3PSEB

Structure of a viral otu domain protease bound to interferon-stimulated gene 15 (isg15)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
150
Chain Sequence
DLTVKMLAGNEFQVSLMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKSDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords RNA polymerase
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
total genus 35
structure length 150
sequence length 153
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pseB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pseB01
3JSVA 4WWOA 1XT9B 2LGDA 2N1WA 4BFRA 2D10A 4PS3A 5C1ZA 3KUZA 3H7SA 2DZIA 3M95A 4MEMA 2JVCA 2LWPA 4NJ7A 4DBGA 2RD0A 3DBSA 2MW5A 4WJQA 2FUHB 3UGBB 1E8ZA 1WGYA 4KSLC 4KV2A 3QA8A 2KMCA 2XK5B 3UIOB 1WGHA 1YX5B 2WDTB 4IM3A 3VTUA 1WYWB 3AXCA 4G50A 2DAFA 1TGZB 4M0WB 1Q1OA 2KD0A 1WF9A 2CHWA 3PLUA 2R2OA 2ZVNA 1KLVA 2O2VA 3AU4A 1WJ6A 2KJ6A 4G3XB 3WIMA 4EKUA 4EZKA 5G55A 3ECIA 1RAXA 3QIJA 2KX0A 3CF6E 3RT3B 4W9IA 5J17A 1V86A 2KOXA 2NBVB 3QCAA 4JLCA 5LXHA 2KC1A 3JVZX 4B95A 3QC8B 4I6LB 1UH6A 2NVUI 4MSQB 3Q3FA 1M94A 5DCNA 5CX3A 4NAWA 1XQQA 2GMIC 2VRRB 4K1RB 3TL5A 2HE7A 3M62B 5C23A 4FA6A 4BKSA 1A5RA 2KN5A 2FIDA 2LGYA 5E6OA 1WIAA 2XBBC 3AULA 1SGHA 2N7EA 1S3SG 3KVFB 4TQ0A 2RGFA 5JHBA 1V49A 2EKEC 4DDGD 2LVQA 3PREA 2KLGA 4TUUA 3VVWB 3A9KA 4A3OA 4IC7B 2LRUA 4P7IA 4IM0A 2A4ZA 4FADA 4ICVA 3O65B 4G0NB 4MJSB 4IG7B 2KANA 2WWZA 2IY1B 4EZLA 4MM3A 1RLFA 2K6QA 2K1FA 1IPGA 2IY0B 5CTRC 3ZKJC 3ONSA 3PSEB 4FBJB 2MA9B 1LFDA 2D11A 1WE7A 3QAQA 2N9EB 4ANWA 2PEAA 3IHPC 2MBQA 2JY6A 3N30A 2BWFA 3R66C 5E6NA 4W9GA 3IVFA 3V62A 3A4RA 3ZRFA 4ANUA 3ML9A 1D3ZA 2FCMA 4W9KA 5D7GA 2K39A 3VHTC 2MBBB 1IP9A 3APFA 2IYDB 2KWUB 2KZRA 3ZDTA 3QQ8B 1V9JA 2KJRA 4NJ6A 4W9EA 2FAZA 3RUIB 3ZNHB 4AJWA 2CU1A 4JL9A 2L0TA 3PRZA 2M17A 3KH0A 1WX9A 3RYTA 2IO3B 1IYFA 2WYQA 3ZIMA 1KOTA 3TIXA 3H7PA 1EF5A 4FN2A 2DX5B 4MH0E 2KK8A 1ISNA 3MTNB 4JGHB 4PS7A 3ZNGC 4W9DA 4BKTA 3DVGX 2FCSA 3HIZA 3HHMA 3A1QB 1OQYA 2MP2B 2JT4B 4GB9A 1Q5WB 2MWSB 3VAWA 3PPAA 2C7MB 1YIWA 1ZW7A 2A5UA 2KFJA 3DPDA 2K25A 3JW0X 1FXTB 3NZUA 4NQLB 2L05A 1YX6B 4RMAA 1HE8A 2EMTA 1VD2A 2KMAA 2O6VB 2ZEQA 3VDZA 4AP4C 1X1MA 4MELA 5TR5A 3NHEB 2NPTA 4BKSD 4F7ZA 2KTRA 1WMHB 1OGWA 3OAWA 3NY5A 2EMSA 3DBRI 3X0WA 2GBRA 3CMMB 2DAJA 4LJPB 3DVGY 1WXVA 5LLIA 2Z0EB 2MBHA 1I42A 5L95C 5CHWA 4MGIE 2N4FA 3AI5A 5KHOA 4URKA 2KC2A 1C1YB 1GG3A 1WRDB 1AARA 3DVNV 1BT0A 4E71A 3R7QA 1V5TA 4HXDA 2DZKA 3V60A 2MCNB 4ANVA 1WX8A 2C7NB 4ZDVA 2GBJA 2XK5A 4GU2A 1WXSA 4WAAA 3VTWA 1WH3A 2JUOA 2WX0A 4E3CA 2G3QB 5DPTA 4GGQA 4BVUC 2KQ7A 4DXAB 3W1SC 5CHVC 4MGYE 4IWPA 4FJVB 2KVRA 3BINA 5LXIB 2NCNA 2RR9A 3PV1A 4DWFA 2LI5A 2MLBA 3ZRCA 3APDA 1SE9A 1WXAA 4NPNA 2CR5A 2MX2A 3PHXB 4PS8A 3V61A 2BKRB 3R7RA 3ALBA 4BBNF 4BOSC 4PYZA 4K7UA 5L83A 2JZ3B 2IBIB 4GDLB 2KWCA 3IG3A 1GC6A 1LM8B 3PTFC 4M8NA 1OEYJ 2KWVB 2ZZPB 4GXBA 5IAAC 2O6VD 2V1YA 3VUWA 1V80A 2KJHB 1R4NI 2K8BA 5J18A 1GUAB 4NQKE 2O2VB 3U7DA 2J0JA 3PRMB 3UINB 2BYEA 2GBMA 1TBEA 2C5LC 2KFKB 3C0RB 3IBEA 2HJ8A 2J7QB 3VQIA 2L0FA 3RCZA 5D2MB 3PLVA 4GDKA 1V5OA 3A4SC 4NNJB 3RD2A 2KLCA 1Y8RC 3A9JA 4W9JA 3DVNU 2JPHA 2LVOA 5DPSA 2LASA 2Z59B 3WA0A 1EF1A 1G6JA 2KX3A 3VH3B 2C7HA 4XC2A 2DYBA 4NAWB 3R3MA 3L0WB 2GOWA 1WJUA 1WXMA 3PT2B 3ZNZB 1UBIA 2NBUA 2C60A 3EHVA 2DHZA 3WAMA 1LXDA 2DZMA 2PPHA 4XX5A 4IWOA 4OVVA 2KNBA 1H8CA 1C3TA 2MBEA 2KHWB 5CHFA 3SDLC 3WAPA 4FLHA 2ZJDA 3APCA 3M63B 4B9KA 3KYDD 3A9KB 2V3SA 3Q3JA 2LXAA 3TCAA 2OOBB 3NOBA 2LGXA 3ZTCA 1H4RA 4HCPB 3L08A 2JZZA 3IFWB 4FJYA 1E8YA 4LDTB 1NBFC 1GNUA 2W9NA 2BYFA 1E7VA 1R4MI 3RULA 4HLEA 2N7DA 2LXCA 2LD9A 4HJKA 3MJWA 4B6WA 2FCQA 3DBHI 4A20A 2AL3A 2UYZB 2OJRA 4WQOB 5AZGA 2KTFA 3LDZE 5AZFA 1E5WA 2NS5A 4FHKA 1WM3A 2DZJA 4HPLB 4W9LA 4KZ0A 4ZRIA 3W1YA 4K7WA 2G45B 1F9JA 5G2NA 2KXJA 1XD3B 3QX1A 2DYOA 3KYCD 5D94A 5IA7A 1K8RB 4K7SA 1E8WA 1WGDA 3NS8A 1J19A 1NDDA 2CHXA 4TQ1A 3ZUNA 3EECA 3S2AA 4PYUA 3H7PB 2D07B 1WY8A 3RZWC 1UD7A 4BOZB 3PS6A 2KO3A 4F8CB 4IW0A 3ML8A 1WMHA 2BWES 1E7UA 2PE6B 2IO0B 3B0AA 4GSWA 4HDQA 3SU8X 5E6PA 3VFKA 3V6EB 4YL8A 4DK5A 2BYVE 4N9F4 4HDOA 4ICUA 2M1MA 4WWPA 1WGRA 3ZTDA 1RRBA 5KHQA 3ZLZA 1CMXB 2C9WB 2JF5A 1E90A 3CSTA 3P2BA 2YVCA 4HVBA 2D3GA 3UIPB 5JHAA 1QZEA 1WJ4A 3HM6X 2LZ6A 3HM3A 3QHTA 3L16A 2KQSA 3B08A 2J0MA 1L2NA 3OLMD 2NBWB 2CHZA 3PRPB 1KJTA 4KIKB 4LDTD 2L3ZA 3TJPA 2KTRB 1P98A 4G11A 3JYUA 1WZ3A 1P0RA 1WJNA 2AEHA 2JRHA 2K8HA 2KDEB 2MSED 3SHQA 4BKGA 4CHKA 2ZPNA 3JSVB 4HPMB 2HD5B 2ZVOA 3ZNID 4BBNC 4EEWA 1UZXB 2I1KA 3K9OB 4DHZB 4II3B 3H1UA 3PZDA 2K6DB 4KDLB 2L8JA 3W1SA 4GOCA 4W9HA 1YJ1A 4CYEA 3A33B 1UELA 4TKNA 2L76A 1LQBA 2UWQA 3UQAA 2N9PC 2LVPA 2DENB 3GZNI 4ZRJA 3AU5A 5JZEB 1UGMA 1TTNA 2GBNA 4GDLA 1E8XA 3T9LA 2GBKA 4J6IA 4EOYA 2BKFA 2QHOA 4K81A 1P9DU 2CKHB 2LRWA 4DDID 4LCDE 2MQJA 3H9DA 4MGZE 4WWNA 1Z5SB 2KFKA 1MG8A 3WAOA 4MDKE 2K8CA 2HTHA 3NZSA 3KW5B 4TV3A 1U4AA 3BY4B 1TZ1A 4RM9A 3ZDMC 2CS4A 4WJPA 1Z2MA 4X57B 4DHJB 3PHWB 3SD5A 3ZVVA 1V6EA 3PGEA 4AWJA 3DQVA 2LUEA 2WX1A 3KUCB 2ZCBA 3B1LX 2AYOB 1L7YA 3X23A 2L7RA 4I6PA 1KM7A 3OJ3A 3GOEA 4W9FA 4MJSA 2MRPA 1WI0A 1WR6E 1ZKHA 3DBLI 3QK0A 4FULA 5BO4B 3DOWA 5D6JB 4HCNB 3TBLD 3WANA 4OVUA 2JWZA 1EO6A 2G4SA 2V4LA 4HWIB 4RM8A 2ASQA 3LJ3A 1J8CA 3QWZB 3DDCB 1UBQA 4GDKB 3VXWA 2N9XA 2FIFA 4IM2A 4KDIC 4GMVA 3A9JB 4WJNA 3L54A 1P1AA 4KZCA 2IO2B 2RSUA 4FJZA 4KSKC 4EUTA 2IZVB 2L00B 4A3PA 2M8SA 4F1SA 4EZJA 1WGGA 1GC7A 1WR1A 4IUMB 3RZFA 3VUXA 5J2RA 3QJZA 4CO7A 3K9PB 3T8MA 2MBOA 3MHSD 4XZ4A 2Z0DB 3U30A 3UF8A 3WALA 3ZW3A 2M0XA 4KVGB 4AJYB 2BF8B 4GN1A 1VCBA 1J0GA 2ZPYA 1SIFA 1V2YA 2G4DB 3EFUA 3M3JA 3ZO5B 2PE9A 4DHZE 5DPRA 3I3TB 2XEWA 3L13A 2NR2A 1ZGUB 2LJ5A 4I6NB 3A1QA 1Q0WB 2MP2A 4JQWC 4W9CA 3VH4B 2J0KA 1YD8U 3KUDB 5DPWA 2YLMA 3U8ZA 4WJOA 2BGFA 1PQSA 4ZRKA 2ZCCA 4LJOB 4ZYNA 4ANXA 4DHJD 1EUVB 1JRUA 2B3AA 2KDIA 4HK2A 3HK0A 4GIVA 1T0YA 2ZNVC 4NY0A 1RFAA 2DYMA 4MGKE 5AEKB 2AL6A 3CSFA 2O6VA 1OEYA 2JXXA 3ENEA 1NI2A 3DCGA 1YQBA 5AZHA 3QARA 2ZNVB 3PVLA 4ASWC 1S1QB 2N1VA 1I35A 1OTRB 5JH5C 2KDBA 1V81A 2AWTA 1WZ0A 2FCNA 3N32A 5HKHA 1WM2A 2IO1B 3D32A 4MSMB 2D2QA 1WE6A 2JRIB 3H6NA 4IWQA 2I1JA 4EFOA 3OJ4B 2FNJB 5EDSA 3VTVA 2RPQA 3V6CB 4JIOU 5FR6A 3UQBA 2Y5BB 2REXA 2BPSA 2M4NA 4FHJA 3VUYA 3TMPB 4II2B 4KIKA 2PJHA 1P3QU 2NPTB 3N3KB 4M8MA 3L17A 2R2QA 2KKCA 2KDFB 1GJZA 1WX7A 5GMVA 3L10B 4E74A 4AOFA 3EC8A 4AUQC 1WFYA
chains in the Genus database with same CATH superfamily
