2ZJDA

Crystal structure of lc3-p62 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
121
Chain Sequence
PSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B precurs
publication title Structural Basis for Sorting Mechanism of p62 in Selective Autophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis inhibitor/apoptosis
total genus 39
structure length 121
sequence length 121
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zjdA00
2D3GA 2WX1A 3HM6X 2MBQA 1V6EA 1R4MI 3ZVVA 4CO7A 4DHJD 4PS7A 5L83A 1R4NI 2AEHA 2MP2B 4PS8A 4TUUA 2A5UA 2AL3A 1OEYJ 4DDGD 1Q0WB 2DAFA 4EZJA 1AARA 3DBRI 2PPHA 1T0YA 4GN1A 4HJKA 2KNBA 5LLIA 2KDEB 1LFDA 2N9EB 4PS3A 2KFKB 3PVLA 2BKRB 2MLBA 1P0RA 3PREA 2WDTB 3NOBA 2J0MA 3CF6E 3DVNU 2MBOA 4ZRJA 2KC2A 2D11A 4IM2A 3RD2A 3HM3A 3DVGX 2ZZPB 4BOSC 4YL8A 3ZRFA 4W9KA 2KDFB 1VD2A 1WXVA 5G2NA 3RUIB 2MBBB 1WZ0A 5KHQA 1E90A 2KN5A 5E6PA 2L8JA 3L08A 5D6JB 3MTNB 4JGHB 1TGZB 1YX5B 3GZNI 3ZIMA 4WQOB 4IM3A 4NQKE 1CMXB 2IY0B 2ZPNA 4W9JA 4N9F4 4II2B 1V80A 1WX8A 1D3ZA 4URKA 1WH3A 3L54A 2D07B 2R2OA 2MA9B 4KSLC 3O65B 4W9DA 4KIKB 2KXJA 2G4DB 1TTNA 2J0JA 1ZGUB 4PYUA 4WJNA 3ZDTA 4EKUA 3CMMB 3VDZA 3IVFA 1EO6A 3OAWA 3ZW3A 4II3B 5L95C 1WXSA 1E8YA 1C3TA 2LD9A 2K39A 4ASWC 2RR9A 4E74A 3W1SC 2Z59B 1TBEA 4DDID 4K7SA 2KFJA 3VTVA 2Z0DB 1E8ZA 1WE6A 1Q1OA 5DCNA 2PE9A 2GBNA 3AI5A 3P2BA 2WX0A 1SGHA 2RD0A 3ZRCA 3ZNGC 2O6VD 2N9XA 3JVZX 4KSKC 5JZEB 2GBRA 3EC8A 2KHWB 5J2RA 1WI0A 1UGMA 2NBWB 4WAAA 2O2VA 2DENB 1L2NA 1WGYA 3SD5A 3UIPB 4JLCA 4G11A 2JPHA 2CU1A 5D2MB 3ZLZA 3DBSA 3HK0A 4B95A 4FJZA 4ANUA 2BWFA 4NAWA 2MBEA 3K9OB 4BKGA 4G0NB 2IO3B 4TKNA 3RCZA 2K8CA 3V6EB 4A3PA 2FCQA 2JRIB 1WGHA 4WJPA 3H1UA 5IAAC 2BYFA 2KOXA 1U4AA 5JHBA 3A33B 1ISNA 1RLFA 2K6QA 3KYDD 4WWPA 3ECIA 3NZUA 4KDLB 2FNJB 1KM7A 1OGWA 2KTRB 2HJ8A 3DQVA 3PHWB 1E5WA 2BGFA 2ZVNA 2NPTA 3RZWC 2HTHA 5BO4B 2M1MA 3H7PB 2FCNA 2GBMA 2G4SA 3KUDB 2JT4B 4BOZB 1GG3A 3AU4A 3DVGY 1KLVA 3B1LX 3AU5A 3VHTC 1NI2A 2UYZB 2KVRA 3QQ8B 4JIOU 1E8XA 4GU2A 2FCMA 2ZNVB 3V61A 1GC6A 4EFOA 1SIFA 3PLUA 3T8MA 2MWSB 3IBEA 3UIOB 2LXAA 2JZ3B 1P3QU 1WZ3A 2BPSA 3SHQA 1WM3A 4MSQB 2LRUA 1L7YA 3OJ3A 3VUYA 3ZKJC 5EDSA 1YQBA 3T9LA 1V81A 4F7ZA 2L0FA 4HK2A 3QIJA 4IG7B 4BBNC 2FIFA 2MQJA 4KVGB 2ZNVC 1WE7A 3RULA 2LASA 2L05A 2AL6A 1MG8A 3CSFA 4MEMA 4F8CB 2V4LA 2XK5A 4K1RB 2I1JA 2KJRA 1FXTB 1LM8B 3PRPB 1WJNA 3Q3FA 1E7UA 2L76A 2N7EA 2O6VA 3ML8A 4W9CA 4DHJB 2MX2A 3WANA 4GIVA 5CHVC 1UBIA 5CHWA 5LXIB 2N7DA 3OLMD 4GDLB 2LVPA 4WWNA 2IO0B 1OTRB 4ICVA 1WGGA 4MH0E 1S1QB 3NHEB 2DYBA 4GDKA 1C1YB 4HCNB 4CHKA 2PJHA 4XX5A 3D32A 1WYWB 2BF8B 4DHZB 2D2QA 2WYQA 2NBUA 3DCGA 1WGRA 3ML9A 2IO2B 4KDIC 1UELA 4B6WA 2M17A 4XZ4A 3KH0A 3WAOA 3PV1A 3WAPA 3ZNHB 1WMHA 4FA6A 3IHPC 3MJWA 1UBQA 3VVWB 2RSUA 3A9KA 2BYEA 1LXDA 5E6OA 4HDOA 3UF8A 3TMPB 3VFKA 3IFWB 4LJOB 3DDCB 2LRWA 1IP9A 3V62A 2NCNA 4MELA 3H6NA 1IYFA 2CR5A 4W9HA 2N9PC 2LXCA 3Q3JA 4BKTA 1LQBA 3M62B 5JHAA 2KWVB 1J0GA 4BBNF 5AZHA 4EZLA 3AXCA 1V86A 4FHKA 3QARA 4MJSB 3M63B 2KMCA 4GSWA 2V1YA 3WAMA 2EKEC 3R66C 2C9WB 2R2QA 3R7RA 4MDKE 4NJ7A 3QAQA 1ZKHA 3B08A 4MGZE 3KUCB 3QA8A 4WJOA 3RT3B 2KC1A 4HVBA 3N30A 2LI5A 4CYEA 4BVUC 2M0XA 4NY0A 1J19A 1V5OA 1EF5A 4HXDA 5AZFA 4AJWA 1YD8U 2JF5A 3ZTCA 1WY8A 3BINA 3ZTDA 1NBFC 2CKHB 4GB9A 3JSVA 5CHFA 4KV2A 3A9JA 1J8CA 4GDLA 1KJTA 2KANA 2KLGA 4M0WB 2N4FA 3A4SC 3H9DA 1H8CA 1H4RA 3OJ4B 4DHZE 2W9NA 5CTRC 2MP2A 4TV3A 5LXHA 3QC8B 2C5LC 1WIAA 2DZKA 4ANWA 1WJ6A 1I35A 2KMAA 2KTFA 2KWCA 2LVOA 2CHXA 2O6VB 4B9KA 2KD0A 3QWZB 2K8HA 5E6NA 1QZEA 4K7WA 3RZFA 3HHMA 3ZUNA 1E7VA 4JQWC 3UQAA 5G55A 4W9IA 4OVUA 2Y5BB 3PSEB 4IUMB 3DPDA 2AWTA 5DPTA 4I6NB 3W1YA 3LJ3A 5HKHA 2NBVB 4FJVB 4GDKB 2MBHA 4GMVA 4ZYNA 1WGDA 1XD3B 2GOWA 2JXXA 2KQ7A 2LGXA 3U30A 3WALA 2KX3A 2KDBA 3ENEA 3M3JA 2C7NB 2PEAA 1OQYA 4G50A 5IA7A 4RM9A 1UZXB 4OVVA 1WR6E 1I42A 1S3SG 1P98A 3L16A 1ZW7A 2YVCA 1K8RB 4RMAA 3A9KB 4LDTB 4MGYE 5DPWA 4AWJA 1UH6A 3TCAA 3QCAA 4EUTA 2KLCA 2C7HA 2K25A 2IO1B 3ONSA 1JRUA 2IY1B 1GJZA 1A5RA 4MGKE 2J7QB 4EOYA 3N3KB 2KKCA 2RGFA 4RM8A 2LZ6A 1SE9A 4DK5A 2GMIC 3TL5A 3UGBB 4FADA 4KIKA 4K81A 3K9PB 3S2AA 2LWPA 3GOEA 5D7GA 1RFAA 1YIWA 2G45B 3DBLI 4DBGA 2B3AA 2KK8A 2IYDB 3ZDMC 4FLHA 1GNUA 4FBJB 5DPSA 3CSTA 1X1MA 5GMVA 3NS8A 4NQLB 2N1WA 3VH3B 1YX6B 4M8MA 2KQSA 2L7RA 3NZSA 3A4RA 4NNJB 2CHWA 3QJZA 1EUVB 2JUOA 1XQQA 2QHOA 4IWQA 5D94A 4P7IA 2CHZA 2L00B 3TIXA 3EHVA 1WRDB 3A9JB 2MCNB 2BYVE 2PE6B 4MSMB 1XT9B 4GXBA 4IWPA 3APFA 3TJPA 3R3MA 5KHOA 2O2VB 1Z5SB 2ZPYA 4W9LA 2MRPA 4ICUA 2JRHA 4HDQA 4W9EA 5AZGA 2G3QB 4WJQA 2D10A 1F9JA 3APDA 3WA0A 3ALBA 3N32A 3EFUA 4NAWB 5J18A 2VRRB 4G3XB 2IBIB 2M4NA 3A1QA 3VXWA 4ANVA 3JW0X 2Z0EB 4HPMB 1RAXA 3L10B 1M94A 1VCBA 1WJUA 1WX9A 2JVCA 3PRMB 2MW5A 4M8NA 4WWOA 4HLEA 3L17A 4IM0A 4W9GA 3U8ZA 3M95A 2REXA 2CS4A 2ZCBA 3R7QA 2UWQA 1IPGA 4K7UA 2YLMA 3SU8X 1V49A 4AJYB 4ZRKA 2KWUB 1Z2MA 1GC7A 2DX5B 2AYOB 1RRBA 1WXAA 2WWZA 2NPTB 2KTRA 4KZ0A 1WR1A 2N1VA 4W9FA 4J6IA 3DOWA 4IC7B 4JL9A 3ZO5B 2HD5B 1P9DU 1UD7A 3H7PA 3PPAA 3PZDA 1YJ1A 2DYOA 4X57B 3B0AA 1Y8RC 3V6CB 2I1KA 1WFYA 1KOTA 2ZCCA 3IG3A 3EECA 3VH4B 1WM2A 4EZKA 5JH5C 3WIMA 5C1ZA 4A20A 2OJRA 2DZIA 5DPRA 2KO3A 4EEWA 3ZNID 4DXAB 2HE7A 2V3SA 3VQIA 3RYTA 4ZRIA 4BKSD 3PLVA 3DBHI 4GGQA 3KYCD 5J17A 3HIZA 2J0KA 4LCDE 2DHZA 4TQ1A 2ZEQA 2XK5B 2XEWA 2FUHB 2K6DB 2XBBC 4PYZA 4TQ0A 4HWIB 3PRZA 3I3TB 1GUAB 2IZVB 4FN2A 3TBLD 4I6PA 2KDIA 3VUXA 2L3ZA 2K1FA 4E71A 4BFRA 4KZCA 4ZDVA 2FAZA 3L13A 2C60A 2GBJA 5TR5A 2NS5A 2NR2A 4XC2A 2KFKA 2GBKA 2LGDA 4FULA 2EMSA 4GOCA 4MM3A 3AULA 1OEYA 5FR6A 1EF1A 3JYUA 3MHSD 1PQSA 3DVNV 3BY4B 1HE8A 2ZJDA 2JWZA 3LDZE 2A4ZA 2C7MB 3U7DA 3ZNZB 2FCSA 2M8SA 2NVUI 4A3OA 1G6JA 2KZRA 4DWFA 2DZJA 3VAWA 2EMTA 3NY5A 4IWOA 1V5TA 3PGEA 3X23A 3KW5B 1Q5WB 1WMHB 4AUQC 1V2YA 2KJHB 3PHXB 2RPQA 5C23A 4F1SA 5CX3A 3A1QB 4HCPB 3KVFB 4AOFA 2DYMA 2OOBB 3APCA 4ANXA 3L0WB 2K8BA 3PTFC 1E8WA 2JY6A 1WXMA 2KX0A 4AP4C 1WJ4A 2DZMA 4HPLB 3QK0A 2ZVOA 4I6LB 4LDTD 4E3CA 3X0WA 4NJ6A 3VUWA 2LGYA 4IW0A 2BKFA 2FIDA 1NDDA 4FJYA 2LUEA 3KUZA 4MJSA 4NPNA 2JZZA 3W1SA 1WX7A 2MSED 2DAJA 1TZ1A 3PS6A 5AEKB 1P1AA 3UINB 1BT0A 3SDLC 2BWES 4MGIE 3QX1A 4BKSA 3PT2B 1V9JA 2KJ6A 2ASQA 3VTUA 3H7SA 1WF9A 2LVQA 3JSVB 3C0RB 3VTWA 2LJ5A 2L0TA 3V60A 4FHJA 4LJPB 3UQBA 3QHTA
chains in the Genus database with same CATH superfamily
