3PSEB

Structure of a viral otu domain protease bound to interferon-stimulated gene 15 (isg15)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
150
Chain Sequence
b'DLTVKMLAGNEFQVSLMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKSDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
total genus 35
structure length 150
sequence length 153
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pseB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pseB01
3A9KA 2NBVB 3A4SC 4ANWA 3PS6A 2LGXA 3PT2B 3SU8X 4ICUA 3VTWA 3VVWB 1RRBA 2N9EB 4ICVA 1J0GA 1Q0WB 2AL3A 2LRUA 4KDLB 5IAAC 3DBLI 3KVFB 3VUYA 2Z59B 3OLMD 4KZ0A 1IPGA 1EUVB 1CMXB 2Z0DB 4DHJB 3ZUNA 4MGZE 2JRIB 3ALBA 3N3KB 4HPLB 3ZRFA 5DPTA 2KOXA 2IO1B 1E90A 4IWPA 3RUIB 3DVNV 2M8SA 1WGHA 3ZTCA 2LRWA 4E3CA 3TMPB 1E8ZA 3OJ3A 4LDTB 2LGDA 4ZRJA 2KWVB 3U8ZA 2C9WB 2V4LA 3L08A 2L7RA 4HWIB 4PS8A 2IZVB 2JZ3B 4J6IA 2BYEA 1P3QU 3M63B 2JY6A 4AOFA 1P98A 2JVCA 2LUEA 4NPNA 3APFA 2PPHA 3DQVA 3DBSA 4MH0E 4WJQA 3ZNZB 3IVFA 2KFKB 2MRPA 2OJRA 1WFYA 3B08A 3VHTC 3WAOA 3ZLZA 4F8CB 3WIMA 2K8CA 4JIOU 4G0NB 4OVVA 3BINA 2DX5B 2JUOA 4IC7B 4ZYNA 1J8CA 3IFWB 3PPAA 3O65B 2JRHA 4JLCA 2IY1B 2HJ8A 2D3GA 2CU1A 3ML8A 2AYOB 3VH4B 2D10A 2MBOA 3ZDMC 5JZEB 1P9DU 1WR6E 3PLVA 3QX1A 4TQ1A 5C1ZA 1OQYA 3PHWB 2GBJA 4IG7B 4DK5A 1WE6A 3I3TB 1U4AA 1T0YA 2LZ6A 3VH3B 3ENEA 2KFJA 1WZ0A 2GMIC 1YX5B 5EDSA 1ZKHA 2JWZA 4GSWA 2A5UA 4GIVA 4GDKB 1RAXA 1WYWB 1S1QB 2KC2A 1UGMA 4KZCA 3JSVB 3ECIA 5E6OA 1NI2A 1WJUA 2JZZA 2N7DA 4E74A 4FHKA 3APCA 1LXDA 3L16A 2K25A 2N7EA 2XK5A 5JHBA 2YVCA 2HD5B 4HDOA 3WALA 2LGYA 3A33B 3LJ3A 4W9EA 2K39A 3CMMB 2CHXA 4FHJA 1Y8RC 4KIKB 4JGHB 1OTRB 2FCNA 5E6NA 3RZFA 4DBGA 2KWCA 1M94A 4HPMB 4KSKC 5J18A 5DPSA 1WMHB 3X0WA 2LVOA 2KTRA 2CHWA 1WGRA 2FUHB 2W9NA 2K8HA 5AEKB 2L05A 4TQ0A 2BGFA 2LXAA 5JHAA 2D11A 3TIXA 5C23A 2FIFA 3PV1A 1LQBA 2KX0A 2EKEC 1TZ1A 3VAWA 3R7QA 2HE7A 3VXWA 3X23A 2ZVNA 2LWPA 3QK0A 2BPSA 4I6LB 4BFRA 1H8CA 3QAQA 4G3XB 2AL6A 3CSTA 3A1QA 3AULA 2O2VB 3DDCB 4NAWB 4W9JA 1LFDA 4WAAA 3QQ8B 4FJVB 5D6JB 3SHQA 2JT4B 3H7PB 4CHKA 1EF5A 2WDTB 2KLCA 5AZFA 3ZTDA 3NHEB 4CYEA 2KZRA 4KV2A 1P1AA 4NJ6A 2BWFA 2KC1A 1V49A 1WGGA 2B3AA 2J0KA 4PYZA 4IM3A 3ZDTA 1XQQA 4BBNC 2KD0A 1E8WA 2MBHA 4MGYE 3KUZA 2KQSA 4FADA 2DZMA 4BBNF 2DYBA 4MJSB 3PRMB 4XZ4A 2G4SA 1UBIA 1WXMA 4P7IA 1HE8A 4HK2A 2GOWA 2M1MA 1NBFC 2KFKA 2IBIB 1SGHA 4MELA 4DDGD 2N4FA 2R2OA 2WYQA 4TUUA 2C7MB 3WANA 4W9HA 3PHXB 4KVGB 3RCZA 1YQBA 5JH5C 4ANXA 1WX7A 2LD9A 3H9DA 2IO3B 2PE9A 4BKSA 4FN2A 2VRRB 2KNBA 2MP2A 2JPHA 2ZPNA 2CHZA 2KHWB 4M8NA 4BKTA 4II2B 2N9PC 4GB9A 2FCQA 3NOBA 3HIZA 2NBWB 3V61A 1E5WA 1L2NA 4HXDA 2KDBA 3V6CB 1F9JA 3ML9A 1TTNA 4IM2A 2LVPA 2KJHB 4DHJD 1V86A 4B95A 2MA9B 1WJ4A 2N9XA 4BOZB 1SIFA 4EEWA 4GN1A 1P0RA 1MG8A 2KX3A 3N30A 3RYTA 2LASA 1I35A 2KDFB 2M17A 2WWZA 4LDTD 3ZIMA 2AWTA 3A9JB 5GMVA 2DYOA 5G2NA 1WJ6A 3KW5B 3DBRI 2PE6B 2IO2B 1S3SG 3HK0A 3UIOB 1WI0A 3OAWA 5L95C 1UH6A 3KUCB 4KIKA 2FAZA 2K6QA 4NQKE 4II3B 3A9KB 2MCNB 3UQBA 1C3TA 1Q5WB 2MLBA 1EF1A 3VUXA 1ZW7A 2CR5A 3ZNHB 3UGBB 3CF6E 2MWSB 2MW5A 4GDLA 2K1FA 2BYFA 2RGFA 3W1SC 1TBEA 1WMHA 4MM3A 1WXAA 4BKSD 1FXTB 3DCGA 1WJNA 1UZXB 3NZUA 5L83A 4GU2A 3QARA 1H4RA 3OJ4B 1E7UA 2G3QB 3AU4A 1R4NI 2KK8A 2GBRA 4GOCA 4MDKE 3VQIA 3VTVA 5BO4B 3SDLC 2L0FA 2XBBC 4X57B 2G4DB 1WZ3A 1IYFA 4NJ7A 2XEWA 3ZKJC 3PLUA 1OEYA 2DAFA 1ZGUB 2GBKA 3MJWA 4MGKE 1WRDB 4DWFA 2YLMA 3RZWC 2LXCA 4NNJB 3H1UA 2Z0EB 5CHFA 2O2VA 4B9KA 1JRUA 4LCDE 4IW0A 4W9IA 2BKFA 2I1JA 4NAWA 1XT9B 2EMTA 1C1YB 3B0AA 1WR1A 5D94A 3KUDB 1ISNA 2LJ5A 4DHZE 4ZRKA 2ZCCA 3V62A 1PQSA 1V5OA 3JW0X 2IO0B 2KWUB 4FBJB 2ZNVB 4A20A 3VTUA 2BWES 4XC2A 2KN5A 4W9LA 4WJNA 1WGDA 2DZIA 3M62B 3QIJA 2KLGA 5FR6A 4BVUC 1RFAA 2BKRB 2MQJA 5CTRC 5DPRA 2NPTB 5KHQA 1WGYA 4F7ZA 3AXCA 4MJSA 2R2QA 1SE9A 3KH0A 1A5RA 2O6VB 5HKHA 1NDDA 2PJHA 2IY0B 3BY4B 4MGIE 2J0JA 2ZNVC 2GBNA 5LXIB 4YL8A 4WWOA 4AUQC 3K9PB 3QJZA 3PREA 3QCAA 1WH3A 2L00B 3ZNID 4ZRIA 3T8MA 4A3OA 4EZKA 4EUTA 4G11A 4PYUA 2ZVOA 2WX0A 4MSMB 5D2MB 2K6DB 2FCMA 3QWZB 1GNUA 2FIDA 2JF5A 2NS5A 2ZJDA 3TL5A 3UIPB 1Z5SB 3NS8A 3ZRCA 2DENB 3EHVA 3EFUA 1VCBA 4WQOB 4IWOA 5J2RA 1KLVA 3QC8B 4M8MA 4A3PA 2FNJB 2DZJA 3TBLD 1G6JA 3SD5A 4EFOA 3GZNI 4M0WB 1WE7A 4CO7A 4FULA 3PGEA 3ZO5B 2KDIA 2BF8B 1V5TA 2AEHA 2LVQA 5E6PA 2KO3A 2UYZB 4FA6A 2I1KA 2C7HA 4GGQA 2NVUI 1WXSA 1V2YA 3NY5A 3W1SA 2MSED 3IHPC 4FJYA 1OEYJ 4IM0A 5LLIA 5KHOA 2ZEQA 4NQLB 4EZLA 2GBMA 5IA7A 2ZPYA 1V9JA 2KVRA 3AI5A 3WAMA 1WM3A 4BOSC 3IG3A 3A1QB 5CHVC 2D07B 2RPQA 3DVGX 4K7WA 1K8RB 3Q3JA 2N1WA 1WF9A 1AARA 3T9LA 1V6EA 2HTHA 3PZDA 4WJOA 4W9CA 2RR9A 3UF8A 3ZNGC 2RD0A 4E71A 4N9F4 2C60A 1EO6A 2L3ZA 3VDZA 2JXXA 4GDKA 2KMCA 2NBUA 3PRPB 4JQWC 3JSVA 3L0WB 4HCNB 3EC8A 3D32A 1J19A 2KMAA 2KJRA 4LJPB 2C7NB 3VFKA 4G50A 4BKGA 2IYDB 4XX5A 4B6WA 3Q3FA 3ZVVA 4RM8A 5AZGA 3UINB 2ZZPB 4AJYB 3DPDA 4DXAB 2KKCA 2UWQA 2Y5BB 1WX8A 3C0RB 3VUWA 1IP9A 3DBHI 2NCNA 4K7SA 3DOWA 4RMAA 1YX6B 2ASQA 4GMVA 4IUMB 4IWQA 4JL9A 4EOYA 2FCSA 4DHZB 2D2QA 3U7DA 3H7SA 4TKNA 4AP4C 4ASWC 3APDA 2DYMA 1YJ1A 2V1YA 2MP2B 1L7YA 4OVUA 2OOBB 3DVNU 3K9OB 3M95A 2C5LC 1TGZB 1E7VA 2NPTA 1WY8A 3S2AA 2DAJA 2DZKA 2KTFA 1V81A 2O6VA 3L54A 5CHWA 1R4MI 1I42A 3MHSD 3WAPA 3R3MA 2PEAA 2EMSA 1Q1OA 2WX1A 1WX9A 3EECA 3H7PA 4KSLC 2V3SA 2BYVE 1KJTA 3M3JA 3B1LX 3PTFC 5J17A 3R66C 1YD8U 1KM7A 3QHTA 2G45B 2QHOA 4NY0A 3AU5A 4F1SA 4FJZA 3ONSA 4HJKA 4URKA 3NZSA 4HVBA 2L76A 1UBQA 1UD7A 2MX2A 1E8XA 3IBEA 2NR2A 1XD3B 5G55A 2KQ7A 4HDQA 3TCAA 1GC7A 3ZW3A 4GDLB 3L13A 2ZCBA 4AWJA 3R7RA 3WA0A 4WJPA 1D3ZA 2KANA 1RLFA 1LM8B 2J0MA 5AZHA 1BT0A 2CS4A 2MBQA 4GXBA 4W9KA 4EZJA 4KDIC 3CSFA 2K8BA 4FLHA 4AJWA 4WWNA 4W9DA 1UELA 3QA8A 4HCPB 3TJPA 2REXA 3L17A 3RT3B 4I6NB 2O6VD 3UQAA 2XK5B 1E8YA 2L8JA 5CX3A 4ANUA 1GJZA 2M0XA 1QZEA 4K7UA 2LI5A 1WIAA 2MBEA 2RSUA 2J7QB 4I6PA 3A4RA 4DDID 3W1YA 5LXHA 1X1MA 4MSQB 3HM3A 4PS3A 3MTNB 4RM9A 5DCNA 3N32A 1WM2A 1Z2MA 4K81A 4LJOB 4ZDVA 2CKHB 3HM6X 4MEMA 2KTRB 5D7GA 1GC6A 3L10B 4ANVA 4WWPA 2KXJA 2L0TA 3LDZE 2A4ZA 3JVZX 4TV3A 3PVLA 3GOEA 3P2BA 4W9GA 1OGWA 1V80A 3H6NA 3HHMA 3RD2A 3PSEB 1GUAB 1KOTA 4HLEA 4PS7A 3A9JA 5DPWA 1GG3A 2MBBB 3JYUA 3PRZA 5TR5A 1VD2A 1WXVA 3U30A 2KJ6A 2DHZA 3DVGY 3V60A 4EKUA 3RULA 3KYDD 4W9FA 2N1VA 3V6EB 3KYCD 1YIWA 4K1RB 2M4NA 2KDEB
chains in the Genus database with same CATH superfamily
