1RFKA

Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
95
Chain Sequence
ATYKVTLINGLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the thermostability of ferredoxin from the cyanobacterium Mastigocladus laminosus.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 25
structure length 95
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1rfkA00
1PDXA 3NVVA 3CWIA 1QLBB 3AEAB 1FIQA 3DWMA 1N5WA 1JROA 2WDQB 2K22A 1YJJA 2M19A 1FRRA 1SIJA 2JX5A 2QJLA 1ZP0B 1E9MA 1RFKA 1NYRA 3AEEB 4KX6B 4IDIA 4WWMA 3HUIA 5C2TB 1R7SA 1B9RA 2MH7A 5AUKA 2WDVB 1VDVA 3FC4A 5C3JB 1VJKA 3NS1A 3SFEB 1WXQA 2G1EA 3W9CB 1L6UA 1JWBD 1TJEA 2M56B 3NVZA 1OFFA 4C7ZA 3SR6A 4US9A 3AE9B 1JW9D 2WLBA 2OHFA 4ITKA 5EE3A 4USAA 3VRAB 1ZUD2 1ZXIA 3NRZA 3L4PA 5AUIA 3P63A 3LB8C 1KF6B 2KAJA 4JX1C 1FXIA 2BS4B 3AE5B 3HVZA 3AEFB 3AE6B 1IUEA 1N5XA 4ZOHC 2WDRB 1TYGB 5H8YE 3FAHA 5MPOA 1GPXA 2H88B 4JWSC 1WRIA 3B2FA 1N63A 3AM9A 4YXDB 1I7HA 5H92C 1JALA 2BT6A 2QIEB 4A9AA 2FBWB 2CJNA 2PVGC 2PVOD 1E0ZA 4YSXB 4N59A 1AYFA 3AE1B 4ZHPA 1JQ4A 1J7CA 1XLQA 4HROA 4WQMA 1WWTA 4FXCA 3AMZA 1TKGA 4JWUC 1DGJA 1L5PA 4YSZB 1DOYA 1UWMA 1SF0A 2HTME 1XLOA 2L52A 3W5UB 3WCQA 1QT9A 2LEKA 1DOIA 1V97A 3P1MA 5GXGB 1NI3A 2W55A 4YTPB 1QOFA 4N58A 1NVID 1E7PB 4P6VF 1VLBA 1RYJA 3P4QB 2WP9B 1ZOYB 2DWQA 1J7AA 3AEGB 5G5HA 3AH7A 3AE2B 1TKEA 2BS3B 3AE4B 3AE8B 3AV8A 1YJIA 2MJEA 1EWYC 2BS2B 2W54A 1L6VA 1YQ4B 3B2GA 3AE7B 1A70A 1FRDA 3B9JA 1L0VB 3W5VB 1ROEA 1QOGA 3AB5A 3LXFA 1GAQB 4N6EB 1FO4A 4US8A 2AX5A 1KFYB 1J7BA 1FFUA 1YQ3B 1FXAA 2PKOA 2W3SA 1FM0D 3CIRB 3SFDB 1DOXA 3AEDB 1PUTA 1JWAD 1CZPA 3ETRA 1RWSA 1QF6A 3KWLA 5EE0A 1SB3C 1KRHA 3AECB 3AE3B 4C7YA 2Y5CA 1F0ZA 1FFVA 2B76B 3AN1A 1XO3A 2EKIA 2PIAA 3HRDD 3ZYYX 1RM6C 1N61A 2MJDA 3RPFC 2WU5B 3VR9B 3AEBB 2MJ3A 1NENB 2N0SB 2ACZB 1PFDA 4YTMB 3NVYA 3NVWA 2K9XA 4YTNB 3PO0A 2WU2B 1NYQA 3P4PB 2K5PA 2WQYB 2Q5WD 5EE1A 2DBYA 2CJOA 4HRSA 2WS3B 1V8CA 2H89B 3ABVB 4YSYB 1NEKB 2W3RA 1FMAD 1TKYA 2E3TA 4ZHOA 1OQRA 2KMMA 3BIID 1QOAA 4C80A 1QOBA 2CU3A 3P4RB 2JQRB 5EE9A 1XLNA 2L83A 1WYGA 3EUB2 1CJEA 3VRBB 1WGKA 1XLPA 1E6EB 1OQQA 1JRPA 1E10A 1AWDA 1N62A 4LTUA 4YT0B 3VR8B 3P4SB 3DWGC 1T3QA 1N60A 5G5GA
chains in the Genus database with same CATH superfamily
3NS8A 3PTFC 4E3CA 2FE8A 1WSPA 3OG5A 1JCKB 3TMPB 1FRRA 1TS4A 1C9FA 1B9RA 2MH7A 2DZIA 4W9KA 1OFFA 2LUMA 3GE8C 2X38A 3AE9B 1SEBD 2LUEA 1ZXIA 2K6DB 4RFBA 2MHJA 2IDYA 1KOTA 1WMHB 4RM9A 1GPXA 4IW0A 1SJHD 4W9EA 4A9AA 1HZ5A 2CJNA 3VH4B 2D3BA 5LNK1 1BT0A 3IT6B 2PJHA 4JWUC 1AW7A 1UWMA 2L3ZA 2PPHA 2WXGA 3HVDA 4B9KA 2CHZA 3X23A 1RYJA 5HKHA 4E74A 3UF8A 4KZCA 2RPQA 2ON8A 2KVRA 5T8IA 3LXFA 3A1QB 1XCQL 3B1LX 4PT5A 2KDFB 4BBNC 1MG8A 3RYTA 2RGFA 1WF9A 4KVGB 1WJNA 5EE0A 5L83A 1S1QB 1YN3A 4GSWA 1TZ1A 3VTVA 1KLUD 1WFYA 2ZW1A 3MHZA 1TGZB 2K5PA 2Q5WD 1Q1OA 2CJOA 1WR1A 1OGWA 5HFYA 2KO3A 3V3XA 2ZCBA 1QOAA 3EA6A 4ANUA 3P4RB 2GMIC 1WYGA 3VXWA 1T0SC 3M3JA 1JRUA 3ZTDA 4YT0B 1UD7A 3NZ3A 3P42A 3L16A 1PDXA 1YN5A 2QEJC 1UUPA 3PVLA 1N5WA 3ZJUA 4ASWC 2LJIA 2WGSA 4HKQA 1L4ZB 1M4VA 3UQAA 4I6LB 1VDVA 4GN1A 2KT7A 1EM7A 4K7WA 3EHVA 1TJEA 1H4RA 3A9JA 2ICIA 1JW9D 1OTRB 1I42A 2LVOA 2LGXA 4USAA 3V6CB 3U2SC 2IJ0A 4FN2A 1D3ZA 3L08A 3L0WB 2BTEA 2IY1B 1BUIC 4TSSA 3VAWA 2FNJB 2FBWB 4ZHPA 3KVFB 2AWTA 2JY6A 1YD8U 1S3SG 2N9EB 2AL6A 4G3XB 2NTTA 1NI3A 4IWPA 1Q5WB 4WAAA 2KNBA 4AS1A 3U7DA 3B9JA 4NPNA 5BYQA 1OEYA 1D5MC 2WXLA 5DPRA 2J0MA 2I1JA 3JSVA 4UDUC 3AECB 5BMHA 4LJPB 1AARA 1J0GA 1FNVA 2GBMA 4OVZA 5DPSA 3VR9B 1HQRD 4A3OA 2KWUB 1L0XB 2UWQA 2FIFA 4IG7B 2EKEC 4LDTB 2KOXA 1JWUD 5EE9A 2L83A 3EUB2 1JRPA 1N62A 2BKRB 3SD5A 4P16A 4HCNB 2LXCA 2BF8B 2LVPA 1UNSA 4KDLB 5KHOA 1JROA 3AXCA 4PK1A 3DHIC 4HK2A 3ZQ4A 3E9SA 4XGAB 3C0RB 4US9A 3CSTA 2O6VA 3RN9C 1WX8A 2JYEA 1KF6B 1C3TA 2KJRA 5D7GA 1FXIA 2NTSA 2W9NA 2DHZA 4WJPA 1N5XA 5D3DA 5H8YE 3QAQA 4GOCA 4LNIA 4CYEA 5IO9A 3NUHB 3I9V1 2BT6A 4EZJA 4YSXB 1XLQA 3N9YC 2IGDA 4NY0A 1TKGA 1ZXHA 2MX2A 1XLOA 4W9LA 2CS4A 4DHZE 5JH5C 1I4QA 2YLMA 1VLBA 3DVNV 3P4QB 4D2KA 4MACA 1IP9A 2WXMA 3DBHB 4GLSC 3T9LA 4ZRIA 3X0WA 1YNTE 1WIAA 3K9PB 1FM0D 1P3QU 1MFWA 3DBLI 3CSFA 2MBHA 1QF6A 2D10A 2JT4B 2J0JA 3N32A 2LGYA 2KYWA 4FJZA 1WX9A 3H8HA 3Q3OC 3KW5B 1WZ0A 4RGMA 2KN5A 4BAXA 1J19A 2CKHB 1UWXA 3VQIA 1FMAD 1TKYA 3Q14C 4MT5A 1WGYA 2ZNVB 4JPSA 4W9FA 2ZJDA 2WXQA 4LDTD 1R4MB 2KFJA 1N60A 2D3CA 1WM2A 4MELA 4OZBA 3PRMB 2GLSA 4ACFA 5C2TB 2MCNB 4MM3A 3DVGX 4IUMB 2WWZA 3RNAC 1K53A 2V3PA 2M56B 3U52E 4BKGA 1ET9A 4XWTA 2WLBA 3H1UA 1STEA 4S17A 4BKSA 2BWES 4ANWA 3ML8A 1ZUD2 4GIVA 4JGHB 3P63A 3N1XC 1C4AA 1TYGB 2AQ1B 2XK5B 3OLMD 3WIMA 3NJTA 3ZDMC 1JQ4A 5G55A 1F1HA 4FJVB 2INDC 4YSZB 2MBEA 3PS6A 4OW0A 4FHKA 4YTPB 3ZVVA 2BW2A 3Q8CA 2C7MB 2K1FA 4WURA 2JVCA 4FA6A 3RULA 2BS3B 2LD9A 2ZPNA 3NZUA 4US8A 3U7ZA 2PKOA 1SE9A 4W9IA 3I57A 2EKIA 2PIAA 3UQBA 2JZ3B 2KN4A 2KFKA 4DWFA 2O6VD 2LJ5A 2DAJA 4KDIC 1D6EC 4JL9A 2KMMA 3BIID 1LGRA 2FCQA 1RFAA 4G11A 3JW0X 4P1CC 3R8BA 1WGKA 2WXRA 1OQQA 5HI1A 4CHKA 2NCNA 1FRDA 2JX5A 3MTNB 4YTNB 1E9MA 3HHMA 1TS3A 2J42A 4CQNA 5CTRC 4KSKC 3VH3B 3EC8A 2LMCA 4C4VB 3QJZA 3SR6A 4DXFA 2V3SA 5TR5A 1LFDA 2BKFA 2KAJA 4E71A 2INCC 1V86A 2YEPB 1TY0A 3DHHC 2FUG1 4JE3B 3BVMA 2OJRA 3LJ3A 3DBLB 4URKA 4MGYE 4EKUA 3HK0A 1L0YB 4HROA 1UGMA 3GOEA 1UF0A 2HD5B 1TTNA 3GB1A 4C00A 1GUAB 1OEYJ 3CF6E 4RCOA 1FNUA 3WAMA 2KX3A 4ZRKA 3VUYA 3V62A 3Q8FA 2IO3B 2GRIA 2QSDA 1FFUA 4FBJB 2C7HA 1V5TA 3SFDB 1CZPA 2LGDA 3GP7A 4G50A 1XO3A 2OOBB 3PV1A 3H7SA 2N0SB 4IWOA 3E56A 3NVYA 3PO0A 1BXTA 2BYVE 3MHSD 1C76A 2V3NA 5EE1A 4AWJA 3WALA 5AEKB 1KH0A 2K0PA 2D5GA 1KJTA 3O65B 2KFKB 4WH4A 3V6EB 1OQRA 