3VRAB

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor atpenin a5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 50
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vraB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vraB01
2PVGC 3VRAB 2BT6A 4LTUA 1JWAD 1QOAA 2JQRB 2OHFA 1DGJA 2DWQA 1CJEA 1SB3C 3HRDD 1GTHA 2K5PA 3HUIA 3AECB 3AM9A 5C2TB 5H8YE 2WDRB 3AE6B 3WCQA 4YTPB 1JW9D 1L6VA 3AEBB 1E9MA 2L83A 2WU2B 3P4SB 2HTME 1TJEA 3AEGB 2WLBA 5EE3A 1WGKA 3AEAB 3SFEB 4YTMB 1NYQA 2WU5B 1FRDA 1R7SA 1XLNA 1KF6B 4N59A 4A9AA 1GPXA 4YSZB 1OFFA 3AE9B 1AWDA 3ZYYX 4JWUC 3SFDB 1N62A 1TYGB 4YSXB 5H92C 3NVVA 2G1EA 2QJLA 2FBWB 3NVZA 4WWMA 3SR6A 1B9RA 2H89B 1N61A 1QOGA 3CF4A 4YTNB 4JX1C 4IDIA 5AUIA 1FFVA 2CJNA 1A70A 1ZXIA 1TKGA 2WDQB 1FO4A 1NENB 1PFDA 1OQRA 3P4QB 4C80A 1WWTA 3AE7B 1VLBA 1ZP0B 2JX5A 1WXQA 1CZPA 1FIQA 1FXAA 2K9XA 2W54A 4YT0B 3PO0A 5GXGB 3AEEB 1N63A 1RM6C 1DOIA 3EUB2 1SIJA 3P4PB 2PKOA 4ZOHC 1GTEA 3NS1A 3P1MA 1J7CA 2AX5A 4N6EB 2BS3B 2CU3A 1KFYB 1EWYC 2QIEB 3AEFB 4US8A 2W3RA 3AE1B 3AN1A 4N58A 1E6EB 1NI3A 1WRIA 3B2GA 1OQQA 3LXFA 3AE4B 3DWGC 4ZHOA 1AYFA 3AB5A 1KRHA 1YJJA 5EE9A 5C3JB 2BS4B 3RPFC 1E0ZA 1F0ZA 2EKIA 3CWIA 4ZHPA 3AMZA 2WQYB 3W9CB 4C7YA 1DOXA 1VDVA 2WS3B 3KWLA 5AUKA 1TKEA 1JALA 1NVID 3AV8A 1JQ4A 3NVWA 3VRBB 4ITKA 1V8CA 1QOFA 1FRRA 1RFKA 2E3TA 2WDVB 2W3SA 5MPOA 3AEDB 4YSYB 1NYRA 1PDXA 1FMAD 1ROEA 1RYJA 2H88B 1GT8A 2KMMA 2B76B 4JWSC 1XLPA 1L0VB 1XLOA 2K22A 1QLBB 1IUEA 1FFUA 2BS2B 3VR9B 1VJKA 1ZUD2 1UWMA 2M19A 5EE1A 1XO3A 2DBYA 2M56B 1N5WA 1YQ3B 4YXDB 2MJDA 4WQMA 1E7PB 5G5GA 3AE3B 3CIRB 3ETRA 3AE2B 1FM0D 1JRPA 1SF0A 3VR8B 3AH7A 3LB8C 3B9JA 2W55A 4HRSA 4C7ZA 2PVOD 3B2FA 1I7HA 2LEKA 2Q5WD 1RWSA 1H7XA 1JROA 1JWBD 3W5UB 4KX6B 1FXIA 1YJIA 3L4PA 1QF6A 1N60A 1QOBA 3AE8B 3P4RB 1XLQA 3P63A 4USAA 5EE0A 1QT9A 1PUTA 1H7WA 1L5PA 3FC4A 3NVYA 2Y5CA 3NRZA 4HROA 4US9A 3DWMA 2L52A 1N5XA 1GAQB 3W5VB 2ACZB 1WYGA 1E10A 1L6UA 3BIID 3FAHA 3ABVB 4FXCA 2MJEA 2MH7A 3HVZA 2PIAA 3AE5B 1ZOYB 1T3QA 1NEKB 1V97A 2WP9B 5G5HA 2KAJA 1YQ4B 1J7AA 1TKYA 2N0SB 4P6VF 2CJOA 2MJ3A 1J7BA 1DOYA
chains in the Genus database with same CATH superfamily
2JQRB 2L8JA 4XDCA 1TS3A 3AECB 3AM9A 1Q10A 4JE3B 4AP4C 2WU2B 2IGDA 4XC2A 3DBHI 3ZLZA 4A9AA 3AE9B 2DHZA 1YMHE 4I6PA 1EM7A 2D11A 1IGCA 1ZXIA 1TZ1A 1V81A 1M4VA 3AULA 3KLSX 4W9JA 1WH3A 2WYQA 4XWTA 4M0WA 1SE2A 2JX5A 3PO0A 3OWEB 3AEEB 2G3QB 4GLSC 3RNGC 1HTQA 2AL3A 3NS1A 1ZGUB 4N6EB 1OGWA 4A3PA 4US8A 1X1MA 2UU7A 4WJPA 3VUXA 2M4NA 4HVBA 2DENB 1MG4A 5FK9C 2CS4A 4P16A 1PGAA 4IWQA 4W9HA 4ZHPA 1V49A 2LASA 1NVID 3NVWA 1SJED 2MLBA 1WJ4A 2OJRA 2K0PA 2GRIA 2N7JA 5AEKB 3VAWA 1HE8A 2G9HD 1I35A 5J2RA 2BS2B 4NAWB 2K25A 2Y5PA 3Q8CA 2M56B 3UIPB 3ZTDA 2IJ0A 1WYWB 4RGTA 4PS8A 1I7HA 2PPHA 3TIXA 3P63A 4MJSA 4RF1A 5FR6A 2MBQA 1FPYA 3KW5B 1SE3A 3MJ5A 3LYYA 4NNJB 2KAJA 3DBHB 2HJ8A 4P6VF 3J9CA 4MM3B 4LTUA 2EMSA 1CMXB 2KVRA 2QCZA 3L13A 4BKSA 3ZUNA 1WF9A 2LMCA 5J17A 2A4ZA 3RT3B 3AEGB 4IM3A 3PGEA 4WIPA 1NYQA 5EE3A 4N59A 2EMTA 1D5MC 2V9HA 3RCZA 5D6JB 1XF5L 1B9RA 5KHQA 2R61A 3W1YA 4PYZA 2KXJA 3PS6A 3P4QB 3JW0X 1VLBA 4E74A 2KK8A 1E7UA 4LJOB 1J7CA 2K3UA 2RPVA 2C9WB 4N58A 1YIWA 4HLEA 2M1MA 4OVVA 2V4IB 4BOZB 5C3JB 2MWSB 3BK2A 4X57B 3PZ7A 3HM6X 4DXGA 1T0SC 2WS3B 3PZ8A 1M94A 2KQ4X 3RFZB 2WXPA 5E6NA 1RFKA 1C76A 2XN9C 1WFYA 4IWOA 2KMMA 1RLFA 1FFUA 4C4VA 1AW7A 3P42A 5CX3A 2BVCA 4MDKE 2IY1B 4GDKB 1V86A 3MFGA 2B3AA 1S3SG 3B2FA 2LEKA 4OZBA 1H7XA 2LGDA 4TSSA 4KX6B 2KACA 2RMMA 3BWUD 1XQQA 2V0GA 1YQBA 2FE8A 4KDIC 3WAMA 1QKZA 3KH0A 4LK0M 1UH6A 1WR1A 2SEBD 2WXMA 1J7AA 5AZFA 2CJOA 1MFWA 2K5PA 2WDRB 2MRPA 4J6IA 3AEBB 3GP7A 4G0NB 3A4SC 3M62B 2O6VA 1OFFA 1L2NA 2MP2A 3TCAA 5BYRA 5H92C 2G1EA 2FBWB 1TS5A 4HJKA 3ZDTA 2WXQA 3IFWB 2BB6A 4JQWC 2BPSA 1C79A 4WAAA 3TMPB 3APDA 2QDFA 4ANVA 2MBOA 3P4PB 1C4PA 2CHXA 3IVFA 4AJWA 1KFYB 2NPTA 3L10B 2V3PA 2KC1A 2AL6A 1KJTA 1WGDA 3BZDB 3TEWA 2K39A 3M3JA 5DPWA 2KN4A 2REXA 1V1OA 4HJGE 3KWLA 5BYSA 4H2AA 4XE0A 4REZA 4YL8A 4FA6A 1ROEA 2BKRB 4FHJA 4O1NA 1D3ZA 2ICIA 3ML9A 4K7WA 1LGRA 1EU4A 2J0JA 3PZDA 4WWPA 3CIRB 4KDLB 3ENEA 4PK1A 4HK2A 5AZHA 3C0RB 4RGMA 4IW0A 1RWSA 1VZ7A 2MCNB 1JWBD 3D32A 3P4RB 1SSNA 1MPEA 1TGZB 2TSSA 4US9A 1U4AA 2GBKA 4NJCA 1RAXA 4K1RB 5D2MB 4LNNA 1E10A 3TEZA 4A90A 1V5OA 3DBRB 1OQYA 4ACFA 2KJHB 3EECA 1YQ4B 1TKYA 2KD0A 2N0SB 3WA0A 5C1ZA 1KOTA 3Q2AC 1DOYA 1AARA 1E90A 2BF8B 4FULA 1P0RA 2LVQA 1FEHA 3R2IA 1ET6A 2KT7A 1WZ3A 4RCOA 2EELA 1GC7A 4W9EA 3PRPB 2K1FA 4JWUC 2PMVA 3I63C 2KZRA 5LXHA 4GDLA 4K81A 4BFRA 3ECIA 2H89B 3RZWC 5AUIA 4RM8A 2AQ1B 3KWVA 1TKGA 1PQSA 4ZYNA 1ZP0B 2KWUB 2GOWA 1RM6C 4WH4A 3QX1A 5BMGA 3RMKC 1SEBD 1UF0A 4NZLB 1NI3A 1OQQA 4HPMB 3NS8A 3U30A 4MH0E 1Y56A 2WXFA 2KJRA 2MQJA 3IAS1 2AWTA 1LQBA 1PDXA 1L4ZB 2H88B 1YD8U 1FXTB 1ET9A 1QZEA 1XCTL 4WQOB 1H8CA 4AJYB 2IDYA 2NVUI 4HRSA 2BYEA 5LXIB 2HE7A 2K8CA 2LRUA 2J42A 3HM3A 4ANWA 4DBGA 3Q3NC 1QOBA 5EE0A 2CHZA 2KMAA 3NVYA 3S2AA 2JF5A 2J7QB 2L52A 2L1AA 4CHKA 3MP9A 1XD3B 2Z8LA 1SE9A 1JWSD 1NEKB 3M95A 1JWUD 4YWGG 1K8RB 4EZKA 3N1ZC 2WXHA 4NAWA 2DYBA 2DYMA 4BKSD 3IHPC 2KANA 3RNFC 4M8NA 4RM9A 3PLVA 3N1YC 5IKCM 1C9FA 1QOGA 3CF4A 2KDBA 2KTRB 1WWTA 3V60A 3H8HA 2D2QA 1CZPA 1E5WA 1SIJA 2AX5A 1KLGD 3GB1A 2W3RA 2XK5B 5TSSA 1YX6B 3AN1A 1F52A 3B2GA 3X23A 1Y8RC 4MM3A 2RDBC 4P7IA 1C77A 3ZKJC 1P7EA 3HHMA 2FCNA 5JXVA 3U4EG 4FJYA 2XBBC 4K7UA 2W3SA 2PW9A 3ZIMA 5DPRA 4DK5A 2MBHA 1WGYA 3I57A 1RYJA 3DBLI 1XLPA 2JYTA 1NDDA 2JWZA 2C5LC 2WXLA 1LXDA 3R3MA 3VVWB 4AWJA 3AE3B 2GMIC 3DDCB 4PT5A 2D10A 4BBNF 2WHIA 3QHTA 1F2RI 3DOWA 1JROA 1FXIA 3GE3C 4NAMA 1I4GA 3EHVA 2G4DB 1MVKA 1KH0A 2C7NB 1ACCA 