3A9KA 1VJKA 1C77A 3PT2B 3VTWA 1RRBA 2N9EB 4ICVA 5H8YE 3KWVA 3FILB 3B2GA 3ZUNA 3N3KB 4HPLB 3ZTCA 2QCZA 3BK2A 4HWIB 3U2SC 1T0RC 4PS8A 2IZVB 2JZ3B 4J6IA 2BYEA 2JVCA 2LUEA 4NPNA 3APFA 4MH0E 3HVDA 1D5XC 2KFKB 2OJRA 1TY0A 4F8CB 2MJ3A 4JIOU 4OVVA 3BINA 2DX5B 4IC7B 3DWMA 4YSZB 3O65B 4YWGG 3ML8A 5JZEB 2WXMA 1WR6E 2WXRA 4ITKA 5C1ZA 2GBJA 1U4AA 1T0YA 2KN4A 3RI7C 3EA6A 4GIVA 4KZCA 2JZZA 1F2RC 2N7DA 2N7EA 2YVCA 2HD5B 1WXQA 4RGNA 4W9EA 3RN9C 4FHJA 1Y8RC 4KIKB 3RZFA 1ZP0B 2PTLA 2Q5WD 1C4PA 2LMCA 3IT4B 2L05A 3RNAC 2LXAA 2D11A 3BVGA 1LQBA 5D3IB 2EKEC 1TZ1A 4LNNA 3VAWA 4C4VB 2WXNA 3SR6A 4ZHOA 1FFUA 2ZVNA 3QK0A 1SXTA 4G3XB 3A1QA 1K50A 1FNVA 3TEZA 4NAWB 5D6JB 5BMIA 4FJVB 2JT4B 2N9KA 1EF5A 1MHXA 5AZFA 3NHEB 1VZ6A 2KZRA 3P63A 3I5JC 5EE0A 4PYZA 2K22A 5HFYA 1CK1A 3KUZA 1TT5B 4BBNF 2DYBA 4MJSB 2W54A 4A8XC 5FKAC 1ET6A 4HK2A 2M1MA 4USAA 2IBIB 1SGHA 1DOYA 2R2OA 1ESFA 4TUUA 2J53A 2C7MB 3U4EG 4C00A 2ON8A 2NTTA 2VH2A 1NYRA 1WX7A 4A6QA 2VRRB 2KT7A 2KHWB 4KX6B 2IGDA 2BTEA 1FM0D 3HIZA 3V61A 1L2NA 1JWBD 5EE3A 2BW2A 2KDBA 3ML9A 3MHZA 5BYSA 2MA9B 1WJ4A 1N63A 5IKCM 2KDFB 4LDTD 5GMVA 3PO0A 1QF6A 1NYQA 4YTMB 1FO4A 1N5WA 2FAZA 4II3B 4YT0B 1Q5WB 2MLBA 1EF1A 2OJWA 3VUXA 2CR5A 2JX5A 4GDLA 1JWAD 1WXAA 3DCGA 3OJ4B 2GBRA 4MDKE 3VQIA 3AE7B 5C2TB 1IYFA 1XCQL 1YQ3B 3PLUA 1OEYA 1SE3A 2DAFA 3VR8B 1TKYA 2WHIA 1I4RA 1WRIA 3E9SA 3AEBB 4NNJB 3H1UA 5CHFA 4LCDE 1GB4A 4RF0A 2LJ5A 4DHZE 1XEEA 2H88B 1PQSA 3JW0X 2JYEA 3VTUA 2W82A 4KKJA 5L83A 4WJNA 3QIJA 1AYFA 2MQJA 2QSDA 5CTRC 2NPTB 3RNCC 5KHQA 3AXCA 2R2QA 3KH0A 1M4VA 2YEPB 1NDDA 5LXIB 4WWOA 4AUQC 1PFDA 3PREA 3H8HA 1WH3A 2L00B 4N58A 2LHDA 4MH8A 4A3OA 1T3QA 2ZVOA 3QWZB 1FCCC 3DHGC 2ZJDA 4JE3B 2K5PA 1Z5SB 2IPKD 3MC8A 1HTQA 2DENB 3EHVA 1FNWA 3BZDB 3EFUA 1VCBA 5J2RA 2XN9C 3NJTA 1L4ZB 1G6JA 1WE7A 4CO7A 1V5TA 2BF8B 2MJEA 2C7HA 4TSSA 1IGDA 1PGAA 1WXSA 2D3CA 3NY5A 4FJYA 1OEYJ 1YOVB 5KHOA 3NUHB 2ZPYA 2DWQA 1SSNA 3WAMA 1WM3A 3V05A 1K8RB 1KH0A 1WF9A 5G5HA 1AARA 2RR9A 3ZNGC 1XO3A 1UWMA 2RD0A 4E71A 3VDZA 2L3ZA 4GDKA 2KMCA 1JCKB 2KJRA 1PGBA 5TSSA 3I9V1 3VFKA 2WS3B 4BKGA 4S0RA 1NI3A 3ZVVA 1WX8A 3C0RB 1ROEA 2H89B 1HZ5A 3UI3A 4K7SA 3DOWA 2LGSA 1MVKA 1QILA 4KGTA 2DYMA 2MP2B 1VDVA 2WDVB 1C76A 2DAJA 4XYCA 1V81A 2O6VA 5CHWA 3WAPA 1I4PA 3R3MA 4C7ZA 3SFDB 3EECA 3H7PA 1DGJA 1KJTA 1MJDA 3C19A 1YD8U 2QHOA 1T0QC 3NVYA 4F1SA 2E6XA 2MX2A 1E8XA 3IBEA 4OW0A 2KQ7A 4RFBA 1EU4A 2PMVA 1MHHE 4AWJA 2BVCA 2J0MA 5HI1A 3GE8C 1BT0A 3NG0A 1J7CA 4HCPB 2REXA 2KMMA 2L8JA 1QZEA 2LI5A 3I63C 2MBEA 2RSUA 2ZW1A 3AE5B 2J7QB 3A4RA 1X1MA 3PZ7A 1VRAB 5G5GA 2J4XA 4PS3A 3MTNB 4IOIE 3AN1A 2BT6A 1Z2MA 3SFEB 4WWPA 3FAHA 4TV3A 3GOEA 1V80A 2QJLA 1KOTA 1E6EB 3A9JA 1GG3A 3JYUA 2KJ6A 2DHZA 3DVGY 2BS2B 3RULA 3IAM1 1JWUD 2N1VA 3KYCD 3P4PB 1CQVA 2NBVB 3A4SC 3AEEB 1TJEA 2LRUA 4KDLB 5IAAC 3ZYYX 3VUYA 3OLMD 2WDRB 1QLBB 4DHJB 4HJGE 3ALBA 2IO1B 4IWPA 2ZW0A 4E3CA 3B2FA 5IO9A 3T3NA 1N6ZA 1P3QU 3M63B 2JY6A 1P98A 3DQVA 3IVFA 4WURA 1WFYA 3B08A 3VHTC 1E0ZA 1J8CA 4ZYNA 2JXTA 3PPAA 2JRHA 2D3GA 4N6EB 2AYOB 1K52A 5BYRA 3QX1A 1TS4A 1WE6A 3VH3B 3LXFA 1WZ0A 3ABVB 3RNEC 2ACZB 2JWZA 1RAXA 1WYWB 1S1QB 1UGMA 4US9A 3JSVB 1FIQA 4E74A 1IBXA 4FHKA 3APCA 3L16A 1EWCA 2K25A 3SEBA 2XK5A 5JHBA 3WALA 3AEDB 3A33B 2K39A 3CMMB 4JGHB 1OTRB 2FCNA 3MFGA 1FXAA 4KSKC 4OHJA 5J18A 1WMHB 4MM3B 2KTRA 2CHWA 1FCLA 2FUHB 1R4NB 5AEKB 4TQ0A 2M0AA 1XCTL 3TIXA 1L0VB 2FIFA 2L32A 4ZRPA 2HE7A 4BFRA 2LWPA 4K3CA 3AULA 2O2VB 3SHQA 3QQ8B 1VLBA 2KLCA 2LHEA 3N1ZC 4OZAA 3FILA 1EU3A 4AS1A 4HPPA 2B3AA 3KLSX 3ZDTA 1XQQA 2KD0A 1E8WA 1QOAA 2MBHA 4OVZA 1WGKA 2KQSA 3VR9B 4FADA 4P7IA 1TS3A 1NBFC 3PZ8A 2KFKA 4MELA 3FC4A 4DDGD 3AEFB 4W9HA 4KVGB 4WIPA 1BUIC 2LD9A 3H9DA 2IO3B 1SEBD 2KNBA 3Q2AC 4BKTA 4II2B 1V8CA 1TY2A 2BS3B 1D4BA 3V6CB 2HTME 1V86A 2MEKA 5C3JB 4K3BA 4YSXB 2V3NA 4GN1A 1QQRA 1MG8A 2KX3A 2VZKD 3DWGC 3N30A 2LASA 2M17A 5G2NA 2IO2B 3HK0A 3OAWA 1ZDXA 5L95C 1UGJA 1UWXA 4KIKA 3UQBA 2K6QA 3A9KB 1MG4A 3CF6E 1SE2A 2RGFA 3W1SC 2K0PA 2KYWA 1TBEA 4RGTA 1H4RA 3KWLA 4WH4A 1E7UA 2G3QB 1R4NI 5H92C 1QKZA 4MT5A 2L0FA 1F77A 4NJ7A 3RNBC 4C4VA 1KFYB 2GBKA 2CJNA 1WRDB 5LNK1 3RZWC 2LXCA 1JRUA 4IW0A 2BKFA 4NAWA 2EMTA 1WR1A 2R61A 1ISNA 4ZRKA 2AX5A 2IO0B 2KWUB 2V3PA 1T6BX 2ZNVB 4A20A 2BWES 2AQ3B 4XC2A 3Q8FA 1WGDA 4F7ZA 4MJSA 2PJHA 3CIRB 3Q3OC 1XLNA 3K9PB 3QJZA 3QCAA 3ZNID 3T8MA 4RNAA 5IN7A 1DOIA 1OQQA 2MJDA 3ZJUA 3HUIA 1IUEA 3TL5A 3AEAB 3J9CA 1L6VA 5MPOA 4WQOB 4M8MA 4A3PA 2FNJB 3O13A 1FRRA 2WXIA 3GZNI 1HA5A 3ZO5B 2KDIA 2AEHA 4FA6A 1GPXA 2NVUI 3W1SA 2MSED 3ETRA 4IM0A 2WXKA 2VH1A 1V9JA 1ZOYB 2WQYB 2FE8A 5CHVC 3A1QB 2RPQA 3Q3JA 1GAQB 2JYTA 2J52A 3NVVA 3T9LA 2WXLA 2DLBA 4N9F4 1EO6A 3RNFC 2IJ0A 2NBUA 2INCC 1JMLA 3EC8A 1J19A 4BAXA 2WU5B 4G50A 2IYDB 4XX5A 1KF6B 5AZGA 3UINB 4DXAB 2N9LA 3Q8CA 1T0SC 3VUWA 4B0EA 3AE4B 3DBLB 4H2AA 2ASQA 4IWQA 4JL9A 4EOYA 2FCSA 4ASWC 2FBWB 4KGRA 2V1YA 4OVUA 1E9MA 3K9OB 1ZDVA 2C5LC 2X38A 2NPTA 3S2AA 2PLPA 1OFFA 1HTOA 2DZKA 2KTFA 3L54A 3MHSD 3MC9A 3B9JA 1WX9A 4LLGM 4UDUC 3OWEB 2INDC 2BYVE 2Z8LA 3EFCA 1ZUD2 2QEJC 5J17A 4IKGA 3QHTA 3BVZA 4QAYA 1CJEA 4FJZA 5AUKA 4URKA 4HVBA 1TS2A 2L76A 1C4AA 5G55A 1UUPA 1J7AA 4KKIA 5IOIA 3ZW3A 2WXFA 4GDLB 3WA0A 1R7SA 1D3ZA 1PUTA 1RLFA 2I38A 5AZHA 1N60A 2CS4A 4EZJA 4GXBA 1BMLC 2V4IB 4WWNA 4DXFA 4IDIA 1UELA 3EGRA 4I6NB 2O6VD 1E8YA 5CX3A 1GJZA 1WIAA 2JZPA 4ZHPA 5LXHA 3ZJVA 2I2YA 2Y5PA 3HM3A 2SEBD 4K81A 4LJOB 2CKHB 3TSSA 5D7GA 1VZ8A 4ANVA 2KXJA 5EE1A 3JVZX 2WXGA 2L52A 3RD2A 3ZQ4A 3PSEB 2EELA 2BB6A 2PKOA 5DPWA 2B76B 5TR5A 1VD2A 4EKUA 3V60A 2AQ2B 3V6EB 1XLQA 1QOFA 4N59A 1D5MC 3BWUD 3VVWB 1SBBB 1J0GA 1Q0WB 2KAJA 3DBLI 4KZ0A 1EUVB 3V3XA 2Z0DB 4MGZE 3ZRFA 3TEXA 5DPTA 2KOXA 5FK9C 1E90A 1MPEA 3RUIB 3P1MA 4XWWA 4YXDB 1WGHA 1E8ZA 3OJ3A 4LDTB 4ZRJA 2OEDA 2KWVB 4C56C 2V4LA 3NZ3A 4ARCA 1DOXA 3DBSA 2MRPA 2J42A 2K8CA 3WIMA 1TS5A 3LYYA 3IFWB 2Y5CA 2IY1B 2HJ8A 4P16A 2CU1A 3T3OA 2QMTA 3BK1A 2D10A 1P9DU 3PLVA 1SIJA 4TQ1A 1YN5A 1D5ZC 1OQYA 4A55A 4DK5A 5EE9A 3GP7A 2LZ6A 2QIEB 2WU2B 3ENEA 4C80A 2GMIC 1Y56A 4JWUC 1ZKHA 4GSWA 4RF1A 4GDKB 2KC2A 4HKQA 5E6OA 4C7YA 2Y3AA 2LGYA 1AN8A 4WWMA 4XDCA 2INNE 5E6NA 5DPSA 4M0WA 3X0WA 4LNFA 3BYTB 1BXTA 2AQ1B 1E7PB 4JX1C 1JW9D 3QAQA 1LO5D 1ZPSA 2AL6A 3DDCB 4W9JA 1LFDA 4CHKA 3H7PB 1KLGD 2BBCA 2KQ4X 3AECB 3ZTDA 4CYEA 1TYGB 3Q8AA 2BWFA 2KC1A 1V49A 1WGGA 1LGRA 2PW9A 2J0KA 4IM3A 1CZPA 2JSVX 5HHDG 3ZGZA 1MFWA 4WAFA 1E10A 1WXMA 1HE8A 4XWTA 1JRPA 4GLSC 3P4RB 3EUB2 5JXVA 3AV8A 3BYYB 3VRAB 5JH5C 2L83A 4BKSA 1FD6A 4FN2A 2JPHA 2OHFA 2CHZA 4KGSA 2HJ1A 3AMZA 3Q3MC 4GB9A 3TEYA 2LUMA 3NOBA 2NBWB 3IAS1 4HXDA 1F9JA 4ZOHC 4OZCA 1TTNA 2M56B 2LVPA 2KJHB 4B95A 1SIFA 2EKIA 4S17A 3NVWA 1XXGA 1I35A 2KACA 3A9JB 1WJ6A 3KW5B 4P1BC 3UIOB 1WI0A 4US8A 1C3TA 4NQKE 1TZOA 2LEKA 1V1PA 2MW5A 2L1AA 2MWSB 2K1FA 2BYFA 3N20C 1WMHA 4MM3A 1FXTB 1WJNA 3GE3C 3AH7A 1FFVA 1GOZA 3QARA 4GU2A 3ZJTA 5BO4B 3SDLC 2DBYA 4X57B 2G4DB 1WZ3A 2WXHA 3ZKJC 2QDFA 1YQ4B 1ZE3D 4DWFA 1YMHE 2O2VA 1WYGA 2KDMA 2I1JA 1XT9B 1C1YB 2D5GA 3B0AA 3KUDB 4WQMA 2ZCCA 3V62A 1V5OA 3Q69A 2KN5A 4W9LA 1AWDA 2DZIA 3M62B 5FR6A 1SE4A 1RFAA 1N61A 4LK0M 1ENFA 1R4MB 1SE9A 1A5RA 1ZXHA 3GS2A 5HKHA 2FUG1 2IY0B 3BY4B 3ZXRA 2ZNVC 2GBNA 4YL8A 2UU7A 2KVZA 4EZKA 4EUTA 4XGAB 4G11A 4R3DA 1IBXB 2WX0A 2JF5A 2NS5A 2PVGC 3NS8A 1XF5L 2YEPF 2WXQA 1C9FA 4HROA 3U52E 4IWOA 1KLVA 3QC8B 4ACFA 2RDHA 3SD5A 4EFOA 2G9HD 2BQQA 1FXIA 3PGEA 5E6PA 2KO3A 3OG5A 1C78A 2DNFA 5LLIA 2ZEQA 4EZLA 1FNUA 2KVRA 2WGSA 3AI5A 4BOSC 1F0ZA 2D07B 1IGCA 3GZNB 1V6EA 2HTHA 3PZDA 2X8XX 2C60A 3W2DA 4JQWC 4HCNB 3L0WB 1J7BA 2KMAA 4LJPB 1ZXIA 4HEA1 1FMAD 4B6WA 3Q3FA 1L4DB 1UF0A 2E3TA 5FR3A 2K3UA 2UWQA 1TIFA 1PGXA 2NTSA 3AE1B 1IP9A 3DBHI 2W55A 1P7EA 1XLPA 1JALA 1UNSA 4IUMB 3DHHC 1TKGA 4DHZB 4AP4C 4ARIA 1YJ1A 4P6VF 1L7YA 2MHJA 2OOBB 3DVNU 2WP9B 3M95A 1TGZB 1E7VA 4RGMA 1I42A 1R4MI 2EMSA 4OZBA 4KSLC 2V3SA 3RFZB 3BIID 2D3BA 4O1NA 3PTFC 1QOBA 1HZ6A 2G45B 5E6JA 4NY0A 3AU5A 4LTUA 2JU6X 3ONSA 4HJKA 4PT5A 3NZSA 2WLBA 1UD7A 1JWSD 1XD3B 1GC7A 4M01A 3R7RA 3IT6B 4WJPA 2KANA 2RMMA 4AQ7A 4W9KA 2WNMA 2K8BA 4PK1A 4FLHA 4AJWA 3TJPA 