2ZW0A

Crystal structure of a streptococcal protein g b1 mutant
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
MDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANEHGVDGEWTYDPETKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein LG
publication title Optimizing pH response of affinity between protein G and IgG Fc: how electrostatic modulations affect protein-protein interactions.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2zw0A00
2I38A 4IOIE 3MP9A 2QSDA 2LGIA 1FD6A 2KQ4X 1PGBA 5HHDG 1K50A 4KGSA 1P7EA 1D4BA 4KGRA 2IGHA 2EELA 5HI1A 1K52A 2ONQA 1QKZA 2JU6X 2PW9A 4KGTA 3V3XA 1XF5L 2N9LA 1K51A 3FILA 1MVKA 3UI3A 2IGGA 5BMIA 2KWDA 2J53A 4OZAA 2N9KA 1YNTE 2ZW1A 4GLSC 5BMHA 4IKGA 2RPVA 2PTLA 4HKZE 2LHEA 2JSVX 4OZCA 1K53A 2J52A 5HG2A 1XCTL 4HJGE 2KDMA 2KN4A 5BMGA 2JWUA 1FCLA 5HFYA 1C9FA 4MACA 1F2RI 1PGXA 1XCQL 2GI9A 1IGCA 2QMTA 1IBXA 2N7JA 2GB1A 1EM7A 1HZ6A 2ZW0A 2K0PA 2JZPA 2NMQA 1YMHE 1FCCC 1F2RC 4D2KA 1UWXA 3GB1A 4WH4A 1MI0A 1HEZE 5JXVA 2KACA 1GB1A 3FILB 1JMLA 2LHDA 1IGDA 1KH0A 1IBXB 1MHXA 1Q10A 2PLPA 2ON8A 1MHHE 2RMMA 2JXTA 1P7FA 2LUMA 1ZXHA 2IGDA 2I2YA 2OEDA 1MPEA 1HZ5A 1GB4A 4OZBA 1PGAA
chains in the Genus database with same CATH superfamily
3PLUA 3A9KB 1SXTA 2YEPB 4JPSA 4M02A 4II2B 3U7ZA 3ZJUA 3VFKA 3TJPA 1STEA 2W3SA 3DBHI 2D10A 4C4VB 4KIKB 2GLSA 2VZKB 1E7UA 1N6ZA 1PYWD 4WJQA 1QT9A 3URYA 3SU8X 1V6EA 4MGZE 2O6VB 2WXLA 1SIJA 3QIJA 5CX3A 1AWDA 2NBVB 2RPVA 3HIZA 4EZLA 1EU4A 2J52A 3NHEB 3NY5A 3MTNB 3ZTDA 2DYBA 4BFRA 4ANUA 1UH6A 2GMIC 4YTMB 3K9OB 4P1BC 3ZNID 2WHIA 4WURA 1SIFA 1KM7A 3Q2AC 2LJIA 1HEZE 2WXRA 2QC8A 2LWPA 2ACZB 3Q3NC 1C4AA 2WXPA 1HQRD 2KWCA 3H6NA 3ZVVA 4X57B 2KTRA 3L54A 3DHHC 2ZNVC 2LUMA 2AWTA 1VDVA 5BYQA 3Q8EA 1WE7A 4XZ4A 1TY0A 3IFWB 4E3CA 1WIAA 5BYSA 1SJHD 3N1ZC 3A9JA 1CQVA 3Q3OC 3HHMA 3M62B 1EWCA 3ML8A 1R4MI 3GZNB 4K7UA 1T0SC 3NZSA 2YLMA 4LJPB 3ENEA 3JSVB 5CHWA 4K7SA 3RNGC 2WU2B 5E6JA 4AP4C 1XF5L 3P4QB 1FXIA 2I1KA 3DHIC 3PS6A 1XEEA 3P4SB 2C9WB 4FJZA 2CU3A 5FR3A 2QIEB 1TJEA 3VUXA 3AEEB 2K6QA 4FLHA 1LM8B 5EDSA 2KJ6A 1WX9A 3ML9A 2RPQA 2M0XA 2KTFA 3OJ4B 2ZJDA 3JW0X 1C9FA 3TEZA 2D3GA 1F2RI 1XCQL 3VR8B 3QJZA 2EMTA 3IG3A 3VTUA 3NJTA 1LXDA 3UQBA 3UIOB 2JRHA 2LGDA 2KKCA 3PREA 2NBWB 2K8CA 5TSSA 2JXXA 1FCCC 4FADA 3B08A 4WH4A 2WDRB 3IT6B 2LMCA 4A20A 3AU4A 4IM3A 1IBXB 4N58A 1GJZA 3QK0A 1VRAB 3TEWA 3A9KA 1P0RA 5T8IA 1XXGA 2E6XA 3GS2A 2MHJA 5DPRA 3FKYA 4AOFA 5E6OA 2DZJA 4MGYE 2KX3A 4C4VA 3NZ3A 3ZRCA 2CJNA 2QCZA 2LGYA 2MJDA 1ISNA 4GMVA 3SDLC 3V6CB 3ZQ4A 2OJWA 1I4HA 4KGSA 1FO4A 2NR2A 2FNJB 4CQNA 1XLPA 5IA7A 4TQ1A 2JVCA 3CSTA 3BYYB 2ZCCA 3M95A 4ARCA 1U4AA 2R2OA 4KX6B 3L13A 3AE1B 1R7SA 4TQ0A 3Q69A 4HK2A 3PHWB 3L17A 3Q3MC 5LNK1 4TUUA 1A5RA 3ZXRA 4HKZE 3ZW3A 3B2FA 2WX0A 4RFBA 2V9HA 2BS2B 4RGMA 3W5VB 3MFGA 2DWQA 2DBYA 4XGAB 4IDIA 4DDGD 2Y3AA 4WAAA 1L5PA 4BKTA 4AS1A 3HM3A 3PTFC 3U52E 1FEHA 2JZPA 3P2BA 1CZPA 2FCSA 1ZOYB 3M63B 4B6WA 1IYFA 3KWLA 5I4DA 5GMVA 2O2VA 2LD9A 2A4ZA 3CSFA 1GC7A 3EGRA 2AL6A 4WIPA 1MI0A 5JXVA 3NG0A 2KACA 1FNVA 1V80A 3RNEC 3AM9A 3RI7C 3C19A 1YX6B 4ZOHC 3WAPA 3R66C 3T3OA 3V60A 2XNAC 2KNBA 4NY0A 3JSVA 4YTPB 2IGDA 4W9IA 4GIVA 2INCC 2WU5B 4I6LB 3QQ8B 3SHQA 1BMLC 2J0JA 1L0XB 2G45B 3NZUA 1HZ5A 1Q1OA 1WZ0A 2LGXA 3QX1A 1C77A 3Q3JA 2CHWA 1Z5SB 3H1UA 4A55A 3U4EG 2QSDA 4XDCA 1FD6A 5HHDG 1FFUA 2L7RA 2IJ0A 4YXDB 5D94A 4AJWA 1K52A 5JHBA 1V8CA 2HTHA 5JH5C 2KDFB 1SE2A 2Y5BB 3I5JC 4ZRPA 4CO7A 3GZNI 3MHZA 4XC2A 5E6PA 3Q8BA 4LTUA 3EA6A 1EUVB 2ICIA 3CWIA 1YNTE 2ZW1A 4M8NA 2DX5B 4YTNB 2N9PC 2J4XA 4KSKC 1KLVA 3JYUA 3N1YC 2KMMA 3PRPB 3GOEA 5C23A 4G3XB 2MA9B 2JWUA 2DZIA 5IAAC 3Q8FA 1LFDA 1TZ1A 2XEWA 3WCQA 1IBXA 2N7EA 1KTKA 2KLGA 4A8XC 2MCNB 1GPXA 3TEYA 3KUDB 4ANXA 4JL9A 3ZGZA 3N30A 2M0AA 1J7CA 5CTRC 4I6PA 3ZO5B 2XK5A 3RMKC 3Q3FA 3PGEA 4KZ0A 2MLBA 2NVUI 5DCNA 4HCNB 1MHXA 1JW9D 1I4RA 3APCA 4M8MA 1AN8A 4NPNA 1C4CA 2J0MA 3OG5A 2BYEA 2LZ6A 4I6NB 2CS4A 5L83A 2WXQA 5LXIB 1WY8A 2EKEC 2KWVB 4L2YA 1V1OA 1TS4A 3BINA 2LVQA 3PZDA 1D4BA 3PO0A 4ITKA 1I4XA 1E5WA 2KLCA 3IXSA 3BK2A 3U7DA 5D3IB 2WXNA 2GRIA 4US9A 3H8HA 4XE0A 2I1JA 3VVWB 4E71A 4W9HA 1C3TA 1BT0A 2N9KA 4W9CA 2INDC 2N1VA 2KTRB 4NAMA 4DXGA 2BWES 2JSVX 2BTEA 1XCTL 3DBSA 4WAFA 3B9JA 2GBKA 1F9JA 1E8ZA 3ZJVA 4GU2A 4FN2A 3W1YA 1YN5A 2WQYB 4BZAA 2XBBC 4C00A 1EM7A 3A9JB 2WDQB 2W82A 1I42A 4II3B 1L7YA 3QHTA 4FA6A 4HPPA 2GBMA 3AULA 2MBHA 1M4VA 3RYTA 1KLGD 1JWMD 1I4GA 4NQLB 2KVRA 4HDOA 2UYZB 2K22A 2AYOB 1R4NB 1NBFC 1BUIC 4HVBA 3L0WB 1WXVA 3WALA 2C7HA 4EUTA 2I2YA 3VDZA 2BS3B 3BVGA 3VQIA 3UIPB 2AQ3B 4K3BA 5BYRA 1RYJA 2HTME 1E0ZA 1SGHA 1RFAA 2IO2B 4LJOB 2KZRA 1GG3A 1S1QB 3DBLB 3DPDA 4HWIB 5C2TB 1HE8A 1UZXB 2RR9A 4WJOA 3K9PB 4ZDVA 3MC8A 3I3TB 2KQ4X 1TTNA 1EU3A 3EECA 2IDYA 2L0TA 2PVOD 2VH1A 3QARA 4IWPA 2R61A 2ONQA 4PK1A 1S3SG 1WR6E 1ZDXA 4YWGG 1FXTB 1K51A 4G11A 1TIFA 2AEHA 4YT0B 4MH8A 3L4PA 2MBQA 1HXYD 1FNUA 2WGSA 3R2TA 3KH0A 1NDDA 5DPSA 2KANA 3MC9A 2K39A 1P3QU 3P1MA 1VLBA 1TS3A 1NI2A 1FCLA 5HFYA 3PZ7A 3V62A 2PMVA 1F77A 2L52A 4TMAB 1D6EC 1OGWA 4HEA1 3HM6X 1UF0A 3MC0B 1HZ6A 4F7ZA 1YN3A 2FIDA 4LDTB 1D5XC 3RFZB 2Z0EB 2L8JA 2B3AA 2OJRA 2JQRB 4LNFA 2JY6A 4IM2A 3U30A 4PYUA 4KKIA 4JWSC 4TV3A 4A9AA 1F0ZA 2JWZA 3ZLZA 2N4FA 4MH0E 4AJYB 1ZUD2 3AEGB 1YJIA 4B9KA 1ZXHA 