2WU2B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystal Structure of the E. Coli Succinate:Quinone Oxidoreductase (Sqr) Sdhc His84met Mutant
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wu2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wu2B01
1ROEA 1FIQA 1JWAD 1VJKA 1XLPA 3AEBB 2CU3A 4YTPB 4ZHOA 2CJOA 1H7WA 2DWQA 1WWTA 3AEAB 1TKGA 1XLOA 3P1MA 3ABVB 1RYJA 5C2TB 2KMMA 2AX5A 5EE1A 3RPFC 3CF4A 2JX5A 5EE3A 5G5HA 4WQMA 4P6VF 4YSYB 1JROA 1DOYA 1DOXA 1XO3A 3ZYYX 4YSXB 1YJIA 2HTME 5GXGB 1XLNA 2WDVB 3W9CB 1SIJA 4JX1C 4C7ZA 4ITKA 1N62A 1VLBA 1GTEA 1J7CA 1DOIA 1OFFA 4LTUA 3FAHA 2QJLA 1FXIA 4IDIA 1TKEA 5H8YE 2M19A 2Q5WD 4JWUC 4ZHPA 3AEEB 4A9AA 3W5UB 2BS4B 5G5GA 1FRDA 5EE9A 3VR8B 1SB3C 1JALA 1E6EB 2WQYB 1N60A 1QOAA 4YXDB 3AECB 1V8CA 1ZXIA 3L4PA 1H7XA 1JRPA 1TYGB 1PUTA 4N58A 1AWDA 2W54A 2B76B 1I7HA 1JW9D 2WU2B 3AB5A 3WCQA 1QF6A 4C7YA 2LEKA 3HRDD 1FFUA 2WDQB 3SFDB 1YJJA 2PKOA 3BIID 1FRRA 5EE0A 1RWSA 1FO4A 1J7AA 1E10A 3NVVA 1RM6C 3AE3B 1SF0A 2OHFA 1ZUD2 1L6UA 3LXFA 4US9A 1QOBA 3AE8B 4YSZB 1TJEA 3EUB2 2N0SB 2ACZB 1VDVA 2WS3B 3P4QB 1CJEA 3NS1A 1KF6B 2EKIA 3AE1B 1FXAA 1FMAD 2FBWB 2DBYA 3DWMA 2K9XA 1KFYB 1L0VB 2PVGC 2KAJA 1XLQA 3P63A 1E0ZA 1KRHA 1QOFA 5H92C 1PFDA 1OQRA 1GTHA 3LB8C 1JWBD 2W3SA 4ZOHC 2MJ3A 3B2FA 3AE2B 1QOGA 1WXQA 1L6VA 4YT0B 3AE7B 1L5PA 1NI3A 2WU5B 1GPXA 3AE9B 1GAQB 1ZOYB 1AYFA 1N5WA 3AMZA 1F0ZA 2MJDA 1QLBB 1N61A 4YTNB 2E3TA 2L52A 3AH7A 5AUKA 3KWLA 4KX6B 2L83A 4HROA 3HVZA 4FXCA 2BT6A 1V97A 1N5XA 2QIEB 2H89B 1UWMA 1NEKB 1FFVA 3P4RB 3HUIA 1B9RA 2CJNA 3SR6A 1NYRA 3W5VB 1NENB 1ZP0B 4JWSC 1R7SA 3PO0A 2H88B 3AM9A 2M56B 3NVZA 2K22A 1JQ4A 1QT9A 3AE4B 4YTMB 3CIRB 1A70A 3NRZA 3AEFB 3P4SB 1N63A 1E9MA 1IUEA 2BS3B 1YQ3B 1RFKA 2WLBA 3FC4A 5MPOA 2BS2B 1PDXA 2G1EA 3AV8A 1FM0D 4WWMA 3NVYA 3VRAB 3AE6B 1YQ4B 2MJEA 1TKYA 2PVOD 1E7PB 2WDRB 2K5PA 3CWIA 3P4PB 1CZPA 2MH7A 1T3QA 3AN1A 1WYGA 3AE5B 4US8A 2PIAA 2W3RA 2WP9B 4USAA 3AEDB 3VR9B 2Y5CA 1GT8A 1WGKA 2W55A 1EWYC 3ETRA 1NVID 2JQRB 3B2GA 4HRSA 5AUIA 3SFEB 1NYQA 3DWGC 3NVWA 1WRIA 4C80A 5C3JB 4N6EB 4N59A 3VRBB 1J7BA 3AEGB 1DGJA 1OQQA 3B9JA
chains in the Genus database with same CATH superfamily
1CQVA 1J19A 1YOVB 3BK2A 3MC0B 3TEZA 2XN9C 2KWDA 4HCNB 4RF1A 2PTLA 3Q69A 3CF4A 1P9DU 2LHDA 5KHQA 2ZVOA 2HTME 3TCAA 3Q14C 1K52A 1CMXB 2KMAA 2WXHA 3QAQA 2AQ3B 4QAYA 4KIKB 2KDBA 2LWPA 2GBKA 1WX7A 3HRDD 1L2NA 4DDID 3WIMA 3NVVA 2GBJA 3L13A 3ZO5B 2HTHA 3E9SA 1NI2A 2MBHA 1EUVB 4FJVB 2JT4B 1WI0A 4IM3A 2BQQA 3A9KA 1XLQA 4IOIE 3ZQ4A 1Q0WB 4GDLA 2WU5B 3VFKA 1F0ZA 4K3CA 4M00A 2R2QA 1V9JA 5AUKA 4CHKA 3V60A 4OVVA 3UIPB 1AARA 1UWMA 4K1RB 2FUG1 2KANA 3MC9A 4XZ4A 1WGDA 2BB6A 3NVZA 2BPSA 2JVCA 4KSKC 4E71A 3AE4B 1WX9A 2DZKA 3CIRB 3NRZA 2RPQA 4PT5A 3AEFB 4WJNA 1P7FA 4WWMA 3IFWB 1P98A 2DNFA 2AYOB 4TQ1A 4AWJA 1NYQA 3ECIA 4BAXA 4BKSD 2JY6A 3JSVB 3RI7C 3B9JA 1UZXB 3A1QB 2KLCA 4LJOB 3VUXA 4HJKA 2QMTA 2RDHA 4HXDA 3UINB 4RNAA 3ZKJC 4JX1C 5E6OA 2Z8LA 1KJTA 4LTUA 1WSPA 3GP7A 4IG7B 4A3PA 1SSNA 4R3DA 2JU6X 4XYCA 2BKFA 3PTFC 3VR8B 4K7SA 1E10A 1V8CA 2KX0A 3M63B 1OGWA 3C19A 2W54A 4RGNA 4O1NA 2KFKA 3PGEA 2IGGA 4Q2JA 5EE0A 4IM2A 3V3XA 3C8YA 1L6UA 4US9A 4EUTA 2K39A 3DBSA 3AE1B 4GMVA 2CHWA 5FR6A 4RGOS 1OQRA 1JWBD 3BYYB 3Q3OC 2K1FA 5FK9C 2B3AA 3H7PA 1GB1A 3AMZA 4LNFA 4JQWC 1N5XA 3RNEC 1WXAA 3L10B 3VUWA 3IT4B 4JE3B 1MHXA 1WZ3A 1JQ4A 4JGHB 4RH6A 1N63A 1E9MA 3TUOA 3L17A 2LGDA 3NVYA 3TIXA 1P0RA 3IBEA 2RD0A 3GB1A 3A4RA 2VZKD 3QQ8B 2JWZA 4NNJB 2NPTA 3KQ4A 4S0RA 1TS3A 1WXVA 2WXFA 3NVWA 3WALA 4WWNA 4ANUA 4BKSA 1FPYA 1H7WA 4PK1A 3GS2A 5EE1A 4OVUA 5AEKB 4GGQA 2AQ2B 2KKCA 1KLUD 4TQ0A 4C7ZA 3R8BA 3APFA 2C9WB 2IBIB 1MHHE 2AL6A 3PRMB 5H8YE 2V4LA 3W1SC 2WXJA 1JALA 1E6EB 4RGMA 5I4DA 3DPDA 4IKGA 4HEA1 4ZDVA 3I57A 2L3ZA 2Y5PA 3NG0A 4YWGG 3N9YC 2C7MB 3Q8CA 3AE3B 1D5ZC 1QOBA 1MVKA 1SE9A 3EUB2 3I63C 1WY8A 2KHWB 3KW5B 1JWSD 4BBNF 5GMVA 1JWMD 1KH0A 4HDOA 1WXQA 4WWOA 5DPWA 2WXRA 2G4SA 2E3TA 3WAOA 1QKZA 4F8CB 3RT3B 1M94A 1SIFA 4KGTA 4MH8A 3HHMA 3PO0A 2ZVNA 4MH0E 2FAZA 4KZ0A 1HXYD 2FIDA 3A9KB 1RFKA 1TZ1A 2O6VA 3R2TA 3T9LA 1STEA 3KLSX 3VTVA 1YN4A 3UI3A 2MJEA 3GE3C 1IP9A 3P4PB 3DHHC 3IAM1 1VRAB 3AEDB 4MGZE 5D7GA 5AUIA 4HDQA 2KWVB 2V3NA 1KTKA 3AU5A 1J7BA 2JXXA 1FIQA 2Y3AA 4YL8A 2R61A 3V6EB 1V86A 4RFBA 2KMMA 1ZPSA 4GN1A 3RN9C 2X8XX 3TEWA 3BWUD 4K81A 1VLBA 2J0JA 1DYQA 4XDCA 1Q10A 4ZHPA 1E90A 1XT9B 4LNIA 1EF1A 1UELA 4KIKA 1JRPA 4BKGA 5CHFA 2D3AA 4C7YA 1YJJA 5D2MB 3BIID 2G4DB 3OAWA 4XX5A 4G11A 4II2B 2KWCA 4NQLB 3M3JA 3NS1A 1FXAA 4XWWA 2LGIA 2WXQA 1E0ZA 4DHJB 2MHJA 4KKJA 4B9KA 1SJED 2INPE 1WGGA 4YT0B 2WX0A 1RAXA 1UNSA 1GPXA 2KFKB 2KWUB 2K8CA 3N20C 4FA6A 5DPRA 4LNOA 1JRUA 2K8HA 3CSTA 5J17A 1V1PA 1F9JA 2K22A 1HTOA 2K3UA 2XNAC 4YTMB 1YD8U 2QSDA 3DCGA 2INNE 5MPOA 2D10A 2NBWB 1D5XC 1ZXHA 3IG3A 4LK0M 3RNGC 1TKYA 3VXWA 2DLBA 4MELA 2K5PA 3H7PB 3NY5A 3EC8A 3DOWA 2W3RA 2WP9B 3VTWA 1NDDA 3SU8X 2W55A 2PE6B 3EFCA 4LDTB 3ZRCA 1WRIA 1WR1A 2M0AA 2QDFA 1JWAD 2BYTA 1WWTA 2MEKA 4DXFA 5EE3A 3K9PB 4PS3A 4WQMA 4WAFA 2C7HA 4GSWA 1DOYA 2QC8A 5CTRC 2NTSA 3HK0A 2FCQA 1UD7A 1GG3A 4AJWA 2NPTB 2EMSA 1C78A 5AZGA 3N1XC 3BK1A 1H7XA 1TYGB 4KKIA 3ALBA 2WU2B 1F52A 3T8MA 2EELA 2K0PA 1PGBA 5DPTA 3MJWA 4DBGA 4ANWA 4F1SA 3RZWC 3ZNID 4FJZA 3L16A 3EA6A 1CJEA 1SE2A 3KYCD 5HG2A 3V6CB 4A20A 3PRPB 3P63A 2L32A 2D3CA 4DXGA 1LM8B 5BMIA 2YVCA 5IOIA 1GB4A 1YQBA 1D6EC 2ZJDA 3MTNB 3ZNHB 1WRDB 4KX6B 2RSUA 4DHZB 4AUQC 4JWSC 1FNUA 2M56B 4RM9A 3U2SC 2N7JA 1WIAA 2BKRB 3FILA 1ZKHA 4ASWC 3PT2B 3SD5A 4RGTA 2KD0A 4GDKA 1GUAB 3AE5B 1V81A 1WMHA 4USAA 1YJ1A 2QCZA 2IO1B 2LGYA 2WDTB 2WNMA 2KOXA 3N1YC 4DWFA 3WA0A 2KJ6A 