3VRAB

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 50
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vraB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vraB01
3VR8B 1TJEA 2WU5B 1QOAA 2LEKA 1E7PB 4YSYB 1DGJA 4P6VF 1XLPA 3DWGC 1E0ZA 1F0ZA 3AECB 2N0SB 3AH7A 4WWMA 1JRPA 1SIJA 5AUKA 2PIAA 2HTME 2JX5A 1ZP0B 3P63A 3P4QB 3ETRA 3AE6B 1L6UA 1OQRA 1PDXA 1N62A 2QJLA 4JWSC 3CWIA 1WXQA 1DOXA 4N6EB 1GTHA 2G1EA 1PFDA 4KX6B 2CU3A 3SFDB 1RM6C 3AEFB 1JW9D 1L6VA 1ZXIA 2PVOD 1NEKB 4YTNB 4YSXB 3B2FA 1N63A 1ROEA 2DBYA 1N60A 2K22A 2OHFA 5AUIA 2BT6A 1NVID 1VJKA 1WGKA 2AX5A 1EWYC 1N5XA 2W3SA 3FC4A 2WDRB 3NVYA 4FXCA 1NENB 2MJEA 1H7WA 3KWLA 3NVVA 3NVZA 4LTUA 3AM9A 1V97A 5G5HA 1JQ4A 1FRDA 2BS4B 1DOIA 1TKGA 2E3TA 2Y5CA 3EUB2 5EE9A 2M19A 2CJNA 3VR9B 1A70A 3ABVB 1KF6B 4YTPB 1XO3A 4US9A 1QOBA 3NRZA 3RPFC 2WQYB 1RWSA 3ZYYX 4C7ZA 3VRBB 3AEEB 1FIQA 1QOFA 3HVZA 1QF6A 3AE8B 1FXIA 2JQRB 2EKIA 4ZHPA 5GXGB 1QOGA 3PO0A 1TKYA 3P4RB 1L5PA 1IUEA 5C3JB 1NI3A 1KFYB 2MH7A 4ZOHC 2Q5WD 5C2TB 1J7CA 1V8CA 3L4PA 1UWMA 2M56B 2L52A 3B9JA 2H89B 3CF4A 1FFVA 2BS3B 3AEBB 1VLBA 2W55A 1KRHA 3AV8A 4JWUC 2PVGC 3AE2B 1FFUA 4YXDB 1CZPA 3AB5A 1QLBB 4YT0B 2WDVB 1GAQB 1QT9A 1GT8A 3FAHA 3SR6A 3W5UB 1E10A 1FRRA 5EE1A 2WU2B 1FMAD 4ZHOA 2MJDA 5EE3A 1SF0A 3HUIA 3SFEB 4IDIA 2FBWB 2W54A 3AE4B 2PKOA 4JX1C 3W9CB 3AE7B 4YSZB 5H92C 1DOYA 4US8A 1CJEA 2WDQB 1YQ3B 4YTMB 3W5VB 3AN1A 4N58A 4N59A 1NYRA 2QIEB 1AWDA 1VDVA 5G5GA 2W3RA 1J7AA 2CJOA 1T3QA 2L83A 3AE3B 2BS2B 1TYGB 1WYGA 1YQ4B 3CIRB 1RFKA 2ACZB 3AMZA 3AEGB 3VRAB 2WLBA 4A9AA 1JROA 1N61A 1ZOYB 1PUTA 5H8YE 1GPXA 1FM0D 1AYFA 2WP9B 2K5PA 3NS1A 3NVWA 1JWAD 1H7XA 3LXFA 2H88B 1E9MA 1XLQA 2MJ3A 3AEDB 1L0VB 1SB3C 4WQMA 5MPOA 1FXAA 1JWBD 3BIID 1ZUD2 4ITKA 3AE9B 1OFFA 1WWTA 1XLOA 2DWQA 3AE1B 3DWMA 1B9RA 1FO4A 3AEAB 3P4PB 2B76B 1I7HA 3AE5B 1E6EB 1NYQA 2KAJA 3LB8C 1GTEA 4HRSA 1OQQA 5EE0A 1YJJA 4C7YA 1TKEA 2WS3B 3P4SB 1XLNA 2K9XA 4USAA 1N5WA 3WCQA 3P1MA 1YJIA 3B2GA 4HROA 2KMMA 1WRIA 1RYJA 4C80A 1R7SA 1JALA 3HRDD 1J7BA
chains in the Genus database with same CATH superfamily
1DGJA 1WMHA 2N0SB 1I4PA 1HTOA 2PIAA 3V6EB 4BKSA 4ANUA 2QDFA 3RULA 1PDXA 4KZCA 1GTHA 2G1EA 3AU5A 2CKHB 1PFDA 1T0YA 3URYA 3APCA 4WWPA 4NJCA 1NDDA 2PEAA 2GBMA 1EWYC 5AZHA 1NENB 2BWES 2KQ4X 2M0AA 2R2QA 4RFBA 2BB5A 5T8IA 2ZEQA 3DBHB 3Q2AC 1RFAA 5BYSA 4B6WA 2L0TA 4I6NB 2DYMA 4NJ7A 1MHHE 4ZHPA 2N9EB 3N30A 3L08A 3DHHC 3RYTA 2BQQA 3KH0A 2FUG1 3VTVA 1UWMA 3P42A 5DPTA 2Z0EB 1GUAB 2VH1A 1C4AA 1L2NA 3RNFC 2V3PA 4ZHOA 2C60A 3SFEB 4ANXA 1UGMA 2KDFB 2JXXA 2MX2A 4IM2A 1D4BA 3WALA 1KH0A 2JYEA 4EEWA 2MEKA 2N9LA 3MJWA 4DHZB 3QC8B 4NNJB 2WHIA 1J0GA 1HQRD 1H7XA 2BYEA 5E6JA 2KZRA 1WX8A 4RGMA 3LB8C 4RH6A 3TEYA 2GB1A 1XF5L 2D3GA 4C00A 1HZ5A 1N5WA 1L0XB 1VZ7A 3PHWB 2INDC 3RNBC 4YL8A 1NBFC 2KVZA 4LJPB 2L8JA 3UQBA 1F0ZA 3DBLI 4K81A 1K8RB 4GDKB 5AZGA 4D2KA 1Z5SB 2L05A 2B3AA 3NZUA 2INCC 1DOXA 2KDIA 4N6EB 1ZXHA 3AEFB 1ZXIA 3EGRA 3HIZA 4EZJA 4NPNA 2DBYA 3HM6X 4HWIB 2BT6A 1WGKA 2AX5A 4LK0M 4LNFA 2MJEA 2RDBC 1V97A 5E6PA 3IXSA 1IYFA 3PZ7A 1F1HA 4P16A 1XCTL 3ECIA 2WQYB 2ZVOA 3AE8B 1FCLA 5J2RA 1WMHB 4DXAB 1Y56A 1TKYA 3P4RB 5I4DA 2MRPA 4NZLB 2Q5WD 2N7EA 3QJZA 2IO0B 4KKJA 4HKZE 4BKGA 3EHVA 5HG2A 4FADA 1LO5D 4AJYB 2KNBA 3PVLA 2ASQA 5LLIA 1EF1A 3IAS1 1YN4A 1QILA 4TSSA 1VDVA 4B95A 2XNAC 3AU4A 2IBIB 4F1SA 3VH4B 3PLVA 1AYFA 2CHXA 3NS8A 2MSED 2QHOA 3AE9B 1IPGA 1OEYA 3IVFA 3JSVA 3ZJTA 1WGHA 3H1UA 3QAQA 1FO4A 1GC6A 2HE7A 3AE5B 1E6EB 2KAJA 2DX5B 3HK0A 4REZA 3L54A 1BUIC 1C4PA 1WZ3A 1YIWA 2HD5B 4MJSA 2BWFA 4N9F4 3ZO5B 3HRDD 3WAMA 1K52A 2FUHB 2DZKA 1WXQA 2NBVB 2ZNVB 1Z2MA 2Z0DB 4E3CA 3EECA 2N1VA 2G9HD 3AXCA 2N4FA 3OLMD 3Q69A 2LI5A 1D5ZC 5EE9A 2CHWA 2MBBB 1WH3A 1FEHA 3ZW3A 5CX3A 4A6QA 3HVZA 3A1QA 1QZEA 2BTEA 2IO3B 3NY5A 4XWTA 3GB1A 3BK1A 5C3JB 3A9KA 4KGRA 4HKQA 3L4PA 4ANVA 5AZFA 4GU2A 1FFVA 3AV8A 2AQ3B 3B08A 1GC7A 1NI2A 4W9EA 4DQOC 1ET6A 2XEWA 2BKRB 2RPVA 4LDTD 1U4AA 3HUIA 3DBRI 1BMLC 2JRHA 4HPPA 1ESFA 4DDID 4LNIA 2CS4A 2ZCCA 3OG5A 2I1KA 2J42A 1SJED 3AN1A 3KYDD 4S0RA 4RCOA 3U2SC 2LXAA 4GGQA 1JROA 4WWMA 1AARA 4WH4A 2PPHA 1UZXB 4KDLB 4PK1A 2LXCA 1SGHA 4PS3A 2K9XA 3TSSA 4TQ0A 5CTRC 1ISNA 2MP2A 3JYUA 1JALA 1UELA 1TS4A 4BVUC 2JXTA 2Y5PA 4FULA 2IY0B 2FCMA 2ZW1A 2FIFA 3P63A 4URKA 2CU3A 1RM6C 3PO0A 1L6VA 1KM7A 1ROEA 4IWQA 3JSVB 4QAYA 1NVID 2NTTA 2YVCA 2MA9B 3FKYA 1YJ1A 2IPKD 4MJSB 3EUB2 3IT6B 4K7UA 1ET9A 1T5XD 4US9A 2Z59B 1DYQA 1QOFA 4GSWA 3A4RA 4XE0A 1QOGA 2WXOA 4Q2JA 3A4SC 4TQ1A 2KTRA 2KD0A 5DCNA 2MHJA 3ZNHB 1HA5A 2H89B 1VR9A 1R4MB 3RT3B 5IO9A 2PVGC 4ACFA 2V9HA 3AB5A 3RZWC 2IO1B 3W5UB 2QSDA 3RUIB 1CMXB 3SHQA 4MSMB 4XC2A 4C56C 4HLEA 3TEZA 2NBWB 3BY4B 4IDIA 2O6VD 4YSZB 2NR2A 2BYFA 4EKUA 3OWEB 1CJEA 2OEDA 1E8YA 1TT5B 4H2AA 3PHXB 3A1QB 2W3RA 1J7AA 3DCGA 1YQ4B 2WXLA 3A9KB 1WE6A 1Q10A 3LJ3A 1JWUD 3DBLB 1WX9A 3N1YC 1EWCA 4WIPA 1C76A 4A9AA 3D32A 4DXFA 3NS1A 2KLCA 1YOVB 4LNNA 5D6JB 3PLUA 5G2NA 1WZ0A 1ZUD2 4MGZE 2EMTA 1B9RA 1TBEA 3H7PA 4ZRKA 2ZZPB 2RR9A 1KOTA 3ZVVA 4USAA 1M4VA 1MPEA 1LXDA 1GNUA 2K6QA 3ML9A 4WJQA 1I4HA 2E6XA 3PPAA 4HROA 2J53A 4ZRJA 2KMMA 3UF8A 4XDCA 3JVZX 1J7BA 5JH5C 4AWJA 2C7NB 1MVKA 1D6EC 2LUEA 2KJHB 4RF1A 4O1NA 3SFDB 3H8HA 2WYQA 3LDZE 4YSXB 3EFUA 3MHSD 1N60A 3NHEB 1UF0A 4WJOA 1H7WA 3NVZA 3ENEA 1SE2A 3WAOA 1KTKA 3DHGC 1A70A 1TIFA 2ON8A 4MM3A 1QOBA 4C7ZA 3VTWA 1WY8A 1F77A 2KN5A 1FCCC 1IGDA 1T6BX 4KDIC 2KQSA 2K8CA 2L52A 3AEBB 2W55A 4HCPB 2GLSA 1WGDA 4PT5A 4TMAB 1SXTA 4BOZB 3MHZA 1GAQB 4K3CA 4W9FA 2BGFA 4RGTA 2LGDA 2C7MB 2MJDA 2UYZB 4DHZE 3L13A 1V5TA 2FBWB 1DOYA 1C77A 1X1MA 3R7RA 2WXQA 5G55A 1WIAA 4GDLA 4FJZA 