1JWMD

Crystal structure of the complex of the mhc class ii molecule hla-dr1(ha peptide 306-318) with the superantigen sec3
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
232
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 67
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwmD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwmD02
4RGNA 2WV6D 2XRQD 5ELBA 1I4GA 5D3DA 1XTCD 3DWAA 1V1PB 1PTOF 1JCKB 1I4PA 2RDGA 1PTOC 1LT4D 1F77A 1PRTC 1SE3A 1B44D 1HA5A 1D6EC 2RDHA 4L63B 1BXTA 2XRSD 4RGOS 4RCOA 2ICIA 1JWUD 4L6TB 1S5BD 1LTSD 1KTKA 3DWQA 4TSSA 1FNVA 4DXFA 3BZDB 1V1PA 1CK1A 1S5FD 1I4RA 2AQ3B 1LTID 1RDPD 3R2TA 2AQ2B 1JQYD 1FGBD 4C56C 2R61A 3R2IA 2TSSA 4K6LA 2AQ1B 2IPKD 1FD7D 1FNUA 1ET6A 1TS2A 1CT1D 4RFBA 1LT5D 1CQVA 1JR0D 2XN9C 1D5XC 1BCPC 1KLGD 1D5ZC 1B1ZA 1CHPD 3W2DA 1EU4A 1S5CD 3DWPA 1PTOB 1DYQA 3BVGA 1M4VA 4RHSA 1SE2A 1HTLD 1PRTB 1BCPF 1I4HA 1T5XD 1CHQD 2QEJC 1PYWD 3SEBA 1GOZA 1S5ED 4OHJA 5ELCA 1EEFD 4RH6A 1SJHD 5I4DA 1LLRD 3BYTB 1HQRD 3MC0B 1LT3D 2J4XA 3OWEB 4RGTA 1L0XB 1LTBD 4O1NA 1SEBD 1ESFA 3BYYB 1RCVD 1EEID 1PTOD 2G9HD 1LT6D 1LTRD 1DJRD 1ET9A 1UNSA 1ENFA 1EWCA 1PTOH 1LO5D 5ELFA 3EFXD 1UUPA 2SEBD 1YN3A 1BCPB 1SXTA 1EU3A 1PZID 2CHBD 1PRTF 3EA6A 2QILA 2Z8LA 1RF2D 1SE4A 1TS3A 1I4QA 4NZLB 1TS4A 4RHRA 3MFGA 1BCPD 1LTTD 1AN8A 1AW7A 1RD9D 3KLSX 1KLUD 3TSSA 3URYA 1PZKD 3BVMA 3GP7A 2NTTA 5D3IB 4DXGA 1TY0A 1PZJD 1SBBB 2NTSA 2O2LD 3R8BA 1I4XA 2IJ0A 3CHBD 1QILA 1D5MC 3BVZA 4UDUC 5FK9C 1L0YB 1JWSD 4Z9CB 4RGMA 1V1OA 1MD2D 1SJED 1S5DD 1HXYD 1G8ZD 4ZYSA 1EFID 1LTGD 1YN4A 5ELDA 1STEA 3O13A 5ELEA 1LTAD 1JWMD 5FKAC 1XXGA 2XNAC 1TY2A 4BWGB 1PRTD 3V05A 1YN5A 5TSSA 1TS5A 1FNWA
chains in the Genus database with same CATH superfamily
3SGIA 1J7BA 5IO9A 3T3NA 1PFBA 2CHWA 3I3TB 4WWNA 1DOKA 1MKHA 4ZK9B 2M8SA 3NVZA 4NXNL 4P75A 2R6GA 2PZTA 3DHQA 1FEHA 3A8JE 3NQIA 4E71A 1YHQA 2NVQB 1HA5A 1I3QH 4JG2A 4FF1A 1N62A 3I70A 4L5TA 2A4ZA 3VR3A 1Q10A 4NAWB 1B9RA 5CV6A 1XLOA 3NENA 2L76A 1YJJA 4LDTD 5TR5A 1XMQQ 5IYDH 2NZHA 4A3JG 2JN4A 3TL5A 5HY6A 3S1RB 3SDZA 4DXFA 4JI6L 4R4QA 1VF5C 4XT3B 4X62Q 4B3TQ 5M5XB 3KUPA 4NXML 1WGRA 2H1EA 4HIOA 2O6VB 5JVH3 3PUWA 1AZPA 4AOFA 2P5ZX 4JI7Q 4BKTA 2G4SA 1VZ8A 3CCLA 1XMOL 1RYJA 1JORA 1ZEQX 2M56B 4M8NA 1OXTA 3V60A 3ZTCA 1FD7D 3D8GA 1FNUA 4QY7A 2ZJRA 4B0MA 4W9HA 1OTCA 1V5OA 4W9IA 1HE8A 1SYCA 1KH0A 1ROEA 1UE6A 3PLVA 1KLGD 1QOHA 3E9HA 1L4DB 3KW5B 2IDYA 2YTXA 4KY6A 1XPUA 1H9SB 3R3OA 1OQYA 2MQJA 2YYZA 5GMVA 3S14B 4MJSA 2PMZE 3K9PB 1RKNA 4RKBA 1KFYB 5HFYA 1JOKA 3VHTC 1U4AA 2ZVNA 4A4IA 4AQ7A 2Z59B 3AU4A 2R93H 2M0AA 4Y7NH 1CHQD 4J15A 1FPYA 4BFRA 2KANA 1S5ED 2DNCA 1X54A 2X38A 1H9KA 2HUGA 4UP8A 3F1ZA 5ELCA 3TS0A 4QUFA 2OTLA 2KA7A 1MPEA 4HJGE 5CR3A 1KD1C 2K4KA 4BVUC 1HQRD 4URKA 3L13A 3OWEB 1KJTA 3O65B 2KACA 3RZOB 1N63A 3P4PB 3TMPB 2K14A 5J2RA 3T51B 2AWTA 3IG3A 2G9HD 4LNFA 4QAYA 4BY1B 4N9TA 1WIAA 2ATWA 3T1YL 4RM8A 3KLSA 4RG1A 2VQEQ 4TQUS 2DLBA 1WYDA 1IL2A 3TDQA 4DV2L 4LF7L 1FD6A 4UAIA 1KABA 1K9MC 1Q1OA 4O2DA 1G2TA 3HRZC 3MEFA 4X64L 2ZJPA 4BS9A 3MFGA 1RM6C 2V4LA 2LHEA 3LB8C 1M8AA 3TCAA 1C4CA 2KLGA 5KHQA 1EOTA 3OJ4B 1WFYA 2YEPB 1QG7A 4ZKBB 2B2VA 4FO2A 1PDXA 1PZKD 3DHHC 4K7WA 3ZW3A 3ZKJC 1E7PB 4X3SA 4IN3A 3JAMi 5CHFA 3EROA 2OQ0A 1WXAA 4ABNA 1D5MC 3W5OA 3M63B 4C1NK 3V6EB 3PGEA 4GN5A 1R4MB 3TJPA 1EOVA 4HJ8A 3FHWA 2B63B 2RPVA 4K2KA 1WXVA 4JK1C 4IJLA 4RA8A 2M19A 3GOEA 2WX1A 2HJ1A 2D0PA 3N20C 2L15A 4WWOA 1K50A 1WXMA 2Z0EB 4EQOA 1Y1WG 1Y14B 4GKJL 2KMCA 1JC7A 1MHWC 3OMCA 3GDEA 3N1ZC 1LFDA 2SNMA 1UBQA 1VQDA 2A69C 3A33B 2CHZA 4RGNA 2Y0SE 4WWPA 5JPMC 4K5WA 1TWAB 5EQ0A 1I4GA 5KYIA 1K73C 3EGRA 1N5XA 2GMIC 4GIVA 3IT6B 2L1AA 2OEOA 2O2VA 2BYEA 2MEKA 4C7ZA 3P7JA 1LACA 3STBC 3LWUA 5I6WA 1Z5SB 2DBYA 2QJLA 3L4PA 2WXJA 4LAAA 3SK6A 3WIMA 3RR5A 4XWTA 5LMUQ 3PZ8A 1O78A 5H8YE 1E6EB 4TSSA 5IYCG 1TWHH 5LMNL 2JA8G 3PO2B 1J9OA 1U4PA 3RPFC 2X6GA 1TVXA 4MM3B 5GQOA 4XYCA 2ZM6Q 1VQIA 1M94A 4HMJA 4OWWB 2XBBC 4R8NA 4CQNA 2ALYB 4G11A 3I3CA 4R1JA 4WJNA 2EJFC 1H8CA 2B3GA 4YHHQ 4AQYL 1WTHA 1VQ8A 4WJ3M 3B2GA 1LT5D 1XNQQ 1YNNC 1HNWQ 1VDVA 4DWFA 1AE2A 4A3MB 3T13A 3H3VH 3CAMA 1STHA 5KHOA 3CCQA 2HIVA 4A3IG 4N59A 2VW9A 1B7YB 1VQ9A 2MJDA 2N3SA 1PH9A 3GTLH 2JF5A 3T1HQ 3KF6A 4ZHPA 4IUNA 2K05A 3PO2H 1V2YA 1WTQA 2YU9H 3PUYA 2VRRB 2M2LA 3CCUA 3HOYH 4OEMB 1HZBA 4OHJA 1WRDB 3NY5A 3S1MH 1KC8C 1N33Q 3A9JA 1G6JA 1LLRD 4APVA 1XPRA 5BMHA 2KQ4X 4HPMB 1Q86C 1FMAD 2PO4A 3NRZA 4FYDA 1SNCA 3P1HA 5EJWA 2W3SA 4ZRIA 4BZAA 4KKJA 3KLWA 3HOXH 4BY1H 1ZGUB 4HIMA 4MH8A 1LTRD 4YY3L 1A62A 5M3FB 3Q3NC 1ILQA 2EE1A 4W9CA 4PYZA 4IALA 3NTKA 2Q8TA 2G5DA 4HDOA 3RZWC 3DWGC 3CMMB 1YNXA 3BWUD 1NDDA 2GI9A 5K36H 3IFDA 2B63H 4FULA 1UBIA 2JA6G 1TS4A 3J81i 2XK5A 1LABA 4IPGA 2E2JH 2ZCBA 3C2PA 2KC1A 3W5UB 4DNTB 4G7ZC 2OWOA 4JI0L 3EFUA 3PUVA 3ZVVA 1HH2P 4A3LH 1SRUA 4H0LC 4NY0A 4USAA 1VQGA 4LFBQ 3RD4A 3CCVA 4ICUA 1WD0A 3NZ3A 3R8BA 2QEXA 1NR4A 1SDFA 1SB3C 1I35A 4DR4Q 4A3BG 1OXSC 4RM9A 3UGBB 1K83B 4FJVB 1WM2A 1YJ9A 2RDFA 2EJMA 4XYQA 1HXYD 1G8ZD 5KNDA 1EFID 3A55A 4A3LG 2C9WB 4JBKA 5FLMH 2DWQA 2A74C 1QOAA 