1I35A 2DX5B 4P1CC 2JYTA 2MBBB 1XLPA 3AEBB 3RNCC 4YTPB 5LLIA 1V6EA 4ZRIA 3DDCB 3ABVB 3QK0A 1UBIA 2JX5A 2NS5A 2O6VB 5G5HA 3IAS1 4UDUC 1WR6E 2KMCA 5GXGB 2LUEA 5DPSA 2KTRB 2CS4A 2V9HA 2FNJB 3KH0A 2BW2A 3R7QA 3W5UB 2ZNVB 5G5GA 3W1YA 4ZRPA 4A90A 1C4AA 1I7HA 2FIFA 1ENFA 4NZLB 2M17A 3PHWB 2YEPF 3MFGA 4II3B 1SF0A 1ZUD2 2JSVX 1ET6A 1F2RI 4DHJD 1V1OA 3TEXA 1E5WA 1OEYJ 1QOFA 1GTHA 3HM3A 4IM0A 1I4RA 1QOGA 2K6DB 2XBBC 5D3IB 3NHEB 1GC7A 1C1YB 2MJDA 3QA8A 2LFIA 2BF8B 2L52A 2BWFA 2KXJA 3VTUA 1I4PA 2PMVA 3EGRA 2NCNA 2BYFA 3DVGY 3ZDTA 5JHAA 2DAFA 2GLSA 2N9XA 5KHOA 2LZ6A 4KGSA 2J52A 3ZRFA 2WLBA 2GB1A 1PDXA 4BKTA 4W9EA 3KWVA 4I6LB 2PVOD 1KM7A 3GZNB 2WXLA 4LDTD 4E74A 1ISNA 2KN4A 2NVUI 3MHZA 1FD6A 1WXMA 2M4NA 2M0XA 2IY0B 3DHIC 3EECA 3H7SA 3VVWB 2J4XA 2J7QB 2C5LC 1V1PB 3KUDB 4NAMA 2LMCA 2DWQA 1TKGA 3QX1A 3ZJUA 3R66C 1C4PA 3NOBA 1T0RC 3ZW3A 3APDA 2QJLA 3RD2A 1FRDA 3B1LX 1E8WA 4M02A 3U52E 2MW5A 3AECB 2KVZA 4M8NA 1QF6A 3QCAA 4W9GA 2KNBA 1E8XA 3Q8EA 2D07B 3U4EG 4RF0A 1XCTL 2WXPA 4NY0A 3RCZA 2WHIA 1S3SG 4NJCA 1P1AA 1WM2A 2UU7A 2D3GA 3RNAC 5J2RA 5J18A 4KZCA 1ZGUB 2DYOA 1KRHA 3H1UA 3LB8C 1PQSA 3AE9B 2FE8A 3V61A 1VZ8A 4JPSA 5D94A 4FULA 2KVRA 1AW7A 3BYTB 2KT7A 5IA7A 3KWLA 2BT6A 4DQOC 3HUIA 1NEKB 1MPEA 2LASA 1C76A 2N7DA 2XEWA 3UGBB 4DDGD 4DK5A 3AULA 1PGAA 1QT9A 2VRRB 2ONQA 2QEJC 3HM6X 1V49A 4A6QA 2G1EA 3AV8A 1HZ5A 1WJNA 2MBOA 4GXBA 2KN5A 5CX3A 1EWYC 5C23A 4BOZB 4PYZA 3PLVA 3HVDA 4W9HA 3GZNI 3AEGB 1OQQA 3U30A 4EZLA 2O6VD 2KDIA 3ZUNA 3PPAA 1VJKA 3NS8A 2KDMA 2PLPA 1XQQA 1J8CA 4TMAB 1SXTA 2DAJA 3FILB 3W9CB 4FHKA 1GC6A 4CYEA 4GDKB 1GTEA 4ZRQA 5TSSA 1WMHB 2D2QA 3ZJTA 1Y56A 3ZGZA 2IYDB 1UGJA 2Q5WD 4MT5A 3VAWA 1IBXA 2NTTA 2JZPA 4YXDB 4IUMB 1AWDA 2B76B 4P7IA 2PE9A 3RUIB 3WCQA 1WM3A 2HJ1A 4TUUA 3RMKC 2PKOA 1FRRA 2ZZPB 3E56A 2IO2B 4PYUA 2I38A 2N9KA 3LXFA 2LVQA 2J42A 4XWTA 1BUIC 1WFYA 1YMHE 4B6WA 2O2VA 3R7RA 3OWEB 4CO7A 4RCOA 2RPVA 1KLGD 4ANVA 2G9HD 1ET9A 4GU2A 1TIFA 3DBLB 4RMAA 1LO5D 4TV3A 3I5JC 1Q5WB 4ZRKA 5G2NA 1GOZA 4L2YA 2MCNB 4D2KA 2H89B 2LXCA 2CJNA 2KLGA 3Q2AC 2LXAA 2LRUA 2W9NA 1EU4A 3BVMA 4EZKA 1WX8A 3RYTA 5FKAC 2Z0DB 2LVPA 1C9FA 4J3OD 2LGSA 1HQRD 1CZPA 2MH7A 2PIAA 4HWIB 2Y5CA 2X38A 2KJRA 2C60A 2ZW0A 5IKCM 5JH5C 2MA9B 2LI5A 1IYFA 4A8XC 5FR3A 2OJWA 1IGDA 5IO9A 2L1AA 3BVGA 3AEAB 4W9JA 3U7DA 3ZLZA 3X23A 3VH4B 2KO3A 2KTRA 4YSXB 1YN5A 2CR5A 2OJRA 2WDVB 2BVCA 4W9KA 4AS1A 4HCPB 2M1MA 3KUZA 3Q8BA 3AEEB 4K3BA 3NZ3A 2WQYB 1ZXIA 2FCMA 1VZ7A 4WQOB 4NJ7A 2GBNA 3SFDB 1ACCA 1TY2A 4RM8A 4MM3A 5EDSA 1WJUA 2I1KA 1QZEA 4WH4A 1I4XA 2WYQA 3P4QB 3C0RB 2EKIA 4NQKE 1FXTB 1FMAD 2DBYA 1VCBA 3IVFA 4B0MA 1KOTA 3TL5A 3ENEA 1Q1OA 3R3MA 3W1SA 2BGFA 3U8ZA 1MI0A 1PFDA 4WJQA 1SE4A 4G50A 3H8HA 4J6IA 1GNUA 3N32A 1V5OA 3QARA 1UBQA 1ZOYB 1PYWD 5T8IA 4M0WA 3HVZA 4FXCA 3DBLI 3P4RB 1TBEA 4BFRA 1D4BA 4HPLB 4WURA 2WXOA 1WE7A 3D32A 1YN3A 4FJYA 4XC2A 1T0SC 2ZPYA 4GIVA 3CWIA 1YNTE 2DENB 4IWPA 1C4CA 2Z59B 1NVID 4P16A 3DWGC 2AQ1B 3V62A 1L0XB 1ROEA 2PW9A 1L4ZB 1T0QC 2CU3A 4ZHOA 3ML9A 2CHZA 1RYJA 2IGHA 1E8ZA 2JXTA 1XCQL 3Q8AA 1N6ZA 2HJ8A 2RDGA 3B08A 1HA5A 1BT0A 3FAHA 5E6JA 3ZDMC 1TKEA 4HVBA 3VQIA 1K50A 4W9DA 1RRBA 1JMLA 2KDEB 1WYWB 2UWQA 4HPMB 3RPFC 3TBLD 1N60A 5AZFA 2KJHB 1T6BX 2GMIC 5IN7A 3H9DA 1MJDA 1T5XD 1J7AA 1ESFA 2IGDA 4BBNC 1D3ZA 4ARIA 4LNKA 4PS8A 1VDVA 3X0WA 4I6NB 4KGRA 4N9F4 4MGKE 3SHQA 3PV1A 1I4HA 1C3TA 4REZA 1IBXB 4ZYSA 1YX6B 3UQAA 1AYFA 2DZMA 3U7ZA 4YTNB 4HROA 2AWTA 2JUOA 1XF5L 3I3TB 2KQ4X 2O2VB 1TY0A 2WXKA 4OZAA 1GJZA 2J0MA 3R2IA 3VRAB 3UIOB 2K25A 1WZ0A 1WYGA 2IO0B 1RLFA 4S17A 1EWCA 3QWZB 3TJPA 4C80A 4A3OA 1L0YB 2KC2A 1DGJA 3OJ4B 3MP9A 2M8SA 2V3PA 2KQ7A 1SGHA 2Y5BB 1M4VA 4KV2A 5TR5A 1E7UA 5LXIB 5E6PA 1DOXA 3ZYYX 4MSQB 5CHVC 1N62A 1FXIA 1WJ6A 2DZJA 4XDDA 2HDEA 1I4QA 5EE9A 3MC8A 2V3SA 1C79A 4WJOA 4K7WA 3AB5A 2WWZA 1XXGA 2LEKA 2WDQB 1G6JA 4MSMB 5LNK1 2OHFA 2MWSB 4LCDE 4YSZB 1V5TA 1TJEA 2N0SB 2K6QA 2GI9A 2LHEA 5BYSA 3QIJA 1UGMA 5HKHA 5CHWA 3ZTCA 4TKNA 5AZHA 2MJ3A 1NI3A 2VH1A 4NAWA 3O65B 1HZ6A 2DYBA 2PJHA 1WJ4A 2INDC 1J0GA 4JIOU 3AH7A 4MM3B 3IXSA 2NR2A 2I2YA 1V2YA 3JW0X 1YX5B 3PRZA 4LNNA 1ZDVA 2ZCCA 3P4SB 4DHZE 3FC4A 2BS2B 3URYA 3SDLC 4AJYB 3Q6BA 1OTRB 2L0TA 4M0WB 4HRSA 2BYEA 4PS7A 3Q3NC 5C3JB 3Q3FA 4HKZE 2IJ0A 3H6NA 2N1WA 3SEBA 2WGSA 2CJOA 2HD5B 3RNFC 4K7UA 3TMPB 2TSSA 4IWQA 1ZE3D 3L0WB 4FHJA 2D3BA 2L7RA 5L83A 2ZPNA 1YJIA 2WXIA 3RFZB 4TSSA 3N30A 4ITKA 2WXMA 4ZYNA 2KK8A 3T3NA 4JWUC 2IZVB 1Z2MA 3WAPA 2FCSA 1PUTA 4WIPA 1ZDXA 2OEDA 1V80A 2QHOA 1WGRA 1FFUA 1RWSA 4KSLC 3AE8B 1MG4A 2XK5A 1MG8A 3OG5A 1FCLA 1FEHA 2NMQA 1RFAA 3WANA 3Q3JA 3ZNGC 2W3SA 2K8BA 2RGFA 4ANXA 2BWES 4M01A 1FNVA 1E7VA 1EO6A 2N9PC 3SR6A 1F2RC 4OZBA 5BMGA 2KC1A 5C1ZA 1IUEA 5E6NA 2N1VA 1YQ3B 4WJPA 5BO4B 1P3QU 3OLMD 5L95C 3AE6B 3MHSD 5HHDG 1T3QA 1TS2A 3VHTC 3DBRB 3ETRA 2N4FA 3B2GA 5JHBA 2ZCBA 2KZRA 1LFDA 4FN2A 2D5GA 2C7NB 4BZAA 3PZDA 2INCC 3AU4A 5BYRA 2BBCA 2AX5A 3EHVA 3A9JB 2SEBD 3VDZA 3TEYA 1P7EA 2N9LA 1XO3A 2ON8A 1IGCA 1JWUD 1C77A 5HFYA 1J7CA 3ZVVA 1ZW7A 4MGIE 2I1JA 2M19A 1SEBD 4KDIC 1SB3C 3AI5A 2JWUA 3LJ3A 5JZEB 1IPGA 1VZ6A 1Z5SB 1WGYA 4MDKE 5IAAC 3DBHB 1YIWA 1EF5A 2SAKA 4LJPB 1K8RB 3M95A 3V05A 1F77A 2WS3B 2RR9A 4IC7B 1VR9A 2FBWB 4HJGE 3NZUA 3PVLA 4MEMA 1KFYB 2IO3B 1HEZE 1R4NB 2IPKD 1UH6A 4ZOHC 4XE0A 3AE2B 2KYWA 1L6VA 2G45B 3AE7B 1TZOA 4NPNA 3VH3B 4OVZA 3GE8C 2ZNVC 3IT6B 2JZ3B 2KX3A 2L83A 2NBVB 3DVGX 2GBRA 3TSSA 3ZIMA 3MJ5A 2LD9A 1NYRA 1NENB 1QILA 4OHJA 2A4ZA 2MQJA 2L76A 1LXDA 2R2OA 1FNWA 2KFJA 4C4VB 1UF0A 4EE2A 3K9OB 2WXGA 2ASQA 2EKEC 1HE8A 2KACA 2W82A 3QHTA 4NAWB 3AN1A 2MRPA 3N3KB 4I6PA 2MP2A 2JYEA 3PHXB 2JQRB 1UWXA 3RNBC 3P42A 