1JWMD

Crystal structure of the complex of the mhc class ii molecule hla-dr1(ha peptide 306-318) with the superantigen sec3
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwmD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwmD02
1TY0A 1HQRD 1I4HA 1M4VA 1EEID 2NTTA 1SE4A 4RGTA 1I4XA 1TS4A 2XNAC 1LT3D 1PZJD 1XTCD 4TSSA 1S5CD 3BVZA 1JWMD 4NZLB 1I4QA 2RDHA 4L63B 1HXYD 4RGOS 1D5ZC 3KLSX 1YN4A 1LTGD 1S5FD 1PTOF 1UUPA 4O1NA 3SEBA 1QILA 3O13A 4RGMA 2WV6D 3MFGA 1SJHD 5ELEA 1LT4D 1LTSD 1RD9D 1F77A 1I4RA 1PTOB 2XN9C 1DJRD 1EU3A 1PTOC 1V1PA 1FNVA 1SBBB 1D5MC 1LT5D 2G9HD 1SJED 1STEA 4DXFA 1HTLD 2QILA 3DWPA 1FNWA 5ELBA 4ZYSA 1I4PA 1BCPB 1LTBD 1CHPD 1BCPC 1GOZA 4RH6A 3BVGA 2J4XA 3R2IA 1YN5A 1FD7D 1LTTD 1I4GA 1MD2D 5FK9C 1S5BD 5TSSA 4RFBA 3TSSA 5I4DA 2SEBD 5D3IB 3URYA 3BYTB 1EFID 1KTKA 2ICIA 1LT6D 3EFXD 4Z9CB 1S5DD 1KLUD 5D3DA 1JWSD 2AQ3B 2XRQD 1BCPF 5ELDA 1AN8A 1PRTB 5FKAC 1PRTC 1XXGA 1BXTA 1FGBD 1TS5A 2RDGA 2IPKD 1KLGD 1V1OA 1B1ZA 1EWCA 1D5XC 1JCKB 2TSSA 1TY2A 3BVMA 1CQVA 1CHQD 1L0XB 4RHSA 1PTOD 1SEBD 1SXTA 1RF2D 2IJ0A 3OWEB 1YN3A 1CT1D 4DXGA 1TS3A 1PZKD 1DYQA 3GP7A 2XRSD 5ELCA 5ELFA 1LTID 1JR0D 4RGNA 1BCPD 1PRTF 1ENFA 3DWAA 1LTAD 2R61A 1RCVD 1LLRD 1LO5D 3V05A 1UNSA 1HA5A 4RHRA 4OHJA 1ET6A 3CHBD 1SE2A 2Z8LA 1EEFD 1PYWD 1S5ED 2O2LD 4UDUC 1PTOH 1CK1A 3R8BA 2CHBD 1V1PB 1FNUA 3MC0B 3W2DA 1ESFA 1D6EC 1B44D 2AQ1B 3BYYB 1AW7A 1TS2A 1SE3A 3R2TA 1JWUD 1PRTD 1ET9A 1RDPD 1T5XD 2NTSA 2QEJC 4L6TB 4C56C 1JQYD 2AQ2B 3BZDB 1L0YB 1LTRD 3DWQA 4BWGB 1EU4A 3EA6A 4K6LA 1G8ZD 1PZID 4RCOA
chains in the Genus database with same CATH superfamily
2EQSA 4OZAA 4CKBA 2K25A 5AZFA 2L7RA 2ZNVC 1TWCB 1IBKL 3Q3NC 1IYVA 1I7HA 1FXTB 5C3XA 2IHEA 1KDAA 3D31A 4IUQA 5LL6X 1FEHA 1UE5A 1PZJD 1S5CD 3ALBA 5GROA 3I4MB 4GZYC 1KJTA 1AP0A 1YN4A 3Q3OC 2MBBB 4LJOB 4LMQD 1KAWA 5I9PA 4DKAC 3RZDH 5E4XA 3G71A 1F9SA 5ELNA 4X6AH 3O13A 4XXEA 3GTJB 1RRBA 1XLNA 3MFGA 4IZ8A 2R2OA 2HHHQ 2NCNA 1RD9D 3CCSA 4EQPA 3BK1A 2QDFA 1B9NA 2YYZA 5M5YH 5G55A 3VAWA 1V1PA 1FR3A 3EBEA 2ZT9C 5C5LA 5H1SE 1WX7A 2MFIA 1Y56A 1E2ZA 2G1EA 1R4PB 2NVUI 2ON8A 2WXJA 3FP9A 2IX0A 2KXJA 4XT3B 4K5WA 2FHTA 5JJIA 1N5WA 2C9WB 1I5FA 1BT0A 3KW5B 4DAVA 3M4QA 1BCPB 2QW7A 2B63H 2B3AA 2JVCA 2PPBC 2E2JH 1V97A 1YN5A 4LF7L 1WXMA 4BXXH 2EMTA 4TRDA 5IYBG 3CC7A 4BBSB 3EFCA 3KUZA 3JSVB 4GNXC 2O6VD 4ID6A 1YHAA 1A0IA 3HRDD 4IJHA 4ICVA 3SK8A 1UE7A 1YIJA 5I6YA 3RD2A 4NQLB 4FNFA 1R4MB 2O2VA 1CJEA 3S16B 2H89B 5I9OA 3AE6B 4EFOA 3K81C 1HNXQ 4Z9CB 2HCIA 1AYFA 3K80C 1BDOA 1S5DD 3M4OB 1Y69U 1PFBA 3S15H 2DZKA 2FE8A 1TWHB 3UF8A 1SDFA 1YITA 4HJKA 1ZXHA 4H02A 1PRTC 1QZHA 2PQEA 4YWKA 4XIGS 2EMSA 1J9OA 2EELA 4KN4C 2F4VQ 5D2MB 5HG2A 3VR8B 3VDZA 1GB4A 5BYRA 2DJFC 1WXQA 1Z7TA 3VFKA 4CDEC 1EWHA 1NDDA 3U9SA 3Q8AA 3NWSA 3T53B 1X3QA 2VY3A 4AWJA 2EY5A 3T1HL 5CV6A 3B08A 3GV6A 3H3VH 1XLQA 1Q3LA 2IO0B 2ZEQA 4WQMA 1EWYC 4XDCA 5C4XB 3KLRA 1RODA 1N36L 2JA7B 1Q5WB 2F0TA 3P4SB 3ZNZB 1PFNA 3SDLC 2ZJDA 3S1QH 3A1QB 2FIDA 1HZ9A 3UI3A 4JG2A 1WJ4A 4IWPA 4RMAA 4ZKCB 2KJXA 3M3YB 1K8GA 4EZLA 4C3JB 1CKNB 1WXAA 4S0RA 1ET6A 3H15A 2CHWA 3D3RA 4OVUA 5H92C 3STBD 1KRSA 2O2LD 2LHDA 3HUIA 3F2CA 2XK5A 3TS2A 5C4ZA 1T9HA 4K8IA 2MHVA 2XWJB 5KIXA 4KX6B 1YJIA 1E8XA 2UUCQ 2E3TA 4DV2Q 3MC0B 3Q3FA 2BS3B 4GOPB 2QMTA 2A6ED 3BYYB 4W9KA 3S1RB 4KHPQ 1F2RI 3AEGB 3ZNHB 3V6EB 1DOKA 4C56C 2F0FA 4K2KA 1KM7A 1TWAB 4JVZA 1FVIA 3H09A 4ZHPA 2YU9B 4RKBA 1HQMC 1G8ZD 2F0IA 2RSNA 3MTSA 1EEID 4B0MA 1B7YB 3AE3B 3E56A 5L95C 2PKOA 2HIXA 2E2HB 5AFWA 1AZPA 2A73B 4DDID 3BVZA 1XCQL 2PI2E 4YTMB 1DOYA 4NMZA 4DV4Q 2L1BA 1CFMA 2F3WA 1S5FD 4FF1A 2J0JA 3VRAB 1Y1VG 1K8RB 3ZVVA 5C5MA 3N3KB 4KKUA 3ENEA 1LT4D 3VTVA 4KSLC 3SK5A 1G51A 4F7XA 5IIFA 4HJAA 1IBLQ 3APFA 1E0ZA 1C0AA 1EYGA 3C1FA 2N9XA 4V190 1WGHA 3FKYA 2RD0A 1C1YB 5BN3A 4JYAQ 3A8IE 2JA9A 2GMIC 2IX3A 4BY7B 3NOBA 4DR4Q 2JXXA 1V6EA 3HOVG 2DJGC 2OEDA 2DHZA 2EXZA 4KKIA 4C3IB 2D62A 3GD7A 4K3BA 2DNFA 2FBWB 1A3UA 4DV3Q 2VQFQ 5BMHA 4G3XB 4A3JH 1FD7D 2BWES 3LYYA 1Y1WB 1NBFC 1K83B 4X66L 5DPTA 4KV6A 4FO2A 4NY0A 5EKKA 3MEHA 4A3KB 2IY1B 2D3AA 3E6ZX 2A69D 3TCAA 5I4DA 2F0KA 4DPGA 2LVPA 5FO9B 2JA5G 1E5WA 2WXHA 1EYCA 4RWSC 2W3RA 4EQ5A 1B53A 5DNFA 4MHEA 4WWPA 4ZKBB 2KVMA 3ZW3A 3L9AX 4OXPA 2D2QA 3VA7A 4FJYA 1PFDA 3TP5A 1D1KA 2R6GA 1HNZQ 3ZNID 3CD6A 4ZRZA 4A75A 3AE5B 4JI0L 1V81A 2ZW1A 1TS5A 2LGIA 1F2MA 4R8NA 1D5XC 3UQAA 1A8VA 2HE7A 4X62Q 2DYOA 5C3JB 4XDXA 3NZ3A 4ZQ3A 2C5LC 1CTMA 5DPRA 1WCMG 2B2WA 1PTOD 4W9FA 1QJOA 3HOUB 3SD5A 3SR6A 1SEBD 3PO2H 1FFUA 2L0TA 1WR6E 3RD4A 2F0MA 1KIXA 4K7UA 1Q10A 2KJ6A 1WJJA 2L15A 2XGTA 1X3FA 1JJCB 1KDCA 3OIQA 2MHJA 1B8AA 4M02A 4DV1L 3FKIB 3PO3H 1IBMQ 1M8AA 1NUCA 4R8IA 4ABNA 1FCCC 1ENFA 3CW2C 1NEKB 3A33B 2EY6A 3RI7C 4HK2A 5A2QL 1JMLA 4GDKA 3ZJUA 3FPPA 2IL8A 3ZJTA 2EZVA 1LM8B 2ZVOA 1IGCA 3CHBD 2N3SA 4JPBW 1SE2A 4A3BG 1C7YA 5GMVA 2UXCQ 1NI3A 4ZK9B 2IO3B 4KHZA 2WP9B 4UP9A 1CK1A 3H1UA 4JI7L 2K04A 3LWEA 3CMAA 2CR5A 5LL6S 3TP7A 1FNUA 5I6WA 1U4LA 3PT2B 2OT2A 1B44D 1ACCA 4HJGE 1YNND 5M5WH 4DNTB 1YEZA 4K8JA 1J19A 3U52E 3UIPB 2QEJC 2BS4B 1Q0WB 