1YJJA 2D3GA 1IGDA 2WX1A 1D6EC 5I4DA 1T0RC 4K3CA 1V6EA 1R4MI 1XEEA 5L83A 4PS7A 3I57A 1HZ5A 2MP2B 1I4PA 4LNFA 5LNK1 3TUOA 5H8YE 2KDEB 1LFDA 2LHDA 1FNWA 1LGRA 2WDTB 2J0MA 3CF6E 2BYTA 1Q10A 2ZZPB 2RDBC 1ZDVA 3ZRFA 3DWGC 4A90A 1D5XC 1VD2A 3L08A 3MTNB 4WIPA 4RF1A 3GZNI 4W9JA 1FO4A 1V80A 3MJ5A 4URKA 1WH3A 3AM9A 2LGIA 3O65B 4KIKB 5IOIA 1J7AA 2J0JA 4PYUA 3VR8B 3ZDTA 4EKUA 5HG2A 3CMMB 3AE5B 2BTEA 3T3OA 1P7EA 1EO6A 1WXSA 1JWMD 2K3UA 3RNBC 2PE9A 1C4CA 2E6XA 3Q8EA 1UF0A 4OVZA 4BZAA 3Q6BA 1KFYB 3NVWA 2GBRA 1T5XD 5J2RA 4ZRPA 2KYWA 1L2NA 2DENB 1WGYA 2HJ1A 4JLCA 5D2MB 3ZLZA 3HK0A 2MBEA 1J7CA 2K8CA 2DWQA 2FCQA 4C56C 1WGHA 1ISNA 1RLFA 4WAFA 4WWPA 4KDLB 2D3CA 2MJDA 2BGFA 2NPTA 2HTHA 4RGMA 2G4SA 3KUDB 5FK9C 3DVGY 2KVZA 5EE1A 3BZDB 4JIOU 3HVZA 2UU7A 4LLGM 3V61A 1GC6A 4YT0B 3PLUA 3T8MA 2R61A 1JRPA 1P3QU 2JZ3B 2J52A 3DBLB 3OJ3A 1ZPSA 3T9LA 1V81A 4IG7B 3FAHA 3QIJA 4NJCA 4F8CB 3NVVA 2V4LA 4K1RB 1FXTB 1LM8B 1WJNA 4ITKA 1ET9A 2N7EA 3AEDB 3ML8A 4USAA 4KKJA 4GIVA 1FFVA 1UBIA 5CHWA 2V0GA 1TS4A 2BS4B 4ICVA 3RNFC 4MH0E 4S17A 4XGAB 4CHKA 2PJHA 1F2RC 1WYWB 2K9XA 2D2QA 2CJOA 3ML9A 4HPPA 2IO2B 1QLBB 4XZ4A 3KH0A 3PV1A 1WMHA 1ZE3D 1IBXB 1N60A 1LXDA 4HDOA 3UF8A 3VFKA 2ZW0A 4B0EA 3DDCB 3V62A 4MELA 2L83A 4ARCA 1VZ8A 1K53A 3BVZA 4HEA1 1LQBA 5JHAA 2B76B 5AZHA 3AXCA 1V86A 4MJSB 1HXYD 4GSWA 4NZLB 3R66C 4MDKE 1EWYC 3RT3B 2LI5A 1J19A 1V5OA 1YD8U 3ZTCA 1FIQA 1WY8A 3BINA 2VZKD 5CHFA 1J8CA 2KANA 4M0WB 1D5MC 2N4FA 3A4SC 4DHZE 5IN7A 1HTQA 4TV3A 4WH4A 5G5HA 2C5LC 1TY0A 4ANWA 1WJ6A 3RMKC 2KTFA 2CHXA 2J4XA 4LNOA 2K5PA 5G55A 2VH1A 3PSEB 4M00A 1HA5A 2NBVB 4FJVB 3U52E 2KDBA 5IA7A 3GB1A 4OVVA 1I42A 4C4VA 3BIID 4MGYE 1HEZE 3QCAA 2E3TA 4EUTA 3ONSA 1AYFA 4KX6B 4IOIE 1I4GA 4EOYA 4RM8A 1SE9A 1TKEA 2GMIC 3UGBB 4R3DA 5AUIA 2LWPA 3GOEA 5DPSA 3FKYA 3CSTA 1X1MA 1JWBD 1RYJA 4M8MA 1DOIA 2YEPB 4IWQA 3TIXA 2L00B 3KQ4A 3EHVA 4MT5A 2MCNB 1F2RI 3BYTB 3TJPA 5KHOA 2O2VB 3C8YA 1SE2A 4ICUA 2JU6X 4WJQA 2I2YA 2WDRB 3A1QA 4CQNA 1MG4A 1VZ7A 1WX9A 2MW5A 4WWOA 3P63A 1QOAA 3U8ZA 1NVID 4RF0A 3R7QA 1IPGA 1MHHE 3KLSX 2QSDA 1Z2MA 1GC7A 2DX5B 1WXAA 2N1VA 4JL9A 1P9DU 5JXVA 3OWEB 4M02A 3AEGB 1YJ1A 2LHEA 1PYWD 1PGAA 1Y8RC 1WFYA 1FXIA 3LB8C 3VH4B 1VZ6A 4EZKA 1KF6B 1OFFA 2V3SA 3VQIA 2H89B 2YEPF 4BKSD 3PLVA 4TQ1A 2WNMA 3RNEC 3WCQA 4US8A 2WXLA 2BS2B 3I3TB 3TBLD 2HDEA 2KWDA 2K1FA 3GE3C 3HRDD 4KZCA 4ZDVA 3AEBB 2FAZA 3NJTA 4L1BA 2NS5A 1PFDA 4GOCA 4RFBA 2EMSA 3AULA 4LNIA 5H92C 3U7DA 5MPOA 2KZRA 3AH7A 1C79A 4Q2JA 1F1HA 3VAWA 3NY5A 4HROA 2RPQA 4F1SA 3A1QB 4B0MA 1AN8A 2OOBB 1V1OA 4A9AA 1VJKA 1E8WA 2JZPA 3MFGA 1FRDA 1K52A 1NYRA 1RFKA 4NJ6A 3VUWA 3KUZA 3W1SA 1WX7A 2NMQA 1SXTA 3MC9A 3PS6A 1P1AA 3UINB 3QX1A 3H7SA 3JSVB 3C0RB 4FHJA 1P7FA 2KN4A 4US9A 2W82A 1R4NI 2A5UA 1IGCA 4M01A 1Q0WB 4EZJA 3DBRI 5LLIA 2G9HD 2JX5A 2KT7A 1QF6A 1P0RA 3PREA 1L0XB 3DVNU 3P4SB 3HM3A 3DVGX 4W9KA 2MJEA 2OEDA 1J7BA 3RUIB 1WZ0A 1E90A 2KN5A 4DXGA 5D6JB 1C4PA 3BVMA 3BYYB 1SIJA 4UDUC 2IY0B 1SSNA 1MFWA 1D3ZA 3L54A 2D07B 4KSLC 1TYGB 4W9DA 1C4AA 5GXGB 1NYQA 2KACA 1ZGUB 2BT6A 3P4PB 1PDXA 3OAWA 4II3B 1C3TA 1YNTE 2K39A 4ASWC 3IT4B 4ZOHC 2Z59B 4DDID 5E6JA 4K7SA 2KFJA 2AQ3B 1WE6A 1Q1OA 5DCNA 4XDCA 2WX0A 4O1NA 4HKQA 4KSKC 4KGRA 1UGMA 2NBWB 3AECB 4PT5A 4KGTA 2PMVA 3HVDA 1T0SC 2CU1A 1JWSD 4ANUA 3P42A 2BWFA 1MHXA 2IO3B 4TKNA 1RM6C 3V6EB 3CWIA 4WJPA 5IAAC 2BYFA 5JHBA 1UUPA 3A33B 2D3AA 2K6QA 3KYDD 2JYEA 1EM7A 4LTUA 1OGWA 2HJ8A 4H2AA 1E5WA 2ZVNA 1XLNA 1ZUD2 3H7PB 2FCNA 2JT4B 4BOZB 1GG3A 3AU4A 1KLVA 3B1LX 3AU5A 3VHTC 1NI2A 1ESFA 2FCMA 1SIFA 2MWSB 2LXAA 1FNVA 2LRUA 5EDSA 4F7ZA 1F0ZA 2DBYA 2L0FA 4HK2A 2MQJA 4KVGB 2ZNVC 1OQQA 2L05A 4ZHOA 3U7ZA 2I1JA 3VRBB 2N9LA 2MJ3A 1KLGD 3I5JC 2O6VA 2WU5B 2MX2A 3WANA 5CHVC 4MM3B 2LVPA 2LGSA 2WS3B 1WGGA 1S1QB 3NHEB 3D32A 4IKGA 3Q8AA 3AB5A 3WAPA 1QOGA 1UBQA 2BYEA 3Q3OC 3BK2A 4LJOB 1CZPA 2NCNA 1WGKA 1IYFA 2CR5A 2LXCA 3M62B 4ARIA 1J0GA 4BBNF 1F52A 1UWXA 1YQ3B 3NVYA 2KMCA 4ZYSA 2V1YA 2FUG1 2MH7A 1YJIA 3R7RA 2PIAA 4NJ7A 3QAQA 1ZKHA 3B08A 3QA8A 2KC1A 3RNGC 4HVBA 3N30A 4CYEA 3SR6A 2M0XA 4NY0A 1EF5A 4AJWA 2RMMA 1R7SA 1FD6A 1TIFA 1GB4A 2WP9B 5T8IA 2HTME 1YMHE 1ET6A 1H4RA 2DNFA 2W9NA 5LXHA 1B9RA 1FPYA 3QC8B 2DZKA 1Y56A 2KWCA 4RGTA 2O6VB 4B9KA 5E6NA 1E0ZA 1QZEA 4K7WA 3ZUNA 1E7VA 2X8XX 1C78A 3HUIA 2AWTA 3LJ3A 3LXFA 4GMVA 2EKIA 2KQ7A 4ZYNA 3WALA 2KX3A 3ENEA 3M3JA 1E6EB 2C7NB 2PEAA 1E7PB 2IJ0A 1S3SG 1ZW7A 4RMAA 4AWJA 1UH6A 1FXAA 2L1AA 3Q2AC 4REZA 3O13A 2KLCA 3E9SA 2LUMA 3VRAB 2J7QB 1XO3A 2KKCA 5EE0A 1RFAA 3B2FA 4QAYA 2JQRB 2IYDB 3ZDMC 2AQ2B 2QC8A 1XCTL 2BBCA 1I4HA 2KQSA 3A4RA 2QHOA 1XQQA 2CHZA 3BK1A 2NTTA 1R4MB 2BYVE 2PE6B 4IWPA 1Z5SB 2BQQA 4HJGE 4ZRQA 2JRHA 5AZGA 3WA0A 3N32A 3EFUA 1L5PA 5J18A 1M4VA 4DXFA 3VXWA 3JW0X 2Z0EB 1N63A 1RAXA 3L10B 2INNE 1M94A 1WJUA 3PRMB 4M8NA 4HLEA 3L17A 2OHFA 2REXA 4K7UA 1FNUA 3SU8X 1V49A 2KWUB 3GZNB 2FE8A 2NPTB 2KTRA 4KZ0A 1DOXA 2W54A 4J6IA 3DOWA 4IC7B 1KRHA 1YN5A 3NVZA 3DHIC 2DYOA 4X57B 3B0AA 2I1KA 1ZXIA 1TJEA 3EECA 5JH5C 1WM2A 1WXQA 2OJRA 2DZIA 1TS5A 4A20A 2KO3A 3ZNID 1N5XA 3DBHB 1V97A 3KYCD 3HIZA 3TEYA 4N58A 1CJEA 3P4RB 3AE8B 2XEWA 4TQ0A 4PYZA 1T3QA 2RDHA 4HWIB 4YTNB 4OZCA 3PRZA 5HHDG 1GUAB 2IZVB 4I6PA 3PZ8A 3VUXA 4E71A 1YQ4B 4BFRA 4J3OD 3L13A 2C60A 2GBJA 1BMLC 2WXGA 2NR2A 2KFKA 5IP4D 1ZOYB 4DQOC 1OEYA 3NZ3A 3MHSD 3BY4B 4YTPB 1HE8A 2JWZA 2FCSA 2NVUI 1G6JA 2L52A 4DWFA 5IO9A 2EMTA 3AEEB 3KW5B 1WMHB 1SE3A 4AOFA 4A55A 3APCA 3KWVA 4HPLB 5BMIA 4IW0A 1D5ZC 1GB1A 2FIDA 1OQRA 2MSED 2DAJA 1V1PA 1BT0A 4RH6A 2ASQA 3VTUA 1JALA 3V60A 2Y5PA 3RI7C 2WDQB 3HM6X 2MBQA 3OG5A 3ZVVA 4CO7A 4D2KA 4PS8A 4IDIA 2AL3A 4DDGD 2LMCA 4S0RA 1AARA 2GLSA 2PKOA 2KNBA 2M56B 4TMAB 1TY2A 4PS3A 2KFKB 4N6EB 2BKRB 1A70A 3NOBA 4ZRJA 2KC2A 4IM2A 3RD2A 3RNAC 3I63C 2GB1A 3KWLA 3E56A 2QCZA 1WXVA 5G2NA 2MBBB 4C4VB 2L8JA 2AQ1B 3SFDB 1UGJA 1YX5B 2WLBA 2WXIA 4NQKE 1EU3A 2ZPNA 2GRIA 4N9F4 1L4ZB 1VDVA 2KQ4X 4II2B 1WX8A 2ON8A 3SEBA 2KXJA 3N20C 1ZP0B 4P16A 1YN4A 3ZW3A 5L95C 1E8YA 2LD9A 2WXKA 4E74A 4C80A 1TBEA 1ROEA 3VTVA 1EU4A 1MPEA 2Z0DB 3Q69A 1E8ZA 4N59A 4OHJA 2AX5A 3P2BA 3ZNGC 2O6VD 3URYA 3JVZX 5JZEB 1I4RA 4WAAA 3UIPB 1NEKB 3DBSA 4B95A 3P1MA 3MC0B 4NAWA 1FMAD 1PGBA 3K9OB 4G0NB 1HTOA 4A3PA 2JRIB 1K51A 3H1UA 2X38A 2KOXA 1U4AA 2IDYA 1GAQB 3AEFB 3AE7B 3ECIA 2EELA 3NZUA 2M0AA 2FNJB 3DQVA 4RCOA 4XYCA 5BO4B 2GBMA 1VLBA 4AS1A 2ACZB 2KVRA 1E8XA 2V4IB 4GU2A 3AEAB 1GOZA 1N6ZA 1ENFA 3R2TA 3AV8A 1JROA 4YSYB 1WZ3A 2W3RA 3VUYA 3V05A 1YN3A 1YQBA 3V3XA 2FIFA 1FCLA 1JMLA 1FFUA 3RULA 2LASA 2AL6A 3CSFA 2XK5A 3Q3MC 1PUTA 5C3JB 4P1CC 3Q3FA 1E7UA 2L76A 1T6BX 4W9CA 4DHJB 1FEHA 2J53A 2N7DA 3AE6B 2IO0B 3AMZA 4HCNB 2Q5WD 3R8BA 2LFIA 2BF8B 3MC8A 2N0SB 4DHZB 2WYQA 2NBUA 1WGRA 4B6WA 1UELA 3ZNHB 4K3BA 1ACCA 4C7YA 2BVCA 3IHPC 1FCCC 1QT9A 3A9KA 5E6OA 3J9CA 3TMPB 4RGNA 2LRWA 5EE9A 2N9KA 1KLUD 4W9HA 2N9PC 1TS3A 4A8XC 1I7HA 4FHKA 2JWUA 3M63B 3AE9B 2Z8LA 2XN9C 2R2QA 1N61A 3NS1A 1CK1A 3EFCA 4WJOA 1WWTA 2W55A 1QKZA 2JXTA 3N1YC 5TSSA 1WRIA 1E9MA 3ZYYX 3PZ7A 1NBFC 4KV2A 4GDLA 1KJTA 3IAM1 2TSSA 3B9JA 3H9DA 1H8CA 5CTRC 2MP2A 4OZAA 2QJLA 4FXCA 1UNSA 1JQ4A 3GE8C 2LVOA 1N62A 3ZXRA 2K8HA 3RZFA 3HHMA 4JQWC 4W9IA 4IUMB 4BAXA 4I6NB 3W1YA 3TEZA 3TSSA 3U30A 1BUIC 1WGDA 1XD3B 2GOWA 1WYGA 4P6VF 1ZXHA 4G50A 4KGSA 3DWMA 1UZXB 1WR6E 2WU2B 3A9KB 2ICIA 1L0VB 3W2DA 2I38A 2KDMA 2SAKA 3TCAA 1YOVB 2BS3B 2BB6A 1A5RA 4MGKE 3N3KB 2LZ6A 4KIKA 4YSXB 3K9PB 3S2AA 5D7GA 3DBLI 2KK8A 4FLHA 4FBJB 4JE3B 4LNNA 5GMVA 3VH3B 4NQLB 1XLPA 1YX6B 2CHWA 3QJZA 1EUVB 2JUOA 4ACFA 4PK1A 1R4NB 4MSMB 4GXBA 3APFA 5BYQA 3R3MA 2ZPYA 3DBRB 2WXRA 4W9LA 4HDQA 2G3QB 1F9JA 3APDA 3ALBA 2QMTA 2N7JA 3N1XC 4G3XB 5IKCM 1D4BA 2JVCA 1I4QA 4W9GA 3M95A 2CS4A 2ZCBA 5BYRA 2YLMA 1XCQL 4OW0A 4AJYB 1NENB 2AYOB 2WWZA 3DHGC 5HI1A 3Q8CA 1WR1A 4W9FA 2HD5B 2WQYB 3PPAA 3PZDA 4LNKA 1KOTA 4YXDB 3RN9C 5DPRA 1SBBB 4DXAB 4MACA 2HE7A 3ZGZA 3RYTA 4ZRIA 3DBHI 3R2IA 4GGQA 1XLQA 5BMGA 5J17A 2DHZA 1QOFA 2QDFA 2ZEQA 2FUHB 1SF0A 2K6DB 1BXTA 4FN2A 4XWTA 1FRRA 2L3ZA 2WHIA 1DYQA 1AW7A 4XC2A 2GBKA 4XE0A 5FR6A 1EF1A 2V9HA 3DVNV 3U4EG 4JPSA 2A4ZA 3Q8FA 2M8SA 2L32A 4A3OA 