3VRAB

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
total genus 50
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vraB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vraB01
1NI3A 2WP9B 3AE1B 2WDQB 1JWAD 1TYGB 2LEKA 3CF4A 1JRPA 2Q5WD 4KX6B 1FIQA 2N0SB 2FBWB 1QOGA 4N58A 2Y5CA 4YSZB 1RYJA 1GTHA 1RWSA 1WYGA 3DWGC 1WXQA 1QOBA 3NVVA 3AE5B 4FXCA 3AE6B 1XLQA 3VRAB 1J7CA 1VJKA 1B9RA 5C2TB 2WDVB 1KF6B 4A9AA 5G5HA 1L6UA 1H7WA 1TKGA 5EE0A 3AECB 1ZXIA 5AUIA 1DOXA 2AX5A 1DGJA 2QIEB 4YXDB 1SIJA 1JQ4A 2W55A 3FC4A 1GAQB 4YTNB 1J7BA 1FXIA 2M19A 2E3TA 2BS4B 3DWMA 1NENB 1ROEA 3AE8B 2QJLA 4YT0B 1FM0D 2W54A 3PO0A 1E0ZA 4USAA 1PUTA 1N60A 1J7AA 1QF6A 1FXAA 1WRIA 3NVWA 1TJEA 4JWUC 1L0VB 1E6EB 3AEFB 5EE1A 3P4RB 3W5VB 5GXGB 1DOYA 1ZP0B 3B9JA 2MH7A 3ABVB 3B2GA 1IUEA 1GT8A 1RM6C 3AV8A 1N62A 1KFYB 2B76B 3SFEB 1FRRA 1KRHA 2PIAA 3FAHA 3HRDD 3AEBB 4ZOHC 3AH7A 3VR9B 3AEAB 3AM9A 3AE9B 3P4QB 1N5WA 1WWTA 2CJNA 1FFUA 2MJDA 1L5PA 3AE3B 1T3QA 2W3SA 1TKEA 1FMAD 3HVZA 2L83A 4C7ZA 2L52A 2OHFA 3NVYA 3AEEB 2K5PA 2DBYA 1QLBB 3LB8C 3EUB2 1H7XA 1EWYC 1YJJA 5AUKA 3P63A 1QOFA 1CZPA 2HTME 3AEGB 3NS1A 3W9CB 2WU2B 1I7HA 4LTUA 1XLPA 1OFFA 1R7SA 2EKIA 1ZOYB 2JQRB 1DOIA 1VLBA 1XLNA 2WDRB 2MJEA 4HROA 4HRSA 1E7PB 3NVZA 1YJIA 3ETRA 4IDIA 2CJOA 1SB3C 1GPXA 1XO3A 2WLBA 5EE9A 4JWSC 1NEKB 1NYQA 4ITKA 4ZHPA 1VDVA 3KWLA 3P4PB 3AEDB 4C80A 1CJEA 4YTMB 1TKYA 2CU3A 2K22A 4P6VF 3SR6A 3CWIA 5H92C 1QT9A 4JX1C 1N63A 5C3JB 2KMMA 3LXFA 2H88B 2K9XA 3AE2B 2ACZB 1JROA 2WS3B 3ZYYX 1JWBD 1F0ZA 2BS2B 1PDXA 3AE4B 1OQRA 2PVOD 3VRBB 2G1EA 3L4PA 5MPOA 4YSXB 1RFKA 1XLOA 2PKOA 5G5GA 1V97A 3B2FA 4YTPB 2WU5B 1FFVA 1AYFA 1N61A 5H8YE 4WWMA 2H89B 2MJ3A 1GTEA 4N6EB 2JX5A 1E9MA 1SF0A 2BS3B 1JALA 3RPFC 3W5UB 3P1MA 3SFDB 4C7YA 1L6VA 2M56B 3AMZA 1ZUD2 2PVGC 5EE3A 3VR8B 1PFDA 1QOAA 1YQ4B 1V8CA 2DWQA 1WGKA 3P4SB 4US9A 1FO4A 1YQ3B 1NVID 2W3RA 2BT6A 1UWMA 3HUIA 4US8A 1AWDA 4N59A 1FRDA 3AB5A 1N5XA 4ZHOA 1E10A 2KAJA 3AN1A 3NRZA 1NYRA 3CIRB 1JW9D 3BIID 3WCQA 4YSYB 4WQMA 2WQYB 1OQQA 3AE7B 1A70A
chains in the Genus database with same CATH superfamily
2JF5A 2LHEA 4HVBA 4M01A 1XXGA 3VTWA 2RDBC 4LJPB 3DWGC 4NJ6A 3AE6B 2IGGA 4AP4C 1VJKA 4P7IA 2ZPNA 2Z59B 4YL8A 2CR5A 1H7WA 3VTVA 1A5RA 1CMXB 3P63A 2OJWA 2Y5PA 4TKNA 4XYCA 2KC1A 2DENB 2W54A 2WWZA 1T5XD 2WYQA 1T0QC 3RNCC 2KN5A 3HVDA 3KVFB 1YIWA 4CHKA 1QILA 3P4RB 2LGYA 3N9YC 2MBOA 4MEMA 2EELA 3ZRFA 4IWPA 2JZZA 1L0YB 4GU2A 4MJSB 2LGXA 3U4EG 1HA5A 1T3QA 3KLSX 2IO3B 3NVYA 3ZXRA 5D6JB 3RNEC 2BF8B 1VCBA 4AWJA 2AQ3B 1I7HA 4AJYB 2MLBA 4BKGA 3ETRA 4HKZE 4K3BA 2LUMA 3PS6A 2NPTB 4ITKA 1MHHE 1YOVB 3SR6A 2BYVE 3TCAA 3Q3OC 3MHZA 3B08A 2K9XA 3T9LA 1V5TA 1F2RC 3RULA 3MC9A 2HD5B 2WU5B 3ZQ4A 2RDHA 4WH4A 1SF0A 2BS3B 3PRPB 4BVUC 1PFDA 3WANA 4GMVA 2BT6A 5J17A 1LFDA 1I4PA 3A9KA 4JPSA 2QMTA 1AN8A 2PEAA 2KANA 2RPVA 3KQ4A 4FN2A 3RNFC 2RGFA 1WXAA 3OWEB 3H1UA 5C23A 2SAKA 1ZKHA 3QJZA 3JSVB 5LXHA 2INPE 2XNAC 2JRHA 5HFYA 2BBCA 4KKIA 2KN4A 4ICVA 3OLMD 4WQOB 3IXSA 1PGAA 4LNIA 1WRDB 2R61A 1WY8A 1I42A 1HZ6A 2Z0DB 2GI9A 3DHIC 4KIKB 3L13A 4KDIC 1YD8U 3R7QA 4M0WA 3I57A 4ACFA 1IUEA 2B3AA 4OW0A 2CU1A 2FCQA 1TS4A 4ICUA 2DBYA 2MHJA 3A1QB 2LMCA 4EOYA 2JSVX 1S3SG 4DXGA 4W9CA 4EZKA 4OZBA 1QQRA 4DDID 2KYWA 4KGRA 3SDLC 4GSWA 1LGRA 2H88B 1GG3A 3H7PB 2G4SA 1OQRA 2O2VA 4PYUA 3RYTA 3RFZB 4G0NB 2G9HD 3AMZA 3VR8B 2WX1A 3A4RA 1FO4A 2FUG1 4A55A 3BZDB 2EMTA 3Q3MC 2N9EB 1SJED 2HJ1A 1VD2A 1OGWA 5D3IB 4W9LA 3AE7B 4NQKE 1MVKA 2MSED 5BYQA 2PJHA 3HM6X 1GTHA 2N4FA 3IHPC 3HK0A 4GB9A 1WR1A 2IGDA 2J7QB 2KFKB 4FHKA 2DYMA 2IY0B 4L23A 4YXDB 3FC4A 3BWUD 4IDIA 4RM9A 3FILB 4DK5A 5IP4D 4CYEA 1Z2MA 2DNFA 2C60A 3DHHC 2I2YA 3TUOA 1K50A 5IKCM 5BYRA 1DOYA 2LGSA 5D94A 1UGJA 2MWSB 3AEBB 3IG3A 3UF8A 1UBQA 3M95A 2K39A 2V4LA 3VHTC 3PRMB 4EFOA 3EUB2 2V3NA 3NOBA 4HLEA 2NBWB 4MM3A 2DZMA 4A3PA 2K3UA 1XLNA 2MJEA 2ZCBA 1V6EA 3Q8EA 3RZWC 3GZNI 3IAS1 1R4MB 2BYFA 1F0ZA 2RPQA 3L4PA 4YSXB 1OQYA 4XX5A 1GTEA 1LXDA 2KOXA 1AARA 1HXYD 3H9DA 2XK5B 3EHVA 3PLVA 1YQBA 3AXCA 3HUIA 3ZO5B 2C7MB 5J18A 4MSMB 1MPEA 1EWCA 2W9NA 3R2TA 3KH0A 2M17A 1XCTL 1AW7A 2KTRB 2K8HA 4WJPA 2WXQA 3U52E 3Q8CA 5EE0A 1ENFA 1SIFA 2NTSA 2BS4B 3K9OB 4HPPA 2N9KA 2ZEQA 1PUTA 1N60A 2KDFB 2L8JA 3APCA 2NVUI 2ZJDA 3NUHB 4HJGE 3MTNB 5DPTA 1R4NI 1IGDA 2NPTA 1SEBD 3AH7A 3C0RB 3AM9A 3QIJA 4B0EA 1OEYA 4W9FA 4NJCA 4XWWA 5TSSA 1F77A 5BO4B 2LXCA 2L0FA 4KGTA 2JQRB 4GXBA 2KK8A 4LNNA 3ML9A 1FEHA 5JXVA 4TV3A 1IGCA 5JHBA 5EE9A 3ZUNA 2MBQA 1WGYA 4ARCA 2NCNA 2RD0A 2J4XA 5C3JB 3Q8BA 4DHZB 2BS2B 2CHZA 2G1EA 3QAQA 1JWSD 4NAMA 2H89B 2D11A 3P1MA 1FNVA 4JE3B 1UZXB 2WXKA 4RF1A 1V8CA 1YQ4B 3ZJTA 3N1XC 1RLFA 1HE8A 4US8A 3JW0X 3ZVVA 1Q1OA 1CQVA 4LDTD 1GUAB 1JW9D 4FJZA 1IBXB 3U7ZA 1TYGB 1M4VA 1WJUA 3PZ8A 1V1OA 3DBRI 2HDEA 1QOBA 3AE5B 4KIKA 2LGIA 2E6XA 2KLCA 5G5HA 2CKHB 1L6UA 4TMAB 3N1ZC 2W55A 4JWSC 2LGDA 1ROEA 4URKA 4L2YA 3TMPB 5KHQA 4J3OD 1JRUA 3A1QA 1J7AA 1DYQA 4W9HA 1WGGA 2N9XA 3KUDB 3W1SC 3ZKJC 3EECA 4BOSC 5IA7A 4P1BC 2GLSA 4MELA 3NVWA 3DQVA 4I6PA 2CS4A 3EA6A 2C5LC 1ZP0B 2WXIA 2C7NB 1I4XA 2XBBC 1HQRD 4KZCA 2RMMA 1FRRA 3U8ZA 3WAOA 4KVGB 1GB1A 3P4QB 3UIPB 3IAM1 4AJWA 1GJZA 2IGHA 2J0KA 3WA0A 1V5OA 1YJJA 3AEGB 3T8MA 4PS3A 2BWFA 2LZ6A 1JMLA 1K51A 3TBLD 1OFFA 1ZOYB 3IBEA 4WJQA 2N1VA 2JY6A 2ZZPB 4ZRPA 4BZAA 2WLBA 5BYSA 1F2RI 1NEKB 3KWLA 2WNMA 4EZJA 5JH5C 1WM2A 1CJEA 4JGHB 1D6EC 4TQ0A 5CHWA 1T0YA 2ACZB 2FCMA 4TUUA 1TTNA 5MPOA 5HI1A 4B6WA 4GDLB 5EDSA 1F9JA 3GB1A 2KDEB 2KVZA 3DVGX 1STEA 2LVOA 4X57B 3BYYB 2REXA 4K3CA 1QOAA 2JYTA 2KFKA 4A8XC 1UWMA 4R3DA 4KDLB 1AWDA 1IP9A 3L16A 1KLUD 1E10A 2KXJA 2HTHA 3M63B 1ESFA 3DBLI 