4JWSC 3AE2B 3M95A 4MEMA 3Q3OC 2FUHB 1WGYA 3T3OA 1JWSD 2BS2B 3W9CB 3UIOB 1WGHA 2N7JA 2JYEA 1D4BA 4M0WB 2OEDA 2ZVNA 2O2VA 1C77A 2KJ6A 2KX0A 4LNFA 3CF6E 3RT3B 1AYFA 2BB5A 2JQRB 1LO5D 4B95A 5FKAC 1XQQA 2VRRB 1MHXA 3E56A 4IKGA 4CQNA 2LGIA 2FIDA 2LGYA 2XBBC 3AULA 1S3SG 1DYQA 1V49A 2EKEC 4DDGD 4TUUA 3A9KA 4OHJA 1BMLC 3O65B 4G0NB 1XCTL 2KANA 2K6QA 1C78A 4XGAB 4US8A 2D11A 2PEAA 2JY6A 4W9GA 3IVFA 3ML9A 1RFKA 4B0EA 3N1XC 4XWWA 4KKJA 3VHTC 1IP9A 3APFA 3PRZA 3KH0A 1WX9A 3FKYA 2WXFA 1QOFA 4FN2A 2IGGA 4MH0E 1ISNA 4JGHB 2WXHA 4PS7A 4J3OD 4RF0A 3HHMA 4REZA 1FXAA 5MPOA 3PPAA 1E7PB 1FXIA 1YIWA 1T0QC 2K25A 2L05A 4LNOA 2EMTA 3U52E 4C56C 2ZEQA 5TR5A 2DBYA 1OGWA 2EMSA 2GBRA 4L23A 4LJPB 5LLIA 1TY0A 3GB1A 5CHWA 1UF0A 5KHOA 4URKA 1FEHA 1WRDB 1IUEA 1HTQA 4HXDA 3AE5B 1WX8A 1L4DB 4GU2A 4WAAA 4ARCA 4HRSA 2JUOA 5DPTA 3IAM1 1N62A 2J4XA 1C4CA 4FJVB 2KVRA 1ET9A 2RR9A 4DWFA 2MLBA 2VZKB 4NPNA 2MX2A 3SR6A 3V61A 3R7RA 3W2DA 4BBNF 4K7UA 1VDVA 4YSYB 2JZ3B 2IBIB 4GDLB 3IG3A 3AE3B 2KWVB 2ZZPB 1ESFA 1TYGB 2V1YA 2KJHB 4NQKE 2O2VB 1F2RI 2D5GA 1TBEA 2HJ8A 3E9SA 1SE2A 2KN4A 3N1YC 4OZAA 1FO4A 1Y8RC 1FCLA 5H92C 2LVOA 3WA0A 1QOGA 2KX3A 3VH3B 3R3MA 3L0WB 1F77A 2K9XA 1WJUA 3TSSA 1K53A 3J9CA 5HHDG 3WAMA 1LXDA 2MEKA 3ZXRA 4KX6B 3A9KB 3I63C 3ABVB 2WXGA 4YT0B 2N9KA 3N1ZC 4HCPB 3EUB2 3IFWB 1GNUA 1TJEA 1MJDA 2BYFA 1R4MI 1FMAD 3Q3NC 2MJ3A 4HJKA 4B6WA 3DBHI 2Z8LA 2N0SB 4WQOB 2KTFA 3PZ8A 3U4EG 4K7WA 2OJWA 2G45B 3BYYB 2H88B 3KYCD 3RNAC 1K8RB 3ZUNA 4TQ1A 1J19A 1NDDA 1WRIA 2CHXA 1TKEA 4USAA 5G5GA 3R2TA 3Q3MC 4F8CB 1WGKA 1WMHA 2IO0B 5E6PA 2FE8A 2WU2B 3IAS1 4WWPA 3ZTDA 1RRBA 2BTEA 3NUHB 1CMXB 2C9WB 3CSTA 3UIPB 3ETRA 3HM6X 2LZ6A 2KQSA 1FCCC 1L2NA 3PRPB 1KJTA 4KIKB 1CZPA 4YTMB 2L3ZA 1P98A 4G11A 2CU3A 1YJIA 1P0RA 1R7SA 2AEHA 2KDEB 3Q14C 2YEPF 3SHQA 2ZPNA 3ZNID 4EEWA 4ACFA 4BBNC 2L32A 4KDLB 4GOCA 4W9HA 1YJ1A 3A33B 1HZ5A 2K0PA 5HI1A 2UWQA 1BUIC 4ZRJA 1F52A 4EOYA 4WH4A 1L5PA 3EGRA 2JXTA 4LCDE 2MQJA 4MGZE 2KFKA 1U4AA 4ZHOA 2NTTA 2LUMA 4AWJA 3DQVA 3GP7A 2ZCBA 2V0GA 3OJ3A 3GOEA 4W9FA 4MJSA 2MRPA 1XCQL 2MHJA 1K51A 4OVUA 2JWZA 3MC9A 4DXFA 1EO6A 4XDCA 1KFYB 4KDIC 1TS3A 1RWSA 4P1BC 1TKGA 2M0AA 3P4SB 1BXTA 4EUTA 2SAKA 4NZLB 2M8SA 1I4XA 3RZFA 4LNIA 2BBCA 3QJZA 2MBOA 2Z0DB 1SIFA 3HVDA 3Q8BA 1HXYD 3PZ7A 3I3TB 2LJ5A 1Q0WB 2MP2A 4W9CA 4OZBA 3AE8B 1L6UA 1HZ6A 5IO9A 3U8ZA 2BGFA 4ZYNA 2ZCCA 4LJOB 4ANXA 3DHHC 1EUVB 2L52A 2B3AA 2KDIA 1AWDA 3RMKC 1RFAA 2XNAC 3ZXVA 3CSFA 2O6VA 4XYCA 1SBBB 1YQBA 5AZHA 1DOXA 4ASWC 1OTRB 2KDBA 2AWTA 1WZ0A 2GRIA 2IJ0A 1WM2A 2R61A 2M19A 4LLGM 3H6NA 2JRIB 1FRDA 4EFOA 2Y5BB 4FHJA 3VUYA 3R8BA 2WU5B 3B2GA 1PFDA 2PJHA 1TS4A 4M8MA 1GJZA 1V1PB 3L10B 3OWEB 4AUQC 1I4HA 2MH7A 3JSVA 1XT9B 2N1WA 2D10A 2BT6A 4PS3A 4WWMA 4N6EB 2UU7A 2MW5A 1XLOA 4KV2A 3QA8A 2XK5B 1UGJA 4IM3A 1WYWB 3AXCA 1TGZB 2WHIA 3GE3C 2KD0A 4XE0A 2CHWA 4P6VF 3PLUA 5JXVA 4EZKA 5G55A 2AQ3B 5BMIA 1V86A 2KOXA 3QCAA 2KC1A 3MFGA 4H2AA 3B9JA 4I6LB 1UH6A 2NVUI 1M94A 3KQ4A 4K1RB 2Y3AA 1UWXA 5IOIA 4FA6A 3EA6A 4ITKA 2KN5A 5E6OA 1SGHA 2IDYA 3AN1A 3U7ZA 3GZNB 3PREA 3UI3A 3RNCC 4P7IA 4IM0A 2A4ZA 4ICVA 3P1MA 3EFCA 4MJSB 2WWZA 4MM3A 1RLFA 2K1FA 4O1NA 5CTRC 2PW9A 4WQMA 4N58A 4FBJB 1ZPSA 3BIID 5E6NA 3R66C 4RGTA 3V62A 1Y56A 2WXQA 3SEBA 1D3ZA 3PO0A 2FCMA 1JROA 5D7GA 2MBBB 2KWUB 1NI3A 3QQ8B 3RUIB 3ZNHB 4AJWA 2L0TA 2M17A 2IO3B 1QLBB 2D3AA 1N5XA 1KLGD 4RFBA 2W82A 1FIQA 3ZGZA 3DVGX 3HIZA 1MHHE 1SJED 1OQYA 2MP2B 2JT4B 3RI7C 3RNFC 4GB9A 2MWSB 2I38A 3Q8EA 3VAWA 2C7MB 1ZW7A 2B76B 3NVYA 2RDBC 3DPDA 1YX6B 3KWVA 2O6VB 1X1MA 3NHEB 2NPTA 4BKSD 1AN8A 3OAWA 3NY5A 3CMMB 1WXVA 2MBHA 5L95C 2BYTA 2ON8A 3AI5A 2J52A 1N63A 1AARA 1QKZA 3DVNV 4M01A 4E71A 4KGRA 3VR8B 3GE8C 2DZKA 2MCNB 4NAMA 4ZDVA 2GBJA 4LTUA 2WXPA 1CK1A 2WX0A 1WSPA 4DXAB 4M00A 1UUPA 1L6VA 3FC4A 4MH8A 3H8HA 2LI5A 5AUIA 3AE4B 3ZRCA 3APDA 2WP9B 1WXAA 4PS8A 2BKRB 2V9HA 4HPPA 2FBWB 2KWCA 1LM8B 4M8NA 1OEYJ 2BB6A 1KH0A 2O6VD 1GUAB 2XN9C 2J0JA 3PRMB 3C0RB 2DNFA 3PLVA 2RMMA 1DOYA 4NNJB 3RD2A 2KLCA 4MT5A 2V3NA 3DVNU 2JPHA 2Z59B 1EF1A 4XC2A 1FNUA 2DYBA 1XLNA 1IBXA 2QC8A 1WXMA 1UBIA 3EHVA 1AW7A 1H8CA 2MBEA 3WAPA 5C3JB 3APCA 3URYA 3KYDD 2V3SA 3TEXA 2LXAA 1VJKA 2JU6X 1FFVA 3DWGC 4MM3B 1H4RA 4RGOS 2KVZA 2LEKA 1MI0A 2W9NA 1E7VA 3RULA 2N7DA 3NRZA 1K50A 4A20A 2AL3A 2OJRA 1MG4A 2H89B 5AZGA 1V1OA 1E5WA 3P4PB 1L4ZB 1HEZE 4TSSA 4ZRIA 3W1YA 3FILA 1XD3B 3LXFA 5D94A 1Q10A 4PYUA 4K3BA 2D07B 3RZWC 3PS6A 2KAJA 1ACCA 4IW0A 5EE9A 2BWES 2PE6B 1E7UA 5IKCM 3SU8X 3TUOA 1L0VB 2VH2A 4YL8A 4DK5A 4N9F4 3AV8A 4HDOA 5T8IA 5KHQA 4HKZE 3ZYYX 2YVCA 2D3GA 4C00A 1WJ4A 1D5ZC 1JWBD 2J0MA 5BYQA 1NENB 2NBWB 1A70A 3ZQ4A 4CHKA 2MSED 5G5HA 2QILA 4A6QA 2MJEA 2ONQA 2I1KA 3K9OB 4DHZB 4II3B 3N9YC 3H1UA 1I4QA 2QCZA 3W1SA 3BVZA 1UELA 3GS2A 4IOIE 4TKNA 1LQBA 2LVPA 2DENB 3GZNI 5JZEB 1TTNA 2GBNA 1I4PA 1P9DU 1VZ6A 2CKHB 1VRAB 4LK0M 2WGSA 4WWNA 1Z5SB 5E6JA 1EM7A 4MACA 2K8CA 3VR9B 2GB1A 4TV3A 3BY4B 2KWDA 3TEYA 4A55A 2EELA 4L2YA 1V6EA 3Q8FA 3B1LX 2WDRB 3TEZA 3MC0B 2L7RA 1KM7A 1N6ZA 1WI0A 3AB5A 1ZKHA 1ZDVA 3DOWA 1JW9D 2JSVX 3T3NA 3WANA 3O13A 4HWIB 2G4SA 2K22A 1VR9A 1J8CA 2INDC 3N20C 1UBQA 1NEKB 1ZXHA 2N9XA 2FIFA 2WS3B 3RNGC 4WJNA 3L54A 1XLPA 1YMHE 4KZCA 4KSKC 1IGDA 2L00B 4F1SA 1WGGA 1XEEA 1WR1A 3VUXA 1E0ZA 5J2RA 1PGBA 4CO7A 3T8MA 3UF8A 3U30A 3RPFC 1D5MC 1JMLA 2ZPYA 3V3XA 1C4PA 3M3JA 4AQ7A 2EKIA 3L13A 2XEWA 3W5VB 3VH4B 2KACA 3KUDB 4WJOA 4DQOC 1WYGA 4ZRKA 3RNBC 4HK2A 3HK0A 4NY0A 4YSXB 2DYMA 2AL6A 1FNVA 3ENEA 1DGJA 1NI2A 3DCGA 4BZAA 3QARA 4QAYA 5JH5C 4ZOHC 3R2IA 1TY2A 5GXGB 2IO1B 1FM0D 1KF6B 2JZPA 2I1JA 2FNJB 2RPQA 4JIOU 5FR6A 3UQBA 2BS4B 2BPSA 1HA5A 2W3SA 2J53A 1P3QU 2G1EA 2L83A 3L17A 2R2QA 2KKCA 2KDFB 4HLEA 1SSNA 2LGDA 4BFRA 2DZIA 2JVCA 2LWPA 4NJ7A 2RD0A 3DBSA 4C80A 1V97A 4KSLC 1QF6A 3BK1A 2WDTB 1F0ZA 1Q1OA 1WF9A 2R2OA 1KLVA 3AU4A 1WJ6A 4G3XB 4ZHPA 1RAXA 3QIJA 5J17A 2NBVB 5LXHA 1FRRA 3TEWA 3QC8B 2V4IB 4A9AA 2BVCA 2JX5A 4NAWA 2GMIC 4XDDA 4YTNB 2HE7A 3M62B 5C23A 2DLBA 4BKSA 2E3TA 2JWUA 4YSZB 3NVWA 5JHBA 1ET6A 1I4RA 1JRPA 5C2TB 4IC7B 2LRUA 4FADA 5H8YE 2BW2A 1EU3A 2IY0B 3ONSA 3PSEB 2MA9B 1SXTA 2J42A 3QAQA 2N9EB 5EE0A 3IHPC 2L1AA 5EE1A 2BWFA 3DWMA 3ZRFA 4C4VA 4HEA1 4ZYSA 2CJOA 2IYDB 3VRAB 2KZRA 3ZDTA 4W9EA 2FAZA 2CU1A 1IYFA 3Q69A 4C7YA 3Q8AA 1SF0A 3TIXA 2KQ4X 3H7PA 2DX5B 2KK8A 3MTNB 3ZNGC 2LGSA 1JQ4A 4W9DA 4BKTA 1JWAD 4S17A 2KFJA 3NZUA 1FXTB 4NQLB 5BMHA 1HE8A 1VD2A 2CJNA 2KMAA 4PT5A 4AP4C 3ZJTA 1CJEA 1YN5A 4F7ZA 1WMHB 1CQVA 3X0WA 1XXGA 1E9MA 1EWCA 3CWIA 1I42A 2Z0EB 1B1ZA 4MGIE 2N4FA 4P1CC 2KC2A 1GG3A 1BT0A 3Q8CA 3R7QA 1V5TA 4WAFA 3LYYA 3IXSA 1QOAA 2LFIA 3VTWA 1E6EB 4M0WA 2G3QB 4GGQA 2KQ7A 5CHVC 1LGRA 3BINA 5LXIB 3PV1A 1SE9A 5L83A 1PGAA 1GC6A 2WNMA 3B2FA 4GXBA 1SE4A 2LMCA 1V80A 2D3CA 2PTLA 4ARIA 3U7DA 3UINB 2KFKB 2C5LC 2PIAA 3VQIA 4A8XC 2J7QB 5IN7A 3LB8C 2QEJC 3A4SC 2WXNA 1SEBD 2LASA 5FR3A 4NAWB 1QQRA 2KYWA 4WIPA 1T3QA 2GOWA 3AEBB 3ZNZB 2NBUA 4RNAA 2DHZA 1ZP0B 4XX5A 3VRBB 4OVVA 5D3DA 3DHIC 1C3TA 2IGDA 5CHFA 4FLHA 2ZJDA 3I57A 1UWMA 3M63B 1KLUD 3Q6BA 1WWTA 3NOBA 2PLPA 3ZTCA 1JCKB 1NVID 1E8YA 3BWUD 2INCC 1KRHA 2LXCA 5D3IB 2UYZB 1FD6A 3Q2AC 4C4VB 3I9V1 2NS5A 4W9LA 1B9RA 2W54A 2LJIA 5G2NA 2DWQA 2DYOA 1WGDA 3EECA 3S2AA 3H7PB 4B0MA 2ZW0A 1UD7A 2K3UA 3C8YA 3B0AA 2PKOA 3CIRB 3VFKA 4YXDB 2BYVE 1SIJA 3AEGB 1TIFA 1YN4A 3AM9A 3ZLZA 2JF5A 1VLBA 3P2BA 5JHAA 1XO3A 1EWYC 1J7BA 2M56B 2QJLA 3B08A 3P4RB 3DHGC 3AEAB 3JYUA 2LHDA 4JE3B 5I4DA 1L0XB 1WJNA 3JSVB 1UZXB 2K6DB 1EU4A 5BYSA 1T5XD 2NMQA 4P16A 4C7ZA 2N9PC 4RH6A 1N5WA 4GDLA 1E8XA 3DBRB 3NG0A 2BKFA 2QHOA 2LRWA 3H9DA 1T6BX 1MG8A 3WAOA 4MDKE 3AE1B 3AMZA 3NZSA 2WXRA 2CS4A 1Z2MA 4DHJB 3PHWB 3SD5A 4JPSA 3KUCB 5TSSA 2AYOB 4I6PA 3WCQA 3C19A 3IT6B 2LHEA 4FXCA 5BO4B 1YNTE 1D5XC 4OVZA 1C79A 2V4LA 2OHFA 2ACZB 3QWZB 3DDCB 1I7HA 2HJ1A 3L4PA 1P1AA 3AEEB 2RSUA 2IZVB 1R4NB 4KGTA 4IUMB 2E6XA 3K9PB 3MHSD 3WALA 3ZW3A 3MJ5A 3FAHA 4GN1A 3IT4B 1VCBA 1ZDXA 2V3PA 1J0GA 5FK9C 2KDMA 1F1HA 2RDHA 3ZO5B 3HUIA 4DHZE 1ZGUB 3A1QA 3P42A 2YLMA 4DHJD 1JRUA 2MJDA 1FFUA 4GIVA 