2ZW0A

Crystal structure of a streptococcal protein g b1 mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
MDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANEHGVDGEWTYDPETKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Protein LG
publication title Optimizing pH response of affinity between protein G and IgG Fc: how electrostatic modulations affect protein-protein interactions.
pubmed doi rcsb
source organism Finegoldia magna
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2zw0A00
1MVKA 2NMQA 4KGRA 5BMIA 2IGDA 2PTLA 3GB1A 5HG2A 2QMTA 1P7FA 1XCQL 2LHDA 2LUMA 3MP9A 1IBXA 2PLPA 1ZXHA 2KN4A 2LHEA 2N9LA 2JWUA 1MHHE 1PGAA 1F2RC 2J53A 2KWDA 5BMHA 1K50A 3FILA 1D4BA 1FCCC 1PGBA 2JXTA 5HFYA 1GB4A 2ZW0A 2OEDA 4HKZE 5HHDG 4MACA 2ONQA 5HI1A 4D2KA 2JSVX 2JU6X 1FCLA 1IGDA 1PGXA 4OZBA 1HZ5A 2LGIA 1GB1A 2J52A 1QKZA 1MPEA 3V3XA 2PW9A 4IOIE 1KH0A 1K53A 1IGCA 1HZ6A 4OZCA 1MI0A 4HJGE 2GI9A 1P7EA 4IKGA 4WH4A 1C9FA 2JZPA 1IBXB 1Q10A 1YNTE 1MHXA 2N9KA 4KGTA 3UI3A 1K52A 5BMGA 2KDMA 1XF5L 2I2YA 1FD6A 1EM7A 2I38A 2ON8A 1HEZE 2N7JA 2QSDA 3FILB 2RPVA 2RMMA 1UWXA 4KGSA 1K51A 4GLSC 4OZAA 1YMHE 1F2RI 2ZW1A 1JMLA 2KQ4X 1XCTL 2K0PA 2IGHA 2KACA 2GB1A 2EELA 5JXVA 2IGGA
chains in the Genus database with same CATH superfamily
2DLBA 1WGHA 3WALA 2NTSA 2XN9C 4YSZB 5TSSA 2A5UA 3PREA 2W9NA 3VH3B 4AP4C 3AI5A 4BVUC 4FJVB 3VTUA 1AN8A 3SFDB 4ACFA 3QQ8B 2RPQA 3L13A 2DBYA 2M19A 2NBVB 4EZKA 2KDEB 4ZHPA 4E74A 1L6VA 2MH7A 5HI1A 3O65B 4LTUA 1AW7A 1G6JA 2ZPNA 2LGIA 1MJDA 1TS2A 3A1QB 4KIKA 1QKZA 3N9YC 5HKHA 2IO2B 4K7SA 1QLBB 1WH3A 4HVBA 1MI0A 5BYQA 1SBBB 2WWZA 1NI2A 1FPYA 1YQ3B 2JZPA 3R7QA 2UWQA 1SXTA 1Q10A 1YNTE 1E7VA 3ZO5B 2QEJC 4IWOA 1YN4A 2W55A 3H6NA 2O2VB 3DHGC 1EM7A 3RNCC 1VD2A 3VR9B 2JXXA 1WJNA 3I57A 3B2GA 1DOYA 2TSSA 4GGQA 1NDDA 4MGIE 4GDKA 5J18A 5JHAA 4MSMB 2IGHA 1T6BX 3SFEB 2BWES 2ZZPB 3ZKJC 3FAHA 2OOBB 2LWPA 3R7RA 2QMTA 2FAZA 1N5WA 3KLSX 3LB8C 1I4GA 3P1MA 3W2DA 2NVUI 3W9CB 2HDEA 1ZXHA 2GBMA 5DPWA 3K9PB 3ZYYX 3LJ3A 2L32A 4NQKE 4ANXA 2BW2A 1EU4A 2GBNA 2O6VD 2KNBA 2V4LA 1D4BA 3AM9A 4LNNA 2BQQA 3L54A 3U7ZA 3Q3JA 1UZXB 4J6IA 2CS4A 3VTWA 2IO3B 2C7HA 2JSVX 2XK5A 4WQOB 3DVNV 1C4AA 3PT2B 3V3XA 1V1PB 1KOTA 2R2OA 1IUEA 3FC4A 5G5GA 2NCNA 2D11A 3PS6A 3DVNU 1F9JA 3WA0A 2MWSB 2DYBA 4NZLB 2N9KA 2BWFA 2NR2A 4G50A 3TL5A 1AARA 1H8CA 1FD6A 1FMAD 3CF6E 2GMIC 4WJNA 1OQYA 4XWTA 3DBHI 1DOXA 3FILB 2WNMA 3ZGZA 1WM2A 2CR5A 1T0RC 4C4VB 4HROA 4M8NA 4RM8A 3PLVA 4BOSC 1WX8A 3HM3A 1FXAA 3NS1A 5FK9C 4A90A 1WY8A 1Q1OA 3Q8FA 5G2NA 5JZEB 4IG7B 1VZ7A 3IT6B 1LGRA 3QWZB 3UQAA 5BMIA 3CMMB 2ZNVC 1D5ZC 2PTLA 3GB1A 2INPE 4MM3B 1L6UA 1D6EC 3V61A 1L2NA 1SE4A 1GPXA 3U7DA 5CHFA 3WAMA 2KQ7A 1NYRA 1OEYA 1WZ3A 4AS1A 3VAWA 1V8CA 1V9JA 2LGXA 2VZKB 2ZEQA 4IDIA 1M94A 3DHIC 3RD2A 5D3IB 2CHWA 4TUUA 3AH7A 1GOZA 2KANA 4W9JA 1J7AA 1WXQA 2KOXA 2LGDA 3IXSA 4AUQC 4YWGG 1HZ5A 2G1EA 2MSED 1XD3B 1CQVA 5CHWA 1IYFA 4XGAB 1PDXA 1WXAA 3MC0B 3KW5B 2D3GA 2K39A 3GP7A 3AU5A 4KZCA 2J42A 4MGYE 3AULA 3CIRB 3R2TA 1S3SG 2XNAC 4OVUA 3UI3A 3ENEA 1CMXB 3U8ZA 3PTFC 3V62A 4A3PA 1GC7A 2DAJA 3PRPB 2DYMA 2A4ZA 3QHTA 2K8CA 1UD7A 2RMMA 1RRBA 1N60A 1CZPA 3DOWA 2D2QA 1WXMA 5AUKA 3AE3B 3DCGA 3RNAC 4L23A 5AZGA 4S17A 2WX1A 2YLMA 4DHJB 3WANA 2M1MA 2R2QA 1V6EA 2NBUA 3JSVB 4KSKC 3L4PA 3P4PB 4MJSA 2W54A 2HJ8A 4HJKA 4II3B 4USAA 1E7PB 1WF9A 3LYYA 2ICIA 3C8YA 5IKCM 1I35A 3MC8A 3NJTA 1ZXIA 3L0WB 1GNUA 3QA8A 2FE8A 2QC8A 4RFBA 1IGDA 4F1SA 2KYWA 1JW9D 2QDFA 2Q5WD 1FNUA 3ZUNA 2KHWB 2DZJA 2E6XA 3RMKC 1NEKB 4FJYA 1UH6A 3FKYA 2LVOA 4WJOA 2NTTA 4ZRKA 3ZTCA 5KHQA 4II2B 4JWUC 3DBLB 4NNJB 3ZJVA 5EE9A 2DX5B 1TKGA 3L17A 4NAWB 2BB6A 5D94A 3RPFC 2WXQA 4RNAA 2MHJA 4BBNC 2KMAA 4GB9A 2IO1B 1L4ZB 4FHKA 4XWWA 2IO0B 2K8HA 1R4MB 1WGDA 3ZVVA 4K7WA 1SJHD 4P7IA 5CTRC 1V5TA 1L5PA 4OZAA 3PGEA 4IWQA 1M4VA 3T8MA 4A55A 1JQ4A 1OQRA 1XQQA 1ZDXA 3DBSA 2NBWB 3NS8A 2WYQA 5CX3A 5JXVA 2L83A 4WIPA 1OEYJ 4AQ7A 4BKGA 2NMQA 1Q0WB 1EWCA 3RI7C 4WJPA 2PVGC 1WYGA 4CQNA 1LFDA 3MP9A 1IBXA 4ZRPA 3VRBB 3X23A 2G4DB 3AEGB 5LNK1 4IC7B 1MHHE 3SU8X 2PE9A 3A33B 1YD8U 4YXDB 1RM6C 2FUG1 1K50A 1VR9A 1J7CA 3PV1A 1YN5A 5IOIA 5HFYA 3Q6BA 1ZW7A 4EUTA 2DNFA 2JU6X 2OHFA 1TBEA 2H89B 1CJEA 3ZRCA 1S1QB 4OZBA 2NS5A 3I9V1 1WIAA 3AEAB 2AQ3B 2K9XA 3S2AA 2KWUB 3A9KB 1XLPA 2ZCBA 4DDGD 1PQSA 2WXGA 3AEBB 1P7EA 4YTPB 1STEA 4FHJA 2VH1A 2J7QB 2FCSA 2FIFA 4EKUA 3SR6A 2SEBD 1KF6B 4J3OD 4L1BA 3Q3FA 5E6PA 3PRMB 1UBQA 3N1XC 2CU1A 3JVZX 1WFYA 3ONSA 3KYDD 3L10B 3AEFB 1TS3A 1YMHE 1F2RI 3J9CA 3APDA 5BYRA 1KTKA 1EO6A 4BBNF 1XO3A 3KH0A 3BIID 1C79A 1WXSA 2KDFB 4WWPA 4K7UA 3P63A 1WWTA 1N62A 2Y5CA 2WXJA 2KWCA 4DHZE 2MP2B 2V9HA 4HRSA 3RZFA 2N9LA 2GBRA 1C1YB 4MELA 4AWJA 4IM0A 4ICVA 2ZCCA 5E6NA 2FNJB 1GUAB 2YEPB 4ANWA 2HTHA 4BKTA 1QOBA 2KO3A 2FCMA 1BMLC 1I4HA 2WXKA 3H8HA 4BAXA 4BKSD 2MJ3A 3AE7B 4HLEA 3IFWB 4GDLA 3Q8AA 1YIWA 4GXBA 3A9JA 1EU3A 4LNKA 2JYEA 4ANVA 2WXLA 4REZA 1SE2A 3QIJA 4ICUA 2BS2B 4AJYB 3M63B 4M01A 1K53A 5FKAC 2D10A 2QIEB 4ITKA 3IAM1 3AE9B 3P4RB 1V1OA 1WI0A 3BYTB 4XX5A 1MHXA 2XK5B 4KGTA 3SD5A 2K3UA 4KVGB 2JY6A 3HUIA 2MBOA 2B3AA 3Q2AC 4WWNA 4EFOA 4DQOC 1WJ6A 1FIQA 3AB5A 4G0NB 3RNGC 1I4RA 2I1KA 2JVCA 1OGWA 2ZW1A 3N30A 1VDVA 2KC2A 3P2BA 3Q14C 3Q8CA 2K0PA 2KXJA 4PYZA 1P3QU 4IWPA 3M62B 1P0RA 1BT0A 