1WH3A

Solution structure of c-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 oasl)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
GSSGSSGIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLILSKKKGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords 59 kDa 2'-5'-oligoadenylate synthetase like protein
publication title Solution structure of C-terminal ubiquitin like domain of human 2'-5'-oligoadenylate synthetase-like protain (p59 OASL)
rcsb
source organism Homo sapiens
total genus 14
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wh3A01
2L0FA 2ZVOA 4BOZB 4FN2A 2PJHA 2GBKA 4KIKA 2D11A 2WWZA 2IZVB 4KDIC 4WWNA 2FCQA 5D94A 4ANUA 4DXAB 4JGHB 1D3ZA 2N1WA 3ZTCA 1UBIA 2MX2A 1A5RA 2FIFA 3PZDA 2KX3A 4AP4C 2KWUB 1V49A 2LWPA 4MGZE 4A3OA 1WXSA 3SD5A 4NJ7A 1E7VA 3U8ZA 5G55A 2MP2A 3JW0X 2XBBC 3APFA 1X1MA 3NZUA 2M4NA 2C7HA 1WIAA 1WR6E 2LGXA 5E6OA 4LJOB 2KHWB 4W9CA 1R4MI 3V61A 1Y8RC 3PLUA 4HDQA 4IM0A 4ZRIA 4AJYB 4W9LA 4NJ6A 2BPSA 3ZO5B 2RR9A 2LVQA 4JLCA 1S3SG 2BYEA 3R7QA 2MSED 3W1SC 2GBRA 3DVGX 4KIKB 4ANVA 3B1LX 3ZUNA 3EHVA 2KNBA 3IHPC 4ICVA 2MBEA 3D32A 4PYZA 1L2NA 1V6EA 2BKRB 2LI5A 2MLBA 2BF8B 2D3GA 2KZRA 2RGFA 5TR5A 4M8NA 2AL3A 2M8SA 5AZFA 4DHJD 4XX5A 4F7ZA 3ZLZA 4IWPA 2ZJDA 2MP2B 2DZJA 4MJSA 3WANA 2KTFA 4FJVB 5JHBA 4WAAA 4KSLC 3UQBA 2CHXA 2IO1B 5EDSA 2GMIC 3UINB 2ZPNA 4MSMB 3VTVA 1ISNA 2D2QA 2IY1B 4RMAA 4PYUA 4ASWC 3U30A 2KMCA 4GMVA 3ZNID 4KZCA 2V3SA 2AL6A 2DZIA 4G11A 3VFKA 2KJRA 2MBOA 2Z59B 4B95A 3UQAA 3PGEA 2L76A 1EF1A 2KMAA 2WDTB 2KDIA 2NPTA 4EZKA 1KOTA 2RD0A 3RT3B 4AWJA 1WXVA 4HPLB 1TBEA 3BINA 3DVNV 1IP9A 3PPAA 3A9JA 4WWOA 2K8CA 4MEMA 1TZ1A 4MGKE 3VTUA 1V81A 3VUYA 2LRUA 2ZPYA 4GOCA 4EUTA 2I1JA 2M0XA 2KFKA 4HXDA 3DBHI 1IYFA 1VCBA 2FCMA 2YLMA 2M1MA 2LVPA 2LXCA 3X0WA 1PQSA 5AZGA 2XK5A 4M0WB 1JRUA 1CMXB 3DOWA 4MJSB 3A1QA 2DENB 2N9PC 4FBJB 3H1UA 2JT4B 2NS5A 3L54A 3WAMA 2GBJA 2DZMA 4HWIB 3BY4B 1RLFA 4FHJA 2MRPA 1KJTA 4DHJB 5J2RA 3TJPA 3VHTC 2PEAA 4CO7A 4I6NB 2KDFB 3AULA 1R4NI 3L16A 3A9KA 3K9PB 3UGBB 3EECA 3ZTDA 4KVGB 4BKTA 5GMVA 4W9DA 3TBLD 4LDTB 1V5TA 1BT0A 4BFRA 3X23A 2NPTB 1E7UA 4DBGA 3QQ8B 3L08A 3EC8A 1OEYA 3B0AA 3TMPB 1ZW7A 2DHZA 3RZWC 4JQWC 1WMHA 2N7EA 3A9JB 3OLMD 1RAXA 3ZW3A 4W9KA 1VD2A 3ZRFA 2LXAA 3OJ3A 4MSQB 2KFKB 3PVLA 2N4FA 2KWCA 2W9NA 2KANA 4AUQC 2KLCA 1L7YA 2XK5B 3ZKJC 1GG3A 4ZRJA 1OTRB 1NBFC 4EEWA 3AU5A 3H7PA 3A1QB 4NAWA 3ZNHB 2BKFA 2LRWA 1YX5B 2RSUA 2MQJA 4OVUA 4DK5A 3PTFC 1MG8A 2EMTA 3A4SC 3DBRI 2D07B 4HCNB 2OOBB 3O65B 3OJ4B 4TQ0A 3QX1A 3DPDA 5L95C 3P2BA 1E5WA 2KC1A 2GBNA 2DYBA 3A9KB 4YL8A 2K1FA 5C23A 1Q5WB 1GC7A 2CR5A 2MBHA 1ZKHA 1V5OA 2IO3B 2JZ3B 2RPQA 3RYTA 4FJZA 1SGHA 3L17A 2N7DA 1WMHB 5J18A 4W9JA 2O2VA 1RFAA 2FIDA 2JRHA 2EMSA 2IO0B 2HE7A 1WGYA 1EF5A 3AXCA 4JIOU 1QZEA 3H7SA 2HJ8A 4HVBA 3WALA 4RM8A 1XT9B 4G0NB 3M63B 4AJWA 3I3TB 5G2NA 1LFDA 3PRMB 2REXA 3APDA 3GOEA 3UIOB 1UD7A 1TGZB 1WR1A 4TQ1A 2G4DB 3DQVA 4FHKA 2KDEB 3H7PB 3CSTA 2DX5B 4NAWB 1K8RB 1WX8A 1WZ3A 1YJ1A 3ZIMA 1T0YA 1C1YB 3JSVA 1U4AA 2IY0B 2R2QA 3KUZA 3NHEB 3DBSA 3OAWA 1NI2A 4MGIE 2K8HA 4AOFA 3DDCB 1WX9A 2NBVB 3PV1A 3H6NA 4MGYE 4K7WA 1RRBA 1V2YA 2CHWA 3PHXB 3PT2B 5DPSA 2FCNA 5DPRA 2LVOA 2N9XA 3V60A 4F1SA 2O6VD 1LXDA 3DVNU 3VUWA 1HE8A 4TV3A 2K6DB 3KW5B 3VQIA 2K25A 1M94A 3ML9A 5AZHA 4CHKA 4WJPA 2KTRA 1Z2MA 2O2VB 5C1ZA 3LDZE 3QIJA 1WRDB 1KM7A 2ZCBA 4W9IA 4GXBA 1WYWB 3R3MA 1WJNA 4WQOB 3T8MA 3VH4B 3M95A 2KD0A 2O6VA 4BKSD 2J7QB 2IYDB 2L7RA 4GDLA 4N9F4 4BKGA 5JZEB 1G6JA 3K9OB 4CYEA 1P0RA 1UGMA 3DBLI 2LGDA 2LD9A 3JSVB 5FR6A 2KOXA 2A4ZA 3QK0A 3L13A 4G3XB 1V86A 3VH3B 3S2AA 3NOBA 5AEKB 3N32A 3CMMB 4ZRKA 4TKNA 4DHZE 1WGGA 1S1QB 2HTHA 4XZ4A 4X57B 3SDLC 1J8CA 3MHSD 3QARA 1P1AA 1P9DU 2NBUA 2KJ6A 4GU2A 3UIPB 3TL5A 4ZDVA 2BYVE 2JWZA 2JF5A 2BGFA 2ASQA 2KTRB 3PLVA 4KZ0A 2AEHA 1KLVA 4BVUC 2ZNVB 4K7SA 2AWTA 1P98A 2G45B 2WYQA 2C7NB 3QHTA 4DDGD 1WM2A 3ZDMC 1WZ0A 2L8JA 2O6VB 4NQLB 3ZVVA 3VUXA 5CHVC 4GDLB 4RM9A 3ZNGC 5IA7A 4II3B 4W9HA 2KO3A 1E8ZA 2CHZA 2M17A 5J17A 3MJWA 1V80A 2DYMA 3HK0A 3L0WB 3SHQA 1GJZA 3M3JA 4GDKA 2LJ5A 4PS8A 2JY6A 3R7RA 3HHMA 4GB9A 5JHAA 4NY0A 1WJ4A 5D2MB 1NDDA 1WJ6A 4EOYA 4GIVA 2ZNVC 4IWOA 2DAJA 3VDZA 4E3CA 2KC2A 2V1YA 3QA8A 4E71A 2ZEQA 4II2B 5L83A 4NPNA 2Z0DB 5DCNA 2MBQA 3VVWB 1WE7A 4FULA 3RULA 3JYUA 2CKHB 2JXXA 3ALBA 3RUIB 5BO4B 2AYOB 4BBNF 4M8MA 2GOWA 4WWPA 4K81A 1J0GA 2FAZA 2HD5B 2JVCA 2L0TA 3EFUA 4IW0A 1WF9A 3RCZA 5JH5C 2LASA 1YD8U 3IVFA 4IC7B 3UF8A 3SU8X 3ZRCA 3PRPB 2BYFA 2UWQA 4B6WA 3WIMA 2N1VA 5CHFA 4LJPB 4MM3A 2A5UA 3QCAA 4GDKB 3MTNB 1AARA 3W1YA 4E74A 1EO6A 2GBMA 5E6NA 2V4LA 2QHOA 3N30A 3L10B 4EKUA 3N3KB 5DPWA 2WX0A 2IO2B 3IBEA 4K7UA 2PE6B 3PS6A 4J6IA 5D7GA 2CS4A 2C9WB 3GZNI 2K6QA 3NS8A 2JRIB 3A4RA 3HIZA 3Q3FA 5KHQA 2L05A 2KDBA 1IPGA 2KQ7A 2KKCA 2WX1A 3B08A 2VRRB 2ZCCA 3KYDD 3T9LA 4MDKE 2CU1A 4HDOA 1E8WA 2JZZA 2R2OA 2DAFA 3KUDB 3QWZB 4OVVA 4HCPB 5CTRC 4BBNC 3CSFA 2MBBB 5IAAC 1LM8B 2KN5A 3IFWB 2Y5BB 3ECIA 1EUVB 1E8YA 1OGWA 4I6LB 1WX7A 1LQBA 3PRZA 3V6CB 1H4RA 2KJHB 4ICUA 5D6JB 2FUHB 4FLHA 1WE6A 4NNJB 2JUOA 3AI5A 4W9EA 2LGYA 3Q3JA 4WJOA 1GNUA 4A20A 1H8CA 4P7IA 4EZJA 4K1RB 3JVZX 4PS3A 1E8XA 5E6PA 1UZXB 4ZYNA 1WM3A 4DDID 1XD3B 4ANWA 4IM2A 4GN1A 4IM3A 4DWFA 2L00B 1GC6A 3PSEB 2G4SA 4GSWA 1UBQA 4JL9A 4MH0E 5CX3A 3VAWA 3WAPA 1I42A 4B9KA 3KVFB 3DVGY 2OJRA 2KVRA 2G3QB 4W9GA 3M62B 1OEYJ 2Z0EB 2KK8A 3ZNZB 3NZSA 4XC2A 1OQYA 2EKEC 3RD2A 1ZGUB 1WGRA 2B3AA 1J19A 4FJYA 4EFOA 4HK2A 3ENEA 4FADA 1WI0A 2JPHA 3APCA 4G50A 4LDTD 5CHWA 3WAOA 4BKSA 4IWQA 3HM6X 3ZDTA 1FXTB 1UELA 3QAQA 3KUCB 2K8BA 3IG3A 3LJ3A 3KYCD 3VXWA 4NQKE 4LCDE 2C60A 1V9JA 1YX6B 2C7MB 1WXMA 1WH3A 2J0KA 1YIWA 1Z5SB 2KX0A 2C5LC 3H9DA 1YQBA 2NVUI 2ZVNA 4HJKA 2D10A 4HLEA 2MWSB 1SIFA 1C3TA 3AU4A 4MELA 3ML8A 3U7DA 4W9FA 2K39A 2BWES 2LZ6A 2FCSA 5KHOA 3V6EB 4F8CB 4KV2A 4WJNA 2J0MA 4ANXA 3RZFA 1UH6A 2NBWB 2MCNB 1P3QU 4A3PA 1GUAB 2NCNA 5HKHA 2ZZPB 4PS7A 3WA0A 3KH0A 2I1KA 1TTNA 2J0JA 5LXHA 3PREA 1WXAA 2KLGA 3DCGA 1WGDA 4IUMB 3R66C 2MA9B 4KSKC 4URKA 5DPTA 2PE9A 3VTWA 3QJZA 2PPHA 2DZKA 1F9JA 3PHWB 4FA6A 4KDLB 1WJUA 4BOSC 2BWFA 3W1SA 2UYZB 4HPMB 1WY8A 2YVCA 2DYOA 3ONSA 4I6PA 5LXIB 2N9EB 4TUUA 1I35A 3HM3A 3A33B 1Q0WB 3C0RB 1SE9A 3CF6E 2NR2A 4EZLA 2LUEA 2KXJA 2KQSA 3TIXA 1XQQA 2MW5A 4GGQA 4IG7B 3V62A 2IBIB 1E90A 1Q1OA 2KWVB 2XEWA 4WJQA 5LLIA 2FNJB 3NY5A 2L3ZA 3TCAA 2KFJA 3QC8B 4DHZB 1WFYA 1WGHA
chains in the Genus database with same CATH superfamily