1TS2A 1STEA 2ZNVC 4MGKE 5AEKB 1OEYA 1V8CA 3AH7A 2HTME 2ZNVB 4ZRQA 1P7EA 3PVLA 1K52A 1S1QB 2N1VA 4EE2A 1VZ8A 2INPE 1V81A 3N32A 1XF5L 3BVGA 3D32A 4MSMB 4JX1C 2D2QA 1WE6A 2K5PA 3OJ4B 1C4AA 2INNE 2REXA 1GPXA 2JYTA 1I4GA 2M4NA 1MPEA 4KIKA 2KT7A 2NPTB 5AUKA 3N3KB 1NYQA 1WX7A 5GMVA 4E74A 3BYTB 3EC8A 5EDSA 4WWOA 1T0SC 5C1ZA 3KUZA 4RF1A 3H7SA 4KGSA 4DBGA 1MFWA 2X38A 4WJQA 3UGBB 1E8ZA 2KMCA 3VTUA 1YX5B 4M02A 1KTKA 4G50A 2DAFA 4RGNA 4EKUA 3MP9A 3ECIA 2PVGC 1SE3A 5HFYA 4W9IA 4JLCA 3JVZX 1GAQB 2IGHA 2PVOD 3AEFB 1ROEA 4MSQB 3Q3FA 5DCNA 5CX3A 3TL5A 1YQ3B 2WXIA 1DOIA 2WLBA 1WIAA 4NJCA 2IPKD 4XWTA 4UDUC 2N7EA 3KVFB 4TQ0A 2RGFA 2WDVB 1M4VA 2LVQA 2KLGA 2QMTA 2VH1A 3VVWB 4A3OA 2WXLA 2QDFA 4IG7B 4EZLA 2IY1B 1IBXB 1IPGA 3ZKJC 3NJTA 1LFDA 1WE7A 1T0RC 2GLSA 2HDEA 4ANWA 1YJJA 2MBQA 3N30A 3V05A 4ANUA 3A4RA 1FPYA 1VZ7A 2G9HD 4W9KA 4DXGA 2K39A 3DBLB 3KWLA 2VZKD 1V9JA 2KJRA 4NJ6A 3MC8A 1TT5B 4JL9A 1ZXIA 3RYTA 4YWGG 1TS5A 2WYQA 3ZIMA 1KOTA 1EF5A 1L0YB 4HROA 1QILA 2FCSA 4N59A 3A1QB 1Q5WB 1GB1A 2Y5CA 2A5UA 4RGMA 5BYRA 3JW0X 3FILB 4RMAA 3VDZA 4MELA 2KTRA 2RPVA 2BQQA 3DBRI 1V1PA 2DAJA 3DVGY 1YN3A 4K3CA 1J7CA 5LNK1 1PDXA 3BVMA 4LNNA 3MHZA 2WDQB 1C1YB 3ZJVA 4US9A 3SFDB 1FNWA 3ZJUA 3V60A 4ANVA 4RCOA 2C7NB 2XK5A 1WXSA 3P4QB 3RFZB 1WH3A 3U2SC 3BK2A 4E3CA 4BVUC 4IDIA 3W1SC 4MGYE 4HJGE 4IWPA 1RM6C 3HVZA 2NCNA 2SEBD 1PGXA 2CR5A 1A5RA 3PHXB 4BOSC 3ALBA 4R3DA 4PYZA 2I2YA 2PMVA 3PTFC 1D6EC 2D3BA 5IAAC 3VUWA 1R4NI 2K8BA 5J18A 1JWUD 2BYEA 2GBMA 1WXQA 3IBEA 2L0FA 3RCZA 5D2MB 3NVZA 4GDKA 1V5OA 3A9JA 4W9JA 5DPSA 1G6JA 2C7HA 1YQ4B 5BMGA 1ENFA 3PT2B 4S0RA 2C60A 1HQRD 2WXOA 2DZMA 2PPHA 4IWOA 2KNBA 1HTOA 2KHWB 3SDLC 2N9LA 4B9KA 3KLSX 3Q3JA 3RN9C 3TCAA 2OOBB 2LGXA 1GB4A 3L08A 2JZZA 4FJYA 4LDTB 1NBFC 2LD9A 3NS1A 3MJWA 2FCQA 3NZ3A 3LDZE 5AZFA 2GI9A 1IGCA 4FHKA 1WM3A 2DZJA 4HPLB 2W55A 1JWMD 1TKYA 2AQ2B 4KZ0A 4LNKA 1TZOA 1F9JA 3NVVA 2KXJA 3QX1A 5IA7A 4K7SA 1E8WA 3NS8A 4PK1A 1WY8A 4BOZB 2KO3A 3ML8A 4GSWA 3WIMA 4HDQA 1C9FA 1JALA 3V6EB 4ICUA 4ZRPA 4KKIA 2M1MA 3OG5A 5EE3A 1WGRA 2QIEB 1E90A 4HVBA 1QZEA 1XLQA 3HM3A 3QHTA 3L16A 3BZDB 3OLMD 2CHZA 2X8XX 1N61A 1YOVB 4LDTD 2WQYB 2YEPB 3TJPA 2KTRB 1WZ3A 2KMMA 2JRHA 2K8HA 3AEDB 4L1BA 4BKGA 3AECB 3SFEB 4HPMB 2HD5B 2ZVOA 3P63A 1ZOYB 2WXMA 3RNEC 3PZDA 2L8JA 4D2KA 4CYEA 2ZW1A 2L76A 3UQAA 3AU5A 4TMAB 1UGMA 1P7FA 3T9LA 2GBKA 4J6IA 5IP4D 1SB3C 4K81A 4DDID 1OFFA 1QT9A 4GLSC 1GOZA 2HTHA 3AE6B 3KW5B 1TZ1A 4RM9A 3ZDMC 4X57B 4WJPA 3I5JC 4BAXA 1N60A 3ZVVA 1C76A 3PGEA 2LUEA 2WX1A 2BS3B 4AS1A 1L7YA 3X23A 2QSDA 1WR6E 4FULA 3DBLI 3QK0A 1J7AA 4WURA 1SJHD 4HKQA 5D6JB 4HCNB 3TBLD 1UNSA 4RM8A 2ASQA 3LJ3A 4GDKB 3VXWA 2AQ1B 2WXJA 4IM2A 3W5UB 4GMVA 1NYRA 3A9JB 4A90A 1F2RC 2IO2B 4FJZA 1ZUD2 4JWUC 5HG2A 4A3PA 4EZJA 1GC7A 4YTPB 1MVKA 4XZ4A 2M0XA 4KVGB 1OQRA 2BF8B 4AJYB 2FUG1 2TSSA 2RDGA 1V2YA 1ZE3D 2ICIA 2G4DB 3EFUA 2PE9A 5DPRA 1OQQA 2NR2A 4I6NB 4JQWC 2J0KA 1YD8U 5DPWA 1PQSA 1RYJA 1T0YA 2AX5A 2JXXA 2Q5WD 4OZCA 1I35A 4Q2JA 2FCNA 2NTSA 5HKHA 3HRDD 1E10A 4IWQA 3AE7B 2Y5PA 1QOBA 1PUTA 3VTVA 3V6CB 1R4MB 3AE9B 3DBHB 1PYWD 3TMPB 4II2B 2WXKA 2W3RA 4AOFA 4OW0A 1WFYA
chains in the Genus database with same CATH topology
3JSVA 4WWOA 1XT9B 2LGDA 2N1WA 4BFRA 2D10A 4PS3A 5C1ZA 3KUZA 3H7SA 2DZIA 3M95A 4MEMA 2JVCA 2LWPA 4NJ7A 4DBGA 2RD0A 3DBSA 2MW5A 4WJQA 2FUHB 3UGBB 1E8ZA 1WGYA 4KSLC 4KV2A 3QA8A 2KMCA 2XK5B 3UIOB 1WGHA 1YX5B 2WDTB 4IM3A 3VTUA 1WYWB 3AXCA 4G50A 2DAFA 1TGZB 4M0WB 1Q1OA 2KD0A 1WF9A 2CHWA 3PLUA 2R2OA 2ZVNA 1KLVA 2O2VA 3AU4A 1WJ6A 2KJ6A 4G3XB 3WIMA 4EKUA 4EZKA 5G55A 3ECIA 1RAXA 3QIJA 2KX0A 3CF6E 3RT3B 4W9IA 5J17A 1V86A 2KOXA 2NBVB 3QCAA 4JLCA 5LXHA 2KC1A 3JVZX 4B95A 3QC8B 4I6LB 1UH6A 2NVUI 4MSQB 3Q3FA 1M94A 5DCNA 5CX3A 4NAWA 1XQQA 2GMIC 2VRRB 4K1RB 3TL5A 2HE7A 3M62B 5C23A 4FA6A 4BKSA 1A5RA 2KN5A 2FIDA 2LGYA 5E6OA 1WIAA 2XBBC 3AULA 1SGHA 2N7EA 1S3SG 3KVFB 4TQ0A 2RGFA 5JHBA 1V49A 2EKEC 4DDGD 2LVQA 3PREA 2KLGA 4TUUA 3VVWB 3A9KA 4A3OA 4IC7B 2LRUA 4P7IA 4IM0A 2A4ZA 4FADA 4ICVA 3O65B 4G0NB 4MJSB 4IG7B 2KANA 2WWZA 2IY1B 4EZLA 4MM3A 1RLFA 2K6QA 2K1FA 1IPGA 2IY0B 5CTRC 3ZKJC 3ONSA 3PSEB 4FBJB 2MA9B 1LFDA 2D11A 1WE7A 3QAQA 2N9EB 4ANWA 2PEAA 3IHPC 2MBQA 2JY6A 3N30A 2BWFA 3R66C 5E6NA 4W9GA 3IVFA 3V62A 3A4RA 3ZRFA 4ANUA 3ML9A 1D3ZA 2FCMA 4W9KA 5D7GA 2K39A 3VHTC 2MBBB 1IP9A 3APFA 2IYDB 2KWUB 2KZRA 3ZDTA 3QQ8B 1V9JA 2KJRA 4NJ6A 4W9EA 2FAZA 3RUIB 3ZNHB 4AJWA 2CU1A 4JL9A 2L0TA 3PRZA 2M17A 3KH0A 1WX9A 3RYTA 2IO3B 1IYFA 2WYQA 3ZIMA 1KOTA 3TIXA 3H7PA 1EF5A 4FN2A 2DX5B 4MH0E 2KK8A 1ISNA 3MTNB 4JGHB 4PS7A 3ZNGC 4W9DA 4BKTA 3DVGX 2FCSA 3HIZA 3HHMA 3A1QB 1OQYA 2MP2B 2JT4B 4GB9A 1Q5WB 2MWSB 3VAWA 3PPAA 2C7MB 1YIWA 1ZW7A 2A5UA 2KFJA 3DPDA 2K25A 3JW0X 1FXTB 3NZUA 4NQLB 2L05A 1YX6B 4RMAA 1HE8A 2EMTA 1VD2A 2KMAA 2O6VB 2ZEQA 3VDZA 4AP4C 1X1MA 4MELA 5TR5A 3NHEB 2NPTA 4BKSD 4F7ZA 2KTRA 1WMHB 1OGWA 3OAWA 3NY5A 2EMSA 3DBRI 3X0WA 2GBRA 3CMMB 2DAJA 4LJPB 3DVGY 1WXVA 5LLIA 2Z0EB 2MBHA 1I42A 5L95C 5CHWA 4MGIE 2N4FA 3AI5A 5KHOA 4URKA 2KC2A 1C1YB 1GG3A 1WRDB 1AARA 3DVNV 1BT0A 4E71A 3R7QA 1V5TA 4HXDA 2DZKA 3V60A 2MCNB 4ANVA 1WX8A 2C7NB 4ZDVA 2GBJA 2XK5A 4GU2A 1WXSA 4WAAA 3VTWA 1WH3A 2JUOA 2WX0A 4E3CA 2G3QB 5DPTA 4GGQA 4BVUC 2KQ7A 4DXAB 3W1SC 5CHVC 4MGYE 4IWPA 4FJVB 2KVRA 3BINA 5LXIB 2NCNA 2RR9A 3PV1A 4DWFA 2LI5A 2MLBA 3ZRCA 3APDA 1SE9A 1WXAA 4NPNA 2CR5A 2MX2A 3PHXB 4PS8A 3V61A 2BKRB 3R7RA 3ALBA 4BBNF 4BOSC 4PYZA 4K7UA 5L83A 2JZ3B 2IBIB 4GDLB 2KWCA 3IG3A 1GC6A 1LM8B 3PTFC 4M8NA 1OEYJ 2KWVB 2ZZPB 4GXBA 5IAAC 2O6VD 2V1YA 3VUWA 1V80A 2KJHB 1R4NI 2K8BA 5J18A 1GUAB 4NQKE 2O2VB 3U7DA 2J0JA 3PRMB 3UINB 2BYEA 2GBMA 1TBEA 2C5LC 2KFKB 3C0RB 3IBEA 2HJ8A 2J7QB 3VQIA 2L0FA 3RCZA 5D2MB 3PLVA 4GDKA 1V5OA 3A4SC 4NNJB 3RD2A 2KLCA 1Y8RC 3A9JA 4W9JA 3DVNU 2JPHA 2LVOA 5DPSA 2LASA 2Z59B 3WA0A 1EF1A 1G6JA 2KX3A 3VH3B 2C7HA 4XC2A 2DYBA 4NAWB 3R3MA 3L0WB 2GOWA 1WJUA 1WXMA 3PT2B 3ZNZB 1UBIA 2NBUA 2C60A 3EHVA 2DHZA 3WAMA 1LXDA 2DZMA 2PPHA 4XX5A 4IWOA 4OVVA 2KNBA 1H8CA 1C3TA 2MBEA 2KHWB 5CHFA 3SDLC 3WAPA 4FLHA 2ZJDA 3APCA 3M63B 4B9KA 3KYDD 3A9KB 2V3SA 3Q3JA 2LXAA 3TCAA 2OOBB 3NOBA 2LGXA 3ZTCA 1H4RA 4HCPB 3L08A 2JZZA 3IFWB 4FJYA 1E8YA 4LDTB 1NBFC 1GNUA 2W9NA 2BYFA 1E7VA 1R4MI 3RULA 4HLEA 2N7DA 2LXCA 2LD9A 4HJKA 3MJWA 4B6WA 2FCQA 3DBHI 4A20A 2AL3A 2UYZB 2OJRA 4WQOB 5AZGA 2KTFA 3LDZE 5AZFA 1E5WA 2NS5A 4FHKA 1WM3A 2DZJA 4HPLB 4W9LA 4KZ0A 4ZRIA 3W1YA 4K7WA 2G45B 1F9JA 5G2NA 2KXJA 1XD3B 3QX1A 2DYOA 3KYCD 5D94A 5IA7A 1K8RB 4K7SA 1E8WA 1WGDA 3NS8A 1J19A 1NDDA 2CHXA 4TQ1A 3ZUNA 3EECA 3S2AA 4PYUA 3H7PB 2D07B 1WY8A 3RZWC 1UD7A 4BOZB 3PS6A 2KO3A 4F8CB 4IW0A 3ML8A 1WMHA 2BWES 1E7UA 2PE6B 2IO0B 3B0AA 4GSWA 4HDQA 3SU8X 5E6PA 3VFKA 3V6EB 4YL8A 4DK5A 2BYVE 4N9F4 4HDOA 4ICUA 2M1MA 4WWPA 1WGRA 3ZTDA 1RRBA 5KHQA 3ZLZA 1CMXB 2C9WB 2JF5A 1E90A 3CSTA 3P2BA 2YVCA 4HVBA 2D3GA 3UIPB 5JHAA 1QZEA 1WJ4A 3HM6X 2LZ6A 3HM3A 3QHTA 3L16A 2KQSA 3B08A 2J0MA 1L2NA 3OLMD 2NBWB 2CHZA 3PRPB 1KJTA 4KIKB 4LDTD 2L3ZA 3TJPA 2KTRB 1P98A 4G11A 3JYUA 1WZ3A 1P0RA 1WJNA 2AEHA 2JRHA 2K8HA 2KDEB 2MSED 3SHQA 4BKGA 4CHKA 2ZPNA 3JSVB 4HPMB 2HD5B 2ZVOA 3ZNID 4BBNC 4EEWA 1UZXB 2I1KA 3K9OB 4DHZB 4II3B 3H1UA 3PZDA 2K6DB 4KDLB 2L8JA 3W1SA 4GOCA 4W9HA 1YJ1A 