2ZJDA

Crystal structure of lc3-p62 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
121
Chain Sequence
PSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis inhibitor/apoptosis
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B precurs
publication title Structural Basis for Sorting Mechanism of p62 in Selective Autophagy
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 121
sequence length 121
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zjdA00
2LRUA 2ZCBA 4CYEA 4KDIC 2MA9B 3PHWB 1J8CA 1LQBA 1EUVB 1C3TA 3R7QA 5EDSA 3ZVVA 2RD0A 2MLBA 1NDDA 1IYFA 1A5RA 1LXDA 4B95A 1WJ4A 4JQWC 2GOWA 2NPTA 4DBGA 3VH3B 3DVGX 1TBEA 2JWZA 3PZDA 2JXXA 2DYOA 4HDQA 1J19A 3ALBA 2A4ZA 5D2MB 2UWQA 3LJ3A 5LLIA 4W9HA 2KJHB 3DBSA 3PLVA 2FCNA 4EOYA 3CSTA 2KVRA 3A9JB 3KUDB 3Q3JA 2KK8A 4FLHA 4I6NB 3ZTCA 4FN2A 3APDA 3ZDTA 5G2NA 4WQOB 2BYFA 3PVLA 4HCNB 3ZNHB 3SD5A 2O6VD 3ZUNA 2FCMA 3JVZX 1OTRB 2WX1A 2KWVB 2L05A 3OJ4B 4NJ7A 2DZKA 2XK5B 3VUYA 2BF8B 3CF6E 4GDKB 2ASQA 2AL6A 3A9JA 2C5LC 4W9IA 1WX9A 4DDID 3ZNGC 4ZRJA 2ZZPB 3H7PB 1UZXB 2RR9A 4NQKE 1WXMA 2RSUA 1GJZA 4GU2A 3PTFC 3MJWA 3AU5A 3VXWA 1TZ1A 2L7RA 4G50A 2FNJB 3UF8A 2XK5A 3VQIA 2XBBC 1Q0WB 2KXJA 3PRZA 1UBQA 4GDKA 2L0FA 2KQ7A 1Z2MA 4NPNA 1EF5A 1VD2A 3KH0A 4MELA 4ZRKA 1BT0A 4I6PA 4MSQB 5IAAC 2M8SA 4EZLA 3ZIMA 3DOWA 1WFYA 2G4SA 3TBLD 4IUMB 3H7PA 2LJ5A 4EUTA 3AU4A 1H8CA 2KTFA 3RYTA 3Q3FA 3I3TB 1WX8A 3DBLI 2K6QA 2MWSB 5GMVA 3X0WA 4CO7A 3DCGA 3WAPA 3ZDMC 1GUAB 4KSKC 2RPQA 4NJ6A 3SU8X 5AZFA 1WY8A 3KVFB 3RUIB 3H6NA 5E6NA 2G4DB 3A1QB 3T9LA 3VUWA 2KJ6A 2LVOA 4MM3A 1WXSA 3NY5A 1E8ZA 2HJ8A 1P1AA 2ZJDA 4JLCA 3L13A 1WMHB 1KJTA 5J17A 2KKCA 3V6CB 2YVCA 3PHXB 4GXBA 2K25A 2XEWA 4HPLB 5DPSA 4URKA 3CSFA 2C7HA 4KVGB 1X1MA 3VFKA 3V62A 2KFKB 1V49A 2V1YA 3ZRCA 2KOXA 2BWFA 2EKEC 3A1QA 3EHVA 4KZ0A 3D32A 4TV3A 4BOSC 5D94A 1WXAA 3QCAA 2BWES 2R2QA 2KD0A 3ECIA 3ZNID 1Y8RC 1E5WA 2KMAA 3M62B 4MEMA 2NBUA 2JY6A 2K8BA 1XD3B 2DZMA 1EF1A 4MGKE 2NCNA 1E90A 2D2QA 2MBHA 3APFA 2FCQA 4LDTD 5JH5C 3DVGY 4BBNF 1R4NI 2PJHA 2KQSA 2KX0A 2JZZA 4W9LA 3PRMB 3WA0A 1WR1A 2KFKA 2IO1B 2J7QB 1YQBA 2KDIA 4IM0A 5KHOA 4IW0A 1WE7A 3WALA 4B9KA 4MDKE 3QQ8B 4OVUA 4ANVA 1E7UA 1C1YB 2M0XA 5AZHA 2I1KA 4LJOB 3NOBA 3N30A 4I6LB 1KOTA 4ZRIA 2IY1B 2BYVE 1ISNA 2REXA 2Z0EB 4PYZA 4DHJB 5LXIB 4GMVA 4AUQC 3HK0A 5CX3A 1XQQA 2KLGA 1LM8B 2LXAA 2YLMA 1CMXB 3RT3B 1E7VA 3UINB 4W9DA 4IWOA 2IBIB 4XZ4A 1Q5WB 3H7SA 4FULA 1E8XA 2N1VA 2N4FA 3GOEA 3KUZA 4RM9A 1WGYA 2FCSA 2O6VB 5CHWA 3RD2A 3TCAA 2KN5A 3B08A 3DVNV 2GBMA 1V2YA 4NAWB 1WI0A 2N9PC 2MW5A 2KC1A 5BO4B 4XX5A 1UH6A 1JRUA 3ZTDA 3ZLZA 3PGEA 1RFAA 4A3OA 1RAXA 3M63B 3QHTA 1OGWA 4II3B 3SHQA 3UIPB 3HIZA 2ZNVC 2LRWA 2HE7A 3WANA 2KNBA 4FJZA 5DPWA 2GBRA 5AEKB 2C7MB 5G55A 2NS5A 1KM7A 2KTRB 4E74A 2N1WA 1PQSA 1VCBA 4P7IA 1P3QU 2O6VA 1U4AA 3BY4B 4GDLB 2C9WB 1YX6B 2L00B 1WJ6A 3VTVA 2ZEQA 3OJ3A 2ZPNA 1WX7A 4KDLB 5D7GA 4B6WA 3L0WB 2G3QB 3PSEB 2LI5A 3NZUA 4WWNA 2LZ6A 2NVUI 4TQ0A 1E8YA 1GG3A 4MGYE 2NBVB 3ZNZB 5J18A 2VRRB 3L54A 4PS3A 2KDEB 2KTRA 3ONSA 2C7NB 2MBOA 4ANXA 1K8RB 2FIFA 2MP2B 3N32A 4KV2A 1SE9A 3ENEA 3ZO5B 4EEWA 3PLUA 3B1LX 2J0MA 4JL9A 2BKFA 4F1SA 4WJQA 4KZCA 4G0NB 3QIJA 4GDLA 4MH0E 3RZFA 2AEHA 3OLMD 5TR5A 5L95C 3KYCD 4FA6A 4W9KA 5E6PA 1TGZB 2AL3A 5DCNA 4DXAB 1P9DU 3DBHI 4CHKA 3MHSD 3SDLC 2FIDA 3T8MA 1OEYA 2BKRB 2GBKA 4ICUA 4JGHB 3L08A 2KX3A 2NBWB 3QX1A 2IY0B 2MP2A 3B0AA 2DYMA 2KHWB 5E6OA 3V6EB 4EFOA 4HWIB 1V5OA 1ZW7A 1XT9B 2JZ3B 3QAQA 4ZDVA 3PT2B 4IG7B 1MG8A 4HVBA 3APCA 1P98A 2PEAA 3LDZE 2HD5B 1M94A 2LVQA 3K9PB 1UELA 1IP9A 2MSED 1NBFC 3ZW3A 3DVNU 3QA8A 1I35A 1V5TA 3ML9A 2DHZA 3PPAA 2KMCA 4WJPA 2JRIB 4IC7B 4WJOA 3JSVB 4HCPB 4F8CB 1P0RA 4KSLC 1WGDA 2M17A 3MTNB 4FADA 2RGFA 1IPGA 1WYWB 1UBIA 1WIAA 3L16A 3HM6X 4LDTB 2PPHA 1WXVA 3W1SA 4LCDE 2CKHB 5JHBA 2B3AA 2CU1A 5KHQA 4K7SA 1WMHA 3QJZA 1KLVA 4JIOU 2KANA 4HXDA 3PS6A 1EO6A 1SIFA 2GMIC 4W9FA 3VHTC 3VTUA 3JSVA 3A4RA 3PREA 4WAAA 2N9XA 2ZVOA 3DDCB 1D3ZA 3QK0A 3VH4B 1S1QB 2WDTB 4K7WA 3VUXA 4MSMB 1WR6E 4GIVA 4KIKB 1GC6A 3CMMB 4DHJD 4ANUA 1WZ3A 1WGRA 2L0TA 4K81A 4EZJA 4IM2A 4PS7A 4W9CA 4E3CA 4W9JA 1S3SG 3WAOA 3IFWB 5HKHA 2KLCA 1I42A 4PYUA 2KO3A 3KW5B 4GSWA 3U8ZA 2K8HA 3RCZA 1FXTB 2KDBA 3H9DA 2JRHA 4J6IA 2J0KA 4MGIE 1OEYJ 4ICVA 1GC7A 2EMSA 4A20A 2ZVNA 4KIKA 2NR2A 2CHZA 4BKGA 4EKUA 4II2B 5FR6A 3VDZA 5J2RA 5CHFA 4BKSD 4M8MA 3O65B 1WJUA 4LJPB 4ASWC 2IO2B 2KDFB 4F7ZA 1L2NA 4YL8A 4BKSA 4TQ1A 4G3XB 2R2OA 3L17A 2LVPA 1NI2A 2D10A 4NNJB 3TIXA 2KZRA 1ZGUB 2IYDB 2HTHA 2I1JA 4IWPA 3AXCA 1V9JA 2D07B 3EECA 2KFJA 5CTRC 4TUUA 2CS4A 2IO3B 3U7DA 2Z0DB 1UD7A 2LXCA 2N7EA 5IA7A 3QWZB 2WWZA 4DWFA 2L8JA 2GBNA 2WYQA 2DYBA 3C0RB 4RMAA 4WJNA 3RZWC 1GNUA 4HPMB 2D11A 4DK5A 3AULA 2KJRA 3ML8A 2W9NA 4OVVA 2MX2A 4W9EA 4NAWA 3RULA 2G45B 2KC2A 2LASA 3A4SC 2GBJA 2LGDA 4BVUC 1Q1OA 2D3GA 1WRDB 2BYEA 3A9KB 4E71A 1Z5SB 1WJNA 1J0GA 3GZNI 4BFRA 3WIMA 3UQBA 2DENB 3TL5A 2OOBB 4IWQA 1WH3A 3VTWA 2DZIA 2MBEA 3V61A 2IZVB 4RM8A 2MRPA 4K7UA 4N9F4 3UQAA 3EC8A 3K9OB 4NQLB 2CHXA 5AZGA 4AOFA 3R7RA 2A5UA 3R3MA 3HM3A 3JYUA 3A9KA 3UGBB 4FHKA 1TTNA 1H4RA 2LUEA 1LFDA 1V86A 2MQJA 3ZRFA 2K8CA 2MCNB 2FAZA 5DPRA 4AJYB 5LXHA 2JUOA 1WGGA 2V4LA 1AARA 5DPTA 4FHJA 2MBQA 3ZKJC 5CHVC 2L76A 2WX0A 2QHOA 1HE8A 5JHAA 4BOZB 4G11A 2FUHB 3DPDA 3KUCB 3S2AA 4M8NA 2JPHA 2Y5BB 4K1RB 2JF5A 3R66C 4AWJA 4GN1A 1RLFA 3EFUA 1WZ0A 1ZKHA 2BPSA 2PE6B 5C23A 3IVFA 2BGFA 3NZSA 4HK2A 4M0WB 2M4NA 4HLEA 1WM3A 3NHEB 2KWUB 1V81A 3AI5A 4WWPA 4AP4C 2O2VB 2LD9A 2Z59B 2K1FA 2V3SA 4A3PA 2EMTA 4W9GA 2DX5B 3W1YA 1WGHA 3IBEA 4MJSB 5C1ZA 2ZCCA 1YJ1A 2CR5A 1WF9A 4TKNA 2LGYA 2L3ZA 3BINA 2PE9A 3M3JA 2KWCA 1V6EA 4FBJB 1WM2A 3VVWB 4FJYA 1WE6A 2N9EB 4GB9A 2DZJA 3VAWA 3NS8A 2DAFA 4DHZE 1E8WA 3IG3A 3U30A 3HHMA 5JZEB 3N3KB 5D6JB 3L10B 2ZNVB 2LWPA 3V60A 1YD8U 2MBBB 2C60A 1OQYA 2O2VA 4HJKA 3KYDD 1SGHA 2K6DB 3WAMA 1R4MI 4MJSA 4PS8A 5L83A 1L7YA 2N7DA 1V80A 2J0JA 2AYOB 2ZPYA 3QC8B 4X57B 4GGQA 4AJWA 1G6JA 3PV1A 4MGZE 4FJVB 4NY0A 2DAJA 3P2BA 4DHZB 1UGMA 4EZKA 3QARA 2CHWA 3OAWA 4BBNC 2JVCA 3DQVA 2JT4B 4HDOA 3TMPB 3DBRI 1RRBA 4ZYNA 4GOCA 4XC2A 4ANWA 2IO0B 2AWTA 1T0YA 1QZEA 2M1MA 4WWOA 4DDGD 3JW0X 3IHPC 1YX5B 2UYZB 3M95A 3PRPB 3X23A 2LGXA 4BKTA 2NPTB 4IM3A 3TJPA 3W1SC 1YIWA 3A33B 2K39A 1F9JA 2OJRA 3H1UA 3UIOB
chains in the Genus database with same CATH superfamily
2LRUA 1TYGB 2MA9B 3PHWB 1C3TA 1TKGA 3ZVVA 1VZ6A 2H88B 3ZJVA 2GOWA 1NVID 3PZDA 4HDQA 5C2TB 1VZ7A 2MJEA 2FCNA 3SFDB 2KVRA 4RGNA 2MJDA 4AS1A 3ZNHB 3JVZX 1SF0A 2N7JA 3OJ4B 1DYQA 2ASQA 2AL6A 3BK1A 3A9JA 1JW9D 3Q3OC 3ZNGC 2LJIA 1R4MB 2ICIA 1WXMA 1GJZA 2QC8A 1TZ1A 1D4BA 4JWSC 3VQIA 1Q0WB 1WGKA 1TY0A 4NPNA 4NZLB 3KH0A 1VD2A 4ZRKA 4EZLA 4MSQB 2M8SA 3V05A 3ZIMA 4MM3B 5E6JA 3FILB 3TBLD 3H7PA 2LJ5A 4EUTA 3AU4A 1H8CA 1QILA 2GB1A 1PGXA 3DBLI 1RM6C 3DCGA 2E6XA 3WAPA 1EU3A 2RPQA 3H6NA 3T9LA 3A1QB 1XXGA 2KJ6A 5FK9C 1TS5A 3ZXVA 3CSFA 3RNGC 2C7HA 3U7ZA 1X1MA 3VFKA 1V49A 1JALA 3BVZA 2BWFA 5EE0A 2WS3B 1WXAA 4XDDA 1E5WA 3M62B 4MEMA 4J3OD 2GLSA 2SAKA 1E90A 1ZE3D 4LDTD 3DHGC 3DVGY 1R4NI 2PJHA 2QDFA 3VR8B 3PRMB 2DBYA 2KFKA 5BMGA 5KHOA 4IW0A 2VZKD 2I1KA 3NOBA 2RPVA 4I6LB 1KOTA 1FPYA 4OZAA 1ISNA 3O13A 4PYZA 4DHJB 4AUQC 4RNAA 2LXAA 3RT3B 5D3IB 1AYFA 2IBIB 2IGHA 4YTMB 1Q5WB 3H7SA 1E7PB 2K5PA 2N1VA 2N4FA 2WXPA 2FCSA 2KN5A 2PW9A 3HRDD 3ZLZA 4A3OA 1RAXA 3SHQA 3RNFC 2GBRA 5AEKB 2C7MB 4REZA 1YJIA 2DLBA 4LNIA 1VCBA 2O6VA 2C9WB 4KDLB 5D7GA 3PSEB 1P7EA 3NZUA 2NVUI 4TQ0A 3V3XA 2AQ3B 3AEEB 3LB8C 3N32A 1SE9A 3PLUA 2J0MA 3FAHA 4JL9A 2H89B 3QIJA 2AEHA 5TR5A 3KYCD 4OW0A 3SDLC 2LFIA 3U52E 3L08A 1FXAA 4L1BA 2MP2A 1FMAD 2I38A 3RN9C 3Q14C 1V5OA 3QAQA 1P98A 2Y5CA 3FILA 2MSED 1NBFC 3ZW3A 3DVNU 1SB3C 1V5TA 3ML9A 1XLNA 1CK1A 4F8CB 1T0SC 3TEYA 4KSLC 1WGDA 2M17A 3MTNB 1TJEA 3EFCA 1WYWB 4LDTB 1SEBD 5BMIA 3E56A 2WGSA 1T3QA 2WXMA 3AE7B 1SIJA 1Y56A 1EO6A 2GMIC 4W9FA 4US8A 3A4RA 2WU5B 3AEGB 2N9XA 1D3ZA 3MFGA 3QK0A 1S1QB 3VUXA 1KF6B 4N59A 4MSMB 4GIVA 1WXQA 1WGRA 1GB4A 4W9JA 4P16A 1LO5D 3BYTB 1L4ZB 2K8HA 2KDBA 3H9DA 1CZPA 4J6IA 1OEYJ 1GC7A 4KIKA 4BKGA 1K50A 1WJUA 3P4PB 1L2NA 3TUOA 3N1XC 4G3XB 4HRSA 4B0MA 2KACA 4YT0B 2KZRA 3TIXA 1ZGUB 1XEEA 1YOVB 5G5HA 4IWPA 2ON8A 3EECA 2KFJA 4TUUA 2QMTA 5HFYA 4C80A 2IO3B 1C79A 2MEKA 1UD7A 2LXCA 3IXSA 3QWZB 4DWFA 3C0RB 4RMAA 1ZUD2 1QT9A 3IAM1 5G5GA 5TSSA 5C3JB 2WQYB 3DWMA 3OG5A 4M00A 4IKGA 3RULA 3BWUD 2GBJA 2KQ4X 4BZAA 1GPXA 1J0GA 3UQBA 4N6EB 1I4RA 3I57A 2DZIA 4MH8A 3V61A 4RM8A 2MRPA 4NQLB 5AZGA 4WWMA 2A5UA 4XYCA 1PDXA 1LFDA 3ZRFA 1ZP0B 1ZXHA 2MCNB 1KH0A 4IOIE 4OZBA 2JUOA 2V4LA 2BS4B 4HJGE 2MBQA 2L76A 4OVZA 1TS3A 4BOZB 3KUCB 3Q69A 4M8NA 4K1RB 4WIPA 2JF5A 4A90A 1WZ0A 1ZKHA 2BPSA 3I63C 2K3UA 2KAJA 4ITKA 4M0WB 4HLEA 4ZRPA 2PTLA 5EE9A 2WXQA 3AI5A 4AP4C 2JZPA 2V3SA 3P1MA 1VLBA 4MJSB 2V3PA 2CR5A 1QQRA 2LGYA 1VR9A 2PE9A 4AQ7A 4FJYA 2N9EB 2DZJA 1OFFA 3U30A 5D6JB 3V60A 1OQYA 3LYYA 4HJKA 3KYDD 3AE3B 4P1BC 4ZRQA 3ZJUA 3WAMA 4AJWA 3W5UB 3NRZA 3PV1A 1D5ZC 4FJVB 4DHZB 4EZKA 3Q3NC 2DNFA 3OAWA 4BBNC 1TY2A 1N60A 4RFBA 1WYGA 4ZYNA 4GOCA 1QZEA 4DDGD 1JWBD 1JMLA 3X23A 4BKTA 1EWCA 3A33B 2N0SB 3J9CA 3H1UA 3I9V1 4LTUA 4YTNB 2ZCBA 1JROA 4R3DA 1T5XD 2MJ3A 1LQBA 1EUVB 3R7QA 5EDSA 3RMKC 3DWGC 1J7CA 1MI0A 1JRPA 1LXDA 1T0RC 2ONQA 3P63A 4JQWC 4KKJA 4K3BA 1SXTA 1GOZA 3ALBA 2EELA 1B1ZA 5D2MB 2PVGC 3LJ3A 5LLIA 4W9HA 1FNWA 3A9JB 1PGAA 2WHIA 3KUDB 4LLGM 3ZTCA 2BYFA 3PVLA 4HCNB 2O6VD 2FCMA 2WX1A 2L05A 3TEZA 1KTKA 1DOIA 3AE6B 3CF6E 1BMLC 1WX9A 4DDID 4USAA 2AX5A 2ZZPB 3H7PB 4ZRJA 3BZDB 2LGIA 4HKQA 2RSUA 3VXWA 1DGJA 1QKZA 3PRZA 1UBQA 2LMCA 3I5JC 1YNTE 4LK0M 3RYTA 4OZCA 3Q3FA 1J7BA 3AH7A 5D3DA 3DHHC 2K6QA 2MWSB 3TSSA 1GUAB 4NJ6A 4RF1A 5AZFA 1WY8A 2W82A 3VUWA 5JXVA 1TKYA 1E8ZA 1KJTA 1AW7A 4C7ZA 3T3OA 3PHXB 4YSXB 4HPLB 2V0GA 5EE1A 3V62A 2KFKB 3ZRCA 1N5XA 1K51A 4KZ0A 1D6EC 3EHVA 5D94A 2BWES 2R2QA 3MP9A 1Y8RC 2NBUA 2JY6A 2K8BA 3E9SA 1EF1A 4MGKE 2FCQA 5HG2A 3C19A 2JWUA 2KQSA 2JZZA 3WA0A 1VJKA 2RDHA 1N63A 3NVVA 2KVZA 1ZOYB 2KDIA 1WE7A 3WALA 4MDKE 4ANVA 4LNOA 2CU3A 1E7UA 1QF6A 1HXYD 3NVWA 3URYA 5AZHA 4RF0A 1HA5A 2IY1B 1C77A 4D2KA 1T6BX 5EE3A 5IN7A 5LNK1 2YLMA 3RNBC 2Y5PA 3ZGZA 3DHIC 1E8XA 3KUZA 5CHWA 4DHJD 2O6VB 4ZOHC 3AE8B 1ZXIA 2GBMA 2N9PC 5FR3A 2KC1A 2HTME 4XX5A 3ZTDA 1RFAA 3QHTA 2XNAC 2LRWA 2KNBA 4KGRA 5DPWA 2WXIA 3N1ZC 3B2GA 1P3QU 1U4AA 2MH7A 3BY4B 2CJOA 4B6WA 3L0WB 2G3QB 1TS2A 4WWNA 2LZ6A 4MGYE 3ZNZB 2RMMA 4C4VA 1YN3A 2YEPF 4ANXA 2FIFA 2MP2B 4JPSA 1FNUA 3ZO5B 1AWDA 1L6UA 4N58A 4WJQA 1CJEA 1JWUD 4GDLA 4MH0E 3OLMD 4JX1C 4W9KA 5E6PA 1YMHE 5DCNA 1P9DU 3DBHI 3MHSD 4ARIA 2BKRB 4RGMA 4FXCA 3Q3MC 1MVKA 2INPE 2DYMA 4DXFA 4EFOA 4HWIB 1ZW7A 4ZDVA 3PT2B 3OWEB 4IG7B 4HVBA 3APCA 3K9PB 1FCCC 1UELA 1RWSA 3R2TA 1UNSA 1XCTL 3QA8A 3B2FA 3PPAA 4WJOA 4A8XC 3HVDA 1WIAA 3L16A 4RH6A 3ZXRA 3W2DA 2M19A 4WQMA 2IPKD 2B3AA 4K7SA 3BIID 4JIOU 3PS6A 3VHTC 1SIFA 3KWVA 3VTUA 3JSVA 2RDBC 3PREA 2ZVOA 4KIKB 3IT4B 4K81A 4PS7A 4W9CA 4M01A 1S3SG 2KLCA 1I42A 2KO3A 2JRHA 4ICVA 1UUPA 2CHZA 3VDZA 4BKSD 4M8MA 1MG4A 2D5GA 3AMZA 2OEDA 3EGRA 1VZ8A 3AECB 2I2YA 2HTHA 2MHJA 2I1JA 3AXCA 3Q8FA 2D3CA 2CS4A 2Z0DB 4HKZE 2WWZA 2J4XA 2GBNA 4WJNA 1JCKB 5IP4D 4EE2A 2HJ1A 4DK5A 2KJRA 1ET9A 2J42A 4L2YA 2KC2A 2K0PA 1Q1OA 2D3GA 2BYEA 3GZNI 4BFRA 3GB1A 1WH3A 4RGTA 3AB5A 1AN8A 4K7UA 4N9F4 3AEAB 3EC8A 1FO4A 3R3MA 3W5VB 4XWWA 1H4RA 1V86A 2INDC 2ZW1A 1N6ZA 2JU6X 1UWXA 3GP7A 5LXHA 4K3CA 2HDEA 5DPTA 2LHEA 2N9KA 2WX0A 1FCLA 1HE8A 4G11A 3DPDA 3S2AA 2M0AA 3R66C 2TSSA 3EFUA 5T8IA 2PE6B 3P4RB 3IVFA 4OHJA 2M4NA 3ZJTA 3NHEB 2KWUB 3BK2A 4WWPA 2EKIA 2Z59B 2EMTA 1FM0D 2DX5B 4W9GA 1WGHA 2CJNA 5C1ZA 4TKNA 2L3ZA 3BINA 1IGCA 1E10A 1WM2A 1I4PA 3B9JA 3NUHB 3ZYYX 3VAWA 1JWMD 3NS8A 2DAFA 2WDVB 4RGOS 4YXDB 3N3KB 3L10B 2ZNVB 2LWPA 2FE8A 1YD8U 2MBBB 2O2VA 1SGHA 2KT7A 1R4MI 3FC4A 3SFEB 4PS8A 1J7AA 4XDCA 5L83A 1V80A 3HVZA 4X57B 4GGQA 1TIFA 2AQ1B 1WSPA 2DAJA 1UGMA 1EM7A 1E0ZA 4HDOA 2JT4B 1YN4A 3TMPB 4JWUC 4ANWA 2WXNA 1FRRA 1T0YA 3JW0X 2BT6A 1C4AA 3M95A 2LGXA 1PYWD 1YIWA 1I4XA 1SJED 2OJRA 3AV8A 3UIOB 2JQRB 4CYEA 1L0XB 4KDIC 3BYYB 1A5RA 4ZHOA 2PMVA 1HTOA 2NPTA 1D5XC 4DBGA 1TBEA 2UU7A 2JXXA 2DYOA 2A4ZA 3AE4B 1E9MA 1QLBB 2D3AA 1BUIC 2UWQA 2WXFA 3CIRB 3DBSA 4EOYA 3CSTA 3Q3JA 4FLHA 1KLGD 4I6NB 3APDA 1QOGA 5G2NA 4WQOB 2KN4A 2KWVB 2DZKA 3VUYA 2BF8B 3TEWA 2BS3B 5H8YE 4A9AA 1XCQL 1UF0A 2RR9A 4NQKE 1YJJA 4GU2A 3PTFC 3MJWA 3AU5A 4G50A 3KLSX 2FNJB 4PT5A 3UF8A 1HEZE 2XK5A 2XBBC 2GRIA 1GAQB 1SE3A 4GDKA 3DBRB 1EF5A 4MELA 5IAAC 1VDVA 3DOWA 1B9RA 4IUMB 4ARCA 2KTFA 1WX8A 3X0WA 4CO7A 4BAXA 3ZDMC 3RFZB 2WXKA 3SU8X 1TT5B 1QOBA 3KVFB 3RUIB 2G4DB 3GE3C 1WXSA 3NY5A 1MHXA 2HJ8A 1P1AA 2ZJDA 1R7SA 1IUEA 5J17A 2B76B 3V6CB 2YVCA 2IDYA 2K25A 5DPSA 4URKA 4C00A 1QOAA 3CWIA 2KOXA 2EKEC 2W3RA 3D32A 3QCAA 3ECIA 3ZNID 2G9HD 1XD3B 2DZMA 2NCNA 3APFA 5JH5C 4BBNF 1WR1A 3NVYA 2J7QB 2FBWB 4IM0A 2NTSA 3QQ8B 4OVUA 2RDGA 5GXGB 2M0XA 4A6QA 3Q8EA 2X38A 3FKYA 2GI9A 2REXA 1YN5A 2Z0EB 3PZ7A 3HK0A 2IJ0A 5CX3A 1XQQA 2KLGA 2VH2A 1SSNA 1VRAB 4W9DA 4TSSA 4XZ4A 1DOXA 1OQQA 4ACFA 3RD2A 1WGYA 3B08A 1V2YA 4NAWB 1WI0A 3DBLB 3VR9B 1JRUA 3PGEA 1P7FA 4II3B 3UIPB 3HIZA 3ZQ4A 4C56C 2ZNVC 4C4VB 2VH1A 5G55A 3SEBA 2NS5A 1KM7A 4E74A 1PQSA 4P7IA 3RI7C 1ZPSA 2R61A 4GDLB 1YX6B 3AE9B 1NYQA 1MFWA 2L00B 2ZEQA 2SEBD 2ZPNA 3OJ3A 4KGSA 2NTTA 1E8YA 5J18A 2VRRB 2KTRA 1V1PA 2C7NB 3EUB2 1FRDA 4EEWA 3ENEA 3B1LX 4F1SA 4G0NB 5L95C 1R4NB 1TGZB 4DXAB 1F77A 3VRBB 5AUIA 2FIDA 3T8MA 1OEYA 2LHDA 2GBKA 2BYTA 2INNE 1BXTA 1L4DB 2IY0B 3B0AA 2KHWB 5E6OA 1JWAD 3AEFB 3V6EB 1PUTA 4MT5A 5H92C 2PEAA 3LDZE 1M94A 2LVQA 1IP9A 5HI1A 2KMCA 4WJPA 2JRIB 3JSVB 1FFUA 4HCPB 1P0RA 1NEKB 2RGFA 1IPGA 1UBIA 3IAS1 3HM6X 4ZHPA 1WXVA 2KDMA 3W1SA 4O1NA 2D3BA 5KHQA 1KLVA 2KANA 3MJ5A 3GE8C 3DDCB 3Q2AC 2WDTB 1WR6E 1GB1A 1GC6A 3L4PA 2L0TA 4QAYA 4IM2A 1L6VA 1HQRD 3IFWB 4PYUA 4TMAB 1I7HA 1FXTB 4HPPA 3R2IA 1TS4A 4MGIE 4S0RA 2EMSA 4EKUA 2L52A 2NR2A 1ENFA 4II2B 5FR6A 1F0ZA 5CHFA 3RNEC 1K52A 4ASWC 2IO2B 4F7ZA 4YL8A 1ZDVA 3AM9A 1CQVA 2R2OA 3L17A 1NI2A 1F2RC 2D10A 1V9JA 2D07B 3N1YC 1F2RI 2KMMA 3RZWC 1Q10A 1GNUA 1XF5L 4HPMB 2D11A 3ML8A 2W9NA 2IGDA 2MX2A 4JE3B 4W9EA 2BS2B 4NAWA 1F52A 4DQOC 3A4SC 4BVUC 1N5WA 3ABVB 4E71A 1Z5SB 4LNKA 3WIMA 2DENB 3TL5A 4H2AA 2MBEA 2CHXA 4XWTA 2BTEA 4AOFA 3R7RA 1FNVA 3A9KA 3UGBB 1IBXA 4FHKA 5BYQA 2LUEA 1I4GA 1L5PA 2FAZA 5DPRA 4AJYB 2WXHA 3MHZA 3Q8CA 1OQRA 1FEHA 4FHJA 1FD6A 5JHAA 3NG0A 2JPHA 4AWJA 2W54A 1QOFA 2L83A 2BGFA 4HK2A 