1C77A 1TS2A 2DZJA 3GP7A 4IWOA 1Q5WB 4AUQC 1V2YA 3PHXB 5C23A 4HCPB 3KVFB 1C76A 2IGDA 2DYMA 2PW9A 4ANXA 3I9V1 1IBXA 3L0WB 2K8BA 2J42A 2JY6A 1LO5D 2NTSA 4AP4C 1WJ4A 2DZMA 4LDTD 3X0WA 2LGYA 4FJYA 4MJSA 4NPNA 3RFZB 1B1ZA 4WURA 5AEKB 3SDLC 2IGHA 3AE1B 2BWES 1V9JA 3VR9B 1WF9A 1IUEA 3UQBA 1JW9D 3IT6B 5D3IB 2PLPA 3BVGA 4DHJD 1PGXA 2AEHA 4M0WA 4TUUA 3W5VB 1OEYJ 2BB5A 4LK0M 2DAFA 3LYYA 3C19A 4RNAA 2PPHA 1T0YA 4GN1A 4HJKA 1L4DB 2N9EB 3PVLA 2M19A 2MLBA 1V8CA 2MBOA 2D11A 4BOSC 2V3NA 4YL8A 5BMHA 3U2SC 4WQMA 2KDFB 2RDGA 1SEBD 1L6VA 5KHQA 5E6PA 4JGHB 1TGZB 3ZIMA 4WQOB 4IM3A 1TKGA 1CMXB 2LJIA 3FC4A 3MP9A 2R2OA 2MA9B 2G4DB 1TTNA 2QILA 2IPKD 4WJNA 3VDZA 3IVFA 3Q8BA 2CU3A 5HFYA 2W3SA 1AWDA 2RR9A 3W1SC 1KTKA 2GBNA 3TEWA 3AI5A 1SE4A 1SGHA 2RD0A 4WWMA 2PVGC 3ZRCA 3AE3B 2N9XA 4OZBA 1DGJA 3EC8A 2KHWB 1TZOA 1WI0A 2H88B 2O2VA 3SD5A 1K50A 4G11A 2JPHA 4FJZA 2INCC 4BKGA 4L2YA 3EA6A 2WXJA 3RCZA 4YWGG 3N1ZC 3GS2A 2WXPA 1GPXA 5D3DA 1MJDA 3TEXA 3NG0A 2WXMA 1NI3A 2WXOA 1KM7A 2KTRB 3PHWB 3PO0A 4KKIA 3RZWC 4JX1C 2M1MA 1RWSA 1VR9A 3ZJVA 4P1BC 2UYZB 3QQ8B 2WXQA 2ZNVB 4EFOA 3IBEA 3UIOB 2WXNA 2BPSA 2DLBA 2WGSA 1WM3A 3FILA 4MSQB 3SHQA 1L7YA 3ZKJC 4BBNC 2JSVX 2XNAC 1WE7A 1L6UA 1MG8A 4MEMA 2V3PA 2KJRA 3PRPB 2D5GA 3P4QB 5G5GA 1SB3C 5LXIB 3OLMD 4WWNA 3AE4B 2IGGA 1OTRB 3L4PA 2WXHA 4HRSA 2DYBA 4GDKA 1C1YB 4XX5A 2WDVB 1CQVA 3DCGA 4KDIC 2M17A 3Q14C 3WAOA 4FA6A 3MJWA 3VVWB 2RSUA 2ONQA 3IFWB 1IP9A 1QILA 3H6NA 2RPVA 1SJHD 1EWCA 3Q3JA 4BKTA 5AUKA 1I4XA 2KWVB 4AQ7A 4EZLA 3AN1A 3QARA 3WAMA 2EKEC 1V1PB 2C9WB 4MGZE 3KUCB 2LEKA 2JYTA 2KMMA 4BVUC 3IXSA 2ZW1A 5AZFA 4HXDA 3NRZA 4XWWA 2JF5A 3ZTDA 2PTLA 3FILB 2CKHB 4GB9A 3JSVA 3A9JA 1F77A 3Q3NC 2KLGA 3CIRB 3OJ4B 1E10A 2K0PA 1WIAA 1I35A 2KMAA 3NUHB 2KD0A 3QWZB 2WXFA 3ZQ4A 3EUB2 4YSZB 3UQAA 3BWUD 2Y5BB 4OVUA 4EE2A 3DPDA 5DPTA 5FR3A 2SEBD 5HKHA 4GDKB 2MBHA 1WSPA 2JXXA 2LGXA 5C2TB 1OQYA 4TSSA 1TKYA 1HQRD 3N9YC 4RM9A 1P98A 3L16A 2YVCA 1K8RB 4C7ZA 1L0YB 4LDTB 5DPWA 4HKZE 2C7HA 2K25A 2IO1B 1ZDXA 1JRUA 2PVOD 2IY1B 3QHTA 1GJZA 3AE2B 2RGFA 4DK5A 3TL5A 4FADA 4K81A 1YIWA 2G45B 4DBGA 2B3AA 2INDC 2INPE 3W9CB 1GNUA 4XDDA 3NS8A 2N1WA 3W5UB 2L7RA 3NZSA 2G1EA 3SFEB 2Y5CA 4NNJB 1QOBA 5D94A 4P7IA 1XLOA 1JWAD 1WRDB 1XXGA 3A9JB 3DHHC 2QEJC 2QIEB 4ZHPA 1XT9B 2KAJA 4MH8A 1XF5L 2MRPA 4W9EA 2D3BA 2D10A 2K22A 1QQRA 3B2GA 1UWMA 1STEA 4NAWB 3MHZA 1MI0A 2VRRB 2IBIB 2M4NA 3IAS1 4ANVA 5EE3A 1MVKA 4HPMB 4RGOS 1VCBA 2VH2A 4IM0A 2UWQA 2MEKA 1KH0A 4ZRKA 1RRBA 1VRAB 1TT5B 1FM0D 3ZO5B 1UD7A 2Y3AA 3H7PA 4JWSC 3V6CB 5BYSA 2ZCCA 3IG3A 2FBWB 3WIMA 5C1ZA 4EEWA 3ZJUA 2BW2A 4L23A 4A6QA 4C00A 1JCKB 2J0KA 4LCDE 5FKAC 2XK5B 2XBBC 1N5WA 2VZKB 3T3NA 2KDIA 3H8HA 1SJED 5TR5A 2LGDA 4FULA 4MM3A 3JYUA 1PQSA 3ZXVA 1DOYA 2ZJDA 2MHJA 4JWUC 3LDZE 3ABVB 2C7MB 4YTMB 3ZNZB 3RNCC 3EGRA 1V5TA 3PGEA 4GLSC 3X23A 2KJHB 5CX3A 3ETRA 3RPFC 3PTFC 1C9FA 1WXMA 2KX0A 3QK0A 2ZVOA 4I6LB 4E3CA 2BKFA 1NDDA 4NAMA 2LUEA 1HZ6A 2JZZA 2OJWA 1TZ1A 2CJNA 1T0QC 2GI9A 4MGIE 1JWUD 4BKSA 3PT2B 2KJ6A 3ZJTA 2LVQA 3VTWA 2LJ5A 2L0TA 4LJPB 4GDLB 3UI3A
chains in the Genus database with same CATH topology
2D3GA 2WX1A 3HM6X 2MBQA 1V6EA 1R4MI 3ZVVA 4CO7A 4DHJD 4PS7A 5L83A 1R4NI 2AEHA 2MP2B 4PS8A 4TUUA 2A5UA 2AL3A 1OEYJ 4DDGD 1Q0WB 2DAFA 4EZJA 1AARA 3DBRI 2PPHA 1T0YA 4GN1A 4HJKA 2KNBA 5LLIA 2KDEB 1LFDA 2N9EB 4PS3A 2KFKB 3PVLA 2BKRB 2MLBA 1P0RA 3PREA 2WDTB 3NOBA 2J0MA 3CF6E 3DVNU 2MBOA 4ZRJA 2KC2A 2D11A 4IM2A 3RD2A 3HM3A 3DVGX 2ZZPB 4BOSC 4YL8A 3ZRFA 4W9KA 2KDFB 1VD2A 1WXVA 5G2NA 3RUIB 2MBBB 1WZ0A 5KHQA 1E90A 2KN5A 5E6PA 2L8JA 3L08A 5D6JB 3MTNB 4JGHB 1TGZB 1YX5B 3GZNI 3ZIMA 4WQOB 4IM3A 4NQKE 1CMXB 2IY0B 2ZPNA 4W9JA 4N9F4 4II2B 1V80A 1WX8A 1D3ZA 4URKA 1WH3A 3L54A 2D07B 2R2OA 2MA9B 4KSLC 3O65B 4W9DA 4KIKB 2KXJA 2G4DB 1TTNA 2J0JA 1ZGUB 4PYUA 4WJNA 3ZDTA 4EKUA 3CMMB 3VDZA 3IVFA 1EO6A 3OAWA 3ZW3A 4II3B 5L95C 1WXSA 1E8YA 1C3TA 2LD9A 2K39A 4ASWC 2RR9A 4E74A 3W1SC 2Z59B 1TBEA 4DDID 4K7SA 2KFJA 3VTVA 2Z0DB 1E8ZA 1WE6A 1Q1OA 5DCNA 2PE9A 2GBNA 3AI5A 3P2BA 2WX0A 1SGHA 2RD0A 3ZRCA 3ZNGC 2O6VD 2N9XA 3JVZX 4KSKC 5JZEB 2GBRA 3EC8A 2KHWB 5J2RA 1WI0A 1UGMA 2NBWB 4WAAA 2O2VA 2DENB 1L2NA 1WGYA 3SD5A 3UIPB 4JLCA 4G11A 2JPHA 2CU1A 5D2MB 3ZLZA 3DBSA 3HK0A 4B95A 4FJZA 4ANUA 2BWFA 4NAWA 2MBEA 3K9OB 4BKGA 4G0NB 2IO3B 4TKNA 3RCZA 2K8CA 3V6EB 4A3PA 2FCQA 2JRIB 1WGHA 4WJPA 3H1UA 5IAAC 2BYFA 2KOXA 1U4AA 5JHBA 3A33B 1ISNA 1RLFA 2K6QA 3KYDD 4WWPA 3ECIA 3NZUA 4KDLB 2FNJB 1KM7A 1OGWA 2KTRB 2HJ8A 3DQVA 3PHWB 1E5WA 2BGFA 2ZVNA 2NPTA 3RZWC 2HTHA 5BO4B 2M1MA 3H7PB 2FCNA 2GBMA 2G4SA 3KUDB 2JT4B 4BOZB 1GG3A 3AU4A 3DVGY 1KLVA 3B1LX 3AU5A 3VHTC 1NI2A 2UYZB 2KVRA 3QQ8B 4JIOU 1E8XA 4GU2A 2FCMA 2ZNVB 3V61A 1GC6A 4EFOA 1SIFA 3PLUA 3T8MA 2MWSB 3IBEA 3UIOB 2LXAA 2JZ3B 1P3QU 1WZ3A 2BPSA 3SHQA 1WM3A 4MSQB 2LRUA 1L7YA 3OJ3A 3VUYA 3ZKJC 5EDSA 1YQBA 3T9LA 1V81A 4F7ZA 2L0FA 4HK2A 3QIJA 4IG7B 4BBNC 2FIFA 2MQJA 4KVGB 2ZNVC 1WE7A 3RULA 2LASA 2L05A 2AL6A 1MG8A 3CSFA 4MEMA 4F8CB 2V4LA 2XK5A 4K1RB 2I1JA 2KJRA 1FXTB 1LM8B 3PRPB 1WJNA 3Q3FA 1E7UA 2L76A 2N7EA 2O6VA 3ML8A 4W9CA 4DHJB 2MX2A 3WANA 4GIVA 5CHVC 1UBIA 5CHWA 5LXIB 2N7DA 3OLMD 4GDLB 2LVPA 4WWNA 2IO0B 1OTRB 4ICVA 1WGGA 4MH0E 1S1QB 3NHEB 2DYBA 4GDKA 1C1YB 4HCNB 4CHKA 2PJHA 4XX5A 3D32A 1WYWB 2BF8B 4DHZB 2D2QA 2WYQA 2NBUA 3DCGA 1WGRA 3ML9A 2IO2B 4KDIC 1UELA 4B6WA 2M17A 4XZ4A 3KH0A 3WAOA 3PV1A 3WAPA 3ZNHB 1WMHA 4FA6A 3IHPC 3MJWA 1UBQA 3VVWB 2RSUA 3A9KA 2BYEA 1LXDA 5E6OA 4HDOA 3UF8A 3TMPB 3VFKA 3IFWB 4LJOB 3DDCB 2LRWA 1IP9A 3V62A 2NCNA 4MELA 3H6NA 1IYFA 2CR5A 4W9HA 2N9PC 2LXCA 3Q3JA 4BKTA 1LQBA 3M62B 5JHAA 2KWVB 1J0GA 4BBNF 5AZHA 4EZLA 3AXCA 1V86A 4FHKA 3QARA 4MJSB 3M63B 2KMCA 4GSWA 2V1YA 3WAMA 2EKEC 3R66C 2C9WB 2R2QA 3R7RA 4MDKE 4NJ7A 3QAQA 1ZKHA 3B08A 4MGZE 3KUCB 3QA8A 4WJOA 3RT3B 2KC1A 4HVBA 3N30A 2LI5A 4CYEA 4BVUC 2M0XA 4NY0A 1J19A 1V5OA 1EF5A 4HXDA 5AZFA 4AJWA 1YD8U 2JF5A 3ZTCA 1WY8A 3BINA 3ZTDA 1NBFC 2CKHB 4GB9A 3JSVA 5CHFA 4KV2A 3A9JA 1J8CA 4GDLA 1KJTA 2KANA 2KLGA 4M0WB 2N4FA 3A4SC 3H9DA 1H8CA 1H4RA 3OJ4B 4DHZE 2W9NA 5CTRC 2MP2A 4TV3A 5LXHA 3QC8B 2C5LC 1WIAA 2DZKA 4ANWA 1WJ6A 1I35A 2KMAA 2KTFA 2KWCA 2LVOA 2CHXA 2O6VB 4B9KA 2KD0A 3QWZB 2K8HA 5E6NA 1QZEA 4K7WA 3RZFA 3HHMA 3ZUNA 1E7VA 4JQWC 3UQAA 5G55A 4W9IA 4OVUA 2Y5BB 3PSEB 4IUMB 3DPDA 2AWTA 5DPTA 4I6NB 3W1YA 3LJ3A 5HKHA 2NBVB 4FJVB 4GDKB 2MBHA 4GMVA 4ZYNA 1WGDA 1XD3B 2GOWA 2JXXA 2KQ7A 2LGXA 3U30A 3WALA 2KX3A 2KDBA 3ENEA 3M3JA 2C7NB 2PEAA 1OQYA 4G50A 5IA7A 4RM9A 1UZXB 4OVVA 1WR6E 1I42A 1S3SG 1P98A 3L16A 1ZW7A 2YVCA 1K8RB 4RMAA 3A9KB 4LDTB 4MGYE 5DPWA 4AWJA 1UH6A 3TCAA 3QCAA 4EUTA 2KLCA 2C7HA 2K25A 2IO1B 3ONSA 1JRUA 2IY1B 1GJZA 1A5RA 4MGKE 2J7QB 4EOYA 3N3KB 2KKCA 2RGFA 4RM8A 2LZ6A 1SE9A 4DK5A 2GMIC 3TL5A 3UGBB 4FADA 4KIKA 4K81A 3K9PB 3S2AA 2LWPA 3GOEA 5D7GA 1RFAA 1YIWA 2G45B 3DBLI 4DBGA 2B3AA 2KK8A 2IYDB 3ZDMC 4FLHA 1GNUA 4FBJB 5DPSA 3CSTA 1X1MA 5GMVA 3NS8A 4NQLB 2N1WA 3VH3B 1YX6B 4M8MA 2KQSA 2L7RA 3NZSA 3A4RA 4NNJB 2CHWA 3QJZA 1EUVB 2JUOA 1XQQA 2QHOA 4IWQA 5D94A 4P7IA 2CHZA 2L00B 3TIXA 3EHVA 1WRDB 3A9JB 2MCNB 2BYVE 2PE6B 4MSMB 1XT9B 4GXBA 4IWPA 3APFA 3TJPA 3R3MA 5KHOA 2O2VB 1Z5SB 2ZPYA 4W9LA 2MRPA 4ICUA 2JRHA 4HDQA 4W9EA 5AZGA 2G3QB 