3QAQA 2GRIA 2EELA 3X0WA 4UDUC 3HM6X 3PHXB 3DBLI 1F1HA 3QC8B 3DBRB 1QILA 2N9PC 1E8YA 2NPTA 1E6EB 2IBIB 2BT6A 4JX1C 1P7FA 2AQ1B 3AEDB 3R66C 4XYCA 1SIJA 1V2YA 1R4MI 2EMSA 4PYUA 4LK0M 1VLBA 3RYTA 4W9LA 1WRIA 4KZ0A 4OW0A 3L08A 2WXIA 1I4PA 1R7SA 4DXAB 5BMHA 2PKOA 4M8MA 3C19A 3UIPB 1PGBA 4ZRJA 1QOFA 4HKZE 3TEYA 1NBFC 4W9HA 4LDTD 4ARIA 3RFZB 1WE6A 2MJEA 3GS2A 1GJZA 3UQBA 1NYQA 2KFKA 3APCA 4KDLB 2J52A 3TMPB 1MG8A 3ZJTA 2YEPF 2IPKD 3TSSA 1I4QA 1HZ6A 2FUHB 4RF0A 2WDVB 3T3OA 5EE0A 4G11A 3EFUA 4HJGE 4OHJA 1MG4A 3OWEB 2LJIA 5IA7A 1JRPA 4TQ0A 1V80A 4DHZB 2LD9A 4P16A 2ZPYA 3OAWA 1FRDA 2M0XA 1TIFA 2N9EB 1T5XD 3RNBC 1MFWA 2ON8A 3M95A 2AX5A 1V81A 3DVGX 3AXCA 4KKIA 5IP4D 4ZRQA 4GOCA 4ZYNA 3MHZA 1P98A 1XLNA 3B0AA 2KTRA 3A1QA 2LASA 5EE3A 2WU5B 4FA6A 1YJIA 3I5JC 3MC9A 1JROA 5C1ZA 4N6EB 2G45B 2GLSA 5AZFA 2IGDA 4RGOS 3Q3OC 3PLUA 3Q8BA 1XCQL 4OVZA 2JPHA 3ZRFA 2KDBA 2B76B 2BVCA 1J19A 1ROEA 2LHEA 1SIFA 3ZNHB 2VRRB 1GG3A 4G3XB 2PMVA 5C2TB 4I6LB 1AWDA 2V0GA 1WJUA 1TT5B 2JRHA 2ZNVB 1WYWB 3AMZA 2M56B 2LMCA 3IBEA 4FBJB 4W9IA 1WX9A 2KLGA 4MJSB 1K8RB 2KN5A 4EZJA 5C3JB 3U30A 2BBCA 2N7DA 3C0RB 3U52E 2CKHB 1JWSD 5JH5C 4W9FA 2XEWA 1SE3A 4MH0E 3GOEA 1P9DU 5H92C 1L4DB 2RDBC 3WIMA 2WXFA 2MBEA 4YTMB 1RAXA 3NVZA 2M0AA 1UGMA 2HE7A 2J4XA 2WXOA 1FFUA 2K8BA 1UGJA 5JHBA 2HTME 1LXDA 5AZHA 1V97A 2BKFA 3P4SB 3PZ7A 2Y3AA 2BPSA 4L2YA 2SAKA 4CYEA 1UELA 3RNEC 2WXPA 2KJRA 3IVFA 4US9A 3BK1A 3RUIB 3H7PA 1V1PA 2INCC 2C7NB 4AOFA 4W9KA 1TZ1A 4HKQA 3DPDA 5CHVC 3AECB 3RN9C 4C7YA 1UWMA 3M3JA 2KX3A 1ZE3D 1ENFA 1T0SC 2N7EA 4F8CB 3SEBA 4RF1A 1TTNA 4YL8A 2FCNA 4I6NB 2G9HD 2MLBA 2R61A 4YSXB 3FILA 3Q3MC 1B9RA 1TY2A 1NI3A 4C4VA 1I4XA 2PPHA 2ZW0A 3PO0A 3DBRI 1Z5SB 4P1CC 4A6QA 3AN1A 3VRAB 3V6CB 3ZNID 3SDLC 2PW9A 1C77A 4YT0B 1OTRB 2RSUA 1Y8RC 2AQ2B 1L0XB 1UNSA 3NZUA 4MM3A 4XZ4A 2Z0DB 3ZXVA 2V3PA 4IKGA 3PHWB 1FXTB 2W3RA 4W9CA 3EA6A 4M00A 2LGYA 3SHQA 3MHSD 3NY5A 1T0YA 2PJHA 2V3SA 3WAPA 5KHOA 4NJCA 2AWTA 2I38A 2N7JA 2KDIA 2ZVNA 1QOAA 4WAFA 3L16A 2RPVA 1RFKA 3I63C 4FXCA 1YQBA 3U2SC 1BXTA 4Q2JA 4RMAA 3TCAA 2KQ4X 2QCZA 1WGKA 3AE4B 2KT7A 5E6JA 4GIVA 2L05A 1WM3A 3B08A 4LNIA 2BTEA 5IAAC 4XC2A 2OJWA 2JWZA 4F7ZA 1RLFA 3EUB2 2L1AA 5DCNA 2Z59B 4KGRA 3V6EB 4C56C 4LNOA 2L0FA 5HG2A 1E10A 1N6ZA 2LHDA 2LUMA 2HJ1A 2LRWA 3URYA 3JYUA 2KJ6A 3VTVA 3EHVA 2FCQA 1SF0A 3DWGC 4P6VF 3I3TB 2LUEA 2X38A 4YTNB 5J2RA 1N5XA 1L0YB 3KUDB 4KX6B 4MGZE 3H9DA 1TY0A 4RGTA 3VUYA 2IDYA 3Q69A 5DPRA 3TBLD 4WURA 5GMVA 3ZJUA 2HD5B 1N63A 1IP9A 4ZYSA 1ACCA 1WRDB 1B1ZA 2JX5A 2AL6A 2RDGA 2C7MB 3BYYB 4PS3A 2WS3B 5EDSA 3AE2B 4O1NA 3ZW3A 3H1UA 2WXRA 4GSWA 3HIZA 3B9JA 4M02A 4DK5A 2LGSA 2N4FA 2X8XX 1ET9A 1K52A 3JSVA 3ZDTA 3VVWB 2WXHA 2RGFA 1ESFA 1XT9B 2PIAA 3W1YA 3P4QB 1XF5L 1EF5A 3NHEB 2D07B 1WZ0A 2QSDA 4KGSA 2M8SA 4JGHB 3A4RA 1E8ZA 3GE3C 1SJED 4ARCA 5AEKB 1YX6B 2MW5A 3NG0A 4KIKB 1TKEA 1KLUD 2M4NA 1T3QA 4C7ZA 1MVKA 1TJEA 3PVLA 2PVOD 1VJKA 3NVVA 2K22A 1Z2MA 3VXWA 2QHOA 4HPLB 1FNWA 5MPOA 4NAWA 4NJ6A 4NY0A 1GAQB 5I4DA 2N9XA 4TKNA 4ZRIA 1UUPA 2NPTB 4LDTB 4RH6A 4M0WA 1YQ4B 2W82A 3E56A 1A70A 1WE7A 3V60A 1E8WA 1HE8A 3ML8A 3N20C 2Z0EB 2RR9A 1LM8B 4RGNA 5FR6A 3N32A 4GDKB 1FCLA 4FLHA 1F0ZA 1PGXA 1FO4A 2QILA 1QT9A 1IGCA 2L3ZA 1D5XC 2BKRB 4DXGA 3ECIA 1KRHA 3N1ZC 4TV3A 2H88B 2BYFA 2N1WA 3OG5A 4B9KA 3CSFA 1D3ZA 2DZKA 3ZQ4A 2KC1A 3B1LX 1C4CA 3AE6B 2CU3A 4LJPB 3BVGA 1YX5B 4DWFA 4ANUA 4EZLA 4MDKE 1K51A 2D3BA 1UF0A 2WGSA 1XEEA 1E9MA 2MBBB 3KWLA 3TJPA 2KD0A 4W9EA 2KX0A 2KACA 4JQWC 4K3CA 1E8XA 3HRDD 2RDHA 3A9KA 3R2IA 1SSNA 2KK8A 3NZ3A 1F77A 1P1AA 2JT4B 3AV8A 1WR1A 4DXFA 4NJ7A 1SEBD 2FIDA 2V1YA 1EUVB 2J0KA 2PLPA 2CHZA 3QJZA 3OJ4B 4XDCA 4N59A 2KTRB 3EC8A 3ZDMC 3AE5B 4DDID 1A5RA 1PGAA 3NOBA 3KUCB 3RULA 1JWAD 4JE3B 2LXCA 3ZXRA 1WMHA 4NPNA 1VCBA 1KM7A 1PUTA 2LJ5A 4K1RB 1RYJA 4TSSA 5HHDG 1J8CA 1WGGA 4A8XC 1SGHA 4FJZA 1WR6E 1U4AA 3ABVB 1GB1A 4HK2A 2L76A 1I7HA 3UGBB 2KFJA 4MGKE 2D3AA 1KH0A 4N58A 2BYTA 2CJOA 1DYQA 1YN3A 3UIOB 2LXAA 3E9SA 3TUOA 4PS7A 3MJ5A 3GZNI 2KVZA 2MP2A 4HWIB 2O6VA 1TYGB 2INDC 5G55A 3HVZA 2L52A 4JIOU 1NVID 4C80A 1HEZE 2DZMA 1ZUD2 1WXVA 2WDTB 4I6PA 3W5VB 1UWXA 3CSTA 1JALA 1DOIA 2LZ6A 4XE0A 5J17A 1C76A 2ACZB 2ZVOA 1Y56A 4NQLB 2UU7A 4B95A 2ZJDA 3NRZA 4JL9A 4YSYB 4NAMA 3EECA 2L8JA 1QZEA 4AJWA 1FNVA 1E0ZA 1OQQA 1QF6A 4MH8A 2CJNA 3OLMD 3RT3B 4A9AA 1ZP0B 1V49A 3NZSA 4A20A 3LXFA 4KSLC 3EGRA 3KVFB 2JF5A 2WU2B 4A3OA 2KN4A 4LNFA 1TZOA 2REXA 1EF1A 1QQRA 4WQMA 3H7PB 2J53A 1LQBA 1KLGD 4TMAB 5H8YE 4H2AA 4EEWA 4US8A 2K6QA 3IHPC 4C00A 5D6JB 2PEAA 3MTNB 4BFRA 4PT5A 4MACA 3ETRA 1Q5WB 4RCOA 2Y5BB 3TIXA 1XLOA 2IY1B 5L83A 2O2VA 2AL3A 3BY4B 1X1MA 3BVMA 5T8IA 2JQRB 1C3TA 2I1JA 3MFGA 2V3NA 2GBJA 2GI9A 4PK1A 1WSPA 4WH4A 2EMTA 3ZLZA 2EKIA 2KVRA 2WQYB 4DBGA 5BMGA 1DGJA 2KDMA 4JWSC 4WWMA 2V4IB 3A4SC 3TEZA 2INNE 3HK0A 2JUOA 3VHTC 3RCZA 3CWIA 1YJJA 3Q3NC 1JWUD 3QX1A 3V05A 1V5OA 1R4NB 3IG3A 4WWOA 2IZVB 3VQIA 1XLQA 4PS8A 2UYZB 4GLSC 3R3MA 2D5GA 1UBIA 4WAAA 3W1SC 3N3KB 2BS3B 5D2MB 4R3DA 4JPSA 3UINB 1QOGA 2GB1A 5FR3A 3NVWA 1PFDA 2KAJA 3ALBA 2MCNB 1FM0D 2MA9B 2EKEC 2JYTA 2DZIA 5LLIA 1I42A 4CO7A 4N9F4 4IM2A 4BOZB 3AEEB 2LVQA 4QAYA 1C78A 1ZGUB 4TQ1A 2K25A 2C9WB 3KQ4A 4B0MA 3PPAA 2WP9B 2G3QB 1F2RC 2MJDA 2BGFA 5DPSA 2KWDA 3Q8EA 3RNFC 1FCCC 2GBKA 1GB4A 2PE6B 1T0QC 