1TZ1A 3I57A 2KTRB 1WXMA 3EFCA 1PGAA 4E71A 4A90A 2AL6A 3UIOB 3HHMA 1D5MC 2ZJDA 5L95C 4OW0A 4BZAA 3WCQA 1WI0A 3L0WB 2LVOA 1RLFA 3LYYA 2G4SA 3T9LA 4FHKA 3T3OA 2EMSA 3VR8B 4HJGE 2WU5B 1WJNA 1EUVB 2IZVB 1TGZB 2D3AA 2OJRA 5C1ZA 3MTNB 1FNUA 4JWSC 1YN5A 2GOWA 2VZKD 1M94A 4HK2A 4HDQA 3V05A 3WA0A 3ZJVA 4YTNB 4ZYSA 4KV2A 1E7UA 3H7PB 2OHFA 4M8MA 2LUMA 2DYOA 1DOIA 3VXWA 2Y5CA 2BF8B 3VR9B 4NAMA 3X0WA 4KSLC 3DBRB 1WJUA 1WX7A 3L16A 3VRBB 3ML8A 1HE8A 4G50A 1HXYD 1V9JA 1PGXA 3V62A 4CO7A 4JGHB 3Q8BA 2L76A 1BT0A 3ZUNA 2D3BA 3V61A 5CHWA 3ZLZA 2QMTA 4PYZA 2WXRA 2JUOA 5EE1A 3K9PB 4LNOA 4C4VB 4P1BC 4JX1C 2KQ7A 4MM3B 4N58A 1YX6B 1RAXA 2QIEB 3Q3MC 3UGBB 3WIMA 1MI0A 3N9YC 1QQRA 3AEGB 4BKTA 4I6PA 4IG7B 4F8CB 2KDMA 2PLPA 1N61A 3Q3FA 1MG8A 1WGGA 3DBSA 2SEBD 3MC8A 2BKFA 4B0EA 2BW2A 4IM0A 5FR3A 3RFZB 3TMPB 3P4PB 2MWSB 1FNWA 3O13A 4W9LA 1WGRA 1XEEA 2JWZA 4JLCA 2YLMA 5HI1A 2LEKA 2J0MA 1E7PB 4GDLB 4YSYB 2WXHA 4P6VF 4BOSC 1LFDA 5J17A 1H8CA 2JX5A 2LHDA 5LXIB 1L4ZB 4NJ6A 2KK8A 2I38A 1P3QU 3EA6A 4XX5A 2FCNA 4FJVB 4HPMB 2V3NA 3VUXA 4ARIA 3NVVA 2WXFA 2XBBC 1TKGA 3W2DA 1SE9A 2PW9A 2KXJA 3PTFC 1EU3A 3Q8FA 3ZYYX 1FIQA 2K25A 2CHZA 1S1QB 1WJ4A 4ASWC 1KFYB 4HEA1 4ANWA 2D10A 3KQ4A 1B1ZA 3QARA 4YXDB 2M8SA 3T3NA 4J3OD 2RDGA 1T0RC 3M95A 2R2OA 1WM3A 4EOYA 2HDEA 2M0XA 4MDKE 1LM8B 1WXAA 2WXNA 3I3TB 3PRMB 1AWDA 1E8XA 1EU4A 2L83A 4DXGA 2JY6A 2NBUA 3VRAB 1FM0D 3L10B 3NVWA 2MJ3A 4DHJD 4K7WA 4W9JA 1JCKB 1WWTA 1T0QC 3APDA 1GTEA 4HRSA 3Q8AA 4FBJB 1L0YB 1D5XC 5HKHA 3BYYB 2MLBA 3NJTA 4PS7A 1P7FA 3MC0B 2C9WB 3ZNID 1TS5A 2ZPNA 3RMKC 1P0RA 1TS3A 3SU8X 1F2RI 2IGGA 1ZP0B 3FILA 1ZGUB 2KC2A 3VAWA 2FCSA 4TUUA 2WXMA 3R2TA 1IBXA 5EDSA 3NOBA 3RZFA 4MGIE 1N5XA 4LTUA 4S17A 3V3XA 1JQ4A 2LASA 1XQQA 3VUYA 1V80A 1EM7A 3RCZA 2PTLA 4W9IA 3ZXVA 2N9KA 2L7RA 2ZPYA 4B9KA 2DZJA 3QHTA 3R2IA 4OZCA 3NRZA 4JIOU 4AUQC 2KOXA 1V81A 5GXGB 1P7EA 1SE3A 4L1BA 4KKIA 3RD2A 3ZNZB 2IJ0A 1J7CA 3UI3A 2LRWA 3CSFA 3DVNU 1KRHA 1S3SG 2K0PA 2N1WA 4HCNB 3Q8EA 2GMIC 2HJ1A 4EZKA 4FLHA 1V2YA 5D3IB 2WDQB 1JWMD 2FE8A 1Y8RC 2JU6X 1UH6A 2CJOA 2DYBA 2RSUA 3EC8A 3O65B 1RFKA 2ACZB 3IG3A 2LVQA 1ZDXA 1MFWA 4KZ0A 4J6IA 2KYWA 2K5PA 2WP9B 3KUCB 2H88B 3IT4B 1L0VB 1FXAA 2XN9C 1OFFA 3U30A 1V1PA 4HJKA 2B76B 1I7HA 3PGEA 2ZCBA 2JVCA 3DVGX 3SDLC 4TV3A 3R7QA 3GS2A 3GZNB 2KACA 2HJ8A 3ZTDA 2LZ6A 3RNCC 1GB1A 1C79A 2NS5A 1ZPSA 1KLGD 2REXA 4WJPA 1CQVA 3BVGA 4RMAA 2LGXA 1FXTB 4KX6B 2Y5BB 3TBLD 3SD5A 2W3SA 1F9JA 1WM2A 4W9GA 3IBEA 2TSSA 2AQ2B 5D3DA 1XO3A 3Q14C 3MP9A 5DPRA 1RRBA 3Q3JA 4GMVA 5C23A 1SBBB 5D2MB 3FILB 3S2AA 4JL9A 3Q3NC 5IA7A 1MHXA 3W1SA 5AEKB 3A9JA 5JZEB 4NAWA 1IBXB 4ARCA 1A5RA 3M3JA 1KLVA 4W9CA 3GE3C 1QLBB 2N9XA 2WDVB 1HZ6A 4MH8A 4GN1A 2KLGA 4WQOB 3W1SC 1F2RC 3IHPC 1FMAD 1SF0A 2GBRA 4WWNA 1JMLA 2L00B 1YQ3B 3W5VB 5KHOA 3WANA 4L2YA 1NYRA 3QQ8B 2DZIA 1TS2A 1K50A 2KDEB 1WR1A 3UINB 3ZQ4A 3JW0X 2VZKB 4M01A 4ZDVA 3MFGA 1SB3C 1ZDVA 1PQSA 1JWBD 4RM8A 3ZKJC 5J18A 1UNSA 3IFWB 4IC7B 2M1MA 1JRUA 3Q6BA 5BMHA 2RMMA 1WXSA 1R7SA 3AM9A 2M17A 3PV1A 3APFA 3DWGC 1E0ZA 2D07B 4OVVA 5AUKA 1I4QA 2HTME 2LFIA 2KX0A 3CF6E 2K3UA 3CWIA 5CHFA 2AQ1B 2IGDA 3TCAA 4W9DA 1SIFA 1YMHE 4EFOA 1YQBA 1VJKA 4K3BA 3H9DA 2I1JA 3K9OB 5G5HA 2L3ZA 3I9V1 3H6NA 2MBEA 1RWSA 2INNE 3AEEB 1VD2A 1FXIA 2PMVA 3DVNV 4JPSA 2ZW0A 4R3DA 2QILA 1NI3A 1WRDB 4KIKA 2IYDB 2G4DB 4OZBA 2KWDA 2PE6B 3ZJUA 1UGJA 2LJIA 1WFYA 1QT9A 1GT8A 1FRRA 2MP2B 5EE3A 1I35A 5DPWA 3AE4B 2KWCA 4IOIE 3AE7B 1PGBA 2X38A 2CR5A 2D2QA 5G5GA 1YNTE 4GOCA 1ZW7A 1J8CA 2JPHA 3TJPA 3Q8CA 5CHVC 1C9FA 2DENB 3A9JB 4NAWB 2KN4A 3AULA 2J52A 1UD7A 5MPOA 4NQLB 1XLQA 2KWVB 2WXGA 3KUDB 3KUZA 3VDZA 4A3PA 4DK5A 1LQBA 2KVRA 3CMMB 4HXDA 4C7YA 1TKEA 2LHEA 2OOBB 1WYWB 1RYJA 2K8HA 4NY0A 3BVMA 3PREA 3AH7A 2XK5A 3OJ3A 4ICUA 3V6CB 3ONSA 3TIXA 3SEBA 4IKGA 5HFYA 4MEMA 3QK0A 1GG3A 2PVOD 2AL3A 5AUIA 4XGAB 4GB9A 2WDRB 3NVYA 3N32A 4ZRPA 3B0AA 2KX3A 3VHTC 2BS4B 3R3MA 1OQYA 2V3SA 4W9HA 3PZDA 1QF6A 4AP4C 2JQRB 2EKIA 3U7ZA 3TEWA 1L5PA 1WF9A 1V1OA 1IUEA 1TY0A 2ONQA 1Q0WB 4GXBA 4ZOHC 4P1CC 1YD8U 3VTUA 2WX1A 2SAKA 2VRRB 3B9JA 3Q3OC 1C4CA 1WXVA 2NPTA 4JWUC 4DHJB 1PYWD 4YT0B 1WJ6A 2BBCA 4LCDE 4WJNA 2DHZA 2W54A 2KHWB 4EUTA 1EF5A 1OEYJ 2BVCA 2KJRA 2V1YA 1MG4A 2G45B 1KLUD 2WDTB 1VZ6A 2K6DB 2INPE 4KIKB 3UQAA 4KGSA 2WWZA 3PSEB 2BPSA 1KJTA 4A55A 2C7HA 3BIID 4JE3B 2KO3A 3AE1B 3DWMA 1VZ8A 2ICIA 2FAZA 1OQQA 5EE0A 1SE4A 2WS3B 3P4SB 2LGSA 4OZAA 4IW0A 1YJIA 4MELA 2YEPF 3U7DA 1WRIA 3C8YA 3DVGY 2WXIA 4RGNA 3QX1A 3MC9A 4BBNF 1L6UA 2JYTA 4EZLA 3B1LX 2QC8A 4AJWA 1CK1A 1NEKB 5GMVA 1K51A 2O6VA 3BWUD 2K1FA 4M8NA 3OAWA 2M19A 1I4GA 3ZTCA 5DPSA 2FNJB 4K1RB 3RNEC 1E8WA 3VQIA 3BVZA 1QKZA 3ZDTA 2KT7A 2EELA 1LGRA 2XK5B 3KLSX 3WAPA 2V4IB 2MH7A 2DAJA 1WSPA 2JZZA 4W9KA 3T8MA 2BS3B 2WXJA 4HVBA 1R4MI 1CZPA 2WX0A 4LDTB 1BXTA 4M02A 1I4RA 3W1YA 2ZVNA 1AN8A 2J4XA 2PKOA 4MH0E 4YWGG 4ZRQA 2ZNVC 2LMCA 4PYUA 3R66C 3A33B 5FKAC 2BS2B 5TR5A 2W9NA 1MJDA 2FIDA 3DOWA 2K8BA 2WLBA 3N1ZC 1PUTA 1ZOYB 2NPTB 1JWAD 3PRPB 1WR6E 1C1YB 2GBJA 5HHDG 4LJOB 4FA6A 1JWSD 5BO4B 3BZDB 2MW5A 4RGOS 2Y3AA 3KW5B 2WXKA 4ICVA 2KFJA 1XLPA 3AECB 4B0MA 5JXVA 1R4NI 5BMIA 1UBQA 3DQVA 2N7DA 2JT4B 3P4QB 4IM3A 3NZ3A 4X57B 1N62A 4WWOA 5BMGA 1N63A 4RF0A 1OTRB 1T0SC 3N1XC 4FN2A 4IWOA 2BYTA 3U8ZA 4BBNC 1FRDA 2JRIB 1J19A 2MBOA 3C19A 3RN9C 2D3CA 3M62B 1ENFA 2KMCA 4II3B 4XZ4A 4UDUC 2DAFA 4MGKE 4OVZA 4F7ZA 1HTQA 2R61A 1E8ZA 1V6EA 3TL5A 1UBIA 1IGCA 3SR6A 3E56A 2O6VB 4KSKC 2N9PC 3DHIC 2KKCA 3VUWA 3UIPB 3PS6A 4YTMB 2MCNB 4M00A 4MGYE 4A20A 1WYGA 3AMZA 3DDCB 3BINA 4TKNA 2X8XX 3ZRFA 4GIVA 1XLOA 2BYVE 2DNFA 4IUMB 1NYQA 3X23A 1XLNA 1GOZA 3ZIMA 2J0KA 2AYOB 