3TEXA 1WM3A 1F1HA 2O2VB 4LNFA 2BQQA 2LD9A 2W55A 4A3PA 3W1YA 3IBEA 4C7YA 1STEA 2ZCCA 1WF9A 2Z8LA 3M3JA 2KWCA 3Q8AA 1V6EA 4FBJB 3VVWB 2PLPA 1WE6A 5I4DA 4DHZE 3IG3A 5JZEB 2V9HA 3U4EG 2AQ2B 1C4CA 2WP9B 2ZW0A 2K6DB 2LUMA 1L7YA 3RPFC 2ZPYA 2AYOB 1HZ6A 3RNAC 4MGZE 4NY0A 2L32A 4Q2JA 3AEBB 1ET6A 2JVCA 4YSZB 3DQVA 1RRBA 5BMHA 1I4QA 4XC2A 2IO0B 2M1MA 4WWOA 3IHPC 1UGJA 3PRPB 1XO3A 2NPTB 3AN1A 3TJPA 4NAMA 2JYEA 4B0EA 2K39A 2ACZB 1K53A 1DOYA 1J8CA 2W3SA 2RD0A 2MLBA 1NDDA 2QJLA 1HTQA 1ESFA 1IYFA 4WH4A 4B95A 1WJ4A 2QSDA 3VH3B 3DVGX 1C78A 2JWZA 1J19A 4LNNA 2JX5A 2KJHB 3PLVA 2BB6A 2Q5WD 4KGTA 2KK8A 1EU4A 4FN2A 2INCC 3H8HA 3ZDTA 2V4IB 3SD5A 3ZUNA 1MHHE 1OTRB 2QCZA 4ZYSA 1YQ4B 2E3TA 4NJ7A 4S17A 2XK5B 4GDKB 5IOIA 2KYWA 1N61A 5BYSA 2C5LC 4W9IA 1UZXB 2L7RA 2KXJA 2FUG1 1EWYC 2L0FA 2KQ7A 1Z2MA 1BT0A 4I6PA 3UI3A 1WFYA 2G4SA 3I3TB 1IGDA 4RCOA 5GMVA 4KSKC 1XLOA 4HROA 5E6NA 2LVOA 4MM3A 2OJWA 3L13A 1WMHB 1YQ3B 4JLCA 4P1CC 2KKCA 3VRAB 2PVOD 2WNMA 4GXBA 2XEWA 1UWMA 2QIEB 4KVGB 3N20C 2WDRB 2V1YA 3A1QA 4TV3A 4BOSC 2KD0A 2KMAA 2VZKB 3EA6A 1ROEA 2D2QA 2MBHA 2KX0A 2Y3AA 4W9LA 2IO1B 1YQBA 4B9KA 1A70A 1MJDA 1C1YB 4LJOB 3N30A 5FKAC 4ZRIA 1WRIA 2BYVE 5LXIB 3MC8A 4GMVA 4GLSC 1LM8B 1CMXB 1E7VA 4L23A 3UINB 4IWOA 3SR6A 1E6EB 4FULA 3GOEA 3TCAA 4RM9A 4KX6B 3P4QB 1JWSD 2WXJA 3AEDB 3DVNV 1FFVA 1ACCA 2MW5A 2J52A 5BO4B 1UH6A 4YWGG 1KRHA 3M63B 1OGWA 1MPEA 2WXRA 2V3NA 2HE7A 3WANA 4FJZA 5AUKA 2KTRB 1V1PB 2N1WA 2BB5A 2DWQA 1C9FA 3KQ4A 1V8CA 1WJ6A 2K9XA 3VTVA 1WX7A 3NS1A 3ETRA 2LI5A 4YSYB 1GG3A 2NBVB 3L54A 4PS3A 1TZOA 2KDEB 2M56B 4XE0A 3ONSA 2MBOA 1T0QC 1K8RB 3MC9A 4KV2A 1D5MC 3MC0B 2BKFA 1SBBB 4KZCA 3RZFA 4FA6A 2AL3A 1LGRA 4CHKA 3C8YA 4ICUA 4JGHB 4UDUC 3N9YC 2KX3A 3KWLA 2NBWB 3QX1A 1I4HA 1NYRA 1KLUD 1XT9B 2JZ3B 1MG8A 4US9A 2HD5B 3Q6BA 1I35A 1N62A 2DHZA 4MACA 4IC7B 2JXTA 4FADA 4XGAB 2JSVX 1NI3A 2LGSA 3NJTA 2PPHA 4LCDE 2CKHB 2LEKA 5JHBA 2CU1A 2KWDA 1WMHA 2WXLA 3QJZA 2WXOA 4HXDA 1RYJA 3GS2A 3PO0A 4WAAA 3VH4B 1PFDA 4K7WA 3CMMB 4ANUA 1WZ3A 3IT6B 4EZJA 4E3CA 2BVCA 1RFKA 3WAOA 4HEA1 5HKHA 4GSWA 3KW5B 3WCQA 3U8ZA 3RCZA 1FIQA 1XLQA 4IDIA 3AE5B 2J0KA 2YEPB 4A20A 2ZVNA 1V97A 4NJCA 5J2RA 4M02A 3O65B 1HZ5A 3DBHB 4DXGA 1L0YB 3BVMA 2KDFB 4LJPB 4YTPB 4BKSA 4TQ1A 5MPOA 2LVPA 4NNJB 3AE2B 1XLPA 2X8XX 2IYDB 2QILA 5HHDG 3P4SB 3LXFA 5CTRC 1L0VB 3NVZA 4WURA 3U7DA 2N7EA 5IA7A 2QEJC 2WXGA 2L8JA 2WYQA 2DYBA 1SE2A 3AULA 4OVVA 1KFYB 3R8BA 2G45B 3NZ3A 2LASA 2LGDA 1FXIA 1WRDB 2G1EA 1V1OA 1IBXB 3A9KB 1WJNA 4PK1A 1C4PA 2N9LA 2OOBB 4IWQA 3VTWA 4KKIA 4A55A 2IZVB 4P6VF 1SE4A 3UQAA 3K9OB 2PKOA 2L1AA 3HUIA 3HM3A 3JYUA 4WAFA 1TTNA 2MQJA 2K8CA 2PIAA 3T3NA 2WDQB 1WGGA 1AARA 2BBCA 1WWTA 3ZKJC 5CHVC 2QHOA 2FUHB 2Y5BB 4GN1A 1RLFA 2NMQA 3AE1B 3P42A 2BW2A 2IGGA 5C23A 3PZ8A 2OHFA 3NZSA 1V81A 2WLBA 2K1FA 3W9CB 3BVGA 1YJ1A 4CQNA 4GB9A 5IKCM 1M4VA 2K22A 4M0WA 3RNCC 1E8WA 1C76A 3HHMA 2J53A 2C60A 3Q8BA 1SJHD 2XN9C 4MJSA 2N7DA 2J0JA 3QC8B 1G6JA 3P2BA 3GZNB 3U2SC 3QARA 2CHWA 3DBRI 1JQ4A 5BYRA 2JYTA 1ZDXA 2AWTA 2WU2B 5IO9A 1YX5B 2UYZB 1TKEA 4IM3A 3W1SC 1NENB 1PGBA 1F9JA
chains in the Genus database with same CATH topology
2LRUA 2ZCBA 4CYEA 4KDIC 2MA9B 3PHWB 1J8CA 1LQBA 1EUVB 1C3TA 3R7QA 5EDSA 3ZVVA 2RD0A 2MLBA 1NDDA 1IYFA 1A5RA 1LXDA 4B95A 1WJ4A 4JQWC 2GOWA 2NPTA 4DBGA 3VH3B 3DVGX 1TBEA 2JWZA 3PZDA 2JXXA 2DYOA 4HDQA 1J19A 3ALBA 2A4ZA 5D2MB 2UWQA 3LJ3A 5LLIA 4W9HA 2KJHB 3DBSA 3PLVA 2FCNA 4EOYA 3CSTA 2KVRA 3A9JB 3KUDB 3Q3JA 2KK8A 4FLHA 4I6NB 3ZTCA 4FN2A 3APDA 3ZDTA 5G2NA 4WQOB 2BYFA 3PVLA 4HCNB 3ZNHB 3SD5A 2O6VD 3ZUNA 2FCMA 3JVZX 1OTRB 2WX1A 2KWVB 2L05A 3OJ4B 4NJ7A 2DZKA 2XK5B 3VUYA 2BF8B 3CF6E 4GDKB 2ASQA 2AL6A 3A9JA 2C5LC 4W9IA 1WX9A 4DDID 3ZNGC 4ZRJA 2ZZPB 3H7PB 1UZXB 2RR9A 4NQKE 1WXMA 2RSUA 1GJZA 4GU2A 3PTFC 3MJWA 3AU5A 3VXWA 1TZ1A 2L7RA 4G50A 2FNJB 3UF8A 2XK5A 3VQIA 2XBBC 1Q0WB 2KXJA 3PRZA 1UBQA 4GDKA 2L0FA 2KQ7A 1Z2MA 4NPNA 1EF5A 1VD2A 3KH0A 4MELA 4ZRKA 1BT0A 4I6PA 4MSQB 5IAAC 2M8SA 4EZLA 3ZIMA 3DOWA 1WFYA 2G4SA 3TBLD 4IUMB 3H7PA 2LJ5A 4EUTA 3AU4A 1H8CA 2KTFA 3RYTA 3Q3FA 3I3TB 1WX8A 3DBLI 2K6QA 2MWSB 5GMVA 3X0WA 4CO7A 3DCGA 3WAPA 3ZDMC 1GUAB 4KSKC 2RPQA 4NJ6A 3SU8X 5AZFA 1WY8A 3KVFB 3RUIB 3H6NA 5E6NA 2G4DB 3A1QB 3T9LA 3VUWA 2KJ6A 2LVOA 4MM3A 1WXSA 3NY5A 1E8ZA 2HJ8A 1P1AA 2ZJDA 4JLCA 3L13A 1WMHB 1KJTA 5J17A 2KKCA 3V6CB 2YVCA 3PHXB 4GXBA 2K25A 2XEWA 4HPLB 5DPSA 4URKA 3CSFA 2C7HA 4KVGB 1X1MA 3VFKA 3V62A 2KFKB 1V49A 2V1YA 3ZRCA 2KOXA 2BWFA 2EKEC 3A1QA 3EHVA 4KZ0A 3D32A 4TV3A 4BOSC 5D94A 1WXAA 3QCAA 2BWES 2R2QA 2KD0A 3ECIA 3ZNID 1Y8RC 1E5WA 2KMAA 3M62B 4MEMA 2NBUA 2JY6A 2K8BA 1XD3B 2DZMA 1EF1A 4MGKE 2NCNA 1E90A 2D2QA 2MBHA 3APFA 2FCQA 4LDTD 5JH5C 3DVGY 4BBNF 1R4NI 2PJHA 2KQSA 2KX0A 2JZZA 4W9LA 3PRMB 3WA0A 1WR1A 2KFKA 2IO1B 2J7QB 1YQBA 2KDIA 4IM0A 5KHOA 4IW0A 1WE7A 3WALA 4B9KA 4MDKE 3QQ8B 4OVUA 4ANVA 1E7UA 1C1YB 2M0XA 5AZHA 2I1KA 4LJOB 3NOBA 3N30A 4I6LB 1KOTA 4ZRIA 2IY1B 2BYVE 1ISNA 2REXA 2Z0EB 4PYZA 4DHJB 5LXIB 4GMVA 4AUQC 3HK0A 5CX3A 1XQQA 2KLGA 1LM8B 2LXAA 2YLMA 1CMXB 3RT3B 1E7VA 3UINB 4W9DA 4IWOA 2IBIB 4XZ4A 1Q5WB 3H7SA 4FULA 1E8XA 2N1VA 2N4FA 3GOEA 3KUZA 4RM9A 1WGYA 2FCSA 2O6VB 5CHWA 3RD2A 3TCAA 2KN5A 3B08A 3DVNV 2GBMA 1V2YA 4NAWB 1WI0A 2N9PC 2MW5A 2KC1A 5BO4B 4XX5A 1UH6A 1JRUA 3ZTDA 3ZLZA 3PGEA 1RFAA 4A3OA 1RAXA 3M63B 3QHTA 1OGWA 4II3B 3SHQA 3UIPB 3HIZA 2ZNVC 2LRWA 2HE7A 3WANA 2KNBA 4FJZA 5DPWA 2GBRA 5AEKB 2C7MB 5G55A 2NS5A 1KM7A 2KTRB 4E74A 2N1WA 1PQSA 1VCBA 4P7IA 1P3QU 2O6VA 1U4AA 3BY4B 4GDLB 2C9WB 1YX6B 2L00B 1WJ6A 3VTVA 2ZEQA 3OJ3A 2ZPNA 1WX7A 4KDLB 5D7GA 4B6WA 3L0WB 2G3QB 3PSEB 2LI5A 3NZUA 4WWNA 2LZ6A 2NVUI 4TQ0A 1E8YA 1GG3A 4MGYE 2NBVB 3ZNZB 5J18A 2VRRB 3L54A 4PS3A 2KDEB 2KTRA 3ONSA 2C7NB 2MBOA 4ANXA 1K8RB 2FIFA 2MP2B 3N32A 4KV2A 1SE9A 3ENEA 3ZO5B 4EEWA 3PLUA 3B1LX 2J0MA 4JL9A 2BKFA 4F1SA 4WJQA 4KZCA 4G0NB 3QIJA 4GDLA 4MH0E 3RZFA 2AEHA 3OLMD 5TR5A 5L95C 3KYCD 4FA6A 4W9KA 5E6PA 1TGZB 2AL3A 5DCNA 4DXAB 1P9DU 3DBHI 4CHKA 3MHSD 3SDLC 2FIDA 3T8MA 1OEYA 2BKRB 2GBKA 4ICUA 4JGHB 3L08A 2KX3A 2NBWB 3QX1A 2IY0B 2MP2A 3B0AA 2DYMA 2KHWB 5E6OA 3V6EB 4EFOA 4HWIB 1V5OA 1ZW7A 1XT9B 2JZ3B 3QAQA 4ZDVA 3PT2B 4IG7B 1MG8A 4HVBA 3APCA 1P98A 2PEAA 3LDZE 2HD5B 1M94A 2LVQA 3K9PB 1UELA 1IP9A 2MSED 1NBFC 3ZW3A 3DVNU 3QA8A 1I35A 1V5TA 3ML9A 2DHZA 3PPAA 2KMCA 4WJPA 2JRIB 4IC7B 4WJOA 3JSVB 4HCPB 4F8CB 1P0RA 4KSLC 1WGDA 2M17A 3MTNB 4FADA 2RGFA 1IPGA 1WYWB 1UBIA 1WIAA 3L16A 3HM6X 4LDTB 2PPHA 1WXVA 3W1SA 4LCDE 2CKHB 5JHBA 2B3AA 2CU1A 5KHQA 4K7SA 1WMHA 3QJZA 1KLVA 4JIOU 2KANA 4HXDA 3PS6A 1EO6A 1SIFA 2GMIC 4W9FA 3VHTC 3VTUA 3JSVA 3A4RA 3PREA 4WAAA 2N9XA 2ZVOA 3DDCB 1D3ZA 3QK0A 3VH4B 1S1QB 2WDTB 4K7WA 3VUXA 4MSMB 1WR6E 4GIVA 4KIKB 1GC6A 3CMMB 4DHJD 4ANUA 1WZ3A 1WGRA 2L0TA 4K81A 4EZJA 4IM2A 4PS7A 4W9CA 4E3CA 4W9JA 1S3SG 3WAOA 3IFWB 5HKHA 2KLCA 1I42A 4PYUA 2KO3A 3KW5B 4GSWA 3U8ZA 2K8HA 3RCZA 1FXTB 2KDBA 3H9DA 2JRHA 4J6IA 2J0KA 4MGIE 1OEYJ 4ICVA 1GC7A 2EMSA 4A20A 2ZVNA 4KIKA 2NR2A 2CHZA 4BKGA 4EKUA 4II2B 5FR6A 3VDZA 5J2RA 5CHFA 4BKSD 4M8MA 3O65B 1WJUA 4LJPB 4ASWC 2IO2B 2KDFB 4F7ZA 1L2NA 4YL8A 4BKSA 4TQ1A 4G3XB 2R2OA 3L17A 2LVPA 1NI2A 2D10A 4NNJB 3TIXA 2KZRA 1ZGUB 2IYDB 2HTHA 2I1JA 4IWPA 3AXCA 1V9JA 2D07B 3EECA 