2L0FA 2ZVOA 4ITKA 1J7AA 2IZVB 4WWNA 4ANUA 2PTLA 2LMCA 4P1CC 1A5RA 2KWUB 3DWMA 3U8ZA 5G55A 4YSYB 2MP2A 3JW0X 1GAQB 4H2AA 2LGXA 1WR6E 5BMGA 4LJOB 4AS1A 1TS3A 1R4MI 3PLUA 4IM0A 3ZQ4A 4ZRIA 4W9LA 1FRRA 2BPSA 3LYYA 3OWEB 1TY0A 3W1SC 2GBRA 4ANVA 3EHVA 3AB5A 4ICVA 2MBEA 4PYZA 1ZP0B 2KZRA 4M8NA 2M8SA 4DHJD 4XX5A 4ZOHC 1TKYA 4FJVB 5JHBA 3UQBA 3MFGA 4WAAA 4LNIA 2ZPNA 3VTVA 2D2QA 4PYUA 3ZNID 5FKAC 2IDYA 2V3SA 4G11A 4XWWA 1QOFA 3BYTB 2WDTB 4AWJA 1N61A 3BINA 3PPAA 2WU2B 4MGKE 2PVOD 5AUIA 1V81A 1ZXIA 2M0XA 2KFKA 3VR9B 1WSPA 2YLMA 1CJEA 4MH8A 1MG4A 1JRUA 2KMMA 2N9PC 2JT4B 4HWIB 2BYTA 2ZW1A 3TJPA 4HPPA 3AULA 4BKTA 3EECA 2KT7A 2FE8A 5GMVA 3U52E 4BFRA 2NPTB 2OJWA 2RPVA 1OEYA 1HZ6A 3HRDD 2LHDA 1VD2A 3OJ3A 2N4FA 2W9NA 2KLCA 1L7YA 1E6EB 4ZRJA 1SB3C 4RGNA 4EEWA 3H7PA 1C77A 2KWDA 2LRWA 1YX5B 2RSUA 2MQJA 1C4PA 1EWCA 1MG8A 4S17A 3DBRI 4KGSA 2GRIA 4HCNB 4TQ0A 3DPDA 1WWTA 2V4IB 2WU5B 3EUB2 2RDBC 1B9RA 2JZ3B 3RYTA 4FJZA 4W9JA 2O2VA 2IO0B 2HE7A 4JIOU 1QZEA 4ACFA 4HVBA 3WALA 2E3TA 3PO0A 1WR1A 4LNKA 3DQVA 1QILA 1EU3A 2KN4A 1UWMA 1WZ3A 1T0YA 3JSVA 2PLPA 4DQOC 1Y56A 3OAWA 3VR8B 1UNSA 1NI2A 2L52A 1XCQL 1JW9D 1SE2A 3KWLA 3H6NA 3RNGC 3Q69A 1RRBA 2CHWA 3PHXB 3V60A 2LVOA 2N9XA 2JSVX 4TV3A 2K6DB 3UI3A 3VQIA 5AZHA 2QCZA 2INPE 3RNAC 1XEEA 5C1ZA 3T8MA 2FUG1 1JWUD 2IYDB 2L7RA 4C4VA 3K9OB 4PT5A 1ZDXA 3BWUD 4WIPA 1P0RA 3MC0B 3DBLI 2HJ1A 1T6BX 3DHGC 3P4SB 3NOBA 3N32A 4TKNA 1D5MC 1L6UA 4DHZE 1QQRA 4KKIA 2HTHA 4X57B 1J8CA 3MHSD 3QARA 1P1AA 4RF1A 2KDMA 4N59A 3R8BA 1RYJA 2JWZA 1C78A 1V1PA 2ASQA 2KTRB 2QJLA 1YOVB 3FAHA 2WXIA 3O13A 4K7SA 2AWTA 1WM2A 3ZDMC 1AW7A 4WH4A 4II3B 2KO3A 3AE2B 2W82A 2CHZA 3GB1A 1GJZA 1XXGA 4RH6A 2LJ5A 4ZHPA 1NDDA 1R7SA 1GB4A 4IWOA 2KC2A 4E71A 1GPXA 3V3XA 4FXCA 4NPNA 3ZJVA 5HFYA 3RULA 1J7CA 2JXXA 3ALBA 3AEFB 1HZ5A 4LNFA 4BBNF 4O1NA 5G5HA 2FAZA 2HD5B 2JVCA 1UWXA 4IW0A 4US9A 5JH5C 3IVFA 1JMLA 3UF8A 3U7ZA 1XO3A 3PRPB 2BYFA 2IPKD 4B6WA 4MM3A 1F77A 1KF6B 2A5UA 4GDKB 4E74A 2GBMA 3Q8EA 3N30A 5DPWA 1TZOA 4LTUA 4K7UA 3R2IA 3ZXRA 1YN4A 3GZNI 2K6QA 3NS8A 1JROA 2WX1A 2WXQA 3B08A 3KYDD 3T9LA 4HDOA 1E8WA 2JZZA 2R2OA 2Y5CA 4HCPB 1TIFA 2BVCA 5IAAC 1TKGA 2Y5BB 4OHJA 2RDGA 2JQRB 4NNJB 4EZJA 1UGJA 1STEA 3B2GA 1N60A 4GSWA 1GC6A 4DXFA 1UBQA 3VAWA 4M01A 5I4DA 2G3QB 3ZNZB 4XC2A 1TJEA 2EELA 1J19A 4HK2A 3APCA 1E7PB 3HM6X 5AUKA 4YWGG 2SEBD 1XCTL 3IG3A 3CWIA 4HEA1 5BYQA 3VXWA 4NQKE 2AX5A 1YX6B 3B2FA 1XLNA 1JALA 2ZVNA 2D10A 1L4ZB 3AEAB 2MWSB 2KVZA 3U7DA 2LZ6A 2FCSA 1JQ4A 3RZFA 2NBWB 4N6EB 1P3QU 1GUAB 2QMTA 1L0YB 2ZZPB 4PS7A 3WA0A 3KH0A 2I1KA 1TTNA 3PREA 1WXAA 1MHXA 4IUMB 3NVWA 3R66C 2MA9B 4URKA 2PE9A 3VTWA 1F9JA 2WDQB 3MC9A 2K9XA 4JX1C 1WY8A 2DYOA 4TSSA 5LXIB 1IGCA 2K22A 2N9EB 3HM3A 2BS4B 2OHFA 3CF6E 1C9FA 2X8XX 3TIXA 4RGTA 5HI1A 4IG7B 2IBIB 3I57A 2DLBA 2G9HD 1SXTA 2KFJA 4ZHOA 3SEBA 4DHZB 1WFYA 3Q8FA 1XF5L 2PJHA 1WXQA 4KGRA 5D94A 2LUMA 1V97A 4JGHB 2N1WA 2EKIA 3Q3OC 4XE0A 2FIFA 1V49A 1TS4A 1I4QA 1WXSA 3GE3C 1X1MA 3NZUA 2M4NA 2C7HA 1WIAA 5E6OA 2BS2B 5T8IA 2BB5A 4PK1A 1F52A 2WXNA 5H8YE 4A90A 3ZO5B 1T0QC 3DVGX 3IHPC 3D32A 4GLSC 2GI9A 3MHZA 2LI5A 5GXGB 2BF8B 4M00A 2D3GA 2RGFA 2JWUA 5AZFA 1T0RC 4HJGE 5IKCM 3WANA 1ET9A 4KSLC 2M0AA 5EDSA 2NMQA 2GMIC 4K3BA 5LNK1 2IY1B 4RMAA 3U30A 2DZIA 1WGKA 2L76A 1EF1A 2NPTA 3RT3B 4HPLB 3DVNV 1IP9A 2K8CA 1N5WA 1V1OA 3VTUA 4EUTA 3W2DA 3ETRA 2YEPF 3AEEB 1PQSA 4M0WB 3HVDA 1CMXB 3DOWA 5IO9A 4MJSB 2BTEA 4FBJB 1FFUA 3WAMA 1D5ZC 3HUIA 1RLFA 1NI3A 1JWMD 4FHJA 2KDFB 1R4NI 2JX5A 2DNFA 4LDTB 3NG0A 3X23A 3L08A 3EC8A 1ZW7A 3RZWC 3AE9B 3OLMD 1RAXA 2VH2A 4W9KA 1ZXHA 2KACA 2KWCA 4HROA 1L4DB 1SE4A 4LLGM 1RM6C 3VRBB 1NBFC 3ZNHB 2BKFA 4DK5A 2MEKA 3QX1A 3FC4A 5L95C 2GBNA 3A9KB 4ZRPA 2IO3B 1SGHA 2N7DA 5J18A 2FIDA 1YN3A 3ZJUA 1EF5A 3AXCA 2HJ8A 3WCQA 1XT9B 4G0NB 3M63B 2AQ2B 3APDA 1SEBD 4B0MA 2G4DB 1TS2A 4NAWB 1WX8A 1VLBA 1C1YB 3OG5A 2R2QA 3KUZA 3W5VB 3DBSA 4XWTA 4RFBA 1WX9A 2AQ1B 4K7WA 2N0SB 3E56A 2FCNA 2BS3B 3EGRA 2K25A 3ML9A 4A9AA 4C80A 2BB6A 2KTRA 2QILA 1WRDB 2ZCBA 4GXBA 2HDEA 1WJNA 3M95A 3Q8CA 3IAS1 3ZXVA 4BKSD 4CYEA 1UGMA 2HTME 3BVGA 2LD9A 1FXIA 5FR6A 2N9KA 2A4ZA 3L13A 5BMIA 3VH3B 5AEKB 2LFIA 3CMMB 1AWDA 5IP4D 1WGGA 4XZ4A 3SDLC 1YJJA 2MJDA 1P9DU 1NYQA 3MJ5A 3AV8A 2JF5A 3Q3NC 1KLVA 4RNAA 2K3UA 3QHTA 2DWQA 3RN9C 2BT6A 2O6VB 4NQLB 3ZVVA 3VUXA 4GDLB 3AEGB 1V80A 3SHQA 3M3JA 4GDKA 2JY6A 3R7RA 2Y5PA 4NY0A 1WJ6A 4EOYA 2ZNVC 2INNE 3TEYA 2V1YA 1FPYA 1KFYB 4II2B 2Z0DB 3T3OA 3IT4B 4FULA 2CKHB 2WDRB 1HTOA 3N1YC 5BO4B 2IGDA 4M8MA 4WWPA 4K81A 2TSSA 4K3CA 2L0TA 3EFUA 1WF9A 1ZE3D 2LASA 1E9MA 4IC7B 4REZA 3ZRCA 4XGAB 2UWQA 3WIMA 2N1VA 1ZPSA 1NEKB 4LJPB 2QHOA 3P42A 3L10B 4EKUA 2WX0A 3GS2A 3PS6A 4J6IA 5D7GA 2CS4A 1DOXA 2C9WB 4OZCA 3W5UB 3A4RA 3HIZA 3Q3FA 1IPGA 2ZCCA 4MDKE 2CU1A 1FEHA 3KUDB 2DAFA 3U4EG 1VJKA 1XLOA 3RNBC 1E8YA 1WX7A 3PRZA 1YNTE 4FLHA 1H8CA 5EE0A 1UZXB 2QEJC 2PVGC 2PW9A 1WM3A 4DWFA 4LNOA 2L00B 2E6XA 3PSEB 4MH0E 5CX3A 3WAPA 1TS5A 1SIJA 1I42A 3I9V1 4B9KA 2Z8LA 1FO4A 2Z0EB 2H88B 2EKEC 4KGTA 5D3DA 3GP7A 3Q6BA 4FJYA 2K5PA 2JYEA 3KQ4A 4LDTD 3WAOA 4BKSA 3DHIC 3SFEB 1VZ6A 3KUCB 2K8BA 1SJHD 2DBYA 2PIAA 1V9JA 2C7MB 2LHEA 5EE3A 2QC8A 3E9SA 4OZBA 2C5LC 3H9DA 1YQBA 2NVUI 5BYRA 3CIRB 1SIFA 3AEBB 4MELA 1M4VA 1T0SC 1UH6A 4C00A 2NCNA 5LXHA 1T3QA 1FCCC 1TYGB 2AQ3B 4YSXB 2PPHA 2DZKA 4KDLB 1WJUA 3SFDB 4C56C 2BWFA 3AECB 2UYZB 2YVCA 3V05A 1K51A 1I35A 4HKZE 3RMKC 2VZKB 3C0RB 2NR2A 4EZLA 2KQSA 2D5GA 2MW5A 4YTMB 1VDVA 3DWGC 3ZJTA 1E90A 4BAXA 2L3ZA 2D3AA 1C4CA 3BZDB 2WXFA 4C7YA 4KDIC 2V3PA 3Q8BA 2V0GA 3ZTCA 1UBIA 2MX2A 1YQ4B 2LWPA 4MGZE 4A3OA 1YMHE 4NJ7A 1E7VA 4JWUC 2XBBC 3APFA 4JWSC 3J9CA 5C3JB 1VR9A 4YXDB 2J53A 4P1BC 1DGJA 5H92C 2LJIA 4L23A 3AE5B 5IN7A 1P7EA 2LVQA 4R3DA 4JLCA 1S3SG 2BYEA 2R61A 2MSED 4OZAA 5BMHA 1JWBD 2KAJA 4KIKB 2J4XA 3RI7C 2KNBA 2QIEB 1L2NA 1V6EA 2BKRB 2MLBA 4OW0A 4CQNA 4M0WA 3ZLZA 4IWPA 4D2KA 2ZJDA 4MJSA 2CHXA 2IO1B 3IXSA 2WXMA 4J3OD 4KZCA 1R4MB 2MBOA 3BVZA 4B95A 4WQMA 2KMAA 3NVVA 4EZKA 1KOTA 4B0EA 2RD0A 1TBEA 2WS3B 2L1AA 2INDC 4MEMA 2LRUA 2ZPYA 4GOCA 4A6QA 2I1JA 1IYFA 3AM9A 1VCBA 2M1MA 2LVPA 2LXCA 5AZGA 4JPSA 2D3BA 3H1UA 2NS5A 1N63A 2YEPB 2MRPA 1KJTA 4DHJB 4CO7A 3A9KA 4KVGB 3TBLD 1V5TA 3P4RB 1QOBA 4DBGA 3QQ8B 2DHZA 3A9JB 1HXYD 3ZRFA 4MSQB 4AUQC 4A55A 2XK5B 2LEKA 3AU5A 2XNAC 3A1QB 4NAWA 3PTFC 3NUHB 1ROEA 2KQ4X 3OJ4B 1PGAA 2WXGA 4NAMA 1E5WA 4WWMA 2DYBA 4YL8A 2K1FA 2MBHA 2FBWB 1HQRD 1V5OA 2RPQA 1K52A 2JXTA 3L17A 1WMHB 1WGYA 2V9HA 3H7SA 1FXAA 1RFKA 4RM8A 4AJWA 3I3TB 5G2NA 3PRMB 3GOEA 1TKEA 1TGZB 4TQ1A 1DOYA 2VH1A 4M02A 2KDEB 4YT0B 1YJ1A 3ZIMA 1U4AA 2IY0B 3NHEB 1VZ7A 3P63A 4MGIE 1JRPA 3KWVA 2K8HA 4AOFA 2LGIA 3DDCB 3DBRB 2NBVB 3AEDB 4MGYE 1V2YA 5DPRA 4F1SA 2WXKA 3DVNU 4YTNB 1GB1A 1M94A 2ACZB 2WXRA 4CHKA 1Z2MA 4OVZA 3QIJA 1KM7A 4W9IA 1GOZA 3R3MA 2PKOA 1EWYC 3LXFA 2KD0A 1SSNA 2O6VA 2J7QB 5JZEB 4GDLA 4BKGA 4N9F4 1G6JA 5FR3A 4XDCA 2LGDA 4KKJA 3QK0A 4G3XB 3MP9A 3S2AA 3N1ZC 1OQQA 1S1QB 4GU2A 2BYVE 1MPEA 2BGFA 2AEHA 1WYGA 3NS1A 3TEZA 1WZ0A 2L8JA 4Q2JA 1NVID 5CHVC 3ZNGC 5IA7A 4W9HA 3FILB 2RMMA 2M17A 3MJWA 2Y3AA 2DYMA 3L0WB 1VZ8A 2JYTA 3HHMA 4GB9A 1JWAD 5D2MB 1C4AA 3VDZA 4E3CA 3QA8A 2W55A 4RGMA 1KH0A 1XLPA 2WGSA 3DBHB 3JYUA 1L0VB 5JXVA 3AE1B 1RWSA 1J0GA 2KYWA 3BVMA 4XYCA 1YD8U 3SU8X 3P4QB 2SAKA 4ZYSA 4ARIA 2B76B 2MJEA 3I5JC 3MTNB 1AARA 1ZUD2 1ZDVA 1MJDA 1SF0A 4RGOS 2JRIB 5KHQA 2L05A 1A70A 2KQ7A 2KKCA 2WXHA 4XDDA 2J52A 4OVVA 3QWZB 1LM8B 3IFWB 1EUVB 1I4HA 1OGWA 1LQBA 3V6CB 2KJHB 4ICUA 2ZW0A 3EA6A 3AI5A 4W9EA 2LGYA 4WJOA 4A20A 1KLUD 4P7IA 3NZ3A 1J7BA 1E8XA 1XD3B 1I4GA 1D5XC 1PGBA 4GN1A 2W3SA 4JL9A 2G4SA 3GZNB 3DVGY 2WNMA 4W9GA 3M62B 1OEYJ 2KK8A 3RD2A 1ZGUB 3N9YC 1WGRA 2B3AA 3ENEA 4FADA 3Q14C 4G50A 1MHHE 2UU7A 1PUTA 3ZDTA 3B9JA 1UELA 4P16A 1KLGD 3PZ7A 1AYFA 4HRSA 3W9CB 2C60A 1CZPA 1WH3A 2GB1A 1YIWA 1C76A 4RF0A 2N9LA 5D3IB 1D6EC 3RFZB 4HLEA 3AE8B 1C3TA 1NYRA 4W9FA 2BWES 5KHOA 2IGGA 3V6EB 4F8CB 2D3CA 1VRAB 4KV2A 4WJNA 1V8CA 2J0MA 4JE3B 4ANXA 2MCNB 3Q3MC 4A3PA 2L83A 5HKHA 