4ANUA 1PDXA 4LNIA 1V1OA 1NEKB 4K7UA 3AM9A 3W1YA 4MSQB 3VRBB 3N32A 3ZXVA 3HM6X 1RFKA 1VR9A 2L0TA 3LDZE 4DXGA 2A4ZA 3PVLA 1NENB 3H6NA 3HHMA 1GUAB 3WCQA 4PS7A 2MBBB 1STEA 2K9XA 2IGHA 3U7ZA 3KYDD 4W9FA 1WWTA 1YJIA 1K51A 1FPYA 2M4NA 4YSYB 1JROA 4ANWA 4B0MA 4JPSA 3PS6A 2LGXA 3SU8X 4ICUA 1OQRA 2AL3A 3KVFB 2N7JA 1GB1A 2MH7A 2Z59B 1IPGA 1CMXB 3W9CB 3Q8EA 1SF0A 2JRIB 2NMQA 1I4XA 3AE9B 3DVNV 2M8SA 2VZKB 3FKYA 2LRWA 5BYQA 3TMPB 3U8ZA 2LGDA 2C9WB 3L08A 2L7RA 4AOFA 2PPHA 2INPE 4WJQA 3ZNZB 3N9YC 3ZLZA 3WAOA 2QILA 4G0NB 2JUOA 4JLCA 3Q3NC 1SJED 1T5XD 2LJIA 3Q8BA 5BMGA 1F1HA 3VH4B 3I57A 3IXSA 2MBOA 3ZDMC 3Q14C 2LFIA 3TUOA 3PHWB 4IG7B 3I3TB 5IP4D 2KFJA 4M02A 1YX5B 5EDSA 2A5UA 1HXYD 3ECIA 1NI2A 1WJUA 3DBRB 3HRDD 1LXDA 1KTKA 4HDOA 3LJ3A 2CHXA 1Q10A 2JQRB 4DBGA 2KWCA 1M94A 4HPMB 4Q2JA 2LVOA 2PVOD 3R2TA 1WGRA 2W9NA 1DYQA 2K8HA 2BGFA 1P7FA 5JHAA 5C23A 1A70A 3PV1A 4HKZE 2KX0A 3R7QA 3VXWA 5I4DA 3X23A 2BPSA 4I6LB 1H8CA 3CSTA 2RDGA 3MJ5A 4WAAA 3TEWA 4MACA 2WDTB 3R2IA 4KV2A 1P1AA 4NJ6A 2TSSA 2BYTA 4BZAA 4BBNC 1L0YB 2HDEA 4MGYE 5D3DA 2DZMA 3PRMB 1KRHA 2G4SA 1UBIA 4J3OD 4XZ4A 2GOWA 3AE8B 3DHIC 2N4FA 2WYQA 4L2YA 2V0GA 3WANA 3RCZA 3PHXB 2GI9A 1SB3C 1YQBA 4ANXA 2PE9A 2M19A 2WXOA 2MP2A 2ZPNA 4M8NA 2N9PC 2FCQA 1L6UA 1E5WA 3BVMA 2RDBC 2ONQA 1F2RI 4IM2A 1YJJA 3RNGC 4DHJD 1K53A 2PIAA 2N9XA 4BOZB 4EEWA 1P0RA 3RYTA 1MI0A 1EM7A 1AW7A 1YN4A 2WWZA 3ZIMA 1I7HA 2AWTA 3NS1A 4CQNA 2DYOA 2N0SB 2W3SA 3DBRI 2PE6B 1S3SG 4A90A 1UH6A 3KUCB 2MCNB 1NVID 2LGIA 1ZW7A 2D3AA 3ZNHB 3UGBB 1RWSA 1N5XA 4BKSD 3E56A 1UZXB 3NZUA 2G1EA 4GOCA 3AU4A 2KK8A 3VTVA 2XBBC 4RGOS 2XEWA 3W5VB 1ZGUB 1RM6C 3MJWA 4MGKE 2YLMA 3P4SB 4M00A 4FXCA 2Z0EB 4B9KA 4W9IA 5D94A 4LNOA 1I4HA 4FBJB 4REZA 2KLGA 4YTNB 4BVUC 2BKRB 5DPRA 1WGYA 1SJHD 2O6VB 2WXPA 4MGIE 2J0JA 3RMKC 3Q6BA 2CJOA 4RH6A 3R8BA 4ZRIA 4PYUA 5T8IA 4MSMB 5D2MB 2K6DB 2FCMA 1GNUA 3C8YA 2FIDA 1C4CA 3UIPB 3URYA 3MP9A 3ZRCA 3RPFC 3MC0B 5AUIA 2DZJA 3TBLD 4M0WB 4FULA 4HRSA 2LVQA 2UYZB 2I1KA 1EWYC 2IDYA 4GGQA 1V2YA 3IHPC 3N1XC 2SAKA 4NQLB 4YTPB 1YNTE 2GBMA 5IA7A 1VZ7A 3IG3A 1XLOA 3DVGX 4K7WA 2N1WA 1B9RA 2V9HA 4ZRQA 4WJOA 4W9CA 3UF8A 3AE6B 1ACCA 1L0XB 2JXXA 3NVZA 4NAMA 3PRPB 3JSVA 3D32A 1FRDA 1QT9A 2C7NB 1HQRD 3P4QB 3L4PA 4RM8A 2ZZPB 4AJYB 3DPDA 2IGGA 2KKCA 2Y5BB 1TKEA 1QOGA 2NCNA 4RMAA 4NJCA 1YX6B 4GMVA 4DQOC 2ICIA 2WXJA 2D2QA 3U7DA 1V97A 3H7SA 4TKNA 1ET9A 3APDA 3LB8C 4ZYSA 1WY8A 3HVZA 1D6EC 1C79A 3W5UB 4P1CC 3DBHB 1JQ4A 2PEAA 2KWDA 4TMAB 1Q1OA 2WX1A 2GRIA 1FEHA 2W3RA 3AE2B 3CWIA 3M3JA 3B1LX 4LNKA 1YN3A 3R66C 1KM7A 1RYJA 1I4QA 4XDDA 1UBQA 1I4GA 1HEZE 2NR2A 1PYWD 3KQ4A 4JWSC 1L5PA 4HDQA 3TCAA 1V1PB 2QC8A 3L13A 2ZCBA 5BMHA 3NRZA 1LM8B 2GLSA 2MBQA 4NZLB 1F52A 2JWUA 4KDIC 3CSFA 4W9DA 4EE2A 2BB5A 2XNAC 3QA8A 3AEGB 3L17A 2RPVA 3RT3B 5GXGB 3P42A 3UQAA 2XK5B 1WSPA 2M0XA 4A9AA 3N1YC 1B1ZA 4I6PA 4DDID 2CU3A 3GB1A 4XE0A 5HG2A 4RM9A 5DCNA 4RCOA 1KLUD 1WM2A 4ZDVA 4MEMA 2KTRB 1GC6A 3L10B 3AB5A 4W9GA 3P2BA 1OGWA 4L1BA 2GB1A 4D2KA 4HLEA 3PRZA 1N62A 1WXVA 3U30A 2BS4B 4L23A 2WDQB 1JWMD 1YIWA 4K1RB 3AE3B 2KDEB
chains in the Genus database with same CATH topology
3A9KA 2NBVB 3A4SC 4ANWA 3PS6A 2LGXA 3PT2B 3SU8X 4ICUA 3VTWA 3VVWB 1RRBA 2N9EB 4ICVA 1J0GA 1Q0WB 2AL3A 2LRUA 4KDLB 5IAAC 3DBLI 3KVFB 3VUYA 2Z59B 3OLMD 4KZ0A 1IPGA 1EUVB 1CMXB 2Z0DB 4DHJB 3ZUNA 4MGZE 2JRIB 3ALBA 3N3KB 4HPLB 3ZRFA 5DPTA 2KOXA 2IO1B 1E90A 4IWPA 3RUIB 3DVNV 2M8SA 1WGHA 3ZTCA 2LRWA 4E3CA 3TMPB 1E8ZA 3OJ3A 4LDTB 2LGDA 4ZRJA 2KWVB 3U8ZA 2C9WB 2V4LA 3L08A 2L7RA 4HWIB 4PS8A 2IZVB 2JZ3B 4J6IA 2BYEA 1P3QU 3M63B 2JY6A 4AOFA 1P98A 2JVCA 2LUEA 4NPNA 3APFA 2PPHA 3DQVA 3DBSA 4MH0E 4WJQA 3ZNZB 3IVFA 2KFKB 2MRPA 2OJRA 1WFYA 3B08A 3VHTC 3WAOA 3ZLZA 4F8CB 3WIMA 2K8CA 4JIOU 4G0NB 4OVVA 3BINA 2DX5B 2JUOA 4IC7B 4ZYNA 1J8CA 3IFWB 3PPAA 3O65B 2JRHA 4JLCA 2IY1B 2HJ8A 2D3GA 2CU1A 3ML8A 2AYOB 3VH4B 2D10A 2MBOA 3ZDMC 5JZEB 1P9DU 1WR6E 3PLVA 3QX1A 4TQ1A 5C1ZA 1OQYA 3PHWB 2GBJA 4IG7B 4DK5A 1WE6A 3I3TB 1U4AA 1T0YA 2LZ6A 3VH3B 3ENEA 2KFJA 1WZ0A 2GMIC 1YX5B 5EDSA 1ZKHA 2JWZA 4GSWA 2A5UA 4GIVA 4GDKB 1RAXA 1WYWB 1S1QB 2KC2A 1UGMA 4KZCA 3JSVB 3ECIA 5E6OA 1NI2A 1WJUA 2JZZA 2N7DA 4E74A 4FHKA 3APCA 1LXDA 3L16A 2K25A 2N7EA 2XK5A 5JHBA 2YVCA 2HD5B 4HDOA 3WALA 2LGYA 3A33B 3LJ3A 4W9EA 2K39A 3CMMB 2CHXA 4FHJA 1Y8RC 4KIKB 4JGHB 1OTRB 2FCNA 5E6NA 3RZFA 4DBGA 2KWCA 1M94A 4HPMB 4KSKC 5J18A 5DPSA 1WMHB 3X0WA 2LVOA 2KTRA 2CHWA 1WGRA 2FUHB 2W9NA 2K8HA 5AEKB 2L05A 4TQ0A 2BGFA 2LXAA 5JHAA 2D11A 3TIXA 5C23A 2FIFA 3PV1A 1LQBA 2KX0A 2EKEC 1TZ1A 3VAWA 3R7QA 2HE7A 3VXWA 3X23A 2ZVNA 2LWPA 3QK0A 2BPSA 4I6LB 4BFRA 1H8CA 3QAQA 4G3XB 2AL6A 3CSTA 3A1QA 3AULA 2O2VB 3DDCB 4NAWB 4W9JA 1LFDA 4WAAA 3QQ8B 4FJVB 5D6JB 3SHQA 2JT4B 3H7PB 4CHKA 1EF5A 2WDTB 2KLCA 5AZFA 3ZTDA 3NHEB 4CYEA 2KZRA 4KV2A 1P1AA 4NJ6A 2BWFA 2KC1A 1V49A 1WGGA 2B3AA 2J0KA 4PYZA 4IM3A 3ZDTA 1XQQA 4BBNC 2KD0A 1E8WA 2MBHA 4MGYE 3KUZA 2KQSA 4FADA 2DZMA 4BBNF 2DYBA 4MJSB 3PRMB 4XZ4A 2G4SA 1UBIA 1WXMA 4P7IA 1HE8A 4HK2A 2GOWA 2M1MA 1NBFC 2KFKA 2IBIB 1SGHA 4MELA 4DDGD 2N4FA 2R2OA 2WYQA 4TUUA 2C7MB 3WANA 4W9HA 3PHXB 4KVGB 3RCZA 1YQBA 5JH5C 4ANXA 1WX7A 2LD9A 3H9DA 2IO3B 2PE9A 4BKSA 4FN2A 2VRRB 2KNBA 2MP2A 2JPHA 2ZPNA 2CHZA 2KHWB 4M8NA 4BKTA 4II2B 2N9PC 4GB9A 2FCQA 3NOBA 3HIZA 2NBWB 3V61A 1E5WA 1L2NA 4HXDA 2KDBA 3V6CB 1F9JA 3ML9A 1TTNA 4IM2A 2LVPA 2KJHB 4DHJD 1V86A 4B95A 2MA9B 1WJ4A 2N9XA 4BOZB 1SIFA 4EEWA 4GN1A 1P0RA 1MG8A 2KX3A 3N30A 3RYTA 2LASA 1I35A 2KDFB 2M17A 2WWZA 4LDTD 3ZIMA 2AWTA 3A9JB 5GMVA 2DYOA 5G2NA 1WJ6A 3KW5B 3DBRI 2PE6B 2IO2B 1S3SG 3HK0A 3UIOB 1WI0A 3OAWA 5L95C 1UH6A 3KUCB 4KIKA 2FAZA 2K6QA 4NQKE 4II3B 3A9KB 2MCNB 3UQBA 1C3TA 1Q5WB 2MLBA 1EF1A 3VUXA 1ZW7A 2CR5A 3ZNHB 3UGBB 3CF6E 2MWSB 2MW5A 4GDLA 2K1FA 2BYFA 2RGFA 3W1SC 1TBEA 1WMHA 4MM3A 1WXAA 4BKSD 1FXTB 3DCGA 1WJNA 1UZXB 3NZUA 5L83A 4GU2A 3QARA 1H4RA 3OJ4B 1E7UA 2G3QB 3AU4A 1R4NI 2KK8A 2GBRA 4GOCA 4MDKE 3VQIA 3VTVA 5BO4B 3SDLC 2L0FA 2XBBC 4X57B 2G4DB 1WZ3A 1IYFA 4NJ7A 2XEWA 3ZKJC 3PLUA 1OEYA 2DAFA 1ZGUB 2GBKA 3MJWA 4MGKE 1WRDB 4DWFA 2YLMA 3RZWC 2LXCA 4NNJB 3H1UA 2Z0EB 5CHFA 2O2VA 4B9KA 1JRUA 4LCDE 4IW0A 4W9IA 2BKFA 2I1JA 4NAWA 1XT9B 2EMTA 1C1YB 3B0AA 1WR1A 5D94A 3KUDB 1ISNA 2LJ5A 4DHZE 4ZRKA 2ZCCA 3V62A 1PQSA 1V5OA 3JW0X 2IO0B 2KWUB 4FBJB 2ZNVB 4A20A 3VTUA 2BWES 4XC2A 2KN5A 4W9LA 4WJNA 1WGDA 2DZIA 3M62B 3QIJA 2KLGA 5FR6A 4BVUC 1RFAA 2BKRB 2MQJA 5CTRC 5DPRA 2NPTB 5KHQA 1WGYA 4F7ZA 3AXCA 4MJSA 2R2QA 1SE9A 3KH0A 1A5RA 2O6VB 5HKHA 1NDDA 2PJHA 2IY0B 3BY4B 4MGIE 2J0JA 2ZNVC 2GBNA 5LXIB 4YL8A 4WWOA 4AUQC 3K9PB 3QJZA 3PREA 3QCAA 1WH3A 2L00B 3ZNID 4ZRIA 3T8MA 4A3OA 4EZKA 4EUTA 4G11A 4PYUA 2ZVOA 2WX0A 4MSMB 5D2MB 2K6DB 2FCMA 3QWZB 1GNUA 2FIDA 2JF5A 2NS5A 2ZJDA 3TL5A 3UIPB 1Z5SB 3NS8A 3ZRCA 2DENB 3EHVA 3EFUA 1VCBA 4WQOB 4IWOA 5J2RA 1KLVA 3QC8B 4M8MA 4A3PA 2FNJB 2DZJA 3TBLD 1G6JA 3SD5A 4EFOA 3GZNI 4M0WB 1WE7A 4CO7A 4FULA 3PGEA 3ZO5B 2KDIA 2BF8B 1V5TA 2AEHA 2LVQA 5E6PA 2KO3A 2UYZB 4FA6A 2I1KA 2C7HA 4GGQA 2NVUI 1WXSA 1V2YA 3NY5A 3W1SA 2MSED 3IHPC 4FJYA 1OEYJ 4IM0A 5LLIA 5KHOA 2ZEQA 4NQLB 4EZLA 2GBMA 5IA7A 2ZPYA 1V9JA 2KVRA 3AI5A 3WAMA 1WM3A 4BOSC 3IG3A 3A1QB 5CHVC 2D07B 2RPQA 3DVGX 4K7WA 1K8RB 3Q3JA 2N1WA 1WF9A 