4WJQA 2D10A 1F9JA 3APDA 3WA0A 3ALBA 3N32A 3EFUA 4NAWB 5J18A 2VRRB 4G3XB 2IBIB 2M4NA 3A1QA 3VXWA 4ANVA 3JW0X 2Z0EB 4HPMB 1RAXA 3L10B 1M94A 1VCBA 1WJUA 1WX9A 2JVCA 3PRMB 2MW5A 4M8NA 4WWOA 4HLEA 3L17A 4IM0A 4W9GA 3U8ZA 3M95A 2REXA 2CS4A 2ZCBA 3R7QA 2UWQA 1IPGA 4K7UA 2YLMA 3SU8X 1V49A 4AJYB 4ZRKA 2KWUB 1Z2MA 1GC7A 2DX5B 2AYOB 1RRBA 1WXAA 2WWZA 2NPTB 2KTRA 4KZ0A 1WR1A 2N1VA 4W9FA 4J6IA 3DOWA 4IC7B 4JL9A 3ZO5B 2HD5B 1P9DU 1UD7A 3H7PA 3PPAA 3PZDA 1YJ1A 2DYOA 4X57B 3B0AA 1Y8RC 3V6CB 2I1KA 1WFYA 1KOTA 2ZCCA 3IG3A 3EECA 3VH4B 1WM2A 4EZKA 5JH5C 3WIMA 5C1ZA 4A20A 2OJRA 2DZIA 5DPRA 2KO3A 4EEWA 3ZNID 4DXAB 2HE7A 2V3SA 3VQIA 3RYTA 4ZRIA 4BKSD 3PLVA 3DBHI 4GGQA 3KYCD 5J17A 3HIZA 2J0KA 4LCDE 2DHZA 4TQ1A 2ZEQA 2XK5B 2XEWA 2FUHB 2K6DB 2XBBC 4PYZA 4TQ0A 4HWIB 3PRZA 3I3TB 1GUAB 2IZVB 4FN2A 3TBLD 4I6PA 2KDIA 3VUXA 2L3ZA 2K1FA 4E71A 4BFRA 4KZCA 4ZDVA 2FAZA 3L13A 2C60A 2GBJA 5TR5A 2NS5A 2NR2A 4XC2A 2KFKA 2GBKA 2LGDA 4FULA 2EMSA 4GOCA 4MM3A 3AULA 1OEYA 5FR6A 1EF1A 3JYUA 3MHSD 1PQSA 3DVNV 3BY4B 1HE8A 2ZJDA 2JWZA 3LDZE 2A4ZA 2C7MB 3U7DA 3ZNZB 2FCSA 2M8SA 2NVUI 4A3OA 1G6JA 2KZRA 4DWFA 2DZJA 3VAWA 2EMTA 3NY5A 4IWOA 1V5TA 3PGEA 3X23A 3KW5B 1Q5WB 1WMHB 4AUQC 1V2YA 2KJHB 3PHXB 2RPQA 5C23A 4F1SA 5CX3A 3A1QB 4HCPB 3KVFB 4AOFA 2DYMA 2OOBB 3APCA 4ANXA 3L0WB 2K8BA 3PTFC 1E8WA 2JY6A 1WXMA 2KX0A 4AP4C 1WJ4A 2DZMA 4HPLB 3QK0A 2ZVOA 4I6LB 4LDTD 4E3CA 3X0WA 4NJ6A 3VUWA 2LGYA 4IW0A 2BKFA 2FIDA 1NDDA 4FJYA 2LUEA 3KUZA 4MJSA 4NPNA 2JZZA 3W1SA 1WX7A 2MSED 2DAJA 1TZ1A 3PS6A 5AEKB 1P1AA 3UINB 1BT0A 3SDLC 2BWES 4MGIE 3QX1A 4BKSA 3PT2B 1V9JA 2KJ6A 2ASQA 3VTUA 3H7SA 1WF9A 2LVQA 3JSVB 3C0RB 3VTWA 2LJ5A 2L0TA 3V60A 4FHJA 4LJPB 3UQBA 3QHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3G A;  2WX1 A;  3HM6 X;  2MBQ A;  1V6E A;  1R4M I;  3ZVV A;  4CO7 A;  4DHJ D;  4PS7 A;  5L83 A;  1R4N I;  2AEH A;  2MP2 B;  4PS8 A;  4TUU A;  2A5U A;  2AL3 A;  1OEY J;  4DDG D;  1Q0W B;  2DAF A;  4EZJ A;  1AAR A;  3DBR I;  2PPH A;  1T0Y A;  4GN1 A;  4HJK A;  2KNB A;  5LLI A;  2KDE B;  1LFD A;  2N9E B;  4PS3 A;  2KFK B;  3PVL A;  2BKR B;  2MLB A;  1P0R A;  3PRE A;  2WDT B;  3NOB A;  2J0M A;  3CF6 E;  3DVN U;  2MBO A;  4ZRJ A;  2KC2 A;  2D11 A;  4IM2 A;  3RD2 A;  3HM3 A;  3DVG X;  2ZZP B;  4BOS C;  4YL8 A;  3ZRF A;  4W9K A;  2KDF B;  1VD2 A;  1WXV A;  5G2N A;  3RUI B;  2MBB B;  1WZ0 A;  5KHQ A;  1E90 A;  2KN5 A;  5E6P A;  2L8J A;  3L08 A;  5D6J B;  3MTN B;  4JGH B;  1TGZ B;  1YX5 B;  3GZN I;  3ZIM A;  4WQO B;  4IM3 A;  4NQK E;  1CMX B;  2IY0 B;  2ZPN A;  4W9J A;  4N9F 4;  4II2 B;  1V80 A;  1WX8 A;  1D3Z A;  4URK A;  1WH3 A;  3L54 A;  2D07 B;  2R2O A;  2MA9 B;  4KSL C;  3O65 B;  4W9D A;  4KIK B;  2KXJ A;  2G4D B;  1TTN A;  2J0J A;  1ZGU B;  4PYU A;  4WJN A;  3ZDT A;  4EKU A;  3CMM B;  3VDZ A;  3IVF A;  1EO6 A;  3OAW A;  3ZW3 A;  4II3 B;  5L95 C;  1WXS A;  1E8Y A;  1C3T A;  2LD9 A;  2K39 A;  4ASW C;  2RR9 A;  4E74 A;  3W1S C;  2Z59 B;  1TBE A;  4DDI D;  4K7S A;  2KFJ A;  3VTV A;  2Z0D B;  1E8Z A;  1WE6 A;  1Q1O A;  5DCN A;  2PE9 A;  2GBN A;  3AI5 A;  3P2B A;  2WX0 A;  1SGH A;  2RD0 A;  3ZRC A;  3ZNG C;  2O6V D;  2N9X A;  3JVZ X;  4KSK C;  5JZE B;  2GBR A;  3EC8 A;  2KHW B;  5J2R A;  1WI0 A;  1UGM A;  2NBW B;  4WAA A;  2O2V A;  2DEN B;  1L2N A;  1WGY A;  3SD5 A;  3UIP B;  4JLC A;  4G11 A;  2JPH A;  2CU1 A;  5D2M B;  3ZLZ A;  3DBS A;  3HK0 A;  4B95 A;  4FJZ A;  4ANU A;  2BWF A;  4NAW A;  2MBE A;  3K9O B;  4BKG A;  4G0N B;  2IO3 B;  4TKN A;  3RCZ A;  2K8C A;  3V6E B;  4A3P A;  2FCQ A;  2JRI B;  1WGH A;  4WJP A;  3H1U A;  5IAA C;  2BYF A;  2KOX A;  1U4A A;  5JHB A;  3A33 B;  1ISN A;  1RLF A;  2K6Q A;  3KYD D;  4WWP A;  3ECI A;  3NZU A;  4KDL B;  2FNJ B;  1KM7 A;  1OGW A;  2KTR B;  2HJ8 A;  3DQV A;  3PHW B;  1E5W A;  2BGF A;  2ZVN A;  2NPT A;  3RZW C;  2HTH A;  5BO4 B;  2M1M A;  3H7P B;  2FCN A;  2GBM A;  2G4S A;  3KUD B;  2JT4 B;  4BOZ B;  1GG3 A;  3AU4 A;  3DVG Y;  1KLV A;  3B1L X;  3AU5 A;  3VHT C;  1NI2 A;  2UYZ B;  2KVR A;  3QQ8 B;  4JIO U;  1E8X A;  4GU2 A;  2FCM A;  2ZNV B;  3V61 A;  1GC6 A;  4EFO A;  1SIF A;  3PLU A;  3T8M A;  2MWS B;  3IBE A;  3UIO B;  2LXA A;  2JZ3 B;  1P3Q U;  1WZ3 A;  2BPS A;  3SHQ A;  1WM3 A;  4MSQ B;  2LRU A;  1L7Y A;  3OJ3 A;  3VUY A;  3ZKJ C;  5EDS A;  1YQB A;  3T9L A;  1V81 A;  4F7Z A;  2L0F A;  4HK2 A;  3QIJ A;  4IG7 B;  4BBN C;  2FIF A;  2MQJ A;  4KVG B;  2ZNV C;  1WE7 A;  3RUL A;  2LAS A;  2L05 A;  2AL6 A;  1MG8 A;  3CSF A;  4MEM A;  4F8C B;  2V4L A;  2XK5 A;  4K1R B;  2I1J A;  2KJR A;  1FXT B;  1LM8 B;  3PRP B;  1WJN A;  3Q3F A;  1E7U A;  2L76 A;  2N7E A;  2O6V A;  3ML8 A;  4W9C A;  4DHJ B;  2MX2 A;  3WAN A;  4GIV A;  5CHV C;  1UBI A;  5CHW A;  5LXI B;  2N7D A;  3OLM D;  4GDL B;  2LVP A;  4WWN A;  2IO0 B;  1OTR B;  4ICV A;  1WGG A;  4MH0 E;  1S1Q B;  3NHE B;  2DYB A;  4GDK A;  1C1Y B;  4HCN B;  4CHK A;  2PJH A;  4XX5 A;  3D32 A;  1WYW B;  2BF8 B;  4DHZ B;  2D2Q A;  2WYQ A;  2NBU A;  3DCG A;  1WGR A;  3ML9 A;  2IO2 B;  4KDI C;  1UEL A;  4B6W A;  2M17 A;  4XZ4 A;  3KH0 A;  3WAO A;  3PV1 A;  3WAP A;  3ZNH B;  1WMH A;  4FA6 A;  3IHP C;  3MJW A;  1UBQ A;  3VVW B;  2RSU A;  3A9K A;  2BYE A;  1LXD A;  5E6O A;  4HDO A;  3UF8 A;  3TMP B;  3VFK A;  3IFW B;  4LJO B;  3DDC B;  2LRW A;  1IP9 A;  3V62 A;  2NCN A;  4MEL A;  3H6N A;  1IYF A;  2CR5 A;  4W9H A;  2N9P C;  2LXC A;  3Q3J A;  4BKT A;  1LQB A;  3M62 B;  5JHA A;  2KWV B;  1J0G A;  4BBN F;  5AZH A;  4EZL A;  3AXC A;  1V86 A;  4FHK A;  3QAR A;  4MJS B;  3M63 B;  2KMC A;  4GSW A;  2V1Y A;  3WAM A;  2EKE C;  3R66 C;  2C9W B;  2R2Q A;  3R7R A;  4MDK E;  4NJ7 A;  3QAQ A;  1ZKH A;  3B08 A;  4MGZ E;  3KUC B;  3QA8 A;  4WJO A;  3RT3 B;  2KC1 A;  4HVB A;  3N30 A;  2LI5 A;  4CYE A;  4BVU C;  2M0X A;  4NY0 A;  1J19 A;  1V5O A;  1EF5 A;  4HXD A;  5AZF A;  4AJW A;  1YD8 U;  2JF5 A;  3ZTC A;  1WY8 A;  3BIN A;  3ZTD A;  1NBF C;  2CKH B;  4GB9 A;  3JSV A;  5CHF A;  4KV2 A;  3A9J A;  1J8C A;  4GDL A;  1KJT A;  2KAN A;  2KLG A;  4M0W B;  2N4F A;  3A4S C;  3H9D A;  1H8C A;  1H4R A;  3OJ4 B;  4DHZ E;  2W9N A;  5CTR C;  2MP2 A;  4TV3 A;  5LXH A;  3QC8 B;  2C5L C;  1WIA A;  2DZK A;  4ANW A;  1WJ6 A;  1I35 A;  2KMA A;  2KTF A;  2KWC A;  2LVO A;  2CHX A;  2O6V B;  4B9K A;  2KD0 A;  3QWZ B;  2K8H A;  5E6N A;  1QZE A;  4K7W A;  3RZF A;  3HHM A;  3ZUN A;  1E7V A;  4JQW C;  3UQA A;  5G55 A;  4W9I A;  4OVU A;  2Y5B B;  3PSE B;  4IUM B;  3DPD A;  2AWT A;  5DPT A;  4I6N B;  3W1Y A;  3LJ3 A;  5HKH A;  2NBV B;  4FJV B;  4GDK B;  2MBH A;  4GMV A;  4ZYN A;  1WGD A;  1XD3 B;  2GOW A;  2JXX A;  2KQ7 A;  2LGX A;  3U30 A;  3WAL A;  2KX3 A;  2KDB A;  3ENE A;  3M3J A;  2C7N B;  2PEA A;  1OQY A;  4G50 A;  5IA7 A;  4RM9 A;  1UZX B;  4OVV A;  1WR6 E;  1I42 A;  1S3S G;  1P98 A;  3L16 A;  1ZW7 A;  2YVC A;  1K8R B;  4RMA A;  3A9K B;  4LDT B;  4MGY E;  5DPW A;  4AWJ A;  1UH6 A;  3TCA A;  3QCA A;  4EUT A;  2KLC A;  2C7H A;  2K25 A;  2IO1 B;  3ONS A;  1JRU A;  2IY1 B;  1GJZ A;  1A5R A;  4MGK E;  2J7Q B;  4EOY A;  3N3K B;  2KKC A;  2RGF A;  4RM8 A;  2LZ6 A;  1SE9 A;  4DK5 A;  2GMI C;  3TL5 A;  3UGB B;  4FAD A;  4KIK A;  