2WU2B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystal Structure of the E. Coli Succinate:Quinone Oxidoreductase (Sqr) Sdhc His84met Mutant
rcsb
source organism Escherichia coli
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wu2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wu2B01
1GTEA 4USAA 5AUIA 1T3QA 3AV8A 4LTUA 1A70A 3DWGC 1XLQA 1VLBA 1J7BA 2DBYA 1AYFA 3AEBB 5EE3A 1N63A 3AE2B 3RPFC 4JWSC 2B76B 1IUEA 1E6EB 2JQRB 1ROEA 1V97A 3W9CB 3AB5A 2QJLA 2BS3B 1KFYB 1YQ3B 1H7WA 1N60A 1TJEA 1L5PA 2L83A 2QIEB 3FC4A 3KWLA 3AN1A 1F0ZA 1RM6C 4C7YA 1OQRA 4N59A 5MPOA 1I7HA 4C80A 1JWBD 3P4QB 1TKGA 2WDRB 3SFDB 1PDXA 5H92C 3W5VB 1RYJA 2WDQB 2ACZB 3AE6B 1JWAD 1FFVA 1PUTA 2K5PA 1FM0D 3PO0A 1CZPA 1QLBB 4US8A 2N0SB 3HRDD 1TYGB 4P6VF 2EKIA 1GT8A 3P63A 4ITKA 3P4PB 1AWDA 1RWSA 2WU2B 4YXDB 1NI3A 3AE7B 1L0VB 1NENB 1FXIA 1L6UA 1TKYA 2M19A 2E3TA 2K22A 1JQ4A 2OHFA 1FMAD 2Q5WD 1E9MA 1WRIA 5EE1A 3ABVB 1N5WA 2MH7A 4N58A 3VR9B 1FO4A 3LB8C 2BS2B 1WWTA 2DWQA 1ZOYB 3CF4A 4YTNB 1WYGA 2HTME 3P1MA 2M56B 1QOGA 2CJOA 3VRBB 1JW9D 3AE3B 2H88B 1B9RA 2BS4B 2WU5B 3B2FA 3L4PA 4N6EB 3P4RB 3NVYA 4WQMA 1WXQA 2BT6A 1JALA 1NEKB 5EE0A 3B9JA 2L52A 2Y5CA 3VR8B 3W5UB 1VDVA 3AE1B 1SB3C 4YSXB 3NVWA 4US9A 1XLNA 1ZUD2 1TKEA 1WGKA 1EWYC 3VRAB 3AEDB 3HUIA 1E0ZA 3AECB 3AE9B 3SFEB 1YJJA 4YSZB 2WDVB 1QOAA 5G5GA 1H7XA 3AE5B 1YJIA 3HVZA 2W54A 1JROA 1JRPA 5EE9A 1YQ4B 2W3SA 1E10A 1OQQA 3B2GA 1FXAA 2PVGC 3ETRA 1GPXA 1J7AA 2H89B 1N61A 1GTHA 1DGJA 2CJNA 1VJKA 1FRRA 2LEKA 2MJEA 4KX6B 3NRZA 3NS1A 2K9XA 5G5HA 2KAJA 1ZP0B 4C7ZA 3P4SB 4JWUC 1XO3A 1NYQA 1QOFA 1SF0A 4ZOHC 4HROA 1SIJA 4YT0B 3NVZA 3SR6A 1FIQA 1XLOA 2WS3B 1NYRA 3AEEB 2PVOD 5C3JB 1J7CA 1GAQB 3EUB2 2MJDA 3DWMA 3FAHA 2PKOA 2JX5A 1V8CA 3LXFA 4FXCA 2W3RA 1FRDA 1QT9A 1UWMA 2AX5A 1OFFA 1QF6A 5H8YE 3CWIA 1E7PB 3BIID 1L6VA 3AMZA 2PIAA 4A9AA 5C2TB 1KF6B 1KRHA 3AE4B 1RFKA 2WP9B 4YTMB 1XLPA 1DOXA 1DOYA 3AEFB 1CJEA 1NVID 2WLBA 3AEGB 1ZXIA 2G1EA 4WWMA 5AUKA 2MJ3A 2WQYB 4YTPB 1N62A 1PFDA 5GXGB 3CIRB 3AEAB 3NVVA 2KMMA 4JX1C 3WCQA 1QOBA 3AH7A 4ZHOA 4ZHPA 3AE8B 2W55A 1DOIA 4IDIA 1N5XA 4YSYB 3ZYYX 3AM9A 2FBWB 4HRSA 1R7SA 1FFUA 2CU3A
chains in the Genus database with same CATH superfamily
3JYUA 3ZW3A 4A55A 5KHQA 3N1ZC 3T8MA 1N63A 1SBBB 2GRIA 1WF9A 1T0RC 3Q8CA 2TSSA 3JSVB 3VVWB 2BS3B 1FNUA 4RGMA 1TJEA 2FIFA 3KWLA 2LJIA 2M8SA 1Y56A 5D2MB 5HG2A 2KTRB 1BMLC 3SU8X 1TY2A 2KDBA 3TEWA 1V49A 2MBOA 3ML9A 1SXTA 1R4NI 1SIFA 1WR6E 4A6QA 2AQ2B 1SE4A 1TBEA 1TTNA 1XXGA 3PHXB 4FJVB 4P7IA 2KWUB 1LO5D 4M8NA 2Y5CA 3QAQA 4D2KA 1WXVA 4YSXB 3DBRB 4XWWA 4EKUA 4HWIB 3EGRA 3AE9B 3H9DA 1ZW7A 1STEA 1WGGA 1YJIA 4FA6A 3TSSA 3ZUNA 2D07B 3TEXA 4HDOA 2MJEA 5BO4B 2NTTA 3GE8C 4MGKE 5E6PA 3A9KB 4HCNB 3R8BA 3SR6A 3ZGZA 2KDMA 3BYYB 3IG3A 1UUPA 1NYRA 2MSED 4W9KA 2ZPYA 1D4BA 1IGDA 4F1SA 1FRDA 3FILB 3ZNHB 3PV1A 1TZ1A 2GLSA 1OTRB 4RH6A 1DOXA 3W1SA 4BKSA 4K81A 2L7RA 4CO7A 3B0AA 3ECIA 5IA7A 1C4AA 5J18A 1FD6A 3AE8B 1DOIA 2KWCA 4IDIA 4E74A 3OJ3A 4LCDE 5AUIA 1D5XC 5FK9C 4WIPA 3U2SC 4BKSD 1VLBA 4GDKB 3H8HA 2LVPA 4RFBA 2JY6A 2LHEA 4A90A 3VTWA 1IUEA 2KKCA 2JXTA 4HEA1 1L0YB 2UWQA 4J6IA 3HK0A 3RNGC 1FFVA 2IO3B 3KW5B 4WJPA 4ARCA 4ITKA 1AWDA 1AN8A 2JYEA 3Q3MC 3ABVB 2KJ6A 2W9NA 4N58A 5D3DA 2KDEB 3P1MA 5HKHA 1WGRA 3B2FA 2KLCA 2PTLA 3IHPC 4OZAA 5BYSA 4LDTD 3B9JA 3ZTDA 2V4IB 1ACCA 4HPMB 4KGRA 2JVCA 1RFAA 2KD0A 4EEWA 2N7EA 3GZNI 1WX7A 3ZJTA 2UU7A 3MC8A 1GC6A 3W1YA 1H7XA 3AE5B 2W54A 2IY1B 2WWZA 4FJZA 2C60A 3IT4B 5L83A 1ZP0B 3ZVVA 4AUQC 2WXHA 2JXXA 1FPYA 3QIJA 4AWJA 3P42A 3A9JA 4XGAB 1KH0A 2X8XX 1XLOA 3HIZA 1V6EA 4GIVA 2JX5A 1TY0A 3RZWC 4WJNA 3FKYA 4BBNC 3PS6A 1QT9A 1V2YA 2D3BA 2MWSB 2D3CA 1KRHA 3AE4B 1MFWA 4E71A 1PGXA 2XEWA 4DBGA 2IY0B 1S1QB 3V05A 4MJSB 3UI3A 2HTHA 1TIFA 2OEDA 4GDLA 4GGQA 2WYQA 3KUCB 2J0MA 4ZHOA 4ZHPA 2IGDA 2K6DB 2GI9A 2KWVB 2K1FA 3WAMA 2DLBA 1FCLA 2DYMA 2KMAA 4BBNF 5CHFA 1G6JA 4H2AA 1TS3A 3VUWA 2HDEA 4IUMB 3JVZX 3W9CB 2LJ5A 4PS8A 2QIEB 2MQJA 1ET6A 2MEKA 2KNBA 3L13A 1FNWA 2QC8A 2D2QA 4PS3A 3T3NA 4JPSA 4P6VF 2LGDA 4X57B 4XWTA 3TJPA 3V3XA 3MTNB 4N9F4 2NVUI 3WA0A 5KHOA 1WRIA 1WGYA 1EF5A 2PJHA 4S0RA 5LXIB 2KDIA 3V60A 3E56A 2WXRA 3VTVA 1QOGA 4JLCA 1UGJA 2WU5B 3L4PA 2RPVA 1WM3A 1L7YA 3PRPB 2N7DA 2L52A 2KZRA 4DXGA 1TT5B 4B95A 4LJPB 1E0ZA 4L23A 4YSZB 2KTRA 3EA6A 1GTHA 5JHAA 3RNFC 2J53A 3CMMB 4WJOA 2BTEA 3TIXA 3BVGA 3DWMA 4XDCA 1I4XA 2MW5A 5BMIA 1E7PB 1Q0WB 2ICIA 4P1CC 2N1VA 1NVID 1ZXIA 4WWNA 3KH0A 1OQYA 4ZRKA 3NVVA 5C1ZA 4AJWA 4KDIC 3TBLD 3IVFA 3DBHI 2FBWB 4ZRJA 1ZXHA 3AV8A 4AOFA 4LTUA 1V5TA 2OJWA 1KM7A 1P7EA 3ZNGC 1AYFA 3A9KA 5DPWA 2FNJB 4W9HA 1V86A 1V97A 2B3AA 2RDBC 1KFYB 1N60A 1P1AA 5IP4D 2L83A 1I42A 3AN1A 3FILA 5HI1A 3IFWB 2BW2A 3AI5A 3DVGY 2ZVOA 4C80A 3BY4B 4GB9A 3AULA 2G3QB 1V5OA 3PO0A 2A4ZA 2J0KA 1LFDA 2JWUA 1XD3B 4KZ0A 2QILA 2CHZA 2N9EB 2Z59B 3KUZA 2K22A 1RLFA 5D3IB 3QK0A 1E9MA 2JRHA 2KC2A 2N9KA 3C0RB 3KVFB 1VRAB 2WXOA 2BS2B 1WWTA 2KO3A 3CF4A 2GBMA 2KFKB 4GDKA 4W9EA 3NVYA 2XN9C 4WQMA 4HKZE 2L00B 4ZYNA 1SSNA 1XLNA 2BKRB 5IN7A 3CF6E 3U7DA 1T0SC 2WXMA 3R7QA 3O65B 2PMVA 2WDVB 3HVZA 1H8CA 3VTUA 2NPTB 4P1BC 4JGHB 3EFCA 1J7AA 3NRZA 3NS1A 4W9FA 4RCOA 3IXSA 1C3TA 4C7ZA 3PPAA 1NYQA 2MBQA 4BKTA 4BZAA 2WS3B 3DBRI 2C7MB 4LK0M 2IO0B 4NJ6A 2W3RA 3ZNZB 3A4SC 4OVZA 3VH4B 3NY5A 3BVZA 4E3CA 4A9AA 5J2RA 3ZQ4A 1LXDA 3AEFB 2XNAC 4TSSA 2MX2A 1ENFA 3V62A 1EWCA 3AEAB 1ZDVA 1UELA 1NI2A 2AQ1B 3TUOA 4K1RB 5JXVA 4USAA 2ZEQA 2L05A 1C77A 2EKEC 4BAXA 3AU4A 2D11A 1E8YA 1YQBA 4BOZB 2BBCA 3C19A 4JE3B 2BQQA 1DYQA 2WGSA 1T5XD 3KUDB 4MT5A 2ZW0A 4TKNA 4NNJB 3W5VB 2KQ7A 2ACZB 1QKZA 1CZPA 3VFKA 2MLBA 2HJ1A 3KWVA 3HRDD 