3VRAB

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
total genus 50
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vraB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vraB01
4ZOHC 2PVOD 2ACZB 1PFDA 1GAQB 2MJ3A 4P6VF 1L6VA 1TKGA 1WWTA 3AMZA 1TKYA 3AE5B 2KAJA 4C7ZA 2HTME 1SF0A 1OFFA 3AE6B 3CF4A 4YSYB 1E0ZA 2H88B 1UWMA 1E10A 4JWSC 2WU2B 1J7AA 3ABVB 4IDIA 4YXDB 1FXAA 1XLQA 1VDVA 1YQ4B 1GTEA 2WLBA 2K5PA 3DWMA 1XLOA 1GT8A 1DGJA 1A70A 1QOAA 2WQYB 4WWMA 3P4QB 1FRDA 2M19A 2WDVB 3HRDD 1IUEA 3EUB2 1QOGA 3W9CB 4US8A 4ZHPA 1DOYA 2WS3B 1WGKA 1L5PA 2W54A 2BT6A 1ZUD2 2CJNA 3AN1A 1AYFA 1TKEA 3AE7B 3AE2B 2L83A 3HVZA 5EE1A 4US9A 2WP9B 1FO4A 2WDRB 4YTPB 2PVGC 2OHFA 3FAHA 2H89B 1ROEA 2KMMA 2G1EA 3AE1B 1I7HA 1J7CA 3AEDB 2CU3A 4HRSA 1GTHA 3AEEB 3NVYA 1ZOYB 4JX1C 3LB8C 5AUIA 3AEGB 1JW9D 3AE3B 1JRPA 1RYJA 5AUKA 1FMAD 5EE0A 3P1MA 1H7XA 1ZXIA 2CJOA 1QF6A 3NRZA 1E6EB 1QOFA 1XO3A 1N61A 3B2FA 5EE9A 1RM6C 1WRIA 3VR9B 2EKIA 1VLBA 2QJLA 2DWQA 1ZP0B 1T3QA 4HROA 3FC4A 3VRAB 3BIID 1KFYB 1KF6B 1FRRA 1N63A 3B9JA 5EE3A 1L0VB 1EWYC 2L52A 1N5WA 1JALA 1JROA 1RFKA 1VJKA 5GXGB 3P4RB 1FIQA 1FM0D 3KWLA 4LTUA 2QIEB 3AM9A 3SFDB 1CZPA 1NYQA 2Y5CA 4YTMB 1QOBA 3AE4B 3P4SB 5H92C 2WDQB 2MJDA 2W3SA 2N0SB 2LEKA 4YT0B 1SIJA 3AEFB 2E3TA 2M56B 1E7PB 4KX6B 2K9XA 3LXFA 2PIAA 1NVID 2W55A 3NVVA 5G5GA 1TYGB 1QLBB 2JQRB 2BS4B 1N62A 3B2GA 4JWUC 1XLNA 1PDXA 4ZHOA 3SFEB 1WYGA 3AV8A 4YTNB 2K22A 1PUTA 3AH7A 3AE8B 4A9AA 1H7WA 1FXIA 2WU5B 1YQ3B 3AEBB 2BS3B 3CIRB 1WXQA 5H8YE 3SR6A 1XLPA 4C80A 3WCQA 1NEKB 5C2TB 1NYRA 4FXCA 1NENB 1R7SA 1DOXA 1QT9A 2PKOA 1N60A 4C7YA 3L4PA 1F0ZA 1E9MA 2W3RA 1JQ4A 3P63A 1JWBD 2B76B 1NI3A 2DBYA 1V97A 4YSXB 2BS2B 1KRHA 3DWGC 5G5HA 3W5UB 1SB3C 4N6EB 4USAA 2Q5WD 3NS1A 2AX5A 1J7BA 1TJEA 2JX5A 1AWDA 3VR8B 4N59A 2MJEA 3AE9B 4ITKA 1YJJA 1RWSA 4YSZB 3AECB 1FFUA 1JWAD 1L6UA 1YJIA 3VRBB 4WQMA 3NVWA 3W5VB 1FFVA 1OQRA 5MPOA 3ETRA 1V8CA 3NVZA 1OQQA 5C3JB 1DOIA 3PO0A 3AEAB 3P4PB 3AB5A 1CJEA 3RPFC 3ZYYX 1B9RA 2MH7A 3CWIA 1GPXA 2FBWB 1N5XA 4N58A 3HUIA
chains in the Genus database with same CATH superfamily
4OHJA 1S1QB 4C7ZA 3RNBC 1YN5A 3PPAA 3ABVB 4RMAA 4NAWA 3ZNHB 1GTEA 3MTNB 3A9KA 2IY0B 3DVGX 2KQ7A 1DYQA 4HJKA 1NBFC 1G6JA 3PRMB 1FNWA 3AE2B 4DXAB 2OOBB 4WWNA 4PT5A 4DWFA 1Y8RC 4L1BA 1QOFA 3B2FA 4M8MA 4GU2A 1QQRA 3SU8X 1Z5SB 2GMIC 4F8CB 3ZVVA 1WGGA 2BYTA 2ZCBA 3VRAB 1LGRA 1N63A 2M0AA 4IM0A 2VRRB 2PLPA 2G9HD 1FD6A 3RYTA 1YNTE 2MBBB 2LEKA 1V1PA 4OZBA 2LRUA 1RRBA 2Z59B 3BYTB 1WYGA 4KDIC 2PTLA 2N1VA 3Q3FA 3AEBB 3D32A 4LDTD 2JRIB 2RPQA 4DBGA 3MC8A 1TS2A 1QKZA 1MG4A 3Q14C 4OVVA 1WXSA 3V3XA 4MGKE 3AE9B 2KDIA 3V6EB 4FADA 2DZIA 2WXIA 1DOIA 3ZYYX 1KLUD 2D3AA 3C0RB 2BQQA 3N1YC 4X57B 1MPEA 2IZVB 1VZ8A 4MSQB 2GBRA 2L00B 4YXDB 2XK5A 3DWMA 2XBBC 4HPLB 3AI5A 3GOEA 3ZJVA 1V81A 1C77A 2WWZA 3AN1A 1WR6E 4E3CA 4YTPB 3LDZE 1UWXA 5JH5C 4KSLC 2PJHA 1E8YA 3R2IA 2MEKA 4XWWA 3P1MA 3NOBA 2RDGA 1L4DB 1K8RB 3UQAA 1EF5A 1LM8B 2HJ8A 3X23A 3OLMD 2W82A 1STEA 1QZEA 4DK5A 1N6ZA 2AYOB 5EE3A 3APCA 5HFYA 3JYUA 4WWOA 3DOWA 4I6PA 4W9FA 2KANA 2PE6B 2KFJA 1E90A 3ECIA 4TQ1A 1SIJA 1E7PB 4KGTA 3L54A 2XNAC 5G55A 5DPRA 1RLFA 3IHPC 2KACA 1SJHD 3VHTC 3UI3A 5D94A 3CSTA 3SR6A 4ICVA 4ZYSA 1V49A 2G4DB 3A1QA 1VR9A 3AXCA 5BO4B 1TT5B 1E9MA 2MWSB 4URKA 2BS2B 1E5WA 3TUOA 4ZYNA 3ZRCA 2KZRA 1L6UA 3PZDA 1WGYA 5DPWA 3RNFC 1MFWA 2L1AA 3CWIA 1TTNA 3NZSA 2OJRA 1WX8A 2MJ3A 3L10B 3OJ3A 4XGAB 2DNFA 1VDVA 3VUXA 2KO3A 1GT8A 1A70A 1IUEA 1QOGA 3TBLD 1C3TA 2LMCA 2WX1A 2ZNVC 3KW5B 4R3DA 4L23A 2Y5BB 2LGSA 2CU3A 2MBOA 4OZCA 2JYTA 2M0XA 1NDDA 3NZ3A 2LGXA 2KMAA 4PS7A 3NG0A 3KYCD 3VR9B 2YLMA 4ANVA 5C23A 5BYSA 2I1KA 4HROA 4ZRQA 1FRRA 4K7WA 1F1HA 3P4RB 3LYYA 3ZGZA 3N1ZC 2KJRA 1E8ZA 3AE4B 3PT2B 2WYQA 1VCBA 1I4HA 2MJDA 1HTOA 3RULA 3VXWA 2J42A 4AQ7A 3SD5A 3VH3B 1SBBB 4YTNB 2K22A 3B0AA 4W9IA 2OEDA 2ONQA 3TL5A 3CIRB 5G2NA 2GLSA 4E74A 3B08A 4NJ6A 2QMTA 4J6IA 3UIPB 2K0PA 1C76A 3RN9C 1Q5WB 3DWGC 4FJVB 3W5UB 3ZTCA 2AX5A 1JWMD 3PSEB 2BYVE 5KHOA 2KYWA 2FCSA 4WH4A 3R8BA 1LO5D 3C19A 3GE8C 4IKGA 1CJEA 1MHHE 1N5XA 2XK5B 2KWCA 2ZPYA 2N4FA 2DZMA 4B0EA 1L7YA 2D07B 2IJ0A 3C8YA 2DLBA 2WLBA 2LUMA 1ZDVA 3DBLB 3IVFA 3UINB 3HRDD 2IGHA 4M0WB 2W54A 4OVZA 4FLHA 4PS3A 4FJZA 1V1OA 1ROEA 2KKCA 1I35A 2K8BA 2FIFA 4FHKA 1OEYA 3M3JA 4FBJB 1RYJA 4MEMA 1T0QC 3VH4B 1WE6A 1XQQA 3R2TA 1ZKHA 2QILA 3GZNB 4G0NB 1ZGUB 2GBMA 2GI9A 2KWVB 3IT6B 1L0VB 1K50A 3TSSA 5FK9C 2NR2A 2BKFA 4IW0A 1KM7A 4ANWA 4TQ0A 3ZJTA 4LTUA 1R4NB 3BVMA 3QHTA 2C5LC 4XWTA 2W3SA 3URYA 2KX3A 4WJNA 3ZDTA 2VZKD 4KIKB 3AE8B 4A9AA 1H7WA 2O2VB 4A90A 2UYZB 4Q2JA 4E71A 1NEKB 4FXCA 1PGXA 4A3PA 3DBSA 2PKOA 5FR3A 2L7RA 3DHIC 2VZKB 2NBVB 2RDHA 1L0YB 1EM7A 1EWCA 2NBWB 3JW0X 1YQBA 3WAPA 2MCNB 2MJEA 1YJJA 1WX7A 3Q3OC 1WSPA 4JGHB 3Q8FA 2O6VB 3HK0A 4MM3A 2L3ZA 1J8CA 4N58A 1ET6A 5AEKB 1EU3A 2PVOD 4NAWB 3N9YC 2BWES 4MACA 5FKAC 5I4DA 1SXTA 4HLEA 4REZA 3UQBA 2JUOA 1HTQA 5D6JB 3ZNID 3J9CA 3PHWB 5CHVC 3HVZA 4IC7B 1P9DU 2PVGC 4MGZE 3AE1B 2JWZA 1Q10A 1XD3B 1UD7A 4LLGM 3DBRB 2QDFA 2V1YA 2D10A 1R4NI 4LNOA 3RZFA 2RPVA 3PVLA 3ZNZB 2DZJA 2KVRA 1EUVB 1WJUA 3BZDB 3ZIMA 1UUPA 1JROA 2NCNA 2J52A 4K81A 3T9LA 2QIEB 2N7DA 2IO3B 1C4CA 1SIFA 2ICIA 2LZ6A 1VD2A 1P7EA 4BKGA 1T0YA 1E7VA 3AEFB 2LVQA 2AWTA 1SE4A 4P1BC 3HHMA 2Y5PA 3DVNU 4EZJA 5HI1A 4W9EA 2Z0DB 3IT4B 3OJ4B 4LDTB 4WURA 4HPMB 3VVWB 4TV3A 4JQWC 1I4PA 1TIFA 3ZDMC 4YL8A 1Q1OA 2LWPA 3FILA 1WF9A 3W1SA 2Q5WD 4BKTA 1TJEA 4MH0E 2LD9A 2WXRA 1RWSA 4C4VA 2RMMA 4WQMA 4ARCA 2MSED 3PZ7A 2LUEA 4KZCA 3QC8B 4NAMA 3H8HA 1MVKA 2DAFA 3NS8A 3AE6B 2QEJC 4YSYB 1E10A 1T5XD 1H4RA 4W9HA 4KDLB 2RGFA 1XLOA 4K3BA 