2RD0A 2JPHA 5AUKA 1XLNA 1YOVB 2TSSA 4DDID 2W9NA 2L3ZA 1DOXA 1WJ6A 3MP9A 1WSPA 2J0KA 2WWZA 4KGRA 1ZKHA 2DENB 1YJJA 4JLCA 1QKZA 4HKQA 2LRWA 1T0QC 4KGTA 2SEBD 2O2VB 1TGZB 1UBIA 3FILA 4WWMA 4C7ZA 4ANVA 2X8XX 2FUG1 1LGRA 1E10A 3AEAB 4J3OD 4XWTA 1JWSD 1K53A 2CHXA 2LRUA 1QLBB 3OJ3A 4RCOA 1DOIA 3N3KB 1WXSA 3J9CA 4ARIA 1TKYA 3RN9C 2ZNVB 3IVFA 1UD7A 4PYZA 1D3ZA 2CHZA 2KFJA 2NMQA 5G2NA 1YMHE 1TZOA 4RM9A 3AE8B 2LEKA 3MJ5A 4D2KA 3I63C 3IT4B 3TIXA 3MJWA 5EE1A 3DOWA 2LUEA 3BK1A 2M56B 5FK9C 2HDEA 1OQYA 2DHZA 1MFWA 2ASQA 2LHDA 2BPSA 1WRIA 1QOGA 2KXJA 1E9MA 2N9XA 2A5UA 4BVUC 2IZVB 3AXCA 3H9DA 3X0WA 1XD3B 3ABVB 3E56A 2BGFA 2BYFA 2K8HA 1SEBD 1I4QA 2MJEA 2WXFA 2Y5PA 4OZBA 4P6VF 5E6NA 3AB5A 2V1YA 3ZJTA 1OEYA 2M4NA 5L95C 2KYWA 1KLUD 3TBLD 1V1PB 1QOFA 4GGQA 1P7EA 5IO9A 4KV2A 4N59A 2QJLA 5HKHA 5IN7A 4A3PA 3OAWA 2UU7A 2BKRB 3WAMA 3OWEB 3BIID 3BYTB 2BQQA 5AZFA 2XK5B 4YSYB 5DPWA 2N9LA 1JWAD 3UI3A 1JCKB 2IGGA 2EKIA 2D3AA 1ZPSA 3ZIMA 1QZEA 2VH2A 4F8CB 4EFOA 3RNAC 2ZEQA 1XO3A 2BBCA 1QQRA 2VRRB 4HJGE 4HPMB 2KK8A 2PEAA 4RH6A 1L4ZB 1IGCA 2KO3A 3ZDMC 2IYDB 4BAXA 3QA8A 1J0GA 3AE6B 2DZMA 3KYCD 3EHVA 5G5GA 4HXDA 4GB9A 2MX2A 1EWYC 5H92C 4USAA 2KDEB 2BVCA 3BY4B 1E8XA 3ZYYX 3TMPB 3L08A 1IGDA 4RF1A 4XWWA 2K6DB 3HUIA 1F1HA 5IP4D 2DYMA 5EE3A 2CJOA 4IWQA 5GXGB 5AZGA 3R7RA 3VRBB 3V6EB 2DZKA 4MGIE 1YQBA 1ROEA 3AU5A 2FBWB 1IP9A 1HTQA 1SE4A 2BKFA 2KT7A 1WFYA 3UF8A 2QEJC 2BWFA 2L83A 3B0AA 3CIRB 1PGAA 4MSQB 4IOIE 2KAJA 3DHGC 4ZHOA 1UBQA 1RLFA 3BWUD 3LXFA 1YJ1A 3I57A 1GAQB 4ACFA 1GNUA 2FIFA 2CU1A 2FUHB 1QF6A 3AE3B 3I9V1 5C3JB 5BMIA 4FJVB 1WMHB 4F1SA 5BMHA 4KZCA 1FM0D 1XLQA 2KMAA 1E7VA 2PPHA 4OVUA 1RAXA 3ECIA 3PSEB 5D7GA 1L0YB 2QMTA 1L2NA 1VCBA 2IPKD 4JGHB 3U8ZA 4US8A 4E74A 1AW7A 1KOTA 1EF5A 3W5UB 2H89B 2BB6A 3EUB2 1QILA 3N20C 3AI5A 4AQ7A 1KRHA 2CKHB 4KDIC 3C0RB 4L23A 4RGTA 3ALBA 2N1WA 1PQSA 3MHSD 2BS4B 3DBHB 2WXMA 4LCDE 3PHXB 1JWUD 2KN5A 1V1PA 4FHJA 5CHVC 1ESFA 3RNBC 2WXOA 2KJRA 3RD2A 1P7FA 2Z8LA 4WWOA 1BXTA 1AYFA 3TEXA 4J6IA 1GB4A 2WXHA 2C7MB 1D5ZC 1JALA 2I38A 3BVMA 4B0MA 5CHFA 1WM3A 4LDTD 1VR9A 1K50A 2WLBA 1WJ4A 1WZ3A 2EELA 4KDLB 1SBBB 1OQQA 1VZ7A 2JU6X 3BZDB 2D2QA 4JIOU 3DVGY 5TR5A 2HE7A 2PJHA 1V49A 3IAS1 5AZHA 3L16A 1UGMA 2L76A 3W9CB 4OHJA 4L1BA 2J42A 1CMXB 4DXFA 1VD2A 2GBRA 5HG2A 3AE2B 1TS2A 3AE4B 5J17A 2B76B 4JQWC 4NAWA 5D2MB 2AL3A 3UQAA 3PV1A 2BYTA 1NENB 3TL5A 1E6EB 3HRDD 1J7BA 3PRZA 2K0PA 1GOZA 4RMAA 1ZGUB 4IUMB 2BYVE 4NJCA 3RPFC 4FHKA 2MP2B 4CHKA 1R4MB 3T3NA 4DHJD 1SB3C 1F2RC 3TUOA 1RWSA 2K1FA 3DQVA 1T5XD 2WDVB 4WJNA 2ZZPB 2N9EB 4FBJB 3O65B 4H2AA 3FILB 2PE9A 3Q6BA 4FXCA 1I7HA 4WQMA 3PLVA 3TCAA 4AWJA 3OLMD 3NS8A 2LVPA 3Q14C 3N1XC 2HJ8A 4S0RA 1TT5B 1OTRB 2KC2A 2MBOA 1YD8U 4LNOA 3A33B 3FAHA 3TSSA 1WMHA 1FXAA 2RDBC 2LASA 4HJKA 2JF5A 3SEBA 3D32A 3H7SA 4C80A 2JRIB 1PGBA 2MWSB 1IUEA 2NBUA 3EC8A 4PS7A 2DAFA 1NEKB 1N61A 1WJUA 2V3NA 3PT2B 1WI0A 2N7DA 4XYCA 3JVZX 2PW9A 4HDQA 3DVGX 4HRSA 1HA5A 4FJYA 4IW0A 4GN1A 1MVKA 1UWMA 1B9RA 4G50A 2LFIA 3NVWA 1WXAA 1P9DU 4DXAB 4NZLB 3IAM1 2AQ1B 1PUTA 3DVNV 1VJKA 5EE9A 4WWNA 2GBJA 1WRDB 3M3JA 2KDMA 2KN4A 1WYWB 3WAOA 4NNJB 4MEMA 4MACA 1V5TA 4C56C 2N7JA 1JQ4A 1FIQA 5AUIA 4ZYSA 1ET9A 4P1CC 4IC7B 4BBNF 1VZ6A 1C76A 4YSXB 1SSNA 2KX0A 3PVLA 3P4RB 1LQBA 1ZXIA 2ZPNA 2KJHB 1L6VA 1TS5A 2QHOA 3VTWA 4BKGA 4GXBA 2XN9C 1GB1A 3HK0A 4OVZA 4PS3A 1I4PA 5AEKB 4JE3B 3NUHB 2LXAA 2WS3B 4IWOA 1WGRA 2FAZA 3N32A 3ZNHB 3VRAB 1SF0A 2JZZA 1K8RB 2IBIB 3Q8CA 3LDZE 3KVFB 4N9F4 1WGGA 2V4LA 4MM3A 2RGFA 3S2AA 4M00A 1FRRA 1TKGA 3C8YA 3SD5A 2H88B 5LXHA 2BW2A 3RZWC 3DBRB 3NVVA 2LI5A 3O13A 3X23A 4RGNA 3KUCB 4W9FA 2PIAA 1E8YA 2YVCA 2INNE 4OVVA 2KD0A 2C60A 5G55A 2KMCA 3W2DA 3AV8A 2MP2A 3KUZA 3R7QA 3N9YC 2REXA 2V3PA 4GDLA 2G3QB 3V05A 3DVNU 1TKEA 3B2GA 4DHJB 1JRPA 1J19A 1IPGA 3AE7B 1L6UA 1ZDVA 4RM8A 1C78A 1QOAA 2K3UA 2G1EA 3IHPC 4TKNA 2EMSA 1UGJA 2FCQA 2BT6A 2Z59B 1C4PA 2KC1A 2UWQA 1T3QA 1F52A 2HJ1A 1EO6A 1WX8A 3E9SA 1L4DB 2M8SA 2MRPA 2KFKA 4LNKA 1KF6B 5KHOA 1Q5WB 1OQRA 3CF6E 3ZUNA 2W55A 1JMLA 4DWFA 4LLGM 2IO0B 4A3OA 5BO4B 3NVZA 2K25A 2IY0B 1WGDA 2L0FA 1NYRA 2D3BA 4W9JA 2PKOA 3A1QB 1MPEA 1TYGB 3A4SC 4BBNC 2FCMA 3ZXVA 3GE8C 1N5XA 1YIWA 1Q0WB 1WE6A 3DWMA 2NPTA 3ETRA 3ONSA 1FNWA 5KHQA 2ZVNA 1V5OA 4DHZE 3APFA 4REZA 1DYQA 4W9KA 4ICUA 3RNCC 4LNIA 1E90A 1QOBA 1ACCA 1WGYA 1HTOA 2NTTA 2KVZA 2LGSA 1R4NI 4B95A 4ZRQA 3LJ3A 4K1RB 3WANA 4G0NB 2J53A 3Q8AA 1TBEA 1T0RC 1WX7A 3SR6A 4HROA 4GLSC 2PTLA 3P63A 4NJ7A 4W9GA 3BVZA 4DQOC 4OZCA 3U2SC 3R2IA 2IO3B 2D3CA 1FMAD 4ASWC 4NQKE 3P4PB 2ZCBA 4KSLC 5JZEB 5IOIA 3DBLI 3WIMA 4MGKE 2KDIA 4BKSA 1GC6A 2V0GA 3RUIB 1Y8RC 3HVDA 1D5MC 2L00B 1UUPA 4A6QA 1PFDA 1CJEA 1AARA 1M94A 4ZRKA 1YQ4B 2NS5A 2BF8B 3RT3B 5D6JB 3RZFA 4KIKA 4BOSC 2ZPYA 4EZJA 4UDUC 2Y5CA 2O6VA 2PLPA 1L0VB 5G5HA 3B1LX 1FFVA 2ON8A 3ZDTA 2D5GA 2SAKA 4YSZB 3R8BA 3V61A 2D07B 3KYDD 3PRMB 1SE3A 2INPE 2JZ3B 1UNSA 2ZVOA 1XQQA 2RSUA 4S17A 3H7PB 2WNMA 4NAWB 2IO1B 1NI3A 2BB5A 3QAQA 2AQ2B 3NRZA 3NS1A 2IGHA 4HPLB 3VH4B 1N62A 3T8MA 3WA0A 1OEYJ 3DCGA 2MEKA 3DBRI 3GP7A 1H8CA 1WR1A 1ENFA 4MSMB 5LLIA 2C5LC 1TY2A 3RCZA 4M0WB 2JX5A 1E7PB 2MW5A 3LYYA 3QC8B 1UELA 1DGJA 4WQOB 1NYQA 1WJNA 1YQ3B 3SFDB 2MJ3A 3VH3B 3AECB 1XLOA 2M17A 2GB1A 1V9JA 2NTSA 1WGKA 1WH3A 5MPOA 1J7AA 2M1MA 1I35A 