4M0WB 1TYGB 2LRWA 4MJSA 2KYWA 5E6OA 4IM3A 1NI3A 2M19A 2E3TA 3WIMA 3J9CA 5LLIA 5EDSA 4DDGD 1YN3A 2FE8A 4M01A 3DQVA 2NBUA 3MC9A 4II2B 1JW9D 3AE3B 2V4LA 3H1UA 3KYDD 3U7ZA 5JZEB 2N9XA 2XK5B 1WGKA 4ZYSA 1I4PA 2D5GA 2Y5BB 4OW0A 2H89B 3N20C 3ONSA 2FCNA 1EF1A 4BFRA 3P4SB 3I5JC 1QOFA 2D10A 1SIJA 1V81A 4WURA 3ZNID 1D5MC 2ZCBA 3PZ8A 3VAWA 2RSUA 4GXBA 1XEEA 1JRUA 2PE6B 4GDLB 2FIDA 3Q69A 3M3JA 1BXTA 5AZHA 4B0EA 2LRUA 2KX3A 2WQYB 4ICUA 3WAOA 4RM9A 3AM9A 3R2TA 4II3B 2HJ8A 3APCA 5LXHA 3DBHB 1UGMA 1M4VA 1J7BA 1D6EC 1KTKA 3RPFC 4JWSC 4I6LB 4MACA 1OGWA 3FC4A 2WXKA 1L5PA 2BB5A 2G9HD 1N6ZA 3V61A 3APFA 1WJUA 2WDRB 1LQBA 2BB6A 1QZEA 2JPHA 1C4PA 3P4PB 4YXDB 4IM2A 4RGOS 1NENB 1FXIA 1EUVB 2JUOA 4G0NB 3DBLB 4PS7A 3VH3B 2PPHA 3VR9B 2YEPF 3OAWA 4IG7B 1JWSD 2INPE 2KK8A 2KX0A 4A3PA 1CK1A 2WNMA 3DHGC 3S2AA 2J4XA 4EZLA 1WE7A 1HZ6A 1P9DU 2K8CA 1EWYC 1XT9B 2JSVX 3P2BA 4MGYE 3ZDMC 4IWOA 4EZJA 1P3QU 1HXYD 1JROA 3A4RA 2PVGC 2CJNA 4KX6B 3ZKJC 2AL3A 4AS1A 3BVMA 2L76A 2LD9A 2ON8A 4K7WA 2DYBA 1E7VA 2KFKA 4OZCA 2PKOA 4MELA 2LFIA 4M00A 4IWQA 2LGXA 1P98A 1UWXA 4ICVA 3LDZE 4CHKA 1M94A 2WLBA 2VZKB 2JF5A 3H7PB 2OOBB 3EC8A 2IBIB 1D3ZA 2KMMA 1QOBA 4MH0E 2KVRA 1N5XA 2NPTA 4PYUA 2CU3A 4WJQA 3RCZA 1L4ZB 3B08A 3AE2B 3ML8A 2CU1A 5C23A 2WXGA 4ZRQA 1I7HA 2WXIA 1ZGUB 1EU3A 4NJCA 2ZNVB 1K50A 2K25A 4XC2A 4HJGE 3IAS1 1AARA 3ENEA 1JMLA 3B1LX 2C5LC 5BMHA 3D32A 1K52A 2MH7A 3NZSA 2CR5A 1WRDB 1XCQL 1AW7A 1WY8A 2DZIA 1ZE3D 1JALA 2KC1A 3SDLC 1ZUD2 2J0JA 4K3BA 3AECB 2WX0A 4EE2A 5TR5A 2DENB 1C79A 3ZXRA 4M0WA 3B2GA 1FXAA 1WMHB 3PZ7A 5L95C 4HK2A 2K9XA 1SF0A 2BGFA 4AJYB 4IC7B 1ET9A 2PVOD 1J7CA 1GAQB 1V8CA 4J3OD 1OFFA 2M1MA 3BIID 1L6VA 1I4QA 4RGNA 3R66C 1SE9A 1WE6A 3TMPB 2XK5A 5JHBA 2RMMA 4URKA 2ASQA 2L8JA 1V80A 3VUXA 4KKIA 3DVGX 3RZFA 1Z5SB 1CQVA 2N9PC 2I1KA 3DPDA 1T3QA 2WHIA 2NCNA 3ZJVA 2GBKA 4B6WA 1HA5A 1IYFA 2AL6A 2QJLA 4DQOC 2CHWA 3OLMD 4HDQA 4A8XC 4ANXA 3SFDB 5D94A 2E6XA 1RYJA 2W82A 3IT6B 3DVNV 2FCQA 2MHJA 1VZ7A 2LVQA 2RGFA 2NBVB 2BVCA 3PZDA 2DX5B 1FMAD 2OHFA 2Y3AA 3V6CB 3LB8C 4REZA 1SGHA 1UH6A 4PK1A 2HTME 2CJOA 5HHDG 2L0TA 1GG3A 1KOTA 1Q10A 1F77A 4RF0A 2WDTB 3NVWA 3ZJUA 1E90A 1Y8RC 3TEYA 2I38A 2INDC 1LM8B 2ZNVC 4TMAB 2L3ZA 4GLSC 2QDFA 4ZDVA 2FUHB 4W9LA 2IO2B 3RNAC 3VXWA 3RFZB 3PSEB 5IO9A 3BK2A 1WXSA 2IGGA 3NHEB 1V1PB 5DPRA 4TUUA 4FHKA 3RI7C 2N9LA 3NJTA 3RN9C 1P0RA 3V6EB 2LASA 3OJ4B 2SAKA 2DYOA 2KQSA 4RGTA 1XLPA 3QQ8B 4KVGB 4WWMA 1TZOA 2QSDA 4WQOB 3QA8A 4S17A 2EELA 2FAZA 5IOIA 3AEBB 1ZPSA 2KJHB 5GMVA 2D3AA 2JWZA 2VH2A 2LUMA 1ROEA 3QC8B 4WAFA 2ONQA 5E6NA 1SE2A 2UYZB 4N59A 3M62B 3DHIC 5MPOA 1FCCC 1TKGA 3P4QB 1KLUD 3I63C 1C1YB 3AE6B 4IW0A 3H7PA 4C56C 1U4AA 2I2YA 2KFJA 4QAYA 3DDCB 3HM6X 3OG5A 4HKQA 3CSFA 4EZKA 3GS2A 1WZ3A 2REXA 3GP7A 3RULA 1MI0A 4HLEA 4NPNA 1WXAA 2VZKD 5CHVC 3GE3C 2BT6A 2Z0DB 2LGYA 3W5UB 2LGIA 3AE1B 3C8YA 4TQ0A 4R3DA 2LWPA 3PGEA 1J19A 3DBLI 3AU5A 1YJJA 4FADA 4YWGG 2DZJA 2QHOA 4HXDA 1N61A 2LEKA 2MBHA 1C76A 1F2RC 1A5RA 1VCBA 4G50A 2KHWB 4HROA 2MCNB 1LGRA 2KLGA 4KGSA 1IPGA 3U8ZA 1YIWA 3BINA 3GOEA 2KWDA 1UWMA 1QF6A 2AWTA 1YX5B 1IGCA 3DHHC 4W9DA 2K8HA 1RFKA 1IBXB 1CJEA 2GBJA 2KOXA 3NZ3A 1TS5A 4A3OA 4PT5A 2WXNA 3DCGA 4B9KA 1WIAA 2D3GA 4IWPA 4ARIA 1WMHA 1R7SA 1NDDA 2YLMA 2HE7A 1KLVA 1XLQA 5EE3A 2KMCA 1UBQA 1HTQA 3UINB 4W9JA 4C7YA 1OQRA 1FXTB 2J42A 2WDQB 3PVLA 1JWAD 1J0GA 1FM0D 4OVUA 1S3SG 3NZUA 3L10B 1TKYA 3RNEC 1XCTL 3MHSD 2JZ3B 1N5WA 3JW0X 2DWQA 1GB4A 1WYGA 1D5ZC 1WZ0A 4MM3B 3VR8B 3A1QB 1UD7A 1TKEA 4GSWA 3NUHB 2CHXA 1VZ6A 3CSTA 2M0AA 1DGJA 1VJKA 3DVNU 3VHTC 2RDHA 2KJRA 3U4EG 1YMHE 5T8IA 5J17A 5FR6A 3SEBA 2K6QA 3N32A 3U52E 3ZLZA 3PREA 2Z0EB 2BF8B 4IKGA 1L0XB 2DZMA 3W2DA 3I3TB 1KF6B 5TSSA 2WX1A 2V1YA 3H6NA 4JQWC 3O13A 2DZKA 4YTPB 2JZPA 3WCQA 1WJ6A 4DHZB 3I57A 4K7UA 3BWUD 2CKHB 1FFUA 4B0MA 1GTEA 4NQKE 1E8ZA 4LJOB 4NJ7A 1K53A 3RNCC 2NBWB 1V1PA 3RNBC 3RUIB 1H4RA 4WWOA 3UGBB 1C4CA 4ANUA 2M17A 2MP2A 3RT3B 4AP4C 2GBRA 5D6JB 3T3OA 2LXAA 4ACFA 4US8A 2N0SB 2K0PA 2PE9A 3NVZA 2WU2B 3Q14C 1JQ4A 5JH5C 1MG4A 2C7HA 1Z2MA 1L4DB 3UQAA 1F1HA 3UIPB 4HPPA 3Q8FA 2JZZA 1YX6B 4LNIA 1WXQA 2OJRA 4OHJA 1VDVA 1SJED 1YN4A 3EECA 1GUAB 4O1NA 3VRAB 2PEAA 3HUIA 3RD2A 3R7RA 1F2RI 2PLPA 1Q5WB 2W3SA 4NY0A 1OQQA 2ZPNA 5BMGA 1FRRA 4F7ZA 4BVUC 2LHDA 3Q8EA 5G5HA 2XBBC 5DPSA 4GU2A 2V9HA 2BYFA 2GB1A 5AEKB 2MBBB 3EUB2 3M63B 2QCZA 2FCMA 1HQRD 3ALBA 3EFUA 5H8YE 4P16A 3X23A 4C00A 1PGAA 4GOCA 4XX5A 4MSQB 2J7QB 4XDDA 3AEGB 2O6VA 2A5UA 2MJ3A 3N1XC 5HFYA 2JU6X 3SHQA 2R2QA 2NR2A 3KQ4A 1I4HA 4PYZA 1QQRA 3L08A 2R61A 1WM2A 4IOIE 4IM0A 2BPSA 2KQ4X 2O6VD 2JT4B 3HHMA 1E6EB 3UF8A 2J52A 5AZGA 2GOWA 2M4NA 3QHTA 4KKJA 1F0ZA 3MP9A 3NG0A 3QCAA 1TS2A 4RM8A 1E5WA 2V3SA 4DK5A 1IBXA 3L16A 1VR9A 1MHXA 1QILA 4NZLB 1OEYA 3U30A 1FEHA 4FHJA 5I4DA 1F9JA 1JWUD 1FNVA 3VRBB 3VQIA 1KLGD 2YVCA 1SE3A 5DPTA 3P4RB 2KACA 1F52A 2MRPA 1TGZB 1WGDA 2WXFA 4EOYA 1WH3A 4GMVA 3APDA 2SEBD 3L0WB 4I6NB 1QOAA 2LVOA 1YQ4B 1BT0A 4DXAB 2IJ0A 1GPXA 3PT2B 3QWZB 3NOBA 4BOSC 3PRZA 4KGTA 4JWUC 2BWFA 4XE0A 4ZOHC 4DHJB 1FIQA 5FKAC 4W9CA 3ZXVA 4MM3A 4KZCA 5CX3A 3A1QA 4FULA 3X0WA 4DXFA 2WXLA 4MEMA 1XF5L 5AUKA 2G1EA 3IBEA 3UIOB 2AYOB 2IPKD 3Q3NC 3N3KB 5G55A 4C4VB 2IGHA 2EMTA 4YSYB 2L1AA 1CMXB 2Z8LA 5CTRC 4Q2JA 3LYYA 4NQLB 3WANA 2G4DB 1RAXA 1MG8A 3ZO5B 2DBYA 4FBJB 1BUIC 1WSPA 1J8CA 1UBIA 3AB5A 3N30A 1H7WA 4DDID 2K3UA 2IZVB 5DCNA 2ZCCA 4L1BA 4NAWA 5H92C 1XQQA 2BKFA 2V3PA 4G3XB 1HE8A 1RRBA 1L6UA 4EFOA 4LNNA 4I6PA 1WYWB 2Q5WD 1HEZE 4DHZE 5EE1A 4CQNA 4RF1A 1C78A 3TL5A 5IAAC 1PGBA 4M02A 2H88B 1GB1A 3MHZA 4LNOA 4ZRPA 2RDGA 2LUEA 4HPLB 3EHVA 4US9A 1T6BX 5G2NA 1WJNA 2O2VB 1K8RB 3NS8A 4KIKB 