2VZKD 1P1AA 3KUZA 2QC8A 2KMAA 3ZXVA 2K8BA 1I4RA 3ZRCA 3TUOA 1T3QA 5G5GA 2K22A 4KIKB 3U30A 1WGRA 4DXAB 5AUKA 4TKNA 2K6QA 1ZW7A 2CU1A 4ZYSA 1C1YB 3OJ3A 3EFCA 1I4GA 3U8ZA 3O13A 5IKCM 4K7UA 5CHWA 4PYZA 3H9DA 1E0ZA 1JWMD 4MGZE 3NHEB 3AU5A 2NMQA 2VZKB 4P1BC 2G45B 3L54A 3Q6BA 3PZ8A 3IT4B 1DOIA 4HPMB 1EUVB 4DHZB 2N7JA 2WP9B 2DWQA 2KWVB 4TV3A 3L17A 4MM3B 5DCNA 1WRDB 3VFKA 2BBCA 1V5OA 3EECA 2RDGA 1PGXA 1WXMA 1FXAA 5DPWA 3AEDB 3KWLA 1RLFA 5JZEB 1VCBA 2VH1A 3IHPC 3R7RA 2IYDB 2ZEQA 4A8XC 2IBIB 4EZLA 2IY0B 2JXTA 4B0MA 3B08A 2A4ZA 2ZVNA 4DXGA 1NEKB 1WGDA 2N1VA 2M0XA 2LVQA 2I38A 3TL5A 3BYTB 4B0EA 2MBQA 4B6WA 1WX7A 3MFGA 1X1MA 2HE7A 4ICUA 2L76A 1HE8A 2KWCA 2C7NB 1FIQA 3DWMA 1HXYD 2MBOA 3HUIA 2QMTA 3A9JB 2CR5A 2UU7A 2G1EA 1JWBD 1ENFA 1T0QC 4KKJA 3BVGA 3AU4A 3ZLZA 4MH8A 2V4IB 4LCDE 2BS4B 4A55A 2PW9A 3DQVA 1U4AA 4DDGD 1UZXB 2FIDA 3VTUA 3FAHA 1GOZA 2Y5PA 2WXJA 2PVOD 1K52A 2PE6B 1YOVB 1M94A 3I63C 2DLBA 4JQWC 2KVZA 2L52A 1V97A 1WI0A 4AJYB 3APCA 2W55A 4N58A 4RF1A 1KLGD 4P6VF 4A90A 2M4NA 3KUCB 2R2QA 1EF5A 2REXA 2X8XX 2QDFA 3APFA 2IO2B 1RWSA 4PS3A 2IZVB 1SE2A 2WXPA 3LDZE 3QA8A 3BYYB 4DBGA 4N9F4 4DDID 2RMMA 2ACZB 4W9GA 2ZPYA 5C23A 2J4XA 3W1SC 4YWGG 4F7ZA 3NG0A 3PLUA 2DYMA 3RNBC 2WX0A 3TCAA 3MP9A 1C79A 1EO6A 5HHDG 1L2NA 1XLNA 3R2IA 1V49A 2L05A 3DWGC 4ITKA 4XWWA 2N9PC 2M19A 1RFKA 3M62B 4M8MA 4NAWA 2V0GA 1T6BX 4A20A 3M63B 2B3AA 3ALBA 3PZDA 4HJGE 3RZWC 4AJWA 4L2YA 4HLEA 4S0RA 4AP4C 4GB9A 2D07B 3N20C 4MSMB 1I7HA 4HPPA 3AE1B 2IO1B 4WQMA 2LGSA 3GZNB 4RMAA 1Q10A 2WNMA 4NJCA 4NAMA 2BQQA 3SDLC 3AE2B 3AE8B 5E6PA 3D32A 3NZSA 4K1RB 5D94A 2JYTA 4KIKA 2QILA 4LNKA 2M8SA 4OVVA 3UGBB 1IPGA 3IVFA 3RI7C 4GDLA 3QQ8B 1B1ZA 5BMGA 1FFVA 2C9WB 4GXBA 1N61A 1HA5A 2A5UA 2I1KA 1NENB 2K9XA 1F2RC 1YQBA 4WJNA 1V1OA 1ZPSA 3ZJVA 1NBFC 2K3UA 1XXGA 4NZLB 1GC7A 2DYBA 2LI5A 3P2BA 4CO7A 3JSVB 1WXSA 2Z8LA 4EUTA 2NBUA 2QHOA 1T5XD 1GJZA 3TEXA 3JVZX 3A1QA 2WDQB 4Q2JA 2AYOB 4TQ1A 2DZJA 4JLCA 2DX5B 5IA7A 2KDMA 1H8CA 1P7EA 1FPYA 3QX1A 2PTLA 4LNOA 1VZ8A 2BYFA 2NBWB 2Z0DB 2FCNA 2JPHA 1IUEA 1UELA 4GGQA 1WRIA 4M0WA 5LXHA 1JALA 2QIEB 2PVGC 4N59A 1TBEA 5J18A 1WWTA 4NJ6A 3AMZA 3WAOA 3WCQA 3W5UB 2KZRA 3SEBA 5AZHA 3URYA 4HVBA 1D4BA 3AEGB 1RRBA 4RGOS 3APDA 2EMTA 1N6ZA 2KX0A 3Q69A 1EWYC 1YQ4B 3PRPB 1L0VB 1V9JA 3A9KA 2KJHB 3AB5A 1FO4A 4EE2A 2WXNA 3PREA 5E6JA 1V1PB 3R3MA 1ZDVA 2KDIA 1WZ3A 1ACCA 3A9KB 4F1SA 1RM6C 3T3NA 1TIFA 1G6JA 1MPEA 3PHXB 4EZKA 3S2AA 1V2YA 4BVUC 3AI5A 1ZGUB 4FULA 3UI3A 2M17A 2JUOA 5DPTA 1TT5B 1V8CA 2WXIA 1P98A 2FCSA 3WA0A 4C80A 4ICVA 2DENB 3MJ5A 3ZUNA 4MSQB 4LTUA 1WGHA 1GC6A 3ML9A 1DOYA 1SIJA 3AULA 2YEPF 3AEEB 2O6VB 3QARA 4IDIA 3B0AA 2QCZA 2GB1A 1F52A 2LWPA 3ZNGC 3SFEB 1WXQA 2V1YA 2LXAA 4WJQA 2BVCA 4KKIA 4A6QA 4WJOA 5EE3A 1SE4A 2PEAA 4HKZE 3W2DA 5KHQA 4TUUA 2JRHA 4ANXA 2KMCA 2WYQA 3B2FA 3AM9A 1EU4A 2ONQA 3Q8BA 2NR2A 2XNAC 2BYTA 1OQYA 4FXCA 5LLIA 3GE3C 1L5PA 3N1YC 1UBQA 2DZMA 1SE3A 3V05A 1QT9A 4DQOC 3QHTA 1NVID 3JYUA 2IGGA 4KV2A 4K3CA 4QAYA 1FD6A 2K8HA 3NOBA 4GDKA 4IWQA 1CMXB 3B2GA 2GOWA 3AE7B 5FKAC 2L32A 5D6JB 2V9HA 3DPDA 5G2NA 3N30A 3W1SA 1YX6B 4M00A 3CIRB 2JU6X 1QZEA 1WR6E 4GMVA 3R7QA 2GBJA 1IGCA 2Y5CA 4XE0A 3AN1A 3ZW3A 3OWEB 1XD3B 2IGHA 4DHJD 1FXTB 3VUXA 3KYDD 4HRSA 2EELA 2Z59B 2O2VB 4ZHOA 1P9DU 2ZW0A 1ZDXA 1TY2A 3A4SC 5BMIA 3PLVA 4M8NA 3VHTC 1IBXB 1L4DB 1E10A 3A33B 3IAS1 1AWDA 2EMSA 4II3B 3P4SB 4IOIE 4RH6A 1DYQA 3DBSA 1I4HA 2HDEA 2LRUA 1VZ7A 2D2QA 1SJED 3Q3FA 2KTRA 4WWMA 2R2OA 2LRWA 2N7EA 2NS5A 3WAPA 3ZNZB 2LZ6A 5IN7A 2MA9B 1Q0WB 2N4FA 1YX5B 4XZ4A 3BY4B 1PGBA 4MGIE 1V6EA 2WX1A 1A5RA 1WXAA 3LB8C 4JX1C 3HIZA 4OHJA 1P0RA 1ET6A 2KKCA 1XF5L 4DHJB 2MBBB 3SU8X 5MPOA 1EWCA 2DAFA 5CHFA 2PMVA 1K51A 5H92C 4MJSB 2KLCA 5J17A 3H6NA 3QK0A 2FAZA 1F77A 4JIOU 2HTME 1SF0A 1SXTA 3EGRA 1LM8B 4XDCA 1J7AA 3BVZA 5G5HA 3AH7A 4W9HA 4W9DA 2L00B 4L23A 4WWNA 2MJEA 1WE6A 5GMVA 1VZ6A 4MGKE 3W5VB 4RGNA 3J9CA 3VDZA 2KK8A 4N6EB 1CQVA 4WAFA 4OZCA 1JWAD 3EFUA 2MQJA 1KRHA 2KQSA 4C4VA 1LQBA 3HRDD 1WJUA 3Q3NC 1VD2A 5LXIB 3KLSX 4LJOB 4RGTA 3U4EG 3DBRI 2WXOA 2GBKA 1JWSD 1R4NB 3R66C 5I4DA 4MDKE 3DOWA 4WQOB 1BMLC 1WM3A 4KGTA 4M01A 2GI9A 1E8ZA 3VVWB 1XLPA 3IFWB 4BFRA 4NJ7A 1R4MI 2CHXA 3VTWA 1L7YA 3RD2A 3VR8B 3R2TA 3PZ7A 1NYRA 3H7PA 3A4RA 2YVCA 4KSLC 5C3JB 3FC4A 1VJKA 3TEZA 2BWFA 3KWVA 4LNFA 2JRIB 4G0NB 3MC9A 3NRZA 5AUIA 5IOIA 4RM8A 4K7SA 2NBVB 4ZDVA 3AEFB 2L8JA 3PRZA 2MLBA 2KDEB 4ZOHC 2TSSA 2Y5BB 3PHWB 2K8CA 1WY8A 2L0FA 4F8CB 3DHGC 3ZJTA 3LYYA 1K8RB 4HJKA 3RNCC 2RD0A 1YN4A 1E8YA 2LHEA 2AQ2B 5JXVA 2MSED 1TKEA 4HWIB 3AE4B 1YJIA 5J2RA 1A70A 4J3OD 1ROEA 1QOGA 2HJ1A 2ZZPB 1GAQB 3MC0B 1E90A 3RUIB 4OVUA 1WJ6A 3ONSA 2XEWA 5JHAA 1V81A 2K25A 2AEHA 1IBXA 2L1AA 1SBBB 1K50A 2B76B 2BYEA 4WWOA 2MJDA 2NPTB 2O2VA 2BB6A 5CHVC 4IM0A 1RAXA 3HM6X 4NQKE 2KTFA 2N9XA 3DBHI 3UIPB 2N7DA 2G4SA 2N1WA 3TIXA 3RZFA 5E6OA 2PE9A 3DVGY 2JXXA 2K39A 1QLBB 2M1MA 2QJLA 1YJJA 4KGSA 2AQ3B 4II2B 1XT9B 3NS1A 1L6UA 1KTKA 1MG4A 3NVZA 4C7ZA 4BOZB 2J52A 4BKSD 3H7PB 2J53A 3K9OB 1HTOA 2D3GA 3L4PA 1QILA 4HXDA 2JZZA 4XC2A 2WDRB 3IG3A 4PS8A 3RNGC 5EDSA 3CMMB 3QWZB 2H88B 2VH2A 4JWSC 3ZXRA 5TSSA 4YXDB 3RCZA 1UH6A 2XK5A 1V1PA 2ZVOA 1PGAA 4XDDA 1QQRA 1WMHA 1ZE3D 3VUWA 2Z0EB 5D3IB 5GXGB 2KDBA 3DCGA 1NDDA 2ASQA 4AOFA 2L7RA 1WE7A 1C77A 1C4CA 4AUQC 1YMHE 3AV8A 1E7VA 4L1BA 1L6VA 4XX5A 1E5WA 4P7IA 4IC7B 2WHIA 4KGRA 1I4XA 2AX5A 4W9CA 1GNUA 4GU2A 1DOXA 1I4PA 1C78A 1SB3C 2LASA 2UYZB 5FK9C 3KQ4A 3ZO5B 3PGEA 2G4DB 2RDBC 1NYQA 3P4PB 1XEEA 3QIJA 1R4NI 3HM3A 2DBYA 2WS3B 2FUHB 3ABVB 1UBIA 4NQLB 1F2RI 2JZPA 1TZOA 2CU3A 4LLGM 4IM2A 1FCCC 3TEYA 4ARIA 5BO4B 3NVVA 3BZDB 1D5ZC 