2KJHB 1IGDA 1T0RC 1WGKA 1JWUD 1AYFA 4K7SA 4US9A 4AUQC 2H89B 4A6QA 4F1SA 4HKQA 1TZ1A 1YIWA 3AEGB 1WFYA 4W9KA 1UNSA 4BKSD 2JVCA 3Q8BA 3AU5A 2WXKA 3Q3MC 1ZXIA 1PQSA 1U4AA 3A1QB 5L95C 3UGBB 1FCLA 1EO6A 1C1YB 1GC6A 3TIXA 1X1MA 4RFBA 3FC4A 2KNBA 2YEPF 2C7NB 2LHEA 2WXJA 1ZDXA 3BVZA 4OW0A 1YMHE 4FHJA 3LXFA 1UGMA 2KTFA 3V60A 1PUTA 2LRWA 1L0XB 2ZW1A 4EOYA 3FKYA 4NQLB 3MHZA 1QT9A 3KUZA 2J0KA 3N3KB 1V97A 1KRHA 3IAM1 2E6XA 4N6EB 1AN8A 2I2YA 3RNGC 3RI7C 2IO1B 2L0TA 1V8CA 3U4EG 1E8WA 1ZXHA 1WJ6A 2MW5A 4ZOHC 5D3DA 3H7PA 3OAWA 1HZ6A 4C56C 1YX6B 4XC2A 1E0ZA 2N9XA 2W9NA 2KQ4X 1UZXB 1GUAB 3PGEA 4MGIE 2WQYB 2A5UA 3P4QB 3MHSD 1KLVA 2ZNVB 3R7QA 3ENEA 4US8A 1DOYA 1HQRD 2WS3B 4AWJA 1WIAA 2L83A 5TR5A 2WDRB 2GRIA 2KMMA 3RNEC 2FCMA 5GMVA 2QSDA 2RDBC 2RR9A 3NZUA 3PLUA 3Q3JA 4JX1C 3DQVA 1H7XA 1SEBD 5TSSA 4A20A 3BY4B 2BYFA 3Q8AA 2N9KA 4CHKA 1JALA 2GBKA 1CZPA 2LJ5A 2XEWA 2FUG1 3QARA 5LXIB 4BOSC 1WZ3A 3GB1A 1WJNA 2LGYA 5JXVA 3WAMA 4WQOB 1XLNA 2G4SA 2OJWA 1YX5B 2WXMA 1V5OA 1I4XA 4HXDA 4XYCA 1D5MC 4F7ZA 5E6NA 4JE3B 2JYEA 5C2TB 4PYUA 4UDUC 2MBQA 4KKIA 4B95A 3MFGA 2B76B 5G5HA 4YSXB 1SB3C 1HEZE 2BVCA 3BK1A 2FUHB 1XF5L 2FIDA 3R3MA 2JXTA 3AECB 1SJED 2LGIA 2V4LA 5D7GA 3DBHI 3QAQA 4RGOS 1OQRA 2JZZA 1S3SG 3AB5A 3WALA 4AJYB 4EE2A 2ACZB 1OQYA 4S17A 1L6VA 2HE7A 1TS4A 2KAJA 1OFFA 1ET9A 4JWSC 4W9DA 2WXQA 4HEA1 1D3ZA 3QA8A 1I42A 1FRDA 2M19A 2EMSA 3W9CB 2XN9C 2WHIA 4P16A 2VH2A 1P0RA 3K9PB 4HDOA 3ZNGC 3ZUNA 3IBEA 3WAOA 1ISNA 4M02A 2G1EA 2KDMA 2M4NA 4DQOC 3A9JA 2J0MA 4B0MA 2INDC 2IGGA 5IKCM 2CKHB 2V3NA 2IY1B 5EE9A 1BT0A 5CHWA 3MC0B 3B1LX 5CX3A 1ZP0B 2L0FA 1MG8A 1WGRA 4W9LA 2BW2A 4HK2A 2WDQB 4LJPB 4YT0B 2E3TA 2M56B 4BBNF 2K9XA 2PIAA 1NVID 3NY5A 2WDTB 5G5GA 2QC8A 5D2MB 3B2GA 1CK1A 1TS5A 3U30A 2FCQA 1K52A 1YQ3B 2BS3B 1WXQA 2ZCCA 2C60A 2N1WA 2J4XA 4B6WA 4IOIE 2IGDA 2DBYA 3AU4A 2ZPNA 2WXLA 2PEAA 4N59A 4ACFA 4ITKA 3I63C 4NY0A 4BVUC 4HCNB 3QQ8B 2I1JA 3VQIA 2BPSA 3RPFC 1V9JA 1C78A 3VTWA 3HUIA 4AOFA 4GB9A 3H6NA 1MHXA 1GB4A 2NPTA 1UWMA 1BXTA 1ZW7A 4S0RA 2JPHA 1J7AA 2V3PA 5BMIA 1FCCC 1WM2A 3Q8CA 4JIOU 2R2OA 2K6DB 1Z2MA 3RD2A 2AQ1B 3DVGY 2C9WB 1ZUD2 3BYYB 1SGHA 1P98A 3QIJA 2FCNA 3H7PB 2KDEB 1MJDA 1GTHA 3LB8C 3ZKJC 2JU6X 2LI5A 5E6PA 2L8JA 3NRZA 1YD8U 1PYWD 1OGWA 4LNKA 2X38A 4LJOB 4YWGG 3BIID 3TEWA 2DZKA 2JT4B 1ESFA 2ZW0A 3IG3A 1D5XC 3FILB 2KQSA 1FIQA 1FM0D 3M62B 4GDLA 4H2AA 5E6JA 5BYQA 5CTRC 1QOBA 3I5JC 3PTFC 2MQJA 3MJWA 4OZAA 2DYOA 2WXNA 4ZHOA 4B9KA 1C4AA 1QLBB 1N62A 3AV8A 4HDQA 2N9LA 1GJZA 2LXCA 3AH7A 3EECA 2VH1A 4IUMB 2WU5B 4K3CA 1NYRA 4BAXA 1WXVA 1IP9A 4GMVA 1JQ4A 3P63A 4GDLB 1JWBD 2QHOA 2NTSA 5L83A 4RM8A 2GB1A 2ZVOA 1L2NA 1FFVA 1WRDB 5MPOA 3NVZA 4HCPB 1Q0WB 1UBIA 4XZ4A 4PS8A 4I6NB 3TJPA 1F52A 1VRAB 4G3XB 1ENFA 4A8XC 2FAZA 3DCGA 1V5TA 2MP2B 2JXXA 2JY6A 2K8CA 2WNMA 2PPHA 1I4GA 1EU4A 2R2QA 2D3GA 5HHDG 2RSUA 4LK0M 1L5PA 1DOXA 3AE7B 3IFWB 1FO4A 2INNE 4ZDVA 3ZJUA 3KH0A 2BBCA 3VTVA 1IGCA 3W1YA 2KC1A 2RD0A 1HZ5A 2O6VA 3VTUA 1JRPA 1FMAD 2BYEA 3PRPB 3PHXB 1E6EB 3UF8A 2KLGA 4TKNA 3Q8EA 1WRIA 3JVZX 4PK1A 2QJLA 4NZLB 3B9JA 4MELA 4WJOA 4DDID 3SFDB 4YTMB 2N9EB 1JWSD 2WGSA 3ML8A 3ZXVA 2HJ1A 3TMPB 5BMGA 3PLVA 4RGNA 3KLSX 2NTTA 3O65B 4KKJA 3QWZB 1F77A 1KOTA 5DPTA 1LFDA 3M63B 1HXYD 3H9DA 3KQ4A 1V80A 1N60A 3L4PA 2KDFB 4HWIB 2KJ6A 4BFRA 4W9CA 1HA5A 4USAA 1D6EC 2R61A 1OTRB 5J2RA 1B1ZA 2AL3A 2KC2A 4RGMA 2YVCA 4YSZB 4BZAA 1V86A 3R7RA 1TS3A 1OQQA 2KLCA 3AEAB 4G50A 2NBUA 1XT9B 5JZEB 2YEPB 4P1CC 3ZO5B 3HM6X 3AE5B 2AL6A 2HTME 2IBIB 1KJTA 2WU2B 1XLQA 1YQ4B 4C00A 2WXPA 1V6EA 2K5PA 4M0WA 3GZNI 2I38A 2SAKA 2B3AA 1TZOA 3DVNV 1UF0A 1V2YA 4D2KA 4IG7B 2Z0EB 2KOXA 2EKEC 4I6LB 5IOIA 2LVOA 1WGHA 4WAAA 4RM9A 2D2QA 3NVYA 4WWPA 3P2BA 5D3IB 4MM3B 4DHJB 1M4VA 5IN7A 2BB5A 1CMXB 1WY8A 2D5GA 2V0GA 1KTKA 1K53A 3NHEB 1LXDA 2KDBA 3IXSA 3KVFB 1F2RI 1N5WA 1FNUA 3WANA 1FNVA 1MI0A 2N0SB 3NVVA 1GNUA 2V4IB 2C7HA 1TYGB 2O2VA 2BS4B 4MSMB 2INCC 1XCQL 4M8NA 4KIKA 4FULA 2DAJA 3KUDB 3U7DA 2V9HA 4AP4C 2HDEA 5CHFA 1WXAA 4DXFA 3PS6A 3GS2A 4EZKA 2MRPA 3DDCB 4GDKB 1P3QU 3NUHB 2ZZPB 4PYZA 2M17A 3ZXRA 2BF8B 2K25A 4TSSA 1YN4A 3ZW3A 2KT7A 1TY2A 4FN2A 2KXJA 3W5VB 4GOCA 1BMLC 3RT3B 1I4QA 5JHBA 3P42A 3SEBA 2JRHA 2MP2A 4M00A 1PFDA 1WWTA 3VFKA 2LFIA 3PREA 2KWUB 1UBQA 2H88B 3A4SC 5J18A 4IDIA 3KUCB 1F2RC 4W9GA 3N20C 3UIOB 4DHZB 2DYMA 1KLGD 3Q69A 3O13A 2BT6A 1RFAA 3ZRFA 3S2AA 1UH6A 3V62A 1L4ZB 2KFKA 4MDKE 4CQNA 3I3TB 5LNK1 2MBEA 2EMTA 2PMVA 1XXGA 3M95A 2LGDA 4HRSA 4KGSA 2GBJA 1C79A 1JW9D 4EUTA 3AE3B 5C1ZA 3TEYA 2CJOA 1QF6A 1SE9A 1R4MB 4NPNA 4EEWA 1TGZB 1IBXB 1RM6C 4RCOA 1FXTB 1JRUA 4BKSA 4NJCA 3APDA 1VJKA 3QX1A 3KWLA 1WJ4A 2G3QB 4JWUC 5HG2A 1PGAA 3WCQA 4DDGD 2A4ZA 4C7YA 4HJGE 1E7UA 4ICUA 1H8CA 4LNIA 3NS1A 2FNJB 2N9PC 1IYFA 3U2SC 3DHHC 1YJIA 2ZEQA 2BGFA 3EFCA 1K51A 4GN1A 4KSKC 1YOVB 1GAQB 1TKGA 3EA6A 3AMZA 1GG3A 4WJPA 1FXAA 2K8HA 4A55A 1WGDA 5EDSA 4WWMA 1FEHA 3HM3A 4RNAA 2CR5A 3EUB2 3I57A 2LXAA 2KX0A 4KGRA 2CHWA 4DHZE 3RUIB 2MBHA 2WXHA 2ZVNA 1I7HA 2SEBD 3AULA 1ZOYB 1NI2A 2V3SA 5EE0A 5KHQA 2CS4A 2WXGA 1N61A 2UWQA 4P7IA 4C4VB 1PGBA 3A4RA 2DWQA 1T3QA 2CHXA 2LVPA 3QCAA 3RFZB 4JPSA 3AM9A 1WMHB 2DENB 2KN5A 2NVUI 3P4SB 1R4MI 3PZ8A 3EGRA 3Q6BA 3DPDA 4KX6B 1YN3A 2M8SA 3JSVA 3EHVA 2ON8A 2NS5A 1P1AA 1XCTL 1ZE3D 1XLPA 1V1PB 3V61A 4O1NA 1WX9A 1R7SA 3L08A 3H7SA 4IWQA 3ZQ4A 1YJ1A 1F0ZA 3DBRI 4M01A 1WE7A 1E8XA 4KZ0A 4IWOA 4XDCA 1VZ6A 4MH8A 2IO2B 3QK0A 1FFUA 2JWUA 3VRBB 2DHZA 4KVGB 4II3B 2LHDA 1UGJA 1A5RA 1B9RA 1HE8A 2DX5B 1WH3A 1D5ZC 4NNJB 1TKYA 5J17A 3SDLC 3CF4A 2HD5B 1J0GA 2ZJDA 4TMAB 2EELA 2MLBA 5IP4D 1GC7A 4GSWA 2J7QB 4II2B 3APFA 3KWVA 2WXOA 1J19A 3RCZA 