1WH3A

Solution structure of c-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 oasl)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
b'GSSGSSGIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLILSKKKGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 59 kDa 2'-5'-oligoadenylate synthetase like protein
publication title Solution structure of C-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 OASL)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wh3A01
3L54A 3IBEA 4IW0A 3UGBB 5JHAA 4JIOU 2FCMA 3L13A 2W9NA 3DPDA 4IWPA 4F7ZA 3T9LA 1V86A 1BT0A 2MP2B 3TL5A 2ZZPB 1RFAA 3KYDD 1C1YB 5AZHA 4MEMA 4WWOA 4TQ0A 4JLCA 2MA9B 1JRUA 2GMIC 1WRDB 2IBIB 4NY0A 1E8WA 3OJ4B 3QX1A 1G6JA 4TKNA 2KDEB 3QQ8B 1KOTA 4MDKE 4JGHB 1I35A 3JSVA 3UQAA 1WGRA 1OEYJ 4GGQA 2CHXA 1TZ1A 3DVNU 2KWCA 3WAPA 3PRMB 1P98A 4E74A 3R3MA 5HKHA 3A9KA 3GOEA 1L7YA 4G3XB 4NAWA 5AEKB 1IYFA 2KFKB 2LASA 1T0YA 3DBLI 1Q1OA 2BYEA 4M8MA 3C0RB 3APDA 5E6PA 2CR5A 1P3QU 1V49A 3EC8A 1SE9A 3QARA 1IP9A 3RYTA 1WR6E 2K6QA 4FHJA 2PE9A 4K7WA 2RSUA 2C7HA 1UD7A 2C7NB 2JT4B 1Q0WB 1WIAA 4DDGD 4HWIB 3B1LX 1Z2MA 2N9EB 3VAWA 2O2VA 1TBEA 2LI5A 4ZRIA 4EEWA 4KDLB 2AL6A 3W1YA 4AUQC 1XT9B 3RT3B 4XZ4A 2N9XA 3JSVB 1Q5WB 1WI0A 2EMTA 3NS8A 3VUWA 2G45B 4PYUA 1WH3A 1E8ZA 3IFWB 1V6EA 4KSKC 3K9PB 2KD0A 3AI5A 3QA8A 4KVGB 3A9KB 3V61A 3MHSD 5JHBA 4GDLA 3KUDB 1GNUA 2JF5A 3DVGX 1VCBA 4NAWB 1H4RA 2KDBA 3R7RA 3Q3JA 4MSMB 2V1YA 3DBRI 2MBBB 2REXA 4RM9A 1D3ZA 1V9JA 4M0WB 1OTRB 3V60A 2L7RA 4FLHA 2GOWA 1M94A 3UIOB 1VD2A 3VDZA 4K7UA 3U7DA 2LGYA 2LJ5A 3DVNV 4PS7A 2HE7A 4HDOA 4CO7A 1WR1A 5DPTA 4FA6A 3UQBA 2DZKA 1E90A 4N9F4 4BKTA 2KVRA 2O6VA 1NI2A 2Y5BB 4ICVA 2M1MA 3PRPB 4NPNA 2IY1B 4OVUA 2IO0B 4HPLB 2IO1B 1WZ0A 4FULA 4E71A 3ZTDA 5CTRC 2FUHB 3ZNHB 1XD3B 1WE6A 1WXMA 3L16A 3QIJA 3B0AA 4WJOA 5AZGA 3X0WA 4ZDVA 5J2RA 4BFRA 2Z59B 3CSTA 2AYOB 2DHZA 3SD5A 2BPSA 2CHWA 4GDKB 1Z5SB 1AARA 2FAZA 5AZFA 3PGEA 3KUZA 4PS8A 3T8MA 5IAAC 1WXVA 5D6JB 5D2MB 3PHXB 4LCDE 2RD0A 2L05A 2KMAA 5D94A 1P1AA 3RULA 4AP4C 2KC2A 3KUCB 4DWFA 1H8CA 5CHVC 4LJPB 2CU1A 2D2QA 3QK0A 4NJ6A 2NBUA 2UYZB 3M62B 3PSEB 1UZXB 2RGFA 2JWZA 2WWZA 4W9CA 3O65B 3QHTA 2L3ZA 2BYVE 3DBHI 5DPSA 2MCNB 4BBNF 3A1QB 2IO3B 2DZJA 4MGKE 4ANXA 2ZCCA 2JUOA 3DBSA 3QWZB 3WAMA 4W9KA 2DYMA 1K8RB 3WANA 1UH6A 5D7GA 1GJZA 4GB9A 4FJZA 1V5TA 1E8YA 4EZJA 1V5OA 4TUUA 3H6NA 3VVWB 4AJYB 4NJ7A 4A20A 2K6DB 2DENB 1NBFC 3PVLA 1WX8A 4WWPA 5DPWA 1OGWA 2FCSA 1YX5B 3NY5A 4KIKA 2G4DB 1J19A 2WDTB 3ZVVA 4W9EA 2XEWA 3HM3A 3PTFC 2FIFA 1UBQA 2N1VA 4LDTD 1OQYA 3N32A 1E7UA 4FBJB 4FN2A 4XC2A 5LXHA 4P7IA 4TV3A 4WJPA 4BOSC 4ZRJA 3ZKJC 1EO6A 2KWVB 4W9HA 4A3PA 2K8CA 5LXIB 2JZ3B 3W1SA 2ZVNA 5LLIA 2KLCA 2YVCA 4XX5A 2V4LA 4EZKA 1WZ3A 1UELA 4W9GA 2L8JA 3A9JA 1Y8RC 5FR6A 1WX7A 2KK8A 3KW5B 4K81A 4DHJD 2JY6A 1UGMA 2PJHA 4IM2A 1WJUA 4DHZB 3L10B 4LJOB 1RRBA 4EUTA 2OOBB 1WF9A 3TJPA 4DDID 3EECA 2D11A 1ISNA 2R2OA 3M95A 1WY8A 3CF6E 2C9WB 2CHZA 3CSFA 1X1MA 3DOWA 4JL9A 1EUVB 2LVQA 4KIKB 4B95A 2ZNVB 3APCA 4GMVA 1V81A 2G3QB 4OVVA 2GBKA 2GBJA 1WFYA 2ZJDA 3EHVA 4HPMB 2HTHA 1LXDA 2K1FA 4IM3A 4WWNA 3WALA 4HVBA 1E8XA 1ZGUB 3TMPB 2M8SA 3ZLZA 2L76A 5TR5A 1UBIA 2C7MB 4PS3A 4EZLA 2KQSA 1U4AA 2GBNA 2K39A 3DDCB 4HCPB 3HHMA 3WIMA 3ZRCA 3ZUNA 3A9JB 3M3JA 4GDKA 4WAAA 2D3GA 1S3SG 4BKSA 4HLEA 2AEHA 3QCAA 3ZNGC 2DAFA 5CX3A 4DHZE 3L08A 3PT2B 3SDLC 4HK2A 2I1KA 2HD5B 1LFDA 1TTNA 3H7PA 4AJWA 1SIFA 1TGZB 2C60A 2YLMA 4W9LA 3V6CB 1WGHA 3ENEA 2MBEA 3ZTCA 1E5WA 2GBRA 2DZMA 3UF8A 1WM2A 3JYUA 2KJHB 5CHFA 2NBVB 3PPAA 4F8CB 3A1QA 4BBNC 2LD9A 1FXTB 3AU4A 3DCGA 4CYEA 2KFJA 2PPHA 2IO2B 4DXAB 1GUAB 4MGYE 2LXCA 4MJSB 2KLGA 2QHOA 4FJVB 2EMSA 3RZFA 3H1UA 4G0NB 3H9DA 2B3AA 3A4RA 4B6WA 2KX0A 2ZCBA 2V3SA 3NHEB 2WX0A 5DCNA 3NZSA 3SHQA 1WM3A 2MX2A 2LRWA 3IVFA 1P0RA 4F1SA 4X57B 4ANUA 1HE8A 2KJRA 2KKCA 5G2NA 3RUIB 3WAOA 1LM8B 3KVFB 3GZNI 2XBBC 4ZYNA 4GSWA 4ZRKA 1WE7A 3M63B 2FNJB 2ZEQA 2D07B 2K8BA 2LZ6A 4K7SA 4GOCA 3H7PB 4BKGA 2KNBA 5EDSA 4W9IA 1QZEA 3TIXA 4URKA 2N1WA 3RZWC 5DPRA 5L95C 3Q3FA 1WJ6A 4NNJB 2RR9A 4KDIC 1J0GA 2OJRA 4YL8A 3I3TB 3U30A 4GU2A 4FADA 4HXDA 2KHWB 4BOZB 1EF5A 1WGDA 3VUYA 1RLFA 2ZPNA 5JH5C 2BGFA 2J0MA 4WJQA 2L0TA 2KDIA 2BWFA 1WX9A 2FCQA 4I6PA 4HCNB 2D10A 5E6OA 2LVPA 1GG3A 3BY4B 2L00B 4KZ0A 4EKUA 1WJNA 3HK0A 1OEYA 2ZVOA 4II3B 4BVUC 1KM7A 2BKFA 3ML8A 1I42A 3UIPB 2K8HA 4TQ1A 3VFKA 3KYCD 2LGDA 3ZDTA 3ML9A 1YIWA 3DVGY 2J7QB 2LVOA 2M4NA 3VTUA 3OJ3A 2LXAA 3VTVA 1R4MI 3OAWA 1WJ4A 1YJ1A 2KTFA 2JPHA 4NQLB 2MSED 2A5UA 2I1JA 3APFA 3NOBA 1CMXB 2WYQA 4MH0E 2MLBA 3DQVA 2BF8B 2BWES 4IM0A 2KZRA 4W9DA 4FHKA 1KJTA 3JW0X 5JZEB 2GBMA 2Z0EB 3N3KB 4M8NA 4IWQA 2ZPYA 2BYFA 4JQWC 4DBGA 1GC6A 2IZVB 4GIVA 1LQBA 4I6NB 1V80A 4IUMB 1L2NA 2NVUI 4FJYA 1PQSA 4MM3A 2KXJA 4DK5A 4K1RB 1YX6B 3R7QA 3ZNZB 4RM8A 3IG3A 3ZW3A 2IY0B 3MJWA 4GXBA 4MGZE 2UWQA 3VXWA 3WA0A 3ZNID 4MSQB 4GN1A 4W9FA 3ZRFA 2NBWB 2CKHB 1E7VA 3VHTC 3QAQA 2KMCA 1ZW7A 2AL3A 2M0XA 4IG7B 2AWTA 4MJSA 4RMAA 1NDDA 2NS5A 2MQJA 3MTNB 3ONSA 3JVZX 3VH4B 1P9DU 1YQBA 4J6IA 2MW5A 3UINB 3QJZA 5GMVA 3PHWB 2DX5B 3PZDA 4DHJB 4G50A 3N30A 4WQOB 1WXSA 3EFUA 1KLVA 4A3OA 3P2BA 2JVCA 4NQKE 4KSLC 3VQIA 4ASWC 3U8ZA 3VH3B 2XK5A 2JZZA 2FCNA 4LDTB 2KN5A 3LDZE 3PLUA 2MBOA 1A5RA 3V62A 2NR2A 4ANVA 3LJ3A 3PLVA 4CHKA 2ZNVC 1WMHA 2CS4A 3D32A 4ICUA 4IC7B 3ZIMA 4ANWA 4B9KA 2KO3A 4G11A 2L0FA 2N9PC 3R66C 4AOFA 2KQ7A 3A33B 2DYOA 4HJKA 4IWOA 4MELA 2PEAA 4KZCA 2NPTA 3S2AA 3ZO5B 2PE6B 1MG8A 1V2YA 3HIZA 3QC8B 4BKSD 2KANA 2N4FA 4PYZA 3X23A 1XQQA 3SU8X 2KTRA 3K9OB 2KX3A 2KOXA 3VTWA 4KV2A 3BINA 3B08A 3W1SC 5C1ZA 2R2QA 4I6LB 2JRHA 2KDFB 5E6NA 2JRIB 2O2VB 2LWPA 2MBHA 4E3CA 5L83A 3RD2A 1C3TA 1GC7A 2KWUB 2LUEA 3PV1A 4W9JA 3KH0A 2XK5B 3TBLD 3PS6A 2M17A 2O6VD 3HM6X 5G55A 3VUXA 1F9JA 4WJNA 3A4SC 1J8CA 3PREA 5KHQA 1SGHA 2LRUA 3V6EB 1WMHB 2EKEC 1R4NI 2C5LC 3OLMD 4GDLB 5BO4B 3L0WB 3H7SA 2MWSB 3ZDMC 1IPGA 2ASQA 2MP2A 5IA7A 1WGGA 2K25A 3AULA 2FIDA 2KC1A 5KHOA 2NPTB 1EF1A 5J18A 2NCNA 2Z0DB 3ALBA 2WX1A 4EFOA 1WXAA 3IHPC 1YD8U 5C23A 2KTRB 3RCZA 2RPQA 1WYWB 3AU5A 5CHWA 2DAJA 1ZKHA 2A4ZA 3ECIA 2JXXA 2N7DA 5J17A 3TCAA 1RAXA 3AXCA 2J0KA 2N7EA 3NZUA 2LGXA 3CMMB 2MBQA 4AWJA 2IYDB 2G4SA 2VRRB 3PRZA 4HDQA 2O6VB 2J0JA 4II2B 1S1QB 1WGYA 2DYBA 2DZIA 2HJ8A 2BKRB 4MGIE 2KFKA 2MRPA 3L17A 2KJ6A 4EOYA
chains in the Genus database with same CATH superfamily
