1WH3A

Solution structure of c-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 oasl)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
GSSGSSGIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLILSKKKGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 59 kDa 2'-5'-oligoadenylate synthetase like protein
publication title Solution structure of C-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 OASL)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wh3A01
3DBLI 2N9XA 1C1YB 3PREA 2PE9A 3N32A 1EO6A 2C9WB 3EFUA 3QX1A 4FHJA 4BFRA 1WXAA 4MGYE 3ZW3A 2DYBA 4ZRJA 4W9JA 1WE6A 2KANA 3DBHI 3DBRI 1WE7A 1E8WA 2KLGA 4G3XB 4AJYB 4DBGA 4BVUC 5LXIB 1XQQA 1WGRA 2MQJA 3HK0A 4FJYA 2AYOB 2IYDB 2RR9A 3VVWB 2LGXA 2N9EB 4B95A 3X0WA 2D2QA 3UIPB 1E7VA 3W1SC 2IO1B 3WIMA 3QWZB 4KSKC 2L76A 3HM6X 5DCNA 4W9HA 3H6NA 2KOXA 2BKRB 2O6VD 2WX0A 3OJ3A 3JSVA 1H4RA 3JVZX 3M62B 3QA8A 3PVLA 2K6QA 3ALBA 2N1VA 3SD5A 1XT9B 4MGZE 4YL8A 2KTFA 4IWOA 3DQVA 3QQ8B 2UYZB 3EHVA 4MGIE 3VXWA 4BOSC 4ICVA 5AZGA 5IA7A 2Y5BB 3AI5A 2FIDA 4AP4C 4BKGA 2KJ6A 4EUTA 3MTNB 3TCAA 3K9PB 5LLIA 3V6CB 3WA0A 1WZ0A 4LDTB 1BT0A 4CYEA 2D3GA 3ZLZA 4DK5A 3CSFA 1WJ6A 2KTRB 4TQ0A 3ZUNA 4F1SA 4EZLA 2G45B 4FADA 4A20A 1GC6A 2OOBB 2J0KA 2JY6A 1TTNA 2MW5A 4GDLA 3IG3A 3N3KB 2BF8B 2IBIB 3T9LA 4PYUA 4K7SA 3ZNHB 1OGWA 2W9NA 3N30A 2KZRA 4MELA 4ANVA 1VD2A 2K1FA 3LJ3A 2G4SA 3ML8A 1F9JA 3A4SC 2J0MA 3AULA 3A9JB 3LDZE 1P9DU 1C3TA 4NQLB 3EC8A 4XC2A 1R4MI 2JPHA 2AEHA 3APCA 3VHTC 2AWTA 4DXAB 1UBIA 2MRPA 4AOFA 4ZDVA 4II2B 2KD0A 5JZEB 1WJNA 2BYVE 3EECA 3O65B 3V6EB 3ZRFA 2KJRA 2FCNA 5D6JB 4HCNB 5KHOA 1P98A 1V5OA 2LRWA 4JQWC 2KWVB 3UINB 3AXCA 2CS4A 4HPMB 2KFJA 4DHJD 2HE7A 4HJKA 3VUWA 4BOZB 3WAPA 2KK8A 2MX2A 2PJHA 2KDEB 3K9OB 2ZNVC 4FA6A 2V3SA 2KC1A 3DBSA 4GMVA 4TKNA 3PSEB 3UQBA 3Q3JA 2LJ5A 3VDZA 2DAJA 4GDKB 4K7UA 1Z5SB 3VAWA 3PTFC 2L3ZA 1OTRB 2NR2A 2RSUA 4G0NB 4ANUA 1L2NA 2KFKB 3ZRCA 1WFYA 4GGQA 3SU8X 2JUOA 1Q1OA 4PYZA 1WRDB 2IO3B 3NOBA 1E8XA 3CMMB 2CKHB 3W1SA 4AUQC 2KVRA 2NBVB 4MSQB 2K8BA 3NY5A 2GMIC 1WR6E 1IYFA 1ISNA 2D07B 3QC8B 1HE8A 3UF8A 2HJ8A 2KX0A 4IUMB 2ZZPB 1WYWB 4WWOA 4EZKA 1RFAA 1V80A 2FIFA 2DAFA 2KTRA 3L08A 4HXDA 4J6IA 1WJ4A 4EFOA 4PS3A 2CHWA 2CHXA 4W9EA 5D94A 2KC2A 2PE6B 4IM2A 3W1YA 2NCNA 3RZFA 1I35A 2NPTB 3NS8A 1YJ1A 3UIOB 5IAAC 5JHBA 1G6JA 3A9JA 2N9PC 3IFWB 3PS6A 3GOEA 2GBNA 1YX6B 4OVVA 2KX3A 2NVUI 1V6EA 3L10B 4RM9A 2KMCA 3VTVA 2IO0B 1AARA 4IM0A 3PV1A 2DENB 1Q5WB 4FJZA 4OVUA 1E8ZA 1ZW7A 2DZMA 3U7DA 2N1WA 1WF9A 3GZNI 2MBBB 3MHSD 4KIKA 5EDSA 1I42A 4WJOA 3QHTA 3PPAA 4EOYA 4FBJB 1WGDA 4CHKA 5E6NA 1V5TA 3NZUA 3X23A 1Z2MA 4HLEA 1VCBA 4B6WA 4GDKA 1TGZB 4EZJA 4TQ1A 4FN2A 2KMAA 3V61A 2WYQA 1EUVB 2CHZA 2LASA 1IPGA 4M0WB 3KYCD 2FCMA 2KFKA 3RUIB 1YQBA 2JZZA 2IO2B 2KNBA 3H7SA 1GNUA 1E8YA 1Q0WB 1ZKHA 4BKTA 2N7EA 2OJRA 1T0YA 4E71A 2WWZA 3VQIA 1V81A 2AL3A 2D11A 3KVFB 4LDTD 1YD8U 1YX5B 4GSWA 2BYEA 3PGEA 1NI2A 4WJPA 4G50A 1E5WA 1KJTA 4W9KA 2PPHA 4WWNA 2K6DB 3ML9A 2JRHA 1RRBA 3R3MA 4ANWA 5CTRC 3DPDA 1SE9A 2NS5A 1GJZA 2FUHB 4HK2A 2CR5A 3ZNZB 5DPRA 4IWQA 4WWPA 3TL5A 3MJWA 2ASQA 2M17A 2KLCA 2Z0EB 1PQSA 2G3QB 2K39A 1OEYA 3PHXB 2LWPA 2NPTA 4GIVA 2DZJA 2L0FA 5AZHA 2NBUA 1WH3A 2R2OA 3APFA 4MH0E 1L7YA 3HHMA 3KH0A 2CU1A 1H8CA 4BKSA 5AEKB 2J7QB 4BBNF 4URKA 3CSTA 2MP2A 2BYFA 3L54A 2IZVB 2M0XA 2KHWB 5G55A 2ZPYA 2M8SA 2EMTA 2KJHB 2ZVOA 2JF5A 4KV2A 2MBQA 1R4NI 3R7QA 4PS8A 3ZNGC 4KIKB 2JVCA 4NY0A 4EKUA 5CHFA 4G11A 4HPLB 2FCQA 1UH6A 3BINA 4JL9A 2KDIA 1QZEA 4X57B 5GMVA 1OQYA 1RLFA 2KWCA 3Q3FA 2ZCBA 5CHVC 5L83A 4I6PA 4DHZE 1WM2A 4PS7A 4DWFA 1WMHA 4K81A 4KZCA 3WAMA 2LXAA 2N4FA 4JGHB 4FHKA 2REXA 1WX9A 2RPQA 3QK0A 5G2NA 3TBLD 4BBNC 2Z0DB 5AZFA 2BWFA 3PLVA 2KN5A 3KYDD 4KZ0A 2I1KA 2ZJDA 3DCGA 1CMXB 1OEYJ 4MDKE 2DYMA 4W9DA 3A9KB 2BKFA 5DPSA 3P2BA 3RT3B 2BWES 3A4RA 3IVFA 2L0TA 2FAZA 5C1ZA 2ZNVB 4W9FA 4RM8A 3NZSA 5L95C 2LZ6A 5D7GA 4HDOA 4II3B 2K25A 4KDIC 4WQOB 2D10A 4GB9A 2L8JA 2KDFB 3VH3B 4HCPB 1WR1A 2KDBA 4HWIB 3ZTDA 2L7RA 3PRPB 2PEAA 3PRMB 4XX5A 3RCZA 4FJVB 3M63B 2YLMA 5DPWA 3M95A 3UQAA 2GBRA 1UBQA 1M94A 2KO3A 3SHQA 3V62A 3VUXA 3APDA 1WX8A 4ZRIA 4LJOB 2B3AA 3L17A 1E7UA 4K1RB 3WALA 4BKSD 1LFDA 3QAQA 2ZPNA 2R2QA 4ZYNA 3R7RA 3B0AA 3ECIA 3B08A 5J17A 3UGBB 4KVGB 2MP2B 1U4AA 4IC7B 1E90A 5C23A 2O2VB 2KKCA 5DPTA 1GUAB 4NAWB 1WZ3A 4NJ7A 3PLUA 3VUYA 3DVGX 1XD3B 2DYOA 1WM3A 5JH5C 4ICUA 4IG7B 2Z59B 2N7DA 3QCAA 4B9KA 2JT4B 3WANA 2L00B 4JLCA 4LCDE 4I6NB 1WMHB 4WAAA 4ASWC 5HKHA 3QIJA 2VRRB 3ZKJC 3OJ4B 2IY0B 3ZDTA 3OLMD 4HDQA 4DDGD 4MJSB 1S3SG 3B1LX 3ONSA 4MSMB 5D2MB 3ZIMA 4K7WA 2DZKA 4MGKE 5LXHA 2GBJA 1GC7A 4FULA 4E3CA 2FNJB 3A9KA 3SDLC 3ZTCA 1KOTA 3QARA 2LRUA 4LJPB 1WXSA 2XK5B 1WXVA 1LQBA 3RULA 2M4NA 3A1QB 5BO4B 3VTWA 5J2RA 3ZVVA 4RMAA 2K8CA 2G4DB 4W9GA 1K8RB 3L13A 1MG8A 1SIFA 2J0JA 4DHZB 2L05A 1WGHA 2KQ7A 2ZCCA 1P1AA 2A4ZA 3IHPC 1J19A 2MSED 1V49A 2O6VB 4AWJA 4GU2A 2HD5B 3H7PB 3A33B 3CF6E 1WI0A 1V9JA 3BY4B 1KLVA 1J8CA 2MBEA 5FR6A 1Y8RC 1EF1A 2DZIA 4TV3A 1ZGUB 2ZVNA 3JYUA 4W9IA 1WJUA 4NNJB 2RGFA 3I3TB 5TR5A 1NDDA 2I1JA 1NBFC 1S1QB 4FLHA 5JHAA 2LI5A 2LVPA 4KDLB 3OAWA 2MBOA 1P3QU 2AL6A 3KW5B 3HM3A 3DVNV 2MBHA 4IM3A 4NPNA 5CHWA 1IP9A 3PHWB 1A5RA 1RAXA 2O2VA 4NJ6A 4AJWA 1D3ZA 3L16A 1WGYA 1WX7A 3H1UA 4NAWA 2YVCA 2C7MB 3L0WB 1LXDA 2DX5B 2KQSA 2WX1A 3ENEA 3VH4B 2LGDA 2MA9B 1SGHA 1V2YA 3RYTA 4DDID 2FCSA 4GXBA 4HVBA 3R66C 2LVOA 5E6PA 1FXTB 4A3OA 3IBEA 4MEMA 1UZXB 2NBWB 2GBKA 1TZ1A 3HIZA 3KUDB 4CO7A 3VTUA 4E74A 3DVGY 2KXJA 4MJSA 3VFKA 4XZ4A 3KUCB 1V86A 4KSLC 3KUZA 1P0RA 3AU4A 2C60A 3AU5A 2EMSA 2C5LC 4M8MA 4A3PA 4DHJB 3RD2A 1WXMA 2XK5A 5CX3A 2GOWA 1WIAA 2LXCA 4P7IA 2LVQA 3A1QA 3PZDA 1YIWA 4W9LA 3WAOA 4GN1A 4TUUA 4W9CA 4F8CB 3JSVB 1GG3A 3C0RB 4ZRKA 4F7ZA 3V60A 2EKEC 3TIXA 2O6VA 3U30A 3DDCB 3H7PA 3ZDMC 5KHQA 5J18A 2RD0A 2BPSA 2JRIB 3T8MA 1UD7A 5E6OA 3M3JA 3DOWA 1LM8B 1UGMA 2LD9A 2GBMA 4EEWA 1J0GA 2JWZA 2A5UA 4ANXA 2V1YA 3D32A 2JXXA 4N9F4 3H9DA 2MWSB 3S2AA 1WY8A 2IY1B 3TMPB 2MCNB 3TJPA 1WGGA 1UELA 2M1MA 3PT2B 2QHOA 2DHZA 1JRUA 2LGYA 3JW0X 4GOCA 2V4LA 2MLBA 2LUEA 4GDLB 2K8HA 4MM3A 4WJQA 2UWQA 2HTHA 3QJZA 2C7HA 3U8ZA 3NHEB 1EF5A 3PRZA 2BGFA 1KM7A 3ZO5B 2ZEQA 4IW0A 3DVNU 2C7NB 4I6LB 2JZ3B 4IWPA 3ZNID 2KWUB 4JIOU 1X1MA 2XBBC 2XEWA 4M8NA 2WDTB 1TBEA 4NQKE 4WJNA 3RZWC
chains in the Genus database with same CATH superfamily
