1JWMD

Crystal structure of the complex of the mhc class ii molecule hla-dr1(ha peptide 306-318) with the superantigen sec3
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwmD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwmD02
5TSSA 1YN5A 1LLRD 3DWQA 1PRTB 1SE4A 1CQVA 2TSSA 2WV6D 1LTBD 1SEBD 1EEID 1FGBD 1LTSD 1TS2A 2AQ1B 1S5DD 1BCPC 1L0XB 4UDUC 1ET6A 1ENFA 1HTLD 1B1ZA 2ICIA 1CK1A 1LTID 1V1OA 1D6EC 1STEA 1PTOC 1TS4A 1SJED 1V1PA 1SE2A 1TS5A 1RF2D 1D5ZC 1JR0D 5FK9C 4C56C 1UNSA 5ELDA 1FNVA 2IPKD 3SEBA 4RHRA 3BVZA 1LT6D 1EU3A 1M4VA 1TY2A 1EU4A 2XRSD 4L6TB 1PZID 1EFID 2NTTA 1MD2D 1XXGA 5ELEA 4DXFA 1UUPA 3TSSA 1GOZA 4RFBA 1HQRD 1FD7D 1RCVD 1LTRD 1SJHD 1ESFA 3CHBD 3O13A 2J4XA 1T5XD 3R8BA 2SEBD 1SBBB 2CHBD 3BVGA 1BCPF 1I4QA 1QILA 3DWAA 1TY0A 1S5CD 1XTCD 3MC0B 1BCPD 1I4PA 4L63B 3OWEB 1PZKD 4TSSA 5FKAC 1BCPB 1PTOF 1CHQD 1PTOD 3KLSX 1TS3A 1PTOB 2RDGA 1AW7A 1RD9D 2O2LD 2R61A 2XNAC 5I4DA 1YN3A 1JQYD 1S5FD 1D5MC 2XN9C 1DJRD 2NTSA 1S5BD 1EWCA 4DXGA 4K6LA 3EFXD 1SE3A 4ZYSA 3W2DA 1FNUA 4Z9CB 1CHPD 4RGNA 1FNWA 1I4HA 4NZLB 2AQ2B 1LO5D 3GP7A 1LTGD 1I4GA 1S5ED 5ELFA 4O1NA 4RGMA 1PRTC 2QEJC 1LT3D 4RHSA 1ET9A 1I4RA 3R2TA 2QILA 1L0YB 1RDPD 5D3DA 1LT5D 1PRTD 1LTAD 1CT1D 4RGTA 1SXTA 1D5XC 3MFGA 4RH6A 2G9HD 2XRQD 4RCOA 3URYA 4BWGB 1KLUD 3EA6A 5ELBA 1AN8A 1BXTA 3BYTB 2AQ3B 1PZJD 5ELCA 1JWSD 1F77A 1PTOH 2Z8LA 1KTKA 2RDHA 3V05A 1KLGD 3BYYB 1LTTD 3R2IA 1HA5A 5D3IB 1YN4A 1JWMD 4OHJA 1EEFD 3DWPA 1DYQA 1V1PB 1LT4D 4RGOS 1PYWD 1HXYD 1PRTF 2IJ0A 3BVMA 1G8ZD 1B44D 1JWUD 1JCKB 3BZDB 1I4XA
chains in the Genus database with same CATH superfamily
3P4PB 4YY3Q 1P7FA 4YTMB 3HOWH 1EQRA 1Q3LA 1UEBA 2WV6D 1MFWA 1EEID 3I3CA 4JW0A 1FXTB 1EZ6A 3S15H 1IXRA 1FRRA 2KT7A 4OZBA 4A3OA 1A15A 2YV5A 4DK6C 3OSOA 2AL6A 2BB6A 3PSIA 1WD1A 2E2JH 2RHQB 3OTOQ 2KXJA 1QOFA 3PF5A 2WB1G 3E0EA 3RFZB 5IODA 3AB9A 4EVOA 4EQNA 4M0WA 1OQQA 2LD9A 2C5LC 1QUQA 4OO1I 5M5XB 4CDEC 3RNUA 2VRRB 3D3RA 4DR2Q 2HCIA 5E1FA 1FCLA 1IKLA 1J8CA 3U7DA 1VCBA 2B2YC 1LABA 3KLRA 4F7XA 3QOLA 2DNEA 3JAMc 1FD7D 3M85A 3UQAA 2IO2B 2KDEB 4AYBE 2N9PC 4PMCA 1GUSA 5CBEE 3I4NH 3O13A 4DPGA 1XQQA 3NQIA 4ABNA 2R93H 1T5XD 1YEZA 1EY8A 4IPDA 1N63A 5TR5A 3D8GA 5HFYA 2EJMA 3FC4A 2GN5A 4GOCA 3MC0B 3S17B 4H2AA 2JA6H 4L63B 4ANWA 1XF5L 2QHOA 1QOAA 4HMJA 2VH2A 1R4PB 3TEZA 2Z6KA 1HTPA 4FXGC 2ZZPB 2M8SA 4R4TA 3BJUA 5BR8L 1CSQA 1TS3A 3PO3B 4MSMB 1DCZA 1RTOA 1RYJA 5JHBA 4W9LA 4ANUA 1YI2A 3ZLZA 1I42A 5HG2A 3J7AV 3DCGA 3CRKC 4OEMB 4DR1L 1F9JA 4DWFA 2F0SA 2KQ7A 3T56B 3T8MA 3HRZC 3AM9A 2V4DA 2VY3A 5IYDG 3K7AB 1V5TA 2JX5A 2RGFA 3S9WA 4OX9L 3IKJA 4F88A 1LXDA 1FYCA 1AFPA 3GS2A 3QOJA 2FMMA 1WY8A 4C2MH 4TQ1A 1LTGD 2F0EA 4YY3L 3TMPB 3KUZA 5DPWA 1FD6A 2ASBA 1WX9A 3MC9A 4OVUA 5BYRA 2F0NA 2F0HA 3TZUA 4TRDA 2GI9A 3B0AA 2O2VA 3NQTA 3F2CA 1Z6HA 2KK8A 2EY2A 3CF5A 1Q82C 3V3XA 3A74A 2YLMA 5BMGA 2LSSA 3HZXA 3HOUH 2WX1A 3X3NA 3OTOL 2AUKA 1R4QB 2L1BA 5C3EG 4L23A 4DHZB 2A1AA 2QDBA 1GHJA 1MJDA 3D4RA 3MZ5A 3AB5A 4LDTD 2NVQH 4CHKA 3PO0A 4XC2A 2B2YA 5I6WA 2HJ8A 2RQXA 1XLPA 4ID6A 4OL7A 1YJWA 3AFPA 4RKLA 4BA1I 4LMQD 5DM63 4A20A 1KLGD 3CCEA 1YQBA 1J0GA 1P8LA 1HZCA 1EUVB 2Q2TA 4IKGA 1JWMD 2EMSA 5C6AA 1MVKA 2MP2A 3KYCD 4A3PA 3TEXA 1DYQA 3ULLA 4NPSA 4XQQA 1P98A 1UE1A 1Q1OA 4WIPA 1XLQA 1VS0A 4ZLTF 3AE1B 3J80E 1TKEA 1R9TH 2BBCA 3SVMA 3JSVA 2VQEQ 3HOVG 3ZNZB 5C44B 3U4VA 3CXCA 1KAWA 1Y1VH 4GB9A 5JOBA 1B70B 1Q90A 3G71A 1GPXA 5GAGC 1GHKA 1VZ6A 1C3TA 3APDA 2ZT9C 2CHZA 4YHHQ 1GB4A 1K3BC 1ZOYB 3M62B 3TMEA 5C0XH 3I8ZA 5JPNC 2MP1A 1CMXB 1TS4A 2JF5A 3R66C 3ZGZA 1SE2A 4P1CC 3AN1A 4GN3B 2EYLA 2GBKA 3BDCA 3BS1A 2G5DA 2KMAA 4DV6Q 1UNSA 4JYAQ 4FP5D 4IURA 4ZUJA 1VQ6A 1ZXHA 2K8BA 2KDFB 2WB1B 2KFJA 2LJ5A 2B76B 4KX6B 1UWMA 4MDKE 3S1MB 4WWMA 1J7AA 1TKWB 3CMAA 5K36G 2X8XX 4K2KA 1L1OC 1RCVD 1VF5C 2HCCA 3K58A 3KW5B 2L0FA 2NVYB 3AE7B 4Q5VA 1HCZA 4A3EG 3GV3A 3PUVA 1C4QA 3CPFA 1WWTA 4TMAB 5JZEB 3ER0A 2WP9B 2CWPA 4CKBA 2VZAA 2CHBD 1BCPF 4C3IH 3IG3A 3AXCA 3PZ8A 4RF0A 2HTHA 1GUNA 2VNUD 2MJ3A 4JGHB 4DR7L 3NVVA 4IUMB 2WAQE 2Q2HA 2KJ6A 2KHIA 3SGIA 1PTOD 2E3TA 3Q3OC 3VQIA 4R8NA 3VR3A 2NVUI 4A3BG 1NTGA 3ZJUA 1L4ZB 1TT5B 1E90A 3HIZA 1ROEA 5LNK1 4J6HA 1OGWA 5CYUA 2ON8A 2JE6I 2C5CA 3UI2A 5HGQA 1N5WA 1MI0A 3NK9A 4GSWA 2K01A 1O80A 3NY5A 1X3QA 1CZPA 2LMCA 4HLEA 1U4PA 1OXTA 4C4VA 1PA6A 2N9EB 4DUYQ 1BUIC 3KYDD 5H1SE 3NUCA 1F9QA 3U50C 2XK5A 2PZTA 1CHPD 3ERSX 3CCMA 1WGHA 2E6XA 1GM5A 4FHKA 4NZLB 4YWGG 2XWJB 3U58A 3IAS1 1EQTA 1PYSB 5FLXE 5EKLA 1DOXA 4XT1B 2SOBA 2VQEL 3B1LX 5J18A 3K57A 1B7YB 2F0VA 3S1NB 2GVBA 2VS1A 2L76A 4IOIE 4PT5A 1K0SA 1ASYA 1K83B 3AU4A 2L12A 3CCVA 4BY1H 3QWNA 2JJQA 1OEYA 4IM0A 4YHHL 4TQ0A 5LL6X 2FMCA 3KF8A 1EO6A 1UE5A 1HA6A 4EGVA 3VUXA 1J8IA 3A8IE 2JXTA 1PZJD 2VB3X 4GNXB 4W9IA 1TWFH 1H95A 4R3DA 2E5LQ 4UPAA 5KIXA 1WTVA 2J0KA 4HIMA 1RJTA 5ELOA 4DV6L 4JYAL 5M5XH 1L1OA 3DHHC 5BN4A 5C3EB 4F87A 1HR0W 1MPEA 1ZDVA 3N1YC 5C2TB 2NUCA 3KYHC 4FBJB 2IY1B 1LQBA 3RMKC 4B3SL 4NW2A 4ZRJA 2NVXB 3V96A 1PH2A 2YEPF 2X38A 4M0WB 1JCKB 3D6WA 4B9WA 3H6MA 2NMQA 2E8GA 3DWQA 1KAAA 1DOKA 1VQLA 