4NQKE 5FK9C 4I6LB 4II2B 2D11A 2IY1B 2QCZA 2WXPA 1Q5WB 1JRPA 2HTHA 1VCBA 2NTSA 1AW7A 3J9CA 3N3KB 4CYEA 1WE7A 5FR6A 2QJLA 4L23A 1ACCA 2KJ6A 5IP4D 5BYQA 2KWUB 1TY2A 3R8BA 4HPLB 3H7SA 1YN3A 3KYCD 1KF6B 5JHBA 3E9SA 3RPFC 4DBGA 3VVWB 1V86A 2GRIA 2YEPB 2CU1A 1IP9A 4WAFA 1G6JA 1TTNA 5TSSA 3VFKA 2K39A 3VH3B 5KHQA 5C2TB 4K7SA 2G3QB 2M56B 4M0WA 3ZNGC 2LGIA 3FAHA 3DBHI 1I4XA 2NMQA 4FJYA 2RDHA 2WGSA 1XXGA 2OJWA 1XCQL 2J7QB 1L7YA 3U52E 2NVUI 3IAM1 5D7GA 3W9CB 2KFKA 2O2VA 1SSNA 2UU7A 4N59A 3BYTB 2GI9A 3QCAA 4HDOA 5BYRA 4BKSD 4E74A 3CIRB 2KDBA 4A3OA 1STEA 2JSVX 2LWPA 1C78A 1H4RA 5H8YE 1FNVA 2DZMA 4WURA 5LXHA 3V60A 2VH2A 4KGTA 5E6NA 2EKEC 2KTFA 4LLGM 4P7IA 5IAAC 2JZ3B 1YJJA 1P9DU 3ZDMC 1D3ZA 2KC1A 3B2GA 3RI7C 2IDYA 4LNKA 1TJEA 3P2BA 1QOAA 3PT2B 3PRZA 4A8XC 5JHAA 3ETRA 3ZRCA 4PS8A 3U4EG 1JW9D 3ALBA 3B2FA 3GOEA 3FC4A 4G3XB 3L17A 2LVPA 2JZPA 3ZGZA 3RNAC 5IOIA 2E3TA 1C3TA 1ZE3D 2Z8LA 2FCQA 5L83A 3ABVB 4YTPB 1EO6A 2QEJC 2PE9A 2AWTA 3I63C 4XWWA 2IGHA 1V5OA 3HVDA 4MSQB 1V1PB 4AOFA 2KANA 3AE2B 4EE2A 1XT9B 1E10A 3C0RB 2KMAA 2WU2B 5E6OA 1L4DB 3MJ5A 2RGFA 2RPQA 4MACA 4KVGB 1P1AA 5H92C 3NZSA 4US8A 4MT5A 3KVFB 3N20C 2J0JA 1V49A 1T3QA 3DPDA 3AE3B 4OVUA 2GBNA 2MBQA 2M4NA 1R4NB 1OGWA 2A4ZA 4M0WB 2C5LC 3LXFA 1E9MA 1GJZA 2L0FA 2MQJA 2JF5A 2WNMA 3BK2A 4ITKA 3AEAB 1HEZE 1XD3B 1UUPA 1F52A 4FHJA 3TEXA 3QIJA 2KFKB 1N6ZA 2O2VB 4C4VA 4RM9A 1SIJA 2RD0A 4CHKA 1YX5B 3AE6B 1OQRA 4ZYNA 4XYCA 2NCNA 3AI5A 2IO2B 3GE8C 2LRUA 2DLBA 1TZOA 3HM3A 1ZKHA 2K22A 1FD6A 4FXCA 3KWLA 4G0NB 2LGYA 4XDDA 2N7JA 5D94A 4BAXA 2CJNA 2A5UA 2JWUA 3M63B 4DDGD 1SJHD 4ZRIA 4RNAA 3OJ4B 2D5GA 1E90A 3QA8A 4JQWC 3NG0A 4WAAA 4BFRA 1E7VA 3NUHB 2AEHA 3CF4A 2MBHA 1VLBA 1FFUA 1UWXA 2I2YA 2V4LA 2L32A 4IWPA 4G11A 4OHJA 4CQNA 2PJHA 3RNGC 1WGYA 3TUOA 2LJ5A 3PZ8A 4AQ7A 2W82A 2BB6A 4GDKA 1TYGB 3I5JC 3KWVA 1K53A 4AS1A 1VRAB 3QWZB 5LNK1 4DWFA 1Q1OA 1GPXA 3CSTA 5IN7A 4WQMA 3AEDB 2V0GA 4GLSC 2LD9A 2DWQA 1P98A 2L1AA 3GP7A 2GBKA 3P1MA 1E5WA 1FPYA 2UWQA 3GZNI 5IKCM 4C80A 3ZXRA 1SEBD 1V8CA 1GB4A 1I42A
chains in the Genus database with same CATH topology
1ZPSA 1DGJA 1XLPA 1KLGD 3AECB 2N0SB 4B0MA 1I4PA 5JXVA 5BMIA 2PIAA 1CQVA 3P4QB 3BVGA 3NZ3A 1MVKA 1N62A 1PDXA 1D6EC 1GTHA 2G1EA 1PFDA 4KX6B 3URYA 4RF1A 4O1NA 3SFDB 3H8HA 5BMGA 4NJCA 4YSXB 1N63A 1N60A 4RF0A 1EWYC 2W3SA 1NENB 1H7WA 3NVZA 2KQ4X 2M0AA 4RFBA 2BYTA 1SE2A 1FRDA 2BB5A 5T8IA 5BYSA 1KTKA 2TSSA 2AQ2B 1A70A 5D3DA 2ON8A 1XO3A 1QOBA 2DYMA 3MP9A 4C7ZA 1ENFA 1MHHE 1F77A 4ZHPA 1SBBB 1FCCC 1IGDA 3FILB 1T6BX 1MHXA 2FUG1 4UDUC 1UWMA 3W1SA 2L52A 3P42A 1IBXB 3AEBB 2W55A 4ARCA 4PT5A 4TMAB 1SXTA 4OVZA 2R61A 1QLBB 2WDVB 1C4AA 1GAQB 1IGCA 1HZ6A 3E56A 3MHZA 4MH8A 4RGTA 3SR6A 1F2RC 2V3PA 1FMAD 4ZHOA 2MJDA 1SF0A 3SFEB 1JMLA 2FBWB 1DOYA 1C77A 1YQ3B 4YTMB 3W5VB 4L2YA 2WXQA 1NYRA 1D4BA 1TS2A 1KH0A 2JYEA 1WYGA 3I57A 2MEKA 1K50A 3AMZA 2N9LA 1PGAA 3ZQ4A 4A90A 2VZKB 1HQRD 1H7XA 3MFGA 1SB3C 1ZDVA 5E6JA 1JWBD 1D5MC 1XLOA 4RGMA 1UNSA 1NYQA 3LB8C 4RH6A 3TEYA 2GB1A 1XF5L 4OW0A 1XLNA 1GOZA 3WCQA 1HZ5A 1N5WA 1L0XB 5FK9C 1VZ7A 3LYYA 5BMHA 2RMMA 1R7SA 3AM9A 3T3OA 3VR8B 4HJGE 2WU5B 1F0ZA 3DWGC 1E0ZA 2WXPA 4GDKB 1JRPA 4D2KA 2NTSA 5AUKA 1I4QA 2HTME 1AW7A 3J9CA 2LFIA 2K3UA 4JWSC 1FNUA 2QJLA 1YN5A 3CWIA 2VZKD 1DOXA 4N6EB 2AQ1B 1ZXHA 2IGDA 4L23A 3V05A 3AEFB 1ZXIA 3ZJVA 1ACCA 4YTNB 3EGRA 4ZYSA 1YMHE 2DBYA 2OHFA 2BT6A 1WGKA 1VJKA 2AX5A 4LK0M 5BYQA 2MJEA 2LUMA 2DYOA 1TY2A 3R8BA 1V97A 5G5HA 1DOIA 2Y5CA 3IXSA 3PZ7A 4P16A 3VR9B 3I9V1 1XCTL 1YN3A 4NAMA 1KF6B 3E9SA 3RPFC 2WQYB 1RWSA 3VRBB 2INNE 3AEEB 2GRIA 2YEPB 3AE8B 1FCLA 1FXIA 2PMVA 4WAFA 4JPSA 5TSSA 2ZW0A 1HXYD 1Y56A 1TKYA 3P4RB 2QILA 4R3DA 5I4DA 1NI3A 4NZLB 1PGXA 2Q5WD 5C2TB 4OZBA 3Q8BA 2M56B 2KWDA 3ZJUA 1UGJA 4M0WA 2LJIA 2LGIA 4KKJA 4HKZE 2QMTA 2WXRA 1QT9A 1GT8A 3FAHA 1I4XA 5HG2A 1FRRA 5EE1A 2NMQA 1LO5D 5EE3A 2RDHA 1XXGA 1XCQL 3AE4B 3IAM1 5D7GA 4JX1C 4IOIE 3U52E 3AE7B 3W9CB 1PGBA 4MM3B 3IAS1 2X38A 1YN4A 1QILA 4TSSA 4N58A 1SSNA 4N59A 2QIEB 1VDVA 5G5GA 1YNTE 3BYTB 2GI9A 5BYRA 2XNAC 1MI0A 3CIRB 3N9YC 3Q8CA 1QQRA 3AEGB 1STEA 1C9FA 2JSVX 2KDMA 2PLPA 1N61A 1C78A 5H8YE 1FNVA 4NAWB 4WURA 1AYFA 2KN4A 2J52A 2SEBD 5MPOA 1XLQA 4KGTA 2WXGA 3AE9B 4B0EA 2BW2A 5FR3A 4LLGM 3RFZB 1FO4A 3ZJTA 3P4PB 3AE5B 1E6EB 2KAJA 4REZA 4C7YA 1YJJA 1BUIC 1C4PA 1TKEA 1FNWA 2LHEA 3O13A 3B2GA 2IDYA 1XEEA 1RYJA 3HRDD 1TJEA 1QOAA 5HI1A 1K52A 2LEKA 1E7PB 3BVMA 4YSYB 2WXHA 4GDLB 4P6VF 3AH7A 4A8XC 2JX5A 2LHDA 3ETRA 1WXQA 3SEBA 4IKGA 5HFYA 3U4EG 1L4ZB 2PVOD 1JW9D 3B2FA 2I38A 3EA6A 5AUIA 2G9HD 3FC4A 2WDRB 2V3NA 3NVYA 4ARIA 4ZRPA 3NVVA 2JZPA 3ZGZA 2WXFA 3Q69A 2BS4B 1TKGA 2E3TA 1D5ZC 5EE9A 1ZE3D 3W2DA 2Z8LA 2PW9A 3ABVB 4YTPB 1FEHA 4A6QA 1EU3A 3Q8FA 3ZYYX 2QEJC 1FIQA 3HVZA 1QF6A 2JQRB 2EKIA 3U7ZA 2BTEA 4XWTA 3GB1A 4XWWA 3TEWA 1L5PA 2IGHA 1V1OA 3BK1A 5C3JB 1IUEA 1TY0A 1KFYB 2ONQA 3HVDA 4ZOHC 4KGRA 1V1PB 3L4PA 4HEA1 4HKQA 2SAKA 3B9JA 1FFVA 3AV8A 1C4CA 4JWUC 3KQ4A 3AE2B 1B1ZA 2AQ3B 4YXDB 1PYWD 4EE2A 4YT0B 3T3NA 4DQOC 1E10A 1ET6A 4J3OD 2BBCA 2WU2B 1L4DB 2RDGA 2RPVA 3MJ5A 4MACA 3HUIA 1BMLC 1ESFA 2HDEA 2W54A 5H92C 4US8A 2WXNA 4MT5A 2J42A 1SJED 3AN1A 1AWDA 1KLUD 1EU4A 1T3QA 2L83A 4DXGA 3AE3B 1VZ6A 2INPE 4RCOA 3U2SC 3VRAB 4KGSA 1JROA 1FM0D 4WWMA 3NVWA 3LXFA 1E9MA 2MJ3A 2WNMA 4A55A 4WH4A 3BK2A 3BIID 1JCKB 4JE3B 4ITKA 1WWTA 3DWMA 3AE1B 3AEAB 1HEZE 1VZ8A 2ICIA 1GTEA 4HRSA 1OQQA 3Q8AA 1UUPA 5EE0A 1SE4A 2WS3B 3P4SB 1L0YB 2K9XA 3TSSA 1D5XC 4OZAA 3BYYB 4TQ0A 3TEXA 1YJIA 1P7FA 2YEPF 3MC0B 1WRIA 1JALA 1TS5A 1TS4A 3C8YA 2JXTA 2Y5PA 2WXIA 4RGNA 1TS3A 1SIJA 1F2RI 2IGGA 2ZW1A 1ZP0B 3P63A 3FILA 3AE6B 1L6UA 