3PSEB

Structure of a viral otu domain protease bound to interferon-stimulated gene 15 (isg15)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
150
Chain Sequence
DLTVKMLAGNEFQVSLMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKSDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
total genus 35
structure length 150
sequence length 153
ec nomenclature
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pseB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pseB01
1C3TA 2N9XA 3VAWA 4TV3A 4BOSC 2MX2A 3BY4B 1CMXB 1LFDA 4EKUA 1WH3A 4BKGA 4E71A 4HLEA 4FBJB 4KVGB 4II2B 2DYBA 3QX1A 3WALA 4ANVA 1J8CA 1ZGUB 1WXSA 2HJ8A 5D94A 2JZZA 3APFA 2L8JA 1V5TA 2W9NA 1S1QB 2FCMA 3A1QB 3L0WB 4DK5A 1UD7A 3SDLC 2KHWB 2KC2A 3X23A 4RM8A 2KXJA 2MW5A 3NY5A 2KDIA 4GIVA 1F9JA 3OAWA 4BKSD 1J0GA 3NOBA 2DYMA 3JW0X 2BWES 2R2OA 3PVLA 1YQBA 2D2QA 2HTHA 3CSFA 2AEHA 3UGBB 3PRZA 2YVCA 1AARA 1A5RA 2N9PC 4MSQB 1Z5SB 4EUTA 3OJ4B 1GC7A 2D3GA 3M3JA 3ZKJC 2KD0A 2NPTB 4F1SA 2KFKA 5DCNA 5LXIB 2V1YA 2PPHA 4A3OA 3ZO5B 1RLFA 3P2BA 1WXAA 2M4NA 1I35A 4GDLA 2KK8A 2KMAA 4ASWC 4A20A 2DAJA 5D7GA 2GMIC 2IY0B 1NBFC 4NJ7A 2KZRA 2AL6A 1RAXA 4ZRKA 4LDTB 5KHQA 1OTRB 2FCNA 2HE7A 3QHTA 1E7UA 2Y5BB 3UIOB 2KJ6A 1ZKHA 2KVRA 1OEYA 3CSTA 3IBEA 2IY1B 4KV2A 2KC1A 4ANUA 1UBQA 2M17A 1WJNA 4G0NB 5AZGA 3R7QA 2V4LA 2Z0EB 4ICVA 2IZVB 4J6IA 4RM9A 1WXMA 4W9LA 4W9HA 5EDSA 2K6DB 3RUIB 3UIPB 4MDKE 4W9KA 1T0YA 1WR1A 2G4DB 4K81A 4ZYNA 2KFJA 3IG3A 3QJZA 4GGQA 4DHJB 1MG8A 1WGGA 1LQBA 4G11A 1YX6B 2C7MB 1GG3A 2FCQA 1WFYA 2RR9A 4MH0E 2ZVOA 4OVVA 5J17A 1WX9A 2MWSB 3EECA 3RD2A 3WANA 3V6EB 2JUOA 2XEWA 3TCAA 2J0MA 3WIMA 3A1QA 3ZNID 1GUAB 3RCZA 2KX3A 5L95C 5IA7A 2R2QA 3KVFB 2CHWA 2RSUA 2XK5A 5G55A 4KDIC 2A4ZA 4MSMB 2KO3A 3QK0A 4IWOA 1TZ1A 2ASQA 3AXCA 3DVGX 3ENEA 2D10A 4JIOU 2LVPA 4TQ1A 1ZW7A 2BPSA 2L00B 3HHMA 3VFKA 1LM8B 2GBJA 2RPQA 2LWPA 1JRUA 3AU4A 4JL9A 1IP9A 4OVUA 5C1ZA 4XZ4A 1RRBA 2N1WA 1UH6A 2NCNA 4GDLB 1L7YA 4HDOA 3IFWB 2KWCA 3W1YA 4GMVA 2N4FA 2C7NB 4KIKA 4MJSA 3VHTC 3KUCB 4W9JA 4XX5A 2D11A 2ZNVC 4X57B 4IC7B 4YL8A 4WWNA 4KDLB 1BT0A 4G50A 4KSLC 1WJUA 2ZEQA 3TBLD 1IYFA 2MQJA 3H7PA 3PT2B 3CF6E 1Z2MA 3C0RB 2GBMA 2NS5A 3QCAA 1WY8A 2ZPNA 3PRPB 2FNJB 2V3SA 2K1FA 4FJVB 3L10B 2LI5A 4HK2A 2QHOA 4FULA 2DX5B 4DHZE 3V6CB 3VUXA 4ANXA 1QZEA 4FADA 3H9DA 3R3MA 1E8XA 3B1LX 4B6WA 4I6LB 3TIXA 3ECIA 3NZUA 2G45B 2MA9B 2VRRB 5L83A 1G6JA 1KJTA 2BF8B 1TBEA 2L0FA 3W1SC 3TL5A 5CHVC 2C9WB 2KQSA 2ZJDA 1WYWB 4ICUA 4NJ6A 4E3CA 4B95A 4NPNA 2LRWA 4HDQA 3V62A 2REXA 2UYZB 1WE7A 1V86A 1Y8RC 1J19A 2MBEA 4RMAA 1WRDB 3WAPA 4FLHA 3DBHI 4EEWA 3DVNU 2XK5B 3Q3JA 4ZDVA 2ZCCA 1IPGA 4WWOA 3RYTA 4HCNB 2N7EA 3KW5B 4DWFA 2YLMA 3U30A 4FHKA 4GDKA 3L54A 3ZDMC 2FCSA 3M95A 4AUQC 1EUVB 4W9DA 2MSED 5LLIA 2IO1B 5FR6A 2JPHA 2MRPA 3ZUNA 3APDA 3SHQA 1OQYA 2G4SA 2FUHB 4CYEA 4W9IA 2K8CA 4KIKB 4MJSB 3V61A 2KN5A 3A4RA 2C5LC 2CS4A 2MP2A 2BYVE 1WGRA 4GSWA 2KMCA 5JH5C 1D3ZA 3ML8A 3M63B 3UF8A 3H6NA 3RZFA 4M0WB 1UGMA 4KZ0A 4EZKA 2WX1A 1VCBA 3H7PB 2Z0DB 3NHEB 4N9F4 2KTRA 4WJOA 2LXAA 3X0WA 2DZMA 1UZXB 2KTFA 2PJHA 2LJ5A 5CX3A 3PS6A 5AEKB 3T9LA 2BYEA 3A9KA 4GU2A 2JZ3B 2N9EB 4BKSA 2JF5A 2IBIB 3HM6X 2CR5A 4PS3A 5CHFA 3QAQA 1WJ6A 4PS8A 3R7RA 4A3PA 2KDEB 4PYZA 5D2MB 3ZDTA 4JLCA 3VQIA 1WM2A 4EOYA 4XC2A 4NQLB 1UELA 4FA6A 4BFRA 2XBBC 1P3QU 1PQSA 4ANWA 3VUWA 2FIFA 5TR5A 2N7DA 1FXTB 3TMPB 2MBHA 4WJQA 1TTNA 1ISNA 4BOZB 2GBKA 3UQBA 3IHPC 2DENB 3D32A 3VDZA 4WAAA 1WF9A 3L16A 3I3TB 4BBNC 3ZRCA 2CKHB 5LXHA 3DQVA 1WGHA 2O6VA 2M8SA 4GB9A 4JQWC 3ZVVA 3VTWA 1C1YB 2JWZA 2JRHA 2KJHB 4GDKB 1E8ZA 1P98A 1V5OA 2I1JA 1YX5B 3JYUA 1XT9B 2J7QB 4LCDE 2G3QB 2WDTB 2KX0A 1GNUA 3PV1A 1H8CA 5J2RA 4AJWA 1P0RA 2D07B 3U8ZA 1GC6A 1EF5A 2NR2A 1RFAA 3VVWB 4LDTD 5GMVA 5HKHA 2LVQA 5DPRA 3ZNZB 4IM0A 1UBIA 4I6PA 4I6NB 2CHZA 3DBSA 4K7UA 4M8MA 4MGKE 2K8HA 2MP2B 4GXBA 4URKA 3VH4B 1TGZB 2K25A 2LASA 2PE6B 3UQAA 1WMHA 1WM3A 2DZKA 2KANA 4CHKA 4IM2A 1V81A 2ZPYA 3PHXB 2JRIB 4DHJD 2L0TA 2KTRB 2KLGA 2KQ7A 2HD5B 4TKNA 3VTUA 3KYDD 3L17A 3ZW3A 2AYOB 1NI2A 3K9OB 2JY6A 2O2VA 3A9KB 3PSEB 3DBRI 2KLCA 3PGEA 3IVFA 3RT3B 3TJPA 2WWZA 1U4AA 3ZLZA 2JXXA 1GJZA 1WR6E 4HPMB 3AULA 4B9KA 3GZNI 3OJ3A 4WWPA 2MBOA 2GBRA 3L08A 3APCA 2RD0A 3Q3FA 4W9EA 1E90A 2ZCBA 4IW0A 4WJNA 1WXVA 3ALBA 4F7ZA 1P9DU 5C23A 1H4RA 4EFOA 1WGDA 4HVBA 3JSVB 4JGHB 3VUYA 1OEYJ 3KUZA 3JVZX 3MHSD 3PHWB 3O65B 3U7DA 3HK0A 2KDBA 2M0XA 3LJ3A 2NBWB 3UINB 1E5WA 3L13A 2O6VB 2KDFB 2NBVB 5AZHA 2CHXA 2BGFA 3VH3B 4FJZA 1WZ0A 1V6EA 2L05A 4TUUA 4W9CA 1Q5WB 2BKFA 5IAAC 4G3XB 1E8WA 2ZVNA 4DBGA 1V9JA 3WAOA 4NAWA 3DCGA 4KZCA 3ZTCA 3CMMB 2J0KA 1EO6A 1S3SG 3A33B 2K8BA 4NY0A 4AJYB 4CO7A 4WJPA 4AP4C 4II3B 2UWQA 4DXAB 3EC8A 4LJOB 2LRUA 3GOEA 1WMHB 5JZEB 2BWFA 3N3KB 2ZNVB 4MELA 5AZFA 3SD5A 4NQKE 3QA8A 3MJWA 1HE8A 3DPDA 4IG7B 4F8CB 3DOWA 3RULA 4BKTA 4K7WA 2DAFA 3BINA 1I42A 1WE6A 3MTNB 2O2VB 2L7RA 2RGFA 2WX0A 4E74A 1YJ1A 1YD8U 2OOBB 3AU5A 3DBLI 2K39A 2N1VA 4WQOB 1WIAA 2MCNB 2MLBA 3KH0A 1WZ3A 2EKEC 2LGXA 4P7IA 1WX8A 2BKRB 1XD3B 3PZDA 4MM3A 3HM3A 3PRMB 4FJYA 4IWQA 2EMSA 2O6VD 3H1UA 1LXDA 5D6JB 2MBBB 4HPLB 3AI5A 1L2NA 4ZRIA 2C60A 2L76A 2LD9A 4HJKA 1WX7A 1OGWA 3PLUA 2ZZPB 3HIZA 1KM7A 1R4MI 1WGYA 3ML9A 3JSVA 3KUDB 4AOFA 3H7SA 5J18A 2JT4B 2GBNA 1WJ4A 3A9JA 1V80A 3A4SC 4DDID 4PYUA 4W9FA 3V60A 4AWJA 1YIWA 2LUEA 1EF1A 3ZTDA 4TQ0A 2AL3A 3QQ8B 3M62B 2M1MA 3WAMA 3DVGY 3N32A 2DYOA 4NAWB 2PEAA 4NNJB 2DZJA 4BVUC 1R4NI 2BYFA 4MGZE 3QWZB 5E6OA 4GOCA 1SGHA 1WI0A 2LGDA 2IO2B 3NS8A 2DZIA 2EMTA 3ZNGC 3EFUA 3QC8B 4HXDA 4MGIE 2LGYA 3VXWA 4FN2A 5E6PA 4BBNF 3QIJA 3QARA 4K7SA 3SU8X 4EZJA 3LDZE 4HCPB 3PLVA 2IO3B 3ZIMA 5JHAA 2FAZA 2K6QA 3B08A 2KKCA 1Q1OA 3PPAA 2JVCA 1P1AA 1Q0WB 4KSKC 3EHVA 2KNBA 2LZ6A 2A5UA 4W9GA 5DPWA 2KFKB 3T8MA 5JHBA 1XQQA 5G2NA 4HWIB 4MGYE 2NPTA 2LVOA 2GOWA 4IM3A 3R66C 5KHOA 1K8RB 2C7HA 2DHZA 2KOXA 2PE9A 4GN1A 2NVUI 2J0JA 3KYCD 4IUMB 4M8NA 4MEMA 5CTRC 1X1MA 4ZRJA 3S2AA 2KWUB 3N30A 1V2YA 4PS7A 3RZWC 2AWTA 3DDCB 3NZSA 4FHJA 2OJRA 5BO4B 4LJPB 2IO0B 3PTFC 3WA0A 5CHWA 3DVNV 3K9PB 2KWVB 4IWPA 1SE9A 3W1SA 1VD2A 2IYDB 4EZLA 5E6NA 1KLVA 2L3ZA 1V49A 2Z59B 3ONSA 5DPSA 4DDGD 2FIDA 1SIFA 2WYQA 2B3AA 3B0AA 5DPTA 2LXCA 1NDDA 2I1KA 4DHZB 1E8YA 1KOTA 3VTVA 3OLMD 3ZRFA 2NBUA 2KJRA 3A9JB 1E7VA 2CU1A 2MBQA 4K1RB 3ZNHB 1M94A 3PREA
chains in the Genus database with same CATH superfamily