4EOYA 2OJRA 4D2KA 3VDZA 2E3TA 4JLCA 2KLCA 2KTFA 4HPPA 3B2FA 3WAOA 3N1YC 1ZOYB 2KMCA 3BWUD 3TEXA 2Y5PA 1VZ8A 2C5LC 3P42A 1WJ4A 3JW0X 2LVPA 1IBXB 1CK1A 4KKJA 1TGZB 2M17A 3W5UB 4FULA 2L0TA 4OVVA 2I2YA 1YOVB 2K5PA 4K81A 1L7YA 2L7RA 2MRPA 3UF8A 5AUIA 1VRAB 2RD0A 2AYOB 1BUIC 4X57B 4E3CA 3NUHB 3R8BA 1RWSA 5L95C 1XCTL 4KDIC 4RM9A 3W1SA 3VUXA 3BVZA 4MT5A 2BYVE 3K9OB 4RGMA 3AE1B 3QARA 2BF8B 2D3CA 3T3NA 2KWVB 3PZ8A 4B6WA 2IGGA 4ZHOA 4HDQA 1FFVA 2JRIB 3DQVA 1E5WA 1JWMD 4URKA 1KLVA 1VZ6A 4IUMB 2WX0A 2KMMA 5LXHA 1LO5D 1C4PA 2C60A 2GOWA 2JZ3B 3T9LA 3QCAA 1N61A 1NENB 2KZRA 1FRRA 4GU2A 3VR8B 2KKCA 4ZDVA 3O13A 4HDOA 5LXIB 1HTOA 3NVYA 3EFCA 1ZKHA 3KWVA 2CHXA 2LRUA 2DENB 2OEDA 4XDDA 3PZDA 4WJQA 2VZKD 2ONQA 5TR5A 3PSEB 3BINA 2Z8LA 2AEHA 1IPGA 1HA5A 2IYDB 2DWQA 2XBBC 1ET6A 2DYOA 4KV2A 3GZNB 4ASWC 2FBWB 3VUWA 4M0WB 1SB3C 5DPTA 4LLGM 1FXIA 3ZIMA 4LJOB 2IY0B 4P1BC 4ZOHC 5IN7A 3IAS1 2LI5A 3QK0A 2WXNA 1HTQA 4W9GA 4EE2A 4B0EA 3DDCB 1D5MC 4BZAA 2J0MA 2MBQA 1JCKB 4HXDA 4CHKA 4W9DA 3U4EG 3D32A 3TEWA 4IM3A 3DWMA 2IJ0A 4GDLB 3A9JB 3DVGY 1EWYC 2KQSA 3MJWA 5BYSA 2VH2A 2K6DB 1WGYA 1H4RA 1L0VB 2K1FA 1JWBD 4GN1A 3BK2A 1KFYB 1OFFA 1ZDVA 2KJHB 3AU4A 3HVDA 4LCDE 1R4NI 4HCNB 2WDRB 2BS4B 4DHJD 1TS5A 2JWUA 5IO9A 2DAFA 2BYEA 4FADA 1TKYA 2ASQA 1HQRD 2YVCA 5EE1A 1F52A 4MEMA 1E90A 3PRZA 2JXTA 1WGRA 3KUZA 4K3BA 3H7SA 2MQJA 4E71A 5C23A 5GXGB 2JZZA 3APFA 3AE8B 3VH4B 3DBHB 1TS4A 3GE8C 3IT4B 3ZTDA 4IW0A 3HHMA 1MPEA 5BO4B 4IOIE 1J0GA 1SE9A 2LEKA 5D3DA 1PYWD 1HXYD 4OZCA 1ZPSA 1FEHA 1WMHB 4MSQB 3WCQA 1J7BA 1KJTA 1AYFA 1YJ1A 3LDZE 1C9FA 2QJLA 3ZNGC 1XXGA 2N1VA 2WHIA 1E7UA 4FN2A 4GMVA 2L00B 3RZWC 3ML9A 2MEKA 3BZDB 3KYCD 1V86A 4BKSA 3OJ3A 4HCPB 1GC6A 2DHZA 2N0SB 3VFKA 2WXMA 2G4SA 1ISNA 3DHHC 3ZNZB 1WX7A 4S0RA 5E6OA 2WLBA 1JMLA 2WDQB 1RFAA 2W3SA 4HPMB 2O6VB 2MBHA 2KFKB 2MX2A 5G5HA 2J0JA 2BB5A 2LFIA 5D7GA 4HEA1 1JRUA
chains in the Genus database with same CATH topology
2NMQA 4MH8A 2CJNA 2DLBA 1EWCA 4A9AA 2PVGC 4HKQA 1ZP0B 1WYGA 3AECB 2NTSA 4CQNA 2XN9C 3LXFA 4YSZB 5TSSA 4C7YA 3EGRA 1UWMA 1ZE3D 3MP9A 1IBXA 2WU2B 4ZRPA 1ENFA 2KN4A 3VRBB 3AEGB 1TZOA 1QQRA 3SEBA 4RF1A 5LNK1 4WQMA 1MHHE 2J53A 4YXDB 1KLGD 1AN8A 1RM6C 2FUG1 1K50A 1VR9A 4TMAB 2G9HD 5H8YE 1J7CA 2R61A 3SFDB 4YSXB 3FILA 1B9RA 4H2AA 2DBYA 2M19A 1TY2A 4US8A 1YN5A 1NI3A 1I4XA 5HFYA 4ZHPA 2ZW0A 1L6VA 4PT5A 3PO0A 4MACA 2MH7A 5HI1A 2JU6X 2OHFA 3ETRA 4RCOA 4LTUA 1AW7A 2H89B 1CJEA 1XLOA 4OZBA 2LGIA 1TS2A 3AN1A 3I9V1 3VRAB 1QKZA 4A6QA 3AEAB 3N9YC 2AQ3B 2K9XA 2PW9A 1C77A 4YT0B 3BVMA 5T8IA 2JQRB 1QLBB 1XLPA 2AQ2B 1L0XB 3MFGA 2V3NA 1MI0A 1UNSA 2WXGA 5BYQA 2GI9A 1SBBB 1WSPA 1P7EA 2V3PA 3AEBB 4IKGA 4WH4A 4YTPB 1YQ3B 1STEA 2JZPA 2EKIA 2W3RA 1SXTA 1Q10A 1YNTE 2WQYB 3EA6A 2QEJC 3SR6A 2SEBD 1KF6B 5BMGA 1DGJA 4J3OD 1YN4A 2KDMA 2W55A 4L1BA 4JWSC 4WWMA 2V4IB 3TEZA 2INNE 4NJCA 1EM7A 2I38A 3VR9B 3CWIA 1YJJA 2N7JA 1JWUD 3V05A 3I57A 1QOAA 4WAFA 2RPVA 3B2GA 3VQIA 1RFKA 3AEFB 1DOYA 1XLQA 4FXCA 2TSSA 1TS3A 4GLSC 1YMHE 3U2SC 1BXTA 1F2RI 2D5GA 3J9CA 4Q2JA 2KQ4X 5BYRA 1WGKA 2BS3B 3AE4B 1KTKA 4R3DA 4JPSA 5E6JA 2IGHA 1XO3A 1QOGA 2GB1A 5FR3A 1T6BX 3BIID 3NVWA 2BTEA 3SFEB 1PFDA 2KAJA 1FM0D 1C79A 2JYTA 3EUB2 2L1AA 4KGRA 3FAHA 4C56C 5HG2A 2QMTA 3P63A 1WWTA 1E10A 1N62A 1N5WA 3KLSX 2Y5CA 3LB8C 2WXJA 3AEEB 1I4GA 3P1MA 3W2DA 2LHDA 2LUMA 3URYA 3W9CB 1C78A 2HDEA 1ZXHA 4TQ1A 3KQ4A 4HRSA 2N9LA 4B0MA 2WP9B 3ZYYX 1F2RC 2L32A 2MJDA 2KWDA 3Q8EA 1SF0A 2BW2A 3DWGC 4P6VF 1EU4A 2X38A 2YEPB 4YTNB 1D4BA 1QOBA 3AM9A 1BMLC 1I4HA 1FCCC 1L0YB 1N5XA 1GB4A 4KX6B 2WXKA 3U7ZA 3H8HA 1TY0A 2MJ3A 4RGTA 2IDYA 3Q69A 3AE7B 2JSVX 4WURA 4D2KA 2E3TA 3Q8AA 3ZJUA 1EU3A 2JYEA 2WXLA 1N63A 4ZYSA 3B2FA 1ACCA 1C4AA 4REZA 1SE2A 3V3XA 1V1PB 1ZOYB 1B1ZA 2BS2B 3BWUD 1K53A 2JX5A 2RDGA 1IUEA 3BYYB 2WS3B 3FC4A 3TEXA 5G5GA 5FKAC 3AE2B 4O1NA 2QIEB 4ITKA 2WXRA 3IAM1 3AE9B 2Y5PA 1VZ8A 3P4RB 3B9JA 3P42A 1V1OA 1IBXB 3BYTB 4NZLB 1MHXA 2N9KA 4KGTA 1ET9A 1CK1A 1K52A 2K3UA 4KKJA 2WXHA 1ESFA 2PIAA 3W5UB 3HUIA 3P4QB 1XF5L 2I2YA 1FD6A 1FMAD 2K5PA 4XWTA 4DQOC 1DOXA 2QSDA 3FILB 2WNMA 1FIQA 3AB5A 4KGSA 3ZGZA 4HROA 5AUIA 1VRAB 1I4RA 1BUIC 2ZW1A 3NUHB 3R8BA 1RWSA 1VDVA 3Q8CA 1XCTL 2K0PA 3W1SA 3BVZA 4MT5A 1SJED 4ARCA 1FXAA 4RGMA 3NS1A 2GRIA 2EELA 4UDUC 5FK9C 3AE1B 4A90A 1TKEA 3T3NA 1KLUD 3Q8FA 1T3QA 3PZ8A 1VZ7A 2IGGA 4ZHOA 3IT6B 1FFVA 4C7ZA 1MVKA 1TJEA 5BMIA 1QILA 2PVOD 1D5ZC 1JWMD 1E6EB 1VJKA 2PTLA 2BT6A 3GB1A 2INPE 4JX1C 4MM3B 1L6UA 1D6EC 1P7FA 2AQ1B 3NVVA 2K22A 3AEDB 1VZ6A 1SIJA 1SE4A 1GPXA 1FNWA 4LK0M 2KMMA 5MPOA 1VLBA 1LO5D 1C4PA 1WRIA 1GAQB 5I4DA 4OW0A 1NYRA 1N61A 2WXIA 1I4PA 1NENB 1FRRA 1R7SA 3VR8B 4AS1A 3O13A 5BMHA 2PKOA 1V8CA 3NVYA 1UUPA 3KWVA 2VZKB 4RH6A 4IDIA 4M0WA 5D3IB 1PGBA 1YQ4B 1QOFA 2OEDA 2W82A 4HKZE 4XDDA 3TEYA 3AH7A 1GOZA 3E56A 1A70A 2VZKD 2ONQA 4ARIA 3RFZB 1J7AA 1WXQA 2Z8LA 4RGNA 3IXSA 2MJEA 3GS2A 4GDKB 1FCLA 1NYQA 1F0ZA 1PGXA 1HA5A 4YWGG 1HZ5A 2G1EA 2J52A 2DWQA 1FO4A 1CQVA 1ET6A 2DYOA 3ZJTA 2YEPF 2IPKD 2QILA 1QT9A 3TSSA 1I4QA 1IGCA 1HZ6A 1PDXA 2FBWB 3MC0B 4RF0A 2WDVB 3T3OA 5EE0A 1SB3C 1D5XC 4HJGE 4DXGA 4LLGM 4OHJA 3GP7A 1FXIA 1KRHA 3OWEB 2J42A 2LJIA 4ZOHC 3CIRB 3R2TA 1JRPA 4TQ0A 2H88B 3IAS1 2XNAC 4P16A 2WXNA 3UI3A 1FRDA 3ZQ4A 1T5XD 4EE2A 1C4CA 4B0EA 2DYMA 3AE6B 2CU3A 2ON8A 3BVGA 