2LZ6A 1RFKA 3ULJA 3AE6B 2NZ1D 4X62L 4B3TL 1C9OA 3UE0A 5EE9A 5LL6X 3CMEA 4GKKQ 3U52E 1GC7A 2YTYA 3MWYW 3RD2A 1H4RA 2M9VA 1YHAA 2MNAA 3J80E 3LYYA 3A5UA 2BB5A 5IGGA 4AYBB 5D7GA 1XTCD 1P16A 2UUCL 3KBGA 1QLBB 4HLEA 1A3VA 1PTOF 1V97A 3SXHA 3QR8A 1IYJB 1IKMA 1ML0D 2MBHA 3C46A 3GTQH 4ALPA 3D6CA 4OO1G 3TP7A 4MZ9A 2XRSD 3TUOA 1BVSA 2KN5A 1A3TA 3I4NH 2M17A 5EE1A 2XSCA 4LNQA 1GUGA 3AB9A 3HHMA 3J7YW 2E2HH 3RZOH 2J7ZA 1G2SA 1PVOA 4CGYB 1KRHA 1RHPA 5IYBG 4IPHA 2VZKB 4PMBA 1F2RC 1IBLQ 3QIJA 2VS1A 2WQYB 2LS01 4XQNA 3PO2G 3GS2A 1YVCA 4LK0M 2AQ3B 1T6BX 2NMQA 1EQVA 3SK8A 4KIKA 2L9HA 2R7FA 5IGDA 1SF0A 4YTPB 4IUVA 4DUYL 3HOUB 2M4NA 4MEMA 1CT1D 2UU9Q 2AYOB 4BY1G 3B2FA 1K8RB 5C0XG 4IFDH 3I4NB 3Q8AA 4ZRPA 4HMIA 3T1YQ 2D2CC 1VQFA 1WYWB 2J0KA 2Y3AA 3AYHB 3PZ7A 3MHSD 5EKIA 4HIKA 1EYCA 1Y56A 2I07B 4GNXB 3EQLC 1XX8A 4C00A 1CM9A 1F9RA 3HOYB 2BQQA 2SOBA 4LDTB 1NI3A 4X66Q 3CC2A 2BF8B 1VQPA 2O5JC 1FJGL 1DGSA 1HTPA 5C5MA 3V3XA 4FA6A 3PHWB 2KVZA 2LJIA 5BR8L 2KKCA 2CFMA 1EQQA 4BXXG 3UIPB 4FADA 1S40A 3HOUH 1B3QA 1DOLA 3AEVA 2R92H 1L6UA 2DZMA 1PXUA 1LT3D 1WF9A 1VQKA 3HOXB 2JX5A 4DDGD 2D07B 2WINB 5CHVC 1WVLA 2KVMA 4M0WA 5C4JH 5AUIA 4K3BA 3L0WB 4OXPA 4C1NI 2I5LX 1CJEA 3HOUG 4W9LA 1Y1VG 5ELOA 2K22A 2Z6BA 4WQMA 3EN2A 3J81j 2RDBC 1BCPB 2D3CA 2WU5B 1PZID 2F0KA 5JPNC 2JK8A 1EIYB 1YJIA 1RF2D 4MNOA 2OTJA 4A76A 5C4XB 2MWSB 2V9HA 3V62A 5JXVA 1LTTD 2KWUB 4A3JB 2EXDA 2PQAB 1N32L 2AWNA 4OVUA 2Q2IA 2M0XA 3I90A 4WURA 3UIOB 2CQOA 1J7AA 2WFWA 2BVCA 3DM3A 5C0XH 4IFDG 2WXMA 1L6VA 5CV8A 4IWQA 3A54A 2W82A 5C6AA 4RGMA 2GBRA 3H15A 4PQXA 2F0NA 3CCRA 4YWKA 1STEA 2LXKA 2UXCL 1E90A 4PT5A 4TUUA 4GOPB 1ASZA 4KY7A 2LGDA 3HOVB 3PSIA 2NBUA 1P98A 1PRTD 4R4CA 2PIAA 3OTOL 3L54A 1NBWA 5L95C 1OFFA 4IPCA 1ZW7A 3RUIB 2WKDA 4DHJB 2B3AA 2PJHA 4ZLTF 4R9WA 4NPSA 2N7JA 4JIOU 2H5XA 2LD9A 4JOIA 1JW9D 5IGFA 4A3IB 3P4RB 2GA4B 1PFNA 5C0XI 2RDHA 1UGMA 2KCTA 2ICIA 1VQLA 2Q8IB 1IGDA 1X32A 3EBEA 2QHOA 4JQWC 1DONA 1B4OA 5IYCH 3DHGC 1E1TA 3K80C 1H9JA 3AU5A 4CHTB 4B08A 1PLFA 4DR6L 5JHAA 3QC8B 3BZKA 1JB7A 1I7HA 2C5LC 3ND9A 2L7RA 1I4RA 3TP8A 1PH1A 2B2YA 3HKZB 2AQ2B 1I3QB 1S1QB 5I6YA 2N7EA 4CJ0B 5CHWA 2AL6A 1L0WA 3FKIB 1E8YA 3HOZH 1NNXA 4A3GH 2Z0SA 4DF7A 1IYVA 1IPGA 2LFNA 4ULLA 3AE3B 1EUVB 4OIKA 4LFAQ 3Q69A 4YY3Q 4L1BA 5IP4D 2K9XA 2K6DB 4LLGM 1X56A 2EPBA 2BWES 3DWPA 2JY6A 1DYQA 2WDQB 4IOCA 1K0RA 4O42A 1PRTB 3F2CA 1YJWA 1CKMA 1JJ2A 1SN8A 2DHZA 4LK1C 4JI1L 1SMXA 3ERQA 1FVIA 4LUVA 1J0GA 1B2TA 1E5WA 2R93B 2KHSA 1EZ6A 4DNIA 5D94A 3TEYA 3U7ZA 3ZRFA 4FNFA 1H9RA 4XDCA 5C3WA 4A3FB 4HEA1 1JALA 1JWAD 4I7AA 4WJPA 3VYTA 1IUEA 2KDBA 3BK2A 4KMUC 4A3DB 1EEID 4N6EB 3A5ZB 4MACA 1E7ZA 1E7VA 2V4DA 2LXCA 1NBFC 1F2MA 2QDFA 1VDZA 2KK8A 4K3CA 3EFXD 1KRSA 3SFDB 2R7ZG 1FCLA 2E2DC 4DKAC 1SXTA 4DAMA 2KT7A 3I5JC 1WOCA 1ZKHA 4FJYA 4S3SA 1YIWA 1BDOA 2MCNB 1AZQA 4DV3L 3RT3B 4CJ1B 1BCPD 2DYOA 2MSED 5C44G 5BYSA 4A3JH 4B3MQ 2X69A 1B8AA 5EKLA 2CWPA 2LFIA 2JEAI 3N1YC 1P1AA 2IW3A 1XCQL 1E3PA 3BVMA 2UUCQ 4GGQA 1Y8NB 5D3IB 4DV7L 2WXGA 3QO2A 5DPWA 5M3FG 1CZGA 4A75A 3AE5B 1WR6E 5C1ZA 4W9EA 4ARIA 4GN4B 1SIFA 1YMHE 2E8GA 2SAKA 2F0OA 4HCSA 1OEYJ 2G9DA 3NHHA 3AFQA 3AH7A 2F4VL 1LM8B 3MHBA 2C9OA 4BBSB 4N8X1 5IP9H 2UXBQ 3O13A 2N8NA 2WXIA 1VQBA 5JJIA 3SK5A 2R7DA 1L7YA 1L1OA 3L2PA 1R4QB 2FUHB 1TY2A 5DPRA 3GE8C 3PPAA 5FLXL 2D3BA 1LGRA 1QUQA 3HOVG 2ZJQA 3S16B 2LEKA 4ANUA 1PDQA 1V8CA 1GPXA 2DNFA 4C3IH 1AARA 2JRIB 2BS4B 2CW0C 2F0PA 4DNRB 1N34L 5CV4A 3H7PB 3QA8A 4LF5Q 4MJSB 2EY6A 5E4XA 1WMHB 2F52A 2WDTB 3P63A 4WIPA 4YTMB 1OXUA 2Z4HA 3KFUA 1EF5A 2R2OA 1D6EC 4RGOS 2YV5A 3VR4A 2XWJB 1KXLA 1V6EA 4M0WB 2JRHA 3C3LA 3ZNHB 1MG8A 2AMCB 2KDEB 4HR7B 2A1AA 5HURA 1K51A 4C3JG 3PCOB 4HRSA 3BZDB 3KUCB 1V1PA 3AB5A 3PO0A 4JI8Q 2JA5H 3FPPA 3ML9A 2HCIA 4Y7NB 2FUG1 1MI2A 3OW7A 1XT9B 5CV5A 3H8HA 4OX9Q 3H0GG 4JGHB 3QB3A 1ESRA 1GG3A 1W3SA 4YSXB 4DV4L 3VA5A 1B53A 2K5NA 1XLQA 4DV0L 1NJIC 1SR3A 1D7QA 1WTWA 4B3RQ 4W9KA 3C8YA 3S2HH 1DM0B 3IRBA 4OZBA 3K59A 3MP9A 2MRPA 5EGTA 2HDEA 5DPSA 2ENBA 1HZ9A 4U673 1W2BA 2IGDA 4DBGA 4LF6Q 2DN8A 3CCSA 1PMRA 3DEOA 4EQNA 3BDCA 2MP2A 4IOIE 1EWHA 1O80A 4YIJA 5AZFA 2EQSA 2Z6KA 1RLFA 4PK1A 2R2QA 3PQIA 3J80L 5G55A 4IO9A 3AEGB 3U4VA 2EYHA 4LNOA 2W54A 1I94Q 2ZTCA 1N8RC 3VDZA 2YEPF 2CH4A 2V3PA 1OTRB 3G6EA 2L83A 3KUDB 1HNXQ 1SYEA 4JI4Q 1WXQA 1PGBA 4EUTA 2JA7B 2KJ6A 3U7DA 3ENEA 3AM9A 1PTOD 1Q8KA 1EWCA 4HKZE 2IGGA 3OAWA 3NS1A 2JXMB 3L9AX 2K01A 1HNZQ 3FMCA 3OPOA 1ONLA 2SEBD 3GE3C 3FDTA 1ASYA 3CW2C 2JVCA 3SR1A 5IGEA 4IFDJ 2Q2TA 1K0SA 3CC7A 1TKYA 1SNOA 1NI2A 1QOBA 1FRDA 4KHZA 3VXWA 1V81A 4FDBA 2BH8A 2NVXH 2Y0SG 4ME3A 1DXMA 1BNZA 1SAPA 1PQSA 3GP7A 4X3UA 3GTPH 4CKCA 1KLVA 3H3VC 3RLFA 2KC2A 1AEXA 1VQCA 3V61A 3B1LX 5JEAG 1L0YB 4H02A 4Z9CB 2QCPX 3OIPA 4ZUIA 2K5DA 1MD2D 4QF4A 2KJHB 3UDIA 1E0ZA 4B0EA 3DVNV 1E1OA 1SYDA 2QGQA 2INCC 5ELEA 5IWAL 3ZO5B 2UUAQ 3AMUA 3U8ZA 2B2VC 3S1QH 3E56A 2K5WA 2LGIA 1YNJD 1E0BA 3GZNI 4DGZA 1HHVA 4FN2A 2IGHA 4NW2A 5AZGA 1YN5A 4BBRH 1FNWA 3K5MA 2KFJA 3WOFA 3TZUA 4OVVA 4DR2L 4JW0A 2K28A 1GKHA 4D2KA 4DR3L 3KF6B 4ZRJA 1KOTA 2K04A 4L63B 4HEDA 4XYOA 1RAXA 