4NAMA 2KN5A 3BZDB 1WX8A 1WX9A 2L0FA 2KVZA 5G5GA 1JRPA 3ETRA 1IP9A 1P7FA 2QEJC 4FJYA 2NS5A 2LXCA 2KAJA 3A33B 2X38A 4KSKC 1E7UA 1JCKB 1V9JA 3ZRCA 4MGIE 2DAJA 2AX5A 3Q8BA 3VDZA 1PYWD 1WR1A 3E9SA 4W9IA 1C9FA 1X1MA 3QARA 3R3MA 3ZRFA 5CHWA 4HCPB 4OVVA 4K7SA 1YOVB 4WWPA 3Q6BA 3DBSA 4HRSA 1FO4A 1PQSA 2VH1A 3KLSX 4XZ4A 3DWGC 2MP2B 3H7SA 4WH4A 5BYRA 3Q3FA 3PHWB 2KTFA 1R4NB 4TQ1A 1HZ5A 1K51A 3UQBA 2IYDB 4KSLC 4G11A 3T9LA 1JWBD 1SJHD 1SEBD 2IDYA 4JIOU 4AQ7A 3JSVA 3BYTB 3RMKC 2G45B 4GN1A 2EKIA 1GJZA 3AE7B 1ISNA 2KN4A 1NBFC 1E8WA 2N1WA 4YTNB 3MFGA 4KDLB 4ANVA 1TS4A 2FUG1 2BS4B 3RYTA 5IKCM 1I35A 1MHHE 4EUTA 5EE0A 2N4FA 1Q1OA 4LLGM 3AEDB 1YN5A 1WI0A 3R2IA 3TCAA 3AXCA 4UDUC 1MVKA 2BYEA 2KDFB 2DHZA 2IO1B 2K39A 4RNAA 1T0QC 1KJTA 1EU4A 4RMAA 5C3JB 3K9PB 2O6VB 4JL9A 2HD5B 3PLVA 3VUYA 5LNK1 3N9YC 3PLUA 3CIRB 4KV2A 1ZDXA 4L2YA 1VD2A 1R4MI 4JX1C 4MDKE 3LJ3A 2K8BA 1HTOA 3KYCD 3K9OB 4CYEA 2BWES 2NTSA 3Q3JA 3BK1A 5BYQA 2ZJDA 3I9V1 2JRIB 4ASWC 1E8XA 3L54A 1WGHA 3ZIMA 2AQ3B 2LGSA 2INNE 4MGZE 2BYVE 1MPEA 3MC0B 5FR3A 1PUTA 1GC7A 2K5PA 1T0YA 4DHJD 2NMQA 1GT8A 3P63A 1RWSA 2JYTA 2G4SA 3Q2AC 3GZNB 4C4VA 3URYA 4ZRIA 3IAM1 2V3NA 1ZOYB 2PW9A 4BKGA 3QJZA 2GMIC 2VRRB 2ZVNA 1B9RA 4YL8A 2CS4A 1NEKB 2YEPB 4W9GA 4DWFA 1SB3C 2AEHA 2QMTA 1YJ1A 4FN2A 4MSMB 4HVBA 1E10A 3DOWA 3HVDA 1EM7A 4OZBA 2WXJA 3MJWA 1XO3A 3M95A 1GNUA 4YT0B 3Q8AA 3AEEB 1I4GA 3FAHA 3PTFC 4M8MA 1MJDA 4FXCA 4XYCA 2L32A 2LI5A 3CWIA 2DNFA 4HJKA 4YTMB 5D7GA 2KXJA 1PFDA 2BYTA 2O2VA 2N7JA 2WXPA 4KIKA 2RR9A 4LDTB 4LNKA 3WALA 1WJ4A 3QX1A 2INCC 2W55A 1UNSA 3ZYYX 4MH8A 1YD8U 4TV3A 1YNTE 1A70A 4A20A 3PRMB 2ZW1A 2MA9B 2B76B 2WXQA 3N1YC 2JQRB 4NAWB 2ZZPB 1YQ3B 3ZTCA 5AZFA 2I1JA 4FLHA 2V0GA 2KANA 1RM6C 1WXMA 1PDXA 3WAPA 1QLBB 1ZKHA 3SD5A 2C9WB 3TEZA 4F8CB 1L0VB 1B1ZA 1V1OA 2KT7A 3OWEB 2FCSA 3L17A 1ESFA 3A9JB 2DAFA 2RD0A 2M56B 2EMSA 2M0XA 4N6EB 4ANWA 2MBEA 1GOZA 1I4RA 4K3CA 2RPQA 3Q3OC 3SFEB 4WAAA 1L2NA 2GBNA 3HM3A 5EE9A 1EO6A 1JWMD 2LZ6A 5E6JA 2LMCA 3GB1A 2MJDA 1OEYJ 3LXFA 3MJ5A 3AMZA 2PIAA 5C2TB 3W1SC 1VZ8A 2WP9B 1DOYA 1UF0A 3ZDTA 1N62A 5GXGB 4LNFA 2C7NB 2Y5PA 3AH7A 1R4MB 1UZXB 1WFYA 2R2OA
chains in the Genus database with same CATH topology
4USAA 2EELA 1C77A 4A55A 2DBYA 3AEBB 1BUIC 1ZPSA 1N63A 1SBBB 1WSPA 2BBCA 4JE3B 2GRIA 1DYQA 2LUMA 1ROEA 3Q8CA 1T5XD 2TSSA 3AB5A 4MT5A 4WAFA 2BS3B 1FNUA 2ZW0A 4RGMA 1H7WA 1TJEA 2LJIA 2ONQA 3KWLA 2K3UA 1SE2A 4N59A 5MPOA 1FCCC 1Y56A 1TKGA 3P4QB 1KLUD 4L1BA 5H92C 3W5VB 2ACZB 3AE6B 5HG2A 1QKZA 1CZPA 3KWVA 3HRDD 1BMLC 1TYGB 4C56C 2V3PA 1TY2A 2I2YA 1NI3A 1L6UA 2M19A 3TEWA 2E3TA 1SXTA 2Q5WD 4HKQA 1HEZE 5EE1A 3GS2A 3J9CA 4A6QA 4CQNA 4RF1A 2AQ2B 1YN3A 3GP7A 2FE8A 1C78A 1MI0A 1SE4A 1XXGA 1PGBA 1JW9D 3AE3B 2H88B 2VZKD 1GB1A 3U7ZA 3MHZA 2BT6A 1LO5D 4ZRPA 2Y5CA 3W5UB 2LGIA 2RDGA 3AE1B 3C8YA 4D2KA 4TQ0A 4YSXB 4R3DA 4US9A 4XWWA 1T6BX 1WGKA 4ZYSA 3EGRA 3AE9B 1YJJA 4NAMA 3BZDB 1STEA 4YWGG 5G5GA 1YJIA 1I4PA 1JRPA 2D5GA 3TSSA 4OW0A 3TEXA 3ETRA 1N61A 2H89B 2LEKA 1P7FA 2QEJC 2MJEA 2NTTA 1C76A 1F2RC 2KAJA 3P4SB 1QOFA 2X38A 4HROA 1SIJA 3R8BA 3SR6A 3ZGZA 2KDMA 4WURA 3BYYB 1JCKB 1UUPA 1NYRA 4KGSA 1D5MC 3PZ8A 1D4BA 1IGDA 2KWDA 3Q8BA 1FRDA 1UWMA 1XEEA 2AX5A 3FILB 1QF6A 1IGCA 4GDLB 1PYWD 3E9SA 3Q69A 1BXTA 1RFKA 1C9FA 4RH6A 4B0EA 1DOXA 3W1SA 1IBXB 1CJEA 2WQYB 3NZ3A 1C4AA 1TS5A 4PT5A 2WXNA 1FD6A 3AE8B 1DOIA 4IDIA 4ARIA 3AM9A 3R2TA 4HRSA 1R7SA 1FO4A 5AUIA 1D5XC 3KLSX 1M4VA 3DWGC 4WIPA 5FK9C 3U2SC 1XLQA 1VLBA 1J7BA 4GDKB 5EE3A 1D6EC 4WH4A 3H8HA 4RFBA 5BYRA 1KTKA 2LHEA 4A90A 3RPFC 4JWSC 4MACA 1IUEA 4TQ1A 2JXTA 1HZ5A 1K51A 4HEA1 3FC4A 2WXKA 1L5PA 1L0YB 2BB5A 2G9HD 4C7YA 1OQRA 2J42A 1JWBD 1SJHD 2WDRB 1SEBD 2IDYA 2WDQB 4AQ7A 1JWAD 3BYTB 1FFVA 1FM0D 2BB6A 4ARCA 1C4PA 2EKIA 4ITKA 3P4PB 1AWDA 4YXDB 1AN8A 3AE7B 1TKYA 1NENB 1FXIA 4RGOS 2KN4A 1XCTL 2JYEA 3ABVB 1N5WA 4N58A 5D3DA 3VR9B 2YEPF 1GB4A 2DWQA 4YTNB 1WYGA 3MFGA 1D5ZC 1JWSD 3P1MA 2INPE 1TS4A 2FUG1 4MM3B 2BS4B 3B2FA 1CK1A 2WNMA 1MHHE 2PTLA 4OZAA 5EE0A 5BYSA 3B9JA 2V4IB 3VR8B 1ACCA 4KGRA 2J4XA 1HZ6A 1TKEA 1EWYC 4LLGM 3AEDB 1YN5A 2JSVX 3R2IA 3ZJTA 4UDUC 1H7XA 3AE5B 1MVKA 1HXYD 2W54A 1JROA 3NUHB 1VZ6A 2M0AA 2PVGC 1DGJA 2CJNA 3IT4B 1VJKA 2RDHA 4KX6B 4AS1A 3BVMA 1ZP0B 4RNAA 3U4EG 1YMHE 2WXHA 3P42A 1KH0A 1EU4A 5T8IA 1XLOA 2ON8A 3SEBA 4OZCA 5C3JB 3U52E 2PKOA 2JX5A 1TY0A 2LFIA 1QT9A 4IKGA 1UWXA 1L0XB 3W2DA 1KRHA 1KF6B 3AE4B 5TSSA 5LNK1 3N9YC 1PGXA 2VZKB 2WLBA 3O13A 4YTPB 3V05A 3UI3A 3CIRB 2JZPA 2OEDA 1ZDXA 4L2YA 2KMMA 4JX1C 3WCQA 1QOBA 4ZHOA 3I57A 4ZHPA 2IGDA 3BWUD 1N5XA 2GI9A 1FFUA 4B0MA 2CU3A 1GTEA 2DLBA 1FCLA 2NTSA 1K53A 2DYMA 1L4ZB 3BK1A 5BYQA 4H2AA 1TS3A 3AE2B 1V1PA 2HDEA 3I9V1 3W9CB 2WXGA 1C4CA 2QIEB 4ZRQA 2AQ3B 1I7HA 2WXIA 2INNE 1ET6A 1EU3A 4NJCA 2MEKA 1MPEA 3T3OA 1K50A 3MC0B 5FR3A 1FNWA 1PUTA 2K5PA 4US8A 4HJGE 3IAS1 2N0SB 2K0PA 4JPSA 2NMQA 3T3NA 4P6VF 1GT8A 3P63A 4XWTA 1RWSA 3NVZA 2WU2B 1JMLA 3V3XA 1JQ4A 2JYTA 5BMHA 1K52A 1WRIA 3URYA 2MH7A 1L4DB 3IAM1 2V3NA 1ZOYB 2PW9A 3E56A 2WXRA 1QOGA 1XCQL 1AW7A 1UGJA 1B9RA 2WU5B 3Q8FA 3L4PA 2RPVA 1ZE3D 1WXQA 1JALA 1NEKB 2L52A 2YEPB 4OHJA 1VDVA 4DXGA 1SB3C 1SJED 1YN4A 1ZUD2 4O1NA 2QMTA 3VRAB 3HUIA 1E0ZA 3AECB 1F2RI 4EE2A 4L23A 2PLPA 4YSZB 1E10A 3HVDA 1C79A 1EM7A 4M0WA 2W3SA 3EA6A 4OZBA 1OQQA 2WXJA 1FXAA 3B2GA 3PZ7A 5BMGA 1GTHA 1FRRA 2LHDA 3Q8EA 2K9XA 5G5HA 1XO3A 2J53A 1SF0A 2GB1A 4YT0B 3Q8AA 2BTEA 1ET9A 3AEEB 2PVOD 1I4GA 1J7CA 1GAQB 3BVGA 3EUB2 3DWMA 3FAHA 4XDCA 1I4XA 1V8CA 4FXCA 1HQRD 4J3OD 1OFFA 5BMIA 5H8YE 2L32A 3CWIA 1E7PB 3BIID 1L6VA 2ICIA 1I4QA 4P16A 4RGNA 4YTMB 1PGAA 5D7GA 1NVID 4XDDA 3AEGB 1ZXIA 2MJ3A 1PFDA 2BYTA 2RMMA 