1JWMD

Crystal structure of the complex of the mhc class ii molecule hla-dr1(ha peptide 306-318) with the superantigen sec3
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
232
Chain Sequence
b'ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural, energetic, and functional analysis of a protein-protein interface at distinct stages of affinity maturation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jwmD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jwmD02
1PRTC 1TY2A 1I4HA 3DWAA 1LTSD 1JWUD 3DWQA 1AN8A 3BZDB 1SEBD 5ELFA 1I4PA 5I4DA 1V1PB 1ET9A 1JQYD 5ELDA 1LT6D 2XNAC 2G9HD 2QEJC 4RGNA 1B44D 3MFGA 4OHJA 1PZID 1TS4A 1EEFD 2R61A 1HQRD 1BCPF 2NTTA 4DXGA 1PTOD 1FNVA 1PRTD 2XN9C 3OWEB 1TS5A 1BCPD 4ZYSA 2NTSA 1LTBD 1L0XB 3DWPA 1TS2A 1BCPB 1RF2D 1I4GA 1PYWD 1EU3A 1V1PA 1EWCA 1FGBD 2RDHA 3URYA 1RD9D 1SJED 1KLUD 1D5ZC 1GOZA 2IPKD 1JCKB 4RFBA 4RGTA 4RGOS 1DYQA 1L0YB 2XRSD 1FNUA 4O1NA 5D3IB 4RHSA 1LT5D 5ELBA 1KTKA 1LT3D 1D6EC 4RH6A 5D3DA 1SE3A 1XTCD 1FNWA 1PTOF 1JWSD 1QILA 2AQ3B 1PRTF 1CQVA 1UUPA 1EFID 1I4RA 1S5FD 1ENFA 1HTLD 3MC0B 1DJRD 1UNSA 4L6TB 2ICIA 4RCOA 5FKAC 4NZLB 1FD7D 1STEA 1D5XC 4UDUC 2IJ0A 1CHQD 1D5MC 1PTOB 5TSSA 1ESFA 1PRTB 1V1OA 2QILA 1SE4A 1TY0A 3R2IA 1EU4A 1LTTD 1AW7A 2AQ2B 1PZKD 4RHRA 1B1ZA 3BVGA 1F77A 3SEBA 4BWGB 4RGMA 2RDGA 4L63B 5ELEA 1EEID 2SEBD 3V05A 3O13A 1G8ZD 1ET6A 3TSSA 1PTOH 1I4XA 2WV6D 1SXTA 1S5CD 3BYYB 1YN3A 1S5DD 2CHBD 1YN5A 1BXTA 1HXYD 3EFXD 1LTGD 1BCPC 1LLRD 1LT4D 1RCVD 3W2DA 2TSSA 1JR0D 1YN4A 1S5BD 1T5XD 3KLSX 1KLGD 2O2LD 3BVMA 1SE2A 1CK1A 2AQ1B 1LTAD 2J4XA 3EA6A 1XXGA 3BYTB 1S5ED 4DXFA 1RDPD 5FK9C 1PZJD 1MD2D 3GP7A 1CT1D 1LTID 2XRQD 1TS3A 5ELCA 3R2TA 1JWMD 1CHPD 1I4QA 3BVZA 4TSSA 1HA5A 4K6LA 4C56C 2Z8LA 1M4VA 1LO5D 4Z9CB 3R8BA 1LTRD 3CHBD 1SJHD 1SBBB 1PTOC
chains in the Genus database with same CATH superfamily
1VQPA 3DWAA 4CQNA 2DX5B 3NHHA 3VYUA 1GPXA 1EUVB 1Y56A 2JYEA 2MP2A 1DONA 5IO9A 1YNJD 1B50A 4W9CA 2FIFA 2CWPA 2GBJA 4MT5A 4LJOB 3KLRA 4M02A 2KEEA 1D1KA 4R4OA 3PPAA 4IPDA 5IP9G 1JB7A 3CW2C 3FVQA 1IBKQ 2WXFA 1WTQA 1BCPF 3WAPA 1TZOA 4LF7Q 3A33B 2B2WC 5T1IA 2Y0SB 2E2IH 5EE9A 2PE9A 1LM8B 3UI3A 1B8AA 3B9JA 1STNA 2F0VA 5CV7A 1UE5A 2MEKA 1HZBA 3NE5B 2NTSA 4GLVB 3KOJA 1SR3A 3AEDB 3PLUA 1QOHA 2FUHB 2K5DA 3CSTA 3I4MH 5M5WH 4HRSA 5C0XG 1KQSA 3DWMA 3I2ZA 1OQYA 3CD6A 1E22A 3F2BA 4J15A 1UAPA 4HK2A 3IKJA 3I5JC 3T51B 3I72A 4OWTB 3U4ZA 2JVCA 2WACA 4MGIE 1I42A 1EYAA 2WDVB 3NBHA 2A74C 3GE3C 4MEMA 3H7PB 5LMNW 1Q7YC 3DHIC 4YIJA 1I6VC 1ONLA 1X3EA 5KRUA 1VR9A 2LXCA 2ICIA 3NTIA 1FD7D 4CDEC 1T3QA 2LY7A 5CMDA 3MAQA 3H3VH 2B76B 3LWUA 2KDEB 1CHQD 4JV5Q 4K5VA 1BUIC 2FCNA 1N34L 2Z6KC 1V1OA 1QOBA 2WXRA 3BK2A 3SXHA 2KJ6A 1QUQA 3TQYA 2KCNA 1EU4A 4TQ1A 3B08A 1NEKB 2EJMA 1DGJA 3BDLA 3R3OA 1WFYA 2KBNA 2EOTA 5KIXA 3CWIA 1WCMH 3EIVA 5M3MH 2XGTA 3TUOA 1I94L 1EO6A 4KKIA 2MHVA 3O13A 1OXTA 2B2VC 4EUTA 3TZUA 2CU3A 1XCTL 4BBNC 1DZ1A 1JC7A 2BF8B 3J80L 1SXTA 3TBIB 3IL8A 5G5GA 4P71A 3S1RB 2KLCA 2G5DA 3NTKA 1ZE3D 2G4DB 2XWJB 2Z4IA 3TP5A 2ATWA 2HDEA 3S1MH 2JK8A 2E5LL 1XT9B 4K0KL 4K8IA 5IYDG 2DZKA 2R92H 3W2DA 1KH0A 2HE7A 4W9DA 2VQFL 2AHOB 3AEFB 4MACA 2M0XA 3KLSX 1KRHA 3L54A 1VJKA 1RM6C 1P1AA 2AL6A 3Q8BA 5J18A 2JA5B 4QUFA 4QL5A 4YHHL 3FILA 4JBJA 4GNXC 4F8CB 1YJ1A 4AWJA 2YU9B 2INCC 4OW0A 4RM9A 3HOWG 2B2TC 2BS2B 2VH2A 3OJ4B 5C1ZA 3VDZA 1JWMD 1BKBA 5IODA 1XCQL 4FXDA 1VQ4A 2EE1A 2QIEB 3JW0X 4EOYA 3PGEA 1YNND 4MSQB 1PTOC 1R4NI 5AUKA 3AE2B 2K22A 1Y1VG 2ZTDA 1E9MA 4DV5Q 2BDOA 4FF3A 3CCRA 2C7MB 5JPNC 1F0ZA 2IGHA 5EDSA 2ENBA 1AARA 2IL8A 2F0MA 4B08A 5HGTA 4HJ7A 1YEZA 2KACA 4OIJA 4DR2L 3RT3B 4A93H 1J0GA 2CKZB 2G9DA 2HTHA 3I91A 4R9WA 2JZPA 1WMHA 1H9KA 3R7RA 4KSKC 4ZDVA 2RDFA 4OVVA 5BMHA 1Q46A 1HQRD 5GADC 4X64Q 1DOIA 4NDXA 1KDCA 4IM2A 4XWWA 5EE3A 1A15A 5GROA 3ZNGC 4DHJB 3PZ7A 1X1MA 1E1TA 1Q90A 2VUMB 5HKHA 2HCCA 4XDCA 1KABA 1GB1A 4MM3A 5HI1A 1AZQA 2K5HA 3DEOA 2KWDA 3LJ3A 2B2UC 1EIGA 1UZXB 1WX7A 2RSNA 4EQPA 3JSVB 4JBMA 4OZCA 3DQVA 1WR6E 1S4ZA 2HJ1A 2F3VA 3A8JE 1IKLA 2R7ZH 5IP7G 4A3KH 2M00A 1O80A 3KDFA 2JSVX 3Q69A 2EYFA 3OTOQ 3TEZA 5D3DA 4HROA 3KF8B 3T56B 1WZ0A 1YJIA 3SFDB 1V5OA 3U7ZA 3KK7A 3PSIA 4WWNA 4LF9L 1EFID 1A62A 3WCQA 2GBRA 4NZLB 3I4NG 3P4PB 1D5XC 4HCEA 1V8QA 3U9OA 1R4QB 4HLEA 2IWHA 3WA0A 4CHTB 2N4FA 4WQMA 2DUDA 2JX5A 5FJ8H 3IT6B 4KJNA 4MGZE 1IP9A 2RKSA 1YX6B 1L1OB 1F2MA 3GTPB 1NR4A 3VYSA 4GOPC 1WTVA 5C3XA 4X57B 1U4AA 4RGMA 1PFMA 2RPQA 4RG1A 1VZ7A 4EX5A 2M8SA 1EEID 3HFZB 4FJZA 3K5NA 4B0MA 4QAYA 2I0QA 1WJ6A 2IX0A 2WQYB 4FJVB 1ESRA 5BYQA 2L55A 2F0NA 4FDBA 5CHVC 2E3TA 3CF5A 3HHMA 3WOFA 2VB3X 1LTGD 2OWOA 5A2QE 1BCPC 5H1SE 2I5MX 5C4ZA 2BVCA 1TWHB 4MJSB 4RKLA 2JPHA 1PMRA 4KI0A 2JE6I 4A3EG 2J4XA 4DXFA 2BOSA 4P72A 4RMAA 2D62A 2J0TD 1CQFA 3UIOB 1ILPA 1C78A 2W3RA 1ROEA 3NEMA 1VF5C 4QIWE 3KH0A 1R4PB 2BB6A 4B95A 2B2WA 5E1FA 2PZTA 2YTYA 3MA2B 3ZO5B 2B8FA 3ZQ4A 1N34Q 4N59A 2D10A 3STBD 1P7EA 2C5LC 2JQRB 1YHQA 1X6OA 3NELA 2JA5H 3H3VI 2F4IA 5G3LD 3V96A 5JVG3 3P2BA 4HVBA 4BY7H 3APCA 1JWUD 3TREA 1KDAA 1AN8A 4DR1L 2DZJA 4FADA 1UH6A 2F0PA 1I94Q 3J81j 4A8XC 