3HVDA 2QC8A 4RCOA 2KCNA 1SIJA 1NUCA 1BUVT 1KDAA 3MXPA 2KDIA 1HCZA 5GAGC 2QIEB 1EYAA 2F3WA 1WJ6A 2EDGA 4POFA 1LTSD 4UP7A 3KJOA 3RN9C 3DWQA 4DV5L 3K0YA 2BWFA 2JA5B 1YQ4B 3RN2A 4GXBA 1TKEA 2B2WC 1L4ZB 3LXFA 1C79A 2KHJA 4G0NB 5G5HA 2LGSA 2EOTA 1XD3B 2KLCA 1EY8A 2L11A 3HG9A 4C56C 1FGBD 5JEAH 1U4RA 3R2IA 4LUZA 1C77A 1YEZA 1WI0A 3X3MA 4NAWA 2DNEA 1VQHA 2EYLA 2XGTA 4RAUC 3VFKA 4P73A 1PH6A 3TN2A 5KIXA 4NP5A 1Q3LA 4Q0FA 1UE5A 1PH3A 1BO0A 1WH3A 3R66C 2BOSA 4DFAA 3IFTA 4OELB 1Z9FA 2F0VA 2E2IH 2XK5B 4ITKA 3K81C 2QMTA 1CTMA 2K5PA 4MSMB 2O6VA 2A5HA 2HD3A 1VLBA 1X55A 1N9WA 1B70B 3LX0A 3AE4B 4DV3Q 1MVKA 3DBLB 1C1YB 3K5OA 2RHQB 2WX0A 3B9JA 4KY5A 1Y1WB 1QUQB 1Q1BA 1Y1VH 4QCLA 4LF4Q 1GHJA 3MC0B 4C4VA 1F9JA 2R92B 2GRIA 3PO3G 2E76C 2F0HA 3BYYB 1TQOA 4HN7A 1OQQA 2ON8A 4C3IB 4RF0A 1S4ZA 2BA0A 2G3QB 3RYTA 4YWLA 4DU9A 1A63A 2RA4A 2Z9HA 2H89B 4LWCA 2IO0B 2B2UA 3WWVA 1D3ZA 1GO3E 1KL9A 3NPPA 1I5FA 2OCEA 4CDCC 1SE4A 4MELA 1EYGA 4BY7G 1Z47A 2D5GA 5LXIB 1EF1A 4C7YA 1P8LA 2WXLA 2FBWB 1Y1WH 1E2ZA 2EY5A 4K8IA 4NPNA 3VVWB 3URYA 2NB0A 3T16A 4X6AH 2KD0A 4KI0A 3HOWH 2CH4W 2PMVA 3DOWA 1FL0A 1EQRA 4K6DA 2FMCA 3BVZA 2LRWA 3OG5A 4ZOHC 4G4KA 5A2QE 5M3FH 1C78A 3GTGB 3SK4A 2HHHQ 1XLNA 1DOMA 2UUBQ 3ZJYC 4EEWA 2RGFA 2WB1B 3VYUA 4US9A 3J81c 5L37A 2CJOA 3CC4A 4B3SL 3S17B 4KZ0A 3VR2A 4NKLA 4ZRZA 2K6QA 5IP9G 3CCJA 2E2JB 4KKIA 3CIRB 3NEMA 5EBDA 2MP2B 4PNYA 4A9AA 2KJXA 3EHVA 3QOLA 4OX9L 4MN3A 3JW0X 4OW0A 5ELBA 4LF7Q 5AJ3Q 1QNUA 1SYBA 3PSEB 1E10A 4P71A 2JZ3B 2QDLA 3QOJA 4DV0Q 3JSVB 2C60A 2M1MA 3M3JA 3TEHB 2IX3A 4OGQC 1FXTB 4II3B 3E6ZX 1LT4D 3R93A 1B44D 1XYIA 4A3IH 3A1QB 3LWEA 1WXSA 3N3KB 1NENB 3APFA 1TWGH 3W1BA 4WORA 1FXAA 4UHVA 1F2RI 1PFSA 1PYBA 3VH3B 1VQ7A 2MW5A 2BKFA 1E22A 1AH9A 3K7AB 4AH6A 2O2VB 2QDBA 2RD0A 1SYGA 1I94L 1MSGA 4ZRKA 1WZ0A 1SNQA 1ENAA 5LXHA 1VQAA 3K9OB 4F1SA 4K81A 4GKJQ 1EFWA 3L08A 4F87A 2L3ZA 4HJ9A 1D5XC 3P4QB 1B1ZA 1CHPD 2R3ZA 3W2DA 1CMXB 3HP3A 4FJZA 3AQQA 1L0VB 3DVNU 4XGAB 1MI0A 5M3MG 3UDXA 4KV2A 3PF5A 3MXNB 4DV2Q 3BVGA 2L05A 3RNAC 3ND8A 4U68A 4KHPQ 5FLXE 1SNDA 2K39A 1P9DU 1NR2A 3N6RA 3NELA 3FKIH 1O7YA 4W9JA 1K53A 4KN4C 1ZYRC 5C4XH 2NBWB 1T0YA 4IUMB 3NTHA 3A4SC 3W5VB 4ZQ3A 1J6QA 2PNRC 4GMVA 3ZDTA 4HVBA 1M90C 3RN5A 2WXQA 1YI2A 2L0CA 4JI2Q 1TWCH 4YTNB 4RGTA 3PT2B 4O1NA 2WLBA 2JXXA 3K0XA 2WXFA 3D31A 1JROA 1X3GA 1LQBA 2MJEA 2HT1A 1M1KC 4N8FA 1UNSA 5GAHC 2F0DA 2HE7A 2PTLA 3VRAB 2BCOA 2K52A 3CD6A 5J1ZA 5IWAQ 3ECIA 2F0UA 1XPOA 1HZ6A 3EA6A 2QILA 2FCNA 1HNWL 4FF3A 3TS2A 4OZAA 3OYYA 2N9KA 1I4QA 4RKLA 4PZ6A 2VQFQ 3R3MA 4RHRA 5BO4B 1STBA 4R4TA 3ZNGC 4L23A 1SNPA 2VXWA 4E6IA 3OJ3A 3S2HB 3KLSX 2IY1B 2ZZPB 3T1HL 1P7EA 3B0AA 4GDKB 1MHHE 1XMQL 4A3KH 3Q6BA 5AZHA 4DXAB 1IW7C 1WY8A 1TT2A 1K3BC 4UDUC 3BK1A 4GDKA 3ZNID 3QARA 3AXCA 1VQMA 4JPBW 4NXMQ 4HKQA 2BE5C 4JL9A 4IURA 2K1FA 1WFQA 2JUOA 3WAOA 1LTGD 4TKOB 4AYBG 3BY4B 1SYFA 4KIKB 4BBSH 1BOSA 3MEHA 1J7CA 3CPFA 3F8TA 1XXGA 1PHJA 4A3CH 1WM3A 1ZPSA 1WZ3A 2MHJA 3IFWB 3R7QA 4V0BA 1GAQB 1C4AA 2EELA 1Q7YC 2BPSA 3DUZA 4H44C 2RR9A 5TSSA 2PVOD 1YITA 2MO1A 5I9OA 2B39A 1QT9A 4A3KB 3ML8A 2XTIA 2JWUA 5IYDG 4A90A 1XNQL 3DWAA 2JWZA 5FJ8G 1KHIA 2KWDA 5E6PA 2CR5A 4C3JH 3JYUA 1SE3A 2Z1CA 1E24A 3V2TA 4L5SA 1EM7A 2KYWA 3A9KB 4R3DA 2HDMA 3KOJA 3J7AF 1V49A 1JE4A 4L6TB 1XCTL 3FC4A 4GN3B 4JC0A 4LFBL 2I1KA 3GV6A 1EYDA 2BT6A 4V190 4AWJA 3H0GB 3GTJH 3HUIA 1O7ZA 3HOVH 1T3QA 1R4PB 4IPDA 3QJYA 1MGSA 3GV3A 2KOXA 3GTMH 2LVPA 4ZHOA 2JA9A 1K52A 3HFZB 2JZZA 3APDA 1UEAB 1LTID 2MJ8A 3I8ZA 4BAXA 1EZ8A 3AE1B 1W6KA 2OOBB 3VRBB 3UQBA 2K5VA 3ZQ4A 3I2ZA 1Q12A 3MA2B 5T1GA 3SVMA 5IP7G 1C4QA 1HA6A 4KJNA 2XN9C 1XLPA 1TWFH 4LCDE 3A56A 2O5IC 1HRJA 1A3UA 2F0MA 4MSQB 4JWUC 4A3DG 4MHEA 1KIXA 3OLMD 2F3IA 4A6QA 2KEEA 4DV1Q 2DY7A 2DJFC 1ZUD2 3BIID 3AI5A 1PTOB 3KWVA 1YJ1A 4KDIC 4WJOA 1M4VA 4GDLB 4RHSA 4IWPA 3HKZE 1I42A 3RUZA 3NZSA 4LNKA 1PYSB 3Q3MC 2K25A 4X57B 1XJVA 1NYQA 4A8XC 1X9NA 1R9TH 5J22A 3M3YB 1FIQA 2RMMA 4X3KA 2EYMA 4JI0Q 3HOYG 3DQVA 4C3HG 5I4DA 3I63C 3NK9A 3KH0A 2F03A 5G2NA 4J1MA 2AUJD 2XVSA 3PO3H 4YWMA 2PZUA 2KTRB 4GLAC 2JQRB 3W1SC 3H09A 4GNXA 2V0GA 4QUCA 3LJ3A 3RNFC 1P3QU 2J7QB 2AWOA 1ZP0B 2ZW1A 2LUMA 4IG7B 1CA6A 1PTOH 1NMFA 3CCMA 1QCBD 3PMFA 1CSPA 5ELFA 2EYOA 3A1QA 3W9CB 3KDFB 4DUYQ 3I4MH 1WD1A 4JOIC 4ZCKA 2Z8LA 1XF5L 1WGYA 3QCAA 3H7PA 3ZRCA 3QWZB 4LJOB 3ULLA 1TWGB 1R9TB 3M3YH 1RRBA 1YX6B 3ZNZB 5G5GA 4HIDA 2INNE 1AN8A 4DAVA 3A7AB 4K8JA 5DM63 4A3EG 4OO1H 1Q46A 4FHJA 5DM73 2W3RA 2D9UA 2KJRA 1UZXB 2EY1A 2BKRB 2HCCA 4M00A 3JVZX 1YNND 1RWSA 2GVBA 3CU7A 1Y8PB 2PQEA 4KHVA 3QHTA 4IM0A 4DK3C 1EY5A 2M00A 5FLMG 4HROA 3KYHC 2PW7A 5IT9E 2WXNA 1YBYA 2F0TA 3SE0A 5IT9c 3QAQA 3NBIA 1C4PA 3U50C 3NUCA 1N36Q 2KCCA 4HJ7A 1IBLL 3S15B 1BMLC 5CORA 2DAFA 3WANA 3V05A 2Y5CA 2MUYA 4DR1Q 2EVBA 3Q3JA 5C3EB 2A19A 3SDLC 4P7IA 4L5QA 1TZOA 4S0RA 5FLXc 3TBLD 3VUXA 3DBSA 4EVOA 1V9PA 4A3GG 2NUCA 4ARCA 3KBXA 1R4NI 4K7UA 1D1KA 2EKIA 3FEWX 4IM2A 4JPSA 3VR9B 2K03A 4GNXC 2WP8J 1UWVA 4RCNA 2PW9A 3I4NG 4J3OD 1XTDA 3PIOA 3MTNB 4ZRQA 4A20A 3G7LA 2ONQA 2KMMA 4MGZE 1IKLA 1VMCA 1PH4A 3P2BA 4CHKA 3F2UA 