4IW0A 3RPFC 2FCMA 3OG5A 3DPDA 2BT6A 4F7ZA 3TL5A 3Q6BA 5FR3A 1C1YB 1V1OA 1JALA 2DWQA 1YJIA 4GLSC 2E3TA 2BBCA 4JLCA 2MA9B 3NVZA 3OJ4B 3QX1A 2JWUA 3BVMA 1KOTA 1I35A 1MVKA 1WGRA 5TSSA 1DOXA 1SJHD 3DVNU 2KWCA 4WIPA 3J9CA 5HKHA 3R3MA 3ZXVA 2NTTA 3AECB 2KFKB 3DBLI 1Q1OA 4M8MA 3BK1A 3C0RB 1FO4A 2CR5A 1SE9A 1WR6E 2K6QA 4K7WA 2K22A 1UD7A 3U52E 1Q0WB 3B1LX 1FNVA 1Q10A 4O1NA 5C2TB 3W1YA 2KVZA 3AE5B 4AUQC 4XZ4A 3VUWA 1WI0A 2V4IB 4PYUA 4JWUC 3IFWB 1V6EA 3AI5A 3I57A 3PZ7A 3V61A 5JHBA 2AQ2B 2JF5A 2KYWA 1E10A 3N20C 1N63A 4RM9A 1D3ZA 1OQRA 2L83A 5H8YE 4YTMB 3TSSA 2GOWA 3UIOB 1IUEA 3VDZA 4K7UA 2LGYA 4HDOA 4CO7A 2WXIA 4WWMA 2ACZB 2DZKA 1ROEA 2O6VA 5IP4D 1KFYB 2AQ1B 3ZQ4A 4OVUA 2IO1B 5D3DA 1XXGA 2FUHB 5AZGA 1T3QA 2Z59B 3ZJUA 3CSTA 2AYOB 2VH1A 2DHZA 2BPSA 1AARA 2GLSA 4N58A 3PGEA 3DBHB 4PS8A 3T8MA 2K0PA 5IAAC 4AP4C 3RULA 1TS3A 1H8CA 3KUCB 1XLNA 3PSEB 1UZXB 2JWZA 4JE3B 2JZPA 1D5XC 3A1QB 2IO3B 3DBSA 3WAMA 3KLSX 1V5TA 1V5OA 2BB5A 4NJ7A 3FILB 1NBFC 1D5MC 4ARCA 1OGWA 3NY5A 2G4DB 2WXFA 3B9JA 2E6XA 3BYTB 1E7UA 4FBJB 4TV3A 1I4HA 4ZRJA 3ZKJC 2WXHA 1QQRA 3E56A 1QILA 3TEWA 5LLIA 5JXVA 4XX5A 2PVOD 2V4LA 2BYTA 3AEDB 1UELA 4DHZB 2JY6A 4IM2A 1WJUA 3N1ZC 3EECA 1AW7A 3Q8EA 4KGRA 1ISNA 3M95A 3CSFA 2CHZA 4JL9A 4OVVA 1V81A 2GBKA 1WGKA 3EHVA 3Q3OC 2HTHA 4A6QA 4R3DA 4EZLA 2KQSA 1MI0A 2K39A 4RGMA 2JU6X 4DXFA 3ZRCA 3ZUNA 3C8YA 3M3JA 4BKSA 1E0ZA 2AEHA 3ZNGC 1B1ZA 3SDLC 1B9RA 3P1MA 1L0VB 1LFDA 3H7PA 1TGZB 1SJED 1ZOYB 1WGHA 1NEKB 2GBRA 2DZMA 3UF8A 1WM2A 3JYUA 5CHFA 4F8CB 4BBNC 1EM7A 1FXTB 3AU4A 4B0MA 1FRRA 3Q3NC 3LB8C 4DXAB 2W3SA 1GUAB 4MGYE 2LXCA 2EMSA 3RZFA 4G0NB 2B3AA 4B6WA 2KX0A 3NHEB 2WX0A 3NZSA 1ACCA 1QOAA 1WM3A 2MX2A 1P0RA 4F1SA 2FE8A 2WHIA 3KVFB 1EWYC 1QKZA 3GZNI 1EU4A 1YN5A 1WE7A 2ZEQA 3MJ5A 4BKGA 3H7PB 2KNBA 4W9IA 3AE6B 1D4BA 3RZWC 1F52A 4BAXA 1PGAA 3I3TB 3SFDB 3RNCC 1WGDA 2IDYA 3VUYA 5JH5C 4YXDB 2J0MA 4WJQA 4I6PA 4HCNB 4NZLB 1GG3A 2N9KA 2L00B 1BMLC 1WJNA 2BW2A 2WXLA 2ZVOA 3ML8A 3FKYA 3VFKA 2LGDA 2X38A 3ZDTA 1SIJA 3ML9A 3VTUA 2LXAA 3VTVA 1KRHA 1R4MI 1WJ4A 2EKIA 2JPHA 3APFA 2M56B 4W9DA 5BYRA 3N3KB 1F1HA 3GS2A 1LQBA 4FJYA 1JCKB 4K1RB 3AEEB 3IAM1 2IY0B 3W5UB 3AM9A 4MSQB 3AEAB 1C78A 2CKHB 2D3AA 4IG7B 3Q2AC 2WDQB 2MW5A 2RMMA 2DX5B 1KF6B 4WURA 4WQOB 1WXSA 2KDMA 3U8ZA 1ZDXA 3VH3B 2XK5A 5G5GA 3ZYYX 3PLUA 4XDDA 2INPE 3C19A 2MBOA 1D5ZC 3FAHA 3PLVA 3Q14C 1WMHA 3Q8CA 4ANWA 1T0RC 2L0FA 1UUPA 4KZCA 3ZO5B 1V2YA 3KQ4A 3QC8B 2KANA 2N4FA 4PYZA 3SU8X 5IN7A 2KOXA 3VTWA 3B08A 4I6LB 5BMHA 1FRDA 2JRIB 5AUKA 4E3CA 2KWUB 2B76B 3DWMA 3KH0A 1OFFA 2XK5B 1FCCC 4L23A 1TS2A 3TBLD 2M17A 1F9JA 4A55A 5KHQA 1TIFA 1YQ3B 1WMHB 2EKEC 1R4NI 3N1XC 2C5LC 1IPGA 4WQMA 2ASQA 1WGGA 3AEFB 2MHJA 4LNKA 1EF1A 2OEDA 3ALBA 1WXAA 1SF0A 4RH6A 2VH2A 1WYWB 3DHGC 3AU5A 3W2DA 4RGTA 2J0KA 2OJWA 2LGXA 3EGRA 4HDQA 4C7YA 2WS3B 1WGYA 2DYBA 3UGBB 2KT7A 3IBEA 2H88B 4JIOU 2W9NA 3PO0A 4IWPA 2BQQA 3T9LA 4ZRPA 2QCZA 5AZHA 4HKQA 1EWCA 1JRUA 2IBIB 4K3BA 5EE1A 1IGDA 3DBLB 2L32A 1OEYJ 2PIAA 1P98A 1A70A 3APDA 1P3QU 1V49A 2WNMA 4FHJA 3MHZA 2AX5A 2RSUA 3CIRB 2C7NB 2RDBC 3BYYB 1Z2MA 2N9EB 2O2VA 2LI5A 1SBBB 2NMQA 2MJEA 4KDLB 2AL6A 2N7JA 1XT9B 1M4VA 4KSKC 3K9PB 5IOIA 4KVGB 3NRZA 4UDUC 2LHDA 3MHSD 4GDLA 3Q3JA 2MBBB 2REXA 4IDIA 4M0WB 3V60A 2L7RA 4P6VF 4C4VA 2K5PA 2LJ5A 4RGNA 1WR1A 4RFBA 5DPTA 3VRAB 3PZ8A 1L4DB 2H89B 1JROA 2Y5BB 4ICVA 4XGAB 1ZXHA 3PRPB 2JSVX 2GI9A 1V97A 1WZ0A 4FULA 4US8A 5IKCM 3ZTDA 5CTRC 3ZNHB 3QIJA 2XNAC 3X0WA 1N5WA 1YN3A 4BFRA 3UI3A 2CHWA 3BZDB 1HA5A 1WXVA 5D6JB 4LCDE 4C4VB 2LUMA 4N59A 4C80A 4QAYA 4LJPB 2CU1A 3QK0A 3RNEC 4W9CA 3I63C 1GOZA 2BYVE 4L1BA 2LHEA 3V3XA 4W9KA 3VR8B 5D7GA 2PTLA 4GB9A 3R8BA 4HKZE 1TS4A 2I38A 2PLPA 3B2FA 3VVWB 1WX8A 2V3PA 3WCQA 3ZJVA 1C4AA 2ZW1A 1FMAD 3P4QB 1FFVA 1TKEA 3PTFC 1PGXA 1WRIA 1SSNA 5GXGB 1FNUA 5LXIB 2QC8A 4W9GA 1JWUD 1IBXA 2KK8A 4K81A 4M02A 3L10B 4LJOB 1RRBA 4NAMA 3ZGZA 3TJPA 4DDID 2D11A 1TT5B 4XWWA 3CF6E 1X1MA 3DOWA 1EUVB 4OW0A 3APCA 2G3QB 2GBJA 5HI1A 3SFEB 3HUIA 1ZGUB 3SR6A 2L76A 1C76A 1MPEA 2FUG1 4PS3A 3AH7A 3Q8FA 3BIID 1IBXB 2D3GA 4A90A 5CX3A 3KWLA 4DHZE 2ICIA 3KWVA 1N5XA 4HK2A 4P1BC 3LYYA 3TUOA 3NVVA 1SIFA 2C60A 2YLMA 3V6CB 2J52A 2K3UA 3ENEA 1MFWA 3E9SA 2KJHB 1PGBA 3A1QA 2PPHA 2IO2B 4KKJA 4MJSB 3GZNB 2V0GA 4C7ZA 4YSZB 3AE1B 1DGJA 3EA6A 2OHFA 4XYCA 3NUHB 3FILA 2VZKD 1CK1A 2W3RA 4ANUA 4WH4A 2KKCA 3RUIB 4ZYNA 3R2IA 4ARIA 1AN8A 4DQOC 4US9A 2FNJB 4BOSC 1TZOA 2LZ6A 4HRSA 2IGDA 4YL8A 4YSYB 4FADA 2JXTA 1EF5A 1DOIA 2QSDA 2BWFA 1T0QC 1WX9A 3RFZB 2LVPA 3BY4B 1R4MB 4MT5A 2LFIA 4EKUA 4YT0B 3HK0A 1FCLA 4BVUC 1I42A 3UIPB 3KYCD 3DVGY 1D6EC 2M4NA 4RF0A 1AYFA 3P42A 3ZXRA 1VRAB 3OAWA 1YJ1A 4NQLB 2A5UA 2I1JA 2N0SB 2WYQA 3W9CB 2BWES 2KZRA 1KJTA 3JW0X 2EELA 2TSSA 4IWQA 3AN1A 4DBGA 4IUMB 2R61A 1PQSA 2KXJA 4DK5A 3BVGA 3GP7A 3R7QA 3ZNZB 1PFDA 3MJWA 1IGCA 1WSPA 2UWQA 3WA0A 1TY0A 3ZNID 4W9FA 2IPKD 2NBWB 4IOIE 4RMAA 1FEHA 1N6ZA 1WWTA 3FC4A 3JVZX 1P9DU 3UINB 3QJZA 1YN4A 3NVWA 1HXYD 3PZDA 1HTOA 4G50A 2GRIA 1KLGD 3EFUA 3RNAC 4H2AA 4NQKE 4USAA 1L6UA 4KSLC 3VQIA 2ONQA 3L4PA 3MC9A 1UGJA 1PDXA 3LDZE 1VJKA 2NR2A 3LJ3A 2ZNVC 2CS4A 2W54A 1NENB 2IJ0A 1T6BX 2KQ7A 3A33B 2MEKA 2NPTA 1VLBA 3HIZA 5FKAC 3NJTA 3K9OB 2KX3A 3W1SC 5C1ZA 2KDFB 1FM0D 1R4NB 3RD2A 1GC7A 2LUEA 1NVID 5G55A 3HM6X 3VUXA 1XLOA 2WXQA 1J8CA 3PREA 2JYEA 2D3BA 1ZDVA 3H7SA 2MWSB 3ZDMC 5IA7A 5KHOA 2NPTB 1QOGA 2NCNA 5BMIA 3IHPC 4LNNA 3AE9B 5C23A 2VZKB 3RCZA 2RPQA 4TSSA 5CHWA 1XLQA 2A4ZA 2N7DA 3CMMB 4AWJA 3PRZA 4CQNA 1N62A 2J0JA 3BVZA 1QT9A 2LEKA 3BWUD 2BKRB 2MRPA 3L17A 2SAKA 1I4PA 4AS1A 4ITKA 1SB3C 4EOYA 2MJ3A 3L54A 5JHAA 3L13A 1K50A 3P4PB 1NYRA 2SEBD 1BT0A 2ZZPB 3DWGC 3KYDD 4WWOA 2GMIC 1WRDB 1UNSA 1SE3A 3AE2B 4TKNA 2KWDA 4B0EA 1GB4A 3UQAA 4A9AA 3RI7C 3Q69A 4NJCA 2CHXA 4M01A 2IGHA 2Y3AA 4E74A 3GOEA 1L7YA 4G3XB 4NAWA 5AEKB 1IYFA 4MACA 2BYEA 1IP9A 3EC8A 3RYTA 2C7HA 1WIAA 1AWDA 4HWIB 4D2KA 1BUIC 4EEWA 3RNFC 4RF1A 1VZ6A 2N9XA 3NS8A 2EMTA 2G45B 2WXGA 1WH3A 4OZCA 3TEZA 2KD0A 3QA8A 3KUDB 1GNUA 4NAWB 4HJGE 2KDBA 3DBRI 1OTRB 4FLHA 3ABVB 4OZAA 3U7DA 3DVNV 4PS7A 1JWSD 4N9F4 4BKTA 2KVRA 2KQ4X 2WP9B 1XCQL 3R2TA 4NPNA 2IO0B 1C4CA 1QF6A 1WE6A 2DLBA 3L16A 4WJOA 3B0AA 4ZDVA 3SD5A 4GDKB 1Z5SB 2FAZA 5AZFA 4C56C 1QOFA 1L0XB 2MH7A 2RD0A 2KMAA 5D94A 1P1AA 4DWFA 1P7EA 2D2QA 2LMCA 3M62B 3O65B 1XLPA 2L3ZA 2MCNB 3I5JC 4BBNF 1C79A 1L0YB 4ANXA 3MP9A 2DYMA 1K8RB 1UH6A 4FJZA 4L2YA 3RNBC 1E8YA 1XF5L 3H6NA 2LGIA 4A20A 2DENB 3PVLA 4WWPA 2FCSA 4KIKA 1J19A 3ZVVA 2XEWA 3HM3A 1GB1A 1UBQA 1KLUD 1OQYA 1I4QA 5E6JA 4FN2A 4XWTA 4P7IA 1JQ4A 1EO6A 4A3PA 2K8CA 5G5HA 3W1SA 1JWAD 2ZVNA 2YVCA 2L8JA 1Y8RC 4Q2JA 4DHJD 2BS3B 2PJHA 1RWSA 4M0WA 4EUTA 2OOBB 1WF9A 1E6EB 5LNK1 2R2OA 4YTNB 1HTQA 1WY8A 2C9WB 4B95A 4AQ7A 4KIKB 2ZNVB 2G1EA 3VRBB 2PKOA 1LXDA 4WWNA 3WALA 4HVBA 1E8XA 3TMPB 3ZLZA 4J3OD 4RGOS 1U4AA 4ACFA 3DDCB 3HVZA 2N9LA 3WIMA 3AV8A 2UU7A 4WAAA 3ETRA 4JPSA 3VR9B 2JYTA 3L08A 4P16A 3PT2B 2FBWB 2HD5B 1J7AA 4W9LA 1TKGA 2M19A 2MBEA 1E5WA 2NBVB 3PPAA 1K52A 4CYEA 1YOVB 3DCGA 1SXTA 2BB6A 1GPXA 4PK1A 4OVZA 1T5XD 2BS2B 3H9DA 3A4RA 3N1YC 2ZCBA 3SHQA 1LO5D 2LRWA 4X57B 5G2NA 3WAOA 1LM8B 3RN9C 4ZRKA 3DHIC 1TY2A 3M63B 2K8BA 4BZAA 4K7SA 4GOCA 2J42A 4URKA 2Q5WD 5L95C 3ZJTA 1J0GA 2OJRA 4GU2A 3EFCA 4BOZB 1RLFA 2L0TA 2KDIA 1ZP0B 2D5GA 5E6OA 4KZ0A 1I7HA 1E9MA 1OEYA 4II3B 3BK2A 1KM7A 2K8HA 4TQ1A 2M0AA 1QOBA 3OJ3A 1HZ6A 2WXKA 3O13A 2KTFA 5FK9C 3NOBA 2V3NA 1CMXB 2L52A 3DQVA 2XN9C 4FHKA 5JZEB 1UWMA 2Z0EB 5MPOA 2IZVB 4GIVA 4LTUA 4I6NB 1V80A 2MJDA 1L2NA 2NVUI 3TEYA 2INNE 4LNIA 1F2RI 4MM3A 1RYJA 3IT4B 2KN4A 2AQ3B 4RM8A 4TMAB 3ZW3A 4GXBA 3VXWA 1L5PA 4KKIA 3ZRFA 3QAQA 1ZW7A 2AL3A 2M0XA 4MJSA 1F77A 1NDDA 2NS5A 2DBYA 3ONSA 3MTNB 1JWBD 2QEJC 4J6IA 5GMVA 4S17A 3Q3MC 4DHJB 1KLVA 1VZ7A 4A3OA 2JZZA 4MM3B 5BYQA 2G9HD 1EU3A 4ZRQA 4CHKA 1MHXA 4ICUA 4IC7B 3ZIMA 4OZBA 4B9KA 2QILA 2KO3A 3OWEB 1CJEA 2N9PC 3U7ZA 3R66C 4AOFA 4HJKA 4MELA 2PEAA 2PE6B 4BKSD 2KTRA 4ZOHC 1L4ZB 2GB1A 2KACA 2WXMA 4YSXB 1FXAA 2R2QA 2JRHA 2LWPA 2MBHA 1Y56A 1TYGB 5L83A 3PV1A 1V8CA 3PS6A 1RM6C 1PYWD 1SGHA 2LRUA 3V6EB 