1J8IA 1M1KC 4GKJQ 3I90A 4MTNA 4ICUA 2FNJB 4JI5Q 4KGTA 3HOWG 1P3QU 4C3HB 5C2TB 4AS1A 3EQLC 3ABVB 2BE5D 1TS4A 3A7LA 2EYMA 1C4QA 4LFCL 2IHFA 1FRDA 2R7ZH 1D8LA 2YLMA 4LNOA 4NZLB 2IGDA 1QE6A 5EE9A 4L5QA 1VCBA 2Y5BB 1WH3A 1N6ZA 1LYLA 3KF6B 2YTXA 5FOBB 4LFAQ 4IM0A 2WYQA 2LGDA 3K58A 4CBVA 4ULLA 5IP9G 3CXCA 3DDCB 3HM6X 3W1YA 1IXRA 4GLXA 2BBCA 2JA6H 1J7CA 1STEA 2RBMA 3WDNA 5LMNL 1R7SA 3SFDB 4DGZA 5L83A 2VXWA 5A2QE 4AH6A 2YTVA 3Q14C 1STAA 2UUCL 4DV2L 3J81L 2ZM6Q 1L2NA 1GUTA 4FJZA 2B8GA 3NBHB 4I7AA 4DQOC 4E3CA 4K7SA 1P9DU 2I0QA 1STBA 1I6HH 1QG7A 1PVOA 5KHQA 4PYZA 1ZP0B 2WGSA 4PV1C 5A35A 5J22A 4BA2I 3H3VI 4US9A 5DM73 3CMEA 4BKTA 2V0GA 2F0VA 4DNRB 3VR3A 2KANA 3I5JC 1Y14B 4JBMA 3PO0A 3S9WA 1SNDA 1PYBA 3TMPB 1YNTE 4L1BA 1YQ3B 4LK0M 1KL9A 1Z47A 4HROA 3KDFA 1RIPA 3RNEC 1AE3A 4LUOA 4QL5A 1PUTA 1QZGA 4A3MG 2OQKA 2OXPA 2WX1A 3ZQ4A 1E3PA 2BDNA 3HOYG 4HAEA 3D32A 4Q2JA 1GC7A 1Q1OA 3V96A 1IBLL 3OSOA 1TKEA 4M0WB 2TSSA 1ZXIA 1STYA 5AZGA 3Q24A 1SB3C 1Q12A 4KY5A 5BR8L 4JYAL 2VZKD 3AM9A 3MC9A 3EHVA 5C44G 1C3TA 2JE6I 1R4NB 2FFKB 4W9LA 1CT1D 1Y8NB 2HCCA 1WTWA 1PZKD 1TIFA 4MACA 1UGJA 1C4PA 3CCEA 2JQRB 3JSVA 3NHEB 5BO4B 4AYBB 1WTXA 2BCOA 3EGRA 4I6LB 2VW9A 1A2UA 4HCPB 1FCLA 2E2IB 4AOFA 4P16A 3LWUA 1IYJB 5JH5C 1PH7A 5HKHA 1EQVA 4ZHOA 3UQBA 3RN9C 1ASZA 3MTNB 3J81E 4DV7Q 1TZOA 4YCWA 3AEDB 4C1NI 1T6BX 4F7ZA 4A3PA 4KHVA 1XPRA 2AYOB 2D0PA 4UDUC 4DK0A 2JA8H 5J1ZA 3BDCA 3S1NB 1HNWQ 1FJGL 4JI1Q 4K1RB 1B50A 4JC0A 1HNZL 1MJCA 3CC2A 5DLQE 1A15A 1SNPA 4OEMB 1IZ6A 1XLOA 5M3MG 4DUYL 5EE0A 2E5LL 1PRTD 3HVZA 5E4WC 2MA9B 3A74A 3RN2A 1DZ1A 2HJ8A 3EC8A 4QQBX 3SHQA 1JQYD 2O5IC 2M19A 1GKHA 4X62L 1Q8IA 4DHJD 4X3SA 4FF3A 4M8MA 3JW0X 2EKIA 4ZRJA 4A3DG 3IHPC 1PH3A 3WAOA 3TP8A 5EPJA 2SOBA 2M0AA 1D7QA 3A1QA 1QOBA 3TUOA 1RFAA 4BKGA 2NVYB 4BY1H 1EYAA 4IUVA 2KJRA 1I35A 2RDHA 2L00B 1IL8A 1KRHA 1NTGA 1IBML 2ZPYA 1UE1A 1QF6A 4YT0B 2K33A 5JJZA 1QQRA 3GTLH 4USAA 4PMWA 1SJHD 1RFKA 2CJNA 3AEBB 1TWFH 3RNBC 3G48A 2LUMA 3M7NA 4NPNA 1C9FA 2UXCL 3NXWA 3RMKC 2G9HD 4J8QA 4N8FA 3ZYYX 3L4PA 1MKHA 4DXFA 1HTLD 4LAAA 4E6IA 4HJ8A 1Q7YC 4LNQA 4L2YA 1CA6A 2K6AA 3W1GA 1WTHA 2AWOA 1K8OA 4ZYSA 1ZUD2 5JEAJ 1XO3A 3IG3A 3X23A 3PIO3 2HJ1A 4LK1C 3VR4A 4YWLA 2VH2A 4IOIE 5JEAG 1RTNA 3BK2A 4BKSD 3R2IA 2N7EA 4XWTA 2HTME 2J52A 2K22A 1LTTD 2Z1CA 5IGBA 3P4QB 1MD2D 3KH0A 2CQAA 3NS1A 2O2VB 3OIPA 4EKUA 1WTQA 5M3FB 5IYDH 4RCNA 2JRIB 2SEBD 4JI5L 2UUAL 4FLHA 2KHSA 4FVMA 1EWIA 3H6NA 1GHJA 1VQ4A 2R93G 4J6IA 1EL0A 2M17A 1WTRA 2ES2A 3A7AB 4BFRA 2M00A 2L0CA 2CCZA 3QCAA 4A3EB 2J53A 3VH3B 1EUJA 3Q22A 2XRQD 2WHIA 2RCNA 1K3RA 2YEPB 4OO1G 4WH4A 3RN5A 2D07B 4MM3A 2OJRA 3NUCA 3RUIB 1I94Q 1HTOA 2CJOA 2K32A 1CUKA 5C0XJ 1XQQA 2DENB 1KNAA 5EGTA 3JAMc 1SNQA 5C0XG 2D5DA 3T3OA 5CBEE 2ZW0A 4GXBA 4IC7B 4W9IA 3IFTA 1XMOQ 2JZ3B 3PZ8A 2CVRA 3FHWA 1OTCA 3H9DA 3F2BA 5DCNA 1F9PA 2LJ5A 3ULPA 3AV8A 1E0BA 2ZM6L 2GLSA 3PSEB 4US8A 2WXKA 1SYCA 2L11A 5C4XG 5K36H 3NVYA 2JA7G 3MVVA 2CWAA 4TVAB 1STHA 1TR5A 2IZVB 4LW1A 2A6EC 1UBQA 2SAKA 4GB9A 4TQ1A 1RYJA 5GADC 2F0SA 4H13C 5LMUQ 1LFDA 3PPAA 3ONSA 2XBBC 4LF6Q 1TU2B 5EQ0A 5NUCA 3RNCC 2A68C 3K9PB 4IUNA 1ZKHA 3C1EA 1EEFD 1NYQA 2ACZB 2EYPA 4X65Q 4LF4L 1A70A 5C4JB 4FYDA 1IW7C 2CHBD 4JCVE 2C7NB 2F0HA 5EBDA 3DQVA 4YSXB 3AB9A 5CR3A 1IBKQ 4IFDH 3N1XC 4XTCS 4D2KA 2JN4A 4BAXA 1T5XD 2FMMA 4PS3A 3PF5A 1F52A 1YI2A 3BY4B 4P7IA 4HPLB 5DM63 4KD3A 1MG4A 3S17B 5LXHA 3DXJC 4K5VA 1SIFA 1HQRD 1SYBA 4G4KA 1QOHA 2OTLA 4A3BB 2I5HA 3A5ZB 3DBLI 4JI8L 2F0GA 2EYOA 2BGFA 2DX5B 4ACFA 3U4ZA 4ZUJA 4O42A 4TSSA 1WI0A 1L2FA 2B2YA 2E74C 2MW5A 3FAHA 5D7GA 4MDKE 4M8AA 4CJ2C 1HCZA 2F3IA 2MO1A 2JSOA 2H5XA 3KF8B 3NQTA 4AYBE 1SFOH 1AE2A 4II2B 3IVFA 1U4RA 3JAME 3X3MA 1L7YA 1SAPA 1VQAA 5IGEA 1BQQT 1V1QA 2QHOA 4WJOA 1QVCA 3LNNA 3N52A 2WAQG 5GAHC 1FNVA 4PZ8A 3RMHA 4AIMA 2VQEQ 3A9JA 4IUUA 3Q8BA 3E0EA 2LRUA 1TWGB 1ENCA 4DNIA 3DWPA 3ITPA 3ND8A 4POFA 3M62B 5EPLA 3HOWB 4YWMA 4BY7G 1N62A 4QUFA 4GIVA 2CH4A 5G5HA 2K6QA 2DWQA 5KRUA 3Q69A 1R4QB 4JGHB 3ZLZA 1SNMA 4H2AA 5CBAE 4WWOA 3L3OC 2WX0A 4KSKC 1Y1WG 5EBCA 3QJYA 2CHXA 4BZAA 4I65A 4P72A 4OIKA 4A76A 4PG3A 3W1SA 1HZ5A 5FO8B 4A3KG 1VF7A 2A8VA 4PK1A 4DN4M 1XD3B 5KYIA 2N9EB 2PEAA 1H9RA 3KF6A 3AEAB 2C35B 2ICIA 1FGUA 2KMMA 3ZTDA 4DR7L 1SSOA 2ZXRA 3K57A 4MN3A 3EFXD 4GLAC 2KCNA 3PGZA 5I2YA 5C3EG 2QKIC 1VQ6A 3S1MB 3K0YA 1E6EB 3I4NH 2V1YA 2KYWA 2FCSA 3T1HQ 5ELDA 1VQIA 4IPGA 1JT8A 4X64L 1QLBB 5FKAC 3FILB 2DBYA 4A8XC 1O7LA 3HOXH 2EKEC 1KLGD 1V1OA 3PRMB 2CKZB 3PF4A 2MRPA 1N36Q 4OVZA 2NZOA 3DHIC 3A55A 4XYOA 3FMCA 4GN1A 4CDDC 1HZ6A 1W6KA 1Q1EA 4KTAA 4FA6A 2N4FA 4X3UA 2L83A 5EDSA 2Q8RE 4DR6L 2K01A 3S14B 2MBQA 2UUBL 1B9RA 4ZAIA 1H9KA 2M2LA 1WF9A 4CYEA 4K2LA 3GO5A 3JYUA 4RKLA 1WGDA 5ELFA 2KWDA 4GDKB 3UDGA 1RHPA 1JR0D 2I5MX 1NJIC 1QOFA 1RKNA 1XMQL 4K7WA 1LLRD 2GB1A 4RHRA 2PQAA 1MPEA 3CP0A 2LD9A 4HKZE 2JZPA 3DBRB 4P1CC 4G7HC 2L32A 4F87A 2LXAA 5D65A 4B9WA 4HVBA 2C60A 5C44B 2F0QA 3KFUA 4JL9A 1DGSA 1FL0A 3L16A 3PLVA 3H6MA 1FM0D 4M0WA 1EFWA 3BZCA 2AQ1B 2R92B 3MHSD 2XVSA 2VS1A 1TS2A 2KQ4X 3ECIA 3I56A 3GTKH 5J3BA 2BYTA 