2WU2B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystal Structure of the E. Coli Succinate:Quinone Oxidoreductase (Sqr) Sdhc His84met Mutant
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wu2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wu2B01
4YSZB 3AE3B 1H7XA 3NS1A 3P4QB 2WU5B 1XLOA 1B9RA 1KFYB 1CZPA 2OHFA 3B9JA 1FXIA 2BS2B 1GAQB 3CWIA 2BS3B 1EWYC 1E7PB 3VR9B 3AECB 2ACZB 1E9MA 1ZXIA 3NVVA 1N62A 3W5VB 1WGKA 1XO3A 1NVID 2LEKA 3FAHA 1TJEA 2PKOA 1SF0A 1DOIA 4C7YA 1OQRA 1UWMA 1RFKA 2WS3B 1N63A 1JALA 3AE2B 3P1MA 3AE9B 5G5GA 1NENB 1KF6B 1PUTA 1N5XA 3P4RB 1FXAA 4P6VF 3PO0A 4LTUA 4ZOHC 3NVWA 1V8CA 3W9CB 2WDVB 1FFUA 2WU2B 3AEEB 3VRBB 4YTMB 1L6UA 1QF6A 1DOYA 1DGJA 1GTEA 1RWSA 3LB8C 2DBYA 2QIEB 3W5UB 1WXQA 1QOAA 1WRIA 2W55A 4US9A 4ZHPA 2PIAA 1FFVA 1JRPA 1NEKB 1JROA 1CJEA 1NYRA 3HUIA 5H8YE 3LXFA 4JWSC 3AE1B 1E0ZA 3VRAB 3HVZA 5AUKA 1QLBB 1FRRA 3ETRA 3BIID 5EE0A 2W54A 3ABVB 5MPOA 3DWMA 4YT0B 2CU3A 5H92C 4YSXB 1J7CA 1TYGB 3RPFC 1L0VB 1XLPA 3AM9A 1OQQA 5G5HA 2MJEA 1ROEA 1WWTA 2CJOA 2HTME 1JQ4A 1FIQA 4N59A 2N0SB 1KRHA 1V97A 1I7HA 1NYQA 1ZP0B 2BT6A 2L52A 1JWBD 4WWMA 3CF4A 3P4SB 1QOFA 1JWAD 4C7ZA 1DOXA 3HRDD 3KWLA 3B2FA 2MJDA 3AEAB 3AE4B 1E6EB 4YTPB 1FM0D 1R7SA 3AEDB 1PFDA 4A9AA 1E10A 5C3JB 1NI3A 2AX5A 2K5PA 5EE9A 1F0ZA 1YQ3B 1OFFA 3L4PA 4KX6B 1TKGA 1VJKA 1VDVA 3AEBB 3DWGC 2W3SA 3AE8B 3AMZA 2JQRB 3AE7B 2L83A 3SR6A 2BS4B 3VR8B 4YSYB 1YJJA 3AH7A 1N61A 4N58A 1N60A 1XLNA 2MJ3A 1TKEA 1QOBA 2DWQA 1ZUD2 3AEGB 2QJLA 4HRSA 4IDIA 1N5WA 1GTHA 1YQ4B 1J7BA 2FBWB 3SFEB 1QOGA 1SIJA 2K9XA 2M56B 1AWDA 1SB3C 3AN1A 4USAA 2EKIA 3FC4A 3P63A 3WCQA 1AYFA 1GT8A 2WQYB 3P4PB 3AB5A 2Y5CA 2KMMA 3AV8A 3B2GA 3NVZA 3ZYYX 4JWUC 1ZOYB 2K22A 2KAJA 2PVOD 3AEFB 1RYJA 2W3RA 1J7AA 5AUIA 1FMAD 4HROA 1YJIA 5EE1A 3CIRB 2WLBA 3NVYA 1FO4A 5EE3A 2WP9B 4YTNB 3SFDB 1IUEA 4YXDB 1VLBA 1PDXA 2CJNA 1WYGA 2G1EA 2PVGC 4FXCA 4JX1C 1A70A 1QT9A 1RM6C 3EUB2 3AE5B 4N6EB 2H88B 1L6VA 2Q5WD 3AE6B 1T3QA 2WDRB 1TKYA 2M19A 1H7WA 1L5PA 1JW9D 4ITKA 4C80A 4US8A 2B76B 2H89B 3NRZA 5C2TB 2JX5A 5GXGB 4ZHOA 1FRDA 2MH7A 1XLQA 4WQMA 1GPXA 2E3TA 2WDQB
chains in the Genus database with same CATH superfamily
2IZVB 3U2SC 3O65B 2WU5B 3Q6BA 3X23A 3I57A 1YQBA 5L95C 1EWYC 3APCA 4P1CC 3AECB 2ACZB 4TV3A 2WX0A 3HK0A 2HDEA 1OQYA 4R3DA 1ISNA 1NENB 1JWMD 3W9CB 3U7DA 4RGOS 2MBOA 2KOXA 1XD3B 5J17A 1TS2A 4BOSC 1VD2A 3HUIA 1L0YB 4B9KA 1SBBB 5AZFA 3DVNV 3PSEB 3ABVB 2YLMA 1C4AA 1NI2A 2MBBB 4OVVA 3BK1A 2KXJA 1MHXA 4HXDA 4OZBA 1CQVA 4N59A 4M0WB 3BVZA 1JWAD 1T0YA 2KDIA 5IAAC 1P1AA 1MJDA 4HDOA 3WANA 4C4VB 3IT4B 1Z2MA 1SJED 1V80A 4IUMB 3GZNI 2UWQA 3MHZA 1WM3A 1GG3A 2AQ3B 3EHVA 4NJCA 2KX3A 4NAWB 3I3TB 4HJKA 2WHIA 1QOBA 4GXBA 1N5WA 2IO0B 3Q8EA 3HM3A 4USAA 1YX6B 4MGIE 3B2GA 1YNTE 1ZDVA 1WJNA 4DHZB 2REXA 5CX3A 4HJGE 5G55A 2J0JA 4YXDB 1ACCA 2G1EA 1FCCC 2ZCBA 2LGYA 1LQBA 2XN9C 1T3QA 2WDRB 4FHJA 4UDUC 1I4GA 3QCAA 2WDQB 1WGHA 3PREA 2MX2A 3DHHC 4A55A 4W9GA 2K6DB 4HKZE 1M94A 1Y56A 2LXAA 4LNOA 2N9PC 1XCQL 1YN3A 2KLGA 2WNMA 4NY0A 1WY8A 4IWQA 5LNK1 3AE9B 5G5GA 1PUTA 3NG0A 3PO0A 1J0GA 1JMLA 4MGKE 3P2BA 3M95A 4XDDA 1FFVA 2KZRA 1NYRA 1L2NA 3U4EG 3GOEA 1WX7A 2EMSA 5HG2A 3TJPA 2MP2B 1Q1OA 2QSDA 1T5XD 1T6BX 3WIMA 4AUQC 4ANVA 1I4XA 1NYQA 3QIJA 4W9CA 3TEWA 2LD9A 3KWLA 2KKCA 4K3CA 4M02A 3W1SA 3ZTCA 1FPYA 1NI3A 3N20C 4DXFA 2K5PA 1EU3A 1F9JA 1R4MB 2A4ZA 1VJKA 4JQWC 4XWWA 1LXDA 2W3SA 1STEA 1E8YA 2N9XA 2OJRA 4WJPA 4DHZE 4JPSA 2BB5A 3PV1A 1VZ7A 4A90A 1J7BA 2FBWB 3FC4A 2WXRA 1AYFA 1KTKA 4L23A 5IN7A 4K81A 1C3TA 4HROA 1YJIA 1L7YA 3BK2A 2QHOA 5EE1A 2DX5B 2V9HA 3U7ZA 4M0WA 4DK5A 3QAQA 1UZXB 1JW9D 2DLBA 4FA6A 1YIWA 4C4VA 1SE2A 2G9HD 2INPE 4GDLA 2PE6B 3ZGZA 3JSVB 2CU1A 2YEPF 4NAWA 1XO3A 1SF0A 2WXPA 4W9HA 3RCZA 2L3ZA 3P1MA 3JW0X 3AU5A 2J4XA 2N9EB 1TZOA 1C1YB 3PRMB 3W2DA 3ZIMA 4YTMB 1MPEA 4AOFA 3NHEB 5BO4B 2WYQA 2RR9A 3HVZA 4MT5A 2BKRB 2KDBA 3ETRA 2KMAA 5EE0A 1C4PA 3DVGX 1ENFA 3WA0A 3RD2A 4MDKE 3AM9A 1C77A 1PGBA 3QC8B 4W9DA 2DZJA 1Q5WB 2JVCA 2L52A 4TMAB 3PTFC 2KJHB 3RNAC 2KNBA 3VQIA 2MJDA 4OZCA 2O2VB 4RH6A 4L1BA 3Q3NC 4WAFA 1TKGA 1E8ZA 3DBRI 3UGBB 3AE8B 3J9CA 2JQRB 2MQJA 3SR6A 4WQOB 2IGDA 3APFA 2MJ3A 1HTQA 3R3MA 4FLHA 4WIPA 2RPQA 3QK0A 1RYJA 1V2YA 2MP2A 1EF5A 1J7AA 1SE9A 5AUIA 1FMAD 4EFOA 2WP9B 2KD0A 3EECA 4LCDE 4W9KA 3ZXVA 4ITKA 3IFWB 4A8XC 3A9JA 1D5XC 4W9JA 4AP4C 3NY5A 4B95A 4B6WA 5AZHA 3AXCA 4MSMB 3T3NA 2C60A 2PPHA 1E7VA 4MEMA 1N6ZA 1KFYB 3HHMA 2M0AA 1F2RC 3UQBA 2GMIC 1HA5A 2D3BA 2JYEA 2KTFA 5HFYA 1AN8A 1LGRA 4KDLB 3IHPC 3H7SA 3B08A 2FE8A 3MTNB 3N32A 3B0AA 2NCNA 2AYOB 2J7QB 3ZO5B 2WXGA 2FCNA 3EA6A 1C9FA 1ZE3D 2WXMA 1K53A 5E6NA 1V5TA 4JWSC 1SIFA 3SU8X 3KUCB 4OVZA 3CSFA 1E5WA 1WIAA 4BBNF 2KO3A 1D5ZC 2LUMA 4G11A 2J0MA 4RGTA 2I1JA 2JZZA 3LJ3A 3DBHI 3JSVA 1TBEA 2BQQA 1T0RC 1JRUA 2FAZA 2VRRB 4ZRJA 2BT6A 1ZGUB 3PHWB 3P4SB 1WRDB 2UYZB 3DBSA 1UF0A 1FM0D 2PMVA 2MLBA 1WZ0A 3PVLA 2G3QB 2L76A 5FKAC 1HTOA 4G3XB 1Y8RC 4C00A 4LJPB 4ANXA 1ZUD2 2L05A 3A1QB 2ZJDA 2EKIA 4WURA 2L7RA 1HE8A 4ASWC 2N7EA 2IJ0A 1ZOYB 1J19A 3ZNID 3KYDD 1WYGA 2FCSA 4IM3A 4LNIA 4RM9A 1X1MA 1VZ8A 2MBQA 3PPAA 4AS1A 3UI3A 4IWOA 3NRZA 4S17A 1D4BA 1K52A 2MH7A 3MFGA 1VZ6A 2JSVX 3NS1A 4NNJB 3P4QB 3IG3A 3B9JA 2BS3B 5C23A 2M0XA 4ZRKA 3W1YA 1WGKA 2LEKA 2KJ6A 2QC8A 1RFKA 3P42A 2L8JA 1N63A 3DVGY 2JZPA 3ML9A 4P6VF 1YJ1A 3QARA 4PYUA 1IGCA 3PLVA 4EZKA 1DGJA 1QKZA 4DQOC 3IBEA 1TT5B 2IO3B 4HCPB 5BYRA 1GC7A 3RNEC 3KW5B 2KACA 2KN5A 5HHDG 3IT6B 5G5HA 2LMCA 1WWTA 2CJOA 4HPMB 5FR3A 5DPWA 2CHXA 2N9LA 3AE4B 3BZDB 3N1XC 4F7ZA 2KN4A 2KT7A 4TQ0A 5DPTA 2BKFA 3L4PA 2NBWB 3DHIC 4CHKA 1IYFA 1TS5A 2MSED 2MBEA 2IYDB 