1D5MC 2AX5A 2RMMA 1JCKB 1N60A 3U4EG 1K51A 1CZPA 4KKIA 3TEWA 1XEEA 1E9MA 3KWLA 3DWMA 2IJ0A 4GDLB 4ZRQA 5AUKA 3AE3B 3MHZA 1XLNA 2KACA 1EWYC 5EE3A 5BYSA 2WU5B 3HRDD 1L0VB 1YJIA 2RDHA 3R2IA 4L23A 1JWBD 1SSNA 3NZ3A 1F77A 3BK2A 1KFYB 1JROA 3AV8A 4N6EB 4DXFA 1OFFA 2IGDA 4RGOS 1ZDVA 1SEBD 3Q8BA 1XCQL 4OVZA 3HVDA 2B76B 2PLPA 4XDCA 2WDRB 1ROEA 2BS4B 4N59A 2LHEA 3L4PA 3P4PB 1TS5A 2W54A 3AE5B 2JWUA 1PGAA 2PMVA 4USAA 1E7PB 1JWAD 4JE3B 5C2TB 1TKYA 3LYYA 1AWDA 2V0GA 1HQRD 5EE1A 2ICIA 3C8YA 1PUTA 2JXTA 3AMZA 2M56B 2LMCA 1RYJA 4TSSA 5HHDG 1ZXIA 4A8XC 2FE8A 5GXGB 4RFBA 1IGDA 3AE8B 1TS4A 1JW9D 3ABVB 1GB1A 3IT4B 5C3JB 1MPEA 2BBCA 1I7HA 2Q5WD 4IOIE 5D3DA 2LEKA 1KH0A 1FNUA 1PYWD 4N58A 2BYTA 2CJOA 1HXYD 1DYQA 2E6XA 3U52E 1YN3A 1NEKB 1JWSD 1FEHA 1ZPSA 4OZCA 3WCQA 3E9SA 3TUOA 2NTTA 1J7BA 1SE3A 3MJ5A 1AYFA 4JWUC 1C9FA 2QJLA 5H92C 3ZJVA 1XXGA 5EE9A 1L4DB 1TKGA 4NAWB 3RPFC 2BB6A 2WXFA 2WXQA 4RNAA 4YTMB 1TYGB 3NVZA 2M0AA 3HVZA 2J4XA 2WXOA 2L52A 1L4ZB 1FFUA 2MEKA 4XWWA 3BZDB 1NVID 1UGJA 4C80A 1HEZE 1ZUD2 2HTME 2N0SB 2WXMA 3W5VB 1UWXA 1SJHD 1V97A 1JALA 1L5PA 4OZAA 1DOIA 3P4SB 3PZ7A 4XE0A 2Y3AA 2WLBA 1JMLA 1M4VA 4A55A 2WDQB 4L2YA 1JQ4A 2W3SA 1C76A 2SAKA 1OQRA 2ACZB 1ZDXA 1Y56A 2WXPA 5G5HA 4US9A 2BB5A 2LFIA 3BK1A 3NRZA 4YSYB 4NAMA 1V1PA 5JXVA 2L83A 1FNVA 4WIPA 1E0ZA 4AQ7A 1OQQA 5D7GA 1QF6A 4HEA1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MVK A;  2NMQ A;  4KGR A;  5BMI A;  2IGD A;  2PTL A;  3GB1 A;  5HG2 A;  2QMT A;  1P7F A;  1XCQ L;  2LHD A;  2LUM A;  3MP9 A;  1IBX A;  2PLP A;  1ZXH A;  2KN4 A;  2LHE A;  2N9L A;  2JWU A;  1MHH E;  1PGA A;  1F2R C;  2J53 A;  2KWD A;  5BMH A;  1K50 A;  3FIL A;  1D4B A;  1FCC C;  1PGB A;  2JXT A;  5HFY A;  1GB4 A;  2ZW0 A;  2OED A;  4HKZ E;  5HHD G;  4MAC A;  2ONQ A;  5HI1 A;  4D2K A;  2JSV X;  2JU6 X;  1FCL A;  1IGD A;  1PGX A;  4OZB A;  1HZ5 A;  2LGI A;  1GB1 A;  2J52 A;  1QKZ A;  1MPE A;  3V3X A;  2PW9 A;  4IOI E;  1KH0 A;  1K53 A;  1IGC A;  1HZ6 A;  4OZC A;  1MI0 A;  4HJG E;  2GI9 A;  1P7E A;  4IKG A;  4WH4 A;  1C9F A;  2JZP A;  1IBX B;  1Q10 A;  1YNT E;  1MHX A;  2N9K A;  4KGT A;  3UI3 A;  1K52 A;  5BMG A;  2KDM A;  1XF5 L;  2I2Y A;  1FD6 A;  1EM7 A;  2I38 A;  2ON8 A;  1HEZ E;  2N7J A;  2QSD A;  3FIL B;  2RPV A;  2RMM A;  1UWX A;  4KGS A;  1K51 A;  4GLS C;  4OZA A;  1YMH E;  1F2R I;  2ZW1 A;  1JML A;  2KQ4 X;  1XCT L;  2K0P A;  2IGH A;  2KAC A;  2GB1 A;  2EEL A;  5JXV A;  2IGG A; 
#chains in the Genus database with same CATH topology
 2DLB A;  1WGH A;  3WAL A;  2NTS A;  2XN9 C;  4YSZ B;  5TSS A;  2A5U A;  3PRE A;  2W9N A;  3VH3 B;  4AP4 C;  3AI5 A;  4BVU C;  4FJV B;  3VTU A;  1AN8 A;  3SFD B;  4ACF A;  3QQ8 B;  2RPQ A;  3L13 A;  2DBY A;  2M19 A;  2NBV B;  4EZK A;  2KDE B;  4ZHP A;  4E74 A;  1L6V A;  2MH7 A;  5HI1 A;  3O65 B;  4LTU A;  1AW7 A;  1G6J A;  2ZPN A;  2LGI A;  1MJD A;  1TS2 A;  3A1Q B;  4KIK A;  1QKZ A;  3N9Y C;  5HKH A;  2IO2 B;  4K7S A;  1QLB B;  1WH3 A;  4HVB A;  1MI0 A;  5BYQ A;  1SBB B;  2WWZ A;  1NI2 A;  1FPY A;  1YQ3 B;  2JZP A;  3R7Q A;  2UWQ A;  1SXT A;  1Q10 A;  1YNT E;  1E7V A;  3ZO5 B;  2QEJ C;  4IWO A;  1YN4 A;  2W55 A;  3H6N A;  2O2V B;  3DHG C;  1EM7 A;  3RNC C;  1VD2 A;  3VR9 B;  2JXX A;  1WJN A;  3I57 A;  3B2G A;  1DOY A;  2TSS A;  4GGQ A;  1NDD A;  4MGI E;  4GDK A;  5J18 A;  5JHA A;  4MSM B;  2IGH A;  1T6B X;  3SFE B;  2BWE S;  2ZZP B;  3ZKJ C;  3FAH A;  2OOB B;  2LWP A;  3R7R A;  2QMT A;  2FAZ A;  1N5W A;  3KLS X;  3LB8 C;  1I4G A;  3P1M A;  3W2D A;  2NVU I;  3W9C B;  2HDE A;  1ZXH A;  2GBM A;  5DPW A;  3K9P B;  3ZYY X;  3LJ3 A;  2L32 A;  4NQK E;  4ANX A;  2BW2 A;  1EU4 A;  2GBN A;  2O6V D;  2KNB A;  2V4L A;  1D4B A;  3AM9 A;  4LNN A;  2BQQ A;  3L54 A;  3U7Z A;  3Q3J A;  1UZX B;  4J6I A;  2CS4 A;  3VTW A;  2IO3 B;  2C7H A;  2JSV X;  2XK5 A;  4WQO B;  3DVN V;  1C4A A;  3PT2 B;  3V3X A;  1V1P B;  1KOT A;  2R2O A;  1IUE A;  3FC4 A;  5G5G A;  2NCN A;  2D11 A;  3PS6 A;  3DVN U;  1F9J A;  3WA0 A;  2MWS B;  2DYB A;  4NZL B;  2N9K A;  2BWF A;  2NR2 A;  4G50 A;  3TL5 A;  1AAR A;  1H8C A;  1FD6 A;  1FMA D;  3CF6 E;  2GMI C;  4WJN A;  1OQY A;  4XWT A;  3DBH I;  1DOX A;  3FIL B;  2WNM A;  3ZGZ A;  1WM2 A;  2CR5 A;  1T0R C;  4C4V B;  4HRO A;  4M8N A;  4RM8 A;  3PLV A;  4BOS C;  1WX8 A;  3HM3 A;  1FXA A;  3NS1 A;  5FK9 C;  4A90 A;  1WY8 A;  1Q1O A;  3Q8F A;  5G2N A;  5JZE B;  4IG7 B;  1VZ7 A;  3IT6 B;  1LGR A;  3QWZ B;  3UQA A;  5BMI A;  3CMM B;  2ZNV C;  1D5Z C;  2PTL A;  3GB1 A;  2INP E;  4MM3 B;  1L6U A;  1D6E C;  3V61 A;  1L2N A;  1SE4 A;  1GPX A;  3U7D A;  5CHF A;  3WAM A;  2KQ7 A;  1NYR A;  1OEY A;  1WZ3 A;  4AS1 A;  3VAW A;  1V8C A;  1V9J A;  2LGX A;  2VZK B;  2ZEQ A;  4IDI A;  1M94 A;  3DHI C;  3RD2 A;  5D3I B;  2CHW A;  4TUU A;  3AH7 A;  1GOZ A;  2KAN A;  4W9J A;  1J7A A;  1WXQ A;  2KOX A;  2LGD A;  3IXS A;  4AUQ C;  4YWG G;  1HZ5 A;  2G1E A;  2MSE D;  1XD3 B;  1CQV A;  5CHW A;  1IYF A;  4XGA B;  1PDX A;  1WXA A;  3MC0 B;  3KW5 B;  2D3G A;  2K39 A;  3GP7 A;  3AU5 A;  4KZC A;  2J42 A;  4MGY E;  3AUL A;  3CIR B;  3R2T A;  1S3S G;  2XNA C;  4OVU A;  3UI3 A;  3ENE A;  1CMX B;  3U8Z A;  3PTF C;  3V62 A;  4A3P A;  1GC7 A;  2DAJ A;  3PRP B;  2DYM A;  2A4Z A;  3QHT