1OQRA 2JYTA 2WXMA 3R2TA 1IBXA 2DLBA 1CK1A 2CU3A 1RM6C 1TZOA 1L6VA 3PO0A 1NEKB 1ROEA 2K22A 1NVID 2NTTA 1FD6A 1N5XA 1K51A 4FXCA 4LTUA 3KWLA 3BWUD 3V3XA 1JQ4A 2IPKD 4XDDA 2N7JA 3EUB2 1EM7A 2PTLA 3IT6B 2M19A 1I4GA 2CJNA 2N9KA 1ET9A 1T5XD 4US9A 3R2IA 2JWUA 4OZCA 3NRZA 3VQIA 1SJHD 3BVZA 4RNAA 1DYQA 1QOFA 1QKZA 2EELA 5GXGB 2D5GA 4XE0A 1P7EA 1QOGA 1SE3A 2WXOA 3KLSX 4KKIA 4L1BA 4Q2JA 4TQ1A 2V4IB 2MH7A 2IJ0A 1J7CA 3UI3A 1WSPA 3NUHB 1HA5A 2H89B 3CF4A 1VR9A 2BS3B 1VLBA 2WXJA 1KRHA 2PVGC 1FFUA 1CZPA 1UWXA 2K0PA 3AB5A 2I2YA 1BXTA 3W5UB 2QSDA 3Q8EA 1I4RA 2L32A 4OHJA 4C56C 3TEZA 4IDIA 4CQNA 1AN8A 2J4XA 2PKOA 4YSZB 5D3IB 3OWEB 2WDQB 1CJEA 2OEDA 4YWGG 3TUOA 1JWMD 3PZ8A 4H2AA 4ZRQA 2FE8A 2LMCA 4AQ7A 2JU6X 2W3RA 2W82A 2BB6A 1J7AA 5FKAC 2CJOA 1TYGB 2BS2B 1YQ4B 2WXLA 3KWVA 1Q10A 2ACZB 1RFKA 1JWUD 1ZDXA 1EWCA 1K53A 1C76A 2WLBA 4WIPA 4A9AA 4AS1A 1VRAB 1PUTA 1ZOYB 5LNK1 1GPXA 2K5PA 2WP9B 3NS1A 4DXFA 1JWAD 2H88B 4WQMA 3IT4B 3AEDB 1L0VB 2V0GA 1FXAA 1ZUD2 2XN9C 1OFFA 4GLSC 2DWQA 5HHDG 1V1PA 1B9RA 2B76B 1I7HA 2L1AA 3GP7A 1JWSD 4USAA 1M4VA 1MPEA 3GS2A 2KACA 3P1MA 3BZDB 4RGOS 1I4HA 2E6XA 2Y3AA 4HROA 2J53A 2KMMA 2WXKA 4C80A 1GB1A 4XDCA 1SEBD 1V8CA 1GB4A 1J7BA 1C79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR8 B;  1TJE A;  2WU5 B;  1QOA A;  2LEK A;  1E7P B;  4YSY B;  1DGJ A;  4P6V F;  1XLP A;  3DWG C;  1E0Z A;  1F0Z A;  3AEC B;  2N0S B;  3AH7 A;  4WWM A;  1JRP A;  1SIJ A;  5AUK A;  2PIA A;  2HTM E;  2JX5 A;  1ZP0 B;  3P63 A;  3P4Q B;  3ETR A;  3AE6 B;  1L6U A;  1OQR A;  1PDX A;  1N62 A;  2QJL A;  4JWS C;  3CWI A;  1WXQ A;  1DOX A;  4N6E B;  1GTH A;  2G1E A;  1PFD A;  4KX6 B;  2CU3 A;  3SFD B;  1RM6 C;  3AEF B;  1JW9 D;  1L6V A;  1ZXI A;  2PVO D;  1NEK B;  4YTN B;  4YSX B;  3B2F A;  1N63 A;  1ROE A;  2DBY A;  1N60 A;  2K22 A;  2OHF A;  5AUI A;  2BT6 A;  1NVI D;  1VJK A;  1WGK A;  2AX5 A;  1EWY C;  1N5X A;  2W3S A;  3FC4 A;  2WDR B;  3NVY A;  4FXC A;  1NEN B;  2MJE A;  1H7W A;  3KWL A;  3NVV A;  3NVZ A;  4LTU A;  3AM9 A;  1V97 A;  5G5H A;  1JQ4 A;  1FRD A;  2BS4 B;  1DOI A;  1TKG A;  2E3T A;  2Y5C A;  3EUB 2;  5EE9 A;  2M19 A;  2CJN A;  3VR9 B;  1A70 A;  3ABV B;  1KF6 B;  4YTP B;  1XO3 A;  4US9 A;  1QOB A;  3NRZ A;  3RPF C;  2WQY B;  1RWS A;  3ZYY X;  4C7Z A;  3VRB B;  3AEE B;  1FIQ A;  1QOF A;  3HVZ A;  1QF6 A;  3AE8 B;  1FXI A;  2JQR B;  2EKI A;  4ZHP A;  5GXG B;  1QOG A;  3PO0 A;  1TKY A;  3P4R B;  1L5P A;  1IUE A;  5C3J B;  1NI3 A;  1KFY B;  2MH7 A;  4ZOH C;  2Q5W D;  5C2T B;  1J7C A;  1V8C A;  3L4P A;  1UWM A;  2M56 B;  2L52 A;  3B9J A;  2H89 B;  3CF4 A;  1FFV A;  2BS3 B;  3AEB B;  1VLB A;  2W55 A;  1KRH A;  3AV8 A;  4JWU C;  2PVG C;  3AE2 B;  1FFU A;  4YXD B;  1CZP A;  3AB5 A;  1QLB B;  4YT0 B;  2WDV B;  1GAQ B;  1QT9 A;  1GT8 A;  3FAH A;  3SR6 A;  3W5U B;  1E10 A;  1FRR A;  5EE1 A;  2WU2 B;  1FMA D;  4ZHO A;  2MJD A;  5EE3 A;  1SF0 A;  3HUI A;  3SFE B;  4IDI A;  2FBW B;  2W54 A;  3AE4 B;  2PKO A;  4JX1 C;  3W9C B;  3AE7 B;  4YSZ B;  5H92 C;  1DOY A;  4US8 A;  1CJE A;  2WDQ B;  1YQ3 B;  4YTM B;  3W5V B;  3AN1 A;  4N58 A;  4N59 A;  1NYR A;  2QIE B;  1AWD A;  1VDV A;  5G5G A;  2W3R A;  1J7A A;  2CJO A;  1T3Q A;  2L83 A;  3AE3 B;  2BS2 B;  1TYG B;  1WYG A;  1YQ4 B;  3CIR B;  1RFK A;  2ACZ B;  3AMZ A;  3AEG B;  3VRA B;  2WLB A;  4A9A A;  1JRO A;  1N61 A;  1ZOY B;  1PUT A;  5H8Y E;  1GPX A;  1FM0 D;  1AYF A;  2WP9 B;  2K5P A;  3NS1 A;  3NVW A;  1JWA D;  1H7X A;  3LXF A;  2H88 B;  1E9M A;  1XLQ A;  2MJ3 A;  3AED B;  1L0V B;  1SB3 C;  4WQM A;  5MPO A;  1FXA A;  1JWB D;  3BII D;  1ZUD 2;  4ITK A;  3AE9 B;  1OFF A;  1WWT A;  1XLO A;  2DWQ A;  3AE1 B;  3DWM A;  1B9R A;  1FO4 A;  3AEA B;  3P4P B;  2B76 B;  1I7H A;  3AE5 B;  1E6E B;  1NYQ A;  2KAJ A;  3LB8 C;  1GTE A;  4HRS A;  1OQQ A;  5EE0 A;  1YJJ A;  4C7Y A;  1TKE A;  2WS3 B;  3P4S B;  1XLN A;  2K9X A;  4USA A;  1N5W A;  3WCQ A;  3P1M A;  1YJI A;  3B2G A;  4HRO A;  2KMM A;  1WRI A;  1RYJ A;  4C80 A;  1R7S A;  1JAL A;  3HRD D;  1J7B A; 
#chains in the Genus database with same CATH topology
 1DGJ A;  1WMH A;  2N0S B;  1I4P A;  1HTO A;  2PIA A;  3V6E B;  4BKS A;  4ANU A;  2QDF A;  3RUL A;  1PDX A;  4KZC A;  1GTH A;  2G1E A;  3AU5 A;  2CKH B;  1PFD A;  1T0Y A;  3URY A;  3APC A;  4WWP A;  4NJC A;  1NDD A;  2PEA A;  2GBM A;  1EWY C;  5AZH A;  1NEN B;  2BWE S;  2KQ4 X;  2M0A A;  2R2Q A;  4RFB A;  2BB5 A;  5T8I A;  2ZEQ A;  3DBH B;  3Q2A C;  1RFA A;  5BYS A;  4B6W A;  2L0T A;  4I6N B;  2DYM A;  4NJ7 A;  1MHH E;  4ZHP A;  2N9E B;  3N30 A;  3L08 A;  3DHH C;  3RYT A;  2BQQ A;  3KH0 A;  2FUG 1;  3VTV A;  1UWM A;  3P42 A;  5DPT A;  2Z0E B;  1GUA B;  2VH1 A;  1C4A A;  1L2N A;  3RNF C;  2V3P A;  4ZHO A;  2C60 A;  3SFE B;  4ANX A;  1UGM A;  2KDF B;  2JXX A;  2MX2 A;  4IM2 A;  1D4B A;  3WAL A;  1KH0 A;  2JYE A;  4EEW A;  2MEK A;  2N9L A;  3MJW A;  4DHZ B;  3QC8 B;  4NNJ B;  2WHI A;  1J0G A;  1HQR D;  1H7X A;  2BYE A;  5E6J A;  2KZR A;  1WX8 A;  4RGM A;  3LB8 C;  4RH6 A;  3TEY A;  2GB1 A;  1XF5 L;  2D3G A;  4C00 A;  1HZ5 A;  1N5W A;  1L0X B;  1VZ7 A;  3PHW B;  2IND C;  3RNB C;  4YL8 A;  1NBF C;  2KVZ A;  4LJP B;  2L8J A;  3UQB A;  1F0Z A;  3DBL I;  4K81 A;  1K8R B;  4GDK B;  5AZG A;  4D2K A;  1Z5S B;  2L05 A;  2B3A A;  3NZU A;  2INC C;  1DOX A;  2KDI A;  4N6E B;  1ZXH A;  3AEF B;  1ZXI A;  3EGR A;  3HIZ A;  4EZJ A;  4NPN A;  2DBY A;  3HM6 X;  4HWI B;  2BT6 A;  1WGK A;  2AX5 A;  4LK0 M;  4LNF A;  2MJE A;  2RDB C;  1V97 A;  5E6P A;  3IXS A;  1IYF A;  3PZ7 A;  1F1H A;  4P16 A;  1XCT L;  3ECI A;  2WQY B;  