2H4OA 3GTPH 2K5HA 1WE6A 2DLBA 3NBIA 3S24A 1Y8RC 4ZRIA 1X32A 2FCNA 5CV7A 1NYRA 1F0ZA 1PH8A 4LF8L 2O6VA 1XMOL 1S1QB 3NZSA 5DEHA 1DOLA 1YOVB 2I1JA 5GAEC 3OLMD 1I4XA 1HFGA 5EPKA 4IOCA 1KC8C 1AZQA 1WSPA 4PQXA 3JVZX 1LTLA 4C3HG 3L2PA 5IT9L 4A3CH 1X65A 4DK1A 1GM5A 2BKRB 2WXLA 3IT6B 4HMJA 3S15B 2L3ZA 1QNUA 4R4QA 5IP7G 3HP3A 1QVFA 4RGOS 2AL6A 4LLGM 1K73C 4FN2A 1BKBA 1JE5A 1K28A 1XTDA 2IW3A 4RGMA 1JQ4A 1YNJC 4K6DA 5M3MB 1ISNA 2K8CA 2F0WA 1JMCA 3RZDB 2KEEA 4X66Q 3ZNGC 2V4DA 3J80L 1BBXC 5FLXc 4A3DB 1SMXA 3AU7A 4POGA 5M5YB 4C2MH 2WXPA 3WIMA 3AEFB 3QHTA 2JK8A 1RAXA 4A3LG 1N34L 2F0LA 1S5BD 4FULA 2I2YA 4JI0Q 2WB1G 3P2BA 2GVAA 3G4SA 1T0YA 3KDFB 4X3TA 1ZEQX 1H4RA 4H0LC 2FAZA 4QF4A 3BG3A 3HRZC 4EQOA 3ERSX 4CJ0B 1SF0A 3QA8A 4NDXA 2JX5A 2QCPX 3PREA 1C78A 4HTHA 3AQQA 1BCPF 4YIJA 4NNJB 2NVTB 4NAWB 3MP9A 2HT1A 1XXGA 1HTPA 1N9WA 4DV1Q 1KAAA 1AWDA 1GG3A 4CKCA 3CCQA 1MI0A 1KFYB 5IT9E 1CHQD 1JOQA 4IFDI 3C2PA 3I63C 2K5DA 3H0GH 3Q23A 2VQEL 3O65B 2D10A 1RF2D 5L37A 3I8ZA 3S2DH 2I46A 3GTOH 3DVNU 2MQJA 3F2DA 2R93B 2LGYA 3KJOA 5ELCA 1H9SA 2QA4A 4BOSC 1LTID 2ID0A 3GDEA 2LMCA 3HZXA 4JI7Q 2WLBA 2WXGA 4AYBG 2BTEA 1RTOA 3K8AA 3RNAC 3J80E 1B4OA 3I4MH 2OF1A 1UWMA 2KWVB 4IUMB 2RQXA 4KV2A 4U673 1T0SC 3DVGX 1YJWA 2AL3A 3NQIA 3S1QB 4H44C 4AJYB 1PH6A 5BN5A 3OW7A 1PMRA 1RLFA 3GZNI 3OMCA 4YXDB 3PHXB 4FBJB 4ARIA 2QGQA 3HGBA 1LXDA 3NENA 3AXCA 1CI3M 2RF4A 1ESFA 4GSWA 2ZJPA 1OEYA 2JYEA 5FR3A 3UDIA 2JF5A 4LFCQ 1FXAA 1UH6A 1FRRA 4DFAA 1IPGA 4BBRG 1H9JA 3J7ZC 2MH7A 1U9RA 4ME3A 4JI4Q 4FXGC 1VLBA 3KBGA 5CV9A 2EY2A 4LUZA 2K50A 1TKWB 1PXUA 3C3LA 1IUEA 4BBSH 2DZJA 1M4VA 4TUUA 4EEWA 4Q5VA 3A4SC 1WIAA 1NMFA 2XNAC 4PMCA 1TQOA 1WYGA 2PW7A 3TZUA 3Q8FA 5TR5A 4B3SL 5J18A 5LMNQ 4G50A 1LTGD 1SE8A 3HOZH 1UUPA 5LLIA 1Q90A 4P75A 2GBNA 4CJ1B 2BWFA 3U50C 3M4OH 2WDQB 3APDA 5JHAA 1SLJA 1TWHH 4G7OC 4B95A 2K1FA 2KLGA 1KDBA 1HR0Q 1EY9A 3CCLA 4A93G 1G6JA 3QR8A 2KQ3A 3LJ3A 1V86A 3G6JB 4W9DA 2A68D 2Y0SB 1TGZB 3CCRA 3U9OA 2BQQA 5FLMH 2N49A 2RCFA 1IW7D 3GQBA 3MXUA 5AJ3Q 1FFVA 1P7EA 2KO3A 1N60A 2GN5A 4YSYB 4A3GH 1CHPD 1BCPC 2A19A 1WGKA 1VQFA 4LJZC 2N88A 4NPSA 5EKIA 4FDBA 1EQRA 1JB3A 1L6UA 1WOCA 5F2DA 4NQKE 3DMUA 3RUZA 1G6ZA 1GUWA 3ZXRA 3P4RB 4DUZL 2HTHA 3PIOA 3OMGA 4A3FG 1CZGA 4UY8C 1K9MC 3M3YH 4C3JH 1EFID 5M3FG 5DPSA 4WQOB 5J17A 2WAQB 3RLOA 4GKKQ 1WM2A 4C7ZA 2K8BA 3KF8A 3SGIA 3CU7A 3FRPB 5IWAL 1LT6D 5CMDA 2KDEB 4JE3B 4MM3B 3UIOB 5BR8Q 4LDTD 4J6HA 4J3OD 1PA6A 3D4WA 2B2VC 4RG1A 4A3EG 2GA4B 2KT7A 3KVFB 4DK5A 2M4NA 2JEAI 3VUXA 4NXNQ 2PW9A 2F0EA 1JCKB 4MH8A 1OEYJ 4A3OA 3KBXA 3S1RH 3BVMA 1XWEA 3RZOB 3OG5A 2KC2A 3MA2B 4LFBL 1L0XB 4R4TA 1X54A 2FCMA 2LEKA 3IBEA 1RJTA 2V3PA 5G5GA 1GB1A 3PQIA 1GJZA 1N5XA 3NVZA 1N61A 3C8YA 3DWGC 4RA8A 3PO2B 3HG9A 1VQNA 2LXCA 1II3A 5C3EB 2F1MA 2A4ZA 5IGFA 3ULJA 4JWSC 3V60A 3DHHC 2EYLA 2MPMA 1FJGQ 1WWTA 4ZOHC 3RZWC 5G3LF 2A5UA 2M56B 2JYOA 2K28A 3K5LA 1WJUA 2KTRA 2B29A 2W54A 3L08A 2Q2UA 3PO3B 4OHJA 4KZCA 4DUYQ 3Q8DA 2F03A 2E5LQ 4IPDA 4OZCA 3ZJVA 4MTKA 4LNFA 3K0XA 1YMHE 1VQEA 1WYWB 4J1MA 3FILA 3SK6A 4U68A 3VYUA 1T0RC 3NJTA 4WJ4A 4Y7NB 4P6VF 5IAAC 2J0TD 2UXBL 3CC4A 3ZJYC 4GOPC 5T1IA 2MLBA 3AFQA 1QZEA 1WMHB 1X6OA 1ZYRD 3P75A 4C3IH 4ZDVA 1WZ3A 1GUNA 2Y5PA 3ERQA 5EE3A 3KYHC 4WAFA 4F1SA 1L0YB 1K52A 2NBVB 5M5WB 1KLVA 3CMMB 1ASYA 1HUMA 1L4ZB 2KCMA 3AE9B 2C7HA 3TZDA 2JSVX 1MVKA 3WCQA 5T8IA 1XTCD 4JOIC 2RMMA 3WAPA 4W9JA 3NWTA 3PHWB 4B6WA 5HGQA 1EOTA 5LXIB 3N1YC 4C1NK 4GU2A 1VR9A 1OQRA 1YHBA 3QO2A 4JBWA 3A9JB 4W9HA 3VRBB 2KUMA 1F77A 3DBHB 4ALPA 3DBSA 1O7ZA 2ZCCA 4LJPB 4B9KA 1YZ6A 4AQYQ 1K51A 1ESRA 3U30A 3T9LA 3PSIA 1KOTA 4EX5A 1JRUA 2K39A 2ALYB 2B2UA 2AKWB 2INPE 3HOUH 4MT5A 2UUAQ 4HIKA 3TEHB 1I4PA 4L5RC 1BUIC 1FMAD 2KACA 2QCZA 2JA6B 3BDOA 1HRJA 1YBYA 3J7AF 3HHMA 4IKGA 2J4XA 3T8MA 4A20A 3U7DA 2TMPA 2F52A 1XF5L 3FKIH 4JI4L 1GVPA 1E2WA 4A6QA 4KGRA 1X55A 2JWZA 3RPFC 3QWNA 1LUZA 2NVXB 1HZAA 2B8FA 5KYLA 3W5UB 3MJ5A 3CQZB 3VXWA 4MGZE 1Q1BA 5FJ8H 1EIGA 1OXTA 3RZFA 4IDIA 2LY7A 2LKVA 2V3NA 4G57A 3AE1B 2BOSA 3T13A 4YY3L 2A74C 3NG0A 3CSTA 2VUMH 3K5MA 1LABA 2PLPA 3NVWA 1EWCA 4MIUA 1YNJD 2D9UA 2PO4A 1TYGB 1JWAD 1HR0L 2QC8A 2NMQA 4A3IG 4RHSA 1KF6B 3NE5B 2JXTA 2OCEA 1SSNA 1SXTA 1WD0A 2IYDB 2LFIA 2WB1B 1WXVA 1V49A 3C46A 1HHVA 3AN1A 5AJ3L 2J42A 4KJOA 4KZ0A 4KDLB 3CPFA 2IO2B 3NTIA 2NBWB 3ZGZA 4LF4Q 3U4EG 2NBFA 3AU4A 2EYJA 4K5XA 1QVGA 3DCGA 2PQAB 2WXMA 1EY5A 3OTOL 4G7ZC 2CWPA 2UYZB 1BF4A 2V3SA 2Z6KC 3PRPB 1R4MI 1XPUA 4A90A 4HXDA 4TV3A 1VDZA 3TEYA 1S5ED 3V62A 3GTGB 1K3BC 4GKKL 4IURA 2X8XX 2CW0C 4NAWA 4I6NB 2MWSB 1PV4A 2WAQE 4WFN3 3V6CB 5IYCG 1PFMA 4IPCA 1CQFA 1K50A 2KFKB 1U4PA 4JI8Q 1J8CA 3V3XA 4JPSA 2BYEA 2KX0A 2R92G 3L7ZC 1QOGA 1JWUD 4V0BA 4NXNL 2O6VB 5MPOA 4BKSA 2FXQA 1ICWA 2N1VA 2M0XA 1WFYA 2KENA 3HVDA 5JPMC 1GHKA 3MXNB 1WRIA 1D2BA 1TIID 2KJHB 1K8MA 2X6LA 3W3AA 4EGVA 4TMAB 2LXJA 1EYDA 1VMPA 2K5QA 2L4NA 3MEFA 2W55A 1HXYD 2D0OA 1HZBA 2PMZB 4UAIA 3QQ8B 1PYSB 3KLSX 1VZ6A 4X3KA 4OWTB 4C80A 2V1CC 4DAYA 3K5NA 1YQ4B 3LX0A 4HSVA 4BY1B 4HIOA 4YTNB 1X3GA 5J2RA 5KNCA 5E1FA 3Q0AA 4EZJA 4BBRB 2CFMA 