4MH8A 2C9WB 2Y5PA 3QX1A 4BFRA 4OZAA 4MGYE 2DYBA 4W9JA 1F2RC 1WE6A 3DBHI 3DBRI 1E8WA 4BVUC 1WGRA 2AYOB 2RR9A 2LGXA 4LTUA 1CK1A 2D2QA 3W1SC 3AE6B 4KSKC 2FBWB 1JMLA 3H6NA 2KOXA 3OJ3A 4XWWA 3RNBC 4USAA 3ALBA 2AQ1B 4YL8A 4IWOA 4P1CC 4MGIE 4ICVA 5AZGA 2Y5BB 4AP4C 4BKGA 5BYRA 3V6CB 2D3GA 1UWMA 4F1SA 4FADA 2G45B 1D5XC 2NMQA 1QT9A 1VLBA 2IBIB 4K7SA 2W9NA 3LJ3A 3NZ3A 2QCZA 4ZOHC 3NVVA 2QDFA 1J7CA 2PW9A 2WHIA 2D5GA 4C7ZA 4XC2A 2KAJA 2AWTA 1UBIA 5JZEB 1WJNA 1TS3A 1EWYC 2JU6X 3AE3B 1P98A 2EELA 4MT5A 3C19A 1T0RC 2HDEA 3C8YA 3AXCA 2KFJA 3WAPA 2KDEB 2KC1A 4LNIA 4TKNA 5MPOA 1L6VA 2DAJA 4HKZE 2BB5A 3VAWA 1JW9D 3V3XA 2L3ZA 1OTRB 1HZ6A 1L2NA 2DLBA 2MHJA 1QOGA 5BMIA 2KVRA 2NBVB 1FMAD 2K9XA 3QC8B 4XGAB 2ON8A 1UUPA 2N9KA 1RFAA 1V80A 2FIFA 4HXDA 2CHWA 3KQ4A 2CHXA 4P16A 2FE8A 4TMAB 1F2RI 3W1YA 1SB3C 3RNCC 3RZFA 1I35A 2H88B 4C7YA 2N9PC 3IFWB 3PS6A 3GOEA 1YX6B 2NVUI 3AV8A 4S17A 2KMCA 2IO0B 2RDBC 1KLUD 3PV1A 2DENB 1MPEA 1Q5WB 4FJZA 2BQQA 1WF9A 3GZNI 1I42A 4WJOA 3PPAA 1WGDA 1ZE3D 4CHKA 5G5HA 1TS5A 5E6NA 4ZHPA 1V8CA 2H89B 1K51A 4HLEA 2W3RA 4A9AA 4ZHOA 5FK9C 3BK2A 3NG0A 2LASA 1CQVA 3BWUD 2FCMA 3P4SB 4N58A 3U7ZA 1YQBA 2JZZA 2IO2B 1T5XD 1GNUA 1L0YB 1Q0WB 2GB1A 1RWSA 1XLOA 2WXMA 3PZ8A 2OJRA 1YD8U 2INPE 2WNMA 3RFZB 2JYEA 1B9RA 1IBXB 2JRHA 1KTKA 3I5JC 1K53A 5DPRA 4WWPA 1ET9A 3NUHB 2M17A 1ZPSA 4GIVA 2K39A 4PK1A 1JWBD 4YXDB 2WXLA 4MH0E 3HHMA 2J7QB 3L54A 2KJHB 3P1MA 2JF5A 2MBQA 3R7QA 4KIKB 2JVCA 4NY0A 4EKUA 4LNNA 5CHFA 4G11A 4HPLB 2FCQA 1UH6A 2KDIA 1GPXA 5IOIA 1UF0A 3SR6A 5GMVA 2E3TA 1OQYA 3IT4B 2G9HD 3Q8EA 4I6PA 4QAYA 4DHZE 4PS7A 4L2YA 4KZCA 3WAMA 1E9MA 2REXA 2LMCA 3PLVA 4DXGA 2ZJDA 1CMXB 4OZBA 3RT3B 4XYCA 2L0TA 2L1AA 5C1ZA 4W9FA 3ZGZA 2MEKA 1I4PA 2KT7A 3RPFC 4KDIC 2J53A 4WQOB 2VZKB 3UI3A 1IBXA 2KDBA 1XF5L 2OJWA 3PRPB 2PEAA 3PRMB 3HVDA 3VR9B 1C9FA 1SE4A 2D3BA 5EE3A 1LFDA 3AE5B 3BVGA 4ARIA 1PUTA 4ZYNA 3B0AA 3Q14C 5J17A 1P7EA 4KVGB 1N63A 5C23A 3AE2B 3B2GA 3PLUA 2M0AA 3NJTA 1D6EC 1F1HA 4S0RA 4ICUA 1YN4A 4YTNB 2AX5A 4WAAA 1E7PB 3MFGA 4OVZA 2IY0B 3ZDTA 4HDQA 1MFWA 5D2MB 1Y56A 3ZIMA 4KGRA 4MGKE 1GC7A 3ZTCA 4LJPB 3W5UB 1WXVA 2M4NA 3ZVVA 4A6QA 3AEAB 4YSZB 2KQ7A 2O6VB 1TKEA 2HD5B 4BAXA 3A33B 1AN8A 1WI0A 1WSPA 1EWCA 2DZIA 3JYUA 5TR5A 1NDDA 4J3OD 2B76B 5JHAA 2MBOA 3KW5B 4NPNA 3PHWB 5I4DA 3H1UA 1NVID 1OQQA 2MH7A 2LGDA 2KWDA 1V2YA 3AEBB 1FXTB 3IBEA 1UZXB 4DXFA 1FCCC 4BZAA 2KXJA 3TEWA 2HJ1A 2KACA 3KUCB 3AU4A 2C60A 4M8MA 1CJEA 4RGTA 3BK1A 4DHJB 3RD2A 4XDDA 4P7IA 1YIWA 2R61A 2Y3AA 2GI9A 3V60A 2EKEC 2O6VA 1RM6C 1T0QC 2BYTA 3ZDMC 5J18A 2LD9A 4EEWA 1SBBB 2QHOA 2DHZA 3JW0X 3NVWA 1T3QA 4GDLB 5T8IA 1GB4A 4WJQA 2UWQA 2HTHA 2JZPA 4LK0M 1EF5A 3DVNU 2JZ3B 3ZNID 4C80A 4JIOU 2KVZA 3PREA 1A70A 2PE9A 3N32A 2KQ4X 1FRDA 1N61A 5HI1A 4ZRJA 2KLGA 4AJYB 3TUOA 5FR3A 4M00A 2V9HA 3VVWB 3AM9A 4B95A 2IO1B 3WIMA 3QWZB 2L76A 3HM6X 5DCNA 1F0ZA 4W9HA 2O6VD 1M4VA 2WX0A 4OHJA 3HVZA 3QA8A 2PKOA 3BVMA 2FIDA 3TCAA 2INDC 3DBLB 3K9PB 5LLIA 1HZ5A 4LDTB 4DK5A 4AS1A 3CSFA 3BVZA 3ZUNA 4A20A 2J0KA 4UDUC 2ICIA 2JY6A 2MW5A 4GDLA 3ZNHB 2BF8B 2INCC 4JPSA 5IKCM 3N30A 2KZRA 4ANVA 1VD2A 3ML8A 3A4SC 3RNEC 2J0MA 3AULA 3A9JB 3FKYA 2BS3B 1P9DU 4NQLB 3EC8A 3VHTC 2AEHA 4DXAB 4GLSC 4ZDVA 4II2B 3EECA 2IGGA 2K5PA 2KJRA 2FCNA 5D6JB 4HCNB 1V5OA 4JQWC 2KWVB 3CIRB 4HPMB 4DHJD 4HJKA 3K9OB 2Q5WD 2L83A 2V3SA 4GMVA 1JROA 3MC8A 3PSEB 2D3AA 3UQBA 3Q3JA 2LJ5A 3GE3C 2OHFA 3VDZA 3T3NA 4K7UA 1Z5SB 2RSUA 4G0NB 1WFYA 1WXQA 3SU8X 2JUOA 2IO3B 3NOBA 1R4MB 2XNAC 2CKHB 4AUQC 2V3PA 3NY5A 3B2FA 2D07B 2HJ8A 1LGRA 1WYWB 3Q3OC 4J6IA 4PS3A 3Q3MC 1PGXA 2NCNA 1HTQA 3VRBB 2NPTB 3R2IA 2PLPA 5JHBA 3A9JA 2GBNA 2KX3A 1PYWD 4RM9A 3VTVA 4HRSA 3AE4B 4OW0A 4IM0A 3O13A 4ACFA 3U7DA 2N1WA 1YN3A 3R2TA 3MHSD 5EDSA 3QHTA 4EOYA 2AQ3B 1ZP0B 1JWUD 1YNTE 1TGZB 3GB1A 3RNFC 4TQ1A 4EZJA 2KMAA 1EUVB 3RN9C 4H2AA 3ABVB 1IUEA 5LNK1 1TKYA 1T0YA 4E71A 2WWZA 2AL3A 3KVFB 4LDTD 2KMMA 4GSWA 2BYEA 3PGEA 2V3NA 3HUIA 1FIQA 2PPHA 1PGAA 4IOIE 4REZA 1FCLA 1RRBA 3RI7C 1QF6A 2JXTA 1GJZA 2FUHB 4HK2A 1TIFA 1PQSA 3PHXB 2LWPA 2NPTA 5AZHA 2W55A 3ETRA 4K3CA 1WH3A 5FKAC 2R2OA 3APFA 3N20C 3PO0A 4Q2JA 1FXIA 4BBNF 4CQNA 2ZPYA 5EE9A 2ZVOA 1IGDA 1N5WA 1VZ7A 3BINA 2MJEA 4X57B 1L4DB 5IO9A 3Q3FA 5CHVC 1WMHA 4K81A 5C2TB 3TEZA 2RPQA 1WX9A 3QK0A 1DOXA 5AZFA 2BWFA 2KN5A 2I1KA 3DCGA 2DYMA 1TZOA 2BWES 3IVFA 1UGJA 1I4XA 5L95C 5D7GA 1C4PA 1XCQL 4II3B 5IP4D 4RF1A 2K25A 2D10A 4GB9A 1HEZE 1WWTA 2KDFB 2PVGC 3VH3B 2QMTA 2W82A 4A8XC 1B1ZA 4XX5A 3RCZA 4FJVB 2GBRA 1UBQA 3IAM1 3V62A 3VUXA 4ZRIA 3MC9A 2B3AA 1E7UA 1K52A 3P63A 3WALA 2VH1A 2ZPNA 1NI3A 2R2QA 3R7RA 3ECIA 3AEGB 4IC7B 2DWQA 2O2VB 1GUAB 4XDCA 1WZ3A 4NJ7A 3AE7B 1TY2A 4LNOA 2DYOA 4DQOC 1WM3A 1IGCA 3MJ5A 4IG7B 2L00B 4JLCA 5HKHA 4I6NB 4RGOS 3ZKJC 1TT5B 5EE1A 4MJSB 3ONSA 4MSMB 3EGRA 3MP9A 5BYQA 4B0MA 1OFFA 2QILA 4FULA 1ZXIA 4WWMA 5HHDG 4RCOA 2LRUA 1WXSA 1LQBA 1UNSA 3BZDB 3GE8C 1JQ4A 3VTWA 2K8CA 1FFVA 1K8RB 3L13A 2J0JA 1WGHA 2A4ZA 2MSED 4GU2A 2IGHA 1V9JA 2FUG1 1J8CA 4C4VA 2MBEA 1NEKB 1WJUA 4NNJB 1E10A 1D5ZC 1VZ8A 3DHGC 3U2SC 3AB5A 3BYYB 3P4QB 2LI5A 2LVPA 3FILB 2WXQA 4MM3B 2O2VA 1D3ZA 3L16A 1FXAA 1LXDA 2HTME 1SGHA 4HVBA 4DDID 3DWMA 4GXBA 5H8YE 1JWSD 4A3OA 1Q10A 4YSYB 1TZ1A 3FC4A 1SJHD 3HIZA 3VTUA 1YOVB 2Y5CA 3DVGY 4MJSA 4YTPB 2WU2B 3RNAC 4KSLC 3KUZA 4YT0B 3AU5A 3I57A 2C5LC 4JWSC 4R3DA 1WXMA 5CX3A 1FFUA 2KDMA 1V1PB 3OWEB 2L32A 4K3BA 4M02A 3C0RB 4ZRKA 2SEBD 5KHQA 2RD0A 5E6OA 4A55A 1J0GA 1UGMA 2GBMA 1TY0A 2A5UA 1MJDA 4ANXA 1MVKA 1TS2A 3TMPB 2M1MA 3PT2B 3FILA 2LGYA 4GOCA 2MLBA 2K8HA 4MM3A 1DGJA 3U8ZA 2ACZB 2BGFA 4I6LB 4IWPA 1X1MA 2XBBC 4M8NA 1TBEA 3DBLI 3LYYA 1C1YB 1EO6A 3EFUA 4WQMA 2GRIA 4FHJA 5BMHA 1F52A 2KANA 4G3XB 1WE7A 2WS3B 2LUMA 1N62A 5LXIB 1XQQA 2MQJA 3HK0A 2IYDB 1C77A 3X0WA 1I4GA 1E7VA 2OEDA 1V1PA 3E9SA 1N6ZA 1H4RA 2KYWA 2RDHA 3N9YC 3PVLA 2K6QA 3Q8CA 3SD5A 3BIID 4L1BA 4HROA 2PVOD 1XT9B 2XN9C 4MGZE 2JQRB 3DQVA 3LB8C 2UYZB 4BOSC 2N0SB 2KJ6A 1MG4A 3T3OA 5IN7A 2IDYA 1WZ0A 4CYEA 3NVYA 2RDGA 1WJ6A 4TQ0A 3ZJTA 2VH2A 1GC6A 3OG5A 1TTNA 1SEBD 3IG3A 1KOTA 2LJIA 4MELA 2K1FA 1GOZA 2G4SA 1F9JA 1GAQB 1C3TA 3AECB 1R4MI 3APCA 1GB1A 1MI0A 4AOFA 2KD0A 3O65B 3V6EB 5KHOA 2K3UA 4P6VF 2LRWA 3UINB 4BOZB 1FO4A 2PJHA 1WGKA 5BMGA 4FA6A 2KN4A 3TEYA 4GDKB 4C56C 4WAFA 4ANUA 2W3SA 3ZRCA 4GGQA 4M0WA 2INNE 1Q1OA 5C3JB 4PYZA 2I2YA 4RH6A 5JXVA 1E8XA 3PZ7A 3W1SA 4N6EB 4MSQB 2K8BA 2GMIC 2W54A 1ISNA 1HE8A 4TSSA 4IUMB 2ZZPB 4WWOA 4EZKA 3L08A 2DAFA 4EFOA 2WXHA 1C79A 1DOIA 4IM2A 4P1BC 1QKZA 3AE1B 3NS8A 3UIOB 1G6JA 1SIJA 3LXFA 3L10B 1AARA 3ZXRA 1E8ZA 1ZW7A 2YEPF 5AUIA 4MACA 2K22A 4FBJB 1YMHE 2N7JA 3AEEB 5E6JA 3NVZA 1Z2MA 1VCBA 4GDKA 3SFDB 4JX1C 4FN2A 2WYQA 2CHZA 1KRHA 1IPGA 3KYCD 3RUIB 3AE9B 2KNBA 3H7SA 4YWGG 2BT6A 3VQIA 1V81A 3ZJUA 2ZW0A 1QOBA 2D11A 3FAHA 1YX5B 3L4PA 3H8HA 4HJGE 1NI2A 2QEJC 4WJPA 4G50A 4W9KA 4WWNA 1J7AA 4IDIA 3DPDA 2NS5A 3ZNZB 2WQYB 3TL5A 2JYTA 2Z0EB 3AEDB 3GS2A 4LLGM 1FNWA 1UWXA 1L7YA 3KH0A 1H8CA 4BKSA 5AEKB 1C78A 2I38A 2MP2A 4A90A 5G55A 2KHWB 2M8SA 4KV2A 3ZNGC 3KWVA 3Q2AC 4FXCA 4JL9A 4YTMB 1RLFA 3AE8B 1TJEA 1WM2A 4BBNC 5G2NA 2Z0DB 3KYDD 3EUB2 4WIPA 1KF6B 4W9DA 4MDKE 3A9KB 2BKFA 3IAS1 3SFEB 3A4RA 3MC0B 2ZNVB 1WYGA 3KLSX 5AUKA 1HTOA 1EM7A 1YN5A 2L8JA 1R4NB 3ZTDA 2L7RA 4L23A 3M63B 2YLMA 3UQAA 1M94A 3SHQA 3APDA 1WX8A 3L17A 4RGNA 4BKSD 4ZRQA 1L6UA 1TKGA 1BMLC 3B08A 1JALA 1U4AA 4LNKA 1SXTA 3IT6B 5DPTA 1QOAA 4NAWB 1FNVA 2LGIA 1XD3B 1YQ3B 2Z59B 2N7DA 3QCAA 5EE0A 3WCQA 3WANA 1ENFA 1WMHB 3QIJA 3ZXVA 3EFCA 3OLMD 4DDGD 4RNAA 1S3SG 3B1LX 5LXHA 2GBJA 4E3CA 4RGMA 1WRIA 2FNJB 3A9KA 3SDLC 2ONQA 1P7FA 2JSVX 4KKJA 1K50A 5BO4B 3RULA 3ZYYX 2JWUA 4RMAA 4W9GA 1MG8A 1YJIA 4DHZB 2L05A 1P1AA 3DHIC 3H7PB 3AN1A 1HQRD 2YEPB 2N9LA 1Y8RC 1EF1A 2X8XX 5FR6A 2TSSA 2LHEA 4W9IA 2RGFA 2WXKA 3I3TB 2J4XA 1NBFC 1S1QB 1V1OA 4D2KA 5TSSA 1E6EB 1P3QU 2LEKA 1VR9A 4IM3A 5CHWA 3TSSA 1RAXA 4NJ6A 1WGYA 1WX7A 4NAWA 4KGSA 1FD6A 2YVCA 3ZJVA 3L0WB 2BS4B 2DX5B 1I4HA 2WX1A 2D3CA 2MA9B 1C4CA 3RYTA 2FCSA 2LVOA 4MEMA 2PIAA 2NBWB 2GBKA 3AEFB 1EU4A 2E6XA 4CO7A 2WDQB 2WXRA 1XEEA 4E74A 4US8A 3VFKA 