4LF4Q 1WRDB 2AUJD 3QX1A 1E2WA 3I4OA 2BA0A 3J80i 1KD1C 3S14B 2G9DA 1TVXA 1YMHE 2E76C 5I9PA 2PVOD 4IG7B 1TKYA 4XYCA 2HDLA 2OCEA 3GO5A 4R4IA 3WA0A 2WXQA 3PO3H 1NAPA 3HOVB 2D0OA 4K7WA 1D6EC 1GNUA 1JALA 3PLVA 3ZDMC 3IBEA 2WACA 2JPHA 1A3TA 3I91A 2JRIB 1K8AC 2JZ3B 2VH1A 2OXPA 4DUYL 5CV4A 4MM3A 2R2QA 2NVTB 1VQ4A 5JPMC 3ZNID 3D4DA 3VTVA 1PZID 1E7UA 4K8IA 2R92B 1I6HB 3NTIA 4NQLB 1VQ7A 4PQXA 1H9MA 3GTMB 3TSSA 2SNMA 1RAXA 2A4ZA 2K5QA 3KJPA 1ESFA 2BGFA 1IYVA 2PJHA 1AE2A 1T0YA 3CU7A 3L10B 1ACCA 5HKHA 3BVGA 1L6UA 1V81A 5AUKA 2IHEA 1SFOB 1RFKA 1WJ4A 1DZ1A 4A3EB 3DDCB 4TSSA 2K8HA 2YYZA 3RT3B 3WOEA 4DV2Q 5EQ0A 1S1QB 2JEBI 4L8JA 4BBRH 3PF4A 4X65Q 3K7UC 5FLMH 2LFIA 4IWOA 4C3JH 3BG3A 2O2VB 2OJWA 4XXEA 4TKOB 3MC8A 5GADC 3AE6B 1BDOA 1S5FD 1Y1WG 3I72A 4US8A 4BBSH 1RL2A 1N9WA 2NBVB 4A3BB 3HOWG 5M5WB 1JROA 1CZWA 1WGRA 1VZ8A 2B39A 1EOVA 3QIAA 2FCNA 3TP5A 4PMBA 4BFRA 3TS2A 3PV1A 1SF0A 4W9GA 3VH4B 4DHZE 4OO1H 2DUDA 4IUUA 3WANA 2W3SA 3A9KA 3QIJA 4LF4L 2NZ1D 1I4GA 4H7BA 1K73C 3VDZA 5C44H 1QKZA 2LJIA 4R8IA 1WCMG 4C7ZA 4P72A 1KHIA 2BVCA 1L0YB 4LK1C 3C19A 4KV6A 4M00A 5BN3A 2N0SB 4OZAA 3C3LA 5GROA 2RD0A 5E6PA 2B63G 3LGJA 1L0WA 1BBXC 2XRQD 3KLSA 2V3PA 3HVZA 5CHVC 3SHQA 1CQFA 4X66Q 5ELBA 5I2XA 3P42A 1DGSA 1D1IA 1PDQA 2EYJA 5HURA 2UUAQ 2LWPA 3L08A 3K81C 4E6IA 4NJCA 3W9CB 4JI8L 1KTKA 2KJRA 4PZ6A 2WWZA 3FAHA 4BAXA 5IGFA 2JZZA 4DDGD 2EY1A 2UWQA 3BYYB 3FP9A 4AIMA 3KFUA 1VMCA 2DGYA 1Q1BA 1A3VA 2N7DA 2M4NA 1LT4D 2MX2A 2IHFA 4LNQA 2OEDA 2QDFA 2KMCA 1IL2A 2O2LD 1ZUD2 2I5MX 4GDKA 3NWSA 1I4XA 1V8CA 5FJ8G 3LWUA 1E1OA 1IW7D 3ML8A 1HNZQ 1TIID 1VQJA 3BDLA 2UUCQ 1TS2A 2RSUA 3P4RB 4DV2L 2WB1E 3ZIMA 4PYZA 3WIMA 1SLJA 1NE3A 2KC2A 2TMPA 4X65L 3OYYA 1HZ5A 5AJ3Q 4BKGA 4LF9L 1BQQT 4DGZA 4XDXA 1TS5A 3B6YA 3AE4B 3ZW3A 4BS9A 2IDYA 2SNSA 2LHEA 1IP9A 4G50A 1YVCA 1CKNA 3D32A 2EE1A 4RHRA 4JI6Q 3KH0A 3BVZA 3Q8AA 3AE9B 3BINA 1TY2A 2INCC 2C7MB 1EFID 3CC7A 2IW3A 3BY4B 1GB1A 1S4ZA 5KNBA 2PVGC 1ZPSA 5IYDH 3H91A 4A76A 2HTME 3BZKA 3S1NH 2LMCB 2OWOA 3V61A 1YNXA 5LMUQ 2DZIA 2LGDA 4C4VB 2EYPA 2MBBB 2LVPA 4K5XA 4DV1Q 3R8BA 1SIFA 1K83H 2SEBD 5FO9B 2MRPA 1HHVA 2XK5B 3EFCA 3ERQA 4N9F4 5CHFA 3ITPA 5T1IA 2L4NA 1CKMA 1E24A 4O42A 1PFNA 2KEEA 5EPKA 1AARA 5A35A 1NR4A 1TZOA 1T0SC 2C7HA 1IBKQ 3P20A 1VF7A 2WXOA 4DBGA 3CRLC 1AE3A 2PE9A 5C3EH 1SYBA 2EIFA 3FPUB 1WE7A 1LTLA 2LGXA 4N58A 4JOIC 3A5ZB 1EQVA 3OMCA 4JI3Q 1QQRA 1QT9A 2V1YA 3M3YB 1WVLA 4NXML 2LUEA 4N59A 3DQVA 1HZ9A 1I6VC 1MI2A 3RD4A 3CSTA 1AEXA 3OWFA 5JHAA 2KCCA 1OQRA 4ZHPA 2L11A 1IUEA 1Y1WB 1I4HA 3M9BA 2MBEA 1L1OB 1O7ZA 4MT5A 2ZTDA 3KF6A 3H15A 4LF5L 1EYCA 2K6AA 3HOWB 1N34Q 3GDEA 2MH7A 4F8CB 4EZLA 2J0JA 1GUAB 4HCSA 1DM0B 2RVLA 3J81L 2UUCL 4DK0A 2JA7G 2LS01 3RZOH 3S15B 2Q5WD 4AJWA 2WGSA 2YVCA 3MTNB 3RULA 4H0LC 2FCQA 2ZW0A 1J6QA 2AMCB 5E6NA 1NUCA 3LNNA 5C4JH 3HOVH 1H4RA 2M0XA 5G5HA 1WCMB 2KWUB 3W5UB 3Q14C 2MCNB 4A3GG 2NN6I 2DBYA 1SYCA 2KVRA 2B2UA 2V3SA 4JCVE 4IPGA 5EJWA 2B63B 1W3SA 2ID0A 1IBMQ 3PVLA 5CV8A 4TV3A 1FCCC 2DX5B 5HI1A 2MW5A 3M63B 2NVTH 3NVYA 4JI6L 2M0AA 4BKSD 3P7JA 1UE7A 2PMZB 2C9WB 1A70A 1I6HH 2I38A 3NRZA 2JXMB 2RHSB 4CJ2C 3T1YQ 3T3OA 5CV7A 2FNJB 2PPHA 1QF6A 1AYFA 4EQOA 2J53A 4RGOS 4JBWA 2JXXA 1WFYA 4A9AA 1A3UA 2BE5D 1UF0A 1VQOA 3I4NB 2KX0A 5LMUL 1LGRA 1SRUA 4LF7Q 2R93B 5IA7A 5K36H 4OWXB 4DV1L 4M8NA 4MM3B 2RDFA 5JJZA 1F9SA 4V190 1HNWL 2Y3AA 1V9PA 1O7YA 3MAQA 1IBXB 4A3EH 4KKJA 4HK2A 4IUTA 2CW0D 3NEMA 3ZJYC 1HH2P 1GXDC 4JOIA 3M7NA 3LWEA 2RR9A 3PSEB 4FF2A 1EOTA 1IBKL 1UD7A 2B8GA 2Y0SG 2DWQA 4KHPQ 4CBVA 5J2RA 4KVGB 4LF8Q 1IKMA 2IX0A 2CWAA 3T4AC 5CV6A 2OOBB 4A3BH 3DBRI 4BZAA 2DNCA 4PZ8A 2NPTA 1VQ8A 5HY6A 2IPKD 3SEBA 1PUTA 5F2DA 3EC8A 4QUFA 3H3VH 2WX0A 1EU4A 1SR3A 4L6TB 3GTQH 2K1BA 1OO9B 3ND8A 4RG1A 5LMNW 4C2MB 3RZWC 2DJGC 1V80A 1XXGA 2DJFC 1E6EB 2KYWA 1YHQA 4RFBA 1N34L 5T1GA 5EBDA 5I6YA 2D3BA 3Q3FA 4RKBA 1B9NA 1UBQA 2GRIA 4G11A 4FA6A 2IBIB 4DK5A 1QZHA 4HIKA 2JU6X 2M1MA 2QW7A 1C1YB 3CAMA 2CKHB 1SNOA 1D1KA 2PPBC 5C4HA 3PCOB 3A9KB 1PTOF 4WH4A 4LFAL 1CHQD 1FXAA 2WYQA 2WXHA 1O7LA 4B3RQ 2EMTA 3DBLB 3GTGH 4NAMA 2L5TA 2PO4A 5LL6S 3ICEA 1ZGUB 1IBML 2WU5B 3GTJH 2W55A 1Y69U 3E9HA 3S2AA 2HQEA 1XPUA 2K5NA 4MN3A 1TWCB 4HRSA 2UXDQ 2D3GA 1R4MI 3T1YL 4DKAC 1PH1A 3TCAA 5E6OA 2DLBA 4DR3L 2JUOA 1X3GA 4BXXG 1J7CA 4H13C 3HVDA 1QNUA 2K5VA 1Q7YC 4RGNA 4HDOA 2K50A 2GBRA 3J7ZC 2K1FA 5I9OA 1PVOA 3Q8EA 4W9FA 5E4XA 4DK1A 2FUHB 4XWTA 3T53B 3UDGA 4B9KA 3HKZG 1WXMA 3L16A 3CCLA 1MSGA 3QQ8B 1PRTC 3DPDA 4DN4M 4W9CA 2OQ0A 2SDFA 4KJNA 1CA6A 4IUQA 1UELA 1PRTD 4HPPA 2EJFC 3V6CB 3RPFC 1I50B 1T6BX 1NI2A 1H9JA 4GNXC 1XLOA 3QB3A 4GDKB 1HE8A 1STBA 3STBC 4LCDE 4KHPL 4K6DA 2JA7B 2VL6A 3BYTB 4XYOA 1Q81C 1BT0A 4LNNA 3STBD 4LF8L 1NENB 4RCNA 1F9PA 1F2RI 3PLUA 4YSYB 2PNRC 3HOZG 4HWIB 5KRUA 4WJQA 2RDHA 4NP5A 3TP8A 3RR5A 4ICUA 4A3GB 5M9OA 2FUG1 1PMRA 3MXUA 2WXPA 1SYGA 3I73A 1KM7A 3A33B 3EN2A 5E3FA 1E9MA 2A5HA 4JV5Q 1N8RC 1KL9A 3P4QB 1GD7A 5J3BA 5KNDA 3VRAB 4B9XA 1CKNB 1CUKA 4FNFA 1TWGB 5GQOA 4HIOA 3PGZA 1QJOA 1ASZA 1T3QA 4B3TQ 1JB7A 1BKBA 4JK1C 3NUHB 3Q8CA 1JOKA 1PGBA 1YITA 