;  3IHP C;  2L05 A;  2NVU I;  1WGR A;  2YLM A;  3U30 A;  2JXX A;  4KIK B;  3U8Z A;  2J0M A;  3V61 A;  4BKG A;  3PVL A;  4ANX A;  3AUL A;  2KWV B;  4BKS D;  4FN2 A;  2OOB B;  2NPT B;  2KX3 A;  3A9J B;  3ZIM A;  2L76 A;  4EZL A;  2N7D A;  5AEK B;  1WM3 A;  5FR6 A;  2MP2 A;  4MJS A;  5D6J B;  1PQS A;  4ICV A;  3APC A;  2DYO A;  2LXA A;  3QAQ A;  1GJZ A;  1WE7 A;  1HE8 A;  3JSV B;  3VUY A;  1V2Y A;  4GIV A;  1C1Y B;  3KH0 A;  5BO4 B;  4DDI D;  2MQJ A;  2ZCB A;  2N4F A;  2L0T A;  5E6O A;  2C60 A;  2ZZP B;  3TMP B;  3UF8 A;  4DHJ B;  3D32 A;  2ZPN A;  3DBH I;  4MSQ B;  4W9C A;  2RSU A;  3A1Q B;  5DPW A;  2JWZ A;  2MBE A;  3ONS A;  4GDL A;  4LJO B;  4HDQ A;  3ZNG C;  4MGY E;  4JLC A;  4MDK E;  2KAN A;  2RR9 A;  2ZVN A;  2V1Y A;  4M8M A;  4LJP B;  5KHO A;  3DPD A;  2EMT A;  3MJW A;  4JL9 A;  4KZC A;  2ZNV B;  2KFJ A;  1P9D U;  3WAL A;  4TQ1 A;  2KFK B;  3GOE A;  3EFU A;  4PYU A;  3A9J A;  4W9G A;  5DPT A;  2HE7 A;  2KDB A;  1Z2M A;  3PT2 B;  2AWT A;  3ML9 A;  5L83 A;  4IG7 B;  2O6V B;  4HCN B;  3B1L X;  2XBB C;  1Q5W B;  4RM8 A;  3LJ3 A;  4GSW A;  2DEN B;  2D10 A;  2DZK A;  4P7I A;  1UBQ A;  1E8Y A;  2FCM A;  2V4L A;  1M94 A;  4NPN A;  1V86 A;  3A1Q A;  2KVR A;  3PHW B;  1WF9 A;  1WMH B;  4EKU A;  4IM3 A;  3UIN B;  3N3K B;  3PTF C;  3H7S A;  4WAA A;  3ZTC A;  3H1U A;  3RD2 A;  2YVC A;  2C7M B;  3MHS D;  1S1Q B;  1UBI A;  2M8S A;  1E5W A;  2GBN A;  3OJ4 B;  1WJ4 A;  2K1F A;  3V6E B;  1LM8 B;  1UD7 A;  4OVU A;  2NR2 A;  2KFK A;  4FJV B;  5J2R A;  1GUA B;  2L3Z A;  5JH5 C;  2FNJ B;  1G6J A;  3H7P B;  4ZRI A;  3A9K B;  1H4R A;  5E6P A;  2DHZ A;  2BYF A;  2D07 B;  2IBI B;  2ZNV C;  2GMI C;  2L7R A;  3L08 A;  4DK5 A;  2GOW A;  2JUO A;  2O6V A;  2G3Q B;  2R2Q A;  2LWP A;  3L16 A;  4IM0 A;  1TGZ B;  1Q0W B;  3BY4 B;  3V60 A;  4ZDV A;  4YL8 A;  2XEW A;  2KHW B;  3ZTD A;  2RPQ A;  2HJ8 A;  3U7D A;  3DBR I;  3ZDT A;  4E74 A;  5J17 A;  1NI2 A;  3QX1 A;  1WJU A;  4KVG B;  3QK0 A;  2K8H A;  1GG3 A;  1WFY A;  2J0K A;  2M4N A;  3ZLZ A;  4NJ7 A;  3ZNH B;  2GBR A;  3ZNZ B;  3N30 A;  4GOC A;  2LZ6 A;  2Z0D B;  4W9L A;  3VTW A;  2CHW A;  3ZDM C;  4URK A;  3KUC B;  4MGI E;  3WA0 A;  1YX5 B;  4GB9 A;  1XT9 B;  1LFD A;  5DPR A;  4B6W A;  3PS6 A;  4ZRK A;  4PYZ A;  2L0F A;  2D3G A;  4EOY A;  3VH4 B;  2C9W B;  4AP4 C;  1H8C A;  2KZR A;  2AL6 A;  2GBJ A;  5AZF A;  1R4N I;  2K39 A;  3KVF B;  3PGE A;  4B95 A;  3B0A A;  2WWZ A;  2MP2 B;  3QAR A;  3PZD A;  4GDK A;  4NQK E;  4RM9 A;  3NS8 A;  2C7N B;  4FJZ A;  4A20 A;  1SGH A;  4ANV A;  4DWF A;  2KJ6 A;  4W9E A;  4HPL B;  4MEM A;  1EF5 A;  1WYW B;  2FIF A;  5GMV A;  3DQV A;  4I6N B;  2K6D B;  4HPM B;  5TR5 A;  2WDT B;  2KD0 A;  4G0N B;  2N7E A;  3QA8 A;  4NQL B;  2J0J A;  4IW0 A;  4B9K A;  3TCA A;  4TUU A;  4FLH A;  2MBQ A;  4GDL B;  4KZ0 A;  1WXS A;  2NS5 A;  2N9X A;  3ML8 A;  2IO2 B;  3HM6 X;  3ZW3 A;  1WIA A;  3HK0 A;  2MWS B;  4E71 A;  3EEC A;  3RUI B;  4KSK C;  1P1A A;  1WY8 A;  3ZUN A;  1E8X A;  4W9H A;  3RYT A;  2JZZ A;  2KTF A;  2K8B A;  3L17 A;  2M17 A;  2K6Q A;  2CR5 A;  1J8C A;  4IWP A;  1U4A A;  4K7W A;  4KSL C;  3R3M A;  3O65 B;  2MBH A;  4TQ0 A;  5AZH A;  4E3C A;  4WJO A;  3AI5 A;  1UZX B;  1ISN A;  1EUV B;  3DBL I;  3TJP A;  4ZYN A;  2QHO A;  4F8C B;  1E7U A;  4BVU C;  2DYM A;  4EZK A;  3PLV A;  4JQW C;  3SHQ A;  2DYB A;  1V81 A;  4IM2 A;  3R66 C;  2BGF A;  3QHT A;  3WIM A;  2K8C A;  3JYU A;  2JPH A;  3PRM B;  1UH6 A;  1WGG A;  2FAZ A;  2ZCC A;  1KM7 A;  1E7V A;  2MSE D;  2JZ3 B;  2R2O A;  3CF6 E;  3BIN A;  4XZ4 A;  5D7G A;  3EHV A;  3UQB A;  1E90 A;  1OEY J;  2DX5 B;  2N1W A;  2D2Q A;  3B08 A;  4AJW A;  3KUD B;  1CMX B;  1TZ1 A;  4HDO A;  2JY6 A;  3LDZ E;  2JF5 A;  4AWJ A;  4FAD A;  2KTR A;  2K25 A;  2XK5 A;  3IG3 A;  4MGZ E;  3V6C B;  1RLF A;  2KC2 A;  2LRW A;  2FCN A;  4NY0 A;  4K7S A;  2GBM A;  3ZRC A;  5KHQ A;  4EEW A;  3IFW B;  3RT3 B;  3W1S A;  4EZJ A;  2I1K A;  2JVC A; 