2G4SA 4O1NA 1WGHA 3AN1A 1Y56A 1FPYA 2MBEA 3A1QA 1RRBA 2LXCA 4LK0M 4BOZB 1V81A 1SJED 2Q5WD 1EF1A 2KOXA 4GDKB 1P1AA 3T9LA 2WP9B 4ZRJA 1X1MA 3W1SC 4Q2JA 4B0EA 1Q10A 4DBGA 3EFUA 4MELA 1KJTA 2K8BA 2V4IB 4ZYNA 1N5WA 2RMMA 2JXTA 4LNNA 4EE2A 2FCNA 4KKJA 1YN4A 5JHAA 3QWZB 4NJ6A 1A70A 4WJPA 2PE6B 1LO5D 2KQSA 4W9EA 2L1AA 5IKCM 4PS8A 2WXIA 4RF0A 3RNFC 1WXMA 2PVGC 2L32A 3ZRFA 4MJSB 3UINB 2IY1B 4GOCA 5HI1A 2QDFA 2MH7A 2JUOA 2AX5A 4ICVA 1MJDA 4JX1C 3ZNZB 4AUQC 4XX5A 2WXGA 3FC4A 4BKSD 2WYQA 5D3DA 4ZRIA 3PZ8A 4FULA 2WX1A 4EOYA 4OW0A 3IBEA 1WXQA 3GE3C 4M01A 2C7NB 3ZKJC 1T0YA 1Z2MA 2J7QB 5FKAC 2YEPF 2GBNA 2RDHA 2LHEA 2HD5B 1N60A 4P7IA 2JYTA 3P42A 2VZKD 1V86A 5BMGA 3VUWA 5J18A 1ZP0B 4IG7B 2MQJA 3A4RA 1PGXA 4EEWA 1N63A 2WXJA 2O6VD 3QCAA 1GUAB 4MM3B 2L05A 3AEBB 1JWBD 3VTVA 4JWUC 1T6BX 2WXKA 3KQ4A 4ANWA 4HLEA 2Z0DB 4RGOS 3DWGC 2OOBB 1G6JA 1MG8A 4EZKA 2KHWB 4YL8A 4ZHPA 3H7PA 1YX5B 2KQ7A 1JROA 2M19A 3NOBA 1MHHE 4XDDA 4URKA 2K5PA 4A90A 1PDXA 1XT9B 2DAJA 1ET6A 2QILA 3HVZA 1SE9A 2E3TA 4GDLB 5FR6A 3UGBB 4P16A 1C79A 4QAYA 3EFCA 4PT5A 3AEFB 2KDBA 1V97A 4K3CA 1FRDA 3VR9B 2GOWA 4W9DA 4W9LA 1OFFA 2LGIA 2FE8A 4M0WA 4MDKE 1H4RA 2OHFA 3V3XA 4RNAA 2LVOA 4DHZB 4GSWA 2DNFA 2LJ5A 4K81A 2JT4B 4HCPB 1WF9A 1RM6C 2KWDA 2KFKB 4MT5A 1V2YA 4OZAA 2DLBA 1C1YB 2G9HD 3RULA 3ZNGC 2K9XA 2G4DB 4IKGA 1NVID 1WWTA 3VAWA 2N0SB 1B1ZA 4GDKA 1ZW7A 3LB8C 3KW5B 1CK1A 2MBBB 2RDGA 1KFYB 1DOYA 3AEDB 1J8CA 2GI9A 2W54A 1RFKA 2X38A 1WYGA 4DK5A 2NPTB 2ZW0A 3ZTCA 4R3DA 5DPTA 4IM0A 3R3MA 3KLSX 5H8YE 3VUYA 4KVGB 2MSED 3AE9B 3AMZA 3AE5B 4K7WA 3CMMB 1UWXA 3L10B 3DDCB 3GB1A 3NVYA 2NCNA 3APDA 1E8WA 1VZ8A 3KWVA 2V3SA 1P98A 1MG4A 2W3RA 3PPAA 1WM2A 2R2QA 3SFEB 1KH0A 1JRUA 4TSSA 2DYOA 4MJSA 3W1SA 3VHTC 4C7YA 5EE0A 4WWPA 2OEDA 2D11A 2JYEA 2KWUB 3AH7A 4N6EB 2WDTB 2CR5A 3VXWA 4CYEA 4EKUA 1ZE3D 5J2RA 5C1ZA
chains in the Genus database with same CATH topology
3ETRA 4IOIE 2KAJA 4L2YA 1V1OA 1TS4A 4ZHOA 1FNWA 3BWUD 4REZA 1DYQA 1SXTA 2YEPB 4JPSA 3U7ZA 1D4BA 3PO0A 4ITKA 1I4XA 3ZJUA 3IXSA 3LXFA 1QOBA 3BK2A 1ACCA 1STEA 3I57A 1GAQB 2NTTA 5D3IB 2WXNA 2W3SA 2GRIA 4US9A 3H8HA 4XE0A 1QF6A 2VZKB 3AE3B 1PYWD 3I9V1 4ZRQA 1QT9A 5BMIA 5C3JB 3URYA 2J53A 3Q8AA 2N9KA 1SIJA 2WXLA 3SR6A 4HROA 4GLSC 1AWDA 5BMHA 1FM0D 2PTLA 2RPVA 3P63A 1XLQA 3BVZA 4NAMA 4OZCA 1EU4A 2JSVX 4DQOC 4DXGA 3U2SC 2BTEA 3R2IA 2J52A 1XCTL 1FMAD 4WAFA 3B9JA 3P4PB 3ZJVA 1YN5A 1L0YB 2WQYB 5D7GA 2V0GA 2QMTA 3HVDA 1D5MC 1EM7A 2IPKD 1UUPA 4A6QA 4US8A 1PFDA 1CJEA 2WDQB 4YTMB 2W82A 1YQ4B 1AW7A 3W5UB 2H89B 2BB6A 3EUB2 1QILA 4AQ7A 4WURA 1M4VA 1KRHA 1KLGD 4L23A 4RGTA 1JWMD 1I4GA 2LJIA 1HEZE 2WXRA 2ACZB 1C4AA 2K22A 4UDUC 2WXPA 2BS4B 2Y5CA 1HQRD 2WXMA 2PLPA 1JWUD 1V1PA 1L0VB 1BUIC 1ESFA 5G5HA 1FFVA 2ON8A 2WXOA 2D5GA 1P7FA 2SAKA 2Z8LA 2LUMA 4YSZB 3R8BA 2I2YA 1VDVA 2BS3B 3BVGA 3VQIA 5BYQA 1BXTA 2AQ3B 3Q8EA 1AYFA 1TY0A 3TEXA 1SE3A 2INPE 5BYRA 1RYJA 2HTME 1GB4A 1UNSA 1E0ZA 2WXHA 5BYSA 1SJHD 1D5ZC 1JALA 2WNMA 4NAWB 1CQVA 2I38A 3BVMA 5C2TB 4B0MA 1NI3A 1EWCA 2BB5A 1VR9A 2KQ4X 1K50A 2AQ2B 2WLBA 3NRZA 1EU3A 3NS1A 2IDYA 2IGHA 2PVOD 2EELA 2R61A 1SBBB 1OQQA 2ONQA 1N62A 1VZ7A 2JU6X 2WU2B 3BZDB 5E6JA 1XF5L 1ZDXA 4YWGG 3P4QB 1FXIA 1K51A 2MEKA 1XEEA 3GP7A 4YT0B 4MH8A 1ENFA 3L4PA 3P4SB 1HXYD 3IAS1 1FNUA 3R2TA 2CU3A 5FR3A 2QIEB 1TJEA 1TY2A 3W9CB 4OHJA 4L1BA 2J42A 4DXFA 3AEEB 2JX5A 1E7PB 3LYYA 5HG2A 3P1MA 1DGJA 3AE2B 1NYQA 1TS2A 1TS3A 1VLBA 1YQ3B 3AE4B 3SFDB 2MJ3A 3AECB 5HFYA 1FCLA 3PZ7A 1XLOA 2PMVA 2B76B 1C9FA 3TEZA 1F77A 2L52A 1F2RI 4TMAB 1XCQL 1D6EC 3VR8B 4HEA1 2GB1A 2NTSA 1WGKA 2BYTA 1NENB 1E6EB 3HRDD 1J7AA 3MC0B 1J7BA 1HZ6A 5MPOA 2K0PA 1GOZA 1YN3A 4NJCA 4O1NA 3RPFC 1D5XC 3T3NA 3RFZB 5TSSA 3AN1A 1Y56A 1FCCC 1SB3C 1F2RC 4LK0M 2JQRB 3TUOA 1RWSA 1SJED 2Q5WD 1T5XD 2WDVB 4WH4A 4GDKB 2WDRB 2WP9B 4KKIA 3IT6B 2LMCA 4JWSC 4H2AA 4Q2JA 3FILB 4B0EA 4A9AA 1IBXB 4N58A 1Q10A 1F0ZA 1VRAB 3TEWA 4FXCA 1I7HA 4WQMA 2V4IB 1ZUD2 5T8IA 1N5WA 1XXGA 3AEGB 2RMMA 2JXTA 1YJIA 2E6XA 4EE2A 3GS2A 1ZXHA 4KKJA 1YN4A 5AUKA 1XLNA 1A70A 2TSSA 3NZ3A 3FAHA 1LO5D 2CJNA 3TSSA 2L1AA 1DOXA 1FXAA 2MJDA 3SEBA 3MP9A 3ZQ4A 4C80A 1I4HA 1WSPA 1PGBA 2WXIA 4RF0A 4KGSA 1FO4A 2PVGC 1IUEA 4CQNA 2L32A 1XLPA 1NEKB 4KGRA 1YJJA 1N61A 5HI1A 4TQ1A 2MH7A 2V3NA 2AX5A 1QKZA 4HKQA 4JX1C 3BYYB 2PW9A 4KGTA 4ARCA 2SEBD 4HRSA 2WXGA 3FC4A 1HA5A 4KX6B 5D3DA 3PZ8A 3FILA 4WWMA 4C7ZA 3AE1B 1R7SA 2FUG1 1MVKA 3Q69A 1UWMA 4TQ0A 1B9RA 1E10A 2LFIA 3NVWA 4OW0A 1WXQA 4NZLB 5LNK1 3AEAB 4J3OD 4XWTA 5FKAC 3IAM1 2YEPF 1JWSD 2AQ1B 1PUTA 2RDHA 1VJKA 2LHEA 4HKZE 1N60A 1K53A 5EE9A 3B2FA 4RFBA 1QLBB 2JYTA 3P42A 2VZKD 4RCOA 2KDMA 2KN4A 5BMGA 2BS2B 1ZP0B 4RGMA 1DOIA 3W5VB 4MACA 4C56C 1PGXA 2DWQA 3MFGA 2DBYA 1N63A 3J9CA 2WXJA 4IDIA 1TKYA 4ARIA 2N7JA 1JQ4A 1FIQA 2Y3AA 4MM3B 1L5PA 3AEBB 1JWBD 5AUIA 4AS1A 3U52E 4JWUC 1FEHA 2JZPA 1ET9A 4ZYSA 1T6BX 2NMQA 2WXKA 3KQ4A 1CZPA 1ZOYB 1YMHE 1TZOA 1VZ6A 1C76A 3AE8B 4YSXB 1SSNA 3KWLA 5I4DA 4RGOS 2LEKA 3P4RB 3MJ5A 4D2KA 3IT4B 3DWGC 5EE1A 1ZXIA 1L6VA 1TS5A 3EGRA 4WIPA 3BK1A 1MI0A 2M56B 5JXVA 5FK9C 2HDEA 2KACA 2XN9C 1FNVA 4ZHPA 3AM9A 1GB1A 4OVZA 1JROA 2LHDA 2M19A 1I4PA 1WRIA 1QOGA 4ZOHC 1E9MA 3T3OA 1MHHE 3NUHB 4JE3B 4XDDA 2WS3B 2XNAC 2K5PA 4A90A 1PDXA 3ABVB 3E56A 4YTPB 2IGDA 3VRAB 1ET6A 1SF0A 2QILA 2WU5B 