2Z8LA 3B2GA 3OLMD 2HJ1A 2MP2A 3AULA 2FIDA 4LNOA 1CQVA 2WDVB 2IGGA 1YD8U 2KTRB 1VR9A 1I4GA 1ZKHA 3ECIA 2JXXA 1YJJA 5J17A 1RAXA 3AXCA 3NZUA 2N7EA 2HTME 2IYDB 2W82A 2O6VB 4II2B 1S1QB 2DZIA 2HJ8A 1SEBD 1VZ8A 4PT5A 2PMVA 2Y5CA 1V86A 2MP2B 1RFAA 3GE8C 2JQRB 4MEMA 4TQ0A 1I4RA 1DOYA 2RDHA 4NY0A 1E8WA 1G6JA 4HEA1 1F0ZA 2KDEB 3QQ8B 4MDKE 4JGHB 3JSVA 4GGQA 1TZ1A 1K51A 3NS1A 5HHDG 3WAPA 3PRMB 2RPVA 5EE3A 3A9KA 1SE4A 2K9XA 2LASA 1T0YA 5E6PA 3QARA 2L1AA 4HROA 5T8IA 1PUTA 3Q8BA 2PE9A 2ZW0A 1WXQA 2NTSA 2JT4B 1F2RC 4DDGD 1FPYA 3VAWA 1TBEA 3GE3C 4ZRIA 1FXIA 2WGSA 1OQQA 3RT3B 3JSVB 3DBRB 1Q5WB 5BMGA 2D3CA 1E8ZA 3A9KB 3HVDA 3DVGX 1VCBA 1H4RA 3R7RA 3AE7B 4MSMB 2V1YA 1V9JA 2WU2B 2RDGA 4LNFA 5I4DA 1XCTL 4KX6B 1I4XA 1M94A 2W55A 1JMLA 5AUIA 1VD2A 2HE7A 1ZXIA 4FA6A 3URYA 4DXGA 2Y5PA 3UQBA 1E90A 1NI2A 1HQRD 1YMHE 2M1MA 3SEBA 2IY1B 3Q8AA 4HPLB 4E71A 1XD3B 1WXMA 1J7CA 5J2RA 3NG0A 3AE3B 3KUZA 5D2MB 3PHXB 2L05A 2KC2A 5BYSA 5CHVC 4NJ6A 2NBUA 2UYZB 2WWZA 2RGFA 2LJIA 3QHTA 4RCOA 1KTKA 3DBHI 5DPSA 2DZJA 1FFUA 4MGKE 2ZCCA 2JUOA 3QWZB 1KH0A 3P4SB 3WANA 1GJZA 3IT6B 4EE2A 4EZJA 4C00A 4TUUA 3W5VB 4AJYB 5HFYA 3MFGA 1K53A 2K6DB 1TS5A 5DPWA 1SE2A 1STEA 1YX5B 4OHJA 4YTPB 2WDTB 4W9EA 2QMTA 2FIFA 2N1VA 3N32A 2ON8A 4XC2A 2J4XA 4WJPA 2HDEA 2KWVB 4W9HA 3U4EG 4M00A 2JZ3B 2KLCA 4EZKA 1WZ3A 3A9JA 5FR6A 1WX7A 3KW5B 1UGMA 2WQYB 3H8HA 1ZUD2 4LDTD 4NNJB 4A8XC 1HZ5A 2LVQA 2QJLA 4GMVA 1WFYA 2ZJDA 4HPMB 2K1FA 4IM3A 4MH8A 1XO3A 1DYQA 2M8SA 2QDFA 5TR5A 5EE0A 1UBIA 2C7MB 4ZHOA 4JWSC 4XE0A 2GBNA 4HCPB 4JX1C 3HHMA 1P7FA 3A9JB 4GDKA 3RMKC 4HLEA 1S3SG 1MG4A 3QCAA 1HEZE 2DAFA 1ET6A 2I1KA 3NZ3A 4WAFA 1TTNA 1N60A 4AJWA 3AEBB 3IXSA 3ZTCA 1NYQA 2LGSA 3NVYA 1MJDA 2QIEB 2BS4B 2LD9A 2KFJA 3N9YC 3P4RB 2KLGA 2QHOA 4FJVB 1C9FA 3H1UA 5C3JB 1N61A 2V3SA 3AMZA 1V1PA 3EUB2 5DCNA 3IVFA 1HE8A 2KJRA 2XBBC 1BXTA 4GSWA 4FXCA 5EE9A 2D07B 5EDSA 3TEXA 1QZEA 3I9V1 3TIXA 2N1WA 5DPRA 2PW9A 3Q3FA 1WJ6A 2RR9A 4KDIC 3U30A 1ENFA 2WU5B 4HXDA 2INDC 2KHWB 3MC0B 1GAQB 3AE4B 2ZPNA 2BGFA 1MHHE 1V1PB 3AE8B 2FCQA 2D10A 1XEEA 3LXFA 1UWXA 2BKFA 1VDVA 4P1CC 4RNAA 1TJEA 1YIWA 1E7PB 2J7QB 2LVOA 1ZPSA 2KMMA 3GB1A 1JW9D 3AEGB 2MSED 5D3IB 4MH0E 2MLBA 4IM0A 2BF8B 4K3CA 3AB5A 1UF0A 1T0SC 2GBMA 1C77A 4M8NA 2ZPYA 2BYFA 4JQWC 1GC6A 1ET9A 2CJOA 5HG2A 4HPPA 3RNGC 1LGRA 1YX6B 3IG3A 4MGZE 3V05A 2WXPA 2CU3A 2YEPF 1JRPA 4GN1A 2DNFA 2JX5A 4LLGM 1E7VA 1YNTE 3VHTC 2KMCA 2AWTA 1WYGA 2MQJA 2BVCA 1TKYA 3VH4B 1YQBA 4KGSA 3PHWB 3N30A 2CJNA 4ZYSA 1ZE3D 3P2BA 2JVCA 3CWIA 4ASWC 4LDTB 2FCNA 2KN5A 4LK0M 1A5RA 3V62A 2BTEA 4ANVA 3D32A 4IKGA 1NI3A 4S0RA 4REZA 2J53A 2V9HA 4G11A 3DHHC 2DYOA 4IWOA 4YWGG 3S2AA 2X8XX 1JWMD 1MG8A 1QLBB 3X23A 1XQQA 3T3OA 2WXJA 3BINA 4KV2A 5E6NA 2O2VB 4N6EB 1C3TA 1C4PA 2KAJA 4W9JA 3U2SC 3T3NA 2WLBA 1L6VA 2O6VD 2YEPB 4WJNA 5H92C 3A4SC 2WXNA 2WDRB 4GDLB 5BO4B 3L0WB 1FNWA 2K25A 2KC1A 2INCC 4KGTA 5J18A 2Z0DB 1CZPA 4EFOA 2WX1A 4ZHPA 5IO9A 1J7BA 1R7SA 2WXOA 3IAS1 3HRDD 2DAJA 4XDCA 3P63A 3TCAA 2PVGC 1ESFA 2MBQA 2VRRB 2G4SA 1FIQA 2WXRA 2I2YA 3MC8A 1YQ4B 4MGIE 1FD6A 2KFKA 1RFKA 2KJ6A 5LXHA
chains in the Genus database with same CATH topology
3L54A 3IBEA 4IW0A 3UGBB 5JHAA 4JIOU 2FCMA 3L13A 2W9NA 3DPDA 4IWPA 4F7ZA 3T9LA 1V86A 1BT0A 2MP2B 3TL5A 2ZZPB 1RFAA 3KYDD 1C1YB 5AZHA 4MEMA 4WWOA 4TQ0A 4JLCA 2MA9B 1JRUA 2GMIC 1WRDB 2IBIB 4NY0A 1E8WA 3OJ4B 3QX1A 1G6JA 4TKNA 2KDEB 3QQ8B 1KOTA 4MDKE 4JGHB 1I35A 3JSVA 3UQAA 1WGRA 1OEYJ 4GGQA 2CHXA 1TZ1A 3DVNU 2KWCA 3WAPA 3PRMB 1P98A 4E74A 3R3MA 5HKHA 3A9KA 3GOEA 1L7YA 4G3XB 4NAWA 5AEKB 1IYFA 2KFKB 2LASA 1T0YA 3DBLI 1Q1OA 2BYEA 4M8MA 3C0RB 3APDA 5E6PA 2CR5A 1P3QU 1V49A 3EC8A 1SE9A 3QARA 1IP9A 3RYTA 1WR6E 2K6QA 4FHJA 2PE9A 4K7WA 2RSUA 2C7HA 1UD7A 2C7NB 2JT4B 1Q0WB 1WIAA 4DDGD 4HWIB 3B1LX 1Z2MA 2N9EB 3VAWA 2O2VA 1TBEA 2LI5A 4ZRIA 4EEWA 4KDLB 2AL6A 3W1YA 4AUQC 1XT9B 3RT3B 4XZ4A 2N9XA 3JSVB 1Q5WB 1WI0A 2EMTA 3NS8A 3VUWA 2G45B 4PYUA 1WH3A 1E8ZA 3IFWB 1V6EA 4KSKC 3K9PB 2KD0A 3AI5A 3QA8A 4KVGB 3A9KB 3V61A 3MHSD 5JHBA 4GDLA 3KUDB 1GNUA 2JF5A 3DVGX 1VCBA 4NAWB 1H4RA 2KDBA 3R7RA 3Q3JA 4MSMB 2V1YA 3DBRI 2MBBB 2REXA 4RM9A 1D3ZA 1V9JA 4M0WB 1OTRB 3V60A 2L7RA 4FLHA 2GOWA 1M94A 3UIOB 1VD2A 3VDZA 4K7UA 3U7DA 2LGYA 2LJ5A 3DVNV 4PS7A 2HE7A 4HDOA 4CO7A 1WR1A 5DPTA 4FA6A 3UQBA 2DZKA 1E90A 4N9F4 4BKTA 2KVRA 2O6VA 1NI2A 2Y5BB 4ICVA 2M1MA 3PRPB 4NPNA 2IY1B 4OVUA 2IO0B 4HPLB 2IO1B 1WZ0A 4FULA 4E71A 3ZTDA 5CTRC 2FUHB 3ZNHB 1XD3B 1WE6A 1WXMA 3L16A 3QIJA 3B0AA 4WJOA 5AZGA 3X0WA 4ZDVA 5J2RA 4BFRA 2Z59B 3CSTA 2AYOB 2DHZA 3SD5A 2BPSA 2CHWA 4GDKB 1Z5SB 1AARA 2FAZA 5AZFA 3PGEA 3KUZA 4PS8A 3T8MA 5IAAC 1WXVA 5D6JB 5D2MB 3PHXB 4LCDE 2RD0A 2L05A 2KMAA 5D94A 1P1AA 3RULA 4AP4C 2KC2A 3KUCB 4DWFA 1H8CA 5CHVC 4LJPB 2CU1A 2D2QA 3QK0A 4NJ6A 2NBUA 2UYZB 3M62B 3PSEB 1UZXB 2RGFA 2JWZA 2WWZA 4W9CA 3O65B 3QHTA 2L3ZA 2BYVE 3DBHI 5DPSA 2MCNB 4BBNF 3A1QB 2IO3B 2DZJA 4MGKE 4ANXA 2ZCCA 2JUOA 3DBSA 3QWZB 3WAMA 4W9KA 2DYMA 1K8RB 3WANA 1UH6A 5D7GA 1GJZA 4GB9A 4FJZA 1V5TA 1E8YA 4EZJA 1V5OA 4TUUA 3H6NA 3VVWB 4AJYB 4NJ7A 4A20A 2K6DB 2DENB 1NBFC 3PVLA 1WX8A 4WWPA 5DPWA 1OGWA 2FCSA 1YX5B 3NY5A 4KIKA 2G4DB 1J19A 2WDTB 3ZVVA 4W9EA 2XEWA 3HM3A 3PTFC 2FIFA 1UBQA 2N1VA 4LDTD 1OQYA 3N32A 1E7UA 4FBJB 4FN2A 4XC2A 5LXHA 4P7IA 4TV3A 4WJPA 4BOSC 4ZRJA 3ZKJC 1EO6A 2KWVB 4W9HA 4A3PA 2K8CA 5LXIB 2JZ3B 3W1SA 2ZVNA 5LLIA 2KLCA 2YVCA 4XX5A 2V4LA 4EZKA 1WZ3A 1UELA 4W9GA 2L8JA 3A9JA 1Y8RC 5FR6A 1WX7A 2KK8A 3KW5B 4K81A 4DHJD 2JY6A 1UGMA 2PJHA 4IM2A 1WJUA 4DHZB 3L10B 4LJOB 1RRBA 4EUTA 2OOBB 1WF9A 3TJPA 4DDID 3EECA 2D11A 1ISNA 2R2OA 3M95A 1WY8A 3CF6E 2C9WB 2CHZA 3CSFA 1X1MA 3DOWA 4JL9A 1EUVB 2LVQA 4KIKB 4B95A 2ZNVB 3APCA 4GMVA 1V81A 2G3QB 4OVVA 2GBKA 2GBJA 1WFYA 2ZJDA 3EHVA 4HPMB 2HTHA 1LXDA 2K1FA 4IM3A 4WWNA 3WALA 4HVBA 1E8XA 1ZGUB 3TMPB 2M8SA 3ZLZA 2L76A 5TR5A 1UBIA 2C7MB 4PS3A 4EZLA 2KQSA 1U4AA 2GBNA 2K39A 3DDCB 4HCPB 3HHMA 3WIMA 3ZRCA 3ZUNA 3A9JB 3M3JA 4GDKA 4WAAA 2D3GA 1S3SG 4BKSA 4HLEA 2AEHA 3QCAA 3ZNGC 2DAFA 5CX3A 4DHZE 3L08A 3PT2B 3SDLC 4HK2A 2I1KA 2HD5B 1LFDA 1TTNA 3H7PA 4AJWA 1SIFA 1TGZB 2C60A 2YLMA 4W9LA 3V6CB 1WGHA 3ENEA 2MBEA 3ZTCA 1E5WA 2GBRA 2DZMA 3UF8A 1WM2A 3JYUA 2KJHB 5CHFA 2NBVB 3PPAA 4F8CB 3A1QA 4BBNC 2LD9A 1FXTB 3AU4A 3DCGA 4CYEA 2KFJA 2PPHA 2IO2B 4DXAB 1GUAB 4MGYE 2LXCA 4MJSB 2KLGA 2QHOA 4FJVB 2EMSA 3RZFA 3H1UA 4G0NB 3H9DA 2B3AA 3A4RA 4B6WA 2KX0A 2ZCBA 2V3SA 3NHEB 2WX0A 5DCNA 3NZSA 3SHQA 1WM3A 2MX2A 2LRWA 3IVFA 1P0RA 4F1SA 4X57B 4ANUA 1HE8A 2KJRA 2KKCA 5G2NA 3RUIB 3WAOA 1LM8B 3KVFB 3GZNI 2XBBC 4ZYNA 4GSWA 4ZRKA 1WE7A 3M63B 2FNJB 2ZEQA 2D07B 2K8BA 2LZ6A 4K7SA 4GOCA 3H7PB 4BKGA 2KNBA 5EDSA 4W9IA 1QZEA 3TIXA 4URKA 2N1WA 3RZWC 5DPRA 5L95C 3Q3FA 1WJ6A 4NNJB 2RR9A 4KDIC 1J0GA 2OJRA 4YL8A 3I3TB 3U30A 4GU2A 4FADA 4HXDA 2KHWB 4BOZB 1EF5A 1WGDA 3VUYA 1RLFA 2ZPNA 5JH5C 2BGFA 2J0MA 4WJQA 2L0TA 2KDIA 2BWFA 1WX9A 2FCQA 4I6PA 4HCNB 2D10A 5E6OA 2LVPA 1GG3A 3BY4B 2L00B 4KZ0A 4EKUA 1WJNA 3HK0A 1OEYA 2ZVOA 4II3B 4BVUC 1KM7A 2BKFA 3ML8A 1I42A 3UIPB 2K8HA 4TQ1A 3VFKA 3KYCD 2LGDA 3ZDTA 3ML9A 1YIWA 3DVGY 2J7QB 2LVOA 2M4NA 3VTUA 3OJ3A 2LXAA 3VTVA 1R4MI 3OAWA 1WJ4A 1YJ1A 2KTFA 2JPHA 4NQLB 2MSED 2A5UA 2I1JA 3APFA 3NOBA 1CMXB 2WYQA 4MH0E 2MLBA 3DQVA 