2JU6X 5HFYA 2N7JA 2WXPA 3NVVA 3KQ4A 1I4HA 4KKIA 2W55A 1UNSA 3ZYYX 2FBWB 4MH8A 1CQVA 1QQRA 2R61A 1ZXHA 1T3QA 4IOIE 3AV8A 4LTUA 1YNTE 1A70A 3ZJVA 1P7EA 2KQ4X 1AYFA 1HA5A 2ZW1A 2B76B 2WXQA 1E6EB 2JQRB 4NAWB 1V97A 2J52A 2QJLA 4DQOC 1KFYB 1YQ3B 1N60A 4A8XC 2L83A 3AN1A 3FILA 2V0GA 4KKJA 1RM6C 5HI1A 1F0ZA 3MP9A 2BW2A 4C80A 1TS2A 3SFDB 1PDXA 2E6XA 1RYJA 2W82A 3IT6B 1IBXA 3PO0A 1VZ7A 1QLBB 2JWUA 3TEZA 2QILA 1L0VB 1VR9A 1MHXA 2K22A 1B1ZA 1V1OA 5D3IB 1QILA 1FMAD 2OHFA 1E9MA 3OWEB 4NZLB 1FEHA 2N9KA 1ESFA 2Y3AA 1VRAB 2WXOA 3LB8C 2BS2B 1WWTA 3CF4A 4REZA 5I4DA 2HTME 2M56B 1JWUD 2CJOA 1FNVA 3VRBB 3VQIA 1KLGD 4N6EB 1SE3A 5HHDG 3P4RB 2KACA 3NVYA 2XN9C 4WQMA 1Q10A 1F77A 4HKZE 4RF0A 1GOZA 1SSNA 2WXFA 3NVWA 1XLNA 1I4RA 3ZJUA 3TEYA 2I38A 2SEBD 3SFEB 2WXMA 4TMAB 2PMVA 2WDVB 1QOAA 3HVZA 5EE9A 1YQ4B 4GLSC 2IJ0A 1GPXA 1J7AA 3NRZA 3NS1A 1JWMD 4RCOA 3IXSA 4C7ZA 3RFZB 4KGTA 4JWUC 1NYQA 4XE0A 3BK2A 4ZOHC 5E6JA 2IGGA 2LMCA 1FIQA 1V1PB 3GB1A 5FKAC 2WS3B 2N9LA 4LK0M 2MJDA 3LXFA 3MJ5A 2W3RA 2SAKA 4OVZA 2DYOA 3AMZA 3BVZA 2PIAA 4A9AA 5C2TB 4RGTA 1VZ8A 2WP9B 1XLPA 2WXLA 3ZQ4A 4DXFA 1DOYA 3AEFB 1XF5L 2XNAC 4WWMA 2G1EA 5AUKA 4TSSA 1ENFA 1N62A 5GXGB 1TZOA 1EWCA 2QSDA 3AEAB 1ZDVA 2Y5PA 2IPKD 3AH7A 2IGHA 2AQ1B 3TUOA 4YSYB 2L1AA 2Z8LA 5JXVA 4Q2JA 3LYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTE A;  4USA A;  5AUI A;  1T3Q A;  3AV8 A;  4LTU A;  1A70 A;  3DWG C;  1XLQ A;  1VLB A;  1J7B A;  2DBY A;  1AYF A;  3AEB B;  5EE3 A;  1N63 A;  3AE2 B;  3RPF C;  4JWS C;  2B76 B;  1IUE A;  1E6E B;  2JQR B;  1ROE A;  1V97 A;  3W9C B;  3AB5 A;  2QJL A;  2BS3 B;  1KFY B;  1YQ3 B;  1H7W A;  1N60 A;  1TJE A;  1L5P A;  2L83 A;  2QIE B;  3FC4 A;  3KWL A;  3AN1 A;  1F0Z A;  1RM6 C;  4C7Y A;  1OQR A;  4N59 A;  5MPO A;  1I7H A;  4C80 A;  1JWB D;  3P4Q B;  1TKG A;  2WDR B;  3SFD B;  1PDX A;  5H92 C;  3W5V B;  1RYJ A;  2WDQ B;  2ACZ B;  3AE6 B;  1JWA D;  1FFV A;  1PUT A;  2K5P A;  1FM0 D;  3PO0 A;  1CZP A;  1QLB B;  4US8 A;  2N0S B;  3HRD D;  1TYG B;  4P6V F;  2EKI A;  1GT8 A;  3P63 A;  4ITK A;  3P4P B;  1AWD A;  1RWS A;  2WU2 B;  4YXD B;  1NI3 A;  3AE7 B;  1L0V B;  1NEN B;  1FXI A;  1L6U A;  1TKY A;  2M19 A;  2E3T A;  2K22 A;  1JQ4 A;  2OHF A;  1FMA D;  2Q5W D;  1E9M A;  1WRI A;  5EE1 A;  3ABV B;  1N5W A;  2MH7 A;  4N58 A;  3VR9 B;  1FO4 A;  3LB8 C;  2BS2 B;  1WWT A;  2DWQ A;  1ZOY B;  3CF4 A;  4YTN B;  1WYG A;  2HTM E;  3P1M A;  2M56 B;  1QOG A;  2CJO A;  3VRB B;  1JW9 D;  3AE3 B;  2H88 B;  1B9R A;  2BS4 B;  2WU5 B;  3B2F A;  3L4P A;  4N6E B;  3P4R B;  3NVY A;  4WQM A;  1WXQ A;  2BT6 A;  1JAL A;  1NEK B;  5EE0 A;  3B9J A;  2L52 A;  2Y5C A;  3VR8 B;  3W5U B;  1VDV A;  3AE1 B;  1SB3 C;  4YSX B;  3NVW A;  4US9 A;  1XLN A;  1ZUD 2;  1TKE A;  1WGK A;  1EWY C;  3VRA B;  3AED B;  3HUI A;  1E0Z A;  3AEC B;  3AE9 B;  3SFE B;  1YJJ A;  4YSZ B;  2WDV B;  1QOA A;  5G5G A;  1H7X A;  3AE5 B;  1YJI A;  3HVZ A;  2W54 A;  1JRO A;  1JRP A;  5EE9 A;  1YQ4 B;  2W3S A;  1E10 A;  1OQQ A;  3B2G A;  1FXA A;  2PVG C;  3ETR A;  1GPX A;  1J7A A;  2H89 B;  1N61 A;  1GTH A;  1DGJ A;  2CJN A;  1VJK A;  1FRR A;  2LEK A;  2MJE A;  4KX6 B;  3NRZ A;  3NS1 A;  2K9X A;  5G5H A;  2KAJ A;  1ZP0 B;  4C7Z A;  3P4S B;  4JWU C;  1XO3 A;  1NYQ A;  1QOF A;  1SF0 A;  4ZOH C;  4HRO A;  1SIJ A;  4YT0 B;  3NVZ A;  3SR6 A;  1FIQ A;  1XLO A;  2WS3 B;  1NYR A;  3AEE B;  2PVO D;  5C3J B;  1J7C A;  1GAQ B;  3EUB 2;  2MJD A;  3DWM A;  3FAH A;  2PKO A;  2JX5 A;  1V8C A;  3LXF A;  4FXC A;  2W3R A;  1FRD A;  1QT9 A;  1UWM A;  2AX5 A;  1OFF A;  1QF6 A;  5H8Y E;  3CWI A;  1E7P B;  3BII D;  1L6V A;  3AMZ A;  2PIA A;  4A9A A;  5C2T B;  1KF6 B;  1KRH A;  3AE4 B;  1RFK A;  2WP9 B;  4YTM B;  1XLP A;  1DOX A;  1DOY A;  3AEF B;  1CJE A;  1NVI D;  2WLB A;  3AEG B;  1ZXI A;  2G1E A;  4WWM A;  5AUK A;  2MJ3 A;  2WQY B;  4YTP B;  1N62 A;  1PFD A;  5GXG B;  3CIR B;  3AEA B;  3NVV A;  2KMM A;  4JX1 C;  3WCQ A;  1QOB A;  3AH7 A;  4ZHO A;  4ZHP A;  3AE8 B;  2W55 A;  1DOI A;  4IDI A;  1N5X A;  4YSY B;  3ZYY X;  3AM9 A;  2FBW B;  4HRS A;  1R7S A;  1FFU A;  2CU3 A; 
#chains in the Genus database with same CATH topology
 3JYU A;  3ZW3 A;  4A55 A;  5KHQ A;  3N1Z C;  3T8M A;  1N63 A;  1SBB B;  2GRI A;  1WF9 A;  1T0R C;  3Q8C A;  2TSS A;  3JSV B;  3VVW B;  2BS3 B;  1FNU A;  4RGM A;  1TJE A;  2FIF A;  3KWL A;  2LJI A;  2M8S A;  1Y56 A;  5D2M B;  5HG2 A;  2KTR B;  1BML C;  3SU8 X;  1TY2 A;  2KDB A;  3TEW A;  1V49 A;  2MBO A;  3ML9 A;  1SXT A;  1R4N I;  1SIF A;  1WR6 E;  4A6Q A;  2AQ2 B;  1SE4 A;  1TBE A;  1TTN A;  1XXG A;  3PHX B;  4FJV B;  4P7I A;  2KWU B;  1LO5 D;  4M8N A;  2Y5C A;  3QAQ A;  4D2K A;  1WXV A;  4YSX B;  3DBR B;  4XWW A;  4EKU A;  4HWI B;  3EGR A;  3AE9 B;  3H9D A;  1ZW7 A;  1STE A;  1WGG A;  1YJI A;  4FA6 A;  3TSS A;  3ZUN A;  2D07 B;  3TEX A;  4HDO A;  2MJE A;  5BO4 B;  2NTT A;  3GE8 C;  4MGK E;  5E6P A;  3A9K B;  4HCN B;  3R8B A;  3SR6 A;  3ZGZ A;  2KDM A;  3BYY B;  3IG3 A;  1UUP A;  1NYR A;  2MSE D;  4W9K A;  2ZPY A;  1D4B A;  1IGD A;  4F1S A;  1FRD A;  3FIL B;  3ZNH B;  3PV1 A;  1TZ1 A;  2GLS A;  1OTR B;  4RH6 A;  1DOX A;  3W1S A;  4BKS A;  4K81 A;  2L7R A;  4CO7 A;  3B0A A;  3ECI A;  5IA7 A;  1C4A A;  5J18 A;  1FD6 A;  3AE8 B;  1DOI A;  2KWC A;  4IDI A;  4E74 A;  3OJ3 A;  4LCD E;  5AUI A;  1D5X C;  5FK9 C;  4WIP A;  3U2S C;  4BKS D;  1VLB A;  4GDK B;  3H8H A;  2LVP A;  4RFB A;  2JY6 A;  2LHE A;  4A90 A;  3VTW A;  1IUE A;  2KKC A;  2JXT A;  4HEA 1;  1L0Y B;  2UWQ A;  4J6I A;  3HK0 A;  3RNG C;  1FFV A;  2IO3 B;  3KW5 B;  4WJP A;  4ARC A;  