3HVZA 3Q8CA 2E3TA 4GDLB 1SEBD 1I4QA 2MJEA 1BMLC 4P16A 1C79A 1L0XB 2WXFA 1HZ5A 4PT5A 3AEFB 2Y5PA 4OZBA 1V97A 4P6VF 1FRDA 3AB5A 3ZJTA 1C77A 3VR9B 1FRRA 1TKGA 3C8YA 4A55A 1KLUD 2H88B 3U4EG 2QSDA 1OFFA 2LGIA 4XDCA 1V1PB 2BW2A 1FD6A 2FE8A 1FFUA 5HHDG 1QOFA 4M0WA 1P7EA 2IJ0A 3NVVA 4YXDB 4N59A 2QJLA 3O13A 1K52A 4RGNA 3OWEB 3BIID 1V8CA 2OHFA 3V3XA 3BYTB 4RNAA 4YSYB 1SE2A 2N9LA 4ZRPA 2PIAA 1JWAD 3MHZA 1RM6C 1JCKB 2INNE 2IGGA 3UI3A 2KWDA 3Q8BA 2EKIA 4LTUA 4MT5A 3EA6A 4OZAA 1ZPSA 2ICIA 2DLBA 3W2DA 2G9HD 3CWIA 1YNTE 2ZW1A 3AV8A 2K9XA 4YTNB 4IKGA 2J4XA 1NVID 1WWTA 3N9YC 1XO3A 2V3PA 2N0SB 2KMMA 3V05A 2BBCA 1QQRA 4HJGE 1B1ZA 3LB8C 2JWUA 1TKEA 3B2GA 1JRPA 1CK1A 2RDGA 3Q8FA 1KFYB 4RH6A 3AEDB 1L4ZB 1DOYA 3AE7B 2GI9A 1IGCA 2W54A 1RFKA 3WCQA 1IBXA 1L6UA 1ZDVA 1KTKA 2X38A 1WYGA 1C78A 4A8XC 1QOAA 2ZW0A 1GPXA 3TEYA 2K3UA 2G1EA 3AE6B 4R3DA 1UGJA 3ZGZA 3KLSX 5H8YE 2BT6A 1C4PA 2M0AA 5G5GA 3AE9B 1J7CA 3AMZA 3AE5B 1EWYC 1T3QA 1UWXA 5H92C 3GB1A 3NVYA 4USAA 1VZ8A 1L4DB 3E9SA 3KWVA 1KF6B 1OQRA 2W3RA 2W55A 3ZYYX 1JMLA 3SFEB 1IGDA 1KH0A 4LLGM 4RF1A 3HUIA 4XWWA 1MHXA 3NVZA 1JW9D 2DYMA 5EE3A 1I4RA 2CJOA 4TSSA 2DYOA 3W1SA 5GXGB 4C7YA 3VRBB 5EE0A 1AN8A 1C4CA 1NYRA 1ROEA 2OEDA 2PKOA 2JYEA 1MPEA 2FBWB 1SE4A 3AH7A 4N6EB 1TYGB 2WXQA 1N5XA 1ZE3D 2QEJC 2L83A 3CIRB 3DWMA 1PGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I38 A;  4IOI E;  3MP9 A;  2QSD A;  2LGI A;  1FD6 A;  2KQ4 X;  1PGB A;  5HHD G;  1K50 A;  4KGS A;  1P7E A;  1D4B A;  4KGR A;  2IGH A;  2EEL A;  5HI1 A;  1K52 A;  2ONQ A;  1QKZ A;  2JU6 X;  2PW9 A;  4KGT A;  3V3X A;  1XF5 L;  2N9L A;  1K51 A;  3FIL A;  1MVK A;  3UI3 A;  2IGG A;  5BMI A;  2KWD A;  2J53 A;  4OZA A;  2N9K A;  1YNT E;  2ZW1 A;  4GLS C;  5BMH A;  4IKG A;  2RPV A;  2PTL A;  4HKZ E;  2LHE A;  2JSV X;  4OZC A;  1K53 A;  2J52 A;  5HG2 A;  1XCT L;  4HJG E;  2KDM A;  2KN4 A;  5BMG A;  2JWU A;  1FCL A;  5HFY A;  1C9F A;  4MAC A;  1F2R I;  1PGX A;  1XCQ L;  2GI9 A;  1IGC A;  2QMT A;  1IBX A;  2N7J A;  2GB1 A;  1EM7 A;  1HZ6 A;  2ZW0 A;  2K0P A;  2JZP A;  2NMQ A;  1YMH E;  1FCC C;  1F2R C;  4D2K A;  1UWX A;  3GB1 A;  4WH4 A;  1MI0 A;  1HEZ E;  5JXV A;  2KAC A;  1GB1 A;  3FIL B;  1JML A;  2LHD A;  1IGD A;  1KH0 A;  1IBX B;  1MHX A;  1Q10 A;  2PLP A;  2ON8 A;  1MHH E;  2RMM A;  2JXT A;  1P7F A;  2LUM A;  1ZXH A;  2IGD A;  2I2Y A;  2OED A;  1MPE A;  1HZ5 A;  1GB4 A;  4OZB A;  1PGA A; 
#chains in the Genus database with same CATH topology
 3PLU A;  3A9K B;  1SXT A;  2YEP B;  4JPS A;  4M02 A;  4II2 B;  3U7Z A;  3ZJU A;  3VFK A;  3TJP A;  1STE A;  2W3S A;  3DBH I;  2D10 A;  4C4V B;  4KIK B;  2GLS A;  2VZK B;  1E7U A;  1N6Z A;  1PYW D;  4WJQ A;  1QT9 A;  3URY A;  3SU8 X;  1V6E A;  4MGZ E;  2O6V B;  2WXL A;  1SIJ A;  3QIJ A;  5CX3 A;  1AWD A;  2NBV B;  2RPV A;  3HIZ A;  4EZL A;  1EU4 A;  2J52 A;  3NHE B;  3NY5 A;  3MTN B;  3ZTD A;  2DYB A;  4BFR A;  4ANU A;  1UH6 A;  2GMI C;  4YTM B;  3K9O B;  4P1B C;  3ZNI D;  2WHI A;  4WUR A;  1SIF A;  1KM7 A;  3Q2A C;  2LJI A;  1HEZ E;  2WXR A;  2QC8 A;  2LWP A;  2ACZ B;  3Q3N C;  1C4A A;  2WXP A;  1HQR D;  2KWC A;  3H6N A;  3ZVV A;  4X57 B;  2KTR A;  3L54 A;  3DHH C;  2ZNV C;  2LUM A;  2AWT A;  1VDV A;  5BYQ A;  3Q8E A;  1WE7 A;  4XZ4 A;  1TY0 A;  3IFW B;  4E3C A;  1WIA A;  5BYS A;  1SJH D;  3N1Z C;  3A9J A;  1CQV A;  3Q3O C;  3HHM A;  3M62 B;  1EWC A;  3ML8 A;  1R4M I;  3GZN B;  4K7U A;  1T0S C;  3NZS A;  2YLM A;  4LJP B;  3ENE A;  3JSV B;  5CHW A;  4K7S A;  3RNG C;  2WU2 B;  5E6J A;  4AP4 C;  1XF5 L;  3P4Q B;  1FXI A;  2I1K A;  3DHI C;  3PS6 A;  1XEE A;  3P4S B;  2C9W B;  4FJZ A;  2CU3 A;  5FR3 A;  2QIE B;  1TJE A;  3VUX A;  3AEE B;  2K6Q A;  4FLH A;  1LM8 B;  5EDS A;  2KJ6 A;  1WX9 A;  3ML9 A;  2RPQ A;  2M0X A;  2KTF A;  3OJ4 B;  2ZJD A;  3JW0 X;  1C9F A;  3TEZ A;  2D3G A;  1F2R I;  1XCQ L;  3VR8 B;  3QJZ A;  2EMT A;  3IG3 A;  3VTU A;  3NJT A;  1LXD A;  3UQB A;  3UIO B;  2JRH A;  2LGD A;  2KKC A;  3PRE A;  2NBW B;  2K8C A;  5TSS A;  2JXX A;  1FCC C;  4FAD A;  3B08 A;  4WH4 A;  2WDR B;  3IT6 B;  2LMC A;  4A20 A;  3AU4 A;  4IM3 A;  1IBX B;  4N58 A;  1GJZ A;  3QK0 A;  1VRA B;  3TEW A;  3A9K A;  1P0R A;  5T8I A;  1XXG A;  2E6X A;  3GS2 A;  2MHJ A;  5DPR A;  3FKY A;  4AOF A;  5E6O A;  2DZJ A;  4MGY E;  2KX3 A;  4C4V A;  3NZ3 A;  3ZRC A;  2CJN A;  2QCZ A;  2LGY A;  2MJD A;  1ISN A;  4GMV A;  3SDL C;  3V6C B;  3ZQ4 A;  2OJW A;  1I4H A;  4KGS A;  1FO4 A;  2NR2 A;  2FNJ B;  4CQN A;  1XLP A;  5IA7 A;  4TQ1 A;  2JVC A;  3CST A;  3BYY B;  2ZCC A;  3M95 A;  4ARC A;  1U4A A;  2R2O A;  4KX6 B;  3L13 A;  3AE1 B;  1R7S A;  4TQ0 A;  3Q69 A;  4HK2 A;  3PHW B;  3L17 A;  3Q3M C;  5LNK 1;  4TUU A;  1A5R A;  3ZXR A;  4HKZ E;  3ZW3 A;  3B2F A;  2WX0 A;  4RFB A;  2V9H A;  2BS2 B;  4RGM A;  3W5V B;  3MFG A;  2DWQ A;  2DBY A;  4XGA B;  4IDI A;  4DDG D;  2Y3A A;  4WAA A;  1L5P A;  4BKT A;  4AS1 A;  3HM3 A;  3PTF C;  3U52 E;  1FEH A;  2JZP A;  3P2B A;  1CZP A;  2FCS A;  1ZOY B;  3M63 B;  4B6W A;  1IYF A;  3KWL A;  5I4D A;  5GMV A;  2O2V A;  2LD9 A;  2A4Z A;  3CSF A;  1GC7 A;  3EGR A;  2AL6 A;  4WIP A;  1MI0 A;  5JXV A;  3NG0 A;  2KAC A;  1FNV A;  1V80 A;  3RNE C;  3AM9 A;  3RI7 C;  3C19 A;  1YX6 B;  