#chains in the Genus database with same CATH topology
 3RZW C;  4G11 A;  1Q1O A;  4OZB A;  4DQO C;  5H92 C;  4RH6 A;  3RZF A;  2BWF A;  2PLP A;  3Q3J A;  5D94 A;  2MBO A;  2VH2 A;  4H2A A;  5EE1 A;  5H8Y E;  2DNF A;  3DBL B;  1F77 A;  4PK1 A;  3ZKJ C;  1A5R A;  1WX9 A;  4GDK B;  2XN9 C;  5DPS A;  1OQY A;  1YQB A;  1PYW D;  2AYO B;  4WWP A;  1WXA A;  2JRH A;  3VHT C;  1QT9 A;  3GE8 C;  1IGC A;  2V4I B;  1QIL A;  5JHA A;  3BII D;  2B76 B;  3AU4 A;  1J0G A;  3Q3N C;  3M95 A;  4DHZ B;  3ZO5 B;  2WU5 B;  3FIL B;  4W9F A;  4I6L B;  1CK1 A;  4J6I A;  2L8J A;  2CJN A;  2KDI A;  2EKE C;  2PJH A;  5LXH A;  1IGD A;  4W9D A;  1FNW A;  3Q6B A;  4GGQ A;  2XNA C;  4XYC A;  1SIF A;  4TKN A;  4AUQ C;  2ASQ A;  3EA6 A;  1TYG B;  1MHH E;  1N60 A;  4WH4 A;  3AU5 A;  3NZU A;  2LVQ A;  3T9L A;  5C2T B;  1ZE3 D;  1BUI C;  4WWN A;  4BAX A;  2M19 A;  3PRP B;  3PRE A;  1MG8 A;  4DDG D;  4HVB A;  2VZK B;  2KWC A;  1LQB A;  5CHF A;  2D3C A;  4FHJ A;  4K1R B;  4HCP B;  3AE8 B;  1QOG A;  3W9C B;  1AN8 A;  5BMH A;  3VRB B;  1R4N B;  4YSZ B;  1P98 A;  1GB4 A;  2LRU A;  3A33 B;  1WGK A;  4DHZ E;  2IY0 B;  5E6J A;  2I1J A;  2KQ4 X;  2ZVO A;  2LD9 A;  4FXC A;  2G45 B;  3E56 A;  3ZRF A;  4KIK A;  3TUO A;  1NDD A;  1WZ3 A;  3I63 C;  2G4D B;  2J52 A;  4IWO A;  5TSS A;  3VTU A;  1ZPS A;  1UGM A;  3AE7 B;  3L10 B;  4ANU A;  4G3X B;  4C7Y A;  1AWD A;  5T8I A;  3VUX A;  3W1S C;  3MC9 A;  4G50 A;  2W54 A;  2WXL A;  3TL5 A;  3MP9 A;  2BS3 B;  2YEP B;  3IXS A;  1YMH E;  1FNU A;  1XLN A;  1UWX A;  2JT4 B;  3X23 A;  3DDC B;  4LNF A;  1EF1 A;  1WXQ A;  2TSS A;  3OAW A;  1SIJ A;  4LDT B;  1V6E A;  5C23 A;  2M0X A;  2WHI A;  1VCB A;  1FO4 A;  1L2N A;  4MM3 B;  1FEH A;  2WX1 A;  2KDE B;  3RFZ B;  2WDV B;  2WYQ A;  2JWU A;  1DOY A;  2WXH A;  5IA7 A;  2RDH A;  3KYD D;  4P6V F;  2MLB A;  1OGW A;  2K22 A;  4NAW A;  3WAP A;  3Q3F A;  2L52 A;  2WLB A;  2UYZ B;  4B0M A;  3AEE B;  2IPK D;  1YN3 A;  5IOI A;  2UWQ A;  4A3O A;  4ZRJ A;  3SU8 X;  2HTM E;  2V3S A;  1MPE A;  3KWV A;  3S2A A;  1F9J A;  3ALB A;  2QIE B;  5IN7 A;  3AE1 B;  3C0R B;  4F1S A;  3L54 A;  1LXD A;  4PS3 A;  5MPO A;  2BPS A;  3NOB A;  2DZI A;  3DWG C;  3DVG Y;  3SD5 A;  2ICI A;  3IHP C;  2NTT A;  2YLM A;  3U30 A;  1RWS A;  4KIK B;  3U8Z A;  1QF6 A;  2LHD A;  4BKS D;  1YQ4 B;  2ACZ B;  5GXG B;  2KX3 A;  4EZL A;  2N7D A;  1WM3 A;  5FR6 A;  1I4X A;  2MP2 A;  5D6J B;  4ICV A;  2DYO A;  1SJE D;  2LXA A;  1GJZ A;  3VUY A;  5BO4 B;  4DHJ B;  2ZZP B;  3UF8 A;  1QOB A;  3RN9 C;  1PGB A;  2ZPN A;  3DBH I;  2RSU A;  5DPW A;  3Q3O C;  2WNM A;  3ZJT A;  2JWZ A;  4GDL A;  2KAN A;  1DOX A;  2WGS A;  5KHO A;  2KFJ A;  1P9D U;  3WCQ A;  2N0S B;  4TQ1 A;  2H88 B;  2WXQ A;  2KYW A;  5DPT A;  2HE7 A;  1Z2M A;  1LO5 D;  3TEZ A;  1FRR A;  1Q5W B;  4GSW A;  3AM9 A;  2JSV X;  1PGX A;  2W3S A;  1UBQ A;  2DLB A;  1V86 A;  3A1Q A;  4IM3 A;  2SAK A;  3N3K B;  3H7S A;  1B1Z A;  3RD2 A;  2YVC A;  2Q5W D;  1Y56 A;  2M8S A;  1E5W A;  4OHJ A;  3NVV A;  1V1O A;  1STE A;  3V6E B;  3Q8C A;  2KFK A;  5J2R A;  1HXY D;  2L3Z A;  5JH5 C;  2FNJ B;  1G6J A;  4ZRI A;  1H4R A;  5E6P A;  2DHZ A;  2BYF A;  2IBI B;  2JUO A;  2G3Q B;  1TGZ B;  1E9M A;  4YL8 A;  1TKY A;  2KDM A;  3DBH B;  2HJ8 A;  1TJE A;  3DBR I;  5J17 A;  4REZ A;  5BYQ A;  2OJW A;  1E10 A;  2J0K A;  1WWT A;  3AN1 A;  