4ITK A;  1AWD A;  1AN8 A;  2JYE A;  3Q3M C;  3ABV B;  2KJ6 A;  2W9N A;  4N58 A;  5D3D A;  2KDE B;  3P1M A;  5HKH A;  1WGR A;  3B2F A;  2KLC A;  2PTL A;  3IHP C;  4OZA A;  5BYS A;  4LDT D;  3B9J A;  3ZTD A;  2V4I B;  1ACC A;  4HPM B;  4KGR A;  2JVC A;  1RFA A;  2KD0 A;  4EEW A;  2N7E A;  3GZN I;  1WX7 A;  3ZJT A;  2UU7 A;  3MC8 A;  1GC6 A;  3W1Y A;  1H7X A;  3AE5 B;  2W54 A;  2IY1 B;  2WWZ A;  4FJZ A;  2C60 A;  3IT4 B;  5L83 A;  1ZP0 B;  3ZVV A;  4AUQ C;  2WXH A;  2JXX A;  1FPY A;  3QIJ A;  4AWJ A;  3P42 A;  3A9J A;  4XGA B;  1KH0 A;  2X8X X;  1XLO A;  3HIZ A;  1V6E A;  4GIV A;  2JX5 A;  1TY0 A;  3RZW C;  4WJN A;  3FKY A;  4BBN C;  3PS6 A;  1QT9 A;  1V2Y A;  2D3B A;  2MWS B;  2D3C A;  1KRH A;  3AE4 B;  1MFW A;  4E71 A;  1PGX A;  2XEW A;  4DBG A;  2IY0 B;  1S1Q B;  3V05 A;  4MJS B;  3UI3 A;  2HTH A;  1TIF A;  2OED A;  4GDL A;  4GGQ A;  2WYQ A;  3KUC B;  2J0M A;  4ZHO A;  4ZHP A;  2IGD A;  2K6D B;  2GI9 A;  2KWV B;  2K1F A;  3WAM A;  2DLB A;  1FCL A;  2DYM A;  2KMA A;  4BBN F;  5CHF A;  1G6J A;  4H2A A;  1TS3 A;  3VUW A;  2HDE A;  4IUM B;  3JVZ X;  3W9C B;  2LJ5 A;  4PS8 A;  2QIE B;  2MQJ A;  1ET6 A;  2MEK A;  2KNB A;  3L13 A;  1FNW A;  2QC8 A;  2D2Q A;  4PS3 A;  3T3N A;  4JPS A;  4P6V F;  2LGD A;  4X57 B;  4XWT A;  3TJP A;  3V3X A;  3MTN B;  4N9F 4;  2NVU I;  3WA0 A;  5KHO A;  1WRI A;  1WGY A;  1EF5 A;  2PJH A;  4S0R A;  5LXI B;  2KDI A;  3V60 A;  3E56 A;  2WXR A;  3VTV A;  1QOG A;  4JLC A;  1UGJ A;  2WU5 B;  3L4P A;  2RPV A;  1WM3 A;  1L7Y A;  3PRP B;  2N7D A;  2L52 A;  2KZR A;  4DXG A;  1TT5 B;  4B95 A;  4LJP B;  1E0Z A;  4L23 A;  4YSZ B;  2KTR A;  3EA6 A;  1GTH A;  5JHA A;  3RNF C;  2J53 A;  3CMM B;  4WJO A;  2BTE A;  3TIX A;  3BVG A;  3DWM A;  4XDC A;  1I4X A;  2MW5 A;  5BMI A;  1E7P B;  1Q0W B;  2ICI A;  4P1C C;  2N1V A;  1NVI D;  1ZXI A;  4WWN A;  3KH0 A;  1OQY A;  4ZRK A;  3NVV A;  5C1Z A;  4AJW A;  4KDI C;  3TBL D;  3IVF A;  3DBH I;  2FBW B;  4ZRJ A;  1ZXH A;  3AV8 A;  4AOF A;  4LTU A;  1V5T A;  2OJW A;  1KM7 A;  1P7E A;  3ZNG C;  1AYF A;  3A9K A;  5DPW A;  2FNJ B;  4W9H A;  1V86 A;  1V97 A;  2B3A A;  2RDB C;  1KFY B;  1N60 A;  1P1A A;  5IP4 D;  2L83 A;  1I42 A;  3AN1 A;  3FIL A;  5HI1 A;  3IFW B;  2BW2 A;  3AI5 A;  3DVG Y;  2ZVO A;  4C80 A;  3BY4 B;  4GB9 A;  3AUL A;  2G3Q B;  1V5O A;  3PO0 A;  2A4Z A;  2J0K A;  1LFD A;  2JWU A;  1XD3 B;  4KZ0 A;  2QIL A;  2CHZ A;  2N9E B;  2Z59 B;  3KUZ A;  2K22 A;  1RLF A;  5D3I B;  3QK0 A;  1E9M A;  2JRH A;  2KC2 A;  2N9K A;  3C0R B;  3KVF B;  1VRA B;  2WXO A;  2BS2 B;  1WWT A;  2KO3 A;  3CF4 A;  2GBM A;  2KFK B;  4GDK A;  4W9E A;  3NVY A;  2XN9 C;  4WQM A;  4HKZ E;  2L00 B;  4ZYN A;  1SSN A;  1XLN A;  2BKR B;  5IN7 A;  3CF6 E;  3U7D A;  1T0S C;  2WXM A;  3R7Q A;  3O65 B;  2PMV A;  2WDV B;  3HVZ A;  1H8C A;  3VTU A;  2NPT B;  4P1B C;  4JGH B;  3EFC A;  1J7A A;  3NRZ A;  3NS1 A;  4W9F A;  4RCO A;  3IXS A;  1C3T A;  4C7Z A;  3PPA A;  1NYQ A;  2MBQ A;  4BKT A;  4BZA A;  2WS3 B;  3DBR I;  2C7M B;  4LK0 M;  2IO0 B;  4NJ6 A;  2W3R A;  3ZNZ B;  3A4S C;  4OVZ A;  3VH4 B;  3NY5 A;  3BVZ A;  4E3C A;  4A9A A;  5J2R A;  3ZQ4 A;  1LXD A;  3AEF B;  2XNA C;  4TSS A;  2MX2 A;  1ENF A;  3V62 A;  1EWC A;  3AEA B;  1ZDV A;  1UEL A;  1NI2 A;  2AQ1 B;  3TUO A;  4K1R B;  5JXV A;  4USA A;  2ZEQ A;  2L05 A;  1C77 A;  2EKE C;  4BAX A;  3AU4 A;  2D11 A;  1E8Y A;  1YQB A;  4BOZ B;  2BBC A;  3C19 A;  4JE3 B;  2BQQ A;  1DYQ A;  2WGS A;  1T5X D;  3KUD B;  4MT5 A;  2ZW0 A;  4TKN A;  4NNJ B;  3W5V B;  2KQ7 A;  2ACZ B;  1QKZ A;  1CZP A;  3VFK A;  2MLB A;  2HJ1 A;  3KWV A;  3HRD D;  4M0W B;  1TYG B;  2LRW A;  4MJS A;  2KYW A;  5E6O A;  4IM3 A;  1NI3 A;  2M19 A;  2E3T A;  3WIM A;  3J9C A;  5LLI A;  5EDS A;  4DDG D;  1YN3 A;  2FE8 A;  4M01 A;  3DQV A;  2NBU A;  3MC9 A;  4II2 B;  1JW9 D;  3AE3 B;  2V4L A;  3H1U A;  3KYD D;  3U7Z A;  5JZE B;  2N9X A;  2XK5 B;  1WGK A;  4ZYS A;  1I4P A;  2D5G A;  2Y5B B;  4OW0 A;  2H89 B;  3N20 C;  3ONS A;  2FCN A;  1EF1 A;  4BFR A;  3P4S B;  3I5J C;  1QOF A;  2D10 A;  1SIJ A;  1V81 A;  4WUR A;  3ZNI D;  1D5M C;  2ZCB A;  3PZ8 A;  3VAW A;  2RSU A;  4GXB A;  1XEE A;  1JRU A;  2PE6 B;  4GDL B;  2FID A;  3Q69 A;  3M3J A;  1BXT A;  5AZH A;  4B0E A;  2LRU A;  2KX3 A;  2WQY B;  4ICU A;  3WAO A;  4RM9 A;  3AM9 A;  3R2T A;  4II3 B;  2HJ8 A;  3APC A;  5LXH A;  3DBH B;  1UGM A;  1M4V A;  1J7B A;  1D6E C;  1KTK A;  3RPF C;  4JWS C;  4I6L B;  4MAC A;  1OGW A;  3FC4 A;  2WXK A;  1L5P A;  2BB5 A;  2G9H D;  1N6Z A;  3V61 A;  3APF A;  1WJU A;  2WDR B;  1LQB A;  2BB6 A;  1QZE A;  2JPH A;  1C4P A;  3P4P B;  4YXD B;  4IM2 A;  4RGO S;  1NEN B;  1FXI A;  1EUV B;  2JUO A;  4G0N B;  3DBL B;  4PS7 A;  3VH3 B;  2PPH A;  3VR9 B;  2YEP F;  3OAW A;  4IG7 B;  1JWS D;  2INP E;  2KK8 A;  2KX0 A;  4A3P A;  1CK1 A;  2WNM A;  3DHG C;  3S2A A;  2J4X A;  4EZL A;  1WE7 A;  1HZ6 A;  1P9D U;  2K8C A;  1EWY C;  1XT9 B;  2JSV X;  3P2B A;  4MGY E;  3ZDM C;  4IWO A;  4EZJ A;  1P3Q U;  1HXY D;  1JRO A;  3A4R A;  2PVG C;  2CJN A;  4KX6 B;  3ZKJ C;  2AL3 A;  4AS1 A;  3BVM A;  2L76 A;  2LD9 A;  2ON8 A;  4K7W A;  2DYB A;  1E7V A;  2KFK A;  4OZC A;  2PKO A;  4MEL A;  2LFI A;  4M00 A;  4IWQ A;  2LGX A;  1P98 A;  1UWX A;  4ICV A;  3LDZ E;  4CHK A;  1M94 A;  2WLB A;  2VZK B;  2JF5 A;  3H7P B;  2OOB B;  3EC8 A;  2IBI B;  1D3Z A;  2KMM A;  1QOB A;  4MH0 E;  2KVR A;  1N5X A;  2NPT A;  4PYU A;  2CU3 A;  4WJQ A;  3RCZ A;  1L4Z B;  3B08 A;  3AE2 B;  3ML8 A;  2CU1 A;  5C23 A;  2WXG A;  4ZRQ A;  1I7H A;  2WXI A;  1ZGU B;  1EU3 A;  4NJC A;  2ZNV