4B95A 2V1YA 2LJ5A 1L4DB 3FKYA 2V4IB 3DBRI 1H4RA 1JCKB 2LUMA 3KYDD 3LDZE 2N7EA 4LLGM 1OFFA 3WAMA 2GOWA 3PREA 3BZDB 4MJSA 3P2BA 4A9AA 2BS4B 2IY1B 3W2DA 1S1QB 1QOAA 4N58A 2D11A 2A5UA 2MLBA 5IP4D 5JXVA 2HE7A 3ONSA 1Y8RC 4KDLB 4G3XB 3NJTA 4JLCA 4WWPA 1X1MA 1UUPA 5G55A 1KF6B 1WE6A 4L1BA 1XEEA 4BVUC 3DBHI 3A4SC 3DWMA 3RZFA 3S2AA 4EFOA 2PVGC 2KAJA 3ML8A 3RULA 3APCA 5H92C 2MX2A 4H2AA 2FUHB 1E8YA 2KDFB 4XGAB 2JRIB 1L5PA 2LJIA 3T3OA 1TTNA 1GAQB 1EM7A 4GDLB 1I4GA 1AN8A 2AEHA 1FCCC 1R4NI 4EZJA 3DVNV 3OJ3A 2QIEB 4W9IA 1FFVA 3ZTDA 2BTEA 1KLVA 2XK5B 3NUHB 1R7SA 1OEYA 2RMMA 3B0AA 4A55A 4CQNA 3JYUA 3O13A 2BS3B 4B0EA 2NBUA 2Z0EB 1I42A 4GLSC 1XD3B 1SBBB 2RDBC 1WH3A 3BVZA 2WDRB 2CHXA 1MFWA 2DYMA 4JL9A 1VD2A 1GT8A 1WGKA 4X57B 5LXHA 1TS4A 4E3CA 1K51A 2J53A 3HIZA 3A33B 3JVZX 2DHZA 4GB9A 2WXNA 3PZ7A 3PS6A 4EOYA 4EEWA 3P1MA 5C2TB 4ZRJA 4P6VF 1CK1A 4YSYB 1JROA 2N9EB 4ARCA 1L7YA 2ZEQA 1XLNA 2LGXA 1SIJA 1DOIA 2ZW1A 1F1HA 4AQ7A 5BYQA 2LRWA 2J0KA 4HPPA 4URKA 3L4PA 3ZJVA 4MGYE 4IWOA 1JW9D 2MBEA 2L8JA 3PZ8A 1FO4A 2JPHA 2DZIA 3EFUA 2L0FA 4FBJB 1RM6C 3ZXRA 3KUCB 3L54A 3J9CA 3IHPC 3PLUA 4MACA 4P1BC 4HLEA 3DQVA 3UF8A 3B2FA 3BINA 1LGRA 3I9V1 4EKUA 2CKHB 1QLBB 1BXTA 2JZZA 2L00B 3GOEA 4C56C 3Q3MC 3ZXVA 1K53A 3JSVA 4W9FA 1TGZB 2H88B 3AM9A 4GOCA 4ACFA 3A1QA 5D6JB 3VUYA 3DHGC 4WAAA 2VH2A 1FM0D 1WF9A 1YQ4B 4ICVA 1R4MB 4AP4C 2E6XA 5DCNA 4OW0A 1WXSA 2UYZB 2OOBB 4FADA 4F7ZA 3N1ZC 2IDYA 2EMTA 4N59A 3L08A 4C00A 2AL3A 1TT5B 2KQSA 5BMHA 3A9JA 3CMMB 1XLOA 3PSEB 3NZSA 2MSED 4M8MA 2GRIA 2CU1A 2LVOA 3CSFA 4IW0A 4IDIA 2MP2B 1WGHA 2FCNA 1HTQA 3CF6E 4BOSC 2JF5A 1TS5A 1SE3A 2WX1A 4ICUA 2V0GA 2GBMA 3ZNZB 3DVNU 2L05A 4NJ6A 4L23A 2ACZB 2PEAA 4AOFA 2K9XA 1L0VB 4MJSB 1PGXA 3M62B 2G3QB 5HI1A 3Q8FA 4FLHA 4DXAB 3BY4B 3QC8B 3AXCA 2YLMA 4W9LA 2REXA 3KVFB 2YEPB 1N5WA 1N61A 3UQBA 1QQRA 1U4AA 1OQYA 1V97A 5D3DA 2JRHA 2QILA 1B9RA 3W5VB 1ZP0B 2KTFA 2MBQA 2PPHA 4OZCA 1A70A 4KVGB 4C4VA 3QJZA 1D5MC 1NBFC 4W9CA 1H8CA 1E7PB 4G0NB 1T0YA 1B1ZA 2BB5A 4US8A 1LQBA 1BMLC 3VR9B 1A5RA 3LYYA 2ICIA 3SFEB 1EU3A 4HK2A 2VZKB 4HKQA 4N6EB 1R4MI 1SJHD 3VRBB 2BYVE
chains in the Genus database with same CATH topology
1CQVA 1JWAD 1IGDA 3BK2A 3MC0B 2L1AA 2XN9C 1WWTA 3BVGA 3AEAB 2KWDA 5BYRA 2MEKA 2BBCA 2PTLA 4RF1A 4DXFA 2AX5A 3Q69A 3CF4A 2SEBD 2LHDA 5EE3A 3TEYA 4WQMA 4WAFA 1P7EA 1DOYA 2N9LA 1XO3A 2ON8A 4YSXB 1YN5A 2HTME 1IGCA 2NTSA 2WDVB 4AS1A 1JWUD 1C77A 5HFYA 1K52A 1J7CA 3Q8BA 2M19A 3AEEB 3TEZA 1C78A 1SEBD 2WXHA 3NZ3A 2AQ3B 1SB3C 1ZXIA 2WQYB 3BK1A 2JWUA 1H7XA 1TYGB 1VZ7A 4KKIA 2WU2B 1VZ6A 2EELA 3HRDD 3SFDB 1ACCA 2K0PA 1TY2A 1PGBA 3NVVA 2SAKA 3E9SA 4WH4A 3V05A 1F77A 3EA6A 1I4XA 2WS3B 3P4QB 1CJEA 2EKIA 1SE2A 5HG2A 1VR9A 1FMAD 2FBWB 4HJGE 2DBYA 4B0MA 1KFYB 1XLQA 3P63A 3W1SA 1HEZE 1MI0A 1PFDA 4IOIE 1SE4A 3ZQ4A 3H8HA 2IPKD 2L32A 4ZOHC 4XE0A 3AE2B 4DXGA 1L6VA 5BMIA 3AE7B 2WU5B 1ZOYB 1PYWD 5T8IA 1F0ZA 1GB4A 1D6EC 4M0WA 1TZOA 4OVZA 5AUKA 4KX6B 3IT6B 2L83A 3HVZA 4FXCA 3TSSA 1UWMA 3P4RB 3MJ5A 1NYRA 2FUG1 1NENB 4JWSC 1D4BA 1QILA 4OHJA 1FNUA 2BB6A 3NVZA 2M56B 4WURA 2WXOA 3AE4B 3NRZA 3CIRB 1FNWA 4PT5A 3AEFB 3U2SC 1YN3A 4EE2A 2N7JA 2WXGA 3FILA 1P7FA 4WWMA 2KACA 2W82A 4RGTA 4NAWB 3CWIA 3AN1A 1YNTE 3AE5B 4USAA 4TQ1A 1C4CA 2JYEA 2WNMA 1NVID 2JQRB 4P16A 1NYQA 3DWGC 1UWXA 2AQ1B 3P42A 1L0XB 3B9JA 2JYTA 1ROEA 1L4DB 2PW9A 2V4IB 1L4ZB 1XLPA 3AEBB 2CU3A 4YTPB 4ZHOA 3ABVB 1RYJA 2IGHA 2JXTA 2JX5A 1JCKB 2LUMA 2QMTA 2RDHA 3IAS1 5G5HA 4RNAA 4UDUC 1XCQL 3Q8AA 4LLGM 2RDGA 5GXGB 4JX1C 2Z8LA 1OFFA 4LTUA 1HA5A 1WSPA 3GP7A 3FAHA 5E6JA 1TKEA 1SSNA 3BZDB 4R3DA 2JU6X 3VQIA 1K50A 2BW2A 1JMLA 4A9AA 3W5UB 2BS4B 3W2DA 5G5GA 3VR8B 3RPFC 1N60A 1QOAA 4ZRPA 1V8CA 4A90A 4N58A 1C4AA 1E10A 2W54A 1I7HA 1T6BX 4RGNA 4O1NA 1ENFA 2IGGA 1T5XD 4NZLB 4Q2JA 5EE0A 1J7AA 1ESFA 2IGDA 2YEPF 5JXVA 3V3XA 3MFGA 4ARIA 1SF0A 1ZUD2 1L6UA 3C8YA 4US9A 2JSVX 1ET6A 1F2RI 1V1OA 1VDVA 1UUPA 1KF6B 3AE1B 4L1BA 3TEXA 1XEEA 4KGRA 3DWMA 2PVGC 2KAJA 4RGOS 1QOFA 5H92C 1I4HA 1OQRA 1GTHA 4H2AA 4REZA 1IBXB 1JWBD 3BYYB 1I4RA 1QOGA 4ZYSA 2LJIA 1L5PA 5FK9C 3T3OA 1GB1A 1GAQB 1EM7A 1AYFA 4GDLB 5D3IB 1I4GA 1AN8A 3AMZA 1FCCC 3U7ZA 2MJDA 4YTNB 2LFIA 2L52A 4HROA 1N5XA 2QIEB 1FFVA 2BTEA 3IT4B 1XF5L 3NUHB 1I4PA 1R7SA 2PMVA 3EGRA 4JE3B 2KQ4X 1MHXA 1JQ4A 1TY0A 2RMMA 4RH6A 4A55A 4CQNA 1N63A 1E9MA 2J52A 4KGSA 3TUOA 3O13A 2BS3B 2WXKA 4B0EA 2WLBA 2GB1A 1PDXA 4OZAA 4GLSC 3NVYA 1SBBB 3VRAB 3R2IA 3KWVA 2PVOD 3BVZA 3GB1A 2WDRB 2WXLA 2VZKD 1WYGA 2KN4A 3MHZA 2DYMA 1FD6A 3KQ4A 1EWCA 1GT8A 1WGKA 1TS3A 4C80A 2WXFA 1TS4A 3NVWA 1K51A 2J53A 1L0YB 2J4XA 1DGJA 3MP9A 1V1PB 4NAMA 2LMCA 2V3PA 1H7WA 2DWQA 2WXNA 3PZ7A 1TKGA 3GS2A 5EE1A 3P1MA 5C2TB 3ZJUA 1M4VA 4P6VF 1CK1A 4YSYB 1C4PA 1JROA 4ARCA 1DOXA 2AQ2B 3ZYYX 1KLUD 1XLNA 4TQ0A 1SIJA 4C7ZA 3R8BA 1N62A 1DOIA 2QJLA 1FXIA 2ZW1A 1MHHE 4XDDA 5H8YE 4AQ7A 5BYQA 2HDEA 1I4QA 1FRDA 5EE9A 2WXJA 3U52E 1JALA 1E6EB 3L4PA 3AECB 4RGMA 5I4DA 4IKGA 3ZJVA 4HEA1 3I57A 1C79A 2Y5PA 4YWGG 1JW9D 3N9YC 3AB5A 1QF6A 1XXGA 2LEKA 2WDQB 3PZ8A 3Q8EA 1FO4A 3Q8CA 3U4EG 5LNK1 1RM6C 4RF0A 3AE3B 1XCTL 2WXPA 2OHFA 1D5ZC 4NJCA 1QOBA 4YSZB 1MVKA 1TJEA 3EUB2 3J9CA 2N0SB 1JWSD 5BYSA 2GI9A 2LHEA 4MACA 2DYOA 1JWMD 1KRHA 1KH0A 3LB8C 2MJ3A 3B2FA 1WXQA 1NI3A 3I9V1 2WXRA 3AE9B 1HZ6A 2FE8A 1VZ8A 4JPSA 1AW7A 1QLBB 1BXTA 2E3TA 3BYTB 3AH7A 4C56C 3KWLA 1QKZA 4MM3B 2BT6A 4DQOC 1K53A 3IXSA 3HUIA 2I2YA 1NEKB 4KGTA 1MPEA 1C76A 4MH8A 3PO0A 2H88B 3AM9A 1PGAA 1QT9A 1ZDVA 2ONQA 1HXYD 2QEJC 3P4SB 1RFKA 3R2TA 3FC4A 2BS2B 1STEA 4A6QA 3URYA 3KLSX 2G1EA 3AV8A 1FM0D 1HZ5A 1YN4A 3UI3A 1YQ4B 2MJEA 3P4PB 2E6XA 3IAM1 4OW0A 1VRAB 3AEDB 4HRSA 1EWYC 