3Q8FA 4AJWA 1A5RA 3T3OA 4X66L 1ILPA 3S16H 3AV8A 3UI2A 1TWHB 5JJLA 1S5FD 2JA6B 2JA8B 3NQTA 2B76B 3PHXB 5C3JB 3AEDB 2PI2A 2QA4A 3I9V1 4DK5A 3TIXA 1QE6A 1QB5D 1L2NA 3J81E 2WIIB 2AQ1B 2CKZB 3IVFA 1KF6B 1OO9B 2BA1A 3PVLA 3P75A 2NVQH 1R7SA 4MTKA 1BCPC 3OTOQ 4BOZB 3VYRA 1YNJC 3FILB 1R4MI 1GUSA 3AEEB 3MZ5A 1A0IA 2KFKA 2BE5D 2WXRA 3HVZA 5E7NA 1V8QA 1TTNA 3ZGZA 1QOGA 1JOOA 1YHBA 2C35B 2KXJA 4JWSC 4P74A 2D62A 3MAQA 2JA8H 2KDMA 2J0MA 2OXPA 3UE1A 4DR4L 4YSYB 4KGRA 2HTME 5AFWA 3RNBC 2I2YA 1T0RC 3U9OA 1DOXA 1ZXIA 5IA7A 1VQEA 1VJKA 3H9DA 3VR8B 5M5YH 4GZYC 5AEKB 4A3BB 1FFUA 1KNAA 1L1OC 4WH4A 4KN7C 3L3OC 5KNCA 1UELA 1S3SG 2MPMA 2N49A 2RCFA 3RNCC 4O0AA 4I6NB 1EU3A 4EOYA 1J5EQ 2DENB 5AUKA 3MXGA 4HTHA 4KK7A 1TIID 5LL6S 2QF7A 3I4LA 4LFAL 3MC8A 4P6VF 3RI7C 2BYVE 2ES2A 4AP4C 1G91A 1G6PA 5EPLA 3UDFA 2WDVB 4DAYA 3D0FA 3PIP3 3OSOA 3VR5A 4W9FA 4CDFC 3IHPC 4WWMA 2QKIC 2JA7H 5IOIA 2Y5BB 5F2DA 3L17A 4JI1Q 1QZEA 5JAVA 1B3AA 3H91A 4WJQA 2KWCA 4EGVA 2GBKA 5IT9L 3BZCA 2VUMG 5DAUA 1QWYA 3CF5A 2WXHA 2NCNA 2X6LA 2C7MB 5FO8B 1VMPA 3KF8A 4A3GB 4KKTA 1F52A 2VH1A 5ELDA 4IKGA 2PYKA 1TU2B 2K5HA 1O7LA 1EL0A 4H13C 2UU9L 1HFNA 2IO1B 4MM3A 4TKNA 1E7UA 1G51A 1SSNA 4C80A 1JT8A 3BU2A 3E0JA 2E74C 1WRIA 4DHJD 1X3PA 4E74A 2IBIB 4GU2A 1AE3A 1I50B 2LJ5A 3PRMB 5FR3A 3M4OB 2K8BA 1VQ4A 2SDFA 2V1CC 1RTNA 1ZDVA 2INDC 4WAFA 1VR9A 2IHFA 2A6ED 2KTRA 3OW2A 4JVZA 1PRTC 3HZXA 4H7BA 2VNUD 5FR6A 2BTEA 1C9FA 2MFIA 3G71A 3ZXVA 1BBXC 4G50A 2OJWA 1ZOYB 2AHOB 3I73A 2NN6H 4MGYE 1X3FA 1WSPA 5M5XH 4FLHA 2D3AA 3BG3A 1NAPA 2JP1A 1B50A 1PGXA 2Z0DB 3VH4B 1NSNS 4IWOA 4NJCA 3I4MB 4BKSA 4PMWA 1AWDA 2ZCCA 2A6HD 2IPKD 1ISNA 2KX3A 4JBJA 4ZDVA 1TZ1A 5NUCA 1F1HA 1V1QA 3NHEB 4K0KQ 1NCVA 2F0GA 4M1UB 2KAJA 2L0TA 1EU4A 2KHIA 1XEEA 3S14H 2LASA 3FRPB 1WTVA 3U4EG 5LHY1 2DZKA 3FVQA 3LGJA 3PTFC 2FCSA 2KBNA 2WB1E 4NB3A 3J7A5 2HTHA 1GJZA 5L83A 4A3BH 3OIQA 1V86A 2CCZA 4EZLA 4LFCL 4DV6L 4UPAA 5C2TB 4X3TA 4HDQA 4XZ4A 3CPWA 2L00B 1SJHD 3EUB2 2IX0A 3ZJUA 1KAAA 1L5PA 5C23A 1C0AA 2VL6A 3IBEA 1U0LA 4IJHA 2Q2HA 3D4RA 4K5VA 3G4SA 3QK0A 2F3VA 1SFOH 5ELNA 1LTBD 2D0OA 1STAA 5IODA 2VUMH 4HJAA 1C48A 1EIHA 5C4HA 4ANWA 2PI2E 3NBHA 2N1VA 3SHLA 4JI7L 3GTPB 3U9SA 5ISRA 2RF4A 2XWBB 4M01A 1C3TA 3ONSA 4TVAB 1TJEA 4DV4Q 1K8GA 2OF1A 3G48A 2B8FA 1N36L 2CHBD 1PRTF 4N58A 1GD7A 3I72A 4LF9L 3S2DH 3I4MG 2TMPA 2KWVB 4C2MB 1Y8RC 5DNFA 1YQ3B 2IO3B 3DBHI 4J8QA 3Q8BA 5C4XG 2LI5A 4EE2A 1NY4A 5D6JB 1UE7A 2L4NA 1X3QA 5IY0A 3CXCA 1SFOB 4I65A 5COYA 1TT5B 4G3XB 4DA2A 2RKSA 3TREA 4DR7Q 1E9MA 2NPTA 1PZJD 5HGQA 4KVGB 2W9NA 2JA6H 3UQAA 4HXDA 1J19A 2B2TC 2NPTB 4KLKA 3DDCB 2N9LA 1BKBA 1Q8IA 2GLSA 4EZJA 4ZYSA 1S5DD 2WWZA 3AE8B 2B2UC 4DUZQ 2GBMA 1GUAB 3U58A 3V96A 1AYFA 1UAPA 2F0FA 2BS2B 1CZWA 4ZUJA 4B95A 2IHEA 2CKHB 3RFZB 2NBVB 3SFEB 5M9OA 2E3TA 1LV9A 1U9RA 4OZCA 1X6OA 2VY3A 2DYBA 3EECA 2K8HA 1TS5A 1UGJA 3UINB 3CP0A 3CQZH 2IX1A 1VCBA 2MGSA 4N9PA 4JV5L 2K7VA 3IKJA 2ZPNA 4WJWA 4EQPA 1MJDA 3NZUA 3LNNA 5CYUA 2CQAA 2WACA 4POGA 4GSWA 3U30A 2KDFB 3PUZA 4A93H 1ENCA 2F0EA 1IBKQ 2LXAA 1H9SA 4ID6A 3W3AA 4IUTA 4DN4M 2KO3A 2MO0A 2JEBI 1NTGA 2QW7A 1ACCA 1K28A 3HKZG 5E6NA 3DVGY 3K58A 3D32A 2CU1A 4IUUA 1JMLA 3DBHB 5LNK1 1GHKA 1CK1A 2A73B 2OHFA 2WP9B 1EQTA 1FR3A 4C3JB 3P42A 1T9HA 2JA5G 3GTMB 1GUOA 2NN6I 3Q8EA 4HJKA 3VA7A 2HD5B 1JRPA 2A8VA 1PUTA 2WGSA 2PNHA 4YXDB 2N9XA 5BN5A 1JRUA 1ET6A 1TS2A 4RFBA 4A3MH 3FKYA 4NXNQ 3H1UA 1CQVA 3N1XC 3MJWA 2N1WA 4C3IG 4NAMA 1TWFB 2NZOA 1XNRQ 2E2IB 2PE9A 2BH2A 3RZFA 3PV0A 4MT5A 5CBAE 3GO5A 3IL8A 3S1NB 1SE2A 3TQYA 1BT0A 1WJJA 1BCPF 1RODA 2L32A 2RSNA 1TKGA 2V3SA 2WYQA 2QEJC 4HPLB 2B2YC 2K50A 4B9XA 1QQRA 3WAMA 3MFYA 1CKNA 1YZ6A 4CDEC 2OJRA 1DCZA 1RIPA 1U5KA 3M62B 5LMNW 1Z6HA 4QB4A 4FXKC 3DBRI 3TP5A 1JICA 2F4VQ 2IZVB 1VQJA 1XMOQ 1EY0A 2J4XA 2L12A 5CTRC 1L0XB 1HTOA 4IZ8A 5IGBA 1BBUA 1QNKA 1LYLA 4ZKCB 4JI5L 1A6XA 1NVID 2FE8A 3AE9B 2LMCB 2E5LQ 5M5WH 4KZCA 3RMKC 3WOEA 1WJ4A 2ZM6L 3KQ4A 1GJXA 2MH7A 2J0JA 1HR0Q 1VCIA 2EKEC 3ZLZA 1WGGA 2WS3B 2MBQA 4YHHL 4AQYQ 2IWHA 4RMFA 2UUAL 2H4OA 3TMEA 5J39A 2A5UA 4FVMA 1KAWA 2ASQA 1MBYA 2PW5A 3T8MA 4ASWC 4BY7B 4ACFA 3ERSX 4LF8L 1AW7A 3A9KA 3S24A 3IAYA 1IXRA 4JCVE 4DR2Q 4MIUA 3EFCA 5CX3A 1A2UA 1HQMC 1D2BA 1WTOA 3AEAB 2WAQE 1WE7A 1SBBB 3VR6A 5M5WB 1C7YA 2J53A 4W9GA 1QILA 2Q5WD 3HIZA 3HEJA 4JI6Q 4DPGA 4JI8L 3AFPA 1VS0A 5FOBB 1VQOA 2YVCA 4LF4L 5D2MB 2MA9B 2RVLA 2BDNA 4A3KG 1YN4A 2XEWA 2ZNVC 3HGBA 4P72A 5JJKA 2CU3A 1DGJA 3AE7B 4RMAA 2E75C 5FKAC 5FO7B 1X1MA 1EIFA 3LDZE 1EUJA 4BBRG 3PREA 1SNMA 1SSOA 2ICEC 3HKSA 3PV1A 3CQZB 4YCVA 2ACZB 3RLOA 1O7IA 3SHQA 2EY2A 4C3HH 3S2AA 3U2SC 4GOCA 4LF6L 4K0KL 2N55A 3ITPA 2BDOA 1IGCA 2BBCA 1IBXB 2YTVA 4ZAIA 4L5RC 2LVOA 4A93B 1PTOC 1ZXTA 3F2DA 4UY8C 4ZYNA 3W1SA 1K8MA 2E6XA 1BXTA 4A3MG 2JYTA 1IBXA 3M9BA 4PZ8A 1JWUD 3AECB 4A3PA 1F0ZA 4DK1A 2JSOA 3WAPA 5HKHA 3APCA 3Q24A 2K75A 2MHVA 2VB2X 4B6WA 1HNXL 1BQQT 2NN6G 2Z6KC 4XC2A 3PF4A 1TGZB 1PH7A 4CYEA 2DX5B 3Q22A 5G3LF 4KGSA 2UUBL 5CV9A 1WI5A 1PH5A 3E9SA 4LNIA 1W6JA 3S9WA 3RLNA 2R61A 3DMUA 5T8IA 1HNZL 1AFPA 4JBMA 3U4ZA 5IGCA 2K8CA 4MDKE 3KYDD 3BDLA 