5FR6A 4YSYB 4N9F4 2PW9A 2KJ6A 5G55A 3V6CB 1JWAD 4ZDVA 3ENEA 1BMLC 3Q3NC 2LJ5A 2Q5WD 3AULA 3RNAC 1G6JA 4N58A 2FBWB 3PT2B 3SD5A 1RWSA 2A4ZA 1TZ1A 3NZUA 3ONSA 4KSLC 5CTRC 1K53A 2GBKA 4EKUA 2O6VD 4RH6A 1WJ6A 2MA9B 4OZAA 2FIDA 3MP9A 1J7BA 2J0JA 4JIOU 5CHFA 3VTUA 1FM0D 1HTOA 2IPKD 2EKEC 4IWOA 1TS3A 1ZGUB 1EU3A 2XN9C 3VFKA 4JWUC 3RNBC 5LNK1 4MACA 2PLPA 3W5VB 2KJRA 2NTTA 1KFYB 3BYTB 4BAXA 1N5WA 3IVFA 1L5PA 1ZDXA 4OZCA 1C76A 1YJ1A 2L52A 3R8BA 2OOBB 2FCSA 4LNFA 1H7XA 1JWUD 2LI5A 4NAWB 4EUTA 3NS1A 1BT0A 2YLMA 3M62B 2GBJA 1WZ0A 1UNSA 1GPXA 1WH3A 2N7JA 1V80A 2D3BA 4A3OA 1TKYA 3PVLA 4HWIB 2GBNA 5H92C 1TS5A 1UGMA 3N1YC 2L76A 4ZYNA 3W1SA 1JWBD 3AE4B 4K7WA 1E9MA 2JWZA 1JALA 4C4VB 3CSFA 3Q8FA 2MW5A 2KTRA 2M56B 1ET9A 3H6NA 1MFWA 2DWQA 2SEBD 1NVID 4BFRA 1MI0A 2JXTA 2CHWA 4UDUC 3ZJVA 3GOEA 2KAJA 3NRZA 1TGZB 4HEA1 1WGDA 1PYWD 2QEJC 2WXMA 3PZ7A 4NPNA 3VQIA 2MBBB 1B9RA 1D5XC 3PHXB 2G3QB 4GN1A 4A9AA 1NI2A 3GP7A 3ZDMC 2OJRA 1KM7A 2INNE 1EF5A 1FXIA 2QJLA 4YT0B 4WAAA 1EUVB 3PO0A 3N20C 4K81A 3UQAA 2JPHA 2WX0A 4DHJB 4RGNA 2NBUA 1WJNA 1XCQL 3DDCB 4B9KA 2WDTB 3B9JA 4MGYE 4ANVA 3Q3FA 3BVGA 5HKHA 3EGRA 4DXFA 2KFJA 3AE9B 1XD3B 1WWTA 4WWNA 2W3SA 3N32A 1FMAD 2Y3AA 2LFIA 4IM3A 4A20A 3K9PB 2FNJB 4ANUA 3UGBB 2WHIA 1MJDA 3MC0B 3NVZA 1YJIA 1IYFA 2VH2A 5D3DA 3AEDB 2MP2B 4I6NB 2PMVA 3IT4B 3CWIA 3TSSA 3AE2B 1SXTA 2K6DB 2PKOA 2M0XA 3L10B 4C7YA 3SU8X 4ANXA 5DPWA 4RCOA 2QDFA 5HHDG 1YX6B 2DZKA 1J8CA 3NHEB 1XF5L 3GE8C 4DHJD 2I1KA 3MHSD 1MG8A 3OG5A 2WDQB 3NY5A 4GDKB 1TBEA 3IT6B 4D2KA 1WXSA 4ZRJA 5C2TB 3BVZA 2N9PC 2PPHA 4RFBA 3GE3C 1OEYJ 2XEWA 1ZXIA 2AX5A 1C78A 5D7GA 4BKSA 5AZFA 3QC8B 2JYEA 1P7EA 4MH0E 3HIZA 1P0RA 1QZEA 4RNAA 3ALBA 1OTRB 3L08A 2KLGA 2PE9A 4WJOA 1P98A 1GT8A 2ZNVB 4GLSC 3HRDD 2BKRB 3TEXA 1FNWA 4DBGA 4E71A 4DQOC 1E5WA 3Q2AC 2OHFA 3AEEB 2YVCA 2WXLA 3NZ3A 4W9IA 4GOCA 3M3JA 5IN7A 2WU2B 2K8BA 4GDLA 1RAXA 2Z8LA 1YMHE 4FADA 4HRSA 2KMCA 2ICIA 1KTKA 4YTMB 4JX1C 2A5UA 3CSTA 3LXFA 4RMAA 3PZDA 2Y5BB 1NBFC 4NNJB 1WM3A 1D5ZC 4HXDA 3E56A 4FLHA 2J42A 3FKYA 1I4RA 2QSDA 4AUQC 1R4MI 1Z5SB 2MCNB 2DZIA 1QKZA 3AN1A 2KDBA 2IO1B 2JWUA 1L4ZB 2I1JA 4S17A 2YEPF 2M8SA 2RSUA 2BYEA 2N0SB 2WXRA 4REZA 5GMVA 2MBEA 2D3CA 3ZJUA 3GZNB 3I9V1 3VUYA 3V3XA 3TEYA 1SIJA 1JQ4A 1UELA 1GAQB 4YTNB 2HJ8A 4XDDA 1E0ZA 4NAWA 2JVCA 4EE2A 1SJHD 1E6EB 5EE1A 1Y8RC 3PGEA 1WXVA 5BMIA 4JL9A 1SE3A 1ET6A 1RM6C 3SFEB 4JLCA 4EZLA 3OJ3A 4MJSA 2CHXA 1WJ4A 5IAAC 2FUHB 1E8XA 2KD0A 1E90A 5KHOA 1EWYC 3EC8A 4OVVA 5E6PA 3W9CB 1K52A 4LDTB 2N9LA 3P2BA 3HM3A 4C4VA 2J52A 4IC7B 1WR6E 1WYWB 2CJOA 2MRPA 1PGXA 3ZNHB 2AWTA 4LJOB 4PT5A 3P4PB 2GBRA 4P6VF 4OHJA 1N63A 3GS2A 2KMMA 1JROA 1T0RC 2WXPA 2L00B 4Q2JA 2WXFA 3DVNU 1HEZE 4YTPB 1FFVA 2J53A 1N61A 1J0GA 4HKQA 3RPFC 2AL3A 2BW2A 3QHTA 4PYZA 1P9DU 2ZW1A 4II2B 4ZYSA 5BMGA 3X0WA 1KLGD 4W9GA 4MDKE 3ZRCA 4FA6A 4XE0A 4HPMB 1SE4A 1OQQA 3CF6E 3Q14C 5DCNA 2KACA 1E8YA 2J0MA 3PPAA 4YSZB 4KGSA 1T0SC 2DYOA 2N1WA 1XLQA 2FIFA 5I4DA 4M8MA 2K6QA 2K1FA 3V60A 3JSVA 5AZHA 4IWQA 3V62A 1E7VA 4FHJA 3A9JB 1DGJA 5CHVC 3EFUA 1V2YA 2IO2B 2D10A 2K8CA 1WXMA 3LDZE 1C4CA 4W9JA 4MGIE 1KJTA 1WSPA 3B0AA 1PQSA 1TIFA 2KWCA 2VZKD 4WIPA 3ZDTA 2MH7A 3ABVB 4XZ4A 1PGBA 3FAHA 4WWOA 3UI3A 3JVZX 4ZOHC 3AEAB 2DZJA 3DBHI 3T3OA 3AE3B 3R7RA 1FD6A 4QAYA 3HVZA 1EM7A 2HTME 4KZ0A 5L95C 1XLPA 4WAFA 3DBRB 1FPYA 3X23A 3I63C 1E7PB 3V61A 3N30A 3DVGY 3PTFC 1NYQA 3S2AA 2DHZA 3U2SC 1CK1A 2ZPYA 2HE7A 3WAPA 5FK9C 3VXWA 2O6VB 1PDXA 3L54A 1ZXHA 3H7PA 1VZ6A 1XLOA 4PS8A 1V86A 3B1LX 4GDKA 2KVRA 1SBBB 1BUIC 4MT5A 4FULA 2RDGA 1ZUD2 2PVGC 2WXGA 3VUWA 1P7FA 2DX5B 1I35A 3DCGA 1KH0A 1YQ3B 2KWUB 3KYCD 2INCC 2YEPB 2ZVOA 3AB5A 2KDMA 4DXAB 3CIRB 1A70A 3UINB 3Q3JA 3AE1B 3TL5A 3PSEB 4W9DA 3VUXA 2RR9A 5E6OA 1WE7A 5FKAC 2KQ7A 3RN9C 2ZW0A 2KC2A 4CQNA 2M4NA 1J19A 2ONQA 1KF6B 5D2MB 2AEHA 2GMIC 3ZNGC 4RGTA 1P3QU 5AUIA 2KT7A 3A4SC 4G3XB 1NENB 2UYZB 3AU4A 1L7YA 3FILA 1FXAA 1P1AA 1V9JA 2ON8A 3E9SA 1L0VB 3AEFB 1C4PA 2C7HA 2BPSA 1UF0A 3B2GA 3BVMA 3W1YA 1VRAB 3KYDD 1TKEA 4AOFA 3ZTCA 4HCNB 1QLBB 4HDQA 1QOFA 5AEKB 4ZRQA 2L1AA 1DOIA 4I6LB 4HROA 1WFYA 2BWES 1TS2A 1SB3C 1EO6A 4C56C 3VH4B 3MC8A 2GB1A 2LWPA 4BBNF 2V3SA 1YX5B 3QK0A 3T3NA 3MJWA 2IY1B 1WX9A 3N3KB 3VRBB 1YN4A 2D5GA 5G5GA 2L3ZA 1ISNA 1ZE3D 4WWMA 2N7DA 4KKJA 4N6EB 3W5UB 3SFDB 4FBJB 1Y56A 1WGHA 3AU5A 4BOZB 3P4SB 1YNTE 3ECIA 2XK5A 4IM2A 5LXIB 2LVQA 1C4AA 2L32A 1WX8A 2JUOA 4LK0M 2KQSA 4P16A 2WXNA 3ZTDA 3CF4A 4K7UA 3LJ3A 4LNOA 2K0PA 3D32A 3NZSA 3JYUA 4OVUA 3RI7C 5L83A 2BYTA 2NR2A 3AECB 4E3CA 1DOXA 3L17A 4LNKA 3TIXA 3DWMA 2M19A 4HCPB 1FCLA 1D3ZA 4OVZA 1VR9A 1VZ7A 4DHZE 4IW0A 4HPLB 4IOIE 4IKGA 2LD9A 2VRRB 1H4RA 2TSSA 3UIOB 2WXJA 1XEEA 1WF9A 2KDIA 4DWFA 4WWPA 4F7ZA 5FR3A 1FFUA 4WURA 3Q69A 1WMHB 2K5PA 5C1ZA 4PS7A 1XT9B 2EMSA 4XGAB 1HZ5A 3VDZA 4NZLB 3SEBA 1WIAA 2V3PA 4G11A 1I4HA 2LHDA 3ZNZB 1SE2A 2KJHB 4M8NA 2BQQA 2NS5A 3DVNV 1VDVA 4RGOS 3PREA 4C80A 3R66C 3SHQA 4FJVB 4ZRIA 1C1YB 4JQWC 4ARIA 2MBHA 1E7UA 4GIVA 5LLIA 1L4DB 2GOWA 1V81A 2BGFA 1WGKA 4US9A 4E74A 2DYBA 1TY2A 5G2NA 2X38A 1LM8B 3A9JA 1GNUA 5HG2A 3VAWA 1NYRA 3U30A 1U4AA 4WQMA 5CX3A 2KMAA 4RGMA 4KV2A 2R2OA 1IBXA 2KNBA 1Q10A 4CO7A 2LEKA 4KX6B 1QOGA 3VVWB 1RYJA 4BKTA 2QILA 2WXOA 3QQ8B 2BB6A 2BB5A 1E8ZA 4P1CC 4USAA 3TJPA 2KWDA 2AQ2B 1I4QA 1WZ3A 3QCAA 1ZPSA 2PTLA 4W9KA 4XDCA 2B76B 3DOWA 3QX1A 4A90A 1LQBA 4PK1A 3OAWA 5TR5A 3BINA 3LYYA 4XWTA 5JHAA 4MGZE 2O6VA 1V1PB 5AUKA 2LASA 4MSQB 1L0XB 2KO3A 5E6JA 2LUEA 4LTUA 1D4BA 2MEKA 3RD2A 2WGSA 1R7SA 3H8HA 1VLBA 4FJYA 3ZNID 4NQLB 1XO3A 2ZCCA 2DLBA 4YWGG 2V1YA 2UU7A 2AYOB 3I3TB 1GC7A 2WS3B 2JZ3B 1JCKB 3BK2A 4WJNA 4W9EA 4NJ7A 