2WU2B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystal Structure of the E. Coli Succinate:Quinone Oxidoreductase (Sqr) Sdhc His84met Mutant
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wu2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wu2B01
3B2GA 1L5PA 1KFYB 3NRZA 4LTUA 4YSZB 1GAQB 1KRHA 2CJNA 5EE9A 1N5WA 5G5HA 3AB5A 1V97A 3LB8C 1YQ4B 1PFDA 4IDIA 3VR9B 1E9MA 3P4SB 3WCQA 4C7YA 2WU2B 3FAHA 3P4PB 1B9RA 3AEEB 1JROA 1QOFA 5EE3A 1XLOA 2OHFA 2H89B 4N59A 3NVVA 4YSYB 1QT9A 1J7BA 3AEAB 2MH7A 2W3RA 4HRSA 2WP9B 3SFDB 1N60A 1NYQA 1QOAA 1QOGA 1VDVA 3AE3B 2M56B 4WQMA 3CIRB 3AE7B 4YTPB 1JW9D 1V8CA 4YTNB 3LXFA 1H7XA 2BS4B 1L0VB 1OQRA 3HUIA 2BS2B 2K22A 2L52A 2E3TA 2LEKA 2WU5B 1YQ3B 3AH7A 3AV8A 1PUTA 3PO0A 1ZXIA 2WDRB 1NVID 3ZYYX 2JQRB 3P63A 3CWIA 1YJJA 4US8A 1WRIA 1DOYA 5H92C 4YSXB 1CJEA 2KMMA 1WXQA 1XLNA 1GTHA 1IUEA 1NYRA 5C2TB 3NVWA 2W54A 3AE2B 4ZOHC 1NI3A 4N6EB 2BT6A 2K9XA 1FFUA 1RFKA 3CF4A 3BIID 1UWMA 1TKGA 1ZUD2 4FXCA 4YT0B 2G1EA 5GXGB 1FO4A 1DGJA 3SR6A 1E6EB 5C3JB 1A70A 1EWYC 4YXDB 1YJIA 2WDVB 3W5VB 2L83A 1OFFA 1E0ZA 3HVZA 2Y5CA 4YTMB 2AX5A 1GPXA 1XLQA 1AWDA 1CZPA 1E7PB 1N5XA 2MJEA 3NVZA 3P4QB 2B76B 1H7WA 1FXIA 3AECB 1FM0D 1KF6B 1WWTA 3B2FA 1NEKB 2DBYA 2DWQA 3B9JA 4JWUC 3AE9B 5H8YE 3W5UB 4C7ZA 1E10A 1J7AA 2ACZB 1SIJA 4ZHPA 4ZHOA 5AUKA 1OQQA 5EE1A 1TYGB 2BS3B 1JWAD 2MJ3A 1RYJA 3AE8B 3SFEB 3AN1A 1N63A 1N62A 2PIAA 3NVYA 2WQYB 1FXAA 1FRRA 2MJDA 1ROEA 4USAA 1JQ4A 1N61A 1QLBB 1J7CA 1DOXA 1TKYA 1T3QA 1FIQA 2JX5A 2PVOD 4JWSC 1GT8A 3AEDB 1ZP0B 1VLBA 1XO3A 1SB3C 1TJEA 3DWMA 5G5GA 2KAJA 1WYGA 1PDXA 3KWLA 1GTEA 1ZOYB 2M19A 3NS1A 3P1MA 5AUIA 1QF6A 4JX1C 1DOIA 1L6UA 1L6VA 2WDQB 2FBWB 1RWSA 3RPFC 4KX6B 5EE0A 3AEGB 1JALA 1XLPA 1FRDA 1WGKA 1FMAD 2CU3A 1F0ZA 2W3SA 4US9A 3W9CB 1I7HA 3AMZA 4P6VF 3AE4B 3ABVB 1AYFA 2EKIA 1JRPA 3AE5B 3AEFB 2W55A 2PVGC 3DWGC 3EUB2 3FC4A 3AE1B 3VRBB 2QJLA 2N0SB 4ITKA 1JWBD 2K5PA 2CJOA 3P4RB 3AM9A 3HRDD 4N58A 3VR8B 2WS3B 1R7SA 1VJKA 2Q5WD 1FFVA 3L4PA 4A9AA 1NENB 2QIEB 4WWMA 4C80A 2H88B 2PKOA 3ETRA 1QOBA 1SF0A 3AEBB 2WLBA 4HROA 1TKEA 2HTME 5MPOA 3VRAB 3AE6B 1RM6C
chains in the Genus database with same CATH superfamily
5JXVA 1KLGD 1KLUD 1YIWA 1GAQB 4FA6A 4MT5A 1N5WA 4E3CA 3EC8A 4W9KA 4GDLB 3KUZA 4ICUA 3APCA 4LJPB 2CHZA 3BYTB 4MM3A 1OGWA 2ZNVC 2DZJA 3RD2A 3KWVA 2L3ZA 4XX5A 3UF8A 2A5UA 1D5MC 3CIRB 3FILB 3PZ8A 1WRIA 4N9F4 1UNSA 1P7EA 2O2VA 3U2SC 1VZ8A 3VDZA 2CS4A 1I35A 1OFFA 2BQQA 2DAJA 1U4AA 4E74A 3UIOB 1G6JA 3N32A 2R2OA 4K1RB 3VUYA 1J7AA 2PTLA 3ECIA 4A3PA 4K7WA 2K6QA 1JQ4A 4GXBA 3J9CA 4LNOA 4GLSC 3Q6BA 1ZP0B 4RFBA 4ZYSA 3UQBA 2RR9A 4GGQA 5G5GA 3CF6E 1ZOYB 3O13A 1F77A 4BKGA 3HIZA 5JHAA 4AJYB 3AEGB 1TS5A 2VH2A 2V3PA 1NI2A 5G2NA 1WGDA 2D3AA 3EUB2 4G0NB 3A9KB 1WM2A 2BF8B 3HRDD 1T0RC 4KKJA 3VVWB 3A4SC 1C3TA 2LUEA 2X8XX 1L5PA 1SJHD 2G4SA 3OLMD 1Y8RC 4IWOA 2KQ4X 3IT4B 4OVUA 1AW7A 4GB9A 3UQAA 1PFDA 4IDIA 3DHGC 4MH0E 2N7JA 2XBBC 4YWGG 3HM3A 3MTNB 4BBNF 2JU6X 2QEJC 1QT9A 2V4IB 1VDVA 3QJZA 4RM9A 2RDGA 3I3TB 1V81A 2G45B 2WU5B 4XDCA 4ZRIA 4LK0M 3EECA 2GI9A 3P63A 2ONQA 1SE4A 1XD3B 3NHEB 4JE3B 4EKUA 1A5RA 2JWZA 5TR5A 3N30A 4WAAA 1F2RI 1FD6A 2G1EA 4TV3A 1L0YB 2IO1B 1WX7A 5C3JB 2D3CA 2KWCA 1TT5B 1E7VA 2IZVB 1TY0A 1D4BA 3T3NA 3ZDTA 3ZTDA 2PIAA 2KXJA 2WXIA 2KQ7A 1F2RC 2N9LA 5HHDG 2RD0A 3ML9A 1TJEA 4REZA 1WI0A 2ZW0A 2E6XA 2EMSA 2JPHA 1D5XC 3ZQ4A 1WE6A 2W3SA 3ZUNA 1V49A 3DWGC 2INCC 1BT0A 2AQ1B 4WIPA 1WZ3A 1BMLC 2HDEA 2XNAC 3H7PB 1TIFA 3AEBB 2WLBA 1EU3A 1RM6C 3P2BA 5IAAC 1YD8U 1EUVB 1SXTA 2KN5A 2KOXA 1WIAA 2N9XA 2A4ZA 1C4CA 3VR9B 1E8WA 5HI1A 2BGFA 1IYFA 5HKHA 2LJIA 4GSWA 4DK5A 3WAOA 4A3OA 1JCKB 4YSYB 1TS3A 4NQKE 1FXTB 4L23A 1N60A 4YTPB 3K9PB 4KSKC 1UWXA 2K3UA 3H1UA 3QK0A 2RMMA 4PS3A 4NAMA 4CHKA 2LGDA 3B08A 5GMVA 2ZPYA 1NYRA 3LJ3A 4FHKA 5CX3A 2K9XA 1GC7A 2JWUA 3IXSA 3V3XA 1SIFA 4W9GA 4J6IA 4DWFA 1IP9A 1CZPA 2LHDA 1N5XA 2XK5A 3W5UB 1YNTE 2MSED 3V05A 4JL9A 4IM3A 2J42A 2ASQA 2DAFA 3PZ7A 1QLBB 3QAQA 4NNJB 1YN3A 3PHWB 5FKAC 1UD7A 3ZW3A 1C78A 3NS1A 3UGBB 4BBNC 3Q3MC 1DOIA 4IM2A 4M8NA 2M0XA 2ZPNA 4WAFA 1JALA 4DQOC 2WXLA 2CU3A 3RNFC 2DENB 1AYFA 3RN9C 3KW5B 1WXVA 2RDHA 2MLBA 4AWJA 4A9AA 2GBNA 1QOBA 1SE2A 4DHZB 4FJZA 4URKA 1I4XA 2KLCA 3NRZA 3NJTA 1UELA 1EF1A 4DDGD 4BOZB 3RZWC 2L05A 3A33B 4AJWA 3EFCA 1TS4A 3LB8C 4DXGA 2GBRA 5IKCM 3BYYB 4K7SA 4IC7B 1Z5SB 3TSSA 1I4RA 2C60A 3BVMA 2IO0B 3NVVA 3RNCC 4LNFA 3AEAB 1MJDA 4NJ6A 2VRRB 4UDUC 3LXFA 1YQBA 2EMTA 3H7SA 2G4DB 1FNUA 1F1HA 1VZ7A 2LUMA 4KKIA 1XXGA 2M17A 2R61A 1YJJA 4YSXB 4C4VA 2NMQA 5C2TB 4NAWB 3R66C 4P1CC 4ZOHC 2NPTA 1ZUD2 3NZSA 2NCNA 1E6EB 1OEYA 2L83A 3ZNGC 1XEEA 2FIFA 3KUCB 4AS1A 3BINA 1FXIA 2KJRA 1T5XD 4HPMB 1E8ZA 1KF6B 2WXMA 2LVPA 4PS7A 1TTNA 3NZUA 5AUKA 4M00A 3AN1A 3TBLD 3VAWA 4RF0A 2N7EA 3QQ8B 1XCQL 1C4PA 3GOEA 1J8CA 1XO3A 1WXMA 4B0MA 1Z2MA 1R4NB 4YL8A 2KWDA 1V9JA 1T0QC 2BTEA 2M1MA 4IM0A 4WWNA 1UGJA 2PEAA 2KDIA 2K25A 3TUOA 2B3AA 3ZRCA 2DYOA 2KJ6A 2MP2A 2W55A 3R2IA 3DBRB 2N0SB 4BVUC 2BWFA 3L4PA 2D11A 4C80A 2V3SA 3Q3JA 1DYQA 5J17A 1SBBB 4EZJA 2IGDA 5DCNA 2ZVNA 2GLSA 2BB5A 3H9DA 1ZPSA 3AEEB 1L7YA 1TS2A 1OEYJ 3R7QA 4OHJA 4RGNA 1WRDB 1YN4A 4I6PA 3AE3B 1HE8A 4GU2A 4OZCA 2L76A 5BYRA 5D3IB 4RF1A 2FE8A 2IO2B 2LEKA 3ALBA 3L0WB 4WJOA 1NVID 3ZYYX 2QC8A 2VZKD 1GOZA 2KMMA 1WXQA 3UI3A 5JZEB 3OJ4B 3C8YA 2LD9A 2MBBB 1I4QA 2K8CA 2C5LC 1RFKA 3BIID 1FO4A 4ZRKA 5BMHA 4I6LB 1ZKHA 3TL5A 1XLQA 4D2KA 3N1XC 2AL3A 5AZGA 4AQ7A 1JWSD 2LMCA 2OOBB 4J3OD 2BYEA 3L16A 4K7UA 3RFZB 1HXYD 4HCNB 4HKZE 4ARCA 3ZVVA 1FIQA 2KX0A 1HTQA 2JX5A 3W2DA 1SB3C 2INNE 3T8MA 1SSNA 2LI5A 2KZRA 1YX5B 2KAJA 4W9DA 1EF5A 4EEWA 3AXCA 