4JE3B 4XZ4A 3NS1A 1BXTA 3Q8FA 4A3PA 5H92C 2LXCA 2LVQA 4EE2A 3WAOA 2BB6A 4GN1A 4KGTA 2WXPA 4F8CB 3J9CA 5D3IB 1KLGD 1GG3A 3JSVB 2GLSA 3TIXA 3B9JA 2BBCA 3DDCB 3H7PA 4C4VB 2NTTA 2JRIB 3T8MA 3M3JA 1LM8B 2JWZA 3IXSA 1DOYA 2X38A 3D32A 2JXXA 3H9DA 3U52E 1N5XA 1NYQA 2MJ3A 2MCNB 3I63C 1WGGA 1UELA 4NAMA 1JRUA 2V4LA 2NTSA 3Q6BA 2LUEA 3QJZA 3NHEB 3W9CB 3U4EG 3ZQ4A 3ZO5B 2ZEQA 3VRAB 2C7NB 2QIEB 2RMMA 3HRDD 2CJOA 4NQKE 4WJNA 2SAKA 1PGBA 1JWAD 2N9XA 3V05A 2WXOA 2IJ0A 1WXAA 3ZW3A 2BVCA 1XLQA 2WDRB 4DBGA 3DWGC 2WLBA 1QQRA 4XE0A 3W2DA 1ET6A 1ZOYB 4FJYA 2JX5A 2N9EB 2LGSA 1HXYD 2DNFA 3UIPB 3BYTB 5GXGB 2ZW1A 3MHZA 2BKRB 2L52A 3JSVA 3JVZX 2DBYA 3M62B 1XXGA 2N1VA 4KKIA 1FRRA 2KTFA 3QQ8B 3EHVA 3VXWA 1TYGB 1C4AA 5IA7A 3AI5A 1L0XB 4EUTA 3MTNB 1SE2A 2QC8A 2J52A 3WA0A 1OQRA 4KX6B 1BT0A 1VZ6A 3ZLZA 1JCKB 2KTRB 4EZLA 4C00A 2OOBB 3DBHB 3DBRB 3NRZA 3N3KB 3T9LA 4PYUA 1OGWA 4M01A 2CU3A 3LDZE 2JPHA 1JWMD 2MRPA 1MHHE 1L5PA 2BYVE 2IGDA 3ZRFA 1LO5D 1I4RA 1ESFA 2CS4A 2HE7A 3VUWA 2MJDA 4B0EA 2KK8A 2MX2A 2Z8LA 2ZNVC 3DBSA 1QOFA 3P4PB 2K0PA 3PTFC 2J42A 2NR2A 2KFKB 3KWLA 3E56A 3URYA 1WRDB 4AQ7A 3CMMB 1T0SC 4PT5A 5HFYA 1WR6E 1IYFA 2AQ2B 3UF8A 4WH4A 2KX0A 3EA6A 3Q8BA 1ROEA 2KTRA 1SSNA 1WJ4A 3I9V1 1AYFA 4W9EA 5D94A 2KC2A 2PE6B 2V4IB 1YJ1A 5IAAC 3SEBA 4OVVA 1V6EA 4ITKA 1T6BX 1QLBB 4OVUA 2DZMA 4XWTA 1L4ZB 2MBBB 2WXIA 4KIKA 3N1ZC 1N60A 3AH7A 1C76A 1PFDA 2V0GA 1V5TA 3NZUA 3X23A 4B6WA 3P42A 3V61A 1D5MC 1E0ZA 3AMZA 4M0WB 2KFKA 1I4QA 4HPPA 1E8YA 1ZKHA 4BKTA 2N7EA 4WURA 5HG2A 1E5WA 1KJTA 1FM0D 2K6DB 3ML9A 3R3MA 4ANWA 5CTRC 3GZNB 1SE9A 4RFBA 1QILA 1XLNA 2CR5A 2WDVB 1R7SA 1DYQA 1HA5A 4IWQA 3MJWA 2ASQA 2KLCA 2G3QB 1OEYA 2DZJA 4IKGA 2L0FA 2NBUA 1SF0A 3R8BA 2CU1A 1ACCA 1D4BA 4URKA 3CSTA 2BYFA 2IZVB 2M0XA 2M19A 2EMTA 2G1EA 1R4NI 4PS8A 4RF0A 4NJCA 1MHXA 4HEA1 3GP7A 1QZEA 3W5VB 2KWCA 2ZCBA 5L83A 4DWFA 1VDVA 2LXAA 2N4FA 4JGHB 4FHKA 4O1NA 3TBLD 1V97A 5BYSA 4KZ0A 1OEYJ 5DPSA 3P2BA 2FAZA 1KFYB 4RM8A 3NZSA 2LZ6A 4HDOA 2VZKD 3VR8B 4HCPB 1WR1A 4HWIB 1ZDXA 1NYRA 4OZCA 2WGSA 5DPWA 3M95A 2WXGA 5D3DA 2KO3A 1YJJA 1ZUD2 4LJOB 4LNFA 1YQ4B 4K1RB 3CWIA 3QAQA 3UGBB 4HKQA 2MP2B 1E90A 1FEHA 2KKCA 1FNUA 3VUYA 3DVGX 1L0VB 1VRAB 1VJKA 5JH5C 1RYJA 4B9KA 1PDXA 2JT4B 4ASWC 4LCDE 2VRRB 3OJ4B 1RFKA 2WXFA 4K7WA 2DZKA 3Q69A 1JRPA 3QARA 2UU7A 4JWUC 2WXNA 2XK5B 3A1QB 5J2RA 2G4DB 1ZXHA 1SIFA 2BW2A 3RMKC 3P4RB 1XCTL 2M56B 2ZCCA 4ZYSA 2CJNA 3IHPC 1J19A 1V49A 4AWJA 3N1YC 2WU5B 3CF6E 3Q8AA 3BY4B 1KLVA 4TV3A 5G5GA 1ZGUB 1CZPA 2ZVNA 2BTEA 2I1JA 4FLHA 2RPVA 4NZLB 4KDLB 3OAWA 2AL6A 3HM3A 3DVNV 2MBHA 1IP9A 1A5RA 1XLPA 2LFIA 4AJWA 4ARCA 2C7MB 2QSDA 1BUIC 2KQSA 3VH4B 3ENEA 3N1XC 3RNGC 3R66C 5E6PA 2WXJA 1KH0A 3KUDB 4ZRPA 1J7BA 1ZDVA 2QJLA 1V86A 1AWDA 1P0RA 2EKIA 2PTLA 3TEXA 2EMSA 1SE3A 2BS2B 2WP9B 2LHDA 1I7HA 2XK5A 2GOWA 1WIAA 1SJED 3A1QA 3PZDA 4W9LA 2IPKD 4W9CA 4TUUA 1EU3A 3DHHC 4YSXB 4F7ZA 3U30A 2BPSA 4N59A 1UD7A 3DOWA 2PMVA 1AW7A 2V1YA 4N9F4 2MWSB 3S2AA 1WY8A 2IY1B 3TJPA 3Q3NC 1NENB 1XO3A 2C7HA 1FPYA 3PRZA 1KM7A 4IW0A 1STEA 1F77A 2KWUB 1TS4A 4US9A 2XEWA 2WDTB 3RZWC
chains in the Genus database with same CATH topology
3DBLI 2N9XA 1C1YB 3PREA 2PE9A 3N32A 1EO6A 2C9WB 3EFUA 3QX1A 4FHJA 4BFRA 1WXAA 4MGYE 3ZW3A 2DYBA 4ZRJA 4W9JA 1WE6A 2KANA 3DBHI 3DBRI 1WE7A 1E8WA 2KLGA 4G3XB 4AJYB 4DBGA 4BVUC 5LXIB 1XQQA 1WGRA 2MQJA 3HK0A 4FJYA 2AYOB 2IYDB 2RR9A 3VVWB 2LGXA 2N9EB 4B95A 3X0WA 2D2QA 3UIPB 1E7VA 3W1SC 2IO1B 3WIMA 3QWZB 4KSKC 2L76A 3HM6X 5DCNA 4W9HA 3H6NA 2KOXA 2BKRB 2O6VD 2WX0A 3OJ3A 3JSVA 1H4RA 3JVZX 3M62B 3QA8A 3PVLA 2K6QA 3ALBA 2N1VA 3SD5A 1XT9B 4MGZE 4YL8A 2KTFA 4IWOA 3DQVA 3QQ8B 2UYZB 3EHVA 4MGIE 3VXWA 4BOSC 4ICVA 5AZGA 5IA7A 2Y5BB 3AI5A 2FIDA 4AP4C 4BKGA 2KJ6A 4EUTA 3MTNB 3TCAA 3K9PB 5LLIA 3V6CB 3WA0A 1WZ0A 4LDTB 1BT0A 4CYEA 2D3GA 3ZLZA 4DK5A 3CSFA 1WJ6A 2KTRB 4TQ0A 3ZUNA 4F1SA 4EZLA 2G45B 4FADA 4A20A 1GC6A 2OOBB 2J0KA 2JY6A 1TTNA 2MW5A 4GDLA 3IG3A 3N3KB 2BF8B 2IBIB 3T9LA 4PYUA 4K7SA 3ZNHB 1OGWA 2W9NA 3N30A 2KZRA 4MELA 4ANVA 1VD2A 2K1FA 3LJ3A 2G4SA 3ML8A 1F9JA 3A4SC 2J0MA 3AULA 3A9JB 3LDZE 1P9DU 1C3TA 4NQLB 3EC8A 4XC2A 1R4MI 2JPHA 2AEHA 3APCA 3VHTC 2AWTA 4DXAB 1UBIA 2MRPA 4AOFA 4ZDVA 4II2B 2KD0A 5JZEB 1WJNA 2BYVE 3EECA 3O65B 3V6EB 3ZRFA 2KJRA 2FCNA 5D6JB 4HCNB 5KHOA 1P98A 1V5OA 2LRWA 4JQWC 2KWVB 3UINB 3AXCA 2CS4A 4HPMB 2KFJA 4DHJD 2HE7A 4HJKA 3VUWA 4BOZB 3WAPA 2KK8A 2MX2A 2PJHA 2KDEB 3K9OB 2ZNVC 4FA6A 2V3SA 2KC1A 3DBSA 4GMVA 4TKNA 3PSEB 3UQBA 3Q3JA 2LJ5A 3VDZA 2DAJA 4GDKB 4K7UA 1Z5SB 3VAWA 3PTFC 2L3ZA 1OTRB 2NR2A 2RSUA 4G0NB 4ANUA 1L2NA 2KFKB 3ZRCA 1WFYA 4GGQA 3SU8X 2JUOA 1Q1OA 4PYZA 1WRDB 2IO3B 3NOBA 1E8XA 3CMMB 2CKHB 3W1SA 4AUQC 2KVRA 2NBVB 4MSQB 2K8BA 3NY5A 2GMIC 1WR6E 1IYFA 1ISNA 2D07B 3QC8B 1HE8A 3UF8A 2HJ8A 2KX0A 4IUMB 2ZZPB 1WYWB 4WWOA 4EZKA 1RFAA 1V80A 2FIFA 2DAFA 2KTRA 3L08A 4HXDA 4J6IA 1WJ4A 4EFOA 4PS3A 2CHWA 2CHXA 4W9EA 5D94A 2KC2A 2PE6B 4IM2A 3W1YA 2NCNA 3RZFA 1I35A 2NPTB 3NS8A 1YJ1A 3UIOB 5IAAC 5JHBA 1G6JA 3A9JA 2N9PC 3IFWB 3PS6A 3GOEA 2GBNA 1YX6B 4OVVA 2KX3A 2NVUI 1V6EA 3L10B 4RM9A 2KMCA 3VTVA 2IO0B 1AARA 4IM0A 3PV1A 2DENB 1Q5WB 4FJZA 4OVUA 1E8ZA 1ZW7A 2DZMA 3U7DA 2N1WA 1WF9A 3GZNI 2MBBB 3MHSD 4KIKA 5EDSA 1I42A 4WJOA 3QHTA 3PPAA 4EOYA 4FBJB 1WGDA 4CHKA 5E6NA 1V5TA 3NZUA 3X23A 1Z2MA 4HLEA 1VCBA 4B6WA 4GDKA 1TGZB 4EZJA 4TQ1A 4FN2A 2KMAA 3V61A 2WYQA 1EUVB 2CHZA 2LASA 1IPGA 4M0WB 3KYCD 2FCMA 2KFKA 3RUIB 1YQBA 2JZZA 2IO2B 2KNBA 3H7SA 1GNUA 1E8YA 1Q0WB 1ZKHA 4BKTA 2N7EA 2OJRA 1T0YA 4E71A 2WWZA 3VQIA 1V81A 2AL3A 2D11A 3KVFB 4LDTD 1YD8U 1YX5B 4GSWA 2BYEA 3PGEA 1NI2A 4WJPA 4G50A 1E5WA 1KJTA 4W9KA 2PPHA 4WWNA 2K6DB 3ML9A 2JRHA 1RRBA 3R3MA 4ANWA 5CTRC 3DPDA 1SE9A 2NS5A 1GJZA 2FUHB 4HK2A 2CR5A 3ZNZB 5DPRA 4IWQA 4WWPA 3TL5A 3MJWA 2ASQA 2M17A 2KLCA 2Z0EB 1PQSA 2G3QB 2K39A 1OEYA 3PHXB 2LWPA 2NPTA 4GIVA 2DZJA 2L0FA 5AZHA 2NBUA 1WH3A 2R2OA 3APFA 4MH0E 1L7YA 3HHMA 3KH0A 2CU1A 1H8CA 4BKSA 5AEKB 2J7QB 4BBNF 4URKA 3CSTA 2MP2A 2BYFA 3L54A 2IZVB 2M0XA 2KHWB 5G55A 2ZPYA 2M8SA 2EMTA 2KJHB 2ZVOA 2JF5A 4KV2A 2MBQA 1R4NI 3R7QA 4PS8A 3ZNGC 4KIKB 2JVCA 4NY0A 4EKUA 5CHFA 4G11A 4HPLB 2FCQA 1UH6A 3BINA 4JL9A 2KDIA 1QZEA 4X57B 5GMVA 1OQYA 1RLFA 2KWCA 3Q3FA 2ZCBA 5CHVC 5L83A 4I6PA 4DHZE 1WM2A 4PS7A 4DWFA 1WMHA 4K81A 4KZCA 3WAMA 2LXAA 2N4FA 4JGHB 4FHKA 2REXA 1WX9A 2RPQA 3QK0A 5G2NA 3TBLD 4BBNC 2Z0DB 5AZFA 2BWFA 3PLVA 2KN5A 3KYDD 4KZ0A 2I1KA 2ZJDA 3DCGA 1CMXB 1OEYJ 4MDKE 2DYMA 4W9DA 3A9KB 2BKFA 5DPSA 3P2BA 3RT3B 2BWES 3A4RA 3IVFA 2L0TA 2FAZA 5C1ZA 2ZNVB 4W9FA 4RM8A 3NZSA 5L95C 2LZ6A 5D7GA 4HDOA 4II3B 2K25A 4KDIC 4WQOB 2D10A 4GB9A 2L8JA 2KDFB 3VH3B 4HCPB 1WR1A 2KDBA 4HWIB 3ZTDA 2L7RA 3PRPB 2PEAA 3PRMB 4XX5A 3RCZA 4FJVB 3M63B 2YLMA 5DPWA 3M95A 3UQAA 2GBRA 1UBQA 1M94A 2KO3A 3SHQA 3V62A 3VUXA 3APDA 1WX8A 4ZRIA 4LJOB 2B3AA 3L17A 1E7UA 4K1RB 3WALA 4BKSD 1LFDA 3QAQA 2ZPNA 2R2QA 4ZYNA 3R7RA 3B0AA 3ECIA 3B08A 5J17A 3UGBB 4KVGB 2MP2B 1U4AA 4IC7B 1E90A 5C23A 2O2VB 2KKCA 5DPTA 1GUAB 4NAWB 1WZ3A 4NJ7A 3PLUA 3VUYA 3DVGX 1XD3B 2DYOA 1WM3A 5JH5C 4ICUA 4IG7B 2Z59B 2N7DA 3QCAA 4B9KA 2JT4B 3WANA 2L00B 4JLCA 4LCDE 4I6NB 1WMHB 4WAAA 4ASWC 5HKHA 3QIJA 2VRRB 3ZKJC 3OJ4B 2IY0B 3ZDTA 3OLMD 4HDQA 4DDGD 4MJSB 1S3SG 3B1LX 