1M94A 2MX2A 3BINA 5EE1A 4DHJD 4XE0A 3U8ZA 4WAFA 3N30A 1J7CA 5IAAC 1FPYA 3ONSA 4ANXA 4WIPA 4CYEA 4GDKA 3DBHB 1GOZA 1OEYJ 1CQVA 1VLBA 2GBNA 2GOWA 4N9F4 2BB6A 4BOZB 1KFYB 1EF1A 3MP9A 1D4BA 2WX0A 4ZRJA 1RAXA 2Y5CA 1WXMA 2DYBA 4RF0A 2N7JA 1F9JA 5H92C 2MHJA 2M1MA 2W55A 1VZ7A 2JQRB 2MA9B 4G11A 5JHAA 1PDXA 3WIMA 1SE3A 3HVDA 1GB1A 5BMHA 1T6BX 3OWEB 3JSVB 4JLCA 4JL9A 3RMKC 2TSSA 5AZHA 5DCNA 4FJYA 3TEZA 2K6QA 1WR1A 1NI3A 3KYDD 3DHGC 3BWUD 4RF1A 1JWAD 2HTHA 3CMMB 5DPSA 3NVWA 3ML9A 2O6VD 3ETRA 3T3NA 3PO0A 4TUUA 1WZ0A 2IYDB 4GGQA 2MH7A 3ZLZA 2IPKD 3DBLI 3RNCC 1P7FA 3V6CB 3L13A 1SF0A 3VUYA 4ANUA 4AJWA 2WDVB 1LQBA 2J0JA 1WM3A 2PW9A 2KK8A 4ZHPA 2KTRB 3RNAC 3A9KB 3I9V1 4QAYA 1TY0A 2OHFA 3FAHA 4OVUA 1XEEA 3AEEB 1Y56A 5AZGA 3OG5A 4IWPA 2LASA 2BTEA 3W2DA 3IAS1 5BYRA 2UU7A 3T3OA 3N32A 1KF6B 5AZFA 2N7EA 2L52A 3PV1A 1RFKA 4HVBA 2D11A 3CSFA 1NYQA 2KN4A 4GIVA 2D3CA 4MJSA 2CU1A 3L17A 2AQ3B 1WMHA 4RH6A 1I4RA 4XX5A 2LJIA 1ZPSA 3VUWA 2BWFA 3SFEB 4L2YA 4ZRPA 3TEXA 3BK2A 2QCZA 1FXIA 3ZTDA 4RGTA 1WI0A 1NENB 2INPE 3LJ3A 1T0SC 4K7UA 2W3RA 2KMCA 3Q3NC 3SHQA 3L16A 1WYWB 5LXHA 4ZRIA 3PRZA 3WA0A 2JX5A 3H1UA 3CF6E 2K3UA 1AW7A 3GE3C 2JZ3B 4ZRKA 1C4PA 4K1RB 1JCKB 3MC9A 3E9SA 5C3JB 2L32A 1GPXA 2IO0B 2FBWB 3ALBA 4ARIA 3HIZA 4P6VF 3E56A 4LCDE 2IDYA 2KFKB 3T8MA 4ASWC 2NPTB 5LLIA 1TBEA 1KH0A 2JZPA 3EFUA 5HKHA 1IPGA 2KTRA 3QJZA 4LNFA 1DGJA 3GP7A 3TCAA 1QOAA 3EC8A 4CO7A 4W9JA 4GXBA 2CHZA 2CJNA 1TKEA 5E6OA 2AQ2B 3V05A 2WP9B 2KD0A 1SE2A 2REXA 4LNNA 1C9FA 3AEDB 5IO9A 3BVGA 5AUIA 1AARA 2J53A 2D3BA 3NJTA 2G45B 5AUKA 2C7MB 4WJQA 4MT5A 4NQKE 4EFOA 2JF5A 1XO3A 2NMQA 4J3OD 2EKIA 3U52E 4HKZE 1EWYC 1JMLA 4AS1A 5GXGB 5IA7A 4IM2A 4EKUA 2Y3AA 2FE8A 1SSNA 4GLSC 2Z8LA 2AEHA 4IM3A 3L0WB 2K1FA 3Q2AC 2BKRB 3R66C 5H8YE 3N1XC 4HPPA 5T8IA 4C80A 1IBXA 3VAWA 4BBNC 4DXGA 2KHWB 4MJSB 3A9JB 3X0WA 4FA6A 3RZWC 1BUIC 2PE9A 1J7BA 3K9OB 1UELA 4XDDA 1AWDA 3U7ZA 2L76A 3VR8B 2ASQA 2KWDA 1QILA 2WXFA 4MGYE 3A33B 2JSVX 1ACCA 5FR6A 3W1SC 3P4PB 2L05A 4NJ7A 4KV2A 2KVZA 2X8XX 3VDZA 3MJ5A 4A3OA 2K39A 4EZLA
chains in the Genus database with same CATH topology
2PVOD 4NAWB 1GAQB 3N9YC 4OHJA 1MHXA 1TKGA 3AMZA 3EA6A 4MACA 4C7ZA 1GB4A 5FKAC 5I4DA 1YN5A 1UWMA 1BXTA 1SXTA 1J7AA 3ABVB 1FXAA 2V3PA 5BMIA 1FCCC 1GTEA 4REZA 4A55A 3Q8CA 4WWMA 1FEHA 1DYQA 4RNAA 3EUB2 2AQ1B 3I57A 3J9CA 1ZUD2 1FNWA 3HVZA 3BYYB 3AE2B 4KGRA 2PVGC 2WXHA 3AE1B 1I7HA 1Q10A 4PT5A 2SEBD 1GTHA 1ZOYB 3LB8C 2JU6X 4LLGM 5EE0A 3NRZA 4L1BA 1QOFA 2WXGA 3B2FA 1N61A 1QQRA 1PYWD 1PGBA 2RPVA 2DWQA 2X38A 1T3QA 2BYTA 3VRAB 3TEWA 4YWGG 3BIID 1N63A 2M0AA 3BZDB 3RFZB 1ESFA 1UUPA 2ZW0A 1JROA 1D5XC 2J52A 4JPSA 3FILB 2PLPA 2G9HD 1FIQA 1FM0D 4H2AA 5E6JA 1FD6A 2QIEB 3AM9A 5BYQA 1C4CA 2ICIA 1QOBA 1YNTE 3P4SB 1P7EA 3PZ8A 4OZAA 3EGRA 2LEKA 2DYOA 3AEFB 2WXNA 1V1PA 4OZBA 4KX6B 1YN3A 4ZHOA 1C4AA 1SE4A 1QLBB 1N62A 2ON8A 3BYTB 2Y5PA 3AV8A 1WYGA 2N9LA 5HI1A 2PTLA 1XCTL 3IT4B 3AH7A 4WURA 2WU5B 3AEBB 1ZE3D 1XLPA 1V1PB 1NYRA 4O1NA 1I4PA 1R7SA 3ZQ4A 1F0ZA 1JQ4A 3P63A 4GDLB 1JWBD 3FILA 1TS2A 1QKZA 3W1SA 2Q5WD 1TJEA 3V3XA 4XDCA 1VZ6A 4MH8A 2WXRA 3AE9B 2NTSA 1RWSA 1FFUA 2GB1A 2JWUA 3VRBB 2RMMA 4WQMA 4ARCA 1FFVA 3PZ7A 5MPOA 3NVZA 2WXIA 1DOIA 2LHDA 1UGJA 1B9RA 4NAMA 1KLUD 3ZYYX 3H8HA 1MVKA 1D5ZC 1MPEA 1VRAB 1TKYA 1VZ8A 1ENFA 3AE6B 3CF4A 4YSYB 2QEJC 4A8XC 1E10A 1T5XD 4YXDB 4TMAB 2EELA 3DWMA 1XLOA 2WNMA 1I4GA 1EU4A 3ZJVA 3KWVA 5HHDG 1IGDA 1WGKA 2WXOA 1L5PA 1C77A 4LK0M 1JWUD 3AN1A 1AYFA 1DOXA 3AE7B 5EE1A 4XE0A 4US9A 1FO4A 4YTPB 2INNE 4WAFA 1UWXA 3ZJUA 2H89B 2BBCA 1J7CA 1IGCA 4A6QA 4HKQA 1HZ5A 3AEGB 3R2IA 4WIPA 1JRPA 1UNSA 2MEKA 3Q8BA 4XWWA 1FMAD 3P1MA 2WXKA 1ZXIA 2RDGA 1L4DB 1E6EB 1GOZA 1FCLA 3Q8EA 1CQVA 1WRIA 1VLBA 2QJLA 4NZLB 2W82A 1STEA 4RFBA 3FC4A 2BB6A 1KFYB 3B9JA 5EE3A 3MP9A 1D4BA 2YEPF 5HFYA 2LHEA 3SFDB 2WXJA 2Y5CA 4YTMB 2N7JA 1ZDXA 4RF0A 1JWSD 3BVZA 4OW0A 5H92C 5BMGA 1SIJA 1YMHE 4TQ1A 1E7PB 3LXFA 4KGTA 2W55A 2NTTA 3KLSX 4RGNA 1VZ7A 2JQRB 4KKJA 1PDXA 2XNAC 1SE3A 3HVDA 1PUTA 1GB1A 2KACA 5BMHA 1SJHD 1F77A 1T6BX 3UI3A 3OWEB 3SR6A 1L0XB 2TSSA 1HXYD 4ZYSA 3KQ4A 2ZW1A 3TEZA 1VR9A 3MHZA 1QT9A 1N60A 3L4PA 1E9MA 1NI3A 1V97A 1KRHA 2BS2B 3TUOA 3IAM1 2E6XA 1HA5A 4N6EB 4USAA 1D6EC 2R61A 3BWUD 1B1ZA 1AN8A 2I2YA 4RF1A 4RGMA 4YSZB 1JWAD 1L6UA 3NVWA 3ETRA 3T3NA 1V8CA 1TS3A 3U4EG 1OQQA 3PO0A 1ZXHA 3AEAB 2L1AA 2MH7A 3CWIA 2IPKD 1P7FA 2YEPB 4ZOHC 5D3DA 2MJ3A 3AE5B 1HZ6A 2HTME 1SF0A 4C56C 1E0ZA 2WU2B 1XLQA 1VDVA 2KQ4X 1YQ4B 2WXPA 4M0WA 2K5PA 1GT8A 1A70A 2WQYB 3P4QB 2I38A 2SAKA 2WDVB 1IUEA 1TZOA 1QOGA 2PW9A 4D2KA 4US8A 4ZHPA 1DOYA 1HQRD 2WS3B 2L83A 2LMCA 3I9V1 2WDRB 1TY0A 2OHFA 3FAHA 2GRIA 2KMMA 1XEEA 4R3DA 4L23A 2QSDA 2CU3A 3NVYA 3AEEB 4OZCA 2JYTA 1Y56A 4JX1C 5D3IB 4MM3B 3NZ3A 1M4VA 1H7XA 1SEBD 2BB5A 5TSSA 2BTEA 2D5GA 3W2DA 2V0GA 1KTKA 1K53A 3VR9B 3IAS1 3Q8AA 5BYRA 2N9KA 5BYSA 4HROA 3T3OA 4ZRQA 1FRRA 1KF6B 3IXSA 2L52A 1F2RI 1N5WA 1JALA 1FNUA 1RFKA 3P4RB 3LYYA 3ZGZA 1CZPA 1NYQA 2KN4A 3AE4B 1FNVA 2AQ3B 2FUG1 1I4HA 1MI0A 2MJDA 2N0SB 3NVVA 2J42A 4AQ7A 2V4IB 1I4RA 3GB1A 4RH6A 5JXVA 1TYGB 2LJIA 2BS4B 1ZPSA 1XLNA 3SFEB 1SBBB 4YTNB 1XCQL 2K22A 2WXMA 4L2YA 4ZRPA 3TEXA 1I4XA 3BK2A 1D5MC 2OEDA 2ONQA 1FXIA 3CIRB 4JE3B 2JYEA 4RGTA 2HDEA 4DXFA 5C2TB 1NENB 2QMTA 2INPE 3GS2A 4UDUC 4GDKB 4KKIA 2K0PA 1C76A 2W3RA 3NUHB 3MFGA 3DWGC 2B76B 5G5HA 4YSXB 3W5UB 1SB3C 1HEZE 2AX5A 2JX5A 3BK1A 4TSSA 1YN4A 1JWMD 1XF5L 2K3UA 2JXTA 1AW7A 1TY2A 3AECB 1SJED 2LGIA 5D7GA 1C4PA 1JCKB 4WH4A 4RGOS 3W5VB 3R8BA 1OQRA 1LO5D 1BMLC 4IKGA 3E9SA 5C3JB 2L32A 1I4QA 1CJEA 1MHHE 3AB5A 1GPXA 2FBWB 3P42A 1N5XA 3SEBA 4ARIA 4EE2A 2ACZB 1PFDA 4P6VF 