4CYEA 3A33B 1UELA 4TKNA 2L76A 1LQBA 2UWQA 3UQAA 2N9PC 2LVPA 2DENB 3GZNI 4ZRJA 3AU5A 5JZEB 1UGMA 1TTNA 2GBNA 4GDLA 1E8XA 3T9LA 2GBKA 4J6IA 4EOYA 2BKFA 2QHOA 4K81A 1P9DU 2CKHB 2LRWA 4DDID 4LCDE 2MQJA 3H9DA 4MGZE 4WWNA 1Z5SB 2KFKA 1MG8A 3WAOA 4MDKE 2K8CA 2HTHA 3NZSA 3KW5B 4TV3A 1U4AA 3BY4B 1TZ1A 4RM9A 3ZDMC 2CS4A 4WJPA 1Z2MA 4X57B 4DHJB 3PHWB 3SD5A 3ZVVA 1V6EA 3PGEA 4AWJA 3DQVA 2LUEA 2WX1A 3KUCB 2ZCBA 3B1LX 2AYOB 1L7YA 3X23A 2L7RA 4I6PA 1KM7A 3OJ3A 3GOEA 4W9FA 4MJSA 2MRPA 1WI0A 1WR6E 1ZKHA 3DBLI 3QK0A 4FULA 5BO4B 3DOWA 5D6JB 4HCNB 3TBLD 3WANA 4OVUA 2JWZA 1EO6A 2G4SA 2V4LA 4HWIB 4RM8A 2ASQA 3LJ3A 1J8CA 3QWZB 3DDCB 1UBQA 4GDKB 3VXWA 2N9XA 2FIFA 4IM2A 4KDIC 4GMVA 3A9JB 4WJNA 3L54A 1P1AA 4KZCA 2IO2B 2RSUA 4FJZA 4KSKC 4EUTA 2IZVB 2L00B 4A3PA 2M8SA 4F1SA 4EZJA 1WGGA 1GC7A 1WR1A 4IUMB 3RZFA 3VUXA 5J2RA 3QJZA 4CO7A 3K9PB 3T8MA 2MBOA 3MHSD 4XZ4A 2Z0DB 3U30A 3UF8A 3WALA 3ZW3A 2M0XA 4KVGB 4AJYB 2BF8B 4GN1A 1VCBA 1J0GA 2ZPYA 1SIFA 1V2YA 2G4DB 3EFUA 3M3JA 3ZO5B 2PE9A 4DHZE 5DPRA 3I3TB 2XEWA 3L13A 2NR2A 1ZGUB 2LJ5A 4I6NB 3A1QA 1Q0WB 2MP2A 4JQWC 4W9CA 3VH4B 2J0KA 1YD8U 3KUDB 5DPWA 2YLMA 3U8ZA 4WJOA 2BGFA 1PQSA 4ZRKA 2ZCCA 4LJOB 4ZYNA 4ANXA 4DHJD 1EUVB 1JRUA 2B3AA 2KDIA 4HK2A 3HK0A 4GIVA 1T0YA 2ZNVC 4NY0A 1RFAA 2DYMA 4MGKE 5AEKB 2AL6A 3CSFA 2O6VA 1OEYA 2JXXA 3ENEA 1NI2A 3DCGA 1YQBA 5AZHA 3QARA 2ZNVB 3PVLA 4ASWC 1S1QB 2N1VA 1I35A 1OTRB 5JH5C 2KDBA 1V81A 2AWTA 1WZ0A 2FCNA 3N32A 5HKHA 1WM2A 2IO1B 3D32A 4MSMB 2D2QA 1WE6A 2JRIB 3H6NA 4IWQA 2I1JA 4EFOA 3OJ4B 2FNJB 5EDSA 3VTVA 2RPQA 3V6CB 4JIOU 5FR6A 3UQBA 2Y5BB 2REXA 2BPSA 2M4NA 4FHJA 3VUYA 3TMPB 4II2B 4KIKA 2PJHA 1P3QU 2NPTB 3N3KB 4M8MA 3L17A 2R2QA 2KKCA 2KDFB 1GJZA 1WX7A 5GMVA 3L10B 4E74A 4AOFA 3EC8A 4AUQC 1WFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSV A;  4WWO A;  1XT9 B;  2LGD A;  2N1W A;  4BFR A;  2D10 A;  4PS3 A;  5C1Z A;  3KUZ A;  3H7S A;  2DZI A;  3M95 A;  4MEM A;  2JVC A;  2LWP A;  4NJ7 A;  4DBG A;  2RD0 A;  3DBS A;  2MW5 A;  4WJQ A;  2FUH B;  3UGB B;  1E8Z A;  1WGY A;  4KSL C;  4KV2 A;  3QA8 A;  2KMC A;  2XK5 B;  3UIO B;  1WGH A;  1YX5 B;  2WDT B;  4IM3 A;  3VTU A;  1WYW B;  3AXC A;  4G50 A;  2DAF A;  1TGZ B;  4M0W B;  1Q1O A;  2KD0 A;  1WF9 A;  2CHW A;  3PLU A;  2R2O A;  2ZVN A;  1KLV A;  2O2V A;  3AU4 A;  1WJ6 A;  2KJ6 A;  4G3X B;  3WIM A;  4EKU A;  4EZK A;  5G55 A;  3ECI A;  1RAX A;  3QIJ A;  2KX0 A;  3CF6 E;  3RT3 B;  4W9I A;  5J17 A;  1V86 A;  2KOX A;  2NBV B;  3QCA A;  4JLC A;  5LXH A;  2KC1 A;  3JVZ X;  4B95 A;  3QC8 B;  4I6L B;  1UH6 A;  2NVU I;  4MSQ B;  3Q3F A;  1M94 A;  5DCN A;  5CX3 A;  4NAW A;  1XQQ A;  2GMI C;  2VRR B;  4K1R B;  3TL5 A;  2HE7 A;  3M62 B;  5C23 A;  4FA6 A;  4BKS A;  1A5R A;  2KN5 A;  2FID A;  2LGY A;  5E6O A;  1WIA A;  2XBB C;  3AUL A;  1SGH A;  2N7E A;  1S3S G;  3KVF B;  4TQ0 A;  2RGF A;  5JHB A;  1V49 A;  2EKE C;  4DDG D;  2LVQ A;  3PRE A;  2KLG A;  4TUU A;  3VVW B;  3A9K A;  4A3O A;  4IC7 B;  2LRU A;  4P7I A;  4IM0 A;  2A4Z A;  4FAD A;  4ICV A;  3O65 B;  4G0N B;  4MJS B;  4IG7 B;  2KAN A;  2WWZ A;  2IY1 B;  4EZL A;  4MM3 A;  1RLF A;  2K6Q A;  2K1F A;  1IPG A;  2IY0 B;  5CTR C;  3ZKJ C;  3ONS A;  3PSE B;  4FBJ B;  2MA9 B;  1LFD A;  2D11 A;  1WE7 A;  3QAQ A;  2N9E B;  4ANW A;  2PEA A;  3IHP C;  2MBQ A;  2JY6 A;  3N30 A;  2BWF A;  3R66 C;  5E6N A;  4W9G A;  3IVF A;  3V62 A;  3A4R A;  3ZRF A;  4ANU A;  3ML9 A;  1D3Z A;  2FCM A;  4W9K A;  5D7G A;  2K39 A;  3VHT C;  2MBB B;  1IP9 A;  3APF A;  2IYD B;  2KWU B;  2KZR A;  3ZDT A;  3QQ8 B;  1V9J A;  2KJR A;  4NJ6 A;  4W9E A;  2FAZ A;  3RUI B;  3ZNH B;  4AJW A;  2CU1 A;  4JL9 A;  2L0T A;  3PRZ A;  2M17 A;  3KH0 A;  1WX9 A;  3RYT A;  2IO3 B;  1IYF A;  2WYQ A;  3ZIM A;  1KOT A;  3TIX A;  3H7P A;  1EF5 A;  4FN2 A;  2DX5 B;  4MH0 E;  2KK8 A;  1ISN A;  3MTN B;  4JGH B;  4PS7 A;  3ZNG C;  4W9D A;  4BKT A;  3DVG X;  2FCS A;  3HIZ A;  3HHM A;  3A1Q B;  1OQY A;  2MP2 B;  2JT4 B;  4GB9 A;  1Q5W B;  2MWS B;  3VAW A;  3PPA A;  2C7M B;  1YIW A;  1ZW7 A;  2A5U A;  2KFJ A;  3DPD A;  2K25 A;  3JW0 X;  1FXT B;  3NZU A;  4NQL B;  2L05 A;  1YX6 B;  4RMA A;  1HE8 A;  2EMT A;  1VD2 A;  2KMA A;  2O6V B;  2ZEQ A;  3VDZ A;  4AP4 C;  1X1M A;  4MEL A;  5TR5 A;  3NHE B;  2NPT A;  4BKS D;  4F7Z A;  2KTR A;  1WMH B;  1OGW A;  3OAW A;  3NY5 A;  2EMS A;  3DBR I;  3X0W A;  2GBR A;  3CMM B;  2DAJ A;  4LJP B;  3DVG Y;  1WXV A;  5LLI A;  2Z0E B;  2MBH A;  1I42 A;  5L95 C;  5CHW A;  4MGI E;  2N4F A;  3AI5 A;  5KHO A;  4URK A;  2KC2 A;  1C1Y B;  1GG3 A;  1WRD B;  1AAR A;  3DVN V;  1BT0 A;  4E71 A;  3R7Q A;  1V5T A;  4HXD A;  2DZK A;  3V60 A;  2MCN B;  4ANV A;  1WX8 A;  2C7N B;  4ZDV A;  2GBJ A;  2XK5 A;  4GU2 A;  1WXS A;  4WAA A;  3VTW A;  1WH3 A;  2JUO A;  2WX0 A;  4E3C A;  2G3Q B;  5DPT A;  4GGQ A;  4BVU C;  2KQ7 A;  4DXA B;  3W1S C;  5CHV C;  4MGY E;  4IWP A;  4FJV B;  2KVR A;  3BIN A;  5LXI B;  2NCN A;  2RR9 A;  3PV1 A;  4DWF A;  2LI5 A;  2MLB A;  3ZRC A;  3APD A;  1SE9 A;  1WXA A;  4NPN A;  2CR5 A;  2MX2 A;  3PHX B;  4PS8 A;  3V61 A;  2BKR B;  3R7R A;  3ALB A;  4BBN F;  4BOS C;  4PYZ A;  4K7U A;  5L83 A;  2JZ3 B;  2IBI B;  4GDL B;  2KWC A;  3IG3 A;  1GC6 A;  1LM8 B;  3PTF C;  4M8N A;  1OEY J;  2KWV B;  2ZZP B;  4GXB A;  5IAA C;  2O6V D;  2V1Y A;  3VUW A;  1V80 A;  2KJH B;  1R4N I;  2K8B A;  5J18 A;  1GUA B;  4NQK E;  2O2V B;  3U7D A;  2J0J A;  3PRM B;  3UIN B;  2BYE A;  2GBM A;  1TBE A;  2C5L C;  2KFK B;  3C0R B;  3IBE A;  2HJ8 A;  2J7Q B;  3VQI A;  2L0F A;  3RCZ A;  5D2M B;  3PLV A;  4GDK A;  1V5O A;  3A4S C;  4NNJ B;  3RD2 A;  2KLC A;  1Y8R C;  3A9J A;  4W9J A;  3DVN U;  2JPH A;  2LVO A;  5DPS A;  2LAS A;  2Z59 B;  3WA0 A;  1EF1 A;  1G6J A;  2KX3 A;  3VH3 B;  2C7H A;  4XC2 A;  2DYB A;  4NAW B;  3R3M A;  3L0W B;  2GOW A;  1WJU A;  1WXM A;  3PT2 B;  3ZNZ B;  1UBI A;  2NBU A;  2C60 A;  3EHV A;  2DHZ A;  3WAM A;  1LXD A;  2DZM A;  2PPH A;  4XX5 A;  4IWO A;  4OVV A;  2KNB A;  1H8C A;  1C3T A;  2MBE A;  2KHW B;  5CHF A;  3SDL C;  3WAP A;  4FLH A;  2ZJD A;  3APC A;  3M63 B;  4B9K A;  3KYD D;  3A9K B;  2V3S A;  3Q3J A;  2LXA A;  3TCA A;  2OOB B;  3NOB A;  2LGX A;  3ZTC A;  1H4R A;  4HCP B;  3L08 A;  2JZZ A;  3IFW B;  4FJY A;  1E8Y A;  4LDT B;  1NBF C;  1GNU A;  2W9N A;  2BYF A;  1E7V A;  1R4M I;  3RUL A;  4HLE A;  2N7D A;  2LXC A;  2LD9 A;  4HJK A;  3MJW A;  4B6W A;  2FCQ A;  3DBH I;  4A20 A;  2AL3 A;  2UYZ B;  2OJR A;  4WQO B;  5AZG A;  2KTF A;  3LDZ E;  5AZF A;  1E5W A;  2NS5 A;  4FHK A;  1WM3 A;  2DZJ A;  4HPL B;  4W9L A;  4KZ0 A;  4ZRI A;  3W1Y A;  4K7W A;  2G45 B;  1F9J A;  5G2N A;  2KXJ A;  1XD3 B;  3QX1 A;  2DYO A;  3KYC D;  5D94 A;  5IA7 A;  1K8R B;  4K7S A;  1E8W A;  1WGD A;  3NS8 A;  1J19 A;  1NDD A;  2CHX A;  4TQ1 A;  3ZUN A;  3EEC A;  3S2A A;  4PYU A;  3H7P B;  2D07 B;  1WY8 A;  3RZW C;  1UD7 A;  4BOZ B;  3PS6 A;  2KO3 A;  4F8C B;  4IW0 A;  3ML8 A;  1WMH A;  2BWE S;  1E7U A;  2PE6 B;  2IO0 B;  3B0A A;  4GSW A;  4HDQ A;  3SU8 X;  5E6P A;  3VFK A;  3V6E B;  4YL8 A;  4DK5 A;  2BYV E;  4N9F 4;  4HDO A;  4ICU A;  2M1M A;  4WWP A;  1WGR A;  3ZTD A;  1RRB A;  5KHQ A;  3ZLZ A;  1CMX B;  2C9W B;  