1I4QA 1L0XB 3AE5B 1ZOYB 1ZDXA 2I2YA 5G5HA 1TTNA 2A5UA 1I4PA 3ZO5B 4DHJB 2JVCA 2PVGC 3NHEB 4HPPA 2VZKD 1CJEA 1BXTA 1T0YA 3HUIA 3WCQA 3R8BA 1V1PB 2HTME 1SE4A 4AUQC 1N62A 1PGBA 2O6VD 3E9SA 2LZ6A 4KKIA 4AQ7A 1P9DU 4IM2A 2WXOA 4FADA 3TBLD 2W54A 1FXAA 1HTOA 2K9XA 3DPDA 2KX3A 2PKOA 5BO4B 1GC6A 4BKGA 1WM3A 1WRIA 1VZ6A 1AYFA 4KIKB 1F77A 1KRHA 3DBLB 2ZVOA 1SGHA 2I1KA 4C7YA 4EEWA 1D6EC 1WGGA 4RGOS 1S1QB 2ZEQA 4NJ7A 4GOCA 2FCMA 3TSSA 2KDFB 2SAKA 4RGNA 4G11A 1UWMA 2CHWA 2J0KA 3VTVA 5JHAA 2LI5A 3VHTC 4W9KA 1YQ3B 3ZW3A 2J4XA 4TMAB 2NTSA 2KO3A 2FIDA 2YVCA 3VH3B 2LUEA 3C8YA 1WXMA 2Q5WD 3N20C 5BYQA 4MH8A 3ZNGC 3FILB 1UGMA 2L76A 1VCBA 4LDTB 4KKJA 4LJPB 3FAHA 2MJEA 3ZNHB 3N9YC 2RDGA 2FCQA 2VH2A 1QQRA 2IBIB 3H7PA 4B0MA 3URYA 1C4AA 2INNE 1TY2A 4W9DA 3MTNB 1JW9D 2AQ2B 2PE6B 2ZJDA 2DZKA 2UWQA 1WXVA 2WXKA 1ZPSA 2D3BA 4WURA 4HEA1 3V6CB 2KWCA 2L32A 1L4DB 4XZ4A 1C1YB 4ARCA 4ASWC 1NENB 4MSQB 4C80A 3AE7B 1FIQA 2HTHA 1HEZE 2CKHB 2Z59B 1Z2MA 1E8YA 4C56C 2NBUA 4QAYA 2QIEB 4OZAA 4WJOA 4TQ0A 4B9KA 1JMLA 2IPKD 4HPLB 4GU2A 4JGHB 4JPSA 2JT4B 3HK0A 1H4RA 2GB1A 1E8WA 1VDVA 3VFKA 2GLSA 3V05A 4LNKA 2LVOA 3RNEC 1QOFA 2QHOA 5BMIA 2JYEA 2G4SA 1WGHA 1F1HA 2N9LA 1L0VB 2K22A 3BINA 4HKQA 3MC8A 3U7ZA 2BW2A 1N5WA 4URKA 2CR5A 1E7PB 4IG7B 4I6NB 3DBSA 1JRPA 2NBWB 5GMVA 4C7ZA 1P98A 2R2OA 5JZEB 3L4PA 2IO1B 1XLQA 4USAA 2FNJB 4MGKE 3A9JA 1Z5SB 1GAQB 4F1SA 3PRZA 1L6UA 2JY6A 4HDOA 3SHQA 4L1BA 2D5GA 2PIAA 4PYUA 3A9KB 2JRHA 2KWVB 4KGTA 3R66C 1Q1OA 2WGSA 3ALBA 1WMHB 1WX8A 1WJNA 1DYQA 4FBJB 2Z0DB 3DVNV 1L0YB 1E9MA 2L83A 4M02A 3Q3MC 3SFEB 4YSZB 2QEJC 3NVVA 4GMVA 4B6WA 3DHIC 2Z0EB 4II2B 4I6LB 3ONSA 4XWWA 1WJUA 3NZUA 2BWFA 3Q8BA 3ZGZA 2RSUA 1IYFA 4ZHOA 1EU3A 2WXRA 3AMZA 3W9CB 3EFCA 1SBBB 1SJHD 5EDSA 5FR3A 3VRBB 2INDC 4II3B 4BKTA 2WDVB 4LNFA 4ANXA 4M00A 1TZOA 1WIAA 3OJ3A 4M0WB 1PYWD 3Q8EA 5L83A 5HFYA 4CO7A 2KTRA 1IBXB 3PLUA 2NS5A 3Q3FA 2BGFA 4ARIA 5HHDG 3I3TB 4FN2A 4P1CC 2KFKB 4BBNC 4GIVA 1WY8A 1FCLA 1YN5A 2M0AA 2XK5A 4TKNA 5HI1A 3X0WA 2LGSA 1WX7A 4NY0A 3OJ4B 3U52E 4WJQA 1WYGA 3OAWA 3BIID 3OLMD 2ZVNA 4FXCA 4FJVB 3QAQA 1T3QA 1GG3A 3VH4B 3Q3OC 4TQ1A 3MHSD 4DDID 2YEPB 2C60A 1YN3A 3T3OA 4NJ6A 3VRAB 3B1LX 2DWQA 4IC7B 5H8YE 3RNAC 2FUG1 2W82A 3R7RA 4YTMB 2N1WA 5IOIA 3NVZA 4WWMA 3TEXA 3B08A 2KLGA 4LCDE 3RYTA 1UNSA 4JX1C 2LGXA 1UWXA 2E6XA 1TS2A 2L05A 2Y3AA 2L7RA 4MACA 1V2YA 1DOIA 4K3BA 3H9DA 1YX5B 1KLVA 3ZNID 3P1MA 4ANUA 2AEHA 1P1AA 1LM8B 3AE4B 3DWGC 5G2NA 2N4FA 2EKIA 1CK1A 2WQYB 2KKCA 4PS3A 1V1PA 2G45B 3TUOA 5MPOA 3PTFC 3Q3JA 4W9GA 2YLMA 3DCGA 1QLBB 5EE1A 5DCNA 3BK1A 2FCSA 2X38A 4YXDB 2KYWA 3WAPA 1BMLC 1FCCC 3ZXRA 2ZW1A 3GE8C 2GBJA 4KIKA 4TUUA 1HXYD 4GSWA 3ZJVA 3ABVB 5CHVC 2KDIA 1SXTA 1B1ZA 4RH6A 3RN9C 1PGXA 1J7BA 1F9JA 4DWFA 3P2BA 1JWAD 3QJZA 1R4MI 3UGBB 1MHHE 3SD5A 5IAAC 1J19A 3Q6BA 4EKUA 2JSVX 3K9PB 4M8MA 4DXFA 1GPXA 2GBRA 1KF6B 3Q14C 1TYGB 4DQOC 5LLIA 1TS4A 3ZNZB 2DAJA 4KGSA 2WDQB 2NCNA 4EE2A 1OEYA 1N63A 3IXSA 3DVGX 4HCPB 2VZKB 1GTEA 1FNWA 2AYOB 2BS3B 4B95A 3CMMB 2DAFA 5D3DA 4JL9A 4DXAB 4G3XB 1WZ0A 4ZRJA 2MSED 4BZAA 5FKAC 1D5ZC 1EF1A 1I4RA 1BUIC 3AV8A 2PEAA 3JYUA 1IPGA 4ZYSA 3RNBC 3KUZA 1GT8A 4EUTA 1VJKA 1ZUD2 3DHGC 4KVGB 3U2SC 1IGDA 3QIJA 3QQ8B 3ETRA 2OOBB 2KN5A 3AE2B 2NPTB 2KMCA 3DHHC 2L00B 1UD7A 3LDZE 5KHOA 3ZXVA 3A1QB 2N1VA 3NG0A 4OVZA 1H7WA 1HZ6A 1L5PA 4A3OA 2MBEA 3R2TA 2M17A 1XCQL 1R4MB 3MHZA 5D7GA 3ZQ4A 3GZNI 4W9FA 4BOSC 4DHZE 2JPHA 1MG8A 2RD0A 5E6PA 3QCAA 3L17A 2QC8A 3A4RA 4EZJA 4JLCA 4MELA 4KSLC 1GB1A 4WJNA 3DVNU 2YEPF 4ZRKA 1TJEA 2ZW0A 1XEEA 1XT9B 1MI0A 3Q8AA 2ZPNA 2CJNA 4MSMB 3KYCD 1FO4A 4GB9A 4L2YA 3VDZA 3W1SC 2N7DA 3T9LA 1GOZA 4YT0B 4W9IA 2N9PC 3HIZA 5D3IB 2ZPYA 3A9KA 1WJ6A 2D07B 4GDKA 3BVGA 4UDUC 2BQQA 1QILA 2BS4B 3CWIA 3JSVB 2LHEA 2WXIA 3ZJTA 4OZCA 1JQ4A 4CYEA 2DYOA 2J0MA 3QA8A 2Y5BB 3EUB2 1A5RA 5HG2A 3Q8FA 2IO2B 3RI7C 1R4NI 4ZRQA 1F2RC 3EC8A 3AH7A 2PLPA 2W55A 3PT2B 1EUVB 3O65B 3RUIB 2KFJA 1WR6E 2KQSA 3UIOB 2XEWA 1QF6A 1G6JA 3SU8X 1N60A 1J8CA 3SDLC 3NZSA 2N9XA 3TJPA 2WX0A 2DZMA 1PUTA 1GUAB 2JWUA 3E56A 2Y5CA 4HROA 3DQVA 1WXAA 1MHXA 3PSEB 4PS7A 4WWNA 4NPNA 2KQ7A 4HXDA 3VUYA 3IAM1 2BB5A 2VRRB 2LVPA 3JVZX 1UBQA 3HRDD 1KM7A 3N3KB 1IBXA 2WXJA 5JHBA 2KX0A 3CSFA 3P4SB 3KUCB 1FRDA 1JWMD 2KFKA 1JCKB 1WE7A 3RNCC 3BYYB 4XDDA 4YTNB 4BVUC 3U8ZA 3V62A 1PFDA 1OQRA 1SIFA 1LFDA 1WXSA 2KC2A 3I5JC 2L3ZA 1V6EA 3A33B 2WXGA 1UELA 1V80A 3AEFB 4AOFA 3I9V1 4IUMB 2HD5B 1E6EB 3LXFA 2LXAA 2EKEC 3UQBA 2WDTB 4ICUA 1K53A 2BYVE 3RD2A 5EE9A 1F0ZA 4DHJD 1NBFC 5G55A 4XGAB 2ZCCA 1MJDA 2BKFA 1TKEA 4A55A 1JALA 5LNK1 1R4NB 1FRRA 3WANA 1GNUA 4E71A 4LLGM 3AEDB 1V9JA 2DX5B 1FMAD 4A20A 4JWSC 3ZTCA 1YOVB 1FNVA 3QK0A 1IUEA 4A6QA 3VR9B 3IG3A 2ON8A 5DPTA 1ZDVA 3NOBA 5IN7A 1D5XC 2DZJA 2K6DB 2NMQA 4DHZB 3BY4B 1SF0A 4D2KA 2MW5A 5T8IA 3ZRCA 1YJ1A 2N9KA 3PHWB 3AE8B 2PTLA 1ZXHA 2BYTA 3NRZA 2KOXA 5CHWA 2IO3B 2MHJA 2KVZA 2MH7A 3HVZA 3PPAA 2PE9A 1Q0WB 1HZ5A 3AI5A 2LFIA 4NQLB 3L16A 1GJZA 4FJZA 3FKYA 4ICVA 3APFA 4ZDVA 2IGGA 2LJIA 2IY0B 1QOAA 1ESFA 1GTHA 4K7SA 5C2TB 1P7FA 3AE6B 4YTPB 2LXCA 4W9CA 4F7ZA 4LNOA 4HDQA 1K52A 3H6NA 3SEBA 2WLBA 4RF0A 3AEAB 1UUPA 1XLNA 2XNAC 1AWDA 4MGIE 3ZYYX 3SFDB 1WGRA 3OG5A 2KTFA 4AS1A 2ZZPB 1TY0A 4IDIA 3BYTB 1FFVA 1A70A 2FAZA 3EGRA 3UF8A 4DDGD 3W2DA 4LDTD 1WE6A 4FHKA 4J3OD 4M01A 2RR9A 3L08A 4XX5A 2O2VB 2K6QA 2RPQA 3BVMA 3QARA 2LGYA 1E8XA 2KJ6A 1KTKA 3NZ3A 4A8XC 2JZZA 1WX9A 3ML8A 4BAXA 5AUKA 5C23A 1ZW7A 3RZFA 1ENFA 2M8SA 2ASQA 1NYRA 3ZJUA 4L23A 2DBYA 2V4LA 3N1XC 4KZ0A 1TBEA 1ZKHA 2D3GA 2W9NA 3VTWA 1UGJA 4E3CA 3UINB 2PVOD 1HA5A 1L7YA 3R7QA 1YJIA 3NUHB 2NR2A 3WAOA 3DBRI 3HVDA 2MA9B 2CU1A 5HKHA 1BT0A 