3R7QA 4JX1C 4YHHL 3VVWB 3FPUB 2PPHA 3MJWA 3GTLB 2NR2A 1LT5D 1PGAA 1ILPA 2W3SA 1QOAA 1EOVA 1TWFB 3NTKA 5IYBH 1AFPA 1FNWA 4A9AA 3G7LA 4MEMA 3HM3A 3A8KE 3E9HA 1UGMA 4J15A 1ZGUB 3QK0A 1BBWA 1B70B 1LACA 1W2BA 4DR7Q 1WY8A 3MXPA 3Q6BA 3EFUA 1I4GA 1U4AA 4II3B 4C7YA 1CZPA 1H9MA 4CO7A 4X64Q 1GC6A 2PCFB 2B63G 2PYKA 2E2IH 2O5JC 1RM6C 3CCUA 4B3MQ 4A93B 2K7VA 3PIP3 3I73A 4BXXG 2LI5A 4ZYNA 4ILWA 1WX8A 3A5UA 1N8RC 4DR6Q 4KY7A 2JRHA 2UUBQ 5CHVC 1V9JA 1ILQA 4XT1B 2RDGA 3EN2A 5JAVA 1HPCA 2MBHA 4MSMB 2J0KA 3K9OB 2KN5A 1OTRB 2D3GA 4AQYL 1Q86C 1XMQQ 3N30A 1N63A 4MGIE 5AUKA 5IA7A 1H9SB 4NB3A 3S2AA 3AYHB 3PUVA 2IT1A 2LMCB 4A3FB 3K5OA 3IRBA 2Q2HA 1TZ1A 4AQ7A 2L0FA 3RLNA 2RDFA 4IG7B 1ENAA 3SHLA 3L10B 2AUKA 2YEPF 1BCPD 4GLVB 4QAYA 3VTWA 1ONLA 2WACA 1CSQA 1U0LA 3S2HH 1IBXA 1T5EA 2KK8A 4ARCA 3NZUA 1DM0B 2F4IA 2LRWA 1LO5D 4QJFA 3TDQA 3M95A 1BBUA 1LV9A 2EE1A 2LHEA 4EQNA 2Z8LA 3CCVA 2WU5B 1GUSA 1I3QB 3UE1A 4MGKE 2C5CA 3M7GA 2EYFA 3HKSA 1C76A 2BT6A 3ONAB 2L76A 4HDOA 3R8BA 5KHOA 2PNRC 1PH9A 2IY5B 2D5GA 4LF8Q 3TQYA 4KIKB 4DDGD 2MO0A 2DGYA 3JAML 5M5XH 3P1HA 3KK7A 4QIWB 3UI2A 2RA4A 3CIRB 2AWNA 3T1YL 1ET9A 2VB2X 3I7FA 2F0DA 1JJGA 3BZDB 2EIFA 5JOBA 2BDOA 5JHBA 2D11A 2YVCA 2PNHA 4XYCA 2KZRA 4BBNF 1TY0A 2NTTA 1Y1VH 1VZ7A 1J5EL 1YJ9A 2ZJQA 3FC4A 1ZOYB 2J7QB 2F0PA 2WB1E 3PMFA 1SRUA 3B0AA 3L0WB 4KD4A 4BS9A 4IQZA 1EY0A 2I1KA 1XNQL 3PV1A 1UWVA 1PTOF 2K05A 3FDTA 4O1NA 1PGXA 1UF0A 2PZTA 3HOVH 2N9PC 1NSNS 1PTOB 3GV3A 4AUQC 2XWBB 3GZNB 3H94A 2HIVA 1HA6A 1SBBB 1C77A 3DPDA 5C23A 2JZZA 2K1BA 5EAYA 2XIWA 3MAQA 1N34Q 4K0KL 2CS4A 4WURA 1WMHA 2Y0SG 1C4AA 1NY4A 2RKSA 3N9YC 2Y3AA 5IO9A 4JI2Q 1VQOA 3OHXC 1R9TH 4RH6A 5I2XA 2JA5H 2FINB 1XT9B 2RPQA 4RM8A 2IX1A 3R93A 4WJPA 1QT9A 2IY0B 4HIMA 2DUDA 1Q46A 5T1GA 5TSSA 3T16A 2MBEA 4JK1C 5IY0A 1MGSA 2E6XA 3VR2A 3AFPA 3VDYA 4A3JG 3BYTB 5FR6A 1STNA 2FJ2A 4DR2Q 3TBIB 5M9OA 5EE1A 2N55A 2OTJA 4JI6L 2KVRA 4R9WA 2LJIA 2CHZA 4GOCA 2B2TA 1EF5A 1GJXA 1WCMH 5C4JH 3MZ5A 2FIFA 2KA7A 4DK3C 1F9RA 4ZUIA 1B1ZA 1GD7A 2B76B 5IOCA 2DNEA 3E0JA 1D4BA 1E8WA 4DA2A 3HK0A 2OHFA 2E2DC 4F8CB 3J7AV 3HOXB 1KHIA 3M3JA 4HCEA 1DONA 3I2ZA 2WDVB 1YVCA 3L0OA 1YN3A 2INNE 4NAMA 3VYRA 3S17H 3OJ3A 2D3BA 3TJPA 3U7ZA 1C4CA 1Z2MA 5GQOA 3IAM1 4LNKA 3AI5A 5IP4D 2X38A 4A3BH 3KUDB 1C48A 1WZ0A 2WIIB 2KTRB 3K59A 4RGNA 3PO2G 3IAS1 1ZDXA 2KVZA 3DWAA 4F8MA 2OJWA 2R61A 2PVGC 4Q0FA 1UEBA 2ZXPA 2NN6G 3OW2A 2JYTA 3D0FA 4LWCA 1OO9B 1NBWA 1L1OB 1NE3A 1HA5A 3DM1A 3RR5A 3AMUA 1DOIA 3PGEA 4L23A 1ZYRC 4BBNC 1OQYA 1Z9FA 1TJEA 2I5LX 1WTPA 4HJ7A 3PO3G 4B3ML 1E7UA 2BS2B 2K5PA 2KDFB 2L05A 1XLPA 2XSCA 3NPPA 4A3IB 3N32A 2JP1A 4HCSA 2KCTA 2RGFA 4ANUA 4UHVA 2B39A 1XEEA 1T3QA 2WXRA 3Q8CA 3GS2A 4ZRKA 3W2DA 1V9PA 1B3AA 1GXDC 3GE3C 1TWGH 1VMCA 3B9JA 2EPBA 2NS5A 3HOWH 3OYYA 1RDPD 1MHXA 3WOEA 3PS6A 2L5TA 1N32Q 3ZO5B 4B3SQ 4YTPB 2QJLA 1EF1A 2HDEA 4DV5L 4K14A 2Z0DB 1R4NI 2ZNVB 1I4HA 5EJWA 3VUWA 3KLSA 1SE4A 3DM3A 5JJLA 4P1BC 1WTOA 2AMCB 2MQHA 4HWIB 1F1HA 1K53A 1GAQB 5IP9H 2GBJA 4WORA 4IW0A 3SR1A 4REZA 2KHJA 4M01A 2NUCA 3ICEA 2VL6A 3W1SC 3H91A 2NB0A 1VZ8A 2D3CA 2M9VA 2BYFA 3GTQB 3GE8C 2EJGC 3GB1A 4HPMB 2R7ZG 5HHDG 2K4KA 3MWYW 2VZKB 2K5NA 1E7VA 3GTMB 2ASQA 5HFYA 1WGGA 1D5MC 4R4OA 1O7IA 4HJ5A 2ONQA 2WS3B 5IGGA 1TKGA 2KFKA 4JLCA 2JWUA 2LVOA 2E76C 2CW0D 1AH9A 2RPVA 1IGDA 4HEDA 3ER0A 2W82A 4DUZQ 4DR1L 1LGRA 3S14H 3TEZA 2NVQH 5IWAQ 1SMYD 1SYFA 2AX5A 2FUG1 1HFNA 3C19A 4QIWE 2JA6G 3MXNA 1GNUA 4GNXB 4PS8A 3U8ZA 3CRLC 4B3RL 4JWUC 1F9QA 3I55A 3TSSA 3NVVA 1K0RA 4NJCA 2G3QB 4A3MH 3IFDA 4QGUA 3HOYH 3J81j 1L0WA 3K6OA 5EKLA 3DLLA 1X1MA 2GBMA 2KTFA 1S3SG 4LFBQ 2UXDL 3EECA 3I3TB 3B2GA 1FPYA 3P4PB 1MJDA 4HKQA 4XZ4A 1SIJA 1E22A 1EY6A 2AQ3B 2IGHA 4IJLA 3J7A5 1PRTB 2LASA 5C44H 2KDBA 1I50H 2BB5A 4DHJB 4O0AA 5FLXL 1L4DB 2B2WC 2NWGA 5IE8A 2EVBA 3HIZA 1UWXA 1CQVA 2W9NA 1IYFA 2ZTCA 2LUEA 5CV5A 4ZLTF 4I6PA 3I70A 3B1LX 2B63B 5KNBA 2K3UA 2V4LA 4K3CA 1EUVB 2MP2B 2E2JB 4EE2A 4HRSA 3KUCB 3K7AH 2PE6B 4OVVA 3CPWA 3GP7A 3H0GB 4JI2L 4WRDA 3BINA 3MC8A 1A2TA 4CHTB 3ZUNA 1X3EA 2P5ZX 3ZDTA 2GI9A 1XNRQ 1X56A 4B3TQ 3CKIB 3QB3A 3WWVA 1V43A 5ELOA 5CGKA 1LTAD 1S72A 1OQQA 2INCC 3NUHB 2IGGA 4MGYE 1QUQB 4FF2A 3DHQA 4PNYA 1X3PA 2UXBQ 3V05A 1UNSA 2BB6A 2RVLA 2N9LA 4S3SA 3H8HA 2ZTDA 3SU8X 5M3MH 4X57B 2DZIA 1MSGA 4DR2L 4LF5L 4ANVA 1E1TA 1VQGA 3KYDD 4MELA 1LQBA 1BUVT 2BVCA 1EM7A 4P71A 4ASWC 3RLFA 4A3DH 1SN8A 2KAJA 3UINB 3M63B 5JZEB 4IWQA 2M1MA 2B2UC 3ZIMA 1TWCH 1KRTA 2JA8G 1NVID 2H1EA 2RR9A 4ANWA 2K14A 1J7BA 3DEPA 3RFZB 1N33L 2A6HC 4KKJA 4OW0A 3EA6A 1STGA 1MI2A 4JQWC 4B08A 1ZW7A 2JUOA 3NTHA 2ZTEA 4PZ7A 2BPSA 4GMVA 2K75A 3F8TA 3TS0A 1CKOA 4KKTA 2PJHA 3Q3JA 2HQEA 1NCVA 1SYDA 2KD0A 3DEOA 4DAYB 3AE4B 4OZBA 1JW9D 1WYDA 5FLXE 3GTJH 2Z9HA 2JT4B 2WWZA 5CYUA 4HPPA 3RYTA 4L63B 4NXMQ 3HKZG 2N0SB 3KUPA 4UP8A 1UZXB 3RULA 4DV0L 3A54A 3KQ4A 2WKDA 2ZXOA 3SEBA 3BWUD 4BA1I 1QILA 1YHQA 3J9CA 5DPWA 4XQQA 1L5PA 1E7PB 3QOLA 1BVSA 4TKOB 3M4YA 4OWXB 3D6WA 4BY1G 1WD1A 2XN9C 2NVTH 2RHQB 5JJKA 2MSED 2NBUA 4KIKA 3HOZB 3TBLD 5JEAH 1OXUA 5JVH3 5E3FA 2Y5CA 3WAMA 2A5HA 1SJED 