3VHTC 2WDQB 3U7ZA 4F7ZA 1UF0A 3E9SA 2VZKB 1WJUA 2EKIA 3ABVB 1Q10A 3AEFB 4XWWA 4HKQA 2O6VD 3PT2B 4W9HA 2PE9A 5LXIB 1L4ZB 1SE9A 3KYDD 1NENB 5LXHA 2SEBD 1L0XB 4HK2A 4S17A 5MPOA 1AARA 1IBXB 2JF5A 4FULA 5E6JA 4YSZB 4M01A 4KGTA 3ZTCA 4KIKB 1ZE3D 1C4AA 2BBCA 5KHOA 3L54A 4JIOU 3WCQA 5G55A 1S1QB 1I4HA 2MBOA 2LVQA 1J7BA 2W3RA 1QOGA 4KSLC 3RCZA 2MW5A 4W9CA 4IG7B 1PUTA 1JWMD 2WHIA 2AYOB 2J0JA 2DYBA 2KWUB 5IP4D 3W1SA 2GOWA 1KJTA 1WXSA 2O6VB 1I4GA 2FNJB 3JVZX 2J53A 3P4QB 4ANWA 1ACCA 2DWQA 2DBYA 3B9JA 3V60A 2GB1A 4OZBA 2LGSA 1KM7A 5IA7A 3L10B 1JWAD 2WQYB 5CTRC 1JWUD 1N61A 1V5OA 2KTRB 3RYTA 4TKNA 4CYEA 3WAMA 3O65B 4KX6B 3SD5A 4DXAB 4P6VF 2MEKA 2JXXA 2QJLA 2OJRA 2HE7A 5CHVC 1VJKA 2WXPA 1WJNA 1WM3A 2WNMA 5BYQA 2V4LA 3R3MA 3W1SC 2ZJDA 3N20C 2NVUI 4L2YA 4LJOB 4NPNA 1OQYA 3WA0A 3VH4B 1FNWA 2KKCA 2I1JA 2LWPA 1MG4A 1Q1OA 3FAHA 1B9RA 4KGSA 2NBUA 2KANA 4DXFA 4GN1A 4TQ1A 2ZEQA 1WJ4A 1QOAA 1N6ZA 2QHOA 1LFDA 3KYCD 4F1SA 2KWVB 2BS2B 1K8RB 2LXCA 4K81A 3OJ3A 4JLCA 3CWIA 3RT3B 4MDKE 2BW2A 4W9EA 3ZKJC 3Q2AC 3A1QB 4MJSA 1P98A 4M0WB 2KACA 1KH0A 3W5VB 2V0GA 1GPXA 1YMHE 1AWDA 3ZJUA 4QAYA 4BKSA 3WIMA 3VH3B 1V1PA 4JWSC 3SFEB 2WXFA 3NVYA 2KYWA 3Q8CA 2BYTA 4ICVA 4USAA 4M02A 4RGTA 1VLBA 2MCNB 2N1VA 3KWLA 2WXGA 3OAWA 1D6EC 1PGXA 5CHWA 5AUIA 3VXWA 1WR1A 1CK1A 1M94A 2K39A 1XLPA 2ZCCA 1WE7A 1I7HA 1J19A 2KDEB 4XC2A 3AE4B 2PE6B 4NJ7A 2LFIA 3ML8A 2MHJA 2WS3B 4KDIC 1R4MB 1LM8B 2DHZA 2AQ3B 2YEPB 4K3CA 1KFYB 3V6EB 3IFWB 2K8HA 3P42A 5E6PA 4FHJA 2KFKA 4RMAA 1QILA 4C7YA 2L8JA 1KOTA 3Q8FA 2NS5A 4ACFA 3A9JB 3PHXB 1FEHA 1QOFA 2MBHA 2WXOA 4EE2A 4FJYA 3AE7B 2MWSB 2BWES 2INPE 1VD2A 4PYUA 4AUQC 2E3TA 2KQSA 3VUWA 1L2NA 1XF5L 3H6NA 1UZXB 4IUMB 1R4NI 3DHIC 3PS6A 1E5WA 1MPEA 2NR2A 3DVGY 2CKHB 1IGDA 3QCAA 4YXDB 2D3BA 1E8YA 1E8XA 1SGHA 1WSPA 2DZKA 3DBHI 5LNK1 3E56A 1KTKA 3KUDB 3SEBA 3GZNI 3DBRI 4JWUC 4TMAB 1UBQA 1TYGB 4MM3B 3RNGC 2PPHA 1RYJA 1FXAA 1WX8A 3FKYA 4GDKA 2OEDA 5C23A 2AEHA 1JRUA 3WALA 3DVNU 5JHBA 3P1MA 5T8IA 2WDTB 3JSVA 1FRDA 4KDLB 1F0ZA 3W9CB 2J7QB 3QIJA 4PT5A 4ANVA 2O2VB 4FLHA 4HVBA 4MSMB 4GOCA 1JWBD 2NBVB 1Q0WB 3EGRA 4N58A 2IDYA 2FUG1 1YN5A 1LXDA 3I57A 2PW9A 4EOYA 4LCDE 3TEZA 2FCMA 5E6OA 4FN2A 5CHFA 2WX0A 3M63B 2ZW1A 2MA9B 3AB5A 1WH3A 4FJVB 3R8BA 2K1FA 3RUIB 1BXTA 2HJ8A 1V5TA 2H89B 2BKRB 4XGAB 4DHJD 3DVGX 4MGIE 2QSDA 1K51A 4LDTD 2KLGA 2L52A 3MHSD 3CSFA 1M4VA 3DHHC 4WQOB 1WMHA 2D2QA 3RNEC 3MHZA 4TQ0A 1Q5WB 3N3KB 1DOYA 4IW0A 4FADA 3H8HA 5AZHA 3U4EG 4HPPA 3DCGA 4N6EB 3ZLZA 3RNBC 1L4DB 1UWMA 3CMMB 4FXCA 3Q3NC 5BO4B 4M8MA 1A70A 1EWYC 2V3NA 3I63C 1E7PB 2N1WA 3ZNHB 4P1BC 3ZIMA 3BVZA 3N1YC 1WWTA 4HJGE 2N7DA 1WGGA 3X0WA 4FBJB 2LGYA 2QMTA 3VUXA 4LNNA 2RPQA 5EE1A 2XN9C 3ZJVA 3W1YA 3DOWA 3HHMA 3AU5A 4H2AA 2QILA 4W9JA 3NUHB 3TCAA 4GDLA 1WR6E 4RGOS 4DBGA 3NG0A 1GTEA 3VTVA 2Y5PA 1ET6A 4BZAA 1XQQA 3FILA 4LDTB 3S2AA 2FCNA 1D5ZC 1D3ZA 3MJWA 2Y5BB 2IYDB 2ZVOA 2L1AA 2WGSA 4HWIB 1I4PA 2PVGC 3VRBB 3A4RA 4O1NA 2CJOA 1RRBA 2RPVA 1JMLA 1Y56A 5DPRA 4W9FA 3PGEA 1P9DU 1T0YA 3VTUA 4OZAA 3VRAB 3AE6B 1WGRA 3PLVA 3DDCB 5FR3A 5D3DA 1TZOA 1WX9A 1RAXA 1IPGA 1CQVA 2BB6A 1TGZB 5KHQA 1PGAA 3U52E 2J0MA 1C77A 1EU4A 4HCPB 2L00B 3BZDB 1RLFA 1NYQA 1F9JA 2BPSA 1HEZE 1OQRA 1TY2A 4MGZE 2K22A 3ONSA 4NQLB 3PO0A 2ZZPB 4MACA 1GB1A 2W9NA 2IO3B 1F52A 3JYUA 3QX1A 5H92C 4PK1A 3L13A 3ZDMC 1C1YB 1XLNA 2LJ5A 2JSVX 4LLGM 4BOSC 1V2YA 2BT6A 3DBLB 4A6QA 3ZRFA 1UH6A 5J18A 3A9KA 1YJIA 2L0TA 2Y5CA 4P7IA 5DPWA 3NVZA 2JRIB 2LRWA 1FM0D 3MJ5A 3B2FA 4XDDA 1EWCA 4RCOA 2DZMA 1ROEA 2I38A 3OG5A 3NS8A 3DWMA 4AP4C 3Q8EA 2LGXA 4JGHB 2LGIA 1AN8A 1RWSA 3GB1A 5EE0A 4OW0A 1VRAB 4US9A 5L83A 2BYVE 1CMXB 3TMPB 2K5PA 1XCTL 2JT4B 2M8SA 4C00A 3OWEB 2QCZA 3QA8A 2XK5B 4DDID 1GG3A 2OJWA 1P3QU 1MHXA 4GIVA 1EM7A 2K0PA 3U7DA 3L17A 4OVVA 4CQNA 2WXJA 1YQ4B 3LYYA 2IPKD 4WJPA 1J0GA 1JROA 3APDA 4HXDA 4X57B 4ZRJA 3JW0X 4HRSA 3V61A 2D5GA 2WWZA 2IGHA 1FNVA 3Q3OC 2KX3A 3IG3A 2DYMA 2FIDA 3EHVA 1STEA 3AU4A 3GP7A 2GMIC 2SAKA 4A90A 3KH0A 4W9LA 4B0EA 1FCCC 2JZZA 4RGMA 5IN7A 2UYZB 3PZDA 2LHEA 3IAS1 2TSSA 3M62B 3H7PA 4S0RA 3KVFB 1NEKB 1VCBA 3AE9B 2WXHA 3AULA 4G11A 4ZHOA 2Z8LA 1OQQA 3AE8B 2GBJA 1FRRA 4KZ0A 3V62A 4EZKA 2FCSA 1WYGA 2XEWA 1QF6A 2CR5A 2X38A 1L6VA 4C4VB 4TUUA 3R7RA 2NPTB 1YJ1A 5JH5C 3PRPB 4MSQB 3T3OA 1JRPA 3AE5B 1ZDVA 4AOFA 2V9HA 1RFAA 3WAPA 4HPLB 5BYSA 2G9HD 2J0KA 1NBFC 3B2GA 4OVZA 1GC6A 1WGYA 2BKFA 3ZGZA 2CJNA 2BVCA 3V6CB 2RGFA 1S3SG 5DPTA 1V86A 4BKTA 4NY0A 3PRMB 4HLEA 2D10A 2IY0B 2LXAA 5DPSA 4EUTA 2IGGA 5FK9C 1H7XA 2R2QA 2Z0DB 3AV8A 4XE0A 2PJHA 2MP2B 5FR6A 1IUEA 3URYA 3NVWA 4LNIA 4KGRA 3K9OB 1FFUA 3HVDA 3LDZE 4YT0B 4KV2A 4WURA 2JZPA 3SR6A 3PLUA 4ZYNA 1HTOA 3D32A 4B9KA 2ACZB 2N4FA 1VR9A 4HDOA 1N62A 3PREA 1J7CA 2Y3AA 4JQWC 1BUIC 4MGYE 3RMKC 3ZNID 2FUHB 2PVOD 1GT8A 5LLIA 5EDSA 2K8BA 4BAXA 1UGMA 1SEBD 1ZDXA 2JYEA 2CHXA 3AM9A 2KN4A 3TEXA 4NAWA 3VR8B 4WJQA 1V80A 3TIXA 2QIEB 1C9FA 2HTME 2PLPA 1MHHE 3ZXRA 1ESFA 1GNUA 3RI7C 1WY8A 3TJPA 1V97A 1K50A 4IWPA 2FCQA 3P4SB 4G50A 5J2RA 2NTSA 1XLOA 2OHFA 4N59A 4ZRPA 4WQMA 3I9V1 2M56B 2JXTA 2M4NA 4YTNB 2ZNVB 1SJED 4XWTA 2DLBA 1PGBA 2WDRB 2JQRB 3NY5A 2KVRA 2FAZA 4A8XC 4I6NB 3CF4A 2MBQA 1ISNA 2KDMA 2IJ0A 4EZLA 2WDVB 3HVZA 2AX5A 3QC8B 1QQRA 1LO5D 3L08A 2KK8A 2INDC 3BWUD 4BFRA 4C7ZA 1C79A 3Q8AA 2KTFA 2BS3B 2MJ3A 2HJ1A 2ZCBA 2D07B 1H8CA 3QARA 3AEDB 2KVZA 3IVFA 2C7NB 1PDXA 3KQ4A 1V6EA 1NDDA 2WYQA 5AEKB 5IO9A 3RPFC 3PRZA 3C19A 5E6NA 3BVGA 3APFA 3KLSX 1ZGUB 1ZW7A 3DQVA 1PQSA 2KC2A 2JUOA 1WF9A 3FC4A 4MEMA 4ITKA 3P4RB 5I4DA 5IOIA 3VQIA 1FFVA 4MGKE 1E7UA 1P7FA 2YLMA 2C7HA 3IBEA 3PVLA 3DBLI 4C56C 5EE9A 4IKGA 4WH4A 1E9MA 3Q8BA 2JYTA 1MVKA 3GE8C 