2J0JA 4A8XC 2KLGA 3DCGA 1EU4A 4KSKC 2X38A 5DPTA 3QJZA 1OQRA 3AN1A 4FA6A 3AMZA 5IOIA 3W1SA 4HPMB 3ONSA 3A33B 5TSSA 1Q0WB 2BBCA 1SE9A 1XQQA 2KWVB 1HA5A 1Q1OA 2XEWA 3BK1A 3LB8C 4WJQA 5LLIA 2FNJB 2WXOA 4L2YA 1I4XA 3IT6B 3QC8B 1HTQA 1WGHA 1FXTB 4BOZB 4FN2A 2GBKA 4KIKA 2D11A 2WWZA 1FD6A 1SE3A 2FCQA 4DXAB 3Q8AA 1I7HA 2WXLA 1D3ZA 2M19A 3FKYA 4AP4C 3PZDA 2KX3A 5BYSA 1I4RA 1QT9A 3RPFC 1QLBB 2OEDA 3SD5A 4BZAA 3Q2AC 1N5XA 4P6VF 1F2RI 3BYYB 1HEZE 2KHWB 4W9CA 1K53A 2H89B 3V61A 1Y8RC 3L4PA 1IBXB 4HDQA 4AJYB 3C8YA 4NJ6A 4UDUC 2RR9A 1BXTA 3R7QA 2N7JA 3B1LX 3ZUNA 4US8A 2LGSA 2MH7A 1YN5A 2INCC 4MT5A 5TR5A 2AL3A 3RNCC 4F7ZA 2MP2B 2DZJA 2KTFA 2CU3A 4RCOA 3GE8C 3UINB 4MSMB 1ISNA 1IGDA 4ASWC 1JWSD 2KMCA 4GMVA 3BK2A 3ABVB 2AL6A 3VFKA 2KJRA 2Z59B 1EM7A 3UQAA 3AE3B 3PGEA 1ENFA 2KDIA 1B1ZA 3VRAB 1WXVA 1QOGA 3A9JA 4WWOA 1TZ1A 2XN9C 3VUYA 4HXDA 3DBHI 1QF6A 2FCMA 1F2RC 2IGHA 3X0WA 3TUOA 2XK5A 3TSSA 2QSDA 3A1QA 2DENB 3L54A 2GBJA 2DZMA 1DYQA 3BY4B 3KLSX 2M56B 5J2RA 3VHTC 2PEAA 4I6NB 2NTSA 3ZTDA 3L16A 3K9PB 3UGBB 2L32A 4W9DA 1QKZA 2ICIA 5HHDG 1BT0A 1E10A 1E7UA 3B0AA 3TMPB 4JQWC 1WMHA 2N7EA 5C2TB 3ZW3A 1TT5B 2LXAA 3SR6A 1PYWD 1FIQA 2KFKB 3PVLA 2KANA 2V3NA 2QDFA 3ZKJC 1GG3A 1OTRB 3AE4B 3U2SC 3NRZA 4OVUA 2EMTA 3A4SC 2D07B 5HG2A 2OOBB 4EE2A 3O65B 3NVZA 3P2BA 2KC1A 2ON8A 1PDXA 5C23A 1Q5WB 1GC7A 2CR5A 1ZKHA 2WP9B 1R4NB 1KRHA 3AE6B 4LK0M 1RFAA 1AN8A 2JRHA 2EMSA 1FCLA 1LFDA 4NZLB 2REXA 3UIOB 1UD7A 4NJCA 1PFDA 4FHKA 3H7PB 1ET6A 3CSTA 2DX5B 1K8RB 1NENB 1FRDA 4DXGA 1L6VA 3C19A 3PV1A 3AH7A 5DPSA 3PT2B 3TEXA 2O6VD 1LXDA 3VUWA 1SBBB 1HE8A 3KW5B 2MJ3A 4WJPA 3URYA 1L0XB 2O2VB 3EFCA 4C7ZA 3LDZE 1MVKA 1BUIC 1WYWB 3VH4B 4WQOB 3IAM1 3N20C 4WAFA 2WLBA 2MHJA 1T5XD 2ONQA 2JZPA 3FILA 4ZRQA 4N58A 2BQQA 3JSVB 3AE7B 2KOXA 1IUEA 1N62A 2Q5WD 1V86A 1KTKA 1FNWA 4ZRKA 3DHHC 1OFFA 2IJ0A 2NBUA 2KJ6A 1YJIA 3UIPB 3TL5A 4ZDVA 1JCKB 3N1XC 5E6JA 3PLVA 4KZ0A 4MACA 4BVUC 2ZNVB 1P98A 2G45B 2WYQA 2C7NB 4DDGD 3NVYA 4S0RA 4RM9A 1MI0A 5G5GA 4C4VB 1E8ZA 5J17A 3HK0A 1E0ZA 2J42A 1N6ZA 3ZYYX 4PS8A 3ZGZA 1C79A 3PZ8A 5JHAA 1TY2A 1WJ4A 1P7FA 4GIVA 1CK1A 2DAJA 2JU6X 2ZEQA 4HKQA 5L83A 5DCNA 2MBQA 3VVWB 1WE7A 2WQYB 1V1PB 3RUIB 2AYOB 2GOWA 1XLQA 1FMAD 3RCZA 4QAYA 4LNNA 2BW2A 1ESFA 2CJNA 2PMVA 2W3RA 5CHFA 1FM0D 3QCAA 3W1YA 1EO6A 5E6NA 2V4LA 1LGRA 2I38A 3N3KB 2IO2B 3IBEA 2PE6B 4TMAB 2KDBA 3HVZA 5FK9C 2VRRB 4YSZB 1CQVA 4BBNC 5CTRC 1LO5D 3CSFA 2MBBB 2KN5A 3ECIA 4I6LB 1H4RA 5D6JB 2FUHB 1WE6A 2RDHA 1K50A 2JUOA 4MM3B 3Q3JA 2GLSA 1GNUA 1PGXA 3RNEC 1UUPA 4K1RB 3JVZX 4PS3A 4USAA 5E6PA 1UF0A 4ZYNA 4DDID 2WXJA 4IM2A 4ANWA 4IM3A 2WHIA 1D4BA 3KVFB 3BIID 2OJRA 2KVRA 4IDIA 3NZSA 1FFVA 1OQYA 1Q10A 3TEWA 4EFOA 3T3NA 1WI0A 2JPHA 5CHWA 1F1HA 4IWQA 4WURA 2WXPA 3QAQA 1FNUA 3RNFC 2VZKD 3LJ3A 1QOAA 3KYCD 1I4PA 4LCDE 3I63C 1WXMA 2J0KA 1YQ3B 1Z5SB 2CJOA 2KX0A 3MC8A 2NTTA 4HJKA 1BMLC 2WDVB 4YTPB 1F0ZA 4L1BA 3AU4A 3NJTA 3ML8A 2K39A 4IKGA 4KX6B 3P1MA 4ARCA 1MFWA 1WRIA 3DBLB 3P4PB 1L5PA 5MPOA 1WGDA 4AQ7A 1ACCA 3PHWB 4BOSC 5EE9A 2G1EA 2I2YA 2W54A 4I6PA 3H8HA 2K0PA 1DOIA 4IOIE 5EE1A 1SJED 4TUUA 1FNVA 2LUEA 2KXJA 4GGQA 3V62A 1IBXA 3NY5A 3R2TA 3TCAA 1ZOYB
chains in the Genus database with same CATH topology
2L0FA 2ZVOA 4BOZB 4FN2A 2PJHA 2GBKA 4KIKA 2D11A 2WWZA 2IZVB 4KDIC 4WWNA 2FCQA 5D94A 4ANUA 4DXAB 4JGHB 1D3ZA 2N1WA 3ZTCA 1UBIA 2MX2A 1A5RA 2FIFA 3PZDA 2KX3A 4AP4C 2KWUB 1V49A 2LWPA 4MGZE 4A3OA 1WXSA 3SD5A 4NJ7A 1E7VA 3U8ZA 5G55A 2MP2A 3JW0X 2XBBC 3APFA 1X1MA 3NZUA 2M4NA 2C7HA 1WIAA 1WR6E 2LGXA 5E6OA 4LJOB 2KHWB 4W9CA 1R4MI 3V61A 1Y8RC 3PLUA 4HDQA 4IM0A 4ZRIA 4AJYB 4W9LA 4NJ6A 2BPSA 3ZO5B 2RR9A 2LVQA 4JLCA 1S3SG 2BYEA 3R7QA 2MSED 3W1SC 2GBRA 3DVGX 4KIKB 4ANVA 3B1LX 3ZUNA 3EHVA 2KNBA 3IHPC 4ICVA 2MBEA 3D32A 4PYZA 1L2NA 1V6EA 2BKRB 2LI5A 2MLBA 2BF8B 2D3GA 2KZRA 2RGFA 5TR5A 4M8NA 2AL3A 2M8SA 5AZFA 4DHJD 4XX5A 4F7ZA 3ZLZA 4IWPA 2ZJDA 2MP2B 2DZJA 4MJSA 3WANA 2KTFA 4FJVB 5JHBA 4WAAA 4KSLC 3UQBA 2CHXA 2IO1B 5EDSA 2GMIC 3UINB 2ZPNA 4MSMB 3VTVA 1ISNA 2D2QA 2IY1B 4RMAA 4PYUA 4ASWC 3U30A 2KMCA 4GMVA 3ZNID 4KZCA 2V3SA 2AL6A 2DZIA 4G11A 3VFKA 2KJRA 2MBOA 2Z59B 4B95A 3UQAA 3PGEA 2L76A 1EF1A 2KMAA 2WDTB 2KDIA 2NPTA 4EZKA 1KOTA 2RD0A 3RT3B 4AWJA 1WXVA 4HPLB 1TBEA 3BINA 3DVNV 1IP9A 3PPAA 3A9JA 4WWOA 2K8CA 4MEMA 1TZ1A 4MGKE 3VTUA 1V81A 3VUYA 2LRUA 2ZPYA 4GOCA 4EUTA 2I1JA 2M0XA 2KFKA 4HXDA 3DBHI 1IYFA 1VCBA 2FCMA 2YLMA 2M1MA 2LVPA 2LXCA 3X0WA 1PQSA 5AZGA 2XK5A 4M0WB 1JRUA 1CMXB 3DOWA 4MJSB 3A1QA 2DENB 2N9PC 4FBJB 3H1UA 2JT4B 2NS5A 3L54A 3WAMA 2GBJA 2DZMA 4HWIB 3BY4B 1RLFA 4FHJA 2MRPA 1KJTA 4DHJB 5J2RA 3TJPA 3VHTC 2PEAA 4CO7A 4I6NB 2KDFB 3AULA 1R4NI 3L16A 3A9KA 3K9PB 3UGBB 3EECA 3ZTDA 4KVGB 4BKTA 5GMVA 4W9DA 3TBLD 4LDTB 1V5TA 1BT0A 4BFRA 3X23A 2NPTB 1E7UA 4DBGA 3QQ8B 3L08A 3EC8A 1OEYA 3B0AA 3TMPB 1ZW7A 2DHZA 3RZWC 4JQWC 1WMHA 2N7EA 3A9JB 3OLMD 1RAXA 3ZW3A 4W9KA 1VD2A 3ZRFA 2LXAA 3OJ3A 4MSQB 2KFKB 3PVLA 2N4FA 2KWCA 2W9NA 2KANA 4AUQC 2KLCA 1L7YA 2XK5B 3ZKJC 1GG3A 4ZRJA 1OTRB 1NBFC 4EEWA 3AU5A 3H7PA 3A1QB 4NAWA 3ZNHB 2BKFA 2LRWA 1YX5B 2RSUA 2MQJA 4OVUA 4DK5A 3PTFC 1MG8A 2EMTA 3A4SC 3DBRI 2D07B 4HCNB 2OOBB 3O65B 3OJ4B 4TQ0A 3QX1A 3DPDA 5L95C 3P2BA 1E5WA 2KC1A 2GBNA 2DYBA 3A9KB 4YL8A 2K1FA 5C23A 1Q5WB 1GC7A 2CR5A 2MBHA 1ZKHA 1V5OA 2IO3B 2JZ3B 2RPQA 3RYTA 4FJZA 1SGHA 3L17A 2N7DA 1WMHB 5J18A 4W9JA 2O2VA 1RFAA 2FIDA 2JRHA 2EMSA 2IO0B 2HE7A 1WGYA 1EF5A 3AXCA 4JIOU 1QZEA 3H7SA 2HJ8A 4HVBA 3WALA 4RM8A 1XT9B 4G0NB 3M63B 4AJWA 3I3TB 5G2NA 1LFDA 3PRMB 2REXA 3APDA 3GOEA 3UIOB 1UD7A 1TGZB 1WR1A 4TQ1A 2G4DB 3DQVA 4FHKA 2KDEB 3H7PB 3CSTA 2DX5B 4NAWB 1K8RB 1WX8A 1WZ3A 1YJ1A 3ZIMA 1T0YA 1C1YB 3JSVA 1U4AA 2IY0B 2R2QA 3KUZA 3NHEB 3DBSA 3OAWA 1NI2A 4MGIE 2K8HA 4AOFA 3DDCB 1WX9A 2NBVB 3PV1A 3H6NA 4MGYE 4K7WA 1RRBA 1V2YA 2CHWA 3PHXB 3PT2B 5DPSA 2FCNA 5DPRA 2LVOA 2N9XA 3V60A 4F1SA 2O6VD 1LXDA 3DVNU 3VUWA 1HE8A 4TV3A 2K6DB 3KW5B 3VQIA 2K25A 1M94A 3ML9A 5AZHA 4CHKA 4WJPA 2KTRA 1Z2MA 2O2VB 5C1ZA 3LDZE 3QIJA 1WRDB 1KM7A 2ZCBA 4W9IA 4GXBA 1WYWB 3R3MA 1WJNA 4WQOB 3T8MA 3VH4B 3M95A 2KD0A 2O6VA 4BKSD 2J7QB 2IYDB 2L7RA 4GDLA 4N9F4 4BKGA 5JZEB 1G6JA 3K9OB 4CYEA 1P0RA 1UGMA 3DBLI 2LGDA 2LD9A 3JSVB 5FR6A 2KOXA 2A4ZA 3QK0A 3L13A 4G3XB 1V86A 3VH3B 3S2AA 3NOBA 5AEKB 3N32A 3CMMB 4ZRKA 4TKNA 4DHZE 1WGGA 1S1QB 2HTHA 4XZ4A 4X57B 3SDLC 1J8CA 3MHSD 3QARA 1P1AA 1P9DU 2NBUA 2KJ6A 4GU2A 3UIPB 3TL5A 4ZDVA 2BYVE 2JWZA 2JF5A 2BGFA 2ASQA 2KTRB 3PLVA 4KZ0A 2AEHA 1KLVA 4BVUC 2ZNVB 4K7SA 2AWTA 1P98A 2G45B 2WYQA 2C7NB 3QHTA 4DDGD 1WM2A 3ZDMC 1WZ0A 2L8JA 2O6VB 4NQLB 3ZVVA 3VUXA 5CHVC 4GDLB 4RM9A 3ZNGC 5IA7A 4II3B 4W9HA 2KO3A 1E8ZA 2CHZA 2M17A 5J17A 3MJWA 1V80A 2DYMA 3HK0A 3L0WB 3SHQA 1GJZA 3M3JA 4GDKA 2LJ5A 4PS8A 2JY6A 3R7RA 3HHMA 4GB9A 5JHAA 4NY0A 1WJ4A 5D2MB 1NDDA 1WJ6A 4EOYA 4GIVA 2ZNVC 4IWOA 2DAJA 3VDZA 4E3CA 2KC2A 2V1YA 3QA8A 4E71A 2ZEQA 4II2B 5L83A 4NPNA 2Z0DB 5DCNA 2MBQA 3VVWB 1WE7A 4FULA 3RULA 3JYUA 2CKHB 2JXXA 3ALBA 3RUIB 5BO4B 2AYOB 4BBNF 4M8MA 2GOWA 4WWPA 4K81A 1J0GA 2FAZA 2HD5B 2JVCA 2L0TA 3EFUA 4IW0A 1WF9A 3RCZA 5JH5C 2LASA 1YD8U 3IVFA 4IC7B 3UF8A 3SU8X 3ZRCA 3PRPB 2BYFA 2UWQA 4B6WA 3WIMA 2N1VA 5CHFA 4LJPB 4MM3A 2A5UA 3QCAA 4GDKB 3MTNB 1AARA 3W1YA 4E74A 1EO6A 2GBMA 5E6NA 