2KFJA 5CTRC 4TUUA 2CS4A 2IO3B 3U7DA 2Z0DB 1UD7A 2LXCA 2N7EA 5IA7A 3QWZB 2WWZA 4DWFA 2L8JA 2GBNA 2WYQA 2DYBA 3C0RB 4RMAA 4WJNA 3RZWC 1GNUA 4HPMB 2D11A 4DK5A 3AULA 2KJRA 3ML8A 2W9NA 4OVVA 2MX2A 4W9EA 4NAWA 3RULA 2G45B 2KC2A 2LASA 3A4SC 2GBJA 2LGDA 4BVUC 1Q1OA 2D3GA 1WRDB 2BYEA 3A9KB 4E71A 1Z5SB 1WJNA 1J0GA 3GZNI 4BFRA 3WIMA 3UQBA 2DENB 3TL5A 2OOBB 4IWQA 1WH3A 3VTWA 2DZIA 2MBEA 3V61A 2IZVB 4RM8A 2MRPA 4K7UA 4N9F4 3UQAA 3EC8A 3K9OB 4NQLB 2CHXA 5AZGA 4AOFA 3R7RA 2A5UA 3R3MA 3HM3A 3JYUA 3A9KA 3UGBB 4FHKA 1TTNA 1H4RA 2LUEA 1LFDA 1V86A 2MQJA 3ZRFA 2K8CA 2MCNB 2FAZA 5DPRA 4AJYB 5LXHA 2JUOA 1WGGA 2V4LA 1AARA 5DPTA 4FHJA 2MBQA 3ZKJC 5CHVC 2L76A 2WX0A 2QHOA 1HE8A 5JHAA 4BOZB 4G11A 2FUHB 3DPDA 3KUCB 3S2AA 4M8NA 2JPHA 2Y5BB 4K1RB 2JF5A 3R66C 4AWJA 4GN1A 1RLFA 3EFUA 1WZ0A 1ZKHA 2BPSA 2PE6B 5C23A 3IVFA 2BGFA 3NZSA 4HK2A 4M0WB 2M4NA 4HLEA 1WM3A 3NHEB 2KWUB 1V81A 3AI5A 4WWPA 4AP4C 2O2VB 2LD9A 2Z59B 2K1FA 2V3SA 4A3PA 2EMTA 4W9GA 2DX5B 3W1YA 1WGHA 3IBEA 4MJSB 5C1ZA 2ZCCA 1YJ1A 2CR5A 1WF9A 4TKNA 2LGYA 2L3ZA 3BINA 2PE9A 3M3JA 2KWCA 1V6EA 4FBJB 1WM2A 3VVWB 4FJYA 1WE6A 2N9EB 4GB9A 2DZJA 3VAWA 3NS8A 2DAFA 4DHZE 1E8WA 3IG3A 3U30A 3HHMA 5JZEB 3N3KB 5D6JB 3L10B 2ZNVB 2LWPA 3V60A 1YD8U 2MBBB 2C60A 1OQYA 2O2VA 4HJKA 3KYDD 1SGHA 2K6DB 3WAMA 1R4MI 4MJSA 4PS8A 5L83A 1L7YA 2N7DA 1V80A 2J0JA 2AYOB 2ZPYA 3QC8B 4X57B 4GGQA 4AJWA 1G6JA 3PV1A 4MGZE 4FJVB 4NY0A 2DAJA 3P2BA 4DHZB 1UGMA 4EZKA 3QARA 2CHWA 3OAWA 4BBNC 2JVCA 3DQVA 2JT4B 4HDOA 3TMPB 3DBRI 1RRBA 4ZYNA 4GOCA 4XC2A 4ANWA 2IO0B 2AWTA 1T0YA 1QZEA 2M1MA 4WWOA 4DDGD 3JW0X 3IHPC 1YX5B 2UYZB 3M95A 3PRPB 3X23A 2LGXA 4BKTA 2NPTB 4IM3A 3TJPA 3W1SC 1YIWA 3A33B 2K39A 1F9JA 2OJRA 3H1UA 3UIOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRU A;  2ZCB A;  4CYE A;  4KDI C;  2MA9 B;  3PHW B;  1J8C A;  1LQB A;  1EUV B;  1C3T A;  3R7Q A;  5EDS A;  3ZVV A;  2RD0 A;  2MLB A;  1NDD A;  1IYF A;  1A5R A;  1LXD A;  4B95 A;  1WJ4 A;  4JQW C;  2GOW A;  2NPT A;  4DBG A;  3VH3 B;  3DVG X;  1TBE A;  2JWZ A;  3PZD A;  2JXX A;  2DYO A;  4HDQ A;  1J19 A;  3ALB A;  2A4Z A;  5D2M B;  2UWQ A;  3LJ3 A;  5LLI A;  4W9H A;  2KJH B;  3DBS A;  3PLV A;  2FCN A;  4EOY A;  3CST A;  2KVR A;  3A9J B;  3KUD B;  3Q3J A;  2KK8 A;  4FLH A;  4I6N B;  3ZTC A;  4FN2 A;  3APD A;  3ZDT A;  5G2N A;  4WQO B;  2BYF A;  3PVL A;  4HCN B;  3ZNH B;  3SD5 A;  2O6V D;  3ZUN A;  2FCM A;  3JVZ X;  1OTR B;  2WX1 A;  2KWV B;  2L05 A;  3OJ4 B;  4NJ7 A;  2DZK A;  2XK5 B;  3VUY A;  2BF8 B;  3CF6 E;  4GDK B;  2ASQ A;  2AL6 A;  3A9J A;  2C5L C;  4W9I A;  1WX9 A;  4DDI D;  3ZNG C;  4ZRJ A;  2ZZP B;  3H7P B;  1UZX B;  2RR9 A;  4NQK E;  1WXM A;  2RSU A;  1GJZ A;  4GU2 A;  3PTF C;  3MJW A;  3AU5 A;  3VXW A;  1TZ1 A;  2L7R A;  4G50 A;  2FNJ B;  3UF8 A;  2XK5 A;  3VQI A;  2XBB C;  1Q0W B;  2KXJ A;  3PRZ A;  1UBQ A;  4GDK A;  2L0F A;  2KQ7 A;  1Z2M A;  4NPN A;  1EF5 A;  1VD2 A;  3KH0 A;  4MEL A;  4ZRK A;  1BT0 A;  4I6P A;  4MSQ B;  5IAA C;  2M8S A;  4EZL A;  3ZIM A;  3DOW A;  1WFY A;  2G4S A;  3TBL D;  4IUM B;  3H7P A;  2LJ5 A;  4EUT A;  3AU4 A;  1H8C A;  2KTF A;  3RYT A;  3Q3F A;  3I3T B;  1WX8 A;  3DBL I;  2K6Q A;  2MWS B;  5GMV A;  3X0W A;  4CO7 A;  3DCG A;  3WAP A;  3ZDM C;  1GUA B;  4KSK C;  2RPQ A;  4NJ6 A;  3SU8 X;  5AZF A;  1WY8 A;  3KVF B;  3RUI B;  3H6N A;  5E6N A;  2G4D B;  3A1Q B;  3T9L A;  3VUW A;  2KJ6 A;  2LVO A;  4MM3 A;  1WXS A;  3NY5 A;  1E8Z A;  2HJ8 A;  1P1A A;  2ZJD A;  4JLC A;  3L13 A;  1WMH B;  1KJT A;  5J17 A;  2KKC A;  3V6C B;  2YVC A;  3PHX B;  4GXB A;  2K25 A;  2XEW A;  4HPL B;  5DPS A;  4URK A;  3CSF A;  2C7H A;  4KVG B;  1X1M A;  3VFK A;  3V62 A;  2KFK B;  1V49 A;  2V1Y A;  3ZRC A;  2KOX A;  2BWF A;  2EKE C;  3A1Q A;  3EHV A;  4KZ0 A;  3D32 A;  4TV3 A;  4BOS C;  5D94 A;  1WXA A;  3QCA A;  2BWE S;  2R2Q A;  2KD0 A;  3ECI A;  3ZNI D;  1Y8R C;  1E5W A;  2KMA A;  3M62 B;  4MEM A;  2NBU A;  2JY6 A;  2K8B A;  1XD3 B;  2DZM A;  1EF1 A;  4MGK E;  2NCN A;  1E90 A;  2D2Q A;  2MBH A;  3APF A;  2FCQ A;  4LDT D;  5JH5 C;  3DVG Y;  4BBN F;  1R4N I;  2PJH A;  2KQS A;  2KX0 A;  2JZZ A;  4W9L A;  3PRM B;  3WA0 A;  1WR1 A;  2KFK A;  2IO1 B;  2J7Q B;  1YQB A;  2KDI A;  4IM0 A;  5KHO A;  4IW0 A;  1WE7 A;  3WAL A;  4B9K A;  4MDK E;  3QQ8 B;  4OVU A;  4ANV A;  1E7U A;  1C1Y B;  2M0X A;  5AZH A;  2I1K A;  4LJO B;  3NOB A;  3N30 A;  4I6L B;  1KOT A;  4ZRI A;  2IY1 B;  2BYV E;  1ISN A;  2REX A;  2Z0E B;  4PYZ A;  4DHJ B;  5LXI B;  4GMV A;  4AUQ C;  3HK0 A;  5CX3 A;  1XQQ A;  2KLG A;  1LM8 B;  2LXA A;  2YLM A;  1CMX B;  3RT3 B;  1E7V A;  3UIN B;  4W9D A;  4IWO A;  2IBI B;  4XZ4 A;  1Q5W B;  3H7S A;  4FUL A;  1E8X A;  2N1V A;  2N4F A;  3GOE A;  3KUZ A;  4RM9 A;  1WGY A;  2FCS A;  2O6V B;  5CHW A;  3RD2 A;  3TCA A;  2KN5 A;  3B08 A;  3DVN V;  2GBM A;  1V2Y A;  4NAW B;  1WI0 A;  2N9P C;  2MW5 A;  2KC1 A;  5BO4 B;  4XX5 A;  1UH6 A;  1JRU A;  3ZTD A;  3ZLZ A;  3PGE A;  1RFA A;  4A3O A;  1RAX A;  3M63 B;  3QHT A;  1OGW A;  4II3 B;  3SHQ A;  3UIP B;  3HIZ A;  2ZNV C;  2LRW A;  2HE7 A;  3WAN A;  2KNB A;  4FJZ A;  5DPW A;  2GBR A;  5AEK B;  2C7M B;  5G55 A;  2NS5 A;  1KM7 A;  2KTR B;  4E74 A;  2N1W A;  1PQS A;  1VCB A;  4P7I A;  1P3Q U;  2O6V A;  1U4A A;  3BY4 B;  4GDL B;  2C9W B;  1YX6 B;  2L00 B;  1WJ6 A;  3VTV A;  2ZEQ A;  3OJ3 A;  2ZPN A;  1WX7 A;  4KDL B;  5D7G A;  4B6W A;  3L0W B;  2G3Q B;  3PSE B;  2LI5 A;  3NZU A;  4WWN A;  2LZ6 A;  2NVU I;  4TQ0 A;  1E8Y A;  1GG3 A;  4MGY E;  2NBV B;  3ZNZ B;  5J18 A;  2VRR B;  3L54 A;  4PS3 A;  2KDE B;  2KTR A;  3ONS A;  2C7N B;  2MBO A;  4ANX A;  1K8R B;  2FIF A;  2MP2 B;  3N32 A;  4KV2 A;  1SE9 A;  3ENE A;  3ZO5 B;  4EEW A;  3PLU A;  3B1L X;  2J0M A;  4JL9 A;  2BKF A;  4F1S A;  4WJQ A;  4KZC A;  4G0N B;  3QIJ A;  4GDL A;  4MH0 E;  3RZF A;  2AEH A;  3OLM D;  5TR5 A;  5L95 C;  3KYC D;  4FA6 A;  4W9K A;  5E6P A;  1TGZ B;  2AL3 A;  5DCN A;  4DXA B;  1P9D U;  3DBH I;  4CHK A;  3MHS D;  3SDL C;  2FID A;  3T8M A;  1OEY A;  2BKR B;  2GBK A;  4ICU A;  4JGH B;  3L08 A;  2KX3 A;  2NBW B;  3QX1 A;  2IY0 B;  2MP2 A;  3B0A A;  2DYM A;  2KHW B;  5E6O A;  3V6E B;  4EFO A;  4HWI B;  1V5O A;  1ZW7 A;  1XT9 B;  2JZ3 B;  3QAQ A;  4ZDV A;  3PT2 B;  4IG7 B;  1MG8 A;  4HVB A;  3APC A;  1P98 A;  2PEA A;  3LDZ E;  2HD5 B;  1M94 A;  2LVQ A;  3K9P B;  1UEL A;  1IP9 A;  2MSE D;  1NBF C;  3ZW3 A;  3DVN U;  3QA8 A;  1I35 A;  1V5T A;  3ML9 A;  2DHZ A;  3PPA A;  2KMC A;  4WJP A;  2JRI B;  4IC7 B;  4WJO A;  3JSV B;  4HCP B;  4F8C B;  1P0R A;  4KSL C;  1WGD A;  2M17 A;  3MTN B;  4FAD A;  2RGF A;  1IPG A;  1WYW B;  1UBI A;  1WIA A;  3L16 A;  3HM6 X;  4LDT B;  2PPH A;  1WXV A;  3W1S A;  4LCD E;  2CKH B;  5JHB A;  2B3A A;  2CU1 A;  5KHQ A;  4K7S A;  1WMH A;  3QJZ A;  1KLV A;  4JIO U;  2KAN A;  4HXD A;  3PS6 A;  1EO6 A;  1SIF A;  2GMI C;  4W9F A;  3VHT C;  3VTU A;  3JSV A;  3A4R A;  3PRE A;  4WAA A;  2N9X A;  2ZVO A;  3DDC B;  1D3Z A;  3QK0 A;  3VH4 B;  1S1Q B;  2WDT B;  4K7W A;  3VUX A;  4MSM B;  1WR6 E;  4GIV A;  4KIK B;  1GC6 A;  3CMM B;  4DHJ D;  4ANU A;  1WZ3 A;  1WGR A;  2L0T A;  4K81 A;  4EZJ A;  4IM2 A;  4PS7 A;  4W9C