2WDR B;  1ESF A;  4NJ7 A;  3ZNH B;  1NYR A;  4GOC A;  3VTW A;  4EE2 A;  1LGR A;  1H8C A;  2D3G A;  2GBJ A;  4ARI A;  1MJD A;  3KVF B;  2MP2 B;  3PZD A;  4NQK E;  4ANV A;  4DWF A;  4FJZ A;  4A20 A;  5AEK B;  1RM6 C;  2KJ6 A;  1EF5 A;  2FIF A;  2OHF A;  3L4P A;  1ET6 A;  2K6D B;  4HPM B;  4OZC A;  4NQL B;  2WDQ B;  4US8 A;  2MBQ A;  4GDL B;  4S0R A;  2E3T A;  2IND C;  3HM6 X;  1L0X B;  3RUI B;  1L6V A;  4LNO A;  2M17 A;  3DBR B;  4K7W A;  2GB1 A;  4E3C A;  3AI5 A;  2K0P A;  4F8C B;  1C9F A;  1J7A A;  1VZ6 A;  2DYB A;  1V81 A;  1TY0 A;  3R66 C;  3N9Y C;  5G5G A;  4LNI A;  1P7F A;  1D4B A;  1F0Z A;  2R2O A;  5D7G A;  1JWB D;  3PO0 A;  3Q8E A;  3Q69 A;  2H89 B;  1RFK A;  2D2Q A;  2IGD A;  5EE9 A;  3LDZ E;  1EWC A;  4AWJ A;  3NVZ A;  2XK5 A;  2J42 A;  4C56 C;  2LRW A;  3SFD B;  4NY0 A;  3ZQ4 A;  5KHQ A;  2WXP A;  2I1K A;  1KLV A;  2JVC A;  4WQM A;  2LGY A;  1UF0 A;  1J19 A;  1V9J A;  4N6E B;  2N9L A;  2M0A A;  4M0W A;  3C19 A;  4W9I A;  2BWE S;  4LTU A;  3RNF C;  1KOT A;  1PUT A;  4DHJ D;  1GNU A;  1FRD A;  3WAN A;  3ECI A;  1KFY B;  1GC6 A;  4ITK A;  4HLE A;  5EDS A;  1FD6 A;  2PVG C;  1WH3 A;  1WRD B;  4DBG A;  2N9P C;  1JAL A;  1ZGU B;  5CTR C;  1VR9 A;  2LI5 A;  5AZG A;  1ZKH A;  1Y8R C;  2MBB B;  4BBN C;  4YSY B;  2NCN A;  1XQQ A;  1C77 A;  1IUE A;  3BK2 A;  3I3T B;  1SE4 A;  1JQ4 A;  5IO9 A;  4XX5 A;  1WXM A;  4WJQ A;  2L83 A;  4FUL A;  4RMA A;  3JVZ X;  1PFD A;  3TSS A;  1I4R A;  2FBW B;  3NVW A;  1NI3 A;  4A55 A;  5C1Z A;  2KOX A;  5IAA C;  3DVN V;  3PRZ A;  4KDI C;  3MC8 A;  1WSP A;  4HXD A;  3H9D A;  4MSM B;  4WWO A;  2JRI B;  3MC0 B;  3NY5 A;  1K8R B;  1I4G A;  3QCA A;  4BKS A;  3JW0 X;  4MH0 E;  2VRR B;  1FXT B;  2AEH A;  1L6U A;  2IGG A;  3U2S C;  3BVZ A;  1ZOY B;  4N9F 4;  3I5J C;  4ICU A;  1F1H A;  3ENE A;  1ZXH A;  3SFE B;  1P3Q U;  2KJH B;  2PW9 A;  2XK5 B;  4O1N A;  5I4D A;  1YOV B;  4MEL A;  4KKI A;  3ZXV A;  3AEA B;  1N61 A;  4HWI B;  3HUI A;  4GU2 A;  1WX7 A;  4KX6 B;  2JYT A;  1XD3 B;  4WQO B;  1EO6 A;  1WR6 E;  4JE3 B;  4M0W B;  1AAR A;  1P0R A;  2UU7 A;  3AXC A;  1I35 A;  1RRB A;  4K3C A;  1WYG A;  3HM3 A;  1E6E B;  3SEB A;  3ZNI D;  5D2M B;  3BVM A;  2FID A;  1IYF A;  2J7Q B;  3P4Q B;  1FCL A;  1SXT A;  4BOZ B;  3L0W B;  2N7J A;  1XO3 A;  1BML C;  3IT6 B;  3PSE B;  4NJC A;  1FM0 D;  4GMV A;  2JZP A;  2MW5 A;  2KLC A;  3T8M A;  3UIP B;  2AQ3 B;  2Z0E B;  3A4S C;  1XCQ L;  1YD8 U;  2IZV B;  2WXR A;  5G55 A;  2M1M A;  1WX8 A;  1E8Z A;  3Q8B A;  4ZOH C;  3NJT A;  1NEN B;  2ZEQ A;  4K7U A;  2KT7 A;  3PLU A;  4YTN B;  3NS1 A;  2CU1 A;  2PVO D;  4P1B C;  2KAC A;  3N1Z C;  2G9H D;  2V9H A;  2Z8L A;  2KO3 A;  1TKG A;  2FCS A;  2RDB C;  5FR3 A;  1ZW7 A;  2A4Z A;  4ANW A;  2Z59 B;  4FA6 A;  3UGB B;  1VLB A;  1ZXI A;  5LLI A;  2ON8 A;  4PS8 A;  3E9S A;  4RGN A;  5E6N A;  3IVF A;  1WR1 A;  3A9K A;  3HRD D;  4PS7 A;  4MM3 A;  3UQA A;  5CHV C;  2BVC A;  3P1M A;  4S17 A;  2WX0 A;  3BVG A;  4A9A A;  1KLU D;  2BYV E;  1TY2 A;  5D3D A;  4BFR A;  3DWM A;  1I42 A;  3IBE A;  1OEY A;  1TBE A;  2ZJD A;  1N5X A;  2N9K A;  1WGR A;  2J0M A;  3V61 A;  3PVL A;  4ANX A;  1EU4 A;  1ZP0 B;  3A9J B;  2L76 A;  2R61 A;  3ZJU A;  1F52 A;  1PQS A;  3APC A;  4A8X C;  1PDX A;  1C1Y B;  4DDI D;  2MQJ A;  4XWT A;  1UWM A;  1C76 A;  3D32 A;  4W9C A;  2OED A;  4LJO B;  3BYT B;  4MGY E;  4JLC A;  4M8M A;  3MJW A;  4KZC A;  3NZ3 A;  2ZNV B;  4WUR A;  4OZA A;  4YWG G;  5L83 A;  4M00 A;  1K52 A;  1YN5 A;  2XBB C;  1T0R C;  4RM8 A;  3OG5 A;  3AEG B;  1HZ5 A;  5D3I B;  1UGJ A;  2V4L A;  1M94 A;  1VRA B;  4NPN A;  3W5U B;  4UDU C;  1WF9 A;  3UIN B;  3ZTC