4HDQA 2KLGA 1MVKA 4K3BA 3W1YA 3T3OA 2KHWB 2WDVB 2KTRB 3IXSA 1Y8RC 2J7QB 1KM7A 2HJ8A 1I35A 5C1ZA 2G9HD 3BK2A 4KZ0A 4AQ7A 4NAWB 4EFOA 3KYCD 4MH0E 2RSUA 2KQ4X 1SIFA 2MP2A 2KJ6A 2INNE 1N63A 1ZKHA 1WXVA 4M0WB 2KXJA 4FJYA 1YJ1A 5FR3A 1AYFA 3ECIA 1J7CA 1P7FA 2JWZA 2L0TA 2OEDA 2MW5A 3IBEA 1UGJA 1WJ4A 1ISNA 3ZRFA 3ZNID 1QOFA 3V61A 3TJPA 1ZOYB 1GG3A 3ZGZA 2KANA 4PS7A 1IGDA 3UIOB 2ZCCA 1E8XA 4H2AA 1KFYB 5CX3A 1PUTA 3Q8AA 2LHDA 3T8MA 2J0KA 3DBRB 3IAM1 2CHWA 3TBLD 4EEWA 3ZYYX 1J8CA 4OZAA 1SGHA 1PFDA 1FNWA 4IKGA 2WU2B 4GDLB 3RNEC 3PT2B 1MJDA 3KH0A 2MP2B 2RDHA 2MWSB 2RPVA 2E3TA 4A3PA 1NI2A 2JQRB 1CJEA 1E6EB 1T0YA 1E8WA 3CWIA 3V60A 2G3QB 1ZP0B 4KX6B 2FCMA 4REZA 1R7SA 4HEA1 3W9CB 2MRPA 4C56C 2OHFA 3RT3B 3I3TB 3AE5B 3PPAA 5AZFA 3HVZA 3AE6B 5E6NA 4ANVA 3BK1A 3TEWA 3ZIMA 1Z2MA 1SSNA 1VR9A 4ZYNA 2VRRB 2JF5A 3BINA 2AL3A 4ZRPA 2NPTA 2PLPA 1D5XC 2JSVX 1DGJA 4M02A 2XBBC 2I2YA 3N1ZC 3Q3MC 3DDCB 4ZRQA 3P1MA 2N9KA 4TMAB 2BPSA 2M0AA 2D11A 4GDKB 4LK0M 4I6PA 2KQ7A 4NNJB 1AN8A 3WANA 2LFIA 3GZNI 5IP4D 1XQQA 2W54A 5BYRA 2KWDA 3GS2A 2Y3AA 1J7BA 2SEBD 3ZKJC 3SHQA 5AZGA 1FEHA 3C19A 3MC8A 1E7UA 4C7YA 2C60A 4RF0A 2ZNVC 3TSSA 4FADA 2NVUI 3AEBB 2MJ3A 4YTMB 3RNFC 3NVWA 4EOYA 3MJWA 4WWPA 1GB1A 1Y56A 2W82A 4YSYB 2MEKA 4X57B 2IO0B 4I6NB 3UINB 2N9LA 1TS5A 2JWUA 3RFZB 2WDTB 5IAAC 2BB5A 4ZRJA 2IPKD 2RR9A 3AEAB 4IM3A 4LNNA 4O1NA 3L10B 4BZAA 3L13A 3KUDB 3N3KB 1CK1A 3FILA 1WYWB 1JMLA 3ZDTA 1ESFA 3RMKC 3Q2AC 1HEZE 2INPE 3ZTCA 3QCAA 3NY5A 3Q8EA 4HPLB 2WXKA 1XCTL 3VRAB 5HG2A 2GBRA 2DYOA 2V4LA 1T0RC 1TS2A 2OJWA 4FHJA 3OAWA 2E6XA 1QKZA 3I5JC 4PYUA 2DZKA 5FR6A 1Z5SB 1LXDA 2GBNA 1WGGA 2KD0A 1VRAB 1MHXA 4XYCA 1EF1A 1KLVA 2HTHA 4B95A 4BKTA 1HTQA 1LO5D 2KC1A 4YL8A 5JHBA 1IYFA 3PSEB 4BOSC 2LEKA 4J6IA 4R3DA 2BGFA 3C8YA 1E7PB 1WH3A 1YIWA 2C5LC 4HCPB 4BBNF 4TQ0A 2BS2B 4DK5A 4RNAA 4W9JA 2KACA 5D2MB 1MHHE 1YQ3B 2W3SA 3M95A 1C4PA 1MI0A 5BYSA 3ETRA 3Q3JA 3FILB 3OJ4B 3AE3B 1F0ZA 3FKYA 3RPFC 2WU5B 1F9JA 4MJSA 2DNFA 2D3AA 3ENEA 3BWUD 1GB4A 2WQYB 1PQSA 2H89B 2LGIA 2WXHA 1V80A 2W3RA 2SAKA 1FCLA 2WXFA 1QOBA 4HDOA 2R61A 2XN9C 2KC2A 3VRBB 3ZNHB 3QC8B 3DVNU 4K81A 4WIPA 1EU3A 1HZ6A 5L95C 4FLHA 4ARCA 1PYWD 4MEMA
chains in the Genus database with same CATH topology
1QLBB 2FE8A 1WSPA 2WDQB 1JCKB 2QJLA 1YJJA 4KGSA 1FRRA 2JX5A 4Q2JA 4YTNB 1E9MA 1TS4A 4TQ1A 1C9FA 1TS3A 2AQ3B 2J42A 4CQNA 1B9RA 2MH7A 2KDMA 3NS1A 1P7EA 2LMCA 2PTLA 1L6UA 1VZ8A 1KTKA 3NVZA 4C7ZA 1OFFA 3SR6A 4DXFA 2LUMA 2X38A 3AE9B 2J52A 1SEBD 2J53A 1ZXIA 3L4PA 2KAJA 1QILA 4RFBA 2YEPB 1IUEA 2IDYA 1TY0A 2WDRB 2FUG1 4JE3B 1GPXA 3BVMA 2H88B 4JWSC 1WRIA 4M0WA 5TSSA 4YXDB 1SJHD 1JALA 2QIEB 4A9AA 1HZ5A 2CJNA 2PVGC 4N59A 5LNK1 1V1PA 1L0YB 1PGAA 3IT6B 4HROA 4XDDA 1WWTA 1QQRA 3AMZA 4JWUC 1AW7A 1UWMA 1ZE3D 3WCQA 3W5UB 5D3IB 5GXGB 2WXGA 3HVDA 3SEBA 3GB1A 1RYJA 3URYA 1D4BA 3AEGB 1C77A 1C4CA 4RGOS 4RCOA 1FNUA 1YMHE 3AV8A 4L1BA 3Q69A 1EWYC 1L6VA 1YQ4B 3Q8FA 1L0VB 2ON8A 5T8IA 3AB5A 3LXFA 1FO4A 4KGRA 1I4XA 2AX5A 4EE2A 2GRIA 1XCQL 2QSDA 2WXNA 5E6JA 1V1PB 1FFUA 4PT5A 1DOXA 1ZDVA 3SFDB 1CZPA 3GP7A 1I4PA 1ACCA 1C78A 5EE0A 1SB3C 1XO3A 1RM6C 5FK9C 1YN3A 3T3NA 2N0SB 3KQ4A 3E56A 1MPEA 3NVYA 1KLUD 3PO0A 2ZW1A 1BXTA 1NYQA 1C76A 3P4PB 3MHZA 2K5PA 3UI3A 2Q5WD 1XEEA 2V3NA 5EE1A 2DBYA 2CJOA 2WS3B 1KH0A 1V8CA 2K0PA 2WXIA 3ABVB 2D5GA 5HFYA 3V3XA 1F2RI 4WH4A 1OQRA 2VZKD 2JZPA 1TZOA 1QOAA 3EA6A 4C80A 2CU3A 3P4RB 4LLGM 1FCCC 1WYGA 3MJ5A 3TEYA 4ARIA 1I4RA 4LTUA 4YT0B 3NZ3A 3P42A 3TUOA 1T3QA 5G5GA 1PDXA 1YN5A 3BZDB 1D5ZC 2QEJC 3NVVA 1UUPA 1N5WA 1DOYA 2K22A 1MVKA 1SIJA 3ZJUA 3T3OA 2YEPF 3AEEB 2LJIA 4IDIA 4HKQA 1L4ZB 1M4VA 2WDVB 1VDVA 2GB1A 5AUKA 3IXSA 1EM7A 3SFEB 1WXQA 1TJEA 2ICIA 4ZYSA 1JW9D 4KKIA 4A6QA 5EE3A 1SE4A 4USAA 2G9HD 3BK2A 4HKZE 3U2SC 3W2DA 2IJ0A 1I4GA 4AQ7A 4NAWB 2BTEA 3O13A 1BUIC 2KQ4X 2INNE 3B2FA 1N63A 3AM9A 4TSSA 1EU4A 2ONQA 2FBWB 1E0ZA 1JWMD 5FR3A 1AYFA 4ZHPA 3Q8BA 1J7CA 1P7FA 2XNAC 2BYTA 2NMQA 2OEDA 2VZKB 4FXCA 1L5PA 1UGJA 3PZ8A 1SE3A 3V05A 1QT9A 3IT4B 1DOIA 2NTTA 1NI3A 4DQOC 1QOFA 1NVID 2IGGA 2N7JA 2WP9B 1ZOYB 2DWQA 1FD6A 4AS1A 3ZGZA 4MM3B 1IGDA 3AE7B 3B2GA 3B9JA 5FKAC 2L32A 5BYQA 2BBCA 1D5MC 2RDGA 2WXLA 4H2AA 1KFYB 1PGXA 3W1SA 1FXAA 3CIRB 2JU6X 3AEDB 1PUTA 3Q8AA 2LHDA 3KWLA 3IAM1 1IGCA 4UDUC 3AECB 5BMHA 2Y5CA 4XE0A 3AN1A 1FNVA 3ZYYX 3OWEB 4OVZA 4OZAA 3VR9B 1HQRD 2IGHA 1PFDA 1FNWA 4A8XC 4IKGA 2WU2B 2JXTA 4B0MA 4GDLB 1L0XB 4HRSA 4DXGA 2EELA 2RDHA 1NEKB 2RPVA 2E3TA 4ZHOA 2I38A 2ZW0A 1ZDXA 1TY2A 3BYTB 5BMIA 4B0EA 1JWUD 2JQRB 5EE9A 2L83A 3EUB2 1CJEA 1IBXB 3MFGA 1L4DB 1E6EB 1JRPA 1E10A 3IAS1 1AWDA 1N62A 3P4SB 4P16A 4IOIE 4RH6A 3CWIA 1DYQA 1I4HA 1UNSA 2HDEA 1FIQA 3DWMA 1JROA 1VZ7A 1ZP0B 1SJED 4KX6B 1HXYD 4REZA 3HUIA 4WWMA 1R7SA 4HEA1 2QMTA 3ZQ4A 3E9SA 3W9CB 2G1EA 1JWBD 4US9A 1ENFA 4C56C 4KKJA 1PGBA 2OHFA 3BVGA 4MH8A 2V4IB 2JYEA 3LB8C 1KF6B 4JX1C 1FXIA 2BS4B 3AE5B 5D7GA 2NTSA 4A55A 2PW9A 4OHJA 3HVZA 3AE6B 1ET6A 1N5XA 3BK1A 1XF5L 5D3DA 3TEWA 5H8YE 3FAHA 5MPOA 1EWCA 2PMVA 1GOZA 1SSNA 2Y5PA 1K51A 3NUHB 1VR9A 5H92C 2WXJA 3I9V1 2BT6A 2PVOD 4YSXB 4ZRPA 1XLQA 1K52A 2PLPA 3N9YC 2IGDA 1D5XC 1TKGA 1ZXHA 2JSVX 1DGJA 1F77A 2I2YA 2HTME 1SF0A 2DLBA 1XLOA 2L52A 1SXTA 4ZRQA 1V97A 3P1MA 2N9KA 2W55A 4TMAB 2M0AA 4N58A 4RF1A 1I4QA 1KLGD 3EGRA 4GDKB 4LK0M 4P6VF 4A90A 1VLBA 3P4QB 4XDCA 1J7AA 3BVZA 5G5HA 3AH7A 1AN8A 4MACA 4D2KA 2LFIA 4L23A 2MJEA 1VZ6A 2W54A 5BYRA 2WXMA 2KWDA 3GS2A 3W5VB 4RGNA 3J9CA 4GLSC 4N6EB 1CQVA 4WAFA 2Y3AA 1YNTE 1J7BA 4OZCA 1FM0D 2SEBD 1JWAD 1FEHA 1RWSA 1QF6A 1SE2A 1KRHA 4C7YA 4RF0A 2WXPA 3HRDD 3TSSA 3BYYB 3AEBB 2MJ3A 2RMMA 3H8HA 2ACZB 3KLSX 