A;  4E3C A;  4W9J A;  1S3S G;  3WAO A;  3IFW B;  5HKH A;  2KLC A;  1I42 A;  4PYU A;  2KO3 A;  3KW5 B;  4GSW A;  3U8Z A;  2K8H A;  3RCZ A;  1FXT B;  2KDB A;  3H9D A;  2JRH A;  4J6I A;  2J0K A;  4MGI E;  1OEY J;  4ICV A;  1GC7 A;  2EMS A;  4A20 A;  2ZVN A;  4KIK A;  2NR2 A;  2CHZ A;  4BKG A;  4EKU A;  4II2 B;  5FR6 A;  3VDZ A;  5J2R A;  5CHF A;  4BKS D;  4M8M A;  3O65 B;  1WJU A;  4LJP B;  4ASW C;  2IO2 B;  2KDF B;  4F7Z A;  1L2N A;  4YL8 A;  4BKS A;  4TQ1 A;  4G3X B;  2R2O A;  3L17 A;  2LVP A;  1NI2 A;  2D10 A;  4NNJ B;  3TIX A;  2KZR A;  1ZGU B;  2IYD B;  2HTH A;  2I1J A;  4IWP A;  3AXC A;  1V9J A;  2D07 B;  3EEC A;  2KFJ A;  5CTR C;  4TUU A;  2CS4 A;  2IO3 B;  3U7D A;  2Z0D B;  1UD7 A;  2LXC A;  2N7E A;  5IA7 A;  3QWZ B;  2WWZ A;  4DWF A;  2L8J A;  2GBN A;  2WYQ A;  2DYB A;  3C0R B;  4RMA A;  4WJN A;  3RZW C;  1GNU A;  4HPM B;  2D11 A;  4DK5 A;  3AUL A;  2KJR A;  3ML8 A;  2W9N A;  4OVV A;  2MX2 A;  4W9E A;  4NAW A;  3RUL A;  2G45 B;  2KC2 A;  2LAS A;  3A4S C;  2GBJ A;  2LGD A;  4BVU C;  1Q1O A;  2D3G A;  1WRD B;  2BYE A;  3A9K B;  4E71 A;  1Z5S B;  1WJN A;  1J0G A;  3GZN I;  4BFR A;  3WIM A;  3UQB A;  2DEN B;  3TL5 A;  2OOB B;  4IWQ A;  1WH3 A;  3VTW A;  2DZI A;  2MBE A;  3V61 A;  2IZV B;  4RM8 A;  2MRP A;  4K7U A;  4N9F 4;  3UQA A;  3EC8 A;  3K9O B;  4NQL B;  2CHX A;  5AZG A;  4AOF A;  3R7R A;  2A5U A;  3R3M A;  3HM3 A;  3JYU A;  3A9K A;  3UGB B;  4FHK A;  1TTN A;  1H4R A;  2LUE A;  1LFD A;  1V86 A;  2MQJ A;  3ZRF A;  2K8C A;  2MCN B;  2FAZ A;  5DPR A;  4AJY B;  5LXH A;  2JUO A;  1WGG A;  2V4L A;  1AAR A;  5DPT A;  4FHJ A;  2MBQ A;  3ZKJ C;  5CHV C;  2L76 A;  2WX0 A;  2QHO A;  1HE8 A;  5JHA A;  4BOZ B;  4G11 A;  2FUH B;  3DPD A;  3KUC B;  3S2A A;  4M8N A;  2JPH A;  2Y5B B;  4K1R B;  2JF5 A;  3R66 C;  4AWJ A;  4GN1 A;  1RLF A;  3EFU A;  1WZ0 A;  1ZKH A;  2BPS A;  2PE6 B;  5C23 A;  3IVF A;  2BGF A;  3NZS A;  4HK2 A;  4M0W B;  2M4N A;  4HLE A;  1WM3 A;  3NHE B;  2KWU B;  1V81 A;  3AI5 A;  4WWP A;  4AP4 C;  2O2V B;  2LD9 A;  2Z59 B;  2K1F A;  2V3S A;  4A3P A;  2EMT A;  4W9G A;  2DX5 B;  3W1Y A;  1WGH A;  3IBE A;  4MJS B;  5C1Z A;  2ZCC A;  1YJ1 A;  2CR5 A;  1WF9 A;  4TKN A;  2LGY A;  2L3Z A;  3BIN A;  2PE9 A;  3M3J A;  2KWC A;  1V6E A;  4FBJ B;  1WM2 A;  3VVW B;  4FJY A;  1WE6 A;  2N9E B;  4GB9 A;  2DZJ A;  3VAW A;  3NS8 A;  2DAF A;  4DHZ E;  1E8W A;  3IG3 A;  3U30 A;  3HHM A;  5JZE B;  3N3K B;  5D6J B;  3L10 B;  2ZNV B;  2LWP A;  3V60 A;  1YD8 U;  2MBB B;  2C60 A;  1OQY A;  2O2V A;  4HJK A;  3KYD D;  1SGH A;  2K6D B;  3WAM A;  1R4M I;  4MJS A;  4PS8 A;  5L83 A;  1L7Y A;  2N7D A;  1V80 A;  2J0J A;  2AYO B;  2ZPY A;  3QC8 B;  4X57 B;  4GGQ A;  4AJW A;  1G6J A;  3PV1 A;  4MGZ E;  4FJV B;  4NY0 A;  2DAJ A;  3P2B A;  4DHZ B;  1UGM A;  4EZK A;  3QAR A;  2CHW A;  3OAW A;  4BBN C;  2JVC A;  3DQV A;  2JT4 B;  4HDO A;  3TMP B;  3DBR I;  1RRB A;  4ZYN A;  4GOC A;  4XC2 A;  4ANW A;  2IO0 B;  2AWT A;  1T0Y A;  1QZE A;  2M1M A;  4WWO A;  4DDG D;  3JW0 X;  3IHP C;  1YX5 B;  2UYZ B;  3M95 A;  3PRP B;  3X23 A;  2LGX A;  4BKT A;  2NPT B;  4IM3 A;  3TJP A;  3W1S C;  1YIW A;  3A33 B;  2K39 A;  1F9J A;  2OJR A;  3H1U A;  3UIO B; 
#chains in the Genus database with same CATH topology
 2LRU A;  1TYG B;  2MA9 B;  3PHW B;  1C3T A;  1TKG A;  3ZVV A;  1VZ6 A;  2H88 B;  3ZJV A;  2GOW A;  1NVI D;  3PZD A;  4HDQ A;  5C2T B;  1VZ7 A;  2MJE A;  2FCN A;  3SFD B;  2KVR A;  4RGN A;  2MJD A;  4AS1 A;  3ZNH B;  3JVZ X;  1SF0 A;  2N7J A;  3OJ4 B;  1DYQ A;  2ASQ A;  2AL6 A;  3BK1 A;  3A9J A;  1JW9 D;  3Q3O C;  3ZNG C;  2LJI A;  1R4M B;  2ICI A;  1WXM A;  1GJZ A;  2QC8 A;  1TZ1 A;  1D4B A;  4JWS C;  3VQI A;  1Q0W B;  1WGK A;  1TY0 A;  4NPN A;  4NZL B;  3KH0 A;  1VD2 A;  4ZRK A;  4EZL A;  4MSQ B;  2M8S A;  3V05 A;  3ZIM A;  4MM3 B;  5E6J A;  3FIL B;  3TBL D;  3H7P A;  2LJ5 A;  4EUT A;  3AU4 A;  1H8C A;  1QIL A;  2GB1 A;  1PGX A;  3DBL I;  1RM6 C;  3DCG A;  2E6X A;  3WAP A;  1EU3 A;  2RPQ A;  3H6N A;  3T9L A;  3A1Q B;  1XXG A;  2KJ6 A;  5FK9 C;  1TS5 A;  3ZXV A;  3CSF A;  3RNG C;  2C7H A;  3U7Z A;  1X1M A;  3VFK A;  1V49 A;  1JAL A;  3BVZ A;  2BWF A;  5EE0 A;  2WS3 B;  1WXA A;  4XDD A;  1E5W A;  3M62 B;  4MEM A;  4J3O D;  2GLS A;  2SAK A;  1E90 A;  1ZE3 D;  4LDT D;  3DHG C;  3DVG Y;  1R4N I;  2PJH A;  2QDF A;  3VR8 B;  3PRM B;  2DBY A;  2KFK A;  5BMG A;  5KHO A;  4IW0 A;  2VZK D;  2I1K A;  3NOB A;  2RPV A;  4I6L B;  1KOT A;  1FPY A;  4OZA A;  1ISN A;  3O13 A;  4PYZ A;  4DHJ B;  4AUQ C;  4RNA A;  2LXA A;  3RT3 B;  5D3I B;  1AYF A;  2IBI B;  2IGH A;  4YTM B;  1Q5W B;  3H7S A;  1E7P B;  2K5P A;  2N1V A;  2N4F A;  2WXP A;  2FCS A;  2KN5 A;  2PW9 A;  3HRD D;  3ZLZ A;  4A3O A;  1RAX A;  3SHQ A;  3RNF C;  2GBR A;  5AEK B;  2C7M B;  4REZ A;  1YJI A;  2DLB A;  4LNI A;  1VCB A;  2O6V A;  2C9W B;  4KDL B;  5D7G A;  3PSE B;  1P7E A;  3NZU A;  2NVU I;  4TQ0 A;  3V3X A;  2AQ3 B;  3AEE B;  3LB8 C;  3N32 A;  1SE9 A;  3PLU A;  2J0M A;  3FAH A;  4JL9 A;  2H89 B;  3QIJ A;  2AEH A;  5TR5 A;  3KYC D;  4OW0 A;  3SDL C;  2LFI A;  3U52 E;  3L08 A;  1FXA A;  4L1B A;  2MP2 A;  1FMA D;  2I38 A;  3RN9 C;  3Q14 C;  1V5O A;  3QAQ A;  1P98 A;  2Y5C A;  3FIL A;  2MSE D;  1NBF C;  3ZW3 A;  3DVN U;  1SB3 C;  1V5T A;  3ML9 A;  1XLN A;  1CK1 A;  4F8C B;  1T0S C;  3TEY A;  4KSL C;  1WGD A;  2M17 A;  3MTN B;  1TJE A;  3EFC A;  1WYW B;  4LDT B;  1SEB D;  5BMI A;  3E56 A;  2WGS A;  1T3Q A;  2WXM A;  3AE7 B;  1SIJ A;  1Y56 A;  1EO6 A;  2GMI C;  4W9F A;  4US8 A;  3A4R A;  2WU5 B;  3AEG B;  2N9X A;  1D3Z A;  3MFG A;  3QK0 A;  1S1Q B;  3VUX A;  1KF6 B;  4N59 A;  4MSM B;  4GIV A;  1WXQ A;  1WGR A;  1GB4 A;  4W9J A;  4P16 A;  1LO5 D;  3BYT B;  1L4Z B;  2K8H A;  2KDB A;  3H9D A;  1CZP A;  4J6I A;  1OEY J;  1GC7 A;  4KIK A;  4BKG A;  1K50 A;  1WJU A;  3P4P B;  1L2N A;  3TUO A;  3N1X C;  4G3X B;  4HRS A;  4B0M A;  2KAC A;  4YT0 B;  2KZR A;  3TIX A;  1ZGU B;  1XEE A;  1YOV B;  5G5H A;  4IWP A;  2ON8 A;  3EEC A;  2KFJ A;  4TUU A;  2QMT A;  5HFY A;  4C80 A;  2IO3 B;  1C79 A;  2MEK A;  1UD7 A;  2LXC A;  3IXS A;  3QWZ B;  4DWF A;  3C0R B;  4RMA A;  1ZUD 2;  1QT9 A;  3IAM 1;  5G5G A;  5TSS A;  5C3J B;  2WQY B;  3DWM A;  3OG5 A;  4M00 A;  4IKG A;  3RUL A;  3BWU D;  2GBJ A;  2KQ4 X;  4BZA A;  1GPX A;  1J0G A;  3UQB A;  4N6E B;  1I4R A;  3I57 A;  2DZI A;  4MH8 A;  3V61 A;  4RM8 A;  2MRP A;  4NQL B;  5AZG A;  4WWM A;  2A5U A;  4XYC A;  1PDX A;  1LFD A;  3ZRF A;  1ZP0 B;  1ZXH A;  2MCN B;  1KH0 A;  4IOI E;  4OZB A;  2JUO A;  2V4L A;  2BS4 B;  4HJG E;  2MBQ A;  2L76 A;  4OVZ A;  1TS3 A;  4BOZ B;  3KUC B;  3Q69 A;  4M8N A;  4K1R B;  4WIP A;  2JF5 A;  4A90 A;  1WZ0 A;  1ZKH A;  2BPS A;  3I63 C;  2K3U A;  2KAJ A;  4ITK A;  4M0W B;  4HLE A;  4ZRP A;  2PTL A;  5EE9 A;  2WXQ A;  3AI5 A;  4AP4 C;  2JZP A;  2V3S A;  3P1M A;  1VLB A;  4MJS B;  2V3P A;  2CR5 A;  1QQR A;  2LGY A;  1VR9 A;  2PE9 A;  4AQ7 A;  4FJY A;  2N9E B;  2DZJ A;  1OFF A;  3U30 A;  5D6J B;  3V60 A;  1OQY A;  3LYY A;  4HJK A;  3KYD D;  3AE3 B;  4P1B C;  4ZRQ A;  3ZJU A;  3WAM A;  4AJW A;  3W5U B;  3NRZ A;  3PV1 A;  