A;  1FFU A;  4RCO A;  3H1U A;  1N5W A;  2C7M B;  1S1Q B;  2X8X X;  3OJ4 B;  4OVU A;  4N58 A;  2RDG A;  1GUA B;  3A9K B;  2D07 B;  3H8H A;  3L08 A;  3L16 A;  4ZDV A;  2LUM A;  2XEW A;  3ZTD A;  1DGJ A;  4DXF A;  1NI2 A;  3QX1 A;  4KVG B;  2K8H A;  3R2I A;  2M4N A;  3RNB C;  3N30 A;  2Z0D B;  2V3P A;  4W9L A;  4RGO S;  2QJL A;  4MGI E;  2EKI A;  4ZRK A;  2MJD A;  4PYZ A;  3AH7 A;  4EOY A;  2VH1 A;  2Y5C A;  4LK0 M;  4JWU C;  2K39 A;  3PGE A;  2BBC A;  1AYF A;  4RM9 A;  4W9E A;  1L0Y B;  5GMV A;  2PIA A;  1V1P A;  2N7E A;  3QA8 A;  2JYE A;  2L1A A;  4IW0 A;  4B9K A;  1GB1 A;  3TCA A;  4FLH A;  3AE5 B;  2QEJ C;  2MWS B;  1ZDV A;  4W9H A;  3RYT A;  2JZZ A;  2KTF A;  2K8B A;  3L17 A;  2CR5 A;  1HZ6 A;  4IWP A;  3O65 B;  1YN4 A;  1FIQ A;  4WJO A;  1ISN A;  1EUV B;  2QHO A;  4BVU C;  3OWE B;  3PLV A;  1C79 A;  3SHQ A;  3BK1 A;  4MAC A;  2JPH A;  3RNC C;  2ZCC A;  3CF6 E;  3BIN A;  3EHV A;  4NZL B;  2AX5 A;  1K50 A;  4RF1 A;  3B2G A;  1K51 A;  1M4V A;  3NVY A;  4AJW A;  1CMX B;  1TZ1 A;  2AQ2 B;  4HDO A;  1SE2 A;  2JF5 A;  2WXM A;  4FAD A;  2KTR A;  1YNT E;  3V6C B;  1RLF A;  2FCN A;  2GBM A;  3ZRC A;  2D5G A;  3IFW B;  3RT3 B;  2EEL A;  3VR9 B;  2BQQ A;  1QQR A;  4ZHP A;  4AJY B;  1QZE A;  3U7Z A;  5EE3 A;  1YJJ A;  4DXA B;  2KQ7 A;  1GPX A;  4GN1 A;  3HHM A;  3Q2A C;  1JWU D;  3P2B A;  3VRA B;  1L5P A;  3SDL C;  2MHJ A;  3NHE B;  4TMA B;  5IP4 D;  4PT5 A;  3M3J A;  5JZE B;  3QIJ A;  2E6X A;  3AE2 B;  2V3N A;  4KDL B;  1XLQ A;  1V1P B;  5DCN A;  2PE6 B;  4XDD A;  4C4V B;  2KNB A;  4GXB A;  3DCG A;  3APF A;  3Q3M C;  1KH0 A;  5G2N A;  2WXF A;  1YJ1 A;  1SSN A;  2IO0 B;  1KLG D;  4HJK A;  1D5X C;  2PMV A;  3AEB B;  2KQS A;  1FMA D;  2HDE A;  2KX0 A;  2B3A A;  3K9P B;  3Q8A A;  2L32 A;  3EC8 A;  4WJP A;  4I6P A;  1RAX A;  1WI0 A;  3URY A;  1WGD A;  3V62 A;  4P1C C;  1NVI D;  5C3J B;  2INN E;  1E7P B;  2CHX A;  1WJ6 A;  2W9N A;  3CSF A;  3MJ5 A;  3PPA A;  4NAM A;  3ZGZ A;  2BKF A;  2GBK A;  4ZYS A;  2EMS A;  4XC2 A;  4NNJ B;  1VD2 A;  1SBB B;  3VQI A;  2KMC A;  2KTR B;  2O2V B;  1JRU A;  3WAM A;  2KXJ A;  3ABV B;  2G1E A;  3B9J A;  1FNV A;  1YX6 B;  2BB5 A;  5CX3 A;  2IO3 B;  1OQR A;  3L13 A;  3AMZ A;  1DYQ A;  1RFA A;  1V80 A;  4A90 A;  5HKH A;  2BB6 A;  2DZJ A;  2KN4 A;  2LVP A;  4US9 A;  1FPY A;  1K53 A;  4A6Q A;  2MH7 A;  2IDY A;  4B0E A;  3VFK A;  4ASW C;  3UI3 A;  5LXI B;  4IWQ A;  2YEP F;  3APD A;  2DAF A;  3ZYY X;  5HFY A;  4IC7 B;  2NPT A;  3M63 B;  3MHZ A;  1J7B A;  3VXW A;  4KGR A;  4HKQ A;  1WGH A;  1HTQ A;  1GAQ B;  1WGY A;  3OLM D;  1VDV A;  4TV3 A;  1CJE A;  4M02 A;  3IAM 1;  2A5U A;  2QIL A;  2RPV A;  1I4H A;  1MG4 A;  1JWS D;  5G5H A;  3VVW B;  4EFO A;  1KJT A;  3TIX A;  2JX5 A;  2N1V A;  4ZRP A;  2KN5 A;  2RD0 A;  4IOI E;  1T5X D;  3QWZ B;  4USA A;  1SE9 A;  3BWU D;  3QC8 B;  2REX A;  1WMH A;  3VUW A;  3PHX B;  2IY1 B;  4HK2 A;  2J4X A;  1ENF A;  3FAH A;  4D2K A;  3AB5 A;  2GI9 A;  3NZS A;  5L95 C;  4MGK E;  4WIP A;  4FJY A;  3WAO A;  1F2R I;  3TEW A;  2WXJ A;  2ONQ A;  4W9J A;  1X1M A;  4MJS B;  3R7R A;  4LCD E;  1V5O A;  1TS3 A;  1KTK A;  1HA5 A;  3TEX A;  3A4R A;  1C4P A;  2X38 A;  3TEY A;  1WRI A;  2BYT A;  3RUL A;  5AUI A;  4ARC A;  2CS4 A;  3AED B;  3GZN I;  1L0V B;  2NVU I;  2JXX A;  2WU2 B;  3B2F A;  3AUL A;  2CJO A;  2OOB B;  2BTE A;  2NPT B;  4M01 A;  3GP7 A;  4LNK A;  4BZA A;  1TS4 A;  3QAQ A;  1WE7 A;  1V2Y A;  2D3B A;  2ZCB A;  4LNN A;  2N4F A;  4RGT A;  5E6O A;  4LLG M;  4KGS A;  3DHH C;  1D5M C;  1T6B X;  4MSQ B;  1JW9 D;  4RFB A;  2WS3 B;  3ONS A;  4HDQ A;  3ZNG C;  2RR9 A;  2ZVN A;  3PZ7 A;  2V1Y A;  