2V4LA 1UUPA 4N58A 2NR2A 1WZ3A 4HRSA 1QOGA 3RZFA 3NOBA 3WCQA 4QAYA 4B0MA 2XK5B 1ET6A 1RFAA 2RDGA 4MJSB 2WLBA 1FO4A 2DHZA 4ZDVA 3JYUA 3RNCC 4F8CB 4RF0A 2LJIA 3VFKA 4HVBA 5GXGB 4DHJB 2C7MB 1WM2A 1P3QU 2PJHA 4ICUA 4EKUA 3EFCA 1OQRA 2JF5A 3C0RB 5D6JB 1SXTA 3ZJTA 3ZDMC 4WWNA 2JU6X 1Q0WB 2BYVE 4ZOHC 4J6IA 1ESFA 4LLGM 2WU2B 1SE3A 4IM2A 5GMVA 1I35A 1GTEA 1RWSA 1KH0A 1TS3A 4W9IA 1WXMA 3L13A 1JROA 2SAKA 2NS5A 2KTRB 1ZXHA 1S1QB 2ZPNA 3DPDA 1UELA 1U4AA 2DZKA 2RMMA 2WGSA 1KJTA 1ZKHA 2I2YA 2KDEB 2MCNB 2BWFA 2VZKD 1ROEA 2K8HA 3TUOA 1FIQA 4B0EA 3N30A 1E7UA 1QOFA 4OZAA 4JGHB 3R2IA 4GIVA 3GE8C 4W9LA 1E8XA 1E10A 5HI1A 1F2RI 3AI5A 4IKGA 3DWGC 3RNFC 4LK0M 3A4RA 2BYTA 3AH7A 1N60A 1QZEA 1FCLA 3AEGB 3GB1A 3NZSA 5J18A 5J2RA 2MEKA 1K50A 3DBLB 3ZYYX 3AB5A 2Y5CA 3NVZA 4E74A 2PVOD 5BMIA 4ZRQA 2KLCA 3IAS1 3MJWA 1BMLC 4DWFA 1PDXA 1UBIA 3EUB2 4DDID 2JWZA 4MELA 1H7WA 4MM3A 3A9KB 2KVZA 5C2TB 2CHZA 3TIXA 1H7XA 1DYQA 1WJ4A 1KLUD 3HIZA 4II2B 5FK9C 2AWTA 2KQ4X 4K7WA 4PS8A 3L16A 1TJEA 1KOTA 2PEAA 3DBRB 1T0SC 1AARA 2WS3B 3RYTA 5KHOA 2XK5A 4TQ1A 2JRHA 3X0WA 4MJSA 1P0RA 1V6EA 3M63B 2KFJA 1C4CA 4OVUA 2Z0EB 2PIAA 2LRWA 2ZEQA 4NJ6A 5C1ZA 4XZ4A 5AUKA 3MC9A 3O13A 5JHBA 2DYMA 2G4SA 1WGDA 2J53A 3UIPB 4ZYSA 3B1LX 4KKJA 1UD7A 2MRPA 3MC8A 3B2FA 1E6EB 2FCMA 2J52A 5TR5A 2WXNA 1OEYA 1SJHD 2KC2A 1MFWA 2ON8A 2ZZPB 4CQNA 3ZLZA 3NJTA 2W82A 2KYWA 2IBIB 2K8BA 1TKEA 2KJRA 2KTRA 1SIJA 1NDDA 1SB3C 2D3GA 3P63A 3ZNHB 1WR6E 2WQYB 3P4PB 4XE0A 2LI5A 2KDFB 1FNVA 4AJYB 3VVWB 2UU7A 2CJNA 4FXCA 3Q8FA 4KZCA 2BBCA 3BINA 3DBHB 4XX5A 1C78A 2SEBD 3KWVA 3VAWA 4FJZA 4K7SA 1I4HA 2CS4A 3CF6E 1K51A 1GAQB 2WWZA 2BB6A 1WX9A 3E56A 2Z8LA 3FAHA 3APDA 5AZGA 2FNJB 2V3PA 5IP4D 2YVCA 2DAFA 2BVCA 4FADA 1IBXB 2C7HA 1N5XA 3DVNU 5LXIB 2D10A 1NBFC 3VRBB 2XNAC 2BPSA 3TEYA 4HDQA 4PT5A 1LO5D 1QOAA 5H8YE 1FXTB 4KZ0A 3A9KA 3PZDA 3U8ZA 2DZIA 1L4DB 1F52A 2L32A 2PW9A 3VH3B 3TBLD 2N0SB 3ZKJC 4ANUA 3VHTC 3Q69A 4E3CA 2G4DB 1YN5A 3DBLI 4EZJA 2QDFA 3GS2A 2K39A 3QQ8B 5E6OA 4EEWA 2IO1B 1FEHA 3ZQ4A 2HTHA 3FILB 1G6JA 3AE7B 2IGGA 3IAM1 2IPKD 1C76A 4K1RB 4IG7B 3N1YC 2LGXA 1HZ6A 5JZEB 2GBKA 3QA8A 1BUIC 2OJWA 3QHTA 1BXTA 4BFRA 4WJQA 3UF8A 2KAJA 2K22A 1AW7A 3PHXB 3CIRB 1SE4A 4JLCA 1WXVA 1QT9A 2N1VA 2WXFA 1C79A 1L4ZB 3AU4A 4MGZE 2X38A 2JX5A 5IKCM 1KLVA 3VUYA 2OHFA 3L10B 1EM7A 3ZTDA 4MSQB 1TGZB 2NMQA 4TUUA 3N1ZC 2V0GA 3ENEA 4HEA1 1UBQA 3U52E 2MA9B 4BKTA 4O1NA 4X57B 3RN9C 1FXAA 2WXLA 3NVWA 3I63C 2WDVB 5D94A 4P7IA 2TSSA 3AEEB 1V1PB 3C8YA 2WXIA 5IA7A 1J8CA 4KDIC 1JRPA 1NEKB 1WYWB 1EO6A 2M17A 2AEHA 3VRAB 2RSUA 1WE6A 1JWSD 1XQQA 3I5JC 1YN4A 5H92C 5AEKB 3R7QA 2QILA 3DQVA 2X8XX 2MJEA 2KWVB 3ZW3A 4DDGD 3TL5A 1DOXA 2ICIA 2BWES 1FD6A 2AL3A 2C7NB 1WI0A 1H8CA 3V3XA 1OGWA 1YD8U 1GJZA 2K1FA 1I4PA 4N9F4 1UGMA 1OTRB 2LZ6A 4NAMA 4E71A 3ZVVA 1TTNA 1GTHA 5DPRA 2IY0B 1P7EA 2KMMA 2NPTB 3GE3C 4JWUC 1R4NI 4REZA 2NTSA 4YL8A 2W9NA 4YTNB 1VCBA 3WALA 2L00B 2H88B 2Q5WD 4BAXA 2E6XA 1MVKA 2M19A 2K6QA 4US8A 2H89B 2OOBB 1D3ZA 2AL6A 3DHGC 1TZ1A 4RM8A 1WGRA 4XC2A 3FILA 2LRUA 1E9MA 2N7DA 2LWPA 1DOIA 1JCKB 4C7YA 3KVFB 3LYYA 4LTUA 4J3OD 4WJOA 4JIOU 2O2VA 1DOYA 4FN2A 2WXHA 4AQ7A 3W5UB 2Y5BB 5E6PA 3I9V1 4WAAA 2LVOA 4P1BC 3TEXA 2D5GA 3DCGA 3RULA 2KWUB 4PS3A 1RAXA 3Q8CA 3MC0B 4HWIB 4GN1A 3VH4B 2FIDA 3H9DA 1JWBD 3TSSA 4KGRA 3NUHB 3PT2B 2K0PA 4IW0A 2DYBA 4WWPA 5DCNA 1V81A 2LGSA 2ZW0A 4K7UA 4W9FA 1I4QA 1OFFA 4GLSC 3AEBB 3AMZA 2BS4B 4NQLB 4URKA 3VR8B 3RZWC 1N61A 2ASQA 2DNFA 3BWUD 3GP7A 4G50A 2QJLA 1LM8B 2Y3AA 3L17A 4G0NB 2ZVOA 1Z5SB 4II3B 3R66C 4IWPA 2DYOA 3WAOA 1IUEA 4A6QA 2N1WA 4JX1C 1WR1A 2O6VB 1TKYA 2L1AA 3H7PB 3Q2AC 2M8SA 3V61A 2LGDA 4DXGA 2EKEC 1FRDA 1ZDXA 1XLQA 1PGAA 4GSWA 2BS2B 2L0TA 1GUAB 4ZRPA 4FHKA 3PLUA 1F77A 1QQRA 1QILA 3ZRFA 3RT3B 3EFUA 4KSKC 1XT9B 2D07B 3AE2B 3P4RB 1V8CA 4K3BA 3URYA 5CHFA 2CR5A 2R2OA 2QMTA 1HEZE 2N4FA 2GBJA 4HKQA 1YOVB 1PGXA 4GOCA 5KHQA 2QIEB 2KX0A 4BVUC 1WRIA 2HE7A 4NQKE 4US9A 1XXGA 3PRZA 3LXFA 1XCTL 2FIFA 3AULA 3RNBC 2DENB 2V3SA 1P7FA 5D2MB 4GU2A 3A1QA 2A5UA 3VTWA 5D3IB 1OQQA 2C5LC 2HTME 1I7HA 4GDKB 2OEDA 3V6CB 4C56C 2BYEA 4C7ZA 1WJUA 3PZ7A 1B1ZA 5BYQA 3ZNGC 1UH6A 3AEAB 5IO9A 2CKHB 4RGNA 1R7SA 2R2QA 2LASA 1V49A 4KV2A 1IGDA 3C19A 2JWUA 2IGHA 1FNUA 1OEYJ 3LDZE 1WF9A 5IOIA 3HVDA 3UINB 2K9XA 5I4DA 4S0RA 4HPLB 1LFDA 3AEFB 2LHDA 4BBNC 3D32A 4JL9A 4RF1A 2ZW1A 4PS7A 3QJZA 2WXJA 3RUIB 1UGJA 3S2AA 2KHWB 2JRIB 2LJ5A 2KWCA 5D3DA 4WQMA 1GB1A 1CMXB 4AWJA 1E90A 2K25A 3AE3B 1CZPA 1M4VA 1E7PB 3Q3OC 4I6NB 3SDLC 4HCNB 3V62A 2C9WB 2MW5A 3OLMD 1V1OA 3ONSA 1YMHE 1KF6B 2GBRA 4LJOB 2Y5PA 4W9EA 3KQ4A 2JXTA 2G45B 3KLSX 4M01A 1MI0A 4DBGA 3SEBA 2O6VD 2O6VA 1K8RB 3AE1B 4KIKB 4ZRIA 2FUHB 4GDLB 4MACA 5HKHA 3H7PA 4RMAA 1TY0A 4L2YA 2JUOA 3T3OA 3ZDTA 3VUWA 1L0VB 4KGTA 1HQRD 1HXYD 4M00A 1ZPSA 5CHVC 1JQ4A 2ZPYA 3BYYB 1V97A 4ANWA 4MGYE 2Z59B 2RDBC 4WWMA 4LDTB 2JY6A 1PFDA 3DDCB 1I4RA 2AX5A 1WXSA 1JWUD 2AQ2B 2IDYA 4KX6B 3TMPB 3SD5A 4CO7A 4XYCA 1V5OA 2KFKB 2PE9A 4TSSA 3UIOB 4AJWA 4DHJD 1IPGA 1V86A 3VUXA 1XLNA 3N3KB 1YQ4B 2M56B 5LXHA 1AWDA 2GLSA 2QEJC 1SEBD 2L0FA 3AV8A 3BVGA 3VDZA 5EDSA 4NPNA 2LUEA 2V4IB 3TEZA 4BKGA 1GB4A 3NVYA 4ACFA 1WMHB 4GDKA 3WAMA 4A3OA 4BOZB 3A33B 3VTUA 1TIFA 4KSLC 4EOYA 1GPXA 1TY2A 4BZAA 3EC8A 4YSZB 2CHWA 2RGFA 2KDMA 1VR9A 3L54A 1UWXA 3CWIA 2WXQA 3W5VB 3L0WB 1NVID 2HJ8A 2K3UA 2J0KA 3H8HA 3OAWA 1GNUA 1XF5L 4EZLA 4LNFA 1FFUA 4LNKA 4FBJB 3BY4B 4IOIE 1QF6A 3T9LA 3A9JB 1R4NB 2DBYA 2GBNA 1CJEA 2B3AA 5E6JA 4I6PA 1P9DU 4KVGB 3M3JA 1FRRA 4OW0A 3WAPA 2N9KA 2W54A 4YT0B 2LXCA 3Q3MC 1TYGB 3PGEA 3KUDB 4FULA 4KKIA 4H2AA 1SGHA 1ZP0B 3RI7C 2BYFA 3Q8BA 3V05A 3AEDB 1MHHE 2WX1A 1YQ3B 