1RFKA

Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
95
Chain Sequence
ATYKVTLINGLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title Structural basis for the thermostability of ferredoxin from the cyanobacterium Mastigocladus laminosus.
pubmed doi rcsb
total genus 25
structure length 95
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1rfkA00
2MJ3A 2WLBA 2MJDA 3P1MA 1SB3C 4N6EB 1GPXA 1XLPA 3P4PB 4USAA 1KRHA 2WQYB 3AE5B 1UWMA 3P4RB 1NENB 1B9RA 4YSXB 1QF6A 1VLBA 4C7YA 1E7PB 3P4SB 4ZHOA 2B76B 3CWIA 2BS2B 3AE8B 3SR6A 3AM9A 2CJOA 1AWDA 2L52A 1OQQA 3CIRB 1YQ3B 3NVWA 4P6VF 3KWLA 4ZHPA 5C3JB 1DGJA 1RYJA 1GAQB 1F0ZA 1J7AA 2M56B 1L0VB 1L6VA 2K5PA 2KAJA 1PUTA 3B2FA 5EE9A 3W5VB 1E0ZA 4WWMA 3PO0A 3AE7B 3AEAB 1QOBA 5C2TB 1RFKA 2H89B 1N5XA 3SFDB 3EUB2 1T3QA 4ZOHC 3VRBB 1TKYA 2CJNA 3AEGB 1XLNA 3HVZA 1YJIA 3AE1B 1OQRA 3AEFB 3AEBB 3DWMA 3LXFA 3AB5A 3NVVA 3VR9B 1JROA 2K9XA 5H92C 3RPFC 4YSZB 1L5PA 1ZUD2 1NI3A 2K22A 3BIID 1XLQA 2JX5A 2CU3A 3ZYYX 2W3SA 2Q5WD 1YJJA 3NRZA 2W55A 2Y5CA 3AE2B 1JALA 2WDQB 3FAHA 4YTNB 3SFEB 3WCQA 3LB8C 1A70A 3B2GA 1TJEA 1XO3A 3AV8A 1FRRA 1QOFA 3W9CB 2L83A 3AE4B 1NVID 1FO4A 1CZPA 3NVZA 1N62A 2WU5B 2DBYA 1ZP0B 3P4QB 1FXIA 1YQ4B 1RWSA 1PDXA 4LTUA 4N59A 1QOGA 1XLOA 1FXAA 1TYGB 4YTPB 1TKGA 2DWQA 1NYQA 2EKIA 3AH7A 3DWGC 4N58A 2BS4B 1FM0D 1DOIA 1N5WA 2FBWB 2PVOD 1CJEA 1J7CA 1QLBB 2MJEA 5AUIA 5GXGB 2W54A 1E6EB 4JX1C 2WU2B 5MPOA 1WWTA 3AE6B 3HRDD 1AYFA 1NYRA 4ITKA 1ZOYB 2LEKA 1JW9D 2WP9B 4HROA 1EWYC 3B9JA 1WGKA 1SIJA 1KF6B 2HTME 3L4PA 3NS1A 4JWSC 4US8A 1NEKB 4A9AA 2W3RA 4JWUC 5EE1A 2WDRB 1R7SA 3HUIA 4US9A 4YT0B 1RM6C 5EE0A 2BT6A 1ROEA 4YSYB 1VJKA 4YXDB 2E3TA 1N60A 2JQRB 2KMMA 1KFYB 2AX5A 2QJLA 4WQMA 1E9MA 4FXCA 5G5HA 1FFVA 1J7BA 2M19A 1FRDA 1JWBD 1WRIA 1QT9A 2QIEB 3ABVB 3AMZA 3W5UB 1TKEA 3AECB 4YTMB 4KX6B 1N61A 3AEEB 1JWAD 2PVGC 1SF0A 3ETRA 5H8YE 4C80A 3P63A 1FIQA 1PFDA 1I7HA 1V8CA 2BS3B 4HRSA 1JRPA 3AE3B 1WXQA 2G1EA 3AEDB 5G5GA 1FFUA 1FMAD 4IDIA 2PIAA 1N63A 5EE3A 1IUEA 2N0SB 3NVYA 3VRAB 3VR8B 2ACZB 1WYGA 3FC4A 2WS3B 3AN1A 1VDVA 4C7ZA 1DOXA 2WDVB 3AE9B 5AUKA 1DOYA 1V97A 2MH7A 2OHFA 2H88B 1OFFA 1L6UA 1E10A 2PKOA 1QOAA 1JQ4A 1ZXIA
chains in the Genus database with same CATH superfamily
4HCPB 1HZ6A 3IHPC 3Q6BA 2GB1A 1WJUA 5FR3A 3SU8X 3U4EG 4N9F4 2DNFA 2K3UA 3V60A 4NZLB 1Y56A 1K52A 1FEHA 3AI5A 2W9NA 3IT6B 1D5ZC 2K5PA 3RI7C 2Y5BB 4XDDA 4WIPA 1WZ0A 2MBBB 2N1VA 2Y5PA 3NZSA 4XDCA 4MH8A 1NI3A 2D3BA 1WE6A 4CHKA 2J53A 1A5RA 4BOSC 2DHZA 4TKNA 4WAAA 3FAHA 2CHZA 1TGZB 2KKCA 2L83A 4W9KA 1K8RB 2IDYA 2KDIA 3QHTA 2KJ6A 3Q14C 4I6NB 1DOIA 3CSFA 4K7WA 3OLMD 2V1YA 1WY8A 2LXAA 2LVQA 2AL6A 5JHBA 4B0EA 4NQKE 2BWFA 4MM3B 1J7BA 3L10B 1QILA 3UI3A 3AEEB 3PRZA 3A33B 3BZDB 2ZZPB 2E6XA 5AZHA 2KXJA 1MJDA 2YEPF 5G5GA 1SE4A 1JCKB 4BBNC 1V9JA 2N1WA 2HE7A 1WRDB 2V4LA 3AN1A 5AUKA 4LJPB 1PGXA 3ZIMA 2FAZA 1K51A 1KRHA 2AQ1B 3P4RB 1TZOA 1M94A 4RGOS 5IKCM 2PMVA 3TEYA 4TUUA 3U52E 3PO0A 1N5XA 2ZVNA 4IWQA 3A9KB 2L0TA 3N3KB 5G55A 1TY2A 3GOEA 3S2AA 2N4FA 2K22A 3BIID 4I6PA 2EELA 1GC7A 3PZ7A 4FULA 3PLVA 4P1BC 5EDSA 3RZFA 4URKA 4B6WA 4BKGA 2LUMA 1YQ4B 1PDXA 1TKGA 4K3CA 3BK2A 3V05A 2FBWB 1T0YA 2QHOA 3H7SA 5AUIA 2KX3A 3AU5A 3PRPB 5MPOA 3X0WA 1SIFA 2WGSA 1J0GA 4UDUC 1YX5B 2ZJDA 2K0PA 3PZ8A 4D2KA 4BKSD 5LNK1 4YSYB 2N9PC 1JWSD 2LD9A 2WXQA 3ZNZB 1XCQL 2NBVB 4TQ1A 3EC8A 3I57A 3QWZB 3Q2AC 2PVGC 3ETRA 3PHWB 2HJ8A 3N20C 4WWPA 1FMAD 3ZNID 3IFWB 1S3SG 3UIPB 4C7ZA 2O6VA 2LUEA 4G3XB 4NQLB 2PKOA 2GBJA 3P1MA 1Z5SB 5JHAA 3BK1A 4WJNA 3N1XC 3I5JC 1KJTA 4XWWA 2KX0A 1AWDA 3CIRB 1GAQB 3CSTA 4W9EA 5BYSA 3NS8A 3HIZA 2MHJA 2MBEA 3IVFA 3SEBA 1RFKA 2YEPB 3DPDA 3LYYA 2DAJA 3NZ3A 2JRHA 3AE1B 1I4XA 3HVDA 1OQRA 2ZPYA 3AEFB 3H9DA 1L5PA 3HHMA 2BPSA 1HTQA 2IJ0A 2KDBA 3AULA 2MX2A 2LXCA 3DVGX 2YVCA 4EOYA 4II2B 2NBUA 3PPAA 1V6EA 2DBYA 2J4XA 1I35A 3KWVA 1WGYA 3BY4B 4FJYA 2BYTA 4BAXA 2VH2A 3GB1A 1Q1OA 3AE6B 4GDLA 4LNIA 2WXIA 4BZAA 2INPE 2J7QB 4ICUA 2AWTA 1FXTB 1V86A 2KMCA 3R7RA 2I1KA 1T0QC 3RNEC 3SD5A 4E3CA 4YXDB 4IOIE 1HZ5A 3L13A 4YL8A 3U8ZA 2G9HD 2N7DA 1SF0A 4NAWB 2A4ZA 1I7HA 1YJ1A 4EEWA 5LLIA 4ZDVA 1IP9A 1WYWB 2UWQA 2LWPA 3NVYA 3VR8B 4PK1A 1FPYA 1E8WA 4GIVA 1FD6A 4OVVA 1WX9A 3FILB 3RCZA 2HD5B 2C60A 3ZTDA 5E6OA 1UWXA 1R4MI 4USAA 3ZTCA 1WJ6A 1TS2A 3APCA 4FJZA 1PGAA 2WX0A 4W9LA 1DGJA 1VD2A 2J0KA 3MHZA 4IWOA 1L6VA 3BVMA 3WANA 2O2VB 3QARA 3OG5A 1IGCA 1XLNA 1YJIA 2LMCA 2MLBA 2IBIB 4OW0A 4S0RA 3ZVVA 3VR9B 1GC6A 1RAXA 2KDMA 3ZYYX 3K9OB 5CHWA 3URYA 2JXTA 4EZLA 2QEJC 2Y5CA 2WDQB 4HKZE 2K8HA 4WAFA 1H4RA 4A90A 2VH1A 3C19A 1VRAB 1E8XA 2ICIA 2WXNA 3DWGC 1XEEA 2KVZA 1MHXA 4P1CC 2W54A 1KLVA 3TEZA 1WF9A 1WXVA 1AYFA 1T0RC 1EWYC 3B9JA 1SJED 3MTNB 3IAM1 3RMKC 4BFRA 2TSSA 1CK1A 1V1PA 2FUG1 1FRDA 3AMZA 1UZXB 4JLCA 2GRIA 4IM0A 4DDID 4HLEA 1JWAD 3PHXB 2XN9C 4NY0A 4BBNF 4MACA 1WXQA 2GBRA 3QJZA 2WHIA 2Y3AA 2NTSA 5E6PA 1IUEA 2EKEC 4ASWC 3AE9B 4EFOA 3H7PB 2KWCA 4LK0M 5L95C 1SB3C 3IT4B 3FKYA 1V80A 3NJTA 4GDKA 4ICVA 2L76A 2JY6A 3DVNU 4ZHOA 4LCDE 2PJHA 4IM3A 3CWIA 4I6LB 1BMLC 1SGHA 2FE8A 3TUOA 2JF5A 3CMMB 2D3CA 2LHDA 3NOBA 1ISNA 2KQ4X 4GOCA 1TY0A 2IYDB 3VH3B 1E0ZA 1WSPA 3WAOA 2WXGA 2MP2A 3SHQA 3NG0A 1KH0A 1SSNA 1F2RI 3HVZA 1SJHD 3KVFB 3AB5A 4YSZB 1BT0A 2Z59B 2NS5A 5BO4B 2KLGA 3DBRI 1RFAA 3KW5B 5L83A 2MSED 3WALA 2AYOB 3SFEB 4KGTA 2Z0DB 2LRUA 3AV8A 4HCNB 2MA9B 2NPTA 3BVGA 2WU5B 3P4QB 1FXIA 1TS4A 4YTPB 1FXAA 2D3AA 2KN5A 1P98A 2BS4B 1FM0D 3RNCC 2L32A 4DHJB 3DBLB 3UQAA 1JW9D 1U4AA 4MJSB 4S17A 1JWMD 5TR5A 3HUIA 3MHSD 2WDTB 3A1QB 3VH4B 1L2NA 3BINA 2E3TA 3P42A 5BMGA 3VAWA 3X23A 4PT5A 5D3IB 2GBNA 2ZVOA 