1XEE A;  4LJP B;  4OVZ A;  4JL9 A;  2KVZ A;  4XDC A;  3EFU A;  1MI0 A;  3A9J A;  2KDB A;  4R3D A;  1QOA A;  1I4Q A;  4L2Y A;  2O6V B;  4HCN B;  2J53 A;  4TSS A;  1I4P A;  2DEN B;  2BS2 B;  2D10 A;  1IBX A;  2JQR B;  2KVR A;  3CWI A;  3ETR A;  3PHW B;  1WMH B;  3PTF C;  4WAA A;  1SE3 A;  3GZN B;  3MHS D;  5BYS A;  1UBI A;  3RNE C;  1LM8 B;  1UD7 A;  1BXT A;  2NR2 A;  1QKZ A;  3EUB 2;  4HKZ E;  4ACF A;  4XWW A;  3KLS X;  3J9C A;  5IKC M;  4AS1 A;  2LFI A;  2ZNV C;  3N1Y C;  2L7R A;  2R2Q A;  2LWP A;  3P42 A;  1Q0W B;  3BY4 B;  2RPQ A;  3U7D A;  1JWM D;  3RNA C;  2FE8 A;  3U52 E;  4GLS C;  2GBR A;  3ZNZ B;  1R7S A;  2CHW A;  3AE4 B;  4URK A;  3KUC B;  4GB9 A;  4RNA A;  1EM7 A;  5DPR A;  4B6W A;  3PS6 A;  3VH4 B;  2C9W B;  4AP4 C;  2MJE A;  2KZR A;  2AL6 A;  1C4C A;  5AZF A;  1R4N I;  4B95 A;  3B0A A;  2JXT A;  3QAR A;  4YXD B;  1KRH A;  3NS8 A;  2I2Y A;  4JWS C;  2W3R A;  4HPL B;  1VZ7 A;  2FUG 1;  4MEM A;  2INP E;  3PZ8 A;  3DQV A;  1N6Z A;  5TR5 A;  2WDT B;  2KD0 A;  2J0J A;  2LGS A;  4C00 A;  4K3B A;  4KZ0 A;  2NS5 A;  2N9X A;  3ML8 A;  2GRI A;  2IO2 B;  1RYJ A;  4KSK C;  3ZUN A;  2Y3A A;  3HVD A;  3EGR A;  4QAY A;  1U4A A;  4KSL C;  3R3M A;  2MBH A;  3RI7 C;  1N62 A;  4ZYN A;  3VR8 B;  1JRP A;  4EZK A;  1IBX B;  4JQW C;  3I9V 1;  3NUH B;  4CQN A;  4IM2 A;  4HPP A;  2BGF A;  4AQ7 A;  3QHT A;  2K8C A;  1D6E C;  3PRM B;  2FAZ A;  1KM7 A;  1E7V A;  2MSE D;  2INC C;  3I57 A;  1E90 A;  2WXG A;  2Y5P A;  1TKE A;  1OEY J;  2DX5 B;  2N1W A;  3B08 A;  5FKA C;  3KUD B;  1L4Z B;  4MH8 A;  2JY6 A;  4RGM A;  2K25 A;  3IG3 A;  4MGZ E;  2K5P A;  2KC2 A;  4K7S A;  1JRO A;  1FCC C;  4EEW A;  1V97 A;  3W1S A;  3V05 A;  5AUK A;  4EZJ A;  3DVN U;  1HQR D;  1VJK A;  4FHK A;  2MEK A;  2WXI A;  5JXV A;  4IKG A;  1I7H A;  2Y5B B;  3HIZ A;  3KQ4 A;  4HJG E;  3HVZ A;  2L00 B;  3LB8 C;  1HTO A;  1OTR B;  2FCQ A;  3DOW A;  2RGF A;  4IUM B;  4BOS C;  2MRP A;  3DVG X;  5HI1 A;  3R2T A;  3GB1 A;  1YJI A;  1TZO A;  3ZVV A;  1MHX A;  2O6V D;  3KW5 B;  1YIW A;  2KLG A;  2KK8 A;  4W9K A;  2PPH A;  1KF6 B;  3QQ8 B;  2WQY B;  3VTV A;  1FFV A;  4JIO U;  3VDZ A;  1V49 A;  5JHB A;  2HTH A;  1WM2 A;  3SR6 A;  1WXV A;  2W82 A;  1C4A A;  2N9E B;  2MX2 A;  4C4V A;  2KJR A;  3GS2 A;  5BYR A;  4CO7 A;  2FUH B;  2C5L C;  3QJZ A;  3N20 C;  2BF8 B;  2KMA A;  3BZD B;  4M8N A;  2BT6 A;  2IYD B;  4JPS A;  1S3S G;  3PV1 A;  2M56 B;  4NJ6 A;  3X0W A;  4L1B A;  4J3O D;  2I38 A;  4A3P A;  4FBJ B;  2KDF B;  2QSD A;  3N32 A;  4CYE A;  1T3Q A;  1ZUD 2;  2IO1 B;  1UEL A;  2BYE A;  2KKC A;  3DBS A;  4II2 B;  1ACC A;  1GC7 A;  2CHZ A;  4RF0 A;  3VAW A;  2QCZ A;  1NYQ A;  2LGI A;  2IJ0 A;  4BBN F;  3H6N A;  3R7Q A;  2PEA A;  3KYC D;  2CU3 A;  1L7Y A;  2AL3 A;  1OQQ A;  2KWU B;  3CST A;  3MTN B;  2DAJ A;  4X57 B;  3ZXR A;  4JGH B;  2KWD A;  3VH3 B;  4EUT A;  3U4E G;  2LJ5 A;  2LXC A;  1TTN A;  2NBW B;  2O2V A;  1WJN A;  1E8W A;  2NBU A;  4HEA 1;  3IAS 1;  2LUE A;  3EFC A;  2LJI A;  1PGA A;  5CHW A;  4P16 A;  1D5Z C;  2BS4 B;  3LYY A;  2LHE A;  3JSV A;  1D3Z A;  2VZK D;  1UNS A;  3V3X A;  4KKJ A;  2LGX A;  3P4R B;  1TT5 B;  4WWM A;  4NAW B;  1T0Y A;  1SF0 A;  3DHG C;  3RPF C;  3P63 A;  4YTM B;  1TS2 A;  1R4M I;  2HJ1 A;  4HRO A;  3Q8F A;  2WXN A;  2BKR B;  3RNG C;  1JML A;  5HG2 A;  3UIO B;  1V5T A;  2KC1 A;  1JWA D;  3ZJV A;  2ZPY A;  2SEB D;  1VZ8 A;  3P4P B;  4WJN A;  1NBF C;  1IPG A;  3W1Y A;  2LVO A;  3AE9 B;  3RMK C;  2G4S A;  2NBV B;  4ZRQ A;  1WE6 A;  1A70 A;  1WZ0 A;  1T0Q C;  3RCZ A;  4C7Z A;  3CMM B;  3AE6 B;  4CHK A;  2JU6 X;  3P4S B;  1QLB B;  2V0G A;  2LGD A;  2HD5 B;  2PKO