B;  1K50 A;  2K25 A;  4XC2 A;  4HJG E;  3IAS 1;  1AAR A;  3ENE A;  1JML A;  3B1L X;  2C5L C;  5BMH A;  3D32 A;  1K52 A;  2MH7 A;  3NZS A;  2CR5 A;  1WRD B;  1XCQ L;  1AW7 A;  1WY8 A;  2DZI A;  1ZE3 D;  1JAL A;  2KC1 A;  3SDL C;  1ZUD 2;  2J0J A;  4K3B A;  3AEC B;  2WX0 A;  4EE2 A;  5TR5 A;  2DEN B;  1C79 A;  3ZXR A;  4M0W A;  3B2G A;  1FXA A;  1WMH B;  3PZ7 A;  5L95 C;  4HK2 A;  2K9X A;  1SF0 A;  2BGF A;  4AJY B;  4IC7 B;  1ET9 A;  2PVO D;  1J7C A;  1GAQ B;  1V8C A;  4J3O D;  1OFF A;  2M1M A;  3BII D;  1L6V A;  1I4Q A;  4RGN A;  3R66 C;  1SE9 A;  1WE6 A;  3TMP B;  2XK5 A;  5JHB A;  2RMM A;  4URK A;  2ASQ A;  2L8J A;  1V80 A;  3VUX A;  4KKI A;  3DVG X;  3RZF A;  1Z5S B;  1CQV A;  2N9P C;  2I1K A;  3DPD A;  1T3Q A;  2WHI A;  2NCN A;  3ZJV A;  2GBK A;  4B6W A;  1HA5 A;  1IYF A;  2AL6 A;  2QJL A;  4DQO C;  2CHW A;  3OLM D;  4HDQ A;  4A8X C;  4ANX A;  3SFD B;  5D94 A;  2E6X A;  1RYJ A;  2W82 A;  3IT6 B;  3DVN V;  2FCQ A;  2MHJ A;  1VZ7 A;  2LVQ A;  2RGF A;  2NBV B;  2BVC A;  3PZD A;  2DX5 B;  1FMA D;  2OHF A;  2Y3A A;  3V6C B;  3LB8 C;  4REZ A;  1SGH A;  1UH6 A;  4PK1 A;  2HTM E;  2CJO A;  5HHD G;  2L0T A;  1GG3 A;  1KOT A;  1Q10 A;  1F77 A;  4RF0 A;  2WDT B;  3NVW A;  3ZJU A;  1E90 A;  1Y8R C;  3TEY A;  2I38 A;  2IND C;  1LM8 B;  2ZNV C;  4TMA B;  2L3Z A;  4GLS C;  2QDF A;  4ZDV A;  2FUH B;  4W9L A;  2IO2 B;  3RNA C;  3VXW A;  3RFZ B;  3PSE B;  5IO9 A;  3BK2 A;  1WXS A;  2IGG A;  3NHE B;  1V1P B;  5DPR A;  4TUU A;  4FHK A;  3RI7 C;  2N9L A;  3NJT A;  3RN9 C;  1P0R A;  3V6E B;  2LAS A;  3OJ4 B;  2SAK A;  2DYO A;  2KQS A;  4RGT A;  1XLP A;  3QQ8 B;  4KVG B;  4WWM A;  1TZO A;  2QSD A;  4WQO B;  3QA8 A;  4S17 A;  2EEL A;  2FAZ A;  5IOI A;  3AEB B;  1ZPS A;  2KJH B;  5GMV A;  2D3A A;  2JWZ A;  2VH2 A;  2LUM A;  1ROE A;  3QC8 B;  4WAF A;  2ONQ A;  5E6N A;  1SE2 A;  2UYZ B;  4N59 A;  3M62 B;  3DHI C;  5MPO A;  1FCC C;  1TKG A;  3P4Q B;  1KLU D;  3I63 C;  1C1Y B;  3AE6 B;  4IW0 A;  3H7P A;  4C56 C;  1U4A A;  2I2Y A;  2KFJ A;  4QAY A;  3DDC B;  3HM6 X;  3OG5 A;  4HKQ A;  3CSF A;  4EZK A;  3GS2 A;  1WZ3 A;  2REX A;  3GP7 A;  3RUL A;  1MI0 A;  4HLE A;  4NPN A;  1WXA A;  2VZK D;  5CHV C;  3GE3 C;  2BT6 A;  2Z0D B;  2LGY A;  3W5U B;  2LGI A;  3AE1 B;  3C8Y A;  4TQ0 A;  4R3D A;  2LWP A;  3PGE A;  1J19 A;  3DBL I;  3AU5 A;  1YJJ A;  4FAD A;  4YWG G;  2DZJ A;  2QHO A;  4HXD A;  1N61 A;  2LEK A;  2MBH A;  1C76 A;  1F2R C;  1A5R A;  1VCB A;  4G50 A;  2KHW B;  4HRO A;  2MCN B;  1LGR A;  2KLG A;  4KGS A;  1IPG A;  3U8Z A;  1YIW A;  3BIN A;  3GOE A;  2KWD A;  1UWM A;  1QF6 A;  2AWT A;  1YX5 B;  1IGC A;  3DHH C;  4W9D A;  2K8H A;  1RFK A;  1IBX B;  1CJE A;  2GBJ A;  2KOX A;  3NZ3 A;  1TS5 A;  4A3O A;  4PT5 A;  2WXN A;  3DCG A;  4B9K A;  1WIA A;  2D3G A;  4IWP A;  4ARI A;  1WMH A;  1R7S A;  1NDD A;  2YLM A;  2HE7 A;  1KLV A;  1XLQ A;  5EE3 A;  2KMC A;  1UBQ A;  1HTQ A;  3UIN B;  4W9J A;  4C7Y A;  1OQR A;  1FXT B;  2J42 A;  2WDQ B;  3PVL A;  1JWA D;  1J0G A;  1FM0 D;  4OVU A;  1S3S G;  3NZU A;  3L10 B;  1TKY A;  3RNE C;  1XCT L;  3MHS D;  2JZ3 B;  1N5W A;  3JW0 X;  2DWQ A;  1GB4 A;  1WYG A;  1D5Z C;  1WZ0 A;  4MM3 B;  3VR8 B;  3A1Q B;  1UD7 A;  1TKE A;  4GSW A;  3NUH B;  2CHX A;  1VZ6 A;  3CST A;  2M0A A;  1DGJ A;  1VJK A;  3DVN U;  3VHT C;  2RDH A;  2KJR A;  3U4E G;  1YMH E;  5T8I A;  5J17 A;  5FR6 A;  3SEB A;  2K6Q A;  3N32 A;  3U52 E;  3ZLZ A;  3PRE A;  2Z0E B;  2BF8 B;  4IKG A;  1L0X B;  2DZM A;  3W2D A;  3I3T B;  1KF6 B;  5TSS A;  2WX1 A;  2V1Y A;  3H6N A;  4JQW C;  3O13 A;  2DZK A;  4YTP B;  2JZP A;  3WCQ A;  1WJ6 A;  4DHZ B;  3I57 A;  4K7U A;  3BWU D;  2CKH B;  1FFU A;  4B0M A;  1GTE A;  4NQK E;  1E8Z A;  4LJO B;  4NJ7 A;  1K53 A;  3RNC C;  2NBW B;  1V1P A;  3RNB C;  3RUI B;  1H4R A;  4WWO A;  3UGB B;  1C4C A;  4ANU A;  2M17 A;  2MP2 A;  3RT3 B;  4AP4 C;  2GBR A;  5D6J B;  3T3O A;  2LXA A;  4ACF A;  4US8 A;  2N0S B;  2K0P A;  2PE9 A;  3NVZ A;  2WU2 B;  3Q14 C;  1JQ4 A;  5JH5 C;  1MG4 A;  2C7H A;  1Z2M A;  1L4D B;  3UQA A;  1F1H A;  3UIP B;  4HPP A;  3Q8F A;  2JZZ A;  1YX6 B;  4LNI A;  1WXQ A;  2OJR A;  4OHJ A;  1VDV A;  1SJE D;  1YN4 A;  3EEC A;  1GUA B;  4O1N A;  3VRA B;  2PEA A;  3HUI A;  3RD2 A;  3R7R A;  1F2R I;  2PLP A;  1Q5W B;  2W3S A;  4NY0 A;  1OQQ A;  2ZPN A;  5BMG A;  1FRR A;  4F7Z A;  4BVU C;  2LHD A;  3Q8E A;  5G5H A;  2XBB C;  5DPS A;  4GU2 A;  2V9H A;  2BYF A;  2GB1 A;  5AEK B;  2MBB B;  3EUB 2;  3M63 B;  2QCZ A;  2FCM A;  1HQR D;  3ALB A;  3EFU A;  5H8Y E;  4P16 A;  3X23 A;  4C00 A;  1PGA A;  4GOC A;  4XX5 A;  4MSQ B;  2J7Q B;  4XDD A;  3AEG B;  2O6V A;  2A5U A;  2MJ3 A;  3N1X C;  5HFY A;  2JU6 X;  3SHQ A;  2R2Q A;  2NR2 A;  3KQ4 A;  1I4H A;  4PYZ A;  1QQR A;  3L08 A;  2R61 A;  1WM2 A;  4IOI E;  4IM0 A;  2BPS A;  2KQ4 X;  2O6V D;  2JT4 B;  3HHM A;  1E6E B;  3UF8 A;  2J52 A;  5AZG A;  2GOW A;  2M4N A;  3QHT A;  4KKJ A;  1F0Z A;  3MP9 A;  3NG0 A;  3QCA A;  1TS2 A;  4RM8 A;  1E5W A;  2V3S A;  4DK5 A;  1IBX A;  3L16 A;  1VR9 A;  1MHX A;  1QIL A;  4NZL B;  1OEY A;  3U30 A;  1FEH A;  4FHJ A;  5I4D A;  1F9J A;  1JWU D;  1FNV A;  3VRB B;  3VQI A;  1KLG D;  2YVC A;  1SE3 A;  5DPT A;  3P4R B;  2KAC A;  1F52 A;  2MRP A;  1TGZ B;  1WGD A;  2WXF A;  4EOY A;  1WH3 A;  4GMV A;  3APD A;  2SEB D;  3L0W B;  4I6N B;  1QOA A;  2LVO A;  1YQ4 B;  1BT0 A;  4DXA B;  2IJ0 A;  1GPX A;  3PT2 B;  3QWZ B;  3NOB A;  4BOS C;  3PRZ A;  4KGT A;  4JWU C;  2BWF A;  4XE0 A;  4ZOH C;  4DHJ B;  1FIQ A;  5FKA C;  4W9C A;  3ZXV A;  4MM3 A;  4KZC A;  5CX3 A;  3A1Q