2L7RA 2JT4B 3RUIB 3B0AA 4MEMA 4KZCA 4HRSA 5E6NA 1C4AA 2KMAA 2KWUB 2K6DB 3AE3B 4RGMA 3VTVA 2HTHA 3A4SC 1FFUA 4EUTA 3PS6A 5G2NA 3U7DA 2JWZA 2JUOA 3KYCD 4C00A 4E71A 4IUMB 4CYEA 1E10A 4LNNA 3T9LA 2KC2A 3QIJA 1WMHA 3ECIA 3RFZB 3P4SB 2CJOA 4G0NB 4HPLB 5C3JB 3RN9C 2GOWA 2G45B 3I63C 4OVUA 3AEAB 4M8NA 1ZKHA 4NNJB 1L4ZB 4E74A 1WH3A 2KFKB 1T0SC 2BKFA 3LXFA 2QC8A 1ET6A 2NVUI 5D94A 2O6VD 3M63B 4KZ0A 1L0XB 1GG3A 3TEXA 3MJWA 1BXTA 4YTNB 3Q8EA 1VZ7A 1XO3A 1ZDVA 1IBXB 2ONQA 2LASA 3PZDA 3L0WB 4HKQA 1ENFA 3U30A 1NYRA 4ITKA 2K25A 1IPGA 4QAYA 3QX1A 1D3ZA 2BYFA 2W3RA 2C9WB 4JWUC 3V6CB 4W9CA 3C8YA 3KH0A 4M00A 2DX5B 1JRUA 1ZXHA 2AX5A 5CTRC 1JWBD 3RT3B 2DYMA 3DVGY 2INCC 1HE8A 3IAS1 2I38A 2NMQA 1FNVA 2J0MA 2IO0B 4WWNA 1JRPA 1XF5L 3EFUA 2J0JA 2GI9A 2L00B 4PS7A 1DOYA 4RH6A 2AL3A 1L6UA 3TSSA 5JH5C 1WM3A 5DPSA 3L16A 2N9LA 3J9CA 2AQ2B 3DBHB 4MM3A 3SR6A 4P6VF 2ZNVB 4BOZB 1OEYA 3MP9A 1WZ3A 1LO5D 3GZNB 1H8CA 2M0AA 3AE7B 4PS3A 4ANVA 2AQ3B 2CJNA 3OJ4B 2KTRB 2ZW0A 5FK9C 4PYUA 1FNWA 2JX5A 4RGNA 2XBBC 4RF1A 4KGSA 1J8CA 4IG7B 1NVID 1N62A 2JSVX 5BYRA 2KWVB 2WX1A 3KLSX 3KUDB 2FUHB 1UH6A 1QKZA 4ARIA 4B0MA 2G4DB 3N32A 4TSSA 2I1JA 1R4NB 2Z0EB 3V61A 1WGKA 3A9KA 5D7GA 4US8A 5LXIB 1E90A 1R7SA 4US9A 1SE3A 1KLUD 3MC9A 2JU6X 2JZZA 1WX8A 1YD8U 2MBQA 3NHEB 4GMVA 4HDQA 2KWDA 3UGBB 4YTMB 1GOZA 2WXKA 1UD7A 4C80A 3VQIA 3T3NA 1TIFA 1D6EC 2K1FA 4G50A 1F9JA 3OJ3A 2V3SA 3EFCA 1VDVA 4K3BA 1MG8A 2WDVB 2M4NA 4JPSA 4BKTA 2MJDA 1OQYA 3AXCA 1B9RA 1G6JA 3QQ8B 3CF6E 3ZDMC 2R61A 3ZRCA 2ZNVC 5J18A 4L1BA 5KHOA 4K7SA 4A6QA 3MC8A 3W5VB 5EE9A 2QDFA 4WWMA 1YMHE 2A5UA 2H89B 1WI0A 4AWJA 1WGGA 4JIOU 3VRBB 2OJRA 3K9PB 4WJPA 4B95A 4TV3A 3EA6A 2JZ3B 3W1YA 2KJRA 3TCAA 5IN7A 1XLQA 4W9GA 2LGXA 1EF5A 3LDZE 2WXFA 1WGHA 2KTFA 3WCQA 1A70A 2DYOA 4AOFA 5T8IA 3H8HA 2WXJA 5AZFA 2RPVA 1EM7A 1RWSA 5GMVA 2KO3A 1TYGB 2D10A 3UF8A 4II3B 4A55A 3Q8BA 3B08A 4FADA 4FHJA 5TSSA 4B9KA 3L08A 2KJHB 3ZJUA 4JWSC 2UYZB 3ML8A 3QA8A 2DLBA 1TZ1A 5IO9A 1VR9A 2LZ6A 1TS3A 3JW0X 4REZA 1I4RA 5EE0A 1E8ZA 2KT7A 1VJKA 3ZGZA 4XGAB 5C23A 3O65B 1WJNA 5LXHA 1V81A 4TMAB 4W9JA 2OJWA 2XEWA 2IO3B 3KUZA 4MELA 2M1MA 2X38A 1UBIA 2G1EA 3DDCB 2REXA 3IBEA 4IDIA 4WJOA 3OWEB 3P2BA 2DZJA 2FCQA 3ZJTA 2JRIB 1SEBD 2KZRA 2OHFA 2OOBB 4DXGA 1HEZE 4KKJA 1Y8RC 2K8BA 2Z8LA 5DPWA 1WXSA 3R66C 2WQYB 2D11A 3BWUD 1YOVB 1P0RA 3ENEA 1GNUA 2ON8A 1QF6A 4C7YA 3JSVB 2B76B 4ANWA 2IY0B 1XQQA 2IGDA 2QSDA 1KOTA 4NAWA 4YWGG 3B2FA 3JSVA 3JYUA 2ZCBA 1QOBA 4KIKB 3EUB2 2VZKD 3EGRA 3M95A 1AARA 2C7MB 2L1AA 5C1ZA 4FJVB 5D2MB 4KDIC 2D07B 2CU3A 1QQRA 3MC0B 3A9JB 3FILA 3N30A 5E6JA 1JALA 4X57B 3LB8C 1UNSA 1VZ8A 1QOFA 3TMPB 2CKHB 2M0XA 1MHHE 1B1ZA 1KLGD 4N58A 3Q69A 1EU3A 5HFYA 1F77A 4GN1A 1XD3B 2KC1A 2N9XA 2O2VA 3M3JA 1YN3A 4HK2A 3HM6X 3NZUA 1KF6B 2LJ5A 3DHGC 3BYTB 3ZKJC 4A9AA 4EKUA 5EE1A 4ZYNA 2LVPA 2KDFB 4AP4C 2RMMA 3QC8B 2LGDA 2ASQA 2W82A 3PGEA 2INNE 3HK0A 4RNAA 2M19A 1WRIA 2V4IB 1YNTE 3VUXA 4IW0A 1NI2A 3VTWA 3NY5A 2MCNB 1WGRA 4ZRPA 2RPQA 1UGJA 2BWES 2CHWA 2RD0A 2PTLA 4BVUC 5D3DA 1V97A 1OFFA 2N7EA 4WQOB 4WQMA 4GSWA 2MJ3A 4N6EB 3VUWA 1P7FA 4J3OD 4DDGD 3A4RA 1Q10A 2DZKA 1WE7A 2WNMA 3APDA 2MBHA 3MFGA 4WJQA 2GMIC 1F0ZA 2ZPNA 3ZXRA 4ZYSA 4DWFA 4RM9A 3SFDB 2LRWA 1T3QA 4XZ4A 3IXSA 5H92C 1WXAA 2LGSA 3H7PA 1WFYA 2WWZA 2IZVB 2W3SA 4FBJB 4MGZE 3AE2B 2WXMA 4KKIA 5J2RA 4W9FA 3B2GA 4MGKE 3AE4B 1NBFC 5GXGB 2MBOA 2WXRA 2RDBC 1N5WA 1J7CA 1QZEA 2D2QA 3ML9A 5CX3A 1IGDA 4C4VB 2JPHA 2WXOA 4NJ7A 4FXCA 2WXPA 1FFVA 3PRMB 2QIEB 4HJKA 3VFKA 2FCSA 2G4SA 1N61A 3HM3A 1HQRD 1RLFA 1SE2A 3WAPA 3T3OA 1STEA 3PV1A 3NUHB 1C9FA 5EE3A 1WXMA 2L0FA 1LQBA 1YN5A 3PT2B 4MJSA 2MH7A 2H88B 4A3PA 3BVZA 3NVVA 5BMHA 1XT9B 4P16A 4F1SA 2ZW1A 2SEBD 3A1QA 4DK5A 4WWOA 4H2AA 1UWMA 4O1NA 1LXDA 1VLBA 3Q3JA 1E7PB 3ZJVA 1YX6B 2JZPA 1OQQA 2IY1B 3KWLA 3DHIC 1J7AA 1L0VB 3GE3C 1LFDA 1PUTA 3N1ZC 1N6ZA 2JWUA 2N9KA 4AJYB 2NCNA 3H1UA 2BTEA 3ZO5B 1ET9A 2J42A 4AUQC 1R4MB 3L17A 3DWMA 3EECA 2K9XA 4LNFA 4K7UA 1ESFA 2QMTA 4NAMA 1CMXB 4EZKA 1C3TA 2BW2A 4EZJA 4HWIB 4ANXA 3MJ5A 2KACA 3KUCB 1CQVA 5IP4D 1FRRA 3W9CB 4RM8A 3NVZA 2KFJA 2BB6A 3ALBA 3DQVA 2LGYA 1HTOA 3GE8C 3ZUNA 2AEHA 2RDGA 3VVWB 4M0WB 4W9IA 4ARCA 4HJGE 2LEKA 1V1OA 2L3ZA 4J6IA 1E7UA 2KFKA 4M0WA 1VZ6A 1FNUA 2CU1A 2EMSA 4YT0B 4M01A 1UUPA 2LI5A 3BYYB 2GLSA 4MGIE 2BF8B 1J19A 1E9MA 2M17A 4L23A 1FCLA 3TJPA 1YN4A 1E8YA 4RGTA 1IBXA 5H8YE 2FIFA 2BS3B 5BYQA 2I2YA 1FCCC 3AEDB 3UQBA 1LM8B 2KVRA 4F7ZA 4LLGM 3QCAA 4A3OA 5HKHA 3FC4A 1GB4A 1V5TA 2XK5B 3U7ZA 4XYCA 2R2OA 4OZAA 1QOAA 1ZXIA 2WLBA 2G3QB 1LGRA 1WX7A 3RNGC 1GPXA 2D5GA 3AE5B 2XK5A 4HDOA 1E7VA 4FN2A 2QILA 4FHKA 2C5LC 1RYJA 4KDLB 1WGDA 2DENB 4ANUA 1ZW7A 3ZDTA 3AEGB 3RZWC 5I4DA 3PSEB 4HPPA 1BUIC 1PGBA 2EMTA 4OHJA 1P9DU 3QK0A 1SE9A 4GLSC 4LDTB 1MI0A 3NRZA 1OTRB 3OAWA 3Q3OC 3ZLZA 1TJEA 4KSKC 1CZPA 1K53A 3ZNHB 2L05A 4LTUA 1JMLA 4N59A 2DWQA 2BVCA 5D6JB 2PVOD 2D3GA 3UIOB 2KK8A 3DBRB 2BYVE 2KDEB 3VHTC 2RDHA 1V2YA 2KTRA 2HTME 2MWSB 1NEKB 1V5OA 3D32A 4XWTA 3PVLA 2V9HA 3WIMA 3W1SA 2KN4A 1S1QB 5AEKB 1TTNA 2JYTA 3VUYA 2N7JA 2FCMA 1UGMA 2K8CA 2DYBA 3P63A 1GUAB 4TQ0A 5AZGA 5IA7A 4JL9A 5DCNA 3W2DA 1N63A 1Z2MA 2ACZB 2R2QA 1TS5A 1DOXA 1C4CA 3RNBC 1KTKA 2BBCA 2PW9A 2JXXA 4KSLC 2ZEQA 4LNOA 5CHFA 3P4PB 5DPTA 2MRPA 5J17A 1NENB 4YSXB 5HG2A 3VTUA 3WAMA 1I4GA 1TT5B 2MW5A 1UBQA 4ZHPA 1SXTA 1E5WA 4IKGA 5C2TB 3EHVA 4GGQA 1L7YA 1C77A 1C78A 3RNAC 1ZUD2 2LVOA 3R3MA 2BB5A 3RULA 2Q5WD 2IGGA 3E56A 1P7EA 4K81A 2WXLA 1HA5A 1F2RC 1I4HA 2KNBA 1DYQA 3R2IA 4DHZE 5BMIA 2WXHA 2KQSA 3AH7A 4IWPA 4OZBA 1CJEA 2MJEA 4HEA1 3W1SC 3DOWA 3N9YC 3TEWA 3HRDD 4IC7B 2O6VB 3NS1A 1I4QA 3RD2A 