3NHEB 1KRHA 1P3QU 4BBSG 1PDXA 1B4OA 1PH6A 5JJLA 2B3GA 4IC7B 3C1FA 2ICIA 2K3UA 1N32Q 2ACZB 2CH4W 1VQ9A 3EUB2 3S1RH 4GLXA 2FJ2A 2WDVB 2Y5PA 3AE8B 3MJ5A 4K7UA 3H8HA 1D5ZC 2UXDL 3ZNHB 1A62A 5K5PA 5G3LD 4C56C 3TQYA 4HSVA 3EQLC 1N60A 1JWAD 2I1JA 4DAVA 3VTWA 1J5EL 4GOPA 2JQRB 4YWKA 5GXGB 3ZDTA 4ANVA 5L95C 2NTTA 1PH3A 1N6ZA 4BY7G 4WURA 3F2UA 3M4QA 4MJSB 4GNXA 1QB5D 1TWAB 3OPOA 2L15A 2MBQA 1EY4A 3HM6X 2CS4A 4FLHA 5CX3A 2D11A 3ONSA 1TWHH 2L0CA 3CW2C 5A2QE 4GXBA 1NSNS 5L83A 1Y8NB 4IPCA 3RD2A 4BY1B 4IUNA 2L83A 5AEKB 1WCMH 1K28A 1S5CD 4M8AA 4MTKA 4UY8C 2WXKA 4MZ9A 4K8JA 2H5XA 4DV5L 4LNFA 4NKLA 4MH8A 3VVWB 3KUDB 3KF6B 2D5GA 1ICWA 2C7NB 2KQ3A 3S2DB 2FCSA 3EJIA 3EBEA 2B63H 1TWFB 3PUXA 4XGAB 2EKIA 2XGTA 4B0EA 1ML0D 4ZKBB 1TU2B 5E4WC 4AQYL 4A93G 3QHTA 2PI2A 1NVID 3CMMB 3X0WA 1JC7A 4DV7Q 4I65A 3GZNB 3H3VC 2MPMA 1HTOA 1QVGA 4MACA 1HZAA 2GBNA 2QA4A 1QVFA 4JV5L 1G6JA 1KC8C 3PS6A 2PEAA 2BPSA 2KHWB 3MTSA 4MSQB 4KSKC 1SNPA 3GTKH 3V62A 2F3WA 1KLVA 3I90A 4B3TL 2GLSA 1NYRA 2QIEB 4GKJQ 2L8JA 5DAUA 5FJ8H 3NWTA 2N7EA 2B8FA 2PMZE 1FPYA 2A74C 3NOBA 4MNOA 3H7PA 3HKZB 3KK7A 2F3VA 4FXDA 3FPPA 1XPRA 3ZRCA 2LRUA 1N32L 1RHPA 3N52A 4PZ7A 4R4QA 1K8GA 4HPMB 3A55A 1NBFC 4WFN3 3AEGB 2ES2A 2CFMA 1Q12A 4A3LG 4MELA 5IGBA 3W1GA 4IWQA 3AE2B 2ZPYA 1V5OA 4PMWA 2KO3A 3ABVB 2N78A 3DBHI 4BOSC 3DMUA 3DWPA 3HOZB 2MQJA 5C4XG 2PCFB 3MJWA 1HXYD 2K22A 1OTRB 3OHXC 4DR6Q 2BDNA 2F0DA 3W1SA 3BZDB 3J81E 3VR8B 4LUVA 2NPTB 2YTXA 2G45B 2KD0A 3OLMD 1WF9A 4IFDJ 3Q8DA 2JSOA 2IX1A 4NXNQ 2R7ZG 1GUTA 2DENB 4LJPB 4IALA 3P2BA 1A5RA 2C9OA 3A8KE 4DR7Q 4ZDVA 1WR6E 1VQEA 1SNCA 5KEEA 1LTSD 1X3EA 1ISNA 2ZJDA 4HR7B 3EHVA 2PYKA 4JI7L 2EKEC 1SE8A 4JWSC 4A3FG 4GS3A 4BBRB 4HJKA 1ZKOA 5IP7G 3L9AX 1VR9A 2D3CA 4KZCA 3NS1A 2N8NA 3N1XC 4QY7A 4C3JB 1DONA 3VYTA 1FIQA 1FJGQ 2IGGA 2KJHB 3FKIG 1WGDA 3V60A 1G51A 5IOIA 1TWCH 4AJYB 4OXPA 2JZPA 1U4MA 2K33A 3P4SB 4BBSB 2MWSB 3JVZX 4DV7L 1YBYA 3SE0A 1PFSA 1EIYB 2V3NA 4A75A 3CIRB 1V8QA 2IT1A 1B50A 3VHTC 3U9SA 4P7IA 4C80A 1H9SB 3PRZA 1EF1A 2KKCA 2JEAI 3NZ3A 4ZRKA 1YD8U 1E3PA 4XTCS 2WDTB 4DXAB 4DR4Q 3MHZA 2HIXA 5JEAJ 4GKJL 4BOZB 3HK0A 1L2FA 1I50H 2GA4B 3TN2A 2MNAA 1UZXB 4YCVA 3TZDA 2MJEA 4I6NB 2PMVA 1VLBA 1ZXTA 4MTNA 4ZUIA 4DAPA 2JA7H 3NE5B 4ZQ3A 4K7SA 4OWTB 1VQ5A 1L2NA 4A90A 3AULA 3M4YA 1J19A 3SK4A 1KJTA 2KWVB 2MO0A 2QC8A 3GE8C 2AKWB 3SR1A 3RZDH 1GC7A 3DOWA 1IHZA 2QJLA 1Q10A 4A3GH 4QQBX 3WDNA 2F0PA 1M8AA 4MEMA 4B3SQ 3SDLC 3T1HQ 1E2VA 1SYEA 2MQHA 3AU5A 3S16H 3U4ZA 4A93B 4JWUC 2LEKA 4NNJB 1FNUA 4AOFA 1F9RA 1O78A 3NZSA 4JC0A 2MLBA 4DR6L 1EL0A 4JVZA 3KQ4A 4G4KA 2AQ2B 1X65A 1TWGH 3DHIC 1UWVA 4X64Q 5IYBG 1F52A 2F0IA 4NXNL 1WJUA 3ZVVA 2Z59B 4I6PA 2Z0EB 2KCNA 1U5KA 2N4FA 4XIGS 3IT4B 5D14A 4MGIE 3ND9A 2G4DB 3NJTA 1MG4A 1NBWA 2EQSA 1P7EA 3AI5A 3W5VB 4OGQC 1FJGL 2N1WA 1C7YA 1Z5SB 4M1UB 4REZA 3Q3JA 4KV2A 2PQAA 1BBUA 3J7AF 4LLGM 1SGHA 4J3OD 4CKEA 2K75A 4UAIA 2D3AA 2AWTA 2DAFA 3Q69A 3CC4A 2N88A 1YOVB 2VUMH 2FHTA 3NG0A 1RFAA 4NJ7A 3LB8C 1VQIA 1YN4A 3HHMA 1MIUA 1AP0A 4GMVA 4IZ8A 1FMAD 1TWAH 3MWYW 5IGGA 1I94Q 3JAML 4WORA 2Q2UA 2L1AA 3RNFC 1DGJA 1YZ6A 4DR4L 1V1OA 1Z9FA 1EY6A 5EKIA 1PH5A 5KNCA 1XMOQ 3L0WB 4R9WA 1PRTB 1E8ZA 5DPSA 3VYSA 4GOPB 4GGQA 4NQKE 2HD3A 2F0JA 1EF5A 3QJZA 4MH0E 3VAWA 3SHLA 4P71A 3S2DH 2K7VA 4J8QA 3HS0C 2KDBA 3AEFB 4LNKA 4D2KA 2RCNA 1MGSA 2NR2A 2QF7A 4O2DA 1XWEA 1STEA 3NELA 1F1HA 2O6VA 1C0AA 1Y56A 1WTHA 1NYQA 2F52A 2YTVA 2F4VQ 4A3FB 3APCA 1VQBA 1Y14B 5BN5A 3T1HL 2EELA 1WJNA 1SNDA 3FKIB 5I2YA 3Q24A 3AEBB 1ILQA 1YJ9A 4GDLA 3ZXVA 1JT8A 1ZW7A 1H8CA 5T8IA 1JE4A 2LFNA 1E1TA 1U0LA 1SIJA 4X64L 4BXXH 1UUPA 2J52A 1E10A 5IGDA 3Q2AC 3DHGC 3Q3NC 3RZOB 1SJHD 3Q22A 1FM0D 1HZ6A 4PS3A 1X3PA 4IPHA 2J4XA 2I46A 2IWHA 3GQBA 1T0RC 5C4JB 3L0OA 1I4QA 1QILA 4B08A 1SROA 2K5DA 4IFDI 3OAWA 4NPNA 4AUQC 5JEAG 3OWEB 2Q8RE 5JJIA 1KXLA 3VR6A 1JB3A 1J7BA 4ILWA 4JLCA 3JW0X 4QAYA 3OMGA 4JI8Q 2Z4HA 2F0WA 4A6QA 3ENEA 2RDGA 1C79A 1WXSA 5CTRC 3LYYA 3RMHA 2R61A 3T16A 1PHJA 3VR5A 3H7PB 2ZXPA 1I3QH 4CHTB 1IBXA 1YHAA 1CA5A 1F2MA 1EWCA 3HOZH 2BCOA 1ZEQX 1I94L 1KRSA 2X6LA 1N61A 4A3DG 3IFWB 1HUNA 1XMOL 3GP7A 1TKGA 2ZVOA 4WAFA 3PHWB 5AFWA 3R2TA 4KTAA 2MJDA 4KKSA 2BTEA 1R4NI 3CKIB 1FVIA 1W6KA 1D7QA 2M56B 2KACA 1H9RA 3NSWA 4LF9Q 2L7RA 4L5RC 3PRMB 4K3BA 5D6JB 4URKA 4BWGB 3H94A 4MHEA 3E5SA 1Y8RC 2HD5B 1AN8A 2KAJA 1BXTA 1NI3A 1LV9A 3LXFA 1YNNC 3CMEA 2F4VL 1YJJA 1HR0L 3IXSA 2H88B 3ZO5B 1G6PA 2WFWA 1G91A 1X32A 2FE8A 2LY7A 3UDFA 1TYGB 4NB3A 5C5MA 2WXIA 1WE6A 3I4MG 1RM6C 3E0JA 1LTTD 4L5TA 3GTQB 4PV1C 4QIWB 3MP9A 2WDQB 3KJOA 4KIKA 5LHY1 4EE2A 2M17A 1K3RA 3TREA 1XCQL 2KTFA 1Q8IA 3W3AA 4YCUA 3HFZB 1IYJB 4IUVA 2HUGA 4BY7H 2UYZB 2CQAA 1LACA 3TIXA 1PGXA 1VQHA 2KENA 4FYDA 5GAEC 2IX3A 2B2VA 1FGBD 4ME3A 3A4RA 1Q0WB 4P75A 3J80c 3N32A 2BDOA 2AQ1B 4XT3B 1ILPA 5C0XJ 4IDIA 4CYEA 1S5DD 3GTGB 1P9DU 2Q8TA 2JYEA 3NTKA 1HTLD 1TZ1A 3GTJB 1YHBA 1LTID 1YJ1A 1BO0A 3IT6B 4Y7NB 4AYBG 2K05A 1STHA 4WJWA 1B8AA 4Q0FA 4YT0B 5J22A 2LZ6A 5J17A 5G3LF 3PMFA 3GTOB 1X9NA 4GN4B 4NXMQ 2QMTA 3MXGA 3VDYA 2HHHQ 2LXCA 4A93H 3MXNA 3B08A 2ASQA 2KFKA 2C35B 4POFA 1J9OA 4B95A 1VQMA 4APVA 2WU2B 1MD2D 4LF5Q 2KVMA 1QOHA 1VQFA 3A5UA 1WJ6A 3P75A 1N5XA 4DXFA 5A2QL 4N6EB 3PUYA 2PZUA 2EYMA 1C8CA 4IN3A 5LXHA 3N3KB 5MPOA 2CHWA 3RNAC 2RMMA 4K0KQ 4WJ4A 2WXJA 2H4OA 1XTDA 1PH8A 1HJPA 2M00A 1D2BA 2K25A 2W9NA 4MGYE 5D94A 3A54A 4EKUA 2K8CA 1XTCD 3QJYA 4C00A 1IBLQ 2UXBQ 3MA2B 4U68A 1LUZA 4JI0L 3GD7A 4ZK9B 4JI4Q 4WAAA 4ZHOA 1P0RA 2BYTA 1K8RB 3RN2A 1AW7A 3KVFB 1ENCA 3S1QH 2HDEA 3MVVA 1YN3A 4HAEA 4JPBW 2B2UC 2KUMA 3VR2A 3DVNU 2ALYB 3RLFA 1F2RC 4KD4A 3PPAA 4IJLA 4A3LH 4FJZA 3LJ3A 2PQAB 2BKFA 1HNXQ 3ZNGC 1X54A 3F8TA 1OFFA 3K9PB 5DPRA 1FNWA 3PRPB 3CWIA 5H92C 4ZCKA 3NHHA 1B9MA 4O0AA 3NS8A 1HNWQ 2RKSA 3M4PA 5C4XH 1S5ED 2LXAA 1VQAA 1ENAA 1SYFA 2RCFA 4RGMA 4FJYA 1E7PB 4A3DB 1E8XA 2EOTA 3GTLH 1RDPD 5FLXc 2JT4B 1LT5D 4LF6Q 2R7ZH 4YSXB 4A3JG 1SNMA 5C5LA 3HM3A 1UE6A 1X1MA 2NN6G 4HMIA 4PG3A 2BF8B 4JE3B 2E2IB 3A9JA 4BVUC 1STYA 1VQNA 4MJSA 3S1RB 3P63A 4HEA1 5M3FG 4A3FH 5IP7H 1IYFA 3WALA 2EY5A 2BT6A 4CO7A 2KHJA 3FKIH 2HHHL 3A7LA 1YX5B 4S17A 1E5WA 3AEAB 3BIID 4GLAC 5D3IB 1II3A 3UDIA 3HG9A 1KF6B 1L5PA 2GMIC 1IL8A 4HKZE 2CR5A 2O6VB 1IGCA 4WQMA 2KWDA 2OQKA 1PLFA 3BVMA 4LFCQ 4R4OA 1TWHB 2K04A 1V86A 2ZPNA 2BS2B 1B44D 4DF7A 4BA2I 4JI5L 4W9HA 1A0IA 1JWBD 4K0KL 2H1EA 3AFQA 4GDLB 4I7ZC 1E22A 3CCRA 4A55A 2L0TA 4QL5A 1XT9B 1MKHA 1WYDA 3D0FA 1SEBD 2CHXA 5E7NA 1DOIA 3SD5A 3FHWA 4LFAQ 3CC2A 1Z2MA 1KFYB 2L00B 4QB4A 1IBLL 2UXBL 2WIIB 4L2YA 2WS3B 1DOMA 3R3MA 1BCPC 4JI4L 5KYLA 4II2B 2PI2E 4JL9A 2N55A 3HRDD 2NYZD 3VTUA 1FR3A 3H09A 2ZTCA 2JP1A 1ZDXA 1OXXK 4HSPA 2I0QA 2LXJA 2V4LA 2OF1A 5FK9C 4CDDC 4DR3Q 2D9UA 3PQIA 4FXKC 4P2CB 3JAME 1M4VA 2VW9A 1HNXL 3EFUA 2WAQG 1G2TA 4KDIC 4KDLB 3GTKB 4P16A 4KLKA 3B9JA 3QR8A 5ELEA 2IL8A 4YL8A 2K32A 1HQRD 1QNKA 1EWYC 4KY7A 4XDDA 1JOQA 1K51A 2D0PA 3CHBD 1CM9A 3NVZA 5G2NA 3ETRA 2FINB 4KHVA 3TBLD 2GBMA 1JJGA 5IYBH 4LF6L 3GOEA 2OTJA 2K6QA 3P1HA 2WINB 3DWAA 4HTHA 1WX7A 1A63A 3PZDA 2BOSA 1SN8A 3TJPA 2ENBA 2I07B 4IOAA 2VUMG 1Q8KA 4RMFA 1VZ7A 4GIVA 4HCPB 4NY0A 3RNBC 2LASA 2BWES 2RDBC 5CORA 3RNEC 3SU8X 4RMAA 4ZOHC 1HTQA 5C0XI 4CKCA 3HOXG 3I4LA 3I56A 2K5PA 2BS3B 2KTRB 1JMCA 5I4DA 1NJIC 2KCMA 2RSNA 3KBXA 5COYA 2N1VA 5IO9A 1STAA 2R7DA 3I57A 1TR5A 4K6LA 4GN1A 2DZJA 3AEVA 4A3KG 1V2YA 1EY7A 4PK1A 2IGDA 2EJGC 4LFCL 1E8WA 1TGZB 1L6VA 2F0FA 3K6OA 1ZP0B 3UQBA 3K5MA 3VFKA 1CTMA 4K5VA 4DNTB 4HJ8A 1WTWA 1GO3E 1WIAA 1SSNA 3K80C 4LFBQ 4TKNA 2DN8A 4KIKB 1K8OA 1XO3A 2GVAA 1LTAD 2A69C 3PUZA 3MEFA 4CDCC 1D5XC 3X23A 4ANXA 4TVAB 1H9SA 2EY6A 3ZYYX 2ZCBA 4RCOA 5AZHA 2A69D 5IE8A 2CH4A 1VQKA 4Y7NH 3G4SA 1C78A 4EZJA 1JMLA 2KCTA 3Q23A 4IFDH 2ZJRA 2MHJA 2AQ3B 3FDTA 2SAKA 2A5UA 4C1NK 3GTOH 1WI0A 4A8XC 1JWSD 4X6AH 2KWCA 3QG1A 2Z9HA 1XX8A 4IJHA 2L52A 2Z0SA 3A56A 1VRAB 3J81j 3L17A 1J5EQ 3VH3B 1ZYRC 3CCQA 1KDAA 5M3FB 3SFDB 1WXAA 1E8YA 1YX6B 1HUMA 1Y8PB 1ZYRD 3QK0A 2CCZA 1TTNA 2ZNVB 4ZKCB 1VQCA 2K9XA 4US9A 2GOWA 1NMGA 1UAPA 1TT2A 3C8YA 3RZFA 4GOPC 3FMCA 5EDSA 3CPWA 1JRUA 5CHWA 3R7QA 1JWUD 3MXNB 3KUPA 2L55A 2KFKB 2MJ8A 1FGUA 3VUYA 5M5YB 4DV5Q 2ZCCA 4FF1A 2LGYA 2N49A 1MHXA 2AYOB 4KHZA 3QCAA 3IAYA 4RF1A 3M3JA 3I9V1 1S72A 3J9CA 4AQYQ 1C76A 5IT9c 3RZDB 1ENFA 3N30A 5IP4D 5JEAH 2FXQA 4DAYA 3WWVA 3MEHA 5JAVA 2R3ZA 4DAMA 1U9RA 1WYWB 4EFOA 3U9OA 4F1SA 1N33Q 3UDXA 1QCBD 4NMZA 1WYGA 3B2GA 1HQMC 4U673 2M19A 2JYOA 3S16B 3ZRFA 2O5JC 2VXWA 2F1MA 1PFBA 2JA5G 3DBRB 4KZ0A 2HDMA 4B6WA 2BWFA 1G291 1L0VB 4POGA 5HGTA 4FO2A 4LUZA 4WJOA 1JQ4A 1QWYA 3PIO3 1BBWA 3RNGC 1HZBA 4A3DH 1LTRD 2IO0B 4H02A 4LFBL 1STGA 4N8X1 3TBIB 2LRWA 5JJKA 4XYQA 3SK8A 2I5HA 1SBBB 4FF4A 1WGGA 3F1ZA 2E2IH 3S2HB 4DHJB 1YJNA 1QE6A 3BDOA 4II3B 2NS5A 3A1QA 4OW0A 4M8MA 2INDC 4OVVA 2Y0SB 1XEEA 3F2BA 4FULA 1NMFA 4C1NI 1C48A 1V9JA 4DK3C 5DLQE 1UH6A 3ALBA 3B2FA 2XSCA 3E9SA 3EGRA 2D10A 2VUMB 4HROA 4HDQA 2DZMA 4IWPA 1D3ZA 1JQYD 1WRIA 2NCNA 3ECIA 1EIFA 3I5JC 3A9JB 3IL8A 4KGTA 4MGZE 1EYGA 3TEYA 3MXPA 4F8MA 4DXGA 1OTCA 1GKHA 4FF3A 3I4MH 3DM1A 4P74A 4X62Q 1R4MB 1N62A 5IP9G 1T9HA 1UGJA 5BYQA 1B53A 1D8LA 1HFGA 2NB0A 1K9MC 1QOGA 2CU3A 2KDMA 3NBHA 5ELFA 4O1NA 4HJ9A 2QKIC 2EYFA 5JH5C 4L5QA 3W1SC 4JI7Q 1Z7TA 3VA5A 3ULJA 1WD0A 5D3DA 1EWIA 4I7AA 4DNRB 2XTIA 3HOYG 1CT1D 4N8FA 5DCNA 4PS7A 3UIOB 5C3JB 4JBKA 4GLVB 1WGYA 1WMHA 4IUPA 4OELB 1K52A 2BH8A 1N33L 4YIJA 5ELCA 3CQZH 4HXDA 4ARCA 1PTOH 2A73B 2PW7A 3TP6A 4FADA 2DAJA 2Z4IA 4JIOU 3AEDB 5IOCA 2RSOA 1JJCB 3W1BA 4OWWB 2NZOA 1GUOA 2OTLA 5IIFA 2LI5A 4ACFA 3Q6SA 3K9OB 4P73A 1SB3C 4IM3A 3RI7C 4WJPA 1FXIA 5C4ZA 3CP0A 3TDQA 4K5WA 1WSPA 1KNAA 3OOCA 1N36Q 4YTNB 1VMPA 4KD3A 3OW2A 1W6JA 3AYHB 4J1MA 4WRDA 3J7A5 2F4IA 2LVQA 2RBMA 3D4WA 1WX8A 2XVSA 1ZXIA 3DWMA 4XE0A 1C4CA 4M02A 1A2UA 4KN7C 2R6GA 3I7FA 1NR2A 1GG3A 4KSLC 5EE3A 2KZRA 2F0UA 2LGIA 2NWGA 4KMUC 2O5IC 4W9EA 2CU1A 2YU9H 3AEEB 2L3ZA 3A4SC 1U4AA 2IZVB 4P6VF 1I3QB 2F03A 3PIP3 3GB1A 2EXZA 2B29A 4DR5Q 2FIDA 4B3ML 3NPPA 1FNVA 4F7ZA 4A3IG 2RA4A 4DA2A 2K5WA 4X62L 2KBNA 3K59A 2WKDA 3FKYA 2XRSD 2VZKB 1Q5WB 1TXYA 4W9KA 3BZCA 5J1ZA 1I7HA 3PREA 2WXRA 3H0GG 2K28A 3L54A 3ML9A 2JA5B 3OIPA 3H9DA 4ZYNA 