4RNAA 4DHZE 2ICIA 3PV1A 3TEYA 1MFWA 2MH7A 3SFDB 2REXA 1V8CA 1P0RA 1HZ5A 2C7MB 3HUIA 1YQ3B 3AH7A 4A20A 1ZXIA 1WGHA 2KC1A 2KD0A 2RSUA 1GTHA 3UIPB 4P16A 3T9LA 2W54A 1OTRB 2JRHA 2L0FA 2DNFA 4L1BA 4G3XB 5GXGB 1B1ZA 3WANA 4ANXA 4BKSD 4YTMB 3BK2A 2MJEA 3EFUA 2LRUA 2L32A 3RZFA 1TBEA 4XZ4A 3I5JC 1IBXA 5HFYA 1VZ6A 2DX5B 1N63A 3QWZB 2MJDA 4KIKA 3N9YC 1TKYA 2YVCA 2NBWB 2LZ6A 3NZ3A 3NOBA 2M19A 3M95A 4XYCA 3GE3C 4JX1C 2JZ3B 1SE3A 1GJZA 4B95A 2N9KA 3AMZA 3DPDA 2M0AA 4MJSB 3BK1A 1WYWB 5D2MB 2ON8A 2CHWA 1R7SA 2Q5WD 2O6VA 4B6WA 1ET9A 4DHJB 1ENFA 1V1PB 3PSEB 1FPYA 1KRHA 5D6JB 3Q69A 4HDQA 2LVOA 3GS2A 1PYWD 2C9WB 2WU2B 3VFKA 5TSSA 3P4PB 4KVGB 1YX6B 2KDBA 3M3JA 2JY6A 2EKEC 2WP9B 2KTRA 1JW9D 2KT7A 2BS4B 1L0VB 1YOVB 1ZXHA 2DZIA 2UU7A 4US8A 4TSSA 1CJEA 4IOIE 3VTWA 1P1AA 3MP9A 4K3BA 3N1ZC 3Q14C 1UBIA 1IGCA 4R3DA 3AE2B 3TEWA 1NI3A 2KDFB 4WWPA 1TKGA 1HA5A 3DVNV 3DBSA 3RNAC 4HEA1 1QZEA 3PTFC 4RH6A 2QDFA 3AECB 4WJNA 2J52A 2I1KA 2KFKB 5H8YE 4MH8A 2D3GA 2YEPF 3X23A 3DBHB 3ENEA 2AQ2B 1T0SC 4ANUA 2WXKA 3GZNB 1DOXA 1T3QA 3HM6X 4ARIA 4IWQA 2WXQA 4PYZA 4EFOA 4E71A 1GB4A 2KJHB 4CO7A 3C0RB 4Q2JA 2Z59B 3B1LX 2IY1B 2WXNA 1LQBA 1V1OA 2KMAA 1L6UA 2FBWB 1E90A 2RDBC 2EELA 3IHPC 4PS8A 1WGKA 5BMGA 4F8CB 2W82A 2IBIB 2MX2A 3AI5A 3MC0B 3A1QA 1LGRA 1XT9B 4JPSA 4WWMA 2H88B 4A55A 3MC8A 1TKEA 4M0WA 2AWTA 1WZ0A 2UWQA 3EA6A 3PPAA 2KFJA 4LTUA 3U8ZA 3MC9A 3ZXVA 3U30A 4II3B 5G5HA 4RM8A 2L7RA 1X1MA 4GDKB 1K52A 2PMVA 3QHTA 5EE3A 1C76A 1MG8A 5BMIA 2MBEA 2GRIA 3IT6B 3SDLC 3Q3FA 1HQRD 3JSVB 2HD5B 3RULA 2CU1A 4WWOA 1H4RA 4II2B 5D7GA 4ASWC 1WXAA 3ZNZB 2WX1A 1UUPA 2VH1A 5C1ZA 2KHWB 3UINB 3ZJTA 3HK0A 3BY4B 2BYFA 3SU8X 1GUAB 1I42A 4GMVA 1WJ6A 1DGJA 1T6BX 3SHQA 3ZO5B 1E0ZA 2B76B 1H7WA 4KZCA 4ZDVA 3R2TA 4W9IA 1E10A 1SIJA 2J4XA 4ZHPA 5HG2A 1EO6A 3B0AA 2JVCA 2N9EB 4NJCA 4LNKA 1QKZA 2G3QB 3A9JA 5L95C 1WMHB 1HZ6A 2KMCA 3IAM1 2K6DB 1TZ1A 1FCLA 1K53A 1FMAD 1KLVA 2I2YA 5D94A 3MFGA 2NTTA 2GBMA 1R4MI 3AE1B 2MRPA 1WFYA 5AZFA 4HJKA 2N9PC 2HTHA 2WXRA 2Z0EB 3CSTA 2MQJA 4ZRQA 2V1YA 4MELA 4NZLB 2KO3A 2GBKA 2PKOA 3ETRA 1MI0A 1SF0A 2KNBA 4HROA 2AL6A 2LASA
chains in the Genus database with same CATH topology
5JXVA 2PW9A 1KLGD 3TEZA 1MHHE 1KLUD 1GAQB 1ESFA 1SBBB 4MT5A 2ZW1A 1N5WA 3AB5A 1V97A 1K50A 2IGDA 3R8BA 3P4SB 4GDLB 2BB5A 2NTSA 1ZPSA 3AEEB 1BXTA 1TS2A 3BYTB 1XLOA 2OHFA 4OHJA 2H89B 3KWVA 4N59A 4RGNA 4ZRPA 1YN4A 3I9V1 4WQMA 2QSDA 1D5MC 3AE3B 2M56B 1K51A 3CIRB 2JXTA 3FILB 4YTNB 4OZCA 5BYRA 5D3IB 4RF1A 1SJED 2FE8A 2L52A 4XWTA 2LEKA 3PZ8A 2DLBA 1M4VA 1PGBA 2WDRB 1NVID 3ZYYX 2JQRB 3MHZA 4TQ0A 2VZKD 1WRIA 1GOZA 1DOYA 2KMMA 1WXQA 3H8HA 3UI3A 3C8YA 3U4EG 4A8XC 1UNSA 1I4QA 4N6EB 1P7EA 1RFKA 3CF4A 1L4DB 1UWMA 1VZ8A 3BIID 3U2SC 4FXCA 1FO4A 5BMHA 2KDMA 1A70A 1EWYC 2IJ0A 2WDVB 1OFFA 3HVZA 2AX5A 2V3NA 1XLQA 4D2KA 1QQRA 1E7PB 1LO5D 4AQ7A 3BVZA 1JWSD 2LMCA 1WWTA 4J3OD 3BWUD 4HJGE 4C7ZA 1C79A 1J7AA 2PTLA 2QMTA 3Q8AA 5EE1A 3RFZB 2BS3B 1HXYD 2MJ3A 2XN9C 3ZJVA 1JQ4A 4H2AA 4HKZE 2QILA 3J9CA 4ARCA 3NUHB 4GLSC 1FIQA 2JX5A 3AEDB 1ZP0B 3W2DA 4RFBA 1SB3C 2INNE 1SSNA 4ZYSA 4RGOS 5G5GA 2KAJA 1PDXA 3KQ4A 1GTEA 1ZOYB 3O13A 1F77A 2Y5PA 1ET6A 2WDQB 3RPFC 3FILA 3U7ZA 3AEGB 3E9SA 1TS5A 3BVGA 3KLSX 1D5ZC 2V3PA 2VZKB 2L1AA 2EKIA 3ABVB 3EUB2 3FC4A 1Q10A 3AEFB 4XWWA 4HKQA 1I4PA 2PVGC 3VRBB 4ITKA 4O1NA 3HRDD 2CJOA 3P4RB 5I4DA 2RPVA 1JMLA 1Y56A 1L4ZB 3VQIA 4KKJA 1FFVA 1NENB 2SEBD 1L0XB 1P7FA 4OZAA 5MPOA 3VRAB 3AE6B 1IBXB 1L5PA 1SJHD 5E6JA 5FR3A 4YSZB 4KGTA 5D3DA 4C56C 1TZOA 2KQ4X 3IT4B 5EE9A 1AW7A 4IKGA 1ZE3D 1PFDA 4IDIA 4WH4A 4YWGG 1C4AA 1CQVA 2BBCA 1E9MA 2N7JA 3Q8BA 3WCQA 2JYTA 2BB6A 1MVKA 1I4HA 4RNAA 1PGAA 2ICIA 3U52E 2JU6X 1C77A 1EU4A 2QEJC 1QT9A 1J7BA 2MH7A 2W3RA 3TEYA 2V4IB 3BZDB 1QOGA 3SFDB 1VDVA 1NYQA 2RDGA 1V8CA 1HEZE 1HZ5A 1OQRA 1TY2A 3HUIA 2K22A 2WU5B 1YQ3B 3AH7A 3PO0A 1PUTA 1JWMD 4LK0M 1ZXIA 4MACA 4XDCA 1GB1A 2GI9A 3P63A 2ONQA 5H92C 1SE4A 1XLNA 1GTHA 4JE3B 2JSVX 4LLGM 3W1SA 4P16A 2W54A 2BT6A 4A6QA 1F2RI 4L1BA 1FD6A 2G1EA 5GXGB 1B1ZA 1I4GA 1L0YB 5C3JB 1YJIA 2Y5CA 4YTMB 3BK2A 2J53A 2MJEA 3NVZA 3P4QB 2L32A 1FM0D 3MJ5A 3B2FA 4XDDA 1ACCA 2DWQA 2DBYA 3B9JA 2GB1A 4OZBA 1IBXA 1EWCA 1TY0A 5HFYA 1VZ6A 1D4BA 1JWAD 3T3NA 4RCOA 1N63A 2PIAA 2WQYB 2WXIA 2MJDA 1ROEA 1JWUD 1N61A 3N9YC 2I38A 1TKYA 1F2RC 2N9LA 5HHDG 1TJEA 3DWMA 4REZA 3NZ3A 2ZW0A 2E6XA 3Q8EA 2M19A 2LGIA 1AN8A 4JX1C 1D5XC 1SE3A 3ZQ4A 1RWSA 4KX6B 3GB1A 5EE0A 4OW0A 1VRAB 2N9KA 2W3SA 4US9A 3AMZA 4P6VF 2MEKA 3DWGC 2M0AA 2AQ1B 2QJLA 3BK1A 2K5PA 1XCTL 4WIPA 2ON8A 3OWEB 1BMLC 1R7SA 2HDEA 1VJKA 2Q5WD 2XNAC 2WXPA 5BYQA 2WNMA 1ET9A 3AEBB 2WLBA 1EU3A 1MHXA 1RM6C 1EM7A 2K0PA 4L2YA 1ENFA 1FNWA 1V1PB 4CQNA 1KRHA 1SXTA 3Q69A 2WXJA 3GS2A 1YQ4B 3LYYA 1C4CA 3VR9B 2IPKD 1PYWD 2WU2B 5HI1A 5TSSA 3FAHA 3P4PB 1B9RA 4KGSA 2LJIA 4DXFA 1JROA 4TQ1A 1JCKB 4YSYB 1TS3A 4L23A 4HRSA 2WP9B 1N60A 1QOAA 2D5GA 2IGHA 4YTPB 1JW9D 1FNVA 2BS4B 1L0VB 2BS2B 1UWXA 1ZXHA 2K3UA 2DYMA 2RMMA 3CWIA 4US8A 4TSSA 4NAMA 1STEA 1CJEA 4IOIE 2BW2A 3MP9A 1NYRA 3GP7A 4R3DA 1IGCA 3AE2B 3TEWA 1NI3A 2K9XA 2SAKA 2JWUA 4A90A 1TKGA 3IXSA 3V3XA 1HA5A 4B0EA 2KACA 1FCCC 1KH0A 3W5VB 4RGMA 2V0GA 1GPXA 1YMHE 1AWDA 1CZPA 3ZJUA 2LHDA 1N5XA 4HEA1 2LHEA 4RH6A 3IAS1 2TSSA 3AECB 2J52A 1NEKB 3W5UB 3AE9B 5H8YE 4MH8A 2WXHA 1YNTE 2YEPF 4ZHOA 2Z8LA 1OQQA 1V1PA 3V05A 4JWSC 3AE8B 3SFEB 2AQ2B 2WXFA 3NVYA 2WXKA 1FRRA 2J42A 3Q8CA 4USAA 3PZ7A 2BYTA 1QLBB 1DOXA 1T3QA 4ARIA 1YN3A 4RGTA 2WXQA 5FKAC 1GB4A 1VLBA 4Q2JA 1C78A 2WXNA 1WYGA 3KWLA 2WXGA 3NS1A 1D6EC 1PGXA 5AUIA 1QF6A 1V1OA 2X38A 1DOIA 1L6UA 1L6VA 1CK1A 2FBWB 2EELA 4WAFA 4DQOC 1JALA 1XLPA 1WGKA 2WXLA 2CU3A 1I7HA 