3V6EB 3A4SC 3PS6A 1UNSA 2L83A 2VH2A 3OJ3A 4D2KA 2ZNVC 2EMTA 4KIKA 2AQ1B 2LHEA 1EUVB 5TSSA 1MG4A 3OG5A 1EWCA 3K9PB 1A70A 1T0QC 3AE6B 4LDTD 3Q14C 2LVPA 2KQSA 3HM6X 2ONQA 3SHQA 3ZUNA 4ZHOA 1RRBA 2GB1A 4HK2A 2KK8A 3RMKC 1XLOA 3R7RA 2KFKA 3BYTB 1ZXIA 3NVVA 3Q3JA 3QX1A 4RGMA 2GOWA 5BYSA 4WJNA 4P16A 2NBUA 1JALA 2LFIA 4CYEA 3ZNZB 3JVZX 2IO2B 1WXAA 4Q2JA 2INNE 3CSTA 4ZYNA 4YWGG 2JZ3B 2BF8B 5BMHA 1WMHA 1WXQA 2VH1A 2W55A 1E0ZA 1KLGD 4JE3B 3DWMA 2CU3A 1J7CA 3OWEB 2Z0DB 3RPFC 2ZNVB 4TKNA 4F1SA 4BKSD 4BKSA 3CF4A 3HRDD 4YTPB 4MH0E 2PLPA 2MHJA 5EE9A 2FUG1 3FKYA 3KYCD 1VDVA 4WH4A 3ZRCA 3MP9A 2INDC 1VRAB 2RDHA 3Q3FA 3IXSA 4ICVA 3NS8A 4IDIA 5CHWA 3ZJVA 3NZ3A 3SFEB 3VTVA 2GRIA 3ALBA 4NJ7A 2M4NA 3H6NA 5G2NA 2BGFA 1IP9A 4OHJA 2W3RA 2WXOA 1IBXA 4MH8A 4KGSA 5T8IA 2KC1A 3EGRA 4C80A 4M8MA 2JPHA 1V9JA 3V60A 2BW2A 3R8BA 2JT4B 5CTRC 1YX5B 3RNGC 5JHAA 1P98A 3MHSD 1Q10A 4HPPA 1FXIA 2DAJA 3VR9B 2V1YA 2WXKA 2NTTA 5FR6A 1N62A 4ARIA 5LLIA 3U30A 1R4MI 1XEEA 5DPSA 3PRPB 1WGYA 2D2QA 2MWSB 2NVUI 3N9YC 1RLFA 4DXAB 4PYZA 3ZJUA 2LVQA 3R2TA 1L0XB 4ZHPA 2I38A 1CK1A 4XDCA 2FCQA 2ZVNA 1A5RA 2WDTB 4HLEA 5MPOA 3T8MA 3M62B 4I6LB 3NZUA 1XLPA 2KMCA 3ECIA 4GB9A 2D3CA 3UQAA 3IVFA 1KRHA 1ET9A 5JH5C 1F1HA 3H1UA 2R61A 1E8WA 5C3JB 1F0ZA 2D11A 1WFYA 2NBVB 4YSYB 1YJJA 2DWQA 4A3PA 3L08A 1MG8A 2D3AA 3AN1A 3BVMA 2JXXA 2VZKB 2XEWA 4M8NA 3GZNB 1FNWA 5EE3A 2RPVA 1VLBA 1RM6C 2IY1B 3MJ5A 3AE5B 1V1PA 2I1KA 3ML8A 3PZ8A 2QCZA 2B76B 3RFZB 1HZ5A 3CMMB 1TS4A 4IC7B 2KANA 4RCOA 1WX8A 1WGGA 4WWOA 3Q8AA 2PKOA 2K8CA 2KWDA 1UWMA 4XGAB 2HJ1A 2V3NA 2PTLA 1WH3A 4PK1A 1WSPA 1SSNA 1H4RA 4EE2A 5D7GA 2MBHA 1L6UA 2J42A 4NZLB 1D5MC 4MM3B 3LB8C 3TCAA 3VXWA 1S3SG 2GI9A 4FJYA 4GMVA 1EF1A 2KQ7A 1QLBB 3BIID 2HD5B 1ZW7A 4YSXB 3W1SC 2NPTA 2M1MA 2EELA 5JXVA 2YEPB 4FJVB 4RNAA 1GC6A 2ZCCA 4XWTA 3ZXRA 1PQSA 4A9AA 1WE7A 2N7JA 3E9SA 4GGQA 5L83A 2GBMA 4RFBA 2LGIA 1EU4A 1I42A 1WJ6A 1B9RA 1GOZA 3DOWA 5BMGA 4IM0A 4EUTA 3K9OB 1GT8A 3OJ4B 2DZMA 1D6EC 1PYWD 2XBBC 3QWZB 1KM7A 4LNNA 3SFDB 1BT0A 2PVGC 2RD0A 3KUZA 4A20A 4N6EB 1L6VA 3KH0A 1L5PA 2JYTA 2BTEA 4ARCA 2KVRA 2INCC 2E3TA
chains in the Genus database with same CATH topology
4YSZB 2JSVX 3NS1A 3U2SC 3P4QB 2KDMA 2WU5B 1VR9A 2OHFA 3B9JA 1EM7A 3I57A 1UWXA 3CWIA 2BS3B 1EWYC 2WXQA 3AECB 2ACZB 3W5VB 2NMQA 1WGKA 1NVID 2LEKA 2HDEA 2V0GA 1RFKA 4HEA1 2K3UA 3P42A 1N63A 4R3DA 3H8HA 3U52E 1XF5L 2JZPA 4O1NA 1NENB 1JWMD 4P6VF 1FXAA 2WXLA 3NVWA 3W9CB 2WDVB 1FFUA 2TSSA 1IGCA 4RGOS 3AEEB 4IOIE 1V1PB 1QF6A 1DGJA 3C8YA 2WXIA 1TS2A 2DBYA 1QKZA 4DQOC 1JRPA 1NEKB 1CJEA 3HUIA 5E6JA 1L0YB 3VRAB 1SBBB 5BYRA 1JWSD 1FRRA 4OW0A 2N9KA 2W54A 3ABVB 1YN4A 2KACA 4YT0B 1C4AA 5H92C 5HHDG 1TYGB 2QILA 3BK1A 1MHXA 3IT6B 4OZBA 5G5HA 2MJEA 1CQVA 1WWTA 2CJOA 2LMCA 4KKIA 4H2AA 4N59A 5FR3A 1ZP0B 1DOXA 3BVZA 2ICIA 1JWAD 2N9LA 3Q8BA 3AE4B 3V05A 3AEDB 3BZDB 1FD6A 1MHHE 3IT4B 2KN4A 1SJED 3V3XA 4TQ0A 1YQ3B 3L4PA 1I4PA 3MHZA 1UNSA 1TS5A 2AQ3B 4NJCA 2L83A 1UUPA 4NAWB 4NAMA 4N58A 1QOBA 4HRSA 4D2KA 1N5WA 1GTHA 1QOGA 3Q8EA 1P7EA 4USAA 3WCQA 2AQ1B 4B0MA 2LHEA 3B2GA 2KMMA 1ET6A 2RDGA 4JWUC 1YNTE 1ZDVA 5TSSA 4REZA 2NTSA 2WLBA 1FO4A 4HJGE 1EWCA 4YTNB 4YXDB 1ACCA 2G1EA 1FCCC 1A70A 2H88B 2XN9C 2Q5WD 3AE6B 1T3QA 2E6XA 4RF0A 2WDRB 1MVKA 2M19A 4US8A 2H89B 2LJIA 4UDUC 2ONQA 1I4GA 5GXGB 4ZHOA 2WDQB 2GB1A 1XLOA 4A55A 3FILA 3BYTB 1E9MA 4HKZE 1ZXIA 3NVVA 1Y56A 1DOIA 1JCKB 4C7YA 1OQRA 1XCQL 1YN3A 2WNMA 4RGMA 5BYSA 4P16A 1SXTA 3ZJTA 1JALA 2JU6X 2LFIA 5LNK1 3AE9B 5G5GA 1PUTA 4Q2JA 4ZOHC 2INNE 3PO0A 3LYYA 4LTUA 1JMLA 1ESFA 4J3OD 4LLGM 2WU2B 1SE3A 4YWGG 1DOYA 4XDDA 1GTEA 1RWSA 2WXHA 1KH0A 1TS3A 3W5UB 4AQ7A 5BMHA 1WXQA 2W55A 3I9V1 1FFVA 1JROA 1NYRA 2SAKA 3TEXA 3U4EG 1ZXHA 2D5GA 1E0ZA 1KLGD 2RMMA 4JE3B 5HG2A 3DWMA 2CU3A 1J7CA 3OWEB 2QSDA 3RPFC 2I2YA 3Q8CA 1T5XD 3MC0B 1T6BX 2VZKD 1ROEA 3TUOA 1FIQA 1I4XA 4B0EA 1NYQA 1JWBD 3TEWA 3CF4A 1QOFA 3TSSA 3HRDD 3KWLA 4KGRA 3NUHB 4OZAA 3R2IA 4YTPB 2K0PA 3W1SA 2PLPA 1E10A 5HI1A 1NI3A 4DXFA 2K5PA 2ZW0A 5EE9A 1EU3A 1F2RI 1I4QA 1OFFA 2FUG1 1VJKA 4XWWA 1VDVA 4GLSC 3AEBB 4IKGA 3DWGC 2W3SA 4WH4A 1STEA 3AMZA 3MP9A 1VRAB 4LK0M 4JPSA 2BS4B 2BB5A 2RDHA 3VR8B 3IXSA 2BYTA 3AH7A 1N61A 3GP7A 1N60A 1VZ7A 3BWUD 1FCLA 2QJLA 4IDIA 3AEGB 4A90A 3ZJVA 2Y3AA 3GB1A 1J7BA 2FBWB 3SFEB 3NZ3A 2GRIA 3FC4A 2MEKA 2WXRA 1AYFA 1K50A 1KTKA 4L23A 3ZYYX 3AB5A 2Y5CA 3NVZA 4OHJA 2PVOD 2W3RA 5BMIA 4ZRQA 2WXOA 3IAS1 1YJIA 4HROA 1IBXA 1BMLC 3BK2A 2DYOA 4MH8A 4KGSA 1IUEA 5EE1A 5T8IA 4A6QA 1PDXA 3EGRA 4JX1C 3EUB2 3U7ZA 4M0WA 1TKYA 1H7WA 4C80A 1JW9D 2DLBA 2L1AA 4DXGA 1SE2A 2BW2A 5C2TB 2G9HD 3R8BA 1FRDA 1ZDXA 1XLQA 2INPE 1H7XA 1PGAA 1Q10A 1DYQA 3ZGZA 1FXIA 2BS2B 1KLUD 4ZRPA 3VR9B 2YEPF 5FK9C 2KQ4X 2WXKA 1F77A 1QQRA 2NTTA 1N62A 1XO3A 1QILA 1TJEA 1SF0A 2WXPA 4ARIA 2WS3B 1XEEA 3AE2B 3P1MA 4TQ1A 3P4RB 2J4XA 1V8CA 1TZOA 3N9YC 3URYA 2QMTA 3W2DA 1HEZE 4YTMB 4HKQA 1MPEA 1PGXA 3ZJUA 3R2TA 2QIEB 1L0XB 1C4CA 4ZHPA 1WRIA 4US9A 2PIAA 1XXGA 3LXFA 1XCTL 2I38A 3HVZA 5AUKA 4MT5A 1CK1A 3O13A 1P7FA 4XDCA 3ETRA 5EE0A 1C4PA 5MPOA 1ENFA 5D3IB 2DYMA 1XLPA 3AM9A 1C77A 1OQQA 2J53A 1PGBA 4ZYSA 2HTME 4KKJA 1KRHA 1I7HA 1ET9A 2OEDA 4GDKB 2L52A 4C56C 4TMAB 4C7ZA 3PZ7A 1B1ZA 5BYQA 3VQIA 3B2FA 2MJDA 3AEAB 1E6EB 4RGNA 1R7SA 4OZCA 2R61A 2J52A 5C3JB 4RH6A 4L1BA 2WXNA 1F0ZA 1SJHD 4WAFA 1TKGA 2ON8A 1IGDA 4CQNA 3AE8B 3J9CA 2JQRB 2JWUA 3SR6A 2IGHA 1FNUA 2W82A 4YSYB 1YJJA 2IGDA 2MJ3A 1TKEA 2DWQA 3HVDA 5I4DA 2K9XA 1SIJA 4WIPA 1SB3C 3AN1A 3P63A 2WQYB 3P4PB 3BVMA 4XE0A 2VZKB 3AEFB 1RYJA 2LHDA 1J7AA 1FNVA 5AUIA 1FMAD 1FNWA 5EE3A 2WP9B 2RPVA 2CJNA 4RF1A 1VLBA 2ZW1A 4FXCA 3Q8FA 1RM6C 3MJ5A 2WXJA 