2BF8B 2BWES 4IM0A 2KZRA 4W9DA 4FHKA 1KJTA 3JW0X 5JZEB 2GBMA 2Z0EB 3N3KB 4M8NA 4IWQA 2ZPYA 2BYFA 4JQWC 4DBGA 1GC6A 2IZVB 4GIVA 1LQBA 4I6NB 1V80A 4IUMB 1L2NA 2NVUI 4FJYA 1PQSA 4MM3A 2KXJA 4DK5A 4K1RB 1YX6B 3R7QA 3ZNZB 4RM8A 3IG3A 3ZW3A 2IY0B 3MJWA 4GXBA 4MGZE 2UWQA 3VXWA 3WA0A 3ZNID 4MSQB 4GN1A 4W9FA 3ZRFA 2NBWB 2CKHB 1E7VA 3VHTC 3QAQA 2KMCA 1ZW7A 2AL3A 2M0XA 4IG7B 2AWTA 4MJSA 4RMAA 1NDDA 2NS5A 2MQJA 3MTNB 3ONSA 3JVZX 3VH4B 1P9DU 1YQBA 4J6IA 2MW5A 3UINB 3QJZA 5GMVA 3PHWB 2DX5B 3PZDA 4DHJB 4G50A 3N30A 4WQOB 1WXSA 3EFUA 1KLVA 4A3OA 3P2BA 2JVCA 4NQKE 4KSLC 3VQIA 4ASWC 3U8ZA 3VH3B 2XK5A 2JZZA 2FCNA 4LDTB 2KN5A 3LDZE 3PLUA 2MBOA 1A5RA 3V62A 2NR2A 4ANVA 3LJ3A 3PLVA 4CHKA 2ZNVC 1WMHA 2CS4A 3D32A 4ICUA 4IC7B 3ZIMA 4ANWA 4B9KA 2KO3A 4G11A 2L0FA 2N9PC 3R66C 4AOFA 2KQ7A 3A33B 2DYOA 4HJKA 4IWOA 4MELA 2PEAA 4KZCA 2NPTA 3S2AA 3ZO5B 2PE6B 1MG8A 1V2YA 3HIZA 3QC8B 4BKSD 2KANA 2N4FA 4PYZA 3X23A 1XQQA 3SU8X 2KTRA 3K9OB 2KX3A 2KOXA 3VTWA 4KV2A 3BINA 3B08A 3W1SC 5C1ZA 2R2QA 4I6LB 2JRHA 2KDFB 5E6NA 2JRIB 2O2VB 2LWPA 2MBHA 4E3CA 5L83A 3RD2A 1C3TA 1GC7A 2KWUB 2LUEA 3PV1A 4W9JA 3KH0A 2XK5B 3TBLD 3PS6A 2M17A 2O6VD 3HM6X 5G55A 3VUXA 1F9JA 4WJNA 3A4SC 1J8CA 3PREA 5KHQA 1SGHA 2LRUA 3V6EB 1WMHB 2EKEC 1R4NI 2C5LC 3OLMD 4GDLB 5BO4B 3L0WB 3H7SA 2MWSB 3ZDMC 1IPGA 2ASQA 2MP2A 5IA7A 1WGGA 2K25A 3AULA 2FIDA 2KC1A 5KHOA 2NPTB 1EF1A 5J18A 2NCNA 2Z0DB 3ALBA 2WX1A 4EFOA 1WXAA 3IHPC 1YD8U 5C23A 2KTRB 3RCZA 2RPQA 1WYWB 3AU5A 5CHWA 2DAJA 1ZKHA 2A4ZA 3ECIA 2JXXA 2N7DA 5J17A 3TCAA 1RAXA 3AXCA 2J0KA 2N7EA 3NZUA 2LGXA 3CMMB 2MBQA 4AWJA 2IYDB 2G4SA 2VRRB 3PRZA 4HDQA 2O6VB 2J0JA 4II2B 1S1QB 1WGYA 2DYBA 2DZIA 2HJ8A 2BKRB 4MGIE 2KFKA 2MRPA 3L17A 2KJ6A 4EOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L54 A;  3IBE A;  4IW0 A;  3UGB B;  5JHA A;  4JIO U;  2FCM A;  3L13 A;  2W9N A;  3DPD A;  4IWP A;  4F7Z A;  3T9L A;  1V86 A;  1BT0 A;  2MP2 B;  3TL5 A;  2ZZP B;  1RFA A;  3KYD D;  1C1Y B;  5AZH A;  4MEM A;  4WWO A;  4TQ0 A;  4JLC A;  2MA9 B;  1JRU A;  2GMI C;  1WRD B;  2IBI B;  4NY0 A;  1E8W A;  3OJ4 B;  3QX1 A;  1G6J A;  4TKN A;  2KDE B;  3QQ8 B;  1KOT A;  4MDK E;  4JGH B;  1I35 A;  3JSV A;  3UQA A;  1WGR A;  1OEY J;  4GGQ A;  2CHX A;  1TZ1 A;  3DVN U;  2KWC A;  3WAP A;  3PRM B;  1P98 A;  4E74 A;  3R3M A;  5HKH A;  3A9K A;  3GOE A;  1L7Y A;  4G3X B;  4NAW A;  5AEK B;  1IYF A;  2KFK B;  2LAS A;  1T0Y A;  3DBL I;  1Q1O A;  2BYE A;  4M8M A;  3C0R B;  3APD A;  5E6P A;  2CR5 A;  1P3Q U;  1V49 A;  3EC8 A;  1SE9 A;  3QAR A;  1IP9 A;  3RYT A;  1WR6 E;  2K6Q A;  4FHJ A;  2PE9 A;  4K7W A;  2RSU A;  2C7H A;  1UD7 A;  2C7N B;  2JT4 B;  1Q0W B;  1WIA A;  4DDG D;  4HWI B;  3B1L X;  1Z2M A;  2N9E B;  3VAW A;  2O2V A;  1TBE A;  2LI5 A;  4ZRI A;  4EEW A;  4KDL B;  2AL6 A;  3W1Y A;  4AUQ C;  1XT9 B;  3RT3 B;  4XZ4 A;  2N9X A;  3JSV B;  1Q5W B;  1WI0 A;  2EMT A;  3NS8 A;  3VUW A;  2G45 B;  4PYU A;  1WH3 A;  1E8Z A;  3IFW B;  1V6E A;  4KSK C;  3K9P B;  2KD0 A;  3AI5 A;  3QA8 A;  4KVG B;  3A9K B;  3V61 A;  3MHS D;  5JHB A;  4GDL A;  3KUD B;  1GNU A;  2JF5 A;  3DVG X;  1VCB A;  4NAW B;  1H4R A;  2KDB A;  3R7R A;  3Q3J A;  4MSM B;  2V1Y A;  3DBR I;  2MBB B;  2REX A;  4RM9 A;  1D3Z A;  1V9J A;  4M0W B;  1OTR B;  3V60 A;  2L7R A;  4FLH A;  2GOW A;  1M94 A;  3UIO B;  1VD2 A;  3VDZ A;  4K7U A;  3U7D A;  2LGY A;  2LJ5 A;  3DVN V;  4PS7 A;  2HE7 A;  4HDO A;  4CO7 A;  1WR1 A;  5DPT A;  4FA6 A;  3UQB A;  2DZK A;  1E90 A;  4N9F 4;  4BKT A;  2KVR A;  2O6V A;  1NI2 A;  2Y5B B;  4ICV A;  2M1M A;  3PRP B;  4NPN A;  2IY1 B;  4OVU A;  2IO0 B;  4HPL B;  2IO1 B;  1WZ0 A;  4FUL A;  4E71 A;  3ZTD A;  5CTR C;  2FUH B;  3ZNH B;  1XD3 B;  1WE6 A;  1WXM A;  3L16 A;  3QIJ A;  3B0A A;  4WJO A;  5AZG A;  3X0W A;  4ZDV A;  5J2R A;  4BFR A;  2Z59 B;  3CST A;  2AYO B;  2DHZ A;  3SD5 A;  2BPS A;  2CHW A;  4GDK B;  1Z5S B;  1AAR A;  2FAZ A;  5AZF A;  3PGE A;  3KUZ A;  4PS8 A;  3T8M A;  5IAA C;  1WXV A;  5D6J B;  5D2M B;  3PHX B;  4LCD E;  2RD0 A;  2L05 A;  2KMA A;  5D94 A;  1P1A A;  3RUL A;  4AP4 C;  2KC2 A;  3KUC B;  4DWF A;  1H8C A;  5CHV C;  4LJP B;  2CU1 A;  2D2Q A;  3QK0 A;  4NJ6 A;  2NBU A;  2UYZ B;  3M62 B;  3PSE B;  1UZX B;  2RGF A;  2JWZ A;  2WWZ A;  4W9C A;  3O65 B;  3QHT A;  2L3Z A;  2BYV E;  3DBH I;  5DPS A;  2MCN B;  4BBN F;  3A1Q B;  2IO3 B;  2DZJ A;  4MGK E;  4ANX A;  2ZCC A;  2JUO A;  3DBS A;  3QWZ B;  3WAM A;  4W9K A;  2DYM A;  1K8R B;  3WAN A;  1UH6 A;  5D7G A;  1GJZ A;  4GB9 A;  4FJZ A;  1V5T A;  1E8Y A;  4EZJ A;  1V5O A;  4TUU A;  3H6N A;  3VVW B;  4AJY B;  4NJ7 A;  4A20 A;  2K6D B;  2DEN B;  1NBF C;  3PVL A;  1WX8 A;  4WWP A;  5DPW A;  1OGW A;  2FCS A;  1YX5 B;  3NY5 A;  4KIK A;  2G4D B;  1J19 A;  2WDT B;  3ZVV A;  4W9E A;  2XEW A;  3HM3 A;  3PTF C;  2FIF A;  1UBQ A;  2N1V A;  4LDT D;  1OQY A;  3N32 A;  1E7U A;  4FBJ B;  4FN2 A;  4XC2 A;  5LXH A;  4P7I A;  4TV3 A;  4WJP A;  4BOS C;  4ZRJ A;  3ZKJ C;  1EO6 A;  2KWV B;  4W9H A;  4A3P A;  2K8C A;  5LXI B;  2JZ3 B;  3W1S A;  2ZVN A;  5LLI A;  2KLC A;  2YVC A;  4XX5 A;  2V4L A;  4EZK A;  1WZ3 A;  1UEL A;  4W9G A;  2L8J A;  3A9J A;  1Y8R C;  5FR6 A;  1WX7 A;  2KK8 A;  3KW5 B;  4K81 A;  4DHJ D;  2JY6 A;  1UGM A;  2PJH A;  4IM2 A;  1WJU A;  4DHZ B;  3L10 B;  4LJO B;  1RRB A;  4EUT A;  2OOB B;  1WF9 A;  3TJP A;  4DDI D;  3EEC A;  2D11 A;  1ISN A;  2R2O A;  3M95 A;  1WY8 A;  3CF6 E;  2C9W B;  2CHZ A;  3CSF A;  1X1M A;  3DOW A;  4JL9 A;  1EUV B;  2LVQ A;  4KIK B;  4B95 A;  2ZNV B;  3APC A;  4GMV A;  1V81 A;  2G3Q B;  4OVV A;  2GBK A;  2GBJ A;  1WFY A;  2ZJD A;  3EHV A;  4HPM B;  2HTH A;  1LXD A;  2K1F A;  4IM3 A;  4WWN A;  3WAL A;  4HVB A;  1E8X A;  1ZGU B;  3TMP B;  2M8S A;  3ZLZ A;  2L76 A;  5TR5 A;  1UBI A;  2C7M B;  4PS3 A;  4EZL A;  2KQS A;  1U4A A;  2GBN A;  2K39 A;  3DDC B;  4HCP B;  3HHM A;  3WIM A;  3ZRC A;  3ZUN A;  3A9J B;  3M3J A;  4GDK A;  4WAA A;  2D3G A;  1S3S G;  4BKS A;  4HLE A;  2AEH A;  3QCA A;  3ZNG C;  2DAF A;  5CX3 A;  4DHZ E;  3L08 A;  3PT2 B;  3SDL C;  4HK2 A;  2I1K A;  2HD5 B;  1LFD A;  1TTN A;  3H7P A;  4AJW A;  1SIF A;  1TGZ B;  2C60 A;  2YLM A;  4W9L A;  3V6C B;  1WGH A;  3ENE A;  2MBE A;  3ZTC A;  1E5W A;  2GBR A;  2DZM A;  3UF8 A;  1WM2 A;  3JYU A;  2KJH B;  5CHF A;  2NBV B;  3PPA A;  4F8C B;  3A1Q A;  4BBN C;  2LD9 A;  1FXT B;  3AU4 A;  3DCG A;  4CYE A;  2KFJ A;  2PPH A;  2IO2 B;  4DXA B;  1GUA B;  4MGY E;  2LXC A;  4MJS B;  2KLG A;  2QHO A;  4FJV B;  2EMS A;  3RZF A;  3H1U A;  4G0N B;  3H9D A;  2B3A A;  3A4R A;  4B6W A;  2KX0 A;  2ZCB A;  2V3S A;  3NHE B;  2WX0 A;  5DCN A;  3NZS A;  3SHQ A;  1WM3 A;  2MX2 A;  2LRW A;  3IVF A;  1P0R A;  4F1S A;  4X57 B;  4ANU A;  1HE8 A;  2KJR A;  2KKC A;  5G2N A;  3RUI B;  3WAO A;  1LM8 B;  3KVF B;  3GZN I;  2XBB C;  4ZYN A;  4GSW A;  4ZRK A;  1WE7 A;  3M63 B;  2FNJ B;  2ZEQ A;  2D07 B;  2K8B A;  2LZ6 A;  4K7S A;  4GOC A;  3H7P B;  4BKG A;  2KNB A;  5EDS A;  4W9I A;  1QZE A;  3TIX A;  4URK A;  2N1W A;  3RZW C;  5DPR A;  5L95 C;  3Q3F A;  1WJ6 A;  4NNJ B;  2RR9 A;  4KDI C;  1J0G A;  2OJR A;  4YL8 A;  3I3T B;  3U30 A;  4GU2 A;  4FAD A;  4HXD A;  2KHW B;  