1L6VA 1WWTA 3E56A 1TS4A 2KAJA 2IDYA 1OFFA 2LFIA 4B0EA 2H88B 2IJ0A 1ET9A 4JWSC 3C8YA 1KH0A 4IDIA 2DLBA 1F2RC 2JZPA 2WXQA 2WLBA 2LUMA 4HEA1 1DGJA 1ZDVA 3GP7A 1QOAA 1FRDA 2M19A 3HRDD 2DYMA 3W9CB 2IGHA 2XN9C 1KLGD 4P16A 3Q69A 3O13A 2W54A 2BT6A 4OVZA 2CJNA 1TKEA 2AQ2B 3V05A 2WP9B 1L4ZB 1SE2A 4CQNA 1V1OA 1ROEA 1C9FA 5LNK1 2G1EA 2KDMA 2PMVA 3AEDB 1XXGA 4HRSA 3BVGA 4KGSA 5AUIA 3TEYA 1C79A 1JW9D 2J53A 3AE3B 4DQOC 1RYJA 5AUKA 2CJOA 1QF6A 4MT5A 3R2TA 4B0MA 2IGGA 2NMQA 1XO3A 2QILA 2V3NA 4J3OD 5EE9A 1IBXB 1RM6C 3MC0B 4RCOA 2EKIA 3U52E 4HKZE 1ZP0B 4NJCA 2GI9A 3IT6B 1L0VB 1EWYC 1K50A 1JMLA 4AS1A 3TSSA 1VJKA 5FK9C 5GXGB 4TQ0A 3KWLA 3ZJTA 4LTUA 2Y3AA 3BVMA 2BW2A 2FE8A 1SSNA 2WDQB 4XWTA 2W3SA 3URYA 4YT0B 2E3TA 2Z8LA 4GLSC 2M56B 2K9XA 2PIAA 1NVID 5G5GA 4JWUC 3B2GA 1CK1A 1TS5A 2VZKD 1K52A 3AE8B 4A9AA 1H7WA 5HG2A 1YQ3B 4A90A 2BS3B 1WXQA 5H8YE 2J4XA 4Q2JA 1PGAA 5T8IA 3WCQA 4C80A 1IBXA 1NEKB 1C78A 4FXCA 1PGXA 2PKOA 4HJGE 4IOIE 4DXGA 4C7YA 5FR3A 2VZKB 2IGDA 2DBYA 2RDHA 1L0YB 1EM7A 1EWCA 1BUIC 3NS1A 2WXLA 1J7BA 3U7ZA 4XDDA 1AWDA 3VR8B 2KWDA 4N59A 2MJEA 4ITKA 1QILA 1YJJA 3U2SC 2WXFA 1YJIA 2JSVX 1ACCA 1WSPA 3VQIA 1K51A 3Q8FA 3P4PB 3RPFC 3MJ5A 4N58A 1ET6A 1EU3A 3HUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZOH C;  2PVO D;  2ACZ B;  1PFD A;  1GAQ B;  2MJ3 A;  4P6V F;  1L6V A;  1TKG A;  1WWT A;  3AMZ A;  1TKY A;  3AE5 B;  2KAJ A;  4C7Z A;  2HTM E;  1SF0 A;  1OFF A;  3AE6 B;  3CF4 A;  4YSY B;  1E0Z A;  2H88 B;  1UWM A;  1E10 A;  4JWS C;  2WU2 B;  1J7A A;  3ABV B;  4IDI A;  4YXD B;  1FXA A;  1XLQ A;  1VDV A;  1YQ4 B;  1GTE A;  2WLB A;  2K5P A;  3DWM A;  1XLO A;  1GT8 A;  1DGJ A;  1A70 A;  1QOA A;  2WQY B;  4WWM A;  3P4Q B;  1FRD A;  2M19 A;  2WDV B;  3HRD D;  1IUE A;  3EUB 2;  1QOG A;  3W9C B;  4US8 A;  4ZHP A;  1DOY A;  2WS3 B;  1WGK A;  1L5P A;  2W54 A;  2BT6 A;  1ZUD 2;  2CJN A;  3AN1 A;  1AYF A;  1TKE A;  3AE7 B;  3AE2 B;  2L83 A;  3HVZ A;  5EE1 A;  4US9 A;  2WP9 B;  1FO4 A;  2WDR B;  4YTP B;  2PVG C;  2OHF A;  3FAH A;  2H89 B;  1ROE A;  2KMM A;  2G1E A;  3AE1 B;  1I7H A;  1J7C A;  3AED B;  2CU3 A;  4HRS A;  1GTH A;  3AEE B;  3NVY A;  1ZOY B;  4JX1 C;  3LB8 C;  5AUI A;  3AEG B;  1JW9 D;  3AE3 B;  1JRP A;  1RYJ A;  5AUK A;  1FMA D;  5EE0 A;  3P1M A;  1H7X A;  1ZXI A;  2CJO A;  1QF6 A;  3NRZ A;  1E6E B;  1QOF A;  1XO3 A;  1N61 A;  3B2F A;  5EE9 A;  1RM6 C;  1WRI A;  3VR9 B;  2EKI A;  1VLB A;  2QJL A;  2DWQ A;  1ZP0 B;  1T3Q A;  4HRO A;  3FC4 A;  3VRA B;  3BII D;  1KFY B;  1KF6 B;  1FRR A;  1N63 A;  3B9J A;  5EE3 A;  1L0V B;  1EWY C;  2L52 A;  1N5W A;  1JAL A;  1JRO A;  1RFK A;  1VJK A;  5GXG B;  3P4R B;  1FIQ A;  1FM0 D;  3KWL A;  4LTU A;  2QIE B;  3AM9 A;  3SFD B;  1CZP A;  1NYQ A;  2Y5C A;  4YTM B;  1QOB A;  3AE4 B;  3P4S B;  5H92 C;  2WDQ B;  2MJD A;  2W3S A;  2N0S B;  2LEK A;  4YT0 B;  1SIJ A;  3AEF B;  2E3T A;  2M56 B;  1E7P B;  4KX6 B;  2K9X A;  3LXF A;  2PIA A;  1NVI D;  2W55 A;  3NVV A;  5G5G A;  1TYG B;  1QLB B;  2JQR B;  2BS4 B;  1N62 A;  3B2G A;  4JWU C;  1XLN A;  1PDX A;  4ZHO A;  3SFE B;  1WYG A;  3AV8 A;  4YTN B;  2K22 A;  1PUT A;  3AH7 A;  3AE8 B;  4A9A A;  1H7W A;  1FXI A;  2WU5 B;  1YQ3 B;  3AEB B;  2BS3 B;  3CIR B;  1WXQ A;  5H8Y E;  3SR6 A;  1XLP A;  4C80 A;  3WCQ A;  1NEK B;  5C2T B;  1NYR A;  4FXC A;  1NEN B;  1R7S A;  1DOX A;  1QT9 A;  2PKO A;  1N60 A;  4C7Y A;  3L4P A;  1F0Z A;  1E9M A;  2W3R A;  1JQ4 A;  3P63 A;  1JWB D;  2B76 B;  1NI3 A;  2DBY A;  1V97 A;  4YSX B;  2BS2 B;  1KRH A;  3DWG C;  5G5H A;  3W5U B;  1SB3 C;  4N6E B;  4USA A;  2Q5W D;  3NS1 A;  2AX5 A;  1J7B A;  1TJE A;  2JX5 A;  1AWD A;  3VR8 B;  4N59 A;  2MJE A;  3AE9 B;  4ITK A;  1YJJ A;  1RWS A;  4YSZ B;  3AEC B;  1FFU A;  1JWA D;  1L6U A;  1YJI A;  3VRB B;  4WQM A;  3NVW A;  3W5V B;  1FFV A;  1OQR A;  5MPO A;  3ETR A;  1V8C A;  3NVZ A;  1OQQ A;  5C3J B;  1DOI A;  3PO0 A;  3AEA B;  3P4P B;  3AB5 A;  1CJE A;  3RPF C;  3ZYY X;  1B9R A;  2MH7 A;  3CWI A;  1GPX A;  2FBW B;  1N5X A;  4N58 A;  3HUI A; 
#chains in the Genus database with same CATH topology
 4OHJ A;  1S1Q B;  4C7Z A;  3RNB C;  1YN5 A;  3PPA A;  3ABV B;  4RMA A;  4NAW A;  3ZNH B;  1GTE A;  3MTN B;  3A9K A;  2IY0 B;  3DVG X;  2KQ7 A;  1DYQ A;  4HJK A;  1NBF C;  1G6J A;  3PRM B;  1FNW A;  3AE2 B;  4DXA B;  2OOB B;  4WWN A;  4PT5 A;  4DWF A;  1Y8R C;  4L1B A;  1QOF A;  3B2F A;  4M8M A;  4GU2 A;  1QQR A;  3SU8 X;  1Z5S B;  2GMI C;  4F8C B;  3ZVV A;  1WGG A;  2BYT A;  2ZCB A;  3VRA B;  1LGR A;  1N63 A;  2M0A A;  4IM0 A;  2VRR B;  2PLP A;  2G9H D;  1FD6 A;  3RYT A;  1YNT E;  2MBB B;  2LEK A;  1V1P A;  4OZB A;  2LRU A;  1RRB A;  2Z59 B;  3BYT B;  1WYG A;  4KDI C;  2PTL A;  2N1V A;  3Q3F A;  3AEB B;  3D32 A;  4LDT D;  2JRI B;  2RPQ A;  4DBG A;  3MC8 A;  1TS2 A;  1QKZ A;  1MG4 A;  3Q14 C;  4OVV A;  1WXS A;  3V3X A;  4MGK E;  3AE9 B;  2KDI A;  3V6E B;  4FAD A;  2DZI A;  2WXI A;  1DOI A;  3ZYY X;  1KLU D;  2D3A A;  3C0R B;  2BQQ A;  3N1Y C;  4X57 B;  1MPE A;  2IZV B;  1VZ8 A;  4MSQ B;  2GBR A;  2L00 B;  4YXD B;  2XK5 A;  3DWM A;  2XBB C;  4HPL B;  3AI5 A;  3GOE A;  3ZJV A;  1V81 A;  1C77 A;  2WWZ A;  3AN1 A;  1WR6 E;  4E3C A;  4YTP B;  3LDZ E;  1UWX A;  5JH5 C;  4KSL C;  2PJH A;  1E8Y A;  3R2I A;  2MEK A;  4XWW A;  3P1M A;  3NOB A;  2RDG A;  1L4D B;  1K8R B;  3UQA A;  1EF5 A;  1LM8 B;  2HJ8 A;  3X23 A;  3OLM D;  2W82 A;  1STE A;  1QZE A;  4DK5 A;  1N6Z A;  2AYO B;  5EE3 A;  3APC A;  5HFY A;  3JYU A;  4WWO A;  3DOW A;  4I6P A;  4W9F A;  2KAN A;  2PE6 B;  2KFJ A;  1E90 A;  3ECI A;  4TQ1 A;  