1V97A 1AYFA 2M1MA 2LVPA 2LXAA 4LLGM 5BMHA 3RCZA 2DAFA 1SE9A 2FCNA 4AS1A 1SSNA 3KUCB 2R2QA 1NI3A 2K25A 2WP9B 4IM0A 4M00A 2FE8A 3MJ5A 2WXHA 3VRAB 3RMKC 4TQ1A 3V6EB 4NY0A 2WDVB 2IYDB 2QC8A 3ZXVA 2V0GA 2QIEB 2E3TA 1Q0WB 1QF6A 3WIMA 4G50A 3V05A 1RFAA 1MG4A 4A6QA 2IJ0A 2MQJA 2INDC 2VH1A 4MGKE 3URYA 2CJNA 1X1MA 2MJDA 2L83A 4DDGD 3BK1A 3W2DA 3IFWB 2BTEA 2D07B 4IG7B 1C79A 4ANWA 3BY4B 2WDRB 1UUPA 1WGRA 4B95A 4F8CB 1HTQA 1ZDVA 5E6NA 1GOZA 1K8RB 2AL6A 2KWVB 2CU3A 1NDDA 3OJ4B 1QT9A 3U7DA 1F1HA 4KSKC 3APFA 2KX0A 3A33B 3B2FA 1S1QB 2KHWB 2MJ3A 3EFCA 4BBNC 5EE3A 4J6IA 2W3RA 2PE6B 4IUMB 2VZKB 5DPSA 1SGHA 1N5XA 2ZNVC 5IO9A 3NJTA 3WCQA 2JRIB 2GBMA 3DHGC 2L0TA 3ZIMA 1UWXA 2LRUA 2KKCA 2Y5CA 2W82A 1IPGA 2KQ4X 3TEWA 4FXCA 3L0WB 2JU6X 1RRBA 1R4NB 1WE6A 2OEDA 3A9KB 4EEWA 3PV1A 1EF1A 3ZLZA 2AQ1B 3AE8B 1WMHA 3APDA 3O13A 1GB4A 1XQQA 2D3AA 3Q6BA 3R3MA 4M02A 3ML8A 3ZW3A 1E8WA 1WRIA 2I38A 1VZ8A 5T8IA 5GXGB 3UQBA 2G4DB 3RT3B 1V49A 1TZOA 3R2IA 1N62A 1KRHA 3KW5B 2L05A 1MHXA 3MFGA 4RM8A 3VR9B 2V9HA 4K1RB 1D5MC 1YN5A 1L2NA 1KLVA 5DPRA 3RZFA 4C7ZA 1JWMD 1B1ZA 1CZPA 3WAMA 1UH6A 3HHMA 2EKIA 1FCCC 2JT4B 2V4IB 2G45B 2FAZA 2JZPA 4M0WB 1H8CA 2ZVNA 1EU4A 3P42A 3Q8AA 2IZVB 4ZHPA 1C77A 2LJIA 5AZGA 2MP2A 2K22A 3NS8A 3O65B 5J2RA 2JXXA 3AI5A 3TEZA 4O1NA 4S0RA 2DAJA 5H8YE 2N7EA 4II3B 4HDOA 3QARA 1C3TA 1L6VA 4ZRKA 2NBVB 4HJKA 1F52A 1LO5D 2GRIA 4XC2A 3J9CA 1WI0A 4N59A 3RNGC 4ZHOA 3C8YA 4TSSA 3BIID 3DBHB 1KOTA 4F1SA 1ZW7A 2O2VB 1Q5WB 1JRPA 3NG0A 4AQ7A 3CMMB 4RF0A 1FIQA 2KZRA 3PHWB 3NVVA 1WXQA 3KUZA 2IDYA 1J7CA 2D2QA 1TT5B 4LCDE 2NMQA 2KTFA 3VH3B 1TKGA 2D3GA 2BKFA 2Z0EB 2IO0B 3C19A 2ASQA 2C9WB 1UD7A 1N6ZA 1V1PA 4C00A 1TJEA 3WALA 3KWVA 3DPDA 3AV8A 2PIAA 4L1BA 2L7RA 2M0AA 1ACCA 5IOIA 2MX2A 4HK2A 4H2AA 1T6BX 1I4GA 3QWZB 3LB8C 1FXTB 2IBIB 4ASWC 2X8XX 3DBSA 1TY0A 2LRWA 4GGQA 1M94A 2KX3A 1GC6A 3I5JC 2UWQA 3ZGZA 1C9FA 1BXTA 4B0MA 2QHOA 3RUIB 3QA8A 3ZYYX 2PVOD 3DBLB 1UBIA 3PLUA 4MH8A 1RFKA 4MM3B 1FNUA 1YN3A 3H7SA 2JX5A 4BKSD 3PRZA 2QCZA 1WX7A 4K7SA 1FRDA 5JZEB 2BVCA 2WQYB 1WYGA
chains in the Genus database with same CATH topology
1IBXA 1L4ZB 1Q10A 3U7ZA 1TYGB 1M4VA 2LEKA 2YEPF 2LHEA 1V1OA 3PZ8A 4KX6B 1XXGA 2N0SB 1QOGA 2HDEA 2WXRA 1RYJA 3DWGC 1QOBA 3AE5B 3AE6B 2LGIA 2IGGA 4REZA 1VJKA 2E6XA 3ZJUA 2QILA 5G5HA 1L6UA 1H7WA 3I9V1 2WXOA 3V3XA 2BB6A 4TMAB 1SIJA 3TEYA 1JQ4A 2W55A 2BB5A 1GAQB 4YTNB 3P63A 4JWSC 2Y5PA 1ROEA 4XDDA 4L2YA 2W54A 4J3OD 1E0ZA 1T5XD 4USAA 1J7AA 1DYQA 4EE2A 2KWDA 2AQ2B 3HVDA 1SJHD 1QILA 1I4QA 3NVWA 1E6EB 5EE1A 3P4RB 3EA6A 5BMIA 3N9YC 1ZP0B 1SE3A 1ET6A 1ZPSA 2EELA 2WXIA 2PTLA 1I4XA 1HQRD 1RM6C 2RMMA 4XDCA 2B76B 3SFEB 1FRRA 1L0YB 4A90A 1GB1A 3P4QB 3IAM1 3U4EG 1HA5A 1T3QA 2IGHA 3KLSX 3LYYA 4XWTA 3NVYA 1EWYC 1V1PB 1YJJA 5AUKA 1L0XB 3AEGB 3W9CB 5E6JA 2AQ3B 1I7HA 1K52A 1JMLA 4LTUA 2N9LA 1D4BA 1K51A 2MEKA 1OFFA 1R7SA 1ZOYB 3H8HA 1VLBA 2J52A 3ETRA 2CJOA 4HKZE 4ZRPA 2LUMA 1XO3A 1PGXA 2WLBA 2DLBA 1F2RI 5BYSA 1NEKB 4ITKA 1MHHE 4PT5A 3KWLA 2WNMA 3P4PB 1CJEA 4YWGG 3SR6A 4P6VF 4OHJA 3MHZA 1D6EC 4TQ0A 1N63A 3GS2A 2KMMA 2K9XA 2ACZB 1F2RC 2WS3B 1JROA 1JCKB 3BK2A 2WXPA 4Q2JA 5MPOA 2WXFA 5HI1A 1V97A 1HEZE 4YTPB 2WU5B 1FFVA 2J53A 4GDLB 1AYFA 1N61A 2RDHA 3GB1A 4WH4A 3ZQ4A 4HKQA 1SF0A 2BS3B 3RPFC 1STEA 3BYYB 2BW2A 1PFDA 1QOAA 2JYTA 4LLGM 4A8XC 2BT6A 1UWMA 2ZW1A 4R3DA 4ZYSA 5BMHA 1I4PA 5BMGA 1AWDA 4JPSA 1KLGD 1KLUD 1E10A 4AS1A 4XE0A 2QMTA 1ESFA 1SE4A 4YSYB 1SSNA 1OQQA 1AN8A 2PW9A 1NI3A 2WP9B 2RPVA 3KQ4A 1JWAD 1BMLC 2Q5WD 2KACA 4N58A 2FBWB 4YSZB 4KGSA 1RWSA 2FE8A 3OWEB 2DYOA 3MJ5A 2WXHA 1XLQA 3VRAB 2SAKA 5I4DA 4TQ1A 2WDVB 2INPE 1K53A 2XNAC 2V0GA 4RH6A 5HFYA 4OZAA 3MP9A 1DGJA 2QIEB 2BBCA 4KKIA 2E3TA 1J7BA 2KN4A 1FM0D 3IXSA 1C4CA 2IPKD 1PGAA 1QF6A 1WSPA 1TS3A 1EU3A 2XN9C 3V05A 2R61A 1HZ6A 4JWUC 5LNK1 2GI9A 4MACA 2PLPA 2VZKD 3W5VB 4WIPA 4A6QA 2IJ0A 2MH7A 3ABVB 2NTTA 1PGBA 3I57A 1IUEA 4M0WA 1KFYB 3FAHA 3BYTB 4OW0A 3UI3A 4ZOHC 3AEAB 1N5WA 3URYA 2CJNA 2MJDA 1L5PA 3T3OA 3AE3B 1FD6A 1ZDXA 3HVZA 2L83A 1EM7A 1C76A 1TS4A 2L52A 3BK1A 4OZCA 3R8BA 2DBYA 3W2DA 1H7XA 1JWUD 4NAWB 2HTME 3NS1A 2LMCA 2BTEA 1XLPA 1C79A 4WAFA 2JSVX 2WDRB 1E7PB 1UUPA 4DXGA 1UNSA 4OZBA 1GPXA 1QQRA 1ZDVA 1NYQA 1GOZA 2N7JA 3U2SC 1CK1A 4KGRA 1TKYA 2CU3A 5H92C 1QT9A 1TS5A 5FK9C 2H88B 3W1SA 1JWBD 1PDXA 3AE4B 1OQRA 1ZXHA 1VZ6A 1XLOA 3B2FA 2MJ3A 1E9MA 1SBBB 1JALA 1BUIC 4MT5A 3Q8FA 3RFZB 2G9HD 2M56B 3AMZA 1ET9A 1ZUD2 2PVGC 2RDGA 3VR8B 1P7FA 2WXGA 5EE3A 2DWQA 1KH0A 2SEBD 1FO4A 1YQ3B 1NVID 2FUG1 2W3RA 4A55A 3BZDB 1MI0A 2JXTA 2YEPB 2VZKB 3AB5A 1N5XA 4UDUC 3ZJVA 2KDMA 2KAJA 1SJED 3NRZA 3CIRB 3WCQA 5D3IB 3AE7B 1A70A 4HEA1 3AE1B 1PYWD 1MVKA 1UWXA 5FKAC 5BYQA 2Y5CA 2W82A 3TEWA 2KQ4X 2ZW0A 1GTHA 2QEJC 2WXMA 3PZ7A 4FXCA 4CQNA 3VQIA 2IGDA 2JU6X 2ONQA 1B9RA 1D5XC 4A9AA 1KF6B 2DYMA 3GP7A 4RGTA 2OEDA 4L23A 5AUIA 4YXDB 2INNE 3FC4A 2AQ1B 3BWUD 4IDIA 1FXIA 1NENB 3AE8B 2QJLA 3FILB 4YT0B 3FILA 3O13A 3PO0A 1GB4A 2I2YA 1FXAA 1WRIA 2I38A 4RGNA 3TUOA 2ON8A 1XCQL 1VZ8A 3E9SA 1L0VB 1K50A 3AEFB 5T8IA 4RGMA 5GXGB 5BYRA 1C4PA 1DOYA 3B9JA 1TZOA 3B2GA 3R2IA 3BVMA 1N62A 1KRHA 3BVGA 1UGJA 1MHXA 3EGRA 4DXFA 3AEBB 3MFGA 3VR9B 3AE9B 1VRAB 1WWTA 1D5MC 1YN5A 2W3SA 1TKEA 1FMAD 2Y3AA 4C7ZA 2LFIA 1QLBB 3EUB2 1JWMD 1B1ZA 1QOFA 1CZPA 2V3NA 4ZRQA 2EKIA 2K3UA 2L1AA 1DOIA 1XLNA 1FCCC 4HROA 2MJEA 3MC0B 2V4IB 1YJIA 3NVZA 2JZPA 1TS2A 1SB3C 3Q8EA 1EU4A 3P42A 3Q8AA 5D3DA 4C56C 4ZHPA 2GB1A 1C77A 2LJIA 3AEDB 3IAS1 2PMVA 3IT4B 2K22A 3CWIA 3TSSA 3AE2B 1F0ZA 3T3NA 1SXTA 3TEZA 3VRBB 3L4PA 4YSXB 2PKOA 1YN4A 2D5GA 5G5GA 4O1NA 5H8YE 1ZE3D 4WWMA 1GTEA 4KKJA 4N6EB 3W5UB 4C7YA 3SFDB 1L6VA 