3IBEA 5CHFA 1CQVA 2NTTA 2KWDA 1J0GA 2WP9B 1C4CA 3VTUA 3NJTA 2BYFA 2INPE 1KLUD 2DNFA 1WRDB 2BT6A 2V3NA 3K9OB 1SB3C 2N9EB 3ZVVA 2QMTA 3UQAA 4HWIB 4RNAA 3U7DA 2WU5B 2MEKA 3GOEA 4RMAA 4GGQA 3A1QA 4GXBA 1N61A 2AQ3B 2V3SA 1T6BX 3V6EB 1OTRB 1LO5D 1TIFA 3VQIA 1EF5A 2GBMA 1E8ZA 3H7PB 4RFBA 2CU3A 4WAFA 1C78A 3AE1B 4IOIE 2BTEA 2LWPA 3AB5A 4MJSB 1YJJA 4OW0A 5L95C 3AU4A 1WI0A 1FD6A 3O13A 2N7EA 4KGRA 1V8CA 2E3TA 1UBIA 4WWOA 2FUHB 2QSDA 2LJ5A 3VUWA 2B76B 1XLOA 2M19A 4Q2JA 1XO3A 3AXCA 2D3AA 3L54A 4MEMA 2JU6X 2JXTA 1T0RC 4OHJA 2WXNA 2MBBB 2LRWA 2J52A 4GN1A 3W1SA 2FIFA 3EFUA 1QT9A 1XXGA 2J53A 1Q5WB 4EOYA 3AU5A 3FC4A 1TT5B 4KV2A 3GS2A 1HQRD 1K50A 3JSVA 4F8CB 4HKZE 3PVLA 5DPSA 1YNTE 3RULA 2HDEA 2JUOA 2V1YA 1EO6A 3C19A 3KQ4A 1AN8A 4MGZE 2OHFA 1DGJA 3M63B 2KDEB 1VZ8A 3WIMA 2WNMA 4MT5A 1L6VA 2IO0B 2D3CA 1UZXB 2IZVB 3NY5A 2LUMA 1WGKA 1R7SA 2JZ3B 1E7VA 4EZLA 3A9JB 3PREA 1NI2A 2R2QA 1GB4A 4S17A 4HCNB 4C4VB 3CSTA 4FLHA 2JXXA 2OEDA 2GBNA 5CTRC 3KYDD 1VD2A 2GI9A 4K3CA 5GXGB 3V3XA 2K8HA 1OEYJ 2KLCA 3DVGY 2ZNVC 3WALA 4B0EA 2WX1A 1K51A 2OJWA 3MJWA 3B0AA 4CQNA 3VXWA 3FILA 2ZNVB 2LHDA 1YN4A 4C00A 1WM2A 4YSYB 2MX2A 4JIOU 3T3NA 2DZIA 1E0ZA 1N6ZA 1ZE3D 2IYDB 3PV1A 5IO9A 2I38A 2MJDA 4WQMA 5G5GA 3UI3A 5D94A 2RGFA 2O6VB 2KDMA 2RDHA 2MP2B 3W5UB 3MC0B 4KZCA 3KUDB 2NBVB 3DWMA 2VH1A 1N5XA 3CF6E 3V61A 4NQKE 2ACZB 4OVUA 1V5TA 3N32A 1P3QU 1V97A 4XYCA 2UYZB 3MC9A 4S0RA 3QWZB 3PHXB 3ZRFA 2MJ3A 2L0FA 2M0XA 3KVFB 1I4XA 3L0WB 3PRMB 5AZGA 4P1BC 4IM0A 1RFAA 4R3DA 2DLBA 4YSXB 1T0QC 5TR5A 2QJLA 3SR6A 4ZRIA 4IWPA 4MGYE 1IP9A 1WXQA 2QILA 5E6JA 5JH5C 1I42A 4ZOHC 4IKGA 1WSPA 2C7MB 3TL5A 2JZPA 1EWYC 3N30A 2C7HA 1STEA 3H7SA 3H1UA 2WWZA 4N9F4 3IT4B 3RPFC 2ZCBA 2I1JA 1DOXA 4TV3A 1VRAB 2L0TA 2ONQA 4ITKA 4KSKC 2JRIB 1D4BA 1RRBA 2BWES 2HJ1A 1I4HA 5IP4D 1JRUA 3T8MA 5I4DA 4LNIA 2K8BA 1VR9A 1WMHA 1FM0D 4ZRPA 4G50A 3VR8B 3LB8C 3B9JA 2PJHA 3IT6B 3EA6A 2O2VA 5IA7A 3APCA 1ISNA 2KNBA 4GDLB 5E6OA 3QC8B 4W9LA 3ZDMC 3BVZA 2LGIA 2X8XX 3W5VB 4EFOA 2KHWB 5J18A 2IGHA 3LJ3A 2LD9A 1C3TA 3TEYA 3Q69A 5BMHA 1FNUA 1T5XD 2BBCA 2INCC 1EWCA 3GZNB
chains in the Genus database with same CATH topology
2IGGA 3VRAB 2LJIA 2JQRB 1QOAA 1ESFA 2DWQA 2WXHA 1GTHA 2DYMA 4XDCA 1TS3A 3AECB 3AM9A 5C2TB 1P7FA 1Q10A 3AE6B 5H8YE 4YTPB 4JE3B 2WU2B 1K52A 2IGDA 2FUG1 2W82A 3SEBA 2WLBA 4RF0A 3AEAB 4YTMB 1UUPA 1XLNA 2XNAC 4A9AA 3AE9B 1AWDA 3ZYYX 3SFDB 1YMHE 1EM7A 3NVZA 4WWMA 3TEXA 4AS1A 1IGCA 1C9FA 1QOGA 1TY0A 3CF4A 1UNSA 4JX1C 4IDIA 3BYTB 1FFVA 1A70A 1UWXA 1ZXIA 2E6XA 1M4VA 1TS2A 1WWTA 3KLSX 3EGRA 4XWTA 4M0WA 1SE2A 2JX5A 3H8HA 1CZPA 2Y3AA 3PO0A 3OWEB 3AEEB 4MACA 4GLSC 1DOIA 3W2DA 1SIJA 4J3OD 3NS1A 3P1MA 4N6EB 2AX5A 1KLGD 4US8A 3GB1A 2W3RA 5TSSA 3AN1A 3BVMA 3B2GA 1KTKA 3AE4B 3DWGC 3NZ3A 4A8XC 1C77A 5FK9C 1P7EA 2EKIA 4P16A 1PGAA 1CK1A 5JXVA 4ZHPA 2WQYB 3U4EG 5AUKA 1V1PA 1NVID 3NVWA 1SJED 1ENFA 2K0PA 2W3SA 3TUOA 5MPOA 2GRIA 2PW9A 2N7JA 1NYRA 2G9HD 3I57A 1RYJA 3ZJUA 4L23A 1XLPA 2JYTA 1QLBB 5EE1A 2BS2B 4NAWB 2WXLA 3Q8CA 2DBYA 2Y5PA 3BK1A 2M56B 2X38A 4YXDB 2IJ0A 3AE3B 4PT5A 1BMLC 1FCCC 2ZW1A 4RGTA 1UGJA 2PVOD 1I7HA 1F2RI 1HA5A 1JROA 1FXIA 1YJIA 3NUHB 3P63A 4NAMA 1I4GA 3HVDA 4RF1A 1MVKA 1HXYD 3ZJVA 1KH0A 1ACCA 1SE3A 1I4QA 1L0XB 3MJ5A 3ABVB 1CQVA 3AE5B 2NTTA 1ZOYB 3LYYA 1ZDXA 2KWDA 2WP9B 1SXTA 1C4CA 2I2YA 5G5HA 1B1ZA 2KAJA 2INPE 1KLUD 4RH6A 4P6VF 3J9CA 1I4PA 1PGXA 1J7BA 4MM3B 2PVGC 2BT6A 4LTUA 1JWAD 2V3NA 2VZKD 1CJEA 1BXTA 1SB3C 1MHHE 2LMCA 3HUIA 3WCQA 2QMTA 2JSVX 3R8BA 1V1PB 2HTME 4RNAA 3AEGB 4WIPA 5EE3A 4DXFA 1NYQA 1SE4A 2WU5B 2MEKA 4N59A 1GPXA 1KF6B 1N62A 1D5MC 1TYGB 4DQOC 1PGBA 3E9SA 1XF5L 1B9RA 1N61A 2AQ3B 1TS4A 1T6BX 2R61A 4KKIA 4KGSA 2WDQB 4AQ7A 3P4QB 1VLBA 2WXOA 4EE2A 2W54A 1FXAA 2K9XA 1LO5D 3VQIA 1N63A 3IXSA 2PKOA 2VZKB 1GTEA 1FNWA 1J7CA 4RFBA 2BS3B 2CU3A 4WAFA 1C78A 2K3UA 2RPVA 3AE1B 4N58A 1WRIA 4IOIE 1VZ6A 5D3DA 2BTEA 1AYFA 3AB5A 1F77A 1KRHA 1YJJA 2V4IB 4OW0A 5C3JB 5FKAC 1D5ZC 1I4RA 3BK2A 1BUIC 3PZ7A 4DXGA 4C7YA 2WS3B 3PZ8A 2KQ4X 1D6EC 1FD6A 3AV8A 3O13A 4RGOS 3RFZB 2WXPA 4KGRA 1V8CA 1RFKA 2E3TA 1C76A 4ZYSA 2XN9C 2QSDA 3TSSA 1GT8A 2KMMA 2B76B 2SAKA 1XLOA 4RGNA 1VJKA 1FFUA 2M19A 1ZUD2 1UWMA 4Q2JA 1XO3A 3U2SC 1IGDA 1AW7A 3P42A 1YQ3B 2J4XA 2JU6X 2JXTA 3ETRA 4TMAB 3AE2B 2NTSA 4OHJA 2WXNA 4GDKB 3MFGA 2J52A 3B2FA 3C8YA 2LEKA 4OZBA 2Q5WD 1H7XA 4TSSA 5BYQA 4KX6B 2KACA 3W1SA 2RMMA 3BWUD 2V0GA 4MH8A 1QT9A 1XXGA 2FE8A 2J53A 3FILB 4OVZA 1H7WA 1HZ6A 1L5PA 3FC4A 3R2TA 3GS2A 1HQRD 1XCQL 1K50A 4KKJA 3MHZA 5D7GA 1QKZA 3FAHA 3ZQ4A 2MJEA 4HKZE 4LK0M 3N9YC 2RDGA 1YNTE 2SEBD 2WXMA 1J7AA 2HDEA 1QQRA 2CJOA 3KQ4A 1AN8A 2OHFA 1DGJA 1VZ8A 4B0MA 3URYA 1GB1A 1C4AA 2K5PA 2INNE 1TY2A 2WDRB 2WNMA 4MT5A 1JW9D 1L6VA 2AQ2B 2YEPF 3AEBB 3GP7A 2WXKA 1TJEA 1ZPSA 2LUMA 2ZW0A 1WGKA 1XEEA 4WURA 1MI0A 1R7SA 4HEA1 3Q8AA 1OFFA 2L32A 5BYRA 5H92C 2G1EA 2FBWB 1L4DB 1TS5A 1GB4A 2CJNA 1FO4A 4ARCA 4L2YA 1NENB 4C80A 2WXQA 3AE7B 2BB6A 2OEDA 1C79A 1FIQA 2GI9A 1GOZA 5GXGB 4YT0B 1HEZE 3V3XA 3P4PB 1C4PA 5D3IB 4C56C 1KFYB 2QIEB 4OZAA 2V3PA 4B0EA 4TQ0A 1K51A 3BVGA 4UDUC 1JMLA 2IPKD 3BZDB 3TEWA 4JPSA 1QILA 2BS4B 3CWIA 2KN4A 4CQNA 2GB1A 4HJGE 1V1OA 2LHEA 3FILA 1VDVA 3KWLA 5BYSA 4H2AA 2WXIA 2LHDA 4OZCA 3V05A 3ZJTA 1YN4A 1JQ4A 2DYOA 4XE0A 4REZA 1QOFA 5BMIA 2JYEA 4YSYB 1ROEA 2N9LA 3T3NA 3EUB2 1L0VB 4O1NA 2K22A 1E0ZA 4HKQA 2ICIA 5HG2A 1ZE3D 1EU4A 3Q8FA 2BW2A 1N5WA 3U7ZA 2I38A 2MJDA 4WQMA 1E7PB 5G5GA 3UI3A 3CIRB 1JRPA 4ZRQA 1F2RC 3AH7A 2PLPA 2W55A 2KDMA 2RDHA 4C7ZA 4RGMA 1RWSA 1VZ7A 1JWBD 3W5UB 3L4PA 1QF6A 3MC0B 1N60A 3P4RB 1XLQA 4USAA 1SSNA 1PUTA 2JWUA 1MPEA 3E56A 2TSSA 2Y5CA 4HROA 4US9A 