2V4LA 2QHOA 3N30A 3L10B 4EKUA 3N3KB 5DPWA 2WX0A 2IO2B 3IBEA 4K7UA 2PE6B 3PS6A 4J6IA 5D7GA 2CS4A 2C9WB 3GZNI 2K6QA 3NS8A 2JRIB 3A4RA 3HIZA 3Q3FA 5KHQA 2L05A 2KDBA 1IPGA 2KQ7A 2KKCA 2WX1A 3B08A 2VRRB 2ZCCA 3KYDD 3T9LA 4MDKE 2CU1A 4HDOA 1E8WA 2JZZA 2R2OA 2DAFA 3KUDB 3QWZB 4OVVA 4HCPB 5CTRC 4BBNC 3CSFA 2MBBB 5IAAC 1LM8B 2KN5A 3IFWB 2Y5BB 3ECIA 1EUVB 1E8YA 1OGWA 4I6LB 1WX7A 1LQBA 3PRZA 3V6CB 1H4RA 2KJHB 4ICUA 5D6JB 2FUHB 4FLHA 1WE6A 4NNJB 2JUOA 3AI5A 4W9EA 2LGYA 3Q3JA 4WJOA 1GNUA 4A20A 1H8CA 4P7IA 4EZJA 4K1RB 3JVZX 4PS3A 1E8XA 5E6PA 1UZXB 4ZYNA 1WM3A 4DDID 1XD3B 4ANWA 4IM2A 4GN1A 4IM3A 4DWFA 2L00B 1GC6A 3PSEB 2G4SA 4GSWA 1UBQA 4JL9A 4MH0E 5CX3A 3VAWA 3WAPA 1I42A 4B9KA 3KVFB 3DVGY 2OJRA 2KVRA 2G3QB 4W9GA 3M62B 1OEYJ 2Z0EB 2KK8A 3ZNZB 3NZSA 4XC2A 1OQYA 2EKEC 3RD2A 1ZGUB 1WGRA 2B3AA 1J19A 4FJYA 4EFOA 4HK2A 3ENEA 4FADA 1WI0A 2JPHA 3APCA 4G50A 4LDTD 5CHWA 3WAOA 4BKSA 4IWQA 3HM6X 3ZDTA 1FXTB 1UELA 3QAQA 3KUCB 2K8BA 3IG3A 3LJ3A 3KYCD 3VXWA 4NQKE 4LCDE 2C60A 1V9JA 1YX6B 2C7MB 1WXMA 1WH3A 2J0KA 1YIWA 1Z5SB 2KX0A 2C5LC 3H9DA 1YQBA 2NVUI 2ZVNA 4HJKA 2D10A 4HLEA 2MWSB 1SIFA 1C3TA 3AU4A 4MELA 3ML8A 3U7DA 4W9FA 2K39A 2BWES 2LZ6A 2FCSA 5KHOA 3V6EB 4F8CB 4KV2A 4WJNA 2J0MA 4ANXA 3RZFA 1UH6A 2NBWB 2MCNB 1P3QU 4A3PA 1GUAB 2NCNA 5HKHA 2ZZPB 4PS7A 3WA0A 3KH0A 2I1KA 1TTNA 2J0JA 5LXHA 3PREA 1WXAA 2KLGA 3DCGA 1WGDA 4IUMB 3R66C 2MA9B 4KSKC 4URKA 5DPTA 2PE9A 3VTWA 3QJZA 2PPHA 2DZKA 1F9JA 3PHWB 4FA6A 4KDLB 1WJUA 4BOSC 2BWFA 3W1SA 2UYZB 4HPMB 1WY8A 2YVCA 2DYOA 3ONSA 4I6PA 5LXIB 2N9EB 4TUUA 1I35A 3HM3A 3A33B 1Q0WB 3C0RB 1SE9A 3CF6E 2NR2A 4EZLA 2LUEA 2KXJA 2KQSA 3TIXA 1XQQA 2MW5A 4GGQA 4IG7B 3V62A 2IBIB 1E90A 1Q1OA 2KWVB 2XEWA 4WJQA 5LLIA 2FNJB 3NY5A 2L3ZA 3TCAA 2KFJA 3QC8B 4DHZB 1WFYA 1WGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0F A;  2ZVO A;  4BOZ B;  4FN2 A;  2PJH A;  2GBK A;  4KIK A;  2D11 A;  2WWZ A;  2IZV B;  4KDI C;  4WWN A;  2FCQ A;  5D94 A;  4ANU A;  4DXA B;  4JGH B;  1D3Z A;  2N1W A;  3ZTC A;  1UBI A;  2MX2 A;  1A5R A;  2FIF A;  3PZD A;  2KX3 A;  4AP4 C;  2KWU B;  1V49 A;  2LWP A;  4MGZ E;  4A3O A;  1WXS A;  3SD5 A;  4NJ7 A;  1E7V A;  3U8Z A;  5G55 A;  2MP2 A;  3JW0 X;  2XBB C;  3APF A;  1X1M A;  3NZU A;  2M4N A;  2C7H A;  1WIA A;  1WR6 E;  2LGX A;  5E6O A;  4LJO B;  2KHW B;  4W9C A;  1R4M I;  3V61 A;  1Y8R C;  3PLU A;  4HDQ A;  4IM0 A;  4ZRI A;  4AJY B;  4W9L A;  4NJ6 A;  2BPS A;  3ZO5 B;  2RR9 A;  2LVQ A;  4JLC A;  1S3S G;  2BYE A;  3R7Q A;  2MSE D;  3W1S C;  2GBR A;  3DVG X;  4KIK B;  4ANV A;  3B1L X;  3ZUN A;  3EHV A;  2KNB A;  3IHP C;  4ICV A;  2MBE A;  3D32 A;  4PYZ A;  1L2N A;  1V6E A;  2BKR B;  2LI5 A;  2MLB A;  2BF8 B;  2D3G A;  2KZR A;  2RGF A;  5TR5 A;  4M8N A;  2AL3 A;  2M8S A;  5AZF A;  4DHJ D;  4XX5 A;  4F7Z A;  3ZLZ A;  4IWP A;  2ZJD A;  2MP2 B;  2DZJ A;  4MJS A;  3WAN A;  2KTF A;  4FJV B;  5JHB A;  4WAA A;  4KSL C;  3UQB A;  2CHX A;  2IO1 B;  5EDS A;  2GMI C;  3UIN B;  2ZPN A;  4MSM B;  3VTV A;  1ISN A;  2D2Q A;  2IY1 B;  4RMA A;  4PYU A;  4ASW C;  3U30 A;  2KMC A;  4GMV A;  3ZNI D;  4KZC A;  2V3S A;  2AL6 A;  2DZI A;  4G11 A;  3VFK A;  2KJR A;  2MBO A;  2Z59 B;  4B95 A;  3UQA A;  3PGE A;  2L76 A;  1EF1 A;  2KMA A;  2WDT B;  2KDI A;  2NPT A;  4EZK A;  1KOT A;  2RD0 A;  3RT3 B;  4AWJ A;  1WXV A;  4HPL B;  1TBE A;  3BIN A;  3DVN V;  1IP9 A;  3PPA A;  3A9J A;  4WWO A;  2K8C A;  4MEM A;  1TZ1 A;  4MGK E;  3VTU A;  1V81 A;  3VUY A;  2LRU A;  2ZPY A;  4GOC A;  4EUT A;  2I1J A;  2M0X A;  2KFK A;  4HXD A;  3DBH I;  1IYF A;  1VCB A;  2FCM A;  2YLM A;  2M1M A;  2LVP A;  2LXC A;  3X0W A;  1PQS A;  5AZG A;  2XK5 A;  4M0W B;  1JRU A;  1CMX B;  3DOW A;  4MJS B;  3A1Q A;  2DEN B;  2N9P C;  4FBJ B;  3H1U A;  2JT4 B;  2NS5 A;  3L54 A;  3WAM A;  2GBJ A;  2DZM A;  4HWI B;  3BY4 B;  1RLF A;  4FHJ A;  2MRP A;  1KJT A;  4DHJ B;  5J2R A;  3TJP A;  3VHT C;  2PEA A;  4CO7 A;  4I6N B;  2KDF B;  3AUL A;  1R4N I;  3L16 A;  3A9K A;  3K9P B;  3UGB B;  3EEC A;  3ZTD A;  4KVG B;  4BKT A;  5GMV A;  4W9D A;  3TBL D;  4LDT B;  1V5T A;  1BT0 A;  4BFR A;  3X23 A;  2NPT B;  1E7U A;  4DBG A;  3QQ8 B;  3L08 A;  3EC8 A;  1OEY A;  3B0A A;  3TMP B;  1ZW7 A;  2DHZ A;  3RZW C;  4JQW C;  1WMH A;  2N7E A;  3A9J B;  3OLM D;  1RAX A;  3ZW3 A;  4W9K A;  1VD2 A;  3ZRF A;  2LXA A;  3OJ3 A;  4MSQ B;  2KFK B;  3PVL A;  2N4F A;  2KWC A;  2W9N A;  2KAN A;  4AUQ C;  2KLC A;  1L7Y A;  2XK5 B;  3ZKJ C;  1GG3 A;  4ZRJ A;  1OTR B;  1NBF C;  4EEW A;  3AU5 A;  3H7P A;  3A1Q B;  4NAW A;  3ZNH B;  2BKF A;  2LRW A;  1YX5 B;  2RSU A;  2MQJ A;  4OVU A;  4DK5 A;  3PTF C;  1MG8 A;  2EMT A;  3A4S C;  3DBR I;  2D07 B;  4HCN B;  2OOB B;  3O65 B;  3OJ4 B;  4TQ0 A;  3QX1 A;  3DPD A;  5L95 C;  3P2B A;  1E5W A;  2KC1 A;  2GBN A;  2DYB A;  3A9K B;  4YL8 A;  2K1F A;  5C23 A;  1Q5W B;  1GC7 A;  2CR5 A;  2MBH A;  1ZKH A;  1V5O A;  2IO3 B;  2JZ3 B;  2RPQ A;  3RYT A;  4FJZ A;  1SGH A;  3L17 A;  2N7D A;  1WMH B;  5J18 A;  4W9J A;  2O2V A;  1RFA A;  2FID A;  2JRH A;  2EMS A;  2IO0 B;  2HE7 A;  1WGY A;  1EF5 A;  3AXC A;  4JIO U;  1QZE A;  3H7S A;  2HJ8 A;  4HVB A;  3WAL A;  4RM8 A;  1XT9 B;  4G0N B;  3M63 B;  4AJW A;  3I3T B;  5G2N A;  1LFD A;  3PRM B;  2REX A;  3APD A;  3GOE A;  3UIO B;  1UD7 A;  1TGZ B;  1WR1 A;  4TQ1 A;  2G4D B;  3DQV A;  4FHK A;  2KDE B;  3H7P B;  3CST A;  2DX5 B;  4NAW B;  1K8R B;  1WX8 A;  1WZ3 A;  1YJ1 A;  3ZIM A;  1T0Y A;  1C1Y B;  3JSV A;  1U4A A;  2IY0 B;  2R2Q A;  3KUZ A;  3NHE B;  3DBS A;  3OAW A;  1NI2 A;  4MGI E;  2K8H A;  4AOF A;  3DDC B;  1WX9 A;  2NBV B;  3PV1 A;  3H6N A;  4MGY E;  4K7W A;  1RRB A;  1V2Y A;  2CHW A;  3PHX B;  3PT2 B;  5DPS A;  2FCN A;  5DPR A;  2LVO A;  2N9X A;  3V60 A;  4F1S A;  2O6V D;  1LXD A;  3DVN U;  3VUW A;  1HE8 A;  4TV3 A;  2K6D B;  3KW5 B;  3VQI A;  2K25 A;  1M94 A;  3ML9 A;  5AZH A;  4CHK A;  4WJP A;  2KTR A;  1Z2M A;  2O2V B;  5C1Z A;  3LDZ E;  3QIJ A;  1WRD B;  1KM7 A;  2ZCB A;  4W9I A;  4GXB A;  1WYW B;  3R3M A;  1WJN A;  4WQO B;  3T8M A;  3VH4 B;  3M95 A;  2KD0 A;  2O6V A;  4BKS D;  2J7Q B;  2IYD B;  2L7R A;  4GDL A;  4N9F 4;  4BKG A;  5JZE B;  1G6J A;  3K9O B;  4CYE A;  1P0R A;  1UGM A;  3DBL I;  2LGD A;  2LD9 A;  3JSV B;  5FR6 A;  2KOX A;  2A4Z A;  3QK0 A;  3L13 A;  4G3X B;  1V86 A;  3VH3 B;  3S2A A;  3NOB A;  5AEK B;  3N32 A;  3CMM B;  4ZRK A;  4TKN A;  4DHZ E;  1WGG A;  1S1Q B;  2HTH A;  4XZ4 A;  4X57 B;  3SDL C;  1J8C A;  3MHS D;  3QAR A;  1P1A A;  1P9D U;  2NBU A;  2KJ6 A;  4GU2 A;  3UIP B;  3TL5 A;  4ZDV A;  2BYV E;  2JWZ A;  2JF5 A;  2BGF A;  2ASQ A;  2KTR B;  3PLV A;  4KZ0 A;  2AEH A;  1KLV A;  4BVU C;  2ZNV B;  4K7S A;  2AWT A;  1P98 A;  2G45 B;  2WYQ A;  2C7N B;  3QHT A;  4DDG D;  1WM2 A;  3ZDM C;  1WZ0 A;  2L8J A;  2O6V B;  4NQL B;  3ZVV A;  3VUX A;  5CHV C;  4GDL B;  4RM9 A;  3ZNG C;  5IA7 A;  4II3 B;  4W9H A;  2KO3 A;  1E8Z A;  2CHZ A;  2M17 A;  5J17 A;  3MJW A;  1V80 A;  2DYM A;  3HK0 A;  3L0W B;  3SHQ A;  1GJZ A;  3M3J A;  4GDK A;  2LJ5 A;  4PS8 A;  2JY6 A;  3R7R A;  3HHM A;  4GB9 A;  5JHA A;  4NY0 A;  1WJ4 A;  5D2M B;  1NDD A;  1WJ6 A;  4EOY A;  4GIV A;  2ZNV C;  4IWO A;  2DAJ A;  