1Y56A 1HXYD 4RCOA 3P4SB 1YNTE 2GRIA 1LO5D 3HUIA 5HHDG 3J9CA 4N59A 1C4AA 2L32A 4ZHOA 1MPEA 1EWCA 3C8YA 4TSSA 1XF5L 4LK0M 3BIID 4P16A 2WXNA 3R2TA 2WDQB 3CF4A 1JRPA 4AQ7A 4RF0A 1FIQA 1XCTL 4GDKB 3NVVA 2K0PA 1AW7A 1WXQA 2IDYA 1J7CA 3IT6B 4D2KA 5C2TB 2WXQA 3BVZA 2NMQA 3U52E 2BYTA 4RFBA 3Q8CA 1TKGA 5EE0A 3AECB 1ENFA 1ZXIA 1DOXA 2AX5A 1C78A 5D7GA 2NTSA 2M19A 3DWMA 2BS4B 1FCLA 2JYEA 2N9KA 4OVZA 1P7EA 1VR9A 1VZ7A 1V1PA 1PUTA 1N60A 4IOIE 4RNAA 4IKGA 1TJEA 3NUHB 4HJGE 2TSSA 3KWVA 2WXJA 1GT8A 3AV8A 4GLSC 3HRDD 2PIAA 1XEEA 1IGDA 4L1BA 1SEBD 3TEXA 3AH7A 3AM9A 2M0AA 5FR3A 1ACCA 1FNWA 1FFUA 4DQOC 4H2AA 4B0EA 4WURA 1T6BX 3Q69A 1I4GA 2OHFA 3AEEB 2K5PA 3LB8C 2WXLA 3NZ3A 4NJCA 4XWWA 5TSSA 1F77A 2WU2B 1HZ5A 1TY0A 2Z8LA 1YMHE 4NZLB 4KGTA 2JQRB 3SEBA 2V3PA 1I4HA 4HRSA 1FEHA 2LHDA 5JXVA 1SE2A 1IGCA 3ZGZA 1C9FA 2ICIA 1BXTA 5EE9A 1KTKA 1VDVA 4B0MA 4ARCA 4RGOS 4C80A 4YTMB 4JX1C 2J4XA 5C3JB 3LXFA 3Q8BA 3ZYYX 2BS2B 2PVOD 1D5ZC 2G1EA 4ARIA 4MH8A 1RFKA 4MM3B 1JWSD 4NAMA 1FNUA 3E56A 2H89B 1YN3A 2JX5A 1L4DB 3P1MA 1FNVA 4JE3B 2WXKA 4RF1A 1V8CA 2J42A 1YQ4B 1WGKA 4US9A 1I4RA 3ZJTA 1TY2A 2QSDA 4US8A 2X38A 1FRDA 1QKZA 1CQVA 3AN1A 5HG2A 1NYRA 1JW9D 4WQMA 1IBXB 2WQYB 2JWUA 1WYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI3 A;  2WP9 B;  3AE1 B;  2WDQ B;  1JWA D;  1TYG B;  2LEK A;  3CF4 A;  1JRP A;  2Q5W D;  4KX6 B;  1FIQ A;  2N0S B;  2FBW B;  1QOG A;  4N58 A;  2Y5C A;  4YSZ B;  1RYJ A;  1GTH A;  1RWS A;  1WYG A;  3DWG C;  1WXQ A;  1QOB A;  3NVV A;  3AE5 B;  4FXC A;  3AE6 B;  1XLQ A;  3VRA B;  1J7C A;  1VJK A;  1B9R A;  5C2T B;  2WDV B;  1KF6 B;  4A9A A;  5G5H A;  1L6U A;  1H7W A;  1TKG A;  5EE0 A;  3AEC B;  1ZXI A;  5AUI A;  1DOX A;  2AX5 A;  1DGJ A;  2QIE B;  4YXD B;  1SIJ A;  1JQ4 A;  2W55 A;  3FC4 A;  1GAQ B;  4YTN B;  1J7B A;  1FXI A;  2M19 A;  2E3T A;  2BS4 B;  3DWM A;  1NEN B;  1ROE A;  3AE8 B;  2QJL A;  4YT0 B;  1FM0 D;  2W54 A;  3PO0 A;  1E0Z A;  4USA A;  1PUT A;  1N60 A;  1J7A A;  1QF6 A;  1FXA A;  1WRI A;  3NVW A;  1TJE A;  4JWU C;  1L0V B;  1E6E B;  3AEF B;  5EE1 A;  3P4R B;  3W5V B;  5GXG B;  1DOY A;  1ZP0 B;  3B9J A;  2MH7 A;  3ABV B;  3B2G A;  1IUE A;  1GT8 A;  1RM6 C;  3AV8 A;  1N62 A;  1KFY B;  2B76 B;  3SFE B;  1FRR A;  1KRH A;  2PIA A;  3FAH A;  3HRD D;  3AEB B;  4ZOH C;  3AH7 A;  3VR9 B;  3AEA B;  3AM9 A;  3AE9 B;  3P4Q B;  1N5W A;  1WWT A;  2CJN A;  1FFU A;  2MJD A;  1L5P A;  3AE3 B;  1T3Q A;  2W3S A;  1TKE A;  1FMA D;  3HVZ A;  2L83 A;  4C7Z A;  2L52 A;  2OHF A;  3NVY A;  3AEE B;  2K5P A;  2DBY A;  1QLB B;  3LB8 C;  3EUB 2;  1H7X A;  1EWY C;  1YJJ A;  5AUK A;  3P63 A;  1QOF A;  1CZP A;  2HTM E;  3AEG B;  3NS1 A;  3W9C B;  2WU2 B;  1I7H A;  4LTU A;  1XLP A;  1OFF A;  1R7S A;  2EKI A;  1ZOY B;  2JQR B;  1DOI A;  1VLB A;  1XLN A;  2WDR B;  2MJE A;  4HRO A;  4HRS A;  1E7P B;  3NVZ A;  1YJI A;  3ETR A;  4IDI A;  2CJO A;  1SB3 C;  1GPX A;  1XO3 A;  2WLB A;  5EE9 A;  4JWS C;  1NEK B;  1NYQ A;  4ITK A;  4ZHP A;  1VDV A;  3KWL A;  3P4P B;  3AED B;  4C80 A;  1CJE A;  4YTM B;  1TKY A;  2CU3 A;  2K22 A;  4P6V F;  3SR6 A;  3CWI A;  5H92 C;  1QT9 A;  4JX1 C;  1N63 A;  5C3J B;  2KMM A;  3LXF A;  2H88 B;  2K9X A;  3AE2 B;  2ACZ B;  1JRO A;  2WS3 B;  3ZYY X;  1JWB D;  1F0Z A;  2BS2 B;  1PDX A;  3AE4 B;  1OQR A;  2PVO D;  3VRB B;  2G1E A;  3L4P A;  5MPO A;  4YSX B;  1RFK A;  1XLO A;  2PKO A;  5G5G A;  1V97 A;  3B2F A;  4YTP B;  2WU5 B;  1FFV A;  1AYF A;  1N61 A;  5H8Y E;  4WWM A;  2H89 B;  2MJ3 A;  1GTE A;  4N6E B;  2JX5 A;  1E9M A;  1SF0 A;  2BS3 B;  1JAL A;  3RPF C;  3W5U B;  3P1M A;  3SFD B;  4C7Y A;  1L6V A;  2M56 B;  3AMZ A;  1ZUD 2;  2PVG C;  5EE3 A;  3VR8 B;  1PFD A;  1QOA A;  1YQ4 B;  1V8C A;  2DWQ A;  1WGK A;  3P4S B;  4US9 A;  1FO4 A;  1YQ3 B;  1NVI D;  2W3R A;  2BT6 A;  1UWM A;  3HUI A;  4US8 A;  1AWD A;  4N59 A;  1FRD A;  3AB5 A;  1N5X A;  4ZHO A;  1E10 A;  2KAJ A;  3AN1 A;  3NRZ A;  1NYR A;  3CIR B;  1JW9 D;  3BII D;  3WCQ A;  4YSY B;  4WQM A;  2WQY B;  1OQQ A;  3AE7 B;  1A70 A; 
#chains in the Genus database with same CATH topology
 2JF5 A;  2LHE A;  4HVB A;  4M01 A;  1XXG A;  3VTW A;  2RDB C;  4LJP B;  3DWG C;  4NJ6 A;  3AE6 B;  2IGG A;  4AP4 C;  1VJK A;  4P7I A;  2ZPN A;  2Z59 B;  4YL8 A;  2CR5 A;  1H7W A;  3VTV A;  1A5R A;  1CMX B;  3P63 A;  2OJW A;  2Y5P A;  4TKN A;  4XYC A;  2KC1 A;  2DEN B;  2W54 A;  2WWZ A;  1T5X D;  2WYQ A;  1T0Q C;  3RNC C;  2KN5 A;  3HVD A;  3KVF B;  1YIW A;  4CHK A;  1QIL A;  3P4R B;  2LGY A;  3N9Y C;  2MBO A;  4MEM A;  2EEL A;  3ZRF A;  4IWP A;  2JZZ A;  1L0Y B;  4GU2 A;  4MJS B;  2LGX A;  3U4E G;  1HA5 A;  1T3Q A;  3KLS X;  2IO3 B;  3NVY A;  3ZXR A;  5D6J B;  3RNE C;  2BF8 B;  1VCB A;  4AWJ A;  2AQ3 B;  1I7H A;  4AJY B;  2MLB A;  4BKG A;  3ETR A;  4HKZ E;  4K3B A;  2LUM A;  3PS6 A;  2NPT B;  4ITK A;  1MHH E;  1YOV B;  3SR6 A;  2BYV E;  3TCA A;  3Q3O C;  3MHZ A;  3B08 A;  2K9X A;  3T9L A;  1V5T A;  1F2R C;  3RUL A;  3MC9 A;  2HD5 B;  2WU5 B;  3ZQ4 A;  2RDH A;  4WH4 A;  1SF0 A;  2BS3 B;  3PRP B;  4BVU C;  1PFD A;  3WAN A;  4GMV A;  2BT6 A;  5J17 A;  1LFD A;  1I4P A;  3A9K A;  4JPS A;  2QMT A;  1AN8 A;  2PEA A;  2KAN A;  2RPV A;  3KQ4 A;  4FN2 A;  3RNF C;  2RGF A;  1WXA A;  3OWE B;  3H1U A;  5C23 A;  2SAK A;  1ZKH A;  3QJZ A;  3JSV B;  5LXH A;  2INP E;  2XNA C;  2JRH A;  5HFY A;  2BBC A;  4KKI A;  2KN4 A;  4ICV A;  3OLM D;  4WQO B;  3IXS A;  1PGA A;  4LNI A;  1WRD B;  2R61 A;  1WY8 A;  1I42 A;  1HZ6 A;  2Z0D B;  2GI9 A;  3DHI C;  4KIK B;  3L13 A;  4KDI C;  1YD8 U;  3R7Q A;  4M0W A;  3I57 A;  4ACF