1SGHA 2LWPA 1KRTA 4FXGC 3C1FA 1NMGA 1S5CD 3ZYYX 4X64Q 3A9JB 4NQLB 3K5LA 4B9WA 2B29A 4FF2A 2QCZA 5E3FA 5AJ3L 1CI3M 3CF6E 3AMZA 5LMUL 1EY7A 3PGZA 1P0RA 4A3FG 2G4DB 1A70A 5J17A 3PUXA 3Q0AA 1JE5A 1GOZA 1U4LA 2RSOA 1BUIC 1CKOA 1EWIA 1U4MA 3NP8A 4JE3B 4ODGA 2SNSA 2D3GA 4PZ7A 4AS1A 1F2YA 5BYRA 2DJGC 4WAAA 3TBIB 4OWTB 3M95A 4S17A 5D14A 3DHIC 4CKBA 1X65A 2G1EA 1QOFA 2C7NB 3K57A 2KENA 3HM6X 3CSTA 4XDDA 1EY9A 4FF4A 1T0SC 4REZA 3K5NA 1I6HB 2NBFA 3KK7A 2J42A 4K7SA 2I38A 1KQSA 1L1OB 2Y0SB 1VZ6A 3I56A 3M7GA 5IN7A 1L2FA 5CGKA 2PPHA 2KCMA 4NZLB 4DR3Q 1C8CA 5E1FA 3N52A 1J8IA 3E9IA 2AUKA 4KX6B 2UWQA 1UE1A 3E0EA 3OHXC 2O6VD 3Q23A 1EY4A 1SE8A 2E2HB 4JLCA 1KLUD 1N33L 3TSSA 2LHDA 2LGYA 1E2WA 4EZKA 5I2YA 3QG1A 3K7AH 1LUZA 3WALA 2ZXRA 2NTSA 2O2LD 3KYCD 4F7ZA 1I4XA 3K8AA 3CSFA 5BMGA 1E8WA 5LMNQ 4XWWA 1HZ5A 1I6HH 1BF4A 4MH0E 4JI3L 1ZKOA 1STGA 3RULA 3X23A 5IOCA 2LUEA 3Q2AC 3MVVA 2IO2B 4JYAL 3AU7A 1J8CA 1HFGA 2EYPA 2PMZB 4ME5A 4OWXB 3MJ5A 2MBEA 2K3UA 2N4FA 3N9YC 1NE3A 3D6WA 2XNAC 2JQOA 4BWGB 2R93G 3H6NA 4F7XA 1MJCA 3S1NH 1WGDA 3RMHA 3DXJC 1V43A 2N9PC 5EPKA 2B2TA 4QIWB 3KJPA 3RCZA 3VAWA 5J18A 3CRKC 3GTJB 2N78A 1N61A 1CKNB 1SMYC 2IYDB 1SMYD 4FP5D 2BW2A 2CS4A 2JPHA 3EIVA 4PS7A 3M4OH 1CFMA 3Q8DA 3GTKH 1GNUA 3MXUA 3P4SB 1RFAA 3SD5A 2FCQA 3S2DB 4OIJA 1N6ZA 1JWBD 4NNJB 4W9DA 1UD7A 5JOBA 2R7ZH 2LMCA 1TYGB 3J7AV 1WX7A 2N7DA 4HJ5A 4GLXA 4KHPL 4I7ZC 1D4BA 4KKUA 5FO9B 5JJZA 2G45B 2WU2B 5EPJA 3W1GA 3L16A 1QF6A 1UEBA 2ZTEA 4NJ6A 2ZXPA 1SE9A 1JJGA 2JJQA 2JZPA 3JSVA 4GKKL 1TR5A 3IXSA 4PS3A 4G7OC 3AE2B 1VQ5A 3R2TA 3HOZB 1MG4A 2FXQA 1JOQA 4DQOC 2EXZA 2CW0D 4TV3A 5IKCM 4DR5L 1NEKB 3KDFA 4JI5Q 1F9QA 2HQLA 3WDNA 1E8ZA 1Q81C 1MFWA 2JSVX 1JMCA 2RSUA 4M8MA 2DGYA 4EKUA 4DDID 2HDLA 2BS3B 2JA7G 3C19A 3PO3B 3I4OA 2NS5A 4BOSC 5M3MH 3G6JB 4TRDA 1TBEA 2C5CA 1N5WA 3TEZA 1T5XD 1ZE3D 4YL8A 5C3EG 1PFMA 3E5SA 3SEBA 1GB4A 5C44H 4LF8Q 2BB6A 2INPE 4F8MA 3VTUA 1A8VA 1PH2A 4X65L 2NVTH 2WNMA 2GOWA 5JHBA 2JT4B 4Q5VA 5IYBH 3KUZA 3NS8A 4LW1A 3QX1A 5E6JA 4GDLA 3T56B 1ZXHA 2B63G 2KHWB 5DLQE 5C0XJ 1A15A 1LTLA 5KGUA 2VUMB 3NG0A 1DJRD 1IL8A 4QJFA 2FAZA 1OQRA 4PG3A 5D65A 2WXOA 4CJ2C 4AJYB 1C76A 3NVVA 1UUPA 4LTUA 2A6HC 5LLIA 2CJNA 2PZWA 1TS3A 5C44B 5JEAJ 4GOPA 2ZVOA 1ICWA 4DV1L 2RBMA 1YQBA 1DOIA 3H0GH 1RD9D 2CWAA 4K14A 4HAEA 3I55A 1QVCA 1WTRA 2UXDL 5BR8Q 1B9NA 1VD2A 2H88B 2MJ3A 3IT4B 1FXIA 1I6VC 2RPQA 5CV7A 1TWAH 3N30A 2NVUI 2NVYB 2FFKB 2L55A 3VYSA 5FK9C 1TIFA 3MTSA 4KSLC 4YWGG 1GC6A 2PPBC 1BBWA 3DVGX 4C2MH 2R92G 1SJED 4BBNC 1AP0A 4E3CA 3ULPA 2Q2UA 5A2QL 3GTKB 1WX9A 2FMMA 3B6YA 2PE6B 2WDRB 5CC4A 4I6LB 4IC7B 1LTAD 1JWMD 2D2QA 4ILWA 2FHTA 1YOVB 1TWCB 3DM1A 4A3CG 4IW0A 2DZJA 4NDXA 4B9KA 4XQJA 1T5EA 3JAMc 2REXA 2WV6D 1H95A 3RNEC 1QVGA 3DBRB 2GBJA 5CBEE 5FJ8H 1KM7A 2DAJA 2PEAA 3TEXA 3ZJTA 2O4XA 2NWGA 3GTOH 1F2LA 3CMAA 2PVGC 1ZDXA 1LM0A 3FPUB 2KQ3A 2KNBA 1F77A 4LJZC 2UYZB 5GROA 1FJGQ 3DCGA 4BA2I 2I5MX 1WE6A 5HI1A 2L5TA 4M02A 2KX0A 4IUPA 1OEYA 2AL3A 2UXCQ 4JX1C 5EAYA 5H92C 4TQ1A 4ANXA 1IHZA 4R4IA 2JU6X 1QKZA 2UU7A 4KTAA 4L8JA 1JJCB 2GN5A 3OOCA 2GB1A 2JYEA 1MJEA 3DEPA 3VUWA 1JQYD 2N9EB 3J7ZC 1F9SA 4K6LA 3I7FA 4M8AA 1Y1VB 3I57A 1DD2A 1NYRA 1E2VA 5GADC 1JR0D 4WQOB 4DR1L 3NUHB 1Q1EA 1GUWA 3FP9A 3H6MA 2VQFL 3P1MA 1D8LA 4MGIE 1TXYA 1RTOA 1PA6A 3EC8A 2ZNVB 3HM3A 1MSHA 1N34Q 3QIAA 3Q8CA 1CZPA 3Q3OC 3TP6A 1N32Q 4GS3A 2VZKD 2B2WA 4K5XA 2F4IA 1I4HA 4C3HB 1XWEA 1HR0W 1T0QC 4RWSC 3DPDA 4P1BC 2AKWB 4YCWA 3RZDH 2EZVA 3UI3A 3D4DA 2KTFA 2LVQA 3BYTB 5K5PA 3AN1A 4CO7A 3PZDA 2V4IB 5BN4A 4AUQC 5J3BA 1JQ4A 3IAS1 1R4NB 1WTXA 2LY7A 4Q2JA 2L1BA 1DOYA 3OWFA 1ESFA 5C3EH 4NMZA 1IBMQ 2J52A 2K0PA 2V1YA 4JI3Q 2ZW0A 3CRLC 2F0LA 2EMSA 1PFDA 5GXGB 1ET9A 1VF7A 4PMCA 5C5LA 3GTLB 4JYAQ 1DZ1A 2A68C 1JB3A 1CSQA 2NVYH 3D3RA 3FKIG 1YIJA 3PIPA 4UP9A 4A3EB 3BS1A 4YCUA 4KGTA 1WCMB 2KZRA 2KQSA 4CDDC 1QZHA 5C4ZA 1YJNA 1FCCC 2KMAA 3J9CA 1B9MA 1GM5A 5EE0A 4J6IA 3CCEA 3NVWA 2F0IA 3NXWA 1HTQA 3IAM1 3PRZA 2FIDA 2WAQG 2NTTA 4EQ5A 3ER0A 3ALBA 2IJ0A 3TZDA 4ICVA 3ZUNA 4R8IA 4OO1I 3AEFB 2F0JA 4DR6Q 1V1OA 3GTQB 1UF0A 1GUNA 3HK0A 3A8KE 2A69D 2XIWA 4JI4L 5KRUA 1WMHA 2EJGC 2FIFA 2YLMA 4I6PA 1EY6A 1WCMH 5G3LD 2OT2A 1PV4A 5CMDA 4CBVA 2JE6I 1FRRA 3DBLI 1EWYC 4BBRB 3X0WA 1S72A 4HWIB 1II3A 4FXDA 4B3ML 2X8XX 3J80c 1OXXK 4G57A 3GTOB 5D3DA 2ZEQA 3OMGA 4DR5Q 3B08A 4A55A 1K8OA 4DK6C 3DLLA 2L0FA 3HRDD 1V1PB 4BKGA 4CKEA 4DV7Q 3M4PA 1I4PA 3H94A 2RDGA 3KWLA 4XQQA 5GAEC 3F2BA 1VZ7A 1WGKA 2KUMA 1VQNA 4L2YA 3A4RA 5HHDG 1EIGA 3MXNA 2ZT9C 4FXCA 4N9F4 4HSVA 3BJUA 2Q8RE 3VUYA 2MLBA 4KKSA 1KTKA 3NWTA 3UF8A 1HZAA 2UXBL 3HOZG 5JZEB 1IYFA 4MGKE 5BMIA 2CVRA 1HEZE 1Y8OB 1GUTA 2LSSA 2DZIA 4HK2A 4IUQA 2KOLA 4IQZA 2I5HA 4X65Q 3CWIA 3NBHB 4HCEA 1HZCA 3AULA 1WGHA 5JH5C 5DEHA 2YU9B 4ANVA 2K32A 4GN1A 3QJZA 1STYA 4LF5L 3RZDB 2QSDA 4WFN3 3E3XA 3S1MB 5KNBA 2N88A 2ASBA 1V80A 1V9JA 1GVPA 1Q5WB 4OVZA 2FINB 4KD3A 3SR6A 3PLUA 1E8XA 2HIXA 2RCNA 1UH6A 1FGUA 2OQKA 2ZJDA 3HOXG 3Q6SA 3P20A 1ICFB 1TKWB 2F0SA 3ONAB 3RNUA 1J5EL 1CQFA 2MP1A 2W55A 3MC9A 2K33A 3JAML 3K7UC 3FAHA 2FNJB 3NTIA 3J80i 1XQQA 