4CDFC 3QIAA 1XYIA 4B9KA 1TJEA 1VQIA 1KNAA 4IFDG 1H95A 1HFNA 4DAMA 3C2PA 2DNCA 1LGRA 4S0RA 1I35A 3A5ZB 1TWFB 1WTHA 2OXPA 1GKHA 1PFDA 3M7GA 2ICEC 2KZRA 1HTPA 2F03A 2E5LQ 1NDDA 4GKJL 4K0KQ 2LVPA 3DBLI 3HVDA 4GOCA 4MTNA 1QNKA 1PDQA 4JCVE 2VQFQ 3P4RB 4OX9L 1F2RC 2MCNB 2G4SA 3HK0A 4DBGA 2PNHA 3NVVA 1AE3A 3I8ZA 4AOFA 4YHHQ 1TGZB 1EU3A 2FMMA 1RD9D 4MSMB 2HIXA 5D94A 3B6YA 1CI3M 1GOZA 2NB0A 4FF2A 2J7QB 3TIXA 3S15B 2RVLA 2D5DA 4ZQ3A 3VR6A 2N9KA 3PUXA 3ENEA 2A73B 1WVLA 3BZKA 2CQAA 3LYYA 2QJLA 3QG1A 5KNCA 2ACZB 1LT3D 2VUMH 2BH8A 1G6ZA 2B2VA 3NTHA 4ZHPA 4NPNA 4A3IG 4DV1L 4ZK9B 4DA2A 3A8IE 1YJWA 1HTLD 2XK5A 2WHIA 3BDCA 4BY1G 5JVH3 3HOUB 5ELOA 3T9LA 1CUKA 1PQSA 1HNXL 1K8GA 1ESFA 3CP0A 2KWUB 3VFKA 1SE4A 4HPPA 1G291 3Q6SA 1CZWA 1AW7A 3K6OA 3WAOA 2PZWA 1MJDA 3ZJTA 1QCBD 5JEAG 3JAMi 2LFNA 1QJOA 3ULJA 4DR2Q 1ZXIA 1V97A 1BNZA 5BYRA 3CF6E 4DNTB 3IG3A 4DU9A 1Y1VB 2HDMA 3U58A 2RDGA 1C9FA 2RGFA 5ELEA 3AULA 4A3MB 5L95C 2EYMA 4OONA 4PQXA 3PT2B 4U673 4K1RB 1C4QA 3NVYA 1YQ4B 4CO7A 1XPOA 3HIZA 3L16A 4A3OA 4B3TL 4RKBA 3ALBA 2V1CC 2VRRB 1EY5A 3AMUA 2UUAL 1ACCA 2WLBA 3VUXA 2YTXA 3WANA 3PIPA 3ZXVA 2GI9A 3PUVA 4ZOHC 2B63H 4DFAA 2R7DA 4PS8A 3U7DA 2GLSA 3EA6A 3E9HA 4C3IG 4DR5L 3OWFA 3GQBA 3H91A 4J6HA 2K9XA 2LZ6A 4JL9A 4Q2JA 3T1HL 2B2YA 5EGTA 3DHQA 3TP8A 2ES2A 3DVNV 3TL5A 4LF9Q 2QA4A 4DHJD 1HR0L 3BVZA 4Y7NB 2PJHA 4K6LA 3TZDA 1IGCA 4JI1Q 1EWIA 3H0GG 1F9QA 1TWHH 3LGJA 1KXLA 1E8XA 3N30A 2M2LA 5JOBA 4DUYL 3Q3FA 2WXIA 1NY4A 3VYTA 4JG2A 4US8A 3MJ5A 3M62B 4DAYB 3RPFC 4LUOA 3NJTA 1A2UA 4G11A 1GXDC 1N36L 2NVUI 4KHZA 5ISRA 5D7GA 3CCQA 1KC8C 3I4NB 1KJTA 4ANWA 4DAVA 4F8MA 3OIQA 4C7YA 2CR5A 4XX5A 1IYFA 1WRDB 2MJDA 4JLCA 1E8YA 5IY0A 1FO4A 4MGYE 4IWQA 4L2YA 4BBSG 1A70A 1PHJA 1EEFD 3GTJH 1X54A 4UP7A 5AFWA 3BS1A 3W5VB 1C48A 1XWEA 4YWKA 4K2KA 3K80C 2XBBC 1JMCA 2IDYA 1F9SA 5DPRA 4NQKE 2ZT9C 4GN4B 1JJ2A 3EHVA 1BCPD 1Y1WB 4JGHB 2HDLA 3A7LA 4LFBL 3HEJA 1TTNA 1L0XB 2LMCA 2NYZD 4FXCA 3S14B 1VQNA 5FLMH 2ZJRA 2Q2TA 2PW9A 1N5WA 3S16H 4XC2A 4WJWA 4JQWC 1SNOA 4DR7L 2OJWA 1JCKB 4RGTA 3IFWB 2V4IB 1F9RA 5FO8B 1FMAD 2JA8B 2PYKA 4RNAA 4R4TA 4A3EB 3HOYH 3C3LA 2KFJA 3C46A 4O0AA 1KOTA 5BMGA 3N1XC 1SGHA 3EGRA 5EKIA 1B70B 3M4YA 1ENFA 2KJXA 2JJQA 3IT4B 4XYOA 2L00B 2K52A 2EY5A 4QIWB 1B53A 5IGEA 4DR1Q 1E2VA 1CKNB 2QW7A 3S15H 1JJGA 1DOKA 2L0TA 3EC8A 3ZLZA 1E0ZA 1MSGA 4A3JG 4GKKL 3AI5A 4LTUA 4M0WA 1E7VA 2MP2B 1ZUD2 2Q8RE 3RCZA 2JA7G 1WXMA 4AJWA 4DHZE 4KGTA 3F8TA 2R93H 1S1QB 3PHXB 2IY1B 4Y52H 3BDOA 3K7UC 3HOUH 2MH7A 4GKJQ 2NS5A 1V2YA 1C9OA 4KLKA 3S2DB 1GHJA 3VAWA 1EQVA 4OX9Q 2FE8A 1TKYA 4KDIC 2CHBD 2RA4A 4R8IA 1TT5B 3P4QB 4H0LC 3A4RA 4G50A 3T16A 2VZAA 2RF4A 4A3GH 1LLRD 1HZ5A 5HG2A 2DZMA 2ZZPB 1MFWA 1EQTA 2UXDQ 4POFA 4C3JH 1MPEA 2DJGC 5CC4A 4MTKA 4A3MH 4WJ4A 2DAJA 4JWUC 1KNEA 5HURA 2PPBC 1TXYA 5JJIA 1TBEA 1IKMA 4HJ8A 4A93G 1UBIA 4J8QA 1LFDA 3V62A 3HM6X 2J0MA 4KVGB 1WTPA 4BBRB 1YNJC 1GUNA 1GG3A 1KLVA 4R8NA 2A68D 5EKLA 4J6IA 3H6MA 3SD5A 3L13A 4YWLA 2Z8LA 4YSYB 4XQNA 5EBCA 1OXVA 2AUJD 5C44B 2C7HA 3VA7A 1TWAH 2IO1B 4CYEA 3NXWA 1FXTB 2EYHA 3ZUNA 1GNUA 1Z5SB 2I1KA 2K0PA 1PH2A 4LJPB 2Y5PA 4HCSA 4ANVA 1QUQB 2BDNA 3W1SC 2A6ED 3KF6A 1HCZA 2WS3B 4FF4A 5H92C 1SEBD 2FHTA 4IDIA 3TBLD 1HZAA 1ET9A 2N88A 5ELDA 4HJ5A 1PH6A 3M4OB 2HJ8A 1J8IA 4UHVA 3PF5A 2NVXB 1WIAA 2H1EA 4B3TQ 1K9MC 1TU2B 3Q8AA 5E6JA 2UUAQ 1UWXA 3ZW3A 2G45B 2N49A 5KGUA 3ZJYC 1L5PA 5G3LF 4BXXH 3P1MA 1I3QH 5DPSA 3BJUA 1OQQA 4DK6C 1XLNA 1WJNA 2LUMA 4DR5Q 3HKZG 5D2MB 4XT1B 3DLLA 4XWTA 3QJYA 3T1HQ 5I6WA 2BW2A 5E3FA 1T6BX 2IPKD 3EN2A 3FEWX 3KUPA 3R7QA 3FILB 4L5SA 2XRSD 1Y8PB 4A3LG 1UGJA 1D4BA 3H9DA 1HR0Q 4RHSA 5IT9c 1EFWA 4NW2A 1DD2A 1WRIA 1B9NA 1VCIA 4C3IB 4XE0A 3BG3A 1U4MA 3U50C 3V2TA 4JI3L 1B3QA 3NS1A 4DUYQ 4HJKA 3RD4A 1FGUA 4NB3A 5C3EH 5AUIA 1GUGA 4I6PA 3CCVA 4WURA 1X3PA 2Z6BA 3TMEA 2EYJA 4IC7B 1OXSC 1N36Q 4HDQA 3FPUB 2NPTA 1VQKA 1WZ3A 3H0GB 2JA8H 1SYFA 2GVAA 4IUQA 2LJIA 3AH7A 2PQAA 4C3HB 4WWPA 1SFOB 1GC7A 5IT9L 4HKQA 4JI0L 3K7AB 1EY8A 3MTNB 3S1NH 2KA7A 5COYA 2PVGC 2WX1A 1WXSA 1U4PA 2IO3B 2K1FA 1Y69U 1D1IA 1JJCB 1PV4A 3IFTA 4FNFA 2E2HB 1CJEA 1MHXA 2BWFA 3D32A 4BA1I 1WMHB 4DDID 2OEDA 1VQMA 3AE3B 2DBYA 3I55A 1I4XA 3VR4A 2WKCA 4LFBQ 2KT7A 5JJLA 4J3OD 3RZWC 2BQQA 3GZNB 4XTCS 1YN5A 1STYA 3CRKC 1QVCA 1X3QA 4E6IA 1YNNC 4MM3B 1WF9A 4DNRB 1FL0A 3J81c 4W9EA 4DR7Q 1T5XD 4YXDB 2ZNVC 2KVRA 4LF4L 2EYLA 1CZPA 3RNCC 1YITA 3HOXG 1FPYA 5K36H 1VQAA 2I5LX 3M9BA 3KDFB 1WXAA 2N7EA 4KHVA 1JWBD 2KHJA 4PZ8A 3PO3G 3I9V1 5AZHA 4KJOA 4LUVA 3KW5B 2W54A 4NAMA 2D07B 5G55A 1YJ9A 3KLWA 4FJYA 2BH2A 4WFN3 4TV3A 5IN7A 2PE6B 2L1BA 4IG7B 3K8AA 2R3ZA 1YI2A 4GKKQ 2KANA 4A3CH 2RSOA 1I4HA 3SHLA 2WXNA 4C80A 4YTNB 5LLIA 3OAWA 4ACFA 2J42A 4BBRH 2O6VA 1AH9A 2NN6G 2LD9A 4ICVA 3AYHB 4DKAC 3A7AB 2EMSA 3U4EG 2G9HD 1LXDA 3T8MA 1I7HA 3G48A 2FINB 4A3JB 3TS2A 3AE8B 4MHEA 4OHJA 4ULLA 1MHHE 3NS8A 1VQBA 3DMUA 1FM0D 1CTMA 2Q2HA 2GBKA 4W9LA 4ZAIA 3MEFA 1I50B 4HEDA 2QDBA 1Q86C 2JA7B 1HFGA 5IWAL 4ID6A 4KIKA 1TVXA 5EKKA 3GTQH 2LHDA 2JXMB 5D6JB 2GRIA 1UD7A 3I4OA 4QY7A 3UE0A 3GTGB 1F52A 4US9A 4OO1H 1YQ3B 2AKWB 2GVBA 4GSWA 