3VDZ A;  4E3C A;  2KC2 A;  2V1Y A;  3QA8 A;  4E71 A;  2ZEQ A;  4II2 B;  5L83 A;  4NPN A;  2Z0D B;  5DCN A;  2MBQ A;  3VVW B;  1WE7 A;  4FUL A;  3RUL A;  3JYU A;  2CKH B;  2JXX A;  3ALB A;  3RUI B;  5BO4 B;  2AYO B;  4BBN F;  4M8M A;  2GOW A;  4WWP A;  4K81 A;  1J0G A;  2FAZ A;  2HD5 B;  2JVC A;  2L0T A;  3EFU A;  4IW0 A;  1WF9 A;  3RCZ A;  5JH5 C;  2LAS A;  1YD8 U;  3IVF A;  4IC7 B;  3UF8 A;  3SU8 X;  3ZRC A;  3PRP B;  2BYF A;  2UWQ A;  4B6W A;  3WIM A;  2N1V A;  5CHF A;  4LJP B;  4MM3 A;  2A5U A;  3QCA A;  4GDK B;  3MTN B;  1AAR A;  3W1Y A;  4E74 A;  1EO6 A;  2GBM A;  5E6N A;  2V4L A;  2QHO A;  3N30 A;  3L10 B;  4EKU A;  3N3K B;  5DPW A;  2WX0 A;  2IO2 B;  3IBE A;  4K7U A;  2PE6 B;  3PS6 A;  4J6I A;  5D7G A;  2CS4 A;  2C9W B;  3GZN I;  2K6Q A;  3NS8 A;  2JRI B;  3A4R A;  3HIZ A;  3Q3F A;  5KHQ A;  2L05 A;  2KDB A;  1IPG A;  2KQ7 A;  2KKC A;  2WX1 A;  3B08 A;  2VRR B;  2ZCC A;  3KYD D;  3T9L A;  4MDK E;  2CU1 A;  4HDO A;  1E8W A;  2JZZ A;  2R2O A;  2DAF A;  3KUD B;  3QWZ B;  4OVV A;  4HCP B;  5CTR C;  4BBN C;  3CSF A;  2MBB B;  5IAA C;  1LM8 B;  2KN5 A;  3IFW B;  2Y5B B;  3ECI A;  1EUV B;  1E8Y A;  1OGW A;  4I6L B;  1WX7 A;  1LQB A;  3PRZ A;  3V6C B;  1H4R A;  2KJH B;  4ICU A;  5D6J B;  2FUH B;  4FLH A;  1WE6 A;  4NNJ B;  2JUO A;  3AI5 A;  4W9E A;  2LGY A;  3Q3J A;  4WJO A;  1GNU A;  4A20 A;  1H8C A;  4P7I A;  4EZJ A;  4K1R B;  3JVZ X;  4PS3 A;  1E8X A;  5E6P A;  1UZX B;  4ZYN A;  1WM3 A;  4DDI D;  1XD3 B;  4ANW A;  4IM2 A;  4GN1 A;  4IM3 A;  4DWF A;  2L00 B;  1GC6 A;  3PSE B;  2G4S A;  4GSW A;  1UBQ A;  4JL9 A;  4MH0 E;  5CX3 A;  3VAW A;  3WAP A;  1I42 A;  4B9K A;  3KVF B;  3DVG Y;  2OJR A;  2KVR A;  2G3Q B;  4W9G A;  3M62 B;  1OEY J;  2Z0E B;  2KK8 A;  3ZNZ B;  3NZS A;  4XC2 A;  1OQY A;  2EKE C;  3RD2 A;  1ZGU B;  1WGR A;  2B3A A;  1J19 A;  4FJY A;  4EFO A;  4HK2 A;  3ENE A;  4FAD A;  1WI0 A;  2JPH A;  3APC A;  4G50 A;  4LDT D;  5CHW A;  3WAO A;  4BKS A;  4IWQ A;  3HM6 X;  3ZDT A;  1FXT B;  1UEL A;  3QAQ A;  3KUC B;  2K8B A;  3IG3 A;  3LJ3 A;  3KYC D;  3VXW A;  4NQK E;  4LCD E;  2C60 A;  1V9J A;  1YX6 B;  2C7M B;  1WXM A;  1WH3 A;  2J0K A;  1YIW A;  1Z5S B;  2KX0 A;  2C5L C;  3H9D A;  1YQB A;  2NVU I;  2ZVN A;  4HJK A;  2D10 A;  4HLE A;  2MWS B;  1SIF A;  1C3T A;  3AU4 A;  4MEL A;  3ML8 A;  3U7D A;  4W9F A;  2K39 A;  2BWE S;  2LZ6 A;  2FCS A;  5KHO A;  3V6E B;  4F8C B;  4KV2 A;  4WJN A;  2J0M A;  4ANX A;  3RZF A;  1UH6 A;  2NBW B;  2MCN B;  1P3Q U;  4A3P A;  1GUA B;  2NCN A;  5HKH A;  2ZZP B;  4PS7 A;  3WA0 A;  3KH0 A;  2I1K A;  1TTN A;  2J0J A;  5LXH A;  3PRE A;  1WXA A;  2KLG A;  3DCG A;  1WGD A;  4IUM B;  3R66 C;  2MA9 B;  4KSK C;  4URK A;  5DPT A;  2PE9 A;  3VTW A;  3QJZ A;  2PPH A;  2DZK A;  1F9J A;  3PHW B;  4FA6 A;  4KDL B;  1WJU A;  4BOS C;  2BWF A;  3W1S A;  2UYZ B;  4HPM B;  1WY8 A;  2YVC A;  2DYO A;  3ONS A;  4I6P A;  5LXI B;  2N9E B;  4TUU A;  1I35 A;  3HM3 A;  3A33 B;  1Q0W B;  3C0R B;  1SE9 A;  3CF6 E;  2NR2 A;  4EZL A;  2LUE A;  2KXJ A;  2KQS A;  3TIX A;  1XQQ A;  2MW5 A;  4GGQ A;  4IG7 B;  3V62 A;  2IBI B;  1E90 A;  1Q1O A;  2KWV B;  2XEW A;  4WJQ A;  5LLI A;  2FNJ B;  3NY5 A;  2L3Z A;  3TCA A;  2KFJ A;  3QC8 B;  4DHZ B;  1WFY A;  1WGH A; 
#chains in the Genus database with same CATH topology
 2L0F A;  2ZVO A;  4ITK A;  1J7A A;  2IZV B;  4WWN A;  4ANU A;  2PTL A;  2LMC A;  4P1C C;  1A5R A;  2KWU B;  3DWM A;  3U8Z A;  5G55 A;  4YSY B;  2MP2 A;  3JW0 X;  1GAQ B;  4H2A A;  2LGX A;  1WR6 E;  5BMG A;  4LJO B;  4AS1 A;  1TS3 A;  1R4M I;  3PLU A;  4IM0 A;  3ZQ4 A;  4ZRI A;  4W9L A;  1FRR A;  2BPS A;  3LYY A;  3OWE B;  1TY0 A;  3W1S C;  2GBR A;  4ANV A;  3EHV A;  3AB5 A;  4ICV A;  2MBE A;  4PYZ A;  1ZP0 B;  2KZR A;  4M8N A;  2M8S A;  4DHJ D;  4XX5 A;  4ZOH C;  1TKY A;  4FJV B;  5JHB A;  3UQB A;  3MFG A;  4WAA A;  4LNI A;  2ZPN A;  3VTV A;  2D2Q A;  4PYU A;  3ZNI D;  5FKA C;  2IDY A;  2V3S A;  4G11 A;  4XWW A;  1QOF A;  3BYT B;  2WDT B;  4AWJ A;  1N61 A;  3BIN A;  3PPA A;  2WU2 B;  4MGK E;  2PVO D;  5AUI A;  1V81 A;  1ZXI A;  2M0X A;  2KFK A;  3VR9 B;  1WSP A;  2YLM A;  1CJE A;  4MH8 A;  1MG4 A;  1JRU A;  2KMM A;  2N9P C;  2JT4 B;  4HWI B;  2BYT A;  2ZW1 A;  3TJP A;  4HPP A;  3AUL A;  4BKT A;  3EEC A;  2KT7 A;  2FE8 A;  5GMV A;  3U52 E;  4BFR A;  2NPT B;  2OJW A;  2RPV A;  1OEY A;  1HZ6 A;  3HRD D;  2LHD A;  1VD2 A;  3OJ3 A;  2N4F A;  2W9N A;  2KLC A;  1L7Y A;  1E6E B;  4ZRJ A;  1SB3 C;  4RGN A;  4EEW A;  3H7P A;  1C77 A;  2KWD A;  2LRW A;  1YX5 B;  2RSU A;  2MQJ A;  1C4P A;  1EWC A;  1MG8 A;  4S17 A;  3DBR I;  4KGS A;  2GRI A;  4HCN B;  4TQ0 A;  3DPD A;  1WWT A;  2V4I B;  2WU5 B;  3EUB 2;  2RDB C;  1B9R A;  2JZ3 B;  3RYT A;  4FJZ A;  4W9J A;  2O2V A;  2IO0 B;  2HE7 A;  4JIO U;  1QZE A;  4ACF A;  4HVB A;  3WAL A;  2E3T A;  3PO0 A;  1WR1 A;  4LNK A;  3DQV A;  1QIL A;  1EU3 A;  2KN4 A;  1UWM A;  1WZ3 A;  1T0Y A;  3JSV A;  2PLP A;  4DQO C;  1Y56 A;  3OAW A;  3VR8 B;  1UNS A;  1NI2 A;  2L52 A;  1XCQ L;  1JW9 D;  1SE2 A;  3KWL A;  3H6N A;  3RNG C;  3Q69 A;  1RRB A;  2CHW A;  3PHX B;  3V60 A;  2LVO A;  2N9X A;  2JSV X;  4TV3 A;  2K6D B;  3UI3 A;  3VQI A;  5AZH A;  2QCZ A;  2INP E;  3RNA C;  1XEE A;  5C1Z A;  3T8M A;  2FUG 1;  1JWU D;  2IYD B;  2L7R A;  4C4V A;  3K9O B;  4PT5 A;  1ZDX A;  3BWU D;  4WIP A;  1P0R A;  3MC0 B;  3DBL I;  2HJ1 A;  1T6B X;  3DHG C;  3P4S B;  3NOB A;  3N32 A;  4TKN A;  1D5M C;  1L6U A;  4DHZ E;  1QQR A;  4KKI A;  2HTH A;  4X57 B;  1J8C A;  3MHS D;  3QAR A;  1P1A A;  4RF1 A;  2KDM A;  4N59 A;  3R8B A;  1RYJ A;  2JWZ A;  1C78 A;  1V1P A;  2ASQ A;  2KTR B;  2QJL A;  1YOV B;  3FAH A;  2WXI A;  3O13 A;  4K7S A;  2AWT A;  1WM2 A;  3ZDM C;  1AW7 A;  4WH4 A;  4II3 B;  2KO3 A;  3AE2 B;  2W82 A;  2CHZ A;  3GB1 A;  1GJZ A;  1XXG A;  4RH6 A;  2LJ5 A;  4ZHP A;  1NDD A;  1R7S A;  1GB4 A;  4IWO A;  2KC2 A;  4E71 A;  1GPX A;  3V3X A;  4FXC A;  4NPN A;  3ZJV A;  5HFY A;  3RUL A;  1J7C A;  2JXX A;  3ALB A;  3AEF B;  1HZ5 A;  4LNF A;  4BBN F;  4O1N A;  5G5H A;  2FAZ A;  2HD5 B;  2JVC A;  1UWX A;  4IW0 A;  4US9 A;  5JH5 C;  3IVF A;  1JML A;  3UF8 A;  3U7Z A;  1XO3 A;  3PRP B;  2BYF A;  2IPK D;  4B6W A;  4MM3 A;  1F77 A;  1KF6 B;  2A5U A;  4GDK B;  4E74 A;  2GBM A;  3Q8E A;  3N30 A;  5DPW A;  1TZO A;  4LTU A;  4K7U A;  3R2I A;  3ZXR A;  1YN4 A;  3GZN I;  2K6Q A;  3NS8 A;  1JRO A;  2WX1 A;  2WXQ A;  3B08 A;  3KYD D;  3T9L A;  4HDO A;  1E8W A;  2JZZ A;  2R2O A;  2Y5C A;  4HCP B;  1TIF A;  2BVC A;  5IAA C;  1TKG A;  2Y5B B;  4OHJ A;  2RDG A;  2JQR B;  4NNJ B;  4EZJ A;  1UGJ A;  1STE A;  3B2G A;  1N60 A;  4GSW A;  1GC6 A;  4DXF A;  1UBQ A;  3VAW A;  4M01 A;  5I4D A;  2G3Q B;  3ZNZ B;  4XC2 A;  1TJE A;  2EEL A;  1J19 A;  4HK2 A;  3APC A;  1E7P B;  3HM6 X;  5AUK A;  4YWG G;  2SEB D;  1XCT L;  3IG3 A;  3CWI A;  4HEA 1;  5BYQ A;  3VXW A;  4NQK E;  2AX5 A;  1YX6 B;  3B2F A;  1XLN A;  1JAL A;  2ZVN A;  2D10 A;  1L4Z B;  3AEA B;  2MWS B;  2KVZ A;  3U7D A;  2LZ6 A;  2FCS A;  1JQ4 A;  3RZF A;  2NBW B;  4N6E B;  1P3Q U;  1GUA B;  2QMT A;  1L0Y B;  2ZZP B;  4PS7 A;  3WA0 A;  3KH0 A;  2I1K A;  