2MX2A 3BY4B 1WH3A 4ZHOA 2DYBA 4ANVA 4A55A 3A1QB 4YTMB 3DHHC 4DK5A 2MH7A 4GIVA 3PZ8A 1J0GA 1YOVB 2VH1A 2JYTA 3JW0X 3HRDD 2R2OA 2D2QA 3BK2A 3CSFA 1I4HA 3UGBB 1AARA 1YN3A 3TEYA 4EUTA 3OJ4B 3P1MA 3ZKJC 3N1XC 2NPTB 5DCNA 4XWTA 1WWTA 2L83A 4US8A 4GDLA 2KK8A 3HVDA 4NJ7A 1RAXA 2X8XX 3FAHA 4LDTB 1NEKB 1Y56A 2HE7A 1E7UA 2WXMA 2Y5BB 3IT4B 1FCLA 1UWMA 3CSTA 1OEYA 2I38A 1PDXA 5AZGA 1N5XA 2V4LA 4J6IA 2WXLA 2K6DB 5G5HA 1T0YA 4K81A 4ZYNA 3IG3A 1WGGA 1YX6B 1PUTA 4MH0E 5J17A 2JUOA 1DOXA 4DXGA 3A1QA 3RCZA 5BYQA 1ZOYB 2EELA 2K0PA 2R2QA 1FXIA 5G55A 4KDIC 4USAA 3ENEA 1SXTA 2D10A 4ARCA 2ZW1A 3VFKA 3WCQA 4YWGG 1JRUA 4N6EB 4XYCA 5C1ZA 1B1ZA 1NVID 1ZE3D 1UH6A 4PK1A 1L7YA 1HA5A 3W1YA 2KWCA 4GMVA 3U7ZA 4MJSA 4KIKA 1JWBD 2D11A 4KGSA 4IC7B 5EE0A 1WJUA 2ZEQA 3BVMA 2MQJA 2GBMA 3RN9C 3L10B 1E8XA 3B1LX 2PVOD 5HFYA 3T3NA 2VRRB 1G6JA 2KDMA 1PGBA 3TL5A 2C9WB 2KQSA 2ZJDA 4NJ6A 1N62A 2REXA 1GAQB 5FKAC 1V86A 3AEGB 1J19A 2JZPA 2SEBD 2WXJA 4L2YA 2VH2A 3HVZA 4DWFA 3URYA 2FCSA 3M95A 1V97A 4W9DA 1F52A 5LLIA 2HTME 3DBRB 3APDA 3SHQA 1FNVA 2IPKD 3GP7A 3V61A 1L4ZB 2C5LC 1FD6A 2MP2A 1D3ZA 4AS1A 1D5MC 1TKYA 4KZ0A 4MT5A 1D5XC 2LXAA 4WJOA 4K3BA 1P7EA 2LJ5A 5CX3A 4C4VA 2D3BA 1HTQA 1JQ4A 4BKSA 2FE8A 2N9EB 2JF5A 1SIJA 4PS3A 5EE1A 5CHFA 3QAQA 1WJ6A 4PS8A 4A3PA 1SEBD 4JLCA 1WM2A 1FNUA 4FA6A 4BFRA 1P3QU 3RPFC 3VUWA 1FO4A 1FXTB 2MBHA 3BVZA 4ITKA 4BOZB 4N59A 1NYQA 1WGHA 3ZVVA 2M8SA 4JQWC 4GDKB 2J7QB 2G3QB 1C77A 1WSPA 2IDYA 1P0RA 3AE1B 1EF5A 3VVWB 4P1BC 4LDTD 1K53A 1N6ZA 2CHZA 3DBSA 4M8MA 5C3JB 2K8HA 1TKGA 4P1CC 3W2DA 1TGZB 2K25A 2DZKA 3MHZA 2ZPYA 2QEJC 4LNOA 2KTRB 2KQ7A 1NENB 3KYDD 1R4MB 3DBRI 1JRPA 2KLCA 2VZKD 3IVFA 3NS1A 1HZ5A 2Z8LA 1SE3A 1GJZA 3AULA 4B9KA 3OJ3A 2GBRA 3ZQ4A 2BBCA 2J42A 1WXVA 1R4NB 1J7CA 5C23A 1WGDA 1KTKA 4JGHB 3KUZA 3PHWB 2NBWB 2O6VB 2NBVB 3ZXVA 2JXTA 4FJZA 1NYRA 1V6EA 4WIPA 4W9CA 1ZP0B 1Q5WB 3C19A 3I9V1 2J0KA 1EO6A 1IBXA 2AQ2B 1V1PB 4WJPA 4AP4C 1JWAD 2UU7A 3AN1A 2HDEA 3EC8A 3EGRA 2LRUA 3RNBC 1WMHB 3N3KB 4MELA 3SD5A 5AZFA 4NQKE 3Q8BA 2W55A 1F77A 1IGDA 2WP9B 3B9JA 2O2VB 2K5PA 1YD8U 2INCC 2EKEC 3R8BA 4P7IA 1WXQA 2BKRB 3AEEB 3PRMB 2EMSA 1LXDA 1I4PA 4C00A 3AI5A 1L2NA 2C60A 1R4MI 3BWUD 1V80A 4DDID 4PYUA 4W9FA 4K3CA 2Y3AA 4M0WA 3ZTDA 3M62B 4NNJB 2WDRB 2DZJA 4BVUC 1R4NI 4MGZE 2JQRB 2LGDA 1N5WA 5IOIA 3KQ4A 2LGYA 2WLBA 1TS3A 1YQ4B 1V1PA 3QIJA 3SU8X 2J52A 4HCPB 1JALA 2IGHA 1C9FA 5JHAA 2KKCA 2N0SB 4KSKC 4W9GA 2KNBA 5DPWA 2KFKB 1XQQA 3VR8B 2KYWA 2KACA 4MGYE 2LVOA 2GOWA 4GN1A 3KYCD 1WGKA 5CTRC 1UF0A 2KWUB 3DDCB 2FUG1 3KLSX 1RM6C 2AX5A 3PTFC 2B76B 1SE9A 3R2IA 5E6NA 2Z59B 5DPSA 2FIDA 1SIFA 1VR9A 2WYQA 4OVZA 5DPTA 1FFUA 1DOYA 1TS4A 1E7VA 2LUMA 2CJOA 1DOIA 4EKUA 4ZOHC 4II2B 1N61A 3APFA 3BVGA 4HRSA 3ZXRA 3RNCC 1FXAA 2RDHA 3L0WB 1UD7A 3GS2A 2KC2A 2QC8A 2KXJA 5IO9A 2KDIA 2QCZA 2DYMA 1ACCA 1T0RC 1TY2A 2ONQA 3PRZA 3E56A 2KD0A 2KFKA 5IP4D 2PPHA 2QILA 4A3OA 1I4RA 1VRAB 1WXAA 1BXTA 4ASWC 2GMIC 3U52E 4REZA 3Q8FA 4C80A 2AL6A 1K50A 1HXYD 1GB1A 2D3CA 2FCNA 3HUIA 3N1ZC 5HHDG 5TSSA 1UBQA 3R7QA 3EA6A 2Z0EB 2NTTA 4RM9A 1WXMA 4W9HA 2DBYA 1WR1A 1BMLC 1MG8A 1XF5L 1E10A 3Q8EA 3RMKC 2V0GA 1WX9A 1V1OA 3IAS1 3TCAA 2J0MA 1MI0A 1QLBB 2KX3A 5L95C 3Q14C 3KVFB 2CHWA 1QOBA 1XLOA 1TZ1A 2ASQA 3DVGX 4RCOA 2LVPA 2L00B 1FRDA 1LM8B 2GBJA 2BTEA 2M56B 4XZ4A 1RRBA 4GDLB 1YQ3B 3BZDB 4FXCA 4W9JA 4X57B 4YL8A 1QKZA 1QT9A 4G50A 4KSLC 3CWIA 3TBLD 1IYFA 3BIID 3H7PA 3PT2B 1Z2MA 5HG2A 1T6BX 4LLGM 2LI5A 4HK2A 4FULA 3GE3C 3V6CB 1QZEA 1VZ7A 3R3MA 4XDDA 3ECIA 3NZUA 1FNWA 4LNKA 3Q69A 2KVZA 1HQRD 2L0FA 4NPNA 2MJEA 2LRWA 3V62A 2M0AA 1Y8RC 3AV8A 3WAPA 1WRDB 1JCKB 2PW9A 4EEWA 3Q3JA 4KGTA 4A9AA 4ZDVA 2ZCCA 4WWOA 3KW5B 3TEXA 3P4RB 3ZDMC 4M02A 2MSED 1TT5B 5FR6A 3ZUNA 2V3PA 1OQYA 1SSNA 2G4SA 2M19A 4W9IA 2KWDA 4MJSB 4KIKB 1ET6A 2KN5A 1D6EC 2W82A 5JH5C 2BYVE 1EM7A 1WGRA 4GSWA 3ML8A 4A8XC 3H6NA 5GXGB 3RZFA 1FIQA 2WXGA 3IT6B 1VCBA 2KN4A 3X0WA 2BB5A 1UZXB 3PS6A 3I63C 1V8CA 2BYEA 3T9LA 2IBIB 3HM6X 2D3AA 3VQIA 3NVVA 4EOYA 1YNTE 2XBBC 5AUIA 4ANWA 1SE2A 3KWVA 2VZKB 5TR5A 4WJQA 2GBKA 3UQBA 3IHPC 1ZPSA 2KQ4X 1TKEA 3VDZA 1WF9A 3NRZA 4L23A 3I3TB 4BBNC 5LXHA 5BMHA 4HPPA 3VTWA 2I1JA 1XT9B 3SFDB 1JWMD 1GNUA 1H8CA 5J2RA 2EKIA 4AJWA 2D07B 2BT6A 3MC9A 2JSVX 4IM0A 4MGKE 3W9CB 1YJJA 4KKIA 3FILB 2MP2B 3VH4B 2PE6B 1QQRA 1WM3A 1ZXIA 2KANA 4IM2A 3PHXB 4B0MA 4C4VB 2AYOB 3K9OB 1PYWD 2WDVB 3RT3B 3KWLA 3TJPA 2WWZA 3NUHB 4DXFA 2JXXA 5I4DA 2MBOA 3APCA 4W9EA 1E90A 2ZCBA 4IW0A 2LGSA 1UGJA 3Q3OC 2GB1A 1OEYJ 3JVZX 2XNAC 3MHSD 3U7DA 2JU6X 1YJIA 1E5WA 3L13A 3VH3B 2BGFA 3E9SA 1ZUD2 4TUUA 2BKFA 4G3XB 3AEDB 1E8WA 1HTOA 4DBGA 4KGRA 4NAWA 3DCGA 4IOIE 1I4XA 5EE9A 3N9YC 4CO7A 1F2RI 3OG5A 4MH8A 2JYEA 2E6XA 3FILA 2ZNVB 1C4CA 2LFIA 3NG0A 4TSSA 4BKTA 1QOAA 4YTNB 4K7WA 3MTNB 2L7RA 4WQOB 1WIAA 3MFGA 3PZ7A 2LGXA 1WRIA 3PZDA 4MM3A 4IDIA 3H1UA 2MBBB 4HPLB 1PGAA 5EE3A 4XE0A 2ZZPB 1RFKA 1WGYA 1FMAD 2GBNA 1WJ4A 3A9JA 4R3DA 4C7ZA 4AWJA 1T3QA 2IGDA 3QQ8B 3DVGY 2PEAA 2BYFA 5E6OA 1IBXB 4JE3B 2IO2B 4JX1C 3VXWA 5IKCM 1E0ZA 1CQVA 3QARA 1R7SA 3LDZE 3GE8C 1Q1OA 4RNAA 2WQYB 3AE3B 1XLPA 2BQQA 1WYGA 4RF1A 2A5UA 1YMHE 2KT7A 4KX6B 4IM3A 2DHZA 2PE9A 3AE2B 2J0JA 3S2AA 3N30A 4PS7A 3RZWC 2RDGA 3TEWA 2AWTA 2HJ1A 1PFDA 2OJRA 4LJPB 3WA0A 3DVNV 3K9PB 3W1SA 2L3ZA 3AE6B 3ONSA 2V9HA 3BYTB 1E8YA 2XN9C 3R2TA 1VLBA 3CIRB 2L52A 2ICIA 3PREA 4IUMB 2N9XA 4M0WB 4TV3A 1TJEA 1IUEA 1CMXB 4E71A 4FBJB 4KVGB 3QX1A 1ZGUB 1FPYA 4A6QA 2L8JA 2YEPF 1V5TA 2W9NA 1S1QB 1ZDVA 1D4BA 2Q5WD 3SDLC 2WXPA 3X23A 4RM8A 3NY5A 2WXHA 2BW2A 1F9JA 3OAWA 4BKSD 3PVLA 1YQBA 3J9CA 2HTHA 2AEHA 1AW7A 5IN7A 2N9PC 4MSQB 2D3GA 3M3JA 4F1SA 1XLQA 5LXIB 3MP9A 1FEHA 2D5GA 2V1YA 2N9LA 1FCCC 1QOFA 1KH0A 3AMZA 1YN5A 5D7GA 3ZGZA 1UNSA 2W3SA 1MPEA 2QMTA 4MACA 5KHQA 3W5VB 3UIOB 2YEPB 2KJ6A 1ZKHA 2KVRA 4KV2A 2KC1A 3P4QB 2M17A 4G0NB 4DQOC 4W9LA 1BUIC 4MDKE 2PTLA 2G4DB 2CU3A 2KFJA 4GGQA 4DHJB 3RNGC 1FFVA 4KKJA 1GG3A 1WFYA 4OVVA 1AN8A 2MWSB 3EECA 3RD2A 4EE2A 3WANA 3V6EB 2XEWA 3U4EG 2ACZB 3ZJVA 3ZNID 1DGJA 4WH4A 1EWYC 5IA7A 3LB8C 5LNK1 2XK5A 2RSUA 3V05A 2ZW0A 1L6VA 4IWOA 3AXCA 1PGXA 4LTUA 4JIOU 2AQ1B 4TQ1A 2BPSA 1L0VB 3AU4A 4OVUA 5D3DA 2N1WA 4PT5A 3IFWB 3P4SB 1JWUD 1GPXA 2N4FA 2C7NB 3VHTC 3DHIC 3Q3MC 4KDLB 4WWNA 1BT0A 3PRPB 2QHOA 4DHZE 4FADA 1TS2A 4B6WA 1NI3A 1CZPA 3TIXA 4JPSA 5L83A 1EU3A 1TBEA 5CHVC 2MEKA 2NMQA 4ICUA 1WYWB 4E3CA 4QAYA 4B95A 4HDQA 1I4QA 2UYZB 1WE7A 2WXNA 2MBEA 3TSSA 4FLHA 4JWSC 1RYJA 2YLMA 4FHKA 1M4VA 1ROEA 1MG4A 3NVZA 2IO1B 3RNAC 1JW9D 3Q3NC 1C78A 4XDCA 3N20C 2FUHB 2IGGA 1HEZE 3GZNB 2CS4A 1OQRA 2KMCA 3M63B 1SJED 1KFYB 5H92C 2PVGC 4EZKA 2WX1A 3AE4B 3H7PB 2Z0DB 3NHEB 4N9F4 4S17A 2WDQB 3A9KA 4GU2A 3FKYA 1EWCA 3AEAB 3R7RA 3ZDTA 2IJ0A 4NQLB 3AEBB 3L4PA 3U2SC 2K22A 1B9RA 2RMMA 4HJGE 4UDUC 3TMPB 1MHXA 2DWQA 1TTNA 2MJ3A 3OWEB 1ISNA 4L1BA 5AUKA 3O13A 4WWMA 2DENB 3D32A 4WAAA 3L16A 3ZRCA 3IXSA 1I4GA 2JWZA 2JRHA 1E8ZA 1V5OA 1YX5B 3Q8CA 3LYYA 3U8ZA 1GC6A 3P42A 2NR2A 1RFAA 2J4XA 4O1NA 2PMVA 3DBLB 2WXFA 1T5XD 1UBIA 4I6PA 4K7UA 1KLUD 2K3UA 3RFZB 2LASA 1XLNA 3VR9B 3RNEC 4CHKA 1V81A 1F1HA 3ABVB 4DHJD 4NAMA 4TKNA 3L17A 3H8HA 1NI2A 3PSEB 3I57A 1L0XB 3ZLZA 3GZNI 2RD0A 2WU5B 1C4AA 4WJNA 3AE8B 4F7ZA 1P9DU 4B0EA 1H4RA 4EFOA 4HVBA 1T0SC 1E6EB 1SBBB 2BS4B 2KDBA 2BVCA 3UINB 5AZHA 2CHXA 5HI1A 1ZXHA 2LHEA 5E6JA 2L05A 2ZVNA 4RF0A 1V9JA 4WURA 1XEEA 4KZCA 3ZYYX 4YSXB 3A33B 1E9MA 2PLPA 4NY0A 4AJYB 4LNIA 1JWSD 4DXAB 2ON8A 4LJOB 2H88B 3GOEA 2RPVA 2WXKA 3QA8A 2GI9A 4CQNA 3DOWA 3RULA 2DAFA 1I42A 2KAJA 3B2GA 2RGFA 1SE4A 2WX0A 1YJ1A 3DBLI 2K39A 2MCNB 2MLBA 3KH0A 2G9HD 2WNMA 2N9KA 1XD3B 4FJYA 4IWQA 5D6JB 2Y5PA 1FM0D 2L76A 1WX7A 1OGWA 3HIZA 1KM7A 5D3IB 1IGCA 4AOFA 3DHGC 3H7SA 5J18A 1L5PA 3DWMA 2JX5A 3V60A 4TQ0A 1N60A 1J7BA 3WAMA 4NAWB 3QWZB 4RGTA 4YSZB 1WI0A 2EMTA 3ZNGC 3QC8B 1LO5D 4MGIE 4FN2A 2BS3B 4RH6A 4K7SA 4HKQA 3RI7C 1ET9A 1I7HA 3PLVA 3ZIMA 4RFBA 2FAZA 2K6QA 2QIEB 3B08A 3PPAA 2LZ6A 3T8MA 4P6VF 4HWIB 2NPTA 2PKOA 1XO3A 4LNNA 3R66C 5KHOA 1K8RB 2C7HA 2KOXA 4RGMA 5G5GA 2NVUI 3W5UB 4MEMA 1L0YB 4MM3B 1V2YA 1Q10A 2OJWA 1XCQL 3LXFA 4FHJA 