4RGTA 3U4EG 4YTMB 3NVWA 2WXOA 4RGMA 1GB1A 1Y56A 1JWSD 1UWXA 2J4XA 3VQIA 2W82A 4YWGG 4YSYB 5I4DA 1FMAD 2MEKA 1TKYA 2DYMA 4MT5A 1BMLC 3MP9A 4JPSA 1C79A 2N9LA 1TS5A 2JWUA 5HHDG 4KGTA 1XLNA 3R2IA 3RFZB 2GI9A 2WXQA 1XLPA 2BB5A 2IPKD 3DWGC 1N60A 4ITKA 4XWWA 3AEAB 4O1NA 3VR8B 2M19A 3R2TA 3PZ7A 4OZBA 1RFKA 1NYRA 5C2TB 5C3JB 3FC4A 1CK1A 1VJKA 3TEZA 3KWVA 2V0GA 1T6BX 3FILA 1K53A 1JMLA 2V3PA 2M56B 1ESFA 3U52E 1HEZE 1ET9A 2INPE 4XWTA 2WLBA 1STEA 4HJGE 3Q8EA 2WXKA 1XCTL 3VRAB 1ZUD2 3NRZA 5HG2A 2DYOA 5AUIA 3P63A 4L2YA 1C4AA 3AEFB 1TS2A 4ZOHC 2TSSA 1TYGB 2E6XA 1QKZA 2AQ1B 1I7HA 1VRAB 1MHXA 1JQ4A 3AE1B 4WQMA 1LO5D 4YSZB 3ZJTA 2LEKA 4OW0A 3LYYA 4YTPB 4R3DA 2BW2A 3C8YA 1Q10A 1E7PB 2WNMA 1YN4A 3Q8CA 4WURA 2LHEA 2AQ2B 5JXVA 4NJCA 4NAMA 3AE2B 1TKEA 2BS3B 3AE4B 3AE8B 1YJIA 4TQ0A 2BS2B 4RNAA 1A70A 4J3OD 2JYTA 1ROEA 1QOGA 3MC0B 1GAQB 2KACA 2QILA 4US8A 3U7ZA 1MHHE 2PKOA 1YQ3B 2W3SA 1C4PA 1MI0A 5BYSA 3ETRA 1IBXA 2L1AA 1B1ZA 5BMGA 1SBBB 3FILB 3AE3B 1K50A 1F0ZA 1FFVA 2B76B 3I57A 2EKIA 2PIAA 1N61A 1HA5A 2MJDA 2WU5B 3RPFC 2BB6A 1NENB 2KN4A 2K9XA 3BWUD 1GB4A 1F2RC 2WQYB 1V1OA 1ZPSA 2H89B 2LGIA 2WXHA 2W3RA 3ZJVA 2SAKA 2K3UA 1FCLA 1D6EC 1XXGA 2KMMA 4NZLB 3BIID 2WXFA 1QOBA 2R61A 2XN9C 3R8BA 3VRBB 1WGKA 2WXRA 2Z8LA 4WIPA 1OQQA 5HI1A 1EU3A 1HZ6A 4ARCA 1T5XD 1PYWD 1FRDA 3TEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDX A;  3NVV A;  3CWI A;  1QLB B;  3AEA B;  1FIQ A;  3DWM A;  1N5W A;  1JRO A;  2WDQ B;  2K22 A;  1YJJ A;  2M19 A;  1FRR A;  1SIJ A;  2JX5 A;  2QJL A;  1ZP0 B;  1E9M A;  1RFK A;  1NYR A;  3AEE B;  4KX6 B;  4IDI A;  4WWM A;  3HUI A;  5C2T B;  1R7S A;  1B9R A;  2MH7 A;  5AUK A;  2WDV B;  1VDV A;  3FC4 A;  5C3J B;  1VJK A;  3NS1 A;  3SFE B;  1WXQ A;  2G1E A;  3W9C B;  1L6U A;  1JWB D;  1TJE A;  2M56 B;  3NVZ A;  1OFF A;  4C7Z A;  3SR6 A;  4US9 A;  3AE9 B;  1JW9 D;  2WLB A;  2OHF A;  4ITK A;  5EE3 A;  4USA A;  3VRA B;  1ZUD 2;  1ZXI A;  3NRZ A;  3L4P A;  5AUI A;  3P63 A;  3LB8 C;  1KF6 B;  2KAJ A;  4JX1 C;  1FXI A;  2BS4 B;  3AE5 B;  3HVZ A;  3AEF B;  3AE6 B;  1IUE A;  1N5X A;  4ZOH C;  2WDR B;  1TYG B;  5H8Y E;  3FAH A;  5MPO A;  1GPX A;  2H88 B;  4JWS C;  1WRI A;  3B2F A;  1N63 A;  3AM9 A;  4YXD B;  1I7H A;  5H92 C;  1JAL A;  2BT6 A;  2QIE B;  4A9A A;  2FBW B;  2CJN A;  2PVG C;  2PVO D;  1E0Z A;  4YSX B;  4N59 A;  1AYF A;  3AE1 B;  4ZHP A;  1JQ4 A;  1J7C A;  1XLQ A;  4HRO A;  4WQM A;  1WWT A;  4FXC A;  3AMZ A;  1TKG A;  4JWU C;  1DGJ A;  1L5P A;  4YSZ B;  1DOY A;  1UWM A;  1SF0 A;  2HTM E;  1XLO A;  2L52 A;  3W5U B;  3WCQ A;  1QT9 A;  2LEK A;  1DOI A;  1V97 A;  3P1M A;  5GXG B;  1NI3 A;  2W55 A;  4YTP B;  1QOF A;  4N58 A;  1NVI D;  1E7P B;  4P6V F;  1VLB A;  1RYJ A;  3P4Q B;  2WP9 B;  1ZOY B;  2DWQ A;  1J7A A;  3AEG B;  5G5H A;  3AH7 A;  3AE2 B;  1TKE A;  2BS3 B;  3AE4 B;  3AE8 B;  3AV8 A;  1YJI A;  2MJE A;  1EWY C;  2BS2 B;  2W54 A;  1L6V A;  1YQ4 B;  3B2G A;  3AE7 B;  1A70 A;  1FRD A;  3B9J A;  1L0V B;  3W5V B;  1ROE A;  1QOG A;  3AB5 A;  3LXF A;  1GAQ B;  4N6E B;  1FO4 A;  4US8 A;  2AX5 A;  1KFY B;  1J7B A;  1FFU A;  1YQ3 B;  1FXA A;  2PKO A;  2W3S A;  1FM0 D;  3CIR B;  3SFD B;  1DOX A;  3AED B;  1PUT A;  1JWA D;  1CZP A;  3ETR A;  1RWS A;  1QF6 A;  3KWL A;  5EE0 A;  1SB3 C;  1KRH A;  3AEC B;  3AE3 B;  4C7Y A;  2Y5C A;  1F0Z A;  1FFV A;  2B76 B;  3AN1 A;  1XO3 A;  2EKI A;  2PIA A;  3HRD D;  3ZYY X;  1RM6 C;  1N61 A;  2MJD A;  3RPF C;  2WU5 B;  3VR9 B;  3AEB B;  2MJ3 A;  1NEN B;  2N0S B;  2ACZ B;  1PFD A;  4YTM B;  3NVY A;  3NVW A;  2K9X A;  4YTN B;  3PO0 A;  2WU2 B;  1NYQ A;  3P4P B;  2K5P A;  2WQY B;  2Q5W D;  5EE1 A;  2DBY A;  2CJO A;  4HRS A;  2WS3 B;  1V8C A;  2H89 B;  3ABV B;  4YSY B;  1NEK B;  2W3R A;  1FMA D;  1TKY A;  2E3T A;  4ZHO A;  1OQR A;  2KMM A;  3BII D;  1QOA A;  4C80 A;  1QOB A;  2CU3 A;  3P4R B;  2JQR B;  5EE9 A;  1XLN A;  2L83 A;  1WYG A;  3EUB 2;  1CJE A;  3VRB B;  1WGK A;  1XLP A;  1E6E B;  1OQQ A;  1JRP A;  1E10 A;  1AWD A;  1N62 A;  4LTU A;  4YT0 B;  3VR8 B;  3P4S B;  3DWG C;  1T3Q A;  1N60 A;  5G5G A; 
#chains in the Genus database with same CATH topology
 3NS8 A;  3PTF C;  4E3C A;  2FE8 A;  1WSP A;  3OG5 A;  1JCK B;  3TMP B;  1FRR A;  1TS4 A;  1C9F A;  1B9R A;  2MH7 A;  2DZI A;  4W9K A;  1OFF A;  2LUM A;  3GE8 C;  2X38 A;  3AE9 B;  1SEB D;  2LUE A;  1ZXI A;  2K6D B;  4RFB A;  2MHJ A;  2IDY A;  1KOT A;  1WMH B;  4RM9 A;  1GPX A;  4IW0 A;  1SJH D;  4W9E A;  4A9A A;  1HZ5 A;  2CJN A;  3VH4 B;  2D3B A;  5LNK 1;  1BT0 A;  3IT6 B;  2PJH A;  4JWU C;  1AW7 A;  1UWM A;  2L3Z A;  2PPH A;  2WXG A;  3HVD A;  4B9K A;  2CHZ A;  3X23 A;  1RYJ A;  5HKH A;  4E74 A;  3UF8 A;  4KZC A;  2RPQ A;  2ON8 A;  2KVR A;  5T8I A;  3LXF A;  3A1Q B;  1XCQ L;  3B1L X;  4PT5 A;  2KDF B;  4BBN C;  1MG8 A;  3RYT A;  2RGF A;  1WF9 A;  4KVG B;  1WJN A;  5EE0 A;  5L83 A;  1S1Q B;  1YN3 A;  4GSW A;  1TZ1 A;  3VTV A;  1KLU D;  1WFY A;  2ZW1 A;  3MHZ A;  1TGZ B;  2K5P A;  2Q5W D;  1Q1O A;  2CJO A;  1WR1 A;  1OGW A;  5HFY A;  2KO3 A;  3V3X A;  2ZCB A;  1QOA A;  3EA6 A;  4ANU A;  3P4R B;  2GMI C;  1WYG A;  3VXW A;  1T0S C;  3M3J A;  1JRU A;  3ZTD A;  4YT0 B;  1UD7 A;  3NZ3 A;  3P42 A;  3L16 A;  1PDX A;  1YN5 A;  2QEJ C;  1UUP A;  3PVL A;  1N5W A;  3ZJU A;  4ASW C;  2LJI A;  2WGS A;  4HKQ A;  1L4Z B;  1M4V A;  3UQA A;  4I6L B;  1VDV A;  4GN1 A;  2KT7 A;  1EM7 A;  4K7W A;  3EHV A;  1TJE A;  1H4R A;  3A9J A;  2ICI A;  1JW9 D;  1OTR B;  1I42 A;  2LVO A;  2LGX A;  4USA A;  3V6C B;  3U2S C;  2IJ0 A;  4FN2 A;  1D3Z A;  3L08 A;  3L0W B;  