1TTN A;  3PRE A;  1WXA A;  1MHX A;  4IUM B;  3NVW A;  3R66 C;  2MA9 B;  4URK A;  2PE9 A;  3VTW A;  1F9J A;  2WDQ B;  3MC9 A;  2K9X A;  4JX1 C;  1WY8 A;  2DYO A;  4TSS A;  5LXI B;  1IGC A;  2K22 A;  2N9E B;  3HM3 A;  2BS4 B;  2OHF A;  3CF6 E;  1C9F A;  2X8X X;  3TIX A;  4RGT A;  5HI1 A;  4IG7 B;  2IBI B;  3I57 A;  2DLB A;  2G9H D;  1SXT A;  2KFJ A;  4ZHO A;  3SEB A;  4DHZ B;  1WFY A;  3Q8F A;  1XF5 L;  2PJH A;  1WXQ A;  4KGR A;  5D94 A;  2LUM A;  1V97 A;  4JGH B;  2N1W A;  2EKI A;  3Q3O C;  4XE0 A;  2FIF A;  1V49 A;  1TS4 A;  1I4Q A;  1WXS A;  3GE3 C;  1X1M A;  3NZU A;  2M4N A;  2C7H A;  1WIA A;  5E6O A;  2BS2 B;  5T8I A;  2BB5 A;  4PK1 A;  1F52 A;  2WXN A;  5H8Y E;  4A90 A;  3ZO5 B;  1T0Q C;  3DVG X;  3IHP C;  3D32 A;  4GLS C;  2GI9 A;  3MHZ A;  2LI5 A;  5GXG B;  2BF8 B;  4M00 A;  2D3G A;  2RGF A;  2JWU A;  5AZF A;  1T0R C;  4HJG E;  5IKC M;  3WAN A;  1ET9 A;  4KSL C;  2M0A A;  5EDS A;  2NMQ A;  2GMI C;  4K3B A;  5LNK 1;  2IY1 B;  4RMA A;  3U30 A;  2DZI A;  1WGK A;  2L76 A;  1EF1 A;  2NPT A;  3RT3 B;  4HPL B;  3DVN V;  1IP9 A;  2K8C A;  1N5W A;  1V1O A;  3VTU A;  4EUT A;  3W2D A;  3ETR A;  2YEP F;  3AEE B;  1PQS A;  4M0W B;  3HVD A;  1CMX B;  3DOW A;  5IO9 A;  4MJS B;  2BTE A;  4FBJ B;  1FFU A;  3WAM A;  1D5Z C;  3HUI A;  1RLF A;  1NI3 A;  1JWM D;  4FHJ A;  2KDF B;  1R4N I;  2JX5 A;  2DNF A;  4LDT B;  3NG0 A;  3X23 A;  3L08 A;  3EC8 A;  1ZW7 A;  3RZW C;  3AE9 B;  3OLM D;  1RAX A;  2VH2 A;  4W9K A;  1ZXH A;  2KAC A;  2KWC A;  4HRO A;  1L4D B;  1SE4 A;  4LLG M;  1RM6 C;  3VRB B;  1NBF C;  3ZNH B;  2BKF A;  4DK5 A;  2MEK A;  3QX1 A;  3FC4 A;  5L95 C;  2GBN A;  3A9K B;  4ZRP A;  2IO3 B;  1SGH A;  2N7D A;  5J18 A;  2FID A;  1YN3 A;  3ZJU A;  1EF5 A;  3AXC A;  2HJ8 A;  3WCQ A;  1XT9 B;  4G0N B;  3M63 B;  2AQ2 B;  3APD A;  1SEB D;  4B0M A;  2G4D B;  1TS2 A;  4NAW B;  1WX8 A;  1VLB A;  1C1Y B;  3OG5 A;  2R2Q A;  3KUZ A;  3W5V B;  3DBS A;  4XWT A;  4RFB A;  1WX9 A;  2AQ1 B;  4K7W A;  2N0S B;  3E56 A;  2FCN A;  2BS3 B;  3EGR A;  2K25 A;  3ML9 A;  4A9A A;  4C80 A;  2BB6 A;  2KTR A;  2QIL A;  1WRD B;  2ZCB A;  4GXB A;  2HDE A;  1WJN A;  3M95 A;  3Q8C A;  3IAS 1;  3ZXV A;  4BKS D;  4CYE A;  1UGM A;  2HTM E;  3BVG A;  2LD9 A;  1FXI A;  5FR6 A;  2N9K A;  2A4Z A;  3L13 A;  5BMI A;  3VH3 B;  5AEK B;  2LFI A;  3CMM B;  1AWD A;  5IP4 D;  1WGG A;  4XZ4 A;  3SDL C;  1YJJ A;  2MJD A;  1P9D U;  1NYQ A;  3MJ5 A;  3AV8 A;  2JF5 A;  3Q3N C;  1KLV A;  4RNA A;  2K3U A;  3QHT A;  2DWQ A;  3RN9 C;  2BT6 A;  2O6V B;  4NQL B;  3ZVV A;  3VUX A;  4GDL B;  3AEG B;  1V80 A;  3SHQ A;  3M3J A;  4GDK A;  2JY6 A;  3R7R A;  2Y5P A;  4NY0 A;  1WJ6 A;  4EOY A;  2ZNV C;  2INN E;  3TEY A;  2V1Y A;  1FPY A;  1KFY B;  4II2 B;  2Z0D B;  3T3O A;  3IT4 B;  4FUL A;  2CKH B;  2WDR B;  1HTO A;  3N1Y C;  5BO4 B;  2IGD A;  4M8M A;  4WWP A;  4K81 A;  2TSS A;  4K3C A;  2L0T A;  3EFU A;  1WF9 A;  1ZE3 D;  2LAS A;  1E9M A;  4IC7 B;  4REZ A;  3ZRC A;  4XGA B;  2UWQ A;  3WIM A;  2N1V A;  1ZPS A;  1NEK B;  4LJP B;  2QHO A;  3P42 A;  3L10 B;  4EKU A;  2WX0 A;  3GS2 A;  3PS6 A;  4J6I A;  5D7G A;  2CS4 A;  1DOX A;  2C9W B;  4OZC A;  3W5U B;  3A4R A;  3HIZ A;  3Q3F A;  1IPG A;  2ZCC A;  4MDK E;  2CU1 A;  1FEH A;  3KUD B;  2DAF A;  3U4E G;  1VJK A;  1XLO A;  3RNB C;  1E8Y A;  1WX7 A;  3PRZ A;  1YNT E;  4FLH A;  1H8C A;  5EE0 A;  1UZX B;  2QEJ C;  2PVG C;  2PW9 A;  1WM3 A;  4DWF A;  4LNO A;  2L00 B;  2E6X A;  3PSE B;  4MH0 E;  5CX3 A;  3WAP A;  1TS5 A;  1SIJ A;  1I42 A;  3I9V 1;  4B9K A;  2Z8L A;  1FO4 A;  2Z0E B;  2H88 B;  2EKE C;  4KGT A;  5D3D A;  3GP7 A;  3Q6B A;  4FJY A;  2K5P A;  2JYE A;  3KQ4 A;  4LDT D;  3WAO A;  4BKS A;  3DHI C;  3SFE B;  1VZ6 A;  3KUC B;  2K8B A;  1SJH D;  2DBY A;  2PIA A;  1V9J A;  2C7M B;  2LHE A;  5EE3 A;  2QC8 A;  3E9S A;  4OZB A;  2C5L C;  3H9D A;  1YQB A;  2NVU I;  5BYR A;  3CIR B;  1SIF A;  3AEB B;  4MEL A;  1M4V A;  1T0S C;  1UH6 A;  4C00 A;  2NCN A;  5LXH A;  1T3Q A;  1FCC C;  1TYG B;  2AQ3 B;  4YSX B;  2PPH A;  2DZK A;  4KDL B;  1WJU A;  3SFD B;  4C56 C;  2BWF A;  3AEC B;  2UYZ B;  2YVC A;  3V05 A;  1K51 A;  1I35 A;  4HKZ E;  3RMK C;  2VZK B;  3C0R B;  2NR2 A;  4EZL A;  2KQS A;  2D5G A;  2MW5 A;  4YTM B;  1VDV A;  3DWG C;  3ZJT A;  1E90 A;  4BAX A;  2L3Z A;  2D3A A;  1C4C A;  3BZD B;  2WXF A;  4C7Y A;  4KDI C;  2V3P A;  3Q8B A;  2V0G A;  3ZTC A;  1UBI A;  2MX2 A;  1YQ4 B;  2LWP A;  4MGZ E;  4A3O A;  1YMH E;  4NJ7 A;  1E7V A;  4JWU C;  2XBB C;  3APF A;  4JWS C;  3J9C A;  5C3J B;  1VR9 A;  4YXD B;  2J53 A;  4P1B C;  1DGJ A;  5H92 C;  2LJI A;  4L23 A;  3AE5 B;  5IN7 A;  1P7E A;  2LVQ A;  4R3D A;  4JLC A;  1S3S G;  2BYE A;  2R61 A;  2MSE D;  4OZA A;  5BMH A;  1JWB D;  2KAJ A;  4KIK B;  2J4X A;  3RI7 C;  2KNB A;  2QIE B;  1L2N A;  1V6E A;  2BKR B;  2MLB A;  4OW0 A;  4CQN A;  4M0W A;  3ZLZ A;  4IWP A;  4D2K A;  2ZJD A;  4MJS A;  2CHX A;  2IO1 B;  3IXS A;  2WXM A;  4J3O D;  4KZC A;  1R4M B;  2MBO A;  3BVZ A;  4B95 A;  4WQM A;  2KMA A;  3NVV A;  4EZK A;  1KOT A;  4B0E A;  2RD0 A;  1TBE A;  2WS3 B;  2L1A A;  2IND C;  4MEM A;  2LRU A;  2ZPY A;  4GOC A;  4A6Q A;  2I1J A;  1IYF A;  3AM9 A;  1VCB A;  2M1M A;  2LVP A;  2LXC A;  5AZG A;  4JPS A;  2D3B A;  3H1U A;  2NS5 A;  1N63 A;  2YEP B;  2MRP A;  1KJT A;  4DHJ B;  4CO7 A;  3A9K A;  4KVG B;  3TBL D;  1V5T A;  3P4R B;  1QOB A;  4DBG A;  3QQ8 B;  2DHZ A;  3A9J B;  1HXY D;  3ZRF A;  4MSQ B;  4AUQ C;  4A55 A;  2XK5 B;  2LEK A;  3AU5 A;  2XNA C;  3A1Q B;  4NAW A;  3PTF C;  3NUH B;  1ROE A;  2KQ4 X;  3OJ4 B;  1PGA A;  2WXG A;  4NAM A;  1E5W A;  4WWM A;  2DYB A;  4YL8 A;  2K1F A;  2MBH A;  2FBW B;  1HQR D;  1V5O A;  2RPQ A;  1K52 A;  2JXT A;  3L17 A;  1WMH B;  1WGY A;  2V9H A;  3H7S A;  1FXA A;  1RFK A;  4RM8 A;  4AJW A;  3I3T B;  5G2N A;  3PRM B;  3GOE A;  1TKE A;  1TGZ B;  4TQ1 A;  1DOY A;  2VH1 A;  4M02 A;  2KDE B;  4YT0 B;  1YJ1 A;  3ZIM A;  1U4A A;  2IY0 B;  3NHE B;  1VZ7 A;  3P63 A;  4MGI E;  1JRP A;  3KWV A;  2K8H A;  4AOF A;  2LGI A;  3DDC B;  3DBR B;  2NBV B;  3AED B;  4MGY E;  1V2Y A;  5DPR A;  4F1S A;  2WXK A;  3DVN U;  4YTN B;  1GB1 A;  1M94 A;  2ACZ B;  2WXR A;  4CHK A;  1Z2M A;  4OVZ A;  3QIJ A;  1KM7 A;  4W9I A;  1GOZ A;  3R3M A;  2PKO A;  1EWY C;  3LXF A;  2KD0 A;  1SSN A;  2O6V A;  2J7Q B;  5JZE B;  4GDL A;  4BKG A;  4N9F 4;  1G6J A;  5FR3 A;  4XDC A;  2LGD A;  4KKJ A;  3QK0 A;  4G3X B;  3MP9 A;  3S2A A;  3N1Z C;  1OQQ A;  1S1Q B;  4GU2 A;  2BYV E;  1MPE A;  2BGF A;  2AEH A;  1WYG A;  3NS1 A;  3TEZ A;  1WZ0 A;  2L8J A;  4Q2J A;  1NVI D;  5CHV C;  3ZNG C;  5IA7 A;  4W9H A;  3FIL B;  2RMM A;  2M17 A;  3MJW A;  2Y3A A;  2DYM A;  3L0W B;  1VZ8 A;  2JYT A;  3HHM A;  4GB9 A;  1JWA D;  5D2M B;  1C4A A;  3VDZ A;  4E3C A;  3QA8 A;  2W55 A;  4RGM A;  1KH0 A;  1XLP A;  2WGS A;  3DBH B;  3JYU A;  1L0V B;  5JXV A;  3AE1 B;  1RWS A;  1J0G A;  2KYW A;  3BVM A;  4XYC A;  1YD8 U;  3SU8 X;  3P4Q B;  2SAK A;  4ZYS A;  4ARI A;  2B76 B;  2MJE A;  3I5J C;  3MTN B;  1AAR A;  1ZUD 2;  1ZDV A;  1MJD A;  1SF0 A;  4RGO S;  2JRI B;  5KHQ A;  2L05 A;  1A70 A;  2KQ7 A;  2KKC A;  2WXH A;  4XDD A;  