2IO0B 2BB6A 2KWVB 1VD2A 4EZLA 1KLVA 2V4IB 1UWXA 4DDGD 2B3AA 1LGRA 2LXCA 1NDDA 2I1KA 1KOTA 3VTVA 3OLMD 2GRIA 1KF6B 3A9JB 2CU1A 2MBQA 4D2KA 3ZNHB 2G1EA 2E3TA 2JWUA 2FBWB 1C3TA 2WGSA 3FC4A 1TYGB 3VAWA 4BOSC 4OZBA 1LFDA 3NJTA 4BKGA 4HLEA 3WALA 1J8CA 1WXSA 2HJ8A 5D94A 2JZZA 2LHDA 4HEA1 3BYYB 1FRRA 2FCMA 3SEBA 2X38A 4YT0B 2KHWB 1MVKA 1F2RC 2MW5A 3AE7B 3NOBA 4BZAA 2BWES 1E7PB 3SR6A 3AECB 2YVCA 4OZAA 1A5RA 1Z5SB 1GC7A 3N1YC 4YXDB 4BAXA 3ZO5B 1RLFA 3EFCA 1VJKA 2H89B 2M4NA 3P2BA 1I35A 1RWSA 2KMAA 2OEDA 2AQ3B 3Q8AA 4A20A 2DAJA 2IY0B 1NBFC 1F0ZA 2KZRA 1A70A 4ZRKA 1OTRB 3QHTA 3IBEA 2IY1B 3Q6BA 4ANUA 1WJNA 3VRBB 3AE9B 3DBHB 2IZVB 4ICVA 5EDSA 2QSDA 3RUIB 3UIPB 4W9KA 1ZDXA 3QJZA 4P16A 1LQBA 4G11A 2C7MB 2FCQA 2RR9A 2ZVOA 4NJCA 4ZYSA 1JMLA 3TUOA 2RDBC 3WIMA 1GUAB 2INPE 4RGNA 1HZ6A 1C4PA 2A4ZA 4MSMB 4ZHPA 5MPOA 2MHJA 4S0RA 2KO3A 4HROA 3QK0A 1D5ZC 1ZW7A 4OHJA 3HHMA 2RPQA 2LWPA 1IP9A 4JL9A 4ZRPA 2OHFA 2NCNA 4HDOA 2TSSA 2N7JA 3KUCB 4XX5A 2ZNVC 4XGAB 1ENFA 3MC8A 2MJDA 2PIAA 2WXRA 3CF6E 3C0RB 2NS5A 3QCAA 1WY8A 2ZPNA 2FNJB 2V3SA 2K1FA 2SAKA 4FJVB 2DX5B 3VUXA 4ANXA 1XXGA 3H9DA 4I6LB 5JXVA 2G45B 2MA9B 2W3RA 1KJTA 2BF8B 3W1SC 4WQMA 2LJIA 4ACFA 2WXQA 3T3OA 4RGOS 5FK9C 2INDC 4RMAA 3DBHI 4YTPB 3DVNU 2XK5B 2BS2B 1IPGA 1J7AA 3RYTA 4HCNB 2N7EA 3U30A 4GDKA 3L54A 4AUQC 1EUVB 3ZJTA 1K51A 2JPHA 2MRPA 1KRHA 4CYEA 3BK1A 1DYQA 2K8CA 3A4RA 3UF8A 2W54A 1UGMA 4LK0M 2WU2B 2KTRA 4C56C 1STEA 2DZMA 2KTFA 2PJHA 3GB1A 5AEKB 3I5JC 1GOZA 4H2AA 2JZ3B 2CR5A 2KDEB 4PYZA 5D2MB 4XC2A 1UELA 1EU4A 3TEZA 3PO0A 1PQSA 4GLSC 1OQQA 2FIFA 2N7DA 1VDVA 5FR3A 1VZ8A 4A90A 4IKGA 3B2FA 1QOGA 2CKHB 3DQVA 4GB9A 2O6VA 1C1YB 2KJHB 4HKZE 5BMGA 1P98A 3JYUA 4LCDE 4AQ7A 2WDTB 2KX0A 1CJEA 3PV1A 2V3NA 4JWUC 2DLBA 5GMVA 1ESFA 1CK1A 2KMMA 2LVQA 5DPRA 5HKHA 3ZNZB 4I6NB 1TY0A 2WXIA 3ZJUA 4GXBA 4URKA 4TMAB 2Y5CA 1VZ6A 1C79A 3UQAA 1WMHA 2JRIB 2L0TA 3VTUA 2KLGA 2HD5B 4Q2JA 3ZW3A 2JY6A 2O2VA 3A9KB 1L6UA 1T0QC 3PGEA 2K9XA 2R61A 3IAM1 4LNFA 1U4AA 4WAFA 1WR6E 4HPMB 1QF6A 4WWPA 5BYSA 3L08A 3DWGC 3Q3FA 1MHHE 1AWDA 3ALBA 3P63A 4OZCA 3JSVB 1SB3C 3VUYA 3C8YA 3O65B 1SF0A 2M0XA 3HK0A 3LJ3A 1JROA 5T8IA 4XWWA 2KDFB 1WZ0A 5IAAC 3AH7A 3MJ5A 2DNFA 3WAOA 1KLGD 3AEFB 1L4DB 3ZTCA 3CMMB 2L32A 1S3SG 2K8BA 2L1AA 4II3B 2UWQA 4YSYB 4N58A 2BWFA 5JZEB 3MJWA 4OW0A 1HE8A 3DPDA 4IG7B 4F8CB 3BINA 1WE6A 3NVYA 4ZRQA 4E74A 2OOBB 3RNFC 3AU5A 2N1VA 2CJNA 1WZ3A 1WX8A 2QJLA 3HM3A 1QILA 2O6VD 4ZRIA 1GB4A 2LD9A 4HJKA 3PLUA 5BMIA 3ML9A 3JSVA 3KUDB 4US9A 2JT4B 4M00A 1UUPA 3A4SC 3ETRA 1MFWA 2GLSA 1YIWA 2LUEA 1EF1A 2I2YA 2AL3A 3V3XA 1XCTL 2M1MA 3AE5B 3N32A 1N63A 2DYOA 4GOCA 1SGHA 3NS8A 1K52A 2DZIA 1OFFA 2LEKA 3EFUA 2QDFA 3P4PB 4HXDA 3NZ3A 2WS3B 5E6PA 3VRAB 4BBNF 2WXOA 4J3OD 4EZJA 1YN4A 2J53A 2INNE 2IO3B 3NVWA 5C2TB 1MJDA 2JVCA 3MC0B 1P1AA 1Q0WB 5BYRA 4ARIA 3AM9A 4NZLB 3EHVA 5JHBA 2WHIA 5G2NA 3Q2AC 2NTSA 2LGIA 4M8NA 1C76A 1X1MA 1SJHD 4ZRJA 3NZSA 5BO4B 1TIFA 3EUB2 5CHWA 4IWPA 1TS5A 5H8YE 2IYDB 1V49A 3SFEB 4C7YA 4M01A 3UI3A 3B0AA 4DHZB 3ZRFA 2NBUA 2KJRA 3AB5A 1AYFA 1TZOA 4K1RB 2BYTA 1M94A 2LMCA 1P7FA
chains in the Genus database with same CATH topology
1C3TA 2N9XA 3VAWA 4TV3A 4BOSC 2MX2A 3BY4B 1CMXB 1LFDA 4EKUA 1WH3A 4BKGA 4E71A 4HLEA 4FBJB 4KVGB 4II2B 2DYBA 3QX1A 3WALA 4ANVA 1J8CA 1ZGUB 1WXSA 2HJ8A 5D94A 2JZZA 3APFA 2L8JA 1V5TA 2W9NA 1S1QB 2FCMA 3A1QB 3L0WB 4DK5A 1UD7A 3SDLC 2KHWB 2KC2A 3X23A 4RM8A 2KXJA 2MW5A 3NY5A 2KDIA 4GIVA 1F9JA 3OAWA 4BKSD 1J0GA 3NOBA 2DYMA 3JW0X 2BWES 2R2OA 3PVLA 1YQBA 2D2QA 2HTHA 3CSFA 2AEHA 3UGBB 3PRZA 2YVCA 1AARA 1A5RA 2N9PC 4MSQB 1Z5SB 4EUTA 3OJ4B 1GC7A 2D3GA 3M3JA 3ZKJC 2KD0A 2NPTB 4F1SA 2KFKA 5DCNA 5LXIB 2V1YA 2PPHA 4A3OA 3ZO5B 1RLFA 3P2BA 1WXAA 2M4NA 1I35A 4GDLA 2KK8A 2KMAA 4ASWC 4A20A 2DAJA 5D7GA 2GMIC 2IY0B 1NBFC 4NJ7A 2KZRA 2AL6A 1RAXA 4ZRKA 4LDTB 5KHQA 1OTRB 2FCNA 2HE7A 3QHTA 1E7UA 2Y5BB 3UIOB 2KJ6A 1ZKHA 2KVRA 1OEYA 3CSTA 3IBEA 2IY1B 4KV2A 2KC1A 4ANUA 1UBQA 2M17A 1WJNA 4G0NB 5AZGA 3R7QA 2V4LA 2Z0EB 4ICVA 2IZVB 4J6IA 4RM9A 1WXMA 4W9LA 4W9HA 5EDSA 2K6DB 3RUIB 3UIPB 4MDKE 4W9KA 1T0YA 1WR1A 2G4DB 4K81A 4ZYNA 2KFJA 3IG3A 3QJZA 4GGQA 4DHJB 1MG8A 1WGGA 1LQBA 4G11A 1YX6B 2C7MB 1GG3A 2FCQA 1WFYA 2RR9A 4MH0E 2ZVOA 4OVVA 5J17A 1WX9A 2MWSB 3EECA 3RD2A 3WANA 3V6EB 2JUOA 2XEWA 3TCAA 2J0MA 3WIMA 3A1QA 3ZNID 1GUAB 3RCZA 2KX3A 5L95C 5IA7A 2R2QA 3KVFB 2CHWA 2RSUA 2XK5A 5G55A 4KDIC 2A4ZA 4MSMB 2KO3A 3QK0A 4IWOA 1TZ1A 2ASQA 3AXCA 3DVGX 3ENEA 2D10A 4JIOU 2LVPA 4TQ1A 1ZW7A 2BPSA 2L00B 3HHMA 3VFKA 1LM8B 2GBJA 2RPQA 2LWPA 1JRUA 3AU4A 4JL9A 1IP9A 4OVUA 5C1ZA 4XZ4A 1RRBA 2N1WA 1UH6A 2NCNA 4GDLB 1L7YA 4HDOA 3IFWB 2KWCA 3W1YA 4GMVA 2N4FA 2C7NB 4KIKA 4MJSA 3VHTC 3KUCB 4W9JA 4XX5A 2D11A 2ZNVC 4X57B 4IC7B 4YL8A 4WWNA 4KDLB 1BT0A 4G50A 4KSLC 1WJUA 2ZEQA 3TBLD 1IYFA 2MQJA 3H7PA 3PT2B 3CF6E 1Z2MA 3C0RB 2GBMA 2NS5A 3QCAA 1WY8A 2ZPNA 3PRPB 2FNJB 2V3SA 2K1FA 4FJVB 3L10B 2LI5A 4HK2A 2QHOA 4FULA 2DX5B 4DHZE 3V6CB 3VUXA 4ANXA 1QZEA 4FADA 3H9DA 3R3MA 1E8XA 3B1LX 4B6WA 4I6LB 3TIXA 3ECIA 3NZUA 2G45B 2MA9B 2VRRB 5L83A 1G6JA 1KJTA 2BF8B 1TBEA 2L0FA 3W1SC 3TL5A 5CHVC 2C9WB 2KQSA 2ZJDA 1WYWB 4ICUA 4NJ6A 4E3CA 4B95A 4NPNA 2LRWA 4HDQA 3V62A 2REXA 2UYZB 1WE7A 1V86A 1Y8RC 1J19A 2MBEA 4RMAA 1WRDB 3WAPA 4FLHA 3DBHI 4EEWA 3DVNU 2XK5B 3Q3JA 4ZDVA 2ZCCA 1IPGA 4WWOA 3RYTA 4HCNB 2N7EA 3KW5B 4DWFA 2YLMA 3U30A 4FHKA 4GDKA 3L54A 3ZDMC 2FCSA 3M95A 4AUQC 1EUVB 4W9DA 2MSED 5LLIA 2IO1B 5FR6A 2JPHA 2MRPA 3ZUNA 3APDA 3SHQA 1OQYA 2G4SA 2FUHB 4CYEA 4W9IA 2K8CA 4KIKB 4MJSB 3V61A 2KN5A 3A4RA 2C5LC 2CS4A 2MP2A 2BYVE 1WGRA 4GSWA 2KMCA 5JH5C 1D3ZA 3ML8A 3M63B 3UF8A 3H6NA 3RZFA 4M0WB 1UGMA 4KZ0A 4EZKA 2WX1A 1VCBA 3H7PB 2Z0DB 3NHEB 4N9F4 2KTRA 4WJOA 2LXAA 3X0WA 2DZMA 1UZXB 2KTFA 2PJHA 2LJ5A 5CX3A 3PS6A 5AEKB 3T9LA 2BYEA 3A9KA 4GU2A 2JZ3B 2N9EB 4BKSA 2JF5A 2IBIB 3HM6X 2CR5A 4PS3A 5CHFA 3QAQA 1WJ6A 4PS8A 3R7RA 4A3PA 2KDEB 4PYZA 5D2MB 3ZDTA 4JLCA 3VQIA 1WM2A 4EOYA 4XC2A 4NQLB 1UELA 4FA6A 4BFRA 2XBBC 1P3QU 1PQSA 4ANWA 3VUWA 2FIFA 5TR5A 2N7DA 1FXTB 3TMPB 2MBHA 4WJQA 1TTNA 1ISNA 4BOZB 2GBKA 3UQBA 3IHPC 2DENB 3D32A 3VDZA 4WAAA 1WF9A 3L16A 3I3TB 4BBNC 3ZRCA 2CKHB 5LXHA 3DQVA 1WGHA 2O6VA 2M8SA 4GB9A 4JQWC 3ZVVA 3VTWA 1C1YB 2JWZA 2JRHA 2KJHB 4GDKB 1E8ZA 1P98A 1V5OA 2I1JA 1YX5B 3JYUA 1XT9B 2J7QB 4LCDE 2G3QB 2WDTB 2KX0A 1GNUA 3PV1A 1H8CA 5J2RA 4AJWA 1P0RA 2D07B 3U8ZA 1GC6A 1EF5A 2NR2A 1RFAA 3VVWB 4LDTD 5GMVA 5HKHA 2LVQA 5DPRA 3ZNZB 4IM0A 1UBIA 4I6PA 4I6NB 2CHZA 3DBSA 4K7UA 4M8MA 4MGKE 2K8HA 2MP2B 4GXBA 4URKA 3VH4B 1TGZB 2K25A 2LASA 2PE6B 3UQAA 1WMHA 1WM3A 2DZKA 2KANA 4CHKA 4IM2A 1V81A 2ZPYA 3PHXB 2JRIB 4DHJD 2L0TA 2KTRB 2KLGA 2KQ7A 2HD5B 4TKNA 3VTUA 3KYDD 3L17A 3ZW3A 2AYOB 1NI2A 3K9OB 2JY6A 2O2VA 3A9KB 3PSEB 3DBRI 2KLCA 3PGEA 3IVFA 3RT3B 3TJPA 2WWZA 1U4AA 3ZLZA 2JXXA 1GJZA 1WR6E 4HPMB 3AULA 4B9KA 3GZNI 3OJ3A 4WWPA 2MBOA 2GBRA 3L08A 3APCA 2RD0A 3Q3FA 4W9EA 1E90A 2ZCBA 4IW0A 4WJNA 1WXVA 3ALBA 4F7ZA 1P9DU 5C23A 1H4RA 4EFOA 1WGDA 4HVBA 3JSVB 4JGHB 3VUYA 1OEYJ 3KUZA 3JVZX 3MHSD 3PHWB 3O65B 3U7DA 3HK0A 2KDBA 2M0XA 3LJ3A 2NBWB 3UINB 1E5WA 3L13A 2O6VB 2KDFB 2NBVB 5AZHA 2CHXA 2BGFA 3VH3B 4FJZA 1WZ0A 1V6EA 2L05A 4TUUA 4W9CA 1Q5WB 2BKFA 5IAAC 4G3XB 1E8WA 2ZVNA 4DBGA 