1W3SA 3JVZX 1WOCA 3J81E 1VLBA 2NVXH 1FVIA 1PFBA 2N55A 1P98A 4W9KA 2W55A 2KHIA 4EQOA 1BBXC 1SIFA 2KKCA 5LXIB 4JI5L 2CWAA 2NBWB 1Z6HA 3PRZA 4RWSC 2F0OA 1BBWA 1A3TA 2XEWA 4DGZA 4DNIA 2QMTA 3DWGC 2LHEA 5D3IB 1IUEA 3AEBB 1GJZA 1PGXA 1V8CA 1EQQA 3WAMA 2MJEA 3NZ3A 3FMCA 1E1OA 2KWVB 4I7AA 1GO3E 2YVCA 3ML8A 1QNUA 2ZEQA 3A1QA 3AECB 4K81A 2R2QA 1XNRL 4FA6A 1TWGB 3PREA 2HT1A 3DBRB 1STEA 2C7NB 1CSPA 1IW7D 4IOAA 2ZXRA 4AQ7A 2B63G 2F0EA 4KD4A 3Q3NC 2JXXA 1VQCA 3FHWA 3PO0A 3OW7A 3ERSX 1YIJA 4RHRA 4P2CB 2QCPX 5IOCA 2J53A 4XYCA 2HIVA 3JYUA 4OXPA 3I3CA 3GTMH 2V4LA 5C4XG 4NAWA 4IOIE 4C1NI 1M8AA 1IBXA 4MIUA 3S1QH 5DCNA 1D3ZA 1N60A 1FRDA 1P7FA 2L4NA 2ZCBA 2MBQA 1G8ZD 1OXXK 3D8GA 3ZJUA 3UQBA 4AYBB 4F7XA 1C3TA 3EUB2 1Q8IA 5C4JB 1YBYA 2AWOA 2KVZA 2KN4A 3A9JA 1V5TA 1YN3A 4C3HH 4IO9A 5IYBH 3U9SA 3GTOH 4N58A 1N33L 1ZOYB 3K5OA 3A55A 3PVLA 4W9FA 3MXNA 1XMQL 4KN4C 2ONQA 3NPPA 3UDXA 3STBC 1QF6A 3J80c 3VVWB 1JR0D 2KC2A 3W1GA 4LFCQ 2CKHB 1PFNA 2E2HH 3Q0AA 2WXKA 2D0OA 2IBIB 5M3FB 1LTAD 4LF5L 2Y3AA 1Y14B 1RDPD 1V6EA 2N9PC 2D9UA 1GUAB 2BYEA 4FLHA 1RL2A 2XWBB 4JI3Q 4DR6L 4YCWA 3QA8A 2RSUA 5ELCA 1AFPA 1FEHA 2JYOA 1WYGA 1YQBA 3B2FA 4ZRKA 1L4DB 2ZVNA 2KMMA 2VY3A 1JT8A 3GTLB 3QOJA 4Q5VA 1C4AA 3N32A 1C8CA 1MKHA 2AWTA 4QGUA 2DLBA 3CCUA 2XK5B 4L8JA 1SJHD 1NENB 2VZKB 4WQOB 1XEEA 2JA6H 1BR9A 3CPWA 5M5XB 1PGBA 1ZDVA 4CJ0B 4MGKE 4JI0Q 4KMUC 3TEXA 4QMGA 3ZDTA 1QQRA 4O42A 2BE5D 3QOLA 1NYRA 2K5NA 3H6NA 3HVZA 2CHXA 2BYTA 3AB9A 2O5IC 4A55A 3MZ5A 4CJ2C 4C2MB 1HNZQ 1SF0A 2LFIA 4I6NB 1IHZA 2PMZB 1NYQA 1MI2A 1BBUA 1EWHA 2KMAA 4IN3A 3CC7A 2E76C 4BKGA 3MHBA 3FKIG 3OG5A 5C6AA 3AN1A 2VH1A 3T13A 4TKNA 2INPE 1N62A 1MSHA 3A54A 1K83H 3CRLC 4LF4Q 4A3FH 1NI2A 2Z59B 2MQJA 3G6EA 3J80E 3APFA 3CQZH 3HOZG 1SNDA 1Z2MA 2BCOA 1HJPA 3HOVH 4BOSC 1TZ1A 3W3AA 2NVTB 1Z9FA 2FCMA 2WB1G 4HMJA 5FR3A 3BK1A 3CMAA 2EJGC 3E3XA 4CDDC 4H02A 5DM73 4EFOA 1D6EC 1DXMA 4RH6A 3ML9A 1SE3A 2ALYB 4LNKA 1JWSD 3HOXB 1OQRA 3SU8X 1VQLA 2ZTEA 4KKJA 4ARIA 2NVQB 2F0SA 2UU9L 3M3YB 2RQXA 5H8YE 1L7YA 4FULA 4XT3B 5AZGA 4JBWA 2BKFA 5LMUL 1KAWA 1OO9B 2EY2A 4A3GG 2FXQA 2NZHA 2IJ0A 3ONAB 2L15A 5TSSA 3KUCB 1YOVB 1OFFA 5CHWA 4HIMA 2VXWA 1W6KA 1UF0A 4JOIA 4LJZC 2YEPB 5CTRC 2JEAI 4A3DB 1E2WA 1GM5A 3EBEA 2N0SB 1F2LA 1VQ6A 2KQ4X 3OLMD 2L0CA 3R93A 3CXCA 3GOEA 4EZKA 1G2SA 2KOXA 4GDLA 5LL6X 1BQQT 1TWGH 3DBSA 2UWQA 2PLPA 2WDRB 2FIDA 5IWAQ 3M4QA 4ZUJA 3RULA 3Q22A 4BKSA 1MVKA 1GUOA 4FXKC 2PNRC 4XQQA 2KQ3A 2MBBB 3RZDB 3Q14C 3V6CB 4KTAA 1S5CD 2LJ5A 2Z9HA 1OEYJ 3RNUA 1BXTA 3J7YW 1XMOL 1HXYD 4OWXB 4LF8L 4JI1L 2WGSA 4YCUA 5IOIA 4OO1I 2WXLA 1LT4D 5EAYA 3FC4A 2LMCB 4A3BG 4FHKA 2RCNA 4JI5Q 3LXFA 4LNFA 2KJHB 3L0WB 3E0EA 4FVMA 2K6QA 2CJNA 1XXGA 3VTWA 2LGIA 3C0RB 4ZRZA 1A3UA 4L23A 1MD2D 2CCZA 1UWVA 2ID0A 4DAPA 3PRMB 1YX5B 4OZAA 4RF0A 4PS3A 3AE6B 2KCTA 2N1WA 3I73A 2UXBL 2L11A 3PIP3 2P5ZX 4YCVA 3VA5A 4DK0A 2ASBA 1XNRQ 1WH3A 1NMGA 4KK7A 1PGAA 2MBOA 4II2B 2K8BA 4KGSA 5MPOA 3RNGC 5M3FH 1WTXA 1ENAA 5DPTA 1JQ4A 5KEEA 2A6HD 3M63B 3TMPB 1R7SA 1VQJA 1L1OC 1RAXA 1SNMA 4ITKA 5BO4B 3UINB 1ZXTA 5CYUA 5E4XA 1V1PB 1VQFA 3GTLH 1RFKA 1WM3A 1WM2A 3ZJVA 5T8IA 1NBFC 4HTHA 2MJ8A 3QIJA 2LGXA 1V9PA 4QB4A 3S1RH 3VRAB 2B3AA 2R61A 4MH8A 3MHZA 2INDC 2ZW0A 5M5XH 3I4LA 1N33Q 1V9JA 1QOGA 1XMQQ 3ZXRA 2I07B 4NPSA 5KYLA 4B0EA 2SDFA 1QOAA 2XSCA 4HSVA 1JMLA 1TS5A 3E5SA 1SLJA 3CSFA 1ICWA 4H2AA 2MBEA 4UPAA 2D3CA 2W3SA 1BO0A 2X6GA 1PVOA 1LTBD 2LSSA 1WTOA 3BIID 3C19A 4LF5Q 2KXJA 2Y5BB 1ISNA 3L9AX 1QE6A 4C2MH 2K50A 4A3PA 1UWMA 1M90C 4MH0E 3LDZE 4C4VB 3DDCB 4RCNA 2YU9H 3URYA 1EYCA 1O7LA 1SJED 3D6CA 3GV3A 4JW0A 4UP8A 3DBHB 2DY7A 4DR6Q 5GAGC 1BF4A 3O65B 2MHJA 3C1FA 1Q3LA 2N8NA 2PW7A 2RHQB 3DM1A 1FCCC 2GOWA 3A56A 3QCAA 4F1SA 3GZNI 2OHFA 5D65A 1K52A 1G51A 2Q8IB 2A4ZA 4OVZA 1IXRA 1HZCA 4RMFA 2DNFA 4QQBX 1V49A 3L17A 4C1NK 1UNSA 4JPSA 3PO2G 5IGFA 4S17A 2OTJA 2K33A 3MJWA 2FBWB 2MUYA 2Z6KA 1FR3A 1EOTA 3ND9A 2ASQA 3KF6B 1IGDA 4TMAB 2K1BA 3K0YA 3BWUD 1WX9A 2UXDL 1YHBA 2G1EA 2K03A 3DVNU 4MN3A 2NVQH 2V9HA 1I5FA 2WIIB 3J7ZC 2M1MA 4HJGE 5BMIA 3M3JA 3FP9A 1JRPA 1ET6A 3VXWA 2QC8A 4PS7A 3Q2AC 1B7YB 2BA0A 2VZKD 2A68C 2K3UA 3AXCA 1P0RA 4NJ7A 4CKEA 4WIPA 4ZRQA 2K6DB 4JI4L 1YNTE 3HOWB 1SROA 1UE1A 4DXAB 5FR6A 3IAM1 1RCVD 2A69D 1N63A 2KFKB 4YTMB 4ZHOA 1MG4A 1ENCA 4N6EB 1YJNA 3ICEA 1XNQL 4WORA 2A6EC 3A9KB 3K5LA 1NE3A 3PS6A 2Q8TA 1KRTA 1SSOA 1QZEA 2PI2A 4GLAC 4GNXA 4WWOA 3S2AA 4A90A 3HOZB 2REXA 1HZ6A 4N9TA 2UU9Q 2JN4A 1FJGL 2B2TA 2M9VA 3ND8A 4CGYB 5LMUQ 3UF8A 2JQOA 3NQIA 2JT4B 1A3VA 1XTDA 2ZPNA 1H8CA 2LKVA 2F4VL 4W9HA 1RFAA 1YIWA 1Q12A 4RAUC 1XPRA 3GTPH 5LL6S 3F2DA 3LNNA 2OCEA 5I9OA 2EPBA 3TP6A 1FFVA 2PQAB 1PLFA 3CIRB 4P7IA 1LYLA 1SN8A 5I4DA 3X0WA 3BU2A 4LNIA 4AS1A 5FO7B 3SK4A 3ABVB 3SFEB 3VH3B 5FLXc 4PK1A 4I65A 4RGNA 1QT9A 2JSOA 1HZ9A 3DM3A 1Q1OA 2KDMA 2IY5B 1H9JA 3VR3A 1JE4A 3D4DA 2I38A 3DBRI 3NY5A 4W9GA 3WIMA 1UEBA 4LCDE 1SSNA 4BZAA 4E71A 4L5RC 4HMIA 5IP9H 2L52A 4IW0A 4DK5A 1XMOQ 4LF8Q 3VR5A 5C3WA 4DXGA 2DY8A 2XN9C 2ZJQA 4USAA 4IALA 2WXHA 1HQMC 4ASWC 3RFZB 1AEXA 4NKLA 2JF5A 4P16A 1IPGA 2HHHL 2RHSB 3I4MG 1TKWB 2B2UA 4HSPA 