3ONSA 4MSMB 5D2MB 3ZIMA 4K7WA 2DZKA 4MGKE 5LXHA 2GBJA 1GC7A 4FULA 4E3CA 2FNJB 3A9KA 3SDLC 3ZTCA 1KOTA 3QARA 2LRUA 4LJPB 1WXSA 2XK5B 1WXVA 1LQBA 3RULA 2M4NA 3A1QB 5BO4B 3VTWA 5J2RA 3ZVVA 4RMAA 2K8CA 2G4DB 4W9GA 1K8RB 3L13A 1MG8A 1SIFA 2J0JA 4DHZB 2L05A 1WGHA 2KQ7A 2ZCCA 1P1AA 2A4ZA 3IHPC 1J19A 2MSED 1V49A 2O6VB 4AWJA 4GU2A 2HD5B 3H7PB 3A33B 3CF6E 1WI0A 1V9JA 3BY4B 1KLVA 1J8CA 2MBEA 5FR6A 1Y8RC 1EF1A 2DZIA 4TV3A 1ZGUB 2ZVNA 3JYUA 4W9IA 1WJUA 4NNJB 2RGFA 3I3TB 5TR5A 1NDDA 2I1JA 1NBFC 1S1QB 4FLHA 5JHAA 2LI5A 2LVPA 4KDLB 3OAWA 2MBOA 1P3QU 2AL6A 3KW5B 3HM3A 3DVNV 2MBHA 4IM3A 4NPNA 5CHWA 1IP9A 3PHWB 1A5RA 1RAXA 2O2VA 4NJ6A 4AJWA 1D3ZA 3L16A 1WGYA 1WX7A 3H1UA 4NAWA 2YVCA 2C7MB 3L0WB 1LXDA 2DX5B 2KQSA 2WX1A 3ENEA 3VH4B 2LGDA 2MA9B 1SGHA 1V2YA 3RYTA 4DDID 2FCSA 4GXBA 4HVBA 3R66C 2LVOA 5E6PA 1FXTB 4A3OA 3IBEA 4MEMA 1UZXB 2NBWB 2GBKA 1TZ1A 3HIZA 3KUDB 4CO7A 3VTUA 4E74A 3DVGY 2KXJA 4MJSA 3VFKA 4XZ4A 3KUCB 1V86A 4KSLC 3KUZA 1P0RA 3AU4A 2C60A 3AU5A 2EMSA 2C5LC 4M8MA 4A3PA 4DHJB 3RD2A 1WXMA 2XK5A 5CX3A 2GOWA 1WIAA 2LXCA 4P7IA 2LVQA 3A1QA 3PZDA 1YIWA 4W9LA 3WAOA 4GN1A 4TUUA 4W9CA 4F8CB 3JSVB 1GG3A 3C0RB 4ZRKA 4F7ZA 3V60A 2EKEC 3TIXA 2O6VA 3U30A 3DDCB 3H7PA 3ZDMC 5KHQA 5J18A 2RD0A 2BPSA 2JRIB 3T8MA 1UD7A 5E6OA 3M3JA 3DOWA 1LM8B 1UGMA 2LD9A 2GBMA 4EEWA 1J0GA 2JWZA 2A5UA 4ANXA 2V1YA 3D32A 2JXXA 4N9F4 3H9DA 2MWSB 3S2AA 1WY8A 2IY1B 3TMPB 2MCNB 3TJPA 1WGGA 1UELA 2M1MA 3PT2B 2QHOA 2DHZA 1JRUA 2LGYA 3JW0X 4GOCA 2V4LA 2MLBA 2LUEA 4GDLB 2K8HA 4MM3A 4WJQA 2UWQA 2HTHA 3QJZA 2C7HA 3U8ZA 3NHEB 1EF5A 3PRZA 2BGFA 1KM7A 3ZO5B 2ZEQA 4IW0A 3DVNU 2C7NB 4I6LB 2JZ3B 4IWPA 3ZNID 2KWUB 4JIOU 1X1MA 2XBBC 2XEWA 4M8NA 2WDTB 1TBEA 4NQKE 4WJNA 3RZWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBL I;  2N9X A;  1C1Y B;  3PRE A;  2PE9 A;  3N32 A;  1EO6 A;  2C9W B;  3EFU A;  3QX1 A;  4FHJ A;  4BFR A;  1WXA A;  4MGY E;  3ZW3 A;  2DYB A;  4ZRJ A;  4W9J A;  1WE6 A;  2KAN A;  3DBH I;  3DBR I;  1WE7 A;  1E8W A;  2KLG A;  4G3X B;  4AJY B;  4DBG A;  4BVU C;  5LXI B;  1XQQ A;  1WGR A;  2MQJ A;  3HK0 A;  4FJY A;  2AYO B;  2IYD B;  2RR9 A;  3VVW B;  2LGX A;  2N9E B;  4B95 A;  3X0W A;  2D2Q A;  3UIP B;  1E7V A;  3W1S C;  2IO1 B;  3WIM A;  3QWZ B;  4KSK C;  2L76 A;  3HM6 X;  5DCN A;  4W9H A;  3H6N A;  2KOX A;  2BKR B;  2O6V D;  2WX0 A;  3OJ3 A;  3JSV A;  1H4R A;  3JVZ X;  3M62 B;  3QA8 A;  3PVL A;  2K6Q A;  3ALB A;  2N1V A;  3SD5 A;  1XT9 B;  4MGZ E;  4YL8 A;  2KTF A;  4IWO A;  3DQV A;  3QQ8 B;  2UYZ B;  3EHV A;  4MGI E;  3VXW A;  4BOS C;  4ICV A;  5AZG A;  5IA7 A;  2Y5B B;  3AI5 A;  2FID A;  4AP4 C;  4BKG A;  2KJ6 A;  4EUT A;  3MTN B;  3TCA A;  3K9P B;  5LLI A;  3V6C B;  3WA0 A;  1WZ0 A;  4LDT B;  1BT0 A;  4CYE A;  2D3G A;  3ZLZ A;  4DK5 A;  3CSF A;  1WJ6 A;  2KTR B;  4TQ0 A;  3ZUN A;  4F1S A;  4EZL A;  2G45 B;  4FAD A;  4A20 A;  1GC6 A;  2OOB B;  2J0K A;  2JY6 A;  1TTN A;  2MW5 A;  4GDL A;  3IG3 A;  3N3K B;  2BF8 B;  2IBI B;  3T9L A;  4PYU A;  4K7S A;  3ZNH B;  1OGW A;  2W9N A;  3N30 A;  2KZR A;  4MEL A;  4ANV A;  1VD2 A;  2K1F A;  3LJ3 A;  2G4S A;  3ML8 A;  1F9J A;  3A4S C;  2J0M A;  3AUL A;  3A9J B;  3LDZ E;  1P9D U;  1C3T A;  4NQL B;  3EC8 A;  4XC2 A;  1R4M I;  2JPH A;  2AEH A;  3APC A;  3VHT C;  2AWT A;  4DXA B;  1UBI A;  2MRP A;  4AOF A;  4ZDV A;  4II2 B;  2KD0 A;  5JZE B;  1WJN A;  2BYV E;  3EEC A;  3O65 B;  3V6E B;  3ZRF A;  2KJR A;  2FCN A;  5D6J B;  4HCN B;  5KHO A;  1P98 A;  1V5O A;  2LRW A;  4JQW C;  2KWV B;  3UIN B;  3AXC A;  2CS4 A;  4HPM B;  2KFJ A;  4DHJ D;  2HE7 A;  4HJK A;  3VUW A;  4BOZ B;  3WAP A;  2KK8 A;  2MX2 A;  2PJH A;  2KDE B;  3K9O B;  2ZNV C;  4FA6 A;  2V3S A;  2KC1 A;  3DBS A;  4GMV A;  4TKN A;  3PSE B;  3UQB A;  3Q3J A;  2LJ5 A;  3VDZ A;  2DAJ A;  4GDK B;  4K7U A;  1Z5S B;  3VAW A;  3PTF C;  2L3Z A;  1OTR B;  2NR2 A;  2RSU A;  4G0N B;  4ANU A;  1L2N A;  2KFK B;  3ZRC A;  1WFY A;  4GGQ A;  3SU8 X;  2JUO A;  1Q1O A;  4PYZ A;  1WRD B;  2IO3 B;  3NOB A;  1E8X A;  3CMM B;  2CKH B;  3W1S A;  4AUQ C;  2KVR A;  2NBV B;  4MSQ B;  2K8B A;  3NY5 A;  2GMI C;  1WR6 E;  1IYF A;  1ISN A;  2D07 B;  3QC8 B;  1HE8 A;  3UF8 A;  2HJ8 A;  2KX0 A;  4IUM B;  2ZZP B;  1WYW B;  4WWO A;  4EZK A;  1RFA A;  1V80 A;  2FIF A;  2DAF A;  2KTR A;  3L08 A;  4HXD A;  4J6I A;  1WJ4 A;  4EFO A;  4PS3 A;  2CHW A;  2CHX A;  4W9E A;  5D94 A;  2KC2 A;  2PE6 B;  4IM2 A;  3W1Y A;  2NCN A;  3RZF A;  1I35 A;  2NPT B;  3NS8 A;  1YJ1 A;  3UIO B;  5IAA C;  5JHB A;  1G6J A;  3A9J A;  2N9P C;  3IFW B;  3PS6 A;  3GOE A;  2GBN A;  1YX6 B;  4OVV A;  2KX3 A;  2NVU I;  1V6E A;  3L10 B;  4RM9 A;  2KMC A;  3VTV A;  2IO0 B;  1AAR A;  4IM0 A;  3PV1 A;  2DEN B;  1Q5W B;  4FJZ A;  4OVU A;  1E8Z A;  1ZW7 A;  2DZM A;  3U7D A;  2N1W A;  1WF9 A;  3GZN I;  2MBB B;  3MHS D;  4KIK A;  5EDS A;  1I42 A;  4WJO A;  3QHT A;  3PPA A;  4EOY A;  4FBJ B;  1WGD A;  4CHK A;  5E6N A;  1V5T A;  3NZU A;  3X23 A;  1Z2M A;  4HLE A;  1VCB A;  4B6W A;  4GDK A;  1TGZ B;  4EZJ A;  4TQ1 A;  4FN2 A;  2KMA A;  3V61 A;  2WYQ A;  1EUV B;  2CHZ A;  2LAS A;  1IPG A;  4M0W B;  3KYC D;  2FCM A;  2KFK A;  3RUI B;  1YQB A;  2JZZ A;  2IO2 B;  2KNB A;  3H7S A;  1GNU A;  1E8Y A;  1Q0W B;  1ZKH A;  4BKT A;  2N7E A;  2OJR A;  1T0Y A;  4E71 A;  2WWZ A;  3VQI A;  1V81 A;  2AL3 A;  2D11 A;  3KVF B;  4LDT D;  1YD8 U;  1YX5 B;  4GSW A;  2BYE A;  3PGE A;  1NI2 A;  4WJP A;  4G50 A;  1E5W A;  1KJT A;  4W9K A;  2PPH A;  4WWN A;  2K6D B;  3ML9 A;  2JRH A;  1RRB A;  3R3M A;  4ANW A;  5CTR C;  3DPD A;  1SE9 A;  2NS5 A;  1GJZ A;  2FUH B;  4HK2 A;  2CR5 A;  3ZNZ B;  5DPR A;  4IWQ A;  4WWP A;  3TL5 A;  3MJW A;  2ASQ A;  2M17 A;  2KLC A;  2Z0E B;  1PQS A;  2G3Q B;  2K39 A;  1OEY A;  3PHX B;  2LWP A;  2NPT A;  4GIV A;  2DZJ A;  2L0F A;  5AZH A;  2NBU A;  1WH3 A;  2R2O A;  3APF A;  4MH0 E;  1L7Y A;  3HHM A;  3KH0 A;  2CU1 A;  1H8C A;  4BKS A;  5AEK B;  2J7Q B;  4BBN F;  4URK A;  3CST A;  2MP2 A;  2BYF A;  3L54 A;  2IZV B;  2M0X A;  2KHW B;  5G55 A;  2ZPY A;  2M8S A;  2EMT A;  2KJH B;  2ZVO A;  2JF5 A;  4KV2 A;  2MBQ A;  1R4N I;  3R7Q A;  4PS8 A;  3ZNG C;  4KIK B;  2JVC A;  4NY0 A;  4EKU A;  5CHF A;  4G11 A;  4HPL B;  2FCQ A;  1UH6 A;  3BIN A;  4JL9 A;  2KDI A;  1QZE A;  4X57 B;  5GMV A;  1OQY A;  1RLF A;  2KWC A;  3Q3F A;  2ZCB A;  5CHV C;  5L83 A;  4I6P A;  4DHZ E;  1WM2 A;  4PS7 A;  4DWF A;  1WMH A;  4K81 A;  4KZC A;  3WAM A;  2LXA A;  2N4F A;  4JGH B;  4FHK A;  2REX A;  1WX9 A;  2RPQ A;  3QK0 A;  5G2N A;  3TBL D;  4BBN C;  2Z0D B;  5AZF A;  2BWF A;  3PLV A;  2KN5 A;  3KYD D;  4KZ0 A;  2I1K A;  2ZJD A;  3DCG A;  1CMX B;  1OEY J;  4MDK E;  2DYM A;  4W9D A;  3A9K B;  2BKF A;  5DPS A;  3P2B A;  3RT3 B;  2BWE S;  3A4R A;  3IVF A;  2L0T A;  2FAZ A;  5C1Z A;  2ZNV B;  4W9F A;  4RM8 A;  3NZS A;  5L95 C;  2LZ6 A;  5D7G A;  4HDO A;  4II3 B;  2K25 A;  4KDI C;  4WQO B;  2D10 A;  4GB9 A;  2L8J A;  2KDF B;  3VH3 B;  4HCP B;  1WR1 A;  2KDB A;  4HWI B;  3ZTD A;  2L7R A;  3PRP B;  2PEA A;  3PRM B;  4XX5 A;  3RCZ A;  4FJV B;  3M63 B;  2YLM A;  5DPW A;  3M95 A;  3UQA A;  2GBR A;  1UBQ A;  1M94 A;  2KO3 A;  3SHQ A;  3V62 A;  3VUX A;  