4BOZ B;  1EF5 A;  1WGD A;  3VUY A;  1RLF A;  2ZPN A;  5JH5 C;  2BGF A;  2J0M A;  4WJQ A;  2L0T A;  2KDI A;  2BWF A;  1WX9 A;  2FCQ A;  4I6P A;  4HCN B;  2D10 A;  5E6O A;  2LVP A;  1GG3 A;  3BY4 B;  2L00 B;  4KZ0 A;  4EKU A;  1WJN A;  3HK0 A;  1OEY A;  2ZVO A;  4II3 B;  4BVU C;  1KM7 A;  2BKF A;  3ML8 A;  1I42 A;  3UIP B;  2K8H A;  4TQ1 A;  3VFK A;  3KYC D;  2LGD A;  3ZDT A;  3ML9 A;  1YIW A;  3DVG Y;  2J7Q B;  2LVO A;  2M4N A;  3VTU A;  3OJ3 A;  2LXA A;  3VTV A;  1R4M I;  3OAW A;  1WJ4 A;  1YJ1 A;  2KTF A;  2JPH A;  4NQL B;  2MSE D;  2A5U A;  2I1J A;  3APF A;  3NOB A;  1CMX B;  2WYQ A;  4MH0 E;  2MLB A;  3DQV A;  2BF8 B;  2BWE S;  4IM0 A;  2KZR A;  4W9D A;  4FHK A;  1KJT A;  3JW0 X;  5JZE B;  2GBM A;  2Z0E B;  3N3K B;  4M8N A;  4IWQ A;  2ZPY A;  2BYF A;  4JQW C;  4DBG A;  1GC6 A;  2IZV B;  4GIV A;  1LQB A;  4I6N B;  1V80 A;  4IUM B;  1L2N A;  2NVU I;  4FJY A;  1PQS A;  4MM3 A;  2KXJ A;  4DK5 A;  4K1R B;  1YX6 B;  3R7Q A;  3ZNZ B;  4RM8 A;  3IG3 A;  3ZW3 A;  2IY0 B;  3MJW A;  4GXB A;  4MGZ E;  2UWQ A;  3VXW A;  3WA0 A;  3ZNI D;  4MSQ B;  4GN1 A;  4W9F A;  3ZRF A;  2NBW B;  2CKH B;  1E7V A;  3VHT C;  3QAQ A;  2KMC A;  1ZW7 A;  2AL3 A;  2M0X A;  4IG7 B;  2AWT A;  4MJS A;  4RMA A;  1NDD A;  2NS5 A;  2MQJ A;  3MTN B;  3ONS A;  3JVZ X;  3VH4 B;  1P9D U;  1YQB A;  4J6I A;  2MW5 A;  3UIN B;  3QJZ A;  5GMV A;  3PHW B;  2DX5 B;  3PZD A;  4DHJ B;  4G50 A;  3N30 A;  4WQO B;  1WXS A;  3EFU A;  1KLV A;  4A3O A;  3P2B A;  2JVC A;  4NQK E;  4KSL C;  3VQI A;  4ASW C;  3U8Z A;  3VH3 B;  2XK5 A;  2JZZ A;  2FCN A;  4LDT B;  2KN5 A;  3LDZ E;  3PLU A;  2MBO A;  1A5R A;  3V62 A;  2NR2 A;  4ANV A;  3LJ3 A;  3PLV A;  4CHK A;  2ZNV C;  1WMH A;  2CS4 A;  3D32 A;  4ICU A;  4IC7 B;  3ZIM A;  4ANW A;  4B9K A;  2KO3 A;  4G11 A;  2L0F A;  2N9P C;  3R66 C;  4AOF A;  2KQ7 A;  3A33 B;  2DYO A;  4HJK A;  4IWO A;  4MEL A;  2PEA A;  4KZC A;  2NPT A;  3S2A A;  3ZO5 B;  2PE6 B;  1MG8 A;  1V2Y A;  3HIZ A;  3QC8 B;  4BKS D;  2KAN A;  2N4F A;  4PYZ A;  3X23 A;  1XQQ A;  3SU8 X;  2KTR A;  3K9O B;  2KX3 A;  2KOX A;  3VTW A;  4KV2 A;  3BIN A;  3B08 A;  3W1S C;  5C1Z A;  2R2Q A;  4I6L B;  2JRH A;  2KDF B;  5E6N A;  2JRI B;  2O2V B;  2LWP A;  2MBH A;  4E3C A;  5L83 A;  3RD2 A;  1C3T A;  1GC7 A;  2KWU B;  2LUE A;  3PV1 A;  4W9J A;  3KH0 A;  2XK5 B;  3TBL D;  3PS6 A;  2M17 A;  2O6V D;  3HM6 X;  5G55 A;  3VUX A;  1F9J A;  4WJN A;  3A4S C;  1J8C A;  3PRE A;  5KHQ A;  1SGH A;  2LRU A;  3V6E B;  1WMH B;  2EKE C;  1R4N I;  2C5L C;  3OLM D;  4GDL B;  5BO4 B;  3L0W B;  3H7S A;  2MWS B;  3ZDM C;  1IPG A;  2ASQ A;  2MP2 A;  5IA7 A;  1WGG A;  2K25 A;  3AUL A;  2FID A;  2KC1 A;  5KHO A;  2NPT B;  1EF1 A;  5J18 A;  2NCN A;  2Z0D B;  3ALB A;  2WX1 A;  4EFO A;  1WXA A;  3IHP C;  1YD8 U;  5C23 A;  2KTR B;  3RCZ A;  2RPQ A;  1WYW B;  3AU5 A;  5CHW A;  2DAJ A;  1ZKH A;  2A4Z A;  3ECI A;  2JXX A;  2N7D A;  5J17 A;  3TCA A;  1RAX A;  3AXC A;  2J0K A;  2N7E A;  3NZU A;  2LGX A;  3CMM B;  2MBQ A;  4AWJ A;  2IYD B;  2G4S A;  2VRR B;  3PRZ A;  4HDQ A;  2O6V B;  2J0J A;  4II2 B;  1S1Q B;  1WGY A;  2DYB A;  2DZI A;  2HJ8 A;  2BKR B;  4MGI E;  2KFK A;  2MRP A;  3L17 A;  2KJ6 A;  4EOY A; 
#chains in the Genus database with same CATH topology
 4IW0 A;  3RPF C;  2FCM A;  3OG5 A;  3DPD A;  2BT6 A;  4F7Z A;  3TL5 A;  3Q6B A;  5FR3 A;  1C1Y B;  1V1O A;  1JAL A;  2DWQ A;  1YJI A;  4GLS C;  2E3T A;  2BBC A;  4JLC A;  2MA9 B;  3NVZ A;  3OJ4 B;  3QX1 A;  2JWU A;  3BVM A;  1KOT A;  1I35 A;  1MVK A;  1WGR A;  5TSS A;  1DOX A;  1SJH D;  3DVN U;  2KWC A;  4WIP A;  3J9C A;  5HKH A;  3R3M A;  3ZXV A;  2NTT A;  3AEC B;  2KFK B;  3DBL I;  1Q1O A;  4M8M A;  3BK1 A;  3C0R B;  1FO4 A;  2CR5 A;  1SE9 A;  1WR6 E;  2K6Q A;  4K7W A;  2K22 A;  1UD7 A;  3U52 E;  1Q0W B;  3B1L X;  1FNV A;  1Q10 A;  4O1N A;  5C2T B;  3W1Y A;  2KVZ A;  3AE5 B;  4AUQ C;  4XZ4 A;  3VUW A;  1WI0 A;  2V4I B;  4PYU A;  4JWU C;  3IFW B;  1V6E A;  3AI5 A;  3I57 A;  3PZ7 A;  3V61 A;  5JHB A;  2AQ2 B;  2JF5 A;  2KYW A;  1E10 A;  3N20 C;  1N63 A;  4RM9 A;  1D3Z A;  1OQR A;  2L83 A;  5H8Y E;  4YTM B;  3TSS A;  2GOW A;  3UIO B;  1IUE A;  3VDZ A;  4K7U A;  2LGY A;  4HDO A;  4CO7 A;  2WXI A;  4WWM A;  2ACZ B;  2DZK A;  1ROE A;  2O6V A;  5IP4 D;  1KFY B;  2AQ1 B;  3ZQ4 A;  4OVU A;  2IO1 B;  5D3D A;  1XXG A;  2FUH B;  5AZG A;  1T3Q A;  2Z59 B;  3ZJU A;  3CST A;  2AYO B;  2VH1 A;  2DHZ A;  2BPS A;  1AAR A;  2GLS A;  4N58 A;  3PGE A;  3DBH B;  4PS8 A;  3T8M A;  2K0P A;  5IAA C;  4AP4 C;  3RUL A;  1TS3 A;  1H8C A;  3KUC B;  1XLN A;  3PSE B;  1UZX B;  2JWZ A;  4JE3 B;  2JZP A;  1D5X C;  3A1Q B;  2IO3 B;  3DBS A;  3WAM A;  3KLS X;  1V5T A;  1V5O A;  2BB5 A;  4NJ7 A;  3FIL B;  1NBF C;  1D5M C;  4ARC A;  1OGW A;  3NY5 A;  2G4D B;  2WXF A;  3B9J A;  2E6X A;  3BYT B;  1E7U A;  4FBJ B;  4TV3 A;  1I4H A;  4ZRJ A;  3ZKJ C;  2WXH A;  1QQR A;  3E56 A;  1QIL A;  3TEW A;  5LLI A;  5JXV A;  4XX5 A;  2PVO D;  2V4L A;  2BYT A;  3AED B;  1UEL A;  4DHZ B;  2JY6 A;  4IM2 A;  1WJU A;  3N1Z C;  3EEC A;  1AW7 A;  3Q8E A;  4KGR A;  1ISN A;  3M95 A;  3CSF A;  2CHZ A;  4JL9 A;  4OVV A;  1V81 A;  2GBK A;  1WGK A;  3EHV A;  3Q3O C;  2HTH A;  4A6Q A;  4R3D A;  4EZL A;  2KQS A;  1MI0 A;  2K39 A;  4RGM A;  2JU6 X;  4DXF A;  3ZRC A;  3ZUN A;  3C8Y A;  3M3J A;  4BKS A;  1E0Z A;  2AEH A;  3ZNG C;  1B1Z A;  3SDL C;  1B9R A;  3P1M A;  1L0V B;  1LFD A;  3H7P A;  1TGZ B;  1SJE D;  1ZOY B;  1WGH A;  1NEK B;  2GBR A;  2DZM A;  3UF8 A;  1WM2 A;  3JYU A;  5CHF A;  4F8C B;  4BBN C;  1EM7 A;  1FXT B;  3AU4 A;  4B0M A;  1FRR A;  3Q3N C;  3LB8 C;  4DXA B;  2W3S A;  1GUA B;  4MGY E;  2LXC A;  2EMS A;  3RZF A;  4G0N B;  2B3A A;  4B6W A;  2KX0 A;  3NHE B;  2WX0 A;  3NZS A;  1ACC A;  1QOA A;  1WM3 A;  2MX2 A;  1P0R A;  4F1S A;  2FE8 A;  2WHI A;  3KVF B;  1EWY C;  1QKZ A;  3GZN I;  1EU4 A;  1YN5 A;  1WE7 A;  2ZEQ A;  3MJ5 A;  4BKG A;  3H7P B;  2KNB A;  4W9I A;  3AE6 B;  1D4B A;  3RZW C;  1F52 A;  4BAX A;  1PGA A;  3I3T B;  3SFD B;  3RNC C;  1WGD A;  2IDY A;  3VUY A;  5JH5 C;  4YXD B;  2J0M A;  4WJQ A;  4I6P A;  4HCN B;  4NZL B;  1GG3 A;  2N9K A;  2L00 B;  1BML C;  1WJN A;  2BW2 A;  2WXL A;  2ZVO A;  3ML8 A;  3FKY A;  3VFK A;  2LGD A;  2X38 A;  3ZDT A;  1SIJ A;  3ML9 A;  3VTU A;  2LXA A;  3VTV A;  1KRH A;  1R4M I;  1WJ4 A;  2EKI A;  2JPH A;  3APF A;  2M56 B;  4W9D A;  5BYR A;  3N3K B;  1F1H A;  3GS2 A;  1LQB A;  4FJY A;  1JCK B;  4K1R B;  3AEE B;  3IAM 1;  2IY0 B;  3W5U B;  3AM9 A;  4MSQ B;  3AEA B;  1C78 A;  2CKH B;  2D3A A;  4IG7 B;  3Q2A C;  2WDQ B;  2MW5 A;  2RMM A;  2DX5 B;  1KF6 B;  4WUR A;  4WQO B;  1WXS A;  2KDM A;  3U8Z A;  1ZDX A;  3VH3 B;  2XK5 A;  5G5G A;  3ZYY X;  3PLU A;  4XDD A;  2INP E;  3C19 A;  2MBO A;  1D5Z C;  3FAH A;  3PLV A;  3Q14 C;  1WMH A;  3Q8C A;  4ANW A;  1T0R C;  2L0F A;  1UUP A;  4KZC A;  3ZO5 B;  1V2Y A;  3KQ4 A;  3QC8 B;  2KAN A;  2N4F A;  4PYZ A;  3SU8 X;  5IN7 A;  2KOX A;  3VTW A;  3B08 A;  4I6L B;  5BMH A;  1FRD A;  2JRI B;  5AUK A;  4E3C A;  2KWU B;  2B76 B;  3DWM A;  3KH0 A;  1OFF A;  2XK5 B;  1FCC C;  4L23 A;  1TS2 A;  3TBL