1SIJ A;  1E7P B;  4KGT A;  3L54 A;  2XNA C;  5G55 A;  5DPR A;  1RLF A;  3IHP C;  2KAC A;  1SJH D;  3VHT C;  3UI3 A;  5D94 A;  3CST A;  3SR6 A;  4ICV A;  4ZYS A;  1V49 A;  2G4D B;  3A1Q A;  1VR9 A;  3AXC A;  5BO4 B;  1TT5 B;  1E9M A;  2MWS B;  4URK A;  2BS2 B;  1E5W A;  3TUO A;  4ZYN A;  3ZRC A;  2KZR A;  1L6U A;  3PZD A;  1WGY A;  5DPW A;  3RNF C;  1MFW A;  2L1A A;  3CWI A;  1TTN A;  3NZS A;  2OJR A;  1WX8 A;  2MJ3 A;  3L10 B;  3OJ3 A;  4XGA B;  2DNF A;  1VDV A;  3VUX A;  2KO3 A;  1GT8 A;  1A70 A;  1IUE A;  1QOG A;  3TBL D;  1C3T A;  2LMC A;  2WX1 A;  2ZNV C;  3KW5 B;  4R3D A;  4L23 A;  2Y5B B;  2LGS A;  2CU3 A;  2MBO A;  4OZC A;  2JYT A;  2M0X A;  1NDD A;  3NZ3 A;  2LGX A;  2KMA A;  4PS7 A;  3NG0 A;  3KYC D;  3VR9 B;  2YLM A;  4ANV A;  5C23 A;  5BYS A;  2I1K A;  4HRO A;  4ZRQ A;  1FRR A;  4K7W A;  1F1H A;  3P4R B;  3LYY A;  3ZGZ A;  3N1Z C;  2KJR A;  1E8Z A;  3AE4 B;  3PT2 B;  2WYQ A;  1VCB A;  1I4H A;  2MJD A;  1HTO A;  3RUL A;  3VXW A;  2J42 A;  4AQ7 A;  3SD5 A;  3VH3 B;  1SBB B;  4YTN B;  2K22 A;  3B0A A;  4W9I A;  2OED A;  2ONQ A;  3TL5 A;  3CIR B;  5G2N A;  2GLS A;  4E74 A;  3B08 A;  4NJ6 A;  2QMT A;  4J6I A;  3UIP B;  2K0P A;  1C76 A;  3RN9 C;  1Q5W B;  3DWG C;  4FJV B;  3W5U B;  3ZTC A;  2AX5 A;  1JWM D;  3PSE B;  2BYV E;  5KHO A;  2KYW A;  2FCS A;  4WH4 A;  3R8B A;  1LO5 D;  3C19 A;  3GE8 C;  4IKG A;  1CJE A;  1MHH E;  1N5X A;  2XK5 B;  2KWC A;  2ZPY A;  2N4F A;  2DZM A;  4B0E A;  1L7Y A;  2D07 B;  2IJ0 A;  3C8Y A;  2DLB A;  2WLB A;  2LUM A;  1ZDV A;  3DBL B;  3IVF A;  3UIN B;  3HRD D;  2IGH A;  4M0W B;  2W54 A;  4OVZ A;  4FLH A;  4PS3 A;  4FJZ A;  1V1O A;  1ROE A;  2KKC A;  1I35 A;  2K8B A;  2FIF A;  4FHK A;  1OEY A;  3M3J A;  4FBJ B;  1RYJ A;  4MEM A;  1T0Q C;  3VH4 B;  1WE6 A;  1XQQ A;  3R2T A;  1ZKH A;  2QIL A;  3GZN B;  4G0N B;  1ZGU B;  2GBM A;  2GI9 A;  2KWV B;  3IT6 B;  1L0V B;  1K50 A;  3TSS A;  5FK9 C;  2NR2 A;  2BKF A;  4IW0 A;  1KM7 A;  4ANW A;  4TQ0 A;  3ZJT A;  4LTU A;  1R4N B;  3BVM A;  3QHT A;  2C5L C;  4XWT A;  2W3S A;  3URY A;  2KX3 A;  4WJN A;  3ZDT A;  2VZK D;  4KIK B;  3AE8 B;  4A9A A;  1H7W A;  2O2V B;  4A90 A;  2UYZ B;  4Q2J A;  4E71 A;  1NEK B;  4FXC A;  1PGX A;  4A3P A;  3DBS A;  2PKO A;  5FR3 A;  2L7R A;  3DHI C;  2VZK B;  2NBV B;  2RDH A;  1L0Y B;  1EM7 A;  1EWC A;  2NBW B;  3JW0 X;  1YQB A;  3WAP A;  2MCN B;  2MJE A;  1YJJ A;  1WX7 A;  3Q3O C;  1WSP A;  4JGH B;  3Q8F A;  2O6V B;  3HK0 A;  4MM3 A;  2L3Z A;  1J8C A;  4N58 A;  1ET6 A;  5AEK B;  1EU3 A;  2PVO D;  4NAW B;  3N9Y C;  2BWE S;  4MAC A;  5FKA C;  5I4D A;  1SXT A;  4HLE A;  4REZ A;  3UQB A;  2JUO A;  1HTQ A;  5D6J B;  3ZNI D;  3J9C A;  3PHW B;  5CHV C;  3HVZ A;  4IC7 B;  1P9D U;  2PVG C;  4MGZ E;  3AE1 B;  2JWZ A;  1Q10 A;  1XD3 B;  1UD7 A;  4LLG M;  3DBR B;  2QDF A;  2V1Y A;  2D10 A;  1R4N I;  4LNO A;  3RZF A;  2RPV A;  3PVL A;  3ZNZ B;  2DZJ A;  2KVR A;  1EUV B;  1WJU A;  3BZD B;  3ZIM A;  1UUP A;  1JRO A;  2NCN A;  2J52 A;  4K81 A;  3T9L A;  2QIE B;  2N7D A;  2IO3 B;  1C4C A;  1SIF A;  2ICI A;  2LZ6 A;  1VD2 A;  1P7E A;  4BKG A;  1T0Y A;  1E7V A;  3AEF B;  2LVQ A;  2AWT A;  1SE4 A;  4P1B C;  3HHM A;  2Y5P A;  3DVN U;  4EZJ A;  5HI1 A;  4W9E A;  2Z0D B;  3IT4 B;  3OJ4 B;  4LDT B;  4WUR A;  4HPM B;  3VVW B;  4TV3 A;  4JQW C;  1I4P A;  1TIF A;  3ZDM C;  4YL8 A;  1Q1O A;  2LWP A;  3FIL A;  1WF9 A;  3W1S A;  2Q5W D;  4BKT A;  1TJE A;  4MH0 E;  2LD9 A;  2WXR A;  1RWS A;  4C4V A;  2RMM A;  4WQM A;  4ARC A;  2MSE D;  3PZ7 A;  2LUE A;  4KZC A;  3QC8 B;  4NAM A;  3H8H A;  1MVK A;  2DAF A;  3NS8 A;  3AE6 B;  2QEJ C;  4YSY B;  1E10 A;  1T5X D;  1H4R A;  4W9H A;  4KDL B;  2RGF A;  1XLO A;  4K3B A;  2KJH B;  1IGD A;  1T0R C;  1WGK A;  1JWU D;  1AYF A;  4K7S A;  4US9 A;  4AUQ C;  2H89 B;  4A6Q A;  4F1S A;  4HKQ A;  1TZ1 A;  1YIW A;  3AEG B;  1WFY A;  4W9K A;  1UNS A;  4BKS D;  2JVC A;  3Q8B A;  3AU5 A;  2WXK A;  3Q3M C;  1ZXI A;  1PQS A;  1U4A A;  3A1Q B;  5L95 C;  3UGB B;  1FCL A;  1EO6 A;  1C1Y B;  1GC6 A;  3TIX A;  1X1M A;  4RFB A;  3FC4 A;  2KNB A;  2YEP F;  2C7N B;  2LHE A;  2WXJ A;  1ZDX A;  3BVZ A;  4OW0 A;  1YMH E;  4FHJ A;  3LXF A;  1UGM A;  2KTF A;  3V60 A;  1PUT A;  2LRW A;  1L0X B;  2ZW1 A;  4EOY A;  3FKY A;  4NQL B;  3MHZ A;  1QT9 A;  3KUZ A;  2J0K A;  3N3K B;  1V97 A;  1KRH A;  3IAM 1;  2E6X A;  4N6E B;  1AN8 A;  2I2Y A;  3RNG C;  3RI7 C;  2IO1 B;  2L0T A;  1V8C A;  3U4E G;  1E8W A;  1ZXH A;  1WJ6 A;  2MW5 A;  4ZOH C;  5D3D A;  3H7P A;  3OAW A;  1HZ6 A;  4C56 C;  1YX6 B;  4XC2 A;  1E0Z A;  2N9X A;  2W9N A;  2KQ4 X;  1UZX B;  1GUA B;  3PGE A;  4MGI E;  2WQY B;  2A5U A;  3P4Q B;  3MHS D;  1KLV A;  2ZNV B;  3R7Q A;  3ENE A;  4US8 A;  1DOY A;  1HQR D;  2WS3 B;  4AWJ A;  1WIA A;  2L83 A;  5TR5 A;  2WDR B;  2GRI A;  2KMM A;  3RNE C;  2FCM A;  5GMV A;  2QSD A;  2RDB C;  2RR9 A;  3NZU A;  3PLU A;  3Q3J A;  4JX1 C;  3DQV A;  1H7X A;  1SEB D;  5TSS A;  4A20 A;  3BY4 B;  2BYF A;  3Q8A A;  2N9K A;  4CHK A;  1JAL A;  2GBK A;  1CZP A;  2LJ5 A;  2XEW A;  2FUG 1;  3QAR A;  5LXI B;  4BOS C;  1WZ3 A;  3GB1 A;  1WJN A;  2LGY A;  5JXV A;  3WAM A;  4WQO B;  1XLN A;  2G4S A;  2OJW A;  1YX5 B;  2WXM A;  1V5O A;  1I4X A;  4HXD A;  4XYC A;  1D5M C;  4F7Z A;  5E6N A;  4JE3 B;  2JYE A;  5C2T B;  4PYU A;  4UDU C;  2MBQ A;  4KKI A;  4B95 A;  3MFG A;  2B76 B;  5G5H A;  4YSX B;  1SB3 C;  1HEZ E;  2BVC A;  3BK1 A;  2FUH B;  1XF5 L;  2FID A;  3R3M A;  2JXT A;  3AEC B;  1SJE D;  2LGI A;  2V4L A;  5D7G A;  3DBH I;  3QAQ A;  4RGO S;  1OQR A;  2JZZ A;  