2ZVO A;  3AE8 B;  1FCL A;  5J2R A;  1WMH B;  4DXA B;  1Y56 A;  1TKY A;  3P4R B;  5I4D A;  2MRP A;  4NZL B;  2Q5W D;  2N7E A;  3QJZ A;  2IO0 B;  4KKJ A;  4HKZ E;  4BKG A;  3EHV A;  5HG2 A;  4FAD A;  1LO5 D;  4AJY B;  2KNB A;  3PVL A;  2ASQ A;  5LLI A;  1EF1 A;  3IAS 1;  1YN4 A;  1QIL A;  4TSS A;  1VDV A;  4B95 A;  2XNA C;  3AU4 A;  2IBI B;  4F1S A;  3VH4 B;  3PLV A;  1AYF A;  2CHX A;  3NS8 A;  2MSE D;  2QHO A;  3AE9 B;  1IPG A;  1OEY A;  3IVF A;  3JSV A;  3ZJT A;  1WGH A;  3H1U A;  3QAQ A;  1FO4 A;  1GC6 A;  2HE7 A;  3AE5 B;  1E6E B;  2KAJ A;  2DX5 B;  3HK0 A;  4REZ A;  3L54 A;  1BUI C;  1C4P A;  1WZ3 A;  1YIW A;  2HD5 B;  4MJS A;  2BWF A;  4N9F 4;  3ZO5 B;  3HRD D;  3WAM A;  1K52 A;  2FUH B;  2DZK A;  1WXQ A;  2NBV B;  2ZNV B;  1Z2M A;  2Z0D B;  4E3C A;  3EEC A;  2N1V A;  2G9H D;  3AXC A;  2N4F A;  3OLM D;  3Q69 A;  2LI5 A;  1D5Z C;  5EE9 A;  2CHW A;  2MBB B;  1WH3 A;  1FEH A;  3ZW3 A;  5CX3 A;  4A6Q A;  3HVZ A;  3A1Q A;  1QZE A;  2BTE A;  2IO3 B;  3NY5 A;  4XWT A;  3GB1 A;  3BK1 A;  5C3J B;  3A9K A;  4KGR A;  4HKQ A;  3L4P A;  4ANV A;  5AZF A;  4GU2 A;  1FFV A;  3AV8 A;  2AQ3 B;  3B08 A;  1GC7 A;  1NI2 A;  4W9E A;  4DQO C;  1ET6 A;  2XEW A;  2BKR B;  2RPV A;  4LDT D;  1U4A A;  3HUI A;  3DBR I;  1BML C;  2JRH A;  4HPP A;  1ESF A;  4DDI D;  4LNI A;  2CS4 A;  2ZCC A;  3OG5 A;  2I1K A;  2J42 A;  1SJE D;  3AN1 A;  3KYD D;  4S0R A;  4RCO A;  3U2S C;  2LXA A;  4GGQ A;  1JRO A;  4WWM A;  1AAR A;  4WH4 A;  2PPH A;  1UZX B;  4KDL B;  4PK1 A;  2LXC A;  1SGH A;  4PS3 A;  2K9X A;  3TSS A;  4TQ0 A;  5CTR C;  1ISN A;  2MP2 A;  3JYU A;  1JAL A;  1UEL A;  1TS4 A;  4BVU C;  2JXT A;  2Y5P A;  4FUL A;  2IY0 B;  2FCM A;  2ZW1 A;  2FIF A;  3P63 A;  4URK A;  2CU3 A;  1RM6 C;  3PO0 A;  1L6V A;  1KM7 A;  1ROE A;  4IWQ A;  3JSV B;  4QAY A;  1NVI D;  2NTT A;  2YVC A;  2MA9 B;  3FKY A;  1YJ1 A;  2IPK D;  4MJS B;  3EUB 2;  3IT6 B;  4K7U A;  1ET9 A;  1T5X D;  4US9 A;  2Z59 B;  1DYQ A;  1QOF A;  4GSW A;  3A4R A;  4XE0 A;  1QOG A;  2WXO A;  4Q2J A;  3A4S C;  4TQ1 A;  2KTR A;  2KD0 A;  5DCN A;  2MHJ A;  3ZNH B;  1HA5 A;  2H89 B;  1VR9 A;  1R4M B;  3RT3 B;  5IO9 A;  2PVG C;  4ACF A;  2V9H A;  3AB5 A;  3RZW C;  2IO1 B;  3W5U B;  2QSD A;  3RUI B;  1CMX B;  3SHQ A;  4MSM B;  4XC2 A;  4C56 C;  4HLE A;  3TEZ A;  2NBW B;  3BY4 B;  4IDI A;  2O6V D;  4YSZ B;  2NR2 A;  2BYF A;  4EKU A;  3OWE B;  1CJE A;  2OED A;  1E8Y A;  1TT5 B;  4H2A A;  3PHX B;  3A1Q B;  2W3R A;  1J7A A;  3DCG A;  1YQ4 B;  2WXL A;  3A9K B;  1WE6 A;  1Q10 A;  3LJ3 A;  1JWU D;  3DBL B;  1WX9 A;  3N1Y C;  1EWC A;  4WIP A;  1C76 A;  4A9A A;  3D32 A;  4DXF A;  3NS1 A;  2KLC A;  1YOV B;  4LNN A;  5D6J B;  3PLU A;  5G2N A;  1WZ0 A;  1ZUD 2;  4MGZ E;  2EMT A;  1B9R A;  1TBE A;  3H7P A;  4ZRK A;  2ZZP B;  2RR9 A;  1KOT A;  3ZVV A;  4USA A;  1M4V A;  1MPE A;  1LXD A;  1GNU A;  2K6Q A;  3ML9 A;  4WJQ A;  1I4H A;  2E6X A;  3PPA A;  4HRO A;  2J53 A;  4ZRJ A;  2KMM A;  3UF8 A;  4XDC A;  3JVZ X;  1J7B A;  5JH5 C;  4AWJ A;  2C7N B;  1MVK A;  1D6E C;  2LUE A;  2KJH B;  4RF1 A;  4O1N A;  3SFD B;  3H8H A;  2WYQ A;  3LDZ E;  4YSX B;  3EFU A;  3MHS D;  1N60 A;  3NHE B;  1UF0 A;  4WJO A;  1H7W A;  3NVZ A;  3ENE A;  1SE2 A;  3WAO A;  1KTK A;  3DHG C;  1A70 A;  1TIF A;  2ON8 A;  4MM3 A;  1QOB A;  4C7Z A;  3VTW A;  1WY8 A;  1F77 A;  2KN5 A;  1FCC C;  1IGD A;  1T6B X;  4KDI C;  2KQS A;  2K8C A;  2L52 A;  3AEB B;  2W55 A;  4HCP B;  2GLS A;  1WGD A;  4PT5 A;  4TMA B;  1SXT A;  4BOZ B;  3MHZ A;  1GAQ B;  4K3C A;  4W9F A;  2BGF A;  4RGT A;  2LGD A;  2C7M B;  2MJD A;  2UYZ B;  4DHZ E;  3L13 A;  1V5T A;  2FBW B;  1DOY A;  1C77 A;  1X1M A;  3R7R A;  2WXQ A;  5G55 A;  1WIA A;  4GDL A;  4FJZ A;  1TZ1 A;  3I57 A;  2KTR B;  1WXM A;  3EFC A;  1PGA A;  4E71 A;  4A90 A;  2AL6 A;  3UIO B;  3HHM A;  1D5M C;  2ZJD A;  5L95 C;  4OW0 A;  4BZA A;  3WCQ A;  1WI0 A;  3L0W B;  2LVO A;  1RLF A;  3LYY A;  2G4S A;  3T9L A;  4FHK A;  3T3O A;  2EMS A;  3VR8 B;  4HJG E;  2WU5 B;  1WJN A;  1EUV B;  2IZV B;  1TGZ B;  2D3A A;  2OJR A;  5C1Z A;  3MTN B;  1FNU A;  4JWS C;  1YN5 A;  2GOW A;  2VZK D;  1M94 A;  4HK2 A;  4HDQ A;  3V05 A;  3WA0 A;  3ZJV A;  4YTN B;  4ZYS A;  4KV2 A;  1E7U A;  3H7P B;  2OHF A;  4M8M A;  2LUM A;  2DYO A;  1DOI A;  3VXW A;  2Y5C A;  2BF8 B;  3VR9 B;  4NAM A;  3X0W A;  4KSL C;  3DBR B;  1WJU A;  1WX7 A;  3L16 A;  3VRB B;  3ML8 A;  1HE8 A;  4G50 A;  1HXY D;  1V9J A;  1PGX A;  3V62 A;  4CO7 A;  4JGH B;  3Q8B A;  2L76 A;  1BT0 A;  3ZUN A;  2D3B A;  3V61 A;  5CHW A;  3ZLZ A;  2QMT A;  4PYZ A;  2WXR A;  2JUO A;  5EE1 A;  3K9P B;  4LNO A;  4C4V B;  4P1B C;  4JX1 C;  2KQ7 A;  4MM3 B;  4N58 A;  1YX6 B;  1RAX A;  2QIE B;  3Q3M C;  3UGB B;  3WIM A;  1MI0 A;  3N9Y C;  1QQR A;  3AEG B;  4BKT A;  4I6P A;  4IG7 B;  4F8C B;  2KDM A;  2PLP A;  1N61 A;  3Q3F A;  1MG8 A;  1WGG A;  3DBS A;  2SEB D;  3MC8 A;  2BKF A;  4B0E A;  2BW2 A;  4IM0 A;  5FR3 A;  3RFZ B;  3TMP B;  3P4P B;  2MWS B;  1FNW A;  3O13 A;  4W9L A;  1WGR A;  1XEE A;  2JWZ A;  4JLC A;  2YLM A;  5HI1 A;  2LEK A;  2J0M A;  1E7P B;  4GDL B;  4YSY B;  2WXH A;  4P6V F;  4BOS C;  1LFD A;  5J17 A;  1H8C A;  2JX5 A;  2LHD A;  5LXI B;  1L4Z B;  4NJ6 A;  2KK8 A;  2I38 A;  1P3Q U;  3EA6 A;  4XX5 A;  2FCN A;  4FJV B;  4HPM B;  2V3N A;  3VUX A;  4ARI A;  3NVV A;  2WXF A;  2XBB C;  1TKG A;  3W2D A;  1SE9 A;  2PW9 A;  2KXJ A;  3PTF C;  1EU3 A;  3Q8F A;  3ZYY X;  1FIQ A;  2K25 A;  2CHZ A;  1S1Q B;  1WJ4 A;  4ASW C;  1KFY B;  4HEA 1;  4ANW A;  2D10 A;  3KQ4 A;  1B1Z A;  3QAR A;  4YXD