3DWMA 1N5XA 1GAQB 1MHXA 4NJCA 2ACZB 1E10A 1L6UA 4L1BA 2D5GA 2PIAA 4A90A 3TEZA 4KGTA 1V97A 3IAM1 2BB5A 1YQ4B 1TKYA 2N0SB 2MJ3A 1DOYA 1I4XA 3HRDD 1FEHA 1DYQA 3R2IA 1ET6A 1IBXA 2WXJA 1L0YB 1E9MA 2L83A 4RCOA 3P4SB 2EELA 3SFEB 4R3DA 1FRDA 2DLBA 1JWMD 4YSZB 4JWUC 1JCKB 2PMVA 2QEJC 4YSXB 3NVVA 2QJLA 3BYYB 3SR6A 2H89B 4XDDA 5AUIA 4YTNB 2AQ1B 3KWVA 1TKGA 1PFDA 1OQRA 1ZP0B 1WXQA 2QILA 5E6JA 1RM6C 4WH4A 5BMGA 4ZOHC 4IKGA 1WSPA 4XWWA 2WXGA 1SEBD 2JZPA 1EWYC 3AEFB 3Q8BA 3ZGZA 3I9V1 4NZLB 1STEA 1E6EB 1NI3A 3LXFA 1OQQA 4ZHOA 1EU3A 3IT4B 1K53A 5EE9A 3RPFC 1F0ZA 2WXRA 3AMZA 3W9CB 1DOXA 1Y56A 1VRAB 1TKEA 1SBBB 1SJHD 4A55A 1JALA 2WXFA 5FR3A 5LNK1 3VRBB 2ONQA 4ITKA 3IAS1 1FRRA 2WDVB 1D4BA 4LLGM 3AEDB 1TZOA 1PDXA 1FMAD 1L4ZB 1PYWD 3Q8EA 2H88B 4JWSC 5HFYA 1FNVA 1ET9A 1IUEA 4A6QA 3VR9B 1I4HA 2ON8A 1ZDVA 1XCTL 1IBXB 4ARIA 5I4DA 1D5XC 1VR9A 1FM0D 2NMQA 5HHDG 1SF0A 2IDYA 4ZRPA 4D2KA 3VR8B 4HRSA 3LB8C 3B9JA 5T8IA 3IT6B 3EA6A 1FCLA 1YN5A 2J42A 2M0AA 2N9KA 5HI1A 4GDLB 1QOBA 5EE0A 3AE8B 2PTLA 1ZXHA 2BYTA 3NVYA 3NRZA 3BVZA 2L52A 2LGIA 3U52E 3W5VB 2L1AA 3MP9A 1WYGA 3BIID 4FXCA 2IGHA 2MH7A 2Z8LA 3HVZA 1JWSD 1T3QA 1NEKB 3TEYA 3Q69A 1HZ5A 5BMHA 4TQ1A 2LFIA 1FNUA 1T5XD 2BBCA 1JWUD 4YWGG 2YEPB 1YN3A 1EWCA 3T3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVG C;  3VRA B;  2BT6 A;  4LTU A;  1JWA D;  1QOA A;  2JQR B;  2OHF A;  1DGJ A;  2DWQ A;  1CJE A;  1SB3 C;  3HRD D;  1GTH A;  2K5P A;  3HUI A;  3AEC B;  3AM9 A;  5C2T B;  5H8Y E;  2WDR B;  3AE6 B;  3WCQ A;  4YTP B;  1JW9 D;  1L6V A;  3AEB B;  1E9M A;  2L83 A;  2WU2 B;  3P4S B;  2HTM E;  1TJE A;  3AEG B;  2WLB A;  5EE3 A;  1WGK A;  3AEA B;  3SFE B;  4YTM B;  1NYQ A;  2WU5 B;  1FRD A;  1R7S A;  1XLN A;  1KF6 B;  4N59 A;  4A9A A;  1GPX A;  4YSZ B;  1OFF A;  3AE9 B;  1AWD A;  3ZYY X;  4JWU C;  3SFD B;  1N62 A;  1TYG B;  4YSX B;  5H92 C;  3NVV A;  2G1E A;  2QJL A;  2FBW B;  3NVZ A;  4WWM A;  3SR6 A;  1B9R A;  2H89 B;  1N61 A;  1QOG A;  3CF4 A;  4YTN B;  4JX1 C;  4IDI A;  5AUI A;  1FFV A;  2CJN A;  1A70 A;  1ZXI A;  1TKG A;  2WDQ B;  1FO4 A;  1NEN B;  1PFD A;  1OQR A;  3P4Q B;  4C80 A;  1WWT A;  3AE7 B;  1VLB A;  1ZP0 B;  2JX5 A;  1WXQ A;  1CZP A;  1FIQ A;  1FXA A;  2K9X A;  2W54 A;  4YT0 B;  3PO0 A;  5GXG B;  3AEE B;  1N63 A;  1RM6 C;  1DOI A;  3EUB 2;  1SIJ A;  3P4P B;  2PKO A;  4ZOH C;  1GTE A;  3NS1 A;  3P1M A;  1J7C A;  2AX5 A;  4N6E B;  2BS3 B;  2CU3 A;  1KFY B;  1EWY C;  2QIE B;  3AEF B;  4US8 A;  2W3R A;  3AE1 B;  3AN1 A;  4N58 A;  1E6E B;  1NI3 A;  1WRI A;  3B2G A;  1OQQ A;  3LXF A;  3AE4 B;  3DWG C;  4ZHO A;  1AYF A;  3AB5 A;  1KRH A;  1YJJ A;  5EE9 A;  5C3J B;  2BS4 B;  3RPF C;  1E0Z A;  1F0Z A;  2EKI A;  3CWI A;  4ZHP A;  3AMZ A;  2WQY B;  3W9C B;  4C7Y A;  1DOX A;  1VDV A;  2WS3 B;  3KWL A;  5AUK A;  1TKE A;  1JAL A;  1NVI D;  3AV8 A;  1JQ4 A;  3NVW A;  3VRB B;  4ITK A;  1V8C A;  1QOF A;  1FRR A;  1RFK A;  2E3T A;  2WDV B;  2W3S A;  5MPO A;  3AED B;  4YSY B;  1NYR A;  1PDX A;  1FMA D;  1ROE A;  1RYJ A;  2H88 B;  1GT8 A;  2KMM A;  2B76 B;  4JWS C;  1XLP A;  1L0V B;  1XLO A;  2K22 A;  1QLB B;  1IUE A;  1FFU A;  2BS2 B;  3VR9 B;  1VJK A;  1ZUD 2;  1UWM A;  2M19 A;  5EE1 A;  1XO3 A;  2DBY A;  2M56 B;  1N5W A;  1YQ3 B;  4YXD B;  2MJD A;  4WQM A;  1E7P B;  5G5G A;  3AE3 B;  3CIR B;  3ETR A;  3AE2 B;  1FM0 D;  1JRP A;  1SF0 A;  3VR8 B;  3AH7 A;  3LB8 C;  3B9J A;  2W55 A;  4HRS A;  4C7Z A;  2PVO D;  3B2F A;  1I7H A;  2LEK A;  2Q5W D;  1RWS A;  1H7X A;  1JRO A;  1JWB D;  3W5U B;  4KX6 B;  1FXI A;  1YJI A;  3L4P A;  1QF6 A;  1N60 A;  1QOB A;  3AE8 B;  3P4R B;  1XLQ A;  3P63 A;  4USA A;  5EE0 A;  1QT9 A;  1PUT A;  1H7W A;  1L5P A;  3FC4 A;  3NVY A;  2Y5C A;  3NRZ A;  4HRO A;  4US9 A;  3DWM A;  2L52 A;  1N5X A;  1GAQ B;  3W5V B;  2ACZ B;  1WYG A;  1E10 A;  1L6U A;  3BII D;  3FAH A;  3ABV B;  4FXC A;  2MJE A;  2MH7 A;  3HVZ A;  2PIA A;  3AE5 B;  1ZOY B;  1T3Q A;  1NEK B;  1V97 A;  2WP9 B;  5G5H A;  2KAJ A;  1YQ4 B;  1J7A A;  1TKY A;  2N0S B;  4P6V F;  2CJO A;  2MJ3 A;  1J7B A;  1DOY A; 
#chains in the Genus database with same CATH topology
 2JQR B;  2L8J A;  4XDC A;  1TS3 A;  3AEC B;  3AM9 A;  1Q10 A;  4JE3 B;  4AP4 C;  2WU2 B;  2IGD A;  4XC2 A;  3DBH I;  3ZLZ A;  4A9A A;  3AE9 B;  2DHZ A;  1YMH E;  4I6P A;  1EM7 A;  2D11 A;  1IGC A;  1ZXI A;  1TZ1 A;  1V81 A;  1M4V A;  3AUL A;  3KLS X;  4W9J A;  1WH3 A;  2WYQ A;  4XWT A;  4M0W A;  1SE2 A;  2JX5 A;  3PO0 A;  3OWE B;  3AEE B;  2G3Q B;  4GLS C;  3RNG C;  1HTQ A;  2AL3 A;  3NS1 A;  1ZGU B;  4N6E B;  1OGW A;  4A3P A;  4US8 A;  1X1M A;  2UU7 A;  4WJP A;  3VUX A;  2M4N A;  4HVB A;  2DEN B;  1MG4 A;  5FK9 C;  2CS4 A;  4P16 A;  1PGA A;  4IWQ A;  4W9H A;  4ZHP A;  1V49 A;  2LAS A;  1NVI D;  3NVW A;  1SJE D;  2MLB A;  1WJ4 A;  2OJR A;  2K0P A;  2GRI A;  2N7J A;  5AEK B;  3VAW A;  1HE8 A;  2G9H D;  1I35 A;  5J2R A;  2BS2 B;  4NAW B;  2K25 A;  2Y5P A;  3Q8C A;  2M56 B;  3UIP B;  3ZTD A;  2IJ0 A;  1WYW B;  4RGT A;  4PS8 A;  1I7H A;  2PPH A;  3TIX A;  3P63 A;  4MJS A;  4RF1 A;  5FR6 A;  2MBQ A;  1FPY A;  3KW5 B;  1SE3 A;  3MJ5 A;  3LYY A;  4NNJ B;  2KAJ A;  3DBH B;  2HJ8 A;  4P6V F;  3J9C A;  4MM3 B;  4LTU A;  2EMS A;  1CMX B;  2KVR A;  2QCZ A;  3L13 A;  4BKS A;  3ZUN A;  1WF9 A;  2LMC A;  5J17 A;  2A4Z A;  3RT3 B;  3AEG B;  4IM3 A;  3PGE A;  4WIP A;  1NYQ A;  5EE3 A;  4N59 A;  2EMT A;  1D5M C;  2V9H A;  3RCZ A;  5D6J B;  1XF5 L;  1B9R A;  5KHQ A;  2R61 A;  3W1Y A;  4PYZ A;  2KXJ A;  3PS6 A;  3P4Q B;  3JW0 X;  1VLB A;  4E74 A;  2KK8 A;  1E7U A;  4LJO B;  1J7C A;  2K3U