2BTE A;  2IY1 B;  1BUI C;  4TSS A;  3VAW A;  2FNJ B;  2FBW B;  4ZHP A;  3KVF B;  2AWT A;  2JY6 A;  1YD8 U;  1S3S G;  2N9E B;  2AL6 A;  4G3X B;  2NTT A;  1NI3 A;  4IWP A;  1Q5W B;  4WAA A;  2KNB A;  4AS1 A;  3U7D A;  3B9J A;  4NPN A;  5BYQ A;  1OEY A;  1D5M C;  2WXL A;  5DPR A;  2J0M A;  2I1J A;  3JSV A;  4UDU C;  3AEC B;  5BMH A;  4LJP B;  1AAR A;  1J0G A;  1FNV A;  2GBM A;  4OVZ A;  5DPS A;  3VR9 B;  1HQR D;  4A3O A;  2KWU B;  1L0X B;  2UWQ A;  2FIF A;  4IG7 B;  2EKE C;  4LDT B;  2KOX A;  1JWU D;  5EE9 A;  2L83 A;  3EUB 2;  1JRP A;  1N62 A;  2BKR B;  3SD5 A;  4P16 A;  4HCN B;  2LXC A;  2BF8 B;  2LVP A;  1UNS A;  4KDL B;  5KHO A;  1JRO A;  3AXC A;  4PK1 A;  3DHI C;  4HK2 A;  3ZQ4 A;  3E9S A;  4XGA B;  3C0R B;  4US9 A;  3CST A;  2O6V A;  3RN9 C;  1WX8 A;  2JYE A;  1KF6 B;  1C3T A;  2KJR A;  5D7G A;  1FXI A;  2NTS A;  2W9N A;  2DHZ A;  4WJP A;  1N5X A;  5D3D A;  5H8Y E;  3QAQ A;  4GOC A;  4LNI A;  4CYE A;  5IO9 A;  3NUH B;  3I9V 1;  2BT6 A;  4EZJ A;  4YSX B;  1XLQ A;  3N9Y C;  2IGD A;  4NY0 A;  1TKG A;  1ZXH A;  2MX2 A;  1XLO A;  4W9L A;  2CS4 A;  4DHZ E;  5JH5 C;  1I4Q A;  2YLM A;  1VLB A;  3DVN V;  3P4Q B;  4D2K A;  4MAC A;  1IP9 A;  2WXM A;  3DBH B;  4GLS C;  3T9L A;  4ZRI A;  3X0W A;  1YNT E;  1WIA A;  3K9P B;  1FM0 D;  1P3Q U;  1MFW A;  3DBL I;  3CSF A;  2MBH A;  1QF6 A;  2D10 A;  2JT4 B;  2J0J A;  3N32 A;  2LGY A;  2KYW A;  4FJZ A;  1WX9 A;  3H8H A;  3Q3O C;  3KW5 B;  1WZ0 A;  4RGM A;  2KN5 A;  4BAX A;  1J19 A;  2CKH B;  1UWX A;  3VQI A;  1FMA D;  1TKY A;  3Q14 C;  4MT5 A;  1WGY A;  2ZNV B;  4JPS A;  4W9F A;  2ZJD A;  2WXQ A;  4LDT D;  1R4M B;  2KFJ A;  1N60 A;  2D3C A;  1WM2 A;  4MEL A;  4OZB A;  3PRM B;  2GLS A;  4ACF A;  5C2T B;  2MCN B;  4MM3 A;  3DVG X;  4IUM B;  2WWZ A;  3RNA C;  1K53 A;  2V3P A;  2M56 B;  3U52 E;  4BKG A;  1ET9 A;  4XWT A;  2WLB A;  3H1U A;  1STE A;  4S17 A;  4BKS A;  2BWE S;  4ANW A;  3ML8 A;  1ZUD 2;  4GIV A;  4JGH B;  3P63 A;  3N1X C;  1C4A A;  1TYG B;  2AQ1 B;  2XK5 B;  3OLM D;  3WIM A;  3NJT A;  3ZDM C;  1JQ4 A;  5G55 A;  1F1H A;  4FJV B;  2IND C;  4YSZ B;  2MBE A;  3PS6 A;  4OW0 A;  4FHK A;  4YTP B;  3ZVV A;  2BW2 A;  3Q8C A;  2C7M B;  2K1F A;  4WUR A;  2JVC A;  4FA6 A;  3RUL A;  2BS3 B;  2LD9 A;  2ZPN A;  3NZU A;  4US8 A;  3U7Z A;  2PKO A;  1SE9 A;  4W9I A;  3I57 A;  2EKI A;  2PIA A;  3UQB A;  2JZ3 B;  2KN4 A;  2KFK A;  4DWF A;  2O6V D;  2LJ5 A;  2DAJ A;  4KDI C;  1D6E C;  4JL9 A;  2KMM A;  3BII D;  1LGR A;  2FCQ A;  1RFA A;  4G11 A;  3JW0 X;  4P1C C;  3R8B A;  1WGK A;  2WXR A;  1OQQ A;  5HI1 A;  4CHK A;  2NCN A;  1FRD A;  2JX5 A;  3MTN B;  4YTN B;  1E9M A;  3HHM A;  1TS3 A;  2J42 A;  4CQN A;  5CTR C;  4KSK C;  3VH3 B;  3EC8 A;  2LMC A;  4C4V B;  3QJZ A;  3SR6 A;  4DXF A;  2V3S A;  5TR5 A;  1LFD A;  2BKF A;  2KAJ A;  4E71 A;  2INC C;  1V86 A;  2YEP B;  1TY0 A;  3DHH C;  2FUG 1;  4JE3 B;  3BVM A;  2OJR A;  3LJ3 A;  3DBL B;  4URK A;  4MGY E;  4EKU A;  3HK0 A;  1L0Y B;  4HRO A;  1UGM A;  3GOE A;  1UF0 A;  2HD5 B;  1TTN A;  3GB1 A;  4C00 A;  1GUA B;  1OEY J;  3CF6 E;  4RCO A;  1FNU A;  3WAM A;  2KX3 A;  4ZRK A;  3VUY A;  3V62 A;  3Q8F A;  2IO3 B;  2GRI A;  2QSD A;  1FFU A;  4FBJ B;  2C7H A;  1V5T A;  3SFD B;  1CZP A;  2LGD A;  3GP7 A;  4G50 A;  1XO3 A;  2OOB B;  3PV1 A;  3H7S A;  2N0S B;  4IWO A;  3E56 A;  3NVY A;  3PO0 A;  1BXT A;  2BYV E;  3MHS D;  1C76 A;  2V3N A;  5EE1 A;  4AWJ A;  3WAL A;  5AEK B;  1KH0 A;  2K0P A;  2D5G A;  1KJT A;  3O65 B;  2KFK B;  4WH4 A;  3V6E B;  1OQR A;  2VZK D;  1P1A A;  3KUZ A;  2QC8 A;  2KMA A;  3ZXV A;  2K8B A;  1I4R A;  3ZRC A;  3TUO A;  1T3Q A;  5G5G A;  2K22 A;  4KIK B;  3U30 A;  1WGR A;  4DXA B;  5AUK A;  4TKN A;  2K6Q A;  1ZW7 A;  2CU1 A;  4ZYS A;  1C1Y B;  3OJ3 A;  3EFC A;  1I4G A;  3U8Z A;  3O13 A;  5IKC M;  4K7U A;  5CHW A;  4PYZ A;  3H9D A;  1E0Z A;  1JWM D;  4MGZ E;  3NHE B;  3AU5 A;  2NMQ A;  2VZK B;  4P1B C;  2G45 B;  3L54 A;  3Q6B A;  3PZ8 A;  3IT4 B;  1DOI A;  4HPM B;  1EUV B;  4DHZ B;  2N7J A;  2WP9 B;  2DWQ A;  2KWV B;  4TV3 A;  3L17 A;  4MM3 B;  5DCN A;  1WRD B;  3VFK A;  2BBC A;  1V5O A;  3EEC A;  2RDG A;  1PGX A;  1WXM A;  1FXA A;  5DPW A;  3AED B;  3KWL A;  1RLF A;  5JZE B;  1VCB A;  2VH1 A;  3IHP C;  3R7R A;  2IYD B;  2ZEQ A;  4A8X C;  2IBI B;  4EZL A;  2IY0 B;  2JXT A;  4B0M A;  3B08 A;  2A4Z A;  2ZVN A;  4DXG A;  1NEK B;  1WGD A;  2N1V A;  2M0X A;  2LVQ A;  2I38 A;  3TL5 A;  3BYT B;  4B0E A;  2MBQ A;  4B6W A;  1WX7 A;  3MFG A;  1X1M A;  2HE7 A;  4ICU A;  2L76 A;  1HE8 A;  2KWC A;  2C7N B;  1FIQ A;  3DWM A;  1HXY D;  2MBO A;  3HUI A;  2QMT A;  3A9J B;  2CR5 A;  2UU7 A;  2G1E A;  1JWB D;  1ENF A;  1T0Q C;  4KKJ A;  3BVG A;  3AU4 A;  3ZLZ A;  4MH8 A;  2V4I B;  4LCD E;  2BS4 B;  4A55 A;  2PW9 A;  3DQV A;  1U4A A;  4DDG D;  1UZX B;  2FID A;  3VTU A;  3FAH A;  1GOZ A;  2Y5P A;  2WXJ A;  2PVO D;  1K52 A;  2PE6 B;  1YOV B;  1M94 A;  3I63 C;  2DLB A;  4JQW C;  2KVZ A;  2L52 A;  1V97 A;  1WI0 A;  4AJY B;  3APC A;  2W55 A;  4N58 A;  4RF1 A;  1KLG D;  4P6V F;  4A90 A;  2M4N A;  3KUC B;  2R2Q A;  1EF5 A;  2REX A;  2X8X X;  2QDF A;  3APF A;  2IO2 B;  1RWS A;  4PS3 A;  2IZV B;  1SE2 A;  2WXP A;  3LDZ E;  3QA8 A;  3BYY B;  4DBG A;  4N9F 4;  4DDI D;  2RMM A;  2ACZ B;  4W9G A;  2ZPY A;  5C23 A;  2J4X A;  3W1S C;  4YWG G;  4F7Z A;  3NG0 A;  3PLU A;  2DYM A;  3RNB C;  2WX0 A;  3TCA A;  3MP9 A;  1C79 A;  1EO6 A;  5HHD G;  1L2N A;  1XLN A;  3R2I A;  1V49 A;  2L05 A;  3DWG C;  4ITK A;  4XWW A;  2N9P C;  2M19 A;  1RFK A;  3M62 B;  