1AARA 3T9LA 1V6EA 2HTHA 3PZDA 4WJOA 4W9CA 2RR9A 3UF8A 3ZNGC 2RD0A 4E71A 4N9F4 2C60A 1EO6A 2L3ZA 3VDZA 2JXXA 4GDKA 2KMCA 2NBUA 3PRPB 4JQWC 3JSVA 3L0WB 4HCNB 3EC8A 3D32A 1J19A 2KMAA 2KJRA 4LJPB 2C7NB 3VFKA 4G50A 4BKGA 2IYDB 4XX5A 4B6WA 3Q3FA 3ZVVA 4RM8A 5AZGA 3UINB 2ZZPB 4AJYB 3DPDA 4DXAB 2KKCA 2UWQA 2Y5BB 1WX8A 3C0RB 3VUWA 1IP9A 3DBHI 2NCNA 4K7SA 3DOWA 4RMAA 1YX6B 2ASQA 4GMVA 4IUMB 4IWQA 4JL9A 4EOYA 2FCSA 4DHZB 2D2QA 3U7DA 3H7SA 4TKNA 4AP4C 4ASWC 3APDA 2DYMA 1YJ1A 2V1YA 2MP2B 1L7YA 4OVUA 2OOBB 3DVNU 3K9OB 3M95A 2C5LC 1TGZB 1E7VA 2NPTA 1WY8A 3S2AA 2DAJA 2DZKA 2KTFA 1V81A 2O6VA 3L54A 5CHWA 1R4MI 1I42A 3MHSD 3WAPA 3R3MA 2PEAA 2EMSA 1Q1OA 2WX1A 1WX9A 3EECA 3H7PA 4KSLC 2V3SA 2BYVE 1KJTA 3M3JA 3B1LX 3PTFC 5J17A 3R66C 1YD8U 1KM7A 3QHTA 2G45B 2QHOA 4NY0A 3AU5A 4F1SA 4FJZA 3ONSA 4HJKA 4URKA 3NZSA 4HVBA 2L76A 1UBQA 1UD7A 2MX2A 1E8XA 3IBEA 2NR2A 1XD3B 5G55A 2KQ7A 4HDQA 3TCAA 1GC7A 3ZW3A 4GDLB 3L13A 2ZCBA 4AWJA 3R7RA 3WA0A 4WJPA 1D3ZA 2KANA 1RLFA 1LM8B 2J0MA 5AZHA 1BT0A 2CS4A 2MBQA 4GXBA 4W9KA 4EZJA 4KDIC 3CSFA 2K8BA 4FLHA 4AJWA 4WWNA 4W9DA 1UELA 3QA8A 4HCPB 3TJPA 2REXA 3L17A 3RT3B 4I6NB 2O6VD 3UQAA 2XK5B 1E8YA 2L8JA 5CX3A 4ANUA 1GJZA 2M0XA 1QZEA 4K7UA 2LI5A 1WIAA 2MBEA 2RSUA 2J7QB 4I6PA 3A4RA 4DDID 3W1YA 5LXHA 1X1MA 4MSQB 3HM3A 4PS3A 3MTNB 4RM9A 5DCNA 3N32A 1WM2A 1Z2MA 4K81A 4LJOB 4ZDVA 2CKHB 3HM6X 4MEMA 2KTRB 5D7GA 1GC6A 3L10B 4ANVA 4WWPA 2KXJA 2L0TA 3LDZE 2A4ZA 3JVZX 4TV3A 3PVLA 3GOEA 3P2BA 4W9GA 1OGWA 1V80A 3H6NA 3HHMA 3RD2A 3PSEB 1GUAB 1KOTA 4HLEA 4PS7A 3A9JA 5DPWA 1GG3A 2MBBB 3JYUA 3PRZA 5TR5A 1VD2A 1WXVA 3U30A 2KJ6A 2DHZA 3DVGY 3V60A 4EKUA 3RULA 3KYDD 4W9FA 2N1VA 3V6EB 3KYCD 1YIWA 4K1RB 2M4NA 2KDEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9K A;  2NBV B;  3A4S C;  4ANW A;  3PS6 A;  2LGX A;  3PT2 B;  3SU8 X;  4ICU A;  3VTW A;  3VVW B;  1RRB A;  2N9E B;  4ICV A;  1J0G A;  1Q0W B;  2AL3 A;  2LRU A;  4KDL B;  5IAA C;  3DBL I;  3KVF B;  3VUY A;  2Z59 B;  3OLM D;  4KZ0 A;  1IPG A;  1EUV B;  1CMX B;  2Z0D B;  4DHJ B;  3ZUN A;  4MGZ E;  2JRI B;  3ALB A;  3N3K B;  4HPL B;  3ZRF A;  5DPT A;  2KOX A;  2IO1 B;  1E90 A;  4IWP A;  3RUI B;  3DVN V;  2M8S A;  1WGH A;  3ZTC A;  2LRW A;  4E3C A;  3TMP B;  1E8Z A;  3OJ3 A;  4LDT B;  2LGD A;  4ZRJ A;  2KWV B;  3U8Z A;  2C9W B;  2V4L A;  3L08 A;  2L7R A;  4HWI B;  4PS8 A;  2IZV B;  2JZ3 B;  4J6I A;  2BYE A;  1P3Q U;  3M63 B;  2JY6 A;  4AOF A;  1P98 A;  2JVC A;  2LUE A;  4NPN A;  3APF A;  2PPH A;  3DQV A;  3DBS A;  4MH0 E;  4WJQ A;  3ZNZ B;  3IVF A;  2KFK B;  2MRP A;  2OJR A;  1WFY A;  3B08 A;  3VHT C;  3WAO A;  3ZLZ A;  4F8C B;  3WIM A;  2K8C A;  4JIO U;  4G0N B;  4OVV A;  3BIN A;  2DX5 B;  2JUO A;  4IC7 B;  4ZYN A;  1J8C A;  3IFW B;  3PPA A;  3O65 B;  2JRH A;  4JLC A;  2IY1 B;  2HJ8 A;  2D3G A;  2CU1 A;  3ML8 A;  2AYO B;  3VH4 B;  2D10 A;  2MBO A;  3ZDM C;  5JZE B;  1P9D U;  1WR6 E;  3PLV A;  3QX1 A;  4TQ1 A;  5C1Z A;  1OQY A;  3PHW B;  2GBJ A;  4IG7 B;  4DK5 A;  1WE6 A;  3I3T B;  1U4A A;  1T0Y A;  2LZ6 A;  3VH3 B;  3ENE A;  2KFJ A;  1WZ0 A;  2GMI C;  1YX5 B;  5EDS A;  1ZKH A;  2JWZ A;  4GSW A;  2A5U A;  4GIV A;  4GDK B;  1RAX A;  1WYW B;  1S1Q B;  2KC2 A;  1UGM A;  4KZC A;  3JSV B;  3ECI A;  5E6O A;  1NI2 A;  1WJU A;  2JZZ A;  2N7D A;  4E74 A;  4FHK A;  3APC A;  1LXD A;  3L16 A;  2K25 A;  2N7E A;  2XK5 A;  5JHB A;  2YVC A;  2HD5 B;  4HDO A;  3WAL A;  2LGY A;  3A33 B;  3LJ3 A;  4W9E A;  2K39 A;  3CMM B;  2CHX A;  4FHJ A;  1Y8R C;  4KIK B;  4JGH B;  1OTR B;  2FCN A;  5E6N A;  3RZF A;  4DBG A;  2KWC A;  1M94 A;  4HPM B;  4KSK C;  5J18 A;  5DPS A;  1WMH B;  3X0W A;  2LVO A;  2KTR A;  2CHW A;  1WGR A;  2FUH B;  2W9N A;  2K8H A;  5AEK B;  2L05 A;  4TQ0 A;  2BGF A;  2LXA A;  5JHA A;  2D11 A;  3TIX A;  5C23 A;  2FIF A;  3PV1 A;  1LQB A;  2KX0 A;  2EKE C;  1TZ1 A;  3VAW A;  3R7Q A;  2HE7 A;  3VXW A;  3X23 A;  2ZVN A;  2LWP A;  3QK0 A;  2BPS A;  4I6L B;  4BFR A;  1H8C A;  3QAQ A;  4G3X B;  2AL6 A;  3CST A;  3A1Q A;  3AUL A;  2O2V B;  3DDC B;  4NAW B;  4W9J A;  1LFD A;  4WAA A;  3QQ8 B;  4FJV B;  5D6J B;  3SHQ A;  2JT4 B;  3H7P B;  4CHK A;  1EF5 A;  2WDT B;  2KLC A;  5AZF A;  3ZTD A;  3NHE B;  4CYE A;  2KZR A;  4KV2 A;  1P1A A;  4NJ6 A;  2BWF A;  2KC1 A;  1V49 A;  1WGG A;  2B3A A;  2J0K A;  4PYZ A;  4IM3 A;  3ZDT A;  1XQQ A;  4BBN C;  2KD0 A;  1E8W A;  2MBH A;  4MGY E;  3KUZ A;  2KQS A;  4FAD A;  2DZM A;  4BBN F;  2DYB A;  4MJS B;  3PRM B;  4XZ4 A;  2G4S A;  1UBI A;  1WXM A;  4P7I A;  1HE8 A;  4HK2 A;  2GOW A;  2M1M A;  1NBF C;  2KFK A;  2IBI B;  1SGH A;  4MEL A;  4DDG D;  2N4F A;  2R2O A;  2WYQ A;  4TUU A;  2C7M B;  3WAN A;  4W9H A;  3PHX B;  4KVG B;  3RCZ A;  1YQB A;  5JH5 C;  4ANX A;  1WX7 A;  2LD9 A;  3H9D A;  2IO3 B;  2PE9 A;  4BKS A;  4FN2 A;  2VRR B;  2KNB A;  2MP2 A;  2JPH A;  2ZPN A;  2CHZ A;  2KHW B;  4M8N A;  4BKT A;  4II2 B;  2N9P C;  4GB9 A;  2FCQ A;  3NOB A;  3HIZ A;  2NBW B;  3V61 A;  1E5W A;  1L2N A;  4HXD A;  2KDB A;  3V6C B;  1F9J A;  3ML9 A;  1TTN A;  4IM2 A;  2LVP A;  2KJH B;  4DHJ D;  1V86 A;  4B95 A;  2MA9 B;  1WJ4 A;  2N9X A;  4BOZ B;  1SIF A;  4EEW A;  4GN1 A;  1P0R A;  1MG8 A;  2KX3 A;  3N30 A;  3RYT A;  2LAS A;  1I35 A;  2KDF B;  2M17 A;  2WWZ A;  4LDT D;  3ZIM A;  2AWT A;  3A9J B;  5GMV A;  2DYO A;  5G2N A;  1WJ6 A;  3KW5 B;  3DBR I;  2PE6 B;  2IO2 B;  1S3S G;  3HK0 A;  3UIO B;  1WI0 A;  3OAW A;  5L95 C;  1UH6 A;  3KUC B;  4KIK A;  2FAZ A;  2K6Q A;  4NQK E;  4II3 B;  3A9K B;  2MCN B;  3UQB A;  1C3T A;  1Q5W B;  2MLB A;  1EF1 A;  3VUX A;  1ZW7 A;  2CR5 A;  3ZNH B;  3UGB B;  3CF6 E;  2MWS B;  2MW5 A;  4GDL A;  2K1F A;  2BYF A;  2RGF A;  3W1S C;  1TBE A;  1WMH A;  4MM3 A;  1WXA A;  4BKS D;  1FXT B;  3DCG A;  1WJN A;  1UZX B;  3NZU A;  5L83 A;  4GU2 A;  3QAR A;  1H4R A;  3OJ4 B;  1E7U A;  2G3Q B;  3AU4 A;  1R4N I;  2KK8 A;  2GBR A;  4GOC A;  4MDK E;  3VQI A;  3VTV A;  5BO4 B;  3SDL C;  2L0F A;  2XBB C;  4X57 B;  2G4D B;  1WZ3 A;  1IYF A;  4NJ7 A;  2XEW A;  3ZKJ C;  3PLU A;  1OEY A;  2DAF A;  1ZGU B;  2GBK A;  3MJW A;  4MGK E;  1WRD B;  4DWF A;  2YLM A;  3RZW C;  2LXC A;  4NNJ B;  3H1U A;  2Z0E B;  5CHF A;  2O2V A;  4B9K A;  1JRU A;  4LCD E;  4IW0 A;  4W9I A;  2BKF A;  2I1J A;  4NAW A;  1XT9 B;  2EMT A;  1C1Y B;  3B0A A;  1WR1 A;  5D94 A;  3KUD B;  1ISN A;  2LJ5 A;  4DHZ E;  4ZRK A;  2ZCC A;  3V62 A;  1PQS A;  1V5O A;  3JW0 X;  2IO0 B;  2KWU B;  4FBJ B;  2ZNV B;  4A20 A;  3VTU A;  2BWE S;  4XC2 A;  2KN5 A;  4W9L A;  4WJN A;  1WGD A;  2DZI A;  3M62 B;  3QIJ A;  2KLG A;  5FR6 A;  4BVU C;  1RFA A;  2BKR B;  2MQJ A;  5CTR C;  5DPR A;  2NPT B;  5KHQ A;  1WGY A;  4F7Z A;  3AXC A;  4MJS A;  2R2Q A;  1SE9 A;  3KH0 A;  1A5R A;  2O6V B;  5HKH A;  1NDD A;  2PJH A;  2IY0 B;  3BY4 B;  4MGI E;  2J0J A;  2ZNV C;  2GBN A;  5LXI B;  4YL8 A;  4WWO A;  4AUQ C;  3K9P B;  3QJZ A;  3PRE A;  3QCA A;  1WH3 A;  2L00 B;  3ZNI D;  4ZRI A;  3T8M A;  4A3O A;  4EZK A;  4EUT A;  4G11 A;  4PYU A;  2ZVO A;  2WX0 A;  4MSM B;  5D2M B;  2K6D B;  2FCM A;  3QWZ B;  1GNU A;  2FID A;  2JF5 A;  2NS5 A;  2ZJD A;  3TL5 A;  3UIP B;  1Z5S B;  3NS8 A;  3ZRC A;  2DEN