4K81 A;  3K9P B;  3S2A A;  2LWP A;  3GOE A;  5D7G A;  1RFA A;  1YIW A;  2G45 B;  3DBL I;  4DBG A;  2B3A A;  2KK8 A;  2IYD B;  3ZDM C;  4FLH A;  1GNU A;  4FBJ B;  5DPS A;  3CST A;  1X1M A;  5GMV A;  3NS8 A;  4NQL B;  2N1W A;  3VH3 B;  1YX6 B;  4M8M A;  2KQS A;  2L7R A;  3NZS A;  3A4R A;  4NNJ B;  2CHW A;  3QJZ A;  1EUV B;  2JUO A;  1XQQ A;  2QHO A;  4IWQ A;  5D94 A;  4P7I A;  2CHZ A;  2L00 B;  3TIX A;  3EHV A;  1WRD B;  3A9J B;  2MCN B;  2BYV E;  2PE6 B;  4MSM B;  1XT9 B;  4GXB A;  4IWP A;  3APF A;  3TJP A;  3R3M A;  5KHO A;  2O2V B;  1Z5S B;  2ZPY A;  4W9L A;  2MRP A;  4ICU A;  2JRH A;  4HDQ A;  4W9E A;  5AZG A;  2G3Q B;  4WJQ A;  2D10 A;  1F9J A;  3APD A;  3WA0 A;  3ALB A;  3N32 A;  3EFU A;  4NAW B;  5J18 A;  2VRR B;  4G3X B;  2IBI B;  2M4N A;  3A1Q A;  3VXW A;  4ANV A;  3JW0 X;  2Z0E B;  4HPM B;  1RAX A;  3L10 B;  1M94 A;  1VCB A;  1WJU A;  1WX9 A;  2JVC A;  3PRM B;  2MW5 A;  4M8N A;  4WWO A;  4HLE A;  3L17 A;  4IM0 A;  4W9G A;  3U8Z A;  3M95 A;  2REX A;  2CS4 A;  2ZCB A;  3R7Q A;  2UWQ A;  1IPG A;  4K7U A;  2YLM A;  3SU8 X;  1V49 A;  4AJY B;  4ZRK A;  2KWU B;  1Z2M A;  1GC7 A;  2DX5 B;  2AYO B;  1RRB A;  1WXA A;  2WWZ A;  2NPT B;  2KTR A;  4KZ0 A;  1WR1 A;  2N1V A;  4W9F A;  4J6I A;  3DOW A;  4IC7 B;  4JL9 A;  3ZO5 B;  2HD5 B;  1P9D U;  1UD7 A;  3H7P A;  3PPA A;  3PZD A;  1YJ1 A;  2DYO A;  4X57 B;  3B0A A;  1Y8R C;  3V6C B;  2I1K A;  1WFY A;  1KOT A;  2ZCC A;  3IG3 A;  3EEC A;  3VH4 B;  1WM2 A;  4EZK A;  5JH5 C;  3WIM A;  5C1Z A;  4A20 A;  2OJR A;  2DZI A;  5DPR A;  2KO3 A;  4EEW A;  3ZNI D;  4DXA B;  2HE7 A;  2V3S A;  3VQI A;  3RYT A;  4ZRI A;  4BKS D;  3PLV A;  3DBH I;  4GGQ A;  3KYC D;  5J17 A;  3HIZ A;  2J0K A;  4LCD E;  2DHZ A;  4TQ1 A;  2ZEQ A;  2XK5 B;  2XEW A;  2FUH B;  2K6D B;  2XBB C;  4PYZ A;  4TQ0 A;  4HWI B;  3PRZ A;  3I3T B;  1GUA B;  2IZV B;  4FN2 A;  3TBL D;  4I6P A;  2KDI A;  3VUX A;  2L3Z A;  2K1F A;  4E71 A;  4BFR A;  4KZC A;  4ZDV A;  2FAZ A;  3L13 A;  2C60 A;  2GBJ A;  5TR5 A;  2NS5 A;  2NR2 A;  4XC2 A;  2KFK A;  2GBK A;  2LGD A;  4FUL A;  2EMS A;  4GOC A;  4MM3 A;  3AUL A;  1OEY A;  5FR6 A;  1EF1 A;  3JYU A;  3MHS D;  1PQS A;  3DVN V;  3BY4 B;  1HE8 A;  2ZJD A;  2JWZ A;  3LDZ E;  2A4Z A;  2C7M B;  3U7D A;  3ZNZ B;  2FCS A;  2M8S A;  2NVU I;  4A3O A;  1G6J A;  2KZR A;  4DWF A;  2DZJ A;  3VAW A;  2EMT A;  3NY5 A;  4IWO A;  1V5T A;  3PGE A;  3X23 A;  3KW5 B;  1Q5W B;  1WMH B;  4AUQ C;  1V2Y A;  2KJH B;  3PHX B;  2RPQ A;  5C23 A;  4F1S A;  5CX3 A;  3A1Q B;  4HCP B;  3KVF B;  4AOF A;  2DYM A;  2OOB B;  3APC A;  4ANX A;  3L0W B;  2K8B A;  3PTF C;  1E8W A;  2JY6 A;  1WXM A;  2KX0 A;  4AP4 C;  1WJ4 A;  2DZM A;  4HPL B;  3QK0 A;  2ZVO A;  4I6L B;  4LDT D;  4E3C A;  3X0W A;  4NJ6 A;  3VUW A;  2LGY A;  4IW0 A;  2BKF A;  2FID A;  1NDD A;  4FJY A;  2LUE A;  3KUZ A;  4MJS A;  4NPN A;  2JZZ A;  3W1S A;  1WX7 A;  2MSE D;  2DAJ A;  1TZ1 A;  3PS6 A;  5AEK B;  1P1A A;  3UIN B;  1BT0 A;  3SDL C;  2BWE S;  4MGI E;  3QX1 A;  4BKS A;  3PT2 B;  1V9J A;  2KJ6 A;  2ASQ A;  3VTU A;  3H7S A;  1WF9 A;  2LVQ A;  3JSV B;  3C0R B;  3VTW A;  2LJ5 A;  2L0T A;  3V60 A;  4FHJ A;  4LJP B;  3UQB A;  3QHT A; 
#chains in the Genus database with same CATH topology
 1YJJ A;  2D3G A;  1IGD A;  2WX1 A;  1D6E C;  5I4D A;  1T0R C;  4K3C A;  1V6E A;  1R4M I;  1XEE A;  5L83 A;  4PS7 A;  3I57 A;  1HZ5 A;  2MP2 B;  1I4P A;  4LNF A;  5LNK 1;  3TUO A;  5H8Y E;  2KDE B;  1LFD A;  2LHD A;  1FNW A;  1LGR A;  2WDT B;  2J0M A;  3CF6 E;  2BYT A;  1Q10 A;  2ZZP B;  2RDB C;  1ZDV A;  3ZRF A;  3DWG C;  4A90 A;  1D5X C;  1VD2 A;  3L08 A;  3MTN B;  4WIP A;  4RF1 A;  3GZN I;  4W9J A;  1FO4 A;  1V80 A;  3MJ5 A;  4URK A;  1WH3 A;  3AM9 A;  2LGI A;  3O65 B;  4KIK B;  5IOI A;  1J7A A;  2J0J A;  4PYU A;  3VR8 B;  3ZDT A;  4EKU A;  5HG2 A;  3CMM B;  3AE5 B;  2BTE A;  3T3O A;  1P7E A;  1EO6 A;  1WXS A;  1JWM D;  2K3U A;  3RNB C;  2PE9 A;  1C4C A;  2E6X A;  3Q8E A;  1UF0 A;  4OVZ A;  4BZA A;  3Q6B A;  1KFY B;  3NVW A;  2GBR A;  1T5X D;  5J2R A;  4ZRP A;  2KYW A;  1L2N A;  2DEN B;  1WGY A;  2HJ1 A;  4JLC A;  5D2M B;  3ZLZ A;  3HK0 A;  2MBE A;  1J7C A;  2K8C A;  2DWQ A;  2FCQ A;  4C56 C;  1WGH A;  1ISN A;  1RLF A;  4WAF A;  4WWP A;  4KDL B;  2D3C A;  2MJD A;  2BGF A;  2NPT A;  2HTH A;  4RGM A;  2G4S A;  3KUD B;  5FK9 C;  3DVG Y;  2KVZ A;  5EE1 A;  3BZD B;  4JIO U;  3HVZ A;  2UU7 A;  4LLG M;  3V61 A;  1GC6 A;  4YT0 B;  3PLU A;  3T8M A;  2R61 A;  1JRP A;  1P3Q U;  2JZ3 B;  2J52 A;  3DBL B;  3OJ3 A;  1ZPS A;  3T9L A;  1V81 A;  4IG7 B;  3FAH A;  3QIJ A;  4NJC A;  4F8C B;  3NVV A;  2V4L A;  4K1R B;  1FXT B;  1LM8 B;  1WJN A;  4ITK A;  1ET9 A;  2N7E A;  3AED B;  3ML8 A;  4USA A;  4KKJ A;  4GIV A;  1FFV A;  1UBI A;  5CHW A;  2V0G A;  1TS4 A;  2BS4 B;  4ICV A;  3RNF C;  4MH0 E;  4S17 A;  4XGA B;  4CHK A;  2PJH A;  1F2R C;  1WYW B;  2K9X A;  2D2Q A;  2CJO A;  3ML9 A;  4HPP A;  2IO2 B;  1QLB B;  4XZ4 A;  3KH0 A;  3PV1 A;  1WMH A;  1ZE3 D;  1IBX B;  1N60 A;  1LXD A;  4HDO A;  3UF8 A;  3VFK A;  2ZW0 A;  4B0E A;  3DDC B;  3V62 A;  4MEL A;  2L83 A;  4ARC A;  1VZ8 A;  1K53 A;  3BVZ A;  4HEA 1;  1LQB A;  5JHA A;  2B76 B;  5AZH A;  3AXC A;  1V86 A;  4MJS B;  1HXY D;  4GSW A;  4NZL B;  3R66 C;  4MDK E;  1EWY C;  3RT3 B;  2LI5 A;  1J19 A;  1V5O A;  1YD8 U;  3ZTC A;  1FIQ A;  1WY8 A;  3BIN A;  2VZK D;  5CHF A;  1J8C A;  2KAN A;  4M0W B;  1D5M C;  2N4F A;  3A4S C;  4DHZ E;  5IN7 A;  1HTQ A;  4TV3 A;  4WH4 A;  5G5H A;  2C5L C;  1TY0 A;  4ANW A;  1WJ6 A;  3RMK C;  2KTF A;  2CHX A;  2J4X A;  4LNO A;  2K5P A;  5G55 A;  2VH1 A;  3PSE B;  4M00 A;  1HA5 A;  2NBV B;  4FJV B;  3U52 E;  2KDB A;  5IA7 A;  3GB1 A;  4OVV A;  1I42 A;  4C4V A;  3BII D;  4MGY E;  1HEZ E;  3QCA A;  2E3T A;  4EUT A;  3ONS A;  1AYF A;  4KX6 B;  4IOI E;  1I4G A;  4EOY A;  4RM8 A;  1SE9 A;  1TKE A;  2GMI C;  3UGB B;  4R3D A;  5AUI A;  2LWP A;  3GOE A;  5DPS A;  3FKY A;  3CST A;  1X1M A;  1JWB D;  1RYJ A;  4M8M A;  1DOI A;  2YEP B;  4IWQ A;  3TIX A;  2L00 B;  3KQ4 A;  3EHV A;  4MT5 A;  2MCN B;  1F2R I;  3BYT B;  3TJP A;  5KHO A;  2O2V B;  3C8Y A;  1SE2 A;  4ICU A;  2JU6 X;  4WJQ A;  2I2Y A;  2WDR B;  3A1Q A;  4CQN A;  1MG4 A;  1VZ7 A;  1WX9 A;  2MW5 A;  4WWO A;  3P63 A;  1QOA A;  3U8Z A;  1NVI D;  4RF0 A;  3R7Q A;  1IPG A;  1MHH E;  3KLS X;  2QSD A;  1Z2M A;  1GC7 A;  2DX5 B;  1WXA A;  2N1V A;  4JL9 A;  1P9D U;  5JXV A;  3OWE B;  4M02 A;  3AEG B;  1YJ1 A;  2LHE A;  1PYW D;  1PGA A;  1Y8R C;  1WFY A;  1FXI A;  3LB8 C;  3VH4 B;  1VZ6 A;  4EZK A;  1KF6 B;  1OFF A;  2V3S A;  3VQI A;  2H89 B;  2YEP F;  4BKS D;  3PLV A;  4TQ1 A;  2WNM A;  3RNE C;  3WCQ A;  4US8 A;  2WXL A;  2BS2 B;  3I3T B;  3TBL D;  2HDE A;  2KWD A;  2K1F A;  3GE3 C;  3HRD D;  4KZC A;  4ZDV A;  3AEB B;  2FAZ A;  3NJT A;  4L1B A;  2NS5 A;  1PFD A;  4GOC A;  4RFB A;  2EMS A;  3AUL A;  4LNI A;  5H92 C;  3U7D A;  5MPO A;  2KZR A;  3AH7 A;  1C79 A;  4Q2J A;  1F1H A;  3VAW A;  3NY5 A;  4HRO A;  2RPQ A;  4F1S A;  3A1Q B;  4B0M A;  1AN8 A;  2OOB B;  1V1O A;  4A9A A;  1VJK A;  1E8W A;  2JZP A;  3MFG A;  1FRD A;  1K52 A;  