3APD A;  1WX8 A;  4ZRI A;  4LJO B;  2B3A A;  3L17 A;  1E7U A;  4K1R B;  3WAL A;  4BKS D;  1LFD A;  3QAQ A;  2ZPN A;  2R2Q A;  4ZYN A;  3R7R A;  3B0A A;  3ECI A;  3B08 A;  5J17 A;  3UGB B;  4KVG B;  2MP2 B;  1U4A A;  4IC7 B;  1E90 A;  5C23 A;  2O2V B;  2KKC A;  5DPT A;  1GUA B;  4NAW B;  1WZ3 A;  4NJ7 A;  3PLU A;  3VUY A;  3DVG X;  1XD3 B;  2DYO A;  1WM3 A;  5JH5 C;  4ICU A;  4IG7 B;  2Z59 B;  2N7D A;  3QCA A;  4B9K A;  2JT4 B;  3WAN A;  2L00 B;  4JLC A;  4LCD E;  4I6N B;  1WMH B;  4WAA A;  4ASW C;  5HKH A;  3QIJ A;  2VRR B;  3ZKJ C;  3OJ4 B;  2IY0 B;  3ZDT A;  3OLM D;  4HDQ A;  4DDG D;  4MJS B;  1S3S G;  3B1L X;  3ONS A;  4MSM B;  5D2M B;  3ZIM A;  4K7W A;  2DZK A;  4MGK E;  5LXH A;  2GBJ A;  1GC7 A;  4FUL A;  4E3C A;  2FNJ B;  3A9K A;  3SDL C;  3ZTC A;  1KOT A;  3QAR A;  2LRU A;  4LJP B;  1WXS A;  2XK5 B;  1WXV A;  1LQB A;  3RUL A;  2M4N A;  3A1Q B;  5BO4 B;  3VTW A;  5J2R A;  3ZVV A;  4RMA A;  2K8C A;  2G4D B;  4W9G A;  1K8R B;  3L13 A;  1MG8 A;  1SIF A;  2J0J A;  4DHZ B;  2L05 A;  1WGH A;  2KQ7 A;  2ZCC A;  1P1A A;  2A4Z A;  3IHP C;  1J19 A;  2MSE D;  1V49 A;  2O6V B;  4AWJ A;  4GU2 A;  2HD5 B;  3H7P B;  3A33 B;  3CF6 E;  1WI0 A;  1V9J A;  3BY4 B;  1KLV A;  1J8C A;  2MBE A;  5FR6 A;  1Y8R C;  1EF1 A;  2DZI A;  4TV3 A;  1ZGU B;  2ZVN A;  3JYU A;  4W9I A;  1WJU A;  4NNJ B;  2RGF A;  3I3T B;  5TR5 A;  1NDD A;  2I1J A;  1NBF C;  1S1Q B;  4FLH A;  5JHA A;  2LI5 A;  2LVP A;  4KDL B;  3OAW A;  2MBO A;  1P3Q U;  2AL6 A;  3KW5 B;  3HM3 A;  3DVN V;  2MBH A;  4IM3 A;  4NPN A;  5CHW A;  1IP9 A;  3PHW B;  1A5R A;  1RAX A;  2O2V A;  4NJ6 A;  4AJW A;  1D3Z A;  3L16 A;  1WGY A;  1WX7 A;  3H1U A;  4NAW A;  2YVC A;  2C7M B;  3L0W B;  1LXD A;  2DX5 B;  2KQS A;  2WX1 A;  3ENE A;  3VH4 B;  2LGD A;  2MA9 B;  1SGH A;  1V2Y A;  3RYT A;  4DDI D;  2FCS A;  4GXB A;  4HVB A;  3R66 C;  2LVO A;  5E6P A;  1FXT B;  4A3O A;  3IBE A;  4MEM A;  1UZX B;  2NBW B;  2GBK A;  1TZ1 A;  3HIZ A;  3KUD B;  4CO7 A;  3VTU A;  4E74 A;  3DVG Y;  2KXJ A;  4MJS A;  3VFK A;  4XZ4 A;  3KUC B;  1V86 A;  4KSL C;  3KUZ A;  1P0R A;  3AU4 A;  2C60 A;  3AU5 A;  2EMS A;  2C5L C;  4M8M A;  4A3P A;  4DHJ B;  3RD2 A;  1WXM A;  2XK5 A;  5CX3 A;  2GOW A;  1WIA A;  2LXC A;  4P7I A;  2LVQ A;  3A1Q A;  3PZD A;  1YIW A;  4W9L A;  3WAO A;  4GN1 A;  4TUU A;  4W9C A;  4F8C B;  3JSV B;  1GG3 A;  3C0R B;  4ZRK A;  4F7Z A;  3V60 A;  2EKE C;  3TIX A;  2O6V A;  3U30 A;  3DDC B;  3H7P A;  3ZDM C;  5KHQ A;  5J18 A;  2RD0 A;  2BPS A;  2JRI B;  3T8M A;  1UD7 A;  5E6O A;  3M3J A;  3DOW A;  1LM8 B;  1UGM A;  2LD9 A;  2GBM A;  4EEW A;  1J0G A;  2JWZ A;  2A5U A;  4ANX A;  2V1Y A;  3D32 A;  2JXX A;  4N9F 4;  3H9D A;  2MWS B;  3S2A A;  1WY8 A;  2IY1 B;  3TMP B;  2MCN B;  3TJP A;  1WGG A;  1UEL A;  2M1M A;  3PT2 B;  2QHO A;  2DHZ A;  1JRU A;  2LGY A;  3JW0 X;  4GOC A;  2V4L A;  2MLB A;  2LUE A;  4GDL B;  2K8H A;  4MM3 A;  4WJQ A;  2UWQ A;  2HTH A;  3QJZ A;  2C7H A;  3U8Z A;  3NHE B;  1EF5 A;  3PRZ A;  2BGF A;  1KM7 A;  3ZO5 B;  2ZEQ A;  4IW0 A;  3DVN U;  2C7N B;  4I6L B;  2JZ3 B;  4IWP A;  3ZNI D;  2KWU B;  4JIO U;  1X1M A;  2XBB C;  2XEW A;  4M8N A;  2WDT B;  1TBE A;  4NQK E;  4WJN A;  3RZW C; 
#chains in the Genus database with same CATH topology
 4MH8 A;  2C9W B;  2Y5P A;  3QX1 A;  4BFR A;  4OZA A;  4MGY E;  2DYB A;  4W9J A;  1F2R C;  1WE6 A;  3DBH I;  3DBR I;  1E8W A;  4BVU C;  1WGR A;  2AYO B;  2RR9 A;  2LGX A;  4LTU A;  1CK1 A;  2D2Q A;  3W1S C;  3AE6 B;  4KSK C;  2FBW B;  1JML A;  3H6N A;  2KOX A;  3OJ3 A;  4XWW A;  3RNB C;  4USA A;  3ALB A;  2AQ1 B;  4YL8 A;  4IWO A;  4P1C C;  4MGI E;  4ICV A;  5AZG A;  2Y5B B;  4AP4 C;  4BKG A;  5BYR A;  3V6C B;  2D3G A;  1UWM A;  4F1S A;  4FAD A;  2G45 B;  1D5X C;  2NMQ A;  1QT9 A;  1VLB A;  2IBI B;  4K7S A;  2W9N A;  3LJ3 A;  3NZ3 A;  2QCZ A;  4ZOH C;  3NVV A;  2QDF A;  1J7C A;  2PW9 A;  2WHI A;  2D5G A;  4C7Z A;  4XC2 A;  2KAJ A;  2AWT A;  1UBI A;  5JZE B;  1WJN A;  1TS3 A;  1EWY C;  2JU6 X;  3AE3 B;  1P98 A;  2EEL A;  4MT5 A;  3C19 A;  1T0R C;  2HDE A;  3C8Y A;  3AXC A;  2KFJ A;  3WAP A;  2KDE B;  2KC1 A;  4LNI A;  4TKN A;  5MPO A;  1L6V A;  2DAJ A;  4HKZ E;  2BB5 A;  3VAW A;  1JW9 D;  3V3X A;  2L3Z A;  1OTR B;  1HZ6 A;  1L2N A;  2DLB A;  2MHJ A;  1QOG A;  5BMI A;  2KVR A;  2NBV B;  1FMA D;  2K9X A;  3QC8 B;  4XGA B;  2ON8 A;  1UUP A;  2N9K A;  1RFA A;  1V80 A;  2FIF A;  4HXD A;  2CHW A;  3KQ4 A;  2CHX A;  4P16 A;  2FE8 A;  4TMA B;  1F2R I;  3W1Y A;  1SB3 C;  3RNC C;  3RZF A;  1I35 A;  2H88 B;  4C7Y A;  2N9P C;  3IFW B;  3PS6 A;  3GOE A;  1YX6 B;  2NVU I;  3AV8 A;  4S17 A;  2KMC A;  2IO0 B;  2RDB C;  1KLU D;  3PV1 A;  2DEN B;  1MPE A;  1Q5W B;  4FJZ A;  2BQQ A;  1WF9 A;  3GZN I;  1I42 A;  4WJO A;  3PPA A;  1WGD A;  1ZE3 D;  4CHK A;  5G5H A;  1TS5 A;  5E6N A;  4ZHP A;  1V8C A;  2H89 B;  1K51 A;  4HLE A;  2W3R A;  4A9A A;  4ZHO A;  5FK9 C;  3BK2 A;  3NG0 A;  2LAS A;  1CQV A;  3BWU D;  2FCM A;  3P4S B;  4N58 A;  3U7Z A;  1YQB A;  2JZZ A;  2IO2 B;  1T5X D;  1GNU A;  1L0Y B;  1Q0W B;  2GB1 A;  1RWS A;  1XLO A;  2WXM A;  3PZ8 A;  2OJR A;  1YD8 U;  2INP E;  2WNM A;  3RFZ B;  2JYE A;  1B9R A;  1IBX B;  2JRH A;  1KTK A;  3I5J C;  1K53 A;  5DPR A;  4WWP A;  1ET9 A;  3NUH B;  2M17 A;  1ZPS A;  4GIV A;  2K39 A;  4PK1 A;  1JWB D;  4YXD B;  2WXL A;  4MH0 E;  3HHM A;  2J7Q B;  3L54 A;  2KJH B;  3P1M A;  2JF5 A;  2MBQ A;  3R7Q A;  4KIK B;  2JVC A;  4NY0 A;  4EKU A;  4LNN A;  5CHF A;  4G11 A;  4HPL B;  2FCQ A;  1UH6 A;  2KDI A;  1GPX A;  5IOI A;  1UF0 A;  3SR6 A;  5GMV A;  2E3T A;  1OQY A;  3IT4 B;  2G9H D;  3Q8E A;  4I6P A;  4QAY A;  4DHZ E;  4PS7 A;  4L2Y A;  4KZC A;  3WAM A;  1E9M A;  2REX A;  2LMC A;  3PLV A;  4DXG A;  2ZJD A;  1CMX B;  4OZB A;  3RT3 B;  4XYC A;  2L0T A;  2L1A A;  5C1Z A;  4W9F A;  3ZGZ A;  2MEK A;  1I4P A;  2KT7 A;  3RPF C;  4KDI C;  2J53 A;  4WQO B;  2VZK B;  3UI3 A;  1IBX A;  2KDB A;  1XF5 L;  2OJW A;  3PRP B;  2PEA A;  3PRM B;  3HVD A;  3VR9 B;  1C9F A;  1SE4 A;  2D3B A;  5EE3 A;  1LFD A;  3AE5 B;  3BVG A;  4ARI A;  1PUT A;  4ZYN A;  3B0A A;  3Q14 C;  5J17 A;  1P7E A;  4KVG B;  1N63 A;  5C23 A;  3AE2 B;  3B2G A;  3PLU A;  2M0A A;  3NJT A;  1D6E C;  1F1H A;  4S0R A;  4ICU A;  1YN4 A;  4YTN B;  2AX5 A;  4WAA A;  1E7P B;  3MFG A;  4OVZ A;  2IY0 B;  3ZDT A;  4HDQ A;  1MFW A;  5D2M B;  1Y56 A;  3ZIM A;  4KGR A;  4MGK E;  1GC7 A;  3ZTC A;  4LJP B;  3W5U B;  1WXV A;  2M4N A;  3ZVV A;  4A6Q A;  3AEA B;  4YSZ B;  2KQ7 A;  2O6V B;  1TKE A;  2HD5 B;  4BAX A;  3A33 B;  1AN8 A;  1WI0 A;  1WSP A;  1EWC A;  2DZI A;  3JYU A;  5TR5 A;  1NDD A;  4J3O D;  2B76 B;  5JHA A;  2MBO A;  3KW5 B;  4NPN A;  3PHW B;  5I4D A;  3H1U A;  1NVI D;  1OQQ A;  2MH7 A;  2LGD A;  2KWD A;  1V2Y A;  3AEB B;  1FXT B;  3IBE A;  1UZX B;  4DXF A;  1FCC C;  4BZA A;  2KXJ A;  3TEW A;  2HJ1 A;  2KAC A;  3KUC B;  3AU4 A;  2C60 A;  4M8M A;  1CJE A;  4RGT A;  3BK1 A;  4DHJ B;  3RD2 A;  4XDD A;  4P7I A;  1YIW A;  2R61 A;  2Y3A A;  2GI9 A;  3V60 A;  2EKE C;  2O6V A;  1RM6 C;  1T0Q C;  2BYT A;  3ZDM C;  5J18 A;  2LD9 A;  4EEW A;  1SBB B;  2QHO A;  2DHZ A;  3JW0 X;  3NVW A;  1T3Q A;  4GDL B;  5T8I A;  1GB4 A;  4WJQ A;  2UWQ A;  2HTH A;  2JZP A;  4LK0 M;  1EF5 A;  3DVN U;  2JZ3 B;  3ZNI D;  4C80 A;  4JIO U;  2KVZ A;  3PRE A;  1A70 A;  2PE9 A;  3N32 A;  2KQ4 X;  1FRD A;  1N61 A;  5HI1 A;  4ZRJ A;  2KLG A;  4AJY B;  3TUO A;  5FR3 A;  4M00 A;  2V9H A;  3VVW B;  3AM9 A;  4B95 A;  2IO1 B;  3WIM A;  3QWZ B;  2L76 A;  3HM6 X;  5DCN A;  1F0Z A;  4W9H A;  2O6V D;  1M4V A;  2WX0 A;  4OHJ A;  3HVZ A;  3QA8 A;  2PKO A;  3BVM A;  2FID A;  3TCA A;  2IND C;  3DBL B;  3K9P B;  5LLI A;  1HZ5 A;  4LDT B;  4DK5 A;  4AS1 A;  3CSF A;  3BVZ A;  3ZUN A;  4A20 A;  2J0K A;  4UDU C;  2ICI A;  2JY6 A;  2MW5 A;  4GDL A;  3ZNH B;  2BF8 B;  2INC C;  4JPS A;  5IKC M;  3N30 A;  2KZR A;  4ANV A;  1VD2 A;  3ML8 A;  3A4S C;  3RNE C;  2J0M A;  3AUL A;  3A9J B;  3FKY A;  2BS3 B;  1P9D U;  4NQL B;  3EC8 A;  3VHT C;  2AEH A;  4DXA B;  4GLS C;  4ZDV A;  4II2 B;  3EEC A;  2IGG A;  2K5P A;  2KJR A;  2FCN A;  5D6J B;  4HCN B;  1V5O A;  4JQW C;  2KWV B;  3CIR B;  4HPM B;  4DHJ D;  4HJK A;  3K9O B;  2Q5W D;  2L83 A;  2V3S A;  4GMV A;  1JRO A;  3MC8 A;  3PSE B;  2D3A A;  3UQB A;  3Q3J A;  2LJ5 A;  3GE3 C;  2OHF A;  3VDZ A;  3T3N A;  4K7U A;  1Z5S B;  2RSU A;  4G0N B;  1WFY A;  1WXQ A;  3SU8 X;  2JUO A;  2IO3 B;  3NOB A;  1R4M B;  2XNA C;  2CKH B;  4AUQ C;  2V3P A;  3NY5 A;  3B2F A;  2D07 B;  2HJ8 A;  1LGR A;  1WYW B;  3Q3O C;  4J6I A;  4PS3 A;  3Q3M C;  1PGX A;  2NCN A;  1HTQ A;  3VRB B;  2NPT B;  3R2I A;  2PLP A;  5JHB A;  3A9J A;  2GBN A;  2KX3 A;  1PYW D;  4RM9 A;  3VTV A;  4HRS A;  3AE4 B;  4OW0 A;  4IM0 A;  3O13 A;  4ACF A;  3U7D A;  2N1W A;  1YN3 A;  3R2T A;  3MHS D;  5EDS A;  3QHT A;  4EOY A;  2AQ3 B;  1ZP0 B;  1JWU D;  1YNT E;  1TGZ B;  3GB1 A;  3RNF C;  4TQ1 A;  4EZJ A;  2KMA A;  1EUV B;  3RN9 C;  4H2A A;  3ABV B;  1IUE A;  5LNK 1;  1TKY A;  1T0Y A;  4E71 A;  2WWZ A;  2AL3 A;  3KVF B;  4LDT D;  2KMM A;  4GSW A;  2BYE A;  3PGE A;  2V3N A;  3HUI A;  1FIQ A;  2PPH A;  1PGA A;  4IOI E;  4REZ A;  1FCL A;  1RRB A;  3RI7 C;  1QF6 A;  2JXT A;  1GJZ A;  2FUH B;  4HK2 A;  1TIF A;  1PQS A;  3PHX B;  2LWP A;  2NPT A;  5AZH A;  2W55 A;  3ETR A;  4K3C A;  1WH3 A;  5FKA C;  2R2O A;  3APF A;  3N20 C;  3PO0 A;  4Q2J A;  1FXI A;  4BBN F;  4CQN A;  2ZPY A;  5EE9 A;  2ZVO A;  1IGD A;  1N5W A;  1VZ7 A;  3BIN A;  2MJE A;  4X57 B;  1L4D B;  5IO9 A;  3Q3F A;  5CHV C;  1WMH A;  4K81 A;  5C2T B;  3TEZ A;  2RPQ A;  1WX9 A;  3QK0 A;  1DOX A;  5AZF A;  2BWF A;  2KN5 A;  2I1K A;  3DCG A;  2DYM A;  1TZO A;  2BWE S;  3IVF A;  1UGJ A;  1I4X A;  5L95 C;  5D7G A;  1C4P A;  1XCQ L;  4II3 B;  5IP4 D;  4RF1 A;  2K25 A;  2D10 A;  4GB9 A;  1HEZ E;  1WWT A;  2KDF B;  2PVG C;  3VH3 B;  2QMT A;  2W82 A;  4A8X C;  1B1Z A;  4XX5 A;  3RCZ A;  4FJV B;  2GBR A;  1UBQ A;  3IAM 1;  3V62 A;  3VUX A;  4ZRI A;  3MC9 A;  2B3A A;  1E7U A;  1K52 A;  3P63 A;  3WAL A;  2VH1 A;  2ZPN A;  1NI3 A;  2R2Q A;  3R7R A;  3ECI A;  3AEG B;  4IC7 B;  2DWQ A;  2O2V B;  1GUA B;  4XDC A;  1WZ3 A;  4NJ7 A;  3AE7 B;  1TY2 A;  4LNO A;  2DYO A;  4DQO C;  1WM3 A;  1IGC A;  3MJ5 A;  4IG7 B;  2L00 B;  4JLC A;  5HKH A;  4I6N B;  4RGO S;  3ZKJ C;  1TT5 B;  5EE1 A;  4MJS B;  3ONS A;  4MSM B;  3EGR A;  3MP9 A;  5BYQ A;  4B0M A;  1OFF A;  2QIL A;  4FUL A;  1ZXI A;  4WWM A;  5HHD G;  4RCO A;  2LRU A;  1WXS A;  1LQB A;  1UNS A;  3BZD B;  3GE8 C;  1JQ4 A;  3VTW A;  2K8C A;  1FFV A;  1K8R B;  3L13 A;  2J0J A;  1WGH A;  2A4Z A;  2MSE D;  4GU2 A;  2IGH A;  1V9J A;  2FUG 1;  1J8C A;  4C4V A;  2MBE A;  1NEK B;  1WJU A;  4NNJ B;  1E10 A;  1D5Z C;  1VZ8 A;  3DHG C;  3U2S C;  3AB5 A;  3BYY B;  3P4Q B;  2LI5 A;  2LVP A;  3FIL B;  2WXQ A;  4MM3 B;  2O2V A;  1D3Z A;  3L16 A;  1FXA A;  1LXD A;  2HTM E;  1SGH A;  4HVB A;  4DDI D;  3DWM A;  4GXB A;  5H8Y E;  1JWS D;  4A3O A;  1Q10 A;  4YSY B;  1TZ1 A;  3FC4 A;  1SJH D;  3HIZ A;  3VTU A;  1YOV B;  2Y5C A;  3DVG Y;  4MJS A;  4YTP B;  2WU2 B;  3RNA C;  4KSL C;  3KUZ A;  4YT0 B;  3AU5 A;  3I57 A;  2C5L C;  4JWS C;  4R3D A;  1WXM A;  5CX3 A;  1FFU A;  2KDM A;  1V1P B;  3OWE B;  2L32 A;  4K3B A;  4M02 A;  3C0R B;  4ZRK A;  2SEB D;  5KHQ A;  2RD0 A;  5E6O A;  4A55 A;  1J0G A;  1UGM A;  2GBM A;  1TY0 A;  2A5U A;  1MJD A;  4ANX A;  1MVK A;  1TS2 A;  3TMP B;  2M1M A;  3PT2 B;  3FIL A;  2LGY A;  4GOC A;  2MLB A;  2K8H A;  4MM3 A;  1DGJ A;  3U8Z A;  2ACZ B;  2BGF A;  4I6L B;  4IWP A;  1X1M A;  2XBB C;  4M8N A;  1TBE A;  3DBL I;  3LYY A;  1C1Y B;  1EO6 A;  3EFU A;  4WQM A;  2GRI A;  4FHJ A;  5BMH A;  1F52 A;  2KAN A;  4G3X B;  1WE7 A;  2WS3 B;  2LUM A;  1N62 A;  5LXI B;  1XQQ A;  2MQJ A;  3HK0 A;  2IYD B;  1C77 A;  3X0W A;  1I4G A;  1E7V A;  2OED A;  1V1P A;  3E9S A;  1N6Z A;  1H4R A;  2KYW A;  2RDH A;  3N9Y C;  3PVL A;  2K6Q A;  3Q8C A;  3SD5 A;  3BII D;  4L1B A;  4HRO A;  2PVO D;  1XT9 B;  2XN9 C;  4MGZ E;  2JQR B;  3DQV A;  3LB8 C;  2UYZ B;  4BOS C;  2N0S B;  2KJ6 A;  1MG4 A;  3T3O A;  5IN7 A;  2IDY A;  1WZ0 A;  4CYE A;  3NVY A;  2RDG A;  1WJ6 A;  4TQ0 A;  3ZJT A;  2VH2 A;  1GC6 A;  3OG5 A;  1TTN A;  1SEB D;  3IG3 A;  1KOT A;  2LJI A;  4MEL A;  2K1F A;  1GOZ A;  2G4S A;  1F9J A;  1GAQ B;  1C3T A;  3AEC B;  1R4M I;  3APC A;  1GB1 A;  1MI0 A;  4AOF A;  2KD0 A;  3O65 B;  3V6E B;  5KHO A;  2K3U A;  4P6V F;  2LRW A;  3UIN B;  4BOZ B;  1FO4 A;  2PJH A;  1WGK A;  5BMG A;  4FA6 A;  2KN4 A;  3TEY A;  4GDK B;  4C56 C;  4WAF A;  4ANU A;  2W3S A;  3ZRC A;  4GGQ A;  4M0W A;  2INN E;  1Q1O A;  5C3J B;  4PYZ A;  2I2Y A;  4RH6 A;  5JXV A;  1E8X A;  3PZ7 A;  3W1S A;  4N6E B;  4MSQ B;  2K8B A;  2GMI C;  2W54 A;  1ISN A;  1HE8 A;  4TSS A;  4IUM B;  2ZZP B;  4WWO A;  4EZK A;  3L08 A;  2DAF A;  4EFO A;  2WXH A;  1C79 A;  1DOI A;  4IM2 A;  4P1B C;  1QKZ A;  3AE1 B;  3NS8 A;  3UIO B;  1G6J A;  1SIJ A;  3LXF A;  3L10 B;  1AAR A;  3ZXR A;  1E8Z A;  1ZW7 A;  2YEP F;  5AUI A;  4MAC A;  2K22 A;  4FBJ B;  1YMH E;  2N7J A;  3AEE B;  5E6J A;  3NVZ A;  1Z2M A;  1VCB A;  4GDK A;  3SFD B;  4JX1 C;  4FN2 A;  2WYQ A;  2CHZ A;  1KRH A;  1IPG A;  3KYC D;  3RUI B;  3AE9 B;  2KNB A;  3H7S A;  4YWG G;  2BT6 A;  3VQI A;  1V81 A;  3ZJU A;  2ZW0 A;  1QOB A;  2D11 A;  3FAH A;  1YX5 B;  3L4P A;  3H8H A;  4HJG E;  1NI2 A;  2QEJ C;  4WJP A;  4G50 A;  4W9K A;  4WWN A;  1J7A A;  4IDI A;  3DPD A;  2NS5 A;  3ZNZ B;  2WQY B;  3TL5 A;  2JYT A;  2Z0E B;  3AED B;  3GS2 A;  4LLG M;  1FNW A;  1UWX A;  1L7Y A;  3KH0 A;  1H8C A;  4BKS A;  5AEK B;  1C78 A;  2I38 A;  2MP2 A;  4A90 A;  5G55 A;  2KHW B;  2M8S A;  4KV2 A;  3ZNG C;  3KWV A;  3Q2A C;  4FXC A;  4JL9 A;  4YTM B;  1RLF A;  3AE8 B;  1TJE A;  1WM2 A;  4BBN C;  5G2N A;  2Z0D B;  3KYD D;  3EUB 2;  4WIP A;  1KF6 B;  4W9D A;  4MDK E;  3A9K B;  2BKF A;  3IAS 1;  3SFE B;  3A4R A;  3MC0 B;  2ZNV B;  1WYG A;  3KLS X;  5AUK A;  1HTO A;  1EM7 A;  1YN5 A;  2L8J A;  1R4N B;  3ZTD A;  2L7R A;  4L23 A;  3M63 B;  2YLM A;  3UQA A;  1M94 A;  3SHQ A;  3APD A;  1WX8 A;  3L17 A;  4RGN A;  4BKS D;  4ZRQ A;  1L6U A;  1TKG A;  1BML C;  3B08 A;  1JAL A;  1U4A A;  4LNK A;  1SXT A;  3IT6 B;  5DPT A;  1QOA A;  4NAW B;  1FNV A;  2LGI A;  1XD3 B;  1YQ3 