1HXYD 4M8MA 3Q8CA 1ROEA 4P7IA 1XCTL 2PPHA 5G5HA 3R8BA 1M4VA 2QCZA 1QT9A 4XX5A 2B3AA 4PYZA 1MVKA 1I4PA 3KYDD 4RMAA 2KOXA 2C7NB 1D4BA 3TBLD 5IAAC 5FR6A 1ZGUB 1PYWD 3WA0A 2HJ1A 1C79A 4RCOA 1X1MA 2J52A 4Q2JA 1C4PA 2SAKA 1YJJA 2FCNA 4K1RB 3ZNGC 2PE6B 3Q3NC 2CR5A 5HI1A 4MSQB 3V3XA 1MPEA 2V3PA 2MEKA 1SBBB 2BYEA 3PTFC 4JE3B 3TIXA 4GDLB 1WJ4A 1Q0WB 3M62B 3N1YC 3UINB 2LHEA 4HPMB 4DHJD 2RGFA 4DXFA 4GB9A 5HHDG 3DBLI 2W55A 1ZPSA 4MT5A 2M8SA 2FNJB 1FO4A 3IG3A 1OEYJ 1UF0A 5FKAC 4DBGA 3GS2A 1F1HA 1QLBB 1P3QU 3O13A 4KIKA 1WWTA 4LJOB 4FA6A 3V62A 2C7HA 1WR1A 2LGIA 3I3TB 1ZDXA 4MSMB 1C1YB 2WDRB 2X8XX 3ZRFA 1RM6C 4GXBA 4W9HA 1C76A 3A9JA 4ZRJA 4NJCA 1IYFA 2BQQA 3ABVB 3LJ3A 1AN8A 2MQJA 3RNFC 1FIQA 2K6QA 2V3NA 1MFWA 3JVZX 3ZW3A 2IPKD 1L0YB 1EWCA 2PIAA 2N0SB 2IO2B 1V49A 4KV2A 2NBWB 3V6EB 5JZEB 2NR2A 4HVBA 2LJIA 1JWUD 3DBSA 2KHWB 2BS2B 1T6BX 2JVCA 1F52A 3NVWA 2L52A 4OZCA 4ZRIA 1YQ3B 1T5XD 1PQSA 4A8XC 1WR6E 4HXDA 2KYWA 4LNKA 4L2YA 4ACFA 3TL5A 1JROA 3RPFC 1OGWA 3SDLC 4WURA 1K50A 4BKSA 1KM7A 4XC2A 2GBMA 1V1PB 4M02A 3RYTA 2LFIA 4C56C 1ACCA 1ZP0B 3Q3MC 1QOGA 4CQNA 1NYQA 1NDDA 3DVNV 4KGRA 4IM2A 5DPRA 3PLUA 1I42A 1E6EB 1ZE3D 2WU2B 2FIDA 5KHQA 3DHHC 1ZOYB 2KLCA 3APFA 4HROA 2YLMA 4ZRQA 1SIJA 3L4PA 2PLPA 2BT6A 4A20A 2CS4A 4GDKB 2JQRB 2KMMA 4W9DA 2UU7A 1EU4A 3W5UB 1WM2A 3GP7A 4RF0A 4WH4A 4KX6B 2PE9A 3Q3FA 4LDTD 3AU4A 4JGHB 1V8CA 1RRBA 4RFBA 3T8MA 2MP2B 4R3DA 3DBHI 2DZIA 2N9EB 3Q8AA 1GB1A 2RR9A 1L4DB 3QAQA 3VRAB 1TBEA 1WYGA 5CHVC 3GZNI 4ZRKA 2ZCCA 4CO7A 3ONSA 3VDZA 4DHZB 4DQOC 1JQ4A 1UELA 4C4VA 1XLPA 3VXWA 3KQ4A 1WIAA 2NPTB 4MH0E 2PEAA 3PREA 3AE8B 4MGYE 3AM9A 2HDEA 4GU2A 2L8JA 2M56B 2GBKA 4FLHA 4NJ6A 2KAJA 1EO6A 3B1LX 4ZOHC 1TKYA 3H6NA 2IO1B 5JXVA 3AEBB 2KQ7A 5IOIA 1D5XC 2WYQA 1EF1A 2OEDA 4KVGB 4AJWA 2BKRB 2NTTA 1VCBA 2V0GA 1XXGA 2VRRB 1R4NI 4XE0A 1D5MC 1P1AA 3L54A 4PS8A 2XNAC 1XLOA 2EKIA 1YQBA 2K39A 2DAFA 2VZKB 4F8CB 4JX1C 3R7QA 3R2TA 3E9SA 4DXAB 2WP9B 1YIWA 1AW7A 2BGFA 3I9V1 2RSUA 3C0RB 4AQ7A 2JYEA 1MG4A 1N60A 1KFYB 2QJLA 1WMHB 4MDKE 4NPNA 1EUVB 2CHXA 1TKEA 3AECB 2IGHA 3ZXVA 3Q8FA 4EE2A 4OVZA 1PFDA 1Q5WB 1GJZA 3U2SC 2DZMA 3ZQ4A 4AS1A 3DCGA 4G11A 2INDC 2KD0A 2WS3B 2KANA 4JQWC
chains in the Genus database with same CATH topology
1HZ6A 1SB3C 3IT4B 3P4PB 2WQYB 2GB1A 3BWUD 5FR3A 1NENB 4YSXB 2ON8A 3U4EG 1QF6A 4C7YA 4ZHOA 2B76B 2K3UA 5HG2A 3CWIA 1BMLC 1I4GA 4NZLB 2FE8A 3TUOA 1Y56A 2IGDA 1K52A 2QSDA 4ZHPA 1FEHA 1SXTA 2LHDA 2KQ4X 1TY0A 3IT6B 1D5ZC 2K5PA 3B2FA 4YWGG 1E0ZA 4IKGA 1WSPA 5C2TB 4XDDA 1QOBA 2WXGA 4WIPA 3EUB2 1KH0A 2Y5PA 1SSNA 2VZKD 1F2RI 3HVZA 1SJHD 3EGRA 2L1AA 3AB5A 4XDCA 4YSZB 1C77A 1C78A 1ZUD2 4MH8A 1NI3A 2J53A 2CU3A 2BB5A 1QQRA 3MC0B 3FILA 2Q5WD 5E6JA 3SFEB 4KGTA 1JALA 3FAHA 2IGGA 3E56A 3LB8C 1UNSA 1VZ8A 1P7EA 2WXLA 3AV8A 1HA5A 1QOFA 2L83A 3BVGA 1F2RC 1I4HA 2WU5B 1MHHE 2IDYA 3P4QB 1DYQA 1FXIA 1B1ZA 1TS4A 1FXAA 3R2IA 4YTPB 1KLGD 5BMIA 2WXHA 3AH7A 4N58A 2BS4B 1FM0D 1DOIA 1EU3A 3Q69A 5HFYA 2L32A 4OZBA 1CJEA 1F77A 2MJEA 4HEA1 3N9YC 3TEWA 3HRDD 1YN3A 1JW9D 1KF6B 3NS1A 1I4QA 1JWMD 1HXYD 3BYTB 4A9AA 5EE1A 3HUIA 2RMMA 3Q8CA 1ROEA 4B0EA 1XCTL 2E3TA 3P42A 2W82A 5BMGA 2INNE 4PT5A 5D3IB 5G5HA 4MM3B 3R8BA 1J7BA 4RNAA 2M19A 1M4VA 1WRIA 2V4IB 1QT9A 1YNTE 1QILA 1MVKA 1I4PA 3UI3A 3AEEB 1D4BA 3BZDB 2E6XA 4HRSA 1C4AA 1PYWD 3AE3B 4RGMA 2YEPF 4ZRPA 5G5GA 1SE4A 1FFUA 1JCKB 1UGJA 1C79A 4RCOA 3AN1A 2J52A 5AUKA 2PTLA 4Q2JA 5D3DA 1V97A 1C4PA 1OFFA 2SAKA 1PGXA 1E10A 4WQMA 1YJJA 2MJ3A 4N6EB 1K51A 1KRHA 1P7FA 4J3OD 5HI1A 1Q10A 2AQ1B 1TZOA 2WNMA 3P4RB 3RFZB 3V3XA 3P4SB 1MPEA 2V3PA 4RGOS 2CJOA 3MFGA 2PMVA 5C3JB 1F0ZA 3TEYA 2MEKA 1SBBB 4JE3B 3U52E 4ZYSA 3PO0A 3AEAB 4GDLB 1N5XA 3SFDB 1L4ZB 1T3QA 3IXSA 2LHEA 3LXFA 1TY2A 5H92C 4DXFA 2K22A 3BIID 1ET6A 2EELA 2W3SA 1L0XB 5HHDG 3TEXA 3PZ7A 2W55A 1ZPSA 1BXTA 3AE2B 2WXMA 4KKIA 4YTNB 3Q8EA 1VZ7A 3B2GA 4MT5A 1XO3A 1FO4A 3AE4B 1ZDVA 1IBXB 2ONQA 5GXGB 2LUMA 1YQ4B 1PDXA 1TKGA 2WXRA 5FKAC 4HKQA 3BK2A 3V05A 1N5WA 2FBWB 3GS2A 1J7CA 1QLBB 5AUIA 1ENFA 3O13A 5MPOA 1WWTA 1NYRA 4ITKA 4UDUC 2LGIA 1ZDXA 2K0PA 2W3RA 4JWUC 3C8YA 3PZ8A 1IGDA 2WDRB 4D2KA 2WXOA 1RM6C 1C76A 5LNK1 4YSYB 1JWSD 2WXQA 1ZXHA 2AX5A 4FXCA 2WXPA 1FFVA 1XCQL 4NJCA 1JWBD 3ABVB 2QIEB 4TQ1A 2DYMA 1N61A 3I57A 2I38A 2NMQA 1HQRD 2PVGC 1AN8A 1SE2A 3ETRA 3IAS1 1FIQA 1FNVA 2V3NA 3T3OA 1JRPA 1STEA 2IPKD 3NUHB 1L0YB 1EWCA 1XF5L 1FMAD 2PIAA 1C9FA 2GI9A 5EE3A 2N0SB 1YN5A 1DOYA 4C7ZA 4RH6A 2MH7A 2H88B 1L6UA 3TSSA 3BVZA 2PKOA 3NVVA 5BMHA 4P16A 2LJIA 1JWUD 2ZW1A 2SEBD 3P1MA 3BK1A 4H2AA 1UWMA 2N9LA 3J9CA 2AQ2B 4O1NA 1VLBA 1E7PB 3ZJVA 2BS2B 1T6BX 3SR6A 4XWWA 2JZPA 1AWDA 2L52A 1OQQA 3CIRB 1YQ3B 1T5XD 3NVWA 4OZCA 4P6VF 3KWLA 1GAQB 1J7AA 3MP9A 1L0VB 5BYSA 1LO5D 4A8XC 1PUTA 2N9KA 2JWUA 2M0AA 3AE7B 3SEBA 1RFKA 2YEPB 2BTEA 3LYYA 2AQ3B 2CJNA 1ET9A 3NZ3A 2J42A 4L2YA 3AE1B 2ZW0A 1I4XA 3HVDA 1OQRA 3AEFB 3DWMA 5FK9C 1JROA 2K9XA 3RPFC 1L5PA 4WURA 1ESFA 1FNWA 2QMTA 1K50A 2JX5A 4NAMA 2IJ0A 2BW2A 1V1PB 4RGNA 2LFIA 4RF1A 4KGSA 4C56C 3MJ5A 2KACA 1CQVA 1FRRA 3W9CB 1ACCA 1NVID 3NVZA 1N62A 2JSVX 2J4XA 2DBYA 1ZP0B 2BB6A 1QOGA 4CQNA 5BYRA 1NYQA 3KWVA 3KLSX 4KGRA 2RDGA 2BYTA 1E6EB 1ZE3D 3GB1A 2WU2B 1QKZA 3AE6B 4ARIA 4ARCA 2WXIA 4HJGE 4B0MA 1ZOYB 2LEKA 1V1OA 2INPE 4HROA 4TSSA 4ZRQA 1WGKA 1SIJA 5D7GA 3L4PA 4US8A 4M0WA 1VZ6A 2PLPA 1FNUA 1R7SA 4US9A 4YT0B 1SE3A 1UUPA 1KLUD 2BT6A 2JU6X 3BYYB 4GDKB 4YXDB 4IOIE 2JQRB 2KMMA 1HZ5A 1EU4A 1E9MA 4L23A 1FCLA 3W5UB 1YN4A 2KWDA 3GP7A 2G9HD 4RF0A 4WH4A 4KX6B 1GOZA 4YTMB 2WXKA 4RGTA 1SF0A 4NAWB 5H8YE 4C80A 3VQIA 1IBXA 1I7HA 1V8CA 3T3NA 2BS3B 5BYQA 1D6EC 4RFBA 2I2YA 4R3DA 