A;  2RPV A;  2C9W B;  4N58 A;  1YIW A;  4HLE A;  2M1M A;  4OVV A;  2V4I B;  4BOZ B;  5C3J B;  2MWS B;  3BK2 A;  4X57 B;  3PZ7 A;  3HM6 X;  4DXG A;  1T0S C;  2WS3 B;  3PZ8 A;  1M94 A;  2KQ4 X;  3RFZ B;  2WXP A;  5E6N A;  1RFK A;  1C76 A;  2XN9 C;  1WFY A;  4IWO A;  2KMM A;  1RLF A;  1FFU A;  4C4V A;  1AW7 A;  3P42 A;  5CX3 A;  2BVC A;  4MDK E;  2IY1 B;  4GDK B;  1V86 A;  3MFG A;  2B3A A;  1S3S G;  3B2F A;  2LEK A;  4OZB A;  1H7X A;  2LGD A;  4TSS A;  4KX6 B;  2KAC A;  2RMM A;  3BWU D;  1XQQ A;  2V0G A;  1YQB A;  2FE8 A;  4KDI C;  3WAM A;  1QKZ A;  3KH0 A;  4LK0 M;  1UH6 A;  1WR1 A;  2SEB D;  2WXM A;  1J7A A;  5AZF A;  2CJO A;  1MFW A;  2K5P A;  2WDR B;  2MRP A;  4J6I A;  3AEB B;  3GP7 A;  4G0N B;  3A4S C;  3M62 B;  2O6V A;  1OFF A;  1L2N A;  2MP2 A;  3TCA A;  5BYR A;  5H92 C;  2G1E A;  2FBW B;  1TS5 A;  4HJK A;  3ZDT A;  2WXQ A;  3IFW B;  2BB6 A;  4JQW C;  2BPS A;  1C79 A;  4WAA A;  3TMP B;  3APD A;  2QDF A;  4ANV A;  2MBO A;  3P4P B;  1C4P A;  2CHX A;  3IVF A;  4AJW A;  1KFY B;  2NPT A;  3L10 B;  2V3P A;  2KC1 A;  2AL6 A;  1KJT A;  1WGD A;  3BZD B;  3TEW A;  2K39 A;  3M3J A;  5DPW A;  2KN4 A;  2REX A;  1V1O A;  4HJG E;  3KWL A;  5BYS A;  4H2A A;  4XE0 A;  4REZ A;  4YL8 A;  4FA6 A;  1ROE A;  2BKR B;  4FHJ A;  4O1N A;  1D3Z A;  2ICI A;  3ML9 A;  4K7W A;  1LGR A;  1EU4 A;  2J0J A;  3PZD A;  4WWP A;  3CIR B;  4KDL B;  3ENE A;  4PK1 A;  4HK2 A;  5AZH A;  3C0R B;  4RGM A;  4IW0 A;  1RWS A;  1VZ7 A;  2MCN B;  1JWB D;  3D32 A;  3P4R B;  1SSN A;  1MPE A;  1TGZ B;  2TSS A;  4US9 A;  1U4A A;  2GBK A;  4NJC A;  1RAX A;  4K1R B;  5D2M B;  4LNN A;  1E10 A;  3TEZ A;  4A90 A;  1V5O A;  3DBR B;  1OQY A;  4ACF A;  2KJH B;  3EEC A;  1YQ4 B;  1TKY A;  2KD0 A;  2N0S B;  3WA0 A;  5C1Z A;  1KOT A;  3Q2A C;  1DOY A;  1AAR A;  1E90 A;  2BF8 B;  4FUL A;  1P0R A;  2LVQ A;  1FEH A;  3R2I A;  1ET6 A;  2KT7 A;  1WZ3 A;  4RCO A;  2EEL A;  1GC7 A;  4W9E A;  3PRP B;  2K1F A;  4JWU C;  2PMV A;  3I63 C;  2KZR A;  5LXH A;  4GDL A;  4K81 A;  4BFR A;  3ECI A;  2H89 B;  3RZW C;  5AUI A;  4RM8 A;  2AQ1 B;  3KWV A;  1TKG A;  1PQS A;  4ZYN A;  1ZP0 B;  2KWU B;  2GOW A;  1RM6 C;  4WH4 A;  3QX1 A;  5BMG A;  3RMK C;  1SEB D;  1UF0 A;  4NZL B;  1NI3 A;  1OQQ A;  4HPM B;  3NS8 A;  3U30 A;  4MH0 E;  1Y56 A;  2WXF A;  2KJR A;  2MQJ A;  3IAS 1;  2AWT A;  1LQB A;  1PDX A;  1L4Z B;  2H88 B;  1YD8 U;  1FXT B;  1ET9 A;  1QZE A;  1XCT L;  4WQO B;  1H8C A;  4AJY B;  2IDY A;  2NVU I;  4HRS A;  2BYE A;  5LXI B;  2HE7 A;  2K8C A;  2LRU A;  2J42 A;  3HM3 A;  4ANW A;  4DBG A;  3Q3N C;  1QOB A;  5EE0 A;  2CHZ A;  2KMA A;  3NVY A;  3S2A A;  2JF5 A;  2J7Q B;  2L52 A;  2L1A A;  4CHK A;  3MP9 A;  1XD3 B;  2Z8L A;  1SE9 A;  1JWS D;  1NEK B;  3M95 A;  1JWU D;  4YWG G;  1K8R B;  4EZK A;  3N1Z C;  2WXH A;  4NAW A;  2DYB A;  2DYM A;  4BKS D;  3IHP C;  2KAN A;  3RNF C;  4M8N A;  4RM9 A;  3PLV A;  3N1Y C;  5IKC M;  1C9F A;  1QOG A;  3CF4 A;  2KDB A;  2KTR B;  1WWT A;  3V60 A;  3H8H A;  2D2Q A;  1CZP A;  1E5W A;  1SIJ A;  2AX5 A;  1KLG D;  3GB1 A;  2W3R A;  2XK5 B;  5TSS A;  1YX6 B;  3AN1 A;  1F52 A;  3B2G A;  3X23 A;  1Y8R C;  4MM3 A;  2RDB C;  4P7I A;  1C77 A;  3ZKJ C;  1P7E A;  3HHM A;  2FCN A;  5JXV A;  3U4E G;  4FJY A;  2XBB C;  4K7U A;  2W3S A;  2PW9 A;  3ZIM A;  5DPR A;  4DK5 A;  2MBH A;  1WGY A;  3I57 A;  1RYJ A;  3DBL I;  1XLP A;  2JYT A;  1NDD A;  2JWZ A;  2C5L C;  2WXL A;  1LXD A;  3R3M A;  3VVW B;  4AWJ A;  3AE3 B;  2GMI C;  3DDC B;  4PT5 A;  2D10 A;  4BBN F;  2WHI A;  3QHT A;  1F2R I;  3DOW A;  1JRO A;  1FXI A;  3GE3 C;  4NAM A;  1I4G A;  3EHV A;  2G4D B;  1MVK A;  1KH0 A;  2C7N B;  1ACC A;  1I4Q A;  1L0X B;  3AE5 B;  1ZOY B;  1ZDX A;  2I2Y A;  5G5H A;  1TTN A;  2A5U A;  1I4P A;  3ZO5 B;  4DHJ B;  2JVC A;  2PVG C;  3NHE B;  4HPP A;  2VZK D;  1CJE A;  1BXT A;  1T0Y A;  3HUI A;  3WCQ A;  3R8B A;  1V1P B;  2HTM E;  1SE4 A;  4AUQ C;  1N62 A;  1PGB A;  2O6V D;  3E9S A;  2LZ6 A;  4KKI A;  4AQ7 A;  1P9D U;  4IM2 A;  2WXO A;  4FAD A;  3TBL D;  2W54 A;  1FXA A;  1HTO A;  2K9X A;  3DPD A;  2KX3 A;  2PKO A;  5BO4 B;  1GC6 A;  4BKG A;  1WM3 A;  1WRI A;  1VZ6 A;  1AYF A;  4KIK B;  1F77 A;  1KRH A;  3DBL B;  2ZVO A;  1SGH A;  2I1K A;  4C7Y A;  4EEW A;  1D6E C;  1WGG A;  4RGO S;  1S1Q B;  2ZEQ A;  4NJ7 A;  4GOC A;  2FCM A;  3TSS A;  2KDF B;  2SAK A;  4RGN A;  4G11 A;  1UWM A;  2CHW A;  2J0K A;  3VTV A;  5JHA A;  2LI5 A;  3VHT C;  4W9K A;  1YQ3 B;  3ZW3 A;  2J4X A;  4TMA B;  2NTS A;  2KO3 A;  2FID A;  2YVC A;  3VH3 B;  2LUE A;  3C8Y A;  1WXM A;  2Q5W D;  3N20 C;  5BYQ A;  4MH8 A;  3ZNG C;  3FIL B;  1UGM A;  2L76 A;  1VCB A;  4LDT B;  4KKJ A;  4LJP B;  3FAH A;  2MJE A;  3ZNH B;  3N9Y C;  2RDG A;  2FCQ A;  2VH2 A;  1QQR A;  2IBI B;  3H7P A;  4B0M A;  3URY A;  1C4A A;  2INN E;  1TY2 A;  4W9D A;  3MTN B;  1JW9 D;  2AQ2 B;  2PE6 B;  2ZJD A;  2DZK A;  2UWQ A;  1WXV A;  2WXK A;  1ZPS A;  2D3B A;  4WUR A;  4HEA 1;  3V6C B;  2KWC A;  2L32 A;  1L4D B;  4XZ4 A;  1C1Y B;  4ARC A;  4ASW C;  1NEN B;  4MSQ B;  4C80 A;  3AE7 B;  1FIQ A;  2HTH A;  1HEZ E;  2CKH B;  2Z59 B;  1Z2M A;  1E8Y A;  4C56 C;  2NBU A;  4QAY A;  2QIE B;  4OZA A;  4WJO A;  4TQ0 A;  4B9K A;  1JML A;  2IPK D;  4HPL B;  4GU2 A;  4JGH B;  4JPS A;  2JT4 B;  3HK0 A;  1H4R A;  2GB1 A;  1E8W A;  1VDV A;  3VFK A;  2GLS A;  3V05 A;  4LNK A;  2LVO A;  3RNE C;  1QOF A;  2QHO A;  5BMI A;  2JYE A;  2G4S A;  1WGH A;  1F1H A;  2N9L A;  1L0V B;  2K22 A;  3BIN A;  4HKQ A;  3MC8 A;  3U7Z A;  2BW2 A;  1N5W A;  4URK A;  2CR5 A;  1E7P B;  4IG7 B;  4I6N