A;  2K8C A;  1UD7 A;  2RMM A;  1RRB A;  1N60 A;  1CZP A;  3DOW A;  2D2Q A;  1WXM A;  5AUK A;  3AE3 B;  3DCG A;  3RNA C;  4L23 A;  5AZG A;  4S17 A;  2WX1 A;  2YLM A;  4DHJ B;  3WAN A;  2M1M A;  2R2Q A;  1V6E A;  2NBU A;  3JSV B;  4KSK C;  3L4P A;  3P4P B;  4MJS A;  2W54 A;  2HJ8 A;  4HJK A;  4II3 B;  4USA A;  1E7P B;  1WF9 A;  3LYY A;  2ICI A;  3C8Y A;  5IKC M;  1I35 A;  3MC8 A;  3NJT A;  1ZXI A;  3L0W B;  1GNU A;  3QA8 A;  2FE8 A;  2QC8 A;  4RFB A;  1IGD A;  4F1S A;  2KYW A;  1JW9 D;  2QDF A;  2Q5W D;  1FNU A;  3ZUN A;  2KHW B;  2DZJ A;  2E6X A;  3RMK C;  1NEK B;  4FJY A;  1UH6 A;  3FKY A;  2LVO A;  4WJO A;  2NTT A;  4ZRK A;  3ZTC A;  5KHQ A;  4II2 B;  4JWU C;  3DBL B;  4NNJ B;  3ZJV A;  5EE9 A;  2DX5 B;  1TKG A;  3L17 A;  4NAW B;  2BB6 A;  5D94 A;  3RPF C;  2WXQ A;  4RNA A;  2MHJ A;  4BBN C;  2KMA A;  4GB9 A;  2IO1 B;  1L4Z B;  4FHK A;  4XWW A;  2IO0 B;  2K8H A;  1R4M B;  1WGD A;  3ZVV A;  4K7W A;  1SJH D;  4P7I A;  5CTR C;  1V5T A;  1L5P A;  4OZA A;  3PGE A;  4IWQ A;  1M4V A;  3T8M A;  4A55 A;  1JQ4 A;  1OQR A;  1XQQ A;  1ZDX A;  3DBS A;  2NBW B;  3NS8 A;  2WYQ A;  5CX3 A;  5JXV A;  2L83 A;  4WIP A;  1OEY J;  4AQ7 A;  4BKG A;  2NMQ A;  1Q0W B;  1EWC A;  3RI7 C;  4WJP A;  2PVG C;  1WYG A;  4CQN A;  1LFD A;  3MP9 A;  1IBX A;  4ZRP A;  3VRB B;  3X23 A;  2G4D B;  3AEG B;  5LNK 1;  4IC7 B;  1MHH E;  3SU8 X;  2PE9 A;  3A33 B;  1YD8 U;  4YXD B;  1RM6 C;  2FUG 1;  1K50 A;  1VR9 A;  1J7C A;  3PV1 A;  1YN5 A;  5IOI A;  5HFY A;  3Q6B A;  1ZW7 A;  4EUT A;  2DNF A;  2JU6 X;  2OHF A;  1TBE A;  2H89 B;  1CJE A;  3ZRC A;  1S1Q B;  4OZB A;  2NS5 A;  3I9V 1;  1WIA A;  3AEA B;  2AQ3 B;  2K9X A;  3S2A A;  2KWU B;  3A9K B;  1XLP A;  2ZCB A;  4DDG D;  1PQS A;  2WXG A;  3AEB B;  1P7E A;  4YTP B;  1STE A;  4FHJ A;  2VH1 A;  2J7Q B;  2FCS A;  2FIF A;  4EKU A;  3SR6 A;  2SEB D;  1KF6 B;  4J3O D;  4L1B A;  3Q3F A;  5E6P A;  3PRM B;  1UBQ A;  3N1X C;  2CU1 A;  3JVZ X;  1WFY A;  3ONS A;  3KYD D;  3L10 B;  3AEF B;  1TS3 A;  1YMH E;  1F2R I;  3J9C A;  3APD A;  5BYR A;  1KTK A;  1EO6 A;  4BBN F;  1XO3 A;  3KH0 A;  3BII D;  1C79 A;  1WXS A;  2KDF B;  4WWP A;  4K7U A;  3P63 A;  1WWT A;  1N62 A;  2Y5C A;  2WXJ A;  2KWC A;  4DHZ E;  2MP2 B;  2V9H A;  4HRS A;  3RZF A;  2N9L A;  2GBR A;  1C1Y B;  4MEL A;  4AWJ A;  4IM0 A;  4ICV A;  2ZCC A;  5E6N A;  2FNJ B;  1GUA B;  2YEP B;  4ANW A;  2HTH A;  4BKT A;  1QOB A;  2KO3 A;  2FCM A;  1BML C;  1I4H A;  2WXK A;  3H8H A;  4BAX A;  4BKS D;  2MJ3 A;  3AE7 B;  4HLE A;  3IFW B;  4GDL A;  3Q8A A;  1YIW A;  4GXB A;  3A9J A;  1EU3 A;  4LNK A;  2JYE A;  4ANV A;  2WXL A;  4REZ A;  1SE2 A;  3QIJ A;  4ICU A;  2BS2 B;  4AJY B;  3M63 B;  4M01 A;  1K53 A;  5FKA C;  2D10 A;  2QIE B;  4ITK A;  3IAM 1;  3AE9 B;  3P4R B;  1V1O A;  1WI0 A;  3BYT B;  4XX5 A;  1MHX A;  2XK5 B;  4KGT A;  3SD5 A;  2K3U A;  4KVG B;  2JY6 A;  3HUI A;  2MBO A;  2B3A A;  3Q2A C;  4WWN A;  4EFO A;  4DQO C;  1WJ6 A;  1FIQ A;  3AB5 A;  4G0N B;  3RNG C;  1I4R A;  2I1K A;  2JVC A;  1OGW A;  2ZW1 A;  3N30 A;  1VDV A;  2KC2 A;  3P2B A;  3Q14 C;  3Q8C A;  2K0P A;  2KXJ A;  4PYZ A;  1P3Q U;  4IWP A;  3M62 B;  1P0R A;  1BT0 A;  3QAQ A;  2GRI A;  2EEL A;  3X0W A;  4UDU C;  3HM6 X;  3PHX B;  3DBL I;  1F1H A;  3QC8 B;  3DBR B;  1QIL A;  2N9P C;  1E8Y A;  2NPT A;  1E6E B;  2IBI B;  2BT6 A;  4JX1 C;  1P7F A;  2AQ1 B;  3AED B;  3R66 C;  4XYC A;  1SIJ A;  1V2Y A;  1R4M I;  2EMS A;  4PYU A;  4LK0 M;  1VLB A;  3RYT A;  4W9L A;  1WRI A;  4KZ0 A;  4OW0 A;  3L08 A;  2WXI A;  1I4P A;  1R7S A;  4DXA B;  5BMH A;  2PKO A;  4M8M A;  3C19 A;  3UIP B;  1PGB A;  4ZRJ A;  1QOF A;  4HKZ E;  3TEY A;  1NBF C;  4W9H A;  4LDT D;  4ARI A;  3RFZ B;  1WE6 A;  2MJE A;  3GS2 A;  1GJZ A;  3UQB A;  1NYQ A;  2KFK A;  3APC A;  4KDL B;  2J52 A;  3TMP B;  1MG8 A;  3ZJT A;  2YEP F;  2IPK D;  3TSS A;  1I4Q A;  1HZ6 A;  2FUH B;  4RF0 A;  2WDV B;  3T3O A;  5EE0 A;  4G11 A;  3EFU A;  4HJG E;  4OHJ A;  1MG4 A;  3OWE B;  2LJI A;  5IA7 A;  1JRP A;  4TQ0 A;  1V80 A;  4DHZ B;  2LD9 A;  4P16 A;  2ZPY A;  3OAW A;  1FRD A;  2M0X A;  1TIF A;  2N9E B;  1T5X D;  3RNB C;  1MFW A;  2ON8 A;  3M95 A;  2AX5 A;  1V81 A;  3DVG X;  3AXC A;  4KKI A;  5IP4 D;  4ZRQ A;  4GOC A;  4ZYN A;  3MHZ A;  1P98 A;  1XLN A;  3B0A A;  2KTR A;  3A1Q A;  2LAS A;  5EE3 A;  2WU5 B;  4FA6 A;  1YJI A;  3I5J C;  3MC9 A;  1JRO A;  5C1Z A;  4N6E B;  2G45 B;  2GLS A;  5AZF A;  2IGD A;  4RGO S;  3Q3O C;  3PLU A;  3Q8B A;  1XCQ L;  4OVZ A;  2JPH A;  3ZRF A;  2KDB A;  2B76 B;  2BVC A;  1J19 A;  1ROE A;  2LHE A;  1SIF A;  3ZNH B;  2VRR B;  1GG3 A;  4G3X B;  2PMV A;  5C2T B;  4I6L B;  1AWD A;  2V0G A;  1WJU A;  1TT5 B;  2JRH A;  2ZNV B;  1WYW B;  3AMZ A;  2M56 B;  2LMC A;  3IBE A;  4FBJ B;  4W9I A;  1WX9 A;  2KLG A;  4MJS B;  1K8R B;  2KN5 A;  4EZJ A;  5C3J B;  3U30 A;  2BBC A;  2N7D A;  3C0R B;  3U52 E;  2CKH B;  1JWS D;  5JH5 C;  4W9F A;  2XEW A;  1SE3 A;  4MH0 E;  3GOE A;  1P9D U;  5H92 C;  1L4D B;  2RDB C;  3WIM A;  2WXF A;  2MBE A;  4YTM B;  1RAX A;  3NVZ A;  2M0A A;  1UGM A;  2HE7 A;  2J4X A;  2WXO A;  1FFU A;  2K8B A;  1UGJ A;  5JHB A;  2HTM E;  1LXD A;  5AZH A;  1V97 A;  2BKF A;  3P4S B;  3PZ7 A;  2Y3A A;  2BPS A;  4L2Y