3AE5B 2BBCA 1UGJA 1V1PA 4ITKA 3PZ8A 2B76B 1C78A 4A8XC 3RFZB 2E3TA 2SEBD 1D5XC 3KWVA 1HZ5A 5D3DA 4WQMA 1GB1A 3T3NA 3AE3B 1TS4A 1I4HA 1K51A 1KFYB 1CZPA 1M4VA 1GAQB 2M0AA 4RCOA 1E7PB 2BB6A 3E56A 2Z8LA 3Q8AA 1F2RC 2JYEA 1HA5A 3FAHA 2PKOA 2KWDA 5HFYA 1UWMA 1AN8A 2V3NA 2V3PA 2PTLA 1V1OA 1IBXB 1YMHE 1KF6B 1N5XA 2FE8A 2Y5PA 1WSPA 1SSNA 3VRBB 2XNAC 4EE2A 5D7GA 2WXGA 1L6UA 2J42A 4NZLB 3KQ4A 2JXTA 1D5MC 3KLSX 3EA6A 4MM3B 1C9FA 1ZE3D 2WXMA 3LB8C 1K53A 3TEYA 4PT5A 1LO5D 1MI0A 1QOAA 2GI9A 3SEBA 5H8YE 4JWSC 3AE1B 4GDLB 4MACA 4OVZA 1TY0A 4L2YA 1QLBB 3BIID 2LUMA 1D5ZC 3T3OA 4RGTA 4YSXB 1L0VB 4KGTA 1L4DB 1HQRD 1HXYD 2L32A 1ZPSA 1JQ4A 2PW9A 3BYYB 2N0SB 1V97A 2EELA 5JXVA 2BT6A 2YEPB 4WWMA 3P4SB 3Q69A 4RNAA 1FM0D 2PMVA 4XWTA 1PFDA 1YN5A 4A9AA 1I4RA 2AX5A 3GS2A 2N7JA 3E9SA 1JWUD 2AQ2B 2IDYA 4KX6B 5FKAC 1FEHA 3ZQ4A 4RFBA 3FILB 4TSSA 3AE7B 2LGIA 2IGGA 3IAM1 2IPKD 1EU4A 1C76A 1XLNA 1ZUD2 1B9RA 1YQ4B 1GOZA 2M56B 1HZ6A 5BMGA 1AWDA 2EKIA 4WURA 1BUIC 2QEJC 1GT8A 1SEBD 3AV8A 1D6EC 1BXTA 3BVGA 1GPXA 2IJ0A 1PYWD 1ZOYB 2K22A 2KAJA 1AW7A 2V4IB 3TEZA 1GB4A 3CIRB 3NVYA 1SE4A 1WYGA 3SFDB 2PVGC 1QT9A 1VZ8A 4N6EB 1L6VA 4AS1A 3UI3A 2WXFA 1C79A 1L5PA 2JYTA 1L4ZB 2BTEA 4ARCA 3NRZA 2X38A 1D4BA 2JX5A 1K52A 2MH7A 3MFGA 1VZ6A 1TY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSZ B;  3AE3 B;  1H7X A;  3NS1 A;  3P4Q B;  2WU5 B;  1XLO A;  1B9R A;  1KFY B;  1CZP A;  2OHF A;  3B9J A;  1FXI A;  2BS2 B;  1GAQ B;  3CWI A;  2BS3 B;  1EWY C;  1E7P B;  3VR9 B;  3AEC B;  2ACZ B;  1E9M A;  1ZXI A;  3NVV A;  1N62 A;  3W5V B;  1WGK A;  1XO3 A;  1NVI D;  2LEK A;  3FAH A;  1TJE A;  2PKO A;  1SF0 A;  1DOI A;  4C7Y A;  1OQR A;  1UWM A;  1RFK A;  2WS3 B;  1N63 A;  1JAL A;  3AE2 B;  3P1M A;  3AE9 B;  5G5G A;  1NEN B;  1KF6 B;  1PUT A;  1N5X A;  3P4R B;  1FXA A;  4P6V F;  3PO0 A;  4LTU A;  4ZOH C;  3NVW A;  1V8C A;  3W9C B;  2WDV B;  1FFU A;  2WU2 B;  3AEE B;  3VRB B;  4YTM B;  1L6U A;  1QF6 A;  1DOY A;  1DGJ A;  1GTE A;  1RWS A;  3LB8 C;  2DBY A;  2QIE B;  3W5U B;  1WXQ A;  1QOA A;  1WRI A;  2W55 A;  4US9 A;  4ZHP A;  2PIA A;  1FFV A;  1JRP A;  1NEK B;  1JRO A;  1CJE A;  1NYR A;  3HUI A;  5H8Y E;  3LXF A;  4JWS C;  3AE1 B;  1E0Z A;  3VRA B;  3HVZ A;  5AUK A;  1QLB B;  1FRR A;  3ETR A;  3BII D;  5EE0 A;  2W54 A;  3ABV B;  5MPO A;  3DWM A;  4YT0 B;  2CU3 A;  5H92 C;  4YSX B;  1J7C A;  1TYG B;  3RPF C;  1L0V B;  1XLP A;  3AM9 A;  1OQQ A;  5G5H A;  2MJE A;  1ROE A;  1WWT A;  2CJO A;  2HTM E;  1JQ4 A;  1FIQ A;  4N59 A;  2N0S B;  1KRH A;  1V97 A;  1I7H A;  1NYQ A;  1ZP0 B;  2BT6 A;  2L52 A;  1JWB D;  4WWM A;  3CF4 A;  3P4S B;  1QOF A;  1JWA D;  4C7Z A;  1DOX A;  3HRD D;  3KWL A;  3B2F A;  2MJD A;  3AEA B;  3AE4 B;  1E6E B;  4YTP B;  1FM0 D;  1R7S A;  3AED B;  1PFD A;  4A9A A;  1E10 A;  5C3J B;  1NI3 A;  2AX5 A;  2K5P A;  5EE9 A;  1F0Z A;  1YQ3 B;  1OFF A;  3L4P A;  4KX6 B;  1TKG A;  1VJK A;  1VDV A;  3AEB B;  3DWG C;  2W3S A;  3AE8 B;  3AMZ A;  2JQR B;  3AE7 B;  2L83 A;  3SR6 A;  2BS4 B;  3VR8 B;  4YSY B;  1YJJ A;  3AH7 A;  1N61 A;  4N58 A;  1N60 A;  1XLN A;  2MJ3 A;  1TKE A;  1QOB A;  2DWQ A;  1ZUD 2;  3AEG B;  2QJL A;  4HRS A;  4IDI A;  1N5W A;  1GTH A;  1YQ4 B;  1J7B A;  2FBW B;  3SFE B;  1QOG A;  1SIJ A;  2K9X A;  2M56 B;  1AWD A;  1SB3 C;  3AN1 A;  4USA A;  2EKI A;  3FC4 A;  3P63 A;  3WCQ A;  1AYF A;  1GT8 A;  2WQY B;  3P4P B;  3AB5 A;  2Y5C A;  2KMM A;  3AV8 A;  3B2G A;  3NVZ A;  3ZYY X;  4JWU C;  1ZOY B;  2K22 A;  2KAJ A;  2PVO D;  3AEF B;  1RYJ A;  2W3R A;  1J7A A;  5AUI A;  1FMA D;  4HRO A;  1YJI A;  5EE1 A;  3CIR B;  2WLB A;  3NVY A;  1FO4 A;  5EE3 A;  2WP9 B;  4YTN B;  3SFD B;  1IUE A;  4YXD B;  1VLB A;  1PDX A;  2CJN A;  1WYG A;  2G1E A;  2PVG C;  4FXC A;  4JX1 C;  1A70 A;  1QT9 A;  1RM6 C;  3EUB 2;  3AE5 B;  4N6E B;  2H88 B;  1L6V A;  2Q5W D;  3AE6 B;  1T3Q A;  2WDR B;  1TKY A;  2M19 A;  1H7W A;  1L5P A;  1JW9 D;  4ITK A;  4C80 A;  4US8 A;  2B76 B;  2H89 B;  3NRZ A;  5C2T B;  2JX5 A;  5GXG B;  4ZHO A;  1FRD A;  2MH7 A;  1XLQ A;  4WQM A;  1GPX A;  2E3T A;  2WDQ B; 
#chains in the Genus database with same CATH topology
 2IZV B;  3U2S C;  3O65 B;  2WU5 B;  3Q6B A;  3X23 A;  3I57 A;  1YQB A;  5L95 C;  1EWY C;  3APC A;  4P1C C;  3AEC B;  2ACZ B;  4TV3 A;  2WX0 A;  3HK0 A;  2HDE A;  1OQY A;  4R3D A;  1ISN A;  1NEN B;  1JWM D;  3W9C B;  3U7D A;  4RGO S;  2MBO A;  2KOX A;  1XD3 B;  5J17 A;  1TS2 A;  4BOS C;  1VD2 A;  3HUI A;  1L0Y B;  4B9K A;  1SBB B;  5AZF A;  3DVN V;  3PSE B;  3ABV B;  2YLM A;  1C4A A;  1NI2 A;  2MBB B;  4OVV A;  3BK1 A;  2KXJ A;  1MHX A;  4HXD A;  4OZB A;  1CQV A;  4N59 A;  4M0W B;  3BVZ A;  1JWA D;  1T0Y A;  2KDI A;  5IAA C;  1P1A A;  1MJD A;  4HDO A;  3WAN A;  4C4V B;  3IT4 B;  1Z2M A;  1SJE D;  1V80 A;  4IUM B;  3GZN I;  2UWQ A;  3MHZ A;  1WM3 A;  1GG3 A;  2AQ3 B;  3EHV A;  4NJC A;  2KX3 A;  4NAW B;  3I3T B;  4HJK A;  2WHI A;  1QOB A;  4GXB A;  1N5W A;  2IO0 B;  3Q8E A;  3HM3 A;  4USA A;  1YX6 B;  4MGI E;  3B2G A;  1YNT E;  1ZDV A;  1WJN A;  4DHZ B;  2REX A;  5CX3 A;  4HJG E;  5G55 A;  2J0J A;  4YXD B;  1ACC A;  2G1E A;  1FCC C;  2ZCB A;  2LGY A;  1LQB A;  2XN9 C;  1T3Q A;  2WDR B;  4FHJ A;  4UDU C;  1I4G A;  3QCA A;  2WDQ B;  1WGH A;  3PRE A;  2MX2 A;  3DHH C;  4A55 A;  4W9G A;  2K6D B;  4HKZ E;  1M94 A;  1Y56 A;  2LXA A;  4LNO A;  2N9P C;  1XCQ L;  1YN3 A;  2KLG A;  2WNM A;  4NY0 A;  1WY8 A;  4IWQ A;  5LNK 1;  3AE9 B;  5G5G A;  1PUT A;  3NG0 A;  3PO0 A;  1J0G A;  1JML A;  4MGK E;  3P2B A;  3M95 A;  4XDD A;  1FFV A;  2KZR A;  1NYR A;  1L2N A;  3U4E G;  3GOE