3TMEA 2QILA 2JY6A 1QB5D 3SVMA 3HFZB 1XYIA 4JW0A 5LNK1 1KH0A 4OGQC 1XJVA 2Q8IB 1A6XA 5KGUA 4XQJA 2GRIA 3BZKA 1V5TA 4S17A 1ZXTA 1DOXA 2R93H 2SNMA 1WJNA 1N32L 4FADA 4GN3B 2SDFA 3S16H 2CU1A 1BNZA 4WJNA 4A3GB 4YY3Q 4FXDA 4RM9A 2KECA 1B9MA 2NZ1D 1JRPA 4OO1H 5D94A 3CAMA 4DV6Q 4FF4A 3VA5A 1ZE3D 4GN4B 1KTKA 2K03A 4YCVA 2MGSA 3WA0A 2AWTA 4IO9A 1KLUD 5C0XH 5D3DA 2RHSB 2Z6BA 4R1JA 1VQPA 2GBRA 5DAUA 5IYDG 4KKSA 4HDQA 2PIAA 4LCDE 4MNOA 1FGBD 5HURA 2L9HA 3BDLA 3PIPA 4YCUA 2JEBI 3NSWA 3AECB 4OWWB 3AB5A 3A4RA 1G2SA 2YV5A 4CGYB 5BYSA 5C4XH 2FCQA 5JPNC 2JA7H 3T3NA 3OTOQ 1VS0A 2Q2IA 3Q6SA 1EIHA 4GDLA 3ZTCA 1EQTA 1UD7A 1D3ZA 4EZKA 2N7JA 2F0UA 4A3JB 2DYMA 3SFEB 2AHOB 1TT5B 5IOIA 1IBXB 2DYBA 5COYA 2O4XA 2LSSA 2KDMA 4MJSB 3CRKC 1ZKOA 3W5OA 1TTNA 3H3VC 2MJ3A 1V80A 1MSHA 1RCVD 5C1ZA 1ROEA 5IN7A 5CORA 5CTRC 5E6OA 3AE7B 4LNNA 1ZPSA 4DR3L 1PHJA 1W6JA 5K36G 2ZZPB 4IM2A 5CV4A 5GXGB 1VQBA 2KHWB 4URKA 4W9EA 4NJ6A 1OXVA 2K5WA 1JJ2A 3BS1A 1E2VA 3WANA 5CV8A 1JE4A 1TWAH 1D6EC 2LFNA 4JV5L 1VQJA 2YU9H 2BF8B 3MHZA 3ML8A 1IP9A 2EJMA 4CKEA 3FEWX 3GOEA 4IFDJ 2AQ2B 3A56A 1LTRD 2E2HH 4BWGB 1VQ5A 2QF7A 2Z4HA 2MNAA 1SGHA 4IFDG 4K6LA 1E90A 2RSUA 3SXHA 3H7PB 2KQ7A 3EUB2 1CZWA 1HJPA 2AUJD 4YHHQ 2LGXA 3A9KB 3I57A 1P8LA 1VDVA 3D6CA 3R3MA 2R3ZA 1HZCA 1I4QA 4LUVA 4YL8A 3ZRCA 1H8CA 1D5ZC 1L1OA 4R4IA 4DAPA 4WJWA 1XNRL 1L6VA 4B3TL 1F2LA 4WJ3M 2WXNA 5IODA 2ZPNA 5LMNW 1EY4A 2WXQA 5ELEA 4JBKA 2N8NA 1E9MA 4BY7H 3W9CB 3PUWA 3DBRI 4JIOU 1EIYB 1DJRD 3J81i 1EU3A 3PZDA 5E6PA 1YIWA 3VYTA 1K8AC 1HR0W 3RCZA 4HJ9A 4M8NA 1PGBA 4HIDA 3X3NA 3RZOH 4DU9A 2CU3A 1Y1WH 2Q2TA 1K83H 4ANXA 3ETRA 4ZCKA 4QUCA 1DXMA 4UP7A 2HHHL 1T0QC 4N58A 2R7DA 1L0VB 4A3KH 5D6JB 3WALA 1I6VC 1VCIA 5JVG3 4PZ6A 5AEKB 2LGSA 1VQKA 4DHZB 5HGTA 4H7BA 5C3EH 5CHFA 2L55A 1MBYA 4N9PA 1TXYA 2HD3A 2LXKA 2NN6H 2WKCA 2L52A 2RDBC 4GLSC 3RT3B 4GN5A 2R7ZB 2WNMA 2MJ8A 3URYA 1G291 1QNKA 3U4VA 1M90C 1WTVA 3KWLA 2NPTB 3N1ZC 4LNIA 3ND9A 4WWMA 1WVLA 2JQOA 1SNCA 3LB8C 1JROA 3DHGC 2V9HA 1O78A 4EVOA 3E3XA 1GUOA 1O7YA 4DR5Q 2FUHB 3VH4B 4L5TA 4NXML 4HSPA 2KBNA 1AN8A 2C7MB 2OWOA 1CA5A 3B2FA 3PVLA 4Y7NH 1IL2A 2EXDA 1F2ZA 2F0OA 3CCJA 3T51B 2QIEB 1VD2A 3DOWA 3VTUA 3ZXVA 4L8JA 3APCA 3IT4B 1TY2A 1M94A 3A0JA 2V4IB 2K0PA 3I4NG 1HNXL 2G45B 4NW2A 2VUMB 2KKCA 2XEWA 3OAWA 1SR3A 1G91A 3PTFC 3QG1A 2EYHA 3CCMA 2FMCA 2JPHA 2IJ0A 1ZDVA 2PW5A 3OWEB 3HOXG 2WQYB 3L13A 1I6HB 2WXIA 1TS3A 3DBLB 1JICA 4GNXA 3P20A 5IGDA 1BOSA 3PUYA 2ZJRA 1K0SA 4RAUC 2F4VL 2PI2A 4MH0E 4WWNA 3MXGA 2DAJA 2EOTA 1TVXA 2CH4W 5E7NA 3KLWA 4DBGA 1IHZA 1A62A 3MHBA 3W1BA 2MCNB 3T1YQ 3IFWB 3RNUA 3ML9A 4EUTA 1OXSC 4DV6L 4TQUS 1S4ZA 3FVQA 1GPXA 3A8JE 2PTLA 2HDMA 1WR1A 3DWMA 1YQBA 1WFQA 3QAQA 4BVUC 2AEHA 3M9BA 4ZRQA 3DVGY 3R66C 1J5EQ 3X0WA 2Y0SE 3T56B 1BO0A 3IXSA 2Z0EB 2MEKA 2WP8J 2HDLA 3BJUA 4C3HH 2VNUD 3J81c 3E5SA 5AZHA 3DWQA 2MP2A 1XNQQ 3QX1A 5IP7H 3CWIA 4LTUA 4W9CA 1KD1C 1P0RA 2B2YC 2WINB 1UE6A 2VB3X 3SDZA 2REXA 3QWZB 1RL2A 5AUIA 4KHPL 2UWQA 2LVQA 1MHHE 3IKJA 1JWMD 1QUQA 2GBKA 1WI5A 1UBIA 2KWCA 1WX9A 4K0KQ 2NVXH 2G4SA 2KQSA 3AE8B 1DCZA 3QJZA 4WAAA 3CQZH 5C3WA 4OO1I 4FJVB 3RNFC 1NR2A 3CF6E 5FO7B 4F88A 2K9XA 4ITKA 4HMIA 2RSOA 4XC2A 2WV6D 1C9OA 4A3CG 2I07B 3RNGC 1LTSD 1B3QA 2K5VA 3TRZA 1GUAB 2N9KA 1SMYC 2B2TC 1TT2A 2JA8B 1CMXB 5C0XI 5CHWA 4IALA 3AMZA 2M8SA 4KI0A 4QY7A 2N78A 2KFJA 1UEAB 4DV4L 4L5SA 4OX9Q 3VQIA 3L54A 4Y52H 1JWBD 1HH2P 4A3LH 3AH7A 4OL7A 4C4VB 4JBJA 3ZDMC 1AEXA 2ENBA 1KABA 2J0MA 1WM3A 1S3OA 2KWUB 1GOZA 1A5RA 1YJJA 3ZKJC 1U4MA 3HKZB 3NP8A 4JI6Q 3UGBB 2KCCA 2ATWA 3EJIA 4DR4L 4RFBA 5C6AA 2IDYA 4G0NB 4PYUA 2A6HD 3EIVA 2WXFA 3ZRFA 4RNAA 1A63A 4XYQA 2DY7A 4DV3L 2VQFL 1E1OA 4LF9Q 4KN7C 1EY8A 1LM0A 5K5PA 2J7ZA 1ICFB 3NEMA 2KHIA 1DD2A 1W3SA 4DXAB 2I38A 4ME5A 3GTGH 2OEOA 5CC4A 5BN4A 4IOAA 4AP4C 1KXLA 1C8CA 1WE7A 1V5OA 2KLCA 3I9V1 3ULLA 1BXTA 3TP6A 3JAMi 1IKMA 3U2SC 1YJNA 2K52A 2B2VA 2R7FA 2A1AA 2KN4A 3Q2AC 3P1MA 2UU7A 4P2CB 5C4HA 1MHWC 3TEXA 3SE0A 3W5VB 4P73A 4MZ9A 2MX2A 5CX3A 2BA1A 4DAMA 1XPOA 3PUZA 1MIUA 2XRSD 3NY5A 3LDZE 3KWVA 3DUZA 3H0GG 1MFWA 4IPHA 4CDFC 1J6QA 2KEDA 3TREA 1F2YA 3TIXA 1HUNA 4DHZE 3S1NH 4TKNA 1E8ZA 1Q81C 1G2TA 3Q8EA 2DNCA 2JU6X 3S2HB 2NYZD 1XX8A 1J0GA 1PYWD 1CKNA 3VUYA 4BBRH 4QB4A 1CM9A 3I4MG 4DV5Q 2E75C 1JALA 2BKFA 1PDQA 1V1PB 4HCNB 4DR5L 3I72A 4B0EA 1NMGA 1VQMA 3QC8B 4KVGB 2QEXA 2G9DA 4N9TA 2WDTB 3L17A 2NTSA 4GOPA 2ICEC 3BU2A 3P42A 5M5XB 2NVYH 2JXMB 1PH1A 2VZAA 3IL8A 2UU9Q 1P1AA 4PT5A 5BYQA 1GUGA 1A3TA 1NI2A 2MUYA 3WOFA 5BMIA 4MJSA 1IYUA 3UDXA 4LDTB 3VR9B 4XX5A 2L12A 4KGSA 2DAFA 1J7AA 4A93H 3TL5A 3CSFA 2NN6I 4GKJL 1Y1VB 1HEZE 1SE9A 2VH1A 1MJEA 4JOIA 4BBSG 3OJ4B 2LS01 4NJ7A 4FP5D 1RWSA 4DR1Q 3TEWA 2ZCBA 1VQLA 1NENB 4XGAB 3SK4A 1I4RA 2N1WA 2XTIA 2PZUA 2KX3A 1UAPA 1EO6A 3HS0C 4DK6C 1FYCA 3C0RB 3HOZG 1OXXK 3HOVB 4B3RQ 3Q3MC 1FXIA 3VR5A 4APVA 3VYSA 1YD8U 1IKLA 1V8CA 4LFAL 2KMAA 1E8YA 3VHTC 4IUPA 5J39A 4A4IA 5G2NA 4A3FH 3BVGA 3P63A 3V61A 4KDIC 5M3FH 2F3VA 4C00A 4DF7A 3QIAA 4OELB 4KK7A 2UXDQ 2WU2B 3H7PA 1TBEA 5FK9C 5FLMG 3A9KA 1R9TB 1BMLC 2JA5B 2VRRB 5ISRA 3EVQA 