4M8M A;  4NAW A;  2V0G A;  1T6B X;  4A20 A;  3M63 B;  2B3A A;  3ALB A;  3PZD A;  4HJG E;  3RZW C;  4AJW A;  4L2Y A;  4HLE A;  4S0R A;  4AP4 C;  4GB9 A;  2D07 B;  3N20 C;  4MSM B;  1I7H A;  4HPP A;  3AE1 B;  2IO1 B;  4WQM A;  2LGS A;  3GZN B;  4RMA A;  1Q10 A;  2WNM A;  4NJC A;  4NAM A;  2BQQ A;  3SDL C;  3AE2 B;  3AE8 B;  5E6P A;  3D32 A;  3NZS A;  4K1R B;  5D94 A;  2JYT A;  4KIK A;  2QIL A;  4LNK A;  2M8S A;  4OVV A;  3UGB B;  1IPG A;  3IVF A;  3RI7 C;  4GDL A;  3QQ8 B;  1B1Z A;  5BMG A;  1FFV A;  2C9W B;  4GXB A;  1N61 A;  1HA5 A;  2A5U A;  2I1K A;  1NEN B;  2K9X A;  1F2R C;  1YQB A;  4WJN A;  1V1O A;  1ZPS A;  3ZJV A;  1NBF C;  2K3U A;  1XXG A;  4NZL B;  1GC7 A;  2DYB A;  2LI5 A;  3P2B A;  4CO7 A;  3JSV B;  1WXS A;  2Z8L A;  4EUT A;  2NBU A;  2QHO A;  1T5X D;  1GJZ A;  3TEX A;  3JVZ X;  3A1Q A;  2WDQ B;  4Q2J A;  2AYO B;  4TQ1 A;  2DZJ A;  4JLC A;  2DX5 B;  5IA7 A;  2KDM A;  1H8C A;  1P7E A;  1FPY A;  3QX1 A;  2PTL A;  4LNO A;  1VZ8 A;  2BYF A;  2NBW B;  2Z0D B;  2FCN A;  2JPH A;  1IUE A;  1UEL A;  4GGQ A;  1WRI A;  4M0W A;  5LXH A;  1JAL A;  2QIE B;  2PVG C;  4N59 A;  1TBE A;  5J18 A;  1WWT A;  4NJ6 A;  3AMZ A;  3WAO A;  3WCQ A;  3W5U B;  2KZR A;  3SEB A;  5AZH A;  3URY A;  4HVB A;  1D4B A;  3AEG B;  1RRB A;  4RGO S;  3APD A;  2EMT A;  1N6Z A;  2KX0 A;  3Q69 A;  1EWY C;  1YQ4 B;  3PRP B;  1L0V B;  1V9J A;  3A9K A;  2KJH B;  3AB5 A;  1FO4 A;  4EE2 A;  2WXN A;  3PRE A;  5E6J A;  1V1P B;  3R3M A;  1ZDV A;  2KDI A;  1WZ3 A;  1ACC A;  3A9K B;  4F1S A;  1RM6 C;  3T3N A;  1TIF A;  1G6J A;  1MPE A;  3PHX B;  4EZK A;  3S2A A;  1V2Y A;  4BVU C;  3AI5 A;  1ZGU B;  4FUL A;  3UI3 A;  2M17 A;  2JUO A;  5DPT A;  1TT5 B;  1V8C A;  2WXI A;  1P98 A;  2FCS A;  3WA0 A;  4C80 A;  4ICV A;  2DEN B;  3MJ5 A;  3ZUN A;  4MSQ B;  4LTU A;  1WGH A;  1GC6 A;  3ML9 A;  1DOY A;  1SIJ A;  3AUL A;  2YEP F;  3AEE B;  2O6V B;  3QAR A;  4IDI A;  3B0A A;  2QCZ A;  2GB1 A;  1F52 A;  2LWP A;  3ZNG C;  3SFE B;  1WXQ A;  2V1Y A;  2LXA A;  4WJQ A;  2BVC A;  4KKI A;  4A6Q A;  4WJO A;  5EE3 A;  1SE4 A;  2PEA A;  4HKZ E;  3W2D A;  5KHQ A;  4TUU A;  2JRH A;  4ANX A;  2KMC A;  2WYQ A;  3B2F A;  3AM9 A;  1EU4 A;  2ONQ A;  3Q8B A;  2NR2 A;  2XNA C;  2BYT A;  1OQY A;  4FXC A;  5LLI A;  3GE3 C;  1L5P A;  3N1Y C;  1UBQ A;  2DZM A;  1SE3 A;  3V05 A;  1QT9 A;  4DQO C;  3QHT A;  1NVI D;  3JYU A;  2IGG A;  4KV2 A;  4K3C A;  4QAY A;  1FD6 A;  2K8H A;  3NOB A;  4GDK A;  4IWQ A;  1CMX B;  3B2G A;  2GOW A;  3AE7 B;  5FKA C;  2L32 A;  5D6J B;  2V9H A;  3DPD A;  5G2N A;  3N30 A;  3W1S A;  1YX6 B;  4M00 A;  3CIR B;  2JU6 X;  1QZE A;  1WR6 E;  4GMV A;  3R7Q A;  2GBJ A;  1IGC A;  2Y5C A;  4XE0 A;  3AN1 A;  3ZW3 A;  3OWE B;  1XD3 B;  2IGH A;  4DHJ D;  1FXT B;  3VUX A;  3KYD D;  4HRS A;  2EEL A;  2Z59 B;  2O2V B;  4ZHO A;  1P9D U;  2ZW0 A;  1ZDX A;  1TY2 A;  3A4S C;  5BMI A;  3PLV A;  4M8N A;  3VHT C;  1IBX B;  1L4D B;  1E10 A;  3A33 B;  3IAS 1;  1AWD A;  2EMS A;  4II3 B;  3P4S B;  4IOI E;  4RH6 A;  1DYQ A;  3DBS A;  1I4H A;  2HDE A;  2LRU A;  1VZ7 A;  2D2Q A;  1SJE D;  3Q3F A;  2KTR A;  4WWM A;  2R2O A;  2LRW A;  2N7E A;  2NS5 A;  3WAP A;  3ZNZ B;  2LZ6 A;  5IN7 A;  2MA9 B;  1Q0W B;  2N4F A;  1YX5 B;  4XZ4 A;  3BY4 B;  1PGB A;  4MGI E;  1V6E A;  2WX1 A;  1A5R A;  1WXA A;  3LB8 C;  4JX1 C;  3HIZ A;  4OHJ A;  1P0R A;  1ET6 A;  2KKC A;  1XF5 L;  4DHJ B;  2MBB B;  3SU8 X;  5MPO A;  1EWC A;  2DAF A;  5CHF A;  2PMV A;  1K51 A;  5H92 C;  4MJS B;  2KLC A;  5J17 A;  3H6N A;  3QK0 A;  2FAZ A;  1F77 A;  4JIO U;  2HTM E;  1SF0 A;  1SXT A;  3EGR A;  1LM8 B;  4XDC A;  1J7A A;  3BVZ A;  5G5H A;  3AH7 A;  4W9H A;  4W9D A;  2L00 B;  4L23 A;  4WWN A;  2MJE A;  1WE6 A;  5GMV A;  1VZ6 A;  4MGK E;  3W5V B;  4RGN A;  3J9C A;  3VDZ A;  2KK8 A;  4N6E B;  1CQV A;  4WAF A;  4OZC A;  1JWA D;  3EFU A;  2MQJ A;  1KRH A;  2KQS A;  4C4V A;  1LQB A;  3HRD D;  1WJU A;  3Q3N C;  1VD2 A;  5LXI B;  3KLS X;  4LJO B;  4RGT A;  3U4E G;  3DBR I;  2WXO A;  2GBK A;  1JWS D;  1R4N B;  3R66 C;  5I4D A;  4MDK E;  3DOW A;  4WQO B;  1BML C;  1WM3 A;  4KGT A;  4M01 A;  2GI9 A;  1E8Z A;  3VVW B;  1XLP A;  3IFW B;  4BFR A;  4NJ7 A;  1R4M I;  2CHX A;  3VTW A;  1L7Y A;  3RD2 A;  3VR8 B;  3R2T A;  3PZ7 A;  1NYR A;  3H7P A;  3A4R A;  2YVC A;  4KSL C;  5C3J B;  3FC4 A;  1VJK A;  3TEZ A;  2BWF A;  3KWV A;  4LNF A;  2JRI B;  4G0N B;  3MC9 A;  3NRZ A;  5AUI A;  5IOI A;  4RM8 A;  4K7S A;  2NBV B;  4ZDV A;  3AEF B;  2L8J A;  3PRZ A;  2MLB A;  2KDE B;  4ZOH C;  2TSS A;  2Y5B B;  3PHW B;  2K8C A;  1WY8 A;  2L0F A;  4F8C B;  3DHG C;  3ZJT A;  3LYY A;  1K8R B;  4HJK A;  3RNC C;  2RD0 A;  1YN4 A;  1E8Y A;  2LHE A;  2AQ2 B;  5JXV A;  2MSE D;  1TKE A;  4HWI B;  3AE4 B;  1YJI A;  5J2R A;  1A70 A;  4J3O D;  1ROE A;  1QOG A;  2HJ1 A;  2ZZP B;  1GAQ B;  3MC0 B;  1E90 A;  3RUI B;  4OVU A;  1WJ6 A;  3ONS A;  2XEW A;  5JHA A;  1V81 A;  2K25 A;  2AEH A;  1IBX A;  2L1A A;  1SBB B;  1K50 A;  2B76 B;  2BYE A;  4WWO A;  2MJD A;  2NPT B;  2O2V A;  2BB6 A;  5CHV C;  4IM0 A;  1RAX A;  3HM6 X;  4NQK E;  2KTF A;  2N9X A;  3DBH I;  3UIP B;  2N7D A;  2G4S A;  2N1W A;  3TIX A;  3RZF A;  5E6O A;  2PE9 A;  3DVG Y;  2JXX A;  2K39 A;  1QLB B;  2M1M A;  2QJL A;  1YJJ A;  4KGS A;  2AQ3 B;  4II2 B;  1XT9 B;  3NS1 A;  1L6U A;  1KTK A;  1MG4 A;  3NVZ A;  4C7Z A;  4BOZ B;  2J52 A;  4BKS D;  3H7P B;  2J53 A;  3K9O B;  1HTO A;  2D3G A;  3L4P A;  1QIL A;  4HXD A;  2JZZ A;  4XC2 A;  2WDR B;  3IG3 A;  4PS8 A;  3RNG C;  5EDS A;  3CMM B;  3QWZ B;  2H88 B;  