B;  3EHV A;  3EFU A;  1VCB A;  4WQO B;  4IWO A;  5J2R A;  1KLV A;  3QC8 B;  4M8M A;  4A3P A;  2FNJ B;  2DZJ A;  3TBL D;  1G6J A;  3SD5 A;  4EFO A;  3GZN I;  4M0W B;  1WE7 A;  4CO7 A;  4FUL A;  3PGE A;  3ZO5 B;  2KDI A;  2BF8 B;  1V5T A;  2AEH A;  2LVQ A;  5E6P A;  2KO3 A;  2UYZ B;  4FA6 A;  2I1K A;  2C7H A;  4GGQ A;  2NVU I;  1WXS A;  1V2Y A;  3NY5 A;  3W1S A;  2MSE D;  3IHP C;  4FJY A;  1OEY J;  4IM0 A;  5LLI A;  5KHO A;  2ZEQ A;  4NQL B;  4EZL A;  2GBM A;  5IA7 A;  2ZPY A;  1V9J A;  2KVR A;  3AI5 A;  3WAM A;  1WM3 A;  4BOS C;  3IG3 A;  3A1Q B;  5CHV C;  2D07 B;  2RPQ A;  3DVG X;  4K7W A;  1K8R B;  3Q3J A;  2N1W A;  1WF9 A;  1AAR A;  3T9L A;  1V6E A;  2HTH A;  3PZD A;  4WJO A;  4W9C A;  2RR9 A;  3UF8 A;  3ZNG C;  2RD0 A;  4E71 A;  4N9F 4;  2C60 A;  1EO6 A;  2L3Z A;  3VDZ A;  2JXX A;  4GDK A;  2KMC A;  2NBU A;  3PRP B;  4JQW C;  3JSV A;  3L0W B;  4HCN B;  3EC8 A;  3D32 A;  1J19 A;  2KMA A;  2KJR A;  4LJP B;  2C7N B;  3VFK A;  4G50 A;  4BKG A;  2IYD B;  4XX5 A;  4B6W A;  3Q3F A;  3ZVV A;  4RM8 A;  5AZG A;  3UIN B;  2ZZP B;  4AJY B;  3DPD A;  4DXA B;  2KKC A;  2UWQ A;  2Y5B B;  1WX8 A;  3C0R B;  3VUW A;  1IP9 A;  3DBH I;  2NCN A;  4K7S A;  3DOW A;  4RMA A;  1YX6 B;  2ASQ A;  4GMV A;  4IUM B;  4IWQ A;  4JL9 A;  4EOY A;  2FCS A;  4DHZ B;  2D2Q A;  3U7D A;  3H7S A;  4TKN A;  4AP4 C;  4ASW C;  3APD A;  2DYM A;  1YJ1 A;  2V1Y A;  2MP2 B;  1L7Y A;  4OVU A;  2OOB B;  3DVN U;  3K9O B;  3M95 A;  2C5L C;  1TGZ B;  1E7V A;  2NPT A;  1WY8 A;  3S2A A;  2DAJ A;  2DZK A;  2KTF A;  1V81 A;  2O6V A;  3L54 A;  5CHW A;  1R4M I;  1I42 A;  3MHS D;  3WAP A;  3R3M A;  2PEA A;  2EMS A;  1Q1O A;  2WX1 A;  1WX9 A;  3EEC A;  3H7P A;  4KSL C;  2V3S A;  2BYV E;  1KJT A;  3M3J A;  3B1L X;  3PTF C;  5J17 A;  3R66 C;  1YD8 U;  1KM7 A;  3QHT A;  2G45 B;  2QHO A;  4NY0 A;  3AU5 A;  4F1S A;  4FJZ A;  3ONS A;  4HJK A;  4URK A;  3NZS A;  4HVB A;  2L76 A;  1UBQ A;  1UD7 A;  2MX2 A;  1E8X A;  3IBE A;  2NR2 A;  1XD3 B;  5G55 A;  2KQ7 A;  4HDQ A;  3TCA A;  1GC7 A;  3ZW3 A;  4GDL B;  3L13 A;  2ZCB A;  4AWJ A;  3R7R A;  3WA0 A;  4WJP A;  1D3Z A;  2KAN A;  1RLF A;  1LM8 B;  2J0M A;  5AZH A;  1BT0 A;  2CS4 A;  2MBQ A;  4GXB A;  4W9K A;  4EZJ A;  4KDI C;  3CSF A;  2K8B A;  4FLH A;  4AJW A;  4WWN A;  4W9D A;  1UEL A;  3QA8 A;  4HCP B;  3TJP A;  2REX A;  3L17 A;  3RT3 B;  4I6N B;  2O6V D;  3UQA A;  2XK5 B;  1E8Y A;  2L8J A;  5CX3 A;  4ANU A;  1GJZ A;  2M0X A;  1QZE A;  4K7U A;  2LI5 A;  1WIA A;  2MBE A;  2RSU A;  2J7Q B;  4I6P A;  3A4R A;  4DDI D;  3W1Y A;  5LXH A;  1X1M A;  4MSQ B;  3HM3 A;  4PS3 A;  3MTN B;  4RM9 A;  5DCN A;  3N32 A;  1WM2 A;  1Z2M A;  4K81 A;  4LJO B;  4ZDV A;  2CKH B;  3HM6 X;  4MEM A;  2KTR B;  5D7G A;  1GC6 A;  3L10 B;  4ANV A;  4WWP A;  2KXJ A;  2L0T A;  3LDZ E;  2A4Z A;  3JVZ X;  4TV3 A;  3PVL A;  3GOE A;  3P2B A;  4W9G A;  1OGW A;  1V80 A;  3H6N A;  3HHM A;  3RD2 A;  3PSE B;  1GUA B;  1KOT A;  4HLE A;  4PS7 A;  3A9J A;  5DPW A;  1GG3 A;  2MBB B;  3JYU A;  3PRZ A;  5TR5 A;  1VD2 A;  1WXV A;  3U30 A;  2KJ6 A;  2DHZ A;  3DVG Y;  3V60 A;  4EKU A;  3RUL A;  3KYD D;  4W9F A;  2N1V A;  3V6E B;  3KYC D;  1YIW A;  4K1R B;  2M4N A;  2KDE B; 
#chains in the Genus database with same CATH topology
 3A9K A;  1VJK A;  1C77 A;  3PT2 B;  3VTW A;  1RRB A;  2N9E B;  4ICV A;  5H8Y E;  3KWV A;  3FIL B;  3B2G A;  3ZUN A;  3N3K B;  4HPL B;  3ZTC A;  2QCZ A;  3BK2 A;  4HWI B;  3U2S C;  1T0R C;  4PS8 A;  2IZV B;  2JZ3 B;  4J6I A;  2BYE A;  2JVC A;  2LUE A;  4NPN A;  3APF A;  4MH0 E;  3HVD A;  1D5X C;  2KFK B;  2OJR A;  1TY0 A;  4F8C B;  2MJ3 A;  4JIO U;  4OVV A;  3BIN A;  2DX5 B;  4IC7 B;  3DWM A;  4YSZ B;  3O65 B;  4YWG G;  3ML8 A;  5JZE B;  2WXM A;  1WR6 E;  2WXR A;  4ITK A;  5C1Z A;  2GBJ A;  1U4A A;  1T0Y A;  2KN4 A;  3RI7 C;  3EA6 A;  4GIV A;  4KZC A;  2JZZ A;  1F2R C;  2N7D A;  2N7E A;  2YVC A;  2HD5 B;  1WXQ A;  4RGN A;  4W9E A;  3RN9 C;  4FHJ A;  1Y8R C;  4KIK B;  3RZF A;  1ZP0 B;  2PTL A;  2Q5W D;  1C4P A;  2LMC A;  3IT4 B;  2L05 A;  3RNA C;  2LXA A;  2D11 A;  3BVG A;  1LQB A;  5D3I B;  2EKE C;  1TZ1 A;  4LNN A;  3VAW A;  4C4V B;  2WXN A;  3SR6 A;  4ZHO A;  1FFU A;  2ZVN A;  3QK0 A;  1SXT A;  4G3X B;  3A1Q A;  1K50 A;  1FNV A;  3TEZ A;  4NAW B;  5D6J B;  5BMI A;  4FJV B;  2JT4 B;  2N9K A;  1EF5 A;  1MHX A;  5AZF A;  3NHE B;  1VZ6 A;  2KZR A;  3P63 A;  3I5J C;  5EE0 A;  4PYZ A;  2K22 A;  5HFY A;  1CK1 A;  3KUZ A;  1TT5 B;  4BBN F;  2DYB A;  4MJS B;  2W54 A;  4A8X C;  5FKA C;  1ET6 A;  4HK2 A;  2M1M A;  4USA A;  2IBI B;  1SGH A;  1DOY A;  2R2O A;  1ESF A;  4TUU A;  2J53 A;  2C7M B;  3U4E G;  4C00 A;  2ON8 A;  2NTT A;  2VH2 A;  1NYR A;  1WX7 A;  4A6Q A;  2VRR B;  2KT7 A;  2KHW B;  4KX6 B;  2IGD A;  2BTE A;  1FM0 D;  3HIZ A;  3V61 A;  1L2N A;  1JWB D;  5EE3 A;  2BW2 A;  2KDB A;  3ML9 A;  3MHZ A;  5BYS A;  2MA9 B;  1WJ4 A;  1N63 A;  5IKC M;  2KDF B;  4LDT D;  5GMV A;  3PO0 A;  1QF6 A;  1NYQ A;  4YTM B;  1FO4 A;  1N5W A;  2FAZ A;  4II3 B;  4YT0 B;  1Q5W B;  2MLB A;  1EF1 A;  2OJW A;  3VUX A;  2CR5 A;  2JX5 A;  4GDL A;  1JWA D;  1WXA A;  3DCG A;  3OJ4 B;  2GBR A;  4MDK E;  3VQI A;  3AE7 B;  5C2T B;  1IYF A;  1XCQ L;  1YQ3 B;  3PLU A;  1OEY A;  1SE3 A;  2DAF A;  3VR8 B;  1TKY A;  2WHI A;  1I4R A;  1WRI A;  3E9S A;  3AEB B;  4NNJ B;  3H1U A;  5CHF A;  4LCD E;  1GB4 A;  4RF0 A;  2LJ5 A;  4DHZ E;  1XEE A;  2H88 B;  1PQS A;  3JW0 X;  2JYE A;  3VTU A;  2W82 A;  4KKJ A;  5L83 A;  4WJN A;  3QIJ A;  1AYF A;  2MQJ A;  2QSD A;  5CTR C;  2NPT B;  3RNC C;  5KHQ A;  3AXC A;  2R2Q A;  3KH0 A;  1M4V A;  2YEP B;  1NDD A;  5LXI B;  4WWO A;  4AUQ C;  1PFD A;  3PRE A;  3H8H A;  1WH3 A;  2L00 B;  4N58 A;  2LHD A;  4MH8 A;  4A3O A;  1T3Q A;  2ZVO A;  3QWZ B;  1FCC C;  3DHG C;  2ZJD A;  4JE3 B;  2K5P A;  1Z5S B;  2IPK D;  3MC8 A;  1HTQ A;  2DEN B;  3EHV A;  1FNW A;  3BZD B;  3EFU A;  1VCB A;  5J2R A;  2XN9 C;  3NJT A;  1L4Z B;  1G6J A;  1WE7 A;  4CO7 A;  1V5T A;  2BF8 B;  2MJE A;  2C7H A;  4TSS A;  1IGD A;  1PGA A;  1WXS A;  2D3C A;  3NY5 A;  4FJY A;  1OEY J;  1YOV B;  5KHO A;  3NUH B;  2ZPY A;  2DWQ A;  1SSN A;  3WAM A;  1WM3 A;  3V05 A;  1K8R B;  1KH0 A;  1WF9 A;  5G5H A;  1AAR A;  2RR9 A;  3ZNG C;  1XO3 A;  1UWM A;  2RD0 A;  4E71 A;  3VDZ A;  2L3Z A;  4GDK A;  2KMC A;  1JCK B;  2KJR A;  1PGB A;  5TSS A;  3I9V 1;  3VFK A;  2WS3 B;  4BKG A;  4S0R A;  1NI3 A;  3ZVV A;  1WX8 A;  3C0R B;  1ROE A;  2H89 B;  1HZ5 A;  3UI3 A;  4K7S A;  3DOW A;  2LGS A;  1MVK A;  1QIL A;  4KGT A;  2DYM A;  2MP2 B;  1VDV A;  2WDV B;  1C76 A;  2DAJ A;  4XYC A;  1V81 A;  2O6V A;  5CHW A;  3WAP A;  1I4P A;  3R3M A;  4C7Z A;  3SFD B;  3EEC A;  3H7P A;  1DGJ A;  1KJT A;  1MJD A;  3C19 A;  1YD8 U;  2QHO A;  1T0Q C;  3NVY A;  4F1S A;  2E6X A;  2MX2 A;  1E8X A;  3IBE A;  4OW0 A;  2KQ7 A;  4RFB A;  1EU4 A;  2PMV A;  1MHH E;  4AWJ A;  2BVC A;  2J0M A;  5HI1 A;  3GE8 C;  1BT0 A;  3NG0 A;  1J7C A;  4HCP B;  2REX A;  2KMM A;  2L8J A;  1QZE A;  2LI5 A;  3I63 C;  2MBE A;  2RSU A;  2ZW1 A;  3AE5 B;  2J7Q B;  3A4R A;  1X1M A;  3PZ7 A;  1VRA B;  5G5G A;  2J4X A;  4PS3 A;  3MTN B;  