A;  4FUL A;  3X0W A;  4DXF A;  2WXL A;  4MEM A;  1XF5 L;  5AUK A;  2G1E A;  3IBE A;  3UIO B;  2AYO B;  2IPK D;  3Q3N C;  3N3K B;  5G55 A;  4C4V B;  2IGH A;  2EMT A;  4YSY B;  2L1A A;  1CMX B;  2Z8L A;  5CTR C;  4Q2J A;  3LYY A;  4NQL B;  3WAN A;  2G4D B;  1RAX A;  1MG8 A;  3ZO5 B;  2DBY A;  4FBJ B;  1BUI C;  1WSP A;  1J8C A;  1UBI A;  3AB5 A;  3N30 A;  1H7W A;  4DDI D;  2K3U A;  2IZV B;  5DCN A;  2ZCC A;  4L1B A;  4NAW A;  5H92 C;  1XQQ A;  2BKF A;  2V3P A;  4G3X B;  1HE8 A;  1RRB A;  1L6U A;  4EFO A;  4LNN A;  4I6P A;  1WYW B;  2Q5W D;  1HEZ E;  4DHZ E;  5EE1 A;  4CQN A;  4RF1 A;  1C78 A;  3TL5 A;  5IAA C;  1PGB A;  4M02 A;  2H88 B;  1GB1 A;  3MHZ A;  4LNO A;  4ZRP A;  2RDG A;  2LUE A;  4HPL B;  3EHV A;  4US9 A;  1T6B X;  5G2N A;  1WJN A;  2O2V B;  1K8R B;  3NS8 A;  4KIK B;  4NAM A;  2KN5 A;  3BZD B;  1WX8 A;  1WX9 A;  2L0F A;  2KVZ A;  5G5G A;  1JRP A;  3ETR A;  1IP9 A;  1P7F A;  2QEJ C;  4FJY A;  2NS5 A;  2LXC A;  2KAJ A;  3A33 B;  2X38 A;  4KSK C;  1E7U A;  1JCK B;  1V9J A;  3ZRC A;  4MGI E;  2DAJ A;  2AX5 A;  3Q8B A;  3VDZ A;  1PYW D;  1WR1 A;  3E9S A;  4W9I A;  1C9F A;  1X1M A;  3QAR A;  3R3M A;  3ZRF A;  5CHW A;  4HCP B;  4OVV A;  4K7S A;  1YOV B;  4WWP A;  3Q6B A;  3DBS A;  4HRS A;  1FO4 A;  1PQS A;  2VH1 A;  3KLS X;  4XZ4 A;  3DWG C;  2MP2 B;  3H7S A;  4WH4 A;  5BYR A;  3Q3F A;  3PHW B;  2KTF A;  1R4N B;  4TQ1 A;  1HZ5 A;  1K51 A;  3UQB A;  2IYD B;  4KSL C;  4G11 A;  3T9L A;  1JWB D;  1SJH D;  1SEB D;  2IDY A;  4JIO U;  4AQ7 A;  3JSV A;  3BYT B;  3RMK C;  2G45 B;  4GN1 A;  2EKI A;  1GJZ A;  3AE7 B;  1ISN A;  2KN4 A;  1NBF C;  1E8W A;  2N1W A;  4YTN B;  3MFG A;  4KDL B;  4ANV A;  1TS4 A;  2FUG 1;  2BS4 B;  3RYT A;  5IKC M;  1I35 A;  1MHH E;  4EUT A;  5EE0 A;  2N4F A;  1Q1O A;  4LLG M;  3AED B;  1YN5 A;  1WI0 A;  3R2I A;  3TCA A;  3AXC A;  4UDU C;  1MVK A;  2BYE A;  2KDF B;  2DHZ A;  2IO1 B;  2K39 A;  4RNA A;  1T0Q C;  1KJT A;  1EU4 A;  4RMA A;  5C3J B;  3K9P B;  2O6V B;  4JL9 A;  2HD5 B;  3PLV A;  3VUY A;  5LNK 1;  3N9Y C;  3PLU A;  3CIR B;  4KV2 A;  1ZDX A;  4L2Y A;  1VD2 A;  1R4M I;  4JX1 C;  4MDK E;  3LJ3 A;  2K8B A;  1HTO A;  3KYC D;  3K9O B;  4CYE A;  2BWE S;  2NTS A;  3Q3J A;  3BK1 A;  5BYQ A;  2ZJD A;  3I9V 1;  2JRI B;  4ASW C;  1E8X A;  3L54 A;  1WGH A;  3ZIM A;  2AQ3 B;  2LGS A;  2INN E;  4MGZ E;  2BYV E;  1MPE A;  3MC0 B;  5FR3 A;  1PUT A;  1GC7 A;  2K5P A;  1T0Y A;  4DHJ D;  2NMQ A;  1GT8 A;  3P63 A;  1RWS A;  2JYT A;  2G4S A;  3Q2A C;  3GZN B;  4C4V A;  3URY A;  4ZRI A;  3IAM 1;  2V3N A;  1ZOY B;  2PW9 A;  4BKG A;  3QJZ A;  2GMI C;  2VRR B;  2ZVN A;  1B9R A;  4YL8 A;  2CS4 A;  1NEK B;  2YEP B;  4W9G A;  4DWF A;  1SB3 C;  2AEH A;  2QMT A;  1YJ1 A;  4FN2 A;  4MSM B;  4HVB A;  1E10 A;  3DOW A;  3HVD A;  1EM7 A;  4OZB A;  2WXJ A;  3MJW A;  1XO3 A;  3M95 A;  1GNU A;  4YT0 B;  3Q8A A;  3AEE B;  1I4G A;  3FAH A;  3PTF C;  4M8M A;  1MJD A;  4FXC A;  4XYC A;  2L32 A;  2LI5 A;  3CWI A;  2DNF A;  4HJK A;  4YTM B;  5D7G A;  2KXJ A;  1PFD A;  2BYT A;  2O2V A;  2N7J A;  2WXP A;  4KIK A;  2RR9 A;  4LDT B;  4LNK A;  3WAL A;  1WJ4 A;  3QX1 A;  2INC C;  2W55 A;  1UNS A;  3ZYY X;  4MH8 A;  1YD8 U;  4TV3 A;  1YNT E;  1A70 A;  4A20 A;  3PRM B;  2ZW1 A;  2MA9 B;  2B76 B;  2WXQ A;  3N1Y C;  2JQR B;  4NAW B;  2ZZP B;  1YQ3 B;  3ZTC A;  5AZF A;  2I1J A;  4FLH A;  2V0G A;  2KAN A;  1RM6 C;  1WXM A;  1PDX A;  3WAP A;  1QLB B;  1ZKH A;  3SD5 A;  2C9W B;  3TEZ A;  4F8C B;  1L0V B;  1B1Z A;  1V1O A;  2KT7 A;  3OWE B;  2FCS A;  3L17 A;  1ESF A;  3A9J B;  2DAF A;  2RD0 A;  2M56 B;  2EMS A;  2M0X A;  4N6E B;  4ANW A;  2MBE A;  1GOZ A;  1I4R A;  4K3C A;  2RPQ A;  3Q3O C;  3SFE B;  4WAA A;  1L2N A;  2GBN A;  3HM3 A;  5EE9 A;  1EO6 A;  1JWM D;  2LZ6 A;  5E6J A;  2LMC A;  3GB1 A;  2MJD A;  1OEY J;  3LXF A;  3MJ5 A;  3AMZ A;  2PIA A;  5C2T B;  3W1S C;  1VZ8 A;  2WP9 B;  1DOY A;  1UF0 A;  3ZDT A;  1N62 A;  5GXG B;  4LNF A;  2C7N B;  2Y5P A;  3AH7 A;  1R4M B;  1UZX B;  1WFY A;  2R2O A; 
#chains in the Genus database with same CATH homology
 4USA A;  2EEL A;  1C77 A;  4A55 A;  2DBY A;  3AEB B;  1BUI C;  1ZPS A;  1N63 A;  1SBB B;  1WSP A;  2BBC A;  4JE3 B;  2GRI A;  1DYQ A;  2LUM A;  1ROE A;  3Q8C A;  1T5X D;  2TSS A;  3AB5 A;  4MT5 A;  4WAF A;  2BS3 B;  1FNU A;  2ZW0 A;  4RGM A;  1H7W A;  1TJE A;  2LJI A;  2ONQ A;  3KWL A;  2K3U A;  1SE2 A;  4N59 A;  5MPO A;  1FCC C;  1Y56 A;  1TKG A;  3P4Q B;  1KLU D;  4L1B A;  5H92 C;  3W5V B;  2ACZ B;  3AE6 B;  5HG2 A;  1QKZ A;  1CZP A;  3KWV A;  3HRD D;  1BML C;  1TYG B;  4C56 C;  2V3P A;  1TY2 A;  2I2Y A;  1NI3 A;  1L6U A;  2M19 A;  3TEW A;  2E3T A;  1SXT A;  2Q5W D;  4HKQ A;  1HEZ E;  5EE1 A;  3GS2 A;  3J9C A;  4A6Q A;  4CQN A;  4RF1 A;  2AQ2 B;  1YN3 A;  3GP7 A;  2FE8 A;  1C78 A;  1MI0 A;  1SE4 A;  1XXG A;  1PGB A;  1JW9 D;  3AE3 B;  2H88 B;  2VZK D;  1GB1 A;  3U7Z A;  3MHZ A;  2BT6 A;  1LO5 D;  4ZRP A;  2Y5C A;  3W5U B;  2LGI A;  2RDG A;  3AE1 B;  3C8Y A;  4D2K A;  4TQ0 A;  4YSX B;  4R3D A;  4US9 A;  4XWW A;  1T6B X;  1WGK A;  4ZYS A;  3EGR A;  3AE9 B;  1YJJ A;  4NAM A;  3BZD B;  1STE A;  4YWG G;  5G5G A;  1YJI A;  1I4P A;  1JRP A;  2D5G A;  3TSS A;  4OW0 A;  3TEX A;  3ETR A;  1N61 A;  2H89 B;  2LEK A;  1P7F A;  2QEJ C;  2MJE A;  2NTT A;  1C76 A;  1F2R C;  2KAJ A;  3P4S B;  1QOF A;  2X38 A;  4HRO A;  1SIJ A;  3R8B A;  3SR6 A;  3ZGZ A;  2KDM A;  4WUR A;  3BYY B;  1JCK B;  1UUP A;  1NYR A;  4KGS A;  1D5M C;  3PZ8 A;  1D4B A;  1IGD A;  2KWD A;  3Q8B A;  1FRD A;  1UWM A;  1XEE A;  2AX5 A;  3FIL B;  1QF6 