2VH2 A;  4JWS C;  3ZXR A;  5TSS A;  4YXD B;  3RCZ A;  1UH6 A;  2XK5 A;  1V1P A;  2ZVO A;  1PGA A;  4XDD A;  1QQR A;  1WMH A;  1ZE3 D;  3VUW A;  2Z0E B;  5D3I B;  5GXG B;  2KDB A;  3DCG A;  1NDD A;  2ASQ A;  4AOF A;  2L7R A;  1WE7 A;  1C77 A;  1C4C A;  4AUQ C;  1YMH E;  3AV8 A;  1E7V A;  4L1B A;  1L6V A;  4XX5 A;  1E5W A;  4P7I A;  4IC7 B;  2WHI A;  4KGR A;  1I4X A;  2AX5 A;  4W9C A;  1GNU A;  4GU2 A;  1DOX A;  1I4P A;  1C78 A;  1SB3 C;  2LAS A;  2UYZ B;  5FK9 C;  3KQ4 A;  3ZO5 B;  3PGE A;  2G4D B;  2RDB C;  1NYQ A;  3P4P B;  1XEE A;  3QIJ A;  1R4N I;  3HM3 A;  2DBY A;  2WS3 B;  2FUH B;  3ABV B;  1UBI A;  4NQL B;  1F2R I;  2JZP A;  1TZO A;  2CU3 A;  4LLG M;  4IM2 A;  1FCC C;  3TEY A;  4ARI A;  5BO4 B;  3NVV A;  3BZD B;  1D5Z C;  4HDQ A;  2KLG A;  1MVK A;  4K3B A;  3W1Y A;  3T3O A;  2KHW B;  2WDV B;  2KTR B;  3IXS A;  1Y8R C;  2J7Q B;  1KM7 A;  2HJ8 A;  1I35 A;  5C1Z A;  2G9H D;  3BK2 A;  4KZ0 A;  4AQ7 A;  4NAW B;  4EFO A;  3KYC D;  4MH0 E;  2RSU A;  2KQ4 X;  1SIF A;  2MP2 A;  2KJ6 A;  2INN E;  1N63 A;  1ZKH A;  1WXV A;  4M0W B;  2KXJ A;  4FJY A;  1YJ1 A;  5FR3 A;  1AYF A;  3ECI A;  1J7C A;  1P7F A;  2JWZ A;  2L0T A;  2OED A;  2MW5 A;  3IBE A;  1UGJ A;  1WJ4 A;  1ISN A;  3ZRF A;  3ZNI D;  1QOF A;  3V61 A;  3TJP A;  1ZOY B;  1GG3 A;  3ZGZ A;  2KAN A;  4PS7 A;  1IGD A;  3UIO B;  2ZCC A;  1E8X A;  4H2A A;  1KFY B;  5CX3 A;  1PUT A;  3Q8A A;  2LHD A;  3T8M A;  2J0K A;  3DBR B;  3IAM 1;  2CHW A;  3TBL D;  4EEW A;  3ZYY X;  1J8C A;  4OZA A;  1SGH A;  1PFD A;  1FNW A;  4IKG A;  2WU2 B;  4GDL B;  3RNE C;  3PT2 B;  1MJD A;  3KH0 A;  2MP2 B;  2RDH A;  2MWS B;  2RPV A;  2E3T A;  4A3P A;  1NI2 A;  2JQR B;  1CJE A;  1E6E B;  1T0Y A;  1E8W A;  3CWI A;  3V60 A;  2G3Q B;  1ZP0 B;  4KX6 B;  2FCM A;  4REZ A;  1R7S A;  4HEA 1;  3W9C B;  2MRP A;  4C56 C;  2OHF A;  3RT3 B;  3I3T B;  3AE5 B;  3PPA A;  5AZF A;  3HVZ A;  3AE6 B;  5E6N A;  4ANV A;  3BK1 A;  3TEW A;  3ZIM A;  1Z2M A;  1SSN A;  1VR9 A;  4ZYN A;  2VRR B;  2JF5 A;  3BIN A;  2AL3 A;  4ZRP A;  2NPT A;  2PLP A;  1D5X C;  2JSV X;  1DGJ A;  4M02 A;  2XBB C;  2I2Y A;  3N1Z C;  3Q3M C;  3DDC B;  4ZRQ A;  3P1M A;  2N9K A;  4TMA B;  2BPS A;  2M0A A;  2D11 A;  4GDK B;  4LK0 M;  4I6P A;  2KQ7 A;  4NNJ B;  1AN8 A;  3WAN A;  2LFI A;  3GZN I;  5IP4 D;  1XQQ A;  2W54 A;  5BYR A;  2KWD A;  3GS2 A;  2Y3A A;  1J7B A;  2SEB D;  3ZKJ C;  3SHQ A;  5AZG A;  1FEH A;  3C19 A;  3MC8 A;  1E7U A;  4C7Y A;  2C60 A;  4RF0 A;  2ZNV C;  3TSS A;  4FAD A;  2NVU I;  3AEB B;  2MJ3 A;  4YTM B;  3RNF C;  3NVW A;  4EOY A;  3MJW A;  4WWP A;  1GB1 A;  1Y56 A;  2W82 A;  4YSY B;  2MEK A;  4X57 B;  2IO0 B;  4I6N B;  3UIN B;  2N9L A;  1TS5 A;  2JWU A;  3RFZ B;  2WDT B;  5IAA C;  2BB5 A;  4ZRJ A;  2IPK D;  2RR9 A;  3AEA B;  4IM3 A;  4LNN A;  4O1N A;  3L10 B;  4BZA A;  3L13 A;  3KUD B;  3N3K B;  1CK1 A;  3FIL A;  1WYW B;  1JML A;  3ZDT A;  1ESF A;  3RMK C;  3Q2A C;  1HEZ E;  2INP E;  3ZTC A;  3QCA A;  3NY5 A;  3Q8E A;  4HPL B;  2WXK A;  1XCT L;  3VRA B;  5HG2 A;  2GBR A;  2DYO A;  2V4L A;  1T0R C;  1TS2 A;  2OJW A;  4FHJ A;  3OAW A;  2E6X A;  1QKZ A;  3I5J C;  4PYU A;  2DZK A;  5FR6 A;  1Z5S B;  1LXD A;  2GBN A;  1WGG A;  2KD0 A;  1VRA B;  1MHX A;  4XYC A;  1EF1 A;  1KLV A;  2HTH A;  4B95 A;  4BKT A;  1HTQ A;  1LO5 D;  2KC1 A;  4YL8 A;  5JHB A;  1IYF A;  3PSE B;  4BOS C;  2LEK A;  4J6I A;  4R3D A;  2BGF A;  3C8Y A;  1E7P B;  1WH3 A;  1YIW A;  2C5L C;  4HCP B;  4BBN F;  4TQ0 A;  2BS2 B;  4DK5 A;  4RNA A;  4W9J A;  2KAC A;  5D2M B;  1MHH E;  1YQ3 B;  2W3S A;  3M95 A;  1C4P A;  1MI0 A;  5BYS A;  3ETR A;  3Q3J A;  3FIL B;  3OJ4 B;  3AE3 B;  1F0Z A;  3FKY A;  3RPF C;  2WU5 B;  1F9J A;  4MJS A;  2DNF A;  2D3A A;  3ENE A;  3BWU D;  1GB4 A;  2WQY B;  1PQS A;  2H89 B;  2LGI A;  2WXH A;  1V80 A;  2W3R A;  2SAK A;  1FCL A;  2WXF A;  1QOB A;  4HDO A;  2R61 A;  2XN9 C;  2KC2 A;  3VRB B;  3ZNH B;  3QC8 B;  3DVN U;  4K81 A;  4WIP A;  1EU3 A;  1HZ6 A;  5L95 C;  4FLH A;  4ARC A;  1PYW D;  4MEM A; 
#chains in the Genus database with same CATH homology
 1QLB B;  2FE8 A;  1WSP A;  2WDQ B;  1JCK B;  2QJL A;  1YJJ A;  4KGS A;  1FRR A;  2JX5 A;  4Q2J A;  4YTN B;  1E9M A;  1TS4 A;  4TQ1 A;  1C9F A;  1TS3 A;  2AQ3 B;  2J42 A;  4CQN A;  1B9R A;  2MH7 A;  2KDM A;  3NS1 A;  1P7E A;  2LMC A;  2PTL A;  1L6U A;  1VZ8 A;  1KTK A;  3NVZ A;  4C7Z A;  1OFF A;  3SR6 A;  4DXF A;  2LUM A;  2X38 A;  3AE9 B;  2J52 A;  1SEB D;  2J53 A;  1ZXI A;  3L4P A;  2KAJ A;  1QIL A;  4RFB A;  2YEP B;  1IUE A;  2IDY A;  1TY0 A;  2WDR B;  2FUG 1;  4JE3 B;  1GPX A;  3BVM A;  2H88 B;  4JWS C;  1WRI A;  4M0W A;  5TSS A;  4YXD B;  1SJH D;  1JAL A;  2QIE B;  4A9A A;  1HZ5 A;  2CJN A;  2PVG C;  4N59 A;  5LNK 1;  1V1P A;  1L0Y B;  1PGA A;  3IT6 B;  4HRO A;  4XDD A;  1WWT A;  1QQR A;  3AMZ A;  4JWU C;  1AW7 A;  1UWM A;  1ZE3 D;  3WCQ A;  3W5U B;  5D3I B;  5GXG B;  2WXG A;  3HVD A;  3SEB A;  3GB1 A;  1RYJ A;  3URY A;  1D4B A;  3AEG B;  1C77 A;  1C4C A;  4RGO S;  4RCO A;  1FNU A;  1YMH E;  3AV8 A;  4L1B A;  3Q69 A;  1EWY C;  1L6V A;  1YQ4 B;  3Q8F A;  1L0V B;  2ON8 A;  5T8I A;  3AB5 A;  3LXF A;  1FO4 A;  4KGR A;  1I4X A;  2AX5 A;  4EE2 A;  2GRI A;  1XCQ L;  2QSD A;  2WXN A;  5E6J A;  1V1P B;  1FFU A;  4PT5 A;  1DOX A;  1ZDV A;  3SFD B;  1CZP A;  3GP7 A;  1I4P A;  1ACC A;  1C78 A;  5EE0 A;  1SB3 C;  1XO3 A;  1RM6 C;  5FK9 C;  1YN3 A;  3T3N A;  2N0S B;  3KQ4 A;  3E56 A;  1MPE A;  3NVY A;  1KLU D;  3PO0 A;  2ZW1 A;  1BXT A;  1NYQ A;  1C76 A;  3P4P B;  3MHZ A;  2K5P A;  3UI3 