1S3S G;  3AB5 A;  3WAL A;  4AJY B;  4EE2 A;  2ACZ B;  1OQY A;  4S17 A;  1L6V A;  2HE7 A;  1TS4 A;  2KAJ A;  1OFF A;  1ET9 A;  4JWS C;  4W9D A;  2WXQ A;  4HEA 1;  1D3Z A;  3QA8 A;  1I42 A;  1FRD A;  2M19 A;  2EMS A;  3W9C B;  2XN9 C;  2WHI A;  4P16 A;  2VH2 A;  1P0R A;  3K9P B;  4HDO A;  3ZNG C;  3ZUN A;  3IBE A;  3WAO A;  1ISN A;  4M02 A;  2G1E A;  2KDM A;  2M4N A;  4DQO C;  3A9J A;  2J0M A;  4B0M A;  2IND C;  2IGG A;  5IKC M;  2CKH B;  2V3N A;  2IY1 B;  5EE9 A;  1BT0 A;  5CHW A;  3MC0 B;  3B1L X;  5CX3 A;  1ZP0 B;  2L0F A;  1MG8 A;  1WGR A;  4W9L A;  2BW2 A;  4HK2 A;  2WDQ B;  4LJP B;  4YT0 B;  2E3T A;  2M56 B;  4BBN F;  2K9X A;  2PIA A;  1NVI D;  3NY5 A;  2WDT B;  5G5G A;  2QC8 A;  5D2M B;  3B2G A;  1CK1 A;  1TS5 A;  3U30 A;  2FCQ A;  1K52 A;  1YQ3 B;  2BS3 B;  1WXQ A;  2ZCC A;  2C60 A;  2N1W A;  2J4X A;  4B6W A;  4IOI E;  2IGD A;  2DBY A;  3AU4 A;  2ZPN A;  2WXL A;  2PEA A;  4N59 A;  4ACF A;  4ITK A;  3I63 C;  4NY0 A;  4BVU C;  4HCN B;  3QQ8 B;  2I1J A;  3VQI A;  2BPS A;  3RPF C;  1V9J A;  1C78 A;  3VTW A;  3HUI A;  4AOF A;  4GB9 A;  3H6N A;  1MHX A;  1GB4 A;  2NPT A;  1UWM A;  1BXT A;  1ZW7 A;  4S0R A;  2JPH A;  1J7A A;  2V3P A;  5BMI A;  1FCC C;  1WM2 A;  3Q8C A;  4JIO U;  2R2O A;  2K6D B;  1Z2M A;  3RD2 A;  2AQ1 B;  3DVG Y;  2C9W B;  1ZUD 2;  3BYY B;  1SGH A;  1P98 A;  3QIJ A;  2FCN A;  3H7P B;  2KDE B;  1MJD A;  1GTH A;  3LB8 C;  3ZKJ C;  2JU6 X;  2LI5 A;  5E6P A;  2L8J A;  3NRZ A;  1YD8 U;  1PYW D;  1OGW A;  4LNK A;  2X38 A;  4LJO B;  4YWG G;  3BII D;  3TEW A;  2DZK A;  2JT4 B;  1ESF A;  2ZW0 A;  3IG3 A;  1D5X C;  3FIL B;  2KQS A;  1FIQ A;  1FM0 D;  3M62 B;  4GDL A;  4H2A A;  5E6J A;  5BYQ A;  5CTR C;  1QOB A;  3I5J C;  3PTF C;  2MQJ A;  3MJW A;  4OZA A;  2DYO A;  2WXN A;  4ZHO A;  4B9K A;  1C4A A;  1QLB B;  1N62 A;  3AV8 A;  4HDQ A;  2N9L A;  1GJZ A;  2LXC A;  3AH7 A;  3EEC A;  2VH1 A;  4IUM B;  2WU5 B;  4K3C A;  1NYR A;  4BAX A;  1WXV A;  1IP9 A;  4GMV A;  1JQ4 A;  3P63 A;  4GDL B;  1JWB D;  2QHO A;  2NTS A;  5L83 A;  4RM8 A;  2GB1 A;  2ZVO A;  1L2N A;  1FFV A;  1WRD B;  5MPO A;  3NVZ A;  4HCP B;  1Q0W B;  1UBI A;  4XZ4 A;  4PS8 A;  4I6N B;  3TJP A;  1F52 A;  1VRA B;  4G3X B;  1ENF A;  4A8X C;  2FAZ A;  3DCG A;  1V5T A;  2MP2 B;  2JXX A;  2JY6 A;  2K8C A;  2WNM A;  2PPH A;  1I4G A;  1EU4 A;  2R2Q A;  2D3G A;  5HHD G;  2RSU A;  4LK0 M;  1L5P A;  1DOX A;  3AE7 B;  3IFW B;  1FO4 A;  2INN E;  4ZDV A;  3ZJU A;  3KH0 A;  2BBC A;  3VTV A;  1IGC A;  3W1Y A;  2KC1 A;  2RD0 A;  1HZ5 A;  2O6V A;  3VTU A;  1JRP A;  1FMA D;  2BYE A;  3PRP B;  3PHX B;  1E6E B;  3UF8 A;  2KLG A;  4TKN A;  3Q8E A;  1WRI A;  3JVZ X;  4PK1 A;  2QJL A;  4NZL B;  3B9J A;  4MEL A;  4WJO A;  4DDI D;  3SFD B;  4YTM B;  2N9E B;  1JWS D;  2WGS A;  3ML8 A;  3ZXV A;  2HJ1 A;  3TMP B;  5BMG A;  3PLV A;  4RGN A;  3KLS X;  2NTT A;  3O65 B;  4KKJ A;  3QWZ B;  1F77 A;  1KOT A;  5DPT A;  1LFD A;  3M63 B;  1HXY D;  3H9D A;  3KQ4 A;  1V80 A;  1N60 A;  3L4P A;  2KDF B;  4HWI B;  2KJ6 A;  4BFR A;  4W9C A;  1HA5 A;  4USA A;  1D6E C;  2R61 A;  1OTR B;  5J2R A;  1B1Z A;  2AL3 A;  2KC2 A;  4RGM A;  2YVC A;  4YSZ B;  4BZA A;  1V86 A;  3R7R A;  1TS3 A;  1OQQ A;  2KLC A;  3AEA B;  4G50 A;  2NBU A;  1XT9 B;  5JZE B;  2YEP B;  4P1C C;  3ZO5 B;  3HM6 X;  3AE5 B;  2AL6 A;  2HTM E;  2IBI B;  1KJT A;  2WU2 B;  1XLQ A;  1YQ4 B;  4C00 A;  2WXP A;  1V6E A;  2K5P A;  4M0W A;  3GZN I;  2I38 A;  2SAK A;  2B3A A;  1TZO A;  3DVN V;  1UF0 A;  1V2Y A;  4D2K A;  4IG7 B;  2Z0E B;  2KOX A;  2EKE C;  4I6L B;  5IOI A;  2LVO A;  1WGH A;  4WAA A;  4RM9 A;  2D2Q A;  3NVY A;  4WWP A;  3P2B A;  5D3I B;  4MM3 B;  4DHJ B;  1M4V A;  5IN7 A;  2BB5 A;  1CMX B;  1WY8 A;  2D5G A;  2V0G A;  1KTK A;  1K53 A;  3NHE B;  1LXD A;  2KDB A;  3IXS A;  3KVF B;  1F2R I;  1N5W A;  1FNU A;  3WAN A;  1FNV A;  1MI0 A;  2N0S B;  3NVV A;  1GNU A;  2V4I B;  2C7H A;  1TYG B;  2O2V A;  2BS4 B;  4MSM B;  2INC C;  1XCQ L;  4M8N A;  4KIK A;  4FUL A;  2DAJ A;  3KUD B;  3U7D A;  2V9H A;  4AP4 C;  2HDE A;  5CHF A;  1WXA A;  4DXF A;  3PS6 A;  3GS2 A;  4EZK A;  2MRP A;  3DDC B;  4GDK B;  1P3Q U;  3NUH B;  2ZZP B;  4PYZ A;  2M17 A;  3ZXR A;  2BF8 B;  2K25 A;  4TSS A;  1YN4 A;  3ZW3 A;  2KT7 A;  1TY2 A;  4FN2 A;  2KXJ A;  3W5V B;  4GOC A;  1BML C;  3RT3 B;  1I4Q A;  5JHB A;  3P42 A;  3SEB A;  2JRH A;  2MP2 A;  4M00 A;  1PFD A;  1WWT A;  3VFK A;  2LFI A;  3PRE A;  2KWU B;  1UBQ A;  2H88 B;  3A4S C;  5J18 A;  4IDI A;  3KUC B;  1F2R C;  4W9G A;  3N20 C;  3UIO B;  4DHZ B;  2DYM A;  1KLG D;  3Q69 A;  3O13 A;  2BT6 A;  1RFA A;  3ZRF A;  3S2A A;  1UH6 A;  3V62 A;  1L4Z B;  2KFK A;  4MDK E;  4CQN A;  3I3T B;  5LNK 1;  2MBE A;  2EMT A;  2PMV A;  1XXG A;  3M95 A;  2LGD A;  4HRS A;  4KGS A;  2GBJ A;  1C79 A;  1JW9 D;  4EUT A;  3AE3 B;  5C1Z A;  3TEY A;  2CJO A;  1QF6 A;  1SE9 A;  1R4M B;  4NPN A;  4EEW A;  1TGZ B;  1IBX B;  1RM6 C;  4RCO A;  1FXT B;  1JRU A;  4BKS A;  4NJC A;  3APD A;  1VJK A;  3QX1 A;  3KWL A;  1WJ4 A;  2G3Q B;  4JWU C;  5HG2 A;  1PGA A;  3WCQ A;  4DDG D;  2A4Z A;  4C7Y A;  4HJG E;  1E7U A;  4ICU A;  1H8C A;  4LNI A;  3NS1 A;  2FNJ B;  2N9P C;  1IYF A;  3U2S C;  3DHH C;  1YJI A;  2ZEQ A;  2BGF A;  3EFC A;  1K51 A;  4GN1 A;  4KSK C;  1YOV B;  1GAQ B;  1TKG A;  3EA6 A;  3AMZ A;  1GG3 A;  4WJP A;  1FXA A;  2K8H A;  4A55 A;  1WGD A;  5EDS A;  4WWM A;  1FEH A;  3HM3 A;  4RNA A;  2CR5 A;  3EUB 2;  3I57 A;  2LXA A;  2KX0 A;  4KGR A;  2CHW A;  4DHZ E;  3RUI B;  2MBH A;  2WXH A;  2ZVN A;  1I7H A;  2SEB D;  3AUL A;  1ZOY B;  1NI2 A;  2V3S A;  5EE0 A;  5KHQ A;  2CS4 A;  2WXG A;  1N61 A;  2UWQ A;  4P7I A;  4C4V B;  1PGB A;  3A4R A;  2DWQ A;  1T3Q A;  2CHX A;  2LVP A;  3QCA A;  3RFZ B;  4JPS A;  3AM9 A;  1WMH B;  2DEN B;  2KN5 A;  2NVU I;  3P4S B;  1R4M I;  3PZ8 A;  3EGR A;  3Q6B A;  3DPD A;  4KX6 B;  1YN3 A;  2M8S A;  3JSV A;  3EHV A;  2ON8 A;  2NS5 A;  1P1A A;  1XCT L;  1ZE3 D;  1XLP A;  1V1P B;  3V61 A;  4O1N A;  1WX9 A;  1R7S A;  3L08 A;  3H7S A;  4IWQ A;  3ZQ4 A;  1YJ1 A;  1F0Z A;  3DBR I;  4M01 A;  1WE7 A;  1E8X A;  4KZ0 A;  4IWO A;  4XDC A;  1VZ6 A;  4MH8 A;  2IO2 B;  3QK0 A;  1FFU A;  2JWU A;  3VRB B;  2DHZ A;  4KVG B;  4II3 B;  2LHD A;  1UGJ A;  1A5R A;  1B9R A;  1HE8 A;  2DX5 B;  1WH3 A;  1D5Z C;  4NNJ B;  1TKY A;  5J17 A;  3SDL C;  3CF4 A;  2HD5 B;  1J0G A;  2ZJD A;  4TMA B;  2EEL A;  2MLB A;  5IP4 D;  1GC7 A;  4GSW A;  2J7Q B;  4II2 B;  3APF A;  3KWV A;  2WXO A;  1J19 A;  3RCZ A;  1M94 A;  2MX2 A;  3BIN A;  5EE1 A;  4DHJ D;  4XE0 A;  3U8Z A;  4WAF A;  3N30 A;  1J7C A;  5IAA C;  1FPY A;  3ONS A;  4ANX A;  4WIP A;  4CYE A;  4GDK A;  3DBH B;  1GOZ A;  1OEY J;  1CQV A;  1VLB A;  2GBN A;  2GOW A;  4N9F 4;  2BB6 A;  4BOZ B;  1KFY B;  1EF1 A;  3MP9 A;  1D4B A;  2WX0 A;  4ZRJ A;  1RAX A;  2Y5C A;  1WXM A;  2DYB A;  4RF0 A;  2N7J A;  1F9J A;  5H92 C;  2MHJ A;  2M1M A;  2W55 A;  1VZ7 A;  2JQR B;  2MA9 B;  4G11 A;  5JHA A;  1PDX A;  3WIM A;  1SE3 A;  3HVD A;  1GB1 A;  5BMH A;  1T6B X;  3OWE B;  3JSV B;  4JLC A;  4JL9 A;  3RMK C;  2TSS A;  5AZH A;  5DCN A;  4FJY A;  3TEZ A;  2K6Q A;  1WR1 A;  1NI3 A;  3KYD D;  3DHG C;  3BWU D;  4RF1 A;  1JWA D;  2HTH A;  3CMM B;  5DPS A;  3NVW A;  3ML9 A;  2O6V D;  3ETR A;  3T3N A;  3PO0 A;  4TUU A;  1WZ0 A;  2IYD B;  4GGQ A;  2MH7 A;  3ZLZ A;  2IPK D;  3DBL I;  3RNC C;  1P7F A;  3V6C B;  3L13 A;  1SF0 A;  3VUY A;  4ANU A;  4AJW A;  2WDV B;  1LQB A;  2J0J A;  1WM3 A;  2PW9 A;  2KK8 A;  4ZHP A;  2KTR B;  3RNA C;  3A9K B;  3I9V 1;  4QAY A;  1TY0 A;  2OHF A;  3FAH A;  4OVU A;  1XEE A;  3AEE B;  1Y56 A;  5AZG A;  3OG5 A;  4IWP A;  2LAS A;  2BTE A;  3W2D A;  3IAS 1;  5BYR A;  2UU7 A;  3T3O A;  3N32 A;  1KF6 B;  5AZF A;  2N7E A;  2L52 A;  3PV1 A;  1RFK A;  4HVB A;  2D11 A;  3CSF A;  1NYQ A;  2KN4 A;  4GIV A;  2D3C A;  4MJS A;  2CU1 A;  3L17 A;  2AQ3 B;  1WMH A;  4RH6 A;  1I4R A;  4XX5 A;  2LJI A;  1ZPS A;  3VUW A;  2BWF A;  3SFE B;  4L2Y A;  4ZRP A;  3TEX A;  3BK2 A;  2QCZ A;  1FXI A;  3ZTD A;  4RGT A;  1WI0 A;  1NEN B;  2INP E;  3LJ3 A;  1T0S C;  4K7U A;  2W3R A;  2KMC A;  3Q3N C;  3SHQ A;  3L16 A;  1WYW B;  5LXH A;  4ZRI A;  3PRZ A;  3WA0 A;  2JX5 A;  3H1U A;  3CF6 E;  2K3U A;  1AW7 A;  3GE3 C;  2JZ3 B;  4ZRK A;  1C4P A;  4K1R B;  1JCK B;  3MC9 A;  3E9S A;  5C3J B;  2L32 A;  1GPX A;  2IO0 B;  2FBW B;  3ALB A;  4ARI A;  3HIZ A;  4P6V F;  3E56 A;  4LCD E;  2IDY A;  2KFK B;  3T8M A;  4ASW C;  2NPT B;  5LLI A;  1TBE A;  1KH0 A;  2JZP A;  3EFU A;  5HKH A;  1IPG A;  2KTR A;  3QJZ A;  4LNF A;  1DGJ A;  3GP7 A;  3TCA A;  1QOA A;  3EC8 A;  4CO7 A;  4W9J A;  4GXB A;  2CHZ A;  2CJN A;  1TKE A;  5E6O A;  2AQ2 B;  3V05 A;  2WP9 B;  2KD0 A;  1SE2 A;  2REX A;  4LNN A;  1C9F A;  3AED B;  5IO9 A;  3BVG A;  5AUI A;  1AAR A;  2J53 A;  2D3B A;  3NJT A;  2G45 B;  5AUK A;  2C7M B;  4WJQ A;  4MT5 A;  4NQK E;  4EFO A;  2JF5 A;  1XO3 A;  2NMQ A;  4J3O D;  2EKI A;  3U52 E;  4HKZ E;  1EWY C;  1JML A;  4AS1 A;  5GXG B;  5IA7 A;  4IM2 A;  4EKU A;  2Y3A A;  2FE8 A;  1SSN A;  4GLS C;  2Z8L A;  2AEH A;  4IM3 A;  3L0W B;  2K1F A;  3Q2A C;  2BKR B;  3R66 C;  5H8Y E;  3N1X C;  4HPP A;  5T8I A;  4C80 A;  1IBX A;  3VAW A;  4BBN C;  4DXG A;  2KHW B;  4MJS B;  3A9J B;  3X0W A;  4FA6 A;  3RZW C;  1BUI C;  2PE9 A;  1J7B A;  3K9O B;  1UEL A;  4XDD A;  1AWD A;  3U7Z A;  2L76 A;  3VR8 B;  2ASQ A;  2KWD A;  1QIL A;  2WXF A;  4MGY E;  3A33 B;  2JSV X;  1ACC A;  5FR6 A;  3W1S C;  3P4P B;  2L05 A;  4NJ7 A;  4KV2 A;  2KVZ A;  2X8X X;  3VDZ A;  3MJ5 A;  4A3O A;  2K39 A;  4EZL A; 
#chains in the Genus database with same CATH homology
 2PVO D;  4NAW B;  1GAQ B;  3N9Y C;  4OHJ A;  1MHX A;  1TKG A;  3AMZ A;  3EA6 A;  4MAC A;  4C7Z A;  1GB4 A;  5FKA C;  5I4D A;  1YN5 A;  1UWM A;  1BXT A;  1SXT A;  1J7A A;  3ABV B;  1FXA A;  2V3P A;  5BMI A;  1FCC C;  1GTE A;  4REZ A;  4A55 A;  3Q8C A;  4WWM A;  1FEH A;  1DYQ A;  4RNA A;  3EUB 2;  2AQ1 B;  3I57 A;  3J9C A;  1ZUD 2;  1FNW A;  3HVZ A;  3BYY B;  3AE2 B;  4KGR A;  2PVG C;  2WXH A;  3AE1 B;  1I7H A;  1Q10 A;  4PT5 A;  2SEB D;  1GTH A;  1ZOY B;  3LB8 C;  2JU6 X;  4LLG M;  5EE0 A;  3NRZ A;  4L1B A;  1QOF A;  2WXG A;  3B2F A;  1N61 A;  1QQR A;  1PYW D;  1PGB A;  2RPV A;  2DWQ A;  2X38 A;  1T3Q A;  2BYT A;  3VRA B;  3TEW A;  4YWG G;  3BII D;  1N63 A;  2M0A A;  3BZD B;  3RFZ B;  1ESF A;  1UUP A;  2ZW0 A;  1JRO A;  1D5X C;  2J52 A;  4JPS A;  3FIL B;  2PLP A;  2G9H D;  1FIQ A;  1FM0 D;  4H2A A;  5E6J A;  1FD6 A;  2QIE B;  3AM9 A;  5BYQ A;  1C4C A;  2ICI A;  1QOB A;  1YNT E;  3P4S B;  1P7E A;  3PZ8 A;  4OZA A;  3EGR A;  2LEK A;  2DYO A;  3AEF B;  2WXN A;  1V1P A;  4OZB A;  4KX6 B;  1YN3 A;  4ZHO A;  1C4A A;  1SE4 A;  1QLB B;  1N62 A;  2ON8 A;  3BYT B;  2Y5P A;  3AV8 A;  1WYG A;  2N9L A;  5HI1 A;  2PTL A;  1XCT L;  3IT4 B;  3AH7 A;  4WUR A;  2WU5 B;  3AEB B;  1ZE3 D;  1XLP A;  1V1P B;  1NYR A;  4O1N A;  1I4P A;  1R7S A;  3ZQ4 A;  1F0Z A;  1JQ4 A;  3P63 A;  4GDL B;  1JWB D;  3FIL A;  1TS2 A;  1QKZ A;  3W1S A;  2Q5W D;  1TJE A;  3V3X A;  4XDC A;  1VZ6 A;  4MH8 A;  2WXR A;  3AE9 B;  2NTS A;  1RWS A;  1FFU A;  2GB1 A;  