2JF5 A;  1E90 A;  3CST A;  3P2B A;  2YVC A;  4HVB A;  2D3G A;  3UIP B;  5JHA A;  1QZE A;  1WJ4 A;  3HM6 X;  2LZ6 A;  3HM3 A;  3QHT A;  3L16 A;  2KQS A;  3B08 A;  2J0M A;  1L2N A;  3OLM D;  2NBW B;  2CHZ A;  3PRP B;  1KJT A;  4KIK B;  4LDT D;  2L3Z A;  3TJP A;  2KTR B;  1P98 A;  4G11 A;  3JYU A;  1WZ3 A;  1P0R A;  1WJN A;  2AEH A;  2JRH A;  2K8H A;  2KDE B;  2MSE D;  3SHQ A;  4BKG A;  4CHK A;  2ZPN A;  3JSV B;  4HPM B;  2HD5 B;  2ZVO A;  3ZNI D;  4BBN C;  4EEW A;  1UZX B;  2I1K A;  3K9O B;  4DHZ B;  4II3 B;  3H1U A;  3PZD A;  2K6D B;  4KDL B;  2L8J A;  3W1S A;  4GOC A;  4W9H A;  1YJ1 A;  4CYE A;  3A33 B;  1UEL A;  4TKN A;  2L76 A;  1LQB A;  2UWQ A;  3UQA A;  2N9P C;  2LVP A;  2DEN B;  3GZN I;  4ZRJ A;  3AU5 A;  5JZE B;  1UGM A;  1TTN A;  2GBN A;  4GDL A;  1E8X A;  3T9L A;  2GBK A;  4J6I A;  4EOY A;  2BKF A;  2QHO A;  4K81 A;  1P9D U;  2CKH B;  2LRW A;  4DDI D;  4LCD E;  2MQJ A;  3H9D A;  4MGZ E;  4WWN A;  1Z5S B;  2KFK A;  1MG8 A;  3WAO A;  4MDK E;  2K8C A;  2HTH A;  3NZS A;  3KW5 B;  4TV3 A;  1U4A A;  3BY4 B;  1TZ1 A;  4RM9 A;  3ZDM C;  2CS4 A;  4WJP A;  1Z2M A;  4X57 B;  4DHJ B;  3PHW B;  3SD5 A;  3ZVV A;  1V6E A;  3PGE A;  4AWJ A;  3DQV A;  2LUE A;  2WX1 A;  3KUC B;  2ZCB A;  3B1L X;  2AYO B;  1L7Y A;  3X23 A;  2L7R A;  4I6P A;  1KM7 A;  3OJ3 A;  3GOE A;  4W9F A;  4MJS A;  2MRP A;  1WI0 A;  1WR6 E;  1ZKH A;  3DBL I;  3QK0 A;  4FUL A;  5BO4 B;  3DOW A;  5D6J B;  4HCN B;  3TBL D;  3WAN A;  4OVU A;  2JWZ A;  1EO6 A;  2G4S A;  2V4L A;  4HWI B;  4RM8 A;  2ASQ A;  3LJ3 A;  1J8C A;  3QWZ B;  3DDC B;  1UBQ A;  4GDK B;  3VXW A;  2N9X A;  2FIF A;  4IM2 A;  4KDI C;  4GMV A;  3A9J B;  4WJN A;  3L54 A;  1P1A A;  4KZC A;  2IO2 B;  2RSU A;  4FJZ A;  4KSK C;  4EUT A;  2IZV B;  2L00 B;  4A3P A;  2M8S A;  4F1S A;  4EZJ A;  1WGG A;  1GC7 A;  1WR1 A;  4IUM B;  3RZF A;  3VUX A;  5J2R A;  3QJZ A;  4CO7 A;  3K9P B;  3T8M A;  2MBO A;  3MHS D;  4XZ4 A;  2Z0D B;  3U30 A;  3UF8 A;  3WAL A;  3ZW3 A;  2M0X A;  4KVG B;  4AJY B;  2BF8 B;  4GN1 A;  1VCB A;  1J0G A;  2ZPY A;  1SIF A;  1V2Y A;  2G4D B;  3EFU A;  3M3J A;  3ZO5 B;  2PE9 A;  4DHZ E;  5DPR A;  3I3T B;  2XEW A;  3L13 A;  2NR2 A;  1ZGU B;  2LJ5 A;  4I6N B;  3A1Q A;  1Q0W B;  2MP2 A;  4JQW C;  4W9C A;  3VH4 B;  2J0K A;  1YD8 U;  3KUD B;  5DPW A;  2YLM A;  3U8Z A;  4WJO A;  2BGF A;  1PQS A;  4ZRK A;  2ZCC A;  4LJO B;  4ZYN A;  4ANX A;  4DHJ D;  1EUV B;  1JRU A;  2B3A A;  2KDI A;  4HK2 A;  3HK0 A;  4GIV A;  1T0Y A;  2ZNV C;  4NY0 A;  1RFA A;  2DYM A;  4MGK E;  5AEK B;  2AL6 A;  3CSF A;  2O6V A;  1OEY A;  2JXX A;  3ENE A;  1NI2 A;  3DCG A;  1YQB A;  5AZH A;  3QAR A;  2ZNV B;  3PVL A;  4ASW C;  1S1Q B;  2N1V A;  1I35 A;  1OTR B;  5JH5 C;  2KDB A;  1V81 A;  2AWT A;  1WZ0 A;  2FCN A;  3N32 A;  5HKH A;  1WM2 A;  2IO1 B;  3D32 A;  4MSM B;  2D2Q A;  1WE6 A;  2JRI B;  3H6N A;  4IWQ A;  2I1J A;  4EFO A;  3OJ4 B;  2FNJ B;  5EDS A;  3VTV A;  2RPQ A;  3V6C B;  4JIO U;  5FR6 A;  3UQB A;  2Y5B B;  2REX A;  2BPS A;  2M4N A;  4FHJ A;  3VUY A;  3TMP B;  4II2 B;  4KIK A;  2PJH A;  1P3Q U;  2NPT B;  3N3K B;  4M8M A;  3L17 A;  2R2Q A;  2KKC A;  2KDF B;  1GJZ A;  1WX7 A;  5GMV A;  3L10 B;  4E74 A;  4AOF A;  3EC8 A;  4AUQ C;  1WFY A; 
#chains in the Genus database with same CATH topology
 4JWS C;  3AE2 B;  3M95 A;  4MEM A;  3Q3O C;  2FUH B;  1WGY A;  3T3O A;  1JWS D;  2BS2 B;  3W9C B;  3UIO B;  1WGH A;  2N7J A;  2JYE A;  1D4B A;  4M0W B;  2OED A;  2ZVN A;  2O2V A;  1C77 A;  2KJ6 A;  2KX0 A;  4LNF A;  3CF6 E;  3RT3 B;  1AYF A;  2BB5 A;  2JQR B;  1LO5 D;  4B95 A;  5FKA C;  1XQQ A;  2VRR B;  1MHX A;  3E56 A;  4IKG A;  4CQN A;  2LGI A;  2FID A;  2LGY A;  2XBB C;  3AUL A;  1S3S G;  1DYQ A;  1V49 A;  2EKE C;  4DDG D;  4TUU A;  3A9K A;  4OHJ A;  1BML C;  3O65 B;  4G0N B;  1XCT L;  2KAN A;  2K6Q A;  1C78 A;  4XGA B;  4US8 A;  2D11 A;  2PEA A;  2JY6 A;  4W9G A;  3IVF A;  3ML9 A;  1RFK A;  4B0E A;  3N1X C;  4XWW A;  4KKJ A;  3VHT C;  1IP9 A;  3APF A;  3PRZ A;  3KH0 A;  1WX9 A;  3FKY A;  2WXF A;  1QOF A;  4FN2 A;  2IGG A;  4MH0 E;  1ISN A;  4JGH B;  2WXH A;  4PS7 A;  4J3O D;  4RF0 A;  3HHM A;  4REZ A;  1FXA A;  5MPO A;  3PPA A;  1E7P B;  1FXI A;  1YIW A;  1T0Q C;  2K25 A;  2L05 A;  4LNO A;  2EMT A;  3U52 E;  4C56 C;  2ZEQ A;  5TR5 A;  2DBY A;  1OGW A;  2EMS A;  2GBR A;  4L23 A;  4LJP B;  5LLI A;  1TY0 A;  3GB1 A;  5CHW A;  1UF0 A;  5KHO A;  4URK A;  1FEH A;  1WRD B;  1IUE A;  1HTQ A;  4HXD A;  3AE5 B;  1WX8 A;  1L4D B;  4GU2 A;  4WAA A;  4ARC A;  4HRS A;  2JUO A;  5DPT A;  3IAM 1;  1N62 A;  2J4X A;  1C4C A;  4FJV B;  2KVR A;  1ET9 A;  2RR9 A;  4DWF A;  2MLB A;  2VZK B;  4NPN A;  2MX2 A;  3SR6 A;  3V61 A;  3R7R A;  3W2D A;  4BBN F;  4K7U A;  1VDV A;  4YSY B;  2JZ3 B;  2IBI B;  4GDL B;  3IG3 A;  3AE3 B;  2KWV B;  2ZZP B;  1ESF A;  1TYG B;  2V1Y A;  2KJH B;  4NQK E;  2O2V B;  1F2R I;  2D5G A;  1TBE A;  2HJ8 A;  3E9S A;  1SE2 A;  2KN4 A;  3N1Y C;  4OZA A;  1FO4 A;  1Y8R C;  1FCL A;  5H92 C;  2LVO A;  3WA0 A;  1QOG A;  2KX3 A;  3VH3 B;  3R3M A;  3L0W B;  1F77 A;  2K9X A;  1WJU A;  3TSS A;  1K53 A;  3J9C A;  5HHD G;  3WAM A;  1LXD A;  2MEK A;  3ZXR A;  4KX6 B;  3A9K B;  3I63 C;  3ABV B;  2WXG A;  4YT0 B;  2N9K A;  3N1Z C;  4HCP B;  3EUB 2;  3IFW B;  1GNU A;  1TJE A;  1MJD A;  2BYF A;  1R4M I;  1FMA D;  3Q3N C;  2MJ3 A;  4HJK A;  4B6W A;  3DBH I;  2Z8L A;  2N0S B;  4WQO B;  2KTF A;  3PZ8 A;  3U4E G;  4K7W A;  2OJW A;  2G45 B;  3BYY B;  2H88 B;  3KYC D;  3RNA C;  1K8R B;  3ZUN A;  4TQ1 A;  1J19 A;  1NDD A;  1WRI A;  2CHX A;  1TKE A;  4USA A;  5G5G A;  3R2T A;  3Q3M C;  4F8C B;  1WGK A;  1WMH A;  2IO0 B;  5E6P A;  2FE8 A;  2WU2 B;  3IAS 1;  4WWP A;  3ZTD A;  1RRB A;  2BTE A;  3NUH B;  1CMX B;  2C9W B;  3CST A;  3UIP B;  3ETR A;  3HM6 X;  2LZ6 A;  2KQS A;  1FCC C;  1L2N A;  3PRP B;  1KJT A;  4KIK B;  1CZP A;  4YTM B;  2L3Z A;  1P98 A;  4G11 A;  2CU3 A;  1YJI A;  1P0R A;  1R7S A;  2AEH A;  2KDE B;  3Q14 C;  2YEP F;  3SHQ A;  2ZPN A;  3ZNI D;  4EEW A;  4ACF A;  4BBN C;  2L32 A;  4KDL B;  4GOC A;  4W9H A;  1YJ1 A;  3A33 B;  1HZ5 A;  2K0P A;  5HI1 A;  2UWQ A;  1BUI C;  4ZRJ A;  1F52 A;  4EOY A;  4WH4 A;  1L5P A;  3EGR A;  2JXT A;  4LCD E;  2MQJ A;  4MGZ E;  2KFK A;  1U4A A;  4ZHO A;  2NTT A;  2LUM A;  4AWJ A;  3DQV A;  3GP7 A;  2ZCB A;  2V0G A;  3OJ3 A;  3GOE A;  4W9F A;  4MJS A;  2MRP A;  1XCQ L;  2MHJ A;  1K51 A;  4OVU A;  2JWZ A;  3MC9 A;  4DXF A;  1EO6 A;  4XDC A;  1KFY B;  4KDI C;  1TS3 A;  1RWS A;  4P1B C;  1TKG A;  2M0A A;  3P4S B;  1BXT A;  4EUT A;  2SAK A;  4NZL B;  2M8S A;  1I4X A;  3RZF A;  4LNI A;  2BBC A;  3QJZ A;  2MBO A;  2Z0D B;  1SIF A;  3HVD A;  3Q8B A;  1HXY D;  3PZ7 A;  3I3T B;  2LJ5 A;  1Q0W B;  2MP2 A;  4W9C A;  4OZB A;  3AE8 B;  1L6U A;  1HZ6 A;  5IO9 A;  3U8Z A;  2BGF A;  4ZYN A;  2ZCC A;  4LJO B;  4ANX A;  3DHH C;  1EUV B;  2L52 A;  2B3A A;  2KDI A;  1AWD A;  3RMK C;  1RFA A;  2XNA C;  3ZXV A;  3CSF A;  2O6V A;  4XYC A;  1SBB B;  1YQB A;  5AZH A;  1DOX A;  4ASW C;  1OTR B;  2KDB A;  2AWT A;  1WZ0 A;  2GRI A;  2IJ0 A;  1WM2 A;  2R61 A;  2M19 A;  4LLG M;  3H6N A;  2JRI B;  