5D7GA 5AUIA 5C3JB 2V3NA 3HVDA 4HKZE 1KTKA 2IDYA 4N59A 1J7BA 2IJ0A 3AEGB 1OQQA 1FIQA 3SEBA 1VJKA 2Y3AA 2KDMA 2PLPA 2R61A 2CJOA 5BMHA 4RFBA 4TMAB 1XLOA 1SXTA 2KMMA 2TSSA 1ZPSA 1ZE3D 3FILB 2GRIA 1YJIA 3TEWA 2WXIA 3RFZB 3W9CB 3BWUD 4TSSA 4ITKA 4GDKB 1VLBA 1GTEA 4ZRQA 5TSSA 2WXMA 1DYQA 4IDIA 3ZJTA 4XDCA 1Y56A 3ZGZA 1UGJA 1Q10A 2Q5WD 4JWUC 3T3NA 4ZHPA 4MT5A 1IBXA 2NTTA 2JZPA 4YXDB 1SE3A 1TS5A 1JRPA 1PUTA 4WIPA 1AWDA 1ZDXA 2B76B 2OEDA 3WCQA 4C7YA 2V0GA 1FFUA 1YJJA 2PKOA 3BIID 1FRRA 1RWSA 2BYTA 3E56A 2I38A 2N9KA 3LXFA 4L23A 3AE8B 2J42A 4XWTA 1BUIC 2ACZB 1YMHE 3NS1A 1FCLA 1FXAA 1FEHA 3OWEB 2NMQA 4RCOA 2RPVA 2K9XA 1KLGD 4XWWA 1L0VB 2LGIA 2WXQA 1E0ZA 1PGXA 2G9HD 1ET9A 5HI1A 3Q8FA 4KKJA 2W3SA 1SJED 2INPE 4YT0B 2YEPB 1UNSA 1GPXA 1LO5D 1N5WA 1N61A 1QQRA 1FNVA 1GOZA 4L2YA 4D2KA 1V97A 5D3DA 2H89B 2QILA 1B9RA 2CJNA 3SR6A 3W5VB 1ZP0B 1F2RC 1EU4A 3BVMA 1V1PA 2K3UA 2K22A 4OZBA 2XNAC 4YTMB 4OZCA 1A70A 5BMGA 2QSDA 5FKAC 1IUEA 1C9FA 1YQ3B 2INNE 5MPOA 1D5MC 4J3OD 1D5XC 1ZXHA 3AE6B 1HQRD 4LK0M 1TKYA 2DLBA 1E7PB 2K5PA 1CZPA 5HHDG 2MH7A 1T3QA 1B1ZA 2BB5A 4US8A 1BMLC 2PIAA 2W3RA 2WP9B 1TS2A 2Y5CA 3VR9B 2X38A 2W55A 3ETRA 3LYYA 3B2GA 2ICIA 2ZW0A 3SFEB 1EU3A 1WRIA 2VZKB 2M0AA 4HKQA 4N6EB 1SJHD 3VRBB 2D5GA 4A8XC 5FR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROE A;  1FIQ A;  1JWA D;  1VJK A;  1XLP A;  3AEB B;  2CU3 A;  4YTP B;  4ZHO A;  2CJO A;  1H7W A;  2DWQ A;  1WWT A;  3AEA B;  1TKG A;  1XLO A;  3P1M A;  3ABV B;  1RYJ A;  5C2T B;  2KMM A;  2AX5 A;  5EE1 A;  3RPF C;  3CF4 A;  2JX5 A;  5EE3 A;  5G5H A;  4WQM A;  4P6V F;  4YSY B;  1JRO A;  1DOY A;  1DOX A;  1XO3 A;  3ZYY X;  4YSX B;  1YJI A;  2HTM E;  5GXG B;  1XLN A;  2WDV B;  3W9C B;  1SIJ A;  4JX1 C;  4C7Z A;  4ITK A;  1N62 A;  1VLB A;  1GTE A;  1J7C A;  1DOI A;  1OFF A;  4LTU A;  3FAH A;  2QJL A;  1FXI A;  4IDI A;  1TKE A;  5H8Y E;  2M19 A;  2Q5W D;  4JWU C;  4ZHP A;  3AEE B;  4A9A A;  3W5U B;  2BS4 B;  5G5G A;  1FRD A;  5EE9 A;  3VR8 B;  1SB3 C;  1JAL A;  1E6E B;  2WQY B;  1N60 A;  1QOA A;  4YXD B;  3AEC B;  1V8C A;  1ZXI A;  3L4P A;  1H7X A;  1JRP A;  1TYG B;  1PUT A;  4N58 A;  1AWD A;  2W54 A;  2B76 B;  1I7H A;  1JW9 D;  2WU2 B;  3AB5 A;  3WCQ A;  1QF6 A;  4C7Y A;  2LEK A;  3HRD D;  1FFU A;  2WDQ B;  3SFD B;  1YJJ A;  2PKO A;  3BII D;  1FRR A;  5EE0 A;  1RWS A;  1FO4 A;  1J7A A;  1E10 A;  3NVV A;  1RM6 C;  3AE3 B;  1SF0 A;  2OHF A;  1ZUD 2;  1L6U A;  3LXF A;  4US9 A;  1QOB A;  3AE8 B;  4YSZ B;  1TJE A;  3EUB 2;  2N0S B;  2ACZ B;  1VDV A;  2WS3 B;  3P4Q B;  1CJE A;  3NS1 A;  1KF6 B;  2EKI A;  3AE1 B;  1FXA A;  1FMA D;  2FBW B;  2DBY A;  3DWM A;  2K9X A;  1KFY B;  1L0V B;  2PVG C;  2KAJ A;  1XLQ A;  3P63 A;  1E0Z A;  1KRH A;  1QOF A;  5H92 C;  1PFD A;  1OQR A;  1GTH A;  3LB8 C;  1JWB D;  2W3S A;  4ZOH C;  2MJ3 A;  3B2F A;  3AE2 B;  1QOG A;  1WXQ A;  1L6V A;  4YT0 B;  3AE7 B;  1L5P A;  1NI3 A;  2WU5 B;  1GPX A;  3AE9 B;  1GAQ B;  1ZOY B;  1AYF A;  1N5W A;  3AMZ A;  1F0Z A;  2MJD A;  1QLB B;  1N61 A;  4YTN B;  2E3T A;  2L52 A;  3AH7 A;  5AUK A;  3KWL A;  4KX6 B;  2L83 A;  4HRO A;  3HVZ A;  4FXC A;  2BT6 A;  1V97 A;  1N5X A;  2QIE B;  2H89 B;  1UWM A;  1NEK B;  1FFV A;  3P4R B;  3HUI A;  1B9R A;  2CJN A;  3SR6 A;  1NYR A;  3W5V B;  1NEN B;  1ZP0 B;  4JWS C;  1R7S A;  3PO0 A;  2H88 B;  3AM9 A;  2M56 B;  3NVZ A;  2K22 A;  1JQ4 A;  1QT9 A;  3AE4 B;  4YTM B;  3CIR B;  1A70 A;  3NRZ A;  3AEF B;  3P4S B;  1N63 A;  1E9M A;  1IUE A;  2BS3 B;  1YQ3 B;  1RFK A;  2WLB A;  3FC4 A;  5MPO A;  2BS2 B;  1PDX A;  2G1E A;  3AV8 A;  1FM0 D;  4WWM A;  3NVY A;  3VRA B;  3AE6 B;  1YQ4 B;  2MJE A;  1TKY A;  2PVO D;  1E7P B;  2WDR B;  2K5P A;  3CWI A;  3P4P B;  1CZP A;  2MH7 A;  1T3Q A;  3AN1 A;  1WYG A;  3AE5 B;  4US8 A;  2PIA A;  2W3R A;  2WP9 B;  4USA A;  3AED B;  3VR9 B;  2Y5C A;  1GT8 A;  1WGK A;  2W55 A;  1EWY C;  3ETR A;  1NVI D;  2JQR B;  3B2G A;  4HRS A;  5AUI A;  3SFE B;  1NYQ A;  3DWG C;  3NVW A;  1WRI A;  4C80 A;  5C3J B;  4N6E B;  4N59 A;  3VRB B;  1J7B A;  3AEG B;  1DGJ A;  1OQQ A;  3B9J A; 
#chains in the Genus database with same CATH topology
 1CQV A;  1J19 A;  1YOV B;  3BK2 A;  3MC0 B;  3TEZ A;  2XN9 C;  2KWD A;  4HCN B;  4RF1 A;  2PTL A;  3Q69 A;  3CF4 A;  1P9D U;  2LHD A;  5KHQ A;  2ZVO A;  2HTM E;  3TCA A;  3Q14 C;  1K52 A;  1CMX B;  2KMA A;  2WXH A;  3QAQ A;  2AQ3 B;  4QAY A;  4KIK B;  2KDB A;  2LWP A;  2GBK A;  1WX7 A;  3HRD D;  1L2N A;  4DDI D;  3WIM A;  3NVV A;  2GBJ A;  3L13 A;  3ZO5 B;  2HTH A;  3E9S A;  1NI2 A;  2MBH A;  1EUV B;  4FJV B;  2JT4 B;  1WI0 A;  4IM3 A;  2BQQ A;  3A9K A;  1XLQ A;  4IOI E;  3ZQ4 A;  1Q0W B;  4GDL A;  2WU5 B;  3VFK A;  1F0Z A;  4K3C A;  4M00 A;  2R2Q A;  1V9J A;  5AUK A;  4CHK A;  3V60 A;  4OVV A;  3UIP B;  1AAR A;  1UWM A;  4K1R B;  2FUG 1;  2KAN A;  3MC9 A;  4XZ4 A;  1WGD A;  2BB6 A;  3NVZ A;  2BPS A;  2JVC A;  4KSK C;  4E71 A;  3AE4 B;  1WX9 A;  2DZK A;  3CIR B;  3NRZ A;  2RPQ A;  4PT5 A;  3AEF B;  4WJN A;  1P7F A;  4WWM A;  3IFW B;  1P98 A;  2DNF A;  2AYO B;  4TQ1 A;  4AWJ A;  1NYQ A;  3ECI A;  4BAX A;  4BKS D;  2JY6 A;  3JSV B;  3RI7 C;  3B9J A;  1UZX B;  3A1Q B;  2KLC A;  4LJO B;  3VUX A;  4HJK A;  2QMT A;  2RDH A;  4HXD A;  3UIN B;  4RNA A;  3ZKJ C;  4JX1 C;  5E6O A;  2Z8L A;  1KJT A;  4LTU A;  1WSP A;  3GP7 A;  4IG7 B;  4A3P A;  1SSN A;  4R3D A;  2JU6 X;  4XYC A;  2BKF A;  3PTF C;  3VR8 B;  4K7S A;  1E10 A;  1V8C A;  2KX0 A;  3M63 B;  1OGW A;  3C19 A;  2W54 A;  4RGN A;  4O1N A;  2KFK A;  3PGE A;  2IGG A;  4Q2J A;  5EE0 A;  4IM2 A;  3V3X A;  3C8Y A;  