5FLXL 1CSQA 1SYEA 1J7BA 1VQEA 2J7ZA 5C0XH 2DGYA 3ER0A 1C4PA 4WJPA 1KM7A 2AYOB 3RMHA 2GB1A 4RFBA 3NVWA 2JY6A 3P63A 4A3BB 2UXBQ 4LF6L 2KEDA 4O1NA 1D7QA 3QX1A 4ICUA 2AQ3B 1KHIA 4YL8A 2LXJA 1DOYA 2KCCA 4BS9A 1VF7A 4A75A 1I4RA 2VS1A 4HN7A 4L6TB 5EBDA 1Z47A 1NCVA 4TRDA 3J81i 1G2TA 4UY8C 3PIO3 4WH4A 1NI3A 2AUKA 2MWSB 3SDLC 1PRTB 1A0IA 1G6PA 1I6HB 1VCBA 2LEKA 4JVZA 1ZKOA 1S72A 1Q8KA 3D4WA 1NAPA 2BPSA 3CC4A 1ML0D 4A9AA 2O6VB 2AQ2B 3EQLC 3JSVA 1EM7A 1WCMG 2CH4W 3SEBA 4H13C 5M3MG 2E74C 4NXML 4GOPA 3EFUA 3NVZA 1LQBA 1TWFH 3F2CA 1SB3C 5FLXE 3RLOA 2LWPA 1MBYA 2N9XA 2HQLA 1JORA 1RYJA 4ALPA 1C1YB 1F2YA 1X9NA 3UDFA 2WXOA 2WV6D 2WWZA 3U8ZA 4DR3L 3WDNA 5K5PA 2ZM6L 1IZ6A 3GDEA 3WOEA 4TUUA 4AIMA 1VQ9A 2R92G 5C23A 1V1QA 4N9F4 3ULPA 3A74A 3KFUA 5IGBA 1E3PA 1EQRA 2GBNA 1QG7A 4CDCC 2AQ1B 2C9OA 1RTNA 1DM0B 2XIWA 1S5ED 2HUGA 1KDBA 4JPBW 3S17B 1AE2A 1OXUA 4DV4L 2J0JA 4IUMB 1NUCA 3G7LA 2F0FA 1VQ7A 2YV5A 1B2TA 4EQNA 3HOWH 3U30A 2X38A 1RKNA 3RZOB 1GUSA 3OW2A 2KK8A 4X3KA 4KY6A 3T4AC 3I70A 4C7ZA 3NOBA 2NR2A 5BR8L 4DWFA 3L7ZC 4X3UA 1JOOA 1VQDA 2GBMA 4APVA 4DV3L 2X8XX 2SOBA 3QK0A 1Y1VH 5IAAC 3VUYA 1J8CA 2MQHA 1OEYA 3MXPA 5ELFA 4JIOU 3KBGA 2IY0B 1QKZA 4NAWB 4DUZL 1WGYA 1IBXB 1ZGUB 1JB3A 2M19A 1NSNS 4HKZE 2OT2A 4DV7L 4JI4Q 1N9WA 4X62L 2K8CA 3NBHB 4PNYA 2RPVA 3A9JB 1SE8A 2E2JB 2V3NA 4B3RL 4IURA 2PTLA 1HUMA 1GAQB 2O4XA 3Q24A 3D3RA 3DWPA 1TS2A 5L37A 5BN5A 1IW7C 1XNQQ 4A3IB 1PA6A 1O7IA 2NN6I 1U0LA 3ZRCA 3G6JB 3TEYA 3AU5A 4BY1B 3J7AV 3GD7A 3A5UA 2R7ZG 4A3KG 2Y0SG 4Y7NH 5JPMC 1J6QA 5J39A 1J5EL 1FJGQ 3G4SA 4IQZA 4AYBE 5IP7H 2FFKB 4BVUC 2K14A 2QEXA 1YVCA 2PCFB 2DYOA 4ZYNA 2K01A 1FNWA 1QILA 2F0KA 1X55A 2F4VQ 2L05A 4PMWA 1PUTA 3K9PB 3DHGC 3Q3MC 1GUTA 4OVUA 5GQOA 2QSDA 3PGZA 1TIID 4B6WA 4HR7B 3W5UB 4DV2L 3J80i 4RCOA 4X66L 3APDA 2MGSA 4UDUC 5HFYA 1VDVA 3I4NH 3LB8C 3Q3OC 3E56A 3RI7C 1L6VA 1ZPSA 1LM0A 5FJ8G 2CW0D 1EOVA 3N9YC 2N1VA 1T0RC 2EDGA 4GDKA 2WP9B 1B1ZA 1B4OA 1TT2A 5IGGA 4BWGB 3PIOA 1FD6A 3D4RA 4LFCL 2MW5A 2BKRB 5AEKB 1S40A 2K6AA 2Z4HA 1A6XA 2BWES 2JEBI 4KV2A 4DR4Q 1WGRA 3TSSA 3MP9A 1CM9A 1Y1WH 1BT0A 4E3CA 4WAAA 1X3GA 4WJQA 2BBCA 2CQOA 2O5JC 2RCFA 1BMLC 1N32L 3I90A 3S14H 3CCSA 5CHFA 1Z7TA 1BVSA 1VQGA 2EYOA 5EPLA 2HHHQ 4P6VF 4WAFA 4A4IA 1WI0A 1P8LA 4WJNA 2XVSA 3NWSA 3SK5A 1B3AA 2PO4A 3VTUA 1HA6A 4UP9A 3JAML 4ZRPA 1X56A 1RWSA 2O2LD 2YLMA 5C0XI 1K50A 4LF6Q 1HTOA 4A3EH 3UDIA 5JXVA 3PUYA 5AZFA 2BE5C 2PMZE 1WXVA 3KVFB 1CT1D 4PYZA 5M5WB 1NVID 1GD7A 3L0OA 3H15A 1O7YA 2LS01 1VQOA 2D3AA 2KQSA 1QZGA 3E0JA 5M5YB 3FPPA 1YJJA 4K14A 1Q1EA 1A2TA 5EJWA 4CJ1B 3SGIA 1NJIC 1HNZL 1C76A 1LO5D 2IO0B 4LFAL 3R8BA 1LTRD 3KBXA 3D31A 4R4CA 4EVOA 4II3B 4U68A 2JA5G 1U4LA 2ZXOA 3SE0A 4BBSB 1RLFA 2C5CA 2RD0A 3DVGY 5DEHA 3ECIA 3PTFC 1STGA 4BY7G 2QKIC 1HRJA 1R4MB 2K28A 5KYIA 4A6QA 3SK8A 1Q1BA 4DV6L 2WKDA 2MO1A 2WAQG 3BZDB 4NXMQ 4ILWA 4KSLC 1X3FA 3PF4A 2K5PA 3RNBC 2IGGA 3NK9A 3IVFA 4HPMB 2R6GA 1JQYD 4HAEA 4ODGA 1SMYD 4ZRJA 4KGRA 3S2DH 4ANUA 3FKYA 1HEZE 1VS0A 3E9SA 2JA9A 4GDLB 4LK0M 4IFDH 3UQAA 1GHKA 4K5XA 3AE1B 4LW1A 1WCMB 2K32A 5IT9E 5M3MB 4NP5A 1SMXA 4DR3Q 5C5MA 2ZM6Q 5LMNL 1WGHA 3PUWA 2EY6A 3QR8A 4OWWB 1Q82C 5J22A 2QCZA 1T0QC 1PRTD 4KY5A 2V3PA 1XX8A 4ZKCB 4ZLTF 4K7UA 1YNXA 2O6VD 1PFSA 3KYHC 2HQEA 4JC0A 3PLVA 4CKCA 3T3NA 1I4GA 2Y5CA 1FXIA 4NNJB 2L83A 4QF4A 3TRZA 1N61A 3S1MB 3K59A 4DV4Q 2LVOA 5E7NA 4JX1C 5CR3A 2D3BA 4IPCA 1D2BA 1WYDA 4G7OC 2WXMA 2E2JH 2VUMG 4TQ0A 5ELBA 1K8OA 3MC8A 5C44H 4LAAA 2EY1A 1XD3B 1SNPA 4G3XB 2JP1A 3K81C 4IM3A 5EPKA 1P16A 2MFIA 5JJZA 4NY0A 1CQVA 3OMGA 4S3SA 5BR8Q 2DAFA 3KWLA 2YEPF 1ZDXA 1VZ8A 1RTOA 3AEAB 4DV3Q 4KD3A 3HS0C 4ME3A 2LVQA 1C79A 4M8MA 4HPLB 1D5MC 3B1LX 3NWTA 1IBML 2KDFB 2QILA 1K53A 2KX0A 1ZYRD 3M4OH 2DZIA 2MLBA 2PVOD 4F87A 2EELA 3Q8CA 3X23A 2EIFA 1V86A 3TCAA 3QO2A 3BVGA 5JEAH 4DUZQ 2BYFA 3HRDD 1HE8A 3DOWA 2KWCA 3K5MA 4DV7Q 5HHDG 2D3GA 2OF1A 1C7YA 4EEWA 2LRUA 4X62Q 2SEBD 3KWVA 2N78A 2V4DA 2D5GA 3N6RA 3FAHA 3SR6A 3DXJC 3CU7A 3P75A 4B3RQ 2FMCA 2O2VA 4KV6A 4B3SL 3L4PA 3H8HA 4A93B 1EIYB 3RLNA 4AH6A 3D0FA 2JWUA 2OOBB 4HCNB 1CKNA 2EQSA 3JC66 2KMCA 4NXNL 4GS3A 2EZVA 4HJAA 2UU7A 1H9SA 2Q2UA 1STAA 5CV5A 2NBUA 2VL6A 1UGMA 4QUCA 1S5BD 1YZ6A 1L4ZB 1XQQA 4DDGD 1KLGD 3AQQA 3IRBA 3TP7A 2K8HA 4FXGC 2A6HC 3ULLA 1UEAB 3AE4B 2ON8A 2B39A 1J5EQ 4C3IH 5G2NA 2IYDB 3GP7A 4ZUIA 4BFRA 2WXPA 2LXAA 4ZRIA 3AFQA 3HUIA 3NG0A 3K57A 3I56A 1F9PA 3KUZA 1JW9D 4R3DA 4IZ8A 1B9MA 4TSSA 1HA5A 4DV2Q 4X66Q 4A3KB 1QVFA 2R7ZB 1O7ZA 1E10A 3DUZA 3LX0A 4PZ7A 3W1YA 3H0GH 4F7ZA 2LXKA 4Z9CB 2D2QA 4P74A 1XLPA 1SFOH 4K6DA 2F3IA 3MXUA 1PH9A 3K7AH 4REZA 1W2BA 4DK3C 3S2HB 4K3CA 1CZGA 5C3JB 3AE7B 3W1SA 2L12A 3ERQA 5M5YH 1JALA 3RUIB 4EE2A 3IBEA 4LNNA 5JHBA 2F0JA 2VQEL 1B44D 1H9RA 4ZKBB 4TVAB 2SNMA 3HKZB 1TS4A 1VQ8A 3KYCD 4BBSH 2WX0A 4MELA 2F0LA 1N32Q 3V3XA 4I6LB 2NTTA 4K7WA 1STHA 1F9JA 4IKGA 4JI8L 4B9XA 2I1JA 3M95A 3OWEB 4A76A 4GMVA 1RRBA 2WNMA 4L5QA 3J7AF 4NJCA 3U4VA 5FLMG 3GE8C 3GTKB 1LACA 2MP1A 3M4PA 1RF2D 4PG3A 3FDTA 5IA7A 4LWCA 1L0VB 1PH8A 3J7A5 4LMQD 4GGQA 1KLUD 1D5ZC 3HP3A 3ZVVA 2IZVB 1DOMA 1DYQA 1L0YB 4G7HC 3CMEA 