B;  2M8S A;  3T3N A;  4J3O D;  2RDG A;  1T0R C;  3M95 A;  2R2O A;  1WM3 A;  4EOY A;  2HDE A;  2M0X A;  4MDK E;  1LM8 B;  1WXA A;  2WXN A;  3I3T B;  3PRM B;  1AWD A;  1E8X A;  1EU4 A;  2L83 A;  4DXG A;  2JY6 A;  2NBU A;  3VRA B;  1FM0 D;  3L10 B;  3NVW A;  2MJ3 A;  4DHJ D;  4K7W A;  4W9J A;  1JCK B;  1WWT A;  1T0Q C;  3APD A;  1GTE A;  4HRS A;  3Q8A A;  4FBJ B;  1L0Y B;  1D5X C;  5HKH A;  3BYY B;  2MLB A;  3NJT A;  4PS7 A;  1P7F A;  3MC0 B;  2C9W B;  3ZNI D;  1TS5 A;  2ZPN A;  3RMK C;  1P0R A;  1TS3 A;  3SU8 X;  1F2R I;  2IGG A;  1ZP0 B;  3FIL A;  1ZGU B;  2KC2 A;  3VAW A;  2FCS A;  4TUU A;  2WXM A;  3R2T A;  1IBX A;  5EDS A;  3NOB A;  3RZF A;  4MGI E;  1N5X A;  4LTU A;  4S17 A;  3V3X A;  1JQ4 A;  2LAS A;  1XQQ A;  3VUY A;  1V80 A;  1EM7 A;  3RCZ A;  2PTL A;  4W9I A;  3ZXV A;  2N9K A;  2L7R A;  2ZPY A;  4B9K A;  2DZJ A;  3QHT A;  3R2I A;  4OZC A;  3NRZ A;  4JIO U;  4AUQ C;  2KOX A;  1V81 A;  5GXG B;  1P7E A;  1SE3 A;  4L1B A;  4KKI A;  3RD2 A;  3ZNZ B;  2IJ0 A;  1J7C A;  3UI3 A;  2LRW A;  3CSF A;  3DVN U;  1KRH A;  1S3S G;  2K0P A;  2N1W A;  4HCN B;  3Q8E A;  2GMI C;  2HJ1 A;  4EZK A;  4FLH A;  1V2Y A;  5D3I B;  2WDQ B;  1JWM D;  2FE8 A;  1Y8R C;  2JU6 X;  1UH6 A;  2CJO A;  2DYB A;  2RSU A;  3EC8 A;  3O65 B;  1RFK A;  2ACZ B;  3IG3 A;  2LVQ A;  1ZDX A;  1MFW A;  4KZ0 A;  4J6I A;  2KYW A;  2K5P A;  2WP9 B;  3KUC B;  2H88 B;  3IT4 B;  1L0V B;  1FXA A;  2XN9 C;  1OFF A;  3U30 A;  1V1P A;  4HJK A;  2B76 B;  1I7H A;  3PGE A;  2ZCB A;  2JVC A;  3DVG X;  3SDL C;  4TV3 A;  3R7Q A;  3GS2 A;  3GZN B;  2KAC A;  2HJ8 A;  3ZTD A;  2LZ6 A;  3RNC C;  1GB1 A;  1C79 A;  2NS5 A;  1ZPS A;  1KLG D;  2REX A;  4WJP A;  1CQV A;  3BVG A;  4RMA A;  2LGX A;  1FXT B;  4KX6 B;  2Y5B B;  3TBL D;  3SD5 A;  2W3S A;  1F9J A;  1WM2 A;  4W9G A;  3IBE A;  2TSS A;  2AQ2 B;  5D3D A;  1XO3 A;  3Q14 C;  3MP9 A;  5DPR A;  1RRB A;  3Q3J A;  4GMV A;  5C23 A;  1SBB B;  5D2M B;  3FIL B;  3S2A A;  4JL9 A;  3Q3N C;  5IA7 A;  1MHX A;  3W1S A;  5AEK B;  3A9J A;  5JZE B;  4NAW A;  1IBX B;  4ARC A;  1A5R A;  3M3J A;  1KLV A;  4W9C A;  3GE3 C;  1QLB B;  2N9X A;  2WDV B;  1HZ6 A;  4MH8 A;  4GN1 A;  2KLG A;  4WQO B;  3W1S C;  1F2R C;  3IHP C;  1FMA D;  1SF0 A;  2GBR A;  4WWN A;  1JML A;  2L00 B;  1YQ3 B;  3W5V B;  5KHO A;  3WAN A;  4L2Y A;  1NYR A;  3QQ8 B;  2DZI A;  1TS2 A;  1K50 A;  2KDE B;  1WR1 A;  3UIN B;  3ZQ4 A;  3JW0 X;  2VZK B;  4M01 A;  4ZDV A;  3MFG A;  1SB3 C;  1ZDV A;  1PQS A;  1JWB D;  4RM8 A;  3ZKJ C;  5J18 A;  1UNS A;  3IFW B;  4IC7 B;  2M1M A;  1JRU A;  3Q6B A;  5BMH A;  2RMM A;  1WXS A;  1R7S A;  3AM9 A;  2M17 A;  3PV1 A;  3APF A;  3DWG C;  1E0Z A;  2D07 B;  4OVV A;  5AUK A;  1I4Q A;  2HTM E;  2LFI A;  2KX0 A;  3CF6 E;  2K3U A;  3CWI A;  5CHF A;  2AQ1 B;  2IGD A;  3TCA A;  4W9D A;  1SIF A;  1YMH E;  4EFO A;  1YQB A;  1VJK A;  4K3B A;  3H9D A;  2I1J A;  3K9O B;  5G5H A;  2L3Z A;  3I9V 1;  3H6N A;  2MBE A;  1RWS A;  2INN E;  3AEE B;  1VD2 A;  1FXI A;  2PMV A;  3DVN V;  4JPS A;  2ZW0 A;  4R3D A;  2QIL A;  1NI3 A;  1WRD B;  4KIK A;  2IYD B;  2G4D B;  4OZB A;  2KWD A;  2PE6 B;  3ZJU A;  1UGJ A;  2LJI A;  1WFY A;  1QT9 A;  1GT8 A;  1FRR A;  2MP2 B;  5EE3 A;  1I35 A;  5DPW A;  3AE4 B;  2KWC A;  4IOI E;  3AE7 B;  1PGB A;  2X38 A;  2CR5 A;  2D2Q A;  5G5G A;  1YNT E;  4GOC A;  1ZW7 A;  1J8C A;  2JPH A;  3TJP A;  3Q8C A;  5CHV C;  1C9F A;  2DEN B;  3A9J B;  4NAW B;  2KN4 A;  3AUL A;  2J52 A;  1UD7 A;  5MPO A;  4NQL B;  1XLQ A;  2KWV B;  2WXG A;  3KUD B;  3KUZ A;  3VDZ A;  4A3P A;  4DK5 A;  1LQB A;  2KVR A;  3CMM B;  4HXD A;  4C7Y A;  1TKE A;  2LHE A;  2OOB B;  1WYW B;  1RYJ A;  2K8H A;  4NY0 A;  3BVM A;  3PRE A;  3AH7 A;  2XK5 A;  3OJ3 A;  4ICU A;  3V6C B;  3ONS A;  3TIX A;  3SEB A;  4IKG A;  5HFY A;  4MEM A;  3QK0 A;  1GG3 A;  2PVO D;  2AL3 A;  5AUI A;  4XGA B;  4GB9 A;  2WDR B;  3NVY A;  3N32 A;  4ZRP A;  3B0A A;  2KX3 A;  3VHT C;  2BS4 B;  3R3M A;  1OQY A;  2V3S A;  4W9H A;  3PZD A;  1QF6 A;  4AP4 C;  2JQR B;  2EKI A;  3U7Z A;  3TEW A;  1L5P A;  1WF9 A;  1V1O A;  1IUE A;  1TY0 A;  2ONQ A;  1Q0W B;  4GXB A;  4ZOH C;  4P1C C;  1YD8 U;  3VTU A;  2WX1 A;  2SAK A;  2VRR B;  3B9J A;  3Q3O C;  1C4C A;  1WXV A;  2NPT A;  4JWU C;  4DHJ B;  1PYW D;  4YT0 B;  1WJ6 A;  2BBC A;  4LCD E;  4WJN A;  2DHZ A;  2W54 A;  2KHW B;  4EUT A;  1EF5 A;  1OEY J;  2BVC A;  2KJR A;  2V1Y A;  1MG4 A;  2G45 B;  1KLU D;  2WDT B;  1VZ6 A;  2K6D B;  2INP E;  4KIK B;  3UQA A;  4KGS A;  2WWZ A;  3PSE B;  2BPS A;  1KJT A;  4A55 A;  2C7H A;  3BII D;  4JE3 B;  2KO3 A;  3AE1 B;  3DWM A;  1VZ8 A;  2ICI A;  2FAZ A;  1OQQ A;  5EE0 A;  1SE4 A;  2WS3 B;  3P4S B;  2LGS A;  4OZA A;  4IW0 A;  1YJI A;  4MEL A;  2YEP F;  3U7D A;  1WRI A;  3C8Y A;  3DVG Y;  2WXI A;  4RGN A;  3QX1 A;  3MC9 A;  4BBN F;  1L6U A;  2JYT A;  4EZL A;  3B1L X;  2QC8 A;  4AJW A;  1CK1 A;  1NEK B;  5GMV A;  1K51 A;  2O6V A;  3BWU D;  2K1F A;  4M8N A;  3OAW A;  2M19 A;  1I4G A;  3ZTC A;  5DPS A;  2FNJ B;  4K1R B;  3RNE C;  1E8W A;  3VQI A;  3BVZ A;  1QKZ A;  3ZDT A;  2KT7 A;  2EEL A;  1LGR A;  2XK5 B;  3KLS X;  3WAP A;  2V4I B;  2MH7 A;  2DAJ A;  1WSP A;  2JZZ A;  4W9K A;  3T8M A;  2BS3 B;  2WXJ A;  4HVB A;  1R4M I;  1CZP A;  2WX0 A;  4LDT B;  1BXT A;  4M02 A;  1I4R A;  3W1Y A;  2ZVN A;  1AN8 A;  2J4X A;  2PKO A;  4MH0 E;  4YWG G;  4ZRQ A;  2ZNV C;  2LMC A;  4PYU A;  3R66 C;  3A33 B;  5FKA C;  2BS2 B;  5TR5 A;  2W9N A;  1MJD A;  2FID A;  3DOW A;  2K8B A;  2WLB A;  3N1Z C;  1PUT A;  1ZOY B;  2NPT B;  1JWA D;  3PRP B;  1WR6 E;  