1L6U A;  4US9 A;  4EUT A;  2K39 A;  3DBS A;  3AE1 B;  4GMV A;  2CHW A;  5FR6 A;  4RGO S;  1OQR A;  1JWB D;  3BYY B;  3Q3O C;  2K1F A;  5FK9 C;  2B3A A;  3H7P A;  1GB1 A;  3AMZ A;  4LNF A;  4JQW C;  1N5X A;  3RNE C;  1WXA A;  3L10 B;  3VUW A;  3IT4 B;  4JE3 B;  1MHX A;  1WZ3 A;  1JQ4 A;  4JGH B;  4RH6 A;  1N63 A;  1E9M A;  3TUO A;  3L17 A;  2LGD A;  3NVY A;  3TIX A;  1P0R A;  3IBE A;  2RD0 A;  3GB1 A;  3A4R A;  2VZK D;  3QQ8 B;  2JWZ A;  4NNJ B;  2NPT A;  3KQ4 A;  4S0R A;  1TS3 A;  1WXV A;  2WXF A;  3NVW A;  3WAL A;  4WWN A;  4ANU A;  4BKS A;  1FPY A;  1H7W A;  4PK1 A;  3GS2 A;  5EE1 A;  4OVU A;  5AEK B;  4GGQ A;  2AQ2 B;  2KKC A;  1KLU D;  4TQ0 A;  4C7Z A;  3R8B A;  3APF A;  2C9W B;  2IBI B;  1MHH E;  2AL6 A;  3PRM B;  5H8Y E;  2V4L A;  3W1S C;  2WXJ A;  1JAL A;  1E6E B;  4RGM A;  5I4D A;  3DPD A;  4IKG A;  4HEA 1;  4ZDV A;  3I57 A;  2L3Z A;  2Y5P A;  3NG0 A;  4YWG G;  3N9Y C;  2C7M B;  3Q8C A;  3AE3 B;  1D5Z C;  1QOB A;  1MVK A;  1SE9 A;  3EUB 2;  3I63 C;  1WY8 A;  2KHW B;  3KW5 B;  1JWS D;  4BBN F;  5GMV A;  1JWM D;  1KH0 A;  4HDO A;  1WXQ A;  4WWO A;  5DPW A;  2WXR A;  2G4S A;  2E3T A;  3WAO A;  1QKZ A;  4F8C B;  3RT3 B;  1M94 A;  1SIF A;  4KGT A;  4MH8 A;  3HHM A;  3PO0 A;  2ZVN A;  4MH0 E;  2FAZ A;  4KZ0 A;  1HXY D;  2FID A;  3A9K B;  1RFK A;  1TZ1 A;  2O6V A;  3R2T A;  3T9L A;  1STE A;  3KLS X;  3VTV A;  1YN4 A;  3UI3 A;  2MJE A;  3GE3 C;  1IP9 A;  3P4P B;  3DHH C;  3IAM 1;  1VRA B;  3AED B;  4MGZ E;  5D7G A;  5AUI A;  4HDQ A;  2KWV B;  2V3N A;  1KTK A;  3AU5 A;  1J7B A;  2JXX A;  1FIQ A;  2Y3A A;  4YL8 A;  2R61 A;  3V6E B;  1V86 A;  4RFB A;  2KMM A;  1ZPS A;  4GN1 A;  3RN9 C;  2X8X X;  3TEW A;  3BWU D;  4K81 A;  1VLB A;  2J0J A;  1DYQ A;  4XDC A;  1Q10 A;  4ZHP A;  1E90 A;  1XT9 B;  4LNI A;  1EF1 A;  1UEL A;  4KIK A;  1JRP A;  4BKG A;  5CHF A;  2D3A A;  4C7Y A;  1YJJ A;  5D2M B;  3BII D;  2G4D B;  3OAW A;  4XX5 A;  4G11 A;  4II2 B;  2KWC A;  4NQL B;  3M3J A;  3NS1 A;  1FXA A;  4XWW A;  2LGI A;  2WXQ A;  1E0Z A;  4DHJ B;  2MHJ A;  4KKJ A;  4B9K A;  1SJE D;  2INP E;  1WGG A;  4YT0 B;  2WX0 A;  1RAX A;  1UNS A;  1GPX A;  2KFK B;  2KWU B;  2K8C A;  3N20 C;  4FA6 A;  5DPR A;  4LNO A;  1JRU A;  2K8H A;  3CST A;  5J17 A;  1V1P A;  1F9J A;  2K22 A;  1HTO A;  2K3U A;  2XNA C;  4YTM B;  1YD8 U;  2QSD A;  3DCG A;  2INN E;  5MPO A;  2D10 A;  2NBW B;  1D5X C;  1ZXH A;  3IG3 A;  4LK0 M;  3RNG C;  1TKY A;  3VXW A;  2DLB A;  4MEL A;  2K5P A;  3H7P B;  3NY5 A;  3EC8 A;  3DOW A;  2W3R A;  2WP9 B;  3VTW A;  1NDD A;  3SU8 X;  2W55 A;  2PE6 B;  3EFC A;  4LDT B;  3ZRC A;  1WRI A;  1WR1 A;  2M0A A;  2QDF A;  1JWA D;  2BYT A;  1WWT A;  2MEK A;  4DXF A;  5EE3 A;  3K9P B;  4PS3 A;  4WQM A;  4WAF A;  2C7H A;  4GSW A;  1DOY A;  2QC8 A;  5CTR C;  2NTS A;  3HK0 A;  2FCQ A;  1UD7 A;  1GG3 A;  4AJW A;  2NPT B;  2EMS A;  1C78 A;  5AZG A;  3N1X C;  3BK1 A;  1H7X A;  1TYG B;  4KKI A;  3ALB A;  2WU2 B;  1F52 A;  3T8M A;  2EEL A;  2K0P A;  1PGB A;  5DPT A;  3MJW A;  4DBG A;  4ANW A;  4F1S A;  3RZW C;  3ZNI D;  4FJZ A;  3L16 A;  3EA6 A;  1CJE A;  1SE2 A;  3KYC D;  5HG2 A;  3V6C B;  4A20 A;  3PRP B;  3P63 A;  2L32 A;  2D3C A;  4DXG A;  1LM8 B;  5BMI A;  2YVC A;  5IOI A;  1GB4 A;  1YQB A;  1D6E C;  2ZJD A;  3MTN B;  3ZNH B;  1WRD B;  4KX6 B;  2RSU A;  4DHZ B;  4AUQ C;  4JWS C;  1FNU A;  2M56 B;  4RM9 A;  3U2S C;  2N7J A;  1WIA A;  2BKR B;  3FIL A;  1ZKH A;  4ASW C;  3PT2 B;  3SD5 A;  4RGT A;  2KD0 A;  4GDK A;  1GUA B;  3AE5 B;  1V81 A;  1WMH A;  4USA A;  1YJ1 A;  2QCZ A;  2IO1 B;  2LGY A;  2WDT B;  2WNM A;  2KOX A;  3N1Y C;  4DWF A;  3WA0 A;  2KJ6 A;  1I35 A;  2DX5 B;  4P1C C;  2JYT A;  2MBB B;  1XLP A;  3AEB B;  3RNC C;  4YTP B;  5LLI A;  1V6E A;  4ZRI A;  3DDC B;  3ABV B;  3QK0 A;  1UBI A;  2JX5 A;  2NS5 A;  2O6V B;  5G5H A;  3IAS 1;  4UDU C;  1WR6 E;  2KMC A;  5GXG B;  2LUE A;  5DPS A;  2KTR B;  2CS4 A;  2V9H A;  2FNJ B;  3KH0 A;  2BW2 A;  3R7Q A;  3W5U B;  2ZNV B;  5G5G A;  3W1Y A;  4ZRP A;  4A90 A;  1C4A A;  1I7H A;  2FIF A;  1ENF A;  4NZL B;  2M17 A;  3PHW B;  2YEP F;  3MFG A;  4II3 B;  1SF0 A;  1ZUD 2;  2JSV X;  1ET6 A;  1F2R I;  4DHJ D;  1V1O A;  3TEX A;  1E5W A;  1OEY J;  1QOF A;  1GTH A;  3HM3 A;  4IM0 A;  1I4R A;  1QOG A;  2K6D B;  2XBB C;  5D3I B;  3NHE B;  1GC7 A;  1C1Y B;  2MJD A;  3QA8 A;  2LFI A;  2BF8 B;  2L52 A;  2BWF A;  2KXJ A;  3VTU A;  1I4P A;  2PMV A;  3EGR A;  2NCN A;  2BYF A;  3DVG Y;  3ZDT A;  5JHA A;  2DAF A;  2GLS A;  2N9X A;  5KHO A;  2LZ6 A;  4KGS A;  2J52 A;  3ZRF A;  2WLB A;  2GB1 A;  1PDX A;  4BKT A;  4W9E A;  3KWV A;  4I6L B;  2PVO D;  1KM7 A;  3GZN B;  2WXL A;  4LDT D;  4E74 A;  1ISN A;  2KN4 A;  2NVU I;  3MHZ A;  1FD6 A;  1WXM A;  2M4N A;  2M0X A;  2IY0 B;  3DHI C;  3EEC A;  3H7S A;  3VVW B;  2J4X A;  2J7Q B;  2C5L C;  1V1P B;  3KUD B;  4NAM A;  2LMC A;  2DWQ A;  1TKG A;  3QX1 A;  3ZJU A;  3R66 C;  1C4P A;  3NOB A;  1T0R C;  3ZW3 A;  3APD A;  2QJL A;  3RD2 A;  1FRD A;  3B1L X;  1E8W A;  4M02 A;  3U52 E;  2MW5 A;  3AEC B;  2KVZ A;  4M8N A;  1QF6 A;  3QCA A;  4W9G A;  2KNB A;  1E8X A;  3Q8E A;  2D07 B;  3U4E G;  4RF0 A;  1XCT L;  2WXP A;  4NY0 A;  3RCZ A;  2WHI A;  1S3S G;  4NJC A;  1P1A A;  1WM2 A;  2UU7 A;  2D3G A;  3RNA C;  5J2R A;  5J18 A;  4KZC A;  1ZGU B;  2DYO A;  1KRH A;  3H1U A;  3LB8 C;  1PQS A;  3AE9 B;  2FE8 A;  3V61 A;  1VZ8 A;  4JPS A;  5D94 A;  4FUL A;  2KVR A;  1AW7 A;  3BYT B;  2KT7 A;  5IA7 A;  3KWL A;  2BT6 A;  4DQO C;  3HUI A;  1NEK B;  1MPE A;  2LAS A;  1C76 A;  2N7D A;  2XEW A;  3UGB B;  4DDG D;  