A;  1IUE A;  2B3A A;  4OW0 A;  2CU1 A;  2FCQ A;  1TS4 A;  4ICU A;  2DBY A;  2MHJ A;  3A1Q B;  2LMC A;  4EOY A;  2JSV X;  1S3S G;  4DXG A;  4W9C A;  4EZK A;  4OZB A;  1QQR A;  4DDI D;  2KYW A;  4KGR A;  3SDL C;  4GSW A;  1LGR A;  2H88 B;  1GG3 A;  3H7P B;  2G4S A;  1OQR A;  2O2V A;  4PYU A;  3RYT A;  3RFZ B;  4G0N B;  2G9H D;  3AMZ A;  3VR8 B;  2WX1 A;  3A4R A;  1FO4 A;  2FUG 1;  4A55 A;  3BZD B;  2EMT A;  3Q3M C;  2N9E B;  1SJE D;  2HJ1 A;  1VD2 A;  1OGW A;  5D3I B;  4W9L A;  3AE7 B;  4NQK E;  1MVK A;  2MSE D;  5BYQ A;  2PJH A;  3HM6 X;  1GTH A;  2N4F A;  3IHP C;  3HK0 A;  4GB9 A;  1WR1 A;  2IGD A;  2J7Q B;  2KFK B;  4FHK A;  2DYM A;  2IY0 B;  4L23 A;  4YXD B;  3FC4 A;  3BWU D;  4IDI A;  4RM9 A;  3FIL B;  4DK5 A;  5IP4 D;  4CYE A;  1Z2M A;  2DNF A;  2C60 A;  3DHH C;  2I2Y A;  3TUO A;  1K50 A;  5IKC M;  5BYR A;  1DOY A;  2LGS A;  5D94 A;  1UGJ A;  2MWS B;  3AEB B;  3IG3 A;  3UF8 A;  1UBQ A;  3M95 A;  2K39 A;  2V4L A;  3VHT C;  3PRM B;  4EFO A;  3EUB 2;  2V3N A;  3NOB A;  4HLE A;  2NBW B;  4MM3 A;  2DZM A;  4A3P A;  2K3U A;  1XLN A;  2MJE A;  2ZCB A;  1V6E A;  3Q8E A;  3RZW C;  3GZN I;  3IAS 1;  1R4M B;  2BYF A;  1F0Z A;  2RPQ A;  3L4P A;  4YSX B;  1OQY A;  4XX5 A;  1GTE A;  1LXD A;  2KOX A;  1AAR A;  1HXY D;  3H9D A;  2XK5 B;  3EHV A;  3PLV A;  1YQB A;  3AXC A;  3HUI A;  3ZO5 B;  2C7M B;  5J18 A;  4MSM B;  1MPE A;  1EWC A;  2W9N A;  3R2T A;  3KH0 A;  2M17 A;  1XCT L;  1AW7 A;  2KTR B;  2K8H A;  4WJP A;  2WXQ A;  3U52 E;  3Q8C A;  5EE0 A;  1ENF A;  1SIF A;  2NTS A;  2BS4 B;  3K9O B;  4HPP A;  2N9K A;  2ZEQ A;  1PUT A;  1N60 A;  2KDF B;  2L8J A;  3APC A;  2NVU I;  2ZJD A;  3NUH B;  4HJG E;  3MTN B;  5DPT A;  1R4N I;  1IGD A;  2NPT A;  1SEB D;  3AH7 A;  3C0R B;  3AM9 A;  3QIJ A;  4B0E A;  1OEY A;  4W9F A;  4NJC A;  4XWW A;  5TSS A;  1F77 A;  5BO4 B;  2LXC A;  2L0F A;  4KGT A;  2JQR B;  4GXB A;  2KK8 A;  4LNN A;  3ML9 A;  1FEH A;  5JXV A;  4TV3 A;  1IGC A;  5JHB A;  5EE9 A;  3ZUN A;  2MBQ A;  1WGY A;  4ARC A;  2NCN A;  2RD0 A;  2J4X A;  5C3J B;  3Q8B A;  4DHZ B;  2BS2 B;  2CHZ A;  2G1E A;  3QAQ A;  1JWS D;  4NAM A;  2H89 B;  2D11 A;  3P1M A;  1FNV A;  4JE3 B;  1UZX B;  2WXK A;  4RF1 A;  1V8C A;  1YQ4 B;  3ZJT A;  3N1X C;  1RLF A;  1HE8 A;  4US8 A;  3JW0 X;  3ZVV A;  1Q1O A;  1CQV A;  4LDT D;  1GUA B;  1JW9 D;  4FJZ A;  1IBX B;  3U7Z A;  1TYG B;  1M4V A;  1WJU A;  3PZ8 A;  1V1O A;  3DBR I;  2HDE A;  1QOB A;  3AE5 B;  4KIK A;  2LGI A;  2E6X A;  2KLC A;  5G5H A;  2CKH B;  1L6U A;  4TMA B;  3N1Z C;  2W55 A;  4JWS C;  2LGD A;  1ROE A;  4URK A;  4L2Y A;  3TMP B;  5KHQ A;  4J3O D;  1JRU A;  3A1Q A;  1J7A A;  1DYQ A;  4W9H A;  1WGG A;  2N9X A;  3KUD B;  3W1S C;  3ZKJ C;  3EEC A;  4BOS C;  5IA7 A;  4P1B C;  2GLS A;  4MEL A;  3NVW A;  3DQV A;  4I6P A;  2CS4 A;  3EA6 A;  2C5L C;  1ZP0 B;  2WXI A;  2C7N B;  1I4X A;  2XBB C;  1HQR D;  4KZC A;  2RMM A;  1FRR A;  3U8Z A;  3WAO A;  4KVG B;  1GB1 A;  3P4Q B;  3UIP B;  3IAM 1;  4AJW A;  1GJZ A;  2IGH A;  2J0K A;  3WA0 A;  1V5O A;  1YJJ A;  3AEG B;  3T8M A;  4PS3 A;  2BWF A;  2LZ6 A;  1JML A;  1K51 A;  3TBL D;  1OFF A;  1ZOY B;  3IBE A;  4WJQ A;  2N1V A;  2JY6 A;  2ZZP B;  4ZRP A;  4BZA A;  2WLB A;  5BYS A;  1F2R I;  1NEK B;  3KWL A;  2WNM A;  4EZJ A;  5JH5 C;  1WM2 A;  1CJE A;  4JGH B;  1D6E C;  4TQ0 A;  5CHW A;  1T0Y A;  2ACZ B;  2FCM A;  4TUU A;  1TTN A;  5MPO A;  5HI1 A;  4B6W A;  4GDL B;  5EDS A;  1F9J A;  3GB1 A;  2KDE B;  2KVZ A;  3DVG X;  1STE A;  2LVO A;  4X57 B;  3BYY B;  2REX A;  4K3C A;  1QOA A;  2JYT A;  2KFK A;  4A8X C;  1UWM A;  4R3D A;  4KDL B;  1AWD A;  1IP9 A;  3L16 A;  1KLU D;  1E10 A;  2KXJ A;  2HTH A;  3M63 B;  1ESF A;  3DBL I;  5FR6 A;  4YSY B;  4N9F 4;  2PW9 A;  2KJ6 A;  5G55 A;  3V6C B;  1JWA D;  4ZDV A;  3ENE A;  1BML C;  3Q3N C;  2LJ5 A;  2Q5W D;  3AUL A;  3RNA C;  1G6J A;  4N58 A;  2FBW B;  3PT2 B;  3SD5 A;  1RWS A;  2A4Z A;  1TZ1 A;  3NZU A;  3ONS A;  4KSL C;  5CTR C;  1K53 A;  2GBK A;  4EKU A;  2O6V D;  4RH6 A;  1WJ6 A;  2MA9 B;  4OZA A;  2FID A;  3MP9 A;  1J7B A;  2J0J A;  4JIO U;  5CHF A;  3VTU A;  1FM0 D;  1HTO A;  2IPK D;  2EKE C;  4IWO A;  1TS3 A;  1ZGU B;  1EU3 A;  2XN9 C;  3VFK A;  4JWU C;  3RNB C;  5LNK 1;  4MAC A;  2PLP A;  3W5V B;  2KJR A;  2NTT A;  1KFY B;  3BYT B;  4BAX A;  1N5W A;  3IVF A;  1L5P A;  1ZDX A;  4OZC A;  1C76 A;  1YJ1 A;  2L52 A;  3R8B A;  2OOB B;  2FCS A;  4LNF A;  1H7X A;  1JWU D;  2LI5 A;  4NAW B;  4EUT A;  3NS1 A;  1BT0 A;  2YLM A;  3M62 B;  2GBJ A;  1WZ0 A;  1UNS A;  1GPX A;  1WH3 A;  2N7J A;  1V80 A;  2D3B A;  4A3O A;  1TKY A;  3PVL A;  4HWI B;  2GBN A;  5H92 C;  1TS5 A;  1UGM A;  3N1Y C;  2L76 A;  4ZYN A;  3W1S A;  1JWB D;  3AE4 B;  4K7W A;  1E9M A;  2JWZ A;  1JAL A;  4C4V B;  3CSF A;  3Q8F A;  2MW5 A;  2KTR A;  2M56 B;  1ET9 A;  3H6N A;  1MFW A;  2DWQ A;  2SEB D;  1NVI D;  4BFR A;  1MI0 A;  2JXT A;  2CHW A;  4UDU C;  3ZJV A;  3GOE A;  2KAJ A;  3NRZ A;  1TGZ B;  4HEA 1;  1WGD A;  1PYW D;  2QEJ C;  2WXM A;  3PZ7 A;  4NPN A;  3VQI A;  2MBB B;  1B9R A;  1D5X C;  3PHX B;  2G3Q B;  4GN1 A;  4A9A A;  1NI2 A;  3GP7 A;  3ZDM C;  2OJR A;  1KM7 A;  2INN E;  1EF5 A;  1FXI A;  2QJL A;  4YT0 B;  4WAA A;  1EUV B;  3PO0 A;  3N20 C;  4K81 A;  3UQA A;  2JPH A;  2WX0 A;  4DHJ B;  4RGN A;  2NBU A;  1WJN A;  1XCQ L;  3DDC B;  4B9K A;  2WDT B;  3B9J A;  4MGY E;  4ANV A;  3Q3F A;  3BVG A;  5HKH A;  3EGR A;  4DXF A;  2KFJ A;  3AE9 B;  1XD3 B;  1WWT A;  4WWN A;  2W3S A;  3N32 A;  1FMA D;  2Y3A A;  2LFI A;  4IM3 A;  4A20 A;  3K9P B;  2FNJ B;  