1FCCC 3AEDB 3Q8AA 1GB1A 1L4DB 4LLGM 3NVYA 3VRAB 3VR8B 1WYGA 3FC4A 1GB4A 1VDVA 3U7ZA 2WDVB 1FD6A 4OZAA 4JPSA 3FILB 4DQOC 1QOAA 1JQ4A 1ZXIA 2WLBA 2MJDA 1GPXA 1XLPA 1UWXA 2D5GA 4USAA 3AE5B 3KQ4A 1TS2A 1B9RA 1PGAA 2R61A 2QILA 3AE8B 3AM9A 4L1BA 2HDEA 1DGJA 1RYJA 2M56B 3MHZA 1L6VA 4A6QA 2KAJA 3W5VB 5EE9A 4WWMA 3BVMA 1YMHE 2H89B 4ZOHC 3VRBB 1TKYA 3AEGB 5I4DA 5JXVA 1IGCA 1XLNA 1YJIA 3EA6A 1BUIC 2LMCA 3AEBB 4OW0A 1D5XC 1PGBA 3VR9B 2OEDA 4OHJA 2KDMA 1XLQA 3ZYYX 4GLSC 1MI0A 3URYA 2JXTA 2NTTA 2WXFA 2V0GA 1XXGA 2QEJC 2Y5CA 3NRZA 2WDQB 3WCQA 4HKZE 4XE0A 1D5MC 1A70A 2DYOA 1TJEA 5T8IA 4WAFA 3H8HA 2WXJA 4A90A 1CZPA 1K53A 2RPVA 1EM7A 4LTUA 1JMLA 1RWSA 2XNAC 4N59A 1VRAB 1XLOA 1TYGB 2ICIA 2EKIA 2DWQA 2WXNA 3DWGC 2PVOD 4A55A 2VZKB 1XEEA 1MHXA 3Q8BA 2W54A 4JX1C 3TEZA 3R2TA 3E9SA 5TSSA 1AYFA 2WP9B 1EWYC 2RDHA 3B9JA 3ZJUA 4JWSC 2HTME 1SJED 3IAM1 1NEKB 1AW7A 2DLBA 4XWTA 1VR9A 3I9V1 1TS3A 4REZA 3W1SA 2TSSA 1I4RA 5EE0A 2KN4A 1CK1A 4AQ7A 2JYEA 1VJKA 3ZGZA 1N60A 2JYTA 1V1PA 1KFYB 2QJLA 2FUG1 1FRDA 2N7JA 3AMZA 1TKEA 4TMAB 3AECB 2IGHA 2GRIA 3Q8FA 4EE2A 4OVZA 1JWAD 3P63A 4TQ0A 1PFDA 2XN9C 4MACA 2X38A 1WXQA 2Y3AA 2G1EA 4IDIA 3U2SC 3W2DA 2NTSA 3ZQ4A 1N63A 3OWEB 1IUEA 4AS1A 2ACZB 3ZJTA 1TS5A 2WS3B 1DOXA 1SEBD 3AE9B 1C4CA 2OHFA 4DXGA 1HEZE 4KKJA 1KTKA 4LK0M 2BBCA 2PW9A 2Z8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ3 A;  2WLB A;  2MJD A;  3P1M A;  1SB3 C;  4N6E B;  1GPX A;  1XLP A;  3P4P B;  4USA A;  1KRH A;  2WQY B;  3AE5 B;  1UWM A;  3P4R B;  1NEN B;  1B9R A;  4YSX B;  1QF6 A;  1VLB A;  4C7Y A;  1E7P B;  3P4S B;  4ZHO A;  2B76 B;  3CWI A;  2BS2 B;  3AE8 B;  3SR6 A;  3AM9 A;  2CJO A;  1AWD A;  2L52 A;  1OQQ A;  3CIR B;  1YQ3 B;  3NVW A;  4P6V F;  3KWL A;  4ZHP A;  5C3J B;  1DGJ A;  1RYJ A;  1GAQ B;  1F0Z A;  1J7A A;  2M56 B;  1L0V B;  1L6V A;  2K5P A;  2KAJ A;  1PUT A;  3B2F A;  5EE9 A;  3W5V B;  1E0Z A;  4WWM A;  3PO0 A;  3AE7 B;  3AEA B;  1QOB A;  5C2T B;  1RFK A;  2H89 B;  1N5X A;  3SFD B;  3EUB 2;  1T3Q A;  4ZOH C;  3VRB B;  1TKY A;  2CJN A;  3AEG B;  1XLN A;  3HVZ A;  1YJI A;  3AE1 B;  1OQR A;  3AEF B;  3AEB B;  3DWM A;  3LXF A;  3AB5 A;  3NVV A;  3VR9 B;  1JRO A;  2K9X A;  5H92 C;  3RPF C;  4YSZ B;  1L5P A;  1ZUD 2;  1NI3 A;  2K22 A;  3BII D;  1XLQ A;  2JX5 A;  2CU3 A;  3ZYY X;  2W3S A;  2Q5W D;  1YJJ A;  3NRZ A;  2W55 A;  2Y5C A;  3AE2 B;  1JAL A;  2WDQ B;  3FAH A;  4YTN B;  3SFE B;  3WCQ A;  3LB8 C;  1A70 A;  3B2G A;  1TJE A;  1XO3 A;  3AV8 A;  1FRR A;  1QOF A;  3W9C B;  2L83 A;  3AE4 B;  1NVI D;  1FO4 A;  1CZP A;  3NVZ A;  1N62 A;  2WU5 B;  2DBY A;  1ZP0 B;  3P4Q B;  1FXI A;  1YQ4 B;  1RWS A;  1PDX A;  4LTU A;  4N59 A;  1QOG A;  1XLO A;  1FXA A;  1TYG B;  4YTP B;  1TKG A;  2DWQ A;  1NYQ A;  2EKI A;  3AH7 A;  3DWG C;  4N58 A;  2BS4 B;  1FM0 D;  1DOI A;  1N5W A;  2FBW B;  2PVO D;  1CJE A;  1J7C A;  1QLB B;  2MJE A;  5AUI A;  5GXG B;  2W54 A;  1E6E B;  4JX1 C;  2WU2 B;  5MPO A;  1WWT A;  3AE6 B;  3HRD D;  1AYF A;  1NYR A;  4ITK A;  1ZOY B;  2LEK A;  1JW9 D;  2WP9 B;  4HRO A;  1EWY C;  3B9J A;  1WGK A;  1SIJ A;  1KF6 B;  2HTM E;  3L4P A;  3NS1 A;  4JWS C;  4US8 A;  1NEK B;  4A9A A;  2W3R A;  4JWU C;  5EE1 A;  2WDR B;  1R7S A;  3HUI A;  4US9 A;  4YT0 B;  1RM6 C;  5EE0 A;  2BT6 A;  1ROE A;  4YSY B;  1VJK A;  4YXD B;  2E3T A;  1N60 A;  2JQR B;  2KMM A;  1KFY B;  2AX5 A;  2QJL A;  4WQM A;  1E9M A;  4FXC A;  5G5H A;  1FFV A;  1J7B A;  2M19 A;  1FRD A;  1JWB D;  1WRI A;  1QT9 A;  2QIE B;  3ABV B;  3AMZ A;  3W5U B;  1TKE A;  3AEC B;  4YTM B;  4KX6 B;  1N61 A;  3AEE B;  1JWA D;  2PVG C;  1SF0 A;  3ETR A;  5H8Y E;  4C80 A;  3P63 A;  1FIQ A;  1PFD A;  1I7H A;  1V8C A;  2BS3 B;  4HRS A;  1JRP A;  3AE3 B;  1WXQ A;  2G1E A;  3AED B;  5G5G A;  1FFU A;  1FMA D;  4IDI A;  2PIA A;  1N63 A;  5EE3 A;  1IUE A;  2N0S B;  3NVY A;  3VRA B;  3VR8 B;  2ACZ B;  1WYG A;  3FC4 A;  2WS3 B;  3AN1 A;  1VDV A;  4C7Z A;  1DOX A;  2WDV B;  3AE9 B;  5AUK A;  1DOY A;  1V97 A;  2MH7 A;  2OHF A;  2H88 B;  1OFF A;  1L6U A;  1E10 A;  2PKO A;  1QOA A;  1JQ4 A;  1ZXI A; 
#chains in the Genus database with same CATH topology
 4HCP B;  1HZ6 A;  3IHP C;  3Q6B A;  2GB1 A;  1WJU A;  5FR3 A;  3SU8 X;  3U4E G;  4N9F 4;  2DNF A;  2K3U A;  3V60 A;  4NZL B;  1Y56 A;  1K52 A;  1FEH A;  3AI5 A;  2W9N A;  3IT6 B;  1D5Z C;  2K5P A;  3RI7 C;  2Y5B B;  4XDD A;  4WIP A;  1WZ0 A;  2MBB B;  2N1V A;  2Y5P A;  3NZS A;  4XDC A;  4MH8 A;  1NI3 A;  2D3B A;  1WE6 A;  4CHK A;  2J53 A;  1A5R A;  4BOS C;  2DHZ A;  4TKN A;  4WAA A;  3FAH A;  2CHZ A;  1TGZ B;  2KKC A;  2L83 A;  4W9K A;  1K8R B;  2IDY A;  2KDI A;  3QHT A;  2KJ6 A;  3Q14 C;  4I6N B;  1DOI A;  3CSF A;  4K7W A;  3OLM D;  2V1Y A;  1WY8 A;  2LXA A;  2LVQ A;  2AL6 A;  5JHB A;  4B0E A;  4NQK E;  2BWF A;  4MM3 B;  1J7B A;  3L10 B;  1QIL A;  3UI3 A;  3AEE B;  3PRZ A;  3A33 B;  3BZD B;  2ZZP B;  2E6X A;  5AZH A;  2KXJ A;  1MJD A;  2YEP F;  5G5G A;  1SE4 A;  1JCK B;  4BBN C;  1V9J A;  2N1W A;  2HE7 A;  1WRD B;  2V4L A;  3AN1 A;  5AUK A;  4LJP B;  1PGX A;  3ZIM A;  2FAZ A;  1K51 A;  1KRH A;  2AQ1 B;  3P4R B;  1TZO A;  1M94 A;  4RGO S;  5IKC M;  2PMV A;  3TEY A;  4TUU A;  3U52 E;  3PO0 A;  1N5X A;  2ZVN A;  4IWQ A;  3A9K B;  2L0T A;  3N3K B;  5G55 A;  1TY2 A;  3GOE A;  3S2A A;  2N4F A;  2K22 A;  3BII D;  4I6P A;  2EEL A;  1GC7 A;  3PZ7 A;  4FUL A;  3PLV A;  4P1B C;  5EDS A;  3RZF A;  4URK A;  4B6W A;  4BKG A;  2LUM A;  1YQ4 B;  1PDX A;  1TKG A;  4K3C A;  3BK2 A;  3V05 A;  2FBW B;  1T0Y A;  2QHO A;  3H7S A;  5AUI A;  2KX3 A;  3AU5 A;  