A;  1WX7 A;  2EMS A;  5HG2 A;  3TJP A;  2MP2 B;  1Q1O A;  2QSD A;  1T5X D;  1T6B X;  3WIM A;  4AUQ C;  4ANV A;  1I4X A;  1NYQ A;  3QIJ A;  4W9C A;  3TEW A;  2LD9 A;  3KWL A;  2KKC A;  4K3C A;  4M02 A;  3W1S A;  3ZTC A;  1FPY A;  1NI3 A;  3N20 C;  4DXF A;  2K5P A;  1EU3 A;  1F9J A;  1R4M B;  2A4Z A;  1VJK A;  4JQW C;  4XWW A;  1LXD A;  2W3S A;  1STE A;  1E8Y A;  2N9X A;  2OJR A;  4WJP A;  4DHZ E;  4JPS A;  2BB5 A;  3PV1 A;  1VZ7 A;  4A90 A;  1J7B A;  2FBW B;  3FC4 A;  2WXR A;  1AYF A;  1KTK A;  4L23 A;  5IN7 A;  4K81 A;  1C3T A;  4HRO A;  1YJI A;  1L7Y A;  3BK2 A;  2QHO A;  5EE1 A;  2DX5 B;  2V9H A;  3U7Z A;  4M0W A;  4DK5 A;  3QAQ A;  1UZX B;  1JW9 D;  2DLB A;  4FA6 A;  1YIW A;  4C4V A;  1SE2 A;  2G9H D;  2INP E;  4GDL A;  2PE6 B;  3ZGZ A;  3JSV B;  2CU1 A;  2YEP F;  4NAW A;  1XO3 A;  1SF0 A;  2WXP A;  4W9H A;  3RCZ A;  2L3Z A;  3P1M A;  3JW0 X;  3AU5 A;  2J4X A;  2N9E B;  1TZO A;  1C1Y B;  3PRM B;  3W2D A;  3ZIM A;  4YTM B;  1MPE A;  4AOF A;  3NHE B;  5BO4 B;  2WYQ A;  2RR9 A;  3HVZ A;  4MT5 A;  2BKR B;  2KDB A;  3ETR A;  2KMA A;  5EE0 A;  1C4P A;  3DVG X;  1ENF A;  3WA0 A;  3RD2 A;  4MDK E;  3AM9 A;  1C77 A;  1PGB A;  3QC8 B;  4W9D A;  2DZJ A;  1Q5W B;  2JVC A;  2L52 A;  4TMA B;  3PTF C;  2KJH B;  3RNA C;  2KNB A;  3VQI A;  2MJD A;  4OZC A;  2O2V B;  4RH6 A;  4L1B A;  3Q3N C;  4WAF A;  1TKG A;  1E8Z A;  3DBR I;  3UGB B;  3AE8 B;  3J9C A;  2JQR B;  2MQJ A;  3SR6 A;  4WQO B;  2IGD A;  3APF A;  2MJ3 A;  1HTQ A;  3R3M A;  4FLH A;  4WIP A;  2RPQ A;  3QK0 A;  1RYJ A;  1V2Y A;  2MP2 A;  1EF5 A;  1J7A A;  1SE9 A;  5AUI A;  1FMA D;  4EFO A;  2WP9 B;  2KD0 A;  3EEC A;  4LCD E;  4W9K A;  3ZXV A;  4ITK A;  3IFW B;  4A8X C;  3A9J A;  1D5X C;  4W9J A;  4AP4 C;  3NY5 A;  4B95 A;  4B6W A;  5AZH A;  3AXC A;  4MSM B;  3T3N A;  2C60 A;  2PPH A;  1E7V A;  4MEM A;  1N6Z A;  1KFY B;  3HHM A;  2M0A A;  1F2R C;  3UQB A;  2GMI C;  1HA5 A;  2D3B A;  2JYE A;  2KTF A;  5HFY A;  1AN8 A;  1LGR A;  4KDL B;  3IHP C;  3H7S A;  3B08 A;  2FE8 A;  3MTN B;  3N32 A;  3B0A A;  2NCN A;  2AYO B;  2J7Q B;  3ZO5 B;  2WXG A;  2FCN A;  3EA6 A;  1C9F A;  1ZE3 D;  2WXM A;  1K53 A;  5E6N A;  1V5T A;  4JWS C;  1SIF A;  3SU8 X;  3KUC B;  4OVZ A;  3CSF A;  1E5W A;  1WIA A;  4BBN F;  2KO3 A;  1D5Z C;  2LUM A;  4G11 A;  2J0M A;  4RGT A;  2I1J A;  2JZZ A;  3LJ3 A;  3DBH I;  3JSV A;  1TBE A;  2BQQ A;  1T0R C;  1JRU A;  2FAZ A;  2VRR B;  4ZRJ A;  2BT6 A;  1ZGU B;  3PHW B;  3P4S B;  1WRD B;  2UYZ B;  3DBS A;  1UF0 A;  1FM0 D;  2PMV A;  2MLB A;  1WZ0 A;  3PVL A;  2G3Q B;  2L76 A;  5FKA C;  1HTO A;  4G3X B;  1Y8R C;  4C00 A;  4LJP B;  4ANX A;  1ZUD 2;  2L05 A;  3A1Q B;  2ZJD A;  2EKI A;  4WUR A;  2L7R A;  1HE8 A;  4ASW C;  2N7E A;  2IJ0 A;  1ZOY B;  1J19 A;  3ZNI D;  3KYD D;  1WYG A;  2FCS A;  4IM3 A;  4LNI A;  4RM9 A;  1X1M A;  1VZ8 A;  2MBQ A;  3PPA A;  4AS1 A;  3UI3 A;  4IWO A;  3NRZ A;  4S17 A;  1D4B A;  1K52 A;  2MH7 A;  3MFG A;  1VZ6 A;  2JSV X;  3NS1 A;  4NNJ B;  3P4Q B;  3IG3 A;  3B9J A;  2BS3 B;  5C23 A;  2M0X A;  4ZRK A;  3W1Y A;  1WGK A;  2LEK A;  2KJ6 A;  2QC8 A;  1RFK A;  3P42 A;  2L8J A;  1N63 A;  3DVG Y;  2JZP A;  3ML9 A;  4P6V F;  1YJ1 A;  3QAR A;  4PYU A;  1IGC A;  3PLV A;  4EZK A;  1DGJ A;  1QKZ A;  4DQO C;  3IBE A;  1TT5 B;  2IO3 B;  4HCP B;  5BYR A;  1GC7 A;  3RNE C;  3KW5 B;  2KAC A;  2KN5 A;  5HHD G;  3IT6 B;  5G5H A;  2LMC A;  1WWT A;  2CJO A;  4HPM B;  5FR3 A;  5DPW A;  2CHX A;  2N9L A;  3AE4 B;  3BZD B;  3N1X C;  4F7Z A;  2KN4 A;  2KT7 A;  4TQ0 A;  5DPT A;  2BKF A;  3L4P A;  2NBW B;  3DHI C;  4CHK A;  1IYF A;  1TS5 A;  2MSE D;  2MBE A;  2IYD B;  2V4L A;  1UUP A;  4N58 A;  2NR2 A;  1WZ3 A;  4HRS A;  1QOG A;  3RZF A;  3NOB A;  3WCQ A;  4QAY A;  4B0M A;  2XK5 B;  1ET6 A;  1RFA A;  2RDG A;  4MJS B;  2WLB A;  1FO4 A;  2DHZ A;  4ZDV A;  3JYU A;  3RNC C;  4F8C B;  4RF0 A;  2LJI A;  3VFK A;  4HVB A;  5GXG B;  4DHJ B;  2C7M B;  1WM2 A;  1P3Q U;  2PJH A;  4ICU A;  4EKU A;  3EFC A;  1OQR A;  2JF5 A;  3C0R B;  5D6J B;  1SXT A;  3ZJT A;  3ZDM C;  4WWN A;  2JU6 X;  1Q0W B;  2BYV E;  4ZOH C;  4J6I A;  1ESF A;  4LLG M;  2WU2 B;  1SE3 A;  4IM2 A;  5GMV A;  1I35 A;  1GTE A;  1RWS A;  1KH0 A;  1TS3 A;  4W9I A;  1WXM A;  3L13 A;  1JRO A;  2SAK A;  2NS5 A;  2KTR B;  1ZXH A;  1S1Q B;  2ZPN A;  3DPD A;  1UEL A;  1U4A A;  2DZK A;  2RMM A;  2WGS A;  1KJT A;  1ZKH A;  2I2Y A;  2KDE B;  2MCN B;  2BWF A;  2VZK D;  1ROE A;  2K8H A;  3TUO A;  1FIQ A;  4B0E A;  3N30 A;  1E7U A;  1QOF A;  4OZA A;  4JGH B;  3R2I A;  4GIV A;  3GE8 C;  4W9L A;  1E8X A;  1E10 A;  5HI1 A;  1F2R I;  3AI5 A;  4IKG A;  3DWG C;  3RNF C;  4LK0 M;  3A4R A;  2BYT A;  3AH7 A;  1N60 A;  1QZE A;  1FCL A;  3AEG B;  3GB1 A;  3NZS A;  5J18 A;  5J2R A;  2MEK A;  1K50 A;  3DBL B;  3ZYY X;  3AB5 A;  2Y5C A;  3NVZ A;  4E74 A;  2PVO D;  5BMI A;  4ZRQ A;  2KLC A;  3IAS 1;  3MJW A;  1BML C;  4DWF A;  1PDX A;  1UBI A;  3EUB 2;  4DDI D;  2JWZ A;  4MEL A;  1H7W A;  4MM3 A;  3A9K B;  2KVZ A;  5C2T B;  2CHZ A;  3TIX A;  1H7X A;  1DYQ A;  1WJ4 A;  1KLU D;  3HIZ A;  4II2 B;  5FK9 C;  2AWT A;  2KQ4 X;  4K7W A;  4PS8 A;  3L16 A;  1TJE A;  1KOT A;  2PEA A;  3DBR B;  1T0S C;  1AAR A;  2WS3 B;  3RYT A;  5KHO A;  2XK5 A;  4TQ1 A;  2JRH A;  3X0W A;  4MJS A;  1P0R A;  1V6E A;  3M63 B;  2KFJ A;  1C4C A;  4OVU A;  2Z0E B;  2PIA A;  2LRW A;  2ZEQ A;  4NJ6 A;  5C1Z A;  4XZ4 A;  5AUK A;  3MC9 A;  3O13 A;  5JHB A;  2DYM A;  2G4S A;  1WGD A;  2J53 A;  3UIP B;  4ZYS A;  3B1L X;  4KKJ A;  1UD7 A;  2MRP A;  3MC8 A;  3B2F A;  1E6E B;  2FCM A;  