5BMGA 3T3OA 3AE4B 1AYFA 1JRPA 3AE5B 1ZDVA 2LFIA 2W82A 2RDHA 3MC0B 4JPSA 2WS3B 4A9AA 4WWMA 5BYSA 2G9HD 2H88B 4A55A 2AQ3B 1QOBA 1SE2A 1TKEA 1I4XA 4M0WA 2YEPB 3B2GA 3EA6A 4OVZA 1KFYB 3NRZA 4LTUA 3P42A 2CJNA 3ZGZA 1TS4A 5G5HA 3LB8C 4DXGA 1QILA 3BYYB 4GDKB 4C7YA 1K52A 2PMVA 3Q8FA 3TSSA 1I4RA 3BVMA 1FEHA 1QOFA 5EE3A 1C76A 5BMIA 3NVVA 2GRIA 3IT6B 3AEAB 2WXOA 4EE2A 1HQRD 4UDUC 2IGGA 3AE7B 3LXFA 5FK9C 2INPE 1H7XA 1FNUA 2E3TA 3AV8A 4XE0A 1VZ7A 2LUMA 4KKIA 1XXGA 2R61A 1YJJA 1XF5L 5D7GA 4YSXB 1IUEA 1UUPA 2NMQA 5C2TB 3NVWA 3URYA 4NAWB 4KGRA 4ZOHC 3ZJTA 1FFUA 1MPEA 3HVDA 1ZUD2 4YT0B 1IGDA 4WURA 2JZPA 1DGJA 1T6BX 3SR6A 1E6EB 4YXDB 2L83A 1E0ZA 1WSPA 1XEEA 5LNK1 3E56A 2B76B 1H7WA 4AS1A 1FXIA 1KTKA 1T5XD 1KF6B 3SEBA 2WXMA 3R2TA 4JWUC 1E10A 1SIJA 2ACZB 2J4XA 4TMAB 4ZHPA 5AUKA 5HG2A 1TYGB 1VR9A 3AN1A 4MM3B 1RYJA 1N62A 1FXAA 1J7CA 2Y3AA 4RF0A 1BUIC 2OEDA 1XCQL 1C4PA 4NJCA 1QKZA 2PVOD 1GT8A 1XO3A 4B0MA 2KWDA 1HZ6A 3IAM1 2BTEA 3P1MA 5T8IA 1FCLA 1UGJA 1SEBD 1K53A 1FRDA 1ZDXA 1FMAD 3TUOA 2I2YA 1F0ZA 3W9CB 3MFGA 2NTTA 4PT5A 2DYOA 2JYEA 2W55A 3AE1B 3R2IA 2N0SB 1JWBD 3AM9A 2KN4A 2WXRA 3EGRA 4N58A 3TEXA 4ZRQA 3VR8B 2IDYA 3L4PA 4C80A 4NZLB 2QIEB 2FUG1 1YN5A 2PKOA 3ETRA 1MI0A 1C9FA 1SF0A 3I57A 4HROA 2HTME 1DYQA 2PLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2G A;  1L5P A;  1KFY B;  3NRZ A;  4LTU A;  4YSZ B;  1GAQ B;  1KRH A;  2CJN A;  5EE9 A;  1N5W A;  5G5H A;  3AB5 A;  1V97 A;  3LB8 C;  1YQ4 B;  1PFD A;  4IDI A;  3VR9 B;  1E9M A;  3P4S B;  3WCQ A;  4C7Y A;  2WU2 B;  3FAH A;  3P4P B;  1B9R A;  3AEE B;  1JRO A;  1QOF A;  5EE3 A;  1XLO A;  2OHF A;  2H89 B;  4N59 A;  3NVV A;  4YSY B;  1QT9 A;  1J7B A;  3AEA B;  2MH7 A;  2W3R A;  4HRS A;  2WP9 B;  3SFD B;  1N60 A;  1NYQ A;  1QOA A;  1QOG A;  1VDV A;  3AE3 B;  2M56 B;  4WQM A;  3CIR B;  3AE7 B;  4YTP B;  1JW9 D;  1V8C A;  4YTN B;  3LXF A;  1H7X A;  2BS4 B;  1L0V B;  1OQR A;  3HUI A;  2BS2 B;  2K22 A;  2L52 A;  2E3T A;  2LEK A;  2WU5 B;  1YQ3 B;  3AH7 A;  3AV8 A;  1PUT A;  3PO0 A;  1ZXI A;  2WDR B;  1NVI D;  3ZYY X;  2JQR B;  3P63 A;  3CWI A;  1YJJ A;  4US8 A;  1WRI A;  1DOY A;  5H92 C;  4YSX B;  1CJE A;  2KMM A;  1WXQ A;  1XLN A;  1GTH A;  1IUE A;  1NYR A;  5C2T B;  3NVW A;  2W54 A;  3AE2 B;  4ZOH C;  1NI3 A;  4N6E B;  2BT6 A;  2K9X A;  1FFU A;  1RFK A;  3CF4 A;  3BII D;  1UWM A;  1TKG A;  1ZUD 2;  4FXC A;  4YT0 B;  2G1E A;  5GXG B;  1FO4 A;  1DGJ A;  3SR6 A;  1E6E B;  5C3J B;  1A70 A;  1EWY C;  4YXD B;  1YJI A;  2WDV B;  3W5V B;  2L83 A;  1OFF A;  1E0Z A;  3HVZ A;  2Y5C A;  4YTM B;  2AX5 A;  1GPX A;  1XLQ A;  1AWD A;  1CZP A;  1E7P B;  1N5X A;  2MJE A;  3NVZ A;  3P4Q B;  2B76 B;  1H7W A;  1FXI A;  3AEC B;  1FM0 D;  1KF6 B;  1WWT A;  3B2F A;  1NEK B;  2DBY A;  2DWQ A;  3B9J A;  4JWU C;  3AE9 B;  5H8Y E;  3W5U B;  4C7Z A;  1E10 A;  1J7A A;  2ACZ B;  1SIJ A;  4ZHP A;  4ZHO A;  5AUK A;  1OQQ A;  5EE1 A;  1TYG B;  2BS3 B;  1JWA D;  2MJ3 A;  1RYJ A;  3AE8 B;  3SFE B;  3AN1 A;  1N63 A;  1N62 A;  2PIA A;  3NVY A;  2WQY B;  1FXA A;  1FRR A;  2MJD A;  1ROE A;  4USA A;  1JQ4 A;  1N61 A;  1QLB B;  1J7C A;  1DOX A;  1TKY A;  1T3Q A;  1FIQ A;  2JX5 A;  2PVO D;  4JWS C;  1GT8 A;  3AED B;  1ZP0 B;  1VLB A;  1XO3 A;  1SB3 C;  1TJE A;  3DWM A;  5G5G A;  2KAJ A;  1WYG A;  1PDX A;  3KWL A;  1GTE A;  1ZOY B;  2M19 A;  3NS1 A;  3P1M A;  5AUI A;  1QF6 A;  4JX1 C;  1DOI A;  1L6U A;  1L6V A;  2WDQ B;  2FBW B;  1RWS A;  3RPF C;  4KX6 B;  5EE0 A;  3AEG B;  1JAL A;  1XLP A;  1FRD A;  1WGK A;  1FMA D;  2CU3 A;  1F0Z A;  2W3S A;  4US9 A;  3W9C B;  1I7H A;  3AMZ A;  4P6V F;  3AE4 B;  3ABV B;  1AYF A;  2EKI A;  1JRP A;  3AE5 B;  3AEF B;  2W55 A;  2PVG C;  3DWG C;  3EUB 2;  3FC4 A;  3AE1 B;  3VRB B;  2QJL A;  2N0S B;  4ITK A;  1JWB D;  2K5P A;  2CJO A;  3P4R B;  3AM9 A;  3HRD D;  4N58 A;  3VR8 B;  2WS3 B;  1R7S A;  1VJK A;  2Q5W D;  1FFV A;  3L4P A;  4A9A A;  1NEN B;  2QIE B;  4WWM A;  4C80 A;  2H88 B;  2PKO A;  3ETR A;  1QOB A;  1SF0 A;  3AEB B;  2WLB A;  4HRO A;  1TKE A;  2HTM E;  5MPO A;  3VRA B;  3AE6 B;  1RM6 C; 
#chains in the Genus database with same CATH topology
 5JXV A;  1KLG D;  1KLU D;  1YIW A;  1GAQ B;  4FA6 A;  4MT5 A;  1N5W A;  4E3C A;  3EC8 A;  4W9K A;  4GDL B;  3KUZ A;  4ICU A;  3APC A;  4LJP B;  2CHZ A;  3BYT B;  4MM3 A;  1OGW A;  2ZNV C;  2DZJ A;  3RD2 A;  3KWV A;  2L3Z A;  4XX5 A;  3UF8 A;  2A5U A;  1D5M C;  3CIR B;  3FIL B;  3PZ8 A;  1WRI A;  4N9F 4;  1UNS A;  1P7E A;  2O2V A;  3U2S C;  1VZ8 A;  3VDZ A;  2CS4 A;  1I35 A;  1OFF A;  2BQQ A;  2DAJ A;  1U4A A;  4E74 A;  3UIO B;  1G6J A;  3N32 A;  2R2O A;  4K1R B;  3VUY A;  1J7A A;  2PTL A;  3ECI A;  4A3P A;  4K7W A;  2K6Q A;  1JQ4 A;  4GXB A;  3J9C A;  4LNO A;  4GLS C;  3Q6B A;  1ZP0 B;  4RFB A;  4ZYS A;  3UQB A;  2RR9 A;  4GGQ A;  5G5G A;  3CF6 E;  1ZOY B;  3O13 A;  1F77 A;  4BKG A;  3HIZ A;  5JHA A;  4AJY B;  3AEG B;  1TS5 A;  2VH2 A;  2V3P A;  1NI2 A;  5G2N A;  1WGD A;  2D3A A;  3EUB 2;  4G0N B;  3A9K B;  1WM2 A;  2BF8 B;  3HRD D;  1T0R C;  4KKJ A;  3VVW B;  3A4S C;  1C3T A;  2LUE A;  2X8X X;  1L5P A;  1SJH D;  2G4S A;  3OLM D;  1Y8R C;  4IWO A;  2KQ4 X;  3IT4 B;  4OVU A;  1AW7 A;  4GB9 A;  3UQA A;  1PFD A;  4IDI A;  3DHG C;  4MH0 E;  2N7J A;  2XBB C;  4YWG G;  3HM3 A;  3MTN B;  4BBN F;  2JU6 X;  2QEJ C;  1QT9 A;  2V4I B;  1VDV A;  3QJZ A;  4RM9 A;  2RDG A;  3I3T B;  1V81 A;  2G45 B;  2WU5 B;  4XDC A;  4ZRI A;  4LK0 M;  3EEC A;  2GI9 A;  3P63 A;  2ONQ A;  1SE4 A;  1XD3 B;  3NHE B;  4JE3 B;  4EKU A;  1A5R A;  2JWZ A;  5TR5 A;  3N30 A;  4WAA A;  1F2R I;  1FD6 