3PRP B;  5MPO A;  3X0W A;  1SIF A;  2WGS A;  1J0G A;  4UDU C;  1YX5 B;  2ZJD A;  2K0P A;  3PZ8 A;  4D2K A;  4BKS D;  5LNK 1;  4YSY B;  2N9P C;  1JWS D;  2LD9 A;  2WXQ A;  3ZNZ B;  1XCQ L;  2NBV B;  4TQ1 A;  3EC8 A;  3I57 A;  3QWZ B;  3Q2A C;  2PVG C;  3ETR A;  3PHW B;  2HJ8 A;  3N20 C;  4WWP A;  1FMA D;  3ZNI D;  3IFW B;  1S3S G;  3UIP B;  4C7Z A;  2O6V A;  2LUE A;  4G3X B;  4NQL B;  2PKO A;  2GBJ A;  3P1M A;  1Z5S B;  5JHA A;  3BK1 A;  4WJN A;  3N1X C;  3I5J C;  1KJT A;  4XWW A;  2KX0 A;  1AWD A;  3CIR B;  1GAQ B;  3CST A;  4W9E A;  5BYS A;  3NS8 A;  3HIZ A;  2MHJ A;  2MBE A;  3IVF A;  3SEB A;  1RFK A;  2YEP B;  3DPD A;  3LYY A;  2DAJ A;  3NZ3 A;  2JRH A;  3AE1 B;  1I4X A;  3HVD A;  1OQR A;  2ZPY A;  3AEF B;  3H9D A;  1L5P A;  3HHM A;  2BPS A;  1HTQ A;  2IJ0 A;  2KDB A;  3AUL A;  2MX2 A;  2LXC A;  3DVG X;  2YVC A;  4EOY A;  4II2 B;  2NBU A;  3PPA A;  1V6E A;  2DBY A;  2J4X A;  1I35 A;  3KWV A;  1WGY A;  3BY4 B;  4FJY A;  2BYT A;  4BAX A;  2VH2 A;  3GB1 A;  1Q1O A;  3AE6 B;  4GDL A;  4LNI A;  2WXI A;  4BZA A;  2INP E;  2J7Q B;  4ICU A;  2AWT A;  1FXT B;  1V86 A;  2KMC A;  3R7R A;  2I1K A;  1T0Q C;  3RNE C;  3SD5 A;  4E3C A;  4YXD B;  4IOI E;  1HZ5 A;  3L13 A;  4YL8 A;  3U8Z A;  2G9H D;  2N7D A;  1SF0 A;  4NAW B;  2A4Z A;  1I7H A;  1YJ1 A;  4EEW A;  5LLI A;  4ZDV A;  1IP9 A;  1WYW B;  2UWQ A;  2LWP A;  3NVY A;  3VR8 B;  4PK1 A;  1FPY A;  1E8W A;  4GIV A;  1FD6 A;  4OVV A;  1WX9 A;  3FIL B;  3RCZ A;  2HD5 B;  2C60 A;  3ZTD A;  5E6O A;  1UWX A;  1R4M I;  4USA A;  3ZTC A;  1WJ6 A;  1TS2 A;  3APC A;  4FJZ A;  1PGA A;  2WX0 A;  4W9L A;  1DGJ A;  1VD2 A;  2J0K A;  3MHZ A;  4IWO A;  1L6V A;  3BVM A;  3WAN A;  2O2V B;  3QAR A;  3OG5 A;  1IGC A;  1XLN A;  1YJI A;  2LMC A;  2MLB A;  2IBI B;  4OW0 A;  4S0R A;  3ZVV A;  3VR9 B;  1GC6 A;  1RAX A;  2KDM A;  3ZYY X;  3K9O B;  5CHW A;  3URY A;  2JXT A;  4EZL A;  2QEJ C;  2Y5C A;  2WDQ B;  4HKZ E;  2K8H A;  4WAF A;  1H4R A;  4A90 A;  2VH1 A;  3C19 A;  1VRA B;  1E8X A;  2ICI A;  2WXN A;  3DWG C;  1XEE A;  2KVZ A;  1MHX A;  4P1C C;  2W54 A;  1KLV A;  3TEZ A;  1WF9 A;  1WXV A;  1AYF A;  1T0R C;  1EWY C;  3B9J A;  1SJE D;  3MTN B;  3IAM 1;  3RMK C;  4BFR A;  2TSS A;  1CK1 A;  1V1P A;  2FUG 1;  1FRD A;  3AMZ A;  1UZX B;  4JLC A;  2GRI A;  4IM0 A;  4DDI D;  4HLE A;  1JWA D;  3PHX B;  2XN9 C;  4NY0 A;  4BBN F;  4MAC A;  1WXQ A;  2GBR A;  3QJZ A;  2WHI A;  2Y3A A;  2NTS A;  5E6P A;  1IUE A;  2EKE C;  4ASW C;  3AE9 B;  4EFO A;  3H7P B;  2KWC A;  4LK0 M;  5L95 C;  1SB3 C;  3IT4 B;  3FKY A;  1V80 A;  3NJT A;  4GDK A;  4ICV A;  2L76 A;  2JY6 A;  3DVN U;  4ZHO A;  4LCD E;  2PJH A;  4IM3 A;  3CWI A;  4I6L B;  1BML C;  1SGH A;  2FE8 A;  3TUO A;  2JF5 A;  3CMM B;  2D3C A;  2LHD A;  3NOB A;  1ISN A;  2KQ4 X;  4GOC A;  1TY0 A;  2IYD B;  3VH3 B;  1E0Z A;  1WSP A;  3WAO A;  2WXG A;  2MP2 A;  3SHQ A;  3NG0 A;  1KH0 A;  1SSN A;  1F2R I;  3HVZ A;  1SJH D;  3KVF B;  3AB5 A;  4YSZ B;  1BT0 A;  2Z59 B;  2NS5 A;  5BO4 B;  2KLG A;  3DBR I;  1RFA A;  3KW5 B;  5L83 A;  2MSE D;  3WAL A;  2AYO B;  3SFE B;  4KGT A;  2Z0D B;  2LRU A;  3AV8 A;  4HCN B;  2MA9 B;  2NPT A;  3BVG A;  2WU5 B;  3P4Q B;  1FXI A;  1TS4 A;  4YTP B;  1FXA A;  2D3A A;  2KN5 A;  1P98 A;  2BS4 B;  1FM0 D;  3RNC C;  2L32 A;  4DHJ B;  3DBL B;  3UQA A;  1JW9 D;  1U4A A;  4MJS B;  4S17 A;  1JWM D;  5TR5 A;  3HUI A;  3MHS D;  2WDT B;  3A1Q B;  3VH4 B;  1L2N A;  3BIN A;  2E3T A;  3P42 A;  5BMG A;  3VAW A;  3X23 A;  4PT5 A;  5D3I B;  2GBN A;  2ZVO A;  2L7R A;  2JT4 B;  3RUI B;  3B0A A;  4MEM A;  4KZC A;  4HRS A;  5E6N A;  1C4A A;  2KMA A;  2KWU B;  2K6D B;  3AE3 B;  4RGM A;  3VTV A;  2HTH A;  3A4S C;  1FFU A;  4EUT A;  3PS6 A;  5G2N A;  3U7D A;  2JWZ A;  2JUO A;  3KYC D;  4C00 A;  4E71 A;  4IUM B;  4CYE A;  1E10 A;  4LNN A;  3T9L A;  2KC2 A;  3QIJ A;  1WMH A;  3ECI A;  3RFZ B;  3P4S B;  2CJO A;  4G0N B;  4HPL B;  5C3J B;  3RN9 C;  2GOW A;  2G45 B;  3I63 C;  4OVU A;  3AEA B;  4M8N A;  1ZKH A;  4NNJ B;  1L4Z B;  4E74 A;  1WH3 A;  2KFK B;  1T0S C;  2BKF A;  3LXF A;  2QC8 A;  1ET6 A;  2NVU I;  5D94 A;  2O6V D;  3M63 B;  4KZ0 A;  1L0X B;  1GG3 A;  3TEX A;  3MJW A;  1BXT A;  4YTN B;  3Q8E A;  1VZ7 A;  1XO3 A;  1ZDV A;  1IBX B;  2ONQ A;  2LAS A;  3PZD A;  3L0W B;  4HKQ A;  1ENF A;  3U30 A;  1NYR A;  4ITK A;  2K25 A;  1IPG A;  4QAY A;  3QX1 A;  1D3Z A;  2BYF A;  2W3R A;  2C9W B;  4JWU C;  3V6C B;  4W9C A;  3C8Y A;  3KH0 A;  4M00 A;  2DX5 B;  1JRU A;  1ZXH A;  2AX5 A;  5CTR C;  1JWB D;  3RT3 B;  2DYM A;  3DVG Y;  2INC C;  1HE8 A;  3IAS 1;  2I38 A;  2NMQ A;  1FNV A;  2J0M A;  2IO0 B;  4WWN A;  1JRP A;  1XF5 L;  3EFU A;  2J0J A;  2GI9 A;  2L00 B;  4PS7 A;  1DOY A;  4RH6 A;  2AL3 A;  1L6U A;  3TSS A;  5JH5 C;  1WM3 A;  5DPS A;  3L16 A;  2N9L A;  3J9C A;  2AQ2 B;  3DBH B;  4MM3 A;  3SR6 A;  4P6V F;  2ZNV B;  4BOZ B;  1OEY A;  3MP9 A;  1WZ3 A;  1LO5 D;  3GZN B;  1H8C A;  2M0A A;  3AE7 B;  4PS3 A;  4ANV A;  2AQ3 B;  2CJN A;  3OJ4 B;  2KTR B;  2ZW0 A;  5FK9 C;  4PYU A;  1FNW A;  2JX5 A;  4RGN A;  2XBB C;  4RF1 A;  4KGS A;  1J8C A;  4IG7 B;  1NVI D;  1N62 A;  2JSV X;  5BYR A;  2KWV B;  2WX1 A;  3KLS X;  3KUD B;  2FUH B;  1UH6 A;  1QKZ A;  4ARI A;  4B0M A;  2G4D B;  3N32 A;  4TSS A;  2I1J A;  1R4N B;  2Z0E B;  3V61 A;  1WGK A;  3A9K A;  5D7G A;  4US8 A;  5LXI B;  1E90 A;  1R7S A;  4US9 A;  1SE3 A;  1KLU D;  3MC9 A;  2JU6 X;  2JZZ A;  1WX8 A;  1YD8 U;  2MBQ A;  3NHE B;  4GMV A;  4HDQ A;  2KWD A;  3UGB B;  4YTM B;  1GOZ A;  2WXK A;  1UD7 A;  4C80 A;  