3E56A 4K81A 1TIFA 1WFQA 1GJXA 1M90C 1SMYC 2EYOA 2ZVNA 3OJ4B 1PH4A 5FR3A 2BYVE 4DUZQ 1PZKD 1SMYD 4G0NB 4WWNA 1CJEA 1BCPB 3T51B 4A3JH 3F2DA 4R1JA 4A3MG 2NN6H 1KQSA 3A8JE 4YWMA 5IT9L 4ZRQA 4GU2A 1VQGA 2ZXOA 3HEJA 5M3FH 3KDFA 1VD2A 2XNAC 4FXCA 4DDID 1LYLA 4G7HC 2HJ1A 1D5MC 2XN9C 5ISRA 1S3OA 2NTSA 4YSZB 4G7ZC 2KMMA 4YWLA 1NDDA 4KGRA 1X56A 1HFNA 1OQYA 1AZPA 2DY8A 3ZTCA 2N9LA 1N36L 3NTHA 4BY7B 3ZXRA 2XIWA 2E74C 4AH6A 4DR2L 5EAYA 3V6EB 5M5YH 2JA8G 1A6XA 5EBCA 4EZKA 1ZE3D 4K3CA 1D4BA 1B3QA 1ICFB 1T5EA 1I4RA 3M7GA 4RHSA 4ALPA 2FBWB 3VYUA 2K03A 1V1QA 2MBOA 3DXJC 1LM0A 3GTPH 1QG7A 2K39A 1FEHA 1V97A 3DVGY 2L32A 3MHBA 2CVRA 1FRDA 3VXWA 1KRTA 2F0GA 3HOYB 2KLCA 1KOTA 3I3TB 2JY6A 1SAPA 1HRJA 4KY6A 4EX5A 1XNRQ 2KOXA 4DR5L 3DVNV 5GMVA 3VR4A 1F77A 2Z8LA 3M95A 3FVQA 5C1ZA 2I5LX 4MIUA 1IPGA 3I2ZA 5HHDG 3VYRA 4HJ5A 1H9KA 1TQOA 3AMZA 3BK1A 2JA9A 1E7VA 3FEWX 2O6VD 3HP3A 3UE0A 4DAYB 2DZKA 4W9JA 5AZFA 4C7YA 2R92G 1QLBB 2UU9Q 3RUZA 3GE3C 3K5LA 5H8YE 3RUIB 2AWNA 2EYHA 2IJ0A 1K50A 3EVQA 2KN4A 3DBHB 5G5GA 2XEWA 2ZEQA 2MO1A 2KEDA 3K5NA 3CD6A 4QF4A 5CBAE 1YN5A 2K0PA 2KANA 2NBWB 2YEPB 1SE4A 1YNTE 4CDFC 1X55A 3S2HH 3G6JB 5DPTA 4DUZL 3EROA 3KWVA 1C9OA 5CR3A 4HIDA 1EQQA 2UXCQ 2JYTA 2KQSA 4RAUC 4K14A 2QCZA 3QARA 4ASWC 2CKZB 1E2ZA 1OEYJ 4UDUC 5GAHC 4XX5A 3AMUA 3TRZA 2HIVA 3D6CA 3S1QB 1JORA 2B3AA 1PTOC 4JI2Q 2ZW1A 2I1KA 1CI3M 1JRPA 4YXDB 2J7QB 3P1MA 1RF2D 3HOXH 1WTPA 3UF8A 3T13A 2F0TA 4W9DA 4LK0M 1EIHA 1E0BA 3A1QB 1BR9A 2N7JA 3ZKJC 3N1ZC 3W5OA 2IO3B 2PQEA 5G55A 1UWXA 3Q8BA 4KJOA 3VA7A 3J81i 5C4XB 3RN5A 2Y0SE 4A3KH 4A3IB 5IN7A 3J7YW 1EY0A 1MJCA 3TEHB 3DEPA 1BNZA 1RKNA 5EE0A 4RM8A 4IFDG 3NXWA 3GTLB 2AX5A 1SYDA 2P5ZX 2R7ZB 4S3SA 1ESRA 2KX3A 3QAQA 3H0GB 2J0MA 1MG8A 4FJVB 4KY5A 3AQQA 2JVCA 2LKVA 4FVMA 4YCWA 3N6RA 4V0BA 3NBHB 3CCUA 1HR0Q 5JVH3 2EZVA 4CQNA 2ZTEA 3C46A 3IRBA 1WM2A 3IHPC 4HJAA 1WZ0A 1IYUA 1BUVT 1XNRL 5M3MG 1UGMA 1MHHE 1KIXA 1RRBA 2IGHA 3L4PA 3MHSD 2KVZA 1EZ8A 3Q6BA 2JQOA 4XZ4A 1T0QC 3AH7A 1CZGA 1WMHB 2RPQA 4P1BC 1DJRD 4A3MB 1S5BD 1EYAA 1YQ3B 5D7GA 3QC8B 3FRPB 2MFIA 2UU9L 4R4CA 3H3VI 1MJEA 4N9TA 1QZEA 2D07B 2E2HB 2W54A 2FFKB 1KABA 2MUYA 3U52E 1P1AA 2F0MA 1ZKHA 2X69A 2FAZA 3TEWA 3T9LA 4AP4C 2BYEA 5FOBB 1V6EA 3W1YA 2JSVX 1ET9A 3HKSA 4DV4Q 3CSFA 3PV0A 3U2SC 2LHDA 4KN4C 2UXCL 3A7AB 3AE3B 1QUQB 1V43A 4RGTA 2JA8B 4FHJA 4RH6A 2B2VC 3S17H 1BF4A 3PO2G 5BO4B 3K0XA 3AE5B 3U4EG 3JC66 4JI2L 2EDGA 3Q3MC 4A3CG 4PNYA 1OXUA 3ZQ4A 2PTLA 1GVPA 3HKZE 3DM3A 1O7IA 1OXVA 2ZNVC 1RIPA 2UU7A 3FILA 2GB1A 1WH3A 1K8MA 2ICEC 3X3MA 4LJZC 4XQNA 1C9FA 2NBUA 4JBJA 3CCSA 2D5DA 4TQUS 4JI1Q 1R7SA 3SXHA 2JA5H 3K7AH 1PRTF 2J0TD 3R7RA 2KTRA 2WXGA 2JRHA 5IYCG 2JN4A 2L9HA 2TSSA 3MFYA 4A4IA 3VR9B 4IQZA 3J81c 1XNQQ 1VDVA 4DV0Q 2INPE 4JI0Q 2IY0B 2BS4B 2JWUA 3RLNA 2E75C 3LDZE 3I63C 3EIVA 1YJIA 1C77A 2ZXRA 1F2ZA 4ULLA 2PKOA 1YNND 3ZUNA 1SMXA 1B1ZA 3NBIA 4ME5A 4IW0A 3RCZA 2KJXA 1SJED 4IM2A 4LUOA 5ELNA 1Y8OB 4C3HG 3NP8A 2HE7A 4LJOB 3E6ZX 4ODGA 3IAM1 3U8ZA 3NVWA 2MSED 2E5LL 5EE1A 3H6NA 5D2MB 1LT6D 1GUGA 2D2CC 2Y5CA 3ZTDA 3N9YC 4JBMA 2KLGA 2REXA 3OG5A 4DV3Q 1EY9A 3APFA 1TBEA 2EXDA 3KDFB 1GOZA 3QWZB 1KDCA 5IP9H 4QGUA 2RPVA 4RM9A 4DV4L 2IO1B 2K14A 2WXMA 4DHJD 3SK6A 3D31A 2GBJA 1I4PA 1IZ6A 5AUIA 2NZHA 1HEZE 2Z1CA 3PUWA 1F2LA 5FKAC 3HOYH 1C4PA 4BKTA 4UP7A 2MP2B 1B9RA 5KGUA 5C23A 3KLSX 1WXQA 5D65A 3E3XA 4GKKQ 1A8VA 1JJ2A 1B3AA 1RD9D 4LAAA 5C3XA 4EUTA 1NEKB 1SE9A 4MGKE 4QJFA 3IVFA 1JICA 3JSVB 5IKCM 1SSOA 1NY4A 5M3MB 1KNEA 4QUCA 3EFXD 4ZYSA 4UHVA 3JYUA 4JI1L 3I70A 2V1CC 4USAA 2A6HC 2EPBA 4JI5Q 2KOLA 3M4OB 1KDBA 3GV6A 4HCEA 3I4NG 4Y52H 3DWGC 2A6HD 2R93G 3S1MH 4OONA 1S3SG 3RYTA 1LT3D 2NVYH 2JA6G 1XNQL 3H7SA 4DV0L 3IFTA 1IW7C 3PHXB 2AHOB 4X3UA 5DM73 4E74A 3DHQA 3R3OA 1R4NB 4E71A 1STNA 3RN9C 4XWWA 1KLUD 4OZCA 4WWOA 1VDZA 5JVG3 3DUZA 3NENA 5IT9E 4YTPB 5BMIA 4BBNC 5CV5A 1UEAB 3N20C 5CV9A 2OHFA 4CGYB 2QSDA 4LDTB 1AH9A 2DNFA 3U30A 2VB2X 4UP9A 1FFUA 3PO2B 2IYDB 1CFMA 2A19A 3V05A 2INNE 4JQWC 1XPOA 2ZM6Q 4L5SA 3L2PA 4JG2A 1XMQQ 4DV3L 2J42A 4OHJA 3G6EA 3U7ZA 4IO9A 4A3IH 2DHZA 4ZRIA 3BK2A 1PYWD 1VCIA 3KUCB 2ONQA 1JOOA 3C1EA 1U4LA 5LXIB 3DLLA 5TSSA 4ITKA 2KC1A 1LLRD 3H0GH 1GUWA 1DXMA 4NDXA 3VRBB 1CQVA 2MHVA 3HUIA 3C2PA 4EEWA 5DEHA 1WTXA 1LTBD 2AWOA 2K5HA 4X3KA 3HOUG 1ONLA 2V4IB 1P16A 2KHSA 4CJ1B 2PW9A 4LTUA 1WJJA 3VUWA 2ZJPA 4PS8A 1MSHA 1FL0A 4I6LB 2K4KA 5LLIA 1L0XB 4GKKL 2BA1A 1Q86C 3Q8FA 2M2LA 2MA9B 4QMGA 2L05A 4OVZA 5EE9A 1PFMA 4NAWA 5E6JA 4UP8A 1V1PA 3K8AA 4X66L 2UUBQ 2Z0DB 2QGQA 3SDZA 4A3MH 4KGSA 3Q0AA 2R2OA 1JR0D 4ZRPA 2UUAL 4J15A 4WJ3M 4ZRZA 1Z47A 5ELDA 1WGKA 3I4MB 2F0QA 1PYBA 2E2HH 3KBGA 2VZKD 2WXNA 1YIWA 1EU3A 1RODA 2F3IA 4LW1A 1WTOA 3RNCC 1WZ3A 4C3HB 5C3WA 2MEKA 1CSPA 3KF8B 1AZQA 4N9PA 2NVXH 3HGBA 4L1BA 2NBFA 4KI0A 4GN5A 1Y1VG 1EM7A 4G3XB 1WXVA 1K0RA 3DVGX 4HEDA 1XCTL 2JA8H 4XDCA 5IWAQ 4HPLB 3QA8A 4KKTA 1M1KC 1BCPD 1HNZL 3S14H 4RNAA 3OJ3A 2PLPA 2V9HA 5KHOA 5C0XG 3DBLI 1XJVA 1DD2A 1CKOA 2AL3A 3CQZB 2CJNA 3LX0A 2A8VA 2ATWA 1PTOB 1PGAA 1RTNA 2F0OA 4AYBB 5AJ3L 2E2JB 2WHIA 3L13A 1WR1A 2WKCA 