A;  1IGC A;  4GDL B;  1PYW D;  3E9S A;  3Q69 A;  1BXT A;  1RFK A;  1C9F A;  4RH6 A;  4B0E A;  1DOX A;  3W1S A;  1IBX B;  1CJE A;  2WQY B;  3NZ3 A;  1C4A A;  1TS5 A;  4PT5 A;  2WXN A;  1FD6 A;  3AE8 B;  1DOI A;  4IDI A;  4ARI A;  3AM9 A;  3R2T A;  4HRS A;  1R7S A;  1FO4 A;  5AUI A;  1D5X C;  3KLS X;  1M4V A;  3DWG C;  4WIP A;  5FK9 C;  3U2S C;  1XLQ A;  1VLB A;  1J7B A;  4GDK B;  5EE3 A;  1D6E C;  4WH4 A;  3H8H A;  4RFB A;  5BYR A;  1KTK A;  2LHE A;  4A90 A;  3RPF C;  4JWS C;  4MAC A;  1IUE A;  4TQ1 A;  2JXT A;  1HZ5 A;  1K51 A;  4HEA 1;  3FC4 A;  2WXK A;  1L5P A;  1L0Y B;  2BB5 A;  2G9H D;  4C7Y A;  1OQR A;  2J42 A;  1JWB D;  1SJH D;  2WDR B;  1SEB D;  2IDY A;  2WDQ B;  4AQ7 A;  1JWA D;  3BYT B;  1FFV A;  1FM0 D;  2BB6 A;  4ARC A;  1C4P A;  2EKI A;  4ITK A;  3P4P B;  1AWD A;  4YXD B;  1AN8 A;  3AE7 B;  1TKY A;  1NEN B;  1FXI A;  4RGO S;  2KN4 A;  1XCT L;  2JYE A;  3ABV B;  1N5W A;  4N58 A;  5D3D A;  3VR9 B;  2YEP F;  1GB4 A;  2DWQ A;  4YTN B;  1WYG A;  3MFG A;  1D5Z C;  1JWS D;  3P1M A;  2INP E;  1TS4 A;  2FUG 1;  4MM3 B;  2BS4 B;  3B2F A;  1CK1 A;  2WNM A;  1MHH E;  2PTL A;  4OZA A;  5EE0 A;  5BYS A;  3B9J A;  2V4I B;  3VR8 B;  1ACC A;  4KGR A;  2J4X A;  1HZ6 A;  1TKE A;  1EWY C;  4LLG M;  3AED B;  1YN5 A;  2JSV X;  3R2I A;  3ZJT A;  4UDU C;  1H7X A;  3AE5 B;  1MVK A;  1HXY D;  2W54 A;  1JRO A;  3NUH B;  1VZ6 A;  2M0A A;  2PVG C;  1DGJ A;  2CJN A;  3IT4 B;  1VJK A;  2RDH A;  4KX6 B;  4AS1 A;  3BVM A;  1ZP0 B;  4RNA A;  3U4E G;  1YMH E;  2WXH A;  3P42 A;  1KH0 A;  1EU4 A;  5T8I A;  1XLO A;  2ON8 A;  3SEB A;  4OZC A;  5C3J B;  3U52 E;  2PKO A;  2JX5 A;  1TY0 A;  2LFI A;  1QT9 A;  4IKG A;  1UWX A;  1L0X B;  3W2D A;  1KRH A;  1KF6 B;  3AE4 B;  5TSS A;  5LNK 1;  3N9Y C;  1PGX A;  2VZK B;  2WLB A;  3O13 A;  4YTP B;  3V05 A;  3UI3 A;  3CIR B;  2JZP A;  2OED A;  1ZDX A;  4L2Y A;  2KMM A;  4JX1 C;  3WCQ A;  1QOB A;  4ZHO A;  3I57 A;  4ZHP A;  2IGD A;  3BWU D;  1N5X A;  2GI9 A;  1FFU A;  4B0M A;  2CU3 A;  1GTE A;  2DLB A;  1FCL A;  2NTS A;  1K53 A;  2DYM A;  1L4Z B;  3BK1 A;  5BYQ A;  4H2A A;  1TS3 A;  3AE2 B;  1V1P A;  2HDE A;  3I9V 1;  3W9C B;  2WXG A;  1C4C A;  2QIE B;  4ZRQ A;  2AQ3 B;  1I7H A;  2WXI A;  2INN E;  1ET6 A;  1EU3 A;  4NJC A;  2MEK A;  1MPE A;  3T3O A;  1K50 A;  3MC0 B;  5FR3 A;  1FNW A;  1PUT A;  2K5P A;  4US8 A;  4HJG E;  3IAS 1;  2N0S B;  2K0P A;  4JPS A;  2NMQ A;  3T3N A;  4P6V F;  1GT8 A;  3P63 A;  4XWT A;  1RWS A;  3NVZ A;  2WU2 B;  1JML A;  3V3X A;  1JQ4 A;  2JYT A;  5BMH A;  1K52 A;  1WRI A;  3URY A;  2MH7 A;  1L4D B;  3IAM 1;  2V3N A;  1ZOY B;  2PW9 A;  3E56 A;  2WXR A;  1QOG A;  1XCQ L;  1AW7 A;  1UGJ A;  1B9R A;  2WU5 B;  3Q8F A;  3L4P A;  2RPV A;  1ZE3 D;  1WXQ A;  1JAL A;  1NEK B;  2L52 A;  2YEP B;  4OHJ A;  1VDV A;  4DXG A;  1SB3 C;  1SJE D;  1YN4 A;  1ZUD 2;  4O1N A;  2QMT A;  3VRA B;  3HUI A;  1E0Z A;  3AEC B;  1F2R I;  4EE2 A;  4L23 A;  2PLP A;  4YSZ B;  1E10 A;  3HVD A;  1C79 A;  1EM7 A;  4M0W A;  2W3S A;  3EA6 A;  4OZB A;  1OQQ A;  2WXJ A;  1FXA A;  3B2G A;  3PZ7 A;  5BMG A;  1GTH A;  1FRR A;  2LHD A;  3Q8E A;  2K9X A;  5G5H A;  1XO3 A;  2J53 A;  1SF0 A;  2GB1 A;  4YT0 B;  3Q8A A;  2BTE A;  1ET9 A;  3AEE B;  2PVO D;  1I4G A;  1J7C A;  1GAQ B;  3BVG A;  3EUB 2;  3DWM A;  3FAH A;  4XDC A;  1I4X A;  1V8C A;  4FXC A;  1HQR D;  4J3O D;  1OFF A;  5BMI A;  5H8Y E;  2L32 A;  3CWI A;  1E7P B;  3BII D;  1L6V A;  2ICI A;  1I4Q A;  4P16 A;  4RGN A;  4YTM B;  1PGA A;  5D7G A;  1NVI D;  4XDD A;  3AEG B;  1ZXI A;  2MJ3 A;  1PFD A;  2BYT A;  2RMM A;  2JU6 X;  5HFY A;  2N7J A;  2WXP A;  3NVV A;  3KQ4 A;  1I4H A;  4KKI A;  2W55 A;  1UNS A;  3ZYY X;  2FBW B;  4MH8 A;  1CQV A;  1QQR A;  2R61 A;  1ZXH A;  1T3Q A;  4IOI E;  3AV8 A;  4LTU A;  1YNT E;  1A70 A;  3ZJV A;  1P7E A;  2KQ4 X;  1AYF A;  1HA5 A;  2ZW1 A;  2B76 B;  2WXQ A;  1E6E B;  2JQR B;  4NAW B;  1V97 A;  2J52 A;  2QJL A;  4DQO C;  1KFY B;  1YQ3 B;  1N60 A;  4A8X C;  2L83 A;  3AN1 A;  3FIL A;  2V0G A;  4KKJ A;  1RM6 C;  5HI1 A;  1F0Z A;  3MP9 A;  2BW2 A;  4C80 A;  1TS2 A;  3SFD B;  1PDX A;  2E6X A;  1RYJ A;  2W82 A;  3IT6 B;  1IBX A;  3PO0 A;  1VZ7 A;  1QLB B;  2JWU A;  3TEZ A;  2QIL A;  1L0V B;  1VR9 A;  1MHX A;  2K22 A;  1B1Z A;  1V1O A;  5D3I B;  1QIL A;  1FMA D;  2OHF A;  1E9M A;  3OWE B;  4NZL B;  1FEH A;  2N9K A;  1ESF A;  2Y3A A;  1VRA B;  2WXO A;  3LB8 C;  2BS2 B;  1WWT A;  3CF4 A;  4REZ A;  5I4D A;  2HTM E;  2M56 B;  1JWU D;  2CJO A;  1FNV A;  3VRB B;  3VQI A;  1KLG D;  4N6E B;  1SE3 A;  5HHD G;  3P4R B;  2KAC A;  3NVY A;  2XN9 C;  4WQM A;  1Q10 A;  1F77 A;  4HKZ E;  4RF0 A;  1GOZ A;  1SSN A;  2WXF A;  3NVW A;  1XLN A;  1I4R A;  3ZJU A;  3TEY A;  2I38 A;  2SEB D;  3SFE B;  2WXM A;  4TMA B;  2PMV A;  2WDV B;  1QOA A;  3HVZ A;  5EE9 A;  1YQ4 B;  4GLS C;  2IJ0 A;  1GPX A;  1J7A A;  3NRZ A;  3NS1 A;  1JWM D;  4RCO A;  3IXS A;  4C7Z A;  3RFZ B;  4KGT A;  4JWU C;  1NYQ A;  4XE0 A;  3BK2 A;  4ZOH C;  5E6J A;  2IGG A;  2LMC A;  1FIQ A;  1V1P B;  3GB1 A;  5FKA C;  2WS3 B;  2N9L A;  4LK0 M;  2MJD A;  3LXF A;  3MJ5 A;  2W3R A;  2SAK A;  4OVZ A;  2DYO A;  3AMZ A;  3BVZ A;  2PIA A;  4A9A A;  5C2T B;  4RGT A;  1VZ8 A;  2WP9 B;  1XLP A;  2WXL A;  3ZQ4 A;  4DXF A;  1DOY A;  3AEF B;  1XF5 L;  2XNA C;  4WWM A;  2G1E A;  5AUK A;  4TSS A;  1ENF A;  1N62 A;  5GXG B;  1TZO A;  1EWC A;  2QSD A;  3AEA B;  1ZDV A;  2Y5P A;  2IPK D;  3AH7 A;  2IGH A;  2AQ1 B;  3TUO A;  4YSY B;  2L1A A;  2Z8L A;  5JXV A;  4Q2J A;  3LYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...