2J52 A;  4OVV A;  3QWZ B;  1LM8 B;  3IFW B;  1EUV B;  1I4H A;  1OGW A;  1LQB A;  3V6C B;  2KJH B;  4ICU A;  2ZW0 A;  3EA6 A;  3AI5 A;  4W9E A;  2LGY A;  4WJO A;  4A20 A;  1KLU D;  4P7I A;  3NZ3 A;  1J7B A;  1E8X A;  1XD3 B;  1I4G A;  1D5X C;  1PGB A;  4GN1 A;  2W3S A;  4JL9 A;  2G4S A;  3GZN B;  3DVG Y;  2WNM A;  4W9G A;  3M62 B;  1OEY J;  2KK8 A;  3RD2 A;  1ZGU B;  3N9Y C;  1WGR A;  2B3A A;  3ENE A;  4FAD A;  3Q14 C;  4G50 A;  1MHH E;  2UU7 A;  1PUT A;  3ZDT A;  3B9J A;  1UEL A;  4P16 A;  1KLG D;  3PZ7 A;  1AYF A;  4HRS A;  3W9C B;  2C60 A;  1CZP A;  1WH3 A;  2GB1 A;  1YIW A;  1C76 A;  4RF0 A;  2N9L A;  5D3I B;  1D6E C;  3RFZ B;  4HLE A;  3AE8 B;  1C3T A;  1NYR A;  4W9F A;  2BWE S;  5KHO A;  2IGG A;  3V6E B;  4F8C B;  2D3C A;  1VRA B;  4KV2 A;  4WJN A;  1V8C A;  2J0M A;  4JE3 B;  4ANX A;  2MCN B;  3Q3M C;  4A3P A;  2L83 A;  5HKH A;  2J0J A;  4A8X C;  2KLG A;  3DCG A;  1EU4 A;  4KSK C;  2X38 A;  5DPT A;  3QJZ A;  1OQR A;  3AN1 A;  4FA6 A;  3AMZ A;  5IOI A;  3W1S A;  4HPM B;  3ONS A;  3A33 B;  5TSS A;  1Q0W B;  2BBC A;  1SE9 A;  1XQQ A;  2KWV B;  1HA5 A;  1Q1O A;  2XEW A;  3BK1 A;  3LB8 C;  4WJQ A;  5LLI A;  2FNJ B;  2WXO A;  4L2Y A;  1I4X A;  3IT6 B;  3QC8 B;  1HTQ A;  1WGH A;  1FXT B;  4BOZ B;  4FN2 A;  2GBK A;  4KIK A;  2D11 A;  2WWZ A;  1FD6 A;  1SE3 A;  2FCQ A;  4DXA B;  3Q8A A;  1I7H A;  2WXL A;  1D3Z A;  2M19 A;  3FKY A;  4AP4 C;  3PZD A;  2KX3 A;  5BYS A;  1I4R A;  1QT9 A;  3RPF C;  1QLB B;  2OED A;  3SD5 A;  4BZA A;  3Q2A C;  1N5X A;  4P6V F;  1F2R I;  3BYY B;  1HEZ E;  2KHW B;  4W9C A;  1K53 A;  2H89 B;  3V61 A;  1Y8R C;  3L4P A;  1IBX B;  4HDQ A;  4AJY B;  3C8Y A;  4NJ6 A;  4UDU C;  2RR9 A;  1BXT A;  3R7Q A;  2N7J A;  3B1L X;  3ZUN A;  4US8 A;  2LGS A;  2MH7 A;  1YN5 A;  2INC C;  4MT5 A;  5TR5 A;  2AL3 A;  3RNC C;  4F7Z A;  2MP2 B;  2DZJ A;  2KTF A;  2CU3 A;  4RCO A;  3GE8 C;  3UIN B;  4MSM B;  1ISN A;  1IGD A;  4ASW C;  1JWS D;  2KMC A;  4GMV A;  3BK2 A;  3ABV B;  2AL6 A;  3VFK A;  2KJR A;  2Z59 B;  1EM7 A;  3UQA A;  3AE3 B;  3PGE A;  1ENF A;  2KDI A;  1B1Z A;  3VRA B;  1WXV A;  1QOG A;  3A9J A;  4WWO A;  1TZ1 A;  2XN9 C;  3VUY A;  4HXD A;  3DBH I;  1QF6 A;  2FCM A;  1F2R C;  2IGH A;  3X0W A;  3TUO A;  2XK5 A;  3TSS A;  2QSD A;  3A1Q A;  2DEN B;  3L54 A;  2GBJ A;  2DZM A;  1DYQ A;  3BY4 B;  3KLS X;  2M56 B;  5J2R A;  3VHT C;  2PEA A;  4I6N B;  2NTS A;  3ZTD A;  3L16 A;  3K9P B;  3UGB B;  2L32 A;  4W9D A;  1QKZ A;  2ICI A;  5HHD G;  1BT0 A;  1E10 A;  1E7U A;  3B0A A;  3TMP B;  4JQW C;  1WMH A;  2N7E A;  5C2T B;  3ZW3 A;  1TT5 B;  2LXA A;  3SR6 A;  1PYW D;  1FIQ A;  2KFK B;  3PVL A;  2KAN A;  2V3N A;  2QDF A;  3ZKJ C;  1GG3 A;  1OTR B;  3AE4 B;  3U2S C;  3NRZ A;  4OVU A;  2EMT A;  3A4S C;  2D07 B;  5HG2 A;  2OOB B;  4EE2 A;  3O65 B;  3NVZ A;  3P2B A;  2KC1 A;  2ON8 A;  1PDX A;  5C23 A;  1Q5W B;  1GC7 A;  2CR5 A;  1ZKH A;  2WP9 B;  1R4N B;  1KRH A;  3AE6 B;  4LK0 M;  1RFA A;  1AN8 A;  2JRH A;  2EMS A;  1FCL A;  1LFD A;  4NZL B;  2REX A;  3UIO B;  1UD7 A;  4NJC A;  1PFD A;  4FHK A;  3H7P B;  1ET6 A;  3CST A;  2DX5 B;  1K8R B;  1NEN B;  1FRD A;  4DXG A;  1L6V A;  3C19 A;  3PV1 A;  3AH7 A;  5DPS A;  3PT2 B;  3TEX A;  2O6V D;  1LXD A;  3VUW A;  1SBB B;  1HE8 A;  3KW5 B;  2MJ3 A;  4WJP A;  3URY A;  1L0X B;  2O2V B;  3EFC A;  4C7Z A;  3LDZ E;  1MVK A;  1BUI C;  1WYW B;  3VH4 B;  4WQO B;  3IAM 1;  3N20 C;  4WAF A;  2WLB A;  2MHJ A;  1T5X D;  2ONQ A;  2JZP A;  3FIL A;  4ZRQ A;  4N58 A;  2BQQ A;  3JSV B;  3AE7 B;  2KOX A;  1IUE A;  1N62 A;  2Q5W D;  1V86 A;  1KTK A;  1FNW A;  4ZRK A;  3DHH C;  1OFF A;  2IJ0 A;  2NBU A;  2KJ6 A;  1YJI A;  3UIP B;  3TL5 A;  4ZDV A;  1JCK B;  3N1X C;  5E6J A;  3PLV A;  4KZ0 A;  4MAC A;  4BVU C;  2ZNV B;  1P98 A;  2G45 B;  2WYQ A;  2C7N B;  4DDG D;  3NVY A;  4S0R A;  4RM9 A;  1MI0 A;  5G5G A;  4C4V B;  1E8Z A;  5J17 A;  3HK0 A;  1E0Z A;  2J42 A;  1N6Z A;  3ZYY X;  4PS8 A;  3ZGZ A;  1C79 A;  3PZ8 A;  5JHA A;  1TY2 A;  1WJ4 A;  1P7F A;  4GIV A;  1CK1 A;  2DAJ A;  2JU6 X;  2ZEQ A;  4HKQ A;  5L83 A;  5DCN A;  2MBQ A;  3VVW B;  1WE7 A;  2WQY B;  1V1P B;  3RUI B;  2AYO B;  2GOW A;  1XLQ A;  1FMA D;  3RCZ A;  4QAY A;  4LNN A;  2BW2 A;  1ESF A;  2CJN A;  2PMV A;  2W3R A;  5CHF A;  1FM0 D;  3QCA A;  3W1Y A;  1EO6 A;  5E6N A;  2V4L A;  1LGR A;  2I38 A;  3N3K B;  2IO2 B;  3IBE A;  2PE6 B;  4TMA B;  2KDB A;  3HVZ A;  5FK9 C;  2VRR B;  4YSZ B;  1CQV A;  4BBN C;  5CTR C;  1LO5 D;  3CSF A;  2MBB B;  2KN5 A;  3ECI A;  4I6L B;  1H4R A;  5D6J B;  2FUH B;  1WE6 A;  2RDH A;  1K50 A;  2JUO A;  4MM3 B;  3Q3J A;  2GLS A;  1GNU A;  1PGX A;  3RNE C;  1UUP A;  4K1R B;  3JVZ X;  4PS3 A;  4USA A;  5E6P A;  1UF0 A;  4ZYN A;  4DDI D;  2WXJ A;  4IM2 A;  4ANW A;  4IM3 A;  2WHI A;  1D4B A;  3KVF B;  3BII D;  2OJR A;  2KVR A;  4IDI A;  3NZS A;  1FFV A;  1OQY A;  1Q10 A;  3TEW A;  4EFO A;  3T3N A;  1WI0 A;  2JPH A;  5CHW A;  1F1H A;  4IWQ A;  4WUR A;  2WXP A;  3QAQ A;  1FNU A;  3RNF C;  2VZK D;  3LJ3 A;  1QOA A;  3KYC D;  1I4P A;  4LCD E;  3I63 C;  1WXM A;  2J0K A;  1YQ3 B;  1Z5S B;  2CJO A;  2KX0 A;  3MC8 A;  2NTT A;  4HJK A;  1BML C;  2WDV B;  4YTP B;  1F0Z A;  4L1B A;  3AU4 A;  3NJT A;  3ML8 A;  2K39 A;  4IKG A;  4KX6 B;  3P1M A;  4ARC A;  1MFW A;  1WRI A;  3DBL B;  3P4P B;  1L5P A;  5MPO A;  1WGD A;  4AQ7 A;  1ACC A;  3PHW B;  4BOS C;  5EE9 A;  2G1E A;  2I2Y A;  2W54 A;  4I6P A;  3H8H A;  2K0P A;  1DOI A;  4IOI E;  5EE1 A;  1SJE D;  4TUU A;  1FNV A;  2LUE A;  2KXJ A;  4GGQ A;  3V62 A;  1IBX A;  3NY5 A;  3R2T A;  3TCA A;  1ZOY B; 
#chains in the Genus database with same CATH homology
 2L0F A;  2ZVO A;  4BOZ B;  4FN2 A;  2PJH A;  2GBK A;  4KIK A;  2D11 A;  2WWZ A;  2IZV B;  4KDI C;  4WWN A;  2FCQ A;  5D94 A;  4ANU A;  4DXA B;  4JGH B;  1D3Z A;  2N1W A;  3ZTC A;  1UBI A;  2MX2 A;  1A5R A;  2FIF A;  3PZD A;  2KX3 A;  4AP4 C;  2KWU B;  1V49 A;  2LWP A;  4MGZ E;  4A3O A;  1WXS A;  3SD5 A;  4NJ7 A;  1E7V A;  3U8Z A;  5G55 A;  2MP2 A;  3JW0 X;  2XBB C;  3APF A;  1X1M A;  3NZU A;  2M4N A;  2C7H A;  1WIA A;  1WR6 E;  2LGX A;  5E6O A;  4LJO B;  2KHW B;  4W9C A;  1R4M I;  3V61 A;  1Y8R C;  3PLU A;  4HDQ A;  4IM0 A;  4ZRI A;  4AJY B;  4W9L A;  4NJ6 A;  2BPS A;  3ZO5 B;  2RR9 A;  2LVQ A;  4JLC A;  1S3S G;  2BYE A;  3R7Q A;  2MSE D;  3W1S C;  2GBR A;  3DVG X;  4KIK B;  4ANV A;  3B1L X;  3ZUN A;  3EHV A;  2KNB A;  3IHP C;  4ICV A;  2MBE A;  3D32 A;  4PYZ A;  1L2N A;  1V6E A;  2BKR B;  2LI5 A;  2MLB A;  2BF8 B;  2D3G A;  2KZR A;  2RGF A;  5TR5 A;  4M8N A;  2AL3 A;  2M8S A;  5AZF A;  4DHJ D;  4XX5 A;  4F7Z A;  3ZLZ A;  4IWP A;  2ZJD A;  2MP2 B;  2DZJ A;  4MJS A;  3WAN A;  2KTF A;  4FJV B;  5JHB A;  4WAA A;  4KSL C;  3UQB A;  2CHX A;  2IO1 B;  5EDS A;  2GMI C;  3UIN B;  2ZPN A;  4MSM B;  3VTV A;  1ISN A;  2D2Q A;  2IY1 B;  4RMA A;  4PYU A;  4ASW C;  3U30 A;  2KMC A;  4GMV A;  3ZNI D;  4KZC A;  2V3S A;  2AL6 A;  2DZI A;  4G11 A;  3VFK A;  2KJR A;  2MBO A;  2Z59 B;  4B95 A;  3UQA A;  3PGE A;  2L76 A;  1EF1 A;  2KMA A;  2WDT B;  2KDI A;  2NPT A;  4EZK A;  1KOT A;  2RD0 A;  3RT3 B;  4AWJ A;  1WXV A;  4HPL