3VQI A;  3T3N A;  1TIF A;  1D6E C;  2K1F A;  4G50 A;  1F9J A;  3OJ3 A;  2V3S A;  3EFC A;  1VDV A;  4K3B A;  1MG8 A;  2WDV B;  2M4N A;  4JPS A;  4BKT A;  2MJD A;  1OQY A;  3AXC A;  1B9R A;  1G6J A;  3QQ8 B;  3CF6 E;  3ZDM C;  2R61 A;  3ZRC A;  2ZNV C;  5J18 A;  4L1B A;  5KHO A;  4K7S A;  4A6Q A;  3MC8 A;  3W5V B;  5EE9 A;  2QDF A;  4WWM A;  1YMH E;  2A5U A;  2H89 B;  1WI0 A;  4AWJ A;  1WGG A;  4JIO U;  3VRB B;  2OJR A;  3K9P B;  4WJP A;  4B95 A;  4TV3 A;  3EA6 A;  2JZ3 B;  3W1Y A;  2KJR A;  3TCA A;  5IN7 A;  1XLQ A;  4W9G A;  2LGX A;  1EF5 A;  3LDZ E;  2WXF A;  1WGH A;  2KTF A;  3WCQ A;  1A70 A;  2DYO A;  4AOF A;  5T8I A;  3H8H A;  2WXJ A;  5AZF A;  2RPV A;  1EM7 A;  1RWS A;  5GMV A;  2KO3 A;  1TYG B;  2D10 A;  3UF8 A;  4II3 B;  4A55 A;  3Q8B A;  3B08 A;  4FAD A;  4FHJ A;  5TSS A;  4B9K A;  3L08 A;  2KJH B;  3ZJU A;  4JWS C;  2UYZ B;  3ML8 A;  3QA8 A;  2DLB A;  1TZ1 A;  5IO9 A;  1VR9 A;  2LZ6 A;  1TS3 A;  3JW0 X;  4REZ A;  1I4R A;  5EE0 A;  1E8Z A;  2KT7 A;  1VJK A;  3ZGZ A;  4XGA B;  5C23 A;  3O65 B;  1WJN A;  5LXH A;  1V81 A;  4TMA B;  4W9J A;  2OJW A;  2XEW A;  2IO3 B;  3KUZ A;  4MEL A;  2M1M A;  2X38 A;  1UBI A;  2G1E A;  3DDC B;  2REX A;  3IBE A;  4IDI A;  4WJO A;  3OWE B;  3P2B A;  2DZJ A;  2FCQ A;  3ZJT A;  2JRI B;  1SEB D;  2KZR A;  2OHF A;  2OOB B;  4DXG A;  1HEZ E;  4KKJ A;  1Y8R C;  2K8B A;  2Z8L A;  5DPW A;  1WXS A;  3R66 C;  2WQY B;  2D11 A;  3BWU D;  1YOV B;  1P0R A;  3ENE A;  1GNU A;  2ON8 A;  1QF6 A;  4C7Y A;  3JSV B;  2B76 B;  4ANW A;  2IY0 B;  1XQQ A;  2IGD A;  2QSD A;  1KOT A;  4NAW A;  4YWG G;  3B2F A;  3JSV A;  3JYU A;  2ZCB A;  1QOB A;  4KIK B;  3EUB 2;  2VZK D;  3EGR A;  3M95 A;  1AAR A;  2C7M B;  2L1A A;  5C1Z A;  4FJV B;  5D2M B;  4KDI C;  2D07 B;  2CU3 A;  1QQR A;  3MC0 B;  3A9J B;  3FIL A;  3N30 A;  5E6J A;  1JAL A;  4X57 B;  3LB8 C;  1UNS A;  1VZ8 A;  1QOF A;  3TMP B;  2CKH B;  2M0X A;  1MHH E;  1B1Z A;  1KLG D;  4N58 A;  3Q69 A;  1EU3 A;  5HFY A;  1F77 A;  4GN1 A;  1XD3 B;  2KC1 A;  2N9X A;  2O2V A;  3M3J A;  1YN3 A;  4HK2 A;  3HM6 X;  3NZU A;  1KF6 B;  2LJ5 A;  3DHG C;  3BYT B;  3ZKJ C;  4A9A A;  4EKU A;  5EE1 A;  4ZYN A;  2LVP A;  2KDF B;  4AP4 C;  2RMM A;  3QC8 B;  2LGD A;  2ASQ A;  2W82 A;  3PGE A;  2INN E;  3HK0 A;  4RNA A;  2M19 A;  1WRI A;  2V4I B;  1YNT E;  3VUX A;  4IW0 A;  1NI2 A;  3VTW A;  3NY5 A;  2MCN B;  1WGR A;  4ZRP A;  2RPQ A;  1UGJ A;  2BWE S;  2CHW A;  2RD0 A;  2PTL A;  4BVU C;  5D3D A;  1V97 A;  1OFF A;  2N7E A;  4WQO B;  4WQM A;  4GSW A;  2MJ3 A;  4N6E B;  3VUW A;  1P7F A;  4J3O D;  4DDG D;  3A4R A;  1Q10 A;  2DZK A;  1WE7 A;  2WNM A;  3APD A;  2MBH A;  3MFG A;  4WJQ A;  2GMI C;  1F0Z A;  2ZPN A;  3ZXR A;  4ZYS A;  4DWF A;  4RM9 A;  3SFD B;  2LRW A;  1T3Q A;  4XZ4 A;  3IXS A;  5H92 C;  1WXA A;  2LGS A;  3H7P A;  1WFY A;  2WWZ A;  2IZV B;  2W3S A;  4FBJ B;  4MGZ E;  3AE2 B;  2WXM A;  4KKI A;  5J2R A;  4W9F A;  3B2G A;  4MGK E;  3AE4 B;  1NBF C;  5GXG B;  2MBO A;  2WXR A;  2RDB C;  1N5W A;  1J7C A;  1QZE A;  2D2Q A;  3ML9 A;  5CX3 A;  1IGD A;  4C4V B;  2JPH A;  2WXO A;  4NJ7 A;  4FXC A;  2WXP A;  1FFV A;  3PRM B;  2QIE B;  4HJK A;  3VFK A;  2FCS A;  2G4S A;  1N61 A;  3HM3 A;  1HQR D;  1RLF A;  1SE2 A;  3WAP A;  3T3O A;  1STE A;  3PV1 A;  3NUH B;  1C9F A;  5EE3 A;  1WXM A;  2L0F A;  1LQB A;  1YN5 A;  3PT2 B;  4MJS A;  2MH7 A;  2H88 B;  4A3P A;  3BVZ A;  3NVV A;  5BMH A;  1XT9 B;  4P16 A;  4F1S A;  2ZW1 A;  2SEB D;  3A1Q A;  4DK5 A;  4WWO A;  4H2A A;  1UWM A;  4O1N A;  1LXD A;  1VLB A;  3Q3J A;  1E7P B;  3ZJV A;  1YX6 B;  2JZP A;  1OQQ A;  2IY1 B;  3KWL A;  3DHI C;  1J7A A;  1L0V B;  3GE3 C;  1LFD A;  1PUT A;  3N1Z C;  1N6Z A;  2JWU A;  2N9K A;  4AJY B;  2NCN A;  3H1U A;  2BTE A;  3ZO5 B;  1ET9 A;  2J42 A;  4AUQ C;  1R4M B;  3L17 A;  3DWM A;  3EEC A;  2K9X A;  4LNF A;  4K7U A;  1ESF A;  2QMT A;  4NAM A;  1CMX B;  4EZK A;  1C3T A;  2BW2 A;  4EZJ A;  4HWI B;  4ANX A;  3MJ5 A;  2KAC A;  3KUC B;  1CQV A;  5IP4 D;  1FRR A;  3W9C B;  4RM8 A;  3NVZ A;  2KFJ A;  2BB6 A;  3ALB A;  3DQV A;  2LGY A;  1HTO A;  3GE8 C;  3ZUN A;  2AEH A;  2RDG A;  3VVW B;  4M0W B;  4W9I A;  4ARC A;  4HJG E;  2LEK A;  1V1O A;  2L3Z A;  4J6I A;  1E7U A;  2KFK A;  4M0W A;  1VZ6 A;  1FNU A;  2CU1 A;  2EMS A;  4YT0 B;  4M01 A;  1UUP A;  2LI5 A;  3BYY B;  2GLS A;  4MGI E;  2BF8 B;  1J19 A;  1E9M A;  2M17 A;  4L23 A;  1FCL A;  3TJP A;  1YN4 A;  1E8Y A;  4RGT A;  1IBX A;  5H8Y E;  2FIF A;  2BS3 B;  5BYQ A;  2I2Y A;  1FCC C;  3AED B;  3UQB A;  1LM8 B;  2KVR A;  4F7Z A;  4LLG M;  3QCA A;  4A3O A;  5HKH A;  3FC4 A;  1GB4 A;  1V5T A;  2XK5 B;  3U7Z A;  4XYC A;  2R2O A;  4OZA A;  1QOA A;  1ZXI A;  2WLB A;  2G3Q B;  1LGR A;  1WX7 A;  3RNG C;  1GPX A;  2D5G A;  3AE5 B;  2XK5 A;  4HDO A;  1E7V A;  4FN2 A;  2QIL A;  4FHK A;  2C5L C;  1RYJ A;  4KDL B;  1WGD A;  2DEN B;  4ANU A;  1ZW7 A;  3ZDT A;  3AEG B;  3RZW C;  5I4D A;  3PSE B;  4HPP A;  1BUI C;  1PGB A;  2EMT A;  4OHJ A;  1P9D U;  3QK0 A;  1SE9 A;  4GLS C;  4LDT B;  1MI0 A;  3NRZ A;  1OTR B;  3OAW A;  3Q3O C;  3ZLZ A;  1TJE A;  4KSK C;  1CZP A;  1K53 A;  3ZNH B;  2L05 A;  4LTU A;  1JML A;  4N59 A;  2DWQ A;  2BVC A;  5D6J B;  2PVO D;  2D3G A;  3UIO B;  2KK8 A;  3DBR B;  2BYV E;  2KDE B;  3VHT C;  2RDH A;  1V2Y A;  2KTR A;  2HTM E;  2MWS B;  1NEK B;  1V5O A;  3D32 A;  4XWT A;  3PVL A;  2V9H A;  3WIM A;  3W1S A;  2KN4 A;  1S1Q B;  5AEK B;  1TTN A;  2JYT A;  3VUY A;  2N7J A;  2FCM A;  1UGM A;  2K8C A;  2DYB A;  3P63 A;  1GUA B;  4TQ0 A;  5AZG A;  