1FRD A;  4EFO A;  2Y5B B;  4FHJ A;  3VUY A;  3R8B A;  2WU5 B;  3B2G A;  1PFD A;  2PJH A;  1TS4 A;  4M8M A;  1GJZ A;  1V1P B;  3L10 B;  3OWE B;  4AUQ C;  1I4H A;  2MH7 A;  3JSV A;  1XT9 B;  2N1W A;  2D10 A;  2BT6 A;  4PS3 A;  4WWM A;  4N6E B;  2UU7 A;  2MW5 A;  1XLO A;  4KV2 A;  3QA8 A;  2XK5 B;  1UGJ A;  4IM3 A;  1WYW B;  3AXC A;  1TGZ B;  2WHI A;  3GE3 C;  2KD0 A;  4XE0 A;  2CHW A;  4P6V F;  3PLU A;  5JXV A;  4EZK A;  5G55 A;  2AQ3 B;  5BMI A;  1V86 A;  2KOX A;  3QCA A;  2KC1 A;  3MFG A;  4H2A A;  3B9J A;  4I6L B;  1UH6 A;  2NVU I;  1M94 A;  3KQ4 A;  4K1R B;  2Y3A A;  1UWX A;  5IOI A;  4FA6 A;  3EA6 A;  4ITK A;  2KN5 A;  5E6O A;  1SGH A;  2IDY A;  3AN1 A;  3U7Z A;  3GZN B;  3PRE A;  3UI3 A;  3RNC C;  4P7I A;  4IM0 A;  2A4Z A;  4ICV A;  3P1M A;  3EFC A;  4MJS B;  2WWZ A;  4MM3 A;  1RLF A;  2K1F A;  4O1N A;  5CTR C;  2PW9 A;  4WQM A;  4N58 A;  4FBJ B;  1ZPS A;  3BII D;  5E6N A;  3R66 C;  4RGT A;  3V62 A;  1Y56 A;  2WXQ A;  3SEB A;  1D3Z A;  3PO0 A;  2FCM A;  1JRO A;  5D7G A;  2MBB B;  2KWU B;  1NI3 A;  3QQ8 B;  3RUI B;  3ZNH B;  4AJW A;  2L0T A;  2M17 A;  2IO3 B;  1QLB B;  2D3A A;  1N5X A;  1KLG D;  4RFB A;  2W82 A;  1FIQ A;  3ZGZ A;  3DVG X;  3HIZ A;  1MHH E;  1SJE D;  1OQY A;  2MP2 B;  2JT4 B;  3RI7 C;  3RNF C;  4GB9 A;  2MWS B;  2I38 A;  3Q8E A;  3VAW A;  2C7M B;  1ZW7 A;  2B76 B;  3NVY A;  2RDB C;  3DPD A;  1YX6 B;  3KWV A;  2O6V B;  1X1M A;  3NHE B;  2NPT A;  4BKS D;  1AN8 A;  3OAW A;  3NY5 A;  3CMM B;  1WXV A;  2MBH A;  5L95 C;  2BYT A;  2ON8 A;  3AI5 A;  2J52 A;  1N63 A;  1AAR A;  1QKZ A;  3DVN V;  4M01 A;  4E71 A;  4KGR A;  3VR8 B;  3GE8 C;  2DZK A;  2MCN B;  4NAM A;  4ZDV A;  2GBJ A;  4LTU A;  2WXP A;  1CK1 A;  2WX0 A;  1WSP A;  4DXA B;  4M00 A;  1UUP A;  1L6V A;  3FC4 A;  4MH8 A;  3H8H A;  2LI5 A;  5AUI A;  3AE4 B;  3ZRC A;  3APD A;  2WP9 B;  1WXA A;  4PS8 A;  2BKR B;  2V9H A;  4HPP A;  2FBW B;  2KWC A;  1LM8 B;  4M8N A;  1OEY J;  2BB6 A;  1KH0 A;  2O6V D;  1GUA B;  2XN9 C;  2J0J A;  3PRM B;  3C0R B;  2DNF A;  3PLV A;  2RMM A;  1DOY A;  4NNJ B;  3RD2 A;  2KLC A;  4MT5 A;  2V3N A;  3DVN U;  2JPH A;  2Z59 B;  1EF1 A;  4XC2 A;  1FNU A;  2DYB A;  1XLN A;  1IBX A;  2QC8 A;  1WXM A;  1UBI A;  3EHV A;  1AW7 A;  1H8C A;  2MBE A;  3WAP A;  5C3J B;  3APC A;  3URY A;  3KYD D;  2V3S A;  3TEX A;  2LXA A;  1VJK A;  2JU6 X;  1FFV A;  3DWG C;  4MM3 B;  1H4R A;  4RGO S;  2KVZ A;  2LEK A;  1MI0 A;  2W9N A;  1E7V A;  3RUL A;  2N7D A;  3NRZ A;  1K50 A;  4A20 A;  2AL3 A;  2OJR A;  1MG4 A;  2H89 B;  5AZG A;  1V1O A;  1E5W A;  3P4P B;  1L4Z B;  1HEZ E;  4TSS A;  4ZRI A;  3W1Y A;  3FIL A;  1XD3 B;  3LXF A;  5D94 A;  1Q10 A;  4PYU A;  4K3B A;  2D07 B;  3RZW C;  3PS6 A;  2KAJ A;  1ACC A;  4IW0 A;  5EE9 A;  2BWE S;  2PE6 B;  1E7U A;  5IKC M;  3SU8 X;  3TUO A;  1L0V B;  2VH2 A;  4YL8 A;  4DK5 A;  4N9F 4;  3AV8 A;  4HDO A;  5T8I A;  5KHQ A;  4HKZ E;  3ZYY X;  2YVC A;  2D3G A;  4C00 A;  1WJ4 A;  1D5Z C;  1JWB D;  2J0M A;  5BYQ A;  1NEN B;  2NBW B;  1A70 A;  3ZQ4 A;  4CHK A;  2MSE D;  5G5H A;  2QIL A;  4A6Q A;  2MJE A;  2ONQ A;  2I1K A;  3K9O B;  4DHZ B;  4II3 B;  3N9Y C;  3H1U A;  1I4Q A;  2QCZ A;  3W1S A;  3BVZ A;  1UEL A;  3GS2 A;  4IOI E;  4TKN A;  1LQB A;  2LVP A;  2DEN B;  3GZN I;  5JZE B;  1TTN A;  2GBN A;  1I4P A;  1P9D U;  1VZ6 A;  2CKH B;  1VRA B;  4LK0 M;  2WGS A;  4WWN A;  1Z5S B;  5E6J A;  1EM7 A;  4MAC A;  2K8C A;  3VR9 B;  2GB1 A;  4TV3 A;  3BY4 B;  2KWD A;  3TEY A;  4A55 A;  2EEL A;  4L2Y A;  1V6E A;  3Q8F A;  3B1L X;  2WDR B;  3TEZ A;  3MC0 B;  2L7R A;  1KM7 A;  1N6Z A;  1WI0 A;  3AB5 A;  1ZKH A;  1ZDV A;  3DOW A;  1JW9 D;  2JSV X;  3T3N A;  3WAN A;  3O13 A;  4HWI B;  2G4S A;  2K22 A;  1VR9 A;  1J8C A;  2IND C;  3N20 C;  1UBQ A;  1NEK B;  1ZXH A;  2N9X A;  2FIF A;  2WS3 B;  3RNG C;  4WJN A;  3L54 A;  1XLP A;  1YMH E;  4KZC A;  4KSK C;  1IGD A;  2L00 B;  4F1S A;  1WGG A;  1XEE A;  1WR1 A;  3VUX A;  1E0Z A;  5J2R A;  1PGB A;  4CO7 A;  3T8M A;  3UF8 A;  3U30 A;  3RPF C;  1D5M C;  1JML A;  2ZPY A;  3V3X A;  1C4P A;  3M3J A;  4AQ7 A;  2EKI A;  3L13 A;  2XEW A;  3W5V B;  3VH4 B;  2KAC A;  3KUD B;  4WJO A;  4DQO C;  1WYG A;  4ZRK A;  3RNB C;  4HK2 A;  3HK0 A;  4NY0 A;  4YSX B;  2DYM A;  2AL6 A;  1FNV A;  3ENE A;  1DGJ A;  1NI2 A;  3DCG A;  4BZA A;  3QAR A;  4QAY A;  5JH5 C;  4ZOH C;  3R2I A;  1TY2 A;  5GXG B;  2IO1 B;  1FM0 D;  1KF6 B;  2JZP A;  2I1J A;  2FNJ B;  2RPQ A;  4JIO U;  5FR6 A;  3UQB A;  2BS4 B;  2BPS A;  1HA5 A;  2W3S A;  2J53 A;  1P3Q U;  2G1E A;  2L83 A;  3L17 A;  2R2Q A;  2KKC A;  2KDF B;  4HLE A;  1SSN A;  2LGD A;  4BFR A;  2DZI A;  2JVC A;  2LWP A;  4NJ7 A;  2RD0 A;  3DBS A;  4C80 A;  1V97 A;  4KSL C;  1QF6 A;  3BK1 A;  2WDT B;  1F0Z A;  1Q1O A;  1WF9 A;  2R2O A;  1KLV A;  3AU4 A;  1WJ6 A;  4G3X B;  4ZHP A;  1RAX A;  3QIJ A;  5J17 A;  2NBV B;  5LXH A;  1FRR A;  3TEW A;  3QC8 B;  2V4I B;  4A9A A;  2BVC A;  2JX5 A;  4NAW A;  2GMI C;  4XDD A;  4YTN B;  2HE7 A;  3M62 B;  5C23 A;  2DLB A;  4BKS A;  2E3T A;  2JWU A;  4YSZ B;  3NVW A;  5JHB A;  1ET6 A;  1I4R A;  1JRP A;  5C2T B;  4IC7 B;  2LRU A;  4FAD A;  5H8Y E;  2BW2 A;  1EU3 A;  2IY0 B;  3ONS A;  3PSE B;  2MA9 B;  1SXT A;  2J42 A;  3QAQ A;  2N9E B;  5EE0 A;  3IHP C;  2L1A A;  5EE1 A;  2BWF A;  3DWM A;  3ZRF A;  4C4V A;  4HEA 1;  4ZYS A;  2CJO A;  2IYD B;  3VRA B;  2KZR A;  3ZDT A;  4W9E A;  2FAZ A;  2CU1 A;  1IYF A;  3Q69 A;  4C7Y A;  3Q8A A;  1SF0 A;  3TIX A;  2KQ4 X;  3H7P A;  2DX5 B;  2KK8 A;  3MTN B;  3ZNG C;  2LGS A;  1JQ4 A;  4W9D A;  4BKT A;  1JWA D;  4S17 A;  2KFJ A;  3NZU A;  1FXT B;  4NQL B;  5BMH A;  1HE8 A;  1VD2 A;  2CJN A;  2KMA A;  4PT5 A;  4AP4 C;  3ZJT A;  1CJE A;  1YN5 A;  4F7Z A;  1WMH B;  1CQV A;  3X0W A;  1XXG A;  1E9M A;  1EWC A;  3CWI A;  1I42 A;  2Z0E B;  1B1Z A;  4MGI E;  2N4F A;  4P1C C;  2KC2 A;  1GG3 A;  1BT0 A;  3Q8C A;  3R7Q A;  1V5T A;  4WAF A;  3LYY A;  3IXS A;  1QOA A;  2LFI A;  3VTW A;  1E6E B;  4M0W A;  2G3Q B;  4GGQ A;  2KQ7 A;  5CHV C;  1LGR A;  3BIN A;  5LXI B;  3PV1 A;  1SE9 A;  5L83 A;  1PGA A;  1GC6 A;  2WNM A;  3B2F A;  4GXB A;  1SE4 A;  2LMC A;  1V80 A;  2D3C A;  2PTL A;  4ARI A;  3U7D A;  3UIN B;  2KFK B;  2C5L C;  2PIA A;  3VQI A;  4A8X C;  2J7Q B;  5IN7 A;  3LB8 C;  2QEJ C;  3A4S C;  2WXN A;  1SEB D;  2LAS A;  5FR3 A;  4NAW B;  1QQR A;  2KYW A;  4WIP A;  1T3Q A;  2GOW A;  3AEB B;  3ZNZ B;  2NBU A;  4RNA A;  2DHZ A;  1ZP0 B;  4XX5 A;  3VRB B;  4OVV A;  5D3D A;  3DHI C;  1C3T A;  2IGD A;  5CHF A;  4FLH A;  2ZJD A;  3I57 A;  1UWM A;  3M63 B;  1KLU D;  3Q6B A;  1WWT A;  3NOB A;  2PLP A;  3ZTC A;  1JCK B;  1NVI D;  1E8Y A;  3BWU D;  2INC C;  1KRH A;  2LXC A;  5D3I B;  2UYZ B;  1FD6 A;  3Q2A C;  4C4V B;  3I9V 1;  2NS5 A;  4W9L A;  1B9R A;  2W54 A;  2LJI A;  5G2N A;  2DWQ A;  2DYO A;  1WGD A;  3EEC A;  3S2A A;  3H7P B;  4B0M A;  2ZW0 A;  1UD7 A;  2K3U A;  3C8Y A;  3B0A A;  2PKO A;  3CIR B;  3VFK A;  4YXD B;  2BYV E;  1SIJ A;  3AEG B;  1TIF A;  1YN4 A;  3AM9 A;  3ZLZ A;  2JF5 A;  1VLB A;  3P2B A;  5JHA A;  1XO3 A;  1EWY C;  1J7B A;  2M56 B;  2QJL A;  3B08 A;  3P4R B;  3DHG C;  3AEA B;  3JYU