1WR1A 2KTRA 4GNXB 2NUCA 4K5WA 2N7JA 1K8AC 1Y8RC 3HOYG 3QHTA 1WFQA 5KNBA 2OTLA 2J52A 3VH4B 4LFAQ 1XTCD 3EVQA 1AZPA 2YTVA 4JK1C 4IJHA 1GC6A 1A8VA 1BDOA 2YYZA 2CH4A 4HDOA 2B3GA 3CCJA 2G3QB 3CC2A 4ABNA 1WD0A 2BS4B 2EKEC 3Q8DA 2ZPYA 5EE0A 2F0GA 1O78A 5FKAC 2Q5WD 2F0WA 2D0PA 4DV6Q 2N7DA 1BOSA 2NWGA 2ZXPA 2IX3A 1PTOB 3MVVA 4NJ6A 1KF6B 3ZDMC 1QWYA 3J9CA 2JWZA 4A3JH 2A69C 1PDXA 3U52E 1UELA 2K05A 3SK6A 3NUHB 3U2SC 2RMMA 5I2XA 2GMIC 3DEPA 3OPOA 2KUMA 4QJFA 4BY7B 1I50H 1E90A 1WJJA 2N3SA 4IM0A 2MRPA 2JA7H 2R93G 1X32A 3VR2A 3DCGA 3HOUG 1KAAA 2WAQB 3V05A 5LMNQ 2WB1E 4IFDI 1VRAB 2L76A 4HCPB 1XO3A 5JZEB 4K8JA 5IE8A 2PEAA 4P75A 3GTGH 2QDFA 3NBIA 5CV8A 1SE9A 2MBHA 3ONSA 4P1CC 1QLBB 1FXAA 4AJYB 4JI6L 3ZTDA 1HPCA 2KDBA 1YMHE 2D2CC 2F0QA 1WY8A 3PO3B 4KY7A 3TDQA 2AEHA 2H88B 4C3JG 4FBJB 5TR5A 5IYCH 4A3MG 2LASA 1B9RA 4YY3Q 2E6XA 2LGSA 1SYCA 5BYSA 3QWZB 3TN2A 3N3KB 4DPGA 4IUPA 1JROA 3KQ4A 2DNEA 4XYQA 4X65L 1MJCA 3RNFC 1DOXA 2LI5A 3PUZA 2B2YC 1FCLA 1SYBA 2UUCL 4BKSD 3UE1A 3W5OA 1Q10A 4TKOB 3SVMA 3Q3JA 3PQIA 4DV0L 1SNQA 3R2TA 1IBLL 1GJXA 1ZW7A 3V6EB 4ANXA 5DPWA 1EZ8A 3AV8A 4L1BA 1I4QA 2FNJB 1C0AA 3X3MA 1E7ZA 1M4VA 1YHAA 5I2YA 2N9EB 2EMTA 1IYUA 1C77A 2F3WA 3AE9B 4XIGS 3QWNA 1E8ZA 4C00A 1N5XA 1UBQA 2CVRA 1IBMQ 1K28A 3CHBD 3VR8B 5NUCA 3NZUA 1JWAD 2JZ3B 1UE6A 1R9TB 4IWOA 2KTFA 5C0XJ 1GVPA 4AP4C 2F0UA 1WD1A 3WWVA 2ZJDA 5CGKA 4PT5A 1I4PA 2L7RA 2K75A 4XZ4A 2AWNA 1SYGA 2WU5B 2XNAC 3I7FA 2OEOA 3L3OC 4HIOA 5C4JH 4GOPB 2A19A 5JH5C 1EF5A 1E7PB 1WXQA 4B3SQ 5A2QL 2L8JA 3S2HH 2DWQA 1K0SA 2R7FA 4XQJA 4PMBA 2KJRA 4NXNQ 2QGQA 5KNDA 2BA1A 2IX1A 4BXXG 3P42A 3N20C 2OJRA 5LHY1 3FRPB 2V1YA 2AMCB 1BCPB 2CU1A 5CBAE 4KZCA 2JRHA 2K04A 4BOZB 2RBMA 1CKMA 1K3BC 3P1HA 2MNAA 1FGBD 4M1UB 5DM63 3MTSA 1T5EA 4OL7A 4M0WB 3I57A 4NMZA 1N8RC 2B63B 3W1BA 2IGDA 1E6EB 3AFPA 2LGDA 3GS2A 4IUTA 5I9PA 1U5KA 4A3LH 4RM8A 3A0JA 1Y1WG 3OOCA 3C1EA 1RODA 1PYBA 2Z0DB 2KECA 1V80A 1PRTF 5C3EG 3D6WA 3L10B 3MWYW 4FO2A 3GTKH 2KOLA 5C4XB 3NSWA 3T1YL 3ITPA 3NQTA 2WU2B 2Z0EB 3A8KE 1JE5A 1AYFA 1WI5A 2SNSA 4YSZB 2JA8G 3M7NA 3CCEA 1F1HA 4LDTB 3PMFA 1NMFA 4EGVA 3NUCA 4HJ9A 4JI2L 1PZKD 2X6LA 5LXHA 2A1AA 2VQEQ 2B8GA 4IUUA 5HGQA 2LUEA 3Q23A 5J2RA 2KN5A 2IHFA 4N9PA 5CORA 1M94A 1EY6A 1VQ5A 4OZBA 2H5XA 4DF7A 1CA5A 4LNQA 2KVMA 3H1UA 1S3SG 1EZ6A 4NQLB 1J7CA 3RYTA 4JI8Q 1QB5D 1PTOH 1L2FA 4G57A 4MNOA 1Q81C 1R4MI 2MX2A 1L0WA 3N1ZC 2PQEA 4LNOA 1XF5L 4MDKE 3GTJB 4GN5A 2MO0A 4P1BC 4ARCA 2FJ2A 1QOFA 1IYJB 3UDGA 4AUQC 3MFYA 2NVTH 2TSSA 4FHJA 4L5TA 3RNEC 2NZ1D 4TQUS 2VW9A 2R2OA 5C5LA 3NHEB 4J1MA 1CK1A 4GU2A 3BYTB 5K36G 2M0AA 4G7ZC 1WX8A 3ZRFA 3E9IA 5FK9C 4Q0FA 3SDZA 3HOXH 3CPFA 2KAJA 3S9WA 3N1YC 1LTID 3M3YH 1MHWC 3S16B 2KO3A 3IAYA 4HEA1 4PZ6A 4D2KA 3H09A 1TWCB 1CHPD 3PO3H 4C56C 3H7PA 1ZP0B 1DOLA 1V43A 3OIPA 3OHXC 4KZ0A 4DK1A 1EWYC 3HOYB 1YD8U 1ILQA 1WGGA 1J9OA 4A3DH 4A3CG 3CCMA 1TY2A 2E75C 1IL2A 2QDLA 1E2ZA 4BBRG 1TIFA 3VUWA 3FKIB 4KHPL 1IL8A 1WJ4A 3IFDA 4GDKB 2PZUA 3VHTC 2NN6H 1PH4A 4R1JA 1EUJA 2RR9A 4YWGG 1W6JA 1Y8NB 5C44G 3RZDH 3PV0A 1PZID 4P73A 2WFWA 4HIKA 1OTRB 2CHWA 5HY6A 3PCOB 1JICA 1R9TH 2KQ7A 5D14A 4JI6Q 1MI0A 2M56B 3NZSA 1HNWL 2VB2X 4JBKA 2WB1B 1PTOD 4A20A 1FNVA 2EXZA 4BA2I 2R93B 3QQ8B 1RIPA 2DN8A 2FCQA 4OO1G 1WTRA 3ZGZA 3KUDB 1D8LA 2FAZA 1E5WA 5EQ0A 1QZHA 2NCNA 3ETRA 2UXCL 2NPTB 3R3MA 1T9HA 2NMQA 4BKTA 4X65Q 3C8YA 3HGBA 2RDHA 2CW0C 2UUCQ 2LGYA 3RNAC 2B29A 4A3GB 1L2NA 2BGFA 2K5VA 2V3SA 4G4KA 4RGOS 4DV0Q 4C3JB 1IBLQ 1EY0A 3S24A 1EY9A 1KTKA 1X65A 3ZNHB 5KHOA 3E6ZX 3K9OB 3VYRA 4FYDA 1V81A 1II3A 3T3OA 1TR5A 2FUG1 3CMMB 5E6NA 1WTWA 1SDFA 2D11A 5IKCM 1PH5A 2E8GA 3A4SC 4JE3B 4XGAB 4DR4L 3L2PA 1K3RA 2E2DC 3CAMA 2C60A 3R2IA 5E6OA 2UUBL 1LTTD 4B3ML 1TWAB 4V190 1G91A 2JXTA 4CHKA 1AWDA 2KCMA 3PHWB 1F77A 4K3BA 1KIXA 3PZDA 3H7SA 5G5HA 4N8X1 4XXEA 5C4XH 2VNUD 4GLXA 4GLSC 3PSEB 1WGKA 5EPJA 1MJEA 2CHZA 3K0XA 4JYAL 3Q6BA 1NTGA 1ASYA 1HTQA 4C3HG 3HKSA 2DENB 5IYBG 3NP8A 3BYYB 3RLFA 3RN9C 2OQKA 2NVYB 4M8NA 2BT6A 2JZZA 3V61A 3AU7A 2DHZA 1KL9A 4RA8A 1ZEQX 2K7VA 3EFXD 3MEHA 1WE6A 3OJ3A 5GMVA 3RN2A 3QJZA 1HUNA 1SAPA 2NZOA 3QARA 5LNK1 3DPDA 3F1ZA 4UAIA 3GV6A 4H44C 1YN4A 2WXJA 4HXDA 4RF1A 4YSXB 3CKIB 2L0FA 3MC0B 1SRUA 1I3QB 2F0TA 1AP0A 2HD3A 2J0KA 1PZJD 3EECA 4IFDJ 2PPHA 3ZIMA 1DGSA 4BAXA 4POGA 1KFYB 1TKGA 3RD2A 1SMYC 1A63A 1JRUA 2L3ZA 1EIFA 3KF8A 3T1YQ 2BB5A 4GN1A 4GZYC 1VD2A 3F2UA 5BN4A 5AJ3L 2IO2B 2K25A 4E74A 5GAHC 4FF1A 2FCSA 4EZJA 2XTIA 2JA6G 4KIKB 3OSOA 1SBBB 4I7ZC 3VRBB 4JI2Q 3IXSA 2SAKA 1PRTC 4KKTA 5C3EB 2ZJPA 2L9HA 4OEMB 4W9IA 2DYMA 3DWQA 2EVBA 2N9LA 5IYDH 1L1OA 2KHSA 1QVGA 1TWCH 3RR5A 4CKBA 1MIUA 1GUWA 2ZW1A 1P3QU 3Q8EA 2KNBA 2PW5A 3MFGA 3PV1A 5E6PA 1F2ZA 4ZCKA 2MA9B 1FFUA 4H7BA 3L08A 2KD0A 4KDLB 4EQ5A 3S1NB 1M1KC 2O2VB 4M01A 3V60A 1STBA 1T0YA 1SNCA 3FKIH 2MJ3A 4LDTD 3TS0A 4KKUA 3KYDD 3A1QB 1K51A 2EJFC 4O2DA 4ZYSA 1KRSA 1CKOA 1NBWA 4A3FG 3B0AA 1H9SB 4MJSA 3IHPC 4GB9A 1LUZA 2KENA 1SYDA 5JEAJ 1XJVA 3HOVG 4R4QA 4JI7L 1V1PA 3HOZH 1C4CA 1ZYRC 3ZKJC 2ZCCA 3EFCA 3R66C 1R4NB 3PO2B 1FRRA 2INNE 1ZXHA 2I2YA 2I5HA 4AQYL 2GN5A 2K5QA 1WYWB 2MSED 5CBEE 