1V9JA 3WAOA 4NAWA 3DCGA 4KZCA 3ZTCA 3CMMB 2J0KA 1EO6A 1S3SG 3A33B 2K8BA 4NY0A 4AJYB 4CO7A 4WJPA 4AP4C 4II3B 2UWQA 4DXAB 3EC8A 4LJOB 2LRUA 3GOEA 1WMHB 5JZEB 2BWFA 3N3KB 2ZNVB 4MELA 5AZFA 3SD5A 4NQKE 3QA8A 3MJWA 1HE8A 3DPDA 4IG7B 4F8CB 3DOWA 3RULA 4BKTA 4K7WA 2DAFA 3BINA 1I42A 1WE6A 3MTNB 2O2VB 2L7RA 2RGFA 2WX0A 4E74A 1YJ1A 1YD8U 2OOBB 3AU5A 3DBLI 2K39A 2N1VA 4WQOB 1WIAA 2MCNB 2MLBA 3KH0A 1WZ3A 2EKEC 2LGXA 4P7IA 1WX8A 2BKRB 1XD3B 3PZDA 4MM3A 3HM3A 3PRMB 4FJYA 4IWQA 2EMSA 2O6VD 3H1UA 1LXDA 5D6JB 2MBBB 4HPLB 3AI5A 1L2NA 4ZRIA 2C60A 2L76A 2LD9A 4HJKA 1WX7A 1OGWA 3PLUA 2ZZPB 3HIZA 1KM7A 1R4MI 1WGYA 3ML9A 3JSVA 3KUDB 4AOFA 3H7SA 5J18A 2JT4B 2GBNA 1WJ4A 3A9JA 1V80A 3A4SC 4DDID 4PYUA 4W9FA 3V60A 4AWJA 1YIWA 2LUEA 1EF1A 3ZTDA 4TQ0A 2AL3A 3QQ8B 3M62B 2M1MA 3WAMA 3DVGY 3N32A 2DYOA 4NAWB 2PEAA 4NNJB 2DZJA 4BVUC 1R4NI 2BYFA 4MGZE 3QWZB 5E6OA 4GOCA 1SGHA 1WI0A 2LGDA 2IO2B 3NS8A 2DZIA 2EMTA 3ZNGC 3EFUA 3QC8B 4HXDA 4MGIE 2LGYA 3VXWA 4FN2A 5E6PA 4BBNF 3QIJA 3QARA 4K7SA 3SU8X 4EZJA 3LDZE 4HCPB 3PLVA 2IO3B 3ZIMA 5JHAA 2FAZA 2K6QA 3B08A 2KKCA 1Q1OA 3PPAA 2JVCA 1P1AA 1Q0WB 4KSKC 3EHVA 2KNBA 2LZ6A 2A5UA 4W9GA 5DPWA 2KFKB 3T8MA 5JHBA 1XQQA 5G2NA 4HWIB 4MGYE 2NPTA 2LVOA 2GOWA 4IM3A 3R66C 5KHOA 1K8RB 2C7HA 2DHZA 2KOXA 2PE9A 4GN1A 2NVUI 2J0JA 3KYCD 4IUMB 4M8NA 4MEMA 5CTRC 1X1MA 4ZRJA 3S2AA 2KWUB 3N30A 1V2YA 4PS7A 3RZWC 2AWTA 3DDCB 3NZSA 4FHJA 2OJRA 5BO4B 4LJPB 2IO0B 3PTFC 3WA0A 5CHWA 3DVNV 3K9PB 2KWVB 4IWPA 1SE9A 3W1SA 1VD2A 2IYDB 4EZLA 5E6NA 1KLVA 2L3ZA 1V49A 2Z59B 3ONSA 5DPSA 4DDGD 2FIDA 1SIFA 2WYQA 2B3AA 3B0AA 5DPTA 2LXCA 1NDDA 2I1KA 4DHZB 1E8YA 1KOTA 3VTVA 3OLMD 3ZRFA 2NBUA 2KJRA 3A9JB 1E7VA 2CU1A 2MBQA 4K1RB 3ZNHB 1M94A 3PREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3T A;  2N9X A;  3VAW A;  4TV3 A;  4BOS C;  2MX2 A;  3BY4 B;  1CMX B;  1LFD A;  4EKU A;  1WH3 A;  4BKG A;  4E71 A;  4HLE A;  4FBJ B;  4KVG B;  4II2 B;  2DYB A;  3QX1 A;  3WAL A;  4ANV A;  1J8C A;  1ZGU B;  1WXS A;  2HJ8 A;  5D94 A;  2JZZ A;  3APF A;  2L8J A;  1V5T A;  2W9N A;  1S1Q B;  2FCM A;  3A1Q B;  3L0W B;  4DK5 A;  1UD7 A;  3SDL C;  2KHW B;  2KC2 A;  3X23 A;  4RM8 A;  2KXJ A;  2MW5 A;  3NY5 A;  2KDI A;  4GIV A;  1F9J A;  3OAW A;  4BKS D;  1J0G A;  3NOB A;  2DYM A;  3JW0 X;  2BWE S;  2R2O A;  3PVL A;  1YQB A;  2D2Q A;  2HTH A;  3CSF A;  2AEH A;  3UGB B;  3PRZ A;  2YVC A;  1AAR A;  1A5R A;  2N9P C;  4MSQ B;  1Z5S B;  4EUT A;  3OJ4 B;  1GC7 A;  2D3G A;  3M3J A;  3ZKJ C;  2KD0 A;  2NPT B;  4F1S A;  2KFK A;  5DCN A;  5LXI B;  2V1Y A;  2PPH A;  4A3O A;  3ZO5 B;  1RLF A;  3P2B A;  1WXA A;  2M4N A;  1I35 A;  4GDL A;  2KK8 A;  2KMA A;  4ASW C;  4A20 A;  2DAJ A;  5D7G A;  2GMI C;  2IY0 B;  1NBF C;  4NJ7 A;  2KZR A;  2AL6 A;  1RAX A;  4ZRK A;  4LDT B;  5KHQ A;  1OTR B;  2FCN A;  2HE7 A;  3QHT A;  1E7U A;  2Y5B B;  3UIO B;  2KJ6 A;  1ZKH A;  2KVR A;  1OEY A;  3CST A;  3IBE A;  2IY1 B;  4KV2 A;  2KC1 A;  4ANU A;  1UBQ A;  2M17 A;  1WJN A;  4G0N B;  5AZG A;  3R7Q A;  2V4L A;  2Z0E B;  4ICV A;  2IZV B;  4J6I A;  4RM9 A;  1WXM A;  4W9L A;  4W9H A;  5EDS A;  2K6D B;  3RUI B;  3UIP B;  4MDK E;  4W9K A;  1T0Y A;  1WR1 A;  2G4D B;  4K81 A;  4ZYN A;  2KFJ A;  3IG3 A;  3QJZ A;  4GGQ A;  4DHJ B;  1MG8 A;  1WGG A;  1LQB A;  4G11 A;  1YX6 B;  2C7M B;  1GG3 A;  2FCQ A;  1WFY A;  2RR9 A;  4MH0 E;  2ZVO A;  4OVV A;  5J17 A;  1WX9 A;  2MWS B;  3EEC A;  3RD2 A;  3WAN A;  3V6E B;  2JUO A;  2XEW A;  3TCA A;  2J0M A;  3WIM A;  3A1Q A;  3ZNI D;  1GUA B;  3RCZ A;  2KX3 A;  5L95 C;  5IA7 A;  2R2Q A;  3KVF B;  2CHW A;  2RSU A;  2XK5 A;  5G55 A;  4KDI C;  2A4Z A;  4MSM B;  2KO3 A;  3QK0 A;  4IWO A;  1TZ1 A;  2ASQ A;  3AXC A;  3DVG X;  3ENE A;  2D10 A;  4JIO U;  2LVP A;  4TQ1 A;  1ZW7 A;  2BPS A;  2L00 B;  3HHM A;  3VFK A;  1LM8 B;  2GBJ A;  2RPQ A;  2LWP A;  1JRU A;  3AU4 A;  4JL9 A;  1IP9 A;  4OVU A;  5C1Z A;  4XZ4 A;  1RRB A;  2N1W A;  1UH6 A;  2NCN A;  4GDL B;  1L7Y A;  4HDO A;  3IFW B;  2KWC A;  3W1Y A;  4GMV A;  2N4F A;  2C7N B;  4KIK A;  4MJS A;  3VHT C;  3KUC B;  4W9J A;  4XX5 A;  2D11 A;  2ZNV C;  4X57 B;  4IC7 B;  4YL8 A;  4WWN A;  4KDL B;  1BT0 A;  4G50 A;  4KSL C;  1WJU A;  2ZEQ A;  3TBL D;  1IYF A;  2MQJ A;  3H7P A;  3PT2 B;  3CF6 E;  1Z2M A;  3C0R B;  2GBM A;  2NS5 A;  3QCA A;  1WY8 A;  2ZPN A;  3PRP B;  2FNJ B;  2V3S A;  2K1F A;  4FJV B;  3L10 B;  2LI5 A;  4HK2 A;  2QHO A;  4FUL A;  2DX5 B;  4DHZ E;  3V6C B;  3VUX A;  4ANX A;  1QZE A;  4FAD A;  3H9D A;  3R3M A;  1E8X A;  3B1L X;  4B6W A;  4I6L B;  3TIX A;  3ECI A;  3NZU A;  2G45 B;  2MA9 B;  2VRR B;  5L83 A;  1G6J A;  1KJT A;  2BF8 B;  1TBE A;  2L0F A;  3W1S C;  3TL5 A;  5CHV C;  2C9W B;  2KQS A;  2ZJD A;  1WYW B;  4ICU A;  4NJ6 A;  4E3C A;  4B95 A;  4NPN A;  2LRW A;  4HDQ A;  3V62 A;  2REX A;  2UYZ B;  1WE7 A;  1V86 A;  1Y8R C;  1J19 A;  2MBE A;  4RMA A;  1WRD B;  3WAP A;  4FLH A;  3DBH I;  4EEW A;  3DVN U;  2XK5 B;  3Q3J A;  4ZDV A;  2ZCC A;  1IPG A;  4WWO A;  3RYT A;  4HCN B;  2N7E A;  3KW5 B;  4DWF A;  2YLM A;  3U30 A;  4FHK A;  4GDK A;  3L54 A;  3ZDM C;  2FCS A;  3M95 A;  4AUQ C;  1EUV B;  4W9D A;  2MSE D;  5LLI A;  2IO1 B;  5FR6 A;  2JPH A;  2MRP A;  3ZUN A;  3APD A;  3SHQ A;  1OQY A;  2G4S A;  2FUH B;  4CYE A;  4W9I A;  2K8C A;  4KIK B;  4MJS B;  3V61 A;  2KN5 A;  3A4R A;  2C5L C;  2CS4 A;  2MP2 A;  2BYV E;  1WGR A;  4GSW A;  2KMC A;  5JH5 C;  1D3Z A;  3ML8 A;  3M63 B;  3UF8 A;  3H6N A;  3RZF A;  4M0W B;  1UGM A;  4KZ0 A;  4EZK A;  2WX1 A;  1VCB A;  3H7P B;  2Z0D B;  3NHE B;  4N9F 4;  2KTR A;  4WJO A;  2LXA A;  3X0W A;  2DZM A;  1UZX B;  2KTF A;  2PJH A;  2LJ5 A;  5CX3 A;  3PS6 A;  5AEK B;  3T9L A;  2BYE A;  3A9K A;  4GU2 A;  2JZ3 B;  2N9E B;  4BKS A;  2JF5 A;  2IBI B;  3HM6 X;  2CR5 A;  4PS3 A;  5CHF A;  3QAQ A;  1WJ6 A;  4PS8 A;  3R7R A;  4A3P A;  2KDE B;  4PYZ A;  5D2M B;  3ZDT A;  4JLC A;  3VQI A;  1WM2 A;  4EOY A;  4XC2 A;  4NQL B;  1UEL A;  4FA6 A;  4BFR A;  2XBB C;  1P3Q U;  1PQS A;  4ANW A;  3VUW A;  2FIF A;  5TR5 A;  2N7D A;  1FXT B;  3TMP B;  2MBH A;  4WJQ A;  1TTN A;  1ISN A;  4BOZ B;  2GBK A;  3UQB A;  3IHP C;  2DEN B;  3D32 A;  3VDZ A;  4WAA A;  1WF9 A;  3L16 A;  3I3T B;  4BBN C;  3ZRC A;  2CKH B;  5LXH A;  3DQV A;  1WGH A;  2O6V A;  2M8S A;  4GB9 A;  4JQW C;  3ZVV A;  3VTW A;  1C1Y B;  2JWZ A;  2JRH A;  2KJH B;  4GDK B;  1E8Z A;  1P98 A;  1V5O A;  2I1J A;  1YX5 B;  3JYU A;  1XT9 B;  2J7Q B;  4LCD E;  2G3Q B;  2WDT B;  2KX0 A;  1GNU A;  3PV1 A;  1H8C A;  5J2R A;  4AJW A;  1P0R A;  2D07 B;  3U8Z A;  1GC6 A;  1EF5 A;  2NR2 A;  1RFA A;  3VVW B;  4LDT D;  5GMV A;  5HKH A;  2LVQ A;  5DPR A;  3ZNZ B;  4IM0 A;  1UBI A;  4I6P A;  4I6N B;  2CHZ A;  3DBS A;  4K7U A;  4M8M A;  4MGK E;  2K8H A;  2MP2 B;  4GXB A;  4URK A;  3VH4 B;  1TGZ B;  2K25 A;  2LAS A;  2PE6 B;  3UQA A;  1WMH A;  1WM3 A;  2DZK A;  2KAN A;  4CHK A;  4IM2 A;  1V81 A;  2ZPY A;  3PHX B;  2JRI B;  4DHJ D;  2L0T A;  2KTR B;  2KLG A;  2KQ7 A;  2HD5 B;  4TKN A;  3VTU A;  3KYD D;  3L17 A;  3ZW3 A;  2AYO B;  1NI2 A;  3K9O B;  2JY6 A;  2O2V A;  3A9K B;  3PSE B;  3DBR I;  2KLC A;  3PGE A;  3IVF A;  3RT3 B;  3TJP A;  2WWZ A;  