1D5Z C;  4FJV B;  4DHZ B;  4EZK A;  3Q3N C;  2DNF A;  3OAW A;  4BBN C;  1TY2 A;  1N60 A;  4RFB A;  1WYG A;  4ZYN A;  4GOC A;  1QZE A;  4DDG D;  1JWB D;  1JML A;  3X23 A;  4BKT A;  1EWC A;  3A33 B;  2N0S B;  3J9C A;  3H1U A;  3I9V 1;  4LTU A;  4YTN B;  2ZCB A;  1JRO A;  4R3D A;  1T5X D;  2MJ3 A;  1LQB A;  1EUV B;  3R7Q A;  5EDS A;  3RMK C;  3DWG C;  1J7C A;  1MI0 A;  1JRP A;  1LXD A;  1T0R C;  2ONQ A;  3P63 A;  4JQW C;  4KKJ A;  4K3B A;  1SXT A;  1GOZ A;  3ALB A;  2EEL A;  1B1Z A;  5D2M B;  2PVG C;  3LJ3 A;  5LLI A;  4W9H A;  1FNW A;  3A9J B;  1PGA A;  2WHI A;  3KUD B;  4LLG M;  3ZTC A;  2BYF A;  3PVL A;  4HCN B;  2O6V D;  2FCM A;  2WX1 A;  2L05 A;  3TEZ A;  1KTK A;  1DOI A;  3AE6 B;  3CF6 E;  1BML C;  1WX9 A;  4DDI D;  4USA A;  2AX5 A;  2ZZP B;  3H7P B;  4ZRJ A;  3BZD B;  2LGI A;  4HKQ A;  2RSU A;  3VXW A;  1DGJ A;  1QKZ A;  3PRZ A;  1UBQ A;  2LMC A;  3I5J C;  1YNT E;  4LK0 M;  3RYT A;  4OZC A;  3Q3F A;  1J7B A;  3AH7 A;  5D3D A;  3DHH C;  2K6Q A;  2MWS B;  3TSS A;  1GUA B;  4NJ6 A;  4RF1 A;  5AZF A;  1WY8 A;  2W82 A;  3VUW A;  5JXV A;  1TKY A;  1E8Z A;  1KJT A;  1AW7 A;  4C7Z A;  3T3O A;  3PHX B;  4YSX B;  4HPL B;  2V0G A;  5EE1 A;  3V62 A;  2KFK B;  3ZRC A;  1N5X A;  1K51 A;  4KZ0 A;  1D6E C;  3EHV A;  5D94 A;  2BWE S;  2R2Q A;  3MP9 A;  1Y8R C;  2NBU A;  2JY6 A;  2K8B A;  3E9S A;  1EF1 A;  4MGK E;  2FCQ A;  5HG2 A;  3C19 A;  2JWU A;  2KQS A;  2JZZ A;  3WA0 A;  1VJK A;  2RDH A;  1N63 A;  3NVV A;  2KVZ A;  1ZOY B;  2KDI A;  1WE7 A;  3WAL A;  4MDK E;  4ANV A;  4LNO A;  2CU3 A;  1E7U A;  1QF6 A;  1HXY D;  3NVW A;  3URY A;  5AZH A;  4RF0 A;  1HA5 A;  2IY1 B;  1C77 A;  4D2K A;  1T6B X;  5EE3 A;  5IN7 A;  5LNK 1;  2YLM A;  3RNB C;  2Y5P A;  3ZGZ A;  3DHI C;  1E8X A;  3KUZ A;  5CHW A;  4DHJ D;  2O6V B;  4ZOH C;  3AE8 B;  1ZXI A;  2GBM A;  2N9P C;  5FR3 A;  2KC1 A;  2HTM E;  4XX5 A;  3ZTD A;  1RFA A;  3QHT A;  2XNA C;  2LRW A;  2KNB A;  4KGR A;  5DPW A;  2WXI A;  3N1Z C;  3B2G A;  1P3Q U;  1U4A A;  2MH7 A;  3BY4 B;  2CJO A;  4B6W A;  3L0W B;  2G3Q B;  1TS2 A;  4WWN A;  2LZ6 A;  4MGY E;  3ZNZ B;  2RMM A;  4C4V A;  1YN3 A;  2YEP F;  4ANX A;  2FIF A;  2MP2 B;  4JPS A;  1FNU A;  3ZO5 B;  1AWD A;  1L6U A;  4N58 A;  4WJQ A;  1CJE A;  1JWU D;  4GDL A;  4MH0 E;  3OLM D;  4JX1 C;  4W9K A;  5E6P A;  1YMH E;  5DCN A;  1P9D U;  3DBH I;  3MHS D;  4ARI A;  2BKR B;  4RGM A;  4FXC A;  3Q3M C;  1MVK A;  2INP E;  2DYM A;  4DXF A;  4EFO A;  4HWI B;  1ZW7 A;  4ZDV A;  3PT2 B;  3OWE B;  4IG7 B;  4HVB A;  3APC A;  3K9P B;  1FCC C;  1UEL A;  1RWS A;  3R2T A;  1UNS A;  1XCT L;  3QA8 A;  3B2F A;  3PPA A;  4WJO A;  4A8X C;  3HVD A;  1WIA A;  3L16 A;  4RH6 A;  3ZXR A;  3W2D A;  2M19 A;  4WQM A;  2IPK D;  2B3A A;  4K7S A;  3BII D;  4JIO U;  3PS6 A;  3VHT C;  1SIF A;  3KWV A;  3VTU A;  3JSV A;  2RDB C;  3PRE A;  2ZVO A;  4KIK B;  3IT4 B;  4K81 A;  4PS7 A;  4W9C A;  4M01 A;  1S3S G;  2KLC A;  1I42 A;  2KO3 A;  2JRH A;  4ICV A;  1UUP A;  2CHZ A;  3VDZ A;  4BKS D;  4M8M A;  1MG4 A;  2D5G A;  3AMZ A;  2OED A;  3EGR A;  1VZ8 A;  3AEC B;  2I2Y A;  2HTH A;  2MHJ A;  2I1J A;  3AXC A;  3Q8F A;  2D3C A;  2CS4 A;  2Z0D B;  4HKZ E;  2WWZ A;  2J4X A;  2GBN A;  4WJN A;  1JCK B;  5IP4 D;  4EE2 A;  2HJ1 A;  4DK5 A;  2KJR A;  1ET9 A;  2J42 A;  4L2Y A;  2KC2 A;  2K0P A;  1Q1O A;  2D3G A;  2BYE A;  3GZN I;  4BFR A;  3GB1 A;  1WH3 A;  4RGT A;  3AB5 A;  1AN8 A;  4K7U A;  4N9F 4;  3AEA B;  3EC8 A;  1FO4 A;  3R3M A;  3W5V B;  4XWW A;  1H4R A;  1V86 A;  2IND C;  2ZW1 A;  1N6Z A;  2JU6 X;  1UWX A;  3GP7 A;  5LXH A;  4K3C A;  2HDE A;  5DPT A;  2LHE A;  2N9K A;  2WX0 A;  1FCL A;  1HE8 A;  4G11 A;  3DPD A;  3S2A A;  2M0A A;  3R66 C;  2TSS A;  3EFU A;  5T8I A;  2PE6 B;  3P4R B;  3IVF A;  4OHJ A;  2M4N A;  3ZJT A;  3NHE B;  2KWU B;  3BK2 A;  4WWP A;  2EKI A;  2Z59 B;  2EMT A;  1FM0 D;  2DX5 B;  4W9G A;  1WGH A;  2CJN A;  5C1Z A;  4TKN A;  2L3Z A;  3BIN A;  1IGC A;  1E10 A;  1WM2 A;  1I4P A;  3B9J A;  3NUH B;  3ZYY X;  3VAW A;  1JWM D;  3NS8 A;  2DAF A;  2WDV B;  4RGO S;  4YXD B;  3N3K B;  3L10 B;  2ZNV B;  2LWP A;  2FE8 A;  1YD8 U;  2MBB B;  2O2V A;  1SGH A;  2KT7 A;  1R4M I;  3FC4 A;  3SFE B;  4PS8 A;  1J7A A;  4XDC A;  5L83 A;  1V80 A;  3HVZ A;  4X57 B;  4GGQ A;  1TIF A;  2AQ1 B;  1WSP A;  2DAJ A;  1UGM A;  1EM7 A;  1E0Z A;  4HDO A;  2JT4 B;  1YN4 A;  3TMP B;  4JWU C;  4ANW A;  2WXN A;  1FRR A;  1T0Y A;  3JW0 X;  2BT6 A;  1C4A A;  3M95 A;  2LGX A;  1PYW D;  1YIW A;  1I4X A;  1SJE D;  2OJR A;  3AV8 A;  3UIO B;  2JQR B;  4CYE A;  1L0X B;  4KDI C;  3BYY B;  1A5R A;  4ZHO A;  2PMV A;  1HTO A;  2NPT A;  1D5X C;  4DBG A;  1TBE A;  2UU7 A;  2JXX A;  2DYO A;  2A4Z A;  3AE4 B;  1E9M A;  1QLB B;  2D3A A;  1BUI C;  2UWQ A;  2WXF A;  3CIR B;  3DBS A;  4EOY A;  3CST A;  3Q3J A;  4FLH A;  1KLG D;  4I6N B;  3APD A;  1QOG A;  5G2N A;  4WQO B;  2KN4 A;  2KWV B;  2DZK A;  3VUY A;  2BF8 B;  3TEW A;  2BS3 B;  5H8Y E;  4A9A A;  1XCQ L;  1UF0 A;  2RR9 A;  4NQK E;  1YJJ A;  4GU2 A;  3PTF C;  3MJW A;  3AU5 A;  4G50 A;  3KLS X;  2FNJ B;  4PT5 A;  3UF8 A;  1HEZ E;  2XK5 A;  2XBB C;  2GRI A;  1GAQ B;  1SE3 A;  4GDK A;  3DBR B;  1EF5 A;  4MEL A;  5IAA C;  1VDV A;  3DOW A;  1B9R A;  4IUM B;  4ARC A;  2KTF A;  1WX8 A;  3X0W A;  4CO7 A;  4BAX A;  3ZDM C;  3RFZ B;  2WXK A;  3SU8 X;  1TT5 B;  1QOB A;  3KVF B;  3RUI B;  2G4D B;  3GE3 C;  1WXS A;  3NY5 A;  1MHX A;  2HJ8 A;  1P1A A;  2ZJD A;  1R7S A;  1IUE A;  5J17 A;  2B76 B;  3V6C B;  2YVC A;  2IDY A;  2K25 A;  5DPS A;  4URK A;  4C00 A;  1QOA A;  3CWI A;  2KOX A;  2EKE C;  2W3R A;  3D32 A;  3QCA A;  3ECI A;  3ZNI D;  2G9H D;  1XD3 B;  2DZM A;  2NCN A;  3APF A;  5JH5 C;  4BBN F;  1WR1 A;  3NVY A;  2J7Q B;  2FBW B;  4IM0 A;  2NTS A;  3QQ8 B;  4OVU A;  2RDG A;  5GXG B;  2M0X A;  4A6Q A;  3Q8E A;  2X38 A;  3FKY A;  2GI9 A;  2REX A;  1YN5 A;  2Z0E B;  3PZ7 A;  3HK0 A;  2IJ0 A;  5CX3 A;  1XQQ A;  2KLG A;  2VH2 A;  1SSN A;  1VRA B;  4W9D A;  4TSS A;  4XZ4 A;  1DOX A;  1OQQ A;  4ACF A;  3RD2 A;  1WGY A;  3B08 A;  1V2Y A;  4NAW B;  1WI0 A;  3DBL B;  3VR9 B;  1JRU A;  3PGE A;  1P7F A;  4II3 B;  3UIP B;  3HIZ A;  3ZQ4 A;  4C56 C;  2ZNV C;  4C4V B;  2VH1 A;  5G55 A;  3SEB A;  2NS5 A;  1KM7 A;  4E74 A;  1PQS A;  4P7I A;  3RI7 C;  1ZPS A;  2R61 A;  4GDL B;  1YX6 B;  3AE9 B;  1NYQ A;  1MFW A;  2L00 B;  2ZEQ A;  2SEB D;  2ZPN A;  3OJ3 A;  4KGS A;  2NTT A;  1E8Y A;  5J18 A;  2VRR B;  2KTR A;  1V1P A;  2C7N B;  3EUB 2;  1FRD A;  4EEW A;  3ENE A;  3B1L X;  4F1S A;  4G0N B;  5L95 C;  1R4N B;  1TGZ B;  4DXA B;  1F77 A;  3VRB B;  5AUI A;  2FID A;  3T8M A;  1OEY A;  2LHD A;  2GBK A;  2BYT A;  2INN E;  1BXT A;  1L4D B;  2IY0 B;  3B0A A;  2KHW B;  5E6O A;  1JWA D;  3AEF B;  3V6E B;  1PUT A;  4MT5 A;  5H92 C;  2PEA A;  3LDZ E;  1M94 A;  2LVQ A;  1IP9 A;  5HI1 A;  2KMC A;  4WJP A;  2JRI B;  3JSV B;  1FFU A;  4HCP B;  1P0R A;  1NEK B;  2RGF A;  1IPG A;  1UBI A;  3IAS 1;  3HM6 X;  4ZHP A;  1WXV A;  2KDM A;  3W1S A;  4O1N A;  2D3B A;  5KHQ A;  1KLV A;  2KAN A;  3MJ5 A;  3GE8 C;  3DDC B;  3Q2A C;  2WDT B;  1WR6 E;  1GB1 A;  1GC6 A;  3L4P A;  2L0T