5IA7 A;  4JL9 A;  5DCN A;  3W2D A;  1N63 A;  1Z2M A;  2ACZ B;  2R2Q A;  1TS5 A;  1DOX A;  1C4C A;  3RNB C;  1KTK A;  2BBC A;  2PW9 A;  2JXX A;  4KSL C;  2ZEQ A;  4LNO A;  5CHF A;  3P4P B;  5DPT A;  2MRP A;  5J17 A;  1NEN B;  4YSX B;  5HG2 A;  3VTU A;  3WAM A;  1I4G A;  1TT5 B;  2MW5 A;  1UBQ A;  4ZHP A;  1SXT A;  1E5W A;  4IKG A;  5C2T B;  3EHV A;  4GGQ A;  1L7Y A;  1C77 A;  1C78 A;  3RNA C;  1ZUD 2;  2LVO A;  3R3M A;  2BB5 A;  3RUL A;  2Q5W D;  2IGG A;  3E56 A;  1P7E A;  4K81 A;  2WXL A;  1HA5 A;  1F2R C;  1I4H A;  2KNB A;  1DYQ A;  3R2I A;  4DHZ E;  5BMI A;  2WXH A;  2KQS A;  3AH7 A;  4IWP A;  4OZB A;  1CJE A;  2MJE A;  4HEA 1;  3W1S C;  3DOW A;  3N9Y C;  3TEW A;  3HRD D;  4IC7 B;  2O6V B;  3NS1 A;  1I4Q A;  3RD2 A;  1HXY D;  4M8M A;  3Q8C A;  1ROE A;  4P7I A;  1XCT L;  2PPH A;  5G5H A;  3R8B A;  1M4V A;  2QCZ A;  1QT9 A;  4XX5 A;  2B3A A;  4PYZ A;  1MVK A;  1I4P A;  3KYD D;  4RMA A;  2KOX A;  2C7N B;  1D4B A;  3TBL D;  5IAA C;  5FR6 A;  1ZGU B;  1PYW D;  3WA0 A;  2HJ1 A;  1C79 A;  4RCO A;  1X1M A;  2J52 A;  4Q2J A;  1C4P A;  2SAK A;  1YJJ A;  2FCN A;  4K1R B;  3ZNG C;  2PE6 B;  3Q3N C;  2CR5 A;  5HI1 A;  4MSQ B;  3V3X A;  1MPE A;  2V3P A;  2MEK A;  1SBB B;  2BYE A;  3PTF C;  4JE3 B;  3TIX A;  4GDL B;  1WJ4 A;  1Q0W B;  3M62 B;  3N1Y C;  3UIN B;  2LHE A;  4HPM B;  4DHJ D;  2RGF A;  4DXF A;  4GB9 A;  5HHD G;  3DBL I;  2W55 A;  1ZPS A;  4MT5 A;  2M8S A;  2FNJ B;  1FO4 A;  3IG3 A;  1OEY J;  1UF0 A;  5FKA C;  4DBG A;  3GS2 A;  1F1H A;  1QLB B;  1P3Q U;  3O13 A;  4KIK A;  1WWT A;  4LJO B;  4FA6 A;  3V62 A;  2C7H A;  1WR1 A;  2LGI A;  3I3T B;  1ZDX A;  4MSM B;  1C1Y B;  2WDR B;  2X8X X;  3ZRF A;  1RM6 C;  4GXB A;  4W9H A;  1C76 A;  3A9J A;  4ZRJ A;  4NJC A;  1IYF A;  2BQQ A;  3ABV B;  3LJ3 A;  1AN8 A;  2MQJ A;  3RNF C;  1FIQ A;  2K6Q A;  2V3N A;  1MFW A;  3JVZ X;  3ZW3 A;  2IPK D;  1L0Y B;  1EWC A;  2PIA A;  2N0S B;  2IO2 B;  1V49 A;  4KV2 A;  2NBW B;  3V6E B;  5JZE B;  2NR2 A;  4HVB A;  2LJI A;  1JWU D;  3DBS A;  2KHW B;  2BS2 B;  1T6B X;  2JVC A;  1F52 A;  3NVW A;  2L52 A;  4OZC A;  4ZRI A;  1YQ3 B;  1T5X D;  1PQS A;  4A8X C;  1WR6 E;  4HXD A;  2KYW A;  4LNK A;  4L2Y A;  4ACF A;  3TL5 A;  1JRO A;  3RPF C;  1OGW A;  3SDL C;  4WUR A;  1K50 A;  4BKS A;  1KM7 A;  4XC2 A;  2GBM A;  1V1P B;  4M02 A;  3RYT A;  2LFI A;  4C56 C;  1ACC A;  1ZP0 B;  3Q3M C;  1QOG A;  4CQN A;  1NYQ A;  1NDD A;  3DVN V;  4KGR A;  4IM2 A;  5DPR A;  3PLU A;  1I42 A;  1E6E B;  1ZE3 D;  2WU2 B;  2FID A;  5KHQ A;  3DHH C;  1ZOY B;  2KLC A;  3APF A;  4HRO A;  2YLM A;  4ZRQ A;  1SIJ A;  3L4P A;  2PLP A;  2BT6 A;  4A20 A;  2CS4 A;  4GDK B;  2JQR B;  2KMM A;  4W9D A;  2UU7 A;  1EU4 A;  3W5U B;  1WM2 A;  3GP7 A;  4RF0 A;  4WH4 A;  4KX6 B;  2PE9 A;  3Q3F A;  4LDT D;  3AU4 A;  4JGH B;  1V8C A;  1RRB A;  4RFB A;  3T8M A;  2MP2 B;  4R3D A;  3DBH I;  2DZI A;  2N9E B;  3Q8A A;  1GB1 A;  2RR9 A;  1L4D B;  3QAQ A;  3VRA B;  1TBE A;  1WYG A;  5CHV C;  3GZN I;  4ZRK A;  2ZCC A;  4CO7 A;  3ONS A;  3VDZ A;  4DHZ B;  4DQO C;  1JQ4 A;  1UEL A;  4C4V A;  1XLP A;  3VXW A;  3KQ4 A;  1WIA A;  2NPT B;  4MH0 E;  2PEA A;  3PRE A;  3AE8 B;  4MGY E;  3AM9 A;  2HDE A;  4GU2 A;  2L8J A;  2M56 B;  2GBK A;  4FLH A;  4NJ6 A;  2KAJ A;  1EO6 A;  3B1L X;  4ZOH C;  1TKY A;  3H6N A;  2IO1 B;  5JXV A;  3AEB B;  2KQ7 A;  5IOI A;  1D5X C;  2WYQ A;  1EF1 A;  2OED A;  4KVG B;  4AJW A;  2BKR B;  2NTT A;  1VCB A;  2V0G A;  1XXG A;  2VRR B;  1R4N I;  4XE0 A;  1D5M C;  1P1A A;  3L54 A;  4PS8 A;  2XNA C;  1XLO A;  2EKI A;  1YQB A;  2K39 A;  2DAF A;  2VZK B;  4F8C B;  4JX1 C;  3R7Q A;  3R2T A;  3E9S A;  4DXA B;  2WP9 B;  1YIW A;  1AW7 A;  2BGF A;  3I9V 1;  2RSU A;  3C0R B;  4AQ7 A;  2JYE A;  1MG4 A;  1N60 A;  1KFY B;  2QJL A;  1WMH B;  4MDK E;  4NPN A;  1EUV B;  2CHX A;  1TKE A;  3AEC B;  2IGH A;  3ZXV A;  3Q8F A;  4EE2 A;  4OVZ A;  1PFD A;  1Q5W B;  1GJZ A;  3U2S C;  2DZM A;  3ZQ4 A;  4AS1 A;  3DCG A;  4G11 A;  2IND C;  2KD0 A;  2WS3 B;  2KAN A;  4JQW C; 
#chains in the Genus database with same CATH homology
 1HZ6 A;  1SB3 C;  3IT4 B;  3P4P B;  2WQY B;  2GB1 A;  3BWU D;  5FR3 A;  1NEN B;  4YSX B;  2ON8 A;  3U4E G;  1QF6 A;  4C7Y A;  4ZHO A;  2B76 B;  2K3U A;  5HG2 A;  3CWI A;  1BML C;  1I4G A;  4NZL B;  2FE8 A;  3TUO A;  1Y56 A;  2IGD A;  1K52 A;  2QSD A;  4ZHP A;  1FEH A;  1SXT A;  2LHD A;  2KQ4 X;  1TY0 A;  3IT6 B;  1D5Z C;  2K5P A;  3B2F A;  4YWG G;  1E0Z A;  4IKG A;  1WSP A;  5C2T B;  4XDD A;  1QOB A;  2WXG A;  4WIP A;  3EUB 2;  1KH0 A;  2Y5P A;  1SSN A;  2VZK D;  1F2R I;  3HVZ A;  1SJH D;  3EGR A;  2L1A A;  3AB5 A;  4XDC A;  4YSZ B;  1C77 A;  1C78 A;  1ZUD 2;  4MH8 A;  1NI3 A;  2J53 A;  2CU3 A;  2BB5 A;  1QQR A;  3MC0 B;  3FIL A;  2Q5W D;  5E6J A;  3SFE B;  4KGT A;  1JAL A;  3FAH A;  2IGG A;  3E56 A;  3LB8 C;  1UNS A;  1VZ8 A;  1P7E A;  2WXL A;  3AV8 A;  1HA5 A;  1QOF A;  2L83 A;  3BVG A;  1F2R C;  1I4H A;  2WU5 B;  1MHH E;  2IDY A;  3P4Q B;  1DYQ A;  1FXI A;  1B1Z A;  1TS4 A;  1FXA A;  3R2I A;  4YTP B;  1KLG D;  5BMI A;  2WXH A;  3AH7 A;  4N58 A;  2BS4 B;  1FM0 D;  1DOI A;  1EU3 A;  3Q69 A;  5HFY A;  2L32 A;  4OZB A;  1CJE A;  1F77 A;  2MJE A;  4HEA 1;  3N9Y C;  3TEW A;  3HRD D;  1YN3 A;  1JW9 D;  1KF6 B;  3NS1 A;  1I4Q A;  1JWM D;  1HXY D;  3BYT B;  4A9A A;  5EE1 A;  3HUI A;  2RMM A;  3Q8C A;  1ROE A;  4B0E A;  1XCT L;  2E3T A;  3P42 A;  2W82 A;  5BMG A;  2INN E;  4PT5 A;  5D3I B;  5G5H A;  4MM3 B;  3R8B A;  1J7B A;  4RNA A;  2M19 A;  1M4V A;  1WRI A;  2V4I B;  1QT9 A;  1YNT