A;  2LHD A;  4JE3 B;  5I4D A;  1L0X B;  1WJN A;  3JSV B;  1UZX B;  2K6D B;  1EU4 A;  5BYS A;  1T5X D;  2NMQ A;  4P16 A;  4C7Z A;  2N9P C;  4RH6 A;  1N5W A;  4GDL A;  1E8X A;  3DBR B;  3NG0 A;  2BKF A;  2QHO A;  2LRW A;  3H9D A;  1T6B X;  1MG8 A;  3WAO A;  4MDK E;  3AE1 B;  3AMZ A;  3NZS A;  2WXR A;  2CS4 A;  1Z2M A;  4DHJ B;  3PHW B;  3SD5 A;  4JPS A;  3KUC B;  5TSS A;  2AYO B;  4I6P A;  3WCQ A;  3C19 A;  3IT6 B;  2LHE A;  4FXC A;  5BO4 B;  1YNT E;  1D5X C;  4OVZ A;  1C79 A;  2V4L A;  2OHF A;  2ACZ B;  3QWZ B;  3DDC B;  1I7H A;  2HJ1 A;  3L4P A;  1P1A A;  3AEE B;  2RSU A;  2IZV B;  1R4N B;  4KGT A;  4IUM B;  2E6X A;  3K9P B;  3MHS D;  3WAL A;  3ZW3 A;  3MJ5 A;  3FAH A;  4GN1 A;  3IT4 B;  1VCB A;  1ZDX A;  2V3P A;  1J0G A;  5FK9 C;  2KDM A;  1F1H A;  2RDH A;  3ZO5 B;  3HUI A;  4DHZ E;  1ZGU B;  3A1Q A;  3P42 A;  2YLM A;  4DHJ D;  1JRU A;  2MJD A;  1FFU A;  4GIV A;  1TS2 A;  1STE A;  2ZNV C;  4MGK E;  5AEK B;  1OEY A;  1V8C A;  3AH7 A;  2HTM E;  2ZNV B;  4ZRQ A;  1P7E A;  3PVL A;  1K52 A;  1S1Q B;  2N1V A;  4EE2 A;  1VZ8 A;  2INP E;  1V81 A;  3N32 A;  1XF5 L;  3BVG A;  3D32 A;  4MSM B;  4JX1 C;  2D2Q A;  1WE6 A;  2K5P A;  3OJ4 B;  1C4A A;  2INN E;  2REX A;  1GPX A;  2JYT A;  1I4G A;  2M4N A;  1MPE A;  4KIK A;  2KT7 A;  2NPT B;  5AUK A;  3N3K B;  1NYQ A;  1WX7 A;  5GMV A;  4E74 A;  3BYT B;  3EC8 A;  5EDS A;  4WWO A;  1T0S C;  5C1Z A;  3KUZ A;  4RF1 A;  3H7S A;  4KGS A;  4DBG A;  1MFW A;  2X38 A;  4WJQ A;  3UGB B;  1E8Z A;  2KMC A;  3VTU A;  1YX5 B;  4M02 A;  1KTK A;  4G50 A;  2DAF A;  4RGN A;  4EKU A;  3MP9 A;  3ECI A;  2PVG C;  1SE3 A;  5HFY A;  4W9I A;  4JLC A;  3JVZ X;  1GAQ B;  2IGH A;  2PVO D;  3AEF B;  1ROE A;  4MSQ B;  3Q3F A;  5DCN A;  5CX3 A;  3TL5 A;  1YQ3 B;  2WXI A;  1DOI A;  2WLB A;  1WIA A;  4NJC A;  2IPK D;  4XWT A;  4UDU C;  2N7E A;  3KVF B;  4TQ0 A;  2RGF A;  2WDV B;  1M4V A;  2LVQ A;  2KLG A;  2QMT A;  2VH1 A;  3VVW B;  4A3O A;  2WXL A;  2QDF A;  4IG7 B;  4EZL A;  2IY1 B;  1IBX B;  1IPG A;  3ZKJ C;  3NJT A;  1LFD A;  1WE7 A;  1T0R C;  2GLS A;  2HDE A;  4ANW A;  1YJJ A;  2MBQ A;  3N30 A;  3V05 A;  4ANU A;  3A4R A;  1FPY A;  1VZ7 A;  2G9H D;  4W9K A;  4DXG A;  2K39 A;  3DBL B;  3KWL A;  2VZK D;  1V9J A;  2KJR A;  4NJ6 A;  3MC8 A;  1TT5 B;  4JL9 A;  1ZXI A;  3RYT A;  4YWG G;  1TS5 A;  2WYQ A;  3ZIM A;  1KOT A;  1EF5 A;  1L0Y B;  4HRO A;  1QIL A;  2FCS A;  4N59 A;  3A1Q B;  1Q5W B;  1GB1 A;  2Y5C A;  2A5U A;  4RGM A;  5BYR A;  3JW0 X;  3FIL B;  4RMA A;  3VDZ A;  4MEL A;  2KTR A;  2RPV A;  2BQQ A;  3DBR I;  1V1P A;  2DAJ A;  3DVG Y;  1YN3 A;  4K3C A;  1J7C A;  5LNK 1;  1PDX A;  3BVM A;  4LNN A;  3MHZ A;  2WDQ B;  1C1Y B;  3ZJV A;  4US9 A;  3SFD B;  1FNW A;  3ZJU A;  3V60 A;  4ANV A;  4RCO A;  2C7N B;  2XK5 A;  1WXS A;  3P4Q B;  3RFZ B;  1WH3 A;  3U2S C;  3BK2 A;  4E3C A;  4BVU C;  4IDI A;  3W1S C;  4MGY E;  4HJG E;  4IWP A;  1RM6 C;  3HVZ A;  2NCN A;  2SEB D;  1PGX A;  2CR5 A;  1A5R A;  3PHX B;  4BOS C;  3ALB A;  4R3D A;  4PYZ A;  2I2Y A;  2PMV A;  3PTF C;  1D6E C;  2D3B A;  5IAA C;  3VUW A;  1R4N I;  2K8B A;  5J18 A;  1JWU D;  2BYE A;  2GBM A;  1WXQ A;  3IBE A;  2L0F A;  3RCZ A;  5D2M B;  3NVZ A;  4GDK A;  1V5O A;  3A9J A;  4W9J A;  5DPS A;  1G6J A;  2C7H A;  1YQ4 B;  5BMG A;  1ENF A;  3PT2 B;  4S0R A;  2C60 A;  1HQR D;  2WXO A;  2DZM A;  2PPH A;  4IWO A;  2KNB A;  1HTO A;  2KHW B;  3SDL C;  2N9L A;  4B9K A;  3KLS X;  3Q3J A;  3RN9 C;  3TCA A;  2OOB B;  2LGX A;  1GB4 A;  3L08 A;  2JZZ A;  4FJY A;  4LDT B;  1NBF C;  2LD9 A;  3NS1 A;  3MJW A;  2FCQ A;  3NZ3 A;  3LDZ E;  5AZF A;  2GI9 A;  1IGC A;  4FHK A;  1WM3 A;  2DZJ A;  4HPL B;  2W55 A;  1JWM D;  1TKY A;  2AQ2 B;  4KZ0 A;  4LNK A;  1TZO A;  1F9J A;  3NVV A;  2KXJ A;  3QX1 A;  5IA7 A;  4K7S A;  1E8W A;  3NS8 A;  4PK1 A;  1WY8 A;  4BOZ B;  2KO3 A;  3ML8 A;  4GSW A;  3WIM A;  4HDQ A;  1C9F A;  1JAL A;  3V6E B;  4ICU A;  4ZRP A;  4KKI A;  2M1M A;  3OG5 A;  5EE3 A;  1WGR A;  2QIE B;  1E90 A;  4HVB A;  1QZE A;  1XLQ A;  3HM3 A;  3QHT A;  3L16 A;  3BZD B;  3OLM D;  2CHZ A;  2X8X X;  1N61 A;  1YOV B;  4LDT D;  2WQY B;  2YEP B;  3TJP A;  2KTR B;  1WZ3 A;  2KMM A;  2JRH A;  2K8H A;  3AED B;  4L1B A;  4BKG A;  3AEC B;  3SFE B;  4HPM B;  2HD5 B;  2ZVO A;  3P63 A;  1ZOY B;  2WXM A;  3RNE C;  3PZD A;  2L8J A;  4D2K A;  4CYE A;  2ZW1 A;  2L76 A;  3UQA A;  3AU5 A;  4TMA B;  1UGM A;  1P7F A;  3T9L A;  2GBK A;  4J6I A;  5IP4 D;  1SB3 C;  4K81 A;  4DDI D;  1OFF A;  1QT9 A;  4GLS C;  1GOZ A;  2HTH A;  3AE6 B;  3KW5 B;  1TZ1 A;  4RM9 A;  3ZDM C;  4X57 B;  4WJP A;  3I5J C;  4BAX A;  1N60 A;  3ZVV A;  1C76 A;  3PGE A;  2LUE A;  2WX1 A;  2BS3 B;  4AS1 A;  1L7Y A;  3X23 A;  2QSD A;  1WR6 E;  4FUL A;  3DBL I;  3QK0 A;  1J7A A;  4WUR A;  1SJH D;  4HKQ A;  5D6J B;  4HCN B;  3TBL D;  1UNS A;  4RM8 A;  2ASQ A;  3LJ3 A;  4GDK B;  3VXW A;  2AQ1 B;  2WXJ A;  4IM2 A;  3W5U B;  4GMV A;  1NYR A;  3A9J B;  4A90 A;  1F2R C;  2IO2 B;  4FJZ A;  1ZUD 2;  4JWU C;  5HG2 A;  4A3P A;  4EZJ A;  1GC7 A;  4YTP B;  1MVK A;  4XZ4 A;  2M0X A;  4KVG B;  1OQR A;  2BF8 B;  4AJY B;  2FUG 1;  2TSS A;  2RDG A;  1V2Y A;  1ZE3 D;  2ICI A;  2G4D B;  3EFU A;  2PE9 A;  5DPR A;  1OQQ A;  2NR2 A;  4I6N B;  4JQW C;  2J0K A;  1YD8 U;  5DPW A;  1PQS A;  1RYJ A;  1T0Y A;  2AX5 A;  2JXX A;  2Q5W D;  4OZC A;  1I35 A;  4Q2J A;  2FCN A;  2NTS A;  5HKH A;  3HRD D;  1E10 A;  4IWQ A;  3AE7 B;  2Y5P A;  1QOB A;  1PUT A;  3VTV A;  3V6C B;  1R4M B;  3AE9 B;  3DBH B;  1PYW D;  3TMP B;  4II2 B;  2WXK A;  2W3R A;  4AOF A;  4OW0 A;  1WFY A; 
#chains in the Genus database with same CATH homology
 3JSV A;  4WWO A;  1XT9 B;  2LGD A;  2N1W A;  4BFR A;  2D10 A;  4PS3 A;  5C1Z A;  3KUZ A;  3H7S A;  2DZI A;  3M95 A;  4MEM A;  2JVC A;  2LWP A;  4NJ7 A;  4DBG A;  2RD0 A;  3DBS A;  2MW5 A;  4WJQ A;  2FUH B;  3UGB B;  1E8Z A;  1WGY A;  4KSL C;  4KV2 A;  3QA8 A;  2KMC A;  2XK5 B;  3UIO B;  1WGH A;  1YX5 B;  2WDT B;  4IM3 A;  3VTU A;  1WYW B;  3AXC A;  4G50 A;  2DAF A;  1TGZ B;  4M0W B;  1Q1O A;  2KD0 A;  1WF9 A;  2CHW A;  3PLU A;  2R2O A;  2ZVN A;  1KLV A;  2O2V A;  3AU4 A;  1WJ6 A;  2KJ6 A;  4G3X B;  3WIM A;  4EKU A;  4EZK A;  5G55 A;  3ECI A;  1RAX A;  3QIJ A;  2KX0 A;  3CF6 E;  3RT3 B;  4W9I A;  5J17 A;  1V86 A;  2KOX A;  2NBV B;  3QCA A;  4JLC A;  5LXH A;  2KC1 A;  3JVZ X;  4B95 A;  3QC8 B;  4I6L B;  1UH6 A;  2NVU I;  4MSQ B;  3Q3F A;  1M94 A;  5DCN A;  5CX3 A;  4NAW A;  1XQQ A;  2GMI C;  2VRR B;  4K1R B;  3TL5 A;  2HE7 A;  3M62 B;  5C23 A;  4FA6 A;  4BKS A;  1A5R A;  2KN5 A;  2FID A;  2LGY A;  5E6O A;  1WIA A;  2XBB C;  3AUL A;  1SGH A;  2N7E A;  1S3S G;  3KVF B;  4TQ0 A;  2RGF A;  5JHB A;  1V49 A;  2EKE C;  4DDG D;  2LVQ A;  3PRE A;  2KLG A;  4TUU A;  3VVW B;  3A9K A;  4A3O A;  4IC7 B;  2LRU A;  4P7I A;  4IM0 A;  2A4Z A;  4FAD A;  4ICV A;  3O65 B;  4G0N B;  4MJS B;  4IG7 B;  2KAN A;  2WWZ A;  2IY1 B;  4EZL A;  4MM3 A;  1RLF A;  2K6Q A;  2K1F A;  1IPG A;  2IY0 B;  5CTR C;  3ZKJ C;  3ONS A;  3PSE B;  4FBJ B;  2MA9 B;  1LFD A;  2D11 A;  1WE7 A;  3QAQ A;  2N9E B;  4ANW A;  2PEA A;  3IHP C;  2MBQ A;  2JY6 A;  