1C1Y B;  2GBJ A;  5HHD G;  4LJO B;  4FA6 A;  1JWS D;  5BO4 B;  3BZD B;  2MW5 A;  4RGO S;  2Y3A A;  3KW5 B;  2WXK A;  4ICV A;  2KFJ A;  1XLP A;  3AEC B;  4B0M A;  5JXV A;  1R4N I;  5BMI A;  1UBQ A;  3DQV A;  2N7D A;  2JT4 B;  3P4Q B;  4IM3 A;  3NZ3 A;  4X57 B;  1N62 A;  4WWO A;  5BMG A;  1N63 A;  4RF0 A;  1OTR B;  1T0S C;  3N1X C;  4FN2 A;  4IWO A;  2BYT A;  3U8Z A;  4BBN C;  1FRD A;  2JRI B;  1J19 A;  2MBO A;  3C19 A;  3RN9 C;  2D3C A;  3M62 B;  1ENF A;  2KMC A;  4II3 B;  4XZ4 A;  4UDU C;  2DAF A;  4MGK E;  4OVZ A;  4F7Z A;  1HTQ A;  2R61 A;  1E8Z A;  1V6E A;  3TL5 A;  1UBI A;  1IGC A;  3SR6 A;  3E56 A;  2O6V B;  4KSK C;  2N9P C;  3DHI C;  2KKC A;  3VUW A;  3UIP B;  3PS6 A;  4YTM B;  2MCN B;  4M00 A;  4MGY E;  4A20 A;  1WYG A;  3AMZ A;  3DDC B;  3BIN A;  4TKN A;  2X8X X;  3ZRF A;  4GIV A;  1XLO A;  2BYV E;  2DNF A;  4IUM B;  1NYQ A;  3X23 A;  1XLN A;  1GOZ A;  3ZIM A;  2J0K A;  2AYO B;  4NQK E;  5FK9 C;  4I6L B;  4II2 B;  2D11 A;  2IY1 B;  2QCZ A;  2WXP A;  1Q5W B;  1JRP A;  2HTH A;  1VCB A;  2NTS A;  1AW7 A;  3J9C A;  3N3K B;  4CYE A;  1WE7 A;  5FR6 A;  2QJL A;  4L23 A;  1ACC A;  2KJ6 A;  5IP4 D;  5BYQ A;  2KWU B;  1TY2 A;  3R8B A;  4HPL B;  3H7S A;  1YN3 A;  3KYC D;  1KF6 B;  5JHB A;  3E9S A;  3RPF C;  4DBG A;  3VVW B;  1V86 A;  2GRI A;  2YEP B;  2CU1 A;  1IP9 A;  4WAF A;  1G6J A;  1TTN A;  5TSS A;  3VFK A;  2K39 A;  3VH3 B;  5KHQ A;  5C2T B;  4K7S A;  2G3Q B;  2M56 B;  4M0W A;  3ZNG C;  2LGI A;  3FAH A;  3DBH I;  1I4X A;  2NMQ A;  4FJY A;  2RDH A;  2WGS A;  1XXG A;  2OJW A;  1XCQ L;  2J7Q B;  1L7Y A;  3U52 E;  2NVU I;  3IAM 1;  5D7G A;  3W9C B;  2KFK A;  2O2V A;  1SSN A;  2UU7 A;  4N59 A;  3BYT B;  2GI9 A;  3QCA A;  4HDO A;  5BYR A;  4BKS D;  4E74 A;  3CIR B;  2KDB A;  4A3O A;  1STE A;  2JSV X;  2LWP A;  1C78 A;  1H4R A;  5H8Y E;  1FNV A;  2DZM A;  4WUR A;  5LXH A;  3V60 A;  2VH2 A;  4KGT A;  5E6N A;  2EKE C;  2KTF A;  4LLG M;  4P7I A;  5IAA C;  2JZ3 B;  1YJJ A;  1P9D U;  3ZDM C;  1D3Z A;  2KC1 A;  3B2G A;  3RI7 C;  2IDY A;  4LNK A;  1TJE A;  3P2B A;  1QOA A;  3PT2 B;  3PRZ A;  4A8X C;  5JHA A;  3ETR A;  3ZRC A;  4PS8 A;  3U4E G;  1JW9 D;  3ALB A;  3B2F A;  3GOE A;  3FC4 A;  4G3X B;  3L17 A;  2LVP A;  2JZP A;  3ZGZ A;  3RNA C;  5IOI A;  2E3T A;  1C3T A;  1ZE3 D;  2Z8L A;  2FCQ A;  5L83 A;  3ABV B;  4YTP B;  1EO6 A;  2QEJ C;  2PE9 A;  2AWT A;  3I63 C;  4XWW A;  2IGH A;  1V5O A;  3HVD A;  4MSQ B;  1V1P B;  4AOF A;  2KAN A;  3AE2 B;  4EE2 A;  1XT9 B;  1E10 A;  3C0R B;  2KMA A;  2WU2 B;  5E6O A;  1L4D B;  3MJ5 A;  2RGF A;  2RPQ A;  4MAC A;  4KVG B;  1P1A A;  5H92 C;  3NZS A;  4US8 A;  4MT5 A;  3KVF B;  3N20 C;  2J0J A;  1V49 A;  1T3Q A;  3DPD A;  3AE3 B;  4OVU A;  2GBN A;  2MBQ A;  2M4N A;  1R4N B;  1OGW A;  2A4Z A;  4M0W B;  2C5L C;  3LXF A;  1E9M A;  1GJZ A;  2L0F A;  2MQJ A;  2JF5 A;  2WNM A;  3BK2 A;  4ITK A;  3AEA B;  1HEZ E;  1XD3 B;  1UUP A;  1F52 A;  4FHJ A;  3TEX A;  3QIJ A;  2KFK B;  1N6Z A;  2O2V B;  4C4V A;  4RM9 A;  1SIJ A;  2RD0 A;  4CHK A;  1YX5 B;  3AE6 B;  1OQR A;  4ZYN A;  4XYC A;  2NCN A;  3AI5 A;  2IO2 B;  3GE8 C;  2LRU A;  2DLB A;  1TZO A;  3HM3 A;  1ZKH A;  2K22 A;  1FD6 A;  4FXC A;  3KWL A;  4G0N B;  2LGY A;  4XDD A;  2N7J A;  5D94 A;  4BAX A;  2CJN A;  2A5U A;  2JWU A;  3M63 B;  4DDG D;  1SJH D;  4ZRI A;  4RNA A;  3OJ4 B;  2D5G A;  1E90 A;  3QA8 A;  4JQW C;  3NG0 A;  4WAA A;  4BFR A;  1E7V A;  3NUH B;  2AEH A;  3CF4 A;  2MBH A;  1VLB A;  1FFU A;  1UWX A;  2I2Y A;  2V4L A;  2L32 A;  4IWP A;  4G11 A;  4OHJ A;  4CQN A;  2PJH A;  3RNG C;  1WGY A;  3TUO A;  2LJ5 A;  3PZ8 A;  4AQ7 A;  2W82 A;  2BB6 A;  4GDK A;  1TYG B;  3I5J C;  3KWV A;  1K53 A;  4AS1 A;  1VRA B;  3QWZ B;  5LNK 1;  4DWF A;  1Q1O A;  1GPX A;  3CST A;  5IN7 A;  4WQM A;  3AED B;  2V0G A;  4GLS C;  2LD9 A;  2DWQ A;  1P98 A;  2L1A A;  3GP7 A;  2GBK A;  3P1M A;  1E5W A;  1FPY A;  2UWQ A;  3GZN I;  5IKC M;  4C80 A;  3ZXR A;  1SEB D;  1V8C A;  1GB4 A;  1I42 A; 
#chains in the Genus database with same CATH homology
 1ZPS A;  1DGJ A;  1XLP A;  1KLG D;  3AEC B;  2N0S B;  4B0M A;  1I4P A;  5JXV A;  5BMI A;  2PIA A;  1CQV A;  3P4Q B;  3BVG A;  3NZ3 A;  1MVK A;  1N62 A;  1PDX A;  1D6E C;  1GTH A;  2G1E A;  1PFD A;  4KX6 B;  3URY A;  4RF1 A;  4O1N A;  3SFD B;  3H8H A;  5BMG A;  4NJC A;  4YSX B;  1N63 A;  1N60 A;  4RF0 A;  1EWY C;  2W3S A;  1NEN B;  1H7W A;  3NVZ A;  2KQ4 X;  2M0A A;  4RFB A;  2BYT A;  1SE2 A;  1FRD A;  2BB5 A;  5T8I A;  5BYS A;  1KTK A;  2TSS A;  2AQ2 B;  1A70 A;  5D3D A;  2ON8 A;  1XO3 A;  1QOB A;  2DYM A;  3MP9 A;  4C7Z A;  1ENF A;  1MHH E;  1F77 A;  4ZHP A;  1SBB B;  1FCC C;  1IGD A;  3FIL B;  1T6B X;  1MHX A;  2FUG 1;  4UDU C;  1UWM A;  3W1S A;  2L52 A;  3P42 A;  1IBX B;  3AEB B;  2W55 A;  4ARC A;  4PT5 A;  4TMA B;  1SXT A;  4OVZ A;  2R61 A;  1QLB B;  2WDV B;  1C4A A;  1GAQ B;  1IGC A;  1HZ6 A;  3E56 A;  3MHZ A;  4MH8 A;  4RGT A;  3SR6 A;  1F2R C;  2V3P A;  1FMA D;  4ZHO A;  2MJD A;  1SF0 A;  3SFE B;  1JML A;  2FBW B;  1DOY A;  1C77 A;  1YQ3 B;  4YTM B;  3W5V B;  4L2Y A;  2WXQ A;  1NYR A;  1D4B A;  1TS2 A;  1KH0 A;  2JYE A;  1WYG A;  3I57 A;  2MEK A;  1K50 A;  3AMZ A;  2N9L A;  1PGA A;  3ZQ4 A;  4A90 A;  2VZK B;  1HQR D;  1H7X A;  3MFG A;  1SB3 C;  1ZDV A;  5E6J A;  1JWB D;  1D5M C;  1XLO A;  4RGM A;  1UNS A;  1NYQ A;  3LB8 C;  4RH6 A;  3TEY A;  2GB1 A;  1XF5 L;  4OW0 A;  1XLN A;  1GOZ A;  3WCQ A;  1HZ5 A;  1N5W A;  1L0X B;  5FK9 C;  1VZ7 A;  3LYY A;  5BMH A;  2RMM A;  1R7S A;  3AM9 A;  3T3O A;  3VR8 B;  4HJG E;  