A;  2SAK A;  4CYE A;  1UEL A;  3RNE C;  2WXP A;  2KJR A;  3IVF A;  4US9 A;  3BK1 A;  3RUI B;  3H7P A;  1V1P A;  2INC C;  2C7N B;  4AOF A;  4W9K A;  1TZ1 A;  4HKQ A;  3DPD A;  5CHV C;  3AEC B;  3RN9 C;  4C7Y A;  1UWM A;  3M3J A;  2KX3 A;  1ZE3 D;  1ENF A;  1T0S C;  2N7E A;  4F8C B;  3SEB A;  4RF1 A;  1TTN A;  4YL8 A;  2FCN A;  4I6N B;  2G9H D;  2MLB A;  2R61 A;  4YSX B;  3FIL A;  3Q3M C;  1B9R A;  1TY2 A;  1NI3 A;  4C4V A;  1I4X A;  2PPH A;  2ZW0 A;  3PO0 A;  3DBR I;  1Z5S B;  4P1C C;  4A6Q A;  3AN1 A;  3VRA B;  3V6C B;  3ZNI D;  3SDL C;  2PW9 A;  1C77 A;  4YT0 B;  1OTR B;  2RSU A;  1Y8R C;  2AQ2 B;  1L0X B;  1UNS A;  3NZU A;  4MM3 A;  4XZ4 A;  2Z0D B;  3ZXV A;  2V3P A;  4IKG A;  3PHW B;  1FXT B;  2W3R A;  4W9C A;  3EA6 A;  4M00 A;  2LGY A;  3SHQ A;  3MHS D;  3NY5 A;  1T0Y A;  2PJH A;  2V3S A;  3WAP A;  5KHO A;  4NJC A;  2AWT A;  2I38 A;  2N7J A;  2KDI A;  2ZVN A;  1QOA A;  4WAF A;  3L16 A;  2RPV A;  1RFK A;  3I63 C;  4FXC A;  1YQB A;  3U2S C;  1BXT A;  4Q2J A;  4RMA A;  3TCA A;  2KQ4 X;  2QCZ A;  1WGK A;  3AE4 B;  2KT7 A;  5E6J A;  4GIV A;  2L05 A;  1WM3 A;  3B08 A;  4LNI A;  2BTE A;  5IAA C;  4XC2 A;  2OJW A;  2JWZ A;  4F7Z A;  1RLF A;  3EUB 2;  2L1A A;  5DCN A;  2Z59 B;  4KGR A;  3V6E B;  4C56 C;  4LNO A;  2L0F A;  5HG2 A;  1E10 A;  1N6Z A;  2LHD A;  2LUM A;  2HJ1 A;  2LRW A;  3URY A;  3JYU A;  2KJ6 A;  3VTV A;  3EHV A;  2FCQ A;  1SF0 A;  3DWG C;  4P6V F;  3I3T B;  2LUE A;  2X38 A;  4YTN B;  5J2R A;  1N5X A;  1L0Y B;  3KUD B;  4KX6 B;  4MGZ E;  3H9D A;  1TY0 A;  4RGT A;  3VUY A;  2IDY A;  3Q69 A;  5DPR A;  3TBL D;  4WUR A;  5GMV A;  3ZJU A;  2HD5 B;  1N63 A;  1IP9 A;  4ZYS A;  1ACC A;  1WRD B;  1B1Z A;  2JX5 A;  2AL6 A;  2RDG A;  2C7M B;  3BYY B;  4PS3 A;  2WS3 B;  5EDS A;  3AE2 B;  4O1N A;  3ZW3 A;  3H1U A;  2WXR A;  4GSW A;  3HIZ A;  3B9J A;  4M02 A;  4DK5 A;  2LGS A;  2N4F A;  2X8X X;  1ET9 A;  1K52 A;  3JSV A;  3ZDT A;  3VVW B;  2WXH A;  2RGF A;  1ESF A;  1XT9 B;  2PIA A;  3W1Y A;  3P4Q B;  1XF5 L;  1EF5 A;  3NHE B;  2D07 B;  1WZ0 A;  2QSD A;  4KGS A;  2M8S A;  4JGH B;  3A4R A;  1E8Z A;  3GE3 C;  1SJE D;  4ARC A;  5AEK B;  1YX6 B;  2MW5 A;  3NG0 A;  4KIK B;  1TKE A;  1KLU D;  2M4N A;  1T3Q A;  4C7Z A;  1MVK A;  1TJE A;  3PVL A;  2PVO D;  1VJK A;  3NVV A;  2K22 A;  1Z2M A;  3VXW A;  2QHO A;  4HPL B;  1FNW A;  5MPO A;  4NAW A;  4NJ6 A;  4NY0 A;  1GAQ B;  5I4D A;  2N9X A;  4TKN A;  4ZRI A;  1UUP A;  2NPT B;  4LDT B;  4RH6 A;  4M0W A;  1YQ4 B;  2W82 A;  3E56 A;  1A70 A;  1WE7 A;  3V60 A;  1E8W A;  1HE8 A;  3ML8 A;  3N20 C;  2Z0E B;  2RR9 A;  1LM8 B;  4RGN A;  5FR6 A;  3N32 A;  4GDK B;  1FCL A;  4FLH A;  1F0Z A;  1PGX A;  1FO4 A;  2QIL A;  1QT9 A;  1IGC A;  2L3Z A;  1D5X C;  2BKR B;  4DXG A;  3ECI A;  1KRH A;  3N1Z C;  4TV3 A;  2H88 B;  2BYF A;  2N1W A;  3OG5 A;  4B9K A;  3CSF A;  1D3Z A;  2DZK A;  3ZQ4 A;  2KC1 A;  3B1L X;  1C4C A;  3AE6 B;  2CU3 A;  4LJP B;  3BVG A;  1YX5 B;  4DWF A;  4ANU A;  4EZL A;  4MDK E;  1K51 A;  2D3B A;  1UF0 A;  2WGS A;  1XEE A;  1E9M A;  2MBB B;  3KWL A;  3TJP A;  2KD0 A;  4W9E A;  2KX0 A;  2KAC A;  4JQW C;  4K3C A;  1E8X A;  3HRD D;  2RDH A;  3A9K A;  3R2I A;  1SSN A;  2KK8 A;  3NZ3 A;  1F77 A;  1P1A A;  2JT4 B;  3AV8 A;  1WR1 A;  4DXF A;  4NJ7 A;  1SEB D;  2FID A;  2V1Y A;  1EUV B;  2J0K A;  2PLP A;  2CHZ A;  3QJZ A;  3OJ4 B;  4XDC A;  4N59 A;  2KTR B;  3EC8 A;  3ZDM C;  3AE5 B;  4DDI D;  1A5R A;  1PGA A;  3NOB A;  3KUC B;  3RUL A;  1JWA D;  4JE3 B;  2LXC A;  3ZXR A;  1WMH A;  4NPN A;  1VCB A;  1KM7 A;  1PUT A;  2LJ5 A;  4K1R B;  1RYJ A;  4TSS A;  5HHD G;  1J8C A;  1WGG A;  4A8X C;  1SGH A;  4FJZ A;  1WR6 E;  1U4A A;  3ABV B;  1GB1 A;  4HK2 A;  2L76 A;  1I7H A;  3UGB B;  2KFJ A;  4MGK E;  2D3A A;  1KH0 A;  4N58 A;  2BYT A;  2CJO A;  1DYQ A;  1YN3 A;  3UIO B;  2LXA A;  3E9S A;  3TUO A;  4PS7 A;  3MJ5 A;  3GZN I;  2KVZ A;  2MP2 A;  4HWI B;  2O6V A;  1TYG B;  2IND C;  5G55 A;  3HVZ A;  2L52 A;  4JIO U;  1NVI D;  4C80 A;  1HEZ E;  2DZM A;  1ZUD 2;  1WXV A;  2WDT B;  4I6P A;  3W5V B;  1UWX A;  3CST A;  1JAL A;  1DOI A;  2LZ6 A;  4XE0 A;  5J17 A;  1C76 A;  2ACZ B;  2ZVO A;  1Y56 A;  4NQL B;  2UU7 A;  4B95 A;  2ZJD A;  3NRZ A;  4JL9 A;  4YSY B;  4NAM A;  3EEC A;  2L8J A;  1QZE A;  4AJW A;  1FNV A;  1E0Z A;  1OQQ A;  1QF6 A;  4MH8 A;  2CJN A;  3OLM D;  3RT3 B;  4A9A A;  1ZP0 B;  1V49 A;  3NZS A;  4A20 A;  3LXF A;  4KSL C;  3EGR A;  3KVF B;  2JF5 A;  2WU2 B;  4A3O A;  2KN4 A;  4LNF A;  1TZO A;  2REX A;  1EF1 A;  1QQR A;  4WQM A;  3H7P B;  2J53 A;  1LQB A;  1KLG D;  4TMA B;  5H8Y E;  4H2A A;  4EEW A;  4US8 A;  2K6Q A;  3IHP C;  4C00 A;  5D6J B;  2PEA A;  3MTN B;  4BFR A;  4PT5 A;  4MAC A;  3ETR A;  1Q5W B;  4RCO A;  2Y5B B;  3TIX A;  1XLO A;  2IY1 B;  5L83 A;  2O2V A;  2AL3 A;  3BY4 B;  1X1M A;  3BVM A;  5T8I A;  2JQR B;  1C3T A;  2I1J A;  3MFG A;  2V3N A;  2GBJ A;  2GI9 A;  4PK1 A;  1WSP A;  4WH4 A;  2EMT A;  3ZLZ A;  2EKI A;  2KVR A;  2WQY B;  4DBG A;  5BMG A;  1DGJ A;  2KDM A;  4JWS C;  4WWM A;  2V4I B;  3A4S C;  3TEZ A;  2INN E;  3HK0 A;  2JUO A;  3VHT C;  3RCZ A;  3CWI A;  1YJJ A;  3Q3N C;  1JWU D;  3QX1 A;  3V05 A;  1V5O A;  1R4N B;  3IG3 A;  4WWO A;  2IZV B;  