2J52 A;  5TR5 A;  2WXN A;  1OEY A;  1SJH D;  2KC2 A;  1MFW A;  2ON8 A;  2ZZP B;  4CQN A;  3ZLZ A;  3NJT A;  2W82 A;  2KYW A;  2IBI B;  2K8B A;  1TKE A;  2KJR A;  2KTR A;  1SIJ A;  1NDD A;  1SB3 C;  2D3G A;  3P63 A;  3ZNH B;  1WR6 E;  2WQY B;  3P4P B;  4XE0 A;  2LI5 A;  2KDF B;  1FNV A;  4AJY B;  3VVW B;  2UU7 A;  2CJN A;  4FXC A;  3Q8F A;  4KZC A;  2BBC A;  3BIN A;  3DBH B;  4XX5 A;  1C78 A;  2SEB D;  3KWV A;  3VAW A;  4FJZ A;  4K7S A;  1I4H A;  2CS4 A;  3CF6 E;  1K51 A;  1GAQ B;  2WWZ A;  2BB6 A;  1WX9 A;  3E56 A;  2Z8L A;  3FAH A;  3APD A;  5AZG A;  2FNJ B;  2V3P A;  5IP4 D;  2YVC A;  2DAF A;  2BVC A;  4FAD A;  1IBX B;  2C7H A;  1N5X A;  3DVN U;  5LXI B;  2D10 A;  1NBF C;  3VRB B;  2XNA C;  2BPS A;  3TEY A;  4HDQ A;  4PT5 A;  1LO5 D;  1QOA A;  5H8Y E;  1FXT B;  4KZ0 A;  3A9K A;  3PZD A;  3U8Z A;  2DZI A;  1L4D B;  1F52 A;  2L32 A;  2PW9 A;  3VH3 B;  3TBL D;  2N0S B;  3ZKJ C;  4ANU A;  3VHT C;  3Q69 A;  4E3C A;  2G4D B;  1YN5 A;  3DBL I;  4EZJ A;  2QDF A;  3GS2 A;  2K39 A;  3QQ8 B;  5E6O A;  4EEW A;  2IO1 B;  1FEH A;  3ZQ4 A;  2HTH A;  3FIL B;  1G6J A;  3AE7 B;  2IGG A;  3IAM 1;  2IPK D;  1C76 A;  4K1R B;  4IG7 B;  3N1Y C;  2LGX A;  1HZ6 A;  5JZE B;  2GBK A;  3QA8 A;  1BUI C;  2OJW A;  3QHT A;  1BXT A;  4BFR A;  4WJQ A;  3UF8 A;  2KAJ A;  2K22 A;  1AW7 A;  3PHX B;  3CIR B;  1SE4 A;  4JLC A;  1WXV A;  1QT9 A;  2N1V A;  2WXF A;  1C79 A;  1L4Z B;  3AU4 A;  4MGZ E;  2X38 A;  2JX5 A;  5IKC M;  1KLV A;  3VUY A;  2OHF A;  3L10 B;  1EM7 A;  3ZTD A;  4MSQ B;  1TGZ B;  2NMQ A;  4TUU A;  3N1Z C;  2V0G A;  3ENE A;  4HEA 1;  1UBQ A;  3U52 E;  2MA9 B;  4BKT A;  4O1N A;  4X57 B;  3RN9 C;  1FXA A;  2WXL A;  3NVW A;  3I63 C;  2WDV B;  5D94 A;  4P7I A;  2TSS A;  3AEE B;  1V1P B;  3C8Y A;  2WXI A;  5IA7 A;  1J8C A;  4KDI C;  1JRP A;  1NEK B;  1WYW B;  1EO6 A;  2M17 A;  2AEH A;  3VRA B;  2RSU A;  1WE6 A;  1JWS D;  1XQQ A;  3I5J C;  1YN4 A;  5H92 C;  5AEK B;  3R7Q A;  2QIL A;  3DQV A;  2X8X X;  2MJE A;  2KWV B;  3ZW3 A;  4DDG D;  3TL5 A;  1DOX A;  2ICI A;  2BWE S;  1FD6 A;  2AL3 A;  2C7N B;  1WI0 A;  1H8C A;  3V3X A;  1OGW A;  1YD8 U;  1GJZ A;  2K1F A;  1I4P A;  4N9F 4;  1UGM A;  1OTR B;  2LZ6 A;  4NAM A;  4E71 A;  3ZVV A;  1TTN A;  1GTH A;  5DPR A;  2IY0 B;  1P7E A;  2KMM A;  2NPT B;  3GE3 C;  4JWU C;  1R4N I;  4REZ A;  2NTS A;  4YL8 A;  2W9N A;  4YTN B;  1VCB A;  3WAL A;  2L00 B;  2H88 B;  2Q5W D;  4BAX A;  2E6X A;  1MVK A;  2M19 A;  2K6Q A;  4US8 A;  2H89 B;  2OOB B;  1D3Z A;  2AL6 A;  3DHG C;  1TZ1 A;  4RM8 A;  1WGR A;  4XC2 A;  3FIL A;  2LRU A;  1E9M A;  2N7D A;  2LWP A;  1DOI A;  1JCK B;  4C7Y A;  3KVF B;  3LYY A;  4LTU A;  4J3O D;  4WJO A;  4JIO U;  2O2V A;  1DOY A;  4FN2 A;  2WXH A;  4AQ7 A;  3W5U B;  2Y5B B;  5E6P A;  3I9V 1;  4WAA A;  2LVO A;  4P1B C;  3TEX A;  2D5G A;  3DCG A;  3RUL A;  2KWU B;  4PS3 A;  1RAX A;  3Q8C A;  3MC0 B;  4HWI B;  4GN1 A;  3VH4 B;  2FID A;  3H9D A;  1JWB D;  3TSS A;  4KGR A;  3NUH B;  3PT2 B;  2K0P A;  4IW0 A;  2DYB A;  4WWP A;  5DCN A;  1V81 A;  2LGS A;  2ZW0 A;  4K7U A;  4W9F A;  1I4Q A;  1OFF A;  4GLS C;  3AEB B;  3AMZ A;  2BS4 B;  4NQL B;  4URK A;  3VR8 B;  3RZW C;  1N61 A;  2ASQ A;  2DNF A;  3BWU D;  3GP7 A;  4G50 A;  2QJL A;  1LM8 B;  2Y3A A;  3L17 A;  4G0N B;  2ZVO A;  1Z5S B;  4II3 B;  3R66 C;  4IWP A;  2DYO A;  3WAO A;  1IUE A;  4A6Q A;  2N1W A;  4JX1 C;  1WR1 A;  2O6V B;  1TKY A;  2L1A A;  3H7P B;  3Q2A C;  2M8S A;  3V61 A;  2LGD A;  4DXG A;  2EKE C;  1FRD A;  1ZDX A;  1XLQ A;  1PGA A;  4GSW A;  2BS2 B;  2L0T A;  1GUA B;  4ZRP A;  4FHK A;  3PLU A;  1F77 A;  1QQR A;  1QIL A;  3ZRF A;  3RT3 B;  3EFU A;  4KSK C;  1XT9 B;  2D07 B;  3AE2 B;  3P4R B;  1V8C A;  4K3B A;  3URY A;  5CHF A;  2CR5 A;  2R2O A;  2QMT A;  1HEZ E;  2N4F A;  2GBJ A;  4HKQ A;  1YOV B;  1PGX A;  4GOC A;  5KHQ A;  2QIE B;  2KX0 A;  4BVU C;  1WRI A;  2HE7 A;  4NQK E;  4US9 A;  1XXG A;  3PRZ A;  3LXF A;  1XCT L;  2FIF A;  3AUL A;  3RNB C;  2DEN B;  2V3S A;  1P7F A;  5D2M B;  4GU2 A;  3A1Q A;  2A5U A;  3VTW A;  5D3I B;  1OQQ A;  2C5L C;  2HTM E;  1I7H A;  4GDK B;  2OED A;  3V6C B;  4C56 C;  2BYE A;  4C7Z A;  1WJU A;  3PZ7 A;  1B1Z A;  5BYQ A;  3ZNG C;  1UH6 A;  3AEA B;  5IO9 A;  2CKH B;  4RGN A;  1R7S A;  2R2Q A;  2LAS A;  1V49 A;  4KV2 A;  1IGD A;  3C19 A;  2JWU A;  2IGH A;  1FNU A;  1OEY J;  3LDZ E;  1WF9 A;  5IOI A;  3HVD A;  3UIN B;  2K9X A;  5I4D A;  4S0R A;  4HPL B;  1LFD A;  3AEF B;  2LHD A;  4BBN C;  3D32 A;  4JL9 A;  4RF1 A;  2ZW1 A;  4PS7 A;  3QJZ A;  2WXJ A;  3RUI B;  1UGJ A;  3S2A A;  2KHW B;  2JRI B;  2LJ5 A;  2KWC A;  5D3D A;  4WQM A;  1GB1 A;  1CMX B;  4AWJ A;  1E90 A;  2K25 A;  3AE3 B;  1CZP A;  1M4V A;  1E7P B;  3Q3O C;  4I6N B;  3SDL C;  4HCN B;  3V62 A;  2C9W B;  2MW5 A;  3OLM D;  1V1O A;  3ONS A;  1YMH E;  1KF6 B;  2GBR A;  4LJO B;  2Y5P A;  4W9E A;  3KQ4 A;  2JXT A;  2G45 B;  3KLS X;  4M01 A;  1MI0 A;  4DBG A;  3SEB A;  2O6V D;  2O6V A;  1K8R B;  3AE1 B;  4KIK B;  4ZRI A;  2FUH B;  4GDL B;  4MAC A;  5HKH A;  3H7P A;  4RMA A;  1TY0 A;  4L2Y A;  2JUO A;  3T3O A;  3ZDT A;  3VUW A;  1L0V B;  4KGT A;  1HQR D;  1HXY D;  4M00 A;  1ZPS A;  5CHV C;  1JQ4 A;  2ZPY A;  3BYY B;  1V97 A;  4ANW A;  4MGY E;  2Z59 B;  2RDB C;  4WWM A;  4LDT B;  2JY6 A;  1PFD A;  3DDC B;  1I4R A;  2AX5 A;  1WXS A;  1JWU D;  2AQ2 B;  2IDY A;  4KX6 B;  3TMP B;  3SD5 A;  4CO7 A;  4XYC A;  1V5O A;  2KFK B;  2PE9 A;  4TSS A;  3UIO B;  4AJW A;  4DHJ D;  1IPG A;  1V86 A;  3VUX A;  1XLN A;  3N3K B;  1YQ4 B;  2M56 B;  5LXH A;  1AWD A;  2GLS A;  2QEJ C;  1SEB D;  2L0F A;  3AV8 A;  3BVG A;  3VDZ A;  5EDS A;  4NPN A;  2LUE A;  2V4I B;  3TEZ A;  4BKG A;  1GB4 A;  3NVY A;  4ACF A;  1WMH B;  4GDK A;  3WAM A;  4A3O A;  4BOZ B;  3A33 B;  3VTU A;  1TIF A;  4KSL C;  4EOY A;  1GPX A;  1TY2 A;  4BZA A;  3EC8 A;  4YSZ B;  2CHW A;  2RGF A;  2KDM A;  1VR9 A;  3L54 A;  1UWX A;  3CWI A;  2WXQ A;  3W5V B;  3L0W B;  1NVI D;  2HJ8 A;  2K3U A;  2J0K A;  3H8H A;  3OAW A;  1GNU A;  1XF5 L;  4EZL A;  4LNF A;  1FFU A;  4LNK A;  4FBJ B;  3BY4 B;  4IOI E;  1QF6 A;  3T9L A;  3A9J B;  1R4N B;  2DBY A;  2GBN A;  1CJE A;  2B3A A;  5E6J A;  4I6P A;  1P9D U;  4KVG B;  3M3J A;  1FRR A;  4OW0 A;  3WAP A;  2N9K A;  2W54 A;  4YT0 B;  2LXC A;  3Q3M C;  1TYG B;  3PGE A;  3KUD B;  4FUL A;  4KKI A;  4H2A A;  1SGH A;  1ZP0 B;  3RI7 C;  2BYF A;  3Q8B A;  3V05 A;  3AED B;  1MHH E;  2WX1 A;  1YQ3 B;  3V6E B;  3A4S C;  3PS6 A;  1UNS A;  2L83 A;  2VH2 A;  3OJ3 A;  4D2K A;  2ZNV C;  2EMT A;  4KIK A;  2AQ1 B;  2LHE A;  1EUV B;  5TSS A;  1MG4 A;  3OG5 A;  1EWC A;  3K9P B;  1A70 A;  1T0Q C;  3AE6 B;  4LDT D;  3Q14 C;  2LVP A;  2KQS A;  3HM6 X;  2ONQ A;  3SHQ A;  3ZUN A;  4ZHO A;  1RRB A;  2GB1 A;  4HK2 A;  2KK8 A;  3RMK C;  1XLO A;  3R7R A;  2KFK A;  3BYT B;  1ZXI A;  3NVV A;  3Q3J A;  3QX1 A;  4RGM A;  2GOW A;  5BYS A;  4WJN A;  4P16 A;  2NBU A;  1JAL A;  2LFI A;  4CYE A;  3ZNZ B;  3JVZ X;  2IO2 B;  1WXA A;  4Q2J A;  2INN E;  3CST A;  4ZYN A;  4YWG G;  2JZ3 B;  2BF8 B;  5BMH A;  1WMH A;  1WXQ A;  2VH1 A;  2W55 A;  1E0Z A;  1KLG D;  4JE3 B;  3DWM A;  2CU3 A;  1J7C A;  3OWE B;  2Z0D B;  3RPF C;  2ZNV B;  4TKN A;  4F1S A;  4BKS D;  4BKS A;  3CF4 A;  3HRD D;  4YTP B;  4MH0 E;  2PLP A;  2MHJ A;  5EE9 A;  2FUG 1;  3FKY A;  3KYC D;  1VDV A;  4WH4 A;  3ZRC A;  3MP9 A;  2IND C;  1VRA B;  2RDH A;  3Q3F A;  3IXS A;  4ICV A;  3NS8 A;  4IDI A;  5CHW A;  3ZJV A;  3NZ3 A;  3SFE B;  3VTV A;  2GRI A;  3ALB A;  4NJ7 A;  2M4N A;  3H6N A;  5G2N A;  2BGF A;  1IP9 A;  4OHJ A;  2W3R A;  2WXO A;  1IBX A;  4MH8 A;  4KGS A;  5T8I A;  2KC1 A;  3EGR A;  4C80 A;  4M8M A;  2JPH A;  1V9J A;  3V60 A;  2BW2 A;  3R8B A;  2JT4 B;  5CTR C;  1YX5 B;  3RNG C;  5JHA A;  1P98 A;  3MHS D;  1Q10 A;  4HPP A;  1FXI A;  2DAJ A;  3VR9 B;  2V1Y A;  2WXK A;  2NTT A;  5FR6 A;  1N62 A;  4ARI A;  5LLI A;  3U30 A;  1R4M I;  1XEE A;  5DPS A;  3PRP B;  1WGY A;  2D2Q A;  2MWS B;  2NVU I;  3N9Y C;  1RLF A;  4DXA B;  4PYZ A;  3ZJU A;  2LVQ A;  3R2T A;  1L0X B;  4ZHP A;  2I38 A;  1CK1 A;  4XDC A;  2FCQ A;  2ZVN A;  1A5R A;  2WDT B;  4HLE A;  5MPO A;  3T8M A;  3M62 B;  4I6L B;  3NZU A;  1XLP A;  2KMC A;  3ECI A;  4GB9 A;  2D3C A;  3UQA A;  3IVF A;  1KRH A;  1ET9 A;  5JH5 C;  1F1H A;  3H1U A;  2R61 A;  1E8W A;  5C3J B;  1F0Z A;  2D11 A;  1WFY A;  2NBV B;  4YSY B;  1YJJ A;  2DWQ A;  4A3P A;  3L08 A;  1MG8 A;  2D3A A;  3AN1 A;  3BVM A;  2JXX A;  2VZK B;  2XEW A;  4M8N A;  3GZN B;  1FNW A;  5EE3 A;  2RPV A;  1VLB A;  1RM6 C;  2IY1 B;  3MJ5 A;  3AE5 B;  1V1P A;  2I1K A;  3ML8 A;  3PZ8 A;  2QCZ A;  2B76 B;  3RFZ B;  1HZ5 A;  3CMM B;  1TS4 A;  4IC7 B;  2KAN A;  4RCO A;  1WX8 A;  1WGG A;  4WWO A;  3Q8A A;  2PKO A;  2K8C A;  2KWD A;  1UWM A;  4XGA B;  2HJ1 A;  2V3N A;  2PTL A;  1WH3 A;  4PK1 A;  1WSP A;  1SSN A;  1H4R A;  4EE2 A;  5D7G A;  2MBH A;  1L6U A;  2J42 A;  4NZL B;  1D5M C;  4MM3 B;  3LB8 C;  3TCA A;  3VXW A;  1S3S G;  2GI9 A;  4FJY A;  4GMV A;  1EF1 A;  2KQ7 A;  1QLB B;  3BII D;  2HD5 B;  1ZW7 A;  4YSX B;  3W1S C;  2NPT A;  2M1M A;  2EEL A;  5JXV A;  2YEP B;  4FJV B;  4RNA A;  1GC6 A;  2ZCC A;  4XWT A;  3ZXR A;  1PQS A;  4A9A A;  1WE7 A;  2N7J A;  3E9S A;  4GGQ A;  5L83 A;  2GBM A;  4RFB A;  2LGI A;  1EU4 A;  1I42 A;  1WJ6 A;  1B9R A;  1GOZ A;  3DOW A;  5BMG A;  4IM0 A;  4EUT A;  3K9O B;  1GT8 A;  3OJ4 B;  2DZM A;  1D6E C;  1PYW D;  2XBB C;  3QWZ B;  1KM7 A;  4LNN A;  3SFD B;  1BT0 A;  2PVG C;  2RD0 A;  3KUZ A;  4A20 A;  4N6E B;  1L6V A;  3KH0 A;  1L5P A;  2JYT A;  2BTE A;  4ARC A;  2KVR A;  2INC C;  2E3T A; 
#chains in the Genus database with same CATH homology
 4YSZ B;  2JSV X;  3NS1 A;  3U2S C;  3P4Q B;  2KDM A;  2WU5 B;  1VR9 A;  2OHF A;  3B9J A;  1EM7 A;  3I57 A;  1UWX A;  3CWI A;  2BS3 B;  1EWY C;  2WXQ A;  3AEC B;  2ACZ B;  3W5V B;  2NMQ A;  1WGK A;  1NVI D;  2LEK A;  2HDE A;  2V0G A;  1RFK A;  4HEA 1;  2K3U A;  3P42 A;  1N63 A;  4R3D A;  3H8H A;  3U52 E;  1XF5 L;  2JZP A;  4O1N A;  1NEN B;  1JWM D;  4P6V F;  1FXA A;  2WXL A;  3NVW A;  3W9C B;  2WDV B;  1FFU A;  2TSS A;  1IGC A;  4RGO S;  3AEE B;  4IOI E;  1V1P B;  1QF6 A;  1DGJ A;  3C8Y A;  2WXI A;  1TS2 A;  2DBY A;  1QKZ A;  4DQO C;  1JRP A;  1NEK B;  1CJE A;  3HUI A;  5E6J A;  1L0Y B;  3VRA B;  1SBB B;  5BYR A;  1JWS D;  1FRR A;  4OW0 A;  2N9K A;  2W54 A;  3ABV B;  1YN4 A;  2KAC A;  4YT0 B;  1C4A A;  5H92 C;  5HHD G;  1TYG B;  2QIL A;  3BK1 A;  1MHX A;  3IT6 B;  4OZB A;  5G5H A;  2MJE A;  1CQV A;  1WWT A;  2CJO A;  2LMC A;  4KKI A;  4H2A A;  4N59 A;  5FR3 A;  1ZP0 B;  1DOX A;  3BVZ A;  2ICI A;  1JWA D;  2N9L A;  3Q8B A;  3AE4 B;  3V05 A;  3AED B;  3BZD B;  1FD6 A;  1MHH E;  3IT4 B;  2KN4 A;  1SJE D;  3V3X A;  4TQ0 A;  1YQ3 B;  3L4P A;  1I4P A;  3MHZ A;  1UNS A;  1TS5 A;  2AQ3 B;  4NJC A;  2L83 A;  1UUP A;  4NAW B;  4NAM A;  4N58 A;  1QOB A;  4HRS A;  4D2K A;  1N5W A;  1GTH A;  1QOG A;  3Q8E A;  1P7E A;  4USA A;  3WCQ A;  2AQ1 B;  4B0M A;  2LHE A;  3B2G A;  2KMM A;  1ET6 A;  2RDG A;  4JWU C;  1YNT E;  1ZDV A;  5TSS A;  4REZ A;  2NTS A;  2WLB A;  1FO4 A;  4HJG E;  1EWC A;  4YTN B;  4YXD B;  1ACC A;  2G1E A;  