3N30 A;  2BWF A;  3R66 C;  5E6N A;  4W9G A;  3IVF A;  3V62 A;  3A4R A;  3ZRF A;  4ANU A;  3ML9 A;  1D3Z A;  2FCM A;  4W9K A;  5D7G A;  2K39 A;  3VHT C;  2MBB B;  1IP9 A;  3APF A;  2IYD B;  2KWU B;  2KZR A;  3ZDT A;  3QQ8 B;  1V9J A;  2KJR A;  4NJ6 A;  4W9E A;  2FAZ A;  3RUI B;  3ZNH B;  4AJW A;  2CU1 A;  4JL9 A;  2L0T A;  3PRZ A;  2M17 A;  3KH0 A;  1WX9 A;  3RYT A;  2IO3 B;  1IYF A;  2WYQ A;  3ZIM A;  1KOT A;  3TIX A;  3H7P A;  1EF5 A;  4FN2 A;  2DX5 B;  4MH0 E;  2KK8 A;  1ISN A;  3MTN B;  4JGH B;  4PS7 A;  3ZNG C;  4W9D A;  4BKT A;  3DVG X;  2FCS A;  3HIZ A;  3HHM A;  3A1Q B;  1OQY A;  2MP2 B;  2JT4 B;  4GB9 A;  1Q5W B;  2MWS B;  3VAW A;  3PPA A;  2C7M B;  1YIW A;  1ZW7 A;  2A5U A;  2KFJ A;  3DPD A;  2K25 A;  3JW0 X;  1FXT B;  3NZU A;  4NQL B;  2L05 A;  1YX6 B;  4RMA A;  1HE8 A;  2EMT A;  1VD2 A;  2KMA A;  2O6V B;  2ZEQ A;  3VDZ A;  4AP4 C;  1X1M A;  4MEL A;  5TR5 A;  3NHE B;  2NPT A;  4BKS D;  4F7Z A;  2KTR A;  1WMH B;  1OGW A;  3OAW A;  3NY5 A;  2EMS A;  3DBR I;  3X0W A;  2GBR A;  3CMM B;  2DAJ A;  4LJP B;  3DVG Y;  1WXV A;  5LLI A;  2Z0E B;  2MBH A;  1I42 A;  5L95 C;  5CHW A;  4MGI E;  2N4F A;  3AI5 A;  5KHO A;  4URK A;  2KC2 A;  1C1Y B;  1GG3 A;  1WRD B;  1AAR A;  3DVN V;  1BT0 A;  4E71 A;  3R7Q A;  1V5T A;  4HXD A;  2DZK A;  3V60 A;  2MCN B;  4ANV A;  1WX8 A;  2C7N B;  4ZDV A;  2GBJ A;  2XK5 A;  4GU2 A;  1WXS A;  4WAA A;  3VTW A;  1WH3 A;  2JUO A;  2WX0 A;  4E3C A;  2G3Q B;  5DPT A;  4GGQ A;  4BVU C;  2KQ7 A;  4DXA B;  3W1S C;  5CHV C;  4MGY E;  4IWP A;  4FJV B;  2KVR A;  3BIN A;  5LXI B;  2NCN A;  2RR9 A;  3PV1 A;  4DWF A;  2LI5 A;  2MLB A;  3ZRC A;  3APD A;  1SE9 A;  1WXA A;  4NPN A;  2CR5 A;  2MX2 A;  3PHX B;  4PS8 A;  3V61 A;  2BKR B;  3R7R A;  3ALB A;  4BBN F;  4BOS C;  4PYZ A;  4K7U A;  5L83 A;  2JZ3 B;  2IBI B;  4GDL B;  2KWC A;  3IG3 A;  1GC6 A;  1LM8 B;  3PTF C;  4M8N A;  1OEY J;  2KWV B;  2ZZP B;  4GXB A;  5IAA C;  2O6V D;  2V1Y A;  3VUW A;  1V80 A;  2KJH B;  1R4N I;  2K8B A;  5J18 A;  1GUA B;  4NQK E;  2O2V B;  3U7D A;  2J0J A;  3PRM B;  3UIN B;  2BYE A;  2GBM A;  1TBE A;  2C5L C;  2KFK B;  3C0R B;  3IBE A;  2HJ8 A;  2J7Q B;  3VQI A;  2L0F A;  3RCZ A;  5D2M B;  3PLV A;  4GDK A;  1V5O A;  3A4S C;  4NNJ B;  3RD2 A;  2KLC A;  1Y8R C;  3A9J A;  4W9J A;  3DVN U;  2JPH A;  2LVO A;  5DPS A;  2LAS A;  2Z59 B;  3WA0 A;  1EF1 A;  1G6J A;  2KX3 A;  3VH3 B;  2C7H A;  4XC2 A;  2DYB A;  4NAW B;  3R3M A;  3L0W B;  2GOW A;  1WJU A;  1WXM A;  3PT2 B;  3ZNZ B;  1UBI A;  2NBU A;  2C60 A;  3EHV A;  2DHZ A;  3WAM A;  1LXD A;  2DZM A;  2PPH A;  4XX5 A;  4IWO A;  4OVV A;  2KNB A;  1H8C A;  1C3T A;  2MBE A;  2KHW B;  5CHF A;  3SDL C;  3WAP A;  4FLH A;  2ZJD A;  3APC A;  3M63 B;  4B9K A;  3KYD D;  3A9K B;  2V3S A;  3Q3J A;  2LXA A;  3TCA A;  2OOB B;  3NOB A;  2LGX A;  3ZTC A;  1H4R A;  4HCP B;  3L08 A;  2JZZ A;  3IFW B;  4FJY A;  1E8Y A;  4LDT B;  1NBF C;  1GNU A;  2W9N A;  2BYF A;  1E7V A;  1R4M I;  3RUL A;  4HLE A;  2N7D A;  2LXC A;  2LD9 A;  4HJK A;  3MJW A;  4B6W A;  2FCQ A;  3DBH I;  4A20 A;  2AL3 A;  2UYZ B;  2OJR A;  4WQO B;  5AZG A;  2KTF A;  3LDZ E;  5AZF A;  1E5W A;  2NS5 A;  4FHK A;  1WM3 A;  2DZJ A;  4HPL B;  4W9L A;  4KZ0 A;  4ZRI A;  3W1Y A;  4K7W A;  2G45 B;  1F9J A;  5G2N A;  2KXJ A;  1XD3 B;  3QX1 A;  2DYO A;  3KYC D;  5D94 A;  5IA7 A;  1K8R B;  4K7S A;  1E8W A;  1WGD A;  3NS8 A;  1J19 A;  1NDD A;  2CHX A;  4TQ1 A;  3ZUN A;  3EEC A;  3S2A A;  4PYU A;  3H7P B;  2D07 B;  1WY8 A;  3RZW C;  1UD7 A;  4BOZ B;  3PS6 A;  2KO3 A;  4F8C B;  4IW0 A;  3ML8 A;  1WMH A;  2BWE S;  1E7U A;  2PE6 B;  2IO0 B;  3B0A A;  4GSW A;  4HDQ A;  3SU8 X;  5E6P A;  3VFK A;  3V6E B;  4YL8 A;  4DK5 A;  2BYV E;  4N9F 4;  4HDO A;  4ICU A;  2M1M A;  4WWP A;  1WGR A;  3ZTD A;  1RRB A;  5KHQ A;  3ZLZ A;  1CMX B;  2C9W B;  2JF5 A;  1E90 A;  3CST A;  3P2B A;  2YVC A;  4HVB A;  2D3G A;  3UIP B;  5JHA A;  1QZE A;  1WJ4 A;  3HM6 X;  2LZ6 A;  3HM3 A;  3QHT A;  3L16 A;  2KQS A;  3B08 A;  2J0M A;  1L2N A;  3OLM D;  2NBW B;  2CHZ A;  3PRP B;  1KJT A;  4KIK B;  4LDT D;  2L3Z A;  3TJP A;  2KTR B;  1P98 A;  4G11 A;  3JYU A;  1WZ3 A;  1P0R A;  1WJN A;  2AEH A;  2JRH A;  2K8H A;  2KDE B;  2MSE D;  3SHQ A;  4BKG A;  4CHK A;  2ZPN A;  3JSV B;  4HPM B;  2HD5 B;  2ZVO A;  3ZNI D;  4BBN C;  4EEW A;  1UZX B;  2I1K A;  3K9O B;  4DHZ B;  4II3 B;  3H1U A;  3PZD A;  2K6D B;  4KDL B;  2L8J A;  3W1S A;  4GOC A;  4W9H A;  1YJ1 A;  4CYE A;  3A33 B;  1UEL A;  4TKN A;  2L76 A;  1LQB A;  2UWQ A;  3UQA A;  2N9P C;  2LVP A;  2DEN B;  3GZN I;  4ZRJ A;  3AU5 A;  5JZE B;  1UGM A;  1TTN A;  2GBN A;  4GDL A;  1E8X A;  3T9L A;  2GBK A;  4J6I A;  4EOY A;  2BKF A;  2QHO A;  4K81 A;  1P9D U;  2CKH B;  2LRW A;  4DDI D;  4LCD E;  2MQJ A;  3H9D A;  4MGZ E;  4WWN A;  1Z5S B;  2KFK A;  1MG8 A;  3WAO A;  4MDK E;  2K8C A;  2HTH A;  3NZS A;  3KW5 B;  4TV3 A;  1U4A A;  3BY4 B;  1TZ1 A;  4RM9 A;  3ZDM C;  2CS4 A;  4WJP A;  1Z2M A;  4X57 B;  4DHJ B;  3PHW B;  3SD5 A;  3ZVV A;  1V6E A;  3PGE A;  4AWJ A;  3DQV A;  2LUE A;  2WX1 A;  3KUC B;  2ZCB A;  3B1L X;  2AYO B;  1L7Y A;  3X23 A;  2L7R A;  4I6P A;  1KM7 A;  3OJ3 A;  3GOE A;  4W9F A;  4MJS A;  2MRP A;  1WI0 A;  1WR6 E;  1ZKH A;  3DBL I;  3QK0 A;  4FUL A;  5BO4 B;  3DOW A;  5D6J B;  4HCN B;  3TBL D;  3WAN A;  4OVU A;  2JWZ A;  1EO6 A;  2G4S A;  2V4L A;  4HWI B;  4RM8 A;  2ASQ A;  3LJ3 A;  1J8C A;  3QWZ B;  3DDC B;  1UBQ A;  4GDK B;  3VXW A;  2N9X A;  2FIF A;  4IM2 A;  4KDI C;  4GMV A;  3A9J B;  4WJN A;  3L54 A;  1P1A A;  4KZC A;  2IO2 B;  2RSU A;  4FJZ A;  4KSK C;  4EUT A;  2IZV B;  2L00 B;  4A3P A;  2M8S A;  4F1S A;  4EZJ A;  1WGG A;  1GC7 A;  1WR1 A;  4IUM B;  3RZF A;  3VUX A;  5J2R A;  3QJZ A;  4CO7 A;  3K9P B;  3T8M A;  2MBO A;  3MHS D;  4XZ4 A;  2Z0D B;  3U30 A;  3UF8 A;  3WAL A;  3ZW3 A;  2M0X A;  4KVG B;  4AJY B;  2BF8 B;  4GN1 A;  1VCB A;  1J0G A;  2ZPY A;  1SIF A;  1V2Y A;  2G4D B;  3EFU A;  3M3J A;  3ZO5 B;  2PE9 A;  4DHZ E;  5DPR A;  3I3T B;  2XEW A;  3L13 A;  2NR2 A;  1ZGU B;  2LJ5 A;  4I6N B;  3A1Q A;  1Q0W B;  2MP2 A;  4JQW C;  4W9C A;  3VH4 B;  2J0K A;  1YD8 U;  3KUD B;  5DPW A;  2YLM A;  3U8Z A;  4WJO A;  2BGF A;  1PQS A;  4ZRK A;  2ZCC A;  4LJO B;  4ZYN A;  4ANX A;  4DHJ D;  1EUV B;  1JRU A;  2B3A A;  2KDI A;  4HK2 A;  3HK0 A;  4GIV A;  1T0Y A;  2ZNV C;  4NY0 A;  1RFA A;  2DYM A;  4MGK E;  5AEK B;  2AL6 A;  3CSF A;  2O6V A;  1OEY A;  2JXX A;  3ENE A;  1NI2 A;  3DCG A;  1YQB A;  5AZH A;  3QAR A;  2ZNV B;  3PVL A;  4ASW C;  1S1Q B;  2N1V A;  1I35 A;  1OTR B;  5JH5 C;  2KDB A;  1V81 A;  2AWT A;  1WZ0 A;  2FCN A;  3N32 A;  5HKH A;  1WM2 A;  2IO1 B;  3D32 A;  4MSM B;  2D2Q A;  1WE6 A;  2JRI B;  3H6N A;  4IWQ A;  2I1J A;  4EFO A;  3OJ4 B;  2FNJ B;  5EDS A;  3VTV A;  2RPQ A;  3V6C B;  4JIO U;  5FR6 A;  3UQB A;  2Y5B B;  2REX A;  2BPS A;  2M4N A;  4FHJ A;  3VUY A;  3TMP B;  4II2 B;  4KIK A;  2PJH A;  1P3Q U;  2NPT B;  3N3K B;  4M8M A;  3L17 A;  2R2Q A;  2KKC A;  2KDF B;  1GJZ A;  1WX7 A;  5GMV A;  3L10 B;  4E74 A;  4AOF A;  3EC8 A;  4AUQ C;  1WFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...