B;  1TBE A;  3BIN A;  3DVN V;  1IP9 A;  3PPA A;  3A9J A;  4WWO A;  2K8C A;  4MEM A;  1TZ1 A;  4MGK E;  3VTU A;  1V81 A;  3VUY A;  2LRU A;  2ZPY A;  4GOC A;  4EUT A;  2I1J A;  2M0X A;  2KFK A;  4HXD A;  3DBH I;  1IYF A;  1VCB A;  2FCM A;  2YLM A;  2M1M A;  2LVP A;  2LXC A;  3X0W A;  1PQS A;  5AZG A;  2XK5 A;  4M0W B;  1JRU A;  1CMX B;  3DOW A;  4MJS B;  3A1Q A;  2DEN B;  2N9P C;  4FBJ B;  3H1U A;  2JT4 B;  2NS5 A;  3L54 A;  3WAM A;  2GBJ A;  2DZM A;  4HWI B;  3BY4 B;  1RLF A;  4FHJ A;  2MRP A;  1KJT A;  4DHJ B;  5J2R A;  3TJP A;  3VHT C;  2PEA A;  4CO7 A;  4I6N B;  2KDF B;  3AUL A;  1R4N I;  3L16 A;  3A9K A;  3K9P B;  3UGB B;  3EEC A;  3ZTD A;  4KVG B;  4BKT A;  5GMV A;  4W9D A;  3TBL D;  4LDT B;  1V5T A;  1BT0 A;  4BFR A;  3X23 A;  2NPT B;  1E7U A;  4DBG A;  3QQ8 B;  3L08 A;  3EC8 A;  1OEY A;  3B0A A;  3TMP B;  1ZW7 A;  2DHZ A;  3RZW C;  4JQW C;  1WMH A;  2N7E A;  3A9J B;  3OLM D;  1RAX A;  3ZW3 A;  4W9K A;  1VD2 A;  3ZRF A;  2LXA A;  3OJ3 A;  4MSQ B;  2KFK B;  3PVL A;  2N4F A;  2KWC A;  2W9N A;  2KAN A;  4AUQ C;  2KLC A;  1L7Y A;  2XK5 B;  3ZKJ C;  1GG3 A;  4ZRJ A;  1OTR B;  1NBF C;  4EEW A;  3AU5 A;  3H7P A;  3A1Q B;  4NAW A;  3ZNH B;  2BKF A;  2LRW A;  1YX5 B;  2RSU A;  2MQJ A;  4OVU A;  4DK5 A;  3PTF C;  1MG8 A;  2EMT A;  3A4S C;  3DBR I;  2D07 B;  4HCN B;  2OOB B;  3O65 B;  3OJ4 B;  4TQ0 A;  3QX1 A;  3DPD A;  5L95 C;  3P2B A;  1E5W A;  2KC1 A;  2GBN A;  2DYB A;  3A9K B;  4YL8 A;  2K1F A;  5C23 A;  1Q5W B;  1GC7 A;  2CR5 A;  2MBH A;  1ZKH A;  1V5O A;  2IO3 B;  2JZ3 B;  2RPQ A;  3RYT A;  4FJZ A;  1SGH A;  3L17 A;  2N7D A;  1WMH B;  5J18 A;  4W9J A;  2O2V A;  1RFA A;  2FID A;  2JRH A;  2EMS A;  2IO0 B;  2HE7 A;  1WGY A;  1EF5 A;  3AXC A;  4JIO U;  1QZE A;  3H7S A;  2HJ8 A;  4HVB A;  3WAL A;  4RM8 A;  1XT9 B;  4G0N B;  3M63 B;  4AJW A;  3I3T B;  5G2N A;  1LFD A;  3PRM B;  2REX A;  3APD A;  3GOE A;  3UIO B;  1UD7 A;  1TGZ B;  1WR1 A;  4TQ1 A;  2G4D B;  3DQV A;  4FHK A;  2KDE B;  3H7P B;  3CST A;  2DX5 B;  4NAW B;  1K8R B;  1WX8 A;  1WZ3 A;  1YJ1 A;  3ZIM A;  1T0Y A;  1C1Y B;  3JSV A;  1U4A A;  2IY0 B;  2R2Q A;  3KUZ A;  3NHE B;  3DBS A;  3OAW A;  1NI2 A;  4MGI E;  2K8H A;  4AOF A;  3DDC B;  1WX9 A;  2NBV B;  3PV1 A;  3H6N A;  4MGY E;  4K7W A;  1RRB A;  1V2Y A;  2CHW A;  3PHX B;  3PT2 B;  5DPS A;  2FCN A;  5DPR A;  2LVO A;  2N9X A;  3V60 A;  4F1S A;  2O6V D;  1LXD A;  3DVN U;  3VUW A;  1HE8 A;  4TV3 A;  2K6D B;  3KW5 B;  3VQI A;  2K25 A;  1M94 A;  3ML9 A;  5AZH A;  4CHK A;  4WJP A;  2KTR A;  1Z2M A;  2O2V B;  5C1Z A;  3LDZ E;  3QIJ A;  1WRD B;  1KM7 A;  2ZCB A;  4W9I A;  4GXB A;  1WYW B;  3R3M A;  1WJN A;  4WQO B;  3T8M A;  3VH4 B;  3M95 A;  2KD0 A;  2O6V A;  4BKS D;  2J7Q B;  2IYD B;  2L7R A;  4GDL A;  4N9F 4;  4BKG A;  5JZE B;  1G6J A;  3K9O B;  4CYE A;  1P0R A;  1UGM A;  3DBL I;  2LGD A;  2LD9 A;  3JSV B;  5FR6 A;  2KOX A;  2A4Z A;  3QK0 A;  3L13 A;  4G3X B;  1V86 A;  3VH3 B;  3S2A A;  3NOB A;  5AEK B;  3N32 A;  3CMM B;  4ZRK A;  4TKN A;  4DHZ E;  1WGG A;  1S1Q B;  2HTH A;  4XZ4 A;  4X57 B;  3SDL C;  1J8C A;  3MHS D;  3QAR A;  1P1A A;  1P9D U;  2NBU A;  2KJ6 A;  4GU2 A;  3UIP B;  3TL5 A;  4ZDV A;  2BYV E;  2JWZ A;  2JF5 A;  2BGF A;  2ASQ A;  2KTR B;  3PLV A;  4KZ0 A;  2AEH A;  1KLV A;  4BVU C;  2ZNV B;  4K7S A;  2AWT A;  1P98 A;  2G45 B;  2WYQ A;  2C7N B;  3QHT A;  4DDG D;  1WM2 A;  3ZDM C;  1WZ0 A;  2L8J A;  2O6V B;  4NQL B;  3ZVV A;  3VUX A;  5CHV C;  4GDL B;  4RM9 A;  3ZNG C;  5IA7 A;  4II3 B;  4W9H A;  2KO3 A;  1E8Z A;  2CHZ A;  2M17 A;  5J17 A;  3MJW A;  1V80 A;  2DYM A;  3HK0 A;  3L0W B;  3SHQ A;  1GJZ A;  3M3J A;  4GDK A;  2LJ5 A;  4PS8 A;  2JY6 A;  3R7R A;  3HHM A;  4GB9 A;  5JHA A;  4NY0 A;  1WJ4 A;  5D2M B;  1NDD A;  1WJ6 A;  4EOY A;  4GIV A;  2ZNV C;  4IWO A;  2DAJ A;  3VDZ A;  4E3C A;  2KC2 A;  2V1Y A;  3QA8 A;  4E71 A;  2ZEQ A;  4II2 B;  5L83 A;  4NPN A;  2Z0D B;  5DCN A;  2MBQ A;  3VVW B;  1WE7 A;  4FUL A;  3RUL A;  3JYU A;  2CKH B;  2JXX A;  3ALB A;  3RUI B;  5BO4 B;  2AYO B;  4BBN F;  4M8M A;  2GOW A;  4WWP A;  4K81 A;  1J0G A;  2FAZ A;  2HD5 B;  2JVC A;  2L0T A;  3EFU A;  4IW0 A;  1WF9 A;  3RCZ A;  5JH5 C;  2LAS A;  1YD8 U;  3IVF A;  4IC7 B;  3UF8 A;  3SU8 X;  3ZRC A;  3PRP B;  2BYF A;  2UWQ A;  4B6W A;  3WIM A;  2N1V A;  5CHF A;  4LJP B;  4MM3 A;  2A5U A;  3QCA A;  4GDK B;  3MTN B;  1AAR A;  3W1Y A;  4E74 A;  1EO6 A;  2GBM A;  5E6N A;  2V4L A;  2QHO A;  3N30 A;  3L10 B;  4EKU A;  3N3K B;  5DPW A;  2WX0 A;  2IO2 B;  3IBE A;  4K7U A;  2PE6 B;  3PS6 A;  4J6I A;  5D7G A;  2CS4 A;  2C9W B;  3GZN I;  2K6Q A;  3NS8 A;  2JRI B;  3A4R A;  3HIZ A;  3Q3F A;  5KHQ A;  2L05 A;  2KDB A;  1IPG A;  2KQ7 A;  2KKC A;  2WX1 A;  3B08 A;  2VRR B;  2ZCC A;  3KYD D;  3T9L A;  4MDK E;  2CU1 A;  4HDO A;  1E8W A;  2JZZ A;  2R2O A;  2DAF A;  3KUD B;  3QWZ B;  4OVV A;  4HCP B;  5CTR C;  4BBN C;  3CSF A;  2MBB B;  5IAA C;  1LM8 B;  2KN5 A;  3IFW B;  2Y5B B;  3ECI A;  1EUV B;  1E8Y A;  1OGW A;  4I6L B;  1WX7 A;  1LQB A;  3PRZ A;  3V6C B;  1H4R A;  2KJH B;  4ICU A;  5D6J B;  2FUH B;  4FLH A;  1WE6 A;  4NNJ B;  2JUO A;  3AI5 A;  4W9E A;  2LGY A;  3Q3J A;  4WJO A;  1GNU A;  4A20 A;  1H8C A;  4P7I A;  4EZJ A;  4K1R B;  3JVZ X;  4PS3 A;  1E8X A;  5E6P A;  1UZX B;  4ZYN A;  1WM3 A;  4DDI D;  1XD3 B;  4ANW A;  4IM2 A;  4GN1 A;  4IM3 A;  4DWF A;  2L00 B;  1GC6 A;  3PSE B;  2G4S A;  4GSW A;  1UBQ A;  4JL9 A;  4MH0 E;  5CX3 A;  3VAW A;  3WAP A;  1I42 A;  4B9K A;  3KVF B;  3DVG Y;  2OJR A;  2KVR A;  2G3Q B;  4W9G A;  3M62 B;  1OEY J;  2Z0E B;  2KK8 A;  3ZNZ B;  3NZS A;  4XC2 A;  1OQY A;  2EKE C;  3RD2 A;  1ZGU B;  1WGR A;  2B3A A;  1J19 A;  4FJY A;  4EFO A;  4HK2 A;  3ENE A;  4FAD A;  1WI0 A;  2JPH A;  3APC A;  4G50 A;  4LDT D;  5CHW A;  3WAO A;  4BKS A;  4IWQ A;  3HM6 X;  3ZDT A;  1FXT B;  1UEL A;  3QAQ A;  3KUC B;  2K8B A;  3IG3 A;  3LJ3 A;  3KYC D;  3VXW A;  4NQK E;  4LCD E;  2C60 A;  1V9J A;  1YX6 B;  2C7M B;  1WXM A;  1WH3 A;  2J0K A;  1YIW A;  1Z5S B;  2KX0 A;  2C5L C;  3H9D A;  1YQB A;  2NVU I;  2ZVN A;  4HJK A;  2D10 A;  4HLE A;  2MWS B;  1SIF A;  1C3T A;  3AU4 A;  4MEL A;  3ML8 A;  3U7D A;  4W9F A;  2K39 A;  2BWE S;  2LZ6 A;  2FCS A;  5KHO A;  3V6E B;  4F8C B;  4KV2 A;  4WJN A;  2J0M A;  4ANX A;  3RZF A;  1UH6 A;  2NBW B;  2MCN B;  1P3Q U;  4A3P A;  1GUA B;  2NCN A;  5HKH A;  2ZZP B;  4PS7 A;  3WA0 A;  3KH0 A;  2I1K A;  1TTN A;  2J0J A;  5LXH A;  3PRE A;  1WXA A;  2KLG A;  3DCG A;  1WGD A;  4IUM B;  3R66 C;  2MA9 B;  4KSK C;  4URK A;  5DPT A;  2PE9 A;  3VTW A;  3QJZ A;  2PPH A;  2DZK A;  1F9J A;  3PHW B;  4FA6 A;  4KDL B;  1WJU A;  4BOS C;  2BWF A;  3W1S A;  2UYZ B;  4HPM B;  1WY8 A;  2YVC A;  2DYO A;  3ONS A;  4I6P A;  5LXI B;  2N9E B;  4TUU A;  1I35 A;  3HM3 A;  3A33 B;  1Q0W B;  3C0R B;  1SE9 A;  3CF6 E;  2NR2 A;  4EZL A;  2LUE A;  2KXJ A;  2KQS A;  3TIX A;  1XQQ A;  2MW5 A;  4GGQ A;  4IG7 B;  3V62 A;  2IBI B;  1E90 A;  1Q1O A;  2KWV B;  2XEW A;  4WJQ A;  5LLI A;  2FNJ B;  3NY5 A;  2L3Z A;  3TCA A;  2KFJ A;  3QC8 B;  4DHZ B;  1WFY A;  1WGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...