D;  2M17 A;  1F9J A;  4A55 A;  5KHQ A;  1TIF A;  1YQ3 B;  1WMH B;  2EKE C;  1R4N I;  3N1X C;  2C5L C;  1IPG A;  4WQM A;  2ASQ A;  1WGG A;  3AEF B;  2MHJ A;  4LNK A;  1EF1 A;  2OED A;  3ALB A;  1WXA A;  1SF0 A;  4RH6 A;  2VH2 A;  1WYW B;  3DHG C;  3AU5 A;  3W2D A;  4RGT A;  2J0K A;  2OJW A;  2LGX A;  3EGR A;  4HDQ A;  4C7Y A;  2WS3 B;  1WGY A;  2DYB A;  3UGB B;  2KT7 A;  3IBE A;  2H88 B;  4JIO U;  2W9N A;  3PO0 A;  4IWP A;  2BQQ A;  3T9L A;  4ZRP A;  2QCZ A;  5AZH A;  4HKQ A;  1EWC A;  1JRU A;  2IBI B;  4K3B A;  5EE1 A;  1IGD A;  3DBL B;  2L32 A;  1OEY J;  2PIA A;  1P98 A;  1A70 A;  3APD A;  1P3Q U;  1V49 A;  2WNM A;  4FHJ A;  3MHZ A;  2AX5 A;  2RSU A;  3CIR B;  2C7N B;  2RDB C;  3BYY B;  1Z2M A;  2N9E B;  2O2V A;  2LI5 A;  1SBB B;  2NMQ A;  2MJE A;  4KDL B;  2AL6 A;  2N7J A;  1XT9 B;  1M4V A;  4KSK C;  3K9P B;  5IOI A;  4KVG B;  3NRZ A;  4UDU C;  2LHD A;  3MHS D;  4GDL A;  3Q3J A;  2MBB B;  2REX A;  4IDI A;  4M0W B;  3V60 A;  2L7R A;  4P6V F;  4C4V A;  2K5P A;  2LJ5 A;  4RGN A;  1WR1 A;  4RFB A;  5DPT A;  3VRA B;  3PZ8 A;  1L4D B;  2H89 B;  1JRO A;  2Y5B B;  4ICV A;  4XGA B;  1ZXH A;  3PRP B;  2JSV X;  2GI9 A;  1V97 A;  1WZ0 A;  4FUL A;  4US8 A;  5IKC M;  3ZTD A;  5CTR C;  3ZNH B;  3QIJ A;  2XNA C;  3X0W A;  1N5W A;  1YN3 A;  4BFR A;  3UI3 A;  2CHW A;  3BZD B;  1HA5 A;  1WXV A;  5D6J B;  4LCD E;  4C4V B;  2LUM A;  4N59 A;  4C80 A;  4QAY A;  4LJP B;  2CU1 A;  3QK0 A;  3RNE C;  4W9C A;  3I63 C;  1GOZ A;  2BYV E;  4L1B A;  2LHE A;  3V3X A;  4W9K A;  3VR8 B;  5D7G A;  2PTL A;  4GB9 A;  3R8B A;  4HKZ E;  1TS4 A;  2I38 A;  2PLP A;  3B2F A;  3VVW B;  1WX8 A;  2V3P A;  3WCQ A;  3ZJV A;  1C4A A;  2ZW1 A;  1FMA D;  3P4Q B;  1FFV A;  1TKE A;  3PTF C;  1PGX A;  1WRI A;  1SSN A;  5GXG B;  1FNU A;  5LXI B;  2QC8 A;  4W9G A;  1JWU D;  1IBX A;  2KK8 A;  4K81 A;  4M02 A;  3L10 B;  4LJO B;  1RRB A;  4NAM A;  3ZGZ A;  3TJP A;  4DDI D;  2D11 A;  1TT5 B;  4XWW A;  3CF6 E;  1X1M A;  3DOW A;  1EUV B;  4OW0 A;  3APC A;  2G3Q B;  2GBJ A;  5HI1 A;  3SFE B;  3HUI A;  1ZGU B;  3SR6 A;  2L76 A;  1C76 A;  1MPE A;  2FUG 1;  4PS3 A;  3AH7 A;  3Q8F A;  3BII D;  1IBX B;  2D3G A;  4A90 A;  5CX3 A;  3KWL A;  4DHZ E;  2ICI A;  3KWV A;  1N5X A;  4HK2 A;  4P1B C;  3LYY A;  3TUO A;  3NVV A;  1SIF A;  2C60 A;  2YLM A;  3V6C B;  2J52 A;  2K3U A;  3ENE A;  1MFW A;  3E9S A;  2KJH B;  1PGB A;  3A1Q A;  2PPH A;  2IO2 B;  4KKJ A;  4MJS B;  3GZN B;  2V0G A;  4C7Z A;  4YSZ B;  3AE1 B;  1DGJ A;  3EA6 A;  2OHF A;  4XYC A;  3NUH B;  3FIL A;  2VZK D;  1CK1 A;  2W3R A;  4ANU A;  4WH4 A;  2KKC A;  3RUI B;  4ZYN A;  3R2I A;  4ARI A;  1AN8 A;  4DQO C;  4US9 A;  2FNJ B;  4BOS C;  1TZO A;  2LZ6 A;  4HRS A;  2IGD A;  4YL8 A;  4YSY B;  4FAD A;  2JXT A;  1EF5 A;  1DOI A;  2QSD A;  2BWF A;  1T0Q C;  1WX9 A;  3RFZ B;  2LVP A;  3BY4 B;  1R4M B;  4MT5 A;  2LFI A;  4EKU A;  4YT0 B;  3HK0 A;  1FCL A;  4BVU C;  1I42 A;  3UIP B;  3KYC D;  3DVG Y;  1D6E C;  2M4N A;  4RF0 A;  1AYF A;  3P42 A;  3ZXR A;  1VRA B;  3OAW A;  1YJ1 A;  4NQL B;  2A5U A;  2I1J A;  2N0S B;  2WYQ A;  3W9C B;  2BWE S;  2KZR A;  1KJT A;  3JW0 X;  2EEL A;  2TSS A;  4IWQ A;  3AN1 A;  4DBG A;  4IUM B;  2R61 A;  1PQS A;  2KXJ A;  4DK5 A;  3BVG A;  3GP7 A;  3R7Q A;  3ZNZ B;  1PFD A;  3MJW A;  1IGC A;  1WSP A;  2UWQ A;  3WA0 A;  1TY0 A;  3ZNI D;  4W9F A;  2IPK D;  2NBW B;  4IOI E;  4RMA A;  1FEH A;  1N6Z A;  1WWT A;  3FC4 A;  3JVZ X;  1P9D U;  3UIN B;  3QJZ A;  1YN4 A;  3NVW A;  1HXY D;  3PZD A;  1HTO A;  4G50 A;  2GRI A;  1KLG D;  3EFU A;  3RNA C;  4H2A A;  4NQK E;  4USA A;  1L6U A;  4KSL C;  3VQI A;  2ONQ A;  3L4P A;  3MC9 A;  1UGJ A;  1PDX A;  3LDZ E;  1VJK A;  2NR2 A;  3LJ3 A;  2ZNV C;  2CS4 A;  2W54 A;  1NEN B;  2IJ0 A;  1T6B X;  2KQ7 A;  3A33 B;  2MEK A;  2NPT A;  1VLB A;  3HIZ A;  5FKA C;  3NJT A;  3K9O B;  2KX3 A;  3W1S C;  5C1Z A;  2KDF B;  1FM0 D;  1R4N B;  3RD2 A;  1GC7 A;  2LUE A;  1NVI D;  5G55 A;  3HM6 X;  3VUX A;  1XLO A;  2WXQ A;  1J8C A;  3PRE A;  2JYE A;  2D3B A;  1ZDV A;  3H7S A;  2MWS B;  3ZDM C;  5IA7 A;  5KHO A;  2NPT B;  1QOG A;  2NCN A;  5BMI A;  3IHP C;  4LNN A;  3AE9 B;  5C23 A;  2VZK B;  3RCZ A;  2RPQ A;  4TSS A;  5CHW A;  1XLQ A;  2A4Z A;  2N7D A;  3CMM B;  4AWJ A;  3PRZ A;  4CQN A;  1N62 A;  2J0J A;  3BVZ A;  1QT9 A;  2LEK A;  3BWU D;  2BKR B;  2MRP A;  3L17 A;  2SAK A;  1I4P A;  4AS1 A;  4ITK A;  1SB3 C;  4EOY A;  2MJ3 A;  3L54 A;  5JHA A;  3L13 A;  1K50 A;  3P4P B;  1NYR A;  2SEB D;  1BT0 A;  2ZZP B;  3DWG C;  3KYD D;  4WWO A;  2GMI C;  1WRD B;  1UNS A;  1SE3 A;  3AE2 B;  4TKN A;  2KWD A;  4B0E A;  1GB4 A;  3UQA A;  4A9A A;  3RI7 C;  3Q69 A;  4NJC A;  2CHX A;  4M01 A;  2IGH A;  2Y3A A;  4E74 A;  3GOE A;  1L7Y A;  4G3X B;  4NAW A;  5AEK B;  1IYF A;  4MAC A;  2BYE A;  1IP9 A;  3EC8 A;  3RYT A;  2C7H A;  1WIA A;  1AWD A;  4HWI B;  4D2K A;  1BUI C;  4EEW A;  3RNF C;  4RF1 A;  1VZ6 A;  2N9X A;  3NS8 A;  2EMT A;  2G45 B;  2WXG A;  1WH3 A;  4OZC A;  3TEZ A;  2KD0 A;  3QA8 A;  3KUD B;  1GNU A;  4NAW B;  4HJG E;  2KDB A;  3DBR I;  1OTR B;  4FLH A;  3ABV B;  4OZA A;  3U7D A;  3DVN V;  4PS7 A;  1JWS D;  4N9F 4;  4BKT A;  2KVR A;  2KQ4 X;  2WP9 B;  1XCQ L;  3R2T A;  4NPN A;  2IO0 B;  1C4C A;  1QF6 A;  1WE6 A;  2DLB A;  3L16 A;  4WJO A;  3B0A A;  4ZDV A;  3SD5 A;  4GDK B;  1Z5S B;  2FAZ A;  5AZF A;  4C56 C;  1QOF A;  1L0X B;  2MH7 A;  2RD0 A;  2KMA A;  5D94 A;  1P1A A;  4DWF A;  1P7E A;  2D2Q A;  2LMC A;  3M62 B;  3O65 B;  1XLP A;  2L3Z A;  2MCN B;  3I5J C;  4BBN F;  1C79 A;  1L0Y B;  4ANX A;  3MP9 A;  2DYM A;  1K8R B;  1UH6 A;  4FJZ A;  4L2Y A;  3RNB C;  1E8Y A;  1XF5 L;  3H6N A;  2LGI A;  4A20 A;  2DEN B;  3PVL A;  4WWP A;  2FCS A;  4KIK A;  1J19 A;  3ZVV A;  2XEW A;  3HM3 A;  1GB1 A;  1UBQ A;  1KLU D;  1OQY A;  1I4Q A;  5E6J A;  4FN2 A;  4XWT A;  4P7I A;  1JQ4 A;  1EO6 A;  4A3P A;  2K8C A;  5G5H A;  3W1S A;  1JWA D;  2ZVN A;  2YVC A;  2L8J A;  1Y8R C;  4Q2J A;  4DHJ D;  2BS3 B;  2PJH A;  1RWS A;  4M0W A;  4EUT A;  2OOB B;  1WF9 A;  1E6E B;  5LNK 1;  2R2O A;  4YTN B;  1HTQ A;  1WY8 A;  2C9W B;  4B95 A;  4AQ7 A;  4KIK B;  2ZNV B;  2G1E A;  3VRB B;  2PKO A;  1LXD A;  4WWN A;  3WAL A;  4HVB A;  1E8X A;  3TMP B;  3ZLZ A;  4J3O D;  4RGO S;  1U4A A;  4ACF A;  3DDC B;  3HVZ A;  2N9L A;  3WIM A;  3AV8 A;  2UU7 A;  4WAA A;  3ETR A;  4JPS A;  3VR9 B;  2JYT A;  3L08 A;  4P16 A;  3PT2 B;  2FBW B;  2HD5 B;  1J7A A;  4W9L A;  1TKG A;  2M19 A;  2MBE A;  1E5W A;  2NBV B;  3PPA A;  1K52 A;  4CYE A;  1YOV B;  3DCG A;  1SXT A;  2BB6 A;  1GPX A;  4PK1 A;  4OVZ A;  1T5X D;  2BS2 B;  3H9D A;  3A4R A;  3N1Y C;  2ZCB A;  3SHQ A;  1LO5 D;  2LRW A;  4X57 B;  5G2N A;  3WAO A;  1LM8 B;  3RN9 C;  4ZRK A;  3DHI C;  1TY2 A;  3M63 B;  2K8B A;  4BZA A;  4K7S A;  4GOC A;  2J42 A;  4URK A;  2Q5W D;  5L95 C;  3ZJT A;  1J0G A;  2OJR A;  4GU2 A;  3EFC A;  4BOZ B;  1RLF A;  2L0T A;  2KDI A;  1ZP0 B;  2D5G A;  5E6O A;  4KZ0 A;  1I7H A;  1E9M A;  1OEY A;  4II3 B;  3BK2 A;  1KM7 A;  2K8H A;  4TQ1 A;  2M0A A;  1QOB A;  3OJ3 A;  1HZ6 A;  2WXK A;  3O13 A;  2KTF A;  5FK9 C;  3NOB A;  2V3N A;  1CMX B;  