B;  3DBS A;  1JRP A;  2NBW B;  5GMV A;  4C7Z A;  1P98 A;  2R2O A;  5JZE B;  3L4P A;  2IO1 B;  1XLQ A;  4USA A;  2FNJ B;  4MGK E;  3A9J A;  1Z5S B;  1GAQ B;  4F1S A;  3PRZ A;  1L6U A;  2JY6 A;  4HDO A;  3SHQ A;  4L1B A;  2D5G A;  2PIA A;  4PYU A;  3A9K B;  2JRH A;  2KWV B;  4KGT A;  3R66 C;  1Q1O A;  2WGS A;  3ALB A;  1WMH B;  1WX8 A;  1WJN A;  1DYQ A;  4FBJ B;  2Z0D B;  3DVN V;  1L0Y B;  1E9M A;  2L83 A;  4M02 A;  3Q3M C;  3SFE B;  4YSZ B;  2QEJ C;  3NVV A;  4GMV A;  4B6W A;  3DHI C;  2Z0E B;  4II2 B;  4I6L B;  3ONS A;  4XWW A;  1WJU A;  3NZU A;  2BWF A;  3Q8B A;  3ZGZ A;  2RSU A;  1IYF A;  4ZHO A;  1EU3 A;  2WXR A;  3AMZ A;  3W9C B;  3EFC A;  1SBB B;  1SJH D;  5EDS A;  5FR3 A;  3VRB B;  2IND C;  4II3 B;  4BKT A;  2WDV B;  4LNF A;  4ANX A;  4M00 A;  1TZO A;  1WIA A;  3OJ3 A;  4M0W B;  1PYW D;  3Q8E A;  5L83 A;  5HFY A;  4CO7 A;  2KTR A;  1IBX B;  3PLU A;  2NS5 A;  3Q3F A;  2BGF A;  4ARI A;  5HHD G;  3I3T B;  4FN2 A;  4P1C C;  2KFK B;  4BBN C;  4GIV A;  1WY8 A;  1FCL A;  1YN5 A;  2M0A A;  2XK5 A;  4TKN A;  5HI1 A;  3X0W A;  2LGS A;  1WX7 A;  4NY0 A;  3OJ4 B;  3U52 E;  4WJQ A;  1WYG A;  3OAW A;  3BII D;  3OLM D;  2ZVN A;  4FXC A;  4FJV B;  3QAQ A;  1T3Q A;  1GG3 A;  3VH4 B;  3Q3O C;  4TQ1 A;  3MHS D;  4DDI D;  2YEP B;  2C60 A;  1YN3 A;  3T3O A;  4NJ6 A;  3VRA B;  3B1L X;  2DWQ A;  4IC7 B;  5H8Y E;  3RNA C;  2FUG 1;  2W82 A;  3R7R A;  4YTM B;  2N1W A;  5IOI A;  3NVZ A;  4WWM A;  3TEX A;  3B08 A;  2KLG A;  4LCD E;  3RYT A;  1UNS A;  4JX1 C;  2LGX A;  1UWX A;  2E6X A;  1TS2 A;  2L05 A;  2Y3A A;  2L7R A;  4MAC A;  1V2Y A;  1DOI A;  4K3B A;  3H9D A;  1YX5 B;  1KLV A;  3ZNI D;  3P1M A;  4ANU A;  2AEH A;  1P1A A;  1LM8 B;  3AE4 B;  3DWG C;  5G2N A;  2N4F A;  2EKI A;  1CK1 A;  2WQY B;  2KKC A;  4PS3 A;  1V1P A;  2G45 B;  3TUO A;  5MPO A;  3PTF C;  3Q3J A;  4W9G A;  2YLM A;  3DCG A;  1QLB B;  5EE1 A;  5DCN A;  3BK1 A;  2FCS A;  2X38 A;  4YXD B;  2KYW A;  3WAP A;  1BML C;  1FCC C;  3ZXR A;  2ZW1 A;  3GE8 C;  2GBJ A;  4KIK A;  4TUU A;  1HXY D;  4GSW A;  3ZJV A;  3ABV B;  5CHV C;  2KDI A;  1SXT A;  1B1Z A;  4RH6 A;  3RN9 C;  1PGX A;  1J7B A;  1F9J A;  4DWF A;  3P2B A;  1JWA D;  3QJZ A;  1R4M I;  3UGB B;  1MHH E;  3SD5 A;  5IAA C;  1J19 A;  3Q6B A;  4EKU A;  2JSV X;  3K9P B;  4M8M A;  4DXF A;  1GPX A;  2GBR A;  1KF6 B;  3Q14 C;  1TYG B;  4DQO C;  5LLI A;  1TS4 A;  3ZNZ B;  2DAJ A;  4KGS A;  2WDQ B;  2NCN A;  4EE2 A;  1OEY A;  1N63 A;  3IXS A;  3DVG X;  4HCP B;  2VZK B;  1GTE A;  1FNW A;  2AYO B;  2BS3 B;  4B95 A;  3CMM B;  2DAF A;  5D3D A;  4JL9 A;  4DXA B;  4G3X B;  1WZ0 A;  4ZRJ A;  2MSE D;  4BZA A;  5FKA C;  1D5Z C;  1EF1 A;  1I4R A;  1BUI C;  3AV8 A;  2PEA A;  3JYU A;  1IPG A;  4ZYS A;  3RNB C;  3KUZ A;  1GT8 A;  4EUT A;  1VJK A;  1ZUD 2;  3DHG C;  4KVG B;  3U2S C;  1IGD A;  3QIJ A;  3QQ8 B;  3ETR A;  2OOB B;  2KN5 A;  3AE2 B;  2NPT B;  2KMC A;  3DHH C;  2L00 B;  1UD7 A;  3LDZ E;  5KHO A;  3ZXV A;  3A1Q B;  2N1V A;  3NG0 A;  4OVZ A;  1H7W A;  1HZ6 A;  1L5P A;  4A3O A;  2MBE A;  3R2T A;  2M17 A;  1XCQ L;  1R4M B;  3MHZ A;  5D7G A;  3ZQ4 A;  3GZN I;  4W9F A;  4BOS C;  4DHZ E;  2JPH A;  1MG8 A;  2RD0 A;  5E6P A;  3QCA A;  3L17 A;  2QC8 A;  3A4R A;  4EZJ A;  4JLC A;  4MEL A;  4KSL C;  1GB1 A;  4WJN A;  3DVN U;  2YEP F;  4ZRK A;  1TJE A;  2ZW0 A;  1XEE A;  1XT9 B;  1MI0 A;  3Q8A A;  2ZPN A;  2CJN A;  4MSM B;  3KYC D;  1FO4 A;  4GB9 A;  4L2Y A;  3VDZ A;  3W1S C;  2N7D A;  3T9L A;  1GOZ A;  4YT0 B;  4W9I A;  2N9P C;  3HIZ A;  5D3I B;  2ZPY A;  3A9K A;  1WJ6 A;  2D07 B;  4GDK A;  3BVG A;  4UDU C;  2BQQ A;  1QIL A;  2BS4 B;  3CWI A;  3JSV B;  2LHE A;  2WXI A;  3ZJT A;  4OZC A;  1JQ4 A;  4CYE A;  2DYO A;  2J0M A;  3QA8 A;  2Y5B B;  3EUB 2;  1A5R A;  5HG2 A;  3Q8F A;  2IO2 B;  3RI7 C;  1R4N I;  4ZRQ A;  1F2R C;  3EC8 A;  3AH7 A;  2PLP A;  2W55 A;  3PT2 B;  1EUV B;  3O65 B;  3RUI B;  2KFJ A;  1WR6 E;  2KQS A;  3UIO B;  2XEW A;  1QF6 A;  1G6J A;  3SU8 X;  1N60 A;  1J8C A;  3SDL C;  3NZS A;  2N9X A;  3TJP A;  2WX0 A;  2DZM A;  1PUT A;  1GUA B;  2JWU A;  3E56 A;  2Y5C A;  4HRO A;  3DQV A;  1WXA A;  1MHX A;  3PSE B;  4PS7 A;  4WWN A;  4NPN A;  2KQ7 A;  4HXD A;  3VUY A;  3IAM 1;  2BB5 A;  2VRR B;  2LVP A;  3JVZ X;  1UBQ A;  3HRD D;  1KM7 A;  3N3K B;  1IBX A;  2WXJ A;  5JHB A;  2KX0 A;  3CSF A;  3P4S B;  3KUC B;  1FRD A;  1JWM D;  2KFK A;  1JCK B;  1WE7 A;  3RNC C;  3BYY B;  4XDD A;  4YTN B;  4BVU C;  3U8Z A;  3V62 A;  1PFD A;  1OQR A;  1SIF A;  1LFD A;  1WXS A;  2KC2 A;  3I5J C;  2L3Z A;  1V6E A;  3A33 B;  2WXG A;  1UEL A;  1V80 A;  3AEF B;  4AOF A;  3I9V 1;  4IUM B;  2HD5 B;  1E6E B;  3LXF A;  2LXA A;  2EKE C;  3UQB A;  2WDT B;  4ICU A;  1K53 A;  2BYV E;  3RD2 A;  5EE9 A;  1F0Z A;  4DHJ D;  1NBF C;  5G55 A;  4XGA B;  2ZCC A;  1MJD A;  2BKF A;  1TKE A;  4A55 A;  1JAL A;  5LNK 1;  1R4N B;  1FRR A;  3WAN A;  1GNU A;  4E71 A;  4LLG M;  3AED B;  1V9J A;  2DX5 B;  1FMA D;  4A20 A;  4JWS C;  3ZTC A;  1YOV B;  1FNV A;  3QK0 A;  1IUE A;  4A6Q A;  3VR9 B;  3IG3 A;  2ON8 A;  5DPT A;  1ZDV A;  3NOB A;  5IN7 A;  1D5X C;  2DZJ A;  2K6D B;  2NMQ A;  4DHZ B;  3BY4 B;  1SF0 A;  4D2K A;  2MW5 A;  5T8I A;  3ZRC A;  1YJ1 A;  2N9K A;  3PHW B;  3AE8 B;  2PTL A;  1ZXH A;  2BYT A;  3NRZ A;  2KOX A;  5CHW A;  2IO3 B;  2MHJ A;  2KVZ A;  2MH7 A;  3HVZ A;  3PPA A;  2PE9 A;  1Q0W B;  1HZ5 A;  3AI5 A;  2LFI A;  4NQL B;  3L16 A;  1GJZ A;  4FJZ A;  3FKY A;  4ICV A;  3APF A;  4ZDV A;  2IGG A;  2LJI A;  2IY0 B;  1QOA A;  1ESF A;  1GTH A;  4K7S A;  5C2T B;  1P7F A;  3AE6 B;  