1U4A A;  3ZLZ A;  2JXX A;  1GJZ A;  1WR6 E;  4HPM B;  3AUL A;  4B9K A;  3GZN I;  3OJ3 A;  4WWP A;  2MBO A;  2GBR A;  3L08 A;  3APC A;  2RD0 A;  3Q3F A;  4W9E A;  1E90 A;  2ZCB A;  4IW0 A;  4WJN A;  1WXV A;  3ALB A;  4F7Z A;  1P9D U;  5C23 A;  1H4R A;  4EFO A;  1WGD A;  4HVB A;  3JSV B;  4JGH B;  3VUY A;  1OEY J;  3KUZ A;  3JVZ X;  3MHS D;  3PHW B;  3O65 B;  3U7D A;  3HK0 A;  2KDB A;  2M0X A;  3LJ3 A;  2NBW B;  3UIN B;  1E5W A;  3L13 A;  2O6V B;  2KDF B;  2NBV B;  5AZH A;  2CHX A;  2BGF A;  3VH3 B;  4FJZ A;  1WZ0 A;  1V6E A;  2L05 A;  4TUU A;  4W9C A;  1Q5W B;  2BKF A;  5IAA C;  4G3X B;  1E8W A;  2ZVN A;  4DBG A;  1V9J A;  3WAO A;  4NAW A;  3DCG A;  4KZC A;  3ZTC A;  3CMM B;  2J0K A;  1EO6 A;  1S3S G;  3A33 B;  2K8B A;  4NY0 A;  4AJY B;  4CO7 A;  4WJP A;  4AP4 C;  4II3 B;  2UWQ A;  4DXA B;  3EC8 A;  4LJO B;  2LRU A;  3GOE A;  1WMH B;  5JZE B;  2BWF A;  3N3K B;  2ZNV B;  4MEL A;  5AZF A;  3SD5 A;  4NQK E;  3QA8 A;  3MJW A;  1HE8 A;  3DPD A;  4IG7 B;  4F8C B;  3DOW A;  3RUL A;  4BKT A;  4K7W A;  2DAF A;  3BIN A;  1I42 A;  1WE6 A;  3MTN B;  2O2V B;  2L7R A;  2RGF A;  2WX0 A;  4E74 A;  1YJ1 A;  1YD8 U;  2OOB B;  3AU5 A;  3DBL I;  2K39 A;  2N1V A;  4WQO B;  1WIA A;  2MCN B;  2MLB A;  3KH0 A;  1WZ3 A;  2EKE C;  2LGX A;  4P7I A;  1WX8 A;  2BKR B;  1XD3 B;  3PZD A;  4MM3 A;  3HM3 A;  3PRM B;  4FJY A;  4IWQ A;  2EMS A;  2O6V D;  3H1U A;  1LXD A;  5D6J B;  2MBB B;  4HPL B;  3AI5 A;  1L2N A;  4ZRI A;  2C60 A;  2L76 A;  2LD9 A;  4HJK A;  1WX7 A;  1OGW A;  3PLU A;  2ZZP B;  3HIZ A;  1KM7 A;  1R4M I;  1WGY A;  3ML9 A;  3JSV A;  3KUD B;  4AOF A;  3H7S A;  5J18 A;  2JT4 B;  2GBN A;  1WJ4 A;  3A9J A;  1V80 A;  3A4S C;  4DDI D;  4PYU A;  4W9F A;  3V60 A;  4AWJ A;  1YIW A;  2LUE A;  1EF1 A;  3ZTD A;  4TQ0 A;  2AL3 A;  3QQ8 B;  3M62 B;  2M1M A;  3WAM A;  3DVG Y;  3N32 A;  2DYO A;  4NAW B;  2PEA A;  4NNJ B;  2DZJ A;  4BVU C;  1R4N I;  2BYF A;  4MGZ E;  3QWZ B;  5E6O A;  4GOC A;  1SGH A;  1WI0 A;  2LGD A;  2IO2 B;  3NS8 A;  2DZI A;  2EMT A;  3ZNG C;  3EFU A;  3QC8 B;  4HXD A;  4MGI E;  2LGY A;  3VXW A;  4FN2 A;  5E6P A;  4BBN F;  3QIJ A;  3QAR A;  4K7S A;  3SU8 X;  4EZJ A;  3LDZ E;  4HCP B;  3PLV A;  2IO3 B;  3ZIM A;  5JHA A;  2FAZ A;  2K6Q A;  3B08 A;  2KKC A;  1Q1O A;  3PPA A;  2JVC A;  1P1A A;  1Q0W B;  4KSK C;  3EHV A;  2KNB A;  2LZ6 A;  2A5U A;  4W9G A;  5DPW A;  2KFK B;  3T8M A;  5JHB A;  1XQQ A;  5G2N A;  4HWI B;  4MGY E;  2NPT A;  2LVO A;  2GOW A;  4IM3 A;  3R66 C;  5KHO A;  1K8R B;  2C7H A;  2DHZ A;  2KOX A;  2PE9 A;  4GN1 A;  2NVU I;  2J0J A;  3KYC D;  4IUM B;  4M8N A;  4MEM A;  5CTR C;  1X1M A;  4ZRJ A;  3S2A A;  2KWU B;  3N30 A;  1V2Y A;  4PS7 A;  3RZW C;  2AWT A;  3DDC B;  3NZS A;  4FHJ A;  2OJR A;  5BO4 B;  4LJP B;  2IO0 B;  3PTF C;  3WA0 A;  5CHW A;  3DVN V;  3K9P B;  2KWV B;  4IWP A;  1SE9 A;  3W1S A;  1VD2 A;  2IYD B;  4EZL A;  5E6N A;  1KLV A;  2L3Z A;  1V49 A;  2Z59 B;  3ONS A;  5DPS A;  4DDG D;  2FID A;  1SIF A;  2WYQ A;  2B3A A;  3B0A A;  5DPT A;  2LXC A;  1NDD A;  2I1K A;  4DHZ B;  1E8Y A;  1KOT A;  3VTV A;  3OLM D;  3ZRF A;  2NBU A;  2KJR A;  3A9J B;  1E7V A;  2CU1 A;  2MBQ A;  4K1R B;  3ZNH B;  1M94 A;  3PRE A; 
#chains in the Genus database with same CATH topology
 2MX2 A;  3BY4 B;  1WH3 A;  4ZHO A;  2DYB A;  4ANV A;  4A55 A;  3A1Q B;  4YTM B;  3DHH C;  4DK5 A;  2MH7 A;  4GIV A;  3PZ8 A;  1J0G A;  1YOV B;  2VH1 A;  2JYT A;  3JW0 X;  3HRD D;  2R2O A;  2D2Q A;  3BK2 A;  3CSF A;  1I4H A;  3UGB B;  1AAR A;  1YN3 A;  3TEY A;  4EUT A;  3OJ4 B;  3P1M A;  3ZKJ C;  3N1X C;  2NPT B;  5DCN A;  4XWT A;  1WWT A;  2L83 A;  4US8 A;  4GDL A;  2KK8 A;  3HVD A;  4NJ7 A;  1RAX A;  2X8X X;  3FAH A;  4LDT B;  1NEK B;  1Y56 A;  2HE7 A;  1E7U A;  2WXM A;  2Y5B B;  3IT4 B;  1FCL A;  1UWM A;  3CST A;  1OEY A;  2I38 A;  1PDX A;  5AZG A;  1N5X A;  2V4L A;  4J6I A;  2WXL A;  2K6D B;  5G5H A;  1T0Y A;  4K81 A;  4ZYN A;  3IG3 A;  1WGG A;  1YX6 B;  1PUT A;  4MH0 E;  5J17 A;  2JUO A;  1DOX A;  4DXG A;  3A1Q A;  3RCZ A;  5BYQ A;  1ZOY B;  2EEL A;  2K0P A;  2R2Q A;  1FXI A;  5G55 A;  4KDI C;  4USA A;  3ENE A;  1SXT A;  2D10 A;  4ARC A;  2ZW1 A;  3VFK A;  3WCQ A;  4YWG G;  1JRU A;  4N6E B;  4XYC A;  5C1Z A;  1B1Z A;  1NVI D;  1ZE3 D;  1UH6 A;  4PK1 A;  1L7Y A;  1HA5 A;  3W1Y A;  2KWC A;  4GMV A;  3U7Z A;  4MJS A;  4KIK A;  1JWB D;  2D11 A;  4KGS A;  4IC7 B;  5EE0 A;  1WJU A;  2ZEQ A;  3BVM A;  2MQJ A;  2GBM A;  3RN9 C;  3L10 B;  1E8X A;  3B1L X;  2PVO D;  5HFY A;  3T3N A;  2VRR B;  1G6J A;  2KDM A;  1PGB A;  3TL5 A;  2C9W B;  2KQS A;  2ZJD A;  4NJ6 A;  1N62 A;  2REX A;  1GAQ B;  5FKA C;  1V86 A;  3AEG B;  1J19 A;  2JZP A;  2SEB D;  2WXJ A;  4L2Y A;  2VH2 A;  3HVZ A;  4DWF A;  3URY A;  2FCS A;  3M95 A;  1V97 A;  4W9D A;  1F52 A;  5LLI A;  2HTM E;  3DBR B;  3APD A;  3SHQ A;  1FNV A;  2IPK D;  3GP7 A;  3V61 A;  1L4Z B;  2C5L C;  1FD6 A;  2MP2 A;  1D3Z A;  4AS1 A;  1D5M C;  1TKY A;  4KZ0 A;  4MT5 A;  1D5X C;  2LXA A;  4WJO A;  4K3B A;  1P7E A;  2LJ5 A;  5CX3 A;  4C4V A;  2D3B A;  1HTQ A;  1JQ4 A;  4BKS A;  2FE8 A;  2N9E B;  2JF5 A;  1SIJ A;  4PS3 A;  5EE1 A;  5CHF A;  3QAQ A;  1WJ6 A;  4PS8 A;  4A3P A;  1SEB D;  4JLC A;  1WM2 A;  1FNU A;  4FA6 A;  4BFR A;  1P3Q U;  3RPF C;  3VUW A;  1FO4 A;  1FXT B;  2MBH A;  3BVZ A;  4ITK A;  4BOZ B;  4N59 A;  1NYQ A;  1WGH A;  3ZVV A;  2M8S A;  4JQW C;  4GDK B;  2J7Q B;  2G3Q B;  1C77 A;  1WSP A;  2IDY A;  1P0R A;  3AE1 B;  1EF5 A;  3VVW B;  4P1B C;  4LDT D;  1K53 A;  1N6Z A;  2CHZ A;  3DBS A;  4M8M A;  5C3J B;  2K8H A;  1TKG A;  4P1C C;  3W2D A;  1TGZ B;  2K25 A;  2DZK A;  3MHZ A;  2ZPY A;  2QEJ C;  4LNO A;  2KTR B;  2KQ7 A;  1NEN B;  3KYD D;  1R4M B;  3DBR I;  1JRP A;  2KLC A;  2VZK D;  3IVF A;  3NS1 A;  1HZ5 A;  2Z8L A;  1SE3 A;  1GJZ A;  3AUL A;  4B9K A;  3OJ3 A;  2GBR A;  3ZQ4 A;  2BBC A;  2J42 A;  1WXV A;  1R4N B;  1J7C A;  5C23 A;  1WGD A;  1KTK A;  4JGH B;  3KUZ A;  3PHW B;  2NBW B;  2O6V B;  2NBV B;  3ZXV A;  2JXT A;  4FJZ A;  1NYR A;  1V6E A;  4WIP A;  4W9C A;  1ZP0 B;  1Q5W B;  3C19 A;  3I9V 1;  2J0K A;  1EO6 A;  1IBX A;  2AQ2 B;  1V1P B;  4WJP A;  4AP4 C;  1JWA D;  2UU7 A;  3AN1 A;  2HDE A;  3EC8 A;  3EGR A;  2LRU A;  3RNB C;  1WMH B;  3N3K B;  4MEL A;  3SD5 A;  5AZF A;  4NQK E;  3Q8B A;  2W55 A;  1F77 A;  1IGD A;  2WP9 B;  3B9J A;  2O2V B;  2K5P A;  1YD8 U;  2INC C;  2EKE C;  3R8B A;  4P7I A;  1WXQ A;  2BKR B;  3AEE B;  3PRM B;  2EMS A;  1LXD A;  1I4P A;  4C00 A;  3AI5 A;  1L2N A;  2C60 A;  1R4M I;  3BWU D;  1V80 A;  4DDI D;  4PYU A;  4W9F A;  4K3C A;  2Y3A A;  4M0W A;  3ZTD A;  3M62 B;  4NNJ B;  2WDR B;  2DZJ A;  4BVU C;  1R4N I;  4MGZ E;  2JQR B;  2LGD A;  1N5W A;  5IOI A;  3KQ4 A;  2LGY A;  2WLB A;  1TS3 A;  1YQ4 B;  1V1P A;  3QIJ A;  3SU8 X;  2J52 A;  4HCP B;  1JAL A;  2IGH A;  1C9F A;  5JHA A;  2KKC A;  2N0S B;  4KSK C;  4W9G A;  2KNB A;  5DPW A;  2KFK B;  1XQQ A;  3VR8 B;  2KYW A;  2KAC A;  4MGY E;  2LVO A;  2GOW A;  4GN1 A;  3KYC D;  1WGK A;  5CTR C;  1UF0 A;  2KWU B;  3DDC B;  2FUG 1;  3KLS X;  1RM6 C;  2AX5 A;  3PTF C;  2B76 B;  1SE9 A;  3R2I A;  5E6N