2L52 A;  3DQV A;  2XN9 C;  4FHK A;  5JZE B;  1UWM A;  2Z0E B;  5MPO A;  2IZV B;  4GIV A;  4LTU A;  4I6N B;  1V80 A;  2MJD A;  1L2N A;  2NVU I;  3TEY A;  2INN E;  4LNI A;  1F2R I;  4MM3 A;  1RYJ A;  3IT4 B;  2KN4 A;  2AQ3 B;  4RM8 A;  4TMA B;  3ZW3 A;  4GXB A;  3VXW A;  1L5P A;  4KKI A;  3ZRF A;  3QAQ A;  1ZW7 A;  2AL3 A;  2M0X A;  4MJS A;  1F77 A;  1NDD A;  2NS5 A;  2DBY A;  3ONS A;  3MTN B;  1JWB D;  2QEJ C;  4J6I A;  5GMV A;  4S17 A;  3Q3M C;  4DHJ B;  1KLV A;  1VZ7 A;  4A3O A;  2JZZ A;  4MM3 B;  5BYQ A;  2G9H D;  1EU3 A;  4ZRQ A;  4CHK A;  1MHX A;  4ICU A;  4IC7 B;  3ZIM A;  4OZB A;  4B9K A;  2QIL A;  2KO3 A;  3OWE B;  1CJE A;  2N9P C;  3U7Z A;  3R66 C;  4AOF A;  4HJK A;  4MEL A;  2PEA A;  2PE6 B;  4BKS D;  2KTR A;  4ZOH C;  1L4Z B;  2GB1 A;  2KAC A;  2WXM A;  4YSX B;  1FXA A;  2R2Q A;  2JRH A;  2LWP A;  2MBH A;  1Y56 A;  1TYG B;  5L83 A;  3PV1 A;  1V8C A;  3PS6 A;  1RM6 C;  1PYW D;  1SGH A;  2LRU A;  3V6E B;  2Z8L A;  3B2G A;  3OLM D;  2HJ1 A;  2MP2 A;  3AUL A;  2FID A;  4LNO A;  1CQV A;  2WDV B;  2IGG A;  1YD8 U;  2KTR B;  1VR9 A;  1I4G A;  1ZKH A;  3ECI A;  2JXX A;  1YJJ A;  5J17 A;  1RAX A;  3AXC A;  3NZU A;  2N7E A;  2HTM E;  2IYD B;  2W82 A;  2O6V B;  4II2 B;  1S1Q B;  2DZI A;  2HJ8 A;  1SEB D;  1VZ8 A;  4PT5 A;  2PMV A;  2Y5C A;  1V86 A;  2MP2 B;  1RFA A;  3GE8 C;  2JQR B;  4MEM A;  4TQ0 A;  1I4R A;  1DOY A;  2RDH A;  4NY0 A;  1E8W A;  1G6J A;  4HEA 1;  1F0Z A;  2KDE B;  3QQ8 B;  4MDK E;  4JGH B;  3JSV A;  4GGQ A;  1TZ1 A;  1K51 A;  3NS1 A;  5HHD G;  3WAP A;  3PRM B;  2RPV A;  5EE3 A;  3A9K A;  1SE4 A;  2K9X A;  2LAS A;  1T0Y A;  5E6P A;  3QAR A;  2L1A A;  4HRO A;  5T8I A;  1PUT A;  3Q8B A;  2PE9 A;  2ZW0 A;  1WXQ A;  2NTS A;  2JT4 B;  1F2R C;  4DDG D;  1FPY A;  3VAW A;  1TBE A;  3GE3 C;  4ZRI A;  1FXI A;  2WGS A;  1OQQ A;  3RT3 B;  3JSV B;  3DBR B;  1Q5W B;  5BMG A;  2D3C A;  1E8Z A;  3A9K B;  3HVD A;  3DVG X;  1VCB A;  1H4R A;  3R7R A;  3AE7 B;  4MSM B;  2V1Y A;  1V9J A;  2WU2 B;  2RDG A;  4LNF A;  5I4D A;  1XCT L;  4KX6 B;  1I4X A;  1M94 A;  2W55 A;  1JML A;  5AUI A;  1VD2 A;  2HE7 A;  1ZXI A;  4FA6 A;  3URY A;  4DXG A;  2Y5P A;  3UQB A;  1E90 A;  1NI2 A;  1HQR D;  1YMH E;  2M1M A;  3SEB A;  2IY1 B;  3Q8A A;  4HPL B;  4E71 A;  1XD3 B;  1WXM A;  1J7C A;  5J2R A;  3NG0 A;  3AE3 B;  3KUZ A;  5D2M B;  3PHX B;  2L05 A;  2KC2 A;  5BYS A;  5CHV C;  4NJ6 A;  2NBU A;  2UYZ B;  2WWZ A;  2RGF A;  2LJI A;  3QHT A;  4RCO A;  1KTK A;  3DBH I;  5DPS A;  2DZJ A;  1FFU A;  4MGK E;  2ZCC A;  2JUO A;  3QWZ B;  1KH0 A;  3P4S B;  3WAN A;  1GJZ A;  3IT6 B;  4EE2 A;  4EZJ A;  4C00 A;  4TUU A;  3W5V B;  4AJY B;  5HFY A;  3MFG A;  1K53 A;  2K6D B;  1TS5 A;  5DPW A;  1SE2 A;  1STE A;  1YX5 B;  4OHJ A;  4YTP B;  2WDT B;  4W9E A;  2QMT A;  2FIF A;  2N1V A;  3N32 A;  2ON8 A;  4XC2 A;  2J4X A;  4WJP A;  2HDE A;  2KWV B;  4W9H A;  3U4E G;  4M00 A;  2JZ3 B;  2KLC A;  4EZK A;  1WZ3 A;  3A9J A;  5FR6 A;  1WX7 A;  3KW5 B;  1UGM A;  2WQY B;  3H8H A;  1ZUD 2;  4LDT D;  4NNJ B;  4A8X C;  1HZ5 A;  2LVQ A;  2QJL A;  4GMV A;  1WFY A;  2ZJD A;  4HPM B;  2K1F A;  4IM3 A;  4MH8 A;  1XO3 A;  1DYQ A;  2M8S A;  2QDF A;  5TR5 A;  5EE0 A;  1UBI A;  2C7M B;  4ZHO A;  4JWS C;  4XE0 A;  2GBN A;  4HCP B;  4JX1 C;  3HHM A;  1P7F A;  3A9J B;  4GDK A;  3RMK C;  4HLE A;  1S3S G;  1MG4 A;  3QCA A;  1HEZ E;  2DAF A;  1ET6 A;  2I1K A;  3NZ3 A;  4WAF A;  1TTN A;  1N60 A;  4AJW A;  3AEB B;  3IXS A;  3ZTC A;  1NYQ A;  2LGS A;  3NVY A;  1MJD A;  2QIE B;  2BS4 B;  2LD9 A;  2KFJ A;  3N9Y C;  3P4R B;  2KLG A;  2QHO A;  4FJV B;  1C9F A;  3H1U A;  5C3J B;  1N61 A;  2V3S A;  3AMZ A;  1V1P A;  3EUB 2;  5DCN A;  3IVF A;  1HE8 A;  2KJR A;  2XBB C;  1BXT A;  4GSW A;  4FXC A;  5EE9 A;  2D07 B;  5EDS A;  3TEX A;  1QZE A;  3I9V 1;  3TIX A;  2N1W A;  5DPR A;  2PW9 A;  3Q3F A;  1WJ6 A;  2RR9 A;  4KDI C;  3U30 A;  1ENF A;  2WU5 B;  4HXD A;  2IND C;  2KHW B;  3MC0 B;  1GAQ B;  3AE4 B;  2ZPN A;  2BGF A;  1MHH E;  1V1P B;  3AE8 B;  2FCQ A;  2D10 A;  1XEE A;  3LXF A;  1UWX A;  2BKF A;  1VDV A;  4P1C C;  4RNA A;  1TJE A;  1YIW A;  1E7P B;  2J7Q B;  2LVO A;  1ZPS A;  2KMM A;  3GB1 A;  1JW9 D;  3AEG B;  2MSE D;  5D3I B;  4MH0 E;  2MLB A;  4IM0 A;  2BF8 B;  4K3C A;  3AB5 A;  1UF0 A;  1T0S C;  2GBM A;  1C77 A;  4M8N A;  2ZPY A;  2BYF A;  4JQW C;  1GC6 A;  1ET9 A;  2CJO A;  5HG2 A;  4HPP A;  3RNG C;  1LGR A;  1YX6 B;  3IG3 A;  4MGZ E;  3V05 A;  2WXP A;  2CU3 A;  2YEP F;  1JRP A;  4GN1 A;  2DNF A;  2JX5 A;  4LLG M;  1E7V A;  1YNT E;  3VHT C;  2KMC A;  2AWT A;  1WYG A;  2MQJ A;  2BVC A;  1TKY A;  3VH4 B;  1YQB A;  4KGS A;  3PHW B;  3N30 A;  2CJN A;  4ZYS A;  1ZE3 D;  3P2B A;  2JVC A;  3CWI A;  4ASW C;  4LDT B;  2FCN A;  2KN5 A;  4LK0 M;  1A5R A;  3V62 A;  2BTE A;  4ANV A;  3D32 A;  4IKG A;  1NI3 A;  4S0R A;  4REZ A;  2J53 A;  2V9H A;  4G11 A;  3DHH C;  2DYO A;  4IWO A;  4YWG G;  3S2A A;  2X8X X;  1JWM D;  1MG8 A;  1QLB B;  3X23 A;  1XQQ A;  3T3O A;  2WXJ A;  3BIN A;  4KV2 A;  5E6N A;  2O2V B;  4N6E B;  1C3T A;  1C4P A;  2KAJ A;  4W9J A;  3U2S C;  3T3N A;  2WLB A;  1L6V A;  2O6V D;  2YEP B;  4WJN A;  5H92 C;  3A4S C;  2WXN A;  2WDR B;  4GDL B;  5BO4 B;  3L0W B;  1FNW A;  2K25 A;  2KC1 A;  2INC C;  4KGT A;  5J18 A;  2Z0D B;  1CZP A;  4EFO A;  2WX1 A;  4ZHP A;  5IO9 A;  1J7B A;  1R7S A;  2WXO A;  3IAS 1;  3HRD D;  2DAJ A;  4XDC A;  3P63 A;  3TCA A;  2PVG C;  1ESF A;  2MBQ A;  2VRR B;  2G4S A;  1FIQ A;  2WXR A;  2I2Y A;  3MC8 A;  1YQ4 B;  4MGI E;  1FD6 A;  2KFK A;  1RFK A;  2KJ6 A;  5LXH A; 
#chains in the Genus database with same CATH homology
 3L54 A;  3IBE A;  4IW0 A;  3UGB B;  5JHA A;  4JIO U;  2FCM A;  3L13 A;  2W9N A;  3DPD A;  4IWP A;  4F7Z A;  3T9L A;  1V86 A;  1BT0 A;  2MP2 B;  3TL5 A;  2ZZP B;  1RFA A;  3KYD D;  1C1Y B;  5AZH A;  4MEM A;  4WWO A;  4TQ0 A;  4JLC A;  2MA9 B;  1JRU A;  2GMI C;  1WRD B;  2IBI B;  4NY0 A;  1E8W A;  3OJ4 B;  3QX1 A;  1G6J A;  4TKN A;  2KDE B;  3QQ8 B;  1KOT A;  4MDK E;  4JGH B;  1I35 A;  3JSV A;  3UQA A;  1WGR A;  1OEY J;  4GGQ A;  2CHX A;  1TZ1 A;  3DVN U;  2KWC A;  3WAP A;  3PRM B;  1P98 A;  4E74 A;  3R3M A;  5HKH A;  3A9K A;  3GOE A;  1L7Y A;  4G3X B;  4NAW A;  5AEK B;  1IYF A;  2KFK B;  2LAS A;  1T0Y A;  3DBL I;  1Q1O A;  2BYE A;  4M8M A;  3C0R B;  3APD A;  5E6P A;  2CR5 A;  1P3Q U;  1V49 A;  3EC8 A;  1SE9 A;  3QAR A;  1IP9 A;  3RYT A;  1WR6 E;  2K6Q A;  4FHJ A;  2PE9 A;  4K7W A;  2RSU A;  2C7H A;  1UD7 A;  2C7N B;  2JT4 B;  1Q0W B;  1WIA A;  4DDG D;  4HWI B;  3B1L X;  1Z2M A;  2N9E B;  3VAW A;  2O2V A;  1TBE A;  2LI5 A;  4ZRI A;  4EEW A;  4KDL B;  2AL6 A;  3W1Y A;  4AUQ C;  1XT9 B;  3RT3 B;  4XZ4 A;  2N9X A;  3JSV B;  1Q5W B;  1WI0 A;  2EMT A;  3NS8 A;  3VUW A;  2G45 B;  4PYU A;  1WH3 A;  1E8Z A;  3IFW B;  1V6E A;  4KSK C;  3K9P B;  2KD0 A;  3AI5 A;  3QA8 A;  4KVG B;  3A9K B;  3V61 A;  3MHS D;  5JHB A;  4GDL A;  3KUD B;  1GNU A;  2JF5 A;  3DVG X;  1VCB A;  4NAW B;  1H4R A;  2KDB A;  3R7R A;  3Q3J A;  4MSM B;  2V1Y A;  3DBR I;  2MBB B;  2REX A;  4RM9 A;  1D3Z A;  1V9J A;  4M0W B;  1OTR B;  3V60 A;  2L7R A;  4FLH A;  