B;  2Z59 B;  2N7D A;  3QCA A;  5EE0 A;  3WCQ A;  3WAN A;  1ENF A;  1WMH B;  3QIJ A;  3ZXV A;  3EFC A;  3OLM D;  4DDG D;  4RNA A;  1S3S G;  3B1L X;  5LXH A;  2GBJ A;  4E3C A;  4RGM A;  1WRI A;  2FNJ B;  3A9K A;  3SDL C;  2ONQ A;  1P7F A;  2JSV X;  4KKJ A;  1K50 A;  5BO4 B;  3RUL A;  3ZYY X;  2JWU A;  4RMA A;  4W9G A;  1MG8 A;  1YJI A;  4DHZ B;  2L05 A;  1P1A A;  3DHI C;  3H7P B;  3AN1 A;  1HQR D;  2YEP B;  2N9L A;  1Y8R C;  1EF1 A;  2X8X X;  5FR6 A;  2TSS A;  2LHE A;  4W9I A;  2RGF A;  2WXK A;  3I3T B;  2J4X A;  1NBF C;  1S1Q B;  1V1O A;  4D2K A;  5TSS A;  1E6E B;  1P3Q U;  2LEK A;  1VR9 A;  4IM3 A;  5CHW A;  3TSS A;  1RAX A;  4NJ6 A;  1WGY A;  1WX7 A;  4NAW A;  4KGS A;  1FD6 A;  2YVC A;  3ZJV A;  3L0W B;  2BS4 B;  2DX5 B;  1I4H A;  2WX1 A;  2D3C A;  2MA9 B;  1C4C A;  3RYT A;  2FCS A;  2LVO A;  4MEM A;  2PIA A;  2NBW B;  2GBK A;  3AEF B;  1EU4 A;  2E6X A;  4CO7 A;  2WDQ B;  2WXR A;  1XEE A;  4E74 A;  4US8 A;  3VFK A;  4JE3 B;  4XZ4 A;  3NS1 A;  1BXT A;  3Q8F A;  4A3P A;  5H92 C;  2LXC A;  2LVQ A;  4EE2 A;  3WAO A;  2BB6 A;  4GN1 A;  4KGT A;  2WXP A;  4F8C B;  3J9C A;  5D3I B;  1KLG D;  1GG3 A;  3JSV B;  2GLS A;  3TIX A;  3B9J A;  2BBC A;  3DDC B;  3H7P A;  4C4V B;  2NTT A;  2JRI B;  3T8M A;  3M3J A;  1LM8 B;  2JWZ A;  3IXS A;  1DOY A;  2X38 A;  3D32 A;  2JXX A;  3H9D A;  3U52 E;  1N5X A;  1NYQ A;  2MJ3 A;  2MCN B;  3I63 C;  1WGG A;  1UEL A;  4NAM A;  1JRU A;  2V4L A;  2NTS A;  3Q6B A;  2LUE A;  3QJZ A;  3NHE B;  3W9C B;  3U4E G;  3ZQ4 A;  3ZO5 B;  2ZEQ A;  3VRA B;  2C7N B;  2QIE B;  2RMM A;  3HRD D;  2CJO A;  4NQK E;  4WJN A;  2SAK A;  1PGB A;  1JWA D;  2N9X A;  3V05 A;  2WXO A;  2IJ0 A;  1WXA A;  3ZW3 A;  2BVC A;  1XLQ A;  2WDR B;  4DBG A;  3DWG C;  2WLB A;  1QQR A;  4XE0 A;  3W2D A;  1ET6 A;  1ZOY B;  4FJY A;  2JX5 A;  2N9E B;  2LGS A;  1HXY D;  2DNF A;  3UIP B;  3BYT B;  5GXG B;  2ZW1 A;  3MHZ A;  2BKR B;  2L52 A;  3JSV A;  3JVZ X;  2DBY A;  3M62 B;  1XXG A;  2N1V A;  4KKI A;  1FRR A;  2KTF A;  3QQ8 B;  3EHV A;  3VXW A;  1TYG B;  1C4A A;  5IA7 A;  3AI5 A;  1L0X B;  4EUT A;  3MTN B;  1SE2 A;  2QC8 A;  2J52 A;  3WA0 A;  1OQR A;  4KX6 B;  1BT0 A;  1VZ6 A;  3ZLZ A;  1JCK B;  2KTR B;  4EZL A;  4C00 A;  2OOB B;  3DBH B;  3DBR B;  3NRZ A;  3N3K B;  3T9L A;  4PYU A;  1OGW A;  4M01 A;  2CU3 A;  3LDZ E;  2JPH A;  1JWM D;  2MRP A;  1MHH E;  1L5P A;  2BYV E;  2IGD A;  3ZRF A;  1LO5 D;  1I4R A;  1ESF A;  2CS4 A;  2HE7 A;  3VUW A;  2MJD A;  4B0E A;  2KK8 A;  2MX2 A;  2Z8L A;  2ZNV C;  3DBS A;  1QOF A;  3P4P B;  2K0P A;  3PTF C;  2J42 A;  2NR2 A;  2KFK B;  3KWL A;  3E56 A;  3URY A;  1WRD B;  4AQ7 A;  3CMM B;  1T0S C;  4PT5 A;  5HFY A;  1WR6 E;  1IYF A;  2AQ2 B;  3UF8 A;  4WH4 A;  2KX0 A;  3EA6 A;  3Q8B A;  1ROE A;  2KTR A;  1SSN A;  1WJ4 A;  3I9V 1;  1AYF A;  4W9E A;  5D94 A;  2KC2 A;  2PE6 B;  2V4I B;  1YJ1 A;  5IAA C;  3SEB A;  4OVV A;  1V6E A;  4ITK A;  1T6B X;  1QLB B;  4OVU A;  2DZM A;  4XWT A;  1L4Z B;  2MBB B;  2WXI A;  4KIK A;  3N1Z C;  1N60 A;  3AH7 A;  1C76 A;  1PFD A;  2V0G A;  1V5T A;  3NZU A;  3X23 A;  4B6W A;  3P42 A;  3V61 A;  1D5M C;  1E0Z A;  3AMZ A;  4M0W B;  2KFK A;  1I4Q A;  4HPP A;  1E8Y A;  1ZKH A;  4BKT A;  2N7E A;  4WUR A;  5HG2 A;  1E5W A;  1KJT A;  1FM0 D;  2K6D B;  3ML9 A;  3R3M A;  4ANW A;  5CTR C;  3GZN B;  1SE9 A;  4RFB A;  1QIL A;  1XLN A;  2CR5 A;  2WDV B;  1R7S A;  1DYQ A;  1HA5 A;  4IWQ A;  3MJW A;  2ASQ A;  2KLC A;  2G3Q B;  1OEY A;  2DZJ A;  4IKG A;  2L0F A;  2NBU A;  1SF0 A;  3R8B A;  2CU1 A;  1ACC A;  1D4B A;  4URK A;  3CST A;  2BYF A;  2IZV B;  2M0X A;  2M19 A;  2EMT A;  2G1E A;  1R4N I;  4PS8 A;  4RF0 A;  4NJC A;  1MHX A;  4HEA 1;  3GP7 A;  1QZE A;  3W5V B;  2KWC A;  2ZCB A;  5L83 A;  4DWF A;  1VDV A;  2LXA A;  2N4F A;  4JGH B;  4FHK A;  4O1N A;  3TBL D;  1V97 A;  5BYS A;  4KZ0 A;  1OEY J;  5DPS A;  3P2B A;  2FAZ A;  1KFY B;  4RM8 A;  3NZS A;  2LZ6 A;  4HDO A;  2VZK D;  3VR8 B;  4HCP B;  1WR1 A;  4HWI B;  1ZDX A;  1NYR A;  4OZC A;  2WGS A;  5DPW A;  3M95 A;  2WXG A;  5D3D A;  2KO3 A;  1YJJ A;  1ZUD 2;  4LJO B;  4LNF A;  1YQ4 B;  4K1R B;  3CWI A;  3QAQ A;  3UGB B;  4HKQ A;  2MP2 B;  1E90 A;  1FEH A;  2KKC A;  1FNU A;  3VUY A;  3DVG X;  1L0V B;  1VRA B;  1VJK A;  5JH5 C;  1RYJ A;  4B9K A;  1PDX A;  2JT4 B;  4ASW C;  4LCD E;  2VRR B;  3OJ4 B;  1RFK A;  2WXF A;  4K7W A;  2DZK A;  3Q69 A;  1JRP A;  3QAR A;  2UU7 A;  4JWU C;  2WXN A;  2XK5 B;  3A1Q B;  5J2R A;  2G4D B;  1ZXH A;  1SIF A;  2BW2 A;  3RMK C;  3P4R B;  1XCT L;  2M56 B;  2ZCC A;  4ZYS A;  2CJN A;  3IHP C;  1J19 A;  1V49 A;  4AWJ A;  3N1Y C;  2WU5 B;  3CF6 E;  3Q8A A;  3BY4 B;  1KLV A;  4TV3 A;  5G5G A;  1ZGU B;  1CZP A;  2ZVN A;  2BTE A;  2I1J A;  4FLH A;  2RPV A;  4NZL B;  4KDL B;  3OAW A;  2AL6 A;  3HM3 A;  3DVN V;  2MBH A;  1IP9 A;  1A5R A;  1XLP A;  2LFI A;  4AJW A;  4ARC A;  2C7M B;  2QSD A;  1BUI C;  2KQS A;  3VH4 B;  3ENE A;  3N1X C;  3RNG C;  3R66 C;  5E6P A;  2WXJ A;  1KH0 A;  3KUD B;  4ZRP A;  1J7B A;  1ZDV A;  2QJL A;  1V86 A;  1AWD A;  1P0R A;  2EKI A;  2PTL A;  3TEX A;  2EMS A;  1SE3 A;  2BS2 B;  2WP9 B;  2LHD A;  1I7H A;  2XK5 A;  2GOW A;  1WIA A;  1SJE D;  3A1Q A;  3PZD A;  4W9L A;  2IPK D;  4W9C A;  4TUU A;  1EU3 A;  3DHH C;  4YSX B;  4F7Z A;  3U30 A;  2BPS A;  4N59 A;  1UD7 A;  3DOW A;  2PMV A;  1AW7 A;  2V1Y A;  4N9F 4;  2MWS B;  3S2A A;  1WY8 A;  2IY1 B;  3TJP A;  3Q3N C;  1NEN B;  1XO3 A;  2C7H A;  1FPY A;  3PRZ A;  1KM7 A;  4IW0 A;  1STE A;  1F77 A;  2KWU B;  1TS4 A;  4US9 A;  2XEW A;  2WDT B;  3RZW C; 
#chains in the Genus database with same CATH homology
 3DBL I;  2N9X A;  1C1Y B;  3PRE A;  2PE9 A;  3N32 A;  1EO6 A;  2C9W B;  3EFU A;  3QX1 A;  4FHJ A;  4BFR A;  1WXA A;  4MGY E;  3ZW3 A;  2DYB A;  4ZRJ A;  4W9J A;  1WE6 A;  2KAN A;  3DBH I;  3DBR I;  1WE7 A;  1E8W A;  2KLG A;  4G3X B;  4AJY B;  4DBG A;  4BVU C;  5LXI B;  1XQQ A;  1WGR A;  2MQJ A;  3HK0 A;  4FJY A;  2AYO B;  2IYD B;  2RR9 A;  3VVW B;  2LGX A;  2N9E B;  4B95 A;  3X0W A;  2D2Q A;  3UIP B;  1E7V A;  3W1S C;  2IO1 B;  3WIM A;  3QWZ B;  4KSK C;  2L76 A;  3HM6 X;  5DCN A;  4W9H A;  3H6N A;  2KOX A;  2BKR B;  2O6V D;  2WX0 A;  3OJ3 A;  3JSV A;  1H4R A;  3JVZ X;  3M62 B;  3QA8 A;  3PVL A;  2K6Q A;  3ALB A;  2N1V A;  3SD5 A;  1XT9 B;  4MGZ E;  4YL8 A;  2KTF A;  4IWO A;  3DQV A;  3QQ8 B;  2UYZ B;  3EHV A;  4MGI E;  3VXW A;  4BOS C;  4ICV A;  5AZG A;  5IA7 A;  2Y5B B;  3AI5 A;  2FID A;  4AP4 C;  4BKG A;  2KJ6 A;  4EUT A;  3MTN B;  3TCA A;  3K9P B;  5LLI A;  3V6C B;  3WA0 A;  1WZ0 A;  4LDT B;  1BT0 A;  4CYE A;  2D3G A;  3ZLZ A;  4DK5 A;  3CSF A;  1WJ6 A;  2KTR B;  4TQ0 A;  3ZUN A;  4F1S A;  4EZL A;  2G45 B;  4FAD A;  4A20 A;  1GC6 A;  2OOB B;  2J0K A;  2JY6 A;  1TTN A;  2MW5 A;  4GDL A;  3IG3 A;  3N3K B;  2BF8 B;  2IBI B;  3T9L A;  4PYU A;  4K7S A;  3ZNH B;  1OGW A;  2W9N A;  3N30 A;  2KZR A;  4MEL A;  4ANV A;  1VD2 A;  2K1F A;  3LJ3 A;  2G4S A;  3ML8 A;  1F9J A;  3A4S C;  2J0M A;  3AUL A;  3A9J B;  3LDZ E;  1P9D U;  1C3T A;  4NQL B;  3EC8 A;  4XC2 A;  1R4M I;  2JPH A;  2AEH A;  3APC A;  3VHT C;  2AWT A;  4DXA B;  