1BVSA 2ZM6L 5IGCA 3AU7A 5EKKA 1XMQL 5IAAC 4AS1A 1E7ZA 4RWSC 1SE3A 5FO7B 1GAQB 2F0KA 3CCJA 1K53A 2WLBA 3CF6E 3SFEB 4HVBA 2BB5A 5KHQA 2ZJQA 4HN7A 3L7ZC 3PIOA 1A2TA 1LO5D 2R92H 3WCQA 1VQPA 3FILB 3GTMH 1QVCA 2BE5C 3L3OC 4EOYA 4C3IG 2H89B 2E2DC 2PIAA 2QEJC 1M94A 3BWUD 3WAPA 3NZUA 1LFDA 2QILA 1NCVA 2HQLA 3J80L 2QEXA 2C60A 3KLWA 2LUMA 5BYSA 1Q46A 1YQ4B 3KWLA 3PTFC 2EVBA 2OT2A 4HJGE 2G9HD 1SFOH 5EPLA 2CW0C 1EIGA 2YU9B 2D62A 1PQSA 2JA6B 1KH0A 3QO2A 4QCLA 4WJNA 2D2QA 4LWCA 2UUBL 2CJOA 3WAOA 2WQYB 5L37A 1WI5A 5LMNQ 1PXUA 1U4RA 2JWZA 3TL5A 3TS0A 1SDFA 3PZ7A 3R2IA 2PW5A 1XD3B 4G7OC 1EYDA 2WDRB 4KK7A 4DU9A 4XQJA 1QOBA 1QZGA 2K52A 4IOCA 1GC6A 2N9XA 1EEFD 4WWPA 1C4AA 5M5WH 4JI3L 5NUCA 1WM3A 1Q1EA 1EUJA 3RLOA 5FR6A 1YIJA 1FFVA 4FDBA 2QCPX 3WOFA 3BU2A 1G8ZD 1NNXA 2KNBA 2A6EC 3UE1A 4QIWE 4CJ0B 5IWAL 2A6ED 4BY1G 3K5OA 2KDIA 4H44C 4ICVA 3EECA 2B2WC 2PZWA 2MBHA 2FIFA 4K1RB 5EGTA 4JX1C 4A3JB 2BQQA 4NJ6A 4WQOB 4X57B 1ET6A 4HKQA 3ULPA 1CK1A 4HJ7A 1IGDA 3E9IA 3HOUB 3C0RB 4BKSA 3T3NA 2FCMA 1EFWA 5IGEA 4PYUA 1MBYA 1OXSC 1UBIA 1G2SA 3A0JA 4HCNB 3PT2B 1X6OA 5M3MH 3OW7A 2NVQB 2Q2IA 2MGSA 2VQFQ 2F0LA 3ONAB 1B2TA 2LGSA 2WXLA 3KOJA 3PGEA 1MHWC 2WNMA 3UIPB 3M4OH 4AQ7A 3G48A 4ARIA 1WOCA 2A68C 3SK5A 2DYBA 1RLFA 1GJZA 1F2YA 2RF4A 4GZYC 3TP7A 3O65B 2XBBC 2Q8IB 2A68D 1DOLA 4DFAA 1BMLC 2JK8A 5FLXL 5J39A 2B2TC 4LF7L 4FN2A 4AWJA 3GTPB 2DYOA 1I5FA 2QDLA 4JPSA 5AZGA 1TY0A 2M9VA 1WTRA 1R9TB 3PO3G 4TUUA 5DNFA 3K0YA 1Y1VB 2OJRA 2XWBB 1PH7A 1EY5A 3WAMA 3S24A 2BYFA 5FO8B 1LM8B 4KKIA 3I55A 2WXFA 3ZJTA 5LMNL 1HPCA 3PIPA 3PO2H 4J6IA 3UI3A 1JW9D 3GZNI 4EQ5A 2KQ4X 2BW2A 5BMHA 4A3CH 2Z6BA 1S40A 1PFDA 2KECA 1EWHA 3JAMi 1G6ZA 2G3QB 5CGKA 1XYIA 1PV4A 4B0MA 2CQOA 1X3FA 1WTQA 3W2DA 2LVOA 3UGBB 4Z9CB 2G4SA 2WAQB 2B2WA 2X6GA 1TJEA 3AECB 4GLSC 1F0ZA 1XLNA 2N3SA 3TUOA 3G7LA 4OIKA 2Y5BB 2WP8J 2N9KA 5EPJA 1JE5A 4BBNF 3SR6A 2BKRB 1FO4A 3OIQA 5IYCH 4ZAIA 1BOSA 2R7FA 4KKUA 2W82A 3UINB 1E0ZA 4K2LA 1SXTA 3MFGA 2KA7A 4OIJA 4BBRG 2OEOA 3URYA 4C3IB 1SNQA 2LXKA 5FLMG 4C3JG 1L7YA 3H1UA 2V0GA 3EA6A 3R93A 1I35A 2W3RA 5IY0A 2IY5B 2DYMA 4M01A 4EQPA 2HT1A 4DQOC 3IFDA 5CC4A 4B3MQ 3HOXB 4E3CA 2G1EA 5BR8Q 4LNIA 4Q2JA 3ZJVA 1RWSA 4B3RL 1DOYA 5KYIA 3V2TA 2DY7A 1L4DB 2VQFL 2AEHA 2K6DB 2PE6B 3DEOA 2YTYA 1PH9A 4LNOA 3DBSA 4DR1Q 4C3HH 1HA5A 2Z6KC 1VJKA 2O4XA 3AV8A 2J7ZA 5CMDA 4X3TA 2KN5A 4OO1G 2B2TA 5JXVA 4RA8A 2BH2A 3M3YH 4NAWB 4A3KB 1VQDA 1V1PB 1YNJC 2PNHA 1W2BA 1AWDA 5C44G 4OX9Q 2I2YA 4G57A 1V49A 4DNIA 4S0RA 4X3SA 1YNJD 1Y1WH
chains in the Genus database with same CATH topology
3P4PB 1P7FA 4YTMB 1Q3LA 2WV6D 1EEID 3I3CA 1EZ6A 1FRRA 4OZBA 1A15A 3OSOA 2BB6A 1WD1A 1QOFA 3RFZB 5IODA 3AB9A 4EVOA 4EQNA 4M0WA 1OQQA 4OO1I 5M5XB 3D3RA 2HCIA 5E1FA 1FCLA 1IKLA 2B2YC 1LABA 3KLRA 4F7XA 3QOLA 2DNEA 3M85A 1FD7D 4PMCA 1GUSA 5CBEE 3AE9B 3O13A 3NQIA 4ABNA 1N63A 1T5XD 1EY8A 3D8GA 5HFYA 2EJMA 3FC4A 3MC0B 3S17B 4H2AA 4L63B 1XF5L 1QOAA 4HMJA 1R4PB 3TEZA 1HTPA 4FXGC 3PO3B 1TS3A 1DCZA 1RTOA 1RYJA 5HG2A 3J7AV 3CRKC 2F0SA 3T56B 3HRZC 3AM9A 2V4DA 3K7AB 2JX5A 3S9WA 3IKJA 4F88A 1FYCA 1AFPA 3GS2A 3QOJA 2FMMA 4TQ1A 1LTGD 2F0EA 1FD6A 5BYRA 2F0NA 2F0HA 3TZUA 4TRDA 2GI9A 3NQTA 1Z6HA 2EY2A 3V3XA 5BMGA 3HZXA 3X3NA 4L23A 2AUKA 1R4QB 2L1BA 2QDBA 1GHJA 3D4RA 3MZ5A 3AB5A 3PO0A 2B2YA 5I6WA 2RQXA 1XLPA 4ID6A 4OL7A 4RKLA 4BA1I 4LMQD 5DM63 1KLGD 4IKGA 1JWMD 5C6AA 1MVKA 3TEXA 1DYQA 4XQQA 4WIPA 1XLQA 4ZLTF 3AE1B 3J80E 1TKEA 2BBCA 3SVMA 5C44B 5JOBA 1Q90A 1GPXA 1GHKA 1VZ6A 2ZT9C 1GB4A 1ZOYB 3TMEA 5C0XH 3I8ZA 5JPNC 2MP1A 1TS4A 3ZGZA 1SE2A 3AN1A 2EYLA 3BDCA 3BS1A 1UNSA 4FP5D 4IURA 4ZUJA 1ZXHA 2WB1B 4KX6B 2B76B 1UWMA 3S1MB 4WWMA 1J7AA 1TKWB 5K36G 4K2KA 1VF5C 1RCVD 2HCCA 3K58A 2NVYB 3AE7B 4Q5VA 1HCZA 3GV3A 3PUVA 1C4QA 1WWTA 4TMAB 2WP9B 4CKBA 2CHBD 1BCPF 3PZ8A 4RF0A 1GUNA 2VNUD 2MJ3A 3NVVA 1PTOD 2E3TA 3VQIA 4R8NA 3VR3A 3ZJUA 1L4ZB 1ROEA 5LNK1 4J6HA 2ON8A 5CYUA 2JE6I 2C5CA 3UI2A 1N5WA 1MI0A 3NK9A 2K01A 1O80A 1X3QA 1CZPA 2LMCA 1U4PA 1OXTA 1BUIC 3NUCA 1F9QA 2PZTA 1CHPD 2E6XA 4NZLB 4YWGG 2XWJB 3IAS1 1EQTA 5FLXE 5EKLA 1DOXA 4XT1B 2SOBA 3K57A 2F0VA 3S1NB 4IOIE 4PT5A 1K83B 2L12A 3QWNA 4TQ0A 5LL6X 2FMCA 3KF8A 1HA6A 4EGVA 1J8IA 3A8IE 2JXTA 1PZJD 2VB3X 4R3DA 1WTVA 5KIXA 1RJTA 5BN4A 5C3EB 4F87A 1MPEA 1ZDVA 5C2TB 2NUCA 4NW2A 2NVXB 3V96A 2YEPF 2X38A 1JCKB 3D6WA 4B9WA 3H6MA 2NMQA 3DWQA 1KAAA 1DOKA 2AUJD 1E2WA 2BA0A 3S14B 2G9DA 1TVXA 1YMHE 2E76C 5I9PA 2PVOD 1TKYA 2HDLA 3GO5A 2WXQA 1NAPA 3HOVB 1D6EC 1JALA 2WACA 1A3TA 3I91A 2OXPA 5CV4A 2NVTB 5JPMC 3D4DA 1PZID 4K8IA 2R92B 1I6HB 3NTIA 4PQXA 1H9MA 3GTMB 3TSSA 2SNMA 2K5QA 1ESFA 1IYVA 3CU7A 1ACCA 3BVGA 1L6UA 5AUKA 1SFOB 1RFKA 1DZ1A 4A3EB 4TSSA 2YYZA 3WOEA 5EQ0A 2JEBI 4L8JA 2LFIA 3BG3A 4XXEA 4TKOB 3AE6B 1BDOA 1S5FD 3I72A 4US8A 4A3BB 5M5WB 1JROA 1CZWA 1VZ8A 2B39A 3QIAA 3TP5A 4PMBA 1SF0A 4OO1H 4IUUA 2W3SA 2NZ1D 1I4GA 4H7BA 1QKZA 2LJIA 4R8IA 4C7ZA 1L0YB 4LK1C 4KV6A 5BN3A 2N0SB 4OZAA 3C3LA 1BBXC 2XRQD 3KLSA 2V3PA 3HVZA 1CQFA 3P42A 5ELBA 5I2XA 1PDQA 1D1IA 2EYJA 5HURA 4NJCA 4E6IA 3W9CB 1KTKA 3FAHA 5IGFA 2EY1A 3BYYB 