4DK5 A;  3AUL A;  1PGA A;  1QT9 A;  2VRR B;  2ONQ A;  2QEJ C;  3HM6 X;  1V49 A;  4A6Q A;  2G1E A;  3AV8 A;  1HZ5 A;  1WJN A;  2MBO A;  4GXB A;  2KN5 A;  5CX3 A;  1EWY C;  5C23 A;  4BOZ B;  4PYZ A;  3PLV A;  3HVD A;  4W9H A;  3GZN I;  3AEG B;  1OQQ A;  3U30 A;  4EZL A;  2O6V D;  2KDI A;  3ZUN A;  3PPA A;  1VJK A;  3NS8 A;  2KDM A;  2PLP A;  1XQQ A;  1J8C A;  4TMA B;  1SXT A;  2DAJ A;  3FIL B;  3W9C B;  4FHK A;  1GC6 A;  4CYE A;  4GDK B;  1GTE A;  4ZRQ A;  5TSS A;  1WMH B;  2D2Q A;  3ZJT A;  1Y56 A;  3ZGZ A;  2IYD B;  1UGJ A;  2Q5W D;  4MT5 A;  3VAW A;  1IBX A;  2NTT A;  2JZP A;  4YXD B;  4IUM B;  1AWD A;  2B76 B;  4P7I A;  2PE9 A;  3RUI B;  3WCQ A;  1WM3 A;  2HJ1 A;  4TUU A;  3RMK C;  2PKO A;  1FRR A;  2ZZP B;  3E56 A;  2IO2 B;  4PYU A;  2I38 A;  2N9K A;  3LXF A;  2LVQ A;  2J42 A;  4XWT A;  1BUI C;  1WFY A;  1YMH E;  4B6W A;  2O2V A;  3R7R A;  3OWE B;  4CO7 A;  4RCO A;  2RPV A;  1KLG D;  4ANV A;  2G9H D;  1ET9 A;  4GU2 A;  1TIF A;  3DBL B;  4RMA A;  1LO5 D;  4TV3 A;  3I5J C;  1Q5W B;  4ZRK A;  5G2N A;  1GOZ A;  4L2Y A;  2MCN B;  4D2K A;  2H89 B;  2LXC A;  2CJN A;  2KLG A;  3Q2A C;  2LXA A;  2LRU A;  2W9N A;  1EU4 A;  3BVM A;  4EZK A;  1WX8 A;  3RYT A;  5FKA C;  2Z0D B;  2LVP A;  1C9F A;  4J3O D;  2LGS A;  1HQR D;  1CZP A;  2MH7 A;  2PIA A;  4HWI B;  2Y5C A;  2X38 A;  2KJR A;  2C60 A;  2ZW0 A;  5IKC M;  5JH5 C;  2MA9 B;  2LI5 A;  1IYF A;  4A8X C;  5FR3 A;  2OJW A;  1IGD A;  5IO9 A;  2L1A A;  3BVG A;  3AEA B;  4W9J A;  3U7D A;  3ZLZ A;  3X23 A;  3VH4 B;  2KO3 A;  2KTR A;  4YSX B;  1YN5 A;  2CR5 A;  2OJR A;  2WDV B;  2BVC A;  4W9K A;  4AS1 A;  4HCP B;  2M1M A;  3KUZ A;  3Q8B A;  3AEE B;  4K3B A;  3NZ3 A;  2WQY B;  1ZXI A;  2FCM A;  1VZ7 A;  4WQO B;  4NJ7 A;  2GBN A;  3SFD B;  1ACC A;  1TY2 A;  4RM8 A;  4MM3 A;  5EDS A;  1WJU A;  2I1K A;  1QZE A;  4WH4 A;  1I4X A;  2WYQ A;  3P4Q B;  3C0R B;  2EKI A;  4NQK E;  1FXT B;  1FMA D;  2DBY A;  1VCB A;  3IVF A;  4B0M A;  1KOT A;  3TL5 A;  3ENE A;  1Q1O A;  3R3M A;  3W1S A;  2BGF A;  3U8Z A;  1MI0 A;  1PFD A;  4WJQ A;  1SE4 A;  4G50 A;  3H8H A;  4J6I A;  1GNU A;  3N32 A;  1V5O A;  3QAR A;  1UBQ A;  1ZOY B;  1PYW D;  5T8I A;  4M0W A;  3HVZ A;  4FXC A;  3DBL I;  3P4R B;  1TBE A;  4BFR A;  1D4B A;  4HPL B;  4WUR A;  2WXO A;  1WE7 A;  3D32 A;  1YN3 A;  4FJY A;  4XC2 A;  1T0S C;  2ZPY A;  4GIV A;  3CWI A;  1YNT E;  2DEN B;  4IWP A;  1C4C A;  2Z59 B;  1NVI D;  4P16 A;  3DWG C;  2AQ1 B;  3V62 A;  1L0X B;  1ROE A;  2PW9 A;  1L4Z B;  1T0Q C;  2CU3 A;  4ZHO A;  3ML9 A;  2CHZ A;  1RYJ A;  2IGH A;  1E8Z A;  2JXT A;  1XCQ L;  3Q8A A;  1N6Z A;  2HJ8 A;  2RDG A;  3B08 A;  1HA5 A;  1BT0 A;  3FAH A;  5E6J A;  3ZDM C;  1TKE A;  4HVB A;  3VQI A;  1K50 A;  4W9D A;  1RRB A;  1JML A;  2KDE B;  1WYW B;  2UWQ A;  4HPM B;  3RPF C;  3TBL D;  1N60 A;  5AZF A;  2KJH B;  1T6B X;  2GMI C;  5IN7 A;  3H9D A;  1MJD A;  1T5X D;  1J7A A;  1ESF A;  2IGD A;  4BBN C;  1D3Z A;  4ARI A;  4LNK A;  4PS8 A;  1VDV A;  3X0W A;  4I6N B;  4KGR A;  4N9F 4;  4MGK E;  3SHQ A;  3PV1 A;  1I4H A;  1C3T A;  4REZ A;  1IBX B;  4ZYS A;  1YX6 B;  3UQA A;  1AYF A;  2DZM A;  3U7Z A;  4YTN B;  4HRO A;  2AWT A;  2JUO A;  1XF5 L;  3I3T B;  2KQ4 X;  2O2V B;  1TY0 A;  2WXK A;  4OZA A;  1GJZ A;  2J0M A;  3R2I A;  3VRA B;  3UIO B;  2K25 A;  1WZ0 A;  1WYG A;  2IO0 B;  1RLF A;  4S17 A;  1EWC A;  3QWZ B;  3TJP A;  4C80 A;  4A3O A;  1L0Y B;  2KC2 A;  1DGJ A;  3OJ4 B;  3MP9 A;  2M8S A;  2V3P A;  2KQ7 A;  1SGH A;  2Y5B B;  1M4V A;  4KV2 A;  5TR5 A;  1E7U A;  5LXI B;  5E6P A;  1DOX A;  3ZYY X;  4MSQ B;  5CHV C;  1N62 A;  1FXI A;  1WJ6 A;  2DZJ A;  4XDD A;  2HDE A;  1I4Q A;  5EE9 A;  3MC8 A;  2V3S A;  1C79 A;  4WJO A;  4K7W A;  3AB5 A;  2WWZ A;  1XXG A;  2LEK A;  2WDQ B;  1G6J A;  4MSM B;  5LNK 1;  2OHF A;  2MWS B;  4LCD E;  4YSZ B;  1V5T A;  1TJE A;  2N0S B;  2K6Q A;  2GI9 A;  2LHE A;  5BYS A;  3QIJ A;  1UGM A;  5HKH A;  5CHW A;  3ZTC A;  4TKN A;  5AZH A;  2MJ3 A;  1NI3 A;  2VH1 A;  4NAW A;  3O65 B;  1HZ6 A;  2DYB A;  2PJH A;  1WJ4 A;  2IND C;  1J0G A;  4JIO U;  3AH7 A;  4MM3 B;  3IXS A;  2NR2 A;  2I2Y A;  1V2Y A;  3JW0 X;  1YX5 B;  3PRZ A;  4LNN A;  1ZDV A;  2ZCC A;  3P4S B;  4DHZ E;  3FC4 A;  2BS2 B;  3URY A;  3SDL C;  4AJY B;  3Q6B A;  1OTR B;  2L0T A;  4M0W B;  4HRS A;  2BYE A;  4PS7 A;  3Q3N C;  5C3J B;  3Q3F A;  4HKZ E;  2IJ0 A;  3H6N A;  2N1W A;  3SEB A;  2WGS A;  2CJO A;  2HD5 B;  3RNF C;  4K7U A;  3TMP B;  2TSS A;  4IWQ A;  1ZE3 D;  3L0W B;  4FHJ A;  2D3B A;  2L7R A;  5L83 A;  2ZPN A;  1YJI A;  2WXI A;  3RFZ B;  4TSS A;  3N30 A;  4ITK A;  2WXM A;  4ZYN A;  2KK8 A;  3T3N A;  4JWU C;  2IZV B;  1Z2M A;  3WAP A;  2FCS A;  1PUT A;  4WIP A;  1ZDX A;  2OED A;  1V80 A;  2QHO A;  1WGR A;  1FFU A;  1RWS A;  4KSL C;  3AE8 B;  1MG4 A;  2XK5 A;  1MG8 A;  3OG5 A;  1FCL A;  1FEH A;  2NMQ A;  1RFA A;  3WAN A;  3Q3J A;  3ZNG C;  2W3S A;  2K8B A;  2RGF A;  4ANX A;  2BWE S;  4M01 A;  1FNV A;  1E7V A;  1EO6 A;  2N9P C;  3SR6 A;  1F2R C;  4OZB A;  5BMG A;  2KC1 A;  5C1Z A;  1IUE A;  5E6N A;  2N1V A;  1YQ3 B;  4WJP A;  5BO4 B;  1P3Q U;  3OLM D;  5L95 C;  3AE6 B;  3MHS D;  5HHD G;  1T3Q A;  1TS2 A;  3VHT C;  3DBR B;  3ETR A;  2N4F A;  3B2G A;  5JHB A;  2ZCB A;  2KZR A;  1LFD A;  4FN2 A;  2D5G A;  2C7N B;  4BZA A;  3PZD A;  2INC C;  3AU4 A;  5BYR A;  2BBC A;  2AX5 A;  3EHV A;  3A9J B;  2SEB D;  3VDZ A;  3TEY A;  1P7E A;  2N9L A;  1XO3 A;  2ON8 A;  1IGC A;  1JWU D;  1C77 A;  5HFY A;  1J7C A;  3ZVV A;  1ZW7 A;  4MGI E;  2I1J A;  2M19 A;  1SEB D;  4KDI C;  1SB3 C;  3AI5 