A;  5BMG A;  4II3 B;  2WXO A;  3H7P A;  1BT0 A;  1OFF A;  5FK9 C;  2RMM A;  3K9O B;  4DXG A;  3TBL D;  5BMI A;  3KWL A;  2OJR A;  3OJ3 A;  4OVV A;  3AEF B;  4K81 A;  1XLP A;  3W5V B;  2CKH B;  3W2D A;  4XGA B;  2ZW1 A;  1N63 A;  2MA9 B;  4F7Z A;  4BKT A;  3KUZ A;  4ZHO A;  2DZM A;  2MCN B;  1C3T A;  4L23 A;  4LDT D;  1Z5S B;  2MJ3 A;  2QDF A;  2LAS A;  2PE9 A;  1R4M B;  3Q14 C;  3M62 B;  4AOF A;  5J18 A;  4KV2 A;  4XE0 A;  1EWY C;  1IP9 A;  2C7H A;  2D11 A;  2L05 A;  2LMC A;  4WAF A;  4BKG A;  1FXI A;  4YTP B;  1AW7 A;  2KWV B;  4FN2 A;  3ZIM A;  1XLO A;  1CQV A;  4MJS A;  3NG0 A;  1HE8 A;  3JSV B;  5LNK 1;  4GIV A;  3KH0 A;  1EU3 A;  4YT0 B;  2L0T A;  3TMP B;  2C60 A;  3A1Q B;  1SB3 C;  2QMT A;  2MBE A;  3FC4 A;  4C80 A;  4MDK E;  3DPD A;  2EMT A;  3CIR B;  3WAL A;  2KFK B;  3GOE A;  4PYU A;  4W9G A;  3C8Y A;  3PT2 B;  2AWT A;  2QC8 A;  3ML9 A;  4IG7 B;  1P7E A;  3B1L X;  1TIF A;  3LJ3 A;  1E0Z A;  1YQ3 B;  2DZK A;  4P7I A;  1E8Y A;  2FCM A;  1XF5 L;  4EKU A;  1T0S C;  1GOZ A;  2GBN A;  1WJ4 A;  2K1F A;  2AQ1 B;  4FJV B;  4YSX B;  1FXA A;  2KAJ A;  4MT5 A;  1L4D B;  3H7P B;  3T3N A;  1F2R C;  3AV8 A;  1TS5 A;  2GMI C;  4DK5 A;  2GOW A;  2O6V A;  4IM0 A;  2LEK A;  2DBY A;  3V60 A;  2K9X A;  4N59 A;  2KHW B;  3ZDT A;  4E74 A;  1WJU A;  2K3U A;  1NEK B;  3QK0 A;  3IT4 B;  1GG3 A;  1J7C A;  1WFY A;  1HEZ E;  3MFG A;  3ZLZ A;  2LZ6 A;  5EE0 A;  2W55 A;  2KMM A;  3ZDM C;  1SJH D;  3WA0 A;  1YX5 B;  1Q10 A;  1XT9 B;  1LFD A;  2WP9 B;  1CZP A;  2NTS A;  1UUP A;  2L0F A;  2PTL A;  1MFW A;  2D3A A;  2WWZ A;  4GDK A;  2C7N B;  3R8B A;  1SGH A;  5HHD G;  1XCT L;  4KGT A;  2NMQ A;  1WYW B;  4I6N B;  1B9R A;  4G0N B;  1DOI A;  4TUU A;  1WXS A;  3T3O A;  1QOF A;  2DWQ A;  3ZW3 A;  1WIA A;  3HK0 A;  4E71 A;  3EEC A;  1P1A A;  1WY8 A;  3GE3 C;  1E8X A;  2ZW0 A;  3BYY B;  1ZDX A;  3FIL A;  2K6Q A;  1J8C A;  1MVK A;  2BW2 A;  4TQ0 A;  3AEC B;  5AZH A;  1UZX B;  3DBL I;  4IDI A;  3TJP A;  1E7U A;  2DYM A;  4OW0 A;  3FKY A;  4HRS A;  2GLS A;  3WIM A;  3JYU A;  2WXK A;  1UH6 A;  1WGG A;  4JX1 C;  2JZ3 B;  1C78 A;  4XZ4 A;  3UQB A;  3N1X C;  1ET9 A;  4Q2J A;  3LXF A;  1V8C A;  3NRZ A;  1SEB D;  2IGH A;  1JCK B;  1XXG A;  3O13 A;  3AE3 B;  3DHI C;  1ROE A; 
#chains in the Genus database with same CATH homology
 3RZW C;  4G11 A;  3DVN U;  2LGY A;  1Q1O A;  1J19 A;  1V9J A;  4FHK A;  3RZF A;  4AJY B;  1QZE A;  4W9I A;  2BWE S;  2BWF A;  3Q3J A;  4DXA B;  2KQ7 A;  1KOT A;  5D94 A;  2MBO A;  4DHJ D;  4GN1 A;  3HHM A;  1GNU A;  2Y5B B;  3HIZ A;  3WAN A;  3ECI A;  3ZKJ C;  3P2B A;  5EDS A;  1GC6 A;  2L00 B;  1WX9 A;  4HLE A;  1A5R A;  3SDL C;  4GDK B;  1WH3 A;  3NHE B;  1OTR B;  2FCQ A;  1WRD B;  4DBG A;  2N9P C;  3M3J A;  5JZE B;  3QIJ A;  3DOW A;  2RGF A;  5DPS A;  1OQY A;  4IUM B;  1YQB A;  4BOS C;  4KDL B;  2MRP A;  1ZGU B;  3DVG X;  5CTR C;  2AYO B;  2LI5 A;  4WWP A;  5DCN A;  5AZG A;  1ZKH A;  2PE6 B;  2KNB A;  1Y8R C;  4GXB A;  1WXA A;  2JRH A;  2MBB B;  3DCG A;  3VHT C;  3ZVV A;  4BBN C;  2O6V D;  3KW5 B;  3APF A;  1YIW A;  2KLG A;  5JHA A;  2NCN A;  5G2N A;  3AU4 A;  1YJ1 A;  2KK8 A;  4W9K A;  1XQQ A;  1J0G A;  2IO0 B;  3I3T B;  2PPH A;  3M95 A;  4DHZ B;  4XX5 A;  4HJK A;  3ZO5 B;  3QQ8 B;  4W9F A;  4I6L B;  2KQS A;  1WXM A;  4J6I A;  3VTV A;  2KX0 A;  2L8J A;  2KDI A;  4JIO U;  2B3A A;  3VDZ A;  1V49 A;  4WJQ A;  3K9P B;  5JHB A;  3EC8 A;  4WJP A;  2HTH A;  4FUL A;  2EKE C;  2PJH A;  4I6P A;  1RAX A;  1WM2 A;  3JVZ X;  4RMA A;  5LXH A;  4W9D A;  1WXV A;  4GGQ A;  1WI0 A;  2N9E B;  5C1Z A;  2MX2 A;  1SIF A;  1WGD A;  2KOX A;  5IAA C;  4TKN A;  