1VMCA 1Q1BA 1A3VA 1LT4D 2OEDA 2O2LD 1ZUD2 3NWSA 1I4XA 1V8CA 3LWUA 1IW7D 1TIID 3BDLA 1TS2A 3P4RB 2TMPA 1HZ5A 1BQQT 4DGZA 4XDXA 1TS5A 3AE4B 4BS9A 2IDYA 2SNSA 2LHEA 2EE1A 4RHRA 3BVZA 3Q8AA 1TY2A 1EFID 1GB1A 2IW3A 1S4ZA 5KNBA 2PVGC 1ZPSA 3H91A 2HTME 2LMCB 2EYPA 4K5XA 3R8BA 5FO9B 2SEBD 1HHVA 3ERQA 3ITPA 5T1IA 2L4NA 4O42A 1PFNA 2KEEA 5EPKA 5A35A 1NR4A 1TZOA 3P20A 1VF7A 2WXOA 3CRLC 1SYBA 3FPUB 4N58A 1EQVA 3OMCA 1QQRA 1QT9A 3M3YB 1WVLA 4N59A 1I6VC 1MI2A 3RD4A 1AEXA 3OWFA 2KCCA 1OQRA 4ZHPA 2L11A 1IUEA 1Y1WB 1I4HA 1O7ZA 4MT5A 3HOWB 1EYCA 2K6AA 2MH7A 4HCSA 1DM0B 2RVLA 3J81L 2Q5WD 4DK0A 2LS01 3S15B 4H0LC 2ZW0A 1NUCA 3LNNA 5G5HA 1WCMB 3W5UB 2NN6I 2DBYA 1SYCA 2B2UA 5EJWA 2B63B 2ID0A 5CV8A 1FCCC 5HI1A 3NVYA 2M0AA 3P7JA 2PMZB 1A70A 3NRZA 2I38A 2JXMB 4CJ2C 3T3OA 5CV7A 1QF6A 1AYFA 4EQOA 2J53A 4RGOS 4JBWA 4A9AA 1A3UA 2BE5D 3I4NB 2R93B 5K36H 4MM3B 2RDFA 5JJZA 1F9SA 4V190 2Y3AA 1O7YA 3MAQA 1IBXB 4KKJA 4IUTA 2CW0D 1GXDC 3M7NA 3LWEA 4FF2A 1EOTA 2B8GA 2DWQA 4CBVA 1IKMA 2IX0A 3T4AC 5CV6A 2DNCA 2IPKD 3SEBA 1PUTA 5F2DA 4QUFA 1EU4A 4L6TB 2K1BA 1OO9B 3ND8A 4C2MB 1XXGA 1E6EB 4RFBA 5T1GA 5EBDA 5I6YA 4RKBA 1B9NA 2GRIA 2JU6X 1SNOA 1D1KA 2PPBC 5C4HA 4WH4A 1PTOF 1CHQD 1FXAA 2WXHA 1O7LA 4NAMA 2L5TA 2PO4A 5LL6S 2WU5B 2W55A 1Y69U 2HQEA 4MN3A 4HRSA 1TWCB 2DLBA 1J7CA 4H13C 3HVDA 1QNUA 4RGNA 3Q8EA 5I9OA 5E4XA 4DK1A 4XWTA 3T53B 1MSGA 1PRTC 4DN4M 2SDFA 4KJNA 1CA6A 4IUQA 1PRTD 2EJFC 3RPFC 1I50B 1T6BX 1H9JA 1XLOA 3QB3A 4GDKB 1STBA 4K6DA 2JA7B 3BYTB 4XYOA 1NENB 4RCNA 1F9PA 1F2RI 4YSYB 2PNRC 5KRUA 2RDHA 4NP5A 3TP8A 4A3GB 5M9OA 2FUG1 1PMRA 3MXUA 2WXPA 1SYGA 3I73A 5E3FA 1E9MA 2A5HA 3P4QB 5KNDA 3VRAB 4B9XA 4FNFA 1TWGB 1QJOA 1T3QA 4JK1C 3NUHB 3Q8CA 1JOKA 1PGBA 1KRHA 1PDXA 1B4OA 3C1FA 2ICIA 2K3UA 2ACZB 3EUB2 3AE8B 2FJ2A 2WDVB 2Y5PA 3MJ5A 3H8HA 1D5ZC 5K5PA 5G3LD 4C56C 4HSVA 3EQLC 1N60A 1JWAD 4DAVA 2JQRB 5GXGB 2NTTA 4WURA 3F2UA 1QB5D 1TWAB 3OPOA 1EY4A 2L0CA 5A2QE 1NSNS 1Y8NB 4BY1B 4IUNA 2L83A 1S5CD 4M8AA 2WXKA 4K8JA 4NKLA 4MH8A 2D5GA 1ICWA 2KQ3A 3S2DB 3EJIA 1TWFB 3PUXA 2EKIA 4B0EA 1ML0D 4ZKBB 1TU2B 5E4WC 1NVID 1JC7A 4I65A 3H3VC 2MPMA 4MACA 3MTSA 1SNPA 2F3WA 3I90A 1NYRA 2QIEB 5DAUA 3NWTA 2B8FA 2A74C 3HKZB 3KK7A 2F3VA 4FXDA 3FPPA 1RHPA 3N52A 3A55A 4WFN3 3AEGB 1Q12A 5IGBA 3AE2B 4PMWA 3ABVB 3DMUA 3DWPA 3HOZB 2PCFB 1HXYD 2K22A 3OHXC 2BDNA 2F0DA 3W1SA 3BZDB 3J81E 3VR8B 4IFDJ 2JSOA 2IX1A 1GUTA 4IALA 2C9OA 3A8KE 1SNCA 5KEEA 1LTSD 4HR7B 2PYKA 4JWSC 4BBRB 1ZKOA 3L9AX 1VR9A 3NS1A 4C3JB 1DONA 3VYTA 1FIQA 2IGGA 2JZPA 1U4MA 2K33A 3P4SB 4BBSB 3SE0A 2V3NA 3CIRB 1V8QA 2IT1A 1B50A 3U9SA 4C80A 1H9SB 2JEAI 3NZ3A 4XTCS 3MHZA 5JEAJ 2GA4B 3TN2A 3TZDA 2MJEA 2PMVA 1VLBA 1ZXTA 4ZUIA 4DAPA 3NE5B 4ZQ3A 4A90A 3M4YA 3SK4A 3SR1A 1IHZA 2QJLA 1Q10A 3WDNA 2F0PA 1M8AA 1E2VA 1SYEA 4A93B 4JWUC 2LEKA 1FNUA 1F9RA 1O78A 3KQ4A 1EL0A 4G4KA 2AQ2B 2F0IA 2KCNA 4XIGS 3IT4B 5D14A 3ND9A 1P7EA 3W5VB 4OGQC 4M1UB 4REZA 3J7AF 4LLGM 4J3OD 4CKEA 4UAIA 3Q69A 2N88A 2FHTA 3LB8C 1YN4A 1AP0A 4IZ8A 1FMAD 5IGGA 3MWYW 3JAML 4WORA 2L1AA 1DGJA 1V1OA 1EY6A 5EKIA 5KNCA 4R9WA 1PRTB 3VYSA 2F0JA 3SHLA 2K7VA 4J8QA 3HS0C 3AEFB 4D2KA 1MGSA 2QF7A 1XWEA 1STEA 1Y56A 1NYQA 4A3FB 5BN5A 2EELA 5I2YA 1SNDA 3FKIB 3Q24A 3AEBB 1ILQA 5T8IA 1JE4A 2LFNA 1SIJA 2J52A 1UUPA 1E10A 5IGDA 3RZOB 1SJHD 3Q22A 1FM0D 1HZ6A 1X3PA 2J4XA 2I46A 2IWHA 3GQBA 5C4JB 1I4QA 1QILA 4B08A 4IFDI 2K5DA 5JEAG 3OWEB 2Q8RE 3VR6A 1JB3A 1J7BA 4ILWA 3OMGA 2Z4HA 2F0WA 4A6QA 2RDGA 1C79A 3LYYA 3RMHA 2R61A 3T16A 3VR5A 2ZXPA 4CHTB 1IBXA 1CA5A 1F2MA 1EWCA 2BCOA 1ZEQX 2X6LA 1N61A 1HUNA 1TKGA 3GP7A 4WAFA 5AFWA 3R2TA 4KTAA 2MJDA 4KKSA 2BTEA 3CKIB 1W6KA 2M56B 2KACA 1H9RA 3NSWA 4BWGB 3H94A 4MHEA 3E5SA 1AN8A 2KAJA 1BXTA 1NI3A 1LV9A 3LXFA 1YNNC 1YJJA 3IXSA 2H88B 1G91A 1X32A 2FE8A 2LY7A 1TYGB 5C5MA 2WXIA 1RM6C 3E0JA 1LTTD 3GTQB 4PV1C 4QIWB 3MP9A 2WDQB 5LHY1 4EE2A 1XCQL 1Q8IA 3W3AA 4IUVA 2HUGA 2CQAA 1LACA 1PGXA 4FYDA 2IX3A 2B2VA 1FGBD 2BDOA 2AQ1B 4XT3B 1ILPA 5C0XJ 4IDIA 1S5DD 3GTGB 2Q8TA 2JYEA 3NTKA 1HTLD 3GTJB 3IT6B 1LTID 1BO0A 4Y7NB 2K05A 1STHA 4WJWA 4Q0FA 4YT0B 5J22A 5G3LF 3PMFA 3GTOB 2QMTA 3MXGA 3MXNA 1J9OA 2WU2B 1MD2D 2KVMA 1QOHA 3P75A 1N5XA 4DXFA 5A2QL 4N6EB 3PUYA 2PZUA 2EYMA 1C8CA 4IN3A 5MPOA 2RMMA 2WXJA 2H4OA 1D2BA 2M00A 3A54A 1XTCD 3QJYA 3MA2B 4U68A 3GD7A 4ZK9B 4ZHOA 2BYTA 1AW7A 1ENCA 2HDEA 3MVVA 1YN3A 4HAEA 2B2UC 2KUMA 3VR2A 3RLFA 1F2RC 4KD4A 1OFFA 1FNWA 5H92C 3CWIA 3NHHA 1B9MA 2RKSA 1S5ED 1ENAA 1SYFA 4RGMA 1E7PB 4A3DB 2EOTA 1RDPD 1LT5D 4YSXB 1SNMA 5C5LA 2NN6G 4HMIA 4JE3B 2E2IB 1STYA 3S1RB 3P63A 4HEA1 2EY5A 2BT6A 3A7LA 3AEAB 3BIID 5D3IB 1II3A 1KF6B 3HG9A 1L5PA 1IL8A 4HKZE 1IGCA 4WQMA 2KWDA 1PLFA 3BVMA 4USAA 4HKQA 1TWHB 2K04A 2BS2B 1B44D 4DF7A 4BA2I 1JWBD 2H1EA 4GDLB 4I7ZC 4A55A 1SEBD 1DOIA 1KFYB 4QB4A 2WIIB 4L2YA 2WS3B 1DOMA 1BCPC 5KYLA 2N55A 3HRDD 2NYZD 1FR3A 3H09A 2JP1A 1ZDXA 1OXXK 4HSPA 2OF1A 5FK9C 2D9UA 4P2CB 4FXKC 3JAME 1M4VA 1G2TA 3GTKB 4P16A 3B9JA 5ELEA 2IL8A 2K32A 1HQRD 1QNKA 1EWYC 4KY7A 4XDDA 1JOQA 1K51A 3CHBD 1CM9A 3NVZA 3ETRA 2FINB 4KHVA 3P1HA 2WINB 3DWAA 