2GOW A;  1M94 A;  3UIO B;  1VD2 A;  3VDZ A;  4K7U A;  3U7D A;  2LGY A;  2LJ5 A;  3DVN V;  4PS7 A;  2HE7 A;  4HDO A;  4CO7 A;  1WR1 A;  5DPT A;  4FA6 A;  3UQB A;  2DZK A;  1E90 A;  4N9F 4;  4BKT A;  2KVR A;  2O6V A;  1NI2 A;  2Y5B B;  4ICV A;  2M1M A;  3PRP B;  4NPN A;  2IY1 B;  4OVU A;  2IO0 B;  4HPL B;  2IO1 B;  1WZ0 A;  4FUL A;  4E71 A;  3ZTD A;  5CTR C;  2FUH B;  3ZNH B;  1XD3 B;  1WE6 A;  1WXM A;  3L16 A;  3QIJ A;  3B0A A;  4WJO A;  5AZG A;  3X0W A;  4ZDV A;  5J2R A;  4BFR A;  2Z59 B;  3CST A;  2AYO B;  2DHZ A;  3SD5 A;  2BPS A;  2CHW A;  4GDK B;  1Z5S B;  1AAR A;  2FAZ A;  5AZF A;  3PGE A;  3KUZ A;  4PS8 A;  3T8M A;  5IAA C;  1WXV A;  5D6J B;  5D2M B;  3PHX B;  4LCD E;  2RD0 A;  2L05 A;  2KMA A;  5D94 A;  1P1A A;  3RUL A;  4AP4 C;  2KC2 A;  3KUC B;  4DWF A;  1H8C A;  5CHV C;  4LJP B;  2CU1 A;  2D2Q A;  3QK0 A;  4NJ6 A;  2NBU A;  2UYZ B;  3M62 B;  3PSE B;  1UZX B;  2RGF A;  2JWZ A;  2WWZ A;  4W9C A;  3O65 B;  3QHT A;  2L3Z A;  2BYV E;  3DBH I;  5DPS A;  2MCN B;  4BBN F;  3A1Q B;  2IO3 B;  2DZJ A;  4MGK E;  4ANX A;  2ZCC A;  2JUO A;  3DBS A;  3QWZ B;  3WAM A;  4W9K A;  2DYM A;  1K8R B;  3WAN A;  1UH6 A;  5D7G A;  1GJZ A;  4GB9 A;  4FJZ A;  1V5T A;  1E8Y A;  4EZJ A;  1V5O A;  4TUU A;  3H6N A;  3VVW B;  4AJY B;  4NJ7 A;  4A20 A;  2K6D B;  2DEN B;  1NBF C;  3PVL A;  1WX8 A;  4WWP A;  5DPW A;  1OGW A;  2FCS A;  1YX5 B;  3NY5 A;  4KIK A;  2G4D B;  1J19 A;  2WDT B;  3ZVV A;  4W9E A;  2XEW A;  3HM3 A;  3PTF C;  2FIF A;  1UBQ A;  2N1V A;  4LDT D;  1OQY A;  3N32 A;  1E7U A;  4FBJ B;  4FN2 A;  4XC2 A;  5LXH A;  4P7I A;  4TV3 A;  4WJP A;  4BOS C;  4ZRJ A;  3ZKJ C;  1EO6 A;  2KWV B;  4W9H A;  4A3P A;  2K8C A;  5LXI B;  2JZ3 B;  3W1S A;  2ZVN A;  5LLI A;  2KLC A;  2YVC A;  4XX5 A;  2V4L A;  4EZK A;  1WZ3 A;  1UEL A;  4W9G A;  2L8J A;  3A9J A;  1Y8R C;  5FR6 A;  1WX7 A;  2KK8 A;  3KW5 B;  4K81 A;  4DHJ D;  2JY6 A;  1UGM A;  2PJH A;  4IM2 A;  1WJU A;  4DHZ B;  3L10 B;  4LJO B;  1RRB A;  4EUT A;  2OOB B;  1WF9 A;  3TJP A;  4DDI D;  3EEC A;  2D11 A;  1ISN A;  2R2O A;  3M95 A;  1WY8 A;  3CF6 E;  2C9W B;  2CHZ A;  3CSF A;  1X1M A;  3DOW A;  4JL9 A;  1EUV B;  2LVQ A;  4KIK B;  4B95 A;  2ZNV B;  3APC A;  4GMV A;  1V81 A;  2G3Q B;  4OVV A;  2GBK A;  2GBJ A;  1WFY A;  2ZJD A;  3EHV A;  4HPM B;  2HTH A;  1LXD A;  2K1F A;  4IM3 A;  4WWN A;  3WAL A;  4HVB A;  1E8X A;  1ZGU B;  3TMP B;  2M8S A;  3ZLZ A;  2L76 A;  5TR5 A;  1UBI A;  2C7M B;  4PS3 A;  4EZL A;  2KQS A;  1U4A A;  2GBN A;  2K39 A;  3DDC B;  4HCP B;  3HHM A;  3WIM A;  3ZRC A;  3ZUN A;  3A9J B;  3M3J A;  4GDK A;  4WAA A;  2D3G A;  1S3S G;  4BKS A;  4HLE A;  2AEH A;  3QCA A;  3ZNG C;  2DAF A;  5CX3 A;  4DHZ E;  3L08 A;  3PT2 B;  3SDL C;  4HK2 A;  2I1K A;  2HD5 B;  1LFD A;  1TTN A;  3H7P A;  4AJW A;  1SIF A;  1TGZ B;  2C60 A;  2YLM A;  4W9L A;  3V6C B;  1WGH A;  3ENE A;  2MBE A;  3ZTC A;  1E5W A;  2GBR A;  2DZM A;  3UF8 A;  1WM2 A;  3JYU A;  2KJH B;  5CHF A;  2NBV B;  3PPA A;  4F8C B;  3A1Q A;  4BBN C;  2LD9 A;  1FXT B;  3AU4 A;  3DCG A;  4CYE A;  2KFJ A;  2PPH A;  2IO2 B;  4DXA B;  1GUA B;  4MGY E;  2LXC A;  4MJS B;  2KLG A;  2QHO A;  4FJV B;  2EMS A;  3RZF A;  3H1U A;  4G0N B;  3H9D A;  2B3A A;  3A4R A;  4B6W A;  2KX0 A;  2ZCB A;  2V3S A;  3NHE B;  2WX0 A;  5DCN A;  3NZS A;  3SHQ A;  1WM3 A;  2MX2 A;  2LRW A;  3IVF A;  1P0R A;  4F1S A;  4X57 B;  4ANU A;  1HE8 A;  2KJR A;  2KKC A;  5G2N A;  3RUI B;  3WAO A;  1LM8 B;  3KVF B;  3GZN I;  2XBB C;  4ZYN A;  4GSW A;  4ZRK A;  1WE7 A;  3M63 B;  2FNJ B;  2ZEQ A;  2D07 B;  2K8B A;  2LZ6 A;  4K7S A;  4GOC A;  3H7P B;  4BKG A;  2KNB A;  5EDS A;  4W9I A;  1QZE A;  3TIX A;  4URK A;  2N1W A;  3RZW C;  5DPR A;  5L95 C;  3Q3F A;  1WJ6 A;  4NNJ B;  2RR9 A;  4KDI C;  1J0G A;  2OJR A;  4YL8 A;  3I3T B;  3U30 A;  4GU2 A;  4FAD A;  4HXD A;  2KHW B;  4BOZ B;  1EF5 A;  1WGD A;  3VUY A;  1RLF A;  2ZPN A;  5JH5 C;  2BGF A;  2J0M A;  4WJQ A;  2L0T A;  2KDI A;  2BWF A;  1WX9 A;  2FCQ A;  4I6P A;  4HCN B;  2D10 A;  5E6O A;  2LVP A;  1GG3 A;  3BY4 B;  2L00 B;  4KZ0 A;  4EKU A;  1WJN A;  3HK0 A;  1OEY A;  2ZVO A;  4II3 B;  4BVU C;  1KM7 A;  2BKF A;  3ML8 A;  1I42 A;  3UIP B;  2K8H A;  4TQ1 A;  3VFK A;  3KYC D;  2LGD A;  3ZDT A;  3ML9 A;  1YIW A;  3DVG Y;  2J7Q B;  2LVO A;  2M4N A;  3VTU A;  3OJ3 A;  2LXA A;  3VTV A;  1R4M I;  3OAW A;  1WJ4 A;  1YJ1 A;  2KTF A;  2JPH A;  4NQL B;  2MSE D;  2A5U A;  2I1J A;  3APF A;  3NOB A;  1CMX B;  2WYQ A;  4MH0 E;  2MLB A;  3DQV A;  2BF8 B;  2BWE S;  4IM0 A;  2KZR A;  4W9D A;  4FHK A;  1KJT A;  3JW0 X;  5JZE B;  2GBM A;  2Z0E B;  3N3K B;  4M8N A;  4IWQ A;  2ZPY A;  2BYF A;  4JQW C;  4DBG A;  1GC6 A;  2IZV B;  4GIV A;  1LQB A;  4I6N B;  1V80 A;  4IUM B;  1L2N A;  2NVU I;  4FJY A;  1PQS A;  4MM3 A;  2KXJ A;  4DK5 A;  4K1R B;  1YX6 B;  3R7Q A;  3ZNZ B;  4RM8 A;  3IG3 A;  3ZW3 A;  2IY0 B;  3MJW A;  4GXB A;  4MGZ E;  2UWQ A;  3VXW A;  3WA0 A;  3ZNI D;  4MSQ B;  4GN1 A;  4W9F A;  3ZRF A;  2NBW B;  2CKH B;  1E7V A;  3VHT C;  3QAQ A;  2KMC A;  1ZW7 A;  2AL3 A;  2M0X A;  4IG7 B;  2AWT A;  4MJS A;  4RMA A;  1NDD A;  2NS5 A;  2MQJ A;  3MTN B;  3ONS A;  3JVZ X;  3VH4 B;  1P9D U;  1YQB A;  4J6I A;  2MW5 A;  3UIN B;  3QJZ A;  5GMV A;  3PHW B;  2DX5 B;  3PZD A;  4DHJ B;  4G50 A;  3N30 A;  4WQO B;  1WXS A;  3EFU A;  1KLV A;  4A3O A;  3P2B A;  2JVC A;  4NQK E;  4KSL C;  3VQI A;  4ASW C;  3U8Z A;  3VH3 B;  2XK5 A;  2JZZ A;  2FCN A;  4LDT B;  2KN5 A;  3LDZ E;  3PLU A;  2MBO A;  1A5R A;  3V62 A;  2NR2 A;  4ANV A;  3LJ3 A;  3PLV A;  4CHK A;  2ZNV C;  1WMH A;  2CS4 A;  3D32 A;  4ICU A;  4IC7 B;  3ZIM A;  4ANW A;  4B9K A;  2KO3 A;  4G11 A;  2L0F A;  2N9P C;  3R66 C;  4AOF A;  2KQ7 A;  3A33 B;  2DYO A;  4HJK A;  4IWO A;  4MEL A;  2PEA A;  4KZC A;  2NPT A;  3S2A A;  3ZO5 B;  2PE6 B;  1MG8 A;  1V2Y A;  3HIZ A;  3QC8 B;  4BKS D;  2KAN A;  2N4F A;  4PYZ A;  3X23 A;  1XQQ A;  3SU8 X;  2KTR A;  3K9O B;  2KX3 A;  2KOX A;  3VTW A;  4KV2 A;  3BIN A;  3B08 A;  3W1S C;  5C1Z A;  2R2Q A;  4I6L B;  2JRH A;  2KDF B;  5E6N A;  2JRI B;  2O2V B;  2LWP A;  2MBH A;  4E3C A;  5L83 A;  3RD2 A;  1C3T A;  1GC7 A;  2KWU B;  2LUE A;  3PV1 A;  4W9J A;  3KH0 A;  2XK5 B;  3TBL D;  3PS6 A;  2M17 A;  2O6V D;  3HM6 X;  5G55 A;  3VUX A;  1F9J A;  4WJN A;  3A4S C;  1J8C A;  3PRE A;  5KHQ A;  1SGH A;  2LRU A;  3V6E B;  1WMH B;  2EKE C;  1R4N I;  2C5L C;  3OLM D;  4GDL B;  5BO4 B;  3L0W B;  3H7S A;  2MWS B;  3ZDM C;  1IPG A;  2ASQ A;  2MP2 A;  5IA7 A;  1WGG A;  2K25 A;  3AUL A;  2FID A;  2KC1 A;  5KHO A;  2NPT B;  1EF1 A;  5J18 A;  2NCN A;  2Z0D B;  3ALB A;  2WX1 A;  4EFO A;  1WXA A;  3IHP C;  1YD8 U;  5C23 A;  2KTR B;  3RCZ A;  2RPQ A;  1WYW B;  3AU5 A;  5CHW A;  2DAJ A;  1ZKH A;  2A4Z A;  3ECI A;  2JXX A;  2N7D A;  5J17 A;  3TCA A;  1RAX A;  3AXC A;  2J0K A;  2N7E A;  3NZU A;  2LGX A;  3CMM B;  2MBQ A;  4AWJ A;  2IYD B;  2G4S A;  2VRR B;  3PRZ A;  4HDQ A;  2O6V B;  2J0J A;  4II2 B;  1S1Q B;  1WGY A;  2DYB A;  2DZI A;  2HJ8 A;  2BKR B;  4MGI E;  2KFK A;  2MRP A;  3L17 A;  2KJ6 A;  4EOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...