3STBC 4A3EH 4A3GG 4FHKA 1Q8KA 4QCLA 2MJDA 2KOXA 1EZ6A 2MJEA 5D14A 2GOWA 1VQDA 1WGRA 1WRDB 2BYVE 4K81A 1SFOB 4RF0A 5HY6A 1FIQA 1I3QH 3PRZA 4R4CA 4O2DA 2K6DB 2XK5B 1X9NA 2PVOD 4HLEA 2EY1A 4C3JG 4BOZB 1V2YA 3DBHI 2IPKD 4N6EB 4CDCC 1E24A 4PS7A 4JI3Q 5HI1A 1QKZA 1YJ1A 1PFSA 1WCMB 1SYEA 4GDLB 4XDDA 3AEVA 1P7FA 2ZVNA 3QOJA 4KMUC 3LXFA 1CSPA 2SNSA 1I42A 2X69A 4OX9L 2JJQA 4B9XA 3AULA 1FO4A 2Z59B 4HN7A 1JB7A 2WXOA 4FHJA 3R7RA 4LF5Q 3U58A 4XQNA 2Z0SA 4DWFA 4GS3A 1WXSA 3PLUA 3QIJA 2B3GA 1TKYA 1P98A 1S40A 3HKZE 2NPTA 3AE2B 4OIJA 2PMZE 4KJNA 2Q8TA 1YX5B 3OOCA 1HE8A 3CF5A 1D1IA 1SROA 1DGJA 2Z6KA 4RMFA 1JORA 1FD6A 3I4NB 4PMBA 3N20C 2K8HA 1PTOH 3MFYA 4LF9L 1VQHA 1N33Q 1NR4A 1C79A 3PCOB 1PH5A 2R2QA 2L8JA 4KY6A 2IWHA 1AW7A 1YNXA 2HD5B 1WGYA 1SE3A 3BIID 1PH4A 3M4PA 2IO1B 4DV7L 2WDRB 3KOJA 2NZHA 3J7YW 4LF7Q 4CHKA 2DY8A 3UE0A 4DV0Q 2A69C 3QARA 1HNWL 2OOBB 4JI1L 5GAGC 1PZID 1JOKA 4RCOA 4M1UB 1P16A 5IGCA 2MP1A 3V2TA 4RGTA 4ZRPA 2BH8A 5IKCM 1NAPA 4C3IG 3AU5A 1QWYA 3OWFA 1LT3D 3I91A 3E9SA 4NP5A 2HQLA 3LGJA 1VQ8A 1QCBD 4FXCA 3P7JA 2KOLA 4XWWA 2DZMA 1A3VA 1ML0D 1JC7A 1E10A 4CQNA 4TQ0A 3J80i 1E7ZA 2YTYA 5KNDA 3G6EA 2H88B 1VRAB 3PV0A 2EJFC 3B6YA 1PTOC 2PMVA 4KLKA 2C9OA 3K7UC 1H95A 1BR9A 5G3LD 3DVNV 4IN3A 1B2TA 2IBIB 4OONA 4WIPA 4IUTA 5E6JA 3E9IA 1U5KA 3GTKB 4I7ZC 5ELBA 3GTPB 3R3OA 1Z5SB 2N7DA 2PZWA 1MG8A 1LTBD 2E8GA 1OGWA 1PH2A 1UELA 4N59A 3VR6A 1VQ7A 3NBHA 4NKLA 1EIFA 2Z4IA 4ODGA 1VQCA 2Q5WD 3HOUG 2GVBA 3NELA 1EZ8A 1G6PA 3NHHA 2NVQB 2BH2A 3S1MH 3H7SA 4N9F4 2UU9L 2HUGA 5D3IB 2EDGA 3IAYA 1AARA 1OFFA 2BA0A 1NNXA 2CQOA 1PDXA 1JOOA 2KMCA 4M00A 2OQ0A 1V8QA 5BMGA 3FKIG 3NK9A 2QDBA 4A3MB 2WFWA 2ASBA 3D8GA 3KJPA 4GGQA 1JWSD 5LHY1 3D4DA 4A3IH 1KNEA 1YNNC 3HOYB 1Y8OB 5JXVA 2LZ6A 1XCTL 2KNBA 4G11A 2F0JA 2F0NA 4YSZB 4HR7B 4XE0A 2KC1A 1F2RC 5FJ8G 4RF1A 1VF5C 1PQSA 3UDFA 4C4VA 1I50B 2D2CC 2INDC 2BE5C 2VUMG 4C2MB 1PLFA 3JC66 4DXGA 1I94L 4DR3Q 3F1ZA 1DYQA 4E71A 4UPAA 1YX6B 4IWOA 1VQ9A 1EQQA 1WJ6A 2CKHB 1EY7A 2G4DB 3AEEB 4EOYA 1PRTF 3PZ7A 1O80A 3PUXA 2PE9A 1Z6HA 4P74A 1F9JA 3K7AB 5IT9c 4E74A 1Q82C 3KYCD 5IYCH 4JV5Q 3N6RA 1CKMA 3M85A 1GO3E 1L1OC 2X6GA 4W9GA 2L1AA 2MBOA 5KEEA 2R92H 3GTQH 3OPOA 2BW2A 2DN8A 3D4RA 1Y8PB 2G5DA 3I3CA 4AJWA 3GTMH 3EROA 3I4OA 3F2UA 4MSQB 1SNOA 4N8X1 1DOMA 3NS8A 3NRZA 4WJQA 4FXKC 4QMGA 3J80c 2QDLA 5LMUL 3R2TA 4IM3A 1HTQA 4YWGG 4LF6L 4A55A 3TN2A 1VJKA 4L6TB 4JI3L 2QSDA 4R3DA 5E6NA 3I4LA 3T4AC 4X65L 1SYGA 2LWPA 4HEA1 3S2DB 1EU4A 2KDIA 3GTOB 3HEJA 1KQSA 5H8YE
chains in the Genus database with same CATH topology
4OZAA 4CKBA 1TWCB 1IYVA 1I7HA 5C3XA 3D31A 1KDAA 4IUQA 5LL6X 1FEHA 1PZJD 1S5CD 3I4MB 4GZYC 1AP0A 1YN4A 4LMQD 5I9PA 5E4XA 1F9SA 3O13A 4XXEA 3GTJB 1XLNA 3MFGA 4IZ8A 1RD9D 4EQPA 3BK1A 1B9NA 2YYZA 1V1PA 1FR3A 5C5LA 2ZT9C 1Y56A 2G1EA 2ON8A 1E2ZA 1R4PB 2WXJA 2IX0A 4XT3B 4K5WA 2FHTA 1N5WA 4DAVA 1BCPB 2PPBC 1V97A 1YN5A 4TRDA 4BBSB 4ID6A 3HRDD 3SK8A 5I6YA 4FNFA 1CJEA 3S16B 2H89B 5I9OA 3AE6B 4Z9CB 2HCIA 1AYFA 2FE8A 1BDOA 1S5DD 3M4OB 1Y69U 1PFBA 1TWHB 1SDFA 1ZXHA 1PRTC 2PQEA 4XIGS 1J9OA 2EELA 4KN4C 3VR8B 5HG2A 1GB4A 5BYRA 1WXQA 1Z7TA 1EWHA 3U9SA 3Q8AA 3NWSA 3T53B 1X3QA 2EY5A 5CV6A 3GV6A 1XLQA 1Q3LA 4XDCA 4WQMA 1EWYC 5C4XB 3KLRA 1RODA 2JA7B 2F0TA 3P4SB 1PFNA 3UI3A 4ZKCB 2KJXA 3M3YB 4C3JB 1ET6A 3D3RA 5H92C 2LHDA 2O2LD 3HUIA 5C4ZA 4K8IA 2MHVA 2XWJB 5KIXA 4KX6B 1YJIA 2E3TA 3MC0B 2BS3B 2QMTA 2A6ED 3BYYB 3S1RB 1F2RI 3AEGB 1DOKA 4C56C 2F0FA 4K2KA 1TWAB 3H09A 4ZHPA 2YU9B 4RKBA 1HQMC 1G8ZD 2F0IA 2RSNA 3MTSA 1EEID 4B0MA 3E56A 3AE3B 2PKOA 2E2HB 5AFWA 1AZPA 2A73B 3BVZA 1XCQL 4YTMB 1DOYA 4NMZA 2L1BA 1CFMA 2F3WA 1S5FD 4FF1A 3VRAB 5C5MA 4KKUA 1LT4D 3SK5A 4F7XA 5IIFA 1E0ZA 3C1FA 4V190 5BN3A 3A8IE 2IX3A 4BY7B 2OEDA 4KKIA 2EXZA 4C3IB 2D62A 3GD7A 2FBWB 1A3UA 5BMHA 1FD7D 3LYYA 1Y1WB 1K83B 4KV6A 4FO2A 5EKKA 3MEHA 4A3KB 3E6ZX 2A69D 5I4DA 2F0KA 5FO9B 2WXHA 1EYCA 4RWSC 2W3RA 1B53A 5DNFA 4MHEA 4ZKBB 2KVMA 3L9AX 3VA7A 1PFDA 3TP5A 1D1KA 2R6GA 4ZRZA 3AE5B 2ZW1A 1TS5A 2LGIA 1F2MA 4R8NA 1D5XC 2DYOA 5C3JB 4XDXA 3NZ3A 4ZQ3A 1CTMA 2B2WA 1PTOD 3SR6A 1QJOA 3HOUB 1SEBD 1FFUA 3RD4A 2F0MA 1Q10A 3OIQA 1KDCA 3FKIB 1M8AA 1NUCA 4R8IA 4ABNA 1FCCC 1ENFA 1NEKB 2EY6A 5A2QL 1JMLA 3ZJUA 3ZJTA 3FPPA 2IL8A 2EZVA 1IGCA 3CHBD 1SE2A 1NI3A 4ZK9B 4KHZA 2WP9B 1CK1A 2K04A 3LWEA 5LL6S 3TP7A 1FNUA 5I6WA 1U4LA 2OT2A 1B44D 1ACCA 4HJGE 1YNND 4DNTB 4K8JA 3U52E 2QEJC 2BS4B 1J8IA 3I90A 4KGTA 4AS1A 4C3HB 5C2TB 3EQLC 3ABVB 2BE5D 1TS4A 3A7LA 2EYMA 1C4QA 1FRDA 4NZLB 2IGDA 1QE6A 5EE9A 5FOBB 3K58A 4CBVA 4ULLA 2BBCA 1J7CA 1STEA 2RBMA 3WDNA 3SFDB 1R7SA 4DGZA 2VXWA 5A2QE 1STAA 3J81L 1GUTA 2B8GA 4DQOC 1STBA 1QG7A 1ZP0B 4PV1C 5A35A 5J22A 4BA2I 4US9A 5DM73 2V0GA 2F0VA 4DNRB 3VR3A 3PO0A 3S9WA 1SNDA 1YNTE 4L1BA 1YQ3B 4LK0M 4HROA 1Z47A 1PUTA 2OXPA 3ZQ4A 2BDNA 4HAEA 4Q2JA 3V96A 3OSOA 1TKEA 2TSSA 1ZXIA 1STYA 3Q24A 1SB3C 1Q12A 4KY5A 3AM9A 2VZKD 2JE6I 2FFKB 1CT1D 1Y8NB 2HCCA 1WTWA 1PZKD 4MACA 1UGJA 1C4PA 2JQRB 4AYBB 1WTXA 2BCOA 3EGRA 1A2UA 1FCLA 2E2IB 4P16A 3LWUA 1EQVA 4ZHOA 3J81E 1TZOA 3AEDB 4C1NI 1T6BX 