4ANU A;  3UGB B;  2WHI A;  1MJD A;  3MC0 B;  3NVZ A;  1YJI A;  1IYF A;  2VH2 A;  5D3D A;  3AED B;  2MP2 B;  4I6N B;  2PMV A;  3IT4 B;  3CWI A;  3TSS A;  3AE2 B;  1SXT A;  2K6D B;  2PKO A;  2M0X A;  3L10 B;  4C7Y A;  3SU8 X;  4ANX A;  5DPW A;  4RCO A;  2QDF A;  5HHD G;  1YX6 B;  2DZK A;  1J8C A;  3NHE B;  1XF5 L;  3GE8 C;  4DHJ D;  2I1K A;  3MHS D;  1MG8 A;  3OG5 A;  2WDQ B;  3NY5 A;  4GDK B;  1TBE A;  3IT6 B;  4D2K A;  1WXS A;  4ZRJ A;  5C2T B;  3BVZ A;  2N9P C;  2PPH A;  4RFB A;  3GE3 C;  1OEY J;  2XEW A;  1ZXI A;  2AX5 A;  1C78 A;  5D7G A;  4BKS A;  5AZF A;  3QC8 B;  2JYE A;  1P7E A;  4MH0 E;  3HIZ A;  1P0R A;  1QZE A;  4RNA A;  3ALB A;  1OTR B;  3L08 A;  2KLG A;  2PE9 A;  4WJO A;  1P98 A;  1GT8 A;  2ZNV B;  4GLS C;  3HRD D;  2BKR B;  3TEX A;  1FNW A;  4DBG A;  4E71 A;  4DQO C;  1E5W A;  3Q2A C;  2OHF A;  3AEE B;  2YVC A;  2WXL A;  3NZ3 A;  4W9I A;  4GOC A;  3M3J A;  5IN7 A;  2WU2 B;  2K8B A;  4GDL A;  1RAX A;  2Z8L A;  1YMH E;  4FAD A;  4HRS A;  2KMC A;  2ICI A;  1KTK A;  4YTM B;  4JX1 C;  2A5U A;  3CST A;  3LXF A;  4RMA A;  3PZD A;  2Y5B B;  1NBF C;  4NNJ B;  1WM3 A;  1D5Z C;  4HXD A;  3E56 A;  4FLH A;  2J42 A;  3FKY A;  1I4R A;  2QSD A;  4AUQ C;  1R4M I;  1Z5S B;  2MCN B;  2DZI A;  1QKZ A;  3AN1 A;  2KDB A;  2IO1 B;  2JWU A;  1L4Z B;  2I1J A;  4S17 A;  2YEP F;  2M8S A;  2RSU A;  2BYE A;  2N0S B;  2WXR A;  4REZ A;  5GMV A;  2MBE A;  2D3C A;  3ZJU A;  3GZN B;  3I9V 1;  3VUY A;  3V3X A;  3TEY A;  1SIJ A;  1JQ4 A;  1UEL A;  1GAQ B;  4YTN B;  2HJ8 A;  4XDD A;  1E0Z A;  4NAW A;  2JVC A;  4EE2 A;  1SJH D;  1E6E B;  5EE1 A;  1Y8R C;  3PGE A;  1WXV A;  5BMI A;  4JL9 A;  1SE3 A;  1ET6 A;  1RM6 C;  3SFE B;  4JLC A;  4EZL A;  3OJ3 A;  4MJS A;  2CHX A;  1WJ4 A;  5IAA C;  2FUH B;  1E8X A;  2KD0 A;  1E90 A;  5KHO A;  1EWY C;  3EC8 A;  4OVV A;  5E6P A;  3W9C B;  1K52 A;  4LDT B;  2N9L A;  3P2B A;  3HM3 A;  4C4V A;  2J52 A;  4IC7 B;  1WR6 E;  1WYW B;  2CJO A;  2MRP A;  1PGX A;  3ZNH B;  2AWT A;  4LJO B;  4PT5 A;  3P4P B;  2GBR A;  4P6V F;  4OHJ A;  1N63 A;  3GS2 A;  2KMM A;  1JRO A;  1T0R C;  2WXP A;  2L00 B;  4Q2J A;  2WXF A;  3DVN U;  1HEZ E;  4YTP B;  1FFV A;  2J53 A;  1N61 A;  1J0G A;  4HKQ A;  3RPF C;  2AL3 A;  2BW2 A;  3QHT A;  4PYZ A;  1P9D U;  2ZW1 A;  4II2 B;  4ZYS A;  5BMG A;  3X0W A;  1KLG D;  4W9G A;  4MDK E;  3ZRC A;  4FA6 A;  4XE0 A;  4HPM B;  1SE4 A;  1OQQ A;  3CF6 E;  3Q14 C;  5DCN A;  2KAC A;  1E8Y A;  2J0M A;  3PPA A;  4YSZ B;  4KGS A;  1T0S C;  2DYO A;  2N1W A;  1XLQ A;  2FIF A;  5I4D A;  4M8M A;  2K6Q A;  2K1F A;  3V60 A;  3JSV A;  5AZH A;  4IWQ A;  3V62 A;  1E7V A;  4FHJ A;  3A9J B;  1DGJ A;  5CHV C;  3EFU A;  1V2Y A;  2IO2 B;  2D10 A;  2K8C A;  1WXM A;  3LDZ E;  1C4C A;  4W9J A;  4MGI E;  1KJT A;  1WSP A;  3B0A A;  1PQS A;  1TIF A;  2KWC A;  2VZK D;  4WIP A;  3ZDT A;  2MH7 A;  3ABV B;  4XZ4 A;  1PGB A;  3FAH A;  4WWO A;  3UI3 A;  3JVZ X;  4ZOH C;  3AEA B;  2DZJ A;  3DBH I;  3T3O A;  3AE3 B;  3R7R A;  1FD6 A;  4QAY A;  3HVZ A;  1EM7 A;  2HTM E;  4KZ0 A;  5L95 C;  1XLP A;  4WAF A;  3DBR B;  1FPY A;  3X23 A;  3I63 C;  1E7P B;  3V61 A;  3N30 A;  3DVG Y;  3PTF C;  1NYQ A;  3S2A A;  2DHZ A;  3U2S C;  1CK1 A;  2ZPY A;  2HE7 A;  3WAP A;  5FK9 C;  3VXW A;  2O6V B;  1PDX A;  3L54 A;  1ZXH A;  3H7P A;  1VZ6 A;  1XLO A;  4PS8 A;  1V86 A;  3B1L X;  4GDK A;  2KVR A;  1SBB B;  1BUI C;  4MT5 A;  4FUL A;  2RDG A;  1ZUD 2;  2PVG C;  2WXG A;  3VUW A;  1P7F A;  2DX5 B;  1I35 A;  3DCG A;  1KH0 A;  1YQ3 B;  2KWU B;  3KYC D;  2INC C;  2YEP B;  2ZVO A;  3AB5 A;  2KDM A;  4DXA B;  3CIR B;  1A70 A;  3UIN B;  3Q3J A;  3AE1 B;  3TL5 A;  3PSE B;  4W9D A;  3VUX A;  2RR9 A;  5E6O A;  1WE7 A;  5FKA C;  2KQ7 A;  3RN9 C;  2ZW0 A;  2KC2 A;  4CQN A;  2M4N A;  1J19 A;  2ONQ A;  1KF6 B;  5D2M B;  2AEH A;  2GMI C;  3ZNG C;  4RGT A;  1P3Q U;  5AUI A;  2KT7 A;  3A4S C;  4G3X B;  1NEN B;  2UYZ B;  3AU4 A;  1L7Y A;  3FIL A;  1FXA A;  1P1A A;  1V9J A;  2ON8 A;  3E9S A;  1L0V B;  3AEF B;  1C4P A;  2C7H A;  2BPS A;  1UF0 A;  3B2G A;  3BVM A;  3W1Y A;  1VRA B;  3KYD D;  1TKE A;  4AOF A;  3ZTC A;  4HCN B;  1QLB B;  4HDQ A;  1QOF A;  5AEK B;  4ZRQ A;  2L1A A;  1DOI A;  4I6L B;  4HRO A;  1WFY A;  2BWE S;  1TS2 A;  1SB3 C;  1EO6 A;  4C56 C;  3VH4 B;  3MC8 A;  2GB1 A;  2LWP A;  4BBN F;  2V3S A;  1YX5 B;  3QK0 A;  3T3N A;  3MJW A;  2IY1 B;  1WX9 A;  3N3K B;  3VRB B;  1YN4 A;  2D5G A;  5G5G A;  2L3Z A;  1ISN A;  1ZE3 D;  4WWM A;  2N7D A;  4KKJ A;  4N6E B;  3W5U B;  3SFD B;  4FBJ B;  1Y56 A;  1WGH A;  3AU5 A;  4BOZ B;  3P4S B;  1YNT E;  3ECI A;  2XK5 A;  4IM2 A;  5LXI B;  2LVQ A;  1C4A A;  2L32 A;  1WX8 A;  2JUO A;  4LK0 M;  2KQS A;  4P16 A;  2WXN A;  3ZTD A;  3CF4 A;  4K7U A;  3LJ3 A;  4LNO A;  2K0P A;  3D32 A;  3NZS A;  3JYU A;  4OVU A;  3RI7 C;  5L83 A;  2BYT A;  2NR2 A;  3AEC B;  4E3C A;  1DOX A;  3L17 A;  4LNK A;  3TIX A;  3DWM A;  2M19 A;  4HCP B;  1FCL A;  1D3Z A;  4OVZ A;  1VR9 A;  1VZ7 A;  4DHZ E;  4IW0 A;  4HPL B;  4IOI E;  4IKG A;  2LD9 A;  2VRR B;  1H4R A;  2TSS A;  3UIO B;  2WXJ A;  1XEE A;  1WF9 A;  2KDI A;  4DWF A;  4WWP A;  4F7Z A;  5FR3 A;  1FFU A;  4WUR A;  3Q69 A;  1WMH B;  2K5P A;  5C1Z A;  4PS7 A;  1XT9 B;  2EMS A;  4XGA B;  1HZ5 A;  3VDZ A;  4NZL B;  3SEB A;  1WIA A;  2V3P A;  4G11 A;  1I4H A;  2LHD A;  3ZNZ B;  1SE2 A;  2KJH B;  4M8N A;  2BQQ A;  2NS5 A;  3DVN V;  1VDV A;  4RGO S;  3PRE A;  4C80 A;  3R66 C;  3SHQ A;  4FJV B;  4ZRI A;  1C1Y B;  4JQW C;  4ARI A;  2MBH A;  1E7U A;  4GIV A;  5LLI A;  1L4D B;  2GOW A;  1V81 A;  2BGF