1NYR A;  1RFK A;  4NJ6 A;  3VUW A;  3KUZ A;  3W1S A;  1WX7 A;  2NMQ A;  1SXT A;  3MC9 A;  3PS6 A;  1P1A A;  3UIN B;  3QX1 A;  3H7S A;  3JSV B;  3C0R B;  4FHJ A;  1P7F A;  2KN4 A;  4US9 A;  2W82 A;  1R4N I;  2A5U A;  1IGC A;  4M01 A;  1Q0W B;  4EZJ A;  3DBR I;  5LLI A;  2G9H D;  2JX5 A;  2KT7 A;  1QF6 A;  1P0R A;  3PRE A;  1L0X B;  3DVN U;  3P4S B;  3HM3 A;  3DVG X;  4W9K A;  2MJE A;  2OED A;  1J7B A;  3RUI B;  1WZ0 A;  1E90 A;  2KN5 A;  4DXG A;  5D6J B;  1C4P A;  3BVM A;  3BYY B;  1SIJ A;  4UDU C;  2IY0 B;  1SSN A;  1MFW A;  1D3Z A;  3L54 A;  2D07 B;  4KSL C;  1TYG B;  4W9D A;  1C4A A;  5GXG B;  1NYQ A;  2KAC A;  1ZGU B;  2BT6 A;  3P4P B;  1PDX A;  3OAW A;  4II3 B;  1C3T A;  1YNT E;  2K39 A;  4ASW C;  3IT4 B;  4ZOH C;  2Z59 B;  4DDI D;  5E6J A;  4K7S A;  2KFJ A;  2AQ3 B;  1WE6 A;  1Q1O A;  5DCN A;  4XDC A;  2WX0 A;  4O1N A;  4HKQ A;  4KSK C;  4KGR A;  1UGM A;  2NBW B;  3AEC B;  4PT5 A;  4KGT A;  2PMV A;  3HVD A;  1T0S C;  2CU1 A;  1JWS D;  4ANU A;  3P42 A;  2BWF A;  1MHX A;  2IO3 B;  4TKN A;  1RM6 C;  3V6E B;  3CWI A;  4WJP A;  5IAA C;  2BYF A;  5JHB A;  1UUP A;  3A33 B;  2D3A A;  2K6Q A;  3KYD D;  2JYE A;  1EM7 A;  4LTU A;  1OGW A;  2HJ8 A;  4H2A A;  1E5W A;  2ZVN A;  1XLN A;  1ZUD 2;  3H7P B;  2FCN A;  2JT4 B;  4BOZ B;  1GG3 A;  3AU4 A;  1KLV A;  3B1L X;  3AU5 A;  3VHT C;  1NI2 A;  1ESF A;  2FCM A;  1SIF A;  2MWS B;  2LXA A;  1FNV A;  2LRU A;  5EDS A;  4F7Z A;  1F0Z A;  2DBY A;  2L0F A;  4HK2 A;  2MQJ A;  4KVG B;  2ZNV C;  1OQQ A;  2L05 A;  4ZHO A;  3U7Z A;  2I1J A;  3VRB B;  2N9L A;  2MJ3 A;  1KLG D;  3I5J C;  2O6V A;  2WU5 B;  2MX2 A;  3WAN A;  5CHV C;  4MM3 B;  2LVP A;  2LGS A;  2WS3 B;  1WGG A;  1S1Q B;  3NHE B;  3D32 A;  4IKG A;  3Q8A A;  3AB5 A;  3WAP A;  1QOG A;  1UBQ A;  2BYE A;  3Q3O C;  3BK2 A;  4LJO B;  1CZP A;  2NCN A;  1WGK A;  1IYF A;  2CR5 A;  2LXC A;  3M62 B;  4ARI A;  1J0G A;  4BBN F;  1F52 A;  1UWX A;  1YQ3 B;  3NVY A;  2KMC A;  4ZYS A;  2V1Y A;  2FUG 1;  2MH7 A;  1YJI A;  3R7R A;  2PIA A;  4NJ7 A;  3QAQ A;  1ZKH A;  3B08 A;  3QA8 A;  2KC1 A;  3RNG C;  4HVB A;  3N30 A;  4CYE A;  3SR6 A;  2M0X A;  4NY0 A;  1EF5 A;  4AJW A;  2RMM A;  1R7S A;  1FD6 A;  1TIF A;  1GB4 A;  2WP9 B;  5T8I A;  2HTM E;  1YMH E;  1ET6 A;  1H4R A;  2DNF A;  2W9N A;  5LXH A;  1B9R A;  1FPY A;  3QC8 B;  2DZK A;  1Y56 A;  2KWC A;  4RGT A;  2O6V B;  4B9K A;  5E6N A;  1E0Z A;  1QZE A;  4K7W A;  3ZUN A;  1E7V A;  2X8X X;  1C78 A;  3HUI A;  2AWT A;  3LJ3 A;  3LXF A;  4GMV A;  2EKI A;  2KQ7 A;  4ZYN A;  3WAL A;  2KX3 A;  3ENE A;  3M3J A;  1E6E B;  2C7N B;  2PEA A;  1E7P B;  2IJ0 A;  1S3S G;  1ZW7 A;  4RMA A;  4AWJ A;  1UH6 A;  1FXA A;  2L1A A;  3Q2A C;  4REZ A;  3O13 A;  2KLC A;  3E9S A;  2LUM A;  3VRA B;  2J7Q B;  1XO3 A;  2KKC A;  5EE0 A;  1RFA A;  3B2F A;  4QAY A;  2JQR B;  2IYD B;  3ZDM C;  2AQ2 B;  2QC8 A;  1XCT L;  2BBC A;  1I4H A;  2KQS A;  3A4R A;  2QHO A;  1XQQ A;  2CHZ A;  3BK1 A;  2NTT A;  1R4M B;  2BYV E;  2PE6 B;  4IWP A;  1Z5S B;  2BQQ A;  4HJG E;  4ZRQ A;  2JRH A;  5AZG A;  3WA0 A;  3N32 A;  3EFU A;  1L5P A;  5J18 A;  1M4V A;  4DXF A;  3VXW A;  3JW0 X;  2Z0E B;  1N63 A;  1RAX A;  3L10 B;  2INN E;  1M94 A;  1WJU A;  3PRM B;  4M8N A;  4HLE A;  3L17 A;  2OHF A;  2REX A;  4K7U A;  1FNU A;  3SU8 X;  1V49 A;  2KWU B;  3GZN B;  2FE8 A;  2NPT B;  2KTR A;  4KZ0 A;  1DOX A;  2W54 A;  4J6I A;  3DOW A;  4IC7 B;  1KRH A;  1YN5 A;  3NVZ A;  3DHI C;  2DYO A;  4X57 B;  3B0A A;  2I1K A;  1ZXI A;  1TJE A;  3EEC A;  5JH5 C;  1WM2 A;  1WXQ A;  2OJR A;  2DZI A;  1TS5 A;  4A20 A;  2KO3 A;  3ZNI D;  1N5X A;  3DBH B;  1V97 A;  3KYC D;  3HIZ A;  3TEY A;  4N58 A;  1CJE A;  3P4R B;  3AE8 B;  2XEW A;  4TQ0 A;  4PYZ A;  1T3Q A;  2RDH A;  4HWI B;  4YTN B;  4OZC A;  3PRZ A;  5HHD G;  1GUA B;  2IZV B;  4I6P A;  3PZ8 A;  3VUX A;  4E71 A;  1YQ4 B;  4BFR A;  4J3O D;  3L13 A;  2C60 A;  2GBJ A;  1BML C;  2WXG A;  2NR2 A;  2KFK A;  5IP4 D;  1ZOY B;  4DQO C;  1OEY A;  3NZ3 A;  3MHS D;  3BY4 B;  4YTP B;  1HE8 A;  2JWZ A;  2FCS A;  2NVU I;  1G6J A;  2L52 A;  4DWF A;  5IO9 A;  2EMT A;  3AEE B;  3KW5 B;  1WMH B;  1SE3 A;  4AOF A;  4A55 A;  3APC A;  3KWV A;  4HPL B;  5BMI A;  4IW0 A;  1D5Z C;  1GB1 A;  2FID A;  1OQR A;  2MSE D;  2DAJ A;  1V1P A;  1BT0 A;  4RH6 A;  2ASQ A;  3VTU A;  1JAL A;  3V60 A;  2Y5P A;  3RI7 C;  2WDQ B;  3HM6 X;  2MBQ A;  3OG5 A;  3ZVV A;  4CO7 A;  4D2K A;  4PS8 A;  4IDI A;  2AL3 A;  4DDG D;  2LMC A;  4S0R A;  1AAR A;  2GLS A;  2PKO A;  2KNB A;  2M56 B;  4TMA B;  1TY2 A;  4PS3 A;  2KFK B;  4N6E B;  2BKR B;  1A70 A;  3NOB A;  4ZRJ A;  2KC2 A;  4IM2 A;  3RD2 A;  3RNA C;  3I63 C;  2GB1 A;  3KWL A;  3E56 A;  2QCZ A;  1WXV A;  5G2N A;  2MBB B;  4C4V B;  2L8J A;  2AQ1 B;  3SFD B;  1UGJ A;  1YX5 B;  2WLB A;  2WXI A;  4NQK E;  1EU3 A;  2ZPN A;  2GRI A;  4N9F 4;  1L4Z B;  1VDV A;  2KQ4 X;  4II2 B;  1WX8 A;  2ON8 A;  3SEB A;  2KXJ A;  3N20 C;  1ZP0 B;  4P16 A;  1YN4 A;  3ZW3 A;  5L95 C;  1E8Y A;  2LD9 A;  2WXK A;  4E74 A;  4C80 A;  1TBE A;  1ROE A;  3VTV A;  1EU4 A;  1MPE A;  2Z0D B;  3Q69 A;  1E8Z A;  4N59 A;  4OHJ A;  2AX5 A;  3P2B A;  3ZNG C;  2O6V D;  3URY A;  3JVZ X;  5JZE B;  1I4R A;  4WAA A;  3UIP B;  1NEK B;  3DBS A;  4B95 A;  3P1M A;  3MC0 B;  4NAW A;  1FMA D;  1PGB A;  3K9O B;  4G0N B;  1HTO A;  4A3P A;  2JRI B;  1K51 A;  3H1U A;  2X38 A;  2KOX A;  1U4A A;  2IDY A;  1GAQ B;  3AEF B;  3AE7 B;  3ECI A;  2EEL A;  3NZU A;  2M0A A;  2FNJ B;  3DQV A;  4RCO A;  4XYC A;  5BO4 B;  2GBM A;  1VLB A;  4AS1 A;  2ACZ B;  2KVR A;  1E8X A;  2V4I B;  4GU2 A;  3AEA B;  1GOZ A;  1N6Z A;  1ENF A;  3R2T A;  3AV8 A;  1JRO A;  4YSY B;  1WZ3 A;  2W3R A;  3VUY A;  3V05 A;  1YN3 A;  1YQB A;  3V3X A;  2FIF A;  1FCL A;  1JML A;  1FFU A;  3RUL A;  2LAS A;  2AL6 A;  3CSF A;  2XK5 A;  3Q3M C;  1PUT A;  5C3J B;  4P1C C;  3Q3F A;  1E7U A;  2L76 A;  1T6B X;  4W9C A;  4DHJ B;  1FEH A;  2J53 A;  2N7D A;  3AE6 B;  2IO0 B;  3AMZ A;  4HCN B;  2Q5W D;  3R8B A;  2LFI A;  2BF8 B;  3MC8 A;  2N0S B;  4DHZ B;  2WYQ A;  2NBU A;  1WGR A;  4B6W A;  1UEL A;  3ZNH B;  4K3B A;  1ACC A;  4C7Y A;  2BVC A;  3IHP C;  1FCC C;  1QT9 A;  3A9K A;  5E6O A;  3J9C A;  3TMP B;  4RGN A;  2LRW A;  5EE9 A;  2N9K A;  1KLU D;  4W9H A;  2N9P C;  1TS3 A;  4A8X C;  1I7H A;  4FHK A;  2JWU A;  3M63 B;  3AE9 B;  2Z8L A;  2XN9 C;  2R2Q A;  1N61 A;  3NS1 A;  1CK1 A;  3EFC A;  4WJO A;  1WWT A;  2W55 A;  1QKZ A;  2JXT A;  3N1Y C;  5TSS A;  1WRI A;  1E9M A;  3ZYY X;  3PZ7 A;  1NBF C;  4KV2 A;  4GDL A;  1KJT A;  3IAM 1;  2TSS A;  3B9J A;  3H9D A;  1H8C A;  5CTR C;  2MP2 A;  4OZA A;  2QJL A;  4FXC A;  1UNS A;  1JQ4 A;  3GE8 C;  2LVO A;  1N62 A;  3ZXR A;  2K8H A;  3RZF A;  3HHM A;  4JQW C;  4W9I A;  4IUM B;  4BAX A;  4I6N B;  3W1Y A;  3TEZ A;  3TSS A;  3U30 A;  1BUI C;  1WGD A;  1XD3 B;  2GOW A;  1WYG A;  4P6V F;  1ZXH A;  4G50 A;  4KGS A;  3DWM A;  1UZX B;  1WR6 E;  2WU2 B;  3A9K B;  2ICI A;  1L0V B;  3W2D A;  2I38 A;  2KDM A;  2SAK A;  3TCA A;  1YOV B;  2BS3 B;  2BB6 A;  1A5R A;  4MGK E;  3N3K B;  2LZ6 A;  4KIK A;  4YSX B;  3K9P B;  3S2A A;  5D7G A;  3DBL I;  2KK8 A;  