4KHVA 4UDUC 4DK0A 5J1ZA 3BDCA 3S1NB 1B50A 1A15A 1SNPA 1XLOA 5EE0A 1PRTD 3HVZA 5E4WC 1DZ1A 1JQYD 2O5IC 2M19A 1Q8IA 4X3SA 4FF3A 2EKIA 3TP8A 5EPJA 2SOBA 2M0AA 3TUOA 1QOBA 2NVYB 1EYAA 4IUVA 2RDHA 1IL8A 1KRHA 1QF6A 4YT0B 2K33A 5JJZA 1QQRA 4USAA 4PMWA 1SJHD 1RFKA 2CJNA 3AEBB 2LUMA 3M7NA 1C9FA 3NXWA 2G9HD 4J8QA 3ZYYX 3L4PA 4DXFA 1HTLD 4LAAA 4E6IA 4L2YA 1CA6A 2K6AA 1K8OA 1ZUD2 2AWOA 4ZYSA 5JEAJ 1XO3A 3PIO3 4LK1C 3VR4A 4IOIE 5JEAG 1RTNA 3BK2A 3R2IA 4XWTA 2HTME 2J52A 2K22A 1LTTD 2Z1CA 5IGBA 3P4QB 1MD2D 3NS1A 2CQAA 3OIPA 1WTQA 5M3FB 4RCNA 2SEBD 2KHSA 4FVMA 1GHJA 1EL0A 1WTRA 3A7AB 2M00A 2L0CA 4A3EB 2J53A 3Q22A 2XRQD 2YEPB 4OO1G 4WH4A 3NUCA 2CJOA 2K32A 5C0XJ 1KNAA 5EGTA 1SNQA 5C0XG 2D5DA 3T3OA 5CBEE 2ZW0A 3IFTA 3PZ8A 2CVRA 1F9PA 3AV8A 1E0BA 4US8A 2WXKA 1SYCA 2L11A 5K36H 3NVYA 3MVVA 1STHA 1TR5A 2A6EC 2SAKA 4TQ1A 1RYJA 2F0SA 4H13C 1TU2B 5EQ0A 5NUCA 2A68C 4IUNA 2ACZB 3C1EA 1EEFD 1NYQA 2EYPA 1A70A 5C4JB 4FYDA 1IW7C 2CHBD 2F0HA 5EBDA 4YSXB 3AB9A 5CR3A 4IFDH 4XTCS 1T5XD 2FMMA 5DM63 4KD3A 3S17B 3DXJC 4K5VA 1HQRD 1SYBA 4G4KA 1QOHA 4A3BB 2F0GA 2EYOA 3FAHA 4ZUJA 4O42A 4TSSA 2B2YA 2E74C 4M8AA 4CJ2C 1HCZA 2JSOA 3NQTA 1U4RA 3JAME 3X3MA 1SAPA 5IGEA 1BQQT 3LNNA 3N52A 1FNVA 3RMHA 4IUUA 3Q8BA 1TWGB 1ENCA 3DWPA 3ITPA 3ND8A 5EPLA 3HOWB 1N62A 4QUFA 5G5HA 2DWQA 5KRUA 3Q69A 1R4QB 1SNMA 4H2AA 5CBAE 3L3OC 5EBCA 3QJYA 4I65A 4OIKA 3W1SA 1HZ5A 5FO8B 1VF7A 4DN4M 5KYIA 3AEAB 1H9RA 2ICIA 2KMMA 1SSOA 2ZXRA 3K57A 4MN3A 3EFXD 2KCNA 3S1MB 5I2YA 1E6EB 2QKIC 3K0YA 5ELDA 1QLBB 5FKAC 3FILB 2DBYA 4A8XC 1O7LA 1KLGD 1V1OA 4OVZA 1GPXA 3A55A 4XYOA 3FMCA 1HZ6A 1W6KA 1Q1EA 4KTAA 4X3UA 2L83A 2Q8RE 2K01A 3S14B 1B9RA 4ZAIA 1H9KA 2M2LA 4K2LA 3GO5A 4RKLA 5ELFA 2KWDA 4GDKB 1RHPA 1JR0D 1QOFA 1RKNA 1LLRD 2GB1A 4RHRA 1MPEA 4HKZE 2JZPA 4G7HC 2L32A 4F87A 5D65A 4B9WA 5C44B 2F0QA 3H6MA 1FM0D 4M0WA 2R92B 2AQ1B 2XVSA 1TS2A 2KQ4X 2BYTA 2H4OA 2DLBA 3NBIA 1X32A 5CV7A 1NYRA 1F0ZA 5DEHA 1DOLA 1I4XA 1HFGA 5EPKA 1WSPA 1AZQA 4PQXA 4C3HG 3IT6B 5IT9L 2WXLA 4D2KA 4DK1A 4HMJA 3S15B 1QNUA 3HP3A 4LLGM 4RGOS 2IW3A 4RGMA 1JQ4A 1YNJC 4K6DA 5M3MB 2F0WA 3RZDB 2KEEA 2V4DA 3J80L 1BBXC 4A3DB 3AU7A 5M5YB 2WXPA 3AEFB 2F0LA 1S5BD 2I2YA 4X3TA 1ZEQX 4H0LC 4QF4A 3BG3A 3HRZC 4EQOA 4CJ0B 1SF0A 4NDXA 2JX5A 2QCPX 1C78A 4HTHA 1BCPF 4YIJA 2NVTB 4NAWB 3MP9A 1XXGA 1HTPA 1AWDA 1KAAA 4CKCA 1MI0A 1KFYB 5IT9E 1CHQD 1JOQA 4IFDI 3C2PA 2K5DA 3Q23A 1RF2D 3I8ZA 2I46A 2R93B 5ELCA 1H9SA 1LTID 2ID0A 2LMCA 3HZXA 2WLBA 2WXGA 2BTEA 1RTOA 3J80E 1B4OA 2OF1A 1UWMA 2RQXA 4U673 3NQIA 3S1QB 4H44C 5BN5A 3OW7A 1PMRA 3OMCA 4YXDB 4ARIA 3HGBA 1CI3M 1ESFA 2JYEA 1FXAA 1FRRA 4DFAA 1H9JA 2MH7A 1U9RA 4FXGC 1VLBA 3KBGA 5CV9A 2EY2A 1TKWB 1PXUA 3C3LA 1IUEA 1M4VA 4Q5VA 2XNAC 4PMCA 1TQOA 1WYGA 2PW7A 3TZUA 3Q8FA 1LTGD 1UUPA 1Q90A 4CJ1B 2WDQB 4G7OC 1KDBA 1EY9A 2KQ3A 3G6JB 2A68D 2Y0SB 3U9OA 3GQBA 1FFVA 1IW7D 3MXUA 1P7EA 1N60A 4YSYB 1CHPD 1BCPC 1WGKA 4LJZC 2N88A 5EKIA 1JB3A 1L6UA 5F2DA 3DMUA 3RUZA 1G6ZA 1GUWA 3P4RB 3OMGA 1CZGA 1EFID 2WAQB 4C7ZA 3KF8A 3CU7A 3FRPB 1LT6D 5CMDA 4JE3B 4MM3B 4J6HA 4J3OD 3D4WA 2B2VC 2GA4B 2JEAI 2PW9A 2F0EA 1JCKB 4MH8A 3KBXA 3BVMA 1XWEA 3RZOB 3MA2B 1L0XB 2LEKA 1RJTA 2V3PA 5G5GA 1GB1A 1N5XA 3NVZA 1N61A 3C8YA 3DWGC 4RA8A 3PO2B 3HG9A 1II3A 5C3EB 2F1MA 5IGFA 4JWSC 2EYLA 2MPMA 1WWTA 4ZOHC 5G3LF 2M56B 2JYOA 2K28A 3K5LA 2W54A 3PO3B 4OHJA 4OZCA 2F03A 3ZJVA 1YMHE 4J1MA 3FILA 3SK6A 4U68A 3VYUA 4Y7NB 4P6VF 2J0TD 5T1IA 1ZYRD 3P75A 5EE3A 1GUNA 2Y5PA 3ERQA 4WAFA 1L0YB 1K52A 5M5WB 1HUMA 1L4ZB 3AE9B 3WCQA 3TZDA 2JSVX 1MVKA 5T8IA 1XTCD 2RMMA 3NWTA 1EOTA 4C1NK 1VR9A 1OQRA 3QO2A 4JBWA 3VRBB 2KUMA 1F77A 1O7ZA 1K51A 1ESRA 2B2UA 2INPE 4MT5A 1BUIC 1I4PA 1FMAD 2KACA 2JA6B 3BDOA 1HRJA 3J7AF 4IKGA 2J4XA 2TMPA 1XF5L 1E2WA 4A6QA 4KGRA 3RPFC 3QWNA 2NVXB 5KYLA 2B8FA 3W5UB 3MJ5A 3CQZB 1Q1BA 1EIGA 1OXTA 4IDIA 2LY7A 2LKVA 2V3NA 4G57A 3AE1B 2BOSA 3T13A 2A74C 3K5MA 1LABA 2PLPA 3NVWA 1EWCA 4MIUA 1YNJD 2D9UA 2PO4A 1TYGB 1JWAD 2NMQA 4RHSA 1KF6B 3NE5B 2JXTA 1SSNA 1SXTA 1WD0A 2LFIA 2WB1B 3C46A 1HHVA 3AN1A 2J42A 4KJOA 3ZGZA 3NTIA 3U4EG 2NBFA 2EYJA 4K5XA 2WXMA 1EY5A 4G7ZC 1BF4A 4A90A 1VDZA 3TEYA 1S5ED 3GTGB 4IURA 2CW0C 4WFN3 1PFMA 1CQFA 1K50A 1U4PA 3V3XA 4JPSA 3L7ZC 1QOGA 1JWUD 4V0BA 5MPOA 1ICWA 3HVDA 5JPMC 1GHKA 1WRIA 1D2BA 1TIID 1K8MA 2X6LA 3W3AA 4EGVA 4TMAB 1EYDA 1VMPA 2K5QA 2L4NA 2W55A 1HXYD 2PMZB 4UAIA 3KLSX 1VZ6A 4X3KA 4C80A 4DAYA 3K5NA 1YQ4B 3LX0A 4HSVA 4BY1B 4YTNB 5KNCA 5E1FA 3Q0AA 4BBRB 4JX1C 3FPUB 3GTLB 1LT5D 1PGAA 1ILPA 2W3SA 1QOAA 1TWFB 3NTKA 1AFPA 1FNWA 4A9AA 3G7LA 3A8KE 1LACA 3MXPA 1I4GA 4C7YA 1CZPA 1H9MA 2PCFB 2PYKA 2O5JC 1RM6C 4A93B 2K7VA 3PIP3 3I73A 4ILWA 4KY7A 1ILQA 4XT1B 2RDGA 5JAVA 1HPCA 1N63A 5AUKA 1H9SB 4A3FB 2IT1A 3PUVA 2LMCB 4AQ7A 3K5OA 2RDFA 1ENAA 3SHLA 2AUKA 2YEPF 1BCPD 1ONLA 2WACA 1IBXA 1T5EA 4ARCA 1DM0B 2F4IA 1LO5D 3TDQA 1LV9A 2EE1A 2LHEA 4EQNA 2Z8LA 2WU5B 1GUSA 1I3QB 2C5CA 3M7GA 2EYFA 1C76A 2BT6A 3ONAB 3R8BA 2PNRC 2D5GA 3JAML 3P1HA 3KK7A 4QIWB 3UI2A 2RA4A 3CIRB 2AWNA 1ET9A 2VB2X 2F0DA 3BZDB 5JOBA 2BDOA 1TY0A 2NTTA 1VZ7A 3FC4A 