4YTP B;  2LXC A;  4W9C A;  4F7Z A;  4LNO A;  4HDQ A;  1K52 A;  3H6N A;  3SEB A;  2WLB A;  4RF0 A;  3AEA B;  1UUP A;  1XLN A;  2XNA C;  1AWD A;  4MGI E;  3ZYY X;  3SFD B;  1WGR A;  3OG5 A;  2KTF A;  4AS1 A;  2ZZP B;  1TY0 A;  4IDI A;  3BYT B;  1FFV A;  1A70 A;  2FAZ A;  3EGR A;  3UF8 A;  4DDG D;  3W2D A;  4LDT D;  1WE6 A;  4FHK A;  4J3O D;  4M01 A;  2RR9 A;  3L08 A;  4XX5 A;  2O2V B;  2K6Q A;  2RPQ A;  3BVM A;  3QAR A;  2LGY A;  1E8X A;  2KJ6 A;  1KTK A;  3NZ3 A;  4A8X C;  2JZZ A;  1WX9 A;  3ML8 A;  4BAX A;  5AUK A;  5C23 A;  1ZW7 A;  3RZF A;  1ENF A;  2M8S A;  2ASQ A;  1NYR A;  3ZJU A;  4L23 A;  2DBY A;  2V4L A;  3N1X C;  4KZ0 A;  1TBE A;  1ZKH A;  2D3G A;  2W9N A;  3VTW A;  1UGJ A;  4E3C A;  3UIN B;  2PVO D;  1HA5 A;  1L7Y A;  3R7Q A;  1YJI A;  3NUH B;  2NR2 A;  3WAO A;  3DBR I;  3HVD A;  2MA9 B;  2CU1 A;  5HKH A;  1BT0 A;  3IBE A;  5CHF A;  1CQV A;  2NTT A;  2KWD A;  1J0G A;  2WP9 B;  1C4C A;  3VTU A;  3NJT A;  2BYF A;  2INP E;  1KLU D;  2DNF A;  1WRD B;  2BT6 A;  2V3N A;  3K9O B;  1SB3 C;  2N9E B;  3ZVV A;  2QMT A;  3UQA A;  4HWI B;  4RNA A;  3U7D A;  2WU5 B;  2MEK A;  3GOE A;  4RMA A;  4GGQ A;  3A1Q A;  4GXB A;  1N61 A;  2AQ3 B;  2V3S A;  1T6B X;  3V6E B;  1OTR B;  1LO5 D;  1TIF A;  3VQI A;  1EF5 A;  2GBM A;  1E8Z A;  3H7P B;  4RFB A;  2CU3 A;  4WAF A;  1C78 A;  3AE1 B;  4IOI E;  2BTE A;  2LWP A;  3AB5 A;  4MJS B;  1YJJ A;  4OW0 A;  5L95 C;  3AU4 A;  1WI0 A;  1FD6 A;  3O13 A;  2N7E A;  4KGR A;  1V8C A;  2E3T A;  1UBI A;  4WWO A;  2FUH B;  2QSD A;  2LJ5 A;  3VUW A;  2B76 B;  1XLO A;  2M19 A;  4Q2J A;  1XO3 A;  3AXC A;  2D3A A;  3L54 A;  4MEM A;  2JU6 X;  2JXT A;  1T0R C;  4OHJ A;  2WXN A;  2MBB B;  2LRW A;  2J52 A;  4GN1 A;  3W1S A;  2FIF A;  3EFU A;  1QT9 A;  1XXG A;  2J53 A;  1Q5W B;  4EOY A;  3AU5 A;  3FC4 A;  1TT5 B;  4KV2 A;  3GS2 A;  1HQR D;  1K50 A;  3JSV A;  4F8C B;  4HKZ E;  3PVL A;  5DPS A;  1YNT E;  3RUL A;  2HDE A;  2JUO A;  2V1Y A;  1EO6 A;  3C19 A;  3KQ4 A;  1AN8 A;  4MGZ E;  2OHF A;  1DGJ A;  3M63 B;  2KDE B;  1VZ8 A;  3WIM A;  2WNM A;  4MT5 A;  1L6V A;  2IO0 B;  2D3C A;  1UZX B;  2IZV B;  3NY5 A;  2LUM A;  1WGK A;  1R7S A;  2JZ3 B;  1E7V A;  4EZL A;  3A9J B;  3PRE A;  1NI2 A;  2R2Q A;  1GB4 A;  4S17 A;  4HCN B;  4C4V B;  3CST A;  4FLH A;  2JXX A;  2OED A;  2GBN A;  5CTR C;  3KYD D;  1VD2 A;  2GI9 A;  4K3C A;  5GXG B;  3V3X A;  2K8H A;  1OEY J;  2KLC A;  3DVG Y;  2ZNV C;  3WAL A;  4B0E A;  2WX1 A;  1K51 A;  2OJW A;  3MJW A;  3B0A A;  4CQN A;  3VXW A;  3FIL A;  2ZNV B;  2LHD A;  1YN4 A;  4C00 A;  1WM2 A;  4YSY B;  2MX2 A;  4JIO U;  3T3N A;  2DZI A;  1E0Z A;  1N6Z A;  1ZE3 D;  2IYD B;  3PV1 A;  5IO9 A;  2I38 A;  2MJD A;  4WQM A;  5G5G A;  3UI3 A;  5D94 A;  2RGF A;  2O6V B;  2KDM A;  2RDH A;  2MP2 B;  3W5U B;  3MC0 B;  4KZC A;  3KUD B;  2NBV B;  3DWM A;  2VH1 A;  1N5X A;  3CF6 E;  3V61 A;  4NQK E;  2ACZ B;  4OVU A;  1V5T A;  3N32 A;  1P3Q U;  1V97 A;  4XYC A;  2UYZ B;  3MC9 A;  4S0R A;  3QWZ B;  3PHX B;  3ZRF A;  2MJ3 A;  2L0F A;  2M0X A;  3KVF B;  1I4X A;  3L0W B;  3PRM B;  5AZG A;  4P1B C;  4IM0 A;  1RFA A;  4R3D A;  2DLB A;  4YSX B;  1T0Q C;  5TR5 A;  2QJL A;  3SR6 A;  4ZRI A;  4IWP A;  4MGY E;  1IP9 A;  1WXQ A;  2QIL A;  5E6J A;  5JH5 C;  1I42 A;  4ZOH C;  4IKG A;  1WSP A;  2C7M B;  3TL5 A;  2JZP A;  1EWY C;  3N30 A;  2C7H A;  1STE A;  3H7S A;  3H1U A;  2WWZ A;  4N9F 4;  3IT4 B;  3RPF C;  2ZCB A;  2I1J A;  1DOX A;  4TV3 A;  1VRA B;  2L0T A;  2ONQ A;  4ITK A;  4KSK C;  2JRI B;  1D4B A;  1RRB A;  2BWE S;  2HJ1 A;  1I4H A;  5IP4 D;  1JRU A;  3T8M A;  5I4D A;  4LNI A;  2K8B A;  1VR9 A;  1WMH A;  1FM0 D;  4ZRP A;  4G50 A;  3VR8 B;  3LB8 C;  3B9J A;  2PJH A;  3IT6 B;  3EA6 A;  2O2V A;  5IA7 A;  3APC A;  1ISN A;  2KNB A;  4GDL B;  5E6O A;  3QC8 B;  4W9L A;  3ZDM C;  3BVZ A;  2LGI A;  2X8X X;  3W5V B;  4EFO A;  2KHW B;  5J18 A;  2IGH A;  3LJ3 A;  2LD9 A;  1C3T A;  3TEY A;  3Q69 A;  5BMH A;  1FNU A;  1T5X D;  2BBC A;  2INC C;  1EWC A;  3GZN B; 
#chains in the Genus database with same CATH homology
 2IGG A;  3VRA B;  2LJI A;  2JQR B;  1QOA A;  1ESF A;  2DWQ A;  2WXH A;  1GTH A;  2DYM A;  4XDC A;  1TS3 A;  3AEC B;  3AM9 A;  5C2T B;  1P7F A;  1Q10 A;  3AE6 B;  5H8Y E;  4YTP B;  4JE3 B;  2WU2 B;  1K52 A;  2IGD A;  2FUG 1;  2W82 A;  3SEB A;  2WLB A;  4RF0 A;  3AEA B;  4YTM B;  1UUP A;  1XLN A;  2XNA C;  4A9A A;  3AE9 B;  1AWD A;  3ZYY X;  3SFD B;  1YMH E;  1EM7 A;  3NVZ A;  4WWM A;  3TEX A;  4AS1 A;  1IGC A;  1C9F A;  1QOG A;  1TY0 A;  3CF4 A;  1UNS A;  4JX1 C;  4IDI A;  3BYT B;  1FFV A;  1A70 A;  1UWX A;  1ZXI A;  2E6X A;  1M4V A;  1TS2 A;  1WWT A;  3KLS X;  3EGR A;  4XWT A;  4M0W A;  1SE2 A;  2JX5 A;  3H8H A;  1CZP A;  2Y3A A;  3PO0 A;  3OWE B;  3AEE B;  4MAC A;  4GLS C;  1DOI A;  3W2D A;  1SIJ A;  4J3O D;  3NS1 A;  3P1M A;  4N6E B;  2AX5 A;  1KLG D;  4US8 A;  3GB1 A;  2W3R A;  5TSS A;  3AN1 A;  3BVM A;  3B2G A;  1KTK A;  3AE4 B;  3DWG C;  3NZ3 A;  4A8X C;  1C77 A;  5FK9 C;  1P7E A;  2EKI A;  4P16 A;  1PGA A;  1CK1 A;  5JXV A;  4ZHP A;  2WQY B;  3U4E G;  5AUK A;  1V1P A;  1NVI D;  3NVW A;  1SJE D;  1ENF A;  2K0P A;  2W3S A;  3TUO A;  5MPO A;  2GRI A;  2PW9 A;  2N7J A;  1NYR A;  2G9H D;  3I57 A;  1RYJ A;  3ZJU A;  4L23 A;  1XLP A;  2JYT A;  1QLB B;  5EE1 A;  2BS2 B;  4NAW B;  2WXL A;  3Q8C A;  2DBY A;  2Y5P A;  3BK1 A;  2M56 B;  2X38 A;  4YXD B;  2IJ0 A;  3AE3 B;  4PT5 A;  1BML C;  1FCC C;  2ZW1 A;  4RGT A;  1UGJ A;  2PVO D;  1I7H A;  1F2R I;  1HA5 A;  1JRO A;  1FXI A;  1YJI A;  3NUH B;  3P63 A;  4NAM A;  