A;  2JWU A;  3LJ3 A;  5JZE B;  1IPG A;  1VZ6 A;  1Z5S B;  1WGY A;  4MDK E;  5IAA C;  3DBH B;  1YIW A;  1EF5 A;  2SAK A;  4LJP B;  1K8R B;  3M95 A;  3V05 A;  1F77 A;  2WS3 B;  2RR9 A;  4IC7 B;  1VR9 A;  2FBW B;  4HJG E;  3NZU A;  3PVL A;  4MEM A;  1KFY B;  2IO3 B;  1HEZ E;  1R4N B;  2IPK D;  1UH6 A;  4ZOH C;  4XE0 A;  3AE2 B;  2KYW A;  1L6V A;  2G45 B;  3AE7 B;  1TZO A;  4NPN A;  3VH3 B;  4OVZ A;  3GE8 C;  2ZNV C;  3IT6 B;  2JZ3 B;  2KX3 A;  2L83 A;  2NBV B;  3DVG X;  2GBR A;  3TSS A;  3ZIM A;  3MJ5 A;  2LD9 A;  1NYR A;  1NEN B;  1QIL A;  4OHJ A;  2A4Z A;  2MQJ A;  2L76 A;  1LXD A;  2R2O A;  1FNW A;  2KFJ A;  4C4V B;  1UF0 A;  4EE2 A;  3K9O B;  2WXG A;  2ASQ A;  2EKE C;  1HE8 A;  2KAC A;  2W82 A;  3QHT A;  4NAW B;  3AN1 A;  2MRP A;  3N3K B;  4I6P A;  2MP2 A;  2JYE A;  3PHX B;  2JQR B;  1UWX A;  3RNB C;  3P42 A;  4B95 A;  2V1Y A;  2LJ5 A;  1L4D B;  3FKY A;  2V4I B;  3DBR I;  1H4R A;  1JCK B;  2LUM A;  3KYD D;  3LDZ E;  2N7E A;  4LLG M;  1OFF A;  3WAM A;  2GOW A;  3PRE A;  3BZD B;  4MJS A;  3P2B A;  4A9A A;  2BS4 B;  2IY1 B;  3W2D A;  1S1Q B;  1QOA A;  4N58 A;  2D11 A;  2A5U A;  2MLB A;  5IP4 D;  5JXV A;  2HE7 A;  3ONS A;  1Y8R C;  4KDL B;  4G3X B;  3NJT A;  4JLC A;  4WWP A;  1X1M A;  1UUP A;  5G55 A;  1KF6 B;  1WE6 A;  4L1B A;  1XEE A;  4BVU C;  3DBH I;  3A4S C;  3DWM A;  3RZF A;  3S2A A;  4EFO A;  2PVG C;  2KAJ A;  3ML8 A;  3RUL A;  3APC A;  5H92 C;  2MX2 A;  4H2A A;  2FUH B;  1E8Y A;  2KDF B;  4XGA B;  2JRI B;  1L5P A;  2LJI A;  3T3O A;  1TTN A;  1GAQ B;  1EM7 A;  4GDL B;  1I4G A;  1AN8 A;  2AEH A;  1FCC C;  1R4N I;  4EZJ A;  3DVN V;  3OJ3 A;  2QIE B;  4W9I A;  1FFV A;  3ZTD A;  2BTE A;  1KLV A;  2XK5 B;  3NUH B;  1R7S A;  1OEY A;  2RMM A;  3B0A A;  4A55 A;  4CQN A;  3JYU A;  3O13 A;  2BS3 B;  4B0E A;  2NBU A;  2Z0E B;  1I42 A;  4GLS C;  1XD3 B;  1SBB B;  2RDB C;  1WH3 A;  3BVZ A;  2WDR B;  2CHX A;  1MFW A;  2DYM A;  4JL9 A;  1VD2 A;  1GT8 A;  1WGK A;  4X57 B;  5LXH A;  1TS4 A;  4E3C A;  1K51 A;  2J53 A;  3HIZ A;  3A33 B;  3JVZ X;  2DHZ A;  4GB9 A;  2WXN A;  3PZ7 A;  3PS6 A;  4EOY A;  4EEW A;  3P1M A;  5C2T B;  4ZRJ A;  4P6V F;  1CK1 A;  4YSY B;  1JRO A;  2N9E B;  4ARC A;  1L7Y A;  2ZEQ A;  1XLN A;  2LGX A;  1SIJ A;  1DOI A;  2ZW1 A;  1F1H A;  4AQ7 A;  5BYQ A;  2LRW A;  2J0K A;  4HPP A;  4URK A;  3L4P A;  3ZJV A;  4MGY E;  4IWO A;  1JW9 D;  2MBE A;  2L8J A;  3PZ8 A;  1FO4 A;  2JPH A;  2DZI A;  3EFU A;  2L0F A;  4FBJ B;  1RM6 C;  3ZXR A;  3KUC B;  3L54 A;  3J9C A;  3IHP C;  3PLU A;  4MAC A;  4P1B C;  4HLE A;  3DQV A;  3UF8 A;  3B2F A;  3BIN A;  1LGR A;  3I9V 1;  4EKU A;  2CKH B;  1QLB B;  1BXT A;  2JZZ A;  2L00 B;  3GOE A;  4C56 C;  3Q3M C;  3ZXV A;  1K53 A;  3JSV A;  4W9F A;  1TGZ B;  2H88 B;  3AM9 A;  4GOC A;  4ACF A;  3A1Q A;  5D6J B;  3VUY A;  3DHG C;  4WAA A;  2VH2 A;  1FM0 D;  1WF9 A;  1YQ4 B;  4ICV A;  1R4M B;  4AP4 C;  2E6X A;  5DCN A;  4OW0 A;  1WXS A;  2UYZ B;  2OOB B;  4FAD A;  4F7Z A;  3N1Z C;  2IDY A;  2EMT A;  4N59 A;  3L08 A;  4C00 A;  2AL3 A;  1TT5 B;  2KQS A;  5BMH A;  3A9J A;  3CMM B;  1XLO A;  3PSE B;  3NZS A;  2MSE D;  4M8M A;  2GRI A;  2CU1 A;  2LVO A;  3CSF A;  4IW0 A;  4IDI A;  2MP2 B;  1WGH A;  2FCN A;  1HTQ A;  3CF6 E;  4BOS C;  2JF5 A;  1TS5 A;  1SE3 A;  2WX1 A;  4ICU A;  2V0G A;  2GBM A;  3ZNZ B;  3DVN U;  2L05 A;  4NJ6 A;  4L23 A;  2ACZ B;  2PEA A;  4AOF A;  2K9X A;  1L0V B;  4MJS B;  1PGX A;  3M62 B;  2G3Q B;  5HI1 A;  3Q8F A;  4FLH A;  4DXA B;  3BY4 B;  3QC8 B;  3AXC A;  2YLM A;  4W9L A;  2REX A;  3KVF B;  2YEP B;  1N5W A;  1N61 A;  3UQB A;  1QQR A;  1U4A A;  1OQY A;  1V97 A;  5D3D A;  2JRH A;  2QIL A;  1B9R A;  3W5V B;  1ZP0 B;  2KTF A;  2MBQ A;  2PPH A;  4OZC A;  1A70 A;  4KVG B;  4C4V A;  3QJZ A;  1D5M C;  1NBF C;  4W9C A;  1H8C A;  1E7P B;  4G0N B;  1T0Y A;  1B1Z A;  2BB5 A;  4US8 A;  1LQB A;  1BML C;  3VR9 B;  1A5R A;  3LYY A;  2ICI A;  3SFE B;  1EU3 A;  4HK2 A;  2VZK B;  4HKQ A;  4N6E B;  1R4M I;  1SJH D;  3VRB B;  2BYV E; 
#chains in the Genus database with same CATH homology
 1CQV A;  1JWA D;  1IGD A;  3BK2 A;  3MC0 B;  2L1A A;  2XN9 C;  1WWT A;  3BVG A;  3AEA B;  2KWD A;  5BYR A;  2MEK A;  2BBC A;  2PTL A;  4RF1 A;  4DXF A;  2AX5 A;  3Q69 A;  3CF4 A;  2SEB D;  2LHD A;  5EE3 A;  3TEY A;  4WQM A;  4WAF A;  1P7E A;  1DOY A;  2N9L A;  1XO3 A;  2ON8 A;  4YSX B;  1YN5 A;  2HTM E;  1IGC A;  2NTS A;  2WDV B;  4AS1 A;  1JWU D;  1C77 A;  5HFY A;  1K52 A;  1J7C A;  3Q8B A;  2M19 A;  3AEE B;  3TEZ A;  1C78 A;  1SEB D;  2WXH A;  3NZ3 A;  2AQ3 B;  1SB3 C;  1ZXI A;  2WQY B;  3BK1 A;  2JWU A;  1H7X A;  1TYG B;  1VZ7 A;  4KKI A;  2WU2 B;  1VZ6 A;  2EEL A;  3HRD D;  3SFD B;  1ACC A;  2K0P A;  1TY2 A;  1PGB A;  3NVV A;  2SAK A;  3E9S A;  4WH4 A;  3V05 A;  1F77 A;  3EA6 A;  1I4X A;  2WS3 B;  3P4Q B;  1CJE A;  2EKI A;  1SE2 A;  5HG2 A;  1VR9 A;  1FMA D;  2FBW B;  4HJG E;  2DBY A;  4B0M A;  1KFY B;  1XLQ A;  3P63 A;  3W1S A;  1HEZ E;  1MI0 A;  1PFD A;  4IOI E;  1SE4 A;  3ZQ4 A;  3H8H A;  2IPK D;  2L32 A;  4ZOH C;  4XE0 A;  3AE2 B;  4DXG A;  1L6V A;  5BMI A;  3AE7 B;  2WU5 B;  1ZOY B;  1PYW D;  5T8I A;  1F0Z A;  1GB4 A;  1D6E C;  4M0W A;  1TZO A;  4OVZ A;  5AUK A;  4KX6 B;  3IT6 B;  2L83 A;  3HVZ A;  4FXC A;  3TSS A;  1UWM A;  3P4R B;  3MJ5 A;  1NYR A;  2FUG 1;  1NEN B;  4JWS C;  1D4B A;  1QIL A;  4OHJ A;  1FNU A;  2BB6 A;  3NVZ A;  2M56 B;  4WUR A;  2WXO A;  3AE4 B;  3NRZ A;  3CIR B;  1FNW A;  4PT5 A;  3AEF B;  3U2S C;  1YN3 A;  4EE2 A;  2N7J A;  2WXG A;  3FIL A;  1P7F A;  4WWM A;  2KAC A;  2W82 A;  