1ZOYB 2F0PA 3PMFA 4KD4A 4BS9A 4IQZA 1EY0A 3FDTA 1PTOF 2K05A 4O1NA 1PGXA 2PZTA 1NSNS 1PTOB 3GV3A 2XWBB 3H94A 1HA6A 1C77A 1SBBB 2K1BA 2XIWA 3MAQA 4WURA 1C4AA 2RKSA 3N9YC 2Y3AA 3OHXC 4RH6A 5I2XA 2FINB 2IX1A 3R93A 1QT9A 5T1GA 5TSSA 3T16A 4JK1C 1MGSA 2E6XA 3VR2A 3BYTB 1STNA 2FJ2A 3TBIB 5M9OA 5EE1A 2N55A 4R9WA 2LJIA 2B2TA 1GJXA 3MZ5A 2KA7A 1F9RA 4ZUIA 1B1ZA 2B76B 5IOCA 2DNEA 3E0JA 1D4BA 4DA2A 2OHFA 2E2DC 3J7AV 3HOXB 4HCEA 1DONA 2WDVB 1YN3A 2INNE 4NAMA 3VYRA 3U7ZA 1C4CA 3IAM1 2X38A 1C48A 2WIIB 3K59A 4RGNA 3IAS1 1ZDXA 3DWAA 4F8MA 2R61A 2PVGC 4Q0FA 2ZXPA 2NN6G 2JYTA 1OO9B 3DM1A 1HA5A 1DOIA 3AMUA 4L23A 1ZYRC 1TJEA 1WTPA 2BS2B 2K5PA 1XLPA 2XSCA 3NPPA 4A3IB 2JP1A 4HCSA 2B39A 1XEEA 1T3QA 2WXRA 3Q8CA 3GS2A 3W2DA 1B3AA 1GXDC 1VMCA 3B9JA 2EPBA 1RDPD 1MHXA 3WOEA 2L5TA 4YTPB 2QJLA 2HDEA 4K14A 1I4HA 5EJWA 3KLSA 1SE4A 1WTOA 1K53A 1GAQB 4WORA 3SR1A 4REZA 2NUCA 3H91A 2NB0A 1VZ8A 2M9VA 3GTQB 2EJGC 3GB1A 5HHDG 3MWYW 2VZKB 3GTMB 5HFYA 1D5MC 2WS3B 2ONQA 5IGGA 1TKGA 2JWUA 2E76C 2CW0D 2RPVA 1IGDA 4HEDA 2W82A 3TEZA 1SMYD 1SYFA 2AX5A 2FUG1 1HFNA 5FR3A 3MXNA 3CRLC 4JWUC 1F9QA 3TSSA 3NVVA 4NJCA 3IFDA 3K6OA 5EKLA 5D7GA 3B2GA 3P4PB 4HKQA 1SIJA 2IGHA 1EY6A 2AQ3B 1PRTB 2BB5A 5FLXL 1L4DB 2B2WC 2NWGA 2EVBA 1UWXA 1CQVA 5CV5A 4ZLTF 3I70A 2B63B 5KNBA 2K3UA 2E2JB 4EE2A 4HRSA 3GP7A 3H0GB 4WRDA 1A2TA 4CHTB 2GI9A 3CKIB 3QB3A 1V43A 5CGKA 1LTAD 1OQQA 3NUHB 2IGGA 4FF2A 3DHQA 4PNYA 1X3PA 3V05A 1UNSA 2BB6A 2RVLA 2N9LA 4S3SA 3H8HA 1MSGA 1BUVT 1EM7A 3RLFA 2KAJA 2B2UC 1NVID 2H1EA 1J7BA 3RFZB 3DEPA 2A6HC 4KKJA 4OW0A 3EA6A 1STGA 1MI2A 4B08A 3NTHA 4KKTA 2HQEA 1NCVA 1SYDA 3DEOA 3AE4B 4OZBA 1JW9D 5FLXE 5CYUA 4L63B 2N0SB 3KUPA 3A54A 3KQ4A 2WKDA 2ZXOA 3SEBA 3BWUD 4BA1I 1QILA 3J9CA 4XQQA 1L5PA 1E7PB 3QOLA 4TKOB 1WD1A 3M4YA 3D6WA 2XN9C 3HOZB 5JEAH 1OXUA 5JVH3 5E3FA 2Y5CA 2A5HA 1SJED 3TMEA 2QILA 1QB5D 3SVMA 1XYIA 5LNK1 1KH0A 4OGQC 2Q8IB 1A6XA 5KGUA 4XQJA 2GRIA 1ZXTA 1DOXA 2SNMA 2SDFA 1BNZA 4A3GB 4FXDA 2KECA 1B9MA 2NZ1D 1JRPA 4OO1H 4FF4A 3VA5A 1ZE3D 1KTKA 2K03A 2MGSA 1KLUD 5C0XH 5D3DA 5DAUA 4KKSA 2PIAA 1FGBD 5HURA 2L9HA 3BDLA 2JEBI 3NSWA 3AECB 3AB5A 1G2SA 5BYSA 4CGYB 5JPNC 3T3NA 3Q6SA 1EIHA 1EQTA 2N7JA 2F0UA 4A3JB 2DYMA 3SFEB 1IBXB 5COYA 2O4XA 2KDMA 3CRKC 1ZKOA 3H3VC 2MJ3A 1MSHA 1RCVD 1ROEA 5CORA 3AE7B 1ZPSA 1W6JA 5K36G 5GXGB 5CV4A 1OXVA 2K5WA 3BS1A 1E2VA 5CV8A 1JE4A 1D6EC 2LFNA 3MHZA 2EJMA 4CKEA 3FEWX 4IFDJ 2AQ2B 3A56A 1LTRD 4BWGB 2QF7A 2Z4HA 4IFDG 4K6LA 3SXHA 3EUB2 1CZWA 2AUJD 3I57A 1VDVA 3D6CA 2R3ZA 1I4QA 1D5ZC 4DAPA 4WJWA 1L6VA 2WXNA 1F2LA 5IODA 1EY4A 2WXQA 5ELEA 1E9MA 3W9CB 3PUWA 1DJRD 1EU3A 3VYTA 1PGBA 3X3NA 4DU9A 2CU3A 3ETRA 4QUCA 1DXMA 4N58A 1L0VB 1I6VC 1VCIA 5JVG3 5HGTA 4H7BA 2L55A 1MBYA 4N9PA 2NN6H 2WKCA 2L52A 4GLSC 2R7ZB 2WNMA 2MJ8A 3URYA 1G291 1QNKA 1WTVA 3KWLA 4WWMA 3ND9A 1WVLA 1SNCA 3LB8C 1JROA 1O78A 4EVOA 1GUOA 1O7YA 4HSPA 1AN8A 1CA5A 3B2FA 1F2ZA 2F0OA 3T51B 2QIEB 4L8JA 3IT4B 1TY2A 2V4IB 2K0PA 4NW2A 2VUMB 1G91A 3QG1A 2EYHA 2FMCA 2WQYB 2IJ0A 1ZDVA 2PW5A 3OWEB 1I6HB 2WXIA 1TS3A 1JICA 3P20A 5IGDA 1BOSA 3PUYA 4RAUC 3MXGA 2EOTA 1TVXA 1IHZA 3MHBA 1OXSC 4TQUS 1S4ZA 3FVQA 3A8JE 2PTLA 2HDMA 3DWMA 3T56B 1BO0A 3IXSA 2MEKA 2WP8J 2HDLA 2VNUD 3E5SA 3DWQA 3CWIA 4LTUA 2B2YC 2WINB 2VB3X 3SDZA 5AUIA 1MHHE 3IKJA 1JWMD 3AE8B 4ZRQA 1DCZA 5C3WA 4OO1I 1NR2A 5FO7B 4F88A 2K9XA 4ITKA 4HMIA 2RSOA 2WV6D 2I07B 1LTSD 2N9KA 1SMYC 2B2TC 1TT2A 2JA8B 5C0XI 4IALA 3AMZA 4KI0A 1UEAB 3VQIA 1JWBD 3AH7A 4OL7A 1AEXA 2ENBA 1KABA 1GOZA 1YJJA 1U4MA 3HKZB 3NP8A 2KCCA 3EJIA 4RFBA 5C6AA 2IDYA 2A6HD 2WXFA 4RNAA 4XYQA 2DY7A 4KN7C 1EY8A 5K5PA 2J7ZA 1DD2A 2I38A 4ME5A 2OEOA 5CC4A 5BN4A 1C8CA 3I9V1 1IKMA 1BXTA 3TP6A 3U2SC 2B2VA 2KN4A 3P1MA 4P2CB 5C4HA 3TEXA 3SE0A 3W5VB 2BA1A 3PUZA 2XRSD 3KWVA 3DUZA 2KEDA 1F2YA 1HUNA 1G2TA 3Q8EA 2DNCA 2JU6X 3S2HB 2NYZD 1XX8A 1PYWD 4QB4A 1CM9A 2E75C 1JALA 1PDQA 1V1PB 3I72A 4B0EA 2G9DA 4N9TA 2NTSA 2ICEC 3P42A 5M5XB 2JXMB 3IL8A 4PT5A 5BYQA 1GUGA 1A3TA 2MUYA 3WOFA 5BMIA 1IYUA 3VR9B 2L12A 4KGSA 1J7AA 2NN6I 1HEZE 1Y1VB 2LS01 4FP5D 1RWSA 3TEWA 1NENB 3SK4A 1I4RA 2PZUA 1UAPA 3HS0C 1FYCA 1OXXK 3HOVB 1FXIA 3VR5A 3VYSA 1IKLA 1V8CA 4IUPA 5J39A 3BVGA 3P63A 2F3VA 4DF7A 3QIAA 2WU2B 4KK7A 5FK9C 1R9TB 1BMLC 2JA5B 5ISRA 3EVQA 4QCLA 2MJDA 1EZ6A 2MJEA 5D14A 4RF0A 1SFOB 1FIQA 2PVOD 2EY1A 4C3JG 2IPKD 4N6EB 5HI1A 1QKZA 1WCMB 1SYEA 4GDLB 4XDDA 1P7FA 3QOJA 4KMUC 3LXFA 2SNSA 2X69A 4B9XA 1FO4A 4HN7A 2WXOA 4XQNA 1TKYA 3AE2B 4OIJA 4KJNA 2Q8TA 3OOCA 1D1IA 1DGJA 1JORA 1FD6A 3I4NB 4PMBA 1PTOH 3MFYA 1NR4A 1C79A 4KY6A 2IWHA 1AW7A 1SE3A 3BIID 2WDRB 3J7YW 2DY8A 2A69C 1PZID 1JOKA 4RCOA 4M1UB 5IGCA 2MP1A 3V2TA 4RGTA 4ZRPA 1NAPA 4C3IG 1QWYA 3OWFA 1LT3D 3I91A 3E9SA 4NP5A 1QCBD 4FXCA 3P7JA 2KOLA 4XWWA 1A3VA 1ML0D 1JC7A 1E10A 4CQNA 4TQ0A 5KNDA 2H88B 1VRAB 3PV0A 2EJFC 1PTOC 2PMVA 2C9OA 1BR9A 5G3LD 4IN3A 1B2TA 4WIPA 4IUTA 5E6JA 3GTKB 4I7ZC 5ELBA 3GTPB 3R3OA 2PZWA 1LTBD 4N59A 3VR6A 3NBHA 4NKLA 2Z4IA 4ODGA 2Q5WD 1EZ8A 3NHHA 2NVQB 2HUGA 5D3IB 2EDGA 3IAYA 1OFFA 2BA0A 1PDXA 1JOOA 1V8QA 5BMGA 3NK9A 2QDBA 4A3MB <