2AEHA 3SU8X 1EEFD 2PKOA 4YSZB 4RH6A 3T9LA 1HUMA 2UXDQ 3VDYA 3FILA 4FBJB 4AYBE 4HSPA 3GD7A 4DV5Q 5HG2A 3M7NA 3HOWG 1RJTA 3Q14C 4KSKC 3VTWA 2ZXOA 2BGFA 2EYJA 1RCVD 1X3EA 2KFKB 1LT6D 2NYZD 4A3DH 1SROA 1ENFA 1GXDC 4R4OA 1Y69U 4KV6A 4IFDI 1MIUA 4KDLB 1WJUA 4DHZB 2WAQB 4AIMA 2EIFA 1KDBA 3BDOA 3MHZA 4II2B 2GVAA 3RNGC 2WKCA 1G291 4A3FH 3PS6A 2WHIA 4XTCS 5T1IA 1G6ZA 2N0SB 5MPOA 3NJTA 4IDIA 4NJ7A 3T4AC 1Q90A 1WCMG 3N32A 5DPTA 3ZIMA 4LUOA 1KNEA 2ID0A 3NWSA 5H1SE 1ZYRD 2WXKA 1V5TA 2KQ7A 2JXTA 4IOAA 1QJOA 4XT1B 4JBWA 1IW7D 5DCNA 4OONA 5KYLA 1KDCA 2C7HA 3GTGH 3C0RB 3A0JA 5IE8A 2A68D 4PV1C 4A93G 2L52A 5E4WC 3VQIA 1FO4A 4WJ4A 4K2LA 2PLPA 4RF1A 4K1RB 3PRPB 5BN3A 1BR9A 4BA1I 2D10A 2D5DA 2VQEL 2VB3X 3ABVB 3C1EA 2CHXA 1EO6A 4QL5A 1PH8A 4KJOA 2LXJA 4BXXH 1LXDA 2MX2A 2EYFA 4NQKE 2BYFA 3ZTDA 4B3RL 2JYOA 2VZAA 4DAYB 5M5YB 2GBNA 3BINA 1QVFA 5E6OA 4TQ0A 3D4WA 2LKVA 2J0TD 1K3RA 2EMTA 2XRQD 3QWNA 4QGUA 1IP9A 1YD8U 2K1BA 4BBSG 2L8JA 2Y5PA 1F9PA 4Y52H 1JCKB 2K6AA 2KVRA 4XE0A 4DHZE 3ZDMC 1H9MA 3KF8B 1Q82C 5EDSA 2PQAA 3NOBA 4GLVB 2MBBB 2DY8A 3DWMA 3WCQA 1S5BD 2Z4IA 3UDGA 5EE3A 1SLJA 3QQ8B 5HGTA 3CKIB 4J6HA 2NVXB 1WJNA 4XIGS 1N60A 1FNVA 1WTPA 1P7FA 2VH2A 3NVYA 2IY5B 4DV6Q 4LFCQ 3EVQA 5EKKA 1Q0WB 1XO3A 3STBD 3S1RH 2HHHL 4XXEA 2NR2A 3V6CB 2WXPA 2PCFB 1UWXA 1RDPD 4A3EH 2FJ2A 2TSSA 4B3SQ 3R7RA 1RL2A 1WX8A 4QMGA 2R7ZB 2MBOA 3KVFB 3ICEA 1IBML 2KEDA 3GB1A 2B8GA 1STNA 1D5ZC 5I9PA 3J81L 2DYMA 2IY0B 1CA5A 2IT1A 3A74A 4DK0A 3X3NA 3S1QB 4HCPB 1Z7TA 3JAME 1FFVA 3Q3FA 1QZGA 1K8AC 3L0OA 3HOWB 5C3XA 5JVG3 1PGAA 4C4VB 1HPCA 2AX5A 1HTLD 4P2CB 4XDXA 1D1IA 4G7HC 4LF9Q 1OXVA 3M4QA 1I50H 1HJPA 3A7LA 4P1CC 4YT0B 1K83H 4P16A 1PYWD 3KLRA 2F1MA 3GZNB 1IBKL 2I0QA 4FHKA 3AEBB 3T53B 3S17H 4GLSC 2DUDA 4LMQD 4DR7L 2HJ8A 4US8A 1VQ6A 3ZJVA 4PYUA 2WB1G 5M3MB 1S3OA 1SEBD 4KD4A 5IIFA 4QQBX 1OGWA 4DAPA 5I2XA 5C4JB 1WWTA 4HCNB 2IL8A 4LNNA 4BBNF 4BKSD 2ZPYA 1YX5B 1F2ZA 3JC66 2K5QA 2RHSB 2V3NA 1IYUA 3H7SA 3L10B 1LO5D 3EJIA 4DUZL 3VTVA 3M85A 5EBCA 3W1YA 1A2TA 1CUKA 4EFOA 1YN3A 5K36G 2HQEA 3A8IE 2D11A 3H3VI 2NVTB 2ZTDA 1YNTE 2KECA 3TEWA 2OEDA 1XNRL 4BY7H 4GB9A 3S15H 4F88A 3I91A 3WA0A 4H2AA 4XX5A 1HUNA 4JV5Q 5A35A 3NE5B 4MTNA 3PIO3 5IP7H 1VRAB 2I1JA 4DXGA 1TY0A 2RQXA 4TMAB 2F0WA 2MQHA 4LJPB 2LGXA 3CHBD 3HS0C 4OL7A 4QIWE 4GOPC 4RNAA 4A3OA 1JWSD 4HPPA 4IM3A 2A6EC 1FM0D 2LRUA 1UWMA 3TRZA 1Z2MA 3K6OA 3ETRA 4JI2L 2KN4A 3M4YA 4WRDA 4PS8A 3ZXRA 1FYCA 5BYQA 2BYTA 2I46A 1MHXA 2F0QA 4EX5A 5IAAC 2E5LL 1WR1A 1IZ6A 1GB1A 4F8CB 3GQBA 1WYGA 5KEEA 3NSWA 3L7ZC 2FCMA 1HR0L
chains in the Genus database with same CATH topology
1J7BA 3T3NA 1PFBA 1DOKA 4ZK9B 3NVZA 2R6GA 2PZTA 3DHQA 1FEHA 3A8JE 3NQIA 2NVQB 1HA5A 4FF1A 1N62A 3I70A 3VR3A 1Q10A 4NAWB 1B9RA 5CV6A 1XLOA 1YJJA 3S1RB 3SDZA 4DXFA 1VF5C 4XT3B 5M5XB 3KUPA 2H1EA 5JVH3 3PUWA 1AZPA 1VZ8A 1RYJA 2M56B 1JORA 1ZEQX 1OXTA 1FD7D 3D8GA 1FNUA 4B0MA 1SYCA 1KH0A 1ROEA 1KLGD 1QOHA 1L4DB 2IDYA 4KY6A 1H9SB 3R3OA 2YYZA 3S14B 1RKNA 4RKBA 1KFYB 5HFYA 1JOKA 4AQ7A 2M0AA 1CHQD 1S5ED 2DNCA 2X38A 1H9KA 2HUGA 5ELCA 4QUFA 4HJGE 2KA7A 1MPEA 5CR3A 1HQRD 3OWEB 2KACA 3RZOB 1N63A 3P4PB 3T51B 2G9HD 4BY1B 4N9TA 3KLSA 4TQUS 2DLBA 3TDQA 1FD6A 4UAIA 1KABA 1G2TA 3HRZC 4BS9A 3MFGA 1RM6C 2LHEA 3LB8C 1M8AA 1C4CA 1EOTA 2YEPB 1QG7A 4ZKBB 2B2VA 4FO2A 1PDXA 1PZKD 1E7PB 4X3SA 4IN3A 3EROA 4ABNA 1D5MC 4C1NK 2B63B 2RPVA 4K2KA 4JK1C 4RA8A 2M19A 1K50A 4EQOA 1JC7A 3OMCA 2SNMA 2A69C 4RGNA 5JPMC 4K5WA 1TWAB 5EQ0A 1I4GA 5KYIA 3EGRA 1N5XA 3IT6B 2L1AA 2OEOA 2MEKA 4C7ZA 3P7JA 1LACA 3LWUA 5I6WA 2DBYA 2QJLA 3L4PA 2WXJA 4LAAA 3SK6A 4XWTA 3PZ8A 1O78A 5H8YE 1E6EB 4TSSA 3PO2B 1J9OA 1U4PA 3RPFC 2X6GA 1TVXA 4MM3B 4HMJA 4R8NA 4CQNA 3I3CA 2EJFC 3B2GA 1LT5D 1YNNC 1VDVA 4A3MB 3T13A 1STHA 4N59A 2MJDA 4ZHPA 4IUNA 2K05A 1WTQA 3PUYA 2M2LA 4OHJA 1LLRD 5BMHA 2KQ4X 1FMAD 2PO4A 3NRZA 4FYDA 1SNCA 3P1HA 5EJWA 2W3SA 4KKJA 4MH8A 1LTRD 5M3FB 1ILQA 2EE1A 4IALA 3NTKA 2Q8TA 3DWGC 3BWUD 2GI9A 5K36H 3IFDA 1TS4A 1LABA 3C2PA 3W5UB 4DNTB 4G7ZC 3PUVA 4H0LC 4USAA 3RD4A 1WD0A 3NZ3A 3R8BA 1NR4A 1SDFA 1SB3C 1OXSC 1K83B 2RDFA 2EJMA 4XYQA 1HXYD 1G8ZD 5KNDA 1EFID 3A55A 2DWQA 2A74C 1QOAA 1RFKA 3AE6B 2NZ1D 5EE9A 3U52E 5LL6X 3MWYW 2M9VA 3J80E 3LYYA 2BB5A 5IGGA 4AYBB 5D7GA 1XTCD 1QLBB 3KBGA 1A3VA 1PTOF 1V97A 3SXHA 1IKMA 1ML0D 3C46A 3D6CA 4OO1G 3TP7A 2XRSD 3TUOA 1A3TA 5EE1A 2XSCA 1GUGA 3AB9A 3J7YW 2J7ZA 1G2SA 4CGYB 1KRHA 1RHPA 2VZKB 4PMBA 1F2RC 2WQYB 2LS01 4XQNA 3GS2A 4LK0M 2AQ3B 1T6BX 2NMQA 1EQVA 3SK8A 2L9HA 5IGDA 1SF0A 4YTPB 4IUVA 3HOUB 1CT1D 3B2FA 5C0XG 4IFDH 3I4NB 3Q8AA 4ZRPA 4HMIA 2D2CC 2Y3AA 3PZ7A 5EKIA 1EYCA 1Y56A 2I07B 3EQLC 1XX8A 1CM9A 1F9RA 3HOYB 2SOBA 1NI3A 2O5JC 1HTPA 5C5MA 3V3XA 2LJIA 1DOLA 1L6UA 1PXUA 1LT3D 3HOXB 2JX5A 2WINB 1WVLA 2KVMA 4M0WA 5AUIA 4C1NI 1CJEA 2K22A 4WQMA 2WU5B 1BCPB 1PZID 2F0KA 5JPNC 1YJIA 1RF2D 5C4XB 5JXVA 1LTTD 4A3JB 2AWNA 4WURA 3I90A 1J7AA 5C0XH 4IFDG 2WXMA 1L6VA 5CV8A 3A54A 2W82A 5C6AA 4RGMA 4PQXA 2F0NA 1STEA 4PT5A 4KY7A 3HOVB 1PRTD 2PIAA 1OFFA 2WKDA 4ZLTF 4R9WA 2N7JA 1JW9D 5IGFA 4A3IB 3P4RB 2GA4B 1PFNA 5C0XI 2RDHA 