A;  2Z59 B;  5DPS A;  2FID A;  1SIF A;  1VR9 A;  2WYQ A;  4OVZ A;  5DPT A;  1FFU A;  1DOY A;  1TS4 A;  1E7V A;  2LUM A;  2CJO A;  1DOI A;  4EKU A;  4ZOH C;  4II2 B;  1N61 A;  3APF A;  3BVG A;  4HRS A;  3ZXR A;  3RNC C;  1FXA A;  2RDH A;  3L0W B;  1UD7 A;  3GS2 A;  2KC2 A;  2QC8 A;  2KXJ A;  5IO9 A;  2KDI A;  2QCZ A;  2DYM A;  1ACC A;  1T0R C;  1TY2 A;  2ONQ A;  3PRZ A;  3E56 A;  2KD0 A;  2KFK A;  5IP4 D;  2PPH A;  2QIL A;  4A3O A;  1I4R A;  1VRA B;  1WXA A;  1BXT A;  4ASW C;  2GMI C;  3U52 E;  4REZ A;  3Q8F A;  4C80 A;  2AL6 A;  1K50 A;  1HXY D;  1GB1 A;  2D3C A;  2FCN A;  3HUI A;  3N1Z C;  5HHD G;  5TSS A;  1UBQ A;  3R7Q A;  3EA6 A;  2Z0E B;  2NTT A;  4RM9 A;  1WXM A;  4W9H A;  2DBY A;  1WR1 A;  1BML C;  1MG8 A;  1XF5 L;  1E10 A;  3Q8E A;  3RMK C;  2V0G A;  1WX9 A;  1V1O A;  3IAS 1;  3TCA A;  2J0M A;  1MI0 A;  1QLB B;  2KX3 A;  5L95 C;  3Q14 C;  3KVF B;  2CHW A;  1QOB A;  1XLO A;  1TZ1 A;  2ASQ A;  3DVG X;  4RCO A;  2LVP A;  2L00 B;  1FRD A;  1LM8 B;  2GBJ A;  2BTE A;  2M56 B;  4XZ4 A;  1RRB A;  4GDL B;  1YQ3 B;  3BZD B;  4FXC A;  4W9J A;  4X57 B;  4YL8 A;  1QKZ A;  1QT9 A;  4G50 A;  4KSL C;  3CWI A;  3TBL D;  1IYF A;  3BII D;  3H7P A;  3PT2 B;  1Z2M A;  5HG2 A;  1T6B X;  4LLG M;  2LI5 A;  4HK2 A;  4FUL A;  3GE3 C;  3V6C B;  1QZE A;  1VZ7 A;  3R3M A;  4XDD A;  3ECI A;  3NZU A;  1FNW A;  4LNK A;  3Q69 A;  2KVZ A;  1HQR D;  2L0F A;  4NPN A;  2MJE A;  2LRW A;  3V62 A;  2M0A A;  1Y8R C;  3AV8 A;  3WAP A;  1WRD B;  1JCK B;  2PW9 A;  4EEW A;  3Q3J A;  4KGT A;  4A9A A;  4ZDV A;  2ZCC A;  4WWO A;  3KW5 B;  3TEX A;  3P4R B;  3ZDM C;  4M02 A;  2MSE D;  1TT5 B;  5FR6 A;  3ZUN A;  2V3P A;  1OQY A;  1SSN A;  2G4S A;  2M19 A;  4W9I A;  2KWD A;  4MJS B;  4KIK B;  1ET6 A;  2KN5 A;  1D6E C;  2W82 A;  5JH5 C;  2BYV E;  1EM7 A;  1WGR A;  4GSW A;  3ML8 A;  4A8X C;  3H6N A;  5GXG B;  3RZF A;  1FIQ A;  2WXG A;  3IT6 B;  1VCB A;  2KN4 A;  3X0W A;  2BB5 A;  1UZX B;  3PS6 A;  3I63 C;  1V8C A;  2BYE A;  3T9L A;  2IBI B;  3HM6 X;  2D3A A;  3VQI A;  3NVV A;  4EOY A;  1YNT E;  2XBB C;  5AUI A;  4ANW A;  1SE2 A;  3KWV A;  2VZK B;  5TR5 A;  4WJQ A;  2GBK A;  3UQB A;  3IHP C;  1ZPS A;  2KQ4 X;  1TKE A;  3VDZ A;  1WF9 A;  3NRZ A;  4L23 A;  3I3T B;  4BBN C;  5LXH A;  5BMH A;  4HPP A;  3VTW A;  2I1J A;  1XT9 B;  3SFD B;  1JWM D;  1GNU A;  1H8C A;  5J2R A;  2EKI A;  4AJW A;  2D07 B;  2BT6 A;  3MC9 A;  2JSV X;  4IM0 A;  4MGK E;  3W9C B;  1YJJ A;  4KKI A;  3FIL B;  2MP2 B;  3VH4 B;  2PE6 B;  1QQR A;  1WM3 A;  1ZXI A;  2KAN A;  4IM2 A;  3PHX B;  4B0M A;  4C4V B;  2AYO B;  3K9O B;  1PYW D;  2WDV B;  3RT3 B;  3KWL A;  3TJP A;  2WWZ A;  3NUH B;  4DXF A;  2JXX A;  5I4D A;  2MBO A;  3APC A;  4W9E A;  1E90 A;  2ZCB A;  4IW0 A;  2LGS A;  1UGJ A;  3Q3O C;  2GB1 A;  1OEY J;  3JVZ X;  2XNA C;  3MHS D;  3U7D A;  2JU6 X;  1YJI A;  1E5W A;  3L13 A;  3VH3 B;  2BGF A;  3E9S A;  1ZUD 2;  4TUU A;  2BKF A;  4G3X B;  3AED B;  1E8W A;  1HTO A;  4DBG A;  4KGR A;  4NAW A;  3DCG A;  4IOI E;  1I4X A;  5EE9 A;  3N9Y C;  4CO7 A;  1F2R I;  3OG5 A;  4MH8 A;  2JYE A;  2E6X A;  3FIL A;  2ZNV B;  1C4C A;  2LFI A;  3NG0 A;  4TSS A;  4BKT A;  1QOA A;  4YTN B;  4K7W A;  3MTN B;  2L7R A;  4WQO B;  1WIA A;  3MFG A;  3PZ7 A;  2LGX A;  1WRI A;  3PZD A;  4MM3 A;  4IDI A;  3H1U A;  2MBB B;  4HPL B;  1PGA A;  5EE3 A;  4XE0 A;  2ZZP B;  1RFK A;  1WGY A;  1FMA D;  2GBN A;  1WJ4 A;  3A9J A;  4R3D A;  4C7Z A;  4AWJ A;  1T3Q A;  2IGD A;  3QQ8 B;  3DVG Y;  2PEA A;  2BYF A;  5E6O A;  1IBX B;  4JE3 B;  2IO2 B;  4JX1 C;  3VXW A;  5IKC M;  1E0Z A;  1CQV A;  3QAR A;  1R7S A;  3LDZ E;  3GE8 C;  1Q1O A;  4RNA A;  2WQY B;  3AE3 B;  1XLP A;  2BQQ A;  1WYG A;  4RF1 A;  2A5U A;  1YMH E;  2KT7 A;  4KX6 B;  4IM3 A;  2DHZ A;  2PE9 A;  3AE2 B;  2J0J A;  3S2A A;  3N30 A;  4PS7 A;  3RZW C;  2RDG A;  3TEW A;  2AWT A;  2HJ1 A;  1PFD A;  2OJR A;  4LJP B;  3WA0 A;  3DVN V;  3K9P B;  3W1S A;  2L3Z A;  3AE6 B;  3ONS A;  2V9H A;  3BYT B;  1E8Y A;  2XN9 C;  3R2T A;  1VLB A;  3CIR B;  2L52 A;  2ICI A;  3PRE A;  4IUM B;  2N9X A;  4M0W B;  4TV3 A;  1TJE A;  1IUE A;  1CMX B;  4E71 A;  4FBJ B;  4KVG B;  3QX1 A;  1ZGU B;  1FPY A;  4A6Q A;  2L8J A;  2YEP F;  1V5T A;  2W9N A;  1S1Q B;  1ZDV A;  1D4B A;  2Q5W D;  3SDL C;  2WXP A;  3X23 A;  4RM8 A;  3NY5 A;  2WXH A;  2BW2 A;  1F9J A;  3OAW A;  4BKS D;  3PVL A;  1YQB A;  3J9C A;  2HTH A;  2AEH A;  1AW7 A;  5IN7 A;  2N9P C;  4MSQ B;  2D3G A;  3M3J A;  4F1S A;  1XLQ A;  5LXI B;  3MP9 A;  1FEH A;  2D5G A;  2V1Y A;  2N9L A;  1FCC C;  1QOF A;  1KH0 A;  3AMZ A;  1YN5 A;  5D7G A;  3ZGZ A;  1UNS A;  2W3S A;  1MPE A;  2QMT A;  4MAC A;  5KHQ A;  3W5V B;  3UIO B;  2YEP B;  2KJ6 A;  1ZKH A;  2KVR A;  4KV2 A;  2KC1 A;  3P4Q B;  2M17 A;  4G0N B;  4DQO C;  4W9L A;  1BUI C;  4MDK E;  2PTL A;  2G4D B;  2CU3 A;  2KFJ A;  4GGQ A;  4DHJ B;  3RNG C;  1FFV A;  4KKJ A;  1GG3 A;  1WFY A;  4OVV A;  1AN8 A;  2MWS B;  3EEC A;  3RD2 A;  4EE2 A;  3WAN A;  3V6E B;  2XEW A;  3U4E G;  2ACZ B;  3ZJV A;  3ZNI D;  1DGJ A;  4WH4 A;  1EWY C;  5IA7 A;  3LB8 C;  5LNK 1;  2XK5 A;  2RSU A;  3V05 A;  2ZW0 A;  1L6V A;  4IWO A;  3AXC A;  1PGX A;  4LTU A;  4JIO U;  2AQ1 B;  4TQ1 A;  2BPS A;  1L0V B;  3AU4 A;  4OVU A;  5D3D A;  2N1W A;  4PT5 A;  3IFW B;  3P4S B;  1JWU D;  1GPX A;  2N4F A;  2C7N B;  3VHT C;  3DHI C;  3Q3M C;  4KDL B;  4WWN A;  1BT0 A;  3PRP B;  2QHO A;  4DHZ E;  4FAD A;  1TS2 A;  4B6W A;  1NI3 A;  1CZP A;  3TIX A;  4JPS A;  5L83 A;  1EU3 A;  1TBE A;  5CHV C;  2MEK A;  2NMQ A;  4ICU A;  1WYW B;  4E3C A;  4QAY A;  4B95 A;  4HDQ A;  1I4Q A;  2UYZ B;  1WE7 A;  2WXN A;  2MBE A;  3TSS A;  4FLH A;  4JWS C;  1RYJ A;  2YLM A;  4FHK A;  1M4V A;  1ROE A;  1MG4 A;  3NVZ A;  2IO1 B;  3RNA C;  1JW9 D;  3Q3N C;  1C78 A;  4XDC A;  3N20 C;  2FUH B;  2IGG A;  1HEZ E;  3GZN B;  2CS4 A;  1OQR A;  2KMC A;  3M63 B;  1SJE D;  1KFY B;  5H92 C;  2PVG C;  4EZK A;  2WX1 A;  3AE4 B;  3H7P B;  2Z0D B;  3NHE B;  4N9F 4;  4S17 A;  2WDQ B;  3A9K A;  4GU2 A;  3FKY A;  1EWC A;  3AEA B;  3R7R A;  3ZDT A;  2IJ0 A;  4NQL B;  3AEB B;  3L4P A;  3U2S C;  2K22 A;  1B9R A;  2RMM A;  4HJG E;  4UDU C;  3TMP B;  1MHX A;  2DWQ A;  1TTN A;  2MJ3 A;  3OWE B;  1ISN A;  4L1B A;  5AUK A;  3O13 A;  4WWM A;  2DEN B;  3D32 A;  4WAA A;  3L16 A;  3ZRC A;  3IXS A;  1I4G A;  2JWZ A;  2JRH A;  1E8Z A;  1V5O A;  1YX5 B;  3Q8C A;  3LYY A;  3U8Z A;  1GC6 A;  3P42 A;  2NR2 A;  1RFA A;  2J4X A;  4O1N A;  2PMV A;  3DBL B;  2WXF A;  1T5X D;  1UBI A;  4I6P A;  4K7U A;  1KLU D;  2K3U A;  3RFZ B;  2LAS A;  1XLN A;  3VR9 B;  3RNE C;  4CHK A;  1V81 A;  1F1H A;  3ABV B;  4DHJ D;  4NAM A;  4TKN A;  3L17 A;  3H8H A;  1NI2 A;  3PSE B;  3I57 A;  1L0X B;  3ZLZ A;  3GZN I;  2RD0 A;  2WU5 B;  1C4A A;  4WJN A;  3AE8 B;  4F7Z A;  1P9D U;  4B0E A;  1H4R A;  4EFO A;  4HVB A;  1T0S C;  1E6E B;  1SBB B;  2BS4 B;  2KDB A;  2BVC A;  3UIN B;  5AZH A;  2CHX A;  5HI1 A;  1ZXH A;  2LHE A;  5E6J A;  2L05 A;  2ZVN A;  4RF0 A;  1V9J A;  4WUR A;  1XEE A;  4KZC A;  3ZYY X;  4YSX B;  3A33 B;  1E9M A;  2PLP A;  4NY0 A;  4AJY B;  4LNI A;  1JWS D;  4DXA B;  2ON8 A;  