1LT5D 2BTEA 1WE7A 1RHPA 1MGSA 2CJOA 3I3TB 3P7JA 1S3OA 1VMPA 5KHQA 4LUZA 3UIPB 1KD1C 2W9NA 2WXQA 1HR0W 1HHVA 1UUPA 4WJ3M 2NBFA 1TYGB 2PKOA 3Q8FA 4PV1C 5IP4D 5JHAA 4YWMA 5IGDA 2JU6X 3I63C 5J3BA 4FP5D 1DCZA 4KHPQ 5IYCG 1IYVA 5F2DA 3MXNB 2QF7A 4EZLA 5IIFA 2X69A 3KJPA 3VQIA 4LLGM 4C4VA 1TKEA 4IUNA 1VDZA 2Z0SA 1U4RA 5DAUA 3MHSD 2QHOA 2K5WA 5C4HA 5L83A 2M17A 3WALA 5CV4A 4W9JA 4WRDA 4L63B 2AL3A 2AX5A 3BINA 1WSPA 4KKSA 2A5HA 4DV1Q 2Y0SE 1HNWQ 2F52A 4OELB 3KJOA 2K4KA 1EY4A 4JWSC 5J17A 1HNXQ 3G71A 4OIKA 2WINB 3T53B 5A35A 4PMCA 1IBKL 1S5DD 3X3NA 4X3SA 2DYBA 2UXCQ 3TEHB 4LF7L 4GXBA 4GIVA 1U9RA 4N8FA 3HM3A 3MXGA 2A5UA 1E24A 1PH7A 1RJTA 1EIHA 4IPHA 2UYZB 3BZCA 2M4NA 3GTQB 4A3BH 2Z1CA 4LK1C 3LWEA 1SE2A 4AYBG 2KYWA 1EYDA 3HKZE 1HH2P 1CMXB 3JAMc 1K8RB 2KTRB 2XRQD 3VR9B 1TS3A 2NVYH 4IPGA 1G6JA 4DQOC 2IW3A 3PZ8A 3OYYA 3AEGB 2PMVA 1J7AA 1ZKHA 2HTME 1GB4A 1E8WA 1I6HH 4FN2A 5M3FG 1ASZA 2C35B 3AEVA 3EROA 4CBVA 2UUBQ 4B3MQ 4YT0B 2IHEA 2KFKA 2BS3B 1PH3A 1LTSD 1CFMA 2LRWA 2HCIA 2E2IB 4F88A 4IJLA 1Q5WB 4IWPA 1EY7A 4JV5L 2KLGA 3HRZC 1WJUA 3QC8B 2V0GA 2PIAA 2PI2E 3A9KA 1LABA 3AB5A 1LT6D 4X3TA 2L5TA 1PH1A 1XLQA 4BBNF 2QEJC 2WP8J 4JYAQ 2EKIA 4YTPB 3UGBB 1XPUA 3I4MB 1N6ZA 3ZNID 1UE7A 4IUVA 4ME5A 2HD5B 4K2LA 2F0IA 4HIDA 1EYGA 1OGWA 3P4SB 1Q0WB 4URKA 3GTMB 3PRPB 2F0DA 3AU4A 3VTVA 3S1QB 2WYQA 2F1MA 2C9WB 3IAS1 2F0HA 2IT1A 4B9WA 3GB1A 2TMPA 4G0NB 3H94A 5T1GA 5JAVA 3DBHI 3S17H 3AE5B 5FO9B 3GTOB 5IGCA 4R4IA 5JJKA 4M8AA 1PYWD 1XLOA 4K7SA 1K8MA 5DNFA 1EL0A 1EWCA 2W82A 2ZNVB 5EE1A 4XDDA 4V0BA 2WAQE 3DVGX 1VMCA 4GN3B 3RZOH 5CV9A 1FNUA 2H4OA 2JRIB 3JAME 2JUOA 2BYVE 4WJOA 3HG9A 4WWMA 1CA6A 2WDQB 5AJ3Q 2L1AA 2KX3A 1PTOF 1TQOA 2Q2IA 3UI2A 1K73C 1F2RI 2WDTB 3QB3A 1JOKA 3CCLA 1T0SC 1S5FD 5E4WC 4KN7C 1SIJA 4M00A 1DJRD 2CS4A 2ZTCA 3AEEB 3ZNZB 2H89B 3RN5A 5CV6A 3PO2H 1K0RA 5J1ZA 3B2GA 3DHHC 4DAYA 1J19A 2EYPA 3KLSA 4X6AH 5CX3A 1FIQA 2RDBC 2ZVOA 3BY4B 1LV9A 1TY0A 4JOIC 3NRZA 5BN3A 3AMZA 1A5RA 1NNXA 3DBLB 1ICFB 3H3VC 1PXUA 2JA6B 3K58A 4DV5L 2WXGA 3ZTCA 2I46A 3EJIA 4IOCA 3TEWA 4YY3L 2R92B 5FOBB 1VQHA 1PYSB 3SR1A 3SHQA 3TJPA 3MC9A 1Y8OB 3AM9A 4PYUA 2DJFC 3J81L 5ELNA 4A3DG 3RMKC 1H9MA 4A3IH 4X64L 3QAQA 1BUVT 3N52A 4BY1H 2JYTA 4JI7Q 2NBVB 2EXDA 1WGDA 1E0BA 3P20A 4AQYQ 3BVMA 3RZFA 2KC1A 1K83B 2K39A 1WWTA 5GAEC 3VDYA 4MZ9A 4A3FB 4XDXA 1L6UA 5C2TB 4DN4M 2KHWB 3OMCA 1E7UA 3CQZB 2KDIA 4QCLA 3HOVB 4HWIB 3ZYYX 2L32A 5GXGB 1MG8A 5M9OA 2CFMA 3M85A 2OQ0A 1H4RA 4DHZB 3W9CB 3HZXA 5DLQE 1P9DU 3OTOL 2A8VA 2GA4B 3GO5A 2MPMA 1LTLA 3RUZA 1VZ6A 1FYCA 3NENA 5I6YA 1NR2A 4KX6B 1OTCA 4OGQC 1EF1A 1JOQA 4EKUA
chains in the Genus database with same CATH topology
3DWAA 4CQNA 1GPXA 3NHHA 3VYUA 1Y56A 2JYEA 1DONA 1YNJD 1B50A 4MT5A 3KLRA 2KEEA 1D1KA 2WXFA 3FVQA 1WTQA 1BCPF 1TZOA 2B2WC 5T1IA 2Y0SB 5EE9A 3UI3A 3B9JA 1STNA 2F0VA 5CV7A 2MEKA 3NE5B 2NTSA 3AEDB 1QOHA 2K5DA 4HRSA 5C0XG 3DWMA 1UAPA 3IKJA 3T51B 3I72A 2WACA 1EYAA 2WDVB 3NBHA 2A74C 4YIJA 1I6VC 1ONLA 5KRUA 1VR9A 2ICIA 3NTIA 1FD7D 1T3QA 2LY7A 5CMDA 3MAQA 2B76B 3LWUA 1CHQD 4K5VA 1BUIC 2WXRA 1V1OA 1QOBA 3BK2A 3SXHA 2KCNA 1EU4A 4TQ1A 1NEKB 2EJMA 1DGJA 3BDLA 3R3OA 3CWIA 5KIXA 2EOTA 3TUOA 4KKIA 2MHVA 3O13A 1OXTA 2B2VC 3TZUA 2CU3A 1XCTL 1DZ1A 1JC7A 3J80L 1SXTA 3TBIB 3IL8A 5G5GA 3S1RB 3NTKA 1ZE3D 2XWJB 2Z4IA 3TP5A 2HDEA 4K8IA 1KH0A 3W2DA 3AEFB 4MACA 3KLSX 1KRHA 1VJKA 1RM6C 3Q8BA 2JA5B 4QUFA 3FILA 2YU9B 4OW0A 2B2TC 2BS2B 1JWMD 5IODA 1XCQL 4FXDA 2EE1A 2QIEB 1YNND 1PTOC 5AUKA 3AE2B 2K22A 1E9MA 2BDOA 4FF3A 5JPNC 1F0ZA 2IGHA 2ENBA 2IL8A 2F0MA 4B08A 5HGTA 2KACA 4OIJA 2G9DA 3I91A 4R9WA 2JZPA 1H9KA 2RDFA 5BMHA 1HQRD 1DOIA 4NDXA 1KDCA 4XWWA 5EE3A 1A15A 3PZ7A 1Q90A 2VUMB 2HCCA 4XDCA 1KABA 1GB1A 5HI1A 1AZQA 3DEOA 2KWDA 2B2UC 1EIGA 2RSNA 4EQPA 4OZCA 1S4ZA 2F3VA 3A8JE 1IKLA 2M00A 1O80A 2JSVX 3Q69A 2EYFA 3TEZA 5D3DA 4HROA 1YJIA 3T56B 3SFDB 3U7ZA 3KK7A 1EFID 3WCQA 4NZLB 3P4PB 1D5XC 4HCEA 1V8QA 3U9OA 1R4QB 2IWHA 4CHTB 4WQMA 2JX5A 3IT6B 4KJNA 2RKSA 1F2MA 3GTPB 1NR4A 3VYSA 1WTVA 5C3XA 4RGMA 1PFMA 1VZ7A 1EEID 3K5NA 4B0MA 2IX0A 2WQYB 1ESRA 5BYQA 2L55A 2F0NA 2E3TA 3WOFA 2VB3X 1LTGD 5A2QE 1BCPC 5C4ZA 1TWHB 4RKLA 1PMRA 4KI0A 2JE6I 2J4XA 4DXFA 2BOSA 2D62A 2J0TD 1CQFA 1ILPA 1C78A 2W3RA 1ROEA 1VF5C 1R4PB 2BB6A 2B2WA 5E1FA 2PZTA 3MA2B 2B8FA 3ZQ4A 4N59A 1P7EA 2JQRB 2F4IA 5G3LD 3V96A 5JVG3 1JWUD 1KDAA 1AN8A 2F0PA 4A8XC 3QIAA 1XYIA 1TJEA 1KNAA 4IFDG 1HFNA 3C2PA 2DNCA 1TWFB 2OXPA 1PFDA 3M7GA 2ICEC 1HTPA 2F03A 3HVDA 1QNKA 1PDQA 3P4RB 1F2RC 3NVVA 3I8ZA 1EU3A 2FMMA 1RD9D 1CI3M 1GOZA 2NB0A 4FF2A 3S15B 2RVLA 2D5DA 4ZQ3A 3VR6A 2N9KA 3PUXA 2A73B 1WVLA 3LYYA 2CQAA 2QJLA 3QG1A 5KNCA 2ACZB 1LT3D 1G6ZA 2B2VA 3NTHA 4ZHPA 4ZK9B 4DA2A 3A8IE 1HTLD 3BDCA 5JVH3 3HOUB 1ESFA 1SE4A 1G291 3Q6SA 1CZWA 1AW7A 3K6OA 2PZWA 3ZJTA 1QCBD 5JEAG 1ZXIA 2LFNA 1QJOA 1V97A 1BNZA 5BYRA 4DNTB 4DU9A 1Y1VB 2HDMA 2RDGA 1C9FA 5ELEA 4A3MB 2EYMA 4PQXA 4U673 1C4QA 3NVYA 1YQ4B 4RKBA 1EY5A 3AMUA 1ACCA 2WLBA 2GI9A 3PUVA 4ZOHC 4DFAA 3EA6A 4C3IG 2K9XA 3OWFA 3GQBA 3H91A 4J6HA 4Q2JA 2B2YA 5EGTA 3DHQA 3TP8A 3AN1A 3BVZA 4Y7NB 4K6LA 3TZDA 1IGCA 1F9QA 