4RGT A;  4NAW B;  3CWI A;  3AN1 A;  1YNT E;  3AE5 B;  4USA A;  4TQ1 A;  1C4C A;  2JYE A;  2WNM A;  1NVI D;  2JQR B;  4P16 A;  1NYQ A;  3DWG C;  1UWX A;  2AQ1 B;  3P42 A;  1L0X B;  3B9J A;  2JYT A;  1ROE A;  1L4D B;  2PW9 A;  2V4I B;  1L4Z B;  1XLP A;  3AEB B;  2CU3 A;  4YTP B;  4ZHO A;  3ABV B;  1RYJ A;  2IGH A;  2JXT A;  2JX5 A;  1JCK B;  2LUM A;  2QMT A;  2RDH A;  3IAS 1;  5G5H A;  4RNA A;  4UDU C;  1XCQ L;  3Q8A A;  4LLG M;  2RDG A;  5GXG B;  4JX1 C;  2Z8L A;  1OFF A;  4LTU A;  1HA5 A;  1WSP A;  3GP7 A;  3FAH A;  5E6J A;  1TKE A;  1SSN A;  3BZD B;  4R3D A;  2JU6 X;  3VQI A;  1K50 A;  2BW2 A;  1JML A;  4A9A A;  3W5U B;  2BS4 B;  3W2D A;  5G5G A;  3VR8 B;  3RPF C;  1N60 A;  1QOA A;  4ZRP A;  1V8C A;  4A90 A;  4N58 A;  1C4A A;  1E10 A;  2W54 A;  1I7H A;  1T6B X;  4RGN A;  4O1N A;  1ENF A;  2IGG A;  1T5X D;  4NZL B;  4Q2J A;  5EE0 A;  1J7A A;  1ESF A;  2IGD A;  2YEP F;  5JXV A;  3V3X A;  3MFG A;  4ARI A;  1SF0 A;  1ZUD 2;  1L6U A;  3C8Y A;  4US9 A;  2JSV X;  1ET6 A;  1F2R I;  1V1O A;  1VDV A;  1UUP A;  1KF6 B;  3AE1 B;  4L1B A;  3TEX A;  1XEE A;  4KGR A;  3DWM A;  2PVG C;  2KAJ A;  4RGO S;  1QOF A;  5H92 C;  1I4H A;  1OQR A;  1GTH A;  4H2A A;  4REZ A;  1IBX B;  1JWB D;  3BYY B;  1I4R A;  1QOG A;  4ZYS A;  2LJI A;  1L5P A;  5FK9 C;  3T3O A;  1GB1 A;  1GAQ B;  1EM7 A;  1AYF A;  4GDL B;  5D3I B;  1I4G A;  1AN8 A;  3AMZ A;  1FCC C;  3U7Z A;  2MJD A;  4YTN B;  2LFI A;  2L52 A;  4HRO A;  1N5X A;  2QIE B;  1FFV A;  2BTE A;  3IT4 B;  1XF5 L;  3NUH B;  1I4P A;  1R7S A;  2PMV A;  3EGR A;  4JE3 B;  2KQ4 X;  1MHX A;  1JQ4 A;  1TY0 A;  2RMM A;  4RH6 A;  4A55 A;  4CQN A;  1N63 A;  1E9M A;  2J52 A;  4KGS A;  3TUO A;  3O13 A;  2BS3 B;  2WXK A;  4B0E A;  2WLB A;  2GB1 A;  1PDX A;  4OZA A;  4GLS C;  3NVY A;  1SBB B;  3VRA B;  3R2I A;  3KWV A;  2PVO D;  3BVZ A;  3GB1 A;  2WDR B;  2WXL A;  2VZK D;  1WYG A;  2KN4 A;  3MHZ A;  2DYM A;  1FD6 A;  3KQ4 A;  1EWC A;  1GT8 A;  1WGK A;  1TS3 A;  4C80 A;  2WXF A;  1TS4 A;  3NVW A;  1K51 A;  2J53 A;  1L0Y B;  2J4X A;  1DGJ A;  3MP9 A;  1V1P B;  4NAM A;  2LMC A;  2V3P A;  1H7W A;  2DWQ A;  2WXN A;  3PZ7 A;  1TKG A;  3GS2 A;  5EE1 A;  3P1M A;  5C2T B;  3ZJU A;  1M4V A;  4P6V F;  1CK1 A;  4YSY B;  1C4P A;  1JRO A;  4ARC A;  1DOX A;  2AQ2 B;  3ZYY X;  1KLU D;  1XLN A;  4TQ0 A;  1SIJ A;  4C7Z A;  3R8B A;  1N62 A;  1DOI A;  2QJL A;  1FXI A;  2ZW1 A;  1MHH E;  4XDD A;  5H8Y E;  4AQ7 A;  5BYQ A;  2HDE A;  1I4Q A;  1FRD A;  5EE9 A;  2WXJ A;  3U52 E;  1JAL A;  1E6E B;  3L4P A;  3AEC B;  4RGM A;  5I4D A;  4IKG A;  3ZJV A;  4HEA 1;  3I57 A;  1C79 A;  2Y5P A;  4YWG G;  1JW9 D;  3N9Y C;  3AB5 A;  1QF6 A;  1XXG A;  2LEK A;  2WDQ B;  3PZ8 A;  3Q8E A;  1FO4 A;  3Q8C A;  3U4E G;  5LNK 1;  1RM6 C;  4RF0 A;  3AE3 B;  1XCT L;  2WXP A;  2OHF A;  1D5Z C;  4NJC A;  1QOB A;  4YSZ B;  1MVK A;  1TJE A;  3EUB 2;  3J9C A;  2N0S B;  1JWS D;  5BYS A;  2GI9 A;  2LHE A;  4MAC A;  2DYO A;  1JWM D;  1KRH A;  1KH0 A;  3LB8 C;  2MJ3 A;  3B2F A;  1WXQ A;  1NI3 A;  3I9V 1;  2WXR A;  3AE9 B;  1HZ6 A;  2FE8 A;  1VZ8 A;  4JPS A;  1AW7 A;  1QLB B;  1BXT A;  2E3T A;  3BYT B;  3AH7 A;  4C56 C;  3KWL A;  1QKZ A;  4MM3 B;  2BT6 A;  4DQO C;  1K53 A;  3IXS A;  3HUI A;  2I2Y A;  1NEK B;  4KGT A;  1MPE A;  1C76 A;  4MH8 A;  3PO0 A;  2H88 B;  3AM9 A;  1PGA A;  1QT9 A;  1ZDV A;  2ONQ A;  1HXY D;  2QEJ C;  3P4S B;  1RFK A;  3R2T A;  3FC4 A;  2BS2 B;  1STE A;  4A6Q A;  3URY A;  3KLS X;  2G1E A;  3AV8 A;  1FM0 D;  1HZ5 A;  1YN4 A;  3UI3 A;  1YQ4 B;  2MJE A;  3P4P B;  2E6X A;  3IAM 1;  4OW0 A;  1VRA B;  3AED B;  4HRS A;  1EWY C;  5D7G A;  5AUI A;  5C3J B;  2V3N A;  3HVD A;  4HKZ E;  1KTK A;  2IDY A;  4N59 A;  1J7B A;  2IJ0 A;  3AEG B;  1OQQ A;  1FIQ A;  3SEB A;  1VJK A;  2Y3A A;  2KDM A;  2PLP A;  2R61 A;  2CJO A;  5BMH A;  4RFB A;  4TMA B;  1XLO A;  1SXT A;  2KMM A;  2TSS A;  1ZPS A;  1ZE3 D;  3FIL B;  2GRI A;  1YJI A;  3TEW A;  2WXI A;  3RFZ B;  3W9C B;  3BWU D;  4TSS A;  4ITK A;  4GDK B;  1VLB A;  1GTE A;  4ZRQ A;  5TSS A;  2WXM A;  1DYQ A;  4IDI A;  3ZJT A;  4XDC A;  1Y56 A;  3ZGZ A;  1UGJ A;  1Q10 A;  2Q5W D;  4JWU C;  3T3N A;  4ZHP A;  4MT5 A;  1IBX A;  2NTT A;  2JZP A;  4YXD B;  1SE3 A;  1TS5 A;  1JRP A;  1PUT A;  4WIP A;  1AWD A;  1ZDX A;  2B76 B;  2OED A;  3WCQ A;  4C7Y A;  2V0G A;  1FFU A;  1YJJ A;  2PKO A;  3BII D;  1FRR A;  1RWS A;  2BYT A;  3E56 A;  2I38 A;  2N9K A;  3LXF A;  4L23 A;  3AE8 B;  2J42 A;  4XWT A;  1BUI C;  2ACZ B;  1YMH E;  3NS1 A;  1FCL A;  1FXA A;  1FEH A;  3OWE B;  2NMQ A;  4RCO A;  2RPV A;  2K9X A;  1KLG D;  4XWW A;  1L0V B;  2LGI A;  2WXQ A;  1E0Z A;  1PGX A;  2G9H D;  1ET9 A;  5HI1 A;  3Q8F A;  4KKJ A;  2W3S A;  1SJE D;  2INP E;  4YT0 B;  2YEP B;  1UNS A;  1GPX A;  1LO5 D;  1N5W A;  1N61 A;  1QQR A;  1FNV A;  1GOZ A;  4L2Y A;  4D2K A;  1V97 A;  5D3D A;  2H89 B;  2QIL A;  1B9R A;  2CJN A;  3SR6 A;  3W5V B;  1ZP0 B;  1F2R C;  1EU4 A;  3BVM A;  1V1P A;  2K3U A;  2K22 A;  4OZB A;  2XNA C;  4YTM B;  4OZC A;  1A70 A;  5BMG A;  2QSD A;  5FKA C;  1IUE A;  1C9F A;  1YQ3 B;  2INN E;  5MPO A;  1D5M C;  4J3O D;  1D5X C;  1ZXH A;  3AE6 B;  1HQR D;  4LK0 M;  1TKY A;  2DLB A;  1E7P B;  2K5P A;  1CZP A;  5HHD G;  2MH7 A;  1T3Q A;  1B1Z A;  2BB5 A;  4US8 A;  1BML C;  2PIA A;  2W3R A;  2WP9 B;  1TS2 A;  2Y5C A;  3VR9 B;  2X38 A;  2W55 A;  3ETR A;  3LYY A;  3B2G A;  2ICI A;  2ZW0 A;  3SFE B;  1EU3 A;  1WRI A;  2VZK B;  2M0A A;  4HKQ A;  4N6E B;  1SJH D;  3VRB B;  2D5G A;  4A8X C;  5FR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...