4LJO B;  2H88 B;  3GOE A;  2RPV A;  2WXK A;  3QA8 A;  2GI9 A;  4CQN A;  3DOW A;  3RUL A;  2DAF A;  1I42 A;  2KAJ A;  3B2G A;  2RGF A;  1SE4 A;  2WX0 A;  1YJ1 A;  3DBL I;  2K39 A;  2MCN B;  2MLB A;  3KH0 A;  2G9H D;  2WNM A;  2N9K A;  1XD3 B;  4FJY A;  4IWQ A;  5D6J B;  2Y5P A;  1FM0 D;  2L76 A;  1WX7 A;  1OGW A;  3HIZ A;  1KM7 A;  5D3I B;  1IGC A;  4AOF A;  3DHG C;  3H7S A;  5J18 A;  1L5P A;  3DWM A;  2JX5 A;  3V60 A;  4TQ0 A;  1N60 A;  1J7B A;  3WAM A;  4NAW B;  3QWZ B;  4RGT A;  4YSZ B;  1WI0 A;  2EMT A;  3ZNG C;  3QC8 B;  1LO5 D;  4MGI E;  4FN2 A;  2BS3 B;  4RH6 A;  4K7S A;  4HKQ A;  3RI7 C;  1ET9 A;  1I7H A;  3PLV A;  3ZIM A;  4RFB A;  2FAZ A;  2K6Q A;  2QIE B;  3B08 A;  3PPA A;  2LZ6 A;  3T8M A;  4P6V F;  4HWI B;  2NPT A;  2PKO A;  1XO3 A;  4LNN A;  3R66 C;  5KHO A;  1K8R B;  2C7H A;  2KOX A;  4RGM A;  5G5G A;  2NVU I;  3W5U B;  4MEM A;  1L0Y B;  4MM3 B;  1V2Y A;  1Q10 A;  2OJW A;  1XCQ L;  3LXF A;  4FHJ A;  2IO0 B;  2BB6 A;  2KWV B;  1VD2 A;  4EZL A;  1KLV A;  2V4I B;  1UWX A;  4DDG D;  2B3A A;  1LGR A;  2LXC A;  1NDD A;  2I1K A;  1KOT A;  3VTV A;  3OLM D;  2GRI A;  1KF6 B;  3A9J B;  2CU1 A;  2MBQ A;  4D2K A;  3ZNH B;  2G1E A;  2E3T A;  2JWU A;  2FBW B;  1C3T A;  2WGS A;  3FC4 A;  1TYG B;  3VAW A;  4BOS C;  4OZB A;  1LFD A;  3NJT A;  4BKG A;  4HLE A;  3WAL A;  1J8C A;  1WXS A;  2HJ8 A;  5D94 A;  2JZZ A;  2LHD A;  4HEA 1;  3BYY B;  1FRR A;  2FCM A;  3SEB A;  2X38 A;  4YT0 B;  2KHW B;  1MVK A;  1F2R C;  2MW5 A;  3AE7 B;  3NOB A;  4BZA A;  2BWE S;  1E7P B;  3SR6 A;  3AEC B;  2YVC A;  4OZA A;  1A5R A;  1Z5S B;  1GC7 A;  3N1Y C;  4YXD B;  4BAX A;  3ZO5 B;  1RLF A;  3EFC A;  1VJK A;  2H89 B;  2M4N A;  3P2B A;  1I35 A;  1RWS A;  2KMA A;  2OED A;  2AQ3 B;  3Q8A A;  4A20 A;  2DAJ A;  2IY0 B;  1NBF C;  1F0Z A;  2KZR A;  1A70 A;  4ZRK A;  1OTR B;  3QHT A;  3IBE A;  2IY1 B;  3Q6B A;  4ANU A;  1WJN A;  3VRB B;  3AE9 B;  3DBH B;  2IZV B;  4ICV A;  5EDS A;  2QSD A;  3RUI B;  3UIP B;  4W9K A;  1ZDX A;  3QJZ A;  4P16 A;  1LQB A;  4G11 A;  2C7M B;  2FCQ A;  2RR9 A;  2ZVO A;  4NJC A;  4ZYS A;  1JML A;  3TUO A;  2RDB C;  3WIM A;  1GUA B;  2INP E;  4RGN A;  1HZ6 A;  1C4P A;  2A4Z A;  4MSM B;  4ZHP A;  5MPO A;  2MHJ A;  4S0R A;  2KO3 A;  4HRO A;  3QK0 A;  1D5Z C;  1ZW7 A;  4OHJ A;  3HHM A;  2RPQ A;  2LWP A;  1IP9 A;  4JL9 A;  4ZRP A;  2OHF A;  2NCN A;  4HDO A;  2TSS A;  2N7J A;  3KUC B;  4XX5 A;  2ZNV C;  4XGA B;  1ENF A;  3MC8 A;  2MJD A;  2PIA A;  2WXR A;  3CF6 E;  3C0R B;  2NS5 A;  3QCA A;  1WY8 A;  2ZPN A;  2FNJ B;  2V3S A;  2K1F A;  2SAK A;  4FJV B;  2DX5 B;  3VUX A;  4ANX A;  1XXG A;  3H9D A;  4I6L B;  5JXV A;  2G45 B;  2MA9 B;  2W3R A;  1KJT A;  2BF8 B;  3W1S C;  4WQM A;  2LJI A;  4ACF A;  2WXQ A;  3T3O A;  4RGO S;  5FK9 C;  2IND C;  4RMA A;  3DBH I;  4YTP B;  3DVN U;  2XK5 B;  2BS2 B;  1IPG A;  1J7A A;  3RYT A;  4HCN B;  2N7E A;  3U30 A;  4GDK A;  3L54 A;  4AUQ C;  1EUV B;  3ZJT A;  1K51 A;  2JPH A;  2MRP A;  1KRH A;  4CYE A;  3BK1 A;  1DYQ A;  2K8C A;  3A4R A;  3UF8 A;  2W54 A;  1UGM A;  4LK0 M;  2WU2 B;  2KTR A;  4C56 C;  1STE A;  2DZM A;  2KTF A;  2PJH A;  3GB1 A;  5AEK B;  3I5J C;  1GOZ A;  4H2A A;  2JZ3 B;  2CR5 A;  2KDE B;  4PYZ A;  5D2M B;  4XC2 A;  1UEL A;  1EU4 A;  3TEZ A;  3PO0 A;  1PQS A;  4GLS C;  1OQQ A;  2FIF A;  2N7D A;  1VDV A;  5FR3 A;  1VZ8 A;  4A90 A;  4IKG A;  3B2F A;  1QOG A;  2CKH B;  3DQV A;  4GB9 A;  2O6V A;  1C1Y B;  2KJH B;  4HKZ E;  5BMG A;  1P98 A;  3JYU A;  4LCD E;  4AQ7 A;  2WDT B;  2KX0 A;  1CJE A;  3PV1 A;  2V3N A;  4JWU C;  2DLB A;  5GMV A;  1ESF A;  1CK1 A;  2KMM A;  2LVQ A;  5DPR A;  5HKH A;  3ZNZ B;  4I6N B;  1TY0 A;  2WXI A;  3ZJU A;  4GXB A;  4URK A;  4TMA B;  2Y5C A;  1VZ6 A;  1C79 A;  3UQA A;  1WMH A;  2JRI B;  2L0T A;  3VTU A;  2KLG A;  2HD5 B;  4Q2J A;  3ZW3 A;  2JY6 A;  2O2V A;  3A9K B;  1L6U A;  1T0Q C;  3PGE A;  2K9X A;  2R61 A;  3IAM 1;  4LNF A;  1U4A A;  4WAF A;  1WR6 E;  4HPM B;  1QF6 A;  4WWP A;  5BYS A;  3L08 A;  3DWG C;  3Q3F A;  1MHH E;  1AWD A;  3ALB A;  3P63 A;  4OZC A;  3JSV B;  1SB3 C;  3VUY A;  3C8Y A;  3O65 B;  1SF0 A;  2M0X A;  3HK0 A;  3LJ3 A;  1JRO A;  5T8I A;  4XWW A;  2KDF B;  1WZ0 A;  5IAA C;  3AH7 A;  3MJ5 A;  2DNF A;  3WAO A;  1KLG D;  3AEF B;  1L4D B;  3ZTC A;  3CMM B;  2L32 A;  1S3S G;  2K8B A;  2L1A A;  4II3 B;  2UWQ A;  4YSY B;  4N58 A;  2BWF A;  5JZE B;  3MJW A;  4OW0 A;  1HE8 A;  3DPD A;  4IG7 B;  4F8C B;  3BIN A;  1WE6 A;  3NVY A;  4ZRQ A;  4E74 A;  2OOB B;  3RNF C;  3AU5 A;  2N1V A;  2CJN A;  1WZ3 A;  1WX8 A;  2QJL A;  3HM3 A;  1QIL A;  2O6V D;  4ZRI A;  1GB4 A;  2LD9 A;  4HJK A;  3PLU A;  5BMI A;  3ML9 A;  3JSV A;  3KUD B;  4US9 A;  2JT4 B;  4M00 A;  1UUP A;  3A4S C;  3ETR A;  1MFW A;  2GLS A;  1YIW A;  2LUE A;  1EF1 A;  2I2Y A;  2AL3 A;  3V3X A;  1XCT L;  2M1M A;  3AE5 B;  3N32 A;  1N63 A;  2DYO A;  4GOC A;  1SGH A;  3NS8 A;  1K52 A;  2DZI A;  1OFF A;  2LEK A;  3EFU A;  2QDF A;  3P4P B;  4HXD A;  3NZ3 A;  2WS3 B;  5E6P A;  3VRA B;  4BBN F;  2WXO A;  4J3O D;  4EZJ A;  1YN4 A;  2J53 A;  2INN E;  2IO3 B;  3NVW A;  5C2T B;  1MJD A;  2JVC A;  3MC0 B;  1P1A A;  1Q0W B;  5BYR A;  4ARI A;  3AM9 A;  4NZL B;  3EHV A;  5JHB A;  2WHI A;  5G2N A;  3Q2A C;  2NTS A;  2LGI A;  4M8N A;  1C76 A;  1X1M A;  1SJH D;  4ZRJ A;  3NZS A;  5BO4 B;  1TIF A;  3EUB 2;  5CHW A;  4IWP A;  1TS5 A;  5H8Y E;  2IYD B;  1V49 A;  3SFE B;  4C7Y A;  4M01 A;  3UI3 A;  3B0A A;  4DHZ B;  3ZRF A;  2NBU A;  2KJR A;  3AB5 A;  1AYF A;  1TZO A;  4K1R B;  2BYT A;  1M94 A;  2LMC A;  1P7F A; 
#chains in the Genus database with same CATH homology
 1C3T A;  2N9X A;  3VAW A;  4TV3 A;  4BOS C;  2MX2 A;  3BY4 B;  1CMX B;  1LFD A;  4EKU A;  1WH3 A;  4BKG A;  4E71 A;  4HLE A;  4FBJ B;  4KVG B;  4II2 B;  2DYB A;  3QX1 A;  3WAL A;  4ANV A;  1J8C A;  1ZGU B;  1WXS A;  2HJ8 A;  5D94 A;  2JZZ A;  3APF A;  2L8J A;  1V5T A;  2W9N A;  1S1Q B;  2FCM A;  3A1Q B;  3L0W B;  4DK5 A;  1UD7 A;  3SDL C;  2KHW B;  2KC2 A;  3X23 A;  4RM8 A;  2KXJ A;  2MW5 A;  3NY5 A;  2KDI A;  4GIV A;  1F9J A;  3OAW A;  4BKS D;  1J0G A;  3NOB A;  2DYM A;  3JW0 X;  2BWE S;  2R2O A;  3PVL A;  1YQB A;  2D2Q A;  2HTH A;  3CSF A;  2AEH A;  3UGB B;  3PRZ A;  2YVC A;  1AAR A;  1A5R A;  2N9P C;  4MSQ B;  1Z5S B;  4EUT A;  3OJ4 B;  1GC7 A;  2D3G A;  3M3J A;  3ZKJ C;  2KD0 A;  2NPT B;  4F1S A;  2KFK A;  5DCN A;  5LXI B;  2V1Y A;  2PPH A;  4A3O A;  3ZO5 B;  1RLF A;  3P2B A;  1WXA A;  2M4N A;  1I35 A;  4GDL A;  2KK8 A;  2KMA A;  4ASW C;  4A20 A;  2DAJ A;  5D7G A;  2GMI C;  2IY0 B;  1NBF C;  4NJ7 A;  2KZR A;  2AL6 A;  1RAX A;  4ZRK A;  4LDT B;  5KHQ A;  1OTR B;  2FCN A;  2HE7 A;  3QHT A;  1E7U A;  2Y5B B;  3UIO B;  2KJ6 A;  1ZKH A;  2KVR A;  1OEY A;  3CST A;  3IBE A;  2IY1 B;  4KV2 A;  2KC1 A;  4ANU A;  1UBQ A;  2M17 A;  1WJN A;  4G0N B;  5AZG A;  3R7Q A;  2V4L A;  2Z0E B;  4ICV A;  2IZV B;  4J6I A;  4RM9 A;  1WXM A;  4W9L A;  4W9H A;  5EDS A;  2K6D B;  3RUI B;  3UIP B;  4MDK E;  4W9K A;  1T0Y A;  1WR1 A;  2G4D B;  4K81 A;  4ZYN A;  2KFJ A;  3IG3 A;  3QJZ A;  4GGQ A;  4DHJ B;  1MG8 A;  1WGG A;  1LQB A;  4G11 A;  