2M2LA 5JOBA 2WXIA 3VYTA 4US8A 3MJ5A 3RPFC 1A2UA 1GXDC 4KHZA 5ISRA 5D7GA 3I4NB 4DAVA 4F8MA 3OIQA 4C7YA 2MJDA 1FO4A 4L2YA 1A70A 1EEFD 5AFWA 3BS1A 3W5VB 1C48A 1XWEA 4K2KA 2IDYA 1F9SA 2ZT9C 1BCPD 1Y1WB 2HDLA 3A7LA 3HEJA 1L0XB 2LMCA 2NYZD 4FXCA 3S14B 2PW9A 1N5WA 4WJWA 1SNOA 1JCKB 4RGTA 2V4IB 1F9RA 5FO8B 1FMAD 2JA8B 2PYKA 4RNAA 4A3EB 3C3LA 3C46A 5BMGA 3EGRA 5EKIA 3M4YA 1ENFA 2KJXA 3IT4B 4XYOA 2EY5A 4QIWB 1B53A 5IGEA 1E2VA 1E0ZA 1DOKA 1MSGA 4LTUA 4M0WA 1ZUD2 2Q8RE 4KGTA 3BDOA 2MH7A 3S2DB 1GHJA 1EQVA 2FE8A 1TKYA 2CHBD 2RA4A 4R8IA 3P4QB 4H0LC 3T16A 1LLRD 1HZ5A 5HG2A 1EQTA 1MPEA 4JWUC 5CC4A 1KNEA 5HURA 2PPBC 1IKMA 4J8QA 1WTPA 4BBRB 1YNJC 1GUNA 4R8NA 2A68D 5EKLA 3H6MA 2Z8LA 4YSYB 4XQNA 5EBCA 1OXVA 2AUJD 5C44B 3VA7A 3NXWA 2EYHA 2K0PA 2Y5PA 4HCSA 2BDNA 2A6ED 1HCZA 2WS3B 4FF4A 5H92C 1SEBD 2FHTA 4IDIA 2N88A 1ET9A 5ELDA 3M4OB 1J8IA 2NVXB 2H1EA 1TU2B 3Q8AA 5E6JA 1UWXA 5KGUA 1L5PA 5G3LF 3P1MA 1OQQA 1XLNA 2LUMA 4XT1B 4XWTA 3QJYA 5I6WA 2BW2A 5E3FA 1T6BX 2IPKD 3FEWX 3KUPA 3FILB 2XRSD 1Y8PB 1UGJA 1D4BA 4RHSA 4NW2A 1DD2A 1WRIA 1B9NA 1VCIA 4C3IB 4XE0A 3BG3A 1U4MA 3V2TA 3NS1A 3RD4A 5AUIA 1GUGA 4WURA 1X3PA 3TMEA 2EYJA 1OXSC 3FPUB 3H0GB 2LJIA 1SYFA 4IUQA 3AH7A 4C3HB 1SFOB 5IT9L 4HKQA 3K7AB 1EY8A 2KA7A 5COYA 2PVGC 1U4PA 1Y69U 1D1IA 2E2HB 1MHXA 3IFTA 4FNFA 1CJEA 4BA1I 2OEDA 3AE3B 2DBYA 1I4XA 3VR4A 2WKCA 4J3OD 4XTCS 1YN5A 1STYA 3CRKC 1X3QA 4E6IA 1YNNC 4MM3B 4DNRB 4YXDB 1T5XD 1CZPA 2EYLA 5K36H 4KHVA 1JWBD 3I9V1 4KJOA 2W54A 4NAMA 4WFN3 2L1BA 2R3ZA 2RSOA 1I4HA 3SHLA 2WXNA 4YTNB 2J42A 2NN6G 3A7AB 3U4EG 2G9HD 1I7HA 2FINB 4A3JB 3AE8B 4MHEA 4OHJA 4ULLA 1MHHE 3DMUA 1FM0D 1CTMA 4ZAIA 1I50B 4HEDA 2QDBA 2JA7B 1HFGA 4ID6A 1TVXA 5EKKA 2LHDA 2JXMB 2GRIA 4US9A 3GTGB 4OO1H 1YQ3B 3J81E 1VLBA 1PFBA 2N55A 2W55A 1BBXC 4EQOA 1Z6HA 4RWSC 2F0OA 1A3TA 4DGZA 2QMTA 3DWGC 2LHEA 5D3IB 1IUEA 3AEBB 1PGXA 1V8CA 2MJEA 3NZ3A 3FMCA 1QNUA 3AECB 1TWGB 1STEA 1IW7D 2ZXRA 4AQ7A 2F0EA 4KD4A 3PO0A 3OW7A 4RHRA 4P2CB 5IOCA 2QCPX 2J53A 3I3CA 4IOIE 4C1NI 1M8AA 1IBXA 4MIUA 1N60A 1FRDA 1P7FA 2L4NA 3ZJUA 1G8ZD 1OXXK 3D8GA 4AYBB 4F7XA 3EUB2 1Q8IA 5C4JB 2AWOA 2KN4A 1YN3A 3U9SA 4N58A 1ZOYB 3K5OA 3A55A 3MXNA 4KN4C 2ONQA 3NPPA 1QF6A 1JR0D 1PFNA 2WXKA 3Q0AA 5M3FB 1LTAD 2Y3AA 1RDPD 2D9UA 2XWBB 5ELCA 1AFPA 1FEHA 2JYOA 1WYGA 3B2FA 1L4DB 2KMMA 3GTLB 3QOJA 4Q5VA 1C4AA 1C8CA 2DLBA 4L8JA 1SJHD 1NENB 2VZKB 1XEEA 1BR9A 5M5XB 1PGBA 1ZDVA 4CJ0B 3TEXA 4KMUC 4QMGA 1QQRA 4O42A 2BE5D 3QOLA 1NYRA 3HVZA 2BYTA 3AB9A 2O5IC 4A55A 3MZ5A 4CJ2C 4C2MB 1SF0A 2LFIA 1IHZA 2PMZB 1NYQA 1MI2A 1EWHA 4IN3A 2E76C 3MHBA 5C6AA 3T13A 2INPE 1N62A 1MSHA 3A54A 3CRLC 3J80E 1SNDA 2BCOA 3W3AA 2NVTB 5FR3A 4HMJA 3BK1A 2EJGC 5DM73 1D6EC 1DXMA 4RH6A 1SE3A 1JWSD 3HOXB 1OQRA 4KKJA 2NVQB 2F0SA 3M3YB 2RQXA 5H8YE 4XT3B 4JBWA 1OO9B 2EY2A 3ONAB 2IJ0A 5TSSA 1OFFA 2VXWA 1W6KA 4LJZC 2YEPB 2JEAI 4A3DB 1E2WA 2N0SB 1F2LA 2KQ4X 2L0CA 3R93A 1G2SA 5LL6X 1BQQT 2PLPA 2WDRB 4ZUJA 3Q22A 1MVKA 1GUOA 4FXKC 2PNRC 4XQQA 2KQ3A 3RZDB 4KTAA 1S5CD 1BXTA 3J7YW 1HXYD 4OO1I 2WXLA 1LT4D 3FC4A 2LMCB 3LXFA 4FVMA 2CJNA 1XXGA 2LGIA 4ZRZA 1A3UA 4L23A 1MD2D 2ID0A 4DAPA 4OZAA 4RF0A 3AE6B 3I73A 2L11A 3PIP3 3VA5A 4DK0A 1PGAA 4KK7A 4KGSA 5MPOA 1WTXA 1ENAA 1JQ4A 5KEEA 2A6HD 1R7SA 1SNMA 4ITKA 1ZXTA 5CYUA 5E4XA 1V1PB 1RFKA 3ZJVA 5T8IA 4HTHA 2MJ8A 4QB4A 4MH8A 2R61A 3MHZA 2ZW0A 3I4LA 1QOGA 2I07B 5KYLA 4B0EA 2SDFA 1QOAA 2XSCA 4HSVA 1JMLA 1TS5A 3E5SA 1ICWA 4H2AA 2W3SA 1BO0A 2X6GA 1LTBD 1WTOA 3BIID 3L9AX 1QE6A 1UWMA 4RCNA 3URYA 1EYCA 1O7LA 1SJED 3D6CA 3GV3A 2DY7A 1BF4A 3C1FA 1Q3LA 2PW7A 1FCCC 3DM1A 3A56A 2OHFA 5D65A 1K52A 2Q8IB 4OVZA 4C1NK 1UNSA 4JPSA 5IGFA 2K33A 2FBWB 2MUYA 1FR3A 1EOTA 3ND9A 1IGDA 4TMAB 2K1BA 3K0YA 3BWUD 2G1EA 2K03A 4MN3A 4HJGE 2WIIB 5BMIA 1JRPA 1ET6A 2BA0A 2VZKD 2A68C 2K3UA 4CKEA 4WIPA 4ZRQA 1YNTE 3HOWB 3IAM1 1RCVD 2A69D 1N63A 4YTMB 4ZHOA 1ENCA 4N6EB 4WORA 2A6EC 3K5LA 2Q8TA 4A90A 1SSOA 3HOZB 1HZ6A 4N9TA 2B2TA 2M9VA 3ND8A 4CGYB 3NQIA 1A3VA 2LKVA 1Q12A 4RAUC 5LL6S 3LNNA 5I9OA 2EPBA 3TP6A 1FFVA 1PLFA 3CIRB 5I4DA 4AS1A 5FO7B 3SK4A 3ABVB 3SFEB 4I65A 4RGNA 1QT9A 2JSOA 2KDMA 4ARIA 1H9JA 3VR3A 1JE4A 3D4DA 2I38A 1SSNA 4HMIA 2L52A 3VR5A 5C3WA 4DXGA 2DY8A 2XN9C 4USAA 4IALA 2WXHA 1HQMC 3RFZB 1AEXA 4NKLA 4P16A 1TKWB 2B2UA 4HSPA 5FLXL 1SYEA 1J7BA 2J7ZA 5C0XH 1C4PA 3RMHA 2GB1A 4RFBA 3NVWA 3P63A 4A3BB 2KEDA 4O1NA 2AQ3B 1DOYA 2KCCA 4BS9A 1VF7A 1I4RA 4HN7A 4L6TB 5EBDA 1Z47A 1NCVA 4TRDA 1G2TA 4WH4A 3PIO3 1NI3A 2AUKA 1PRTB 1I6HB 2LEKA 1ZKOA 3D4WA 1NAPA 1ML0D 4A9AA 2AQ2B 3EQLC 1EM7A 3SEBA 4H13C 2E74C 3NVZA 1SB3C 5FLXE 1MBYA 1JORA 1RYJA 1F2YA 2WXOA 2WV6D 3WDNA 5K5PA 3WOEA 5IGBA 1QG7A 2AQ1B 2C9OA 1RTNA 1DM0B 2XIWA 1S5ED 2HUGA 1KDBA 3S17B 1OXUA 1NUCA 3G7LA 2F0FA 1B2TA 4EQNA 2X38A 1RKNA 3RZOB 1GUSA 4X3KA 4KY6A 3T4AC 3I70A 4C7ZA 3L7ZC 4X3UA 1JOOA 2SOBA 3MXPA 5ELFA 3KBGA 1QKZA 4NAWB 1IBXB 2M19A 1JB3A 1NSNS 4HKZE 2OT2A 4PNYA 2RPVA 2E2JB 2V3NA 4IURA 2PTLA 1HUMA 1GAQB 2O4XA 3Q24A 3D3RA 3DWPA 1TS2A 5BN5A 1IW7C 4A3IB 2NN6I 3G6JB 3TEYA 4BY1B 3J7AV 3GD7A 5JPMC 5J39A 4IQZA 2FFKB 2PCFB 2DYOA 2K01A 1FNWA 1QILA 2F0KA 