2WU5 B;  1F0Z A;  3DWG C;  1E0Z A;  2WXP A;  4GDK B;  1JRP A;  4D2K A;  2NTS A;  5AUK A;  1I4Q A;  2HTM E;  1AW7 A;  3J9C A;  2LFI A;  2K3U A;  4JWS C;  1FNU A;  2QJL A;  1YN5 A;  3CWI A;  2VZK D;  1DOX A;  4N6E B;  2AQ1 B;  1ZXH A;  2IGD A;  4L23 A;  3V05 A;  3AEF B;  1ZXI A;  3ZJV A;  1ACC A;  4YTN B;  3EGR A;  4ZYS A;  1YMH E;  2DBY A;  2OHF A;  2BT6 A;  1WGK A;  1VJK A;  2AX5 A;  4LK0 M;  5BYQ A;  2MJE A;  2LUM A;  2DYO A;  1TY2 A;  3R8B A;  1V97 A;  5G5H A;  1DOI A;  2Y5C A;  3IXS A;  3PZ7 A;  4P16 A;  3VR9 B;  3I9V 1;  1XCT L;  1YN3 A;  4NAM A;  1KF6 B;  3E9S A;  3RPF C;  2WQY B;  1RWS A;  3VRB B;  2INN E;  3AEE B;  2GRI A;  2YEP B;  3AE8 B;  1FCL A;  1FXI A;  2PMV A;  4WAF A;  4JPS A;  5TSS A;  2ZW0 A;  1HXY D;  1Y56 A;  1TKY A;  3P4R B;  2QIL A;  4R3D A;  5I4D A;  1NI3 A;  4NZL B;  1PGX A;  2Q5W D;  5C2T B;  4OZB A;  3Q8B A;  2M56 B;  2KWD A;  3ZJU A;  1UGJ A;  4M0W A;  2LJI A;  2LGI A;  4KKJ A;  4HKZ E;  2QMT A;  2WXR A;  1QT9 A;  1GT8 A;  3FAH A;  1I4X A;  5HG2 A;  1FRR A;  5EE1 A;  2NMQ A;  1LO5 D;  5EE3 A;  2RDH A;  1XXG A;  1XCQ L;  3AE4 B;  3IAM 1;  5D7G A;  4JX1 C;  4IOI E;  3U52 E;  3AE7 B;  3W9C B;  1PGB A;  4MM3 B;  3IAS 1;  2X38 A;  1YN4 A;  1QIL A;  4TSS A;  4N58 A;  1SSN A;  4N59 A;  2QIE B;  1VDV A;  5G5G A;  1YNT E;  3BYT B;  2GI9 A;  5BYR A;  2XNA C;  1MI0 A;  3CIR B;  3N9Y C;  3Q8C A;  1QQR A;  3AEG B;  1STE A;  1C9F A;  2JSV X;  2KDM A;  2PLP A;  1N61 A;  1C78 A;  5H8Y E;  1FNV A;  4NAW B;  4WUR A;  1AYF A;  2KN4 A;  2J52 A;  2SEB D;  5MPO A;  1XLQ A;  4KGT A;  2WXG A;  3AE9 B;  4B0E A;  2BW2 A;  5FR3 A;  4LLG M;  3RFZ B;  1FO4 A;  3ZJT A;  3P4P B;  3AE5 B;  1E6E B;  2KAJ A;  4REZ A;  4C7Y A;  1YJJ A;  1BUI C;  1C4P A;  1TKE A;  1FNW A;  2LHE A;  3O13 A;  3B2G A;  2IDY A;  1XEE A;  1RYJ A;  3HRD D;  1TJE A;  1QOA A;  5HI1 A;  1K52 A;  2LEK A;  1E7P B;  3BVM A;  4YSY B;  2WXH A;  4GDL B;  4P6V F;  3AH7 A;  4A8X C;  2JX5 A;  2LHD A;  3ETR A;  1WXQ A;  3SEB A;  4IKG A;  5HFY A;  3U4E G;  1L4Z B;  2PVO D;  1JW9 D;  3B2F A;  2I38 A;  3EA6 A;  5AUI A;  2G9H D;  3FC4 A;  2WDR B;  2V3N A;  3NVY A;  4ARI A;  4ZRP A;  3NVV A;  2JZP A;  3ZGZ A;  2WXF A;  3Q69 A;  2BS4 B;  1TKG A;  2E3T A;  1D5Z C;  5EE9 A;  1ZE3 D;  3W2D A;  2Z8L A;  2PW9 A;  3ABV B;  4YTP B;  1FEH A;  4A6Q A;  1EU3 A;  3Q8F A;  3ZYY X;  2QEJ C;  1FIQ A;  3HVZ A;  1QF6 A;  2JQR B;  2EKI A;  3U7Z A;  2BTE A;  4XWT A;  3GB1 A;  4XWW A;  3TEW A;  1L5P A;  2IGH A;  1V1O A;  3BK1 A;  5C3J B;  1IUE A;  1TY0 A;  1KFY B;  2ONQ A;  3HVD A;  4ZOH C;  4KGR A;  1V1P B;  3L4P A;  4HEA 1;  4HKQ A;  2SAK A;  3B9J A;  1FFV A;  3AV8 A;  1C4C A;  4JWU C;  3KQ4 A;  3AE2 B;  1B1Z A;  2AQ3 B;  4YXD B;  1PYW D;  4EE2 A;  4YT0 B;  3T3N A;  4DQO C;  1E10 A;  1ET6 A;  4J3O D;  2BBC A;  2WU2 B;  1L4D B;  2RDG A;  2RPV A;  3MJ5 A;  4MAC A;  3HUI A;  1BML C;  1ESF A;  2HDE A;  2W54 A;  5H92 C;  4US8 A;  2WXN A;  4MT5 A;  2J42 A;  1SJE D;  3AN1 A;  1AWD A;  1KLU D;  1EU4 A;  1T3Q A;  2L83 A;  4DXG A;  3AE3 B;  1VZ6 A;  2INP E;  4RCO A;  3U2S C;  3VRA B;  4KGS A;  1JRO A;  1FM0 D;  4WWM A;  3NVW A;  3LXF A;  1E9M A;  2MJ3 A;  2WNM A;  4A55 A;  4WH4 A;  3BK2 A;  3BII D;  1JCK B;  4JE3 B;  4ITK A;  1WWT A;  3DWM A;  3AE1 B;  3AEA B;  1HEZ E;  1VZ8 A;  2ICI A;  1GTE A;  4HRS A;  1OQQ A;  3Q8A A;  1UUP A;  5EE0 A;  1SE4 A;  2WS3 B;  3P4S B;  1L0Y B;  2K9X A;  3TSS A;  1D5X C;  4OZA A;  3BYY B;  4TQ0 A;  3TEX A;  1YJI A;  1P7F A;  2YEP F;  3MC0 B;  1WRI A;  1JAL A;  1TS5 A;  1TS4 A;  3C8Y A;  2JXT A;  2Y5P A;  2WXI A;  4RGN A;  1TS3 A;  1SIJ A;  1F2R I;  2IGG A;  2ZW1 A;  1ZP0 B;  3P63 A;  3FIL A;  3AE6 B;  1L6U A;  1OQR A;  2JYT A;  2WXM A;  3R2T A;  1IBX A;  2DLB A;  1CK1 A;  2CU3 A;  1RM6 C;  1TZO A;  1L6V A;  3PO0 A;  1NEK B;  1ROE A;  2K22 A;  1NVI D;  2NTT A;  1FD6 A;  1N5X A;  1K51 A;  4FXC A;  4LTU A;  3KWL A;  3BWU D;  3V3X A;  1JQ4 A;  2IPK D;  4XDD A;  2N7J A;  3EUB 2;  1EM7 A;  2PTL A;  3IT6 B;  2M19 A;  1I4G A;  2CJN A;  2N9K A;  1ET9 A;  1T5X D;  4US9 A;  3R2I A;  2JWU A;  4OZC A;  3NRZ A;  3VQI A;  1SJH D;  3BVZ A;  4RNA A;  1DYQ A;  1QOF A;  1QKZ A;  2EEL A;  5GXG B;  2D5G A;  4XE0 A;  1P7E A;  1QOG A;  1SE3 A;  2WXO A;  3KLS X;  4KKI A;  4L1B A;  4Q2J A;  4TQ1 A;  2V4I B;  2MH7 A;  2IJ0 A;  1J7C A;  3UI3 A;  1WSP A;  3NUH B;  1HA5 A;  2H89 B;  3CF4 A;  1VR9 A;  2BS3 B;  1VLB A;  2WXJ A;  1KRH A;  2PVG C;  1FFU A;  1CZP A;  1UWX A;  2K0P A;  3AB5 A;  2I2Y A;  1BXT A;  3W5U B;  2QSD A;  3Q8E A;  1I4R A;  2L32 A;  4OHJ A;  4C56 C;  3TEZ A;  4IDI A;  4CQN A;  1AN8 A;  2J4X A;  2PKO A;  4YSZ B;  5D3I B;  3OWE B;  2WDQ B;  1CJE A;  2OED A;  4YWG G;  3TUO A;  1JWM D;  3PZ8 A;  4H2A A;  4ZRQ A;  2FE8 A;  2LMC A;  4AQ7 A;  2JU6 X;  2W3R A;  2W82 A;  2BB6 A;  1J7A A;  5FKA C;  2CJO A;  1TYG B;  2BS2 B;  1YQ4 B;  2WXL A;  3KWV A;  1Q10 A;  2ACZ B;  1RFK A;  1JWU D;  1ZDX A;  1EWC A;  1K53 A;  1C76 A;  2WLB A;  4WIP A;  4A9A A;  4AS1 A;  1VRA B;  1PUT A;  1ZOY B;  5LNK 1;  1GPX A;  2K5P A;  2WP9 B;  3NS1 A;  4DXF A;  1JWA D;  2H88 B;  4WQM A;  3IT4 B;  3AED B;  1L0V B;  2V0G A;  1FXA A;  1ZUD 2;  2XN9 C;  1OFF A;  4GLS C;  2DWQ A;  5HHD G;  1V1P A;  1B9R A;  2B76 B;  1I7H A;  2L1A A;  3GP7 A;  1JWS D;  4USA A;  1M4V A;  1MPE A;  3GS2 A;  2KAC A;  3P1M A;  3BZD B;  4RGO S;  1I4H A;  2E6X A;  2Y3A A;  4HRO A;  2J53 A;  2KMM A;  2WXK A;  4C80 A;  1GB1 A;  4XDC A;  1SEB D;  1V8C A;  1GB4 A;  1J7B A;  1C79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...