A;  1WGK A;  4US9 A;  4E74 A;  2DYB A;  1TY2 A;  5G2N A;  2X38 A;  1LM8 B;  3A9J A;  1GNU A;  5HG2 A;  3VAW A;  1NYR A;  3U30 A;  1U4A A;  4WQM A;  5CX3 A;  2KMA A;  4RGM A;  4KV2 A;  2R2O A;  1IBX A;  2KNB A;  1Q10 A;  4CO7 A;  2LEK A;  4KX6 B;  1QOG A;  3VVW B;  1RYJ A;  4BKT A;  2QIL A;  2WXO A;  3QQ8 B;  2BB6 A;  2BB5 A;  1E8Z A;  4P1C C;  4USA A;  3TJP A;  2KWD A;  2AQ2 B;  1I4Q A;  1WZ3 A;  3QCA A;  1ZPS A;  2PTL A;  4W9K A;  4XDC A;  2B76 B;  3DOW A;  3QX1 A;  4A90 A;  1LQB A;  4PK1 A;  3OAW A;  5TR5 A;  3BIN A;  3LYY A;  4XWT A;  5JHA A;  4MGZ E;  2O6V A;  1V1P B;  5AUK A;  2LAS A;  4MSQ B;  1L0X B;  2KO3 A;  5E6J A;  2LUE A;  4LTU A;  1D4B A;  2MEK A;  3RD2 A;  2WGS A;  1R7S A;  3H8H A;  1VLB A;  4FJY A;  3ZNI D;  4NQL B;  1XO3 A;  2ZCC A;  2DLB A;  4YWG G;  2V1Y A;  2UU7 A;  2AYO B;  3I3T B;  1GC7 A;  2WS3 B;  2JZ3 B;  1JCK B;  3BK2 A;  4WJN A;  4W9E A;  4NJ7 A;  1V97 A;  1AYF A;  2M1M A;  2LVP A;  2LXA A;  4LLG M;  5BMH A;  3RCZ A;  2DAF A;  1SE9 A;  2FCN A;  4AS1 A;  1SSN A;  3KUC B;  2R2Q A;  1NI3 A;  2K25 A;  2WP9 B;  4IM0 A;  4M00 A;  2FE8 A;  3MJ5 A;  2WXH A;  3VRA B;  3RMK C;  4TQ1 A;  3V6E B;  4NY0 A;  2WDV B;  2IYD B;  2QC8 A;  3ZXV A;  2V0G A;  2QIE B;  2E3T A;  1Q0W B;  1QF6 A;  3WIM A;  4G50 A;  3V05 A;  1RFA A;  1MG4 A;  4A6Q A;  2IJ0 A;  2MQJ A;  2IND C;  2VH1 A;  4MGK E;  3URY A;  2CJN A;  1X1M A;  2MJD A;  2L83 A;  4DDG D;  3BK1 A;  3W2D A;  3IFW B;  2BTE A;  2D07 B;  4IG7 B;  1C79 A;  4ANW A;  3BY4 B;  2WDR B;  1UUP A;  1WGR A;  4B95 A;  4F8C B;  1HTQ A;  1ZDV A;  5E6N A;  1GOZ A;  1K8R B;  2AL6 A;  2KWV B;  2CU3 A;  1NDD A;  3OJ4 B;  1QT9 A;  3U7D A;  1F1H A;  4KSK C;  3APF A;  2KX0 A;  3A33 B;  3B2F A;  1S1Q B;  2KHW B;  2MJ3 A;  3EFC A;  4BBN C;  5EE3 A;  4J6I A;  2W3R A;  2PE6 B;  4IUM B;  2VZK B;  5DPS A;  1SGH A;  1N5X A;  2ZNV C;  5IO9 A;  3NJT A;  3WCQ A;  2JRI B;  2GBM A;  3DHG C;  2L0T A;  3ZIM A;  1UWX A;  2LRU A;  2KKC A;  2Y5C A;  2W82 A;  1IPG A;  2KQ4 X;  3TEW A;  4FXC A;  3L0W B;  2JU6 X;  1RRB A;  1R4N B;  1WE6 A;  2OED A;  3A9K B;  4EEW A;  3PV1 A;  1EF1 A;  3ZLZ A;  2AQ1 B;  3AE8 B;  1WMH A;  3APD A;  3O13 A;  1GB4 A;  1XQQ A;  2D3A A;  3Q6B A;  3R3M A;  4M02 A;  3ML8 A;  3ZW3 A;  1E8W A;  1WRI A;  2I38 A;  1VZ8 A;  5T8I A;  5GXG B;  3UQB A;  2G4D B;  3RT3 B;  1V49 A;  1TZO A;  3R2I A;  1N62 A;  1KRH A;  3KW5 B;  2L05 A;  1MHX A;  3MFG A;  4RM8 A;  3VR9 B;  2V9H A;  4K1R B;  1D5M C;  1YN5 A;  1L2N A;  1KLV A;  5DPR A;  3RZF A;  4C7Z A;  1JWM D;  1B1Z A;  1CZP A;  3WAM A;  1UH6 A;  3HHM A;  2EKI A;  1FCC C;  2JT4 B;  2V4I B;  2G45 B;  2FAZ A;  2JZP A;  4M0W B;  1H8C A;  2ZVN A;  1EU4 A;  3P42 A;  3Q8A A;  2IZV B;  4ZHP A;  1C77 A;  2LJI A;  5AZG A;  2MP2 A;  2K22 A;  3NS8 A;  3O65 B;  5J2R A;  2JXX A;  3AI5 A;  3TEZ A;  4O1N A;  4S0R A;  2DAJ A;  5H8Y E;  2N7E A;  4II3 B;  4HDO A;  3QAR A;  1C3T A;  1L6V A;  4ZRK A;  2NBV B;  4HJK A;  1F52 A;  1LO5 D;  2GRI A;  4XC2 A;  3J9C A;  1WI0 A;  4N59 A;  3RNG C;  4ZHO A;  3C8Y A;  4TSS A;  3BII D;  3DBH B;  1KOT A;  4F1S A;  1ZW7 A;  2O2V B;  1Q5W B;  1JRP A;  3NG0 A;  4AQ7 A;  3CMM B;  4RF0 A;  1FIQ A;  2KZR A;  3PHW B;  3NVV A;  1WXQ A;  3KUZ A;  2IDY A;  1J7C A;  2D2Q A;  1TT5 B;  4LCD E;  2NMQ A;  2KTF A;  3VH3 B;  1TKG A;  2D3G A;  2BKF A;  2Z0E B;  2IO0 B;  3C19 A;  2ASQ A;  2C9W B;  1UD7 A;  1N6Z A;  1V1P A;  4C00 A;  1TJE A;  3WAL A;  3KWV A;  3DPD A;  3AV8 A;  2PIA A;  4L1B A;  2L7R A;  2M0A A;  1ACC A;  5IOI A;  2MX2 A;  4HK2 A;  4H2A A;  1T6B X;  1I4G A;  3QWZ B;  3LB8 C;  1FXT B;  2IBI B;  4ASW C;  2X8X X;  3DBS A;  1TY0 A;  2LRW A;  4GGQ A;  1M94 A;  2KX3 A;  1GC6 A;  3I5J C;  2UWQ A;  3ZGZ A;  1C9F A;  1BXT A;  4B0M A;  2QHO A;  3RUI B;  3QA8 A;  3ZYY X;  2PVO D;  3DBL B;  1UBI A;  3PLU A;  4MH8 A;  1RFK A;  4MM3 B;  1FNU A;  1YN3 A;  3H7S A;  2JX5 A;  4BKS D;  3PRZ A;  2QCZ A;  1WX7 A;  4K7S A;  1FRD A;  5JZE B;  2BVC A;  2WQY B;  1WYG A; 
#chains in the Genus database with same CATH homology
 1IBX A;  1L4Z B;  1Q10 A;  3U7Z A;  1TYG B;  1M4V A;  2LEK A;  2YEP F;  2LHE A;  1V1O A;  3PZ8 A;  4KX6 B;  1XXG A;  2N0S B;  1QOG A;  2HDE A;  2WXR A;  1RYJ A;  3DWG C;  1QOB A;  3AE5 B;  3AE6 B;  2LGI A;  2IGG A;  4REZ A;  1VJK A;  2E6X A;  3ZJU A;  2QIL A;  5G5H A;  1L6U A;  1H7W A;  3I9V 1;  2WXO A;  3V3X A;  2BB6 A;  4TMA B;  1SIJ A;  3TEY A;  1JQ4 A;  2W55 A;  2BB5 A;  1GAQ B;  4YTN B;  3P63 A;  4JWS C;  2Y5P A;  1ROE A;  4XDD A;  4L2Y A;  2W54 A;  4J3O D;  1E0Z A;  1T5X D;  4USA A;  1J7A A;  1DYQ A;  4EE2 A;  2KWD A;  2AQ2 B;  3HVD A;  1SJH D;  1QIL A;  1I4Q A;  3NVW A;  1E6E B;  5EE1 A;  3P4R B;  3EA6 A;  5BMI A;  3N9Y C;  1ZP0 B;  1SE3 A;  1ET6 A;  1ZPS A;  2EEL A;  2WXI A;  2PTL A;  1I4X A;  1HQR D;  1RM6 C;  2RMM A;  4XDC A;  2B76 B;  3SFE B;  1FRR A;  1L0Y B;  4A90 A;  1GB1 A;  3P4Q B;  3IAM 1;  3U4E G;  1HA5 A;  1T3Q A;  2IGH A;  3KLS X;  3LYY A;  4XWT A;  3NVY A;  1EWY C;  1V1P B;  1YJJ A;  5AUK A;  1L0X B;  3AEG B;  3W9C B;  5E6J A;  2AQ3 B;  1I7H A;  1K52 A;  1JML A;  4LTU A;  2N9L A;  1D4B A;  1K51 A;  2MEK A;  1OFF A;  1R7S A;  1ZOY B;  3H8H A;  1VLB A;  2J52 A;  3ETR A;  2CJO A;  4HKZ E;  4ZRP A;  2LUM A;  1XO3 A;  1PGX A;  2WLB A;  2DLB A;  1F2R I;  5BYS A;  1NEK B;  4ITK A;  1MHH E;  4PT5 A;  3KWL A;  2WNM A;  3P4P B;  1CJE A;  4YWG G;  3SR6 A;  4P6V F;  4OHJ A;  3MHZ A;  1D6E C;  4TQ0 A;  1N63 A;  3GS2 A;  2KMM A;  2K9X A;  2ACZ B;  1F2R C;  2WS3 B;  1JRO A;  1JCK B;  3BK2 A;  2WXP A;  4Q2J A;  