1I4G A;  3HVD A;  4RF1 A;  1MVK A;  1HXY D;  3ZJV A;  1KH0 A;  1ACC A;  1SE3 A;  1I4Q A;  1L0X B;  3MJ5 A;  3ABV B;  1CQV A;  3AE5 B;  2NTT A;  1ZOY B;  3LYY A;  1ZDX A;  2KWD A;  2WP9 B;  1SXT A;  1C4C A;  2I2Y A;  5G5H A;  1B1Z A;  2KAJ A;  2INP E;  1KLU D;  4RH6 A;  4P6V F;  3J9C A;  1I4P A;  1PGX A;  1J7B A;  4MM3 B;  2PVG C;  2BT6 A;  4LTU A;  1JWA D;  2V3N A;  2VZK D;  1CJE A;  1BXT A;  1SB3 C;  1MHH E;  2LMC A;  3HUI A;  3WCQ A;  2QMT A;  2JSV X;  3R8B A;  1V1P B;  2HTM E;  4RNA A;  3AEG B;  4WIP A;  5EE3 A;  4DXF A;  1NYQ A;  1SE4 A;  2WU5 B;  2MEK A;  4N59 A;  1GPX A;  1KF6 B;  1N62 A;  1D5M C;  1TYG B;  4DQO C;  1PGB A;  3E9S A;  1XF5 L;  1B9R A;  1N61 A;  2AQ3 B;  1TS4 A;  1T6B X;  2R61 A;  4KKI A;  4KGS A;  2WDQ B;  4AQ7 A;  3P4Q B;  1VLB A;  2WXO A;  4EE2 A;  2W54 A;  1FXA A;  2K9X A;  1LO5 D;  3VQI A;  1N63 A;  3IXS A;  2PKO A;  2VZK B;  1GTE A;  1FNW A;  1J7C A;  4RFB A;  2BS3 B;  2CU3 A;  4WAF A;  1C78 A;  2K3U A;  2RPV A;  3AE1 B;  4N58 A;  1WRI A;  4IOI E;  1VZ6 A;  5D3D A;  2BTE A;  1AYF A;  3AB5 A;  1F77 A;  1KRH A;  1YJJ A;  2V4I B;  4OW0 A;  5C3J B;  5FKA C;  1D5Z C;  1I4R A;  3BK2 A;  1BUI C;  3PZ7 A;  4DXG A;  4C7Y A;  2WS3 B;  3PZ8 A;  2KQ4 X;  1D6E C;  1FD6 A;  3AV8 A;  3O13 A;  4RGO S;  3RFZ B;  2WXP A;  4KGR A;  1V8C A;  1RFK A;  2E3T A;  1C76 A;  4ZYS A;  2XN9 C;  2QSD A;  3TSS A;  1GT8 A;  2KMM A;  2B76 B;  2SAK A;  1XLO A;  4RGN A;  1VJK A;  1FFU A;  2M19 A;  1ZUD 2;  1UWM A;  4Q2J A;  1XO3 A;  3U2S C;  1IGD A;  1AW7 A;  3P42 A;  1YQ3 B;  2J4X A;  2JU6 X;  2JXT A;  3ETR A;  4TMA B;  3AE2 B;  2NTS A;  4OHJ A;  2WXN A;  4GDK B;  3MFG A;  2J52 A;  3B2F A;  3C8Y A;  2LEK A;  4OZB A;  2Q5W D;  1H7X A;  4TSS A;  5BYQ A;  4KX6 B;  2KAC A;  3W1S A;  2RMM A;  3BWU D;  2V0G A;  4MH8 A;  1QT9 A;  1XXG A;  2FE8 A;  2J53 A;  3FIL B;  4OVZ A;  1H7W A;  1HZ6 A;  1L5P A;  3FC4 A;  3R2T A;  3GS2 A;  1HQR D;  1XCQ L;  1K50 A;  4KKJ A;  3MHZ A;  5D7G A;  1QKZ A;  3FAH A;  3ZQ4 A;  2MJE A;  4HKZ E;  4LK0 M;  3N9Y C;  2RDG A;  1YNT E;  2SEB D;  2WXM A;  1J7A A;  2HDE A;  1QQR A;  2CJO A;  3KQ4 A;  1AN8 A;  2OHF A;  1DGJ A;  1VZ8 A;  4B0M A;  3URY A;  1GB1 A;  1C4A A;  2K5P A;  2INN E;  1TY2 A;  2WDR B;  2WNM A;  4MT5 A;  1JW9 D;  1L6V A;  2AQ2 B;  2YEP F;  3AEB B;  3GP7 A;  2WXK A;  1TJE A;  1ZPS A;  2LUM A;  2ZW0 A;  1WGK A;  1XEE A;  4WUR A;  1MI0 A;  1R7S A;  4HEA 1;  3Q8A A;  1OFF A;  2L32 A;  5BYR A;  5H92 C;  2G1E A;  2FBW B;  1L4D B;  1TS5 A;  1GB4 A;  2CJN A;  1FO4 A;  4ARC A;  4L2Y A;  1NEN B;  4C80 A;  2WXQ A;  3AE7 B;  2BB6 A;  2OED A;  1C79 A;  1FIQ A;  2GI9 A;  1GOZ A;  5GXG B;  4YT0 B;  1HEZ E;  3V3X A;  3P4P B;  1C4P A;  5D3I B;  4C56 C;  1KFY B;  2QIE B;  4OZA A;  2V3P A;  4B0E A;  4TQ0 A;  1K51 A;  3BVG A;  4UDU C;  1JML A;  2IPK D;  3BZD B;  3TEW A;  4JPS A;  1QIL A;  2BS4 B;  3CWI A;  2KN4 A;  4CQN A;  2GB1 A;  4HJG E;  1V1O A;  2LHE A;  3FIL A;  1VDV A;  3KWL A;  5BYS A;  4H2A A;  2WXI A;  2LHD A;  4OZC A;  3V05 A;  3ZJT A;  1YN4 A;  1JQ4 A;  2DYO A;  4XE0 A;  4REZ A;  1QOF A;  5BMI A;  2JYE A;  4YSY B;  1ROE A;  2N9L A;  3T3N A;  3EUB 2;  1L0V B;  4O1N A;  2K22 A;  1E0Z A;  4HKQ A;  2ICI A;  5HG2 A;  1ZE3 D;  1EU4 A;  3Q8F A;  2BW2 A;  1N5W A;  3U7Z A;  2I38 A;  2MJD A;  4WQM A;  1E7P B;  5G5G A;  3UI3 A;  3CIR B;  1JRP A;  4ZRQ A;  1F2R C;  3AH7 A;  2PLP A;  2W55 A;  2KDM A;  2RDH A;  4C7Z A;  4RGM A;  1RWS A;  1VZ7 A;  1JWB D;  3W5U B;  3L4P A;  1QF6 A;  3MC0 B;  1N60 A;  3P4R B;  1XLQ A;  4USA A;  1SSN A;  1PUT A;  2JWU A;  1MPE A;  3E56 A;  2TSS A;  2Y5C A;  4HRO A;  4US9 A;  3DWM A;  1N5X A;  1GAQ B;  1MHX A;  4NJC A;  2ACZ B;  1E10 A;  1L6U A;  4L1B A;  2D5G A;  2PIA A;  4A90 A;  3TEZ A;  4KGT A;  1V97 A;  3IAM 1;  2BB5 A;  1YQ4 B;  1TKY A;  2N0S B;  2MJ3 A;  1DOY A;  1I4X A;  3HRD D;  1FEH A;  1DYQ A;  3R2I A;  1ET6 A;  1IBX A;  2WXJ A;  1L0Y B;  1E9M A;  2L83 A;  4RCO A;  3P4S B;  2EEL A;  3SFE B;  4R3D A;  1FRD A;  2DLB A;  1JWM D;  4YSZ B;  4JWU C;  1JCK B;  2PMV A;  2QEJ C;  4YSX B;  3NVV A;  2QJL A;  3BYY B;  3SR6 A;  2H89 B;  4XDD A;  5AUI A;  4YTN B;  2AQ1 B;  3KWV A;  1TKG A;  1PFD A;  1OQR A;  1ZP0 B;  1WXQ A;  2QIL A;  5E6J A;  1RM6 C;  4WH4 A;  5BMG A;  4ZOH C;  4IKG A;  1WSP A;  4XWW A;  2WXG A;  1SEB D;  2JZP A;  1EWY C;  3AEF B;  3Q8B A;  3ZGZ A;  3I9V 1;  4NZL B;  1STE A;  1E6E B;  1NI3 A;  3LXF A;  1OQQ A;  4ZHO A;  1EU3 A;  3IT4 B;  1K53 A;  5EE9 A;  3RPF C;  1F0Z A;  2WXR A;  3AMZ A;  3W9C B;  1DOX A;  1Y56 A;  1VRA B;  1TKE A;  1SBB B;  1SJH D;  4A55 A;  1JAL A;  2WXF A;  5FR3 A;  5LNK 1;  3VRB B;  2ONQ A;  4ITK A;  3IAS 1;  1FRR A;  2WDV B;  1D4B A;  4LLG M;  3AED B;  1TZO A;  1PDX A;  1FMA D;  1L4Z B;  1PYW D;  3Q8E A;  2H88 B;  4JWS C;  5HFY A;  1FNV A;  1ET9 A;  1IUE A;  4A6Q A;  3VR9 B;  1I4H A;  2ON8 A;  1ZDV A;  1XCT L;  1IBX B;  4ARI A;  5I4D A;  1D5X C;  1VR9 A;  1FM0 D;  2NMQ A;  5HHD G;  1SF0 A;  2IDY A;  4ZRP A;  4D2K A;  3VR8 B;  4HRS A;  3LB8 C;  3B9J A;  5T8I A;  3IT6 B;  3EA6 A;  1FCL A;  1YN5 A;  2J42 A;  2M0A A;  2N9K A;  5HI1 A;  4GDL B;  1QOB A;  5EE0 A;  3AE8 B;  2PTL A;  1ZXH A;  2BYT A;  3NVY A;  3NRZ A;  3BVZ A;  2L52 A;  2LGI A;  3U52 E;  3W5V B;  2L1A A;  3MP9 A;  1WYG A;  3BII D;  4FXC A;  2IGH A;  2MH7 A;  2Z8L A;  3HVZ A;  1JWS D;  1T3Q A;  1NEK B;  3TEY A;  3Q69 A;  1HZ5 A;  5BMH A;  4TQ1 A;  2LFI A;  1FNU A;  1T5X D;  2BBC A;  1JWU D;  4YWG G;  2YEP B;  1YN3 A;  1EWC A;  3T3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...