2JWU A;  3VRB B;  2RMM A;  4WQM A;  4ARC A;  1FFV A;  3PZ7 A;  5MPO A;  3NVZ A;  2WXI A;  1DOI A;  2LHD A;  1UGJ A;  1B9R A;  4NAM A;  1KLU D;  3ZYY X;  3H8H A;  1MVK A;  1D5Z C;  1MPE A;  1VRA B;  1TKY A;  1VZ8 A;  1ENF A;  3AE6 B;  3CF4 A;  4YSY B;  2QEJ C;  4A8X C;  1E10 A;  1T5X D;  4YXD B;  4TMA B;  2EEL A;  3DWM A;  1XLO A;  2WNM A;  1I4G A;  1EU4 A;  3ZJV A;  3KWV A;  5HHD G;  1IGD A;  1WGK A;  2WXO A;  1L5P A;  1C77 A;  4LK0 M;  1JWU D;  3AN1 A;  1AYF A;  1DOX A;  3AE7 B;  5EE1 A;  4XE0 A;  4US9 A;  1FO4 A;  4YTP B;  2INN E;  4WAF A;  1UWX A;  3ZJU A;  2H89 B;  2BBC A;  1J7C A;  1IGC A;  4A6Q A;  4HKQ A;  1HZ5 A;  3AEG B;  3R2I A;  4WIP A;  1JRP A;  1UNS A;  2MEK A;  3Q8B A;  4XWW A;  1FMA D;  3P1M A;  2WXK A;  1ZXI A;  2RDG A;  1L4D B;  1E6E B;  1GOZ A;  1FCL A;  3Q8E A;  1CQV A;  1WRI A;  1VLB A;  2QJL A;  4NZL B;  2W82 A;  1STE A;  4RFB A;  3FC4 A;  2BB6 A;  1KFY B;  3B9J A;  5EE3 A;  3MP9 A;  1D4B A;  2YEP F;  5HFY A;  2LHE A;  3SFD B;  2WXJ A;  2Y5C A;  4YTM B;  2N7J A;  1ZDX A;  4RF0 A;  1JWS D;  3BVZ A;  4OW0 A;  5H92 C;  5BMG A;  1SIJ A;  1YMH E;  4TQ1 A;  1E7P B;  3LXF A;  4KGT A;  2W55 A;  2NTT A;  3KLS X;  4RGN A;  1VZ7 A;  2JQR B;  4KKJ A;  1PDX A;  2XNA C;  1SE3 A;  3HVD A;  1PUT A;  1GB1 A;  2KAC A;  5BMH A;  1SJH D;  1F77 A;  1T6B X;  3UI3 A;  3OWE B;  3SR6 A;  1L0X B;  2TSS A;  1HXY D;  4ZYS A;  3KQ4 A;  2ZW1 A;  3TEZ A;  1VR9 A;  3MHZ A;  1QT9 A;  1N60 A;  3L4P A;  1E9M A;  1NI3 A;  1V97 A;  1KRH A;  2BS2 B;  3TUO A;  3IAM 1;  2E6X A;  1HA5 A;  4N6E B;  4USA A;  1D6E C;  2R61 A;  3BWU D;  1B1Z A;  1AN8 A;  2I2Y A;  4RF1 A;  4RGM A;  4YSZ B;  1JWA D;  1L6U A;  3NVW A;  3ETR A;  3T3N A;  1V8C A;  1TS3 A;  3U4E G;  1OQQ A;  3PO0 A;  1ZXH A;  3AEA B;  2L1A A;  2MH7 A;  3CWI A;  2IPK D;  1P7F A;  2YEP B;  4ZOH C;  5D3D A;  2MJ3 A;  3AE5 B;  1HZ6 A;  2HTM E;  1SF0 A;  4C56 C;  1E0Z A;  2WU2 B;  1XLQ A;  1VDV A;  2KQ4 X;  1YQ4 B;  2WXP A;  4M0W A;  2K5P A;  1GT8 A;  1A70 A;  2WQY B;  3P4Q B;  2I38 A;  2SAK A;  2WDV B;  1IUE A;  1TZO A;  1QOG A;  2PW9 A;  4D2K A;  4US8 A;  4ZHP A;  1DOY A;  1HQR D;  2WS3 B;  2L83 A;  2LMC A;  3I9V 1;  2WDR B;  1TY0 A;  2OHF A;  3FAH A;  2GRI A;  2KMM A;  1XEE A;  4R3D A;  4L23 A;  2QSD A;  2CU3 A;  3NVY A;  3AEE B;  4OZC A;  2JYT A;  1Y56 A;  4JX1 C;  5D3I B;  4MM3 B;  3NZ3 A;  1M4V A;  1H7X A;  1SEB D;  2BB5 A;  5TSS A;  2BTE A;  2D5G A;  3W2D A;  2V0G A;  1KTK A;  1K53 A;  3VR9 B;  3IAS 1;  3Q8A A;  5BYR A;  2N9K A;  5BYS A;  4HRO A;  3T3O A;  4ZRQ A;  1FRR A;  1KF6 B;  3IXS A;  2L52 A;  1F2R I;  1N5W A;  1JAL A;  1FNU A;  1RFK A;  3P4R B;  3LYY A;  3ZGZ A;  1CZP A;  1NYQ A;  2KN4 A;  3AE4 B;  1FNV A;  2AQ3 B;  2FUG 1;  1I4H A;  1MI0 A;  2MJD A;  2N0S B;  3NVV A;  2J42 A;  4AQ7 A;  2V4I B;  1I4R A;  3GB1 A;  4RH6 A;  5JXV A;  1TYG B;  2LJI A;  2BS4 B;  1ZPS A;  1XLN A;  3SFE B;  1SBB B;  4YTN B;  1XCQ L;  2K22 A;  2WXM A;  4L2Y A;  4ZRP A;  3TEX A;  1I4X A;  3BK2 A;  1D5M C;  2OED A;  2ONQ A;  1FXI A;  3CIR B;  4JE3 B;  2JYE A;  4RGT A;  2HDE A;  4DXF A;  5C2T B;  1NEN B;  2QMT A;  2INP E;  3GS2 A;  4UDU C;  4GDK B;  4KKI A;  2K0P A;  1C76 A;  2W3R A;  3NUH B;  3MFG A;  3DWG C;  2B76 B;  5G5H A;  4YSX B;  3W5U B;  1SB3 C;  1HEZ E;  2AX5 A;  2JX5 A;  3BK1 A;  4TSS A;  1YN4 A;  1JWM D;  1XF5 L;  2K3U A;  2JXT A;  1AW7 A;  1TY2 A;  3AEC B;  1SJE D;  2LGI A;  5D7G A;  1C4P A;  1JCK B;  4WH4 A;  4RGO S;  3W5V B;  3R8B A;  1OQR A;  1LO5 D;  1BML C;  4IKG A;  3E9S A;  5C3J B;  2L32 A;  1I4Q A;  1CJE A;  1MHH E;  3AB5 A;  1GPX A;  2FBW B;  3P42 A;  1N5X A;  3SEB A;  4ARI A;  4EE2 A;  2ACZ B;  1PFD A;  4P6V F;  1L6V A;  1WWT A;  3E56 A;  1TS4 A;  2KAJ A;  2IDY A;  1OFF A;  2LFI A;  4B0E A;  2H88 B;  2IJ0 A;  1ET9 A;  4JWS C;  3C8Y A;  1KH0 A;  4IDI A;  2DLB A;  1F2R C;  2JZP A;  2WXQ A;  2WLB A;  2LUM A;  4HEA 1;  1DGJ A;  1ZDV A;  3GP7 A;  1QOA A;  1FRD A;  2M19 A;  3HRD D;  2DYM A;  3W9C B;  2IGH A;  2XN9 C;  1KLG D;  4P16 A;  3Q69 A;  3O13 A;  2W54 A;  2BT6 A;  4OVZ A;  2CJN A;  1TKE A;  2AQ2 B;  3V05 A;  2WP9 B;  1L4Z B;  1SE2 A;  4CQN A;  1V1O A;  1ROE A;  1C9F A;  5LNK 1;  2G1E A;  2KDM A;  2PMV A;  3AED B;  1XXG A;  4HRS A;  3BVG A;  4KGS A;  5AUI A;  3TEY A;  1C79 A;  1JW9 D;  2J53 A;  3AE3 B;  4DQO C;  1RYJ A;  5AUK A;  2CJO A;  1QF6 A;  4MT5 A;  3R2T A;  4B0M A;  2IGG A;  2NMQ A;  1XO3 A;  2QIL A;  2V3N A;  4J3O D;  5EE9 A;  1IBX B;  1RM6 C;  3MC0 B;  4RCO A;  2EKI A;  3U52 E;  4HKZ E;  1ZP0 B;  4NJC A;  2GI9 A;  3IT6 B;  1L0V B;  1EWY C;  1K50 A;  1JML A;  4AS1 A;  3TSS A;  1VJK A;  5FK9 C;  5GXG B;  4TQ0 A;  3KWL A;  3ZJT A;  4LTU A;  2Y3A A;  3BVM A;  2BW2 A;  2FE8 A;  1SSN A;  2WDQ B;  4XWT A;  2W3S A;  3URY A;  4YT0 B;  2E3T A;  2Z8L A;  4GLS C;  2M56 B;  2K9X A;  2PIA A;  1NVI D;  5G5G A;  4JWU C;  3B2G A;  1CK1 A;  1TS5 A;  2VZK D;  1K52 A;  3AE8 B;  4A9A A;  1H7W A;  5HG2 A;  1YQ3 B;  4A90 A;  2BS3 B;  1WXQ A;  5H8Y E;  2J4X A;  4Q2J A;  1PGA A;  5T8I A;  3WCQ A;  4C80 A;  1IBX A;  1NEK B;  1C78 A;  4FXC A;  1PGX A;  2PKO A;  4HJG E;  4IOI E;  4DXG A;  4C7Y A;  5FR3 A;  2VZK B;  2IGD A;  2DBY A;  2RDH A;  1L0Y B;  1EM7 A;  1EWC A;  1BUI C;  3NS1 A;  2WXL A;  1J7B A;  3U7Z A;  4XDD A;  1AWD A;  3VR8 B;  2KWD A;  4N59 A;  2MJE A;  4ITK A;  1QIL A;  1YJJ A;  3U2S C;  2WXF A;  1YJI A;  2JSV X;  1ACC A;  1WSP A;  3VQI A;  1K51 A;  3Q8F A;  3P4P B;  3RPF C;  3MJ5 A;  4N58 A;  1ET6 A;  1EU3 A;  3HUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...