1FCC C;  1A70 A;  2H88 B;  2XN9 C;  2Q5W D;  3AE6 B;  1T3Q A;  2E6X A;  4RF0 A;  2WDR B;  1MVK A;  2M19 A;  4US8 A;  2H89 B;  2LJI A;  4UDU C;  2ONQ A;  1I4G A;  5GXG B;  4ZHO A;  2WDQ B;  2GB1 A;  1XLO A;  4A55 A;  3FIL A;  3BYT B;  1E9M A;  4HKZ E;  1ZXI A;  3NVV A;  1Y56 A;  1DOI A;  1JCK B;  4C7Y A;  1OQR A;  1XCQ L;  1YN3 A;  2WNM A;  4RGM A;  5BYS A;  4P16 A;  1SXT A;  3ZJT A;  1JAL A;  2JU6 X;  2LFI A;  5LNK 1;  3AE9 B;  5G5G A;  1PUT A;  4Q2J A;  4ZOH C;  2INN E;  3PO0 A;  3LYY A;  4LTU A;  1JML A;  1ESF A;  4J3O D;  4LLG M;  2WU2 B;  1SE3 A;  4YWG G;  1DOY A;  4XDD A;  1GTE A;  1RWS A;  2WXH A;  1KH0 A;  1TS3 A;  3W5U B;  4AQ7 A;  5BMH A;  1WXQ A;  2W55 A;  3I9V 1;  1FFV A;  1JRO A;  1NYR A;  2SAK A;  3TEX A;  3U4E G;  1ZXH A;  2D5G A;  1E0Z A;  1KLG D;  2RMM A;  4JE3 B;  5HG2 A;  3DWM A;  2CU3 A;  1J7C A;  3OWE B;  2QSD A;  3RPF C;  2I2Y A;  3Q8C A;  1T5X D;  3MC0 B;  1T6B X;  2VZK D;  1ROE A;  3TUO A;  1FIQ A;  1I4X A;  4B0E A;  1NYQ A;  1JWB D;  3TEW A;  3CF4 A;  1QOF A;  3TSS A;  3HRD D;  3KWL A;  4KGR A;  3NUH B;  4OZA A;  3R2I A;  4YTP B;  2K0P A;  3W1S A;  2PLP A;  1E10 A;  5HI1 A;  1NI3 A;  4DXF A;  2K5P A;  2ZW0 A;  5EE9 A;  1EU3 A;  1F2R I;  1I4Q A;  1OFF A;  2FUG 1;  1VJK A;  4XWW A;  1VDV A;  4GLS C;  3AEB B;  4IKG A;  3DWG C;  2W3S A;  4WH4 A;  1STE A;  3AMZ A;  3MP9 A;  1VRA B;  4LK0 M;  4JPS A;  2BS4 B;  2BB5 A;  2RDH A;  3VR8 B;  3IXS A;  2BYT A;  3AH7 A;  1N61 A;  3GP7 A;  1N60 A;  1VZ7 A;  3BWU D;  1FCL A;  2QJL A;  4IDI A;  3AEG B;  4A90 A;  3ZJV A;  2Y3A A;  3GB1 A;  1J7B A;  2FBW B;  3SFE B;  3NZ3 A;  2GRI A;  3FC4 A;  2MEK A;  2WXR A;  1AYF A;  1K50 A;  1KTK A;  4L23 A;  3ZYY X;  3AB5 A;  2Y5C A;  3NVZ A;  4OHJ A;  2PVO D;  2W3R A;  5BMI A;  4ZRQ A;  2WXO A;  3IAS 1;  1YJI A;  4HRO A;  1IBX A;  1BML C;  3BK2 A;  2DYO A;  4MH8 A;  4KGS A;  1IUE A;  5EE1 A;  5T8I A;  4A6Q A;  1PDX A;  3EGR A;  4JX1 C;  3EUB 2;  3U7Z A;  4M0W A;  1TKY A;  1H7W A;  4C80 A;  1JW9 D;  2DLB A;  2L1A A;  4DXG A;  1SE2 A;  2BW2 A;  5C2T B;  2G9H D;  3R8B A;  1FRD A;  1ZDX A;  1XLQ A;  2INP E;  1H7X A;  1PGA A;  1Q10 A;  1DYQ A;  3ZGZ A;  1FXI A;  2BS2 B;  1KLU D;  4ZRP A;  3VR9 B;  2YEP F;  5FK9 C;  2KQ4 X;  2WXK A;  1F77 A;  1QQR A;  2NTT A;  1N62 A;  1XO3 A;  1QIL A;  1TJE A;  1SF0 A;  2WXP A;  4ARI A;  2WS3 B;  1XEE A;  3AE2 B;  3P1M A;  4TQ1 A;  3P4R B;  2J4X A;  1V8C A;  1TZO A;  3N9Y C;  3URY A;  2QMT A;  3W2D A;  1HEZ E;  4YTM B;  4HKQ A;  1MPE A;  1PGX A;  3ZJU A;  3R2T A;  2QIE B;  1L0X B;  1C4C A;  4ZHP A;  1WRI A;  4US9 A;  2PIA A;  1XXG A;  3LXF A;  1XCT L;  2I38 A;  3HVZ A;  5AUK A;  4MT5 A;  1CK1 A;  3O13 A;  1P7F A;  4XDC A;  3ETR A;  5EE0 A;  1C4P A;  5MPO A;  1ENF A;  5D3I B;  2DYM A;  1XLP A;  3AM9 A;  1C77 A;  1OQQ A;  2J53 A;  1PGB A;  4ZYS A;  2HTM E;  4KKJ A;  1KRH A;  1I7H A;  1ET9 A;  2OED A;  4GDK B;  2L52 A;  4C56 C;  4TMA B;  4C7Z A;  3PZ7 A;  1B1Z A;  5BYQ A;  3VQI A;  3B2F A;  2MJD A;  3AEA B;  1E6E B;  4RGN A;  1R7S A;  4OZC A;  2R61 A;  2J52 A;  5C3J B;  4RH6 A;  4L1B A;  2WXN A;  1F0Z A;  1SJH D;  4WAF A;  1TKG A;  2ON8 A;  1IGD A;  4CQN A;  3AE8 B;  3J9C A;  2JQR B;  2JWU A;  3SR6 A;  2IGH A;  1FNU A;  2W82 A;  4YSY B;  1YJJ A;  2IGD A;  2MJ3 A;  1TKE A;  2DWQ A;  3HVD A;  5I4D A;  2K9X A;  1SIJ A;  4WIP A;  1SB3 C;  3AN1 A;  3P63 A;  2WQY B;  3P4P B;  3BVM A;  4XE0 A;  2VZK B;  3AEF B;  1RYJ A;  2LHD A;  1J7A A;  1FNV A;  5AUI A;  1FMA D;  1FNW A;  5EE3 A;  2WP9 B;  2RPV A;  2CJN A;  4RF1 A;  1VLB A;  2ZW1 A;  4FXC A;  3Q8F A;  1RM6 C;  3MJ5 A;  2WXJ A;  3AE5 B;  2BBC A;  1UGJ A;  1V1P A;  4ITK A;  3PZ8 A;  2B76 B;  1C78 A;  4A8X C;  3RFZ B;  2E3T A;  2SEB D;  1D5X C;  3KWV A;  1HZ5 A;  5D3D A;  4WQM A;  1GB1 A;  3T3N A;  3AE3 B;  1TS4 A;  1I4H A;  1K51 A;  1KFY B;  1CZP A;  1M4V A;  1GAQ B;  2M0A A;  4RCO A;  1E7P B;  2BB6 A;  3E56 A;  2Z8L A;  3Q8A A;  1F2R C;  2JYE A;  1HA5 A;  3FAH A;  2PKO A;  2KWD A;  5HFY A;  1UWM A;  1AN8 A;  2V3N A;  2V3P A;  2PTL A;  1V1O A;  1IBX B;  1YMH E;  1KF6 B;  1N5X A;  2FE8 A;  2Y5P A;  1WSP A;  1SSN A;  3VRB B;  2XNA C;  4EE2 A;  5D7G A;  2WXG A;  1L6U A;  2J42 A;  4NZL B;  3KQ4 A;  2JXT A;  1D5M C;  3KLS X;  3EA6 A;  4MM3 B;  1C9F A;  1ZE3 D;  2WXM A;  3LB8 C;  1K53 A;  3TEY A;  4PT5 A;  1LO5 D;  1MI0 A;  1QOA A;  2GI9 A;  3SEB A;  5H8Y E;  4JWS C;  3AE1 B;  4GDL B;  4MAC A;  4OVZ A;  1TY0 A;  4L2Y A;  1QLB B;  3BII D;  2LUM A;  1D5Z C;  3T3O A;  4RGT A;  4YSX B;  1L0V B;  4KGT A;  1L4D B;  1HQR D;  1HXY D;  2L32 A;  1ZPS A;  1JQ4 A;  2PW9 A;  3BYY B;  2N0S B;  1V97 A;  2EEL A;  5JXV A;  2BT6 A;  2YEP B;  4WWM A;  3P4S B;  3Q69 A;  4RNA A;  1FM0 D;  2PMV A;  4XWT A;  1PFD A;  1YN5 A;  4A9A A;  1I4R A;  2AX5 A;  3GS2 A;  2N7J A;  3E9S A;  1JWU D;  2AQ2 B;  2IDY A;  4KX6 B;  5FKA C;  1FEH A;  3ZQ4 A;  4RFB A;  3FIL B;  4TSS A;  3AE7 B;  2LGI A;  2IGG A;  3IAM 1;  2IPK D;  1EU4 A;  1C76 A;  1XLN A;  1ZUD 2;  1B9R A;  1YQ4 B;  1GOZ A;  2M56 B;  1HZ6 A;  5BMG A;  1AWD A;  2EKI A;  4WUR A;  1BUI C;  2QEJ C;  1GT8 A;  1SEB D;  3AV8 A;  1D6E C;  1BXT A;  3BVG A;  1GPX A;  2IJ0 A;  1PYW D;  1ZOY B;  2K22 A;  2KAJ A;  1AW7 A;  2V4I B;  3TEZ A;  1GB4 A;  3CIR B;  3NVY A;  1SE4 A;  1WYG A;  3SFD B;  2PVG C;  1QT9 A;  1VZ8 A;  4N6E B;  1L6V A;  4AS1 A;  3UI3 A;  2WXF A;  1C79 A;  1L5P A;  2JYT A;  1L4Z B;  2BTE A;  4ARC A;  3NRZ A;  2X38 A;  1D4B A;  2JX5 A;  1K52 A;  2MH7 A;  3MFG A;  1VZ6 A;  1TY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...