1UBI A;  2MRP A;  4AOF A;  4ZDV A;  4II2 B;  2KD0 A;  5JZE B;  1WJN A;  2BYV E;  3EEC A;  3O65 B;  3V6E B;  3ZRF A;  2KJR A;  2FCN A;  5D6J B;  4HCN B;  5KHO A;  1P98 A;  1V5O A;  2LRW A;  4JQW C;  2KWV B;  3UIN B;  3AXC A;  2CS4 A;  4HPM B;  2KFJ A;  4DHJ D;  2HE7 A;  4HJK A;  3VUW A;  4BOZ B;  3WAP A;  2KK8 A;  2MX2 A;  2PJH A;  2KDE B;  3K9O B;  2ZNV C;  4FA6 A;  2V3S A;  2KC1 A;  3DBS A;  4GMV A;  4TKN A;  3PSE B;  3UQB A;  3Q3J A;  2LJ5 A;  3VDZ A;  2DAJ A;  4GDK B;  4K7U A;  1Z5S B;  3VAW A;  3PTF C;  2L3Z A;  1OTR B;  2NR2 A;  2RSU A;  4G0N B;  4ANU A;  1L2N A;  2KFK B;  3ZRC A;  1WFY A;  4GGQ A;  3SU8 X;  2JUO A;  1Q1O A;  4PYZ A;  1WRD B;  2IO3 B;  3NOB A;  1E8X A;  3CMM B;  2CKH B;  3W1S A;  4AUQ C;  2KVR A;  2NBV B;  4MSQ B;  2K8B A;  3NY5 A;  2GMI C;  1WR6 E;  1IYF A;  1ISN A;  2D07 B;  3QC8 B;  1HE8 A;  3UF8 A;  2HJ8 A;  2KX0 A;  4IUM B;  2ZZP B;  1WYW B;  4WWO A;  4EZK A;  1RFA A;  1V80 A;  2FIF A;  2DAF A;  2KTR A;  3L08 A;  4HXD A;  4J6I A;  1WJ4 A;  4EFO A;  4PS3 A;  2CHW A;  2CHX A;  4W9E A;  5D94 A;  2KC2 A;  2PE6 B;  4IM2 A;  3W1Y A;  2NCN A;  3RZF A;  1I35 A;  2NPT B;  3NS8 A;  1YJ1 A;  3UIO B;  5IAA C;  5JHB A;  1G6J A;  3A9J A;  2N9P C;  3IFW B;  3PS6 A;  3GOE A;  2GBN A;  1YX6 B;  4OVV A;  2KX3 A;  2NVU I;  1V6E A;  3L10 B;  4RM9 A;  2KMC A;  3VTV A;  2IO0 B;  1AAR A;  4IM0 A;  3PV1 A;  2DEN B;  1Q5W B;  4FJZ A;  4OVU A;  1E8Z A;  1ZW7 A;  2DZM A;  3U7D A;  2N1W A;  1WF9 A;  3GZN I;  2MBB B;  3MHS D;  4KIK A;  5EDS A;  1I42 A;  4WJO A;  3QHT A;  3PPA A;  4EOY A;  4FBJ B;  1WGD A;  4CHK A;  5E6N A;  1V5T A;  3NZU A;  3X23 A;  1Z2M A;  4HLE A;  1VCB A;  4B6W A;  4GDK A;  1TGZ B;  4EZJ A;  4TQ1 A;  4FN2 A;  2KMA A;  3V61 A;  2WYQ A;  1EUV B;  2CHZ A;  2LAS A;  1IPG A;  4M0W B;  3KYC D;  2FCM A;  2KFK A;  3RUI B;  1YQB A;  2JZZ A;  2IO2 B;  2KNB A;  3H7S A;  1GNU A;  1E8Y A;  1Q0W B;  1ZKH A;  4BKT A;  2N7E A;  2OJR A;  1T0Y A;  4E71 A;  2WWZ A;  3VQI A;  1V81 A;  2AL3 A;  2D11 A;  3KVF B;  4LDT D;  1YD8 U;  1YX5 B;  4GSW A;  2BYE A;  3PGE A;  1NI2 A;  4WJP A;  4G50 A;  1E5W A;  1KJT A;  4W9K A;  2PPH A;  4WWN A;  2K6D B;  3ML9 A;  2JRH A;  1RRB A;  3R3M A;  4ANW A;  5CTR C;  3DPD A;  1SE9 A;  2NS5 A;  1GJZ A;  2FUH B;  4HK2 A;  2CR5 A;  3ZNZ B;  5DPR A;  4IWQ A;  4WWP A;  3TL5 A;  3MJW A;  2ASQ A;  2M17 A;  2KLC A;  2Z0E B;  1PQS A;  2G3Q B;  2K39 A;  1OEY A;  3PHX B;  2LWP A;  2NPT A;  4GIV A;  2DZJ A;  2L0F A;  5AZH A;  2NBU A;  1WH3 A;  2R2O A;  3APF A;  4MH0 E;  1L7Y A;  3HHM A;  3KH0 A;  2CU1 A;  1H8C A;  4BKS A;  5AEK B;  2J7Q B;  4BBN F;  4URK A;  3CST A;  2MP2 A;  2BYF A;  3L54 A;  2IZV B;  2M0X A;  2KHW B;  5G55 A;  2ZPY A;  2M8S A;  2EMT A;  2KJH B;  2ZVO A;  2JF5 A;  4KV2 A;  2MBQ A;  1R4N I;  3R7Q A;  4PS8 A;  3ZNG C;  4KIK B;  2JVC A;  4NY0 A;  4EKU A;  5CHF A;  4G11 A;  4HPL B;  2FCQ A;  1UH6 A;  3BIN A;  4JL9 A;  2KDI A;  1QZE A;  4X57 B;  5GMV A;  1OQY A;  1RLF A;  2KWC A;  3Q3F A;  2ZCB A;  5CHV C;  5L83 A;  4I6P A;  4DHZ E;  1WM2 A;  4PS7 A;  4DWF A;  1WMH A;  4K81 A;  4KZC A;  3WAM A;  2LXA A;  2N4F A;  4JGH B;  4FHK A;  2REX A;  1WX9 A;  2RPQ A;  3QK0 A;  5G2N A;  3TBL D;  4BBN C;  2Z0D B;  5AZF A;  2BWF A;  3PLV A;  2KN5 A;  3KYD D;  4KZ0 A;  2I1K A;  2ZJD A;  3DCG A;  1CMX B;  1OEY J;  4MDK E;  2DYM A;  4W9D A;  3A9K B;  2BKF A;  5DPS A;  3P2B A;  3RT3 B;  2BWE S;  3A4R A;  3IVF A;  2L0T A;  2FAZ A;  5C1Z A;  2ZNV B;  4W9F A;  4RM8 A;  3NZS A;  5L95 C;  2LZ6 A;  5D7G A;  4HDO A;  4II3 B;  2K25 A;  4KDI C;  4WQO B;  2D10 A;  4GB9 A;  2L8J A;  2KDF B;  3VH3 B;  4HCP B;  1WR1 A;  2KDB A;  4HWI B;  3ZTD A;  2L7R A;  3PRP B;  2PEA A;  3PRM B;  4XX5 A;  3RCZ A;  4FJV B;  3M63 B;  2YLM A;  5DPW A;  3M95 A;  3UQA A;  2GBR A;  1UBQ A;  1M94 A;  2KO3 A;  3SHQ A;  3V62 A;  3VUX A;  3APD A;  1WX8 A;  4ZRI A;  4LJO B;  2B3A A;  3L17 A;  1E7U A;  4K1R B;  3WAL A;  4BKS D;  1LFD A;  3QAQ A;  2ZPN A;  2R2Q A;  4ZYN A;  3R7R A;  3B0A A;  3ECI A;  3B08 A;  5J17 A;  3UGB B;  4KVG B;  2MP2 B;  1U4A A;  4IC7 B;  1E90 A;  5C23 A;  2O2V B;  2KKC A;  5DPT A;  1GUA B;  4NAW B;  1WZ3 A;  4NJ7 A;  3PLU A;  3VUY A;  3DVG X;  1XD3 B;  2DYO A;  1WM3 A;  5JH5 C;  4ICU A;  4IG7 B;  2Z59 B;  2N7D A;  3QCA A;  4B9K A;  2JT4 B;  3WAN A;  2L00 B;  4JLC A;  4LCD E;  4I6N B;  1WMH B;  4WAA A;  4ASW C;  5HKH A;  3QIJ A;  2VRR B;  3ZKJ C;  3OJ4 B;  2IY0 B;  3ZDT A;  3OLM D;  4HDQ A;  4DDG D;  4MJS B;  1S3S G;  3B1L X;  3ONS A;  4MSM B;  5D2M B;  3ZIM A;  4K7W A;  2DZK A;  4MGK E;  5LXH A;  2GBJ A;  1GC7 A;  4FUL A;  4E3C A;  2FNJ B;  3A9K A;  3SDL C;  3ZTC A;  1KOT A;  3QAR A;  2LRU A;  4LJP B;  1WXS A;  2XK5 B;  1WXV A;  1LQB A;  3RUL A;  2M4N A;  3A1Q B;  5BO4 B;  3VTW A;  5J2R A;  3ZVV A;  4RMA A;  2K8C A;  2G4D B;  4W9G A;  1K8R B;  3L13 A;  1MG8 A;  1SIF A;  2J0J A;  4DHZ B;  2L05 A;  1WGH A;  2KQ7 A;  2ZCC A;  1P1A A;  2A4Z A;  3IHP C;  1J19 A;  2MSE D;  1V49 A;  2O6V B;  4AWJ A;  4GU2 A;  2HD5 B;  3H7P B;  3A33 B;  3CF6 E;  1WI0 A;  1V9J A;  3BY4 B;  1KLV A;  1J8C A;  2MBE A;  5FR6 A;  1Y8R C;  1EF1 A;  2DZI A;  4TV3 A;  1ZGU B;  2ZVN A;  3JYU A;  4W9I A;  1WJU A;  4NNJ B;  2RGF A;  3I3T B;  5TR5 A;  1NDD A;  2I1J A;  1NBF C;  1S1Q B;  4FLH A;  5JHA A;  2LI5 A;  2LVP A;  4KDL B;  3OAW A;  2MBO A;  1P3Q U;  2AL6 A;  3KW5 B;  3HM3 A;  3DVN V;  2MBH A;  4IM3 A;  4NPN A;  5CHW A;  1IP9 A;  3PHW B;  1A5R A;  1RAX A;  2O2V A;  4NJ6 A;  4AJW A;  1D3Z A;  3L16 A;  1WGY A;  1WX7 A;  3H1U A;  4NAW A;  2YVC A;  2C7M B;  3L0W B;  1LXD A;  2DX5 B;  2KQS A;  2WX1 A;  3ENE A;  3VH4 B;  2LGD A;  2MA9 B;  1SGH A;  1V2Y A;  3RYT A;  4DDI D;  2FCS A;  4GXB A;  4HVB A;  3R66 C;  2LVO A;  5E6P A;  1FXT B;  4A3O A;  3IBE A;  4MEM A;  1UZX B;  2NBW B;  2GBK A;  1TZ1 A;  3HIZ A;  3KUD B;  4CO7 A;  3VTU A;  4E74 A;  3DVG Y;  2KXJ A;  4MJS A;  3VFK A;  4XZ4 A;  3KUC B;  1V86 A;  4KSL C;  3KUZ A;  1P0R A;  3AU4 A;  2C60 A;  3AU5 A;  2EMS A;  2C5L C;  4M8M A;  4A3P A;  4DHJ B;  3RD2 A;  1WXM A;  2XK5 A;  5CX3 A;  2GOW A;  1WIA A;  2LXC A;  4P7I A;  2LVQ A;  3A1Q A;  3PZD A;  1YIW A;  4W9L A;  3WAO A;  4GN1 A;  4TUU A;  4W9C A;  4F8C B;  3JSV B;  1GG3 A;  3C0R B;  4ZRK A;  4F7Z A;  3V60 A;  2EKE C;  3TIX A;  2O6V A;  3U30 A;  3DDC B;  3H7P A;  3ZDM C;  5KHQ A;  5J18 A;  2RD0 A;  2BPS A;  2JRI B;  3T8M A;  1UD7 A;  5E6O A;  3M3J A;  3DOW A;  1LM8 B;  1UGM A;  2LD9 A;  2GBM A;  4EEW A;  1J0G A;  2JWZ A;  2A5U A;  4ANX A;  2V1Y A;  3D32 A;  2JXX A;  4N9F 4;  3H9D A;  2MWS B;  3S2A A;  1WY8 A;  2IY1 B;  3TMP B;  2MCN B;  3TJP A;  1WGG A;  1UEL A;  2M1M A;  3PT2 B;  2QHO A;  2DHZ A;  1JRU A;  2LGY A;  3JW0 X;  4GOC A;  2V4L A;  2MLB A;  2LUE A;  4GDL B;  2K8H A;  4MM3 A;  4WJQ A;  2UWQ A;  2HTH A;  3QJZ A;  2C7H A;  3U8Z A;  3NHE B;  1EF5 A;  3PRZ A;  2BGF A;  1KM7 A;  3ZO5 B;  2ZEQ A;  4IW0 A;  3DVN U;  2C7N B;  4I6L B;  2JZ3 B;  4IWP A;  3ZNI D;  2KWU B;  4JIO U;  1X1M A;  2XBB C;  2XEW A;  4M8N A;  2WDT B;  1TBE A;  4NQK E;  4WJN A;  3RZW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...