4IOI E;  3AN1 A;  2BT6 A;  1Z2M A;  3SFE B;  4WWP A;  3FAH A;  4TV3 A;  3GOE A;  1V80 A;  2QJL A;  1KOT A;  1E6E B;  3A9J A;  1GG3 A;  3JYU A;  2KJ6 A;  2DHZ A;  3DVG Y;  2BS2 B;  3RUL A;  3IAM 1;  1JWU D;  2N1V A;  3KYC D;  3P4P B;  1CQV A;  2NBV B;  3A4S C;  3AEE B;  1TJE A;  2LRU A;  4KDL B;  5IAA C;  3ZYY X;  3VUY A;  3OLM D;  2WDR B;  1QLB B;  4DHJ B;  4HJG E;  3ALB A;  2IO1 B;  4IWP A;  2ZW0 A;  4E3C A;  3B2F A;  5IO9 A;  3T3N A;  1N6Z A;  1P3Q U;  3M63 B;  2JY6 A;  1P98 A;  3DQV A;  3IVF A;  4WUR A;  1WFY A;  3B08 A;  3VHT C;  1E0Z A;  1J8C A;  4ZYN A;  2JXT A;  3PPA A;  2JRH A;  2D3G A;  4N6E B;  2AYO B;  1K52 A;  5BYR A;  3QX1 A;  1TS4 A;  1WE6 A;  3VH3 B;  3LXF A;  1WZ0 A;  3ABV B;  3RNE C;  2ACZ B;  2JWZ A;  1RAX A;  1WYW B;  1S1Q B;  1UGM A;  4US9 A;  3JSV B;  1FIQ A;  4E74 A;  1IBX A;  4FHK A;  3APC A;  3L16 A;  1EWC A;  2K25 A;  3SEB A;  2XK5 A;  5JHB A;  3WAL A;  3AED B;  3A33 B;  2K39 A;  3CMM B;  4JGH B;  1OTR B;  2FCN A;  3MFG A;  1FXA A;  4KSK C;  4OHJ A;  5J18 A;  1WMH B;  4MM3 B;  2KTR A;  2CHW A;  1FCL A;  2FUH B;  1R4N B;  5AEK B;  4TQ0 A;  2M0A A;  1XCT L;  3TIX A;  1L0V B;  2FIF A;  2L32 A;  4ZRP A;  2HE7 A;  4BFR A;  2LWP A;  4K3C A;  3AUL A;  2O2V B;  3SHQ A;  3QQ8 B;  1VLB A;  2KLC A;  2LHE A;  3N1Z C;  4OZA A;  3FIL A;  1EU3 A;  4AS1 A;  4HPP A;  2B3A A;  3KLS X;  3ZDT A;  1XQQ A;  2KD0 A;  1E8W A;  1QOA A;  2MBH A;  4OVZ A;  1WGK A;  2KQS A;  3VR9 B;  4FAD A;  4P7I A;  1TS3 A;  1NBF C;  3PZ8 A;  2KFK A;  4MEL A;  3FC4 A;  4DDG D;  3AEF B;  4W9H A;  4KVG B;  4WIP A;  1BUI C;  2LD9 A;  3H9D A;  2IO3 B;  1SEB D;  2KNB A;  3Q2A C;  4BKT A;  4II2 B;  1V8C A;  1TY2 A;  2BS3 B;  1D4B A;  3V6C B;  2HTM E;  1V86 A;  2MEK A;  5C3J B;  4K3B A;  4YSX B;  2V3N A;  4GN1 A;  1QQR A;  1MG8 A;  2KX3 A;  2VZK D;  3DWG C;  3N30 A;  2LAS A;  2M17 A;  5G2N A;  2IO2 B;  3HK0 A;  3OAW A;  1ZDX A;  5L95 C;  1UGJ A;  1UWX A;  4KIK A;  3UQB A;  2K6Q A;  3A9K B;  1MG4 A;  3CF6 E;  1SE2 A;  2RGF A;  3W1S C;  2K0P A;  2KYW A;  1TBE A;  4RGT A;  1H4R A;  3KWL A;  4WH4 A;  1E7U A;  2G3Q B;  1R4N I;  5H92 C;  1QKZ A;  4MT5 A;  2L0F A;  1F77 A;  4NJ7 A;  3RNB C;  4C4V A;  1KFY B;  2GBK A;  2CJN A;  1WRD B;  5LNK 1;  3RZW C;  2LXC A;  1JRU A;  4IW0 A;  2BKF A;  4NAW A;  2EMT A;  1WR1 A;  2R61 A;  1ISN A;  4ZRK A;  2AX5 A;  2IO0 B;  2KWU B;  2V3P A;  1T6B X;  2ZNV B;  4A20 A;  2BWE S;  2AQ3 B;  4XC2 A;  3Q8F A;  1WGD A;  4F7Z A;  4MJS A;  2PJH A;  3CIR B;  3Q3O C;  1XLN A;  3K9P B;  3QJZ A;  3QCA A;  3ZNI D;  3T8M A;  4RNA A;  5IN7 A;  1DOI A;  1OQQ A;  2MJD A;  3ZJU A;  3HUI A;  1IUE A;  3TL5 A;  3AEA B;  3J9C A;  1L6V A;  5MPO A;  4WQO B;  4M8M A;  4A3P A;  2FNJ B;  3O13 A;  1FRR A;  2WXI A;  3GZN I;  1HA5 A;  3ZO5 B;  2KDI A;  2AEH A;  4FA6 A;  1GPX A;  2NVU I;  3W1S A;  2MSE D;  3ETR A;  4IM0 A;  2WXK A;  2VH1 A;  1V9J A;  1ZOY B;  2WQY B;  2FE8 A;  5CHV C;  3A1Q B;  2RPQ A;  3Q3J A;  1GAQ B;  2JYT A;  2J52 A;  3NVV A;  3T9L A;  2WXL A;  2DLB A;  4N9F 4;  1EO6 A;  3RNF C;  2IJ0 A;  2NBU A;  2INC C;  1JML A;  3EC8 A;  1J19 A;  4BAX A;  2WU5 B;  4G50 A;  2IYD B;  4XX5 A;  1KF6 B;  5AZG A;  3UIN B;  4DXA B;  2N9L A;  3Q8C A;  1T0S C;  3VUW A;  4B0E A;  3AE4 B;  3DBL B;  4H2A A;  2ASQ A;  4IWQ A;  4JL9 A;  4EOY A;  2FCS A;  4ASW C;  2FBW B;  4KGR A;  2V1Y A;  4OVU A;  1E9M A;  3K9O B;  1ZDV A;  2C5L C;  2X38 A;  2NPT A;  3S2A A;  2PLP A;  1OFF A;  1HTO A;  2DZK A;  2KTF A;  3L54 A;  3MHS D;  3MC9 A;  3B9J A;  1WX9 A;  4LLG M;  4UDU C;  3OWE B;  2IND C;  2BYV E;  2Z8L A;  3EFC A;  1ZUD 2;  2QEJ C;  5J17 A;  4IKG A;  3QHT A;  3BVZ A;  4QAY A;  1CJE A;  4FJZ A;  5AUK A;  4URK A;  4HVB A;  1TS2 A;  2L76 A;  1C4A A;  5G55 A;  1UUP A;  1J7A A;  4KKI A;  5IOI A;  3ZW3 A;  2WXF A;  4GDL B;  3WA0 A;  1R7S A;  1D3Z A;  1PUT A;  1RLF A;  2I38 A;  5AZH A;  1N60 A;  2CS4 A;  4EZJ A;  4GXB A;  1BML C;  2V4I B;  4WWN A;  4DXF A;  4IDI A;  1UEL A;  3EGR A;  4I6N B;  2O6V D;  1E8Y A;  5CX3 A;  1GJZ A;  1WIA A;  2JZP A;  4ZHP A;  5LXH A;  3ZJV A;  2I2Y A;  2Y5P A;  3HM3 A;  2SEB D;  4K81 A;  4LJO B;  2CKH B;  3TSS A;  5D7G A;  1VZ8 A;  4ANV A;  2KXJ A;  5EE1 A;  3JVZ X;  2WXG A;  2L52 A;  3RD2 A;  3ZQ4 A;  3PSE B;  2EEL A;  2BB6 A;  2PKO A;  5DPW A;  2B76 B;  5TR5 A;  1VD2 A;  4EKU A;  3V60 A;  2AQ2 B;  3V6E B;  1XLQ A;  1QOF A;  4N59 A;  1D5M C;  3BWU D;  3VVW B;  1SBB B;  1J0G A;  1Q0W B;  2KAJ A;  3DBL I;  4KZ0 A;  1EUV B;  3V3X A;  2Z0D B;  4MGZ E;  3ZRF A;  3TEX A;  5DPT A;  2KOX A;  5FK9 C;  1E90 A;  1MPE A;  3RUI B;  3P1M A;  4XWW A;  4YXD B;  1WGH A;  1E8Z A;  3OJ3 A;  4LDT B;  4ZRJ A;  2OED A;  2KWV B;  4C56 C;  2V4L A;  3NZ3 A;  4ARC A;  1DOX A;  3DBS A;  2MRP A;  2J42 A;  2K8C A;  3WIM A;  1TS5 A;  3LYY A;  3IFW B;  2Y5C A;  2IY1 B;  2HJ8 A;  4P16 A;  2CU1 A;  3T3O A;  2QMT A;  3BK1 A;  2D10 A;  1P9D U;  3PLV A;  1SIJ A;  4TQ1 A;  1YN5 A;  1D5Z C;  1OQY A;  4A55 A;  4DK5 A;  5EE9 A;  3GP7 A;  2LZ6 A;  2QIE B;  2WU2 B;  3ENE A;  4C80 A;  2GMI C;  1Y56 A;  4JWU C;  1ZKH A;  4GSW A;  4RF1 A;  4GDK B;  2KC2 A;  4HKQ A;  5E6O A;  4C7Y A;  2Y3A A;  2LGY A;  1AN8 A;  4WWM A;  4XDC A;  2INN E;  5E6N A;  5DPS A;  4M0W A;  3X0W A;  4LNF A;  3BYT B;  1BXT A;  2AQ1 B;  1E7P B;  4JX1 C;  1JW9 D;  3QAQ A;  1LO5 D;  1ZPS A;  2AL6 A;  3DDC B;  4W9J A;  1LFD A;  4CHK A;  3H7P B;  1KLG D;  2BBC A;  2KQ4 X;  3AEC B;  3ZTD A;  4CYE A;  1TYG B;  3Q8A A;  2BWF A;  2KC1 A;  1V49 A;  1WGG A;  1LGR A;  2PW9 A;  2J0K A;  4IM3 A;  1CZP A;  2JSV X;  5HHD G;  3ZGZ A;  1MFW A;  4WAF A;  1E10 A;  1WXM A;  1HE8 A;  4XWT A;  1JRP A;  4GLS C;  3P4R B;  3EUB 2;  5JXV A;  3AV8 A;  3BYY B;  3VRA B;  5JH5 C;  2L83 A;  4BKS A;  1FD6 A;  4FN2 A;  2JPH A;  2OHF A;  2CHZ A;  4KGS A;  2HJ1 A;  3AMZ A;  3Q3M C;  4GB9 A;  3TEY A;  2LUM A;  3NOB A;  2NBW B;  3IAS 1;  4HXD A;  1F9J A;  4ZOH C;  4OZC A;  1TTN A;  2M56 B;  2LVP A;  2KJH B;  4B95 A;  1SIF A;  2EKI A;  4S17 A;  3NVW A;  1XXG A;  1I35 A;  2KAC A;  3A9J B;  1WJ6 A;  3KW5 B;  4P1B C;  3UIO B;  1WI0 A;  4US8 A;  1C3T A;  4NQK E;  1TZO A;  2LEK A;  1V1P A;  2MW5 A;  2L1A A;  2MWS B;  2K1F A;  2BYF A;  3N20 C;  1WMH A;  4MM3 A;  1FXT B;  1WJN A;  3GE3 C;  3AH7 A;  1FFV A;  1GOZ A;  3QAR A;  4GU2 A;  3ZJT A;  5BO4 B;  3SDL C;  2DBY A;  4X57 B;  2G4D B;  1WZ3 A;  2WXH A;  3ZKJ C;  2QDF A;  1YQ4 B;  1ZE3 D;  4DWF A;  1YMH E;  2O2V A;  1WYG A;  2KDM A;  2I1J A;  1XT9 B;  1C1Y B;  2D5G A;  3B0A A;  3KUD B;  4WQM A;  2ZCC A;  3V62 A;  1V5O A;  3Q69 A;  2KN5 A;  4W9L A;  1AWD A;  2DZI A;  3M62 B;  5FR6 A;  1SE4 A;  1RFA A;  1N61 A;  4LK0 M;  1ENF A;  1R4M B;  1SE9 A;  1A5R A;  1ZXH A;  3GS2 A;  5HKH A;  2FUG 1;  2IY0 B;  3BY4 B;  3ZXR A;  2ZNV C;  2GBN A;  4YL8 A;  2UU7 A;  2KVZ A;  4EZK A;  4EUT A;  4XGA B;  4G11 A;  4R3D A;  1IBX B;  2WX0 A;  2JF5 A;  2NS5 A;  2PVG C;  3NS8 A;  1XF5 L;  2YEP F;  2WXQ A;  1C9F A;  4HRO A;  3U52 E;  4IWO A;  1KLV A;  3QC8 B;  4ACF A;  2RDH A;  3SD5 A;  4EFO A;  2G9H D;  2BQQ A;  1FXI A;  3PGE A;  5E6P A;  2KO3 A;  3OG5 A;  1C78 A;  2DNF A;  5LLI