2ICIA 1IGDA 2Q8IB 1X32A 1DONA 1B4OA 1H9JA 4CHTB 4B08A 1PLFA 1I7HA 3ND9A 1I4RA 3TP8A 2B2YA 3HKZB 2AQ2B 1I3QB 5I6YA 4CJ0B 3FKIB 4DF7A 1IYVA 2LFNA 4ULLA 3AE3B 3Q69A 4OIKA 4L1BA 2K9XA 4LLGM 2EPBA 3DWPA 1DYQA 2WDQB 4O42A 1PRTB 4LK1C 3ERQA 1B2TA 2R93B 2KHSA 1EZ6A 3TEYA 3U7ZA 4FNFA 1H9RA 4XDCA 5C3WA 4A3FB 4HEA1 1JALA 1JWAD 3VYTA 1IUEA 3BK2A 4KMUC 4A3DB 1EEID 4N6EB 4MACA 2V4DA 1F2MA 1VDZA 3EFXD 3SFDB 1FCLA 2E2DC 1SXTA 4S3SA 1BDOA 1AZQA 4CJ1B 1BCPD 2DYOA 5BYSA 2X69A 5EKLA 2LFIA 2JEAI 2IW3A 1XCQL 3BVMA 1Y8NB 5D3IB 2WXGA 3QO2A 3AE5B 1CZGA 4ARIA 1YMHE 2SAKA 2F0OA 4HCSA 2G9DA 3NHHA 3AH7A 3MHBA 2C9OA 4BBSB 3O13A 3SK5A 1R4QB 1TY2A 5FLXL 3S16B 2LEKA 1PDQA 1V8CA 1GPXA 2BS4B 2CW0C 2F0PA 4DNRB 5CV4A 2EY6A 5E4XA 3P63A 4WIPA 4YTMB 1OXUA 2Z4HA 1D6EC 4RGOS 3VR4A 2XWJB 3C3LA 4HR7B 5HURA 1K51A 4C3JG 4HRSA 3BZDB 1V1PA 3AB5A 3PO0A 3FPPA 2HCIA 4Y7NB 2FUG1 1MI2A 3OW7A 5CV5A 3H8HA 3QB3A 1ESRA 4YSXB 3VA5A 1B53A 1XLQA 1WTWA 3C8YA 1DM0B 4OZBA 3K59A 3MP9A 5EGTA 2HDEA 2ENBA 4U673 2IGDA 2DN8A 1PMRA 3DEOA 4EQNA 3BDCA 4IOIE 1EWHA 1O80A 4YIJA 3J80L 3AEGB 2EYHA 2W54A 2YEPF 2V3PA 2L83A 1SYEA 1WXQA 1PGBA 2JA7B 3AM9A 1PTOD 1EWCA 4HKZE 2IGGA 3NS1A 2JXMB 3L9AX 2K01A 3FMCA 3OPOA 1ONLA 2SEBD 3FDTA 3SR1A 5IGEA 4IFDJ 1TKYA 1SNOA 1QOBA 1FRDA 4KHZA 1DXMA 1BNZA 1SAPA 3GP7A 4X3UA 4CKCA 3H3VC 3RLFA 1AEXA 5JEAG 1L0YB 4Z9CB 2QCPX 3OIPA 4ZUIA 2K5DA 1MD2D 4QF4A 1E0ZA 4B0EA 1SYDA 5ELEA 3AMUA 2B2VC 3E56A 2K5WA 2LGIA 1YNJD 1E0BA 4DGZA 1HHVA 2IGHA 4NW2A 1YN5A 1FNWA 3K5MA 3WOFA 3TZUA 2K28A 4D2KA 2K04A 4L63B 4HEDA 4XYOA 3HVDA 4RCOA 2KCNA 1SIJA 1NUCA 1BUVT 1KDAA 3MXPA 2QIEB 1HCZA 1EYAA 2F3WA 2EDGA 1LTSD 3DWQA 3K0YA 2JA5B 1YQ4B 1TKEA 2B2WC 1L4ZB 3LXFA 1C79A 5G5HA 2EOTA 1EY8A 2L11A 3HG9A 4C56C 1FGBD 5JEAH 1U4RA 3R2IA 1C77A 2WXIA 3X3MA 2DNEA 4RAUC 2EYLA 3TN2A 5KIXA 4NP5A 1Q3LA 4Q0FA 1BO0A 2BOSA 4DFAA 3IFTA 2F0VA 4ITKA 2QMTA 1CTMA 2K5PA 2A5HA 1VLBA 3LX0A 3AE4B 1MVKA 3K5OA 3B9JA 4KY5A 1Y1WB 1Q1BA 4QCLA 1GHJA 3MC0B 2R92B 2GRIA 2E76C 2F0HA 3BYYB 1TQOA 4HN7A 1OQQA 2ON8A 4C3IB 4RF0A 1S4ZA 2BA0A 4DU9A 2RA4A 2H89B 2B2UA 3NPPA 1SE4A 2D5GA 1Z47A 4C7YA 2WXLA 2FBWB 1E2ZA 2EY5A 4K8IA 3URYA 2NB0A 3T16A 4KI0A 2PMVA 4K6DA 2FMCA 3BVZA 4ZOHC 4G4KA 5A2QE 1C78A 3GTGB 3SK4A 1XLNA 1DOMA 2WB1B 3VYUA 4US9A 2CJOA 3S17B 3VR2A 4NKLA 4ZRZA 2E2JB 4KKIA 3CIRB 5EBDA 4PNYA 4A9AA 2KJXA 3QOLA 4MN3A 4OW0A 5ELBA 1QNUA 1SYBA 1E10A 3QOJA 2IX3A 4OGQC 3E6ZX 1LT4D 3R93A 1B44D 1XYIA 3LWEA 1NENB 4WORA 1FXAA 1F2RI 3K7AB 2QDBA 1SYGA 1MSGA 1SNQA 1ENAA 4F87A 1D5XC 3P4QB 1B1ZA 1CHPD 2R3ZA 3W2DA 3HP3A 1L0VB 1MI0A 3BVGA 3ND8A 4U68A 5FLXE 1SNDA 1NR2A 3N6RA 1O7YA 1K53A 4KN4C 1ZYRC 3NTHA 3W5VB 4ZQ3A 2PNRC 2WXQA 2L0CA 4YTNB 4RGTA 4O1NA 2WLBA 2WXFA 3D31A 1JROA 2MJEA 1UNSA 2F0DA 2PTLA 3VRAB 2BCOA 5J1ZA 2F0UA 1HZ6A 3EA6A 2QILA 4FF3A 4OZAA 2N9KA 1I4QA 4RKLA 4RHRA 1STBA 4L23A 1SNPA 2VXWA 4E6IA 3S2HB 3KLSX 1P7EA 4GDKB 1MHHE 1IW7C 1TT2A 4UDUC 3BK1A 4HKQA 2BE5C 4IURA 1LTGD 4TKOB 1SYFA 1BOSA 3MEHA 1J7CA 1XXGA 1ZPSA 4V0BA 1GAQB 1C4AA 2EELA 3DUZA 4H44C 5TSSA 2PVOD 5I9OA 2B39A 1QT9A 4A3KB 2JWUA 4A90A 3DWAA 2KWDA 1SE3A 2Z1CA 3V2TA 4R3DA 1EM7A 2HDMA 3J7AF 1JE4A 4L6TB 1XCTL 3FC4A 3GV6A 1EYDA 2BT6A 4V190 3H0GB 3HUIA 1O7ZA 1T3QA 1R4PB 3QJYA 1MGSA 3GV3A 4ZHOA 1K52A 1UEAB 1LTID 2MJ8A 3I8ZA 1EZ8A 3AE1B 1W6KA 3VRBB 3ZQ4A 1Q12A 3MA2B 5T1GA 3SVMA 1C4QA 1HA6A 4KJNA 2XN9C 1XLPA 3A56A 2O5IC 1HRJA 1A3UA 2F0MA 4JWUC 4MHEA 4A6QA 2KEEA 2DY7A 1ZUD2 3BIID 1PTOB 3KWVA 1M4VA 4GDLB 4RHSA 3RUZA 4A8XC 1NYQA 3M3YB 5J22A 1FIQA 2RMMA 4X3KA 2EYMA 4C3HG 5I4DA 3NK9A 2F03A 4J1MA 2AUJD 2XVSA 2PZUA 2JQRB 3H09A 2V0GA 4QUCA 2AWOA 1ZP0B 2ZW1A 2LUMA 1CA6A 1PTOH 1QCBD 3PMFA 5ELFA 3W9CB 2EYOA 1WD1A 2Z8LA 1XF5L 1R9TB 1TWGB 5G5GA 2INNE 1AN8A 4DAVA 3A7AB 4K8JA 5DM63 4OO1H 5DM73 2W3RA 2D9UA 2EY1A 2HCCA 1YNND 1RWSA 3CU7A 1Y8PB 2PQEA 4KHVA 1EY5A 2M00A 4HROA 2PW7A 5IT9E 2WXNA 2F0TA 3SE0A 3NBIA 1C4PA 3NUCA 2KCCA 3S15B 1BMLC 5CORA 3V05A 2Y5CA 2MUYA 2EVBA 5C3EB 1TZOA 4EVOA 2NUCA 4ARCA 3KBXA 4JPSA 1D1KA 2EKIA 3FEWX 3VR9B 2K03A 2WP8J 4RCNA 2PW9A 4J3OD 4ZRQA 3G7LA 2ONQA 2KMMA 1IKLA 1VMCA 3F2UA 3Q8FA 3T3OA 1ILPA 3AV8A 3UI2A 1TWHB 1S5FD 2JA6B 2JA8B 3NQTA 2B76B 5C3JB 3AEDB 3I9V1 1QE6A 1QB5D 3J81E 2WIIB 2AQ1B 1KF6B 1OO9B 2BA1A 3P75A 1R7SA 1BCPC 3VYRA 1YNJC 3FILB 1GUSA 3AEEB 3MZ5A 2BE5D 2WXRA 3HVZA 1V8QA 3ZGZA 1QOGA 1JOOA 4JWSC 2D62A 3MAQA 2KDMA 2OXPA 4YSYB 4KGRA 2HTME 5AFWA 2I2YA 3U9OA 1DOXA 1ZXIA 1VJKA 3VR8B 4GZYC 4A3BB 1FFUA 1KNAA 4WH4A 4KN7C 3L3OC 5KNCA 2MPMA 1EU3A 5AUKA 3MXGA 4HTHA 4KK7A 1TIID 5LL6S 2QF7A 3I4LA 4P6VF 1G91A 5EPLA 2WDVB 4DAYA 3PIP3 3OSOA 3VR5A 4WWMA 2QKIC 5F2DA 5JAVA 1B3AA 3H91A 4EGVA 5IT9L 5DAUA 1QWYA 2WXHA 2X6LA 5FO8B 1VMPA 3KF8A 4A3GB 4KKTA 5ELDA 4IKGA 2PYKA 1TU2B 1O7LA 1EL0A 4H13C 1HFNA 1SSNA 4C80A 3E0JA 2E74C 1WRIA 1X3PA 1I50B 5FR3A 3M4OB 2SDFA 1RTNA 1ZDVA 4WAFA 1VR9A 2A6ED 1C9FA 1PRTC 3HZXA 4H7BA 2VNUD 2BTEA 1BBXC 1ZOYB 3I73A 2NN6H 1WSPA 3BG3A 1NAPA 2JP1A 1B50A 1PGXA 1NSNS 4NJCA 3I4MB 4PMWA 1AWDA 2A6HD 2IPKD 5NUCA 1NCVA 2F0GA 4M1UB 2KAJA 1EU4A 1XEEA 3U4EG 3FRPB 1WTVA 