4ZOH C;  3WAP A;  3R66 C;  3T3O A;  3V60 A;  2XNA C;  2KNB A;  4NY0 A;  3JSV A;  4YTP B;  2IGD A;  4W9I A;  4GIV A;  2INC C;  2WU5 B;  4I6L B;  3QQ8 B;  3SHQ A;  1BML C;  2J0J A;  1L0X B;  2G45 B;  3NZU A;  1HZ5 A;  1Q1O A;  1WZ0 A;  2LGX A;  3QX1 A;  1C77 A;  3Q3J A;  2CHW A;  1Z5S B;  3H1U A;  4A55 A;  3U4E G;  2QSD A;  4XDC A;  1FD6 A;  5HHD G;  1FFU A;  2L7R A;  2IJ0 A;  4YXD B;  5D94 A;  4AJW A;  1K52 A;  5JHB A;  1V8C A;  2HTH A;  5JH5 C;  2KDF B;  1SE2 A;  2Y5B B;  3I5J C;  4ZRP A;  4CO7 A;  3GZN I;  3MHZ A;  4XC2 A;  5E6P A;  3Q8B A;  4LTU A;  3EA6 A;  1EUV B;  2ICI A;  3CWI A;  1YNT E;  2ZW1 A;  4M8N A;  2DX5 B;  4YTN B;  2N9P C;  2J4X A;  4KSK C;  1KLV A;  3JYU A;  3N1Y C;  2KMM A;  3PRP B;  3GOE A;  5C23 A;  4G3X B;  2MA9 B;  2JWU A;  2DZI A;  5IAA C;  3Q8F A;  1LFD A;  1TZ1 A;  2XEW A;  3WCQ A;  1IBX A;  2N7E A;  1KTK A;  2KLG A;  4A8X C;  2MCN B;  1GPX A;  3TEY A;  3KUD B;  4ANX A;  4JL9 A;  3ZGZ A;  3N30 A;  2M0A A;  1J7C A;  5CTR C;  4I6P A;  3ZO5 B;  2XK5 A;  3RMK C;  3Q3F A;  3PGE A;  4KZ0 A;  2MLB A;  2NVU I;  5DCN A;  4HCN B;  1MHX A;  1JW9 D;  1I4R A;  3APC A;  4M8M A;  1AN8 A;  4NPN A;  1C4C A;  2J0M A;  3OG5 A;  2BYE A;  2LZ6 A;  4I6N B;  2CS4 A;  5L83 A;  2WXQ A;  5LXI B;  1WY8 A;  2EKE C;  2KWV B;  4L2Y A;  1V1O A;  1TS4 A;  3BIN A;  2LVQ A;  3PZD A;  1D4B A;  3PO0 A;  4ITK A;  1I4X A;  1E5W A;  2KLC A;  3IXS A;  3BK2 A;  3U7D A;  5D3I B;  2WXN A;  2GRI A;  4US9 A;  3H8H A;  4XE0 A;  2I1J A;  3VVW B;  4E71 A;  4W9H A;  1C3T A;  1BT0 A;  2N9K A;  4W9C A;  2IND C;  2N1V A;  2KTR B;  4NAM A;  4DXG A;  2BWE S;  2JSV X;  2BTE A;  1XCT L;  3DBS A;  4WAF A;  3B9J A;  2GBK A;  1F9J A;  1E8Z A;  3ZJV A;  4GU2 A;  4FN2 A;  3W1Y A;  1YN5 A;  2WQY B;  4BZA A;  2XBB C;  4C00 A;  1EM7 A;  3A9J B;  2WDQ B;  2W82 A;  1I42 A;  4II3 B;  1L7Y A;  3QHT A;  4FA6 A;  4HPP A;  2GBM A;  3AUL A;  2MBH A;  1M4V A;  3RYT A;  1KLG D;  1JWM D;  1I4G A;  4NQL B;  2KVR A;  4HDO A;  2UYZ B;  2K22 A;  2AYO B;  1R4N B;  1NBF C;  1BUI C;  4HVB A;  3L0W B;  1WXV A;  3WAL A;  2C7H A;  4EUT A;  2I2Y A;  3VDZ A;  2BS3 B;  3BVG A;  3VQI A;  3UIP B;  2AQ3 B;  4K3B A;  5BYR A;  1RYJ A;  2HTM E;  1E0Z A;  1SGH A;  1RFA A;  2IO2 B;  4LJO B;  2KZR A;  1GG3 A;  1S1Q B;  3DBL B;  3DPD A;  4HWI B;  5C2T B;  1HE8 A;  1UZX B;  2RR9 A;  4WJO A;  3K9P B;  4ZDV A;  3MC8 A;  3I3T B;  2KQ4 X;  1TTN A;  1EU3 A;  3EEC A;  2IDY A;  2L0T A;  2PVO D;  2VH1 A;  3QAR A;  4IWP A;  2R61 A;  2ONQ A;  4PK1 A;  1S3S G;  1WR6 E;  1ZDX A;  4YWG G;  1FXT B;  1K51 A;  4G11 A;  1TIF A;  2AEH A;  4YT0 B;  4MH8 A;  3L4P A;  2MBQ A;  1HXY D;  1FNU A;  2WGS A;  3R2T A;  3KH0 A;  1NDD A;  5DPS A;  2KAN A;  3MC9 A;  2K39 A;  1P3Q U;  3P1M A;  1VLB A;  1TS3 A;  1NI2 A;  1FCL A;  5HFY A;  3PZ7 A;  3V62 A;  2PMV A;  1F77 A;  2L52 A;  4TMA B;  1D6E C;  1OGW A;  4HEA 1;  3HM6 X;  1UF0 A;  3MC0 B;  1HZ6 A;  4F7Z A;  1YN3 A;  2FID A;  4LDT B;  1D5X C;  3RFZ B;  2Z0E B;  2L8J A;  2B3A A;  2OJR A;  2JQR B;  4LNF A;  2JY6 A;  4IM2 A;  3U30 A;  4PYU A;  4KKI A;  4JWS C;  4TV3 A;  4A9A A;  1F0Z A;  2JWZ A;  3ZLZ A;  2N4F A;  4MH0 E;  4AJY B;  1ZUD 2;  3AEG B;  1YJI A;  4B9K A;  1ZXH A;  2RD0 A;  2JPH A;  5AUK A;  1XLN A;  1YOV B;  2TSS A;  4DDI D;  2W9N A;  2L3Z A;  1DOX A;  1WJ6 A;  3MP9 A;  1WSP A;  2J0K A;  2WWZ A;  4KGR A;  1ZKH A;  2DEN B;  1YJJ A;  4JLC A;  1QKZ A;  4HKQ A;  2LRW A;  1T0Q C;  4KGT A;  2SEB D;  2O2V B;  1TGZ B;  1UBI A;  3FIL A;  4WWM A;  4C7Z A;  4ANV A;  2X8X X;  2FUG 1;  1LGR A;  1E10 A;  3AEA B;  4J3O D;  4XWT A;  1JWS D;  1K53 A;  2CHX A;  2LRU A;  1QLB B;  3OJ3 A;  4RCO A;  1DOI A;  3N3K B;  1WXS A;  3J9C A;  4ARI A;  1TKY A;  3RN9 C;  2ZNV B;  3IVF A;  1UD7 A;  4PYZ A;  1D3Z A;  2CHZ A;  2KFJ A;  2NMQ A;  5G2N A;  1YMH E;  1TZO A;  4RM9 A;  3AE8 B;  2LEK A;  3MJ5 A;  4D2K A;  3I63 C;  3IT4 B;  3TIX A;  3MJW A;  5EE1 A;  3DOW A;  2LUE A;  3BK1 A;  2M56 B;  5FK9 C;  2HDE A;  1OQY A;  2DHZ A;  1MFW A;  2ASQ A;  2LHD A;  2BPS A;  1WRI A;  1QOG A;  2KXJ A;  1E9M A;  2N9X A;  2A5U A;  4BVU C;  2IZV B;  3AXC A;  3H9D A;  3X0W A;  1XD3 B;  3ABV B;  3E56 A;  2BGF A;  2BYF A;  2K8H A;  1SEB D;  1I4Q A;  2MJE A;  2WXF A;  2Y5P A;  4OZB A;  4P6V F;  5E6N A;  3AB5 A;  2V1Y A;  3ZJT A;  1OEY A;  2M4N A;  5L95 C;  2KYW A;  1KLU D;  3TBL D;  1V1P B;  1QOF A;  4GGQ A;  1P7E A;  5IO9 A;  4KV2 A;  4N59 A;  2QJL A;  5HKH A;  5IN7 A;  4A3P A;  3OAW A;  2UU7 A;  2BKR B;  3WAM A;  3OWE B;  3BII D;  3BYT B;  2BQQ A;  5AZF A;  2XK5 B;  4YSY B;  5DPW A;  2N9L A;  1JWA D;  3UI3 A;  1JCK B;  2IGG A;  2EKI A;  2D3A A;  1ZPS A;  3ZIM A;  1QZE A;  2VH2 A;  4F8C B;  4EFO A;  3RNA C;  2ZEQ A;  1XO3 A;  2BBC A;  1QQR A;  2VRR B;  4HJG E;  4HPM B;  2KK8 A;  2PEA A;  4RH6 A;  1L4Z B;  1IGC A;  2KO3 A;  3ZDM C;  2IYD B;  4BAX A;  3QA8 A;  1J0G A;  3AE6 B;  2DZM A;  3KYC D;  3EHV A;  5G5G A;  4HXD A;  4GB9 A;  2MX2 A;  1EWY C;  5H92 C;  4USA A;  2KDE B;  2BVC A;  3BY4 B;  1E8X A;  3ZYY X;  3TMP B;  3L08 A;  1IGD A;  4RF1 A;  4XWW A;  2K6D B;  3HUI A;  1F1H A;  5IP4 D;  2DYM A;  5EE3 A;  2CJO A;  4IWQ A;  5GXG B;  5AZG A;  3R7R A;  3VRB B;  3V6E B;  2DZK A;  4MGI