A;  4QAY A;  4IM2 A;  1L6V A;  1HQR D;  3IFW B;  4PYU A;  4TMA B;  1I7H A;  1FXT B;  4HPP A;  3R2I A;  1TS4 A;  4MGI E;  4S0R A;  2EMS A;  4EKU A;  2L52 A;  2NR2 A;  1ENF A;  4II2 B;  5FR6 A;  1F0Z A;  5CHF A;  3RNE C;  1K52 A;  4ASW C;  2IO2 B;  4F7Z A;  4YL8 A;  1ZDV A;  3AM9 A;  1CQV A;  2R2O A;  3L17 A;  1NI2 A;  1F2R C;  2D10 A;  1V9J A;  2D07 B;  3N1Y C;  1F2R I;  2KMM A;  3RZW C;  1Q10 A;  1GNU A;  1XF5 L;  4HPM B;  2D11 A;  3ML8 A;  2W9N A;  2IGD A;  2MX2 A;  4JE3 B;  4W9E A;  2BS2 B;  4NAW A;  1F52 A;  4DQO C;  3A4S C;  4BVU C;  1N5W A;  3ABV B;  4E71 A;  1Z5S B;  4LNK A;  3WIM A;  2DEN B;  3TL5 A;  4H2A A;  2MBE A;  2CHX A;  4XWT A;  2BTE A;  4AOF A;  3R7R A;  1FNV A;  3A9K A;  3UGB B;  1IBX A;  4FHK A;  5BYQ A;  2LUE A;  1I4G A;  1L5P A;  2FAZ A;  5DPR A;  4AJY B;  2WXH A;  3MHZ A;  3Q8C A;  1OQR A;  1FEH A;  4FHJ A;  1FD6 A;  5JHA A;  3NG0 A;  2JPH A;  4AWJ A;  2W54 A;  1QOF A;  2L83 A;  2BGF A;  4HK2 A;  3TEX A;  1WM3 A;  1F1H A;  2O2V B;  4LNF A;  2BQQ A;  2LD9 A;  2W55 A;  4A3P A;  3W1Y A;  3IBE A;  4C7Y A;  1STE A;  2ZCC A;  1WF9 A;  2Z8L A;  3M3J A;  2KWC A;  3Q8A A;  1V6E A;  4FBJ B;  3VVW B;  2PLP A;  1WE6 A;  5I4D A;  4DHZ E;  3IG3 A;  5JZE B;  2V9H A;  3U4E G;  2AQ2 B;  1C4C A;  2WP9 B;  2ZW0 A;  2K6D B;  2LUM A;  1L7Y A;  3RPF C;  2ZPY A;  2AYO B;  1HZ6 A;  3RNA C;  4MGZ E;  4NY0 A;  2L32 A;  4Q2J A;  3AEB B;  1ET6 A;  2JVC A;  4YSZ B;  3DQV A;  1RRB A;  5BMH A;  1I4Q A;  4XC2 A;  2IO0 B;  2M1M A;  4WWO A;  3IHP C;  1UGJ A;  3PRP B;  1XO3 A;  2NPT B;  3AN1 A;  3TJP A;  4NAM A;  2JYE A;  4B0E A;  2K39 A;  2ACZ B;  1K53 A;  1DOY A;  1J8C A;  2W3S A;  2RD0 A;  2MLB A;  1NDD A;  2QJL A;  1HTQ A;  1ESF A;  1IYF A;  4WH4 A;  4B95 A;  1WJ4 A;  2QSD A;  3VH3 B;  3DVG X;  1C78 A;  2JWZ A;  1J19 A;  4LNN A;  2JX5 A;  2KJH B;  3PLV A;  2BB6 A;  2Q5W D;  4KGT A;  2KK8 A;  1EU4 A;  4FN2 A;  2INC C;  3H8H A;  3ZDT A;  2V4I B;  3SD5 A;  3ZUN A;  1MHH E;  1OTR B;  2QCZ A;  4ZYS A;  1YQ4 B;  2E3T A;  4NJ7 A;  4S17 A;  2XK5 B;  4GDK B;  5IOI A;  2KYW A;  1N61 A;  5BYS A;  2C5L C;  4W9I A;  1UZX B;  2L7R A;  2KXJ A;  2FUG 1;  1EWY C;  2L0F A;  2KQ7 A;  1Z2M A;  1BT0 A;  4I6P A;  3UI3 A;  1WFY A;  2G4S A;  3I3T B;  1IGD A;  4RCO A;  5GMV A;  4KSK C;  1XLO A;  4HRO A;  5E6N A;  2LVO A;  4MM3 A;  2OJW A;  3L13 A;  1WMH B;  1YQ3 B;  4JLC A;  4P1C C;  2KKC A;  3VRA B;  2PVO D;  2WNM A;  4GXB A;  2XEW A;  1UWM A;  2QIE B;  4KVG B;  3N20 C;  2WDR B;  2V1Y A;  3A1Q A;  4TV3 A;  4BOS C;  2KD0 A;  2KMA A;  2VZK B;  3EA6 A;  1ROE A;  2D2Q A;  2MBH A;  2KX0 A;  2Y3A A;  4W9L A;  2IO1 B;  1YQB A;  4B9K A;  1A70 A;  1MJD A;  1C1Y B;  4LJO B;  3N30 A;  5FKA C;  4ZRI A;  1WRI A;  2BYV E;  5LXI B;  3MC8 A;  4GMV A;  4GLS C;  1LM8 B;  1CMX B;  1E7V A;  4L23 A;  3UIN B;  4IWO A;  3SR6 A;  1E6E B;  4FUL A;  3GOE A;  3TCA A;  4RM9 A;  4KX6 B;  3P4Q B;  1JWS D;  2WXJ A;  3AED B;  3DVN V;  1FFV A;  1ACC A;  2MW5 A;  2J52 A;  5BO4 B;  1UH6 A;  4YWG G;  1KRH A;  3M63 B;  1OGW A;  1MPE A;  2WXR A;  2V3N A;  2HE7 A;  3WAN A;  4FJZ A;  5AUK A;  2KTR B;  1V1P B;  2N1W A;  2BB5 A;  2DWQ A;  1C9F A;  3KQ4 A;  1V8C A;  1WJ6 A;  2K9X A;  3VTV A;  1WX7 A;  3NS1 A;  3ETR A;  2LI5 A;  4YSY B;  1GG3 A;  2NBV B;  3L54 A;  4PS3 A;  1TZO A;  2KDE B;  2M56 B;  4XE0 A;  3ONS A;  2MBO A;  1T0Q C;  1K8R B;  3MC9 A;  4KV2 A;  1D5M C;  3MC0 B;  2BKF A;  1SBB B;  4KZC A;  3RZF A;  4FA6 A;  2AL3 A;  1LGR A;  4CHK A;  3C8Y A;  4ICU A;  4JGH B;  4UDU C;  3N9Y C;  2KX3 A;  3KWL A;  2NBW B;  3QX1 A;  1I4H A;  1NYR A;  1KLU D;  1XT9 B;  2JZ3 B;  1MG8 A;  4US9 A;  2HD5 B;  3Q6B A;  1I35 A;  1N62 A;  2DHZ A;  4MAC A;  4IC7 B;  2JXT A;  4FAD A;  4XGA B;  2JSV X;  1NI3 A;  2LGS A;  3NJT A;  2PPH A;  4LCD E;  2CKH B;  2LEK A;  5JHB A;  2CU1 A;  2KWD A;  1WMH A;  2WXL A;  3QJZ A;  2WXO A;  4HXD A;  1RYJ A;  3GS2 A;  3PO0 A;  4WAA A;  3VH4 B;  1PFD A;  4K7W A;  3CMM B;  4ANU A;  1WZ3 A;  3IT6 B;  4EZJ A;  4E3C A;  2BVC A;  1RFK A;  3WAO A;  4HEA 1;  5HKH A;  4GSW A;  3KW5 B;  3WCQ A;  3U8Z A;  3RCZ A;  1FIQ A;  1XLQ A;  4IDI A;  3AE5 B;  2J0K A;  2YEP B;  4A20 A;  2ZVN A;  1V97 A;  4NJC A;  5J2R A;  4M02 A;  3O65 B;  1HZ5 A;  3DBH B;  4DXG A;  1L0Y B;  3BVM A;  2KDF B;  4LJP B;  4YTP B;  4BKS A;  4TQ1 A;  5MPO A;  2LVP A;  4NNJ B;  3AE2 B;  1XLP A;  2X8X X;  2IYD B;  2QIL A;  5HHD G;  3P4S B;  3LXF A;  5CTR C;  1L0V B;  3NVZ A;  4WUR A;  3U7D A;  2N7E A;  5IA7 A;  2QEJ C;  2WXG A;  2L8J A;  2WYQ A;  2DYB A;  1SE2 A;  3AUL A;  4OVV A;  1KFY B;  3R8B A;  2G45 B;  3NZ3 A;  2LAS A;  2LGD A;  1FXI A;  1WRD B;  2G1E A;  1V1O A;  1IBX B;  3A9K B;  1WJN A;  4PK1 A;  1C4P A;  2N9L A;  2OOB B;  4IWQ A;  3VTW A;  4KKI A;  4A55 A;  2IZV B;  4P6V F;  1SE4 A;  3UQA A;  3K9O B;  2PKO A;  2L1A A;  3HUI A;  3HM3 A;  3JYU A;  4WAF A;  1TTN A;  2MQJ A;  2K8C A;  2PIA A;  3T3N A;  2WDQ B;  1WGG A;  1AAR A;  2BBC A;  1WWT A;  3ZKJ C;  5CHV C;  2QHO A;  2FUH B;  2Y5B B;  4GN1 A;  1RLF A;  2NMQ A;  3AE1 B;  3P42 A;  2BW2 A;  2IGG A;  5C23 A;  3PZ8 A;  2OHF A;  3NZS A;  1V81 A;  2WLB A;  2K1F A;  3W9C B;  3BVG A;  1YJ1 A;  4CQN A;  4GB9 A;  5IKC M;  1M4V A;  2K22 A;  4M0W A;  3RNC C;  1E8W A;  1C76 A;  3HHM A;  2J53 A;  2C60 A;  3Q8B A;  1SJH D;  2XN9 C;  4MJS A;  2N7D A;  2J0J A;  3QC8 B;  1G6J A;  3P2B A;  3GZN B;  3U2S C;  3QAR A;  2CHW A;  3DBR I;  1JQ4 A;  5BYR A;  2JYT A;  1ZDX A;  2AWT A;  2WU2 B;  5IO9 A;  1YX5 B;  2UYZ B;  1TKE A;  4IM3 A;  3W1S C;  1NEN B;  1PGB A;  1F9J A; 
#chains in the Genus database with same CATH homology
 2LRU A;  2ZCB A;  4CYE A;  4KDI C;  2MA9 B;  3PHW B;  1J8C A;  1LQB A;  1EUV B;  1C3T A;  3R7Q A;  5EDS A;  3ZVV A;  2RD0 A;  2MLB A;  1NDD A;  1IYF A;  1A5R A;  1LXD A;  4B95 A;  1WJ4 A;  4JQW C;  2GOW A;  2NPT A;  4DBG A;  3VH3 B;  3DVG X;  1TBE A;  2JWZ A;  3PZD A;  2JXX A;  2DYO A;  4HDQ A;  1J19 A;  3ALB A;  2A4Z A;  5D2M B;  2UWQ A;  3LJ3 A;  5LLI A;  4W9H A;  2KJH B;  3DBS A;  3PLV A;  2FCN A;  4EOY A;  3CST A;  2KVR A;  3A9J B;  3KUD B;  3Q3J A;  2KK8 A;  4FLH A;  4I6N B;  3ZTC A;  4FN2 A;  3APD A;  3ZDT A;  5G2N A;  4WQO B;  2BYF A;  3PVL A;  4HCN B;  3ZNH B;  3SD5 A;  2O6V D;  3ZUN A;  2FCM A;  3JVZ X;  1OTR B;  2WX1 A;  2KWV B;  2L05 A;  3OJ4 B;  4NJ7 A;  2DZK A;  2XK5 B;  3VUY A;  2BF8 B;  3CF6 E;  4GDK B;  2ASQ A;  2AL6 A;  3A9J A;  2C5L C;  4W9I A;  1WX9 A;  4DDI D;  3ZNG C;  4ZRJ A;  2ZZP B;  3H7P B;  1UZX B;  2RR9 A;  4NQK E;  1WXM A;  2RSU A;  1GJZ A;  4GU2 A;  3PTF C;  3MJW A;  3AU5 A;  3VXW A;  1TZ1 A;  2L7R A;  4G50 A;  2FNJ B;  3UF8 A;  2XK5 A;  3VQI A;  2XBB C;  1Q0W B;  2KXJ A;  3PRZ A;  1UBQ A;  4GDK A;  2L0F A;  2KQ7 A;  1Z2M A;  4NPN A;  1EF5 A;  1VD2 A;  3KH0 A;  4MEL A;  4ZRK A;  1BT0 A;  4I6P A;  4MSQ B;  5IAA C;  2M8S A;  4EZL A;  3ZIM A;  3DOW A;  1WFY A;  2G4S A;  3TBL D;  4IUM B;  3H7P A;  2LJ5 A;  4EUT A;  3AU4 A;  1H8C A;  2KTF A;  3RYT A;  3Q3F A;  3I3T B;  1WX8 A;  3DBL I;  2K6Q A;  2MWS B;  5GMV A;  3X0W A;  4CO7 A;  3DCG A;  3WAP A;  3ZDM C;  1GUA B;  4KSK C;  2RPQ A;  4NJ6 A;  