3VQI A;  1XLQ A;  4PS8 A;  2UYZ B;  4GLS C;  3R3M A;  2D5G A;  1UBI A;  4WAA A;  3W1S C;  3N3K B;  2BS3 B;  5D2M B;  4R3D A;  4JPS A;  3UIN B;  1QOG A;  2GB1 A;  5FR3 A;  3NVW A;  1PFD A;  2KAJ A;  3ALB A;  2MCN B;  1FM0 D;  2MA9 B;  2EKE C;  2JYT A;  2DZI A;  5LLI A;  1I42 A;  4CO7 A;  4N9F 4;  4IM2 A;  4BOZ B;  3AEE B;  2LVQ A;  4QAY A;  1C78 A;  1ZGU B;  4TQ1 A;  2K25 A;  2C9W B;  3KQ4 A;  4B0M A;  3PPA A;  2WP9 B;  2G3Q B;  1F2R C;  2MJD A;  2BGF A;  5DPS A;  2KWD A;  3Q8E A;  3RNF C;  1FCC C;  2GBK A;  1GB4 A;  2PE6 B;  1T0Q C;  4EOY A;  2OJR A;  4D2K A;  3VDZ A;  2E3T A;  4JLC A;  2KLC A;  2KTF A;  4HPP A;  3B2F A;  3WAO A;  3N1Y C;  1ZOY B;  2KMC A;  3BWU D;  3TEX A;  2Y5P A;  1VZ8 A;  2C5L C;  3P42 A;  1WJ4 A;  3JW0 X;  2LVP A;  1IBX B;  1CK1 A;  4KKJ A;  1TGZ B;  2M17 A;  3W5U B;  4FUL A;  2L0T A;  4OVV A;  2I2Y A;  1YOV B;  2K5P A;  4K81 A;  1L7Y A;  2L7R A;  2MRP A;  3UF8 A;  5AUI A;  1VRA B;  2RD0 A;  2AYO B;  1BUI C;  4X57 B;  4E3C A;  3NUH B;  3R8B A;  1RWS A;  5L95 C;  1XCT L;  4KDI C;  4RM9 A;  3W1S A;  3VUX A;  3BVZ A;  4MT5 A;  2BYV E;  3K9O B;  4RGM A;  3AE1 B;  3QAR A;  2BF8 B;  2D3C A;  3T3N A;  2KWV B;  3PZ8 A;  4B6W A;  2IGG A;  4ZHO A;  4HDQ A;  1FFV A;  2JRI B;  3DQV A;  1E5W A;  1JWM D;  4URK A;  1KLV A;  1VZ6 A;  4IUM B;  2WX0 A;  2KMM A;  5LXH A;  1LO5 D;  1C4P A;  2C60 A;  2GOW A;  2JZ3 B;  3T9L A;  3QCA A;  1N61 A;  1NEN B;  2KZR A;  1FRR A;  4GU2 A;  3VR8 B;  2KKC A;  4ZDV A;  3O13 A;  4HDO A;  5LXI B;  1HTO A;  3NVY A;  3EFC A;  1ZKH A;  3KWV A;  2CHX A;  2LRU A;  2DEN B;  2OED A;  4XDD A;  3PZD A;  4WJQ A;  2VZK D;  2ONQ A;  5TR5 A;  3PSE B;  3BIN A;  2Z8L A;  2AEH A;  1IPG A;  1HA5 A;  2IYD B;  2DWQ A;  2XBB C;  1ET6 A;  2DYO A;  4KV2 A;  3GZN B;  4ASW C;  2FBW B;  3VUW A;  4M0W B;  1SB3 C;  5DPT A;  4LLG M;  1FXI A;  3ZIM A;  4LJO B;  2IY0 B;  4P1B C;  4ZOH C;  5IN7 A;  3IAS 1;  2LI5 A;  3QK0 A;  2WXN A;  1HTQ A;  4W9G A;  4EE2 A;  4B0E A;  3DDC B;  1D5M C;  4BZA A;  2J0M A;  2MBQ A;  1JCK B;  4HXD A;  4CHK A;  4W9D A;  3U4E G;  3D32 A;  3TEW A;  4IM3 A;  3DWM A;  2IJ0 A;  4GDL B;  3A9J B;  3DVG Y;  1EWY C;  2KQS A;  3MJW A;  5BYS A;  2VH2 A;  2K6D B;  1WGY A;  1H4R A;  1L0V B;  2K1F A;  1JWB D;  4GN1 A;  3BK2 A;  1KFY B;  1OFF A;  1ZDV A;  2KJH B;  3AU4 A;  3HVD A;  4LCD E;  1R4N I;  4HCN B;  2WDR B;  2BS4 B;  4DHJ D;  1TS5 A;  2JWU A;  5IO9 A;  2DAF A;  2BYE A;  4FAD A;  1TKY A;  2ASQ A;  1HQR D;  2YVC A;  5EE1 A;  1F52 A;  4MEM A;  1E90 A;  3PRZ A;  2JXT A;  1WGR A;  3KUZ A;  4K3B A;  3H7S A;  2MQJ A;  4E71 A;  5C23 A;  5GXG B;  2JZZ A;  3APF A;  3AE8 B;  3VH4 B;  3DBH B;  1TS4 A;  3GE8 C;  3IT4 B;  3ZTD A;  4IW0 A;  3HHM A;  1MPE A;  5BO4 B;  4IOI E;  1J0G A;  1SE9 A;  2LEK A;  5D3D A;  1PYW D;  1HXY D;  4OZC A;  1ZPS A;  1FEH A;  1WMH B;  4MSQ B;  3WCQ A;  1J7B A;  1KJT A;  1AYF A;  1YJ1 A;  3LDZ E;  1C9F A;  2QJL A;  3ZNG C;  1XXG A;  2N1V A;  2WHI A;  1E7U A;  4FN2 A;  4GMV A;  2L00 B;  3RZW C;  3ML9 A;  2MEK A;  3BZD B;  3KYC D;  1V86 A;  4BKS A;  3OJ3 A;  4HCP B;  1GC6 A;  2DHZ A;  2N0S B;  3VFK A;  2WXM A;  2G4S A;  1ISN A;  3DHH C;  3ZNZ B;  1WX7 A;  4S0R A;  5E6O A;  2WLB A;  1JML A;  2WDQ B;  1RFA A;  2W3S A;  4HPM B;  2O6V B;  2MBH A;  2KFK B;  2MX2 A;  5G5H A;  2J0J A;  2BB5 A;  2LFI A;  5D7G A;  4HEA 1;  1JRU A; 
#chains in the Genus database with same CATH homology
 2NMQ A;  4MH8 A;  2CJN A;  2DLB A;  1EWC A;  4A9A A;  2PVG C;  4HKQ A;  1ZP0 B;  1WYG A;  3AEC B;  2NTS A;  4CQN A;  2XN9 C;  3LXF A;  4YSZ B;  5TSS A;  4C7Y A;  3EGR A;  1UWM A;  1ZE3 D;  3MP9 A;  1IBX A;  2WU2 B;  4ZRP A;  1ENF A;  2KN4 A;  3VRB B;  3AEG B;  1TZO A;  1QQR A;  3SEB A;  4RF1 A;  5LNK 1;  4WQM A;  1MHH E;  2J53 A;  4YXD B;  1KLG D;  1AN8 A;  1RM6 C;  2FUG 1;  1K50 A;  1VR9 A;  4TMA B;  2G9H D;  5H8Y E;  1J7C A;  2R61 A;  3SFD B;  4YSX B;  3FIL A;  1B9R A;  4H2A A;  2DBY A;  2M19 A;  1TY2 A;  4US8 A;  1YN5 A;  1NI3 A;  1I4X A;  5HFY A;  4ZHP A;  2ZW0 A;  1L6V A;  4PT5 A;  3PO0 A;  4MAC A;  2MH7 A;  5HI1 A;  2JU6 X;  2OHF A;  3ETR A;  4RCO A;  4LTU A;  1AW7 A;  2H89 B;  1CJE A;  1XLO A;  4OZB A;  2LGI A;  1TS2 A;  3AN1 A;  3I9V 1;  3VRA B;  1QKZ A;  4A6Q A;  3AEA B;  3N9Y C;  2AQ3 B;  2K9X A;  2PW9 A;  1C77 A;  4YT0 B;  3BVM A;  5T8I A;  2JQR B;  1QLB B;  1XLP A;  2AQ2 B;  1L0X B;  3MFG A;  2V3N A;  1MI0 A;  1UNS A;  2WXG A;  5BYQ A;  2GI9 A;  1SBB B;  1WSP A;  1P7E A;  2V3P A;  3AEB B;  4IKG A;  4WH4 A;  4YTP B;  1YQ3 B;  1STE A;  2JZP A;  2EKI A;  2W3R A;  1SXT A;  1Q10 A;  1YNT E;  2WQY B;  3EA6 A;  2QEJ C;  3SR6 A;  2SEB D;  1KF6 B;  5BMG A;  1DGJ A;  4J3O D;  1YN4 A;  2KDM A;  2W55 A;  4L1B A;  4JWS C;  4WWM A;  2V4I B;  3TEZ A;  2INN E;  4NJC A;  1EM7 A;  2I38 A;  3VR9 B;  3CWI A;  1YJJ A;  2N7J A;  1JWU D;  3V05 A;  3I57 A;  1QOA A;  4WAF A;  2RPV A;  3B2G A;  3VQI A;  1RFK A;  3AEF B;  1DOY A;  1XLQ A;  4FXC A;  2TSS A;  1TS3 A;  4GLS C;  1YMH E;  3U2S C;  1BXT A;  1F2R I;  2D5G A;  3J9C A;  4Q2J A;  2KQ4 X;  5BYR A;  1WGK A;  2BS3 B;  3AE4 B;  1KTK A;  4R3D A;  4JPS A;  5E6J A;  2IGH A;  1XO3 A;  1QOG A;  2GB1 A;  5FR3 A;  1T6B X;  3BII D;  3NVW A;  2BTE A;  