5MPO A;  2WXF A;  5HI1 A;  1V97 A;  1HEZ E;  4YTP B;  2WU5 B;  1FFV A;  2J53 A;  4GDL B;  1AYF A;  1N61 A;  2RDH A;  3GB1 A;  4WH4 A;  3ZQ4 A;  4HKQ A;  1SF0 A;  2BS3 B;  3RPF C;  1STE A;  3BYY B;  2BW2 A;  1PFD A;  1QOA A;  2JYT A;  4LLG M;  4A8X C;  2BT6 A;  1UWM A;  2ZW1 A;  4R3D A;  4ZYS A;  5BMH A;  1I4P A;  5BMG A;  1AWD A;  4JPS A;  1KLG D;  1KLU D;  1E10 A;  4AS1 A;  4XE0 A;  2QMT A;  1ESF A;  1SE4 A;  4YSY B;  1SSN A;  1OQQ A;  1AN8 A;  2PW9 A;  1NI3 A;  2WP9 B;  2RPV A;  3KQ4 A;  1JWA D;  1BML C;  2Q5W D;  2KAC A;  4N58 A;  2FBW B;  4YSZ B;  4KGS A;  1RWS A;  2FE8 A;  3OWE B;  2DYO A;  3MJ5 A;  2WXH A;  1XLQ A;  3VRA B;  2SAK A;  5I4D A;  4TQ1 A;  2WDV B;  2INP E;  1K53 A;  2XNA C;  2V0G A;  4RH6 A;  5HFY A;  4OZA A;  3MP9 A;  1DGJ A;  2QIE B;  2BBC A;  4KKI A;  2E3T A;  1J7B A;  2KN4 A;  1FM0 D;  3IXS A;  1C4C A;  2IPK D;  1PGA A;  1QF6 A;  1WSP A;  1TS3 A;  1EU3 A;  2XN9 C;  3V05 A;  2R61 A;  1HZ6 A;  4JWU C;  5LNK 1;  2GI9 A;  4MAC A;  2PLP A;  2VZK D;  3W5V B;  4WIP A;  4A6Q A;  2IJ0 A;  2MH7 A;  3ABV B;  2NTT A;  1PGB A;  3I57 A;  1IUE A;  4M0W A;  1KFY B;  3FAH A;  3BYT B;  4OW0 A;  3UI3 A;  4ZOH C;  3AEA B;  1N5W A;  3URY A;  2CJN A;  2MJD A;  1L5P A;  3T3O A;  3AE3 B;  1FD6 A;  1ZDX A;  3HVZ A;  2L83 A;  1EM7 A;  1C76 A;  1TS4 A;  2L52 A;  3BK1 A;  4OZC A;  3R8B A;  2DBY A;  3W2D A;  1H7X A;  1JWU D;  4NAW B;  2HTM E;  3NS1 A;  2LMC A;  2BTE A;  1XLP A;  1C79 A;  4WAF A;  2JSV X;  2WDR B;  1E7P B;  1UUP A;  4DXG A;  1UNS A;  4OZB A;  1GPX A;  1QQR A;  1ZDV A;  1NYQ A;  1GOZ A;  2N7J A;  3U2S C;  1CK1 A;  4KGR A;  1TKY A;  2CU3 A;  5H92 C;  1QT9 A;  1TS5 A;  5FK9 C;  2H88 B;  3W1S A;  1JWB D;  1PDX A;  3AE4 B;  1OQR A;  1ZXH A;  1VZ6 A;  1XLO A;  3B2F A;  2MJ3 A;  1E9M A;  1SBB B;  1JAL A;  1BUI C;  4MT5 A;  3Q8F A;  3RFZ B;  2G9H D;  2M56 B;  3AMZ A;  1ET9 A;  1ZUD 2;  2PVG C;  2RDG A;  3VR8 B;  1P7F A;  2WXG A;  5EE3 A;  2DWQ A;  1KH0 A;  2SEB D;  1FO4 A;  1YQ3 B;  1NVI D;  2FUG 1;  2W3R A;  4A55 A;  3BZD B;  1MI0 A;  2JXT A;  2YEP B;  2VZK B;  3AB5 A;  1N5X A;  4UDU C;  3ZJV A;  2KDM A;  2KAJ A;  1SJE D;  3NRZ A;  3CIR B;  3WCQ A;  5D3I B;  3AE7 B;  1A70 A;  4HEA 1;  3AE1 B;  1PYW D;  1MVK A;  1UWX A;  5FKA C;  5BYQ A;  2Y5C A;  2W82 A;  3TEW A;  2KQ4 X;  2ZW0 A;  1GTH A;  2QEJ C;  2WXM A;  3PZ7 A;  4FXC A;  4CQN A;  3VQI A;  2IGD A;  2JU6 X;  2ONQ A;  1B9R A;  1D5X C;  4A9A A;  1KF6 B;  2DYM A;  3GP7 A;  4RGT A;  2OED A;  4L23 A;  5AUI A;  4YXD B;  2INN E;  3FC4 A;  2AQ1 B;  3BWU D;  4IDI A;  1FXI A;  1NEN B;  3AE8 B;  2QJL A;  3FIL B;  4YT0 B;  3FIL A;  3O13 A;  3PO0 A;  1GB4 A;  2I2Y A;  1FXA A;  1WRI A;  2I38 A;  4RGN A;  3TUO A;  2ON8 A;  1XCQ L;  1VZ8 A;  3E9S A;  1L0V B;  1K50 A;  3AEF B;  5T8I A;  4RGM A;  5GXG B;  5BYR A;  1C4P A;  1DOY A;  3B9J A;  1TZO A;  3B2G A;  3R2I A;  3BVM A;  1N62 A;  1KRH A;  3BVG A;  1UGJ A;  1MHX A;  3EGR A;  4DXF A;  3AEB B;  3MFG A;  3VR9 B;  3AE9 B;  1VRA B;  1WWT A;  1D5M C;  1YN5 A;  2W3S A;  1TKE A;  1FMA D;  2Y3A A;  4C7Z A;  2LFI A;  1QLB B;  3EUB 2;  1JWM D;  1B1Z A;  1QOF A;  1CZP A;  2V3N A;  4ZRQ A;  2EKI A;  2K3U A;  2L1A A;  1DOI A;  1XLN A;  1FCC C;  4HRO A;  2MJE A;  3MC0 B;  2V4I B;  1YJI A;  3NVZ A;  2JZP A;  1TS2 A;  1SB3 C;  3Q8E A;  1EU4 A;  3P42 A;  3Q8A A;  5D3D A;  4C56 C;  4ZHP A;  2GB1 A;  1C77 A;  2LJI A;  3AED B;  3IAS 1;  2PMV A;  3IT4 B;  2K22 A;  3CWI A;  3TSS A;  3AE2 B;  1F0Z A;  3T3N A;  1SXT A;  3TEZ A;  3VRB B;  3L4P A;  4YSX B;  2PKO A;  1YN4 A;  2D5G A;  5G5G A;  4O1N A;  5H8Y E;  1ZE3 D;  4WWM A;  1GTE A;  4KKJ A;  4N6E B;  3W5U B;  4C7Y A;  3SFD B;  1L6V A;  1Y56 A;  1HXY D;  4RCO A;  3P4S B;  1YNT E;  2GRI A;  1LO5 D;  3HUI A;  5HHD G;  3J9C A;  4N59 A;  1C4A A;  2L32 A;  4ZHO A;  1MPE A;  1EWC A;  3C8Y A;  4TSS A;  1XF5 L;  4LK0 M;  3BII D;  4P16 A;  2WXN A;  3R2T A;  2WDQ B;  3CF4 A;  1JRP A;  4AQ7 A;  4RF0 A;  1FIQ A;  1XCT L;  4GDK B;  3NVV A;  2K0P A;  1AW7 A;  1WXQ A;  2IDY A;  1J7C A;  3IT6 B;  4D2K A;  5C2T B;  2WXQ A;  3BVZ A;  2NMQ A;  3U52 E;  2BYT A;  4RFB A;  3Q8C A;  1TKG A;  5EE0 A;  3AEC B;  1ENF A;  1ZXI A;  1DOX A;  2AX5 A;  1C78 A;  5D7G A;  2NTS A;  2M19 A;  3DWM A;  2BS4 B;  1FCL A;  2JYE A;  2N9K A;  4OVZ A;  1P7E A;  1VR9 A;  1VZ7 A;  1V1P A;  1PUT A;  1N60 A;  4IOI E;  4RNA A;  4IKG A;  1TJE A;  3NUH B;  4HJG E;  2TSS A;  3KWV A;  2WXJ A;  1GT8 A;  3AV8 A;  4GLS C;  3HRD D;  2PIA A;  1XEE A;  1IGD A;  4L1B A;  1SEB D;  3TEX A;  3AH7 A;  3AM9 A;  2M0A A;  5FR3 A;  1ACC A;  1FNW A;  1FFU A;  4DQO C;  4H2A A;  4B0E A;  4WUR A;  1T6B X;  3Q69 A;  1I4G A;  2OHF A;  3AEE B;  2K5P A;  3LB8 C;  2WXL A;  3NZ3 A;  4NJC A;  4XWW A;  5TSS A;  1F77 A;  2WU2 B;  1HZ5 A;  1TY0 A;  2Z8L A;  1YMH E;  4NZL B;  4KGT A;  2JQR B;  3SEB A;  2V3P A;  1I4H A;  4HRS A;  1FEH A;  2LHD A;  5JXV A;  1SE2 A;  1IGC A;  3ZGZ A;  1C9F A;  2ICI A;  1BXT A;  5EE9 A;  1KTK A;  1VDV A;  4B0M A;  4ARC A;  4RGO S;  4C80 A;  4YTM B;  4JX1 C;  2J4X A;  5C3J B;  3LXF A;  3Q8B A;  3ZYY X;  2BS2 B;  2PVO D;  1D5Z C;  2G1E A;  4ARI A;  4MH8 A;  1RFK A;  4MM3 B;  1JWS D;  4NAM A;  1FNU A;  3E56 A;  2H89 B;  1YN3 A;  2JX5 A;  1L4D B;  3P1M A;  1FNV A;  4JE3 B;  2WXK A;  4RF1 A;  1V8C A;  2J42 A;  1YQ4 B;  1WGK A;  4US9 A;  1I4R A;  3ZJT A;  1TY2 A;  2QSD A;  4US8 A;  2X38 A;  1FRD A;  1QKZ A;  1CQV A;  3AN1 A;  5HG2 A;  1NYR A;  1JW9 D;  4WQM A;  1IBX B;  2WQY B;  2JWU A;  1WYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...