A;  2ZEQ A;  4EZL A;  1FNU A;  2KVR A;  2WGS A;  3AI5 A;  4BOS C;  1F0Z A;  2D07 B;  1IGC A;  3GZN B;  1V6E A;  2HTH A;  3PZD A;  2X8X X;  2C60 A;  3W2D A;  4JQW C;  4HCN B;  3L0W B;  1J7B A;  2KMA A;  4LJP B;  1ZXI A;  4HEA 1;  1FMA D;  4B6W A;  3Q3F A;  1L4D B;  1UF0 A;  2E3T A;  5FR3 A;  2K3U A;  2UWQ A;  1TIF A;  1PGX A;  2NTS A;  3AE1 B;  1IP9 A;  3DBH I;  2W55 A;  1P7E A;  1XLP A;  1JAL A;  1UNS A;  4IUM B;  3DHH C;  1TKG A;  4DHZ B;  4AP4 C;  4ARI A;  1YJ1 A;  4P6V F;  1L7Y A;  2MHJ A;  2OOB B;  3DVN U;  2WP9 B;  3M95 A;  1TGZ B;  1E7V A;  4RGM A;  1I42 A;  1R4M I;  2EMS A;  4OZB A;  4KSL C;  2V3S A;  3RFZ B;  3BII D;  2D3B A;  4O1N A;  3PTF C;  1QOB A;  1HZ6 A;  2G45 B;  5E6J A;  4NY0 A;  3AU5 A;  4LTU A;  2JU6 X;  3ONS A;  4HJK A;  4PT5 A;  3NZS A;  2WLB A;  1UD7 A;  1JWS D;  1XD3 B;  1GC7 A;  4M01 A;  3R7R A;  3IT6 B;  4WJP A;  2KAN A;  2RMM A;  4AQ7 A;  4W9K A;  2WNM A;  2K8B A;  4PK1 A;  4FLH A;  4AJW A;  3TJP A;  4ANU A;  1PDX A;  4LNI A;  1V1O A;  1NEK B;  4K7U A;  3AM9 A;  3W1Y A;  4MSQ B;  3VRB B;  3N32 A;  3ZXV A;  3HM6 X;  1RFK A;  1VR9 A;  2L0T A;  3LDZ E;  4DXG A;  2A4Z A;  3PVL A;  1NEN B;  3H6N A;  3HHM A;  1GUA B;  3WCQ A;  4PS7 A;  2MBB B;  1STE A;  2K9X A;  2IGH A;  3U7Z A;  3KYD D;  4W9F A;  1WWT A;  1YJI A;  1K51 A;  1FPY A;  2M4N A;  4YSY B;  1JRO A;  4ANW A;  4B0M A;  4JPS A;  3PS6 A;  2LGX A;  3SU8 X;  4ICU A;  1OQR A;  2AL3 A;  3KVF B;  2N7J A;  1GB1 A;  2MH7 A;  2Z59 B;  1IPG A;  1CMX B;  3W9C B;  3Q8E A;  1SF0 A;  2JRI B;  2NMQ A;  1I4X A;  3AE9 B;  3DVN V;  2M8S A;  2VZK B;  3FKY A;  2LRW A;  5BYQ A;  3TMP B;  3U8Z A;  2LGD A;  2C9W B;  3L08 A;  2L7R A;  4AOF A;  2PPH A;  2INP E;  4WJQ A;  3ZNZ B;  3N9Y C;  3ZLZ A;  3WAO A;  2QIL A;  4G0N B;  2JUO A;  4JLC A;  3Q3N C;  1SJE D;  1T5X D;  2LJI A;  3Q8B A;  5BMG A;  1F1H A;  3VH4 B;  3I57 A;  3IXS A;  2MBO A;  3ZDM C;  3Q14 C;  2LFI A;  3TUO A;  3PHW B;  4IG7 B;  3I3T B;  5IP4 D;  2KFJ A;  4M02 A;  1YX5 B;  5EDS A;  2A5U A;  1HXY D;  3ECI A;  1NI2 A;  1WJU A;  3DBR B;  3HRD D;  1LXD A;  1KTK A;  4HDO A;  3LJ3 A;  2CHX A;  1Q10 A;  2JQR B;  4DBG A;  2KWC A;  1M94 A;  4HPM B;  4Q2J A;  2LVO A;  2PVO D;  3R2T A;  1WGR A;  2W9N A;  1DYQ A;  2K8H A;  2BGF A;  1P7F A;  5JHA A;  5C23 A;  1A70 A;  3PV1 A;  4HKZ E;  2KX0 A;  3R7Q A;  3VXW A;  5I4D A;  3X23 A;  2BPS A;  4I6L B;  1H8C A;  3CST A;  2RDG A;  3MJ5 A;  4WAA A;  3TEW A;  4MAC A;  2WDT B;  3R2I A;  4KV2 A;  1P1A A;  4NJ6 A;  2TSS A;  2BYT A;  4BZA A;  4BBN C;  1L0Y B;  2HDE A;  4MGY E;  5D3D A;  2DZM A;  3PRM B;  1KRH A;  2G4S A;  1UBI A;  4J3O D;  4XZ4 A;  2GOW A;  3AE8 B;  3DHI C;  2N4F A;  2WYQ A;  4L2Y A;  2V0G A;  3WAN A;  3RCZ A;  3PHX B;  2GI9 A;  1SB3 C;  1YQB A;  4ANX A;  2PE9 A;  2M19 A;  2WXO A;  2MP2 A;  2ZPN A;  4M8N A;  2N9P C;  2FCQ A;  1L6U A;  1E5W A;  3BVM A;  2RDB C;  2ONQ A;  1F2R I;  4IM2 A;  1YJJ A;  3RNG C;  4DHJ D;  1K53 A;  2PIA A;  2N9X A;  4BOZ B;  4EEW A;  1P0R A;  3RYT A;  1MI0 A;  1EM7 A;  1AW7 A;  1YN4 A;  2WWZ A;  3ZIM A;  1I7H A;  2AWT A;  3NS1 A;  4CQN A;  2DYO A;  2N0S B;  2W3S A;  3DBR I;  2PE6 B;  1S3S G;  4A90 A;  1UH6 A;  3KUC B;  2MCN B;  1NVI D;  2LGI A;  1ZW7 A;  2D3A A;  3ZNH B;  3UGB B;  1RWS A;  1N5X A;  4BKS D;  3E56 A;  1UZX B;  3NZU A;  2G1E A;  4GOC A;  3AU4 A;  2KK8 A;  3VTV A;  2XBB C;  4RGO S;  2XEW A;  3W5V B;  1ZGU B;  1RM6 C;  3MJW A;  4MGK E;  2YLM A;  3P4S B;  4M00 A;  4FXC A;  2Z0E B;  4B9K A;  4W9I A;  5D94 A;  4LNO A;  1I4H A;  4FBJ B;  4REZ A;  2KLG A;  4YTN B;  4BVU C;  2BKR B;  5DPR A;  1WGY A;  1SJH D;  2O6V B;  2WXP A;  4MGI E;  2J0J A;  3RMK C;  3Q6B A;  2CJO A;  4RH6 A;  3R8B A;  4ZRI A;  4PYU A;  5T8I A;  4MSM B;  5D2M B;  2K6D B;  2FCM A;  1GNU A;  3C8Y A;  2FID A;  1C4C A;  3UIP B;  3URY A;  3MP9 A;  3ZRC A;  3RPF C;  3MC0 B;  5AUI A;  2DZJ A;  3TBL D;  4M0W B;  4FUL A;  4HRS A;  2LVQ A;  2UYZ B;  2I1K A;  1EWY C;  2IDY A;  4GGQ A;  1V2Y A;  3IHP C;  3N1X C;  2SAK A;  4NQL B;  4YTP B;  1YNT E;  2GBM A;  5IA7 A;  1VZ7 A;  3IG3 A;  1XLO A;  3DVG X;  4K7W A;  2N1W A;  1B9R A;  2V9H A;  4ZRQ A;  4WJO A;  4W9C A;  3UF8 A;  3AE6 B;  1ACC A;  1L0X B;  2JXX A;  3NVZ A;  4NAM A;  3PRP B;  3JSV A;  3D32 A;  1FRD A;  1QT9 A;  2C7N B;  1HQR D;  3P4Q B;  3L4P A;  4RM8 A;  2ZZP B;  4AJY B;  3DPD A;  2IGG A;  2KKC A;  2Y5B B;  1TKE A;  1QOG A;  2NCN A;  4RMA A;  4NJC A;  1YX6 B;  4GMV A;  4DQO C;  2ICI A;  2WXJ A;  2D2Q A;  3U7D A;  1V97 A;  3H7S A;  4TKN A;  1ET9 A;  3APD A;  3LB8 C;  4ZYS A;  1WY8 A;  3HVZ A;  1D6E C;  1C79 A;  3W5U B;  4P1C C;  3DBH B;  1JQ4 A;  2PEA A;  2KWD A;  4TMA B;  1Q1O A;  2WX1 A;  2GRI A;  1FEH A;  2W3R A;  3AE2 B;  3CWI A;  3M3J A;  3B1L X;  4LNK A;  1YN3 A;  3R66 C;  1KM7 A;  1RYJ A;  1I4Q A;  4XDD A;  1UBQ A;  1I4G A;  1HEZ E;  2NR2 A;  1PYW D;  3KQ4 A;  4JWS C;  1L5P A;  4HDQ A;  3TCA A;  1V1P B;  2QC8 A;  3L13 A;  2ZCB A;  5BMH A;  3NRZ A;  1LM8 B;  2GLS A;  2MBQ A;  4NZL B;  1F52 A;  2JWU A;  4KDI C;  3CSF A;  4W9D A;  4EE2 A;  2BB5 A;  2XNA C;  3QA8 A;  3AEG B;  3L17 A;  2RPV A;  3RT3 B;  5GXG B;  3P42 A;  3UQA A;  2XK5 B;  1WSP A;  2M0X A;  4A9A A;  3N1Y C;  1B1Z A;  4I6P A;  4DDI D;  2CU3 A;  3GB1 A;  4XE0 A;  5HG2 A;  4RM9 A;  5DCN A;  4RCO A;  1KLU D;  1WM2 A;  4ZDV A;  4MEM A;  2KTR B;  1GC6 A;  3L10 B;  3AB5 A;  4W9G A;  3P2B A;  1OGW A;  4L1B A;  2GB1 A;  4D2K A;  4HLE A;  3PRZ A;  1N62 A;  1WXV A;  3U30 A;  2BS4 B;  4L23 A;  2WDQ B;  1JWM D;  1YIW A;  4K1R B;  3AE3 B;  2KDE B; 
#chains in the Genus database with same CATH homology
 3A9K A;  2NBV B;  3A4S C;  4ANW A;  3PS6 A;  2LGX A;  3PT2 B;  3SU8 X;  4ICU A;  3VTW A;  3VVW B;  1RRB A;  2N9E B;  4ICV A;  1J0G A;  1Q0W B;  2AL3 A;  2LRU A;  4KDL B;  5IAA C;  3DBL I;  3KVF B;  3VUY A;  2Z59 B;  3OLM D;  4KZ0 A;  1IPG A;  1EUV B;  1CMX B;  2Z0D B;  4DHJ B;  3ZUN A;  4MGZ E;  2JRI B;  3ALB A;  3N3K B;  4HPL B;  3ZRF A;  5DPT A;  2KOX A;  2IO1 B;  1E90 A;  4IWP A;  3RUI B;  3DVN V;  2M8S A;  1WGH A;  3ZTC A;  2LRW A;  4E3C A;  3TMP B;  1E8Z A;  3OJ3 A;  4LDT B;  2LGD A;  4ZRJ A;  2KWV B;  3U8Z A;  2C9W B;  2V4L A;  3L08 A;  2L7R A;  4HWI B;  4PS8 A;  2IZV B;  2JZ3 B;  4J6I A;  2BYE A;  1P3Q U;  3M63 B;  2JY6 A;  4AOF A;  1P98 A;  2JVC A;  2LUE A;  4NPN A;  3APF A;  2PPH A;  3DQV A;  3DBS A;  4MH0 E;  4WJQ A;  3ZNZ B;  3IVF A;  2KFK B;  2MRP A;  2OJR A;  1WFY A;  3B08 A;  3VHT C;  3WAO A;  3ZLZ A;  4F8C B;  3WIM A;  2K8C A;  4JIO U;  4G0N B;  4OVV A;  3BIN A;  2DX5 B;  2JUO A;  4IC7 B;  4ZYN A;  1J8C A;  3IFW B;  3PPA A;  3O65 B;  2JRH A;  4JLC A;  2IY1 B;  2HJ8 A;  2D3G A;  2CU1 A;  3ML8 A;  2AYO B;  3VH4 B;  2D10 A;  2MBO A;  3ZDM C;  5JZE B;  1P9D U;  1WR6 E;  3PLV A;  3QX1 A;  4TQ1 A;  5C1Z A;  1OQY A;  3PHW B;  2GBJ A;  4IG7 B;  4DK5 A;  1WE6 A;  3I3T B;  1U4A A;  1T0Y A;  2LZ6 A;  3VH3 B;  3ENE A;  2KFJ A;  1WZ0 A;  2GMI C;  1YX5 B;  5EDS A;  1ZKH A;  2JWZ A;  4GSW A;  2A5U A;  4GIV A;  4GDK B;  1RAX A;  1WYW B;  1S1Q B;  2KC2 A;  1UGM A;  4KZC A;  3JSV B;  3ECI A;  5E6O A;  1NI2 A;  1WJU A;  