E;  1QIL A;  1MVK A;  1I4P A;  3UI3 A;  3AEE B;  1D4B A;  3BZD B;  2E6X A;  4HRS A;  1C4A A;  1PYW D;  3AE3 B;  4RGM A;  2YEP F;  4ZRP A;  5G5G A;  1SE4 A;  1FFU A;  1JCK B;  1UGJ A;  1C79 A;  4RCO A;  3AN1 A;  2J52 A;  5AUK A;  2PTL A;  4Q2J A;  5D3D A;  1V97 A;  1C4P A;  1OFF A;  2SAK A;  1PGX A;  1E10 A;  4WQM A;  1YJJ A;  2MJ3 A;  4N6E B;  1K51 A;  1KRH A;  1P7F A;  4J3O D;  5HI1 A;  1Q10 A;  2AQ1 B;  1TZO A;  2WNM A;  3P4R B;  3RFZ B;  3V3X A;  3P4S B;  1MPE A;  2V3P A;  4RGO S;  2CJO A;  3MFG A;  2PMV A;  5C3J B;  1F0Z A;  3TEY A;  2MEK A;  1SBB B;  4JE3 B;  3U52 E;  4ZYS A;  3PO0 A;  3AEA B;  4GDL B;  1N5X A;  3SFD B;  1L4Z B;  1T3Q A;  3IXS A;  2LHE A;  3LXF A;  1TY2 A;  5H92 C;  4DXF A;  2K22 A;  3BII D;  1ET6 A;  2EEL A;  2W3S A;  1L0X B;  5HHD G;  3TEX A;  3PZ7 A;  2W55 A;  1ZPS A;  1BXT A;  3AE2 B;  2WXM A;  4KKI A;  4YTN B;  3Q8E A;  1VZ7 A;  3B2G A;  4MT5 A;  1XO3 A;  1FO4 A;  3AE4 B;  1ZDV A;  1IBX B;  2ONQ A;  5GXG B;  2LUM A;  1YQ4 B;  1PDX A;  1TKG A;  2WXR A;  5FKA C;  4HKQ A;  3BK2 A;  3V05 A;  1N5W A;  2FBW B;  3GS2 A;  1J7C A;  1QLB B;  5AUI A;  1ENF A;  3O13 A;  5MPO A;  1WWT A;  1NYR A;  4ITK A;  4UDU C;  2LGI A;  1ZDX A;  2K0P A;  2W3R A;  4JWU C;  3C8Y A;  3PZ8 A;  1IGD A;  2WDR B;  4D2K A;  2WXO A;  1RM6 C;  1C76 A;  5LNK 1;  4YSY B;  1JWS D;  2WXQ A;  1ZXH A;  2AX5 A;  4FXC A;  2WXP A;  1FFV A;  1XCQ L;  4NJC A;  1JWB D;  3ABV B;  2QIE B;  4TQ1 A;  2DYM A;  1N61 A;  3I57 A;  2I38 A;  2NMQ A;  1HQR D;  2PVG C;  1AN8 A;  1SE2 A;  3ETR A;  3IAS 1;  1FIQ A;  1FNV A;  2V3N A;  3T3O A;  1JRP A;  1STE A;  2IPK D;  3NUH B;  1L0Y B;  1EWC A;  1XF5 L;  1FMA D;  2PIA A;  1C9F A;  2GI9 A;  5EE3 A;  2N0S B;  1YN5 A;  1DOY A;  4C7Z A;  4RH6 A;  2MH7 A;  2H88 B;  1L6U A;  3TSS A;  3BVZ A;  2PKO A;  3NVV A;  5BMH A;  4P16 A;  2LJI A;  1JWU D;  2ZW1 A;  2SEB D;  3P1M A;  3BK1 A;  4H2A A;  1UWM A;  2N9L A;  3J9C A;  2AQ2 B;  4O1N A;  1VLB A;  1E7P B;  3ZJV A;  2BS2 B;  1T6B X;  3SR6 A;  4XWW A;  2JZP A;  1AWD A;  2L52 A;  1OQQ A;  3CIR B;  1YQ3 B;  1T5X D;  3NVW A;  4OZC A;  4P6V F;  3KWL A;  1GAQ B;  1J7A A;  3MP9 A;  1L0V B;  5BYS A;  1LO5 D;  4A8X C;  1PUT A;  2N9K A;  2JWU A;  2M0A A;  3AE7 B;  3SEB A;  1RFK A;  2YEP B;  2BTE A;  3LYY A;  2AQ3 B;  2CJN A;  1ET9 A;  3NZ3 A;  2J42 A;  4L2Y A;  3AE1 B;  2ZW0 A;  1I4X A;  3HVD A;  1OQR A;  3AEF B;  3DWM A;  5FK9 C;  1JRO A;  2K9X A;  3RPF C;  1L5P A;  4WUR A;  1ESF A;  1FNW A;  2QMT A;  1K50 A;  2JX5 A;  4NAM A;  2IJ0 A;  2BW2 A;  1V1P B;  4RGN A;  2LFI A;  4RF1 A;  4KGS A;  4C56 C;  3MJ5 A;  2KAC A;  1CQV A;  1FRR A;  3W9C B;  1ACC A;  1NVI D;  3NVZ A;  1N62 A;  2JSV X;  2J4X A;  2DBY A;  1ZP0 B;  2BB6 A;  1QOG A;  4CQN A;  5BYR A;  1NYQ A;  3KWV A;  3KLS X;  4KGR A;  2RDG A;  2BYT A;  1E6E B;  1ZE3 D;  3GB1 A;  2WU2 B;  1QKZ A;  3AE6 B;  4ARI A;  4ARC A;  2WXI A;  4HJG E;  4B0M A;  1ZOY B;  2LEK A;  1V1O A;  2INP E;  4HRO A;  4TSS A;  4ZRQ A;  1WGK A;  1SIJ A;  5D7G A;  3L4P A;  4US8 A;  4M0W A;  1VZ6 A;  2PLP A;  1FNU A;  1R7S A;  4US9 A;  4YT0 B;  1SE3 A;  1UUP A;  1KLU D;  2BT6 A;  2JU6 X;  3BYY B;  4GDK B;  4YXD B;  4IOI E;  2JQR B;  2KMM A;  1HZ5 A;  1EU4 A;  1E9M A;  4L23 A;  1FCL A;  3W5U B;  1YN4 A;  2KWD A;  3GP7 A;  2G9H D;  4RF0 A;  4WH4 A;  4KX6 B;  1GOZ A;  4YTM B;  2WXK A;  4RGT A;  1SF0 A;  4NAW B;  5H8Y E;  4C80 A;  3VQI A;  1IBX A;  1I7H A;  1V8C A;  3T3N A;  2BS3 B;  5BYQ A;  1D6E C;  4RFB A;  2I2Y A;  4R3D A;  1FCC C;  3AED B;  3Q8A A;  1GB1 A;  1L4D B;  4LLG M;  3NVY A;  3VRA B;  3VR8 B;  1WYG A;  3FC4 A;  1GB4 A;  1VDV A;  3U7Z A;  2WDV B;  1FD6 A;  4OZA A;  4JPS A;  3FIL B;  4DQO C;  1QOA A;  1JQ4 A;  1ZXI A;  2WLB A;  2MJD A;  1GPX A;  1XLP A;  1UWX A;  2D5G A;  4USA A;  3AE5 B;  3KQ4 A;  1TS2 A;  1B9R A;  1PGA A;  2R61 A;  2QIL A;  3AE8 B;  3AM9 A;  4L1B A;  2HDE A;  1DGJ A;  1RYJ A;  2M56 B;  3MHZ A;  1L6V A;  4A6Q A;  2KAJ A;  3W5V B;  5EE9 A;  4WWM A;  3BVM A;  1YMH E;  2H89 B;  4ZOH C;  3VRB B;  1TKY A;  3AEG B;  5I4D A;  5JXV A;  1IGC A;  1XLN A;  1YJI A;  3EA6 A;  1BUI C;  2LMC A;  3AEB B;  4OW0 A;  1D5X C;  1PGB A;  3VR9 B;  2OED A;  4OHJ A;  2KDM A;  1XLQ A;  3ZYY X;  4GLS C;  1MI0 A;  3URY A;  2JXT A;  2NTT A;  2WXF A;  2V0G A;  1XXG A;  2QEJ C;  2Y5C A;  3NRZ A;  2WDQ B;  3WCQ A;  4HKZ E;  4XE0 A;  1D5M C;  1A70 A;  2DYO A;  1TJE A;  5T8I A;  4WAF A;  3H8H A;  2WXJ A;  4A90 A;  1CZP A;  1K53 A;  2RPV A;  1EM7 A;  4LTU A;  1JML A;  1RWS A;  2XNA C;  4N59 A;  1VRA B;  1XLO A;  1TYG B;  2ICI A;  2EKI A;  2DWQ A;  2WXN A;  3DWG C;  2PVO D;  4A55 A;  2VZK B;  1XEE A;  1MHX A;  3Q8B A;  2W54 A;  4JX1 C;  3TEZ A;  3R2T A;  3E9S A;  5TSS A;  1AYF A;  2WP9 B;  1EWY C;  2RDH A;  3B9J A;  3ZJU A;  4JWS C;  2HTM E;  1SJE D;  3IAM 1;  1NEK B;  1AW7 A;  2DLB A;  4XWT A;  1VR9 A;  3I9V 1;  1TS3 A;  4REZ A;  3W1S A;  2TSS A;  1I4R A;  5EE0 A;  2KN4 A;  1CK1 A;  4AQ7 A;  2JYE A;  1VJK A;  3ZGZ A;  1N60 A;  2JYT A;  1V1P A;  1KFY B;  2QJL A;  2FUG 1;  1FRD A;  2N7J A;  3AMZ A;  1TKE A;  4TMA B;  3AEC B;  2IGH A;  2GRI A;  3Q8F A;  4EE2 A;  4OVZ A;  1JWA D;  3P63 A;  4TQ0 A;  1PFD A;  2XN9 C;  4MAC A;  2X38 A;  1WXQ A;  2Y3A A;  2G1E A;  4IDI A;  3U2S C;  3W2D A;  2NTS A;  3ZQ4 A;  1N63 A;  3OWE B;  1IUE A;  4AS1 A;  2ACZ B;  3ZJT A;  1TS5 A;  2WS3 B;  1DOX A;  1SEB D;  3AE9 B;  1C4C A;  2OHF A;  4DXG A;  1HEZ E;  4KKJ A;  1KTK A;  4LK0 M;  2BBC A;  2PW9 A;  2Z8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...