A;  2G1E A;  4TV3 A;  1L0Y B;  2IO1 B;  1WX7 A;  5C3J B;  2D3C A;  2KWC A;  1TT5 B;  1E7V A;  2IZV B;  1TY0 A;  1D4B A;  3T3N A;  3ZDT A;  3ZTD A;  2PIA A;  2KXJ A;  2WXI A;  2KQ7 A;  1F2R C;  2N9L A;  5HHD G;  2RD0 A;  3ML9 A;  1TJE A;  4REZ A;  1WI0 A;  2ZW0 A;  2E6X A;  2EMS A;  2JPH A;  1D5X C;  3ZQ4 A;  1WE6 A;  2W3S A;  3ZUN A;  1V49 A;  3DWG C;  2INC C;  1BT0 A;  2AQ1 B;  4WIP A;  1WZ3 A;  1BML C;  2HDE A;  2XNA C;  3H7P B;  1TIF A;  3AEB B;  2WLB A;  1EU3 A;  1RM6 C;  3P2B A;  5IAA C;  1YD8 U;  1EUV B;  1SXT A;  2KN5 A;  2KOX A;  1WIA A;  2N9X A;  2A4Z A;  1C4C A;  3VR9 B;  1E8W A;  5HI1 A;  2BGF A;  1IYF A;  5HKH A;  2LJI A;  4GSW A;  4DK5 A;  3WAO A;  4A3O A;  1JCK B;  4YSY B;  1TS3 A;  4NQK E;  1FXT B;  4L23 A;  1N60 A;  4YTP B;  3K9P B;  4KSK C;  1UWX A;  2K3U A;  3H1U A;  3QK0 A;  2RMM A;  4PS3 A;  4NAM A;  4CHK A;  2LGD A;  3B08 A;  5GMV A;  2ZPY A;  1NYR A;  3LJ3 A;  4FHK A;  5CX3 A;  2K9X A;  1GC7 A;  2JWU A;  3IXS A;  3V3X A;  1SIF A;  4W9G A;  4J6I A;  4DWF A;  1IP9 A;  1CZP A;  2LHD A;  1N5X A;  2XK5 A;  3W5U B;  1YNT E;  2MSE D;  3V05 A;  4JL9 A;  4IM3 A;  2J42 A;  2ASQ A;  2DAF A;  3PZ7 A;  1QLB B;  3QAQ A;  4NNJ B;  1YN3 A;  3PHW B;  5FKA C;  1UD7 A;  3ZW3 A;  1C78 A;  3NS1 A;  3UGB B;  4BBN C;  3Q3M C;  1DOI A;  4IM2 A;  4M8N A;  2M0X A;  2ZPN A;  4WAF A;  1JAL A;  4DQO C;  2WXL A;  2CU3 A;  3RNF C;  2DEN B;  1AYF A;  3RN9 C;  3KW5 B;  1WXV A;  2RDH A;  2MLB A;  4AWJ A;  4A9A A;  2GBN A;  1QOB A;  1SE2 A;  4DHZ B;  4FJZ A;  4URK A;  1I4X A;  2KLC A;  3NRZ A;  3NJT A;  1UEL A;  1EF1 A;  4DDG D;  4BOZ B;  3RZW C;  2L05 A;  3A33 B;  4AJW A;  3EFC A;  1TS4 A;  3LB8 C;  4DXG A;  2GBR A;  5IKC M;  3BYY B;  4K7S A;  4IC7 B;  1Z5S B;  3TSS A;  1I4R A;  2C60 A;  3BVM A;  2IO0 B;  3NVV A;  3RNC C;  4LNF A;  3AEA B;  1MJD A;  4NJ6 A;  2VRR B;  4UDU C;  3LXF A;  1YQB A;  2EMT A;  3H7S A;  2G4D B;  1FNU A;  1F1H A;  1VZ7 A;  2LUM A;  4KKI A;  1XXG A;  2M17 A;  2R61 A;  1YJJ A;  4YSX B;  4C4V A;  2NMQ A;  5C2T B;  4NAW B;  3R66 C;  4P1C C;  4ZOH C;  2NPT A;  1ZUD 2;  3NZS A;  2NCN A;  1E6E B;  1OEY A;  2L83 A;  3ZNG C;  1XEE A;  2FIF A;  3KUC B;  4AS1 A;  3BIN A;  1FXI A;  2KJR A;  1T5X D;  4HPM B;  1E8Z A;  1KF6 B;  2WXM A;  2LVP A;  4PS7 A;  1TTN A;  3NZU A;  5AUK A;  4M00 A;  3AN1 A;  3TBL D;  3VAW A;  4RF0 A;  2N7E A;  3QQ8 B;  1XCQ L;  1C4P A;  3GOE A;  1J8C A;  1XO3 A;  1WXM A;  4B0M A;  1Z2M A;  1R4N B;  4YL8 A;  2KWD A;  1V9J A;  1T0Q C;  2BTE A;  2M1M A;  4IM0 A;  4WWN A;  1UGJ A;  2PEA A;  2KDI A;  2K25 A;  3TUO A;  2B3A A;  3ZRC A;  2DYO A;  2KJ6 A;  2MP2 A;  2W55 A;  3R2I A;  3DBR B;  2N0S B;  4BVU C;  2BWF A;  3L4P A;  2D11 A;  4C80 A;  2V3S A;  3Q3J A;  1DYQ A;  5J17 A;  1SBB B;  4EZJ A;  2IGD A;  5DCN A;  2ZVN A;  2GLS A;  2BB5 A;  3H9D A;  1ZPS A;  3AEE B;  1L7Y A;  1TS2 A;  1OEY J;  3R7Q A;  4OHJ A;  4RGN A;  1WRD B;  1YN4 A;  4I6P A;  3AE3 B;  1HE8 A;  4GU2 A;  4OZC A;  2L76 A;  5BYR A;  5D3I B;  4RF1 A;  2FE8 A;  2IO2 B;  2LEK A;  3ALB A;  3L0W B;  4WJO A;  1NVI D;  3ZYY X;  2QC8 A;  2VZK D;  1GOZ A;  2KMM A;  1WXQ A;  3UI3 A;  5JZE B;  3OJ4 B;  3C8Y A;  2LD9 A;  2MBB B;  1I4Q A;  2K8C A;  2C5L C;  1RFK A;  3BII D;  1FO4 A;  4ZRK A;  5BMH A;  4I6L B;  1ZKH A;  3TL5 A;  1XLQ A;  4D2K A;  3N1X C;  2AL3 A;  5AZG A;  4AQ7 A;  1JWS D;  2LMC A;  2OOB B;  4J3O D;  2BYE A;  3L16 A;  4K7U A;  3RFZ B;  1HXY D;  4HCN B;  4HKZ E;  4ARC A;  3ZVV A;  1FIQ A;  2KX0 A;  1HTQ A;  2JX5 A;  3W2D A;  1SB3 C;  2INN E;  3T8M A;  1SSN A;  2LI5 A;  2KZR A;  1YX5 B;  2KAJ A;  4W9D A;  1EF5 A;  4EEW A;  3AXC A;  3VHT C;  2WDQ B;  3U7Z A;  4F7Z A;  1UF0 A;  3E9S A;  2VZK B;  1WJU A;  2EKI A;  3ABV B;  1Q10 A;  3AEF B;  4XWW A;  4HKQ A;  2O6V D;  3PT2 B;  4W9H A;  2PE9 A;  5LXI B;  1L4Z B;  1SE9 A;  3KYD D;  1NEN B;  5LXH A;  2SEB D;  1L0X B;  4HK2 A;  4S17 A;  5MPO A;  1AAR A;  1IBX B;  2JF5 A;  4FUL A;  5E6J A;  4YSZ B;  4M01 A;  4KGT A;  3ZTC A;  4KIK B;  1ZE3 D;  1C4A A;  2BBC A;  5KHO A;  3L54 A;  4JIO U;  3WCQ A;  5G55 A;  1S1Q B;  1I4H A;  2MBO A;  2LVQ A;  1J7B A;  2W3R A;  1QOG A;  4KSL C;  3RCZ A;  2MW5 A;  4W9C A;  4IG7 B;  1PUT A;  1JWM D;  2WHI A;  2AYO B;  2J0J A;  2DYB A;  2KWU B;  5IP4 D;  3W1S A;  2GOW A;  1KJT A;  1WXS A;  2O6V B;  1I4G A;  2FNJ B;  3JVZ X;  2J53 A;  3P4Q B;  4ANW A;  1ACC A;  2DWQ A;  2DBY A;  3B9J A;  3V60 A;  2GB1 A;  4OZB A;  2LGS A;  1KM7 A;  5IA7 A;  3L10 B;  1JWA D;  2WQY B;  5CTR C;  1JWU D;  1N61 A;  1V5O A;  2KTR B;  3RYT A;  4TKN A;  4CYE A;  3WAM A;  3O65 B;  4KX6 B;  3SD5 A;  4DXA B;  4P6V F;  2MEK A;  2JXX A;  2QJL A;  2OJR A;  2HE7 A;  5CHV C;  1VJK A;  2WXP A;  1WJN A;  1WM3 A;  2WNM A;  5BYQ A;  2V4L A;  3R3M A;  3W1S C;  2ZJD A;  3N20 C;  2NVU I;  4L2Y A;  4LJO B;  4NPN A;  1OQY A;  3WA0 A;  3VH4 B;  1FNW A;  2KKC A;  2I1J A;  2LWP A;  1MG4 A;  1Q1O A;  3FAH A;  1B9R A;  4KGS A;  2NBU A;  2KAN A;  4DXF A;  4GN1 A;  4TQ1 A;  2ZEQ A;  1WJ4 A;  1QOA A;  1N6Z A;  2QHO A;  1LFD A;  3KYC D;  4F1S A;  2KWV B;  2BS2 B;  1K8R B;  2LXC A;  4K81 A;  3OJ3 A;  4JLC A;  3CWI A;  3RT3 B;  4MDK E;  2BW2 A;  4W9E A;  3ZKJ C;  3Q2A C;  3A1Q B;  4MJS A;  1P98 A;  4M0W B;  2KAC A;  1KH0 A;  3W5V B;  2V0G A;  1GPX A;  1YMH E;  1AWD A;  3ZJU A;  4QAY A;  4BKS A;  3WIM A;  3VH3 B;  1V1P A;  4JWS C;  3SFE B;  2WXF A;  3NVY A;  2KYW A;  3Q8C A;  2BYT A;  4ICV A;  4USA A;  4M02 A;  4RGT A;  1VLB A;  2MCN B;  2N1V A;  3KWL A;  2WXG A;  3OAW A;  1D6E C;  1PGX A;  5CHW A;  5AUI A;  3VXW A;  