1YX6 B;  2C7M B;  1GG3 A;  2FCQ A;  1WFY A;  2RR9 A;  4MH0 E;  2ZVO A;  4OVV A;  5J17 A;  1WX9 A;  2MWS B;  3EEC A;  3RD2 A;  3WAN A;  3V6E B;  2JUO A;  2XEW A;  3TCA A;  2J0M A;  3WIM A;  3A1Q A;  3ZNI D;  1GUA B;  3RCZ A;  2KX3 A;  5L95 C;  5IA7 A;  2R2Q A;  3KVF B;  2CHW A;  2RSU A;  2XK5 A;  5G55 A;  4KDI C;  2A4Z A;  4MSM B;  2KO3 A;  3QK0 A;  4IWO A;  1TZ1 A;  2ASQ A;  3AXC A;  3DVG X;  3ENE A;  2D10 A;  4JIO U;  2LVP A;  4TQ1 A;  1ZW7 A;  2BPS A;  2L00 B;  3HHM A;  3VFK A;  1LM8 B;  2GBJ A;  2RPQ A;  2LWP A;  1JRU A;  3AU4 A;  4JL9 A;  1IP9 A;  4OVU A;  5C1Z A;  4XZ4 A;  1RRB A;  2N1W A;  1UH6 A;  2NCN A;  4GDL B;  1L7Y A;  4HDO A;  3IFW B;  2KWC A;  3W1Y A;  4GMV A;  2N4F A;  2C7N B;  4KIK A;  4MJS A;  3VHT C;  3KUC B;  4W9J A;  4XX5 A;  2D11 A;  2ZNV C;  4X57 B;  4IC7 B;  4YL8 A;  4WWN A;  4KDL B;  1BT0 A;  4G50 A;  4KSL C;  1WJU A;  2ZEQ A;  3TBL D;  1IYF A;  2MQJ A;  3H7P A;  3PT2 B;  3CF6 E;  1Z2M A;  3C0R B;  2GBM A;  2NS5 A;  3QCA A;  1WY8 A;  2ZPN A;  3PRP B;  2FNJ B;  2V3S A;  2K1F A;  4FJV B;  3L10 B;  2LI5 A;  4HK2 A;  2QHO A;  4FUL A;  2DX5 B;  4DHZ E;  3V6C B;  3VUX A;  4ANX A;  1QZE A;  4FAD A;  3H9D A;  3R3M A;  1E8X A;  3B1L X;  4B6W A;  4I6L B;  3TIX A;  3ECI A;  3NZU A;  2G45 B;  2MA9 B;  2VRR B;  5L83 A;  1G6J A;  1KJT A;  2BF8 B;  1TBE A;  2L0F A;  3W1S C;  3TL5 A;  5CHV C;  2C9W B;  2KQS A;  2ZJD A;  1WYW B;  4ICU A;  4NJ6 A;  4E3C A;  4B95 A;  4NPN A;  2LRW A;  4HDQ A;  3V62 A;  2REX A;  2UYZ B;  1WE7 A;  1V86 A;  1Y8R C;  1J19 A;  2MBE A;  4RMA A;  1WRD B;  3WAP A;  4FLH A;  3DBH I;  4EEW A;  3DVN U;  2XK5 B;  3Q3J A;  4ZDV A;  2ZCC A;  1IPG A;  4WWO A;  3RYT A;  4HCN B;  2N7E A;  3KW5 B;  4DWF A;  2YLM A;  3U30 A;  4FHK A;  4GDK A;  3L54 A;  3ZDM C;  2FCS A;  3M95 A;  4AUQ C;  1EUV B;  4W9D A;  2MSE D;  5LLI A;  2IO1 B;  5FR6 A;  2JPH A;  2MRP A;  3ZUN A;  3APD A;  3SHQ A;  1OQY A;  2G4S A;  2FUH B;  4CYE A;  4W9I A;  2K8C A;  4KIK B;  4MJS B;  3V61 A;  2KN5 A;  3A4R A;  2C5L C;  2CS4 A;  2MP2 A;  2BYV E;  1WGR A;  4GSW A;  2KMC A;  5JH5 C;  1D3Z A;  3ML8 A;  3M63 B;  3UF8 A;  3H6N A;  3RZF A;  4M0W B;  1UGM A;  4KZ0 A;  4EZK A;  2WX1 A;  1VCB A;  3H7P B;  2Z0D B;  3NHE B;  4N9F 4;  2KTR A;  4WJO A;  2LXA A;  3X0W A;  2DZM A;  1UZX B;  2KTF A;  2PJH A;  2LJ5 A;  5CX3 A;  3PS6 A;  5AEK B;  3T9L A;  2BYE A;  3A9K A;  4GU2 A;  2JZ3 B;  2N9E B;  4BKS A;  2JF5 A;  2IBI B;  3HM6 X;  2CR5 A;  4PS3 A;  5CHF A;  3QAQ A;  1WJ6 A;  4PS8 A;  3R7R A;  4A3P A;  2KDE B;  4PYZ A;  5D2M B;  3ZDT A;  4JLC A;  3VQI A;  1WM2 A;  4EOY A;  4XC2 A;  4NQL B;  1UEL A;  4FA6 A;  4BFR A;  2XBB C;  1P3Q U;  1PQS A;  4ANW A;  3VUW A;  2FIF A;  5TR5 A;  2N7D A;  1FXT B;  3TMP B;  2MBH A;  4WJQ A;  1TTN A;  1ISN A;  4BOZ B;  2GBK A;  3UQB A;  3IHP C;  2DEN B;  3D32 A;  3VDZ A;  4WAA A;  1WF9 A;  3L16 A;  3I3T B;  4BBN C;  3ZRC A;  2CKH B;  5LXH A;  3DQV A;  1WGH A;  2O6V A;  2M8S A;  4GB9 A;  4JQW C;  3ZVV A;  3VTW A;  1C1Y B;  2JWZ A;  2JRH A;  2KJH B;  4GDK B;  1E8Z A;  1P98 A;  1V5O A;  2I1J A;  1YX5 B;  3JYU A;  1XT9 B;  2J7Q B;  4LCD E;  2G3Q B;  2WDT B;  2KX0 A;  1GNU A;  3PV1 A;  1H8C A;  5J2R A;  4AJW A;  1P0R A;  2D07 B;  3U8Z A;  1GC6 A;  1EF5 A;  2NR2 A;  1RFA A;  3VVW B;  4LDT D;  5GMV A;  5HKH A;  2LVQ A;  5DPR A;  3ZNZ B;  4IM0 A;  1UBI A;  4I6P A;  4I6N B;  2CHZ A;  3DBS A;  4K7U A;  4M8M A;  4MGK E;  2K8H A;  2MP2 B;  4GXB A;  4URK A;  3VH4 B;  1TGZ B;  2K25 A;  2LAS A;  2PE6 B;  3UQA A;  1WMH A;  1WM3 A;  2DZK A;  2KAN A;  4CHK A;  4IM2 A;  1V81 A;  2ZPY A;  3PHX B;  2JRI B;  4DHJ D;  2L0T A;  2KTR B;  2KLG A;  2KQ7 A;  2HD5 B;  4TKN A;  3VTU A;  3KYD D;  3L17 A;  3ZW3 A;  2AYO B;  1NI2 A;  3K9O B;  2JY6 A;  2O2V A;  3A9K B;  3PSE B;  3DBR I;  2KLC A;  3PGE A;  3IVF A;  3RT3 B;  3TJP A;  2WWZ A;  1U4A A;  3ZLZ A;  2JXX A;  1GJZ A;  1WR6 E;  4HPM B;  3AUL A;  4B9K A;  3GZN I;  3OJ3 A;  4WWP A;  2MBO A;  2GBR A;  3L08 A;  3APC A;  2RD0 A;  3Q3F A;  4W9E A;  1E90 A;  2ZCB A;  4IW0 A;  4WJN A;  1WXV A;  3ALB A;  4F7Z A;  1P9D U;  5C23 A;  1H4R A;  4EFO A;  1WGD A;  4HVB A;  3JSV B;  4JGH B;  3VUY A;  1OEY J;  3KUZ A;  3JVZ X;  3MHS D;  3PHW B;  3O65 B;  3U7D A;  3HK0 A;  2KDB A;  2M0X A;  3LJ3 A;  2NBW B;  3UIN B;  1E5W A;  3L13 A;  2O6V B;  2KDF B;  2NBV B;  5AZH A;  2CHX A;  2BGF A;  3VH3 B;  4FJZ A;  1WZ0 A;  1V6E A;  2L05 A;  4TUU A;  4W9C A;  1Q5W B;  2BKF A;  5IAA C;  4G3X B;  1E8W A;  2ZVN A;  4DBG A;  1V9J A;  3WAO A;  4NAW A;  3DCG A;  4KZC A;  3ZTC A;  3CMM B;  2J0K A;  1EO6 A;  1S3S G;  3A33 B;  2K8B A;  4NY0 A;  4AJY B;  4CO7 A;  4WJP A;  4AP4 C;  4II3 B;  2UWQ A;  4DXA B;  3EC8 A;  4LJO B;  2LRU A;  3GOE A;  1WMH B;  5JZE B;  2BWF A;  3N3K B;  2ZNV B;  4MEL A;  5AZF A;  3SD5 A;  4NQK E;  3QA8 A;  3MJW A;  1HE8 A;  3DPD A;  4IG7 B;  4F8C B;  3DOW A;  3RUL A;  4BKT A;  4K7W A;  2DAF A;  3BIN A;  1I42 A;  1WE6 A;  3MTN B;  2O2V B;  2L7R A;  2RGF A;  2WX0 A;  4E74 A;  1YJ1 A;  1YD8 U;  2OOB B;  3AU5 A;  3DBL I;  2K39 A;  2N1V A;  4WQO B;  1WIA A;  2MCN B;  2MLB A;  3KH0 A;  1WZ3 A;  2EKE C;  2LGX A;  4P7I A;  1WX8 A;  2BKR B;  1XD3 B;  3PZD A;  4MM3 A;  3HM3 A;  3PRM B;  4FJY A;  4IWQ A;  2EMS A;  2O6V D;  3H1U A;  1LXD A;  5D6J B;  2MBB B;  4HPL B;  3AI5 A;  1L2N A;  4ZRI A;  2C60 A;  2L76 A;  2LD9 A;  4HJK A;  1WX7 A;  1OGW A;  3PLU A;  2ZZP B;  3HIZ A;  1KM7 A;  1R4M I;  1WGY A;  3ML9 A;  3JSV A;  3KUD B;  4AOF A;  3H7S A;  5J18 A;  2JT4 B;  2GBN A;  1WJ4 A;  3A9J A;  1V80 A;  3A4S C;  4DDI D;  4PYU A;  4W9F A;  3V60 A;  4AWJ A;  1YIW A;  2LUE A;  1EF1 A;  3ZTD A;  4TQ0 A;  2AL3 A;  3QQ8 B;  3M62 B;  2M1M A;  3WAM A;  3DVG Y;  3N32 A;  2DYO A;  4NAW B;  2PEA A;  4NNJ B;  2DZJ A;  4BVU C;  1R4N I;  2BYF A;  4MGZ E;  3QWZ B;  5E6O A;  4GOC A;  1SGH A;  1WI0 A;  2LGD A;  2IO2 B;  3NS8 A;  2DZI A;  2EMT A;  3ZNG C;  3EFU A;  3QC8 B;  4HXD A;  4MGI E;  2LGY A;  3VXW A;  4FN2 A;  5E6P A;  4BBN F;  3QIJ A;  3QAR A;  4K7S A;  3SU8 X;  4EZJ A;  3LDZ E;  4HCP B;  3PLV A;  2IO3 B;  3ZIM A;  5JHA A;  2FAZ A;  2K6Q A;  3B08 A;  2KKC A;  1Q1O A;  3PPA A;  2JVC A;  1P1A A;  1Q0W B;  4KSK C;  3EHV A;  2KNB A;  2LZ6 A;  2A5U A;  4W9G A;  5DPW A;  2KFK B;  3T8M A;  5JHB A;  1XQQ A;  5G2N A;  4HWI B;  4MGY E;  2NPT A;  2LVO A;  2GOW A;  4IM3 A;  3R66 C;  5KHO A;  1K8R B;  2C7H A;  2DHZ A;  2KOX A;  2PE9 A;  4GN1 A;  2NVU I;  2J0J A;  3KYC D;  4IUM B;  4M8N A;  4MEM A;  5CTR C;  1X1M A;  4ZRJ A;  3S2A A;  2KWU B;  3N30 A;  1V2Y A;  4PS7 A;  3RZW C;  2AWT A;  3DDC B;  3NZS A;  4FHJ A;  2OJR A;  5BO4 B;  4LJP B;  2IO0 B;  3PTF C;  3WA0 A;  5CHW A;  3DVN V;  3K9P B;  2KWV B;  4IWP A;  1SE9 A;  3W1S A;  1VD2 A;  2IYD B;  4EZL A;  5E6N A;  1KLV A;  2L3Z A;  1V49 A;  2Z59 B;  3ONS A;  5DPS A;  4DDG D;  2FID A;  1SIF A;  2WYQ A;  2B3A A;  3B0A A;  5DPT A;  2LXC A;  1NDD A;  2I1K A;  4DHZ B;  1E8Y A;  1KOT A;  3VTV A;  3OLM D;  3ZRF A;  2NBU A;  2KJR A;  3A9J B;  1E7V A;  2CU1 A;  2MBQ A;  4K1R B;  3ZNH B;  1M94 A;  3PRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...