3SFE B;  1PFD A;  2KAJ A;  1FM0 D;  1C79 A;  2JYT A;  3EUB 2;  2L1A A;  4KGR A;  3FAH A;  4C56 C;  5HG2 A;  2QMT A;  3P63 A;  1WWT A;  1E10 A;  1N62 A;  1N5W A;  3KLS X;  2Y5C A;  3LB8 C;  2WXJ A;  3AEE B;  1I4G A;  3P1M A;  3W2D A;  2LHD A;  2LUM A;  3URY A;  3W9C B;  1C78 A;  2HDE A;  1ZXH A;  4TQ1 A;  3KQ4 A;  4HRS A;  2N9L A;  4B0M A;  2WP9 B;  3ZYY X;  1F2R C;  2L32 A;  2MJD A;  2KWD A;  3Q8E A;  1SF0 A;  2BW2 A;  3DWG C;  4P6V F;  1EU4 A;  2X38 A;  2YEP B;  4YTN B;  1D4B A;  1QOB A;  3AM9 A;  1BML C;  1I4H A;  1FCC C;  1L0Y B;  1N5X A;  1GB4 A;  4KX6 B;  2WXK A;  3U7Z A;  3H8H A;  1TY0 A;  2MJ3 A;  4RGT A;  2IDY A;  3Q69 A;  3AE7 B;  2JSV X;  4WUR A;  4D2K A;  2E3T A;  3Q8A A;  3ZJU A;  1EU3 A;  2JYE A;  2WXL A;  1N63 A;  4ZYS A;  3B2F A;  1ACC A;  1C4A A;  4REZ A;  1SE2 A;  3V3X A;  1V1P B;  1ZOY B;  1B1Z A;  2BS2 B;  3BWU D;  1K53 A;  2JX5 A;  2RDG A;  1IUE A;  3BYY B;  2WS3 B;  3FC4 A;  3TEX A;  5G5G A;  5FKA C;  3AE2 B;  4O1N A;  2QIE B;  4ITK A;  2WXR A;  3IAM 1;  3AE9 B;  2Y5P A;  1VZ8 A;  3P4R B;  3B9J A;  3P42 A;  1V1O A;  1IBX B;  3BYT B;  4NZL B;  1MHX A;  2N9K A;  4KGT A;  1ET9 A;  1CK1 A;  1K52 A;  2K3U A;  4KKJ A;  2WXH A;  1ESF A;  2PIA A;  3W5U B;  3HUI A;  3P4Q B;  1XF5 L;  2I2Y A;  1FD6 A;  1FMA D;  2K5P A;  4XWT A;  4DQO C;  1DOX A;  2QSD A;  3FIL B;  2WNM A;  1FIQ A;  3AB5 A;  4KGS A;  3ZGZ A;  4HRO A;  5AUI A;  1VRA B;  1I4R A;  1BUI C;  2ZW1 A;  3NUH B;  3R8B A;  1RWS A;  1VDV A;  3Q8C A;  1XCT L;  2K0P A;  3W1S A;  3BVZ A;  4MT5 A;  1SJE D;  4ARC A;  1FXA A;  4RGM A;  3NS1 A;  2GRI A;  2EEL A;  4UDU C;  5FK9 C;  3AE1 B;  4A90 A;  1TKE A;  3T3N A;  1KLU D;  3Q8F A;  1T3Q A;  3PZ8 A;  1VZ7 A;  2IGG A;  4ZHO A;  3IT6 B;  1FFV A;  4C7Z A;  1MVK A;  1TJE A;  5BMI A;  1QIL A;  2PVO D;  1D5Z C;  1JWM D;  1E6E B;  1VJK A;  2PTL A;  2BT6 A;  3GB1 A;  2INP E;  4JX1 C;  4MM3 B;  1L6U A;  1D6E C;  1P7F A;  2AQ1 B;  3NVV A;  2K22 A;  3AED B;  1VZ6 A;  1SIJ A;  1SE4 A;  1GPX A;  1FNW A;  4LK0 M;  2KMM A;  5MPO A;  1VLB A;  1LO5 D;  1C4P A;  1WRI A;  1GAQ B;  5I4D A;  4OW0 A;  1NYR A;  1N61 A;  2WXI A;  1I4P A;  1NEN B;  1FRR A;  1R7S A;  3VR8 B;  4AS1 A;  3O13 A;  5BMH A;  2PKO A;  1V8C A;  3NVY A;  1UUP A;  3KWV A;  2VZK B;  4RH6 A;  4IDI A;  4M0W A;  5D3I B;  1PGB A;  1YQ4 B;  1QOF A;  2OED A;  2W82 A;  4HKZ E;  4XDD A;  3TEY A;  3AH7 A;  1GOZ A;  3E56 A;  1A70 A;  2VZK D;  2ONQ A;  4ARI A;  3RFZ B;  1J7A A;  1WXQ A;  2Z8L A;  4RGN A;  3IXS A;  2MJE A;  3GS2 A;  4GDK B;  1FCL A;  1NYQ A;  1F0Z A;  1PGX A;  1HA5 A;  4YWG G;  1HZ5 A;  2G1E A;  2J52 A;  2DWQ A;  1FO4 A;  1CQV A;  1ET6 A;  2DYO A;  3ZJT A;  2YEP F;  2IPK D;  2QIL A;  1QT9 A;  3TSS A;  1I4Q A;  1IGC A;  1HZ6 A;  1PDX A;  2FBW B;  3MC0 B;  4RF0 A;  2WDV B;  3T3O A;  5EE0 A;  1SB3 C;  1D5X C;  4HJG E;  4DXG A;  4LLG M;  4OHJ A;  3GP7 A;  1FXI A;  1KRH A;  3OWE B;  2J42 A;  2LJI A;  4ZOH C;  3CIR B;  3R2T A;  1JRP A;  4TQ0 A;  2H88 B;  3IAS 1;  2XNA C;  4P16 A;  2WXN A;  3UI3 A;  1FRD A;  3ZQ4 A;  1T5X D;  4EE2 A;  1C4C A;  4B0E A;  2DYM A;  3AE6 B;  2CU3 A;  2ON8 A;  3BVG A;  1D5M C;  2AX5 A;  2RMM A;  1JCK B;  1N60 A;  3U4E G;  1K51 A;  1CZP A;  4KKI A;  3TEW A;  1XEE A;  1E9M A;  3KWL A;  3DWM A;  2IJ0 A;  4GDL B;  4ZRQ A;  5AUK A;  3AE3 B;  3MHZ A;  1XLN A;  2KAC A;  1EWY C;  5EE3 A;  5BYS A;  2WU5 B;  3HRD D;  1L0V B;  1YJI A;  2RDH A;  3R2I A;  4L23 A;  1JWB D;  1SSN A;  3NZ3 A;  1F77 A;  3BK2 A;  1KFY B;  1JRO A;  3AV8 A;  4N6E B;  4DXF A;  1OFF A;  2IGD A;  4RGO S;  1ZDV A;  1SEB D;  3Q8B A;  1XCQ L;  4OVZ A;  3HVD A;  2B76 B;  2PLP A;  4XDC A;  2WDR B;  1ROE A;  2BS4 B;  4N59 A;  2LHE A;  3L4P A;  3P4P B;  1TS5 A;  2W54 A;  3AE5 B;  2JWU A;  1PGA A;  2PMV A;  4USA A;  1E7P B;  1JWA D;  4JE3 B;  5C2T B;  1TKY A;  3LYY A;  1AWD A;  2V0G A;  1HQR D;  5EE1 A;  2ICI A;  3C8Y A;  1PUT A;  2JXT A;  3AMZ A;  2M56 B;  2LMC A;  1RYJ A;  4TSS A;  5HHD G;  1ZXI A;  4A8X C;  2FE8 A;  5GXG B;  4RFB A;  1IGD A;  3AE8 B;  1TS4 A;  1JW9 D;  3ABV B;  1GB1 A;  3IT4 B;  5C3J B;  1MPE A;  2BBC A;  1I7H A;  2Q5W D;  4IOI E;  5D3D A;  2LEK A;  1KH0 A;  1FNU A;  1PYW D;  4N58 A;  2BYT A;  2CJO A;  1HXY D;  1DYQ A;  2E6X A;  3U52 E;  1YN3 A;  1NEK B;  1JWS D;  1FEH A;  1ZPS A;  4OZC A;  3WCQ A;  3E9S A;  3TUO A;  2NTT A;  1J7B A;  1SE3 A;  3MJ5 A;  1AYF A;  4JWU C;  1C9F A;  2QJL A;  5H92 C;  3ZJV A;  1XXG A;  5EE9 A;  1L4D B;  1TKG A;  4NAW B;  3RPF C;  2BB6 A;  2WXF A;  2WXQ A;  4RNA A;  4YTM B;  1TYG B;  3NVZ A;  2M0A A;  3HVZ A;  2J4X A;  2WXO A;  2L52 A;  1L4Z B;  1FFU A;  2MEK A;  4XWW A;  3BZD B;  1NVI D;  1UGJ A;  4C80 A;  1HEZ E;  1ZUD 2;  2HTM E;  2N0S B;  2WXM A;  3W5V B;  1UWX A;  1SJH D;  1V97 A;  1JAL A;  1L5P A;  4OZA A;  1DOI A;  3P4S B;  3PZ7 A;  4XE0 A;  2Y3A A;  2WLB A;  1JML A;  1M4V A;  4A55 A;  2WDQ B;  4L2Y A;  1JQ4 A;  2W3S A;  1C76 A;  2SAK A;  1OQR A;  2ACZ B;  1ZDX A;  1Y56 A;  2WXP A;  5G5H A;  4US9 A;  2BB5 A;  2LFI A;  3BK1 A;  3NRZ A;  4YSY B;  4NAM A;  1V1P A;  5JXV A;  2L83 A;  1FNV A;  4WIP A;  1E0Z A;  4AQ7 A;  1OQQ A;  5D7G A;  1QF6 A;  4HEA 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...