1WR1 A;  1CK1 A;  1M94 A;  2K39 A;  1XLP A;  2ZCC A;  1WE7 A;  1I7H A;  1J19 A;  2KDE B;  4XC2 A;  3AE4 B;  2PE6 B;  4NJ7 A;  2LFI A;  3ML8 A;  2MHJ A;  2WS3 B;  4KDI C;  1R4M B;  1LM8 B;  2DHZ A;  2AQ3 B;  2YEP B;  4K3C A;  1KFY B;  3V6E B;  3IFW B;  2K8H A;  3P42 A;  5E6P A;  4FHJ A;  2KFK A;  4RMA A;  1QIL A;  4C7Y A;  2L8J A;  1KOT A;  3Q8F A;  2NS5 A;  4ACF A;  3A9J B;  3PHX B;  1FEH A;  1QOF A;  2MBH A;  2WXO A;  4EE2 A;  4FJY A;  3AE7 B;  2MWS B;  2BWE S;  2INP E;  1VD2 A;  4PYU A;  4AUQ C;  2E3T A;  2KQS A;  3VUW A;  1L2N A;  1XF5 L;  3H6N A;  1UZX B;  4IUM B;  1R4N I;  3DHI C;  3PS6 A;  1E5W A;  1MPE A;  2NR2 A;  3DVG Y;  2CKH B;  1IGD A;  3QCA A;  4YXD B;  2D3B A;  1E8Y A;  1E8X A;  1SGH A;  1WSP A;  2DZK A;  3DBH I;  5LNK 1;  3E56 A;  1KTK A;  3KUD B;  3SEB A;  3GZN I;  3DBR I;  4JWU C;  4TMA B;  1UBQ A;  1TYG B;  4MM3 B;  3RNG C;  2PPH A;  1RYJ A;  1FXA A;  1WX8 A;  3FKY A;  4GDK A;  2OED A;  5C23 A;  2AEH A;  1JRU A;  3WAL A;  3DVN U;  5JHB A;  3P1M A;  5T8I A;  2WDT B;  3JSV A;  1FRD A;  4KDL B;  1F0Z A;  3W9C B;  2J7Q B;  3QIJ A;  4PT5 A;  4ANV A;  2O2V B;  4FLH A;  4HVB A;  4MSM B;  4GOC A;  1JWB D;  2NBV B;  1Q0W B;  3EGR A;  4N58 A;  2IDY A;  2FUG 1;  1YN5 A;  1LXD A;  3I57 A;  2PW9 A;  4EOY A;  4LCD E;  3TEZ A;  2FCM A;  5E6O A;  4FN2 A;  5CHF A;  2WX0 A;  3M63 B;  2ZW1 A;  2MA9 B;  3AB5 A;  1WH3 A;  4FJV B;  3R8B A;  2K1F A;  3RUI B;  1BXT A;  2HJ8 A;  1V5T A;  2H89 B;  2BKR B;  4XGA B;  4DHJ D;  3DVG X;  4MGI E;  2QSD A;  1K51 A;  4LDT D;  2KLG A;  2L52 A;  3MHS D;  3CSF A;  1M4V A;  3DHH C;  4WQO B;  1WMH A;  2D2Q A;  3RNE C;  3MHZ A;  4TQ0 A;  1Q5W B;  3N3K B;  1DOY A;  4IW0 A;  4FAD A;  3H8H A;  5AZH A;  3U4E G;  4HPP A;  3DCG A;  4N6E B;  3ZLZ A;  3RNB C;  1L4D B;  1UWM A;  3CMM B;  4FXC A;  3Q3N C;  5BO4 B;  4M8M A;  1A70 A;  1EWY C;  2V3N A;  3I63 C;  1E7P B;  2N1W A;  3ZNH B;  4P1B C;  3ZIM A;  3BVZ A;  3N1Y C;  1WWT A;  4HJG E;  2N7D A;  1WGG A;  3X0W A;  4FBJ B;  2LGY A;  2QMT A;  3VUX A;  4LNN A;  2RPQ A;  5EE1 A;  2XN9 C;  3ZJV A;  3W1Y A;  3DOW A;  3HHM A;  3AU5 A;  4H2A A;  2QIL A;  4W9J A;  3NUH B;  3TCA A;  4GDL A;  1WR6 E;  4RGO S;  4DBG A;  3NG0 A;  1GTE A;  3VTV A;  2Y5P A;  1ET6 A;  4BZA A;  1XQQ A;  3FIL A;  4LDT B;  3S2A A;  2FCN A;  1D5Z C;  1D3Z A;  3MJW A;  2Y5B B;  2IYD B;  2ZVO A;  2L1A A;  2WGS A;  4HWI B;  1I4P A;  2PVG C;  3VRB B;  3A4R A;  4O1N A;  2CJO A;  1RRB A;  2RPV A;  1JML A;  1Y56 A;  5DPR A;  4W9F A;  3PGE A;  1P9D U;  1T0Y A;  3VTU A;  4OZA A;  3VRA B;  3AE6 B;  1WGR A;  3PLV A;  3DDC B;  5FR3 A;  5D3D A;  1TZO A;  1WX9 A;  1RAX A;  1IPG A;  1CQV A;  2BB6 A;  1TGZ B;  5KHQ A;  1PGA A;  3U52 E;  2J0M A;  1C77 A;  1EU4 A;  4HCP B;  2L00 B;  3BZD B;  1RLF A;  1NYQ A;  1F9J A;  2BPS A;  1HEZ E;  1OQR A;  1TY2 A;  4MGZ E;  2K22 A;  3ONS A;  4NQL B;  3PO0 A;  2ZZP B;  4MAC A;  1GB1 A;  2W9N A;  2IO3 B;  1F52 A;  3JYU A;  3QX1 A;  5H92 C;  4PK1 A;  3L13 A;  3ZDM C;  1C1Y B;  1XLN A;  2LJ5 A;  2JSV X;  4LLG M;  4BOS C;  1V2Y A;  2BT6 A;  3DBL B;  4A6Q A;  3ZRF A;  1UH6 A;  5J18 A;  3A9K A;  1YJI A;  2L0T A;  2Y5C A;  4P7I A;  5DPW A;  3NVZ A;  2JRI B;  2LRW A;  1FM0 D;  3MJ5 A;  3B2F A;  4XDD A;  1EWC A;  4RCO A;  2DZM A;  1ROE A;  2I38 A;  3OG5 A;  3NS8 A;  3DWM A;  4AP4 C;  3Q8E A;  2LGX A;  4JGH B;  2LGI A;  1AN8 A;  1RWS A;  3GB1 A;  5EE0 A;  4OW0 A;  1VRA B;  4US9 A;  5L83 A;  2BYV E;  1CMX B;  3TMP B;  2K5P A;  1XCT L;  2JT4 B;  2M8S A;  4C00 A;  3OWE B;  2QCZ A;  3QA8 A;  2XK5 B;  4DDI D;  1GG3 A;  2OJW A;  1P3Q U;  1MHX A;  4GIV A;  1EM7 A;  2K0P A;  3U7D A;  3L17 A;  4OVV A;  4CQN A;  2WXJ A;  1YQ4 B;  3LYY A;  2IPK D;  4WJP A;  1J0G A;  1JRO A;  3APD A;  4HXD A;  4X57 B;  4ZRJ A;  3JW0 X;  4HRS A;  3V61 A;  2D5G A;  2WWZ A;  2IGH A;  1FNV A;  3Q3O C;  2KX3 A;  3IG3 A;  2DYM A;  2FID A;  3EHV A;  1STE A;  3AU4 A;  3GP7 A;  2GMI C;  2SAK A;  4A90 A;  3KH0 A;  4W9L A;  4B0E A;  1FCC C;  2JZZ A;  4RGM A;  5IN7 A;  2UYZ B;  3PZD A;  2LHE A;  3IAS 1;  2TSS A;  3M62 B;  3H7P A;  4S0R A;  3KVF B;  1NEK B;  1VCB A;  3AE9 B;  2WXH A;  3AUL A;  4G11 A;  4ZHO A;  2Z8L A;  1OQQ A;  3AE8 B;  2GBJ A;  1FRR A;  4KZ0 A;  3V62 A;  4EZK A;  2FCS A;  1WYG A;  2XEW A;  1QF6 A;  2CR5 A;  2X38 A;  1L6V A;  4C4V B;  4TUU A;  3R7R A;  2NPT B;  1YJ1 A;  5JH5 C;  3PRP B;  4MSQ B;  3T3O A;  1JRP A;  3AE5 B;  1ZDV A;  4AOF A;  2V9H A;  1RFA A;  3WAP A;  4HPL B;  5BYS A;  2G9H D;  2J0K A;  1NBF C;  3B2G A;  4OVZ A;  1GC6 A;  1WGY A;  2BKF A;  3ZGZ A;  2CJN A;  2BVC A;  3V6C B;  2RGF A;  1S3S G;  5DPT A;  1V86 A;  4BKT A;  4NY0 A;  3PRM B;  4HLE A;  2D10 A;  2IY0 B;  2LXA A;  5DPS A;  4EUT A;  2IGG A;  5FK9 C;  1H7X A;  2R2Q A;  2Z0D B;  3AV8 A;  4XE0 A;  2PJH A;  2MP2 B;  5FR6 A;  1IUE A;  3URY A;  3NVW A;  4LNI A;  4KGR A;  3K9O B;  1FFU A;  3HVD A;  3LDZ E;  4YT0 B;  4KV2 A;  4WUR A;  2JZP A;  3SR6 A;  3PLU A;  4ZYN A;  1HTO A;  3D32 A;  4B9K A;  2ACZ B;  2N4F A;  1VR9 A;  4HDO A;  1N62 A;  3PRE A;  1J7C A;  2Y3A A;  4JQW C;  1BUI C;  4MGY E;  3RMK C;  3ZNI D;  2FUH B;  2PVO D;  1GT8 A;  5LLI A;  5EDS A;  2K8B A;  4BAX A;  1UGM A;  1SEB D;  1ZDX A;  2JYE A;  2CHX A;  3AM9 A;  2KN4 A;  3TEX A;  4NAW A;  3VR8 B;  4WJQ A;  1V80 A;  3TIX A;  2QIE B;  1C9F A;  2HTM E;  2PLP A;  1MHH E;  3ZXR A;  1ESF A;  1GNU A;  3RI7 C;  1WY8 A;  3TJP A;  1V97 A;  1K50 A;  4IWP A;  2FCQ A;  3P4S B;  4G50 A;  5J2R A;  2NTS A;  1XLO A;  2OHF A;  4N59 A;  4ZRP A;  4WQM A;  3I9V 1;  2M56 B;  2JXT A;  2M4N