E;  1YQB A;  1ROE A;  3AU5 A;  2FBW B;  1IP9 A;  1HTQ A;  1SE4 A;  2BKF A;  2KT7 A;  1WFY A;  3UF8 A;  2QEJ C;  2BWF A;  2L83 A;  3B0A A;  3CIR B;  1PGA A;  4MSQ B;  4IOI E;  2KAJ A;  3DHG C;  4ZHO A;  1UBQ A;  1RLF A;  3BWU D;  3LXF A;  1YJ1 A;  3I57 A;  1GAQ B;  4ACF A;  1GNU A;  2FIF A;  2CU1 A;  2FUH B;  1QF6 A;  3AE3 B;  3I9V 1;  5C3J B;  5BMI A;  4FJV B;  1WMH B;  4F1S A;  5BMH A;  4KZC A;  1FM0 D;  1XLQ A;  2KMA A;  1E7V A;  2PPH A;  4OVU A;  1RAX A;  3ECI A;  3PSE B;  5D7G A;  1L0Y B;  2QMT A;  1L2N A;  1VCB A;  2IPK D;  4JGH B;  3U8Z A;  4US8 A;  4E74 A;  1AW7 A;  1KOT A;  1EF5 A;  3W5U B;  2H89 B;  2BB6 A;  3EUB 2;  1QIL A;  3N20 C;  3AI5 A;  4AQ7 A;  1KRH A;  2CKH B;  4KDI C;  3C0R B;  4L23 A;  4RGT A;  3ALB A;  2N1W A;  1PQS A;  3MHS D;  2BS4 B;  3DBH B;  2WXM A;  4LCD E;  3PHX B;  1JWU D;  2KN5 A;  1V1P A;  4FHJ A;  5CHV C;  1ESF A;  3RNB C;  2WXO A;  2KJR A;  3RD2 A;  1P7F A;  2Z8L A;  4WWO A;  1BXT A;  1AYF A;  3TEX A;  4J6I A;  1GB4 A;  2WXH A;  2C7M B;  1D5Z C;  1JAL A;  2I38 A;  3BVM A;  4B0M A;  5CHF A;  1WM3 A;  4LDT D;  1VR9 A;  1K50 A;  2WLB A;  1WJ4 A;  1WZ3 A;  2EEL A;  4KDL B;  1SBB B;  1OQQ A;  1VZ7 A;  2JU6 X;  3BZD B;  2D2Q A;  4JIO U;  3DVG Y;  5TR5 A;  2HE7 A;  2PJH A;  1V49 A;  3IAS 1;  5AZH A;  3L16 A;  1UGM A;  2L76 A;  3W9C B;  4OHJ A;  4L1B A;  2J42 A;  1CMX B;  4DXF A;  1VD2 A;  2GBR A;  5HG2 A;  3AE2 B;  1TS2 A;  3AE4 B;  5J17 A;  2B76 B;  4JQW C;  4NAW A;  5D2M B;  2AL3 A;  3UQA A;  3PV1 A;  2BYT A;  1NEN B;  3TL5 A;  1E6E B;  3HRD D;  1J7B A;  3PRZ A;  2K0P A;  1GOZ A;  4RMA A;  1ZGU B;  4IUM B;  2BYV E;  4NJC A;  3RPF C;  4FHK A;  2MP2 B;  4CHK A;  1R4M B;  3T3N A;  4DHJ D;  1SB3 C;  1F2R C;  3TUO A;  1RWS A;  2K1F A;  3DQV A;  1T5X D;  2WDV B;  4WJN A;  2ZZP B;  2N9E B;  4FBJ B;  3O65 B;  4H2A A;  3FIL B;  2PE9 A;  3Q6B A;  4FXC A;  1I7H A;  4WQM A;  3PLV A;  3TCA A;  4AWJ A;  3OLM D;  3NS8 A;  2LVP A;  3Q14 C;  3N1X C;  2HJ8 A;  4S0R A;  1TT5 B;  1OTR B;  2KC2 A;  2MBO A;  1YD8 U;  4LNO A;  3A33 B;  3FAH A;  3TSS A;  1WMH A;  1FXA A;  2RDB C;  2LAS A;  4HJK A;  2JF5 A;  3SEB A;  3D32 A;  3H7S A;  4C80 A;  2JRI B;  1PGB A;  2MWS B;  1IUE A;  2NBU A;  3EC8 A;  4PS7 A;  2DAF A;  1NEK B;  1N61 A;  1WJU A;  2V3N A;  3PT2 B;  1WI0 A;  2N7D A;  4XYC A;  3JVZ X;  2PW9 A;  4HDQ A;  3DVG X;  4HRS A;  1HA5 A;  4FJY A;  4IW0 A;  4GN1 A;  1MVK A;  1UWM A;  1B9R A;  4G50 A;  2LFI A;  3NVW A;  1WXA A;  1P9D U;  4DXA B;  4NZL B;  3IAM 1;  2AQ1 B;  1PUT A;  3DVN V;  1VJK A;  5EE9 A;  4WWN A;  2GBJ A;  1WRD B;  3M3J A;  2KDM A;  2KN4 A;  1WYW B;  3WAO A;  4NNJ B;  4MEM A;  4MAC A;  1V5T A;  4C56 C;  2N7J A;  1JQ4 A;  1FIQ A;  5AUI A;  4ZYS A;  1ET9 A;  4P1C C;  4IC7 B;  4BBN F;  1VZ6 A;  1C76 A;  4YSX B;  1SSN A;  2KX0 A;  3PVL A;  3P4R B;  1LQB A;  1ZXI A;  2ZPN A;  2KJH B;  1L6V A;  1TS5 A;  2QHO A;  3VTW A;  4BKG A;  4GXB A;  2XN9 C;  1GB1 A;  3HK0 A;  4OVZ A;  4PS3 A;  1I4P A;  5AEK B;  4JE3 B;  3NUH B;  2LXA A;  2WS3 B;  4IWO A;  1WGR A;  2FAZ A;  3N32 A;  3ZNH B;  3VRA B;  1SF0 A;  2JZZ A;  1K8R B;  2IBI B;  3Q8C A;  3LDZ E;  3KVF B;  4N9F 4;  1WGG A;  2V4L A;  4MM3 A;  2RGF A;  3S2A A;  4M00 A;  1FRR A;  1TKG A;  3C8Y A;  3SD5 A;  2H88 B;  5LXH A;  2BW2 A;  3RZW C;  3DBR B;  3NVV A;  2LI5 A;  3O13 A;  3X23 A;  4RGN A;  3KUC B;  4W9F A;  2PIA A;  1E8Y A;  2YVC A;  2INN E;  4OVV A;  2KD0 A;  2C60 A;  5G55 A;  2KMC A;  3W2D A;  3AV8 A;  2MP2 A;  3KUZ A;  3R7Q A;  3N9Y C;  2REX A;  2V3P A;  4GDL A;  2G3Q B;  3V05 A;  3DVN U;  1TKE A;  3B2G A;  4DHJ B;  1JRP A;  1J19 A;  1IPG A;  3AE7 B;  1L6U A;  1ZDV A;  4RM8 A;  1C78 A;  1QOA A;  2K3U A;  2G1E A;  3IHP C;  4TKN A;  2EMS A;  1UGJ A;  2FCQ A;  2BT6 A;  2Z59 B;  1C4P A;  2KC1 A;  2UWQ A;  1T3Q A;  1F52 A;  2HJ1 A;  1EO6 A;  1WX8 A;  3E9S A;  1L4D B;  2M8S A;  2MRP A;  2KFK A;  4LNK A;  1KF6 B;  5KHO A;  1Q5W B;  1OQR A;  3CF6 E;  3ZUN A;  2W55 A;  1JML A;  4DWF A;  4LLG M;  2IO0 B;  4A3O A;  5BO4 B;  3NVZ A;  2K25 A;  2IY0 B;  1WGD A;  2L0F A;  1NYR A;  2D3B A;  4W9J A;  2PKO A;  3A1Q B;  1MPE A;  1TYG B;  3A4S C;  4BBN C;  2FCM A;  3ZXV A;  3GE8 C;  1N5X A;  1YIW A;  1Q0W B;  1WE6 A;  3DWM A;  2NPT A;  3ETR A;  3ONS A;  1FNW A;  5KHQ A;  2ZVN A;  1V5O A;  4DHZ E;  3APF A;  4REZ A;  1DYQ A;  4W9K A;  4ICU A;  3RNC C;  4LNI A;  1E90 A;  1QOB A;  1ACC A;  1WGY A;  1HTO A;  2NTT A;  2KVZ A;  2LGS A;  1R4N I;  4B95 A;  4ZRQ A;  3LJ3 A;  4K1R B;  3WAN A;  4G0N B;  2J53 A;  3Q8A A;  1TBE A;  1T0R C;  1WX7 A;  3SR6 A;  4HRO A;  4GLS C;  2PTL A;  3P63 A;  4NJ7 A;  4W9G A;  3BVZ A;  4DQO C;  4OZC A;  3U2S C;  3R2I A;  2IO3 B;  2D3C A;  1FMA D;  4ASW C;  4NQK E;  3P4P B;  2ZCB A;  4KSL C;  5JZE B;  5IOI A;  3DBL I;  3WIM A;  4MGK E;  2KDI A;  4BKS A;  1GC6 A;  2V0G A;  3RUI B;  1Y8R C;  3HVD A;  1D5M C;  2L00 B;  1UUP A;  4A6Q A;  1PFD A;  1CJE A;  1AAR A;  1M94 A;  4ZRK A;  1YQ4 B;  2NS5 A;  2BF8 B;  3RT3 B;  5D6J B;  3RZF A;  4KIK A;  4BOS C;  2ZPY A;  4EZJ A;  4UDU C;  2Y5C A;  2O6V A;  2PLP A;  1L0V B;  5G5H A;  3B1L X;  1FFV A;  2ON8 A;  3ZDT A;  2D5G A;  2SAK A;  4YSZ B;  3R8B A;  3V61 A;  2D07 B;  3KYD D;  3PRM