2JZZ A;  2N7D A;  4E74 A;  4FHK A;  3APC A;  1LXD A;  3L16 A;  2K25 A;  2N7E A;  2XK5 A;  5JHB A;  2YVC A;  2HD5 B;  4HDO A;  3WAL A;  2LGY A;  3A33 B;  3LJ3 A;  4W9E A;  2K39 A;  3CMM B;  2CHX A;  4FHJ A;  1Y8R C;  4KIK B;  4JGH B;  1OTR B;  2FCN A;  5E6N A;  3RZF A;  4DBG A;  2KWC A;  1M94 A;  4HPM B;  4KSK C;  5J18 A;  5DPS A;  1WMH B;  3X0W A;  2LVO A;  2KTR A;  2CHW A;  1WGR A;  2FUH B;  2W9N A;  2K8H A;  5AEK B;  2L05 A;  4TQ0 A;  2BGF A;  2LXA A;  5JHA A;  2D11 A;  3TIX A;  5C23 A;  2FIF A;  3PV1 A;  1LQB A;  2KX0 A;  2EKE C;  1TZ1 A;  3VAW A;  3R7Q A;  2HE7 A;  3VXW A;  3X23 A;  2ZVN A;  2LWP A;  3QK0 A;  2BPS A;  4I6L B;  4BFR A;  1H8C A;  3QAQ A;  4G3X B;  2AL6 A;  3CST A;  3A1Q A;  3AUL A;  2O2V B;  3DDC B;  4NAW B;  4W9J A;  1LFD A;  4WAA A;  3QQ8 B;  4FJV B;  5D6J B;  3SHQ A;  2JT4 B;  3H7P B;  4CHK A;  1EF5 A;  2WDT B;  2KLC A;  5AZF A;  3ZTD A;  3NHE B;  4CYE A;  2KZR A;  4KV2 A;  1P1A A;  4NJ6 A;  2BWF A;  2KC1 A;  1V49 A;  1WGG A;  2B3A A;  2J0K A;  4PYZ A;  4IM3 A;  3ZDT A;  1XQQ A;  4BBN C;  2KD0 A;  1E8W A;  2MBH A;  4MGY E;  3KUZ A;  2KQS A;  4FAD A;  2DZM A;  4BBN F;  2DYB A;  4MJS B;  3PRM B;  4XZ4 A;  2G4S A;  1UBI A;  1WXM A;  4P7I A;  1HE8 A;  4HK2 A;  2GOW A;  2M1M A;  1NBF C;  2KFK A;  2IBI B;  1SGH A;  4MEL A;  4DDG D;  2N4F A;  2R2O A;  2WYQ A;  4TUU A;  2C7M B;  3WAN A;  4W9H A;  3PHX B;  4KVG B;  3RCZ A;  1YQB A;  5JH5 C;  4ANX A;  1WX7 A;  2LD9 A;  3H9D A;  2IO3 B;  2PE9 A;  4BKS A;  4FN2 A;  2VRR B;  2KNB A;  2MP2 A;  2JPH A;  2ZPN A;  2CHZ A;  2KHW B;  4M8N A;  4BKT A;  4II2 B;  2N9P C;  4GB9 A;  2FCQ A;  3NOB A;  3HIZ A;  2NBW B;  3V61 A;  1E5W A;  1L2N A;  4HXD A;  2KDB A;  3V6C B;  1F9J A;  3ML9 A;  1TTN A;  4IM2 A;  2LVP A;  2KJH B;  4DHJ D;  1V86 A;  4B95 A;  2MA9 B;  1WJ4 A;  2N9X A;  4BOZ B;  1SIF A;  4EEW A;  4GN1 A;  1P0R A;  1MG8 A;  2KX3 A;  3N30 A;  3RYT A;  2LAS A;  1I35 A;  2KDF B;  2M17 A;  2WWZ A;  4LDT D;  3ZIM A;  2AWT A;  3A9J B;  5GMV A;  2DYO A;  5G2N A;  1WJ6 A;  3KW5 B;  3DBR I;  2PE6 B;  2IO2 B;  1S3S G;  3HK0 A;  3UIO B;  1WI0 A;  3OAW A;  5L95 C;  1UH6 A;  3KUC B;  4KIK A;  2FAZ A;  2K6Q A;  4NQK E;  4II3 B;  3A9K B;  2MCN B;  3UQB A;  1C3T A;  1Q5W B;  2MLB A;  1EF1 A;  3VUX A;  1ZW7 A;  2CR5 A;  3ZNH B;  3UGB B;  3CF6 E;  2MWS B;  2MW5 A;  4GDL A;  2K1F A;  2BYF A;  2RGF A;  3W1S C;  1TBE A;  1WMH A;  4MM3 A;  1WXA A;  4BKS D;  1FXT B;  3DCG A;  1WJN A;  1UZX B;  3NZU A;  5L83 A;  4GU2 A;  3QAR A;  1H4R A;  3OJ4 B;  1E7U A;  2G3Q B;  3AU4 A;  1R4N I;  2KK8 A;  2GBR A;  4GOC A;  4MDK E;  3VQI A;  3VTV A;  5BO4 B;  3SDL C;  2L0F A;  2XBB C;  4X57 B;  2G4D B;  1WZ3 A;  1IYF A;  4NJ7 A;  2XEW A;  3ZKJ C;  3PLU A;  1OEY A;  2DAF A;  1ZGU B;  2GBK A;  3MJW A;  4MGK E;  1WRD B;  4DWF A;  2YLM A;  3RZW C;  2LXC A;  4NNJ B;  3H1U A;  2Z0E B;  5CHF A;  2O2V A;  4B9K A;  1JRU A;  4LCD E;  4IW0 A;  4W9I A;  2BKF A;  2I1J A;  4NAW A;  1XT9 B;  2EMT A;  1C1Y B;  3B0A A;  1WR1 A;  5D94 A;  3KUD B;  1ISN A;  2LJ5 A;  4DHZ E;  4ZRK A;  2ZCC A;  3V62 A;  1PQS A;  1V5O A;  3JW0 X;  2IO0 B;  2KWU B;  4FBJ B;  2ZNV B;  4A20 A;  3VTU A;  2BWE S;  4XC2 A;  2KN5 A;  4W9L A;  4WJN A;  1WGD A;  2DZI A;  3M62 B;  3QIJ A;  2KLG A;  5FR6 A;  4BVU C;  1RFA A;  2BKR B;  2MQJ A;  5CTR C;  5DPR A;  2NPT B;  5KHQ A;  1WGY A;  4F7Z A;  3AXC A;  4MJS A;  2R2Q A;  1SE9 A;  3KH0 A;  1A5R A;  2O6V B;  5HKH A;  1NDD A;  2PJH A;  2IY0 B;  3BY4 B;  4MGI E;  2J0J A;  2ZNV C;  2GBN A;  5LXI B;  4YL8 A;  4WWO A;  4AUQ C;  3K9P B;  3QJZ A;  3PRE A;  3QCA A;  1WH3 A;  2L00 B;  3ZNI D;  4ZRI A;  3T8M A;  4A3O A;  4EZK A;  4EUT A;  4G11 A;  4PYU A;  2ZVO A;  2WX0 A;  4MSM B;  5D2M B;  2K6D B;  2FCM A;  3QWZ B;  1GNU A;  2FID A;  2JF5 A;  2NS5 A;  2ZJD A;  3TL5 A;  3UIP B;  1Z5S B;  3NS8 A;  3ZRC A;  2DEN B;  3EHV A;  3EFU A;  1VCB A;  4WQO B;  4IWO A;  5J2R A;  1KLV A;  3QC8 B;  4M8M A;  4A3P A;  2FNJ B;  2DZJ A;  3TBL D;  1G6J A;  3SD5 A;  4EFO A;  3GZN I;  4M0W B;  1WE7 A;  4CO7 A;  4FUL A;  3PGE A;  3ZO5 B;  2KDI A;  2BF8 B;  1V5T A;  2AEH A;  2LVQ A;  5E6P A;  2KO3 A;  2UYZ B;  4FA6 A;  2I1K A;  2C7H A;  4GGQ A;  2NVU I;  1WXS A;  1V2Y A;  3NY5 A;  3W1S A;  2MSE D;  3IHP C;  4FJY A;  1OEY J;  4IM0 A;  5LLI A;  5KHO A;  2ZEQ A;  4NQL B;  4EZL A;  2GBM A;  5IA7 A;  2ZPY A;  1V9J A;  2KVR A;  3AI5 A;  3WAM A;  1WM3 A;  4BOS C;  3IG3 A;  3A1Q B;  5CHV C;  2D07 B;  2RPQ A;  3DVG X;  4K7W A;  1K8R B;  3Q3J A;  2N1W A;  1WF9 A;  1AAR A;  3T9L A;  1V6E A;  2HTH A;  3PZD A;  4WJO A;  4W9C A;  2RR9 A;  3UF8 A;  3ZNG C;  2RD0 A;  4E71 A;  4N9F 4;  2C60 A;  1EO6 A;  2L3Z A;  3VDZ A;  2JXX A;  4GDK A;  2KMC A;  2NBU A;  3PRP B;  4JQW C;  3JSV A;  3L0W B;  4HCN B;  3EC8 A;  3D32 A;  1J19 A;  2KMA A;  2KJR A;  4LJP B;  2C7N B;  3VFK A;  4G50 A;  4BKG A;  2IYD B;  4XX5 A;  4B6W A;  3Q3F A;  3ZVV A;  4RM8 A;  5AZG A;  3UIN B;  2ZZP B;  4AJY B;  3DPD A;  4DXA B;  2KKC A;  2UWQ A;  2Y5B B;  1WX8 A;  3C0R B;  3VUW A;  1IP9 A;  3DBH I;  2NCN A;  4K7S A;  3DOW A;  4RMA A;  1YX6 B;  2ASQ A;  4GMV A;  4IUM B;  4IWQ A;  4JL9 A;  4EOY A;  2FCS A;  4DHZ B;  2D2Q A;  3U7D A;  3H7S A;  4TKN A;  4AP4 C;  4ASW C;  3APD A;  2DYM A;  1YJ1 A;  2V1Y A;  2MP2 B;  1L7Y A;  4OVU A;  2OOB B;  3DVN U;  3K9O B;  3M95 A;  2C5L C;  1TGZ B;  1E7V A;  2NPT A;  1WY8 A;  3S2A A;  2DAJ A;  2DZK A;  2KTF A;  1V81 A;  2O6V A;  3L54 A;  5CHW A;  1R4M I;  1I42 A;  3MHS D;  3WAP A;  3R3M A;  2PEA A;  2EMS A;  1Q1O A;  2WX1 A;  1WX9 A;  3EEC A;  3H7P A;  4KSL C;  2V3S A;  2BYV E;  1KJT A;  3M3J A;  3B1L X;  3PTF C;  5J17 A;  3R66 C;  1YD8 U;  1KM7 A;  3QHT A;  2G45 B;  2QHO A;  4NY0 A;  3AU5 A;  4F1S A;  4FJZ A;  3ONS A;  4HJK A;  4URK A;  3NZS A;  4HVB A;  2L76 A;  1UBQ A;  1UD7 A;  2MX2 A;  1E8X A;  3IBE A;  2NR2 A;  1XD3 B;  5G55 A;  2KQ7 A;  4HDQ A;  3TCA A;  1GC7 A;  3ZW3 A;  4GDL B;  3L13 A;  2ZCB A;  4AWJ A;  3R7R A;  3WA0 A;  4WJP A;  1D3Z A;  2KAN A;  1RLF A;  1LM8 B;  2J0M A;  5AZH A;  1BT0 A;  2CS4 A;  2MBQ A;  4GXB A;  4W9K A;  4EZJ A;  4KDI C;  3CSF A;  2K8B A;  4FLH A;  4AJW A;  4WWN A;  4W9D A;  1UEL A;  3QA8 A;  4HCP B;  3TJP A;  2REX A;  3L17 A;  3RT3 B;  4I6N B;  2O6V D;  3UQA A;  2XK5 B;  1E8Y A;  2L8J A;  5CX3 A;  4ANU A;  1GJZ A;  2M0X A;  1QZE A;  4K7U A;  2LI5 A;  1WIA A;  2MBE A;  2RSU A;  2J7Q B;  4I6P A;  3A4R A;  4DDI D;  3W1Y A;  5LXH A;  1X1M A;  4MSQ B;  3HM3 A;  4PS3 A;  3MTN B;  4RM9 A;  5DCN A;  3N32 A;  1WM2 A;  1Z2M A;  4K81 A;  4LJO B;  4ZDV A;  2CKH B;  3HM6 X;  4MEM A;  2KTR B;  5D7G A;  1GC6 A;  3L10 B;  4ANV A;  4WWP A;  2KXJ A;  2L0T A;  3LDZ E;  2A4Z A;  3JVZ X;  4TV3 A;  3PVL A;  3GOE A;  3P2B A;  4W9G A;  1OGW A;  1V80 A;  3H6N A;  3HHM A;  3RD2 A;  3PSE B;  1GUA B;  1KOT A;  4HLE A;  4PS7 A;  3A9J A;  5DPW A;  1GG3 A;  2MBB B;  3JYU A;  3PRZ A;  5TR5 A;  1VD2 A;  1WXV A;  3U30 A;  2KJ6 A;  2DHZ A;  3DVG Y;  3V60 A;  4EKU A;  3RUL A;  3KYD D;  4W9F A;  2N1V A;  3V6E B;  3KYC D;  1YIW A;  4K1R B;  2M4N A;  2KDE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...