3V62 A;  4AUQ C;  3DVN V;  3PRZ A;  2KJR A;  4KDI C;  2ASQ A;  4HXD A;  4CO7 A;  2FUH B;  3H9D A;  4MSM B;  4WWO A;  2JRI B;  2C5L C;  2CHX A;  1WJ6 A;  2W9N A;  3NY5 A;  3QJZ A;  2BF8 B;  1K8R B;  2KMA A;  3QCA A;  3CSF A;  3AU5 A;  3JW0 X;  3NZU A;  4M8N A;  4BKS A;  2LVQ A;  4MH0 E;  2VRR B;  2IYD B;  3T9L A;  1FXT B;  3PPA A;  1S3S G;  2AEH A;  3PV1 A;  4NJ6 A;  3X0W A;  4WWN A;  4A3P A;  4FBJ B;  2KDF B;  2BKF A;  2GBK A;  3N32 A;  4N9F 4;  4CYE A;  3PRP B;  2EMS A;  2IO1 B;  4ICU A;  4XC2 A;  3PRE A;  3ENE A;  1MG8 A;  1UEL A;  4DDG D;  4HVB A;  2BYE A;  2KKC A;  1P3Q U;  4NNJ B;  3DBS A;  1VD2 A;  2KJH B;  3VQI A;  4II2 B;  2KMC A;  2KTR B;  2XK5 B;  2O2V B;  1GC7 A;  2CHZ A;  1JRU A;  2KWC A;  1LQB A;  2KXJ A;  5CHF A;  3WAM A;  4MEL A;  3VAW A;  4FHJ A;  4K1R B;  4HCP B;  4HWI B;  4GU2 A;  1YX6 B;  4BBN F;  1WX7 A;  3H6N A;  5CX3 A;  3R7Q A;  2PEA A;  3KYC D;  2IO3 B;  1L7Y A;  2AL3 A;  3L13 A;  1XD3 B;  2KWU B;  3CST A;  1EO6 A;  4WQO B;  3MTN B;  2DAJ A;  1WR6 E;  4M0W B;  4X57 B;  1AAR A;  1P98 A;  1RFA A;  2LRU A;  3A33 B;  1V80 A;  2IY0 B;  4JGH B;  1P0R A;  4DHZ E;  3AXC A;  5HKH A;  1I35 A;  2DZJ A;  2I1J A;  1RRB A;  2ZVO A;  2LD9 A;  3VH3 B;  4EUT A;  2LVP A;  3HM3 A;  1KLV A;  3ZNI D;  5D2M B;  2LJ5 A;  2LXC A;  2FID A;  1IYF A;  3VFK A;  2G45 B;  2J7Q B;  1TTN A;  4ASW C;  2NBW B;  3ZRF A;  5LXI B;  4IWQ A;  2O2V A;  1WJN A;  4BOZ B;  1E8W A;  2NBU A;  3APD A;  4KIK A;  2DAF A;  3L0W B;  1NDD A;  1WZ3 A;  2G4D B;  3PSE B;  2LUE A;  4IWO A;  4IC7 B;  3VTU A;  2NPT A;  3M63 B;  1UGM A;  4GMV A;  5CHW A;  3VXW A;  2MW5 A;  3L10 B;  4ANU A;  1WGH A;  2KLC A;  1WGY A;  4G3X B;  3OLM D;  3T8M A;  3JSV A;  3UIP B;  3VUX A;  3W1S C;  1D3Z A;  4TV3 A;  2Z0E B;  2A5U A;  4G50 A;  3A4S C;  3TL5 A;  1YD8 U;  2IZV B;  2LGX A;  5G55 A;  2M1M A;  1WX8 A;  4NAW B;  1E8Z A;  1T0Y A;  3VVW B;  4EFO A;  2JT4 B;  1KJT A;  3TIX A;  3DDC B;  3X23 A;  1EF1 A;  3OAW A;  1R4M I;  4LDT B;  1V6E A;  2BKR B;  2ZEQ A;  4K7U A;  3PLU A;  2N1V A;  5C23 A;  2M0X A;  1V5T A;  2KC1 A;  3UIO B;  1VCB A;  2CU1 A;  2KN5 A;  1L2N A;  2ZPY A;  2RD0 A;  2WX1 A;  2KDE B;  3QWZ B;  1SE9 A;  1NBF C;  2WYQ A;  4WJN A;  1IPG A;  3W1Y A;  2LVO A;  2KO3 A;  3QC8 B;  2REX A;  5IA7 A;  2G4S A;  2NBV B;  3KYD D;  1WE6 A;  2FCS A;  1WMH A;  2MLB A;  1WZ0 A;  3PHX B;  3VUW A;  1ZW7 A;  1OGW A;  2A4Z A;  3CMM B;  4NAW A;  3RCZ A;  3WAP A;  4ANW A;  2Z59 B;  4CHK A;  3UGB B;  4FA6 A;  3Q3F A;  5LLI A;  2IY1 B;  4PS8 A;  2UYZ B;  4HK2 A;  2LGD A;  2UWQ A;  2HD5 B;  3NZS A;  5E6N A;  4A3O A;  4MGK E;  3IVF A;  5L95 C;  4ZRJ A;  4II3 B;  3SU8 X;  3H7P A;  1BT0 A;  1WR1 A;  3A9K A;  3K9O B;  4FJY A;  3WAO A;  2V3S A;  4PS7 A;  3TBL D;  3S2A A;  1F9J A;  4MM3 A;  2OJR A;  3ALB A;  3OJ3 A;  4OVV A;  4K81 A;  3UQA A;  5CHV C;  2CKH B;  3C0R B;  4F1S A;  4W9J A;  1X1M A;  4MJS B;  3R7R A;  2MA9 B;  4F7Z A;  2WX0 A;  4BKT A;  3L54 A;  4LCD E;  3KUZ A;  1V5O A;  2DZM A;  1LXD A;  2MCN B;  4PS3 A;  1C3T A;  4LDT D;  2BYV E;  3A4R A;  1Z5S B;  2BPS A;  4BFR A;  3NOB A;  2LAS A;  2PE9 A;  1I42 A;  2DZI A;  3M62 B;  3RUL A;  4AOF A;  5J18 A;  3IBE A;  4KV2 A;  1OEY A;  2CS4 A;  3DVG Y;  1IP9 A;  1TBE A;  2ZJD A;  2C7H A;  3SD5 A;  3GZN I;  2D11 A;  3IHP C;  2L05 A;  2NVU I;  1WGR A;  2YLM A;  3U30 A;  2JXX A;  4KIK B;  3U8Z A;  2J0M A;  3V61 A;  4BKG A;  3PVL A;  4ANX A;  3AUL A;  2KWV B;  4BKS D;  4FN2 A;  2OOB B;  2NPT B;  2KX3 A;  3A9J B;  3ZIM A;  2L76 A;  4EZL A;  2N7D A;  5AEK B;  1WM3 A;  5FR6 A;  2MP2 A;  4MJS A;  5D6J B;  1PQS A;  4ICV A;  3APC A;  2DYO A;  2LXA A;  