B;  1SE3 A;  2INP E;  2JZ3 B;  1UNS A;  2ZVO A;  1XQQ A;  2RSU A;  4S17 A;  3H7P B;  2WNM A;  4NAW B;  2IO1 B;  1NI3 A;  2BB5 A;  3QAQ A;  2AQ2 B;  3NRZ A;  3NS1 A;  2IGH A;  4HPL B;  3VH4 B;  1N62 A;  3T8M A;  3WA0 A;  1OEY J;  3DCG A;  2MEK A;  3DBR I;  3GP7 A;  1H8C A;  1WR1 A;  1ENF A;  4MSM B;  5LLI A;  2C5L C;  1TY2 A;  3RCZ A;  4M0W B;  2JX5 A;  1E7P B;  2MW5 A;  3LYY A;  3QC8 B;  1UEL A;  1DGJ A;  4WQO B;  1NYQ A;  1WJN A;  1YQ3 B;  3SFD B;  2MJ3 A;  3VH3 B;  3AEC B;  1XLO A;  2M17 A;  2GB1 A;  1V9J A;  2NTS A;  1WGK A;  1WH3 A;  5MPO A;  1J7A A;  2M1M A;  1I35 A;  2G4S A;  4O1N A;  1WGH A;  3AN1 A;  1Y56 A;  1FPY A;  2MBE A;  3A1Q A;  1RRB A;  2LXC A;  4LK0 M;  4BOZ B;  1V81 A;  1SJE D;  2Q5W D;  1EF1 A;  2KOX A;  4GDK B;  1P1A A;  3T9L A;  2WP9 B;  4ZRJ A;  1X1M A;  3W1S C;  4Q2J A;  4B0E A;  1Q10 A;  4DBG A;  3EFU A;  4MEL A;  1KJT A;  2K8B A;  2V4I B;  4ZYN A;  1N5W A;  2RMM A;  2JXT A;  4LNN A;  4EE2 A;  2FCN A;  4KKJ A;  1YN4 A;  5JHA A;  3QWZ B;  4NJ6 A;  1A70 A;  4WJP A;  2PE6 B;  1LO5 D;  2KQS A;  4W9E A;  2L1A A;  5IKC M;  4PS8 A;  2WXI A;  4RF0 A;  3RNF C;  1WXM A;  2PVG C;  2L32 A;  3ZRF A;  4MJS B;  3UIN B;  2IY1 B;  4GOC A;  5HI1 A;  2QDF A;  2MH7 A;  2JUO A;  2AX5 A;  4ICV A;  1MJD A;  4JX1 C;  3ZNZ B;  4AUQ C;  4XX5 A;  2WXG A;  3FC4 A;  4BKS D;  2WYQ A;  5D3D A;  4ZRI A;  3PZ8 A;  4FUL A;  2WX1 A;  4EOY A;  4OW0 A;  3IBE A;  1WXQ A;  3GE3 C;  4M01 A;  2C7N B;  3ZKJ C;  1T0Y A;  1Z2M A;  2J7Q B;  5FKA C;  2YEP F;  2GBN A;  2RDH A;  2LHE A;  2HD5 B;  1N60 A;  4P7I A;  2JYT A;  3P42 A;  2VZK D;  1V86 A;  5BMG A;  3VUW A;  5J18 A;  1ZP0 B;  4IG7 B;  2MQJ A;  3A4R A;  1PGX A;  4EEW A;  1N63 A;  2WXJ A;  2O6V D;  3QCA A;  1GUA B;  4MM3 B;  2L05 A;  3AEB B;  1JWB D;  3VTV A;  4JWU C;  1T6B X;  2WXK A;  3KQ4 A;  4ANW A;  4HLE A;  2Z0D B;  4RGO S;  3DWG C;  2OOB B;  1G6J A;  1MG8 A;  4EZK A;  2KHW B;  4YL8 A;  4ZHP A;  3H7P A;  1YX5 B;  2KQ7 A;  1JRO A;  2M19 A;  3NOB A;  1MHH E;  4XDD A;  4URK A;  2K5P A;  4A90 A;  1PDX A;  1XT9 B;  2DAJ A;  1ET6 A;  2QIL A;  3HVZ A;  1SE9 A;  2E3T A;  4GDL B;  5FR6 A;  3UGB B;  4P16 A;  1C79 A;  4QAY A;  3EFC A;  4PT5 A;  3AEF B;  2KDB A;  1V97 A;  4K3C A;  1FRD A;  3VR9 B;  2GOW A;  4W9D A;  4W9L A;  1OFF A;  2LGI A;  2FE8 A;  4M0W A;  4MDK E;  1H4R A;  2OHF A;  3V3X A;  4RNA A;  2LVO A;  4DHZ B;  4GSW A;  2DNF A;  2LJ5 A;  4K81 A;  2JT4 B;  4HCP B;  1WF9 A;  1RM6 C;  2KWD A;  2KFK B;  4MT5 A;  1V2Y A;  4OZA A;  2DLB A;  1C1Y B;  2G9H D;  3RUL A;  3ZNG C;  2K9X A;  2G4D B;  4IKG A;  1NVI D;  1WWT A;  3VAW A;  2N0S B;  1B1Z A;  4GDK A;  1ZW7 A;  3LB8 C;  3KW5 B;  1CK1 A;  2MBB B;  2RDG A;  1KFY B;  1DOY A;  3AED B;  1J8C A;  2GI9 A;  2W54 A;  1RFK A;  2X38 A;  1WYG A;  4DK5 A;  2NPT B;  2ZW0 A;  3ZTC A;  4R3D A;  5DPT A;  4IM0 A;  3R3M A;  3KLS X;  5H8Y E;  3VUY A;  4KVG B;  2MSE D;  3AE9 B;  3AMZ A;  3AE5 B;  4K7W A;  3CMM B;  1UWX A;  3L10 B;  3DDC B;  3GB1 A;  3NVY A;  2NCN A;  3APD A;  1E8W A;  1VZ8 A;  3KWV A;  2V3S A;  1P98 A;  1MG4 A;  2W3R A;  3PPA A;  1WM2 A;  2R2Q A;  3SFE B;  1KH0 A;  1JRU A;  4TSS A;  2DYO A;  4MJS A;  3W1S A;  3VHT C;  4C7Y A;  5EE0 A;  4WWP A;  2OED A;  2D11 A;  2JYE A;  2KWU B;  3AH7 A;  4N6E B;  2WDT B;  2CR5 A;  3VXW A;  4CYE A;  4EKU A;  1ZE3 D;  5J2R A;  5C1Z A; 
#chains in the Genus database with same CATH homology
 3ETR A;  4IOI E;  2KAJ A;  4L2Y A;  1V1O A;  1TS4 A;  4ZHO A;  1FNW A;  3BWU D;  4REZ A;  1DYQ A;  1SXT A;  2YEP B;  4JPS A;  3U7Z A;  1D4B A;  3PO0 A;  4ITK A;  1I4X A;  3ZJU A;  3IXS A;  3LXF A;  1QOB A;  3BK2 A;  1ACC A;  1STE A;  3I57 A;  1GAQ B;  2NTT A;  5D3I B;  2WXN A;  2W3S A;  2GRI A;  4US9 A;  3H8H A;  4XE0 A;  1QF6 A;  2VZK B;  3AE3 B;  1PYW D;  3I9V 1;  4ZRQ A;  1QT9 A;  5BMI A;  5C3J B;  3URY A;  2J53 A;  3Q8A A;  2N9K A;  1SIJ A;  2WXL A;  3SR6 A;  4HRO A;  4GLS C;  1AWD A;  5BMH A;  1FM0 D;  2PTL A;  2RPV A;  3P63 A;  1XLQ A;  3BVZ A;  4NAM A;  4OZC A;  1EU4 A;  2JSV X;  4DQO C;  4DXG A;  3U2S C;  2BTE A;  3R2I A;  2J52 A;  1XCT L;  1FMA D;  4WAF A;  3B9J A;  3P4P B;  3ZJV A;  1YN5 A;  1L0Y B;  2WQY B;  5D7G A;  2V0G A;  2QMT A;  3HVD A;  1D5M C;  1EM7 A;  2IPK D;  1UUP A;  4A6Q A;  4US8 A;  1PFD A;  1CJE A;  2WDQ B;  4YTM B;  2W82 A;  1YQ4 B;  1AW7 A;  3W5U B;  2H89 B;  2BB6 A;  3EUB 2;  1QIL A;  4AQ7 A;  4WUR A;  1M4V A;  1KRH A;  1KLG D;  4L23 A;  4RGT A;  1JWM D;  1I4G A;  2LJI A;  1HEZ E;  2WXR A;  2ACZ B;  1C4A A;  2K22 A;  4UDU C;  2WXP A;  2BS4 B;  2Y5C A;  1HQR D;  2WXM A;  2PLP A;  1JWU D;  1V1P A;  1L0V B;  1BUI C;  1ESF A;  5G5H A;  1FFV A;  2ON8 A;  2WXO A;  2D5G A;  1P7F A;  2SAK A;  2Z8L A;  2LUM A;  4YSZ B;  3R8B A;  2I2Y A;  1VDV A;  2BS3 B;  3BVG A;  3VQI A;  5BYQ A;  1BXT A;  2AQ3 B;  3Q8E A;  1AYF A;  1TY0 A;  3TEX A;  1SE3 A;  2INP E;  5BYR A;  1RYJ A;  2HTM E;  1GB4 A;  1UNS A;  1E0Z A;  2WXH A;  5BYS A;  1SJH D;  1D5Z C;  1JAL A;  2WNM A;  4NAW B;  1CQV A;  2I38 A;  3BVM A;  5C2T B;  4B0M A;  1NI3 A;  1EWC A;  2BB5 A;  1VR9 A;  2KQ4 X;  1K50 A;  2AQ2 B;  2WLB A;  3NRZ A;  1EU3 A;  3NS1 A;  2IDY A;  2IGH A;  2PVO D;  2EEL A;  2R61 A;  1SBB B;  1OQQ A;  2ONQ A;  1N62 A;  1VZ7 A;  2JU6 X;  2WU2 B;  3BZD B;  5E6J A;  1XF5 L;  1ZDX A;  4YWG G;  3P4Q B;  1FXI A;  1K51 A;  2MEK A;  1XEE A;  3GP7 A;  4YT0 B;  4MH8 A;  1ENF A;  3L4P A;  3P4S B;  1HXY D;  3IAS 1;  1FNU A;  3R2T A;  2CU3 A;  5FR3 A;  2QIE B;  1TJE A;  1TY2 A;  3W9C B;  4OHJ A;  4L1B A;  2J42 A;  4DXF A;  3AEE B;  2JX5 A;  1E7P B;  3LYY A;  5HG2 A;  3P1M A;  1DGJ A;  3AE2 B;  1NYQ A;  1TS2 A;  1TS3 A;  1VLB A;  1YQ3 B;  3AE4 B;  3SFD B;  2MJ3 A;  3AEC B;  5HFY A;  1FCL A;  3PZ7 A;  1XLO A;  2PMV A;  2B76 B;  1C9F A;  3TEZ A;  1F77 A;  2L52 A;  1F2R I;  4TMA B;  1XCQ L;  1D6E C;  3VR8 B;  4HEA 1;  2GB1 A;  2NTS A;  1WGK A;  2BYT A;  1NEN B;  1E6E B;  3HRD D;  1J7A A;  3MC0 B;  1J7B A;  1HZ6 A;  5MPO A;  2K0P A;  1GOZ A;  1YN3 A;  4NJC A;  4O1N A;  3RPF C;  1D5X C;  3T3N A;  3RFZ B;  5TSS A;  3AN1 A;  1Y56 A;  1FCC C;  1SB3 C;  1F2R C;  4LK0 M;  2JQR B;  3TUO A;  1RWS A;  1SJE D;  2Q5W D;  1T5X D;  2WDV B;  4WH4 A;  4GDK B;  2WDR B;  2WP9 B;  4KKI A;  3IT6 B;  2LMC A;  4JWS C;  4H2A A;  4Q2J A;  3FIL B;  4B0E A;  4A9A A;  1IBX B;  4N58 A;  1Q10 A;  1F0Z A;  1VRA B;  3TEW A;  4FXC A;  1I7H A;  4WQM A;  2V4I B;  1ZUD 2;  5T8I A;  1N5W A;  1XXG A;  3AEG B;  2RMM A;  2JXT A;  1YJI A;  2E6X A;  4EE2 A;  3GS2 A;  1ZXH A;  4KKJ A;  1YN4 A;  5AUK A;  1XLN A;  1A70 A;  2TSS A;  3NZ3 A;  3FAH A;  1LO5 D;  2CJN A;  3TSS A;  2L1A A;  1DOX A;  1FXA A;  2MJD A;  3SEB A;  3MP9 A;  3ZQ4 A;  4C80 A;  1I4H A;  1WSP A;  1PGB A;  2WXI A;  4RF0 A;  4KGS A;  1FO4 A;  2PVG C;  1IUE A;  4CQN A;  2L32 A;  1XLP A;  1NEK B;  4KGR A;  1YJJ A;  1N61 A;  5HI1 A;  4TQ1 A;  2MH7 A;  2V3N A;  2AX5 A;  1QKZ A;  4HKQ A;  4JX1 C;  3BYY B;  2PW9 A;  4KGT A;  4ARC A;  2SEB D;  4HRS A;  2WXG A;  3FC4 A;  1HA5 A;  4KX6 B;  5D3D A;  3PZ8 A;  3FIL A;  4WWM A;  4C7Z A;  3AE1 B;  1R7S A;  2FUG 1;  1MVK A;  3Q69 A;  1UWM A;  4TQ0 A;  1B9R A;  1E10 A;  2LFI A;  3NVW A;  4OW0 A;  1WXQ A;  4NZL B;  5LNK 1;  3AEA B;  4J3O D;  4XWT A;  5FKA C;  3IAM 1;  2YEP F;  1JWS D;  2AQ1 B;  1PUT A;  2RDH A;  1VJK A;  2LHE A;  4HKZ E;  1N60 A;  1K53 A;  5EE9 A;  3B2F A;  4RFB A;  1QLB B;  2JYT A;  3P42 A;  2VZK D;  4RCO A;  2KDM A;  2KN4 A;  5BMG A;  2BS2 B;  1ZP0 B;  4RGM A;  1DOI A;  3W5V B;  4MAC A;  4C56 C;  1PGX A;  2DWQ A;  3MFG A;  2DBY A;  1N63 A;  3J9C A;  2WXJ A;  4IDI A;  1TKY A;  4ARI A;  2N7J A;  1JQ4 A;  1FIQ A;  2Y3A A;  4MM3 B;  1L5P A;  3AEB B;  1JWB D;  5AUI A;  4AS1 A;  3U52 E;  4JWU C;  1FEH A;  2JZP A;  1ET9 A;  4ZYS A;  1T6B X;  2NMQ A;  2WXK A;  3KQ4 A;  1CZP A;  1ZOY B;  1YMH E;  1TZO A;  1VZ6 A;  1C76 A;  3AE8 B;  4YSX B;  1SSN A;  3KWL A;  5I4D A;  4RGO S;  2LEK A;  3P4R B;  3MJ5 A;  4D2K A;  3IT4 B;  3DWG C;  5EE1 A;  1ZXI A;  1L6V A;  1TS5 A;  3EGR A;  4WIP A;  3BK1 A;  1MI0 A;  2M56 B;  5JXV A;  5FK9 C;  2HDE A;  2KAC A;  2XN9 C;  1FNV A;  4ZHP A;  3AM9 A;  1GB1 A;  4OVZ A;  1JRO A;  2LHD A;  2M19 A;  1I4P A;  1WRI A;  1QOG A;  4ZOH C;  1E9M A;  3T3O A;  1MHH E;  3NUH B;  4JE3 B;  4XDD A;  2WS3 B;  2XNA C;  2K5P A;  4A90 A;  1PDX A;  3ABV B;  3E56 A;  4YTP B;  2IGD A;  3VRA B;  1ET6 A;  1SF0 A;  2QIL A;  2WU5 B;  3HVZ A;  3Q8C A;  2E3T A;  4GDL B;  1SEB D;  1I4Q A;  2MJE A;  1BML C;  4P16 A;  1C79 A;  1L0X B;  2WXF A;  1HZ5 A;  4PT5 A;  3AEF B;  2Y5P A;  4OZB A;  1V97 A;  4P6V F;  1FRD A;  3AB5 A;  3ZJT A;  1C77 A;  3VR9 B;  1FRR A;  1TKG A;  3C8Y A;  4A55 A;  1KLU D;  2H88 B;  3U4E G;  2QSD A;  1OFF A;  2LGI A;  4XDC A;  1V1P B;  2BW2 A;  1FD6 A;  2FE8 A;  1FFU A;  5HHD G;  1QOF A;  4M0W A;  1P7E A;  2IJ0 A;  3NVV A;  4YXD B;  4N59 A;  2QJL A;  3O13 A;  1K52 A;  4RGN A;  3OWE B;  3BII D;  1V8C A;  2OHF A;  3V3X A;  3BYT B;  4RNA A;  4YSY B;  1SE2 A;  2N9L A;  4ZRP A;  2PIA A;  1JWA D;  3MHZ A;  1RM6 C;  1JCK B;  2INN E;  2IGG A;  3UI3 A;  2KWD A;  3Q8B A;  2EKI A;  4LTU A;  4MT5 A;  3EA6 A;  4OZA A;  1ZPS A;  2ICI A;  2DLB A;  3W2D A;  2G9H D;  3CWI A;  1YNT E;  2ZW1 A;  3AV8 A;  2K9X A;  4YTN B;  4IKG A;  2J4X A;  1NVI D;  1WWT A;  3N9Y C;  1XO3 A;  2V3P A;  2N0S B;  2KMM A;  3V05 A;  2BBC A;  1QQR A;  4HJG E;  1B1Z A;  3LB8 C;  2JWU A;  1TKE A;  3B2G A;  1JRP A;  1CK1 A;  2RDG A;  3Q8F A;  1KFY B;  4RH6 A;  3AED B;  1L4Z B;  1DOY A;  3AE7 B;  2GI9 A;  1IGC A;  2W54 A;  1RFK A;  3WCQ A;  1IBX A;  1L6U A;  1ZDV A;  1KTK A;  2X38 A;  1WYG A;  1C78 A;  4A8X C;  1QOA A;  2ZW0 A;  1GPX A;  3TEY A;  2K3U A;  2G1E A;  3AE6 B;  4R3D A;  1UGJ A;  3ZGZ A;  3KLS X;  5H8Y E;  2BT6 A;  1C4P A;  2M0A A;  5G5G A;  3AE9 B;  1J7C A;  3AMZ A;  3AE5 B;  1EWY C;  1T3Q A;  1UWX A;  5H92 C;  3GB1 A;  3NVY A;  4USA A;  1VZ8 A;  1L4D B;  3E9S A;  3KWV A;  1KF6 B;  1OQR A;  2W3R A;  2W55 A;  3ZYY X;  1JML A;  3SFE B;  1IGD A;  1KH0 A;  4LLG M;  4RF1 A;  3HUI A;  4XWW A;  1MHX A;  3NVZ A;  1JW9 D;  2DYM A;  5EE3 A;  1I4R A;  2CJO A;  4TSS A;  2DYO A;  3W1S A;  5GXG B;  4C7Y A;  3VRB B;  5EE0 A;  1AN8 A;  1C4C A;  1NYR A;  1ROE A;  2OED A;  2PKO A;  2JYE A;  1MPE A;  2FBW B;  1SE4 A;  3AH7 A;  4N6E B;  1TYG B;  2WXQ A;  1N5X A;  1ZE3 D;  2QEJ C;  2L83 A;  3CIR B;  3DWM A;  1PGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...