A;  4YTN B;  2ZNV B;  1SJE D;  4XWT A;  2DLB A;  1PGB A;  2WDR B;  2JQR B;  3NY5 A;  2KVR A;  2FAZ A;  4A8X C;  4I6N B;  3CF4 A;  2MBQ A;  1ISN A;  2KDM A;  2IJ0 A;  4EZL A;  2WDV B;  3HVZ A;  2AX5 A;  3QC8 B;  1QQR A;  1LO5 D;  3L08 A;  2KK8 A;  2IND C;  3BWU D;  4BFR A;  4C7Z A;  1C79 A;  3Q8A A;  2KTF A;  2BS3 B;  2MJ3 A;  2HJ1 A;  2ZCB A;  2D07 B;  1H8C A;  3QAR A;  3AED B;  2KVZ A;  3IVF A;  2C7N B;  1PDX A;  3KQ4 A;  1V6E A;  1NDD A;  2WYQ A;  5AEK B;  5IO9 A;  3RPF C;  3PRZ A;  3C19 A;  5E6N A;  3BVG A;  3APF A;  3KLS X;  1ZGU B;  1ZW7 A;  3DQV A;  1PQS A;  2KC2 A;  2JUO A;  1WF9 A;  3FC4 A;  4MEM A;  4ITK A;  3P4R B;  5I4D A;  5IOI A;  3VQI A;  1FFV A;  4MGK E;  1E7U A;  1P7F A;  2YLM A;  2C7H A;  3IBE A;  3PVL A;  3DBL I;  4C56 C;  5EE9 A;  4IKG A;  4WH4 A;  1E9M A;  3Q8B A;  2JYT A;  1MVK A;  3GE8 C;  4RNA A;  4DHZ E;  2ICI A;  3PV1 A;  3TEY A;  1MFW A;  2MH7 A;  3SFD B;  2REX A;  1V8C A;  1P0R A;  1HZ5 A;  2C7M B;  3HUI A;  1YQ3 B;  3AH7 A;  4A20 A;  1ZXI A;  1WGH A;  2KC1 A;  2KD0 A;  2RSU A;  1GTH A;  3UIP B;  4P16 A;  3T9L A;  2W54 A;  1OTR B;  2JRH A;  2L0F A;  2DNF A;  4L1B A;  4G3X B;  5GXG B;  1B1Z A;  3WAN A;  4ANX A;  4BKS D;  4YTM B;  3BK2 A;  2MJE A;  3EFU A;  2LRU A;  2L32 A;  3RZF A;  1TBE A;  4XZ4 A;  3I5J C;  1IBX A;  5HFY A;  1VZ6 A;  2DX5 B;  1N63 A;  3QWZ B;  2MJD A;  4KIK A;  3N9Y C;  1TKY A;  2YVC A;  2NBW B;  2LZ6 A;  3NZ3 A;  3NOB A;  2M19 A;  3M95 A;  4XYC A;  3GE3 C;  4JX1 C;  2JZ3 B;  1SE3 A;  1GJZ A;  4B95 A;  2N9K A;  3AMZ A;  3DPD A;  2M0A A;  4MJS B;  3BK1 A;  1WYW B;  5D2M B;  2ON8 A;  2CHW A;  1R7S A;  2Q5W D;  2O6V A;  4B6W A;  1ET9 A;  4DHJ B;  1ENF A;  1V1P B;  3PSE B;  1FPY A;  1KRH A;  5D6J B;  3Q69 A;  4HDQ A;  2LVO A;  3GS2 A;  1PYW D;  2C9W B;  2WU2 B;  3VFK A;  5TSS A;  3P4P B;  4KVG B;  1YX6 B;  2KDB A;  3M3J A;  2JY6 A;  2EKE C;  2WP9 B;  2KTR A;  1JW9 D;  2KT7 A;  2BS4 B;  1L0V B;  1YOV B;  1ZXH A;  2DZI A;  2UU7 A;  4US8 A;  4TSS A;  1CJE A;  4IOI E;  3VTW A;  1P1A A;  3MP9 A;  4K3B A;  3N1Z C;  3Q14 C;  1UBI A;  1IGC A;  4R3D A;  3AE2 B;  3TEW A;  1NI3 A;  2KDF B;  4WWP A;  1TKG A;  1HA5 A;  3DVN V;  3DBS A;  3RNA C;  4HEA 1;  1QZE A;  3PTF C;  4RH6 A;  2QDF A;  3AEC B;  4WJN A;  2J52 A;  2I1K A;  2KFK B;  5H8Y E;  4MH8 A;  2D3G A;  2YEP F;  3X23 A;  3DBH B;  3ENE A;  2AQ2 B;  1T0S C;  4ANU A;  2WXK A;  3GZN B;  1DOX A;  1T3Q A;  3HM6 X;  4ARI A;  4IWQ A;  2WXQ A;  4PYZ A;  4EFO A;  4E71 A;  1GB4 A;  2KJH B;  4CO7 A;  3C0R B;  4Q2J A;  2Z59 B;  3B1L X;  2IY1 B;  2WXN A;  1LQB A;  1V1O A;  2KMA A;  1L6U A;  2FBW B;  1E90 A;  2RDB C;  2EEL A;  3IHP C;  4PS8 A;  1WGK A;  5BMG A;  4F8C B;  2W82 A;  2IBI B;  2MX2 A;  3AI5 A;  3MC0 B;  3A1Q A;  1LGR A;  1XT9 B;  4JPS A;  4WWM A;  2H88 B;  4A55 A;  3MC8 A;  1TKE A;  4M0W A;  2AWT A;  1WZ0 A;  2UWQ A;  3EA6 A;  3PPA A;  2KFJ A;  4LTU A;  3U8Z A;  3MC9 A;  3ZXV A;  3U30 A;  4II3 B;  5G5H A;  4RM8 A;  2L7R A;  1X1M A;  4GDK B;  1K52 A;  2PMV A;  3QHT A;  5EE3 A;  1C76 A;  1MG8 A;  5BMI A;  2MBE A;  2GRI A;  3IT6 B;  3SDL C;  3Q3F A;  1HQR D;  3JSV B;  2HD5 B;  3RUL A;  2CU1 A;  4WWO A;  1H4R A;  4II2 B;  5D7G A;  4ASW C;  1WXA A;  3ZNZ B;  2WX1 A;  1UUP A;  2VH1 A;  5C1Z A;  2KHW B;  3UIN B;  3ZJT A;  3HK0 A;  3BY4 B;  2BYF A;  3SU8 X;  1GUA B;  1I42 A;  4GMV A;  1WJ6 A;  1DGJ A;  1T6B X;  3SHQ A;  3ZO5 B;  1E0Z A;  2B76 B;  1H7W A;  4KZC A;  4ZDV A;  3R2T A;  4W9I A;  1E10 A;  1SIJ A;  2J4X A;  4ZHP A;  5HG2 A;  1EO6 A;  3B0A A;  2JVC A;  2N9E B;  4NJC A;  4LNK A;  1QKZ A;  2G3Q B;  3A9J A;  5L95 C;  1WMH B;  1HZ6 A;  2KMC A;  3IAM 1;  2K6D B;  1TZ1 A;  1FCL A;  1K53 A;  1FMA D;  1KLV A;  2I2Y A;  5D94 A;  3MFG A;  2NTT A;  2GBM A;  1R4M I;  3AE1 B;  2MRP A;  1WFY A;  5AZF A;  4HJK A;  2N9P C;  2HTH A;  2WXR A;  2Z0E B;  3CST A;  2MQJ A;  4ZRQ A;  2V1Y A;  4MEL A;  4NZL B;  2KO3 A;  2GBK A;  2PKO A;  3ETR A;  1MI0 A;  1SF0 A;  2KNB A;  4HRO A;  2AL6 A;  2LAS A; 
#chains in the Genus database with same CATH homology
 5JXV A;  2PW9 A;  1KLG D;  3TEZ A;  1MHH E;  1KLU D;  1GAQ B;  1ESF A;  1SBB B;  4MT5 A;  2ZW1 A;  1N5W A;  3AB5 A;  1V97 A;  1K50 A;  2IGD A;  3R8B A;  3P4S B;  4GDL B;  2BB5 A;  2NTS A;  1ZPS A;  3AEE B;  1BXT A;  1TS2 A;  3BYT B;  1XLO A;  2OHF A;  4OHJ A;  2H89 B;  3KWV A;  4N59 A;  4RGN A;  4ZRP A;  1YN4 A;  3I9V 1;  4WQM A;  2QSD A;  1D5M C;  3AE3 B;  2M56 B;  1K51 A;  3CIR B;  2JXT A;  3FIL B;  4YTN B;  4OZC A;  5BYR A;  5D3I B;  4RF1 A;  1SJE D;  2FE8 A;  2L52 A;  4XWT A;  2LEK A;  3PZ8 A;  2DLB A;  1M4V A;  1PGB A;  2WDR B;  1NVI D;  3ZYY X;  2JQR B;  3MHZ A;  4TQ0 A;  2VZK D;  1WRI A;  1GOZ A;  1DOY A;  2KMM A;  1WXQ A;  3H8H A;  3UI3 A;  3C8Y A;  3U4E G;  4A8X C;  1UNS A;  1I4Q A;  4N6E B;  1P7E A;  1RFK A;  3CF4 A;  1L4D B;  1UWM A;  1VZ8 A;  3BII D;  3U2S C;  4FXC A;  1FO4 A;  5BMH A;  2KDM A;  1A70 A;  1EWY C;  2IJ0 A;  2WDV B;  1OFF A;  3HVZ A;  2AX5 A;  2V3N A;  1XLQ A;  4D2K A;  1QQR A;  1E7P B;  1LO5 D;  4AQ7 A;  3BVZ A;  1JWS D;  2LMC A;  1WWT A;  4J3O D;  3BWU D;  4HJG E;  4C7Z A;  1C79 A;  1J7A A;  2PTL A;  2QMT A;  3Q8A A;  5EE1 A;  3RFZ B;  2BS3 B;  1HXY D;  2MJ3 A;  2XN9 C;  3ZJV A;  1JQ4 A;  4H2A A;  4HKZ E;  2QIL A;  3J9C A;  4ARC A;  3NUH B;  4GLS C;  1FIQ A;  2JX5 A;  3AED B;  1ZP0 B;  3W2D A;  4RFB A;  1SB3 C;  2INN E;  1SSN A;  4ZYS A;  4RGO S;  5G5G A;  2KAJ A;  1PDX A;  3KQ4 A;  1GTE A;  1ZOY B;  3O13 A;  1F77 A;  2Y5P A;  1ET6 A;  2WDQ B;  3RPF C;  3FIL A;  3U7Z A;  3AEG B;  