5LHY1 3FVQA 3OIQA 5C2TB 4X3TA 1SJHD 3EUB2 2IX0A 3ZJUA 1KAAA 1L5PA 4K5VA 3D4RA 2F3VA 1LTBD 1STAA 5IODA 1EIHA 1C48A 5C4HA 3NBHA 3SHLA 3GTPB 3U9SA 5ISRA 2XWBB 1TJEA 2OF1A 2B8FA 2CHBD 1PRTF 4N58A 3I72A 2TMPA 4C2MB 1YQ3B 5DNFA 4J8QA 3Q8BA 4EE2A 2L4NA 1X3QA 1SFOB 4I65A 5COYA 4DA2A 2RKSA 1E9MA 1PZJD 2B2TC 2N9LA 1Q8IA 4ZYSA 1S5DD 3AE8B 2B2UC 3V96A 1AYFA 1UAPA 2F0FA 2BS2B 1CZWA 4ZUJA 3RFZB 3SFEB 5M9OA 2E3TA 1LV9A 1U9RA 4OZCA 1TS5A 1UGJA 2IX1A 2MGSA 4N9PA 2K7VA 3IKJA 4WJWA 4EQPA 3LNNA 5CYUA 2CQAA 2WACA 3PUZA 1ENCA 2F0EA 1H9SA 4ID6A 3W3AA 4IUTA 4DN4M 2JEBI 1ACCA 3K58A 4IUUA 1JMLA 5LNK1 1GHKA 1CK1A 2A73B 2OHFA 2WP9B 1EQTA 1FR3A 4C3JB 3P42A 3GTMB 1GUOA 2NN6I 3Q8EA 3VA7A 1JRPA 1PUTA 4YXDB 5BN5A 1ET6A 1TS2A 4RFBA 1CQVA 4C3IG 4NAMA 1TWFB 2E2IB 3PV0A 4MT5A 5CBAE 3GO5A 3IL8A 3S1NB 1SE2A 1BCPF 1RODA 2L32A 2RSNA 1TKGA 2QEJC 2B2YC 4B9XA 1QQRA 3MFYA 1DCZA 1Z6HA 4QB4A 4FXKC 3TP5A 1JICA 1EY0A 2J4XA 2L12A 1L0XB 4IZ8A 5IGBA 1QNKA 1A6XA 2FE8A 4ZKCB 1NVID 3AE9B 2LMCB 3WOEA 3KQ4A 1GJXA 2MH7A 1VCIA 2WS3B 2IWHA 2H4OA 3TMEA 5J39A 4FVMA 1MBYA 2PW5A 4BY7B 1AW7A 3IAYA 4MIUA 1A2UA 1HQMC 1D2BA 1WTOA 3AEAB 1SBBB 3VR6A 5M5WB 2J53A 1QILA 2Q5WD 3HEJA 5FOBB 2RVLA 2BDNA 1YN4A 3HGBA 2CU3A 1DGJA 3AE7B 2E75C 5FKAC 5FO7B 1SNMA 1SSOA 2ICEC 3CQZB 2ACZB 2EY2A 3U2SC 2N55A 3ITPA 2BDOA 1IGCA 2BBCA 1IBXB 4ZAIA 3W1SA 4A93B 1PTOC 1ZXTA 1K8MA 2E6XA 1BXTA 1IBXA 2JYTA 1JWUD 3AECB 1F0ZA 4DK1A 2JSOA 3Q24A 2MHVA 2VB2X 1BQQT 2NN6G 3Q22A 5G3LF 4KGSA 5CV9A 3E9SA 1W6JA 3S9WA 2R61A 3DMUA 5T8IA 1AFPA 5IGCA 3BDLA 4FXGC 3C1FA 1S5CD 3ZYYX 3K5LA 4B9WA 4FF2A 5E3FA 1CI3M 3AMZA 1EY7A 1A70A 3PUXA 3Q0AA 1GOZA 1U4LA 2RSOA 1BUIC 1U4MA 3NP8A 4JE3B 4ODGA 2SNSA 4AS1A 1F2YA 5BYRA 3TBIB 5D14A 4CKBA 2G1EA 1QOFA 3K57A 4XDDA 1EY9A 4FF4A 4REZA 3K5NA 1I6HB 2NBFA 3KK7A 2J42A 2I38A 2Y0SB 1VZ6A 3M7GA 5CGKA 4NZLB 1C8CA 5E1FA 3N52A 1J8IA 2AUKA 4KX6B 3OHXC 3Q23A 1EY4A 2E2HB 1KLUD 3TSSA 2LHDA 1E2WA 5I2YA 3QG1A 2O2LD 2NTSA 2ZXRA 1I4XA 5BMGA 4XWWA 1HZ5A 1BF4A 1ZKOA 1STGA 5IOCA 3MVVA 3AU7A 1HFGA 2EYPA 2PMZB 4ME5A 3MJ5A 2K3UA 3N9YC 3D6WA 2XNAC 4BWGB 4F7XA 3RMHA 3DXJC 1V43A 5EPKA 4QIWB 2B2TA 3CRKC 3GTJB 1N61A 1SMYC 1SMYD 4FP5D 2BW2A 1CFMA 3MXUA 3P4SB 3S2DB 4OIJA 1JWBD 5JOBA 2LMCA 1TYGB 3J7AV 4I7ZC 1D4BA 4KKUA 5FO9B 5JJZA 2WU2B 5EPJA 1QF6A 2ZXPA 2JZPA 1TR5A 3IXSA 4G7OC 3AE2B 3R2TA 3HOZB 1JOQA 4DQOC 2EXZA 2CW0D 1NEKB 1F9QA 3WDNA 2JSVX 2HDLA 2BS3B 3PO3B 3G6JB 4TRDA 2C5CA 1N5WA 3TEZA 1T5XD 1ZE3D 1PFMA 3E5SA 3SEBA 1GB4A 2BB6A 2INPE 4F8MA 2WNMA 4Q5VA 5E6JA 3T56B 1ZXHA 5C0XJ 1A15A 5KGUA 2VUMB 1DJRD 1IL8A 1OQRA 5D65A 2WXOA 4CJ2C 1C76A 3NVVA 1UUPA 4LTUA 2A6HC 2CJNA 2PZWA 1TS3A 5C44B 5JEAJ 1ICWA 2RBMA 1DOIA 1RD9D 4K14A 4HAEA 2H88B 1WTRA 2MJ3A 1B9NA 3IT4B 1FXIA 1I6VC 5CV7A 2NVYB 2FFKB 2L55A 3VYSA 5FK9C 3MTSA 4YWGG 2PPBC 1SJED 1AP0A 5A2QL 3GTKB 2WDRB 2FMMA 5CC4A 1LTAD 1JWMD 2FHTA 4ILWA 1TWCB 3DM1A 4NDXA 4XQJA 1T5EA 2WV6D 5CBEE 3ZJTA 3TEXA 2O4XA 2NWGA 2PVGC 1F2LA 1ZDXA 3FPUB 2KQ3A 1F77A 4LJZC 4BA2I 5HI1A 2L5TA 4IUPA 4JX1C 5H92C 4TQ1A 1IHZA 2JU6X 1QKZA 4KTAA 4L8JA 3OOCA 2GB1A 2JYEA 3DEPA 1JQYD 1F9SA 4K6LA 4M8AA 1Y1VB 3I57A 1DD2A 1NYRA 1E2VA 1JR0D 3NUHB 1Q1EA 1GUWA 3H6MA 3P1MA 1RTOA 1MSHA 3QIAA 3Q8CA 1CZPA 3TP6A 2VZKD 2B2WA 4K5XA 2F4IA 1I4HA 4C3HB 1XWEA 4RWSC 2EZVA 3UI3A 3D4DA 3BYTB 5K5PA 3AN1A 2V4IB 5BN4A 1JQ4A 3IAS1 4Q2JA 1WTXA 2LY7A 1DOYA 2L1BA 3OWFA 1ESFA 2J52A 4NMZA 2K0PA 2ZW0A 3CRLC 2F0LA 5GXGB 1PFDA 1ET9A 1VF7A 4PMCA 3GTLB 5C5LA 1DZ1A 2A68C 1JB3A 3D3RA 4A3EB 3BS1A 4KGTA 1WCMB 5C4ZA 1FCCC 3J9CA 1B9MA 5EE0A 3NVWA 2F0IA 3NXWA 3IAM1 2NTTA 2IJ0A 3TZDA 4R8IA 4OO1I 3AEFB 2F0JA 1V1OA 3GTQB 1GUNA 3A8KE 2A69D 2XIWA 5KRUA 2EJGC 1EY6A 5G3LD 2OT2A 5CMDA 4CBVA 2JE6I 1FRRA 1EWYC 4BBRB 1II3A 4FXDA 1OXXK 4G57A 3GTOB 5D3DA 3OMGA 4A55A 1K8OA 3HRDD 1V1PB 4CKEA 1I4PA 3H94A 2RDGA 3KWLA 4XQQA 1VZ7A 1WGKA 4L2YA 5HHDG 2KUMA 1EIGA 3MXNA 2ZT9C 4FXCA 4HSVA 2Q8RE 4KKSA 1KTKA 3NWTA 5BMIA 2CVRA 1HEZE 1Y8OB 1GUTA 2KOLA 4IUQA 4IQZA 3CWIA 4HCEA 5DEHA 2YU9B 2K32A 1STYA 3RZDB 2QSDA 4WFN3 3S1MB 5KNBA 2N88A 4OVZA 3SR6A 2FINB 4KD3A 3Q6SA 3P20A 1TKWB 2F0SA 3ONAB 1CQFA 2MP1A 2W55A 2K33A 3JAML 3FAHA 3NTIA 1EEFD 2PKOA 4YSZB 4RH6A 1HUMA 3FILA 4HSPA 3GD7A 5HG2A 3M7NA 1RJTA 2ZXOA 2EYJA 1RCVD 1LT6D 2NYZD 1ENFA 1GXDC 1Y69U 4IFDI 4KV6A 2WAQB 3MHZA 3BDOA 1KDBA 2WKCA 1G291 4XTCS 5T1IA 1G6ZA 2N0SB 5MPOA 4IDIA 3T4AC 1Q90A 1KNEA 2ID0A 3NWSA 2WXKA 1ZYRD 2JXTA 1QJOA 4XT1B 4JBWA 1IW7D 5KYLA 1KDCA 3VQIA 2A68D 4PV1C 2L52A 5E4WC 1FO4A 2PLPA 4K2LA 4RF1A 5BN3A 1BR9A 4BA1I 2D5DA 2VB3X 3ABVB 3C1EA 4KJOA 2EYFA 2JYOA 5M5YB 4TQ0A 3D4WA 2LKVA 2J0TD 2XRQD 3QWNA 2K1BA 2Y5PA 1F9PA 1JCKB 2K6AA 4XE0A 1H9MA 2DY8A 3DWMA 3WCQA 1S5BD 2Z4IA 5EE3A 5HGTA 3CKIB 4J6HA 2NVXB 4XIGS 1N60A 1FNVA 1WTPA 1P7FA 3NVYA 3EVQA 5EKKA 1XO3A 4XXEA 2WXPA 2PCFB 1UWXA 1RDPD 2FJ2A 2TSSA 4QMGA 2R7ZB 2KEDA 3GB1A 2B8GA 1STNA 1D5ZC 5I9PA 3J81L 2DYMA 1CA5A 2IT1A 4DK0A 3X3NA 3S1QB 1Z7TA 3JAME 1FFVA 3HOWB 5C3XA 5JVG3 1PGAA 1HPCA 2AX5A 1HTLD 4P2CB 4XDXA 1D1IA 4G7HC 1OXVA 3A7LA 4YT0B 4P16A 1PYWD 3KLRA 2F1MA 3AEBB 3T53B 4GLSC