3SU8 X;  5AZF A;  1WY8 A;  3KVF B;  3RUI B;  3H6N A;  5E6N A;  2G4D B;  3A1Q B;  3T9L A;  3VUW A;  2KJ6 A;  2LVO A;  4MM3 A;  1WXS A;  3NY5 A;  1E8Z A;  2HJ8 A;  1P1A A;  2ZJD A;  4JLC A;  3L13 A;  1WMH B;  1KJT A;  5J17 A;  2KKC A;  3V6C B;  2YVC A;  3PHX B;  4GXB A;  2K25 A;  2XEW A;  4HPL B;  5DPS A;  4URK A;  3CSF A;  2C7H A;  4KVG B;  1X1M A;  3VFK A;  3V62 A;  2KFK B;  1V49 A;  2V1Y A;  3ZRC A;  2KOX A;  2BWF A;  2EKE C;  3A1Q A;  3EHV A;  4KZ0 A;  3D32 A;  4TV3 A;  4BOS C;  5D94 A;  1WXA A;  3QCA A;  2BWE S;  2R2Q A;  2KD0 A;  3ECI A;  3ZNI D;  1Y8R C;  1E5W A;  2KMA A;  3M62 B;  4MEM A;  2NBU A;  2JY6 A;  2K8B A;  1XD3 B;  2DZM A;  1EF1 A;  4MGK E;  2NCN A;  1E90 A;  2D2Q A;  2MBH A;  3APF A;  2FCQ A;  4LDT D;  5JH5 C;  3DVG Y;  4BBN F;  1R4N I;  2PJH A;  2KQS A;  2KX0 A;  2JZZ A;  4W9L A;  3PRM B;  3WA0 A;  1WR1 A;  2KFK A;  2IO1 B;  2J7Q B;  1YQB A;  2KDI A;  4IM0 A;  5KHO A;  4IW0 A;  1WE7 A;  3WAL A;  4B9K A;  4MDK E;  3QQ8 B;  4OVU A;  4ANV A;  1E7U A;  1C1Y B;  2M0X A;  5AZH A;  2I1K A;  4LJO B;  3NOB A;  3N30 A;  4I6L B;  1KOT A;  4ZRI A;  2IY1 B;  2BYV E;  1ISN A;  2REX A;  2Z0E B;  4PYZ A;  4DHJ B;  5LXI B;  4GMV A;  4AUQ C;  3HK0 A;  5CX3 A;  1XQQ A;  2KLG A;  1LM8 B;  2LXA A;  2YLM A;  1CMX B;  3RT3 B;  1E7V A;  3UIN B;  4W9D A;  4IWO A;  2IBI B;  4XZ4 A;  1Q5W B;  3H7S A;  4FUL A;  1E8X A;  2N1V A;  2N4F A;  3GOE A;  3KUZ A;  4RM9 A;  1WGY A;  2FCS A;  2O6V B;  5CHW A;  3RD2 A;  3TCA A;  2KN5 A;  3B08 A;  3DVN V;  2GBM A;  1V2Y A;  4NAW B;  1WI0 A;  2N9P C;  2MW5 A;  2KC1 A;  5BO4 B;  4XX5 A;  1UH6 A;  1JRU A;  3ZTD A;  3ZLZ A;  3PGE A;  1RFA A;  4A3O A;  1RAX A;  3M63 B;  3QHT A;  1OGW A;  4II3 B;  3SHQ A;  3UIP B;  3HIZ A;  2ZNV C;  2LRW A;  2HE7 A;  3WAN A;  2KNB A;  4FJZ A;  5DPW A;  2GBR A;  5AEK B;  2C7M B;  5G55 A;  2NS5 A;  1KM7 A;  2KTR B;  4E74 A;  2N1W A;  1PQS A;  1VCB A;  4P7I A;  1P3Q U;  2O6V A;  1U4A A;  3BY4 B;  4GDL B;  2C9W B;  1YX6 B;  2L00 B;  1WJ6 A;  3VTV A;  2ZEQ A;  3OJ3 A;  2ZPN A;  1WX7 A;  4KDL B;  5D7G A;  4B6W A;  3L0W B;  2G3Q B;  3PSE B;  2LI5 A;  3NZU A;  4WWN A;  2LZ6 A;  2NVU I;  4TQ0 A;  1E8Y A;  1GG3 A;  4MGY E;  2NBV B;  3ZNZ B;  5J18 A;  2VRR B;  3L54 A;  4PS3 A;  2KDE B;  2KTR A;  3ONS A;  2C7N B;  2MBO A;  4ANX A;  1K8R B;  2FIF A;  2MP2 B;  3N32 A;  4KV2 A;  1SE9 A;  3ENE A;  3ZO5 B;  4EEW A;  3PLU A;  3B1L X;  2J0M A;  4JL9 A;  2BKF A;  4F1S A;  4WJQ A;  4KZC A;  4G0N B;  3QIJ A;  4GDL A;  4MH0 E;  3RZF A;  2AEH A;  3OLM D;  5TR5 A;  5L95 C;  3KYC D;  4FA6 A;  4W9K A;  5E6P A;  1TGZ B;  2AL3 A;  5DCN A;  4DXA B;  1P9D U;  3DBH I;  4CHK A;  3MHS D;  3SDL C;  2FID A;  3T8M A;  1OEY A;  2BKR B;  2GBK A;  4ICU A;  4JGH B;  3L08 A;  2KX3 A;  2NBW B;  3QX1 A;  2IY0 B;  2MP2 A;  3B0A A;  2DYM A;  2KHW B;  5E6O A;  3V6E B;  4EFO A;  4HWI B;  1V5O A;  1ZW7 A;  1XT9 B;  2JZ3 B;  3QAQ A;  4ZDV A;  3PT2 B;  4IG7 B;  1MG8 A;  4HVB A;  3APC A;  1P98 A;  2PEA A;  3LDZ E;  2HD5 B;  1M94 A;  2LVQ A;  3K9P B;  1UEL A;  1IP9 A;  2MSE D;  1NBF C;  3ZW3 A;  3DVN U;  3QA8 A;  1I35 A;  1V5T A;  3ML9 A;  2DHZ A;  3PPA A;  2KMC A;  4WJP A;  2JRI B;  4IC7 B;  4WJO A;  3JSV B;  4HCP B;  4F8C B;  1P0R A;  4KSL C;  1WGD A;  2M17 A;  3MTN B;  4FAD A;  2RGF A;  1IPG A;  1WYW B;  1UBI A;  1WIA A;  3L16 A;  3HM6 X;  4LDT B;  2PPH A;  1WXV A;  3W1S A;  4LCD E;  2CKH B;  5JHB A;  2B3A A;  2CU1 A;  5KHQ A;  4K7S A;  1WMH A;  3QJZ A;  1KLV A;  4JIO U;  2KAN A;  4HXD A;  3PS6 A;  1EO6 A;  1SIF A;  2GMI C;  4W9F A;  3VHT C;  3VTU A;  3JSV A;  3A4R A;  3PRE A;  4WAA A;  2N9X A;  2ZVO A;  3DDC B;  1D3Z A;  3QK0 A;  3VH4 B;  1S1Q B;  2WDT B;  4K7W A;  3VUX A;  4MSM B;  1WR6 E;  4GIV A;  4KIK B;  1GC6 A;  3CMM B;  4DHJ D;  4ANU A;  1WZ3 A;  1WGR A;  2L0T A;  4K81 A;  4EZJ A;  4IM2 A;  4PS7 A;  4W9C A;  4E3C A;  4W9J A;  1S3S G;  3WAO A;  3IFW B;  5HKH A;  2KLC A;  1I42 A;  4PYU A;  2KO3 A;  3KW5 B;  4GSW A;  3U8Z A;  2K8H A;  3RCZ A;  1FXT B;  2KDB A;  3H9D A;  2JRH A;  4J6I A;  2J0K A;  4MGI E;  1OEY J;  4ICV A;  1GC7 A;  2EMS A;  4A20 A;  2ZVN A;  4KIK A;  2NR2 A;  2CHZ A;  4BKG A;  4EKU A;  4II2 B;  5FR6 A;  3VDZ A;  5J2R A;  5CHF A;  4BKS D;  4M8M A;  3O65 B;  1WJU A;  4LJP B;  4ASW C;  2IO2 B;  2KDF B;  4F7Z A;  1L2N A;  4YL8 A;  4BKS A;  4TQ1 A;  4G3X B;  2R2O A;  3L17 A;  2LVP A;  1NI2 A;  2D10 A;  4NNJ B;  3TIX A;  2KZR A;  1ZGU B;  2IYD B;  2HTH A;  2I1J A;  4IWP A;  3AXC A;  1V9J A;  2D07 B;  3EEC A;  2KFJ A;  5CTR C;  4TUU A;  2CS4 A;  2IO3 B;  3U7D A;  2Z0D B;  1UD7 A;  2LXC A;  2N7E A;  5IA7 A;  3QWZ B;  2WWZ A;  4DWF A;  2L8J A;  2GBN A;  2WYQ A;  2DYB A;  3C0R B;  4RMA A;  4WJN A;  3RZW C;  1GNU A;  4HPM B;  2D11 A;  4DK5 A;  3AUL A;  2KJR A;  3ML8 A;  2W9N A;  4OVV A;  2MX2 A;  4W9E A;  4NAW A;  3RUL A;  2G45 B;  2KC2 A;  2LAS A;  3A4S C;  2GBJ A;  2LGD A;  4BVU C;  1Q1O A;  2D3G A;  1WRD B;  2BYE A;  3A9K B;  4E71 A;  1Z5S B;  1WJN A;  1J0G A;  3GZN I;  4BFR A;  3WIM A;  3UQB A;  2DEN B;  3TL5 A;  2OOB B;  4IWQ A;  1WH3 A;  3VTW A;  2DZI A;  2MBE A;  3V61 A;  2IZV B;  4RM8 A;  2MRP A;  4K7U A;  4N9F 4;  3UQA A;  3EC8 A;  3K9O B;  4NQL B;  2CHX A;  5AZG A;  4AOF A;  3R7R A;  2A5U A;  3R3M A;  3HM3 A;  3JYU A;  3A9K A;  3UGB B;  4FHK A;  1TTN A;  1H4R A;  2LUE A;  1LFD A;  1V86 A;  2MQJ A;  3ZRF A;  2K8C A;  2MCN B;  2FAZ A;  5DPR A;  4AJY B;  5LXH A;  2JUO A;  1WGG A;  2V4L A;  1AAR A;  5DPT A;  4FHJ A;  2MBQ A;  3ZKJ C;  5CHV C;  2L76 A;  2WX0 A;  2QHO A;  1HE8 A;  5JHA A;  4BOZ B;  4G11 A;  2FUH B;  3DPD A;  3KUC B;  3S2A A;  4M8N A;  2JPH A;  2Y5B B;  4K1R B;  2JF5 A;  3R66 C;  4AWJ A;  4GN1 A;  1RLF A;  3EFU A;  1WZ0 A;  1ZKH A;  2BPS A;  2PE6 B;  5C23 A;  3IVF A;  2BGF A;  3NZS A;  4HK2 A;  4M0W B;  2M4N A;  4HLE A;  1WM3 A;  3NHE B;  2KWU B;  1V81 A;  3AI5 A;  4WWP A;  4AP4 C;  2O2V B;  2LD9 A;  2Z59 B;  2K1F A;  2V3S A;  4A3P A;  2EMT A;  4W9G A;  2DX5 B;  3W1Y A;  1WGH A;  3IBE A;  4MJS B;  5C1Z A;  2ZCC A;  1YJ1 A;  2CR5 A;  1WF9 A;  4TKN A;  2LGY A;  2L3Z A;  3BIN A;  2PE9 A;  3M3J A;  2KWC A;  1V6E A;  4FBJ B;  1WM2 A;  3VVW B;  4FJY A;  1WE6 A;  2N9E B;  4GB9 A;  2DZJ A;  3VAW A;  3NS8 A;  2DAF A;  4DHZ E;  1E8W A;  3IG3 A;  3U30 A;  3HHM A;  5JZE B;  3N3K B;  5D6J B;  3L10 B;  2ZNV B;  2LWP A;  3V60 A;  1YD8 U;  2MBB B;  2C60 A;  1OQY A;  2O2V A;  4HJK A;  3KYD D;  1SGH A;  2K6D B;  3WAM A;  1R4M I;  4MJS A;  4PS8 A;  5L83 A;  1L7Y A;  2N7D A;  1V80 A;  2J0J A;  2AYO B;  2ZPY A;  3QC8 B;  4X57 B;  4GGQ A;  4AJW A;  1G6J A;  3PV1 A;  4MGZ E;  4FJV B;  4NY0 A;  2DAJ A;  3P2B A;  4DHZ B;  1UGM A;  4EZK A;  3QAR A;  2CHW A;  3OAW A;  4BBN C;  2JVC A;  3DQV A;  2JT4 B;  4HDO A;  3TMP B;  3DBR I;  1RRB A;  4ZYN A;  4GOC A;  4XC2 A;  4ANW A;  2IO0 B;  2AWT A;  1T0Y A;  1QZE A;  2M1M A;  4WWO A;  4DDG D;  3JW0 X;  3IHP C;  1YX5 B;  2UYZ B;  3M95 A;  3PRP B;  3X23 A;  2LGX A;  4BKT A;  2NPT B;  4IM3 A;  3TJP A;  3W1S C;  1YIW A;  3A33 B;  2K39 A;  1F9J A;  2OJR A;  3H1U A;  3UIO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...