4PMWA 1PUTA 1GUTA 2QSDA 1TIID 4HR7B 3W5UB 4RCOA 2MGSA 4UDUC 5HFYA 1VDVA 3LB8C 3E56A 1L6VA 1ZPSA 2CW0D 3N9YC 2EDGA 2WP9B 1B1ZA 1B4OA 1TT2A 5IGGA 4BWGB 1FD6A 3D4RA 2K6AA 2Z4HA 1A6XA 2JEBI 3TSSA 3MP9A 1CM9A 2BBCA 2O5JC 1BMLC 3I90A 1Z7TA 2EYOA 5EPLA 4P6VF 4WAFA 2XVSA 3NWSA 3SK5A 1B3AA 2PO4A 1HA6A 3JAML 4ZRPA 1RWSA 2O2LD 5C0XI 1K50A 5JXVA 3PUYA 2BE5C 4C80A 1CT1D 5M5WB 1NVID 1O7YA 2LS01 3E0JA 5M5YB 3FPPA 1YJJA 4K14A 1Q1EA 1A2TA 5EJWA 4CJ1B 1C76A 1LO5D 3R8BA 1LTRD 3KBXA 3D31A 4EVOA 4U68A 1U4LA 2ZXOA 3SE0A 4BBSB 2C5CA 5DEHA 1STGA 2QKIC 1HRJA 2K28A 5KYIA 4A6QA 3SK8A 1Q1BA 2WKDA 3BZDB 4ILWA 2K5PA 2IGGA 3NK9A 2R6GA 1JQYD 4HAEA 4ODGA 1SMYD 4KGRA 1HEZE 4LK0M 3E9SA 4GDLB 4IFDH 1GHKA 4K5XA 3AE1B 1WCMB 2K32A 5IT9E 5M3MB 4NP5A 5C5MA 3PUWA 2EY6A 5J22A 1PRTD 4KY5A 2V3PA 1XX8A 4ZKCB 4ZLTF 2HQEA 4CKCA 3T3NA 1I4GA 2Y5CA 1FXIA 2L83A 4QF4A 1N61A 3S1MB 3K59A 4JX1C 5CR3A 1D2BA 4G7OC 2WXMA 4TQ0A 5ELBA 1K8OA 4LAAA 2EY1A 1SNPA 2JP1A 5EPKA 5JJZA 1CQVA 3OMGA 4S3SA 3KWLA 2YEPF 1ZDXA 1VZ8A 1RTOA 3AEAB 4KD3A 3HS0C 1C79A 1D5MC 3NWTA 2QILA 1K53A 3Q8CA 1ZYRD 2PVOD 4F87A 2EELA 3QO2A 3BVGA 5JEAH 3HRDD 3K5MA 5HHDG 2OF1A 2SEBD 3KWVA 2V4DA 2D5GA 3N6RA 3FAHA 3SR6A 3DXJC 3CU7A 3P75A 2FMCA 4KV6A 3L4PA 3H8HA 4A93B 2JWUA 2EZVA 1H9SA 1STAA 5CV5A 4QUCA 1S5BD 1L4ZB 1KLGD 3TP7A 3AE4B 4FXGC 2A6HC 1UEAB 2ON8A 2B39A 3GP7A 4ZUIA 2WXPA 3HUIA 3K57A 1F9PA 1JW9D 4R3DA 4IZ8A 1B9MA 4TSSA 1HA5A 2R7ZB 1E10A 4A3KB 1O7ZA 3DUZA 3LX0A 4Z9CB 1XLPA 4K6DA 3MXUA 4REZA 3S2HB 1CZGA 5C3JB 3AE7B 3W1SA 2L12A 3ERQA 1JALA 4EE2A 2F0JA 1B44D 1H9RA 4ZKBB 2SNMA 3HKZB 1TS4A 2F0LA 3V3XA 2NTTA 1STHA 4IKGA 4B9XA 3OWEB 2WNMA 3J7AF 4NJCA 3GTKB 1LACA 2MP1A 1RF2D 3FDTA 1L0VB 4LMQD 1KLUD 1D5ZC 3HP3A 1DOMA 1DYQA 1L0YB 4G7HC 2NUCA 4K5WA 2N7JA 5KNBA 2J52A 1AZPA 1XTCD 3EVQA 4JK1C 1BDOA 2YYZA 2BS4B 4ABNA 1WD0A 3VRAB 5EE0A 2F0GA 1O78A 5FKAC 2Q5WD 2F0WA 1BOSA 2NWGA 2ZXPA 2IX3A 1PTOB 3MVVA 1KF6B 1QWYA 3J9CA 3U52E 2A69C 1PDXA 2K05A 3SK6A 3NUHB 3U2SC 2RMMA 5I2XA 3DEPA 3OPOA 2KUMA 4BY7B 1X32A 3VR2A 1KAAA 2WAQB 3V05A 4IFDI 1VRAB 1XO3A 4K8JA 3NBIA 5CV8A 1QLBB 1FXAA 1HPCA 1YMHE 2D2CC 2F0QA 3PO3B 4KY7A 3TDQA 2H88B 4C3JG 1B9RA 2E6XA 1SYCA 5BYSA 3TN2A 1JROA 4IUPA 3KQ4A 2DNEA 4XYQA 1DOXA 3PUZA 2B2YC 1FCLA 1SYBA 1Q10A 4TKOB 3SVMA 1SNQA 3R2TA 1GJXA 1EZ8A 3AV8A 4L1BA 1I4QA 3X3MA 1M4VA 5I2YA 1IYUA 1C77A 2F3WA 3AE9B 4XIGS 3QWNA 1N5XA 2CVRA 3CHBD 3VR8B 5NUCA 1JWAD 1R9TB 5C0XJ 2F0UA 1WD1A 4PT5A 5CGKA 1I4PA 2AWNA 1SYGA 2WU5B 2XNAC 3L3OC 2OEOA 1E7PB 1WXQA 5A2QL 2DWQA 4XQJA 4PMBA 5KNDA 2BA1A 2IX1A 3P42A 5LHY1 3FRPB 1BCPB 5CBAE 2K04A 2RBMA 3P1HA 1FGBD 4M1UB 5DM63 3MTSA 1T5EA 4OL7A 3I57A 4NMZA 2B63B 2IGDA 1E6EB 3GS2A 4IUTA 5I9PA 3OOCA 3C1EA 1RODA 2KECA 1PRTF 3D6WA 3MWYW 4FO2A 2KOLA 5C4XB 3NSWA 3ITPA 3NQTA 2WU2B 3A8KE 1AYFA 2SNSA 4YSZB 3M7NA 3PMFA 4EGVA 3NUCA 1PZKD 2X6LA 2B8GA 4IUUA 3Q23A 4N9PA 5CORA 1EY6A 4OZBA 4DF7A 1CA5A 2KVMA 1EZ6A 1J7CA 1QB5D 1PTOH 4G57A 2PQEA 1XF5L 3GTJB 4ARCA 2FJ2A 1QOFA 3MFYA 2TSSA 2NZ1D 4TQUS 5C5LA 4J1MA 1CK1A 3BYTB 5K36G 2M0AA 4G7ZC 2KAJA 5FK9C 4Q0FA 3SDZA 3S9WA 1LTID 3S16B 3IAYA 4HEA1 4D2KA 3H09A 1TWCB 1CHPD 4C56C 1ZP0B 1DOLA 1V43A 3OIPA 3OHXC 4DK1A 1EWYC 3HOYB 1ILQA 1J9OA 1TY2A 2E75C 1E2ZA 3FKIB 1IL8A 3IFDA 4GDKB 2PZUA 2NN6H 4YWGG 1W6JA 1Y8NB 3PV0A 1PZID 1JICA 5D14A 1MI0A 2M56B 2VB2X 2WB1B 1PTOD 1FNVA 2EXZA 4BA2I 2R93B 2DN8A 4OO1G 1WTRA 3ZGZA 5EQ0A 3ETRA 2NMQA 3C8YA 3HGBA 2RDHA 2CW0C 4A3GB 4G4KA 4RGOS 4C3JB 1EY0A 1EY9A 1KTKA 3E6ZX 3VYRA 4FYDA 1II3A 3T3OA 1TR5A 2FUG1 1WTWA 1SDFA 4JE3B 2E2DC 3R2IA 1LTTD 2JXTA 1TWAB 4V190 1G91A 1AWDA 1F77A 5G5HA 4XXEA 2VNUD 4GLSC 1WGKA 5EPJA 4C3HG 3NP8A 3BYYB 3RLFA 2NVYB 2BT6A 3AU7A 4RA8A 1ZEQX 2K7VA 3EFXD 3MEHA 5LNK1 1HUNA 1SAPA 4UAIA 3GV6A 4H44C 1YN4A 2WXJA 4RF1A 4YSXB 3CKIB 3MC0B 1I3QB 2F0TA 1AP0A 1PZJD 4IFDJ 1KFYB 1TKGA 1SMYC 3KF8A 2BB5A 4GZYC 3F2UA 5BN4A 4FF1A 3OSOA 1SBBB 4I7ZC 3VRBB 3IXSA 2SAKA 1PRTC 4KKTA 5C3EB 2L9HA 2DYMA 2EVBA 3DWQA 2N9LA 2KHSA 4CKBA 1GUWA 2ZW1A 3Q8EA 2PW5A 3MFGA 1F2ZA 1FFUA 4H7BA 3S1NB 1STBA 1SNCA 2MJ3A 4KKUA 1K51A 2EJFC 4ZYSA 1H9SB 5JEAJ 1SYDA 1V1PA 1C4CA 1ZYRC 3PO2B 1FRRA 2INNE 1ZXHA 2I2YA 2K5QA 5CBEE 1LT5D 2BTEA 1RHPA 1MGSA 2CJOA 3P7JA 1VMPA 2WXQA 1HHVA 1UUPA 1TYGB 2NBFA 2PKOA 3Q8FA 4PV1C 5IGDA 2JU6X 4FP5D 1DCZA 1IYVA 5F2DA 2QF7A 5IIFA 2X69A 3VQIA 4LLGM 1TKEA 4IUNA 1VDZA 1U4RA 5DAUA 2K5WA 5C4HA 5CV4A 4WRDA 4L63B 2AX5A 1WSPA 4KKSA 2A5HA 1EY4A 4JWSC 4OIKA 2WINB 3T53B 5A35A 4PMCA 1S5DD 3X3NA 4X3SA 1U9RA 3MXGA 1RJTA 1EIHA 3GTQB 2Z1CA 4LK1C 3LWEA 1SE2A 1EYDA 3VR9B 2XRQD 1TS3A 4DQOC 2IW3A 3PZ8A 3AEGB 2PMVA 1J7AA 2HTME 1GB4A 3EROA 4CBVA 4YT0B 2BS3B 1LTSD 1CFMA 2HCIA 2E2IB 4F88A 1EY7A 3HRZC 2V0GA 2PIAA 1LABA 3AB5A 1LT6D 4X3TA 2L5TA 1XLQA 2QEJC 2WP8J 2EKIA 4YTPB 3I4MB 4IUVA 4ME5A 4K2LA 2F0IA 3P4SB 3GTMB 2F0DA 3S1QB 2F1MA 3IAS1 2F0HA 2IT1A 4B9WA 3GB1A 2TMPA 3H94A 5T1GA 5JAVA 3AE5B 5FO9B 3GTOB 5IGCA 1XLOA 4M8AA 1PYWD 1K8MA 5DNFA 1EL0A 1EWCA 2W82A 5EE1A 4XDDA 4V0BA 1VMCA 5CV9A 1FNUA 2H4OA 4WWMA 3JAME 3HG9A 1CA6A 2WDQB 2L1AA 1PTOF 1TQOA 3UI2A 1F2RI 3QB3A 1JOKA 1S5FD</