3QAQ A;  1GJZ A;  1WE7 A;  1HE8 A;  3JSV B;  3VUY A;  1V2Y A;  4GIV A;  1C1Y B;  3KH0 A;  5BO4 B;  4DDI D;  2MQJ A;  2ZCB A;  2N4F A;  2L0T A;  5E6O A;  2C60 A;  2ZZP B;  3TMP B;  3UF8 A;  4DHJ B;  3D32 A;  2ZPN A;  3DBH I;  4MSQ B;  4W9C A;  2RSU A;  3A1Q B;  5DPW A;  2JWZ A;  2MBE A;  3ONS A;  4GDL A;  4LJO B;  4HDQ A;  3ZNG C;  4MGY E;  4JLC A;  4MDK E;  2KAN A;  2RR9 A;  2ZVN A;  2V1Y A;  4M8M A;  4LJP B;  5KHO A;  3DPD A;  2EMT A;  3MJW A;  4JL9 A;  4KZC A;  2ZNV B;  2KFJ A;  1P9D U;  3WAL A;  4TQ1 A;  2KFK B;  3GOE A;  3EFU A;  4PYU A;  3A9J A;  4W9G A;  5DPT A;  2HE7 A;  2KDB A;  1Z2M A;  3PT2 B;  2AWT A;  3ML9 A;  5L83 A;  4IG7 B;  2O6V B;  4HCN B;  3B1L X;  2XBB C;  1Q5W B;  4RM8 A;  3LJ3 A;  4GSW A;  2DEN B;  2D10 A;  2DZK A;  4P7I A;  1UBQ A;  1E8Y A;  2FCM A;  2V4L A;  1M94 A;  4NPN A;  1V86 A;  3A1Q A;  2KVR A;  3PHW B;  1WF9 A;  1WMH B;  4EKU A;  4IM3 A;  3UIN B;  3N3K B;  3PTF C;  3H7S A;  4WAA A;  3ZTC A;  3H1U A;  3RD2 A;  2YVC A;  2C7M B;  3MHS D;  1S1Q B;  1UBI A;  2M8S A;  1E5W A;  2GBN A;  3OJ4 B;  1WJ4 A;  2K1F A;  3V6E B;  1LM8 B;  1UD7 A;  4OVU A;  2NR2 A;  2KFK A;  4FJV B;  5J2R A;  1GUA B;  2L3Z A;  5JH5 C;  2FNJ B;  1G6J A;  3H7P B;  4ZRI A;  3A9K B;  1H4R A;  5E6P A;  2DHZ A;  2BYF A;  2D07 B;  2IBI B;  2ZNV C;  2GMI C;  2L7R A;  3L08 A;  4DK5 A;  2GOW A;  2JUO A;  2O6V A;  2G3Q B;  2R2Q A;  2LWP A;  3L16 A;  4IM0 A;  1TGZ B;  1Q0W B;  3BY4 B;  3V60 A;  4ZDV A;  4YL8 A;  2XEW A;  2KHW B;  3ZTD A;  2RPQ A;  2HJ8 A;  3U7D A;  3DBR I;  3ZDT A;  4E74 A;  5J17 A;  1NI2 A;  3QX1 A;  1WJU A;  4KVG B;  3QK0 A;  2K8H A;  1GG3 A;  1WFY A;  2J0K A;  2M4N A;  3ZLZ A;  4NJ7 A;  3ZNH B;  2GBR A;  3ZNZ B;  3N30 A;  4GOC A;  2LZ6 A;  2Z0D B;  4W9L A;  3VTW A;  2CHW A;  3ZDM C;  4URK A;  3KUC B;  4MGI E;  3WA0 A;  1YX5 B;  4GB9 A;  1XT9 B;  1LFD A;  5DPR A;  4B6W A;  3PS6 A;  4ZRK A;  4PYZ A;  2L0F A;  2D3G A;  4EOY A;  3VH4 B;  2C9W B;  4AP4 C;  1H8C A;  2KZR A;  2AL6 A;  2GBJ A;  5AZF A;  1R4N I;  2K39 A;  3KVF B;  3PGE A;  4B95 A;  3B0A A;  2WWZ A;  2MP2 B;  3QAR A;  3PZD A;  4GDK A;  4NQK E;  4RM9 A;  3NS8 A;  2C7N B;  4FJZ A;  4A20 A;  1SGH A;  4ANV A;  4DWF A;  2KJ6 A;  4W9E A;  4HPL B;  4MEM A;  1EF5 A;  1WYW B;  2FIF A;  5GMV A;  3DQV A;  4I6N B;  2K6D B;  4HPM B;  5TR5 A;  2WDT B;  2KD0 A;  4G0N B;  2N7E A;  3QA8 A;  4NQL B;  2J0J A;  4IW0 A;  4B9K A;  3TCA A;  4TUU A;  4FLH A;  2MBQ A;  4GDL B;  4KZ0 A;  1WXS A;  2NS5 A;  2N9X A;  3ML8 A;  2IO2 B;  3HM6 X;  3ZW3 A;  1WIA A;  3HK0 A;  2MWS B;  4E71 A;  3EEC A;  3RUI B;  4KSK C;  1P1A A;  1WY8 A;  3ZUN A;  1E8X A;  4W9H A;  3RYT A;  2JZZ A;  2KTF A;  2K8B A;  3L17 A;  2M17 A;  2K6Q A;  2CR5 A;  1J8C A;  4IWP A;  1U4A A;  4K7W A;  4KSL C;  3R3M A;  3O65 B;  2MBH A;  4TQ0 A;  5AZH A;  4E3C A;  4WJO A;  3AI5 A;  1UZX B;  1ISN A;  1EUV B;  3DBL I;  3TJP A;  4ZYN A;  2QHO A;  4F8C B;  1E7U A;  4BVU C;  2DYM A;  4EZK A;  3PLV A;  4JQW C;  3SHQ A;  2DYB A;  1V81 A;  4IM2 A;  3R66 C;  2BGF A;  3QHT A;  3WIM A;  2K8C A;  3JYU A;  2JPH A;  3PRM B;  1UH6 A;  1WGG A;  2FAZ A;  2ZCC A;  1KM7 A;  1E7V A;  2MSE D;  2JZ3 B;  2R2O A;  3CF6 E;  3BIN A;  4XZ4 A;  5D7G A;  3EHV A;  3UQB A;  1E90 A;  1OEY J;  2DX5 B;  2N1W A;  2D2Q A;  3B08 A;  4AJW A;  3KUD B;  1CMX B;  1TZ1 A;  4HDO A;  2JY6 A;  3LDZ E;  2JF5 A;  4AWJ A;  4FAD A;  2KTR A;  2K25 A;  2XK5 A;  3IG3 A;  4MGZ E;  3V6C B;  1RLF A;  2KC2 A;  2LRW A;  2FCN A;  4NY0 A;  4K7S A;  2GBM A;  3ZRC A;  5KHQ A;  4EEW A;  3IFW B;  3RT3 B;  3W1S A;  4EZJ A;  2I1K A;  2JVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...