3E9S A;  1TS5 A;  3BVG A;  3KLS X;  1D5Z C;  2V3P A;  2VZK B;  2L1A A;  2EKI A;  3ABV B;  3EUB 2;  3FC4 A;  1Q10 A;  3AEF B;  4XWW A;  4HKQ A;  1I4P A;  2PVG C;  3VRB B;  4ITK A;  4O1N A;  3HRD D;  2CJO A;  3P4R B;  5I4D A;  2RPV A;  1JML A;  1Y56 A;  1L4Z B;  3VQI A;  4KKJ A;  1FFV A;  1NEN B;  2SEB D;  1L0X B;  1P7F A;  4OZA A;  5MPO A;  3VRA B;  3AE6 B;  1IBX B;  1L5P A;  1SJH D;  5E6J A;  5FR3 A;  4YSZ B;  4KGT A;  5D3D A;  4C56 C;  1TZO A;  2KQ4 X;  3IT4 B;  5EE9 A;  1AW7 A;  4IKG A;  1ZE3 D;  1PFD A;  4IDI A;  4WH4 A;  4YWG G;  1C4A A;  1CQV A;  2BBC A;  1E9M A;  2N7J A;  3Q8B A;  3WCQ A;  2JYT A;  2BB6 A;  1MVK A;  1I4H A;  4RNA A;  1PGA A;  2ICI A;  3U52 E;  2JU6 X;  1C77 A;  1EU4 A;  2QEJ C;  1QT9 A;  1J7B A;  2MH7 A;  2W3R A;  3TEY A;  2V4I B;  3BZD B;  1QOG A;  3SFD B;  1VDV A;  1NYQ A;  2RDG A;  1V8C A;  1HEZ E;  1HZ5 A;  1OQR A;  1TY2 A;  3HUI A;  2K22 A;  2WU5 B;  1YQ3 B;  3AH7 A;  3PO0 A;  1PUT A;  1JWM D;  4LK0 M;  1ZXI A;  4MAC A;  4XDC A;  1GB1 A;  2GI9 A;  3P63 A;  2ONQ A;  5H92 C;  1SE4 A;  1XLN A;  1GTH A;  4JE3 B;  2JSV X;  4LLG M;  3W1S A;  4P16 A;  2W54 A;  2BT6 A;  4A6Q A;  1F2R I;  4L1B A;  1FD6 A;  2G1E A;  5GXG B;  1B1Z A;  1I4G A;  1L0Y B;  5C3J B;  1YJI A;  2Y5C A;  4YTM B;  3BK2 A;  2J53 A;  2MJE A;  3NVZ A;  3P4Q B;  2L32 A;  1FM0 D;  3MJ5 A;  3B2F A;  4XDD A;  1ACC A;  2DWQ A;  2DBY A;  3B9J A;  2GB1 A;  4OZB A;  1IBX A;  1EWC A;  1TY0 A;  5HFY A;  1VZ6 A;  1D4B A;  1JWA D;  3T3N A;  4RCO A;  1N63 A;  2PIA A;  2WQY B;  2WXI A;  2MJD A;  1ROE A;  1JWU D;  1N61 A;  3N9Y C;  2I38 A;  1TKY A;  1F2R C;  2N9L A;  5HHD G;  1TJE A;  3DWM A;  4REZ A;  3NZ3 A;  2ZW0 A;  2E6X A;  3Q8E A;  2M19 A;  2LGI A;  1AN8 A;  4JX1 C;  1D5X C;  1SE3 A;  3ZQ4 A;  1RWS A;  4KX6 B;  3GB1 A;  5EE0 A;  4OW0 A;  1VRA B;  2N9K A;  2W3S A;  4US9 A;  3AMZ A;  4P6V F;  2MEK A;  3DWG C;  2M0A A;  2AQ1 B;  2QJL A;  3BK1 A;  2K5P A;  1XCT L;  4WIP A;  2ON8 A;  3OWE B;  1BML C;  1R7S A;  2HDE A;  1VJK A;  2Q5W D;  2XNA C;  2WXP A;  5BYQ A;  2WNM A;  1ET9 A;  3AEB B;  2WLB A;  1EU3 A;  1MHX A;  1RM6 C;  1EM7 A;  2K0P A;  4L2Y A;  1ENF A;  1FNW A;  1V1P B;  4CQN A;  1KRH A;  1SXT A;  3Q69 A;  2WXJ A;  3GS2 A;  1YQ4 B;  3LYY A;  1C4C A;  3VR9 B;  2IPK D;  1PYW D;  2WU2 B;  5HI1 A;  5TSS A;  3FAH A;  3P4P B;  1B9R A;  4KGS A;  2LJI A;  4DXF A;  1JRO A;  4TQ1 A;  1JCK B;  4YSY B;  1TS3 A;  4L23 A;  4HRS A;  2WP9 B;  1N60 A;  1QOA A;  2D5G A;  2IGH A;  4YTP B;  1JW9 D;  1FNV A;  2BS4 B;  1L0V B;  2BS2 B;  1UWX A;  1ZXH A;  2K3U A;  2DYM A;  2RMM A;  3CWI A;  4US8 A;  4TSS A;  4NAM A;  1STE A;  1CJE A;  4IOI E;  2BW2 A;  3MP9 A;  1NYR A;  3GP7 A;  4R3D A;  1IGC A;  3AE2 B;  3TEW A;  1NI3 A;  2K9X A;  2SAK A;  2JWU A;  4A90 A;  1TKG A;  3IXS A;  3V3X A;  1HA5 A;  4B0E A;  2KAC A;  1FCC C;  1KH0 A;  3W5V B;  4RGM A;  2V0G A;  1GPX A;  1YMH E;  1AWD A;  1CZP A;  3ZJU A;  2LHD A;  1N5X A;  4HEA 1;  2LHE A;  4RH6 A;  3IAS 1;  2TSS A;  3AEC B;  2J52 A;  1NEK B;  3W5U B;  3AE9 B;  5H8Y E;  4MH8 A;  2WXH A;  1YNT E;  2YEP F;  4ZHO A;  2Z8L A;  1OQQ A;  1V1P A;  3V05 A;  4JWS C;  3AE8 B;  3SFE B;  2AQ2 B;  2WXF A;  3NVY A;  2WXK A;  1FRR A;  2J42 A;  3Q8C A;  4USA A;  3PZ7 A;  2BYT A;  1QLB B;  1DOX A;  1T3Q A;  4ARI A;  1YN3 A;  4RGT A;  2WXQ A;  5FKA C;  1GB4 A;  1VLB A;  4Q2J A;  1C78 A;  2WXN A;  1WYG A;  3KWL A;  2WXG A;  3NS1 A;  1D6E C;  1PGX A;  5AUI A;  1QF6 A;  1V1O A;  2X38 A;  1DOI A;  1L6U A;  1L6V A;  1CK1 A;  2FBW B;  2EEL A;  4WAF A;  4DQO C;  1JAL A;  1XLP A;  1WGK A;  2WXL A;  2CU3 A;  1I7H A;  5BMG A;  3T3O A;  3AE4 B;  1AYF A;  1JRP A;  3AE5 B;  1ZDV A;  2LFI A;  2W82 A;  2RDH A;  3MC0 B;  4JPS A;  2WS3 B;  4A9A A;  4WWM A;  5BYS A;  2G9H D;  2H88 B;  4A55 A;  2AQ3 B;  1QOB A;  1SE2 A;  1TKE A;  1I4X A;  4M0W A;  2YEP B;  3B2G A;  3EA6 A;  4OVZ A;  1KFY B;  3NRZ A;  4LTU A;  3P42 A;  2CJN A;  3ZGZ A;  1TS4 A;  5G5H A;  3LB8 C;  4DXG A;  1QIL A;  3BYY B;  4GDK B;  4C7Y A;  1K52 A;  2PMV A;  3Q8F A;  3TSS A;  1I4R A;  3BVM A;  1FEH A;  1QOF A;  5EE3 A;  1C76 A;  5BMI A;  3NVV A;  2GRI A;  3IT6 B;  3AEA B;  2WXO A;  4EE2 A;  1HQR D;  4UDU C;  2IGG A;  3AE7 B;  3LXF A;  5FK9 C;  2INP E;  1H7X A;  1FNU A;  2E3T A;  3AV8 A;  4XE0 A;  1VZ7 A;  2LUM A;  4KKI A;  1XXG A;  2R61 A;  1YJJ A;  1XF5 L;  5D7G A;  4YSX B;  1IUE A;  1UUP A;  2NMQ A;  5C2T B;  3NVW A;  3URY A;  4NAW B;  4KGR A;  4ZOH C;  3ZJT A;  1FFU A;  1MPE A;  3HVD A;  1ZUD 2;  4YT0 B;  1IGD A;  4WUR A;  2JZP A;  1DGJ A;  1T6B X;  3SR6 A;  1E6E B;  4YXD B;  2L83 A;  1E0Z A;  1WSP A;  1XEE A;  5LNK 1;  3E56 A;  2B76 B;  1H7W A;  4AS1 A;  1FXI A;  1KTK A;  1T5X D;  1KF6 B;  3SEB A;  2WXM A;  3R2T A;  4JWU C;  1E10 A;  1SIJ A;  2ACZ B;  2J4X A;  4TMA B;  4ZHP A;  5AUK A;  5HG2 A;  1TYG B;  1VR9 A;  3AN1 A;  4MM3 B;  1RYJ A;  1N62 A;  1FXA A;  1J7C A;  2Y3A A;  4RF0 A;  1BUI C;  2OED A;  1XCQ L;  1C4P A;  4NJC A;  1QKZ A;  2PVO D;  1GT8 A;  1XO3 A;  4B0M A;  2KWD A;  1HZ6 A;  3IAM 1;  2BTE A;  3P1M A;  5T8I A;  1FCL A;  1UGJ A;  1SEB D;  1K53 A;  1FRD A;  1ZDX A;  1FMA D;  3TUO A;  2I2Y A;  1F0Z A;  3W9C B;  3MFG A;  2NTT A;  4PT5 A;  2DYO A;  2JYE A;  2W55 A;  3AE1 B;  3R2I A;  2N0S B;  1JWB D;  3AM9 A;  2KN4 A;  2WXR A;  3EGR A;  4N58 A;  3TEX A;  4ZRQ A;  3VR8 B;  2IDY A;  3L4P A;  4C80 A;  4NZL B;  2QIE B;  2FUG 1;  1YN5 A;  2PKO A;  3ETR A;  1MI0 A;  1C9F A;  1SF0 A;  3I57 A;  4HRO A;  2HTM E;  1DYQ A;  2PLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...