A;  2Q5W D;  1XEE A;  2V3N A;  5EE1 A;  2DBY A;  2CJO A;  2WS3 B;  1KH0 A;  1V8C A;  2K0P A;  2WXI A;  3ABV B;  2D5G A;  5HFY A;  3V3X A;  1F2R I;  4WH4 A;  1OQR A;  2VZK D;  2JZP A;  1TZO A;  1QOA A;  3EA6 A;  4C80 A;  2CU3 A;  3P4R B;  4LLG M;  1FCC C;  1WYG A;  3MJ5 A;  3TEY A;  4ARI A;  1I4R A;  4LTU A;  4YT0 B;  3NZ3 A;  3P42 A;  3TUO A;  1T3Q A;  5G5G A;  1PDX A;  1YN5 A;  3BZD B;  1D5Z C;  2QEJ C;  3NVV A;  1UUP A;  1N5W A;  1DOY A;  2K22 A;  1MVK A;  1SIJ A;  3ZJU A;  3T3O A;  2YEP F;  3AEE B;  2LJI A;  4IDI A;  4HKQ A;  1L4Z B;  1M4V A;  2WDV B;  1VDV A;  2GB1 A;  5AUK A;  3IXS A;  1EM7 A;  3SFE B;  1WXQ A;  1TJE A;  2ICI A;  4ZYS A;  1JW9 D;  4KKI A;  4A6Q A;  5EE3 A;  1SE4 A;  4USA A;  2G9H D;  3BK2 A;  4HKZ E;  3U2S C;  3W2D A;  2IJ0 A;  1I4G A;  4AQ7 A;  4NAW B;  2BTE A;  3O13 A;  1BUI C;  2KQ4 X;  2INN E;  3B2F A;  1N63 A;  3AM9 A;  4TSS A;  1EU4 A;  2ONQ A;  2FBW B;  1E0Z A;  1JWM D;  5FR3 A;  1AYF A;  4ZHP A;  3Q8B A;  1J7C A;  1P7F A;  2XNA C;  2BYT A;  2NMQ A;  2OED A;  2VZK B;  4FXC A;  1L5P A;  1UGJ A;  3PZ8 A;  1SE3 A;  3V05 A;  1QT9 A;  3IT4 B;  1DOI A;  2NTT A;  1NI3 A;  4DQO C;  1QOF A;  1NVI D;  2IGG A;  2N7J A;  2WP9 B;  1ZOY B;  2DWQ A;  1FD6 A;  4AS1 A;  3ZGZ A;  4MM3 B;  1IGD A;  3AE7 B;  3B2G A;  3B9J A;  5FKA C;  2L32 A;  5BYQ A;  2BBC A;  1D5M C;  2RDG A;  2WXL A;  4H2A A;  1KFY B;  1PGX A;  3W1S A;  1FXA A;  3CIR B;  2JU6 X;  3AED B;  1PUT A;  3Q8A A;  2LHD A;  3KWL A;  3IAM 1;  1IGC A;  4UDU C;  3AEC B;  5BMH A;  2Y5C A;  4XE0 A;  3AN1 A;  1FNV A;  3ZYY X;  3OWE B;  4OVZ A;  4OZA A;  3VR9 B;  1HQR D;  2IGH A;  1PFD A;  1FNW A;  4A8X C;  4IKG A;  2WU2 B;  2JXT A;  4B0M A;  4GDL B;  1L0X B;  4HRS A;  4DXG A;  2EEL A;  2RDH A;  1NEK B;  2RPV A;  2E3T A;  4ZHO A;  2I38 A;  2ZW0 A;  1ZDX A;  1TY2 A;  3BYT B;  5BMI A;  4B0E A;  1JWU D;  2JQR B;  5EE9 A;  2L83 A;  3EUB 2;  1CJE A;  1IBX B;  3MFG A;  1L4D B;  1E6E B;  1JRP A;  1E10 A;  3IAS 1;  1AWD A;  1N62 A;  3P4S B;  4P16 A;  4IOI E;  4RH6 A;  3CWI A;  1DYQ A;  1I4H A;  1UNS A;  2HDE A;  1FIQ A;  3DWM A;  1JRO A;  1VZ7 A;  1ZP0 B;  1SJE D;  4KX6 B;  1HXY D;  4REZ A;  3HUI A;  4WWM A;  1R7S A;  4HEA 1;  2QMT A;  3ZQ4 A;  3E9S A;  3W9C B;  2G1E A;  1JWB D;  4US9 A;  1ENF A;  4C56 C;  4KKJ A;  1PGB A;  2OHF A;  3BVG A;  4MH8 A;  2V4I B;  2JYE A;  3LB8 C;  1KF6 B;  4JX1 C;  1FXI A;  2BS4 B;  3AE5 B;  5D7G A;  2NTS A;  4A55 A;  2PW9 A;  4OHJ A;  3HVZ A;  3AE6 B;  1ET6 A;  1N5X A;  3BK1 A;  1XF5 L;  5D3D A;  3TEW A;  5H8Y E;  3FAH A;  5MPO A;  1EWC A;  2PMV A;  1GOZ A;  1SSN A;  2Y5P A;  1K51 A;  3NUH B;  1VR9 A;  5H92 C;  2WXJ A;  3I9V 1;  2BT6 A;  2PVO D;  4YSX B;  4ZRP A;  1XLQ A;  1K52 A;  2PLP A;  3N9Y C;  2IGD A;  1D5X C;  1TKG A;  1ZXH A;  2JSV X;  1DGJ A;  1F77 A;  2I2Y A;  2HTM E;  1SF0 A;  2DLB A;  1XLO A;  2L52 A;  1SXT A;  4ZRQ A;  1V97 A;  3P1M A;  2N9K A;  2W55 A;  4TMA B;  2M0A A;  4N58 A;  4RF1 A;  1I4Q A;  1KLG D;  3EGR A;  4GDK B;  4LK0 M;  4P6V F;  4A90 A;  1VLB A;  3P4Q B;  4XDC A;  1J7A A;  3BVZ A;  5G5H A;  3AH7 A;  1AN8 A;  4MAC A;  4D2K A;  2LFI A;  4L23 A;  2MJE A;  1VZ6 A;  2W54 A;  5BYR A;  2WXM A;  2KWD A;  3GS2 A;  3W5V B;  4RGN A;  3J9C A;  4GLS C;  4N6E B;  1CQV A;  4WAF A;  2Y3A A;  1YNT E;  1J7B A;  4OZC A;  1FM0 D;  2SEB D;  1JWA D;  1FEH A;  1RWS A;  1QF6 A;  1SE2 A;  1KRH A;  4C7Y A;  4RF0 A;  2WXP A;  3HRD D;  3TSS A;  3BYY B;  3AEB B;  2MJ3 A;  2RMM A;  3H8H A;  2ACZ B;  3KLS X;  4RGT A;  3U4E G;  4YTM B;  3NVW A;  2WXO A;  4RGM A;  1GB1 A;  1Y56 A;  1JWS D;  1UWX A;  2J4X A;  3VQI A;  2W82 A;  4YWG G;  4YSY B;  5I4D A;  1FMA D;  2MEK A;  1TKY A;  2DYM A;  4MT5 A;  1BML C;  3MP9 A;  4JPS A;  1C79 A;  2N9L A;  1TS5 A;  2JWU A;  5HHD G;  4KGT A;  1XLN A;  3R2I A;  3RFZ B;  2GI9 A;  2WXQ A;  1XLP A;  2BB5 A;  2IPK D;  3DWG C;  1N60 A;  4ITK A;  4XWW A;  3AEA B;  4O1N A;  3VR8 B;  2M19 A;  3R2T A;  3PZ7 A;  4OZB A;  1RFK A;  1NYR A;  5C2T B;  5C3J B;  3FC4 A;  1CK1 A;  1VJK A;  3TEZ A;  3KWV A;  2V0G A;  1T6B X;  3FIL A;  1K53 A;  1JML A;  2V3P A;  2M56 B;  1ESF A;  3U52 E;  1HEZ E;  1ET9 A;  2INP E;  4XWT A;  2WLB A;  1STE A;  4HJG E;  3Q8E A;  2WXK A;  1XCT L;  3VRA B;  1ZUD 2;  3NRZ A;  5HG2 A;  2DYO A;  5AUI A;  3P63 A;  4L2Y A;  1C4A A;  3AEF B;  1TS2 A;  4ZOH C;  2TSS A;  1TYG B;  2E6X A;  1QKZ A;  2AQ1 B;  1I7H A;  1VRA B;  1MHX A;  1JQ4 A;  3AE1 B;  4WQM A;  1LO5 D;  4YSZ B;  3ZJT A;  2LEK A;  4OW0 A;  3LYY A;  4YTP B;  4R3D A;  2BW2 A;  3C8Y A;  1Q10 A;  1E7P B;  2WNM A;  1YN4 A;  3Q8C A;  4WUR A;  2LHE A;  2AQ2 B;  5JXV A;  4NJC A;  4NAM A;  3AE2 B;  1TKE A;  2BS3 B;  3AE4 B;  3AE8 B;  1YJI A;  4TQ0 A;  2BS2 B;  4RNA A;  1A70 A;  4J3O D;  2JYT A;  1ROE A;  1QOG A;  3MC0 B;  1GAQ B;  2KAC A;  2QIL A;  4US8 A;  3U7Z A;  1MHH E;  2PKO A;  1YQ3 B;  2W3S A;  1C4P A;  1MI0 A;  5BYS A;  3ETR A;  1IBX A;  2L1A A;  1B1Z A;  5BMG A;  1SBB B;  3FIL B;  3AE3 B;  1K50 A;  1F0Z A;  1FFV A;  2B76 B;  3I57 A;  2EKI A;  2PIA A;  1N61 A;  1HA5 A;  2MJD A;  2WU5 B;  3RPF C;  2BB6 A;  1NEN B;  2KN4 A;  2K9X A;  3BWU D;  1GB4 A;  1F2R C;  2WQY B;  1V1O A;  1ZPS A;  2H89 B;  2LGI A;  2WXH A;  2W3R A;  3ZJV A;  2SAK A;  2K3U A;  1FCL A;  1D6E C;  1XXG A;  2KMM A;  4NZL B;  3BII D;  2WXF A;  1QOB A;  2R61 A;  2XN9 C;  3R8B A;  3VRB B;  1WGK A;  2WXR A;  2Z8L A;  4WIP A;  1OQQ A;  5HI1 A;  1EU3 A;  1HZ6 A;  4ARC A;  1T5X D;  1PYW D;  1FRD A;  3TEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...