4FLH A;  4FBJ B;  4JE3 B;  4LNN A;  5GMV A;  3VH3 B;  4NQL B;  1XLP A;  1YX6 B;  2CHW A;  3QJZ A;  1EUV B;  2JUO A;  4ACF A;  4PK1 A;  1R4N B;  4MSM B;  4GXB A;  3APF A;  5BYQ A;  3R3M A;  2ZPY A;  3DBR B;  2WXR A;  4W9L A;  4HDQ A;  2G3Q B;  1F9J A;  3APD A;  3ALB A;  2QMT A;  2N7J A;  3N1X C;  4G3X B;  5IKC M;  1D4B A;  2JVC A;  1I4Q A;  4W9G A;  3M95 A;  2CS4 A;  2ZCB A;  5BYR A;  2YLM A;  1XCQ L;  4OW0 A;  4AJY B;  1NEN B;  2AYO B;  2WWZ A;  3DHG C;  5HI1 A;  3Q8C A;  1WR1 A;  4W9F A;  2HD5 B;  2WQY B;  3PPA A;  3PZD A;  4LNK A;  1KOT A;  4YXD B;  3RN9 C;  5DPR A;  1SBB B;  4DXA B;  4MAC A;  2HE7 A;  3ZGZ A;  3RYT A;  4ZRI A;  3DBH I;  3R2I A;  4GGQ A;  1XLQ A;  5BMG A;  5J17 A;  2DHZ A;  1QOF A;  2QDF A;  2ZEQ A;  2FUH B;  1SF0 A;  2K6D B;  1BXT A;  4FN2 A;  4XWT A;  1FRR A;  2L3Z A;  2WHI A;  1DYQ A;  1AW7 A;  4XC2 A;  2GBK A;  4XE0 A;  5FR6 A;  1EF1 A;  2V9H A;  3DVN V;  3U4E G;  4JPS A;  2A4Z A;  3Q8F A;  2M8S A;  2L32 A;  4A3O A;  1C77 A;  1TS2 A;  2DZJ A;  3GP7 A;  4IWO A;  1Q5W B;  4AUQ C;  1V2Y A;  3PHX B;  5C23 A;  4HCP B;  3KVF B;  1C76 A;  2IGD A;  2DYM A;  2PW9 A;  4ANX A;  3I9V 1;  1IBX A;  3L0W B;  2K8B A;  2J42 A;  2JY6 A;  1LO5 D;  2NTS A;  4AP4 C;  1WJ4 A;  2DZM A;  4LDT D;  3X0W A;  2LGY A;  4FJY A;  4MJS A;  4NPN A;  3RFZ B;  1B1Z A;  4WUR A;  5AEK B;  3SDL C;  2IGH A;  3AE1 B;  2BWE S;  1V9J A;  3VR9 B;  1WF9 A;  1IUE A;  3UQB A;  1JW9 D;  3IT6 B;  5D3I B;  2PLP A;  3BVG A;  4DHJ D;  1PGX A;  2AEH A;  4M0W A;  4TUU A;  3W5V B;  1OEY J;  2BB5 A;  4LK0 M;  2DAF A;  3LYY A;  3C19 A;  4RNA A;  2PPH A;  1T0Y A;  4GN1 A;  4HJK A;  1L4D B;  2N9E B;  3PVL A;  2M19 A;  2MLB A;  1V8C A;  2MBO A;  2D11 A;  4BOS C;  2V3N A;  4YL8 A;  5BMH A;  3U2S C;  4WQM A;  2KDF B;  2RDG A;  1SEB D;  1L6V A;  5KHQ A;  5E6P A;  4JGH B;  1TGZ B;  3ZIM A;  4WQO B;  4IM3 A;  1TKG A;  1CMX B;  2LJI A;  3FC4 A;  3MP9 A;  2R2O A;  2MA9 B;  2G4D B;  1TTN A;  2QIL A;  2IPK D;  4WJN A;  3VDZ A;  3IVF A;  3Q8B A;  2CU3 A;  5HFY A;  2W3S A;  1AWD A;  2RR9 A;  3W1S C;  1KTK A;  2GBN A;  3TEW A;  3AI5 A;  1SE4 A;  1SGH A;  2RD0 A;  4WWM A;  2PVG C;  3ZRC A;  3AE3 B;  2N9X A;  4OZB A;  1DGJ A;  3EC8 A;  2KHW B;  1TZO A;  1WI0 A;  2H88 B;  2O2V A;  3SD5 A;  1K50 A;  4G11 A;  2JPH A;  4FJZ A;  2INC C;  4BKG A;  4L2Y A;  3EA6 A;  2WXJ A;  3RCZ A;  4YWG G;  3N1Z C;  3GS2 A;  2WXP A;  1GPX A;  5D3D A;  1MJD A;  3TEX A;  3NG0 A;  2WXM A;  1NI3 A;  2WXO A;  1KM7 A;  2KTR B;  3PHW B;  3PO0 A;  4KKI A;  3RZW C;  4JX1 C;  2M1M A;  1RWS A;  1VR9 A;  3ZJV A;  4P1B C;  2UYZ B;  3QQ8 B;  2WXQ A;  2ZNV B;  4EFO A;  3IBE A;  3UIO B;  2WXN A;  2BPS A;  2DLB A;  2WGS A;  1WM3 A;  3FIL A;  4MSQ B;  3SHQ A;  1L7Y A;  3ZKJ C;  4BBN C;  2JSV X;  2XNA C;  1WE7 A;  1L6U A;  1MG8 A;  4MEM A;  2V3P A;  2KJR A;  3PRP B;  2D5G A;  3P4Q B;  5G5G A;  1SB3 C;  5LXI B;  3OLM D;  4WWN A;  3AE4 B;  2IGG A;  1OTR B;  3L4P A;  2WXH A;  4HRS A;  2DYB A;  4GDK A;  1C1Y B;  4XX5 A;  2WDV B;  1CQV A;  3DCG A;  4KDI C;  2M17 A;  3Q14 C;  3WAO A;  4FA6 A;  3MJW A;  3VVW B;  2RSU A;  2ONQ A;  3IFW B;  1IP9 A;  1QIL A;  3H6N A;  2RPV A;  1SJH D;  1EWC A;  3Q3J A;  4BKT A;  5AUK A;  1I4X A;  2KWV B;  4AQ7 A;  4EZL A;  3AN1 A;  3QAR A;  3WAM A;  2EKE C;  1V1P B;  2C9W B;  4MGZ E;  3KUC B;  2LEK A;  2JYT A;  2KMM A;  4BVU C;  3IXS A;  2ZW1 A;  5AZF A;  4HXD A;  3NRZ A;  4XWW A;  2JF5 A;  3ZTD A;  2PTL A;  3FIL B;  2CKH B;  4GB9 A;  3JSV A;  3A9J A;  1F77 A;  3Q3N C;  2KLG A;  3CIR B;  3OJ4 B;  1E10 A;  2K0P A;  1WIA A;  1I35 A;  2KMA A;  3NUH B;  2KD0 A;  3QWZ B;  2WXF A;  3ZQ4 A;  3EUB 2;  4YSZ B;  3UQA A;  3BWU D;  2Y5B B;  4OVU A;  4EE2 A;  3DPD A;  5DPT A;  5FR3 A;  2SEB D;  5HKH A;  4GDK B;  2MBH A;  1WSP A;  2JXX A;  2LGX A;  5C2T B;  1OQY A;  4TSS A;  1TKY A;  1HQR D;  3N9Y C;  4RM9 A;  1P98 A;  3L16 A;  2YVC A;  1K8R B;  4C7Z A;  1L0Y B;  4LDT B;  5DPW A;  4HKZ E;  2C7H A;  2K25 A;  2IO1 B;  1ZDX A;  1JRU A;  2PVO D;  2IY1 B;  3QHT A;  1GJZ A;  3AE2 B;  2RGF A;  4DK5 A;  3TL5 A;  4FAD A;  4K81 A;  1YIW A;  2G45 B;  4DBG A;  2B3A A;  2IND C;  2INP E;  3W9C B;  1GNU A;  4XDD A;  3NS8 A;  2N1W A;  3W5U B;  2L7R A;  3NZS A;  2G1E A;  3SFE B;  2Y5C A;  4NNJ B;  1QOB A;  5D94 A;  4P7I A;  1XLO A;  1JWA D;  1WRD B;  1XXG A;  3A9J B;  3DHH C;  2QEJ C;  2QIE B;  4ZHP A;  1XT9 B;  2KAJ A;  4MH8 A;  1XF5 L;  2MRP A;  4W9E A;  2D3B A;  2D10 A;  2K22 A;  1QQR A;  3B2G A;  1UWM A;  1STE A;  4NAW B;  3MHZ A;  1MI0 A;  2VRR B;  2IBI B;  2M4N A;  3IAS 1;  4ANV A;  5EE3 A;  1MVK A;  4HPM B;  4RGO S;  1VCB A;  2VH2 A;  4IM0 A;  2UWQ A;  2MEK A;  1KH0 A;  4ZRK A;  1RRB A;  1VRA B;  1TT5 B;  1FM0 D;  3ZO5 B;  1UD7 A;  2Y3A A;  3H7P A;  4JWS C;  3V6C B;  5BYS A;  2ZCC A;  3IG3 A;  2FBW B;  3WIM A;  5C1Z A;  4EEW A;  3ZJU A;  2BW2 A;  4L23 A;  4A6Q A;  4C00 A;  1JCK B;  2J0K A;  4LCD E;  5FKA C;  2XK5 B;  2XBB C;  1N5W A;  2VZK B;  3T3N A;  2KDI A;  3H8H A;  1SJE D;  5TR5 A;  2LGD A;  4FUL A;  4MM3 A;  3JYU A;  1PQS A;  3ZXV A;  1DOY A;  2ZJD A;  2MHJ A;  4JWU C;  3LDZ E;  3ABV B;  2C7M B;  4YTM B;  3ZNZ B;  3RNC C;  3EGR A;  1V5T A;  3PGE A;  4GLS C;  3X23 A;  2KJH B;  5CX3 A;  3ETR A;  3RPF C;  3PTF C;  1C9F A;  1WXM A;  2KX0 A;  3QK0 A;  2ZVO A;  4I6L B;  4E3C A;  2BKF A;  1NDD A;  4NAM A;  2LUE A;  1HZ6 A;  2JZZ A;  2OJW A;  1TZ1 A;  2CJN A;  1T0Q C;  2GI9 A;  4MGI E;  1JWU D;  4BKS A;  3PT2 B;  2KJ6 A;  3ZJT A;  2LVQ A;  3VTW A;  2LJ5 A;  2L0T A;  4LJP B;  4GDL B;  3UI3 A; 
#chains in the Genus database with same CATH homology
 2D3G A;  2WX1 A;  3HM6 X;  2MBQ A;  1V6E A;  1R4M I;  3ZVV A;  4CO7 A;  4DHJ D;  4PS7 A;  5L83 A;  1R4N I;  2AEH A;  2MP2 B;  4PS8 A;  4TUU A;  2A5U A;  2AL3 A;  1OEY J;  4DDG D;  1Q0W B;  2DAF A;  4EZJ A;  1AAR A;  3DBR I;  2PPH A;  1T0Y A;  4GN1 A;  4HJK A;  2KNB A;  5LLI A;  2KDE B;  1LFD A;  2N9E B;  4PS3 A;  2KFK B;  3PVL A;  2BKR B;  2MLB A;  1P0R A;  3PRE A;  2WDT B;  3NOB A;  2J0M A;  3CF6 E;  3DVN U;  2MBO A;  4ZRJ A;  2KC2 A;  2D11 A;  4IM2 A;  3RD2 A;  3HM3 A;  3DVG X;  2ZZP B;  4BOS C;  4YL8 A;  3ZRF A;  4W9K A;  2KDF B;  1VD2 A;  1WXV A;  5G2N A;  3RUI B;  2MBB B;  1WZ0 A;  5KHQ A;  1E90 A;  2KN5 A;  5E6P A;  2L8J A;  3L08 A;  5D6J B;  3MTN B;  4JGH B;  1TGZ B;  1YX5 B;  3GZN I;  3ZIM A;  4WQO B;  4IM3 A;  4NQK E;  1CMX B;  2IY0 B;  2ZPN A;  4W9J A;  4N9F 4;  4II2 B;  1V80 A;  1WX8 A;  1D3Z A;  4URK A;  1WH3 A;  3L54 A;  2D07 B;  2R2O A;  2MA9 B;  4KSL C;  3O65 B;  4W9D A;  4KIK B;  2KXJ A;  2G4D B;  1TTN A;  2J0J A;  1ZGU B;  4PYU A;  4WJN A;  3ZDT A;  4EKU A;  3CMM B;  3VDZ A;  3IVF A;  1EO6 A;  3OAW A;  3ZW3 A;  4II3 B;  5L95 C;  1WXS A;  1E8Y A;  1C3T A;  2LD9 A;  2K39 A;  4ASW C;  2RR9 A;  4E74 A;  3W1S C;  2Z59 B;  1TBE A;  4DDI D;  4K7S A;  2KFJ A;  3VTV A;  2Z0D B;  1E8Z A;  1WE6 A;  1Q1O A;  5DCN A;  2PE9 A;  2GBN A;  3AI5 A;  3P2B A;  2WX0 A;  1SGH A;  2RD0 A;  3ZRC A;  3ZNG C;  2O6V D;  2N9X A;  3JVZ X;  4KSK C;  5JZE B;  2GBR A;  3EC8 A;  2KHW B;  5J2R A;  1WI0 A;  1UGM A;  2NBW B;  4WAA A;  2O2V