4HTHA 2BOSA 2ENBA 2I07B 1VZ7A 5CORA 4ZOHC 5C0XI 4CKCA 3I4LA 2K5PA 2BS3B 5I4DA 2RSNA 5COYA 3KBXA 1STAA 3I57A 1TR5A 4K6LA 1EY7A 2IGDA 2EJGC 1L6VA 2F0FA 3K6OA 1ZP0B 3K5MA 1CTMA 4K5VA 4DNTB 1WTWA 1SSNA 2DN8A 1K8OA 1XO3A 1LTAD 2A69C 3PUZA 1D5XC 1H9SA 2EY6A 3ZYYX 4RCOA 2A69D 1C78A 1JMLA 3Q23A 4IFDH 2AQ3B 3FDTA 2SAKA 4C1NK 4A8XC 1JWSD 3QG1A 1XX8A 2L52A 3A56A 1VRAB 1ZYRC 1KDAA 5M3FB 3SFDB 1HUMA 1Y8PB 1ZYRD 4ZKCB 2K9XA 4US9A 3C8YA 1UAPA 1TT2A 3FMCA 1JWUD 3KUPA 2L55A 2MJ8A 5M5YB 4FF1A 1MHXA 4KHZA 3IAYA 4RF1A 3I9V1 3J9CA 1C76A 3RZDB 1ENFA 5JEAH 4DAYA 3MEHA 5JAVA 2R3ZA 1U9RA 3U9OA 1QCBD 4NMZA 1WYGA 3B2GA 1HQMC 4U673 2M19A 2JYOA 3S16B 2O5JC 2VXWA 2F1MA 1PFBA 2HDMA 1G291 1L0VB 5HGTA 4FO2A 1JQ4A 1QWYA 3PIO3 1LTRD 1STGA 3TBIB 4XYQA 3SK8A 4FF4A 1SBBB 3S2HB 1QE6A 3BDOA 4OW0A 2Y0SB 1XEEA 4C1NI 1C48A 3B2FA 2XSCA 3E9SA 3EGRA 2VUMB 4HROA 1JQYD 1WRIA 4KGTA 3IL8A 3TEYA 3MXPA 4F8MA 4DXGA 4FF3A 3DM1A 1N62A 1UGJA 5BYQA 1B53A 1HFGA 2NB0A 2KDMA 1QOGA 2CU3A 3NBHA 5ELFA 4O1NA 2QKIC 2EYFA 1Z7TA 3VA5A 1WD0A 5D3DA 4DNRB 5C3JB 1CT1D 4IUPA 1K52A 4YIJA 5ELCA 4ARCA 1PTOH 2A73B 2PW7A 3TP6A 2Z4IA 3AEDB 5IOCA 2RSOA 1GUOA 5IIFA 3Q6SA 1SB3C 1FXIA 5C4ZA 3TDQA 4K5WA 1WSPA 1KNAA 3OOCA 4YTNB 1VMPA 4KD3A 1W6JA 4WRDA 4J1MA 2F4IA 3DWMA 2RBMA 3D4WA 1ZXIA 2XVSA 4XE0A 1C4CA 1A2UA 4KN7C 2R6GA 1NR2A 5EE3A 2F0UA 2LGIA 2NWGA 4KMUC 2O5IC 3AEEB 4P6VF 1I3QB 2F03A 3PIP3 3GB1A 2EXZA 3NPPA 1FNVA 2RA4A 4DA2A 2K5WA 3K59A 2WKDA 2XRSD 2VZKB 1I7HA 5J1ZA 2WXRA 2K28A 2JA5B 3OIPA 3E56A 1GJXA 1SMYC 2EYOA 5FR3A 1PZKD 1SMYD 1CJEA 1BCPB 3T51B 2NN6H 3A8JE 5IT9L 4ZRQA 2ZXOA 3HEJA 2XNAC 4FXCA 4G7HC 1D5MC 2XN9C 5ISRA 2NTSA 4YSZB 4G7ZC 2KMMA 4KGRA 1HFNA 1AZPA 2DY8A 2N9LA 3NTHA 4BY7B 2XIWA 2E74C 1A6XA 5EBCA 1ZE3D 1D4BA 1T5EA 3M7GA 4RHSA 1I4RA 2FBWB 3VYUA 2K03A 3DXJC 1QG7A 1FEHA 1V97A 2L32A 3MHBA 2CVRA 1FRDA 2F0GA 3HOYB 1SAPA 1HRJA 4KY6A 3VR4A 1F77A 2Z8LA 3FVQA 4MIUA 5HHDG 3VYRA 1H9KA 1TQOA 3AMZA 3BK1A 3FEWX 3HP3A 4C7YA 1QLBB 3RUZA 3K5LA 5H8YE 2AWNA 2EYHA 2IJ0A 1K50A 3EVQA 2KN4A 5G5GA 2KEDA 3K5NA 4QF4A 5CBAE 1YN5A 2K0PA 2YEPB 1SE4A 1YNTE 3G6JB 3EROA 3KWVA 5CR3A 2JYTA 4RAUC 4K14A 1E2ZA 4UDUC 3AMUA 3D6CA 3S1QB 1JORA 1PTOC 2ZW1A 1CI3M 1JRPA 4YXDB 3P1MA 1RF2D 1WTPA 3T13A 2F0TA 4LK0M 1EIHA 1E0BA 1BR9A 2N7JA 2PQEA 1UWXA 3Q8BA 4KJOA 3VA7A 5C4XB 4A3IB 3J7YW 1EY0A 1BNZA 3DEPA 1RKNA 5EE0A 4IFDG 3NXWA 3GTLB 2AX5A 1SYDA 2R7ZB 4S3SA 1ESRA 3H0GB 4KY5A 2LKVA 4FVMA 3N6RA 4V0BA 5JVH3 2EZVA 4CQNA 3C46A 1IYUA 1BUVT 1MHHE 2IGHA 3L4PA 1EZ8A 3AH7A 1CZGA 1DJRD 4A3MB 1S5BD 1EYAA 1YQ3B 5D7GA 3FRPB 4N9TA 2E2HB 2W54A 2FFKB 1KABA 2MUYA 3U52E 2F0MA 2X69A 3TEWA 5FOBB 2JSVX 1ET9A 3U2SC 3PV0A 2LHDA 4KN4C 3A7AB 3AE3B 1V43A 4RGTA 2JA8B 4RH6A 2B2VC 1BF4A 3AE5B 3U4EG 2EDGA 4PNYA 1OXUA 3ZQ4A 2PTLA 1OXVA 3FILA 2GB1A 1K8MA 2ICEC 3X3MA 4LJZC 4XQNA 1C9FA 2D5DA 4TQUS 1R7SA 3SXHA 1PRTF 2J0TD 2WXGA 2L9HA 2TSSA 3MFYA 3VR9B 4IQZA 1VDVA 2INPE 2JWUA 2BS4B 2E75C 1YJIA 1C77A 2ZXRA 1F2ZA 4ULLA 2PKOA 1YNND 1B1ZA 3NBIA 4ME5A 2KJXA 1SJED 1Y8OB 4C3HG 3NP8A 3E6ZX 4ODGA 3IAM1 3NVWA 5EE1A 1LT6D 1GUGA 2D2CC 2Y5CA 3N9YC 1EY9A 1GOZA 1KDCA 2RPVA 2WXMA 3SK6A 3D31A 1I4PA 5AUIA 1HEZE 2Z1CA 3PUWA 1F2LA 5FKAC 1C4PA 1B9RA 5KGUA 3KLSX 1WXQA 5D65A 1B3AA 1RD9D 4LAAA 5C3XA 1NEKB 1JICA 1SSOA 5M3MB 1KNEA 4QUCA 3EFXD 4ZYSA 3I70A 2A6HC 2EPBA 2KOLA 3M4OB 1KDBA 3GV6A 4HCEA 3DWGC 2A6HD 1LT3D 3IFTA 1IW7C 4X3UA 5DM73 3DHQA 3R3OA 1STNA 4XWWA 1KLUD 4OZCA 1VDZA 5JVG3 3DUZA 5IT9E 4YTPB 5BMIA 5CV5A 1UEAB 5CV9A 2OHFA 4CGYB 2QSDA 2VB2X 1FFUA 3PO2B 1CFMA 3V05A 2INNE 2J42A 4OHJA 3U7ZA 3BK2A 1PYWD 1VCIA 2ONQA 1JOOA 3C1EA 1U4LA 5TSSA 4ITKA 1LLRD 1GUWA 4NDXA 1DXMA 3VRBB 1CQVA 2MHVA 3HUIA 3C2PA 5DEHA 1WTXA 1LTBD 2AWOA 4X3KA 1ONLA 2V4IB 4CJ1B 2KHSA 4LTUA 2PW9A 1MSHA 1L0XB 2BA1A 3Q8FA 2M2LA 4QMGA 4OVZA 5EE9A 1PFMA 5E6JA 1V1PA 4KGSA 3SDZA 4ZRPA 3Q0AA 1JR0D 4ZRZA 1Z47A 5ELDA 1WGKA 3I4MB 2F0QA 2WXNA 3KBGA 2VZKD 1EU3A 1RODA 1WTOA 4C3HB 5C3WA 2MEKA 1AZQA 4N9PA 3HGBA 4L1BA 2NBFA 4KI0A 1EM7A 4HEDA 1XCTL 4XDCA 4KKTA 1BCPD 4RNAA 2PLPA 5C0XG 1DD2A 3CQZB 2CJNA 3LX0A 1PTOB 1PGAA 1RTNA 2F0OA 4AYBB 2E2JB 2WKCA 5IGCA 3AU7A 5EKKA 4AS1A 4RWSC 1SE3A 5FO7B 1GAQB 2F0KA 2WLBA 1K53A 3SFEB 2BB5A 4HN7A 3L7ZC 1A2TA 1LO5D 3WCQA 3FILB 2BE5C 3L3OC 4C3IG 2H89B 2E2DC 2PIAA 2QEJC 3BWUD 2QILA 1NCVA 3J80L 2LUMA 5BYSA 1YQ4B 3KWLA 2EVBA 2OT2A 4HJGE 2G9HD 5EPLA 2CW0C 1EIGA 2YU9B 2D62A 2JA6B 1KH0A 3QO2A 4QCLA 2CJOA 2WQYB 1PXUA 1U4RA 1SDFA 3PZ7A 3R2IA 2PW5A 4G7OC 1EYDA 2WDRB 4KK7A 4DU9A 4XQJA 1QOBA 1EEFD 1C4AA 5NUCA 1Q1EA 1FFVA 3WOFA 2QCPX 1G8ZD 2A6EC 4CJ0B 2A6ED 3K5OA 4H44C 2B2WC 2PZWA 5EGTA 4JX1C 4A3JB 1ET6A 1CK1A 1IGDA 3HOUB 3T3NA 5IGEA 1MBYA 1OXSC 1G2SA 2NVQB 3OW7A 2MGSA 2F0LA 3ONAB 1B2TA 2WXLA 2WNMA 4AQ7A 4ARIA 2A68C 3SK5A 1F2YA 4GZYC 3TP7A 2Q8IB 2A68D 1DOLA 4DFAA 1BMLC 5FLXL 5J39A 2B2TC 3GTPB 2DYOA 4JPSA 1TY0A 2M9VA 1WTRA 1R9TB 5DNFA 3K0YA 1Y1VB 2XWBB 1EY5A 5FO8B 4KKIA 3ZJTA 2WXFA 1HPCA 3UI3A 1JW9D 2KQ4X 2BW2A 5BMHA 1PFDA 2KECA 1EWHA 1G6ZA 5CGKA 1XYIA 4B0MA 1WTQA 3W2DA 4Z9CB 2WAQB 2B2WA 2X6GA 1TJEA