A;  2DEN B;  1L2N A;  1WGY A;  3SD5 A;  3UIP B;  4JLC A;  4G11 A;  2JPH A;  2CU1 A;  5D2M B;  3ZLZ A;  3DBS A;  3HK0 A;  4B95 A;  4FJZ A;  4ANU A;  2BWF A;  4NAW A;  2MBE A;  3K9O B;  4BKG A;  4G0N B;  2IO3 B;  4TKN A;  3RCZ A;  2K8C A;  3V6E B;  4A3P A;  2FCQ A;  2JRI B;  1WGH A;  4WJP A;  3H1U A;  5IAA C;  2BYF A;  2KOX A;  1U4A A;  5JHB A;  3A33 B;  1ISN A;  1RLF A;  2K6Q A;  3KYD D;  4WWP A;  3ECI A;  3NZU A;  4KDL B;  2FNJ B;  1KM7 A;  1OGW A;  2KTR B;  2HJ8 A;  3DQV A;  3PHW B;  1E5W A;  2BGF A;  2ZVN A;  2NPT A;  3RZW C;  2HTH A;  5BO4 B;  2M1M A;  3H7P B;  2FCN A;  2GBM A;  2G4S A;  3KUD B;  2JT4 B;  4BOZ B;  1GG3 A;  3AU4 A;  3DVG Y;  1KLV A;  3B1L X;  3AU5 A;  3VHT C;  1NI2 A;  2UYZ B;  2KVR A;  3QQ8 B;  4JIO U;  1E8X A;  4GU2 A;  2FCM A;  2ZNV B;  3V61 A;  1GC6 A;  4EFO A;  1SIF A;  3PLU A;  3T8M A;  2MWS B;  3IBE A;  3UIO B;  2LXA A;  2JZ3 B;  1P3Q U;  1WZ3 A;  2BPS A;  3SHQ A;  1WM3 A;  4MSQ B;  2LRU A;  1L7Y A;  3OJ3 A;  3VUY A;  3ZKJ C;  5EDS A;  1YQB A;  3T9L A;  1V81 A;  4F7Z A;  2L0F A;  4HK2 A;  3QIJ A;  4IG7 B;  4BBN C;  2FIF A;  2MQJ A;  4KVG B;  2ZNV C;  1WE7 A;  3RUL A;  2LAS A;  2L05 A;  2AL6 A;  1MG8 A;  3CSF A;  4MEM A;  4F8C B;  2V4L A;  2XK5 A;  4K1R B;  2I1J A;  2KJR A;  1FXT B;  1LM8 B;  3PRP B;  1WJN A;  3Q3F A;  1E7U A;  2L76 A;  2N7E A;  2O6V A;  3ML8 A;  4W9C A;  4DHJ B;  2MX2 A;  3WAN A;  4GIV A;  5CHV C;  1UBI A;  5CHW A;  5LXI B;  2N7D A;  3OLM D;  4GDL B;  2LVP A;  4WWN A;  2IO0 B;  1OTR B;  4ICV A;  1WGG A;  4MH0 E;  1S1Q B;  3NHE B;  2DYB A;  4GDK A;  1C1Y B;  4HCN B;  4CHK A;  2PJH A;  4XX5 A;  3D32 A;  1WYW B;  2BF8 B;  4DHZ B;  2D2Q A;  2WYQ A;  2NBU A;  3DCG A;  1WGR A;  3ML9 A;  2IO2 B;  4KDI C;  1UEL A;  4B6W A;  2M17 A;  4XZ4 A;  3KH0 A;  3WAO A;  3PV1 A;  3WAP A;  3ZNH B;  1WMH A;  4FA6 A;  3IHP C;  3MJW A;  1UBQ A;  3VVW B;  2RSU A;  3A9K A;  2BYE A;  1LXD A;  5E6O A;  4HDO A;  3UF8 A;  3TMP B;  3VFK A;  3IFW B;  4LJO B;  3DDC B;  2LRW A;  1IP9 A;  3V62 A;  2NCN A;  4MEL A;  3H6N A;  1IYF A;  2CR5 A;  4W9H A;  2N9P C;  2LXC A;  3Q3J A;  4BKT A;  1LQB A;  3M62 B;  5JHA A;  2KWV B;  1J0G A;  4BBN F;  5AZH A;  4EZL A;  3AXC A;  1V86 A;  4FHK A;  3QAR A;  4MJS B;  3M63 B;  2KMC A;  4GSW A;  2V1Y A;  3WAM A;  2EKE C;  3R66 C;  2C9W B;  2R2Q A;  3R7R A;  4MDK E;  4NJ7 A;  3QAQ A;  1ZKH A;  3B08 A;  4MGZ E;  3KUC B;  3QA8 A;  4WJO A;  3RT3 B;  2KC1 A;  4HVB A;  3N30 A;  2LI5 A;  4CYE A;  4BVU C;  2M0X A;  4NY0 A;  1J19 A;  1V5O A;  1EF5 A;  4HXD A;  5AZF A;  4AJW A;  1YD8 U;  2JF5 A;  3ZTC A;  1WY8 A;  3BIN A;  3ZTD A;  1NBF C;  2CKH B;  4GB9 A;  3JSV A;  5CHF A;  4KV2 A;  3A9J A;  1J8C A;  4GDL A;  1KJT A;  2KAN A;  2KLG A;  4M0W B;  2N4F A;  3A4S C;  3H9D A;  1H8C A;  1H4R A;  3OJ4 B;  4DHZ E;  2W9N A;  5CTR C;  2MP2 A;  4TV3 A;  5LXH A;  3QC8 B;  2C5L C;  1WIA A;  2DZK A;  4ANW A;  1WJ6 A;  1I35 A;  2KMA A;  2KTF A;  2KWC A;  2LVO A;  2CHX A;  2O6V B;  4B9K A;  2KD0 A;  3QWZ B;  2K8H A;  5E6N A;  1QZE A;  4K7W A;  3RZF A;  3HHM A;  3ZUN A;  1E7V A;  4JQW C;  3UQA A;  5G55 A;  4W9I A;  4OVU A;  2Y5B B;  3PSE B;  4IUM B;  3DPD A;  2AWT A;  5DPT A;  4I6N B;  3W1Y A;  3LJ3 A;  5HKH A;  2NBV B;  4FJV B;  4GDK B;  2MBH A;  4GMV A;  4ZYN A;  1WGD A;  1XD3 B;  2GOW A;  2JXX A;  2KQ7 A;  2LGX A;  3U30 A;  3WAL A;  2KX3 A;  2KDB A;  3ENE A;  3M3J A;  2C7N B;  2PEA A;  1OQY A;  4G50 A;  5IA7 A;  4RM9 A;  1UZX B;  4OVV A;  1WR6 E;  1I42 A;  1S3S G;  1P98 A;  3L16 A;  1ZW7 A;  2YVC A;  1K8R B;  4RMA A;  3A9K B;  4LDT B;  4MGY E;  5DPW A;  4AWJ A;  1UH6 A;  3TCA A;  3QCA A;  4EUT A;  2KLC A;  2C7H A;  2K25 A;  2IO1 B;  3ONS A;  1JRU A;  2IY1 B;  1GJZ A;  1A5R A;  4MGK E;  2J7Q B;  4EOY A;  3N3K B;  2KKC A;  2RGF A;  4RM8 A;  2LZ6 A;  1SE9 A;  4DK5 A;  2GMI C;  3TL5 A;  3UGB B;  4FAD A;  4KIK A;  4K81 A;  3K9P B;  3S2A A;  2LWP A;  3GOE A;  5D7G A;  1RFA A;  1YIW A;  2G45 B;  3DBL I;  4DBG A;  2B3A A;  2KK8 A;  2IYD B;  3ZDM C;  4FLH A;  1GNU A;  4FBJ B;  5DPS A;  3CST A;  1X1M A;  5GMV A;  3NS8 A;  4NQL B;  2N1W A;  3VH3 B;  1YX6 B;  4M8M A;  2KQS A;  2L7R A;  3NZS A;  3A4R A;  4NNJ B;  2CHW A;  3QJZ A;  1EUV B;  2JUO A;  1XQQ A;  2QHO A;  4IWQ A;  5D94 A;  4P7I A;  2CHZ A;  2L00 B;  3TIX A;  3EHV A;  1WRD B;  3A9J B;  2MCN B;  2BYV E;  2PE6 B;  4MSM B;  1XT9 B;  4GXB A;  4IWP A;  3APF A;  3TJP A;  3R3M A;  5KHO A;  2O2V B;  1Z5S B;  2ZPY A;  4W9L A;  2MRP A;  4ICU A;  2JRH A;  4HDQ A;  4W9E A;  5AZG A;  2G3Q B;  4WJQ A;  2D10 A;  1F9J A;  3APD A;  3WA0 A;  3ALB A;  3N32 A;  3EFU A;  4NAW B;  5J18 A;  2VRR B;  4G3X B;  2IBI B;  2M4N A;  3A1Q A;  3VXW A;  4ANV A;  3JW0 X;  2Z0E B;  4HPM B;  1RAX A;  3L10 B;  1M94 A;  1VCB A;  1WJU A;  1WX9 A;  2JVC A;  3PRM B;  2MW5 A;  4M8N A;  4WWO A;  4HLE A;  3L17 A;  4IM0 A;  4W9G A;  3U8Z A;  3M95 A;  2REX A;  2CS4 A;  2ZCB A;  3R7Q A;  2UWQ A;  1IPG A;  4K7U A;  2YLM A;  3SU8 X;  1V49 A;  4AJY B;  4ZRK A;  2KWU B;  1Z2M A;  1GC7 A;  2DX5 B;  2AYO B;  1RRB A;  1WXA A;  2WWZ A;  2NPT B;  2KTR A;  4KZ0 A;  1WR1 A;  2N1V A;  4W9F A;  4J6I A;  3DOW A;  4IC7 B;  4JL9 A;  3ZO5 B;  2HD5 B;  1P9D U;  1UD7 A;  3H7P A;  3PPA A;  3PZD A;  1YJ1 A;  2DYO A;  4X57 B;  3B0A A;  1Y8R C;  3V6C B;  2I1K A;  1WFY A;  1KOT A;  2ZCC A;  3IG3 A;  3EEC A;  3VH4 B;  1WM2 A;  4EZK A;  5JH5 C;  3WIM A;  5C1Z A;  4A20 A;  2OJR A;  2DZI A;  5DPR A;  2KO3 A;  4EEW A;  3ZNI D;  4DXA B;  2HE7 A;  2V3S A;  3VQI A;  3RYT A;  4ZRI A;  4BKS D;  3PLV A;  3DBH I;  4GGQ A;  3KYC D;  5J17 A;  3HIZ A;  2J0K A;  4LCD E;  2DHZ A;  4TQ1 A;  2ZEQ A;  2XK5 B;  2XEW A;  2FUH B;  2K6D B;  2XBB C;  4PYZ A;  4TQ0 A;  4HWI B;  3PRZ A;  3I3T B;  1GUA B;  2IZV B;  4FN2 A;  3TBL D;  4I6P A;  2KDI A;  3VUX A;  2L3Z A;  2K1F A;  4E71 A;  4BFR A;  4KZC A;  4ZDV A;  2FAZ A;  3L13 A;  2C60 A;  2GBJ A;  5TR5 A;  2NS5 A;  2NR2 A;  4XC2 A;  2KFK A;  2GBK A;  2LGD A;  4FUL A;  2EMS A;  4GOC A;  4MM3 A;  3AUL A;  1OEY A;  5FR6 A;  1EF1 A;  3JYU A;  3MHS D;  1PQS A;  3DVN V;  3BY4 B;  1HE8 A;  2ZJD A;  2JWZ A;  3LDZ E;  2A4Z A;  2C7M B;  3U7D A;  3ZNZ B;  2FCS A;  2M8S A;  2NVU I;  4A3O A;  1G6J A;  2KZR A;  4DWF A;  2DZJ A;  3VAW A;  2EMT A;  3NY5 A;  4IWO A;  1V5T A;  3PGE A;  3X23 A;  3KW5 B;  1Q5W B;  1WMH B;  4AUQ C;  1V2Y A;  2KJH B;  3PHX B;  2RPQ A;  5C23 A;  4F1S A;  5CX3 A;  3A1Q B;  4HCP B;  3KVF B;  4AOF A;  2DYM A;  2OOB B;  3APC A;  4ANX A;  3L0W B;  2K8B A;  3PTF C;  1E8W A;  2JY6 A;  1WXM A;  2KX0 A;  4AP4 C;  1WJ4 A;  2DZM A;  4HPL B;  3QK0 A;  2ZVO A;  4I6L B;  4LDT D;  4E3C A;  3X0W A;  4NJ6 A;  3VUW A;  2LGY A;  4IW0 A;  2BKF A;  2FID A;  1NDD A;  4FJY A;  2LUE A;  3KUZ A;  4MJS A;  4NPN A;  2JZZ A;  3W1S A;  1WX7 A;  2MSE D;  2DAJ A;  1TZ1 A;  3PS6 A;  5AEK B;  1P1A A;  3UIN B;  1BT0 A;  3SDL C;  2BWE S;  4MGI E;  3QX1 A;  4BKS A;  3PT2 B;  1V9J A;  2KJ6 A;  2ASQ A;  3VTU A;  3H7S A;  1WF9 A;  2LVQ A;  3JSV B;  3C0R B;  3VTW A;  2LJ5 A;  2L0T A;  3V60 A;  4FHJ A;  4LJP B;  3UQB A;  3QHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...